1WZAA

Crystal structure of alpha-amylase from h.orenii
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
488
structure length
488
Chain Sequence
FEKHGTYYEIFVRSFYDSDGDGIGDLKGIIEKLDYLNDGDPETIADLGVNGIWLMPIFKSPSYHGYDVTDYYKINPDYGTLEDFHKLVEAAHQRGIKVIIDLPINHTSERHPWFLKASRDKNSEYRDYYVWAGPDTDTKETKLDGGRVWHYSPTGMYYGYFWSGMPDLNYNNPEVQEKVIGIAKYWLKQGVDGFRLDGAMHIFPPAQYDKNFTWWEKFRQEIEEVKPVYLVGEVWDISETVAPYFKYGFDSTFNFKLAEAVIATAKAGFPFGFNKKAKHIYGVYDREVGFGNYIDAPFLTNHDQNRILDQLGQDRNKARVAASIYLTLPGNPFIYYGEEIGMRGQGPHEVIREPFQWYNGSGEGETYWEPAMYNDGFTSVEQEEKNLDSLLNHYRRLIHFRNENPVFYTGKIEIINGGLNVVAFRRYNDKRDLYVYHNLVNRPVKIKVASGNWTLLFNSGDKEITPVEDNNKLMYTIPAYTTIVLEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha-amylase A
publication title Crystal structure of AmyA lacks acidic surface and provide insights into protein stability at poly-extreme condition.
pubmed doi rcsb
source organism Halothermothrix orenii
molecule tags Hydrolase
total genus 170
structure length 488
sequence length 488
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2005-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1wzaA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1wzaA01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 1wzaA02
3DC0A 5E0FA 5CPSA 5IXEA 1D3CA 4F8XA 5E6YA 3AIBA 4UTFA 2RGLA 1MVYA 3N13A 4ACZA 4BQ2A 2VI0A 2VURA 4NSBA 4ZEPA 3II1A 1BF2A 1E73M 1PS3A 2E9MA 4OUEA 3GZAA 1WZKA 3SUSA 3OA5A 2VZOA 4UR9A 4Y7EA 4CVUA 2J47A 2BFGA 5E70A 1GZJA 2C8NA 3WNLA 1E0WA 2J25A 3F5JA 4Z2JA 2YL8A 4FNRA 3APGA 4QLJA 1FH7A 1E40A 3SCOA 3CPUA 5E09A 2HVMA 1LWJA 3EMZA 2GJXB 3VSUA 2WYSA 3GH7A 4UQBA 3TP4A 3WD2A 4KMQA 2JF6A 2NSXA 1QX1A 1H09A 3CHFA 3RCNA 4A3YA 2ZX9A 4TVUA 3GBEA 3CGTA 1BG9A 4F66A 5HDRA 1GOMA 4M8UA 1CPUA 2BY3A 2TAAA 2WK2A 3GH5A 1ZJAA 2FHCA 2WMKA 2VRJA 1FA2A 3AMGA 1JFHA 4E8CA 4PTVA 4YHEA 4CD5A 1CXHA 2ZX5A 1OCQA 3J7HA 2G3NA 4AD3A 2PC8A 3RPMA 2PWHA 4P8UA 1V3IA 4KRUA 4OIFA 1WZAA 2CESA 3RIKA 3FHAA 3TTSA 1JZ8A 3HZ3A 4PUDA 4ACZB 1B3YA 1QOXA 3SCVA 1BYAA 4WSJA 3LRMA 3MMWA 1HJWA 2XIBA 2EPLX 2ESCA 3CZEA 1WDPA 3N12A 3AMLA 2BVTA 1MFVA 2GK1A 2Q8XA 2PBGA 1JI2A 4JFWA 4WKHA 4RE3A 4QFUA 5E9AA 4N0RA 3HG5A 1KWGA 3B8SA 1OINA 1QI3A 3CZLA 2BHYA 4NRRA 2VX7A 5I3DA 1KXTA 3M07A 2XN2A 1C7TA 1JGIA 4CKQA 4EK7A 4ZE5A 4NRSA 2UY2A 4P7QA 2YFOA 1O7DC 1Y7VA 4JFTA 1JZ2A 2FHFA 4H7VA 4U5IA 1CDGA 1XD0A 1NOUA 3KL3A 2YLLA 2BV9A 2DDXA 5CPTA 4NX0A 1EO7A 1E6PA 2G3MA 4YHGA 3AHTA 3GM8A 3OB8A 4JL2A 3N15A 1UWTA 5A8OA 3VDCA 1NP0A 6CGTA 2DT3A 3L4VA 1H11A 3KEHA 5AC5A 4F79A 2W5FA 3VGHA 4D1JA 3D4YA 3QR3A 4AYSA 1W9UA 2G4FA 4DO5A 3AI0A 5CPQA 2EO7A 3H55A 2EADA 4QLLA 4H8UA 1PAMA 4ATWA 1UQYA 4MB3A 2F1AA 1VRXA 3VD4A 1KWKA 2J7EA 5CSUA 3BLBA 4ATLA 3VTRA 4JAWA 1BFNA 3GXFA 2IUZA 3E1F1 1W2PA 5A8NA 3W6MA 1GOWA 4CN4A 5BRPA 2GK1B 1NWRA 1TFVA 1JXKA 2YL6A 4B16A 5HPCA 2D3NA 1KR1A 1M01A 1EGZA 2EXOA 2W91A 2OWWA 5A6BA 3VIJA 1J0KA 5D8ZA 1KQYA 2X2IA 4Z2GA 3EJQA 2A3BA 1BPLB 4JHOA 3SCNA 3BVUA 4BF7A 4E8DA 2FDMA 1Q6GA 4A3HA 1VAHA 1V3KA 3N1AA 2ZUMA 1Q6FA 3WY1A 4D1IA 3CLWA 1J9YA 4WF7A 1V3LA 3KE0A 3WDHA 1XC6A 5C70A 4J7RA 4AMCA 1E6SM 4OZOA 1FFQA 2WSKA 1V0NA 5AYBA 4J3UA 8CGTA 1UA7A 3VPLA 3MS8A 2WZIA 2X05A 3L4XA 3AXHA 4W8AA 4JFSA 4DO4A 1JI1A 3WH8A 1JZ5A 2GDVA 5D9OA 1HJVA 1KGWA 1VJSA 3TV8A 3NSXA 2X1IA 3CZ8A 3MV11 2WXDM 4NZCA 1L0PA 1U33A 2ZXBA 3WENA 2CBIA 1H4PA 2WMFA 1QNQA 3EDFA 3SCWA 5FKYA 1LWHA 1Q6DA 1X6NA 2YL5A 2EJ1A 1VEPA 2VX5A 3U5UA 4BQ4A 3VSTA 1HN1A 4HMEA 4F9JA 4AD0A 3A21A 1FP9A 3RDKA 3W4RA 2DSZA 1QVBA 1CGYA 2DT0A 1GVYA 1EQPA 3T08A 2WVUA 2X2YA 8A3HA 3NYDA 4CU8A 1JFXA 1OGSA 1CGUA 3OIHA 2QMKA 3WF0A 4UQAA 5CLWA 2ZX6A 4CD7A 6TAAA 2JALA 3WD4A 1UWSA 4JFVA 4AZIA 2UY4A 3PZMA 1E15A 1G0CA 1ISWA 1MQQA 4QCEA 2VZVA 5A2AA 1CNVA 4D6DA 3UCQA 4MNMA 5CLTA 1XCXA 3O6AA 3WNOA 3OBAA 1C3FA 1YQ2A 1GORA 1GW1A 5BXSA 4P7LA 3UESA 4AIEA 2GSJA 4UQEA 4P8WA 4U31A 1UKSA 4JL1A 1R8LA 3W24A 1CXLA 3CUFA 1W1TA 3NCOA 2J7GA 4CVWA 3DHUA 2DPEA 1PZ2A 3L4ZA 2YLAA 2OSYA 2D23A 3VDHA 2VT0A 1LL4A 4WSKA 1OIMA 4LYRA 1BGAA 1TVPA 5FD0A 1OSEA 1FH9A 2BHZA 1UZ4A 3PTMA 1IZKA 2YKKA 2VR4A 1GUVA 1GQKA 3CZGA 2OSXA 2WHLA 3U7VA 4MDPA 3KL0A 2W61A 2XN1A 2VVNA 2CBJA 1CZ1A 1PEZA 2WBGA 3CUGA 3MSGA 3ZR5A 2CYGA 1Q4NX 1LLOA 1KCLA 1C8XA 4M81A 4AXNA 2JEPA 3NSMA 1HJUA 2EPNA 2YDSA 1CGWA 4FLRA 3ZR6A 3AHXA 3MSDA 3PTQA 3AMDA 3HU7A 4HMDA 4PMOA 4W89A 4W7WA 3SCTA 3QHNA 4J28A 1ISVA 5IFPA 1WPCA 1A3HA 1ISYA 1SZNA 2YA1A 3N04A 1SMAA 1XRVA 3RJYA 4Z2IA 2Y4SA 2F61A 2Y2WA 3SEPA 4URIA 4PBGA 1CGVA 3T0DA 3OG2A 3AFBA 1NWSA 1WAWA 3WH5A 4NXKA 2W63A 4FK9A 2A3AA 3SCUA 4UFIA 3SUTA 1HP5A 4MPKA 1M04A 3WFZA 1QBBA 1DWJM 1E9LA 2VX6A 2WC4A 2XYLA 3ALFA 4UQDA 2NT1A 4GQRA 1WZLA 1W9XA 5HBFA 1E1FA 3WNMA 4H41A 5JIWA 2D24A 3A4WA 2BNJA 3WDRA 1HTYA 1K9FA 4J3VA 3VM7A 2WVVA 4FNQA 1B3XA 2OWXA 5A94A 4AMWA 2V3DA 1WP6A 1CTNA 4MAZA 1LG2A 3BAKA 1CECA 1EDTA 3SCQA 4M29A 3WFLA 2DH2A 3BLPX 1VENA 3W28A 1UH4A 2WMJA 2XVGA 4JCLA 1C7SA 4D6HA 3VIPA 3SUVA 1V08A 1CWYA 1IT0A 3W53A 2Y5EA 1WO2A 5LYRA 4FNUA 2XG9A 1EO5A 5I24A 1QHZA 4TX6A 2D20A 1RP9A 1QW8A 4L4OA 3WELA 3VGBA 1UR2A 3PN8A 1UKOA 1CLXA 4H2CA 1NWTA 2YBTA 3DX1A 3PZUA 2EACA 1HKKA 1N82A 2VZSA 4P8VA 2XFRA 3ZT6A 3AS2A 2E8YA 3WD0A 1XH0A 2XVNA 3BUBA 3VNZA 3HG2A 3RM4A 1AQMA 4D6GA 2IXVA 1UWQA 2EEXA 3VIGA 2XWEA 1DWIM 5GNYA 4FLQA 1HJQA 2ZOXA 1JZ6A 1B30A 1VF8A 1UOKA 3W37A 2J8GA 1V6XA 3TONA 1EOMA 1C90A 5DT5A 2F7QA 4V27A 3VD3A 2WM0A 1JD7A 1AQ0A 4K68A 1R7AA 2J7FA 4IPNB 3WDQA 1VFMA 3A6OA 3OLGA 1OIFA 2VOTA 4AYGA 3H53A 2CBUA 1E4IA 3AMCA 4EKJA 2YIHA 2W66A 3ECQA 1CGXA 1CENA 2DIEA 1HL8A 1VB9A 4PRWA 2VCAA 4HA3A 1KQZA 1J0YA 2WVVB 3WF4A 3MUY1 5HXMA 3AOFA 5TD4A 1NM9A 3WY2A 2ALWA 3PTKA 3CUJA 2F8QA 3BAIA 3AJ7A 4U3CA 1V0MA 2VZTA 3BGAA 1JDAA 1VFOA 3ZJKA 3PZNA 5FIPA 1E4LA 2WLZA 2QMJA 3PZIA 2E8ZA 3K46A 3WH7A 1GOIA 1G1YA 1E3ZA 2V3EA 5IFTA 3WQ5A 2XUCA 5JIPA 2V38A 2X2JA 3QOKA 3VILA 1XSKA 2O9OA 4GZIA 3ARPA 3K8KA 3VMNA 1B3ZA 4W5ZA 1P6WA 1O6IA 3SCRA 4PMZA 1I75A 1UWIA 1E4NA 1K9TA 2VCBA 5HOSA 4JFUA 1J0HA 2WSPA 3VIIA 5GNZA 2PWFA 2GUYA 4JKLA 3U5YA 1OT1A 5DO8A 1DP0A 1LQ0A 4AD2A 1SYTA 2FH6A 3FNDA 4ACYA 2QPUA 3OLEA 4RE4A 5I77A 3CZNA 2Y8KA 1XCWA 1WKYA 3D51A 1DWAM 3WF3A 1EXPA 1S46A 3WH6A 3VM5A 1R86A 2V5DA 3PBGA 4HPHA 1W1VA 1V03A 3LRKA 4CN6A 9CGTA 2D0HA 3MUIA 1GJUA 2CKRA 3BXWA 4PCSA 3OGRA 4AY1A 5A6SA 1CXKA 1E72M 4CD8A 4CD6A 2XVKA 2ZUUA 3WQ4A 1K9EA 1E6ZA 1E3XA 5HPOA 4ZENA 1FH8A 3NJ3A 4B9ZA 1KXVA 1L8NA 3FAXA 4R27A 1H0IA 3VGFA 1QNPA 5I5RA 3BCDA 2IGTA 5CQ1A 1WE5A 2D22A 2JFEX 2O9PA 3EDDA 1NOFA 1LL7A 4XB3A 2O92A 4D71A 1I1XA 4QDMA 4EE9A 3TOPA 1TA3A 4OBSA 1HVQA 1A47A 3UEQA 5IHSA 1QHOA 3IK2A 3GXPA 4OGZA 1TR1A 2WMIA 2BXYA 1B1YA 2EPKX 1C91A 4NZJA 4B9YA 1ZBKA 3A4AA 4JCMA 1CXIA 1RH9A 2J8FA 5D8WA 1J18A 4FNSA 2ZWZA 4UFKA 4BS0A 4LPCA 2ZXQA 2A3CA 1UWRA 3IJ7A 5A69A 2GFTA 3VGGA 3BVWA 1J11A 1LG1A 2DSUA 2QPSA 3LXCA 1E0VA 5CGMA 2QHAA 5GQBA 3VGDA 5BYWA 3WH9A 3QGVA 5CXPA 1PBGA 3HN3A 2EPMX 2J7CA 5LA1A 1JIBA 2CNCA 3EBVA 4H04A 3LPFA 5CGTA 4ZXOA 2VUYA 1C8YA 3WQWA 4HP5A 1ZB5A 1QNSA 1UKTA 2BVYA 4P8XA 3T0BA 1UD2A 5EFFA 3WIJA 1H5VA 1OGGA 1ITCA 2YJQA 1DTUA 1E56A 5JBEA 3FN9A 5DF0A 5KEZA 3IJ8A 1PJ9A 1HKIA 3WD3A 1HL9A 1TCMA 4OKDA 2ZUSA 2ZUTA 1W9BM 2ZXAA 2YDRA 3FHQA 3POHA 3BCFA 2AMGA 3SCSA 1R87A 2CHOA 3ZJ8A 1PX3A 3GDBA 1Z32X 4H8VA 3A3HA 2J78A 1TA3B 1ODZA 2D0GA 3A47A 4U33A 1KFWA 1TQVA 3RM9A 1XYZA 3WY3A 5AYIA 5E1QA 4W85A 3B9EA 2WMIB 1BGGA 2EPOA 3S5YA 2DSWA 5D4YA 5M03A 3CH9A 3VUPA 4B3LA 1J0JA 1JYVA 4CD4A 4W86A 1BVNP 4GXPA 4MAVA 1V6WA 3CO4A 3GXMA 4PSPA 1SMDA 1GVIA 2WAGA 5BROA 2EAEA 4U3AA 4UFHA 3TTQA 1TUXA 3NSNA 1UR4A 2YOCA 5A6AA 3EDJA 1UR9A 3WMBA 2WANA 1UA3A 3IJ9A 2J7BA 3AZSA 2VL4A 3VX0A 4DWSC 3WDPP 1OWQA 2ZUNA 3EJPA 2OYMA 3LPOA 3ARTA 3VKKA 1E1EA 1HP4A 4AD5A 3NIYA 2UY3A 3WL1A 1BQCA 4B15A 1MXDA 2XVLA 3ALGA 1IZJA 4J3SA 2WHKA 4YPJA 1NQ6A 3VGEA 3EJTA 3WNKA 1V0LA 2JE8A 1C93A 5A8PA 4GO9A 5M3WA 1WZMA 4J3XA 2VCCA 4FLOA 4IM4A 2RGMA 3M7SA 2BHUA 1VJZA 1HJSA 1EA9C 2G41A 1US2A 3THCA 4B3KA 3WQVA 2J62A 3GNPA 3L4TA 1J01A 3UETA 1C8QA 2PB1A 4KH2A 3WSUA 1W3KA 5I6SA 1GOOA 1EQCA 5BWFA 1J0ZA 2XJ7A 2NW0A 1XGZA 3BUIA 5IDIA 4BQ5A 1E55A 1UYQA 4W88A 1UH3A 4WIWA 4AZ7A 1B9ZA 1ZS2A 4AZBA 1B2YA 3ZSTA 1B90A 2BVDA 1G01A 2VC9A 4PUEA 2XWDA 3I3DA 2XSBA 3D52A 3DYOA 3RMEA 2VZUA 2ZXDA 3CBWA 2B31A 4JZ5A 4PMNA 1HJXA 1F4HA 2ZICA 1EIBA 3NDYA 2CPUA 3MO4A 7TAAA 3ZO9A 1W1PA 2DEPA 3FAWA 2ZE0A 2UY5A 1EH9A 2XGBA 4UFMA 1UR8A 1T0OA 3T09A 3AZTA 1YHTA 1UHVA 4PMDA 5DEZA 4BZYA 4GKLA 3GYCA 4RL3A 3WL0A 3WUBA 5EB8A 3D5HA 5IHRA 3O2LA 2YFNA 3WUEA 4AW7A 2GVYA 4ML4A 3OZOA 1FHDA 1TG7A 4KRTA 4AZHA 2FGLA 4HOWA 1K6AA 1WDQA 3GXTA 1KR0A 2XGIA 5BCAA 4LYQA 2PF0A 1E0XA 2WLYA 1HT6A 4M56A 1H0GA 3DDFA 1VBUA 3VO0A 1W3JA 2CCRA 1V3MA 3KL5A 6A3HA 4UQCA 2ZX7A 3WMCA 1RPKA 2VO5A 1B3WA 2EBNA 2QLYA 1HF6A 4OBRA 3WEZA 3DX3A 1BSIA 1QNRA 4D6FA 1KBBA 1I1WA 1MWOA 3EJSA 3WUGA 1TQUA 3KWXA 2VX4A 5BXRA 3M6DA 4NXSA 1VEOA 3BAJA 7A3HA 3MKKA 1E5JA 4PMVA 4KGJA 3WMSA 1BYCA 2WCSA 1XD1A 3ZT7A 4GI9A 2WWCA 3DX0A 2FYVA 4DUWA 1R33A 2JIWA 2E0PA 3VSVA 4M24A 5AY7A 4AZ6A 3PZGA 2XFYA 3OLIA 3ARUA 4PN2A 3LX9A 3PZTA 4AD4A 1TE1A 1J10A 1VFUA 3AISA 1BVZA 5HNNA 2J75A 4PMYA 4FF5A 3MUAA 3WBEA 2W67A 4Z2HA 5I79A 4OJYA 3WD1A 3WQ8A 1JYXA 4PMUA 3ZIZA 4WKFA 4PTXA 2XSAA 3T2OA 4WJXA 1PZ3A 3KLKA 1JZ7A 3T2PA 3BUDA 1WDSA 2WVSA 1J0IA 2ZWYA 1WB0A 1ISZA 2C7FA 1W9PA 1HKMA 4HTYA 1CXFA 1SR0A 2WHJA 1GOQA 2WHMA 3MI6A 2VNCA 3VIHA 2WMHA 4X9YA 5C71A 5FL1A 1LL6A 3WKZA 1CIUA 3BSGA 4TVDA 1UD3A 2DSKA 3L4YA 3GNOA 2XM2A 5F7UA 3ARQA 1EHNA 4PMXA 2E9LA 3K1DA 5ECUA 4UOQA 3AHYA 3O9NA 1ITXA 3HJEA 4HOXA 2WB5A 2XFFA 2J7DA 1UR1A 3ZSSA 5EFDA 1AVAA 2WPGA 3VOCA 1CEOA 3MUZ1 1WDRA 4S3KA 3F5KA 2MANA 3EMCA 3K8LA 3F4VA 3BMVA 1JDDA 3PZQA 2QV4A 3BSHA 1E5NA 3B9DA 1JYNA 1BLIA 2PWDA 4PEEA 2HISA 1GQIA 1JYWA 1MQRA 5BXPA 3W81A 3AXIA 4JKKA 4JIEA 3WEMA 2DIJA 3CMGA 3AIWA 1OD0A 1NH6A 1QW9A 4C7FA 4CCCA 3UR8A 5A2BA 4MNLA 2PI6A 3EMQA 1E43A 4D6IA 2AAAA 3CZKA 3VD5A 3A23A 3LPPA 1E6NA 1XV8A 4CUCA 4Q22A 3ARWA 5I78A 1HXKA 1BHGA 4MB5A 2G3IA 3D3AA 3KLLA 4MJ2A 3CHCA 2WC3A 3VDAA 2OYLA 1W9VA 4MB1A 1M53A 1V02A 1MW1A 1V6UA 2DGAA 4ATDA 4AD1A 4KWUA 2CBVA 1E4MM 3EDKA 1M03A 1J12A 3AICA 2WC7A 1QWUA 3W27A 3VNYA 5ABFA 3SUWA 5A6JA 4TXEA 4W7VA 5JBFA 3PHAA 3VIOA 3UG4A 1R34A 1UQZA 3BAXA 3AHVA 5DMYA 2WWDA 4E4PA 3CUHA 4UZUA 1OGBA 3TA9A 3ARSA 5A8MA 3UERA 2E4TA 1R47A 2X8RA 5CZKA 1GHSA 4PYSA 1UASA 1MQPA 1JZ4A 2AOSA 4ZXLA 1JZ3A 2WCGA 3W26A 3SIMA 3VMPA 1QWNA 4AEEA 1ESWA 1H49A 4N42A 2J77A 1TQWA 2Z1SA 3BAWA 1CBGA 1HNYA 2W62A 2CXGA 2Z1KA 2F1BA 1GCYA 2WW5A 1UWUA 3N18A 2X09A 1H41A 2GJRA 3GH4A 4AWEA 4QAWA 4AEFA 2YL9A 1UH2A 1OB0A 5LA2A 3D4ZA 2OW6A 3CZJA 4D6EA 2UWFA 1US3A 3K8MA 1BG4A 4W87A 1JDCA 2BY2A 3ARYA 1BTCA 5D9MA 5GNXA 2CKSA 3AIUA 2F2HA 2J79A 2A3EA 3TTYA 4HA4A 1JL8A 2D0FA 3W82A 1W1YA 4D6CA 1QNOA 3ZQ9A 1UKQA 4AIOA 1NP2A 4UZSA 1ODUA 2V5CA 2OSWA 4WLCA 1O7AA 3BC9A 1KBKA 2WKLA 1ZBVA 4DUVA 5ABFB 5JBDA 1X1NA 2QF8A 3RILA 3LXBA 3IANA 3BVVA 2GJPA 3DECA 3F5LA 3ZMRA 4DUXA 4W84A 1D7FA 1R75A 4U2YA 1OD8A 1VBRA 1UUQA 5EMYA 4W93A 3W25A 3AIQA 1LF1A 1V3JA 1OT2A 3UR7A 3WEOA 5FOOA 4Q7NA 3W29A 4MTVA 5I0DA 1C92A 4NF7A 4DWSD 1GNXA 1G94A 1E6QM 5JUVA 4CU6A 3NUKA 1V0KA 1QI5A 2VQTA 1KXQA 1GOKA 1PIGA 3QHMA 2VRQA 3DX4A 4BCEA 2VRKA 3RM8A 2Y24A 3BVTA 3LXAA 3MU7A 1E70M 2E3ZA 4WKAA 4TX8A 4NZFA 5BRQA 3CHEA 4TUFA 3PZVA 1GHRA 3QHOA 3I3BA 3CC1A 1EOKA 4ZFMA 2OW7A 1KXHA 1RP8A 2VTFA 2E9BA 3UG3A 3FXYA 3S6TA 3SUUA 5GPRA 3ARZA 1FHLA 3ZM8A 4GINA 1EHAA 4NI3A 1KB3A 3PZ9A 3ZOAA 2D1ZA 1E6RA 4PSRA 3IGUA 1FOBA 4HMCA 1ZJBA 3U7BA 3VX1A 4QP0A 3WNNA 2OWCA 4LGXA 2W4XA 2D3LA 2CEQA 2WBKA 3G6MA 2JF7A 4HPGA 3BMWA 1V02E 4XUYA 5AC4A 3MV01 1HWWA 4Z2LA 4CN1A 2IXUA 1DHKA 4KGLA 1V3HA 3LMYA 4S3JA 2YDQA 1DWHM 1JAEA 3MMUA 3WBAA 2JEQA 1B31A 4IPLA 3VU2A 4GZEA 3VD9A 5I2UA 3VVGA 5FL0A 4GI6A 1OBAA 3SCPA 4FMVA 1JNDA 1GONA 1OM0A 3SURA 2F7PA 3OLDA 1MFUA 2XM1A 2J4GA 3PZOA 1JAKA 4LYPA 3DYMA 3FW6A 4P7RA 3VDBA 5EBAA 2C0HA 2WNWA 3ARRA 5A6KA 4IUGA 3N9KA 5A95A 1KCKA 1HXJA 3CZSA 1MYRA 1W3HA 1U30A 5A6MA 2X0YA 4AIUA 3VINA 1F4AA 4LXFA 4PCTA 3A5VA 7CGTA 1UD5A 3WF2A 1NARA 2GDUA 4TOQA 3B9AA 2ZIDA 1QBAA 3WQ6A 4XV0A 5BXTA 4ZE4A 4UFJA 3T2QA 2BY1A 4H8HA 5DT7A 1W2VA 3VMOA 3H54A 2CERA 3RJXA 3GBDA 4BQ3A 2F7OA 1WCGA 3L2MA 3UG5A 4XZWA 2FHBA 4PMRA 3A4XA 3EYPA 1VIWA 3D50A 1K9DA 1MW3A 2J7HA 3ARVA 1TQTA 3GXIA 3GXDA 1HIZA 2CIPA 5CJ5A 1V6YA 4W8BA 4AZCA 4MJ4A 1QI4A 2DH3A 3QOMA 2G8ZA 5E6ZA 3DHPA 3CHDA 5D9NA 1W9DM 1GJWA 4M82A 1HKJA 4C7GA 3AYSA 5CSYA 2CETA 4UQ9A 2CHNA 3VIMA 4D72A 4LQ1A 4HZ6A 4JKMA 3RO8A 3I3EA 1QHPA 4E2OA 4FLSA 1G5AA 4HU0A 3T0AA 3CUIA 1H3GA 1TQSA 3TTOA 3W6LA 3U57A 1XSIA 1W32A 2FGZA 3CTTA 4MB4A 1R85A 5FCZA 1RD6A 3AS3A 2V3GA 3EDEA 5A8QA 2WCAA 4UNIA 1UG6A 2VQUA 3AIVA 4IISA 1JG9A 4DM2A 4DO6A 3GNRA 3CV5A 3AIEA 4W8LA 3CIVA 4CU7A 3IAQA 5I23A 3AS0A 2G3JA 1FFRA 2F7RA 2X2HA 4PTWA 1V6VA 3JUGA 4DWSA 1IV8A 5DFAA 4J3WA 2DSVA 1W3LA 4HZ7A 5ABEA 3ZJ7A 4JHZA 2A3HA 3OZPA 5C8BB 3BUPA 1UD6A 3HMCA 1HVXA 5ABHA 2VMFA 1DWFM 1D2KA 2WVTA 1KTBA 4DM1A 1XH2A 2XPKA 4V2XA 1XHGA 3AMKA 4M80A 4XZBA 5A6BD 3AS1A 2FE0A 2YBUA 2DQXA 4AZCB 4GI8A 4OOUA 2XTKA 4QCFA 3OGSA 2YA2A 2O9RA 2OYKA 4HA1A 2W92A 2E40A 3S5ZA 1CLVA 4HOZA 4TTGA 2D2OA 3N11A 5A6LA 4FNPA 2OLHA 2EQDA 4RE2A 3L2LA 5ABGA 3IAPA 3S2CA 1JXJA 3FY1A 1G9HA 1BYDA 4P7OA 2XHYA 3ZT5A 4AC1X 4PMQA 1B3VA 1XH1A 1M7XA 3G6LA 4GO8A 3POCA 3VIKA 1TZ7A 3VD7A 1NOWA 1PX4A 5LA0A 3DYPA 3NDZA 4J3TA 1ZBWA 4P7NA 1NWUA 4GZJA 2X0HA 1E6XM 1JNEA 4F9DA 1QI0A 4WK9A 3GTNA 3VIFA 2WKGA 4L4PA 1GQJA 4EAMA 1PX8A 3AROA 4R5EA 4W7UA 1UZ1A 4DWSB 3L4WA 5E0CA 1EDGA 3WNPA 4D6JA 5M5DA 4AISA 2JIEA 4V28A 3WF1A 2Y8VA 4BA0A 1BAGA 3BH4A 1GQLA 4X0VA 3AHZA 4PTMA 2XN0A 3AYRA 5A1AA 3AIRA 4GPNA 3MMDA 4MNKA 4MNJA 4GQQA 4C7DA 2BXZA 1W91A 1KTCA 1QI2A 3HG4A 3AQUA 3K4AA 1ZU8A 2BS9A 1KGXA 1CXEA 4TVCA 1HX0A 4TTUA 3BLKA 1SFSA 1EDQA 3ARXA 1JD9A 1PIFA 3W0KA 4CGTA 1ECEA 1KGUA 3HG3A 2WZEA 4UCFA 5A2CA 2ZUWA 2O9TA 4QLKA 4Z2KA 2F18A 2PBOA 5A3HA 1FP8A 3ZJ6A 4HZ8A 1GPFA 3AZRA 1VEMA 1R46A 2BY0A 2PWEA 1PPIA 2V3FA 1B0IA 4GIAA 2FH8A 1MXGA 2EABA 1QPKA 3A24A 2CITA 4XX6A 4UOJA 1WNOA 3WN6A 2WMGA 4FNTA 2ZUVA 1H1NA 5KZ6A 4YN5A 2XIIA 1MW2A 1X6LA 1AQHA 1BYBA 3A22A 1MW0A 1UR0A 2XVPA 2D73A 3CMJA 4W5UA 1VFFA 2NT0A 4HU8A 1DEDA 1XSJA 3OGVA 4AZGA 1CYGA 2VR5A 3DDGA 3EJRA 3BUQA 4CCEA 4A4AA 2WZHA 3THDA 3K4DA 3W38A 3LRLA 1H2JA 3MANA 3N17A 3BAYA 1TVNA 3M46A 2PWGA 2J74A 3WY4A 4EANA 3EJUA 1LJYA 4OOZA 4UOZA 4UFLA 2GJXA 1JF6A 3GXNA 1UKPA 1DWGM 1R7OA 1JF5A 1Q6EA 1XYFA 1Q6CA 4U2ZA 3WUFA 3DX2A 1TMQA 2YA0A 2DT2A 1ISXA 1UD4A 4U5KA 4J27A 1U2YA 5CG0A 3KZSA 4AMXA 1CGTA 2ZX8A 2VVSA 3L4UA 1ZL1A 2VJXA 1ZBCA 5D9PA 3BVXA 1E71M 3WDJA 5M17A 1UD8A 4CCDA 4LX4A 4M1RA 1AMYA 3AXXA 4MADA 4MDOA 4AZ5A 4X0NA 3LPGA 3WDIA 2DT1A
chains in the Genus database with same CATH superfamily
3WS3A 5ACZB 5IVXE 5IXEA 2XSKA 3S1GA 5E6YA 2E6AA 4B5SA 3H2EA 3TCLB 1YYLL 1PS3A 3LG3A 3KLDA 1VYRA 4PB9H 1L7IH 4QPEA 1UADC 3NDZE 2WM1A 3L5XH 4JHAL 1XF3B 2P3ZA 3SDCA 2BFGA 4JDZA 4JE4B 3S7GA 1NIFA 3U9PL 2CBMA 2DD8L 4JFPB 4M8QB 4YL4A 2GJXB 1LLAA 4XVJH 2VEFA 3RCNA 4DZBB 4RW3A 1MFEH 4Z7VA 4H8NA 1ML1A 2C3HA 4PD4K 3DC8A 2DMCA 4L8DA 1C1EL 1U5HA 2P5EE 3HOGA 2P3YA 2ZX5A 2ORBL 1SW0A 4TUKH 2VDQB 4E9VA 4DJFD 4KKRA 3K5SA 2ITFA 4ZW3A 1BYAA 1HSBA 5EDXA 3LRMA 4Z1CA 3K7UA 1BECA 1D6VL 3WFAA 1W5OA 3EA1A 4WKHA 2BOFX 4GAJL 3B8SA 4ECLA 2BVQB 2E7HA 3LZ5A 2R1WB 2OMXB 2VXTH 3M07A 4PRRA 2AGJH 3G6JF 3KPSD 1D9KD 2CZNA 1S2VA 4H7VA 4U5IA 1QSEB 4QEGA 4NM8H 2YLLA 2BV9A 4ODXA 1MFAL 1E6PA 3VCRA 4HK3N 3BCJA 3BW3A 2XBZA 4PJHA 5L7XL 2X9YA 1WBYB 1MCIA 3EPMA 3QR3A 4X9IA 2CZDA 1LDSA 3KJ4B 1DDHA 4WQ6A 4HEPA 2PYEA 3H55A 4UTCA 4QLLA 1JDEA 5IZ7A 1Z0NA 5HGDA 3MPGA 1FNHA 1RA0A 4ASTA 3NA9L 2ZE3A 2PP1A 2IUZA 5A8NA 4HZLB 1A6VL 2ONEA 5FUOH 4LAKA 1DVTA 1EVTC 2ZAHA 3MLUH 3ZX1A 2VLJA 2V7NB 2BX7A 3W1ZA 3QG7H 3QDGB 4W4OA 3FQWA 4XNYH 1RIVH 4NO3A 3KE0A 2H45A 3VA2C 3CHPA 4J7RA 1XCTB 4NKCA 3QUYB 1E5UI 4DPCX 3OZMA 2VUKA 2QKIB 4PREA 2BNUA 1LMIA 4C56A 1CTMA 3TJIA 5JW3L 3MV11 5JPNA 1L0PA 2X0WA 5CNHA 2OX5A 4GMTL 3IDXH 1LWHA 2ESVD 3QO1A 2NWRA 3MUXA 1TPEA 4PL1A 3O0RH 3FJTA 3IXTB 1QZNA 1FP9A 2OA9A 4Y19E 4OHQA 1VLWA 5TQ2H 4A29A 1R30A 5F7EL 2VH5L 2VLKA 4OJAA 2PTYA 2Y0SA 2OMUB 5HI5C 1JP5A 1A3RL 3OEXA 1UWSA 4FQ2L 4AZIA 1BXCA 3WTVA 1QFOA 1ERNA 3GNNA 5AC7A 1I1YB 1NBZA 1E15A 4UDUB 5IREA 1Q7MA 4B0MB 4MMZA 2CJSA 3IIZA 1GW1A 1XIWB 2CIKB 2DL9A 3QUZB 4TU1A 3T1GA 2R4RL 5GGUB 1G7LA 3W24A 3DXAB 4J35A 1W1TA 4XZIA 4IOFC 2D23A 4NQVA 1GGCL 5AFDA 3LSCA 1QO3A 1MCKA 1LP9F 5FD0A 2DLGA 4BF5A 1OSEA 4F2ME 1UZ4A 2OR7A 4XO6A 4ZDHA 2X7VA 3CXHJ 4YL9A 3SY0B 3BUYB 3ZWSA 4MDPA 3L5JA 4GG6B 2VVNA 3LKSB 4BI6A 3BJFA 1QOPA 4F9LA 3PTDA 1GMIA 1EWHA 3KPNA 3LERA 1EBGA 3GUTB 5JLZB 1F41A 5K4XA 3MSDA 4WD0A 3E0VA 3SI9A 3EOAA 4GRWB 3L1FA 3CFEA 3P3RA 4G71B 1TCRB 2K9FB 3GSRB 3SEPA 2WMPA 4UMGA 2P50A 1FWWA 3R58A 3SE3A 3HTWA 4G2DA 1U42A 1QBBA 2VR9A 2ZA2A 1EHLH 4H00A 2HT2D 5HBFA 3UBXI 2Z8RA 3RVTD 1S2AA 1JERA 5IMLB 3MRNA 4XNXH 3MRRA 4IIGA 4CC4C 4A38A 4PJ9D 2BFVH 3VXUA 3BLPX 4X42A 4WGWB 5CILL 3VIPA 3B9KD 5I15H 1K8ZA 1V08A 1FIEA 3IGKA 3I74A 4XO4A 1IT0A 1AZZC 2IV8A 5DJ8B 4TLUA 3CFJA 4Y5VB 5ANME 2GBVA 3PZUA 1N82A 3T0TA 4E9XA 1K2DA 3O2WL 3FU9A 2JELL 3CYVA 2VMJA 3MLSH 4G8AC 4UTTC 4K3JL 1V6XA 4WFHD 5BVPH 3THUA 2QQKH 1T3FB 3LHTA 4BK8A 1KFLA 4I6KA 4ZW6A 2CBUA 4KDVA 1OABA 3N6YA 5IJKC 1NGZB 3FCTB 3KYOB 4ONOA 3LEYH 2DIEA 2PXYC 2F58H 2HEJA 3RU8X 1RV8A 4PB4A 4I3RH 4UMBA 1FWSA 2G60H 4JQIA 4W9ZA 3BEWA 3BAIA 2YWYA 1LD9B 3AJ7A 4P9ML 1OE1A 1DOSA 1S5MA 5BZDB 4ZB5A 1DL7H 5HGGS 4NNPL 4EI5A 2HH0L 3DH7A 1QAWA 3SECA 4HUKB 4Y8AA 3LN5A 4KXZH 4G6FD 1O6IA 3SCRA 3UFYA 4TOYL 3SN0A 3NQ2A 3FSWA 5LGHH 1FDJA 5BMFH 1NFGA 4QJ1A 2ARJA 2Q7NA 3EOLA 5DO8A 3LZFH 2AKRA 4OI9A 4XHJC 4PB0H 4JQ4A 3OPSA 2Y8KA 7REQB 5D1ZI 1QR1B 2EXYD 1OFBA 4MA7L 2CUIA 4CN6A 2QVFB 3BN9D 4S1QH 4OCYH 1NCJA 4Y9AA 3SE8L 1NTDA 5HD8D 4Z7WB 2BS8A 1GW9A 4DNHA 3EXLA 4AYBA 3H23A 4HLEA 4A7UA 3EW3B 2PZNA 5GS0C 1G6RH 1P5BA 5KOMC 5CSZB 1TJ0A 3G5VA 4FN0A 1WBHA 4TNFA 4WKXA 2UXTA 5D5MF 1NDZA 1FBAA 2EPKX 3VG9C 4GXVL 2EYTA 4JCMA 2IPUK 4DK5A 5GJPA 1TJMA 2A3CA 3SPVA 5D7SH 2VC5A 3NQAA 4XWGH 2DSUA 4MCZB 1E0VA 5GQBA 4XCNA 1VA9A 5C6PB 1IR1A 1ZHKA 3K1GA 3GT6A 4G83A 1G6CA 2AGTA 1UKTA 1S9WA 1OP9A 4P3CH 1ME8A 4PGEB 4CNPA 3R1GL 5KVMC 1TIMA 4QXGL 3IFOA 3CWGA 4ORMA 5TJWK 4HCLA 1PAZA 2WZ6A 3VI4A 4YGAB 1ZLDA 3CZFA 1R87A 4I2XE 4H8VA 5JHAA 1J6PA 3DHJA 1N64L 1LMKA 4LRSA 4JRYA 1QHQA 2PD9A 2WZ5A 4O1AA 1KN4L 4GXPA 1O6SA 2X4PB 1H7OA 3Q65A 4HC1A 2WSYA 2M83A 3VFPB 1XGDA 4NQ1A 1WXYA 3W02A 5GHWH 1C08A 1AGDB 3NQVA 2P47B 1H63A 3UT0A 1X97A 1CB4A 3V4PL 2B1AL 1EPFA 3UYPA 5A8PA 1OFDA 3IJYB 2WXPA 3W85A 2FO4A 4UMCA 3DGGB 3L6FB 4IH3A 1NCDL 1LLWA 1TRDA 3WQVA 4B90A 3TLLA 1OPOA 4IFKB 1HEJC 2C9AA 4IOSD 5EU6D 4K36A 1KFAH 1UYQA 4B96A 4XP1H 5JH2A 4HETA 4YDJA 5FK9B 2YAOA 4N0YL 1DZ0A 3CAKA 2MMXA 3AXLA 3HNSH 3L3GB 3SO3B 4WW1B 3R19A 4S0HA 2F15A 4OF3A 3IYLW 2B31A 3GXUB 5LN4A 2X5PA 5DZAA 3NDYA 5KBNC 3H3BC 4HB7A 3T81A 4H88L 3WLPA 1JWMB 1TPC1 1BIHA 4JG1L 2YPKA 5DCBA 4INFA 2Z2AA 1FZJA 4BH7B 1BBJA 3CX2A 3L1EA 1WDQA 1RHHB 3BWUF 4LS2A 1M65A 1SHWA 3CQKA 3ZE0B 3CVDA 5D4IA 1JXDA 1GY1A 3W1PA 5T1KB 3WKPA 4JD4A 1YN7A 3EXJA 2CCRA 1OX6A 5T1DL 2QLYA 4FQQA 5DMGC 1OF8A 2AXFB 3NH7H 4HV8A 3ARGC 1A5UA 4NXSA 1NIUA 3BAJA 1TWIA 4LUSA 4ZTPH 2OEKA 1G4TA 3LM3A 3WMSA 4PJFB 2A77H 1BYCA 1G6VK 2VUNA 5K2ZA 2FYVA 4NWUH 4U49A 5CAKA 1R3IH 1HZHH 2JK2A 1NIDA 5AY7A 4U1GC 2CHXA 4ILDA 2FD6L 4AD4A 2J5LB 1U8PB 2OI9B 4G80B 3ZFHA 3KNBB 1WKEA 1OAYH 3GC5A 3IARA 1NJ9A 2YGPA 1M68A 5B8CA 2YYTA 5EMJA 1JZ7A 2E6DA 4BXVA 2CUAA 2WVSA 2WIIB 2I57A 2QCCA 2E5DA 5EOQH 2E7LC 4ZQCA 3MI6A 5DANA 3DMMB 4B3EA 4MJ6A 5FL1A 4E5XA 3G5YB 1HYRC 3SGGA 1OFPA 4WI9A 4ZAKA 4N8CL 2W0KA 3QQDB 1LGVA 3HZKA 5JTWA 2QPDB 4GW4B 1NCBL 3VNMA 5F3FA 3K8LA 2E5CA 1S7VB 4QUOA 4Y16A 1TZGH 3TVMD 2F5BH 2L5HA 1G4EA 5DZLA 3FRPB 4LARL 1WG3A 2HLAB 3B03A 3JV6B 1MFMA 1EXHA 1WWBX 3VWKB 4X6DF 3FMGL 3CMGA 1OD0A 5LIUX 1QW9A 3A3XA 1IEXA 5J56B 2OJEA 3A23A 3AM8A 3FPXA 4GFXA 3ARWA 5DZVA 2X4TA 4K37A 5HYIA 4PJAB 3D3AA 3VFTB 3NCMA 4AMAA 3DAQA 4GA8A 4LEFA 3RX5A 5HHXH 2AEQL 3KGSA 3W7DA 1E4MM 1ECYA 3VI3A 4EP8C 1JGDA 2RR3A 3M7WA 3VNYA 1JPEA 5KSAA 4N6QA 4Z7AA 3ZKNC 5DQDL 2DQHL 1UQZA 4H44C 4H9TA 2HTKC 2XPGA 4UTAL 2J12B 4E0CA 3CVIH 3BLFA 1GHSA 4AAJA 1KIPA 1XR8A 3SW6A 3M8OL 2GL5A 4JR9L 4JFDB 2Q3RA 3SKUD 4LVBA 1QWNA 1NGWB 2ED8A 2ZAGA 3BYTA 1Q65A 5E1AB 3EYOA 2NYYC 2EH7L 5AOLA 1ZGDA 2F1BA 1GCYA 4H5SB 3ASOB 3RY6C 2FYMA 4WDIA 2ZSWA 3PJSB 4WY0B 5LA2A 3QIBC 2R2CA 4WTZA 5F88A 3IAGC 1I1AC 1MNSA 1JDCA 1CFNB 1YEDA 5IQ9A 1JGUH 2A6JB 4UZSA 4ZPTA 3F01A 3FXIC 2F53A 1G1OA 3QDAA 2FIRT 2G5RA 4CVZA 1Z66A 4OD3H 2GTZB 4OZFH 2ALDA 4L05A 1UUQA 3IU4H 5IFJB 5REQA 3EXSA 4I9TA 2OCCB 1QCWA 3U1QA 3DX6A 4IKNA 5JZ7D 1GHFL 1JXFA 2JBMA 2QDWA 3LQAH 4R3UA 5DQ9B 2Y69B 2UZIH 2OZ0A 1QLRB 3U0TA 4DIAA 1KXQA 4K7PY 1KLGA 2DZPA 3WSQL 3B7YA 1E70M 4Q4OA 1FCGA 4UV7H 5D1ZB 2R2BB 4LLQB 3IUDA 1FL5A 4NC0B 1BD2B 3QHOA 2QDVA 3JTSB 1T6BX 3I3BA 4ZFMA 3MNVB 1Z7JA 2QV2A 3RWGB 3S6TA 1TVLA 5K9JH 4MXVE 3QNYB 2HKAA 4XAGA 3VG0H 1QUNA 3EYFA 1NAL1 4ZOEA 3WN5C 3FZUC 3T3PF 5IBLC 2GWNA 1I0BA 1SDYA 3Q0HA 1BWLA 2IXUA 4QG8A 1V3HA 2J88L 4RMQA 3EH1A 3MMUA 4BI5A 1TZIA 1UM4L 1HTIA 3CB3A 3XINA 1IEVA 3X1EA 3T7VA 3L0NA 3U3HA 3HRZA 3SCPA 1CDJA 5L2JA 4HK6A 3KYKL 1YBQA 2PTXA 3H2AA 1O7VA 3U4AA 4ZMAT 3MRDA 4MS8C 2X4UA 2L7JA 4IMGA 4YHMH 4PCTA 5LLIC 1F4WL 5C0CA 2Y7EA 1Q9WB 1XCFA 2NMSA 4OLYH 4EZKA 4GE8A 4ODXB 3RPBA 2V63A 1INEL 4JPQA 4AC4A 1A66A 2YLKA 1ONRA 1FFNB 4FO4A 4PEKA 3GXDA 5AYUL 1WFMA 5KJRH 4L4MA 3DHPA 3KVQA 4ADSA 4I0PA 2ADFL 3FUFA 4PS4L 3M7FB 3MOQA 5HGDB 4LPUA 1WDAA 4HU0A 5ID1A 1TQSA 3US9A 5GS1C 3TTOA 1VGAA 1FORH 5DSCA 5ANHA 5A8QA 5E9DA 4AWTA 1UG6A 3FCUB 2VLJB 4GGBA 2AAVA 4E41A 2HTLD 4B5XA 3GNRA 3CIVA 4YIQA 1Q63A 5AFAA 4Q8BA 1IV8A 2AJVL 3NVQA 1IBGL 3B43A 4WEEA 3HA1A 1F45A 1NCIA 5KSAD 1ONXA 1DWFM 5J13B 4V2XA 2BNUB 3KGUA 3NJVA 1LE5A 5IK3A 3W2DL 3WCZA 2B16A 1JPMA 5D7EA 5DMNA 3RWIB 2A7PA 3PNUA 1RZ7H 4P2QD 4PMQA 1FNGA 1FWGC 1NWUA 3MBEB 1K5NB 4GZJA 3FOMB 3IBEA 4I6VA 1QI0A 4PG9A 2YQBA 5CJQH 5AVTB 1O7DE 1G7HB 4CW1A 3SY6A 3HC3L 3IJIA 2J9XA 1KZQA 3N40P 3HG4A 3M0LA 2IF7A 3FO1B 1G7LB 4I48A 1D7DA 3KPLB 4XP6L 3JVGA 4NQVB 1I2OA 5HHVH 4MAYC 4I9AA 3T8QA 3ZJ6A 3DVGB 2BY0A 1H7NA 5KZ6A 2QHLA 3V4PA 2XIMA 5IM7B 2P52A 4DPPA 4JFYB 2C91A 2MNRA 3MV8B 2NY2B 4AV0A 3E0GA 5IM51 3TCLA 4DK3A 1I3VA 3DROB 2NY5C 3WV0A 3WE1A 2V0TA 2EYRB 5L4JA 3LKPB 4URKA 4ZOCA 3L0GA 2FZ9A 1XF3A 3UZJA 3NEOA 1U95B 3MI2A 2BSEA 2VFHA 2J74A 4FQLH 3NPZB 4JIIX 4JFPA 4L0ZA 1HYSD 4Z0BH 3T0EB 3HIJA 2GJXA 5CC5A 2YGYA 1Q6EA 2V2DA 4DZBA 4M9OA 1U2YA 5GVJA 1E8WA 3BIKA 5I3FA 5GIRA 2Q2LA 3TEVA 3W22A 3I9IA 3MRRB 3H85A 1IL1B 3MUUA 1D3GA 4CMHB 1XGQB 3MPCA 1FGNH 3R8GA 1OVZA 3QJFB 4QX4A 3CPLB 5LGZA 2LLEA 5JQ6L 4LDEB 3C2RA 4V1YA 1NAKL 1F2JA 1MVFA 3GUFA 3G3DA 1K2DB 3P2BA 4HK7A 5FGSA 2BVQA 2OMXA 3UYOD 3APGA 2GC7C 2PPGA 2MUCA 1SGKA 4Y9OA 3SCOA 2JF6A 5AVNA 1QSEA 4EBQL 1FCBA 5M2FX 5A3IC 3BPLC 1BG9A 4NC1E 1LT7A 4BCYA 4PBWD 4IMLB 4KI5D 2ATMA 1MG3C 2VRJA 1ZAJA 3BKJL 4N20A 1CW2A 4MZ8A 3VE7A 1OCQA 1XLKA 2PC8A 3HQPA 1XTMA 1Y65A 4ZMPA 4G6JL 4LK4A 4OCXH 4HIBA 1MRCH 7FABL 2CGRH 4FTVB 1A3QA 3FQUB 4UAOB 4TMPA 3BG9A 1TEFA 2VN4A 4UTMA 3QC0A 5CZVL 4Q8TA 2NW3B 3N12A 3TZNA 4HZLA 1SXCA 3S36H 4ODTL 2QXWA 5E9AA 3STPA 1M1XB 3MOAH 4EX4A 4FC3E 3DOIA 4PJIB 1JGIA 1KCRL 5ACLA 3RVVD 2ZBTA 2WTRB 3QTPA 2YFOA 4LNRB 3V16A 3HC0B 1JGLH 3O4LE 3KFTA 1XCTA 3QUYA 1K6QL 2X1WL 3QWOB 2QKIA 3GI9L 4FYQA 3HO8A 1YNLH 2TSAA 3MRQB 3ABXA 3D4YA 4DO5A 1HINH 4Y1AB 4GNJA 5F2GA 1SEBA 4QRSB 4WZHA 2A6LA 3AG4B 4DKFH 4UM9B 2WKJA 2OK0H 4H0GA 3NVDA 4MNQD 3IXTA 1GOWA 3UTTB 3D8MA 1AI1H 4MVBC 3IVSA 5IB5B 4JNMA 5T1LB 1UB3A 2OWWA 4HN4A 3EOUA 2ADIB 1XSOA 3NSDA 5EN3A 2UZXB 5LWYL 2Q02A 5B1CA 3K5RA 1RUKH 4UNTA 2JCCE 1KCWA 3GZQA 1U4EA 1I1YA 4UTAA 4PG2A 1FFQA 4UDUA 1IE7C 3ALPA 4PRAB 3VPLA 2DM7A 4W8AA 2CIKA 1SO5A 5CZ0A 4LO9A 4IGNA 3UTSE 5GGUA 5L2KB 2YBVA 4Z7UF 1KGWA 2BP3A 4ZO7A 3DXAA 3NSXA 1D7KA 3MCG1 5AVSB 3LSBA 4GY4A 2KT6A 2WSDA 4MRCA 2PURA 3VI4B 2EJ1A 4H9MA 1T6WA 4FHBD 4JPKH 1J88A 2GSIB 4B9KC 3SY0A 3BUYA 3HJZA 4GG6A 5AYZA 4CBZA 5BRZD 3RDKA 2DSZA 5K93A 3LKSA 1D2OA 4H8PA 1OGSA 1WFOA 5JLZA 4PJXB 5F4XA 3QMTA 4YTQA 5BNKA 4KVNH 1TCRA 1MQQA 3ZW3A 4FYTA 1XVSA 4M3PA 3V7AG 3OBAA 4U7KA 1MEXL 3UZVB 3U2CA 4OJDH 4U31A 4FDWA 1AGFB 3G18A 1L2UA 2QVTA 4IBVA 3QCTL 4R9OA 2NZ1A 3TFBA 3DFQA 5IMLA 4YSUA 2YKKA 1TTJA 3TJPA 3U1SL 4JDTL 2HV5A 2CLRB 2P7TB 5TQ0H 5DJ8A 3LGGA 1EEZB 3G0XA 4Y5VA 8FABB 4GBXD 2ZC8A 3QORC 4LF1A 1JPIA 2AP2A 1XB6A 2YDSA 2DDQL 4F1SA 1FL3A 3R0MA 3AMDA 4PMOA 4L4TD 4W89A 4WFGD 4LOUD 3QHNA 4J28A 3HBZA 1UZHA 2P80D 3MVIA 4XMPL 2PYFB 2J88A 1G87A 1JCNA 4Z2IA 1F58H 3AO0A 4FI7A 3CN2A 3QUHA 3U46B 3SD2A 2I56A 1L9NA 1TZ9A 2XX0A 4K94L 1TV4A 5K9QI 4LOEA 5C9WA 1T3FA 1Q8JA 1QFWM 4LLVB 1DWJM 1QKZH 5JOPE 1W9XA 2J56A 5FUZL 1NGZA 3FCTA 3KYOA 2WQSA 4RNFA 1HTYA 1LBMA 2V3DA 5GJSL 2XISA 1OJXA 1CECA 3I6GB 4UNKA 1LD9A 3FQTB 5E03A 4HUUB 1KY7A 1L0QA 4H6KA 4KQ4H 5BZDA 3S2AA 3UMNA 3QDGD 3KBMA 3GQFA 2WO2B 1RQBA 4PWFA 4LJ3A 4YHNB 4IRJD 2X16A 3HHRB 4KT2A 4TVPD 3DTDA 1NCCL 3TJHD 5AKTA 2CLHA 1FKWA 4RMUA 3RTLA 2WJEA 2EEXA 4N2IA 2COVD 1FDLL 3T71A 1EP2A 2Y7FA 1BXXA 1R7AA 4HJTA 4RAHA 3WLBB 5B8CB 7REQA 3E7JA 2WXQA 1QR1A 2E28A 4I8YA 1OARH 2YMTA 3OOQA 1FNLA 4M4PA 3PJXA 4BSWB 4MJHA 2E09A 4NHVA 1TQBB 4R7LA 1UTDA 4UM8B 2OOGA 3O1NA 4M3HA 3V9FA 3DO7B 3ZIYA 4Z7WA 4TQTA 2B08A 5KS9F 1JDAA 3FIGA 3MLYH 3PY2A 4ZAKB 1YPZE 1G1YA 4PVMA 3P62A 2VDNH 4JGNA 1U8QB 4QRRD 5CSZA 1JNNH 4G5ZL 4A39A 4R88A 4DP9X 2XQ0A 3ARBB 5AEAA 2O5ZH 1EFQA 1XIWD 5CUSL 4ORIA 4QDWA 3QUZD 1BPVA 2GUYA 4IHBA 4OB5H 5C9UA 4ZXBB 3FNDA 1ZPUA 1WHOA 1RULL 4S1DC 4OGYH 2VW4A 3ZXWA 4FKEA 3G8RA 3X2QB 4DN1A 2I9EA 1KDJA 1DWAM 4ZMVA 3MJ9L 4DGYL 1T8QA 4OWGA 1RVGA 2AK4B 3BP4B 1MSSA 3A9BA 1DBBH 2ZRVA 2N7AA 4EPEC 4ILSA 2CLIA 4DRSA 4HUXB 4PGEA 5HPOA 2V9DA 1XG4A 5EA0H 4AQOA 1QLEH 1T1XA 4LSRL 1IGFL 2PR9A 1UC6A 4R83A 4GO6B 4K1GA 3AABA 3INOA 3CHOA 2FEDC 1QPRA 2E7BA 5I1EH 1OWWA 2YRPA 3DXIA 2X4PA 1ZOXA 1YECL 4IZGA 3VNKA 2G96A 1LWIA 2NY4C 1CDYA 4FF9A 1AGDA 5LA1A 3NPSB 4GFSA 4NN7B 3LPFA 5DU7A 3NQKA 5FHAL 4BK5C 4O5LL 1BW8A 5F7AA 4PU2A 1YEDB 1UENA 4UBDC 1SQ7A 5JBEA 3TR2A 3L6FA 4JX5A 3UROR 2WZPD 3GFZA 4AL8L 1NMAH 5E6UB 4ZSOB 3NO5A 4BZ1H 1M5WA 2ZUTA 1AAJA 4K38A 4YO0B 1KRMA 3BCFA 2HE8A 3QJOA 1X5AA 1QO5A 2C3GA 4B2DA 2DTML 1Z32X 4IFKA 2J78A 3AG2B 1ME7A 3A47A 2XWCA 3AT9A 4R0LC 5C08B 1CG9B 5FK9A 2X41A 3L3GA 3WKNA 1BM3H 3CO4A 4WW1A 3H2NA 1XYBA 4P2RD 3L3OB 5FGCE 4QYAA 4M1CC 1FL6B 2MTAA 1T1YB 1FL5B 3V6OE 1JWMA 3GS4A 1OYBA 1RK7A 4UTBL 3ARTA 2OV0A 2VN3A 4DELA 5CCJA 3W7HA 3KLSA 4XTRD 4Q97A 4DGIH 4BH7A 3KD4A 1A6UL 3VH8B 1KTLB 1RHHA 3M1OA 3EYFB 2VR8A 3JT0A 5DHXB 3X13B 1G5GA 3WK0A 4C58B 3STFA 2ZCLL 4M48L 4XPGL 1E9YB 1O0VA 4UTKA 2PTDA 1Z9PA 3W88A 4PJBB 3G6DH 2AXFA 3VXRB 3GYEA 4AITA 2DLHA 2VKZG 3HRZB 1B90A 5L2JB 1G01A 3HURA 3W1NA 2BP0B 1YBQB 3NPXA 3A64A 4PJFA 2E74C 1F76A 3MO4A 1V5XA 3GVGA 1JRHH 3ZO9A 2GY5A 4UIKL 1CICD 3TEXA 4AYID 4YVUA 4RGNB 3B8TA 4BZYA 1U8PA 4G80A 3D5HA 1FJ1B 2X6AA 5IHRA 4XQ6A 1HQTA 1AH3A 4N4QA 5HWNA 3KNBA 3IFNH 3NIGE 1KCUH 2ZCKL 1XXDC 3VWJD 3TCTA 3BFOA 1RKRA 2WIIA 4O50A 3SE6A 5IT2H 1YYAA 3DMMA 2F8XC 3G2GA 4I0PB 2EBNA 3G5YA 1S5TA 2ARWA 4BK9A 3ERPA 3QQDA 1Z89A 4JFHE 4QGTA 1QYGL 4GW4A 1YRRA 3RKPA 4FS0A 5T1JA 5LJYH 4KWWA 1USZA 5JXAH 3K2KA 3WIHL 1TSRA 1OY0A 4PLJC 1S7VA 1A14L 4PJ7F 1QRNB 2CD0A 2ANUA 4CSZA 3M1ZA 3AISA 2P28B 4PMYA 5JHDE 2HLAA 3JV6A 2W67A 3TTEA 1D5RA 3VWKA 5I79A 3QEQD 3EWBX 4PTXA 1BVNT 2Z7ZA 2GJZB 3RUBL 4ZFQA 4DXVA 2C7FA 3QEHB 4ZS7L 4PJAA 1CXFA 3VFTA 2EIDA 1C9DA 4QY8B 2HKHH 3BSGA 4JEJA 5ICYB 4K8RC 4L5FH 1OCZB 4UOQA 2DZUA 3NCYS 2NZLA 3TJXA 1CEOA 4S3KA 1FAIH 4B9CA 5FF0A 4JFDA 5KYXB 3PZQA 4X5LA 1NGWA 4Y9MA 3LHAA 5E1AA 2EDMA 3EA3A 3UO1H 3WEXB 3E2RA 2X38A 4WWKB 3K2UL 4H5SA 5F2MA 1GOXA 4LRTA 3NGBB 3PJSA 3NNTA 1UURA 3F8UB 4WY0A 4C7FA 1I53A 3GZ3A 4Z3HA 1QVOB 2AAAA 2Y07L 5T3XD 4MWAE 3C08L 1HXKA 1CFNA 4DP7X 4F15C 1M53A 1FHVA 3W7GA 5JIMA 1MW1A 2A6JA 1FG9C 1CQKA 4V33A 2OKOA 4JRXB 5L8KB 1DJNA 1HHJB 4IJRA 2GTZA 4E4PA 2KQMA 2UY6B 5SV4A 1YXYA 4DPAX 3ARSA 5IFJA 4L7ZA 2X70B 4KDWA 4PV8B 4KWSA 4FYRA 3JRKA 2AOSA 4UR8A 1Q2RA 4YDKL 1TPVA 3FU7A 2E27H 5DQ9A 2I5YL 1QLRA 4M1GL 4PGZA 2BOEX 4W6YB 4F5CE 4C4UA 3ICJA 3N18A 4YVPA 2A9NL 1KPUB 3SRKA 5D1ZA 2R2BA 4LLQA 2E25A 5I74B 4LAZA 3P54A 1B6UA 1BD2A 3S0PA 1AR1B 2JIXB 3TWCL 3KDNA 4R8WL 3JTSA 4XMTA 1OFEA 1URZA 2QVKA 1DXIA 5T1KD 4K7VA 3MNVA 5SWQA 3WHXB 4WV1A 4KK6C 3MLVL 1NPNA 3RWGA 3MYOA 3W82A 3COTA 5D4HA 3QNYA 4JFXB 4S3GA 3BIKB 4HFUH 5GIRB 4Q4PA 4ONVA 4R7VA 2P44B 5PCYA 1OC6A 4O57A 2B8OT 3IANA 3DETC 5IJBC 4KZEL 3N1FC 3TH6A 3NZGA 3L4CA 3CN0A 3HMWH 3EXTA 3FU5A 4HUWB 5F9OH 1UWFA 1P84J 3QQ4B 4B9GA 4B7LA 4GS7B 1S5HB 3H4XA 4A2DA 3L3HB 2VC2L 1ZSXA 2Y6SD 5GZNC 3G1DA 3KGTA 1ONQB 1PZ5B 5I9QC 4IMFA 1U8LA 5FV1L 1OM3L 5DURD 2OR9H 2ZQKA 1Q9WA 3HNVH 2FQIA 1P5UC 3TASA 1H5BC 3M5YA 4YN3A 5GPRA 1OQXA 2PDQA 4KQ3H 3C0JA 4V2CB 1E6RA 4HMCA 5FYJL 1FNSL 1Z3RA 1FFNA 3BEVB 3C09C 4G6MH 4UTLA 3NIFE 1SOKA 4NPJA 5E6ID 5I18H 2RHGA 4HIHB 4IICA 2O1AA 1BOGB 3IE4A 2IH8A 5HHQB 1WVZA 1XIJA 3GW3A 15C8L 3OLDA 3MJYA 1WDDA 3PZOA 4Q74A 5B3NA 4K8EA 3LCIA 4MYXA 5A6MA 3PCYA 2C9XA 1MKFA 1M4KA 1RU9H 4WTWA 4EJ1C 5LGJB 2NR6D 2RQ8A 5SWSB 2ZZUT 1S3KH 3O16A 5F97E 5DT7A 4K8RH 2R56L 4IUOA 3DIDA 1T5AA 2FHBA 5MEQB 4BZ2H 4POZD 4APQD 3S8HA 3V0HA 3X11B 3LI1A 5BO0D 3HZVB 3R0NA 2HWZH 4YNYB 3SKMB 2KZKA 4MY1A 1FWTA 5C0FB 4C7GA 3WUWG 4JFDD 2UVEA 5DGQA 1SEBB 1OP4A 1GAFH 4MXWL 3RWIA 1XLFA 3RO8A 3I3EA 2JI3A 1SJHB 3MJ9A 1G9NL 4HWEL 2FGZA 2DBLL 4UB0H 4KHXL 4MDIB 4JO4H 2NQ9A 4Q9RH 4IISA 3MBEA 1K5NA 3FBKA 3FOMA 1JVOA 4PTTA 4FQCH 3CV5A 2OPCA 1R0AL 2F7RA 5SWZD 4IRSB 1G7HA 2YAEA 1TVHB 5GRJL 2C19A 3QQ9D 3FFCD 3K2MC 1HC1A 1HVXA 3I6LD 5EF1A 4Z7QB 1LP6A 3FO1A 2PGWA 2YBUA 2E9GA 3KPLA 3B5HA 3MUHL 2D2OA 3MXWH 4QKXB 1K3ZA 1G1KA 3DVGA 3S6DA 4GYKA 2DJLA 4FKKA 3MJ7B 3SDCD 4Q8UA 5IM7A 2EINB 6REQA 4JFYA 3MV8A 4AYMC 1JNEA 5TTRA 4H83A 4Y7OC 3DROA 1CK0L 2DBJA 2WKGA 2EYRA 3LKPA 4NUMA 4V28A 1U95A 2Y8VA 4WUKH 3W9DB 2XN0A 4I9JA 1LEKA 4ANXA 3MMDA 4M5YH 4CADB 4O51B 3KHQA 3T0EA 5C09E 3RHGA 4YCPA 4S1RL 2ROXA 4AE0A 3ZE1F 4ACPA 4P5MB 3MV7B 1NZRA 4UTBA 2R0WL 3X3GL 4AH7A 2EABA 1IL1A 4QTGA 3RLVA 1XGQA 4AEIL 3QJFA 4X7SL 3UPCA 3CPLA 1X5XA 5KJ4A 1AJZA 3BUQA 1T4WA 3WBXA 1I9JH 3OODA 2O5XL 1FL3B 5FEPA 5ICZB 2OZ4L 3FTYA 3G1XA 3BI9X 3PFMA 2PWGA 4CCZA 3UADA 4AGNA 4WX2A 5BOFA 3OKLA 3EWWA 1G7QB 3U9IA 2FJHB 3LLXA 3IMRA 2PYED 4U2ZA 2DJXA 3H2CA 3O2VL 5HHNB 1I8UA 1CGTA 4IMLA 3FFSA 4QM1A 4JGDA 4DX3A 1X7IA 4HG4J 1IGCL 4LUIA 4OF0A 5IBUB 3NO3A 2H26A 3I02B 1B0GB 3V0GA 4B3VA 5CGBA 4Q7IA 2FPTA 5CEZL 2VLJD 1P84K 3UPAA 4FTVA 3MRMB 2PWVA 1L6FA 2VI0A 3FQUA 4YFLI 4FMKA 4DN3L 4UTIA 3TA4D 3S5LG 2NW3A 1L6ZA 3ZHLA 3L5IA 1JCTA 1Q0YL 1ZV2A 4JUTA 1CQYA 4CQ8A 1M1XA 5J8OA 2Y2TA 3GSMA 4PUJA 1HWHB 4PJIA 4HSQA 1GS7A 2VEIA 2WTRA 3PWUB 4C56D 2VSCA 4LNRA 3HC0A 2ZX9A 2G2NA 4FMFA 1TJXA 3CDCA 4F66A 2D7TH 3K6NA 2BDQA 3WIHA 1GOGA 4YWGL 3QWOA 3IETB 3U4BH 1CXHA 3MRQA 3J7HA 4YBQC 2FWSA 4OU3A 1DBAL 2VLKD 1BEUA 1A21A 4Y1AA 1NCNA 4QRSA 3IN0A 4UM9A 4XNUL 3UTTA 4TNVK 3R8QA 1XGTB 2PCFB 4IMKC 5IB5A 2PP9A 4I1PA 5T1LA 2FMOA 5EORH 2ADIA 3REQB 4Y89A 4NRRA 2UZXA 2N7SA 5CSGA 2H8XA 4NRSA 1SOSA 1O7DC 2PFHA 2DW7A 4NKIL 3WLHA 2K4WA 3GM8A 5DY3A 3I6TA 4PRAA 4ZT1A 3U1PA 2YX0A 1AO7B 2P88A 5A8OA 4DJEA 6CGTA 4JPSA 4MZ3A 3L4VA 2GWGA 5L2KA 3CVHH 2EJAA 1W9UA 3RU8H 1W3IA 1R6VA 2NY2D 4NY2A 2Y7LA 5F2IA 3DV6B 5EOTB 1T1XB 1VRXA 2EIBA 1G69A 1OANA 2ODIA 1KY6A 4TQ8A 4JAWA 2GSIA 4AQ8A 5EZOL 1CC3A 1TPB1 1ACCA 5KTEH 1NWRA 3Q1SH 5CD5D 2H2PD 4ZQTA 3QY7A 2A0LD 3OYXA 4BF7A 3QUXB 4PJXA 1VPOL 3RVXD 4O10A 3GIYA 1Q7QA 4OQ1A 1HILA 2KPWA 3V0SA 4Y7MA 4LASL 3UZVA 8XIMA 5TK2A 2FLBT 3ZDXF 3VXUD 4L65A 3NRPA 4A3UA 3EO9H 2K45A 5JA8B 3D2UB 1AGFA 2X1IA 4XNQB 4YE4L 3EB3A 3EWDA 1BEXA 3GSVB 2ZOKB 2CBIA 2HKFH 1FDZA 3D7PA 2ICEB 1II4E 1R9FA 3QSKB 4DEPB 2NZIA 5IW3A 2Z4QB 2X1UA 1QT1A 3A4JA 5EYWA 3ESPA 2CLRA 1GVOA 2V68A 3L67A 2P7TA 3F04A 1Q13A 1EEZA 3HQ1A 8FABA 1FX6A 1MQKH 1K02A 1X9RA 1SHSA 3M16A 4V2BA 3D06A 3CV6A 1JPGB 1FWRA 5AZ2L 5LXVA 2PYFA 3OPZL 1P0BA 4HSHA 3AWEA 4DI8A 4LVNC 3SN4A 4ERGA 4XKMA 3U46A 2H90A 3R06B 3AITA 2XRAL 4LLVA 5A16B 2IBZY 3NCOA 2LU5A 3W7MA 1LO0H 1PZ2A 1EC9A 4NC1C 3UWZA 2OSYA 1KM4A 4EI5D 3I6GA 3QJQB 3VI3F 4I9WD 2WHLA 4JTEA 3FQTA 3F6IA 4HUUA 1CFSB 1LO5B 1PEZA 4ENLA 3WLJA 2CYGA 2OLSA 3FTWA 3R2GA 3K81A 1PL9A 5C7HA 3TW6A 4OVUA 3MCLL 4YHNA 1CGWA 1QTYT 1NEZB 2HVBA 1RQHA 4GXUM 3PTQA 4P4KB 5JW4M 1QSVA 1N0XL 5IFPA 3O6KL 3DERA 3MOBH 1KKRA 1ZY9A 1W1B1 4N5ED 4O9HH 5DVMA 2J9YA 3D85B 2QSVA 4FK9A 2W9EL 5GS0H 4XP9L 4OE7A 4L37B 1HP5A 1ZXQA 5CINH 4GQRA 4HG4K 3WLBA 1IGML 3QFGA 3BW4A 2ZG3A 4AWSA 1YEWA 3USZA 3WDRA 1BIIB 1QOKA 1B4RA 4FNQA 2CHWA 4AMWA 3KPQB 4BSWA 1TTQA 3FTUA 4UM8A 5HDQH 4GP5B 4X9FA 3DO7A 1TFPA 1V7AA 1EO5A 4BKNA 5I24A 1AK5A 3B34A 1U8QA 3HB3B 2XFRA 2ZVIA 4MZYA 2XVNA 8TIMA 1XYCA 5KAQG 3ARBA 5HDBF 2XWEA 1ZCCA 4XKYB 5L2KD 4LVDA 3FVMA 1JD7A 1AQ0A 4ZXBA 3OLGA 4N24A 3A67L 1QR7A 3ECQA 1VCAA 1IAMA 4AXKA 3KBVA 4V15A 1NUFA 3BESR 1J0YA 2AK4A 2PAJA 3BP4A 2JGQA 3QZWB 5AYXA 4M7JL 2G30A 3BLLA 4HUXA 2XPYA 5D2TA 5D6CB 1QBLL 2VZTA 4QJ4B 4JRYD 2ILLA 3ZJKA 3PG9A 1DO6A 2QMJA 3PZIA 2E8ZA 2KMWA 4HF5L 1Q1JH 2X2JA 1NGXB 5DHDA 2WWKT 2Q09A 3QLLA 4BSJA 4P06A 3H7UA 2P48B 3DG6A 2CZVA 3EF4A 2QV5A 3CL6A 4BKLB 3QRLA 3OAYK 3WGVB 4TSAL 3NZPA 4OZHB 4D9LH 3DTUB 1OT1A 2WXNA 1ONEA 2P46B 2A7NA 2GAZB 2R29H 4LYKA 3GD1C 5LGXA 4TQEL 3CK5A 3RVWC 5DFVD 4AGMA 4EQ3A 3L1OL 1T2QL 4K71C 3NFSL 2XVKA 3S3PA 3QPQC 3S34H 3NJ3A 3LS9A 4ZSOA 2NZ9D 5JMOC 4Y4FC 2IDTA 4KOBA 4YO0A 1KUMA 2YXGA 2IEPA 5EEUA 4KK8D 3AADB 3R79A 1S7QB 3HUJB 5IW6B 5C08A 1CG9A 3FU7B 5K4ZA 1J18A 3OR6B 3WJZA 5E56A 5D2YA 4OM1H 4QDGA 4DB7A 5C0IB 4FCHA 3L3OA 3LXCA 1FL6A 1T1YA 2GABA 2ADAA 1Y1UA 4F7PB 4M8VA 4D9RE 5FGBA 4HLZH 4HWZB 1AOHA 3N3TA 5I1IL 3O8XC 5SWQB 1RK0B 4WV1B 2A7RA 2ZKHL 1AE6H 3PHQB 4X2PA 5I6XB 3FA3A 2OZ4A 3VH8A 1KTLA 2NQ3A 2QQNH 1ZCRA 1SYSB 5AVXB 3RGVB 3X13A 32C2B 1BVKB 3DV4B 2NY0B 2EIMB 2ZUSA 4NSKB 2ZXAA 3S5SA 1M2OA 3F00A 2Y5TB 1PX3A 1A3WA 4JMNA 4X4ZA 2Z00A 3NSYA 5KSBF 4U33A 4PJBA 1EMTL 2QYGA 3VXRA 1J0JA 4Z1AA 4O19A 2BP0A 1AJ7H 4MAVA 1KBPA 5LDUA 4OLUH 1H6FA 3WMBA 1A9VA 4FRWA 1U8LB 4XVUC 5LBSH 3TN0B 1FBIL 3UWUA 2FT7A 1FJ1A 2JE8A 4U05A 1MCQA 1WRFA 3REWB 3PUOA 2VCCA 2RGMA 5EUOB 4ZAKD 1PXGA 1QNZH 3THCA 2H0EA 4NRXB 4L23A 1A5FL 3UETA 2APWA 2CRYA 2DKMA 3MKGA 2OM5A 3NMEA 3MTRA 2NW0A 1E42A 1XYAA 4FI8A 2VERN 3L7FB 3QARA 4H8QA 3VUSA 1XJBA 3Q8FA 2YB1A 4Y16D 3O3RA 4H2HA 2VYRE 4EXPX 3CV2A 2XTJE 2ZXDA 1IHIA 3FSUA 4X9BA 1XYMA 4G2AA 3AQDA 2N0KA 2AK4D 3AZTA 4G72B 1QRNA 4GKLA 4D0BB 3HMXH 4JS7A 4ML4A 3A4FA 1T21B 2DY2A 3EGDB 3QCVH 1RUQL 3TYGL 3BQ6A 2GJZA 4JM0A 3DVFA 5DD3H 1H9DA 2WLYA 3QEHA 4PLOB 5AAMC 2WO3B 1V6TA 1KC7A 4F8TA 1CDCA 1ZZMA 2Q0ZX 4M6NH 1VBJA 4QY8A 2MHAB 1A3XA 1MWOA 3RZCC 3JWOC 5ICYA 1GTNA 3WUGA 1O5KA 3FQNB 2N0MA 3QJSB 3B8WA 4KGJA 4EUPH 4Z42C 3BO9A 1WJ3A 4HKPA 4DI9A 2XYBA 3VD1A 2YZ8A 4LAUA 4KKCC 3GB6A 4PTTB 2AVFA 5KYXA 3ZUNC 2PU1A 5A2FA 4G7VL 1ZPTA 3JTTB 3WEXA 2R0ZH 3PWJB 1N8ZA 3WS6A 4EVZA 2KDGA 4WWKA 4FF5A 3NJIA 3EBAA 4L61A 4O28A 3ZIZA 4WKFA 2F53D 2E59A 1LZOA 3BLOA 4WAFA 5EEXA 1QVOA 4BJLA 2GHWB 2EZ0C 3GMQB 5EZLB 2VEMA 1EEPA 4WO0A 3EYVB 4I0CC 4XO9A 4JS3A 1PLBA 3LZ3A 4JRXA 4NZ1A 1CIUA 2I25N 2PPDA 3WYZA 3QZNA 1HHJA 3MQTA 4C6FA 2UY6A 2NNXA 2B7PA 3AHYA 4FJZA 5DZPA 4DHGA 1MHPL 6REQB 2PN5A 2X70A 3MV9E 3RIFK 3CMOL 4PV8A 3K4WA 4XNDA 5D7HA 5I0VA 2HRWA 3EYUL 3GWJA 1EJXC 4XO5A 2LE9A 5B3JE 2YW3A 3ZL4L 3OTTA 3B9DA 5BZWB 4PIRF 3ZLFA 2A1WH 3S96B 5FA4A 4F1ZA 1TCDA 2MFNA 3HN5A 4C6LA 3WMQA 3ULVC 1KPUA 2GIYA 4N2AA 1I3GL 3V6OC 1LEKB 2ZRWA 4M7KH 4XZ9A 2JIXA 5FKAB 3EMQA 2E5EA 3OHIA 3CZKA 4O1BA 1Z9OA 1MZYA 3B2DC 4JHVA 3WHXA 3AG3B 2E9JA 1E9IA 2CO2A 2ZZ4A 3T55A 5LNVA 1BJ8A 1W9VA 4LCRA 4X2UA 3GGWB 2CBVA 4JFXA 1GVQA 3THAA 4KJQC 1YXDA 5EZIL 3MYPA 3KBHE 1TOXA 1AH1A 1RY8A 4KCWA 1BMGA 3FT3B 2R82A 1F42A 1YTDA 1UASA 3TSDA 1JZ4A 3VACA 5I8OH 5C0CD 4HUWA 4GYPA 4M62H 3QQ4A 5F1OB 1S5HA 3L3HA 5I17B 2HK1A 3ETTA 1ZNNA 1Y18B 2Z1KA 2EC9U 4U1IB 4L4VB 1UWUA 4J6IA 3HFMH 1ONQA 1PZ5A 2DL2A 2GJRA 1BXUA 1J8SA 5A7EA 3OKLB 4M8RA 2WTOA 2AZUA 5DWPA 5J57B 2A4CA 3NZUA 1AXTL 2UWFA 1Y0LB 3S8GB 4ZA0A 2Z27A 2L7UA 5GNXA 3GSNH 1I60A 3UTPE 4KY1H 4I0PD 2A9BA 1BWMA 5L8JB 4OJFH 5JUEH 3BEVA 1N6VA 3O0FA 3ZMRA 2OCFD 5AOMA 1IO4C 2H26B 2JKEA 5AZ1A 3HC2A 1CLYL 1KBGL 5E9DD 5EMYA 3N43F 4JM4H 4HIHA 5MHBA 4F2TA 4E41D 3RLUA 1Q5MA 1BOGA 1DPMA 3F7PC 5HHQA 1QRND 4IKIA 2F9RA 3BKCL 3GBMH 3NUKA 4KS0A 1URIA 3M7OA 4LB3A 4I7WA 4FG6D 1F18A 4B4HA 3UGVA 1PHQA 3CIAA 4TULH 5LGJA 1FG2B 3FJNA 4LCCC 5SWSA 2Y7SA 2B4GA 3SAZA 3N06B 5LCVH 4JPWL 1TKKA 2W9DL 3EOOA 2F6UA 4NI3A 1E4KA 2YD0A 5MEQA 4RISH 3GM0A 4TKWA 3WNNA 3OF6A 1KFCA 4F0LA 2XIJA 3HI1B 1UW9A 4XUYA 3X11A 4G42B 4DYKA 3HZVA 5FW7A 4YNYA 4XPTL 1NAMB 3SKMA 1C29A 3ZZLA 5C0FA 1FTXA 5FL0A 5HYJB 4WGXA 3P6LA 1MF2L 1SJHA 2DYSB 5I73B 3PULA 1JAKA 5EBAA 1QJWA 4PA8A 4MDIA 3PVFA 3FJ6A 4APXB 5B3SB 5TE4L 1HXJA 4AIUA 3RDTC 7CGTA 2BVWA 1DQML 2VM3A 4IRSA 4LBEA 5HYEA 1I85A 3QFWA 1TVHA 2Z6JA 4JN1H 1H15B 4PMRA 4OQTH 1UM5H 3TLRA 2WWMC 4MWAC 1Z3GL 2DB8A 3ARVA 4NKDB 5H8PA 2NY5H 1G7IB 3QOMA 4OLXL 5E6ZA 5TF1H 2G50A 4XNZC 3L9BA 5D9NA 1IIKA 3M1CA 3HR5B 4H6QA 3MJ7A 3KRZA 4N2DA 2BSED 4JGUA 1JSYA 1KGIA 4XCFH 3LIZA 5CKAA 1IGIL 1S2EA 5KBKA 3TC3A 1GIGH 1SO3A 3CHSA 4TF4A 1ZWIB 3B0PA 4J4PA 4XP4L 5F7KC 3W9DA 1HILB 5IG7A 2AJXH 2R69H 3BUPA 4CADA 4O51A 4AUUA 4DM1A 3SGKC 3I84A 1G4SA 1PZAA 2DQXA 1U3YA 2QTVA 5F9WB 1Q4WA 2EGZA 2AEPH 3S5ZA 3N11A 4P5MA 4E9SA 3MV7A 3JS3A 4CLMA 3B2VH 1UZ6E 5CP3A 3UXAA 4OZFG 3FLUA 1G9HA 3WAKA 2VEKA 3GMRA 1VHNA 4Y2WA 4HGWB 3PWIA 4P7NA 3E8UL 3O3UN 1XGPA 4WKZB 4XBEH 5D38A 2MQCA 5E95B 4IIEA 2IFFL 4LOVA 2ERJB 4TQHA 4L4PA 1QSED 3DBNA 5D93C 5ICZA 3CH0A 3G0SA 3MI3A 3NGJA 1F7BA 1N4XH 4Q89A 4N0CC 1G7QA 2FJHA 3K4AA 1ZU8A 1DQXA 4ODVL 1J05B 3K71A 1HX0A 1T0NA 1Z9AA 4TTUA 3JVFC 3V0VB 2UWEE 2VC2B 1GEHA 4DPQA 1RCOB 3H24A 5HHNA 1FP8A 3EKGA 3LNMA 1PPIA 1MNUL 1J2WA 3I02A 1B0GA 3HG0A 3NA4A 1JPTL 1A6WL 5FCUL 5EO0B 3MRMA 1OSPL 4WW2F 2WCPA 5DD5H 1A5LC 4B92A 3RL2B 3WXWL 3NYZA 1BFOB 3VRIB 3D25B 2FLMA 3NIDE 5J06A 6FABH 2E77A 3QUYD 3SBPA 2GZXA 3OF6D 5B22A 4NP9A 1IAOA 3PWUA 3VNJA 4MKMA 1RPUA 4OD2B 3DX2A 4MJIB 1H3VA 4S2CA 4HNTA 1UD4A 4MD4A 4I7VA 4HCRL 3UP1A 1NSNH 2FX9H 3BSMA 3IETA 5D9PA 3NEVA 5A43C 3WDJA 1QPQA 3U9UB 2NXGA 3MKCA 3FXGA 4TO8A 4NSBA 3FN0L 4MBRA 3RFAA 2Y5QA 4AM0Q 3KP1A 3E49A 3UOAB 1KG0B 4JKPH 3TO2B 3PWAA 3SUSA 3AYTA 4PJGF 1A5NC 2VZOA 1XGTA 2PCFA 3CFKB 2W65B 5FWQA 1GZJA 3REQA 3QI9B 1FH7A 5F7LB 4XPFL 4OCMC 1LWJA 2GCYA 3VSUA 3DXAD 3GVWA 1QX1A 4RDVA 4N25A 2W38A 1GZHA 3IPFA 2Q2EB 3CGTA 3BZDA 3LS4L 5TDPB 2DYPB 2HE5A 4M8UA 1NDMB 5I1HH 1AO7A 2WXLA 4XNBA 1AZNA 1LEGB 4UMAA 5FO9B 1FHUA 3V5HB 1KV3A 1A7RH 3FBQA 1U83A 4FP8L 1H9VA 2OG9A 3PWPE 2OT0A 3GK8L 1YJDL 1B3YA 3DV6A 3LA4A 3RDJA 5EOTA 1A64A 4M51A 2IDQA 4ATTA 4Z7NE 5D7LE 3RMJA 5D55A 4XI5D 4XP5L 4M5ZL 2JJSA 1H3PL 2P26A 1HQRB 3MROB 3QUXA 2FIQA 3N2JA 1N19A 1ICPA 3MSRA 3R43A 1CDGA 1OTTD 2ZYFA 3CN1A 3HRPA 5XIMA 1OKEA 2IPKB 1QBMH 2E9WA 2TRHA 3NZ8B 1SFDA 2GGJA 3EOEA 3SM0A 2DQUH 3D2UA 2WQ8A 4XNQA 3AI0A 3TFKD 5FLVA 2EADA 3GSVA 2ZOKA 1B9KA 2A6NA 4H8UA 4HJGB 3EO1B 4YDIH 1Q9OA 2ICEA 1ET8A 4A3QA 2PTUA 2Z4QA 2CBOA 3C56A 2VLLB 2E7DA 3NCJH 2BLEA 3P3SA 4HNCA 3VIJA 1YNQA 1TELA 2XFWA 2FDMA 2W60B 2YUZA 4NJ9L 1IGJB 4XD4A 3CLWA 1BM7A 1Q8AA 4ZMOA 1JPGA 3WDHA 4Q14A 3ULVE 2X6MA 1YC8A 1V0NA 1T0MB 4J3UA 1INDH 1N26A 4PCYA 3R06A 4FA8A 2GQHA 1T7ZA 4R4FH 3JBG7 4RRPM 1JGVH 5ITBH 5A16A 3SFWA 2DQDL 3GU9A 4A67A 2IWFA 2CA3A 2EDKA 2YL5A 1KYOJ 1VEPA 1MH5B 1LOQA 1BV8A 3UR5A 1CFSA 1LO5A 4JEGB 4XPBH 3T08A 3NOIA 3QY8A 1KFEA 3TIEB 4X7TB 2IPGA 3WF0A 3VTAA 3TK7A 4BDVB 3B0XA 2FTWA 5CFAA 1NEZA 1XQKA 3EYQC 3NFPB 4P4KA 3QIUC 4QCEA 3QKZA 4KEUA 1X5IA 1V79A 1C3FA 3EYSL 4MYAA 4PIBA 3D85A 3B2MA 4P7LA 1XF1A 1OK4A 1PG7L 1DR9A 1UKSA 4L37A 1RERA 3QZLA 2PC4A 5AKQA 4NUGH 3NL5A 5D2VA 1WIPA 2APVA 2TSBA 3KPPB 2BRRH 1BIIA 4FJYA 4PJCF 4ELMF 3KPQA 5E7BA 2E7CA 2C7UB 4TLTA 2PDBA 4NN6C 1SY6L 1NC4B 5HYSG 1UM6H 1G9ML 4WNQB 2FEJA 2AABH 2Y06L 2AAMA 3QBTB 3HU7A 1KBJA 3TGXA 1DQLL 1BRLB 1YX1A 4Q8MA 4NFBA 5AHIA 5INCB 4XKYA 4JREC 3T0WA 5KVFE 3T0DA 4C6DA 4DERA 1AACA 1NAML 1Z6JT 4S3CA 1M04A 2VX6A 5IOBA 1JHTB 1UGNA 5JIWA 3DFYA 2A74B 2BNJA 1HESA 3E0LA 3TXZA 4Z7VF 1WP6A 4MAZA 3QZWA 3SJVE 2JKXA 4N4PA 1F3XA 2CLZB 1IAIH 3IU3B 2XVGA 5D6CA 1CWYA 1JZHA 3GDLA 4IBSA 2DKUA 3BKYH 4FNUA 4P46C 3QUXD 1I9CB 1V10A 1RP9A 3WELA 1TWWA 5D05A 1QFEA 1NGXA 2VW7A 4WTXA 5JHLH 4RZ6A 4M4RB 1JV2B 3F7YB 3TA3B 4BKLA 3O0KA 1D6EB 5IEKB 5F7BA 1SJDA 4OZHA 4GXWA 1N8ZB 4GSUA 4KAQL 1GTEA 3S37X 4IPNB 2YMXH 3WDQA 3UU0A 4LL9A 3QPXL 2HRPL 1DFBH 3SDXB 2W66A 1JNLH 2GAZA 1V7ML 1BD0A 4ADGA 4Z95H 1UCTA 4B2DD 4MAUH 4BQCA 3LDVA 4P5SA 1UYWH 3TH2T 1KB5B 1XAKA 2VEGA 2PGRA 1X4ZA 1RJZB 3BGAA 4PJHF 2F1EA 4M1DL 1JWSB 2CBTA 3N34A 4MWFA 2YD9A 3PREA 3UIZA 3QOKA 3OC8A 4DW2L 4PRHE 5KVEL 3KYNB 1S7QA 3B56A 3HUJA 5IW6A 4LS0A 1A5AA 1OAXL 3TYFB 3VIIA 1IGTB 3S46A 1WS7A 3OR6A 2IMRA 5HBBA 4BFJA 1RZGB 3GHBH 5C0IA 2JTYA 5FA4B 5IROC 1KBVA 3IS1X 4JFEB 3RNDA 3EKZA 4MUPA 4F7PA 1IC7H 4HWZA 1R86A 3PBGA 1RK0A 4U7SA 4PPTA 1TO3A 3NAVA 1P4BH 3PHQA 3E6EA 4AY1A 2AJSL 5AOJA 2FGWH 1B0WA 1FH8A 1SYSA 1L8NA 3RGVA 1H0IA 32C2A 1BVKA 3DV4A 5KBMA 5I5RA 4NSKA 4S1SH 3GHEH 2Z8SA 4D71A 2Y5TA 4EE9A 5ECJE 1XGYL 2J4WH 2B4CL 3LD8C 1AG0A 4HHHA 1GW0A 5F6IB 1JCJA 2OZTA 2NDGA 3GIZH 1ZBKA 4LVOB 3E6HB 2Z31C </