1JDDA

Mutant (e219q) maltotetraose-forming exo-amylase cocrystallized with maltotetraose (crystal type 2)
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
418
structure length
418
Chain Sequence
DQAGKSPNAVRYHGGDEIILQGFHWNVVREAPNDWYNILRQQAATIAADGFSAIWMPVPWRDFSSWSDGSKSGGGEGYFWHDFNKNGRYGSDAQLRQAASALGGAGVKVLYDVVPNHMNRGYPDKEINLPAGQGFWRNDCADPGNYPNDCDDGDRFIGGDADLNTGHPQVYGMFRDEFTNLRSQYGAGGFRFDFVRGYAPERVNSWMTDSADNSFCVGQLWKGPSEYPNWDWRNTASWQQIIKDWSDRAKCPVFDFALKERMQNGSIADWKHGLNGNPDPRWREVAVTFVDNHDTGYSPGQNGGQHHWALQDGLIRQAYAYILTSPGTPVVYWDHMYDWGYGDFIRQLIQVRRAAGVRADSAISFHSGYSGLVATVSGSQQTLVVALNSDLGNPGQVASGSFSEAVNASNGQVRVWRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 1,4-ALPHA MALTOTETRAHYDROLASE
publication title Crystal structures of a mutant maltotetraose-forming exo-amylase cocrystallized with maltopentaose.
pubmed doi rcsb
source organism Pseudomonas stutzeri
molecule tags Hydrolase
total genus 148
structure length 418
sequence length 418
ec nomenclature ec 3.2.1.60: Glucan 1,4-alpha-maltotetraohydrolase.
pdb deposition date 1997-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09081 DUF1921 Domain of unknown function (DUF1921)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1jddA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jddA01
1ZBWA 1XHGA 5GQBA 4F9DA 5LA1A 4ZEPA 5HPOA 4HU0A 4J3SA 3VGGA 2A3AA 3QHNA 5FIPA 2X09A 1VEPA 2VO5A 1UR8A 5IHRA 1OT1A 4JFWA 1CXIA 1ZS2A 3QOMA 3WD3A 4CUCA 1JZ3A 3ZJKA 4TOQA 4BQ4A 1QNOA 4W85A 1CZ1A 2J8GA 2YL8A 3WNOA 2CBUA 1VRXA 2WZHA 4AEFA 1J01A 4UNIA 3AIVA 1V3IA 4W87A 5D9PA 3WNNA 3WMBA 2YDRA 1G0CA 1E6RA 1WZLA 2ZXQA 2XTKA 3WBEA 1XRVA 1JZ4A 2YBUA 4GPNA 4ATLA 3BUPA 1BQCA 3N18A 1GVIA 3ZQ9A 2VJXA 3EMCA 2E8YA 3DHPA 1DWGM 2E40A 1AQHA 3NIYA 4KGJA 2OWXA 4W7VA 3BAKA 1NWTA 2CBIA 4C7DA 1KXTA 2OW7A 1B3WA 3WF2A 5ABFA 3ARRA 3SCTA 1LL6A 5A94A 1V6VA 2DGAA 4W93A 1EQCA 3AQUA 1MW2A 3VSUA 2DIJA 4DWSA 2J78A 2WK2A 5LYRA 3BVVA 3WMCA 1VFMA 2BXZA 1HKIA 5A6BD 4P8XA 4GQQA 3K46A 2VX5A 2ZUVA 1LF1A 3QHOA 3EJSA 3EDDA 2VCBA 3WEMA 4U3AA 4GIAA 2YFNA 3KL5A 4KH2A 3W82A 2D22A 1HL9A 2CITA 1KQZA 1KR1A 4MJ2A 4AD2A 1J0IA 2WZIA 4L4PA 1GJWA 3VIFA 2WCSA 5E09A 5IFPA 2CKSA 4Y7EA 3HMCA 5DFAA 1VJSA 1OD0A 5LA0A 4D6JA 4BCEA 3WF3A 4M56A 3RJXA 3KZSA 1VAHA 1NOWA 4P7QA 1HP5A 2VQUA 4AISA 3W0KA 2UY5A 2Y4SA 2CHNA 1V0KA 1BTCA 4FMVA 1E4MM 3WDHA 3OB8A 2GK1B 4TX6A 4JFTA 2EQDA 4XX6A 3RMEA 2G8ZA 1V3LA 4EANA 2EEXA 3AIRA 3CUHA 2J7GA 1QI3A 4AC1X 1M03A 1U33A 4E2OA 4Z2JA 2X2JA 4UQDA 1HXKA 2EPKX 2RGLA 2W92A 1V3MA 1E4LA 1H3GA 3MS8A 1QI5A 1J0JA 1BLIA 1SFSA 5A6KA 4GI8A 3MKKA 4CD5A 4BF7A 4E8DA 2J4GA 4MB4A 4JIEA 5DO8A 1CGYA 4ACZA 3CBWA 4M81A 2CPUA 3I3BA 1NP2A 1VJZA 1FH8A 4OBSA 3VIJA 7TAAA 5CSYA 1W1VA 1QWNA 2BNJA 2VRJA 1TCMA 5HDRA 1KR0A 2V38A 3CHCA 2W91A 1B9ZA 3BC9A 1R85A 3KEHA 4AZBA 2W63A 1WP6A 3VD7A 3A6OA 4V2XA 4U31A 2WHMA 2OSXA 1E0WA 1EA9C 2YLLA 1B0IA 3WEZA 1E5NA 3CZNA 4HOXA 4U2ZA 1EIBA 1W9DM 1A3HA 3F5LA 5CGTA 1K6AA 2D3NA 3M7SA 3AS1A 2ZX5A 3ZT5A 1H5VA 1EDGA 4CU7A 3ZOAA 4RE2A 2FGLA 1D3CA 2GDVA 3W81A 3HU7A 3WMSA 5LA2A 4U5IA 3DDGA 3W27A 4B15A 4DM2A 1ECEA 2AOSA 1Q6FA 1CGTA 3ARVA 1H49A 4P7NA 3LXBA 5HXMA 3FHAA 3N1AA 3IANA 3W28A 2VVNA 2C8NA 4FK9A 4AMCA 1RP9A 2CBVA 2VZVA 1BYDA 1VFUA 1EDQA 5JBDA 1HKMA 4QP0A 2DEPA 2FYVA 5BYWA 1R7OA 3M6DA 1PX3A 2CXGA 3AMLA 1YQ2A 4FNRA 2XVNA 1GQIA 3VNZA 5M3WA 1CTNA 3K8LA 2XIIA 1GOQA 1G5AA 4OGZA 4GXPA 4J7RA 1CBGA 2JF6A 5A8MA 4AD4A 3DX0A 2CHOA 4GQRA 1FH9A 2O9PA 3W37A 4PCSA 2GJXB 2YOCA 4MB5A 1R34A 4D71A 2DSVA 5CG0A 3PBGA 3A4WA 2QHAA 2ZUMA 2J7DA 4FLOA 2ZUUA 4C7GA 4M80A 4CU8A 3EJRA 1JI1A 4V27A 3K4AA 3UR8A 1GJUA 1G1YA 2ESCA 3AIQA 1UR4A 5DMYA 1ODZA 2WCGA 4FLRA 1VF8A 1C8QA 1NH6A 5JIWA 1CLXA 2G41A 4ML4A 1US3A 2UY4A 4PTXA 3SURA 1XH0A 1XYZA 1XH1A 2WSKA 3GXFA 1QHZA 3BLBA 4R5EA 3WH5A 3BXWA 1B30A 8A3HA 4GKLA 1JZ8A 2FHCA 3VGBA 3WF1A 3G6MA 4OOUA 3GXPA 2C7FA 3NUKA 4UFMA 1T0OA 2GUYA 2NSXA 4J3XA 4ZE5A 2BV9A 1RD6A 3SCQA 3AROA 1ISWA 4LPCA 1KXVA 1I1WA 1TQWA 3B8SA 3U5YA 3WENA 1E6ZA 3SUUA 2BFGA 4D6FA 3ARZA 3L4WA 2W4XA 5BXTA 4TVDA 5JBEA 1E56A 1XYFA 5I5RA 4AZHA 1HP4A 2XN1A 4DWSC 4UZUA 3T08A 3RM8A 2B31A 1FA2A 3BMWA 5CSUA 1JZ2A 1PX8A 2CCRA 3THCA 1JZ5A 5DEZA 1HJUA 4XUYA 4YHEA 5A6LA 2F18A 1EOMA 3VMOA 2WVTA 5A2BA 1HIZA 5A6SA 1C91A 4CCDA 1KGUA 3GXMA 2AAAA 1V03A 2CETA 3FW6A 3CUIA 1JGIA 4CKQA 1W2VA 1KTCA 1W32A 2O92A 1KBBA 1ZB5A 5EB8A 4XZWA 2WB5A 3FY1A 1CLVA 1JYXA 3BLKA 3CHEA 2WBGA 5E0FA 5E6ZA 3FAWA 1FP8A 2X0YA 3W6MA 4P7RA 1M7XA 1UR9A 1QBAA 5IFTA 1SR0A 4UQCA 2F7QA 2BY2A 1WAWA 3OLDA 3LPGA 3BLPX 5HOSA 1TZ7A 1R47A 2VURA 3WFLA 4UQAA 1JZ6A 2YL9A 3OBAA 4B3LA 1PEZA 2J7HA 5GNZA 4PMOA 3T0BA 3MUY1 4AZ5A 1D7FA 1PZ2A 2WSPA 2XVGA 1MYRA 2BY0A 4JKLA 5F7UA 1KGXA 2X2YA 4B9YA 4F66A 3OGRA 1SZNA 4PTWA 5IXEA 3KLKA 3VGEA 2VVSA 3VSTA 2IXUA 1MVYA 5E1QA 5I3DA 5GPRA 2VRQA 5FKYA 1VBRA 3GDBA 2J25A 2XWDA 2JEQA 5M5DA 1LWHA 3FXYA 1CENA 4Q7NA 3ZJ8A 1C90A 3PZIA 2GJPA 1OBAA 2WC7A 2G3IA 1V0MA 1W9UA 4J3WA 1SYTA 2OYMA 3BCDA 1R87A 3UG4A 1EHAA 3GH5A 1K9DA 2YL6A 3RO8A 1E55A 4BZYA 4MNKA 2DT2A 2VZTA 1HXJA 3WF4A 2PWDA 1GZJA 3PZNA 3NJ3A 1NOFA 1HJVA 4MB1A 2E3ZA 1WDRA 1V6XA 5A6AA 1E6SM 4TUFA 1HJQA 5FL0A 1ZU8A 2XSAA 1PJ9A 2HISA 3ARWA 2TAAA 2J75A 1E4NA 1HJSA 3VKKA 4Q22A 2J7EA 2GFTA 2WMJA 1H2JA 1UG6A 1R7AA 3W53A 1TA3A 4W7WA 1O7DC 3WH9A 3VOCA 3PTKA 5D8ZA 5BCAA 2ZUWA 3LXCA 4CN6A 1UHVA 3WQWA 1DWHM 2Z1KA 4N42A 5A6BA 1H4PA 5ABFB 3WSUA 4HOZA 3DX4A 1JYNA 4H8VA 1CGVA 3BUIA 4JHOA 2WMFA 4PUEA 4DWSB 3RILA 2WC3A 4EK7A 4R27A 3A23A 3WQ6A 3PN8A 3WN6A 2A3BA 4IM4A 3MV11 1OT2A 3ZSSA 4P7LA 3SCSA 5A1AA 4ZFMA 3VPLA 2WVUA 3BVWA 2CYGA 9CGTA 3GM8A 1ZBCA 3BCFA 4A3YA 2BVDA 1EOKA 4GI6A 3K8KA 3DHUA 1QHPA 5BXRA 1UASA 3FNDA 5GNXA 4EE9A 4UCFA 2E8ZA 4HOWA 1W91A 1I75A 4FNUA 3PZOA 4HZ8A 3POHA 4PTMA 4ATDA 1JD9A 4MNJA 5EFFA 1BHGA 4HTYA 1EO7A 2QPUA 2V3FA 1E3XA 1ZBVA 1RP8A 1E43A 3CPUA 1CNVA 4B16A 1W3HA 2CERA 2VZUA 3CUJA 2A3HA 2OLHA 3VINA 4CU6A 1XH2A 3T2QA 1QNQA 3NDZA 3QOKA 1MW3A 1W9VA 1QX1A 2V5CA 3AISA 2VX7A 3U5UA 5I78A 3VSVA 1UWQA 1FHDA 2ZWZA 3BAWA 1LWJA 3BAIA 3DYMA 5AC5A 1J12A 1ZJBA 1JL8A 3NSMA 4WKFA 4PCTA 4PSRA 1J0KA 4JFSA 3L4YA 2Y2WA 1DP0A 2Y8VA 2Y8KA 3AMDA 3SCPA 1OWQA 1KXHA 2YJQA 2JIWA 4YN5A 1E1EA 3ZJ7A 4RE3A 1O7AA 3T0DA 1JAEA 5I2UA 1V0LA 2DH3A 4JCLA 4ACZB 1J0YA 4UFIA 4AD3A 3UESA 1B31A 2WMIA 4W5ZA 3VD5A 4IPNB 1MQPA 1C3FA 1OM0A 1DWIM 3RM4A 3RDKA 2ZX9A 3ARXA 4HP5A 3J7HA 5DF0A 3VGHA 2WKGA 4MAVA 1FOBA 3WDRA 3UERA 1UH2A 5JBFA 1W9XA 4K68A 4FLSA 3N17A 3AIWA 4Z2IA 3AHXA 3PZMA 4UOJA 4PMVA 1GPFA 5I24A 1GVYA 4DO6A 5JUVA 1DWAM 3W29A 3EDJA 3D51A 3II1A 2E9BA 3MU7A 2XFYA 2YBTA 4AXNA 2OSYA 4KGLA 3DYPA 3K1DA 4JFVA 3A47A 5A8OA 1XD1A 3AI0A 6CGTA 2G3MA 5DT7A 1NP0A 3D50A 1BAGA 2G3JA 5A69A 4LXFA 1W1PA 2WYSA 3D4YA 5A2AA 1BG4A 2ZX8A 1H41A 4JZ5A 3WUFA 4DO5A 3EMZA 1NOUA 3OLGA 3BUDA 2JIEA 3DX1A 2WWDA 3SCUA 1UKTA 3CLWA 3WY4A 1IZKA 1Q4NX 4QLLA 1JZ7A 1M53A 4PUDA 4HA4A 3UR7A 1OIMA 3AZTA 7CGTA 3AZRA 4PMZA 4KMQA 2XN0A 1OINA 1WCGA 2YDSA 1PBGA 1MFVA 1GORA 1NQ6A 1F4AA 5AYBA 2FHFA 3M46A 3GH4A 1TMQA 1E6NA 1KCKA 1LG2A 3VDCA 1ISYA 3AXHA 2YLAA 1JYWA 4UZSA 2YA1A 4TTGA 4S3JA 2ZOXA 4NSBA 3PHAA 1XD0A 1E6QM 1UA3A 3SUSA 2ZXBA 2XG9A 2V3DA 4HA3A 3O6AA 1C93A 1HT6A 2ZE0A 1CPUA 1B3VA 4D1IA 2XGIA 3WBAA 1G9HA 3HN3A 1EGZA 4QCEA 4E4PA 3AYSA 2CKRA 2J77A 4J3VA 1PPIA 1VBUA 1JNEA 4UFKA 1B3XA 4LYQA 4U2YA 1XCWA 2J7BA 4MB3A 1CGUA 3TOPA 1J11A 1JNDA 3CZSA 1UD8A 2WVSA 1D2KA 1J0HA 1IT0A 1BYAA 4U5KA 1YHTA 3O2LA 1R8LA 2PWGA 1Q6DA 4BQ2A 4BS0A 3T2OA 1J9YA 4AZCA 3VGDA 5D4YA 2WNWA 3VIPA 3HG5A 3O9NA 3WY3A 4MNMA 4HPHA 3WY1A 1QNRA 2DT1A 1E73M 1V6YA 4UFJA 1HF6A 1EO5A 4LX4A 2W66A 3EDEA 1E6XM 1UR0A 2X0HA 4PSPA 4QLJA 1QPKA 3U7VA 2J7FA 3ZM8A 5KZ6A 2D0FA 4AD0A 3OIHA 2BY3A 3OGSA 4H7VA 4M82A 2PWFA 1MW1A 2YKKA 2WVVB 5A8NA 2A3EA 4AZIA 4NRRA 1OGGA 3W6LA 5A6JA 4UQBA 5FOOA 4M1RA 4CD4A 2XPKA 3A3HA 1AQMA 2Y24A 4YPJA 1UWIA 1UZ4A 2J47A 2V3EA 4AZGA 3GNPA 1UWTA 4HMDA 1SMAA 3RCNA 2WPGA 3VDHA 4D72A 3OZOA 4KWUA 5C8BB 5ECUA 3A5VA 2VNCA 4ACYA 1ZBKA 2IXVA 1KFWA 3UEQA 3DDFA 3WF0A 1C7TA 3VMPA 1HTYA 1UKOA 1UWRA 1UKPA 5D8WA 3U7BA 1UA7A 2EPOA 3RIKA 4AEEA 3PZTA 1WDSA 2Z1SA 3CZGA 1HKJA 1GHSA 3LRLA 4MDPA 1JI2A 1UUQA 1C8YA 4JKKA 3AS3A 4NXKA 3ZMRA 2PBOA 2WMGA 3CUGA 4EKJA 2PWEA 3CHFA 1GOWA 1VFFA 2VZOA 1QVBA 3KL3A 2DSKA 3LPOA 1AMYA 1KQYA 1BVNP 4QAWA 2MANA 2OWWA 2WHLA 4DO4A 3MANA 1TR1A 1EDTA 1MQRA 3DYOA 4ZE4A 3VU2A 1OIFA 1JFHA 2VL4A 1TFVA 1E72M 4MDOA 2WVVA 4AYSA 4OOZA 2EACA 1H09A 1PS3A 1FFQA 1BVZA 3L4VA 2DQXA 1S46A 1X6NA 1L8NA 4H04A 3WH7A 5A8PA 1WPCA 3DX2A 1ITCA 3VO0A 2O9TA 2VZSA 4HZ7A 3GBDA 1PIFA 2EABA 1C7SA 2XVPA 5FL1A 3VIIA 4AW7A 1NWRA 3CC1A 1W2PA 4X9YA 4AYGA 3SCNA 2W62A 2J8FA 3TV8A 3IAPA 4ZXOA 3SIMA 1WZKA 2F7RA 5C71A 2X1IA 3G6LA 4TVCA 1IZJA 4CGTA 2NW0A 3WNMA 3NSNA 4W84A 3CTTA 1NWSA 2FH8A 4U3CA 2WM0A 3CIVA 5CZKA 3WD1A 3ZO9A 1LL7A 1V6WA 3LPFA 5BXPA 1ZJAA 2VCAA 2WHJA 4NZJA 5M17A 3IJ8A 1ISZA 3TTQA 3MUAA 4ZXLA 3ZSTA 1OB0A 4J3UA 1JYVA 1MXDA 1CXLA 3MMDA 1GONA 1Q6CA 1AQ0A 3MI6A 2ZXDA 1FP9A 3AXXA 1A47A 1TA3B 2NT1A 5M03A 2QF8A 3WD0A 2QMKA 4X0NA 3VX1A 2F61A 5IHSA 3WNKA 1X6LA 3FHQA 4AMXA 1EXPA 2DPEA 4HA1A 1TG7A 3B9DA 3WUGA 1E70M 4NZCA 4KRTA 2EPLX 4AIEA 4GO8A 3W38A 4DUXA 2F7OA 1ODUA 3AXIA 3VDBA 1V3KA 3DECA 4PN2A 1B3ZA 4PRWA 5CJ5A 1C92A 4AIUA 4Z2HA 2CIPA 3GH7A 2XYLA 1UQZA 1H11A 1W9BM 4HZ6A 4JKMA 3BUBA 3SEPA 3AS0A 3CZ8A 5FCZA 2GDUA 2F1AA 1V02A 3EMQA 4TXEA 1U2YA 3LRMA 3WUBA 4XB3A 3JUGA 4D6HA 2FGZA 3RJYA 4W89A 4CVUA 3OA5A 2YA0A 1KWGA 2FDMA 1WDQA 4MTVA 4ZENA 3BAYA 1KTBA 1BYBA 3W26A 2OSWA 1ESWA 2JFEX 4W5UA 3AIUA 4YHGA 5KEZA 1SMDA 1JDDA 2WZEA 1GOOA 3CO4A 3T09A 2D24A 2XHYA 5D9MA 3WDIA 5DT5A 3RPMA 3OGVA 2D23A 3SUTA 3TTOA 1JG9A 2W5FA 2VR5A 2FE0A 1JDCA 4WSKA 1EH9A 2WANA 2YA2A 4BQ5A 3H53A 1KB3A 2ZX6A 3GXNA 4TTUA 1R46A 1HL8A 3TA9A 1G94A 4QDMA 3NYDA 4P7OA 3GNRA 3NCOA 4JL2A 3I3EA 3POCA 4WJXA 2EAEA 2WHKA 2EO7A 4F8XA 2OW6A 3LXAA 3N11A 1R33A 1Q6EA 2X05A 2JE8A 1QWUA 4FNSA 2QPSA 1MXGA 3RM9A 1E1FA 1US2A 1E71M 4PMQA 3W25A 3EYPA 2F2HA 3HG4A 1BF2A 3F5KA 2XWEA 1WZMA 1V0NA 4F9JA 2ZICA 3VD3A 1U30A 1HVXA 4OIFA 3D52A 1QI0A 3WQVA 2PI6A 2PBGA 3BAXA 1MQQA 2ZWYA 3KLLA 3AIBA 1J18A 2WMIB 1CIUA 3H54A 3AFBA 2WBKA 4V28A 1JIBA 3HG3A 1UH3A 5I0DA 4D6DA 2YDQA 3LMYA 4GZEA 3BGAA 1J10A 4TVUA 3H55A 3MV01 4GI9A 1FFRA 1K9FA 1W9PA 1UYQA 3MUIA 1GOMA 3CGTA 1DHKA 3QHMA 4W8BA 3M07A 5CLTA 5BRPA 3K4DA 1QNPA 2V5DA 5EMYA 3L4TA 1TE1A 1VFOA 1ZL1A 1CXHA 2WLZA 1JF5A 1CXFA 3VM5A 2EPMX 1GQKA 1M01A 3N12A 3SCRA 5A3HA 3BVTA 2WLYA 3AHTA 1W1TA 4M8UA 2XUCA 3WH6A 1PIGA 2BY1A 2CNCA 4JAWA 1JFXA 2J74A 4E8CA 5ABGA 1VB9A 3N04A 3OLIA 2VCCA 1QW9A 2F7PA 3SUVA 4J28A 2O9RA 5EFDA 3VIHA 2WWCA 3FN9A 5JIPA 2W67A 2OYLA 3CMJA 1E3ZA 2XM2A 5AC4A 4FNTA 1RPKA 1WKYA 3TP4A 3GXTA 4GZIA 1XSJA 3GBEA 3CHDA 3VM7A 4PMUA 3L2LA 1PZ3A 3MO4A 2WAGA 4EAMA 4D6EA 4RL3A 4QFUA 5AYIA 4UFHA 5A8QA 1L0PA 3S2CA 2DH2A 4NRSA 4H8HA 3UCQA 4PMXA 4CD6A 4PTVA 4WKAA 2D0HA 2IGTA 1TQTA 3E1F1 2CEQA 5FD0A 1OD8A 1M04A 3B9EA 1OSEA 4Z2GA 1UKSA 1G01A 3L4UA 1GHRA 3AMCA 5I79A 4OKDA 4DM1A 3AHZA 3CV5A 1C8XA 4IPLA 3D5HA 2DSWA 2BVYA 1GQJA 1XGZA 1V6UA 5ABHA 4BA0A 3ZT7A 1LG1A 2E9MA 1IV8A 4PBGA 1E15A 4HU8A 4CVWA 1EHNA 5E6YA 1B90A 4LYPA 5TD4A 1VEMA 3QGVA 4HMCA 3AHYA 3GZAA 1JD7A 4AZ7A 3IJ9A 1I1XA 3WUEA 2PWHA 3WL1A 2J79A 1FH7A 3WY2A 3AZSA 5C70A 1PX4A 4CN1A 1O6IA 1NARA 3KWXA 3DC0A 3VIMA 5BRQA 3PZUA 5I6SA 2WXDM 3WNPA 4RE4A 5HBFA 2F8QA 2AMGA 1TVNA 1JAKA 3MSGA 3A22A 2UY2A 4GZJA 1Z32X 2VC9A 3LPPA 3A21A 3AOFA 1KBKA 3N15A 1UR1A 2EADA 4PMNA 2GSJA 3IGUA 2YL5A 4W86A 3S5ZA 1MWOA 2G3NA 4AZCB 3W24A 1QW8A 1WNOA 1V3JA 5CXPA 3OG2A 3I3DA 4OBRA 1UR2A 1GNXA 1TUXA 2BHZA 1WE5A 2UY3A 4DWSD 2CESA 1GOKA 3ARSA 1BGAA 3T2PA 4UQ9A 2D20A 1XCXA 3QR3A 2ZX7A 2XFRA 2YIHA 1DTUA 1CYGA 3OLEA 3GYCA 1CDGA 4D6CA 2VX6A 4HPGA 3BVXA 4C7FA 1WO2A 1E4IA 2DSUA 4CD8A 4IUGA 3BVUA 3APGA 4DUVA 4PYSA 3WFZA 1VIWA 4J27A 4JFUA 2IUZA 4XV0A 1K9EA 3WDQA 5A2CA 4M24A 1HNYA 1B3YA 2VX4A 3D3AA 2ZXAA 1UZ1A 4W7UA 4NXSA 2VMFA 4J3TA 4FLQA 4A3HA 8CGTA 1KGWA 4M29A 3VTRA 2E0PA 2Q8XA 4D6IA 3D4ZA 2WCAA 2XSBA 2OWCA 4NI3A 4H8UA 4WF7A 2GK1A 3UETA 1BGGA 3ZIZA 1J0ZA 2D73A 1TQUA 2W61A 2FH6A 2O9OA 2J7CA 3ECQA 1UH4A 1RH9A 1NM9A 4P8WA 4MAZA 2DSZA 4WK9A 4AIOA 1JF6A 1UWUA 1QNSA 3MMWA 3AHVA 2JALA 3ZT6A 4DUWA 1MW0A 2XN2A 1GQLA 3SUWA 3EJUA 1V02E 5ABEA 1X1NA 1CGWA 2EJ1A 1GCYA 3L4XA 2F1BA 2GVYA 1W3JA 4KRUA 1UOKA 2YFOA 3GNOA 3BSGA 1GW1A 1LL4A 2VI0A 1E5JA 2RGMA 1E0XA 3KE0A 3WIJA 3VMNA 2X2HA 1GOIA 3HG2A 1E9LA 4UOQA 2VQTA 2XFFA 3EJTA 2ZIDA 2XM1A 4B3KA 1V3HA 1OGBA 5CGMA 5CLWA 3SCOA 1QHOA 1E6PA 2G4FA 1XC6A 1P6WA 1H0GA 4P8VA 3K8MA 3FAXA 4TX8A 3VD9A 1N82A 1E0VA 3GXIA 4WSJA 3VVGA 3CZLA 5D9NA 3S6TA 3WH8A 6TAAA 2A3CA 1TQSA 1HKKA 4AMWA 5E0CA 2X8RA 1UD6A 3WNLA 1W3KA 4PMDA 5E70A 1JDAA 4NF7A 1UD2A 4WLCA 3EJPA 2BHUA 3A24A 1UKQA 3CZJA 2QV4A 1B2YA 1B1YA 3ARPA 3ARQA 2E4TA 2WW5A 3PZQA 5CPQA 1FHLA 3WL0A 1W1YA 2VRKA 3VD4A 1OGSA 4UQEA 1XV8A 4XZBA 4OUEA 3CUFA 1ISVA 3ZR6A 1TVPA 2EXOA 4LYRA 2ZUSA 2BS9A 3ZR5A 5HPCA 4AD5A 1CXKA 1R86A 3PZVA 3LRKA 4MNLA 1ITXA 2WMKA 1XSKA 3BUQA 1AVAA 3CZKA 3W4RA 3IJ7A 1HX0A 1LJYA 1JXKA 4BQ3A 2C0HA 1QI2A 3ALGA 3VDAA 1UQYA 4S3KA 5AY7A 3ARUA 3PTQA 1NWUA 3VILA 1EQPA 5I77A 3TONA 1OCQA 5CPSA 5D9OA 3EDFA 3L4ZA 4ATWA 1VENA 5E9AA 3AYRA 1QI4A 1V08A 4JCMA 2GJXA 2UWFA 1HWWA 1UD4A 4H41A 3U57A 3NSXA 4CD7A 2BXYA 1CWYA 3ZJ6A 2EPNA 4URIA 1LLOA 3LX9A 4FNPA 1DWFM 3S5YA 2XIBA 2VT0A 3DX3A 5BROA 1BPLB 1E40A 1Q6GA 2JF7A 3AS2A 1R75A 4NX0A 2E9LA 2VTFA 3AICA 1UD3A 5A95A 1K9TA 4W8LA 3TTYA 2ZUNA 3CH9A 4FF5A 2EBNA 4L4OA 5I23A 3VIKA 1KCLA 4WKHA 5CPTA 3WQ4A 1CGXA 3GTNA 2NT0A 3AMGA 4LGXA 1TQVA 3CMGA 2X2IA 3PZ9A 5HNNA 1F4HA 3L2MA 3A4XA 4JHZA 1JXJA 4AY1A 4D6GA 4PEEA 3WD2A 2D2OA 4LQ1A 3KL0A 2XVKA 1HJWA 3EJQA 1HJXA 4NZFA 4JL1A 2V3GA 1MFUA 2D3LA 4CCCA 3WD4A 3CZEA 2XVLA 1H1NA 4WIWA 2CBJA 4B9ZA 4PMYA 3N9KA 4N0RA 2HVMA 4P8UA 3NDYA 4MJ4A 4AZ6A 2OYKA 2GJRA 2DIEA 4CN4A 2XGBA 1H0IA 1KXQA 4UR9A 5CQ1A 3VNYA 4AWEA 4Z2KA 1CECA 5GNYA 3HJEA 3PZGA 2BHYA 3SCVA 1GUVA 3HZ3A 3WDPP 2VOTA 4D1JA 3WKZA 5BXSA 2VUYA 1W3LA 6A3HA 3T0AA 4W8AA 2D0GA 1WDPA 3WELA 4A4AA 3BSHA 2BVTA 5BWFA 3WDJA 4X0VA 3VIOA 4QCFA 3AJ7A 1UD5A 3ARYA 2DT0A 2PF0A 4H2CA 3VGFA 1CEOA 1HVQA 3VUPA 1VEOA 2WMHA 5A6MA 4GO9A 4FNQA 2ZUTA 3SCWA 2VR4A 1XSIA 3MUZ1 1CXEA 3MSDA 3OZPA 2DT3A 4HMEA 3EBVA 1BYCA 3BH4A 3EDKA 4Z2LA 3AMKA 3WQ5A 1WZAA 4F79A 4OJYA 1BFNA 3N13A 3B9AA 3WEOA 2PC8A 2XJ7A 2WKLA 2QMJA 3VIGA 2JEPA 4IISA 3WQ8A 4PMRA 3UG3A 4CCEA 4GINA 3BAJA 3IK2A 4U33A 5EBAA 1BG9A 2FHBA 3VX0A 2DDXA 1WB0A 3ALFA 4UTFA 7A3HA 2D1ZA 4UOZA 2PB1A 3MMUA 3ARTA 3GXDA 3AIEA 2WC4A 3A4AA 1ISXA 1QBBA 2ALWA 4AD1A 1QOXA 1DEDA 4QLKA 3F5JA 1DWJM 5IDIA 3IAQA 4OZOA 1KWKA 1BSIA 4UFLA 2QLYA 3TTSA 1Y7VA 2Y5EA 4MADA 1UWSA 3THDA 1PAMA 4MPKA 2J62A 3PTMA 1LQ0A 4W88A 3F4VA 1HN1A 3BMVA 3UG5A
chains in the Genus database with same CATH superfamily
5T5FA 4WDTA 4Y5VC 5I66B 5HPOA 1I85A 2VMEA 3D4GA 4QPEA 1UM5H 1OWWA 4LQFL 4KK6C 5PTDA 4MQ7B 1P5BA 2NTFA 1OV8A 1RZ8A 4UNIA 5C2XA 1HEHC 4NBXB 5ICXB 3FONA 5H6HA 3FU7B 1UT9A 4L7ZA 5AOZA 4Y9BA 1BEYL 4XP5H 4NB7A 3A13A 1JHTB 4QRSA 2PURA 3OBEA 1UGKA 1ONWA 1JCJA 2A74B 4M02A 2Z7WA 4NFDA 4G2AA 4YSDA 3QQ4A 4HVXA 4P61A 1QLFA 5T3ZH 3ULVC 4GAAA 4S3BA 1HKIA 2H6PA 1X7FA 5TFSH 4U6YB 4PV8A 2NW2B 4MMXC 1OC6A 3C09B 4QHNA 1UACH 2F1EA 1MCKA 1W8NA 4HIHA 1M05B 3B40A 2DUZA 1HP5A 2VSMB 2VDKL 5H37H 1KN4H 4MZ2A 4CMHC 2C1GA 5I1DB 2HPOA 5I6KA 1NAMB 4AVJA 4EO5A 2ZOLB 4R2GC 3V5HA 3QULB 2EEXA 3CUHA 1TQBB 5ALBH 4DP7X 1M03A 1U8LB 5JDSA 5FA5A 1R3LA 3CFJB 2CO4A 3OZLA 4MG4A 2NDFA 4YWSA 1RI8A 3C9NB 4YOKA 4KK9C 1SFSA 2C1OB 3BSZA 2QELA 3LCYA 5EV7A 1B2WL 3QIWD 3ONCA 2XWXA 4JQ3A 4JDEB 4YDLB 4M81A 1SJDA 2YEZB 3QPXL 3VJ6B 5AVVB 4DT2A 4HB7A 3MJ7B 1QA9B 4RSVA 1DUYA 1E5NA 5AG9A 1QVOA 3TEXA 3D30A 4FQXA 4DKAA 2X6CA 4R7LA 3S96A 2Q76A 3PFUA 4Y16A 4S1QL 1FVEB 3OAZK 1W15A 2AOSA 3NIDB 4P7NA 4P2AA 3T0WA 5G1MA 4D7PA 5CSBA 2W1NA 1KYOJ 5CP3A 4PJCF 3A9BA 4K5NA 4GRLC 3TESA 4J40A 4L8DB 2L7EA 5I1EL 6PCYA 2IF7A 1A49A 3MN8A 4HJGA 4AVNA 3U6WA 3BWWA 3LEYL 4EPDC 1U4EA 1AE6H 3WIFB 1TYJA 4JREC 2L7JA 2O9PA 1KEGL 3DIFB 3EWCA 5J1SC 4WKZA 1BKHA 5CAHA 5GS1B 3U25A 4FL4B 4BFKA 5FFLA 3DOPA 2Z2UA 2C9XA 4XBJA 2FQEA 2WCGA 2PYEA 1SZEA 2VD9A 4DHLA 3PGCB 4IFRA 5F88A 4O52A 4HJJH 2EVJA 1FZOB 1XH0A 3N41F 2FATL 3BVNA 3RCYA 4RBPK 5IQ7H 2NSXA 3IDUA 2DQUH 3KVJA 4ABWA 2EPHA 3QXAB 2DEWX 2XDFA 5I5RA 2ADAA 4BK5C 1WBXA 1TWSA 1MFMA 1JOIA 1JZ5A 2FJGB 3MTRA 4YYCA 5DEZA 5BOOA 5BS0A 1GJIA 1KIPA 5IW6B 4IFOA 3TYDA 1J5TA 5HMEA 3QCVH 1KBBA 4F5CA 1RIHL 2VUNA 3TU9A 3ARGC 2VERA 3ZE0F 4PR5B 2BY2A 2VN3A 2XZAL 4IBSA 3EYVB 5D2NE 4TQEL 5C09D 4A3QA 4KTEH 5ICUA 3CN1A 3P9WB 4QCIA 4GFXA 3DBSA 1AQDB 3QUZB 3RI5K 3ZR4A 4QNPF 4W9JC 3SYCA 2I1OA 3APYA 4KKBC 4YPGB 1JNLL 3O8AA 1PZ1A 1MI5D 1JZJA 3DX7A 3LZRA 3VGEA 4RA3A 4K94L 4V2BA 2CDFB 5GPRA 1N8IA 1MJUL 2B7DT 4S2CA 3B05A 1F58H 4TXVB 3TASA 1QBLH 5J04A 1JVNA 3SFKA 3F7LA 4JN2B 2BIHA 5J6SA 5HPMB 3LA4A 3WKMH 1F3JB 2YGVA 2D7QA 2YEVB 1IM9D 1RJZB 4JDVB 4ELKB 4OUUA 3SHSA 3T42A 3RQ3A 1C08A 3KBPA 2AQOA 3TR9A 4JHUA 3KGUA 2HRGA 5BV7B 3QIUA 3PP3K 5I71C 4M93B 5TK2A 5LXGH 3ABMB 4HIEB 1Z9AA 2C91A 1A0DA 5FM4A 2ZYSA 2FYYB 2QKIA 1QSEE 4JANB 3W53A 3QHTC 4PM1A 1QD0A 4CN6A 2C1IA 1AGFB 1G7QA 1P53A 4TSBH 2EDKA 1LM8V 3PS7A 1TIMA 5JPMC 4X8XA 4MNQA 4D0BA 3RR1A 1WAAA 3LEXA 1ZLSH 4DZ8B 5AAWA 2VOMA 4AJ0A 5CLYA 4O17A 4OSUL 3GM8A 4KRLB 4GLRH 2QAFA 2E3VA 3KBSA 5DLML 3TPKA 1U8JA 2XY1A 3WIHL 2QL1A 4A6GA 3TCSA 1W91A 1WV2A 4XX5A 4ATDA 4LGPB 4JTDA 3MWCA 2Q5BA 1CNVA 3CPUA 5E23A 4I18B 1OSZA 1DE5A 1IBGH 3GHEL 5AOKA 1TV4A 2B39A 5KVGE 5KANI 4DJDA 4LEOA 5JTWA 4HD5A 3TEUA 2CRMA 5E1AB 1UWQA 2Q7YB 5IM7B 1A7PH 3FB6B 3BAIA 5I1JL 4KNUA 4F7EA 4ODTH 4Y4KB 4JFSA 4RMTA 1KXVC 3MWAA 3AYTA 3KAOA 1KXHA 5B1JC 1X96A 3I9PA 2DH3A 2IQDA 3EWBX 3FOKA 3FL7A 1OCWH 1T03L 4H5SB 1MLBB 5GGVY 2FZ9A 3DO7B 5M1TA 1GEQA 1F2JA 4HS3B 1CICA 1YYLH 4JQIL 4ZTEA 3Q8BA 1FPTH 4D8ZA 4MX7A 4QLWA 4FXTA 2OMWB 5CO1A 1GYVA 4XAKD 3UAJA 3D07A 3CFEA 3JWNH 1UH2A 1QATA 3AIWA 4XPAH 3RFAA 2W80C 1UXWA 5I24A 4ZUUB 2BVPB 1XXXA 3WO8A 2H5UA 5DJ2B 4YXKH 1XD1A 3RWIB 1NP0A 2EYTB 4KKPA 2QCGA 2NXYB 4MY9A 2NZIA 3O3BA 3CU1A 4HYWA 1GYNA 4DEPB 3FH8A 1FYTE 4PUDA 4I48B 4LUYA 4PJFB 3AZTA 5IT2L 5A3IC 1IQDB 4JLRA 5BMXA 1UUMA 2JB6B 1JPGA 4PRBB 1NFDF 4PRHA 1JWMB 3GS6A 1J8HE 2GGIA 3PANA 3QUYA 4DZBA 2YD8A 2VSCA 5CIPB 3WBAA 3HS0C 4ECLA 3HNSH 3M44A 4IP7A 1VBUA 5AVZB 3RTQB 1W1B1 4U2YA 1F8MA 3TOPA 2ITCB 4M19A 3I6TA 2DYPB 1OP4A 1D2KA 1BYAA 3P81A 4LMQI 2WWKO 3PP3H 1YHTA 3C2FA 4ABVA 5CD5C 4HS6A 2WBWB 5F93C 5F9JA 4QRPA 1SVBA 3IE4A 3QNYB 1J1XH 2B1HL 2PCFB 5IEHA 4YHNA 1CC3A 4YS1A 2DL2A 1SEQL 1XVSA 4Z3GA 3RYMA 4D2JA 4J4PD 1AXSA 2J7FA 4DJED 5KZ6A 4UBPC 1IYXA 2IG2H 3OGSA 4O2EA 1NCNA 4JDYA 2F58H 1K2DB 3FXIC 3NGJA 5GZOD 1FO0H 3BHBB 2QQNL 5AOLA 1I4FA 3A3HA 2ACQA 3MV8E 3HHSB 2V3EA 1J1PL 3WQGA 3WXWH 1PSCA 4KO5A 4AX7A 3S8HA 3OZOA 3FU5A 4KWUA 3A5VA 4WJ8A 2ZRWA 5DTFB 1TG8A 4HSHA 3S0PA 4YN3A 3N1QC 3WF0A 1GAFH 3LH2L 2WWMD 4ISVA 4B97A 3US0A 4G9FE 1WBHA 3D4CA 1Z5YD 1ZAGA 1GHSA 4Z7WA 5K4XA 4EPEC 4ZPVA 2NUPB 3ALWA 4PJDB 3E6HA 1XBRA 4LLQB 2OZ4A 3PV6B 5KS9F 5A16B 4DO4A 1TR1A 4XO8A 3I6GB 1L6GA 2WVVA 4J3OF 1GT8A 3SD5A 1PS3A 5AW9B 5AW5B 2CO6B 4KTGA 2P0IA 3PWNB 1XCQB 3VO0A 3GMOA 4AW7A 1W0WB 4Y5XC 2DLHA 2CZEA 3QJVB 3KG5A 4QRUA 1WZKA 1N2RA 1UB5B 3MXWL 2WO5A 3T8XA 2EDJA 2IXQA 32C2A 2VCAA 5HYJB 2G60L 5DBUA 5I73C 4YMPA 2PLJA 1OB0A 3SOBH 1RUML 3IJSB 3AGWA 2ZXDA 4FA3A 4HWNA 4Z1YA 3HRZB 1CK0L 3SGDI 4N85A 2IDSA 3QXDB 4PQXA 3VYPA 1OFDA 3GEFA 1M7IB 3UPCA 4AIEA 4GO8A 1KT2A 3RWCB 3BOFA 1RK6A 3JWNC 4NKMA 5HGHB 4I0CC 1GKRA 3BUBA 2DWYA 1L9OA 3UR5A 4L1WA 3PABA 1TZHB 5LNWA 1D7DA 4GG8B 1U2YA 1UM4L 2WQRA 3DX9A 2V5TA 3PQYD 4ZFZB 3HMXA 4KX8A 5KN5B 2P1FA 1UUNA 8RUCA 2JFEX 4M62L 4YLQT 3CPRA 1OKEA 3U6RB 1G9ML 2AAVA 1V54B 2R27A 4MMZA 1EH9A 4KVNL 3DPBB 3H53A 4GS7C 4KHTH 4ZFQA 3LENA 5AAPA 2ADIB 2B7PA 4L1TA 4KO6A 5I03A 2VWSA 5DD6A 2IDQA 1E6OL 4AH2B 2QPDB 5HUPA 2BLEA 3BZJA 4GAJH 5KJRL 3MTWA 1DVYA 1A9VA 4N2EA 1QDSA 4H3DA 5DRZB 2O7QA 3TK7A 4U6HB 1OTTC 4PGEB 4M7ZB 4X4ZA 2GOUA 4GNVA 3O0KA 1CIUA 2WXQA 4GKOA 3GIPA 4OLVL 1J10A 3QWNA 3B0PA 3X1BA 4NQCB 3QHMA 5DJXA 4QXTB 5LBGA 2E68A 3ARFC 3MA9L 4HH9A 5JVLA 4LHUB 3WS6A 1PAZA 5DT1H 1JF1B 2G5BB 3UPRA 5CKSA 3CHRA 3FT3B 4FD0A 2Z28A 1BDYA 4JPWH 1KELH 1TR7A 1IU1A 4GRWH 5HDBB 4O12A 3N04A 3RDJA 3S4SA 1E3ZA 4MNGB 2XWBB 4FR1A 5AYIA 2NY5H 4UFHA 3Q3GA 1HI6A 4DYKA 4Z23A 4NJKA 1T1WB 2IWGA 3GSVB 2WLNA 2BHFA 5C0FA 1UKSA 2NR6C 3IF1A 1LLZA 1OM9A 1TZGL 4P0DA 2DSWA 2UZYA 2JK2A 4ELMF 1FGVH 1YEFL 5G4NA 4PBGA 5KYUB 1N64H 3GZAA 5M7QA 4CVXA 2D7TL 3MJ8B 1Q94A 4DKEL 4V11A 2CZDA 2Q71A 1V8EA 1S9XB 2WXDM 2LU5A 5JPNB 1NF7A 4BR1A 4HPOH 3A22A 3W76A 3W7RA 3PGFH 5F3FA 1P0NA 2BNQE 2Q20A 3UJTH 1OF2B 2CKBA 3BQUB 4PJGE 2XPGB 1N6UA 4TO8A 2FJKA 1D5MA 1ZOXA 3FMGL 1QOPA 3T07A 4YSRA 2BHZA 4F9PC 1SUXA 4ZFGH 1Y5XA 3JWDH 5SWZE 2R69H 2CESA 3ARSA 4EIVA 1A21A 2NY3B 3QR3A 3F84A 3P30H 4JR9H 2YBVA 2GTWA 4JY4B 3C2OA 4O10A 2OLSA 4IKKA 4PYSA 3BWSA 2X1PA 4MCYA 4J27A 2QAPA 5CSZB 5J1AB 1UP2A 3WDQA 4H6QA 4MJMA 1VFBA 4FLQA 2WQAA 8CGTA 4ZUVA 4ZMAT 3LBOA 3IIVA 3VXOA 1O1HA 1FJ1A 1KB9K 1OARL 4XZIA 3H3KA 4F8LA 3R4RA 1I0DA 1XF2A 3RLGA 4JYFA 4MAZA 4A21A 5DJ8A 1WFTA 4AIOA 1JF6A 1G7PB 2XN2A 1KB5L 3JT2A 4AJWA 4FZ8H 4CADB 1VGEH 5IOKA 3ARBB 4KRUA 2JKEA 5C54A 1OCJA 1YTKA 2RGMA 3P74A 3BJ91 2CLMA 4IGBC 4Z1DA 2BP8A 2UXGA 4Y9NA 2QZ5A 3K6NA 1RULL 2V7NB 4BFOA 4LF1A 2ZPKH 4AU0A 4DQOH 4WGHA 5CGMA 1WZ1H 3VD9A 4KT2A 3GXIA 4GH7B 5EU6A 5D9NA 5LGHL 1TQSA 3S46A 2P24B 3KBVA 1E4XL 1OAQL 5DQ9B 3O9WB 1IGIL 3HM7A 3EPOA 4Z18A 3IDNB 1TRIA 1FKWA 2J6EH 2DQJH 1BZOA 3T71A 3IARA 5B21A 1WEJL 4MNLA 3ZLQC 1GS6X 4KKXA 4PGZA 1NCDH 2BO0A 4KUCF 2PMQA 3VDAA 1OCOB 2QGYA 2PA6A 1KBLA 1O5PA 3VILA 1NIBA 3E38A 4ZTYA 1A6WH 1T96A 1UCBH 4FP8H 2CO2A 3NCWA 4ODHL 3QMSA 4YSPA 3P3SA 3VXTA 3U57A 2PR4H 1E27A 1AFVH 1G7JA 3ULUH 2WJ5A 1R75A 4NX0A 2ZUNA 4L4MA 1NICA 2V82A 4L48A 1YY9D 2GC7C 1IBFA 4L4OA 4K38A 1KCLA 3LQZB 3Q44A 2HVBA 3ZIMA 4B9FA 4DGVL 4CNTA 3MACL 4DVOA 1JXJA 5BOEA 1UVQA 5G4HC 5D96C 5I74C 2OMTB 3WD4A 1A7OL 5DD3H 3W07A 2HVMA 1SYSA 4MJ4A 2XQYG 1BKSA 1E8YA 1D6VL 4ZFFA 4AWEA 5GNYA 2GJNA 1V7NL 5KVDE 2HLEB 5JOFA 1JHLL 2UY6B 4ZCWA 3KHQA 2H9GA 1X7TA 5KAQG 4FYTA 1CDYA 5KW9L 5BWFA 1QJWA 5J7CC 4QCFA 3P4NA 4WY0B 3RVWD 2ZXEB 1E9PB 3BKMH 3WK2A 5J6GB 1MRDH 4H2CA 1GGIL 1YEDA 4IBYA 1MY5A 2DT3A 3VFWB 3G9AB 4LVNC 3AMKA 3N4FA 2CRIA 5GS0D 3WQFA 4OJYA 1FLRL 5BMFH 3VK5A 4P23C 2P1YA 3CU2A 3JWDC 3GUGA 1KYFA 1Z9NA 4UTTA 5MKGA 1N10A 4OHQA 3BAJA 1WSST 4GIOA 4PBDA 1RUPH 3QXWA 4PGJA 3MMUA 2F53B 2PETA 2GSGB 2AQWA 3UTTB 4M00A 4OD2B 4AD1A 4QLKA 4NLHA 1KWKA 3ZMEA 2QCLA 4R9OA 3CN3A 5JW4Q 5HAOA 1DUZB 5HHNA 3KNBB 3KX6A 1CE6A 3VFTA 5H8MA 3CB8A 3WHXB 1JPTL 2C71A 2K7QA 4Q8BA 3QHNA 3ZYZA 3UZVB 4N0UB 1TV7A 1JMXA 9XIAA 2PUZA 4JGDA 1PZ5A 2J7LA 1OF6A 2O5NA 3IFOB 2B4GA 1TSIA 3WLWC 4N2NA 4TNVK 4MSWA 1QNOA 2FNWA 4GYKA 2CBUA 4RNFA 1Q6QA 3TMLA 5FF4A 1F00I 1ZVYA 4ATLA 5HYJD 3IV3A 5JA8B 1TETH 4P57B 1OPGH 4L9LB 1ZXQA 4KGJA 4ZW8A 5I16B 2ZAIA 2OW7A 3MJMA 1T83A 2OFQA 4X4YB 4NAEB 1MFCL 5F0JB 3MUGA 3TVMD 4YR6A 1NC2B 1NGYA 1XMEB 5D2XA 1G7LA 4UMCA 5IK3B 1FBIL 2AJYL 2X1OA 1MI5E 3EOLA 4O1AA 3I6KB 3QC3A 1SFHA 3GTTA 1N8FA 4FQQA 1XL6A 3T1FA 1G84A 4Y7EA 3HMCA 1M2VA 3NZHL 3BAEL 3K72A 3TN5A 1BVOA 2BRQA 4TQ8A 1CYWA 4RISH 1I9IH 3VH8B 4IIDA 4R4FL 1PY9A 4R3SB 3QDGB 3CV7A 1TVHA 4JDTL 2V9QA 4MNHB 5I1CH 3NQDA 3G1HA 4ZA0A 4Y4FA 3VI3A 4BA8A 2VC2H 4OVUA 2F8XC 3NPSB 3DJRA 3W1NA 5E5LA 1L7IH 5EBWA 4ZRGA 3ULUC 3A67H 5HGAA 2J4GA 3DV6B 1DSFH 5FOBB 4UT6H 3EFOB 2O6CA 4PUMA 5DMMA 4G5DA 3VIJA 3H70A 2YB1A 4G5AA 4B96A 5L4IA 1PWLA 3GKFA 1N7ML 2D3VA 3IJHB 1AG1O 4KVCH 3W0WD 3KEHA 4OTXH 3DTDA 2E7CA 4HJIA 2VABB 3VYNA 4UF7C 4EIBA 2OVLA 3MGTA 1CMOA 7ODCA 2AXWA 5HYEA 4NQCD 4L5FH 3RWJA 3FUMA 2WBJD 4R9HA 4EN3B 3ZOAA 2E1DA 3IV8A 3AWGA 4IF2A 1ONEA 3N25A 3QTPA 3KGTA 3TLLA 1XLDA 4IRZL 2WUCL 1KJ3H 1S2VA 2GK0B 2CBVA 4NUJA 4EI6A 4E3VA 4JIPA 1RUQL 2IQ0A 4U6TA 1BYPA 1RHHA 1SDYA 1R7OA 1PX3A 5AZEL 1E8XA 1LK3H 3VNZA 3WQPA 3IE9A 4RNHA 4OGZA 5I8CA 1BVWA 1WCBB 3DSFL 5DS1A 4AG4H 3P4OA 2YOCA 3CEPA 1U8MA 4A7UA 5CG0A 4A6YL 4IOIB 3MYJB 1JSYA 3HC4L 1WS8A 4J8RA 5C0DA 3RX8A 1BJ1H 1ODZA 2FLMA 4FULA 1A14H 1M3UA 1OL0A 1OCCB 2EE9A 3P8JA 5FYKU 1AHWC 4R5EA 5ESAB 2Z1VA 3ZE2F 3Q6GH 8A3HA 4A2MA 4XAKE 3WNJA 3EOBB 4MAUH 4JFHE 3VGBA 4IGMA 5AD0B 4W9CC 4L65A 4ZMQA 3LNMA 3ELQA 1B0RB 3ARZA 1FVCB 4TSCL 1E56A 4DWSC 1H7XA 1HHJA 4YU1A 4G7RB 2CBMA 1MLCB 1S9VA 3M0JA 4GKNA 2ZOKA 2Q6ZA 2NY3D 2VDPL 4PPTA 3N2CA 3DBPA 1KMGA 2IADA 3WUZA 1OQXA 2P3ZA 1W32A 3WXVH 3FY1A 3BLKA 4NFCA 3QO0A 4LRNL 3QEGH 1PZBA 4IMFA 4HMNA 1AZUA 5GJSL 4GNJA 3ENLA 4WUUB 1DIOA 4B3LA 1KFAH 4PB0H 3ILQC 2Z31B 4H0IA 4WFEE 4JKLA 5I15H 1A6TA 4HQVA 4TRPL 1ZAHA 1YEIL 1NGWB 1K5NB 4FFWC 2NY1D 4PRID 2H1XA 3MTXA 2I27N 2BVOB 4ZBJA 3GDBA 4HWZB 3FU6A 3A3WA 3IUDA 3ITTA 3BEWA 3ZDYE 1HZLA 2OYMA 4OZGF 2DIKA 3UGVA 1LLAA 2XG5B 5FGBA 4I0PA 3VCRA 5FF6A 2A2QT 2GGGA 5FM8A 2VZTA 3BQVA 4NNBA 2J13A 4EMZA 4A3UA 4YDIL 5EMLA 3M8OL 3U9IA 2TAAA 4PTUB 3FOLB 3F62A 4CBZA 4LVBA 5MHBA 4DY1A 2BVQA 3VXQB 5E9NA 4Z3IA 3PTKA 3SRHA 5HJBA 1A9BA 4Q4EA 1EZVY 3UTQA 3SO5A 2QZQA 4B9GA 5GZNA 4CNSA 3ZK0A 2WAHA 2QV2A 4TNFA 1Q1JH 3QZWB 5A1AA 4O00A 2ZQ0A 2EP6A 4IBUA 3FEQA 4WUKH 3TBTA 1DSWA 3UP8A 1P4LB 3STBA 4Q4IA 1YXDA 5J12C 3WJXA 4EE9A 3V7PA 4X5WB 4PTMA 4C6BA 3W7IA 4JTGA 4F7CB 3FB8B 1GCFA 4R96A 3V6OE 1J5SA 5IR1A 1I1AD 4J2QA 3O3DA 3O41A 1XH2A 1M9HA 1MW3A 3WBYA 1DBKH 5AFDA 3FFCE 2OTWB 4EVNA 4K8RH 5TF1H 2CRZA 2IQAB 1OLZA 3DXAD 5D32A 3F2DA 1QLEL 1JL8A 4A2HA 4XWOD 1UADC 1ACZA 3OMZA 4BZ2H 2Y8VA 5EC1A 2J9ZA 2YJQA 3AW5A 2ERJC 2MWCA 5FECB 4ACPA 4MGGA 3GSQA 1H5BB 1J0YA 1UP0A 4FTVE 3LZLA 1OTUC 2AABL 3BZ4B 4W5ZA 5CPNA 5I5MA 2J6WA 5DCBA 1LOQA 1JPIA 4XMZA 5CCZA 1ETB1 6XIMA 4LNRB 4MAVA 3RUGF 2EDHA 2Q01A 3UERA 5T33H 4Y8AA 4U1KA 1C16B 3AHXA 5ID0B 3RVUC 4C5YA 5HNTA 2EC9T 1DCLA 2YD0A 3N0PB 4K7PH 3AXLA 2Y1HA 1DVXA 3PQYE 3K1DA 6CGTA 1IEXA 3LN3A 4YBQC 3WJLC 5C0EB 3IT8D 2QQQA 5BO1L 4OUOA 3OKNB 4GVIA 4JZNA 4NQEA 3TN0C 2XFXA 3QQXA 1EFXB 1GORA 3UTTD 5LUMA 2OXHB 1NQ6A 3DHJA 1OCBA 1ISYA 4TTGA 4HLZG 5H8PA 3JTTB 4TSAL 1NEZA 3QYQA 3SUSA 3MYZA 3QFGA 2A99A 1A4KA 1FRGH 5LAXB 1XYAA 2NX5B 1HT6A 5AYZA 4XCFL 3QEQE 5CEZH 3Q4DA 3PBWA 4MLIA 4ZSOB 1QNZL 2VLJA 5CZXD 4OV5A 1S7WA 4RFOH 2FWOB 2VFIA 1JNDA 3CZSA 2XTJC 1MSPA 4LMQE 4U5KA 3VXRE 2OO6A 4FR6A 1EPVA 1VPOH 4JHAH 4PJAA 3B8IA 4BS0A 5C0BA 1ADQA 2LU3A 1AR1C 2W88A 1BZQK 1ZHAA 4WHDA 1QNRA 2WGNB 3V6OA 4K3DH 4JTSA 4GQ9L 2DT1A 5FUOL 3F2CA 1E6XM 4NWTL 4ENLA 1NC2D 1AODA 4KUZH 3SPVA 4EZMA 1KLGA 4AMKL 1DBJL 4AEHL 1SUHA 3GMQA 2XACC 1J2BA 5DJ6A 4US5D 4WEEA 4LCCA 2PDQA 2AJUL 4RMUA 1N18A 4YNYB 3ULVH 4M1RA 4UWMA 2Y24A 3FFDA 2X88A 4M1BA 5L4FA 3EH3B 1EWEA 1JTOA 1H7WA 4EOUA 4KDWA 2XRAL 5C0JA 1U1UA 3QDGD 4WDWA 3PF2A 3VMPA 2WNZA 4IRSA 1HTYA 1F3TA 2W6RA 5CR8A 2W9DH 4PRDB 2OMYA 5HI5C 2P76A 3PZTA 3BIBX 3DH7A 4HLJA 1JI2A 2PBOA 2BC4B 3CHFA 3HS8A 1GOWA 2PDUA 3C3NA 2P5ED 4XNXL 4GBXD 4QAWA 1JGVH 4YDMA 2DQHL 1R24A 1OIFA 4IJ3B 4JX4A 4GW5B 2P42B 2X4RB 2YSTA 2H3NB 4JRYD 2POTA 1T4KA 2O7SA 3U9UA 1ZANH 5C9JB 3MV9E 5C2CA 1FFQA 2DQXA 3QHZH 5A8PA 4HZ7A 4C6QA 4X2PA 4X9YA 4K8RC 4F33B 2F7RA 4I3SH 4CGTA 4IU3B 2UXTA 4LLVA 1FG2B 1WBZA 1VFSA 3I6LE 1SDDA 2FH8A 1N9PA 3W23A 2V6AA 2QW5A 5A43C 3PUOA 2NY2C 3FYOA 3MUAA 1A6VH 1WITA 1FP9A 4AYDC 4RSYA 3U1SH 4NBZB 4HSAC 2KLTA 4HA1A 3UH8A 2NWSA 3UZ5A 1ZCCA 4GXFA 4PJHE 1GC1L 3R7RA 4PJ5A 1AH1A 2Z24A 3E49A 1B3ZA 3VXRA 3KVPA 4UC5A 2ICEA 4OF6A 3X1GA 4IBWA 2WB7A 2DI8A 4X6CA 5G4OA 5IMKA 3L12A 4XB3A 1YPZB 1KCSL 2O56A 4H4NA 1TTUA 1YEGH 4I5BA 1N8ZA 1WDQA 4HC1H 3FQTA 3MSYA 5D9MA 4G7YH 1DIDA 3WDIA 1VFHA 4KC3B 2N1KA 1AYRA 4MKVA 2GUOB 1F86A 5DJCA 5F7EL 5CBEA 1XBYA 5I1IL 3IS1X 5MI0B 3ZL4H 4DK5A 4O2FA 3KLAB 4RNIA 4FC3E 3DOHA 3KFTA 4PJIF 3GMRB 4PJ9A 4QDMA 1EEXA 4MOZA 4W6YB 1BQHA 2RCSH 2EIBA 4NO2A 4XR8C 1Q6RA 2IQTA 2VFGA 5C0CB 4P9ML 2CLZB 3VD3A 2C16A 1BM3H 4F2MA 3MJ9H 2ZWYA 3PWPA 4WI4A 4DW2H 1EP3A 3AFBA 2ZTJA 3H54A 1E5AA 4Z0BH 4QJ1A 5HJDA 4FKKA 3MV7A 1G7HA 4MAYB 3KPQB 3DJSA 5CLTA 4E4UA 5SWSB 4P2CG 4X6EA 1ZL1A 1HH9A 5AL0A 3APNA 5AZUA 1W1TA 2VXNA 1G9NC 4NN6B 3GSOA 3LZFL 2BX7A 2JKLA 4WW2F 2CLHA 3C2RA 4E8CA 3D3VD 2VAAA 3W7NA 3MRCA 4X9FA 3VIHA 3BFOA 4K23L 4QHKI 1T0NB 4PJ8D 3GRWH 3FCUB 4UNVA 1L3WA 3S2CA 1FHGA 2GL5A 2XWTB 2W9EL 1EXGA 2VDLH 2XZQH 2CZVA 3B9EA 1P7KA 1BBJA 4RRPG 1SO6A 4J3ZA 1R3JB 2E9MA 3L5AA 1IV8A 4KW2A 2OXNA 5E6YA 4HWBH 4DN3L 1GGOA 2JELH 2QT3A 4PJHA 4EDWL 3G8EA 1A8JH 2GITB 2PO6B 5C08D 2CDEA 5JW3L 3SPIA 3LB0A 5HDQH 5BRQA 4XIMA 2J1ZA 3FKKA 4DELA 3PWJB 2PN5A 3KZPA 3GSWA 4G8GA 2MNUA 1WFUA 2B9AA 2VQ1B 1UJ3A 3HGRA 3S5ZA 3T4AC 2FR4A 1PYWB 1S7SB 1A5CA 2O1AA 3GNMH 1XGUA 4WSHA 1IKNC 1WE5A 4JJHA 1JRHI 1T40A 4Z7IA 1J05B 1CYGA 1T20B 4HPGA 4QAIA 3O3RA 5AAMA 2YD9A 4H8QA 1DJXA 4OV9A 5AW7B 2FD6L 3WEAA 4OU3A 3V52L 3D3AA 4P9HH 4NQUA 2VMFA 4BZ1L 1XC4A 1GZ1A 2Y6SD 2YAEA 4WF7A 3RZWA 2GK1A 5TDNB 3OC8A 2XXMB 3TH4T 5KSBF 4OZIE 3PDOB 3N5AA 3OHXA 5J13B 1H3WM 1EANA 5D1ZA 3CU7A 1V55B 4FI7A 4YHKL 1QMUA 2X70A 2D4FA 1OD7A 4IG2A 3VQ1C 4ZXBB 4AK2A 3KLHD 3A0OA 1R3KA 4GJTB 3FN0H 5G1YA 3CDZB 1JUFA 4X8CA 4KKQA 3B9KA 2I5QA 5HYJE 4JG5A 1DVFD 5AVQB 2OMBA 3R0NA 2DRUA 3MU3A 1BGXL 2ITDB 4UOQA 3L7RA 1R2RA 4XIAA 4OY9A 5TAOA 5SX5K 3MZ2A 3SGGA 3BH8A 4OD1H 4B0MM 3SCOA 2XXCB 3QEUA 3M1CA 4GSRA 2ACSA 4TX8A 3B37A 2B4CL 1UATA 1KTLB 4ZOEA 2CJTA 2CUHA 5DO2D 3VXUB 4J2XA 1QT1A 5D33A 4ZOCA 3CZJA 1B2YA 4IBTA 3U0WH 5FWQA 4Y9FA 3IVSA 3NQFA 1E9QA 3BP7A 4AITA 2E46A 3ZR6A 2FGWH 1KJMB 1N0LB 5DHYB 4LYRA 4P2OC 3ZR5A 5HPCA 3FTSA 3AACA 5B38A 3X1EA 4X0KA 3T3MB 4HIIB 3CZKA 3CHOA 4TYUA 3GUTB 3EGSB 3LM7A 4MJHA 4MKNA 1ZLWK 1EGJL 3H56A 4JGJA 2CUIA 2W3ZA 2N0KA 3O4LB 4AAJA 2O5XL 4X98A 1XIWC 2CMRL 3QGAC 2F9BT 4L23A 2Y2YA 1QI4A 3CTLA 3MUUA 3AYVA 3NSXA 1KPVA 2BXYA 1NCAH 5H35B 1YIXA 2H8PB 2AV7A 3H9HB 2OJPA 3HB9A 4C60A 4XNMB 4GYFA 2NX5D 3AAMA 2IPJA 1JULA 3G08A 4YSTA 3E3HA 1UWGL 2R7EB 3CZFA 3W0WE 5HNNA 1F4HA 5D6CB 2ZRZA 1A6UL 4JY5H 2EE2A 4AY1A 3VFRA 1CZ8L 4U1GC 5AW3B 3H2EA 2B08A 3V10A 4N0RA 3MLRL 1OG6A 5EU5A 3BPCA 3CN2A 4LUIA 4WO4C 3N1PC 1P0KA 1M1XB 3GKAA 5HDBE 1MFAH 3AAZB 4LLMB 4C6KA 3DENA 1GUVA 4OGQC 2NPLX 5IHLB 1RUKH 1Q0YH 3K0WA 1HS6A 3NQEA 2DT0A 3A6CH 2ZUQB 4LT7A 4J9JA 5F6HI 4FNQA 25C8L 3MX0A 4Y2DD 2DWDB 3S9DB 2APTA 5LHEA 4IQDA 4EVZA 1K8CA 3S47A 1YRKA 4YHIA 4H83A 4EE2A 1BFNA 4NN5B 3B3DA 3S1WA 3NJJA 4EZKA 3PBUA 3TYFA 2VLRD 1KBIA 4EI5A 1U3JA 3U7YH 4U33A 4AEOA 5KBLA 1LBFA 2NQDA 1WB0A 1PZ0A 2PAJA 4UOZA 1LQ2A 5KSAB 3SQSA 3OAZH 3IDGB 4O51A 2NXGA 2W0UA 1TVBB 5HNUA 1MH5A 4CBPA 3O8XB 3OGOE 5L0QC 3AVEA 4P9HC 1EAQA 3D87B 2KHAA 4HISA 1W80A 4WI2A 4ZZFA 3UY7A 1PAMA 5CGBA 3G3LA 1NC4D 1DJWA 1QAWA 3BGFB 4S23A 5SX5H 1PL3A 3H8AA 3GGWB 3GSRB 1OJXA 3CN0A 4LT9A 1YY8B 1Q90A 2E47A 1X9RA 4HUXA 3FUNA 2JIXD 2BP1A 2YL8A 2YDAA 4UU9B 1PTDA 4I1RA 2OL3H 3B4UA 3SQOH 4O5LH 3H7RA 3OR6A 5F4SA 1F1DA 3AU1B 3CVHB 4Z8FL 2QSCH 4NZRL 3DHPA 1X98A 5D4HA 2D8KA 1WT5A 5L6YL 3UYIA 5K9KB 1EBGA 4RBPH 3SE4A 1R5IA 2CWXA 5HYQA 3QJFA 4CSTA 1SVCP 1ZLWH 4K2UL 4GIAA 3NQGA 5T1DL 5D2NA 3A4FA 1LCOA 2HT4D 3ME3A 3BOXA 4PRIE 2OM5A 4YFDB 4HG4J 4TU1A 1K02A 1ZPTA 1ICQA 35C8H 1ETZA 5D7JC 1BD2B 5JZ7D 2Y4SA 2DQDH 1IZCA 1XR2A 3ZMNA 3FJTA 1E4MM 1XF1A 3EO0A 5BO0D 3UTSD 3FTYA 1XTLA 4EANA 1G6RH 3G1DA 5RUBA 3RPKA 3RWHA 2H9AA 2Q09A 3U4BH 4TV6A 4LGSB 3BN3B 5FF2A 4PBVC 1FGNH 3QHFL 5C9KA 2RJMA 5FHBH 4NGHL 3AQXA 4AGLA 5HHQA 1I6NA 3QI9C 1SF5A 3NFUA 4LESA 4AQ1B 2AC0A 1P2CB 4XCEB 3MRMA 3TCXA 1FNGA 1LE9A 1QYGH 1M7DB 3VXSE 3QDJD 2GJZA 1FH8A 4WWKC 4BRJA 4Y5VB 3S3CB 4APXA 5A2FA 1L8PA 1QSEA 3GKWH 2V38A 4BH8A 1GVOA 3V0JA 1VKXA 5IFJB 1X5XA 1EA9C 1J9QA 4A35A 3SKOA 2C7UB 3MQIA 4IP5A 2CO7B 1KXQE 2Q86A 5HI3C 2R4SH 2YGYA 4FXLA 4XNBA 2Y7OA 5SWSD 4CU7A 4QRTB 1ECEA 5CCKL 1GHFL 1FWIC 4NN7C 1DVQA 2C8NA 4GE8A 4MCMA 1BLNB 4G9PA 2VDML 5KBKA 2GW5A 1AG6A 1AO7E 3KPRB 4S1DC 3B4NA 4LFHD 3DXAE 2B59B 1LK2B 4MMXB 3RIAK 5GRUL 4AIXA 1HO1A 4DEUA 4G71B 1FH9A 3O7UA 3IACA 2EH8L 3P84A 1XSOA 4PL2A 1EJTC 3QO1A 3NJMA 1K4HA 2A7RA 3TPUB 5I30H 5HGGS 4NYLB 1F90H 3S6OA 4HUWB 4R2GB 3PNWA 1B0GA 2PO6D 5FUCC 2RTTA 4U3SA 2VFDA 3VE0A 3FKRA 5AWNL 4GKLA 3JZUA 4XO5A 2DJ4A 1DCEA 5DUJA 1H15B 2A5HA 3WJWA 3NUKA 2GUYA 1RVFL 4NJ9L 3LSBA 1SZFA 2BV9A 3OTRA 5INDB 3PG9A 2D7MA 2PTWA 3U6XS 2HDJA 3FGCB 3GO1H 3VOIA 5E4EB 1R3HA 4EBQH 2Z26A 5CJQH 5DZNA 1AQKL 1XYFA 2V0TA 4HT1H 4JO8A 4F9LC 3VFPA 3ZKXC 3CVDA 4UDTA 4RAVB 3T08A 3FH5A 2B31A 5L2JA 3RWGB 1S5MA 2EF9A 3SDDA 5FF0A 4FGMA 4H88H 3QJHB 5CKGA 4CNUA 4Q74A 1KGUA 2B7NA 1ZB5A 2R0KL 5JO5B 1H9DA 2WBGA 4L2YA 2ZNWA 1FP8A 1FYTA 4XVUC 3MP3A 2PDCA 3HCVA 3LQMA 5E5MA 1JNHA 4BEQA 4HU4A 3N2JA 3CUPA 4PV9A 4I8DA 3VXSA 3PFRA 4E9WA 4N0UE 2GK2A 3KGRA 4NP4L 3TQPA 5CFAA 1J8HA 5FDWA 3TV3L 4AWTA 1I0BA 5FA4A 4PA8A 2Q8AH 5LNRA 2Y1AA 3DBXB 4L4TB 3KLKA 3IRDA 4PWKA 3IGAB 3VTMA 5I2IB 1WAAF 3VFMA 5ILTL 4JREB 3CWHA 3PZIA 3EYSH 1QUNB 5DI8B 1B4EA 2YKLL 1IQWH 2DLFH 2BP5M 3HHRB 1N4XL 2PP3A 4AGMA 1R87A 3FSOA 43CAB 4A2SA 3KPSB 3BL3A 1SBSH 3RO8A 4KX9A 3ISIX 2EZ0C 1EX0A 3BG9A 1GIGH 1HOEA 1XBXA 4BCXA 5CWSB 4H9XA 1WDRA 2P50A 2XBZA 4XN8A 4Q8WA 3EYOA 1PTGA 3ZS4A 1OTSD 5DA0B 3W9EA 1NM4A 3L5LA 5D8ZA 4AB4A 2J5LC 3O3UN 4DP1X 1UHVA 2ZUWA 1K7XA 3JV0A 1K8IA 2PCQA 1CD9B 3OVRA 3EG9A 1NCJA 3MV8A 3V1HA 3T0EC 2YD1A 3O4LD 2AKRA 4ILSA 1OK6A 2LLEA 4FX7A 4G1MA 4LYKA 2EKSB 3SCSA 3ZE1F 1QPRA 3M5YA 1HDMB 1XGDA 1YYMH 4JPKH 3BISA 2C26A 1ZBCA 4PRTA 4PRNB 2P5EE 2XKSA 4K7FA 3NACH 4G9FA 2KDGA 3FNDA 1A02N 1DJQA 5DJYA 3ARGB 2VELA 3WMQA 4JRYE 4WSGA 1V4YA 4LP4A 1T80A 1ZBVA 1RP8A 3C12A 4S3DA 3LKQA 3SIKA 2TODA 4Q4QA 4GUHA 2WQPA 5JNYA 4L1LA 5I78A 4G6KH 4NT6B 3IDMB 5C0RL 2WKOA 4I9MA 3F04A 1QP1A 3TYGL 3EYQD 2J6VA 3QUZD 3RN6A 3HZVA 4LUTA 1K77A 3AMDA 4MMWA 3FA5A 2JIWA 3ZJ7A 5GGTA 5EORH 4G8EB 3MUXA 3EZ4A 3ZTJG 4Q8NA 1VLIA 1AKPA 3E0GA 3AQYA 4LS2A 3Q01A 4I77L 3MNZA 3ROLA 3M17A 4GPVA 2PW2B 3NFNB 4BHUA 4JQ1A 4P4KB 4E36A 5DF0A 4Z9KB 4AXWB 5I71B 4HPYH 1GEHA 2IAMC 4Q33A 3D85B 2FKPA 3PZMA 4JAMB 1OFRA 4DO6A 4PJ7B 7PCYA 3M0HA 3T40A 3ABKB 1LO5A 1KC5H 5GHWL 2OSYA 2YYTA 4JFVA 1SFTA 2NNRA 1FL3A 5J56B 3D50A 1J5OL 2JF1A 4ZZ9A 1NAKL 3COTA 1NTDA 3G04A 4HA4A 5JPMB 2TYSA 2P8PB 1FCQA 3O8XD 3JV4B 1MHEA 2NY4C 1WDDA 3MRHB 1MPAH 3F7VA 1JV5A 3SQMA 5GIRB 4S3JA 2EDBA 1XD0A 2ARJB 5LIXX 2OFJA 4UTIA 3GMNA 2XZCL 3O63A 1XLAA 5E8DL 2GAZA 1B3XA 5FV2A 4D0CA 2JFCA 4GFSA 1R5YA 1ZUAX 1J0HA 4UTJA 3E2QA 4GW4B 1XLCA 3MREA 5LKNA 5DK0B 3T2OA 4Z7WF 4R26H 5EF1A 2V37A 4PJBE 2HMCA 4XNDA 1E4KC 5TH2A 5B1AB 2Z4GA 4Y4KD 3NEHA 3D3VE 3FTGB 2ZA3A 1DJIA 2QT6A 3ITOA 4X6DB 2WXMA 5I02A 5DLLA 1NKOA 1FH5H 2VLLA 2BNUB 1ZA6B 1R9XA 3UWZA 2EYRA 1S5HB 3M5XA 3GBNL 4NPYB 3DGGB 4G42A 1A5MC 1KPRB 4C55A 1TEGA 3MBEA 4OLYH 4R85A 4YUEL 2NVCA 1KGIA 1AKJB 5AKQA 4LVHB 4N6FA 3UWWA 4PFMA 3L7EA 4B60A 1QO3B 1IB5A 5C08E 5ADPL 2VDNH 4L1DA 4CEUC 3LZ5A 4NM8H 4Q4RA 4JKKA 2NXYD 3ZMRA 2H41A 3QN3A 3CAVA 3CUGA 4BFIB 1LBLA 3WJJA 2CLEA 1FDLL 3KPLB 2WN2A 1XCTB 5AN7A 3G1YA 2FBRA 4ZMTA 5AOIA 4P07A 3MANA 1MQRA 3PY2A 1TJIL 1E72M 3OP2A 4UUJB 4MDOA 5AYUL 4DN1A 1R6VA 3G5VA 1URLA 1ZAIA 3FFOA 1X6NA 3L81A 1IWBA 4N2GA 2OQYA 3MY9A 3GBDA 4H7ZA 1LOSA 2BNQA 5E8NA 3IJIA 3R7MA 5FL1A 3PWLB 5LDSA 3VIIA 3HS0B 4PJGA 1UA6L 3OXSB 4DXKA 1IZJA 4CC4C 3WEXA 5I6PA 1Z7JA 4W84A 1NWSA 3TA3C 2EYSA 4YGAB 1FC1A 3TWCL 4IQLA 2BG5A 5SWZA 3U7WL 3RTQD 4MDIB 1JK9B 1OGTA 4JKPL 3V4UH 3RYSA 3LKOA 4C6EA 3SBRA 2DYPD 1KNOB 3HV8A 1BRLB 1JCNA 2QFRA 3QXTA 4YIWA 1X5GA 1HHHB 3CCHB 3Q67A 5ALCL 3VX1A 3HV9A 2ICWA 1WUFA 3WI9A 4LB8A 4YDVA 5BVJA 5B3JF 1E70M 1PVHA 4RETB 5I8EB 1DSYA 1H50A 3UWVA 1T1XA 1W6TA 3NK3A 1LMKA 3GT6A 3KPRD 1ODUA 2XQYK 4NUGL 3P9MB 1J1OL 4JQVA 1B4LA 4OLEA 4OQTA 5T8GA 3SGJC 3UPMA 1XLGA 4AZUA 4DGWC 3NSJA 3R94A 4Z7QB 3X3FH 1X39A 3BP5A 1KA9F 4ZQCA 3U9PL 4X7FC 5FJOA 2P8CA 1PD0A 2VXTL 1T2JA 3GMMA 4BSWB 4MTVA 1TPVA 4W5UA 4YHGA 1JDDA 3HR5A 2IMNA 3S34L 4R2GD 3ZDXF 4JE0A 3TTOA 1RJLB 5G5DB 1FWAC 1F2QA 1KN2H 2EECA 2VR5A 3MODH 4WSKA 2A7NA 3STZB 2JI3A 2BOBB 1KFKA 4MD5A 4B27A 1A4JB 3UAEA 4OI7A 1VLXA 4GKTA 5CBBA 2FVLA 2HV5A 1W8EA 5CSRA 4DOHB 1KRAC 4OIIH 1U95A 1HGWA 4P4RB 5K69A 2EHHA 3MRJB 5CGYC 5LXEA 5FM5O 4OZ4A 4UTAA 2TSBA 4PCPA 1BF2A 4UIKL 3QK0A 4XSMA 5IB4B 2XWEA 4I5XA 4F92B 2EDRA 4MWAC 2PBGA 4Y5XB 1T04B 4L29B 4V28A 4UTBH 1JIBA 4H6KA 3ICJA 5FHAH 1JUBA 3BKJH 3J07A 1FFRA 3MUIA 5LB1A 1RZJL 1YVLA 3KM2A 1E3FA 2V5DA 1USQA 1TZOA 1PGRB 5I73B 4XAPA 1JF5A 1KLUB 4ALAL 4LDEB 1GQKA 1TTQA 3NO3A 2XHNA 5MEOB 2BY1A 4JAWA 4OLWL 1I4NA 2SODB 4BDVA 5EFDA 3QIWA 2WWCA 4H1ZA 1QSZA 2HZHA 3X11A 4PJEE 4MKMA 1U8CB 4GZIA 3CQFA 4YSSA 1DDHB 3L2LA 5C09E 4L4TD 1VGKB 5A8QA 4GVHA 3I50H 4WVXA 3E0LA 3WL9B 3IKKA 1GL4B 1M04A 3QR1A 3SD2A 1MIEL 1OSEA 3QORC 1G01A 1NCIA 1C8XA 2KL6A 1MCOL 4JNZA 2NWRA 1SM3L 1WWWX 4BA0A 2XZ7A 4B7IA 5JXEC 4LYPA 4U1IB 5FM5M 2PXYC 3B9VA 1LO4H 4D2NA 1W5OA 4FI8A 1N0XH 3MRGA 2YPVA 5AVNA 4KFMA 4TPRH 3TF7C 3LHWA 4NC0B 3BP6A 1XLEA 4GS7B 4M0XA 1KY7A 3LPPA 3A21A 3OZ9L 4XN1A 4NZUL 1U21A 3B8YA 2VSKB 3T8QA 4FQJL 4HJEA 3W24A 5AW2B 4PLNC 1NMBH 5J5RA 3F3HA 2VLRE 3HKFA 1GOKA 1BGAA 3MA7B 3T2PA 4GH1A 2ZD0A 1YMYA 3BLDA 2RHGA 1RZMA 3D8MA 3APGA 2BMKB 2Y1ZA 5DMIL 5KVEH 4YXLL 4LUSB 1VIWA 4FG0A 3HFFA 1ALDA 1HNYA 2VX4A 3F05A 5BNKA 2P28B 4RDQF 43C9A 3ARFB 4PZVA 4H8UA 3CFDA 4DKDC 2WLMA 3IFNL 5LLIC 5FA3B 5M2FX 4Q4MA 4EDXA 1T1YA 1TQUA 4YLCA 5ECJE 3N6YA 3DIPA 1NM9A 2W9LA 4LHUD 4XP4H 3UBPC 4M5YH 2E27H 3P3RA 4CGUB 1AW1A 4XKYB 3RL1A 4KKBD 2YFOA 1DXFA 3GZPA 5F1UA 1FO0B 2COVD 1MREL 2G2NA 3AM8A 3HRPA 4CW1B 1ITBB 2CLIA 1LRTA 1SW3A 4KKLD 2BBFA 3VSQA 2O5YH 2G4FA 1XC6A 4Q58C 3SCMC 2FMOA 2F6UA 3CZLA 3V4VH 4LVFA 2A3CA 1NJJA 4GKZA 3CFCL 4AMWA 2X8RA 4P4KD 4KAQH 1B1YA 2VC5A 2VFHA 1I8AA 2AW2A 3LRGA 3WL0A 3RLSA 3VD4A 1QOQA 5KTEL 4XZBA 3D0LA 3LHTA 2VEIA 2HP4A 3FSZA 1MI5A 3MCLL 4O1BA 3FUJA 4H0GA 1OAZH 3UTSE 4IMKA 2V5KA 3W1PA 4A37A 4N28A 4U1MB 3K6SB 3BQUD 1EEYB 3KBEA 3BRDA 5HYSB 1EQPA 2WO4A 2OULB 1E8WA 1RBOB 3TIDB 3FT9A 1G7IA 4ZQOA 4GLRI 4Z1AA 4HNTA 5EN2A 3WFBH 4DVRL 3QUMH 1J5IA 3NCYP 1V6TA 4PMJA 2N7BA 4G8IA 1DBML 3CH9A 4P49A 3QDJE 4YXHH 4N87A 5AOJA 4UM9B 4I7ZC 3S1UA 4YCOA 4PODA 2X89D 2V2XA 4RFEA 4LSQL 1CF8H 1Q0XL 2XXFA 3M41A 2CLVA 4GRMB 3V1PA 1Z5HA 3IFLL 1JPHA 1MFBH 4XH2A 3QUXB 5EEYA 4IIEA 2OG9A 2WQVA 3CZEA 2XVLA 5SWSE 4QT5A 2XNAA 4B6ZA 3ELAT 3NJFA 4GIEA 5HSFA 1CDJA 2UZXB 3ARBD 1I1FB 4NP7A 2WYHA 1YRRA 1QRKA 3OKDB 3D34A 2AZAA 3LHPL 1YUHA 3WDPP 1YE4A 3LMZA 2E9IA 2AJSH 1RFDH 6A3HA 1IWAA 1R9FA 3E6EA 2EKCA 5D1QC 4IQJA 4HFWB 3MB9A 1J88A 1U6AL 3GRBA 3OJMB 5AKTA 2KPNA 1UWYA 5A6MA 1M6OB 3L1EA 4AUBA 4X8JA 4KY1L 3GG8A 3QVQA 1MWAL 5JW4R 4AV0A 3O9WD 2UZIH 5DHVH 4G7EA 3CV2A 3IS4A 1U41A 3S5SA 3MC0A 3PL6C 2VWEE 1BJMA 3AFLA 7PTDA 3JUZA 3QG6A 1IC7L 5IZ7A 3G2GA 3GTFA 2Z8RA 3GXDA 1SO4A 1EFZA 4H9MA 1A50A 1ISXA 4FNLH 4OTKA 3G18A 5GISH 3LLDA 3UY8A 5F1KC 3B7SA 4LEBA 1D2OA 3BMVA 2ZCHH 1NCHA 3GM0A 4HU0A 1UPPA 3K2MC 1M1SA 2YC1B 4GRWB 2V2WA 5GJPA 3L4CA 1A5FL 4AQAA 3Q65A 3UZQA 4ZUSB 2IGLA 4BQ4A 4YX2L 1IGYB 3C2AH 1RMFH 2OZNA 4GUGA 3RG1C 4M1DL 5IHUL 5FYJL 3VI3F 4YQXL 4MHHI 5D96B 4JDBA 1GOFA 1KRMA 5CD5D 3VG9B 4IU2B 4U1NB 3S5LB 2PPDA 3EGJA 5BOZG 1NGXA 2DW7A 2FSDA 1EBPA 3U36B 4BXSV 1VSCA 3HVDA 2H26A 1T2QH 3P77B 4YFEA 4LHJB 4GC4A 4IGNA 4UI2A 3SE8L 3NIDE 1ELSA 1EJ8A 3E74A 3EJZC 2DQCH 2MTAA 4N8PA 4OCLC 1Q8MA 2MCPH 3TA4D 3WLLA 1BZ7B 1S2CA 3K4WA 3FQRB 1XLJA 1KQZA 1RK1A 2AQRA 2F15A 4PD4K 1R4XA 3OXRA 3E96A 3EXLA 4Q9RH 3KS0H 4P7QA 2NYZA 1KRBC 3W0KA 5ICXA 1SXBA 2WXNA 3TJHD 1S9YB 4P23B 3AIRA 5IB1A 2ZWNA 2Z7UA 4OCYL 5PCYA 1RY8A 4YTTA 3CWOX 1EJXC 3K7UA 4Y9PA 3FQWA 5D2LB 1TO4A 4JE4B 3DGDA 4DJEA 3HFMH 4G8TA 2F53D 1X6UA 2FIKB 3WFCH 3WIIL 5CJXA 4ACZA 4RNRA 2FZ3A 1LRNA 1OX4B 5GZOA 2PTDA 1EGMA 4B3EA 1EXHA 5CU9A 3U83A 3ABLB 4Q14A 2Z4TA 4OJFL 1WICA 3CHCA 1Z6JT 2F5BH 2X16A 4ODUA 2X28A 1PBYA 2WHMA 5BZWB 1E0WA 1JQXA 1OX6A 1NAMA 1Q0EA 1F42A 3U46B 1B4KA 1GPOH 2XOTA 1A3HA 2IPKB 1NDYA 2WOBA 3L0GA 1A3LL 3CFJA 4B15A 1VBHA 4P59L 4IIFA 1IRAY 2E6YA 2W0FB 2X4SB 1GGTA 3BQ5A 2YPKA 2WTOA 5CC5A 4R4NC 5FYLD 1DFBH 4JFYA 4LOEA 4U1JA 4UT7L 2WXGA 1HOCB 4E5TA 1WUEA 1I8KA 3S35L 1AYOA 3M6DA 3IETA 5IMLB 2NUYA 1S5IH 3H7BA 1P5UC 1T8XA 1U42A 5DRIA 1FHNA 1XL4A 1G9NH 1FNSH 3K13A 2MQGA 4IBLT 5DQPA 2DSVA 3FFCA 4XMWA 4XTIA 3C6LC 2V5LA 4HXAH 5EF0A 3J2PA 4AQLA 1HZHH 5FO9B 3V0IA 3DFTA 4JYEA 1MUCA 4TS6A 1FVEA 2G41A 4HH8A 4G43A 5DFTA 5ITBH 2BSDA 3F58H 3KBWA 2H3DA 4AQZA 2FX8H 4FTVA 4S1RH 1BVLA 1FWWA 2ATKA 4J3XA 1JCVA 4HAKA 3TM6A 1I1WA 3CYVA 4XBEH 5F2FA 1ZLUK 3D1MC 4MZYA 4O19A 3NSFA 1E6ZA 3NZ8A 4FA8A 2OODA 3ID7A 1R3WA 3WIFA 2DQIL 4AZHA 2DOCA 5GGUA 5G55A 3HI5H 1S9WB 3U2SA 4HK3J 3HZKA 1KFJA 4S39A 4G3YL 4CDHA 1EOMA 5EFIA 3PQYA 2WVTA 4ZDHA 1CURA 5HHXH 4PG9B 3SN1A 2BLFA 5D9SB 4RLIA 3VKAA 1IUZA 3ESPA 2EAWA 5E0FA 3G5XB 4LAKA 1FDJA 4P7RA 4YZWA 2VR9A 4WEUD 4AGQA 3BP4B 4XZUB 2F7QA 1INQA 3CAFA 3ZYIA 1K8ZA 3SDYH 3AG4B 4EN3D 2WSPA 1MYRA 3SY8A 5F7UA 1OFEA 4PTWA 4ML9A 1X7SA 4QXGH 3BUYB 3QEQA 3VSTA 1ZSHA 3JUYA 4Z76B 1Q63A 4NY2A 1NKGA 1RLDA 4HNUA 3D6GA 2V81A 3GY1A 2BOCA 4N5EC 1T7WA 5FSDC 1Q9WB 1TJGH 4G7VH 3CG8A 3BVJA 4IQEA 2EG7A 4P46C 2NZ9D 3WMPA 3RU8H 4L6OA 4JDZB 4YVVA 3OMAB 2Z6IA 2WIMA 2W60B 4TOYH 2R1YB 1OFOA 4OFPA 1L6SA 1USZA 4A2RA 1DQLH 1CI1A 4J23A 4HLZH 2FO1A 1SJMA 3MLUH 2HISA 3G5ZA 2Z0IA 4X6FA 3QFEA 1TJXA 3UC2A 1F4WH 1K8DB 2DQFB 1FWFC 4P5TB 1EC7A 2FO8A 4LS1A 2FNBA 1MNNA 4DWSB 4O02H 4AIBA 4YGVA 3RU6A 4N0FA 1HNFA 2A3BA 3DROB 2EE3A 3HAEA 5EIIG 3ZSSA 3F01A 3M5VA 2AV1A 4YL9A 4EPKA 1F4YL 3M86A 1SFDA 4G80A 3M16A 4C8XA 1TWWA 3NJNA 4WEVX 2R29H 3DHUA 1IFGA 4PJFE 3I2CL 2CDGB 2NLJB 3FRPG 3RHWF 2C1HA 4Y6GA 2QJHA 4EAEA 2F84A 4B16A 2FYYA 4Z5RB 2CERA 3QJZA 4UM9D 5FYKD 3DFNA 2J8TA 3SBWC 4MSSA 4OB5L 4AWJC 4LKCA 5HJGA 2ZWZA 3RRQA 3LKRA 3MV9A 1AHKA 4WUUD