4GJ1A

Crystal structure of 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (hisa).
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
242
structure length
229
Chain Sequence
TQIIPALDLIDGEVVRLVKGDYEQKKVYKYNPLKKFKEYEKAGAKELHLVDLTGAKDPSKRQFALIEKLAKEVSVNLQVGGGIRSKEEVKALLDCGVKRVVIGSMAIKDATLCLEILKEFGSEAIVLALDTILKEDYVVADKKLMEVLDFYSNKGLKHILCTDISKGVNVRLYKLIHEIFPNICIQASGGVASLKDLENLKGICSGVIVGKALLDGVFSVEEGIRCLAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneam
publication title Crystal structure of 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (hisA).
rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Isomerase
total genus 72
structure length 229
sequence length 242
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2012-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4gj1A00
3TXVA 4TR9A 3INPA 2FDSA 2ZZ7A 1KTCA 1FCUA 5L9FA 1SW3A 1VLIA 1OX4A 3EXTA 1ME7A 3BG5A 4O11A 1X7FA 1D3HA 2DZWA 3W7MA 4IJBA 1O4UA 1L6SA 3HPZA 1W5NA 4OT7A 3KXQA 4BK9A 5CSSA 3JR2A 4GE8A 1TTPA 2RDTA 1VYRA 3NQ6A 3NQ7A 4DQWA 4R7JA 1ME9A 3C6CA 3N3MA 3PM6A 2ISWA 5J5RA 1QNVA 3FKRA 1WV2A 4AHOA 5LHFA 1H7RA 4UIOA 3FOKA 2AAMA 3W76A 4PEKA 1FBAA 2NXIA 2J24A 1OYAA 4Y8FA 3O15A 2OMAA 1H5YA 1KFLA 2CZ5A 4WY0B 4JD4A 5K2ZA 4JYEA 1IGSA 3CLMA 3FIGA 5LGZA 4KWWA 5D2VA 3NVTA 3LERA 3ABQA 5AHFA 2JBMA 1ZY9A 3C2VA 5F4XA 2BXVA 2A5HA 3MI6A 5CSRA 4P2VA 4AVFA 4TO8A 3P80A 4KKXA 1H61A 4RLIA 2XN2A 5ABTA 2A4AA 5EMUA 3GIYA 2RDWA 1XL9A 5CZTA 3UWZA 2ZRZA 3NYZA 1LOSA 4DEFA 1RPXA 3PUDA 3TDFA 4WUIA 3IEBA 4Z08A 3IVSA 2XFWA 2CU0A 4FX6M 3HBLA 2ALDA 2ZRXA 3SECA 4FX7A 1YPIA 1ICPA 3DXIA 4LNYA 1EP1A 4LRTA 3B04A 4AB4A 4I7VA 3O16A 3M5ZA 3LDVA 4MZ1A 3QW4B 4JTIA 5F2MA 3C3NA 1ZJIA 2V2HA 1I2QA 4U28A 3W1UA 3O6YX 3YPIA 3LTPA 5K9CA 2ZA2A 1J5TA 4ZL1A 3NPXA 3DAQA 2DJLA 3O1NA 1OFPA 4PFMA 4UFJA 4O52A 5FF3A 2A7NA 1X6UA 2C1HA 4N6FA 4LU0A 4WOZA 2BSLA 3LBCA 2VEIA 3SR7A 2R8WA 1XKYA 3L66A 3O6CA 3GVGA 3LCFA 1F6KA 1L6YA 2PCQA 4AF0A 1LP6A 1R46A 2QCMA 1C29A 3W1LA 2YYTA 1LDCA 3G3MA 4MZ8A 3EKLA 2Y6ZA 5LHEA 4JNMA 5KMYA 3GDTA 3WJXA 5BMXA 4FNSA 4RCXA 2QCFA 5BMWA 3S5OA 4PCFA 3HG5A 3S1WA 3PVFA 2V30A 1GG1A 2TRSA 4UR8A 4JR5A 5LNUA 1ML1A 5C6MA 4IXHA 2QCCA 2GQAA 3PWAA 1RR2A 2NUWA 1H7OA 4IOTA 2A21A 4M6VA 3TW7A 2UV8G 2OJPA 3I65A 1XBZA 3HB9A 1HO4A 1MEWA 3TSMA 5KZDA 4HPXA 5GVJA 3GYEA 1ADOA 3B05A 2RHGA 1UJPA 4N4PA 4C1LA 2NWSA 3ABSA 3LOTA 3OVRA 3B4UA 1W0MA 4WY0A 2YYUA 1QFEA 2VEKA 5E93A 4FX8A 3I7RA 3PBWA 1DHPA 3PSWA 1HL2A 4OBTA 4UC5A 2DZPA 1PL9A 2Z6JA 1TPB1 1JQVA 2YW3A 2WNZA 1P4CA 3C4UA 4YCOA 3DENA 3H54A 5EY5A 1LORA 2FIQA 2O7SA 3W7RA 2GUUA 1TV5A 2ZZ3A 1JUBA 2QJHA 4JTGA 3W1MA 3LB0A 3U6WA 2EAWA 3VI2A 3Q2DA 1GQNA 3ELFA 1WX0A 1YXDA 4MOZA 2ATMA 4C1KA 1LZOA 3QC3A 3FS2A 1QOQA 5G5IA 4OQVA 1J2WA 3UWUA 1KV8A 2YGYA 1T8XA 4JY8A 3SGZA 3W22A 3MI2A 1N55A 2NZLA 2GJNA 2F84A 5K4XA 4O18A 1KFJA 4Z1DA 2ABAA 1DKWA 5U4NA 1LROA 4LS0A 5BOOA 1IXQA 4YXGA 3W1QA 1IXOA 2QUVA 5A8GA 3W23A 4U4MA 1E51A 1GPWA 1R30A 2E09A 2DORA 2ABBA 4IXXA 4O1BA 4NXKA 3O06A 2QJGA 1LBMA 3T44A 1SO3A 1SU5A 1RQEA 4NJGA 3UPWA 2OT0A 1KFCA 1PHQA 4FIQA 4Z1CA 2Z1BA 3R13A 3TV8A 2PURA 4PODA 1I8JA 2H90A 4TIMA 1LRQA 5IBXA 3HMJG 2R94A 3P5ZA 4QITA 1ZENA 4DPPA 3BW3A 1T0OA 2GQ9A 2V82A 5K9XA 3PG9A 3W2NA 1TPEA 1K8ZA 1V5XA 3GXPA 3E0IA 3FYOA 1M5WA 5LNRA 3G1HA 1TTJA 3L68A 1KFBA 1LCOA 2JKEA 3H55A 3FA5A 4OHQA 3CTLA 1MXSA 2C16A 1M6JA 2V81A 2Y62A 2X1UA 4JDYA 1GG0A 2JKPA 1XXXA 3L65A 3THAA 3RNDA 1LRTA 3CPRA 3G0XA 4QNWA 3O07A 5D2XA 4P61A 4O16A 1TREA 1EUNA 5DXXA 1O5XA 2E5CA 3Q94A 4GJ1A 3A5VA 4YCPA 1C9DA 3TAKA 3W2UA 2Y7EA 4NZFA 1RVGA 2GVGA 3F4WA 4UTLA 3VE7A 1XCFA 2YZRA 3L0KA 1NF0A 1F74A 3GB6A 3W83A 1TO3A 4DPQA 3T78A 1XM3A 3W73A 4Y96A 1Y0EA 4IGHA 3DU0A 1PS9A 3LRKA 3V1PA 1TRDA 4NUWA 3RF9A 3G0SA 5I3FA 2QCNA 5K9DA 4Y9AA 2H3BA 1YTEA 3S1UA 2Q8LA 2JK2A 1UASA 2NXHA 1QO2A 1PVNA 4WQ6A 4O15A 1AL7A 1LRNA 3BO9A 4QAIA 1L9WA 1H50A 4EF8A 2ZA3A 4OV4A 3TIMA 1FQ0A 1TYGA 3MP5A 2WSRA 4R53A 3M43A 2C19A 3P74A 1PIIA 3V75A 5D09A 1JVNA 4M7TA 3TSDA 1H7WA 4O12A 3WJWA 1OX4B 2BTMA 2EGZA 4XWUA 2QDGA 4LS1A 2GVLA 1LOLA 2J9YA 1U83A 2E5DA 3W2JA 3W2LA 1TIMA 4LC6A 3LGEA 5AB3A 3KVJA 3M7WA 2QF7A 3HGOA 3QMSA 4UFHA 5HULA 1U5JA 2A1YA 5D2TA 3CWOX 3NM3A 4O57A 1VR6A 1DJQA 1Q6RA 4GXMA 3B0VC 2WOQA 1OK4A 5AHNA 1I45A 4BR1A 1OFOA 2C14A 3NPUA 3QFEA 3CEPA 4CCDA 1VS1A 1S5WA 4IUOA 2Z2UA 4LWWA 3OG3A 5LGXA 3SJ3A 4GWEA 1YYAA 3L0GA 4QQ3A 1ZAJA 2A0NA 1I4NA 1Q6QA 4L4LA 1SW7A 1K7XA 5F2GA 5CPNA 4IPJA 3FEMA 3P8IA 1QAPA 1VLWA 1W8SA 1JRCA 2NX1A 1K03A 1VPXA 1EA0A 1FWTA 3GR8A 3TSBA 4JDBA 3L5LA 3HGRA 4I7UA 4QM1A 2Q8ZA 3W85A 4GNJA 2J88A 3MBFA 1KTNA 2VC6A 1YLVA 4A21A 2ZTKA 2YX0A 3C2FA 5HUPA 4CNOA 3TUUA 3PBVA 1FWNA 4PL1A 4M19A 5KSWA 3W86A 3N73A 4NXSA 1FDJA 1KTBA 3S0CA 2C6QA 3SW6A 1S5TA 4JX5A 4IMEA 3BG3A 3EX6A 2Z6IA 2NXGA 3L21A 4WXZA 4J9JA 2B4GA 4AWUA 1GYNA 3SIZA 3QEZA 1O94A 3A22A 1KM6A 5DBUA 2FB3A 3CEUA 4FEZA 3MHFA 4IMFA 4JTFA 3W1TA 4AWTA 1ALDA 4UR7A 4LVGA 4MZYA 1SZFA 2XN0A 5D33A 2NLIA 2DZSA 2JGYA 2RKXA 2PRMA 2EPHA 4M6QA 1IIGA 3EWBX 4HSOA 4PH6A 2DZTA 1DQWA 3RLUA 4MYAA 2ZQ0A 4HN4A 2V0TA 4M5PA 1KFEA 3DI1A 3DFTA 5AC6A 4UTKA 5KTLA 4UTIA 2ZDRA 2AQWA 4NX5A 2H3DA 3QSRA 3TFXA 1KM5A 4JTEA 2WPBA 3LXBA 1GJPA 4AF0B 1JUEA 2YCEA 2GOUA 4PA8A 3EKZA 3W3OA 3PY2A 4IX2A 4UMCA 1TV8A 5I3JA 3P8JA 3HG4A 3FJLA 4XBKA 1A5CA 1JJKA 2C15A 3FFSA 5IM51 1JCJA 1TPWA 3M44A 4N9DA 5D30A 1A50A 1KFKA 3QPZA 2C0AA 3LCXA 1JR1A 3GDKA 1SR9A 3CIXA 1G4SA 2PRHA 3UXAA 1TPVA 3RK8A 2NX9A 3A5FA 5L6UA 3FLUA 3L5MA 3GXTA 3QW3A 4N4QA 5BW6A 3NQVA 1TQXA 4MY9A 1SFJA 3P62A 1F5ZA 3W7NA 3W1RA 3W7DA 3GK0A 4FNRA 4UTJA 1VCFA 1LBLA 3USBA 3PG8A 3G8EA 3W7KA 1ICQA 3T4CA 2CFFA 2ISSA 5CGQA 2B7OA 5D05A 1M7OA 2PRLA 1GVFA 2HTMA 5U7SA 3VE9A 3IVUA 3GKFA 3QMTA 4LOCA 3ABRA 4O1AA 3EXRA 5F1VA 4FNUA 3M41A 3CQ0A 3G22A 4KFNA 1F7BA 3EWUA 3TK7A 1W54A 4H4IA 1TPFA 3NL2A 3C2EA 3PBYA 1G7UA 3BGGA 1HO1A 1JRBA 1EP3A 3EEGA 4HNUA 3LI0A 3P7YA 1X1ZA 4S2BA 1VRDA 3UWYA 3DFNA 3IIPA 3P61A 3ZWSA 1Q6OA 1AW5A 2QCEA 3PULA 1XUUA 1W37A 3TX9A 1B57A 5LZLA 1S3HA 5I3GA 3BLFA 3P82A 4O53A 3W88A 3AJXA 3PF3A 3W2KA 1XBYA 2YFNA 3EX4A 1OF6A 3ATZA 4LY8A 3B06A 2ZZ6A 3WJZA 1AG1O 4LC8A 4FO4A 1FUYA 1CX9A 3B8DA 2Q3RA 4LTSA 1GYLA 3BVJA 5K3VA 5BNKA 3BV4A 4O1DA 5DN1A 2B7QA 2TMDA 1R47A 3WFAA 1QPNA 3NM1A 5C2XA 4QNEA 1W3NA 3FJ6A 3M47A 4MIMA 1QDSA 3M5VA 2B7PA 3CM4A 3A9IA 4RK8A 4ZMGA 1OK6A 5HINA 3BK0A 3CWNA 2WNNA 4IPIA 4DF2A 5DY2A 1VZWA 4RKAA 3HJZA 4UFMA 4EVZA 3HQ1A 3EWYA 3EWXA 3C56A 1YTDA 3W74A 3N2MA 3TNOA 2NV2A 5FESA 3RMJA 3HO8A 5D2YA 3G1AA 2NV1A 4X22A 4DO6A 4RV8A 4CNNA 4MFEA 1K7EA 4JTUA 3P67A 1ME8A 4XZ9A 3NZRA 3W07A 4TU1A 5FF0A 3TJXA 3W84A 5TBOA 2NUYA 5HQEA 3NQGA 2VFGA 4ZQNA 2TSYA 3B0PA 1XC4A 4TX9A 4I7WA 2QR6A 1JCLA 3STGA 3NEVA 3TC7A 4ZQCA 2QAPA 3GDMA 2ZZ1A 3NL6A 5G1YA 5EKYA 1YTKA 2ZRUA 3BARA 4A29A 2B7NA 2HMCA 4K6AA 3LV6A 1DQXA 2WNQA 2DU2A 1P0KA 1O5KA 2YW4A 1PCWA 3SSJA 2VFEA 4X3ZA 1DORA 3JS3A 1NEYA 1KM1A 2EHHA 1JCXA 1G4EA 1F76A 3G0UA 4O0ZA 4HSNA 4JX4A 1GVRA 3HGSA 1VYSX 3KOFA 1FXPA 4ML9A 4CCCA 4N02A 1ZFJA 1PHWA 1QO5A 3CB8A 4JEQA 1AMKA 4ADUA 2I14A 2G5WA 2E1DA 1DV7A 3TROA 2Y7DA 4O8RA 1YDVA 3WK1A 2Z0IA 3JRKA 4ORMA 1TPUA 3CHVA 3LHTA 4AHQA 4XQ6A 5DCEA 3C61A 3LM7A 1IIHA 1K8XA 3H53A 3MYOA 1TJRA 3SFKA 3S5NA 4A2SA 2E77A 4FIRA 4GBUA 2QCLA 2ZRYA 4MJMA 5F1UA 3TQKA 2NX3A 1LYXA 1KM2A 1ZALA 4LVAA 5AOUA 3G8RA 4WOQA 4BF9A 1H7PA 4YLWA 5EPDA 1VJIA 4XTDA 2WKJA 3IIVA 2V5LA 2YR1A 3TXZA 4LVBA 1WOAA 5LNWA 5DXYA 1SPQA 2W6RA 4LVDA 2G97A 2WV8A 2TYSA 2O7QA 3A23A 1TQJA 1KV5A 1GVOA 4MY1A 1MO0A 2FPTA 1GWJA 2PC4A 5AFDA 3B03A 3CC1A 3W7EA 1GZGA 1UCWA 3I6RA 1RD5A 4AXKA 4NJIA 3LHUA 2WJZA 4XKYA 1P1XA 1QWGA 1QPOA 1Q6LA 4JIQA 2QCGA 3W7QA 4Z0JA 3MMTA 3NL5A 2G95A 1EPXA 1L2UA 2R91A 4ONVA 5KZEA 1OFDA 4O4VA 1T99A 5FF7A 1THFD 2OT1A 4ZZ9A 1PCKA 3QPYA 2E6DA 2BWGA 2NWRA 1FCQA 4IMCA 4KFOA 3NQMA 1X8FA 3LCIA 3B0UX 2QUUA 2ZZ5A 4OE7A 2KZHA 1JCNA 1FDYA 3BG9A 2QDHA 2C18A 4A3UA 4JN6A 3TA6A 4YWIA 3S8HA 1SO4A 3C2RA 2V9DA 4Q32A 5HUOA 1O95A 4NJJA 3KX6A 3G1SA 3DZ1A 4UNKA 5AHIA 5FEPA 5LNVA 5G2HA 3BLEA 3DFPA 4UTTC 1UBSA 3GR7A 1TPC1 4JS3A 3TW6A 4BWLC 1SO5A 1GT8A 3NQCA 1YPFA 2E68A 3LHWA 4MLJA 4H6KA 3DBPA 3S5YA 3TH6A 4K7VA 4N9EA 3NOEA 4HIBA 3DFOA 1QPRA 3DFSA 4ZQMA 5HJLA 3TQVA 4W9TA 5HMSA 4ALDA 4O17A 5LSMA 1KW1A 1DBTA 5G4EA 4NJKA 4R33A 4D2JA 3VFLA 4K38A 1C8VA 4PC8A 1H1ZA 1XUZA 4QISA 4CQ8A 2V8ZA 3KRSA 1G4PA 2OX1A 2ZCGA 3BW2A 3QZEA 4TMBA 3ZWTA 1SFLA 3TU9A 1W5OA 1OABA 2WO5A 2R14A 4EWND 5AHEA 1EUAA 3N34A 2ZTJA 1KM4A 3GAYA 4HPJA 1W56A 1IF2A 4HHPA 1A5AA 1VHNA 1OG0A 1Z44A 4MYXA 3TMLA 2A6NA 1TJPA 3ATYA 3W7CA 4OGZA 3N19B 1MEHA 3G1VA 3W6YA 3UZJA 3S1VA 5CZSA 2NUXA 4O13A 4FXRA 3OEXA 2IQTA 3FKKA 2EKCA 3NQDA 3DKLA 4UTWC 2YDAA 2E6FA 4O14A 1WYIA 1JCMP 1F73A 1GVQA 2CLMA 1HFBA 4DO4A 2I1OA 4I9AA 3SGUA 4XTIA 2CLIA 4MVAA 1F05A 3CU2A 4CQAA 2GPTA 3EWZA 4PTNA 1KM0A 2ZYFA 2VFFA 3HG3A 2JGQA 3LRLA 4QIUA 5D03A 3UWVA 3LCWA 1FWSA 5AC7A 3EX2A 4UTMA 3N14A 5K7JA 3O63A 1H1YA 3GKAA 4GC4A 4MJZA 3W7GA 1S5VA 2D73A 4CCEA 1XFBA 4JYDA 1VGAA 3NQFA 3W7LA 5DY3A 3LTYA 2ISVA 3QMRA 4LUJA 5HWJA 1G4TA 1N7KA 4HNTA 4UMAA 4ZVJA 3W1AA 3ABOA 3GNDA 3QYQA 3NGJA 3UY7A 1BEUA 2A85A 3BGJA 5HWNA 5KITA 8TIMA 5D02A 3W1XA 4LUIA 4E2BA 5LKYA 1YADA 4LV9A 3IV3A 2BZNA 3M0ZA 3C52A 5LNSA 1ZAIA 3EXSA 3KVMA 1Z48A 3QH2A 3OA3A 1QOPA 2B0MA 3TAOA 3R12A 1UUOA 4G1KA 4FXSA 4N9CA 3WK3A 2A2IA 1JCYA 5EA9A 3UZ5A 4MFDA 4FB7A 4Z0SA 4JTHA 2DP3A 1VH7A 2YPIA 3GDRA 4M7SA 1YXCA 3QSTA 3NPVA 4WZHA 5I3KA 3UXDA 4UFLA 2QKFA 3R5EA 1G69A 3LCGA 1NSJA 5EYWA 1ZHAA 3N9SA 1FWRA 4L4MA 1HTIA 3K30A 1PE1A 4RR4A 4FHAA 2X1RA 2VFIA 2X2GA 5SWUA 1SW0A 3W75A 3PB2A 1V7YA 3MWAA 4NVTA 1EIXA 4EF9A 3C2OA 4NX0A 5AN7A 1OHLA 4LT9A 1F6PA 4RZ6A 1SQ7A 1Z41A 2J27A 3R89A 4IX0A 3W72A 4GUJA 2W79A 3TR2A 3RU6A 2FJKA 3SI9A 4LV4A 1T96A 3A24A 3KHJA 2P0OA 3HIJA 3WK0A 1WXJA 2GVJA 1OFEA 4AEOA 2QCHA 4IQLA 3LLFA 1I2NA 3W2MA 4BFAA 3TE9A 5FI8A 1Q45A 3G18A 2VENA 4CNPA 3E96A 3SZ8A 3QM3A 4DBEA 4K8EA 2H8ZA 4ICNA 3EX3A 3MUXA 4Z1BA 1DVJA 1JULA 5I3IA 2CLHA 3KVLA 2E6YA 2Y88A 3IIXA 5CPLA 4E2DA 3E9AA 3DHDA 2W0UA 3W1NA 3P60A 5D2WA 4O0KA 4LVFA 3MP4A 3NQ8A 5D38A 3UPBA 1DJNA 3W7OA 3DH7A 2OCZA 3LHYA 2VEPA 1VCVA 3DI0A 3PB0A 4MPQA 5G1TA 1TRIA 4UXDA 5FF4A 3W71A 2HS8A 3Q37A 1ZNNA 3BLIA 3I68A 4NNAA 7TIMA 5AC8A 1IXNA 4DXVA 1SZEA 2QCDB 3KRUA 2H6RA 4FNTA 5A5WA 4JGDA 1OFRA 3ZFHA 4UTHA 2GJLA 3VNDA 1WA3A 5D37A 3UNDA 5FEZA 1WOBA 5TIMA 3STCA 2VELA 5CG7A 1SSGA 1RQBA 2A7PA 3U8GA 3S9YA 1EEPA 3M9YA 1BWKA 2V2CA 1MSSA 1OYCA 3A21A 1SSDA 2Y7GA 3QJAA 2DZVA 4GUFA 4UUIA 2Y7FA 3UYCA 1LBFA 2BX7A 3LLDA 3NG3A 1SZGA 5EL1A 4WXYA 4MLRA 4BI6A 4GFSA 3T40A 1W31A 1WAUA 2XN1A 3GDLA 3DGRA 1KBIA 3TKFA 6TIMA 1OF8A 1RQHA 5D32A 3EB2A 1TB3A 5C55A 3PS7A 3N9RA 1XBVA 3UWQA 2QJIA 5E0KA 1BWLA 4M6PA 1H62A 1D9EA 4DO5A 1I2PA 1KLZA 3DFQA 2CLLA 1EX5A 1XI3A 1G7VA 1D3GA 3LCHA 1EP2A 5HR6A 2ATSA 2P10A 4MUZA 1I2OA 1N8FA 3I7QA 3R8RA 4JTTA 3LXAA 1ZAHA 2VKZG 1H60A 4JXCA 2WSQA 3GZ3A 4UTUA 4XKYB 3NXFA 4HKPA 4LS2A 2QEZA 5E1QA 1OFAA 3MI3A 1A5SA 1L6WA 1X1OA 3O05A 3P81A 4NNCA 5I3HA 5F4WA 3MHUA 1SO6A 4K37A 4AMAA 3MBDA 1GEQA 1IXPA 5T26A 5CZJA 3NO5A 1QPQA 1JQXA 3CIWA 3W7IA 2GQ8A 2I9EA 2X30A 5CPOA 1EWEA 4RX0A 1BKSA 5DELA 3IGSA 1K02A 2CLKA 2E5BA 1NVMA 2A6LA 3O8AA 3DHFA 1WBJA 4O54A 3TCEA 2Y89A 1CI1A 4H3DA 4S1FA 1VHCA 3IGXA 4RZ5A 3W70A 2TPSA 1SZNA 3NQAA 4O10A 4EIVA 5H2ZA 2F7FA 4O28A 1TMHA 4MY8A 3HG2A 2CZFA 1H7XA 2FB2A 4JICA 5MHBA 4K39A 3L0NA 4RXGA 4JTKA 4LRSA 4XUGA 4N9BA 3HPSA 1OFQA 5DLCA 3TJLA 1OX5A 3BPWA 4K36A 4NJHA 3P84A 1XBXA 4UTTA 2Y61A 1NAL1 4BWLA 1VYPX 1K7FA 1KA9F 3Q58A 2V2DA 4FNQA 4JTSA 1LLWA 6ALDA 3KFTA 3D0CA 2QCDA 4A22A 4FF7A 3NNTA 4A2RA 3IIOA 5AYZA 4HNVA 4NNBA 2WQPA 2H8XA 3LHVA 1OJXA 3MW7A 4JY9A 4NU7A 2RH9A 3G1DA 3ZR4A 1W3IA 1YDOA 3NPWA 2ZA1A 5AHMA 4YMZA 1R2SA 4BI7A 1KLYA 2VFHA 5KZMA 3SY5A 1RV8A 5F2LA 4IMDA 5C54A 1YXYA 1AK5A 3LHZA 1AW1A 1A5BA 1W3TA 3F4NA 4HNNA 3THQA 2FPYA 4OV9A 4NQ1A 3O6DA 2OZ0A 2ZBTA 2BLEA 1P5BA 3G1FA 4WY0F 4AWSA 1NF7A 5HWMA 3TFCA 3M5XA 2QUTA 1HUVA 3W7HA 1TPH1 2VFDA 3OVQA 2CZEA 4UFIA 4R34A 4UTWA 5C5YA 1QMLA 1MEIA 1FXQA 1TCDA 1W5PA 1O60A 3KRZA 1G6CA 3BW4A 1HG3A 2V5BA 3T55A 3S6DA 4E0CA 5AYYA 1P0NA 3M5YA 3IVTA 4X9SA 3C8FA 2HS6A 3HPXA 1B4EA 3NA8A 3NDOA 5HNRA 2X1TA 3GAKA 1AL8A 4IMGA 3QQ1A 2Q3OA 5F2IA 3LBMA 2VEMA 1W5QA 1Q3NA 3S1XA 1H63A 1UB3A 4Y6GA 3HF3A 1G67A 1FCVA 4AAJA 1A53A 1BTMA 2ZRVA 2FQIA 2DZUA 5G2WA 2FFCA 1MZHA 4JIPA 3TQ0A 2DZXA 3MHGA 1LLZA 3OBKA 3OIXA 1TV7A 2X1SA 2CLEA 2YXGA 2YFOA 4YL2A 3P5YA 1H7NA 3PC0A 3CT7A 3STEA 1QR7A 1F2JA 4OWGA 5FF2A 3M16A 4O4WA 3OHIA 4WD0A 4WJEA 4EOUA 4JX6A 1WDWA 4O50A 1OFBA 2LLEA 2CW6A 1GOXA 5G2IA 2PE4A 3PUOA 2VXNA 2Y85A 3NAVA 1M7PA 2J9ZA 4O1CA 1FY6A 1B3OA 4ADTA 2J6XA 1VCGA 3LTSA 3PUEA 3MO7A 2FTPA 4Z1AA 4XBSA 1R2RA 1SUXA 4HT3A 4KFPA 3RLVA 3WJYA 4UFKA 3MP3A 3MYPA 1KBJA 1W1ZA 3G3DA 3FYPA 4AH7A 5DBTA 3S42A 4RXFA 2C3ZA 5H91A 1K3UA 4LW7A 5TQLA 2X16A 4ZQOA 1WBHA 5CKSA 3W1PA 2ZZ4A 1FWWA 3N2XA 4ZQRA 4NT0A 1CW2A 2E6AA 1NFBA 1UUMA 4GRSA 1XDLA 4UNLA 4E38A 4N2YA 1FX6A 3IIZA 1OVDA 3GX9A 1QCWA 4Q4KA 4TMCA 4Q33A 2DJXA 5EBUA 3G1XA 2C13A 5FEXA 2P1FA 1PV8A 3GNNA 1VQTA 3S5ZA 4IWWA 3VCRA 4KWVA 4MKNA 3G24A 5HR7A 2QAFA 1J4EA 3NQEA 3EWWA 1GTEA 3PBUA 2J9XA 3KAOA 3W9ZA 3LI1A 3G1YA 4QSHA 2G96A 5CPMA 3T7VA 4S2CA 4WX2A 4CLMA 1B9BA 3DKJA 3QQ0A 3W7JA 3IGUA 4K8HA 3LV5A 3PSVA 3TMQA 4DF0A 4GUIA 3E49A 3GXNA 5D04C 5IBXC 3L2IA 1GTHA 5K4ZA 1JUKA 1OX6A 3PR2A 3PAJA 3EX1A 3QRHA 1K8YA 3QF0A 1W5MA 3ZS4A 1ICSA 3NL3A 3VKJA 1LTDA 3UQNA 3E02A 4ORIA 2CWNA 4PL2A 3LCLA 3C0JA 4AHPA 2EF9A 3LX9A 4ADSA 1ONRA 1RZMA 3I7SA 2WSYA 2RDUA 2ZRWA 3HOJA 3RFAA 5AYXA 4ZQPA 1OYBA 2A7RA 4JYFA 1XDMA 4UCGA 4GUHA 1AW2A 1FCBA 1EB3A 2JKAA 1R2TA 2CZDA 3GLCA 1YDNA 2YSWA 3WJSA 3U2OA 1TPDA 1TTQA 3HGJA 3L5AA 3MJYA 2RFGA 3OVPA 5FEWA 5DCBA 1Z42A 5CZ0A 5BRBA 3M6YA 1DOSA 4O19A 4CQ9A 2ZFAA 1DL3A 2HSAA 2VOMA 5G4WA 4B5NA 4X2RA 4OU1A 4POCA 1VC4A 3R2GA 4N6EA 3NQ2A 3TC6A 5KINA 1FDZA 2ZZ2A 1TTIA 1TSIA 3W87A 3STFA 4FNPA 4K7YA 1GVSA 3LXCA 3KVKA 3NZ1A 3L9CA 3W7PA 1H51A 4Y90A 5F4SA 4JTLA 3UY8A 4NZJA 1KM3A 2FPVA 1B4KA 3AO0A 2Y70A 5AHLA 3NR0A 3M1ZA 1LM1A 5DCDA 3UD6A 3ANYA 4JTJA 4DELA 3LRMA 4RJEA 3F03K 4BI5A 5J5DA 3L67A 1ZCOA 1I2RA 2CLOA 2FLIA 4QJ1A 4RZ4A 1LOQA 1EWDA 4UMBA 3E12A 3UWWA 1WQ5A 4GUGA 4DF1A 3IRDA 4DBDA 2Y63A 2CLFA 3F1QA 2AGKA 3WK2A
chains in the Genus database with same CATH superfamily
1R7OA 1SVDA 2NT0A 1MI3A 1V0KA 1GK8A 4WRHA 3NSNA 1VLIA 1IR1A 1OM0A 1Y5WA 3MT1A 1KQYA 4LAKA 1N82A 1S2WA 3ARVA 1TTPA 4DQWA 4I9JA 5CAHA 3PM6A 2PTWA 2PGRA 1T5AA 2XH2A 5EB8A 4H8NA 3FKRA 1OC5A 4UIOA 2PODA 1US3A 3UNTA 4PEKA 1FBAA 2NXIA 3H2OA 1AFSA 2DY3A 3O15A 4FR6A 1QK0A 2OMAA 2CZ5A 5K2ZA 3UWEA 4JYEA 3CV2A 2VZVA 3U7BA 5D2VA 2VZTA 3ABQA 5BWAA 2JEQA 1RA0A 5CSRA 3LN3A 4V33A 4KKXA 1RHCA 2A4AA 4JFTA 1E1CA 1XGZA 4PBGA 2C1IA 1E4MM 5A6KA 1LOSA 2VNCA 3UERA 3TDFA 4WUIA 2Q01A 3IVSA 5BXSA 1VFMA 1UQZA 3HBLA 4FX6M 1GOIA 2ZRXA 1YPIA 1ICPA 4WDWA 1PKYA 3PZMA 2INZA 2WW5A 2Z29A 3BSMA 3IJDA 1SYTA 3ZIZA 4JTIA 5F2MA 4M82A 4Y7EA 2NW0A 3K8KA 3MC5A 3W1UA 3O6YX 2QXWA 3WQOA 5K9CA 2KX9A 3MUCA 1J5TA 1EPVA 1N8IA 4GJIA 3O1NA 1OFPA 1NH6A 4O52A 1EF2A 1UIOA 4QDPA 1T7LA 1WKDA 4WOZA 3WELA 5BZAA 3MSRA 3O6CA 2A3EA 1F6KA 3L7RA 1CXFA 5AY7A 2WKGA 1V8EA 3KWXA 2YYTA 3SCUA 3KBMA 3EKLA 1TJ1A 5E5CA 3B9NA 3GDTA 3WJXA 4FNSA 3S1WA 3PVFA 3CUHA 3VNKA 3BURA 3OLIA 2VQUA 1X97A 3P14A 4PYSA 4JQ2A 2I16A 3A64A 2GDQA 2QGYA 1O6IA 4BQ4A 1TA3B 3QGKC 4U5KA 3VGDA 2CESA 1BG4A 1XIDA 3GW3A 4K3ZA 3M0JA 3HB9A 4Q4RA 3GM8A 1GJWA 4W89A 3MVTA 1XPGA 4GBDA 1ADOA 5A6BD 3PZOA 1XD0A 3CT2A 2NWSA 1NFPA 3OVRA 4WY0A 4EKJA 1QFEA 3WLNA 3ARXA 7ODCA 2WWDA 2Z1KA 1R3WA 3IJIA 2DZPA 3LZ5A 5EMKA 1TPB1 2D3LA 4QR6A 3C4UA 4YCOA 3H54A 1LORA 3QZ6A 4C91A 3DG6A 1RP8A 3N2CA 2FIQA 2DT2A 2O7SA 3W7RA 2GUUA 4JNYA 2QJHA 4F3HA 4XVDA 5A6JA 3S2NA 5IXEA 2EAWA 3VI2A 3Q2DA 1GQNA 3ELFA 1YXDA 1Z6KA 4GZJA 2NT1A 5G5IA 3PPFA 2YGYA 4JY8A 3WDRA 2NZLA 4O18A 2XFYA 4TOQA 4Z1DA 4DUOA 1IV8A 1LROA 3WUBA 1IXQA 4MHBA 5A69A 2X7VA 2WYSA 3W23A 4U4MA 4QDMA 1IZKA 4FAMA 4B9YA 2O0TA 2ABBA 2WMFA 1JPHA 3MUY1 4O1BA 2WSKA 3SY8A 4WDTA 1CENA 1KFCA 4Z1CA 3R13A 3TV8A 2PURA 1KQZA 4DB7A 2VZOA 1I8JA 4AUBA 4JIIX 2A3LA 1LRQA 1Z89A 1PZ2A 3HMJG 3P5ZA 4DM2A 3EA3A 4DPPA 3BW3A 1X6NA 2GQ9A 5K9XA 3W2NA 1TPEA 4AU0A 3U9IA 1WUEA 3FYOA 5LNRA 1TTJA 3M7SA 2YOCA 2PS2A 3H12A 2R6OA 3FA5A 2C16A 2V81A 2Y62A 2ZUTA 1KWKA 1UP2A 3MS8A 2OYKA 2Q6ZA 2VR5A 2PCEA 1GG0A 1E73M 2IKHA 4DWSB 4UZUA 1V0NA 1LRTA 3DFHA 3URNA 3RX3A 4QNWA 4TVDA 2Z7KA 1UR9A 3CJPA 4XZHA 3ME3A 4XSLA 2XM2A 1RVGA 1SMDA 1V6YA 2YZRA 1UP3A 4LNCA 4J35A 1F74A 4GLEA 1WXZA 3GB6A 2VCAA 3W73A 1ZU8A 1Y0EA 4IGHA 3XISA 4JIHA 4ZTXA 1PS9A 2VR2A 1ZS2A 1HKJA 5I3FA 5K9DA 2HJPA 2X09A 5JUVA 3S1UA 2FZMA 4XK2A 2A3HA 2OZ3A 2NXHA 1CIUA 1AL7A 2CBUA 1Q2SA 4KRTA 4EF8A 3WSUA 1S1PA 3TIMA 4A3QA 3MU7A 4RDZA 5F7UA 4R53A 2J66A 1MDLA 3MCOA 4O1FA 4XZBA 2IUZA 5CC6A 1M1BA 3VD5A 3SGGA 1QW8A 2BTMA 2EGZA 1R3SA 5KEZA 1LOLA 2E5DA 1AH3A 3PJUA 1TIMA 3KS6A 4OBSA 3KVJA 2WMKA 1CXHA 3M7WA 1VPYA 4UFHA 1U5JA 2UBPC 2XH7A 5D2TA 3DFYA 1LWJA 2WOQA 3AUOA 3EOLA 1PJ9A 2VHLA 5CBBA 2GVYA 5B7YA 2J77A 1DYSA 4BR1A 1OFOA 2C14A 1VS1A 4LWWA 3SEPA 2XSXA 3L0GA 1XLCA 2BVDA 3ZLGA 4AIBA 4XUYA 4IFRA 3ID7A 3ANUA 1PYFA 3OHMB 3AIRA 1H11A 4EPDC 3QC0A 5FA5A 5CPTA 1K03A 1PX8A 3U7VA 2W62A 1NQ6A 4JDBA 5JBFA 4I7UA 2P53A 2HPIA 1XDJA 4IF2A 2Q8ZA 3DYPA 1B3WA 2VC6A 4A21A 2ZTKA 1V02E 2VVSA 2XU2A 3PBVA 4C1NB 1Z3NA 4M19A 3SCVA 4CNTA 4GKTA 2D20A 4GH3A 5EU9A 4E4PA 3FDGA 1IWAA 3BG3A 2Z6IA 5CPQA 4FMVA 3L21A 4WXZA 4J9JA 2B4GA 3VDBA 3RPMA 2HNEA 4E8DA 4F2UA 3GE7A 2NVDA 1UD5A 3MHFA 4XZWA 4AWTA 1W1TA 1WKYA 3BOXA 2DZSA 2RKXA 3EWBX 3S4TA 3TYDA 4PH6A 1KFEA 2WM0A 2AQWA 2W91A 3QSRA 3AWOA 1YHTA 4PA8A 4QE5A 1PTDA 5JH1A 2BXYA 3CUIA 2XSAA 3VKCA 1C91A 2R1PA 2X0YA 2Y8VA 1W91A 2GOKA 1JJKA 3CPUA 1US0A 1JCJA 5D30A 4N9DA 3ARRA 4NI3A 2ZX8A 3GDKA 1SR9A 3CIXA 4GA8A 3UXAA 3RJYA 3VDCA 3A5FA 5L6UA 3BDKA 5CC7A 1QNPA 3NQVA 1MZRA 3IUIA 3QOMA 4ACZB 3GK0A 3LMZA 4FNRA 1GJUA 3PG8A 4HMEA 3G8EA 2FH8A 1V08A 2B7OA 4L6DA 4OUIA 1GVFA 2HTMA 3VE9A 3BGAA 3MUZ1 4RPPA 3RR1A 3GKFA 3Q65A 3ABRA 2G4JA 4GYPA 4GI9A 3EXRA 2AKMA 5F1VA 3GU9A 3G22A 4L4OA 3UJRA 4GQRA 3P6LA 1W54A 4H4IA 4J40A 2QLYA 3NL2A 2J47A 3C2EA 3LMYA 3NVDA 2QPUA 3PBYA 5A6LA 3B40A 1YMYA 3BGGA 1EP3A 2ADAA 3E74A 3LI0A 1PEZA 4UB9A 5C7HA 1VRDA 3VOGA 3DFNA 4JL1A 1UOZA 3LSCA 3PULA 3VTRA 1CXLA 2XFRA 1B57A 3W0KA 4JTQA 2ISFA 4LCSA 2YCJA 1JXJA 3W2KA 3EX4A 2J7DA 4XD6A 3ATZA 3WF3A 4LY8A 1TV4A 3THDA 1Q7ZA 3V1HA 1XIFA 3B8DA 3WLSA 3V7PA 4GVFA 5FKYA 4B5TA 1YX1A 1A0DA 3SCPA 2DFAA 3S9ZA 1WDSA 1HZYA 2G0WA 5A3HA 1KC7A 4QNEA 1RJPA 2QDEA 3FJ6A 3M47A 1QDSA 1HJSA 4JKMA 1FP9A 5HQLA 5CLTA 2B7PA 5A2AA 3UXLA 2AL2B 4Z2KA 3SUVA 4HBKA 3GNPA 3CWNA 4UFMA 1XRFA 5CJ5A 3C56A 3XIMA 2PDKA 4LB4A 4HPHA 3UYIA 1BGAA 2GGGA 4YVVA 5FESA 4S3JA 2NV1A 3MO4A 1UWTA 7CGTA 4X22A 4DO6A 3MQTA 3FCPA 3B0XA 1SFSA 3MV01 4JTUA 4Q8NA 4YYFA 1OCBA 3GG1A 4MWAE 5AVNA 3SSZA 5IFPA 3PBMA 4QBXA 4XZ9A 1ZQ5A 4KCVA 3NZRA 2OU4A 5FF0A 3W84A 4QLKA 2NUYA 5HQEA 4ZQNA 4CNUA 3F5JA 2Z25A 3SIMA 7XIMA 1AZ2A 4B16A 4BZYA 3TC7A 4ZQCA 1BYCA 1C7TA 4M29A 2OQLA 4W85A 3W24A 1BF6A 2DU2A 3H23A 1W3KA 1O5KA 1PCWA 4W5UA 2EHHA 2EQDA 4L1GA 4YPJA 4HSNA 4JX4A 1GVRA 3K1DA 2Q8XA 1X1NA 1J93A 1FXPA 3ISIX 5H1WA 4QP0A 3M0KA 1I0BA 1NJJA 1PHWA 1QO5A 4JEQA 4I5UA 2W9MA 2O9OA 2G5WA 2QYGA 3VM5A 1GZ1A 2Y7DA 5D9OA 4LUSA 4PUWA 2NLYA 3WK1A 2E28A 2CIPA 4LYPA 3V4BA 3JRKA 3LHTA 4XQ6A 5DCEA 4UWMA 3E3HA 3GXMA 3SUUA 3SFKA 1TJRA 4MDPA 4XAGA 4CUCA 2E77A 4GBUA 2QCLA 1JZ4A 3WMBA 1SMAA 3CAWA 1ZALA 3WBYA 4LVAA 1UZHA 1H7PA 4HU8A 2W4XA 5E9AA 2WBGA 4XTDA 5ENLA 3QV6A 3A3HA 1PDZA 1SPQA 3Q45A 4FA3A 2W67A 4HMNA 1GGOA 4MY1A 2FPTA 2I5GA 2PC4A 4E8CA 3B03A 5A6BA 1FHUA 1VFHA 3BAWA 3LQLA 3AYSA 1L8PA 5I03A 4FOUA 1Q6LA 4JIQA 2QCGA 3CK5A 5M5DA 4Z0JA 2C1GA 5M17A 3MMTA 2R91A 1L2UA 2PWUA 3QR3A 1THFD 2OSWA 1E0WA 2OKTA 3HFYA 5BXPA 1FCQA 5I77A 1FWDC 4KFOA 3NQMA 4QHRA 3VOJA 4DBWA 3L4VA 2QUUA 2ZZ5A 4OE7A 2IPFA 1W1PA 3E0FA 1Q63A 4JN6A 1OQFA 3UFYA 4YWIA 3NSXA 3B8UA 5DT5A 5HUOA 3PWIA 3G1SA 3ZLFA 5FEPA 3L4ZA 1S39A 4GISA 1YIXA 3TW6A 4AW7A 3L4YA 2RGLA 2E68A 2XVPA 2W5FA 4NRRA 4MLJA 3TJIA 1ZP4A 1M3UA 2X42A 3DBPA 4RNHA 3S5YA 4HIBA 3LEPA 2WK2A 4W9TA 4GACA 2EG8A 4O17A 1MXGA 4C60A 3OJGA 5LA1A 4R33A 3VFLA 4H9YA 2INFA 1J96A 1P43A 1XUZA 3BLDA 2V8ZA 1D2KA 3KRSA 2OX1A 2ZCGA 3BC9A 4NRSA 1G01A 2WO5A 1XYBA 1R9YA 5AHEA 4C90A 3NDYA 3WLHA 3GAYA 2ACQA 4HHPA 3TMLA 1Z44A 2GJPA 2JF6A 7PTDA 4OGZA 3AYRA 3WQFA 4F48A 4GKLA 4N0RA 2DQXA 5BOFA 4U33A 2EKCA 3DKLA 2YDAA 2BB0A 1JCMP 1CGUA 4PRTA 3CZKA 4DO4A 3SGUA 2Z7GA 4GQQA 5H6HA 1F05A 2GPTA 1UD8A 3EWZA 4ZR8A 1I1XA 1HL9A 1OB0A 1IYXA 5AC7A 2JGQA 3EX2A 3QHNA 1JFHA 3PTQA 2F6UA 4I6KA 2D73A 4CCEA 1OEPA 1W3JA 1VGAA 1BTCA 2YCIX 1CGVA 3SRDA 2QIIA 2V63A 2WZIA 4HNTA 3CAQA 1GHRA 1ZLPA 4RPQA 1S2UA 3M0MA 3UJFA 3N4EA 2PWHA 3MWCA 4UOJA 5A94A 1VIZA 1BEUA 3MJMA 3BGJA 2OEKA 4DYEA 3R4IA 3CQJA 3ARWA 1Z32X 4JTRA 1ZBWA 1ISVA 3IV3A 3UA3A 4NYYA 1FFRA 3QBUA 5LNSA 2OWCA 3B8SA 1PX3A 1H5VA 2PC8A 4RV3A 3A3WA 4HPNA 4KERA 2XPKA 3TAOA 3ALFA 1BRLB 1EGVA 1V7AA 4Z42C 4S3BA 2YJQA 3O9NA 4C5YA 4LF2A 3QSTA 3M4HA 3NPVA 5ABFA 4WZHA 4Y9MA 4UFLA 5AECA 4J3SA 1B3XA 4JBRA 4UQDA 4FS9A 4WF7A 4P8WA 2Z00A 3BQ6A 1HTIA 2JE8A 1PE1A 4FHAA 2VFIA 3GFZA 1E72M 1RJRA 3W75A 1NM9A 3KS5A 4IUGA 3MWAA 1IT0A 1BLIA 1MRQA 2BXZA 3UJSA 2UZ9A 2I5QA 4OUEA 4RZ6A 3ALGA 3WQDA 4GUJA 2W79A 1V0LA 4Q4MA 1T96A 3A24A 1CXKA 2P0OA 7REQB 1WXJA 3WL0A 1XIBA 1OFEA 4IQLA 1GOQA 3W2MA 4LPCA 5FI8A 3WLJA 5I3DA 3KLKA 4GOAA 4DAIA 3RDKA 2BODX 4K8EA 3V5FA 2YL5A 4KGLA 3ARSA 2D22A 2W92A 5C9UA 1AVAA 4FLRA 1XX1A 3WZ0E 2YA0A 4P8XA 3MV11 1EJTC 5BU9A 5CPLA 1OADA 2Y5SA 4LBUA 4IIGA 2FZDA 4ZO7A 2XH4A 1OT1A 3DH7A 3OQEA 3LHYA 5FACA 4JN7A 4MPQA 1TRIA 3VMNA 2AAAA 2CC0A 3OU8A 3S6TA 1TR1A 3EDJA 3VNMA 4NSBA 1MNZA 1MW3A 4DXVA 2WJDA 1ZBCA 3CO4A 4ATWA 5A5WA 4JGDA 3ZFHA 1NELA 2GJLA 2JIEA 3LGGA 3OQ8A 3ENLA 1WA3A 4H8UA 4XVEA 5CG7A 2A7PA 1EEPA 3PAOA 5LIXX 5FJOA 2OB3A 3WH6A 2PDQA 1LBFA 1SZGA 1JF5A 2H9AB 4MLRA 4WXYA 5C9ZA 4GFSA 3T40A 1XLJA 3GG0A 1EOKA 2TAAA 3GDLA 3TKFA 1M7XA 1C92A 3IPWA 4WSKA 4WGXA 5C55A 5CAKA 1L8NA 2IPJA 3PNZA 2DH2A 4I9MA 3W82A 4P7QA 1W9PA 1XBVA 1G9HA 3UWQA 1C3FA 2HVNA 3DYOA 2QJIA 3R10A 4GVGA 1ITUA 1EX5A 1AQ0A 1G7VA 1EP2A 4IPPA 2ATSA 4QJ4B 1VBUA 1MQRA 6REQB 2P3ZA 3DOPA 2NQZA 4GCXA 3ANVA 1H60A 2Y5EA 1HJVA 4DJFC 2PWFA 2WSQA 3JW7A 2V5DA 4LS2A 3TW9A 2IKJA 1PUDA 3AICA 2NSXA 1SO6A 2VR4A 3KDOA 3OGSA 4H9MA 3CMGA 3BAKA 1Q85A 3PWGA 1QPQA 1JQXA 3VIHA 1UBPC 2GQ8A 4MSSA 1E55A 4Q4OA 4RX0A 2CKSA 1J79A 3LENA 1BKSA 4GI4A 2V5CA 3F4VA 2YDSA 5FJUA 1NVMA 3FA4A 1F3WA 1WBJA 3OYZA 2OTDA 4H3DA 3S83A 2ZVIA 2Y2WA 2XYLA 1WUFA 4DVOA 1VHCA 3M6DA 3QPEA 3TA9A 4D8ZA 2IQDA 1H7XA 4QS5A 4JICA 5MHBA 4K39A 1HJXA 4JTKA 4LRSA 4XUGA 1LUCB 1DXIA 3TJLA 5CGTA 1X98A 1V4YA 4TUFA 3BLPX 2WC4A 3S6OA 4UTTA 2Y61A 1VYPX 4RNJA 3Q58A 4FNQA 2ANUA 2DH3A 4HMCA 3KFTA 2FTYA 4H2CA 4XBJA 2GUBA 2XIIA 3WENA 4NASA 4A22A 3NNTA 1LL7A 2PU0A 2HWGA 3KP0A 1TZ7A 1SJBA 2UWFA 5JVLA 3R8GA 5D4YA 3MW7A 3G1DA 1NWRA 3ZR4A 3BV7A 2GL5A 1AJZA 5D9NA 2CXEA 4ZE5A 1W3IA 1VEOA 1XG4A 5AHMA 4YMZA 5TAOA 5DEZA 4BI7A 1KLYA 5KZMA 1E9LA 3AXHA 2V3FA 2JQXA 3WO8A 1IGWA 4JFSA 4GG9A 2AOSA 1A5BA 4QG9A 4IQDA 3F4NA 4HNNA 4KMQA 4PMOA 2FPYA 2OZ0A 5BCAA 1PIGA 4E5TA 1XIEA 1NF7A 4W7VA 3M5XA 1JGMA 3W7HA 4AZCB 6PTDA 3SO7A 1TCDA 2QW5A 2PAJA 1ZUAX 2VOTA 4AY7A 4AZ5A 1IHIA 4TVCA 1GORA 2IW0A 1V51A 3AMDA 3FJ4A 5AYYA 4X9SA 2X2YA 2HS6A 1B4EA 3NDOA 3I4EA 3OLGA 3GAKA 4IMGA 2QGHA 4DIAA 3S1XA 1DJGA 1H63A 1UB3A 2QV4A 3B97A 3UU0A 4Q4SA 1FCVA 4X9YA 4JN8A 1A53A 1JFXA 3N2TA 5G1MA 1BTMA 3H4GA 2DZUA 3QN3A 5G2WA 1Z8AA 3SY1A 1MZHA 3TR9A 4GMEA 3TQ0A 3FXYA 3MHGA 4ZO6A 1TV7A 4YL2A 5B7ZA 3LPGA 3H2EA 3STEA 3RIKA 4OWGA 3OHIA 4O1EA 2DSUA 3FY1A 2GSHA 1S5MA 3U5UA 3W6MA 4U2ZA 1BFNA 9XIAA 3PUOA 3NAVA 1UC5A 3BICA 3WF1A 4O1CA 1CWYA 2J6XA 4HHMA 2OGYA 3LTSA 3PUEA 2FTPA 2VURA 4Z1AA 4WKAA 4L9YA 4L6HA 2HV5A 4NL1A 4WCJA 1KBJA 3G3DA 3S42A 5AC5A 2X16A 3GC5A 1E4IA 5CKSA 5FAJA 2ZZ4A 3IJLA 1U5VA 1GQIA 4BCEA 2V68A 2WAGA 4LQ1A 4E38A 1XQLA 1CXEA 4LGXA 1GPFA 4NILA 3TN4A 4TMCA 3T2QA 4Q33A 5FEXA 2P1FA 1VQTA 3GVVA 4J5NA 2OELA 2FTWA 4NP7A 3VDHA 4PMXA 4YJ5A 3NO3A 4GXPA 5IDZA 2QAFA 3PBUA 4DJED 2JF7A 1TWWA 1VFSA 5CPMA 2QJMA 4WX2A 5EGRA 3RO6A 3QQ0A 3NFUA 1K9TA 2ZX6A 3ZJ7A 3E49A 1XSKA 1YNPA 2F2KA 1OX6A 2AGTA 3PAJA 3QRHA 1KKOA 2E0PA 3QF0A 2XIOA 4EPEC 4OFCA 3C0SA 4Q8OA 1FKXA 3UQNA 2C71A 2QVHA 4GD0A 3RG6A 4E4UA 4PL2A 1QBAA 4KPLA 3LCLA 3C0JA 4PUMA 4AHPA 1MW0A 1RBOB 4ADSA 1ONRA 3I7SA 3MTWA 1E1FA 4C6EA 5AYXA 4Y2WA 2PBOA 3V18A 1ODZA 2FZBA 4GUHA 2BHZA 1FCBA 1B30A 2CZDA 4DWSA 4QSFA 4RE2A 1MMFA 3OVPA 3SRKA 5A8MA 2MUCA 4RNIA 3OVGA 1J0ZA 1Z42A 5CZ0A 4D6HA 1DOSA 4MF4A 4O19A 4R3UA 2PDWA 3W81A 2VOMA 5G4WA 2Q02A 4Q8MA 4QJ3B 4D6GA 4N6EA 4DAFA 1TR9A 3M0LA 2BGQA 4PTWA 3SADA 2ZZ2A 3CMJA 3QGAC 3AIBA 4US5D 1PBGA 4CD6A 2CPUA 2WVSA 3W6LA 3T42A 4XIMA 4Y90A 3CHDA 1E6PA 1HIZA 3VU2A 2FPVA 2VVNA 2J7GA 5A6TC 1BVZA 4GY7A 1DIKA 2FKPA 4G7FA 1LT7A 3ANYA 3AXXA 4JTJA 4ACYA 3UJEA 1I2RA 3FAWA 4D72A 1MWOA 4QJ1A 3E12A 1UD4A 1EDQA 2P3EA 4JIEA 2RJGA 2Y63A 2CLFA 3ZVHB 2YL6A 2F9RA 5A1AA 4DJDA 4YU1A 1KTCA 2O56A 5HNNA 2VGIA 4ZFMA 3VKKA 4O11A 5IDIA 1X7FA 3LQGA 4L6OA 4B5SA 3ITXA 4HGXA 1L6SA 3N18A 3KXQA 3F2BA 4BK9A 3NDZA 5I6SA 1XQKA 3N2BA 5CSSA 1JPIA 4GE8A 4JTDA 1HN1A 2ISWA 3DEQA 1CDGA 3LU2A 1UP0A 3FOKA 2AAMA 3W76A 2PDIA 4PSPA 1IEXA 1A47A 1J18A 2J24A 4U10A 3P2VA 3WLTA 5FCZA 1JYXA 4WY0B 4JD4A 4X0VA 3BQ5A 5LGZA 3WF4A 2W3ZA 5AHFA 2JBMA 2E9MA 2VZUA 1BXBA 4AVFA 4TO8A 1H61A 5ABTA 4PB5A 3GIYA 1XL9A 3ERPA 4L7ZA 3NYZA 4S39A 3H2MA 4BY3A 5HK4A 1EJWC 2CU0A 4YNGA 2ALDA 3SECA 3OLEA 1HKKA 1JG9A 2OLSA 4LRTA 3H21A 4KETA 3SRHA 1UUQA 1K1DA 4X60A 1BPLB 3M5ZA 4HTBA 4D1JA 3TN5A 3RLGA 1WXYA 2GJRA 2YBVA 3L4TA 3BUVA 3EB3A 5B80A 2DZAA 3GBEA 2O9TA 2ZA2A 4J3TA 1XIHA 3DAQA 4WK9A 2J4GA 2C1HA 4B5VA 3LBCA 1L6YA 1H49A 1R46A 2OG9A 2QCMA 1XJBA 4LUTB 1C29A 1LDCA 5LHEA 2Y6ZA 4JNMA 1ZP3A 2YL8A 3C8NA 4ZBCA 4JZ5A 3S5OA 5BMWA 4PCFA 4KRUA 2AMGA 2FVKA 2PWDA 4UR8A 1SGJA 4ZB5A 1GUVA 2QCCA 3WEMA 1DJHA 1H7OA 4IOTA 4ZENA 3DG3A 2VM8A 2UV8G 2WBKA 2V38A 1XBZA 4BJHA 3R58A 3RX2A 4PMZA 4ACZA 1A80A 3TSMA 4WHBA 3MMUA 3JU2A 1ZJAA 3VGGA 3B05A 2WM1A 3T81A 3LOTA 1XRTA 5GJPA 1W0MA 4JIRA 4M1RA 2YYUA 4FX8A 3N04A 1CNVA 1DHPA 1YQ2A 3PSWA 1HL2A 4GYPC 4JAWA 1JDAA 3CV6A 5REQB 1JQVA 2HISA 4PMQA 3GG7A 2XM1A 5EY5A 1MUMA 2P76A 4LX4A 2ZZ3A 4W87A 3W1MA 4AZGA 3LB0A 3EOEA 2XGIA 3CQHA 2C79A 3MUAA 3U6WA 3CH9A 5C9XA 4NIRA 1PDYA 4KWOA 4US6A 3GVRA 2CKRA 3IJ7A 2DSWA 3QC3A 4MJ2A 3FS2A 1QOQA 1BGGA 3SGZA 3UZWA 2F84A 4U3AA 3FV9A 3WNOA 3R0UA 2VL4A 2WMHA 3GC2A 5FL1A 3TP4A 1E4LA 3F2CA 1R30A 2E09A 2DORA 4G8TA 3TWBA 4NXKA 3T44A 1RQEA 3UPWA 4FIQA 1IEVA 2Z1BA 1R87A 4PODA 5ABHA 2AL2A 1QI2A 3ICJA 1Z7AA 1ISWA 1X8CA 5CCZA 2R94A 1VBHA 1JZ2A 1JDEA 1V3LA 1E43A 3AIEA 3AJ7A 1V5XA 2IXUA 3GXPA 1KFBA 2IQ0A 1CXIA 7ENLA 3CTLA 4QRNA 2OQYA 1DWJM 1GQKA 1K4HA 2JKPA 2QPSA 4H8VA 1O12A 4FLQA 2VGBA 3VZYA 5D2XA 1EBHA 4YTRA 4P61A 4O16A 5DXXA 1O5XA 3EA1A 2E5CA 3AHYA 4RNFA 4GJ1A 3A5VA 2VI0A 4C6IA 1EHAA 3F4WA 3VE7A 1XCFA 3L0KA 2VDGA 1VAHA 3LY0A 2G3MA 3COTA 1EC7A 4DPQA 3T78A 1XM3A 4HZ7A 3RU8X 2OODA 5GNYA 3O2LA 2EG6A 4XAPA 3V1PA 3CL7A 2CZVA 4NZ1A 3RF9A 3G0SA 4HYWA 2UY4A 4Y9AA 4QCEA 3HV8A 3UCQA 3MMDA 3NTYA 4ZE4A 1F8MA 3CLWA 3E38A 1UASA 4MNKA 5I2UA 1EXBA 3VKBA 3GXIA 4B5XA 4AIOA 3CBWA 5HXMA 1Q4NX 2ZA3A 3MP5A 4QG8A 4PUNA 4CD5A 1E4NA 1FTXA 3M43A 4B4HA 1IEQA 3AROA 1JVNA 2PTDA 4DLFA 3NURA 1S2VA 1JPKA 4TVUA 4QE1A 2GVLA 1U83A 4AG0A 3OB8A 1H0IA 3W2JA 1WZAA 4KF1A 1W8GA 3W2LA 5AB3A 4IL2A 3HGOA 3QMSA 3KBJA 4GFIA 5HULA 4HYRA 3T9PA 1Q6RA 1OGBA 5AHNA 3POHA 3ARYA 1EDTA 4KT2A 1S5WA 4KQNA 2PTZA 3CUFA 3VGFA 2P5NA 5CBIA 3OG3A 3GO2A 2PP3A 4QG6A 3GD6A 3UR5A 3AIQA 3PZNA 4U31A 1ZAJA 1Q6QA 1SW7A 5CPNA 3SCRA 4IPJA 3M0VA 3P8IA 1O5RA 3TLQA 1VLWA 3VNLA 2NX1A 1EA0A 1V3JA 4F0SA 1FWTA 3TSBA 2VX6A 9CGTA 3RM4A 3W85A 4QGCA 3GNRA 1KTNA 5CSYA 1YLVA 4DXXA 2R1MA 2YX0A 3C2FA 2BGSA 3SCTA 3N9KA 3OBEA 3TUUA 2V6AA 1XCWA 4JOMA 2NVAA 1HF6A 2C6QA 2BG5A 1DP0A 2PDNA 1W2VA 3EX6A 2NXGA 3CIVA 1HXJA 4AWUA 1GYNA 1KB3A 4DJEA 1O94A 3L4XA 3VOHA 2XSBA 4LYRA 4R9XA 1HJUA 3PFRA 3WD3A 2EEXA 4FEZA 1W1VA 1QXLA 3R43A 1Z9AA 5AZ0A 3W1TA 3WH8A 4B90A 3QHOA 4UR7A 4LVGA 1FH9A 4PN2A 2XN0A 5D33A 1VEMA 3H2AA 2PDXA 1IEIA 3OPSA 3PJWA 4M6QA 1UC4A 3RLUA 2Y1HA 4ICCX 4GC3A 2ZQ0A 4UCFA 3RR4A 5A2BA 5AC6A 4UTKA 2ZDRA 4NX5A 3TFXA 3U0HA 1R3TA 3LXBA 4AF0B 4AMCA 4PRWA 3GRIA 2C91A 4BF7A 3EKZA 3W3OA 3PY2A 4IX2A 1ODUA 2B81A 3SM0A 3FJLA 3WQWA 1MDRA 1LL6A 2C15A 3EWCA 5IM51 2FYMA 3VIOA 4IPLA 4KIRA 3KOXA 2ZE3A 2PRHA 2R82A 4C6KA 3ZR6A 3FLUA 1QW7A 2PP0A 3AOFA 3QW3A 3S2CA 5AC4A 2J7EA 3KBWA 4MY9A 1SFJA 3P62A 3PJTA 1F5ZA 2VD8A 3W7NA 5BU6A 3B8VA 3GC4A 1DWAM 3USBA 1EKOA 1XICA 1ICQA 4AD2A 3CS2A 3ZR5A 4E2OA 1P6WA 3T4CA 3H7UA 3WMSA 3QMTA 3FGCB 1ZL1A 3RM9A 4EP8C 2PF8A 4O1AA 2ZX7A 1J0KA 1W9VA 4FNUA 4KFNA 4A6GA 3FX4A 3TK7A 3VGBA 3LBOA 3VCCA 2R1KA 4P5UA 2OGJA 1HO1A 6XIAA 1JRBA 3IJQA 4IGNA 1WE5A 1P7TB 3CL6A 1X1ZA 2UY5A 4LUSB 4M0XA 3UWYA 3IIPA 3P61A 4B2DD 3ZWSA 1Q6OA 1J0YA 1W37A 1Q5MA 2WSPA 1S3HA 4YTQA 3QXBA 1E6XM 1MQQA 1ZJBA 4EX4A 1A0EA 1GONA 1BRLA 1V0MA 3WJZA 4LC8A 4FO4A 3K8MA 1UA7A 1JZ7A 1FUYA 1CX9A 2HQAA 3W53A 4LTSA 1UKSA 4AX7A 3WX7A 3BV4A 1V3HA 2OVLA 2B7QA 4KESA 3WFAA 3MSDA 5C2XA 1H2JA 4FSAA 4MIMA 3V5CA 1CT5A 3A9IA 4RK8A 4ZMGA 1JPDX 1QNOA 3TC3A 3L12A 5HINA 5H8UA 2WNNA 4DF2A 3GHSA 5DY2A 1EC9A 1PWMA 1VZWA 2J78A 3AIVA 3HQ1A 3EWXA 4Q7NA 3W74A 3QVQA 1WZMA 4AISA 3KW3A 1EOMA 3TNOA 7REQA 1K70A 5D2YA 3G1AA 3UGRA 5DQPA 2G3FA 4RV8A 4MFEA 4YYCA 3P67A 1ME8A 3RPTA 1XLAA 1C7SA 4ZB0A 4HTYA 1X6LA 3K8LA 2FDMA 1W6TA 3NQGA 2BVWA 4KH2A 4TX9A 4W88A 3OZYA 2QR6A 3FEQA 1SJAA 3STGA 3UVAA 3NEVA 3E2QA 2QAPA 3GDMA 1NARA 3NL6A 3C3UA 1HT6A 2ZRUA 4A29A 5TNVA 1TJ2A 2B7NA 4K6AA 4MNLA 1DQXA 1OD0A 1EJRC 2IPWA 3VD4A 2VFEA 3SUTA 3WEOA 1JCXA 1G4EA 1F76A 3G0UA 4W7WA 2D69A 4KCWA 2P50A 3HGSA 5I23A 4GABA 4L56A 4ML9A 1ZGDA 4CQDA 3WQCA 3UJ2A 4RDWA 3CB8A 3A47A 1UD3A 4ADUA 5A8QA 1XD1A 3TROA 1V3KA 2NV9A 4O8RA 4AZBA 1YDVA 1AJ0A 3C61A 3R11A 3T8LA 3LM7A 4FLOA 1K8XA 4C7FA 3MY9A 1Z69A 3AHXA 3MYOA 3S5NA 1J6OA 3EOUA 4KCUA 1LYXA 3QLDA 2OPJA 1A3HA 5AOUA 1H1NA 4WOQA 4BF9A 3GH4A 2IKIA 4YLWA 1V6WA 1BYAA 2YR1A 1XINA 3EWDA 3B8WA 1EF3A 2W6RA 4LVDA 5BXTA 2TYSA 3LM3A 4HVXA 1MO0A 4GVIA 1GWJA 3CC1A 1UCWA 4W7UA 2XVKA 6REQA 2WZHA 4H04A 4NJIA 4LAZA 3DYMA 4DXKA 1QWGA 2Y5JA 1JI2A 4KEMA 1VENA 3NL5A 1WNOA 1AUSL 1OFDA 3TVAA 1T99A 4XAZA 1WCGA 2OT1A 4ZZ9A 1POJA 2X8RA 1J11A 2ZXBA 3VC5A 2X05A 4IMCA 1UKTA 3UR2A 3HQOA 3V0SA 4LBRA 4D6FA 1GQJA 5CG0A 2KZHA 3CZEA 1VFLA 1DHKA 2OX4A 2C18A 1IQ8A 1BQGA 3HJEA 4G7EA 1JEZA 4AD4A 2R9RA 2XZ9A 1NWUA 1UD2A 1JL8A 3FDKA 3IUDA 4ZCWA 3UGVA 5DMMA 1WDDA 4JQAA 3DZ1A 4BF5A 4UOZA 5A6SA 4UNKA 1LUCA 3BLEA 3J7HA 4UTTC 1JD9A 3S2JA 1VJSA 1GT8A 4FOJA 3WLIA 3E2SA 4DNMA 1KGWA 3B9DA 3DFOA 2G41A 3TQVA 2OXNA 3CZJA 5LSMA 3CGTA 5G4EA 1EXPA 4D2JA 1PKNA 1DIEA 4K38A 1C8VA 3VABA 1G4PA 3QZEA 3GYCA 4HMDA 3WLLA 3GHRA 1A4LA 1B0IA 1W5OA 1BWVA 4EWND 4J2MA 4HPJA 1IF2A 1EC8A 4MYXA 2DQWA 3RYSA 2XFFA 2A6NA 1TJPA 5FJPA 2V3DA 5A95A 1MEHA 3LD5A 3G1VA 2R1LA 2WZEA 4HNOA 4ROPA 4O13A 3OEXA 3FKKA 4O14A 3KOZA 4AZCA 1F73A 1WDRA 1I6NA 4AD1A 2J62A 3RITA 3THCA 2CERA 4C6FA 3WUFA 4MVAA 2CYGA 4CQAA 1J10A 1KM0A 3HG3A 4QTGA 3UWVA 1FWSA 3N14A 1NP2A 2YXXA 1H1YA 3GKAA 2FMOA 3B9OA 1S5VA 3A12A 4GZIA 1MQPA 1XFBA 4Q6XA 1HKVA 5J04A 3W7LA 5LXEA 2F6XA 3EB4A 3HQNA 3JZEA 4JQ3A 4IP5A 2PSNA 2E4TA 4ENLA 1RK5A 4HPGA 4AC1X 1UMYA 1N7KA 4TTUA 4GH1A 4A3RA 1GVYA 3ABOA 4ZOCA 3U2EA 3QYQA 1PZ3A 4ATDA 2A85A 2GJXB 3KM8A 5KITA 2CXGA 2PZNA 3H70A 4ASTA 3W1XA 5H8PA 4E2BA 1AD4A 5GNZA 4G5DA 5E70A 2ZUVA 4IIHA 1R85A 1CLVA 3C52A 3EXSA 2HROA 3VGEA 3LGDA 1ISZA 1V93A 2PMQA 1VIWA 3QH2A 3N15A 2B0MA 4FPSA 1OSEA 3WLOA 1A0CA 1EX1A 4FXSA 1XLHA 3WN6A 5DMNA 3R7MA 2A2IA 3UZ5A 3GFXA 4FB7A 4Z0SA 2PDPA 3APYA 2AL1A 3MVIA 5HJYA 3GDRA 4OIFA 1YXCA 1XLFA 3EDKA 4V15A 3E5PA 4GJJA 3UXDA 1XH0A 3APTA 3R5EA 3UA4A 2ZDSA 3GSMA 3N9SA 3IK2A 4D6CA 4HD5A 4L4MA 3K30A 4RR4A 4OECA 3GZAA 2DIEA 2X2GA 3R0KA 5SWUA 4PE8A 2DVTA 1WP6A 3MANA 1XIGA 2E25A 4TV5A 3CTTA 1V7YA 3GTFA 3BTNA 5M1TA 4EF9A 2XJ7A 4MADA 2V3GA 1OHLA 3UZZA 3MUIA 2J27A 9XIMA 3NZGA 3W72A 2PFHA 3TR2A 1SM9A 3SI9A 4LV4A 4ZO8A 4AEOA 2IS7A 3QY7A 3CUJA 3IAPA 1I2NA 3PPCA 1O66A 3GTIA 3MSGA 4JQ4A 5CLWA 3SZ8A 5HA7A 3QM3A 1EYWA 4ICNA 2OOGA 4J1OA 3LS9A 5A8NA 2CLPA 1DVJA 1EHNA 3FNDA 3TYZA 3KVLA 3IIXA 3ZQ9A 4E2DA 4YHGA 5I7GA 3W1NA 3CXOA 4HOXA 3NQ8A 1XWYA 5D38A 1DJNA 3SB0A 4Z1YA 3KL5A 2OCZA 1DJWA 2YIHA 4CVWA 4K68A 2FFIA 1R9ZA 3VNZA 3DI0A 4H7ZA 1LF1A 4H7VA 4CGTA 1H3GA 1EGMA 1NTHA 3W71A 3V0TA 3QR1A 5A8OA 3WQGA 1U30A 1XFCA 1ZNNA 3P0WA 3EMZA 3MSYA 3I68A 1E5JA 4NNAA 7TIMA 1U1HA 3BXWA 3K4WA 1IXNA 1AD1A 2G3IA 1UA3A 1SZEA 3IAQA 3KRUA 2ZE0A 4PBEA 4FNTA 4DWSC 1OFRA 1R0MA 4PB3A 4PMUA 7TAAA 3VNDA 4PCPA 5D37A 2RDXA 3BSGA 3LG3A 3STCA 2VELA 4WDUA 4HCHA 4HJFA 3DIPA 3SN0A 2QJNA 1SSDA 2Y7GA 4NZ4A 2DZVA 3PZ9A 1GEHA 2Y7FA 3UYCA 3LLDA 2VJXA 2Q71A 5EMYA 2XN1A 4WSHA 2BGNE 4LANA 1TB3A 3PK7A 3PS7A 1EBGA 2D0FA 4KS0A 4GZ7A 3WNLA 5E0KA 1BWLA 1H62A 1I2PA 1TE1A 3DFQA 2CLLA 1XI3A 1F8IA 1QW9A 1XLDA 3LCHA 3CNYA 4MUZA 4JTTA 2VKZG 4JXCA 1R5YA 3IK4A 4XKYB 4HKPA 1OFAA 2WHLA 4H19A 4NNCA 5F4WA 2FHCA 3MHUA 1FH8A 4K37A 4AMAA 1GEQA 3Q4DA 3F5KA 3B0YA 2PLJA 5CZJA 3W7IA 1K9DA 2I9EA 5CPOA 1EDGA 1EWEA 1OCJA 4DZHA 1C9WA 1K02A 4DJDC 3ZVHA 2Y8KA 3WYZA 3NUKA 2YKKA 3ZJ6A 3DHFA 2Y89A 1YDYA 4BQ3A 1CI1A 1T41A 3WNPA 3AISA 3SN4A 1FOBA 4S23A 3VX1A 2ESCA 2F7FA 4O28A 3NCOA 2YA1A 2FB2A 2INEA 4GIRA 5GNXA 1B5TA 4S3FA 3NIYA 2QUMA 2PGWA 2HDJA 4N9BA 5I24A 5DX7A 3BPWA 5FSEC 1UPMB 3DUGA 4AZ6A 1XBXA 1NAL1 3ECQA 3DCPA 3VIFA 4L80A 1A4MA 1CECA 6ENLA 3WLRA 1NDVA 3B9AA 1O1HA 4J4KA 1E0XA 2H8XA 2QZRA 4NU7A 3AYTA 2G3JA 5MKGB 1QHZA 3WLPA 1YDOA 2IXVA 1S46A 4J3UA 4CN4A 5HBFA 3TEVA 3ZSSA 1QTWA 4OKDA 3T0TA 1I1WA 4MWAA 3GY1A 4JHMA 4IMDA 3SUSA 3WDIA 3RGTA 1AK5A 2POZA 3LHZA 3AS3A 1W3TA 4OV9A 2OYLA 1NDZA 3O6DA 4AD3A 2ZBTA 2BLEA 1P5BA 4P7RA 5FL0A 2HRWA 3EYPA 2L5HA 3VKAA 3ZXWA 3VC6A 4DUXA 1RK6A 1O60A 3KRZA 3WLMA 4JCMA 3BW4A 4JNZA 2DDXA 4L9ZA 2PDHA 3NSMA 3D6NA 1XR2A 2P0IA 3M5YA 1D8WA 3C8FA 4LAOA 2GWNA 4LUTA 2X1TA 1I75A 1AL8A 2XTKA 1E6QM 3QQ1A 4W4QA 8XIMA 3LBMA 1W5QA 1TV2A 3ZO9A 4R7OA 3NZPA 3VIIA 2YA2A 1G67A 1K9FA 1NP0A 1XCXA 1GHSA 1FWCC 1QVBA 2NVCA 2ZRVA 4JQ1A 4IJRA 3HZ3A 1F3TA 1AJ2A 1UH3A 3OBKA 4XKMA 3W27A 1FWBC 3PC0A 3CT7A 4M24A 3VMOA 1QR7A 1OG6A 3M16A 1KBBA 4O4WA 5HPOA 4WD0A 4WJEA 4XD3A 4EOUA 1EYEA 1IWPA 1W1A1 3TYCA 1WDWA 1OFBA 4J3ZA 2LLEA 4ZGYA 1CGYA 2VQTA 5G2IA 4X61A 3OOQA 4YTSA 3WF2A 1BAGA 4GQ0A 1JCTA 4ADTA 2D3NA 4D1IA 1R2RA 3RLVA 3C5QA 3WJYA 5REQA 2P8CA 3QFWA 5J8LA 3GHTA 3U2CA 2WCAA 5EMJA 2WNWA 1ISXA 5DBTA 1OC7A 5H91A 1K3UA 5TQLA 4ZQOA 3K5XA 5T91A 1E6SM 3N2XA 4ZQRA 1ONXA 1UPPA 4BKNA 1NFBA 2WVUA 3AHVA 5FSDC 3E2VA 4N2YA 4DN1A 3WH9A 1FX6A 3IIZA 4AQLA 5D8ZA 1OD8A 2WHJA 3BWWA 3WQ8A 4TV6A 3KZPA 4IWWA 1XYFA 3GH7A 3G24A 1LG1A 4CD4A 5HR7A 2VO5A 3N2OA 3EWWA 1GTEA 2ON3A 1Y8BA 5CH9A 5IFTA 1O1ZA 3H2CA 3E0VA 1N8WA 2G96A 2EBNA 3OW1A 4CLMA 4Q4PA 3TMQA 4GUIA 2X1IA 1GTHA 5K4ZA 4DJFD 2WHMA 3WD2A 3EX1A 3ITYA 1K8YA 3WBAA 4PR4A 1ICSA 1KO0A 3AMLA 1RCXB 3PZGA 3RLHA 3E02A 3NWRA 4ORIA 3E1F1 4FP1A 4F66A 2CWNA 1YBQB 1GNXA 4UQAA 2EF9A 4IG2A 3TWAA 2WSYA 3HOJA 3RCYA 3RFAA 1EA9C 4F8XA 4ZQPA 1OYBA 2A7RA 4JYFA 4V27A 3LSBA 1DJYA 3QLLA 1XDMA 1EB3A 5E09A 2MANA 3H2NA 3GLCA 1YDNA 3WJSA 3UF9A 3KBVA 4BHYA 5LIYX 5CJMA 1KXHA 3MJYA 2ZC8A 4C6PA 4BEUA 5E0FA 2VZSA 3M6YA 5BRPA 1A49A 1TELA 2ZFAA 2HSAA 4B5NA 4XIAA 1G0CA 1C8QA 3QY6A 3TC6A 3DGBA 1E9YB 1FDZA 3KCJA 1TSIA 3UR7A 4HU3A 4FNPA 4K7YA 3KVKA 3QTPA 3L9CA 3W7PA 2QMKA 5F4SA 4JTLA 4MNJA 3UY8A 4GO9A 1B4KA 1FWFC 2PLCA 5AHLA 1PTAA 4UOQA 1LM1A 3PN8A 1LWHA 2JFEX 1DWFM 3CPGA 3L67A 3M0HA 4UQ9A 2CLOA 1EWDA 4GUGA 1WQ5A 3PZUA 3PZTA 3M64A 3BJFA 4JPGA 4CU8A 4EPKA 3TXVA 4YIWA 3ZJ8A 1FRBA 1XF0A 4WIWA 3AZRA 1FCUA 5L9FA 4JKKA 3WQ6A 1V77A 2DZWA 3W7MA 4PMYA 3G6MA 4PUJA 1W5NA 3IUHA 3RN6A 4YTTA 4QDWA 1DJZA 3PPGA 2HEJA 3NO1A 2WCGA 2RDTA 2D2OA 4R7JA 3SCNA 2EPLX 3KP1A 2ZUMA 4AD0A 1WV2A 2TODA 3AZTA 1OGGA 1JAEA 1WZLA 1DWGM 1OYAA 3VD3A 5JU6A 4Y8FA 1UD6A 2O9PA 3TTYA 1H5YA 2W63A 3VUPA 4A8LA 2A3AA 3CLMA 4DI8A 3NVTA 3LERA 1UWIA 4HZ8A 1FKWA 3RRXA 3C2VA 5F4XA 2YB4A 2A5HA 4P2VA 3SURA 2PEVA 1AQHA 2X41A 2XN2A 1XIJA 1DWHM 1UZ4A 2C0HA 5CZTA 3UWZA 1M65A 2J8TA 4KIEA 2REQA 2R24A 1VFOA 2GGEA 1RPXA 3PUDA 3KLLA 2PD5A 4GYFA 3OBAA 2XFWA 4MB5A 3WLQA 3V16A 4FX7A 3DXIA 4LNYA 1M7JA 4EAYA 4CNSA 4AB4A 4M81A 1NY1A 4MZ1A 3QW4B 2PDMA 1ZJIA 2V2HA 3KTXA 3F2DA 2G50A 1I2QA 4C5ZA 4U28A 3YPIA 3LPPA 3BAJA 1J5SA 4MGGA 1S2CA 4ZL1A 3NPXA 1ENUA 2DJLA 3H4WA 2IPGA 4PFMA 5M03A 4UFJA 5FF3A 1FWGC 2A7NA 1X6UA 2Z1SA 4LU0A 1LT8A 3HV9A 4HCLA 2BSLA 2VEIA 3SR7A 1XKYA 3GVGA 1AH0A 4B5WA 2PCQA 4AF0A 1LP6A 2A79A 3G3MA 2AKZA 5T9BG 3CYJA 5KMYA 3GQYA 2QCFA 5JQ9A 2WLYA 4MAVA 3WIJA 3HG5A 1XH2A 1IWBA 4W86A 5EMMA 2OR2A 3P3BA 2PZ0A 2TRSA 1OZMA 3W25A 3OLDA 4IXHA 4M51A 3CV7A 3H24A 3PWAA 4GPNA 1RR2A 4U3CA 2A21A 2QJJA 2OJPA 1YNYA 3F4CA 4W8AA 2ZWZA 4FXJA 1KCZA 1JIBA 2PD9A 3H7VA 2Z27A 3W00A 5GVJA 4KEZA 3G2GA 3GYEA 4F4RA 1W3LA 1L6GA 5BYWA 3WQEA 1UJPA 1KCKA 5FJIA 1QI4A 4A05A 4PZVA 3PBWA 4OBTA 4UC5A 3KDNA 1DEDA 3FGCA 3N6JA 3NXLA 1ZZMA 4Q8WA 1W1B1 4LCQA 3H4XA 1P4CA 3DENA 3M0XA 1XISA 1FHLA 4GIAA 2PGEA 1TV5A 5CC5A 3SJNA 1QI5A 3AXIA 3QR0A 3EOOA 1P7TA 2ZADA 3D3AA 2VYOA 2XVNA 1WX0A 4W84A 2ATMA 1D7KA 4C1KA 1J8VA 1LZOA 4H7CA 3AIWA 4OQVA 1PB0A 4OOZA 3W22A 1T8XA 3UVIA 4ERGA 3MI2A 2GJNA 5K4XA 3SAZA 3ONCA 2HXTA 1KFJA 1JPMA 2ABAA 4H8HA 1DKWA 5U4NA 1G5AA 1IEWA 2GK1A 4LS0A 5AZ1A 3W1QA 1IXOA 2QUVA 2R1NA 5A8GA 2E40A 1GPWA 2HK1A 3C2YA 4IXXA 5D9PA 3LZ3A 2PU1A 2QJGA 1LBMA 4IGMA 1PIFA 1SU5A 4NJGA 1TE6A 2OT0A 1PHQA 3N13A 3MPGA 5E9XA 3HTWA 4JHZA 1MNSA 4WSJA 2H90A 4HOWA 2YLLA 1JZ3A 5IBXA 4EANA 2YL9A 2WZTA 2FVMA 1RBLA 1FWIC 2WMJA 3NEHA 2CCRA 3AI0A 5E0CA 4QITA 1T0OA 2VGGA 3G6LA 4L1XA 2RJHA 1K8ZA 3G1HA 3L68A 3VA8A 3GUGA 4QEHA 2BHYA 1S5NA 4PTXA 1UG6A 4DZIA 1MXSA 1XIIA 1M6JA 2X1UA 1EO5A 4GQGA 4PUEA 4ZSTA 1HQTA 4JDYA 2CHOA 1CPUA 1XXXA 3L65A 2E3ZA 3RNDA 3KTSA 3CPRA 4R88A 4F2BA 3O07A 1MW1A 1TREA 1BKHA 1EUNA 4XG1A 4J3XA 4NAEA 3FXGA 4YCPA 1C9DA 2Y7EA 1U33A 4QFUA 3EAUA 1U22A 2ZWYA 1DJXA 4R27A 5FD0A 3W83A 4CU7A 3TNBA 4XZNX 3N25A 3BAYA 3ORWA 1VJZA 1GZJA 4Y96A 1LQ0A 3LRKA 3MKKA 1TRDA 4NUWA 3S5SA 3WFLA 1J0HA 2O4QA 4P7OA 2Q8LA 4NZ3A 1QO2A 4KWSA 1PVNA 3UP8A 1H41A 3WL1A 2GZXA 3BO9A 1LG2A 1L9WA 3B4YA 4OV4A 4TX8A 1FQ0A 1TYGA 2VC7A 4LAMA 3QGVA 2OEJA 4PMNA 2WSRA 2C19A 3EPMA 1PIIA 4H83A 1RA5A 4PMDA 3GH5A 3CAKA 1H7WA 1MUWA 1OX4B 3PZQA 2YBUA 3F4DA 4LS1A 4JFUA 1GOOA 3AMCA 3AFBA 1J2BA 1UJQA 1J9YA 1XYAA 1HKMA 4MB3A 1CLXA 3LGEA 1KCLA 3T0BA 2PBGA 3NM3A 2OO6A 4O57A 4MTVA 1VR6A 1DJQA 1ZPTA 4GXMA 4QROA 1RCQA 2JALA 4IMAA 1I45A 3E5BA 3A4JA 4UZSA 3NPUA 3QFEA 3CEPA 4CCDA 4IUOA 2Z2UA 4Y8EA 2FZ9A 4PUDA 4GWEA 3KEHA 3K13A 2W61A 1I4NA 4L4LA 1W2PA 5LYRA 1K7XA 1NDYA 5F2GA 4YTUA 4XISA 3SQSA 4HCDA 1QAPA 2YBTA 1JRCA 1OGSA 1UZDA 1VPXA 3S47A 3VPLA 4QM1A 1OINA 4GNJA 3TTSA 1BD0A 1TX0A 5HUPA 4CNOA 3BOLA 3UXIA 2XIQA 4PL1A 4AZHA 2ZC1A 5KSWA 1Q6GA 2J7HA 1KTBA 3SW6A 3WNNA 4JX5A 3WDJA 4XD5A 4EPBC 3O0FA 1R6WA 1QJWA 3W02A 3GS6A 4ERAA 5XIAA 1KM6A 2FB3A 4JTFA 1ALDA 4I3GA 1SZFA 4H6QA 2NLIA 4A8IA 2PRMA 2EPHA 1IIGA 1MVYA 4ZOAA 4HSOA 2DZTA 4DJFA 4IH3A 4MYAA 3BOFA 4DBSA 4S38A 3DI1A 1OWQA 5KTLA 4UTIA 2H3DA 4R9OA 2VRJA 3SFWA 5A6MA 1HVQA 1KM5A 4JTEA 1JUEA 3K4DA 2GOUA 4EACA 3WDQA 3QV8A 4YS1A 1TV8A 2Z1WA 5I3JA 4YWSA 4BS0A 4FLSA 1RAKA 3RX4A 2AQVA 3P8JA 2PLKA 1CTNA 5A2CA 1TPWA 3R25A 1A50A 1FA2A 2D2JA 1EJXC 1UWRA 2CBIA 5HMFA 1A3WA 3TCSA 3RK8A 2NX9A 1L0PA 4F0RA 1TQXA 4UTFA 3MA8A 5C8BB 1NU5A 2PF0A 3W1RA 3W7DA 4QXIA 1VCFA 3W7KA 1SR0A 5CGQA 5D05A 4GCAA 1M7OA 1K77A 2J25A 3EA2A 5I06A 3R1ZA 4R7WA 3DDMA 4JKLA 4NHVA 4H1ZA 2FGLA 2VC5A 3M41A 5EFDA 3CQ0A 2GSEA 3IGHX 1TPFA 3VD7A 1M53A 4AD5A 2GJXA 4GI8A 3EEGA 4HNUA 1A5KC 5EMLA 2DT0A 4S2BA 1CEOA 4ILSA 3A6OA 2QCEA 1XUUA 3TX9A 4WEVX 3BLFA 3P82A 4O53A 1XIMA 1HKWA 3W88A 3AJXA 4UQEA 1XBYA 1OF6A 1ISYA 2UY2A 3N6HA 2WVVA 1V3MA 1Y5VA 3B06A 3WF0A 2ZZ6A 5CC3A 4EE9A 1AG1O 1K4GA 1RVKA 3TYBA 1JI1A 3BVJA 4O1DA 2I7GA 2TMDA 3RAOA 1QPNA 3NM1A 1CLKA 4LYKA 5BRQA 4A3HA 4AEEA 3MCMA 1XLLA 3CM4A 1XSIA 4PULA 1B31A 3BK0A 1KBKA 3CMFA 2YZ5A 4NYUA 3HJZA 1E6RA 1UHVA 4EVZA 3EWYA 3AS1A 3PTDA 3ZT6A 1FWHC 3HO8A 4FOKA 1BQCA 1NOUA 5BROA 1K7EA 3GR4A 4QX4A 1XYCA 4BQ2A 3N17A 1GCYA 5XINA 5C7VA 1VBRA 3W07A 4TU1A 4G2DA 3A9BA 3BCDA 4ICMA 7A3HA 1G94A 1QNQA 2EG7A 4TTGA 3B0PA 4G7EB 4X2PA 1JCLA 1RLDA 3E6EA 3CZ8A 5C2CA 1CGTA 3GW0A 2ZZ1A 1VD6A 1VP5A 3PANA 3BARA 3LV6A 4HZMA 3BLLA 1F4AA 1P0KA 5CZKA 2YW4A 4X3ZA 3JS3A 2BDQA 1KM1A 3DX5A 4O0ZA 5ABEA 4FZIA 1VYSX 1P6CA 1Q65A 4CCCA 4HA3A 2Z1XA 3OIHA 1ZFJA 2DGAA 3DERA 3U5YA 1YW1A 1IE7C 2E1DA 1DV7A 2Y24A 4G56A 2Z0IA 1TPUA 3CHVA 4AHQA 4J3VA 4DZAA 4DZ5A 4IIBA 1MXDA 3H53A 4ML4A 4I8YA 4A2SA 4E4FA 1M9HA 3K2GA 1E5NA 5F1UA 2NX3A 3N11A 1M01A 4B92A 3L23A 4XAFA 1DJIA 5EPDA 1VJIA 4XD4A 2WKJA 2I9UA 3CUGA 4GHRA 3IIVA 3TXZA 1WOAA 3PP7A 5HANA 5DXYA 1XYZA 1TIWA 2WV8A 1JZ6A 2YLAA 4IIDA 1GVOA 3EPOA 1PO9A 2D2HA 5AFDA