1B31A

Xylanase from penicillium simplicissimum, native with peg200 as cryoprotectant
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
302
structure length
302
Chain Sequence
b'EASVSIDAKFKAHGKKYLGTIGDQYTLTKNTKNPAIIKADFGQLTPENSMKWDATEPNRGQFTFSGSDYLVNFAQSNGKLIRGHTLVWHSQLPGWVSSITDKNTLISVLKNHITTVMTRYKGKIYAWDVLNEIFNEDGSLRNSVFYNVIGEDYVRIAFETARSVDPNAKLYINDYNLDSAGYSKVNGMVSHVKKWLAAGIPIDGIGSQTHLGAGAGSAVAGALNALASAGTKEIAITELDIAGASSTDYVNVVNACLNQAKCVGITVWGVADPDSWRSSSSPLLFDGNYNPKAAYNAIANAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (XYLANASE)
publication title Xylan binding subsite mapping in the xylanase from Penicillium simplicissimum using xylooligosaccharides as cryo-protectant.
pubmed doi rcsb
molecule tags Family 10 xylanase
total genus 130
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1998-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1b31A00
3W6MA 1JF6A 2EPNA 2WKLA 5LA1A 3VGFA 1GQIA 2WK2A 1O6IA 3ALGA 1GQJA 2CETA 4DWSA 3CO4A 4JIEA 1NOFA 2BVDA 2DSZA 2FH8A 4N0RA 1JZ2A 3AXHA 2J77A 1IT0A 3VIKA 4UOQA 1UKTA 5CPQA 3WUBA 3AFBA 2YL8A 1PJ9A 3AMCA 3MUIA 5I79A 1HKMA 2VZTA 4JFSA 1G9HA 3FHAA 3LPGA 4CD5A 1B30A 3AICA 4AZ5A 4M56A 9CGTA 1ECEA 4UQ9A 1Q4NX 4ACYA 3PZMA 1DEDA 1E55A 2EPMX 3KWXA 3VDCA 4U5KA 4JKKA 3GNOA 4AW7A 3W37A 4PUEA 2FH6A 3BGAA 2Y4SA 5LA2A 3UESA 1V6XA 3AIRA 5DO8A 2FHBA 1FH8A 2PWFA 3CUGA 1CGUA 2CBIA 1GOIA 4HZ6A 2VO5A 2E0PA 3DHPA 2D3LA 2E9MA 2VMFA 5IHRA 4D6FA 3WF4A 3SUTA 3NSNA 4ATLA 4PEEA 1MW1A 4WIWA 1B3XA 5BYWA 3VINA 3EBVA 4EAMA 3W24A 1E6RA 4HMDA 2WLYA 2ZUVA 4P7QA 3ECQA 5CGTA 4W88A 1BVZA 4ZEPA 4QFUA 4PMDA 4KRUA 1E5NA 1ZJAA 4V27A 4LGXA 1CXHA 1BPLB 2WVVA 1VAHA 1HJXA 3WDHA 2O9TA 2D2OA 3DECA 3WFLA 3AIUA 4LYQA 2VT0A 1UWSA 3OLIA 1G5AA 2Z1KA 1UKOA 1VFOA 2J62A 7A3HA 1W3JA 4AXNA 3U57A 2G4FA 4GO9A 4H7VA 4UR9A 4D71A 2J4GA 1BHGA 3F5JA 1VEPA 4UFLA 3SUWA 1ODZA 3ZSSA 4TX6A 3AHYA 3ZQ9A 1CXEA 3PN8A 1UWQA 2CKRA 1OB0A 5A6LA 1D7FA 1TVNA 1Q6GA 4WKFA 3B9AA 5AC4A 3ZR6A 3K8LA 3NCOA 1KWKA 2D20A 1HP4A 3KE0A 2YIHA 4FF5A 1HXJA 1TA3B 3ZOAA 1E43A 1W9XA 1VFMA 1JD9A 1GCYA 3D3AA 4MJ2A 5ABGA 4KGJA 1UA3A 3CGTA 3T0BA 4DUWA 2D1ZA 3VM5A 3N9KA 4HU8A 5CJ5A 3CMGA 3WQ5A 1ZBVA 2UY3A 2W92A 1ZL1A 2WM0A 1DTUA 3N17A 1CLVA 1QW9A 2WCGA 1E6XM 1H1NA 3GYCA 3S2CA 4J3WA 1N82A 3AS0A 1UZ1A 1UA7A 1W1YA 1W91A 3QGVA 5DT5A 1H0IA 1EO7A 1MW0A 1US2A 3MU7A 4PMXA 1KBKA 1J01A 5CZKA 1VBRA 3U7VA 3WH7A 2VCAA 3I3EA 1GORA 4WSKA 4XUYA 1HJVA 3AIVA 4KH2A 2XVKA 5IHSA 1JZ7A 2E3ZA 4MNKA 1CDGA 1HNYA 1X6NA 1J11A 4AZGA 2ZUUA 2CERA 1HKKA 2G3NA 2XVNA 2XM2A 3GNRA 3MV11 2YDRA 3WN6A 3CUIA 1GZJA 1H11A 3LPPA 4LPCA 2X8RA 4J3UA 4J3SA 2XHYA 3DHUA 5CSYA 3RM9A 2PF0A 3PZVA 1CGTA 4BQ5A 2EBNA 3BXWA 3VIJA 1W9DM 1GONA 1PZ2A 1EDQA 4J28A 2VCBA 3B9DA 1CXIA 4P7RA 5D9MA 3NJ3A 3UETA 2PBOA 2QPSA 3WDJA 2A3AA 2CBVA 4S3JA 4JL1A 3WDRA 1KBBA 1ZB5A 1QHOA 1CGXA 1SYTA 5A6MA 4F9JA 3N1AA 4Z2LA 3WIJA 4AD1A 5IDIA 5TD4A 2X0HA 1OT2A 6A3HA 1UD8A 4OBSA 3L4UA 3T2QA 1V02E 3WY1A 1B2YA 4WF7A 4EK7A 2A3CA 4PMYA 1H3GA 5D9OA 1EIBA 2A3BA 2ZWZA 1JNEA 1GOWA 5E09A 4CVWA 3NDYA 2QHAA 1XH0A 3BAWA 1FP8A 3I3BA 3VNYA 1UH2A 3WF2A 4NRSA 1NP2A 3ARQA 2PI6A 1E6ZA 4WSJA 3IJ9A 4X0NA 1JYNA 1PIFA 4KRTA 2WZEA 2W91A 4PCTA 2BY0A 1V6VA 4YHGA 1TA3A 1LLOA 3OLGA 2V38A 3VD5A 5D4YA 2ZIDA 4PSPA 2CKSA 4ML4A 2VNCA 4P8VA 1E0VA 4AYSA 1E56A 3KL3A 4M24A 4AEEA 1V3MA 5A8NA 2J7DA 2XGBA 2XPKA 4H8UA 3W29A 5BXPA 2DPEA 5A3HA 4CCDA 4FLOA 2OYMA 3WELA 1JXKA 5HPCA 3CUJA 4S3KA 2X09A 1B3ZA 3EDDA 3RM4A 1MW2A 5A8MA 1UWIA 4DWSD 3TP4A 1E3ZA 1TCMA 2YJQA 1UH4A 2VI0A 4HOWA 3OLDA 3WMSA 4HA4A 5E6YA 1JAKA 1PBGA 2C8NA 4CD8A 1XGZA 1WZKA 5LA0A 1PAMA 5DMYA 1CTNA 2QF8A 4D6CA 3EMCA 1XH2A 3HU7A 4MB3A 3MUAA 2GJPA 1LG1A 1ZBKA 1QPKA 1UKQA 4K68A 1J0ZA 1WDSA 3WNLA 3HJEA 1W1PA 5D8WA 4CU7A 4UNIA 1W3KA 4HMCA 4PSRA 5A8OA 3WMCA 1CENA 3PTKA 1XSKA 1C92A 3F5KA 4UFJA 3WMBA 3VPLA 1R86A 4Q22A 1WB0A 2BFGA 2EPKX 1K9DA 3SCQA 5A95A 1WNOA 2YLLA 3M7SA 4PMVA 1FHLA 4U2YA 4YN5A 4F8XA 3GXIA 3EMZA 1JNDA 3B9EA 3SCOA 2W4XA 1XC6A 2ZE0A 4GZJA 1CLXA 1HKIA 1H4PA 4R27A 2JFEX 2VZUA 4PYSA 3WDPP 3ZM8A 1JFXA 1UKPA 3VM7A 1QI5A 3AXIA 4E2OA 2BV9A 3BCDA 3ARUA 3PZOA 4N42A 2BY1A 1WE5A 3TTOA 3AMKA 3VGBA 3WUGA 1K9TA 3ARVA 3FW6A 3GH4A 3PZTA 2VC9A 5DEZA 4UQDA 4D1IA 4XV0A 1EH9A 4D6GA 2VL4A 1BYAA 4PCSA 4LYRA 3ALFA 3TTQA 2TAAA 5JIPA 1KXTA 3BCFA 1OD8A 3T09A 1NM9A 4ZXLA 3S6TA 1BGGA 3ZJ8A 5CLWA 5CQ1A 3PZUA 2VURA 1DWHM 2WHMA 3AMDA 3ZT7A 3CZKA 2AMGA 2OLHA 2YA0A 2XIBA 4AIUA 2JIEA 1QHZA 4CU8A 3NUKA 4P8XA 4TXEA 1W2PA 2BHUA 2WVUA 4MDPA 3L4WA 1Q6DA 3AROA 3GNPA 2VX5A 3SCVA 1C8QA 4LXFA 4UFKA 1V3KA 3M46A 3W38A 3SEPA 1VENA 1CPUA 1E6SM 4AZCB 2D22A 3K4DA 2WMFA 5ECUA 1HIZA 1OD0A 3SCPA 3ARXA 4MAZA 4UZSA 3WNMA 2OYKA 5BWFA 3WH9A 1W9BM 1LF1A 5FIPA 5E70A 1UR8A 4XZWA 4CD7A 2DDXA 1OIMA 2Y5EA 1UQZA 2BVTA 1DWAM 1WZMA 1GHRA 3TTSA 1W9PA 4TOQA 1LL7A 3CHFA 2WANA 3A47A 3K8MA 3PZQA 4XZBA 1RH9A 2WC3A 1V6YA 4B9YA 2WMIB 3OG2A 4JHZA 4XB3A 4OKDA 2WMHA 4D6HA 3ARZA 1R7OA 4HU0A 3DYPA 4JAWA 4AD2A 1RP9A 3SCSA 2G8ZA 3WNKA 1XD1A 4NSBA 3T2PA 4JKMA 5CLTA 3MSGA 3L4TA 5CSUA 3CBWA 3VD7A 1EO5A 3PZGA 5HDRA 1HP5A 3WNNA 4CD4A 1CIUA 4GZIA 4AY1A 4BA0A 1JZ5A 1QBAA 4FK9A 1MFVA 3SIMA 4L4OA 1AQ0A 3CH9A 3O6AA 3A6OA 2PWEA 1HX0A 5E6ZA 4J3XA 2OSXA 2J7EA 1BG9A 5ABFB 1HJUA 2O9PA 1W9UA 1D2KA 4LYPA 5A6JA 2AAAA 2IXUA 3AHVA 3LMYA 1UUQA 1TMQA 2WSKA 1EHNA 3EYPA 2W63A 4RE3A 3BAXA 4JCLA 3OZOA 2XVPA 5FL0A 3L4ZA 1OINA 4AEFA 2UY5A 3CIVA 4QLJA 4GKLA 1NWTA 1JI2A 2NT1A 2UWFA 2CBUA 5JBEA 3AJ7A 3IANA 4MNJA 4D72A 2DIEA 1KXQA 2VRJA 4TVCA 2XWEA 2BY2A 2Y8VA 4C7GA 4CUCA 4QP0A 1A47A 1K6AA 3MSDA 1U33A 3WNPA 2QMKA 3N18A 4B3LA 1DWIM 3QHNA 3POCA 4W86A 1JDDA 2XFRA 4AZCA 1HVXA 1MFUA 2X0YA 1LG2A 1PIGA 1M04A 1J9YA 3CTTA 4Z2JA 5I78A 2ZICA 1KGWA 2V3EA 3FY1A 1GQKA 1NWUA 1V0NA 2DT2A 2XFYA 5M03A 2W62A 3WEMA 4BS0A 2NW0A 2J7CA 2ZOXA 3PTMA 1UR9A 1OGSA 1SMAA 4DWSC 3RJXA 2VQTA 2UY4A 3RMEA 2VX4A 2UY2A 4AD5A 4D6JA 1G94A 2F61A 1JG9A 3NYDA 2PC8A 5LYRA 5HBFA 1Q6CA 3W26A 4UQEA 1MYRA 1JIBA 2VR4A 1V6UA 2WMIA 2YLAA 5A6SA 2CESA 1XH1A 1V3LA 2XUCA 3PTQA 4B9ZA 2VTFA 4KMQA 3ZT5A 4CKQA 3OLEA 3VX0A 4MNMA 2MANA 3CLWA 1MW3A 1JZ8A 1J0YA 1PX4A 3UEQA 1ISVA 1C91A 1C7TA 3UCQA 2OWXA 2WBGA 3A3HA 2X2YA 1BAGA 3PZNA 2ZUWA 1CGWA 2D0FA 3U5UA 4JFWA 2DGAA 2WHKA 4EE9A 4M29A 1E6NA 4M82A 4P7NA 3VO0A 3SCUA 1C90A 3ZO9A 4JHOA 1PX8A 5ABFA 1J0IA 1YQ2A 1FA2A 4GI6A 1OSEA 2W61A 2QMJA 4F79A 3WL1A 3WL0A 5I2UA 1VF8A 2BXZA 1JYVA 1OM0A 4W89A 1JL8A 4ZFMA 1QI2A 1UYQA 3KZSA 3MKKA 4H41A 2E9LA 3N13A 3PZ9A 1A3HA 4L4PA 4UTFA 4OJYA 3SCWA 1H49A 3CHCA 4UQBA 4H2CA 2BY3A 3IAQA 3NSMA 2ZUTA 5A1AA 4UQCA 2W5FA 3T0AA 1DHKA 4Z2GA 4RE4A 1GOOA 3WH8A 5FD0A 1CWYA 5C71A 2EPLX 1BFNA 1XV8A 1KQYA 3A4AA 1AVAA 3VD4A 2G3MA 3EDFA 1GNXA 3OIHA 1BYBA 2XGIA 3GZAA 3OA5A 2WHJA 1IZJA 1M53A 1CXLA 2V3DA 3WENA 1I75A 4C7DA 1C7SA 1QI0A 1QNPA 4P7LA 4R5EA 3VIIA 2BS9A 2WWDA 1XCWA 3VIOA 3VDAA 2WAGA 4JCMA 2EEXA 5JUVA 2DIJA 1JF5A 1R8LA 5GNZA 1J12A 1W3HA 1DWJM 5ABEA 1UD3A 4GO8A 4AZHA 1EDTA 1HT6A 4URIA 1ITXA 1GJWA 4U3AA 1F4HA 3VDBA 1BLIA 1NWSA 1CZ1A 3OGRA 2JF7A 1MVYA 1M01A 1UQYA 1ZBWA 3RPMA 4F66A 1VRXA 4QLLA 3GXFA 3II1A 2C0HA 4MDOA 1XSJA 1JFHA 3APGA 4B3KA 1H41A 1KCKA 4W85A 5KZ6A 1BYDA 4W87A 3L4YA 2CYGA 1FFRA 1MWOA 3VDHA 2WZIA 1KR1A 4OOZA 1RP8A 3ZSTA 5M5DA 4PRWA 2DSWA 1W32A 2CNCA 3VGHA 4MB5A 4AD4A 1AQMA 3RCNA 2DSVA 4V28A 3CZ8A 3UG3A 3NSXA 4CCEA 5EMYA 5CGMA 1QI3A 3CZJA 4WKHA 5A2CA 3BLKA 4GIAA 4HOXA 2F2HA 4PN2A 3WUEA 3B8SA 3AZRA 1JDCA 1G1YA 1QNOA 3AIEA 4X0VA 2X05A 2IXVA 1K9EA 3TONA 4D6IA 3WD4A 4AWEA 2VX7A 3GBDA 4J3VA 2VZOA 3ARWA 2WVSA 1S46A 1CXKA 2DT1A 1QOXA 3AHTA 3RJYA 1WZAA 3LPFA 1OGBA 1XYZA 2WNWA 2BXYA 4IUGA 1V08A 4NZCA 1OT1A 4OBRA 2E40A 1DWFM 1E4IA 5EB8A 3A4WA 1MQRA 3L2LA 3JUGA 2RGLA 2F8QA 2VVSA 4PMQA 3W4RA 3OB8A 5A6KA 1G01A 8CGTA 4OOUA 1CGVA 3F5LA 1ZU8A 4W7UA 1K9FA 2CIPA 2VVNA 1I1WA 1JI1A 2B31A 4J3TA 4PMOA 1G0CA 4TVDA 1V3HA 3AS1A 1OIFA 1QI4A 1MXDA 1PZ3A 2DH2A 5A8PA 2FGZA 1JZ6A 4OZOA 1HF6A 4PTVA 6CGTA 4FLQA 1HVQA 5BXTA 3GXMA 1LL4A 3DYMA 3AOFA 2VR5A 4H8VA 3AIQA 3ARRA 3UERA 2JIWA 1PPIA 1B9ZA 3BAIA 1BTCA 1TE1A 1L0PA 3W53A 3WQWA 1FH9A 1HKJA 1UWUA 4BCEA 1BVNP 3BAJA 3FN9A 3HN3A 3RIKA 3ARSA 2WXDM 3EDJA 1E73M 2EO7A 1E70M 3TOPA 1B3YA 1W9VA 1ZBCA 5I23A 4RL3A 3E1F1 1X1NA 4J7RA 3WKZA 1UR4A 3BMWA 3ZR5A 3AS2A 5JBFA 2NSXA 2JALA 2VZVA 3SUVA 3W82A 4Z2IA 1ISWA 2ZX5A 2D23A 1BG4A 3UG5A 1M03A 1Z32X 3N15A 5FL1A 2XVLA 2WB5A 2WPGA 4TUFA 5D9NA 1XHGA 1FOBA 2WW5A 4LX4A 2D3NA 3WBEA 2J47A 1UR0A 3VVGA 2J25A 1UH3A 2FGLA 1ESWA 3RO8A 3U7BA 1BSIA 3SUSA 1E4MM 2V5DA 4NF7A 2WCAA 3QHMA 3MMUA 3VD3A 1RPKA 2W66A 3W6LA 3VIFA 1VB9A 3WUFA 4F9DA 3WD2A 1V6WA 3AHZA 1E0XA 1UOKA 1GQLA 3ZMRA 1E6PA 5I6SA 5DFAA 2ESCA 3T0DA 4H04A 2ZXBA 2WYSA 3AYRA 1ITCA 2E4TA 4AZBA 2GJXB 3WDIA 4DM1A 3K46A 1B31A 3VX1A 1CECA 4QCFA 3FAWA 1JDAA 4PBGA 5E0FA 3K4AA 4AZ6A 3T08A 4HA3A 1EA9C 1W2VA 1XSIA 4JZ5A 4TTUA 1JAEA 2VCCA 5E0CA 3WH6A 2Y2WA 2ZUSA 4AIEA 2XSBA 1E1EA 1GOQA 5I77A 1WO2A 4B16A 5BROA 3BMVA 3AI0A 1EQPA 5DF0A 1TFVA 1H5VA 1B3VA 1D3CA 1H2JA 1XYFA 1LWHA 2E8YA 1U2YA 2FDMA 2YKKA 1E4LA 3MUZ1 2ZUMA 3UR8A 4PMZA 2VJXA 3HMCA 4QLKA 1JZ4A 2NT0A 1J10A 1E6QM 3ARPA 2WBKA 1GOMA 2EXOA 2J7BA 1UZ4A 6TAAA 2FHCA 3AZTA 5GNXA 3ZT6A 2YBTA 4TTGA 1Q6FA 2A3HA 1JYXA 1JXJA 4KWUA 3N12A 4W5UA 1GUVA 2CPUA 2PWGA 3OGSA 4MADA 1VFUA 4LQ1A 1TR1A 3L4VA 2G3IA 3AS3A 5ABHA 2VZSA 3F4VA 3WEZA 4AMCA 1J0HA 4OUEA 1E1FA 2EPOA 1B3WA 4GINA 1KXHA 4MJ4A 5HXMA 4P8UA 2WZHA 2W67A 1NOUA 3QR3A 2CHOA 4FMVA 1UHVA 1P6WA 2OSWA 4CD6A 3K1DA 4E8DA 1E40A 5BXRA 4PTXA 3OGVA 3VU2A 1QNRA 1EGZA 4PTMA 1UG6A 1VEOA 4NRRA 3WH5A 2V3GA 3IAPA 2DQXA 3M07A 2RGMA 4BQ3A 3VGDA 3QOMA 3MMWA 3MMDA 4U31A 3THCA 2CCRA 1NQ6A 5CPSA 3ZJ7A 5BXSA 3W27A 3SCRA 3GBEA 5F7UA 3SURA 4DUVA 4YPJA 1FFQA 1V0LA 3I3DA 7TAAA 3K8KA 4UQAA 1B90A 1NARA 1C8YA 3BSGA 3RILA 5CG0A 4IPNB 4PUDA 4UFHA 4B15A 2YDQA 2XSAA 2BVYA 1H09A 5A6BD 3ARYA 3AISA 3BLPX 1U30A 2ZUNA 3L4XA 1SFSA 1IZKA 3BAKA 4W8AA 2X1IA 3GM8A 4BF7A 3VOCA 1PX3A 2Q8XA 4V2XA 3W28A 4ZXOA 1KQZA 3AZSA 2GJXA 2XFFA 3WD0A 1DP0A 1QNQA 2JEPA 1L8NA 2D24A 1CNVA 2GDVA 1UKSA 5FCZA 1W1TA 1OWQA 3MUY1 2J74A 2QLYA 2XYLA 4MB1A 4W84A 3MS8A 3WFZA 1LL6A 3WQ6A 2PWHA 3FHQA 3EDKA 1GHSA 2YL9A 3N11A 4AISA 1ZJBA 1WDRA 2DSUA 4P8WA 2YBUA 5GQBA 3VIGA 2VRKA 2PWDA 3WF3A 3T2OA 4A3YA 3UG4A 4U2ZA 1KB3A 1TUXA 2G3JA 1CBGA 1EOKA 4GI9A 2WCSA 3N04A 1QVBA 3D5HA 2DEPA 1WCGA 3GDBA 2YA1A 1PEZA 1WDPA 4D6DA 3L2MA 4HTYA 5FKYA 4MB4A 3U5YA 4TX8A 1TZ7A 4AZIA 1FHDA 2GFTA 2VUYA 4ACZB 5BRPA 1R87A 3IJ7A 4C7FA 3FAXA 4W8BA 2GVYA 3QHOA 1JD7A 4JL2A 1H0GA 2J79A 5AY7A 2XWDA 2XIIA 4Z2HA 3CZLA 1TG7A 3SUUA 2GUYA 1OGGA 2WC4A 1WDQA 1VEMA 4UOJA 3NIYA 1ISZA 3CHDA 3EMQA 1Q6EA 3CHEA 2ZWYA 2J7GA 3W25A 5JIWA 2C7FA 2PB1A 1I1XA 1MQPA 3VKKA 5IFTA 3WF0A 3DYOA 4OIFA 4A4AA 4FLSA 3DC0A 1C93A 2CITA 4QCEA 5HPOA 4JFVA 4QAWA 5EFDA 4CGTA 3OBAA 4Y7EA 4JFTA 4HPHA 1UWRA 1WZLA 1J0KA 2J78A 4NI3A 4E4PA 5D8ZA 4PTWA 1ISXA 1F4AA 1EXPA 2D0GA 2GK1B 2XM1A 5HNNA 4D1JA 3G6LA 1UD5A 4AD0A 2AOSA 1B1YA 3WQ4A 3O9NA 2WKGA 3ARTA 1Y7VA 1GJUA 2GDUA 1E9LA 2ZX6A 1VBUA 3WSUA 1HJWA 3POHA 1QW8A 3VMNA 4ATWA 2VOTA 1KGXA 1CGYA 1BF2A 4UFMA 5I24A 2JF6A 1HJSA 1ISYA 3VGEA 2BHZA 1WPCA 3WD3A 2O9RA 1CEOA 3VIHA 4Q7NA 4Z2KA 1E72M 3WQ8A 4ZE4A 3FNDA 1NH6A 3VIPA 3QOKA 5A2BA 5EFFA 3EDEA 4CU6A 3PHAA 5DT7A 1J18A 2J7HA 3WEOA 5HOSA 4JKLA 1XCXA 5AYBA 1GVYA 1O7AA 1UWTA 1VJZA 2HISA 4IM4A 4MTVA 1RD6A 2BNJA 3W0KA 4MPKA 1OCQA 3CZGA 4GPNA 4QDMA 2WVTA 3GH5A 2ZXAA 4UOZA 5JBDA 4UFIA 3RDKA 1XD0A 3RM8A 2YA2A 5I5RA 5BCAA 3IK2A 5A6BA 5GNYA 5AYIA 4BQ4A 4GQRA 1NP0A 3A4XA 2EJ1A 1E71M 2J8FA 4BZYA 2J8GA 1FP9A 1QBBA 1KR0A 3SCNA 3THDA 3OZPA 1VIWA 1KCLA 4UZUA 4XX6A 3W81A 4ACZA 4CVUA 4PMRA 2D0HA 3VNZA 5FOOA 3BH4A 1BYCA 3TA9A 2DSKA 4PMNA 1UD4A 4WJXA 1GOKA 1AMYA 4WKAA 1CYGA 1EOMA 3MO4A 2OSYA 4IPLA 4WK9A 4KGLA 1SMDA 4ZE5A 3VILA 2WC7A 4UCFA 2GSJA 5C8BB 1LJYA 2XJ7A 5D9PA 1E15A 1TVPA 2ZXDA 3NDZA 4M81A 4M8UA 2XG9A 2WMJA 2E9BA 4J27A 2EQDA 4GZEA 1KGUA 2ZX9A 2YDSA 1EDGA 2JEQA 3WF1A 4W7VA 1HL9A 1AQHA 1NWRA 1VJSA 5IFPA 2WMGA 2VX6A 4CN1A 4W8LA 2YL5A 5CPTA 1GVIA 3VIMA 3CUFA 2V3FA 4HZ7A 3O2LA 4CN4A 4U3CA 2Y8KA 2XTKA 3GXDA 5A8QA 2ZX8A 3VMOA 1C8XA 2GK1A 3AQUA 3TTYA 2J7FA 3ZJ6A 4AC1X 1UR2A 5A2AA 2CEQA 2QPUA 5A6AA 1CXFA 1E3XA 3BC9A 4MNLA 1ODUA 1XRVA 1FH7A 3SCTA 1LQ0A 2WLZA 4AIOA 4D6EA 4EKJA 5EBAA 3AMLA 1LWJA 3MV01 4A3HA 1OBAA 4GXPA 3AIWA 1YHTA 3J7HA 3VTRA 4DWSB 1UD6A 1V0KA 3IJ8A 3PBGA 4X9YA 4M1RA 2YL6A 1HJQA 1M7XA 1R7AA 2JE8A 2OWCA 2V5CA 4MAVA 3WNOA 4HZ8A 1HL8A 5GPRA 4GI8A 3LPOA 1NOWA 3PZIA 1V03A 1DWGM 4HP5A 5M3WA 5A69A 2XVGA 3UR7A 1B0IA 4FLRA 4E8CA 2CBJA 4U5IA 3ZIZA 7CGTA 3G6MA 1KWGA 2GJRA 4H8HA 1WP6A 1US3A 2G41A 2YOCA 3AHXA 2Y24A 4W5ZA 4HOZA 1V3IA 1E0WA 3M6DA 2WMKA 1EQCA 1VFFA 5IXEA 1GW1A 3KL0A 2J75A 4AD3A 4EANA 2WWCA 2FHFA 4P7OA 1BQCA 8A3HA 2HVMA 3CZEA 2E8ZA 1UD2A 4CN6A 1X6LA 3KEHA 2A3EA 1MQQA 5C70A 3WQVA 1JZ3A 2CXGA 3VD9A 5BRQA 3ZJKA 3VMPA 3CPUA 4JFUA 2DT0A 4CCCA 1KFWA 1QNSA 3BAYA 4HMEA 2OWWA 2O9OA 5I3DA 4YHEA 2DH3A 1E5JA 3WD1A 4ZENA 5M17A 2ZX7A 2WVVB 3GTNA 3MANA 5AC5A 4W93A 1KXVA 1WKYA 2O92A 2PBGA 1J0JA 1SR0A 4DM2A 4GQQA 5I0DA 1R85A 2WHLA 4DUXA 1E4NA 3CUHA 1C3FA 3VGGA 4IISA 4BQ2A 3CMJA 3AIBA 4PMUA 2BHYA 1QHPA 2DT3A 3BSHA 1V0MA 2QV4A 1UR1A 3VUPA 3WDQA 2IUZA 4RE2A 3KL5A 4HPGA 4AZ7A 1JGIA 1IV8A 5KEZA 1W3LA 4HA1A 4W7WA 2WSPA 1EHAA 4U33A 1GPFA 3FXYA 2VQUA 3AYSA 1ZS2A 4M80A 4TVUA 3WBAA 4ATDA 2OYLA 1V02A 5CXPA 1MXGA 2Z1SA 5A94A 1BGAA 2VRQA 1V3JA 2CHNA 5E9AA 1JYWA 1WAWA 2ZXQA 3AMGA 1W1VA 3GH7A 3AXXA 1HN1A 4WLCA
chains in the Genus database with same CATH superfamily
1JF6A 1N8IA 5HMDA 4F0LA 1N55A 4GIEA 2QIIA 2CETA 4CEXC 2Z6JA 4HPNA 1BD0A 1XLLA 3W9ZA 3GX9A 3NZPA 4UXDA 5C7HA 3F4NA 4UCGA 3AMCA 3H7VA 1VJIA 4K39A 4JFSA 2ZE3A 3AICA 4Q4MA 3I10A 1F74A 3TCSA 9CGTA 4M6PA 4UQ9A 3UZZA 4ACYA 3CEPA 1DEDA 3KWXA 3VDCA 3SR7A 1IYXA 3GNOA 5IDZA 1VPXA 4HSHA 3W37A 1VZWA 3H53A 1X96A 4IIDA 5LNSA 4MKNA 1JCTA 2VM8A 2FHBA 4PUKA 1SO4A 2ZVIA 2CBIA 1S5WA 3DHPA 2PCQA 2E9MA 1DXIA 1XIIA 2VMFA 4G6CA 4ATLA 4IFRA 3DN5A 3HBLA 5M2FX 1NU5A 1FWAC 3VINA 4BF9A 5H6HA 1E6RA 4HMDA 1NELA 2WLYA 2WQDA 1FKXA 4P7QA 2PDHA 3ECQA 3AO0A 2R1LA 3PBUA 3TW6A 4ZEPA 4W88A 2NQZA 3GVGA 3GVWA 3NQ6A 1K8XA 4I7UA 4KRUA 4LCSA 4LGXA 1CXHA 3TJLA 5HR6A 3LCHA 4GNKB 1TTPA 1K7XA 4GXMA 3TN4A 1H61A 3M5YA 1HJXA 3DECA 3WFLA 4F0RA 2VT0A 1ZALA 2X0SA 4GO9A 1P1XA 4UR9A 4D71A 4O17A 1VEPA 3FA3A 2XIQA 4KKXA 3WMLA 5T91A 1XLFA 4NG3A 4DZHA 3ZQ9A 1CXEA 5E0KA 1SW0A 2NX3A 4LANA 4C6QA 4MKVA 1WXJA 5A6LA 4XZLX 4PUMA 3B9NA 1DJXA 1KRBC 3B9AA 4JY9A 3A3XA 4DO4A 3ZR6A 1KWKA 4YYCA 1UWAA 4EWND 4G1KA 3WBWA 5CBIA 3NURA 2YW3A 1XLKA 4C6LA 1JD9A 3AYVA 3D3AA 1F8MA 2FYMA 4O1CA 2ZRWA 3T0BA 1TRDA 2D1ZA 4HU8A 3WQ5A 2OT1A 5IBXC 3GFZA 3GZ3A 3S0CA 3T55A 5EL1A 1CLVA 3SM0A 4XQ6A 1H1NA 3M0VA 4J3WA 5LIXX 1W1YA 3QLLA 5FEWA 3CV1A 3GUWA 4RR4A 3V5FA 2FVKA 3ZLFA 3EKLA 4PMXA 1KBKA 3R13A 4RNHA 1GORA 4XUYA 4NJKA 2XVKA 4Z1AA 2AGTA 5TF0A 5EMLA 3MV11 3WN6A 3CUIA 3TIMA 3SN0A 3EB3A 3HF3A 4A8LA 5C9XA 1ZCCA 2PF0A 1A4LA 3BXWA 1GONA 3P0WA 1EP3A 3RLUA 3IWPA 1W1B1 2XZ9A 4H7CA 1M1BA 1BSLA 3B9DA 1WXYA 3MYOA 1KRCC 1V77A 5AHFA 3C86A 2QPSA 3G1RA 3CB3A 2NUWA 2A3AA 2CBVA 4S3JA 3EKGA 4IICA 4JTDA 4DEFA 1ZB5A 1QHOA 1CGXA 5A6MA 4ADTA 5IDIA 4BWLC 1DJZA 3MWAA 4YXGA 1AJ2A 3T2QA 4KWSA 3C0JA 2RUSA 2A3CA 4PMYA 3WJYA 2EG6A 3C0LA 3O0KA 3UF9A 1VS1A 4DJED 4AUBA 3FS2A 4CVWA 3STEA 1FP8A 3LQGA 4EPDC 1UH2A 3PJWA 3WF2A 1XYBA 4IUOA 3ARQA 2PI6A 4WSJA 4GQBA 5REQA 3CM4A 1VFSA 3DENA 3GR7A 4OT7A 3LI1A 1OCNA 3W87A 3EPMA 1LLOA 1Z7AA 2OQYA 1KM1A 5D4YA 1HL2A 4NJJA 4LAZA 4ML4A 2VNCA 1T99A 3V0SA 3A4JA 3KL3A 4WZHA 2C1IA 4M24A 1B3OA 4AEEA 1UC4A 4HT3A 4UBPC 2J7DA 1A5NC 2XPKA 1EZWA 1TELA 3S5YA 5C9WA 2VEIA 1JJKA 1U5JA 3EOSA 2QAFA 3HPFA 1VP5A 2ATSA 1UWIA 2ZRZA 3LXAA 4JTAA 1E3ZA 1EC7A 1TCMA 2YJQA 3W2NA 4ZL1A 1JAKA 3APTA 3GXNA 3MB9A 3FV9A 2QF8A 3VYLA 4CLMA 4MB3A 2QJNA 3MUAA 4PCNA 3ITOA 4S2CA 4LNYA 1WDSA 3H26A 4WGHA 3IRDA 1M6JA 5D8WA 4CU7A 3C2RA 3M0LA 3THUA 3V5CA 4I7VA 4S1FA 1FX6A 1C92A 3F5KA 3QTPA 3WMBA 3NZGA 2AKMA 1AD4A 3SCQA 4O50A 4RV8A 4NAEA 1J6OA 4IJRA 4U2YA 4GH1A 4GXWA 3GXIA 3EMZA 3B9EA 2Y70A 4BFAA 1KM0A 3FGCA 3STGA 2PD5A 1L2QA 3WDPP 1QI5A 4E2OA 3ARUA 3FX4A 1IEVA 2PSNA 3PANA 2EPHA 4KEMA 3BW3A 5HJYA 1D3GA 2BXVA 1X8CA 2E6DA 4QIUA 5DEZA 1O12A 4HK7A 1QTWA 1OQFA 1MNZA 4PCSA 4LYRA 5G4HC 1SJCA 5JIPA 3TC3A 4E2BA 2ZDRA 1OK4A 4Z1CA 2FFCA 2GVGA 4FNQA 4DB7A 3RHGA 1RJPA 4OE7A 4XVEA 1DWHM 1N8FA 3TWBA 3CZKA 2AMGA 2Y63A 2YA0A 3M16A 1FXPA 1G4PA 3E5PA 4I7WA 3NUKA 3EXSA 5GJPA 4CU8A 3M4HA 2BHUA 2C14A 4MDPA 4EXAA 3AROA 3GNPA 2VX5A 1MXSA 1XLGA 3W38A 1VENA 1ONRA 3I6RA 1P43A 1FWDC 1F07A 5ECUA 1HIZA 3ARXA 2DVUA 3C0SA 4MAZA 4IJBA 2AL2A 1W9BM 1LF1A 1QPOA 4CD7A 2DDXA 2Y5EA 1UQZA 4ROQA 1MUMA 1T5AA 4DYKA 3TTSA 3SECA 1LL7A 4OQVA 3STPA 2CLMA 2QCEA 3PZQA 1QPRA 2WC3A 1GZ1A 3FEQA 4IXHA 4JHZA 3OG2A 3QPYA 4OKDA 1M3UA 3YPIA 3PG8A 1R3TA 3TOYA 4LUJA 3IARA 1RP9A 2Q3OA 2ONEA 3WNKA 3UVAA 3LU2A 5CSUA 5G2IA 1KCXA 3BLLA 3CBWA 4I6VA 4NYYA 3AC0A 4ZQPA 5J5DA 4D2JA 4DHGA 2PDWA 4A8RA 2CZVA 3GG8A 4BA0A 1JZ5A 4XIAA 3N6HA 4ILSA 2E1DA 4PUNA 3EPOA 1I0BA 4BEUA 5I07A 4PZVA 2OSXA 1TPH1 2I5GA 2J7EA 1PWLA 4DXXA 5BMWA 1PS9A 4AHPA 4I9TA 3OW1A 4NX0A 1W0MA 1W9UA 5A6JA 2IXUA 1H62A 3E96A 3E3HA 5AKQA 1POKA 1UUQA 4F0KA 1P1MA 4TQTA 4D8LA 3PUOA 4XAYA 2KAUC 3RK8A 3ZR4A 2QDGA 4AB4A 4NIRA 3C8NA 5E9XA 4GISA 3L4ZA 5HUOA 2BASA 1VYRA 4S38A 4H9VA 1DE6A 1K3UA 4GKLA 1NWTA 1JI2A 3IANA 4H7ZA 1OHLA 2FQIA 4JTCA 3SW6A 3VC5A 3DERA 4FHAA 2VRJA 2ODOA 3EZ4A 3DFNA 4QP0A 4MZYA 4LNCA 5XIMA 1U33A 1DQUA 2QMKA 3N18A 1TWIA 3TH6A 2Y5JA 3FYPA 4PBFA 4LRSA 3H8AA 2XFRA 4AZCA 4LB4A 4Z2JA 3TVAA 4N9EA 2ZICA 3BW2A 1GQKA 2CLFA 3OQEA 4V1XA 2YXXA 3PULA 1WKFA 1C8VA 3NQ2A 3PTMA 1UR9A 3L9CA 4JTKA 3MSRA 3GG0A 2VQTA 1G94A 1G4TA 3VCNA 4NX5A 5LNRA 4GFIA 2UV8G 4X61A 3PPGA 4HTBA 3EKZA 5LIWX 3W26A 2Y7DA 3DFSA 3C3UA 2IPJA 4L5ZA 1XBVA 3IVTA 2EGZA 1JIBA 3GC4A 1V6UA 2WMIA 4TV5A 2I9EA 5B7YA 4QSFA 5FF2A 1PVNA 2CESA 5D33A 2PDJA 3TFXA 2W27A 2H9AA 3A5VA 4KMQA 3ZT5A 1PYFA 3OLEA 4ZBCA 2POZA 4B4HA 1FCBA 5U7SA 5CAHA 1MW3A 2Z00A 1EJTC 1MUCA 4YNGA 1PX4A 1PTAA 3H21A 5AC6A 4Q4SA 2OWXA 4DBWA 3C6CA 3I4KA 2GVLA 2J88A 1M68A 2HV5A 4UTTC 1S39A 1IF2A 3U5UA 5H1WA 4PL1A 2WHKA 1DJHA 1ITQA 1TPFA 4NZJA 2OODA 3M7WA 2PWUA 5LNWA 4H1ZA 4GI6A 3NZ1A 4KS0A 2W6RA 4RJEA 1VF8A 1JYVA 1XFCA 2VDGA 3E9AA 1S5TA 3KRZA 3M43A 3SDOA 2A0NA 4L4PA 1A5AA 4UTFA 4JNMA 1S2UA 3QY8A 1H49A 2E1WA 4H2CA 5G2WA 1AMKA 3LV5A 2IQDA 3WH8A 4U28A 1Q7ZA 4CQAA 3DGRA 2WJZA 1XV8A 4H9ZA 3EA3A 3VD4A 4YS1A 4AXKA 2XGIA 2P88A 1IZJA 1XGEA 1E9IA 1TV7A 1RJQA 4MKSA 3WENA 1I75A 2IKJA 4R5EA 4ZGYA 4ROPA 2WAGA 4JCMA 3D47A 5JUVA 3WX7A 2ADAA 2B7NA 1R8LA 5GNZA 3KOFA 1J12A 1WOAA 1AODA 4AZHA 3GVQA 1HT6A 4U3AA 2CLEA 3IJQA 1CZ1A 4O18A 4JTLA 3MVTA 3PSVA 3ITVA 3RPMA 2I9UA 1XI3A 4S39A 4A2SA 1KA9F 2C0HA 3GXFA 2E5DA 1XSJA 3CC1A 1GWJA 1XLJA 2AGKA 1FWWA 4FA3A 3FKRA 4C5YA 1V4YA 1R9ZA 3G0XA 1MWOA 2F6XA 1ZHAA 3VDHA 4ML9A 4QS5A 3S1XA 2BTMA 3VZYA 3ZSTA 3ATYA 2I5QA 2OKTA 2CNCA 3VGHA 4A6GA 4A2RA 3VOJA 4CCEA 3BURA 5EMYA 4C1KA 3NQAA 3DH7A 3CZJA 2AQVA 2QF7A 4HOXA 2F2HA 1T0OA 1OFAA 2FJKA 3AZRA 1G1YA 4PCFA 1QNOA 2X05A 3E2SA 3QW4B 1A49A 4A8NA 4Z1YA 1Z48A 4HHMA 3TLQA 3ARWA 5FJTA 4PGLA 1CXKA 5EYWA 3WJZA 2FFIA 3AHTA 3LPFA 1FHVA 4LB3A 4ZZ9A 4NZCA 1OT1A 2E40A 1DWFM 2QCGA 2Z29A 3B05A 3HV8A 4XK2A 2DUXA 1JVNA 2NVCA 3A4WA 5HNUA 1DL3A 1DV7A 3PR2A 1MQRA 2NLIA 1U83A 1MEIA 1T8XA 5A6KA 2VVSA 1M65A 3W4RA 4RUBA 4KCVA 4G7FA 4OOUA 1ZU8A 3QXBA 4HA0A 1G0CA 1V3HA 4Q33A 2DH2A 1NDVA 1JZ6A 3NFUA 3W00A 1HVQA 5HANA 2RFGA 3DYMA 1XUUA 1TPWA 3ARRA 3DC8A 2JIWA 1PPIA 3CUZA 2W3ZA 2PUZA 3V3WA 1QUMA 4AU0A 4HNOA 2ACUA 3W53A 1FH9A 1UWUA 3MI2A 4BCEA 1BVNP 5GVJA 1LLZA 4B92A 1E70M 5A6TC 4B5XA 1ZBCA 1X1NA 4J7RA 3RYSA 2DJLA 3WLLA 1XR2A 1RBLA 1UR4A 3TQVA 1NDZA 3ZR5A 1I0DA 1PHQA 3W82A 4PUUA 3O05A 5AZ0A 3NXLA 3CWHA 4NZ1A 1XC4A 3EOUA 2ZX5A 3O16A 4FZIA 1Z32X 3N15A 5JMUA 4G1NA 2XVLA 2WB5A 4TUFA 2WW5A 3GIPA 2D3NA 4K38A 3VVGA 1VCFA 1G67A 3RO8A 3L0NA 2V5DA 3KBMA 3USZA 2FB3A 4NF7A 3VD3A 2W66A 3VIFA 4C6CA 3WD2A 3BICA 1E0XA 4UTIA 4ZVJA 3D3FA 2OG9A 1GQLA 3ZMRA 2OO6A 4EF9A 5DFAA 4S3DA 2WSYA 1XYMA 4H6KA 2ZXBA 3AYRA 4JIHA 2TRSA 4LVFA 4AZBA 2Y61A 2BDQA 3WDIA 1LOQA 3UWYA 4DM1A 3K46A 3VX1A 1Y5XA 1TJ1A 2XISA 4M0XA 3F2CA 3FAWA 1EGMA 3K4AA 3R5EA 4AZ6A 1ADOA 3FK4A 1W2VA 3RN6A 5E0CA 3WH6A 2YCKX 4AIEA 5FJOA 1WO2A 4EACA 5CBBA 1TFVA 4RE0A 1B3VA 1D3CA 1XYFA 1X8FA 1QAPA 2E8YA 3UZJA 5DXYA 1DXEA 3RO6A 1P7TA 2NQ9A 2PDMA 2YKKA 3XISA 2REQA 2GQ8A 2ZUMA 3UR8A 4OVXA 2OEJA 3SN1A 3HMCA 2NT0A 1E6QM 2QZRA 3ARPA 2EXOA 4EP8C 2FHCA 3AZTA 1R3SA 4TTGA 2LLEA 4V33A 3GXTA 3OJGA 3KXQA 2B7OA 3UP8A 1VFUA 1TR1A 5I3JA 2GLKA 1G4EA 4JHMA 3VI2A 3F4VA 1J0HA 3LY0A 1E1FA 3H22A 3RLVA 2PPGA 4KIRA 2WJFA 4MJ4A 4P8UA 3E2QA 4FMVA 2OPJA 4R7OA 2NV1A 4E6MA 2WNZA 1OYAA 2XU2A 3TYZA 5HR7A 1ZCOA 2I57A 3WH5A 1JUBA 1R38A 4GIRA 3VGDA 1MUWA 4F2BA 1GKRA 3MMDA 3PBWA 1LROA 3W27A 3SURA 4S3GA 3GAYA 4TR9A 3K8KA 1NARA 4IMCA 1Z89A 2IPWA 1W17A 3BVJA 2DJXA 1VD6A 4ICCX 4K3ZA 5AN7A 5DRCA 1NAL1 1KRMA 4LSBA 1XS2A 4IPNB 2VFIA 3JW7A 1V7AA 3H7UA 2YDQA 2XSAA 1ZPTA 4GRSA 3SSJA 1IZKA 3P84A 3GM8A 4S23A 1XQKA 4WOZA 4Q7BA 3EX4A 4UTWC 3DBNA 3M0XA 2GJXA 3WD0A 1FCUA 8XIMA 2D24A 2ZA2A 3IIZA 2GDVA 2NWRA 2HRWA 3UXDA 4XZHA 5LNVA 2R8WA 3TMLA 2GGIA 2OVLA 3WFZA 5AFDA 4TMBA 3NR0A 4LBUA 4B5WA 3OPSA 1FBAA 2VC7A 3FHQA 3RITA 3EDKA 3LBOA 2YL9A 5EMUA 4N9DA 2DSUA 5GQBA 3HOJA 3VIGA 3UZWA 3CPGA 2PWDA 3UG4A 1F6YA 2YW4A 3S5ZA 2ZTKA 3LDVA 4LF2A 2PDPA 2V2CA 2DEPA 3D5HA 3HA1A 4IHCA 4MY1A 3V75A 2YGYA 4J35A 2QUVA 4JEQA 4CQ8A 1XPGA 3RX4A 4B5TA 3N4AA 1WDPA 4D6DA 3L2MA 2GUBA 4MB4A 3U5YA 4DJFD 3PB0A 5IM51 1R0MA 1XDMA 1LBLA 4Q4OA 3NVDA 3ANUA 3LRKA 3FAXA 2GVYA 5JU6A 4ALDA 2J79A 1QO5A 5DMLA 4HJWA 4H9UA 1JRBA 1G4SA 3PWAA 1TG7A 3WQGA 4DRSA 3MZ2A 1YBQA 2ZC1A 4UOJA 1ISZA 1Q6EA 3CHEA 5D04C 3L68A 2GOUA 3IJ6A 5EBUA 2PB1A 1I1XA 3MMTA 2Q09A 3WF0A 3R8GA 1XIJA 4DELA 1QU4A 1K03A 5CEWA 2P5NA 5XINA 4FLSA 1C93A 1R3VA 1SSDA 4A22A 5EKYA 4AF0A 4CGTA 3OBAA 3BOFA 3PNZA 3CQJA 3MCOA 5D8ZA 1F4AA 3PP7A 2GK1B 3R10A 3C8FA 2AOSA 2YDAA 4TIMA 3M0HA 3ARTA 3SADA 5AHIA 1GJUA 4XZMX 1E9LA 3MC5A 1KV5A 1JCJA 1VBUA 3WSUA 4L9YA 4NZ4A 3H2AA 1F73A 3KX6A 2E6YA 4ATWA 2VOTA 4XKYA 3PUDA 4QS6A 4UFMA 5I24A 1NDYA 2JF6A 1HJSA 2Z27A 3VGEA 2BHZA 3WD3A 3VIHA 4Q7NA 3G77A 1LRQA 3WQ8A 1QWKA 3VIPA 5CPOA 5CC3A 3LLDA 1CB2A 3QOKA 4H83A 1IHIA 4CU6A 3C52A 3T78A 1J18A 6ALDA 3BLDA 1XCXA 2EAWA 2A3LA 1W1ZA 3L5LA 4LAMA 1IT8A 2HISA 2P8CA 4DAFA 1AZ1A 1SFLA 2WVTA 3KOYA 2BP1A 3TAKA 2ZXAA 4FXFA 2V8ZA 5AVNA 3QRHA 5GNYA 3GDMA 3S2NA 1X97A 2EJ1A 3GU2A 4U10A 4HZMA 4ERIA 2J8GA 1FP9A 1AW5A 3THDA 3OZPA 4UZUA 1SO3A 1GOKA 5A8GA 3UNDA 3NZRA 1EOMA 2OSYA 4C6BA 4XUGA 5I3HA 2VR2A 4IPLA 5ABTA 4GUGA 2WC7A 5C2XA 1H63A 1EWDA 3BGGA 5C8BB 1K4GA 1LJYA 2XJ7A 2R91A 1E15A 1TVPA 2ZXDA 2X7VA 3C2YA 4M81A 3VAVA 3DKJA 4DLFA 1KGUA 4O57A 2GUUA 3P60A 1EDGA 3PBVA 4W7VA 1GVEA 4FX7A 3BJFA 4QM1A 4G5DA 4GCAA 3TE9A 3H4XA 4C1LA 1VJSA 5BWAA 3LHWA 2PFHA 2C16A 4WXZA 1OG0A 4W8LA 1XRSA 3SQMA 3LZ5A 3U8GA 4CN4A 3A24A 1IT7A 3BQ5A 3GXDA 4ZQOA 1MNSA 4MLJA 3S6OA 1C8XA 1EF2A 4H00A 3TTYA 2F9RA 1UR2A 4O19A 3TDFA 4MSSA 2W9MA 2ZC8A 1OY0A 3LLFA 1E3XA 1ODUA 1BEUA 2WLZA 4AIOA 4D6EA 1EJ7L 1SW7A 5EBAA 3AMLA 4GACA 4KFOA 2PC4A 1J8VA 4A3HA 1OBAA 2R1MA 3IJ8A 1AD1A 2HMCA 3CS2A 1UBPC 2DU2A 1J5SA 4M1RA 3BARA 1HJQA 1M7XA 1R7AA 3PM6A 4Y9NA 2CLOA 3BZJA 4HZ8A 5DBTA 1W5QA 1HL8A 1UUMA 4GI8A 1ZJHA 3W7PA 3PWIA 1V03A 3I4EA 3AXMA 3OODA 3BJTA 4QITA 4QJ3B 1CLKA 1WP6A 4HHPA 3AHXA 4W9TA 3IRSA 3ISIX 5IXEA 4R85A 3VDGA 2QGHA 4ZSUA 4PRTA 2YX0A 4EANA 2WWCA 2FHFA 3V7PA 1X6LA 5FEPA 1A5CA 4HGXA 2X2GA 2QJGA 1KBIA 4B5NA 4FNUA 1KFWA 1TYGA 4HK6A 1QNSA 1RVGA 4TX9A 2OWWA 5I3DA 3S83A 1E5JA 2ZX7A 5BOOA 1DVJA 2H3DA 3WLNA 1TTQA 1GVFA 3O15A 4QEHA 3CQHA 1PIIA 4DM2A 5I0DA 2WHLA 4DUXA 4C6PA 2PGWA 3BSHA 4O1AA 3VUPA 3KOXA 4EX4A 3AALA 4US5A 2C13A 4AWUA 4DYJA 5HQEA 3M64A 2QULA 4MUZA 1XLAA 3ONBA 4B2DD 4LYKA 1EHAA 4U33A 1VFHA 1VHNA 1GPFA 3N19B 5H8PA 3NPWA 3MBFA 2VP8A 3BCJA 1O68A 2IMRA 3LBCA 3PWGA 4MJMA 2WPBA 4IQEA 2VRQA 5E9AA 4LWWA 2YFNA 3AXXA 4XKMA 7ODCA 1M7OA 2EPNA 4JTQA 5LA1A 3S9YA 3VGFA 1O6IA 5HWNA 4DF0A 2DSZA 1QOPA 2FH8A 4N0RA 3AXHA 3VIKA 1UKTA 4FP1A 2ZVRA 3R89A 3AFBA 2YL8A 4KFNA 1G9HA 3CAKA 3FHAA 3LPGA 1Z8AA 3QKZA 1B30A 1DORA 4M56A 1XLDA 4DBDA 3W1TA 1F76A 1Q4NX 2D2JA 1XUZA 1E55A 3LRLA 2YCJA 4PUEA 1P0DA 4JPGA 3BGAA 2Y4SA 5LA2A 3KTCA 1V6XA 3AIRA 5LGXA 3EWWA 3LHZA 1LM1A 4MUPA 2PWFA 3CUGA 3C56A 3RG6A 1AW2A 4KCWA 2VO5A 2E0PA 2D3LA 3GR8A 3GW0A 5IHRA 4D6FA 4JIRA 3SUTA 3NSNA 4PEEA 4EWJA 4YYFA 3AU2A 5BYWA 1T96A 5HINA 3MSYA 1GEHA 8XIAA 4QG9A 1GKQA 1HKWA 1FDZA 5CGTA 1BVZA 3QC0A 4QFUA 4EXQA 4MZ8A 3TR2A 2CXEA 4CNSA 1F05A 1XJBA 1ZJAA 4V27A 3DFOA 1KTBA 3B3DA 4NXSA 4IGSA 3WDHA 1EBHA 2Z0IA 4NU7A 1UWSA 1VYPX 2Z1KA 3OLIA 3B97A 1EJWC 4NP7A 1W3JA 3KS6A 4I8YA 4AXNA 4E4UA 3BDKA 4GZ7A 2P1FA 3K1GA 1YDNA 3F5JA 2V5KA 1BXNA 1SU5A 3BK0A 1X98A 3EA2A 4LCRA 2A4AA 3VOHA 3IGXA 3T7VA 1W1IE 1GK8A 5REQB 1TVNA 4WKFA 5DBUA 2HK1A 5AC4A 4Z1DA 1E1CA 3B8VA 1HP4A 4FF5A 1OZMA 3UWVA 1OX6A 2Y7EA 3RRXA 3ZOAA 1ZAJA 5K2ZA 3RR4A 4MJ2A 5ABGA 4KGJA 1Q8AA 4DUWA 3UT0A 3VM5A 1B4EA 1ZBVA 4L1XA 1ZL1A 1PCWA 3N17A 4XZNX 5EA9A 2WCGA 5TQLA 3E2VA 1PDYA 3NQGA 3GYCA 3T4WA 3S2CA 4AWTA 3KBVA 4GI4A 1N82A 3AS0A 1UA7A 3QGVA 2CW6A 3E02A 2OZ3A 4E3VA 1US2A 3MU7A 3TJIA 2HXTA 3PSWA 2XH2A 4GE8A 3NM3A 5CZKA 1J01A 1VBRA 5H8UA 4MFEA 3O06A 5AOUA 2R94A 3W2LA 1HJVA 1ZLPA 4IOTA 4FNSA 2E3ZA 4MNKA 5C9RA 2BOFX 1BTMA 4C6KA 1CDGA 1HNYA 1J11A 2PCEA 2G5WA 2ZUUA 4AVNA 2CERA 2G3NA 2XM2A 3GNRA 1VFLA 2YDRA 5K9DA 1GZJA 3W07A 1POJA 1IXQA 3V36A 2B7QA 3SRKA 4OWGA 4JTTA 2BWGA 4BI6A 4J3SA 2PRLA 3DHUA 3RM9A 3A3WA 4R3UA 2EBNA 5D30A 1PZ2A 4NAEB 4Z42C 1EDQA 3IACA 4QE1A 4GY7A 3VKCA 2VCBA 5DX7A 1JQXA 3FGCB 3M0ZA 3HGRA 3TYCA 4LAOA 2XN0A 4DI9A 3WDJA 2YPIA 1PL9A 1H50A 1K6WA 1KBBA 3NPVA 1TPUA 3LA4A 1SYTA 2I14A 2V68A 3KW3A 4XBJA 1KTCA 2QJIA 3ZZ1A 1GW9A 5M1TA 2O4MA 3MBDA 2OTDA 3L4UA 2NUYA 1V02E 2VD9A 4WF7A 4L61A 1UJQA 2ZWZA 1JNEA 5FESA 4XO6A 3I3BA 1XH0A 3VNYA 1NP2A 3TYAA 3ONCA 3OEXA 3GU1A 3IJ9A 1R3YA 4IIGA 2PTDA 2W91A 1O1ZA 1V6VA 4ZTYA 1YXDA 3OLGA 3HPXA 2V38A 4NZ5A 3VD5A 1P0NA 2ZIDA 4FIRA 2CKSA 4AYSA 4DLMA 5HJLA 3REQA 1I2QA 1W5MA 3CPRA 4FOKA 5A8NA 3NL5A 5TNVA 1NF0A 5BXPA 2DPEA 2AL2B 4FLOA 3WELA 1JXKA 1IEXA 4B91A 2OT0A 5DQPA 1IWPA 3U48A 1LLWA 3TNOA 3TP4A 1EX5A 2GQ3A 1UH4A 1AQFA 4NAFA 3HQ1A 5E6YA 3VNJA 2C8NA 3ITCA 1XGZA 5LA0A 3K5XA 4JOMA 1PAMA 5DMYA 1XH2A 3LHTA 2FDSA 3F2DA 3Q58A 4K68A 1ZGDA 2ACSA 4Q8QA 5BU9A 1O5RA 2Z6IA 2ZRYA 3VNIA 2PDUA 1FWTA 2FPYA 4HMCA 4PSRA 5A8OA 4RKAA 1YMYA 5C9ZA 3LI0A 4I5RA 3WMCA 3PTKA 4IIFA 4Q8MA 4EAYA 3AUJA 1R86A 4Q22A 1WB0A 2PLKA 3RLHA 1K9DA 5KITA 2R1NA 3DESA 4OV4A 4EPEC 4PMVA 4YLWA 4FAMA 1T6MA 4F8XA 2W4XA 4H8NA 3NL6A 4GZJA 3TQPA 1HKIA 1ICQA 2WNQA 4R27A 2JFEX 3ZM8A 1UKPA 3ZVHB 3KVJA 2BV9A 3BCDA 3GIYA 3LSCA 2NQ5A 4N42A 4IIEA 2OGJA 3T81A 2BY1A 4ASTA 1WE5A 4PH6A 4WUIA 3VGBA 1U5HA 3GH4A 4XAPA 2VYOA 4D1IA 1EH9A 3IJDA 3L66A 4QNEA 2VL4A 3E74A 3DI0A 3PTDA 1QO2A 3E0FA 4KEZA 3CWNA 4RCXA 2AL1A 3IIXA 3I6TA 1SZGA 1KXTA 3KDNA 4NILA 2AQOA 1OD8A 1NM9A 4ZXLA 3S6TA 3HGOA 1JULA 1O4UA 3OTRA 3AWOA 4GFSA 1XYAA 2VURA 2QUNA 3S42A 4YWSA 3AYTA 1F3TA 2XIBA 4AIUA 2JIEA 6XIAA 4C1NA 4LVAA 2DVXA 1XRFA 1W2PA 4UTKA 1RK5A 4O15A 1Q6DA 2PDYA 2GOKA 3SCVA 4LXFA 4IL2A 3UJSA 2ZYFA 3BPWA 3LUTA 4LEQA 4AZCB 3K4DA 2WMFA 4NASA 1VFTA 4HPXA 4J1OA 2GJLA 5DCBA 3WH9A 1GJPA 1GKPA 5E70A 1UR8A 4XZWA 3TW7A 3B06A 4ADUA 2C6QA 3W2JA 2A2IA 4Q8UA 4D8AA 1XW8A 1W9PA 1DTNA 1ONXA 2OLSA 3MA8A 4B9YA 5AECA 2HCVA 1QK2A 2WMIB 4XB3A 1AZ2A 2WMHA 1LZOA 2BSLA 3ARZA 2W79A 4HU0A 4JAWA 2H9AB 1F6KA 3SCSA 1TTJA 3TX9A 4NSBA 5CLTA 4J9JA 1K70A 3L4TA 3WQPA 3OVRA 2J27A 2R82A 4GCXA 3VD7A 5MHBA 3PZGA 4NXKA 5D2WA 3NWRA 3VKBA 1CIUA 4DQWA 1X1ZA 3HO8A 3HFTA 3SIMA 3LK6A 3GS6A 5CZJA 3O6AA 3A6OA 2V2DA 2PWEA 1X6UA 4OTKA 5HMEA 1DQWA 4FS9A 1G7VA 3M1ZA 1HJUA 2O9PA 5G1TA 5HULA 2PP1A 3AHVA 3LMYA 1EEXA 4I90A 4F48A 3W1PA 3KP0A 3EYPA 3QR1A 4RE3A 2I1OA 3BAXA 4J5NA 2XVPA 5C5YA 3OP2A 4XZ9A 3F1QA 3WLJA 4IL0A 3DFPA 1EZ2A 2UWFA 2CBUA 2HEJA 2QUUA 4UTTA 2V63A 2VEKA 3GTXA 3FVDA 2HPMA 4C7GA 1DWIM 3POCA 1MFUA 1PIGA 1XIFA 4R9OA 1OYCA 2QQ6A 1J9YA 4GVIA 3HJZA 2HBXA 5T9CE 2DT2A 3WBXA 5M03A 1WKEA 3DFHA 2NW0A 3UZYA 3NXFA 3VUSA 3GTIA 2PDBA 3RJXA 2UY2A 1OK6A 4AD5A 3DKLA 5KETA 5HBFA 2FKPA 3TU9A 3BG9A 3MYPA 1KFLA 3Q45A 1WBHA 2YLAA 2DZXA 5FJRA 5CKSA 5CGQA 3CT7A 4IWWA 1V3LA 2XUCA 1VCVA 3BG3A 3RMJA 3FYOA 3E0VA 1I2NA 3LLXA 3VX0A 2DZWA 4MNMA 3NTYA 1EKOA 4MY9A 1AH3A 2YXGA 4M6VA 3TFCA 3LTPA 4Y8FA 1J0YA 4NJGA 1ISVA 3U2EA 1PCKA 3H12A 1C7TA 1EP2A 3GFYA 2WBGA 4LS0A 2KX9A 1MZRA 1BAGA 1CGWA 3D46A 4WX2A 1RCQA 3BV7A 2YCLA 1H7XA 4GQGA 4A3RA 3SY1A 3W71A 2PU0A 3SCUA 1C90A 3A12A 3ZO9A 2XIJA 1AA1B 1YXCA 2E68A 1PX8A 1AL8A 4LV4A 4D9PA 3VKAA 1FA2A 4JX4A 1OSEA 1Q6OA 3R1ZA 2OGYA 4F79A 5EMKA 5I2UA 4QG8A 2E5BA 3VK5A 2JKPA 1M7PA 2BB0A 3EWUA 4S2BA 4YJ5A 1UYQA 3OG3A 3T8LA 3KZSA 2AQWA 1QWGA 3Q2DA 1E0UA 2E9LA 5B7ZA 3PZ9A 1Y65A 5B80A 4OJYA 3SCWA 3CHCA 4UQBA 2SFPA 4DX3A 1WKDA 4UQCA 2PS2A 1DJNA 3T0AA 4CNPA 4MYAA 2BG5A 2WOQA 3EXTA 3KLLA 1CWYA 2MUCA 1BFNA 4QQ3A 2QW5A 2NZLA 4PMJA 3KVMA 1GNXA 5AHEA 2WHJA 3N3MA 1M53A 3LS9A 1CXLA 1REQA 2EG8A 3WLMA 3GDRA 4Q8OA 1UUOA 4P7LA 2WWDA 4PC8A 3IIOA 3VDAA 3CLMA 2DIJA 3DG3A 3A13A 3TK7A 5ABEA 1UD3A 4FSAA 5FAGA 5G4EA 4ERGA 1ITXA 1K8CA 1F4HA 3VDBA 1XIHA 3QGKC 3QPZA 4ZA0A 3IIVA 1NWSA 4NUWA 1MVYA 3F7JA 4O14A 3N9SA 1XG3A 4F66A 1IIHA 1K1DA 2JGYA 4ZCWA 2G97A 2R14A 4MDOA 4XO7A 4Y8EA 1PDZA 3APGA 2AAMA 4B3KA 4W85A 4TU1A 3IJIA 1LT8A 4IIHA 3NL3A 1EGVA 1DIDA 4KWOA 2TYSA 3USBA 1A0EA 1AFSA 1WYIA 4PRWA 3FJLA 3D0CA 4MB5A 2DSVA 5EMJA 1IGWA 4HVXA 3CZ8A 1HTIA 4YTQA 5CGMA 2OZTA 3G5EA 2Z1WA 4IIBA 1TSIA 2WKJA 3PBMA 3O6CA 1W31A 1O1HA 1XWYA 1B9BA 2ACRA 2XDFA 1JDCA 1OX4A 5D02A 5HWMA 2O4QA 4X0VA 3MZNA 2PTWA 4JYDA 2Z2BA 4IX2A 3TONA 4ORMA 3WD4A 4AWEA 4WXYA 4J3VA 4Y9OA 2VZOA 1EA0A 3W7OA 3NEHA 2ZTJA 2DT1A 1WZAA 1XLHA 1TQXA 1OGBA 1XYZA 4IUGA 1ZP3A 3GAKA 1O66A 3R43A 4PEKA 4MMWA 2QCNA 3P81A 4BR1A 4WY0A 3UWZA 4IMEA 3JUGA 5FF7A 3VKDA 1QCWA 2RGLA 2F8QA 1IEIA 2Z2UA 2PLMA 3HIJA 2REQB 2CIPA 1I1WA 2B31A 4PMOA 2XIMA 4TVDA 1XLEA 3WLRA 4AWSA 1MXDA 1HO4A 3O0FA 1PZ3A 1ZAHA 2FGZA 1HF6A 5E93A 1HFBA 6CGTA 2DZUA 5AC8A 3BLIA 3SFKA 5BXTA 5FF0A 3KZPA 3AOFA 4AMAA 3TKFA 3UXIA 4H8VA 1W3TA 2HNHA 2P53A 3BAIA 1L0PA 2INEA 1DJYA 3EB4A 4IGMA 1YDYA 2GWNA 3HN3A 3FN9A 3ARSA 2OO0A 1QATA 2NVAA 4GUHA 4XAGA 4PODA 2ANUA 5I23A 3KCJA 2DUAA 2QCDA 2C1HA 2E25A 3WKZA 2FGBA 3BMWA 4JX6A 5JBFA 3P93A 2NSXA 2VZVA 1GEQA 1DYSA 4GGHA 3SUVA 5J8LA 4Z17A 3PPFA 4DZIA 2D2GA 2UZ9A 4GX8A 1KLZA 3UWEA 3TSBA 2QUTA 5D09A 5D9NA 2EG7A 1XHGA 1GVRA 3ABRA 3UCDA 4CEUC 2J25A 4IG2A 1FHUA 3SUSA 2D69A 3T05A 3CYVA 1E4MM 2YZRA 5C2GA 4E4FA 1RPKA 5LXEA 1VB9A 1E0TA 4JN7A 4FB7A 1V6WA 3AHZA 3BSMA 1UOKA 4NNBA 3LERA 2ESCA 4PULA 5AYYA 2XN2A 2WYSA 1AH0A 2E4TA 1SJBA 5DY3A 2GJXB 3SN4A 4KWWA 2ISSA 2CZDA 5BNKA 1CECA 1P5BA 3S9IA 2J9XA 2NXHA 1TZZA 1T8QA 1JDAA 5C9UA 4PBGA 3SAZA 1EA9C 5E5CA 1XIGA 4TTUA 1LBMA 3H2EA 3LHVA 2XSBA 1E1EA 1GOQA 2DUZA 2XFWA 3BMVA 3GY1A 2H8ZA 3NGFA 5DF0A 3CEUA 1VPYA 1LWHA 5LGZA 3MT1A 1Z3NA 3R2GA 1IEWA 3GVRA 4Z0SA 3IVUA 4QLKA 3ABZA 2ZZ5A 2WBKA 2A5HA 1GOMA 4UTWA 4MWAA 4Q4QA 3H23A 3S46A 4CCZA 1Q6FA 2A3HA 1JXJA 4UTLA 2P0OA 3N12A 4O12A 1Q85A 3BZGA 1GUVA 3M44A 4L64A 2PWGA 1XL9A 3KVKA 3VCCA 4WDUA 4FNTA 4MADA 2DY3A 3URBA 3L4VA 2PP0A 1QK0A 5ABHA 2DW7A 1RY0A 2HS6A 3UJRA 4GINA 1B3WA 4INFA 1XLMA 2PDFA 4C6MA 3QR3A 3K1DA 4JN6A 1LUCA 2XINA 1EC8A 2V0TA 4PTXA 2XH0A 3W7KA 3R0KA 3ABSA 3AAMA 2RGMA 4AF0B 3S5SA 1TKKA 1FVPA 4QRNA 4U31A 3THCA 2CCRA 3CO8A 3B0XA 1NQ6A 5CPSA 1WQ5A 3SCRA 2V30A 3GBEA 3WG6A 3UR5A 1MRQA 3I3DA 7TAAA 2BZNA 5HQLA 4GGBA 3HMJG 4S3CA 2BGNE 4PRRA 4KEVA 3TSMA 5CZ0A 1F2JA 3IIPA 3W7MA 1J2BA 1RY8A 3T42A 4B15A 1JUEA 4R7WA 5FA5A 3HPAA 4PTNA 2BVYA 5T8GA 1H09A 5A6BD 3LSBA 3V35A 4MJZA 3AISA 3BLPX 2OCZA 4GG9A 1GYMA 2ZUNA 1SFSA 4XKYB 3OVPA 1DXFA 5ECVA 4BF7A 1W5PA 3VOCA 4LS1A 1PX3A 1EJVC 4YWIA 1Z9AA 4R53A 2XFFA 1AK5A 1DP0A 1QNQA 5D2YA 3BUVA 1RK6A 2JEPA 1CNVA 5F2LA 1JPMA 1CI1A 1W1TA 3E6EA 3VABA 3M41A 1VQTA 3PAJA 4AY7A 1PO9A 1D3HA 1OFDA 3MUY1 6ENLA 2XYLA 2ZZ7A 3H6OA 4L6OA 4MB1A 1LL6A 3WQ6A 1UCWA 3GUGA 2PWHA 4IQLA 1LTDA 3KFTA 4RZ4A 1GHSA 1NVMA 3W7EA 4ZB2A 2VRKA 3WF3A 4PFMA 3ES7A 3T2OA 4A3YA 3BL3A 4Y9AA 3TYEA 3W75A 3C2EA 1EL3A 1EOKA 1J2WA 1FY6A 4NVTA 2WCSA 3N04A 1QVBA 1WCGA 2DV0A 5FKYA 3L2IA 4TX8A 4AZIA 3V0UA 1DQXA 4XD6A 2BODX 1KCZA 3WQCA 4W8BA 1JD7A 2OU4A 3TAOA 3UGRA 3CZLA 4QJ5B 3SUUA 4GYFA 1ZTVA 1G69A 3Q4DA 1C29A 4RW3A 2FVLA 4WHBA 3MCNA 1VEMA 1K8YA 2WZMA 4JTEA 2J9YA 2P76A 2J7GA 4X60A 1FCVA 5JIWA 2C7FA 3QC3A 4WJEA 3KHJA 3VKKA 4RZ5A 3ZFHA 4CNOA 1RZMA 3KVLA 3TYUA 4JR5A 2CITA 4GX9A 2J8TA 1EYEA 1NIUA 1MI3A 1O95A 5EFDA 3P2VA 1D7KA 4JFTA 4HPHA 1IWBA 1VC4A 1V8EA 1GT8A 3GNDA 2D0GA 1SZFA 2PGEA 4J2PA 1B1YA 3WQ4A 2Z4GA 3NQVA 4QJ1A 4OGZA 3ITLA 4LY8A 3ZVIA 1LYXA 3DFQA 1W5OA 1HJWA 1QW8A 3VMNA 2PURA 3GHRA 1KGXA 1BF2A 1Z41A 3NG3A 3W23A 1Q13A 1HQTA 5F4SA 4QEEA 1CEOA 1IIGA 2BMBA 3KRSA 1E72M 1ML1A 2PDCA 4GWEA 1L6WA 1NH6A 2HWGA 1W3IA 1R3RA 3TJXA 3OYZA 4TO8A 2Y1HA 5A2BA 2QR6A 7TIMA 1BXBA 2PD9A 2ZADA 5DT7A 5HOSA 1BKSA 3CV7A 1GVYA 1VJZA 4IM4A 1NTHA 1NEYA 2BNJA 1DJWA 1OCQA 3CZGA 4QDMA 3QW3A 3QBUA 4JNYA 3GK0A 3C0QA 3RDKA 4HNUA 2YA2A 2OQHA 5I5RA 3QV6A 5AYIA 1IXNA 3UNTA 1U1UA 5KZMA 4FF7A 2PGRA 3A21A 4K6AA 1E71M 2B0MA 2J8FA 3TN5A 1QBBA 3ABOA 4NJHA 3DX5A 4UTMA 4HHHA 4XX6A 4KEUA 1TRIA 4ACZA 3PPCA 2V9DA 3S2MA 4PMRA 1IR1A 4L6DA 3N25A 5FOOA 1ZSXA 3TA9A 4IF2A 1UD4A 1AMYA 3QY6A 3H55A 1SUXA 3QPEA 1SFTA 1YTEA 4WK9A 1MO0A 3OIXA 4HK5A 1SMDA 2QJHA 4ZE5A 1C9DA 4UCFA 2DVTA 3IUHA 2YSWA 2CHRA 3TCEA 5KZEA 1TPB1 2XG9A 1P6CA 3U0HA 2E9BA 4GZEA 3S1UA 4H2HA 3N34A 1OFEA 1Q6LA 2VD8A 1AQHA 4IFOA 1Q4WA 2WMGA 2Q3RA 2V3FA 3O2LA 4HPJA 3W6YA 2QCHA 3UXAA 1FWNA 4D8ZA 3WFAA 4DZAA 3NM1A 3CNYA 3AQUA 3KRBA 3UPMA 3QM3A 1IXOA 2Q8LA 2CEQA 1OFOA 3IUIA 3DIPA 3P0XA 5A6AA 2WJEA 2YZ5A 3DGBA 1XRVA 3P80A 3SCTA 1LQ0A 4JQ1A 1LWJA 3W83A 1M7JA 3B40A 4I5UA 4JTGA 3PY2A 1YHTA 3J7HA 2QCMA 1TV4A 2VEMA 4GQ0A 4X9YA 1KM2A 2YL6A 5CC6A 2JE8A 3C3NA 2V5CA 4MAVA 2Z24A 1QASA 4HCLA 1XIDA 3N2XA 1Z6KA 1ITUA 1AUSL 4G9PA 1JDEA 4HP5A 5HQMA 2XVGA 3WLPA 3M6YA 4E8CA 2FZNA 3KCLA 2CBJA 4U5IA 3ZIZA 3VXGA 1MEHA 3N6QA 4IXXA 4H8HA 2V81A 1PZ0A 3TA6A 3HPZA 2YOCA 3K13A 3WQFA 1YPIA 2O7SA 1V3IA 2X1RA 1NFBA 4LEFA 2VFFA 1EQCA 1VFFA 3UWQA 1UOZA 2YB1A 3FDGA 4K1WA 4JYEA 2FTWA 2E77A 4UR8A 4LUIA 3S2LA 4P7OA 1BQCA 3H2FA 2HVMA 3CZEA 3S3GA 2G4JA 1UD2A 4N4PA 4CN6A 3M5XA 3ATZA 2A3EA 3WQVA 1TV2A 1JZ3A 3PUEA 4HHLA 4KPLA 1KM3A 4CCCA 3SGGA 3LQLA 1IZCA 4YHEA 4US6A 4UTJA 4ZENA 4PR4A 3MANA 5HUPA 3VNKA 1KXVA 4JS3A 1WKYA 2O92A 2PBGA 1J0JA 4GQQA 3SI9A 1E4NA 1C3FA 4GC4A 2CLKA 3VGGA 4BQ2A 3AIBA 1RVKA 1QHPA 1V0MA 3TC7A 4KWVA 5DCEA 2IUZA 4RE2A 3KL5A 4KFPA 4HPGA 1JGIA 1W3LA 1EYWA 2CC0A 3ZLHA 1Q8JA 1QOQA 3EOEA 2GGGA 4LUSA 3URNA 4DN1A 4W7WA 2WSPA 3HQNA 4OFCA 3JS3A 3CIWA 1VLIA 4LBSA 4M80A 4TVUA 1E1CB 1UPMB 5CC5A 3S4TA 2QCFA 5A94A 2FZ9A 3GQYA 1J6PA 4KT2A 4LUTA 3W6MA 3FJ6A 4P5UA 2WK2A 3CL7A 1K4HA 3ALGA 1GQJA 4DWSA 3CO4A 1OZQA 4JTFA 4JIEA 3N2BA 1NOFA 2BVDA 1KW1A 3CV6A 2J77A 2XH7A 1NSJA 4KQNA 3WUBA 2Z7GA 3MUIA 1WX0A 5I79A 2VZTA 4O52A 4K36A 1GQNA 1XQLA 4FXRA 4BK9A 2VELA 5LHFA 3PZMA 2EPMX 4U5KA 4JKKA 4AW7A 3V16A 2FH6A 1ZUAX 3BGJA 4DI8A 4DXVA 2XZ7A 4PUJA 4DJEC 1ZJIA 4GNVA 3SGZA 4LVGA 1CGUA 3NVTA 4NHVA 1D8CA 3UPWA 3RFAA 1PXGA 3T40A 4WIWA 2EKGA 3NPXA 1B3XA 6XIMA 1EF3A 1H1ZA 4KIEA 3TYDA 3A9IA 3KS5A 4EAMA 3W24A 1BWVA 2V69A 4XTDA 2OX4A 4IZGA 3QYQA 4PMDA 3KLKA 3FJNA 4IMAA 3ZWSA 5KSWA 1E5NA 4XAZA 1OFBA 1BPLB 2WVVA 1VAHA 2O9TA 4GIYA 2D2OA 4LYQA 3GKAA 1G5AA 3CAWA 1UKOA 2J62A 7A3HA 4AG0A 3U57A 2G4FA 3WQOA 3BG5A 4H7VA 4EPBC 5LSMA 3JZUA 3O07A 3WBYA 1S1RA 3PNUA 3UU0A 3GW3A 5PTDA 3EWYA 1FQ0A 4UFLA 2OZ0A 1MDRA 3ZSSA 1BRLA 5CSSA 3AHYA 4KCTA 2QV5A 4LFYA 1FWIC 1OB0A 3ITTA 1Q6GA 3MQTA 1SJDA 2IW0A 4PB3A 3KBWA 4JQAA 4ICNA 4JIPA 2D20A 4V15A 1R30A 3KE0A 1HXJA 3EB2A 1HGYA 4JGDA 2OZ8A 5L9FA 1W9XA 1VFMA 5TIMA 3REQB 1UA3A 1DJGA 2R9RA 5IRPA 1EUAA 3P82A 3NO5A 3N9KA 3CMGA 3NGJA 8TIMA 3L65A 3WLSA 2UY3A 1TWSA 2WM0A 5E1QA 2FIQA 2MNRA 4QISA 1VBJA 2PF8A 3P3BA 1V51A 3QSTA 4YTSA 1IXPA 1EIXA 1GPWA 2H8XA 3W86A 4GYPA 3W2KA 4NAFB 2OJPA 4JICA 1H0IA 4H9TA 3T9PA 3I6EA 4N9CA 3LXCA 1KBJA 1MW0A 3HQOA 3P7YA 3U7VA 1N8WA 2VCAA 3I3EA 4WSKA 5IHSA 2ABAA 2OEMA 4M5PA 3JZEA 4Y2WA 3W7RA 1X6NA 4X63A 2HPIA 3KTXA 1HKKA 2OMAA 1V93A 2XVNA 3THAA 2J6VA 1H11A 4RW5A 1EX1A 4K7YA 3LPPA 3B8IA 1KM4A 2PP3A 1GOXA 3M5VA 3CAQA 4J3UA 2XHYA 4G7EA 3QMRA 1QDSA 1CGTA 1LORA 1RQBA 1TWZA 4DO5A 4J28A 4F2UA 1Q3NA 4IFKA 1RHCA 3ME3A 4G56A 1CXIA 5D9MA 1RAKA 3NJ3A 3QQ0A 4XAFA 3UETA 2VGGA 4LJ3A 2QVHA 2PBOA 2R1PA 6TIMA 1TREA 2G3FA 5AHLA 4F0SA 4GJIA 4H9YA 4F9JA 1YXYA 3WIJA 4AD1A 2FZ8A 2X0HA 4B5VA 4WRHA 1H1YA 3F4CA 6A3HA 4AC7C 4OBSA 1B2YA 3V5OA 3KDOA 2V2HA 3Q37A 3SRDA 4EK7A 1H3GA 1QW7A 2A3BA 2I5IA 4ZO6A 5E09A 4POCA 3GE7A 3NDYA 2VHLA 3BAWA 2W0UA 3N3TA 4BI5A 3BQ6A 3SIZA 2ISFA 2ZKMX 4OU1A 1E6ZA 4IPPA 4US5D 3CQIA 3QY7A 1JYNA 1PIFA 1QNVA 4XD3A 4MY8A 3FKKA 4ZO8A 3ZLGA 2WZEA 4PCTA 4O8RA 3UBPC 4C1NB 1A5MC 3S8HA 1TA3A 3WK0A 5F2MA 1TPC1 1UB3A 1W6TA 4P8VA 1E0VA 1E56A 1HG3A 2J66A 1V3MA 3C2OA 3QQWA 3W29A 3FYYA 5A3HA 4LC6A 2GL5A 2OYMA 3GDKA 5EPDA 5HPCA 3CUJA 3KCOA 4S3KA 2X09A 1TMHA 4GA8A 1B3ZA 3EDDA 5MKGA 5A8MA 1S3HA 1M41A 2CWXA 1XBYA 4ZOEA 3UGVA 2VI0A 4HOWA 3OLDA 1A5OC 3PC0A 2VFGA 1BVWA 1PBGA 1WZKA 3N29A 3IS4A 4WCJA 2GVJA 1GG0A 3W84A 2GJPA 3PUGA 1QPKA 3TEVA 3N14A 4ENLA 1OCBA 3EWZA 3MJMA 3WNLA 1W1PA 4X9SA 1W3KA 4NT0A 3NDOA 3PK7A 3VOIA 3EWXA 3QTGA 3I7SA 4HNNA 4IMGA 4XBSA 3W72A 2ON3A 2BFGA 2EPKX 1W37A 1EP1A 5A95A 1WNOA 3B8WA 3U2ZA 4J3ZA 1NJJA 3LRMA 5GJMA 1CCWB 3TXVA 1U22A 4YN5A 3KBSA 2QT3A 4KRZA 2I7GA 3SCOA 3SSZA 2Y8UA 1XC6A 4NNAA 5H8MA 3DU0A 4LU0A 1CLXA 1ZQ5A 4IP4A 2VZUA 3FSUA 1D9EA 1Q7QA 1JFXA 3VM7A 2XIOA 4ZQRA 3P74A 3GVVA 1O5QA 2QNEA 2H90A 5KZDA 3WUGA 3GDTA 1K9TA 3FW6A 3INPA 2VC9A 4EVZA 4KBXA 4UQDA 4XV0A 3TUUA 3RCYA 1BYAA 1UASA 1W8GA 3ALFA 1P0BA 2TAAA 3UG8A 5C0QA 4XVDA 3FCPA 3M0MA 2A7RA 3T09A 4K8GA 5K3VA 1BGGA 5CQ1A 3LHUA 4NY2A 1YADA 4ORIA 2QPXA 5D32A 2GQAA 2WHMA 1XIBA 3ZT7A 2OLHA 3JU2A 2CLIA 4J4KA 5C7VA 4LRTA 4FEZA 4QNWA 3G0UA 2CFFA 1C8QA 1VBHA 2GJNA 3M46A 3BO9A 1K77A 3SEPA 4KF1A 1CPUA 1ZFJA 4UZSA 2Q8ZA 3WNMA 5BWFA 3E38A 3IJLA 4YVVA 1J4EA 1SJAA 5G4WA 4JTSA 2PTZA 1W5NA 1OIMA 2BVTA 1XRTA 1OJXA 1YNYA 1DWAM 1GHRA 4ERAA 3TR9A 3FSTA 4DBSA 1YYAA 4UIOA 1JCNA 1H51A 4X2PA 3UWUA 1ICPA 4TOQA 1ZRQA 3LM7A 4NI8A 2WANA 5I3GA 3A47A 2GGJA 3R8HA 3TZFA 4XZBA 1RH9A 1V6YA 3RX3A 4CQ9A 1R47A 4NQ1A 3BMXA 4DJDD 1GYNA 2VFEA 3B8DA 1OFQA 4NNCA 1SVDA 1ECQA 2F2KA 1Y8BA 4AD2A 2YXOA 1R3WA 1F61A 2WJDA 2G8ZA 3AUOA 4IPJA 3T2PA 4JKMA 2YYUA 3CV2A 3MSGA 4V1YA 4XTIA 2HXUA 1RPXA 1QPQA 3E12A 1EO5A 1HW6A 3WNNA 1NF7A 1YE4A 1QJWA 3GWQA 4GZIA 4R88A 3WJXA 2DZVA 1QBAA 2O0TA 4UMBA 1RXOB 2YCLB 3CH9A 1DIOA 1HX0A 2PLJA 3UZXA 1BG9A 1TQJA 3E49A 1Y5WA 2PDLA 1YKWA 1TV3A 3WQDA 3FEMA 3I65A 3W1UA 4QE4A 1D2KA 2AAAA 4Y9PA 2P10A 1CX9A 5J04A 3UY8A 1MRAA 4QBXA 1TMQA 2WSKA 4XSMA 1V6TA 4E2DA 1Z44A 2W63A 1FWRA 2VWSA 4JCLA 5LKYA 3UJFA 5FL0A 3HPSA 1PV8A 5HMFA 5JH1A 1OINA 4AEFA 3RGTA 5BU6A 3BOXA 3PFRA 4QLJA 2NT1A 2IKGA 1UC5A 1XG4A 4D72A 1E9ZB 4MOZA 2BY2A 2PLCA 2Y8VA 3LCGA 1TJ2A 1A47A 3KHDA 1Q45A 3MSDA 3K4WA 1UMLA 1UR3M 5JXQA 1JDDA 5HMSA 1HVXA 1REQB 3P5YA 1LG2A 4F3HA 4I9AA 1M04A 5FF4A 5I78A 3VKJA 5FSEC 5D37A 4HNLA 3FY1A 1KGWA 1SW3A 2V3EA 3R58A 1T41A 3HV9A 1V0NA 2XFYA 4X22A 3WEMA 4BS0A 5BZAA 2V5LA 1FWGC 2J7CA 2C3ZA 4AX7A 1OGSA 1SMAA 3W7NA 2QVNA 2H6RA 2UY4A 3RMEA 2VX4A 3BLOA 3H4WA 3B4UA 3TROA 3SY5A 2F61A 3H54A 5HAOA 4PBEA 1JG9A 3NYDA 3UJ2A 5I3IA 2PC8A 4LAUA 3W01A 5LYRA 4Q3MA 3MJYA 4HN4A 3RU8X 3W7HA 3Q94A 2VR4A 3VNLA 5LHEA 1XH1A 2FMNA 1V79A 3GKFA 3PTQA 2VTFA 3SJNA 3GD6A 4CKQA 1A3XA 2OR2A 3L0KA 3L12A 2PDKA 3BOLA 4RXGA 1TX0A 4LCQA 4BF5A 4M51A 2NSOA 3CLWA 2YCEA 3IPWA 3TV8A 1JZ8A 2P3ZA 4JIQA 1C91A 3G0SA 1UP0A 3A3HA 2X2YA 3QVQA 4B4FA 2G37A 2DGAA 4QDWA 4M7SA 5F2IA 1OX4B 3FJ4A 3TQ0A 1E6NA 5I02A 4M82A 3VO0A 4IP5A 4ZQCA 4O1FA 5ABFA 1W8SA 4LVDA 1J0IA 1JPDX 2QMJA 5FEXA 2G50A 3WL0A 3SFWA 2BXZA 3CU2A 4YTTA 1OM0A 3LHYA 4W89A 1UMYA 4QTGA 1AG1O 2DORA 1FWFC 4C6OA 1QI2A 3H24A 5FJPA 1YNPA 3MKKA 2HVOA 4H41A 3OOQA 3P61A 3IV8A 4WY0B 4F0HA 4L7ZA 2BY3A 3G3MA 3NSMA 2I16A 3GHTA 4A35A 1TJPA 3TN3A 4WY0F 4RE4A 1GOOA 8RUCA 4KESA 3VFCA 5FD0A 4UMAA 5C71A 2EPLX 2OEKA 5DY2A 2YB4A 3A4AA 4HYRA 3GZAA 2Z26A 3URQA 2G0WA 3DCPA 2V3DA 2CZ5A 4J2MA 3DXIA 1PSCA 6REQA 1OABA 2XSXA 1QI0A 1QNPA 3UXLA 3C2FA 1OFRA 4GVFA 2BS9A 3VIOA 4RDVA 1ONEA 2EEXA 4QXIA 3S47A 2FVMA 1DWJM 1A5LC 1F3XA 3E5BA 2OQLA 4ONVA 4URIA 2A21A 1GJWA 2QCDB 4ZO7A 1BLIA 2Q71A 3OGRA 1PUDA 1M01A 3U4FA 1VRXA 4QLLA 2YR1A 3II1A 3QZ6A 1JFHA 3D6NA 2Q01A 3W3OA 1KCKA 1UIPA 5KZ6A 3P14A 1ADSA 2CYGA 3R12A 4ZR8A 3WLIA 4DJDC 2FJUB 4JTUA 1DOSA 1KR1A 1LQ2A 3W7DA 1NQKA 3DG6A 1W32A 3W7LA 1AQMA 3RCNA 2GZXA 4V28A 2EHHA 4IG2B 3NOEA 3UG3A 2C18A 3NSXA 3O3RA 5CBJA 4AIBA 1RQEA 5CPNA 4WKHA 3W22A 3DOPA 3BLKA 3VE9A 4GIAA 4GBUA 4JD4A 5JQ9A 2P0IA 4PN2A 3B8SA 4L6HA 2P8BA 2TMDA 1QMLA 5KTLA 3AIEA 3LZ3A 1K9EA 9XIMA 2P3EA 1EPXA 2VGFA 3V4BA 2PA6A 4RNFA