1WZAA

Crystal structure of alpha-amylase from h.orenii
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
488
structure length
488
Chain Sequence
FEKHGTYYEIFVRSFYDSDGDGIGDLKGIIEKLDYLNDGDPETIADLGVNGIWLMPIFKSPSYHGYDVTDYYKINPDYGTLEDFHKLVEAAHQRGIKVIIDLPINHTSERHPWFLKASRDKNSEYRDYYVWAGPDTDTKETKLDGGRVWHYSPTGMYYGYFWSGMPDLNYNNPEVQEKVIGIAKYWLKQGVDGFRLDGAMHIFPPAQYDKNFTWWEKFRQEIEEVKPVYLVGEVWDISETVAPYFKYGFDSTFNFKLAEAVIATAKAGFPFGFNKKAKHIYGVYDREVGFGNYIDAPFLTNHDQNRILDQLGQDRNKARVAASIYLTLPGNPFIYYGEEIGMRGQGPHEVIREPFQWYNGSGEGETYWEPAMYNDGFTSVEQEEKNLDSLLNHYRRLIHFRNENPVFYTGKIEIINGGLNVVAFRRYNDKRDLYVYHNLVNRPVKIKVASGNWTLLFNSGDKEITPVEDNNKLMYTIPAYTTIVLEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords alpha-amylase A
publication title Crystal structure of AmyA lacks acidic surface and provide insights into protein stability at poly-extreme condition.
pubmed doi rcsb
source organism Halothermothrix orenii
total genus 170
structure length 488
sequence length 488
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2005-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1wzaA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1wzaA01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 1wzaA02
1NWTA 2PWGA 4AYSA 2XUCA 3D4ZA 4KWUA 2J8GA 4HZ7A 2GFTA 3WD0A 3AHVA 3MS8A 4E4PA 4WJXA 2DIJA 4YHGA 1HKIA 2DSZA 4U2YA 5A8QA 1H5VA 1I1WA 3NSXA 1BLIA 4AZ7A 3GXDA 4JCLA 4AISA 1LJYA 1FP9A 3TTOA 2J62A 3N1AA 5JUVA 3WNOA 3PZNA 1UQZA 3MMUA 3W0KA 2WC4A 4JIEA 4PMDA 3WH6A 3WUGA 3WH9A 1UR4A 3D51A 1PS3A 1BYDA 4W7WA 5IFTA 1D3CA 3GXIA 2GJXA 1KGUA 2W67A 3WY4A 5ABFB 1EQCA 1VBRA 3QOMA 2VZUA 3WMCA 5HNNA 1UKSA 3WH7A 1QHOA 1B3YA 3VX1A 3CPUA 1GOOA 2OYKA 5DEZA 1LLOA 2XWEA 4F66A 1DWIM 3A6OA 1E43A 1WZAA 1J0ZA 3VSTA 2RGLA 4UOZA 5EFFA 3UCQA 2OSYA 1M03A 1GONA 1V08A 2OWXA 1EHAA 3VIJA 1J0IA 4PUEA 1JDDA 2WMJA 3THCA 4ZFMA 4OBSA 1E0VA 2ZUTA 3S5ZA 4IPNB 1HL8A 1I1XA 1UD3A 2D24A 1GOMA 3MUZ1 1VJZA 2VZVA 2VQTA 4WKFA 1BQCA 4E2OA 3VVGA 2D0FA 3NUKA 3RCNA 2AMGA 4EAMA 1J9YA 1RP8A 4U33A 2QPUA 5IHRA 1QW9A 3BAXA 4BCEA 5D8ZA 2YA2A 3CH9A 3CZSA 1W91A 1QVBA 3HN3A 4AEEA 3I3DA 1UH3A 2JF6A 4MJ2A 5I24A 2Z1SA 3EJQA 2GVYA 3N15A 4YN5A 3JUGA 1MW1A 4H2CA 4R5EA 3SCSA 4B16A 3OZOA 4UOJA 2EAEA 1PZ3A 1B0IA 3TTQA 4GIAA 1U2YA 1B1YA 4GZJA 2GDVA 2DT0A 1NARA 3BVUA 2XN2A 2OW6A 3OIHA 2WLZA 3MUAA 4PMRA 2G41A 4DUXA 4MNJA 2V3EA 3AXHA 2BY0A 1ZB5A 2F18A 1CGXA 3DX3A 5A1AA 3LPPA 4MNKA 3WNPA 1KCLA 3DX4A 3VPLA 4XZBA 2ZUSA 3A22A 4D6CA 2E40A 3AIQA 5BYWA 4PUDA 1H49A 1NQ6A 2WVVB 4JFVA 1ODZA 2VVSA 4ML4A 4AD1A 1IZJA 3FHQA 4HP5A 3OG2A 1E5NA 4D6IA 3AXIA 1GQJA 1OM0A 2XHYA 4B9ZA 2X2YA 3DDFA 4CN6A 3F5KA 1KGXA 3BCFA 4QCFA 3QHMA 1UWUA 4DO4A 4BZYA 3VIKA 4BA0A 2CESA 1WCGA 4MNMA 1UKTA 1MQPA 4C7FA 2YDRA 4B9YA 3WQ4A 1B2YA 1JNEA 3K4DA 2J7EA 2EQDA 4GI6A 4ACZA 2BY2A 2J77A 1LQ0A 3TV8A 4FLQA 2VNCA 3GBDA 1JXKA 1G5AA 1U30A 3UESA 3SCPA 1E40A 1CLVA 1TQTA 1NP2A 4IPLA 1Z32X 2DPEA 1CWYA 1XCWA 2WCAA 5FIPA 1E71M 1KR0A 2O92A 1QI5A 4JFTA 4NXSA 1QNRA 5A95A 3VMPA 1LG1A 1TG7A 1UKPA 2WZIA 1QHPA 3W24A 3I3EA 1GORA 2EJ1A 4FLOA 1CXHA 3O9NA 1Q6EA 1TQUA 5A6AA 1FFRA 3D50A 4UQBA 4P8UA 3K8LA 5A6JA 4H8HA 4KGJA 3WSUA 1UR0A 2DH2A 1CGWA 1WDSA 4BS0A 4DM1A 3WENA 3VMNA 1OINA 1CXIA 1NH6A 2OLHA 1W3JA 3ALGA 1W1PA 2GSJA 2WAGA 1ESWA 4MADA 4W84A 3KL3A 2X2IA 3DYPA 4UZUA 3RIKA 1C91A 4W89A 1SMAA 2A3CA 2WLYA 4JL1A 2QPSA 3MU7A 1JZ7A 3VGEA 2WB5A 2DSWA 2Q8XA 4EANA 2WKLA 4NX0A 3WDPP 3PTKA 4J7RA 1W9UA 4U3CA 2XM1A 1WZLA 2E4TA 2BVDA 1CGVA 1MQRA 2VX4A 5HBFA 1BFNA 3W82A 3VUPA 4PMVA 2YBTA 3VKKA 3KWXA 5FKYA 1KWKA 4AW7A 5CJ5A 2J75A 5ABEA 3LPOA 3ZSSA 4GINA 4A3HA 1V6UA 1DTUA 2XFYA 2ZX8A 3T0BA 2EPKX 3HG4A 3A5VA 2NT1A 3A24A 2J47A 3ZJ6A 4J3XA 3H55A 1JD7A 1T0OA 2VCAA 1NWSA 4WKHA 3NDZA 3ZJ7A 4HA3A 2HISA 2DT2A 3E1F1 1W2PA 1EHNA 1AVAA 1TFVA 5FD0A 3VMOA 2QF8A 5CSYA 1CIUA 4AIOA 3SCUA 3OA5A 4P7LA 5EB8A 2WANA 3GH7A 3T0AA 4MB5A 4W93A 1HJUA 1BYBA 2XPKA 1SR0A 2UY3A 1NOUA 2G4FA 3VNZA 1GJWA 3AIWA 5LA2A 4H7VA 5DFAA 1BYAA 4FNTA 1V02E 2ZXAA 4QDMA 6TAAA 1V0MA 1JYVA 5A6SA 3WDJA 3OLDA 2YFOA 1WDRA 4HA1A 2QLYA 1JFHA 1QWUA 1TR1A 1QI0A 3LRKA 4AMWA 1YHTA 4BQ4A 5CQ1A 4H8UA 3UG4A 5CZKA 4AWEA 1EOMA 2D22A 2Y5EA 1CXLA 1VFMA 4AZBA 3BUPA 4OGZA 2E0PA 2YIHA 3SEPA 4KH2A 5BXTA 3WQ5A 1QNQA 2ZXQA 4F79A 3W26A 2DEPA 3A47A 1JZ6A 3BSHA 1ODUA 3SCTA 1V3HA 2X0YA 3WBAA 2GJRA 3DYOA 2W91A 1ECEA 2X09A 4LYRA 4B3KA 3B9EA 2F61A 3LXAA 4AD2A 1UD6A 5JBEA 1HKKA 3VM7A 3MSDA 2IUZA 1QHZA 3EJRA 4FMVA 1WAWA 2VUYA 3GH5A 1EO5A 1GOIA 3CUGA 3WUBA 2E9BA 2VX5A 3AS1A 4UFIA 3EDFA 4Z2GA 3T2OA 1JF5A 2W92A 1V6WA 1PZ2A 1QNOA 1B30A 5D9NA 4AD5A 5HDRA 1ZBWA 1HX0A 4LGXA 3WNMA 3WDQA 2CBJA 1C92A 3GDBA 4NSBA 1XSJA 1QI3A 1TQVA 1E4LA 4PBGA 9CGTA 4KGLA 1B3WA 4LXFA 3CHEA 1EDTA 1W3LA 1PAMA 1U33A 1JDCA 1JFXA 1OIFA 2F8QA 1WDPA 1FP8A 3WF0A 5BXPA 1LG2A 2EADA 1XGZA 1FFQA 1W3KA 3AZRA 4QLLA 4HTYA 1JZ8A 1CTNA 3IAQA 3ZR5A 4P8WA 3WMSA 2WHKA 3AIRA 3DX2A 1F4AA 2VJXA 5E09A 1KFWA 1W1TA 2FGLA 1J0YA 3W81A 2OSXA 4UFKA 4DWSA 4YPJA 4ZE5A 2CKRA 3UG5A 3L4ZA 5ABFA 4ATWA 2W62A 3LXCA 3CLWA 2JIEA 2J7BA 2W61A 2J74A 1MW0A 3CV5A 2OW7A 2WPGA 3L4TA 4DUWA 1HXJA 2ZICA 1HF6A 1S46A 3OLGA 2X2HA 3MMDA 3SCNA 1XCXA 2WWCA 1HNYA 3CMJA 1VFOA 1CDGA 3VIFA 1ZBCA 1WB0A 3KEHA 2YL8A 1Y7VA 1G94A 1V6YA 4H41A 1M7XA 3ARTA 2PI6A 5AC5A 1WO2A 4PYSA 1E73M 1KXTA 3AHXA 4LYPA 4NZCA 1HJXA 5DO8A 1UD2A 1K6AA 3VOCA 2XJ7A 1R34A 1GNXA 1W9PA 1FOBA 3EDEA 3VD7A 3KE0A 5HPOA 1B31A 2CBVA 1GPFA 4P7QA 3OGVA 4DWSB 3AIBA 3ZJKA 4F9DA 1D2KA 4TVDA 1CLXA 3G6LA 3WEOA 1G01A 2C8NA 1EGZA 3RILA 3WY3A 4U5KA 2FH8A 3AS3A 4UQDA 1J0HA 3MSGA 1OT2A 1G9HA 3AS0A 1O6IA 1XH0A 2BHUA 2VCCA 2F2HA 1TVNA 5CG0A 4E8CA 5LYRA 2ZE0A 3TA9A 2JALA 2PBOA 1QNSA 5AY7A 3O2LA 1CXFA 3BAWA 1ZBVA 4J28A 1VBUA 3AMDA 4NZJA 3IJ7A 1M53A 3GM8A 3RM4A 3ZM8A 1UKOA 2VT0A 4BF7A 1UZ1A 4ZEPA 2WCGA 3K8KA 4TOQA 5GNXA 1XV8A 2YJQA 1UWSA 4XZWA 4QLJA 1GOKA 3ZOAA 3GTNA 4R27A 1JAEA 2XVLA 4TVUA 1NP0A 2WHJA 3WELA 3NCOA 2ZIDA 1D7FA 2E8ZA 1TZ7A 2VRJA 2C7FA 3IK2A 2G3IA 3ARRA 2F7PA 3ZJ8A 3NIYA 3VIHA 3H54A 5FCZA 1MWOA 4M80A 3W25A 2VVNA 3DX1A 3WDIA 5C70A 4RE4A 3ALFA 2ESCA 3BVTA 4D1JA 4DWSD 4WF7A 2V3DA 3FY1A 3WNLA 2ZWZA 4P7RA 2WVVA 1UA3A 4P7OA 3I3BA 4X0VA 5C8BB 5DF0A 3PZUA 1GW1A 3VILA 2ALWA 1CEOA 1EXPA 1J01A 3AXXA 5BRQA 3QOKA 3W27A 1FH9A 2XN1A 1M04A 3F4VA 3D3AA 1JNDA 4WLCA 4X0NA 1K9FA 3QHOA 4JKKA 2D73A 3KLKA 3J7HA 5BWFA 5CSUA 1UOKA 1CGTA 1VIWA 4UCFA 1JF6A 5CGTA 3ZR6A 3L2MA 2XFFA 1IT0A 3SCVA 5KEZA 5JBDA 1KGWA 5JIWA 3BLBA 1OGBA 2O9RA 3LXBA 2J4GA 2YDSA 4OZOA 2EPNA 3AHYA 2WMFA 1BHGA 1Q4NX 3NDYA 4WSKA 3WN6A 1JZ3A 1B9ZA 1R87A 4HOXA 3T08A 2WZEA 3TTSA 2UY2A 3S6TA 1GQKA 5JBFA 5HXMA 2VRQA 2O9TA 1FH8A 1LL7A 1JGIA 1BGAA 1WZKA 4ZXLA 3WNKA 3GH4A 3SCOA 5A6BA 3VD5A 1HTYA 3ZT5A 3OLIA 3A4AA 1UWQA 1CXEA 2X0HA 5D4YA 5A2BA 3BVWA 2TAAA 4AZCB 1XC6A 4AMCA 5E9AA 2CPUA 3FHAA 1XH1A 1VF8A 3WQ6A 1E3XA 4FF5A 1E1FA 3HG5A 3ARVA 2XVKA 4FNSA 1W9DM 2XIIA 4PCTA 4HOZA 2EPOA 1FA2A 3WH5A 4KMQA 2DT3A 3AMGA 3CUIA 2XTKA 3W29A 1DWGM 1HJWA 3CUFA 2NT0A 2X2JA 3KLLA 5A6LA 2VI0A 3NJ3A 2D3LA 1PEZA 3K1DA 3RJXA 3A4WA 4D6GA 5M03A 1CXKA 2BVTA 3M7SA 5FL1A 1ITCA 3THDA 5TD4A 1OGGA 4AD4A 1JL8A 3ARSA 1EDQA 1ISVA 4PMUA 1V0KA 4PMYA 1Q6GA 2PB1A 1B90A 4TUFA 2WHLA 3MV01 1HVXA 1QW8A 4QFUA 1H41A 4OIFA 2GK1B 1E4MM 3EJUA 2XVPA 3FXYA 3EMZA 1CNVA 4MJ4A 3VIIA 2YFNA 2F1AA 3WNNA 4Y7EA 3VGDA 1LWJA 1WNOA 4XV0A 4NF7A 3CZEA 3D52A 4GI8A 4J3TA 1TE1A 4GPNA 1EQPA 4W8AA 4MB3A 3EJPA 3EMQA 3MI6A 4GO9A 4PMZA 4GKLA 3OGSA 3WUEA 3VD4A 3K8MA 4HA4A 3PBGA 2Y24A 3WIJA 1LF1A 4V2XA 4GXPA 4RE2A 1NWUA 1WDQA 2WSKA 3O6AA 4NI3A 4XUYA 3SCQA 2IGTA 1E0WA 1KXHA 4IM4A 3CZ8A 1K9TA 3PZIA 4FK9A 4Z2HA 1KBBA 3N13A 1ISXA 3RM8A 4EKJA 3AISA 4MPKA 3WF3A 1IV8A 3VTRA 4JKLA 2YLLA 3VX0A 2WC7A 2W5FA 3AROA 1E6XM 4QCEA 1KR1A 3HMCA 4JFWA 2E8YA 3WEMA 1FHDA 4JKMA 4MAVA 3VDCA 1OWQA 1V3IA 1ZL1A 3HU7A 2BY3A 3SCRA 3CZGA 3BAKA 2EPMX 2YA1A 2J7DA 4AY1A 1JYXA 3GXPA 1VRXA 4J3UA 2EO7A 1FH7A 4DO5A 1GHSA 2J25A 4HOWA 2CBUA 1CENA 3ZO9A 4PTMA 2XFRA 4D6FA 5KZ6A 4YHEA 1GHRA 4MDPA 1L8NA 2CCRA 1J12A 4NXKA 5CLTA 4UQAA 4D6JA 4PMXA 1G0CA 1J18A 4URIA 3AIUA 1XH2A 1KBKA 4N42A 1PIFA 4FNUA 1W1VA 3M07A 2BFGA 5M3WA 1UH2A 1UHVA 3PZVA 1MXGA 3GNOA 5LA1A 1E4NA 2FYVA 3II1A 1E5JA 1LWHA 1HJVA 4OUEA 4WK9A 4A4AA 4Z2KA 1OD0A 4D6HA 1R7OA 3MANA 3BSGA 4F9JA 3L2LA 1SMDA 4RL3A 5AYBA 2CIPA 3UG3A 4D72A 2GUYA 3PZMA 3VO0A 2FH6A 2IXVA 1JDAA 2EEXA 2VR5A 4J27A 3KZSA 1X6LA 1V3MA 1JI2A 1QBAA 4W5ZA 3DDGA 3EMCA 4L4PA 2BV9A 2PF0A 1HXKA 4UQEA 4S3JA 3DHPA 4TX8A 4W87A 3WH8A 4ZXOA 2A3AA 2W63A 4WSJA 1VAHA 2QMJA 1C7SA 1UD8A 3AZTA 1VFFA 1C90A 4AD3A 1J0JA 1HIZA 7A3HA 3DC0A 2DT1A 4JFSA 4CVWA 2XIBA 1DWAM 2YL5A 1V3JA 1DEDA 3WBEA 2FHCA 1RP9A 3PZ9A 1OSEA 1Q6DA 2UY5A 2J8FA 2EBNA 4UTFA 2OWCA 3BAYA 1E1EA 1E70M 1G1YA 3UR8A 1BG4A 3N12A 4M8UA 1DP0A 1UASA 3RO8A 1UR8A 3SUSA 3POHA 4W7UA 3LMYA 3CZKA 1OB0A 4D6DA 3GXNA 2VCBA 2YBUA 3S5YA 3BUDA 3CHDA 2ZX5A 1JI1A 4W85A 3ZMRA 4HZ6A 4A3YA 3U5UA 4PMQA 3FAXA 3PZOA 1W9VA 4JFUA 1ZJBA 4XB3A 2VL4A 2XGIA 1DWFM 1GVYA 5EBAA 3BCDA 3N9KA 2ZWYA 3ZIZA 3LRMA 3IGUA 1JYNA 3LRLA 1V02A 3WD1A 1E6SM 1TMQA 4AZ6A 1UWTA 1W32A 5I78A 3VU2A 4CCDA 3GXFA 4PRWA 1E6QM 2WVSA 2D0HA 2WK2A 3AMCA 2VO5A 4HPGA 2VQUA 1C8XA 5DT7A 1MW3A 2BS9A 4V28A 2WSPA 3N11A 3OLEA 3AYSA 2VC9A 3D4YA 2ZOXA 1QNPA 4OOUA 3BXWA 2D0GA 1ZU8A 4AYGA 2ZUMA 2WMHA 3BUIA 1ZBKA 2XM2A 4KRTA 5IDIA 5A69A 4FLSA 2J7GA 3SUWA 3CMGA 3AICA 3BLKA 2VX6A 4PMNA 3EBVA 1UG6A 4B3LA 4CN1A 3W53A 4ATLA 5A8NA 4NRRA 3SUTA 3CUHA 4LQ1A 4QP0A 4W7VA 4ACYA 1A47A 1ISWA 1E15A 1H09A 1W9XA 5GPRA 2V38A 2F1BA 3CHFA 3W37A 1V0LA 3AHTA 4CKQA 2VMFA 2WHMA 1QOXA 4UFJA 2ZUVA 2CYGA 3UETA 3ZSTA 3DECA 3OBAA 2O9OA 4PTXA 2XSBA 1XRVA 1B3ZA 1WZMA 3HZ3A 1J0KA 1J10A 5I3DA 1UZ4A 4U2ZA 4DO6A 4S3KA 5HPCA 4PMOA 5AYIA 5BRPA 3WQVA 4AZHA 5EMYA 4PN2A 4FNPA 2VZOA 2D23A 3VINA 4CD6A 1PJ9A 2W66A 3GBEA 2VZSA 1IZKA 1JZ4A 4Z2LA 4GI9A 1RPKA 4MB4A 1QBBA 5A2AA 1AQHA 2WMGA 1TCMA 4CD5A 5BROA 1KCKA 3NSNA 2ZUUA 3ARQA 3BLPX 4M82A 1R8LA 5D9OA 4FNRA 2EXOA 3K4AA 4GQRA 3FNDA 3CC1A 1NOWA 4OBRA 5GQBA 2UWFA 1UQYA 3HG2A 1C93A 1KQZA 3BH4A 4LX4A 4DM2A 1W1YA 4UR9A 5C71A 4HMCA 3MUIA 1OD8A 4FLRA 2F7QA 1N82A 5A6KA 1H2JA 2ZXDA 1MQQA 1YQ2A 1WE5A 2JE8A 3N04A 3FN9A 4OKDA 2J78A 2FE0A 3SUVA 3A21A 1BYCA 2WVTA 2X8RA 1TA3A 1BF2A 4CU6A 1X1NA 1O7AA 4GZIA 5D8WA 1GQIA 1A3HA 3MMWA 1JYWA 3L4YA 5CXPA 2PWHA 2Y2WA 3BUQA 5A8OA 3CGTA 2NW0A 3QHNA 1NOFA 1HJSA 3AQUA 1VENA 3IJ8A 5E1QA 5EFDA 3T09A 3M46A 1CPUA 2WMKA 1R47A 2DIEA 2VTFA 3BVXA 3UEQA 3PN8A 3W6LA 4AC1X 4PCSA 2YL9A 2F7RA 3WL1A 3VIPA 2PWEA 4N0RA 4MNLA 3NYDA 1LL6A 2PWDA 4HPHA 1VB9A 4XX6A 2E9MA 1UR9A 1HT6A 2G3MA 2V5DA 4V27A 3BMVA 3H53A 5E0CA 1MYRA 2YKKA 2YLAA 5CPTA 3W38A 4TXEA 2XGBA 1BAGA 3BAIA 5A6MA 1UR1A 1W3HA 4UQ9A 2WBGA 1OIMA 2J79A 3AS2A 4CN4A 4M24A 4CCCA 3OGRA 1KTBA 3CBWA 4J3WA 5E70A 4JAWA 2EABA 2PC8A 1TA3B 4PTVA 3ARUA 2PWFA 1E6RA 3WY2A 4JHZA 4U31A 4AMXA 4K68A 5CPSA 4AZCA 2WBKA 1H3GA 5DMYA 2CEQA 3WFZA 2BHZA 1Q6CA 3N18A 2XWDA 1HN1A 3MUY1 3AFBA 4EK7A 2ZXBA 3GXMA 2FHBA 4GQQA 2V5CA 1O7DC 3CO4A 1WP6A 3AIVA 6A3HA 3L4WA 5LA0A 4QLKA 3W28A 2WXDM 1EH9A 7TAAA 5I23A 3AMKA 2GJXB 1XHGA 5DT5A 4CU7A 3CIVA 4Z2IA 2CERA 1UWRA 4WKAA 5M17A 1BTCA 4UFMA 3EDJA 2G3JA 4BQ5A 1V6VA 3B8SA 1I75A 1C8YA 4F8XA 2O9PA 3GXTA 1UR2A 3AYRA 3AMLA 5BXSA 2C0HA 5GNZA 3ZQ9A 1WPCA 1B3XA 3EJSA 4WIWA 1TQWA 1AQMA 1BG9A 3TOPA 2JFEX 2BXZA 4D6EA 4AZ5A 4AXNA 1EA9C 1OCQA 1H0GA 4CU8A 2CXGA 2BY1A 3BUBA 1R86A 3KL0A 1EIBA 3DHUA 4P7NA 3VSUA 1PX4A 3QGVA 2GK1A 2XYLA 3T2QA 3OB8A 3MKKA 5IHSA 2QHAA 1QPKA 1L0PA 1MW2A 1MFVA 2OYMA 1E4IA 1M01A 2J7CA 4M1RA 2FGZA 2PBGA 7CGTA 3RDKA 4CVUA 4JZ5A 2V3GA 4RE3A 3HG3A 5CGMA 2VR4A 3PTMA 1E6NA 2WWDA 1VFUA 4NRSA 1PX8A 2HVMA 1E9LA 1HVQA 5I77A 1E6ZA 4X9YA 1E55A 3VIOA 4AIUA 1MXDA 4M56A 2JF7A 1Q6FA 3VGBA 3W6MA 3D5HA 3CZLA 2GJPA 3VGFA 2JEPA 1FHLA 3TONA 5F7UA 5AC4A 2WYSA 3GZAA 1GZJA 3FW6A 1H0IA 2XN0A 3RJYA 2E3ZA 2ZX6A 1AMYA 3BMWA 1DWHM 2XG9A 1PIGA 4PTWA 1JG9A 2QMKA 2E9LA 1H11A 4MAZA 1BPLB 1K9DA 3AI0A 4M81A 3LX9A 1CGUA 3L4UA 3RMEA 4Z2JA 2WMIA 2A3BA 3IAPA 1XSIA 1HL9A 2CHNA 6CGTA 3S2CA 1HKMA 3EDDA 3PZGA 3IANA 1UKQA 4TTUA 3ECQA 2OYLA 3RPMA 5ECUA 5ABGA 3RM9A 1KQYA 1ZS2A 2ZUWA 4H8VA 4QAWA 5I2UA 5IFPA 5E6YA 3MV11 5IXEA 1R85A 1QWNA 1E6PA 1OGSA 3L4XA 2WVUA 2WZHA 1XYZA 4GO8A 2A3EA 3TP4A 4BQ2A 4AIEA 1JXJA 4W5UA 4B15A 3U7VA 1MFUA 4H04A 4DUVA 4M29A 2BNJA 3A23A 1KXVA 4AZGA 3ZT6A 1BVNP 2DH3A 5A8PA 3W4RA 1R75A 2DSVA 1US3A 2MANA 4HU0A 3WQ8A 2YA0A 4D1IA 3F5LA 3AIEA 4JCMA 2UY4A 3UERA 2ZX9A 2X1IA 1HP4A 1H1NA 1QI4A 2ZUNA 4HU8A 1V3KA 1UD5A 3CUJA 5FL0A 5A6BD 3VDAA 1QX1A 4J3VA 5M5DA 1ITXA 2WMIB 3ARZA 5CLWA 3ARYA 5A2CA 3WQWA 3AZSA 3GNRA 4ACZB 5FOOA 2BHYA 4JL2A 1TQSA 1CBGA 3WDHA 4OJYA 4LPCA 1NWRA 3L4VA 3FAWA 2B31A 3WDRA 2BVYA 1E56A 2D3NA 4PSPA 4U5IA 1R46A 1VEPA 1C3FA 2VRKA 1UWIA 2J7FA 1RH9A 2CNCA 2WC3A 1ZJAA 2QV4A 2W4XA 2Y8VA 3AOFA 1P6WA 1US2A 1DHKA 1ISYA 3U57A 8CGTA 1C8QA 4LYQA 3VD3A 1CGYA 2VOTA 3T0DA 1V3LA 1E3ZA 2CKSA 2YOCA 3BGAA 4ZE4A 4CUCA 5A8MA 5D9PA 3VDHA 1F4HA 2AOSA 2DSKA 4P8VA 4CD8A 3TTYA 3WD2A 1GQLA 5HOSA 2IXUA 3T2PA 5I0DA 3MO4A 4FNQA 3GYCA 1CZ1A 1KB3A 1B3VA 1DWJM 1E72M 3SURA 5I79A 2EACA 2D1ZA 4CD7A 4MTVA 3B9AA 2ZX7A 1KTCA 4TTGA 3KL5A 1JIBA 4Q22A 4UOQA 1XD0A 3LPFA 1GOWA 2D20A 1PBGA 4UNIA 1ISZA 3K46A 1HJQA 2WW5A 1CYGA 1R33A 4UFLA 2RGMA 1EO7A 4W86A 3SUUA 5I5RA 3B9DA 2WNWA 3NSMA 3WF2A 2FHFA 3VGGA 4L4OA 3WFLA 3BAJA 2CHOA 1X6NA 1BGGA 1XYFA 3EDKA 1UYQA 1UH4A 4MDOA 4W8LA 5CPQA 3U7BA 2VX7A 3M6DA 2JIWA 3WEZA 1LL4A 4J3SA 1QI2A 1TUXA 1UA7A 3CHCA 1HWWA 3DYMA 4W88A 2CBIA 2EPLX 1JAKA 3WF1A 3ARXA 1SYTA 3AHZA 2WCSA 2VURA 1KXQA 3ARWA 5A3HA 1CECA 1TVPA 3VGHA 2OWWA 3SIMA 3VDBA 1NM9A 2AAAA 4AEFA 2WKGA 3EJTA 3POCA 3VIMA 3HJEA 1JZ2A 1OBAA 3CZNA 3CZJA 5BCAA 2CITA 2XSAA 1GJUA 2G8ZA 2D2OA 1J11A 1KWGA 1K9EA 2F7OA 1BVZA 3N17A 3IJ9A 1UD4A 3F5JA 3U5YA 4NZFA 5E6ZA 1H4PA 3VSVA 4CGTA 4OOZA 5D9MA 3WD3A 2YDQA 3WD4A 4GZEA 2Y8KA 4MB1A 3VM5A 3UR7A 4JHOA 3G6MA 1WKYA 2Y4SA 5I6SA 3VD9A 5A94A 2DDXA 4UQCA 2DSUA 4C7GA 4HMEA 3PZQA 3A3HA 4ZENA 3PZTA 3QR3A 3VIGA 4HZ8A 4ATDA 2A3HA 4U3AA 4BQ3A 2BXYA 2DQXA 1W2VA 2XVGA 1VJSA 2Z1KA 2NSXA 2JEQA 3ARPA 1AQ0A 4AD0A 3CTTA 4HMDA 3WL0A 1PX3A 1XSKA 4D71A 1JD9A 2GDUA 4UZSA 1V0NA 3BC9A 3PHAA 1SZNA 3WUFA 2VZTA 4CD4A 4PSRA 2CETA 3APGA 2DGAA 3DX0A 4UFHA 1VEMA 2G3NA 5GNYA 8A3HA 3OZPA 3ZT7A 4PEEA 2YL6A 4IISA 4TX6A 4DWSC 4E8DA 2WM0A 1JZ5A 1V6XA 1EOKA 5E0FA 4AZIA 3A4XA 4CCEA 5ABHA 4P8XA 1GOQA 3EYPA 1C7TA 4TVCA 3VNYA 1EDGA 3SCWA 2XVNA 5JIPA 4W8BA 3AJ7A 3WMBA 1OT1A 3LPGA 1E0XA 4KRUA 4IUGA 1R7AA 3BVVA 1BSIA 3GNPA 4Q7NA 1W9BM 1GCYA 1V03A 3WY1A 1SFSA 2OSWA 2J7HA 2X05A 1PPIA 2V3FA 2FDMA 3WF4A 3PTQA 1GUVA 1HP5A 3WKZA 1RD6A 1UUQA 4EE9A 1HKJA 1MVYA 1XD1A 5BXRA 1GVIA 1VEOA 4C7DA
chains in the Genus database with same CATH superfamily
1YYAA 4GKTA 4JTGA 1H6FA 5CR1A 4QPEA 3LNMA 2J8GA 5ESVA 4N2OA 4E4PA 4WUKL 1HKIA 4WVRA 3B8YA 2LFEA 4AZ7A 1DJYA 4PRPA 4ELME 1RZ7H 2A7BA 5DY2A 1EEUA 2OPCA 5BV7C 5KS9A 1VZGA 3PV7A 4YSSA 4CNSA 5T5NF 2IOOA 2PTZA 1KBLA 5DHYB 3ULUL 5DSCB 1T2XA 3V4BA 3WHXA 4XWOD 2I69A 3TIEB 4RA0C 4LIQH 4O1FA 4X5PA 2LAAA 2MCPH 2AK4B 4U0RC 3REVB 1C9SA 4OJDH 1REQA 2PDUA 2GJJA 5EB9A 3IMRA 2JB6A 1FNHA 2PDLA 1E9QB 3W2KA 3BJLA 5C07E 2HUHA 4D9QD 3P80A 1PKMA 4E2OA 2FZMA 3PPFA 1RP8A 2ENQA 4U33A 4URTB 5C9KA 1IEBB 1RY8A 3F7YA 3GZKA 3CQ0A 4N2EA 4M5YH 4UANA 3JS3A 4BHYA 2YGPA 1UH3A 5JUEL 4LYKA 4R5EA 2WPBA 4ANUA 4CMHC 3OQ3B 2GUOA 5KS9F 2DYPB 4QG8A 3FZUD 1XGQB 1SPQA 4MNJA 2FT6A 2YGVA 4F7CA 5DQDH 4KKLC 3WNPA 3MCMA 1RJLA 2H0EA 3W2NA 5AYXA 2ZTJA 1F1GA 3MBEC 3GMNB 5ICUA 3BSMA 4OZFB 4JPWH 4XMLL 2E68A 2ISVA 1SZGA 3OJDB 4GJ1A 3RDTA 3INOA 1YEFL 4LV4A 5IB4B 3UAJA 1FRGH 4H19A 3VA8A 1TJ2A 2NY2B 2CK2A 4H1LG 2JXMA 4MNMA 3I6GA 1NCWL 3D06A 2NUPB 1AI1H 5C2CA 2FEEI 2P4AB 3TU6A 1I85A 5HYQA 5HQEA 2QFRA 3V52H 3IDJB 4IK6A 2NY1D 4U1KA 3BP5B 3KPRE 3RL2A 1RBAA 3AYVA 4H83A 3UZWA 2Z6FA 5HYSG 4FSAA 2BP8A 2UUDH 2HPTA 2WCAA 1E71M 4D8PB 3G5VB 4NC2B 5C09A 2EP6A 3O6CA 1JV5A 5KVEL 3VMPA 1YLVA 4Q8VA 5AAMA 1SRDA 4EUPB 2H6UA 5FM4A 3FUJA 3EF4A 1TPFA 5GZNA 4X60A 4HGKC 2Z31C 4OW6A 4UQBA 3IE9A 4KGJA 2R94A 2HJKA 4XRCA 3AO0A 3RX4A 4WQ6A 2VW6A 2ENSA 4A2HA 3TT1L 5JIDA 2NY3B 4PJ7B 4YDKL 3F12B 3ZE1E 4EE2A 1U42A 4Q4RA 4FKHA 2X2IA 2FLIA 2OQLA 2DVUA 4ERIA 1OADA 2WLYA 5I1LA 1V7NH 2CSPA 1RY7B 4XIMA 3TQVA 4GYFA 1EZUA 5ITFB 2XI9A 3B04A 3KWXA 5JOPD 3ITGA 5GGUB 4LHUB 4QD2E 3X1GA 3LSBA 3QG7L 3UXAA 5TPWL 2C9PA 2WSQA 1RUPH 1PEWA 5I17A 5AYUL 2Z9TA 5EU6B 1HSBB 1MELA 5MKGB 4YHML 4DCQB 2VXVL 3BYYA 2QTEA 4HLZH 5AFDA 1OAKH 5F88B 4NJIA 2OQJB 4W93A 2XPKA 2VMDA 5JPNA 1RQHA 2JB5H 2Z25A 3WL9B 2EDRA 3PFUA 5I66B 5A6SA 3KEDA 4EI0A 2HLAB 3KPMB 1FWIC 4ENEC 4FB7A 3SY6A 3NJJA 3NACL 4GSRA 3LRGA 2Z91B 3U2SA 4V1XA 4MJ5A 1EO8L 1A7QH 4AZBA 1M7IA 1H8NA 1E9OA 3LI1A 3V5OA 4POCA 2VLJD 1PY0A 4CC1A 3ELAT 5AVRB 4ELDA 1ECQA 2CWXA 2XISA 2CZVA 2OXGA 4GH1A 3CSYA 5ACLA 3TT3H 4KFNA 4J2XA 3FSWA 1FLRL 3HOGA 2DQEH 2VX5A 4CAGA 3VKBA 2CKBH 3E02A 3GVRA 4OVUA 3NPZB 2QIIA 2YDAA 4NQSB 3PGDA 1PCXA 1EK3A 4GUOA 1TPXB 4S3EA 3ZDXE 5GS1C 4N26A 4JX6A 1PU0A 4JTLA 2CZFA 1EWHA 2FO8A 4BUGA 2EG8A 5JW4Q 3T0VA 4N8VB 4Q2ZB 5F1NA 2G4GA 1UCBL 4X9FA 1MLBB 3S2AA 3FOKA 3HG1E 4ATWA 4FRWA 4PRAB 1JZEA 1R0AH 5GS0D 3B2UC 1KJ2L 5E5UB 3WE6B 2XXFA 3QXDB 4OV4A 1XCXA 3QJFA 1I2OA 5HWMA 4ABWA 1KBIA 4NN6B 5J1SC 4AGLA 4AHPA 1IFHH 3M1BA 3PG8A 2KH2B 1BF8A 4I9JA 2HT4C 3VXPA 3ZKND 1UD2A 2RJGA 3PBVA 3FSAA 1NFIB 1P0DA 1QU4A 3VD7A 1XYMA 4QR7A 1L8PA 1B31A 3QDMB 3H22A 3MKVA 3CH1B 3RGBA 5AVHA 2J6EA 2A85A 3T9PA 3EG9B 4PG9B 2OJZH 3BDXA 5TF0A 2O93L 4IOFC 3MJMA 4LEXH 1G0YR 2DLTA 1O6IA 5AZEH 4F7TA 1M2OA 3W02A 1W5NA 3SBWA 4MQ7A 4UDTA 5J6HA 4HUVB 4J28A 1HKWA 4A8NA 1MFNA 5AL8A 3UCDA 5BJTA 3IJ7A 3TJHD 4OAWA 1KB5B 3GTNA 4R27A 4Z9KB 4JG1L 1RZJL 5JR1L 3HC3L 3NEEA 1UPMB 1DYSA 2DD8H 2R24A 4Z0BH 2DV6A 4WSGA 3NQ7A 5C2XA 1S5WA 5C0EA 3NNTA 4YSCA 2Y89A 4WF7A 3FY1A 2SEBB 4F15B 4PRIA 3O8XC 1YG9A 2D31B 3PWNA 1GW1A 3TJIA 2BVOA 3GFYA 3NPVA 5DDHA 3QOKA 2Q6WA 4Z7UB 4LMQE 1D5ZA 4JKKA 3M0XA 4IKIA 3NQ8A 1TKKA 4UCFA 1GIGL 1J8HA 3I50H 3SCVA 2F54B 5SWZD 1XR8A 4X83A 5EBUA 4KQ4L 3GEWB 5T1MA 1HW6A 2DQHL 3ZS4A 5I1KH 4YXKL 4UM8A 2D4FA 3ZTDC 2QJHA 1WWCA 2HFFB 3MLYL 3UBXI 3P0WA 3TURA 2AW2A 4H1LA 3WO3B 4ZQTA 1XC6A 5F7DA 4Y5VA 3JV6B 4N24A 3QPYA 1ZS8A 1WFOA 5C6TL 2HJLB 2VLKD 1L6XA 1NOAA 3F7VB 5FI8A 3VOHA 4N2BA 3HEIB 3PV6B 4OCLC 1ONQA 2C1PA 1WHOA 3C2RA 3CUIA 5HYSA 5DX7A 2YMXL 5TE6L 2BOCB 3V0JA 2I9TB 3DN5A 4GUFA 4QJ4B 4FQHB 3QZAA 2DDQL 3TYAA 4QGTA 1NIEA 1YRRA 2DIKA 3DIVA 2F15A 2GK1B 1Z6JT 3DK0A 1GPWA 5DYFA 1PTZA 1E3FA 5GGRB 3WNNA 4LUJA 3B0UX 3FNKA 1X9QA 2HT3D 4GPNA 5CF3A 1AZBA 1VRSA 1ZHLB 3WIJA 4ZMYA 4LLQB 4R5XA 4XNXL 1N0XH 1R2TA 4PULA 5GRUL 1MFDH 3NK4A 3ZHDA 1NCNA 2ATMA 1N6UA 5F0PB 2P47B 5DZAA 4IM4A 1RK7A 4HDIB 2OMNA 5IFJA 4TMCA 5IMOB 4Q8WA 1KPUA 4C56D 3C3NA 4MPKA 3ZZQA 4I9TA 3AROA 4JK0D 3U4BH 4WJ8A 3VG0L 2JKIS 1MNUH 3J2PA 2I32A 4DN4H 4RLDA 4JVWA 5I26A 2YUWA 4WXYA 1FH7A 3QCUL 3EO9H 3VCLA 2XFRA 2IS7A 3S35H 1PMYA 2AKRB 2YCLB 1MHEB 3U9UA 2OZ4L 4LEQA 3X1FA 4G8EA 3I6KA 1FJ1B 1MDAA 1ZK5A 3DTXA 1W5MA 4UTAH 1W0WA 4DQOH 3G6DH 4ZPTB 1OCZB 5D1QB 5I1EL 4UU9B 3Q3GB 1LBFA 1Q65A 3C5XA 3IWUA 3PWPA 2EEXA 1OK8A 3MOAL 3EWUA 4ORMA 4CDGC 1SQ7A 3OMNB 2P24A 1OX4A 4O18A 3AQZA 2GHWB 1IIKA 2YB1A 4FJZA 3FO0H 4WKXA 2CBQA 4DVRH 1XDTT 3QDAA 3L5JA 4XVJL 3UXLA 4M6MH 4TO8A 1MY5A 3FT3B 2VCBA 3L7RA 5I1DA 4HNTA 1JI1A 2P50A 3F62A 4WUUD 4DOHB 3RFZC 3V0DA 5F2FA 2VEMA 4OZGA 1TG8A 5AOIA 3KDNA 4ZFOB 2KDYA 2W1NA 3VU2A 4PW9A 1M4KA 1NAML 2ZG1A 4RNHA 1BFVL 4H8WL 4PRWA 4KESA 1TV5A 2D0HA 1L7IH 4RDVA 1ZLPA 4D9QE 4N0YL 4U1LB 1V4YA 1Q0XH 5F2MA 1T7XA 2P8MB 3Q94A 1H3XA 6ENLA 4XKMA 4ATLA 4ZMOA 3NTCH 3DTDA 1SO4A 4UT7H 2ASHA 1ISWA 5GPRA 3T8XA 3CHFA 1V0LA 3H2WA 3KYNB 4JDZB 4RAUB 5LHFA 3RIAK 4JHWL 3LEVH 1J0KA 3BUYA 2PDYA 4RISH 5GRJL 1O9VA 3RXZA 1FO0L 2VCOA 1YO4A 3RQ3A 4YWIA 2D23A 3RPIB 3EYUL 2HKFH 2WOBA 4OV9A 1A5FL 2VXSH 3O06A 2ZP9A 1B9BA 5CD3B 2PDQA 4ZAKC 3OJGA 4N8CL 5E6RB 3BLPX 2X4RA 1R8LA 3OXRB 2LLGA 5H6HA 4FTVD 4EZJA 1R3LB 2X6CA 4OBRA 1QFPA 3R2GA 1SJBA 1GGIL 4JFQB 5C7ZA 1KT2A 1C93A 3AQYA 4OZGF 2VC2H 4LPUA 2CDGB 3R1GL 2F7QA 4FI4A 4AJWA 4IIQB 4OZ4B 1X1NA 3T4CA 3JR2A 1A3HA 2XZCH 3O2VH 4AWSA 4MHHI 1XR2A 3P4NB 4MAUH 4Q8PA 3QIWC 3NO3A 1N70A 3U0TB 3Q8CA 5T3XL 3SJVB 4L37B 3GSXB 4BKNA 4UT9H 4XTIA 2GYSA 1GTEA 5HAOA 1OK4A 3W6LA 4HHMA 5L8KB 2VFGA 4X2UA 4ZQKB 1UC5A 1F4WH 3CFCL 2PNDA 1IXOA 4XX6A 2N7SA 1SBSL 2YUVA 5CZXC 2ACQA 4KTEL 3NQKA 4FXGC 4TV5A 5ESVB 4U1MA 4X80H 1CICD 3CDGA 4M24A 1C5DA 5KSAC 5F2GA 3PGFL 2EABA 1V55B 4PRPB 3KVPA 1TA3B 4PTVA 4PWKA 3MYZA 3MLWH 3RJQB 5KS9B 3TWCL 1O7DC 4C6OA 2QVIA 4JBRA 5IBXC 1JGEA 2XHNA 1FAIL 1QEWA 2XTJD 1D5RA 1T8XA 4IG2A 5I09A 4QJ3B 1A25A 1U1HA 3WHXB 3V8OA 3MLRH 5JOPE 2C0HA 1BQUA 4A7TA 3GG0A 4Y9MA 2V5YA 1FL5A 3QMTA 3KS6A 3PHOA 1XLIA 1LXMA 5K1JA 1REQB 1MJUH 2CXGA 3LQAL 4X7CC 1OAXH 1R86A 1U4FA 3GNNA 3OB8A 4A39A 3MKKA 1GTNA 2J7CA 4KV5E 4WWPA 3UYRL 3NCYS 2B1AL 1XPYA 1S9XB 4Y2OA 4HV8A 5CGMA 3MZ2A 1IBGH 1VFUA 2WXPA 2EIZA 3H9ZA 4PY7A 5HWNA 3QIBC 2JF7A 2V68A 1HK6A 4RMVA 4G6ML 3ANYA 1J79A 5BUPA 4BXSV 3CFEA 5KWYC 5LG6A 3BWWA 1UB3A 1SHSA 5GGQL 1MWAH 3L13A 5F7FA 2GUOB 4AYEC 3AI0A 2VLJE 4LE8A 1BD2B 3WFEH 3NGBB 5H37H 2Y63A 1PWMA 3N2BA 1P7TB 2DQUL 4GRLD 4FULA 4JDYA 5JQHC 4TYUA 2ZZ1A 4EAEA 3KGUA 4GUHA 3DG7A 2EILB 1RJLB 2CO2A 4XN7A 2YPVL 4BIKA 3L0GA 1YEEH 4WO4D 4JHUA 1PL3A 4TR9A 4DNLA 2OXHA 4GSUA 1IIGA 4CVZA 3ZVHB 3W4RA 2VDNB 4ANKA 3W88A 2R91A 4XC1L 1X7IA 4M6VA 4QWWC 2VUKA 2JXMB 1VQTA 1HP4A 1UD5A 1IWPA 2VQ1A 4X8CA 3VDAA 4KKLD 1QQDA 1IGTA 5HYQB 2Y5TA 4KZEL 3DI3B 3MBED 3WYRA 1VF5C 3KOFA 4XNAA 1U3HC 5J1AA 3RL2B 3H24A 1CLOL 1FCQA 2BP8B 3LEXA 4PUMA 1YEGL 1JV5B 1NC4A 2HQAA 3CVCA 2B4CC 3SZKC 2G60L 2HRPH 3U2ZA 3QV6A 3SYOA 2B81A 3AT8A 4PP1C 4U1IA 3VFOA 4PWGA 4B0MM 3BO8A 3VACA 2B9AA 3BV7A 4XRCB 4BSJA 2LE9A 2F8XC 4TOYH 1TZZA 4LH8A 3SGDI 4MZ1A 4AYBA 3JV0A 2NY6B 4TTGA 4HISA 4O0ZA 1U1UA 4RFEA 1ET7A 1PLGH 1XGEA 5KZDA 3R19A 3CJPA 1CLZL 1QWKA 2YAEA 3AWFA 5I1LB 5JIMA 2GITA 4LARH 3F83A 4AY7A 1G4RA 1MCIA 4QRNA 1JVNA 1KXQA 3EYQC 3VE7A 1CECA 5A3HA 1KC5L 4QG6A 5I17B 3F6JA 2VC5A 1SY6A 3STCA 1U8KA 2QFPA 1ID5I 2F53D 5K9CA 4GIYA 4B3VA 4JFZL 4YHLH 4LDOB 3G9VA 2QCCA 3FQUA 3JT0A 4HMEA 3PZQA 5JPNB 2ZWLT 4BQ3A 3DIPA 2YSSA 3EB3A 1GC1C 2JLPA 5GJTL 4CD4A 4BM7A 4IRSB 5SWZE 1FX6A 3U2SB 2PYFA 5DZOA 4MJ5B 1PV8A 1SVBA 4HA0A 3G18A 1M7IB 4RGOL 3EH5B 3CHQA 5FUOH 4WI2A 4DP6X 4P9HL 2PPEA 2HP4A 2G96A 4KXAA 5DHYA 3ILPA 5FYKH 3STFA 3CSYB 2EDOA 3GKAA 1MVYA 1XD1A 3ES7A 1R3WA 2VLKE 4DZHA 2WTOA 4G6AC 2ATSA 4HZ7A 1C1EL 3PGDB 1ETZB 4XMXA 2DSZA 1H5VA 1I31A 1IWBA 2NLYA 3IK4A 3TA6A 2AP2A 3GXDA 4HN4A 2WBJA 2PWUA 4LUIA 1LJYA 1W8OA 3C4UA 5F1NB 4AHQA 2JI2A 1UZ6F 1IC1A 4BFIA 2J5WA 3DFYA 2RR3A 3BW4A 4WWOA 1XRSA 3AU1B 2VRAA 1LQ2A 1ZLVH 1PG7X 4GVHA 3QJFB 2IJ0C 1YECH 4MMXC 2XFGB 2VMCA 3L3KA 1DR9A 3PWIA 4EJ1C 3VIJA 5I9QB 3LLFA 3VXPB 1XGQA 5EOCL 2R0LL 5EL1A 4D9LH 4DT2A 1GGBH 3P3BA 4HYWA 4C56E 5MP6L 4LZKA 3FHEA 2UZIL 2BZDA 2DQGH 4HJSA 1J9YA 3HC0B 4JYDA 2DY2A 1EXUA 3OJDA 4UBDD 3ELQA 3PNRB 3CZSA 4YBLB 3T7VA 3NZUA 3H7BA 1HKLH 4O2CA 4F7TB 1MCNA 4UDTB 3JUGA 5J6HB 4O0KA 3EH1A 5BJTB 4NHCL 1UZGA 3SQOL 1LYQA 3WD5H 4XNZC 3SDXE 1JFQH 1QDSA 4MJJA 2V3EA 1TZIB 1UT2A 4HJJL 5A1AA 1MCQA 2PR4L 3QJQB 4XZBA 5C0EB 4XNMB 1U3JA 2QL1A 4D8PA 5I1CH 4Z7NE 3LIZA 4JFVA 1YXYA 4N2CA 4X2PA 2EVFA 3NXFA 3IDIA 5DDHB 2Q6WB 5B1CA 1SJAA 1D5ZB 3SCMD 2JKPA 4EOUA 3P93A 4FPSA 2MUCA 1XR8B 4XB8A 5T1MB 4XWGH 3M9YA 4FXRA 2HPIA 4PJ7A 3ABMB 2BRRH 2DZPA 4H6RA 1S3HA 4FZEH 3CQQA 4ACZA 4AWTA 4FLQA 3GBDA 4WUUE 4K5MA 4GIPD 3HNTL 3O8XD 5E5LA 3SYPA 2FBJL 2ZYFA 2DZVA 1OQOA 1T6BX 2NNAA 4K8GA 4H1LB 3HM7A 1TG7A 4C1NA 4U10A 4M3JA 4IJ3B 2ZKHL 4JRFA 5F7DB 4Y5VB 2EJ1A 4JRXB 4MZ3A 1ZS8B 5GGUA 1T41A 2R4RL 2MNJB 2EDXA 3U48A 4KQNA 1ONQB 2C1PB 2GIYA 3V0TA 3NRQA 3Q45A 1HSBA 3T4AA 5HYSB 4YHZH 1ZKAA 5FYKD 5TE7L 3VMNA 4GIOA 1NH6A 2WO2B 1S5MA 1W1PA 3OKDA 3ULVF 3KL3A 1U8OB 1FNSH 1Q2SA 3B2PA 1FRBA 3GKZA 4EIUA 5DK2B 1LGVA 5I66A 1CGVA 2A3TA 4MM1A 1EUAA 4LW7A 2HLAA 2XPGA 4NCDA 2G4JA 4K2SA 2XZQL 4MXVE 4QRAA 2Z91A 1AY1L 1K6WA 3D08A 4ZX4A 4PJ7F 1MQKL 1EAQA 1Q0YH 2QDDA 5FKPA 5IRPA 1YNKH 3ZJ6A 4FTVE 3QIUB 7ODCA 2HZHA 4HMNA 5D04C 1RUQH 1JCKA 4J3OH 5IFJB 1KPUB 3ZVIA 3RIAF 3T0AA 4O02A 2BNRD 2CKNA 1HJUA 3MCG1 2J8OA 3PC0A 3DUHA 1K03A 4FG6C 1TQBB 1VA9A 2Z4TA 2R0KL 2OLSA 4HVBA 3OG3A 3VCLB 1XIEA 3SQMA 2D22A 5EA0L 2A4AA 1Q1PA 2EXYC 3BUPA 3U9UB 4G8EB 3I6KB 1G67A 5G1MA 3WQ5A 5EN3A 3DTXB 4F79A 2WWNA 1XLGA 1ODUA 3KTXA 1W0WB 2UX6A 4WEVX 2DQFA 1P0SE 4M4RB 4FMVA 3WE6A 4M7SA 3PWPB 4Y6GA 3QXDA 4PUBH 5E6IC 1IBYA 1V7MH 3RAJL 3FJ6A 2C9VA 5F7MC 4UIKL 2E6QA 3H7LA 1KYOJ 1T66C 3SE8L 4Y5YA 2P24B 1OX4B 3WNMA 1C92A 4JTSA 2YCJA 4HEPA 3PULA 2XTJE 2X7WA 2UXTA 1BF5A 1V5JA 2AV1A 1T96A 3W1AA 2XV3A 3CSGA 5I1DB 4GK8A 5JPMA 4HTYA 3QDMA 3ZR5A 4QROA 1BJ1J 5DLCA 1J0YA 2C3VA 4YPJA 3VNJA 3EG9A 4OZGB 4ZW5A 3FQ4A 1ME8A 1F7BA 3L4TA 1RAMA 1BXBA 3R11A 4GLRI 3K2UH 1O7SA 3CMJA 1VFOA 1ZXKA 2YL8A 4XPGH 1A5BA 4PTTB 4H41A 3EBIA 4JX4A 1V6TA 1DBML 3BPWA 4GQ9L 5F71A 4ZFZB 3RVVD 4Y7MA 1KXTA 1NCOA 3AHXA 3STGA 1R34A 4JQ1A 5FOBA 3FQ2A 3UU0A 3WN5C 4AL8L 3BPCA 1BAFH 2Y1YA 1RPQA 3T8XB 1GA2A 1D2KA 1MUWA 2W88A 4L2YA 4WU7A 5BS0D 5AZ2L 4BZ2A 3MRCB 1J0HA 3BUYB 2NYZA 3MKCA 4G80B 4EMZA 2VDKB 5G4OA 4HALA 3CAKA 1OM9A 1CFQA 3RPKA 4M0XA 5JXAL 3P4LA 3WQEA 2X4RB 5FFOA 4FABH 1G9NL 1OK0A 1KT2B 4ZFGH 3V6FA 2HFFA 4ZX6A 2VDPL 3R18A 4P7OA 5AW2B 4O11A 2WAHA 1J01A 2X88A 3G1HA 3BZEA 1IO4C 1JNJA 4L4VA 4F57L 3PV6A 4ZQMA 5IVXE 4ZAKD 2O1AA 3VVWA 4HHGA 4F1ZA 1KGWA 3CLFL 2G2PA 1NLDH 1A14L 4Q14A 3WQOA 1ZA6B 2EPNA 4XMPH 4J3OD 4RNFA 4XD5A 4IKJA 2KLSA 5DRWA 2BOCA 2I9TA 3MBDA 4PTDA 1LO2H 4L8BA 1FF5A 4FQHA 1R19A 2TMDA 5H8PA 1GK8A 1JN6A 3H2EA 1LO5A 4U1MB 3QY8A 4P49A 1F73A 3O6MH 4Z7WA 4DXKA 3QIWD 2X70A 1UFGA 1YN7A 1MRQA 2JKTM 2JJTA 3LCGA 4PJEA 3WQ6A 2VOMA 2W3ZA 1EJFA 4UAHA 5D1XD 5EY5A 1JGEB 4LLQA 1PG7L 1FUYA 1KIUB 3KRBA 1PVNA 5B4MC 4J2MA 2Z4GA 3CUFA 1QEWB 4IG2B 5CZXD 4I77L 3TEXA 2GSEA 4B4HA 5B7ZA 5IMOA 2VAAA 3CFIC 4HPYL 5TD4A 5C2BL 5KSAD 3CK0L 1K8IA 1FL5B 1NFKA 1CDCA 2QHLA 3PHOB 4LNRA 2DWDA 1GEHA 2ZQKA 4ICWA 3GHBL 1UG9A 5G5DB 5A6TC 5GGTL 1GW0A 3W7RA 2F53E 2XA3A 2MMXA 4Q89A 4Y2OB 1SOKA 1W80A 2AKRA 3ZBMA 3U6WA 3K8MA 2EIZB 1CF1A 1YYLL 4L23A 2R9RA 2NQLA 4XZ4A 5AC7A 3B0XA 1NJJA 3LDBC 1D9KD 3F7RA 4RMSA 2EDJA 1KBBA 3CFEB 3E0WA 3W56A 5HMFA 3VTRA 1P7HL 2YUXA 5E1HB 4WWKA 3F7KA 4ZNCD 3VUSA 3CVIH 4RGMB 4EN3A 1R24A 1RBOB 4YFLI 4PJEF 1Z5YD 2EDQA 2EPMX 4AY1A 1T5KA 4OLWL 1WVZA 3C60A 3W7JA 2QGCA 4DO5A 1VFBA 2BPBA 2FJFA 1OARH 4B9KC 3QIBD 3RWEB 3IGSA 2WXNA 2RDXA 4XN8A 1JHTB 4N2NA 3BWUF 4XAWH 1PIFA 2EDKA 2ZUQC 2BFGA 3WIHA 3PDGA 5BW7A 2QJGA 1ZLSH 5TQ0L 4PB9L 4D6HA 4CVZB 4IP4A 1BV8A 4PWEA 1ZVNA 3UG3A 3T8QA 3H4FA 3HV9A 4QQ3A 2OEMA 5LZLA 2DWXA 5FYJU 1BZEA 1QZNA 1V3MA 3BDYL 1A7OL 2PXYA 4HIHA 1QQDB 5EBGA 1IGTB 2BX7A 5EKYA 2Y5TB 2A3AA 3FQRA 1DJZA 2P8MA 4M03A 3N42B 3CS2A 4W9JC 3N06B 3LHUA 3LEXB 2V2DA 3LMYA 4XVEA 1NC4B 4LY4A 3OJMB 3RA7L 1AQKL 3K5XA 3FAXA 3PZOA 1GOFA 1RIUL 4OFQA 2IC2A 4U1IB 3BO8B 4G8GD 4I7WA 2RHEA 3ISWA 3LRLA 4L8CB 4XVDA 1QD0A 1OWRM 5ICZA 2GTWA 3GXFA 1NJ9A 1U3HD 4FQ1L 3AMCA 2VO5A 1TVDA 5SWSD 3AYSA 4PGJA 3BXWA 2HRWA 1F4YL 3WKPA 2XH4A 5A69A 2J7GA 2GITB 3X1NA 3BLKA 4V1DD 3I9IA 2P46B 1RK6A 3SUTA 4DKFH 4PP1D 4WCJA 3CUHA 5I03A 3L2NA 2QPEB 1Q8AA 4W7VA 3V36A 1E15A 4B3ZA 4IIQA 2W95A 4OZ4A 1LM8V 1JSYA 3L2IA 4K5PA 2ZUVA 4M4PA 4KOBA 2DW5A 1SJEA 1SZFA 4MUZA 1U8KB 3D34A 4BWLA 3S48A 4QDPA 5T9CE 4I9AA 2P76A 3AM8A 4FNPA 2VXTL 2PDBA 3WBYA 2Y7NA 5I6OA 1UGNA 3C6LD 3FQUB 2R1MA 3NSNA 4QDGA 4L1XA 2RFXA 2YZ8A 4GQRA 1IAOB 3IFNH 3PUEA 4E2VA 4MVBC 1TX2A 3QP3A 3HG2A 2YSSB 3EYQD 3VZYA 1E8ZA 2APWA 4IFRA 2VGLM 3S0CA 1N82A 3MODH 3SN6N 3EOOA 2NY0C 1MQQA 1Q45A 1AZNA 2H3KA 3VD0A 2OQHA 1OXYA 4PRHD 1TA3A 2PYFB 1NGPL 4LTSA 3MJWA 1CZ8H 3ECUA 1LP9A 3BUQA 3PL6D 4WRHA 4NC0B 5GRVK 1GRWA 4JQXA 3Q6GH 3A6BH 3ILPB 4CQAA 3GIVA 3ZDXB 4XNUL 3UH8A 2J9XA 1E4KA 2PABA 4MXQC 3NEHA 3NJVA 4JKNA 4KKQA 1LLAA 5D4JA 1ELSA 5E0CA 1MYRA 4NUJB 5CPTA 3PE9A 1WC7B 3SJ3A 4TXEA 1E4WL 1TLKA 2OTDA 2PAJA 1BAGA 3BPOB 2E6DA 5DRXB 1SHXA 4JTHA 4DYEA 1KTBA 4M48H 5E70A 5SX4I 2WBJB 3QBUA 3LS4L 5FYKE 1XLCA 2IALB 1ZPLA 3O2DL 1S9XA 2R1XA 2BXVA 4DEPB 3DFTA 4BFIB 1OT4A 3W7DA 3R89A 1UWRA 2ICEC 3TA3A 4BQ5A 5CLYA 4G6AD 5HHVH 2WXLA 5AZ1A 3X2QB 5BXSA 4MAYB 5GNZA 3KAOA 3CU2A 1GGCL 5JW3H 2VITA 1XQ4A 3V9FA 2BWGA 1LP9F 3L3KB 4PQXA 1EA9C 4ODSL 1A7NH 1R9YA 2CLVA 1BD2A 4P7NA 3X11A 3UDWA 1IE5A 3KVLA 1P7TA 1R2SA 1SJVA 3UTTA 1WZ1L 4HCRH 2V3GA 4Z7VA 2BNRE 2HFGL 3HI5H 1RI8A 3DUSA 5GRZA 3LKQA 4X9YA 4AQZA 1EXUB 4M56A 4OLVL 5I8CA 3BZFA 1HCYA 1MG2C 4X7EC 3ZVHA 4KPHL 3H7BB 3H2MA 2Y3NA 4QOKD 3L9EA 5GS0H 4O2CB 2WYSA 1QK2A 3FW6A 2XN0A 4X8JA 2E3ZA 3QZBA 2A77H 1KCSH 3URAA 1E27A 2ZFAA 4NQ1A 1AO7A 3C8DA 5C08A 3D12B 1TRDA 1D7KA 3DHDA 4OR1A 1OCWL 2WJZA 3B8DA 5EZLA 3S2CA 1PL9A 3PG2A 4W4OC 5AWNL 4DHLA 3XISA 2A5UA 1IL1B 3OAUL 3R79A 4NO0D 3KYOA 4YMPA 3P9LA 5I2UA 4R26L 5DUPH 2WZHA 4K2UL 5CS7A 2AQTA 4BQ2A 3IDIB 3U7VA 2BNJA 3SY0A 1MMFA 3FIGA 5FF3A 2X1UA 4K0OA 1FBIH 2H32A 4NJKA 2VZ3A 4P5TC 1BX2A 4Z7VF 1UT9A 3ABXA 5JZ7D 3PFQA 1J87A 4L9LA 4ACZB 2Y1ZA 2YSTA 5F6IB 4GVIA 5E00A 1R46A 3CLEL 4LL9A 5BMFH 1RH9A 4BGDA 1P6AB 2CBTA 2NNAB 5LQBL 3FQWA 4C1NB 5I07A 4K1WA 1P6WA 2FJUB 4MSSA 3C5ZD 5IVOA 3A0OA 4PJIA 3MLUH 4IRZL 4GP4B 1P4IL 2DJUA 2Q76A 4JX5A 2VDML 3WD2A 4HUUA 3T2PA 3T4AB 3SKNB 4LVEA 2ZX7A 3OKDB 2ZRXA 1JWUA 2Q7AA 4P46A 5BS0E 1EO7A 4WFFD 1TJMA 3MCLH 2N7AA 3CHPA 4HC1A 2XV2A 2XPGB 2W59A 2X44D 5IMMA 4AAJA 2IQ9H 4OQTL 3KYMA 3XIMA 4DLFA 2CJ3A 2RBLA 2EPLX 4IRSA 2Z1PA 1TWDA 3SDDA 3CWHA 1KELH 4IBQA 4CSTA 2AAAA 1LCOA 3P84A 3PPSA 3UPAA 5FKPB 2A6DB 3L6FB 4DZBA 4NZFA 3U0PB 1C08A 1H4PA 2V9QA 2YDQA 3BQ6A 4JHOA 4NCC2 4O02B 2Z1XA 2PPDA 4Y4KB 1MDLA 1QTSA 4A3UA 5LIXX 4GGBA 1EWDA 4PJIF 1W2VA 3W76A 1VHCA 2HT2C 3ARPA 1F6AB 2L7UA 4RZBA 4QRFA 1ETZA 1ZLVK 3VQ1C 4ZQPA 5GJSH 3HN5A 2NZIA 3S1VA 2XFXB 3BQVA 4N90D 1A6UL 4O4WA 2ZPKH 1NICA 1KF9B 4TX6A 3QQXA 1XIIA 4XZLX 1CWVA 4CCEA 4LVOC 2N01B 4PJ9C 3VNYA 5E1GA 4AF0A 1NMCB 2DQFB 4OTXH 3AU1A 4FG6D 1W9BM 5F9DC 4M51A 1E4XI 3NH7H 2ZCKH 4NKIL 4ZMAT 2MEJB 1NWTA 3QPZA 5D1XE 3D4ZA 3KR3L 4Y5YB 1NMAL 4K3JL 3DX5A 1PIIA 3EWDA 1II4E 1AZVA 3S34H 2EEDA 2AV1B 1PNCA 4QRRD 2XBTA 3LCHA 1MCKA 5JPMB 3K1KC 3WNOA 1YE6A 3WH6A 2C3VB 3D51A 2WQWA 3WIIH 4UUIA 3HC0A 2BVQA 2CDEA 1J9QA 1FQ0A 1B3YA 3WBDA 2WB1A 2E25A 2ZUYA 1O7DE 1T66D 5JHLA 4PBXA 4JTRA 3UNDA 4UXDA 3UVAA 3MLXH 2L3BA 1O9ZA 4OVVA 3MMTA 1NFBA 5AZUA 1KXTB 5DD0L 1C16A 1WFMA 5IQOA 2FK9A 1UC6A 2O4EA 3RGVD 3TNMA 3ITXA 2OV0A 1TZIA 1FH2A 4X98A 1UWGL 3IDYC 5FOBB 2D24A 4YTQA 1K8YA 2P3ZA 1PJWA 4FQJH 2O5YH 4PI2A 2C79A 4XNMA 3BPCB 2D0FA 1LVEA 3R0UA 4WU7B 5MERA 2X87A 4AEEA 4LNCA 4GMEA 3U2EA 1KKRA 4WHBA 3IS4A 2VW4A 4H2CA 3MLSL 1CFQB 4KQ3L 1ZDQA 3US1A 2Z34A 4NJ9H 2OW6A 2EEAA 3EF7A 3B8IA 4DUXA 2BY0A 4MSWA 1BQRA 4HUNB 2WZ6A 2JK5B 3V6FB 3KVKA 3ZUNC 3FB7A 5CSSA 4RGNB 3W07A 4KK9C 3DMMC 2I26N 4JZJA 2YMOA 3SBFA 5CBBA 35C8H 4M6NL 3BZEB 4JRXA 1L3NA 1LK3H 3SGDH 4L4VB 3KDOA 1Q3NA 2C1HA 5ERWA 2JELH 4NI8A 1RUKH 3EH4B 3LH2L 5C0GB 2ZP0T 3O4OC 3DDFA 5BVJA 5IQLA 3ESOA 4Q8TA 2W0UA 4G3YL 1JPSH 1OY3B 3NJHA 1XYBA 5FJPA 5B1JA 5DRWB 3TH2T 3SDCD 1UATA 3ZGIA 2OR2A 4GI6A 1U8OA 5HVGB 4L8BB 3GIZL 3UESA 1A1OB 1JN6B 5DK2A 4G8GE 5FPIA 1LO5B 4Z7WB 3QJZA 5F2IA 1QI5A 4E9YA 4C83A 1URLA 5AHMA 3M0HA 2X70B 1ZALA 1YN7B 3I85A 3ORJA 4XUGA 5INCA 5KZMA 2R69L 4PJEB 4FLOA 5SWSE 1HZHL 1Q6EA 5E7BA 1NCDH 3I6TA 5A6AA 1IVLA 4KUZL 3O2WL 4Y5XB 2ICSA 3QIUA 4XNDA 4V1DE 4JMNA 2IH1A 1OF0A 2OLHA 2Y7OA 2VAAB 5ICXB 1V10A 1ESWA 1F3XA 4HWEL 3MRPA 4UC5A 1K8IB 2JLLA 3QUZC 4MZIA 4LNRB 2XWXA 2DWDB 1WZLA 2C1OB 1L9QA 1Z66A 1HKFA 4L3ED 3ZL1A 5FYLH 2DMHA 4AMKH 3APTA 1VHNA 2J6VA 2VISA 1QBLH 3A5VA 1VPXA 4HEME 3GLAA 3MA8A 1CI5A 4HUMB 4FZIA 3H55A 5D7JC 1WFUA 3HKFA 1W2PA 2DPKA 4KY1L 3T71A 2ZADA 2BVWA 3U6RA 4M4RA 4WJG3 3IIVA 1FGNH 2VR6A 4PRHE 4WWKB 3LS9A 1VRDA 4JEQA 2YW4A 5CCGE 1BYAA 4EN3B 1R24B 4XP4L 2IWFA 3JV4A 3US9A 4H8PA 4OLYH 3C60B 5K9JL 1VFBB 5BV7H 3KWWA 8PAZA 2G0LA 3QQWA 5BW6A 2FIQA 4AMWA 4XZIA 2FJFB 1NSJA 5EMKA 4NILA 4OGZA 3CNKA 4KI5C 4LT9A 4WXZA 2K6WA 4GHRA 3OV6A 3GZOA 4C6PA 4KRZA 3GYRA 5F96H 3QH3A 4UINL 1RVGA 4CEXC 1EO5A 3KAAA 2SFPA 3WUBA 1SFTA 3BH8A 2PXYB 4HIHB 4RMWA 3X3FH 4PTTA 4Z6AT 2ZWNA 3FQRB 1XL6A 4AD5A 1QWHA 1ZBWA 3WJSA 2LOEA 5D2LE 4ZFZA 2Q8AH 3IKCA 3HNVH 3QARA 3ECBA 9CGTA 3OYXA 1U33A 5AL0A 3HV8A 1EJTC 4HGMA 3R0KA 5FW8A 2YD9A 3FJNA 5I6XB 2YPKA 4OJFH 1R5VA 1AYRA 3Q48A 4NZ8A 5EO0A 3WFCH 3N4AA 1XZWA 3PQYD 2FGLA 4A68A 3LEYH 1TSRA 5B8CA 1ND0B 1P1ZA 2W62A 4JHAL 3MRCA 5I8OL 1HXJA 1HF6A 2TODA 2X2HA 3D39D 1J1XH 4G80A 5ICZB 2GTWB 1YTEA 1N2RB 4JO2L 1RZPA 3JWOL 1NJ9B 4I9MA 3IDXH 4M62H 4YNGA 4HPXA 3F7LA 4F3FA 2DOCA 5TBOA 2YGQA 3T07A 3DSFH 3RIFK 4B9IA 4Y1TA 4QOKE 1YLBB 1WWAX 3M6YA 1X4XA 1SUXA 1I9IL 5B1KA 4XBKA 1WIPA 4H0HB 4PZVA 4EDXA 3ZKXB 1ZSHA 4IRJD 2B1HH 4TVDA 4EX4A 3D4GA 4GRWH 1SJEB 1NDMB 1KN2L 2OULB 3ULAB 1WGOA 2BZ7A 1OT2A 3GAYA 1DVYA 3BN9C 1YY9C 4AHOA 3EWZA 1QNSA 4LCCC 3S36X 3SN4A 2GTZB 3DFQA 2IQAB 1ZA6A 5SWZB 5HGHA 2WCGA 3VOJA 5TQ2H 2YJQA 1OCCB 4ELMA 2RFXB 4DPCX 4YUEL 1EUNA 2Z28A 4NNXA 2N1KA 5D30A 1W8NA 2DVXA 3V10A 3DX1A 4Z77A 2ESCA 2H7WA 4YLWA 1G7HA 2BS8A 1RUAL 3ERPA 3R0MA 4PJ6A 1LDPH 4AQ8A 2QBWA 5FYLD 1EXPA 4KEVA 1LP9B 3NCYP 1INQB 3LMJL 3OEXA 4K4KA 5EEUA 1EEXA 4XXWA 3F4VA 1M7PA 3D3AA 2D73A 3LHYA 4F2UA 4DPPA 3UJ2A 1PY4A 5HI5C 3KBFA 1KIUA 3JU2A 5JIWA 4UTBH 4MNGE 1GPOH 2C9XA 5TNVA 3GIVB 2O9RA 1F3EA 5E2TL 4MHBA 3BPNC 2ZYSA 3DTUB 4LCRA 3MWAA 5C07A 4AEHL 3I68A 1JGIA 1WZKA 5F9JA 1FDYA 5G5DA 2VR2A 1DIEA 1BXVA 3SCOA 1QPRA 1P6FA 2YRBA 1ZLWK 1B4TA 2YUZA 3W9EB 5D4YA 3FHAA 4BSVA 2R1XB 4LPVA 4ELMF 4BEIA 5TF1H 2RH9A 4WFFE 3ECWA 2BASA 1QYGH 4GXVH 5TE4H 4WDXA 3TA3B 1Z69A 2WWKO 2BVTA 4L1SA 4X99A 2VITB 4DIXA 1JL8A 1J48A 2PUZA 2UY7A 1S3RA 1UC4A 2NZLA 2CLVB 1H41A 3X11B 4M8VA 2NTFB 5HA7A 4BXVA 4YSAA 2YFNA 3FCBA 5DTFB 2ZF8A 3UTTB 3E2SA 4W8AA 3RWEA 4XPTH 3T05A 1XP3A 1QSED 2ED9A 4JYEA 4Z7VB 1JHTA 3DUSB 3VRJA 4Q4OA 3LKQB 1AMXA 4YC2C 4V2XA 1E6JL 1XO8A 3O6AA 5I8CB 3BZFB 2ZDRA 2AEWA 3HE7C 3RU8X 2IGTA 2EO1A 3SO3C 4FK9A 4X8JB 4NHUA 4NKCA 1TJGH 1OWWA 3KPRA 1E27B 1MAMH 3ZDWA 5F4XA 4N90E 5BRBA 3KD4A 3MFFB 1AO7B 2L5HA 1NGXA 5C08B 2XIMA 1BREA 5EZLB 4J12A 3FO2A 2GWNA 3A4JA 4K39A 4FXLA 4CEUC 5IT2L 3MHUA 3KYOB 1A2YA 4UM9B 3P9LB 4QM1A 3PM6A 2MHAA 3KH3A 2R4SL 4URIA 1ZHKA 1H50A 4E9XA 3B5GA 4GLRH 4S1QH 3TBBA 3BOFA 2IKHA 4JQAA 1KIQA 3SY0B 3ZTCC 1LBMA 4M7LH 3T4YB 5F89A 3NQGA 5AYBA 1IKFL 4L8CA 2FH6A 4MA8H 3RJDA 4JQVA 4BI5A 4QRRE 3OJ2C 2H32B 4HD5A 1BX2B 4X4ZA 4R7DA 5DFWH 3AZUA 4TPRL 4L9LB 1VAHA 3AZTA 1HIZA 1ZLUH 1DWAM 5E00B 3WBEA 4IM8A 5HHPA 5I1JL 1OSEA 3GMLA 5AKSA 1GKOA 3FQWB 4AB4A 1PCWA 4F27A 2Z31D 3TXVA 3I6SA 5JORA 1EGJA 2J66A 1OFBA 3HS0A 4PJIB 3QI9B 4XB3A 4OFDA 2RFGA 3FQNA 2FT8A 5DFVC 4FQ2H 3DKJA 1L0QA 2Q76B 5I3KA 1QTYT 5DCDA 1ZXQA 1UWTA 4DPRA 4PRRA 4HUUB 5EF3A 3N42F 2VJ8A 4ZTPL 4Z5RA 2VQUA 4X2RA 1CE6B 3OSKA 3IPEA 1L4IA 1XTLA 1H3WM 1JWUB 3AFLA 1GEQA 1N6QH 3ZE1F 2NXIA 4P46B 3U4KA 2PP0A 1OM3L 5EOCJ 1IAOA 5AVYB 1UG6A 3S37H 1ZD6A 5LXVA 3W53A 2UZ9A 5IMMB 3KYMB 4D8AA 3EZJB 3TSMA 1H09A 2AF2A 5DRNA 3V4UH 4UT6H 4LS2A 3SDDB 4LBUA 4FA8A 1J10A 3RLVA 4L18A 1K8DA 3MRQA 4DZBB 3HTLX 3WQVA 2RQ8A 3FSTA 1C08B 2H3NB 2G9KA 5C0AD 2FX9H 4BQ8A 2W66A 3VWJC 1ZPTA 3N0AA 1UOLA 3GSNH 1I3GH 4K7PX 3QJVB 3SJNA 5EZJA 3HI6H 4ENED 1XIBA 4XQ6A 1PQZA 5I1AA 4NUJA 1GVQA 1WC7A 4UR9A 2VN4A 5DRXA 3TCEA 1TSIA 2ZXDA 3HG1A 3NPSC 5JHBA 4G5ZL 4GNKB 3PDDA 3CX5K 1SDDA 3ALXA 2IALA 1AL7A 3P1VA 3SPGA 4MWAC 3Q58A 4AF0B 3ARDA 5ES4B 3BHBB 1RMFH 2QUTA 3C5JA 1FNFA 3T0XA 3F2DA 2WLKA 5IQMA 5DQPA 4CQ8A 2F7RA 2PWDA 4MAYA 1RPUA 1P4BL 1UR9A 2H5UA 4F93B 3E9AA 1OSYA 3O4LD 4BCZA 1YHPA 5CWSA 5KYXB 2WBGA 2VDLH 4PJ9D 4KK8C 2IBBA 2OJPA 1E51A 3B9OA 3ZDXF 4FFZH 1EGMA 1EERB 2R0ZH 3BOVA 1L6YA 3QO0A 3B2UD 1RBLA 1SHWA 1G6RL 5AUMB 1XHGA 3N4EA 2I17A 4CU7A 5C54A 2BVQB 4Z2IA 3GUFA 2CDEB 1QFWI 4F2FA 2W9MA 1I75A 5D6DA 2UUDK 2FPVA 5T33H 2D7PA 3TN4A 4L3EE 3ZQ9A 3LBCA 2CLHA 2HT4D 1Z6KA 4LU0A 2ADJA 3EYSL 4D6EA 4AZ5A 1DQMH 2Z7ZA 4WW1A 4X7SH 3LGDA 5C0NC 7PCYA 2BY1A 3NSYA 1C16B 1NCAL 3SKJL 3TNMB 1MW2A 4OF5A 4X98B 3W0WB 1IL1A 3QXAA 3LTVA 5AW9B 5HD8C 4IOFD 3H26A 4LSQH 4FZ8L 3NFNA 4HSNA 1IKOP 3URNA 1R3KA 4WO4B 4PRBB 5J0BA 1V7AA 4NN7C 5MERB 4H9TA 3VGBA 3E38A 3S36L 4TUOA 2XA8H 1QO3A 2FMOA 1HU8A 3FUNA 4BJLA 3RWCA 5T9BG 3L5MA 4E41D 4B91A 3P8JA 5EHFA 1LE9A 3R0NA 1BPLB 1ROCA 3IETA 3L4UA 3ZU8A 2A9NL 5JA8B 1KYUA 1EEYA 2FEDC 4MSWB 2IWKA 3QEGL 4TTUA 3FB7B 4OVXA 5HNTA 3WTWA 3ESUF 1OF2B 2YK1L 1D8CA 3O0RH 3MV11 3LNGA 1R85A 3DX9A 4I3RL 2WVUA 4XBEH 5J5DA 3T8MA 4GO8A 5HDQL 2ATKA 4JZJB 4FIRA 5CIPH 2VDRL 5LNSA 3VXGA 3P30H 5ERWB 4OFKA 5L88H 5AEAA 1EZVY 4KBXA 4XO8A 3S9YA 5BVJB 4PGCB 4HJEA 3ATZA 4ZA0A 4U6YA 1W5PA 1AZ1A 1F05A 1EC9A 3SKNA 1V3KA 4LEBA 4TLTA 5A6BD 1XMWA 4IQJA 4FQCL 2FZDA 1ZLEA 3WQWA 3KCJA 3PQYE 2AQSA 2P42B 2HG0A 3ZVVA 2B31A 3DBPA 4KK9D 3DMMD 1L9MA 2VIRA 2A9BA 3A9BA 2VRKA 5CBIA 1TYJA 3D39E 4PA8A 4C83B 5IQ7L 4PBVC 2PFHA 5INCB 4YSOA 1M41A 3FU6A 4MD5B 3BZJA 1JDFA 5SV3A 2NXHA 2A6DA 3L6FA 4KDWA 4MLSA 3ZO0A 2IH1B 1EA0A 1BZ9A 3U0PA 3W1MA 4HQQL 2ZKWA 2V9RA 3GM0A 1EC7A 3MRPB 1GOWA 2P8PA 4YXLL 4Y4KA 3UBHA 4HBCH 2WW5A 1IQWL 3ASNB 3QRGL 3E8VA 1FFPA 3IYLW 1Y0EA 1F6AA 3ARGA 3U7BA 4M6OH 3WEZA 3HCVA 2ATAA 3H70A 1UA7A 3L4CA 2VFFA 4IGNA 2XFXA 3R8BB 1FVDA 1T2QL 3M5ZA 4XNYL 4GMSL 1MAKA 2VISB 3RU8L 3VIMA 3PJLA 1VPQA 2LT9A 4U1HA 4P59L 5CEYB 3N17A 3QUZD 3EB4A 1UYWH 5D9MA 2P44B 4P5KB 4TUKH 3PPGA 3U6RB 1XLFA 5FYLE 3PZTA 4WZ9A 5SX4H 4ATDA 2FRGP 3GSOB 3TLLA 3JV4B 2L4OA 1JPKA 2R82A 2AZUA 4MKMA 3V4VL 4F2BA 5B3SB 1MWAB 2JIXD 3KWWB 3TVMC 2VYOA 4L9XA 4KTDH 1AOHA 4LVHC 5KN5A 3RCMA 1TTRA 5D7JD 2VSMB 1FVCA 2DKMA 3BWZA 1DE5A 4DX3A 5IFHH 2HXTA 3N14A 2QXWA 3NFSL 3WEAA 15C8H 4WI4A 1R7AA 1E65A 1KIRB 3H3PL 4IDJH 3QH3B 1AHWA 5L0QB 4ESKA 5IKCA 3KCOA 3WKZA 3KHJA 4L9DA 3BH8B 1TWZA 3OX8B 3K6IA 4H4NA 3PWUA 1ACCA 3U4EA 3IKCB 1V05A 1A4JA 4KI5D 4XAGA 3ECBB 3ICJA 2QGEA 5E4AA 4DGYL 1OHLA 1DSWA 2YPKB 3TTOA 1R5VB 1YEDA 4OF0A 4JN6A 4TQTA 5CEXB 1POJA 5EO0B 5HNRA 5DZ9A 2Z4QB 3S1UA 4HLZG 4IBLT 4W9EC 5B8CB 2YZ5A 1P1ZB 2AL2A 3TKFA 1VBRA 2VZUA 5LVEA 4EPBC 3K30A 1DWIM 1Z0MA 4FI6A 1FG9C 3OKLA 4XMZA 1QSEE 3QULA 4OGYH 4A2SA 1JPEA 2CM5A 1UM6L 4F3FB 3FVMA 1A3QA 1NDVA 2FLBT 4PUWA 4IOSD 2O5XL 2CE6A 4YL4A 1F6KA 1HL8A 4UDUA 2DQWA 2JK5A 1LP6A 1GOMA 1XRTA 4MJMA 4EDXB 2K8QA 1MJ8H 2AMGA 3K7UA 4HNVA 1ET8A 1RZKC 2VB5A 3QXTA 1BYNA 3CXDL 4ZMQA 1L9NA 4QJ1A 3DWTA 2GDQA 3GSQB 3I3DA 3SCMB 3W1QA 4U7KA 5I24A 5C0GA 4K7PL 4LSTH 1O5KA 1YEYA 2PLMA 3V0GA 3OZOA 3TYUA 2EAEA 4NWTL 3PS6A 5HGHB 4IIEA 1B1YA 1JPST 1SZRA 1GGOA 4ELMB 4AM0Q 4OLEA 4NNXB 3U2CA 2B4CH 4GRWE 1A1OA 4Z77B 5DURB 4XPFL 1H7WA 2VR9A 4QHKJ 5JW4M 1G7HB 1N7ML 3ESPA 1KYFA 1GMIA 1JPDX 3NEVA 3BKCH 4E0CA 5C55A 4YHYC 2NXYB 4HWBL 1QG3A 3GNMH 1FWJC 1A0QL 2PYED 2VABB 1SVZA 3B4UA 2ENPA 3BI9X 4NAQA 3WJMA 3S1WA 1OM0A 4RDZA 1MJ7L 2AABH 2X2YA 5F9OL 4MMYB 4Y5XA 2YCEA 3CUZA 4DO4A 4ODVL 2CESA 4MD0A 3HS9A 3WLNA 3DOSB 5ICXA 4ZYKA 5C07B 4XODA 3HF3A 2VNCA 1RUSA 5E8NA 1MJJA 5I15H 2QEJA 5F9JB 4S11A 2C1OA 2RD0A 3N50A 4A7SA 1B5TA 4U3SB 5BOEA 3EA1A 2KUTA 1LT7A 3L68A 1M2VB 4NXSA 2EICA 3W1PA 4O12A 1O75A 5HI5D 5IESL 2CJUH 3APYA 3MXWH 4JO3L 5FLUA 1GR7A 3VTMA 4BSVB 5DLMH 3BUTA 4RETB 3O9NA 2XJKA 2AEQH 2Z93A 4H88L 1Q94A 3AY4A 4M9OA 5I16A 3EOEA 1WEJL 2VLJA 1WDSA 3ANUA 3V0WH 3QLLA 4JO4H 1TJHL 4Z7WF 1W3JA 4JNXA 2R1LA 4CRPA 1GC1H 4Z18A 4F0LA 4X99B 3DYPA 2K70A 2UY7B 4JL1A 1AXTL 2WKLA 3G3LA 3PTKA 4J7RA 1LT8A 4QTIL 2YB4A 5HBFA 5J5EA 1TX0A 4RBPH 1KWKA 4AW7A 1S9YA 1QOKA 4MGGA 3H56A 4N6RA 5C0AE 1UWAA 1V6UA 2Z7UA 2A9AA 2ADFL 3VRJB 4KV5F 2NT1A 1XBVA 1E4XH 3TEVA 4LANA 2Q01A 3EX4A 1NWSA 4AH7A 4JN1H 5ILTH 1EHNA 3GBLA 4PR4A 4NHUB 1CIUA 3KPRB 1HEJC 5GHWL 4JTDA 4G8TA 4MB5A 4YDIH 1MNZA 4H20L 4HNOA 3EBGA 1NGXB 5LA2A 5DN1A 2IFFL 2K6ZA 2GQ8A 4M1DH 3GNXA 4JDTL 3FO2B 2XG4A 2CALA 4C47A 3Q01A 3UA3A 1ZEAL 3IJEA 2YAMA 3A4FA 1A2YB 1HCZA 2MHAB 4LHQB 1ZHKB 2OR9H 3HBZA 2YIHA 2COQA 4QWWD 3SGKA 3ZE1B 5AALA 1JZ6A 1KIQB 3SCTA 3O4LE 1ND0A 3B9EA 4OWGA 1QTWA 5F89B 1MCFA 2BVUA 4Q3MA 3G24A 4BELD 1GOIA 4WHTA 2ZCZA 1N2RA 3HQNA 3IJIA 1QFEA 5B3NA 5AG8A 4R7DB 3HMXL 3D9AH 5DMIH 4GBUA 4OT1H 1D7DA 1IC4L 4LEOA 9XIAA 1W72L 1DSFH 4AM0A 3CJJA 5HHPB 1IGFL 3GMLB 3MCKB 4TSCH 2FQEA 2HX9A 2NRDA 5JORB 2B20A 4IBTA 3HS0B 3UO1H 3PBMA 3FQ1A 3BURA 3RI5K 1IKNA 3UG5A 3EYFA 4ONFL 3FQNB 3DNKA 3CLWA 2DMCA 5AAWA 4N1HB 1NDMA 4F0RA 4QUOA 3UMNA 3SE9L 4FFYL 1HNYA 4TL4A 4AKPA 4DVBA 4Z5RB 1PWLA 2GTZA 4ZK8A 1Y7VA 2CCWA 2IQAA 3W83A 2OEJA 5SWZA 5DEJA 3HPLB 3ILEA 3NZ1A 5GRXG 4X6CE 4G83A 3BSZL 2FKPA 2AAMA 3EGXB 5DFVD 5DRNB 3SE4C 4FP8H 4HQVA 4E41E 5C8JB 3G0XA 3RILA 1SYVB 2FH8A 1INQA 4GPVA 4XBJA 3MSGA 3ZN6A 1K8DB 3MRQB 2BHUA 2H8XA 2VLKA 2GI7A 1QNZL 4L4JA 1INDH 1KFAL 3CASA 1VBHA 5AY7A 2F9BT 3GYEA 4NZJA 1K2DA 3GFUA 3PFRA 4U6HA 1XV8A 1GOKA 4RPQA 1CLYH 5EZJB 1JAEA 1NP0A 3ZHFA 1QP1A 1TZ7A 1PQZB 5I1AB 3ARRA 4LSRH 3SOBL 2GL5A 1MWOA 2OOGA 4B9GA 2CKBA 3HI1A 3HG1B 2NZ9C 3EA2A 1XDLA 2ZWZA 5L4JA 2DKSA 4UTUA 4X0VA 4NQTA 3W9EA 3PZUA 2D2GA 2ALWA 1AUSL 1SDDB 3KHOA 3AB0B 1YEHH 4MRBA 4WLCA 3QHOA 1VIWA 1EJSC 3TV3L 1GGUA 3ARDB 1VESA 2FFIA 5KEZA 3C5JB 1J5OH 4KX8A 1U8NA 5FUCC 1OGBA 4ZUUA 3CFDA 4LRIA 1KB9J 1F2JA 4C5ZA 1JZ3A 3QNFA 4GRMA 4OFCA 4HNNA 4C56A 2VN3A 3GTFA 4MXWL 2V8LA 4M5ZH 2YCKX 5CWSB 5TDNA 1TU2B 1ED3B 3BKYL 3VD5A 2NTFA 3QNYB 5C92A 1ONXA 1AGFA 5DTFA 1S9WA 3EHBB 2CK0H 5E9AA 2CPUA 4CLMA 4V2BA 1RD5A 1T04A 4HJWA