1JDDA

Mutant (e219q) maltotetraose-forming exo-amylase cocrystallized with maltotetraose (crystal type 2)
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
418
structure length
418
Chain Sequence
DQAGKSPNAVRYHGGDEIILQGFHWNVVREAPNDWYNILRQQAATIAADGFSAIWMPVPWRDFSSWSDGSKSGGGEGYFWHDFNKNGRYGSDAQLRQAASALGGAGVKVLYDVVPNHMNRGYPDKEINLPAGQGFWRNDCADPGNYPNDCDDGDRFIGGDADLNTGHPQVYGMFRDEFTNLRSQYGAGGFRFDFVRGYAPERVNSWMTDSADNSFCVGQLWKGPSEYPNWDWRNTASWQQIIKDWSDRAKCPVFDFALKERMQNGSIADWKHGLNGNPDPRWREVAVTFVDNHDTGYSPGQNGGQHHWALQDGLIRQAYAYILTSPGTPVVYWDHMYDWGYGDFIRQLIQVRRAAGVRADSAISFHSGYSGLVATVSGSQQTLVVALNSDLGNPGQVASGSFSEAVNASNGQVRVWRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of a mutant maltotetraose-forming exo-amylase cocrystallized with maltopentaose.
pubmed doi rcsb
source organism Pseudomonas stutzeri
molecule tags Hydrolase
molecule keywords 1,4-ALPHA MALTOTETRAHYDROLASE
total genus 148
structure length 418
sequence length 418
ec nomenclature ec 3.2.1.60: Glucan 1,4-alpha-maltotetraohydrolase.
pdb deposition date 1997-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09081 DUF1921 Domain of unknown function (DUF1921)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1jddA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jddA01
2WWDA 4HMDA 2EQDA 3MUZ1 3WH9A 3VMNA 3BUIA 3U57A 2J8FA 4CD7A 5BYWA 1ITCA 1DWFM 2GJPA 3T2PA 3LXAA 4D72A 1E4NA 4M82A 3VM7A 4J28A 3CUFA 1D2KA 3DYOA 3BC9A 3JUGA 1H5VA 4JL2A 5E09A 3DYPA 3RDKA 5EB8A 1PX8A 5A8NA 2GK1A 1E0VA 3VX0A 1EIBA 1J18A 3OLIA 3L4XA 1HKKA 1O7DC 3BMWA 1XYFA 2UY3A 5C70A 3VIKA 2PWHA 3DX1A 1TQTA 1PZ2A 3AROA 4WKHA 3IGUA 1G1YA 1CLXA 1BFNA 5E1QA 1UWQA 3WNPA 3WQ5A 3VUPA 3A4WA 3WNNA 3N13A 2F7PA 1LWJA 3ZM8A 4UFLA 4RE3A 1OGSA 3W4RA 4AC1X 4HMEA 3K8MA 4FK9A 3LXBA 2W91A 4YN5A 4W85A 2VURA 3M07A 2OWCA 1CGVA 2DGAA 1QOXA 3ZSSA 1MYRA 2DH3A 1VRXA 4RE4A 1ODZA 4BQ5A 4TVDA 4OOUA 1V6XA 1V02A 2D23A 3SCQA 4V27A 4TUFA 1UWIA 1WDQA 1E0WA 4JFWA 1WB0A 3AHVA 6CGTA 4TTUA 1WE5A 1ZU8A 3HU7A 5I77A 1E6RA 4J7RA 1BYAA 4QDMA 1ZBVA 5I0DA 1W1PA 1H0IA 1KXQA 4MDOA 4KRTA 3RJYA 3VPLA 1EHNA 4XB3A 3FAWA 4K68A 2UY4A 2VRQA 1RP9A 1FFQA 4PMQA 3IJ8A 3FXYA 1WZLA 1E1EA 4PMZA 4D6GA 1EDTA 2XN2A 4MPKA 1NM9A 2XIIA 1E6PA 1W9VA 1B3WA 1UHVA 5CLTA 5BWFA 5GNYA 1X6NA 3MMWA 3N11A 3LRKA 3PZQA 2DDXA 2CBVA 3VDCA 4LX4A 4C7GA 4UFKA 1CLVA 4AEFA 1R87A 4BQ3A 4ATLA 1JXKA 2XIBA 3WUBA 2GJXA 1QWUA 2WCGA 2O92A 3BAJA 3ZT6A 1I1XA 7CGTA 2RGLA 3N15A 5JBEA 3EDJA 3BLKA 2XVGA 1GJWA 1MFUA 2WC4A 5AC4A 2YL6A 3ARUA 1JD7A 3CBWA 3GM8A 2O9RA 3T0BA 4S3JA 3O2LA 2JE8A 1XCWA 3CHCA 1G5AA 3KZSA 4MJ2A 3WQ6A 2BY1A 3ARYA 2OSWA 2AOSA 1CENA 3PZ9A 1V3MA 1EA9C 5GNZA 3MUIA 1KQZA 1QI2A 3EMCA 3IANA 2XM1A 3L4TA 1R47A 1AMYA 1R75A 5DO8A 2JIWA 4UZSA 1YHTA 1J01A 4P7RA 3UG3A 2E9LA 5EFDA 2WKGA 2OYKA 1QNQA 3SIMA 2FH8A 3BLPX 1BF2A 2IXVA 4EE9A 1WZMA 1MW3A 5JBFA 1KXTA 5DEZA 4W87A 3UR8A 4CN6A 2ZICA 2QPUA 3FY1A 5D8WA 1GPFA 5BXPA 1CGWA 3B9AA 1CXEA 1BPLB 3QOMA 4PMYA 4XV0A 1CYGA 4WSJA 1V6UA 3CZJA 1MQQA 2GDVA 4F9DA 4U5IA 1KCLA 4DWSC 4JFSA 3SCOA 6A3HA 1DWGM 1EO5A 1WZAA 3EJUA 1PZ3A 2ZXQA 2FHFA 3DX2A 1OD8A 2VO5A 1B31A 4WSKA 2YIHA 1OM0A 2Y2WA 5F7UA 3THDA 2CERA 2DQXA 3WNMA 4PMRA 3BAYA 4GI9A 4X9YA 4W93A 1NP0A 2DT1A 5FKYA 2BNJA 5M17A 1CBGA 5BCAA 1PEZA 2O9PA 4NXSA 2D24A 3W37A 1UR4A 3A3HA 3NDZA 1JFXA 1FH9A 3PZNA 4IM4A 2WCAA 3VD5A 3SUTA 1NOUA 4BCEA 1BVZA 1IZKA 2PI6A 4Y7EA 8A3HA 4JCMA 1LWHA 1WAWA 1CZ1A 2F1BA 4UFHA 1E4MM 3GNRA 2ZX5A 3BMVA 4MTVA 3TP4A 4AW7A 3LMYA 4CGTA 1W3LA 5C71A 3AFBA 4LYPA 2ZWYA 3VM5A 5HXMA 2WKLA 2J25A 3D4YA 1XD1A 4JKMA 1Q4NX 3LRLA 1V3JA 4NI3A 2YJQA 3I3DA 1JFHA 4LGXA 3OIHA 1W32A 1HIZA 3PHAA 1PPIA 2J75A 1QNPA 3WDIA 2X8RA 1WDRA 1C8XA 2XFFA 1KGUA 1UKOA 1UH2A 4MDPA 1K9FA 1UYQA 3AS3A 2WMKA 4GINA 3CUGA 2QHAA 1SR0A 4PCSA 4DUWA 3VMOA 1FH7A 3W29A 1XSJA 4FLSA 3UG4A 3BXWA 3L4WA 4HZ7A 3BSHA 1KWKA 4PTVA 4A3HA 4W5ZA 3ARZA 2WBGA 1KCKA 1MVYA 4AZIA 2EPLX 1VFUA 2VX5A 1CXHA 1EH9A 2E9BA 2OW7A 1UR0A 2DIEA 5TD4A 1GZJA 3RPMA 3CO4A 4MNJA 4NRRA 2VT0A 5I23A 3SCWA 4Z2GA 4JZ5A 2BVTA 4KMQA 3EDEA 3SCSA 3RMEA 3GNOA 1AVAA 3CMJA 4P8XA 3GXDA 4E2OA 4W7UA 2EPOA 3GH7A 2J7HA 3CHDA 4RL3A 2CBJA 3KWXA 5E0CA 4OUEA 2F1AA 3SCRA 2WANA 2VUYA 4BS0A 1NOFA 4UQCA 3ZIZA 2XG9A 1HTYA 1GQJA 2YA0A 4CVUA 3QHOA 3GXPA 3TTSA 3WUGA 3WF0A 2XGBA 2W61A 2CHNA 2YDRA 3PZOA 2C0HA 4J3SA 4MB3A 2GJXB 1M03A 4DUXA 3KE0A 7A3HA 5HNNA 4ZXLA 1BLIA 3VIMA 3KL3A 1GVYA 4AIOA 2VRJA 1UKQA 3VIFA 1BG9A 1JD9A 3SUSA 1K9EA 1J11A 4YHGA 3S2CA 3H53A 2WC3A 3WY2A 5CQ1A 1X1NA 1CDGA 1AQ0A 2CXGA 2WZEA 1QI4A 2D1ZA 1OGGA 1JXJA 2VQUA 2X09A 1E4LA 3AXHA 4C7DA 3AOFA 1TVPA 3UCQA 3WEZA 3OGRA 4QCEA 1CEOA 3GDBA 2X2YA 4GXPA 3LPOA 2JF6A 1H49A 4ZXOA 1H11A 3OZPA 4CU6A 3AIQA 2ZX9A 2UY5A 4GKLA 2WVSA 1Y7VA 3WDPP 2VNCA 3W6MA 5AYBA 4A3YA 1W1TA 5ABFB 4FNRA 1G9HA 1DWHM 4QLKA 1UD8A 1LG1A 1TQVA 2X2HA 3SCPA 3VIOA 3PZUA 1UR1A 5AC5A 3LXCA 3A4XA 3CGTA 5DT7A 1V3LA 1GQKA 4S3KA 4PUDA 1MWOA 4X0VA 1NARA 3SCVA 2OYMA 4AWEA 2V5DA 1K9DA 3MS8A 4PSPA 2EACA 5A2AA 3WY1A 4CN1A 1JDAA 4WK9A 2X0HA 5E6ZA 3VX1A 3EDDA 4CN4A 1J0KA 1GOWA 3N12A 5EFFA 1LG2A 3T2QA 3VDBA 1M53A 2ZOXA 3ZR6A 1JL8A 1CXKA 1KB3A 4UTFA 2WHKA 1LL4A 2F2HA 3U7BA 3D51A 3CZNA 1KTCA 1E56A 1E5NA 2GDUA 2IXUA 2WSKA 3AMLA 3UESA 1JZ2A 1EGZA 1KFWA 1H09A 3NUKA 3QOKA 1SMDA 2XUCA 1E40A 2A3HA 3AZTA 4QAWA 3VD3A 1JZ8A 3RM9A 3BSGA 1E73M 1PAMA 5CGTA 1HKJA 5BXRA 3TA9A 4TVUA 1TMQA 4FLRA 1E9LA 3WDRA 4W84A 2ZUVA 3CUJA 2FHBA 2WMJA 4UQDA 4HA1A 1GHRA 4UQBA 2X2IA 1E3ZA 5HBFA 5M5DA 1PJ9A 1F4AA 5FOOA 2GSJA 2BVYA 1JNDA 1JZ3A 1E1FA 2XYLA 1VENA 1J0HA 3UR7A 1R86A 4FNPA 1DWIM 1VBUA 2PC8A 4X0NA 3MI6A 1V3KA 1HJUA 3GXNA 1JDDA 1UR8A 1PBGA 1UD5A 4D6CA 4H04A 1Q6EA 1NP2A 3N9KA 2PWEA 2NW0A 1P6WA 2XWDA 3HN3A 5A8OA 2OWWA 1QVBA 1QPKA 2QLYA 4H8VA 1ESWA 2VI0A 5I79A 4JHZA 1EOMA 2GUYA 3K1DA 5LA1A 3W38A 4J27A 3MMDA 4U3CA 3L4VA 1JI2A 2EABA 1Q6FA 4HPGA 1HXKA 1XV8A 2WW5A 3RM8A 2CKSA 1HJSA 4P8VA 4D6FA 2CETA 3WQWA 1JG9A 1IZJA 2J7FA 3ZMRA 3DX3A 4W8LA 2MANA 3D50A 3DX4A 2QPSA 3K46A 4NZFA 4UZUA 1W1YA 4JKLA 2PBGA 1HL9A 1J0ZA 1JF5A 1DP0A 1SFSA 4WLCA 3AIVA 2WSPA 1VB9A 3ZO9A 1HT6A 2PF0A 3THCA 4J3XA 3LX9A 5CXPA 2UY2A 3LPFA 3FW6A 2EEXA 4ML4A 2VVNA 1JZ7A 3UERA 1L8NA 4F9JA 4ATWA 4W89A 4MADA 2VR5A 3QHNA 2DSKA 2VZUA 3AIRA 3WF3A 4AD1A 3QR3A 2FHCA 3M7SA 2FYVA 2BS9A 1C8QA 2BV9A 4H8HA 3VINA 3OZOA 1BHGA 5I6SA 3VSTA 1XRVA 2DH2A 2E3ZA 1UD4A 3KL0A 3S5ZA 4PYSA 1NWSA 1TQUA 2CKRA 3L4YA 4URIA 1TUXA 1QI3A 4Z2JA 3WEOA 4D6IA 3DX0A 3OLGA 3CZGA 2VVSA 1HP5A 1UA7A 1WPCA 3GXIA 1KBKA 1W3HA 3MV01 4ATDA 4AXNA 2C8NA 3VNZA 3GXTA 1LL6A 3O9NA 1HVXA 1OBAA 4PMDA 3MSGA 1NWUA 3AZSA 3D5HA 2F7QA 1QHZA 3U7VA 4LXFA 4F66A 1UR9A 1W91A 3CZSA 3F4VA 1GOIA 3AXXA 2TAAA 1E6NA 4BQ4A 2WVVB 1KGXA 1C8YA 2EBNA 1TG7A 4PMUA 4LPCA 1UKSA 4DO5A 2YFOA 4NXKA 1I1WA 1GOQA 5HPOA 3TTQA 2WLZA 1AQHA 1C7SA 3VNYA 1V0MA 2CYGA 3WD1A 3GH4A 1UASA 3HG5A 1TZ7A 2VZSA 2QV4A 2ZUMA 3OGSA 4CU7A 2XVLA 1CGXA 1OD0A 4HOWA 4JAWA 4FNTA 1B3ZA 1OWQA 5CPQA 1JF6A 1ECEA 2G3NA 2YLLA 3AQUA 1U2YA 1CPUA 3BVWA 1R85A 5D4YA 1QWNA 4M56A 4D6HA 1TQSA 1CGUA 4U3AA 1HJVA 1CWYA 2DT2A 3WFZA 4JIEA 4HOZA 2G4FA 7TAAA 1E4IA 1PIFA 1NOWA 1V02E 3TONA 2A3EA 3ZT5A 3PZMA 4CVWA 2J4GA 3SCUA 1XYZA 4W7VA 3TTYA 3FNDA 3DECA 3QHMA 3RILA 4KGLA 3RIKA 3ALFA 1QNOA 1K6AA 3UETA 4PEEA 2NT1A 3IK2A 1UWUA 2E40A 2O9TA 3MSDA 3ZOAA 1ISVA 3WKZA 4UOQA 1DWAM 3SCTA 2O9OA 3TV8A 2J79A 2BY0A 4CD5A 3BUDA 4Z2KA 4OIFA 1V0NA 3POCA 3B9EA 4BZYA 1DHKA 3EJQA 6TAAA 1ITXA 1W9DM 3WENA 1W9XA 3SURA 4C7FA 3KLKA 1HVQA 2J78A 5KZ6A 4TVCA 3VGGA 3WD3A 5CJ5A 4UR9A 1Q6GA 3G6LA 2X2JA 3WMCA 1JI1A 1NH6A 1AQMA 2WYSA 1OT2A 1HX0A 1GW1A 4P7LA 1MQRA 4M8UA 5AYIA 2PB1A 1E3XA 2IGTA 3CV5A 5I24A 4GPNA 4DO4A 3OGVA 1GOKA 3HMCA 1JYVA 1ZJAA 2OWXA 3WQ8A 4GO8A 5I3DA 1JGIA 3MMUA 2YA2A 5CLWA 1J0YA 3OB8A 3BUQA 3VSVA 2J74A 1UWSA 4AD0A 1R33A 2ZX8A 1H4PA 1U30A 3AHZA 1V6YA 3WL0A 5GNXA 4GI6A 4PSRA 2WMGA 4R5EA 5JBDA 4CCEA 1RD6A 1HJWA 1L0PA 3CPUA 4E8CA 2A3CA 2CBUA 3NCOA 4QLJA 3II1A 5A6BD 4OBRA 2B31A 3J7HA 5CG0A 3W27A 3AI0A 3RCNA 5FL1A 5A6BA 1E72M 1FHDA 3W28A 1MW2A 2QMJA 4D6JA 1LQ0A 4U2YA 1ISWA 4IISA 1ZB5A 3DDGA 4PMVA 2J77A 2XVKA 1US2A 4IPNB 4MJ4A 2CCRA 3I3BA 4ZE4A 2WVUA 3GXMA 2W5FA 4MNKA 3W6LA 3ARTA 3BLBA 2XN1A 2Y5EA 5A6LA 1TFVA 3BCFA 3N17A 2FH6A 5D9PA 1RP8A 4Z2LA 4FNSA 1A3HA 2Q8XA 4E4PA 3AIEA 5A2BA 4GZEA 4AD3A 3S6TA 3CH9A 4J3WA 3HJEA 3F5JA 1RPKA 2WZIA 3WH8A 3AS1A 3CLWA 3WIJA 2QF8A 3WL1A 3DDFA 2BFGA 2OLHA 4IPLA 1EQCA 1R34A 2D0GA 5EMYA 1E0XA 3WBEA 1VFMA 1O7AA 2IUZA 4AIUA 3VIPA 2PWDA 1BG4A 3ARQA 2YOCA 2XJ7A 2Z1KA 1KGWA 2ZUNA 5JUVA 2VRKA 1BYDA 3DYMA 3HZ3A 4AD2A 3ECQA 2YBTA 2JFEX 2AMGA 4PCTA 1ZL1A 4MB1A 3AHTA 4ZE5A 1TCMA 2ZUWA 2DSUA 2WMIB 3W53A 2NSXA 5FD0A 2WXDM 1VBRA 4Z2HA 1QHPA 1MQPA 3QGVA 4D1JA 1E5JA 2WPGA 3I3EA 3WDHA 1BAGA 1UD6A 5AY7A 3SEPA 1QW9A 3PTQA 3RO8A 3CUIA 4BQ2A 2JALA 2BHZA 1XHGA 3F5LA 4B3KA 3PN8A 4B3LA 3T0AA 5D9OA 3A24A 1H0GA 1UG6A 4ZENA 3L4UA 3WH5A 2XWEA 5A69A 1V3IA 2XFRA 5LA0A 3W26A 3IJ9A 1KWGA 4ZEPA 3BUBA 4OBSA 2DIJA 1PX3A 4AZ6A 1J0JA 1HJXA 4PMNA 2YKKA 4AZHA 3ZJ6A 2YDSA 1G01A 4EK7A 1BTCA 2ZE0A 3VD4A 3BAKA 1ZBKA 1R7OA 1C91A 4TX8A 3W25A 5CPSA 2XN0A 5D9MA 3A23A 4AZ5A 4FNQA 2HVMA 3CZ8A 3L2MA 4GZIA 2G41A 3OA5A 2D20A 1QW8A 4AD5A 5ABHA 3U5UA 1Q6CA 3VU2A 5D8ZA 2YBUA 4W86A 2YL9A 1XCXA 3AMDA 1QNSA 4OOZA 3ZSTA 2V3FA 3VSUA 4GZJA 4NSBA 3WMBA 3WELA 1UKPA 2VC9A 4P7NA 1IT0A 2BXZA 4TXEA 3H55A 4HPHA 2OW6A 4EAMA 3BAIA 5A6KA 3PBGA 1QHOA 1VF8A 2W67A 2WMHA 2JF7A 4J3VA 1UQYA 1V3HA 3EYPA 4AY1A 3VGDA 2CITA 3SCNA 4GI8A 3AIWA 4M24A 4L4OA 4CKQA 1TE1A 2D2OA 3VGEA 4AD4A 1E55A 5ABEA 3KLLA 2Y8KA 4U5KA 4GIAA 4LYQA 2BHUA 2BY3A 3POHA 3UEQA 1TQWA 1UR2A 1ZS2A 1W2PA 1QNRA 1WZKA 4WJXA 4MNLA 4HA4A 5D9NA 5IXEA 1DTUA 3GBEA 3VKKA 2J8GA 1H3GA 3E1F1 1HWWA 1OSEA 2EAEA 5BRPA 3WUEA 1FH8A 2OYLA 2J7EA 3D52A 1C7TA 2D0HA 1E71M 3SUUA 1J10A 4HZ8A 4EANA 2EPMX 5A8MA 2ZUUA 5A94A 3VDHA 1F4HA 4U33A 1KR0A 3BAXA 2GVYA 1WO2A 1UZ1A 1JAEA 1TR1A 4UQAA 4V2XA 2WZHA 1EXPA 5E9AA 4PTWA 2XM2A 2EXOA 3AIUA 3W81A 1B90A 1OIMA 1VJSA 1G0CA 3ZJKA 1UA3A 4W88A 1EQPA 1XH0A 2JIEA 3UG5A 3ARVA 4RE2A 1WDPA 4UCFA 2Z1SA 1XC6A 3WD0A 1C93A 2J62A 4WKAA 1A47A 5HPCA 3MV11 2X05A 1B30A 1QI5A 3H54A 1XD0A 4H8UA 4QCFA 4ACZA 3K8KA 1IV8A 1Q6DA 3WQ4A 3VMPA 2BXYA 8CGTA 4UOJA 2PWFA 2PBOA 3LPPA 1BYCA 5IHSA 5A6MA 1R8LA 4OGZA 3BVTA 3SUVA 5CGMA 1B3XA 5BXTA 3K4AA 4M80A 3VIGA 2QMKA 1JNEA 1UD2A 2C7FA 5FL0A 1ZBCA 1UUQA 1UD3A 3EJRA 3WF2A 1B3VA 1GHSA 2WWCA 4FLOA 2J7BA 2CHOA 4NZCA 1GVIA 4OKDA 3WQVA 4R27A 1QBBA 4CD6A 4CU8A 1JAKA 3L4ZA 2X1IA 1J9YA 4MB4A 2X0YA 1FA2A 2VZTA 3S5YA 3WNKA 2CESA 3M46A 5KEZA 4V28A 4P8UA 2FGLA 4HTYA 2CPUA 3AMKA 3A5VA 5LA2A 2J7GA 1W1VA 1C3FA 1HNYA 1OIFA 2V38A 2VZVA 3B9DA 2WHMA 2XSBA 2EPNA 3MUAA 2VQTA 2XFYA 1V03A 1MXDA 1V0LA 3T2OA 3CZKA 2W92A 4QP0A 2WVVA 3BGAA 5CSYA 3NJ3A 1QBAA 4PRWA 1H2JA 1ISZA 2EPKX 4KRUA 4Z2IA 5I2UA 1EO7A 1BGGA 1PX4A 3N18A 4NZJA 4W8BA 2D22A 3WH6A 1VJZA 3M6DA 5IFTA 5GQBA 1WDSA 3AMGA 1G94A 1QI0A 5GPRA 2D3LA 3ZT7A 5LYRA 3CMGA 2WMFA 1UQZA 5E0FA 4TOQA 4P7QA 3A22A 1ZJBA 3OLDA 4FLQA 3AHXA 5A3HA 3WN6A 2WNWA 1MW1A 4DUVA 2WBKA 1J12A 1BSIA 4FMVA 1Z32X 2V3GA 2VL4A 4D6EA 4B15A 4UQEA 1W9BM 5BXSA 1VFFA 4OZOA 2W4XA 3AJ7A 4JFTA 3ARWA 3WUFA 3WH7A 3HG4A 5JIWA 3VGFA 4XX6A 2F61A 4GO9A 1TA3B 2DEPA 1M7XA 1PIGA 1XH2A 1V6WA 3O6AA 3WFLA 1KBBA 3DHPA 1E15A 3BVVA 1UWRA 2F18A 3ZJ8A 1C90A 3ZQ9A 3VD9A 3AS0A 3K4DA 1M04A 3WBAA 1OINA 4AMCA 5CSUA 3VOCA 5A8PA 4CCCA 5M3WA 4JCLA 4JFUA 4PBGA 1KQYA 5C8BB 2V3DA 3BVXA 3EDKA 1W2VA 2EADA 1LJYA 2WK2A 4KGJA 3WDQA 4DWSB 1ISYA 2WB5A 1US3A 4ACYA 3GXFA 4UFJA 1GORA 1OB0A 3AIBA 1UZ4A 2DSZA 3ARPA 4Q7NA 2E4TA 5ECUA 3VILA 2W63A 2JEPA 4TX6A 2HISA 4JKKA 2WMIA 2WC7A 5ABFA 3AYRA 5IFPA 3APGA 4AZCB 2XVPA 1CXIA 4D1IA 3A6OA 3MO4A 4JHOA 1BGAA 3AS2A 1JZ6A 4LQ1A 4B16A 4PUEA 2XHYA 1SYTA 5A1AA 3VVGA 2YLAA 1RH9A 2FDMA 1GUVA 3AXIA 3LPGA 2ZX6A 4AZ7A 1UH3A 1MFVA 2XGIA 1JYXA 4XZWA 3NSXA 4UOZA 2VZOA 3SUWA 1HKIA 1TVNA 1NWTA 3CTTA 3VD7A 3EJTA 3K8LA 3MUY1 4AMWA 1E6XM 3PZGA 4WKFA 2WHJA 3A4AA 5BROA 3MU7A 3WMSA 1UH4A 4DO6A 1JDCA 4AYGA 3FAXA 4DWSD 5A95A 4U2ZA 1T0OA 1JYNA 4Q22A 2W62A 4N42A 2J7DA 3W0KA 2GK1B 2DT0A 4QLLA 1XSKA 3NSMA 4PTMA 1GJUA 2ZXAA 4AIEA 4DM2A 1W3KA 3CIVA 3PTKA 3ZR5A 4E8DA 1E6QM 4QFUA 2WCSA 4MNMA 4TTGA 1H1NA 1W3JA 3WY4A 1XSIA 2ZUTA 1GNXA 1VEOA 1YQ2A 5DT5A 4AYSA 3W82A 2WAGA 2BY2A 1SMAA 1WKYA 2YFNA 1D3CA 2WM0A 3RJXA 4L4PA 3KEHA 4ACZB 1UWTA 3OG2A 2VCBA 5FCZA 3VIJA 2D3NA 4HU0A 1KTBA 2VJXA 3PTMA 2Y24A 2VX7A 1PS3A 3CZLA 1GOOA 4GQQA 1LL7A 4KH2A 4D71A 3BUPA 4ZFMA 2E9MA 3GTNA 1OT1A 3WSUA 5E6YA 3W24A 1M01A 3MANA 1S46A 3D4ZA 1CXLA 2YA1A 1UOKA 1V0KA 3HG3A 3VO0A 3CC1A 3ARXA 4AZBA 3WEMA 5DFAA 3GH5A 4JL1A 4B9ZA 4LYRA 4B9YA 3VGBA 1EDGA 2NT0A 5M03A 1HXJA 4HA3A 1ZBWA 2OSYA 1NQ6A 3ALGA 4P8WA 2ZXDA 1CGYA 2RGMA 4HOXA 4N0RA 5A6SA 2BVDA 5IDIA 1JYWA 1HL8A 2XPKA 3NYDA 3N04A 2VR4A 4OJYA 3ZJ7A 3VGHA 3D3AA 2AAAA 4A4AA 5A8QA 2V5CA 4HZ6A 2XSAA 4AZCA 4NF7A 4M29A 1R7AA 2DT3A 3OLEA 4WIWA 5CZKA 3NSNA 2PWGA 1B3YA 1VEMA 1WP6A 1R46A 1EDQA 5ABGA 3GNPA 1BVNP 2FGZA 5HOSA 2Y8VA 2YDQA 3WY3A 4HMCA 4GQRA 3WD2A 2JEQA 4EKJA 1WNOA 3CHFA 2WVTA 1CIUA 1E6ZA 2WLYA 3FHQA 3EDFA 2G8ZA 2E8ZA 9CGTA 1VIWA 3L2LA 2VCAA 3AYSA 1BYBA 2VMFA 3LRMA 4AMXA 2A3BA 4W7WA 2ESCA 4D6DA 4UFIA 4NRSA 1HP4A 2VCCA 2DSWA 4BF7A 1W9UA 1FHLA 2ZX7A 3WF4A 1ODUA 2V3EA 3CUHA 4PMOA 1B1YA 5EBAA 4CCDA 1HF6A 4BA0A 3AICA 4W8AA 2F8QA 1B9ZA 1V6VA 1XH1A 1JIBA 1VEPA 3GBDA 4J3UA 3VIHA 1HN1A 3A21A 2VX4A 5A6JA 3CHEA 3VDAA 3KL5A 2CNCA 3VIIA 4JFVA 1DWJM 3B8SA 5FIPA 3T09A 4H2CA 1B0IA 5HDRA 3ARRA 4F79A 2E8YA 1N82A 3GZAA 2UWFA 1MW0A 1FP8A 1HJQA 3EBVA 4PMXA 3G6MA 3FHAA 5A2CA 1HKMA 2EO7A 2Y4SA 3BH4A 1OGBA 1OCQA 4HU8A 1BQCA 1FP9A 5I78A 2D0FA 4F8XA 5I5RA 1CTNA 3EJPA 1SZNA 1GQLA 3DC0A 1DEDA 3PZTA 1VFOA 1E6SM 5CPTA 3OBAA 1E70M 3MKKA 1MXGA 2ZIDA 1LF1A 4M1RA 1JZ5A 1ISXA 4U31A 4FNUA 1H41A 1K9TA 1TA3A 1FOBA 1GONA 1GCYA 2ZXBA 3U5YA 4HP5A 1KXHA 2W66A 3GYCA 4CD4A 4UNIA 3EJSA 1V08A 4NX0A 1WCGA 2J7CA 2XTKA 5A6AA 3CZEA 1LLOA 2VTFA 1EHAA 4J3TA 2WHLA 4AEEA 4WF7A 1U33A 2ZWZA 2YL8A 1VAHA 2EJ1A 5E70A 3VTRA 1D7FA 3AISA 2VOTA 3FN9A 3PZIA 2DPEA 4IUGA 2ALWA 2J47A 1JZ4A 3AMCA 3WD4A 4CUCA 4FF5A 3WF1A 3A47A 1B2YA 1CXFA 3NIYA 5DMYA 3EMQA 4M81A 3NDYA 3ARSA 3AHYA 1CECA 2F7OA 3EMZA 4MAVA 2OSXA 3TOPA 5DF0A 2A3AA 4W5UA 4UQ9A 3BCDA 1EOKA 2GJRA 2CIPA 1O6IA 1KXVA 3BAWA 4H7VA 4MB5A 1W9PA 3F5KA 1KR1A 2ZUSA 5BRQA 4AISA 3PZVA 1I75A 2D73A 3T0DA 4H41A 3IJ7A 1NWRA 1GOMA 2G3IA 4YPJA 1FFRA 5JIPA 4DWSA 4CD8A 2CBIA 3N1AA 4DM1A 2YL5A 4YHEA 4P7OA 4UFMA 4MAZA 2CEQA 3TTOA 3AZRA 3IAQA 2GFTA 3WNLA 2VX6A 3HG2A 3DHUA 5IHRA 1X6LA 4KWUA 1CGTA 1GQIA 2G3MA 3WDJA 1QX1A 4PN2A 4PTXA 1C92A 2BHYA 2F7RA 2G3JA 2DSVA 2XVNA 4XZBA 1XGZA 3WNOA 4AZGA 4XUYA 1J0IA 1UKTA 2FE0A 1CNVA 3BVUA 3T08A 1E43A 2E0PA 3RM4A 3IAPA
chains in the Genus database with same CATH superfamily
2FBOJ 1ODAA 4NKMA 3KGRA 1AQKH 2JF1A 1XB6A 2EQDA 5BZAA 2O6FA 4WY0A 2WAHA 4HJ1A 5EY5A 5IM51 1LBFA 1BRLA 3SQMA 4EX4A 1U36A 3RKDD 1Q85A 5SWSE 3NQVA 1GIGH 1KXVC 3UPWA 5BYWA 2CCLA 2X4QB 3NAVA 5H8PA 1JGDB 1DUYA 1WEJL 4WI7A 3T2PA 3WLWC 3D33A 4A2EA 2AAVA 1HCZA 4D72A 1E4NA 3G6JA 4DKFL 5I1CL 3LHPH 1MCHA 4M1BA 2VMDA 5JIMA 1NEPA 2AQ1A 2BIQA 3DYOA 3QUYD 4ES4A 2ZUQC 4WI0B 4ACPA 1KLUB 3TO2B 4Q4RA 5G1MA 2Z8VC 3OKEA 4NENB 3SDDC 5HSFA 2Y63A 3WG6A 1T3FB 5EB8A 3D3VB 3SO7A 1RJCA 1JWMA 4IYKA 4PRIE 2ZVRA 1ZLDA 2AQ2A 2HX8A 3DX8B 4PRIB 4IT1A 3QYCA 3SE6A 4IJCA 5FA5A 1DJSA 1M2VB 3VX0A 3OLIA 3L4XA 4HPOH 1HKKA 4F8QA 3IRCA 1YMYA 2V5LA 2BMKB 1DANU 1PIIA 4NUJA 3UABA 1FNLA 4K7YA 4PI2A 5C70A 4AL8L 2IXQA 4G6KL 1HQRB 1NEUA 3ZJAA 1QAWA 3EYVB 4PJXE 2WP3T 3PQYE 4Q33A 1HZHH 1LP9B 1ZXQA 2LGNA 2OL3B 3ECBB 3IGUA 2FQDA 3MXVL 3RJOA 4NQDE 5EN2B 1A4LA 3FTYA 2IQ0A 4KERA 2XPYA 2P1YA 1WIOA 2Y2TA 1YJDH 2JKSA 3B8WA 3C6SA 4UIKL 4M5ZL 1DL3A 2CIIB 3LCIA 4JN2A 3UZZA 1A3WA 4GG8A 2GGEA 5FHAL 3WNPA 3MNVB 2FFCA 2J1WA 4MTMA 3DOIA 4XB8A 3LVEA 3CSPA 4JQVC 4K3HA 4WY7L 4K2UL 1GVEA 1J1XL 4XH2A 2Z4QB 4EAYA 3GDMA 2RAGA 2O93L 4CC1A 3HFYA 3ZM8A 3APFA 3P7YA 3C6LA 4AQOA 5B80A 1Z9MA 2PLTA 4YAQA 4ENZA 4HSOA 1RSFA 5EZJA 3LBMA 3QH2A 4UNVA 1YNTA 5D1ZA 5CAHA 4L6DA 2G9HA 1FX6A 3TFXA 2VERN 3TH4T 4OSUL 3G77A 5KW9L 2W91A 3LXBA 4WR3A 3I6GA 3PAOA 4H00A 2GEEA 3T9PA 2DKUA 1EV2E 4PJEA 3U9PL 1HIMH 5IQLA 1YBQB 1UC6A 2EXWD 3BKJL 4PBWD 5AZEH 2DGAA 3CYVA 4M4RB 2DV6A 4Z7NE 4C91A 2XV0A 4S11A 1SFDA 4NHCL 3VVVA 3WGVB 3DZ1A 5FLUA 3S5OA 2DH3A 1SHMA 4WK2B 4Z1BA 2QQQA 2B0MA 2YSTA 4NKOA 2KQNA 4NQEA 3MLWL 1CE6B 3FB5A 4MWAB 1LOQA 2Q5BA 2OEMA 1U0QA 3SCQA 4QG9A 1E9ZB 5E2TH 5T3ZE 3UBXI 5E8NA 3LCGA 3P2VA 5I1EH 3AAMA 3RR1A 3T0WA 1XQLA 3ZJKA 5I09A 1NSNH 3JZYA 4YVNA 3HU7A 3MODH 3QV6A 4GVFA 5I77A 3EGDA 1P7BA 5BW7A 4I6KA 1FUNA 1MI5D 3IMVA 3HBGA 2X30A 4JY5H 5GZOC 4YNYA 3GMNA 4LHUB 5F2FA 4C6EA 4GW5B 1QDSA 4GXMA 4S10A 3PAJA 3AZUA 2J8UA 4LQFL 1N59B 3RGBA 5FJOA 2QEJA 1W1PA 3N9GL 4JFEE 3W9EB 5L7XL 1D5ZB 1KXQA 3MRGA 5E08L 1OHQA 3ABKB 2WAQA 5BRZD 4L9ZA 2NX5E 2AL2A 3RJYA 4AHOA 2PXYB 3BDYL 2C9UA 4NB7A 2HFGL 5SX4I 2OBGA 3NGBB 2B1OA 1NAMB 4N0CC 1HOEA 4HS6A 1SYVB 4LPWA 2EO1A 4HVBA 1EF3A 1X38A 4DZHA 3IJ8A 1SXSA 1FAIL 2E7MA 2R56L 2WZPA 3FXYA 1WZLA 4MHHG 3N6JA 3D87B 4O14A 3BGFB 1KC7A 4JG1L 4YNYB 3F05A 1E9PB 3U7WH 1W5MA 2J9ZA 3QSRA 3RY5A 1C5DA 4HUUA 4OJCA 4U7KA 1FCBA 1KJVB 1TITA 2XN2A 4S1RH 1HQ4B 3C08L 3B34A 3HE7C 1NFDF 3A4EA 3MRJA 4IRJD 4M02A 4YHKH 4ZPTA 5K1VA 1PGRB 1E6PA 1TJHL 1TV3A 3GLDA 4JW3A 3SYCA 4GRSA 5CLTA 1UW9A 5EA9A 3JV0A 5A6TC 4NDMA 2EILB 2H5UA 3AY4A 4Q52A 1CCZA 4HUKB 4LPXA 4MJIB 3ZW3A 3B56A 2AXJA 3O2DA 1Z0MA 3IGAB 4X80L 4ZMAT 5A16A 4OQTA 2PWUA 4OM0L 4K1WA 3PPFA 3CV2A 2VDLL 3ABLB 3MCKA 5CJBA 4NAQA 4LLWA 2V8MA 2PODA 3B4NA 25C8H 4L9YA 4M6UA 4XO7A 3EOLA 5DRCA 3D18B 4K8GA 4BQ3A 5FYLH 3I7SA 3D07A 4EUPG 1BVKA 4AJWA 3KHJA 3D3VE 3ARDD 2NUTB 1MJJA 3QIWA 4LS0A 4HHAA 1W8NA 4YGVA 4XWGH 1NPUA 1G4RA 3G6AB 5JYLA 3PB2A 1GSMA 1NGQL 4HN8A 2XIBA 3BAEL 3FQTA 3STZA 2I16A 3OVUB 1QWUA 1HH9A 2VXUL 2WCGA 1PCKA 3ANUA 4PRNB 1AQKL 4GP4B 1FWEC 2PPAA 2Y1YA 4RWYH 2ICEC 5KBMA 1FVDA 2CZEA 1ET5A 2TODA 2OXGA 3D05A 1TWSA 3NJGA 1A5UA 1FHVA 1OAZL 3EJYC 1GIGL 3EDJA 2I9UA 2V7HB 3EO0A 4XC3H 3KR3H 4EF3A 4XC1L 1HQRA 5K59E 3A64A 3EGJA 3LHZA 1SVDA 5A3IC 2XVGA 4U4BA 4F7TB 1EHLL 3QXWA 3AJXA 4XO3A 2KQMA 4AC4A 4QRTA 2QHLA 2X4UA 1U92B 5DJ2A 3UTZB 1JD7A 3EKGA 2OMXB 2ICES 3X13B 1F3EA 1ME9A 2QCLA 4K8HA 1A7QH 2H6PB 3PAZA 4LCWD 3RY6A 5DI8B 3T0BA 5CBAB 3NZ8B 4QF1A 5EOTB 3U4FA 3T77B 2NQ9A 4PJDE 3JT0A 1G5AA 4KTYA 5IB3B 5LLIC 4R8WL 1ONWA 5JXED 3WQ6A 1CICD 2DQJH 1WTLA 2CKBL 2BP8A 4HSCX 3PHQB 3JV6B 3B9OA 3KBMA 4JDEB 2WIMA 5HYSG 4HN4A 3CVIL 3IJQA 4E5XB 1V3MA 1EA9C 3NRFA 2JJVA 5DJ6A 2YBRA 4KFNA 5GNZA 1KQZA 4G82A 2GBUA 1NBZB 1A7OL 3D3VA 1SZRA 1R47A 4AYID 1AMYA 4YLCA 5CF3A 2CXEA 2P76A 5A7BA 2VWSA 1T1ZB 4G7QB 5DO8A 2R1XB 1ND0A 2C19A 3E9UA 4XD5A 1P2CB 1PZAA 3BEVB 5GHWL 1E1CA 5DEGB 2QPDB 5FO8B 1YJDL 3BJLA 5L6YL 5E4IA 4KWOA 2F19L 3V1HA 4UTAH 2E9LA 5I03A 2QV5A 2E25A 2X4NB 1QFEA 2QJDA 1OW0C 1BEYH 1BAWA 4O28A 4U1JA 3V0VB 3B2XA 1NGWB 1MCNA 3BLPX 2W5PA 3D39B 3HS0C 3B0VC 4YZWA 1G9NC 3MLSH 3B9KA 3NJFA 1QSEB 5JBFA 3KPPB 4F7PB 1OM3L 4O8RA 4FRWA 4W87A 3G1RA 3E2SA 4OJDH 5TK2A 3MCG1 5HHNB 2Q86B 3STLA 2IANA 3EW3B 3H22A 4BY3A 1DIOA 5I76B 3S83A 4CJ0A 1JK8B 3FY1A 1E8XA 4P4KA 4YSEA 4AUJA 5BXPA 4MCMA 4XVJH 1VLIA 2HSIA 1MCQA 4OZHB 1BPLB 5CKSA 3QMSA 5PAZA 3SE3A 2R7EA 2IWGA 4OCWH 3HIZA 3BKJH 5AZEL 3C60D 5BUGA 1MQQA 1FBIL 2GDVA 1DSFL 3BIKB 3KLSA 5I00A 3KWWB 1B0GB 3PWPD 3PXLA 1NUFA 5F7AA 3ZL1A 2C9VA 4JFZL 3CMOH 3W75A 4H8WH 3MV8A 2VGLM 3MC0A 1FCUA 1OYBA 3W39A 2EJAA 1XR8A 1I2RA 3EJUA 3LEVL 2CHWA 3WUWA 1PZ3A 2KZBA 2G3ZA 2A3TA 3HGSA 2EKCA 4IU2B 3VI4F 3DX2A 1ZA6A 5HQMA 1USZA 3BLIA 2VL5B 1OFRA 5BXFB 2DZTA 3EOYG 1S7XB 1SDDA 3KVQA 2C4FU 1O94A 3KVKA 4LC6A 4UM9B 2DQXA 1XH3A 1YEJL 3BAYA 4AZ8B 1G7HB 1XQ4A 3H2QA 1QZ1A 2HUEA 5B8CA 3ZLGA 3T1WA 3LZRA 4W9KC 5TF1L 4KUZH 3G5XB 4UDTB 2GQ9A 3STEA 4X9YA 2YZ1A 4GOSA 1R6VA 3I4KA 4HULB 1UT1A 5F3BA 2QPXA 5M17A 3ZLFA 4HV8B 4ZB2A 4MJJA 1S2AA 1DUZB 2LE9A 3N9GH 5J0BA 3LERA 5KBKA 4L1GA 5B7YA 2UUDK 4MCYB 4LEXL 1UZ8B 2D24A 5GS3A 4LAUA 4HHGA 2CO6A 3PWLB 1KFLA 2HFGH 3RNKB 3NDZA 1FH9A 2OK0L 3W3BA 3C5ZA 4AGPA 1BIHA 4IGBC 4BCEA 5EU4A 1H15A 1QU4A 1T2XA 1WUEA 4WEBL 4PJAE 1QRNE 4PJEE 4DPQA 1XMWA 1CF8L 2FB4L 4H8QA 1EGJA 3UWVA 4HXBH 2OTWB 1JTOA 1IQWH 3TP4A 4IKLA 3OF6D 3LMYA 1VBHA 4CGTA 5C71A 2OXGB 4HIEA 5AENA 4JTRA 4LYPA 5REQA 1PKQE 5JQ6H 4NCC2 3NG5A 1XD1A 2CK0H 4X6FB 5IB1B 2ORBH 3LRLA 1LJMA 5D2XA 2YJQA 4PJEF 4KKXA 4GKSB 1HSBB 2EG7A 4K8RD 5AAWC 2RH0A 2DWXA 5HYFA 1JFHA 4G7EA 4LGXA 4MFDA 4JIHA 2VC6A 1W32A 4RCXA 1YG9A 1BM3H 3EA2A 2J75A 2A85A 1QNPA 3BG5A 1UVQB 2BRRL 4HF5L 4PRBB 2BNRD 4NN7B 1LEIB 2EC9T 3L5AA 3CWHA 3MN8A 1J5OL 1T20A 3P4MA 4L29A 3FA5A 1M7PA 3IJEB 2XPGB 4ALAH 5HUOA 2B15A 2P45B 3L7EA 1QTPA 3NZSA 3OHXB 4P9HC 4LCSA 5FF0A 2OKTA 3MR9A 4JICA 1TPXB 5G2IA 4GINA 3AXLB 4IIFA 1S7TB 2ZOLA 3R25A 1R3LB 4QAMB 3QJUB 2AK1H 1EEZB 1QSFE 4R2GC 2L04A 4ZCWA 3HG1B 4AV5A 3LIZL 4PCSA 2JJSC 2WNGA 2B7DT 3O2VH 4I3SH 4LVFA 5D1ZD 3VI4B 4I0PC 3L3HA 2CJUH 3AB0C 3D08A 1FH7A 3NCXA 3W29A 1NFDB 5KTEL 2N7SA 2DZWA 3BXWA 4ODXB 4TUOB 3T8QA 1IGIL 4XX1G 3NQAA 4IMEA 1KWKA 3MYJA 3W23A 1PY9A 5D8JL 5IB5A 1CYXA 2W1NA 3KBHE 5LKNA 2JKLA 4EIVA 1VFUA 1OCCB 1YZZA 1ZALA 3SKJH 1IJ9A 5E2UL 2PLMA 4C6OA 1CIDA 2E9BA 2DM7A 3HAEH 4M61B 4WV1C 3LZNA 2AI0H 4PJIE 3OR6A 4OCXH 4UTWC 4N20A 5TD4A 4HETA 3RPMA 5F2LA 3R79A 4H19A 4CW1B 1ETJA 2VT0A 2NY4C 4BZ2L 4UB9A 2JCWA 4HNVA 2Y0SA 4X5WB 2QDGA 3R8RA 4JY4A 5LXEA 3UBGA 2HA1A 3Q4DA 1OCJA 4MG4A 2QAFA 4C60A 2NQ3A 4X6CE 2FJFB 2FL5B 3RMEA 3KM1A 4AEHL 2IKHA 1G6CA 1FP5A 2BOBA 3DX9A 4PRHB 4QHPA 3LV3B 3MCYA 2EO9A 4K7PY 3CUPB 2A77H 5E6IC 3QUXC 4ZUWA 4B0MB 1KM2A 2PC4A 4APXB 3KTSA 3GXDA 4W7UA 3W7MA 5E6IB 2FUQA 2P49B 2XZAL 2QXWA 3GH7A 3MUUA 2GG1A 2JJTA 2WP3O 3H7LA 3IVUA 1PSKH 3RGTA 2CBJA 2BSSB 1LE9B 2JGQA 2F1AA 1UP3A 1FYTD 1IGFL 1XF1A 4XN7A 5DJCA 1KIQB 4UV4L 5J04A 5FSEC 2HP4A 4DKEL 4BS0A 4YAQB 3S35L 2CU0A 1N0LB 2BP5M 4H0LC 5L88L 3MUJA 2JWYA 5D7LD 1ME8A 4ZOBA 2W0UA 4LB3A 5HHMD 4LGRB 5IJBC 2W9EH 3FN3A 3TTSA 1G4EA 1U3HD 3S3SA 2O56A 2XGBA 3RA7H 4L8CA 2PEVA 4ML9A 5E03A 4DVBB 5C0CD 5MHSE 1W5NA 1A4BA 4M6NH 2OMYA 5EOCL 1UWYA 4OCWL 3DJSA 3EX4A 2DIKA 1W72H 3MW7A 1XW8A 2GJXB 3LHUA 4PBFA 3L3IB 2Q2LA 3G5EA 1KPRB 3IFLL 4XE5B 4LCIH 4R33A 2VISB 4XZLX 4ZXLA 5BZDA 3KL3A 1AP2B 1EMTL 4JN1H 1L0QA 4KY1L 1MO0A 1UKQA 2CK2A 1TSRA 1RLWA 2CBMA 3A67H 4NAEB 4YHGA 1QOQA 3QG6A 3B4YA 2Q7YB 1W6WA 1EXHA 3D0LA 2QF7A 3HE7B 4NQUA 4FTVE 1WK0A 5F88A 1X1NA 2X41A 1CDGA 1GYLA 3ZVHA 1AQ0A 2VDRB 1QI4A 3G3MA 4W9DC 2D1ZA 2P5WD 2P5EA 1PTDA 1AD9A 3N1QC 1NBVH 3LZQA 3FTWA 1YN6A 2GSIB 4U0QB 3ZE2F 1QQDA 3WEZA 3EOAA 3OGRA 3N06B 4QCEA 4KKQA 4F1SA 5BMFL 4NYLA 1KTJA 3QUHA 5ABZA 4RK8A 2AEIT 4GXPA 3MRJB 5JDJA 3VCCA 1AZZC 4ZXOA 5C0BB 4ZFGL 4KTEH 2EIEA 4U1HA 1H11A 3IRDA 1RCYA 3FRPA 4XNQA 3RUBL 1JV2A 1CK0L 3L21A 4Q9QH 3R2GA 1BMZA 3V0WL 4HGXA 2DZPA 3QDGB 1NLBL 3HR5A 3JWNE 3ARFB 3USBA 5D1ZI 3HMJG 2M26A 5LQBL 2ZNWA 4A3YA 2FWUA 2KYIA 4YDMA 1F8TL 4O12A 4NQSA 4D0BA 2CKBB 1DJXA 1GY1A 1TJGH 3MRLA 4MMWA 1TQVA 3QEQE 3S8WA 4F2BA 1KYOK 2GC4C 2MWCA 2VW6A 2QYGA 4LHUG 5AC5A 4ODWB 1XLHA 1OAYL 3JTTB 1R3KA 2FIKA 2VZ1A 2ZD0A 3OAZK 5LN8A 4NM4H 3BPNB 5DT7A 1GQKA 2TMDA 1RSCA 3ARBD 3QG7L 1IC7H 1NCAH 2H26B 3IT8D 2ISWA 3MBEC 4YWGH 1E5UI 2EICA 4LLVB 1G1CA 1AO7D 3CAVA 1N6VA 2L7QA 4PUDA 4H9VA 1ZLUK 1TPB1 2YHGA 1MWOA 4ZSTA 2PDCA 1T21A 3I68A 4NRZB 4ODUB 2PZNA 3SCVA 3MS8A 3V0SA 3MHGA 2EACA 1HOCB 5A2AA 1FFOB 3FJ6A 1NDGA 3LCYA 3NQ7A 5IUCA 4O16A 1XDLA 3EZJB 2P48B 4R9HA 4NM8L 4Z7UF 2GJZA 3H8NA 5C0IA 3BZEA 3EDDA 4LSBA 1GTHA 2YCEA 4Q89A 1QTWA 3GSNL 5KYUA 5EFFA 1NF7A 3KGUA 3MRRB 3VDBA 2GHWB 3F62A 4O2FA 3ZR6A 4PEKA 1KJMB 3LH9A 5K3VA 1NGYA 2W0PA 3RYSA 4Z7OF 4R6UA 4WTZA 1KB3A 1N7ML 2IDCA 3LQAH 1KO0A 1OQXA 2WHKA 3DGBA 5DZJA 1TJXA 2F2HA 1BD2D 4JREB 3GX9A 4CMMB 3WQEA 4MYWB 3SQLA 3RF9A 1OTSD 2P8CA 3N0PB 2XTJE 2FJGB 3DURB 1OF0A 2FL5A 1QSFA 1MH5B 1E56A 4BCZA 4F9LA 2AHIA 4CW1A 4KY2A 4G8AC 1XCTA 5EH1A 4C56B 5C86A 3AMLA 2IVFC 3U2JA 1JZ2A 1IX2A 1GZHA 3IJLA 2N4IA 4PBEA 3F1QA 5JXQA 1IGIH 4Q6YA 3V6OA 1BVLB 3U2CA 2NV1A 1SMDA 1VCAA 4MZ1A 2OJEB 4R9OA 4K7PL 4TQEH 4QAWA 3OJDA 1JZ8A 4X6DF 4NO5B 2ON3A 3QV7A 3ETBF 5TDNA 4EP8C 2VUNA 1UM5L 1N6UA 2Z91A 1H63A 1E73M 4XOCA 3R94A 5E2UH 1IL1A 3LH8A 4Y9FA 3BJ91 5HUPA 5ISZB 4Y9OA 2AI0L 1AO7B 3E6HB 2A79A 3IDGB 4YQXL 2R1NA 2XH7A 1MZRA 4NNCA 3MJ7A 3PFMA 3WLMA 3LY6A 4P2QB 4ZQOA 1DJZA 4L2LA 3QIWC 4Z95H 1RJLA 4UQDA 1V7AA 4JPVH 4POUB 5EPMB 4HA1A 4YWIA 3TA3A 4A2RA 3P3YA 2HB0A 4UQBA 1PEWA 4Z7WE 2FX9H 5CUSH 1H1YA 4HHHA 4MWAA 2A6DB 2WSRA 1BGXL 1DVXA 3N2OA 4DJEA 3HLAA 2BG5A 3UCCA 2RFGA 4BXSV 2CRMA 1TX2A 1F4AA 2KUTA 3ZRFC 5FOOA 2A9DA 2H1LM 4POZD 5ALBH 4ABUA 3GSOB 5CD3A 5L9DL 3NSDA 1NFBA 2W9MA 3KCOA 4DBEA 4JO2H 3PDGA 4JFFB 5BO1L 1VENA 4RDQG 3L95A 3RVTC 1YYML 3N1FC 3T6VA 3BQ6A 4X4MA 4WXZA 3P2DA 3SE8L 4H9MA 4HXAL 3TEVA 1GAFH 2UYLA 4X0NA 1PSKL 3B9VA 3MI6A 4XOEA 5AW9B 5B7EA 4LS1A 2YD2A 2J4WH 3MI3A 2QCGA 4POCA 5IVZB 2XN9E 3ZE1F 1VD6A 1PBGA 3KH3A 2VHLA 1UD5A 4XRCA 5TNVA 4NQ1A 4NPJA 1Z7AA 3SJNA 2MCMA 4O51B 4OJFL 3IXTB 4RNFA 3WUWB 4J35A 2N1TE 2NW0A 1P6WA 2PZ0A 5J6HA 5C2UB 4NO0D 2W9EL 2OWWA 1KV5A 5KG9B 1QVBA 4GG6F 2PLKA 1QPKA 3RIAK 2Z0UA 1CL7L 5BXFA 4KXBA 1BBDH 2F2KA 4YJ5A 3S37L 4QD2E 3HBQA 1PZ1A 2VDOB 1J6PA 1IKFH 4JHZA 1EOMA 2GUYA 1N0LA 5KJ7E 4I88A 3GUTB 2NXZD 1UEMA 1ZTXH 3W38A 4JR5A 4PZVA 2ODIA 3VG0H 2D3JA 2X7VA 3KBWA 1I8UA 2DQUH 1QVOA 3C9NA 3MV8B 4XSMA 4FE9A 2YRZA 2RJMA 4FQPA 1XV8A 5K59F 2WW5A 3L5WA 3S5NA 4QJ4B 1ICPA 2P10A 3RM8A 4P57A 1U8KB 2CKSA 4Z78A 5MI0B 2R1KA 4P8VA 3V5HA 1GYMA 3GJFK 4EIUA 3P4OB 4X98A 3GDLA 1JG9A 4LSQH 1XXXA 3MSPA 3P81A 2X9XA 2PW1A 2HNEA 3KBEA 5C09E 3VC6A 3LHPL 2JLLA 1INEH 4N1HB 4PRPE 1ITUA 1WBHA 1DFXA 4JHVA 2IO5A 3PSWA 3Q43A 2V5YA 4PLKD 4MSSA 3MRLB 3DBXA 2Y23A 3BUYA 1PBYA 1GOGA 1TVDA 1U2CA 1LUCB 1L6GA 5ICYB 2CM5A 4JKLA 4KTDL 4UMBA 2PETA 4I8YA 4DPPA 1J0ZA 4O58L 5CP3A 1JF5A 1DP0A 4Q4OA 1ZA6B 4WLCA 2AXFB 2CRYA 4OLEA 4XO4A 3B8VA 2NNAA 4LRSA 3KYMA 1MFMA 3DSFL 1KACB 1O68A 3WLHA 4QT5A 5TPWL 4PTTA 4U6XB 3CQQA 5AWNL 5EBGA 1I85C 1M7UA 2VB5A 3LPFA 2C4XA 1KTLA 1OD9A 2CUIA 2EEXA 3T55A 4OT1L 1XX9C 3RKDC 1JZ7A 3PULA 3DGGB 3E12A 3VOGA 1YEHL 2J21A 3G6DH 4HIHA 3UERA 1L8NA 1YPFA 3LV6A 3L3KB 3WS6C 2YQGA 5TFSL 3GHEH 5BJTA 3Q44A 4I7VA 3UYCA 4X7FC 2WUBH 4RKAA 4M5TA 5IHHA 5B3SB 4L61A 2E3VA 4UIKH 1EPXA 4N2AA 4MADA 3WQDA 2HBXA 3ZBMA 5DVNA 4XKMA 4RWHA 2OSLB 4IQLA 2RBLA 1WC7A 2DQFB 3AIRA 4UINH 3NSFA 4NHUA 4PGBB 2X4UB 4P49A 4XO9A 4HNUA 1C8QA 4L48A 5FJTA 2DBJA 1J05B 3V8CA 4KRPD 2WXFA 4I3RL 4HHMA 1XGQA 4OZGF 2YO3A 2ZOLB 3VNMA 4WGXA 4C55A 1HH9B 1SN0A 1TTUA 3VTAA 1PDKA 3BVNA 3VSTA 2X3AA 4F7KA 1XPYA 1MJ7H 1OK8A 1TZHA 2E3ZA 4NJKA 2XJLA 3NIFB 1DXFA 3T0ED 5I15L 3Q3GA 1RVGA 1FVDB 4KNTA 1MZYA 1G9NL 1PY4A 1C5CH 3HB3D 1X4ZA 4UNUA 4PYSA 1G7VA 4RISL 5T3XE 4PTDA 3ZDWA 1IGMH 2EC9U 5T5FH 3V5DA 3QJQB 4F7TA 4JKNA 2MCG1 4PV8A 3VFPB 2ZC1A 2GPTA 5CFHA 2WQSA 3KRZA 5CJOL 2P28B 3DEQA 5AYYA 4ENLA 3CZGA 3NGBC 1IF2A 2D3VA 4KFMA 3M9YA 2H3NB 1KFKA 1C5BH 1WPCA 3GXIA 1KBKA 3GJFH 3MBXL 3UGXA 1VFLA 4GE8A 4LFYA 4IU3A 3WO8A 4AXNA 4NNYB 5I82A 5FYKD 2IG2H 1JRHI 2C1HA 2R1PA 4GG9A 4LDCA 4HS3B 1T4KB 3GXTA 1LL6A 4M6QA 3BH8A 2OZ0A 3SDXF 3SODB 1EJFA 4OBTA 5I1EL 2CJTA 2HFEB 3ZYOA 1RHHA 3DROA 4JFFA 4PMDA 2A9MH 2RH9A 4K37A 5FK9B 2IXQB 3WS6A 1DKWA 1ZAHA 3NOYA 3FYIB 4E9SA 4DGUA 2Y1HA 3LS9A 5SWQA 5D6CA 1T41A 3EWBX 4JLRA 2FDBP 2F7QA 3GBMH 2FTWA 5HHXL 1OCWL 4AKOA 3UA3A 3CHXA 5ICZB 4F66A 4W70A 1MWAB 3OM3B 4NQCD 3ALXA 4HWUA 4Y4FC 2QVKA 5F93C 4C6PA 4IP5A 1YNYA 4P3CL 5DFVD 2WBJB 4MCZB 3AXXA 1SBBA 3UAEA 3BP5A 3NDZE 4JZJC 4P2OC 1WVZA 3CV6A 4BQ4A 3VA8A 5BOPA 3I9IA 3IMBA 3HVDA 5MKGB 4Z95L 1Q9LB 2PTWA 3HQNA 2Y06L 1IEHA 5EBWA 4HDIB 2APSA 3FH5A 1KY7A 3JVGC 2OOFA 4XTIA 3G0XA 1SXAA 2HN7A 3UD6A 3SSZA 4QGTA 1F58H 5C5YA 2O5YH 3THML 2QVIA 2E9WA 2ARJQ 2YAFA 4BHUI 2A9NL 4L2YA 2GABA 4NXKA 3V7AE 1F8IA 3BW3A 5BZWA 1J79A 5J5RA 3TTQA 1J8HA 4JO2L 3WXWH 1K6WA 3CFBB 1WDDA 4J3OG 4LIQE 3S4SG 3TBTB 2PP8A 5E8EB 1YYMH 5LGJA 4N2BA 1A7RL 3HG5A 2VZSA 4UBDD 3ES8A 3TV3H 4JRYD 1SLUA 2VEPA 2ZUMA 1NAKL 3OGSA 3LV5A 3LBOA 3DFYA 4NNBA 5C9KA 1N59A 4NJIA 4K7FB 4B5VA 5J12B 3QEQB 3AT8A 3BH9B 3ZKSD 4FNTA 4K38A 4XNYL 2J8UE 1JF6A 3MV8E 4AQZA 1ECEA 1U42A 3QCVL 1YTEA 4J8RB 2PP1A 2VDGA 1CPUA 2OXNA 2BWDA 5DMIH 5D4YA 4YS4A 1U3JA 1OTUC 3SGGA 4MY1A 5FM5O 2X87A 3W2DH 1N8WA 2LHAA 1RQEA 1UWGH 1AGFA 1JHLL 1TQSA 3ZDZF 4IFOA 4L65A 4G1EA 3TW6A 3CFBA 1DVUA 3REVA 1NQKA 3BKMH 4M6ML 3BAEH 4OZ4B 2B16A 2EIDA 3HE7D 5E4OA 1ETZB 3U3HA 1RJQA 4FYRA 2QADD 5DD5L 5B7FA 2B0SL 7TAAA 2VLKD 5DC0A 1D3HA 3SDXE 4H5SB 1OB1B 5HHPB 4D0DB 5ESAB 5CGYD 3RWIB 4DESA 2YQBA 2OT0A 4GBXB 2P5ED 5IB1A 4HEME 1BJ8A 3UL4A 1TR9A 3RU6A 3UTSA 4I1RA 3BW2A 3GW0A 5MEOB 5F2MA 3QHTC 4FTVB 3ARFA 4G8EA 4JMNA 5FF6B 1HK6A 2R15A 3L13A 4WEMB 1RK5A 4IIEA 1L5GA 2PR9A 4YHOL 3STBA 2NWSA 3BEWB 1EA0A 1RZJC 1AKPA 2CKBA 1R4XA 1UWUA 1S7UB 1S7QA 2YD5A 5K69A 3LD5A 5DJYB 3MTWA 1YEFH 2E40A 1XGYL 4ERAA 2XU2A 4LCWB 2XIJA 5HDBB 3EH3B 3HC0A 3Q5TA 3ZOAA 5D04C 1KJ3H 2DJUA 4MS8D 1PD1A 1JPMA 1Y0LA 2BK8A 2BDNH 4ZG1A 1TPUA 2O9OA 3DKLA 1J9QA 1JGUH 1JZFA 2BY0A 3SCTA 3TW7A 5EKYA 4OIFA 3TVMA 1QPQA 3POCA 5FFLA 3MRBA 5HP5A 3QJHA 4N8PA 4QY8A 3NOIA 1SW3A 3V7PA 6TAAA 1KBVA 3DRQB 1C08A 3CBRA 4IHBA 1RZGB 5B1CA 3QEQD 3WENA 3CVHH 2JVUA 1Z9NA 3S5LA 3IBEA 2PDIA 3GAYA 3SURA 2QR6A 3H2EA 2NLJA 3W11C 3E0GA 2DAVA 4Q6IA 4H9ZA 2LU4A 3TROA 4UT9H 2VLRA 3KLAA 3GHEL 3HRZA 2CBPA 3OKMB 4QRPA 1VACA 3IS1X 2J9YA 3N9RA 2WYSA 2NOYA 5IF0B 2Z4TA 3MRMB 2W07B 1GW1A 2EHHA 1ZT7B 1IYXA 1DUYB 1MQRA 3G1FA 3O3EB 1MVFA 4QRRA 4M5YL 4HS3A 5CWSB 1E3XA 2FQEA 3RGHA 2ISFA 2PB1A 2XPGA 3E0IA 3AAZB 3CCHB 2NV9A 5I1LA 1H5YA 3HMCA 2ABAA 1JYVA 3WBXA 3MUHL 2IC2A 3FFCE 5L2KE 1ZJAA 4PW3A 2XH0A 4Q4KA 2OWXA 4NC1E 4LW7A 1RCXB 3TYZA 4B5TA 3WLIA 5I3DA 4ZFZB 2PXYD 3F7KA 4UTCA 3GVQA 1JWMB 2HTLC 1SQMA 5F1KC 1CI1A 3WEXB 5FUCC 1HH6B 4ABQA 4OD1H 4FX7A 4HS8H 4G1KA 2V0AA 2C9AA 2Q6ZA 4RPQA 4IS6B 1DL7H 4FTVD 1NC4B 4H44C 2BM3A 4U1GC 4TSBH 5T1LB 3VFNA 1UWSA 4FALA 3U4KA 3TT1L 3BG3A 2OCCB 1Q9WA 3GSWB 4LVHB 3NL5A 5AW5B 1A02N 3BVNB 4GXUN 5CJOH 4BK4A 2E28A 3Q48A 32C2B 3KYKH 1I8MB 4GI6A 4B9KC 3KVJA 3S48A 5ES4B 4AGQA 1ZQ5A 2KZWA 2PP3A 4FQHB 4H8WL 2WMGA 2VC2H 1RULH 1C5BL 5JBDA 1YEIH 3P0GB 1L9QA 2FX8L 2OX5B 5LBSL 2HQAA 1WWCA 3NFPA 3ILQC 1PHQA 4NUJB 4OLWL 5BXRA 3X1BA 1K4CB 2NXYD 1KELH 1WH0A 2CLLA 4AGOA 1ASQA 4GG6B 4E8CA 1QRQA 5C9ZA 3IJHA 3LH2H 1IFRA 4IBTA 3TFBA 1S7SA 1NLDH 1GZPA 3O2WL 4KI5C 5I30H 1SM3H 2DYPB 2YAQA 3J7HA 4N2MA 4HZAA 3DETC 4OBRA 4BRJA 3W27A 1NBQA 3PU7A 4ANUA 3CFUA 4ZOEA 4E9RA 1YW1A 1OVZA 2XZZA 1MRAA 2I27N 3K81A 2PDWA 5FL1A 1QPRA 1BFSA 2QIWA 4PP2A 1CD0A 5ABTA 1BWMA 3F7RA 2GEQA 3P67A 1V5JA 3HO8A 1XGUB 2X1RA 2W0FA 1JPKA 1UUSA 1MW2A 3CHPA 1OFPA 4DELA 1LQ0A 2MOGA 4JVUA 1SPDA 5ERWB 3QXAB 4G8TA 1AKJA 5FJIA 2W60A 2ZCLH 3N1GC 1PNCA 4JY4B 1FO0B 3VJ6B 1Z69A 3QPYA 7REQB 4OF3A 4QHNB 4M7LL 4HC1A 4N5EC 4Y1AA 2H3DA 3BTNA 4WNJA 3VABA 4B50A 4P9HL 1RZJL 1ADQA 2E7CA 1F6AB 1G7PA 2EYTA 5FYKL 1KXQE 3MDUA 3TO4D 1LNUB 3RHGA 3EO9H 3PBYA 4G6MH 1KEMH 4UQIM 3RPIB 5J6GB 3BLBA 2XN1A 2F7FA 2I07A 4NZUL 2JKTM 4DBUA 3Q2WA 5KWYC 3CC5B 4FFTA 4NN5B 5D9PA 4XNMA 4PJFA 4XVUD 3VD0A 5DJZA 3CJPA 5LGHL 1U6AL 3JWOC 1C16A 2FZDA 5I66A 3CQPA 4W4QA 1YRKA 2WWNA 4BKLA 2IQDA 1R1CA 5D1XC 1U8MB 2IAMB 5A2BA 3GG7A 4AD3A 3PUEA 5EORL 1PZDA 3QQ9D 1DVFA 3HJEA 4P5TB 5DYOB 3T0EA 3SDYL 1A9BB 1E7VA 3AM8A 5F4SA 1YMMA 4EZLA 4Z7UE 3PWPE 4EUPA 4Y6GA 3UGRA 3WH8A 1BFVL 4ZTPH 5EOCJ 4XUGA 3KCLA 3WQCA 2DUZA 3QO0A 1DBTA 2BRRH 3EH4B 1E4KC 1K8DA 3OAWA 3Q8CA 4JQ2A 3EH1A 4P5KA 1OCQA 4H6RA 4RDWA 3MLTB 1EP1A 4J3BA 2EUZA 3V35A 3Q2NA 4L9DA 3VFRA 5FHBH 1NTDA 2IDFA 5FV2A 5KG9A 4GYPA 1E0XA 3NCJH 4B95C 3RWHB 3L54A 3MPGA 2IW0A 3CT2A 3DUSB 3IUHA 4AIUA 4KITB 1WLHA 2YPLB 4Y2DA 3VIPA 2PWDA 3BH9A 5B4MD 4U3HA 2QKIC 2HJKA 2ZRWA 1HKFA 3HS9A 3NO1A 5HHQB 2BOEX 3WXVL 5KBDA 4U28A 4G5DA 3MHZA 2VRKA 1WIUA 3TNNA 1I8JA 3W2JA 2QSTA 3EUDA 4M43H 4PCKA 2PF6A 1SEBA 3CIAA 5FYJE 3HZ3A 3JWNH 3WLWD 1G0CA 3ULUC 3ECQA 1IWBA 3PJWA 2FD6L 2XFXA 3QJVB 5D4QA 4E9WA 4L4VB 3F65A 1LDPH 1ZL1A 4EPBC 3LKPA 4IKNA 4MB1A 1F7BA 2R1LA 4ENED 3TIEA 3PNRB 1GTEA 3MO1A 5H4YA 3N40P 3AAZA 2MKLC 3CCHA 4Z7NB 4OIIL 3C09B 2ACQA 2GJJA 1IAKB 3SCNA 2YD3A 5EZLB 1AOZA 1R2RA 1RJPA 5FD0A 1B6DA 3KRUA 2XZCL 4LP5A 4D1JA 1U8NA 1EXUA 3QDJE 3OKMA 4QRPB 2GHZA 1ZHKB 4ZX4A 3W88A 4B2DD 2AQRA 5KMYA 1PDZA 3PK7A 3C86A 5FECA 1YEFL 4ZOAA 2FLMA 4LCWA 1TJIL 4L05A 1QW9A 3TBYB 3PTQA 1OGAE 4OCXL 3RG1C 3ZGIA 3C2YA 1B0RB 2VDKB 3CUIA 4BQ2A 3T81A 5DANA 1MVUB 3U2ZA 4EVZA 4IXXA 2VW7A 5AG9A 2HTLD 2DMGA 4FL4C 2OULB 3TT3H 5CM1A 5I18L 1H7PA 1QO2A 2HWZH 4TOYL 1TU2B 2YPVA 3A24A 3G5WA 3EX3A 2XWEA 2CC0A 2JJTC 4NI6A 5A69A 4O02A 4P4KD 5DK2B 5DZAA 4AKQA 1LM8V 4RR4A 1P5UC 3P9MA 43CAA 5IK3B 2ICEA 3HE6D 2PDXA 1M2VA 2VR3A 1OE1A 2GGHA 5LJYH 2YQ3A 2CGRH 3M17A 3QFJE 5CNHA 4ZFCA 1CLKA 3HMXA 3RNQA 3QULB 4MA8L 4KJPD 5JIDA 2R4RL 4BFRA 1KBLA 1RJRA 4AV0A 4LCCA 4AWJC 1IGJB 1VA9A 1R9YA 4C4KO 3KW7A 1G01A 4ZMWA 4JE4B 1F3RB 3ESPA 3TQ0A 2A1YA 1DLFL 4BKSC 2A4AA 2ISVA 4NLAA 4CMMA 4DKEH 3BZEB 1DYSA 3VD4A 3NEVA 2DD8L 5U7SA 1K2DA 1EJOH 3QQDA 5IF0A 2CDEB 2V2WB 1RV6X 1JGDA 3RI5K 1KFCA 3W2LA 3GIZL 4TX8A 1QSFB 2ADFL 1XIWD 1AFSA 3WLTA 1EJ8A 1KJMA 3NIFF 1SJVA 4OCYL 3H0TB 5C0AB 3WUWG 3ZZ1A 3GZ3A 2ZUYA 3A6CL 2HVMA 3SE9L 5KS9F 3IETA 3L2MA 4WSGA 1JPTH 4CMHB 1EJRC 3RNQB 2G41A 3F7JA 1XMEB 4AX6A 3CMFA 3OA5A 5HR6A 2MOQA 2LABA 3NSJA 1QW8A 1UJ3A 4GAYA 4G1MB 3VXSE 5CCKL 1Q6CA 3QI9D 1A6VH 3TZVB 2YBUA 2O61A 1S8DA 1G7PB 1F6AA 3MJ8B 3UJRA 4JN1L 3R0DA 1C12B 1MKFA 2GTZB 1YECH 2XV3A 1QR7A 4S1DD 3N91A 1QNSA 2W60B 3TW9A 1CDCA 1VESA 4GW4B 4NQCA 3QKEA 2CO1A 4GNVA 1KELL 1OTTC 1WYJA 5FM4A 2V3FA 4L0YA 4XBSA 3K2MC 1Y65A 1ZJIA 3T05A 2E09A 1S7WA 1XLIA 4YO0B 2MHAB 3ZWSA 2VC9A 1PFOA 3O7UA 2J3SA 3MGTA 4U1IB 5D7JD 3B06A 2EYTB 1ZHNB 1BJ1J 1VPOL 5I8KL 1E3FA 1LP6A 1WV2A 1X9LA 2CCWA 3FSAA 2A99A 4AHPA 4YBQC 3SJVE 2L4OA 3QHFH 4OF0A 2BLEA 3W7RA 2BZNA 1RQHA 1XF3A 1P43A 2AL1A 5DEFB 3VWKC 2WD0A 2HZHA 2YC1A 3ARGB 1KC5H 4XBGB 4FABH 1NICA 1DBJL 1XPGA 4DN3L 2IS7A 2XJKA 2W67A 2RAMA 3IPFA 4Z8FH 1TJ0A 4YDJA 5TH2A 4HUNB 3LTPA 5DJ6B 4IIGA 2ZKYA 1UQYA 4AY1A 1GPOL 3TAKA 1NLBH 2BIHA 2EE0A 4M7LH 1R0AL 1XYMA 1SFTA 4TVSa 3RFZA 5EZOH 3LB0A 1KFAL 5HJGA 1RZJH 1J86A 4GSXA 3AIWA 2W79A 1X5JA 1GJPA 4M24A 4B90A 4HVXA 4Z3FA 1F8TH 1SY6A 1OAUL 4NNXB 3TIDA 2HJKB 3EO9L 5HK4A 1E55A 5SX4H 3PR2A 4C6FA 2GJ6A 4YU1A 4ORIA 2Z29A 5ABEA 2M83A 2NY5H 2X0HA 2VLKA 4HPXA 1UP2A 4ZPVA 1KDIA 5MP6H 3IIVA 4QDPA 4E68A 4W9FC 1F6KA 1A2YA 1ZS2A 5CIPH 4AXWB 1UR2A 5LGHH 3RWHA 2G3XA 3W7JA 1ZTXE 4XMXA 3VXTA 5E2VH 3SO3B 1I1YA 4PFHA 1XGPB 1U4FA 1K77A 4JS3A 4MNLA 5F96L 4TUKH 3PPGA 5E8EA 3ZDXF 2WQAA 3WJZA 1XLLA 5BU6A 3GBEA 1UYWH 5KVDL 1A3LH 3UIZA 4H1LA 3E1F1 4KVNH 4XP6L 3DUHA 4K9EC 3IARA 2EAEA 3BO8A 1ASPA 4G59C 2RGSA 5BRPA 4Q6JA 3L1FA 3O8XB 1T2JA 3TEZA 3GSNH 4CILA 5F9OL 4URTB 1S7VB 3DK0A 2AJVL 4EDWH 4H40A 5DXWA 4AYFA 3C8KB 4GLRI 3O8XC 3SQBB 5C3LD 5I0ZA 3KNBA 4HZ8A 4ELMA 1RZIA 3TR2A 3SE4C 1UB5A 3L23A 1S3KL 4EANA 3K5SA 1U8CA 4G42B 1BQSA 3UO1H 1WYIA 3RAJH 1E0TA 3RPTA 3AB0B 3C6CA 4QITA 1FZMA 5HHOE 5HGAA 5IVXA 3T7VA 2VDLB 3EGSB 3MRIA 4NERA 2BIMA 2HJLA 4XWOC 2IALB 4LLWB 1PQZA 3BAXA 3WU1A 1A3XA 5JHDE 2VW4A 2R9RA 3D46A 4JIIX 3VXMD 1T0NA 2Q8BH 3QVAA 3GVWA 3HBZA 4JX5A 3NPSB 3ROOB 1HQ4A 1UCTA 5E6RB 4V2XA 4FFZH 5D02A 1A8ZA 4HCGA 3TVMB 3E7JA 1EXPA 2GJLA 1JWSB 4HJGA 2XQBL 5AZ2H 1I9JH 2IDSA 3BCJA 3L2IA 4JEQA 1SJAA 4Y4KA 2XM2A 3DMMC 3KPSB 2A9CA 1D7BA 5DFWH 4NDMB 1P0BA 1Q6RA 1URLA 1OIMA 2RJHA 3D39E 1UOVA 3FCPA 4KVPA 1P48A 1MCFA 1DOSA 4W88A 4X83A 2QQKL 2XX0A 4HUUB 1XH0A 2BS8A 1TPXC 1MRDL 3BEWA 5C2BL 2C18A 2XZCH 3ARVA 1WDPA 4PFMA 4QHLB 4FA8A 4R2GB 4TL5A 4TNGA 4YDZA 1I2NA 4JTSA 4R34A 1JFQL 1TCRB 2P47B 4PL1A 1DBKL 4MNGE 4L8DA 2H9AB 4U6HB 3TASA 1K85A 5DVPA 4PLNC 1A9VA 4WJ8A 7PAZA 3JVFC 3M0XA 4IIDA 4PREB 1MDLA 3PG9A 1QI5A 5HI4D 2G4EA 3IPBA 3HC3L 1JDFA 2NR6D 1B9KA 4JPVL 3LCXA 3VMPA 1WG3A 4ICMA 2BXYA 4J23A 1ZEAH 4N9EA 4Q6KA 4H0GA 5DRZB 3O06A 5DK2A 3DOSB 3K6OA 1A4MA 4Y5VA 3F7PC 5A6MA 2F53B 1RHCA 1WQVT 2WJ5A 2XYBA 4KJPC 1M3IA 2PDMA 4OGZA 1C12A 2PYEB 1IQDB 3ZUCA 5BOFA 5ALBL 3WUZA 1M71A 5CGMA 4UUJA 2GLKA 3WJXA 2PNDA 1JPDX 2CE6A 1OSYA 1X4YA 3GG8A 2PDQA 4NQVA 3K4AA 3W1MA 5AW7B 4I0PD 1JNEA 1D5IH 2CMRL 4YHMH 2GY7B 5FL0A 3ULUF 1A5SA 3NL3A 2NQZA 2Z35A 3M7OA 4KDTA 4KK5D 4OSUH 5DUML 1S8DB 3MJ8A 1B3VA 3WF2A 4JTUA 4XVSL 4H8NA 4MPQA 5AOZA 3EFOA 1ONQA 1GVIA 3PQYD 4GFXA 1NANH 4GQZA 4I48B 5DRWA 3SDCD 3QFWA 3BH8B 4L3CA 3Q37A 3WL9B 3QC6X 4GH3A 4YJZL 4M4RA 1J9YA 5I1HH 4QXVA 3H0TA 2IPKA 1Z42A 2F54D 1RBOB 3GYRA 2OR7A 3S5YA 3WNKA 3LHVA 5KEZA 4K3JH 1O12A 3SE9H 1MAMH 1OSZA 4J6RL 1IWPA 4P8UA 3KGSA 2VFHA 1XLFA 1OFOA 2VABB 4HTYA 4ZZ9A 5K4XA 4HU3A 5M94B 1K2DB 2HN7B 3VIJA 1BBJA 4MMXB 5I73C 2O5ZL 1OIFA 4K8EA 3IVKA 1IT7A 2EPNA 3P02A 1ACXA 3MUAA 2VQTA 4A2MA 3O6ML 4Z7WB 2V0TA 3W7PA 2NYYD 1JXDA 1AIFB 1W0VB 1MXDA 4J6IA 3ZFHA 3TX9A 4GG6E 1GYVA 4B7LA 4HCHA 3LHAA 2EDKA 3KHQA 1QBAA 1NGZB 2NXZC 3BPOB 3MV7B 4R88A 4S3EA 4UMCA 3TN5A 1J8SA 2ZXGA 4HDIA 4LQFH 3D39D 2LTQC 5EBWB 4R0LC 5EUOE 5AW4B 3VRLE 3VYNA 1K7EA 2BOCA 5D2VA 4C6KA 5I2UA 3KYNB 2HH0L 3KYNA 2G0KA 3N18A 3U1SH 1YAZA 3TYCA 4AJYV 4H9UA 3UZQB 3US1A 2CHZA 1PG7X 4Z6AT 2O6CA 1GW0A 2YK1H 3CFCH 1VJZA 4QDWA 3CB3A 3TC3A 4XX5A 2RQ8A 1AANA 5GQBA 4PGEA 1DBJH 1FWXA 1Q9LA 5EPMA 5KSAC 1EJUC 2CLPA 4G8FB 3C2OA 3ITVA 1TKWB 3SR7A 5LUMA 4CADB 3WI9A 4LLMA 4JG1H 3U7WL 3BYYA 3CMGA 5LYRA 3WD5L 5LDSA 4IEFA 4B5UA 5C7ZA 5D5MF 1KFAH 2FTAA 4P7QA 4N1EA 1TQBC 3ARGA 1ZJBA 1D9KB 2YC1B 4YHKL 3UZVB 4AGMA 2VDOH 4PPTA 3RU8L 4R5XA 1G0DA 2YXWA 5I5IA 3EX6A 4P8WA 1XZ0A 4QHRA 1MW1A 4JFED 2WBKA 4UQ3A 4XNBA 4FMVA 2VWTA 1MFBH 5AVXB 3CFDB 1O60A 2E27H 2AS5M 4AGNA 2PP0A 3SN1A 2GDUA 4L4TB 12E8L 2BNRA 2Q1EA 5GRUL 1FHUA 2BSED 3U6RA 1INDH 1R3WA 3T8VA 2YXGA 3QKZA 4EXKA 1GZQA 3H4XA 2GYIA 3LEXA 1RY0A 2JMRA 1VFFA 1MJ7L 4JFTA 5ICXB 3WLRA 2UWEF 5T3ZH 1X44A 2Q7NA 2VIRA 3JXAA 1OOAA 1M7JA 3MRDB 5DJZB 4H1LH 3QO0B 5C07E 4KT2A 2AGJL 1FWNA 5KZDA 5JIWA 5PTDA 2BC4A 2F61A 4GO9A 1TA3B 4NBZB 1PIGA 1XH2A 4AH2B 1EEYA 3O6AA 4UILL 5FEZA 3TNMB 4Z18A 5EF3A 4C47A 5AKRA 1JZDC 2ZKHL 1G4MA 1WAAA 4I87A 5CJMA 5I75B 5A2JH 1AR1D 3NEXA 1O7SA 1F11B 3LMZA 4S2SB 4LVOC 4ZOCA 3QS2A 4S2SA 2EAWA 5JH1A 4QCIA 4NKIH 1YHPA 2F18A 5PCYA 5ADOL 3ZJ8A 3IWUA 4WU5A 2UY7B 2EKSB 4PJCE 1XIEA 3AXKA 1UG9A 4N2DA 4KMLB 4LGSB 4EI6B 3VD9A 4KFPA 4WDWA 3O6KH 2NY2D 4E41A 3K4DA 3HNVL 3T3PE 2Y72A 4PVLA 6PCYA 1I9JL 3MLRL 2PTYA 1BZ7A 5GZOD 1B88A 1EZUA 3ZDXB 2A21A 1XDMA 3QDJD 3OYXA 1TWIA 4GRMB 3DGGA 2P5WA 4V11A 4J5VA 4IDLA 1N7KA 4A2GA 2GPZA 2V3DA 4Y2LA 5FJJA 1W2VA 3T0VA 2PU0A 4RZ5A 2QKSA 2GIYA 3QC0A 3QUYA 4WO4C 1AJ2A 2G2NA 4JRXA 3H7UA 2BNQD 1HE8A 1OB0A 1GORA 4UFJA 3PNWA 5HNRA 4NL1A 1S1PA 2OZ3A 5D32A 2YBVA 3FUKA 4JDEA 4P3CH 3VILA 2N0MA 1FKXA 2PYFB 2JEPA 5D5ME 2ZRZA 2AC0A 4OGAD 4Q8WA 4BEQA 3INUH 3WK1A 2AK4A 3UNDA 4H8WC 3WQPA 4RFOH 2I57A 5ABFA 3AYRA 3S1UA 5IFPA 1KUMA 5K9CA 2OX5A 4IU3B 2E1DA 3NFNB 1CXIA 2JXMA 3LN5B 3LNEA 4G43A 4LLUA 4J2QA 1T22A 3SDAD 1I2QA 3E2RA 3PABB 3TBYA 4XAYA 1ORQB 1MRCH 4I9WD 5KYWA 4E0RA 1L6ZA 2XG5B 3IDYB 1I7UB 4ZUUA 4L6HA 2YLAA 4JQ4A 1A0QL 1U58B 2N7BA 3OTRA 4M7ZB 4ZFOA 4TUOA 5KVGH 3MKVA 1FZJA 1UH3A 4K0OA 5J5EA 1I82A 2XGIA 3GSWA 2C3WA 3EX1A 2CMRH 5T9CE 3RWJB 3MP3A 2VZOA 3HKZA 3TV3L 2R69A 3G0UA 3IIPA 3WYZA 1RLCL 3CTTA 2G30A 4DUOA 1JGVH 2W80C 2X6AA 3NJJA 4IS6A 2WXHA 2P8PA 1ANUA 3MRQA 3U4BL 5CFAA 3CPLA 3BRDA 1KRBC 1Q45A 2C0AA 4F48A 4XNYH 4MYAA 4KU1A 4WKFA 3L2NA 5BROA 2NY5C 4JFDA 4NJAH 3WMSA 1QFPA 1KFBA 2WBWB 4DO6A 4IX0A 1YEEH 3ZPDA 2ADJB 4LSPH 4AYGA 4Y9GA 2VKWA 4HU2A 2PPGA 4G9DB 1U5HA 3L5JA 2NY6B 2R4SH 2YBGA 4GMTL 4LCCC 1E8ZA 4P59H 3W7HA 3S3JA 1BQHG 2A6DA 3LEVH 5FC9A 4HBCH 3IUDA 4TU1A 4UTJA 2W62A 4N42A 4JPWH 1BKSA 2APVA 3W0KA 4I9XA 1BM7A 1DQKA 1W8OA 3GLEA 1X3DA 1X4XA 3MFGB 3TL5A 4EEEA 4PB5A 1RZQA 1XSKA 2Z7YA 5G4OA 1XINA 4PTMA 3K71B 2N0KA 1IE4A 1D5XA 2YGPA 4XX1E 4F57H 2X16A 3SCMB 4MM1A 4PRHD 5F9AC 1EZVX 1JHKH 1YEJH 3SYOA 1SF5A 5KYYA 4OZGA 2ZDRA 3DTUB 3T0EB 1ZSXA 1LO2L 2WCSA 3MP4A 4MNMA 5TF1H 4QFUA 2JQZA 3NXLA 3RFZB 4PCNA 5JIQA 1H1NA 3RR4A 2R2CA 1PYWB 5D1QC 1N8FA 1TQCB 3GVGA 1XSIA 1YAIA 3G1DA 1NCDL 3C2EA 3CL6A 5TDOA 1VEOA 1YQ2A 2R39A 1GNXA 3THUA 2H2SD 1EJ6A 1OFDA 3QG6B 5F7WC 3VFUB 5DT5A 1N70A 2WAGA 3CSFA 3H9ZA 2P5NA 4TMBA 1BXAA 4ALAC 4L1SA 3IDNB 1XF3B 3RJXA 5HHMB 1AH3A 2VUOA 2WO3B 4MA7L 5ECJE 2D9CA 3ABGA 3W9DB 3TEWA 5HGGS 2B1AH 3TWBA 5L2JA 5MERA 5MERB 4N8UA 4CSSA 5F1NB 3CXHJ 3QZWG 1HKVA 3GG1A 2GWNA 4RE0A 4O2EA 5GGRB 4A22A 2Y62A 4TQ8A 3M86A 1OAJA 4HU0A 1CFNA 1IXOA 4LYKA 3JT2A 2NVDA 1G9MH 1PD6A 3SJVA 3RWIA 1G9MC 1JPGB 1EP2A 4E2DA 1L7TL 4XZUB 5BVPH 1AACA 4LF3A 4N2LA 1ZAGA 4F8NA 3KLHD 3MMTA 4YIQB 1OCOB 1KCXA 5I8CB 1NVMA 1WS7A 3T4AC 5HGDA 2E9MA 1HI6A 5E1GA 1GT8A 3N43F 1T1XA 3QORA 1IT8A 3WSUA 4DBSA 4G1EB 3VW3H 1M01A 2A73A 3EWXA 3MANA 1ZT4B 3DUUB 2DYSB 1V8EA 3MNZB 5DCCA 4Y8EA 3BN9D 1S46A 4I3GA 2YA1A 4G71B 5DEJA 1ETZA 5I2IB 2NQHA 4L9XA 2VEGA 3CC1A 1KF9B 4PJ5D 2W95A 3AU1A 4JVWA 5EULV 3LG3A 3D2UD 4AZBA 3TLRA 3NJMA 4FN0A 3GH5A 2ZA1A 5HANA 2HVKB 2LW3A 4TSBL 4UU9B 4LYRA 1UQSA 1SJDA 4QTIL 5DMJB 1H3UA 1SGKA 2WSDA 1HXJA 2HE5A 2VR2A 5I6KA 4EPEC 4NRZA 4ODUA 5CPMA 2YD1A 2ZWLT 1NQ6A 1QFWM 3O11B 4FF9A 4YDVB 2Z92A 4X4ZA 3GNNA 3CBKB 4TVPH 3C3NA 1CGYA 3P9MB 3MLPA 4O13A 1IC5L 4HOXA 2K3TA 5DHYA 2WZPD 1H7WA 4LUSB 4W9TA 1XIWC 6FABL 4HWNA 1QRNB 3QUMH 5DFTA 5F9DC 5TE4L 3L12A 3N9SA 2XPKA 3SO5A 1RK7A 5ALCH 4LFHD 4OJYA 4AYFB 2VDNH 3ZJ7A 3PQYA 1I7UA 4H20H 4M6OL 3RVXC 4EZMA 4GK8A 5GJNA 3SSJA 4DRSA 4R2GD 5C0GB 2I25N 4PB3A 4A4AA 2MNRA 3SGJA 2V5CA 3ZVIA 1ZLEA