4GJ1A

Crystal structure of 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (hisa).
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
242
structure length
229
Chain Sequence
b'TQIIPALDLIDGEVVRLVKGDYEQKKVYKYNPLKKFKEYEKAGAKELHLVDLTGAKDPSKRQFALIEKLAKEVSVNLQVGGGIRSKEEVKALLDCGVKRVVIGSMAIKDATLCLEILKEFGSEAIVLALDTILKEDYVVADKKLMEVLDFYSNKGLKHILCTDISKGVNVRLYKLIHEIFPNICIQASGGVASLKDLENLKGICSGVIVGKALLDGVFSVEEGIRCLAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneam
publication title Crystal structure of 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (hisA).
rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Isomerase
total genus 72
structure length 229
sequence length 242
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2012-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4gj1A00
3CQ0A 2FIQA 4KWVA 1DHPA 5L6UA 4RCXA 2YW4A 4IMDA 4XZ9A 3W74A 2OMAA 4JDYA 3W1XA 1CI1A 4UFJA 4UMCA 3UWUA 5F2GA 4UNLA 5C6MA 1ZALA 3UWWA 4MVAA 1VYSX 1OK6A 4HSNA 5F4WA 3Q2DA 2R8WA 4Y6GA 3NYZA 4I7WA 4U4MA 4GBUA 3YPIA 4LV4A 1THFD 2GQ9A 3DKJA 3B06A 5HUOA 1LROA 3NNTA 5DLCA 1TPEA 6ALDA 2QJIA 3G3DA 2WJZA 3RLVA 4L4MA 1I4NA 2LLEA 3DFPA 5C2XA 1W5MA 2EF9A 2DZSA 2V2DA 4W9TA 4LS1A 4N9BA 1Q6RA 5FESA 4N4QA 1KV8A 1KLZA 2FTPA 3DHFA 3PC0A 3QM3A 3MMTA 1ICPA 1SU5A 2ZBTA 5U7SA 1FDZA 3MHGA 3W7QA 3B0VC 4A29A 1W8SA 2V5LA 1TPH1 1EWEA 1VLWA 1W3NA 1VYRA 1WBJA 2NXHA 4IPJA 3EWUA 3G18A 1FWTA 2X30A 3S6DA 1ZHAA 3B03A 1S3HA 4BI7A 4XQ6A 4Z1CA 4O11A 4QITA 1C8VA 2YR1A 1GYLA 3GXPA 3W7GA 4E0CA 5LNRA 2R14A 3LHYA 5AHMA 1VC4A 4NJHA 1LRTA 1TPUA 2ZZ1A 2J9ZA 3GIYA 1KTBA 3KOFA 3G3MA 3LHWA 2FDSA 1RD5A 2NV2A 4ORMA 4X3ZA 2CLFA 1ZCOA 2TRSA 3G24A 3FIGA 3VE9A 4O19A 1LBMA 1OX6A 4MUZA 4CLMA 1YXCA 4O1CA 3NA8A 1N8FA 1W1ZA 4UFLA 3OVRA 3CEUA 1PV8A 2X16A 2NX3A 2P1FA 3P7YA 2H3BA 4JR5A 3PG9A 3TW6A 5I3IA 3KX6A 1S5VA 2CW6A 4JTHA 3PUOA 1X8FA 2EPHA 1KM6A 1W3TA 4J9JA 3INPA 3W2KA 1RQBA 5G1TA 3CIXA 3WK3A 1F6PA 3W2NA 3LXCA 4FX6M 1X1OA 3ABOA 1J4EA 1VPXA 1OJXA 1EIXA 3LV6A 2V5BA 4JS3A 3HMJG 2VEMA 3IVUA 1XBVA 3WK2A 2ZRYA 1P5BA 3NPWA 4AAJA 5AOUA 1FWNA 4ICNA 4UXDA 4HT3A 3LXBA 2VEKA 5DY3A 4MY9A 3A9IA 1NF0A 1LDCA 4O28A 3L68A 4H6KA 2WQPA 1EA0A 1AW2A 1HO1A 4MLRA 3ABSA 4R7JA 3TXZA 1OX4A 1TV5A 3UXAA 3O6DA 5CZ0A 1K02A 1TTJA 4OHQA 1M5WA 4R53A 4YLWA 3LRMA 4IWWA 1XDLA 5K4XA 1A5SA 5ABTA 4POCA 2WSQA 3MI6A 2B0MA 4QIUA 1EX5A 2ZRWA 5CKSA 4ADSA 1H1YA 4NNCA 2H8ZA 5TBOA 1TTQA 1DVJA 2I14A 2VFEA 4JTIA 3LCGA 5AN7A 3K30A 3SIZA 1ZY9A 4JTUA 2JKPA 3GAYA 4O1AA 3GDRA 4JTTA 3M5XA 1TPVA 3W1MA 2KZHA 2G97A 5K9DA 3W76A 1QAPA 1VCGA 2VXNA 1HG3A 4Q32A 4CCEA 3FKKA 5HINA 4FB7A 3LLDA 2EAWA 2HSAA 4OQVA 4R34A 3GZ3A 4PCFA 1LOSA 2CU0A 2V0TA 5CGQA 4S2BA 3NDOA 4OBTA 4JX5A 3W7DA 4WY0F 4HPJA 3SGZA 4ZZ9A 1QOQA 1H7XA 1NEYA 3UZJA 1W5PA 1M7PA 3P74A 4DELA 2GVJA 1R47A 3O07A 1G4TA 1KFJA 2FPVA 4M7TA 3PUDA 1Z42A 4YCPA 4RLIA 4JGDA 1JCMP 3UQNA 1TO3A 4QSHA 3S1VA 2QCMA 5E93A 2YYTA 1LM1A 3DI0A 3CLMA 3F03K 4LS2A 1JJKA 3W2JA 3W7RA 1F6KA 4E2BA 3LI0A 2E6DA 4JYFA 5E0KA 2VENA 4BF9A 3MW7A 3GXNA 3NR0A 3G1AA 2B7OA 3GKFA 2J9XA 1RVGA 3QEZA 3W7HA 5KINA 2A0NA 1LCOA 1TYGA 3W85A 2R94A 1M6JA 4AHQA 1QPNA 1OX5A 3NEVA 1UJPA 4NJKA 2X1TA 2QCGA 2C0AA 3W7LA 4A21A 3T55A 4MFDA 1J2WA 3TQKA 4FO4A 1EP3A 3KFTA 3PBWA 2C3ZA 3NVTA 3W1QA 1QCWA 3MYPA 1OK4A 3W1RA 5AFDA 2OZ0A 5F1UA 4WY0A 4PODA 5LGXA 4PFMA 4LY8A 4JDBA 1WV2A 3T44A 2NWSA 3MJYA 3QMTA 3GR8A 1LYXA 1SO6A 2QJHA 3NZRA 3ZS4A 1WA3A 1F73A 4GC4A 5D38A 3W7MA 5G4WA 1TV7A 3OIXA 4RZ4A 1JCYA 3A5FA 1BTMA 1QFEA 2JBMA 2EGZA 3IRDA 3BLIA 4UTLA 4UFKA 2H90A 1XI3A 3GVGA 3PY2A 5D02A 3QFEA 1SW3A 1DORA 1RPXA 1F7BA 2J6XA 5AC8A 1O94A 3A5VA 3FJLA 3QMSA 5DCEA 1QDSA 4UR7A 5HMSA 2QUVA 1KTCA 4Z1BA 2R91A 3HJZA 2E6AA 3MUXA 1KLYA 2C6QA 1EP1A 2DZXA 1H7NA 1K7EA 3N9SA 1VZWA 3I6RA 4LS0A 1HFBA 3VFLA 1GVQA 2NX9A 2ATMA 1SFJA 3KVMA 3G1YA 4N4PA 4FNPA 5C54A 4IXHA 4LT9A 1SPQA 4FXRA 4JTKA 3NPUA 1G7UA 5LSMA 4H3DA 5D2XA 3GDLA 4M6PA 1LLZA 3I7QA 3ABQA 4D2JA 3W07A 1AW1A 3HOJA 3C52A 3QQ1A 4NVTA 3GR7A 3EX2A 2E6YA 1B4KA 3NQ7A 1PCWA 4IMEA 1HTIA 3EX6A 4FNTA 3WJYA 3USBA 1ZJIA 2WNZA 2VC6A 1V5XA 1IXPA 5DELA 1FCBA 1SW0A 3EWXA 4UCGA 3G1DA 1WX0A 3DFNA 1EPXA 2BSLA 4IX2A 1P1XA 5FEWA 1A5CA 3G0XA 1KM2A 1TTIA 4M7SA 3P5ZA 4UMAA 1OG0A 3L5LA 3LBCA 3THAA 2C1HA 5DBUA 3O16A 2ZTJA 3W70A 4S2CA 2A1YA 3ABRA 1KM4A 2E09A 3NPVA 1V7YA 3DKLA 2JKEA 3UZ5A 5K4ZA 3B8DA 1VRDA 4AB4A 4N9DA 1VHNA 3HO8A 4NZFA 1O4UA 4LVGA 3TFXA 1H63A 2GJNA 3DXIA 3W1NA 2FB2A 1RV8A 3QPYA 5KMYA 1TPWA 1Z41A 4M5PA 3RU6A 4WOQA 3M1ZA 3MBFA 3EWBX 4WXYA 3LRLA 3EX4A 4BI6A 2VEPA 5KTLA 3T7VA 3L21A 2GVLA 2RFGA 3L5MA 3M9YA 4O8RA 1VQTA 2AQWA 4JNMA 4EF8A 4NNAA 2DZUA 1U5JA 3PB0A 3NL6A 1OVDA 4UTMA 3KVLA 3LHUA 3P84A 2RHGA 4LVDA 1F76A 4JYEA 4FIRA 2QCFA 3LTPA 2P0OA 1KM5A 1K8XA 2W6RA 4K7VA 3KHJA 4XKYB 2CLMA 1GZGA 3G1HA 3BW4A 4U28A 4GUJA 4MY1A 1ADOA 1T96A 2B7PA 5IM51 4BI5A 3L0NA 3LV5A 2RDWA 5BMWA 2FPTA 2Y7EA 4Z1AA 1RQEA 4O14A 3MI3A 3M41A 1DQWA 3OA3A 4AF0B 3N2MA 3W1LA 4NX5A 3E02A 3C6CA 5AHIA 1LLWA 4UR8A 2QCNA 4DPQA 4LVBA 1FCUA 2NLIA 5I3KA 4CQ8A 3SSJA 4MOZA 3W71A 2QCDB 5EBUA 4O52A 2PE4A 2VELA 3M44A 2RH9A 2V8ZA 1GTHA 1GVRA 1K8ZA 3G0UA 2WSRA 3HG2A 2V81A 5F4XA 1H7OA 4HPXA 4LVAA 1I2OA 2V30A 4GE8A 1Q6LA 2AGKA 4MIMA 3TV8A 3M5ZA 1Z48A 1PHQA 2YW3A 1JRCA 4XWUA 2ZRUA 1R30A 4JIQA 3W2MA 3A21A 3DBPA 3THQA 2NXGA 1LP6A 1TCDA 2G5WA 2YFNA 2ZZ5A 1F05A 3DFSA 1DOSA 1PL9A 5BNKA 3H54A 2ISSA 3HQ1A 3W6YA 1XXXA 3W7KA 1RR2A 5F2LA 1LBFA 1QNVA 1S5TA 3GNDA 4LWWA 5MHBA 5DY2A 1BWLA 3W2UA 3M5VA 2V2CA 4MJZA 2H6RA 1MEWA 2VFIA 4FXSA 2IQTA 5CPLA 1X6UA 1I8JA 1NF7A 3LTYA 5G5IA 5LNSA 2WO5A 5G1YA 3JR2A 3GYEA 2Q3RA 1B3OA 3O05A 4UTJA 2ZFAA 5DBTA 4GJ1A 1ICSA 5I3FA 2FFCA 3L5AA 3M47A 5LHEA 5D2VA 3TJLA 2CZ5A 3V75A 1TSIA 3TQVA 5K9CA 4LRSA 1A53A 1OFPA 3GDTA 2QKFA 1K7XA 2VEIA 2A4AA 2PC4A 2Q8ZA 1A5AA 3N2XA 3VCRA 3NQCA 8TIMA 1QOPA 3HGRA 3PSWA 4E38A 3TC6A 2WSYA 1FX6A 1B57A 1OHLA 3STFA 3P67A 1KM3A 4JY9A 3EXRA 4YL2A 3C56A 3DAQA 1TQXA 5U4NA 2A7PA 3FEMA 3NM1A 1HL2A 5F2IA 1TRDA 2A6NA 4MPQA 1DL3A 3E12A 3E49A 5AHLA 1TRIA 3W73A 5LGZA 3DZ1A 3S5ZA 2C13A 3KRZA 1ME8A 1K7FA 3PAJA 5DXYA 3TSBA 3UY7A 2CWNA 1HO4A 3LGEA 1OFEA 1R46A 2Y7FA 1UUMA 4UNKA 3LB0A 3TC7A 4XTDA 1FBAA 3NQ2A 3PUEA 4PA8A 3JRKA 5AYZA 4UTTA 3M6YA 1QPOA 4RR4A 1NFBA 1X1ZA 5BRBA 1FXPA 3DFOA 2XFWA 1KFBA 4LOCA 4N6FA 4EOUA 4PH6A 4BWLA 4AEOA 3C2OA 1H1ZA 4A3UA 2PRLA 1SZGA 1CX9A 1T8XA 2PURA 3P80A 2B7NA 3EWYA 4JD4A 4KFOA 4PC8A 1X7FA 1TPDA 3RMJA 1QO5A 1XUZA 1GQNA 5HULA 4O1DA 2DU2A 3PULA 4YXGA 1ZAHA 1H60A 6TIMA 4UTWA 1NAL1 3W1UA 1SQ7A 5HWMA 2QUTA 2ZZ3A 1VCFA 3UWZA 1IXQA 4OWGA 4ADUA 3BGGA 4NQ1A 2YXGA 2QAPA 5CPMA 1OX4B 3TJXA 5DN1A 5FF3A 1B4EA 3CC1A 4IPIA 5FF2A 3LHTA 4IMFA 2XN2A 4MYAA 3GDMA 1FDJA 1GPWA 5AHNA 2ALDA 3W7CA 4I7UA 1YLVA 3ZWSA 4ZQNA 2GUUA 1I2RA 3PS7A 2DJLA 5EA9A 4O15A 3IGXA 2YCEA 3W2LA 5HNRA 5D2TA 3MWAA 3P61A 5IBXA 3QMRA 4GNJA 4ZQCA 3MBDA 3O1NA 1BKSA 3UXDA 1UASA 1N7KA 3FYOA 3WFAA 3UWQA 1VYPX 3I68A 2FPYA 3TDFA 2WV8A 5A5WA 2RDTA 3ZFHA 3VI2A 3CIWA 3ANYA 5A8GA 1OYBA 3ATZA 2FLIA 4GUHA 4O50A 1JUKA 4ZQPA 2TMDA 3LHVA 4N9EA 4CNNA 3FFSA 1XFBA 1SUXA 4Z0SA 2YZRA 4DO6A 3R13A 3UNDA 1XC4A 3TFCA 3KVKA 4AWSA 1VH7A 5BOOA 2JK2A 3BO9A 1WXJA 3TMLA 3ZWTA 4KKXA 3STCA 1AW5A 3N9RA 3BPWA 3LRKA 1SSGA 2CLHA 3DFQA 3W7PA 4A2RA 3CPRA 3P8IA 3G8EA 1FY6A 3SFKA 1VGAA 1P0KA 4XBSA 1G4PA 3M5YA 4K36A 2PCQA 4UTTC 2Y61A 4NX0A 3G1VA 5HJLA 4TMCA 2HS8A 2Y62A 3EB2A 2VFHA 3PR2A 2VOMA 4Z1DA 3NQFA 3O06A 4O1BA 3BLEA 3LOTA 4E2DA 1UUOA 4IJBA 1YTDA 2CLIA 1JUEA 3QZEA 4BWLC 2W0UA 1T99A 3SR7A 5K9XA 5CG7A 3SZ8A 3BG9A 3Q94A 4RZ5A 2A7NA 4A2SA 4K7YA 3CU2A 1TPFA 2J24A 1OFQA 3G1XA 4B5NA 3M16A 4O13A 4HIBA 2WOQA 1SO5A 4FX8A 4N2YA 3KXQA 3QJAA 3QSTA 1DJQA 2ZZ4A 1JCJA 3RNDA 4JYDA 4ORIA 5AHFA 5KZMA 4JTFA 4UTWC 1D3GA 1IIHA 4HNNA 5EPDA 5LNVA 3PWAA 1PS9A 4IQLA 1UB3A 3NAVA 3HBLA 2OT1A 4IOTA 3IIZA 3TSMA 3TKFA 2ZDRA 2A5HA 2DP3A 4IUOA 3TH6A 4K37A 1AL7A 2E5CA 3E9AA 1XM3A 4UTUA 5FF7A 1MSSA 2UV8G 3UWVA 5IBXC 3B4UA 3WJWA 4JX4A 3WJSA 4NXSA 4TR9A 4O57A 2Y85A 1R2RA 2Z1BA 2BWGA 1I2NA 4AVFA 1IIGA 3GAKA 3LHZA 3UPWA 2C18A 3NG3A 2P10A 5F4SA 2W79A 1LORA 3G1SA 4TX9A 1S5WA 3A22A 3W7EA 2C19A 4M6QA 2V2HA 3BK0A 1FCVA 2I1OA 4N9CA 4RX0A 1DJNA 4LRTA 5LZLA 3W22A 3WK1A 5T26A 2EKCA 2ABAA 2CZEA 1MO0A 4RKAA 4ML9A 1AL8A 3BGJA 4BR1A 1WYIA 2VFDA 4MKNA 5D04C 1T0OA 3ATYA 2EHHA 4I9AA 4ALDA 2JGYA 1H50A 3O63A 1G4SA 5C55A 2CLEA 4MZYA 3NPXA 4OGZA 3QW3A 1YADA 3R5EA 1DKWA 2NUYA 3OBKA 1XBZA 3IV3A 1GWJA 3W88A 4UTHA 1IXNA 2PRHA 3A24A 4AH7A 1QWGA 3C8FA 5CSSA 3GKAA 4CQ9A 5AYXA 3O6CA 2C16A 2OJPA 1OFBA 4LUIA 5K3VA 2DZWA 3WJZA 3RF9A 1KFEA 1UCWA 3QYQA 3PG8A 3I65A 2DZTA 1FWWA 5BW6A 3E96A 5EL1A 3N3MA 3R89A 4AHOA 3RK8A 3C4UA 3SI9A 2GPTA 4MFEA 3IVTA 4DXVA 1ZNNA 1GT8A 2JGQA 1JR1A 1DBTA 3QPZA 1PCKA 4K38A 4BK9A 3S5OA 2E5DA 4FNQA 1TPB1 2RDUA 1PVNA 1TTPA 1I2QA 1TJRA 3IVSA 4ZL1A 3ELFA 3TAKA 2QF7A 1EEPA 4Q33A 1IF2A 3RFAA 3EWZA 3L2IA 2YYUA 3QH2A 3BARA 4S1FA 3PBYA 1H62A 1LRQA 1MZHA 3DHDA 1TREA 3NZ1A 1ZENA 3NL5A 1L2UA 1H7PA 3B05A 3GXTA 3W75A 4LC6A 5FI8A 1LBLA 2VFFA 3U2OA 1Q3NA 3S42A 2OCZA 4HNVA 2CLKA 2ZQ0A 3L9CA 3DFTA 1JCLA 2YGYA 2CFFA 3H55A 2QR6A 3NM3A 4DEFA 3LM7A 1GJPA 4O16A 1E51A 2NXIA 1J5TA 3NQ6A 1F74A 3Q58A 2H8XA 4DBDA 4Q4KA 2QUUA 3HGJA 5LNWA 4NJJA 1GYNA 1RQHA 3CB8A 3DGRA 3SGUA 5D33A 1JUBA 2CLLA 4WXZA 1FUYA 2ZZ6A 3L0KA 4O12A 4C1LA 1UBSA 5TIMA 3B0UX 1W0MA 4IMCA 3TMQA 1ALDA 4XBKA 1OFDA 3QW4B 4R33A 4WX2A 1H61A 3P60A 4N02A 3TUUA 5AHEA 3HF3A 3L65A 1K8YA 2ZZ7A 4O4VA 4LUJA 3STEA 3BW3A 3BLFA 4Z0JA 2OX1A 3PBUA 2BZNA 3BVJA 4RXGA 2YPIA 1LRNA 1D9EA 4OV9A 1QPQA 3BG3A 4LTSA 4O10A 3W7OA 3S0CA 2QDGA 2G95A 4ZMGA 3L67A 2A6LA 4WZHA 1WOAA 4BFAA 3MI2A 1EWDA 1G7VA 3O6YX 3W23A 2FB3A 2NV1A 2Z2UA 4Y9AA 3A23A 1ME9A 3IIOA 4JEQA 2C14A 3S8HA 4AF0A 1TV8A 2Y6ZA 3W72A 2J27A 3CWNA 3LI1A 4O17A 1MXSA 2HTMA 3NO5A 4O54A 5EKYA 2D73A 3E0IA 1KFCA 5H2ZA 5G2IA 3EKZA 3GB6A 3AO0A 2YX0A 3I7RA 1NVMA 2VKZG 3N73A 2O7QA 4FEZA 4O0KA 1GVFA 4UC5A 3W7IA 4RZ6A 1GG0A 4FNUA 3L66A 4Z08A 3W9ZA 4UTKA 4YWIA 3NQGA 3NQ8A 2Y89A 4LNYA 1XBYA 2ZYFA 4WJEA 1O5XA 3WJXA 3CWOX 3FLUA 3FS2A 4UFIA 3TAOA 2B4GA 5GVJA 5EMUA 3NQAA 2Z0IA 5CZJA 3SW6A 3PF3A 1FDYA 3NQEA 2QCEA 3QSRA 1ICQA 2V82A 2YSWA 1KM0A 3WK0A 2HMCA 3ZR4A 4L4LA 2ZA1A 1KFKA 3LCFA 4MZ1A 5CSRA 1BEUA 4TO8A 4UIOA 1AK5A 1LTDA 1VS1A 4JTSA 4K8EA 5KZDA 3TE9A 3V1PA 2AAMA 2BTMA 1MEIA 3TU9A 3NQMA 3N34A 4GFSA 2ZRXA 4HNUA 3EXSA 3G0SA 1XBXA 4GUIA 4DPPA 5KSWA 5I3HA 3R8RA 4EF9A 1YXDA 3H53A 4RK8A 1FCQA 4HN4A 2ZRZA 5FEPA 4CNPA 3W84A 1EUAA 5D30A 1K3UA 1A50A 3IIVA 4IMGA 1F5ZA 4IX0A 2X1RA 3RLUA 1GTEA 5CZSA 1W37A 3KRUA 2GJLA 3SECA 3LLFA 1FWRA 3IGSA 3NXFA 1TIMA 2E1DA 5EYWA 4YCOA 5AB3A 5AYYA 1PIIA 3TCEA 2A7RA 1VHCA 3P62A 5FEZA 4AMAA 1XDMA 3HG3A 3PM6A 3Q37A 3LBMA 3DH7A 3EWWA 1EUNA 3GK0A 4RJEA 5CZTA 4ZQMA 4NXKA 2H3DA 1YPIA 2G96A 2TYSA 1NSJA 5DCDA 1JCXA 2QCCA 3HPXA 5F2MA 1R2TA 1P0NA 3M0ZA 1ME7A 1FWSA 4LC8A 1YDVA 2Z6JA 4N6EA 4GUGA 5D05A 1OABA 3C0JA 1L6WA 1YTKA 4OT7A 3NQVA 3NGJA 1LOQA 1KV5A 1SW7A 3R12A 2OT0A 3P8JA 5HUPA 4LV9A 1KBIA 3W7JA 2XN0A 1SZFA 1JULA 2ZTKA 4MY8A 1FQ0A 2O7SA 3W87A 1KTNA 5G2WA 4QISA 3CM4A 1W54A 1SSDA 1C29A 1VJIA 2ZA3A 4FNRA 4DF1A 4DF2A 1I2PA 2Y7DA 3KVJA 1SO3A 4A22A 4PEKA 2A85A 1TQJA 1TB3A 4O0ZA 1EB3A 2Y7GA 4GUFA 3IEBA 4X22A 5D37A 3W3OA 1KM1A 5D2WA 4G1KA 3M7WA 2DZPA 3OVPA 1OYAA 4K8HA 1WDWA 4JTLA 4CQAA 2Y63A 3S1XA 3B04A 3CHVA 3UPBA 4HKPA 1JQXA 2TPSA 1JCNA 5D2YA 2GVGA 4JIPA 4TU1A 1W5NA 3T78A 1OF8A 3W86A 1OFRA 1H5YA 4MZ8A 5H91A 5FF4A 4QQ3A 3KRSA 1N55A 4DO4A 3C2VA 3G8RA 3S1UA 1QMLA 1HUVA 4Y8FA 4MLJA 4DO5A 1YYAA 1AG1O 3F1QA 3P5YA 1ZAIA 3P81A 5FEXA 3TR2A 3F4WA 4GRSA 1WBHA 4OE7A 5AC7A 2CZFA 3L0GA 3HIJA 3C61A 2J88A 1W31A 1L9WA 1GOXA 3HB9A 4JICA 2Q3OA 3OEXA 4HHPA 3T4CA 3MP5A 1D3HA 5I3JA 5HWNA 2XN1A 2BXVA 1SO4A 4CCCA 2WNQA 3W1AA 1M7OA 2NUXA 4UUIA 3M43A 1AMKA 4HSOA 4LU0A 5J5RA 1YDOA 4RXFA 2DJXA 4UFHA 3LXAA 3O8AA 4I7VA 3FJ6A 5D03A 3TXVA 4OV4A 3HPSA 3TK7A 2NZLA 1LZOA 3U6WA 4ADTA 3I7SA 4QNEA 1SFLA 5KITA 4GXMA 4TMBA 3TW7A 1SR9A 5HQEA 4PL2A 5LNUA 3HGSA 2YDAA 4IXXA 2QEZA 1XL9A 4FHAA 4WY0B 3S1WA 1VR6A 1PE1A 2ZZ2A 3PBVA 2F7FA 3QQ0A 3LTSA 2VFGA 4O4WA 4M6VA 4FX7A 1EP2A 3TIMA 4X9SA 4NU7A 2TSYA 4PL1A 4RV8A 2FJKA 3MP4A 4WUIA 2CLOA 3C2FA 3AJXA 3P82A 1Q6OA 1GG1A 3UWYA 5I3GA 2HS6A 3VKJA 4O18A 5J5DA 4C1KA 5L9FA 4FIQA 1TPC1 1OFOA 5HWJA 3PB2A 2FQIA 1W3IA 1SZNA 2E77A 4LW7A 3R2GA 3JS3A 4UTIA 2F84A 3SJ3A 1K03A 3CT7A 3FKRA 3LERA 1R2SA 4CCDA 4EWND 1XKYA 2ATSA 1QPRA 2X1SA 4MYXA 3EX1A 3N19B 2A2IA 4KFNA 5BMXA 4NUWA 1WAUA 3OVQA 3S9YA 3LCHA 1TJPA 5F1VA 4UMBA 3GLCA 4HNTA 4LVFA 2GQAA 2X1UA 4X2RA 4O53A 4Y90A 3BW2A 3NL3A 3F4NA 5TQLA 2E68A 2E6FA 3EKLA 3LCWA 3DENA 4NZJA 1ZFJA 2ZRVA 5DXXA 2ISWA 1H7RA 3W7NA 4TIMA 1ONRA 3EXTA 3IGUA 1RZMA 3GNNA 1QO2A 1O95A 4Y96A 1PHWA 4ONVA 3TSDA 2CZDA 3W1TA 1Q45A 5CPNA 1L6YA 4DQWA 3MYOA 2WKJA 1KBJA 3GDKA 4ZQOA 3HGOA 2PRMA 1G4EA 3B0PA 2DORA 1VCVA 2GOUA 3O15A 1JRBA 3G22A 3TROA 5AC6A 3PVFA 4EIVA 5EY5A 1QR7A 2B7QA 5LHFA 4GWEA 4XUGA 5D32A 3MHFA 3QF0A 1O5KA 1IGSA 3NL2A 3C2RA 3LCXA 1DQXA 1KFLA 1G6CA 2J9YA 3IIPA 2Y88A 2QDHA 4QJ1A 1C9DA 3C3NA 1H51A 4P2VA 3QC3A 1VLIA 3OG3A 2ZCGA 1Z44A 4WOZA 2JKAA 3LDVA 4AXKA 3U8GA 1XUUA 3S5YA 4ZVJA 1WOBA 3EEGA 3W83A 1IXOA 2NUWA 2QCLA 2ZA2A 3VNDA 7TIMA 1FXQA 2ABBA 1U83A 1KA9F 4NNBA 3TX9A 4CNOA 1Y0EA 5LKYA 5K2ZA 1W5QA 3LCIA 1ZAJA 1A5BA 4MJMA 3T40A 1ML1A 4NJIA 1BWKA 4QM1A 2NWRA 4NT0A 4DBEA 1F2JA 4ZQRA 3HG4A 2BLEA 5SWUA 2WNNA 2Y70A 2NX1A 2DZVA 3UYCA 1OYCA 5K7JA 2BX7A 5FF0A 2Z6IA 4FF7A 4AWTA 2Q8LA 4UFMA 1TMHA 3NOEA 3HG5A 2QAFA 1YPFA 3UD6A 1YTEA 5KZEA 3G1FA 1JVNA 4JXCA 1O60A 3S5NA 4KFPA 4P61A 3N14A 4K39A 1DV7A 5HR6A 1KW1A 4YMZA 1OF6A 3FYPA 3TQ0A 2QCHA 2A21A 3STGA 1MEHA 3UY8A 2RKXA 3EX3A 4IGHA 5C5YA 2I9EA 4AWUA 4JTEA 3CTLA 4XTIA 1L6SA 5G2HA 2E5BA 4JN6A 1G69A 3QRHA 1XCFA 4WQ6A 3MP3A 3SY5A 3TA6A 1H7WA 3D0CA 3W1PA 4QAIA 3MO7A 4QNWA 4JTGA 1GVOA 2ISVA 3NQDA 4JY8A 1I45A 3BG5A 1G67A 4H4IA 1SZEA 4KWWA 4K6AA 3IIXA 4NJGA 5CPOA 3DU0A 1Q6QA 3VE7A 3LX9A 3DI1A 4WD0A 3FA5A 3MHUA 3BV4A 3OHIA 2C15A 3C2EA 3FOKA 4AHPA 1YDNA 1LOLA 4XKYA 5D09A 1WQ5A 4PTNA 1P4CA 1W5OA 5E1QA 3GX9A 2V9DA 1W56A 2WPBA 1B9BA 3TNOA 2QJGA 1CW2A 1OFAA 4JTJA 3KAOA 3LCLA 1GEQA 2GQ8A 3CEPA 3PSVA 5HR7A 4OU1A 4M19A 4FNSA 1JQVA 2X2GA 4JX6A 5G4EA 3HPZA 4DF0A 2YFOA 4EVZA 1YXYA 1GVSA 5DCBA 2QCDA
chains in the Genus database with same CATH superfamily
3E2QA 3BV7A 3LEPA 4XZ9A 1RK6A 3V16A 2FGBA 1S3TC 4PB5A 3EA3A 4IPPA 3KOYA 3UWWA 4MVAA 1VYSX 1JCTA 3GS6A 5F4WA 1L8PA 1KBBA 1R8LA 4U4MA 4AD2A 4GBUA 3IACA 4LV4A 2GQ9A 3DKJA 4DY1A 1XRSA 3K8KA 1LROA 3ID7A 3K1GA 4TV6A 5DLCA 4FR6A 1MXGA 4F79A 3IJQA 2X41A 1UKQA 2R9RA 3G3DA 4Q8VA 3WQ5A 3IRSA 4GKLA 4L4MA 2BGQA 1QBAA 1V08A 3B8VA 4HU8A 2EF9A 4CEXC 4N9BA 5FESA 4H7CA 1EX1A 1KV8A 1KLZA 3IWPA 3N2CA 2FTPA 3VKDA 1IR2A 4IIHA 1EQPA 3MHGA 1PBGA 1QW8A 4A29A 3JW7A 4I9JA 3I3EA 2Y24A 1VYRA 2NXHA 3W53A 1KD0A 1X96A 4ZO6A 3S6DA 1ZHAA 5A6AA 4BI7A 2DUZA 4XQ6A 1EH9A 4O11A 2DZBA 4PUMA 4U10A 4M51A 1VPYA 4JTQA 6A3HA 2VGIA 3R6IA 2R14A 1UC5A 2IUZA 4MSSA 1XF0A 3T08A 3LHWA 1IEIA 2XUCA 4LUTA 4KWOA 3NZQA 1RD5A 2NV2A 4ORMA 2CLFA 1F3EA 2TRSA 4IICA 3VE9A 1OX6A 4CLMA 1M1BA 1N8FA 1EO5A 2EPLX 3CEUA 4AIEA 2VGGA 3DERA 4BQ4A 3TW6A 1ONEA 1E4MM 1G01A 3KX6A 3PUOA 1RAKA 4LCQA 1X8FA 1XS2A 1BRLA 1OT2A 3WEMA 2CIPA 4J9JA 3W2KA 2WYSA 2BOFX 3PZ9A 1RQBA 2VZVA 5G1TA 2WWDA 1SJCA 1VFSA 4J3SA 3PJUA 3ABOA 4P8VA 2HISA 1JZ7A 2CXGA 4JNYA 1B3VA 1LUCA 1VKFA 1XBVA 4U31A 4AZIA 3NPWA 1NM9A 5AOUA 4GQGA 4DAIA 4E3VA 1CXKA 2VEKA 3TWAA 4UOJA 1JZ5A 3AJ7A 2XTKA 3WF4A 2DSWA 1HO1A 3WFLA 3MCMA 4R7JA 1A5KC 3WF2A 4EAYA 1I1XA 1TTJA 4RE0A 1UOKA 1TZ7A 1H0GA 1BLIA 2B0MA 2HDJA 2ZRWA 3CYJA 1UUQA 4AVNA 1EGVA 5HMDA 3S2LA 2DSKA 4IIGA 4JTIA 5AN7A 4I9MA 1BYBA 4JTUA 2JKPA 3SURA 1V02A 4REQB 3W1MA 2KZHA 2PMQA 1A4MA 2VXNA 1W8GA 1EC9A 2PC8A 3AWNA 4PTXA 3FKKA 4PUKA 3FW6A 4B5XA 2PAJA 1E9ZB 3EPMA 2CU0A 5CGQA 3SY1A 1E71M 2NW0A 4OBTA 1E9LA 3BOFA 5M03A 5BRQA 4HPJA 3WLIA 1ELSA 2UY4A 2VJXA 3UZJA 4GCXA 1M7PA 8RUCA 4DELA 4AD5A 4RLIA 2O0TA 4JGDA 1JCMP 4AYSA 2ZADA 2HPMA 2YYTA 4PR4A 3DI0A 3TZNA 5JIWA 1V0LA 4E2BA 4F0KA 4JYFA 5E0KA 4H8HA 5JUVA 3KCOA 5CJNA 3NR0A 4DI9A 2HVMA 5BWAA 3MUIA 3WF0A 1PWMA 2J9XA 3W7HA 1WXYA 3D3AA 4PUWA 1OCJA 4AW7A 1HIZA 1OX5A 4QG9A 2VL4A 4YVPA 3M0YA 4A21A 3T55A 4GYPC 4MFDA 1J2WA 4ASTA 1BF6A 5EBAA 4UZUA 2O9TA 3PZNA 5JMUA 3MYPA 3NXLA 1F3WA 1IR1A 3W1RA 1EOKA 2OZ0A 5F1UA 3E3HA 3F4CA 4PFMA 2VQTA 3UYIA 3M0XA 5J8LA 2NWSA 3GR8A 1UC4A 3H2FA 1SO6A 2QJHA 3ZS4A 1WA3A 3L4YA 1VFHA 1L6FA 2RJGA 1TV7A 4K8GA 3A5FA 4M24A 1GOQA 3RPDA 1BTMA 2EGZA 3IRDA 4UTLA 4UFKA 4AISA 4EPKA 3DN5A 3OG2A 3QFEA 4GO8A 1JPDX 1DORA 3AXMA 3CS2A 5AC8A 4C6EA 3A5VA 2EPMX 3QMSA 1DIKA 1QDSA 2E0PA 5HPCA 9XIMA 5BXSA 1V8EA 4A6GA 2R91A 2O9RA 1EP1A 3MVTA 3MUAA 2DZXA 1GOIA 3N9SA 3WBEA 1IQ8A 4RE3A 3EDJA 1QJWA 1MUMA 4N4PA 5BXRA 4FNPA 4IXHA 3AXKA 2I5GA 3T07A 1KQZA 1XIGA 3R8HA 3GDLA 3BAXA 4IISA 3UG3A 4R7WA 2YDRA 1PKYA 1UR2A 3NQ7A 4CD8A 2IPFA 3QV8A 2QV5A 4C5ZA 1PIFA 1MRQA 4FNTA 4OUEA 3QOKA 3WLPA 3UG8A 2BBFA 3EPOA 5E09A 1Y8BA 4OTKA 4UCGA 2PDLA 3BJSA 3DFNA 1GOKA 3KBWA 1M9HA 1KM2A 4UMAA 3MTWA 1OG0A 3THAA 2C1HA 2VP8A 4IFKA 4HHHA 2ZTJA 4ZENA 3TN6A 1PTGA 4NHVA 3T8LA 7TAAA 1XLLA 1U1UA 1KM4A 3NPVA 3DKLA 4TQTA 1VRDA 1XGEA 1ZGDA 3ABXA 1VHNA 3ENLA 3HO8A 1O4UA 4ZB0A 1EJRC 3TFXA 3B8WA 1H63A 3DIPA 4V2XA 3FX4A 3W1NA 4WRHA 5KMYA 4L56A 2EG7A 5C9WA 3B9DA 1TPWA 1Z41A 1J18A 1TFVA 3TLLA 4ENLA 3AIBA 4DJFD 2PFHA 1XLHA 3WF1A 1RK5A 4J3WA 4WXYA 2ZUTA 2DVTA 3MZNA 3T7VA 4DYJA 2UZ9A 4GZIA 4NP7A 1OD8A 3FXYA 4DXXA 4LVDA 2RHGA 1F76A 2QCFA 3LTPA 4K7VA 4QG6A 3KHJA 1KXTA 3G5EA 4DJFA 1FWIC 2CLMA 3G1HA 3VKCA 3ZYZA 1T96A 4IQDA 2B7PA 3FGCB 3L0NA 1GKPA 2RDWA 1R6WA 4O14A 1Q6EA 2OLSA 2IPJA 4DLMA 3N2MA 1LLWA 2OEMA 1MI3A 4AZGA 4N7QA 4IIDA 1GUVA 3UJSA 4JCLA 4MOZA 1XLGA 4MB1A 3TZFA 2CESA 5CQ1A 3OZMA 3M44A 2PDUA 1UJQA 2V8ZA 4QDMA 3UGRA 2PA6A 3HG2A 1QRQA 1DIEA 2V81A 3T2PA 1ZP4A 1DWJM 1XSKA 2V30A 4GE8A 4IG2B 1VAHA 1NQKA 3TV8A 3M5ZA 1Z48A 1BGAA 2XVKA 4JIQA 5FL0A 3A21A 4HU4A 1EJXC 4IIFA 2HEJA 3BDKA 2IQDA 4AY1A 1E55A 5LA2A 2ISSA 1XCWA 1VB9A 2DZAA 3W6YA 2P76A 3LPPA 1XXXA 3VMNA 4UB9A 1LBFA 1QNVA 4HQVA 1UR0A 4BJHA 3NOYA 4C1NA 2XWEA 3BCDA 2VRJA 4MJZA 2H6RA 2VFIA 2IQTA 4LXFA 1H0IA 2X7WA 3GYEA 1B3OA 3O05A 4UTJA 2ZFAA 4AYGA 1VIZA 1YNQA 4GJ1A 4PFHA 3WLSA 5I3FA 5LHEA 3OB8A 3VTRA 2WQDA 3TJLA 3KHDA 4QDWA 2SFPA 1TSIA 5K9CA 4LRSA 5DT5A 1A53A 2XVPA 3IPWA 1OFPA 4DZHA 5BZAA 3H8AA 2QKFA 3WSUA 3N2XA 3IJ8A 3HGRA 3UZXA 4E38A 3N4EA 3S9IA 1SJBA 1B57A 4LAKA 3P67A 4OUIA 4NL1A 5D9MA 3EXRA 3QY8A 1V93A 3M0HA 1Q63A 4MPQA 2ZDSA 4AEFA 2XWDA 2OX4A 1GJWA 5LGZA 1UQZA 1FKWA 3KRZA 1ME8A 3PAJA 4HK6A 3U3HA 1R46A 4QEHA 1UUMA 4ZOEA 3AIVA 4UNKA 3PUEA 1RA0A 1EGZA 4UTTA 2WCAA 4RR4A 3UA4A 3L4UA 4IJCA 3ARZA 3NTYA 5CLWA 4BWLA 4AEOA 2R1PA 3FDKA 4A3UA 1WXZA 1LL7A 2QIIA 2VTFA 1P7TB 1Z89A 3UF9A 1CLKA 1E0VA 5HULA 3PULA 4YXGA 3LYEA 3D47A 3QV6A 1GW9A 2J7BA 3TJXA 5CC3A 5DN1A 5FF3A 3LHTA 1A3XA 3OO2A 5AHNA 2ALDA 2JE8A 2GUUA 1GGOA 5EA9A 3FDGA 3W2LA 1HXJA 5D2TA 1PKMA 4CQDA 3BLOA 4GNJA 4XKMA 3O1NA 1M7XA 4JTAA 2G3MA 4UR9A 3BMVA 1XGDA 4MB3A 3TYBA 3WFAA 1FFRA 2INFA 3RR4A 1VYPX 3I68A 3I4KA 4IQEA 1RBAA 4ZCWA 2RGLA 5TD4A 3ZFHA 3VM7A 2CEQA 4XAZA 3QVQA 3ANYA 4KWUA 4HOXA 5A8GA 5LA1A 3L4XA 5CGMA 2Y0FA 1RBOB 4ZQPA 2QYGA 4BHYA 1ZTVA 2F2HA 4Y8EA 5CXPA 3AIRA 3R13A 3FV9A 5I3DA 2A3LA 3TFCA 3KVKA 4AWSA 2PGEA 1E0WA 1RLCL 3BO9A 3AHZA 3V5OA 3TMLA 3VUPA 3ZWTA 2WBGA 3ITXA 3W7PA 4O1EA 4GIRA 4O8AA 5FJTA 3G8EA 3SUTA 4KEVA 1LWHA 1G4PA 3M5YA 1PO9A 2X0SA 4ZOCA 4F2TA 2HS8A 4HGXA 1V3HA 3NQFA 4O1BA 1EDGA 3ERPA 3LOTA 1UKTA 4IJBA 1H41A 3QZEA 1OWQA 4IL2A 1N82A 4GY1A 1JZ4A 2YLAA 3BG9A 3Q94A 4A2SA 3CU2A 4PBGA 2ZXDA 3BC9A 2PWVA 3M16A 4O13A 2DUXA 4HIBA 4FX8A 3KXQA 3KP0A 1DJQA 1Y5VA 3ZJ6A 1JCJA 4B3LA 3EYPA 3L4ZA 4JYDA 3T1GA 2XINA 3TR9A 4QRNA 4HNNA 2AL2A 5CSUA 2OELA 3W4RA 5AECA 4WVXA 3ZOAA 4XIAA 1HN1A 4S3BA 3IIZA 3LS9A 3I3DA 4IUOA 3TH6A 4F0SA 1XM3A 3H26A 5IBXC 3B4UA 2G3IA 4TR9A 5A69A 1R2RA 1FWFC 3FK4A 1GVYA 4AVFA 3NG3A 4ACZA 2O4MA 1LORA 4CD5A 4TX9A 4M6QA 3BK0A 1TR9A 5A2CA 3W22A 5B80A 1XD1A 2YA2A 3IGHX 4MWAB 5HMEA 2CZEA 8A3HA 3VZZA 1AL8A 1HJUA 2PLCA 4B4FA 2VFDA 2YLLA 1T0OA 1ONWA 4LYQA 3URBA 4ALDA 1UWAA 2GGGA 3NPXA 4U2YA 1R7AA 1PZ3A 1J0IA 5M3WA 1QBBA 1DKWA 4HCDA 3K4AA 3DYOA 2GDUA 1MQRA 4M80A 4B5TA 4F48A 1YNYA 1W3HA 4N42A 3WNMA 4K68A 4PMXA 4AH7A 5CBBA 3DGBA 4G9PA 3GKAA 3PZGA 5IXEA 2OJPA 4V1XA 2UY5A 3S5SA 1FWWA 5BW6A 1E1EA 4AHOA 1SMAA 3T8QA 1CGUA 2FZDA 3U48A 3SI9A 3BSGA 3IVTA 3BLDA 1ADSA 2JGQA 1PCKA 3W37A 3GDBA 2E5DA 1TPB1 2AOSA 3S3GA 5EFDA 3RRAA 3SM0A 2FVKA 1JDEA 4ZL1A 4XK2A 4PTMA 4GX9A 1XIMA 4QR6A 3TAKA 4Q33A 3L2IA 5CGTA 1TWDA 5CJ5A 4HMDA 1T6MA 3CB3A 4FSAA 3GXTA 5E9XA 3II1A 3C0QA 2VVNA 1Q3NA 1VRXA 3S42A 4FXJA 3DC0A 2HROA 5A2AA 3NVDA 4QP0A 1R3WA 2CFFA 1A5MC 2QR6A 3L4VA 3WEZA 1A5UA 1WUEA 4DIAA 3BTNA 1JXJA 2O4QA 4O16A 1FTXA 3OQEA 1R9XA 1SFSA 4FALA 1V51A 4TTUA 3Q58A 4DBDA 4Q4KA 3MCOA 2YCLA 1RQHA 3DGRA 3B0YA 5HK4A 1JPHA 2ZZ6A 3L0KA 4O12A 3RIKA 4PTWA 3GH4A 1J2BA 3QTGA 2WAGA 3M0IA 4XD3A 1JXKA 3HMCA 5GNXA 3TTEA 3P60A 4WKFA 4B15A 3HF3A 1V3JA 2VEFA 2ZZ7A 4O4VA 4LUJA 2ON3A 1O7AA 3STEA 3MKKA 1DJIA 1Z3NA 3ABZA 3PFRA 4RXGA 4RW3A 2PSNA 3CHFA 4RNFA 1D9EA 4OV9A 3W7OA 3BG3A 5H6HA 3MMDA 2RUSA 2QDGA 4ZMGA 4DWSC 5EU9A 1WP6A 2YJQA 1ZBVA 1G7VA 2FB3A 2Z1KA 4G5DA 4Y9AA 1ME9A 4JHZA 4D72A 2C14A 3IK2A 4UQCA 3W72A 3IUIA 1JD7A 4BA0A 1MXSA 4MNJA 2HTMA 3UR8A 4XZNX 1G1YA 3NO5A 1QNOA 5EKYA 3EKZA 3URNA 2XJ7A 3ICJA 3K1DA 1DQUA 1VIWA 2VKZG 1ZBCA 3UXIA 4KIEA 4FEZA 3N6QA 4O0KA 1RXOB 1E0XA 2YA0A 4D6GA 4XO6A 4WKAA 4FNUA 5HXMA 2Z29A 3BAIA 3NQ8A 2Y89A 3WJXA 3CWOX 1AD1A 4UFIA 2PDJA 3S1GA 3TC3A 3N04A 1I0BA 4AD3A 5EMUA 4M0XA 1YNPA 1JYNA 4Q4RA 3SW6A 5E0FA 4MJ4A 1HKWA 3AI0A 1KFKA 5H1WA 3Q67A 1BEUA 2ALRA 3I6EA 1O6IA 4LSBA 3WUBA 2DIEA 4JTSA 1EJSC 4GFSA 1EC7A 4GUIA 4DPPA 4H1ZA 1J8VA 1Y7VA 4HN4A 1XLEA 2ZRZA 4MB4A 4L6HA 3A3WA 3W84A 1EUAA 3IIVA 4UQBA 1H5VA 3KDNA 4BF5A 4BY3A 3RLUA 5RUBA 2OB3A 4ERIA 2OU4A 3M0LA 3GC2A 3LLFA 1FWRA 3IGSA 5LIYX 3PZTA 1NDZA 5AB3A 3N12A 3CL7A 2A7RA 2ZUWA 3UESA 1VHCA 5KEZA 4HB7A 1XDMA 3PM6A 1B54A 2XIIA 3DH7A 2J6VA 3U57A 2D0FA 3VKAA 1VBRA 2H3DA 2G96A 2TYSA 1JCXA 3EAUA 3AISA 4URIA 4ZFCA 2VZTA 2YL6A 1HJXA 3ARYA 4D6JA 1RCXB 3KL5A 4LC8A 1LWJA 2EJAA 2Z6JA 1XIIA 3WMLA 1HVQA 1B90A 1LOQA 4KIRA 4NZ1A 3N9KA 1KBIA 5HJYA 2X40A 2XN0A 1TV4A 4UQEA 4MY8A 3EA1A 2O7SA 4QGCA 4M3PA 4H2HA 3MKVA 4R27A 3WNOA 1Q4WA 2P8CA 4DF1A 2WM1A 4KCVA 4GABA 4U5KA 1RUSA 2QMJA 3CPGA 3VD4A 3RM8A 4WCJA 1WKYA 3D46A 3RITA 3GU2A 2A85A 1TB3A 4O0ZA 5E5CA 4PE8A 5A6SA 4X22A 1KM1A 5D2WA 1E0TA 1XPYA 3TTQA 1WDWA 4HA3A 4OOZA 3IAQA 3B04A 5GJNA 4HKPA 1JQXA 3MWCA 2OOFA 2TPSA 2WC7A 5GNYA 5D2YA 3TP4A 1P6WA 2GVGA 4JIPA 1BVZA 4TU1A 3SIMA 1OFRA 4MZ8A 3D5HA 2PDNA 1RVKA 4PBEA 4QQ3A 3KRSA 2YIHA 3C2VA 2CC0A 1HUVA 4Y8FA 2NQLA 1UH2A 4B90A 4DO5A 2DPEA 3W81A 1JDFA 4LAMA 1ODUA 3PJXA 2PWFA 4LF2A 3KBMA 2YB4A 4OE7A 1NWUA 1MFUA 2VZOA 4UNIA 1IEWA 3C61A 2FVLA 1W31A 3AZTA 1GOXA 4M56A 5EMLA 4HNLA 3MP5A 5HWNA 5T9CE 1SO4A 4J7RA 4J3VA 1AODA 1M7OA 2FMOA 3U4AA 4UTFA 3M43A 4G7EA 4LU0A 1TX2A 4AZ5A 4RXFA 4UFHA 5CH9A 4I7VA 3TXVA 1L8NA 3TK7A 1FH7A 5DMLA 3UP8A 2CKRA 4B3ZA 3BLPX 4IP7A 3Q65A 3I7SA 4QNEA 5KITA 1CLVA 4GXMA 2W5FA 4TMBA 4P5UA 1GKRA 1HF6A 4KRTA 4LB3A 4FHAA 3WQEA 3QQ0A 2WMFA 4O4WA 1JFHA 1TG7A 1MW2A 1EP2A 1SGJA 4L1XA 4PL1A 2FJKA 4WUIA 2CLOA 3R25A 3ZJKA 1NDYA 2JEQA 1GG1A 3V7PA 5J5DA 2DDXA 3E2VA 1MUCA 3CV6A 2VO5A 1CGWA 1VFLA 3K8MA 3BQ5A 1TJ2A 2FQIA 1POJA 2P5NA 1XSJA 5EMYA 4LW7A 2QNEA 3FKRA 3FJNA 2WVUA 2ATSA 4MYXA 2FZ9A 2A2IA 3TN5A 4NUWA 3GYCA 3S9YA 5F1VA 3GLCA 5E6ZA 3LG3A 4X2RA 4O53A 3BW2A 1TZ9A 3AZRA 3F4NA 4BEUA 2E68A 3EKLA 4ZTYA 3H7VA 2FH8A 5LXXA 2ZRVA 5DXXA 1R87A 4GC3A 5BOFA 2WHKA 1F3XA 2WBKA 4DWSB 3WD2A 1H2JA 3IJDA 2PI6A 2HQAA 1KKRA 1O95A 3EWDA 1EZWA 3GHRA 4ONVA 3TSDA 1Q45A 5CPNA 2VC5A 4DQWA 5F7UA 3MYOA 1B3WA 1JNEA 1KBJA 3GDKA 2J47A 1LL4A 1OIMA 3L2MA 4P8XA 1IEQA 2DORA 2GOUA 4LYRA 5AC6A 2PWUA 2YOCA 1TKKA 1M41A 2B7QA 3G6MA 4XUGA 5ABGA 2DT2A 2FGZA 3MHFA 1UH4A 5C7HA 2XGIA 2XSXA 1V6WA 4TV5A 4BZYA 2J9YA 4LBSA 4QJ1A 1C9DA 4ERAA 2R1MA 1VLIA 2WM0A 1E3ZA 1GKQA 4WOZA 4GZ7A 4GLEA 3BUVA 1PSCA 3VVGA 3MY9A 1TR1A 1WO2A 7TIMA 1KBKA 2AMXA 3ZSTA 2VCCA 3WY1A 2X1IA 1MWOA 5LKYA 1IWBA 4BEQA 4W8BA 4MJMA 2PF0A 4DBEA 2VGBA 1YW1A 2WMHA 2BLEA 1EBGA 4J5NA 4PMOA 1TMHA 3HG5A 2QAFA 1YPFA 3PPHA 6ENLA 3AIUA 3SCRA 1JVNA 2OLAA 1QNPA 4DXKA 5TF0A 2V3FA 2QCHA 4JFVA 3STGA 2F61A 1XSIA 3UY8A 2RKXA 3EX3A 3QZ6A 2NT1A 2I9EA 2PDYA 4U3AA 3HFTA 5HBFA 4JN6A 3QRHA 1XCFA 1H4PA 2QJJA 4WDTA 3CLWA 4WDUA 3AXHA 1A49A 1R9ZA 3OJGA 2BY1A 1HX0A 3GVWA 1G67A 3DYPA 4H4IA 1SZEA 1Q6QA 4PMNA 3VZXA 5ABFA 3DESA 1CXLA 5DX7A 2Y5SA 3MHUA 3FOKA 3OBAA 1JYXA 1C3FA 3CAKA 1LOLA 1W6TA 3RU8X 4CU7A 1P4CA 4QLJA 5EGRA 2WMIA 2V9DA 3E2RA 4FR1A 1B9BA 5AYIA 2MUCA 4IIEA 1NELA 4CN1A 4JTJA 3RYSA 1TE6A 1ZBKA 3VX1A 1GEQA 1V3IA 4LJ3A 3GG0A 4E4PA 2EBNA 3FY1A 1TIWA 2D2OA 4FNSA 3QC0A 2PDKA 4JX6A 5G4EA 4XZHA 2YFOA 1YXYA 3K13A 2E8YA 3TN4A 4KCWA 3CQ0A 3CASA 1DHPA 4B9ZA 4RCXA 2YW4A 5D9NA 4JDYA 3W1XA 1CI1A 4UMCA 4QAWA 5CG0A 1CB2A 3UWUA 4LAZA 2PLJA 1CECA 4IFRA 3NYZA 2A3BA 3B8TA 1THFD 3B06A 3ISIX 2WK2A 2HVNA 3NNTA 1XIDA 1TPEA 3GBDA 1ADDA 3DG3A 2D24A 6ALDA 5E6YA 3CZGA 2WJZA 4U33A 4IF2A 1I4NA 2LLEA 3ZLHA 1W5MA 2DZSA 2NVDA 3VDCA 4LF1A 4HTYA 4W9TA 4H9YA 1Q6RA 1YRRA 3T0BA 4EKJA 4H7ZA 4GH3A 2CNCA 3W7QA 1J0KA 4A8RA 1TPH1 1VLWA 3FHAA 3O6AA 4IPJA 2GGEA 2X30A 2WWCA 2FGLA 2Y2WA 3KEHA 3IUDA 1GYLA 2DW7A 2E40A 2C1IA 3N15A 1FRBA 3UWEA 3A64A 3GE7A 5CPSA 1ISZA 3EOUA 1LRTA 1TPUA 3BAWA 2J9ZA 3DCPA 3VINA 2GFTA 4ZSUA 5T8GA 3E0LA 2ANUA 1R3YA 4X3ZA 1TX0A 3GXFA 3PN8A 2J7HA 1LBMA 4MUZA 2HJPA 3NA8A 1BSIA 3BAJA 3CUJA 1CBGA 4UFLA 3OVRA 1PV8A 3K5XA 2X16A 1XC6A 1JAEA 1NTHA 4EXQA 4JR5A 2H3BA 1RHCA 5I3IA 2C7FA 1S5VA 1E6RA 3MANA 3QYSA 1CCWB 1J0ZA 4PSRA 5AVNA 1EXPA 4DJEC 1J12A 4H6EA 1OCBA 4RPQA 4NSBA 4JN7A 4ICMA 4JAWA 3ITOA 4WJ8A 3CQHA 1F6PA 3W2NA 2BP1A 3PZIA 3WK3A 1X1OA 2Z27A 1OJXA 1EIXA 4JS3A 2ZOXA 3GRIA 3WK2A 4YS1A 2ZRYA 1W3JA 3H12A 1I60A 4AAJA 2XIOA 2ASHA 5DY3A 4YTTA 1NF0A 1LDCA 3L68A 4W8LA 1AW2A 5BCAA 3ABSA 3GW3A 2ICSA 3TXZA 1FWDC 1OX4A 3UU0A 4LX4A 4CQBA 5CZ0A 4HHMA 4OHQA 2FZBA 3LRMA 1NWTA 4RDVA 1A5SA 3O0KA 3URAA 4POCA 3MI6A 4QIUA 4ADSA 5FSDC 4QFUA 4JFUA 4B91A 5TBOA 3M7SA 5A2BA 2OEJA 1DVJA 2I14A 2VFEA 2P3EA 4Q4PA 2D3NA 3K30A 1ZY9A 3FA4A 1MXDA 2I7GA 4JTTA 1TPVA 1CEOA 3B8IA 1HG3A 3SADA 1GQLA 4HJWA 2WZHA 1ZRQA 5FACA 4FB7A 2EAWA 2HSAA 3PZUA 4R34A 1LOSA 3RM9A 2AL2B 2GQ3A 2DFAA 4S2BA 1O68A 6REQB 3VGEA 4OIFA 3W7DA 4WY0F 3I10A 4ZZ9A 1QOQA 4NRSA 1LG1A 3P74A 4E2OA 1R47A 3O07A 1G4TA 4M7TA 3C2YA 3G77A 3BMWA 2OKTA 3S1VA 2QCMA 5E93A 4F8XA 5J04A 4KRZA 4HK7A 2F9RA 3CLMA 4LS2A 1AQFA 1JJKA 3W2JA 2XSAA 3LI0A 2E6DA 1V0NA 1VBHA 5ECUA 4BF9A 3MW7A 4DX3A 3GXNA 3CUGA 1R5YA 1E1CA 4LB4A 3RX3A 1B9ZA 1UD3A 1ITCA 4B92A 2B7OA 5BXTA 5KINA 2VX5A 4L6DA 1FWCC 2A0NA 1LCOA 2BVTA 5C9UA 1GNXA 1F6YA 1MRAA 4IHCA 1Q5MA 1QPNA 3RR1A 1UJPA 4I8DA 2QCGA 2C0AA 3W7LA 4PMDA 4FO4A 1W1A1 3KFTA 4ILSA 1QCWA 2XVNA 3BAKA 4WY0A 2P0IA 3PZVA 4LY8A 4EACA 2YCKX 4FOJA 2OO0A 3CZLA 1TMQA 1B3XA 1S2UA 2F38A 4LQ1A 5EFFA 5G4WA 4JBRA 2GJPA 1E43A 1QFEA 1XV8A 1J6OA 4QLKA 2E3ZA 4W85A 2VX7A 3PY2A 5D02A 3VNZA 1W9PA 3SCPA 1SW3A 2J6XA 1O94A 3FJLA 1QHOA 4W8AA 2QUVA 3S6TA 1ZCCA 3D3FA 4O0QA 4PRRA 3SCNA 1ZJAA 1K7EA 1MW3A 1RJPA 4LS0A 4A4AA 4Q6JA 1HFBA 3IV8A 2ATMA 4L6OA 1SFJA 2D0GA 3N13A 4FLQA 3HV9A 3ZMRA 4FXRA 3MV11 3UCCA 5A6JA 3KL3A 1G7UA 5LSMA 3MQTA 5HDRA 5D2XA 4M6PA 5JBDA 1VJZA 4V27A 1RCQA 3WH9A 1LLZA 3HOJA 1PX3A 2CCRA 3GR7A 3EX2A 3AHYA 3NJ3A 1B4KA 3MKCA 1PCWA 2W66A 3VOFA 4IMEA 1HTIA 1YBQA 3EX6A 3WJYA 3SCSA 3USBA 3EBVA 3ONBA 1AVAA 4GVIA 1ZJIA 3QGAC 2WNZA 2VC6A 4BCEA 3GTXA 4HMNA 2GDQA 1O1HA 1X97A 2HBXA 4ZEPA 4Q4OA 2AKZA 4EWJA 3H2NA 3H7RA 1EPXA 4IX2A 1P1XA 5FEWA 1TTIA 4E6MA 5DBUA 1FHVA 3RRXA 3KW3A 3W70A 4S2CA 2Z28A 4F3HA 4HN8A 3SN4A 3GIQA 2E09A 1V7YA 3LZ5A 5CZKA 1BTCA 4NZFA 3VU2A 4LVGA 1GHSA 1QI0A 4J4KA 5AC4A 3C86A 4JPGA 4M5PA 2POTA 1BSLA 4C7DA 4WOQA 3M1ZA 4R5EA 1O5QA 1UH3A 4XG1A 3PZOA 2P50A 4HBKA 2QDDA 5KTLA 5HATA 2J4GA 2RFGA 4EF8A 3RXZA 3WEOA 4J2PA 1OVDA 5C71A 3KVLA 3B8SA 4FIRA 4XSMA 3R11A 5LYRA 2P0OA 3CO4A 5DQPA 4GUJA 4MY1A 1ADOA 3HJEA 4HYRA 1R3SA 2Z2AA 4D6EA 2Y7EA 4CUCA 3H2CA 4L1WA 4Z1AA 2ISDA 3NDYA 1D8CA 4O1FA 3CV1A 2BGSA 3M41A 1DQWA 2QGYA 3CGTA 3W1LA 3C6CA 3SO7A 2WSKA 2QCNA 2RDXA 3R7MA 4DPQA 4LVBA 2OZ3A 2PU1A 2NLIA 1TWZA 1QHZA 1X98A 3W71A 2PE4A 2UWFA 2RH9A 4Y9MA 1K8ZA 3BLKA 5F4XA 3C3UA 1H7OA 4JL2A 1A80A 4HPXA 1E6SM 1V3KA 1I2OA 3AFBA 1SVDA 1KCLA 3WMCA 3CWHA 4OVXA 3APTA 2ZRUA 1M68A 3VD9A 2G5WA 1TCDA 2ZZ5A 4KS0A 1AJ2A 1DOSA 1PL9A 5ABEA 3TQPA 1JFXA 1JF5A 1OT1A 1VEMA 4LUSA 1C9WA 2ADAA 3V0UA 3VUSA 1RR2A 1MW0A 1Q8JA 3V0TA 4LWWA 1BWLA 4GINA 3M5VA 5CC6A 3R0UA 5CPLA 3LTYA 1XLBA 4U2ZA 5LNSA 5G1YA 3JR2A 3MC5A 3A4JA 4GQQA 3AIQA 1D7KA 2CZ5A 3D6NA 3TQVA 1IHIA 2BV9A 1K7XA 2VEIA 2A4AA 3N2TA 1A5AA 1WDPA 3S2NA 2WSYA 1FX6A 3T81A 1FWAC 3U2EA 1OHLA 2WLYA 1AJ0A 4W4QA 3A6OA 3DAQA 5U4NA 2EPKX 3FEMA 1TRDA 4X61A 2A6NA 3KTXA 1OIFA 1EZ2A 1DL3A 3E12A 3SUUA 4D8LA 1XYMA 4XVDA 1K7FA 5DXYA 3TSBA 1ECEA 1HO4A 2CWNA 2Y8VA 3MSDA 2Y7FA 3LB0A 3TC7A 3BOXA 2BHYA 3TYZA 1FBAA 3NQ2A 3JRKA 2BXYA 5AYZA 4L4OA 1QPOA 1FHLA 1C8YA 4FOUA 2OQLA 3N3TA 3UXLA 2XFWA 1K8CA 5JH2A 4LOCA 3C2OA 1SR0A 1W2VA 3C5QA 3UVAA 1T8XA 2XISA 4ZOAA 5DF0A 4PC8A 1SYTA 3WL1A 3ITLA 1BAGA 1GQNA 2D2GA 4O1DA 2OR2A 2E25A 3IAPA 4V1YA 1H60A 4G56A 4UTWA 2C79A 3WN6A 5H8PA 2GUYA 1XYLA 1S2TA 2YXGA 3PTDA 2VD9A 3RMEA 2PU0A 1B4EA 2NQZA 1P48A 3GDMA 1LL6A 1FDJA 3W7CA 4EPBC 2J78A 3PS7A 2YCEA 3TONA 3P61A 1TELA 4ZQCA 4E8CA 1XR2A 1UASA 4JZ5A 1N7KA 3GWQA 1NY1A 4S3DA 1UA7A 3UWQA 1UR3M 2FPYA 2ZXAA 2WV8A 4A3YA 2WLZA 2OKOA 3BGAA 3M0JA 3BSHA 4QG8A 1X6LA 2X42A 1OYBA 2DVUA 3SCUA 3AMLA 4G7EB 4N9EA 4CNNA 1XFBA 4GD0A 4Z0SA 3AIWA 1BXCA 1XRVA 5BOOA 3U2CA 3OGSA 1JDDA 5B7YA 1KB3A 2ONEA 2XZ9A 2IMRA 3WH7A 3LRKA 4QDPA 1FWGC 3APGA 4X60A 2OSWA 1U30A 3WMBA 1YKWA 1VGAA 1P0KA 3PPCA 1Y65A 1DE5A 3ZVHA 2VT0A 3BAYA 1US3A 3B9NA 4NX0A 2R24A 5HJLA 3DFHA 4DYKA 2NVCA 1JIBA 4Z1DA 2XH7A 1UZHA 4MG4A 1CZ1A 2FHBA 4QQUA 4MNKA 2NQ5A 1TZZA 3R94A 2W0UA 1T99A 3NYDA 5K9XA 5CG7A 3AS0A 2ZX6A 5G1MA 2A7NA 2WMKA 1TPFA 2J24A 3I4EA 4B5NA 4D1JA 2WOQA 2R1NA 3VCNA 5CC7A 2Z1VA 1XYBA 3B9OA 3RNDA 4JTFA 4Q8NA 5KETA 2ZE0A 1IIHA 3BE7A 4EXAA 4CNSA 3PWAA 4IQLA 1UB3A 3GU1A 2Z7GA 5CCZA 5IFTA 2J7CA 2DP3A 4X0NA 2J79A 1GONA 4K37A 5GNZA 4LH8A 1K4HA 3T09A 2PWHA 4F0LA 1MSSA 3VIIA 3EMZA 4I6VA 1HKJA 3WJSA 2Y85A 3PK7A 4X0VA 1J11A 2Z1BA 1I1WA 2PGFA 3LNPA 2BWGA 2YB1A 3QTPA 3GAKA 4BS0A 2VDIA 1CYGA 5F4SA 4NILA 4B2DD 1VBUA 1U22A 2V2HA 3VX0A 4GYFA 4WSJA 1F8IA 1DJNA 4LRTA 3WK1A 3M07A 5E0CA 4MNLA 2EKCA 4C65A 4ML9A 2CBUA 5DFAA 3VNJA 4H7VA 1WYIA 3ATYA 1Q13A 2D0HA 3Q45A 4B2DA 1FWHC 2CLEA 1PDZA 3QW3A 1YADA 3RPMA 3ITTA 2PP0A 3LA4A 5HMFA 4KWSA 1GPFA 1TWWA 3IV3A 3W88A 1IXNA 4Q7NA 3C8FA 3WNPA 1WDRA 1IT7A 5AYXA 4W5UA 4AZCA 3NSXA 2C16A 5K3VA 1JGMA 4XB3A 2DZWA 4TTGA 1HL9A 2X7VA 1PB0A 4JHOA 3SQLA 4A8LA 4HHLA 3E96A 3N3MA 3CHCA 3RK8A 2PDQA 4QSFA 2GPTA 4FZIA 4CQCA 4MFEA 4TX6A 3ZLFA 4DJDD 2VDHA 1HKIA 2XH2A 3KLKA 2YZ5A 3W01A 5I24A 3VNYA 5KZ6A 1NH6A 2RDUA 2HE5A 4L9YA 4KF1A 1I2QA 1TJRA 4B5UA 4Y9NA 3K46A 3ELFA 3WDJA 2QF7A 4HU3A 1UZDA 3IJ9A 3GNRA 4GI6A 1C7TA 3BARA 2QVNA 4S1FA 3PBYA 1LRQA 1MZHA 5DMNA 4DJDA 2DH3A 3NZ1A 3NCOA 1ZENA 5JVLA 1L2UA 5FJRA 5FI8A 2OCZA 4HNVA 3TVAA 2JF7A 3L9CA 3DFTA 2YGYA 4ES4A 1EO7A 3H55A 3H2OA 4RPPA 3NM3A 5ABFB 3F7JA 4A3RA 3CK5A 2NXIA 4D6IA 3WBXA 3OQ8A 1F74A 1DJGA 2H8XA 2QT3A 4NJJA 4WKHA 3FEQA 4DUWA 1GYNA 1ZS2A 1NOUA 4EANA 3SGUA 5D33A 4AU0A 4WXZA 1KXVA 1A0EA 1UBSA 3B0UX 2OGYA 3S2JA 4GACA 1DWIM 4AWEA 1SJDA 4IMCA 4W89A 1HJWA 1O5RA 1ZUAX 1XFCA 1WB0A 2XH4A 4N02A 4R9OA 3TUUA 5AHEA 3L65A 4JOMA 3UFYA 3BLFA 4Z0JA 4ZXOA 2OX1A 1ITXA 4J2MA 5CBIA 3QQWA 1PXGA 4L80A 3OLDA 5MKGA 5H8MA 4LGXA 1V02E 2VCBA 1B1YA 5HNUA 4AZHA 4LTSA 3CNYA 4O10A 4PUNA 2G95A 1FHDA 3ZR5A 2A6LA 4WZHA 3ARPA 5BWFA 1UZ4A 4BFAA 3TYAA 1HJVA 2Z2UA 3P6LA 4CVWA 3B8UA 3S8HA 1US0A 2Z1SA 3LI1A 4O17A 1WUFA 1E40A 1RSCA 1AJZA 2D73A 3WLTA 2BFGA 1UWIA 5H2ZA 1R86A 2FHCA 5G2IA 7ODCA 3GB6A 3AO0A 2YX0A 1WAWA 4NZCA 3N73A 3ARXA 2O7QA 1W9VA 4L9ZA 2G3NA 1BG4A 4L61A 1QNSA 2V6AA 3NQGA 4YWIA 5LIKX 4LNYA 1XBYA 2IXVA 2VUYA 3FS2A 2OO6A 1NJJA 3POCA 4HU0A 3PTKA 1GOOA 3TAOA 4OECA 5GVJA 3KS5A 2D2HA 1PKNA 3PF3A 4LAOA 3NQEA 2QCEA 1ZB5A 4XZLX 2YSWA 3WK0A 3MT1A 3NUKA 3ZR4A 4L4LA 3MS8A 1R3QA 1RALA 4UIOA 1FFQA 4PCNA 3AIEA 4K8EA 5KZDA 1VS1A 1P0EA 2PODA 2AAMA 3N34A 3VXGA 3WUFA 3WD1A 3VIJA 4HNUA 3EXSA 5I3HA 3R8RA 4EF9A 1FCQA 5DT7A 2POZA 3WUEA 4ZSTA 4W88A 4YPJA 1W3KA 5D30A 1K3UA 4IX0A 2X1RA 1F9CA 3U4FA 4LCSA 3RO6A 3KRUA 3LU2A 3MZ2A 2F6XA 4J35A 4E8DA 2DT3A 4IM4A 1TIMA 3W29A 1PWLA 2E1DA 4J40A 3WQ4A 5AYBA 1UIOA 3OOQA 5AYYA 2XIMA 4MF4A 3TCEA 4ZO7A 3P62A 2VC7A 5FEZA 3LBMA 3GK0A 4RJEA 4GKTA 3VOCA 5DCDA 1ZSXA 5F2MA 1P0NA 4JQ2A 1DJYA 3WNLA 3GM8A 3M0ZA 3UZWA 5A8MA 1Y5WA 4Z2JA 8XIAA 3VDHA 2RAGA 4GUGA 5D05A 3C0JA 4K3ZA 4QCFA 4B9YA 3NQVA 1KV5A 3R12A 1HGYA 3P8JA 3QHOA 4W93A 3BQ6A 1JULA 3PJWA 2ZTKA 1LQAA 1XHGA 1FQ0A 3H2MA 1KTNA 4QISA 1SSDA 2ZA3A 4FNRA 3T2OA 2EG6A 2WKGA 2Y7DA 5M5DA 3KVJA 2IW0A 3ZT6A 3SCWA 4C6CA 2Y7GA 1J10A 4GUFA 4JN8A 1EHNA 3W3OA 4WK9A 4G1KA 2VWSA 2FHFA 1P43A 1LG2A 4IJRA 3N11A 3N2OA 2QW5A 3T0TA 1E70M 1W5NA 1ZZMA 2TODA 3W86A 5H91A 2PDMA 5FF4A 4Y7EA 2O9PA 4DO4A 3S1UA 3OW1A 1XLMA 2G3FA 3TYCA 4UQAA 1YX1A 3P5YA 1ZAIA 5FEXA 1E9IA 5D9PA 3L12A 3AWOA 3L23A 2J88A 1KGWA 3HPFA 5HJXA 2Q3OA 1VFUA 4B16A 4HHPA 1A47A 5IHRA 1S2WA 5I3JA 2XN1A 4NAFB 5EMJA 3WQ8A 3WQOA 1E1CB 2EXOA 3GHUA 1XWYA 3VIFA 4I5RA 1YDOA 2DJXA 3O8AA 3CBWA 3AROA 5D03A 3B3DA 4OV4A 4DYEA 1QK2A 4YWSA 1DWAM 3P2VA 4ADTA 1WZLA 1K9DA 1SFLA 3ZVIA 3TW9A 3TW7A 8XIMA 1SR9A 1XD0A 2YL8A 1MQPA 1XIFA 3TEVA 1YHTA 4B5WA 1XL9A 3S1WA 4WY0B 1VR6A 1QUMA 2XZ7A 2KAUC 2XYLA 3TIMA 2IKGA 4D6CA 3CZJA 3MP4A 3AJXA 4TVDA 4XAGA 1IWAA 3P82A 4A8IA 5I3GA 3SAZA 3MUCA 3NZGA 2F6UA 3O9NA 4WGXA 1A5OC 5HWJA 2J8GA 3PB2A 4EPEC 4CCZA 2YL5A 1W3IA 2E77A 1ODZA 4RE4A 3BZJA 1YE6A 3R2GA 4GISA 3JS3A 4GXWA 3SJ3A 2F84A 4L7ZA 4GFIA 1R7OA 4EWND 3EX1A 2DV0A 4KFNA 2VCAA 3LCHA 1TJPA 1PEZA 4UMBA 4HNTA 3RCNA 1AZ2A 2OSYA 1I75A 1RY8A 4UQDA 2REQB 4ZBCA 4C6BA 3EB4A 2ISWA 3LN3A 5FL1A 1B0IA 3GHSA 3PPGA 3GG7A 2ZWZA 1R38A 2PD9A 3EXTA 3IGUA 1Q7QA 3DYMA 4Y96A 1CGVA 1UWTA 2FH6A 3JZUA 4D9PA 4AG0A 3DUGA 7REQB 1AQMA 2VMFA 4HD5A 4ZQOA 1E4LA 3OA5A 3W27A 1G4EA 3ARVA 2Z1XA 3R58A 2C91A 1T7LA 3QY7A 3O15A 2VRQA 4G1NA 2Z4GA 1JRBA 3G22A 3PVFA 4EIVA 3COTA 4GX8A 3GBEA 1TMLA 2W62A 3QF0A 2W9MA 1O5KA 3CT2A 1UYQA 2PLMA 3WLQA 3IIPA 1YDYA 2Z7KA 2QDHA 1A0DA 1H51A 3VIMA 3MA8A 3CO8A 4AXKA 3U8GA 1XUUA 3FA3A 1WOBA 3W83A 3OGRA 1MNZA 2ZA2A 3NGFA 3VO0A 1FXQA 1U83A 1KA9F 4NNBA 1I9CB 2CBIA 3KL0A 1Y0EA 2OEKA 1MVYA 3RN6A 6XIMA 3LCIA 4AC7C 1Y5XA 3F4VA 1EF3A 2ZXBA 3WLKX 1A5BA 4NJIA 1BWKA 3GW0A 2NWRA 4QJ5B 2Y70A 5FF0A 4AWTA 4UFMA 3R0KA 1NQ6A 4E5TA 1EC8A 1QWKA 4A3QA 5KZEA 2ODOA 1O60A 3S5NA 5ABHA 4NYYA 1DV7A 5HR6A 2VR4A 1J0YA 3TQ0A 2AKMA 2Y4SA 1PIGA 2BHUA 4IGHA 3DC8A 4KGLA 2BNJA 5C5YA 4H19A 3CTLA 1LJYA 4XTIA 4K2SA 5I5RA 2HWGA 4XAPA 1R85A 1GZ1A 4F4RA 1OG6A 1G69A 2PZNA 3MP3A 3SY5A 1T40A 4F0MA 1H7WA 2OZTA 2Q02A 1BFNA 1BQGA 2ISVA 2ZICA 3NQDA 4JY8A 5DANA 3RO8A 3B4YA 3VGDA 3R10A 4NJGA 4TX8A 3THCA 3VE7A 3UCDA 3LX9A 3DI1A 4L1GA 1B5TA 3BV4A 1AQ0A 4LUSB 3QR0A 3WDHA 1NIUA 3E74A 3FGCA 2CPUA 1FWJC 3BANA 3GQYA 3OYZA 2IXUA 3SRKA 1CW2A 5D9OA 4MWAC 3KAOA 1FKXA 2GDVA 3GTIA 2EKGA 3RJXA 3CEPA 5HR7A 1FH9A 4ERGA 3TJIA 4JTDA 3WDIA 4GHRA 3W6LA 1JQVA 2X2GA 3BSMA 1OGBA 5DCBA 3VGGA 1ISYA 4KWVA 2PDCA 3S83A 3VNMA 1XIHA 2NQ9A 3GUGA 3W74A 3ALGA 2OMAA 3CXOA 4NZ4A 5F2GA 1YE4A 4UNLA 2PBOA 2BVWA 1AFSA 5FCZA 3L7RA 1UBPC 2X09A 2XPKA 2R8WA 1GQJA 4I7WA 4PCPA 1FVPA 4TUFA 7XIMA 5A8QA 1M03A 5FJPA 5HUOA 2XFYA 2VWTA 2PTXA 1DJXA 2PUZA 1V79A 1OM0A 1J0JA 3RLVA 3PJTA 4FAMA 3WZ0E 2BMBA 3DFPA 5C2XA 2Y8KA 1H3GA 3TLQA 3GU9A 3CUZA 4LS1A 4N4QA 3H2EA 3ARUA 3E5BA 4MTVA 3BMXA 3QM3A 1VEPA 1UD6A 1ICPA 5DRIA 1K9FA 1ITQA 3LQLA 5A6TC 3VK5A 3HQNA 1BXNA 2BDQA 1W8SA 4G8TA 2V5LA 3AZSA 4F0RA 1W3NA 1X7IA 3EWUA 3HU7A 3G18A 1FWTA 4AZ7A 1O12A 3B03A 2I5QA 1EXBA 6CGTA 1RP8A 3FVDA 4Z1CA 3WD4A 3GUWA 3U0HA 1JI1A 2YR1A 5A8NA 1UD5A 3BICA 2QJMA 4NJHA 2ZZ1A 4PRWA 4GH1A 2G4FA 1KTBA 3KOFA 2VYOA 3G3MA 3PAOA 1NP0A 5TAOA 4OBRA 3AMKA 3G24A 3FIGA 4O19A 1WCGA 3W24A 2CERA 4O1CA 4EPDC 1W1ZA 1MDLA 3XISA 5XIMA 3RDKA 2NX3A 1H1NA 2J7DA 2O56A 3PG9A 2CW6A 4C6JA 1XIEA 4WGHA 2MANA 1GORA 4CN4A 1MW1A 3NO1A 4DUOA 3ANUA 1HP4A 4GYPA 3INPA 2I57A 3FVMA 1E4IA 1P7TA 3CIXA 2PDPA 3QHNA 3LXCA 2WSPA 4FX6M 3F5JA 1VPXA 1UPMB 1SFTA 3E0WA 4RNJA 3LV6A 5EMMA 1WZKA 2BOGX 3ZSSA 5EB8A 1P5BA 3ECQA 3ZR6A 4HT3A 3LXBA 1EA9C 3ZZ1A 4KEUA 4MY9A 2WZEA 5A3HA 2WKLA 2WQPA 1EA0A 4MLRA 1V03A 3L4TA 3EOEA 3UXAA 3LZ3A 2PWGA 3ZVHB 2OQYA 3G2GA 3HM7A 2AAAA 4IL0A 1EX5A 1A4LA 5CKSA 3UVIA 1WDDA 2WC3A 1OCNA 1JGIA 1OZQA 3SIZA 4DWDA 4F2BA 1IZJA 4IGNA 4KEMA 3B97A 4Q4SA 2E9BA 3M5XA 2G97A 3CQIA 3W76A 1VCGA 1UG6A 2J62A 2ZVRA 4Q32A 2YCIX 3U2ZA 5HINA 4R9XA 5CAKA 1PAMA 4OQVA 1VENA 5JBFA 1KKOA 3H21A 3NDOA 3SGZA 4JKMA 4W7WA 2DGAA 3CZ8A 1KFJA 4ZXLA 2FPVA 4C6QA 3PUDA 1Z42A 3WENA 4YCPA 3GNXA 1IEVA 1UIPA 5E9AA 1GOWA 2WZIA 1TO3A 4QSHA 3IJLA 5C9ZA 1E0UA 1LM1A 1XX1A 4JKLA 4GI9A 3R0DA 3VABA 2IPWA 3BWWA 3F03K 3BL3A 3W7RA 3WQDA 1F6KA 4AXNA 4DVOA 2VENA 3OBEA 1ENUA 3UR2A 1RVGA 3QEZA 4Q22A 2YXOA 1X39A 3P93A 1PDYA 4PULA 3EDFA 4MNMA 3LD5A 4LANA 2R94A 1M6JA 2DQWA 3SBFA 4AHQA 4US6A 1VBGA 4Z17A 3RPTA 5T91A 3EZ4A 3CQKA 5JIPA 2Y1HA 3G6LA 1KC7A 2GL5A 1EP3A 4V28A 5I0DA 3PBWA 2C3ZA 4OKDA 3W1QA 2QLYA 1TWSA 2DSVA 3W6MA 4PODA 5LGXA 3MJYA 3QMTA 1JYVA 1LYXA 1F73A 1L2QA 5D38A 2RJHA 1KRMA 2XM2A 4E8GA 4RZ4A 4W84A 2AQVA 3NWRA 4S3GA 4XAFA 1BYAA 4YTRA 2JBMA 3CJPA 1BKHA 3BLIA 1GYMA 1XI3A 3ITCA 5IDZA 1PYMA 4U5IA 5A6MA 3GVGA 1Z8AA 3VC6A 4G2DA 2NQHA 1F7BA 1B30A 1K9EA 5C0QA 2XGBA 3S2CA 5HMSA 4Z1BA 1V77A 2GYIA 1KLYA 4AX6A 1H7NA 3OLEA 3F5LA 3I6RA 3VFLA 4I3GA 2YBTA 4HZMA 3G1YA 2DT0A 1CXHA 1SPQA 1XIBA 4JTKA 1EIBA 1ISVA 2CBVA 3IUHA 3VFCA 3MDWA 1M65A 3S4TA 3ABQA 2PTWA 3W07A 1AW1A 4XZBA 1DWFM 4NVTA 4QJ4B 2HRWA 2E6YA 4GK8A 1XG3A 1M04A 3WLNA 5BXPA 4JFWA 3WBYA 1S2CA 1V5XA 1NFGA 3AS2A 4E4FA 2P88A 3XIMA 1SW0A 3EWXA 4XV0A 1N2VA 2G8ZA 3E38A 3ZQ9A 3G1DA 4P7LA 4QS6A 2BSLA 2UY2A 4H00A 3R8GA 1A5CA 2H9AA 4AY8A 1DXIA 4M7SA 3KS6A 3L5LA 1J01A 1B2YA 5FOOA 4HTBA 3B9EA 3UJ2A 2FDMA 3O16A 4H9ZA 3AMCA 2A1YA 2C71A 2JKEA 1QPKA 3REQB 4AB4A 4PBFA 3I3BA 3DXIA 2FB2A 1RV8A 3QPYA 1AH4A 3F2BA 1PKLA 2J8FA 9RUBA 3GNPA 5FIPA 1MFVA 3QN3A 3RU6A 1T41A 2CLPA 3B9AA 5I07A 3MBFA 2C8NA 3EWBX 3LRLA 3G1RA 4BI6A 2VQUA 4NKCA 2IQ0A 1S2AA 1VQTA 7ENLA 4NNAA 1U5JA 1TV3A 2PDHA 1XH0A 4ROQA 2ZX5A 4XX6A 3K4DA 4KGJA 3P84A 1PTDA 3DX5A 2D1ZA 4UOQA 4JYEA 5MKGB 4NY2A 4GNVA 3R79A 4HOZA 1K8XA 4XKYB 2AGTA 1GZGA 3BW4A 4HPNA 5C9RA 1TUXA 1S46A 5FJIA 5IM51 3MVIA 4BI5A 3AS3A 1SJAA 5BMWA 2GSHA 1RQEA 1K6AA 4PCSA 4MPKA 3WQPA 1OSEA 2AL1A 4NX5A 3E02A 2WVVA 1CTNA 5D4YA 1J79A 5AZ1A 2YL9A 3UNTA 1MUWA 3UERA 1FCUA 5I3KA 2QCDB 4M29A 3VD3A 2HXTA 1US2A 2VELA 1H11A 3PZQA 1GTHA 3VGHA 1CGXA 3G0UA 4CKQA 3ZLGA 1JZ8A 3HPAA 3VDGA 1Z69A 3A4WA 4F9JA 1BXBA 1NWSA 1ZJBA 2BVYA 3JVAA 4XWUA 1R30A 1OZMA 3W2MA 3DBPA 4ZB5A 3THQA 3HA1A 5BU6A 4XZIA 3VIKA 3H54A 2YBVA 2IKIA 3MUY1 3GFXA 1LT7A 1CWYA 2R1LA 2ZWYA 1PPIA 4Q7BA 3W7KA 5F2LA 2PP1A 3FSUA 5MHBA 5JU6A 3W2UA 1Q85A 2V2CA 4DO7A 1MEWA 1X6UA 1NF7A 2BXZA 5G5IA 3FYYA 2QPUA 3CUIA 5DBTA 1A3HA 2ZX9A 1UMLA 3OYXA 3EDEA 3GC4A 3MB9A 3VMPA 3WIJA 5FJJA 3VIHA 3M47A 1F61A 3DG6A 1PZ2A 2R1KA 2VZUA 4B4HA 2PCEA 4X9YA 1TUFA 4HYWA 3V75A 1JAKA 1E56A 3SUVA 3GDTA 2PC4A 4FOKA 3AUJA 3NQCA 1QOPA 2WXDM 5AC5A 4PMJA 4PUDA 1BGGA 4MKSA 6XIAA 3CZEA 3STFA 3VM5A 1CENA 4JY9A 4YL2A 2PP3A 1W17A 3C56A 3VNKA 3GR4A 4NI8A 5F2IA 2WB5A 3RLGA 1V6XA 4DJFC 4RV3A 3ANVA 2BS9A 5AHLA 1TRIA 4J28A 4LUTB 1OC5A 3AQUA 1BVWA 2C13A 2J66A 3SRFA 2DSZA 5ENLA 3E0FA 2GGIA 3E6EA 3MSGA 4H04A 3NSNA 2VDGA 2OYMA 1E3XA 1SZRA 3M6YA 1NFBA 2OXNA 1X1ZA 2BB0A 3HFYA 4DBWA 4P7RA 3DFOA 1KFBA 4H8NA 2XFFA 4N6FA 1BRLB 1G9HA 2WJDA 1QI4A 4AX7A 5LXEA 1H1ZA 4D6DA 2PRLA 1SZGA 1EEXA 1TJ0A 4PUEA 2PURA 2B7NA 4HNCA 4JD4A 4KFOA 1X7FA 5FD0A 3RMJA 1QO5A 1XUZA 4GGHA 1LUCB 1ZAHA 3PWGA 3KBNA 4YHGA 1SQ7A 2VR5A 2OLHA 3LENA 3WF3A 7A3HA 1VCFA 4L9XA 2Q09A 3QOMA 3UWZA 1IXQA 4OWGA 4ADUA 3MMWA 3BGGA 2PEVA 4AD1A 3MCNA 2QAPA 4U3CA 2FKPA 2XDFA 2ZC1A 5CPMA 3FHQA 2XH0A 2NV9A 4MYAA 4JCMA 3K8LA 1YLVA 4ZQNA 1I2RA 1V6YA 5CJMA 4JQAA 5HNRA 1DXFA 3MWAA 4DBSA 5IBXA 3CL6A 4IZGA 4G6CA 5FAJA 3OODA 1CNVA 3FYOA 3CPUA 3TDFA 1NARA 4GYKA 2RDTA 3CMGA 3VI2A 3WNKA 3CIWA 3EEZA 2FZMA 2Z00A 3T0DA 4H83A 2INEA 4GUHA 4O50A 3E0VA 4C6IA 3LHVA 3FFSA 5DRCA 1E15A 3EKGA 2YZRA 4DO6A 3UNDA 1DXEA 1XC4A 3RHGA 4MAZA 1VH7A 4FI4A 2JK2A 1P6BA 3CUHA 1F07A 4LEFA 3TWBA 4I5UA 3EWCA 4PRTA 2V63A 4Q7IA 3DFQA 4Q8OA 3SUSA 4A2RA 4QBXA 2YCJA 4CNUA 3P8IA 4D71A 4D8AA 2QF8A 1FY6A 3SFKA 3EOSA 3F5KA 4XBSA 2PTDA 2XU2A 2ZIDA 3QPEA 2PCQA 2W92A 4UTTC 2QHAA 2Y61A 3G1VA 4W5ZA 3PUGA 2JIWA 3EB2A 2VFHA 9CGTA 3PR2A 1I6NA 2VOMA 2GOKA 3V36A 3O06A 3BLEA 1WZMA 4E2DA 4PYSA 1E4NA 4S3JA 2CLIA 1JUEA 3AALA 4BWLC 1X8CA