1WZAA

Crystal structure of alpha-amylase from h.orenii
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
488
structure length
488
Chain Sequence
FEKHGTYYEIFVRSFYDSDGDGIGDLKGIIEKLDYLNDGDPETIADLGVNGIWLMPIFKSPSYHGYDVTDYYKINPDYGTLEDFHKLVEAAHQRGIKVIIDLPINHTSERHPWFLKASRDKNSEYRDYYVWAGPDTDTKETKLDGGRVWHYSPTGMYYGYFWSGMPDLNYNNPEVQEKVIGIAKYWLKQGVDGFRLDGAMHIFPPAQYDKNFTWWEKFRQEIEEVKPVYLVGEVWDISETVAPYFKYGFDSTFNFKLAEAVIATAKAGFPFGFNKKAKHIYGVYDREVGFGNYIDAPFLTNHDQNRILDQLGQDRNKARVAASIYLTLPGNPFIYYGEEIGMRGQGPHEVIREPFQWYNGSGEGETYWEPAMYNDGFTSVEQEEKNLDSLLNHYRRLIHFRNENPVFYTGKIEIINGGLNVVAFRRYNDKRDLYVYHNLVNRPVKIKVASGNWTLLFNSGDKEITPVEDNNKLMYTIPAYTTIVLEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of AmyA lacks acidic surface and provide insights into protein stability at poly-extreme condition.
pubmed doi rcsb
source organism Halothermothrix orenii
molecule tags Hydrolase
molecule keywords alpha-amylase A
total genus 170
structure length 488
sequence length 488
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2005-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1wzaA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1wzaA01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 1wzaA02
4P7QA 1EO7A 1W2PA 1H0GA 4UR9A 1IZKA 1J0JA 1ISVA 1EQCA 3SURA 5TD4A 1E15A 5AYBA 4Z2HA 3T2OA 4CD6A 1UHVA 2VL4A 3UEQA 1CWYA 5JUVA 4PBGA 2XVKA 4XX6A 5AYIA 4W7WA 3PN8A 2BXYA 5I3DA 3OZPA 1E6ZA 3CUHA 1V3LA 4W5UA 1PX3A 5GPRA 2ZXBA 3W37A 4ZENA 2E9BA 3L4YA 2WB5A 3LPGA 3MKKA 2WC7A 4XB3A 2WMHA 4HA4A 1UR4A 2YOCA 3WQ5A 1BHGA 4GXPA 3VX1A 4CCCA 2ZX5A 4F79A 3SEPA 3VNYA 3CZ8A 4HPGA 4BQ3A 1CBGA 1GORA 3D4ZA 3BUPA 1QHZA 1VENA 3WN6A 4JAWA 4WJXA 3RO8A 3SUSA 3PTMA 1P6WA 4DO6A 2VCBA 3PZ9A 2CHNA 3VUPA 3QGVA 5I6SA 1V6UA 4HMCA 1TVPA 2F1AA 4U3AA 1E1FA 1BFNA 3GXMA 1TUXA 2ALWA 1KQZA 1G1YA 4PSPA 2QV4A 1W3KA 3GH7A 1CXFA 4QLKA 3K8LA 2BVDA 1JFXA 4D72A 4J7RA 1KCLA 1GVYA 2J7FA 4HPHA 1OSEA 3BLKA 1V02E 2XJ7A 3WQWA 3AROA 3FN9A 1UR2A 4P7LA 2OSXA 5E6ZA 2NSXA 1WZKA 1VJZA 2JEPA 2WLYA 2F2HA 1V3IA 5M5DA 3D3AA 1W1TA 4V28A 2Y2WA 3LXAA 5ABHA 2CERA 1LWHA 3HG4A 3A3HA 3GXDA 1UR9A 4DM2A 5C70A 5A6AA 4QLJA 1KCKA 1QOXA 3PZQA 3T08A 1XYZA 5IHRA 4TVCA 3VD5A 1R47A 5A2AA 1SMAA 2WAGA 1JAEA 3U5YA 3NCOA 2YJQA 2DGAA 5A6BD 3A4WA 3WELA 3VIKA 1HKIA 4H41A 5C71A 2JIWA 4Q22A 1DWGM 3A6OA 3OBAA 4FNUA 3CUJA 1IT0A 2PI6A 3T2QA 3WEOA 4ATLA 1BVNP 3KLLA 1WKYA 2ZIDA 2UWFA 4MNLA 1EHNA 4MNMA 5A6JA 4M81A 3ARYA 1UR1A 5EBAA 4A3YA 1B2YA 3AMGA 2O9OA 4JHZA 3WNOA 3L4ZA 3T2PA 1GW1A 3T0AA 3EDJA 2DSZA 3DC0A 2DH3A 3ARQA 2VR5A 3WDRA 3B9DA 5CPSA 1DWFM 7CGTA 3WY3A 1W3LA 1BYAA 5JIPA 1B31A 1LL4A 1LQ0A 2V3GA 4TOQA 3F5KA 3CZLA 1NWSA 5BROA 2CCRA 3WF0A 2J47A 1UZ1A 1C91A 3GXIA 1HL9A 2PBOA 5CLTA 1XRVA 4OIFA 3L4TA 3AHTA 7A3HA 1R33A 4LGXA 2QPSA 1AVAA 4UZUA 1JZ7A 3A22A 1J0YA 8CGTA 1WDRA 3PZNA 1C3FA 4FNQA 1M03A 1BLIA 1JD9A 3A24A 5CXPA 1KXVA 3WMBA 1Q6FA 4XZBA 3W6LA 2YKKA 2DPEA 4BF7A 3ZT5A 4GI8A 1BF2A 4U31A 1HVXA 4CU7A 5JBDA 3H53A 2WHLA 4NI3A 1US3A 3KL3A 3S5ZA 5LA0A 3PTQA 3AS3A 1V08A 4D6GA 1O7DC 5BXRA 1FA2A 4J3SA 3VMNA 4CKQA 1V3HA 3A21A 1L8NA 1GNXA 2ZXAA 3WF4A 2X1IA 3GXPA 2CBJA 2Z1SA 2ZUTA 2BHYA 2WMGA 1OT2A 1BSIA 1NWUA 3IGUA 4Y7EA 3WD3A 2E3ZA 2E9LA 3WEZA 3PZIA 2W67A 3RM9A 5A2BA 1HKKA 4XUYA 3WY4A 2IUZA 1FFRA 2DDXA 2VZOA 4M80A 4X9YA 3FY1A 4KRTA 2BY1A 4CD5A 2WBGA 1AMYA 2G41A 4ZFMA 3BUIA 4OZOA 4Z2JA 3WH8A 1XSJA 3IAQA 2F18A 4U2YA 5A2CA 2EABA 2F7OA 1X6LA 1XH0A 1J10A 3TOPA 2WWDA 1JDCA 1GQLA 5I77A 3RMEA 1DWJM 1GQKA 3W29A 1OCQA 2D3NA 4P7OA 3T0DA 3CHEA 1JF5A 3AIEA 1HN1A 3GXNA 3CHCA 3DYMA 2VZUA 4AZCB 2GDVA 1G9HA 2CBUA 3W25A 3TA9A 5ABFB 2WM0A 3BAYA 4F8XA 3K4DA 3BH4A 2E4TA 3W24A 4OKDA 4UCFA 1MW3A 1GHSA 3BLPX 5DT5A 2A3HA 3WD2A 1B3WA 1EQPA 1I1WA 4W5ZA 3VKKA 1OD8A 2IGTA 3OB8A 1QNRA 1XH1A 4GQQA 4B9ZA 3WBAA 3OZOA 1K9DA 2XN2A 4PMXA 4UFHA 1ITXA 4QCEA 1PJ9A 1WDSA 1MW2A 4IISA 3IJ8A 4F9DA 2YFNA 1HVQA 1SMDA 2GDUA 4MPKA 4CN1A 4FNPA 2OWWA 5M3WA 3OGRA 3ZMRA 2XN1A 1JZ5A 3TP4A 1FH9A 2QF8A 5FL1A 4UQBA 1MXGA 1ISZA 3CMGA 1VF8A 2OWXA 2DT2A 2WW5A 1PX8A 3L4UA 4WF7A 3NSMA 3GXFA 2BS9A 3RILA 5HDRA 4J3XA 4RE3A 3TTSA 1JNDA 1VEOA 2VMFA 1CGTA 1BYBA 1QI0A 1FHLA 2VRQA 3HG3A 1SR0A 2WSPA 4W89A 1MVYA 1QWNA 3ALFA 4FF5A 4DO4A 1F4HA 2GFTA 2PWHA 4DO5A 5DFAA 2AMGA 1PZ2A 4E8DA 4FNRA 1XD1A 5A95A 1VFOA 3IJ7A 4PSRA 4MADA 3CZGA 1MFVA 3W6MA 2EO7A 3WDIA 1GJWA 3EDDA 3ALGA 3OLIA 2OLHA 1V02A 4W86A 2VZVA 4WSKA 3VMPA 2XSBA 4AD0A 1E6SM 1IZJA 3WY2A 2VCCA 2JF6A 3IJ9A 3BAJA 1OINA 1R34A 3M6DA 1WZLA 4UFMA 4KGLA 2VNCA 3GNPA 3AIVA 3I3DA 5CSUA 3VDAA 1NWRA 1Q4NX 1W9BM 2OYLA 1N82A 4DUWA 4D6FA 3VIHA 2YBUA 1OBAA 4URIA 4W8BA 3NJ3A 4DWSD 4OUEA 1K9EA 1W1VA 1LG1A 1WZAA 3D5HA 2RGMA 1QBAA 3AOFA 1KBKA 3SCPA 1BAGA 3VD4A 1XSIA 1FOBA 2V3EA 3A4AA 3OLGA 2DSKA 3PHAA 2YIHA 5I2UA 4LYQA 4HTYA 2XIIA 1V3MA 1OIMA 2O9TA 4JFSA 2J78A 3AIRA 4RL3A 4NSBA 1ZL1A 4LXFA 1UR8A 3VDHA 3KLKA 2XWEA 2X2YA 3ARSA 1RP8A 4YHEA 2BY2A 3WL0A 4UZSA 4A4AA 3GNRA 3H55A 1CECA 3DX3A 2WSKA 4YPJA 4B15A 1RPKA 1WB0A 3ZQ9A 1CXHA 3I3BA 5D9MA 1JDAA 1QW8A 4WKFA 3AXIA 4QCFA 3LPOA 1C7SA 2ZXQA 1Q6EA 3D50A 1T0OA 3ARUA 4CCEA 3A4XA 2WHKA 1SFSA 3WUGA 3FAWA 4WKHA 1OT1A 1UWUA 8A3HA 3II1A 3N18A 1E70M 4L4PA 5HNNA 2WMJA 3F4VA 3JUGA 3AHXA 1E6XM 3AXHA 2NT1A 2UY4A 1O7AA 3G6MA 5D8ZA 2MANA 4AZ7A 4FLSA 4AWEA 5GNXA 3AJ7A 1V03A 3AYRA 4DWSA 1ZBKA 3U5UA 1F4AA 1EA9C 2BVYA 1EOMA 2F7QA 1HJVA 3VIGA 3EYPA 3SUWA 5A6BA 4JKMA 5D9OA 5A94A 3EMZA 4JIEA 2WZEA 5JBFA 4W84A 4W87A 3VM5A 4PMUA 4UNIA 4AEFA 3HMCA 3PZOA 1E4MM 4C7GA 1EXPA 3PZVA 1CTNA 2YBTA 3BXWA 3VGGA 2XVPA 1E9LA 2GUYA 1QI4A 2CIPA 3IK2A 4PYSA 2X8RA 4M82A 3BAXA 5FOOA 3BAKA 3ECQA 2J77A 3N15A 3POHA 2ZUSA 1GQIA 3VGBA 1AQHA 4WK9A 2CKSA 2FDMA 1H49A 4BA0A 3DX0A 3WF1A 1LLOA 1E0WA 4DUXA 5BCAA 5IFTA 4HMEA 3LMYA 2PWDA 3KL0A 5A8NA 1Z32X 2ZWYA 5I79A 1WP6A 2CITA 1W3HA 2Y8KA 1PBGA 2VJXA 1ITCA 3CUIA 4OOZA 2VI0A 3WSUA 3QHMA 4H04A 1RH9A 2WKGA 3SCTA 2CESA 4GZEA 2J75A 3DX2A 2Y24A 2XN0A 4AYSA 1UH2A 1UWQA 1ODZA 3N04A 2W63A 3D52A 4W7VA 1V0NA 1H2JA 2D3LA 3L2LA 4U33A 3HZ3A 3GH5A 4CD8A 4MB1A 4E2OA 4GI6A 4XZWA 3KWXA 4HU8A 2G3JA 1JDDA 4U5IA 2J79A 3M46A 2BHUA 2EQDA 4AIUA 1UOKA 5HXMA 3WMCA 3RPMA 1NOFA 1I1XA 3OIHA 3N11A 3WDQA 2W66A 2BVTA 2G4FA 3LXCA 3ZSTA 2V5CA 4B3LA 3OGSA 5FCZA 2JFEX 3SCNA 3AIWA 3W4RA 3RJYA 3SIMA 3LPPA 4DUVA 2WMFA 3MUAA 4JCLA 1R85A 3MUIA 3WH7A 3DYOA 4Z2LA 2D22A 1B3YA 1CGYA 4E4PA 4ACYA 3TV8A 1RP9A 3GNOA 2OW7A 4GZIA 4MNKA 5BWFA 4GINA 1V0MA 4H8UA 1Y7VA 2BHZA 4K68A 3POCA 3L4XA 4CU8A 1B9ZA 4MTVA 1BVZA 1WNOA 2W91A 5KEZA 2A3BA 3AZRA 3I3EA 2TAAA 2CBIA 3FAXA 1D3CA 1VFUA 1PIGA 3VX0A 1QI2A 3BC9A 1VAHA 4ZE5A 4PMVA 2GJXA 3OLDA 3AHYA 5CPTA 3KEHA 1SZNA 1KGWA 2AOSA 5CPQA 1C7TA 5E1QA 2E8YA 5DMYA 2X05A 3ZJKA 1KXQA 4R27A 2VX6A 1PAMA 3EJPA 3CLWA 4YN5A 1KTCA 4P8UA 2ZICA 1CLVA 4RE2A 3UERA 3AI0A 3T09A 1JXKA 5A1AA 4BCEA 4Z2KA 3A5VA 2DSUA 2NW0A 3WEMA 2WCAA 3AHZA 3WUBA 1US2A 3UESA 5DF0A 1E6PA 2X0YA 3WNLA 1OB0A 3VO0A 1E0VA 3FNDA 5IHSA 3HU7A 3VGDA 1JIBA 3WY1A 4CU6A 2WANA 1GOWA 2WLZA 2O92A 4UFJA 2UY3A 1JYVA 1E71M 1QBBA 1JAKA 2VZTA 2WMKA 2DSVA 3WDPP 1EHAA 1BYCA 4UQEA 2OWCA 1BYDA 3THCA 4Q7NA 1NARA 1PS3A 1UA3A 1UD4A 3VD9A 5EFFA 4HU0A 3RIKA 1C90A 4MDOA 1J18A 2UY2A 3MSGA 2X0HA 2FGZA 3PZUA 1GOQA 2VR4A 3ARRA 1M53A 2JE8A 1E3ZA 1UWIA 4N0RA 1C8YA 4TTGA 1UG6A 1JNEA 1UH4A 3CZKA 4IM4A 1DEDA 5ABFA 5HBFA 1XCWA 3MMWA 4J3TA 1NP0A 3W82A 4UTFA 1CDGA 2ZX6A 4JKKA 3K4AA 2WVVA 3WD0A 3BVWA 2EACA 4FNSA 2FE0A 2ZWZA 3SUVA 1B3XA 3NSXA 2G3IA 1DHKA 3BVVA 5IDIA 4EK7A 4JFVA 1QVBA 2WBKA 1HJQA 2FH6A 2J7GA 3SCSA 1E72M 4ZXOA 1J0ZA 4IPNB 4HZ6A 1FHDA 4AEEA 1V3JA 3LX9A 1DWHM 1KXHA 2WC3A 3DX1A 5LYRA 3W28A 3ARTA 4X0NA 1EDQA 1LWJA 4UOQA 4ATDA 3DDFA 4AZCA 2WVTA 3O2LA 2J74A 4M24A 3CPUA 4FLOA 4W93A 2GJXB 3NUKA 1TZ7A 3WH6A 2EPNA 4MAVA 2CYGA 4M29A 1GONA 4EANA 5AY7A 1AQMA 3VGHA 3ARXA 3ZO9A 1OGBA 4P8VA 1H0IA 4HOZA 4H8VA 1EIBA 2J25A 3AS0A 5LA2A 3KL5A 1KWGA 2ZX9A 1KGUA 4D6DA 4PMNA 4C7FA 3SCWA 2CEQA 3AYSA 2YDRA 1PZ3A 3HG5A 1UWTA 4C7DA 1I75A 3ZT7A 1QX1A 1CXKA 4PCSA 1WCGA 5CGMA 3S6TA 4AZIA 2JALA 1R8LA 1HL8A 1BTCA 2HVMA 3K8MA 3HJEA 3FW6A 1HIZA 4ACZA 2VURA 2D20A 1E6RA 1MW1A 1QI5A 3DYPA 4A3HA 1UD6A 5CZKA 4CN4A 2CXGA 3RJXA 5ABGA 3WL1A 4MDPA 5D8WA 2PBGA 5A6KA 1TQVA 3BUQA 2VQTA 1J12A 4OGZA 4MB4A 5M03A 4CN6A 1BG4A 5AC4A 3B9EA 3WQVA 1MW0A 3BAIA 1Q6GA 4AY1A 1JZ3A 3AHVA 4WKAA 4FMVA 1NOWA 2XVGA 4F66A 4KMQA 1VRXA 6CGTA 4FNTA 4LYPA 2FHCA 1ZJBA 2C8NA 3VGEA 4PEEA 4LPCA 4PTWA 3WF2A 2YL5A 1VFMA 1TA3A 1HXKA 4FLQA 1VBUA 4AZHA 1R7AA 5E9AA 1HT6A 3SCVA 3VIPA 3VDCA 4J3UA 3K46A 3EMQA 2ZUUA 4JHOA 1E55A 4V27A 2PWGA 1H1NA 2J8GA 4BS0A 1JZ2A 3WMSA 2GJPA 1UUQA 4HZ8A 2XFRA 3GBEA 2VX7A 1CNVA 3AIUA 1E56A 3APGA 1BPLB 4ATWA 1TG7A 1JYXA 2YA2A 3BLBA 2YLAA 1PX4A 4J28A 4PMZA 4J27A 1TQTA 1GOMA 2XTKA 4UQDA 3VSVA 1OWQA 1TCMA 5IXEA 1CXLA 1UYQA 4JFUA 3HN3A 1G5AA 3LRMA 4CD4A 2BNJA 4NZJA 4QFUA 1KQYA 3T0BA 3UR7A 2YA0A 1R75A 1ZJAA 3QHNA 2XWDA 3VSTA 4AD1A 4NZCA 5D9PA 4L4OA 4FLRA 5CQ1A 3WDJA 1NWTA 2Y4SA 3NDYA 3BMWA 4X0VA 5A6MA 1C92A 1XC6A 4UFKA 4D6CA 1OD0A 3AMKA 1JZ8A 2XFFA 2GK1B 3OLEA 5AC5A 1UQZA 2W5FA 3VOCA 2F8QA 1TVNA 3OG2A 2ZOXA 1ZBVA 2DT1A 4YHGA 3F5JA 5BRPA 5BXPA 3NSNA 4JZ5A 4BQ5A 1CIUA 1V3KA 3BGAA 3RCNA 1TR1A 1LF1A 1YHTA 3FXYA 3E1F1 1CPUA 2PWEA 4AZBA 3ZJ6A 4D1IA 1JI2A 3W26A 4TTUA 1E5NA 1C8XA 4M8UA 2OYKA 4LX4A 3U57A 4CUCA 1XYFA 3EDFA 3WENA 4OJYA 1OGSA 3KZSA 3ZT6A 4H2CA 2IXUA 1QHPA 4GO8A 3AIQA 1ZBCA 2VX4A 1VIWA 1CXIA 1LL7A 1H11A 2B31A 2J7CA 3PZGA 1U33A 3VIJA 5D9NA 1UASA 3VIFA 5GNYA 1V0LA 2XPKA 1ZU8A 4H8HA 4PMOA 3MS8A 3MV11 1E5JA 1KFWA 1LL6A 1L0PA 3ZR5A 1G94A 4NRRA 4PMDA 4OBSA 1NP2A 4PMYA 2OW6A 1W32A 5BRQA 4AZGA 5I24A 1BGGA 3FHQA 1VB9A 3RM4A 1KGXA 5EFDA 1XSKA 2VT0A 1HXJA 1NOUA 3MI6A 4JL1A 1C8QA 1W2VA 1H09A 3EJSA 2VVNA 1JZ4A 4UOZA 5ABEA 2FYVA 1WO2A 3SCOA 2F1BA 2BV9A 2WC4A 4KGJA 1R46A 1R87A 4CD7A 3DHPA 2PC8A 4BQ4A 3S5YA 2WVVB 3J7HA 4D6EA 2EADA 4MJ4A 3ARPA 1BQCA 1KR0A 2Q8XA 4HA1A 5GNZA 2WYSA 2VCAA 1XV8A 4QLLA 1WDPA 4RE4A 5EMYA 4JCMA 3WFLA 2VRJA 1C93A 1W9DM 5I23A 1ZS2A 3AMLA 1QHOA 1GHRA 4Z2IA 4D6IA 2YL9A 4D71A 2GVYA 1Q6DA 1E43A 1MXDA 1KWKA 1GPFA 4AMCA 2D73A 3NDZA 1E73M 1W3JA 3WUEA 1GVIA 4LQ1A 2G3NA 1K9FA 3M07A 1U30A 3BUDA 1HJSA 4GO9A 2E0PA 1VEPA 2VO5A 1ZB5A 2WZIA 3U7VA 3TONA 1CXEA 1J0HA 1VJSA 4ZXLA 2X09A 4B16A 2G3MA 1KTBA 3MMUA 4B9YA 1UKPA 3AS1A 4UOJA 1WPCA 1HKMA 3W27A 2WMIA 1W9XA 2BY0A 3VIIA 4PUDA 3PBGA 4AMWA 3AMCA 1A3HA 3RDKA 4UQAA 5CGTA 3CHDA 1B1YA 3NIYA 2DIJA 2CETA 2PB1A 1QNSA 4QDMA 4AC1X 3TTOA 1HP4A 1NH6A 4U2ZA 2ZX8A 2D0HA 3WF3A 5DT7A 1E40A 3GTNA 4AISA 4D1JA 1B30A 1HP5A 3N12A 1X1NA 2IXVA 1H5VA 3WH5A 1CGWA 3SUUA 4PRWA 5C8BB 3VTRA 4QP0A 3N17A 2E8ZA 1W1PA 4UFIA 1TQUA 1E6NA 3VILA 1K9TA 3AXXA 1QW9A 3L4WA 4AD3A 1HKJA 4WSJA 1MYRA 3EDEA 4S3KA 1D2KA 1XH2A 1FP9A 1ZBWA 5E0CA 1V0KA 3AFBA 4EKJA 1W91A 4KRUA 2PF0A 2YA1A 4PTVA 4GQRA 4NZFA 1EDGA 3DECA 2WHMA 5FD0A 4JFWA 1CEOA 5KZ6A 3VVGA 3D4YA 3LPFA 1EDTA 4W7UA 1KBBA 2QHAA 3SUTA 2XHYA 1B0IA 2GK1A 2W62A 3U7BA 3EDKA 3LRKA 2DSWA 1JG9A 2J7BA 2J4GA 2YDQA 1UD3A 2VC9A 2F7RA 4CGTA 3IAPA 2ZUMA 1DWIM 5M17A 3WNNA 2XSAA 1H3GA 3WQ4A 3BVTA 3ZSSA 4PMRA 1DP0A 1KXTA 3MANA 1XD0A 3DHUA 5I0DA 1Q6CA 2WZHA 5CG0A 1E1EA 3WUFA 2ZX7A 1UWSA 2E9MA 4W85A 1W1YA 3UCQA 3TTQA 5HPCA 1FH7A 1IV8A 9CGTA 1UQYA 2CNCA 2UY5A 5A8OA 1LJYA 3CGTA 4W88A 3GDBA 1JF6A 1ESWA 1UD8A 1KB3A 3WNPA 1XCXA 1VBRA 1JL8A 4MNJA 1V6VA 3AZSA 3CZEA 3IANA 4ACZB 4CVWA 4M1RA 5DEZA 4AYGA 4EE9A 3EJTA 2D0FA 4N42A 1H41A 3H54A 4AZ5A 2VZSA 3CC1A 3HG2A 1WDQA 3WQ6A 1PEZA 1SYTA 3CBWA 2DQXA 2FH8A 4LYRA 3GM8A 2CHOA 2CPUA 3EBVA 4NXKA 2VOTA 3L4VA 3MU7A 2D2OA 2ZXDA 2EPKX 3VGFA 2NT0A 2XYLA 1M04A 3AISA 2W92A 4PUEA 1JXJA 5I78A 2OYMA 1W9VA 1JD7A 2YLLA 2VVSA 1XHGA 5E70A 1OGGA 4P7RA 3WD4A 2YFOA 1HX0A 2E40A 1A47A 2QMJA 4HMDA 4CVUA 1D7FA 1QI3A 1WE5A 4AW7A 1UR0A 1WAWA 4IPLA 4JKLA 3EJQA 4UQCA 4EAMA 3VINA 4FK9A 4M56A 3CUGA 3AMDA 1TMQA 1J11A 3CTTA 3ARWA 2QPUA 3O9NA 3VPLA 3A23A 1QNQA 4GPNA 3PTKA 3MSDA 3SCRA 1YQ2A 3QOKA 3AIBA 3EJRA 3CZJA 5ECUA 3M7SA 3WD1A 3N13A 2WCGA 3CV5A 1HNYA 3B9AA 3K1DA 4KH2A 5JBEA 1ISYA 4PN2A 3AZTA 1HJWA 3F5LA 1V6XA 4AD2A 4NRSA 2F61A 1XGZA 1UKQA 2W61A 2W4XA 2V3DA 2V5DA 4AD5A 1TFVA 3FHAA 4AZ6A 3BAWA 4TVUA 3WH9A 2JF7A 3GH4A 4S3JA 5LA1A 4AIOA 3LXBA 2ZE0A 1U2YA 4B3KA 2EBNA 2X2IA 2CKRA 4AIEA 5I5RA 4MB5A 1S46A 3VNZA 3A47A 1MQQA 3DX4A 3WNKA 4DWSC 3VDBA 4HA3A 2XVLA 2XG9A 3MO4A 1EO5A 1TQWA 2Y5EA 3D51A 1TA3B 3W81A 3QHOA 1FH8A 2ZUVA 3WBEA 2ZUWA 3WQ8A 3PZTA 1PPIA 1HTYA 1GJUA 4NXSA 2XM2A 4GI9A 4PMQA 2DH2A 2VRKA 1OIFA 1ISXA 2F7PA 4ZEPA 2XM1A 2BXZA 3EMCA 3W53A 4JL2A 4XV0A 4IUGA 4D6HA 3ARVA 7TAAA 5F7UA 4TUFA 5HOSA 3BCFA 4F9JA 3OGVA 4HZ7A 3TTYA 5E09A 1ISWA 1O6IA 4OOUA 2DIEA 5CSYA 2EPOA 3CZSA 4ZE4A 1UD5A 3RM8A 4HOWA 3ZM8A 4Z2GA 3CUFA 2V3FA 2BFGA 2EEXA 1HJXA 2D24A 1CGXA 1GZJA 3VD7A 3CIVA 2WXDM 1W9PA 4PTXA 1RD6A 5EB8A 1G01A 3AICA 1CENA 2CBVA 3WIJA 3N1AA 1TE1A 4P7NA 1HJUA 2GSJA 1QNPA 1UKSA 1DTUA 4W8LA 4TVDA 1X6NA 1JYNA 4TXEA 5A6SA 1GOOA 3G6LA 2DEPA 1TQSA 2WCSA 4D6JA 4ML4A 2J62A 4TX8A 2WVSA 2EPMX 4J3WA 3GZAA 1R7OA 4U5KA 3AS2A 3UG5A 4BQ2A 3QR3A 1EH9A 3W38A 2FHFA 1G0CA 3L2MA 4CCDA 3WKZA 2QMKA 1J0KA 2ZUNA 2J7HA 1QPKA 1JI1A 2EAEA 2BY3A 1B3ZA 4TX6A 5IFPA 1MQRA 2DT0A 5DO8A 5A8QA 4V2XA 2A3AA 4MB3A 3N9KA 3THDA 4MJ2A 1H4PA 2WNWA 5HPOA 3GBDA 2J7EA 3ZR6A 5JIWA 2HISA 1V6YA 2XUCA 4QAWA 3SCUA 1E3XA 1GUVA 2WVUA 2XGBA 5A8MA 1PIFA 2OSYA 4GIAA 1BG9A 2AAAA 4GKLA 5CJ5A 2VUYA 4WLCA 4H7VA 5E0FA 4PCTA 2O9RA 4R5EA 5GQBA 3DDGA 1CGVA 1CGUA 2A3EA 3ZJ8A 1QWUA 3UG3A 1GOKA 4HP5A 2C0HA 1W9UA 2O9PA 5BYWA 2QLYA 2WK2A 4AXNA 4UQ9A 1JZ6A 2EPLX 3QOMA 1ECEA 1J0IA 1QNOA 2WHJA 5D4YA 1J01A 5FKYA 2D0GA 1E0XA 4NX0A 1E6QM 3CH9A 1E4IA 2XFYA 4U3CA 4HOXA 2EJ1A 4J3VA 2WMIB 3BVXA 1ODUA 3MUY1 3VIOA 1GQJA 3VSUA 3LRLA 3ZJ7A 3UR8A 4UFLA 3OA5A 1B3VA 3KE0A 6TAAA 1WZMA 1KR1A 2V38A 3UG4A 1E4LA 5BXTA 5E6YA 1E4NA 3VM7A 3BCDA 3S2CA 1J9YA 4BZYA 2J7DA 3VIMA 5A6LA 3GYCA 6A3HA 3CO4A 5A8PA 1JYWA 1UWRA 3K8KA 3PZMA 1B90A 3MV01 2DT3A 1FFQA 1M7XA 1EOKA 2Z1KA 3O6AA 1MFUA 1V6WA 2X2HA 3MMDA 4DM1A 4P8WA 4DWSB 4OBRA 3CZNA 4P8XA 1MQPA 4GZJA 5CLWA 5FL0A 3EJUA 2XIBA 1AQ0A 5BXSA 1MWOA 1UD2A 3NYDA 1BGAA 2YL8A 4KWUA 1DWAM 3VMOA 3CHFA 3SCQA 2VX5A 3MUZ1 1JGIA 2EXOA 2VTFA 5FIPA 2ESCA 1K6AA 2A3CA 2D1ZA 4AD4A 3BVUA 1VFFA 1M01A 4AMXA 1UKTA 1HF6A 2WKLA 2D23A 3ZIZA 1HWWA 3ARZA 5A3HA 2J8FA 1EGZA 1FP8A 1OM0A 1UA7A 2JIEA 3BSGA 2X2JA 3GXTA 1R86A 2Y8VA 3UETA 2GJRA 3VD3A 3WFZA 4E8CA 1UH3A 1GCYA 3WDHA 4WIWA 4PTMA 1NM9A 2FHBA 4MAZA 4W8AA 3AQUA 3BSHA 2YL6A 2G8ZA 2XVNA 2C7FA 1CZ1A 3B8SA 3WNMA 1UZ4A 3BUBA 1LG2A 1GOIA 1NQ6A 1CYGA 2RGLA 2WWCA 3BMVA 2VQUA 3VU2A 1VEMA 1CLXA 2JEQA 2FGLA 1UKOA 3W0KA 3ZOAA 2YDSA 5A69A 2XGIA 2PWFA 4NF7A 1JFHA 2WPGA 4JFTA 2OSWA 3CMJA
chains in the Genus database with same CATH superfamily
3CM4A 3ZE0F 1XQLA 5C0JB 3SQRA 2H1PH 2XUWA 4UR9A 4XAZA 2IG2H 1ZVSB 4M8QB 3KYOB 3V4UL 1CT8B 1ZT1A 2APXA 4M48H 4DP2X 5C92A 4CD6A 1A5FL 5EEWA 4GRLB 4MXWL 2Q8AL 1D5BA 2NLYA 2SODB 4PJIF 5JZ7C 1IFHH 4LEOB 3GO1L 5AYIA 2DYPB 4HLZH 3H23A 3UYPA 3FRPA 5HGDB 4DY1A 5JH1A 1BD2A 4C5ZA 4B9KC 2B59A 5CP7A 2BXYA 2R14A 3MO7A 5FYKH 3DUSA 1UXSB 5AB2A 3UPRB 1BYNA 2VDPH 1G9NL 3OKOA 1UC6A 4YNGA 4C90A 3FT3B 3L9YA 4XRCA 4W5UA 4A8IA 3V52L 1XL9A 3SKJH 1PX3A 2C5DC 5GPRA 4B97A 4N2AA 2ZSWB 3SYPA 1MIEH 2X0UA 3VFWB 1IHIA 2E9BA 1ZVYA 7TIMA 2WB5A 3CVDA 4KRNA 4XXCA 3PIQA 4U7SA 3KBNA 1AGBA 4L1XA 4P9HC 5J4MA 5F1VA 5CM1A 4PGCB 3GSRA 1T7VA 4MQ7A 2ILLA 2XQBH 3D69A 2BCKB 4PRPD 3OVQA 1KFEA 2HPMA 5LDUA 2BASA 3DK2A 4MPQA 4GXPA 3MRKA 4JNXA 3IBOA 2NXYB 2EYSB 5HVHB 1P1VA 4KPLA 5DY2A 5DHVA 3SQOH 1QAWA 1RIHH 1SOXA 5FYJH 3BE7A 1Q6LA 4HKPA 1BD2E 3BUPA 4HLZG 1EWHA 4WJXA 1GIGL 2VCBA 3JWNG 2F2KA 4GRSA 2X4SA 5FOJA 2CHNA 3ATAA 3B5TA 3J07A 3RE0A 3CV7A 1I1AD 1PDKB 3HGSA 3APFA 2EDEA 5J3HC 3TJEH 5E7FA 1BWKA 5FJTA 4WFGE 3CU1A 4LHJB 1TJPA 2A0LC 3WLBA 2V30A 4IRZA 5GJTL 3GXMA 1TUXA 2YWYA 4PJ9B 4XPHL 4XAWL 1W3TA 3TCTA 1TVBB 2HMIC 2J9ZA 1JK9B 4NJGA 5CZXC 4NP4L 4W9HC 1BIIA 2RTTA 4P4KB 4WJG3 3TYGH 4LMQE 1VC4A 3QA3A 1FV1A 1G9NC 4CNIA 1A7NH 1QFWH 3C2AL 2JKWA 2LQRA 2R8SH 4YHNB 4S3DA 4I18B 1YEHH 3F7VA 3DK0A 3TKFA 2GBVA 3K8LA 4X6CF 1EYEA 2BVDA 4LFHD 1MVFA 4F37K 2NSMA 3D0LA 5ILTH 1GVYA 1S5TA 5CEZL 1OSEA 5AUMA 4CJ0A 1YPFA 4UB9A 3ZYJA 4DGUA 2CLLA 2DYRB 2IDCA 3VXRE 1QACA 3WQWA 4N25A 4JG9A 1J96A 4TYUA 3I75B 3S4SG 3AO0A 2ZA1A 4F7EA 1CU4H 1JZDC 3PS7A 2OSXA 5E6ZA 5BUPA 1OAKH 3ZVHB 3C60A 3WD5L 1G87A 1VJZA 1PXGA 2JEPA 3NR0A 3P0VH 1NGQH 1FQ0A 2V6HA 3ZYIA 2F6AA 5BVPL 1WBZA 3BWUC 2OXGA 3IS0X 4FX8A 1Q85A 4AWTA 3OAZH 3Q8EA 5C0RH 3SPCA 3NP4A 2QPEB 1EBHA 3D4GA 4QRPA 3QQ0A 3JV4B 3HI5L 3GMLA 5EOCJ 3KX6A 1JJKA 2P49B 3WLIA 2BSRB 4LASL 1KM0A 2X6VA 4NM4L 5JA8B 4G6JH 4FQ2H 4LVOB 3QUXC 5L2JA 1R86A 5J6HA 1BWWA 4OLVH 1KEGH 4X7TB 4YLWA 3NQCA 1P1MA 4RZKA 1AW2A 1M6JA 4TVCA 5IBXC 4JVWA 1R47A 1RURH 4OV6F 5EOQH 1DOSA 1F11B 5DJ8A 1IEAB 2BWIA 1UMLA 4HZAA 1FAIL 1JV2B 3OM3B 3NCOA 4I7UA 2DGAA 4TTDC 5ACZB 2NUTB 1DV7A 3RWHB 1SLUA 4U6VL 1PKYA 3A4WA 3RY6A 1LK3H 1YNTF 1MFBL 5C07D 3NACH 5IB4B 3UAJD 4DQOL 1JNHA 4F2EA 1OVDA 1WBJA 3RVWD 1EX1A 3VXRB 2JIWA 4QITA 1ONEA 4IOIB 2CKBL 5I1LB 4HQVA 4Q22A 2EDDA 2Z31C 5TIMA 3F2CA 2EDXA 1I8KB 1YEIH 2KDYA 5DZVA 4KKCC 5E2JA 4KFOA 5ABDE 5D33A 3OBAA 4DJDC 4XCEB 3E12A 3FYYA 1BQHG 2A4EA 4G7VH 1S7SA 3L3KA 5FYKE 5EU6A 2Z91A 3KHOA 4L4VA 2EYRA 5B8CA 3DFOA 1J79A 3L0NA 3CUJA 1UIOA 3LHZA 3P73A 4G2AA 4IGBB 4LBSA 1BFTA 5HI4C 1QO3B 2X41A 3GSNB 4XNYL 5MI0B 5GS2D 1XDJA 3F4CA 4R33A 1NAMH 2PI6A 5IV2A 3T2QA 3R13A 5K4ZA 3ZDXB 3WEOA 4U10A 1BVNP 3NJIA 3PJSB 4PI0A 4GBUA 3KLLA 1IEHA 3JS3A 2P7TB 3KDPB 4WEMB 3EGJA 3SYAA 5FK9B 2MCPH 4OIAA 3WGUB 3GSUB 2RAGA 2UWFA 4FG4A 3MRHB 3L3JB 3L54A 1OAXH 3BP5A 4YLCA 3H12A 2V9QA 1YY8A 4E9XA 4KXZI 1HGYA 1I9CB 1K8IA 1HKVA 2X6CA 4AX3A 5T9CE 2BC4B 3LSOA 3US0A 5BUGA 2UWEE 3KWWB 5EBAA 2EXYD 5J04A 2XC8A 2PO6B 2ERJB 4V1DD 2BOBB 5GXBB 5GISH 4J2PA 3U2IA 2HZHA 3ZMEA 2O9OA 2X4QB 4V1DB 4EDXA 4Z7UF 3QS2A 2C4FU 2XPZA 4Q56A 3QW9A 3T71A 3T0AA 5DS2A 3B7SA 1EBPA 2X6AA 3GSNH 1XIEA 5KSWA 2I5GA 4HDIA 1OZUA 2ENYA 3DC0A 1CBVL 3ARQA 4K37A 3WDRA 2CJSA 4YWSA 4ETQB 1NSNL 2C34A 3TZVC 4NO3B 4KHXH 3E7JA 4RRPG 3IRDA 3HJZA 2DQEH 4ONGH 1YYLL 5ETUA 1TJXA 3ZHKA 5LIKX 8FABA 4B53A 3ULUD 2DMCA 3FPXA 5G2IA 2QVFB 5E5RB 3VXOA 4ZD3H 3QWRD 4L9YA 3ELQA 3TDFA 4TOQA 1J5CA 4Y5YB 4QOKD 3O8XD 4Q6KA 4NUPA 1CDIA 3CZLA 2J24A 3I4KA 4G70B 4I9TA 2E27L 2BOCA 1UZ1A 1LZOA 3E0GA 4RRPM 3KLAB 5E9DE 4FFWC 5F7NC 2NW3A 5DRIA 1RBOB 3QUHA 3DPBA 4NZTH 4LKXA 1NC4B 4OIFA 3UAJA 2GJ6B 3OGCA 5CD5D 2FZ9A 4FX7A 1FWXA 1DJHA 1R33A 3S34H 4KVCH 3T65A 4BI5A 3NPZB 2QPSA 3KRUA 4LGXA 3SN1A 1EHLL 1TV8A 2GW5A 5C6PB 3TEWA 4YHIA 4JM2B 4JLRA 5B3JF 3L1OH 5ESVB 3TWYA 1EJVC 1Y5XA 3STEA 5E5LA 5JR1L 4WW2C 2AGTA 4R90L 5K1NA 1WKFA 4V15A 3H9YA 4DESA 8CGTA 2GSHA 1PLGH 2NV2A 1RCYA 4FNQA 4O13A 3T8QA 4AQ1C 1M03A 4M62H 1XLHA 4GBXD 4NBXB 2Q7AA 3CU2A 1JD9A 3WK1A 5AW5B 3CV6A 5GGVH 1RHFA 1A4AA 5CXPA 3WX7A 1UZ8B 1UCBL 4JW3A 3V0AC 2JBMA 2CHWA 4Q14A 3V4VB 2DPEA 3VCLB 2LVEA 5E1AB 4BF7A 2X5PA 3NAAH 4H2AA 4M7KH 5ANME 5DS8A 5GRYA 4BFIA 4D3CH 4U31A 4WFED 1XIBA 1HVXA 4GUQA 1LO3L 2DJXA 3U7WH 2RHGA 2Z8SA 5G2NA 1B3IA 4L1TA 1G9ML 1NCWH 3RVUD 3LRHA 3EOUA 1RVFL 2XWTA 3KL3A 5EULV 3S5ZA 1RALA 4O16A 3PTQA 2DLTA 5LA0A 3QJUB 1UVQB 1IM3D 2CR6A 2Z3FA 2PLCA 1TEFA 2Y3AA 3NK3A 4Z77B 4UTMA 2A6IA 2NR6A 1BXNA 2GTZA 1KRMA 2ZT9C 3DOHA 3GSNA 4J3SA 1PDYA 1BAFL 1Z9MA 2D9QB 3IDGA 2F08A 3RWEA 1MWAA 3VMNA 3DXAD 1OY3B 1V3HA 1L8NA 4JM4L 4XIMA 3SAZA 3PHOA 2K4WA 1FBIL 3WF4A 2BSSA 4RXGA 1G7QB 1I1RA 2Z1PA 1P0NA 2HYMA 4IXXA 4JPVL 3ZZQA 2PTZA 3QCUL 5DC4B 1XO8A 3IGAB 4ZMOA 4K8RC 4HYTB 4YSUA 1A3LL 4Z18A 5CAYB 1IYXA 2BHYA 1KELH 1ZTVA 2WMGA 3HC0A 4PJ8D 3PWAA 1HWGB 2O6FA 4JQ4A 1HHKB 4GAFB 4AQ8A 2GSIA 2W65B 4DLFA 1QSZA 2P8MB 3NCEB 2R69H 3WD3A 2EHHA 3LVEA 3KOFA 4YEEA 3WEZA 3OL2A 3WNJA 4YAQA 3PZIA 3WO8A 3RTQB 5A2BA 1EGJH 5CKAA 1U3HC 4PS3A 1FL5A 4HGXA 2E6AA 3IXTB 4CNSA 1JNHB 4S1RL 3IPWA 4XUYA 5CAHA 1DBAL 4KRPD 1TE6A 3UQNA 5CF3A 2GJZB 5H37A 3L95B 1YXYA 4K94C 3FA5A 1D2PA 1FFRA 1KLFA 5FYJE 1NOLA 3Q2NA 2HS8A 3UVIA 1TTJA 4KRZA 2J6EH 2FZNA 1EC9A 3MQTA 4CNUA 5I15L 4R6UA 4X9YA 2E86A 2N3JA 3JQOB 4PJAA 2ZZ7A 2Q7YB 1A7RL 4CD5A 1IEAA 5JIKA 3RHWF 1IGCL 1VFHA 1AMYA 1LEKB 1PZ5B 4PYGA 2CJUH 4L8BA 1MFMA 1ETB1 4HJGA 5AVRB 4WW1B 1CK0L 2XTLA 3HS8A 4M48L 3DKHA 1P7QD 3SI9A 3WH8A 2AITA 3Q8AA 1FNEA 1FWBC 1FIGL 1ZLUK 3IRPX 4YJZL 1LDPL 1M05A 2ZSVB 4RWYH 5GS1A 1BEYL 7ENLA 1JUFA 5CHNA 3TJHC 4OCXL 4UXDA 2Y5TA 3SW6A 4KKZA 3GSUA 1CT5A 2PYED 32C2B 2X2UA 4CQAA 3WLHA 1YMMB 3AT8A 3M0LA 2KMWA 6PCYA 1AFVL 5EO0A 1SJXA 3TOPA 3OQEA 5DURB 5LXGH 2ENPA 1XLAA 2EKGA 1I9IL 4R2GB 3W29A 4XP9L 4HULB 4K7PX 4B27A 4MNQD 4LLMA 4UQ3A 4URTB 1M57B 1JF5A 1TPXB 2HB0A 3GJFK 3LS4H 3EFFA 4QOKB 4ORGA 4K55A 3QHZH 4KXCA 5KYXB 3AIEA 4N2YA 4FXGA 4UC5A 3N25A 4FFWD 4DF1A 2VZUA 4WO0A 4AZCB 2GDQA 4H20L 5EB8A 1G9HA 2CBUA 5JHDA 2H8PA 2UXGA 2VL5A 4K3ZA 5ABFB 3GVGA 1OXYA 2ISSA 3EYSL 1Q0EA 3NL6A 1S2CA 4JRXA 2CO1A 4JTTA 4BSWB 1FWTA 2Q8LA 4KVNH 1N0XH 4ANUA 1IO4C 4JTLA 3IFLH 4ZQOA 4UAOB 3AJXA 3V1HA 2XZQH 5DZPA 2DY2A 3B4NA 3L3OC 3FB8B 4FMFA 4A8NA 2AQPA 3KW7A 3GTTA 5HHPA 4B5UA 4OJDH 2E7HA 4DEPC 5A6IA 1EQPA 1VBJA 4JDBA 3MBEB 4LCWD 1S9XA 4LT7A 3LZ5A 1L5GA 2JCCA 2CCVA 1SVZA 3OD3A 4JCWA 4R0LB 4KQ3L 1HW6A 1OW0A 1P7BA 4YHMH 4Z77A 4B9ZA 5D71L 2WYTA 3X2QB 3GRWL 5IJDC 4KX9A 3GVQA 2XVNA 4NQ1A 4MCYB 5DCDA 4NRXB 2YPIA 2IXQA 2XN2A 3T0ED 4GFXA 3BEWA 3CE1A 3HNSH 4PMXA 5DZLA 2EYRB 3SODB 4NNYA 4XE0A 3SJVA 1PJ9A 1MH5A 4N24A 2K8MA 3FQWB 1XM3A 2B7QA 3ILPB 2FZBA 4MAYC 3KR3H 4A66A 2IFFH 4LSUL 1SMDA 4QR6A 2GDUA 2WQRA 4OZFA 1VP5A 2HVJA 4DZ8A 1TETL 3ICJA 4GJTB 4RFOL 3OVPA 2R39A 2BGSA 1X7TA 5EBLB 3CFIC 3H9SB 3HG1D 3MNDA 2EO1A 4HIPA 4DGYL 4FOKA 4ZQPA 4I7VA 3D47A 2R4SL 4X5XB 2V8ZA 2QF8A 3D2UA 3ZHLA 1FP5A 1JPIA 4TUKL 2RH0A 4XISA 4JIIX 4WKXA 4N26A 4YBHA 2OWXA 3E0VA 1PX8A 2JTYA 2HVBA 2VDPL 4WF7A 3K6FA 5JNYB 4JLRB 4JM2A 3D0AA 2EVGA 1A9VA 1JCMP 4HSAC 3ZE2E 5FLVA 1XMEB 4MWFB 3RILA 5EMUA 3DIFA 3II2A 5F88B 1BA9A 3NFPB 3ME3A 3CZUB 2OTWA 2H0FA 3ARDD 3TTSA 3WBYA 3O3RA 1MIEL 2PXYC 2D7TH 3H2PA 3LNMA 4Y4FC 2B4CH 1MCRA 1IBGH 4OCMC 5JDSB 2P80A 3NJMA 5DUPL 2PLTA 1QI0A 4ISVA 3FT2B 2D69A 3FDWA 2J8GA 2Y62A 4Y9NA 2VRQA 3KYAA 1ES0B 3NJLA 4Y1AD 4ZPVA 3P0XA 4RIRB 5HYSB 1IL1B 3ULSB 1DLHA 2FWLB 2E5BA 1UBSA 3EO0A 3IWPA 1JGUH 2B1AH 2PWHA 3CK0L 5HD8C 3CIWA 4GD0A 2NUWA 4DWSB 5JW4R 1GKRA 1XCQB 3HI5H 5C9RA 3K7UA 1FNAA 3FKKA 4FOJA 1DE4B 2A4ZA 4FNLL 2Q09A 4AEHH 4JTCA 2JKPA 2CIIB 4F7PA 5DWPA 1QDSA 3FGCA 4M5YL 4YHKH 1CICD 3FQXB 3L5XL 3RG1C 5JHBA 5CU9A 3B0YA 4LO9A 1KNOB 1W1ZA 2AQOA 2X7LA 3BG5A 2BNQA 3U83A 4Y9EA 3IBEA 1V02A 3QQ9C 3MLPA 1EXBA 2OLHA 5HATA 1TJGH 3GHEL 5E00B 5ALBH 5IBUG 5JXED 3TEUA 4ZFFB 3RWFA 1IZJA 3N1MC 5IJCC 1E6SM 1EZLA 2VEMA 3GWQA 3SB0A 3BAJA 1TV2A 4AITA 5IQNA 2ZOTA 4ZO7A 2X1QA 3QXVA 1R34A 1E0UA 2UZYA 3OOQA 1JRHL 3V0DA 3EX3A 3NM1A 2EP6A 4UFMA 4KGLA 2VNCA 2G2NA 4E42B 3SY8A 4P5MB 1CTOA 2GK0A 3AIVA 4NCDA 2LABA 4XNZB 2R8SL 1Q4NX 4NSKA 3LHVA 1ACYH 3VXSB 3VIHA 4D6FA 2H32A 3NQ8A 1A3ZA 1OBAA 2FZ8A 4XXWA 5DUBB 3TBVB 4YL4A 3WXVL 1IKNC 5FM5M 2EH7H 4POYA 3WJSA 1KPRB 1D5ZB 5E1GA 1U4FA 1S5VA 4PGDA 1SM3L 5HHOE 4F20A 3HR5A 1QBAA 3FUEA 4PJXE 2NY0B 1X5HA 4Y2NA 4ELKA 2RGMA 1KBKA 3AWEA 3AOFA 5DELA 3ZHDA 1XIIA 1XLFA 1XSIA 1C5CH 4NX5A 2A9NH 3A4AA 1BD2B 3OLGA 3AXKA 1OF0A 4LYQA 2E6PA 5KVFL 3SCMD 1CD1B 1OFAA 2OMWB 2IAMD 4KFMA 4XPFL 2FECI 5SWSA 1EUUA 5D09A 3BEVB 9RUBA 2IAMB 4U1NA 4JFSA 2K78A 4LLWA 2QT6A 2CO6B 4M6NH 4ALAH 3OJVC 2PTVA 3BUYB 3A67L 3PRZA 3RKDD 3AADB 5A43C 4RGMC 3V5DA 2RB8A 2K6ZA 3ME0B 4I4WB 4MMXA 3OODA 1YNPA 4XPAH 1IVLA 1MCSA 3BDYH 4POZC 4OQVA 2FD6H 1DQIA 3ARSA 1MKFA 1U8IB 2FTPA 2VFFA 3K6IA 1DQQB 3WL0A 1AD9B 4UZSA 7REQB 3GNRA 1RZKC 3H55A 3HRZC 1K2DA 1CECA 3DRQB 2PU1A 3DESA 1CWVA 4H19A 1WSST 3UIYA 2WSKA 4YPJA 3VXMB 3NP3A 1JMZA 2J6WA 4TUJB 4KK6C 4KHXL 3KVPA 1P9MA 4F5CA 2I9LB 4M6QA 1QW8A 3RBGA 5I9QC 1U4EA 1II4E 2XPGB 4J3BA 3PJUA 4QCFA 4O2CB 1OTSC 3FV9A 5FJPA 1Q6EA 3AG1B 3D50A 3RVXC 1AY1L 4Y2LA 2NUPA 2XDHA 3SADA 1S9YA 5AHFA 3BURA 1X38A 4R3SA 4LHQB 1W2KT 2P5WE 5BS0A 2PGWA 4N87A 3CFKB 1E28B 3II1A 3N18A 4L4PA 4QKXB 4M43L 2WMJA 3F4VA 1E6XM 3NL3A 4KRPC 3EKGA 4DW2L 1G4PA 3H26A 4WXYA 3T7VA 3AXHA 4HF5H 3ENLA 1NAKH 4FHKA 1YJDC 1AIFA 4Z7QF 1O7AA 4B5WA 1YAIA 2MANA 4GCXA 1EHLH 1IGIL 4AWEA 5CPMA 4HETA 2XJKA 2RACA 3U5UA 2P5EE 3WKMH 3CQQA 1X5LA 3V5FA 1E9OB 2NY4D 1EOMA 2PCFB 3NK4A 4LLVB 3SUWA 3Q3GB 5DJDB 3SE9H 3TZVA 5IEHB 1ONXA 4ZGYA 3EMZA 5K39B 2XZAL 5IBLC 3TO2B 3BLFA 1JNNL 2WSDA 4UNIA 3W1ZA 3TX9A 1ZHNB 3FB6A 3WTVA 4N8PA 5HMEA 3THUA 3HLAB 5AWNL 3L2IA 2HT4C 2N0KA 4RCAA 3GIYA 1ONRA 2Z93A 1JUKA 5FA5A 3U6RA 2C91A 4J12A 3BXWA 3TW6A 4B9GA 2C1PA 2R56L 4X5XA 4M93B 1U8PB 1OYAA 2YXOA 4ZSTA 3AGWA 1TTPA 5KANI 4GUGA 1E9LA 1NIBA 1MCQA 1QI4A 1S7TA 2GUYA 5CIPH 2HRPL 5IUCA 4LCWA 2V7HA 1INDL 4AWUA 1REQA 2X8RA 2XZ9A 3VFSB 1YQVH 3BAXA 4GRMB 5IK3B 4RMSA 1CN4A 2A2IA 2J77A 4Z7QB 5E00A 3N15A 3C60D 4XC1L 2PDYA 5D70L 1ETZB 5T5NF 2NTFB 4BI7A 1GQIA 1CC3A 2ZRWA 2OKOA 1QR4A 5AZ1A 2FQDA 3BEWB 3GDCA 3WIIL 1L7IL 1N8IA 3EJZC 2PDJA 2Z6FA 3BPCA 1Q1JL 2JXMB 3RRQA 2I5YL 2VLJB 2X9ZA 3FCUB 3WF1A 2FX7H 4XCNB 2E27H 5FM4A 4DUXA 1L9RA 1HL2A 4JPQA 4HMEA 1IKFL 3DJZA 3OVRA 3CVHL 2PWDA 4NBZB 3KL0A 4WTZG 3T5WA 3NZPA 4MLRA 3MKVA 4PCFA 5I79A 4FQLL 3SE3C 1G6RB 1BZDA 2H2PD 3GLZA 4FZEH 3RVWC 2BMBA 2CITA 2Y8KA 4D2JA 4AGPA 4Z1YA 3TIDB 1PBGA 4X8GA 2XH2A 2O6CA 3WU1A 3CUIA 3HB9A 3W1LA 4Q4KA 6PTDA 1EWDA 2VXUL 3ITCA 5IP4A 3K2UH 2IOMA 1RH9A 3GKFA 3W2NA 1HHIA 1S7XA 3LIZA 3MO1B 3UJTH 2CESA 5B4MD 3KCOA 4GZEA 1C12B 2A6NA 3BZGA 4JM2F 3W9ZA 4GT0A 4BE5A 1UH2A 2CJUL 3VXTB 1MNUH 1NGZA 4P5RA 2ICWB 1YEYA 5ID0B 2W63A 3OHIA 3GSVB 3V75A 1ULVA 3A6CH 3UBXI 4XN1A 4G8IA 1H2JA 3JWDL 1XLDA 2B7PA 3L5WB 3PWNA 4N86A 2VFEA 3CXOA 4G8EA 1N7MH 3UZJA 2WINB 3ZUNC 2YUVA 1JOIA 4JYDA 2XLLA 4IEFA 3HKZA 4MB1A 2R7EA 4GI6A 3SUSA 4CD8A 2WOQA 2CJ3A 2ZKHH 4U5IA 1YN6A 1U8CB 2P8LB 3M46A 2BHUA 4MDIB 3STBA 5JHMA 3B3BA 3BKYL 5BRZD 1K5NB 4NPJA 5HXMA 4JVUA 7PAZA 3EKLA 1M6OB 1NOFA 3OIHA 1IM3A 5J1TC 1JSYA 4JO4H 4NS0A 1WBYA 1S3HA 2G4FA 2PC4A 3JVGA 3T3MF 4GKZB 3I6SA 4L48A 4DEUA 4QP0A 3Q2WA 3RTQA 2DEYX 3B7RL 4JIQA 3BT0A 2EIZA 1T22A 2EIJB 5KOVC 3EWXA 1N5YH 3VXMA 1NMCC 2DQJH 3SPVA 3XINA 4M1BA 4AC4A 1CG9A 3RUGB 1K2DB 2DMBA 3VG9B 4JFYB 5I74C 3NIDB 2D2HA 5DJ0A 3VH8G 1DKWA 5FGRA 3G6AA 2WMFA 4H7CA 6XIAA 5FF6A 4IG2A 4OZGE 4YSCA 3MUAA 3OEXA 2DQIH 4KF1A 5I73B 1DCLA 4JCLA 1IIKA 2V5JA 4MY1A 1G7PB 1R85A 3C75A 3ABZA 2YPVL 4A63A 1KFJA 2AJUH 2BRQA 1A4KB 2XTSA 2HT3D 4IW4C 1JF1B 4XPTL 5AAMA 1S9VA 4BFGA 5LO7A 1QW7A 1DO6A 1B3YA 5B3NA 3MUGB 4XMTA 2R23B 4QHUA 5I30H 5KYUA 4AE0A 2CUAA 4L8DB 3TV8A 4MNKA 4QGCA 1A7PL 2A73B 4QUOA 3UC2A 1TWWA 2PDCA 2BHZA 3ZRFC 2YCJA 3S6DA 4NYLA 2WUBH 3MREA 1B0WA 5EU5A 5E8PA 3KLHC 3WLMA 4PV1C 2ATMA 1Z6JT 2AK4B 2HH0H 3POCA 5C0DA 3CHVA 4K68A 3CBKB 4LRIC 2BZCA 5MEQA 4CU8A 3B9KA 5I1GH 3DX8B 1S2AA 2QCNA 2ADFL 3G1HA 5LCVH 4MTVA 1BVZA 3C6SB 3CBJB 2QL1A 1J8HB 3HS0C 3VFNB 1WNOA 3C8NA 2A3BA 5HHOB 3PBUA 3U4FA 1T5WB 4Y5VB 5KN5B 4JS7A 4L8SB 1I9RH 2P8PA 1F3RB 4UBDD 2CGRL 1PIGA 3VK5A 3W7KA 3OKLB 1AGFB 1NANI 4DGYH 1AFVH 4OLUH 3HBQA 4UTAL 1PEWA 3NQ2A 4KQ4L 4MD4A 4NQUA 2Y5QA 4PJBE 4YHPA 5DD0H 3BV4A 3HFYA 1ADOA 1RUSA 1E7VA 2BO0A 2CLHA 5L2JB 1JS4A 2R6OA 1EJFA 1VD6A 3AHYA 4JTGA 4LAKA 4MYAA 4S2BA 5CPTA 4FABH 1V8EA 3QHZL 3KLHD 4HT1H 1SZNA 4XBPB 3UABA 3VI4F 4D9LH 5KYYA 2K70A 2C0AA 1P5UB 4DPRA 5E1QA 1L6FA 2E8YA 3LV3B 3RWGB 3O45A 1PVHA 5DMYA 5IIEB 2TPSA 2YBVA 1P2CA 3ZJKA 3GMRB 1XGQA 4QQ3A 2B4CL 3A4EA 3P3RA 3DV6A 3RVVC 1OZQA 2VX6A 2FWUA 2AAMA 3EJPA 1MUWA 3VC6A 2HX8A 3CH8A 5LIUX 4G9PA 1KTCA 1CDUA 4IBQA 4NOFA 4PJXF 4WGVB 1FH2A 3DC8A 4OFVA 3GIVA 4OFYD 4G7EB 2PPFA 4RGND 3RPIA 1UFGA 3G08A 4KK8C 3ZZSA 4BUGA 1SO6A 2XKNA 5A1AA 1ZQ5A 1T7XA 2FYYB 1RK0B 2OXHB 3BQVA 2VR8A 2NW0A 2CA4A 1OO2A 4KQ3H 1N3NB 1JCNA 3V6FA 1T8QA 3MP4A 3P5ZA 3KOZA 3WUBA 2ITFA 1T1ZB 2WN3A 3OKYA 5K93A 1MMFA 1S7WB 1E6PA 5C5YA 1J1XL 3CFQA 3QNXB 4J3OF 4XBEH 1OB0A 2EEBA 3NRPA 5I82A 4AB4A 1E8YA 1OANA 2N7AA 3IFPA 1F07A 4NRYB 2B3RA 3I74A 3F12A 2WWMC 3UZWA 2W79A 3UGUA 3ATFA 5BRZA 5K9KA 4X7DC 4GKSB 1EHKB 3TPUB 4PJDB 3QFEA 3BIKB 2X4TA 2FJSA 4PJAB 1ZUAX 4KTGA 3H7VA 1OOWA 4ODTL 4PP1D 2Y7EA 5T33L 3UW6A 4LF1A 2EJAA 2YD2A 4YSAA 3GS6A 1WZ1H 2I85A 2PCXA 1W0VB 5I1JH 1SJEA 1O68A 2OZ8A 2OWCA 4W4OC 4KROD 1OD7A 3T4YA 3P84A 1QSEA 2BDNL 1O95A 2F74A 4XKMA 1TKWB 3NAVA 1E3FA 3VOHA 3FFCE 2PO6D 3TFKC 1SM3H 4HYWA 1U42A 5MHBA 3CZFB 2QCDA 1YNLL 3GDRA 1IQWL 2WXIA 4HU0A 3GLCA 4FQXA 4UAOC 3BW3A 1AA1B 2HT3C 5C08B 4KRPB 4IMCA 3H4GA 4KEVA 4BZ2A 5D7IE 1G0DA 2FGZA 2W9LA 3DUHA 4HX1B 1SDYA 3IJYA 5DUPH 1IEVA 1UQSB 2DIKA 2BNRB 3V3WA 3PZUA 5AHEA 2VR4A 3ARRA 3MBEC 1M53A 4JBSA 5CSZB 2JE8A 4XMUA 3U0TB 1R2TA 1A49A 1UWIA 3R7RA 4PJIE 1KIQA 4TTGA 3L3KB 5IHLB 5I2IA 4L4JA 2R7EB 4LRNH 4ZW8A 4K8EA 3UWZA 2KUTA 4OGXH 5ABFA 1XCWA 4ODXB 4QPEA 5E4EB 2ED8A 2BSLA 5HGAA 4BSWA 1ZPLA 3W82A 4ERSH 5IB1A 2IKHA 4PS4L 4UTFA 1KBWA 2W07B 3JZYA 2IPUK 3JYBA 2HFEA 3HC4L 3BZFB 3T81A 4FXRA 1QRNA 3WD0A 1FNEB 3WN5C 4QNPE 2OMUA 5B7ZA 1WITA 1W31A 3SUVA 3UVAA 8XIMA 1B3XA 3M5ZA 4C57C 2OGYA 3UYRL 1DHKA 4PY8J 4HUVA 1X8CA 4EK7A 2VWEE 4XNXL 5JQ6H 4DELA 1CUOA 2E7CA 4G6ML 3ZTJG 3WBXA 2FH6A 4YTTA 3ZX1A 3LGEA 4RDQG 5DJAB 5AL8A 1J0ZA 1EZVX 1E72M 3CUPB 3BKCH 1FHDA 1DJQA 2EUVA 3MJ9H 1M1XA 3LLDA 4LH8A 4XVJH 4L4TE 1RCOB 3PXLA 3OV6A 1S2VA 3GDLA 5ISZE 4XZ9A 1SOQA 4UOQA 4A7TA 4MZRA 3DDFA 4MX7A 3E8VA 4PRHE 3TBWB 4YBLC 1Q6OA 4AZCA 1K8CA 4ZUUB 3O2LA 2J74A 2CO4A 3BP7B 2R2HB 1UTDA 4BEQA 3QDMD 1Q65A 2UUDH 4NAEB 2EPNA 5I76B 2CYGA 3LCWA 3P5YA 4HFUL 1GONA 2MPAL 3B34A 3N14A 4MGGA 1EFXA 4IS6A 1J5DA 3ARXA 4D9QE 1G7LA 2XYCA 4OTXL 2XV0A 5IJKA 2JELH 1GEQA 1MPAL 4JTQA 2CO7B 2FX8H 3KPSE 2DOCA 1BV8A 3NH7L 4HUWB 2I9EA 3L17A 1GVEA 1UGKA 2OBGA 3TN0B 3PL6C 3ARFC 4K5PA 2P8CA 1QEWB 2I32A 4AVHA 2QSTA 3JZUA 2P5PA 4TQEL 1KM5A 1EIBA 2XBDA 3QZBA 4H8VA 4A7GF 4EQ2A 5MEOB 3L12A 3FVMA 3IETB 4JN1H 5AWNH 1KWGA 1X7QB 2HPIA 4D6DA 4KNQA 4Y6GA 1ZSDB 3MJ6A 1EUNA 2O7QA 4X83A 1A21A 2J4WL 4KKAC 4XPAL 4ZFCA 5DMIL 4TN9A 3T4YB 3IGAA 4F0KA 5AECA 4HNLA 3AWNA 3QYQA 5DLML 2Q7YA 5J12C 1PZ3A 4NN5C 5G4WA 3HG5A 1W8OA 3MT1A 2FMOA 1I75A 4E41A 5C2UB 3APYA 2ICSA 4C7DA 1CXKA 4OUIA 1WCGA 3GUTA 3L7FB 2Z1VA 1MCDA 2IQ9H 1ZFJA 5JBFA 3NPVA 1EO8L 4TV3A 4IFKB 3LB0A 3K8MA 3ZRSA 4NENB 5DHDA 1QFEA 3QYMA 3PGFH 3CYVA 3M0ZA 2QADC 3TFCA 5H4YA 1K4CA 3GI8H 2XQYA 3WSQH 1BBJA 4DZHA 5D2LB 1INEH 1QSVA 1UD6A 4PRIA 2Y25A 4O1EA 3TC6A 1MJ7L 1L6SA 2CXGA 4NM8L 3RJXA 1CB4A 4I77L 4TSCL 5KJ4A 3HGRA 3OB0K 1JGDA 3WK2A 3RZCD 3DDMA 1TQVA 2AEOA 2VLJD 3KPMA 1J12A 3IU4L 3P11H 2WWKO 3Q9PA 5G5DA 4CN6A 2IPWA 2NUXA 5M03A 2XKNB 4LVNC 1BWLA 1H51A 1SJEB 3EHBB 4G7SB 3C5QA 1KXVC 3PUDA 2IGFL 4IKKA 2A21A 2BJMH 2BNRD 1QLEL 4O9HH 2Z7ZA 3ATDA 3UJRA 3WQVA 3BAIA 1JJUA 1I7UB 1IGIH 3H85A 3M7OA 1QK2A 3ESNA 3W7DA 3S88H 1NIDA 3NGBC 4FMVA 4XB8A 4G3YH 4OJFL 1IEIA 4RGNE 6CGTA 4FNTA 4WI3A 1DBTA 2YRLA 1HS6A 4JFEE 4X22A 3UZYA 3ECUA 2FTYA 1W0WB 4RV8A 5D1QC 4PJ7B 2YL5A 3F4DA 1N6UA 1HXKA 4FLQA 2B0MA 2YKLL 1VBUA 2JKIS 3Q43A 3EWCA 1GGIL 2WOYA 4LLQA 1SXSA 4WHCA 4HIXL 4WHYG 4JY4B 3VDCA 2QUNA 2BSCA 4J3UA 4U1KA 3VFVB 2JI1A 4ERIA 3K46A 4CMMA 4TR9A 5HOSA 4AL8L 4JHOA 4C6NA 4O2FA 4YFLI 1W8NA 4XODA 3BKYH 3PDDA 4LLWB 2IAMA 4U1NB 1JZ2A 1H1NA 2GTQA 2C15A 2P7TA 5FIEA 4Z3JA 1NIEA 2C7UB 2DYPD 3GS0A 4PRBB 2IGLA 1GYAA 2XFRA 4FX6M 3TBYB 3KTXA 4HNOA 3MCMA 1DVYA 1DEEA 3ENEA 4QYOA 3L8QA 4OFDA 1NC4A 5JXAL 3TMQA 1SDAB 6FABH 1MCIA 4MS8D 4N2KA 5F9DC 3ZE0B 1TVLA 2PD5A 3KRBA 1ZCCA 1T1ZA 1JYXA 4AUBA 4Z0XA 4GW1A 2JKXA 4QHMB 3Q7JA 3O3EA 3WIIH 5JA9A 4OGYH 4PMZA 1YSOA 4FG0A 2FDSA 1A6ZA 4JNMA 5DFVD 1L0YA 1KIRB 3RB7A 4WFHD 1JPSL 3Q6FA 4MMYA 2Z24A 4APXB 4MKSA 3UP8A 1XGTB 3FK3A 1U8KA 4LSRL 5EZJA 2ZCLL 3VAEA 2AJUL 3QXBA 1EUAA 2FBJH 1IE4A 4Y1AA 1TCMA 3FU0A 4GPVA 3N44F 2ZUQB 2OMZB 4I9MA 1ZOXA 5DD6B 4YVVA 1A7PH 3ABRA 4PJEB 4BK4A 4LFYA 1ASQA 5DJ2B 3T4AA 3BLLA 3EG9A 1E6OH 4DB7A 1E4XL 2CDGA 1T1YB 3F7KA 3G0UA 1UUOA 1GXEA 1G5AA 2NXYC 4ZMNA 1DXIA 1W5OA 4HS3A 4PREA 4YDLB 2AC0A 4JO1H 5KVGH 3T0BA 4Q58C 5L6UA 4J4PA 1XF3B 5AD0A 2A6LA 2NWSA 2A5HA 3W72A 1MQ8A 4IK6A 3LCIA 1KFAH 4ZX3A 3N6YA 4OCYH 4BHUA 5D9PA 5AHNA 2PP0A 3GMNA 3QZOA 4JZNA 3QO1B 4RMRA 1ML1A 3ZDZF 3NDYA 5L4FA 4UTAH 4F7TB 3SGJA 1C92A 3LZPA 4GMTH 3W39A 1OD0A 4UFKA 4NQEA 1MFEL 4M1CC 4PWKA 4C6BA 3BQ5A 4OZ4B 1FE8L 1MCPL 5AOLA 3SDCC 4F9PA 2GK1B 3QGAC 3G1XA 4YO0A 3M4HA 4IIHA 1UQZA 5T1DL 2W5FA 1G9MC 3VOCA 3DVGB 4AKPA 3EOYG 4M1GL 2VSKB 5JXEA 1ZGLM 2D03H 2F8QA 4L2LA 3ZU8A 1XTMA 1AC0A 4NQDE 2LV4A 3C08H 4OLWH 4Y0GA 5CJXC 3VFUB 4MJIE 4D0DA 1AZ2A 1Z7JA 2LLNA 1T5KA 1PZSA 1IT8A 4PJGA 2WXQA 1KV5A 3MLVH 2NDGA 3NSNA 3BP4A 1VPOH 5I18L 1GZPA 1AR1B 1R9YA 3GSMA 4BQ5A 5DGQA 5C9JB 1SN2A 3OKDB 1UWAA 4GX8A 5T3XD 1J2BA 1UOVA 3APMA 4CL7A 1FWSA 1KCUH 4NUGL 3RCNA 2VXTH 3K6OA 3FH5A 4XXWC 4YXKL 4BXSV 5BS0D 2WO2B 1BXBA 1LF1A 2ODOA 1TTCA 2YPVH 1CPUA 4AZBA 3MWAA 2CBTA 2WBJB 1JI2A 3W26A 3WLOA 3UBGA 3V0UA 4AE1A 3QPKA 1QLEB 5EUKB 3TNMB 2PGRA 1T3FB 1OCCB 1VF5C 2VLRE 4M8UA 4WI5A 5GGUA 1AUSL 4H1ZA 4XHJD 1WXZA 4LX4A 4ZMZA 4AYEC 4N2FA 2W81C 4XCNA 3RU8H 4EZKA 3RL1B 2HROA 1JR1A 2IPJA 2OPJA 1SF3A 1W17A 3QI9A 1JTOA 1OGSA 1YPZE 3P3UA 4GP5B 1VCGA 3V0GA 1AZCA 4K39A 4ZOEA 4Z0JA 3ZT6A 1F97A 4LQFH 1WH0A 4PRHB 2E6DA 3UCCA 1SUXA 3KYOA 2DLFH 4JFQB 1DQXA 4FYTA 2DQWA 3M5VA 3KGSA 4JQ3A 2QCGA 4QXUL 3Q1EA 2E6QA 3IDUA 4UDUB 5KVMC 3LEPA 1K1DA 5K3VA 1EMTL 4MZ1A 3AWOA 4X9IA 1GY2A 5BJTA 4JANB 5EORL 1HEHC 4EDWL 1CDJA 3GJEA 4AM0A 3GO1H 5KS9B 1E5CA 3KPOA 2K9UA 1O1ZA 3CQ0A 1W15A 3VXNA 2WMPB 4X7CC 1R3QA 1O6VA 3F03K 2QJGA 2FB2A 3LKOB 1HQ4B 2Q8BL 4QRRE 2NW2B 2TSBA 3MV11 3IFOA 4JRXB 5FAAA 3W9EA 4BA8A 4U1IB 1NKRA 4B50A 2B81A 3QFJD 1GS7A 5EN2A 1G94A 4HMNA 4MSSA 3AVEA 4FABL 1OEPA 3Q5TA 2NNAB 3FT3A 2YX0A 3FJ4A 4PMDA 3KAOA 1NC2A 4OF8A 1J8SA 3QCTL 1W32A 4JDTH 3TL5A 3KPQA 2CZFA 5E2UH 3W7RA 2Z1WA 3UXLA 5CUSL 1VB9A 1D7CA 5FHAL 4JFXA 3RM4A 2CKBA 3KTSA 1SU5A 5JOFB 3DN5A 2F15A 1R3HA 4PJDE 4ZG1A 3QY6A 1UEYA 5F9OL 3S2JA 1FORH 3MV9E 1XSKA 4US5A 1G9EA 3IN2A 2V17H 5BV7L 4PJIB 5TGBB 1NOUA 3BGJA 4J40A 1TTFA 1F58L 2BIHA 1G4RA 4KEUA 1SNRA 2FAUA 4UT6L 1MZHA 3UPRA 4YHOH 1S2UA 4PJ5B 1PKQE 2YXXA 1KIRA 5BW7A 4QXIA 5E2VL 2GOKA 2E68A 3WKNA 2HJFA 4BZ2L 5KYNA 1CL7H 2F1BA 4RISH 3GNNA 1UB6B 4WUIA 4RMUA 2VN5A 2BV9A 2PEVA 4HUNB 5C2XA 1CVRA 2YYTA 1F8TL 1A6UH 5TE7H 2YJLA 3QV7A 1Q9WA 2UVFA 4BKTC 5AOMA 3HC4H 4Q4IA 1MI5A 2PE4A 1TMHA 1T41A 4IOTA 1AHMA 4A8LA 3J7HA 1YAZA 1EZUA 4QYOB 3M47A 2CR0A 4G8EB 1EP2A 1YG9A 4K9JA 4MLIA 5EYWA 3L5IA 1RMFL 3JUYA 4PJCA 4M1CD 1BQCA 4KEZA 2W38A 4WY0F 1RJCA 1T6BX 3CQFA 3RB5A 3EPMA 3CVBA 5B1JC 4XPHH 1KM2A 1R3KB 1A6WL 2BHFA 2NY4B 4XZUA 3JXAA 2WYSA 5I3IA 4PH6A 4ZBCA 1TX2A 1ADQL 3PCYA 4HUCA 1PLCA 3C4UA 3FT1A 3D0VB 2I7OA 1HXMA 4JR5A 2VRJA 3ORWA 1H3TA 4WJ8A 4ZQMA 1ZS2A 1CI3M 3AMLA 1HGWA 1YEHL 5IMLA 1AO7A 3KLQA 2PP8A 4XVDA 1P5UC 2QVTA 1IIGA 3W7GA 2G60H 3G1VA 1KBPA 1S7UB 2XG4B 3TCXA 1E43A 3TFBA 1WUFA 5F2GA 4YDIH 3T3ME 3QNYB 3SPJA 3S9IA 4XVTL 5FWRA 1W3JA 4NSKB 1ET5A 3WUEA 4HZMA 2R1LA 4LQ1A 1UWEH 4HXBL 3CHSA 2WBJD 1WV2A 2GABA 3M07A 4TQPA 5AALA 2DZPA 1CU4L 5G4EA 3BUDA 3N44B 1BD2D 1SLWA 3T6WA 3GR8A 2LLGA 4Q6IA 4BYHA 2PDMA 1SEBB 1B2WL 1LWIA 3I6KB 3W3OA 1QR7A 1GYVA 1WOAA 3PWLB 3LTPA 3K2KA 3VWJA 4BGLA 2BERA 4J35A 4UTCA 5AW9B 4DK6A 1VJSA 4G1MB 3SDAB 3O3EB 1GTNA 4IJTA 4V2CB 5L8KB 2OCZA 4NC2B 5F4WA 3U2JA 3UDWC 5ICXB 2V7NB 1JZFA 3O6FA 3TVMA 2Y0FA 3MMUA 1RJLB 4B9YA 3QZAA 1W72L 4ZSOE 2FGWH 4OT7A 2LAAA 4R9XA 3TAKA 4UOJA 4LS1A 5C9WA 1UXLA 2CO6A 5DCBA 3FU6A 4U1HB 1A2YB 2NNAA 5DMNA 5GGUB 3OJ2C 1ZGLP 2K3TA 3CBRA 2B1HL 4BR1A 1X5ZA 4LCIH 4WI4A 2HBXA 3G5VA 4ZPTA 3W27A 5J5EA 5IVOA 1S2TA 2BY0A 3V0IA 4TVPD 1CCWB 4PUDA 4I89A 1SN5A 5JQ6L 3RN6A 5I8CB 2E7LC 3W87A 1AAJA 2K6WA 2PURA 5DMLA 1TG8A 1BW8A 3OKDA 2PP1A 4J4PD 1F3JA 1A3HA 2GL5A 1BECA 3RPBA 2P5NA 5FFOA 1NLBL 2YAPA 3KS0H 3NACL 2A77L 2DIJA 5E6UB 1B1YA 5DEJA 2FJUB 3N3EA 5E03A 4EI5A 3I6EA 1QNSA 2YSTA 5K9CA 1UG9A 1IEBA 5AYQA 3X12A 2CZVA 4RJEA 3VZZA 3L81A 4MUPA 1LO2L 3MV7A 4L4MA 2ZX8A 3LMJL 4FP8L 4F2BA 2D0HA 2NW2A 4CDGC 3WF3A 3ARBB 1TWIA 5DR5H 1MWAH 3OR7A 4W4QA 3SCMB 4U6HB 2DQHL 3ARGD 4MQXC 3LDBB 4XAPA 3QI9B 3IPBA 3WHE0 1F3WA 1QNZH 5JW4N 3KPNA 1HP5A 4AX6A 1NAML 3Q06A 1WDWA 4HWBH 3G0XA 1IGTA 4HSCX 4I0CC 4X9BA 4N2GA 1MIML 2IKGA 1NDTA 4OTXH 3M1ZA 5AVYB 2FBRA 3QJOA 2Y5TB 3G2GA 3W1AA 3CHOA 3SQBB 3E9AA 4AYMC 4Q89A 2L04A 3SUUA 2H3NA 3VTRA 2H0EA 4EIBA 3GKWH 3N17A 2VXVL 3WFEL 3X14A 1XF0A 4TUJA 5LHDA 3M0MA 3KXFD 1FSKC 2GFBB 5E2TH 3WAKA 1PZ1A 2A83A 1F6FB 1HAWA 1XLIA 1FZMA 4JTUA 1I7RA 4AMAA 3KPLB 1ERNA 1DBKL 4YGVA 4AD3A 4LSPH 3FTWA 3QIBA 2MHAB 3H9SD 3HG1B 3L3HB 2X38A 4ZK8A 5KSBA 1FLTX 1J8KA 1UM4L 5G4NA 1D2KA 2PTWA 2X4NA 3UY8A 2GJZA 5E0CA 1DFBH 2AEIT 4LDOB 4I7ZC 1W91A 2X0VA 3D6GA 2D4DA 1P7KA 4FI7A 1JHKL 3S8GB 4JDZB 5L88L 4NJAL 2PF0A 4D7PA 4Y16B 3ZKMD 4NZFA 1T21B 5TDNA 2E28A 1ZXQA 3DURB 4JFED 2DRUA 3UTSA 1OE1A 4U1SB 3NNTA 1EDGA 5HINA 3DECA 4R2GC 2CKBB 3R0NA 2WHMA 3S3BB 3R0DA 4NUWA 2W07A 4EAYA 1ZJHA 2XETA 2PLMA 5DMMA 1YXDA 2X1RA 1DJXA 2X9YA 3IT8D 2KQMA 3P69A 3Q2CA 5FW6A 4H8PA 1MJ7H 1AHWB 1EXGA 1OX6A 1OAYL 2ROXA 3D7PA 3VVGA 1WS7A 1TNNA 3LPFA 1EIXA 1EDTA 1F45A 2BW4A 2WWOA 3A9IA 1FFNB 3SYQA 3SKOA 3EWDA 2PUQT 3H2QA 3SUTA 5EUOB 1B0IA 4GQ9L 5GZNA 2D2GA 4JHAH 2W62A 4D94A 4YZFE 3H24A 3IJYB 1BZOA 2ZOLB 4PJHF 3MV9D 5GRUH 3S5NA 3SDDB 3ROOB 5CCGE 3L1OL 1OF8A 4UTJA 4AX7A 1SO5A 2J7BA 3LN9A 4EQ3A 1L3NA 4RDBA 4G8TA 4K36A 1AE6L 2OMYA 2Y23A 1ZLSL 3WN5B 4TRPL 2ZTKA 4ZUUA 5T3XL 2OCJA 4EN2A 2IQTA 1N4XL 1WS8A 3HAEH 3HPJA 3E49A 3MNZA 5FUOH 3WNNA 4PW4A 1MELA 3T0EB 4P59H 4PMRA 4S3EA 1Y18B 4I3RH 4X80H 5IJVB 4LBEA 1U3ZA 5L7XH 3MANA 3HI1B 3WTWA 5LAXA 1U5VA 2E7LA 3GGWB 4XNMA 3DI1A 3AW5A 3DHUA 5A8GA 4I2XA 3MRCA 1XZWA 4M7KL 5ADOH 1FWFC 1Q6CA 3IJHB 5C2GA 4L2YA 2GI0A 3IGKA 5CG0A 4JTKA 4FN0A 3QZLA 4AL8H 5KSAC 2Q76A 2OKTA 4ANWA 5ABEA 1AODA 1F1DA 3I9GL 4M1DL 1E1EA 1U3JA 1R19A 2ZX7A 3QRGL 3UR2A 4FA3A 2ICWI 4YBLB 1KTJA 2PUZA 2XFGB 3FL7A 4RBPK 4LSTL 4U0RB 4RDWA 2CNZA 4Z78A 1W1YA 2P3EA 2Y72A 1U8KB 3TTQA 2D03L 4U1JB 1IF2A 4AVOA 4QG6A 2LAGB 3EJYC 5I0VA 2BVPB 3ULSA 1OCBA 3O8AA 1MQKL 5DD1L 4IRJA 2CNCA 2UY5A 2QDGA 4X7FC 5A8OA 4EI5D 2OM5A 3WLPA 3GDBA 3L3IB 4JPVH 2OXHA 1G5GA 4PJEA 1ESWA 3GG7A 2FFIA 1KB3A 3E0LA 1YCSA 1BKSA 1LRQA 2OEKA 3JV0A 3MXWL 1W0WA 1KJVB 1LK2B 1WICA 5EIVA 4N0UB 1VBRA 1HHIB 1S7XB 3GNMH 3ANYA 2C14A 3OXSB 1TELA 5DVOA 1U95B 4JM2C 3RBSA 3NPSB 4ABVA 3VD1A 5GIRB 3ONCA 2K8QA 3N9SA 1J1PH 3NGBB 4I18A 2Y9RT 4WWID 4TL5A 2AVGA 1XKYA 1L6XA 3QK0A 1P4IL 5J3HD 2MHAA 3BDXA 3HG1A 3L3HA 4TSAL 5H37G 4JQIL 3RI5F 4N42A 1H41A 2R0WH 3BQUC 3PXJA 4GYPC 4GKSA 2YZ8A 4HGMA 3KEDA 3GMRA 3HC3L 1ZT4A 5AC8A 1I7ZB 2OSLA 3NURA 1WDQA 3X13A 4Y2WA 3WQ6A 1PEZA 4AVKA 1YTEA 2TODA 5TQ0H 3PUEA 2FEDD 3ILQD 4QJ1A 2VLJA 4RNIA 4UU9B 5F4XA 4NHVA 3QIUD 2P8MA 4TX9A 2FH8A 3NCYS 2EEAA 1HSBA 2YD9A 3IDMB 2YZ5A 3BWSA 3L9RA 4ICXA 4GVHA 4EX4A 1CK0H 2CWXA 2CHOA 5I17A 3LD5A 2BOCB 3LNIA 2OTUA 2CPUA 3E02A 3I7RA 5G2HA 2REQB 2HVNA 3EBVA 4TQTA 5T91A 3L48A 3OC5A 1UP2A 4IIFA 4QS6A 3UIZA 1OM3L 4OCXH 4NDMA 5E6SB 2ZXDA 2EPKX 1MJ8H 4Q6YA 5J1SC 1XIHA 2Q8ZA 4UR7A 1ZGDA 3ATZA 5HJLA 4AL8C 4FF7A 1JRBA 5B39A 4QLRA 5IQ7H 2E76C 2OR7A 2IMNA 3TXAA 1FFPA 4PUEA 3D39E 3QIUA 3MTRA 1N59A 4B7LA 1TSRA 2OYMA 1W9VA 4L8BB 4ES8A 1HOCB 3HFMH 4G8GA 4XNZC 5TQ2L 3V6OE 1FC1A 4FTVA 4PLNC 2GUBA 2VVSA 2YLLA 3C08L 5E70A 5AG8A 3N2BA 1VFBB 1EAJA 3V55A 3C5SA 1EUTA 3LS5L 3TLQA 4PRDA 1KLGA 5T3XE 3I9AA 1KACB 4LP8A 5E1AA 1Z3NA 3BUVA 5D4JA 5TF1H 1M7JA 3E6EA 2QMJA 4B3ZA 4HMDA 1EA0A 3QAZB 3K72B 1P7TB 2J8UB 5HPMB 2H8ZA 1A6TB 1WE5A 3FH8A 4AW7A 1WAWA 4O4WA 2XZQL 3QQWA 1CDHA 4OD1L 4HJ1A 2KC0A 3EFFB 3QIWC 3DIDA 3FU3A 1BVOA 1HQTA 3LMZA 4TUOA 2ZCKH 1T83A 1ZHKB 1JCLA 4XWGL 5KN5A 1TVHB 4FG6D 2OFJA 1QFWL 1HUVA 3RU8L 5KANG 5EH1A 3AMDA 1TMQA 4GG6B 1J11A 2VKZG 1RZ8A 1YEDB 3GRWH 4TQ8A 4TTDD 4S2CA 1EJTC 3VPLA 3PTKA 3B0UX 2GYSA 3VXOB 5CO1A 1GW0A 1FVDA 3FU9A 4QRNA 4YIWA 4ACPA 3U0WH 5K9QG 1FJ1B 2H0PA 1AGDB 3N13A 3WLJA 2YPLD 1AI1H 1HNYA 1J48A 2B9BA 4S1DD 5DFTA 1P84J 3L13A 2BSTA 3NZRA 3K1DA 3DX7B 3W9DA 3WKYA 3F7YA 4QHLA 2DZBA 2R23A 2IJ0C 4QHUB 3G5XB 1IM9A 4MLSA 4MYWB 1H6UA 1T83C 5C0AE 5C8JA 3HOJA 5AZ0A 2E9JA 5KOMC 1HJWA 4G11A 2INEA 2ENQA 3CH1A 1DQWA 1JEZA 4EZLA 2Y6SD 3OJMB 5IT2H 3MRCB 3WD5H 2X9WA 1DDHA 3PBVA 4YCOA 1IBYA 2I69A 5DZJA 4X6CA 5DZ9A 4IDLA 1DTNA 1FN4A 4N28A 1IGYB 1QG3A 5C0RL 2ALDA 5FUCE 4PJ8A 1HQRB 1PL3A 4H5SB 3O8XB 4AD5A 3WHXA 3IUHA 2ESVA 5IBTH 1TFVA 4HIBA 3BAWA 2X1WL 3QTGA 2DWXA 4G9FD 4ODVH 1CO1A 2JF7A 3QCTH 4WWKC 1ALDA 2OX1A 4U1JA 4X7EC 4NZUH 1H62A 5LA1A 4NQSA 5F7FA 4L23A 1SGKA 3MV9B 2DQDH 3LXBA 3SGEH 3WG7B 5I0WA 1U2YA 5DCCA 4ZX6A 2H47C 3L9RB 1H15B 4DEPB 4HSNA 3D3VD 4URKA 1KXTB 4B3KA 3PWJA 4FQIH 1X9QA 3EYQC 4AIEA 2V33A 3UA4A 2ZQ0A 4HJEA 4MB5A 1Z69A 1DJYA 1URLA 1W8EA 1UR3M 1S46A 3IFPB 3IJHA 3GK8H 3X11B 4YLQT 1MQQA 2PODA 5J57B 2XG9A 5E2VH 1YYMH 3VFCA 1ZLEA 2D7MA 2XWZA 4HX1A 2HFGH 2Y5EA 1XIWB 1TA3B 4F24A 3WAJA 3MBWB 2WJ5A 1FH8A 4GY7A 3I02B 3WBEA 3P8JA 4FQCL 4L3CA 3PZTA 2I56A 3DI2B 3U1SL 2HFTA 1FAKT 1YEIL 5EO1B 1Q9KB 2DW5A 4JAMA 3PWPD 2YD5A 3ROOA 2HSIA 1LL1A 2E67A 3ES8A 3ESPA 2VRKA 1OIFA 1EVTC 3KLDA 3RRAA 3KBPA 3ZBMA 4NKDB 5LAPA 4JFOA 4R26L 1ETJA 4O15A 1CFMA 2W88A 2GITA 4JL2A 5BZDB 1YADA 2VWEC 3PUUA 2EXWD 4JG0L 4P5TC 3OA3A 3FRUA 4Q2ZB 4YSEA 1Y18A 3ARVA 7TAAA 2CWNA 1J8HE 3O0RH 1OAXL 1GY1A 3FTZA 4PV9B 4FFZL 1I3RB 4NPYB 3BCFA 3PQYD 4QHKJ 4U7KA 1YMHB 2EDOA 2OQJB 2AEPL 3MO1A 1E9ZB 1D5RA 3B8VA 2Z7UA 2OJEB 4PFHA 5DR5L 3PBMA 1EBAA 1DVFD