1WZAA

Crystal structure of alpha-amylase from h.orenii
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
488
structure length
488
Chain Sequence
FEKHGTYYEIFVRSFYDSDGDGIGDLKGIIEKLDYLNDGDPETIADLGVNGIWLMPIFKSPSYHGYDVTDYYKINPDYGTLEDFHKLVEAAHQRGIKVIIDLPINHTSERHPWFLKASRDKNSEYRDYYVWAGPDTDTKETKLDGGRVWHYSPTGMYYGYFWSGMPDLNYNNPEVQEKVIGIAKYWLKQGVDGFRLDGAMHIFPPAQYDKNFTWWEKFRQEIEEVKPVYLVGEVWDISETVAPYFKYGFDSTFNFKLAEAVIATAKAGFPFGFNKKAKHIYGVYDREVGFGNYIDAPFLTNHDQNRILDQLGQDRNKARVAASIYLTLPGNPFIYYGEEIGMRGQGPHEVIREPFQWYNGSGEGETYWEPAMYNDGFTSVEQEEKNLDSLLNHYRRLIHFRNENPVFYTGKIEIINGGLNVVAFRRYNDKRDLYVYHNLVNRPVKIKVASGNWTLLFNSGDKEITPVEDNNKLMYTIPAYTTIVLEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha-amylase A
publication title Crystal structure of AmyA lacks acidic surface and provide insights into protein stability at poly-extreme condition.
pubmed doi rcsb
source organism Halothermothrix orenii
molecule tags Hydrolase
total genus 170
structure length 488
sequence length 488
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2005-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1wzaA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1wzaA01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 1wzaA02
3A3HA 2QMJA 5A2BA 5BRPA 3ZO9A 3WNNA 1JG9A 4GZJA 3GM8A 3EJRA 2ZXAA 1V3JA 1VFFA 2FH6A 4JCMA 1EOMA 1I1XA 3IJ8A 1ZS2A 1CPUA 4P8VA 4MJ4A 3HJEA 2WCAA 1B3ZA 3PZGA 2DSKA 1KCLA 4NRSA 1D7FA 2GJRA 3LMYA 4TX6A 3ECQA 4R5EA 1KR0A 3A24A 1RH9A 1DP0A 2JIWA 4PMUA 3MUY1 5DO8A 4JHOA 1DWAM 4GIAA 5BWFA 5ABEA 4BQ5A 3D51A 1FH7A 4HA4A 1PZ3A 3CMJA 4J3UA 2J7FA 1OT2A 4QLJA 4MB3A 3UCQA 3SUUA 1FHDA 3AHVA 1RPKA 4JKMA 1Q6DA 2GFTA 4H8UA 4P8WA 2WMJA 4AZCA 4PRWA 1W1PA 3IGUA 3BAYA 3ZSSA 1HTYA 4UOJA 1WO2A 1E6XM 1MYRA 3AICA 2OW6A 3KLLA 4D6JA 1UH4A 4HZ8A 4EANA 4UQ9A 3BUBA 4AZCB 2J47A 5I0DA 1KQYA 1KXVA 1MQPA 3WFLA 2WWDA 3N1AA 3OB8A 5BCAA 1W32A 2V5CA 2DT0A 2XM1A 3D4YA 4U2YA 3AROA 3AXIA 4P8XA 4CCEA 4WF7A 2J79A 3RO8A 3VDHA 2W5FA 1DEDA 5BRQA 1NP2A 1HVQA 1HXKA 2FHFA 1UASA 3WUBA 1TQWA 5CSUA 4CGTA 1R87A 4W7WA 3POHA 3CGTA 1GVIA 3BMVA 3WDRA 3WBEA 5GNXA 5FOOA 4WKHA 3FAWA 4W7VA 4J3TA 3L2MA 3LX9A 2WVUA 2FYVA 1M03A 4XUYA 2DPEA 2QV4A 5JBDA 4B9ZA 4WSJA 2WLYA 4Z2GA 3MKKA 2NW0A 2WHMA 4X0VA 3W6LA 2DH3A 1CWYA 4UOZA 1JZ7A 3VU2A 1TQUA 2PBGA 1PIGA 1H09A 3TONA 3H53A 1FP9A 4AD1A 1CXKA 2PWFA 2OSYA 2O9PA 3CUIA 5E6YA 2WB5A 4D6GA 1E6RA 5JBEA 3CH9A 3BVWA 3NDYA 2WAGA 1F4AA 1A3HA 3M7SA 3ARUA 3VOCA 1WPCA 4M80A 2WK2A 4DWSD 3ARTA 3SCRA 1QOXA 4AMCA 5GNYA 4CVWA 1B3VA 3SCTA 2XVKA 2WVVA 4NZFA 3RILA 1LG2A 3K4AA 3DX1A 1E5NA 4FNTA 4D6DA 2DH2A 5D9NA 3T09A 1NOUA 1V08A 4M8UA 4JFUA 1E0XA 1MW3A 1UWIA 1ITXA 2WVVB 2VX5A 5GNZA 4HMEA 3MO4A 4F79A 2ZX7A 2XGIA 3GNPA 3I3BA 3MI6A 3N15A 1UQYA 2VZVA 7A3HA 5DEZA 5TD4A 2X09A 2ZWZA 2CYGA 3W0KA 4ZE5A 5HBFA 1FOBA 4JIEA 4JL2A 4Z2KA 3L4TA 3L2LA 1JZ3A 4AD2A 4OIFA 4H8HA 1ZU8A 4GINA 2CBIA 2F7RA 1IT0A 2A3CA 3T2OA 3N13A 4M82A 2WC3A 4W8BA 4U2ZA 1JYXA 4AYGA 2WMGA 4NF7A 1N82A 3D5HA 4H41A 1G94A 2OW7A 3SCQA 3L4XA 1JFXA 1BVNP 1LL6A 1WZMA 2CHNA 2PC8A 3RCNA 4V27A 1TR1A 2XN0A 4JFVA 1DWIM 1PBGA 1R47A 3VILA 2VCAA 3A6OA 4OBRA 4TVDA 5LYRA 5CLWA 4CU7A 2YFNA 1EO5A 3WUGA 2CBUA 3NSXA 1LL4A 1U30A 5FCZA 1E4IA 3A4AA 3HN3A 3CUGA 1ZBCA 1WDQA 3OGVA 1J0HA 3GH5A 3W24A 5LA1A 1WKYA 2XJ7A 2VVSA 3WDJA 5A94A 1MFUA 2Z1SA 2G3JA 1RP8A 5A2CA 3O2LA 4CD8A 4HU8A 2YA1A 4KGJA 3AI0A 1LLOA 1E4NA 1JYWA 2DT3A 4MAVA 4DO6A 3OIHA 1UKOA 2UY3A 1BSIA 1W3HA 2CHOA 4PTWA 3A47A 4MNJA 1GW1A 4W5UA 1V6XA 3AMDA 2HVMA 3AHZA 3BVUA 1QI3A 2CITA 4AZGA 4UFLA 3BC9A 3VD5A 1JDCA 2XFYA 3NYDA 2J4GA 3QHMA 2X2YA 1PPIA 4YN5A 3WH9A 2Y5EA 1V3IA 1HP4A 1JF6A 4MDPA 3AXHA 5D9MA 1FA2A 4OZOA 1GCYA 2XYLA 1GQLA 1XYZA 2DDXA 1UKTA 2CXGA 2YJQA 1R7AA 3WD4A 4CN4A 1KGXA 1Q6GA 2DIJA 4P7OA 4AEFA 3VSVA 1C93A 4PTVA 1B90A 1H1NA 3VGBA 2E8ZA 5EBAA 4HU0A 1E3ZA 2O9RA 3WDPP 4ACYA 3QR3A 2DGAA 3W27A 1L0PA 4OJYA 3M46A 1GZJA 3OGRA 3W53A 1LQ0A 2AAAA 1QNPA 4B3KA 1HJUA 1MXDA 4IPNB 1MW0A 2VURA 1HL8A 1M04A 3IK2A 5A6SA 1UKQA 1V6WA 1TQVA 4LX4A 5A6BD 3DX2A 2O9TA 2PB1A 4W7UA 3RJYA 2EPOA 1HL9A 1KGWA 4V28A 3ARPA 1W9PA 1QNRA 1NH6A 2QMKA 2ZUUA 3KL5A 5FIPA 2WMIA 2V5DA 4Q7NA 1US3A 2PWGA 2VX6A 3RM9A 1WE5A 5A6JA 3GZAA 3VD3A 2F18A 3ARQA 2F8QA 1HJXA 4PTMA 3T0AA 5CXPA 3II1A 4EK7A 1CTNA 1AQMA 3EDFA 1ZL1A 2WMIB 4CU6A 4ZENA 3DECA 3WQWA 4GO8A 3VKKA 4DUXA 4MAZA 2C7FA 4MNMA 3PZIA 5I78A 3WEMA 3LPPA 1X6NA 4D6CA 3BVXA 5EFDA 3WD1A 3PBGA 3BLPX 3RDKA 3DX3A 2J7EA 2UWFA 2G3MA 1ODZA 4W85A 5GPRA 4AY1A 4Z2LA 2W91A 3OLGA 1XCXA 2F1AA 2XVGA 1E40A 3BUQA 2CKSA 3K1DA 2XM2A 1OGGA 1QHPA 2BY2A 1EDTA 4UR9A 3GH4A 2J62A 4HMDA 4JHZA 4MNKA 5DMYA 2OYMA 2ZXBA 3U7BA 4PMNA 2E0PA 1VJZA 4HPGA 4AZIA 1VFMA 1K6AA 4AZ5A 1XD1A 3WF3A 2XUCA 3LXBA 1H11A 1WNOA 3PTMA 1GOOA 3KWXA 3W29A 3AS0A 4NRRA 2G4FA 4D6FA 3W38A 1UR8A 2V3GA 3AMKA 3WH7A 1SFSA 5IDIA 1W1VA 2E9MA 2MANA 1CLVA 2D3NA 6TAAA 4H04A 2VCCA 1ODUA 2D23A 1C91A 3FAXA 4LPCA 2IXUA 4TTGA 3WF2A 1UWSA 2YIHA 4CD6A 2AOSA 3FNDA 1E9LA 2JF7A 4D1IA 5E09A 4Z2JA 1H4PA 1UWQA 3W81A 1UYQA 2WPGA 2Y8KA 3AZTA 3MSGA 3WNKA 4X9YA 2JEQA 2VX4A 1XSJA 4DUVA 3F5JA 3S5YA 1VBUA 3VIPA 5M5DA 2YA0A 5CJ5A 3MMUA 2OWCA 3SUTA 3VMOA 3BVTA 1UD2A 3RPMA 3TTYA 3ZT7A 2ZX9A 4PTXA 4R27A 1A47A 3N18A 3DX4A 1R85A 2F1BA 3BUDA 3A23A 1G5AA 2JEPA 3W28A 2EPMX 2YBTA 2E8YA 5BYWA 1JAEA 2EBNA 3WNMA 3AFBA 4M1RA 1CGXA 1JIBA 1CENA 1UG6A 1C7SA 2BVTA 1R46A 1E73M 4UFIA 1XRVA 1E70M 4L4OA 1J11A 3GXTA 3NIYA 1QHZA 5E70A 2CETA 1XSIA 5HOSA 3ALFA 3MMWA 3I3DA 3ZOAA 1WCGA 1DWHM 1R86A 4JL1A 1NQ6A 3QHNA 2F2HA 2GUYA 1V3MA 3WQ4A 4FLQA 1C7TA 3AIBA 3PZQA 1DTUA 1EA9C 4S3JA 3T08A 3HZ3A 1GQJA 1OINA 2FHBA 3KLKA 2J25A 3EMZA 3WQ5A 3MUIA 3BSGA 4P7RA 1KTBA 1W2PA 4PMDA 1JDDA 2CERA 5AY7A 3PZ9A 3ZT6A 1B1YA 1ESWA 4QCFA 4QP0A 3ZJ7A 3CTTA 1OBAA 2QPUA 4HPHA 1U33A 1ZBWA 2BY0A 3VIKA 4FNSA 2J7DA 1XH1A 4J27A 3CHFA 1H0IA 4B16A 5D4YA 1GQKA 2J77A 3T0BA 1HJVA 3WH8A 2ZIDA 2GK1A 3VIFA 5CLTA 1TFVA 3NSNA 2FGLA 1CDGA 1J0YA 4MB5A 5I77A 4DM2A 1NOWA 1UH2A 3HMCA 2FDMA 2E9LA 2VRJA 1O7AA 2OLHA 2VZTA 2J7HA 2GK1B 1JZ4A 1HKKA 3D50A 1AQ0A 1QBAA 3SCUA 4IM4A 1BYCA 1BG9A 3PZNA 4DO4A 2X2JA 5I6SA 3A21A 3VNYA 1XCWA 2VNCA 3VDAA 3DDFA 3MV01 4DWSA 1E6SM 1CGYA 5KEZA 3LPGA 1V3KA 5D8ZA 4ZFMA 4F8XA 4WK9A 1FP8A 4TVCA 4UFHA 4OGZA 3K8KA 1B3WA 1VENA 2IXVA 4HA3A 4DWSB 4XZWA 3CZSA 3OBAA 5IXEA 4XZBA 1VJSA 4W86A 3VGDA 4CD5A 4AW7A 1KWGA 3EDJA 5BXSA 1TQTA 2D73A 2A3AA 3B8SA 4KWUA 3ARWA 1G01A 4L4PA 4OKDA 3VD4A 3GXMA 4U3CA 1HJWA 3BH4A 2XWDA 4AD3A 5M03A 1NARA 1CECA 2BS9A 3DYOA 2QLYA 5CSYA 3MANA 4AD5A 3TA9A 5EB8A 3EDDA 4XV0A 1JZ5A 1BYAA 4BQ4A 1BTCA 1OGSA 4LYQA 4AIOA 1KR1A 1B0IA 1WP6A 5EFFA 4KMQA 3PZUA 4E2OA 3F4VA 5I5RA 1QX1A 1ISYA 2F7PA 3K8LA 1ECEA 2G3IA 2XSAA 1VBRA 2EPLX 4PMXA 4AZBA 4D1JA 3CZLA 2OWWA 3U7VA 3NDZA 5CG0A 1VFOA 1E6PA 2BHZA 2EAEA 1NP0A 3O9NA 3W4RA 1EDGA 1MXGA 4U33A 2B31A 1GVYA 3PN8A 4TX8A 2IUZA 1R33A 2X0YA 5D9PA 5A95A 2FH8A 1KTCA 2TAAA 4UQAA 3NCOA 2ZXQA 3IAQA 1W9VA 4WIWA 3RIKA 1BQCA 3FXYA 1NWRA 3VDBA 1S46A 3WY4A 3TOPA 4ATWA 1JNEA 3JUGA 3LPFA 1SYTA 4CN6A 2RGMA 3ZIZA 1CGTA 4NXKA 2YL6A 4ML4A 3L4UA 1X6LA 7TAAA 1XYFA 3GXFA 1W9UA 3ARYA 3ZQ9A 4E4PA 1E0VA 3BCDA 1VAHA 1VEPA 2E3ZA 2ZX6A 5A8QA 1C90A 3SCNA 2XPKA 3VD7A 4LYPA 3N9KA 4NZCA 3SUWA 2Z1KA 1UD3A 5IFPA 3OLDA 1R75A 4P8UA 2WM0A 4FNUA 1EGZA 2EXOA 4AIUA 1VRXA 1CXIA 3ARSA 4CD4A 1HNYA 4PMRA 3AZRA 3QHOA 4AZ6A 2W62A 2WZEA 3BUPA 2XN1A 1BHGA 2OYKA 1AQHA 4URIA 4J3XA 2V38A 4A3YA 2D24A 3KZSA 4W87A 2XGBA 2PWEA 4UTFA 2EEXA 2BXZA 2JF6A 3ALGA 1QPKA 1V0NA 1W1TA 5AYBA 3UG3A 1W91A 2EJ1A 4BA0A 2PF0A 3WUFA 1ZJBA 1J0KA 4FLOA 1V03A 2WZHA 4D6EA 4NX0A 4GO9A 1JD9A 4HA1A 1LF1A 1QWUA 1ZJAA 4P7NA 3EJQA 1C8YA 5A69A 3VTRA 1UQZA 3WQVA 3VINA 3THDA 5CPTA 3GBEA 2WHLA 3IAPA 5D8WA 2PWDA 2ZUNA 3ZM8A 2DT2A 3AS2A 3N12A 1WDSA 2JIEA 1EOKA 2J7CA 1HN1A 2WC7A 2WCGA 1X1NA 1ZBKA 2F7OA 3WNPA 4JKKA 3H55A 2ZWYA 1JFHA 3OLIA 2J74A 4J3SA 4BQ3A 1RD6A 3NUKA 3QOMA 4J3WA 1QNSA 3WH5A 1MWOA 5A6KA 5HPOA 1R34A 1QBBA 3WMCA 4GXPA 3ZJ8A 1R7OA 3TTQA 1WDPA 2GDUA 3WBAA 1BYDA 2VT0A 3VSUA 5HDRA 1JZ6A 1W3KA 1OB0A 4CCDA 3KEHA 4UQBA 1IZKA 4MTVA 4W8LA 1JDAA 1O7DC 3THCA 2VX7A 3D4ZA 4PSRA 5FKYA 4PEEA 5JIWA 3A5VA 1UH3A 3WENA 4MPKA 4CCCA 3CV5A 2BVYA 3VDCA 1VB9A 2OSXA 1V6UA 4UOQA 2BV9A 4HOWA 2NSXA 1K9EA 3NSMA 3DX0A 3ZR6A 1HX0A 1TVNA 2GJXA 3WQ8A 3UESA 4D72A 1H0GA 1E15A 4BZYA 1KBBA 3CO4A 3PHAA 1CYGA 2ZOXA 2WYSA 1TUXA 3CPUA 1Q6CA 1QW9A 3GBDA 2X8RA 3WF0A 1E1EA 2GJXB 2NT0A 3M6DA 1E71M 3N04A 2ALWA 2VL4A 2YLLA 2NT1A 4AMXA 3CC1A 5ABFA 2CBVA 4D6HA 2WMKA 5C71A 1TG7A 3GXDA 4E8DA 4C7FA 3SCOA 2X2HA 2BY3A 2O92A 3ZMRA 1J0IA 4NI3A 3CBWA 4JZ5A 4D6IA 2VZUA 3A4WA 4QLLA 2Y4SA 3CZGA 1F4HA 4AYSA 5I79A 3WD2A 2YFOA 1J12A 4XX6A 1FH8A 3WMBA 5ABFB 2VVNA 1MQRA 4HOXA 4DUWA 1TA3A 3AIVA 1Y7VA 2JFEX 1QI2A 1VF8A 1GOMA 3DHUA 3TP4A 4FNPA 2XG9A 1UWTA 3CIVA 1E6ZA 2J8GA 2ZE0A 3UR8A 2DSWA 2A3BA 3GXPA 1UR9A 1LL7A 4F9JA 2VRKA 4BCEA 4H8VA 3O6AA 1PEZA 4PCTA 1H41A 4WSKA 1TA3B 2D0GA 1E3XA 4UQDA 2VTFA 3WQ6A 1UR0A 5FL1A 1HT6A 3GH7A 3U5YA 1ISZA 3G6MA 1W1YA 1CXLA 4U31A 1DWGM 1UD6A 3GYCA 3WSUA 1P6WA 3BLBA 2WZIA 3BSHA 3CUJA 3L4ZA 2D20A 3MUAA 3WF1A 3VIGA 2BHUA 4PCSA 1Z32X 3S2CA 5AYIA 3T2QA 5A2AA 4DWSC 4D71A 1QVBA 3VGGA 3UG5A 3UETA 4UZUA 1SMAA 2WHKA 4XB3A 3TV8A 4EKJA 1K9FA 1OM0A 1UHVA 3ARVA 3RM8A 4FLSA 3WF4A 3AS3A 4ACZA 2ZX5A 4M81A 2FHCA 1HJSA 3MUZ1 4AXNA 4JKLA 1CEOA 2FE0A 3BVVA 2CPUA 1UWUA 1HJQA 4UNIA 4ACZB 3FY1A 5IHSA 1UKSA 3EDKA 1C8QA 1GHRA 3PTQA 3DC0A 4CVUA 3BLKA 1W2VA 4PYSA 1TCMA 3VPLA 1NWUA 8A3HA 2EACA 3CMGA 4ATDA 1L8NA 2GVYA 1V02E 3D3AA 1H2JA 4CUCA 1KXQA 3WIJA 3VUPA 5A8MA 2VI0A 1B3YA 3BXWA 3WELA 3WN6A 1W3JA 1KQZA 1HWWA 2VZOA 4FMVA 5E0CA 5DFAA 1C92A 2BVDA 4PUEA 3IANA 2E40A 4JCLA 3AYRA 3WDQA 5E9AA 5DT7A 5C70A 1GOKA 3W82A 3N17A 4X0NA 5A6MA 4TVUA 4NXSA 1CGWA 1NOFA 3B9EA 2WBGA 4KRUA 4M29A 4W5ZA 3IJ7A 3S6TA 5BXPA 1EHAA 2CEQA 3BAWA 1G1YA 1O6IA 4OOUA 4H2CA 1JXKA 3EJUA 5BXRA 3BUIA 4GI8A 3LXAA 4LXFA 3AIQA 5A8PA 3WD3A 1E4MM 3CZEA 3KL0A 1GJUA 1V6VA 2VCBA 3K8MA 5LA2A 4MB4A 3AYSA 3ARRA 4JFTA 3AXXA 4MDOA 3NJ3A 3ARZA 3W26A 2YL9A 4E8CA 3AOFA 3BAXA 3VIMA 1KFWA 3LPOA 3VX1A 2VRQA 6A3HA 3SCWA 3VO0A 1QNOA 2ZUVA 1BLIA 1VEMA 1XH2A 1V3LA 2WLZA 2BNJA 2F7QA 1B9ZA 1D3CA 3BAKA 2EPKX 1W9DM 4UQEA 1MW2A 2W66A 3AZSA 4WJXA 3WNLA 2EO7A 4QFUA 3SCSA 2X0HA 4KH2A 4CD7A 2DQXA 2QHAA 3APGA 2J75A 2D0FA 1CXEA 1BVZA 1BGGA 2WCSA 2E9BA 1HP5A 3J7HA 2YLAA 3AS1A 1EQCA 1E43A 1WZAA 3VIIA 5EMYA 4Z2IA 2V3EA 2UY2A 3QOKA 1CZ1A 1E56A 3ZSTA 1XC6A 3T0DA 4PMQA 3CZNA 3CHEA 4S3KA 1EQPA 3KE0A 1CXFA 3AIEA 1PX3A 3HG4A 2X1IA 4BQ2A 4AZ7A 2GSJA 2XN2A 4CN1A 1M7XA 1V0MA 4B3LA 1MW1A 2CIPA 4UFJA 3AMLA 1CGVA 1JZ8A 2DT1A 5A6LA 2YKKA 3ARXA 1UD5A 1CNVA 3EDEA 1EH9A 3L4WA 3E1F1 3PZVA 3WL0A 3MSDA 4U5IA 1PJ9A 2WSKA 5FL0A 2XHYA 3K4DA 1OCQA 1ZB5A 1D2KA 5JUVA 4JAWA 3DHPA 1QWNA 4HP5A 1NWTA 2AMGA 1GUVA 1QI4A 2F61A 1QI0A 1UOKA 3CZKA 2VUYA 3LXCA 2C8NA 2CKRA 8CGTA 3WDHA 1BG4A 3WL1A 2BY1A 1XH0A 1HF6A 3AHXA 5F7UA 4W93A 1H5VA 3OZPA 4EE9A 2VR5A 3EJPA 2X2IA 2FGZA 4ZXLA 1OD0A 1PS3A 4YHGA 3W25A 1LG1A 5E6ZA 4AC1X 2D3LA 1JYVA 1V02A 1EO7A 2YL8A 1KCKA 2D2OA 1JI2A 1J18A 1BGAA 3GTNA 2W4XA 4CU8A 2YBUA 2CESA 4PMVA 1TVPA 5D9OA 5ABGA 1CXHA 4JFWA 1G9HA 4PMYA 1MFVA 1TMQA 1NM9A 3GXNA 2DSVA 2UY4A 3AMCA 1JYNA 4N0RA 4TXEA 5HNNA 3AHTA 1PAMA 1K9DA 1UKPA 2CNCA 1HVXA 1WZLA 3AIRA 3RJXA 4C7DA 2YA2A 3L4YA 4M24A 4AIEA 4AD4A 4A3HA 5LA0A 1DHKA 1UA7A 3I3EA 1HIZA 1Q6FA 4TTUA 1AVAA 4IPLA 2HISA 4UZSA 1Q6EA 5IFTA 4DO5A 3OLEA 5HPCA 3VIOA 5KZ6A 1FHLA 2J8FA 1UZ4A 3SCPA 1PZ2A 1ISWA 1KBKA 3HG5A 1HKMA 3B9AA 2ZUMA 1GORA 4RE4A 2CBJA 2E4TA 2VC9A 2PWHA 5DT5A 1JZ2A 3G6LA 1EDQA 2OWXA 4HZ7A 2W61A 1UD8A 5I3DA 3A4XA 1FH9A 3OA5A 2Y8VA 1E6NA 1KXHA 3WY3A 4ZE4A 3EYPA 4FF5A 5DF0A 4J28A 3LRLA 2WVSA 4AEEA 4AD0A 3VMPA 3U57A 4W88A 1EXPA 5CPSA 4FNQA 2VO5A 4OOZA 1M53A 2XTKA 3MV11 3WEOA 1OT1A 4QAWA 1US2A 2VZSA 1IZJA 2QF8A 1QNQA 3BAIA 3UG4A 3HG2A 4GI9A 1JNDA 4DM1A 1MQQA 5I2UA 1JAKA 2Y2WA 2WANA 9CGTA 5A6BA 2CCRA 2JE8A 2WW5A 3F5LA 3BMWA 2VOTA 1R8LA 1LJYA 4Q22A 3EJTA 1OIMA 5E0FA 1E72M 3VM5A 4GI6A 1V0LA 1YHTA 4QLKA 1C8XA 1EIBA 2BHYA 4BF7A 4J3VA 1XHGA 1MVYA 2EPNA 4GPNA 1VEOA 1UZ1A 4JFSA 1CLXA 4HMCA 1DWJM 2YL5A 3OGSA 1E1FA 1V6YA 1PX8A 2JALA 4MADA 1B2YA 3PZTA 3H54A 1JF5A 4WLCA 4IUGA 3DDGA 1YQ2A 3WKZA 1KGUA 1SZNA 2XWEA 4C7GA 1ISVA 2XFRA 4UQCA 2XVLA 6CGTA 3WDIA 1TQSA 5JIPA 1SMDA 2YOCA 4KRTA 3UEQA 4PUDA 4PN2A 4RE2A 2QPSA 3CZ8A 3FN9A 4YPJA 4W8AA 3UERA 1V3HA 3MS8A 2G41A 4OBSA 2W92A 1JGIA 1Q4NX 4MB1A 3B9DA 1GOQA 3VSTA 4P7QA 4UCFA 5IHRA 3WUEA 1UA3A 4Y7EA 3VX0A 2PI6A 4HOZA 1W3LA 3GDBA 5A8NA 1UUQA 4PBGA 1CGUA 1M01A 1VFUA 3VGHA 5CGTA 3VIHA 4MJ2A 3D52A 1EHNA 2W67A 1TE1A 7CGTA 4BS0A 3T2PA 4Z2HA 3CZJA 3WH6A 1QI5A 3VGFA 2WKGA 3U5UA 3VM7A 4A4AA 2WMHA 2J7BA 4PSPA 2A3HA 3VNZA 4U5KA 4LGXA 5A6AA 3EMQA 2WSPA 3AIWA 4P7LA 3LRKA 4H7VA 3PTKA 1JL8A 1UWRA 4KGLA 1PX4A 3KL3A 3F5KA 4ZEPA 2V3FA 1WB0A 5A1AA 3WY1A 1GHSA 2GJPA 2YDRA 5JBFA 1HXJA 3RM4A 4QCEA 4ZXOA 1B30A 2DEPA 2OYLA 2ZUSA 1GNXA 3K46A 1B31A 4PMZA 4ATLA 1WZKA 4AZHA 1UR2A 1ITCA 2ZX8A 3FHAA 3HU7A 4YHEA 4UFMA 2D22A 2WVTA 3SIMA 4W89A 4EAMA 1HKIA 1KB3A 3BGAA 1CBGA 5BROA 2VQTA 1JD7A 1GQIA 2ZUWA 1OWQA 5M17A 1J0JA 2XSBA 2DIEA 2XIIA 4W84A 2DSZA 3W6MA 3AISA 2WC4A 3WNOA 1OSEA 2XVNA 3AIUA 3HG3A 3CUFA 1G0CA 2WWCA 5C8BB 1UR4A 4FNRA 3ZJKA 1KXTA 2Y24A 3VIJA 3TTOA 3GNOA 3ZT5A 3PZMA 1C3FA 1TZ7A 1W9BM 1B3XA 5ECUA 3VMNA 2D1ZA 1H3GA 4FK9A 1GOIA 3POCA 3ZJ6A 3DYPA 1QHOA 2G8ZA 3L4VA 4TOQA 3AHYA 2WKLA 3M07A 3A22A 3WFZA 5I23A 4GQQA 5A3HA 3W37A 1LWHA 5ABHA 2VJXA 5FD0A 1GOWA 3MMDA 2Q8XA 4NSBA 4UFKA 2VMFA 1RP9A 5E1QA 2WBKA 4TUFA 2J7GA 1VIWA 1BFNA 4GKLA 4RE3A 1ISXA 1U2YA 3SUVA 5BXTA 1HKJA 3GNRA 1WAWA 2V3DA 1J01A 4WKFA 3DYMA 4J7RA 1E5JA 5CZKA 5I24A 2EADA 1W9XA 4FLRA 1XV8A 4AMWA 1LWJA 3EJSA 3SURA 4PMOA 2WMFA 3AJ7A 3CHDA 2ZUTA 4F66A 1E55A 1DWFM 1J10A 1JI1A 4V2XA 3WD0A 1J0ZA 3GXIA 1GJWA 3OG2A 2DSUA 3BAJA 3SUSA 3WY2A 1BF2A 1I75A 2G3NA 2VQUA 3QGVA 1BAGA 2WNWA 2O9OA 3WEZA 2ZXDA 4LYRA 4B9YA 1GONA 3EBVA 2IGTA 2EQDA 1FFRA 1I1WA 1IV8A 3AQUA 5AC5A 3MU7A 3RMEA 1E0WA 1UR1A 3EMCA 1BYBA 3S5ZA 1JXJA 3TTSA 2D0HA 4CKQA 3CHCA 1H49A 1GPFA 3AMGA 3IJ9A 4N42A 2YDSA 1KWKA 5A8OA 1BPLB 4AISA 1E6QM 2BXYA 2PBOA 2A3EA 2BFGA 3FW6A 2XFFA 4GZEA 1K9TA 1CIUA 1V0KA 1UD4A 2XIBA 3VGEA 3BCFA 4OUEA 2EABA 1OGBA 2VR4A 3VD9A 3WMSA 5CGMA 4MNLA 4IISA 1PIFA 4RL3A 2X05A 3N11A 4B15A 3VVGA 5GQBA 3SEPA 3ZR5A 1T0OA 2C0HA 4QDMA 1XSKA 1XD0A 5M3WA 5AC4A 2RGLA 1OIFA 5CPQA 1E4LA 3PZOA 1OD8A 2WHJA 2YDQA 4HTYA 4NZJA 4U3AA 5CQ1A 1XGZA 1ZBVA 1FFQA 4F9DA 3FHQA 4HZ6A 4K68A 4WKAA 2ESCA 4AWEA 3SCVA 1NWSA 2W63A 4GQRA 5HXMA 2XVPA 4GZIA 3LRMA 3OZOA 3UR7A 2UY5A 3CUHA 1J9YA 1SR0A 2J78A 1AMYA 1QW8A 2ZICA 4LQ1A 2GDVA 2OSWA 2WXDM 1WDRA 4M56A 3CLWA
chains in the Genus database with same CATH superfamily
3ZO9A 1QTYT 1VPQA 2R8WA 4C56E 3TCLB 2QS8A 1RAMA 4MTMA 4QNWA 1HE7A 4MJ4A 3C0SA 1UVQB 4HEME 4LLMB 3KYKL 3M88A 3H6OA 1QBLH 3TJEH 1E28A 5FV2A 1IUZA 2PDMA 2ZG3A 3MNZB 3A24A 3L9EA 3QJFB 1SO5A 3TWCH 3QEHA 1PKQA 4MJIA 1Z8AA 1FH7A 3G04A 3UCQA 1EP2A 4TL4A 3GMPB 2VQ1A 3GI9H 4Q6YA 4Q97A 3HR5A 2I07B 4P2RB 1MHPL 1GGCL 1OAQH 1WBZA 4I9WD 2VDOB 1QFEA 4PJ8B 4PJCA 4XOEA 2DP3A 5FYJD 2VDGA 1W32A 5DSCA 4XHJC 4JTFA 5FIEA 3WD5L 2EIJB 3NJJA 2B0MA 3NYKA 4JM2B 2CDEB 5HINA 4Z78B 4DP6X 4MXWH 1VR6A 1FNHA 1U8QB 5B3JF 5I03A 4CGTA 3MDUA 3Q37A 3VYLA 1MRDH 3FKKA 4QRTB 3WMLA 4I9TA 1S7WA 5EUOA 5CZRA 1ULVA 4HLEA 4YGAB 2NQ3A 2I9EA 5B38A 4RAUA 1VKFA 4C6KA 1WT5C 4DGUA 4PWGA 2VLKE 4MNQA 3O6MH 3MHZA 3UDWA 3KJ6H 1K6WA 1YPZF 5KVEE 2B1HH 3VH8A 4U1NA 1IILE 1F1DA 3EFOB 3LGDA 4CVWA 3QORC 3BWZA 2H0PA 4I1PA 2P28B 3PWAA 1RV8A 4O2FA 2W0FA 3GMOA 2R0ZH 2HX8A 4QRUB 1I1AB 1E0XA 1BJ8A 3HB9A 2BOBB 1YYLL 2E7CA 1KM3A 5C7XL 4F79A 3IU3B 4BK4A 4NHCL 1EJOH 4FQLH 1CTMA 4GNKB 3T6XA 2H3DA 5FF0A 3IDGB 1S39A 4QHMA 4AYGA 1M3JA 1KIQA 4F0LA 1GKEA 2YAQA 5FYJL 2FDSA 3IRCA 4PJEA 2CHNA 4M62H 5DA4A 1HKFA 3UBXB 2VUOA 4CU7A 4RMRA 2R2CA 4HH9A 3A4AA 3L67A 1UT9A 4LVHB 3EOEA 3STGA 4G6JL 2ICEC 2G3JA 2APVA 5EIIB 3H4WA 2ZDRA 4QRRA 2N3JA 4CDGC 3MA9L 5BQ7A 4E41A 3PFUA 1NBYB 1JF1B 2VWEC 2VN7A 1V6XA 2GBVA 4NUGH 2XWTA 4Z0XB 2J8UB 5AZ2H 2BIPA 1XGUA 3TIEA 5F1SA 2A79A 3DX6B 2KBGA 3RBGA 5HI3D 4PGLA 5FGRA 3QZWG 2KYIA 2AJZA 5ENWA 5D2LB 4P7OA 2BIOA 5F9AC 4GVGA 1IFGA 4ACYA 3SN0A 2JB5L 2CLZB 2DGAA 1P1XA 4ODSH 5IV2A 3SFWA 2UY6A 2YCEA 3L17A 4C5YA 4H13C 5HDLA 3ALWA 1HJUA 1M04A 2JIXA 1NDMB 3RJYA 5CZXD 2ZUUA 4G80A 4RDBA 4DK3A 4Q7NA 3QIBC 3WJYA 2R7EA 3DHMA 3LHTA 5KSBF 1AP2B 2KAUC 3RVXD 1HJXA 2FSEA 1KV3A 2VCOA 4LLYB 5D7JA 4EK7A 5CXPA 1SBSH 3BWUC 1T66D 2W38A 4KKAD 4PD4K 3VKKA 2MTAA 3L7RA 5FGCB 1E6JH 1JUBA 1ZA6A 3KW8A 3V0AC 2VAAB 1QWKA 3O45B 3PJXA 5E8PA 1WXJA 3GSWA 1K70A 2PA6A 2PTDA 2XM2A 1U3HB 4DYEA 4UR8A 2PCQA 5HNTA 3TBTB 5FJTA 2NUPA 1BAFH 2CRZA 3CAVA 1FZMB 1BQSA 1H61A 1U8MB 3LZ3A 4AZ5A 1G7HA 2FFCA 2AITA 4KT2A 1AD9A 3W38A 3U9IA 4RZKA 1LBFA 5HWMA 4Q8NA 4OKVA 5FFOA 1EEZB 1EYWA 3CPLA 2YIHA 4WRHA 3OKEA 5FWQA 1TELA 2TRSA 3GSNH 3RX4A 5B8CB 4LFYA 4WU7B 5EFIB 3D0LB 1US0A 5HJ3B 1K03A 2OOGA 1Q1JL 1Q9KA 2GFBA 3SUTA 3NQBA 1MVUB 1AYOA 2ZX9A 3P73A 4WO0A 4JO2L 2OI9B 4Y6GA 3MREB 1RBOB 2RQEA 4N4QA 2DI9A 2QBWA 1JIBA 4AQ8A 1UG6A 5I1HL 1HILA 4DKEL 4DN3L 3RWHA 3GGWA 3D85A 1MUCA 2G37A 3AXLA 2YXFA 2Z4TA 5FFGA 2F68X 3ZOAA 2OMVB 3R89A 3L3JB 5IW1A 4FLQA 1BZEA 2WXHA 2AK4A 4KETA 4E68A 2V63A 1GQJA 3TURA 3RL2B 4PH8A 1YN6B 5E99L 4P7RA 3ZXWA 1LJMA 2PNDA 2Z7KA 2DAVA 4KCVA 5LQBH 4PJBA 3QRLA 1IJNA 4QP0A 3QIUB 4O0KA 1HOCA 3WIFA 3S8WA 1H0IA 5A6IA 2AEIT 3HZYB 5DQDH 2J77A 2KZ1B 4LT9A 3UG8A 2LTQC 3C60B 3B56A 5IHWA 2PXYC 4RCXA 1N8OE 1IVLA 3LCHA 1DANU 4K5MA 2FFIA 2OLHA 2YD8A 5DXYA 1ET8A 3RHGA 3I10A 1BYCA 3PWPD 3U2SA 4DO4A 4FA8A 4X99B 3MO1B 2EXYC 5CGYC 1H7RA 5EOCL 3ISIX 3IJHB 3BG3A 2F54A 5AW3B 2WIIA 5CBEA 3LV5A 4CNSA 2HN7A 4ZRGA 4JFFA 2PZ0A 1FP8A 5BOFA 2L7QA 4OGZA 4O02L 4R34A 1TVHA 3LEXB 4IMLB 1VENA 4WTQA 1VJSA 3I7SA 1YY8B 2B2XH 3NCJH 2C9AA 1PD1A 2Z1XA 4Z8FL 4BK9A 2EZ0D 3BFOA 3SKOB 3MRGB 5BZDB 4DJDC 4NZRL 3NJIA 3UZQB 4RAVA 1N5YH 3OC5A 2D7NA 3H6JA 2IADA 2MUCA 2NX5A 2O5XH 1I9CB 2C91A 4AD5A 5EB8A 3EDDA 4EI5B 3FVDA 4XV0A 4GEJA 1HZLA 3KHQA 4XKMA 5MI0B 2FUTA 3C6SA 4HUKB 3AGVA 1TTPA 2XSAA 1VBRA 3OKOA 4AZBA 2OWWA 4PIBA 1X6UA 3OPZL 5C08D 1S9VA 3LDVA 1R33A 4JUTA 2D2HA 3WTVA 3DZ1A 4XGZB 4A7TA 3B8IA 4N9OB 1AW1A 1QR1B 3ECVA 4ZQNA 5CGQA 3EO9H 2YKLL 2W94A 5KTLA 1ACCA 4NO5A 3NJVA 3MCG1 5TIMA 2EEBA 2R0KL 2BNRD 1AGCA 3LHPH 2E3ZA 4BHUA 1LO2L 1IIGA 4O1AA 3CXDL 3HVNA 2BIHA 3RWCB 7REQB 3QEUA 4PJDE 4A3UA 2GGIA 3FCBA 3QHOA 4IPJA 2OX4A 4YU1A 3W7JA 2OYKA 2DUZA 3IVKB 1POKA 4A3YA 1LP9A 4JBSA 3KZSA 3ZPDA 4MJ5A 4UTFA 4P5UA 4TQEH 2G9KA 3KPPB 2OR7A 4M7KL 1UJ3B 4JDTH 2Z6JA 1AJ7L 5IJBC 4DCQB 4HA1A 4O0QA 4I8YA 4JQ4A 4G1KA 3A6CH 5E5MB 3K30A 3WQVA 5IDZA 5CPTA 3NPUA 3GBEA 3IAPA 5D5MA 4F2UA 4JPQA 4LVNC 3T05A 3FBKA 2J7CA 4GRWF 3B9KD 4Q52A 4RMTA 3M0JA 2A9AA 4ODXB 2QR6A 4LEXL 1MDAA 2J4WL 4LLVA 5LGKA 4OF8A 1Q5MA 4ROPA 3H9HA 4YFLF 4AZ8A 3PHQB 1BZ7B 1DVZA 4UM8A 3N2JA 3BW3A 2WINA 4I88A 3KYKH 2N7SA 2FR4B 3ULSB 2IALB 1MWAH 2QR0B 1B0WA 1S7RA 3QAZC 1T1YA 3VFVA 3GLCA 3H8NA 1UH3A 1VBHA 4LHQB 3FZUD 5INDA 3DX0A 3JWDC 2BGQA 2GSIB 2HT3C 4LOUC 4BGLA 3W7GA 2GTWA 1R19A 1MHPH 4NZ1A 3CNKA 1KBBA 2ZOXA 5JIMA 4F58L 4X8CA 4Q9RH 2CHRA 4DO7A 2VL5B 3HFML 5D93C 1E71M 1RXOB 4O1CA 4LCVA 4WZ9A 2IANB 3HNSL 4FFWC 3HI6L 5JYMA 4G6FD 3DHUA 4GRLC 4OD2B 4JPWH 1FBAA 4IIQA 2NY5L 3FT1A 1THFD 4MHHI 3FPYA 5BS0B 4F0KA 1OF6A 5GRUL 3S2NA 1ICTA 1OX4B 5AW2B 2V33A 3CQHA 1Q66A 2PMQA 2REQA 1XBDA 5CP3A 3TPKA 4JLRA 3ZTDC 3NOYA 4W9JC 2CHWA 1MJJA 1BBJA 1B57A 1FUNA 2DLTA 3TU9A 2EEFA 3DUUA 3AAMA 1HJQA 4OTKA 4H88H 1MG2C 1BQHG 3UGEA 2DLIA 4XPHL 1EJUC 4CVUA 4N2CA 2IH3A 4DJEA 1YYLH 4KFZC 5C7XH 3SJVD 1EHLH 1P9MA 3QXAB 3RMJA 2PZNA 3P7YA 1TPXB 2K4AA 3GW3A 4G9FB 5KVGE 1I8IB 5DXWA 4P5KA 5AB0A 3N3TA 2ZZ1A 3M8OL 4FERA 5DT7A 4MF4A 1O5KA 3VXUE 4RFEA 2IEPA 4ZMNA 1NOFA 3TJHD 4OFQA 2OZ4L 4IXXA 4Y2DA 4I87A 4Y16B 4OFVA 3CK5A 3W2KA 4XNQA 4LSPH 2CU0A 2GSGA 2Z34A 4FI8A 3BW9B 5CSGA 1K1DA 3QPKA 1SYVB 3CUZA 1OB1B 1JVLA 4KI5D 4P0DA 4KQ4L 4G6JH 2IWKA 5F2LA 2YB4A 4E8CA 5CEXB 2TRYA 3VX1A 3GSQA 3UABA 4C91A 3GK8L 4JN2A 4IU3B 3VO0A 1WISA 3QN3A 5DY3A 3O6FA 2Z4QA 2WV8A 4QRSB 1S2CA 1RULL 4LLQA 4HSAC 1FO0B 2IQ9H 2E7BA 4YHPB 3AZSA 1JRCA 3TX9A 2WB7A 3KOWA 1J8SA 3RLSA 2IPUG 2ZE3A 3TZVA 3T40A 5C2BH 2BP8A 4U0QB 5ABZA 3A4DA 1MPAL 1OHQA 4WXZA 4KEVA 4B97A 1QCWA 1HP5A 4E6MA 2YLAA 3AS1A 3NZGA 1WZAA 2C6QA 2B14A 3L65A 1VIZA 2NSQA 4PRRA 2VH5H 1MCRA 3ASOB 3CHEA 1OO2A 5IHUL 1JZJA 4K2UL 3HC4L 4L2LA 3IGAB 2F53A 5E8EB 1G7PB 2CFFA 4FQ1L 2DT1A 3ARXA 1T7VA 1MFNA 1V77A 1K4DA 3US0A 3OHXA 4F1SA 1PY9A 4QXTB 4M1GH 3ZMEA 4AM0A 3RNQA 1TUPA 4LALA 4L3EB 3KOFA 4FD0A 2RKXA 4FQXD 5I1DB 5I1KH 4KXCA 5JXQA 1ZHLB 3BP7B 3FBQA 1TPUA 4P2OD 1FCGA 4PY7B 3JWNE 4Y2OB 5IM7A 1I9IL 4X7FC 2YBUA 4LCWB 2CESA 1TVPA 4XD4A 3YPIA 1PY4A 3GNNA 2DSVA 2XV6B 2EDQA 1WS7A 1LO5A 4TXEA 3QUMA 4I89A 3PP4L 2WOYA 5DRXA 2G2RA 3REWA 1V7ML 4TSBL 4A3HA 4H40A 2NMSA 1HIZA 3WO4C 1GGTA 3FYOA 3IM1A 4DO5A 1ZIBA 3ABOA 4AY8A 3CDZA 4P2RD 4WNJA 1NIFA 2ODHA 2MCPL 1RL1A 1EEXA 3CZFA 1P43A 1FL5A 2PDUA 1MCHA 3WY3A 5CJXA 1GY2A 1OX6A 1L6XA 4AD0A 2G97A 2ZZUT 5DZNA 4JM2D 3LV6A 3QB7C 1FRGL 2A9DA 1KCUL 3B04A 1Y18B 1EK3A 1EFXA 1MJUH 3F5WB 2DW5A 4NO0D 4JK0D 5I1HH 4DN3H 2G5BA 1LJYA 3U46B 5E0FA 1OTTD 1V0LA 1C8XA 3OWEA 1I8JA 5T1DL 4A39A 5AVTB 4W81A 3OGSA 4TLTA 5DZJA 5TGBB 5E9NA 4FA7B 4IWWA 5E99H 1VYSX 2YWZA 3KWSA 1ETJA 4WWID 3ZYIA 3PNRB 2DWEA 2XTJE 1R0MA 3ZLQC 5K9DA 4NJJA 5IZ7A 4JTIA 5IEKB 4UTWC 3AY4C 2I32A 3Q2NA 3MS8A 4F3HA 3U7AA 3C2AH 3VOJA 4MB1A 3QG7H 1TEGA 3WUEA 1CQKA 3GDRA 3FQUB 5GGSB 1OSPL 2P76A 4ZQMA 1W5QA 1C9SA 1TYRA 3TFKC 5HHOE 2PURA 5HUPA 1IBDA 4PBXA 3W57A 4O02H 1XDLA 4ODTL 2VDOL 4QQ3A 1A64A 3EYUL 2ZZ6A 1AY1H 2L7UA 2Z24A 1DSYA 1OVDA 1W8GA 2HNHA 5HYSA 1Y6MR 4U1KB 4WWKA 1C8PA 5CAYB 1W0MA 3VFTA 2ZX8A 3S47A 3SIMA 4NNPH 2OZTA 3QDMD 1SM9A 4KZEH 2XY2A 4OZIB 5LG6A 3N0PB 5L7XH 2IPKB 3CMOH 4YDLC 4ZUSB 4PRIA 4UINL 3KAAA 1OWQA 3R94A 1I2NA 1MSPA 5D2NB 4F40A 3RITA 5CC6A 1DE4A 2LLNA 4RR4A 1G0CA 1G9ML 2GK0B 3ILDA 4MMYB 1OSYA 2Z92B 4C1KA 4WJ5B 1PKQE 3KBEA 4FK9A 2OPJA 4MJIE 3R4IA 3W00A 2VLLA 1I9RL 1UENA 3FQXB 2PCFA 4U1LA 4J6IA 1VIWA 4J1UA 3ULVE 2KH2B 5LB1A 1SM3H 4UTLA 1RD5A 4PJCE 1WGOA 3SQBA 5DJAB 2M8XA 3PV7A 2R0KH 3GFXA 3JT0A 1LO2H 1XV8A 1QNIA 2RALA 4C54A 3CXDH 3KZPA 2MSPA 1M7UA 4UNLA 2DSUA 1AQDA 2VQUA 5EUOE 1I3VA 3B97A 2O9OA 5CZJA 3V0UA 3WKPA 5KVDL 3BE7A 5CN1A 4XNMB 1CFTB 1EGMA 2PODA 1KYAA 3O15A 4HD9A 5BMWA 4MNQE 1QSZA 1KCVH 2EG8A 1LILA 1H1ZA 1E6QM 3ZO0A 2VJ0A 4P4KB 3S1XA 1D5BB 2ZTKA 2G50A 5I3GA 2CK0H 4HXAL 4ZPTA 1JPSH 3KOYA 3KBNA 2JKLA 1U93A 3WX7A 1F3JB 1T0MA 4WUKL 4IISA 4K0OA 3ZLHA 2GVEA 3R5EA 5SWSA 4YVUA 5G5DA 1XSKA 1S3KL 1XD0A 1F41A 1LD9A 2K0RA 4LY8A 4U3AA 1H5BA 4LEXH 4OGAC 5HQMA 2ESCA 1BVLB 4PPTA 3HQNA 2YRZA 1WBXA 4OFCA 1ZLVH 4QF1B 4JBRA 2OMUA 2CBTA 3WJXA 1W0WA 1J9YA 3NCWA 1FX6A 1E5YA 2HRGA 1VBJA 4GUQA 4HKPA 2WXDM 1PZ3A 5A2BA 1ZRQA 4NO3B 4L56A 1A7OL 3MCMA 1RHHB 2J72A 4ELMA 2FH6A 3EGSB 1EOMA 4WCJA 1CPUA 4P8VA 3FKUS 2VC2B 3Q2DA 4PJEE 3IDXL 2FJHB 1EZ2A 1S7QB 2IAMA 3FU8A 1PGRB 3Q2VA 2BWQA 3DTXB 4OZFA 43C9B 1H9DA 2FGWL 3FUFA 2ICES 4DEWA 5IGXL 4MYXA 2J73A 3I2CL 3T0VA 4F58H 1ZTXH 4FZEL 1CVRA 4JS7A 4QRRE 1F6AB 4LARL 1MFMA 1E6XM 2PD9A 2V8MA 3DX8B 4E41E 1Q0EA 3HI6H 5I3FA 1KXVA 5DWUL 1FG9C 3OB8A 5BCAA 5JHAA 3MC5A 4C6EA 3BIKA 3U7WL 3QIUD 2N0KA 4PW9A 4PAZA 2WKOA 3LAFA 4L05A 1RK7A 3SDAB 1A5CA 5AOZA 5E1HB 3C60D 4L9LC 3CAFA 5GRUH 4PY8I 4LC8A 4XX1E 3FAWA 4IBLT 3GSMA 1Q8AA 2VYOA 1NFIB 3EZ4A 3TUUA 1DVFC 1J6OA 4QUOA 1C5BH 4YS1A 3UTOA 3BVNB 4GRMB 1R6WA 4AD1A 1UM5H 4XKYB 2OSYA 4F2EA 2X4TA 3FCUB 3PPCA 4MFDA 1UOLA 2X40A 3DX5A 4CGUB 3UAFA 2WAGA 1F4AA 1FVDB 4ZA0A 2FJFB 5E8NA 1IGSA 4M80A 2WZTA 1T41A 2GQ9A 4NJKA 3KRUA 5I6KA 4HDIA 5EEVA 1I8KB 4NZFA 4IQHA 3ZDZE 4C6MA 5I3JA 1T4KB 2C1HA 1L7IH 2GITA 3MCYA 2VX5A 4LANA 3N15A 4OCSH 5J9PA 5HBFA 2JB6B 3MKVA 1W6LA 1GGYA 4EI5D 1R2SA 3L2LA 5MP6L 4R2GC 1FNLA 2X10A 4WI2A 3B1TA 3N13A 3QH3A 1MRFL 4JMXA 4U2ZA 3V0VB 3EYVB 2CIIB 2OZ4H 1KG0A 3O3EB 1ZCCA 2AERT 2UZYA 1FZKB 3PYCA 3T77B 4WDWA 3XISA 4Q6IB 5DHDA 4QS5A 5C2UB 1OFQA 5EDXA 1DWIM 3TK7A 3B1UA 2CH8A 25C8H 4G8IA 4G43A 2WUCL 3OYZA 3OKLA 1NKGA 4KVNL 2G0LA 3HNTL 4XVSH 4AGPA 3U7YL 3ARFC 1RULH 1A6VH 2CBOA 2XA8L 2YSWA 1G6RB 2FBJL 4QTIH 2IFFL 1P2CA 1S7TA 4EMZA 1A5UA 3MROB 1JDCA 1L2UA 1MPAH 5FF6A 4G9PA 3BV7A 2OMNA 1DYZA 3NCXA 3QO0B 5G1TA 4YSQA 2C3VA 3VRLF 2H9AA 3E5PA 3JTSA 2CXKA 2HZGA 4PTVA 4MY8A 3DV4A 1OCBA 3QXDA 2AK4E 3HRZB 1E27B 1LDSA 4TRPL 2PO6C 2PDGA 2BSDA 4PJBE 1LQ0A 4A04A 3C12A 4LF3B 4ZTEA 5LCVA 1CLYH 3QW9A 1BIIB 1DVQA 5A6BD 2L8AA 5BRZB 4UYPA 1DO5A 1FWJC 4DKAA 4RX4D 3LCLA 1FFNA 3SGEI 1US3A 2SODB 3JR2A 5EF2A 3LTVA 2F18A 2Q71A 3ARQA 3WCYA 1QWGA 5E1AA 4B53A 3VFNB 1S2VA 1O6SB 2QSVA 4MAZA 5I78A 3LH9A 3S7GA 5I06A 1K7FA 2UUDH 3BOFA 2F54E 2PR4L 3B03A 3NZ8A 4MX7B 5IB2A 1BWMA 1U42A 3LN4A 3ZJAA 4JFFE 2J7EA 3L3IB 4FABL 2DDQH 2WXJA 1EJRC 2DQJH 5HNUA 3PP4H 4RFNB 3RZWA 4PCPA 4HMDA 2VW7A 4HJ0C 2ITDA 1AGFA 4F24A 4I3GA 2Y72A 3KR3H 4G3YL 2XZ7A 4L3AA 1LEGA 4WKZA 4HKXB 2V2WA 1ZAIA 7XIMA 2UWEF 2NX5E 4NNXB 1AFSA 2BMBA 4HAGA 2D23A 3BRDA 3CN2A 2IAND 1MUJA 5E09A 5I16A 3RGHA 1UWQA 2F08A 3WNKA 3F5JA 2Y1YA 3MMUA 4FOUA 3RPMA 1P69B 1LK3L 3BLFA 1KEML 1BEYL 3ENEA 3V0HA 5BMXA 4JJ5A 3L3DA 1G4RA 1NCWL 3DV6B 2YBTA 4Q9QL 5BS0D 3Q8BA 2WBJA 4GW4A 4KFNA 4UQ2B 1A0DA 2X1RA 1HQ4A 3PUUA 4Q14A 2L5HA 1S5HB 1D7CA 4L4OA 4MQXC 2HTLC 4YHIA 1KZYA 4GLEA 3KG5A 1ZPTA 1MCJA 4LY4A 3NFNB 2VR9A 2F2HA 1N8IA 3OD3A 2QCDA 5JO5A 3AIBA 4M5PA 2C16A 1YRRA 4E42B 1ZE3C 1Q45A 2R1XB 3HOJA 1CJYA 3Q9QA 1VGAA 3B9OA 2QQLH 4PTTB 5D1QB 3QZOA 2XINA 5FX3A 1YBQB 3W02A 3GS0A 3HMJG 1LP9E 2RHEA 1B0GB 4N1HB 4JIPA 3KPNB 2VN6A 3SE4A 2IDCA 1BXXA 3BANA 2X0VA 2E68A 2GK1B 1HKKA 4JZNA 1QBAA 1Q13A 4CEUC 4IM4A 1NCIA 3ZE2B 3HIZA 3RGVC 4G9FD 3FXIC 1OKEA 2R9RA 3WIHA 1JFQH 5D5ME 5L9DL 4RMVA 3KVMA 1NU5A 3G9AB 4UFHA 1CFMA 5EF3A 4DWSB 1WUNT 4UTBL 4W86A 5KBLA 3IF1A 3EDJA 1BM3L 1XGEA 4KWWA 2P50A 1Y0LA 4L4PA 2A2IA 3UF9A 4JQVA 4UINH 1PLAA 4XVJL 5EA9A 3F7LA 4PFEA 5M03A 4LP8A 4OLEA 1CR9L 4GKNA 4OLUH 3EX1A 1ZJHA 3GE7A 1K6QH 4CVXB 2H6UA 4US5D 1B0IA 4NG3A 4QT5A 3B4NA 2YMXL 2C7UB 5I5RA 3D0AA 4PBWD 1USQA 4DGVL 4PMXA 4WW2A 3VXSA 3NDZA 1I9RH 4JANA 1N7KA 1FXPA 2B31A 1GVYA 3EHBB 4DZHA 3VFWB 1BG1A 4O14A 1RXLA 3HE7A 1R5YA 2DYPB 2NWSA 1KTCA 2VP8A 2GEEA 1H15A 1YXYA 5HYJB 1JP5A 2ZSWB 3UCCA 2RGMA 2QPDB 3ZIZA 4NXKA 3S4SB 4OU1A 5LXEA 3VXOA 4PE8A 2IH8A 3QV7A 3PWUB 3MCLL 1ME8A 4OF0A 4FZ8L 4KKLC 2XPKA 5EMLA 1M5WA 4GYPC 2XG5B 3EXRA 2X1UA 3W2LA 4OZGA 5KVDH 4JIHA 1V54B 2PETA 1KPRB 1M2VB 4ESKA 2R94A 2W62A 3FTZA 3KRZA 1DR9A 4KXBA 4L3ED 1AKJD 3CWNA 5AKRA 4LESA 1O5DT 2PWEA 2A77H 4HXAH 1OCJA 3MN8A 4KJQC 3KMDA 1EZVY 4F33B 4BA0A 3F2LA 4KPHL 4X63A 1R3YA 1JD9A 4HUUB 2AQOA 3LS5L 3THAA 1S3KH 1DL3A 1MHEB 3ZR4A 4MD0B 3C5QA 4S3FA 1SFJA 1LE9A 3E8UL 2OR9H 3ESPA 5H2BA 3WJMA 1GZHC 4ZMTA 2XC8A 3FMGH 4E36A 2ZT9C 4N6RB 3RAOA 3CDGA 3I6EA 3D18A 1IEBB 3MKCA 5CLXA 1Z9OA 3MV9B 1HGWA 1A7OH 2GVJA 3RX3A 1R34A 3SYQA 5DQ9A 1R7OA 4Y4KC 2GDUA 5LN8A 3W7HA 1OC5A 4W9IC 1FLTX 3WTUA 3IMSA 3IDXH 3RR1A 4UQBA 2EDYA 1CL7I 4EPBC 3RURA 4K1WA 3A5VA 3O2VL 3E2HB 4PJHB 2VFFA 4HJIA 1BZ9A 1VHNA 5IQ9B 3CL8A 4GVIA 1QXLA 3HB3B 5IGXH 1TVNA 3I2CH 4R96A 1U3NA 5SWQA 5FGBC 4FZEH 4JKPH 4XUGA 3Q43A 3P0GB 4G7EA 4LARH 2WZPA 1XGYL 2DWDA 2EDRA 1FZOB 3U6RA 4IFKB 2NT1A 2DQCH 1AG6A 3SB3A 2HQAA 3PANA 1SVBA 2DJLA 2VIRB 3U7WH 1UW9A 3LHUA 5AN7A 4QTGA 2VN5A 1X5FA 3BPCB 5DEGB 4DUWA 4GAGH 3AGWA 4XVUD 4PGCB 2BSSB 4XXWA 5EU6B 4PGBA 3UZJA 2WLHA 3C6LC 2GL5A 2R6OA 3DMMA 2D0GA 3ORWA 1D5XB 3F7VA 3G24A 2PGEA 1UD6A 2DZBA 3NMEA 1E7UA 2F53E 2Z6IA 4YTQA 4WU5A 1XDTT 4QITA 1AD1A 2KZBA 1GGIH 3AFLA 1O5QA 3W87A 2JJUA 3TA3B 1IGYA 4MJMA 3FQRA 2CKBB 5IHSA 3SGDH 1W0VA 5JW4R 2XT1B 4INFA 1EEUA 2OB3A 3BLKA 3O6LH 4Q4KA 1C1EL 2IPWA 5DMIH 4HIIB 1O7VA 3P8IA 4PJ9A 4M93B 4AENA 3QHFL 2QQ6A 4P9HH 4L18A 4H0HB 1KQZA 1C16B 5ESAA 5MEOB 1JNLH 1JK9B 4R7VA 3EYSL 1KM0A 4N87A 1GOKA 3VFLA 3N17A 2QJIA 3FRPA 3G6JB 2EE9A 1E51A 1ENUA 4KQ3L 3SY1A 9RUBA 3AU2A 3F2BA 5KJRH 3T07A 1PO9A 3SDCC 2YO3A 3D6GA 2ADJA 4GUHA 4IYKA 5EEZA 3CUXA 4EVNB 3T6VA 5DJCB 2NQDA 2VCBA 3MXWL 3WFEH 1DQTA 5CMAA 3AYSA 4JDEB 3AXXA 4MRCA 4ZW6A 2YL9A 4U7MA 2DU2A 4O11A 1N67A 1YEEL 5DD3L 1Y07A 4U6YB 2WZ5A 4GW1B 2NY6C 35C8L 2FBJH 4S38A 1QNOA 2GJJA 2K8MA 5FO8A 2JKPA 2BNJA 4FTVA 3M7FB 5CIPB 4WFED 1DN2A 3MTRA 2YEQA 1PE1A 1YEIL 2VFEA 4OB5L 1PKOA 3VA2C 2GQ8A 4NNCA 4BYHA 2Y1HA 1XEUA 3V55A 3IPBA 4ACPA 1BVZA 2NY2D 4XP5L 4W70A 4ZFOL 2DJXA 2V9DA 4XCNB 3QQNA 4F8NA 2EIZB 2CKNA 1OP5K 1YN7A 1U58A 2X6BA 4P4KD 4TRPH 1YKWA 1AH1A 4S3KA 3VB8A 1CCWB 1M68A 5I66B 1TJHH 2JNZA 2ADAA 5K33A 2QGYA 3RR4A 3P8JA 4FFYA 4XTRD 3GB7B 3HOGA 1Y6KR 2EVIA 4IS6B 1QPNA 4YDJB 4HS6A 1QWNA 4MCZB 2XWJA 4M8QB 4C83B 2APBA 4XSLA 2G60L 1JPFA 3EB2A 1FFTB 5AVRB 4XVDA 2YCKX 2ABBA 4R4FL 4H44C 8CGTA 1H0DB 4PLJC 4R7LA 1SVDA 1PS3A 4QCIA 2ZC8A 4XTIA 4RGND 3J8F7 3L7FA 5HDWA 1V8EA 5U7SA 1C5CL 4JFWA 2EF9A 3VC6A 1M7PA 4N0RA 4N9DA 1TV8A 1HVXA 3QY8A 5HVFB 1KT2A 3HBQA 4GJTB 4PRIE 4L3CB 1AVAA 2Q20A 2HISA 1GMEA 4JPIA 4BQ9A 4MXVF 2FGBA 5CZVH 2VC9A 4PVLA 2PWHA 2LT9A 1QATA 4MZRA 5TJWK 4YUEL 4NGHL 3CQQA 3DURB 5KETA 2W5PA 2A9ML 3TIMA 4B5EA 1ADWA 4A2MA 4Q9QH 5JW4N 4O51A 5ICZB 4M7JL 5FOBB 5GGQL 3SDAD 2QPXA 1JNDA 1JTOA 2LR4A 4KXZI 4DQWA 4ZMLA 1IC4L 4K7FA 4RXFA 2V7NB 3C2FA 1F1GA 3UAAA 5KS9A 3RWJA 4LNVA 4PG9B 4GI6A 2JK5A 4QLKA 2AQPA 1Y1UA 1EIBA 4HIJB 5HPMB 3D39A 3W7PA 4PRPD 2HJFA 3BZ4B 3MRDB 4I18A 4J5NA 3ES8A 4Z76B 5EB9A 4E8GA 3DDGA 4O2CA 1ZGLB 1HYSC 4R0LC 3APMA 6CGTA 3FO0L 4TKWA 2RH9A 2VC2L 4PUDA 5LUMA 3FN9A 1ZLWK 2VABA 4NQCB 2Z35A 1U3YA 1N55A 1T8QA 1TPB1 2SFPA 5KBNC 1RFDH 4HGWA 1F6LL 3O0FA 1VS1A 5KSUA 4K5NA 5GJPA 1UUQA 4PBGA 4AGOA 5F2FA 1L5GB 4C6NA 3CZJA 2Y7QB 2DQFB 3AREA 2Z7GA 2GHZA 4MDIA 4DVRL 1GC1L 5SWSE 5L9DH 4S0SD 4YSEA 2FPYA 3VNKA 1P4CA 3IGLA 3H9ZA 3LZFL 3LNFA 1PX4A 2FYYB 3KL3A 3P2BA 4TNFA 2PYEA 2IPFA 3NTCH 1BM3H 1X96A 1O9VA 3T0TA 1CDBA 5C9XA 3OU8A 1SXSA 3C8NA 4MD4A 1GNXA 4XAYA 1F6KA 4Y90A 4UFMA 1R3KB 2EINB 3GEFA 3U30C 1XG3A 1CR9H 2VQTA 4GXUM 1UIPA 3GKWL 4ELME 5M17A 4ZTPL 2YGPA 4QO1A 1L0QA 2YZ8A 4IP4A 3HE6A 3UXKA 3GVRA 3KOZA 3SYAA 3ILQC 4ZFGL 5DMKB 4PEKA 5FD0A 2VDRB 1FAKT 1NUGA 2H1LM 4MXQC 3U2JA 4S2BA 5AOJA 1IARB 3KM8A 3JXAA 3VQLA 4B9CA 3IV3A 2A4AA 2EVGA 4ZUVB 3AWFA 4AVKA 1E67A 5J13B 1OK0A 5I24A 4FZ8H 4ZAKC 1YIXA 3SURA 4JE0A 4F91B 4LNCA 5IRPA 1J0ZA 5DZVA 1XLJA 5BRZD 4B3EA 3EPNA 4RNHA 4HK3J 1WFUA 5JLZA 2YRLA 4G1MA 5FK9A 4ILSA 1NCHA 2VKXA 4EF8A 2HXUA 1S1RA 3NO5A 4LL1A 1JVNA 4X7TA 3RDTC 2QJNA 4PUBL 1A7RL 3VC5A 1P1VA 2OL3B 3MO7A 5CEYB 2A3EA 1HH6A 5KSAA 1F90H 3VGEA 3DK0A 3BCFA 1OGBA 1X7FA 1M7DA 3LS5H 1GOFA 2JQXA 4Z7VF 3FT0A 1P5UC 1NJJA 2MNJB 4OD3L 2A85A 4GQPH 4A67A 5HVHC 3WE6B 4H9UA 5C2CA 1VGKB 1AZZC 1G6RL 4HTYA 5C0DA 1XGZA 4MA7L 3FHQA 4GXVH 3R13A 4OJDH 4LB4A 5IBXC 1T21A 4GZIA 1RJPA 3R43A 3ULUC 3DVFA 3COTA 3NIDF 2OX1A 3MLVL 5L2KB 4QLRA 5BRPA 1G7JA 4AQAA 4KEZA 2Z31A 1QUMA 1TPWA 5C9RA 1FNEA 3II2A 4NRSA 1D7FA 3SDDD 1BM7A 3ZVIA 4YCPA 2J8TA 3TCXA 4NQUA 5DR5H 1LLZA 5DO8A 4U6HA 2JQMA 4PRAB 1WD9A 3OVPA 3WUWB 5IT2L 3LDBC 1XGYH 2OEMA 1AODA 1NF0A 4ONOA 1RMFL 1HTYA 4ADJA 1J9TA 3KPMB 2YZRA 5B1BB 5IMMB 4EANA 4AZCB 2H26B 2G3FA 2WXOA 3RIAF 1J4EA 3KVLA 2DT0A 1LOSA 1GYLA 1R38A 1CCZA 2W9EH 4HETA 1SDYA 3WFCL 4ZMPA 2YCLA 1JGVL 5D1QD 1E4WL 4MYPA 1R3SA 2Q76B 5I1CH 3GSOB 1DV7A 4XZHA 1ZHNB 4RGMC 1K8IA 3T2NL 3WDRA 4NENB 4AV0A 2KQMA 2BC4A 5E5LA 3LA4A 4A55A 4XUYA 4F2TA 1EJSC 4JTEA 3LOWA 3BAEL 4GP4B 4GS7C 4Y4HA 4O17A 1HI6B 4XXCC 4D0CA 5L88H 2A73B 4OAWB 1KLFB 4R8WH 2PP1A 1AS8A 1LE5B 5CPLA 2ICWI 2V2DA 5AG9A 4JZOA 3TVMC 1HC1A 1XWYA 4AU0A 2JI1A 4DWSD 2ATPB 1YEJL 3K4AA 1C1EH 2RGSA 5J57B 4F7TB 4PJGA 3T09A 3KH3A 4AUUA 2AGKA 5FB8A 5E24E 2Y6SC 3WJJC 3I3BA 1UQYA 4RDYA 1XGDA 1ZZMA 3L4TA 3EYSH 1BZDA 4GINA 4N85A 4V2BA 2ZRXA 4L37B 5D4IA 2PUQT 1TDQA 4N2IA 2X7LA 1FV1B 3S5LA 4UB0H 4IQLA 2FL5B 4Y1TA 3O0RH 5DJ6B 2ZOLA 2Q1EA 4Z3JA 1GVQA 2HSAA 1C9DA 2GB2A 1KYOK 1K3ZA 4IKNA 2FTYA 5I8CB 1UATA 2DYPD 3MXWH 3WUGA 1V51A 4ADGA 1HZKA 5LNWA 1T1ZB 3ZGHA 1LM8V 3VWKB 5B22A 3VD1A 3CYVA 5DVOA 4LCQA 3C4UA 3RFZC 4CD8A 1WQ5A 3VE9A 3PJLA 4JPGA 2UY3A 1BSIA 1HQTA 1HJBC 2WYIA 1YEIH 3AHZA 5LKNA 3BVUA 2CITA 4NHVA 4B0MB 4C1NB 2X2YA 4XP5H 2ADIB 1GQLA 1XYZA 2DDXA 3M6YA 1FG2A 3MI2A 4AEFA 4HB7A 4ICXA 3NESA 3IBOA 4G7VL 4YHKL 4IEFA 5ILTL 4M4RA 4K7PY 3QDJA 3R4DA 1EVUA 5M1TA 1DQKA 3OF6D 5DZAA 1GGCH 2EG7A 3DX2A 3V3WA 3NACL 3PWVB 1I1RA 3MW7A 2JKWA 4A2EA 1E8YA 3BGFB 2VLKB 3KL5A 3ZZLA 3DX7B 2PWGA 5LNUA 3L3OC 3G1AA 3VD3A 1F61A 3WD5H 2F8QA 1I8MA 2WMIB 4AIZA 4GO8A 2K70A 3W23A 1YEHL 5DUPL 1IM9A 5H4ZA 2WNGA 1CS6A 3U1SL 3QFWA 3BLPX 1SEQL 2FWOB 3N2BA 2IQAB 4H0IA 4NX5A 1C5CH 4W85A 1RA0A 1VERA 1IBZA 4XO5A 2J62A 3SQLA 4UT6L 2ZXBA 3W9DB 2BXVA 1VJZA 3VKJA 1N0LA 3HB3D 2IXQA 3AS0A 3BP4B 4P57A 3ES6B 5EULV 4CQBA 2ALAA 1SFSA 3GG0A 1CLVA 1ODUA 4ZFZB 3CBKB 4YUEH 4NGHH 2NQZA 3X3FL 1CI1A 1HG3A 2A9MH 1LQAA 3VXSE 3NDZE 3VYOA 4NHCH 4HKBB 3QI9A 3JW7A 1CK0L 5F1UA 5EU6D 4QROA 4N8CL 1IAKA 3DTDA 1FN4B 1KLGB 3NJLA 3HPLB 3QUZB 1OABA 5FYJH 4GLRH 3QK0A 4UFIA 1XRVA 1J11A 4NBXB 1QHZA 4YDKL 3QIWA 1U8PB 3QV6A 2X7VA 4ABUA 1OCOB 1WX0A 3CFUA 3IFOA 1R86A 4XP6L 1UWYA 3QHNA 3SKNA 4IMCA 4UB9A 2XJLA 4R84A 4IUOA 1KLUB 2GUUA 3B8VA 3KLKA 4OZGE 4KO5A 4P46A 2GG1A 4N90E 2Y62A 4MZIA 4QEGA 4KKCD 4TU1A 1IFHL 5EZJA 4HV8A 3TA3D 1W8EA 2FD6L 4AKPA 1RK1B 3MA9H 2AKRA 3KGTA 3SJ3A 4DHGA 3CB8A 1KM6A 4KK9D 3U1QA 3NSNA 4RNRA 5EO1A 5DUBB 4DM2A 4AE0A 2PW2A 4X4XB 4P23D 5I7GA 4ENEC 1O7AA 2EIBA 1KJVB 2ZBTA 2ZF9A 3OXRA 5GSVB 1VCAA 4DVRH 5DJZA 2G5RA 3VNYA 3VFMA 4MZ8A 4JVUA 4PJFA 4F57L 5DEFB 3LZFH 1E6SM 3M43A 2NX3A 2NXZC 2E6DA 2JB5H 5ACZB 3VD2A 4HA3A 3E2SA 5FHBL 3LZOA 4S1FA 5HWJA 4PGDB 4L8SA 4KWUA 2DMBA 1N64L 3NQGA 3BUYA 3V8CA 3C6CA 1DVYA 1YJDL 3O16A 3KJ4B 4TL5A 2YBRA 3GKWH 4ZTPH 2PCYA 1B3IA 3DYOA 4REQA 3MQTA 3M0YA 5F70A 5A43C 3IJYA 2WW8A 4JJHA 4CMHB 1HXMB 4E2OA 3MB9A 4AH2B 1NAMA 4ZFGH 2YXMA 1OK4A 1ZD6A 4DJFA 2BP0B 4DPAX 4M6NL 3UMTA 3QXWA 2X0YA 3S3PA 2LAGB 3GUTB 2PPAA 4QE4A 3NCOA 2CKBL 2P8LB 1BVKA 4XI5D 2DZTA 2O72A 3EZ8A 5FAGA 2DD8L 5DMNA 3TWBA 3GTTA 1WTGT 4GX8A 2J9XA 4CN6A 2YL6A 4S2SB 4UM9B 5JOPE 4PUJA 3KBWA 4AL8C 4Z3GA 4MQ7B 5I82A 3T1FA 1T7YA 4H9YA 1NUNB 5ELIA 4Y2LA 3SUWA 2KKQA 4PB9L 3G3DA 1OC6A 3DBSA 4PJ8D 1CXIA 5AW6B 2B0SL 1Q1JH 4XBGA 4FX6M 4AB4A 5IFJB 2QCEA 3AYVA 1SHXA 4GFSA 1A7RH 4JO2H 4URIA 2A74B 3SE9L 2NY4B 5HHPA 2WXNA 2G4GA 1ZGLP 1QPKA 4JQXC 5IMOB 2YLHA 4DKEH 4HKJB 5TDPA 1I8UA 1RPUA 1M57B 1YNYA 4D6EA 4ODHL 3MLZL 1JEZA 4BHYA 3EJQA 4TNWK 5AL8A 1BJ1J 3DVNB 3THDA 3RZCA 2G2NA 2NQ5A 3IFPA 2ZUNA 5FJOA 3VFPA 2WC7A 4HUXA 4XO6A 4LWWA 3I6GB 1KFAL 2DKSA 2WXRA 3ANUA 3V9CA 3THQA 4LEOB 2P43B 3QWOA 3GIPA 1U8JA 2YD0A 5EN2A 3N3MA 2KLSA 1XINA 5HHME 5ISZA 4UDUA 4PI0A 4FYSA 3ABKB 5BW7C 4EDWL 1BFSA 2BSBA 1PAZA 4EXPX 1PB0A 1I1AD 4UDTA 3RU8L 5D1XC 1ORQA 5EOCH 4XNBA 4M6QA 4HOWA 2NSXA 3DXIA 4KNSA 3NXLA 4OSUL 5A2KH 1N0XL 4YO0B 1ES0B 2Z4GA 2QL1A 5D03A 2AC0A 2ICWA 3PP3H 4IOFD 4PRBA 3CO4A 3PHAA 4BDVA 3HIJA 2X8RA 3MBDA 4KJYB 2ALWA 4Z8FH 5C71A 4FTVE 3BDYL 4JZ5A 3TOYA 4NZRH 1JWUB 3SBFA 4Q4PA 2YPLA 5DQJA 3WFCH 1JGVH 1E4WH 4D0DB 2HPOA 1YNQA 3RAJL 3FSWA 2PDFA 4HQVA 2CO1A 4PCTA 5TTRA 1PW3A 1E9IA 1QTWA 1E2WA 3MJ9A 4ORZC 4BGDA 3ETSA 5F1IA 1LT7A 1W1YA 2HFEB 4WW1A 1TYEB 1ZLSL 4WDIB 1JR1A 3WSUA 2DMCA 3OPZH 1KM2A 3GRWA 3WHXB 4E4FA 4GKZB 4PJDB 4R3UA 1TMHA 4AK1A 4WGXA 4QG6A 1RPXA 2YKLH 4QHUA 1KTKE 2BS71 4UQ3B 3SCMB 1CEOA 3V6OA 2O7SA 1THCA 1YEJH 3O41A 1UKSA 3IIZA 2OMWA 3M0MA 2EIDA 1PZ5B 2P10A 4PTUB 5ACLA 1FL3B 3QUYC 3FF7A 2GVYA 3T0EC 1A5LC 1F9CA 3LHYA 1HHGA 1OWRM 2GCYB 3BZEA 4QXGL 3MLPA 4WV1B 3HG1A 4GCXA 4IKIA 2VZOA 1PZUB 3UWYA 4JCLA 5C9WA 2UX7A 3TNMA 2QTEA 1EJ6A 4M7KH 1FVCB 3G5XB 1AJ7H 4FYRA 4H1ZA 1EHAA 2GUBA 2FKPA 3ZWTA 2X1WL 4AI7A 4H1LA 2ZCHL 1U3HD 4MMZB 3RE0A 1HNFA 2MPAL 2J88A 5ESQA 4LCRA 3GUFA 1VFSA 4C60A 3T7VA 3DETC 2J4WH 3ZTNL 2OOFA 1NEZB 2LU3A 4I5XA 4WIQA 3GS4A 1R2RA 3ELFA 4GACA 1QAPA 3VRIA 1V6TA 4YAQA 5M2FX 4QFUA 5BRBA 4FXGC 4XWOC 5KS9E 3JV6B 2I16A 3KVKA 5F9WB 1T5WB 1A80A 3ROLB 3RU8X 3D39E 4GFIA 4YHKH 3ZSTA 5HY9B 3RNDA 2PLKA 4WK0B 1GW9A 5TK2A 1M6JA 3AAZB 4OIIL 2XN2A 3MRNB 1V0MA 2Q87A 4B3LA 1MW1A 2OO0A 3L5IA 3THML 4OQVA 1EH9A 1Z0NA 2YD2A 3HFMH 3CFDB 3KX6A 1WTLA 1MCOL 3HNSH 1OCQA 1LROA 2Q86A 4HP5A 3K0YA 2AMGA 2F61A 4U1JB 5DCDA 3LV3A 1MCCA 4FXKC 3QQ4B 2H3NB 3NL6A 3CUPB 1T7WA 2C8NA 1XIJA 2CKRA 1XXFC 5DUPH 3WDHA 5JYLA 5LG1A 1HF6A 1WXZA 2NY5H 2VDRL 5L2KD 4CQ9A 4M5YL 4KV5F 3MOAL 4LKCB 1BFOB 4W4OC 1XS2A 4X6FA 2CLPA 1A53A 4WUUA 2PYEE 5D9OA 4K9EL 3HFYA 4P5TB 5GJMA 5I3HA 3AC0A 4UT6H 2O5YL 1CFNB 1MFVA 3ZE0F 1OPGL 1B4RA 1RSFA 3T71A 1SOSA 2O5ZL 3VD0A 3SBWA 4FQIL 2BSRA 3QFJB 5DS8A 2KPWA 3DU0A 4WFFD 1J1PL 2Q7YB 3VXUB 2WMPB 3EOYG 1BQGA 3TSMA 1T20A 2BNUA 1P6FA 3EPMA 3U9PL 1EMTL 3CIQA 3X3FH 3RIFF 3KWWB 4XPHH 4LTSA 1TKWA 3PABA 2XKNA 3WBWA 4PJXF 4NI8A 4A22A 4AEEA 1WFTA 4NYLA 3BURA 4IKKA 4ZMYA 3VCLB 1HHJA 5IB3B 4N8CH 5LDUA 5DYOB 3HG2A 3M8OH 2JKXA 4AAJA 1P7KB 2V2XA 4YSDA 4AV5A 4O4WA 4E5TA 4Q22A 1S7UB 4Q8QA 4AIXA 4A1RA 3RU6A 4JEGB 3P3SA 1ZTVA 4LU0A 1Z6JT 4JFSA 4PLOB 4Z7WB 2YL5A 5AKQA 2ZZ2A 5CJBA 1TJXA 4OCXL 4TPRL 2Z93B 4KQ4H 4ZMQA 4IUGA 1SYSA 3UZVB 2FD6H 3NG5A 2X4OA 4UZGA 5I6MA 3GK8H 3P60A 1GZPB 3ARGC 1S3RA 4O5LL 1D8WA 1RKRA 5C9JA 1LUCB 3GSXB 1XLEA 3O3BB 1VACB 4Y9AA 4Y7EA 4QRQA 1P0EA 3GDBA 1VFUA 4U28A 2PLMA 3VIHA 2PP8A 4MA1B 1F6YA 1X98A 3ASWA 3T2PA 3VGFA 1FHNA 2AV1A 4HC1A 1J86A 3BEWA 4IBTA 4DEPB 1XZWA 5IHUH 5FHBH 4K2UH 3HC4H 1QEXA 2GJPA 3PBVA 4X8JB 4FQ1H 2WZAA 1N64H 4N68A 1WF5A 4KQNA 4DZIA 2WVTA 2OQYA 4Z7OF 2XFWA 4ANWA 4JCWA 1ILUA 4ZW3A 1JPKA 1JD7A 4HMNA 4DP9X 2UVFA 4W6XB 2Y89A 1CF8L 4DIXA 3KBMA 5DRWA 3IDIB 1D5RA 2F1EA 1B4TA 3VVWA 5JPMB 3B2PA 1PLGL 5FUCC 1U1UA 1IHIA 4TOQA 4LASL 1I9IH 4GQQA 4Y8EA 4O53A 4NZ3A 4GB9A 3PSWA 1HHHA 4HLZH 5DJXA 3CFCL 4GSRA 3NCCB 3O3UN 5IF0A 1BXAA 3RVVD 4BWLA 1V7MH 4TSBH 4PI2A 5CPOA 4ELKB 3PGFL 4PIRF 3TGXA 3G6DL 1UM4L 4J7RA 1W9XA 3T4WA 5HGDB 4OF5A 4AEIL 2AV7A 4F0MA 3D4GA 2N4IA 3F6LA 3NPSC 4QJ4B 4X9FA 2MCPH 3LQZA 3ARBC 5IR1B 5IJDC 4DZBB 4NKCA 1QYGL 2VLKD 5IK3B 4BUGA 1NBZB 3PXJA 1RU9L 4N8VG 1FFRA 2PC4A 3C5ZA 3DFHA 1P53A 2JELL 1FRGH 4QQUA 1KCUH 2XTJB 5EMKA 4CKQA 4YOKA 3IE4A 5CBAB 1T1WA 2YDSA 1SLXA 2PDNA 1BPLB 1AO7A 3WOVA 4HCRA 3NIFE 2BXYA 2A4CA 2DI7A 3PWLB 3LM3A 2OKTA 2WLJA 5CGMA 3WLTA 5GS3A 3ZKMC 4XZNX 4F9PC 5T1DH 4JPKL 1SO3A 3IXAA 3URNA 2BCKB 4B9FA 2HE8A 4ZB5A 4ZGYA 2LFGA 4PJGE 5HHOB 4Z7QF 1HQRA 1ZBVA 5IMKB 1YG9A 3EGDA 5KBMA 3FTXA 3TW9A 2NTSP 2NSMA 1ONQB 5C0ND 1IGTB 1GTEA 3MVIA 4GH7B 3BJFA 4EDWH 4MY9A 2RBLA 5KVMC 1A6UL 1FNFA 4AFYA 4GW5A 2EXWD 1ZS2A 2F74B 2YDAA 3H9YA 4TX6A 1OSPH 2SEBA 3NGBB 4HPOL 3FTSA 4KTEL 3WUZA 1VADA 3N2OA 4DOHE 1E28B 4ODTH 2VDOH 3CMJA 2J24A 2JQAA 3EYUH 3QUZD 4MM1A 3CS2A 2Q3ZA 4JHWL 3QEHB 2GFTA 3O3DA 1PKQB 4MJIB 2OK0L 4CA4A 4Y16D 4JQAA 4FSAA 3G04B 5FO7A 5DMGC 4G59C 4FQCL 3BDYH 2VQ1B 3HR5B 3TCSA 3PAUA 1RV6X 1UB5A 2XWZA 1AZ2A 3JBG7 1ONXA 2OP4L 4PJIA 4U2YA 4PJCB 4P5MA 1NP2A 3NGJA 2FHFA 5KSVA 2BW5A 5DSCB 4NQEA 4XK2A 1G9MH 1RQHA 1G5GA 2C3WA 3POHA 5I26A 1ZK9A 1GVIA 3E38A 3VKDA 3GIVA 3PG2A 1CO1A 1M03A 1W5PA 2OR8A 4NQDA 5GS0C 1GQNA 3QDJE 3OIXA 1S7WB 5EUOB 3ZDWA 4ZX6A 1FVEA 2DH3A 1R9FA 3QUXB 2IH1A 3HZKA 1H09A 4X2UA 5B38B 1YNTF 2NYZA 4ZT1A 2XG4A 4XT1C 4S2CA 2OVLA 3ZDXB 1YE4A 4RMUA 5GNYA 3Q05A 1NIEA 3VH8B 4U1NB 2HRPL 1JCJA 3CB3A 2WNZA 1R3JA 1K4CA 5KZEA 1YEYA 4HT1L 2ZX7A 5AKTA 1GA2A 4QXGH 4RH4A 4O2FB 2W0FB 1DQIA 5TD4A 3GMOB 4Y0GA 4OF7A 2WZ0A 5J3HC 4JTAA 4YTUA 5KYXA 4WSHA 1BD0A 1MQKL 4W8BA 4NF7A 1OYBA 3L4XA 4BUHA 4LSBA 1ACZA 3FQTA 4QHMB 4U1IA 3BICA 4M7ZC 1Y65A 4GAJL 1KIQB 2ZCHH 4C6OA 4WUKH 2ATAA 4HU4A 4YHML 4K94L 3VILA 4LCWD 4MASA 4YH6A 3X1BA 5CLWA 4PJEB 3NSXA 1LL4A 1U30A 4K23L 5I2IB 4A7GA 4NN7C 5DN1A 4GABA 1FO0L 4H6EA 4HH9B 4AZUA 2BB0A 4A3RA 4KGJA 4EDXA 4BZ2A 1V7NL 3WLBA 1KO0A 1U8OA 4Y4FC 4HNUA 4Q4RA 1LRQA 4W5UA 4HFWA 1E2ZA 1A7QL 3EOUA 3EXSA 1RBAA 4UFLA 3LGGA 2J4GA 4N2MA 4E41B 5BQ7B 1BXNA 4L23A 3NSCA 4EO5A 4WTZG 2HVKA 1ZT7A 1U1JA 2GSEA 1XGUB 3TIEB 1BIHA 4I2XB 2FGWH 4AUYA 1PFOA 5LGXA 3UZZA 1Z7JA 2AJZB 2ENYA 5ENWB 1TLMA 3M46A 3OGRA 3THMH 5FEZA 1MXDA 5I71B 2CLMA 1HL8A 1B6UA 1NBVL 1MCOH 5IV2B 5LIYX 2UY6B 3R6IA 1L9RA 2XN9A 1GR7A 3DJ9A 5DWUH 3QZWA 4AYBA 3P3UA 3ZRSA 2PDKA 4H8WC 2AQSA 4L8BA 4G80B 3WQWA 2R7EB 1EGJA 4M5YH 2XGZA 3MOAH 3CFIC 2FSEB 4PJFE 1MDLA 4GUFA 2PYFA 3B5HA 5EFDA 2FX8L 1YUHA 3PBGA 3ZDZB 5J5RA 2Q6WA 3DX3A 3AXKA 3UJFA 4CVZA 2XVGA 3C56A 2YCIX 1QZNA 1OGGA 3S1WA 2H2SD 2O5ZH 2GYIA 5E8PB 3Q8CA 3GSWB 2E0PA 1JGUL 4GJIA 4FR6A 2OT1A 5CCKL 4R97C 2NUPB 3W5NA 4LPVA 3QMRA 4ODWA 4PWKA 1EMTH 3GSUA 1EAQA 5IDIA 1G7HB 1AD9B 4MKSA 4TTGA 3D3VA 2YXGA 1B4LA 2H8XA 4KKXA 3WJLC 5ALCL 3MSGA 3CPLB 1ADQA 3OKEB 1PL9A 5CCHE 4EIUA 4PTXA 2E7HA 5MP6H 3BUDA 1Q9KB 2GFBB 1MRFH 1RVGA 2C9PA 2HJKA 1CENA 3QJQB 4XWUA 1ZGDA 4NAFA 4DK6A 3X1EA 2J9YA 4B4HA 4JRXA 1WCGA 3RCYA 1MVFA 4PL2A 2R1LA 1HEZA 1HILB 2GWGA 3NQIA 3BT0A 3AXLB 3PZQA 2WUCH 1RJYB 1UGNA 1R5VA 3HZ3A 3QIBA 2J25A 3EMZA 5AC7A 4KVNH 3PPFA 3SCMD 3HNTH 2INFA 5IW1B 3GRBA 3FA5A 4QCFA 2AK4B 4TX9A 3U7YH 4U0RB 4C6CA 4O5LH 4GIEA 2J1WA 3V7MA 4PJBB 4M6VA 2XA8H 5CLTA 1HOCB 2IFFH 5LN4A 5B21A 3WIFB 2E25A 4FKEA 2EJAA 1UH2A 4ZUTA 1WYIA 4FLHA 4EUPG 3VE0A 5E08L 1OX5A 5D7LA 3ZTCC 4JVWA 1NPUA 2HRLA 1OHLA 2QSQA 1TXKA 3TN5A 1K5NA 3LPGA 1FL6A 1RZGA 3U2SB 4RDVA 1B3WA 1DLFL 2F54B 5IESL 2WIIB 4XZBA 1IM3A 1E2VA 2CD0A 3FB7B 5JW4M 1TVHB 5BU9A 1BZQK 5D96C 3VD4A 2E28A 4KX9A </