1B31A

Xylanase from penicillium simplicissimum, native with peg200 as cryoprotectant
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
302
structure length
302
Chain Sequence
EASVSIDAKFKAHGKKYLGTIGDQYTLTKNTKNPAIIKADFGQLTPENSMKWDATEPNRGQFTFSGSDYLVNFAQSNGKLIRGHTLVWHSQLPGWVSSITDKNTLISVLKNHITTVMTRYKGKIYAWDVLNEIFNEDGSLRNSVFYNVIGEDYVRIAFETARSVDPNAKLYINDYNLDSAGYSKVNGMVSHVKKWLAAGIPIDGIGSQTHLGAGAGSAVAGALNALASAGTKEIAITELDIAGASSTDYVNVVNACLNQAKCVGITVWGVADPDSWRSSSSPLLFDGNYNPKAAYNAIANAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Family 10 xylanase
molecule keywords PROTEIN (XYLANASE)
publication title Xylan binding subsite mapping in the xylanase from Penicillium simplicissimum using xylooligosaccharides as cryo-protectant.
pubmed doi rcsb
total genus 130
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1998-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1b31A00
4IISA 4B3KA 4PTXA 2VZVA 1PBGA 2CYGA 2UY5A 3QR3A 3WFLA 3WL0A 3ZJKA 4PCSA 1WZLA 1EDQA 3ARXA 3WNNA 2EPLX 2W92A 3N9KA 2WSPA 1JXJA 4FLRA 1OT1A 1QHOA 1UYQA 3VX1A 5I23A 4PSPA 2GSJA 4A3HA 1NOUA 3UR8A 4HP5A 1UWTA 3WF3A 1RPKA 1UUQA 2ZUVA 2D3LA 2VR4A 4WLCA 4AY1A 4EAMA 1UA7A 3RCNA 1VEPA 2XGBA 4W7VA 2F61A 2VO5A 1ZS2A 1HL9A 3ZOAA 3F5KA 4ZE4A 3ARWA 7TAAA 2XG9A 2J78A 5CXPA 3VNZA 2XVGA 3EDDA 3AS0A 1B3XA 3W4RA 2ZUNA 1JZ3A 1WZMA 4PBGA 6CGTA 4J27A 2WMIA 3DYMA 4PMXA 3VIHA 2WZIA 4JAWA 1E4IA 2ZUUA 5M03A 3T0BA 2YOCA 1H4PA 4BQ3A 1DWGM 2DSVA 2CERA 5EFDA 1JDDA 1V6YA 1KXTA 1MQQA 1B30A 1CGYA 2VCAA 1EOMA 4NI3A 2V3GA 1LJYA 2CHNA 3VM5A 1H5VA 3W28A 3WD1A 1FHLA 4ZE5A 3BLPX 4JKMA 1V3KA 3WDIA 4MB3A 4PSRA 3GXDA 4BQ5A 1HJWA 4TOQA 4HA3A 4C7GA 5EMYA 2WHMA 2YIHA 2A3HA 1CXFA 1QNSA 1EO5A 4H8VA 1BTCA 2PWDA 1JGIA 2VUYA 4UOJA 4EKJA 3TP4A 1PIGA 3MUZ1 1TG7A 1J12A 3SCNA 1NQ6A 2QMKA 1QI2A 1HKIA 3N15A 3DYOA 2EPNA 4QLLA 3AMKA 3QOMA 4TVUA 1CEOA 4P7QA 3L4WA 3BSGA 3OIHA 5D9MA 4W93A 4HOZA 1NARA 4AZCB 2EJ1A 3KL5A 5A2CA 2CBVA 2YL8A 4GI6A 4WSKA 1WB0A 1BYAA 1JF5A 3W29A 1UWSA 2XVPA 2WHJA 2G41A 2HISA 4U3AA 4CCEA 4ML4A 5A6MA 3T2OA 1C7SA 1OGSA 2BVDA 2WMFA 1IZKA 2D0HA 4WKHA 1W2VA 2VZOA 5M5DA 3L4YA 4JHZA 3WBEA 1W9UA 1UR2A 2UY4A 1H41A 3AIUA 1JNDA 6TAAA 5JIWA 4UQBA 1JI2A 2F8QA 3WNPA 2VL4A 4HA1A 4LYQA 1RH9A 1XCWA 1W9BM 1W1TA 4BS0A 2G3JA 2IXVA 3VD7A 3OG2A 1F4AA 1BVNP 1HT6A 2VR5A 2WXDM 3IANA 1JIBA 1B3YA 1PX3A 3GXMA 1EXPA 4AZ7A 1G0CA 3PZIA 3CUJA 2VTFA 1H11A 3MMDA 2X1IA 4TUFA 2YDQA 2X0HA 1MVYA 2NT1A 1WKYA 3VD4A 4S3KA 2E9BA 3W81A 1CPUA 3PZ9A 5KEZA 1UQYA 4UQDA 1Q6CA 3I3EA 4PUEA 1EHNA 2BVYA 3CZLA 1UZ4A 1NWSA 3VGDA 3ZR5A 4DUWA 4M8UA 2BXYA 4GO8A 2D23A 3CZEA 1PX4A 1H49A 1ISVA 1UG6A 2DGAA 3MMWA 1RP9A 4AD4A 4WF7A 4CU7A 3EMZA 4X0NA 1MW0A 2V38A 5C71A 1OBAA 2VVNA 1M04A 4CU8A 5JUVA 2QMJA 4JFTA 1UHVA 1MXGA 3BMWA 1W32A 1JF6A 5ABEA 1TMQA 1E55A 2O9PA 2E9MA 2AMGA 5IHRA 1TUXA 5C70A 2W61A 3GXIA 3WH7A 2WMHA 3IK2A 4UFMA 1NOFA 4ZFMA 1SR0A 1JNEA 1GQKA 5A69A 2WVVB 5FOOA 3L4TA 1UR0A 1G1YA 4PMNA 1MW2A 3ZT7A 1GHSA 4E4PA 3GH7A 3SCUA 4YN5A 3FAXA 1WDPA 1PPIA 2D0GA 4UOQA 4P8XA 3CMJA 3AISA 2OSYA 1VB9A 4MAZA 1LWJA 1ZBKA 5D8ZA 2V3EA 2Y24A 3KZSA 3EDEA 3MANA 3W6MA 1E73M 4U3CA 2PWFA 2BY1A 5CQ1A 1V6UA 2ZX9A 1M53A 5BXTA 2VI0A 2VURA 5CGTA 2YLLA 1GOQA 3ARTA 3SUUA 1OIFA 1OCQA 1C8QA 1WPCA 5CSYA 1TZ7A 1JXKA 1QHZA 4XV0A 1FH7A 1V3LA 3AHXA 3T08A 2YBTA 1KXQA 3PTQA 3WQVA 1NM9A 1E40A 2PWHA 1V08A 4D6IA 2JFEX 4U2YA 1V3IA 2ZUTA 2YL5A 4J28A 2PC8A 3RDKA 5AC5A 1QI3A 1UD3A 4U5KA 1E6RA 1K9DA 4OUEA 3MV11 4AW7A 1E72M 2ZX6A 1HIZA 1LL6A 4Z2KA 5M17A 2VT0A 2HVMA 2GVYA 2DSWA 1J0ZA 5IFPA 1FOBA 1F4HA 4AIUA 1GW1A 3CTTA 2OWCA 4NRSA 1E4MM 1ZB5A 2DT0A 3W37A 2XWDA 3UG3A 2ZXQA 1UZ1A 5GNYA 2O9TA 2IUZA 1MFVA 1ODZA 2QPSA 4PYSA 2XPKA 5HOSA 1GVYA 2ZWZA 3DECA 4KGJA 3WSUA 4QP0A 4UFKA 3A4XA 1GOIA 1UA3A 2F2HA 1C92A 4IM4A 3NIYA 1B31A 4LX4A 3AYSA 2J7HA 4K68A 4GINA 1XSKA 3U5YA 3LPFA 4FMVA 5BYWA 3A6OA 3W27A 2GFTA 5A6JA 5E0FA 2DDXA 3ALFA 4CKQA 2BNJA 1WE5A 4GPNA 2CCRA 4UQAA 3WEZA 4W85A 3CGTA 1B9ZA 2W67A 2G3MA 1QI5A 4MNJA 4H04A 4GZIA 1VEMA 3OZPA 3WL1A 1M7XA 1BYDA 1JAKA 1DWAM 1IV8A 5CZKA 1UOKA 3AS3A 2CITA 4RE3A 3NCOA 2O9RA 2XFFA 4MJ4A 1SFSA 3UETA 4UTFA 3T0DA 2GK1B 1NWRA 3VMNA 2YA0A 1B0IA 1LG1A 3BAYA 2DQXA 4JHOA 1CXEA 2WAGA 1JAEA 4AZIA 4JFUA 1V0MA 3WN6A 1UR1A 4HZ7A 3AIBA 2Y2WA 1GQJA 3AS1A 3T2PA 1XCXA 2DPEA 3AXXA 3NJ3A 4TX6A 3SCRA 5HPOA 1GJWA 2ZXDA 1XYFA 3LPGA 4MADA 4R5EA 1KWKA 3CHFA 9CGTA 2OYKA 4PMUA 4CUCA 3L4ZA 1RD6A 3ZJ6A 1OGGA 2YDRA 4P7RA 1MW3A 1S46A 1C3FA 2OYMA 1CGUA 3PZMA 2A3BA 3B9EA 1E0WA 4M29A 2VX7A 4HU0A 4QLKA 4J7RA 3W26A 1EGZA 1UKPA 5DO8A 1GZJA 3AFBA 7A3HA 1AQHA 2WBGA 1MQPA 1GQIA 1B2YA 2J7CA 1FH9A 3M07A 1GUVA 1XGZA 3N04A 3SCTA 1HL8A 4P8VA 5I79A 2ZE0A 4MDOA 5A8PA 1HKJA 4YHEA 4UQEA 3CMGA 4AZ6A 4WJXA 1V02E 5I2UA 3AI0A 2FH6A 2WZEA 2CHOA 1W3HA 2WANA 1CLVA 1PIFA 4H2CA 3F5JA 3GNRA 4H41A 1XV8A 3VUPA 3D3AA 4B3LA 3WNKA 3NSMA 1MFUA 1W9PA 3VOCA 3AMDA 5DT7A 3PZTA 3ARUA 2G3NA 4CD4A 3HN3A 1UWUA 2ZXAA 1NH6A 4HMCA 4W7UA 5EB8A 1FP9A 3CPUA 1YQ2A 3GXFA 4AD3A 1K9EA 5AY7A 2WSKA 2GJPA 1E3ZA 1TR1A 4NZCA 3D5HA 1ZBVA 4IPNB 3VGEA 2GK1A 1HVXA 3MUY1 4FLQA 3HMCA 4UZUA 1Q4NX 4UZSA 2ZIDA 3UCQA 8A3HA 3WQ4A 2X0YA 1O6IA 4LYRA 3BAWA 3DHUA 1E71M 3PTMA 2FHCA 4HTYA 3BLKA 1JYXA 3MV01 4J3VA 1EQPA 2X8RA 1DWIM 1W1PA 5FL1A 5E70A 4B15A 4C7FA 3WD3A 5AYIA 3CZKA 4HZ6A 1V03A 4UFHA 2PBOA 1GONA 3OBAA 4QCEA 4MPKA 4V2XA 5A6BA 3VIIA 5CGMA 2NT0A 1A47A 1VAHA 2ZUSA 2JEQA 2ZUWA 5GPRA 5FIPA 1Q6EA 4RL3A 1HJUA 1M03A 2OWXA 2VNCA 2VRQA 1KFWA 2D1ZA 3WDQA 3WH6A 3KL3A 1C8XA 1K6AA 1CXHA 2A3AA 4FK9A 2EPOA 4R27A 3AROA 4MB5A 2XJ7A 1SMAA 1WDRA 3WELA 4LGXA 3PZOA 2CETA 3BAJA 4E8CA 1R8LA 4F8XA 2VRJA 3CHEA 5D9PA 3EDFA 4MAVA 3WD4A 3VIKA 2FGZA 4PMRA 2BY3A 3PTKA 1NWUA 1WP6A 1QNOA 3L4XA 5HPCA 2VCCA 4S3JA 1VJZA 4JKKA 2QLYA 2XVKA 1E70M 1UD8A 3MSGA 5D9OA 1AVAA 4PMDA 5CPSA 2X05A 4UQ9A 4WK9A 4HA4A 3AYRA 5TD4A 4P8WA 1ZJBA 5CPQA 1J0HA 2VZUA 3FXYA 3U5UA 2FHBA 1VJSA 1W3KA 2WWCA 4P7NA 1TA3A 4CGTA 1BSIA 3GM8A 4GIAA 2XM1A 3VILA 1AMYA 3VIPA 1V0NA 1NOWA 4H8HA 1ZBCA 3RILA 1VENA 3B9AA 4PMQA 5E0CA 2WMJA 4PMOA 4JFSA 2OSXA 1VBUA 2FGLA 3IJ8A 3AS2A 1BGAA 1TFVA 1DWHM 2J75A 3QOKA 2E4TA 5BRQA 3I3BA 5DT5A 3RM9A 2FH8A 2WCGA 4KRUA 2OYLA 4OZOA 4E8DA 3W24A 3WNLA 4H8UA 3MUIA 2YL9A 3BXWA 1JZ5A 5BRPA 3GZAA 4URIA 4AMCA 4DWSA 5A8NA 4M80A 1PZ2A 3TTSA 4AD2A 2DT2A 2C8NA 4KGLA 5CPTA 1TVPA 1WCGA 4PTVA 3G6LA 3W53A 3GBDA 4MNMA 3L2MA 3WMBA 4W86A 3HJEA 3PZGA 3GTNA 3VNYA 2J8FA 5CLWA 3QHOA 3WUBA 1XH2A 1ISWA 1BVZA 3NDYA 4M82A 1CENA 2WC7A 3WNOA 4PTMA 2YA1A 1GCYA 2J47A 4BQ4A 1X6NA 3RJYA 4MB4A 3VD5A 1BFNA 1Q6FA 4W87A 3GH5A 2DSKA 3T0AA 1V6XA 3WH8A 3OLGA 4Z2GA 5FCZA 1HP5A 5AC4A 4A3YA 5EBAA 4HU8A 1KBKA 1GOMA 3CBWA 4E2OA 1PJ9A 3EYPA 3CUGA 1HJSA 4P7OA 4CD6A 2EEXA 3BCFA 3L2LA 3TOPA 5A6SA 2J79A 1VFFA 3U7VA 1H3GA 1G5AA 1OD8A 2BFGA 2BS9A 2E8ZA 4MJ2A 1UD2A 3WH5A 4MNLA 2PI6A 5ECUA 1JFHA 3WQWA 5CJ5A 1MW1A 3M46A 1QBAA 1RP8A 4NRRA 1CXLA 2ZOXA 1AQMA 3K4DA 5KZ6A 4UFIA 1OIMA 5BWFA 1A3HA 1WAWA 3WH9A 3FW6A 3MUAA 4QLJA 3RJXA 2Y4SA 1E56A 2VOTA 1JYNA 5D4YA 3CHDA 3VIOA 2BVTA 4ZEPA 1KXHA 1N82A 1CTNA 4GI8A 1XC6A 3OLDA 3TTYA 1PAMA 3UG5A 1ODUA 3ZR6A 3OGSA 4J3TA 1VFUA 1KGWA 4CVWA 3WUEA 2JIWA 3S6TA 1DEDA 1KGUA 4OBSA 1BF2A 1HXJA 2BY2A 2QV4A 3N13A 3BAKA 5E6YA 3ZSSA 4KWUA 5FD0A 3SUTA 3U57A 3SEPA 2WVSA 4UCFA 3FNDA 3ZMRA 1V0KA 7CGTA 2JF6A 2JF7A 1VRXA 1E6ZA 4GXPA 3K8KA 2QPUA 4TVCA 2XSBA 5A94A 4CN4A 2V3DA 4BCEA 5LA2A 3PBGA 4JCMA 3A3HA 1L0PA 3BSHA 2D2OA 4WIWA 3ZO9A 1DWJM 2QF8A 3VO0A 1UR8A 1UKOA 1XHGA 2AOSA 1E6NA 1R7OA 1R87A 1V3JA 3PZQA 3POHA 3ZT5A 3TTQA 1I1WA 1K9TA 3A4AA 3F5LA 1UKTA 4OKDA 3B9DA 2XWEA 3WQ8A 4L4PA 4HOWA 3KL0A 4F79A 1J11A 1OM0A 3ZSTA 4N0RA 1HKMA 1GOWA 4B9ZA 1US2A 1WO2A 2VX5A 3VPLA 1DHKA 5D9NA 1GHRA 4W84A 1B3VA 4CN6A 1GNXA 1G94A 4GI9A 3CUIA 2ZWYA 5CSUA 3GBEA 4LYPA 3U7BA 1H0GA 4PMVA 3ZJ7A 2YDSA 3AZSA 1V6VA 2ZXBA 4P8UA 3L4UA 1BAGA 5E09A 1R86A 4Z2IA 5ABFA 3WBAA 2VC9A 1KR0A 3NYDA 1UH2A 1ZJAA 2JE8A 3OGRA 5A2BA 4TTGA 1J0IA 2VZSA 3FHQA 3UESA 3RPMA 2WLYA 1XD1A 3VIFA 1DWFM 3GDBA 4DM1A 1JG9A 1J01A 4RE2A 2J62A 3VINA 1ITXA 5CLTA 3AHZA 3WD0A 1NWTA 1Q6DA 4GQRA 3M6DA 1Q6GA 2D20A 2YL6A 3AJ7A 1LL4A 3PZVA 4W8LA 1JZ7A 3UR7A 5CG0A 1B3ZA 1JZ8A 4ZXLA 1E43A 4PUDA 5BXRA 3GNOA 5A6AA 4NSBA 3MKKA 1ISZA 5I78A 1GQLA 3II1A 3ARSA 2CBIA 1OD0A 4F9JA 4FLSA 4P7LA 5A1AA 2DH3A 4BQ2A 2NSXA 3WF1A 3WDHA 3RIKA 4ATLA 1XH0A 4B16A 4PCTA 4JZ5A 2RGLA 3ARVA 4TVDA 3QGVA 2RGMA 3MSDA 1KXVA 3ZIZA 2VRKA 3WDJA 3AMGA 3BAXA 2DIJA 2Y8KA 3WD2A 3SCQA 3NSNA 2XVLA 4TX8A 1WZAA 4PEEA 2WM0A 1CIUA 4ACZA 2WVUA 4AXNA 4X9YA 3AHYA 4W5ZA 1O7AA 2BY0A 1E6QM 1AQ0A 1E6PA 4AD1A 3N18A 1CBGA 2XIIA 2DSZA 1ZU8A 4U5IA 4HMEA 4KRTA 3GNPA 5A6KA 3SURA 1HVQA 2A3CA 2DH2A 3DHPA 1E15A 1UWQA 3N17A 4EE9A 1PX8A 3TA9A 1HJVA 4WKFA 1OSEA 2VZTA 1KBBA 3AIRA 1V6WA 2EXOA 3T2QA 1XSIA 1VFOA 3T09A 1QHPA 2DEPA 5DF0A 5A6LA 2D22A 2XIBA 3WF0A 1CGVA 3FAWA 2PF0A 4MDPA 4TXEA 1PEZA 3VIGA 2OSWA 1US3A 2XM2A 3SCSA 2XUCA 5LA0A 1QBBA 2J7FA 1KQZA 1E0VA 5E6ZA 2C7FA 2UY2A 2ZX8A 3EDKA 4AYSA 4J3XA 2XFRA 1E9LA 5EFFA 2E9LA 3LPPA 4JFVA 5I6SA 3WQ6A 1HP4A 3ZQ9A 5A8QA 3ARQA 3VM7A 1B3WA 2UWFA 3RM4A 4U31A 3BH4A 1B1YA 1KGXA 3N12A 1ZL1A 3CO4A 3GH4A 3O6AA 2WC3A 3CLWA 1XD0A 4J3UA 5FL0A 1B90A 1TA3B 2ZX7A 2XVNA 2VQTA 4J3SA 4CCDA 1WZKA 2YBUA 1W1VA 5LA1A 2GDUA 1QW9A 1W1YA 1ZBWA 1D3CA 4F66A 2WBKA 3ALGA 1EDTA 4BZYA 3WUGA 1IT0A 1EA9C 3VTRA 3VU2A 2VVSA 1Y7VA 1X1NA 1SYTA 3O2LA 1VBRA 3ARYA 2WB5A 3BAIA 4DWSB 3KWXA 3VD9A 4LQ1A 4YHGA 1UD4A 1JI1A 4YPJA 1XYZA 1LG2A 3TONA 1C90A 3J7HA 3THCA 2W63A 3KE0A 2UY3A 4XZWA 3WEOA 2WKGA 4RE4A 3M7SA 4D6CA 3ECQA 2PB1A 4XX6A 3CH9A 1CGTA 2YKKA 5JBDA 1OWQA 4UNIA 2DT3A 3WFZA 3CHCA 1LLOA 2JALA 4D6JA 3OB8A 4D6EA 2VCBA 3BC9A 3ZT6A 1E6XM 2WHKA 3SCWA 4F9DA 1W9VA 3CUHA 5F7UA 3ARRA 5DEZA 1CWYA 4AD0A 1C7TA 1BHGA 4AC1X 2WW5A 2XTKA 3SCVA 1JD9A 4L4OA 1EDGA 2XHYA 4D6HA 1J18A 3AXIA 5I24A 1EIBA 2J77A 4Z2HA 1IZJA 1HNYA 3AMCA 1KQYA 3G6MA 2J8GA 3AIEA 5ABGA 4JL2A 4PTWA 4AZ5A 2O92A 4Y7EA 1E3XA 2IXUA 4JIEA 4LXFA 3EBVA 3WNMA 2C0HA 1K9FA 4QDMA 3VIJA 5JBEA 4U33A 3VDCA 4DWSC 2GJRA 2OWWA 4HPGA 3B8SA 2YJQA 3IJ9A 3AICA 2XYLA 2PWGA 3WDRA 1P6WA 1KR1A 5DMYA 3ARZA 3VDBA 1FFQA 1UD5A 5BROA 4M1RA 3WF4A 3AMLA 2WCSA 1H0IA 1JZ4A 3W25A 2WLZA 1ECEA 3OLEA 1V02A 3AZTA 3RMEA 1HJXA 2WNWA 2D24A 5GQBA 4DM2A 3QHMA 1I75A 1OGBA 4M24A 3N11A 5BXPA 3UERA 2YLAA 4IUGA 3AIWA 1G9HA 3ZM8A 1BQCA 1BLIA 3L4VA 3ZJ8A 2D0FA 2WMGA 1J0YA 2BHYA 2ESCA 3CZ8A 5I0DA 1W2PA 1J0KA 4JL1A 1JDAA 2WC4A 4D72A 2CKSA 2EPKX 2JEPA 3OZOA 1LL7A 3AIVA 3VGGA 4CVUA 3W38A 3DYPA 1R85A 4KH2A 1GOKA 2MANA 4QAWA 5A3HA 4QCFA 2X2YA 5AYBA 1V0LA 3F4VA 3PZUA 2E40A 4AEFA 4A4AA 5JBFA 4OOZA 5A8MA 4KMQA 3GYCA 3WF2A 4DUXA 4M56A 2J74A 3E1F1 4XB3A 4CD7A 1JFXA 2X09A 2O9OA 2NW0A 4UFLA 2VJXA 2QHAA 2GJXB 3CUFA 3SCPA 1BYCA 4Q7NA 5LYRA 3VDAA 1QI4A 3VX0A 1HJQA 3K46A 3AHTA 5I5RA 2BV9A 4HZ8A 2XGIA 3MS8A 4WSJA 1QVBA 1GVIA 5IDIA 1ITCA 3K8MA 1H09A 3CZJA 4X0VA 1E5JA 1E0XA 1QNRA 3WMCA 3NSXA 1XSJA 3RM8A 5HBFA 2CXGA 4Z2JA 1J9YA 5GNZA 1QNQA 4AISA 4AZHA 3VKKA 1UR9A 2V3FA 2Y8VA 4W8BA 3IAQA 2ZICA 1I1XA 4MNKA 1KCLA 1UKQA 3CZGA 2V5DA 1BG4A 3BGAA 2XFYA 3OA5A 4LPCA 4MB1A 4PN2A 5IFTA 1X6LA 3AQUA 3AXHA 1EHAA 1U30A 4V28A 2E0PA 5ABFB 2Z1KA 3WENA 2VQUA 4UR9A 1QPKA 5ABHA 1VF8A 1UD6A 4J3WA 3OGVA 4AZCA 4HOXA 4WKAA 1H2JA 1D7FA 1OB0A 1KCKA 3CIVA 3EMCA 1FHDA 2FDMA 4AIEA 3ARPA 4W5UA 1E6SM 2WPGA 4ZENA 5C8BB 2WCAA 4CCCA 1W3JA 1CYGA 2J25A 2XSAA 1LQ0A 3SUSA 2WK2A 4D1JA 3SCOA 2G3IA 1FH8A 1W9XA 1YHTA 2WYSA 2W62A 2E8YA 5A8OA 1EH9A 4AWEA 5GNXA 2WKLA 4TTUA 1XH1A 3WY1A 1PZ3A 1GPFA 2CKRA 5E9AA 3VGHA 4UOZA 3QHNA 2Q8XA 1GJUA 2B31A 1CGWA 1JYVA 1OT2A 2VX4A 1UH4A 4OIFA 2CBUA 4Q22A 5DFAA 4XZBA 3RO8A 1NP2A 4HMDA 2GJXA 1HKKA 4H7VA 3WDPP 4EK7A 1SMDA 4BF7A 3EMQA 5I3DA 3TTOA 3PHAA 1WDQA 1MQRA 5I77A 4QFUA 1C8YA 4JCLA 5A6BD 2OLHA 3O9NA 2JIEA 2TAAA 1CECA 2BHZA 2J4GA 5IHSA 3K8LA 1BPLB 2J7GA 4GKLA 4AD5A 4FLOA 4NF7A 4IPLA 1FP8A 3SUWA 2WZHA 4ACZB 4JKLA 5JIPA 2AAAA 3FY1A 4JFWA 1CNVA 4D1IA 4D6DA 2WMKA 2CIPA 1W91A 4C7DA 3KEHA 3I3DA 4GZEA 3FN9A 4AZGA 2D3NA 2W5FA 3MMUA 4ATDA 1JYWA 4D71A 3NDZA 1LWHA 3A4WA 1MWOA 3W82A 3DC0A 2FHFA 2WVVA 1VIWA 2EO7A 4ZXOA 4PMYA 5A2AA 2ZUMA 2W4XA 4GZJA 4AEEA 2GDVA 2EQDA 1UR4A 1UWIA 1DTUA 1Z32X 3AOFA 2G8ZA 3AIQA 4PRWA 3WQ5A 3VMOA 3VD3A 3VDHA 1J0JA 5D8WA 3VIMA 1QI0A 1MYRA 3LPOA 4D6GA 1VEOA 1BYBA 4Z2LA 1TE1A 3SUVA 1CXKA 1BGGA 5HNNA 3IAPA 1KB3A 1M01A 2DIEA 3VGFA 1JDCA 2VX6A 3VMPA 2BXZA 2CEQA 1HN1A 3SIMA 2V5CA 4GO9A 2CBJA 1E1FA 3PN8A 1NP0A 3LMYA 1C91A 1FA2A 2VMFA 3BCDA 4W88A 1G01A 2CESA 2DT1A 5M3WA 1L8NA 1KWGA 1D2KA 5HXMA 2DSUA 4DUVA 5A95A 1CXIA 3WEMA 4DWSD 3K1DA 4CN1A 2J7DA 2GUYA 1W3LA 3BMVA 1LF1A 4AZBA 1CZ1A 4OOUA 2PWEA 2Y5EA 4W8AA 1ISXA 4XUYA 2BHUA 4D6FA 3PZNA 1C93A 1JZ6A 1WDSA 4UQCA 2E3ZA 1HX0A 3NUKA 2WHLA 3N1AA 1UH3A 2EPMX 2Z1SA 4CU6A 3VGBA 3S2CA 4ACYA 4ATWA 2CPUA 1XRVA 4EANA 8CGTA 6A3HA 2G4FA 1EQCA 1EOKA 4W7WA 2CNCA 1TCMA 3WKZA 3MU7A 2A3EA 2W91A 1QNPA 2ZX5A 3K4AA 1U33A 3UG4A 5BXSA 1TVNA 2J7EA 4OJYA 1UKSA 1R7AA 2WWDA 3FHAA 3POCA 1CGXA 3IJ7A 4B9YA 1ESWA 1ISYA 1E4LA 1JD7A 2WMIB 1WNOA 4N42A 4CD5A 1JZ2A 1HF6A 1OINA 5FKYA 3W0KA 4CD8A 3VVGA 3MO4A 1V3HA 4AIOA 3OLIA 1UWRA 3AHVA 1EO7A 4M81A 1E5NA 4HPHA 3UEQA 4BA0A 3W6LA 4U2ZA 1H1NA 4OBRA 1FFRA 1QOXA 5HDRA 1W9DM 1GORA 1E4NA 3APGA 1BG9A 4GQQA 3EDJA 1MXDA 4UFJA 2WVTA 1JL8A 5BCAA 1CDGA 2YA2A 3WUFA 3A47A 3JUGA 3WIJA 2J7BA 1QW8A 2EBNA 5IXEA 1J10A 4FF5A 4W89A 1DP0A 3THDA 1CLXA 1V3MA 2W66A 3WMSA 3AZRA 1GOOA 4V27A 1U2YA 3HU7A 4PMZA 4MTVA 1E1EA 1UQZA 2PBGA 1VFMA
chains in the Genus database with same CATH superfamily
3UJFA 1MEHA 2NXGA 1ELSA 1YTKA 5AVNA 4DJFC 1PTAA 5GJNA 4DI9A 3QR3A 4PH6A 3WFLA 3WL0A 3ZJKA 4PCSA 3APYA 4J4KA 2Z1BA 3WNNA 1Q2SA 2W92A 3IS4A 4D8LA 1JXJA 5DX7A 3VX1A 4PSPA 3C3UA 2IS7A 1V79A 2QJJA 1NOUA 4O1AA 3W22A 2ZUVA 1YX1A 2D3LA 2VR4A 3DFTA 4L6DA 4E4FA 4AFYA 5L6UA 4DO5A 3N14A 2XGBA 1LWIA 2ZC1A 4HNUA 1ZS2A 1HL9A 4HKPA 2XG9A 2G37A 3W1UA 3FJ4A 3EDDA 1B3XA 4AUBA 4J27A 2WMIA 3OG3A 3DYMA 3VIHA 4B2DA 2X0SA 1R6WA 1E4IA 4FX8A 2IQ0A 5M03A 4QJ5B 3T0BA 2LLEA 1H4PA 2DSVA 3EXTA 2CERA 4RNIA 5EFDA 1V6YA 4ZR8A 3W75A 3G0SA 3G1HA 1CGYA 2QF7A 4H9TA 2V3GA 4O8RA 4Y8FA 4C6OA 2CHNA 2XU2A 1H5VA 3LM3A 4S2CA 1FHLA 4ZE5A 2CLKA 3BLPX 3WK0A 3I6TA 4PSRA 2HRWA 4C7GA 5EMYA 2H9AB 3TYUA 2HMCA 3FV9A 1EO5A 2O4QA 1BTCA 1JGIA 1IF2A 1RK5A 2Z29A 1LQ2A 4UMAA 3RF9A 1DTNA 1JR1A 1NQ6A 1HKIA 2EPNA 1VBJA 4L1WA 1GKQA 3Q2DA 3LXAA 5IBXA 3E6EA 3OIHA 1Z41A 4YYCA 3W86A 4RKAA 4AZCB 3QSRA 3KL5A 3GW3A 1KFBA 3IARA 3TSBA 2XGZA 3F4DA 5C2XA 1WB0A 1QPNA 4MJMA 1H7XA 3STEA 2P5NA 2PTWA 4ML4A 5A6MA 2Y7EA 1OGSA 3DX5A 2DY3A 1IZKA 2D0HA 3PBUA 3NA8A 2VWTA 1H41A 1X97A 3W2JA 1JNDA 1YRRA 4O1BA 4UQBA 2TSYA 4GCXA 4NZ4A 1UJQA 3TYAA 1UP2A 1XCWA 3N73A 2A0NA 4CQ8A 1RJPA 1HT6A 1PXGA 2DU2A 4HYRA 3KRZA 3U0HA 2DZPA 3LHVA 1PX3A 4FNUA 5BWAA 4AZ7A 2Q8LA 1E1CB 4H6EA 4IGNA 2PDHA 1EEXA 4GYPA 3TU9A 1Y8BA 2X0HA 2NT1A 1DIEA 4S3KA 2Y62A 3E3HA 3GHSA 1Q6CA 3BJTA 4PUEA 3VK5A 3P80A 1FUYA 2HXUA 2CZVA 4JTLA 2BXYA 3M0XA 3CZEA 3VKCA 1RP9A 2NX3A 1YXYA 3V5FA 4X0NA 4UWMA 2VVNA 1R5YA 4CU8A 1S38A 1WKEA 1K3UA 2YB1A 1W32A 3H12A 1JF6A 1TMQA 2O9PA 2AMGA 2Q3RA 2W61A 3PG8A 2CZDA 4OFCA 1PUDA 1T8QA 1SR0A 3PVFA 3NQMA 3DFNA 3PUDA 3TW9A 1TPH1 4LUJA 3REQB 1G1YA 4PMNA 2ZRVA 4ICNA 1GHSA 3LQLA 3GH7A 1PL9A 1WDPA 1TPVA 3CMJA 2OSYA 3G3DA 2P88A 4MAZA 4WRHA 1SW3A 1ZBKA 3G2GA 2V3EA 2Y24A 3W6MA 3EDEA 3MANA 2V5JA 1E73M 2DUXA 2DJXA 5CQ1A 4REQB 3N25A 1XRSA 1M53A 5BXTA 2VI0A 2CLEA 4DY1A 1GOQA 3SUUA 3KVKA 1OIFA 2E5BA 1NF0A 4E8GA 4J3ZA 5CSYA 1JXKA 1DJHA 2Z28A 3AHXA 3TYZA 4KERA 1XISA 2A21A 1DJIA 2PWHA 1V08A 1O94A 4DAIA 2OZ3A 1V3IA 1EA0A 1V93A 3UFYA 4WJ8A 1MUCA 3ERPA 5AC5A 2RUSA 4HHMA 4IMEA 2VEPA 4OGZA 1XIFA 1YLVA 3QBUA 3FX4A 3TX9A 5TIMA 1PKYA 3LRMA 4MWAB 1GW1A 3CTTA 2OWCA 1ZB5A 3LCWA 2XIOA 5DBTA 5HA7A 2O9TA 3S47A 5CSRA 4EVZA 2QPSA 4PYSA 3DECA 2EAWA 3BGJA 1EWEA 2OO0A 4QHRA 3Q65A 4UTLA 4XZLX 3A4XA 3ZS4A 2ICSA 1B31A 4LX4A 1XSKA 1YPXA 3M4HA 1XPYA 5C9ZA 4IGMA 3VDGA 2FFIA 4QQ3A 1GQNA 3A6OA 4RDYA 3W7MA 2DDXA 3ABOA 1M9HA 1WE5A 1UP0A 3E9AA 4NQ1A 4H4IA 1B9ZA 3M7WA 2W67A 3RGTA 4MNJA 3GTXA 4CQAA 5G2IA 2DUZA 1VQTA 4OV9A 3EKZA 3WL1A 4QJ1A 1AMKA 4YIWA 1JAKA 3W23A 1TPFA 1KM3A 1NF7A 1UJPA 2CITA 3N4AA 4FALA 4BEUA 3NCOA 4GRSA 4IOTA 2Z2BA 1LORA 3QEZA 1R0MA 2WJDA 3U48A 3G3MA 1EGMA 3WLPA 1F05A 2GK1B 1NWRA 2H6RA 2X40A 2YA0A 5I09A 1LP6A 3A9IA 3EOSA 2WAGA 5M2FX 3BE7A 5HUPA 1V0MA 4HZ7A 3AIBA 3ISIX 1SSGA 4CLMA 1N55A 3AXXA 3CV1A 4HNLA 5HPOA 1GG0A 2ZXDA 3WQDA 4R5EA 3CHFA 6TIMA 2VENA 4C1KA 9CGTA 1TV8A 1RD6A 3G8EA 5EMMA 1OGGA 1CB7B 4HSOA 3GS6A 1E9ZB 5G4HC 4M29A 2VX7A 3LI0A 3W26A 5K4ZA 3L12A 1UKPA 1PVNA 1AQHA 2FPYA 2Z25A 1S2CA 4AY7A 2QQ6A 2PTZA 1V5XA 4YHEA 3G1FA 2BX7A 3OEXA 3PWGA 4KCTA 4WJXA 2E25A 3T40A 3WLTA 4GUFA 3H8AA 2WANA 1QK2A 3MP5A 3D3AA 5I02A 1UUOA 3NSMA 3ID7A 1W9PA 3PJWA 5DT7A 3PZTA 4CD4A 2OVLA 4YCPA 1FDYA 2ZXAA 1T40A 2OU4A 1FP9A 2VEKA 4DPQA 4RR4A 4YNGA 4NZCA 3LLXA 3C2EA 3E38A 1FQ0A 4FLQA 2XINA 3NZ1A 8A3HA 1UUMA 1XBZA 1XLLA 1G67A 1EJWC 2PDKA 1GVOA 4UTHA 5DCEA 3ES8A 3QPYA 3MV01 5J8LA 4KWSA 1SGJA 1DWIM 2HVNA 3DI0A 5E70A 1Q8AA 3W00A 1TTIA 1V03A 3GIQA 3ORWA 1A53A 3B04A 5A6BA 3HA1A 1ZGDA 3ITOA 2OQHA 3MVTA 4RNJA 2I5GA 3VIIA 5CGMA 4L1XA 2HPIA 4DJDA 1A47A 2WPBA 5CC7A 1QASA 1UC4A 5GPRA 4BR1A 4RL3A 4UXDA 3F03K 2VNCA 3B8WA 1FWEC 1CXHA 3KDOA 4RK8A 4R3UA 2GLKA 1G4EA 5F2GA 5H8MA 3Q58A 1WDRA 3BW3A 1RQHA 3BAJA 2WO5A 2RH9A 3FVDA 4F8XA 3QQ0A 3VKBA 4UC5A 3WD4A 3VIKA 1W17A 1NDYA 2QAFA 3AO0A 5IBXC 2BY3A 1QNOA 1SO3A 4O19A 3WJWA 2NWRA 4MUZA 1RCXB 1VJZA 2GL5A 3MTWA 3OVPA 3QPEA 2XVKA 3QVQA 4NXKA 2CZFA 1UD8A 1MZHA 1AVAA 4NKCA 3LXCA 4BI7A 5G1MA 3AYRA 4GJ1A 3WJSA 2RFGA 3GR4A 5TD4A 4P8WA 3WK2A 1KKOA 5CPQA 1J0HA 3K30A 1RCOB 4C6QA 1BSIA 4K37A 4ZSTA 5LKYA 3H22A 3O6YX 2F9RA 2XM1A 1AMYA 1ONXA 1V0NA 3RILA 4H00A 3P61A 4IHCA 1QWGA 1DL3A 4JFSA 4EF9A 3O63A 3AS2A 3IJ8A 1DWHM 4NZ5A 3I3BA 1BXBA 4E2VA 3A12A 2X7VA 3TCSA 3CTLA 3W24A 3WLMA 4H8UA 2YL9A 3TN5A 1TE6A 2V2HA 4GYPC 2RDUA 2C8NA 5KMYA 5CPTA 1TVPA 3L65A 1U83A 2YXOA 4IX0A 4IQEA 3S0CA 2QV5A 1LT8A 5IRPA 1JPKA 3W53A 4MNMA 1LOLA 3L2MA 1NFBA 7PTDA 3LTSA 3PZGA 3GTNA 4WVXA 3VNYA 4LS2A 3NO5A 1SZNA 3GTHA 4WOQA 1RQEA 1BVZA 4LWWA 4B5XA 1D3GA 3WNOA 1IWPA 3AUJA 4QG6A 3KTCA 2C1HA 1BFNA 1GVRA 4Q8WA 3N6HA 1VBHA 3T0AA 3WH8A 5K9DA 3T0TA 4Z2GA 1XLFA 1HP5A 4HU8A 1XL9A 4E2OA 1W5QA 2TODA 5J5RA 1SJBA 5U7SA 1XDJA 1HJSA 3EOOA 3BCFA 3L2LA 4JTIA 1O5KA 4HHLA 4NHVA 4WD0A 1G5AA 2BS9A 1UD2A 2PI6A 4GIRA 2F6KA 1X96A 2PDBA 4NRRA 1CXLA 3C4UA 5XIAA 2WJFA 4G1NA 5KZ6A 4RV8A 4DZIA 4LF2A 3R2GA 1VYSX 4A3UA 2J66A 2ZRZA 2V63A 1MRAA 2VFHA 3EXSA 1WAWA 1UPPA 3QH2A 4J40A 3UWQA 3GC4A 3MUAA 3P93A 4JTSA 1E56A 3ZWSA 1T0OA 3CHDA 2HWGA 3PC0A 3WG6A 3W1AA 3EOEA 1X7IA 3BZGA 3TTYA 1PAMA 3QC3A 3UG5A 3MDWA 3GNXA 1C9WA 5HAOA 1RV8A 3S9YA 3CWOX 2RDWA 3YPIA 2QJGA 1DEDA 1T41A 3S6TA 1K4GA 1BF2A 2QV4A 3EX4A 1VJIA 2WVSA 3FNDA 1AD4A 2JF6A 1VRXA 1RHCA 1E6ZA 4ZB2A 4GXPA 4JOMA 2QPUA 5A94A 3VXGA 4CN4A 2V3DA 3QLLA 1WA3A 4JCMA 4MJZA 3A3HA 1OX6A 3OPSA 5EYWA 4IP4A 2OKOA 1DWJM 3CAKA 3UCDA 3VO0A 3O16A 2AGTA 3MI3A 2ATMA 1XHGA 2AOSA 2HXTA 1E6NA 2VC7A 1D9EA 4XKYA 4XO6A 2FZBA 1R87A 2VHLA 3E0VA 3PZQA 2OLSA 3S83A 1MDLA 2ZRUA 3LRLA 3V4BA 2J6VA 1I1WA 3RXZA 3BICA 3B9DA 2XWEA 4HOWA 3GE7A 1WAUA 4F79A 1J11A 4N0RA 3GVRA 1NDZA 3U2EA 4U4MA 4B9ZA 3CAQA 5F4SA 4UTWA 1B3VA 5KINA 1GNXA 3WLLA 4XKMA 4YL2A 4BI6A 3OJGA 4I5RA 1G94A 2B7QA 3GBEA 3LGGA 4LYPA 3U7BA 1O5XA 2OZ8A 3AZSA 2FPVA 2ZXBA 1FHUA 1BAGA 3TC3A 4K8HA 1KR0A 4EXBA 1UIOA 4Z1YA 3HV8A 3DC8A 1YDOA 2VZSA 3RPMA 2PZ0A 1XD1A 3SN1A 3TR9A 2TYSA 3O7UA 3I68A 2J62A 1B4EA 3VINA 5CPNA 6XIMA 4TX9A 3VZYA 1NIUA 1IQ8A 4FXFA 4JTJA 4GQRA 4N6EA 2D20A 2YL6A 3PZVA 3SY8A 5CG0A 3M5XA 1TVLA 1A80A 1BVWA 3UXDA 4PUDA 5BXRA 1CT5A 4C6CA 3UYIA 1QK0A 3ITLA 2VP8A 3PK7A 3HGRA 1OC7A 4S3GA 5HJYA 1XFBA 1LYXA 2FJKA 3W7KA 1OHLA 4F40A 4FLSA 3WQGA 4Q3MA 4BQ2A 3WLOA 4X22A 5I3GA 4XK2A 2NSXA 3OTRA 3W07A 1EYEA 2IMRA 4J2MA 3RIKA 3V7PA 4R85A 1G4TA 1RZMA 4JZ5A 4PCTA 2ZRYA 2RGLA 3ARVA 3KBNA 2C18A 2BZNA 4IMCA 4IL2A 4XBSA 1DQXA 1PB0A 2OOGA 3B06A 4AWUA 3O8AA 3BAXA 2DIJA 3B0XA 1M1BA 3E2VA 1XX1A 4TX8A 3RFAA 3T07A 2DW6A 4H9MA 5AYYA 1AQ0A 2ADAA 4AD1A 2XIIA 5DY3A 4BWLA 1D8CA 4HMEA 3NPVA 4KRTA 3UZJA 4MZYA 3DHPA 2DH2A 1UWQA 2V0TA 1PX8A 1UMYA 4Y9AA 1HJVA 4AF0B 1KBBA 3AIRA 2YB4A 3GHTA 3KCJA 4JY9A 4H9YA 2INZA 5D32A 4JD4A 1RLCL 3BPWA 2UBPC 3QM3A 1XUZA 3FAWA 5C9XA 3NYZA 3FEMA 4ZQRA 5CG7A 2HS8A 4B5SA 4WQ6A 2XM2A 3GTIA 3MHUA 2ZBTA 3A22A 1A0DA 2UY2A 3RU8X 3BLDA 5KITA 5F2MA 4JQ1A 1R9YA 1E9LA 3T44A 3R0KA 2GGEA 4LAMA 4ZO6A 3VM7A 3PBVA 3W7NA 5LNWA 1TWZA 3W1TA 4U31A 3MW7A 1J6PA 1Q3NA 2E09A 4MY1A 3UNTA 3W7OA 2PU0A 4DJDC 3CO4A 1TQJA 3DGRA 1XLIA 3R12A 2V67A 4LVAA 3MSRA 4I90A 4IXHA 1JPMA 3INPA 1QWKA 1QDSA 1ZBWA 3SGUA 1EP2A 2WBKA 3ALGA 1L6YA 1EDTA 4FAMA 1EA9C 4NZJA 4D2JA 1SYTA 2BB0A 4XG1A 5FJRA 3RPTA 6ENLA 3LX9A 1ICQA 4YHGA 1S39A 1JI1A 3IIVA 1XYZA 3KM8A 4POCA 4MMWA 4GK8A 1LG2A 1YBQB 3B40A 3J7HA 1KA9F 3R0UA 4FX6M 5PTDA 3NZQA 5D33A 4XZWA 3WEOA 1PDZA 4D6CA 4DLMA 7TIMA 3HPAA 5LHFA 5JBDA 5C7HA 1N8WA 1OWQA 4UNIA 3R11A 2NV1A 3LCIA 3Q67A 1W5OA 4D6JA 2VCBA 3ZT6A 2YCIX 4ZQOA 5FF7A 2WHKA 1S5NA 3SCWA 4F9DA 5FEXA 4JX6A 4GVFA 1CWYA 4AD0A 3T0CA 1KM4A 1BHGA 4PC8A 3B8UA 1VYRA 3NPXA 3SCVA 2JKPA 1J18A 1C29A 4EXAA 1IZJA 4N4PA 3AMCA 3AIEA 1W1B1 3DFHA 1XLEA 4NAFA 4OBTA 1GEHA 4Q6JA 1K9FA 3VIJA 1RY0A 2NLYA 4U33A 1XRTA 4GJJA 3W1MA 4MYAA 4HPGA 2FQIA 3W1PA 2YJQA 4F4RA 1ZCOA 3TW6A 2BODX 4MG4A 1P6WA 1L2UA 2CXEA 3GDKA 1HKWA 3LCXA 5BROA 3WF4A 3BV7A 3KP0A 4BEQA 1JZ4A 1H0IA 3G0UA 1Q4WA 2CW6A 1OCJA 2WLZA 4DZ5A 1UZHA 2WNWA 2A7PA 1OGBA 1Q6LA 2YXXA 1R2RA 3QFWA 3R43A 4TO8A 2QIIA 3LTYA 5JU6A 5EL1A 3ZJ8A 2WMGA 3R13A 2BHYA 3CZ8A 1W2PA 3FA5A 3UPBA 3QC0A 1XICA 3NR0A 3WLRA 1BXNA 2EPKX 3OZOA 1LL7A 3NQFA 3VGGA 3G77A 4CVUA 4KH2A 4XBJA 1R3QA 4KFOA 4DAFA 4Z0SA 1R46A 2DVTA 4RE0A 4MUPA 2X2YA 2PU1A 1VD6A 2HV5A 3UY8A 2E40A 3KBWA 2VELA 1BWVA 4KIEA 4OOZA 3WF2A 4JEJA 3W01A 4GX9A 4M56A 3E1F1 3KW3A 4IPJA 4CD7A 1AH0A 2ZTKA 3H21A 4KW2A 4GIYA 3S4TA 4FX7A 2VJXA 1GVFA 3CUFA 4YJ5A 4XKYB 3VDAA 1YDVA 4WX2A 3O06A 2BG5A 4DHGA 1HJQA 3AHTA 2BV9A 3G5EA 3MWAA 4HZ8A 3TN4A 3NXLA 4WSJA 3F2DA 4XQ6A 3QV6A 1LLZA 4YVVA 3WMCA 3DESA 1XSJA 2CXGA 1ADOA 3S8HA 3CUXA 3LGEA 3NQDA 1M6JA 1I1XA 1P1MA 4XZNX 4MNKA 1XIHA 3CZGA 1DQUA 4PN2A 3PJUA 3AXHA 4AY8A 1EHAA 4M6VA 2Z1KA 3WENA 5AB3A 4NL1A 1VF8A 1UD6A 1DPMA 1RY8A 2XIQA 1JDEA 4LUTA 1OB0A 1D7FA 4MKNA 2DORA 3OQ8A 1KCKA 3CIVA 3EMCA 4NU7A 1OCNA 4AIEA 1E6SM 1LLWA 2PDCA 1W3JA 1TTPA 4HNVA 1DVJA 2RJHA 4D1JA 3PNUA 1F73A 4LALA 1IR1A 2WYSA 2W62A 2E8YA 5FF3A 4Q6XA 1KRBC 2WKLA 1TV2A 3U2OA 4FNQA 1PZ3A 2CKRA 4DF1A 2ACQA 5E9AA 4O57A 3CC1A 2NQ9A 4ILSA 3CNYA 4QNEA 1Z69A 2YW3A 3QHNA 1W8SA 4UOZA 4UTWC 2Q8XA 4LUIA 1GJUA 1V7YA 1P0KA 1Q6QA 1UH4A 2VX4A 1UP3A 5DANA 4NG3A 1OX4A 3RO8A 1VBGA 1K7FA 5CAKA 4NNBA 4ZO7A 4H7VA 3MDUA 2PEVA 4EK7A 1SMDA 3VNJA 3PHAA 1WDQA 1MQRA 2FB2A 1MRQA 2CFFA 3HO8A 1UIPA 1AUSL 5AFDA 1FDZA 4ES4A 1OF6A 3NFUA 4TMCA 5IHSA 1MO0A 1A5KC 3SUWA 3W1NA 1RJQA 1KBIA 1CNVA 1YNQA 2WMKA 4DJFD 4GYFA 3I7RA 4C7DA 1T8XA 2G95A 4US6A 2HNHA 3C0QA 3MMUA 4GY7A 1TCDA 1VS1A 4D71A 1LWHA 3A4WA 5XIMA 4IF2A 1MWOA 3W82A 4WDUA 4IGSA 4PR4A 1GYMA 5A2AA 4GZJA 3QXBA 4JTFA 3W9ZA 4HK6A 1KD0A 4JTAA 3CASA 2X42A 2G8ZA 3ATZA 3LZ3A 3OBKA 3WQ5A 3VD3A 2PDIA 3CQKA 1DHPA 4QBXA 5CCZA 2TMDA 2XZ9A 3G24A 4K2SA 4NYYA 4KF1A 2UV8G 4JN6A 1VEOA 1BYBA 2IKHA 4QEHA 3SUVA 2GVJA 3P7YA 1BGGA 3IIPA 5HNNA 3IAPA 1M01A 3VGFA 3K13A 2BXZA 3GR8A 4YXGA 2V5CA 4GO9A 4H9VA 5CPOA 4BWLC 1B3OA 1NP0A 4NX0A 1C91A 3BCDA 4W88A 4H3DA 2DT1A 5FI8A 4QJ3B 1ZP4A 3HFTA 5A95A 3B8VA 4DWSD 2VD9A 3LN3A 3QQWA 4CN1A 3W2UA 1W3LA 4M19A 3TJLA 4AZBA 2NQLA 2PDYA 2W79A 2YGYA 3TXZA 3VCRA 1TX0A 1I60A 1IYXA 3QTGA 1ZJIA 4XUYA 2BHUA 3PZNA 1I2NA 4QDWA 4UQCA 1FCUA 1HX0A 2CC0A 2Z1SA 1SPQA 2Q8ZA 3VGBA 3KVMA 3S2CA 4ACYA 4ATWA 4Q4PA 1XRVA 3QMRA 8CGTA 4DPPA 2G4FA 3HG5A 2CNCA 1TCMA 3WKZA 4HMNA 1XIDA 3P8IA 3LRKA 5BXSA 4QGCA 5ENLA 4GE8A 4J5NA 1JPIA 4LCQA 1JD7A 5CZJA 3WCZA 1JZ2A 4R9OA 1PWMA 3PM6A 4GACA 1XW8A 2A7NA 4IMFA 3TQKA 3GD6A 2PDQA 1OFEA 4O16A 1GTEA 4O18A 1JJKA 1FFRA 3I10A 2FTPA 1GORA 1O66A 4NAFB 4GQQA 4GISA 3LCLA 1YEYA 1MNZA 4UFJA 2QZRA 3PR2A 2W27A 2ABAA 2YA2A 1JRCA 2OQYA 3O0KA 1H7NA 4RXFA 2BWGA 2J7BA 1WX0A 1J10A 3FVMA 4W89A 1DP0A 1CLXA 2E1DA 1V3MA 1W3IA 3WMSA 1GOOA 4FB7A 1KM2A 2D2JA 3HU7A 3L23A 1FWIC 1EP1A 2Z26A 3W02A 5FF4A 4B3KA 1R9XA 4O0KA 3HB9A 1AH3A 2CYGA 3ITXA 5BW6A 2UY5A 3T8QA 2E7FA 3H7UA 5M1TA 1BD0A 1GEQA 4Q8PA 2R1MA 2FMNA 1KM0A 5I23A 3SJ3A 2I17A 3GZ3A 1SM9A 1XGDA 2ZRXA 4HP5A 1UWTA 3E5BA 3VKAA 4WLCA 4GQBA 3LDVA 5FEPA 4AY1A 3S5OA 1H5YA 3RCNA 1VEPA 2F61A 3ZOAA 3ARWA 3CV7A 5HINA 3VNZA 2ZUNA 4J1OA 3H2MA 4PMXA 4S3CA 2YR1A 1PV8A 5F1VA 3KRUA 4BQ3A 3AU6A 1JDDA 1TR9A 1B30A 2PD9A 1KBJA 3BK0A 4M6PA 4QROA 2VCAA 1EOMA 4NI3A 3VM5A 1S5TA 4QX4A 3WD1A 4Q8TA 4NNAA 4RDVA 1TJ1A 3W1LA 1V3KA 1XDMA 4DYEA 1HJWA 1O1ZA 2YCJA 4BY3A 5EBUA 1JCNA 3XISA 1CXFA 4H8VA 4N6FA 3I4EA 2PWDA 2VUYA 1A5CA 3TP4A 1F2JA 3MUZ1 1TG7A 1J12A 2WNQA 3U9IA 3SCNA 4AX7A 3H4GA 3N15A 2GSEA 4QLLA 4KFPA 4TVUA 5CJMA 4O12A 4JYFA 2V2DA 4MY8A 4W93A 1OFOA 4DZHA 2EJ1A 3M0KA 4LUTB 1W54A 2CBVA 4ZZ9A 4XZMX 1HQTA 3D0CA 4EPBC 4AQLA 4LVGA 1JF5A 1ADSA 4PULA 2Q02A 1UWSA 5T9CE 2Z2UA 2WHJA 4ZMGA 2WMFA 3L0GA 2BVDA 4MGGA 3DEQA 4WKHA 3VZZA 4HN4A 2VZOA 1CB2A 1W9UA 1UR2A 5JH2A 2YW4A 5IDZA 3AIUA 6TAAA 3S2JA 3ENLA 1HGWA 3W2KA 2C0AA 3WNPA 4XAGA 3V5OA 3BLFA 4HA1A 1RH9A 3SQSA 1W1TA 4BS0A 1WBJA 2IXVA 2VUNA 4ORIA 4IMGA 3HPFA 1EJVC 1KRCC 2VR5A 1OX4B 2WXDM 3IANA 2IKIA 1JIBA 1B3YA 3CIWA 1WBHA 1G0CA 1JCXA 2NQZA 1AJZA 4AX6A 3QZEA 3SSZA 1H11A 2YFOA 2X1IA 4TUFA 1AW1A 2E9BA 3W81A 3PZ9A 4LRTA 1UQYA 2E5DA 3DG7A 3S2MA 1EHNA 1L2QA 3CZLA 1UZ4A 3TAOA 1YW1A 2PSNA 1NWSA 1TV3A 3LTPA 1A3WA 4DUWA 4M8UA 6REQB 2I16A 2DGAA 4PTDA 4WF7A 1P5BA 4RCXA 4CU7A 3EMZA 1OBAA 5JUVA 1M04A 3GDRA 4UUIA 4YTQA 3MQTA 4YWIA 4MYXA 3BMWA 4G1KA 1AD1A 5ABEA 3AC0A 1E55A 4GGHA 3TR2A 4H9UA 3WH7A 2WMHA 3IK2A 1XCFA 3PNZA 1H1ZA 3E74A 5ABTA 4EF8A 3U3HA 1JNEA 5BOFA 5A69A 3KCLA 5FOOA 4DJEC 1LUCB 1UR0A 2Z1VA 1TPDA 3COTA 2FVLA 5L9FA 3ZT7A 4E4PA 4FEZA 1D8WA 3WLQA 3GFZA 3FAXA 4IIEA 1BEUA 3S9IA 4GGBA 4UOQA 1ZP3A 3UVAA 1TMLA 2H8XA 5G2HA 2GOKA 2Z6JA 2BY1A 2ZX9A 2POZA 2BOEX 5CGTA 5G1YA 4PTNA 3LZ5A 4B5NA 1OCQA 2R82A 2P10A 2YX0A 4JTGA 3V35A 3ABRA 1TZ7A 3H2OA 4PB5A 1AG1O 4HCHA 3QYQA 4XV0A 1F3TA 3HQPA 3CHVA 2ZDSA 3WQVA 5FAGA 1E40A 3NEVA 4Z1AA 3CL8A 5CEWA 5I3JA 5GVJA 5C9WA 2YDAA 3KTSA 1POJA 2PC8A 2ISDA 3LHYA 1QI3A 1UD3A 3MV11 4QTGA 1E72M 2VEIA 2NVAA 2QT3A 4JYEA 4Z2KA 3QQ1A 2HVMA 4RW3A 1BSLA 2AKZA 1J0ZA 1FOBA 1MZRA 4NRSA 1E4MM 1Z89A 3FFSA 3KBMA 2ZXQA 1IEIA 3OVQA 3VOJA 5GNYA 2IUZA 1NU5A 5F1UA 1XWYA 1PCWA 3TTEA 2PZNA 1KC7A 2QJHA 5I3KA 2X1TA 2ZWZA 3WMLA 7REQB 4KGJA 3WSUA 3FA3A 4GOAA 1MEIA 2QUVA 3ABXA 4UFKA 4IM4A 1C92A 3NIYA 4JX5A 2Y70A 1BRLA 2J7HA 4GINA 4HTBA 3MKVA 3W27A 4K3ZA 2GFTA 1SQ7A 1PE1A 4CKQA 2BNJA 4G5DA 4UQAA 3VKDA 2ZVIA 3UY7A 4GQGA 4YWSA 1QI5A 1SO6A 3ANYA 3P14A 2DQWA 4JDYA 3MPGA 1XR2A 1XLHA 1DWAM 2V8ZA 1A5NC 2QULA 3P5YA 3G1RA 5CZKA 3HQNA 4C6IA 1OK4A 1IR2A 2IQDA 4RE3A 2O9RA 4ZBCA 1EJUC 4Q7BA 5AN7A 3W2NA 1SFSA 1TWIA 1X8CA 2JGQA 3T0DA 2FPTA 5K7JA 3P62A 5LHEA 1B0IA 1LG1A 1LRQA 3WLNA 4JN7A 3P67A 5DRIA 4HB7A 1S5VA 4JFUA 3GLCA 1UR1A 4HNOA 3UZXA 3AS1A 5F4XA 2DPEA 3SFKA 2WKJA 3KUMA 3NJ3A 4B4FA 2Y88A 3ITYA 1PTDA 3GDLA 4MZ1A 4ZGYA 2FJUB 1GJWA 3U2ZA 4I9AA 2OYKA 2VDGA 1EPVA 3CYJA 2A7RA 5AZ0A 2AGKA 1W8GA 2YDRA 1MW3A 3B9EA 4ZO9A 4HU0A 4J7RA 4Z1CA 3OZMA 2QIWA 1AL8A 1GZJA 1EUAA 1IHIA 3PFRA 2WBGA 1GQIA 3IJLA 1B2YA 2QCHA 2BGQA 1WUEA 3N04A 3PBMA 5I79A 2ZE0A 4A2SA 3C5QA 4JTHA 1F8IA 1K8YA 4E6MA 4IWWA 2XN0A 3TROA 4UQEA 3CMGA 2Z0IA 4AZ6A 1V02E 2CHOA 3F5JA 2PTXA 3GNRA 1W1A1 4B3LA 5ECVA 1S2TA 3VOCA 2WV8A 3BMXA 3ARUA 4XO7A 5DXXA 1AA1B 3HN3A 1FCQA 1HUVA 4L61A 4W7UA 5EB8A 3RLHA 3OHIA 3QV7A 3CPUA 3GXFA 4AD3A 5AY7A 3C86A 1PZ0A 3K2GA 3QLDA 1TR1A 3LY0A 1A5SA 5HWJA 5LZLA 3W71A 4IUOA 2EF9A 2VEFA 4I3GA 3MUY1 1M7PA 1NFGA 2ALRA 2UZ9A 4UZUA 1Q4NX 1W5MA 3GW0A 3KOWA 5JQ9A 3ITCA 1SO4A 1LM1A 3WQ4A 2PDXA 1XBVA 4WGXA 1PHQA 4HTYA 3BLKA 5FESA 2VWSA 4O8AA 4J3VA 1EQPA 1TQXA 1W1PA 4C7FA 3D3FA 5AYIA 4JIQA 3V0SA 3CZKA 4TMBA 4LC8A 2V2CA 3HF3A 4Q8MA 4W4QA 3U2CA 3MO7A 1VAHA 2JEQA 3DCPA 5FIPA 1ZNNA 4V1YA 4BJHA 1HJUA 3TC6A 5C2CA 1PKNA 1KFWA 3MUXA 5BNKA 1DORA 1BTMA 1DV7A 3EEGA 3WDQA 1K6AA 2DJLA 4UTMA 5D04C 1XLDA 3T1GA 4FK9A 4CNUA 2EPOA 2GGGA 3AROA 3LENA 1OYBA 1SMAA 3TSDA 3WELA 3ABSA 3L67A 2VRJA 1F07A 1B9BA 3EDFA 1RR2A 2FGZA 4PMRA 5FJPA 4US5A 2C19A 1OFDA 1WP6A 3WBYA 5HPCA 1J2WA 3JZUA 1A5OC 3SFWA 3CB3A 4JKKA 3V3WA 1P7TB 5TF0A 3VOHA 1LBLA 2XISA 1M68A 1FWFC 2OEJA 4C60A 4KRZA 3E02A 4UQ9A 2FTWA 2GYIA 3H2CA 2DZAA 4Q4RA 1TWDA 3FXYA 4GUGA 2EHHA 1W3KA 3ATYA 4CGTA 3GM8A 4GIAA 3DFSA 5I7GA 1VENA 4QEEA 2H90A 2WMJA 1TZZA 4CEUC 3GVVA 1VBUA 3KBJA 1BGAA 2J75A 3QOKA 4TU1A 2VFEA 4DF0A 1F3EA 1Q7MA 3BSMA 3UWZA 3N2TA 2WCGA 3C61A 2OYLA 4OZOA 3TIMA 4DXVA 4E8DA 4PFMA 4IX2A 3WNLA 3H24A 4RV3A 4URIA 4DWSA 5T8GA 4M80A 4QE4A 5A8NA 4AC7C 1DJQA 1EF3A 5BU9A 1KFCA 4PTVA 4RXGA 5REQA 3UWEA 3SGGA 5HQEA 3H70A 4LB4A 1O68A 3T42A 5DCBA 4BI5A 5CLWA 3QHOA 4XD3A 3WUBA 1H7PA 4XD6A 2B7NA 1CENA 4DBEA 7ODCA 2ALDA 4MB4A 3VD5A 1Q6FA 3GH5A 2DSKA 1FBAA 2R24A 4RPQA 3WK3A 3NZRA 1AZ2A 3HIJA 4FXJA 3USBA 1Y5VA 1J6OA 3S5SA 3XINA 3EYPA 4G56A 3M1ZA 2EEXA 2PA6A 3TOPA 1GJPA 4OHQA 2J79A 4OQVA 3LXBA 1OD8A 2BFGA 4S3DA 3ZLFA 2TPSA 1L6GA 1ZJHA 1H62A 3WQWA 5CJ5A 1RA0A 3M46A 1QBAA 2W0UA 1RP8A 4AB4A 1TPB1 2P50A 2EKGA 3CT7A 1D7KA 4GG9A 4BK9A 4UFIA 5J04A 1OIMA 4K1GA 1A5UA 3RLVA 1A3HA 9XIAA 3WH9A 1S2VA 2BOGX 3FW6A 1ITQA 4HCLA 5BOOA 1BRLB 1SFJA 4GHRA 1J4EA 3W1QA 4JTQA 4FZIA 2VOTA 2Q71A 4HYVA 1CX9A 5D4YA 4ZEPA 5G2WA 2ISFA 2NUYA 4GI8A 1V8EA 1XC6A 2ZZ4A 3B9NA 3JS3A 1OADA 2A5HA 1VFUA 4LY4A 1KGWA 4CVWA 2JIWA 4ZQMA 2PDMA 3OOQA 3TH6A 2C16A 4F2UA 3C2FA 3SUTA 4DNMA 4M3PA 3SEPA 3KOFA 2C6QA 3QFEA 1TPUA 4PUKA 4X2PA 4GMEA 3GXPA 3CV6A 2XSBA 1WV2A 1DE6A 3LU2A 4BCEA 3VC6A 1Q7QA 4O28A 1A5LC 4JTKA 2D2OA 4WIWA 1GZ1A 1QOPA 5E1QA 1UKOA 3EWDA 4HK5A 3GG7A 3POHA 4KBXA 4YTSA 4AU0A 4RNFA 2O56A 1K9TA 4LAKA 3KP1A 4OVXA 4JQ3A 3MMTA 3KL0A 3THAA 1YIXA 4PCNA 2CLLA 4DJDD 1KTNA 4GA8A 1GOWA 1IXQA 3VE7A 1WO2A 2VX5A 3OZYA 1DHKA 5D9NA 1GHRA 1JUEA 4PUNA 5GJMA 4BFAA 4CN6A 4LRSA 4AHOA 4KPLA 1A4MA 2P53A 5CSUA 3VOFA 4DF2A 3ZWTA 3TZFA 3ZJ7A 3L7RA 1JCMP 3QF0A 5DBUA 3L4UA 3IV3A 5ABFA 2HZGA 3WBAA 1H1YA 1B5TA 4C6FA 2ODOA 3NYDA 1UH2A 5CBBA 4C1NA 3KX6A 1J0IA 3FKKA 4L4LA 3FHQA 3UESA 1OFRA 1AW5A 4L4MA 3VIFA 1DWFM 3QV8A 4DM1A 4DYJA 1TIMA 4PB3A 5E9XA 3NM3A 3BL3A 4P2VA 3KOXA 5CLTA 4H6RA 3UBPC 3AHZA 4JTUA 2RDTA 4H1ZA 1Q6DA 4PUMA 3M6DA 4ZL1A 1LL4A 3UR7A 5AC7A 4E3TA 1KW1A 3P74A 4ZXLA 3OBEA 1E43A 3DKJA 2DFAA 3TKFA 3MKKA 2GWGA 1ISZA 3FYYA 5I78A 3VNMA 4G8TA 2E6YA 2GJLA 4S38A 3ZR4A 1VH7A 3MI2A 1OD0A 2ATSA 5A1AA 4NIRA 4YVXA 4TR9A 3EZ4A 4AEOA 3A13A 3G1YA 1VGAA 1M5WA 4ATLA 3BZJA 4B16A 4PUWA 5CBIA 5D2VA 1OC5A 2O7SA 3S1UA 1S2AA 3QGVA 3NGJA 2VRKA 3WDJA 4RDWA 2NZLA 3U4AA 3SQMA 4LFYA 3NZGA 1TUFA 3GHRA 2CZ5A 3NSNA 2Y85A 5FA5A 1WZAA 4PEEA 3C0SA 4ACZA 1CIUA 2WVUA 5AHFA 3AHYA 1O7AA 1QCWA 1EZWA 3L0NA 1K02A 2V5LA 1CBGA 1X39A 5H6HA 5A6KA 1XYLA 3N17A 2QJIA 1QPOA 4WKFA 4ZTXA 1VCVA 1ZHAA 1YKWA 3LERA 4R88A 1V6WA 2EXOA 3T2QA 4HHPA 9RUBA 3QTPA 4QSFA 2QS8A 2D22A 1CGVA 1XLKA 3A3XA 2VC5A 4IFOA 3VIGA 2GVGA 2OSWA 3SCSA 2XUCA 2V9DA 5LA0A 1POKA 2XN2A 5KZEA 5HATA 1KQZA 1E0VA 1VFTA 2FZ9A 5E6ZA 4AYSA 3H23A 2OR2A 2VEMA 2V81A 5I6SA 5K3VA 3WQ6A 4DYKA 5CJNA 3NPUA 2UWFA 2X30A 4K1WA 1EEPA 1B1YA 2R9RA 3ZYZA 3HURA 1ZL1A 3DAQA 4O10A 3O6AA 3F7JA 4ERIA 5FL0A 5HMFA 1B90A 2ZQ0A 4Q8VA 3W7DA 4DB7A 3SBFA 4ZO8A 1WZKA 1W1VA 3MSYA 2P76A 1JDFA 1QW9A 3FCPA 1W1YA 5LIKX 2FB3A 1RQBA 1EGVA 4ADSA 3M0IA 3VTRA 3VU2A 3N3TA 3NEHA 1VBRA 4PODA 2WB5A 3LSCA 4DWSB 3KWXA 3V0UA 4LQ1A 4E2DA 4HNNA 4C6BA 3TONA 2W63A 3HTWA 2UY3A 3TLLA 3MB9A 5REQB 2DZBA 2OGYA 1TJ2A 3ECQA 4N2YA 4XX6A 4TQTA 5CC3A 2YKKA 3PUEA 3GRIA 3CHCA 3FLUA 4EAYA 3EKLA 3VCNA 3BC9A 4C91A 2QCGA 2WSQA 1W9VA 1G7UA 2BGNE 3CUHA 4CNNA 1R38A 3ARRA 3HPZA 3CJPA 4IIDA 4X60A 1PDYA 1QPRA 4AC1X 2XTKA 1HGYA 1XYBA 5HULA 4KCVA 3GKAA 5BOEA 3NQ6A 4D6HA 1EIBA 4Z2HA 2F6UA 1HNYA 1AJ0A 1BQGA 2J8GA 1XP3A 4AZ5A 4B5VA 4Y7EA 1R3WA 3EBVA 3WNMA 2C0HA 4QDMA 5F2LA 5JBEA 4DWSC 1KNWA 2GJRA 5I06A 5LGXA 1TV4A 4QR6A 3IJ9A 2PWGA 4R53A 3WDRA 4EPKA 4QG8A 4Z1BA 4GLEA 1EC8A 1GKRA 3Q45A 2E77A 3W25A 3Q4DA 2W6RA 4XBKA 4JPGA 1JCLA 1ECEA 3OLEA 1V02A 1FKXA 2PWUA 1H61A 2D24A 4I6VA 2QDGA 5GQBA 3BLOA 3BDKA 3QHMA 1W3NA 4M24A 4FO4A 4IUGA 3AIWA 1G9HA 3UNDA 1DXEA 2Z4GA 2D0FA 4GKTA 1K8XA 3EWZA 1DKWA 1J0KA 2FFCA 4XTDA 1GKPA 1XXXA 2CKSA 3BO9A 1Q6OA 1MEWA 2PLCA 3W38A 1KKRA 2MANA 4WDTA 5DQPA 4IJCA 4PBEA 4HU4A 3KRSA 3VYLA 5AYBA 3F4VA 3PZUA 3V0TA 2WOQA 1FTXA 4QNWA 3M47A 5JBFA 4O1EA 2BVWA 2F7FA 5K4XA 1JGMA 4KMQA 4U10A 2Q6ZA 4XB3A 5DY2A 1Q45A 1JFXA 2FLIA 5F2IA 3T05A 2L5HA 3LBCA 1TREA 2O9OA 2GDQA 2NW0A 4UFLA 3HPXA 3KOZA 1KBLA 2GJXB 4XUGA 2A1YA 1R2TA 4MF4A 3SZ8A 5EMLA 3NDOA 1VFLA 4I5UA 5EPDA 3ZVHA 2OT1A 2X1UA 2GQ8A 3USZA 1E5JA 3UXLA 3V5CA 2VFDA 1QNRA 4GIEA 2ZZ3A 3E96A 4HBKA 3F2BA 1OG6A 3MBFA 4LTSA 1FCBA 5HBFA 2F84A 4LU0A 1J9YA 1QNQA 3VKKA 1HW6A 1EB3A 5C5YA 4JYDA 1QO2A 1BG4A 1O1HA 2XFYA 4LPCA 4MB1A 4GD0A 3AQUA 3CT2A 1U30A 1ZTVA 2E0PA 4PMJA 5ABFB 4KETA 5FJTA 4F0HA 1ME7A 2PWVA 4UR9A 4OWGA 3OGVA 4C1NB 2J9YA 3WJYA 1A3XA 4ZQPA 2WCAA 4L9YA 2J25A 2C71A 1LQ0A 4DI8A 3NZPA 3EA2A 5A8OA 1EH9A 4M1BA 4AWEA 4S3BA 5GNXA 3DI1A 3PUOA 4MWAE 4TTUA 2FZ8A 2Y7FA 4O0ZA 1XQLA 2VFFA 1GPFA 3G1AA 3NQ8A 1GG1A 3AJXA 4M6UA 1Y5WA 2B31A 1OX5A 1OFQA 2PS2A 4OIFA 7ENLA 3EEZA 4ZOEA 4GNKB 3RYSA 4GXWA 1E9IA 4BF7A 3TTOA 1ONRA 4QFUA 1R3VA 3GQYA 1TSIA 2OLHA 3FYOA 4LUSA 4CNTA 2ZTJA 2BHZA 2J4GA 4WY0F 2F38A 3TYCA 1LBMA 3K8LA 1BPLB 2J7GA 3PP7A 4GKLA 3CLMA 2QDHA 4FLOA 5XINA 4IPLA 1FP8A 8TIMA 3TWAA 4YCOA 4ACZB 2VGGA 5JIPA 1QOQA 1ZRQA 3BQ5A 4LEFA 3OO2A 2CIPA 3ABQA 3RG6A 3I3DA 1ECQA 4AZGA 2ZZ6A 3S1VA 2W5FA 2XIJA 3CH0A 4NAEA 1Y65A 4ZA0A 2FHFA 2EO7A 4PMYA 2GDVA 2EQDA 4IMDA 4N9CA 3WQCA 1Z32X 4NVTA 2ISSA 3GC5A 1P48A 3SAZA 1XBYA 4XIAA 1G7VA 3OU8A 3NQ7A 3VDHA 4BHYA 4JTEA 5CC6A 4GABA 3VIMA 1REQA 3S6OA 3TYEA 3A64A 4XSLA 2HVOA 1GPWA 3ANVA 2D2HA 1MYRA 1TE1A 5DMMA 3DBNA 4L65A 5D03A 2I56A 2DIEA 3PAJA 3VMPA 3UF9A 1W0MA 2CEQA 1HN1A 4O4VA 3SIMA 4GYKA 4FIRA 3HM7A 1E1FA 3LMYA 1EUNA 3NOEA 1LZOA 2VMFA 2OQLA 1QW7A 1L8NA 3S5NA 2DSUA 4DUVA 2B0MA 1S5WA 3K1DA 3CL6A 2DZVA 1VPYA 2GUYA 2QUUA 3BMVA 1LF1A 4OOUA 4IP5A 3L5LA 4W8AA 4NT0A 3TMQA 4D6FA 3UWVA 3PPCA 1C93A 1XIMA 1JZ6A 2YCKX 1YNPA 1UH3A 1V4YA 2QEZA 4LNCA 3IIXA 3W76A 3LLDA 2BOFX 3VOIA 1BF6A 2CPUA 3C2YA 4GX8A 4HIBA 4QS6A 2VM8A 1PO9A 3ITVA 3GG0A 4W7WA 1EOKA 3R7MA 3MU7A 2W91A 1QNPA 3K4AA 3ZVIA 3UG4A 2HSAA 1TVNA 2J7EA 1WKDA 3POCA 2WZTA 3IJ7A 4B9YA 1E4LA 3O05A 4NJHA 4F3HA 2WMIB 4CD5A 2E6DA 4UMBA 1HF6A 2YSWA 5FKYA 4CD8A 2FYMA 4QAIA 1IIHA 3VVGA 4JTDA 1V3HA 4Y96A 1EL3A 1Z3NA 5AHIA 1EO7A 4M81A 4BA0A 4G2DA 3DG3A 4UTJA 4V15A 1QOXA 3APGA 1EWDA 2OZ0A 2WVTA 1JL8A 2HROA 4F0MA 4XAYA 3OVGA 1Q85A 3UW6A 5KETA 3IPWA 5DXYA 2X16A 3U6WA 2D69A 4Y9NA 2NV2A 2X1SA 1XIJA 3HGOA 1PTGA 4S3FA 3KLLA 3A5VA 1TJ0A 4PMZA 1UQZA 2PBGA 3FJ6A 5AECA 1F6KA 3N9SA 3KCOA 2R1LA 4ZSUA 3TFXA 1HFBA 4S1FA 4M0XA 4PTXA 1PBGA 1FWCC 2R8WA 1K03A 1A5BA 3S46A 3L5AA 5CGQA 2EPLX 3N9KA 4YYFA 4JGDA 1ICPA 2WSPA 3H26A 3GAYA 1UYQA 4NILA 2GSJA 3ONBA 4C6JA 3PBWA 3W7RA 3PBYA 3ZLGA 4N4QA 1ENUA 3UGVA 4EAMA 4ERAA 3CK5A 4YMZA 4DJED 7TAAA 4U28A 2J78A 5CXPA 1QT1A 3RN6A 2R6OA 2A79A 4AHPA 2HE5A 1KCXA 2DP3A 3AS0A 2PP0A 3AALA 4PBGA 3GB6A 4CCZA 4A3RA 6CGTA 1SJDA 4GZ7A 1NAL1 5DMLA 2NXHA 4JAWA 4KQNA 3H2FA 3LD5A 4WXYA 1JVNA 4H7ZA 1QRQA 4TV6A 4O54A 4DN1A 1MQQA 4XAPA 4MSSA 4FP1A 3STPA 4HNTA 1FWHC 4P61A 2HEJA 4QE1A 4UMCA 3NL3A 3ZVHB 4JKMA 1TTQA 2IPWA 3WLKX 3GXDA 4BQ5A 4HA3A 2A6NA 1BWKA 2WHMA 2A3HA 2PRHA 4YTTA 2QPXA 3WJXA 1QNSA 1SVDA 2REQA 3GDMA 4UOJA 4EKJA 3G1XA 2FGBA 3C0JA 1ME8A 4RDZA 2OOFA 3HV9A 1VCGA 2QMKA 2EGZA 3QW3A 3DYOA 4IQDA 3QOMA 3N2CA 4UNKA 4FNTA 3BSGA 4KEMA 5D9MA 1MMFA 5A2CA 2YL8A 1DYSA 4WSKA 4ZB0A 8RUCA 3GWQA 2DZWA 2XVPA 3P0XA 2HISA 4U3AA 4CCEA 2XN1A 1RUSA 4XIMA 3T2OA 4A8RA 1W2VA 2AL2A 5BRBA 2OCZA 3L4YA 3MJYA 3SQLA 4HSHA 4PUJA 2F8QA 1PYMA 2R1NA 2ZA1A 1F4AA 1BVNP 2DUAA 2ZFAA 1A4LA 3OQEA 3MY9A 1PCKA 1GTHA 2ZYFA 4Y8EA 1XIGA 1ICSA 3PZIA 3CUJA 5EA9A 2VTFA 3HZ3A 1MVYA 4MZ8A 1WKYA 5JH1A 2QVHA 4A6GA 4HVXA 2H9AA 3I3EA 1UZDA 1W5PA 3QY6A 1DXIA 3ZR5A 4S3AA 4GO8A 2D23A 1PX4A 2OTDA 1ISVA 1XIBA 3ANUA 5GJPA 3LI1A 5LNVA 1MW0A 5C71A 1XKYA 2Z00A 3SRKA 2QMJA 5CC5A 3O6DA 2NQJA 2FZDA 1UHVA 1MXGA 1H7WA 2E9MA 3IRSA 5IHRA 1TUXA 1XFCA 1I2RA 3W1RA 4AHQA 1NOFA 4IIGA 1H60A 3S2NA 4ZFMA 1TJPA 1LRTA 4A8LA 1GQKA 1A49A 2AQOA 3LCGA 2NQHA 4AXKA 3UD6A 3DFYA 1MW2A 4QQUA 1TYGA 3VOGA 4HPXA 4NZ3A 3SCUA 1OY0A 3MI6A 3O6CA 4JNYA 2GWNA 3BW2A 1VB9A 4Q8UA 1A5AA 1YE4A 3GXTA 1OK6A 2ZCGA 5D8ZA 3GVWA 3KZSA 4Z08A 4U3CA 4X9SA 4CQDA 2PWFA 3EX2A 2FIQA 1V6UA 4G7EA 2VURA 4UBPC 2YLLA 3F4NA 3UZ5A 3ARTA 3BW4A 1C8QA 1WPCA 3NVTA 1QHZA 1OVDA 3UJSA 4HGXA 4JTRA 3PB2A 1NJJA 1V3LA 4IGHA 2CLPA 1NTHA 1KXQA 1CI1A 4S39A 2PDWA 3H4XA 3W74A 2GQAA 3K5XA 2DV0A 2V30A 4MIMA 4Q4MA 4O52A 4DXKA 1NSJA 1K9DA 3M0JA 2E67A 3UPWA 1RAKA 5FF2A 1FWRA 2ZX6A 3LA4A 3KXQA 1L6FA 1I2QA 1PKMA 3TNOA 4WSHA 2VT0A 1XLCA 5IFPA 4AIUA 4N9DA 2DT0A 2XWDA 3UG3A 5CSSA 3T9PA 4NYUA 4DVOA 3C8NA 5IOBA 2NXIA 4B5WA 2XPKA 1GVYA 3FYPA 4LVFA 3EOUA 3UWUA 4IH3A 3UR2A 4JTCA 3DXIA 2XDFA 1E51A 4XZIA 3TA6A 1R30A 1UA3A 1HO1A 2F2HA 1M65A 3VAVA 3LCFA 3U5YA 3MC5A 2QGHA 4JQ4A 3LPFA 3RO6A 4FMVA 3B4YA 5BYWA 2AKMA 4XTIA 2XZ7A 5E0FA 4L9ZA 3WBWA 2C13A 3BUVA 2CCRA 2R1PA 2NQ5A 3WEZA 3CGTA 4LAZA 3M44A 2G3MA 4B3ZA 4H04A 1KM1A 4GZIA 5CZ0A 1OEPA 4KIRA 3OZPA 3UT0A 3BLLA 3H2AA 3WBXA 1M7XA 5I3HA 1N7KA 1FY6A 5DLCA 4PCFA 3FDGA 4UTFA 3UETA 5C7VA 4XISA 1LCOA 1OYAA 4JXCA 3VCCA 3VMNA 3G22A 3BAYA 2DQXA 4JIRA 4JHOA 4XVDA 3ZXWA 3HG3A 1GGOA 1JAEA 4Q8NA 1VHCA 3WN6A 1TTJA 1GQJA 4LOCA 2C1GA 4J2PA 1VLWA 1XCXA 4YTUA 2DVXA 4Y9MA 5KZDA 4R9XA 4MWAA 1JQXA 1OQFA 4TX6A 3RMJA 3THUA 1XIEA 3LPGA 5LGZA 4MADA 1AODA 1KWKA 3NAVA 1QNVA 3BJSA 4K38A 3TK7A 1V6TA 4O1CA 2C14A 4C1LA 4Q4QA 1XI3A 4P7RA 3M0HA 2OYMA 1CGUA 1T99A 3N2BA 1E0WA 1EGZA 5DO8A 2OPJA 1MQPA 3E0IA 3E5PA 1FH9A 1GUVA 1R3SA 1XGZA 2DW7A 4NI8A 3SCTA 3LSBA 1FXQA 4P8VA 5KZMA 1W6TA 4MDOA 4QE5A 5A8PA 1HKJA 2ZRWA 5I2UA 4IJRA 2ON3A 3AI0A 2FH6A 5MHBA 5A5WA 4CNSA 2J24A 1W3HA 4H2CA 2JBMA 4AG0A 1XV8A 3VUPA 2A6LA 3WNKA 1MFUA 3AMDA 5LIWX 1SFLA 2G3NA 4M7TA 1UWUA 2NVDA 4HMCA 2NV9A 1YQ2A 1KM5A 4IIFA 2GSHA 2GJPA 2WSKA 1QATA 2G4JA 2G96A 3BGGA 3DIPA 1CW2A 2I57A 4GH1A 3D5HA 1AH4A 1Z9AA 1RCQA 3MP3A 2GK1A 3EXRA 3N6JA 4UZSA 4UIOA 3LUTA 5H8PA 2X0YA 4LYRA 4M5PA 2XH2A 4Y90A 1B57A 1I2OA 3BAWA 3DHUA 1E71M 3PTMA 2FHCA 2HNEA 4EIVA 4I7VA 4LF1A 5HNUA 3H2EA 2PCEA 2GUBA 1IIGA 5FL1A 2CZEA 2B4GA 3W3OA 3S9ZA 3WD3A 2QCNA 4D9PA 3V16A 3DBPA 2A3LA 2PP3A 6PTDA 5I03A 2PBOA 3UR5A 3EAUA 4MPKA 1YXDA 1SW0A 1Z6KA 2A4AA 1XYCA 2O4MA 3TJ4A 3M0VA 1OABA 2AL2B 4PFHA 4ERGA 2IPGA 2NT0A 4Z17A 3GIPA 1RVKA 1Q6EA 4ZODA 1M03A 5D02A 5FJJA 4I9TA 3R0DA 3WH6A 1C8XA 2VFIA 4AVOA 1G4PA 2A3AA 4DEFA 1GT8A 1LRNA 1X8FA 4I7WA 4R27A 2RHGA 4MB5A 4HPJA 3MCNA 4LGXA 3TJIA 4GXMA 3E2SA 3VABA 5K9CA 3PZOA 1KFJA 4E8CA 3W7PA 2FZMA 4PB4A 3CPRA 1EZ2A 2TRSA 3KVJA 3CHEA 4MAVA 3IGUA 3ES7A 3CWNA 3EX3A 3PTKA 2I9UA 3DH7A 2VCCA 3BG9A 2QYGA 3T4CA 4EPEC 1FWAC 3M41A 1FWWA 2CLFA 3R5EA 2Z1XA 2QLYA 3FJLA 3SY1A 1QAPA 2PDLA 3SGZA 1H63A 2OT0A 1E70M 1OYCA 2VFGA 6ALDA 3C0LA 3O1NA 4PMDA 3TFCA 2P8CA 4ML9A 3O0FA 4WK9A 1HL2A 1EBGA 4LUYA 3B8DA 3WK1A 3M9YA 4M7SA 3TQPA 2Z24A 1ZJBA 2VZUA 3NNTA 5AYXA 1TA3A 4HJWA 4GCAA 3SB0A 3VIPA 1NOWA 3NVDA 3ONCA 4H8HA 1ZBCA 4ZVJA 4PL2A 2Z6IA 4H19A 3CWHA 4PMOA 4A8IA 2X2GA 3PJTA 2OSXA 2FGLA 1O12A 1TFVA 2E4TA 5BRQA 5DT5A 1TRDA 4KRUA 4LH8A 5HNTA 5AHLA 2VDIA 2ZADA 1JZ5A 5BRPA 3C52A 1R3RA 2B7OA 3HGSA 1PZ2A 4O1DA 3CQIA 3VUSA 2ABBA 2DT2A 2VOMA 4KGLA 1WCGA 1H7OA 2QNEA 3GBDA 3ME3A 4BF5A 2QXWA 4ZCWA 5T91A 4RLIA 3WMBA 3RITA 4W86A 4G7EB 4LNYA 2Z27A 2J8FA 4MKVA 1XH2A 2ANUA 1ONEA 3NL6A 1U1UA 2P1FA 3RLUA 3NDYA 4M82A 3W2LA 1T6MA 2WC7A 4PTMA 3P6LA 1DIDA 3PF3A 1KO0A 1GCYA 2J47A 1TB3A 1X6NA 3BCJA 3OA3A 4RPPA 1YXCA 5HMSA 1EPXA 3AYVA 4MFEA 3OLGA 2J88A 5LSMA 4KWOA 5EBAA 1KBKA 3IJIA 1OJXA 2HK1A 2QCEA 4P7OA 4R7JA 1GVSA 1FXPA 2BMBA 4PCPA 5A6SA 5C9RA 3U7VA 4IL0A 2R14A 2B81A 3NURA 2DZUA 5ECUA 3UXKA 3GVGA 1MW1A 3TDFA 1KV5A 4LBRA 2PC4A 1P6CA 3GNDA 4LC6A 2FVKA 3IV8A 1EC9A 2PURA 1OC6A 1VC4A 3QN3A 2QCCA 3EX1A 5HR6A 1NDVA 4RZ6A 3RRXA 1TWWA 4Q33A 1FCVA 2Y4SA 1JYNA 2PLKA 3LM7A 1VHNA 5CPLA 3UXAA 3VIOA 4PRTA 3QPZA 2OODA 3MP4A 1N82A 4NASA 4KT2A 1UCWA 3LHUA 1YADA 1ODUA 4GC4A 2NWSA 4J3TA 3DN5A 3GFXA 1BWLA 4F0LA 1KCZA 5HJLA 4OBSA 1HXJA 3V36A 2BY2A 3N13A 3OW1A 5E6YA 8XIMA 4KWUA 4JNZA 3U57A 2AL1A 2XH0A 1XYAA 4DO6A 3ZMRA 1V0KA 7CGTA 3MWCA 2JF7A 4NJJA 4ZQCA 4MVAA 1Q13A 1E9YB 1F9CA 4UNLA 5AOUA 4TVCA 2YYUA 1YTEA 5CKSA 3PBGA 4DJEA 4JDBA 1FHVA 3BSHA 3B8TA 4J9JA 4JIHA 1ZUAX 1UR8A 3NM1A 1ZPTA 1KRAC 1V3JA 3R8RA 1T7LA 1IXOA 1ITUA 5FF0A 3ZT5A 3TTQA 3A4AA 3NG3A 3RPDA 4UTTC 3WQ8A 1VZWA 4L4PA 4WDWA 1OM0A 3ZSTA 4LAUA 1HKMA 3ELFA 1US2A 3QKZA 3BQ6A 3VPLA 1YMYA 1EJTC 1XF0A 1XINA 1VCFA 1IXNA 4FR6A 4S2BA 2G0WA 1H0GA 4PMVA 3L5MA 1V6VA