4GJ1A

Crystal structure of 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (hisa).
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
242
structure length
229
Chain Sequence
TQIIPALDLIDGEVVRLVKGDYEQKKVYKYNPLKKFKEYEKAGAKELHLVDLTGAKDPSKRQFALIEKLAKEVSVNLQVGGGIRSKEEVKALLDCGVKRVVIGSMAIKDATLCLEILKEFGSEAIVLALDTILKEDYVVADKKLMEVLDFYSNKGLKHILCTDISKGVNVRLYKLIHEIFPNICIQASGGVASLKDLENLKGICSGVIVGKALLDGVFSVEEGIRCLAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneam
publication title Crystal structure of 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (hisA).
rcsb
source organism Campylobacter jejuni subsp. jejuni
total genus 72
structure length 229
sequence length 242
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2012-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4gj1A00
2CZ5A 3FOKA 3TC7A 4MYXA 3IIZA 4JY9A 3G0UA 1UUOA 5F2MA 3G1HA 5D32A 1J5TA 5CPOA 1UBSA 1XKYA 4NX0A 3PWAA 3WK2A 2HTMA 4NVTA 3W85A 1LBLA 1SFLA 1YXDA 1U5JA 4LVAA 4NXSA 2QDGA 4KFNA 4JTTA 2QJHA 4AHOA 1OFRA 1ZCOA 1TIMA 3P81A 3WJSA 5L6UA 3O6CA 4NJKA 3BLEA 4OT7A 3BV4A 1TO3A 3CT7A 3L5MA 4PEKA 2X1UA 3GKFA 2Z6IA 3KRSA 4N9EA 2ZA1A 2NXHA 1OYBA 4IJBA 4A2RA 4O10A 3S0CA 1E51A 3LHYA 2V5BA 3QRHA 3BGGA 3G18A 3OEXA 1WDWA 3BW4A 1H7PA 2FPVA 4WOQA 4KWWA 2ZA3A 1XBYA 1ZENA 1AK5A 3W2JA 1KFCA 2Y7DA 1YPIA 1UUMA 1JR1A 2VKZG 5FEPA 1W8SA 2C13A 1F2JA 5AN7A 4JTFA 3PUDA 4FNUA 4AVFA 2Y6ZA 1SU5A 4MY9A 1ZAIA 4IX0A 4YLWA 1O60A 3LTYA 3W1PA 5AHFA 2CZDA 5C55A 3NM1A 2FQIA 1OFPA 3M5VA 3G3MA 4O11A 1OX5A 3W9ZA 3LTPA 1YTKA 1M5WA 1FWNA 3W73A 1LRTA 1TPFA 5HUPA 4O4VA 5LKYA 1YTEA 3IGXA 2ZA2A 3NQEA 5HUOA 2FB3A 3HBLA 5CSRA 5KITA 4O28A 4DXVA 1B9BA 4R53A 4CNNA 1O95A 1TRIA 3FS2A 3IRDA 3ZWTA 2GVGA 4Z08A 5LNWA 3W76A 3NL2A 3VFLA 2RFGA 3EX2A 2QR6A 3PM6A 1RR2A 3BG5A 1KBJA 4BWLC 3UNDA 2X1TA 4JYEA 4UTLA 4QNEA 4HSOA 3SW6A 4AAJA 3KOFA 1VZWA 5HWNA 4DBDA 3GXPA 4PL1A 3TSBA 1DBTA 3G1DA 5D04C 1TV7A 1SO5A 2FDSA 2GOUA 3DH7A 2CLKA 4HKPA 5CPLA 3LOTA 3TC6A 5J5RA 5G5IA 4HT3A 2J24A 3H54A 3N14A 4LOCA 4YWIA 1MEWA 3ABOA 1FQ0A 3OBKA 4HPJA 4TU1A 3G1AA 3P82A 4WZHA 4IPIA 1YTDA 3EXTA 2J9XA 8TIMA 1NSJA 5F4WA 2QUVA 3NNTA 4YMZA 5TBOA 1NEYA 2WKJA 5GVJA 1ZHAA 3EX1A 3N34A 3L0KA 3LCXA 1WA3A 3GLCA 3DHDA 2VEIA 1DOSA 3CPRA 3R12A 2R94A 2NUWA 2NWSA 4EWND 2D73A 2NV2A 4WY0F 1LCOA 3LHWA 1TPVA 2ZZ6A 1L6WA 3EKZA 5BMXA 4M7SA 3TJXA 2G96A 1BKSA 2BXVA 1I2PA 2J9YA 1SW7A 1QPOA 3TNOA 1SZGA 3W6YA 2Y89A 3QYQA 3N19B 2DZSA 5IBXA 3IIVA 3KRUA 5AYXA 2Y7EA 3PULA 4AF0A 5LHEA 2A5HA 4UTWC 3TFCA 4Z1DA 7TIMA 5DELA 5F1VA 5D37A 1OK4A 4Q4KA 3CQ0A 1G6CA 2QDHA 2W79A 3E0IA 2C19A 2YSWA 3FKRA 1EUNA 4UTTA 2ATSA 4ADUA 1L2UA 2BSLA 3U2OA 4PTNA 4JN6A 1G4EA 1Q6LA 3DI0A 4XZ9A 3SJ3A 4LTSA 1MEIA 4HNVA 2ZZ5A 3ZWSA 4HNNA 1G4TA 3HIJA 1QR7A 3E02A 4U4MA 1VYRA 2QF7A 3LBCA 3TUUA 4DELA 3OG3A 3B8DA 5KTLA 3NL6A 4E38A 1P0KA 1TPEA 4A22A 4BFAA 3DGRA 5DN1A 1VCGA 3MYOA 5HQEA 4DO4A 1K7XA 4RV8A 2WJZA 1Z44A 5MHBA 3NQAA 3ABQA 4HNUA 1L6YA 5FF7A 2CLOA 3WJWA 1SZFA 2QCMA 3L0NA 3CWOX 1WV2A 1K7EA 5DXXA 4IMFA 3LXBA 2VFEA 1O94A 3QQ1A 2VFDA 2DZTA 4UFMA 1OHLA 3KX6A 2RH9A 1YYAA 3GNNA 1AG1O 5U7SA 4UUIA 2WO5A 5F1UA 1VGAA 4LS2A 3S6DA 4O50A 3QM3A 3G8EA 4LV9A 4O18A 3CB8A 4LC8A 4XKYB 1H50A 3FFSA 4E2DA 1A5AA 1RQBA 3O07A 1R30A 3UD6A 3EB2A 2ZDRA 1WBJA 3HG3A 2YCEA 5DCBA 4Y8FA 1TCDA 3LGEA 4L4MA 3UY7A 3JS3A 4QNWA 3W7KA 3QH2A 3ZR4A 2YPIA 1TMHA 3R5EA 1A5BA 4X3ZA 1MO0A 3C0JA 3T44A 3ELFA 6TIMA 4FF7A 4WXZA 3LCGA 1G67A 3EX6A 3W70A 5I3GA 3BG3A 2PE4A 3N73A 4O53A 4UIOA 1PL9A 5EYWA 2ZRZA 3VCRA 4LNYA 4IMDA 2OT1A 2C18A 3LCHA 3NPUA 3EWZA 1K03A 4S2CA 5FI8A 2FPTA 4LV4A 4NNAA 3I6RA 4RZ6A 3W1MA 5EMUA 1T8XA 1QDSA 1ONRA 3MI2A 4ML9A 1BEUA 3MUXA 3RLVA 4RXFA 2I1OA 4K37A 2CZEA 1ICPA 2OZ0A 2DZUA 2QCHA 1VR6A 4UXDA 5G4EA 1FX6A 1EP3A 2ZCGA 2C14A 2AQWA 1XXXA 5EPDA 1QCWA 3W23A 4NU7A 3W1NA 1TPH1 5D2XA 2LLEA 2HS6A 1DKWA 1FY6A 2B7OA 3TQ0A 1TTQA 1JCXA 3SR7A 3VI2A 2Z2UA 2ZRXA 3LXCA 3WJZA 1YDVA 2OJPA 4MY8A 2V2DA 2A1YA 4O14A 3G1VA 2A7PA 1G7UA 2WNQA 1DHPA 5CKSA 4H6KA 3S8HA 4ADSA 3QJAA 4I7WA 1VHNA 4FIRA 3NDOA 2ZYFA 4UNLA 1P4CA 2CLFA 1QAPA 1FXPA 1P0NA 2PRLA 1OYAA 4R34A 4O1DA 4LW7A 3B0VC 3G0SA 3IIPA 2WOQA 1KM3A 2PCQA 4ZQCA 4FNTA 1KM6A 1WOBA 1SR9A 3IV3A 1OFEA 4DBEA 3QFEA 4JD4A 2VFHA 5BRBA 3S9YA 4WX2A 5BMWA 2C6QA 3MHGA 1JJKA 1YADA 4YCOA 1SZNA 4FHAA 3NPXA 1DVJA 3CTLA 5IBXC 4K7YA 3N2XA 3Q2DA 2ZZ7A 3INPA 3W2UA 3NO5A 4B5NA 2WPBA 4OV9A 3LHZA 1AW2A 2Q3OA 2EF9A 2V82A 2I9EA 4ORMA 1LOQA 4JDBA 5DXYA 3NPWA 4QISA 3B04A 3S1VA 4N6FA 2RDTA 4GJ1A 2ZZ4A 4RK8A 1O5XA 1XBXA 1H7WA 1V7YA 1F76A 2RDUA 1H1ZA 5LNRA 4WD0A 1T0OA 4GUJA 4A3UA 4FX6M 1LOLA 3I7QA 4OU1A 2QCNA 4MFDA 3STFA 1FCVA 2WSRA 3PVFA 1JRCA 4JEQA 4K8EA 4WUIA 1DV7A 3RMJA 4LVGA 3GR8A 4MJZA 4FO4A 4ALDA 4BR1A 3GZ3A 1HL2A 5LNSA 4JTIA 1M7OA 1I4NA 3GK0A 2E09A 3NAVA 5KMYA 3LCLA 4PCFA 1GTEA 3G1SA 1I2NA 3PUEA 4WJEA 2YFOA 3GX9A 1XUUA 4POCA 3ANYA 3ZS4A 3NYZA 1CI1A 1DJQA 4IUOA 2JBMA 4UFLA 1JCMP 1IIGA 4KKXA 3LCFA 3LERA 2J9ZA 2Z6JA 3W84A 1K8ZA 3E49A 4O0KA 3M44A 2X1SA 3SIZA 2DJXA 1QNVA 4M5PA 1OX4B 3DI1A 1KW1A 3GIYA 3KRZA 3IIXA 1X7FA 3Q58A 5DLCA 4YXGA 2CFFA 4W9TA 3MI6A 1C8VA 3CEPA 4UCGA 4CNPA 1QO5A 4GUFA 1BWKA 3DKLA 2GUUA 5D05A 4Z1CA 1D3HA 3W88A 3BLIA 5D2YA 4IXHA 4FIQA 3P8JA 4FNQA 3NZRA 2NZLA 3A5VA 3LXAA 3EKLA 3UXAA 5L9FA 1F7BA 3M9YA 3QEZA 3W83A 3TH6A 1JUKA 1O5KA 1PHQA 4UTIA 5D33A 2ZQ0A 3TIMA 1VRDA 3W7GA 4N9CA 3NL3A 2G5WA 5LGXA 1IXNA 3T40A 3RF9A 5BW6A 4LVBA 4OGZA 3R8RA 3LHUA 2QCGA 1ME9A 4LWWA 5DBUA 2PC4A 2V2HA 4IWWA 4GUGA 2X30A 4ZL1A 1F05A 2NUXA 4JYDA 3W1TA 3IVUA 3QW4B 4I9AA 4XTIA 4KFPA 5TQLA 3R13A 2ISVA 3ABRA 3QZEA 3T7VA 2NV1A 3LRLA 4EF8A 2YR1A 4XWUA 1O4UA 2WV8A 2H3BA 2JK2A 3MP5A 1T99A 3CC1A 1ZFJA 5CSSA 1M6JA 2J6XA 2RHGA 4NZJA 1J4EA 3RFAA 2H90A 2V5LA 3O63A 3O1NA 4Y90A 4RLIA 2YX0A 3LHVA 2YW3A 1EPXA 5I3KA 2GJNA 3NXFA 4CLMA 2CLEA 2GVJA 3C56A 3V75A 3EX3A 3G22A 4GUIA 1KM4A 3W7RA 5LGZA 1YDNA 4HNTA 3DFQA 3C4UA 1V5XA 3HGJA 4JTUA 4JS3A 1Z48A 2NUYA 4JTHA 5DCDA 1KM2A 1RVGA 1SSGA 1T96A 3WJXA 3CIXA 2QJIA 5DY3A 1GVFA 2PRMA 4CCDA 3TROA 4NZFA 4FXRA 3F03K 4GRSA 2Y61A 4OV4A 1H7OA 1ICQA 3UXDA 1GOXA 1TREA 4Y9AA 3Q94A 4ZQMA 3NR0A 1S5WA 3SY5A 5CZ0A 3LB0A 2QCDB 3GDRA 1J2WA 1HTIA 5E0KA 3PB0A 3FA5A 5G4WA 4WOZA 3A23A 4K39A 4NJJA 5D2VA 3KHJA 2E6YA 2F84A 3M5ZA 4RR4A 1H62A 2B0MA 3L2IA 2NLIA 1W0MA 1OFDA 5AYZA 4O1BA 4WY0A 1L6SA 3TXVA 4N4QA 1KFBA 4QAIA 4IXXA 3R2GA 3ZFHA 2V30A 3BPWA 3U8GA 5FEZA 1M7PA 1X1ZA 3BVJA 2FPYA 1H7XA 1SFJA 2RKXA 3H53A 4LRSA 3W71A 3NGJA 4O12A 4AEOA 1JVNA 2EHHA 1IGSA 4N2YA 4HN4A 4D2JA 1WAUA 3HQ1A 4Z0SA 3G24A 4CCEA 4IPJA 1TPUA 4O19A 4PODA 4BK9A 2JKAA 1N8FA 3LLDA 3GDLA 5AB3A 2AGKA 3C2FA 2YDAA 3L68A 3FJLA 3W7NA 2NX9A 2B7PA 3TA6A 4K6AA 1WYIA 1OFQA 2XN2A 4GNJA 1TPB1 4YL2A 1DQXA 1EUAA 3NEVA 1XC4A 1EB3A 2C16A 4S2BA 3FEMA 1PHWA 3FLUA 2CZFA 3DXIA 3TSMA 4TMCA 1PS9A 4PC8A 1FCUA 1DQWA 3UWUA 2O7QA 2DZVA 4OE7A 3TDFA 1EWDA 1C9DA 3W7HA 4AHPA 3S42A 3PSVA 3W1AA 3O15A 2XN1A 4UTMA 2A7RA 4DPQA 4BI5A 1H7NA 1SO3A 3DKJA 1EWEA 3SGUA 1R2RA 3M6YA 2TMDA 1B4KA 5AHIA 1H51A 3CWNA 5FEWA 5AHEA 4AB4A 5EL1A 3KXQA 3NQ8A 3HGOA 4U28A 5HULA 1BTMA 2NXGA 2R14A 1LBFA 5FF0A 4ZZ9A 2FJKA 5ABTA 4O17A 3QMTA 4NXKA 4NQ1A 5HWMA 1KFJA 2E6AA 1KA9F 2OCZA 3EWWA 1IF2A 1FXQA 4BF9A 2HSAA 4I7VA 3EWBX 4UNKA 2QCLA 1YXYA 3PAJA 3TW7A 3L21A 4RKAA 3PBYA 1VLWA 1W5NA 1GQNA 3LI0A 1F73A 2R91A 5FEXA 1FDYA 1XFBA 5AOUA 2JGYA 3NZ1A 3NQGA 5SWUA 2E77A 1AL8A 1VHCA 1K02A 3HG4A 1KBIA 2ZZ1A 3SZ8A 4DF2A 3UZ5A 1KLYA 4UMBA 3LRMA 3P74A 3S1XA 5F2GA 1NVMA 3W7JA 1B4EA 1HO1A 4JYFA 2DZXA 1WOAA 5F4XA 2I14A 1ALDA 1DL3A 1MXSA 3UWVA 1ZJIA 4ZQNA 3W7PA 4JXCA 1JUEA 4K38A 3W22A 4IX2A 1OABA 4OWGA 3W2KA 4MIMA 1K8YA 2A2IA 5DY2A 1AW1A 3RU6A 1X8FA 4DEFA 4H3DA 5K2ZA 4MZYA 3F4NA 3O05A 1ZAHA 2VXNA 1W56A 3CM4A 1QPQA 3UYCA 1TSIA 4A2SA 1KM0A 2E5CA 3C8FA 4RZ4A 3G1XA 3P60A 1GVSA 4UMCA 2CU0A 4HPXA 4O1AA 3FYPA 4P2VA 1KFLA 4LC6A 3TJLA 1VYSX 3WK0A 1TTJA 4Y96A 2WQPA 4JIPA 4IMGA 1I8JA 1A5SA 1VS1A 3SSJA 3UWWA 5LNUA 2VEPA 2NX3A 3HPXA 3L67A 4M7TA 5FF2A 3W1LA 3P7YA 2TRSA 4ZQOA 2Z0IA 2GQAA 3NQ7A 4M6QA 5AC6A 2V0TA 1GZGA 4Q33A 3LRKA 4RX0A 1LYXA 1TPC1 5K3VA 3PBVA 3NM3A 4O4WA 1YLVA 4PFMA 1ZNNA 3FIGA 1EP2A 5AYYA 3NQ2A 4MPQA 2GQ8A 1PV8A 1F5ZA 2ZRWA 2NWRA 5AHMA 3UY8A 3KAOA 4ZQPA 3IGSA 2ATMA 3OVRA 4DPPA 1Q3NA 5U4NA 3M47A 5AHNA 1A53A 4DO5A 5BOOA 1ICSA 3MW7A 4CNOA 1SW3A 3DENA 1SZEA 1TV8A 3A21A 4FNPA 1VQTA 2BLEA 5AHLA 4UC5A 4Z1BA 1KFEA 3PBWA 1W5OA 3IGUA 3A5FA 4WXYA 4PH6A 4UFIA 4CQAA 3L9CA 5K7JA 5HR6A 1TJPA 6ALDA 2VEKA 4AWSA 3E12A 1OG0A 5C5YA 3MI3A 3E96A 2HS8A 1OVDA 1Z41A 3CEUA 2QJGA 3MJYA 2PURA 3V1PA 5C2XA 3B06A 3TE9A 4AWUA 4AWTA 1IIHA 2QKFA 1W5QA 3GYEA 3LM7A 5F4SA 2VOMA 3C2VA 4BI6A 3M5YA 2HMCA 1JUBA 3PUOA 3W2NA 3F4WA 4NJHA 3S1WA 3W7OA 4P61A 1GYNA 4PA8A 1WBHA 2VFGA 5K4ZA 1PVNA 1ZY9A 2Y88A 5EKYA 4O0ZA 1QOPA 4CCCA 4IQLA 3F1QA 4M19A 4UFKA 2DZPA 1ME8A 4MUZA 4Q32A 3BK0A 3EXRA 1I2OA 1BWLA 4M6PA 3JR2A 1KTCA 3R89A 1QO2A 4TR9A 5E93A 2ALDA 3TAOA 5DCEA 3D0CA 3DAQA 3I65A 3W1QA 4BWLA 1GG0A 3YPIA 3ATZA 3I7SA 2C1HA 4QSHA 1VJIA 4J9JA 1VC4A 3N2MA 3S5NA 3HPSA 3OIXA 1ML1A 2NX1A 1VLIA 1KV8A 5G2HA 1G7VA 5CZJA 3W7DA 1JULA 2QEZA 1W3TA 3KVLA 4JTKA 4IOTA 3M1ZA 4UTTC 4HSNA 5CZTA 1GVOA 2E1DA 3C61A 2ZBTA 1QPRA 3SFKA 3B03A 5FF3A 3NQ6A 1RD5A 3W1UA 3EX4A 2VENA 3C2OA 1JRBA 4RXGA 3QC3A 1K7FA 3LV5A 3M0ZA 5D38A 4MLRA 2CLIA 1W5MA 2Y70A 4IMEA 1KM1A 4QQ3A 1HO4A 2YXGA 1VPXA 3ABSA 3NQDA 4TIMA 1GG1A 4O57A 4MKNA 3PS7A 3TK7A 2Z1BA 1OFAA 2VC6A 2P0OA 1YXCA 3MWAA 5LSMA 2WNNA 3GDKA 1XCFA 2BX7A 3OHIA 4FNSA 5C6MA 1TQJA 5G1TA 3NA8A 5A8GA 4EOUA 4R7JA 1KTNA 3HG2A 2TYSA 2OT0A 4LS0A 1F74A 3DU0A 3WK3A 3QPZA 3AO0A 1W31A 1GVQA 2GJLA 3B0PA 4XKYA 3GKAA 2WSQA 2ZTJA 1AMKA 4AHQA 5E1QA 3A22A 1HFBA 1W1ZA 1DORA 2XFWA 1FCQA 2ZRVA 4O54A 4NUWA 4JTLA 5D30A 2WSYA 1TPWA 2JKPA 1JCNA 4UTWA 1U83A 4QITA 3S5ZA 4WQ6A 1XUZA 2YW4A 1ADOA 3M43A 1W54A 1F6KA 1EP1A 1XBVA 2A6LA 2DP3A 4FEZA 3BGJA 1G4PA 1VCVA 3MBDA 3W2MA 3KVKA 4UTHA 4MZ1A 2R8WA 1GEQA 2UV8G 5KZEA 4LVFA 3PC0A 4O15A 1GPWA 1UCWA 4OBTA 2B7QA 3DHFA 4E2BA 4AF0B 1LZOA 4Z1AA 3MYPA 4OHQA 5G2IA 3RLUA 5T26A 3KVMA 4EF9A 4XBKA 1WX0A 3WJYA 2YFNA 4LT9A 3BLFA 2QAFA 3T78A 2VFFA 1ZAJA 4EIVA 4L4LA 5K9DA 5HWJA 1R2SA 2G95A 3FJ6A 3TR2A 4UTUA 3PB2A 4GXMA 3MO7A 2A6NA 3GR7A 4RCXA 2FB2A 5G2WA 4NNBA 1KLZA 3O6DA 3THAA 3T55A 4ADTA 1LBMA 5I3HA 1ME7A 3UWYA 1EX5A 2ZFAA 3HG5A 4NJGA 3G1FA 2A7NA 1WXJA 3OA3A 5EA9A 5CPMA 1KM5A 1JQVA 5G1YA 2VEMA 1RQHA 1NF0A 1GYLA 3C52A 4JNMA 3FKKA 4IGHA 1JCJA 1I2QA 5HMSA 2YYUA 1GTHA 2WNZA 3PG8A 3O6YX 4MVAA 1TYGA 1Y0EA 3M41A 3K30A 3CLMA 3L5LA 2IQTA 3P5ZA 3JRKA 4GFSA 2C3ZA 1UJPA 4ONVA 3G3DA 5D2WA 3HPZA 1I2RA 3LHTA 5BNKA 5F2LA 4GBUA 3W1XA 3QMRA 4MY1A 3CIWA 3H55A 5F2IA 3IIOA 5KZDA 3PY2A 3HO8A 3TAKA 3USBA 5KINA 2QAPA 4YCPA 2E5DA 4DF0A 4JTGA 2Y7GA 4O8RA 3AJXA 2B7NA 3W7IA 1Q45A 2VFIA 3GDMA 3THQA 1FBAA 1L9WA 2NXIA 1DJNA 1MZHA 1G4SA 2ISSA 5FESA 3P67A 4FX7A 1SSDA 4X9SA 1Z42A 1LORA 1MSSA 3UZJA 2BTMA 3MP3A 3P62A 3TMLA 2OMAA 4O16A 2DZWA 4XBSA 1K3UA 1B3OA 4FNRA 4MLJA 3W7MA 3WK1A 2EAWA 1NFBA 3MBFA 3PSWA 3LBMA 4E0CA 3UWZA 3MP4A 3O16A 5K9CA 3NOEA 1P5BA 3W86A 2H8XA 2H8ZA 5J5DA 2Q8LA 1XDLA 5LZLA 3NVTA 1W5PA 3MMTA 3HJZA 1EA0A 3A9IA 1QOQA 3BARA 2VELA 4MZ8A 3LTSA 4ZVJA 2FLIA 1JQXA 3DFSA 4DF1A 1H60A 4FX8A 2TPSA 1S5TA 5AC8A 3PR2A 1QMLA 1LOSA 1OX6A 2O7SA 3P84A 1QPNA 3S5YA 3W75A 3N3MA 4O13A 1R46A 3IVSA 3S5OA 3TMQA 1SO4A 3GNDA 1FUYA 3P61A 2F7FA 3G8RA 1X6UA 4N9DA 4ORIA 3VE7A 4UTJA 4AMAA 4GE8A 1W37A 1KFKA 4H4IA 4EVZA 5HR7A 2JKEA 3CHVA 1XDMA 3SECA 3B0UX 2XN0A 4XTDA 1AL7A 4A21A 1OJXA 2PRHA 2RDWA 1OX4A 3B05A 3LDVA 3NQFA 1G69A 1S3HA 2GQ9A 2P10A 5TIMA 3W7QA 5LHFA 3B4UA 2E6FA 3VKJA 1OF8A 1S5VA 1KTBA 3PBUA 4N6EA 5D2TA 3QMSA 3BG9A 5CG7A 4N9BA 2C15A 3OVQA 3EWYA 1UASA 2EKCA 4K8HA 1GVRA 5KSWA 3NG3A 3I68A 4M6VA 5C54A 5H2ZA 1C29A 2FTPA 2AAMA 5D02A 4UR7A 3LCWA 1VCFA 3S1UA 1Q6RA 3W7EA 1VH7A 3HOJA 2BWGA 3EWUA 1LM1A 3Q37A 4MJMA 1D9EA 1AW5A 1PIIA 2ABAA 3M5XA 2DU2A 3P80A 2BZNA 3QW3A 4Y6GA 1OK6A 4K7VA 1THFD 5K9XA 1XBZA 4O1CA 3W1RA 3UQNA 5IM51 3DFNA 5D03A 4RJEA 1SW0A 2CWNA 3DFPA 2GVLA 4ZQRA 1TTIA 2ZRUA 2A85A 2E5BA 3W74A 1QFEA 2V81A 3TW6A 1EEPA 4LVDA 3NQCA 2A0NA 1H7RA 2H3DA 4LRTA 3TQVA 3DBPA 3QPYA 1LROA 5HINA 3W7LA 3UWQA 1K8XA 1TJRA 2ISWA 4IMCA 5EBUA 3M7WA 3QSTA 1B57A 1NAL1 2Y62A 4AXKA 3GVGA 5DBTA 3U6WA 1IXQA 3FYOA 4UMAA 1GWJA 1WQ5A 4JIQA 5AFDA 1TV5A 3W7CA 2ABBA 1FWSA 2A21A 5K4XA 1LRQA 1XL9A 3PG9A 4LU0A 3W07A 1H61A 4JTEA 1SQ7A 3VE9A 2E6DA 2QCDA 1GT8A 3NPVA 2X1RA 4ICNA 3NL5A 1R47A 2P1FA 3STGA 4C1LA 4JDYA 4AH7A 2YYTA 1W3IA 3EWXA 1LDCA 5A5WA 4X22A 3W2LA 4PL2A 1TQXA 3QSRA 1P1XA 4JY8A 2Y85A 3GDTA 1MEHA 1FCBA 2ZZ2A 2J88A 3KVJA 4N02A 3HMJG 3CU2A 2Q8ZA 4DQWA 3T4CA 1KV5A 1ZALA 1PCWA 4TO8A 3TX9A 3STEA 4NNCA 4QJ1A 3W87A 3O8AA 4HIBA 4N4PA 1TRDA 3NQVA 2KZHA 2FIQA 2TSYA 3GXNA 4LS1A 1H5YA 1FWTA 4JX6A 1FDJA 1JCYA 1CX9A 2QCEA 4KWVA 1A5CA 4TX9A 3L5AA 1SUXA 4X2RA 4JTSA 3TFXA 3L65A 2QCFA 4RZ5A 5CZSA 2CLMA 4CQ8A 3SI9A 5CGQA 4JX5A 1OFOA 5EY5A 3MHFA 4DO6A 2JGQA 3I7RA 1XI3A 2GPTA 3TXZA 2OX1A 1FDZA 1LP6A 2E68A 4LY8A 2DORA 2Y7FA 1IXPA 4G1KA 5I3IA 3TCEA 2YZRA 3TSDA 4UFJA 4S1FA 1N55A 1W3NA 3RK8A 1OYCA 2J27A 3W3OA 2H6RA 1RPXA 3C2RA 4FXSA 1LLWA 2QCCA 4JTJA 4XUGA 1H63A 4UFHA 1FWWA 1SPQA 1OFBA 1H1YA 3TU9A 1JCLA 1QWGA 4O52A 1GJPA 5HNRA 3HGRA 3RNDA 5AC7A 1X1OA 2G97A 3N9SA 4K36A 3PF3A 5H91A 3TV8A 4TMBA 1LTDA 5LNVA 3E9AA 4GC4A 2A4AA 4NX5A 1SO6A 1TB3A 3GAKA 5I3JA 1FWRA 2B4GA 1HUVA 4JR5A 2EGZA 3C3NA 4Z0JA 3QQ0A 3DFTA 1PCKA 1R2TA 4QM1A 2V9DA 3N9RA 4LUJA 3BO9A 3P8IA 1NF7A 3EEGA 1Q6OA 4LUIA 4MYAA 4GUHA 3IEBA 4UTKA 2C0AA 3L66A 3G1YA 3C2EA 1F6PA 3KFTA 3M16A 1RZMA 2QUTA 3HB9A 3P5YA 4OQVA 1A50A 4WY0B 2ZTKA 3VNDA 2FFCA 4JGDA 3HGSA 2CLLA 3SGZA 4NT0A 3BW3A 4BI7A 3UPBA 3QF0A 3BW2A 4HHPA 1VYPX 4R33A 4I7UA 2CLHA 2X16A 1I45A 3MHUA 3A24A 1Q6QA 2V2CA 1YDOA 4JICA 3LLFA 3O06A 3W72A 3UPWA 1TPDA 4A29A 3LCIA 1UB3A 5KZMA 4MOZA 5I3FA 2ZZ3A 3TKFA 3OVPA 5FF4A 2QUUA 4ZMGA 3GAYA 2V8ZA 3DFOA 3LV6A 1HG3A 1IXOA 4XQ6A 3GB6A 1TTPA 3EXSA 1RV8A 3L0GA 2YGYA 2EPHA 5D09A 1XM3A 3HF3A 1EIXA 1YPFA 4GWEA 4MFEA 2CW6A 4CQ9A 4KFOA 4UR8A 1D3GA 4NJIA 1N7KA 3NQMA 5CPNA 4C1KA 3ATYA 3WFAA 1OF6A 2DJLA 3TQKA 3C6CA 2Y63A 3LI1A 5HJLA 3G0XA 3IVTA 3GXTA 1LRNA 1RQEA 2Q3RA 4QIUA 1CW2A 2W6RA 3LX9A 4JX4A 3STCA 2X2GA 3DZ1A 4FB7A 2W0UA 1LLZA 1PE1A 2ZRYA
chains in the Genus database with same CATH superfamily
1E9IA 3BXWA 4MYXA 1ZJHA 2X7VA 3OW1A 1AD1A 5E9XA 1OC5A 1QW9A 3G1HA 5M2FX 5D32A 1M41A 1JZ5A 2CNCA 3H2EA 1W1TA 1K6WA 1RCOB 1LBLA 3CPUA 1LWHA 2XIJA 2QDGA 3WIJA 1VAHA 4YPJA 3WBAA 4U10A 4AISA 4B2DA 3OTRA 4NJKA 3OGSA 4FLSA 1FHUA 3WUBA 3VIOA 3IJ7A 4PEKA 1RD6A 5IDZA 4GX9A 5FA5A 4IJBA 4MNLA 3VOCA 2GL5A 4A2RA 3DBNA 5JBFA 5HPCA 5D9MA 3QRHA 1XINA 4C6NA 3BGGA 1OT1A 4TV5A 3EDJA 4WKAA 4AQLA 3MT1A 1IT0A 4D6JA 4WOQA 1XC6A 4IMAA 4PMJA 1HP5A 1KXHA 2VHLA 1KFCA 4EX4A 2PI6A 2IKHA 4L6DA 3WQ4A 2C13A 4IIDA 3R11A 4JTFA 3RCMA 4AVFA 3T6CA 3AS0A 1V0MA 4GCAA 1W9DM 4QE4A 1UH4A 4YLWA 3LQGA 5AHFA 2WZIA 3BAWA 4O11A 3H2MA 4DUWA 1NY1A 5IHRA 1FWNA 1CXLA 4XD4A 3W73A 2WWDA 4C6KA 4DBWA 4IFRA 3UW6A 3C2YA 2ZA2A 2FB3A 3HBLA 1S1PA 3GXDA 2NW0A 4PMYA 2ESCA 2H9AB 4W93A 1B9BA 1O95A 4LALA 1XQLA 3MMDA 3NSNA 4Z08A 3W76A 1MYRA 3GC4A 2RFGA 2ZX5A 3AMLA 4JYEA 4QNEA 3IPWA 4P7OA 3SW6A 1QTWA 5A2CA 2X1IA 3MUZ1 1XICA 4QG9A 1E70M 4RE4A 2ZX9A 5GQBA 1ECQA 5DX7A 3WQPA 2CLKA 5CPLA 1LG2A 1J8VA 2VYOA 3AHXA 4DXXA 2J24A 3H54A 3HQNA 4LOCA 4IQEA 3LMYA 1EH9A 1J9YA 3ABOA 4GK8A 4AZHA 1HKWA 1CGYA 2G0WA 4HPJA 3CMJA 4GNKB 1YTDA 3DG3A 4Y9NA 8TIMA 1OY0A 2E25A 1NSJA 3TQPA 1NEYA 3TONA 3O0FA 4LBSA 2V63A 1PUDA 2WJDA 4O8AA 1WA3A 1Q6GA 3TYAA 4H2CA 1GKQA 3R12A 2NUWA 4CNUA 4AFYA 2D73A 4KGLA 2NV2A 1UR8A 4WY0F 5E09A 1LCOA 1TPVA 1EJXC 1L6WA 4IICA 4CKQA 1KWGA 1I2PA 1XP3A 3TNOA 2EPNA 1N82A 6REQA 2DZSA 1ITCA 3AXXA 1IEIA 3N2CA 1MRQA 5AYXA 2W5FA 4DWSA 2A5HA 4H6RA 5LA1A 2O55A 5DELA 5F1VA 1AQMA 3LD5A 5CJMA 3WNKA 1OK4A 2GDVA 4EPEC 3D5HA 4Y9PA 3D6NA 2O92A 2ATSA 1BGGA 4ADUA 1MXGA 1CXEA 5HJYA 2REQA 4JN6A 1UC5A 3HQPA 2PBOA 3S6OA 4B5SA 4HMCA 1QBAA 1RJPA 3H4XA 2ZZ5A 4Q7NA 1VBGA 3HIJA 3HM7A 2V3FA 3AMDA 3E02A 1VYRA 3MKCA 3TUUA 1UOKA 4DELA 1PZ1A 4NY2A 3XIMA 5KTLA 3EOOA 4A22A 4BFAA 1RLDA 5DN1A 1MZRA 1OIFA 4WGXA 3AIVA 4DO4A 5CCZA 5MHBA 3VABA 4MWAE 2Z1KA 1PX4A 3N9KA 4CCZA 1B0IA 2XVNA 4KEVA 3GVWA 3L0NA 1WV2A 4IMFA 2VX4A 3POCA 1MW2A 1JPIA 1O94A 3SUVA 3U4AA 1IQ8A 1UROA 3PPFA 4UFMA 5BWFA 1REQA 4ZFCA 3URAA 4L1GA 3LA4A 5F1UA 1VGAA 3GU2A 3QM3A 4B3LA 4E2DA 3D46A 1GOMA 1R30A 2ZDRA 4ZOBA 2WLZA 1U5VA 3N6QA 1TCDA 5FD0A 1C7TA 2OEJA 4L4MA 3SCPA 4QNWA 1RCXB 4EKJA 4V1XA 3W7KA 3QH2A 2UWFA 1Z6KA 4H9MA 5ABFB 7TAAA 3R5EA 1SJBA 1XQKA 1A5BA 2PTDA 3SQSA 4WXZA 3LCGA 2RGMA 1G67A 5I3GA 2XU2A 2OXNA 3UETA 2FVMA 2WVTA 1R9ZA 4DBUA 2XVGA 2WBGA 2MANA 4S2CA 4NNAA 1D2KA 3E0FA 4RZ6A 3S6TA 5HA7A 2XM1A 1A49A 5EMUA 1MFUA 3STPA 1T8XA 2YL9A 4Z2KA 1ONRA 3MI2A 5A2AA 1TV3A 4Q8OA 1BEUA 4R88A 2YCKX 4K37A 2IKJA 4NZCA 3VMOA 5A8OA 1XIDA 4N7QA 4UXDA 1FX6A 3ITOA 2J7DA 1EP3A 3LGDA 4QLJA 4PTXA 3VM5A 3WLHA 3OJGA 5EPDA 3S4TA 3W0KA 3W37A 4QP0A 4NU7A 1XX1A 2RAGA 2XH2A 2HS6A 7CGTA 2B7OA 3AI0A 1JPDX 3DFHA 2YLAA 2XWEA 4DVOA 3SR7A 1QUMA 2CHOA 2ZRXA 3EA3A 1XLBA 2OJPA 4QXIA 3KBSA 3ZJKA 2A1YA 4O14A 2IPJA 3I3DA 2A7PA 3TC3A 3V16A 2VWSA 4AY8A 1DHPA 2CZVA 3QJAA 4I7WA 1VHNA 1RK5A 5MF5A 1IEVA 3NDOA 2ZYFA 1D7KA 3VPLA 2CLFA 1FXPA 2D2GA 2RJGA 2G8ZA 4ZA0A 4QTGA 3UJRA 3NDYA 1HXJA 5FJJA 4HBKA 2DQXA 1OADA 4LW7A 4UQBA 3PAOA 5A1AA 2E3ZA 3IIPA 2WOQA 1GQIA 3JW7A 1XG4A 4HQVA 1KRCC 3GBEA 4JD4A 5BRBA 1J0KA 2JIWA 3NCOA 2Y5JA 4Q8UA 1DVJA 4K7YA 3NYDA 3R8GA 4HJWA 1B3ZA 4I5UA 1H11A 1I0BA 1J11A 2Q3OA 1UHVA 2EF9A 1E1FA 2V82A 1HJXA 1QW7A 2VC5A 1LOQA 3S1VA 4N6FA 4F48A 3EOLA 4W88A 2GWGA 3DYMA 2OQYA 1T0OA 4GUJA 4WD0A 2EG7A 1F3EA 3R0UA 2FZNA 1PPIA 3PVFA 4S23A 1JRCA 4JEQA 3VYLA 2GDUA 1VPYA 3KHDA 5RUBA 4WUIA 1HQTA 1HJQA 3GR8A 3GXIA 4E4UA 1YIXA 3EDDA 3AXHA 1B1YA 3NAVA 4ZOEA 3LCLA 3T2OA 3GVVA 1VBUA 3LUTA 3WENA 5A69A 1XUUA 3GH7A 3ZS4A 3NYZA 1CI1A 2INEA 3L2LA 4AC7C 6XIAA 4ZOAA 4KKXA 4C6MA 5BXSA 1U2YA 1Q63A 3VMPA 3SQLA 2CCRA 4O0KA 1DP0A 3P6LA 1XLIA 3DI1A 3KRZA 3IIXA 5DLCA 4KGJA 4S3JA 3MI6A 3QHMA 3CEPA 4GUFA 4JAWA 1D3HA 5LIKX 2DY3A 4EE9A 3TTSA 2Y5EA 1R3SA 2VMFA 4DJED 1XYAA 3A5VA 3EKLA 1VIWA 2HDJA 3M9YA 3R43A 1R7OA 1JUKA 1O5KA 4NAFA 4DYJA 4LUYA 5D33A 1E0TA 1ZU8A 3HPAA 2ZQ0A 3TIMA 1XIBA 1ITXA 3W7GA 4AZGA 4N9CA 2I56A 1PDYA 4HCLA 1WE5A 5HAOA 4OGZA 1E72M 1JI2A 3R8RA 4AD2A 1I0DA 1WDQA 1O7AA 3PANA 4LWWA 2NUXA 1YDYA 5TQLA 4KFPA 3VOJA 2IQDA 1QXLA 1E6XM 1HJWA 2NQZA 2NV1A 1XLLA 1T6MA 3QV8A 2E0PA 3AU6A 5DT7A 2PD5A 4HTBA 4HCDA 3SQMA 1R3WA 3MP5A 7PTDA 2JF7A 3CC1A 1VEOA 1VFMA 3H4WA 4DJDA 3BAIA 4G7EB 4IGSA 2PDQA 3KWXA 1KD0A 4PSPA 1ENUA 4Y90A 4H8VA 3CJPA 3LHVA 4R27A 2GJNA 1FTXA 4UCFA 4B16A 5E0CA 2FMOA 4HCHA 4PUMA 3FA3A 1BXCA 3DC8A 3C4UA 4LPCA 4G9PA 3IANA 4B5VA 1EIBA 4JTHA 1XLFA 1PTGA 1T96A 4IL0A 1NDZA 2DZBA 4FS9A 3GU9A 1DYSA 4CCDA 4JKMA 1BYAA 1XD1A 4P8UA 2Y61A 2YB4A 3SAZA 2NQJA 2D0FA 4QLKA 3LB0A 5LA2A 4AIOA 5A6BA 1QI4A 1CCWB 2QCDB 4C6EA 2ZXBA 4RDZA 1J2WA 1HTIA 3MDUA 5E0KA 3UZXA 2Y2WA 3FA5A 4C5YA 5G4WA 1UG6A 9XIAA 4NJJA 2VVNA 1WKDA 2E6YA 2F84A 3IUIA 4RV3A 2B0MA 1OFDA 3H2AA 5BU6A 3TXVA 1Q5MA 4HHHA 3OYZA 4C5ZA 3U8GA 3BPWA 4KW2A 4KEZA 3VZZA 2C8NA 1XR2A 1TWZA 1H7XA 4QRNA 3UVAA 2RKXA 1CXIA 1BFNA 4D1IA 3BZGA 3ZLFA 2W9MA 3HN3A 1IGSA 3MVTA 3VKBA 3FSTA 1IEWA 1WDDA 3B40A 2XH7A 1FOBA 3BMWA 2OKOA 1PKLA 3S3GA 2JKAA 1N8FA 3LLDA 3GDLA 4Q4PA 2ONEA 2YDAA 2VT0A 3D47A 3L68A 4IGMA 2ZKMX 2B7PA 4LUTA 1BPLB 1RALA 1PO9A 3FK4A 3LNPA 2BMBA 4FLOA 5D4YA 1TIWA 1QHPA 4LYPA 4NILA 4M80A 2XN2A 4ACYA 5D8ZA 1U1UA 1TPB1 3AIEA 4YL2A 4DUXA 1P1MA 4PGLA 1EB3A 4S2BA 3ZVHA 1YQ2A 3FEMA 4TMCA 1FCUA 1DQWA 5AKQA 4OE7A 1ECEA 2GGHA 3W7HA 4AHPA 1B3XA 3PSVA 3W1AA 4B92A 4UTMA 4FMVA 1EWEA 3CHCA 1PKNA 4DNHA 3M6YA 4PCNA 1XIFA 3EOEA 2PGFA 3KXQA 1W9VA 1XLMA 1BTMA 1EC9A 1K9FA 4H83A 4XZWA 5FF0A 5ABTA 2E9BA 2VZTA 1XSJA 3B4YA 5HWMA 2OCZA 2X42A 1FXQA 3EOSA 4GA8A 3C86A 2VRJA 1YXYA 1XS2A 2VX7A 3UXIA 1W5NA 2QV4A 1GQNA 3NQGA 4Q6JA 4J28A 4CD7A 1K02A 4I3GA 5DMYA 3MKKA 3VK5A 5GJPA 4UMBA 2OLHA 5F2GA 2C79A 5E70A 2NVCA 1MXSA 1RA5A 1GQLA 4ZOCA 2DSWA 4RNIA 5DT5A 4IX2A 4JHOA 3BOFA 4HU8A 3ARUA 4ZXLA 1V6WA 3CV6A 1DJGA 3MO4A 4H3DA 3O05A 2WVVB 4AC1X 2VXNA 1M3UA 3Q65A 1KKOA 1W56A 1P0DA 1TSIA 1P7TA 1O12A 2Z29A 1E6SM 1KM0A 3WDIA 3NO1A 2ICSA 3IJDA 4RZ4A 4JQ1A 3P60A 3QKZA 4PTMA 1GW1A 1EDTA 2PWGA 1TTJA 4BQ5A 3SSJA 1VS1A 2DGAA 3UWWA 1T7LA 3WLRA 5FF2A 3P7YA 5GPRA 2Z0IA 3ZJ8A 3T0CA 3AUOA 4NYYA 2PU0A 1TPC1 1V79A 5K3VA 3NM3A 3P2VA 2OWWA 1YLVA 3FIGA 4GXWA 5AYYA 3QZAA 2WKGA 2NWRA 2ZRWA 5AYBA 1POKA 1RHCA 3UJEA 3UY8A 2WHKA 4IP5A 4QE5A 3KTCA 4DO5A 4AYSA 1ICSA 1QK2A 4CNOA 1TV8A 4V27A 4Y2WA 3MANA 4FNPA 5EMYA 5CC7A 4HZ7A 2B81A 4UC5A 3EMCA 1KFEA 4Z1BA 4TVUA 3A5FA 3U7BA 3Q45A 4CQAA 5EFDA 3L9CA 5BZAA 3EBVA 4AWSA 3E12A 5C5YA 3MI3A 3VIFA 1ELSA 1R5YA 2ALRA 2WC4A 4KMQA 4X63A 2ZC8A 3QGKC 2BOGX 1O1ZA 5C8BB 3TE9A 4AWUA 3CS2A 4PTVA 1IIHA 1WDPA 4IJCA 1W5QA 3WQFA 3C2VA 4IFKA 4BI6A 3F4WA 4NJHA 2QPUA 4TX8A 3S1WA 3TR9A 1JAEA 4P61A 2IPWA 2CERA 2PDUA 4EWJA 4HSHA 3TJ4A 1GEHA 5DMMA 4HJFA 1ZY9A 4GI8A 1UR0A 2DUZA 1JGIA 1PYFA 5DF0A 3BK0A 4LH8A 1BWLA 1EDQA 4M6PA 4AD3A 3BTNA 4TR9A 4UOQA 3WUFA 3TAOA 5DCEA 1W1IE 3DAQA 1NDYA 3W1QA 1CENA 3ARRA 1IE7C 5D8WA 4W7WA 1VC4A 3S5NA 3M0VA 1ML1A 3IJ9A 1G7VA 4IPNB 1JULA 1FP9A 2QEZA 4QS6A 3M1ZA 4HSNA 3VGDA 4UQAA 2NQ5A 1X7IA 2ZBTA 4J2PA 3AAMA 3B03A 3I6TA 5FF3A 3W02A 1JRBA 3QC3A 3CTTA 4IMEA 1WZLA 2FZBA 1KM1A 4MAVA 3VZXA 3NQDA 1VPXA 2Q71A 3ABSA 2E9LA 2QYGA 1V6YA 1XH2A 3PS7A 2VC6A 1HJUA 2P0OA 4ERAA 5LSMA 4S39A 3H4GA 2Z00A 3BCJA 1E6ZA 4FNSA 3EMQA 2D24A 4H7CA 5XINA 5DO8A 1UR4A 2TYSA 2OT0A 4F0RA 3DU0A 2YB1A 3QPZA 1W31A 3RLHA 3CHFA 4X60A 4XKYA 3GKAA 2ZTJA 1FFRA 1HFBA 3CZJA 4MB3A 1FWJC 1W1ZA 4JTRA 1DORA 1OINA 1CB7B 3AWOA 2ZADA 4JTLA 1DXFA 1TPWA 1JCNA 1U83A 1LUCA 4QITA 3S5ZA 3WF3A 4Q8QA 1WXYA 1ADOA 4J3WA 4NSBA 3BJTA 1W54A 2A6LA 4K68A 4FEZA 1J01A 2HE8A 3AS2A 3VDHA 3AIUA 9RUBA 2DSZA 2GK1B 4PUKA 5CC3A 4UTHA 2R8WA 3CBWA 1UCWA 4AF0B 1QHZA 2DZAA 5T26A 4EF9A 2PWEA 3WJYA 3FXGA 2YFNA 5HATA 2HCVA 2QAFA 4IIHA 1RJRA 3TYZA 1FKWA 3UCDA 4R9XA 5K9DA 2HNEA 5CAHA 3FJ6A 3PZIA 1FWCC 3GR7A 4D8ZA 1KLZA 4GVFA 3VNZA 2NV9A 3O6DA 3T55A 3SEPA 3OQ8A 3UCQA 1ME7A 2G3IA 2J6VA 3UWYA 3WF4A 2QGYA 2FYMA 1EX5A 2Z1XA 1HGYA 1LQ0A 2A7NA 5EA9A 5CPMA 1KM5A 4AG0A 5AVHA 2VEMA 3L2MA 2DUXA 3FJ4A 4AD5A 1GYLA 1IZCA 2QGHA 3W27A 3JZEA 3SIMA 1I2QA 1FRBA 1GTHA 2QDDA 3PG8A 3BDKA 3AS1A 1TX2A 3M41A 1QASA 2CC0A 3B97A 1XHGA 2NT1A 4QG8A 3P5ZA 2RUSA 2C3ZA 3G3DA 3BLLA 3G6LA 3QHOA 1V0LA 3ITXA 4UOJA 5BNKA 3C0SA 3RUBL 3BZJA 5F2IA 5KZDA 4MPKA 3HO8A 3NXLA 2HK1A 1U30A 4HGXA 2JEQA 1B30A 2QAPA 4YCPA 4DF0A 3OZYA 2Y7GA 3MPGA 2B7NA 2VJXA 1HGWA 3A3XA 3N3TA 3WCZA 4CVUA 4JL1A 1I9CB 5DANA 1EJSC 1V51A 4ASTA 4X9SA 4CU8A 1Z42A 3CHEA 3POHA 1LORA 1F9CA 2BTMA 3TMLA 3W7MA 4F3HA 2XVLA 3BE7A 2E8ZA 1NFBA 2HPMA 3NVDA 4AEFA 2QULA 3MBFA 3LBMA 1Z8AA 4C1NB 4D6CA 1MDRA 4WHBA 1CLVA 2AQVA 1E3XA 3K8KA 4AX6A 2DT1A 1XKJA 4DF1A 3WD2A 3PP7A 2R24A 3M4HA 5AC8A 2WZHA 1OX6A 3HZ3A 4PMXA 4RE0A 3V18A 4S3BA 4FR6A 1E0VA 3N3MA 4O13A 1DWGM 4QBXA 3P61A 2PAJA 1Y5VA 3VE7A 4UTJA 4XX6A 1W37A 2WMFA 1GVIA 4EVZA 5HR7A 2BOEX 3CHVA 4HZ6A 4DX3A 3B0UX 2XN0A 2X8RA 2V3DA 1XLEA 2PRHA 3S47A 1OX4A 1V3JA 4PUWA 3B05A 3LDVA 3BOXA 3QKEA 2GQ9A 5TIMA 3WNPA 1AH0A 3R0DA 2A3HA 2E6FA 3VKJA 3K46A 4IPPA 2VDIA 4QGCA 2XWDA 3QMSA 4E3VA 4L6HA 1E0UA 5CG7A 1A3XA 1UASA 2EKCA 3CAVA 4FP1A 4QQUA 1NOUA 5KSWA 3I68A 5C54A 2OTDA 4P7NA 1C29A 3VX1A 2WKLA 2AAMA 1VPQA 4B5TA 4MDPA 4MNMA 2BWGA 3ISIX 3A3WA 5LXXA 4MJMA 1D9EA 3PZQA 1AW5A 3M5XA 2DU2A 1IEXA 2BZNA 4C6QA 2VC7A 5K9XA 1CGWA 4O1CA 5IM51 1R3VA 1V93A 1HL8A 2VRKA 3EGJA 3WNMA 1JD9A 3R1ZA 2A85A 2E5BA 1GQKA 2OO6A 2XYLA 1H7RA 4LRTA 3TQVA 1LROA 3VOFA 3AFBA 3WQ8A 1EYWA 2ISWA 3B3DA 3SN1A 4PBGA 2YCLA 1B57A 1DJWA 4AXKA 1VFLA 4F0HA 1JXKA 2VEFA 1HJVA 1IXQA 3GNRA 2QZRA 1XYMA 2Y24A 1TV5A 1UIOA 2VCCA 5K4XA 1R0MA 1ZP3A 3GRIA 4TTGA 1JAKA 4O1EA 5PTDA 1RAKA 3CUIA 2X1RA 1GOKA 3UCCA 3STGA 2D1ZA 4QJ3B 4YYCA 1TA3B 2Z1SA 4AH7A 1Z89A 1SJAA 3U9IA 4PL2A 1YPXA 1EJWC 1TQXA 1P1XA 4JY8A 1S1RA 2INZA 1FCBA 4AD0A 1OC7A 2J88A 3WLNA 4N02A 4DQWA 1PCWA 1EOKA 5A6JA 3TX9A 3STEA 3TOYA 1F8IA 3AXIA 3W87A 1TRDA 3ZMRA 4DJEA 4LS1A 1DWHM 1LQAA 4A3YA 2RJHA 3UGRA 4YN5A 3L5AA 3MS8A 4DAIA 4X2RA 4JTSA 3L65A 3NZQA 1HKIA 5CGQA 1ODZA 1HKJA 3AXMA 5GNYA 4DO6A 1ZSXA 3NQBA 2GPTA 3TXZA 2TODA 1FDZA 3VOHA 6ENLA 3QLLA 4Q4SA 2Y7FA 1NH6A 2YZRA 3ORWA 3GH5A 4F2UA 2J27A 3V0UA 3W3OA 3UXLA 4JTJA 4XUGA 4RZBA 1FHDA 4YHGA 5I6SA 1D8CA 1JCLA 4O52A 4KIRA 3F5LA 2ZUWA 4LEQA 3RNDA 4BHYA 3L4YA 3W25A 3THDA 2ASHA 3RX2A 1PX3A 3H26A 4K36A 3ZJ7A 2E7FA 4XO6A 3TV8A 2Z24A 4IISA 1PB0A 4GMEA 4GC4A 2ZUTA 3CL8A 2GLKA 3MV11 2B4GA 4JR5A 1NWTA 3C3NA 3WQCA 4U2ZA 3QQ0A 4WSJA 1XH0A 2DEPA 1PCKA 4WKHA 4KEMA 1GJWA 2WM0A 4DHGA 1XRFA 5I02A 2GGGA 3P8IA 3HV9A 1NF7A 4S3GA 4BZYA 2J66A 4LUIA 2CBIA 3LYEA 4KQNA 4HNLA 5I2UA 1OZMA 3NO3A 1Q85A 1NOFA 4W89A 1A50A 2GJPA 2ZTKA 2WJFA 2PGEA 4MMWA 1A5OC 2O4QA 3TLQA 5DMNA 2FFIA 4BI7A 3KTXA 1XWYA 3BW2A 4HHPA 3GE7A 1JZ6A 1I45A 3A24A 4BQ4A 2I57A 3FCPA 4JICA 7REQB 4DUVA 2C1GA 3G5EA 1MDLA 2HISA 2PGWA 4HTYA 8A3HA 4PFHA 4MOZA 5I3FA 3TKFA 5FF4A 2PB1A 1X6NA 3OG2A 4IF2A 3V36A 4HA0A 3GFZA 4XQ6A 4IP4A 2EPHA 3WQWA 3NFUA 4M6UA 1B3WA 5EMMA 3N4FA 1O66A 1D8WA 3HF3A 1EQCA 3MV01 4UR8A 4C1KA 3ATYA 3WFAA 2WPGA 3MUAA 5CSYA 3LI1A 1KNWA 5DRIA 4IZGA 1LRNA 2ISFA 3LX9A 3BANA 5I23A 1LLZA 3FOKA 2FGZA 3N29A 3TC7A 3L23A 4TVCA 1B3YA 4JY9A 2YL6A 3G0UA 3HQOA 1UUOA 3U4FA 3UGVA 2O4MA 1W9XA 1C93A 1SJCA 3W85A 4NF7A 4I5XA 3CH0A 2Z28A 1C8QA 4CN4A 4KFNA 1PZ2A 5FJIA 1E0XA 3RPMA 1TIMA 3P81A 1FKXA 1TUFA 4Z2GA 3BLEA 1TO3A 3OBAA 1F4HA 3GKFA 4XUYA 2PDHA 1OYBA 8XIMA 1XIEA 3WMBA 4JQAA 1E51A 1KRBC 4B9YA 2ZWYA 5CG0A 4GZ7A 3OEXA 3M0HA 1RUSA 1WDWA 4ZCWA 3PTKA 1Q2RA 3LSBA 1YPIA 1UUMA 4Y7EA 3UA3A 1JR1A 5FEPA 1CGTA 1W8SA 3MC5A 4C6OA 5AN7A 3GQYA 1G0CA 2G37A 4MY9A 4IX0A 4OKDA 3AHVA 4N0RA 4NAEB 1E1CA 3PJXA 2J8TA 3LTYA 4L1XA 3W1PA 2ZE0A 1CT5A 2OZTA 3WQGA 5IHSA 2FQIA 3LTPA 1M5WA 3AQUA 1LRTA 4E5TA 3D3AA 5HUPA 2GYIA 4W8BA 2ACUA 1UD8A 5LKYA 1YTEA 5HUOA 5C9WA 2IMRA 1YBQA 8RUCA 4L9XA 3HMCA 1JFXA 3GHSA 4DXVA 3E1F1 1KWKA 1TRIA 4GGBA 3IRDA 3ZWTA 1V3MA 5CPQA 3M07A 3VFLA 1OBAA 1UR3M 1KRAC 3BG5A 4CEUC 3VFCA 1TWDA 4BWLC 3COTA 4HSOA 3BWWA 1TE6A 1W9BM 2CESA 4PL1A 3TSBA 3G1DA 4OOUA 4B4HA 4HKPA 4G5DA 1RJQA 3TTEA 5CQ1A 3C0LA 3I6EA 2Q02A 1Y8BA 4WJXA 3N14A 9XIMA 1SMAA 3CQJA 1KR0A 1KGUA 3P82A 3MZ2A 3KE0A 1P0BA 5F4WA 1XH1A 1S38A 1R3TA 1S46A 4KESA 1YKWA 3N34A 4PSRA 4GKTA 3LCXA 3DHDA 4US5D 1DOSA 3SCTA 2R1KA 3P0XA 1C8XA 3ZQ9A 3VIPA 3B0YA 3LHWA 3W24A 3EKZA 4M7SA 1XYBA 3GTHA 4PCSA 4LSBA 4WRHA 1SZGA 4WIWA 3W6YA 1CWYA 1W8GA 4O0QA 3N19B 1UQZA 4ML4A 5IBXA 3KUMA 2P3EA 4I8DA 2WW5A 3QR1A 5A8PA 3PULA 3VGGA 1EGVA 5LHEA 4UTWC 4XD5A 3TFCA 4QE1A 2FZDA 7TIMA 1V6UA 3CQ0A 4LCRA 2QDHA 1R3RA 4V33A 4TVDA 2YSWA 3FKRA 5A95A 4BY3A 3TN4A 4JOMA 2QMKA 2J75A 4F4RA 2HVMA 1A3HA 2J7EA 3W6MA 1UKOA 4XZ9A 3DI0A 3SJ3A 1MEIA 4HNVA 3BCDA 3ZWSA 4HNNA 1KC7A 1G4TA 2VR4A 3EA2A 3WD3A 1QR7A 1VFFA 5I24A 4NZ4A 1JZ4A 1ZJBA 3B8DA 1JI1A 4E38A 4GCXA 1P0KA 4X0VA 4YYFA 3DGRA 1UMLA 3VD3A 3RRXA 3V5FA 4C60A 1VCGA 1PJ9A 2WJZA 4RDWA 1Z44A 4B5UA 3VGFA 4HNUA 4CVWA 4XIAA 5FF7A 1SZFA 3QN3A 3RIKA 5DXXA 1K7EA 4REQB 4GZIA 1EXBA 3LXBA 3P14A 5TF0A 4HZ8A 5M1TA 6PTDA 2DZTA 1V02E 4PE8A 3KX6A 4H9YA 3R10A 3GNNA 1AG1O 2WO5A 3KOWA 5MKGA 3S6DA 4C65A 3G8EA 2ACQA 4O18A 1KCZA 1H50A 3FFSA 3V7PA 4DNMA 4JEJA 4LAZA 3DYPA 3O07A 4MJ2A 1WBJA 2PDMA 3HG3A 2F9RA 4Y8FA 1MW1A 2G50A 1UR2A 3S2MA 3ALFA 1U1HA 4RW5A 3ZR4A 2YPIA 1BF6A 3QY6A 3KL0A 3OZOA 2CPUA 4X3ZA 2OEMA 6TIMA 4FF7A 3F2DA 3EX6A 3W70A 3CQIA 3BG3A 2PE4A 1KBLA 4L61A 3N73A 3AJ7A 4UIOA 4BKNA 3THCA 3CL7A 5I5RA 2HROA 3LK6A 2ZRZA 2UY4A 4IMDA 2OT1A 3OIHA 5I09A 2QT3A 2C18A 4HYRA 4HHLA 3LCHA 4XAFA 4ZO8A 3PJUA 3EWZA 7A3HA 3FV9A 1BHGA 2QJJA 2P3ZA 4CQCA 3ITTA 3VM7A 3CV2A 3AZTA 1QDSA 1Q7ZA 4IQJA 4ML9A 2I1OA 4PB4A 1ICPA 1MW3A 1VR6A 1Q8JA 1UWRA 1W1PA 1TR1A 1XG3A 2ZCGA 2C14A 4WSKA 2PF8A 2VI0A 2XFFA 3W1NA 1TPH1 3WQOA 3TQ0A 3IRSA 1TTQA 1JCXA 2GOKA 1BRLA 4C6JA 2Z2UA 3LQLA 1YDVA 4MY8A 4JFWA 3G1VA 4URIA 2IQ0A 1Q6CA 3S8HA 3O7UA 3EOUA 2CKRA 4FIRA 2WCGA 1IR1A 4JHZA 3UF9A 3OLGA 1W17A 2PRLA 1QPKA 1XF0A 1GOQA 4R34A 2D0GA 4O1DA 3KZPA 3B8TA 3B0VC 4Q4RA 3B9AA 1QK0A 2PCQA 4HK6A 4QSFA 1XLCA 1KM6A 3IV3A 3V0TA 4DBEA 1Q65A 4WX2A 5BMWA 2C6QA 1YADA 4YCOA 2RGLA 3CTLA 4KF1A 3QR0A 3W2UA 4MWAB 4H6QA 3HURA 3IAPA 3CPGA 5CGTA 1AW2A 1B9ZA 1CGXA 4ORMA 2Y4SA 1UWQA 3NPWA 4QISA 2ZZ4A 3TJIA 1NQKA 1OZQA 3K8LA 1V7YA 1F76A 2RDUA 3ZT7A 3DERA 3REQB 2VWTA 4FX6M 3I7QA 4OU1A 2ZC1A 3PTMA 2DSUA 4B5XA 1W3HA 3BSGA 3VA8A 3K2GA 3AMKA 3GWQA 2X2YA 4MJZA 3B8VA 3ARTA 3LS9A 1HL2A 1AD4A 4A4AA 1EO7A 1M7OA 1VFOA 3URQA 2E09A 3LMZA 5KMYA 2OFJA 2X0HA 3JUGA 5KZ6A 1XGDA 4A8NA 4PCFA 4Z2LA 1I2NA 3UEQA 3GX9A 4LUSB 3KEHA 4XISA 3ANYA 2JFEX 1DJQA 4IUOA 4ICMA 1BTCA 4KWSA 3LCFA 3LERA 2R6OA 4DM2A 1K8ZA 2QW5A 3KM8A 3AHZA 2DW7A 3V5OA 1QNVA 1SFSA 5JIWA 1KW1A 3Q58A 1GUVA 2YDSA 2BVYA 3DKLA 4DRSA 1WB0A 5D2YA 2Y1HA 4M24A 2ODOA 2R1MA 3FHAA 3QEZA 5REQA 3SUSA 3W83A 4UTIA 3KDOA 3R7MA 3NL3A 4G1NA 5LGXA 2BY2A 3T40A 5BW6A 2ZXQA 1UW9A 2BGNE 1Q6FA 2EPLX 4M1RA 2QCGA 3AYSA 1ME9A 2BV9A 2PC4A 1ISYA 2V2HA 4GUGA 2X30A 5ABHA 2ZXAA 1F05A 3WZ0E 3WBYA 1Z69A 3SCSA 4I9AA 3SY1A 3ABRA 2PLJA 3T7VA 1LL4A 4AIEA 3GUGA 2YR1A 2VQTA 1ZBVA 4E2OA 3RYSA 1T99A 1PAMA 5CSSA 5LIXX 1M6JA 2PS2A 1UP3A 4NZJA 1EGMA 3RFAA 1ZL1A 2H90A 2V5LA 3O63A 4XZBA 4RLIA 2YX0A 3P3BA 3GUWA 4ATLA 3VNLA 3UG3A 4CLMA 2GVJA 1T41A 3C56A 3ANVA 3B8UA 3V75A 1L8PA 2J74A 5LGZA 3T1GA 3NDZA 4KPLA 3HGJA 4ICCX 1OM0A 1D7FA 1KM2A 1RVGA 3UFYA 3WJXA 2QJIA 5T9BG 2JEPA 2PRMA 3TROA 4FXRA 1RPKA 2GVYA 2KAUC 3NR0A 2P76A 2PDLA 4Z2HA 4L9YA 4KWOA 3GO2A 1Q13A 3EKGA 4WOZA 3A23A 4GKLA 2DSVA 3BUVA 1KXVA 4K39A 2WMIB 1SMDA 4ZEPA 3RCYA 3M5ZA 4UOZA 4RR4A 3FAXA 4K8GA 1H62A 1F3WA 2O9PA 1MFVA 1W0MA 5AYZA 3UPMA 3T81A 3QGAC 5I78A 4N4QA 5A8MA 4QAIA 2CKSA 4GXPA 4HMNA 1RVKA 2W63A 3RJXA 5FEZA 5HMDA 1X1ZA 3BVJA 4KS0A 2CBVA 1Q66A 4AIBA 4YTTA 3AIWA 8XIAA 3W71A 1HL9A 3OODA 2EHHA 3CHDA 4N2YA 3WMCA 4P7LA 3NIYA 4HN4A 3RN6A 4D2JA 3G24A 4CCEA 1JGMA 2EJ1A 4IPJA 4O19A 4F2BA 3Q67A 3T2PA 3C2FA 4GVIA 1JZ8A 4K6AA 5E6YA 4LY4A 1OFQA 3M0KA 4LAMA 3S83A 1K9EA 3NEVA 1E9YB 3EA1A 1GKRA 3QY7A 4G56A 3WD1A 2CZFA 3TSMA 4AZIA 1PS9A 2ANUA 4HYWA 3FHQA 2O7QA 4BJHA 4YTUA 2BHUA 1EWDA 1E9LA 2DT3A 2XN1A 2A7RA 2A3LA 1W1YA 4DPQA 1H7NA 4I6VA 5CH9A 3SGUA 2BGQA 2ZVRA 3U2CA 5H1WA 5ENLA 3RG6A 4UQCA 3CWNA 4R7WA 4GH3A 3EDFA 4G6CA 4AB4A 4WJ8A 2ON3A 3NQ8A 1H0GA 1J93A 4ZZ9A 4WEVX 3OBEA 2NSOA 4D8LA 4FF5A 4NQ1A 2GFTA 1H1NA 3GTIA 3GDBA 1KA9F 4Q8VA 1IF2A 3UBPC 4P8WA 4G2DA 4PMOA 2OOFA 3PAJA 3TW7A 4RKAA 2XIIA 3LI0A 4MKSA 4H7ZA 4PB5A 2D69A 1QJWA 1X39A 1AL8A 1ZUAX 3C5QA 3CLWA 1ADSA 4Z17A 3KOZA 2I17A 4JZ5A 1BKHA 3GTNA 2GSHA 1NVMA 4JYFA 3UJFA 1WOAA 4X9YA 2I14A 3CT2A 4M81A 3OZMA 1H2JA 3W7PA 2E1WA 4RUBA 4U2YA 5F7UA 1OABA 4OWGA 4MIMA 4D6FA 1Q2SA 3RU6A 4WKFA 1X8FA 3V1HA 3APTA 3KL3A 3F4NA 1NQ6A 4H9TA 1XFCA 4HN8A 4W87A 3CM4A 3UYCA 3EWCA 4A2SA 3H12A 1RY0A 3V5CA 4ZTYA 3ABZA 3LPGA 3C8FA 2OOGA 3G1XA 1GVSA 5T9CE 3WNOA 1JPMA 4UMCA 2CU0A 1JPKA 3ITLA 1XW8A 5BCAA 1KFLA 4LC6A 3ARPA 2GJXB 5FJOA 4IMGA 1I8JA 1OQFA 2ZWZA 3NJ3A 5LNUA 2H9AA 3VIMA 2WC7A 2QQ6A 3CMFA 2BXYA 3GM8A 5AECA 3I4EA 4L80A 3L4WA 3ABXA 2GQAA 2W67A 2F6UA 5AC6A 2V0TA 4U5KA 1GZGA 2QIWA 3LRKA 3TOPA 3N11A 1WKYA 3P0WA 4O4WA 1K4HA 4FSAA 1XIJA 1YNQA 3T4WA 3THUA 3NQ2A 4DJFD 2GQ8A 1UZHA 4W5UA 3KAOA 1KRMA 1W9UA 1GZ1A 3IGSA 5CSUA 4DPPA 4M56A 1MW0A 3M47A 4NZ1A 3UZYA 1XLGA 4LJ3A 4OUEA 3TN3A 1SW3A 1AQHA 2PDKA 1SZEA 1VKFA 3A21A 1GZJA 4LBRA 1JD7A 4JNYA 1MNZA 3WL0A 1X98A 4P5UA 5CJNA 1W5OA 4WXYA 1TV4A 3PZMA 2D3NA 4NI3A 3S2LA 3LPPA 5K7JA 5HR6A 2J7FA 1TJPA 3ZIZA 1F8MA 1OG0A 2WZTA 1Z41A 3CEUA 2QJGA 3MJYA 3ZLHA 3B06A 4AMCA 4DN1A 3BSHA 4AWTA 1EDGA 3RGTA 2HMCA 3L4UA 3W2NA 3IACA 3WDPP 3AISA 2GSJA 1GYNA 2VFGA 5K4ZA 2J62A 2P0IA 2Y88A 4UR9A 5EKYA 5JU6A 1L2QA 4OOZA 1TV2A 4TXEA 2DZPA 1KKRA 3JR2A 1KTCA 1QO2A 3LPOA 3W29A 2ALDA 2HQAA 3FYYA 4GYJA 1TX0A 2TAAA 3FVDA 4BWLA 1GG0A 5A94A 4QSHA 3N2MA 1CEOA 1FWDC 3HPSA 1BYBA 3SSZA 1VLIA 1XD0A 2AKZA 3W7DA 3KVLA 1JDDA 4UTTC 4Q8NA 2E1DA 2IUZA 4XZNX 1H41A 1YRRA 2JF6A 5DRCA 1QPRA 2OGJA 4PUEA 4D6DA 1DHKA 1OEPA 1QI0A 3NQ6A 1OD0A 4ES4A 1OB0A 4RXGA 3OYXA 4O1FA 3M0ZA 4CD6A 2FTYA 3GFYA 3QR3A 2YXGA 3TTYA 4S3EA 3ZSSA 5I07A 1GG1A 1M53A 4NKCA 2Z1BA 1YXCA 3MWAA 1XSIA 1XCFA 2E67A 4CD8A 4GBDA 3OHIA 5C6MA 4KBXA 4PMVA 4L64A 3HG2A 4FLRA 3WK3A 3AO0A 1GVQA 3GD6A 4AZCB 1G9HA 4XZIA 1AMKA 1ISVA 4J3SA 1KFWA 4A3RA 1UD3A 2XFWA 1FCQA 4O54A 2WMGA 5D30A 1DQUA 5ABFA 4UTWA 5IRPA 4WQ6A 1XUZA 4F0KA 1CYGA 3U2EA 4US5A 3QTGA 2VZVA 1G4PA 3MBDA 3L7RA 2UV8G 1GEQA 4O15A 3PC0A 1GPWA 1AJZA 4OBTA 3WLKX 4KCWA 3ARQA 3BLKA 4Z1AA 4OHQA 1EHAA 2NVDA 1EHNA 3UXKA 4GINA 1C92A 3T78A 1I75A 2VFFA 1AJ0A 2W27A 1A5KC 4CN1A 3TR2A 4UTUA 5BWAA 2GSEA 3PB2A 4GXMA 1K77A 2A6NA 4XSLA 3THAA 1LBMA 3K4WA 2ZFAA 3HA1A 3HG5A 3OA3A 5E9AA 2QNEA 4D71A 2WSPA 1UMYA 1NF0A 3NSXA 2XGBA 3K1DA 4UB9A 3FKKA 3CASA 4C7GA 3S2NA 3O6YX 4C6FA 2E8YA 2PDFA 3CAQA 5G1MA 3CLMA 1E71M 4L6OA 1IWBA 2PLMA 3QPEA 5DMLA 4FLQA 4LAUA 1ZCCA 3LHTA 2PTYA 3VNIA 1XGZA 3ENLA 2ZUUA 4RNHA 4GBUA 1NFGA 5CJ5A 3M0IA 3CIWA 2X09A 2QF8A 3E2RA 2VTFA 3PZTA 3TAKA 4PCPA 1N8WA 3V0SA 3PPGA 4GGHA 3W4RA 3M0LA 4O8RA 3AJXA 3VD7A 3W7IA 2QXWA 3THQA 1FBAA 1L9WA 3M0JA 3WH5A 2NXIA 1MZHA 1XJBA 1CDGA 3WY1A 5FESA 5LIUX 2E40A 1JIBA 1MSSA 3UZJA 4KWUA 1IHIA 4IM4A 4FNRA 4UTFA 2EPOA 2EAWA 1JDAA 1W1B1 3MP4A 5K9CA 1QOXA 2DQWA 3NOEA 1P5BA 3W86A 2D2JA 2H8XA 3QGVA 3E0LA 5LZLA 1XDLA 3GS6A 3MMTA 3GNOA 1EA0A 3KP1A 2FLIA 1FWFC 3DFSA 1H60A 3ITVA 2V69A 3DHUA 2TPSA 3PR2A 3DHPA 2VR5A 4CNSA 3S5YA 1L0PA 3ITYA 1W2PA 1NARA 3TMQA 2J7CA 1SO4A 4YVVA 2HBVA 4ORIA 1EFZA 4JFUA 4AMAA 1GONA 2J8GA 3GTXA 4S3FA 5D9NA 4UQ9A 1VENA 1AL7A 3AWNA 2EG6A 1OJXA 5JBDA 3AIRA 3WQ5A 1ISXA 1DWFM 3GIPA 4F2TA 1G69A 3CB3A 4ZO9A 4PMRA 2NT0A 2F2HA 2AMGA 3B4UA 1Q8AA 3BCFA 2XVPA 2D23A 3BICA 1GCYA 3ITCA 4KERA 1D3CA 3V4BA 3VD9A 2C15A 4AZBA 3EWYA 4GNVA 3CZ8A 4K8HA 4B2DD 3WN6A 3FXYA 4UQEA 1IWPA 1E6NA 4Z2IA 1XIIA 2FTPA 1M7JA 4CD4A 3W7EA 1VH7A 3EWUA 2Y5SA 2G3JA 3IS4A 3KZSA 2R9RA 2QPSA 1PIIA 1NWUA 3SO7A 3OLEA 3R8HA 3AZRA 1OK6A 5BU9A 4JQ3A 4G7EA 3W1RA 1UP2A 3DFNA 4RJEA 2BOFX 3DFPA 3UZWA 2XZ7A 1SGJA 2EBNA 1UH3A 3RX3A 3DBPA 3QPYA 1R87A 3SFWA 3VUPA 4W5ZA 3UWQA 4CN6A 3QBUA 3M7WA 4M0XA 1FWHC 4PN2A 3DESA 1IGWA 3PWIA 4U3CA 1OCBA 3WLIA 1QBBA 3D3FA 1FWSA 4OFCA 5FL0A 3PG9A 1GGOA 4LU0A 2BBFA 4J3ZA 4PMNA 1SQ7A 4NI8A 3VE9A 2QCDA 4MTVA 3A6OA 3NL5A 3GNXA 2P1FA 4JDYA 3N4AA 3ARZA 1W3IA 1LDCA 2PDBA 3WX7A 4X22A 1EPVA 4J3TA 3QSRA 2R82A 2Y85A 1TWIA 3IJIA 3SCOA 1S2AA 5A2BA 2ZXDA 3VGEA 3PWGA 2J8FA 3HMJG 3CU2A 2WNWA 1KV5A 4C7FA 1IYXA 4MJ4A 4U3AA 2QLYA 5HMFA 3NQVA 5JQ9A 1JYVA 2FIQA 4G8TA 3GXNA 2PLCA 4JX6A 1TVPA 1FDJA 1JCYA 4KWVA 3LN3A 3IK4A 4DZAA 3NGFA 4V28A 5I3DA 1HKMA 3M6DA 1OFOA 4E3TA 2WZEA 3MHFA 3PTQA 3VU2A 1LP6A 3A4AA 2DORA 1IXPA 1E43A 1O5RA 3FNDA 2ZUMA 4S1FA 1N55A 1W3NA 3N12A 3UA4A 3DFYA 1OYCA 4QFUA 4IG2B 3F5JA 3RO6A 3QOKA 1TJ0A 4UFHA 4DWSD 3EYPA 3TU9A 2KX9A 1GJPA 5FAGA 1YW1A 2OKTA 4AD1A 2G97A 1JF6A 2WHJA 4I9TA 1AODA 1BLIA 4GYPC 4H41A 2MNRA 3E9AA 2DPEA 3GAKA 1UPMB 2Z27A 1FWRA 4AYGA 1EJTC 3JVAA 3VCNA 4LUJA 3BO9A 4B3KA 1F6YA 2XH0A 3EPNA 5IDIA 1BG4A 4RNJA 4PMQA 1GOOA 1L6GA 3L66A 4LYRA 5A8NA 5CBJA 3WFLA 4NRRA 1F6PA 3FAWA 4AY7A 4CQBA 3SCRA 1RZMA 1FWEC 1Q4NX 4WY0B 2AL2B 2DVXA 4M3PA 2WVUA 4ZB5A 2DT0A 3SGZA 4NT0A 1L6FA 3PPCA 3QF0A 1L8NA 1VYPX 2X16A 1J0JA 1UZDA 1XDJA 2V2CA 3O06A 3W72A 2X05A 3N2OA 5FL1A 4BS0A 1U1JA 3LCIA 2ZZ3A 4A35A 2VGIA 3OO2A 2GQ3A 4ZMGA 2V8ZA 2CYGA 1HG3A 3BGAA 2WVVA 2PLKA 3IUHA 1TTPA 5A6AA 3J7HA 1NU5A 1EIXA 1ZTVA 4RE2A 3ARYA 3GTFA 2CW6A 3QLDA 3MUCA 3CL6A 1D3GA 1P6BA 2PDNA 4M51A 4KRTA 2DJLA 1W3JA 3C6CA 3PK7A 3TQKA 2Y63A 2DIKA 5HJLA 2HWGA 3IVTA 1HIZA 2BFGA 1RQEA 4J4KA 1TWSA 2Q09A 2W6RA 1RBAA 2ZX6A 4Q8WA 2W0UA 4NL1A 2D2OA 3MSDA 5I0DA 3APYA 4JKKA 1G94A 3N6JA 3IIZA 1LL6A 5F2MA 1J5TA 5CPOA 3SDOA 1XKYA 3WK2A 2HTMA 2VR2A 4NVTA 1SFLA 1U5JA 1T5AA 4LVAA 4NXSA 4JTTA 4AHOA 3WJSA 2I5IA 5L6UA 2R1PA 3BV4A 3M64A 3CT7A 4Q6XA 1WZKA 3ECQA 3L5MA 2GUYA 2QV5A 2X1UA 5GNXA 2Z6IA 4MB1A 4DJEC 4N9EA 4O10A 3S0CA 1ZB5A 2V5BA 3G18A 4AZ7A 4MUPA 3RITA 4NRSA 1H7PA 2FPVA 4KWWA 3AICA 3PZNA 3APGA 4PRTA 1XBYA 2O56A 2PZ0A 4LX4A 1ZENA 4ZB2A 3NZGA 1VIZA 1YNYA 2PDPA 1QI5A 3EB4A 1F2JA 1U22A 3PUDA 4FNUA 3URBA 3RRAA 2XFYA 1O60A 2XDFA 5C55A 1XRSA 2PCEA 3NM1A 1CLXA 5C0QA 3M5VA 1OFPA 4HK7A 1OX5A 3W9ZA 1YTKA 4NZ3A 1MQQA 3NUKA 3KCOA 5BXRA 1TPFA 4F9DA 3E5BA 2GUBA 1ZBWA 3IGXA 5CXPA 3UERA 3NQEA 4YNGA 2VGFA 3CZEA 5KITA 4O28A 4Q8TA 1E4LA 2WHMA 4R53A 5DFAA 1TZ9A 5LNWA 4R7OA 3EX2A 3C0QA 2QR6A 2HJPA 1VFTA 2V3EA 3UNDA 1KB3A 2X1TA 5B7YA 5BRPA 2PDGA 4AAJA 2NQ9A 3KOFA 1VZWA 1HP4A 4WDUA 5HWNA 2OSXA 4HVXA 3GXPA 1DBTA 5D04C 3BL3A 1TV7A 3FGCB 3JZUA 1SO5A 1C9WA 1QI3A 2FDSA 4S3DA 2GOUA 2OZ8A 4Q7IA 4HNCA 2O9OA 2FHFA 5G5IA 3UESA 3TWBA 3MWCA 2VL4A 1X38A 3OGVA 1MEWA 1KCLA 1ZJAA 4DJFA 1FQ0A 2POZA 3OBKA 1V8EA 1HJSA 4TU1A 4XD3A 4YHEA 3SBFA 3G1AA 1Y5WA 4WZHA 3FY1A 3ES7A 3EXTA 3TCSA 2J9XA 1OD8A 4ATDA 2QUVA 3NNTA 1QW8A 2VO5A 4HPNA 5GVJA 1PZ0A 1J0ZA 3EX1A 3K13A 5E6ZA 3L0KA 1YE6A 4XZLX 2Y0FA 4JBRA 4LYQA 4BF7A 2VEIA 3CPRA 3PNUA 3VNJA 1IWAA 4EWND 4WR3A 3KS5A 5BMXA 2NVAA 3TJXA 1BKSA 2J9YA 1SW7A 1IT8A 4QHRA 2PPGA 3QYQA 4QDWA 3IIVA 2Y7EA 4AF0A 1EEXA 2WMHA 1ADDA 1R8LA 2W79A 1SZRA 3CWHA 3PBGA 2C19A 4DLMA 3WEZA 1EUNA 4UTTA 1JDCA 2ZX8A 2BSLA 4DJDD 1W2VA 1Q6LA 1CXFA 3OU8A 1M65A 4YVPA 3ONBA 1S3TC 4PYSA 4U4MA 2FVKA 2UBPC 2JIEA 1ZGDA 4FXJA 4ATWA 1DTUA 4AZ5A 1LG1A 1TPEA 2BB0A 1LL7A 2OYLA 3WFZA 5LIWX 1M03A 2VZUA 2VX5A 1EX1A 2CLOA 2QCMA 4XB3A 3RPTA 2BXZA 3CWOX 4RE3A 3BH4A 3VCCA 1I1WA 3QFWA 3BQ6A 3TYDA 3QQ1A 2DH3A 4EXBA 4JIHA 4GD0A 1YYAA 3NTYA 5U7SA 1WZMA 4LS2A 4O50A 4GVHA 2Y8VA 1AZ1A 3CB8A 3F4VA 1W32A 3KBWA 4MWAD 2YCEA 1BVZA 5DCBA 1G5AA 3LZ5A 1J6OA 3UY7A 1KBKA 3KBNA 1R9YA 4KCUA 1R9XA 3R6IA 2IKGA 4H8NA 1EF3A 3AUJA 1TMHA 2XH4A 3KOXA 4J7RA 1GYMA 5JUVA 3C0JA 3ELFA 4QCFA 4LAOA 2CBJA 4XV0A 5H6HA 5REQB 3GC2A 3N04A 4O53A 3PPHA 1PL9A 7XIMA 2CHRA 4JCMA 3AXKA 1EBGA 4C1NA 5EYWA 1E4MM 1KXQA 4H04A 2PP3A 3R0KA 3NPUA 4UBPC 4F79A 1TMQA 1FA2A 1K03A 3BLDA 2W61A 2UY2A 5FI8A 2FPTA 2XIMA 3A47A 3I6RA 2VD8A 1V0KA 3TW9A 4CQDA 2BHYA 2VP8A 1GJUA 3MUXA 3RLVA 1S2UA 2DZUA 1WXZA 2PUZA 1A80A 4A8IA 1ZP4A 3BQ5A 2BNJA 5CLWA 4KRUA 4LANA 1XXXA 1QCWA 4LBUA 3W23A 3A4XA 4I5RA 3GG1A 3M0XA 3FVMA 3EDEA 4DAFA 4L9ZA 3WJZA 3UJSA 5AZ0A 3WEMA 1FH7A 2ZE3A 2WNQA 1EOMA 1KCXA 1XPYA 2FZ9A 3H7RA 1A0EA 5BOFA 3PNZA 4UNLA 1P4CA 3SCQA 5HNUA 1QAPA 5FJUA 3OA5A 3W01A 1P0NA 2DV0A 3R4IA 4C6PA 2VDGA 4JIEA 1OYAA 4OVXA 4Z42C 1MQRA 3K8MA 1E56A 1ZLPA 3ZOAA 3IARA 1DJZA 3UR8A 4FNTA 4GHRA 1SR9A 1HT6A 3QFEA 2VFHA 1HKVA 5D9PA 3WLTA 1SZNA 2WMKA 3NPXA 5IBXC 1FWIC 2P50A 1R7AA 3NO5A 1DEDA 4B5NA 3LHZA 4XAPA 5B80A 1DIKA 2I9EA 3MSGA 4S3KA 3IUDA 3RM4A 4JDBA 3M46A 2BVWA 3B04A 1NP2A 4FOUA 2RDTA 4GJ1A 1O5XA 1S2TA 1H7WA 2WANA 3B8IA 3T42A 2PTXA 3IJ6A 1H1ZA 3BAXA 3GHTA 2V67A 1E73M 4C6DA 1VRXA 2FZ8A 2QCNA 4MFDA 1FCVA 4EACA 3WKZA 4GC3A 4YTRA 4PTDA 4K8EA 1DV7A 4HB7A 4FO4A 3GZ3A 1JNEA 1AJ2A 3UNTA 4JTIA 1KXTA 2XJ7A 1I4NA 2A79A 2J7BA 3MUIA 1GTEA 3G1SA 4WJEA 4POCA 3WSUA 2J78A 1EF2A 5FSEC 2JBMA 3GZAA 1JCMP 3ZZ1A 4HPHA 3FX4A 2FJUB 3H24A 2BHZA 3W82A 3SIZA 4M5PA 4OJYA 1TA3A 5IFPA 1X7FA 2NLYA 4ACZB 2CFFA 3IV8A 4Z1CA 1TWWA 1B31A 3W88A 3BLIA 4HMEA 4IXHA 2O9TA 2YLLA 2NZLA 3OHMB 3LXAA 3UXAA 5L9FA 3AYTA 5A6TC 4AWEA 5CAKA 3TH6A 1PHQA 4GJIA 1VRDA 2VZOA 1Z7AA 2HXUA 2EEXA 4LVBA 1EBHA 2X7WA 4GQRA 2F2KA 1ONXA 4JYDA 3W1TA 4XTIA 5AC4A 3GC5A 3R13A 2CIPA 3QZEA 3ZJ6A 4PMZA 3LRLA 3VX0A 4EF8A 3WO8A 1UD5A 4P8XA 2H3BA 5LA0A 1ZFJA 1YNPA 4TOQA 2J6XA 2GJRA 4R9OA 3AS3A 1J4EA 3U0HA 3OLIA 3O1NA 4H19A 2JQXA 1C8YA 4E4PA 2YW3A 1EPXA 3MUY1 5I3KA 3NXFA 4D9PA 2CLEA 1I60A 3QHNA 3G22A 3SRFA 1KM4A 1IT7A 1YDNA 2Z1VA 4HNTA 3DFQA 1VF8A 2BY3A 4JS3A 1Z48A 3LLXA 2NUYA 1SYTA 2OR2A 3R94A 5DCDA 4J3UA 4IQDA 3UZZA 1SSGA 3OB8A 3CIXA 3N2TA 5DY3A 1Y7VA 3HFTA 4NZFA 4OV4A 1H7OA 2WMJA 3UXDA 1GOXA 2R1LA 4Y9AA 2FGLA 3T9PA 3SY5A 5CZ0A 1HVQA 2VVSA 2VCAA 5HPOA 2OYKA 3PB0A 2VCBA 1E6QM 3WQVA 4L4PA 2Z25A 4H9VA 5D2VA 1KQYA 3N13A 4ZTXA 1R85A 3DUGA 5JBEA 4C6CA 4A8RA 1TELA 3SM0A 3LY0A 1KFBA 4IXXA 2JE8A 3R2GA 4AD4A 2V30A 1M7PA 4QJ4B 4IT1A 3WD0A 3VDBA 2IW0A 2I7GA 1QATA 1SFJA 3H53A 2IPGA 4QS5A 3U57A 3VINA 3NGJA 2OYMA 3L4VA 3BC9A 5EMJA 1JVNA 5I00A 3K4DA 5BXPA 7REQA 4IIGA 3PJWA 3HQ1A 3OGRA 2E4TA 1EXPA 2W3ZA 3LENA 2EPMX 2AGKA 3WF0A 2NX9A 3TA6A 1K9DA 4GI4A 2OPJA 4GY7A 2OGYA 1O5QA 4IL2A 5C9UA 3KBMA 2XSBA 2C71A 3LSCA 1PBGA 3CV1A 1XC4A 2C16A 4GYPA 4OBRA 1PHWA 3DXIA 1EQPA 4HA4A 2Z2AA 3UWUA 2DZVA 3KTSA 2G3FA 3ARSA 3TDFA 4DIAA 1KR1A 2AMXA 3RLGA 1VB9A 4D8AA 3O15A 2PDXA 3QVQA 3AHTA 3DKJA 3LPFA 1R2RA 3MSYA 3U48A 3BV7A 1B4KA 5AHIA 1H51A 3LEPA 5FEWA 4A8LA 5AHEA 5EL1A 4OBSA 5EGRA 5HULA 2NXGA 4LF1A 4HP5A 1LBFA 1HN1A 2FJKA 1HKKA 1UWUA 4O17A 2YIHA 3QMTA 4NXKA 1DWAM 1S2WA 1KFJA 4UNIA 2MUCA 3BSMA 2YZ5A 3H70A 1WP6A 2E6AA 5IFTA 3EWWA 3SRDA 1POJA 4V1YA 2HSAA 3EWBX