1WZAA

Crystal structure of alpha-amylase from h.orenii
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
488
structure length
488
Chain Sequence
b'FEKHGTYYEIFVRSFYDSDGDGIGDLKGIIEKLDYLNDGDPETIADLGVNGIWLMPIFKSPSYHGYDVTDYYKINPDYGTLEDFHKLVEAAHQRGIKVIIDLPINHTSERHPWFLKASRDKNSEYRDYYVWAGPDTDTKETKLDGGRVWHYSPTGMYYGYFWSGMPDLNYNNPEVQEKVIGIAKYWLKQGVDGFRLDGAMHIFPPAQYDKNFTWWEKFRQEIEEVKPVYLVGEVWDISETVAPYFKYGFDSTFNFKLAEAVIATAKAGFPFGFNKKAKHIYGVYDREVGFGNYIDAPFLTNHDQNRILDQLGQDRNKARVAASIYLTLPGNPFIYYGEEIGMRGQGPHEVIREPFQWYNGSGEGETYWEPAMYNDGFTSVEQEEKNLDSLLNHYRRLIHFRNENPVFYTGKIEIINGGLNVVAFRRYNDKRDLYVYHNLVNRPVKIKVASGNWTLLFNSGDKEITPVEDNNKLMYTIPAYTTIVLEKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha-amylase A
publication title Crystal structure of AmyA lacks acidic surface and provide insights into protein stability at poly-extreme condition.
pubmed doi rcsb
source organism Halothermothrix orenii
molecule tags Hydrolase
total genus 170
structure length 488
sequence length 488
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2005-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1wzaA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1wzaA01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 1wzaA02
1LL6A 1E6ZA 3DHUA 2G41A 3VINA 2WZEA 4P8VA 3ZT7A 4HU8A 4DWSD 2OYKA 3IJ7A 4QLKA 4PYSA 1GQJA 1O7DC 3WMBA 4H04A 3QGVA 3VPLA 4JKKA 2CBIA 5A6JA 4D6DA 5A8QA 2GK1A 1EOKA 4Z2JA 1TUXA 3AIWA 3PN8A 3U5UA 2YA2A 4KGLA 1OM0A 1NH6A 4PUDA 3SCUA 1ZBCA 3AICA 1ZJAA 4B9YA 2W4XA 4PMZA 2WCSA 2YL9A 4W84A 1JYVA 4M24A 3WF3A 3A47A 1V6WA 4WSKA 3J7HA 2V3GA 1TQTA 2E9LA 1E1EA 3GYCA 4HU0A 1DWAM 1MW1A 3VILA 2QHAA 1L0PA 1XSIA 4NXSA 4H8HA 2DEPA 4JCLA 2YDRA 1J0YA 4NZFA 2F1AA 4CCCA 2X2IA 3NIYA 2A3HA 3MO4A 3W53A 1QOXA 1V3HA 3AHXA 1RP9A 1KBBA 3ZQ9A 3TTSA 4WF7A 4WLCA 2F7PA 1EH9A 3BAWA 3CZJA 4XUYA 1HT6A 4PMVA 2CBJA 2Y2WA 3L4XA 4KRTA 2WANA 4B3KA 3SURA 4AC1X 4Z2IA 4ACZB 5DT7A 4U2YA 5JBEA 1QBBA 3HU7A 3WMCA 2F18A 2XIBA 2VURA 4EAMA 1YHTA 4W89A 4AD3A 2F7OA 4JHZA 3BAXA 4M29A 1W91A 4AD0A 3K8KA 1TQSA 2G3IA 3NUKA 4TVCA 4UFHA 4AIOA 4HMDA 3N13A 4C7GA 5HXMA 5IDIA 4ACYA 3DECA 2XFYA 4J3XA 1CXIA 3OA5A 1F4AA 1KGWA 4RE4A 2J79A 1HKKA 3TP4A 2BY1A 3GNOA 3HZ3A 1UD3A 3A21A 3DDFA 2WMJA 3ZR6A 4CGTA 1W9BM 2BVYA 3LPPA 3CH9A 1S46A 1IZKA 2VQTA 3LRLA 3I3EA 1K6AA 4W7UA 1E4NA 2FH8A 1KCKA 2YJQA 3A4WA 4OUEA 2CERA 2OWXA 2J78A 1QPKA 4IUGA 3W28A 3VIOA 1EQCA 3CO4A 4N0RA 1J0KA 4M81A 2XJ7A 4NRRA 1JXKA 3ARYA 4IPLA 5A95A 4R27A 3NYDA 2XVPA 3VNZA 2J47A 4AY1A 2RGLA 2Z1KA 4GI8A 4B9ZA 4CVUA 2D0GA 1E6QM 4GZEA 2VJXA 1UYQA 5A2AA 1GOMA 1BG9A 3LXAA 1DWJM 2GSJA 3FY1A 1TG7A 4JFTA 1C8QA 3VD3A 3THCA 4DO5A 2CITA 1SZNA 3E1F1 4JFWA 2J7CA 4DUVA 2W61A 5EFFA 3TOPA 3K4DA 2FHBA 3RILA 4D6HA 4CN4A 3MMWA 3AIUA 1KQZA 4DWSA 2PWFA 2X8RA 2ZICA 3K4AA 4D6IA 1D3CA 3DX0A 2XGIA 1LL7A 4V27A 3WQ8A 1QI3A 4GO8A 2D3LA 4MB4A 5CLWA 1I75A 3O2LA 2W67A 4PMYA 4J28A 4KH2A 2GK1B 3UCQA 3F5KA 3F5JA 2PWGA 1VFUA 3HG2A 5BROA 3MMUA 3W6LA 5IHRA 1AMYA 4PRWA 5M3WA 2ZUMA 3SCSA 3SUVA 4P7LA 2ZUVA 3IJ9A 2WYSA 5A1AA 3CZSA 4U5IA 5D9OA 1Q4NX 1GJUA 2XM2A 3BSGA 5FL0A 3WELA 1B30A 4CD6A 4W7VA 1VFMA 2XN2A 3VIPA 1BGAA 4E2OA 5A8NA 3HG4A 4NI3A 3EJSA 2DIJA 3MKKA 2FDMA 1W3JA 1O6IA 2XIIA 2WW5A 4CN6A 2OSYA 1M7XA 4UFIA 2X2YA 4ZEPA 3CHCA 2D1ZA 1JD9A 1OB0A 1H11A 3RJYA 1PS3A 3AMDA 4UQBA 1EXPA 3TONA 4UZUA 3ARPA 1JZ7A 2CKRA 3TTQA 1Y7VA 4FNTA 1WDPA 1HKIA 5C8BB 1BVNP 4U2ZA 1HTYA 4XV0A 5CZKA 1BSIA 4TX8A 3WQWA 3GXTA 1FH9A 3BLPX 1UR9A 1MVYA 1C90A 5HBFA 2A3AA 1XYZA 2JEPA 1E40A 2WHJA 1QVBA 3POHA 1WZKA 4V2XA 3VGDA 3SUUA 3W0KA 2WPGA 1UWQA 4F9JA 3WH5A 1W9XA 2J74A 1QI0A 5GNZA 2BHUA 2VNCA 1ZU8A 1IZJA 4H7VA 3HN3A 7CGTA 5I23A 2ZUSA 1E6RA 1VRXA 4PTVA 4BCEA 3VD9A 3CUGA 1V0KA 2CETA 1JXJA 1HJUA 1TQVA 4AZ6A 1UWUA 2E40A 1CBGA 3T09A 3M07A 2ZIDA 1W1TA 3DX3A 1R75A 3ALFA 1QWNA 4PTMA 3RPMA 3WNLA 5CSYA 1XSKA 2YDSA 4HZ7A 4QCFA 3VDAA 4KWUA 4PEEA 4CN1A 3PZIA 3EDJA 3DX2A 1TMQA 1QNRA 3AZTA 3RO8A 1UZ1A 1CNVA 5LYRA 4MNMA 1FFRA 1KFWA 5A94A 1DP0A 2GVYA 3VMNA 1F4HA 2WAGA 1E9LA 5JIPA 1DWIM 1CYGA 3GNRA 3BAKA 2WZIA 3AIEA 3VDHA 4BA0A 1BYBA 5D9MA 2E0PA 3BAIA 1L8NA 2WM0A 3M7SA 4GZIA 4OZOA 1E4IA 3KL5A 3BC9A 3ALGA 1D2KA 1R7AA 4H41A 3WY2A 4DWSB 3N1AA 3KL3A 1KXTA 4OOUA 1EA9C 5JBFA 2VRJA 2WSKA 1XD1A 8A3HA 1KXHA 1LLOA 1VJSA 1MW0A 3AISA 5IXEA 5ABHA 3UETA 1KB3A 3L4WA 1UASA 1BYAA 5CPTA 4DM1A 1SR0A 1NWTA 2YLAA 3WNPA 3RIKA 1M03A 5A6MA 4W85A 4RE2A 4TTGA 4PTWA 3VGEA 3U7VA 3CZEA 1K9EA 1AQMA 2DT1A 3BH4A 4FF5A 4NZCA 5AC4A 3O6AA 3GM8A 1W9DM 5GNXA 4PMQA 3VO0A 3CZ8A 3VTRA 4KMQA 2E4TA 2C7FA 2VX5A 1JDDA 2J8FA 4AMCA 1OWQA 5A2BA 1WO2A 5FL1A 3DC0A 7TAAA 1W32A 1E3ZA 1H0IA 2BXYA 1HN1A 1XGZA 3CUJA 1GOQA 3EJTA 3WUBA 3QHMA 4FMVA 1DEDA 1BF2A 3VM5A 3ARZA 2NT0A 2DT0A 3AHYA 3WY4A 4HOXA 1NP0A 2WWDA 4P8XA 3AIVA 3TA9A 3PTKA 2D20A 5GQBA 4P8WA 1M01A 1UZ4A 3MS8A 2ZX6A 2O92A 4MPKA 3M6DA 1HKJA 3WY1A 3OGSA 1SMDA 3VSTA 4F8XA 1JIBA 2D0HA 5ABEA 4TVUA 1QHZA 2QLYA 2UY5A 3LMYA 3A22A 5ABFB 3T08A 1H4PA 1ZJBA 2VZSA 1NARA 2CXGA 3CHDA 1ISXA 1ZBKA 3PTMA 3TV8A 1NWUA 3MUY1 4TOQA 4QP0A 4BZYA 1ESWA 2VI0A 2G4FA 2UY4A 5E9AA 2J7DA 5AYBA 1J11A 2RGMA 3ZJ7A 1N82A 3AI0A 2BHZA 4JFVA 2ZUUA 3CMGA 4JKLA 4N42A 1IV8A 3VSVA 4KGJA 1FHDA 4MADA 2VZTA 3CV5A 3BSHA 4DO6A 3GXDA 3D5HA 3WH8A 3VX0A 4YN5A 1AQ0A 1C92A 2O9TA 4TTUA 1M04A 3BVXA 3A4XA 1J18A 2VZVA 1E70M 4BQ4A 3WIJA 3AZSA 5C70A 3OB8A 5FIPA 1CLXA 4GXPA 2J25A 3OZPA 4J3TA 2VOTA 1KXVA 4F66A 3W37A 3AHTA 1C93A 3CGTA 4LQ1A 1GOWA 1ZBVA 2PBGA 2O9OA 3EJPA 3OLIA 5A8OA 3EBVA 5A6KA 1JDCA 1QHOA 3AQUA 3LPFA 2XFFA 1TQUA 2XM1A 4BQ5A 2E8YA 4LYQA 4QDMA 3AS0A 2J7EA 1B2YA 1E0XA 3GXIA 2V5CA 2Q8XA 3CHFA 1TCMA 2F7RA 3PBGA 5JUVA 1PBGA 2A3BA 3WD1A 1CXKA 4UQ9A 1B9ZA 2VL4A 2J75A 3W81A 1J0HA 3VIIA 1US3A 3PZUA 3CLWA 2X2HA 1LWJA 1CGVA 3VMOA 1WKYA 4MB1A 4WIWA 4QAWA 1E3XA 3WL0A 2WVSA 4UQCA 2WC7A 6CGTA 1B3XA 1PX3A 4GZJA 1GQKA 5I24A 2CHOA 3AMKA 2EPLX 2F8QA 4OIFA 2XTKA 5CPQA 5I0DA 3EMCA 2D0FA 4YHGA 1P6WA 1GCYA 3VGFA 3DX1A 2GJXA 4NX0A 1JZ4A 3EDEA 2W63A 4ATWA 3MV11 1E5JA 4YHEA 2YL6A 2OSXA 2G3MA 1EO7A 3NSXA 1JG9A 1V6VA 4X0VA 3RM8A 4GQQA 2E9MA 1KR0A 4EK7A 1VB9A 3II1A 2X09A 4PUEA 2G3JA 2X05A 3OLGA 3WF2A 5A8PA 5BXTA 3VDCA 4AMXA 3L4VA 3UERA 5HNNA 3HMCA 3MUIA 4GI9A 1MFUA 1J0ZA 2IXUA 3VIKA 5I3DA 2JF6A 1MW3A 2DH3A 4UOZA 1BYDA 2JALA 1PIFA 3WQVA 3ZIZA 4U33A 4HTYA 1GPFA 4AZ7A 1V6XA 3IK2A 2J7BA 1G01A 2WMKA 1WP6A 1CGWA 2PWDA 1GW1A 1FFQA 1AVAA 1X6NA 4UNIA 2AOSA 5DT5A 4MB3A 1GUVA 3VIMA 4MDPA 4LPCA 1VEMA 3APGA 3WF0A 3VMPA 3NDZA 1ZBWA 1E0WA 2VTFA 5A8MA 2GUYA 2Y5EA 4GKLA 3GNPA 4ZFMA 2WZHA 2FYVA 1A47A 4LYRA 1UHVA 2ZUTA 4M1RA 3W27A 1G5AA 2VX6A 2IGTA 3EJQA 3ARQA 4W8LA 1XV8A 1HL8A 1V02A 2VO5A 4TXEA 3S2CA 5EFDA 2AMGA 5CXPA 3I3BA 4XB3A 1QNPA 3KEHA 1CXFA 3GXNA 2FGLA 2X2JA 1J9YA 3MI6A 1JI2A 3K8MA 1UKOA 4JAWA 5A6BD 3AHZA 3N11A 3GXMA 1TVNA 1V6UA 3DYMA 8CGTA 4OBSA 1K9FA 2PWEA 4FK9A 1JD7A 2ZXQA 2W62A 4OGZA 3PZTA 1OGSA 1GVIA 1HXJA 5D8ZA 3SUTA 1Q6GA 1OINA 4TUFA 5IFPA 1BVZA 2OSWA 3OIHA 1TZ7A 1G94A 3PZMA 4C7DA 3N9KA 3FHQA 4U31A 1BGGA 2VZOA 1NWSA 4GIAA 1CIUA 3ARVA 3GH5A 1E6XM 4UQEA 4M56A 3CBWA 1J01A 1OGBA 4TVDA 3BAYA 2W92A 1QI5A 1E4LA 5CGTA 2CCRA 4UCFA 1DHKA 4AWEA 5E6YA 5I77A 1MXDA 2CPUA 1O7AA 3MMDA 2WK2A 3VUPA 1KQYA 1OBAA 2VRKA 3IGUA 4HZ6A 4WKHA 1JGIA 2ZX9A 1KGUA 5FCZA 5E0FA 2CBUA 3WKZA 3OLEA 3T0DA 5EB8A 3S5YA 5I5RA 3WQ4A 4AZIA 2JIWA 2EPKX 3T2QA 3GXFA 1V3JA 3VD7A 3PZNA 1HXKA 1BTCA 3FHAA 3EJUA 3ZMRA 4P7RA 1CXLA 1IT0A 3RM9A 2J62A 3B9AA 4QFUA 4S3JA 3RMEA 3S6TA 3D52A 2D24A 2DGAA 1UD5A 2BFGA 5BRQA 1W9PA 1PX8A 2GJXB 4W8AA 3GDBA 3FAXA 1H2JA 3DHPA 1V3KA 3BMVA 1ISVA 2WVUA 1AQHA 3ARTA 2XVKA 4AZCA 4GI6A 3QOKA 3A4AA 1WB0A 2VZUA 4JZ5A 3SCQA 5FOOA 1PPIA 3AXHA 3SCNA 1XH2A 1DWHM 3AZRA 4DM2A 5I79A 1M53A 4HA4A 4NRSA 3RCNA 2C0HA 1QX1A 1V0LA 3FN9A 4UQAA 4MNJA 3D3AA 3WNKA 1CENA 1Q6CA 2J77A 4P8UA 1B31A 4AD1A 3ZJKA 3QHNA 1LL4A 1J0IA 3AXIA 2YA0A 1MYRA 4AEEA 1QI2A 1NWRA 1UR0A 2WB5A 1K9DA 5KZ6A 1PEZA 1GHRA 4M8UA 1E56A 2NW0A 4LXFA 3PZOA 2OYMA 3WH6A 1E4MM 3N17A 2V3DA 5CLTA 1A3HA 1GVYA 1HJWA 2D73A 4D6FA 4AEFA 1QNQA 5CGMA 4DWSC 4ATDA 5ABFA 5I6SA 3A3HA 4MJ2A 3TTOA 2PF0A 5M5DA 3VIFA 3VD5A 4W5ZA 3WL1A 2WHKA 4W86A 2NSXA 1BHGA 3VD4A 3FAWA 1ODUA 3IJ8A 4RE3A 2VR5A 2XHYA 4FNPA 4WKFA 3WF1A 5BXRA 1HVQA 1ITXA 1KGXA 1U2YA 3WFZA 4PMXA 3T0AA 3OG2A 1GZJA 3NCOA 3UR8A 1LF1A 4M80A 3RDKA 4AD5A 2GJPA 2WMHA 4R5EA 1V6YA 3WSUA 4BQ3A 3DYOA 1H41A 2D23A 3D51A 5A6BA 2FHFA 4PMDA 1CECA 1OCQA 5E09A 3VGGA 3SIMA 1UWSA 1KR1A 4LYPA 4E4PA 5BXPA 4OJYA 3CC1A 2YFOA 5IHSA 3WFLA 4J7RA 1UQZA 3MUZ1 4PSPA 4E8DA 3AIRA 4XX6A 3SCRA 1GORA 1UQYA 3ARSA 1LWHA 2VCCA 4MTVA 3UG3A 1R85A 2WMFA 4BQ2A 5BXSA 2CEQA 1V0MA 1B3VA 4MB5A 2F2HA 1QBAA 3BVTA 3B9DA 2ALWA 3KL0A 3DDGA 1UG6A 5A2CA 3H53A 4B15A 3L2MA 4PTXA 3GH7A 1QHPA 5HPCA 4QLLA 4AIEA 4GPNA 4JFSA 2ZXAA 3AXXA 3SUWA 2G8ZA 1TA3A 5DF0A 1Q6FA 2PC8A 2VVSA 2WHLA 3OLDA 2WVVA 1UR4A 1V03A 1JDAA 1ISYA 3W24A 4HZ8A 1ECEA 4URIA 5ECUA 1XD0A 2CYGA 2BXZA 3SCPA 4W88A 1UOKA 2OW7A 3WQ5A 4AZ5A 6TAAA 3HG5A 3WBAA 4CCEA 2VMFA 3G6LA 2PB1A 2CHNA 1VBUA 4LGXA 3SUSA 3W82A 4D6GA 4JL1A 1H09A 3UESA 3TTYA 2ZXDA 2GDUA 3VSUA 2WKGA 3H54A 5D9NA 3EMZA 5DEZA 1XRVA 1HL9A 1BG4A 1R87A 4Q7NA 4A3YA 1RPKA 2BY2A 4EANA 1XCWA 3AJ7A 3WF4A 1ISZA 2EBNA 4AZCB 4GO9A 4DUWA 3WUEA 2EPMX 1SMAA 2IXVA 1XH1A 2VQUA 1B3YA 2YBUA 1R33A 1V0NA 2BHYA 4EKJA 5JIWA 1UH3A 5I2UA 3KLLA 4M82A 3W26A 4AYSA 3B8SA 3T0BA 2VX7A 3AS2A 5IFTA 3WY3A 1HJQA 1R8LA 1RD6A 1Q6DA 3BGAA 2CBVA 2PBOA 1H1NA 4P7OA 4Z2KA 4JL2A 4FNSA 4UFKA 1JI1A 1HJXA 4CD8A 4WK9A 3BXWA 3CZGA 3EDDA 1H3GA 3WNMA 3L4UA 2YIHA 2GDVA 2VC9A 2UWFA 3F4VA 4Q22A 5CJ5A 1JF6A 1V3IA 1CDGA 4P7NA 2WC4A 1R86A 2A3EA 3AS3A 2QPUA 3BMWA 4CU6A 2F7QA 1CTNA 3SEPA 4HA3A 2QMKA 1W1PA 3WDRA 2Y24A 2ZE0A 4ZENA 1EO5A 9CGTA 1PZ3A 5LA0A 5E1QA 2EO7A 1UD6A 2XGBA 5DFAA 2XVGA 1BFNA 3LPOA 2BY3A 2QV4A 1EGZA 4AD4A 1U30A 3POCA 1ZS2A 1KCLA 1BPLB 3G6MA 5D8WA 4HOZA 4ML4A 4PMNA 3MUAA 1GNXA 2DQXA 4NSBA 4UR9A 1NP2A 3ARWA 3LXBA 3AIBA 4U3CA 1LJYA 2XG9A 3U7BA 5HPOA 4CD7A 2XVNA 3I3DA 1JYNA 2XVLA 4D1JA 4NZJA 1HP5A 3L4YA 1B3WA 1US2A 1I1WA 1E5NA 1CPUA 1EHNA 1MWOA 1RP8A 1OD0A 4AMWA 4F9DA 3A5VA 1WDRA 3N15A 4JCMA 2CKSA 4BS0A 1PX4A 3K8LA 4D6JA 1C8XA 1VFOA 1XSJA 1VEPA 3VKKA 3PZVA 5CSUA 4CVWA 2JEQA 2WVTA 3BUPA 5ABGA 3NSMA 1UR2A 1HWWA 1W3KA 2DSKA 3VIHA 4AZGA 3H55A 3ZSSA 4D6EA 1HJSA 4L4OA 1UKPA 1FHLA 2VCAA 1CGYA 2BV9A 1W9UA 1TA3B 3EMQA 3W4RA 1KWGA 3FW6A 3GH4A 1JAKA 1OT1A 2WVVB 1UR1A 3BLKA 4GQRA 1UUQA 2CESA 2B31A 3GBDA 2J7GA 1C7SA 1I1XA 2XYLA 3OGRA 4J3SA 1VFFA 3MSGA 1EDQA 4D6CA 2EAEA 4W7WA 1CLVA 3WQ6A 2DSVA 2ZWYA 3K1DA 4K68A 3MU7A 1V08A 1E6NA 3WUFA 3WH9A 1TVPA 3UR7A 3LXCA 3PZQA 5HOSA 2ZX8A 1VBRA 5AC5A 4Z2HA 5KEZA 4H2CA 5JBDA 4CD4A 4IISA 1W2VA 3WDJA 4OOZA 1SFSA 2DDXA 5BRPA 3N18A 1HVXA 5I78A 1Q6EA 3NJ3A 1HP4A 1KTCA 1CZ1A 1PZ2A 1E55A 2ZUWA 1E73M 1XH0A 4W8BA 2YOCA 1GJWA 3GXPA 1OD8A 3ARRA 2FE0A 4NF7A 1G9HA 1VIWA 3L4TA 2FHCA 4CU8A 4J3WA 1EQPA 1ODZA 1NOWA 1E71M 5A6LA 2D3NA 1E0VA 5AYIA 1JF5A 2DH2A 3FXYA 1UKQA 2Y8VA 1EIBA 2OYLA 3EYPA 4J3UA 2WWCA 5BYWA 2VVNA 4X0NA 3AFBA 5A3HA 2EQDA 2OLHA 1OGGA 3HJEA 5E0CA 3DYPA 1JYWA 2G3NA 5CPSA 2QMJA 1ZB5A 4XZBA 3RJXA 1JNDA 3WENA 2WSPA 1U33A 4FNQA 4PMOA 1W9VA 2WCAA 1FA2A 1UWRA 4AISA 1MQRA 4FLQA 4U5KA 1CGXA 1VJZA 1JZ2A 1D7FA 3UEQA 1UD8A 5D4YA 6A3HA 3EDFA 3KWXA 4HMEA 5BWFA 1TE1A 4HMCA 5A6AA 1E43A 5LA1A 3BCFA 3A6OA 3BUBA 3M46A 1WZLA 3SCTA 3ZR5A 1MFVA 1OIMA 5CG0A 2UY3A 1JZ8A 4CUCA 2QPSA 1SYTA 3BVWA 5A6SA 4AXNA 1GQLA 2PI6A 3O9NA 4OBRA 4H8VA 4UFMA 2JIEA 3WD4A 1BLIA 4PMRA 1E72M 5EBAA 3THDA 1TR1A 2F61A 3AOFA 1J0JA 4U3AA 4C7FA 1OSEA 2X0HA 3S5ZA 1V02E 2YL5A 2WHMA 1UH2A 1MQQA 5D9PA 1PIGA 1QNOA 2DT2A 3QR3A 4EE9A 1FOBA 2XSBA 2C8NA 1ISWA 2DT3A 4V28A 3CZNA 2X0YA 4ZXOA 2E9BA 4L4PA 1OT2A 2XN1A 3WDPP 2WMIA 2MANA 3W25A 3GTNA 1V3LA 1QI4A 1G0CA 3UG4A 1GQIA 2BVDA 4PBGA 1E15A 4UOJA 4HPHA 3WEZA 3VX1A 2XUCA 3VGBA 3WEOA 4TX6A 3EJRA 1UA3A 3D4ZA 1EDGA 4DO4A 3WBEA 1JAEA 2QF8A 2EJ1A 2WKLA 2GJRA 2E3ZA 3PZ9A 1H0GA 3VM7A 3WH7A 1GOKA 2TAAA 3L2LA 3MSDA 4UZSA 1W3HA 2EPNA 1EOMA 1KXQA 1RH9A 3WD3A 2E8ZA 1OIFA 4BF7A 1FP8A 3U57A 4PCSA 1UA7A 4J3VA 2O9RA 1NM9A 2VUYA 3KE0A 1WDQA 5GNYA 1QWUA 2YL8A 1H49A 4ATLA 4ZE5A 1E6PA 5EMYA 2VX4A 3WNNA 1FH8A 4FNUA 3WN6A 1NQ6A 2ZUNA 2WLYA 4MAVA 1C7TA 4RL3A 4UFLA 2EACA 3ZOAA 3SCVA 3CPUA 3NSNA 1LG2A 2W91A 1JFXA 3CTTA 1GONA 3AMCA 3AYRA 1MQPA 1JL8A 4UTFA 3BUIA 2JE8A 1UWTA 4LX4A 3N04A 2DSZA 2WC3A 1DWGM 1E6SM 4YPJA 5CQ1A 2V5DA 2J7FA 3U5YA 1H5VA 3A23A 3IANA 4A3HA 2EEXA 3DX4A 4FLRA 5TD4A 3AMGA 3ARUA 3IAPA 4CU7A 3D50A 3HG3A 5E70A 4D72A 1V3MA 3PTQA 4PSRA 4X9YA 2YBTA 4MJ4A 4E8CA 4JIEA 4NXKA 4IPNB 1B3ZA 2EABA 1XCXA 1W1VA 2FH6A 1CGTA 4UOQA 1TQWA 2HISA 3CZLA 2XPKA 4H8UA 4B3LA 1PAMA 4HP5A 1J12A 4CCDA 2D22A 2V38A 2XWEA 2YLLA 5FKYA 2GFTA 3FNDA 3OBAA 1W1YA 3WD2A 1J10A 2DSWA 1JZ5A 4J27A 4F79A 2WBKA 2F1BA 1TFVA 3BLBA 1WAWA 3JUGA 1R46A 3GBEA 3T2PA 3AROA 1HNYA 4CD5A 2BY0A 2WXDM 1WZAA 1HKMA 3T2OA 4HPGA 3CUHA 1FP9A 2BNJA 1K9TA 1MXGA 5F7UA 3CUIA 5AY7A 2HVMA 3B9EA 1R47A 1UR8A 2OW6A 3BVUA 3VNYA 4GINA 2PWHA 4WJXA 2Z1SA 3NDYA 1C91A 4CKQA 1EHAA 2DSUA 1WE5A 1FH7A 5A69A 3WMSA 1WNOA 1W2PA 4PCTA 3ZM8A 4AIUA 2WCGA 1JNEA 4P7QA 4ZXLA 2ESCA 2WNWA 3BCDA 3KLKA 2WMIB 3QHOA 2NT1A 3ZT5A 2ZX7A 1GOIA 1X1NA 1XHGA 1HX0A 1HF6A 5DO8A 3SCWA 2OWWA 1DWFM 4MAZA 4A4AA 1QNSA 1DTUA 1VAHA 1CEOA 1BAGA 3VIJA 3VGHA 2ZOXA 4JFUA 2O9PA 2IUZA 3OGVA 1HIZA 2YKKA 4QLJA 5C71A 1JYXA 2DIEA 3BUQA 2UY2A 4PN2A 2JFEX 4Z2LA 2A3CA 5HDRA 4AW7A 1XC6A 2V3EA 3W6MA 2W5FA 2XFRA 1JZ3A 4UFJA 3ZJ8A 3AYSA 2FGZA 3VVGA 3PZGA 1VENA 5M17A 1WCGA 4ZE4A 2ZX5A 2X1IA 2AAAA 2WBGA 3N12A 1KTBA 1G1YA 3MV01 3CZKA 2JF7A 2XN0A 5BCAA 3LX9A 1W3LA 2ZWZA 2EXOA 4QCEA 3WUGA 2BVTA 2VR4A 3LRMA 4IM4A 3IAQA 3BVVA 3ARXA 4MDOA 2OWCA 1E1FA 2YDQA 3VOCA 1LQ0A 3VIGA 4AYGA 1WDSA 4HA1A 2CNCA 1Z32X 4JHOA 2J4GA 3AHVA 3PHAA 5FD0A 4B16A 1JZ6A 3ZSTA 1ZL1A 2EPOA 1MW2A 3ECQA 1KBKA 4OKDA 1QW8A 5GPRA 4JKMA 1C3FA 2XWDA 1UWIA 1T0OA 3VU2A 1R34A 3ZT6A 4MNKA 3A24A 1UD2A 5LA2A 3OZOA 1C8YA 3AMLA 4HOWA 4ACZA 3BUDA 1KWKA 2YA1A 1ITCA 3SCOA 2VCBA 1VEOA 3K46A 4Y7EA 1GOOA 1B1YA 4MNLA 3CUFA 4Z2GA 4D1IA 1NOFA 1X6LA 3EDKA 1GHSA 5E6ZA 3LPGA 2VRQA 1JFHA 2BS9A 4WKAA 1CWYA 3L4ZA 3WNOA 1CXHA 1WPCA 4S3KA 4FLOA 1UH4A 4AZHA 4WSJA 3W38A 3ZJ6A 4KRUA 3W29A 1R7OA 1QW9A 3BAJA 1NOUA 2CIPA 5M03A 3CIVA 3RM4A 2J8GA 3WDIA 3GZAA 4DUXA 7A3HA 1BYCA 1B0IA 5DMYA 3WDHA 1CGUA 3ZO9A 3F5LA 4FNRA 4PMUA 3WDQA 2Y4SA 1B90A 3AIQA 2XSAA 3CMJA 2W66A 3UG5A 1HJVA 1VF8A 4W5UA 1XYFA 3KZSA 3MANA 2D2OA 1YQ2A 3QOMA 4AD2A 1EDTA 1UD4A 2YFNA 1PJ9A 2ZXBA 3CHEA 2WMGA 4W93A 2DPEA 3LRKA 3D4YA 3WEMA 1BQCA 2Y8KA 1LG1A 2EADA 1UKTA 1WZMA 2WLZA 4W87A 2V3FA 4FLSA 1UKSA 1CXEA 4UQDA 4XZWA 3VDBA 3WD0A 2J7HA 2VT0A 3AS1A 4AZBA 4D71A
chains in the Genus database with same CATH superfamily
2F68X 1Q6LA 1SOSA 5B1AB 3QNYA 3TA6A 1NLBL 4WRHA 2CO6A 3WMBA 2VM8A 5J6HA 1TKWA 1EBAA 1UPPA 3SW6A 4R96A 3OKEA 4KFNA 1OQFA 4OZFH 4C6IA 1KYAA 5DR5H 2AJXH 4R97C 3PNZA 5LIXX 1JYVA 1T41A 1V6WA 1D9KC 4Q4QA 2XNAB 1UVQA 2CLVA 5J8LA 1E1EA 4MDJB 1JP5A 1HHHA 4H8HA 5JA8B 1F1AA 1BM7A 2X2IA 3B9VA 1BJ8A 1V3HA 5IB2B 3LRSA 3WMLA 3UO1L 3U46B 4YCPA 2QAFA 3H4XA 5FUZH 1YUHA 1NFGA 2EH8L 3L7RA 2NNXA 5E5UB 4JE0A 3KS0J 3TPUA 5H37H 2VFHA 5MP6H 4TVCA 3N13A 5F96L 1N8IA 1AP2A 3WFEH 3PY2A 2W59A 4LEFA 3AALA 5F4WA 3R94A 2O61B 1OHQA 4O11A 4GUPA 4HCRH 3J07A 7FABH 3VKCA 3UZEA 4NKCA 4BI5A 1K6AA 4IPPA 2O26U 4WTZG 4JFQB 5EZJB 2J8TA 1U8IB 3VNIA 2R0LL 3FKRA 3CO4A 4N0RA 1Z3RA 2AXGA 2A4ZA 2ZC1A 1IR1A 1T40A 3RUGE 4WEBH 3I50L 5ICXA 2HVKB 1F3RB 4KVNH 1KN2H 5C0DB 4HIJA 1P1MA 4MHHG 3BDYH 1JNJA 4W9ZA 3BW3A 2HX9A 1XTMA 4HCLA 4ZMLA 1KBIA 3AIUA 3GSRA 2ZICA 5GHWH 3QNYB 3CH8A 4U1SA 2Z27A 4GO8A 2D3LA 4RZBA 1JPTH 5J6HB 1H9VA 4PMYA 5B8CA 3BAEL 4R96B 3AM8A 5K7JA 3OKEB 4YWGL 3C2RA 3VWKA 3WTWA 1FWAC 3DEQA 1WWAX 1WCBA 5M3WA 1C08A 1KBGH 1UZ6E 5E9DA 5AB3A 2J55A 3QO1A 5A1AA 5BU6A 3WQOA 4Y4KD 2E28A 2Q3RA 5T3ZE 4IJTA 1HHHB 3QVQA 1XCQA 3QMSA 1VFMA 1NGQL 3HG4A 2L4OA 2Y25A 1IC7H 4ZEPA 4LBAA 1V5JA 1PS3A 3LRSB 1EXPA 3KBHE 3IJEA 1FNLA 1YUHB 3NDOA 5EZOL 3F5WA 4J2XA 1HTYA 3VRJB 3TPUB 1MVYA 1ZT1A 2CDEA 2WHJA 4M1CC 4UV7H 3S2MA 4KQ3L 4PGEA 3B06A 1RJLA 2QZ5A 4P4KD 3VFLA 1AP2B 2XACC 3QYNA 3Q4DA 1QWGA 1IZJA 3QK0A 4ENEC 5BVPH 1GKEA 4HQVA 1E6RA 3TVMC 4GE8A 4GUPB 3IIPA 4BQ8A 4UT7L 4AZ6A 1HYRC 4ZODA 4PBXA 2QQNH 1J9SA 2GJ6A 4DP8X 4PJBF 2IQDA 5GZNC 2RDXA 3ALFA 5CJOL 3WNLA 4Y5XA 4KWUA 5AD0A 1N70A 4OM0H 4Z7NB 3QS3A 4MD5A 1P4UA 5A94A 1G6RA 5ICXB 4AGPA 3U4EA 5DA4A 2GVYA 3K30A 1L9SA 4HIJB 3TYAA 2WZIA 2EDOA 4PRDA 3G0XA 1U1JA 3M7SA 3KL5A 4PRHD 3OAUL 1NLDH 1RK1B 1YECH 4S3EA 5FDWA 4GXWA 1HGYA 4U1SB 1N7MH 4F48A 3U0TA 5B8CB 1UASA 1KBJA 3L5JA 3WNPA 2OKTA 3VFTA 4M4RA 1G7HA 3BLOA 3HR6A 3VWKB 1KJ3L 3PABA 1CR9L 3N1MC 2HFGH 1WCBB 1C08B 2J8FA 1OWQA 3T77A 5E9DB 4PV9A 1FWTA 2XYBA 3QO1B 3UD6A 5KVDL 2NLJB 1EC7A 5L9DL 2PLJA 4AVOA 3QZAA 1XCQB 3SQRA 2FL5A 1RLBA 4P2QD 3ARGA 4FXGC 1TPVA 3GM0A 3WG6A 2DRUA 1LBMA 1MAMH 1NCAH 3S6DA 2HRWA 5EU6A 3IJEB 3QI9D 3T0XA 5G1TA 4H8QA 4IRSC 1NAMH 4HPYL 3F5WB 1Q7MA 4JR5A 4W4QA 2UWEE 2DYPD 5IBXC 1O5PA 2CDEB 4BZYA 2J7DA 2J8OA 4QNWA 1ZTXL 4GD0A 3X1GA 5DCEA 4EDXA 3CV5A 1IAMA 5I9QC 3WH8A 1X7IA 3KYOA 1C92A 3CN4A 1E7VA 4PJ7A 1PDYA 4Y5VC 4BQ4A 3KXFA 4MOZA 2GJ6B 3HNTL 4J3TA 1D6VL 1C93A 1GOWA 5L4IA 1ZBVA 3OLIA 1PLGL 3F2CA 3TA3A 5DMNA 4Y5XB 1CBVL 5AD0B 3S3DB 1UUMA 1E5YA 3PBGA 1GXEA 1G6RB 1YDNA 4X6CF 2VL4A 3U4EB 1UR3M 2IADA 2X2HA 5GISL 3R1GH 3VKAA 1ML1A 4PRDB 3UBXI 1F3JA 1PYWA 5C0AA 1C5CH 5ILTH 2ZC8A 3OMIB 1MN4A 1LEGA 4MD0A 5FDWB 1M7DA 1GCYA 2WB7A 3L1OH 4E0RA 5AB2A 1IBHA 3VFTB 4M4RB 1XG4A 1G7HB 4OQ1A 2F7IA 3LZOA 4EK7A 3PABB 1P43A 4DF9A 3MBFA 4A67A 5DXWA 2PTDA 1J05A 1OYBA 3T77B 4PV9B 5A8PA 3VDCA 3UBFA 1H3PH 3HE7A 1E0UA 2R24A 3HMCA 2FL5B 1MNUH 3MTRA 3ARGB 1I1CA 4WHTA 3PWIA 1CGWA 3TH4T 4UNIA 1U8MB 3LKSA 2XZCH 2NX5D 4GGBA 3URAA 4Y2DD 5G2IA 3FT9A 3KH4A 2J43A 3GI9L 1KRBC 2FB3A 2EIMB 1Q6QA 4ZTXA 4LNRB 2FGLA 1S9WA 4QSFA 3NIFE 3PQYD 2Y9RT 1S2TA 4EDXB 4HW6A 3BW2A 1EJVC 3V4BA 3KYOB 2RIKA 4FK9A 3D6NA 3KYKL 4PJ7B 4M8RA 3KXFB 2IALA 2YGNA 3STPA 3TWCH 5TFSH 4XAZA 4RXGA 2BM3A 3WYRA 1BGGA 4MAYA 3T2NL 2DV6A 4GIAA 3TA3B 1TOXA 2AP2A 4GXUN 3FFCD 2X2GA 3OODA 1J01A 5DD5L 1OCJA 3NBNA 2NY5C 3FJ4A 3C87A 1XR2A 2GGHA 2C13A 4WFFD 4HH9A 3IGUA 4FTDA 4WY7H 25C8L 1KGUA 1DJNA 2AK4A 4M62L 5ADPH 1TPH1 3AGVA 2AQVA 4D3CL 1F3JB 5JNYA 1PYWB 5C0AB 2DDQH 1V3JA 4PWHA 1D7KA 1MSSA 4X8CA 1SZRA 4U0RC 1LEGB 3FZUC 4MD0B 2HLFC 4HIXH 1M7DB 1W9PA 1XDLA 2OR2A 4E0RB 3CIAA 4N4PA 3E9TA 2VZUA 4LF3A 4ENLA 5HVWA 1XH2A 1HEZA 4NKQB 4ONVA 1QHQA 1J05B 4AKOA 5GSRA 5D2NC 3HE7B 4EE2A 4DZAA 1DJWA 1V54B 3BJ91 4JPVH 2ZJSL 4WHTB 5AB1A 1E56A 3JU2A 2ENJA 4KMLB 2EILB 4AQZA 2IH9A 2B77A 2VB5A 3A4EA 3LKSB 3UAJA 1MFMA 5F6IC 2IPWA 1ZGDA 2IQTA 1WUNT 3TV3H 2YD0A 3MXWL 3QPXL 3O3AA 2XHYA 3Q2WA 3IEAA 3QUMH 3TBYA 4WKFA 1O5KA 1HVQA 4LUSA 4LB3A 1DYSA 3NCOA 1S9WB 1LF1A 3UXKA 1LXMA 4GRLD 4NSKA 2DLGA 1F5ZA 1OGAE 4PJ5E 1KCSH 3NVTA 4D0BA 4N28A 1GY2A 3BD4A 3U8GA 3AIRA 2IALB 2VCCA 4HWEH 2CK2A 3QEQA 4QDGA 2R2EA 4MB5A 3TR9A 4MAYB 3BVTA 1O12A 5EMJA 2Z8SA 4XAGA 1NA8A 1YHPA 1YNKH 4JPWL 3DJSA 1I85C 4YDZA 2BGNE 4TPRL 2ESVE 3D25A 4HH9B 4EDWH 4ODUA 1XD0A 2CE6A 3L5WA 3HQ1A 2AK4B 3KRZA 4N2GA 5FUCE 4O1EA 4R85A 2PNDA 5JNYB 4ZAKA 1X96A 4PULA 1Z9NA 4Z76B 1IBDA 1CC3A 5FKPA 1OSPH 2AJYH 1HQTA 3RLVA 2EIEA 5J6SA 2DTSA 1JCKA 2Z00A 4LF3B 1UM4H 2BP5M 3CK0L 4Z3TA 5SWSA 3KWSA 2UV3A 3WY3A 2TSYA 3ZBMA 2WWKT 4NO2A 4MAUL 3BGAA 3IXTB 2Q8AH 4I13B 5GSRB 3UGEA 3T4YB 2IAAC 1UXMA 5LNWA 2YIHA 1AGDA 4DP6X 5EPDA 2BNUA 4GRWH 3N2JA 2WZAA 3TT3H 1CDGA 4P7NA 2XCMC 2BNQA 2OX5A 4RWYH 3FOMA 3B2DC 1CTNA 4PRID 4HA3A 3VUSA 3K1GA 2XQBH 2BIIA 4ONHA 4PRNA 1W56A 1YPXA 3I9GH 3O3AB 3C0QA 3TBYB 2DQXA 3BSMA 2W6RA 4LUSB 3FK3A 4JPGA 4LNCA 4M6NH 1E3FA 4NSKB 1U42A 1H6FA 4D0BB 1QQDA 3FQTB 5D4IA 3USZA 1MWAB 3QEQB 3BPNC 3WKMH 2R2EB 3GLCA 4CVWA 5ERWA 1MIEL 3V4VL 2IWKA 4TNFA 1UXSA 3GH4A 4ZDHA 3D4CA 4F20A 1PY4A 3X14A 3CVHL 4M7KL 3D25B 1TF4A 3HG0A 4JHBA 4XCFH 4ODUB 4GK8A 2GBUA 4WJ8A 1I1XA 5EF2A 3L5WB 3CDCA 3WQ6A 1OF2A 2V5SA 5IHUL 5HOSA 1CFTA 3U4AA 3UWEA 5FKPB 3MQIA 2KLRA 1SFSA 3GS4A 3JBG7 3TN4A 4PJEF 5D1XE 1A4BA 3T8MA 2Z24A 3VFGL 1YQVH 2ZRWA 3LNMA 5SWSB 4WDXA 1AY1H 1UCTA 1ODZA 3SOBH 3CV6A 4NO2B 1NGWA 3GUTA 3FXYA 1BZOA 3MOBH 4E42A 5IGXL 5C3TA 2DQIH 4GSQA 3PPCA 2C5DC 1WIPA 4BKNA 5I3JA 1J8HD 1E0TA 2BNUB 3HJEA 4OU3A 4R4BA 3QIUC 1PD6A 4RFOL 4JD4A 1EJUC 2BNQB 2VHLA 4U5KA 4OJEH 3FOMB 4GXVL 4NN7B 5D4YA 4HMEA 4CDGC 4HMCA 2X4QA 1V55B 4WGXA 4HHWA 5C0BA 1OO2A 1CICD 4ONHB 4PRNB 5DJAA 3RYSA 5CG0A 2BPBA 2I69A 3KUMA 3GQFA 3BVWA 2N0MA 3SR7A 5I0XA 1HZYA 3HO8A 4PJHA 4UFMA 2V5YA 4JX6A 2K8MA 1BCIA 4KMTL 5SWQA 1N59A 5E1GA 4LLQA 1MNZA 3O8AA 1O0VA 4KRPC 2QIIA 2DT2A 5CHNA 2C8NA 3DBSA 2PLMA 1QQDB 4WHBA 2X2UA 4NWTH 5FXCH 4KITB 4V2BA 5A2FA 4Z7AA 3RKPA 5KJRL 5ERWB 4R4NC 4G7QB 1SNRA 3WEZA 3KGTA 1M56B 3U9PL 2G2RB 2FCBA 4F7MA 2GJRA 5B80A 4ZDHB 3VM7A 2Y70A 1TO4A 3X14B 2NQDA 3SD2A 3SYQA 2ATSA 1OIFA 4C6MA 3EH5B 4LMQI 3U57A 4XAWL 1OF2B 1IEBA 3E0WA 1IR2A 1CFTB 3WQPA 3WN6A 2WLYA 5KBDA 3HGSA 2AQQA 5EUKA 4MAVA 4RL3A 3NSNA 1OX6A 1GSMA 4TSAL 4PWEA 2QJJA 3OWRA 4K9EC 3GFZA 2V5DA 1OTTD 1S7XA 3V0JA 1S1PA 3CV2A 1NGWB 3GUTB 3PJNA 4UR8A 4OF8A 3N14A 4E42B 2YD1A 1X4ZA 3C08H 3G22A 3QHFL 2YBTA 5AVHA 4LOCA 2XPKA 4QOKD 4HZMA 2ZP9A 4R4BB 2BVPA 3PUGA 1FCQA 4F91B 5FKYA 1S7WB 2X4QB 3MLSL 4MA8L 5C0BB 5DJAB 2FECL 3RNDA 1P4CA 2CG9X 3JUGA 1FCBA 4BKTC 4GAAA 1QR1A 4PJHB 1HKMA 1OYAA 1TZGH 4JHMA 2Z31A 3RHGA 3NCCB 1A3XA 3UJJH 5HINA 4JKNA 4WIQA 1KACB 2X12A 5SWQB 3EXJA 1N59B 2A0LD 4LLQB 1QO2A 4YWSA 4Z77A 2WAQA 1MHPH 4DCQA 1WDWA 5CHNB 5HDOA 3T6CA 4QXVA 1W2PA 2Y2YA 4DJDD 2NT1A 5TE4H 2KAUC 4IOSA 2IG2L 1V77A 2HRPL 1GOIA 4EAEA 3T8XA 2KI6A 5E1IA 1TVDA 1HOCA 2B3IA 1HF6A 2X1RA 2ZCHH 5BNXD 4F7MB 4F2UA 4GWEA 2IUZA 1EYWA 1UWXK 4XAKD 4GY4A 1W15A 5C71A 1NIEA 1B4EA 2EDTA 4F33A 3DU0A 4O02L 3KXQA 1HC1A 1MDRA 4DSYA 2E68A 1FY6A 1YEJL 4HWBL 1MRDL 4ELKB 3VXOA 4QIRA 5EUKB 5C0CB 1AW5A 1TZ9A 5IKCA 3CZKA 5BWAA 3W70A 4X7EC 2A9AA 2EKSA 4LTSA 2QPFA 4YQXL 5E2JA 3O9WD 4IM4A 2CAKA 4G5DA 1NIDA 3SN4A 1E1FA 1NCTA 1S7XB 4X8JA 1YXDA 1JZ6A 1BREA 3RKDD 1KBKA 5JXED 2BHFA 5F7DA 3AQYA 2QCNA 3GVGA 5F1VA 4HG4J 3IT8D 1Y6NR 3A24A 3U30C 3THMH 4M6QA 2F54D 2BVPB 1DJZA 1MCOL 2HKAA 1BFVL 3HC4L 3LPGA 3QHZL 4WUUD 2A6LA 4S3KA 5JQ6L 2LTQC 3RFAA 3WLQA 1QR1B 2VGLM 5E2TH 4FZ8L 4OCMC 2OMVA 1EFXD 4OIBA 2H3XC 2CLZA 2Z31B 1IE5A 1NFKA 3NPZB 5K9KA 4DAGL 5JR1L 3ZLFA 3WDHA 4BF5A 3ZO9A 1YTEA 4Z77B 4AX6A 3V6ZB 4DCQB 4QRPA 4HD9A 4QJ5B 1BGXL 2DQTH 1NWOA 1NGXA 4E8GA 4EIBA 1UJ3C 2ZXBA 4E9WA 3T8XB 5FGSA 1UP2A 3GTVA 4UQDA 3ARBA 3AS1A 4UT6L 1YNLH 1M71A 2JXMB 1T1YB 4M48L 1RY0A 2E6FA 2WSRA 2BOEX 1EO8L 3ELQA 4JKKA 2PDMA 1YRRA 2VQ4A 2R23A 3T4WA 2NYYD 3SDCC 3N43F 5H91A 1ET7A 3VXOB 3R06A 5IKCB 3AICA 3DJTA 1ZJAA 4MTMA 2EKSB 3KWTA 2YL9A 4NOFA 5CJMA 3BWWA 4QJ1A 2VSDA 1G7MA 4CGUB 1CE1H 1I9JH 4Q4IA 2IJ0C 4X8JB 3FQ2A 2EKCA 3DA0A 3E80A 4G5ZL 3V7AE 3ZQ9A 1HQ4A 1AI1L 4ACPA 4Y5YC 1AMKA 5HJBA 1QBBA 1DQLH 4EAMA 1JFQH 4LSTL 3MLVL 4LSUL 4EXQA 4HMDA 1X7SA 2XH7A 1JXGA 3B56A 5DJYA 1A4KA 1BP3B 2BY1A 1J5SA 1WAEA 4LSSL 1UD3A 2DAVA 4Y9OA 4F2BA 2OMVB 4OGQC 5KVMC 1X5HA 2CLZB 2MQCA 3PS7A 5K9KB 5T1JA 4JOMA 3I3EA 5CJQH 1E4NA 2HZHA 4IIHA 3VZYA 1URIA 2CERA 4QRPB 4PJCA 2PTZA 3EFFA 2G30A 1OX5A 1NGXB 4R27A 2J47A 2H47C 3V6OE 1PSCA 4K38A 1UYQA 4BV1A 3NJMA 1IXNA 4WSGA 3CX2A 1XIEA 3PP3K 3ARBB 3QIBA 2FHBA 4JKPH 1M71B 4K39A 4I9XA 4WU5A 1D3CA 2F8OA 1PV8A 1F6YA 1PUDA 2NZ1A 4HIPA 5F7AA 2PYEA 2R23B 1B6DA 3LKNA 4GHRA 3QO0B 3FO1A 3R06B 1VFUA 2CBTA 5F2GA 4OKVA 4HU3A 1YDYA 4TRPH 4FG2A 3O6DA 3YPIA 4YHYB 1YNQA 2Z0UA 4B5XA 2NXYD 1G7MB 3DGDA 2PS2A 5FL0A 1JGDA 1VQTA 5J3HC 4E2OA 1EX0A 4ZL1A 3UR2A 2VFDA 3WIIH 2V82A 1SFLA 1EERB 2E7BA 1HQ4B 4M3JA 4QRBA 1WFMA 1NFPA 3R10A 3EYVB 3OQ3B 4AC4A 4RPPA 4A05A 3TTQA 2VFFA 4XV0A 4GYBA 5HWJA 3GXTA 1SU5A 1CF8L 2BSSA 43C9A 4IQLA 1E40A 1UATA 3KOFA 1OM3L 4NDMA 5LZLA 4QDWA 1QI0A 5DJYB 2BHUA 3TF7C 1A4KB 1IGWA 2WNGA 5AKVA 2XH0A 1TQVA 2YUXA 2GSGA 2PPGA 1FNFA 5DBTA 1W1TA 2OCFD 1IC1A 4QXIA 4FFYH 1NF7A 4PJCB 4PTMA 2NWRA 2VW6A 3EFFB 5FFGA 1LK3L 4XWUA 3OA3A 5CPMA 1DP0A 5LXEA 4IL0A 2VC2B 1R2TA 2LGNA 3GNRA 3BAKA 1AZVA 1BYBA 2O7SA 1GH7A 2CR6A 3FGCA 2E1WA 4YMPA 3QIBB 5FJJA 4DK6A 3ALGA 3OZYA 1A2YA 1M7UA 1E9ZB 4WU5B 3FKKA 1OP4A 4AL8C 4X9SA 1VJSA 5ABHA 4GEIA 4IMLA 3I7RA 2PYEB 2WZPA 3D2UD 3LKNB 3FO1B 4PJ9A 3VXUA 4NZCA 3RTQA 2GYSA 4OKVB 3VTRA 3N6JA 1SUHA 1HILA 2EXWC 1DVXA 1WO2A 4IPJA 3KPSD 4ATTA 1QSEE 1YLBB 1W37A 4ZS6C 3LLDA 1NBVH 3ZX1A 4N20A 1JGDB 1O5DT 5I3KA 4XTDA 2FNWA 2ICWI 1JMXA 4JE4B 3P84A 4FALA 3B2MA 3TC9A 2Y6ZA 3U2CA 4C56D 1QOKA 2DFAA 3BP4A 2PC4A 3T9PA 4WHDA 2HG0A 1QHZA 4K94L 3IGXA 1EC9A 3JWOL 2C6QA 2BSSB 43C9B 2V2XA 2EAWA 5LG1A 4QP0A 4PJBE 4MA3A 4IMFA 4NDMB 3KDOA 5EZIH 1ACYH 1OF0A 3UVIA 4N42A 3CAWA 1BIIA 1IV8A 3GTTA 4XD5A 4DO6A 2YLHA 3O7UA 1T83C 4LOUC 1KCRH 3EJZC 2QAPA 4NKIH 3RVUD 4NNPH 4JTTA 3RVTC 3BD3A 4HK3N 3I6EA 2YS4A 1BQSA 4OR1A 4BQ5A 3DJZA 1VPOH 4GW1A 4A7GA 2YGPA 3NXFA 4FS9A 2YCEA 1WBYA 3WD1A 5HMEA 5DHDA 5GRJH 1NUDA 1WKYA 3N42F 3MMTA 4NHCH 3FGCB 4XTRC 4OCRL 2EPLX 1A2YB 3NCBB 3LKRA 4MY8A 4PUNA 2DWSA 4LQFH 4OIFA 5I03A 4A3QA 3EFDL 2QDGA 3ABMB 2DI9A 1JJKA 5AVQB 4KI1A 2G95A 1RL1A 4P23A 5KJ7E 3LCIA 2ON3A 1IC4H 1JG9A 3VXUB 1AHKA 3RTQB 5E1AA 2OCZA 1PMYA 1HILB 4JDYA 2VO8A 3O81A 4MLSA 5F97E 2RH0A 5GGUA 3UERA 3PRZA 3L2IA 5JHLA 2J71A 2EF9A 4WR3A 2PD9A 4A7QA 5E2UL 3ZIZA 1NQBA 3D6GA 3QJRB 1V05A 3VIMA 3SI9A 3APGA 3BP4B 2FGBA 4GKLA 5DUBA 4M5PA 3BQUB 3RZWA 2V2XB 4L4TA 2OK0L 4RGNE 2WOYA 4S2SA 1V02A 4TXEA 5T3XD 4G72B 3H9HA 4EPBC 4MA3B 3B83A 1G9ML 3LDBB 4U49A 5HBBA 4L5FE 1BIIB 4N25A 1HYSC 3UABA 4AEHH 4HVXA 4X6CE 3WJLC 1XLKA 1ZP4A 3ZU8A 1Q6GA 5GZOC 2P3EA 3V5DB 1RIVL 4GQZA 4XPBH 5KAQG 1CIUA 3O4OC 3WYZA 2NY0D 5JW4Q 5DUML 3KX6A 1N7KA 2FO1A 2W92A 1QK0A 4GW1B 1VPXA 3UF9A 5TF1H 4HMNA 3KLHD 3LU2A 3BE1H 5I77A 1WBYB 2DPKA 1F4WL 1L8PA 4WKHA 4HIBA 5E0FA 2OP4H 3S5YA 4JY5H 3D85A 4ICNA 5HULA 1F05A 3LKRB 2A1WL 4S3JA 1CVRA 4OGXH 1PX8A 4H1LH 1FUNA 3BMVA 4XZIA 1RUPL 1NUNB 3UJSA 4ADUA 2QZQA 3F05A 4DGYL 2FATL 2OZ4H 2OBGA 3GSOA 3NCXA 3RCNA 4J3OG 5E1AB 5KVDE 2M26A 4NIKB 4HK0A 5TQ2H 3IAGC 4MS8C 2J77A 1FFTB 5AVUB 1W72A 4UIMA 3VCLA 4AD1A 2J73A 3DHJA 4NRXA 3RY4A 3TS8A 4WD0A 5KZ6A 3B9KA 5JH2A 5CGBA 2EH7H 4I3SH 2UZ9A 3BP7A 2V3DA 4TLKA 1WRFA 1KOAA 3G5EA 2G4JA 5M5DA 3VD5A 4XZUA 1OFQA 2X6BA 5DUBB 2OGJA 4E9YA 1EUUA 1ZTXE 4HEME 2WKOA 4JO1H 4L4TB 4L1LA 3DGCR 3M0JA 4S2SB 3EXLA 3H9HB 2EYRA 1HO1A 3MLUH 5FF6A 3I6TA 5IQ7H 1ADQH 2BGSA 5IVOA 3C2FA 4OJYA 4XX1E 3PR2A 1UQZA 4Z0XA 2I85A 4EP8C 1OAZH 2NUXA 5CINH 2CEQA 3E3QC 3LHZA 3GZOA 3FX4A 3AXKA 2F38A 4IGHA 1D9KD 5IIEA 3CDZA 3MLXL 3MAWA 3W75A 5IM51 3DUSA 4AIZA 3V35A 4M6OH 4A22A 2JJVA 4IMKC 5CMAA 1LT7A 4H0GA 3C6CA 5XINA 4ETQA 4M7LT 2BXZA 3C8NA 2PGRA 2PLKA 1LTDA 3WQ5A 1MCPH 3VTMA 3D85B 2VRAA 4WWID 3IGLA 2YCJA 5M94B 1ZLWK 3G5VA 3V3WA 1IEXA 2QHRL 3WJMA 1Q0XL 1HL9A 4P0DA 3EYUL 1XCWA 5BRZD 1SMAA 5I26A 5IROA 3GSOB 3DI1A 2A3TA 4HK0B 1GPOH 4RIRA 2VX7A 5IFTA 1HJQA 4ONOA 5FUCC 2Y69B 1V6TA 3EWBX 1W72B 4UIMB 3VCLB 1RUQH 5TQLA 4CL7A 1KC5H 3IGAA 4YZFE 1WDDA 4OZIA 1DQMH 3B9KB 1HJBC 1UZDA 1IM3D 1CB7B 5SV3A 1UWGH 3BP7B 4K5LA 1SYVA 2Q6WA 1ELSA 3WDRA 3TXVA 2CLPA 5I82A 2P0IA 4ZENA 5JDSA 4XZUB 1DJHA 4E41A 3S9DB 4UT9H 4Q32A 2C4FT 3DARA 3IVKA 1LDSA 2EYRB 3PFUA 2CZDA 4JG1L 5FF6B 4J3ZA 3ZE2E 3NZRA 4O2EA 3M4HA 1A6UH 1GHFL 2Q3OA 4CD7A 4D1JA 3L4YA 4MYAA 4JS3A 1DJQA 1GYLA 2FX7H 3D7PA 2FPVA 4AMWA 3U7WL 3Q67A 4HBCH 4Z0XB 1TTUA 5HAOA 4XP4L 4F37K 4NIYE 5DX7A 3KYNA 3WIHA 1QOQA 7REQA 5AYXA 4E4FA 5IIEB 4BZ1A 3CDZB 3N6QA 3DZ1A 3OVRA 1L6GA 4EWJA 2VCAA 2CWNA 3EH3B 3DUSB 3GAKA 1KWGA 4AIZB 4Z1BA 4XNAA 5CN2A 1RZQA 3B5GA 3QC6X 1TTFA 4Y2WA 5CMAB 5AQ0A 2CESA 5F2LA 4YDIL 1QLEL 4ETQB 4RGOH 2BXVA 1Q8AA 1BAFL 3U0PA 4GXUM 3G1XA 1RCQA 3WUFA 1H62A 3G5VB 1W2VA 3WJMB 3UJTL 4M1CD 1KFJA 3N18A 3ONBA 1TREA 2O7QA 1E55A 3MHUA 2G2NA 1DE6A 5KSAC 1S2VA 3UJIH 1HWHB 4ENED 4BWTA 2MRYA 3PF3A 1GGUA 1E8ZA 1G9HA 4MJIA 1WS7A 4RIRB 5AYIA 3I6KA 4FEIA 4YTQA 4TV3A 2VIRA 1Z9LA 3IGAB 2XN9B 4G6FB 3QUZA 4XP6L 3AFBA 4L4VE 5GZND 4OZIB 4Y0GA 4DVOA 2QMJA 1E4KC 3K72A 1SYVB 2Q6WB 1IILE 5D1XC 1VJZA 1OVDA 1GZ1A 1PFCA 5G1YA 2ZPKL 3W1ZA 5JDSB 1RU9L 1P1XA 5L2KE 1J88A 4KTEH 1WZLA 3FJ6A 4E41B 2QPSA 4FQXA 2DEXX 3BH8A 1EANA 2HJLA 3IVKB 2JIEA 2PO6D 1L0QA 4NUJA 1N6QL 2GI7A 2BJMH 1M2OA 3KRSA 3QR3A 1O6SA 4IT1A 3QRHA 2DT3A 3VOHA 4FA3A 2BOBA 2F08A 1V4YA 2J13A 1CDIA 1QI4A 7REQB 1XGPA 4N2FA 4KHTH 3VGBA 1CFVH 4F1SA 4D7PA 1ME7A 4OCNC 4H1ZA 2OZ0A 1G4SA 1BQKA 3ERXA 1F18A 4PJEE 3H9SD 3HNVL 3I02A 1UJQA 2A4EA 4ZB0A 5ETUA 1SFTA 5F4SA 1L6XA 4IRSD 3U0PB 1I7UA 2Z3FA 2E9GA 4ZGYA 1YBQA 4YSUA 5JHBA 1E6PA 1FH8A 2W95A 2CO6B 3WLRA 2FDSA 3TQPA 5LXVA 1TKWB 2AQSA 3CPUA 4GVGA 1JFXA 1MJ7H 4X61A 4LARL 4PGZA 4F7TA 3O6FA 4L9LA 3SSGA 3EIFA 2WGNB 3Q8EA 4FTVA 5AW5B 1MEWA 2P26A 1H6UA 3HKZA 4KPHH 4MJIB 3R4IA 4BK4A 4WXYA 3QEGL 1P0KA 4G1KA 4UNTA 5IBTH 1UVQB 3I6KB 2CLVB 2ADJA 4I77L 4O57A 5BQ7A 2VIRB 5IJCC 3QUZB 3U36A 1T5AA 5I15L 4MMXC 1W1VA 2P76A 4E9VA 4Z1CA 3K72B 2XWEA 5LXGL 4XXWC 1FO0H 3QDJA 1IIKA 1AAJA 4EXKA 5HDWA 2N4IA 1INEH 4B91A 4FQXB 5D7SH 5CD5D 5KG9A 3TZVA 4CD5A 2HJLB 4F5CE 4EXAA 4WNJA 3O8XC 4QE4A 5DA0B 3KOXA 3WJZA 1K03A 3ME3A 3QWRA 4JFHE 2EIKB 1O6SB 5T3XH 2WNWA 2X44D 2JJTC 4DTGH 2ADGA 2F7FA 4R2GC 1XGPB 5A3IC 2AXGB 1QRND 2UUDH 1O95A 4HU2A 5DEFA 2CC0A 4ICXA 3SGDI 3I02B 2NY1B 5DVLA 3ZE1B 5ETUB 5GJSH 5HDRA 1XC6A 1I7UB 3GSRB 4K37A 1YBQB 5DJZA 1S7QA 2AV1A 2DWTA 4ZE4A 1J8RA 2BSBA 1GKPA 4AM0A 3KPRA 1A5FL 4F7TB 3O6FB 4L9LB 4CJ0A 1U8OA 4AYGA 2PF8A 2CNCA 1XRTA 1EJTC 4JHOA 1F8TL 3TT1H 2ADJB 2BIQA 5HJDA 2KQNA 5BQ7B 1K7FA 1V51A 1RPXA 4GIYA 4A7VA 3O4LA 4FR6A 3LEYL 3ARFC 4TVPD 5FCUL 3GPSA 3HFML 4LSPL 3GSWA 4KKPA 3BUDA 4XMZA 5EBGA 3I4EA 4RX4D 1JNHA 2VLME 3V4PA 2OULB 4FO4A 2BS9A 2Q3ZA 3SDXA 1S6NA 3L4ZA 1ZT1B 5E0KA 1WPCA 2WIIA 5KG9B 3WLNA 4PGEB 3TZVB 1R7OA 1RJLB 3APYA 1S9KC 1NOUA 4J4KA 1RA0A 4JKWA 3Q05A 5HYJA 4AT6A 2QADC 4RQQA 4DUXA 1LE9A 1YAIA 2C4XA 3ALXA 2R0WL 2PP8A 4R7NA 2I5YL 1U8CA 5B1KA 2LE9A 4W5UA 1XYFA 1AZZC 3QOMA 1UD4A 2ADGB 2E1DA 1Q9WA 2FJUB 3BJSA 4GX9A 4MD5B 4XVJH 3NNTA 4XVTH 4W87A 2XV3A 4P48A 1NMBH 3MXVL 5DEFB 1WV2A 4AGQA 3DHUA 1R0AH 4RV8A 2W80C 4BH8A 1KIRA 3T1WA 2F0CA 3BRDA 5L0QB 1L7TL 1IEWA 4OCYH 5DJZB 1S7QB 2AV1B 2GPTA 3U0TB 4DUOA 2VEIA 1FWCC 1KYUA 4AM0B 2W4XA 1X1ZA 4ICWA 1HSAA 3I84A 3CHXA 2F53E 3TJXA 1QMUA 1UC6A 4PH8A 2PETA 2E9LA 4HU0A 3VILA 1DSYA 2KBGA 5JDJA 2A3HA 3T81A 5GS1A 1T6MA 4JY8A 1KBBA 4ZMPA 4WF7A 3O4LB 2PWUA 2FEEI 2XRAL 3GSWB 3THQA 2HNEA 4PRRA 1CTMA 5EU6B 3GK8L 5FJTA 3W7JA 2CH8A 1JNHB 4W89A 3V4PB 4PBEA 3KJ4B 5KYNA 4UFHA 1J87A 1VHCA 3SDXB 4ACYA 3W00A 1AE6L 2WIIB 1HCFX 4XAPA 3DX9A 1Z48A 2ODOA 2O5XL 4A7UA 5DHVH 4YDKH 2HPTA 1ZFJA 2XZ9A 4UNLA 1IQ8A 4AT6B 4HOMA 1DL3A 4RQQB 1LE9B 1OY0A 1E4HA 4R7NB 4NNCA 3Q2NA 4LCWD 4DGIH 3RFZA 1KCUL 5L4FA 3QQWA 1NL0L 3FH7A 1TSRA 1U8CB 1T2XA 5DJ8A 2IQ0A 5FAJA 4TU1A 4Z7QE 5CJXA 2VN4A 1SXAA 1Q9WB 4US6A 2YUVA 2DLIA 4JFEE 4HCDA 4DESA 4GUFA 1PWLA 3UW6A 1NGPH 1JZGA 4WAFA 1Q65A 1LQBC 2IADB 3R7RA 3FQWA 4JDTL 4ODHL 2BSTA 1LL7A 4BH8B 1KIRB 1KD0A 3V6OC 2X70A 5IT2L 1U8HA 3B8VA 1YEIH 1U4EA 1HSAB 1S78C 3GF8A 1MCFA 3QUYD 2GY7B 1R2SA 4CD6A 5XIAA 3ZR4A 2XIIA 2K4AA 5GS1B 3X3FH 1JD9A 2GVEA 3D3VA 4I9WE 3TONA 3MU3A 1CDUA 3WKPA 3MWAA 3EXSA 1EJWC 5C8BB 2VSMB 2DOCA 4QHUA 3C6LC 2FZ3A 4GSXA 1BSIA 1GKRA 1KV3A 3QBUA 4FXRA 3HA0A 4ZNEE 2DJUA 1K6QL 2RCSL 4KTYA 4ZSTA 4YZFF 4GC3A 3NZGA 4NLHA 4RCXA 1E2ZA 2J74A 1WX0A 2A7PA 3DX9B 1WAUA 2ZUSA 1SZFA 3LKQA 3BPWA 4WEUD 2F9RA 4B9JA 2HK1A 1FNGA 4MBOA 4NRYA 3VCRA 1U21A 3U6XS 4LBEA 1IGIL 2Y23A 1WD8A 4JDBA 5DHEA 2P50A 5L88L 1L2UA 3RFZB 1DE4A 5ALCH 4BUGA 1CCWB 5DJ8B 5BS0A 1ACZA 4V1DD 3ZE2F 4PUMA 3W1MA 4A6YL 4X4ZA 1G4EA 3QWQB 3OKYA 3DOSA 5ICUA 3R8QA 1DYZA 2YGQA 4Z7WF 1M9SA 2OR7A 2CBPA 2VWSA 3FQWB 3RRXA 3D3FA 1AG1O 1RCOB 1FAIH 3TCEA 4ZQCA 1KA9F 1EA9C 2BSTB 3NTYA 5HHOA 3PULA 4OD1H 4IRJC 5A6MA 3O2DH 2X70B 2DT1A 3HI6L 5E00A 5BMWA 1U8HB 4PR4A 4AF0A 4ADJA 4DIAA 5AC4A 1S7VA 5AVWB 3GHBH 4WGVB 2YD3A 1EEPA 1NUGA 3MLYL 2CO7A 1WWCA 1W32A 1HEZB 2B7QA 1CX9A 1XPGA 3NSCA 1XIHA 1OZTG 1MO0A 5LNGA 4JS7A 3QHMA 4H26A 5D1QE 3WY4A 1NP0A 2WWDA 4YHIA 1CGSH 2ATPA 4M7LH 4CMHC 3PTKA 1DFBH 5GQBA 2J6EA 2QKFA 4U05A 1T6WA 2HG5A 3D3VB 2AZAA 2P80A 4R4ND 2EE9A 4KAQH 3SJVD 3VSTA 2D0HA 4QHUB 2FZ3B 1N67A 3A22A 1UACL 1RQBA 3CHDA 3N6YA 3TV8A 3UTSA 3MUY1 1HZKA 3TASA 1OCBA 3ICJA 5E9AA 4UXDA 4EXPX 1CUOA 1U8LA 4FFZA 2BHZA 1XIWA 4JFVA 3E02A 1J5CA 1CFQA 4YVVA 2NV2A 5FEBA 4Q7BA 1J86A 5E8NA 3LKQB 4Y7OC 2VM9A 3C2SA 3Q94A 3UYPA 1FNGB 3A4XA 3KHJA 3Q8BA 4NRYB 1QSFE 4LBEB 1XVSA 1FWEC 5D8JL 2ADYA 1SJBA 4YH6A 4LQ1A 1DE4B 2PBGA 2RHGA 5C08E 5A8OA 3IV3A 3WQCA 1MWAL 3P73A 1ZA6A 1VD6A 4NT0A 5I8EA 3CDGA 3N9RA 4IOTA 3SDAA 3W81A 4E9QA 1NCBH 3DOSB 3RY5A 1OTUC 5CWSA 1AD9A 5CCKL 4JM2F 1Z89A 4IJ3B 2WC7A 1PX3A 2F8QA 4NZ4A 4M6PA 3AB0C 1JUBA 4ZAKB 3PNRB 3EDEA 2W63A 3M88A 5HHOB 2WSQA 1I1RA 1E5JA 5CLZA 5E00B 4XNMA 1S7VB 1F02I 1A65A 4R88A 2Z91A 1MLCA 1YIXA 2X05A 2CO7B 4UIOA 4LSQH 1FBIL 3DPDA 1EPVA 2CRIA 4H26B 1LRNA 5FYKH 3QNFA 4P2OC 4MJJA 4YHIB 2QGDA 4FI4A 2ATPB 1IB5A 3ZDWA 5D96C 2JALA 3TZFA 1AGDB 1WP6A 2HG5B 3OF6A 3REWA 4Q8BA 1GUVA 3H2EA 3VMPA 5HI3C 4ODBD 1YSOA 2OX5B 4OCSH 3RWFA 4ZFMA 4XB8A 1FNEA 3N55A 1LLWA 3RWJA 3FSTA 4LYRA 3TCSA 2P7TA 4WI5A 1QG3A 4N2NA 3UTSB 5DGQA 2F8IA 2VO5A 3D0LA 4NOBA 1U8LB 4DFHA 4M9PA 5MHBA 4PP1D 5LHFA 1J9YA 2PP0A 1CFQB 3K8MA 4TVPH 1I8MA 1RCXB 3S8FB 3CXHK 1XH3A 4NYLA 5E8NB 1Q0EA 4OBSA 1XB6A 1NICA 4YTRA 2CR3A 3OKNA 3UYPB 2NY5H 2W62A 2XH4A 3OEXA 2VLRA 4J8QA 4U31A 3D2TA 3GH5A 1KLZA 1E6XM 4UQEA 1N10A 4HZLA 5CLXA 3IDYC 1RIUL 1E4LA 2CCRA 3UYIA 3P73B 5GIRA 5I8EB 3CDGB 1IT9H 3X1NA 3SDAB 1UXSB 4XCYA 3DN5A 4YTTA 5FCZA 5CWSB 1AD9B 5CUSL 4PUJA 1ZVNA 5IQLA 5E6ID 1CXLA 4WQOA 4RBPK 1MUJA 3RMEA 2BFGA 3IPEA 1ISVA 2Y5QA 1RZIA 2WGXA 1JNNL 3AWEA 2XWXA 5DJ0A 4G8GE 2VUNA 1PPIA 1QEWA 3M43A 1Q1JH 4XNMB 3DNKA 3KHQA 2PDNA 1RZ7H 1RHFA 3UEZA 2QCFA 2Z91B 1MLCB 2H6UA 5FV2A 5I73C 3MBXL 4UILH 1VH7A 2X1OA 1UBPC 1TPWA 2QJMA 2WLHA 1ICQA 2PPDA 4KQ4L 1DBBL 1ZAHA 3L66A 1TTBA 5I1KH 4AQ1C 4TM9A 5I6SA 3REWB 4B2DD 2J5LB 4BRVA 2QDVA 1W6TA 3RWFB 1BHGA 3IJ6A 1FNEB 4YHML 3RWJB 1TETH 5FIEA 5F9AC 2P7TB 3FA5A 2Z7KA 3TO4A 3D0LB 1PLAA 4PRBA 2XWCA 3ZDXE 5JIHA 2WMHA 1I8MB 4PJXA 1XH3B 4NYLB 2FHFA 4F0SA 3SAZA 4D8OA 15C8H 3SDCD 3WFLA 3OKNB 5B1BB 3EF4A 4WWKD 3II2A 1LWHA 2K1MA 4N2LA 2A0NA 1TNMA 2AAMA 2F9BT 3MUHL 1HINL 2LLNA 2W9EL 2W27A 4AIEA 2MSPA 4HZLB 3MBED 2G8ZA 3KVKA 1O6TA 2ZCKL 5GIRB 1V03A 5PCYA 3W24A 3IJQA 1BZQK 4XCYB 1JWSA 1SR9A 3S96A 2KL6A 1XXFC 6TAAA 3QQXA 4QYOA 2J1WA 4CEUC 3HC3H 1Z9PA 3SDDC 3MJGX 4JL1A 3EOAA 3BN9C 3QEZA 4QRUA 3UESA 1RUKH 5DZJA 1MUJB 3LI1A 2VLKA 3ZXAC 1GMEA 1IEBB 3GI8L 2EEFA 4C57C 1RQEA 1RZIB 1F13A 2BSED 4YHLL 5DJ0B 4B4FA 2EPMX 3MUCA 1IAIL 2XHNA 1QEWB 2B1OA 4MMZA 1R33A 2DBJA 5I2UA 4M82A 3NEXA 4IMDA 4JAMA 5I1CL 2P5EE 4GUGA 1SXBA 2G4EA 2CBOA 3V0WL 3GJEA 2VDKH 2EUZA 3SGEI 3WBWA 2EDLA 4UFKA 2EXYC 1HJXA 4CD8A 3BXWA 4G6AC 4FL4B 1JSYA 1S5IH 4ALAL 1E8YA 4PLKC 5DS1A 2V33A 2VEMA 1W1ZA 3KCOA 3H22A 1P7KA 1ZLEA 2HVOA 4X80L 3NABH 3T42A 2Y61A 1F3EA 4K3EL 1T2QH 3PJXA 4OFYA 3VRIA 3L3JA 1EGZA 2Y1HA 2OEKA 2KUTA 2UX6A 4PRBB 3LMJL 4M93C 2XPZA 3FMGL 1SXZA 3ZDZF 4NQXA 3SPIA 4PJXB 2BCKA 3I3DA 3OMAB 3QDMA 3RGHA 1BXVA 2GTQA 4WV1C 4N6QA 3N1FC 1IGML 2F15A 4KZDL 1RD5A 4Q97A 1JZEA 1VEPA 5FFOA 1SVBA 5M95B 1BQLL 3N85L 3NK3A 1YCSA 3BUPA 1W3KA 1M57B 1CK0L 4XAFA 4AEOA 4BWWA 4IU3A 1HOCB 3EHBD 3WO4C 1Z8AA 1XG3A 3W22A 1QDSA 5EO1A 3WJJA 4DGVL 1JWSB 3S96B 2NQZA 4RMUA 1DQKA 5GGSY 2ZVIA 1IHIA 1V08A 3PZQA 3EOAB 4F33B 4QRUB 5HMFA 2MUCA 4Z7QF 3QORC 4IX2A 5I1JH 2VLKB 4PVLA 2YCIX 4ZX3A 7PCYA 2IDTA 4ZMWA 3QAZC 4MMZB 3QJHA 3B2VH 4HVBA 4NF7A 2FD6H 3CLFH 4JAMB 3MT1A 3LH2L 4OV4A 3GJEB 1UKQA 4G8IA 4J3UA 3IM1A 5CSBA 3EZJB 2Z0BA 3AWFA 4KU1A 3DYPA 3SE3A 1JYWA 3VD1A 4MX7A 5F7DB 3NQ7A 2P10A 4WJ5A 3CYJA 5AVSB 1P4IH 1RQ5A 4Y19D 3QY6A 1B2WH 1P7KB 5HYSA 1AIFA 3EDFA 2OKMA 2VDHA 3SCTA 1WBJA 5DVOA 3TIEA 5BOEA 3SGDH 3L3JB 2YGVA 2XIMA 4H8VA 3RNKA 3CLMA 2WQPA 1Q6RA 2DQGH 4M61A 3OIXA 1CS6A 5JZ7D 5AYUL 4NQXB 1DZBA 1OSEA 2FLBT 2BCKB 5CC6A 4ES8A 3QDMB 2G60L 3C56A 1XLEA 2K3HA 1ISWA 4DBUA 1ADDA 4V28A 2WO5A 3FU3A 2EECA 2EXWD 4Q0XH 3QUXD 5JW3L 3LYRA 4KJQD 4XMLL 4UOJA 4JPKL 1IL1A 2V9RA 2BP0A 4ZS6D 2RUSA 1MREH 3KJ6H 2XXGA 1KJ2H 2K6ZA 4G6KH 5I1GH 3IARA 1DVUA 3AQXA 3S8WA 3LRGA 4X5XA 3MSDA 5EO1B 3QCTL 4NQQA 1IEQA 1NM9A 4K9EH 2L7UA 1XF4A 2CO1A 1WDQA 1H49A 2X6AA 1G7UA 3DENA 4HPXA 3C5JA 4QD2E 1TVHA 1UWXH 2VX4A 4YBQC 1SO3A 4NAQA 4GLEA 4DGUA 3LEVH 4H6RA 3RBSA 4LAZA 2IC2A 4RNJA 4JFDA 3ZDYF 3GMRA 4HJ0C 1XHHA 3QJHB 2NUPA 1DBAH 1XYBA 4PFHA 4YPJA 2CZVA 4LOUD 3EJZD 1OT4A 1H5VA 4XNZC 3RVTD 4G8IB 2HN7A 4J2MA 5AZ2H 4PSRA 4FKHA 4CRPA 1U5JA 2P5WE 5ITFA 3D0VA 3TBWA 4I18C 2FPYA 2O6FA 4WJ5B 2GQ3A 5C2UB 1UWYA 4O4WA 5HYSB 1G9EA 1AIFB 5AOKA 1U0QA 4BCXA 1LE5A 2F1BA 3TIEB 1J5OH 5HYEA 4A38A 3RAOA 1WA2X 3PWVA 4XTRD 3RNKB 1P48A 4M61B 3DG3A 2C14A 3HB9A 5JMOC 4BJHA 4PB0L 4JO4H 3BGFC 5CO1A 5C0QA 1G84A 3QQ3A 2ZKHH 3FSZA 4ZPVA 2K4WA 1P5BA 1HHGA 5AOMA 2YWZA 1E9IA 2JK5A 5LGHL 1NCWH 4QYAA 4EO5A 3UWZA 2YXMA 3MZNA 1XHGA 3OYXA 1IL1B 5CS7A 2BP0B 1D7CA 1NPNA 1DWFM 3L0GA 2CD0A 1EJSC 2EEDA 5HYFA 5I76A 2VN5A 4X5XB 5HHXL 2VC2L 1XF4B 3V95A 4C1KA 3D08A 3NZQA 1WA1X 3C5JB 1TVHB 1S3KL 3H3PH 4H88H 1UP0A 4R90L 4A8RA 2MCPH 3C60A 3CLEH 4FNLH 4QHLA 4JFDB 3GMRB 2EXOA 1MEXH 2YGYA 2BVTA 2ZAIA 4MNQA 2AJSH 3PV7A 2ONEA 2NUPB 1HYSD 1RUAH 2OWCA 1BA9A 1R0MA 1G4PA 1KM6A 4FOMA 5GZOD 3M5XA 3W23A 5GPRA 4B9IA 3M17A 5ITFB 3P30H 3ZMNA 3D0VB 3TBWB 2ZKXA 2VCBA 2HMIC 3DURA 3HAEA 5SWZE 3ATAA 3UZZA 1VP5A 2XZ7A 4OZ4A 2Y6SC 3F7YA 3RGVC 4WK0B 4IX0A 2DUXA 1LE5B 3HMWH 3PJSA 4CVZA 2DTMH 4ZXBA 5D70H 4JTLA 1EGJA 4XWGL 1KBWA 4P04A 3KR3H 3G1RA 4FYRA 3EGDA 4JRYD 3PWVB 3X13A 5HI4C 3UY8A 3RPIA 3CPLA 2VDQL 3GZAA 2CLFA 4JQIA 3FO0H 2PPAA 5IEHA 4LVDA 4FADA 1RBOB 2UV8G 4PMUA 4Z1PA 2Y4SA 2BIPA 1M6JA 2GSGB 1S4IA 3QQ3B 4KXAA 2H7WA 1HHGB 1KJVA 4S1FA 4L3AA 4AD2A 2IAMD 2JK5B 4MS8D 4LZKA 3HKFA 4R5TA 4FEMA 1JZFA 4GSRA 3HI5L 3KHOA 5D7KE 1BQCA 4H13C 1A3WA 1WZMA 5K59F 3SYCA 1ZANL 3BIBX 3U1QA 2V3FA 4S1SH 5I76B 4NZTH 3A6BL 4JANA 2C9AA 3SKNA 2BOFX 1UB3A 1XLJA 3ALPA 2C3VA 2WZEA 4KQNA 3JWNG 1KZQA 2BNRA 2HSAA 3NO1A 5K9DA 4PUUA 4H04A 2Z6FA 3INUL 1EXGA 3C09B 4Y9FA 1XLAA 3S2LA 3PN8A 2QIWA 3UTOA 1KIQA 1CTOA 5FGCE 2R8SL 4C6EA 2PXYC 3SCUA 3P11H 5CCGE 4IMLB 4ZOBA 3C60B 5E0QA 5T33H 4PJ9B 4TOYH 4MNQB 5DHYA 5ACZA 3PFMA 4OV9A 1Q0YH 2PDKA 3VWJA 4NQDD 3TX4A 3QPEA 2Y3NA 3VAVA 1YJDL 4X83A 3HE6A 3CXDL 3MO4A 3QISA 4JQ4A 3OXSA 1MPAL 5BW7C 3TTSA 3WSQL 4WLCA 4EN3A 4XUYA 3M17B 3T78A 1PE1A 5F71A 3O6YX 1AGEA 5B1CA 3DURB 3HAEB 2XZQH 3RF9A 3HU7A 2QPDB 4OZ4B 2IANE 4ZFOA 4YC2C 1EP3A 5JHDD 1OGAD 3QWOA 3NUKA 3PJSB 4CVZB 5HDLA 2V9QA 4U6VL 2K0RA 4ZXBB 5IDIA 4D9RE 3E9AA 2NCEA 3NZ8A 3PP4L 2DZVA 3EGDB 1SEQH 2DMKA 3X13B 5K4ZA 2P3YA 3RPIB 4JFFA 3R8GA 3UTTE 2I5GA 3CPLB 4ORIA 1PHQA 5I74C 1EFZA 3F2DA 5IEHB 5JUEL 5ID0A 5I7GA 4OUEA 4NKOA 1XISA 4M81A 4X5RA 4XNYH 2ESVD 3SRHA 3ARYA 1KJVB 4QBXA 2HX8A 2VDIA 3V1HA 3ZDXF 4B9ZA 4UTUA 1F6AA 4N4QA 4YLWA 2OQLA 4RGMC 4KWVA 2GSJA 3CNYA 3UP1A 4C6LA 4ZFCA 2NMSA 5ISZD 4HUKB 3E2RA 1SZNA 3B5HA 4NJGA 1E51A 2F5AL 1XYAA 1BKHA 5FK9A 4JANB 3SKNB 4YX2H 3MMWA 4JO3H 2ZUQB 2PWFA 3DX0A 3BK0A 2BNRB 3OGOE 3C0JA 3S2JA 5K33A 1C29A 2F74A 1SZEA 4HJSA 5C0JA 5EOCH 1FGVH 1KIQB 5LBSL 1M7PA 4P23B 2HLEB 2ZKMX 2Q8BL 3L9BA 4GBDA 3JTBA 3ZHKA 1QT1A 2QULA 4P7LA 2ZUVA 1I3RA 2VKWA 5DHYB 5ACZB 2MQ0A 3VWJB 2XKNA 4C6CA 2Q01A 5EMLA 3NT0A 3AWNA 2D7TL 1LP6A 5A8NA 5D72L 1MRQA 3HE6B 5GGUB 3SYPA 2WW5A 4NLAA 2BP3A 2WW8A 3TEXA 4IDJH 5T3ZH 5KZCD 3TQKA 4EN3B 4HBQA 3MA9L 3B4YA 1FIGL 2Z6IA 5KETA 3GDMA 1QEXA 2CKRA 2GG1A 5F9WC 5JHLL 3M1OA 4LAQL 3CZUB 4DRSA 3KBWA 1MFDH 3W0KA 1BJ1J 3QWOB 1Q8JA 2ICEA 3I6LE 3RPKA 2WBJC 1QRKA 3NZ8B 3NL3A 1TMCB 4HDIA 1UGNA 4H7VA 7CGTA 5CH9A 4JFFB 2VDPB 3NFNA 4JZNA 2FSEA 2DP3A 2E40A 2WP3T 4X2PA 4XBPA 1W5MA 4NUQA 4TLUA 4CJ1A 3KOZA 5ID0B 4NKOB 1NFIA 4HAFA 2NR6A 4QCFA 1Q5MA 2AZUA 2C1OA 4F7PA 2PP1A 2QSCL 1F6AB 2WWKO 3DVIA 1HIML 1E28A 3UPBA 4AL8H 1OAKH 1TQBB 3R11A 2E59A 5G2HA 4DAFA 1MF2H 4QTIL 5FK9B 4W1TA 2EDFA 1AQKL 4RH4A 1TZOA 1FAKT 2Y5TA 5IXEA 4DEPC 3WKNA 3SD5A 4OI8A 2F74B 5C0JB 3BH4A 1Q6OA 3SE8H 5BMXA 3IK4A 4MSWA 4EX4A 5EYWA 5EOQH 1D3GA 1I3RB 3IDGA 2WHVA 2CGRH 1HN1A 3SYAA 2XKNB 3FU7A 1AKJD 3P0YH 4GXFA 3AHYA 2QDHA 1I2RA 4B9GA 4AVIA 2D20A 4NRXB 3MRIA 3UXFA 3EA1A 1A5UA 3MS8A 2DD8L 4K2UH 1TLMA 4ZMYA 4KQ0A 1DR9A 4PJ8A 1RFDL 5AAPA 1LDCA 2QLYA 2AHIA 2PTYA 4AG4H 2I17A 2CXEA 4MKSA 3BGMA 4DP7X 5EFIA 3LCXA 3GS7A 2E5CA 6FABH 4A8LA 4I87A 3PE9A 4FX7A 2WN3A 3ZRSA 5D1QC 1EJRC 4HDIB 2NX1A 4YN5A 4E36A 3NFNB 3LCLA 4JZNB 3AY4C 1M04A 2FSEB 2B1AL 5SX5K 4XBPB 2VZVA 2XWZA 2R2HA 5DHMC 4D9QE 3CMOL 4Z7WE 4P59L 1NFIB 3CGTA 2X0VA 5A6KA 1FNSL 4N1CA 2C1OB 2QJHA 1KCWA 2R29L 4F7PB 1IGCH 1E28B 3EO1A 5F3BA 3OAYK 4Q8VA 4JN6A 4P5UA 2Y7SA 1A49A 3DFYA 1EFQA 1L6WA 3DFPA 4XBJA 4NYYA 4FIRA 4GZJA 4XGZA 2YSSA 4KIRA 1YEHL 2Y5TB 2GJXA 1DZ0A 4NX0A 3SADA 4O4YH 1T22A 1TTAA 5K9QG 3PWPE 4YHEA 2YL6A 1E65A 4R26L 5C9XA 1EO7A 1ZV9A 2HCZX 3II1A 4MSWB 5LIUX 1A3LH 4DP4X 1DL7H 3I65A 3RTLA 2J9ZA 3TVMD 3IDGB 1OPGH 3I2CH 4NJ9H 3FU7B 1EZ2A 3OX8A 3M5VA 3TBSA 1J0ZA 4O51A 3V0FA 3MRIB 5HHPA 4HTYA 2J7BA 4HEPG 3U1SH 3GR8A 4Z7VA 3I85A 4R2GD 2ZWKA 1JTTA 2JGQA 3E8VA 5A5WA 4PJ8B 5A3ID 5A8MA 3THAA 1DBTA 1GEHA 3BGMB 2WYZA 5HSFA 5EFIB 4J4PA 4EWND 3NACH 2GUBA 2K3TA 4OVUA 1UKOA 4YIWA 3DYMA 3V4UH 1A5OC 5DJXA