1JDDA

Mutant (e219q) maltotetraose-forming exo-amylase cocrystallized with maltotetraose (crystal type 2)
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
418
structure length
418
Chain Sequence
DQAGKSPNAVRYHGGDEIILQGFHWNVVREAPNDWYNILRQQAATIAADGFSAIWMPVPWRDFSSWSDGSKSGGGEGYFWHDFNKNGRYGSDAQLRQAASALGGAGVKVLYDVVPNHMNRGYPDKEINLPAGQGFWRNDCADPGNYPNDCDDGDRFIGGDADLNTGHPQVYGMFRDEFTNLRSQYGAGGFRFDFVRGYAPERVNSWMTDSADNSFCVGQLWKGPSEYPNWDWRNTASWQQIIKDWSDRAKCPVFDFALKERMQNGSIADWKHGLNGNPDPRWREVAVTFVDNHDTGYSPGQNGGQHHWALQDGLIRQAYAYILTSPGTPVVYWDHMYDWGYGDFIRQLIQVRRAAGVRADSAISFHSGYSGLVATVSGSQQTLVVALNSDLGNPGQVASGSFSEAVNASNGQVRVWRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of a mutant maltotetraose-forming exo-amylase cocrystallized with maltopentaose.
pubmed doi rcsb
source organism Pseudomonas stutzeri
molecule tags Hydrolase
molecule keywords 1,4-ALPHA MALTOTETRAHYDROLASE
total genus 148
structure length 418
sequence length 418
ec nomenclature ec 3.2.1.60: Glucan 1,4-alpha-maltotetraohydrolase.
pdb deposition date 1997-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09081 DUF1921 Domain of unknown function (DUF1921)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1jddA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jddA01
1VJSA 1JYVA 4X0VA 3OZOA 2XPKA 2OSXA 2XVGA 5C8BB 1XCWA 4LXFA 2DT2A 5EFDA 5JBDA 3BAIA 1WP6A 4FNSA 1ODZA 1J0KA 4W86A 5M3WA 1WDRA 1HKMA 1NOUA 1JZ3A 1WO2A 3UEQA 4D1IA 3ARYA 2NW0A 3VVGA 1Y7VA 1UKOA 2EACA 2D23A 2V5CA 1Q6FA 1JD7A 4AZGA 1LWJA 1NWSA 4JHZA 4AZHA 4D6IA 3GNOA 2CBIA 4UCFA 3ZOAA 4ATWA 1FFRA 3AIUA 4BF7A 4F8XA 5A6MA 4HA1A 2Y8KA 2GK1B 3IJ7A 3AIWA 2J78A 1E1EA 1ZBWA 1HJVA 1TE1A 5AYIA 1JXJA 4PBGA 3MI6A 2EABA 2QMKA 4KGLA 3DX0A 4ZFMA 3UESA 3CZGA 1J0JA 4Z2KA 4FLRA 1W9VA 2WKLA 1JG9A 5CPQA 2Z1SA 4LPCA 2CESA 3KL5A 3U7BA 5ABEA 3AISA 4H04A 1BG4A 3N9KA 2BHUA 1NQ6A 2PC8A 3CZNA 2WB5A 3IAQA 1EIBA 1GNXA 1X1NA 1E6QM 1GOWA 1P6WA 2CXGA 2GJXB 2J8GA 5CQ1A 3DYOA 5FCZA 1HL8A 5HOSA 1ODUA 1NM9A 2VZOA 1EHAA 2MANA 4OGZA 4AZ5A 4EE9A 4A4AA 1LL4A 3RMEA 5A2AA 1CXHA 1R47A 1F4HA 2O9TA 3WY3A 1B2YA 1BAGA 4GZEA 1KGWA 3VSUA 4Z2LA 4UOZA 2WK2A 1MW1A 4C7DA 3W6LA 4AIEA 5A6KA 4NXSA 1A47A 2WVSA 2ZX6A 1VBRA 2BFGA 2J47A 8CGTA 3GNRA 5E09A 4WJXA 3ZSTA 1GW1A 4GI8A 2DSWA 1NP2A 1E55A 1MQPA 4U5IA 4D6JA 1VJZA 1FP9A 3MUZ1 2JF6A 1C91A 4AMCA 3WNLA 1ISZA 1TQVA 4PYSA 1EQCA 1JI2A 2XHYA 1LG1A 4X9YA 2J25A 1E0XA 5E70A 4JFUA 1VFMA 4DUVA 3SCTA 3THDA 1R85A 4N42A 3M7SA 1Z32X 4RE3A 1SR0A 4UFJA 2ZWZA 5A8PA 5IDIA 2XG9A 1KCKA 2V3EA 5ABFB 5CGMA 3LRLA 4NZFA 1BFNA 1T0OA 2JEQA 3ARXA 1F4AA 3VIFA 2ZICA 1QPKA 5IFPA 1DWGM 2E40A 1GOQA 5GNYA 3EDEA 3CMJA 2XWEA 1KXTA 4W85A 4A3YA 2A3AA 1CXEA 2GDUA 1CGYA 1R34A 3ECQA 3WQVA 3LPPA 1J11A 4AZIA 1UKQA 1MVYA 4AISA 3OIHA 3BC9A 1W1YA 4FNTA 2VO5A 3EJTA 3VD7A 2FH8A 2YDSA 1UWUA 1KXVA 1TUXA 4E2OA 1DP0A 4UFMA 3ZJ6A 4NZCA 2DDXA 3WELA 4CN6A 3TP4A 3LPOA 2X2YA 3CGTA 1DWHM 3U7VA 3LMYA 4W5ZA 3SCPA 3L4WA 3UERA 3EMCA 1UWSA 3D4YA 4BA0A 3CUGA 3VIMA 2UWFA 1C8XA 3NUKA 3RDKA 5IXEA 1PIGA 3L4YA 1WCGA 3W82A 4TVDA 2XM1A 4ZXLA 5E0FA 3LXCA 2XN2A 2PWEA 3VX1A 1E6RA 3CBWA 2O92A 1HVXA 3HG3A 2VZSA 3ZQ9A 3WUFA 3AZRA 8A3HA 2YL9A 1KQZA 4AD3A 1HN1A 1XCXA 2WMKA 2XUCA 4R27A 2DH2A 9CGTA 3GNPA 3WDPP 1E3ZA 4E8DA 5HBFA 3A47A 4WK9A 4PCSA 3WQ8A 2YLAA 4AIOA 1XYFA 4RL3A 3TTOA 1R7AA 4F9DA 3H54A 4M1RA 1EHNA 3CZ8A 2JEPA 3PTQA 3UG4A 1Q6EA 2X0HA 3GH4A 1NOWA 3VD3A 1EO7A 1UKSA 4LQ1A 1C93A 2AOSA 1NP0A 2VQTA 1NH6A 1B3ZA 3RM8A 2PBOA 5BRPA 1UR9A 4AZCA 2WC3A 4HMDA 2YA1A 1BLIA 3N18A 3MUAA 1KWKA 1IV8A 1E43A 3MSGA 2XIIA 3EBVA 1CECA 1W3KA 3T2OA 1GCYA 3CZEA 2J4GA 4W87A 4JFWA 5JUVA 1HWWA 4DWSC 2C0HA 1G0CA 4P8UA 4AZBA 2J62A 2FHFA 3PHAA 1BSIA 3WF1A 4QFUA 1JI1A 2E3ZA 4W7UA 4W84A 2DT3A 1PIFA 2D0GA 1W9DM 3EMQA 3NSNA 2CBVA 3VIIA 5CJ5A 1EDQA 2EPMX 4A3HA 5C70A 7CGTA 4QCFA 3IANA 2VC9A 1M01A 4HPGA 3EDJA 3D3AA 3WNOA 2F7PA 4MB5A 1ISVA 2O9PA 3A5VA 1BPLB 3A6OA 3F5LA 4CVUA 3ZM8A 5C71A 3WBEA 3ZIZA 2Z1KA 1I1XA 1G1YA 4ZE5A 3BXWA 1HJWA 3UR8A 3PZOA 4GQQA 4PMZA 2E0PA 1EGZA 4BQ5A 1OT1A 3BSGA 1JXKA 1B1YA 2WBGA 3B9AA 2ZXAA 2E9BA 1E5JA 1V3IA 1PX8A 5I0DA 2E4TA 2RGMA 4P7OA 3ZR6A 1VIWA 3A4XA 3BMVA 3THCA 3SCNA 3SCVA 3H53A 1EDGA 3PTMA 4BQ4A 1G94A 2GFTA 4HZ8A 4JFTA 3WMCA 3DC0A 1JYWA 2XJ7A 2JE8A 1UWTA 4QAWA 1JGIA 2OSWA 3VGHA 1US3A 2VX7A 2VTFA 1KB3A 2C8NA 2EPOA 3W24A 3N15A 3MV11 3BVUA 5EMYA 4XX6A 4CD4A 3AHVA 1ESWA 3BUPA 1TA3B 5FIPA 1MXDA 1ITCA 3OLEA 4MPKA 2X1IA 5A3HA 3KL3A 5CLWA 3WFZA 2DIJA 1WDQA 3DYMA 3U57A 5FD0A 3KE0A 2G8ZA 2WVVB 1LQ0A 3BVTA 3VNZA 4AZCB 3GXDA 2XSAA 1V3MA 5BWFA 1BGAA 1HTYA 4GINA 1B3WA 1K6AA 3SCRA 4CD5A 3FW6A 4ACYA 4UQEA 1VEPA 2BHYA 2VQUA 1GHRA 2FH6A 2J7DA 3WENA 3SUVA 1AQMA 1JF5A 1UH2A 1V0LA 3SCSA 4PMVA 1QI3A 3BLBA 4PN2A 3VU2A 1LL7A 1LL6A 1XH2A 3NDZA 5LYRA 1BVNP 5I3DA 1JDCA 5CZKA 4TTGA 3ARUA 5CGTA 2DSUA 2WSKA 4W7WA 2XN1A 4MJ2A 4EANA 3N11A 1H49A 3CV5A 4JL2A 5D9PA 2ZXDA 3H55A 3LRKA 2BVTA 2A3EA 1JFHA 3EDKA 3U5UA 1H2JA 1DEDA 4V27A 4P8XA 3K4AA 3WF2A 5I79A 4B16A 1PAMA 3B8SA 3AMLA 3BGAA 2QHAA 1XD1A 2EBNA 2XFRA 3LXBA 3W25A 4EK7A 4CCDA 2WHLA 1J9YA 3DDFA 1O7AA 5DO8A 2D0HA 3PZVA 1E6NA 4B3KA 1D2KA 3TV8A 1CEOA 4CVWA 1QX1A 1UD5A 2FHBA 1QI4A 1CXLA 2IGTA 3DHPA 2FGZA 1QHZA 2VZTA 2F1AA 1C7TA 5AY7A 1TQTA 1XD0A 3OLGA 2ZWYA 1ZU8A 5KZ6A 1V6YA 4XZBA 3DX3A 3VIKA 2NT1A 4QLLA 3MUIA 1E71M 4P8VA 1BF2A 2ZUTA 3I3EA 2RGLA 4TX8A 1HIZA 1PS3A 3FXYA 2OYMA 3TTSA 2WZEA 2IUZA 2GJRA 3FHAA 3KWXA 2WANA 2WZHA 1C8YA 2ZUUA 3QR3A 2WMHA 1IZJA 5A6BA 1UA3A 1G5AA 3SEPA 2WWDA 1WZMA 5CXPA 4UZSA 1J0ZA 4D71A 2ZX8A 1UYQA 3PZQA 3CO4A 3GTNA 3AMKA 1KGUA 4GO8A 3WDIA 2VVNA 2YOCA 3WKZA 4IUGA 3M46A 5EB8A 3WD3A 1JD9A 1PJ9A 4P7QA 1UA7A 3BMWA 4HOZA 3WEZA 3O9NA 2XM2A 4GPNA 2VJXA 1SMDA 5IFTA 3WQWA 3GXPA 4J3SA 5DF0A 3T2QA 5ABHA 4MB1A 5GNXA 1E3XA 4OOZA 1CXIA 3SUSA 4J3UA 1C90A 1G01A 2EAEA 1FH7A 3CUIA 4KRTA 3GBDA 4RE2A 4ATDA 5A95A 1R8LA 3VM7A 2QLYA 1EOKA 1FHDA 1HP4A 3W26A 4AXNA 3BUQA 4CD7A 3BH4A 2A3CA 3S5YA 2WLZA 1JYNA 4CU7A 1WZKA 5GQBA 3HG4A 4LGXA 1KQYA 1UQYA 3N1AA 4F9JA 1ZJAA 2F2HA 3VNYA 4PMYA 1DTUA 5D9NA 3HJEA 2OW7A 3M07A 3AZSA 3VIJA 4PUDA 1U2YA 3GH7A 3A3HA 2J7EA 4GO9A 3D4ZA 3VOCA 3VD5A 3GH5A 3PZ9A 2WLYA 1QVBA 3VGFA 3NCOA 4WSJA 3GYCA 3POCA 5JIPA 3AXXA 4JZ5A 1E70M 1RP9A 4ZEPA 3ARWA 3MO4A 4MB3A 2PWFA 1W3JA 4C7GA 1UHVA 1E5NA 2ZXQA 3TTYA 1XH0A 3WEOA 4OUEA 4YN5A 3ARVA 1DWFM 5BROA 3VINA 2PB1A 4OIFA 2XFYA 4GI9A 5BXSA 5I2UA 1UD4A 3GXTA 2QMJA 1V6VA 3BAXA 3AIRA 2BXYA 5BXPA 1UH4A 4ATLA 2VZVA 4FNQA 2J7HA 4YPJA 4Z2IA 1OGBA 4L4PA 1FFQA 1FHLA 3T09A 5D4YA 1CPUA 4GKLA 4AIUA 5AYBA 2ZX5A 3WQ5A 5JIWA 1CIUA 4HZ6A 1MFUA 3LPFA 3HG5A 1XC6A 3E1F1 4PEEA 4MJ4A 1QHOA 3IGUA 5CSYA 2ZE0A 3VGDA 4DM2A 2GVYA 4UFKA 2ALWA 3DDGA 3ZSSA 1KTBA 2X8RA 4M81A 2X2JA 1OIMA 2O9RA 5HDRA 2BV9A 3L4TA 4IPLA 3S5ZA 1VFFA 4S3JA 4CKQA 1NARA 2A3HA 3PZNA 4CN1A 3WUEA 4HMCA 4NI3A 4BQ2A 3MV01 4W8BA 2J7BA 1CWYA 4J3TA 1H5VA 1OM0A 4PMNA 1UZ1A 4UR9A 4H8HA 1K9DA 2WVTA 3GXFA 5I77A 1QWUA 4L4OA 4FNRA 4YHEA 5I6SA 3QOMA 4AEFA 5JBEA 3VDBA 1ISXA 1GOMA 2W62A 2VRKA 1GJWA 4E8CA 2O9OA 4M56A 2C7FA 4OKDA 4V2XA 1Q4NX 3BSHA 3ALFA 1H1NA 1HVQA 1QNPA 1TVNA 2ZX7A 3ARRA 3L4ZA 3A23A 1V0KA 4ZXOA 3VMOA 1HJXA 3ARPA 2V38A 2YBTA 3ZJ7A 3KEHA 4ML4A 2ZX9A 1E6SM 4NF7A 4D6GA 4JCLA 5CSUA 2BY2A 3WD1A 3A24A 4LYPA 7A3HA 1QI5A 1E40A 2ZUWA 3VGGA 3AI0A 4PTXA 2G41A 3ZJ8A 3IK2A 1EDTA 1E73M 4W88A 4RE4A 3VDHA 1NOFA 1DHKA 1V02A 1WDSA 1UR4A 1GOKA 1GQKA 3VIPA 1V6XA 2X2HA 1B9ZA 5E6YA 1XGZA 4ZENA 1LG2A 3BLKA 3SCUA 5M17A 1V3HA 1TFVA 1B30A 1B31A 4MDPA 2PBGA 3BLPX 1H0GA 3AIVA 2D0FA 3PBGA 4TOQA 5CPSA 4CU8A 1RPKA 1E0VA 3AZTA 2YKKA 5A8QA 5A8NA 1NWUA 1OWQA 4D6FA 1KGXA 2F7RA 1PX4A 6A3HA 2QPUA 1VFOA 3GXNA 2WYSA 3NJ3A 1MXGA 3WDJA 5GPRA 3WD4A 3VM5A 3ZT6A 2YDQA 5FL0A 3ZT5A 2E8YA 4AD2A 3WL0A 2CIPA 3WNMA 2G3NA 6CGTA 2OSYA 3TTQA 3MUY1 3AIBA 3WBAA 1UASA 2BY1A 3NSMA 1M53A 3VILA 1JF6A 3ALGA 2CHOA 3F5JA 5HNNA 3ZO9A 1WKYA 2EXOA 1QW9A 3KL0A 5A8OA 1JL8A 3PZIA 2CPUA 2FHCA 5BRQA 1L0PA 3RJYA 3IJ8A 1BYAA 1GVIA 1QHPA 3WEMA 4YHGA 5F7UA 2J77A 2GUYA 3KZSA 2XIBA 2F8QA 4B3LA 3WY2A 1E6ZA 4HPHA 5AC4A 4PCTA 3I3DA 3CZSA 4D6EA 1CDGA 1LLOA 1PEZA 1R86A 2Y2WA 1LJYA 2F1BA 1XRVA 2WMIB 4TVUA 1TG7A 2EPLX 1WPCA 2WSPA 4GI6A 1WE5A 1KR1A 1J0YA 4W8AA 3A21A 1JNEA 4TX6A 3ZJKA 2Q8XA 4FF5A 1E4IA 1GQLA 4P7LA 1Q6DA 4H8UA 1Q6CA 1W32A 1E4MM 3POHA 4CUCA 2G4FA 1CGUA 3VIGA 3EDFA 1C7SA 1LWHA 4KMQA 4LYQA 3UR7A 1E0WA 4DM1A 4M29A 4AD1A 5BXRA 1EOMA 3LRMA 3GXMA 1PX3A 1BQCA 1E1FA 1UR0A 1OSEA 2D3NA 3WNKA 4CD6A 2XVKA 5E1QA 3EJQA 1WDPA 3VTRA 3K46A 5A6BD 1HKIA 1VENA 1B90A 1W2PA 1W1PA 5GNZA 3GBEA 2B31A 3FAXA 2WWCA 4J3VA 2WBKA 4PMUA 3T0DA 1CYGA 1H4PA 3AYSA 4PSPA 2EJ1A 2WCGA 4J7RA 3UCQA 1BYBA 2VOTA 3CHDA 2G3IA 1E6XM 3WD2A 1GHSA 3N13A 5FL1A 1UUQA 4JFVA 1ZBKA 1V02E 3W38A 4V28A 3WF4A 2DQXA 2V3DA 2E8ZA 3WH9A 2BHZA 1OGGA 3EJPA 4MNLA 3OA5A 4Y7EA 1U33A 3CUHA 4NX0A 4ZE4A 3MKKA 2XVNA 1ISYA 2AMGA 4CGTA 3BUIA 2W91A 4JCMA 1HX0A 2OW6A 1MQRA 3CIVA 1H41A 2AAAA 3SCWA 4K68A 3QHNA 2XSBA 2PWGA 4Z2GA 4H8VA 1B3VA 1UWRA 1R87A 1QNOA 2XGBA 3CH9A 3WDQA 3J7HA 5LA0A 2HVMA 1K9EA 3FNDA 3W37A 3SUWA 4PUEA 3AHXA 3WNNA 1JFXA 4AZ7A 1E56A 2EEXA 4AMXA 1IT0A 1CZ1A 3G6LA 1QBAA 4AY1A 1SMAA 3QHMA 3BVVA 5CG0A 3A4WA 3F4VA 1HNYA 3D5HA 4DWSD 3II1A 3WQ6A 1ZS2A 1BHGA 4M82A 4MAZA 2YLLA 1G9HA 1HKKA 4R5EA 3CZJA 3SCQA 3WFLA 3L4XA 3WY1A 4HTYA 1V3KA 3DX4A 3RILA 2ZUSA 1UR2A 3WH5A 2D24A 1W3HA 3BAJA 2HISA 3N17A 3W6MA 4X0NA 4UOJA 4CU6A 3ZMRA 4NSBA 4FLSA 5E9AA 2JIEA 2XFFA 1E6PA 1C8QA 3JUGA 3OG2A 1DWIM 3RM9A 3CZKA 2DT0A 2OYLA 1BG9A 1KXQA 1V0NA 1UH3A 2V5DA 2J8FA 3NDYA 1XSKA 1KBKA 2OWCA 1HT6A 4FMVA 4UFLA 3LPGA 1HJUA 2YIHA 4J3WA 3WL1A 1X6NA 2BY0A 1XSIA 2ZUMA 1EA9C 1MW0A 1EXPA 2VR5A 4PTMA 1I75A 4WKHA 2ESCA 2CBUA 5A69A 5ABFA 3A4AA 1XSJA 3N04A 3FN9A 4U3CA 4TVCA 3IAPA 3M6DA 3PZMA 4OOUA 4JL1A 2WNWA 1RH9A 3F5KA 3SUTA 1KBBA 3D51A 2YA2A 1W9XA 1QI0A 1YQ2A 2WHMA 2X05A 3UG3A 1H0IA 2IXVA 5IHSA 2VURA 2W63A 1UD8A 3T0BA 3SCOA 4DWSA 3K8LA 1S46A 2YL5A 4KRUA 1ITXA 2X0YA 5A8MA 1B3XA 1A3HA 3CC1A 2WAGA 1U30A 1B3YA 2YFNA 2DSZA 1J01A 1YHTA 4DO4A 4OBRA 2ZXBA 4UQ9A 1GQIA 1MQQA 3ARZA 2UY2A 1ZBCA 4DO5A 1SZNA 5E0CA 3SUUA 3O2LA 1E4LA 3TONA 1JZ5A 4GIAA 2D1ZA 1GPFA 1ZB5A 1HJQA 2VCCA 5HPCA 3CUJA 4WKFA 1TZ7A 2Y5EA 2F18A 1HJSA 1CENA 1HF6A 4UQCA 4MTVA 3AS0A 3HMCA 1FP8A 3I3BA 2QPSA 1ZL1A 4HA4A 1I1WA 4D6HA 3K8MA 2WCAA 2WXDM 1N82A 2CKRA 1J0HA 3AXIA 3EJSA 4M80A 1E4NA 2DPEA 3PZGA 1W1TA 2CYGA 4KGJA 4UFHA 1OB0A 1H3GA 3AIQA 4MADA 3WIJA 1CLVA 2VMFA 1UG6A 3CTTA 4Q7NA 3OLIA 3RIKA 2GDVA 1E9LA 4WSKA 5AC5A 1UD3A 4GQRA 3ARTA 2CEQA 1JZ8A 1KR0A 3MSDA 3AIEA 5ABGA 3WSUA 4KH2A 4XUYA 4AW7A 1TQWA 4Z2HA 3HG2A 3QGVA 5CLTA 1OCQA 4CD8A 1R33A 3NSXA 1D7FA 2J7FA 3QOKA 2W4XA 3WY4A 4W7VA 2X09A 4N0RA 4U31A 3CZLA 1UD2A 4BCEA 4HOXA 2VVSA 1SFSA 2WMGA 2QV4A 4M24A 1E15A 1VRXA 5D9MA 3AFBA 3LX9A 3BVWA 1K9TA 1HL9A 3L4UA 2YL8A 4AWEA 3WDHA 2J74A 1CGTA 1MW2A 1VFUA 5HXMA 1QNQA 4QP0A 3WMSA 1XYZA 3BAYA 1WZAA 3CHCA 3T0AA 5DEZA 4CCEA 1QW8A 5DMYA 3GXIA 1OIFA 2G3JA 4HP5A 1NWRA 3UETA 3EDDA 2XN0A 1GORA 1K9FA 1KXHA 5I23A 2XYLA 1QI2A 3O6AA 2NSXA 3GM8A 2UY5A 3WQ4A 2PF0A 3AS2A 4P8WA 4UQBA 3AQUA 2E9MA 3AYRA 2BVYA 2VX6A 1J12A 4W8LA 3RO8A 3VKKA 4PSRA 2D73A 3K4DA 5TD4A 5BXTA 2G3MA 3DECA 1WAWA 2ZUVA 4DO6A 2W92A 1D3CA 4PMQA 1KFWA 4HMEA 1JNDA 2D22A 1VBUA 3EMZA 1VAHA 1R46A 4WKAA 3VIHA 1FA2A 2OWWA 1FH8A 3VGEA 5M5DA 1CBGA 3WD0A 4LX4A 4C7FA 3L2MA 2EPNA 2CNCA 2DEPA 3BVXA 4UZUA 1DWJM 4OJYA 1QOXA 2GJXA 1CGVA 1J10A 1V3JA 2GK1A 3VD9A 3WF3A 4J3XA 3WF0A 4P7RA 2FDMA 5A2CA 1W9PA 2IXUA 2VUYA 1Q6GA 2WKGA 4AEEA 3QHOA 3SIMA 5A6AA 4GXPA 3MMUA 3G6MA 2J7CA 2JIWA 1OD8A 3EYPA 3OGVA 2BXZA 4UNIA 1J0IA 2JFEX 2GJPA 1W9UA 2BVDA 3NIYA 3W29A 5D9OA 4FK9A 4AD0A 2J75A 4QCEA 3CHEA 2VR4A 4JIEA 1JZ4A 3AHZA 4B15A 3AMGA 3OZPA 2VZUA 1BYDA 4E4PA 2XWDA 4MNMA 2FYVA 5A94A 1JZ6A 4MAVA 3PTKA 1CGXA 2W66A 1ZJBA 3WN6A 4PRWA 1CNVA 1V6UA 5A1AA 4LYRA 2VCAA 3VUPA 3AXHA 4BZYA 1OD0A 2WMIA 3EJRA 3VIOA 3APGA 2PWDA 3AMDA 3W53A 2XVLA 3BCDA 4HA3A 5IHRA 1GVYA 1KCLA 3FAWA 2UY3A 5DT5A 3VSVA 1PZ2A 3S2CA 3TOPA 1NWTA 2J79A 3VGBA 1UKTA 1XHGA 4PMRA 2F7OA 4GZIA 1CXFA 3K1DA 4EAMA 3MU7A 4PTWA 3WDRA 2ZIDA 3W0KA 2YL6A 4TUFA 3U5YA 4JKKA 4HU0A 2Y8VA 3MANA 4JHOA 1ECEA 1V08A 3AHTA 5D8WA 3HZ3A 5HPOA 2WHJA 4U5KA 2JALA 5A6LA 3RPMA 4AC1X 2VI0A 1GONA 2V3FA 1PPIA 3BCFA 3ZR5A 3HN3A 4NRSA 2J7GA 2Y4SA 2YA0A 2OYKA 3VX0A 2F7QA 2D20A 1PZ3A 5LA1A 1QNSA 4J27A 4GZJA 1VEOA 4CCCA 5I5RA 4FLQA 2PWHA 4MDOA 3WH7A 3D52A 2W67A 4H2CA 4W93A 1UWIA 4TTUA 1C3FA 2D3LA 3VSTA 1TQUA 4IISA 3EJUA 1V03A 4M8UA 1KWGA 2XGIA 1LF1A 3OBAA 4QLJA 1O6IA 1JZ7A 1FH9A 1CLXA 5FOOA 4UOQA 3CHFA 1CGWA 4PTVA 2BNJA 1QBBA 4WF7A 1JYXA 3FY1A 2DGAA 1MW3A 1US2A 2VNCA 4WLCA 2WMJA 2V3GA 5E6ZA 3W4RA 4U33A 1W2VA 1WNOA 1ZBVA 2EPKX 3CUFA 3K8KA 3FHQA 3WH8A 2WW5A 1JDDA 5A6SA 4WIWA 3N12A 1MYRA 3CMGA 1IZKA 4H7VA 1CXKA 4IPNB 4PMDA 1ISWA 1JAKA 3WH6A 3BUBA 4NXKA 1XH1A 3DYPA 1AQHA 1JDAA 3WUBA 4UQDA 5D8ZA 4J28A 2E9LA 2VCBA 5EBAA 5DT7A 1M04A 4ACZB 1W1VA 2VX4A 3SURA 3KLKA 1VF8A 2DIEA 5ECUA 1AVAA 3D50A 2XTKA 2ZOXA 1L8NA 1V0MA 4D72A 2FE0A 4AZ6A 2YFOA 3CPUA 5I78A 1GJUA 3VMNA 2WMFA 3AOFA 2BY3A 4XB3A 5I24A 1H09A 1PBGA 1AQ0A 1QWNA 3DX2A 3T08A 4D6CA 3AS3A 4MB4A 2PI6A 2W61A 2JF7A 4UTFA 1UR1A 1JZ2A 3BAKA 1EO5A 5A6JA 4OBSA 1TMQA 3AHYA 2QF8A 4NZJA 4H41A 4PMXA 2WZIA 1OINA 1BVZA 4AYGA 3AMCA 2WC7A 3RCNA 2VX5A 3CLWA 3OGRA 5KEZA 1RP8A 4AYSA 3W81A 4AD4A 3WUGA 3PZTA 2ZUNA 1TR1A 2Y24A 5FKYA 1TVPA 2VT0A 4DUXA 1MFVA 2YDRA 1M03A 4AMWA 4F79A 4BQ3A 3VMPA 4D6DA 1W9BM 1R7OA 2GSJA 1CTNA 4BS0A 2DH3A 4CN4A 1JIBA 3ARSA 3MMDA 4DWSB 3VD4A 2EO7A 3OGSA 4P7NA 4FNPA 2YJQA 3RM4A 3VDCA 1V3LA 1EQPA 2WHKA 4JKLA 1WZLA 3HU7A 1W91A 3TA9A 1JAEA 2CKSA 3B9DA 2DSKA 3AJ7A 3LXAA 4QDMA 4URIA 5BYWA 3KLLA 1AMYA 1GOIA 1RD6A 2OLHA 2FGLA 4F66A 2W5FA 1V6WA 5DFAA 5JBFA 3VPLA 3VO0A 5CPTA 4UFIA 6TAAA 4XZWA 1H11A 1FOBA 4IM4A 1GZJA 1TA3A 4ACZA 4HZ7A 1UOKA 4HOWA 2CCRA 3BUDA 2XVPA 4W5UA 4XV0A 1SYTA 1HKJA 5M03A 1J18A 3AS1A 2WVVA 1O7DC 3B9EA 2CITA 1UKPA 5BCAA 2BS9A 5EFFA 4MNJA 4D1JA 4W89A 4FNUA 2WC4A 4JAWA 1TCMA 2X2IA 4Q22A 4DUWA 1VB9A 2EADA 2EQDA 4OZOA 1BYCA 4FLOA 1QNRA 2OWXA 1HXJA 4NRRA 4B9ZA 1OGSA 1EH9A 4UQAA 4TXEA 3BAWA 4KWUA 2F61A 2A3BA 2NT0A 2CHNA 3WNPA 4PMOA 3S6TA 4QLKA 3VDAA 4MNKA 3DHUA 3ARQA 2WM0A 3A22A 1OT2A 3DX1A 2VRQA 2CBJA 2UY4A 1B0IA 1HP5A 3L2LA 3L4VA 3MMWA 3PZUA 1UD6A 1TQSA 4U3AA 2CETA 2D2OA 2TAAA 3GDBA 4B9YA 1WB0A 2WCSA 4JFSA 3OLDA 3ZT7A 4S3KA 1BGGA 1GOOA 3GZAA 4U2YA 1VEMA 1R75A 4JKMA 1KTCA 4U2ZA 3IJ9A 1GUVA 3UG5A 3MS8A 1M7XA 3OB8A 1DWAM 4AD5A 3NYDA 3W28A 2DT1A 1OBAA 1BTCA 1XV8A 1C92A 4Z2JA 2WPGA 4HU8A 2CERA 1UWQA 3RJXA 3T2PA 1UR8A 3AROA 2VL4A 2DSVA 1W3LA 2WVUA 5LA2A 4EKJA 2VRJA 1HXKA 1UQZA 1E72M 5A2BA 1MWOA 3AICA 3WMBA 1GQJA 1X6LA 7TAAA 1UZ4A 3W27A 3PN8A 2YBUA
chains in the Genus database with same CATH superfamily
2I9EA 4Y2DC 4Y4KB 3TN4A 2HT2C 2XPKA 2Z1XA 3FPYA 3WHXB 4XNAA 4JFPB 2FUQA 1ITQA 3NNTA 3UW6A 3C5ZA 4F0HA 5T8GA 1LMKA 1QFHA 3L45A 3MBWB 3BAIA 4RFOL 3B8IA 1WP6A 1ODZA 3QFDA 4W86A 1PYFA 1WDRA 2WNNA 3UTTE 1NOUA 4R2GB 2X6VA 2CUAA 1WO2A 1F11A 4ZUSB 3FULA 2FX7L 5M7QA 1UMLA 4Z95H 4G7SB 1DVUA 1X98A 4POUB 4KXZI 4WWKD 1E9PB 2YMXH 3AB0B 1ME9A 4EP8C 2ZZUT 1T1ZB 1XGRB 4FQQB 1XLGA 3GNOA 4HETA 4WEEA 3VXTB 4YU1A 2F19L 3HA0A 2VERA 4NQEE 3ZOAA 4HS6B 1TJ1A 2CBIA 2Y6ZA 5T1KB 3L7RA 2NY4D 3RG1C 4BF7A 2ALRA 2Y8KA 3GFXA 2F54E 2C3XA 3NCYP 3NQ8A 1E1EA 3BH8A 2PDIA 3QDGB 1F4XH 5AYZA 3S0CA 2IANE 4G8TA 1BOYA 4AEIH 4C55A 5AYIA 2QMKA 4UQIM 2RDXA 4NO2A 3W2KA 2IPKA 2NZ9C 4Y4FD 3E0VA 3DX8A 4ZFMA 2QAFA 1GZPB 1XTLA 4ASTA 3AUJA 5F96L 3GD6A 1WLHA 4FHAA 2JI1A 2YK1H 1IM3B 4GKZA 1AYRA 1WAEA 2HRPH 4LEXL 4Y4HA 3RL1B 3V4PH 3VTMA 3WD5H 4BCYA 4LCWB 4BK4A 1AHMA 4J39A 2WBXA 1CVRA 3SB3A 4IPPA 1JG9A 1PZAA 1YNLH 5AHFA 4OZGA 1ZGLP 4JQ3A 3MV8D 4W9FC 1X9LA 4FJYA 3V0VA 1ZLDA 4LSSL 4H5SB 2ODIA 2OSLA 4GGHA 3U7BA 3AISA 2YEZB 2FSEB 3KH4A 1TX2A 4H04A 4FI8A 3N9KA 3FYPA 4JN7A 1AXIB 5RUBA 2NY3D 2CM5A 1EF2A 2BLFA 5FM4A 4MKVA 4XKYA 4G82A 2DQWA 3BPNC 1G6RL 2EIKB 1EIBA 2GSMB 2IWKA 4FXLA 4N68A 1X1NA 1QLFB 1E6QM 2EECA 1GOWA 4UIKL 4UTAH 1JCXA 4AUBA 5HA7A 2W07B 2J8GA 1HSAA 1J05A 5ID0A 4ANVA 1U83A 5C07B 3QY6A 1O5QA 3DYOA 2CDGB 4OQ1A 2AERT 3KDNA 2NOYA 1IKFH 4ONFL 1HL8A 4I48B 4JFZH 1ODUA 1NM9A 2VZOA 4ESKA 3F5WB 3UJTL 1WC7B 3NIDE 1EHAA 3BKJL 5ICYB 3FU0A 5F7EL 2MANA 2V5LA 1S5NA 2UY7A 3T65A 4MA3B 3A4JA 1BKSA 1XZWA 3ETSA 2PU0A 1F4HA 4ONHB 5F89B 4NOBA 3C6CA 4XNMB 4GYFA 2OMZA 4NT0A 5JIHA 4B0MB 4X83A 4JS3A 1JXFA 1PD0A 3DTUB 4PJ7E 1SO4A 2DQUL 4OCYH 1QXLA 4HK5A 1D5XA 4C7DA 5CKAA 2XXCB 2DJLA 1TVBB 5AG8A 2INEA 4JG1H 4AIEA 3W6LA 3W76A 2REQA 4AZ5A 4GQ9H 5A6KA 5FKPB 4Z3JA 2EVFA 1A47A 1S5MA 1PNDA 2PDHA 2RCSH 5FYJE 2ZX6A 3IWVA 4V11A 3CUPA 1FFPB 1VBRA 2J47A 3GNRA 3ABZA 5I76A 1A5FL 1G4PA 3IDXL 4L6HA 5JMOC 3WKNA 1UC6A 2OCZA 3SW6A 5L88H 4XO8A 3BWAB 1Z3GH 1A7BA 4U5IA 3SYPA 4HF5H 5EPMA 3MUZ1 2RDTA 2JB6A 2JF6A 2D4FA 5LGKA 5KETA 5T3ZH 2GBAA 2ARJA 1AH4A 4JFEE 5FOBB 4PYSA 1IGML 3RGVA 1ZGLB 2WUCL 4LTSA 4PR4A 5L2JA 4CKVX 1IXOA 2JCCA 3VG0H 4EUPB 3S2MA 1GGYA 3D0LA 4E2VA 4P9HH 1E0XA 4HYVA 4UOW1 4OZFH 4IMAA 4O0ZA 4JZJB 4I3SL 1JCJA 5JUEL 4GD0A 4MZ2A 4FFZH 4FB7A 2Y1VA 3IBOA 3U2EA 2FB2A 3Q2CA 4MJMA 1AO7D 1TNNA 1VFSA 2PYEE 3ESOA 3FO2A 4X42A 1A1OB 1Q9WA 3HE7C 2VISA 1XH3A 3L3IB 1SR0A 4UFJA 1FFOA 4I89A 5A8PA 3B3BA 3PHQB 3H26A 4YHMH 4IRSB 1NIAA 3W00A 4OT1H 1QPRA 5B4MD 2GITA 3OWEA 4PCKA 1BD2D 5EORL 4WGKA 4ES9A 3Q1SL 3GHTA 3HCVB 3ZDYE 3F6JA 1YNTA 1FQ0A 4PJDA 3L7FB 4H25B 1O0VA 5LIKX 2WTOA 4B4HA 4FTVE 1BFNA 3ENLA 2BJML 4TMPA 1E5BA 3CYJA 3FDKA 1RLBA 3VIFA 4Z77B 1AJ0A 1P2CA 2ZICA 3GRGA 4YMPA 4Q7IA 5IFPA 5DR5L 3QORC 2GSGB 4WUKL 1BYPA 3VKJA 2HJFA 3CMJA 2G95A 2NY2D 5I7GA 4EIUA 4NYUA 3U2SA 3AQYA 3OZ9H 4HIJA 2DTMH 3UWVA 3DPBB 4AZ8A 1JK8A 1ZLPA 1HQ4A 4FG4A 4O18A 2GDUA 2WIIB 1OFOA 1MHHB 4WO4B 3MP5A 4MVBC 1FNEA 2NY0B 2R23A 2OL3L 3PRZA 5HSFA 2CLRB 4KMLB 4L8CA 1UKQA 4HUXB 5CCKL 2YCEA 1T2QH 4QDPA 2L8AA 3CCHA 1R19A 1UXSA 5HJ3B 2XFXB 2F9BT 3BC9A 2QDWA 4OF0A 3AITA 4EN3B 3CFKB 2HXTA 2VO5A 1ZMYA 2WYIA 3EJTA 4G3YH 3VD7A 2DQTH 3S88L 3MYPA 3UP8A 2FH8A 2A1WH 3O41B 1WXJA 1T1YA 4GIPD 2YDSA 4C4KO 3UP1A 5LDUA 1KXVA 1LT8A 1TUXA 5I1IL 4H6RA 4MHBA 3HHSB 2QPFA 4KV5F 3KPSA 3NACH 1PG7X 3LNGA 4K4KA 4JR9H 4QT5B 4NZCA 1TIWA 4WWKC 1LE5A 1FYTE 3QQWA 4XZMX 2EXTA 1TFHA 1YYML 1WAAF 2B2XH 4KKNA 3CLMA 3S3SA 5PAZA 3SE9H 1F8TL 5T1KD 1DCEA 2X2YA 1LP9E 3CGTA 4CNIB 5FYKE 5CBEA 1DANU 3OJDA 5C0CB 3S1XA 4J1OA 4WU5B 1BQHA 1DWHM 1NAMB 4HEPG 4Q14A 2K9FB 3TO2B 5MKGB 2MQ0A 3SCPA 3HNTH 3E0FA 5HDBE 1FF5A 3L4WA 4PVMA 3BANA 3N3TA 2WB7A 1UWSA 2W9EL 4DJED 1GHFL 3GFZA 5AD0B 3CUGA 1PDKB 4WOQA 3QQDB 2HRPL 4MMYA 2CD0A 4FRWA 3NUKA 3RWFA 3V4PL 5IESL 1C8XA 3NAAH 1AGEB 4ZFFB 4JPGA 3R43A 3RDKA 2BS8A 3L4YA 3FA3A 1QRKA 4H6EA 1RUQH 2J5LB 4AE1A 4ZI8A 1MAMH 1NICA 1OCZB 2ZF8A 4LVAA 4HJGB 5E5UB 1UUNA 4XO7A 4MD5B 1JGVL 2DQGH 3C61A 3NAVA 2V2HA 4R3SB 1US0A 4G9FE 3RP1A 3TOYA 5EA0H 4DQOL 5FYKH 3II3A 1QOKA 3TKFA 4F7CB 4Y5VB 3UAFA 2PYED 4EOWL 2YPLA 5F3HA 2D8KA 3EOBB 3QEGL 4HK0B 1OOAA 3SJVB 3ZDWA 5C0AA 4YSSA 5E7FA 1ECYA 4JDTH 3D39B 5HGBA 3MSPA 1WBHA 1HH6B 1AR1D 2PDQA 2WMKA 3E2VA 3GU9A 3LD5A 3T81A 2Z34A 1TZ8A 3MNVA 1EJSC 1L9WA 3WDPP 1G9NC 5F4SA 5KVGE 3EBAA 4TLUA 25C8L 4YDIL 4QXIA 3KPMA 2BWGA 2FTPA 3X3GL 5LBSL 2X30A 3H6JA 4R9XA 3PL6D 1HKFA 1MJUH 3D09A 4X5WA 4H40A 8TIMA 1T2XA 3BKML 3DAQA 3ITOA 3L3GA 3VQ2C 4IZGA 2P5WA 2LAAA 2YLAA 4WQ6A 1XYFA 5LIWX 5HHVL 4KDTC 5KYXA 3KYAA 4IOTA 1BREA 4BEQA 2OYPA 3PTQA 3DVGA 4M1BA 3LQLA 1FDLL 3N2TA 4F5CA 1Q6EA 2E77A 1JGUH 3B6SB 3RHWF 3QAZC 4J12A 3AGWA 1NOWA 4E41E 3U9PL 3E6FA 4KRZA 1CCZA 2E6PA 4FXRA 4LSRH 3EZJB 2BSRA 1AH1A 1C93A 2AOSA 1NP0A 2VQTA 3FU3A 2E1DA 1A6TB 3RM8A 1P7TB 1JUFB 3AQDA 1NAKH 3KPOB 2AABH 2F2KA 3S88H 2P44B 2AEIT 3IN0A 4K3DL 2HXAA 3P3TA 3NSJA 4BFNA 3Q4DA 4MJIE 5JZ7C 3S3DB 1BLIA 4LVNB 1IR1A 1P69B 2AQSA 1VP5A 1KWKA 2DVTA 3N18A 4ZQRA 4RUBA 3UC2A 5HD8D 3P82A 4ONGL 5ITBH 1LLAA 2G2RB 3L95B 4AHQA 1UVQA 2XIIA 4QITA 4GB9A 4S0SD 3VXUE 3JV6B 4LRNL 4M7LH 1CECA 1BCIA 3I68A 3T2OA 3GZOA 3TN3A 2J4GA 2Z2BA 1IC4L 2EH8H 2BWDA 1QSZA 3TNMB 2QJGA 3N9RA 1A6PA 3RL2A 1YMHB 1P1ZA 3A6CL 3FQWB 3MRFA 1TPFA 1EAOA 1Z3GL 2H6PB 4KY1L 5FA4B 1XLEA 3G0UA 4NQXB 1IQDA 2A5UA 2ICES 2R69H 4JJ5A 4LSQH 3WSQL 5MI0B 4OCRH 2Y3NA 1JVNA 4P8UA 4N25A 5DD6B 2VLKA 2YAFA 3QG6A 3RRAA 1N2RB 4DLMA 5ECJE 5FB8A 5D93C 4IFRA 4W7UA 1TCRA 2OV0A 3P1VA 1KW1A 4Q8QA 4IGBC 3VFMB 3BK0A 2D0GA 5CJ5A 3MQIA 2QGHA 2CBVA 3KWSA 4KTEH 1I4FB 2OXHA 1EDQA 3IJHB 1MHEA 4G43B 3W2DL 1KCSL 2EPMX 3AXMA 3M0KA 3QFWA 4GOSA 4JTSA 3FRPB 3SB0A 4A3HA 2MOGA 1QRNB 5IQ7H 1OTSD 2VN7A 2W0FA 1AJZA 3DVFA 4DEPC 2BSSB 4FG6D 2R1LA 1YPZB 1M01A 3EDJA 3QUYA 2PWUA 4WY7H 3NJVA 1A5NC 3P2TA 2PZ0A 5LIYX 5D6DA 1HHIA 2F7PA 1O1ZA 1KT2B 4IFOA 2GFBB 4MX7B 3K2IA 1HCFX 1WS8A 2QW5A 1F74A 4EWJA 3A5VA 4JIPA 1KTLA 1T21A 3WLLA 5LNVA 4G59C 4BFBD 1WVZA 5EBWB 5C71A 1DFBH 4JPIB 1NDYA 2OK0H 3ZIZA 2BS71 4OUOA 2RH9A 2FFIA 1KCVL 1NCJA 3QUYC 1EK3A 3FXIC 5IF0B 2FJFB 4NNBA 3BRFA 4JQ1A 4JGMA 2QF7A 1CG9A 3WK0A 4P8QA 4NPKA 4PGEA 2EILB 2EDLA 4PUNA 3D3VD 5CN1A 4Q8NA 2X3AA 4Q8WA 2XG4A 5JQHC 1KTNA 4N0CC 3N6QA 3SE8L 2WZ0A 2Y2YA 1HI6B 3APFA 1MUMA 1C5BL 2WWNA 1HW6A 1Q2SA 1W17A 1H6UA 1OTUC 1OAJA 1BF6A 3WFCL 1TJGL 3I6EA 5GIRB 3HS0C 3VFUB 4XVTH 1D3GA 4KEVA 3RFAA 1JXDA 1NGZB 2B14A 3F01A 4R0LC 5DHVA 4XPTL 3NQBA 1OHZA 4LCRA 3DESA 3MLYL 5DJZA 3MKGA 1PX8A 1CFVH 1LO2L 2E4TA 5GXBB 5CGYC 2DQDH 1LCOA 2H5UA 2N59A 4ORMA 4P5TB 5I1CH 5T91A 4L3ED 3A4XA 5D38A 5EFIB 3THCA 2XH0A 4X4MA 1HU8A 4XIMA 1FL6B 3H53A 4R83A 1XX9C 1EDGA 3SBFA 3OKOA 4BQ4A 5K3VA 2GFTA 4JFTA 3UMNA 3MRPB 2Y3AA 4LCIL 4FFYH 2XJ7A 2VLRD 5CP7B 1EZUA 4TS6A 3RKPA 4P2QB 2HK0A 3NACL 5CD3B 4IMFA 1JGIA 4R53A 5FO8B 4Q2ZA 3PP3K 4L8SC 2EPOA 3OOQA 3DOHA 2F84A 1KYFA 3JS3A 4R9OA 5CPOA 4DXVA 4I8YA 1QR4A 1CE1H 4TSBH 2OULB 2QHRL 4YYCA 5FJJA 2MQCA 2PPAA 5H35A 5IW1B 2X4UB 4RFNB 1ONXA 2YZ5A 3P8JA 4FIQA 3FSTA 4CD4A 3W7JA 4K71B 5B38B 1F4YH 2VDNH 2RFXB 3BUPA 3K0YA 3PS6A 4F2MA 3MW7A 4HJWA 5JH1A 1U36A 4PMFA 3VCLA 1GEHA 3UJIL 2BIHA 4LSUH 4NO5A 2R1XA 3OLEA 5AW3B 2HJPA 3A64A 5INDB 3QH2A 3CN2A 3NCJH 1YHPA 5D2VA 3IEBA 4WHBA 1CWVA 1SSGA 3T78A 5L2KE 1QKZH 3IU4H 1ONQA 1AG1O 4HSNA 4QE5A 3BVTA 4JHUA 1TIUA 1JDEA 2QSCL 5FK9A 3UL4A 2PDKA 3O6KH 4AH7A 4AZCB 4EN3C 3NJNA 2A74B 2J7LA 4IGSA 3VCNA 3KBVA 3QW3A 1S78D 1HTYA 3QY7A 3BP5A 1IFHH 2BOCB 2Q3XA 1RVGA 1FZKB 5A2FA 1C08B 3ULVC 1KFKA 3FW6A 2PTUA 3TA3C 5GRWA 4AHPA 4ETQB 4Y9EA 2IXQA 3L0KA 1BOGA 2VXQA 4WI7A 3QJFB 2JTYA 3WHE0 4GG6B 1UC5A 4Q6JA 5BZAA 1SR9A 2I26N 4I1PA 3WLSA 3MO1B 5F2IA 1KRMA 7FABL 1HDMA 1AD9A 3VFPA 1B4LA 3WENA 4PUKA 1KEMH 2W80C 3SUVA 3B7TA 3DTDA 4PV8A 3SYQA 4GE8A 2MEJB 4GKNA 1E1CB 1UH2A 3UTSE 1NIBA 1XIIA 4Y1SA 4L3EB 4PJ7B 2ZXCA 4LUTA 1QI3A 3SDAA 4HLEA 4JFEB 1QSFA 3H2WA 2P88A 1JWUB 1TO4A 1LWRA 4Z8FL 4X8GA 1NCTA 5HJDA 1H15A 3RKDD 2GJZB 1JDCA 3LCIA 1UPPA 4NQDB 5CGTA 1E7UA 1NQBA 2EDHA 4Z7WF 1UB6B 4TNEA 4W7WA 3T4AB 4P2RB 1T66D 2JJTA 1N8OE 2LGNA 2XN1A 4MJ2A 2INZA 4WHTB 1XUZA 3BP7A 1WV7T 12E8H 4DJMA 4ERSL 1VKXA 2IFFH 3DFYA 4X8JB 2WUCH 1AKJA 3CV5A 3IDNB 3V4LA 1VGEL 2O6PA 2UZIH 2Z8WC 4NL1A 3K2MC 4LRIA 2ZXDA 3LRKA 4NCC2 4AQEA 1MLBB 1JFHA 1XR8B 5BO0D 2VEFA 3DROA 4NFBA 3V6OE 1LE9B 3FJNA 3WHXA 1DEDA 3ORWA 4P8XA 1M7OA 4YNGA 4K2UL 5T1DL 4DEFA 3M0HA 3FYIB 1TV3A 1UOZA 2VDPH 3NWRA 2WBJD 4HIHB 5FGCB 3UPCA 1YYMH 1XD1A 1KRAC 4UR8A 1XZ0B 3MA7A 5EZLB 3S34H 5E5LA 1MOEA 2XI9A 5J6GB 1FVDA 2WQUA 2WTRA 4PWJA 5C6TL 3JT2A 4EZLA 4XN7A 4YDVB 3L3HB 3I2CL 3NDYE 4Z0BH 1O7AA 1RUKH 5F1SA 1BQ5A 3CDCA 4AGLA 5LBVA 3WFHB 4E9RA 1KJVB 4JG0L 5D1XC 5DTFB 2D0HA 1XQKA 1SRDA 4PS4L 4CNTA 2NMSA 3O8XC 3TWCH 1ADQL 3MX0B 4L0ZA 2SFPA 3HBQA 3TEWA 3TV8A 1X5JA 1AODA 1KLFA 3QO1B 1GS7A 4FI7A 4JRWA 7PAZA 1TPXB 1A80A 3D3FA 4A8IA 4NUQA 3IT8D 5F9WB 4LAZA 4ODHL 5HUPA 3QIUD 3FO0L 4G1EA 1YEGH 1FCBA 4RGNC 3AU1A 4E42B 1OCJA 4S3DA 1QHZA 4G9DA 2Y7NA 2VZTA 4K7PH 2F1AA 4NASA 1C7TA 3QORA 5JHDE 2R9HD 3TFKD 1TQTA 3GIVA 4PY7B 2FJHB 2ZXWB 3I84A 3S37H 2V69A 3G3MA 1AG6A 2ZWYA 4I9MA 2BX5A 4LFHG 4U4IA 3RX9A 4YS1A 1YPZE 1BECA 3F7LA 1NJ9B 3NQGA 5FSEC 1CFSB 4QRUA 1ZLUK 1JQXA 2HQAA 3MLTA 4YFLF 4IMEA 3VIKA 4GJJA 4RJEA 1NBCA 4BSWA 2ZZ6A 4DWDA 3QUMB 4ORGB 5F6HI 3TA3A 3U1SH 4H5SA 5TDPA 1FVCB 4TSAL 4OSUH 4ZOEA 1T04B 1E71M 3MUIA 4P8VA 4ZX5A 4AV4A 3K3QA 3COOA 3G8RA 2XG5A 2DVUA 4U1MB 1YNLL 2PYFA 5D5ME 4PRAB 3DX7B 2KAUC 4ELME 3FQ4A 5KYYA 4X5XA 3KTSA 3K5SA 4RDZA 1PS3A 1VHPA 2OYMA 1CS6A 2Q3AA 1PZDA 3QSKB 5D5MA 4O5LH 3L5AA 4GKSA 3TNNB 1PQZB 1FY6A 1YNKL 3UYIA 4N0YH 2A21A 3TDFA 2NUPB 3HGJA 4ZUVA 1AIZA 5LN4A 2J72A 3FFDA 4CAGA 3PULA 4XE0A 3W11C 1C8YA 2ZUUA 3BZFA 3V52H 3OR7A 1NGWA 1BM3L 5EIIG 8PAZA 4LAMA 4KROB 5KTLA 1SOQA 2WMHA 1SGKA 4ODSL 4JGNA 3XINA 6PTDA 3N43B 4MDJA 1K6QH 5GRYA 3IRDA 2KZBA 4PWEA 1P6CA 1KCRL 3G0SA 3CD4A 4PJBE 3IUHA 4P06A 4P59L 5CXPA 1W1B1 3TEXA 2AK4E 1XHHA 2VFHA 5JR1L 3B9OA 3MTWA 2OMTA 4GXUM 1F97A 5FEPA 7PTDA 4OF3A 3LEVH 3M0IA 2PR4H 1GH7A 2ZOUA 1A3LL 3D5OF 5F21B 3EEZA 3RPIB 3IUIA 4KRMB 3GTNA 3R8HA 4BWLA 3AMKA 1Q72L 3D0VA 2W0PA 6ALDA 5IQMA 3IF1A 3AWNA 2CRMA 4K9JA 2EG7A 5H4ZA 4IUGA 3II2A 3STEA 1JPSH 3SDDC 3WD3A 1I8AA 1DQUA 5F1NA 4OKVB 5B7FA 1PJ9A 3QV8A 3EB4A 3QY8A 4IIEA 2WKOF 1RUMH 4X6DA 3PXLA 4NNCA 2NY6C 4ZSOA 1QBML 3BMWA 1UWYA 5GGVL 4P2OA 3WEZA 1T7VA 4YZWA 4JPWH 1B3OA 3IDMB 1GY2A 3H70A 3RX4A 5FGBA 1Q6LA 4GMTL 3ZY7A 2DL2A 4R0LA 3AXLA 1SMDA 3DVNB 1YN7B 3WUWB 2CBTA 4N9CA 4DBEA 4AEHL 5IFTA 3QPKA 1YEKL 4EUPA 5GZNC 4U1HB 5DHVH 2J4WL 2CKBB 1CFNA 1OFEA 3EYSL 1TO3A 1YY9C 4ZAKD 2X6CA 5G4NA 3SUSA 3W6YA 3MRNA 1G01A 4XKMA 5DK3A 5E4EB 1FH7A 2L04A 3CUIA 5C0RH 2PP1A 3FKKA 5DO2D 3SPJA 2B08A 3O3EA 2CK0H 2J56A 4P3DB 1T0MA 3GBDA 1EKOA 4ALDA 4HS8H 2XTJE 1P7QD 5AZ0A 3ILDA 1VYPX 3D18B 4ODWA 2XT1B 4QXTA 4NAEA 3L3IA 2FB4L 1CDCA 2H9AA 3N73A 3H4HA 1HP4A 2WUBH 3VOFA 1Z5LA 4CD7A 5C0BE 4R4BB 3ZHKA 3G1SA 1S5IL 3RUBL 2A0LC 3QYSA 2A3CA 4IBTA 5CIPA 3GZQA 3ASNB 3HCVA 5AZUA 5MEOB 5L4IA 1JYNA 1HKLH 2B16A 2F6UA 3ZE0F 3KPRD 5C9WA 4RX0A 4LGXA 3H9SA 2C7UA 4IG2A 1YYLH 5K1VA 4ZW6A 1K70A 1U0QA 2F2HA 3BD3A 2X89D 5E9DD 3VNYA 2FEEI 5IGXL 3OW1A 3LGEA 1LILA 1DTUA 4ZJ9A 4GUPA 1BXAA 2GSGA 3QDAA 3BDXA 2HRGA 4FTVD 1VPYA 4M6PA 3V5FA 4ZFCA 3M07A 4YHIB 3FK3A 3MUHL 4JREB 5D2NB 3AZSA 2EIZB 4PUDA 4DSYA 3MKVA 2J73A 2XN9A 4GY4A 3GH7A 1N70A 2NSQA 3A3HA 1DQLH 5IIEA 1CI1A 3CZUB 4PRIB 4KI5F 2X4PA 1SYSA 4DCQA 4WK2B 4J3OG 2YBRA 5I8EA 1BVKA 3VD5A 3LH2H 2CGRH 1ZNNA 4QHUA 4HGMA 4WV1C 4WD0A 4M93C 2LABA 3EH2A 1C5CH 3HI6H 2OEKA 1QVBA 1ENUA 3BAEH 3PZ9A 3REQB 3E74A 1XAUA 2J27A 3PNZA 3C8HA 3CFKA 3WIHA 4RWYL 3BJSA 4Y19D 2X7LA 2VUKA 4BH7A 4G6AD 3CFDB 1SLVA 1JNNL 2AJ3B 4XMVA 3POCA 3M0ZA 3K13A 1MWAL 3CIWA 2OM5A 1LK2B 3NPZB 4XODA 4UIOA 2B9AA 4DJDA 2DBLH 1EXUA 1E70M 1OF2A 4KCTA 2OGJA 2ZNWA 1LE5B 2B59A 4MB3A 2PWFA 1W3JA 4NENA 2NVDA 2XZQH 1W0YT 4QNPE 3OC5A 4ZMNA 4FEMA 1QK2A 3FFCB 3QUHA 4IJRA 4OUEA 1OPOA 2UZXB 2BOBA 3ARVA 4E9XA 4RDBA 2QVKA 3SY6A 2Z00A 4IHOB 3VINA 3VD2A 4PJDE 4C6JA 1WA0X 4GI9A 3VXRB 3W2MA 1Q9LA 3EAKA 1GTEA 4FXSA 4HSHA 3BX7C 2VQ1A 3M86A 1PDKA 1LP6A 4FXKC 4GYKA 3B7RL 5I2UA 3NH7H 1FSKC 2AQPA 3GEWB 4N2DA 5DK0B 2JJSC 3BAXA 3QIUA 4QLWA 4LQFL 1WD8A 2BDNH 3QDJA 4TVSa 2Z8VC 3NYZA 5DLCA 2N7BA 4ATLA 4AT6B 2JKAA 3GC4A 1DJXA 2RBLA 8RUCA 3OSKA 1Z9SB 1AC0A 1OGBA 2CO6A 2OMYA 1DSYA 3C0QA 1LO4L 1FHLA 4PJ8C 3TLRA 1EX5A 3FOLA 3UGRA 3AG3B 4CRPA 3KBPA 4AIUA 1ZAJA 3WQ5A 4NQED 1HHGB 1G7VA 5JIWA 2R2BA 1WDWA 3P67A 3LQMA 4AEOA 2E27H 5KS9B 5C0AB 3N50A 1L9SA 3KPQB 1W2KT 3ECBB 3ULSA 1PYWA 3LPFA 3SE4A 3HG5A 4G9PA 2PW2B 3H3KA 4YHKL 4KCWA 3N91A 3GRWL 3MCMA 5FGSA 3IS1X 1XIGA 4Y89A 4Z7NE 4Q8TA 2ZE0A 3VGDA 1QQDA 4GYPC 3KPMB 1MEXL 4M7KL 3PS7A 3URAA 4M5SA 3B3IA 4IJCA 4K38A 1XBVA 3C8FA 1W6WA 4N0UA 4MPQA 4EQ3A 4GLEA 4B3EA 4YS4A 3GSRA 2IKHA 2X8RA 3MCKA 3DH7A 4WY0A 1OIMA 5TE7L 2BV9A 4R34A 3LUTA 3CFJB 2VFFA 4S3JA 4OZGE 3S5ZA 5L9FA 1A5SA 3PDOB 3T4AC 3V1HA 4OTXH 5DHXB 1Q65A 4N0CD 3FO9B 2V2TA 1N59B 3JUZA 3QZNA 4LPXA 3NZPA 4NZDA 5GSRA 5HHPB 4XE5B 1HCYA 5D1ZB 4BQ2A 2G5WA 1TYEB 5E8EA 4AC4A 2J7BA 3EBGA 1DVJA 2DIKA 4B5VA 2XWZA 3U6XA 4GFIA 3EUDA 4HKZB 3WIIH 5ILTL 4R4NC 5EDSA 2CAKA 3HAEG 5ADPL 4H8HA 1U1HA 2YWYA 5IHHA 4N3TA 4RCAA 5JQ6H 2EIBA 2GOKA 3WFEL 3SRDA 4YNYA 2KPNA 2LLEA 1M1SA 2FZNA 4J6IA 5AECA 2ZKWA 4Y19E 2JKWA 1N6QL 1RJLA 3VDBA 4GS7B 1L4IA 1KIPA 1WD9A 2IDQA 2GJ6A 4QHLB 1UXWB 1TZZA 3UO1H 1HSAB 1X5AA 2H7WA 2YPVL 2K1MA 3ME0B 4Y8AA 2DMGA 2FWOB 2HN7B 1TJIH 3PWAA 3CWNA 2Y1YA 4E8CA 5AUMB 4OKDA 1NAL1 2GJJA 3EXRA 4LUJA 1W0MA 4X2RA 5EBGA 2EXSA 3KP1A 1H1NA 5F1UA 3F7VA 4M3KB 4F7PB 3UCCA 4LSPL 1T5XA 2MRYA 3CX2A 4MA3A 2F6XA 2B7PA 2P5WE 4MUPA 4HEPA 2CDEB 4RAUB 3FQTA 4ZTOH 1LORA 3ZTNH 4F15B 1EFXD 1SHMA 3SDXE 3D07A 1Z9PA 3QHZL 4EIZC 4KKLC 2BVPB 3OHMB 3KEHA 4XHQA 2YSTA 1E6SM 3G5WA 3BWUF 2QCHA 4EI5D 2C6QA 3EKLA 3KTCA 4XD5A 3WD1A 3A24A 2IDTA 3QDMD 4CBPA 1R24B 3IMSA 3L3JA 3OWRA 4X6EA 1YKWA 1TCRB 4K71C 4G6CA 4YLWA 5G1YA 4U6YB 4WCYH 3RFZC 7TIMA 4F48A 2R29L 3A67H 3ZJ8A 3L3DB 2DQDL 3MRLA 3FUMA 3P9MB 3QO0B 5DLLA 5AYUH 5MEPA 1LWIA 4JDEB 4PIBA 1NELA 4NYYA 1I0BA 2DL9A 1NOFA 2W0FB 4HOMA 3C2AL 4UV7H 1BJ1J 1CI5A 4OGXH 1GPOL 4YL4A 4W1TA 5BS0B 5D7IB 1RZGA 1HHIB 1GOKA 1ZJIA 3EYVA 2POTA 4B15A 3NVDA 1LQSR 4RRPM 3VI2A 2NX5E 5DC0A 3SQBB 2CBOA 4UIMB 4RMRA 4A38A 1U8MB 2BK8A 4DZ8B 1V6TA 4LEQA 4ZMGA 3LVTA 4QXUH 1S2WA 4M61A 2GABA 4JPIA 4TUKH 3EFDH 4G8EA 3UXLA 1X7QA 1NGXA 4NP4L 3SCUA 4NKIL 3SFKA 1L0YA 3MLUL 1L6SA 3UG8A 1JV2B 5AW2B 1TZHB 3MROA 3COTA 2PBGA 4PGEB 1ICTA 3T0VA 2O4EA 3GMRB 3QEZA 2QL1A 4LGSB 2Z7GA 1QVOB 4HNCA 4TOQA 2C0AA 3PHQA 4ZFGH 5D7JB 3SDCC 1BXVA 5T3XD 1IKNA 1KYOJ 5DQ9B 5F6HJ 3DOPA 5A8QA 4IOFC 5A8NA 2WOBA 3SGKC 4G71B 2QKIB 2SEBA 3TEVA 1LHZA 1K4HA 4HBCH 4KRLB 3KM1A 2H1LM 3MTRA 4H25A 1OWQA 1W1IE 4D6FA 4NRYB 1K8DA 3B1TA 2G30A 5EN2B 4R7OA 4HQVA 3REVA 2G9KA 6A3HA 1WCQA 4FI4A 4Z77A 1VFOA 4BK8A 1W15A 1K3ZA 5EFIA 3NJ3A 2PXYD 2VDMH 2AV7A 3MCLL 4PYGA 2F0CA 3L9RB 1ZA6B 3MNZB 3P3SA 3CWHA 2D03H 3LHPL 4LBUA 5K2ZA 2CIKB 1ODAA 2YXWA 4P49A 5EBMB 1FXPA 2YDQA 1K5NA 1Q3NA 2E8YA 1XB3A 3O0KA 4M48H 3VSQA 3VUSA 3FCUB 3ORJA 4H6QA 4EVNB 4LVFA 2PDNA 4V2CB 3BGJA 1OADA 3G0XA 1XYCA 3MUY1 1BTMA 3OIXA 5D7LA 3LB6D 4Z1AA 3IGAA 4IIQC 2JK2A 3W7GA 2CLRA 2J6EL 3AAZB 3FQUA 1DQMH 3UXFA 4I3RH 1X5XA 1MEWA 2BY1A 4S11A 1E51A 4GIYA 4NSBA 3FFCE 3GSOB 2ICEC 3EZ4A 3F4DA 5A5WA 3NSMA 4OUUB 5ID1B 2YCIX 3R1ZA 4FHBD 5MP6H 3V5HB 2X4UA 3F5JA 4ZMAT 2D31B 3TW9A 2MNJB 1QNZH 1CLZH 3LEXB 2EXOA 3R18A 2D9QB 4Z0JA 2HFFA 3PZIA 2CPUA 5BRQA 1L0PA 2Y0FA 3BE7A 3DUGA 3RJYA 1GVIA 1QHPA 2WNZA 4YHGA 2P24A 2YAOA 5JHLL 3CQHA 1TTFA 4XCNA 2GUYA 5INDA 1E5ZA 3BZEA 3KZSA 2XIBA 2F8QA 2RFGA 4B3LA 3UD6A 3R89A 4R7XA 4OGXL 2KLTA 4LCCA 2VDLH 3E9UA 4KJPC 5E6RB 2HAZA 2NX9A 3PP7A 4LCSA 4JM2B 4PCTA 1VPOL 3B8UA 3FT3A 1UEMA 1UWEL 3S6OA 4J8RB 4PREA 4WDTA 4GH3A 3UZWA 3WFCH 3TJEL 1AQKL 4S2SB 3W9DB 3DI3B 2EDBA 4LIQL 3VXRD 5I30L 3US1A 1CDYA 3MC0A 4MVBD 4BWUA 4ETQA 2R29H 4M1DH 4JICA 1TV8A 3MCNA 1NCGA 2X6AA 2EPLX 1G9ML 4YTQA 2J88H 1HE7A 3CFCL 4LOUD 4OCXH 3W1UA 1KM2A 5D09A 4DQAA 2C9AA 4XCYA 3OKNB 1D5ZB 2WO4A 2YEQA 1JNEA 2YGYA 4TX6A 3ZJKA 5AVXB 2L7UA 1NGPH 3V0GA 1M71A 2Y1HA 2GQHA 3OG4B 2MJWA 3JQOB 2V82A 1ZVHA 4DNMA 3URBA 2RDUA 3O6YX 1NCCL 2FD6L 5F97E 4P2OD 4PH8A 4I7WA 4RDWA 5I6LA 3OAYH 3RCMA 4L1TA 2VFIA 1TQBB 2PUQT 4J23A 4CUCA 2R8WA 2BP5M 2ZYFA 1LBLA 1TKWB 1CGUA 4PV9B 5HGBB 3W11D 5ISZD 3TCEA 3VIGA 1LM8V 4X9FA 1N7ML 4TSCH 5AFDA 3MNVB 3UR7A 3ESMA 4LCQA 4KKBC 1VKXB 3KYNB 5AN7A 2C16A 4M03A 4X8JA 1Z2KA 2PKDA 4ZW3A 2NY1C 2HZHA 1E1FA 2PLMA 1OFRA 4IICA 2O5YL 1OSEA 2D3NA 2AXFA 2EVHA 1XIHA 4PJFE 1QEWA 2DZVA 3WJYA 4KTEL 4H4IA 4CD6A 3T77A 1QRND 2WWOA 3MA9L 3HNVL 2P5WB 4POZC 4XRCB 5DCCA 3HBGA 3S2AA 3P54A 4Y4KA 2J71A 3VTRA 4HIHA 5DC4B 5C7VA 3SJVE 3WS6A 4UXDA 1ALDA 2HH0H 3HC3L 4JFYB 3WJLC 4LSQL 1B90A 3D39E 1UMYA 1OB1B 4MXVF 1W1PA 5CEYB 4HC1L 4LBEB 4O02L 1ACYL 1ERNA 5ESQA 2WWCA 6XIMA 5T3XL 5D96C 3AYSA 2FBJH 1F11B 2CBMA 2GUUA 5JXQA 3CHDA 3ZDXF 3F58H 3RU8H 2G3IA 2OX5A 3MNWA 5FL1A 2GQ9A 1UUQA 2A5HA 4CEUC 4GRWE 1IGCL 2WLNA 3MBEA 4ONGH 5ITBL 1ZBKA 3B0YA 5HI5C 4P4KB 1NFIA 1YRRA 4L4TD 3WLWC 4V28A 2PW1B 4XXDA 3HG0A 4Z17A 3X13B 2AP2A 5KBMA 4AK1A 1EIXA 3UWYA 4DRSA 2ZKHL 3HPLA 4G1EB 4C5ZA 5I6MA 4OD3H 4AIZA 3QZ6A 2ZUQB 2BNRD 3MJ9A 3ZKNC 4MUZA 4UM9D 2GJLA 4ZE4A 3IDGA 2CHXA 4M6ML 5LWYL 2F74B 2GEEA 4PJAF 4PLKD 4TOYL 2XVNA 1RZIA 5EUOF 5HI4D 3FIGA 2NQJA 4G8FB 4ZOCA 5C0EB 1Q0YL 2J55A 4QRUB 4PLNC 4Z7QE 1HX0A 1LEKB 2F9RA 1H41A 2AAAA 3SCWA 1T83A 1IM3A 4GKZB 4HHLA 1G1KA 3ZYIA 5AB0A 3QG6B 4K68A 2IQ9L 2BP3A 1N5AB 1A6AA 5LQBL 2XSBA 2VL5A 4X99A 4H8VA 2ADJA 4U1MA 2FZ9A 2F53D 2H45A 4I3GA 3R8GA 3DXIA 8FABB 3I4EA 4QUOA 4I7VA 2V9UA 3P0YH 3MNDA 1FZOA 1N3NA 1OPGL 3OGCB 3CH9A 4A6YA 4BFAA 3UA4A 1QRNA 2EE9A 3WDQA 4B5SA 4ZUUA 3TBVA 2A83B 1PQZA 3J7HA 3MRBA 4JO1L 1V7NH 1N5YH 4XKYB 4ZUVB 2BMKB 1KT2A 2J6WA 3AHXA 2P10A 3O8AA 2FPYA 4DH2A 2EEXA 2ZTKA 3OXRA 5DDHB 4QIRA 5FACA 3IIXA 3CFEB 4F80A 1PKYA 1NFGA 1GA2A 1QBAA 4AY1A 9PCYA 3LQZB 4TLKA 2J66A 2DBLL 3BVVA 3MRQB 2HMIC 3A4WA 4MZYA 1NDVA 4P57B 1JRHL 1NEPA 2Y89A 2HNEA 4DWSD 3H23A 2NY5C 5E95B 3RNKB 4M4RA 3RWCB 3BJTA 2JJWA 2CA4A 1JFQH 3DSFL 5F7HA 1G9HA 4ACTA 3MSYA 1W3IA 3OTRA 3LDBB 3U0PB 2OMZB 2PLTA 1KENH 3GSXB 2WSRA 2UXVA 1F8MA 2A9MH 3QQ9D 1LDCA 4V1YA 2JKIS 4O14A 3WY1A 3WFDL 3BKYH 4WK4B 2NWRA 2NXZD 3CLFL 5TAOA 2K9UA 3DX4A 5E1AB 1D5XB 1R30A 5I3GA 1W31A 3E3HA 1NGZA 1UADC 1KBIA 3H22A 1BF5A 1BZDA 2WZ6A 3V9FA 4KNTA 4XCEA 2ATPA 4AKQA 4NDMA 4UTTA 3DMMC 3CL8A 3WD5L 1FUNA 2HISA 4C83B 4V33A 3N17A 5AHLA 3W6MA 4GQ9L 4X0NA 4UOJA 4I9AA 2CO3A 1D5IL 1GEQA 3ZHFA 3HS0B 2PABA 1IGFL 4LCUB 2MUCA 2XIQA 1KPRB 1F4WH 2WIMA 3D12B 2WBJA 4Z7NB 1E6PA 2JIEA 3PNWA 2W3ZA 2J21A 2Y7QB 4HB7A 3QI9A 3LZPA 1DWIM 4QG8A 3QZWA 4I85A 1BG9A 1KXQA 5E94A 1V0NA 4Q8BA 2E27L 4Q97A 43CAB 1P7QA 3LM3A 2N7SA 3NDYA 1FWGC 2HBXA 3WLJA 1XSKA 3T6WA 1F41A 4MA1B 4YHOL 4EI6A 4AX7A 2OWCA 4XTRD 3VKBA 3WCZA 4FMVA 1VC4A 2DI7A 5BUGA 1HJUA 3G6DH 4RGOH 3KZ8A 4GOAA 4DHLA 3BW9A 4LRTA 5A8GA 5J0BA 2E9JA 3OQRA 3SE6A 4J6RH 4IBLT 3ZWTA 2I16A 3N4FA 2X1OA 2O72A 5JIDA 2OQJB 1I75A 4WKHA 4LP5A 4N3UA 1UXLA 1WWAX 2CBUA 2E6YA 1KGCE 5A69A 4Y5XA 4N02A 4KEMA 4F7KA 4QWWC 1F8IA 1NC2A 5I6OA 5I1DA 1JCTA 2HNHA 4A35A 3DJTA 3CFCH 1I9JL 1KTRL 1ONQB 3IAPA 1PIIA 4CLMA 3O9WB 3CHXA 2C9SA 3IXTA 1ED3A 2EVJA 1S9WA 3EYOB 1YE6A 3PIQA 2WNWA 4KNQA 2G4GA 1IC7H 3G5ZB 2R14A 4L3CA 1R9FA 2BJMH 4JUSA 5TQ2L 3VFVB 1LK3L 2BOCA 1B3JA 4MDIB 3NTCH 4NIKB 4NQVB 5E5RB 1BYNA 3P2VA 4Y1TA 3L7EA 2BBFA 3H4FA 1XCTB 1JPEA 2YBRB 5BZDA 5TE4L 1IVLA 3HA1A 3NJXA 1XM3A 1VPOH 3ZZLA 3VFLA 3R8RA 3LIZA 1MCDA 1PTDA 1EA0A 1YNYA 5JR1H 5FV2A 1FBIL 2Z65C 4IIDA 5DVOA 5HP5A 2X7LB 1NFDF 2WM1A 4KFOA 3UG3A 5D55A 1QSED 2IXVA 4KK5C 4AENA 5B3SB 1S7XA 2VURA 5J7CC 4Z7UE 1UD8A 2XFXA 4KUZL 4BGLA 2W63A 2ZA2A 3GDRA 2QDGA 3QPEA 1S46A 5CJMA 1QSFB 1NMAH 3MJ9H 4I18A 4KVNH 1NFKA 1ITXA 3WXWL 2QCCA 5EN3A 4P9HL 5A8MA 3T4CA 5I8CB 3T44A 4NQQA 1CD8A 2X6BA 1PVNA 2IMMA 2CLMA 3ZWSA 4C6FA 1YNKH 1A4BA 4LSDA 2FWUA 4FA6A 4LLMA 3T5WA 2R0WL 5IW6B 1J01A 5MI0C 1YHTA 5C0ND 2J6EH 3TU9A 4MSSA 3QQNA 3QXDB 4UQ9A 1OAXH 1LNUB 1EEUA 2HPOA 4YCOA 4XX1E 3WLWD 3TYAA 4JFQB 3HUJE 1ZV2A 1F5WA 3S8HA 4I0PC 1RK1A 4X4ZA 1MUJA 1X9QA 5AZEL 2E7HA 4AQEB 3AXKA 5IOPB 1NAMA 4FTDA 4RQQA 9RUBA 2DQ6A 3O4LE 1LE9A 3F4CA 2BNQA 3C6SB 5AC8A 3QDMB 2XIDA 4V1DA 4IK7A 4HFUH 2RD0A 2E76C 4MZ3A 4OQTH 2ISDA 3U48A 5FPIA 3E9AA 5E0CA 1SJDA 5EU6E 3KUMA 3O2LA 2PZNA 3TONA 2AKZA 3MDJA 3GHSA 4J5NA 4XIAA 3QQDA 1XL6A 2I9TB 3MV7E 3N34A 4XVUC 1FYTA 3DUSB 4W4OA 1GTNA 4FXJA 4ORZC 4O1EA 1MCSA 3CVDA 5AW6B 3AB0C 3FOLB 1FJ1B 4GSDL 2WUBL 4MNHA 2QV5A 3VFTA 4RZ6A 2DYSB 4MIMA 1EZVY 3RUGE 2YGPA 3L3HA 2RQ8A 1HHGA 2F18A 1YMMD 4PW4A 3FGCA 3NGFA 1U92A 4ZFZB 1WFUA 4OJFL 5F7NC 4HJ0C 3ULUF 1SEQL 4F15C 3NQ7A 2Z31A 4UQCA 3EX4A 1M4KA 2BVQA 1IHIA 3N3MA 2CLPA 3M0VA 4F57H 1F1GA 1Y0EA 2E7CA 1TPEA 1XDJA 3IKKA 3WG6A 1OAUH 1F58H 3I3BA 3RVUD 1FP8A 1VPQA 3SJVA 3H24A 4PS7A 5HYSA 3B9KC 4HA4A 2Z6FA 5E8OB 1U8NB 2WCAA 5I0VA 3DIVA 2H0PA 3NQKA 2WXDM 1PKQE 3H2NA 2A9NH 3P9LB 1J0HA 4UMSA 3GSRB 4GS7C 1EDHA 5IHLB 2X0SA 4H9ZA 1VLIA 2C14A 2IH3B 4IRZL 1QO3B 4CC4C 5IR1B 2JKPA 2X1XR 3DUUB 4D8PA 3N41F 3ASOB 5HYJD 1J88A 1P4BH 1E4NA 1PSKL 2FJHA 3GG1A 3PBVA 4PJIA 2V2TB 1SXAA 3UBGA 3KRSA 1S8DB 1ZRQA 4P2RD 3MGOB 4BFGA 1YEEH 4K5NA 2JBMA 3Q8CA 3AIQA 1EC8A 2QCEA 1Q72H 2ZONA 4DTGH 4IBWA 3B0XA 4WJ8A 5FESA 4QHMA 4Q8VA 3T8MA 2AGJL 3B6SA 4KO6A 4TVPD 5J6HA 3OKKB 2IFFL 4Y4HC 1Q0YH 3ULAB 3QIBB 1AOZA 3CPGA 3PANA 1PF3A 3O8XD 4MJ6A 2CK2A 1E8XA 3OLIA 4EIGB 3UJEA 1JV5A 1H7NA 4Z7QF 5HDQL 3Q67A 3G9AB 4M8QB 3I9GH 2L5HA 4N2NA 2YPVA 3Q06A 4HN4A 5DVMA 4TV3A 4WSKA 2QVHA 1XB6A 2JVUA 3KPOA 2DB8A 3H21A 4WFGE 1NCAL 2JLPA 3FFDB 4KFZC 1B4JH 5G4OA 1CO1A 3V95A 3ARTA 3ARBB 1KR0A 4DB7A 4B9FA 1FI8C 1OP3K 2ZWNA 4KZ0A 3M5YA 1NM4A 2XPYA 3HC0B 3IVUA 3APTA 5ABGA 1LGVA 1MHCA 1H62A 2IANA 1T8QA 3TVMD 4B5WA 1TQWA 5M03A 2WZ5A 4JKPL 1TJIL 4MWAA 1NUDA 4KX7A 3MJ8B 2PTTA 1G6RA 4R4FH 4EZMA 1MFEL 2QKFA 3CT7A 3KCOA 4IK6A 3UWWA 3E0WA 2P7TA 4MCYA 4NC1E 5C0DB 4S1SL 1PZ1A 2Z7ZA 3BLLA 4CD8A 3AZUA 4HUUB 3P0VH 1RJCA 1D7FA 4QR6A 4X60A 3ZVVA 5JORB 3H7BA 1H3PH 5I28A 2PTYA 3ELFA 4W7VA 3IF1B 2X09A 5BZZA 5GS1C 3JWDH 5DFVD 1ZFJA 4OLXH 2PF8A 4U31A 1UEYA 3CZLA 4KO5A 4YUEH 1YVLA 4BCEA 5XIMA 1GGCH 1J9SA 2L7JA 3O6FB 4KPHL 1S2AA 3ZHNA 4Y2LA 3VRLE 3P9MA 1J5TA 3IUDA 2HVKB 4N6FA 4WTZA 3QULB 5KSAD 4ODVL 2A4ZA 1I8UA 4QRRD 1A5MC 4ZMTA 2OI9B 4BBWA 5GZOA 1VRXA 2P8PB 3BQUD 4IMKA 5DGRA 3VXUA 2FBRA 3MCG1 3LX9A 5BS0A 1Q8AA 4N22A 2VXVL 3PBMA 2R0KL 2E4FA 3QPYA 5D2LB 4P2VA 3GI8L 4LLVA 4XAFA 3L4UA 2PR4L 4UTBH 4AM0B 1NDZA 3WL9B 4GY0A 3DVNA 1AG0A 3WUWA 5FYLE 1H7XA 2BSSA 5EUOE 3TO4D 3JZUA 4MBRA 4R96A 1QNQA 4U1HA 3QIBD 5GGUB 1F18A 2B0SL 4WI6A 1YBQA 4F9PA 2NNFA 4U1GB 1E9YB 2Z8RA 3D69B 4KKAC 3CDFA 4FOKA 4DAIA 3HZYB 3VNIA 5DEZA 2F54A 1A7PH 3K6SB 4CCEA 1MCOH 1ICPA 4F3HA 2XGZA 1T0MB 5HGHB 3UQNA 3GMRA 4RAVB 1TB3A 4MWFB 1KPVA 2R1PA 2G97A 1A5BA 5GRXG 1RFDH 1HHHB 1G1CA 3BDBA 4CADA 4GRWB 4O5LL 1U1JA 4D8LA 1IQWL 3DBNA 2XN0A 4OF6A 3C2EA 3GHEL 1BA9A 1GORA 1K9FA 5HMDA 1ZV5A 2J20A 1B88A 4WI5A 4LKXB 4XP4L 5I23A 3PUGA 2PMQA 4EI5C 5DXYA 2Y07H 3CVHA 4CVXA 3O6AA 4M7JL 4A3RA 4CMMA 4D0DA 1UP3A 2IAND 3IDIB 2HFTA 4N2AA 3SGEI 1PFOA 2BNUB 2UY5A 1KXQE 4P8WA 2DZXA 4XO4A 3TWAA 3H9YA 4YK4B 3AQUA 4S3GA 4GUPB 5DA4A 5AOMA 1MFCH 1GVSA 3NN8A 5A6TC 1YEEL 2BVYA 1OFDA 1V05A 2E9IA 2KL6A 1NLBH 3HKFA 1HILA 15C8L 1J12A 1J5HA 2PDLA 4W8LA 4ZOAA 4Y4FC 4EOUA 5JIIA 3Q2DA 3DSFH 2MSPA 2X3BA 4IL2A 4GK8A 4HKPA 1P5VB 4OB5L 2O93L 3RK8A 4I0PD 3WKYA 4LSVH 1RV6X 3R1GH 4WCJA 3VOGA 3EYQC 4GW4B 4XPAL 5DJYA 4GVHA 5D7LB 2C91A 4TUJB 4AQ8A 3UTPE 2DM3A 1KDIA 2ZUVA 4JANB 2PO6D 4LHQB 5I6PA 3REQA 5E6ID 1BJ8A 1BVLA 2YARA 1JNHB 1N4XL 2H0EA 5C0FA 1E28A 2FQDA 4HAFA 1TV7A 2RJGA 3GDTA 2F53A 2IAMC 2P76A 4R2GD 2DKUA 4UT7L 1XF3B 4FYTA 3CV6A 4OIAA 1VAHA 1R46A 1MSSA 3CDGA 5INCB 4M5PA 3W7QA 2CIIB 4FMKA 1R3WA 1NCDL 3P0GB 2OWWA 1FH8A 4URKA 4J4PC 3C6EA 1A0CA 1EV2E 3SZKC 2V6AA 3WJLA 2DUAA 2YLKA 4LX4A 3P4LA 1FWRA 2BOBB 3NQAA 3SODB 4F3FA 2DEPA 4P23A 4UZUA 4ELKB 4LIQE 6XIAA 4J8RA 4PREB 4OJYA 4DW2L 2GJXA 1CGVA 1S7TB 4L0YA 4X80L 2GK1A 4S2SA 1JZDC 1BWWA 4J3XA 5J89A 3FV9A 5BRZD 1MRFH 2QV2A 4WW1B 2VUYA 2YJLA 2XTSA 1EDYA 5LXEA 4CMHC 2VDQB 1CZ8H 2ITCA 3MRKB 3HOJA 1E6OH 4X5RA 5AZEH 5K9KA 1JPMA 3KPSE 3FT0A 2EHHA 1G4TA 4KY1H 4JLRA 1GT8A 3IJEA 3KOFA 5I15H 1O60A 2J7CA 1IQWH 1F7BA 2GSIA 3BIKB 2IDSA 4JHWL 4YXLL 5IHWA 4X4KA 1F2XK 5L6YL 4Y6GA 2AEOA 2GJPA 1AD9B 2VCOA 1P4IL 3A4EA 3VFPB 4WEBH 5EBUA 3WGUB 4JHMA 4J2PA 4JY4A 5KS9A 4YBQC 2Z0BA 3US0A 4QCEA 4GRLC 2VR4A 2V2XA 2UUDK 4PRNA 3QPZA 3IJSB 2WXFA 3LHAA 3MRCB 4XN9A 3VXQA 3GSMA 4PZVA 2NQ9A 4H20L 4E3VA 4P2YA 1BYDA 4KROC 1E2WA 4NQDA 3CV2A 3RUGF 2FSDA 2Y1ZA 5GRVK 5BXFA 1W56A 2EIDA 4P2RA 3WN6A 4WFHE 3N40P 1TT6A 2X0UA 3OKLA 4G8GA 4I4WA 4LO9A 5E2TL 4PRWA 3GRWA 2RKXA 4N4QA 3S83A 3BUVA 5HNTA 3GIQA 3CFJA 6PCYA 1RLWA 1RLCL 5TQ2H 3C2YA 4O10A 5HNRA 1EUTA 1XLBA 3B7SA 4UB9A 3VIOA 2ATKB 1OZUA 2QR0A 4BFIA 1YA5A 3KAOA 5DQDH 2E5EA 3IVKB 2DY2A 2V5YA 1RCYA 3KVQA 4O9HH 5LJYH 1ME7A 2Z2UA 3IU4L 2ADIA 1DTNA 1QPPA 1CZ8L 1OGAB 4DPQA 3CT2A 3SJVD 1KCLA 1REQB 3FAWA 2UY3A 4APQB 4Q74A 4WNQA 4Y7OC 3VSVA 3SHSA 5I1LA 3BTNA 1EEXA 4HKXB 5EEUA 2CFFA 5J4MA 3T4WA 3ZXAC 1NWTA 3GI9L 4OJEH 3E02A 1F00I 4ERAA 1GL4B 2VW7A 2J79A 1KFCA 3N06B 1MJUL 5MHSE 1UKTA 2N0MA 4PMRA 4FOMA 2F7OA 4FKHA 4FQIH 4R7NA 4GZIA 4JTEA 2UX6A 3VXGA 1IXPA 4WW2C 5T3ZD 1FNHA 1OE1A 2YZRA 3RBSA 2Z92B 3ZS4A 1IWPA 3AREC 3TIDB 2FWOA 2HN7A 2OAAA 1VESA 5AUMA 2ZIDA 4U0RC 1QFUH 4XX1G 4AXWA 3UZQB 4X3ZA 4ES8A 3DJ9A 4FS0A 3NFNB 4JKKA 1VJIA 4GA8A 4JHOA 2EG8A 2JIXD 4PG9B 3FU7A 2R39A 4R90L 4U1GC 4AF0B 1IGFH 1NKGA 3JV4A 4LK4A 2GG1A 2H6OA 5A6LA 4DZHA 3W75A 1B2WH 2MCPH 4AC1X 3BJFA 4KIEA 2QHLA 1AO7B 1EEPA 3U83A 1P9MC 3RX2A 2HX7A 3HN3A 1I9CB 3GK8H 3TH4T 2Y4SA 3RI5K 5CAKA 4PC8A 2I9LA 3LYRA 3R1GL 3INUH 1U2CA 2X1UA 1TJPA 4ZODA 1CF8L 2Q7YB 1UWGL 4A7GA 4OLYH 3TA3B 2PE4A 4JDVA 4EDWH 1HKVA 4GZJA 1R2TA 1VEOA 3BGFB 4ORIA 4WDXA 3EJZC 4GLRH 3S36X 5GJMA 2OEJA 3SDOA 2XG5B 1SGJA 3DXAD 1IRAY 3GG8A 4E9WA 4CCCA 3SQOL 3OMZA 4FLQA 4DJEA 4GIOA 2HWZH 1BXNA 1FIEA 1WDAA 5EZPA 1TWDA 2FECI 3CAVA 3GKZA 4Z6AT 3GHUA 4GUGA 1ZVSA 5AYXA 5HANA 3N25A 4JR9L 5E1HB 3MHGA 4H2CA 1RERA 4GKSB 3MJ6A 4UIMA 4YJZL 3CQJA 4TTUA 5AYTA 5JLZB 4ZQTA 5HI5D 4W6WB 3EJUA 1RUAL 5DURB 3VA2C 4M8UA 1RJZB 4WEBL 1X44A 2ADAA 3O07A 5LAPA 1IAKB 2J13A 1T6BX 5AKSA 5J04A 5AOJA 5TPWL 1O6IA 2NQHA 1CLXA 1ZHNA 1OARL 2YC1A 2ITDA 1B0RA 1DQML 1W72B 2JQAA 3G1VA 4TV6A 4NCDA 3ARBC 3B0VC 4CA4A 2Q8AL 4OCNC 1A1NA 2A7PA 3CHFA 1FO0H 3E7JA 4QF1B 3U0PA 5CSRA 3KYKH 5KUMA 3WJJA 3MV9A 3BVJA 3BEVA 4V2BA 4WF7A 1S7WB 3K2KA 3GTFA 3RDTB 4DEWA 1US2A 3W2NA 2IG2L 5GJSH 4CC0A 1SJHA