1D3GA

Human dihydroorotate dehydrogenase complexed with brequinar analog
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
367
structure length
360
Chain Sequence
MATGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DIHYDROOROTATE DEHYDROGENASE
publication title Structures of human dihydroorotate dehydrogenase in complex with antiproliferative agents.
pubmed doi rcsb
source organism Homo sapiens
total genus 138
structure length 360
sequence length 367
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 1999-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1d3gA00
1EIXA 1QR7A 3B04A 3DZ1A 2QEZA 4AF0B 1A5AA 3SGUA 3B4UA 1S5VA 4RKAA 4MY1A 3QJAA 3CIXA 3I7QA 1FUYA 3P84A 4MUZA 4UTHA 4FXRA 2V9DA 4X2RA 4IXXA 2A4AA 3WJSA 4OQVA 3W7MA 2FPTA 4WXYA 1W3TA 3FIGA 3L0GA 3NQVA 5D04C 1H62A 1F5ZA 2E6FA 5AYXA 2Y61A 4WOZA 3VCRA 1FWNA 1OFDA 2NXIA 1XFBA 4HIBA 3ZS4A 1WBHA 4KWVA 4UTLA 1W37A 3ELFA 4JGDA 6ALDA 3S8HA 3F1QA 2BLEA 3C61A 3S5YA 3QF0A 2VEPA 4ZQMA 3W7RA 4DPPA 3G1FA 1T8XA 1TPDA 4KFPA 1W5PA 5LNSA 4CQAA 5AHEA 1FDJA 3RK8A 5DY2A 1Q6QA 1S5TA 2I14A 1QPRA 1ZNNA 1TSIA 3LRMA 3O06A 1Z44A 3NVTA 3P67A 4M7TA 4O1BA 4BF9A 2A85A 2WO5A 1HG3A 3IGSA 1JCMP 3BV4A 2H6RA 3FYOA 3L67A 2JK2A 3DFPA 2J88A 3M9YA 2YX0A 3W7IA 4O14A 2AAMA 5BMXA 5G1TA 3P82A 4MFDA 1SFLA 3WFAA 4S1FA 5I3FA 3RF9A 4IMFA 2Z6JA 1OABA 2GQ8A 3C52A 4FB7A 1SSDA 1ICQA 1LZOA 2ZYFA 2IQTA 2ZA1A 3BGGA 4Y6GA 5EKYA 4IQLA 1TTQA 3BARA 5F4WA 2E5CA 4PEKA 2CLMA 3L5MA 4O10A 3UZJA 4LRTA 3NQ2A 3EX2A 3W73A 3PM6A 1F6PA 4TMCA 4OU1A 1DBTA 4IOTA 4GRSA 4N02A 5FESA 1GJPA 3EWBX 4H3DA 3SIZA 3P80A 3RFAA 5FEPA 2A2IA 1D9EA 2DZXA 3DENA 4R33A 2YFNA 1OFQA 3EXTA 2PC4A 3PS7A 3O1NA 1RQBA 4A2RA 3M6YA 5KTLA 2Z6IA 4JICA 1KBIA 3GXPA 2QAPA 2RDTA 3PAJA 3W74A 1H7WA 4YL2A 1GVSA 3LBMA 3THAA 3HG5A 3R13A 2UV8G 5FEZA 1O5XA 3M5ZA 2QDHA 3NOEA 5T26A 3DFSA 4DXVA 3R5EA 3GAKA 2QCLA 4PA8A 1U83A 3L0NA 2DZSA 3GDLA 2BXVA 3VFLA 3Q94A 4WXZA 1SFJA 3PSVA 3DI1A 1SU5A 3DFTA 1Z41A 4MY8A 4P61A 4AAJA 5BRBA 4K7VA 3R2GA 1UASA 1F74A 3BW2A 4RJEA 3D0CA 4UUIA 2YSWA 3LTSA 3DKLA 3BPWA 1ZCOA 2TPSA 3M44A 4DPQA 1OG0A 2C16A 2FFCA 4FNTA 2A7PA 1C8VA 5HINA 1QO2A 2BTMA 1XL9A 2YPIA 2I9EA 5AHFA 1P4CA 1XDMA 1ZAHA 1XBYA 4JTFA 1LP6A 4RX0A 1J5TA 2ISWA 5KZDA 1XUZA 5GVJA 4AWTA 1VLWA 4GUGA 4WJEA 1UUOA 1P5BA 1W3IA 3H54A 4X3ZA 5AOUA 2DZTA 2YYTA 3BW4A 1H63A 4BI5A 4CNNA 3RMJA 2A6NA 1H7OA 2ZRVA 1W1ZA 2XFWA 4LVDA 1VPXA 4IMGA 1XBXA 1OX4A 7TIMA 4S2CA 4O53A 3TROA 4O19A 2YR1A 2JKAA 3N34A 3N3MA 1R2RA 3QC3A 3TIMA 4CQ8A 3KRZA 2CU0A 5CZ0A 1RQEA 4X9SA 1YXCA 2Y89A 3UNDA 1R30A 3QZEA 1QOPA 3NEVA 4R53A 1Z42A 3PBYA 4K8HA 2NV2A 1YPFA 2JKPA 3W7EA 1U5JA 4PL2A 1QPQA 4I7UA 3O6YX 1ML1A 2W0UA 3M47A 4FX7A 4WD0A 2YXGA 3W7LA 4NX5A 3V1PA 3R12A 1CW2A 3HGRA 4LC8A 2I1OA 1KTBA 3C6CA 4UMAA 1TRIA 3W88A 4RZ5A 2OMAA 1OHLA 3GDRA 3VKJA 2Y6ZA 1TJRA 5FF0A 3NNTA 1SR9A 1LRTA 3WK0A 3DI0A 3GR8A 4M6VA 4ADTA 3F03K 3EKZA 1Z48A 2G95A 5D09A 3DFOA 2CZ5A 3VNDA 1BWLA 2QCCA 4YCPA 3TKFA 3L65A 2OT0A 5U4NA 2HS8A 3HG2A 3FEMA 3HO8A 4XWUA 5FEWA 3HMJG 4YLWA 1EEPA 4QNWA 1A5SA 1SUXA 1OX4B 3IRDA 2WV8A 1JRCA 1X6UA 4O57A 3P74A 3H55A 5AHMA 1VQTA 4I7WA 3USBA 4LNYA 4LWWA 1H61A 1LLWA 4L4MA 3GDTA 1PHWA 3IEBA 5K9DA 3G8RA 1T99A 1GPWA 1OK4A 1DV7A 1TV7A 4IUOA 2AQWA 4R7JA 3LHYA 3PG8A 2ZRXA 2PCQA 1K7EA 1MZHA 4U4MA 1CX9A 5LSMA 4MLRA 5L6UA 4UNLA 3W2UA 1I2QA 3T40A 3LCIA 3C2FA 5DELA 3KVLA 3GVGA 3TMLA 4QQ3A 3S6DA 3L68A 2CFFA 2HSAA 5DXYA 3UZ5A 1AW1A 2GQ9A 2RKXA 4AXKA 1ZHAA 3M1ZA 3NL2A 1WYIA 4OV9A 3OG3A 1ME8A 1EB3A 1Q45A 1R2TA 5D03A 4IGHA 4HNUA 1AMKA 4JTKA 3W85A 3TK7A 2VFIA 4ZQOA 4JDYA 3QSRA 2WNNA 4N4PA 2C14A 1KBJA 1TPFA 3A23A 4PODA 1QAPA 2ATSA 3W83A 2DZWA 3U8GA 3NO5A 3GB6A 4DF2A 1JUKA 3LLFA 3N73A 1VCGA 1N7KA 3NQ7A 4O8RA 4OV4A 4K39A 1IF2A 3KHJA 1LOLA 2DORA 1V7YA 2LLEA 3Q2DA 4K37A 3CWNA 1QOQA 1HL2A 3THQA 2V5BA 3P8JA 3S5OA 4DBDA 1K8XA 5HJLA 3MMTA 5LNWA 5G4EA 3B8DA 2QCMA 3MP5A 3EWXA 3OHIA 3HB9A 4QSHA 1VZWA 3QW3A 3G1VA 3UD6A 2NUXA 5FEXA 4RXFA 4Z0JA 1H50A 2E5BA 1FWTA 2ZZ1A 3UPBA 1FWSA 5AHNA 3M0ZA 8TIMA 3A24A 5KITA 3OBKA 5FF2A 2QCHA 1IXNA 4Y8FA 1LRNA 3OIXA 3JRKA 4K36A 1H5YA 1BEUA 5SWUA 5I3KA 1H7RA 3DU0A 4UTIA 3RU6A 4JIPA 4FNRA 3LI1A 4K6AA 3WK1A 2CLHA 1SZFA 3T78A 3MJYA 3TDFA 2VKZG 4LS2A 1L9WA 1A5CA 1JUEA 1EUAA 5TQLA 2JBMA 3LXCA 1DVJA 2RFGA 2Y88A 3IIXA 1DJQA 3LV6A 2YZRA 2BX7A 1KM3A 4TU1A 3MP3A 4JTJA 2CLEA 4ADSA 3DHFA 1EX5A 1PL9A 3HG3A 4ICNA 3QMSA 4JYDA 4MZ1A 1PE1A 4C1KA 3DAQA 1OF8A 1EP3A 2Y85A 3IVSA 2AGKA 4BI7A 2W79A 1JULA 4K38A 2V2HA 1YTKA 2NXHA 1DQXA 3LCLA 3MYOA 5LNUA 1XCFA 1MSSA 3L66A 4O54A 4Q33A 5LGZA 1W3NA 3P5YA 1TYGA 1J2WA 4QNEA 2G96A 2QUVA 4H4IA 3PULA 1EP2A 3FKKA 1C29A 3NGJA 4O4VA 2GJNA 1YPIA 1I2PA 4O12A 5A5WA 2V2CA 3FA5A 4NJGA 4DBEA 3CQ0A 1F2JA 1O94A 1I2RA 4FNPA 3LX9A 1YXDA 2C1HA 5HUPA 4O11A 1MO0A 4UFHA 2ZFAA 3NPUA 3GNNA 3LGEA 2QCDA 5BMWA 1V5XA 1ZAJA 2ZTJA 3LM7A 2ZZ6A 1OFRA 1RVGA 1EWDA 3RLUA 3LOTA 3HOJA 3W2MA 3KFTA 3TE9A 3O16A 4MZ8A 2NLIA 4JTGA 3F4NA 3SW6A 5J5RA 4JYFA 4AEOA 2YDAA 4I9AA 4UFIA 4MPQA 3G18A 5L9FA 2RH9A 4M6QA 3PC0A 4UTUA 2CLLA 1BWKA 2WNZA 4XUGA 3G1XA 4U28A 2X1RA 5F2GA 4NZFA 3PVFA 1P1XA 1NVMA 4CNPA 5HNRA 3DGRA 1AW5A 3A22A 3TH6A 2P0OA 1XKYA 4IX0A 4AMAA 4KFNA 4DQWA 1JQVA 4GUFA 5E93A 4CLMA 3C56A 3GDMA 3NQDA 3BLEA 3SECA 4N2YA 4WY0F 5AN7A 3W72A 4MYXA 1JRBA 2J9XA 4IX2A 4Q32A 4DELA 3BVJA 3S1WA 2NUYA 1VC4A 3GKFA 4JX4A 3W1RA 4OWGA 1M7PA 2PRHA 2B7QA 2QCDB 3P7YA 2FJKA 1YYAA 3ZR4A 4JTEA 3NA8A 3G0UA 4K7YA 3S5NA 2ZRUA 3W71A 3LBCA 3W2KA 2QCNA 4E2BA 1ADOA 3LXAA 5EBUA 2CZFA 2A0NA 1GTEA 1SW0A 2OCZA 1IGSA 3MW7A 2VFGA 1WQ5A 3EWWA 1QDSA 4AVFA 2R14A 4UTJA 3CB8A 3ABRA 4GE8A 5DXXA 1KM6A 5CZSA 1VYPX 2C3ZA 1RQHA 4XKYA 4O50A 1PV8A 4LV9A 1O5KA 4AHQA 2WPBA 3LHWA 3TFCA 1LORA 4O15A 1H7XA 3CTLA 4DEFA 1LYXA 3HPSA 2YCEA 4LC6A 2G97A 2H3DA 5D02A 1K3UA 2NX3A 3NL6A 4DO4A 1GVQA 1IIHA 3E49A 1GQNA 2QCGA 3TAOA 3NZRA 2X2GA 1XBVA 3PBUA 4IMEA 1OFEA 1THFD 5AFDA 3EX3A 2VELA 4O17A 5CKSA 3DBPA 3WK3A 5AC6A 4BI6A 4ALDA 3CPRA 3M5XA 4ORMA 3DFQA 2NX1A 4UFLA 1KFCA 2QJGA 1JJKA 1VCVA 1W5NA 4HSOA 2EKCA 2QDGA 1M7OA 4QM1A 3LCFA 1KTCA 3G1DA 1TJPA 1TQJA 5CPMA 1AK5A 4NJIA 2GUUA 2H3BA 1KFKA 2NWSA 4C1LA 3O6CA 1TTJA 1F05A 2GOUA 4FNSA 2QUTA 3MHGA 3O6DA 3LB0A 3B06A 1A53A 2R91A 3NPXA 1QNVA 5LKYA 3L21A 1FCUA 1JUBA 5F4XA 2QAFA 5C55A 3ZWTA 1JCXA 1ZFJA 2TYSA 3W23A 4RV8A 2J9ZA 4XKYB 2DJXA 2FTPA 4M19A 1KLZA 2GVGA 1ZY9A 3W86A 3C3NA 5A8GA 4G1KA 1HFBA 4EF8A 3T44A 4NXSA 3E9AA 4MKNA 3G22A 4Y90A 1FDYA 2VEIA 1PVNA 5LZLA 2O7SA 4QJ1A 3STGA 5EA9A 3GZ3A 3QPYA 3TW7A 3N19B 2VXNA 1F7BA 3QH2A 4UMBA 3S9YA 3I68A 3AO0A 4XQ6A 5F1VA 3SZ8A 1W8SA 4NU7A 2ZA2A 2X1UA 4WX2A 4FF7A 1P0NA 1HO1A 4HKPA 5D2XA 5K9CA 5H2ZA 4A29A 5HR6A 2DU2A 4IXHA 3GX9A 5AHIA 3UWUA 2YW3A 3TQ0A 4NX0A 4Z1CA 2WSQA 2NV1A 2HS6A 3EX1A 3MBFA 1T0OA 1H1YA 3N9SA 3W2LA 4RZ4A 1ZAIA 2QJIA 3OVQA 4A21A 2Q3OA 4P2VA 2GVJA 4LS0A 4FX8A 3W7JA 1GG0A 4LUIA 3G0XA 3NQCA 3S42A 1AL7A 3WJZA 4NT0A 1DOSA 1L2UA 2WQPA 4IPJA 3SFKA 4Q4KA 1MEHA 1BTMA 4XZ9A 4NJKA 1YDOA 2EF9A 3CM4A 4UCGA 3G0SA 2VFEA 3HF3A 2W6RA 1EUNA 1X1OA 5DLCA 4DF1A 1MXSA 4EOUA 4N9BA 4NJHA 1LROA 2GVLA 3NL5A 4GXMA 1GYNA 3WJWA 2E6DA 5FF7A 4QISA 2CLFA 3SGZA 2ZZ4A 1KM4A 3TX9A 4JTTA 2V0TA 3UWVA 2NZLA 2F7FA 1ZJIA 4JTLA 2J27A 4JR5A 3O15A 4N6EA 5BNKA 2ATMA 3L0KA 5FI8A 5CG7A 3QSTA 1IIGA 1UCWA 3UWYA 3L2IA 2EGZA 1O95A 5G2HA 2DZPA 1X1ZA 2CZEA 1KV8A 3OVRA 3OVPA 4GNJA 1QPOA 4FO4A 2J9YA 4AH7A 4RLIA 1TV5A 5D2WA 3E02A 4J9JA 3C8FA 4Z1AA 3W1TA 3W1UA 5TIMA 1FXPA 4Z08A 3HGSA 2QF7A 1GYLA 3QQ1A 5DCEA 1VCFA 3MBDA 1OF6A 1N8FA 1HUVA 3VE9A 4FNQA 3G24A 4JYEA 2J24A 3FJ6A 1VLIA 2X30A 4YXGA 5HULA 2X16A 3NG3A 4IMCA 3F4WA 4KFOA 2H8XA 4JY8A 4O0ZA 5HUOA 4JTUA 4HHPA 4AHPA 2GJLA 4OT7A 1RPXA 1F73A 2FQIA 2V81A 1W54A 2FIQA 2V5LA 1NEYA 4M7SA 3HQ1A 4JTHA 3R8RA 1QWGA 3W07A 3GR7A 5HR7A 2XN1A 3LHZA 1NFBA 1VS1A 1ICSA 3PB0A 4RR4A 4A2SA 3PWAA 1XC4A 3L9CA 4NJJA 1K03A 3NM1A 5HWMA 4E38A 4JY9A 3W7HA 1YADA 3S1UA 2E68A 3SI9A 1EP1A 3KXQA 2B4GA 4IJBA 2Q8LA 4JXCA 1TCDA 3W84A 1WV2A 3TSDA 1BKSA 3W7GA 1WOAA 3MUXA 1LBMA 1XM3A 3W3OA 1F6KA 3QYQA 5K9XA 1JCJA 4ZMGA 1S5WA 2GQAA 2QUUA 2WSYA 3MYPA 3A21A 3TXVA 5F2MA 3IIVA 3OEXA 2ISVA 1AG1O 3LXBA 3NQFA 3S5ZA 1OYCA 1OFAA 4EF9A 1DL3A 4AHOA 4XTDA 2E6AA 1Q6LA 3W7CA 1G7UA 3TU9A 3LCXA 5LNRA 1EA0A 3HPZA 3BG3A 2NXGA 4ZQNA 3YPIA 4NXKA 2VEKA 3GDKA 5C2XA 3DHDA 3LV5A 1PIIA 1C9DA 2A1YA 5KZEA 2V30A 4GUIA 2HMCA 4YCOA 4CQ9A 3NQ8A 1FQ0A 2DJLA 5E1QA 1N55A 1GEQA 1W5QA 4CCCA 3N14A 1QMLA 3QQ0A 4DF0A 3FOKA 3ABOA 4LY8A 1VYSX 2A7NA 4JX5A 4FEZA 1B4KA 1G4PA 3EX4A 3UWWA 1AL8A 1SO5A 2EHHA 4BWLC 2V2DA 3KAOA 3SJ3A 4RZ6A 3UY8A 5G2WA 1LBLA 1KFJA 1RV8A 2BWGA 4ADUA 3P60A 2ZZ3A 5IBXC 5K3VA 1B9BA 1OYBA 4IMDA 5D37A 3M5YA 1LRQA 1F76A 2E5DA 3W2NA 5HWNA 2JGYA 1B3OA 4O16A 3W7QA 3G1HA 5EL1A 5AC7A 1FWRA 2NUWA 3W1QA 4LU0A 1G4TA 3A9IA 3G1AA 3BLIA 3KX6A 3G1YA 5KMYA 1TRDA 4X22A 3FS2A 4O4WA 3S0CA 1K7FA 2A7RA 1IXOA 1VJIA 4UFJA 4EVZA 3FJLA 3SSJA 1IXQA 3HGJA 4EWND 2Y70A 5C5YA 3LTPA 4ZQRA 2Z0IA 3E12A 3MO7A 4BFAA 2QCEA 4UTTC 3PG9A 3IIOA 1TB3A 2ZRWA 1X8FA 3OA3A 1VHNA 1H7PA 2E77A 1W0MA 2J6XA 4HSNA 4MFEA 3W1MA 2R94A 1VYRA 4B5NA 3BG9A 3KVKA 1OX5A 2D73A 3TCEA 1W5MA 3TW6A 1QCWA 3BW3A 4KWWA 4PL1A 4FHAA 5CGQA 3E96A 2QKFA 3L5LA 2RDUA 3DH7A 3PUEA 3PSWA 3INPA 4MJMA 1DKWA 3KOFA 4S2BA 3N9RA 3I6RA 4UXDA 3Q58A 3TC6A 1R47A 4UR8A 4IPIA 1LTDA 5BOOA 2X1SA 4OGZA 3ATYA 3W22A 1XDLA 4N4QA 1IXPA 1RR2A 3RLVA 4WY0A 5MHBA 3KRSA 4GWEA 3UWZA 1G67A 1VH7A 3ABSA 4PCFA 4E0CA 3TJLA 2ZRZA 5C6MA 1VR6A 4OHQA 4WQ6A 3M5VA 3QW4B 1KM1A 3M7WA 4MIMA 1KM2A 4Y9AA 3QRHA 4LOCA 2BZNA 5DN1A 3U2OA 1L6YA 3VI2A 2TMDA 4WUIA 1LOQA 1YDVA 4E2DA 4JEQA 2A5HA 1GWJA 1NF7A 1NAL1 3PBVA 4I7VA 5CZTA 5DBTA 5DCDA 3CEPA 2ZBTA 3W7PA 1TPWA 3W1PA 5D38A 2NX9A 1YTDA 3M43A 3UY7A 1FCVA 3W76A 2ZZ2A 2XN0A 3NXFA 4HPJA 3PUOA 3L5AA 3NQEA 3O63A 1WA3A 4IWWA 5D05A 4A3UA 1RD5A 1M6JA 1NSJA 3PF3A 1S3HA 5D32A 4QAIA 2H90A 4MOZA 2Y7FA 5I3IA 3VE7A 3S1VA 4UFMA 3P81A 4WY0B 4LTSA 4MY9A 1DJNA 1SO3A 1P0KA 5K4XA 3MI6A 4NUWA 4K8EA 3W1AA 2EPHA 2ZTKA 2KZHA 3WJXA 3GYEA 4OBTA 3TSMA 3TXZA 3LTYA 3T55A 1H7NA 4FNUA 1ME7A 3LHTA 2FLIA 4BR1A 2BSLA 1H60A 2WNQA 5BW6A 3P8IA 1I45A 3I7SA 3CT7A 3WJYA 4WOQA 3TMQA 4N9EA 1TPUA 1WBJA 1GOXA 3QFEA 3PR2A 2ISSA 2O7QA 2Y7GA 4R34A 4RK8A 3W7KA 4BWLA 5FF3A 1M5WA 2C0AA 4NNCA 4LT9A 3EWYA 1B57A 4OE7A 1GVRA 3IIPA 1W56A 3NQGA 4JS3A 3N2MA 2ABAA 2EAWA 1SSGA 1TTIA 4O1AA 5IBXA 3STEA 1KW1A 4JIQA 3SY5A 2VC6A 1ONRA 3TC7A 2WJZA 3NQ6A 3KVMA 3LERA 1KM5A 1R2SA 1FX6A 2GPTA 3NYZA 4QITA 2ZQ0A 3CHVA 3LLDA 3G8EA 5E0KA 1TTPA 1GT8A 4MYAA 1DORA 3GNDA 4NNBA 5CPLA 1R46A 4FX6M 5EY5A 1TPEA 5LGXA 1L6WA 3KRUA 3IGUA 4HN4A 3PUDA 3CEUA 1ZENA 3QM3A 2YGYA 4ZQPA 2Y63A 5LHEA 1FXQA 4JNMA 3NPWA 3ZFHA 3DKJA 3HJZA 3MWAA 4MLJA 5G2IA 3B0VC 4UTTA 3ABQA 2PE4A 1Y0EA 2FPVA 3W70A 5LNVA 4AWUA 3W2JA 1YTEA 3O05A 3CWOX 4UC5A 3IVTA 3UQNA 3QPZA 4A22A 5AHLA 3Q37A 3W9ZA 3MHFA 1TIMA 3FYPA 4TMBA 5F1UA 4CNOA 3IGXA 1H51A 1WDWA 1FCQA 3T7VA 4N9DA 5KZMA 5G1YA 2CWNA 5F2LA 3NR0A 4UTWC 3TAKA 6TIMA 3LCHA 5EPDA 1OK6A 4XBKA 1G7VA 4TO8A 3CC1A 4NQ1A 4TIMA 2F84A 3EWUA 4UR7A 3T4CA 3UWQA 3CU2A 1B4EA 3B05A 5I3GA 2VFHA 1HTIA 4LV4A 4NNAA 2P10A 3K30A 5D33A 3BLFA 5KSWA 3NL3A 3ANYA 4HT3A 3TUUA 4D2JA 1SW3A 5I3JA 4JD4A 2OJPA 3M16A 5K2ZA 1FDZA 5ABTA 5IM51 5CPNA 4LS1A 3TQKA 3GXNA 2G5WA 2JGQA 2R8WA 3MHUA 1OVDA 2H8ZA 4JN6A 3W7DA 2NWRA 1W5OA 3NZ1A 4Y96A 1A5BA 4UFKA 2CZDA 4JTSA 2E1DA 3PBWA 2Y62A 4ZVJA 1Q6RA 3GLCA 1ALDA 2B7PA 3BGJA 4JTIA 1YXYA 1OFBA 1OFOA 1JCNA 4JDBA 2QCFA 1KFLA 4W9TA 5HWJA 1SO4A 3LHUA 1GTHA 1K7XA 1EPXA 3HPXA 3QMRA 3TJXA 3W7OA 2ZZ5A 1Q3NA 2FDSA 2VFFA 3I65A 2ZDRA 1I2NA 1FWWA 2DP3A 5G5IA 2Y7EA 4H6KA 3LDVA 4UIOA 1QO5A 5HMSA 3IVUA 3HIJA 4EIVA 4JX6A 3R89A 5J5DA 3UYCA 5C54A 3MP4A 1TPB1 3PY2A 4YMZA 2Q8ZA 2C15A 5AC8A 1TO3A 1QPNA 1PHQA 1XXXA 1SPQA 4KKXA 1G6CA 4AB4A 3IV3A 1OFPA 1TPVA 3NDOA 4RXGA 1YLVA 2CLKA 4NVTA 3FLUA 3FFSA 3TNOA 2A21A 5DCBA 1GZGA 2WOQA 1SZEA 1WX0A 2VEMA 2VFDA 3IIZA 4UNKA 3KVJA 4CCEA 3GIYA 4ZZ9A 2FB3A 1XBZA 4FIQA 4XTIA 3DFNA 3UXAA 3H53A 5AB3A 3SR7A 4O18A 4HNNA 2E6YA 3A5FA 1UJPA 2P1FA 1FY6A 4Z1DA 5D30A 4UMCA 3B03A 2DZUA 4GJ1A 5LHFA 4POCA 3NPVA 3W7NA 4BK9A 4TR9A 1KA9F 2C6QA 2Y7DA 4HNTA 4CCDA 5EMUA 2QR6A 2RHGA 2OX1A 4YWIA 5KINA 3MI2A 3W87A 2VOMA 1XUUA 4M5PA 3UXDA 5CZJA 2HTMA 4O1CA 1I8JA 1EWEA 4LUJA 4ML9A 4ZQCA 3WK2A 3C0JA 3TV8A 3TA6A 3TQVA 3B0PA 1K02A 4GFSA 1UUMA 2C19A 1X7FA 3LHVA 3P5ZA 2ALDA 1W31A 2B0MA 4Z0SA 1PCWA 4LRSA 5CPOA 4MJZA 3W1LA 2ABBA 5EYWA 5K4ZA 1KLYA 4M6PA 4N6FA 5DBUA 1GG1A 4O1DA 3LRKA 1FCBA 1PCKA 3GK0A 3STCA 4HNVA 4PH6A 3RNDA 2B7NA 2ZA3A 5G4WA 1SZNA 3GKAA 3EXSA 3EXRA 3E0IA 1G4EA 3LRLA 5K7JA 3BG5A 1CI1A 4FIRA 2C13A 3V75A 2PRMA 3P62A 1T96A 2X1TA 3G3DA 3DXIA 3C2OA 1FBAA 1LOSA 1JVNA 4GC4A 4DO6A 3QEZA 3B0UX 1Q6OA 4FXSA 2ZRYA 2QJHA 5F2IA 4O28A 3GXTA 1UB3A 1KV5A 3LCGA 4AWSA 1SW7A 1HO4A 4UTWA 3EKLA 2ZZ7A 2CLOA 2V8ZA 5I3HA 1TV8A 3C2EA 1ICPA 5AYYA 4PC8A 4Z1BA 1YDNA 1J4EA 1VGAA 3N2XA 3UPWA 1MEIA 4LVAA 4PFMA 3W6YA 3TR2A 2OZ0A 1TREA 5H91A 1A50A 1LDCA 3NQAA 1DQWA 3STFA 1G69A 2FB2A 1JR1A 1LM1A 3AJXA 1ME9A 4ONVA 1GVOA 1H1ZA 2JKEA 4TX9A 3GAYA 4O52A 3G3MA 2YYUA 2DZVA 4GUJA 1TQXA 1XI3A 3TFXA 1E51A 4UTKA 5AYZA 3JS3A 1VHCA 2Z2UA 3PB2A 3NQMA 1WAUA 3CIWA 2VENA 3W75A 1O60A 2Q3RA 3U6WA 1AW2A 3FKRA 2YW4A 4UTMA 4MVAA 3HBLA 5HQEA 3C4UA 4N9CA 1JCYA 1KM0A 3CLMA 1KFEA 5CSSA 3QMTA 1LBFA 1WOBA 3ATZA 3I7RA 3LCWA 3BO9A 4DO5A 1NF0A 3P61A 4WZHA 4NZJA 4XBSA 1RZMA 3S1XA 4AF0A 2FPYA 4L4LA 4ORIA 1I4NA 1WXJA 3C2VA 2C18A 5DY3A 4QIUA 3EWZA 4O0KA 1L6SA 1OYAA 3HG4A 3NM3A 3MI3A 5D2TA 3W1XA 1UBSA 4LVGA 2YFOA 2B7OA 1VRDA 2TRSA 1SO6A 2OT1A 2TSYA 1D3GA 2CLIA 2WKJA 1TPC1 2WSRA 4O13A 4LVBA 3NAVA 3BK0A 2A6LA 3HGOA 5FF4A 2RDWA 3M41A 1LCOA 3LI0A 1TPH1 3ZWSA 1LLZA 2CW6A 5D2YA 1O4UA 1ZALA 1DHPA 1QFEA 1JQXA 1OJXA 3EEGA 2ZCGA 5U7SA 4MZYA 5CSRA 3O07A 3W1NA 4LVFA 4GBUA 1I2OA 4HPXA 5D2VA 3TSBA 4ZL1A 2E09A 5F4SA 1K8ZA 3EX6A 1TMHA 1KFBA 3C2RA 4GUHA 4PTNA 1JCLA 4LW7A 1SQ7A 2PRLA 1G4SA 1SZGA 2PURA 1OX6A 1K8YA 1D3HA 3A5VA 3EB2A 1KTNA 2Z1BA 3G1SA 5TBOA 2XN2A 1GVFA 3JR2A 1PS9A 4RCXA 2V82A 1MEWA 3O8AA
chains in the Genus database with same CATH superfamily
1QR7A 3B04A 3DZ1A 2QEZA 3VNIA 1A5AA 2YCLB 3SGUA 4ICMA 4RKAA 3QJAA 1AFSA 1XR2A 1FUYA 5JQ9A 1V6TA 2DGAA 1HZYA 4OQVA 3W7MA 4WXYA 4YTTA 3L0GA 1Q7QA 4JTQA 4M6UA 2AMXA 1F5ZA 1C8YA 5AYXA 3RLHA 1UW9A 2EJAA 4DI8A 4IGNA 4FF5A 2ZICA 3VCRA 3KCOA 4I5UA 4HIBA 3AQUA 3JU2A 3L4XA 1GQLA 5EMKA 3TYBA 6ALDA 3VGHA 1XW8A 2VEPA 3C8NA 3SCNA 4XZLX 3W7RA 2JFEX 1T8XA 4LEFA 1YNYA 2F61A 3KRBA 1TCMA 1JF6A 2P0IA 2F8QA 4EK7A 3WQEA 2I14A 4RDWA 3FYYA 3LRMA 3P67A 2IKJA 4BF9A 4Q8OA 3SUSA 3PJWA 1JCMP 3FYOA 3NSNA 2J88A 3PNUA 2FHBA 3RCNA 1A5OC 4O14A 2AAMA 3AALA 4GO8A 1SFLA 4YHEA 5I3FA 3RF9A 3AYTA 3T08A 2YB1A 3A3HA 1N8WA 2IQTA 3RR4A 3F2CA 3OA5A 3GTNA 4C6LA 4B9ZA 3CUHA 1R86A 3NQ2A 5DMLA 3EX2A 2OODA 5BWAA 4JBRA 3W73A 4PB4A 2YA0A 4DBSA 4TMCA 4YVXA 1GJPA 4H3DA 3GG7A 2Y1HA 3SIZA 3RFAA 2VJXA 3M4HA 2ALRA 1HVXA 4QLJA 4E4UA 4Q8QA 1MDRA 3O1NA 1CECA 3U57A 1NELA 3L4UA 2Z6IA 1KBIA 3GXPA 2CXGA 1EYWA 1T41A 2RDTA 2V5DA 3W74A 4HMNA 4YL2A 1ZJBA 4EXAA 1W1YA 2IPJA 3NZGA 3R13A 3QKEA 2WC4A 1P43A 1UKQA 3KWXA 3GAKA 2Z7GA 2DZSA 3Q94A 1Q2RA 3LUTA 1J10A 1YPXA 2DSWA 4PB5A 5BRBA 3JZUA 4MJ4A 5I00A 1GYMA 1F74A 3BW2A 4UUIA 4U3CA 2YSWA 3RCYA 3B9OA 1C8VA 3ID7A 5AHFA 3N6HA 1P4CA 4U2YA 1ZAHA 3SFWA 3AHZA 1DIOA 4JTFA 5D9OA 2PD9A 4RX0A 3O0KA 5KZDA 5GVJA 2FH6A 3K4WA 4WJEA 1S2WA 1UUOA 1UA3A 5KETA 4WVXA 1RBLA 3B40A 3GTXA 3H54A 4H83A 1Y8BA 4X3ZA 2V6AA 5AOUA 4DLFA 1JL8A 4JFSA 3WUBA 4BI5A 2O56A 3RMJA 1H7OA 3GG8A 1W1ZA 2ZXDA 4FS9A 4QG9A 3WO8A 5GNXA 4LVDA 4IMGA 3BAKA 7TIMA 5HNNA 2MANA 3KOXA 3TROA 1WP6A 3N3MA 1R2RA 3TIMA 3T0AA 1JDEA 4ERIA 1G94A 2O4MA 3NEVA 3V4BA 2J7CA 4GC3A 5CXPA 1H41A 3C2YA 4F4RA 1PIFA 3K2GA 1E6RA 3IS4A 1UG6A 4UZSA 1VBGA 3G2GA 2W0UA 2XGIA 5JIWA 4WD0A 4NX5A 1Q66A 4AZ7A 2GK1B 4MTVA 3V1PA 4AD5A 2I1OA 2NV9A 1E71M 4Y2WA 3MZ2A 3GHUA 2EG6A 2OYKA 3WK0A 1KR0A 3DI0A 5FOOA 1E55A 4I8DA 3F03K 1GCYA 2HBVA 2CZ5A 1BWLA 2P3ZA 2EPKX 3R10A 2CHOA 5U4NA 2HS8A 2ONEA 1XH0A 3HO8A 4NZ3A 4XWUA 1A4LA 3BMVA 4AUBA 1JYNA 3NGFA 4REQA 4XO6A 4GACA 4Q4OA 2PD5A 1VFHA 4FLOA 2RJHA 5GNZA 2ZXQA 1X6UA 4O57A 2QPSA 4MHBA 3LGGA 4GYKA 4RPQA 1HKMA 2CESA 1NWTA 1LLWA 3BQ5A 3GDTA 4ICCX 5K9DA 4LY4A 2VDIA 2XWEA 3N11A 3QFWA 2NQ9A 1F4AA 3U4FA 3AI0A 2AQWA 1X97A 1J5SA 3PG8A 4NHVA 6REQA 3HMCA 3WD3A 5LA2A 4B4HA 2G4FA 4UNLA 3T40A 2QMJA 4ACYA 3UG3A 1VKFA 5DXYA 1EHAA 2FHFA 4AXKA 1ZHAA 3M1ZA 1WYIA 3ITLA 3OG3A 1ME8A 3WL0A 2WMKA 3NUKA 4DJDA 4ZQOA 5B80A 2XH0A 1KBJA 3TVAA 3TTEA 1BQGA 3RITA 3W83A 1M65A 1QW8A 3WEOA 5M2FX 2ZKMX 3DHUA 1NIUA 1C7TA 1VB9A 4O8RA 4K39A 3DC0A 1WPCA 4PUNA 4X0VA 1H49A 1QNQA 2LLEA 3Q2DA 3ONCA 3VD5A 3THQA 3P8JA 3U4AA 3SADA 2A3LA 2OLSA 3EWXA 5C71A 2HCVA 3E0VA 4QSHA 3SRDA 2BHUA 1PEZA 1PKLA 1CXLA 3UD6A 2PTZA 1H50A 2E5BA 1FWTA 4LB3A 3W24A 4LYKA 4H9UA 5CJ5A 2H9AA 5AHNA 3M0ZA 3A24A 3OBKA 3MUY1 1E4IA 1EBGA 3WQ4A 3OIXA 1ZS2A 1DTUA 3IPWA 1UZDA 5SWUA 4GIAA 1D7FA 1HN1A 3S2LA 1H7RA 1HXJA 3TWAA 4JIPA 1XIMA 4FNRA 4K6AA 1FH9A 3WELA 3BAJA 4AD4A 4LS2A 2PC8A 1A5CA 1JUEA 2PBGA 1LQAA 1V0MA 3MY9A 1A0DA 1C93A 2RFGA 2PP1A 3IIXA 4HA1A 1XH2A 3DECA 1KM3A 1BAGA 3MP3A 3HPAA 4ADSA 4PUMA 2GLKA 2NQHA 1LUCB 2QLYA 1W9BM 3HG3A 4HU0A 4JYDA 4MZ1A 2PDBA 5A6TC 4C1KA 1V93A 1NWRA 1OF8A 1EP3A 3R94A 4JCMA 2V2HA 3PTMA 1UKOA 4IMAA 4LH8A 4Q33A 7PTDA 2I57A 1EDQA 4Q8TA 5C8BB 1NM9A 1XCXA 7A3HA 2CLPA 3GHSA 1DWHM 5FJUA 1QU4A 2C1IA 4O12A 4MB3A 1NOWA 5A5WA 4NJGA 4DBEA 5AVNA 5B7ZA 1B3VA 3C0QA 3GU2A 5HUPA 1WZAA 2W61A 3QV8A 3VGFA 2ZUTA 3BJTA 3LGEA 1VJZA 1V5XA 1RXOB 1RVGA 3QC0A 3RLUA 3ICJA 1Z6KA 4R9OA 1VPYA 2YDRA 2PMQA 4R9XA 3AIWA 4MZ8A 1H2JA 3M0YA 3WY1A 2DH2A 1G0CA 3F4NA 3EDKA 1QBBA 1UIOA 4DXXA 1ENUA 1VBHA 3SN4A 2WNZA 1Y7VA 4Q7IA 2IQDA 4U28A 4AISA 3WD4A 5F2GA 1FKWA 4NZFA 4MAZA 2BNJA 4L4OA 3ARTA 4QRNA 2OKOA 4XZHA 1Q2SA 4IF2A 1S2UA 4D9PA 3BC9A 4NZ1A 4KFNA 1DJXA 3KL3A 5CC7A 1LJYA 3D5HA 1I1WA 3GDMA 5A6BA 5AN7A 3D47A 5HNUA 3W72A 3CQHA 2MUCA 1W1IE 1TZ9A 4MYXA 3CPUA 4Q32A 2OLHA 4B5VA 3ITTA 4AD0A 1NOFA 3S1WA 1XQLA 2YCIX 1VC4A 3GKFA 4JX4A 3VDHA 3W1RA 5M5DA 1D3CA 2B31A 2PRHA 2V3GA 4MG4A 3N17A 1Q13A 3GVRA 1V3HA 3NA8A 2VTFA 4H19A 4MKSA 3ZR6A 3S5NA 1EDGA 1V3MA 4P7OA 5FJTA 2QCNA 1ADOA 3LXAA 4C7DA 3L4TA 1GTEA 5JXQA 4GH1A 3UBPC 1WQ5A 2XH2A 2R14A 3CB8A 3ABRA 2QIIA 4IL0A 1TZ7A 3HPFA 1O5KA 4AHQA 1AA1B 3AZTA 4DVOA 3LHWA 1TA3A 2BY0A 4O15A 1J0KA 3CTLA 1LYXA 3HPSA 4LC6A 1DJHA 2P3EA 1NDZA 4JQ1A 2Y2WA 4WKHA 1IIHA 1AODA 3NZRA 2X2GA 3IRSA 3T2OA 3PBUA 3QV6A 5CJMA 3RM8A 3WH5A 3B3DA 4RDVA 4IMEA 3RG6A 1UMYA 1THFD 5CC6A 5AFDA 2BODX 2VELA 1OZQA 5CKSA 3OZOA 3EA1A 4PUDA 2C79A 3M5XA 2DFAA 3WCZA 4WKAA 3HFTA 1B3YA 4JKMA 1JI1A 1DJZA 4ORMA 4QLKA 4DBUA 1TQJA 3OB8A 4KERA 4S3CA 1KFKA 2Y24A 4NG3A 4C1LA 2WC3A 1TTJA 2GOUA 3KM8A 3AIUA 1A3HA 4M56A 2WCGA 2R91A 3A47A 4C91A 1JUBA 1I1XA 5F4XA 5C55A 1XLAA 3ZWTA 4KCWA 1ZFJA 2TYSA 2VR2A 1X6NA 1CIUA 4M19A 2GVGA 4KWSA 2ZUVA 1ZP3A 3W86A 1XG4A 4XD4A 4G1KA 1GHRA 4Q8PA 3T0TA 4MKNA 1PVNA 4QJ1A 3CHEA 1A5MC 5EA9A 5I3DA 3N19B 4D1JA 3D3AA 3QH2A 1M41A 4UMBA 4GIRA 3I68A 5F1VA 3SZ8A 3V35A 4LPCA 4W86A 3TQPA 2VVNA 2EO7A 3VGEA 1EC9A 4IXHA 1XG3A 3GX9A 4RNHA 3UWUA 2YW3A 3CHCA 4Z1CA 2NV1A 2HS6A 3MBFA 1T0OA 4ZSUA 3N9SA 3W2LA 1BPLB 3TOYA 1ZAIA 4A21A 2GVJA 1V0LA 4R3UA 4S3GA 1TMLA 1IV8A 4XSLA 2PGRA 3SFKA 1BTMA 3GH5A 2EF9A 1GOKA 3URQA 3G0SA 1JZ6A 1E73M 2CBUA 5FA5A 5DLCA 4DF1A 6XIAA 2GVLA 3H2OA 5EMMA 4AX7A 1H4PA 2CLFA 5TD4A 1KM4A 4AXNA 3HJEA 5I6SA 4ZSTA 1DJGA 4HZ7A 4JTLA 2J27A 5BNKA 2ATMA 1E15A 3L0KA 5CG7A 1KGWA 2UY4A 3QN3A 5A8MA 2HZGA 7REQA 1UCWA 2PLKA 4XZBA 4ATDA 3UWYA 2OSXA 1POJA 5FJIA 1O95A 5G2HA 2DZPA 3URNA 1X1ZA 2CZEA 4YVVA 1BLIA 3MVTA 1E6ZA 4AD3A 3R0DA 4PRWA 1SYTA 5D2WA 1BXCA 2VYOA 4Z1AA 5RUBA 4LXFA 4I3GA 1PX8A 4LYPA 2PCEA 2HJPA 3HGSA 2OOFA 2BGSA 3OU8A 4GX9A 5DCEA 1OF6A 1BQCA 4PMZA 3NVDA 4JYEA 2OG9A 2DW6A 1ONEA 2X30A 4PULA 4YXGA 2X16A 3NG3A 3GVQA 1SJCA 4JTUA 4AHPA 3AZSA 2FIQA 3VINA 3R8RA 3GR7A 1KXTA 4XBJA 4R7WA 1AJZA 3IAQA 5HWMA 3NCOA 4E38A 4PUKA 4QDPA 1DEDA 1RAKA 4DO7A 2E28A 3KXQA 3A9BA 4IJBA 1M7XA 2F2HA 1VEMA 2PI6A 3W84A 1TWIA 1WOAA 5CLTA 3NJ3A 3QYQA 5K9XA 5DRIA 2GQAA 1XYZA 2WSYA 3OQ8A 1T5AA 1J0ZA 5FIPA 4CU8A 3LXBA 1UKSA 3NQFA 1ZL1A 3H22A 1XLEA 2G8ZA 3LCXA 3MZNA 3VOGA 4AW7A 1IQ8A 6TAAA 3BG3A 3YPIA 1SJBA 1FWBC 3R7MA 9XIAA 2V30A 4DB7A 3E0LA 1PJ9A 4CQ9A 3KBJA 1FQ0A 5E1QA 1AQMA 4UQ9A 3UZYA 4S3DA 1E1EA 1ECEA 4JX5A 3AXXA 2HPMA 1G4PA 3EX4A 3UWWA 1XLFA 3FSTA 2EHHA 2WAGA 3SJ3A 1E9IA 1RV8A 1XLHA 1DIKA 4XUYA 1KCZA 4ZOAA 2ZZ3A 4RE2A 3FJNA 4NRRA 3TEVA 1E1CB 4W89A 3CO8A 4G7EB 3VIPA 4IP4A 5EL1A 1I75A 3W1QA 1R3SA 4LU0A 3A13A 3G1YA 1TRDA 1FFRA 4Q8MA 4F79A 1ZBCA 4O4WA 3BCFA 1VJIA 3CLWA 4Z42C 3WLIA 3DDMA 2J47A 3BJSA 4ZQRA 2Z0IA 1GW1A 2HVMA 2BDQA 3PG9A 3VD3A 3V3WA 4PBGA 4NRSA 3N18A 1H7PA 4CNUA 1W0MA 4HGXA 5A6KA 2DUXA 2R94A 1A5KC 1JGMA 4B5NA 3KVKA 1W5MA 2GWNA 4F2TA 4J3XA 2HE8A 2QKFA 3L5LA 2XM1A 1O68A 4ZE4A 3PSWA 3H4GA 4JIRA 4MJMA 1X8CA 3TC6A 5D8ZA 4DUOA 2VGIA 3K46A 1IXPA 3VU2A 4WY0A 2AQOA 4GWEA 2DSZA 4PCFA 1E6QM 1MDLA 3GNPA 1VR6A 1YQ2A 4IIDA 2G50A 4MWAE 3UGVA 1FWEC 4KW2A 2TMDA 2L5HA 1J9YA 4J3SA 4JEQA 4JQ3A 2PUZA 3MSGA 1NF7A 2NW0A 3W82A 5CZTA 2X09A 3NSMA 3CAKA 5C9RA 4AMCA 1PUDA 3WMCA 2ZBTA 3W7PA 1TPWA 3P0XA 4RNFA 3FDKA 2WHLA 4BCEA 3KZSA 3S47A 3DBNA 3PUOA 1J0IA 4UCFA 4A3UA 3REQB 1BYBA 3GXFA 3ZJ6A 4A8IA 4XD6A 2C1GA 3RN6A 4QAIA 4AZGA 2H90A 5I3IA 1CB7B 4LTSA 4Q4PA 3S83A 1DJNA 1SO3A 2QPUA 4M51A 1PWMA 5K4XA 3MI6A 3LM3A 2ZTKA 1Q8AA 1EC8A 1H7NA 5CPSA 4FNUA 1ME7A 1AD4A 1PZ1A 2FLIA 2BSLA 3B8SA 1H60A 1FHDA 1I45A 3CT7A 5HATA 4WOQA 1MW0A 4GMEA 4N9EA 3ES7A 3KOWA 4C6EA 1TELA 1DHKA 1AD1A 4QG6A 2XGZA 3AYVA 4DJEC 4LT9A 8RUCA 1B57A 5BU6A 3KBSA 3NQGA 4ZCWA 3S4TA 1WZLA 2C7FA 2EAWA 1SSGA 4PGLA 5IBXA 2Z1KA 1KW1A 4TTGA 1BG9A 1XLJA 2ZC1A 3NQ6A 1H5VA 3ANVA 4HHLA 5KEZA 3ZJKA 3SQSA 3UPMA 1LF1A 1ZU8A 1QHOA 3AIRA 4JFWA 1J79A 3CHVA 2ACSA 5E0KA 3B4YA 4AZCA 1N82A 1GT8A 4MYAA 1W3JA 3MUIA 4FX6M 3PPHA 5EY5A 3BJFA 4HN4A 1XLDA 3KBVA 2AMGA 1M53A 4JNMA 2YXOA 1M68A 4QS6A 3ZFHA 2G4JA 4HHHA 5REQA 4OBSA 2PE4A 4XSMA 3UXKA 2XIOA 2XH4A 5HJYA 4CUCA 1WDSA 3TTOA 1NFPA 1YTEA 3O6AA 3C0SA 2CWXA 3IVTA 4UOJA 3SCSA 3NYDA 5E70A 3UCDA 3UQNA 3QPZA 3GS6A 1KRMA 5ENLA 5FL0A 5F1UA 1KC7A 3N15A 3IJ6A 4J2PA 1H51A 1XYAA 4UQDA 5I0DA 1FFQA 3P6LA 3GVWA 1W3KA 2CBVA 3CC1A 4NQ1A 3IJDA 3EOUA 1JNEA 1VIZA 3UZXA 3S6TA 3B8TA 4XIMA 5I3GA 5BRPA 3K30A 5D33A 4M0XA 3NURA 4JHOA 3ANYA 2OJPA 5EBAA 1I6NA 4WDTA 1J01A 5CPNA 4LS1A 1CDGA 8CGTA 2JGQA 1MFVA 4IISA 4RPPA 3SRKA 1CXEA 4IFKB 2UY3A 1UWUA 3HV9A 1FWAC 5FSEC 2D3NA 3ZQ9A 3PBWA 2Z7KA 3TYDA 4GI8A 1QUMA 4U31A 1YXYA 3H70A 1UR0A 1OFOA 4LCSA 3U48A 3VD9A 3B97A 3NWRA 4JKKA 2V69A 3K4AA 3MDWA 1AH0A 5HWJA 1SO4A 2WQDA 2Y5JA 5TNVA 1K7XA 3AMKA 4R85A 4QJ5B 1JPMA 1KQYA 1GNXA 3HTWA 1ECQA 3CZ8A 4L1WA 3LDVA 3OOQA 4DJFD 3HIJA 4JX6A 3R89A 1V02E 5J5DA 3UYCA 3EMCA 5A8OA 1TPB1 4A8RA 3RYSA 1QPNA 1RY0A 2XYLA 2ZC8A 1SPQA 1KKRA 3P3BA 1UR8A 4KKXA 2WMIB 2QJNA 4S3JA 3NDOA 3RPTA 4NVTA 3FLUA 4KQNA 3IJIA 3EBVA 4P5UA 3AXIA 1GJWA 1ZSXA 4LCRA 5DCBA 4MDPA 2NQJA 8A3HA 1SZEA 1WX0A 4HOXA 4DWSB 4HCHA 4O0QA 3RR1A 2VZTA 2FB3A 3UXAA 3ITVA 2E6YA 2P1FA 3VKCA 1V8EA 3D3FA 1FWDC 3GIPA 1HF6A 5D30A 3B03A 4GJ1A 4X2PA 3G6MA 4D72A 3NPVA 3U7BA 1JDAA 4TR9A 1KA9F 1UR1A 1BFNA 2Q01A 4HNTA 2QR6A 2RHGA 2W4XA 3OGRA 1DP0A 2Z27A 2F38A 4O1CA 1I8JA 4ML9A 4ZQCA 3RPDA 1SGJA 1ZTVA 5CBBA 2C19A 1X7FA 3LHVA 4KEMA 4M29A 1V03A 3P5ZA 3DYOA 4Z0SA 3VX0A 1PCWA 1Q65A 3EMZA 4M6PA 4HPNA 2ESCA 2DW7A 1J18A 3RNDA 2ZA3A 3GKAA 3EXSA 2WKGA 1G4EA 1R7OA 3ITCA 3V75A 2A3BA 4Q8WA 3TWBA 3DXIA 3C2OA 1FBAA 5EMYA 3QEZA 3B0UX 4FXSA 4MWAB 2J78A 1R38A 1EIBA 2ZIDA 4HCDA 3SCTA 2PBOA 4AWSA 1XDJA 4GIYA 2QXWA 3EOOA 1Y65A 4XVEA 4FK9A 4PBEA 2XVGA 3T1GA 3C2EA 5AYYA 4PC8A 4Z1BA 2GSJA 4A8NA 3RXZA 3H2CA 3PTQA 1VENA 3W6YA 2ASHA 3V5CA 1TREA 1A50A 3WKZA 4XZWA 4A3RA 3CAVA 1ZJHA 5C2GA 1MYRA 3AJXA 1ME9A 3JUGA 2VUYA 1P0EA 1GVOA 2VDGA 1SZRA 1XH1A 4O52A 3CZLA 3WD0A 3TFXA 2E1WA 3PHAA 1IZCA 4UTKA 3PZNA 4ZBCA 3N2TA 4V15A 3EEZA 3NQMA 3CPGA 1AVAA 3H2FA 3LU2A 2PDIA 3VOFA 4YTUA 3K13A 4MVAA 3HBLA 5HQEA 1HKWA 3C4UA 1IT8A 1JCYA 3T81A 4X63A 2C91A 5CSSA 3E0WA 1Q4WA 2OYLA 3QMTA 4CN6A 4ZFCA 1LBFA 3ATZA 3I7RA 3LN3A 3BO9A 5CJNA 4AVOA 1XIJA 3P61A 1X98A 2GVEA 4BQ3A 4GIEA 4NZJA 2W92A 2YCLA 1K9TA 2C18A 1HKIA 1EL3A 4OECA 2PP0A 1R3YA 3EWZA 1P1MA 3H2EA 3NM3A 2Y4SA 3MI3A 5F7UA 1UBSA 4AY1A 4LVGA 2XIIA 3T42A 1XYFA 2F2KA 1XC6A 2O9TA 1TPC1 1O66A 4O13A 2FZBA 4IHCA 1EH9A 2AL2A 1LCOA 2RDWA 4QE1A 1TPH1 3ZWSA 4M1BA 4GYFA 5D2YA 3KE0A 4XZIA 2DSUA 1G01A 1OJXA 2ZCGA 3BCDA 2NQ5A 4AZIA 4L9ZA 4LVFA 4RNIA 4PMJA 3TSBA 3V1HA 2PDPA 4PCTA 1E9LA 3C2RA 4GUHA 4XX6A 1UZ4A 1SQ7A 1G4SA 2PURA 3KW3A 3GUWA 3I4KA 1BF2A 1JGIA 1AJ0A 3SURA 1VFOA 3V18A 2XU2A 4MDOA 2QJJA 5AECA 3WDPP 4LEQA 3JR2A 1B3ZA 2OB3A 1XJBA 1MEWA 2I9UA 4C6CA 3A3XA 3VZYA 3WNOA 5JH1A 2D2GA 4XD5A 3B4UA 1S5VA 3AIVA 4NZ4A 1TKKA 1EGZA 2V5KA 3IJ9A 3W01A 4X2RA 4IXXA 4WGXA 1PZ0A 3ISIX 1W3TA 4W8AA 5D04C 1H62A 2E6FA 2WJDA 3MV01 4WOZA 2HBXA 2NXIA 4L64A 3SCVA 2I5GA 4FMVA 1WBHA 1E0TA 4M1RA 1MNSA 3WG6A 2O9PA 1DJWA 2D0HA 1W37A 4JGDA 1IYXA 3S8HA 2BLEA 4J7RA 3S5YA 3G1FA 2IS7A 1H09A 1TPDA 3WH9A 1YNPA 5ECVA 5LNSA 5GPRA 3RK8A 2D1ZA 1EJSC 3RJXA 1ZNNA 1TSIA 1Z44A 4U10A 4L9XA 1REQB 3V0TA 1OIFA 2A85A 3NZQA 1W9DM 2BP1A 3IGSA 1GKRA 2R82A 1JD7A 2WMGA 3VDBA 2V38A 5G1TA 3P82A 4XAZA 1YKWA 1XLLA 4HPHA 4NI3A 2YJQA 3CIVA 4MB4A 2HVOA 4B90A 3C0LA 2VQTA 3QGKC 4C7FA 5DANA 1TTQA 2YB4A 2DT1A 4G8TA 4LCQA 4O10A 1XGEA 3CHDA 1E0UA 2QUMA 3QR0A 3ITYA 4B91A 3PM6A 1F6PA 2FKPA 2HVNA 4N02A 4KGJA 4YN5A 5FEPA 2A2IA 2DSVA 3N25A 1D9EA 2DZXA 3DENA 4ZO9A 2YFNA 3U9IA 3MKVA 3EXTA 3PS7A 6ENLA 2OZ8A 1QW7A 3IANA 4PUEA 3M0VA 3OODA 1S5NA 1W9PA 3LGDA 5I78A 1U33A 4W8BA 3BMXA 3THAA 4WJXA 5I02A 3FHAA 5C9WA 3BQ6A 4DJDC 3HG5A 4H01A 9RUBA 4H41A 4MUPA 2DIKA 1O5XA 2PDCA 3M5ZA 2QDHA 5T26A 3DFSA 1UP0A 2Z00A 4DXVA 3R5EA 2ACRA 2V63A 2OGJA 3WNMA 3S1GA 4CD5A 3PSVA 2D22A 1GORA 2I16A 1SU5A 3DFTA 4HZ6A 4IICA 3R2GA 5EFDA 1AH4A 3D0CA 4DJFA 2VEGA 4HTYA 2TPSA 4DPQA 3F7JA 1EZWA 2BY3A 3QKZA 4FNTA 4H2CA 2GK1A 1JYXA 1N8IA 2J7EA 2YPIA 3KP0A 1XDMA 5A2CA 4AWTA 4D1IA 1TX2A 4C65A 1P5BA 2YL9A 3FY1A 2BOEX 4YWSA 2VT0A 4FOJA 2YYTA 3EB4A 1V3LA 2QS8A 1H63A 1E5JA 1HGWA 3BW4A 4GA8A 4W93A 5IDZA 5CSUA 2XFWA 5CC3A 1VPXA 1OZMA 1M04A 3JVAA 3TTQA 4C1NB 4O19A 1OT2A 2QNEA 4CQ8A 3ANUA 4ZTYA 1C90A 1YXCA 4UWMA 4RE4A 1JZ4A 1Z42A 5JUVA 3SQMA 4GX8A 2JKPA 3QY6A 3KCJA 3OGSA 2Z25A 4BA0A 3O6YX 1KRBC 1W17A 4M82A 2PAJA 1Z32X 2YXGA 3W7LA 3H6OA 3R12A 3DC8A 3HGRA 4UMAA 2ZX9A 1V6VA 3EDFA 4RZ5A 5J04A 1UD3A 3FV9A 4GOAA 3BICA 5FF0A 3NNTA 1EGVA 4QBXA 2Z1XA 1EKOA 1YDYA 1HJWA 3EKZA 3SCWA 4U3AA 2OT0A 3MA8A 4OUIA 4D8ZA 2CKSA 2V3DA 1LQ2A 3R4IA 4IIBA 4E8DA 2Z28A 3K8KA 1LL6A 3F4VA 1QATA 3P74A 3H55A 3WBWA 4A4AA 2RDXA 1PKNA 4LNYA 1L0PA 3THCA 2WHJA 1PHWA 2VZUA 1T99A 4QQUA 1GPWA 1DV7A 3BLPX 4C5ZA 3MCNA 3DEQA 3C3UA 2PCQA 1K7EA 2OU4A 2QV4A 3MSDA 4GQRA 3T2PA 3SEPA 3UXLA 1Q6CA 3NOYA 1FWGC 3W2UA 1I2QA 5XINA 2VC7A 3I10A 5DELA 3KVLA 3GVGA 1O1ZA 3L68A 2CFFA 2HSAA 2YBTA 2RKXA 2BGNE 3GSMA 3NL2A 3OPSA 4OV9A 5CLWA 3QPEA 1EB3A 3ARSA 1LWIA 1VJSA 2OYMA 5D03A 3DG7A 4JTKA 4K8GA 3W85A 3R1ZA 4GY0A 4N4PA 2C14A 4ACZB 1TPFA 3A23A 4CNSA 1QAPA 1EF2A 2DZWA 3U8GA 3NO5A 2QGYA 2R1KA 1UWAA 1MRAA 3LLFA 3T8QA 4HN8A 1VCGA 1M03A 4BKNA 4W5UA 3NQ7A 2WWDA 3KTXA 1B0IA 4H8NA 1JDFA 5M3WA 1LOLA 1MW3A 3HURA 5A2AA 4JQ2A 1V7YA 5HBFA 3CWNA 1LUCA 4ROQA 3WBEA 1HL2A 5LIKX 1TVPA 3MMTA 5G4EA 3B8DA 3B0YA 3LPOA 3MP5A 2G3FA 1FKXA 4LJ3A 3OHIA 2VP8A 2V67A 1RBOB 1VZWA 3QW3A 3G1VA 1V0NA 1XIGA 1V6YA 4RXFA 3WFLA 2TODA 3VNLA 8TIMA 1UOZA 5KITA 5FF2A 2QCHA 3JW7A 3K4DA 1FWFC 1LRNA 3TTSA 1W1VA 4K36A 1BEUA 1L8NA 4ZB2A 3NQBA 5MKGB 3TN5A 3LI1A 2CLHA 4A35A 3T78A 2XTKA 3TDFA 1P48A 2DVXA 2IW0A 3Q45A 5TQLA 1AQFA 7XIMA 2JBMA 3IUHA 1D7KA 2HE5A 3CH9A 1DJQA 2BX7A 3E3HA 3ZT5A 1GK8A 3N1AA 1E6XM 3R8HA 3EDEA 3DHFA 2FVMA 4PMVA 2PWUA 4Y9MA 3DAQA 2Y85A 2GJPA 4RUBA 2VX5A 1NOUA 1BHGA 2YBVA 2PWEA 1OCNA 1DQXA 1ODUA 2PDXA 4DX3A 2IQ0A 3MYOA 1XCFA 4O54A 2BVWA 4WHBA 1TYGA 5IFTA 1TG7A 4H4IA 3PULA 1EP2A 1C29A 3UG4A 1I2PA 3AWNA 3FA5A 4RE3A 1ZJAA 3L12A 1F2JA 4FNPA 3VGGA 3LX9A 3EYPA 3ARQA 2VD9A 4KRZA 1BGGA 4A3QA 2ZFAA 3QOKA 5BMWA 1JZ2A 3AXMA 1NWUA 3LM7A 3VNMA 4KT2A 1JFXA 3KFTA 4H7CA 4CN4A 1SFTA 2INFA 1Q4NX 4GBDA 4JYFA 4AEOA 4MPQA 1EA9C 4L6DA 3G18A 3HQOA 2RH9A 3PC0A 3WBXA 1BWKA 1KCXA 4NAFB 4OUEA 4RZBA 4HMCA 4MGGA 4GY7A 2FFIA 3PVFA 2OWWA 1P1XA 3ARPA 4KIRA 3CWHA 2A3HA 1FP9A 4AWEA 3TH6A 2P0OA 3QVQA 1C8QA 4KRTA 4GUFA 4GVIA 4JNYA 3DN5A 4N42A 3SECA 2R1LA 4B2DA 4WY0F 5GJMA 4UTFA 4JN8A 2X1IA 3BVJA 3PANA 4PMNA 1LWHA 3BAIA 5I2UA 3H24A 4OWGA 5E5CA 1ZLPA 3P7YA 2FJKA 3ZR4A 1R8LA 4PYSA 4JTEA 5I7GA 2FGZA 3TYAA 2ZRUA 3LBCA 1YBQB 4I90A 3EWCA 3RX3A 4E2BA 2O0TA 1NTHA 3RRXA 3AU6A 3GBEA 3DIPA 1SW0A 4RNJA 3EWWA 1QDSA 1KGXA 1VEPA 4FR6A 4AVFA 3SGGA 4GE8A 5DXXA 1KM6A 2VURA 3GHRA 1RQHA 1PXGA 4O50A 2VI0A 3TC3A 2BY2A 2DT0A 3K8MA 1LL4A 3DERA 2WPBA 4AX6A 3TFCA 3H4XA 4H9ZA 1QNSA 1XYLA 2YCEA 1WNOA 2ADAA 4DO4A 1EJ7L 1GVIA 4HK5A 2OO0A 2QCGA 4ZXOA 1XBVA 4GYPA 3VZZA 3VO0A 2VZVA 3QV9A 1RALA 1VF8A 3KEHA 1OFEA 4HYVA 4O17A 2CXEA 4B5UA 3WK3A 1BG4A 3WMBA 1O1HA 1DIDA 2W62A 2QJGA 4NY2A 1M7OA 2WMFA 3QYSA 1VBRA 3T8LA 1AK5A 2W91A 3LMYA 4W85A 2V5JA 3VIFA 2PDJA 1UWIA 3L4YA 3B06A 1R3QA 1QNVA 2DIJA 4WDXA 5IFPA 1P0DA 1ZZMA 4RV8A 3SUVA 4XKYB 4E6MA 2DJXA 2FTPA 3A4AA 1XSKA 5GJPA 3C3NA 5FAGA 4EF8A 4AZHA 1QI4A 4NXSA 3E9AA 3CUFA 3KHDA 3G22A 3SQLA 4Y90A 1FDYA 2VEIA 1XPYA 4W4QA 4F2BA 3STGA 1KBBA 3GH4A 3GZ3A 2WVSA 4F8XA 3E5PA 2YOCA 2CC0A 2VXNA 3B8WA 4U33A 1XRSA 1VBUA 1FA2A 1EJTC 4NU7A 4LSBA 2FMOA 2UZ9A 3L4ZA 1P0NA 1HO1A 3AHYA 4A29A 1MMFA 1YEYA 5AHIA 5T9CE 2RJGA 1MUWA 4NX0A 2Z1WA 1C9WA 2O92A 2X8RA 4BJHA 1MQQA 2QJIA 4GISA 1GG0A 1QVBA 3G0XA 1AL7A 2YDSA 3VK5A 4ATLA 3H7RA 1IT0A 4I5RA 2WQPA 1HL8A 2J4GA 4NJKA 3XIMA 3IJQA 3MU7A 1EBHA 3ZR5A 4UCGA 1UZ1A 1X1OA 2CKRA 3HF3A 5BXSA 1LROA 3BUVA 3WJWA 1DE5A 1S2VA 2E6DA 3OZMA 5FF7A 3ZVHA 4O1EA 4QISA 2V0TA 3HV8A 3SCOA 2CITA 1JZ7A 4HJFA 1V79A 3O15A 3ITOA 4IP7A 3QSTA 4ZFMA 1IIGA 1B3XA 3WQCA 4FA3A 3USZA 2WSKA 1UP2A 3VM5A 4GNJA 4IM4A 5XIMA 3ZSTA 1WKYA 4FO4A 1KWGA 3SRHA 4RLIA 1WXZA 3RM9A 3WQPA 1TV5A 3CL6A 1UD2A 3E02A 3HQNA 4J9JA 4MNLA 1A0CA 3WBYA 1WDRA 3B8VA 2R1NA 3OIHA 4B16A 4JZ5A 3W1UA 1GQKA 4Z08A 4DWSD 5AKQA 1GYLA 2DIEA 1VCFA 1W9VA 1K70A 3MBDA 3ARYA 3VE9A 4FNQA 2CERA 3UFYA 5ABFB 2SFPA 1VFMA 1V6XA 4DWDA 2PB1A 3APTA 3ARVA 3BOXA 4HU4A 4CU6A 4O0ZA 4CD4A 1AJ2A 2GJLA 4OT7A 1RPXA 4TX8A 1ZP4A 2V81A 4IL2A 2ICSA 4M7SA 1W1TA 4JTHA 5CPTA 2OOGA 1QWGA 3W07A 5HR7A 5EB8A 4HZ8A 2W67A 4HNCA 3PB0A 4ZOCA 2OZ3A 3T05A 4HMDA 3VABA 4EAYA 1U5VA 1KXQA 1K03A 3M46A 3NM1A 3R25A 4JY9A 2PDQA 1YADA 1VPQA 1RH9A 2RGMA 3S1UA 3ZM8A 2X41A 3IJ8A 4WJ8A 4REQB 2PPGA 1TCDA 3V36A 1WV2A 3MUAA 4GJIA 1B5TA 3MUXA 4PTVA 3UVAA 1LBMA 3CUZA 1CGVA 4D8AA 2DQXA 1ITCA 1S5WA 1E1CA 2WM0A 4G7EA 2J77A 4DYEA 2Y8VA 4EF9A 4AHOA 3W7CA 4B9YA 5LNRA 1EA0A 1A5LC 3HPZA 1PIGA 1UBPC 2QIWA 4GKLA 2VO5A 2VEKA 3GDKA 4TVCA 3UCQA 1BD0A 3T9PA 3LV5A 3CO4A 1RCOB 1C9DA 1CBGA 4YCOA 3DESA 2G0WA 3R11A 3GBDA 3RDKA 4D6HA 1GEQA 2E40A 3VDCA 3N14A 4DF0A 3FOKA 3OTRA 1RHCA 3KTCA 4LBSA 2A7NA 4FEZA 4GQGA 3C5QA 1IWPA 1TJ1A 2ZWZA 1AL8A 4FLRA 3LEPA 2V2DA 3UY8A 4RZ6A 3I3BA 1ONWA 4P8VA 2YL6A 4AYSA 1XLIA 3P60A 1QHPA 5IBXC 1B9BA 1E9YB 4IMDA 2P88A 4DJDD 4J3TA 2JIWA 1UKTA 3W2NA 3BAXA 3BE7A 4J3VA 1JNDA 4O16A 3G1HA 4TOQA 3APGA 1FWRA 3A4XA 4LAKA 5GJNA 1S38A 3KX6A 5KMYA 4X22A 3FS2A 5LIYX 3AWOA 1JD9A 3ARUA 1IXOA 4EVZA 3HN3A 3H23A 1IE7C 2XPKA 3ZJ7A 2FZ8A 1DWFM 1IXQA 2G41A 4EWND 5IRPA 2A3CA 4H9YA 4JFVA 2CZVA 3BTNA 3TP4A 1CYGA 4IGSA 1XIIA 3MO7A 4QFUA 2ZXBA 1WAWA 2QCEA 4R27A 4DM1A 2ZWYA 4YTRA 3F4CA 1C3FA 1OGBA 1XF0A 1VHNA 2WHMA 4IP5A 2E77A 2J6XA 3GNRA 1ISZA 3W1MA 3BSGA 1OX5A 2D73A 3TCEA 1QCWA 1NQ6A 2FHCA 3BW3A 4PL1A 5CSYA 4FHAA 4P8XA 3QZAA 1MW1A 2FVKA 4M3PA 1DXFA 1QXLA 3REQA 2WKLA 4KPLA 1DKWA 3PJTA 3Q58A 3UU0A 3VGBA 1TVNA 2X1SA 4OGZA 3ATYA 1XDLA 1RR2A 3AS0A 1E72M 1E0VA 4PBFA 4ILSA 1E4NA 1G67A 1XRFA 2CETA 5C6MA 4G1NA 4BZYA 1T40A 3ARWA 4OHQA 2WMJA 3M5VA 4MIMA 1J93A 5I23A 4UOZA 1IZJA 3QRHA 4MNKA 5DN1A 5BCAA 2WVVB 1L6YA 3VI2A 4UZUA 1QK2A 4WUIA 4AU0A 1LOQA 4HZMA 1YDVA 4XIAA 3U7VA 1EO7A 4E2DA 2Z24A 2A5HA 2OGYA 1K4GA 4PTWA 3W1PA 5D38A 1XGDA 3W76A 1PKYA 3DHPA 4IQEA 2XN0A 3NQEA 1WA3A 5D05A 1EJVC 1RD5A 5JH2A 1NSJA 3SCRA 1S3HA 4AC1X 4JTAA 2OX4A 4DUXA 5D32A 2EPMX 3S1VA 4UFMA 2WK2A 1HL9A 4DZHA 1M01A 3SJNA 2D20A 4QTGA 3OGVA 5HJXA 4J35A 4D6JA 4NUWA 4K8EA 3II1A 2V5CA 3GYEA 1AZ1A 2DT2A 4ZTXA 1Z69A 3LHTA 4D6IA 1BVWA 2WNQA 3LLXA 3I7SA 2ZOXA 1TPUA 1V77A 1WBJA 1HKKA 3VIGA 4PN2A 2O7QA 2Y7GA 3W7KA 5HPOA 4BWLA 1M5WA 1RUSA 1ITUA 1S2CA 1GVRA 1W56A 1CXIA 3NZPA 4JS3A 3N2MA 5KZ6A 2INZA 1TTIA 1WUFA 3QR1A 4C6KA 1YMYA 3TLLA 3TC7A 2WJZA 3KVMA 3LERA 1KM5A 1R2SA 4QITA 2ZQ0A 3UJRA 1CGYA 1C7SA 3LLDA 2ZUWA 4Q8UA 3S2NA 1UD6A 1MUCA 4US6A 1DORA 4NNBA 5CPLA 5C9UA 5A6BD 4PFHA 4E3TA 1TPEA 3Q65A 1XQKA 5LGXA 1L6WA 3KRUA 2R24A 1ZENA 3PTKA 4ZQPA 2Y63A 4AFYA 1FXQA 4IFKA 3U5UA 1JIBA 1EOKA 4HPGA 3UR5A 4UTTA 3L23A 5FJOA 1Y0EA 1K9EA 2FPVA 1KCKA 3I3EA 3BAYA 3UYIA 4UC5A 4EE9A 3KS6A 5AHLA 4H8VA 1TA3B 3S5SA 3MHFA 3LZ3A 4HOWA 3FYPA 3A4JA 1I0DA 3FHQA 3SCQA 2EPOA 1NU5A 5G1YA 1AZ2A 1US3A 1CT5A 4UQAA 2IPGA 3TAKA 1PWLA 3WUEA 5EPDA 6A3HA 1OK6A 4XBKA 3AYSA 4C6NA 4L65A 1G7VA 4TIMA 3EDDA 1P0BA 2IPFA 3UXIA 3CU2A 3LNMA 4FP1A 1UH2A 2J66A 4NNAA 2VOTA 1B30A 1P6BA 1E4LA 5KSWA 2WMIA 1E6SM 3TUUA 2CPUA 3RGTA 3BOFA 3M16A 4UQCA 3TN3A 3GXNA 2R8WA 3E2QA 1R87A 4DWSA 4XISA 3M64A 4JN6A 1W5OA 3NZ1A 4QAWA 3TOPA 4ERGA 4QGCA 2BXZA 1Q6RA 3GLCA 2NT0A 2HV5A 5EFFA 2PFHA 2O9RA 4JDBA 3A3WA 3F5JA 1U2YA 1KFLA 4Z2LA 1PBGA 3MSYA 1K8CA 2PF8A 3CZJA 1GTHA 3QMRA 3IV8A 3TJXA 3W7OA 4AD1A 4XV0A 4HP5A 4F0MA 3IJLA 2DP3A 5G5IA 3AIBA 3VOHA 2Y7EA 3LMZA 2EEXA 4UIOA 1W1A1 1QO5A 5LYRA 1ZCCA 5C54A 1HJUA 3PY2A 2Q8ZA 2C15A 4EXBA 5AC8A 3QHOA 4QR6A 3LSCA 3WDQA 1G6CA 1KCLA 4UQBA 4RXGA 3GXMA 1YLVA 2FZMA 2WWCA 1HP5A 2PWGA 4LUTA 1KWKA 1QW9A 1HIZA 2WOQA 3IIZA 4PUJA 2FZ9A 4ZZ9A 1XBZA 5AB3A 3DFNA 4MWAA 5CQ1A 1FY6A 2ZX8A 4Z1DA 1IHIA 2DZUA 2PODA 5LHFA 4POCA 5I77A 4BK9A 4GLEA 4H2HA 2Y7DA 4CCDA 5EMUA 4YJ5A 3SUWA 4YWIA 2VOMA 1J8VA 4M5PA 4LF1A 5DX7A 2XSBA 4K1GA 1BXBA 1EEXA 3AMGA 1QBAA 3C0JA 3TV8A 4RV3A 2D24A 1K02A 2QHAA 3H7VA 4JL2A 4WDUA 2PGFA 2ALDA 1GOWA 2KX9A 4KCUA 4Q7BA 4FAMA 2E8YA 4OFCA 3H26A 4MJZA 3W1LA 3RHGA 5EYWA 1QPKA 4N6FA 4GG9A 4O1DA 3LRKA 5CGTA 2ZUMA 3V16A 4MSSA 3BLLA 2B7NA 4LUYA 2J25A 3E0IA 3LRLA 3BG5A 1CI1A 3GFZA 1P7TB 2XFRA 4U2ZA 2PRMA 3N6QA 4ECLA 4DYJA 5BXRA 4IQJA 5EGRA 1Q6OA 1FH8A 3LA4A 2J7HA 2QJHA 5I79A 3GXTA 4Y7EA 3LCGA 1B2YA 3VVGA 4M81A 1XICA 1HO4A 2ZZ7A 3AIEA 3O3RA 3GHTA 3N4EA 5A6LA 1WE5A 1ICPA 1YDNA 3UPWA 2PGWA 1X1NA 4PFMA 1QI0A 3TR2A 3V5OA 1DQWA 3MANA 1G69A 2FB2A 4I9JA 3B0XA 1UP3A 1EX1A 2JKEA 2IXUA 4TX9A 4HK7A 3GAYA 4BEQA 3TNBA 1NP2A 1CNVA 4GUJA 1CXHA 1XRVA 1VHCA 2Z2UA 3MQTA 3CB3A 3PB2A 3ZLGA 1G9HA 3CIWA 3NDZA 4MJ2A 3WH7A 3TR9A 3WSUA 3FKRA 2GFTA 4H8HA 3LY0A 3FA3A 2D23A 4UTMA 1DWGM 5CGMA 4QJ4B 2A3AA 3U5YA 1OC5A 3CLMA 3BH4A 1KFEA 2YXXA 3FK4A 1R7AA 5FJRA 4J27A 3VD7A 3UJSA 3WQVA 2W27A 4JAWA 1WOBA 3QV7A 3LCWA 5FSDC 1Q6EA 1RBAA 3ZZ1A 5ABHA 4XBSA 1RZMA 3KBMA 1M9HA 2POTA 4L4LA 4CGTA 4ORIA 4LBRA 1WXJA 3FXYA 1A3WA 1XLKA 1JYVA 5DY3A 4QIUA 1F8IA 1GKPA 4O0KA 2VCBA 3WNKA 4V33A 3RRAA 3W1XA 3CASA 3PJUA 1GHSA 1RY8A 1VRDA 1SO6A 2TSYA 1GW9A 1D3GA 3EA2A 2YBUA 2WKJA 2WSRA 1XSIA 4IG2B 1NY1A 1B90A 1FWHC 3BK0A 5FF4A 1OCBA 2X0SA 3LI0A 3M0KA 3G5EA 1BYCA 4DJFC 1O4UA 1DHPA 1E6PA 3EEGA 3S3GA 4MZYA 3W1NA 4JCLA 4GBUA 3CQIA 1FWJC 3RJYA 2PWFA 3F2BA 1K8YA 1D3HA 4CNTA 3GG0A 2E67A 3WLHA 1SM9A 1KTNA 1REQA 4C6QA 3N2BA 3OYXA 1PS9A 2GWGA 2V82A 3O8AA 3LPFA 4C6PA 2IKHA 4MNMA 1HJSA 1QI2A 1OY0A 3GG1A 2GZXA 4C5YA 5JBDA 5FJPA 2F6KA 3I7QA 3GIQA 1V02A 4CVUA 4UTHA 2V9DA 4YPJA 3CV6A 3WJSA 5LA1A 2FPTA 1DWIM 3FIGA 3NQVA 4AY7A 2FYMA 5C7HA 1XSJA 4RDYA 1UC4A 1RA5A 2HEJA 2Y61A 1AQ0A 1ZPTA 3WLKX 1YIXA 4BQ4A 1ESWA 1XFBA 4KWVA 2PDHA 3F1QA 3W81A 2XJ7A 3PZUA 3QF0A 4KEVA 2DUZA 4ZQMA 4TXEA 4YU1A 4KFPA 1W5PA 4QCEA 4HVXA 1E40A 3U2EA 2E4TA 5AHEA 1FDJA 4PTXA 1M7JA 2D2HA 1Q6QA 1QPRA 1UWSA 3O06A 1RJPA 3NVTA 4M7TA 4O1BA 4C7GA 1EJWC 1BRLB 1HG3A 1S3TC 3BV4A 3DFPA 4HD5A 1YE4A 3W7IA 4MKVA 4MFDA 1Q6GA 3WFAA 4S1FA 2XGBA 4IMFA 5ABEA 2Z6JA 1TZZA 5D8WA 3VIIA 3RLGA 1OABA 3BWWA 3C52A 4FB7A 2XFYA 5GNYA 1LZOA 2ZA1A 2Q09A 3S2JA 2JEQA 2VHLA 5EKYA 1XIDA 4CCZA 4IQLA 1JF5A 2E5CA 4PEKA 3L5MA 3IGHX 4LRTA 1EXPA 2PEVA 1PAMA 4GXPA 3GNOA 2JALA 5FESA 3EWBX 3P80A 4E2VA 4P8WA 2NT1A 3B9NA 1K4HA 1PYFA 4FOUA 1S5MA 2PC4A 4UB9A 1PB0A 1RQBA 4A2RA 3M6YA 1W2PA 4EP8C 1UZHA 6CGTA 3PAJA 3WF0A 3HZ3A 3U2CA 1H7WA 1GVSA 3LBMA 4XKMA 3W38A 2ZVIA 3ALFA 1ISVA 3WF1A 5I03A 5FEZA 2HNEA 1UIPA 3TYCA 3NOEA 2WNWA 4PA8A 2QCLA 1DYSA 1CCWB 4ZXLA 5CBIA 3GDLA 5BWFA 4FOKA 2BXVA 3VFLA 2J7GA 1CGXA 4WXZA 4EACA 1XLBA 1Z41A 3H12A 3GC4A 3MUZ1 4MY8A 4P61A 4K7VA 4ZOEA 1F9CA 3N12A 4AAJA 4RJEA 2QQ6A 4NKCA 1F8MA 3LTSA 1OG0A 2FFCA 1B9ZA 3SO7A 2OQHA 4WIWA 1FP8A 4E5TA 2I9EA 3OW1A 3CBWA 2X2YA 1RCQA 1LP6A 1VLWA 3PNZA 2IMRA 1IWAA 1YNQA 4AZCB 4J3UA 4QEEA 1NDVA 2Y8UA 1TMQA 4PB3A 2VCAA 1GUVA 2A6NA 3OBAA 3VM7A 3W0KA 3EGJA 1XBXA 2VWSA 4S2CA 1C91A 2AQVA 4O53A 3FAWA 1R3WA 1UD4A 2BY1A 3W4RA 4H9TA 2YR1A 3QC3A 3KRZA 5CZ0A 1RQEA 2Y89A 3BL3A 3UNDA 3WEZA 2QW5A 3QZEA 1QOPA 3T0BA 2FTWA 2DUAA 3ARRA 4PL2A 1QPQA 4I7UA 3TCSA 3KWSA 1ML1A 5FACA 2ZUSA 3M47A 4PMDA 4FX7A 3MMWA 3NIYA 2YA2A 4EWJA 1OEPA 1WCGA 2P53A 1CW2A 4LC8A 1KTBA 3C6CA 3M0IA 2BGQA 1TRIA 5E09A 2Z2BA 1AH3A 4XG1A 2OMAA 3VC6A 3GDRA 3W26A 3VKJA 1TJRA 4GH3A 4AYGA 1L2QA 4J4KA 4M6VA 4ADTA 3R79A 1Z48A 2G95A 4WR3A 3WLSA 1JPHA 3VNDA 4ACZA 4YCPA 5A1AA 3ZT7A 3AUJA 3HG2A 4GGBA 3FEMA 2PU0A 2E9MA 3QTGA 5FEWA 4YLWA 1EEPA 1SUXA 1WZKA 1OX4B 2HXTA 5I09A 4AVNA 4FZIA 1XINA 4W7VA 3VYLA 3PZQA 4AZBA 3MJMA 4I7WA 3USBA 3A64A 3HM7A 4KCVA 1A80A 4L4MA 3IEBA 3G8RA 1RD6A 1LT8A 1ZRQA 4R7JA 3VDAA 2ZRXA 1MZHA 3GTIA 4U4MA 1CX9A 5LSMA 1CZ1A 2UWFA 1U22A 3PBGA 3PPFA 2PDUA 2A79A 1XWYA 4F3HA 4DM2A 1AW1A 2GQ9A 4IIGA 1O12A 2BFGA 2EG7A 1Q45A 4IGHA 2EJ1A 1J11A 3TK7A 2VFIA 4S38A 4JDYA 2WNNA 3WLTA 2ZX6A 4PODA 4HK6A 4PMYA 2ATSA 4KS0A 3ITXA 3GB6A 2EPNA 4YTQA 1JUKA 3ZLHA 3R43A 1ZBVA 1N7KA 5LXEA 4A8LA 3SBFA 1O5RA 4F66A 2Y8KA 2DORA 4GZIA 3GU1A 1AQHA 3EZ4A 3JZEA 4IIEA 4K37A 4WSKA 1J2BA 4GO9A 1OWQA 3E0FA 4QLLA 2BS9A 1U1HA 4XZNX 3WN6A 1IEWA 2W66A 4A3HA 2FH8A 4D8LA 4Z0JA 1NDWA 3UR7A 1VEOA 3UPBA 5JVLA 2VUNA 2RGLA 4GQ0A 2VWTA 3JRKA 1HJXA 2GSEA 5D9PA 4F0LA 5HPCA 1GVEA 5I3KA 3DU0A 3RU6A 1FOBA 1DXEA 3WK1A 1LG1A 1SZFA 3MJYA 2QV5A 4Y9OA 1V51A 2VKZG 1J0JA 2OTDA 1ADDA 1H3GA 2QF8A 4W8LA 2BMBA 2BVDA 2YZRA 5FKYA 3FEQA 4JTJA 1SR0A 4LAUA 4GYPC 2QMKA 4Z2GA 4M24A 1EX5A 2INEA 3PN8A 3QMSA 5HXMA 3VD4A 5AZ0A 3WIJA 2AOSA 4BI7A 1SJAA 4DI9A 2W79A 1XYBA 1QHZA 1YTKA 2NXHA 1CLKA 2P8CA 3VMPA 4PMUA 5TF0A 4AD2A 5LNUA 5A69A 1Z89A 4LANA 5H1WA 1MNZA 4IFRA 4ZOBA 3LQLA 3P5YA 5GQBA 3M7SA 4KMQA 1KBKA 1J2WA 2GL5A 4MB1A 4F48A 2WZMA 3CAWA 2QUVA 3FKKA 3NGJA 3BAWA 1MXDA 2GJNA 1YPIA 3TLQA 2V2CA 4CEUC 4K3ZA 1PO9A 3QHMA 4P7NA 2C1HA 3MWCA 4AG0A 4UFHA 3NPUA 4KBXA 1JAKA 2W9MA 5LIXX 1BSLA 2E25A 1OFRA 4GQQA 4J28A 4LQ1A 1HJQA 4JQ4A 2OFJA 3W2MA 4L6HA 3O16A 1YBQA 3HA1A 4AIEA 2NLIA 1TV2A 2YDAA 4I9AA 3THUA 4UFIA 4KF1A 2J62A 1KRCC 3WD2A 2Z29A 4HTBA 3G1XA 2I17A 1POKA 4YHGA 3IWPA 2J7FA 3A22A 2R1MA 4W87A 3AXHA 3LSBA 1JDCA 4GI6A 1TX0A 3P0WA 1XKYA 5DT5A 1PX3A 3CV2A 4R7OA 4AMAA 4AZ5A 2X40A 5BRQA 1JQVA 5E93A 4GNVA 4CLMA 2AL2B 3GFYA 4D6FA 5PTDA 3WX7A 4N2YA 3VMOA 4C6MA 2RUSA 1JRBA 3OHMB 1ZGDA 3ARXA 1TUFA 2W3ZA 3O9NA 1M7PA 2B7QA 2J6VA 2EKGA 2CIPA 2QCDB 1YYAA 3G77A 1UR9A 3V7PA 1UHVA 1MUMA 2OQLA 2O4QA 1OGSA 4AEFA 3W71A 3KP1A 3N04A 4LALA 4CEXC 1O7AA 4PEEA 5EBUA 3FVMA 1GGOA 3WQFA 2A0NA 1JAEA 3KL0A 3MMUA 2OCZA 3AS1A 1IGSA 3GFXA 3MW7A 5HAOA 1EYEA 1VYPX 1G1YA 2PTWA 2C3ZA 2PWVA 4XKYA 1W1B1 5AZ1A 4B5WA 1E3ZA 4V27A 4QJ3B 1LORA 1Q5MA 3MPGA 2Z4GA 4DEFA 2WSPA 2PDNA 5AC4A 2REQB 5C2CA 5D02A 1K3UA 2J8TA 5I06A 5BOEA 3M0HA 4OOZA 1WZMA 4LFYA 1GVQA 3E49A 3TAOA 1ODZA 5JMUA 3FVDA 3HFYA 2WBGA 2XFFA 5HANA 3EX3A 4BQ2A 1A47A 1KNWA 2J79A 3DBPA 5IOBA 2VGGA 4BI6A 4ALDA 1E6NA 1M3UA 3DFQA 4ZE5A 4UFLA 1KFCA 2EKCA 2GGIA 2QDGA 2WLYA 4QM1A 3W02A 1KTCA 3G1DA 1TJPA 5CPMA 5A6MA 2H3BA 2NWSA 1JPKA 4BS0A 1F05A 4FNSA 2QUTA 2PDLA 3MHGA 3O6DA 4JTRA 1A53A 3GC2A 3L21A 1FCUA 4KEUA 2QAFA 2WC7A 1GQIA 2BG5A 4RE0A 3QHNA 4NZ5A 2E9LA 2PA6A 5A6SA 2F9RA 3NSXA 5A8GA 4LYRA 1HFBA 1JXJA 1VP5A 4L80A 2X05A 4TTUA 4JIIX 4AIOA 2GJXB 4RDZA 3CZKA 4S3FA 5E0FA 2OKTA 3CV1A 4GK8A 1F7BA 1EHNA 3S9YA 1C8XA 4PE8A 4NI8A 3AO0A 4XQ6A 1UMLA 4WX2A 1JEZA 4TUFA 5D2XA 1KXHA 5HR6A 1CLVA 3BZGA 3BXWA 2DU2A 2J8FA 1ADSA 3EPOA 1XISA 2DZBA 3GD6A 2WSQA 3EX1A 1H1YA 2CHNA 5CPQA 3CMGA 3OZYA 1TV4A 4DNMA 4FX8A 4LUIA 5D9MA 3NQCA 2XH7A 3S42A 3OVGA 4NT0A 4AC7C 4IQDA 4WLCA 2D69A 4TVUA 2XVPA 4Q4KA 3PJXA