1JDDA

Mutant (e219q) maltotetraose-forming exo-amylase cocrystallized with maltotetraose (crystal type 2)
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
418
structure length
418
Chain Sequence
DQAGKSPNAVRYHGGDEIILQGFHWNVVREAPNDWYNILRQQAATIAADGFSAIWMPVPWRDFSSWSDGSKSGGGEGYFWHDFNKNGRYGSDAQLRQAASALGGAGVKVLYDVVPNHMNRGYPDKEINLPAGQGFWRNDCADPGNYPNDCDDGDRFIGGDADLNTGHPQVYGMFRDEFTNLRSQYGAGGFRFDFVRGYAPERVNSWMTDSADNSFCVGQLWKGPSEYPNWDWRNTASWQQIIKDWSDRAKCPVFDFALKERMQNGSIADWKHGLNGNPDPRWREVAVTFVDNHDTGYSPGQNGGQHHWALQDGLIRQAYAYILTSPGTPVVYWDHMYDWGYGDFIRQLIQVRRAAGVRADSAISFHSGYSGLVATVSGSQQTLVVALNSDLGNPGQVASGSFSEAVNASNGQVRVWRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords 1,4-ALPHA MALTOTETRAHYDROLASE
publication title Crystal structures of a mutant maltotetraose-forming exo-amylase cocrystallized with maltopentaose.
pubmed doi rcsb
source organism Pseudomonas stutzeri
total genus 148
structure length 418
sequence length 418
ec nomenclature ec 3.2.1.60: Glucan 1,4-alpha-maltotetraohydrolase.
pdb deposition date 1997-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09081 DUF1921 Domain of unknown function (DUF1921)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1jddA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jddA01
3TTOA 3N17A 5IFTA 2QV4A 3HG2A 2Y24A 3WL0A 4KMQA 4CU8A 1KBBA 3WMCA 1UG6A 1KTCA 1MQRA 2J78A 1QBAA 3RJXA 3HG3A 2BNJA 2GDUA 1XCWA 3TOPA 2PWGA 4Q7NA 2YJQA 3AHVA 3A4XA 3ARRA 4PBGA 5CSUA 1JZ3A 2WSKA 4H7VA 1UD6A 2PBGA 3HMCA 3NJ3A 3BAKA 4JFWA 5GPRA 1JXKA 2J7GA 1DEDA 2FH8A 1PJ9A 3OLIA 1BF2A 3FXYA 1UD5A 3LRMA 3WIJA 2UWFA 2V3FA 4U3CA 1GQIA 3SUWA 4LPCA 4ZXLA 1J0KA 2XFFA 3HG5A 4XB3A 2VMFA 1GOOA 4YN5A 1W3HA 5A1AA 3GXNA 3VIFA 4N42A 3M7SA 3UEQA 4AZ7A 1NM9A 3WUFA 1HXJA 1QHOA 2E40A 3N1AA 1IV8A 3D52A 1C3FA 2ZXAA 1CXHA 1R75A 1HKIA 4DO6A 4FNUA 1CLVA 1AQHA 2BVYA 2DSWA 3EJSA 2WHLA 3SUTA 3VIKA 3VIJA 3WELA 1TQSA 2GJXA 1OGGA 4P8XA 2X2YA 1T0OA 2WLYA 2FH6A 1CGVA 2W61A 4TX8A 5AYIA 1ISXA 2VZUA 2YLLA 3KZSA 1Q6CA 2O92A 4JL1A 4J28A 4D6FA 5LYRA 4PUDA 3LXCA 3BUIA 4D6EA 5EB8A 3WUGA 1MXDA 4MADA 3MSGA 2GJRA 5DFAA 1GHSA 1GPFA 4W8AA 4FMVA 4MJ2A 1V3HA 1H41A 1E72M 1OT2A 3AS3A 4MAZA 1YHTA 2W63A 3T2OA 2FHFA 5I0DA 1QBBA 1EXPA 4X0NA 4J3UA 2W66A 3K1DA 1C91A 1QWNA 1ISYA 2O9TA 2DIEA 2WW5A 3EJRA 4BF7A 3U7VA 1CPUA 4B16A 3TP4A 1QWUA 4W87A 4AZ6A 4AMCA 2ZWYA 3FHAA 3EJUA 4AZIA 5C8BB 1E6ZA 3L4YA 3IJ7A 1OSEA 2BS9A 2MANA 3GH4A 1I1XA 2Q8XA 1KWGA 1CGWA 4W89A 2D0GA 2CHNA 4V2XA 3CHFA 1VF8A 1ECEA 1CXLA 1EH9A 4FLQA 2ZX9A 4HOXA 3UG4A 1FH9A 1TA3B 2D2OA 5TD4A 1KFWA 2QMKA 1QVBA 4XX6A 1TCMA 2ZUMA 1WZAA 3AHXA 1R87A 2WC4A 1LWHA 2ZWZA 1K9TA 3WEZA 2WXDM 4GI9A 5LA1A 3D51A 5GNYA 3II1A 1C7TA 3CH9A 1BG4A 2EPNA 4BQ2A 1EO7A 4GQRA 3EDEA 1QW9A 2E3ZA 4TTUA 4UNIA 1HKJA 5CPQA 3TONA 3IGUA 5CLTA 1EA9C 3BMWA 2J77A 3VPLA 4CD5A 4CU7A 3WL1A 1X6NA 2QHAA 5A8MA 3T08A 3WEOA 4NZCA 1QNPA 3AHZA 1QNRA 1UZ1A 2YDSA 3AIQA 1HVXA 4QFUA 3APGA 2YBTA 1JG9A 3BUDA 4IM4A 4EAMA 1GQLA 1UWQA 5IHRA 4DO4A 3AS0A 4J27A 2E9MA 3OIHA 1UWTA 3LPFA 2XGIA 4H8VA 2E9BA 4PMNA 3AIUA 3SCQA 2PWFA 1X6LA 4AXNA 3CIVA 2PWEA 2EQDA 1TQUA 1JZ5A 5ABHA 2OW7A 1UA3A 1J0YA 2WC3A 3WFZA 2XN2A 1J11A 3W6LA 2VX4A 2BY3A 2YA0A 2ZOXA 4KRTA 3KEHA 1E0VA 2XSBA 3O9NA 1N82A 5AYBA 3DYOA 1NWSA 3DYMA 2YFNA 4JKKA 2WAGA 1B3VA 2V3GA 2XYLA 1QI0A 1GCYA 2DT3A 3KL3A 1DWIM 1K9DA 3ZM8A 3MMWA 1ITCA 1UWRA 2J7HA 3ZR6A 4PCTA 1PIGA 3QOKA 5JIWA 1ZJBA 4LX4A 2VCCA 4JHZA 2CBVA 1ZS2A 4AYSA 1CYGA 1CWYA 3SCUA 3GXFA 1HIZA 3ZT7A 5BRPA 4B9ZA 4KWUA 1TQVA 1FOBA 6CGTA 1XSKA 4J3SA 3E1F1 3MMUA 2G4FA 1UR1A 1Z32X 4IISA 5EFDA 1JD7A 3LX9A 1BGAA 2GJXB 4AISA 1EIBA 4M8UA 1ISVA 2ZUVA 3VIGA 5E0CA 1UD3A 2WMJA 2J8FA 4MJ4A 4ATLA 3U5YA 1BFNA 3BUBA 3CBWA 4PSPA 3WF3A 3S5YA 5FKYA 4GI6A 5I24A 1ITXA 3A5VA 1EDGA 4L4OA 3AIRA 3RM9A 2W4XA 1VEOA 3VGBA 4D6GA 3ARWA 1XHGA 2JFEX 2WKGA 3ZT6A 1R85A 4MB3A 4V27A 3H53A 3NSMA 3K8MA 1KB3A 4JCMA 1FFQA 3L4XA 1UKQA 1E71M 2CKRA 4MB4A 1CNVA 4OZOA 5A8OA 3PZOA 2QF8A 3UR8A 1FHDA 2E9LA 4J3XA 3W38A 5E6YA 4HMDA 4NXKA 4ACYA 4A3HA 1E6SM 4J3VA 1UR9A 3A3HA 3N13A 3W27A 3ZO9A 5HPOA 3CZSA 3SIMA 1MW0A 1H2JA 1E15A 1SMDA 4FNRA 2JALA 2EACA 4WSKA 3ARUA 4F79A 3PZMA 1A47A 2EBNA 3WUEA 3EDDA 2O9PA 2QPSA 3A4AA 3PZTA 1O7DC 1WDSA 3ZOAA 4DUXA 3W24A 1EDQA 1W1YA 4FK9A 3ZJ8A 1XCXA 4AMXA 2WMFA 2FYVA 1I75A 4QAWA 2O9OA 2CCRA 1HXKA 4HA4A 2WYSA 1CXEA 1UZ4A 4TXEA 1C8XA 2A3BA 6TAAA 4JAWA 4QLKA 2YL5A 1JF5A 3JUGA 1KXQA 3A47A 4K68A 1WO2A 4NX0A 3VGDA 5A6JA 4JKMA 1E5JA 3WH6A 3I3DA 3AMGA 2CESA 3QOMA 3HJEA 2JEPA 2C8NA 2CXGA 2EADA 1KCKA 3AIVA 3K4DA 1JNDA 3LPGA 4U2ZA 2YBUA 5D9NA 2GK1A 1HNYA 3AI0A 4PYSA 2ALWA 1B30A 2J7CA 1UHVA 4FLSA 3AFBA 1R47A 3CUGA 3WF2A 3GBEA 3CC1A 3WD1A 1W1PA 2YL8A 1UD2A 4JFSA 4X9YA 2VO5A 2WB5A 3PTMA 1CGUA 4DWSC 2GVYA 3WY3A 3WUBA 1WCGA 2VRQA 3VMNA 4AD2A 2GUYA 4LGXA 4PRWA 4HZ7A 3NSXA 1DHKA 2X05A 1MYRA 4GZEA 1MXGA 3RM8A 2OSXA 1LWJA 1UR0A 3GM8A 1BVZA 3AXIA 2WNWA 3OLEA 3T0AA 1YQ2A 3BC9A 1ISZA 3AIEA 7A3HA 5CZKA 4WK9A 1UR8A 1V6UA 2OSWA 3BLBA 2EAEA 1QPKA 4DWSD 4EKJA 1OB0A 3KLLA 1PBGA 1I1WA 1NQ6A 4NF7A 3BUPA 1E6XM 5A2AA 3OB8A 3MO4A 4W88A 2PF0A 2X1IA 4P8UA 1E1FA 1B0IA 3VMPA 5ABFA 2A3AA 1SFSA 3F5LA 4MPKA 1KCLA 1CEOA 3G6MA 1CXFA 2OYKA 3UERA 3ARXA 6A3HA 1G9HA 3BMVA 1CGYA 4WF7A 1MWOA 3CZGA 2Z1KA 5CSYA 3FY1A 3GTNA 1HJQA 3PZUA 5HOSA 3ZSSA 3PZNA 7CGTA 4QLLA 1DWAM 4D1JA 3MS8A 1WKYA 1E4IA 3DDGA 4DO5A 4CD4A 3QGVA 3WNKA 4W85A 2CIPA 4HPGA 3A21A 3WD4A 3RDKA 1V08A 1L8NA 5D8ZA 3VX0A 1SMAA 2DSKA 1RD6A 4AZGA 3EMZA 4GO8A 3D5HA 5CPSA 2D23A 2ZXDA 3WNNA 3M6DA 1B1YA 1MW1A 3LMYA 1TQWA 2OWXA 1R86A 3SUVA 2XIBA 5C70A 4IPLA 3WY2A 2G3IA 3WEMA 4ACZB 3BLPX 2NSXA 2ZIDA 1NH6A 2XUCA 4U5KA 2VQTA 4HU0A 2ZX5A 3WFLA 5D9OA 2J79A 3M46A 4E8DA 5EMYA 1IZJA 4UOQA 4LYRA 1MQQA 4JHOA 4R5EA 3LXAA 4ZE4A 2Y4SA 3J7HA 2XWEA 3VGFA 1V0KA 1WDPA 4XUYA 3CZJA 2YL6A 3WD0A 3WF0A 1BVNP 5A2BA 4MTVA 3BSGA 4CU6A 1AQ0A 4UFLA 4LXFA 4MB5A 8A3HA 1OT1A 1KGXA 3PTQA 4FNTA 1BTCA 5HPCA 3ARVA 5I3DA 4AYGA 2F2HA 1B2YA 3SUUA 4D6IA 5A6SA 4PTMA 4S3KA 1RPKA 3W6MA 4R27A 5HDRA 4NRSA 4W93A 4HP5A 2F7RA 5ABGA 3CHDA 1U2YA 2BVDA 1O6IA 1AMYA 3TTQA 1UH4A 1C90A 3T2QA 3KE0A 1TZ7A 1PZ3A 2D22A 3EJPA 2ZUNA 3A22A 3A24A 1OIMA 4HZ8A 4DWSA 2NT1A 3EJTA 4UQDA 1J0HA 4M82A 4KH2A 3VO0A 4Z2KA 3BLKA 1R33A 3W4RA 4Z2IA 1GONA 2CYGA 4UFMA 3W29A 2GK1B 4NZFA 2GFTA 3WD3A 2F61A 5I79A 1F4AA 2YL9A 2XVKA 4D1IA 1FA2A 3VSUA 2J75A 3ALGA 5DO8A 4Z2HA 1H09A 1HJVA 1MQPA 1KGWA 3VKKA 3O2LA 2AMGA 1JZ8A 1E4LA 2BY1A 2D3NA 4GQQA 2VTFA 3DDFA 4PMZA 1GORA 3AXXA 1WPCA 3VM7A 3N12A 1DWFM 4J3WA 1HJSA 3ZJ7A 1W1VA 2WWCA 2F7QA 4B15A 5I2UA 4CCCA 2YOCA 4JZ5A 1CXIA 4MB1A 4IPNB 3DX4A 3VIIA 2FE0A 1WE5A 2WKLA 4AEFA 3ZMRA 2DGAA 5HNNA 2PB1A 3CTTA 2G3MA 3ZSTA 4ZENA 3AIBA 4C7GA 1PX3A 4XV0A 3VTRA 1UOKA 1GVIA 4AD3A 2CBUA 5A6KA 4D6JA 4H8UA 4PN2A 1L0PA 4D71A 4AC1X 4ZE5A 8CGTA 1VFMA 1LG1A 1WDQA 2BVTA 3T0DA 1R46A 2YKKA 2WHKA 4ATDA 5DMYA 3SEPA 3WY4A 2VZOA 1VBRA 4MNKA 1J10A 2BY2A 1GNXA 1E56A 2A3HA 4CD8A 4UTFA 1UQYA 3CO4A 4NRRA 5A8PA 1TQTA 1Q6EA 5BXTA 4OIFA 3VIOA 2WC7A 3L4ZA 4W84A 3VVGA 3AOFA 4HOWA 3I3BA 2W5FA 1DWJM 1EOMA 3MU7A 1PS3A 3DHUA 2VZVA 1HWWA 1JD9A 4OBRA 3PHAA 1XH0A 2XIIA 2XM2A 4EE9A 3A23A 2DSUA 1JAKA 2PI6A 4UZUA 2DH2A 1OD8A 3BAJA 4M1RA 1KQYA 1D3CA 3UCQA 3D4YA 3OGSA 4P8VA 1XSJA 3PZQA 3CZEA 1H3GA 2F7OA 2AAAA 2E4TA 4TVCA 3BVXA 4GI8A 1JFHA 1KR0A 1XH1A 2OLHA 1G0CA 2XN0A 3WH9A 5A8NA 3FHQA 3IAQA 4UQBA 3NDYA 1R7OA 3GXMA 2QPUA 2JF7A 4CCDA 3CZ8A 1W3KA 3S6TA 1E4NA 2BFGA 1OCQA 3L4VA 4CN6A 5LA2A 2XM1A 2ZX6A 3WDHA 3H54A 3B9EA 1HJUA 3VIHA 3RJYA 1VEMA 1VEPA 2J47A 1F4HA 3VUPA 2X0YA 1V6YA 3SCWA 5EFFA 2J7BA 3IJ9A 5IFPA 1OWQA 1MVYA 2VCAA 3MV11 4BZYA 4KGJA 1V3LA 1W9XA 3EDKA 3W37A 2C0HA 4PMUA 1J18A 5A95A 1GQJA 1E73M 4AZ5A 1ZB5A 1EDTA 4NSBA 1E0WA 1CGTA 5FD0A 2ZUSA 3AZTA 3GNOA 5E09A 1WNOA 1V02E 2VZTA 1HKKA 2WCGA 4JFTA 1JZ6A 3ZT5A 1H11A 1QX1A 2GSJA 1V0NA 2XSAA 1E3ZA 1JDDA 2ZE0A 3WKZA 1NOUA 2WVSA 4U33A 3WNPA 1Q6FA 2EPMX 2XVLA 1BYBA 1D7FA 3BVTA 3UETA 1HX0A 2WSPA 4BQ3A 5A6AA 1R7AA 4MDOA 4HPHA 2AOSA 1ODZA 3KL0A 1R8LA 4TVUA 1HL9A 1Q4NX 4J3TA 1UD4A 4MNLA 1E1EA 3LXBA 4FF5A 3BVWA 4PTVA 4DM1A 2Y8KA 1QNOA 1UWUA 3WDJA 2CNCA 4AZCA 3WSUA 4AD4A 4PTXA 3VGEA 3WH7A 3ZJKA 4CD6A 3VDHA 3ARPA 3MUZ1 1WAWA 4U3AA 1NP2A 2JE8A 4HOZA 3BUQA 1JXJA 4HZ6A 1KR1A 2WBKA 3SUSA 5CGTA 2W91A 4BQ4A 5A8QA 4AW7A 4AMWA 3MKKA 3ARTA 3DYPA 5IXEA 1FHLA 3CZNA 3WENA 4P7LA 4E4PA 5M5DA 4BA0A 1FP8A 1UYQA 1GJUA 1P6WA 2WVUA 3SCNA 3TA9A 2WCAA 4OUEA 4B9YA 3CGTA 1ZBWA 2YA2A 5AC5A 1ZL1A 3KL5A 1UR2A 3GBDA 3BAXA 3SCTA 1BYDA 1XH2A 5ABEA 5E0FA 1QI5A 2PWDA 4TVDA 4PMVA 3ZJ6A 1GOWA 1QNSA 1WDRA 3OGVA 2VQUA 4YPJA 1JZ2A 2V5DA 2XVPA 5E70A 2A3CA 3EYPA 1XSIA 2QMJA 4WKFA 1VJSA 5A69A 2UY2A 4UCFA 3NDZA 1ZBVA 2D3LA 1JDAA 3WNMA 3VDCA 2E0PA 2WMIA 5M03A 3QR3A 2NW0A 1BYCA 4WIWA 1LJYA 1TVPA 4CN4A 2XN1A 3AMKA 2BV9A 1KXVA 2CPUA 3CUJA 1JYVA 1ISWA 2JIEA 1CBGA 4U5IA 1WZKA 2YLAA 1VFOA 2BXYA 1K6AA 1QOXA 1UWIA 3S2CA 2G3NA 4HMEA 1E43A 1C92A 4AEEA 1EGZA 1GVYA 5BRQA 3PZGA 1E70M 1C8YA 3GYCA 3WD2A 3VD5A 2WBGA 4J7RA 1VENA 4JFUA 2V5CA 1BPLB 2DQXA 4QP0A 1M03A 2QLYA 5GNXA 4TTGA 4L4PA 3I3EA 1W1TA 3PN8A 4X0VA 3ARSA 2WZHA 2J8GA 3EDJA 1QI2A 5BCAA 5EBAA 5D9MA 1HTYA 2VC9A 5JIPA 4Y7EA 4PUEA 4Q22A 4AIUA 1FH8A 3B9DA 3CLWA 2O9RA 3U57A 1FFRA 3CHEA 3NUKA 3ARYA 2VX5A 3K8LA 1GZJA 4HTYA 3BAYA 4YHGA 9CGTA 1ZJAA 5A6BD 1G01A 4JCLA 2J62A 3EJQA 3KWXA 5CXPA 4RE2A 3OG2A 5FCZA 1H0GA 3W25A 3WF4A 1W32A 4W7WA 1J01A 1AQMA 2YFOA 3QHMA 3MUAA 2J7DA 1XYZA 2XFRA 4H04A 5JBDA 4GZIA 3DX2A 4GINA 3PZ9A 4P8WA 3GXDA 1Q6DA 5M17A 2UY4A 4C7DA 1HL8A 1CIUA 1GOIA 2HISA 2WVTA 2JF6A 4GXPA 3SCOA 2B31A 1JFXA 4JKLA 1PAMA 4FLOA 2YDRA 2X0HA 3AQUA 1J0JA 3CV5A 1U33A 4CGTA 3CMJA 2VRJA 4MNJA 3W53A 2J74A 1FP9A 1SR0A 2DIJA 3BVVA 2VZSA 1TFVA 1B3WA 3WQ5A 1HN1A 1O7AA 4JIEA 3GZAA 1M04A 4ML4A 3BVUA 4NZJA 4AY1A 2CBJA 4B3KA 1QI3A 2VVSA 3K46A 4W8LA 2FHCA 4MAVA 4OBSA 1NWUA 3T2PA 3RO8A 4B3LA 1XV8A 3LRLA 5BWFA 1PEZA 3BCDA 1TUXA 4AD1A 1V6XA 3VDBA 1IT0A 4JFVA 1GOKA 1CECA 3W81A 4AZCB 5FIPA 2VRKA 3SCRA 1B3ZA 1KGUA 1W3LA 1LL7A 3POCA 4LQ1A 1US2A 3DC0A 1UQZA 2J25A 5D4YA 1H0IA 3NCOA 3MSDA 2OW6A 2W92A 4AIOA 2BY0A 3IK2A 3VMOA 3HU7A 4URIA 2G41A 3DX0A 1PX8A 5HBFA 2EJ1A 3AROA 2CERA 2WHJA 3VINA 1V3MA 4P7RA 1CDGA 3VOCA 1CLXA 3SCVA 2D73A 2F18A 1OGSA 3NYDA 1XRVA 2J7FA 4CVUA 3RMEA 2F7PA 1BHGA 2D0FA 3EMCA 3SCPA 3RPMA 1B3XA 3MANA 1OGBA 4PMRA 2CITA 3LPOA 1CENA 1NARA 4XZWA 1E4MM 4AIEA 1W2PA 4WJXA 3T0BA 3F4VA 1GHRA 1VB9A 4E8CA 2W62A 4QLJA 1S46A 2DDXA 2DPEA 3AICA 1VJZA 4H2CA 1HVQA 2WMIB 1EO5A 1UKPA 4PEEA 2VVNA 2VCBA 2F1AA 5A3HA 1KBKA 1JF6A 3RM4A 5DT7A 2X2JA 4HMCA 2V3DA 3K8KA 3AZRA 4UR9A 2XTKA 2DT0A 4BS0A 2ZXQA 5A6BA 2D20A 1Y7VA 2DEPA 1DWHM 4TOQA 1MFVA 3AYSA 1XYFA 1A3HA 1SYTA 4M80A 1EHAA 1EHNA 2ZUWA 5CJ5A 5CGMA 2ZUUA 3WQWA 2Y8VA 1LL4A 4U31A 4FNQA 2WMHA 2EEXA 3WNLA 7TAAA 1WP6A 2VR4A 4E2OA 2EPOA 4WLCA 4LYQA 3GH5A 2PBOA 3FNDA 1W2VA 5JUVA 3EBVA 1PIFA 1UA7A 1BSIA 3BSHA 4UQCA 2VURA 3RILA 3WMBA 1VRXA 1V0LA 1EQPA 3GH7A 2XG9A 1EOKA 1M01A 4N0RA 1HJXA 3VD4A 1GUVA 2UY5A 1OM0A 1W9PA 3IAPA 4D6CA 1H5VA 2G8ZA 4D6HA 1CTNA 4WKHA 4UFIA 4W86A 3DX3A 2BHUA 5ECUA 2VX6A 3DECA 1RP8A 4A4AA 2E8YA 2WLZA 5BROA 3A6OA 1OBAA 5AY7A 1QHPA 3W0KA 1XD1A 2G3JA 3VX1A 2OWWA 5I23A 1J9YA 2VI0A 2ESCA 1VIWA 3BAWA 2WWDA 1HJWA 1DWGM 3O6AA 3MUIA 3THDA 1E5NA 5ABFB 3PBGA 1XC6A 4H41A 5IHSA 2WANA 5CPTA 5BXSA 3VNZA 4WKAA 1W9UA 3IANA 4PTWA 4ZFMA 1XGZA 5BXRA 4CN1A 2V3EA 1E6NA 2VNCA 3L4TA 1BAGA 4M56A 1E0XA 2X8RA 3B8SA 3ZQ9A 3CUHA 3D3AA 2X2IA 3TTYA 3GDBA 3DHPA 1DTUA 2XPKA 3WDRA 3RCNA 3T09A 2VR5A 1BG9A 2YDQA 2GJPA 3L4WA 5I6SA 2CETA 3OLDA 1BGGA 1NWRA 5GNZA 1UH3A 3IJ8A 4LYPA 1QNQA 1JYNA 3VD7A 4CKQA 2WCSA 3WDPP 3OA5A 2FGLA 5CQ1A 4AZHA 4PMYA 4AWEA 2C7FA 5DT5A 1UH2A 4YHEA 1XD0A 1LQ0A 5FL0A 2OSYA 1C93A 4DUVA 1B9ZA 4GO9A 4QDMA 3CZKA 1UKSA 3M07A 1NWTA 2IUZA 4IUGA 3VSTA 3VGHA 5GQBA 1OIFA 2Z1SA 2RGLA 2WMGA 2CKSA 3W82A 4OJYA 2DSVA 3ECQA 1RH9A 1E55A 4UOJA 1RP9A 4UFJA 3WQVA 4WSJA 3HN3A 3G6LA 1EQCA 1ZBKA 3WF1A 5BYWA 1UD8A 2EABA 1CGXA 4JL2A 1JL8A 2WVVA 4F66A 5CG0A 3BCFA 1E3XA 1OD0A 4FNSA 4GZJA 2DH3A 4OKDA 1LLOA 1V6WA 4RE3A 4PCSA 3VD9A 1E6QM 5KEZA 3QHNA 2D0HA 3GXPA 4EK7A 4HA3A 1GJWA 1JI1A 4OOZA 1VAHA 1W3JA 1B3YA 1KQZA 5F7UA 3WMSA 3AMLA 4EANA 5E1QA 2OYMA 2ZX7A 1KXTA 1HKMA 3ZR5A 1E9LA 1JYWA 3WBAA 1V3KA 4Z2JA 1E6RA 2VT0A 1V3IA 2JEQA 3UG5A 3AYRA 1X1NA 3AMCA 3PZVA 5I77A 1MFUA 4W7UA 1D2KA 4W8BA 1H49A 3FAWA 3AS1A 3SURA 1H1NA 2D1ZA 3CHCA 4DWSB 3EMQA 1CZ1A 1VFFA 3CUIA 4F9DA 4FNPA 4UQ9A 3THCA 2BHZA 3WQ8A 3PTKA 1FH7A 1UWSA 3AHTA 5LA0A 4AD0A 2VJXA 5D8WA 3WDIA 3N18A 4DM2A 1BQCA 1G1YA 1UUQA 5E9AA 4M81A 2IGTA 1TG7A 1V6VA 2WK2A 3F5KA 1UASA 3NIYA 1MW3A 3VDAA 4AD5A 2X2HA 4ATWA 2JIWA 2Y2WA 4BQ5A 3VNYA 3B9AA 1DP0A 1TMQA 4UQAA 1E6PA 4ZEPA 2ZXBA 4HA1A 2WMKA 3MMDA 3CMGA 2F1BA 3OBAA 1ZU8A 1UKOA 1H4PA 1K9FA 1TE1A 1BLIA 4PMQA 2YA1A 4MDPA 4KGLA 4PMOA 4ACZA 2FGZA 3WN6A 4CD7A 5A94A 5HXMA 3RIKA 1JYXA 4UZSA 2E8ZA 4S3JA 2Y5EA 3AIWA 4M24A 2BXZA 4OOUA 3BXWA 3GXIA 1NP0A 5BXPA 3KLKA 1NOWA 1J0IA 4FLRA 1J12A 2GDVA 3S5ZA 4KRUA 3N04A 1TVNA 1W91A 1KXHA 5D9PA 1KWKA 2XJ7A 4GIAA 1GOQA 3VIMA 3MV01 1KTBA 2XVGA 3WQ6A 3N11A 4XZBA 3QHOA 4TX6A 5A2CA 3GXTA 4PMDA 1JDCA 2WPGA 2A3EA 1R34A 2UY3A 1NOFA 2XVNA 4UFKA 1US3A 3OLGA 1GW1A 3CZLA 2EPKX 3UG3A 2HVMA 4W5ZA 2DSZA 4UOZA 1IZKA 4QCEA 4RL3A 2DT1A 2XFYA 1UR4A 3AISA 2RGMA 1PPIA 3VM5A 4NXSA 1V3JA 4DUWA 1WZMA 3F5JA 1BYAA 4MNMA 3BH4A 2IXUA 1JIBA 1E40A 1HP4A 4NI3A 2PWHA 3GNPA 4HU8A 5I78A 3LRKA 1QHZA 2D24A 2WM0A 4AZBA 3W26A 1JZ4A 1M7XA 1VFUA 1V02A 4UQEA 4PSRA 2ZUTA 3CPUA 1GOMA 3BGAA 5M3WA 2CEQA 2BHYA 4W7VA 1M53A 1TR1A 4GKLA 2DT2A 3BAIA 1LL6A 3ARZA 3ARQA 1W9DM 2ZX8A 1G5AA 1JNEA 1QI4A 3UESA 3K4AA 4D6DA 2FDMA 3D4ZA 2EXOA 1V03A 1HT6A 1MW2A 1U30A 2EPLX 3LPPA 4QCFA 1W9BM 5JBFA 4U2YA 3L2LA 3ZIZA 1K9EA 2WVVB 3OZOA 5I5RA 3VSVA 3TV8A 5IDIA 3L2MA 3NSNA 1C7SA 4CVWA 3VILA 4ZXOA 4F9JA 2XGBA 1CXKA 1JZ7A 3GNRA 3CUFA 4BCEA 3PZIA 4H8HA 2FHBA 4P7NA 4UFHA 1LG2A 2J7EA 2VOTA 5A6LA 3HG4A 2TAAA 2X09A 3WBEA 4P7QA 3FAXA 3MUY1 4V28A 1HP5A 3OZPA 3VD3A 5FOOA 3MI6A 4GPNA 2VL4A 5KZ6A 3POHA 3VU2A 4Z2LA 5A6MA 4OGZA 1Q6GA 2CBIA 4C7FA 4M29A 2VX7A 4W5UA 2V38A 3AMDA 4F8XA 3L4UA 5JBEA 2J4GA 1ODUA 3H55A 3AJ7A 4PMXA 3AXHA 3A4WA 1VBUA 2OYLA 1TA3A 4D72A 3VIPA 1SZNA 1J0ZA 5DEZA 2PC8A 1C8QA 2YIHA 3EDFA 5DF0A 5AC4A 4CCEA 1B31A 3OGRA 3WDQA 3N15A 2VUYA 1JGIA 3WY1A 3U7BA 1PX4A 3U5UA 4P7OA 1G94A 3AS2A 5E6ZA 2XWDA 3HZ3A 2F8QA 3WQ4A 1WZLA 2WHMA 3FW6A 4A3YA 1LF1A 1AVAA 1ZBCA 1UKTA 1JAEA 2CHOA 3ALFA 1QW8A 2OWCA 2WZIA 3W28A 3N9KA 1OINA 2ZICA 2IXVA 4TUFA 5FL1A 5C71A 1ESWA 3WNOA 2XHYA 1WB0A 2W67A 1HF6A 1B90A 3TTSA 1W9VA 5CLWA 3WH8A 4CUCA 3AHYA 1JI2A 2WZEA 4RE4A 3FN9A 3SCSA 1PZ2A 1GQKA 3VGGA 3UR7A 3WH5A 1V0MA 2NT0A 4Z2GA 3AZSA 3D50A 2EO7A 3DX1A
chains in the Genus database with same CATH superfamily
3TTOA 3PSWA 3UG8A 3TW9A 4KMQA 3UACA 4CU8A 4S1RH 4WX2A 3C8HA 1LROA 3JS3A 4FQXA 5ISZD 4OLVL 3DUUA 3VTMA 2BMBA 3FUKA 3NJ3A 3N40F 3WIIH 5JMOC 5FEXA 4TSAL 4OBTA 3NZUA 2WKJA 4BH7A 2XFFA 4AT6B 2X88A 5KS9F 1Y6MR 3L5IA 2PYEB 3VKDA 4MWFB 1NM9A 5IIEB 3UADA 4PH8A 4FNUA 5JUEH 1F6FB 3OHXB 3VIJA 1GA2A 3QPXH 2HS8A 4G43A 1NEZG 1OM9A 1XLEA 1WBYA 3JVFC 4GABA 1YN7B 3TT3H 1S8DB 5C0IA 1T0MA 3MJ8A 4S0HA 5EZLA 2EDJA 1IO4C 1E8ZA 3IDIA 4Z8FH 3C2AL 3SR7A 4XNAA 4MJ2A 1V3HA 4HV8B 3TWBA 3NL3A 4DQAA 5AW6B 4FQHA 3QUXB 2W63A 3H12A 5T3XD 2GYIA 3K1DA 1G7UA 3VJ6A 4LKCA 3D0CA 1S4IA 3SBFA 3CLEL 5IZ7A 4AYDC 4N0YH 3WQOA 2V9UA 3E3QE 2Q8XA 1CGWA 4LEFA 2CHNA 3CHFA 2X44D 1ECEA 1CXLA 4FLQA 4KWOA 1R5WB 3O9WD 5FFGA 2ZUMA 3L0KA 3AHXA 1ND0B 2PEVA 2MQGA 5LA1A 2G97A 2PPAA 4NT0A 3GE7A 3N6HA 3CH9A 1D8WA 4KHXH 5DGRA 1W1ZA 2ZYHA 1EO7A 3NPUA 3BRDA 2NY5C 3LRSB 2DIAA 3M6YA 2YAHA 4RDYA 4YE4L 3IGUA 4N2EA 1TSHA 3NZSA 4XE5B 2AQ2A 1L0XA 2NW2B 3WS6C 3DA0A 3P5ZA 1QNPA 3RPBA 3O4LD 3P80A 3AIQA 3WIIL 3LSBA 5KBDA 3PXJA 1A2YB 4D0DA 3CNYA 2CGZA 1YECH 5EN3A 2XIMA 4HN4A 3JR2A 3S97C 2AXGB 5I1AB 4GUIA 1KRAC 2IANE 1UWTA 1GXEA 1AGEB 5B38G 4TUOB 5AVRB 3W75A 2NY0D 2DYSB 3M0HA 1KJMA 5JUEL 3GSNH 3E8VA 4OJFH 4Q9RH 4I9MA 3WTYA 5FXCH 3C2SA 3UC0H 3HG1B 2DT3A 3UX9B 5C0AE 3UXAA 3W7NA 3T42A 4TTDD 3TT3L 1XR2A 4S1FA 4Z8FL 2PABA 1KW1A 1HG3A 1THAA 1Q1PA 4PR4A 3TK7A 1ZE3C 2QKSA 1DUYA 5FW6A 3TWAA 1E5AA 5IB2A 1IKOP 2WNZA 2WAHA 2BGNE 4M8UA 3ITLA 1I8LC 5D1QD 2O61A 1WWWX 3N3MA 3O2WH 4N0YL 4LVNC 1OZUA 4KK5C 1K02A 4KKAD 4IBSA 1EX1A 2PP3A 4NN6B 4FA6A 2FBOJ 2R0LH 5GGTA 3FCSA 1XLGA 1R3KB 2MTAA 4XVOA 1MW0A 1L9RA 4KCTA 4KHXL 1MHCA 3AWFA 3SKMA 2E7FA 2VABB 2WJ5A 3ZOAA 4CSTA 4UTMA 3QI9A 1XCXA 2GT9A 1OK0A 4AMXA 3TMQA 2FVLA 1TRDA 1KJVB 5KSBE 3I7RA 3AQZA 1YECL 4KRZA 4PV8B 5KW9H 3WH6A 3I3DA 2EXYC 2FZMA 1F3DH 5IOPA 4V1YA 2QIWA 1UMYA 5BVJA 4V11A 2F53A 2W6RA 3BP5B 3G5YB 1F4YH 4NWTH 2QYGA 4FXTA 1B30A 2OVLA 3QJVB 5C0NC 1R47A 3E0GA 4N8PA 5C07E 3GBEA 4OJFL 4Q9RL 4RFEA 4X9YA 5C0BA 4IIFA 3GSWA 3LLXA 2OFQA 4PRWA 4HZ7A 6XIAA 4A2SA 4W4NA 3TYDA 2CWNA 5DJAB 2OSXA 5EC1B 1T1YA 3LZPA 4IPIA 3LTSA 2DZUA 1FGNH 2QFRA 1I8IA 2JKJA 4DOHE 4JY6B 5C0DB 2A3AA 4ZUVA 1SFSA 3V4LA 3F5LA 4MPKA 5D2NE 1P1VA 4FERA 3O2WL 1NCHA 1CGYA 4H6KA 4YK4B 1RZ7H 4KDWA 5IBXA 1Z6KA 4C1NB 4HPYH 3LS9A 2O5YH 5DZVA 5GZNC 1WS8A 2P88A 4J4PD 3HE6A 4HCIA 5JW4N 3QBUA 1G7QB 5IRPA 3MA9H 1J9SA 4KQ0A 2DSKA 1RD6A 2R0LL 3A12A 5IW1A 4A6YA 1VGEH 1MW1A 3AITA 4L1HA 4BFRA 3KPPB 3RWHA 3CVCA 4X4KA 2Y1HA 4FYSA 4X6EA 3CSPA 4M1GH 2NZ1A 1QBML 2VM9A 3WFLA 2QSTA 3O15A 4G1NA 4BWLA 3LXAA 2ZRVA 1KG0A 2Y4SA 1QPNA 2OZ4H 1OK8A 3T0EA 4PGLA 3BSGA 3MRJA 4P04A 5IOBA 3MSPA 4LDOB 2Z31D 5KW9L 3EXJA 5IB3A 1B2YA 3SUUA 1TTFA 4ZQMA 5I76A 5AYUH 3V5OA 1AD0A 1RPKA 5F9WC 1LE5B 1F4YL 4HP5A 2DY2A 2P5PA 4BQ9A 3D18B 2OQLA 3E6EA 1CYWA 3HAEA 3UJEA 3XIMA 4AWSA 3ML8A 2B81A 1TZ7A 1YDVA 3BJLA 3KRUA 1F3JB 3A22A 5EU5A 3C5ZB 4DWSA 1LP9B 2B15A 1IC4H 2PP8A 2CYGA 3ZE0B 5KBPA 2E5CA 2ODHA 1JK9A 4MAYC 3FLUA 2FJGA 3PP3K 4C56B 2X10A 1VZGA 1HFBA 4B53A 1FGNL 4HJWA 3HPXA 5CZXC 1OCJA 4C6OA 4GQQA 2VTFA 1WPCA 3VXGA 4GRLC 3M0ZA 1K3ZA 3V6FB 3QJRB 4JZ5A 4YMPA 4IPNB 4YSDA 2Z35B 3FHEA 4HPYL 2O5YL 4UU9A 2VIRA 3OAZH 2QADC 5CFAA 4AD3A 2PTXA 1PZ5B 3AALA 4ZE5A 1MJ7H 2NXGA 5D7IA 5FJOA 5E1AB 3MA9L 2YKKA 3GJFA 2J55A 3Q8CA 3AYVA 4GYJA 1CVRA 1VGEL 1PXGA 4ZAKD 3M47A 3PPHA 5AYTA 4R7JA 4POZD 1Z9OA 3G1XA 1IYXA 2FZ3B 4M1GL 2BSRB 2QT3A 1QZNA 3NQ8A 5HULA 3E38A 3STFA 4EEEA 4WNQB 2AMUA 3ZLQC 2WLIB 2XIIA 4GW5B 4IBZA 4FEZA 3G6JF 2PE4A 2OZ4L 3CWOX 5A3IC 3JV5A 1UP3A 3MVIA 4ICNA 3EOBA 4AOFA 3A4DA 1UJ3C 5DZPA 2XH7A 2VLLB 4ODWB 3ML9A 1X4YA 3S3JA 3W1MA 4TVCA 2OZ0A 4AQLA 2R1PA 5AYUL 1RZGB 1GKRA 4A05A 4DUOA 4JHVA 2R8SH 3LUTA 1Q4WA 4XXWA 1I8JA 4NILA 4PJ7E 5MERB 4WUUB 4GIEA 3LQLA 3L4VA 4HU3A 2CBTA 3CXDH 4PRTA 3VIHA 3APMA 3WUZA 2ZAGA 4KGJA 4JN8A 3SSGA 4LVEA 2VFIA 5FV2A 5E94A 3UWUA 1KYOJ 3KOFA 1D2PA 4JGUA 3U7YH 4RW3A 3BP6A 3BG3A 3ZT5A 1R17A 1MIMH 3KJ6L 2L5HA 1FFNA 1V0NA 1O5PA 1QRKA 1NOUA 2BSBA 2G0LA 5AOLA 4BRVA 4YOKA 4MDOA 2HLAB 3W2JA 4TVUA 3TW6A 5ABDE 1D7CA 2VDQB 5B7YA 3VXOB 3IJSB 4K1GA 4PTXA 4DCQA 1MJ7L 1F74A 1WAWA 5J1TC 1W72H 2WBKA 4BQ4A 5CGTA 2WXQA 4F15B 5D7KE 1RULH 2JJSC 3VABA 2F54D 4LKXB 4OIIH 4S3AA 3GJFK 4C6CA 2O7QA 5TAOA 1ILUA 4NO3B 1KCUH 1THFD 1ERNA 3LQAH 4YPJA 1WAPA 5F71A 3G2GA 3WKYA 1IAMA 5A69A 4EXAA 3MV9D 5DJ6A 4N4YB 3UYOD 2E0PA 1QACA 1CFVH 1GOHA 1X3DA 2YPLB 4BFKA 5DRCA 3U1PA 2DMKA 5IWLA 3WCYA 2YLAA 1UR3M 1ZTXE 4AEHH 2YUXA 3CQQA 3I75A 3LCIA 3PPCA 2JIXA 2Y7NA 1X9UA 4P9HH 4QHRA 2WXGA 3ESMA 3PZGA 2QR6A 3WD2A 4LANA 4QD2E 4IW4C 2HKFH 4GG8B 1WX0A 3CXDL 3UP8A 5JORA 1Y1DA 2VDRH 1UP0A 5IW3A 1EGJH 3TU9A 2X42A 4O19A 4PJXF 3ARSA 4PJBF 3F8UB 2RDWA 4GSUA 3NFSH 2VC9A 2GAZA 4PJ8A 3TH4T 2NXIA 2NWRA 3U57A 2RMNA 4BCYA 2AQVA 2VE6A 2NY3C 1ZJAA 3GSUB 2YEVB 4F33A 1H5BA 1MIML 3VFTA 3QV8A 3U46B 1JCVA 4PRBA 2DQCH 3G1AA 1FHNA 3W11C 2KZHA 5FB8B 1ONQB 1SXCA 3QNZA 1K4GA 2DYRB 5K9OA 2OEKA 3SPJA 4DAIA 5T3ZH 5G4WA 3RK8A 5AZUA 1GYMA 1V51A 4MKTA 1HN1A 2OX5A 1H3TA 5LNUA 4HF5L 3FO9B 1DVUA 4L4VA 2XWZA 2F08A 3VVVA 2BS71 2DIKA 1RJYA 3MRIB 3W5MA 4Y4HB 2FPTA 2GZXA 5TPWH 2JI1A 1RULL 4B3LA 1CD9B 4OIIL 4PMFA 2ZKHH 3H4GA 1IGYA 1DEEA 2RJMA 5ID1B 5AKTA 2YN3A 5FKPA 5FIPA 5D6CA 3LQAL 3V0UA 3MBXL 4BZ2A 1MSPA 3OPZH 1XIBA 2FB2A 3MCMA 5JXED 2ZSVA 2W92A 1I1AC 2RFXA 4FF9A 4O51A 2Y2YA 1CFVL 4KKRA 2OTWA 4CC4C 4JN1H 1MEXH 1UG9A 4LOVA 4AEHL 3GMNB 1G9NH 1P1MA 4YQXH 1I3GL 1R3QA 1T5AA 3VWJB 1AQ8A 5T5FH 4P9HL 1BKSA 1MCEA 2FJKA 3DG6A 4L4JA 2P26A 1G4TA 2VDRL 3TWYA 1QFWI 3K8KA 3W85A 4GP8B 3Q06A 5A6BA 2E27H 4HHGA 1EHAA 3NFSL 2F8IA 1UEMA 2J8UB 3WQWA 3IE4A 2Y8VA 4U31A 4FNQA 4ISVA 1SJEA 4AAJA 2VR4A 3OEXA 4PW9A 5JUVA 2I9LB 2LU4A 4BGLA 2Q3RA 3R89A 4NJKA 3NQDA 1TPUA 1OZMA 1GC1L 3HOGA 2A6IB 4PRIB 4PUBH 4PBWD 4K38A 4GKNA 5A16B 4LEQA 5I2IA 4EAEA 4L80A 4XKMA 2DMHA 1YEHH 5T3ZL 4OLYL 3UVAA 3CB3A 4NIYE 3LOWA 3UTTB 1W3NA 3KVKA 1BXAA 4CC0A 3KPRD 3AG1B 4A1RA 3LKPA 3S7GA 2VQ1A 3R4DA 5TPWL 2N1TE 5INCA 3IIPA 2ZKHL 4L4LA 3B8SA 4Y4FA 4P5TB 5F0MB 1IAKA 3RCNA 4YPGA 3BZDA 4H0HB 4E9QA 4OCRH 2F5BL 1JR1A 3S42A 1A3XA 1DVFC 3OPZL 4XN1A 4REQA 4QWWD 2XBTA 4NQTA 2A0LD 1DCEA 1R9FA 3MRMB 2NQHA 4AVOA 2AKRA 5CR8A 3VGHA 1NGXB 1MEXL 2APFA 3BWSA 2RGLA 1PLAA 5HTSA 4OJYA 5IROA 5T1KA 5HYEA 1G9NL 1RP9A 1AH3A 3UZEC 1UP2A 4YQXL 1A0QH 5T5FL 4M9OA 4JKPH 2KDGA 1XR9B 2N0MA 1Z3GH 1Q9WA 3ZE2E 5AD0B 3W2MA 3C0LA 2J21A 5GS1B 4RE3A 4PCSA 1YLVA 1ADQA 3EYQD 4GH3A 2GI7A 3UAJC 2I5IA 5IHLB 2E27L 1AL7A 3PAVA 3W39A 5T3XH 2J43A 4F7CA 1LGVA 2D8KA 4F9PC 1KXQE 1YMMA 4M3JA 3GMOB 3MDUA 3MY9A 1YEWA 2X6AA 3AREB 4G42A 4YZWA 3APNA 3H2NA 1XF4B 5I1GH 3AS1A 3HZYA 4PUBL 5IVXA 3BURA 5FV1L 2X1XR 1SXBA 4FNPA 5EU6B 1IBFA 5EDXA 1U1JA 3U9UA 1GGYA 2CLFA 4H7CA 2KBGA 4XIAA 3EBHA 3B9AA 1KIUA 1EZSA 1TMQA 2HTLD 2PDPA 5I74B 2YBGA 3W1NA 1K9FA 2W0KA 2NY4D 2ZG3A 3WN6A 2V37A 1JTTA 4L1GA 4K39A 7PTDA 3HI5H 3GKZA 1NEYA 2NXZB 1NP0A 3CFTA 1TVNA 4HS3B 4OCRL 4CLMA 3PHQB 2XICA 4BHUA 2PDUA 4OF5A 3QSRA 3WFAA 4L4TD 2PCYA 4AT6A 4M6UA 3UZ5A 4LPYA 1ZTVA 1FA4A 2EPKX 5MENB 4AYEC 4MWFA 1A8ZA 1MMFA 4XD5A 1UR4A 1OGAE 3LBMA 4NQVA 1A0QL 1TEFA 3B8VA 3BH4A 4JKPL 4FQXD 2OQYA 2C13A 1U8IB 2FGBA 1JZ4A 1M7XA 2C4XA 5CGYC 3DSFH 4JVPA 1RKRA 2CLKA 1SYSA 3ETBF 1S8DA 1QI4A 3QGKC 4XPTL 3KHJA 1U30A 3MUHL 5T3XL 5G4NA 1P4UA 4HV8A 4MKSA 4ZPVA 4L3FA 2YGOA 2ALAA 3QUXA 9PCYA 4BFOA 5I1GL 4N2MA 2BSSB 1M3JA 4KC3B 2HJLA 5F97E 3N29A 4H6QA 2RKXA 2C16A 4W5UA 1EUTA 3GLDA 2BOBA 5JBEA 3FYPA 3R2GA 3P67A 3MHZA 3TR2A 1N5YH 1XH3B 1R5WA 5DF0A 4FFVD 4KO9A 4NRYA 1R9YA 1WUZA 3SDDA 5E6ZA 1G67A 3WQ4A 4XODA 4OQTA 1UUMA 3LRSA 5B7EA 3K4WA 1MAMH 1OINA 3CT2A 3WJYA 3WAKA 2NW2A 3I6KB 5FL1A 4I9WE 3W1QA 1IIKA 5C71A 3MOAH 1A2YA 3WH8A 2F8VA 2XV2A 2O0TA 2ASHA 3FN9A 4RMTA 4M8VA 1GQKA 1IAOB 3AZSA 3DGBA 3ANVA 1L2UA 2AXGA 5I1AA 4L8SB 4GE8A 3AUVA 3FQ1A 2J78A 1EV2E 3IDGB 4TUOA 5CSUA 2Y6TE 4WY0B 2AK1H 5DRNA 5G4MA 2R1NA 1Q9OB 1ZZMA 4PH6A 4L1TA 4LLVB 5HJ3A 1MJJB 3WN5B 4DZHA 3DSFL 3VI4E 3HBLA 1ZDSA 4N42A 4Z3FA 4NO5B 4AZ7A 4ZBJA 1NLDH 4S3EA 1SU5A 3DJSA 5C9RA 1XB8A 2INEA 2V4LA 2IXQB 1OWWA 4P8XA 2WP3O 1CL7H 3RE0A 3HE7B 3KZSA 3R13A 1G7JA 3UTPD 4GIOA 5DK2B 3LXCA 4EQ2A 1D3HA 3HRZA 5CN1A 4KDTC 3TN0C 5D4IA 4J3OG 1N5YL 2XIJA 3P4OB 4KNSA 1FZJB 2DIEA 1PCXA 4KW2A 1R3KA 3BW3A 1HFUA 4LK4A 2CUMA 4I6KA 4QYOB 4GVHA 3IJ7A 4D9QD 3NA8A 1WK0A 4XP1H 4CGUB 4F9LA 1MAML 4DEPB 1G69A 4HOXA 4N2CA 1Z3NA 3CE1A 1QVBA 3MOAL 1WVZA 4D0BA 4DPAX 1F1GA 3EWDA 4P4KC 1HNFA 3FVDA 3SQOH 6PTDA 1RJLB 4BQ2A 5J6HA 4GQRA 2GFBB 3EOAB 1L9NA 3STEA 4MJIB 4OIAA 2E86A 4JRYB 3BMWA 4JTDA 3G5YA 2QS8A 4IMEA 4MYWB 1ZAIA 3QI9D 5ANHA 1Y07A 3APYA 1A1OB 4DO4A 3L5MA 5DJAA 5EC1A 1RJQA 3R12A 1NLDL 5LLIC 1TKKA 3LV6A 1HWHB 1A4KB 1R2TA 5IF0B 2J9XA 2F53D 5E4IA 5JDJA 4G7RB 4JY6A 1CL7L 1B3VA 2V3GA 2XYLA 3N50A 3Q05A 4EXQA 2J7HA 1AJ7H 4Z7NB 3W56A 4JHZA 3RKDC 4JFEB 4WI3A 4C1NA 5C0BD 4DZBB 1IBYA 3HBGA 1U3NA 4KWUA 1QSEA 4NZRH 3FQTA 4HWBH 3GTFA 1W6WA 1N70A 4WWPA 2PRMA 1G7IA 3Q6GH 2DZPA 2AQSA 1JRHI 4G2DA 4X83A 4R8WL 3HR5A 2HH0H 2XJKA 2KZKA 5B3SB 1NDZA 2UZXA 4CJ1A 4HZLB 4PWKA 1XHGA 4Y2DB 4IJBA 4UIMB 1R85A 5DJDB 3H53A 5TQLA 5K5YA 4XP1L 1UKQA 4K3JL 4I7UA 4UTTC 4GXMA 2CSPA 5E6YA 2OKMA 3ATZA 2W88A 3HE6D 5JQIB 2X89A 3W27A 3ZO9A 2OFJA 3VC5A 1SMDA 4FNRA 4JFQB 3SQOL 3FUJA 2P28B 1IBHA 4IS6B 5FKAB 2I17A 1MZYA 2A7NA 3DX8A 3UWYA 3DX6A 4FI4A 2FYVA 1DN0B 2ITEA 1CXEA 2YD2A 4PAZA 3RCMA 2A3BA 5C2XA 2J44A 3D0LB 3GMPB 4O1FA 1CQYA 1VSCA 1F3JA 1VPXA 3UXLA 1EAPB 3P30H 3T0ED 3PJLA 2JEPA 2NYYD 5DYFA 3BVJA 4M61B 3R0MA 4PYSA 4Y9CA 3LMJH 1M7JA 4B7IA 4MVAA 2UX6A 3CC1A 3HJZA 3ZL4H 4IOFD 1LMKA 1CGUA 2JJUA 4NWUL 4P3DB 3O8XB 1T7YA 3KPMB 2BVOB 3NSXA 1BBJB 4ZMYA 1AJ7L 5EU7C 3V6FA 3FUEA 2RR3A 5CO1A 2I7GA 2R2CA 3GM8A 1YQ2A 3BC9A 4AGPA 1BD0A 4EOWH 3RR4A 2CUHA 4DWSD 4K94H 4NZRL 3E74A 1Q7QA 5GGVY 4N7QA 3VCCA 1PZ5A 2Q0ZX 3Q6GL 2VEMA 3IMWA 3QIBB 5JPNA 2HH0L 3GTNA 4QHNB 2NZ9D 3U2IA 2NY6D 4O28A 5CJXA 4YDVA 1CS6A 3N85H 4JNYA 1E4IA 1DJXA 1MWAH 2K6YA 5TE4H 4CD4A 5CEYB 3NURA 3WNKA 3GFUA 4PJCB 3R19A 4OFKA 3HHRB 1KM6A 4JO2H 2FTAA 2WLIA 4GW5A 4U6YB 5DRZB 2A74C 3M6DA 1DSYA 4PUWA 2Y7GA 4N0UB 3UJJL 1TB3A 5C70A 2VLLA 4XXDB 1BZ7B 3UU0A 3IDYC 4KFNA 3RUGB 1RK7A 3KPLB 1MQKL 2DWSA 3COOA 4TL4A 4Z6AT 3L3HB 5CKGA 1UA6H 4RPPA 1O94A 2LFEA 2JKAA 4Y8EA 4RH4A 1IFRA 4S2CA 1GYAA 2ICES 1Y5WA 1DHPA 4LUJA 4QRNA 4X7TB 4IJ3C 3GDTA 3FUHA 3P30L 4LF3A 3NPVA 4HUUB 3EJZD 5A6SA 5FYKD 4H9XA 5ABGA 3FKRA 1IC7H 2DWTA 3LMJL 5ETUB 3ZL4L 2B1HL 4N0FA 1JMZA 3L13A 3K6OA 3QUZA 2HWZH 3A24A 4OV5A 2NT1A 2C4FT 1KBJA 2Z4TA 3LZNA 1J9TA 3C6CA 1RL1A 2GK1B 5FYJE 2HLAA 4EOWL 5TE6H 1FA2A 4ILSA 2QPEB 3VXOA 1E4HA 4QXTB 3ALGA 1DQXA 3E3QC 2V33A 4ONGH 4IBTA 4DK3A 4H83A 3T6VA 3AXXA 4Q8OA 2XG4B 1T1WB 3ANYA 3FO1A 5DHVB 2EE6A 3MSRA 3N85L 4LKXA 3NCJL 2BB0A 2QLVB 2PW1A 5TE4L 1A6AB 5HYSB 2CBUA 4PN2A 1L0PA 4YHPB 1ZIBA 2ESVB 4GIYA 4MCMA 3QM3A 4JO2L 2FECI 2AZAA 4I3GA 1E56A 1H8OA 2A9AA 1THCA 2R9HC 5E1GA 3Q2NA 1EVUA 2YPLA 1OSZB 1MCLA 3U79A 3IJEB 4ES9A 5CBAB 4W84A 3AC0A 4BK5C 1EOMA 3L7EB 3LEVL 3DHUA 4U05A 2XM2A 1LEKB 2B7OA 1KQYA 4PJFB 1D3CA 3X2QB 5E9DE 4GG8A 3NCWA 5HDLA 3FT0A 4QIRA 1JJKA 5C9WA 1IFGA 3BVXA 3WMLA 1KPUA 4N25A 2OJPA 2ICEA 1NMAH 5HPMB 5EB9A 1ZRQA 4OI8A 4WHBA 1IKFH 1R7OA 1IC7L 3YPIA 1XIEA 1QRQA 1W3KA 3HLKA 2XM1A 5G4EA 2JIXD 1B0WA 4H4IA 1RVKA 1BQ5A 5FF6B 2HWZL 3QIUA 3SJVE 5D71H 1F45A 5FJRA 4Y0GA 1URIA 1YYLH 4HNUA 1ONQA 5D7IF 1FQ0A 5TE6L 1NSJA 5LXXA 2WCGA 4ONGL 4PJ8D 1C29A 3U8GA 3FO9A 3M0VA 4FX5A 4Y4HA 3JUZA 4KETA 1EJVC 3UETA 3QA3B 2Y1VA 3FTUA 4NYUA 2FZBA 2Y8KA 5C6MA 4RMWA 2DQEH 4UQIM 3VGEA 4LNVA 2QDGA 1HIMH 3ULUF 2VSCA 4IU3B 1L7IH 1X7QA 3LNMA 5J04A 3TFBA 2AV1A 2ZOLB 2R1XB 4P7LA 4ABQA 4TMCA 3QH3A 2HN7B 2QNEA 4L4VD 3OX8A 3BAXA 2AJ3B 3QDJE 1AH4A 3GMNA 2GPTA 4YLWA 1T83A 1A22B 1ZT4B 25C8H 1VJSA 3MRCB 3QULB 2OJEB 1OE2A 3TT1H 3GAYA 1JYVA 1ISWA 1TE6A 1Z7AA 5LGXA 5HYIA 4K3ZA 3RHWF 1RVFH 4HMEA 4I5RA 1C92A 1IKFL 4RSYA 4NJJA 3GYCA 4NKIH 4GAYB 5JOEA 1KBGL 4G9FE 3ONBA 3T3PE 5KSAC 4MZIA 4OCYH 2A6IA 5D71L 2FJFB 1FG9C 1J6OA 3VE9A 5A16A 1CT5A 2PTDA 3L16A 1NGWB 2QF7A 4E9LA 3BVDB 2P5WE 2A7BA 2WTPA 1GZJA 4O50A 5A6BD 5H94B 5JW4R 4RE2A 3SCMC 4KK6C 1KGYE 3BD4A 3WF4A 1IB5A 3FU7B 3T7VA 1U8NB 4RAVA 2MKLC 3ZE1B 1PD1A 1BZOA 4WWKB 3D06A 3DX2A 3DLQR 4K2UH 2UY4A 3KAAA 2JCCE 5DEGB 3G5XA 4QRAA 4NERA 2YW3A 3VXME 5TNVA 4QRPE 5KVGE 2W1NA 2DQEL 4P5TA 4LSBA 2PTWA 1HIML 1O7AA 3A3YB 1L7IL 3CLEH 4M51A 2BRQA 4UMBA 2FHCA 4HAKA 3RIFK 1G4RA 4EPBC 4ZBCA 2NVAA 4TQ8A 4AVJA 2W60A 5F9OH 1XF5B 4AD1A 1N64H 1U4FA 1NGXA 5D55A 4NNPH 3QW3A 2ENSA 1R3IL 1I85C 2CZDA 3PWLB 3RRAA 2GQ3A 4LQ1A 5CMAB 3DC0A 1UGNA 5D4YA 25C8L 5IKCB 4Y4FD 4C6MA 4PJAB 1XR9A 1H8LA 3RPIB 2XI9A 5I6NA 3TT1L 2WQRA 5K7JA 5DZNA 4I18A 4YE4H 3S96B 1MRQA 3VOCA 2E68A 2J5WA 5AKVA 2YSTA 3BRGC 2GJLA 4KY1H 2OI9C 1RVFL 3LPOA 2ATPB 5LNSA 2V5RA 3L9EA 3RG1C 2Q71A 4NKIL 5T1KD 5IROD 3AREA 1FFOB 2PWVA 4HNTA 2DBJA 1XF4A 4OCYL 1GOFA 4MMZA 4C83B 3ECBA 1Y7VA 3UXIA 5DLLA 3P9MB 2HLFC 3WJMB 1PGRB 3W74A 4LCIH 2E6JA 2CDFB 5DQJA 2A6KB 1N0LB 4E5XG 2BIOA 1NIAA 2O6FA 3VRIB 3MLYH 1HILB 2VURA 4X9IA 2F6AA 2GK2A 1PG7W 1YMMD 3VD4A 4W1TA 4XAYA 2PAJA 1OM0A 1KBWA 1BAFH 1ICPA 4K2UL 4GS7C 2H8XA 4FFWC 2VX6A 3AW5A 1GZHC 5HYQB 4WHYH 1R30A 3AY4A 4HBQA 4YFLI 2C9AA 4HS3A 4D9RD 3PHQA 1OY3B 3PREA 2G2RB 4FSAA 2V3EA 2YEZB 4BDVB 2YD5A 4KO6A 4NOFA 1PZUB 5F9OL 1G1CA 5KITA 1N64L 1BJ1J 4MMXC 2PNDA 2D3VA 2A9BA 3DHPA 5DD3H 4ZB0A 5MENA 4NNPL 3WDRA 2GWNA 1A9EB 3GPSA 4L0ZA 2AF2A 3VD7A 4GX8A 4U1HB 2FGLA 1LD9B 5B7MA 5B1BB 4K15A 1KMGA 1U8IA 3N4EA 4DSYA 2YAQA 3AADB 1ZHNB 5C55A 1URZA 4MDIB 4KY1L 3HN3A 2IMNA 3MAWA 4GRSA 4JFFE 2ALRA 3R8GA 2JI2A 1IKNC 3Q6FB 4EXPX 3V5KB 4ZO9A 3I68A 4O18A 4Q8WA 3B8IA 4X5LA 2XZ9A 3UW6A 5ALBH 4LCIL 3GZKA 2D7OA 2ZX7A 1KXTA 4YVPA 4IIHA 4N9GB 2CJ3A 1MCIA 2CAKA 3WBAA 4PGDB 3I6LD 3MLYL 1I1CA 3S6DA 2APBA 4M1CC 4PP2B 2F7FA 1O66A 5FAGA 4PN6A 5E8NA 2GIMA 4ELMB 1BSLA 1I2NA 3U9PL 2Q02A 3ORWA 4GISA 4E2DA 3S35H 1BAFL 3QUXD 5KJRL 1SUJA 1FL3A 4DM2A 1UUQA 1RK1B 3ZYJA 3C0QA 4LCWB 5FWQA 2HXTA 3JUYA 4OSUH 5KOMC 5GGTH 4N2GA 3I6KA 5BMWA 3RI5F 2CE6A 3D6NA 4GAJH 1ZVHA 2C79A 3GNXA 3NP3A 3RAOA 1G0XA 3SE4A 2E8ZA 4UMGA 4LHUB 2DZEA 4L8SA 2IAAC 3GXIA 2EKCA 5DD3L 3USBA 3SDDD 3IDGA 1GOQA 4WY0A 3EXSA 4IIZA 3GTTA 4C1KA 1G5GA 4JNMA 4TX6A 1QLFB 4U0RB 4QXIA 3W5NA 3QFWA 3OYZA 1QBMH 4FG6C 5FJIA 4U10A 3WG6A 3MTXA 2XVNA 1MJJA 4UFKA 4N5ED 3WN5A 1FNAA 2QVHA 4DXKA 4NO5A 2AERT 1A7QL 4QRRB 5KAQG 5EL1A 1BGXH 4Y5VA 4MNMA 4NI3A 5IHZB 5IVXF 2YHGA 3V1HA 5FJUA 1X6UA 3VQ2C 1X5MA 4M7JH 1I2QA 3HE7A 1VGKB 3NCBB 4AENB 4A7GA 4RGMB 5DK2A 4I4WB 2CHRA 1G5AA 3L7FB 2VC5A 5JOFA 2QZ5A 2PCPB 5ALBL 3TCLB 1OADA 3NSNA 4ZXOA 3GNRA 5CJMA 3K2UH 2PCEA 3USZA 5LGJB 3CQFA 3F05A 4HJUA 4Y2OA 4S1DC 4R7LA 5GJMA 1ZD6A 1DVXA 5D03A 1MCSA 1FZJA 1MH5A 1U3YA 3MU3A 3S35L 1SO5A 4UM8A 5FFLA 3DGCR 2YC1B 3FTWA 3DENA 5L4IA 4QYOA 2BODX 4ZFFB 4LY8A 1UACH 3LNGA 3TF7C 3WE6A 4D2JA 1UFGA 4B4HA 1LDSA 2RGSA 5LGHL 4OSUL 1WF5A 4TQPA 2ABAA 2ZTBA 1P0KA 5GGTL 4NQSA 4RJEA 3GNML 4A6YH 4GVFA 3LQMA 2Q86A 3WDQA 4L48A 1GYNA 4GAJL 1MCBA 4P7OA 1BOGA 3B9NA 3HZ3A 3I6RA 2A2QT 2EF9A 1RJLA 1OL0A 4A3YA 2ZDSA 3KXFA 3HMJG 1JAEA 2GJNA 3GKAA 2GFBA 3EOAA 4MJIA 4LOFA 4NRXA 1FWDC 3VFMB 1XLIA 2Q3ZA 1MCCA 3OSKA 4AQ1C 1ESWA 1I1YB 4FOKA 2PDHA 4CVZB 5FA3B 4XB8A 1HKVA 2P42B 4Z1DA 4KFOA 4RE4A 2X6BA 2NT0A 1VBGA 4WDIB 2XPGB 5IFTA 3HG2A 3UPRB 1KBBA 5FDWA 3ELQA 1AS6A 1C12B 4E2VA 4WO4B 1P1ZB 2XPZA 4ZODA 2IWEA 5JHDE 5GPRA 1BGXL 5EBMA 1A4KA 3HIZA 4LESA 3BPNB 3HAEH 4LB3A 3K6SA 2F8XC 4B9KC 4TUUA 4GY1A 3SUWA 1VRSA 5HGAB 4M7JL 1F6LL 4BSWB 1GOOA 3E12A 3VIFA 1Q65A 1TYEB 3B0VC 2K7PA 1D2OA 4JFEA 1N4XH 1R75A 1BAWA 1FYHB 2BP0A 4WI7A 2LFGA 3P3YA 5IVOA 4Q8PA 3K2UL 4ACPA 1MDRA 1Q6CA 1K72A 1EHLH 3C56A 3N41B 3EJYC 4ADGA 2C9VA 3PUGA 3NEVA 2DB8A 5EB8A 4JDTH 4LV4A 1S2AA 4HZLA 2E7HA 2RUSA 2GJRA 4Y2DA 5DJDA 1UACL 3KJ6H 5IP4A 3V7PA 1O7SA 2NLJA 4HNLA 2QCLA 4HOMA 5I0WA 4BF5A 4A6YL 1DPMA 3GIYA 1QSED 2WW5A 4Z7QB 1CPUA 3F5WA 3QY8A 2WYZA 2ZWYA 3ZK0A 3BKCH 1ZA3B 4WIQA 4JICA 1L6GA 4Y4KB 4M19A 4IS6A 1K85A 3TBTB 2ATKB 1TPB1 2Z6JA 1KV7A 4EN2A 1TA3B 1RY0A 1Z48A 3ULUH 2FSEB 2M1KA 4RDQG 1C7TA 3ILQC 3DIFA 4RMSA 2W65B 4AUJA 3TXZA 1M3IA 3P4MB 1XBYA 5AKQA 2X89D 4PB0H 1DBTA 3OKKA 3JV6B 2XIQA 4N68A 4IM8A 4JHAH 1FDZA 3T08A 4B90A 4F7MA 2R2BB 1KTLA 4M61A 3CBJB 1TTCA 4NQCB 2VLKB 2P8MB 5BPPA 3QC0A 5IHRA 1PKLA 5JA9A 4P3DA 5FO8B 3AS0A 3EA3A 1GHFL 5FF2A 4PJ5E 2ZVRA 3KPMA 2BVOA 3WLIA 1TO4A 2WYHA 1AI1H 2OU4A 1N4XL 5DCBA 1ELSA 4DGWC 5L9DH 4WKZB 3DYMA 3BGFC 4R26L 1L0QA 2OPJA 3G1YA 3QIBA 1K9DA 1EHLL 1OF6A 4R34A 1COBA 4J6IA 4QHNA 3RGTA 5MKGB 4JDTL 4FZIA 1SQMA 2FZDA 5CEYA 4PJCA 1X8CA 1P5UB 2KMWA 2YRZA 3GR4A 3FB6B 2XZQH 1ZGLM 4F2ME 5AW3B 5DRZA 4IPJA 3BSZA 3IVKB 3S3DB 4N0UA 3QNXB 4J2PA 3ME0A 4A7UA 2K8QA 4D6GA 3MJGX 3BKCL 1TZOA 3NSMA 4TL5A 3BH8A 1NCGA 1FFQA 3RUGA 3Q9QA 5F88B 4OZOA 4HF5H 3FT4B 2ZKWA 5FUOH 1NEUA 3HN5A 2WIMA 5DVLA 3FTSA 3ULUL 5D1ZC 3RWFB 1E15A 1L9OA 4NGHH 1FNHA 4HEME 3WUEA 3B9OA 3E96A 3C8FA 4C58B 5I16B 2UZPA 5BZDA 2JVUA 3MBXH 4PB0L 1DVTA 5GIRB 1CDYA 4XHQA 4JHAL 1HYSC 3FA4A 2WMFA 5ICXB 1NFKA 1K8IB 3W73A 4TXEA 3Q4DA 5ETUA 5CC6A 3TFXA 4QLKA 3E5BA 4NX0A 3WJWA 3H9SB 2DJLA 2C8NA 1I3GH 3MRRB 1AI1L 4PRPA 1R5VB 1GG1A 2GK1A 2ICWJ 4XSMA 3UYPA 1L6XA 2EHHA 4QXTA 3ZHDA 5LDUA 5L9DL 3B2VL 5C5YA 5G2WA 4AM0Q 3G5VB 3WUBA 3PNUA 1QVOB 1MYRA 1M57B 2XG4A 1UR0A 4JHWH 5DHVA 3QUZD 4WK9A 1UR8A 2WBWB 1QBLL 3KLLA 1G0YR 1A6AA 1D5RA 5DXXA 3AU2A 4YHPA 2Y6SC 1GC1H 2ESVA 5F8QC 4NT6B 5ABFA 2XZQL 4HW6A 5XIAA 1CEOA 1LT7A 3GDMA 5KN5B 1L6FA 1EQWA 2V6AA 2Y7SA 4JTLA 4UTBA 5I8EA 5GRZA 3PZNA 1S7TB 3O8AA 2B9AA 5DU7A 5MHSD 2PCXA 4D1JA 4OLYH 4AY8A 1BQHG 4LT9A 3IJEA 3TAOA 4CNOA 3L7EA 4GVGA 5IHWA 1V93A 4BZ2H 4O5LH 5FUOL 2MQ3A 4DAGH 3EMZA 1LEKA 3WNNA 2GPZA 2V9DA 3FKUS 4N6EA 1NDGB 3LHZA 1PAZA 4PJFA 1J05B 4KT2A 3RZCB 4HJ1A 4EUPG 1DQDL 4NGHL 2NSXA 2VQTA 3PABB 2I7SA 3SADA 3OP2A 3LNFA 5IJDC 3ID7A 2F5BH 5HPMA 2HNEA 4P2QB 1U5VA 1IM9B 2YPLD 3U1QA 2ZNXA 4HJ0C 5F7HA 2OZNA 1SGKA 4CU6A 4QITA 1E65A 1QO5A 3W7DA 1KGXA 3PTQA 4Z76B 2P9RA 1WFTA 2IF7A 3R8QA 2OGJA 4NRSA 1FL5A 1XKYA 4P2AA 3FSZA 1ZWIB 4FI7A 1E67A 1MFBL 6ENLA 1C90A 4YL2A 4O11A 4IXXA 3NGBC 3QJXA 1OIMA 4GX9A 5I1LA 4AF0B 2EZ0D 3HPLB 2DY3A 4H25A 3QA3A 4JHWL 4RA3A 5E5RB 3WKNA 4DKEH 3MDJA 2KERA 1A4JB 3F7QA 2XVKA 3QIUD 3SKOB 4X8CA 3FN0L 1LLAA 1XIWB 1RPXA 3QH2A 4XGZA 1PJWA 2P8PB 3DX7B 4IU3A 4H0LC 1EP2A 1TV2A 2ZOLA 3KS5A 1MUJB 1MHEB 1SF3A 3MBDA 5E6IC 1S2UA 1NQKA 2DUAA 3NQGA 4Y6GA 5D33A 3S5SA 2BC4B 3CTTA 4UBPC 3ES7A 2ZZ3A 4K71B 2AJ3A 2IWKA 4Y4HD 3CUZA 4BZ2L 4O5LL 4ATDA 4DAGL 1KB5B 1EJOH 1I1FA 4KTGA 1ZT4A 5ILTH 1RK6A 4LBEB 2HS6A 2P8LB 4UI2A 2OJEA 3D12B 2IOIA 1EJUC 2QDVA 2QR0B 1RD5A 4DBUA 5DZ9A 4LALA 2EVJA 1IUZA 3HFYA 3WAJA 4W4OC 3FCGA 4RXFA 3WLWC 4RV8A 4OIFA 1BEYL 2WC7A 4DPPA 2OXGB 3EJCA 1JD9A 1TTIA 2EDWA 2ZAHA 1K5NB 3W23A 5CWSB 4N3TA 1HSBB 4M1RA 4OZGE 2ZONA 1R24B 3VOGA 5D2LF 4EZMA 3VFNA 4ZMPA 1ADQH 1KXVC 2H6UA 5D93C 1H3GA 3ES6A 1QNZH 2FJFA 4JZJA 3ZDZB 5J9PB 3D46A 2PGWA 2VERA 5C7XH 3VNJA 1NGWA 1SZGA 3BE1H 1UXMA 5H94A 5HBBA 3WLTA 1TV3A 2Y88A 2CDGB 3WLJA 2LTQB 3FU7A 3OKYA 1U8NA 4LQFH 1Q7MA 4YSCA 1E9PA 5L4MA 4XPTH 1BXVA 3F62A 3H2AA 4QOKB 4WWKA 4BR1A 3B5GA 4UUIA 3ZDYF 4DKEL 1ACZA 3V5DB 1L9PA 1E4XI 1GS7A 4JRXB 1ZB5A 3NOEA 1CGTA 3II3A 4RGOH 1JUEA 4IP5A 5C97A 1JZ6A 4NP4H 4ILDA 4EAYA 3EFFA 3W1ZA 5J6GB 3L6FB 3WKZA 1U4EA 4PA8A 4U33A 4XVSL 2I1OA 3NQCA 2OS7A 2DLHA 1EJXC 2VEGA 2AOSA 3ARFC 3IFLH 4PB3A 1Q4NX 2IMMA 1XF5A 2EGZA 3LXBA 4JJOA 2C9XA 1FO0B 4Z0SA 4HCGA 3G24A 3FFDA 1O9WA 3LN4A 1SOXA 3W0WB 1J5TA 5I0XA 1EJOL 1DQUA 3SUSA 5ILTL 4HCHA 3U83A 5J4MA 4BZ1A 4PJAA 5GRUH 4P5TD 5KBNC 4IQEA 4LLDB 3B8DA 5EEVA 1F41A 3S96A 4J2MA 1VHCA 1BYDA 5C2UB 4R88A 1QI5A 3S4SG 2VN3A 2ATPA 2EG7A 4KQ3H 3MLWH 5IHHA 1FHGA 4F2FA 4RBPK 3LPWA 1ADQL 1FFOA 5DMMA 2PYEA 2J72A 4X0KB 4C83A 1QNZL 4ZMZA 5IIEA 5F1NB 1QOXA 4LFHG 1UWIA 1WWCA 4KX7A 1UUOA 5C7XL 5F0JB 4K3HA 3OW1A 3OHXA 5K2ZA 3BE1L 2A6KA 1N0LA 2EXTA 4WHCA 2PLJA 3VRIA 1BPLB 1SJVA 5AAMA 4YTQA 3M0LA 2QLYA 1YN7A 4LQFL 3EAUA 1EZVX 4K8EA 1YMHB 1PKQE 1J4EA 3ARED 5ID0B 3B9DA 4F3HA 1FFRA 3F64A 4IIGA 4S1SL 4RGOL 4AZUA 1I8AA 3PG8A 4NP4L 1EB3A 5CKAA 4JR5A 1RJCA 3WLOA 4X42A 4FA8A 1U8OB 5KYXB 2GIXA 3N2XA 1XGTB 2J7DA 1B3JA 3WG7B 3LHAA 1VBJA 2G2RA 3ZUNC 1GOIA 4GXPA 2YEZA 4BDVA 3IFLL 4OQTH 3IGLA 1BD2B 1U33A 3SM0A 1OZQA 1PQZB 2DIJA 4IZGA 4W9FC 3WQ5A 2FMOA 4IRJB 4EPEC 3GZAA 1M04A 3HR6A 5K39B 5HHVH 1ND0A 4U1HA 2NXZD 1LD9A 3U48A 5GRUL 1MDLA 3N34A 1K7XA 5EIQA 4LNCA 1NMCB 5EMJA 3NEOA 1ZHNA 1CECA 3W81A 5DRXB 1BVLB 2EDNA 3V0VB 3PB2A 4KQ3L 3MLWL 4PG9B 1RHFA 4L0PB 1UWXH 3CVHB 4Q2ZB 5MEND 4L29B 4WVRA 3Q6FA 5F44A 3SN4A 2COQA 2WHJA 3LB6D 1AGEA 4TU1A 3SN1A 5IG7B 3BARA 4OZHB 4C4UA 4ZTXA 2J66A 3EXTA 2FWOB 1RZKH 4Q3MA 1XLDA 4JUSA 1NIUA 1UJPA 4U0QB 2PODA 3C09B 4QS5A 2E09A 1S46A 4U7MA 4PGDA 1HVQA 3HG1A 4MNQE 4AL8C 2X2JA 5LXGH 4LAKA 1E90A 1DWHM 1XYFA 1KRCC 4ELMA 3PFQA 2X28A 5JHBA 4JJ5B 2EEXA 4U3HA 3WNLA 4OCWL 2EPOA 4PRRA 1AXIB 2H3NB 4LCWA 3AXLB 3VXUE 3EBVA 5E08H 1DQTA 1K8ZA 4J5NA 1L9QA 5CHNB 2VSKB 5BO0D 2VLRE 1Y65A 3T0XA 1M7OA 4IIQC 3RN6A 1VDGA 2P0IA 2UY5A 2TSBA 3X3GH 1XG3A 2ID5A 4NKQB 4OQTL 4LHUA 3ULVE 2E8YA 3ZTJH 3C5SB 4AK2A 3A6OA 5AY7A 1JUFB 4R8WH 5HHVL 4Y19E 3BWZA 4KKLD 3GVGA 4KI1A 2XV3A 4QXWA 5HJYA 3GXUB 2WD0A 5KVDE 1QLFA 1WFOA 4A37A 1IE4A 1O68A 3AU6A 4M7ZC 2VABA 3NZGA 3CN4A 4K3JH 1E0XA 4U1NB 5EBWB 1QPRA 3V8CA 1B4EA 2Z7UA 4QRRA 1DJNA 1S9YB 2HT3C 1KJVA 3IU3B 4LVOC 3KTSA 1T3FB 2MUCA 2CJSA 3T40A 5FL0A 2B4CC 4RZ5A 4PV8A 4FC3E 4XAKE 3FSTA 4H6EA 4BK8A 4Y9AA 4YHKH 3BP5A 4G8EB 1RZKL 3LNHA 2Q87A 1K8DB 2PCPA 4LGRB 1ZLPA 3WCZA 1O1HA 3KDNA 3O6LL 5GSVB 2DH3A 3TSMA 3ZZ1A 1WV2A 1OYCA 3VD9A 2WLLB 1HHJB 4PCYA 4KCWA 5DY2A 3G18A 5SV4A 1NFPA 5LXGL 3H6OA 3D2UB 2MTPA 2CXKA 2KT6A 1X96A 3WMSA 3KBPA 3KJ4C 1KM2A 3GKWL 3HE7D 3RB7A 3VFOB 2J57A 5LN4A 4ZFFA 3CD4A 3RRQA 4MJJA 4JB9L 2E1WA 2BPBA 5C0DA 5E08L 4NWUH 3AMCA 5I77A 4BK9A 1H1NA 1F8TH 3CHCA 5F2LA 1FIEA 4G11A 2XCMC 3P3TA 3X3GL 5D8WA 2DM2A 3N18A 1G7QA 4YFDB 5E9AA 2Y5JA 3EKZA 4RXGA 3V4BA 3QDMB 3UGEA 3VOJA 3MMDA 3OBAA 1FLRH 1SOSA 5CJQH 2MWCA 1ONWA 4MAUH 4CVZA 4HNCA 2DMBA 3KPPA 5JXQA 4CD7A 1OFPA 2KDYA 2Y5EA 5HA7A 1P9MA 4WDIA 2XPGA 3P7YA 2BP5M 4L8DB 1NOWA 4EX4A 4DGIH 1P1ZA 1TF4A 3KPSE 3KXFD 3UJJH 3WQ6A 3EX2A 3N11A 4MJID 5TF0A 3M44A 1R3TA 1FGVH 1P43A 2UY3A 7XIMA 1WV7T 1MQKH 4BSWA 4YHKL 4QIUA 3V0TA 4NVTA 1LE5A 1WIUA 1QSZA 4KFZC 1K6QL 3D18A 5IFHH 4YWSA 3W7LA 3NRQA 2PUQT 1L9TA 3INPA 4EI6B 5IOKA 2QPDB 3QZMA 2ZOUA 3DESA 1GTFA 1URLA 3KWWB 4DYEA 3DXAB 4HJGB 2VW4A 3C5ZA 1LP9A 5I6PA 1VFUA 1Z1WA 1V02A 4PJ9C 1MN4A 2R6OA 2FEDC 4LEXH 3RVUD 4C56A 4L5FE 2WVVB 3VI2A 2WXOA 2B1HH 4YDLC 5G4OA 1T8XA 3KFTA 4X6DE 4JFED 2AQQA 3TJEH 3ZDXE 3DX5A 4YHYB 1N19A 1F8TL 2J7EA 4IGBC 3WBEA 2Z35A 3ZRCC 3MZNA 3WHXB 3I9IA 3PWVB 1ZA3A 3F6IA 5T1DL 4Y4KA 1JUKA 2XN9E 5E1AA 3L5AA 3TBTA 2DWEB 2ATKA 2FKPA 1EMTH 5AC7A 1FLRL 4Y2DD 1TA3A 2OYLA 5CJQL 1RZFH 4YXKL 2YIHA 5KYYB 4MAUL 2FSEA 1S3HA 2H9GB 3WY1A 3U5UA 1ZLDA 4RVBA 2FZ3A 3NCJH 2GDQA 2WHMA 2BSRA 2W65A 4QXUH 4ICWA 3TU6A 3P40A 4WNQA 2EDLA 4MVBD 3T9WA 4DGIL 3JV6A 2CA4A 3FJNA 5I5MA 2R2BA 2IDUA 5K33A 4X63A 1NM4A 2ED7A 4NQCA 1LO4H 4A7GF 2VLKA 4ODWA 3PJSB 1XXFC 1PZ2A 3DJRA 2P8MA 1FGVL 4NL1A 2ROXA 5HDBF 4HXBH 4KXZH 4NKMB 4JO1H 1N8ZB 5FO8A 3LEVH 1CFMA 2E6DA 5KBMA 1U1UA 3HG3A 1RZGA 4HZMA 4FXGB 3AHVA 3EWWA 2UUDK 3ARRA 4PBGA 3NEHA 4H7VA 5IFHL 5MERA 4WUUA 5E99H 3N73A 1CF8H 4AQ8C 4BE6A 3BN3B 3N4FA 2C26A 3OWEA 2XISA 4WKZA 2DLEA 3VA2C 4QGYA 5K9KB 1UXSB 3P0GB 3CQIA 2ACSA 1OSPL 2R51A 2XNAB 4O57A 3WTVA 2FJHB 5MKGA 4ABWA 4LEXL 5B4MC 1OWRM 2HTMA 3SUTA 3WELA 1YNTB 1TQSA 3SPHA 2WQPA 5HR7A 1FSKC 1KB9K 3FB6A 3TJEL 5AG9A 4MQXC 3F2LA 3SSJA 2N7BA 1AXTH 3SGKA 2P3YA 3IVKA 2DL2A 3QNXA 2FATL 1GHSA 2L4OA 3IJSA 3QIBD 5DR5H 4GKTA 2XQYG 3NFNB 3RDTB 4TMPA 2HVNA 5IUSA 4C4KO 3K1GA 2PDMA 3FT4A 1EMTL 3UWVA 1RZFL 5C9UA 3H7LA 3WQFA 1LMIA 3RWFA 5LCVA 3BUYB 4KRMB 4QXUL 4NO3A 4NUQA 2BS9A 3GH4A 1NL0H 1PMYA 4K7FB 2OCZA 3TA4D 5I16A 3ICJA 3NCFB 3UG4A 3MBEC 2R39A 4LY4A 1K8IA 1LT8A 1TCMA 1WZAA 4DERA 4OU3A 1LO4L 5LVEA 5J8OA 3LHWA 5C0CB 4E9WA 3GR8A 1BG4A 2NR6C 4IEFB 4HXBL 4Z7NF 4JO1L 3B2UD 2CC0A 2YUWA 1A0EA 3RPDA 5AHNA 3MRRA 1PD6A 4OV6F 3LM7A 3I2CH 5F93C 2WOYA 5E99L 1CF8L 32C2B 2G5WA 3PWPE 1H8NA 1OEZW 2DLTA 5EOQL 1ET8A 3BUDA 4ZQNA 1NPJA 4IM4A 5AAWA 4E8GA 1QVOA 1B9KA 3AZUA 2JELH 4GUCA 1XLKA 3QPYA 3UBFA 1JZ5A 3MKVA 2O1AA 5DVNA 1VBHA 3EBIA 3GSUA 2AVGA 2BVPB 2W5PA 1KFAH 1B3OA 2ZOXA 1KBGH 4X9FA 1JPIA 3DZ1A 3U46A 4PRPD 2WAGA 1AXTL 4QLWA 5FB8A 2WLJA 3ZLGA 1BEUA 2NX5E 1XISA 1E5CA 2KAUC 2H41A 4PWFA 3H1ZA 1F61A 2XZCH 4J3SA 5DR5L 2KX9A 2H6PB 5SWQB 5EFDA 1SFLA 4PYGA 1EIBA 3C12A 1ISVA 4NJAH 4P59H 3MRIA 3VXSE 1OAYH 3RFAA 4JDVB 3F4CA 5I24A 1NDGA 1J05A 2ESVD 2QVFB 3ELAT 1T7XA 3GD6A 4L64A 3CSTA 1T5XB 4FYTA 5ID1A 1W3IA 4G80B 3PABA 4FQQB 4V27A 1NL0L 3RGBA 4ECNA 5D37A 2EYSB 1AD4A 4Q8NA 2QF8A 3TFKD 1XGPB 4P2QA 4DESA 1IM9A 2C3GA 1ID2A 2K3HA 1P0SE 1TUPA 3GUTB 3F2CA 2IOMA 4B5ZA 4UNUA 1ZP4A 3URQA 4XWOD 2Y1ZA 3EDDA 1UZDA 4RESB 1DTNA 1ZHKB 1R3IH 4Z76A 1WDSA 3MMTA 1XIDA 3C2RA 1CTOA 2B8OT 3LZLA 4TX9A 3VWJA 3SE3A 5EA0L 5AOKA 3I2CL 4R2GB 4HA4A 1ZWIA 3UCRA 1O6SB 2VKZG 3TYUA 1JWMB 5C7HA 4HK0B 2H9AB 2JELL 4ZMOA 4AF0A 3HPLA 2J8UA 2E6YA 4W9IC 1T40A 1A4JA 4PJIB 2ALWA 3SDYH 1KFAL 3CUGA 2I9LA 4NZUH 2HZHA 3NABH 2QV2A 2P8PA 3SDCC 3DX7A 1TZIB 4FMKA 1KYUA 4PRIA 5D2NC 2WQWA 1PCSA 3PGCB 1TELA 4WY7L 3ITYA 5CZSA 1MHEA 2WNWA 3QZWB 2AGTA 1XL4A 5CZKA 1SQ7A 3GSXB 3OG6B 5C08B 3NL2A 4Z7OE 5AENA 2XZCL 3UTTA 4WGHA 1UOZA 3LNDA 1E1FA 3T1GA 3M1ZA 3S8WA 3VMPA 4NJAL 4P59L 2H0JA 1KB5A 2PDJA 1DR9A 1OAYL 3Q3GB 3WLPA 3NA9H 4LBEA 4UWMA 2QR0A 3BKJH 3B7RL 4GUOA 3E49A 2AJSH 3G5EA 1F8IA 3ARGC 2XT1B 1W5OA 4GH7B 1KC7A 3A6BH 5BZXA 1HKFA 3GI9L 3R06B 1MLBB 5CWSA 1TWIA 1B1YA 1HSBA 1NFGA 2WSRA 3ESPA 1R86A 4MNGE 2BNQE 2R27A 3MRMA 1DJQA 1YEEH 2R0WH 2JCWA 2H1PL 3GHSA 3MHUA 3GRWA 5D9OA 4DF1A 4MJ5B 2O6PA 3QJFB 2XH0A 4YBLC 1U93B 3DGGB 1V0KA 3TSBA 1XF1A 2IKHA 1FV1B 3CHRA 5AD0A 3WD0A 1BVNP 5A2BA 5GS1A 4U1KB 4PIBA 3G04B 4FHBD 4MB5A 2PTUA 8A3HA 4Y5XB 3VG9C 3MC5A 2UV8G 3ARVA 1XT5A 3FXGA 4KK9D 3BQ6A 4N0CC 1A5AA 5I6LA 3ZKND 4JRXA 1FC2D 2PN5A 3GMOA 4AJ0A 3SDYL 3TTQA 2AXWA 2HAZA 4NZUL 2H45A 3T2QA 3NABL 3H23A 4IIBA 3B43A 4WTXA 3SBRA 4V2BA 1J0HA 4M82A 4IRSB 5EU6A 4DVBB 5JLZB 2XU9A 3SBQA 1N12A 1FO0A 4WWKD 1E0OB 3O2LA 4PJFF 3W7KA 2GW5A 3U9PH 3KBWA 3NA9L 5EUOB 2WWCA 2E5DA 4KOCA 5I2UA 5KJRH 3BKJL 3VIIA 1XRSA 4LLDA 3DBXB 4FG4A 4AEFA 2AJSL 1IBGL 3R8RA 3BEVB 1UOKA 1P5VB 1G9MH 5A6KA 8RUCA 3A6BL 2LOEA 1A02N 4C55A 4QRSB 4XBJA 3G5WA 4Z95H 1Q6EA 2NSMA 2H3XC 5B1CA 1WIPA 2R0WL 1YEEL 2L3BA 3FU9A 1JGEB 4C57C 4LB4A 1GW6A 1DWJM 1CO1A 5H8MA 4TMBA 5F1NA 4PWGA 4XO9A 3V4PB 2FR4B 1FDJA 5BOPA 3FTZA 3L17A 4P8VA 1R6VA 1X5JA 1DIEA 2FYYB 3FEQA 3EYUH 4TVPE 2AHIA 3O3AB 5I17B 4O14A