1B31A

Xylanase from penicillium simplicissimum, native with peg200 as cryoprotectant
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
302
structure length
302
Chain Sequence
EASVSIDAKFKAHGKKYLGTIGDQYTLTKNTKNPAIIKADFGQLTPENSMKWDATEPNRGQFTFSGSDYLVNFAQSNGKLIRGHTLVWHSQLPGWVSSITDKNTLISVLKNHITTVMTRYKGKIYAWDVLNEIFNEDGSLRNSVFYNVIGEDYVRIAFETARSVDPNAKLYINDYNLDSAGYSKVNGMVSHVKKWLAAGIPIDGIGSQTHLGAGAGSAVAGALNALASAGTKEIAITELDIAGASSTDYVNVVNACLNQAKCVGITVWGVADPDSWRSSSSPLLFDGNYNPKAAYNAIANAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (XYLANASE)
publication title Xylan binding subsite mapping in the xylanase from Penicillium simplicissimum using xylooligosaccharides as cryo-protectant.
pubmed doi rcsb
molecule tags Family 10 xylanase
total genus 130
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1998-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1b31A00
5BRQA 3AMCA 4NI3A 3M7SA 2FGZA 4WKAA 1H3GA 4WJXA 2Y4SA 2DIEA 4D6CA 1GOWA 1KXTA 1FP9A 4OOUA 3MMWA 2VRKA 4MTVA 3MKKA 1H09A 1H0GA 2D0GA 4B16A 2E4TA 1E4NA 2CKRA 1PIFA 3F5JA 1Z32X 3SCPA 1G5AA 4BZYA 3GNPA 2JF6A 5DMYA 1TA3A 4GQQA 2D0FA 1JZ6A 1M7XA 5KZ6A 4IISA 4GZEA 5E6ZA 5DT7A 4W85A 1W9DM 1I1XA 4KMQA 2WSPA 1E3XA 1JIBA 1E6SM 1OD0A 5JIWA 2FHCA 2WHKA 1HKIA 1V03A 5GNZA 6A3HA 2ZWZA 1LL7A 4BCEA 2W91A 4DWSB 3BXWA 3GBDA 4AXNA 1QPKA 1BPLB 3RM8A 3IJ9A 2WMHA 4H8VA 4ZEPA 4QP0A 3WUGA 1X1NA 4PMRA 3NJ3A 2PWHA 3WUBA 4AD2A 3ALFA 2D20A 1J0YA 3THDA 2DSWA 2AOSA 4WSJA 4HZ6A 3PZ9A 5JBEA 2EXOA 3AMDA 1DWAM 2VCBA 4W7VA 3VM5A 1UD4A 1IV8A 4HTYA 3GTNA 2CKSA 4D6IA 1BFNA 1V6UA 3ZSTA 4HU8A 4OZOA 4R5EA 1UHVA 2BHZA 3FY1A 4UOZA 3WF2A 4KGJA 1MFVA 2EPMX 1M01A 2VC9A 3T0DA 4XV0A 4W5ZA 2VL4A 3WF1A 1B3YA 3UERA 3KL3A 4CCDA 2PI6A 4UQ9A 5ABFB 4DM2A 2G3MA 2E9LA 1BYDA 4GI9A 4CD7A 3THCA 2WLYA 3WQ8A 3FW6A 1JZ3A 3AHTA 2O9RA 2XHYA 2VMFA 2DGAA 4PN2A 3T2QA 1VBRA 1W2PA 4HPHA 2Y8VA 1UA7A 3PZNA 3VX1A 4CD4A 2G8ZA 3I3DA 3K8MA 4P8WA 1WZAA 2GJXA 3IANA 4WF7A 3CLWA 4IM4A 2JFEX 3WL0A 1TZ7A 3MMDA 1FHLA 3CBWA 3CIVA 1M04A 3ARPA 3QOMA 1LWJA 2J62A 4QLKA 2ZWYA 2OYLA 1HN1A 1UG6A 3WD0A 2WC7A 2DT0A 2W5FA 4BQ2A 2X1IA 2D3LA 3BAIA 5HPCA 2OLHA 2F2HA 3ZT6A 1V3KA 3N15A 1UOKA 2WVVB 1RD6A 1EGZA 3SUVA 5IFTA 5LA1A 3SCWA 2VRJA 3VTRA 3W38A 1CXHA 2DH2A 1W3LA 2ZUTA 1UWSA 1JNDA 3W25A 2V3GA 2OYMA 4J3SA 4X0NA 1ZS2A 1EDQA 1K9EA 1E9LA 4AMCA 4W8LA 3IJ7A 2D22A 1IT0A 2VI0A 2ZUWA 2EPNA 2PWDA 4U5KA 1KFWA 3OGRA 2YA2A 2FH8A 2OSYA 1XD1A 3K8LA 1E0WA 3CMJA 3ALGA 1O6IA 2C8NA 2VOTA 3KWXA 1CXKA 1HJQA 1PX8A 1OCQA 1W3JA 4AW7A 1B3VA 1UR1A 1FFRA 3VGEA 4JCMA 3N18A 4UQCA 3AZRA 2VZVA 4W7UA 3OGVA 4V27A 5AC4A 3POCA 3AXXA 1VENA 3AMGA 3DYMA 3WF4A 2DSZA 3CUFA 1XH2A 4P7QA 5AYBA 2PBGA 3CZEA 4MJ4A 3CHDA 3WD3A 5A95A 4J3WA 3VKKA 1TVPA 4PRWA 1BVZA 3CHFA 5E6YA 3LPFA 1OSEA 2CPUA 1JD9A 5HXMA 2XJ7A 1XRVA 4AEFA 1CWYA 1E6QM 3WF0A 4F79A 1HL8A 5CGMA 2DDXA 2WK2A 3WDIA 2CCRA 1ZBCA 2CYGA 3T2OA 4UFMA 4L4PA 3CUJA 1GQLA 1WCGA 3VILA 1KWGA 1E4IA 3MMUA 1Q6DA 4CN4A 2XVNA 2J78A 4H2CA 2UY5A 4PTVA 4ATLA 1UWTA 1E6PA 4PMZA 4JHZA 2YDQA 4HMDA 1C3FA 4PUEA 5BXTA 4HA1A 2NSXA 2EBNA 4P8XA 5CGTA 2BY1A 4HZ7A 3WNMA 3W27A 2UY2A 2E40A 2QF8A 2ZUUA 3BCFA 1OT1A 2WC3A 3RDKA 3G6LA 3GH4A 1J01A 3W6MA 1EOMA 4J28A 2VZTA 3WNPA 1KWKA 2PWFA 3W26A 4ACZA 1BTCA 5DEZA 1XCWA 1NWUA 1QNRA 1B3XA 3WQWA 3ZIZA 2TAAA 4CD8A 3WDQA 3MUAA 1ECEA 1FHDA 1VFFA 3AXIA 4IUGA 1M03A 3IJ8A 4U2ZA 1WZMA 5D9MA 2J8FA 2ZX7A 3RM9A 2WKLA 1VFUA 4TUFA 3EMQA 1JF5A 1J0ZA 3ARTA 1CGWA 2BNJA 5I5RA 1MXDA 3TTYA 1J11A 3WY1A 3L4UA 1VF8A 2VUYA 3NDYA 2BY0A 3CZKA 1E6NA 1JFXA 3N04A 3W4RA 1BHGA 2XVGA 3SCUA 4LYPA 1VFOA 2O9OA 1J10A 1FFQA 4GO9A 5ABEA 1XD0A 3L2LA 4YHGA 1RP8A 4MDPA 1Q6GA 1CGXA 2J79A 2QPUA 4EK7A 1B2YA 1QOXA 1ISWA 3NYDA 1BYAA 1DWIM 3PZMA 5CLTA 1OGSA 2JALA 2WHMA 3F4VA 4JKMA 3VINA 4FLQA 1KXHA 3SCVA 4FF5A 2WB5A 3W82A 5CSYA 1CLVA 4TOQA 3E1F1 1ISZA 4F8XA 3EMZA 5D8ZA 2VNCA 5BYWA 2Y24A 4D1IA 1W9VA 1EXPA 4LGXA 1HKKA 3WQ5A 1LLOA 3CZLA 4UQEA 1VIWA 4U3CA 1V3IA 5FIPA 1E4LA 1WB0A 5I79A 2D23A 3RMEA 3OZPA 2ZUNA 3ARUA 4A3HA 3WH9A 1O7AA 2WMGA 3LPPA 3MUIA 3VIGA 2WHJA 4UQDA 3FHQA 2D24A 1H2JA 1V3JA 3A6OA 3WBAA 3O6AA 1H49A 2BVYA 3GNOA 4M81A 1ISYA 3EDKA 4XZBA 5DF0A 2WVTA 4IPLA 1V6WA 1CENA 4C7GA 1G9HA 4NRSA 1HJVA 3AIQA 4CVUA 2VR4A 2W67A 2WZEA 1YHTA 2GUYA 2O9PA 2ZUMA 1E15A 2BFGA 1FH9A 1VFMA 2ZXQA 2OWWA 5A6MA 1KQYA 5IXEA 2WCAA 1N82A 1OINA 1Q4NX 4HZ8A 1QNQA 3N9KA 1OB0A 2DSUA 1JI2A 1K6AA 4JHOA 5CPTA 3TP4A 1LL6A 1UZ1A 1HKMA 3VOCA 2J7FA 3SCQA 1ISXA 2DSKA 2J7BA 2XYLA 1K9DA 2GFTA 1KGUA 2EPOA 3VDCA 1UR0A 2EPLX 3LMYA 4JL2A 3VMPA 5JIPA 1EQPA 2XIIA 3RILA 4AC1X 1ZBVA 1EO5A 2J25A 3ZM8A 1KXQA 3B9EA 2J77A 4Z2KA 5CZKA 1RPKA 2EO7A 5A6BA 4HMEA 1WZLA 1H1NA 1LWHA 3AIEA 2JIEA 4H41A 1JZ8A 4AZ5A 1SMAA 1C7TA 1MQPA 2CXGA 5A8OA 1AMYA 1MW0A 3BH4A 1W91A 7A3HA 4AZCB 5EFFA 3WFLA 3SUWA 1A47A 1L0PA 4P8VA 4MNMA 5BXSA 4WSKA 1C7SA 1UD3A 1KXVA 3L4XA 1UR8A 2YLAA 1BYBA 3AIVA 3DYPA 3DECA 4QAWA 1H11A 4FK9A 1HIZA 1HVQA 1KB3A 4JFWA 2OSXA 1EHAA 4OIFA 3IAPA 4M56A 4BA0A 1JDCA 4PUDA 4BS0A 3L4VA 3I3BA 4MB5A 3QHMA 3J7HA 2Y8KA 1QNPA 1DWHM 1CXFA 3NIYA 2HVMA 3PN8A 3EDJA 2EJ1A 1I75A 4UR9A 1EDGA 4A3YA 2RGMA 1XV8A 4AYSA 2QV4A 2GJPA 2IXVA 2NT1A 3POHA 4W87A 1LG1A 1HP5A 2YDRA 4LYQA 3WH7A 1UH2A 3UG4A 3GZAA 4TVDA 3HJEA 1UR4A 3U5UA 1ISVA 1V6VA 5EB8A 3AZSA 2VZUA 2AAAA 3WQ6A 4F9JA 5A2CA 2HISA 1WO2A 4CN6A 2A3AA 2DQXA 4MJ2A 1VJSA 1UZ4A 1HP4A 1TE1A 3EBVA 4AZHA 1GPFA 1BGGA 5A8QA 4JAWA 4J3UA 3VNZA 1V3HA 1PZ3A 4DWSC 4F66A 3VDAA 1VBUA 4W86A 5HDRA 5I78A 4D6GA 4HU0A 1V3MA 1QHZA 3SURA 3VIPA 1OWQA 1JF6A 4AD4A 2ZXDA 3VGFA 3BAWA 1G01A 1PZ2A 2CBUA 2UWFA 2WYSA 1EO7A 4P8UA 3WEMA 1K9TA 4HA3A 5FD0A 3CUGA 3WH8A 3N11A 1C90A 4PMXA 1V0KA 5KEZA 1D7FA 1R85A 3S6TA 3AIRA 1TMQA 2JF7A 2QLYA 5A94A 3WD1A 1UH3A 2WC4A 3WUFA 3GH7A 3OLDA 1V02A 1ZU8A 2ZX8A 3PZIA 4PSPA 3UEQA 3GM8A 5FCZA 5EMYA 1W9BM 4JFTA 1DHKA 4DWSA 1B31A 2YKKA 3VIHA 5CG0A 5I6SA 4W84A 5IHSA 4E8DA 3DYOA 3VD4A 4KRTA 2CBVA 1RP9A 3U7BA 2WBKA 1GQIA 1CXIA 1MW1A 3IK2A 4S3KA 4Y7EA 1NM9A 4WKFA 3PZVA 5D8WA 3WH5A 2XIBA 2QHAA 3BLKA 3UETA 4B15A 1AVAA 1GUVA 1JZ4A 1UWRA 3M46A 3ZJ7A 1QVBA 3AXHA 3DHUA 2F61A 1NWRA 3WBEA 3ZJ8A 1J18A 2GK1B 4X9YA 3A4WA 4FLOA 4QCFA 1XC6A 3VNYA 3F5KA 3M07A 6TAAA 4E8CA 3RO8A 4PMVA 1U2YA 1BGAA 2XM1A 2YL9A 4LQ1A 4D1JA 1W3KA 1HJWA 3L4TA 3AS1A 4KRUA 1EOKA 1DWFM 4L4OA 5ABFA 1KQZA 1UWQA 4V2XA 3ZJKA 1OBAA 3O9NA 4U5IA 3SUSA 1E6XM 1AQHA 3N12A 3T08A 1B1YA 4OOZA 5A6KA 3OB8A 3PZOA 4AZBA 1WZKA 3WEZA 4AIOA 1UKTA 3WSUA 4CVWA 2GSJA 1R86A 2DSVA 2OWCA 2G4FA 4ZFMA 4QDMA 1LL4A 5CXPA 4UOJA 4MNKA 5EBAA 1GNXA 1C91A 4GINA 1ZBWA 2VO5A 3VGBA 3WDPP 1KCKA 2WVSA 4KWUA 3WNOA 5IHRA 2WW5A 3N1AA 2VR5A 5FL1A 5HPOA 3AYSA 1AQ0A 2C7FA 3AHXA 1VRXA 5EFDA 3L4YA 4KGLA 4OJYA 4XX6A 3AHYA 1JZ2A 1UKOA 3U7VA 3PZTA 3BMWA 1OD8A 1HT6A 3QHOA 4M24A 1UR9A 2YL6A 3QOKA 2WSKA 2G3JA 1VB9A 2GJRA 2J7DA 2DIJA 5A6AA 2XFRA 3ARVA 3GH5A 1GOKA 3AJ7A 1PIGA 4OUEA 4LX4A 1ITCA 4P7OA 4RE4A 1XYZA 1JYWA 1XGZA 1U30A 3U57A 1E56A 5E0FA 2MANA 1TVNA 3RPMA 4EANA 3VD5A 2WNWA 4M80A 1UQYA 4K68A 2NW0A 1JAEA 5BXPA 1CZ1A 4JFVA 3EDDA 1V0LA 2XFFA 2X2YA 3VIFA 4DUWA 3AS2A 1AQMA 3ZSSA 1W1VA 5DT5A 4P7NA 1BQCA 4AZIA 4M8UA 4NZCA 4TTUA 4AIUA 1EQCA 4AY1A 2XVKA 3WD4A 3OIHA 3UR7A 2V3FA 4MPKA 3VUPA 7TAAA 4PCSA 4MNLA 3TOPA 4PBGA 4GZIA 4W93A 2ZUSA 1JNEA 1W9UA 3QR3A 3VMNA 2Y5EA 2FDMA 5M17A 4LYRA 1DWJM 1W1TA 1XSJA 3WDRA 3QHNA 1A3HA 1OM0A 4PMDA 2J4GA 3PTMA 3WL1A 1JL8A 3CTTA 1GORA 2XVLA 3AROA 1E1EA 1GOMA 1QNOA 2BHUA 2BY2A 1BSIA 2V5DA 3WIJA 3CZ8A 2V3DA 2A3EA 1OGGA 1HVXA 1E43A 3II1A 5BRPA 4XB3A 3G6MA 3WMBA 5I3DA 2XM2A 4J3VA 1JDAA 3RM4A 1JYVA 2WMIB 4HMCA 3ARZA 1SFSA 3SIMA 3WD2A 5D9OA 2V5CA 1Q6CA 2G41A 1J12A 3BLPX 1GVYA 1V0MA 2Q8XA 1JYNA 1JYXA 2VQUA 1PBGA 2YL5A 1OIMA 3HU7A 5HBFA 3CUIA 3VU2A 2FGLA 1GJWA 3PHAA 2QMJA 4Q7NA 4ATWA 1FOBA 4GKLA 1JFHA 5C8BB 4TTGA 1EA9C 1UH4A 1QNSA 3WNNA 1EDTA 1HJXA 4QLJA 5TD4A 2G3NA 2J7GA 4E2OA 5ECUA 1Q6EA 3D5HA 1MFUA 3AMLA 1US2A 2C0HA 4UFHA 4PTMA 1GJUA 3MSGA 4B3KA 3T0AA 4ZE5A 3L2MA 2VZOA 4DUVA 4CU6A 2O92A 2VT0A 3VDBA 4W7WA 1QI4A 4Q22A 3WMCA 2CBIA 3UR8A 4R27A 1E0VA 1VEPA 1BAGA 2WAGA 4PTXA 4H8HA 5AC5A 2WMJA 2WVUA 3VDHA 1LJYA 5E9AA 1HF6A 1NQ6A 3FAWA 1E6RA 3K4AA 2J47A 2PWEA 3HN3A 1JXJA 4Z2GA 1J0IA 4JIEA 3ECQA 4M1RA 1Y7VA 4D6DA 1C8QA 3N13A 3OA5A 3WNKA 1QI2A 4AEEA 4N0RA 2VJXA 1TCMA 1HXJA 1ZB5A 2CEQA 2WZIA 3AS3A 2X05A 3KE0A 4WK9A 5LYRA 2UY3A 1C92A 1XHGA 5FL0A 1GCYA 1X6NA 4D6HA 1UQZA 1PX4A 1W9XA 2QMKA 1NWSA 3QGVA 3GNRA 1QHOA 4CGTA 1GONA 5JUVA 2XPKA 1OGBA 4AISA 1XYFA 2EPKX 1MW3A 3WNLA 1J9YA 2ZICA 3AFBA 2Z1SA 4PMNA 2PC8A 4PMYA 3OLIA 4HPGA 1ZJBA 5E70A 3EYPA 1NP0A 3CHEA 3UG5A 1UD6A 3W81A 4UQAA 1WP6A 2WXDM 1HX0A 3FXYA 3SCRA 5A2BA 2A3CA 3DC0A 4CCCA 2XG9A 3AIWA 5DFAA 2VX6A 2XVPA 3MS8A 1B9ZA 1W1PA 3CO4A 5A6SA 2CNCA 5I23A 1X6LA 4P7LA 2J7CA 1GW1A 1H5VA 1NOFA 4CCEA 1PEZA 4HA4A 4NF7A 4LXFA 2BXYA 4AIEA 1GHSA 3AOFA 5A69A 1NOWA 5FKYA 4JFSA 1P6WA 3BAKA 3AISA 2WCGA 3UG3A 4EKJA 2JEQA 3BCDA 2AMGA 2ZX9A 1DEDA 4MB4A 4CD5A 3PTQA 1V6XA 3TONA 3D3AA 2WMFA 4PSRA 2ZXBA 1JI1A 5GPRA 1GQJA 3L4WA 8CGTA 3A3HA 2YL8A 1FP8A 3PZUA 1BLIA 3NSXA 1V0NA 5LA0A 1WE5A 2W61A 5BWFA 1DTUA 2W4XA 5CPSA 1S46A 1RH9A 4XZWA 2VTFA 3AHZA 5IDIA 3GYCA 2ESCA 4XUYA 3FAXA 1FH8A 4AD1A 3WH6A 1TFVA 2ZUVA 3W28A 2XTKA 1LQ0A 2YBUA 3OLGA 4NRRA 1UWUA 3AZTA 2O9TA 4D6EA 1HKJA 2BHYA 3K4DA 1TA3B 4W5UA 3W37A 1MW2A 3GBEA 4QFUA 4AZCA 3T2PA 2BXZA 4UFIA 2BVDA 3W24A 5F7UA 3VD9A 1G0CA 2WPGA 4WLCA 3VIOA 3MV11 3WDHA 1D3CA 4GO8A 1ZJAA 2A3BA 3SCNA 3VVGA 4UTFA 4ZXLA 3EDFA 3NSMA 4CD6A 1QI3A 2OWXA 1QBAA 4RE2A 3PZGA 5DO8A 5A3HA 4UOQA 3W53A 4B3LA 2WCSA 2VX4A 1G94A 3SEPA 1MYRA 2GVYA 4Z2HA 5AY7A 4S3JA 2XSBA 1HJSA 3MU7A 2BV9A 3ARYA 1E73M 5GNYA 3W6LA 4JZ5A 1F4HA 1V3LA 2WKGA 3WKZA 3W29A 3WELA 3CPUA 3VM7A 2D0HA 2W66A 5IFPA 1QHPA 4OBRA 3RJYA 4PEEA 3MUZ1 5LA2A 3WMSA 1TG7A 2J8GA 2IUZA 3ZT5A 1R87A 3DHPA 5A8PA 1C8XA 2ZE0A 3VGHA 1VAHA 1EHNA 1JAKA 4MDOA 3VGGA 2XUCA 2D2OA 2ZIDA 4W88A 3MO4A 1IZJA 1C8YA 2DT1A 4CUCA 5BXRA 1FH7A 2A3HA 3ZR6A 1E3ZA 5M5DA 5D9PA 2XFYA 1J0JA 2PF0A 1OIFA 2BVTA 4BF7A 4RE3A 4HOWA 1ODZA 2YOCA 2NT0A 2WLZA 2CETA 1XSKA 2CBJA 1QW9A 1KGXA 3APGA 1E1FA 2GJXB 3WDJA 4HOXA 4CU7A 4W8AA 4JKLA 3T0BA 3N17A 4ATDA 3ARSA 3BAJA 3WQ4A 4Z2IA 4H7VA 1ZBKA 4PTWA 3PTKA 4UQBA 3A4AA 2J7EA 3O2LA 3W0KA 3CZJA 3WUEA 4J7RA 2X0HA 1TUXA 1KBKA 1NARA 3GXIA 4OKDA 3GXFA 4AZ6A 4IPNB 3VIJA 1QI5A 2X8RA 3AIBA 4JKKA 1E0XA 1GOOA 1L8NA 1H0IA 2BY3A 2IXUA 3TTQA 3BSGA 2CESA 2Z1KA 1NWTA 1E55A 2VURA 1HJUA 2W92A 3PZQA 4MNJA 2WANA 1MQQA 1UD8A 4FMVA 2VRQA 4B9YA 1XH1A 3U5YA 1W1YA 3CZGA 2XWDA 5C70A 1E70M 3NCOA 3VIKA 2DT3A 3OG2A 1G1YA 4BQ5A 4UZSA 3ZQ9A 1UKSA 1BG4A 5A1AA 3AQUA 4QLLA 3AMKA 2CHNA 2GK1A 3B8SA 3KL0A 3ZJ6A 5ABHA 2WBGA 1I1WA 1J0KA 4GIAA 1YQ2A 4E4PA 2JIWA 1ZL1A 4PCTA 2VX7A 2J75A 1ODUA 1R8LA 1NOUA 2XWEA 1E72M 1KGWA 2PBOA 3RJXA 4YN5A 5CQ1A 3UESA 1M53A 4BQ4A 4TX8A 2V3EA 3SUTA 1OT2A 3TTOA 2WVVA 3HMCA 1B30A 1IZKA 4KH2A 4AWEA 4BQ3A 4P7RA 4H04A 1WDPA 4B9ZA 1VEMA 3BSHA 3F5LA 3WENA 1NH6A 5CLWA 5I0DA 3A47A 1HNYA 4YHEA 1CBGA 5BROA 3S2CA 1B0IA 1TR1A 4PMOA 4GZJA 4JL1A 1EH9A 3CH9A 1CDGA 3WFZA 1BG9A 3MANA 1QI0A 1HL9A 4Z2LA 2X09A 3UCQA 2ZXAA 3CMGA 3FHAA 1CGYA 1CTNA 4W89A 1K9FA 1WNOA 4HOZA 1CYGA 2YIHA 3VIMA 5ABGA 3ZO9A 1EIBA 2BS9A 1V08A 1W9PA 3TA9A 2ZX5A 1JG9A 4J3XA 3VX0A 1UWIA 1UYQA 1CPUA 3VMOA 4CU8A 5M03A 1XCXA 3ZOAA 4ZE4A 2DH3A 3VO0A 3WF3A 2YA0A 4JFUA 1PX3A 6CGTA 1VEOA 1MXGA 3OGSA 4ACZB 1NP2A 2E9MA 3BAYA 2WM0A 1WKYA 3OBAA 4D72A 4F9DA 1V02E 2YLLA 5CSUA 4D6JA 1D2KA 2X0YA 1R7AA 1W2VA 4MAZA 4UFJA 4TVCA 3VD3A 2GDVA 3KZSA 3AS0A 2E8ZA 5A6BD 3NDZA 1WDQA 5HOSA 2CITA 3ARRA 1H41A 4CKQA 1UA3A 3T09A 3GXDA 3EMCA 1R7OA 4TX6A 1JGIA 3A4XA 1JD7A 2YDSA 4V28A 1ESWA 3AYRA 2OYKA 4ML4A 3L4ZA 4RL3A 3GXMA 1GHRA 5A6JA 1E71M 2VZSA 3K8KA 4ACYA 5C71A 1E40A 1CIUA 2DT2A 3BMVA 1B3ZA 4GXPA 1KR1A 2EEXA 3AIUA 2CHOA 1JZ5A 4J3TA 5D9NA 3ZT7A 4Z2JA 2JEPA 4X0VA 4MADA 4EE9A 2VCAA 1WAWA 1UKPA 1E6ZA 2XGIA 2E9BA 2JE8A 1W3HA 3BC9A 1WDRA 2WMIA 3ZMRA 3MUY1 1CXEA 5I24A 2YBTA 1QBBA 5HNNA 4MB1A 4D71A 3FN9A 4J27A 2YA1A 2ZX6A 1DWGM 4AD0A 4DM1A 2FHBA 3NUKA 3SCSA 4MAVA 2VCCA 5D4YA 3OZOA 4W8BA 2WWDA 4AD5A 1BYCA 1VJZA 1BVNP 1J0HA 3JUGA 4YPJA 3WN6A 3RIKA 2WHLA 5GQBA 2PWGA 2FHFA 3SCTA 4U33A 4NSBA 5A8MA 7CGTA 3M6DA 1DP0A 5M3WA 1SYTA 2OSWA 2E0PA 2VVSA 5BCAA 1JZ7A 4JCLA 4WIWA 1WPCA 2QPSA 4ZENA 3B9AA 4UZUA 4U2YA 3MSDA 3TTSA 1UD2A 1WDSA 5A8NA 1CECA 3PBGA 4EAMA 1LG2A 1CEOA 3SUUA 2WMKA 1SR0A 4FLSA 3MV01 1GQKA 1JXKA 1GOIA 2B31A 3KEHA 2XGBA 3NSNA 4U3AA 5FOOA 1B90A 4PMQA 1CGVA 3ARXA 1B3WA 1GVIA 3FNDA 2DPEA 2G3IA 2UY4A 4N42A 4H8UA 1C93A 4WKHA 3ZR5A 2W62A 1XSIA 1Q6FA 3VD7A 2PB1A 1LF1A 3LPOA 1SMDA 2GDUA 4GQRA 3VPLA 2VX5A 4URIA 4A4AA 1ITXA 2ZOXA 4GPNA 1W32A 4C7DA 4D6FA 5AYIA 3BAXA 2D3NA 4UCFA 2EQDA 1KBBA 4CN1A 4GI8A 4PMUA 4QCEA 5JBDA 1GOQA 2RGLA 4AD3A 2VVNA 2E8YA 5I2UA 2J7HA 3CUHA 2E3ZA 1MVYA 1GZJA 1UD5A 4FLRA 2DEPA 3AI0A 5CPQA 4DWSD 1U33A 1E4MM 5E0CA 2J74A 1PAMA 4M29A 3WQVA 9CGTA 4UFKA 1PPIA 8A3HA 5A2AA 1KCLA 4PYSA 1XH0A 3GDBA 5CJ5A 2WWCA 3SCOA 1MQRA 3CHCA 1MWOA 1FA2A 1PJ9A 1BF2A 2D1ZA 4U31A 3K1DA 3VIIA 3VGDA 1E5JA 2CERA 3I3EA 4HP5A 1E5NA 5JBFA 1UUQA 3CGTA 1F4AA 2VQTA 3BGAA 4TVUA 2XSAA 2WZHA 3AICA 4OBSA 4UFLA 4AZ7A 2F8QA 5I77A 4TXEA 5E09A 4C7FA 4AZGA 1UKQA 3RCNA 2FH6A 1KR0A 2W63A 3B9DA 4GI6A 4DUXA 3OLEA 1H4PA 3AHVA 1JDDA 1QW8A 3IAQA 1UR2A 5A6LA 2V38A 2YJQA 3ARQA 4LPCA 1CXLA 3KL5A 4ZXOA 1CGTA 4UNIA 3WEOA 1US3A 5GNXA 1CLXA 2Y2WA 2CIPA 3EDEA 4M82A 3K46A 3LPGA 4MB3A 1CGUA 3ARWA 1CNVA 1V6YA
chains in the Genus database with same CATH superfamily
5FJPA 4ZQPA 1H3GA 4WJXA 1Y5XA 4D6CA 2XISA 2QAFA 2NUWA 1BRLA 4HYRA 3MMWA 4MTVA 6TIMA 3MKKA 2GYIA 2IPGA 2FTWA 1H0GA 4GABA 2E4TA 1PS9A 2Z7KA 1L6YA 1AODA 1JDEA 3TLQA 3MCMA 1SSGA 3GC4A 3DESA 5H2ZA 1G5AA 4JX6A 3ERPA 3GNPA 3ZVIA 2JF6A 3E2SA 1TA3A 4TV6A 1TIMA 3ITCA 4GZEA 1L6SA 5E6ZA 3QF0A 4W85A 4YMZA 1E3XA 1JIBA 3I65A 1OD0A 3R7MA 5JH1A 4K36A 1WAUA 1ALDA 6A3HA 4LVDA 4QG6A 2E6DA 4BCEA 3M0XA 2W91A 3IVSA 3MJYA 3A3WA 3ITTA 2CLPA 1OG6A 2CLLA 3AUOA 1BPLB 3RM8A 2WMHA 4QP0A 4LYKA 2X42A 4FSAA 4DZ5A 4NNBA 3N2TA 4AD2A 2C1HA 4Y8EA 4DRSA 2D20A 5K7JA 1KTNA 1G69A 2EXOA 5F2MA 4W7VA 2ATMA 3TH6A 3ZSTA 4OZOA 1CB2A 3PUDA 4PR4A 3RX3A 4MWAE 3PBVA 4HPNA 2EPMX 1M01A 2A2IA 4LV4A 3VI2A 2VL4A 4KQNA 2Z28A 3H26A 3TCSA 4IF2A 4UQ9A 2QCMA 3QTPA 1PL9A 4DM2A 3RLUA 3S2JA 5F4XA 1JZ3A 3FW6A 2XHYA 2VMFA 4GIYA 2B4GA 3PTDA 1V79A 4IXXA 3TZFA 1VBRA 1QMLA 3E0VA 4DI9A 3O0FA 1X6UA 4UTUA 1UA7A 4EF8A 2NX1A 5TQLA 2QJGA 1I4NA 2E6YA 3FK4A 4Y8FA 3K8MA 3LU2A 3LN3A 1P6BA 4NNCA 1GVRA 3CLWA 3V5CA 2JFEX 3WL0A 2E7FA 1FHLA 3HG5A 3LXCA 4LAMA 3ARPA 1XX1A 3BV7A 3F03K 1OFQA 2OO0A 4RKAA 5H6HA 2PDCA 4YWIA 3BAIA 1AL8A 4ADTA 3W2NA 5HPCA 2OLHA 1LBMA 1YPXA 1XLAA 2F2HA 4QJ5B 3ZT6A 4WEVX 2PWUA 3DCPA 4C5ZA 3UJSA 2VYOA 5IFTA 4KFNA 4AVNA 1CXHA 3G8RA 1W3LA 2QCCA 2ZUTA 5JQ9A 1UWSA 3W25A 1ZS2A 2O7QA 1EDQA 2G97A 5CCZA 3LHTA 1IGSA 4AMCA 3VCRA 4ZA0A 1V51A 1IT0A 4LUJA 1QWKA 1KKOA 4MY1A 2PWDA 3DFPA 2FH8A 3IV8A 4JN7A 2ZC8A 3CTLA 1D9EA 1FWFC 2IPFA 1Q2RA 2C8NA 2DU2A 2B7OA 1CXKA 3ES7A 1OCQA 1YEYA 1B3VA 1VFSA 1FFRA 2AQOA 2V69A 4JCMA 4HSHA 4DJED 3FFSA 3EWCA 4B5WA 2VZVA 3KOFA 6REQB 5AC4A 3AXXA 3AMGA 4PUKA 3DYMA 3M0IA 3P80A 3W7QA 3XINA 3N4AA 1WOAA 4P7QA 4S1FA 3LLFA 3CZEA 4KF1A 1K8CA 1ML1A 2YYUA 1DIOA 1XKYA 3WD3A 1Q5MA 2ZZ6A 4FXFA 4J3WA 1ZQ5A 5A6TC 3RPTA 4L64A 1TJ0A 3O6DA 3CHFA 2G3FA 5E6YA 2NXIA 1XYCA 2INFA 4S3EA 1SJBA 3U4AA 1CWYA 1O68A 3WF0A 3R0DA 2DDXA 3IIPA 2CCRA 1Q2SA 4JS3A 1GOXA 2CYGA 3CUJA 2VFFA 1H7WA 4TIMA 1TQXA 3G24A 4E2DA 3DFSA 1WKDA 3T0CA 3IUHA 1XYBA 4ONVA 3S8HA 3GG0A 4IJCA 1NFBA 1IEQA 5HNRA 3NFUA 4HA1A 3QLLA 4QSHA 2BY1A 3WNMA 2R1KA 2UY2A 4C60A 3GK0A 4ML9A 1EOMA 1XDJA 5AC6A 1ZTVA 2VZTA 1KWKA 4KCWA 3U6WA 3W26A 4ACZA 3BV4A 1XCWA 3GHRA 1NWUA 2PLCA 4O8RA 3KLKA 3WQWA 1FWAC 1Q6RA 2TAAA 5BWAA 1I2RA 3SJ3A 4JNZA 3W1UA 2NVCA 5L9FA 3IJ8A 2Y6ZA 1TV3A 1ADDA 1AJ2A 5D9MA 3N9RA 2J8FA 3MDUA 3CEPA 2ZX7A 3T42A 1VFUA 1RCQA 4UWMA 3EMQA 1JF5A 4O10A 1RAKA 4S38A 5I5RA 4IPIA 3TTYA 4Q6XA 3L4UA 3NVDA 4ZB0A 2X1UA 3G8EA 3NDYA 3TN4A 1P1MA 2BY0A 4GX9A 1XCFA 3KBWA 4F2TA 3TWAA 3W4RA 1BHGA 2RFGA 4Q3MA 3HJZA 1J10A 1SFTA 4GO9A 3KTCA 5HQMA 3FOKA 3OOQA 1Z7AA 1OK6A 8XIMA 3L2LA 5LIKX 4CQ9A 4MDPA 2W79A 2GVGA 5KMYA 4YLWA 2CW6A 4GI4A 3B03A 1OGSA 2WB5A 4A8LA 4K1GA 5DMMA 5BRBA 5CSYA 1I6NA 3WQOA 4RR4A 4TOQA 2BG5A 4XUGA 2XH7A 4POCA 5HANA 3FVMA 4TMBA 3EMZA 4FOJA 1W9VA 1G7VA 1EXPA 3LX9A 4UQEA 3GDRA 4U3CA 1XLGA 1WB0A 5C5YA 3OZPA 2PU1A 2I14A 5HR6A 1PKYA 3WH9A 4RW5A 3LPPA 2WMGA 3C2VA 4HGXA 4UQDA 1DJQA 4GNKB 2D24A 3S42A 5ABTA 3LCFA 1M1BA 1W1B1 1CENA 3LCIA 5FF0A 1QJWA 2WO5A 3ABQA 1TWWA 2P76A 2Z4GA 2VR4A 2W67A 1ZALA 2YYTA 1W5MA 3FJNA 3B8DA 3SJNA 1BWKA 2C79A 3UP8A 3IGSA 4Q8TA 3NGFA 3COTA 3DU0A 2WCAA 4E3TA 4HZ8A 3SQMA 3TYEA 3HV9A 2C71A 1N2VA 3BLOA 2TYSA 3UJRA 1YADA 3CC1A 1RPXA 3EWUA 2J7BA 2XYLA 4ZOAA 1NJJA 5TBOA 4G5DA 3B4UA 5JIPA 1EQPA 1GKQA 3OVPA 2XIIA 3W72A 2J25A 2BSLA 1KXQA 3B9EA 3NQAA 2PDMA 2O0TA 3H4WA 4JICA 1GWJA 4Z2KA 5CZKA 4ALDA 1KFJA 3TDFA 1S5NA 1H1NA 4N4PA 2QGYA 6XIAA 5T26A 4DYKA 1TWZA 4A6GA 1ITUA 2CXGA 2OEKA 1GPWA 4XAYA 4GIEA 5A8OA 5D02A 1W91A 1IWBA 4LNCA 3RK8A 3UYIA 1W5PA 3BJSA 2VWSA 3QMTA 4WSKA 1UR8A 4LAOA 3UZYA 3ZZ1A 1HIZA 4G7FA 5BNKA 2OGYA 1I0BA 1KB3A 3DFTA 4JFWA 4LS2A 3W9ZA 4L80A 3DFQA 4OIFA 1XXXA 1EX1A 4J40A 3VNDA 1ENUA 3W1NA 4PUDA 3DFHA 4DJFA 4H83A 2HPIA 5LSMA 3I3BA 2DZUA 3S5OA 4DF1A 1P4CA 1SW0A 4I3GA 2GPTA 3DKJA 1DWHM 2PP3A 2HVMA 3PN8A 2EJ1A 3F7JA 1I75A 4UR9A 4BI5A 3CYVA 2NT1A 3POHA 2VD9A 4D8ZA 1GYMA 3L23A 4ZQMA 1J8VA 3N4FA 2GQ9A 1M7PA 4C6BA 3VDGA 1UR4A 1ISVA 3TFCA 1ZY9A 2PURA 5I03A 3TJ4A 1R9XA 3WQ6A 4IOTA 2NV2A 3TSBA 4UMCA 3TXVA 2OELA 1WO2A 2A3AA 3TEVA 4JNMA 1A0DA 3LNPA 3C52A 1TO3A 1BGGA 3VUSA 5A8QA 2C1GA 3CPGA 4J3UA 1TPH1 3BW2A 1B57A 4QAIA 1KCZA 1T6MA 4W86A 4XIAA 2CU0A 5DELA 4D2JA 1V3MA 3SURA 3UXDA 1HZYA 3A9BA 1OWQA 5ENLA 3W7OA 4QE4A 5B7ZA 3T1GA 4QQUA 4XAFA 2PAJA 2F38A 4AY7A 2WYSA 4C6LA 4J5NA 3WH8A 1C90A 4PMXA 5K9DA 5KEZA 4GUGA 3QBUA 1D7FA 1R85A 3S6TA 2JF7A 2QLYA 3R2GA 4NJJA 1O12A 5JVLA 1UH3A 2GGHA 3OBKA 2WC4A 3GH7A 4WDWA 1K4GA 2ZX8A 3UEQA 2HZGA 3CASA 4NT0A 2ZA3A 5EMYA 3SY1A 1T7LA 1DHKA 2PTXA 1M68A 2E09A 5I6SA 4ADSA 2HMCA 1EKOA 4FX8A 1XUUA 2WBKA 1CXIA 3BOFA 3R8HA 3G1AA 4E2BA 4Y7EA 1OFDA 2B7NA 3QQWA 3PZVA 3WH5A 1QFEA 4B15A 4PZVA 1BWVA 4K8EA 3M46A 3ZJ7A 1IR2A 3LCLA 3DHUA 3WBEA 3BARA 1KM6A 3ZJ8A 2GK1B 3A4WA 4Q8NA 3VNYA 3M07A 1R3RA 4WVXA 3RO8A 4QR6A 2DZTA 1U2YA 5G1TA 1Q63A 1W3KA 4KRUA 3TOYA 4L4OA 4ZQOA 5ABFA 4AHOA 1OBAA 4U5IA 4KCVA 5EMLA 3N12A 4Q4MA 4O15A 3PZOA 2YCJA 4GVFA 3SGGA 4LC8A 3U9IA 1X98A 3QMRA 3T78A 1QUMA 4G1KA 3GG7A 5H8MA 4AHPA 2BTMA 3GDLA 2VO5A 3W2UA 3WDPP 4YYFA 2WZTA 2WVSA 3QR1A 3S4TA 3W1MA 3DC8A 1UPPA 5IHRA 1PXGA 4JIPA 2VR5A 4GYFA 4OECA 4FF7A 1EJSC 1AQ0A 1ZHAA 3C2EA 4RW3A 5HINA 3UPMA 5F2LA 3HV8A 5C2GA 4H2HA 9XIMA 4XX6A 3AHYA 3T81A 1JZ2A 2G5WA 3QZEA 1IT8A 1K3UA 2Y1HA 3IVUA 3U7VA 3PZTA 3BMWA 3HBLA 2WSKA 4GOAA 3EOLA 4LX4A 3TYZA 2P50A 4EIVA 1E56A 3THQA 3VOFA 3P5ZA 2MANA 3LLXA 4DPQA 1SO4A 5BZAA 3VD5A 1H7NA 2G50A 4QM1A 3PVFA 2NW0A 3U8GA 3M0ZA 3EDDA 2V68A 2D2JA 3VIFA 4R3UA 4DUWA 5DRCA 2PZ0A 3G3DA 4S2CA 1W1VA 1BQCA 1Z6KA 4DY1A 4QG9A 5A5WA 2XVKA 1OZMA 1DPMA 1W3IA 1DJXA 2D2HA 3UR7A 7TAAA 4PCSA 4MNLA 3ITXA 4PBGA 3EPNA 4A2RA 2OR2A 3QSRA 5CPMA 3VMNA 3DUGA 4MOZA 4ZVJA 3EAUA 5M2FX 1W1TA 4Z1BA 1VLWA 3FDKA 3FV9A 4IGHA 3I7RA 3WL1A 5LKYA 1P43A 3CTTA 4HYVA 3GC5A 1JCMP 1GOMA 1IE7C 3M5XA 1JEZA 3E3HA 2A0NA 2V3DA 3C2FA 3G6MA 2XM2A 3SQSA 1PSCA 1JYVA 2AGTA 3PFMA 3QFWA 2QCDA 1M41A 3ARZA 1DXEA 2VC7A 2BMBA 3K30A 1KKRA 2ISSA 1A5SA 2I7GA 2YL5A 3A24A 4M51A 4RDYA 3L68A 3MSYA 2PDFA 5HBFA 4LTSA 2V67A 2C18A 1JCJA 4Q7NA 2W27A 4UTWA 5I3KA 2ZZ7A 3KTXA 4WUIA 1JFHA 6ALDA 4Q4OA 4IQLA 2ANUA 1XIFA 5C2CA 5CC7A 1OABA 2E5CA 3L65A 2EHHA 3BICA 3WNNA 4HT3A 1HJXA 3ABOA 3BJTA 2J7GA 3C61A 3H2AA 3FJ6A 4E2OA 1Q6EA 4ICMA 3W7NA 1X8FA 3AMLA 4GKTA 1US2A 3KX6A 1RQEA 2YCLB 1IEXA 1I2OA 3FKKA 3W01A 1LM1A 4EPKA 1JCLA 4W7WA 4LT9A 3H70A 1OHLA 4XAPA 1R0MA 2FVKA 4R27A 4NASA 3W85A 2PZNA 1E0VA 1BAGA 2WAGA 4PTXA 1IT7A 1TTQA 1Q66A 3C3NA 2WMJA 2WVUA 3PB0A 1L2QA 4HHMA 1E6RA 4I8DA 3CAQA 2J47A 1A3WA 3HN3A 1JXJA 3GLCA 3O15A 1Y7VA 3N13A 1TRDA 4GFIA 3WNKA 4AEEA 4N0RA 1U83A 2EKCA 2WZIA 2X05A 3KE0A 3T55A 4WK9A 4L1WA 2V63A 5GJNA 3S83A 2YCEA 3VA8A 3WQEA 4DJEA 4OHQA 3JVAA 1JJKA 1GCYA 1FWCC 1G4TA 4KEVA 3LGGA 2QMKA 4X63A 3CU2A 3UW6A 4AXKA 4MUPA 1SM9A 3E38A 1P7TB 2POTA 4XZMX 4FNUA 3SRDA 2EPKX 3H23A 3WNLA 4DBDA 1F5ZA 3RX4A 3AFBA 3N6QA 4G9PA 2Z1SA 4NI8A 1EC7A 3CQIA 5KTLA 4PMYA 2VELA 4GYPC 1YE6A 1JVNA 4FI4A 5E70A 1XJBA 3PFRA 1XLEA 3EOSA 3T9PA 4UQAA 2IQ0A 2WXDM 4AHQA 3PPFA 3CS2A 1UJQA 2A3CA 5CC6A 1TMLA 3PG9A 5DFAA 4CQAA 2XVPA 4JY8A 1ONRA 2B7QA 2J7CA 4XTDA 3UZZA 2AAMA 1PEZA 4HA4A 4NF7A 5G5IA 3G1DA 1ZENA 2EG6A 2D2GA 4AIEA 3LV5A 4H4IA 3RO6A 3WO8A 1FWEC 1G7UA 3GKAA 3PTQA 4NVTA 2E6FA 4PSRA 3SBFA 3L4WA 5CEWA 4DQWA 4BWLC 3HB9A 3MJMA 1PDYA 3UWUA 8CGTA 2YL8A 3PZUA 3A5VA 3NSXA 8TIMA 5LA0A 2W61A 3MYPA 1DTUA 2W4XA 3H22A 2X30A 4M7SA 2IPJA 1D7KA 5IDIA 2ESCA 1U1HA 2WQDA 2V5LA 3E2QA 1WOBA 2BWGA 4WX2A 4Y9PA 2O9TA 2BHYA 3K4DA 4W5UA 3MYOA 5F1UA 1MW2A 3SQLA 3T2PA 4UFIA 4ZBCA 5EA9A 1G0CA 2WPGA 2GSEA 4WLCA 5LIUX 3VIOA 3R0KA 3WDHA 2YCKX 4GO8A 1ZJAA 3SCNA 4K2SA 4UTFA 4ZXLA 4QJ1A 1OVDA 3HURA 2H90A 3GDTA 3PZGA 5BOFA 1A49A 5A3HA 4UOQA 4DLMA 2WCSA 2Q8LA 3SDOA 3SEPA 3LOTA 4V1XA 5J5RA 4S3JA 3BZJA 1HJSA 2J6VA 1M6JA 3W1RA 1VC4A 4Q32A 1F4HA 3M0HA 3WKZA 3W29A 3VM7A 4PRRA 4H9XA 4YVVA 5IFPA 4OBRA 3RJYA 5LA2A 3WMSA 1J6PA 3DHPA 5A8PA 3GIPA 1UIOA 4BR1A 3BGGA 2Z26A 3R12A 2D2OA 2ZIDA 3MO4A 1IZJA 1FH7A 1E3ZA 5D9PA 1G4SA 2PF0A 1FCVA 2BVTA 4KERA 3N14A 2XN1A 2Z1VA 3FA4A 2GUBA 2HV5A 4DIAA 3Q37A 4L9YA 3SIZA 1VFLA 1O5QA 4C6QA 4R9OA 1QW9A 3TW9A 3WDJA 1OFOA 4JKLA 5C9ZA 1PVNA 3ARSA 3I6EA 3BAJA 1B5TA 4H7VA 3R79A 4PTWA 4UQBA 1WDDA 1QTWA 1FWRA 3P2VA 4LVAA 1UP2A 3GC2A 4HMNA 3GXFA 3CL6A 1V77A 4P61A 4AZ6A 3PR2A 4A8RA 4GA8A 2RAGA 2X8RA 5DQPA 1QU4A 1ADOA 2Q09A 1E0XA 1EF2A 2BY3A 2WJDA 2IXUA 5AYYA 3BSGA 3HFYA 1NWTA 2VURA 3NZGA 3NPXA 1S39A 5AHLA 4HBKA 3BDKA 4B9YA 1W1YA 3VKJA 1L2UA 3VIKA 2DT3A 2PE4A 3MMTA 3P14A 4BQ5A 2DZAA 3QGAC 4EPBC 5T8GA 2ZTKA 5H1WA 3DEQA 1VLIA 1RVGA 5D38A 2CHNA 1W1A1 1VRDA 3B8SA 1DQUA 3RR1A 3IGXA 3ANYA 5HJXA 2J75A 3W22A 1W54A 1E72M 1VH7A 2GVEA 3L7RA 5CQ1A 1MDRA 3MBFA 5CZJA 2OOGA 1MRAA 3TTOA 4WXZA 4ZOCA 5LHFA 2GGIA 1ZAHA 4P7RA 3F1QA 4S3AA 1R9ZA 3T8LA 4H04A 1VEMA 3BSHA 4HK6A 2BOEX 3A47A 2REQA 3G18A 1REQB 2XN2A 4GJ1A 1HNYA 3U2OA 3V36A 3IS4A 5DY3A 3JU2A 3VNKA 1B0IA 4PMOA 3CAKA 2C6QA 3BLDA 4GZJA 4JL1A 1LOSA 4J1OA 4UR7A 4FR6A 2OMAA 1ZCOA 3MA8A 1HL9A 1VR6A 2QUUA 2FFIA 3EKGA 2X09A 3H2EA 4C1NB 1G4EA 2HBXA 3FHAA 4Q8VA 4GQ0A 1K9FA 1PB0A 2W3ZA 4RV3A 1WNOA 3AXMA 4KIEA 1Q6LA 4GHRA 6REQA 5ABGA 3NYZA 5JH2A 1EIBA 3I6TA 1Q7ZA 3PSVA 4J3XA 2MUCA 4XD4A 2HSAA 1PZ1A 1MUWA 3LGDA 3VMOA 1EGVA 2NX3A 4LUTA 2DH3A 4ZODA 3LBCA 4H6KA 1PX3A 1QK0A 2E9MA 3R0UA 5E9XA 1WKYA 4QS5A 4D72A 3LY0A 3NZPA 4K3ZA 3E0FA 3KVKA 1D2KA 2Y5JA 2X0YA 3HIJA 4UTHA 1W2VA 3OPSA 4UFJA 1FWGC 4JTDA 2PRLA 4DNMA 3WQGA 2E8ZA 5A6BD 3NDZA 5HOSA 2O56A 4CNUA 3GXDA 1C8VA 3EMCA 4S23A 1PTAA 2YDSA 3AYRA 3GXMA 1VHCA 5A6JA 2DT2A 1B3ZA 5HMEA 3W2KA 3FSTA 3T05A 2EEXA 3GD6A 3BLFA 1FCUA 1JZ5A 5D9NA 4Z2JA 3PWAA 4X0VA 3A13A 5HJLA 3FA5A 2VCAA 4OWGA 4IP7A 1WAWA 3BO9A 2JE8A 4Y90A 3GKFA 2LLEA 3URQA 2WMIA 1KM4A 1JUBA 1MZRA 4CNNA 3FN9A 3ZLFA 3GIYA 4AD0A 4DM1A 3R94A 1JUEA 4ES4A 3SCSA 3L2IA 5D4YA 1YYAA 3W86A 1SO5A 4ZGYA 3BURA 1UZHA 2A7RA 3JUGA 4YPJA 3RIKA 5JMUA 1BXBA 1ZUAX 1EPVA 4B5XA 3STEA 4U33A 7CGTA 5M3WA 1F6YA 1WKFA 3MBDA 1SYTA 4LCRA 2OSWA 4PTDA 1EPXA 4JCLA 3B9AA 3GXNA 1XW8A 3QFEA 5A8NA 4YJ5A 2ZRWA 3A22A 1KCXA 1R38A 1GQKA 5HATA 3GTHA 3M0LA 2WJEA 2QIWA 3QH2A 1Q85A 4KETA 2AGKA 1DL3A 5DCBA 4JX5A 1Q6FA 3VD7A 1LF1A 4K38A 3E74A 4N02A 1MUMA 3VPLA 4LH8A 2VX5A 1R46A 3IUDA 1TPB1 3OP2A 1W32A 2ISWA 5DCEA 4GI8A 1WUFA 2RGLA 2NQJA 2E8YA 4IT1A 5U4NA 2E3ZA 2ZDSA 4FLRA 1VBGA 3A21A 3H2MA 3RCYA 4ZSUA 1U33A 2J74A 3LQGA 4Z1CA 8XIAA 4Y9MA 1HTIA 3QPEA 1KRAC 4UFKA 4MYAA 1LUCB 4UTLA 8A3HA 1SFJA 3GDBA 1P0NA 4FO4A 5E93A 1SUXA 3CHCA 1BF2A 1EBGA 2E68A 3B9NA 2OEMA 3DFYA 1PWMA 1E5JA 3ICJA 1O5RA 1F07A 2CERA 3GXTA 1VYSX 1UUQA 1IQ8A 1J79A 3P8JA 4OBSA 2PDKA 5FEPA 5I77A 3IJIA 4FX6M 4KFPA 5DXYA 3OLEA 2PDJA 1A5UA 3B8TA 1JDDA 1UR2A 3IAQA 3VOIA 4EWND 3NR0A 5A6LA 4YVPA 1S2AA 2YJQA 3ARQA 4WOZA 3QY7A 2V8ZA 3B8UA 1IHIA 1X38A 1CGTA 4UNIA 1W6TA 3MQTA 4HPXA 5GNXA 2BB0A 2XIOA 4ZMGA 2J88A 5HQLA 1CLXA 2GJLA 4UTJA 1TREA 1J96A 2WSRA 2ZDRA 3EDEA 3TJLA 3IIVA 4JIIX 1CNVA 1QXLA 3CO8A 3N3MA 5BRQA 4AWUA 3W1XA 3RUBL 3M7SA 1Z9AA 4BWLA 1FP9A 3OBEA 3OQEA 4OOUA 3NVTA 3UCCA 1XLHA 3V16A 4O1BA 4MZYA 4DXXA 1TX0A 1E4NA 4KW2A 1YNYA 4WY0A 3C3UA 1POKA 3SR7A 3FCPA 5F4WA 1J6OA 3SCPA 3VOHA 4BZYA 3ES8A 2D0FA 1JZ6A 5KZ6A 5H8UA 4NXSA 5DT7A 4KMQA 2WSPA 5JIWA 3P67A 2FHCA 2P53A 5C9RA 1WUEA 3AU2A 3VNJA 2VEPA 3R4IA 3H2NA 1LL7A 2OFJA 4WSHA 1NAL1 3SGUA 1JQVA 4DWSB 3EEZA 4H9MA 3KRSA 1DYSA 4ZEPA 5CBIA 3WUGA 5K2ZA 3GHSA 3LBOA 4NX0A 5EKYA 4XAZA 2IMRA 2CZFA 3WUBA 2V9DA 4H6QA 1L9WA 3RMJA 4MSSA 5LNVA 4IQJA 3THDA 2AOSA 2DVXA 5JBEA 2CLIA 2ACQA 3AMDA 2VCBA 2ZBTA 1V6TA 1HGYA 4HTYA 3K5XA 3KRUA 4RDVA 3CB3A 4WGXA 4IG2B 5DBTA 3I10A 1AW1A 4BF5A 2BHZA 3P0WA 3QZAA 4MM1A 4YTSA 4S2BA 2WSQA 2NV9A 4W5ZA 3WF1A 2PI6A 1Q7MA 3KM8A 3CB8A 3A5FA 3MKVA 5MF5A 3NO1A 1VBJA 2G95A 3GIQA 4HPHA 2X1RA 4OQVA 3ZVHB 3LZ3A 1PHQA 4IMCA 3CLMA 1KM0A 2J9XA 3I3DA 3F4WA 1WDWA 5CJMA 2FZ9A 2FZBA 1TZ7A 3W73A 4YWSA 3CBWA 3CIVA 1M04A 2C13A 1OY0A 4KEZA 4QLKA 1FUYA 2ZWYA 2WC7A 2DT0A 3VKDA 2D3LA 2Y88A 1XP3A 3M5ZA 1TV4A 1SZGA 1Q65A 1V3KA 2CLOA 2I56A 1RD6A 4N6EA 2CZDA 3KP0A 3SUVA 5LA1A 2VRJA 6XIMA 2OPJA 1W5QA 3VTRA 4IJRA 2OYMA 3KDOA 4J3SA 4IMDA 4WOQA 3STGA 4W8LA 3IJ7A 3EZ4A 2D22A 2VI0A 2W0UA 3CPRA 1GG1A 2EPNA 3GNXA 1JR1A 3OGRA 1E0WA 4O17A 3GZ3A 1RJRA 1S5TA 4RPQA 3DGBA 4S3DA 3THUA 1Y5WA 4Q7BA 3PY2A 1W3JA 1FXPA 3M9YA 1UR1A 3VGEA 3N18A 1OYBA 1LLWA 4UQCA 3DXIA 3AZRA 1OCJA 4EX4A 1OZQA 5KZEA 4OV9A 4W9TA 2P8CA 2QUNA 3LXAA 3GR4A 4IGMA 1LLZA 1YPFA 2PBGA 3ZWTA 2G37A 3IIOA 2R82A 4MJ4A 4RZ4A 5J04A 1TVPA 4LS1A 1LWIA 3EOEA 3LPFA 3DBNA 1IIHA 2R9RA 4LU0A 1E6QM 4GFSA 3LENA 2J13A 5CGMA 2WK2A 5E5CA 4ICNA 1ZBCA 2X40A 3TSDA 4FXJA 1MMFA 2OTDA 1QRQA 2ZRUA 3GHUA 3VILA 3E49A 2P3EA 1KTCA 3MMUA 1O1HA 3TC6A 3T6CA 2J78A 3R89A 3PPGA 2UY5A 1K77A 1UWTA 1E6PA 4PMZA 1FX6A 4Z0JA 4PUEA 4O4VA 5BXTA 4X61A 2EBNA 4QJ3B 2NQ5A 3B97A 3PJTA 3N2OA 3IGHX 4LY8A 3IIXA 1J01A 3LRMA 4HCDA 3APYA 1J4EA 1OX4B 5DEZA 3E96A 2XINA 2QDDA 1QNRA 1UP3A 3W71A 1FHDA 1VFFA 3AXIA 1TJ1A 5D2VA 3LHZA 1H60A 1WZMA 4S3BA 4U2ZA 2F6KA 1LORA 4TUFA 3ARTA 3FYOA 3KUMA 4GCXA 2ZZ1A 1MXDA 2ZTJA 4TU1A 4RXGA 2OX1A 1VF8A 3PC0A 3QV7A 3VE9A 5KINA 2XZ7A 2VUYA 2R1NA 4HU4A 1K70A 3CZKA 1E6NA 2VHLA 3N04A 2RH9A 3SCUA 3W1QA 3RRXA 1ZNNA 2E67A 2O9OA 3LUTA 3U4FA 5ABEA 1XD0A 4U28A 2P3ZA 5D03A 1RP8A 3EPOA 1Q6GA 4G7EB 1HKVA 1CGXA 1VJIA 1X7IA 4EK7A 1O4UA 5D2WA 2BXVA 1EWEA 5CLTA 2WHMA 3F4VA 1X96A 3MCOA 1EFZA 4MJZA 3SCVA 4FF5A 1QW7A 5BOEA 3W82A 3D0CA 5HNTA 3G1SA 4HHHA 1CLVA 8RUCA 4QISA 3M0MA 2DZSA 4CNPA 3OG3A 5D8ZA 2YCLA 2Y24A 3KW3A 1F6PA 3LNMA 4LGXA 4DF0A 1E9YB 1LLOA 3UFYA 1VIWA 4ZQNA 1XLFA 1V3IA 2QUTA 1E4LA 4HNNA 5I79A 2D23A 2NQLA 3RMEA 1RBOB 1UCWA 2ZUNA 5G2IA 1N8WA 3HPAA 2WHJA 2PU0A 3K13A 1V93A 1AH3A 1DXIA 1TWSA 3FHQA 1VFTA 3MT1A 3A6OA 3WBAA 3KDNA 1H49A 2BVYA 5AYZA 3GNOA 2VENA 1ISYA 3QMSA 4XZBA 5DF0A 1DJHA 1TUFA 5K9CA 4MPQA 1UIPA 1V6WA 4C7GA 5A8GA 1YTEA 3NQBA 1G9HA 4NRSA 1HJVA 1JDFA 1IEWA 3W7IA 4DO5A 1YHTA 3MP3A 1E51A 2BFGA 1FH9A 4GC3A 4H7ZA 4M0XA 3PANA 1B54A 1KQYA 4MGGA 1XRTA 4JQ1A 1Q4NX 3N9KA 1H1ZA 3UY8A 2GGGA 1JI2A 1K6AA 4JHOA 1NF7A 1S2UA 3TP4A 3CIXA 5BMXA 3GHTA 4LRSA 3V1HA 1ISXA 1RBLA 1XC4A 1KBIA 2DSKA 4IIDA 1P7TA 4HNUA 3MWCA 3G1FA 3KCJA 2GFTA 2EPOA 3VDCA 1UR0A 4GH3A 4JNYA 4LFYA 1MUCA 5FEWA 2BBFA 3BG3A 4KEMA 2J77A 4GBDA 4KESA 1UBPC 4HHPA 5A6BA 1NFPA 2BDQA 3EB4A 4DLFA 1O94A 1TPDA 4HMEA 3AIEA 1CT5A 3OHMB 1UC4A 4HCLA 1TV8A 1MQPA 5D32A 1M7JA 4K7VA 4A3RA 4LBSA 1YBQB 4I9JA 2DZXA 4AZCB 4LVFA 2Z1BA 1A47A 4XISA 5GJMA 4P8VA 5F2GA 4MKNA 1T0OA 3FGCA 1UD3A 5LXEA 3L4XA 3RR4A 4B5TA 1NDZA 1BYBA 1LTDA 4NAFA 3DECA 2X7VA 3UJ2A 1HVQA 1TVLA 4JEJA 5EMKA 4EP8C 4FALA 4PB4A 3LTYA 4M56A 4UIOA 3VK5A 2PA6A 2WOQA 3KFTA 3W70A 2ACUA 3J7HA 3C56A 4D8LA 1CXFA 1P0BA 3NIYA 4C6MA 3P0XA 1EDGA 2PSNA 1XV8A 3QKZA 2QV4A 4W87A 1LG1A 4DELA 4GNVA 2A6NA 4IICA 1PHWA 1GTHA 4X9SA 3DH7A 3WH7A 1B4KA 1XIBA 1SJCA 3UG4A 3GZAA 3S9IA 1VIZA 1NY1A 5I02A 4DO4A 1QO2A 2E28A 1V6VA 5EB8A 2A6LA 2AAAA 3GUWA 4GH1A 4HIBA 5FA5A 2P8BA 2NVDA 5A2CA 2HISA 4B2DA 2HK1A 2DQXA 2ZCGA 2W6RA 2ZA2A 4M6UA 4AZHA 2J9ZA 4JAWA 2GOKA 4ZCWA 2PUZA 3LTPA 4DWSC 3VDAA 1VBUA 5HDRA 5I78A 3BL3A 3S2MA 1JF6A 2ZXDA 3VGFA 4KKXA 1IYXA 1EO7A 3WEMA 2CWNA 4ZQCA 3CUGA 3N11A 1L6WA 1RUSA 1MEHA 4M6PA 1X1OA 2O7SA 2QW5A 3W1LA 3JR2A 3SN1A 3CV7A 2IS7A 4E4UA 1YE4A 3OLDA 1V02A 5LIWX 3PZIA 4GQGA 1T99A 1RK5A 3T44A 2YXGA 4IFOA 5CZSA 1B31A 5LIYX 2YKKA 3A4JA 4OGZA 3PG8A 4UTIA 4W84A 4RJEA 2Y85A 4ZR8A 4DNHA 3DYOA 4C6NA 3VD4A 4KRTA 2P0IA 4B91A 3EA3A 1YX1A 2CBVA 4IPPA 1GQIA 4S3KA 1ZGDA 1NM9A 4PGLA 4HA0A 2XIBA 2QHAA 3U2ZA 3UETA 3G3MA 4IWWA 4GACA 3QV8A 5KZMA 3WLSA 3LHUA 1GZ1A 1GVOA 2ASHA 1HO4A 1XIGA 2QCLA 3AXHA 1J18A 2X0SA 4V33A 3F5KA 2TRSA 3GS6A 4PMVA 2XM1A 2QNEA 2EF9A 3AS1A 3KRBA 1EOKA 4QGCA 1DWFM 3LM3A 3NQEA 1UWQA 1UC5A 2HE5A 1AQHA 3T08A 1XLDA 1B1YA 1RALA 4OOZA 1WZKA 3WEZA 3STPA 4CVWA 3V4BA 3OZMA 3VE7A 4QDMA 3PBWA 1H50A 5EPDA 1LL4A 2XH2A 3HG3A 3FJ4A 3AUJA 3UYCA 4GX8A 3TQKA 1WX0A 4ZFCA 1ZBWA 2PP0A 1ZCCA 3EWWA 4KWUA 2FB2A 4ZO9A 5HPOA 1EUAA 3AHXA 4M7TA 2C19A 2G0WA 3IEBA 1FDZA 1RLDA 3ABSA 3ATYA 3HQ1A 1W1IE 3T07A 5EGRA 1FQ0A 4H01A 1KRBC 1OD8A 1GK8A 1HT6A 1FTXA 3QOKA 4C90A 2G3JA 3EXRA 2GJRA 2J7DA 2DIJA 5A6AA 4IXHA 4O28A 2GLKA 1GOKA 3GVGA 4AWTA 4NU7A 4GC4A 2DIKA 4NZJA 1JYWA 3UWZA 1P6CA 1CI1A 4IFKB 1UP0A 4M80A 1OFPA 4AG0A 4PUWA 2DW6A 2ISFA 4XZLX 1V0LA 2XFFA 4Q4KA 2X2YA 1TJ2A 2C16A 3BMXA 2GSHA 5DT5A 5K4ZA 3H7VA 5ECVA 2H3DA 2Y8UA 4DJDC 3MY9A 4AIUA 4LF1A 1S5MA 4FZIA 3V5FA 2VEFA 2OGJA 3ITYA 3OIHA 2V3FA 3BVJA 3VUPA 1J93A 1SQ7A 3TLLA 4DXKA 3H12A 2I9EA 3WK2A 3REQB 5F1VA 3R58A 3NL6A 5FF3A 3S1UA 3V7PA 1JNEA 1W9UA 1OC6A 1JQXA 4LC6A 4QS6A 2Y5EA 2ALDA 2FDMA 4PULA 5M17A 3NPVA 3MPGA 1DWJM 1EP2A 3QV6A 3WDRA 3WLRA 1A5NC 3GTFA 2A3LA 2J4GA 2VDIA 1H61A 1GORA 2XVLA 3AROA 3IJQA 3KVJA 3NXLA 1E1EA 3V35A 4NXKA 1CX9A 2I5IA 1TTJA 2PD9A 2HVOA 4AX7A 2BY2A 4M19A 3BPWA 2V5DA 3WIJA 2KAUC 3CZ8A 1F3WA 1E43A 3II1A 1EL3A 3UWYA 9RUBA 3O6CA 4HMCA 3SIMA 5D9OA 2V5CA 4J3ZA 3FLUA 3BLPX 4ZTYA 1BTMA 1V0MA 1JYXA 3XIMA 4WJ8A 3VCCA 3VU2A 1T96A 3LERA 3CV2A 2XDFA 3GWQA 1YTKA 1OFRA 2QDHA 2PMQA 4TTGA 3V0SA 1EA9C 4E2VA 3M0YA 3UXIA 1EDTA 4DJFD 5TD4A 4LEQA 2QUVA 1Q4WA 3EWZA 5H8PA 4PTMA 2OQYA 2Y89A 2HEJA 3VC5A 2QR6A 4G6CA 1UASA 4XBKA 4ZE5A 2VP8A 1B9BA 4NZ4A 4CU6A 1A50A 2VT0A 1QI4A 3WMCA 3LGEA 3SI9A 2CBIA 4QIUA 4AVFA 1VEPA 1F76A 1V8EA 7PTDA 3VDHA 1LJYA 3G0UA 3USBA 4R7WA 3LHVA 1OFBA 2FZMA 4M1RA 2ZFAA 1C8QA 3L5MA 4A3UA 2VJXA 2JKPA 1ZB5A 1EX5A 1E1CA 4A2SA 1A5MC 3GXPA 3IPWA 4EPEC 2RHGA 3TROA 1XHGA 3UF9A 2QDEA 4D6HA 4UTKA 4HNVA 3GNRA 2AL2A 2QVHA 4CGTA 1PCWA 2JKEA 3A12A 4AISA 4N9CA 1XYFA 5LNRA 5G2HA 3RU6A 4PMNA 2VOMA 1U1UA 3RF9A 1UD6A 4OUIA 3ENLA 3NQ2A 4A8IA 4MWAA 2FZ8A 1YDOA 3SCRA 1VS1A 2J66A 4H8NA 3C2YA 3AALA 4CCCA 1IZCA 2XG9A 3HTWA 3TA6A 5FSDC 2P10A 3E12A 4GXMA 2HNHA 1TV2A 1X6LA 4P7LA 3N3TA 4LUIA 1K8XA 3TXZA 1THFD 4DN1A 2QYGA 4IQEA 1GT8A 3YPIA 2HROA 3AOFA 5FKYA 4JFSA 2VC5A 2I5QA 3AISA 2WCGA 3D46A 4G8TA 4WY0F 2AMGA 2ZX9A 1DEDA 4MB4A 4CD5A 2R8WA 3S3GA 2WMFA 4FNRA 2ZXBA 3PM6A 3BWWA 1O5KA 1EJRC 3SW6A 1QOPA 1FP8A 4JTKA 1BRLB 3M16A 2QJIA 4HKPA 4LCSA 3QXBA 4ROQA 3WH6A 2ZUVA 4K8GA 1LQ0A 2YBUA 4YTTA 3VZYA 3P3BA 5AZ1A 3SM0A 1YPIA 2ZZ2A 4H1ZA 4D6EA 1D8CA 1V7YA 2CZ5A 1CCWB 1TA3B 5D33A 4L7ZA 3GBEA 1BF6A 1AG1O 1FBAA 2DVUA 1W3TA 3G1VA 1PV8A 3HPFA 3W24A 5F7UA 1L6FA 2YW3A 1SU5A 2H9AB 1Y65A 4U10A 2DFAA 2A1YA 4O13A 3P81A 4BI7A 2NWSA 2PDNA 1K1DA 2ZE3A 4XD6A 1P5BA 3EDFA 1FWJC 3NSMA 4CD6A 1XIHA 4O0KA 3NQ6A 3FYPA 3EKZA 1XLJA 3AU6A 5IBXA 1U1JA 3A64A 3C0QA 2IQTA 2XSBA 1VPYA 1FWWA 2BP1A 2GGEA 5GNYA 3E02A 2OODA 4JZ5A 3OIXA 2WKGA 2OQHA 4GWEA 1WBHA 3WELA 4PC8A 3HMJG 1QHPA 4H9VA 3MUZ1 1TG7A 2IUZA 5I09A 1GGOA 3VGHA 1JAKA 4MDOA 3VFLA 4W88A 2DT1A 4QBXA 1K7EA 3ELFA 5HUPA 4H6EA 1WV2A 4BF7A 4HOWA 2DQWA 1ODZA 2ACSA 2YOCA 1SR9A 3QLDA 2HS8A 2WLZA 2CETA 1XSKA 2CBJA 3APGA 3T0BA 2IQDA 2WZMA 1PUDA 3ZXWA 3AXKA 2C15A 3A4AA 3TTEA 2J7EA 3UA4A 5CPLA 3W0KA 2Q6ZA 4GMEA 4J7RA 3UXKA 1KRMA 1NARA 1KM3A 3GSMA 7ODCA 1KM2A 2PDGA 4QHRA 2ADAA 3VIJA 2PDXA 1QI5A 3NL5A 1GKRA 4JKKA 3I4EA 1GOOA 1L8NA 3L0GA 4PH6A 3EB3A 2FZDA 4B90A 1HJUA 4MNJA 1F9CA 2GDQA 2X16A 1IEVA 3R8GA 3CUZA 3LRLA 1XH1A 4D9PA 4F2UA 1UZDA 3HA1A 3ZVHA 3I6RA 4XIMA 3NCOA 1WQ5A 2VWTA 2OO6A 3BZGA 3IACA 4E3VA 1FWNA 3W7MA 1Z41A 1F3TA 2PC4A 3AQUA 5CSRA 3ZJ6A 4IIHA 2WBGA 3D47A 1A4LA 2PTWA 1IWAA 3WK0A 4GIAA 4E4PA 2JIWA 1ZL1A 4PCTA 1R8LA 2GGJA 3B0YA 4XVDA 3RJXA 3UESA 4PODA 2CLEA 2I1OA 4BQ4A 1AUSL 1LRQA 4TX8A 2D69A 2V3EA 4LOCA 4QQ3A 3MUCA 3HMCA 2XH4A 4NNAA 4LEFA 2H8ZA 4KH2A 4AWEA 1FKWA 1JRCA 4B9ZA 1W17A 1OG0A 3WENA 5I0DA 4YU1A 4RCXA 4E6MA 1R2RA 3AAMA 3OA3A 4B5NA 3RXZA 5I06A 1X97A 1BVWA 1S38A 1EH9A 3CH9A 4O50A 1CDGA 4I9AA 1XKJA 1BG9A 1OFEA 1S3TC 3EX4A 3W7LA 1CTNA 2WNZA 3IJDA 4HOZA 4XKMA 2QJMA 3LCWA 2FMNA 4IQDA 3MVIA 1W56A 3UCDA 4O57A 1V08A 4JTHA 1T8XA 3SY8A 4KFOA 3VX0A 3E5PA 1CPUA 3JZUA 5M03A 4L9XA 3ZOAA 4ZE4A 3VO0A 3WF3A 2YA0A 6CGTA 1VEOA 1UUMA 4ACZB 3OGSA 4WR3A 2Q71A 3LG3A 3OBAA 5XINA 4Q4QA 2YLLA 5I7GA 3QW4B 1FY6A 4NZ5A 1Q7QA 4TVCA 2GDVA 2PF8A 4RDZA 1YRRA 3AS0A 1DIEA 2JGYA 4O52A 4CKQA 2X1TA 4XZIA 4FIRA 3KHDA 2HTMA 3RLHA 5TIMA 1R7OA 3OW1A 4AH7A 3UA3A 1JGIA 3XISA 3HGSA 1JD7A 1NFGA 4ZB2A 2R1MA 3B40A 2CLFA 2OYKA 2QS8A 4IP5A 3M0VA 2VZSA 3K8KA 4KCTA 2ZZ5A 4AUBA 1E40A 3QGKC 1CIUA 3GG8A 1FWTA 5CGQA 4JYDA 2CHOA 3VYLA 1QT1A 4GUIA 4BFAA 1UKPA 1FWHC 5FJRA 2VGFA 1OC7A 2FB3A 1W3HA 1WDRA 1U5JA 5I24A 1LOQA 1XDMA 4EACA 2YBTA 4X22A 1QBBA 3H55A 4MB1A 4MMWA 2YA1A 4DZHA 2FHBA 3NUKA 4MAVA 2OOFA 1SZFA 2WWDA 1RZMA 1J0HA 3WN6A 5AHNA 2PWGA 4XKYA 2R91A 4L5ZA 2XIJA 2E0PA 4A21A 3WQCA 2NX9A 4WIWA 1WPCA 2QPSA 3DX5A 4U2YA 1WDSA 2J9YA 4L9ZA 4MLRA 3PBGA 3OJGA 1LG2A 4KT2A 2B81A 1EP3A 4PL1A 3S5NA 3MV01 1JXKA 1GOIA 2NZLA 2PDHA 5EBUA 3GG1A 4FHAA 5HK4A 4GUJA 2XGBA 3NSNA 5AHEA 5FOOA 1B90A 4OE7A 3E2VA 2WSYA 1B3WA 1KM1A 3FNDA 4WD0A 1SGJA 2OZTA 3MCNA 3W7PA 4N42A 3PULA 3OTRA 4H8UA 4LAUA 5DX7A 1C93A 1K8ZA 2PLKA 4WKHA 1KRCC 2W62A 3GFXA 1XIJA 3HPZA 1R9YA 3CNYA 1AH0A 4GQRA 4URIA 4A4AA 2J27A 4KEUA 3CK5A 2Z1XA 4D6FA 2GUUA 5AYIA 1I45A 2EQDA 3NXFA 5JBDA 3VC6A 1SZNA 4US5D 2NUXA 2VXNA 2R1LA 4AD3A 1XRSA 5CPQA 3CV1A 1POJA 3PS7A 3PWIA 5EY5A 4J4KA 1PAMA 1OF8A 2YZ5A 4M29A 3WQVA 2J6XA 9CGTA 1Q45A 3I4KA 3WLMA 4M6VA 3MP4A 1GEQA 1YNQA 2XH0A 4PYSA 1XH0A 5CJ5A 1KM5A 1XDLA 1FWDC 3KBSA 1MWOA 4U31A 3MW7A 6PTDA 2TSYA 3PSWA 3L5LA 3WBYA 4MHBA 1ZRQA 2ZZ4A 4FR1A 2QV5A 1JPMA 4B3ZA 2ODOA 1F4AA 3BGAA 4YTQA 3AICA 2WZHA 5HMSA 4F0MA 2F8QA 3P84A 3EB2A 2BGNE 4TXEA 5E09A 2GZXA 4R34A 2FH6A 5DN1A 1KR0A 3B9DA 3LQLA 3HZ3A 4GI6A 1X8CA 3M5VA 1E9IA 4C6CA 3GAYA 3G1RA 1NDYA 1CXLA 2YDAA 3BOLA 4I90A 1ITQA 3GX9A 4GK8A 3UGRA 2V30A 4H7CA 2FGBA 5I3JA 3P7YA 3QTGA 3I7SA 3ARWA 3A9IA 4CNOA 1V6YA 1YXCA 2DVTA 3G5EA 4NI3A 4WKAA 4QROA 4I5XA 2DIEA 1GOWA 2VRKA 4L4LA 3P5YA 5CPNA 3KP1A 3LLDA 2D0GA 2A85A 4JTGA 4ZOEA 3GNDA 1PIFA 3F5JA 1ICPA 5F2IA 3EEGA 5CC5A 2QXWA 1XYLA 3WCZA 3S1XA 1AZ1A 4IX2A 4REQA 1VGAA 1OJXA 5I3IA 5DMYA 3CL8A 1ECQA 4QX4A 1M7XA 1AH4A 1EC8A 1AZ2A 1I1XA 3HQOA 1ME8A 3R6IA 3VNMA 2PDWA 1V03A 5GNZA 4PE8A 5REQA 4CCZA 4LSBA 3H6OA 5CJNA 3BXWA 3LHWA 4OVXA 1FHVA 3N2MA 3PNUA 3IJ9A 4H8VA 2F7FA 1X1NA 4PMRA 1ZP3A 2AKZA 4RE0A 1XI3A 3Q65A 1T41A 3ALFA 5K4XA 1J0YA 4FX7A 3PZ9A 1DWAM 3VM5A 1UD4A 3GTNA 2CKSA 3CYJA 4D6IA 1V6UA 4HU8A 5GVJA 4XTIA 4UOZA 3CIWA 3WF2A 4E0CA 3H7RA 4JTJA 1MFVA 1YXDA 5AC7A 2VC9A 1W5NA 3L0NA 1TJRA 1OEPA 3LI1A 4HZMA 4CCDA 5ABFB 4GI9A 2E9LA 1BYDA 2O9RA 4PN2A 3T2QA 3O8AA 5BOOA 4INFA 1XICA 1WXZA 5BU6A 1FCBA 5DANA 4JPGA 1F05A 2F84A 3QR0A 2QEZA 1XBVA 2GJXA 3IANA 1BWLA 1NSJA 4WF7A 4DAFA 2DZVA 3CT7A 5G1YA 1LYXA 4QDWA 3LCXA 1P0DA 2CXEA 3QOMA 1AW5A 4AQLA 1LWJA 3A3XA 2V82A 3WD0A 3KCLA 3B3DA 2X1IA 4M3PA 5B80A 4QEHA 5HR7A 3N15A 2WVVB 2A7PA 5AFDA 1EGZA 3TKFA 3SCWA 2ATSA 4AC7C 2EG7A 2DH2A 1WXYA 3HGOA 3KHJA 1UWAA 1JNDA 2V3GA 4JBRA 4X0NA 1BEUA 4GYKA 3BQ6A 3N2XA 3QSTA 4U5KA 4IL0A 2YA2A 2OSYA 1VQTA 3DI1A 4RK8A 3RLVA 3ALGA 3KWXA 1OCNA 1HJQA 1PX8A 1R3SA 4AW7A 2YCIX 4C6JA 3GFYA 3QEZA 3OGVA 4V27A 5D2XA 3WF4A 1RJPA 4GY0A 3ZLGA 5CBBA 3CUFA 3TYAA 3C0SA 4AVOA 5AYBA 3QJAA 3BANA 5I07A 4PCPA 4OFCA 1H7XA 3ABZA 2NXHA 2PDLA 3VKKA 1DV7A 4PRWA 3W2JA 1BVZA 1XIMA 3NL3A 1OSEA 4WDTA 1AJZA 1WXJA 4OV4A 1BD0A 2JK2A 4AEFA 4BK9A 1BQGA 2V5BA 1RCXB 2C0AA 3WLPA 5J5DA 4BEQA 2QCDB 1DE5A 4A05A 3TJXA 1DJIA 3T2OA 1A5KC 4G1NA 4H00A 4L4PA 1GQLA 3L66A 3C8FA 1S2TA 1KWGA 1Q6DA 2FJUB 1HQTA 1Z89A 4RNHA 2XVNA 5FESA 2DUXA 5DCDA 1KA9F 4TV5A 2ZRXA 4AAJA 1XISA 4JQ3A 2QUMA 5HAOA 1C3FA 3SECA 3O06A 4P8XA 5CGTA 3W27A 1UBSA 3GR7A 2E40A 3WJZA 5C0QA 2QF8A 2Y61A 5FF7A 2ZUUA 1ADSA 3RDKA 4DO6A 4ERIA 2P5NA 1LRTA 3T40A 4J28A 3WNPA 2PWFA 1BTCA 5AC8A 5I3HA 3SAZA 1B3XA 3ZIZA 4CD8A 3WDQA 2BVWA 1ECEA 4IUGA 3CQJA 1M03A 1QR7A 2H8XA 4MKVA 3UJEA 2VEIA 4NY2A 4E4FA 4US6A 4AIBA 2E5DA 2KZHA 4ZO7A 1LBLA 3FYYA 4MZ8A 2FYMA 3O16A 1O5XA 4O14A 2BODX 1D8WA 3WY1A 4P2VA 2VUNA 4D8AA 4X3ZA 4XWUA 5T91A 4H9TA 1JFXA 3W7EA 4GQBA 3ISIX 1EYEA 1OC5A 3TR2A 1FFQA 4FS9A 2PDYA 2QDGA 3KOWA 4ASTA 1JPIA 2J79A 2YXXA 1B2YA 5LNWA 1ISWA 3TK7A 1BYAA 4JKMA 2JALA 3VINA 3T4CA 3CWNA 4DBEA 1GJPA 1IXQA 3STFA 4LBUA 4NAEA 1SW3A 3E1F1 1ISZA 4F8XA 3GU9A 1Q8AA 2ISDA 4D1IA 1CW2A 4UTMA 1HKKA 1JRBA 3RU8X 3BG5A 5FIPA 1TV7A 3WLHA 4IMGA 2YFOA 3TC3A 3P8IA 1O7AA 4GLEA 3MUIA 3ORWA 2PDIA 2YW4A 4X2RA 3S9ZA 3NZQA 3N6JA 2OT0A 1Q8JA 3FDGA 2WVTA 3PF3A 4JN6A 2HBVA 5AKQA 3R5EA 3U3HA 3CH0A 4IMEA 5I3FA 3AIQA 4CVUA 2QVNA 2WZEA 5HMFA 4ERGA 2GUYA 2O9PA 3PJUA 1VFMA 3HG4A 3SFKA 2EKGA 1VBHA 3K2GA 2ZXQA 3WLOA 3DDMA 4XZNX 3MWAA 2Z1WA 4WHBA 3OU8A 4JTIA 5A6MA 1B4EA 7TIMA 2Y5SA 3KLLA 1A5LC 5IXEA 2A5HA 3CWHA 1OINA 2ZVIA 1MXSA 5C9WA 5CPTA 3URBA 2CFFA 1UZ1A 3VOCA 3S5ZA 2Z2UA 4GY7A 1TWDA 4Z1YA 4OU1A 3LMYA 4R88A 3VMPA 1ONXA 3NA8A 4AC1X 3T0TA 1EO5A 4FXSA 1HUVA 3H7UA 3ZM8A 4QDPA 1YMYA 2BASA 1KV8A 3UPBA 2Z6IA 3U2EA 1EF3A 2EO7A 1DJWA 2IKJA 5IM51 1E0UA 1WZLA 1LWHA 1JZ8A 2INEA 4DB7A 4E8GA 3LSBA 1C7TA 3LEPA 3BH4A 5EFFA 1VYRA 2G96A 3SUWA 1LQAA 1XRFA 4MNMA 5BXSA 1C7SA 1DTNA 3W76A 4QAWA 3N73A 3TQ0A 4DWDA 1EHAA 1Z44A 2DJLA 3WJWA 3IAPA 4BA0A 1JDCA 2CC0A 2E6AA 3HF3A 2GQ8A 1IXOA 4MB5A 3QHMA 4G2DA 2Z00A 2Y8KA 1KD0A 3EWBX 3W74A 2RGMA 3ITLA 4AYSA 2GJPA 3TW7A 2QGHA 1HP5A 2Z29A 4L6DA 1EYWA 4A22A 2PDBA 2GOUA 2E1DA 2NQ9A 3HQPA 1OK4A 3G1HA 4Q8OA 4TVDA 3HJEA 4FNPA 3TX9A 2V0TA 3BQ5A 5D04C 2F9RA 1ZLPA 3AZSA 3O1NA 2PFHA 1R2SA 3NQMA 3LM7A 4CN6A 4FNQA 3CEUA 2H9AA 4LB4A 5IOBA 4DBWA 2YX0A 1UZ4A 1HP4A 1TE1A 4QJ4B 3EBVA 4CNSA 3CMFA 3CQHA 1GPFA 4PRTA 2Y7GA 4TMCA 3VNZA 1V3HA 1TPC1 2BGQA 3CHVA 5D2YA 3BLEA 4HU0A 1QHZA 2E77A 4AD4A 2PTYA 2I16A 3TNBA 2FPVA 4LS0A 1LRNA 2BGSA 1G01A 3DBPA 1JULA 2CBUA 4P8UA 5C7HA 4HA3A 5FD0A 3W00A 3WX7A 3V0UA 3UBPC 4CLMA 1SVDA 4AY8A 3AIRA 3H4XA 4RNJA 2O4QA 3TE9A 3LV6A 1AQFA 3WUFA 4US5A 1UW9A 4PSPA 4IIFA 3GM8A 4JFTA 1OADA 3L0KA 1FCQA 1PO9A 3VIHA 1CB7B 4E8DA 4KCUA 3F2CA 1HO1A 1U5VA 3IRSA 3CQ0A 1RBAA 1RP9A 4DUOA 3U7BA 4K7YA 1MW1A 3EX2A 5D8WA 3WJXA 3BLKA 3KZPA 1AVAA 5FJTA 3FJLA 4NJGA 3QRHA 2VFEA 1UWRA 1DIDA 2CLKA 3UD6A 1R6WA 1RHCA 2F61A 1OCBA 2YB1A 4PL2A 4X9YA 4DO7A 3WYZA 2BZNA 4QCFA 3AYVA 6TAAA 1UR3M 4E8CA 5AHMA 4IGNA 1BGAA 4LQ1A 4D1JA 1PE1A 4UNLA 1HJWA 3L4TA 3E0IA 1XLIA 4HQVA 3B04A 3ZJKA 4JR5A 3O9NA 3SUSA 1E6XM 4GUHA 3CAWA 4AZBA 5FF4A 4AIOA 1BSLA 1UKTA 4LF2A 2GSJA 3FKRA 3GDMA 3TVAA 5D37A 4RNFA 5CXPA 4F0LA 1HG3A 3E0WA 3B0XA 5EBAA 1SPQA 1C91A 4GINA 3VGBA 1KCKA 2REQB 1XL9A 4HD5A 3N1AA 4HNCA 3AYSA 2C7FA 5J8LA 2AMXA 3N29A 3ITOA 3W1TA 4QTGA 4UB9A 1NTHA 5EFDA 3UXLA 2NLIA 3L4YA 4KGLA 3VOJA 3QY6A 1XIEA 2BX7A 4UTTC 4CNTA 2XFWA 2C3ZA 4M24A 1UR9A 2YL6A 3UXAA 1K02A 3GE7A 2V81A 1VB9A 4R33A 3UJFA 2XFRA 3GH5A 1PIGA 3PNZA 1QOQA 1ITCA 4P7OA 4RE4A 1KFBA 1XYZA 1S2VA 4MYXA 5G4WA 5E0FA 2Y0FA 3HQNA 4LUTB 3W3OA 1TZZA 2WNWA 1UQYA 3KOXA 4K68A 3MHFA 3KS6A 1A4MA 2O55A 4B5SA 3O0KA 1E0TA 4H6RA 4P7NA 4AZIA 4M8UA 4NZCA 4TTUA 5G4EA 1EQCA 1FWBC 2F6UA 4EPDC 4XQ6A 2OT1A 4MPKA 3ID7A 5AHFA 2IKIA 4GZIA 2R1PA 3OHIA 2ZUSA 1PYFA 5K9XA 1C29A 2FIQA 4GBUA 5G2WA 4GNJA 3IARA 1A3HA 4UTWC 2QJHA 4DPPA 4PMDA 3PTMA 1IR1A 3QQ0A 1XG4A 1QNOA 3IWPA 3QQ1A 2BHUA 3OEXA 1BSIA 5FSEC 2FPYA 5BRPA 5FAJA 3WMBA 4J3VA 2Y7DA 3RM4A 3KVMA 2WMIB 3LMZA 4L1XA 3RG6A 3MI2A 3TQPA 3WD2A 3KOYA 3ZR4A 2G41A 3MO7A 2MNRA 4JYFA 1GVYA 3ONBA 3L21A 1JYNA 3IIZA 4JTTA 1YW1A 4ZOBA 1OIMA 1RQHA 3HU7A 4ZL1A 3CUIA 3RITA 2FGLA 4BHYA 1GJWA 1PCKA 3PHAA 4LVGA 4ATWA 3ONCA 5AVHA 4ENLA 3NPWA 4GKLA 1GKPA 3S2NA 1H7OA 3C0LA 4HU3A 3ZYZA 3DOPA 3RYSA 1XBYA 2EJAA 3B8IA 4NP7A 4QLJA 2G3NA 3U0HA 3APTA 3Q45A 1Y5VA 3D5HA 4UFHA 1GJUA 1WA3A 3MSGA 3W02A 4DJEC 4B3KA 2NSOA 1DQXA 2ALRA 4RLIA 3T0AA 3L2MA 2VZOA 1V7AA