4UQDA

X-ray structure of glucuronoxylan-xylanohydrolase (xyn30a) from clostridium thermocellum at 1.25 a resolution
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
390
structure length
390
Chain Sequence
b'HMASATINLSAEKQVIRGFGGMNHPVWISDLTPQQRDTAFGNGEGQLGFTILRIHVDENRNNWSKEVATARRAIELGAIVSASPWNPPSNMVETFTRNGVPNQKRLRYDKYGDYVQHLNDFVAYMKSNGVDLYAISVQNEPDYAHEWTWWTPQEMLRFMRDYAGQINCRVMAPESFQYLKNMSDPILNDPQALANLDILGAHFYGTTVNNMPYPLFEQKGAGKELWMTEVYVPNSDSNSADRWPEALEVAHNMHNALVEGNFQAYVWWYIRRSYGPMKEDGTISKRGYMMAHYSKFVRPGYVRVDATKNPTYNVYLSACKNKKDNSVVAVVINKSTEAKTINISVPGTSIRKWERYVTTGSKNLRKESDINASGTTFQVTLEPQSVTTFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CARBOHYDRATE BINDING FAMILY 6
publication title Conservation in the Mechanism of Glucuronoxylan Hydrolysis Revealed by the Structure of Glucuronoxylan Xylano-Hydrolase (Ctxyn30A) from Clostridium Thermocellum
pubmed doi rcsb
source organism Ruminiclostridium thermocellum
molecule tags Hydrolase
total genus 138
structure length 390
sequence length 390
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uqdA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uqdA02
2WVUA 1TFVA 5FD0A 2XFYA 4LYQA 3W28A 3WDPP 4M24A 1W9XA 3LXCA 5BRQA 3VDCA 5IXEA 4D6EA 3VGHA 4H8UA 4J3SA 5ABFA 1GHSA 2QMJA 2XM2A 1W32A 3L4XA 4HOXA 2G41A 3PZIA 2WVVB 3WD3A 4FNQA 2E4TA 1PIFA 3TP4A 1AVAA 1WPCA 1PPIA 1B90A 2MANA 1WO2A 1QWUA 1UD3A 1GNXA 4HA3A 3RILA 4PUDA 2EPLX 1HIZA 3VKKA 1E56A 3N17A 1CECA 1E3XA 2ZWZA 5TD4A 1W91A 5DT7A 2Y24A 4B3LA 3BVTA 3G6MA 3SCPA 5CPTA 1B2YA 1PZ2A 3TOPA 4P7NA 4QCEA 4UFLA 2CBVA 4WKAA 1WP6A 2X2YA 2XVKA 2JF6A 1UHVA 2WMIB 3EJSA 3CZGA 1RP8A 5D9MA 4D6HA 4AMWA 3A4AA 2OYKA 3WIJA 1J10A 1WDQA 1QI5A 3T2QA 3W27A 4KGLA 3BH4A 1E70M 1HTYA 1KXQA 1H41A 1V03A 4D72A 1PEZA 4LQ1A 1UOKA 2WVTA 4QLJA 4HA1A 1UZ4A 3CMJA 1E73M 3BUQA 1WZKA 3E1F1 1Q6CA 4OOUA 1LQ0A 2BY1A 4JL2A 1W1TA 4JIEA 3DHUA 2ZX6A 3VIJA 1DTUA 4IUGA 1LWJA 1JFHA 2RGLA 2WWCA 3WMCA 1XRVA 4GO8A 2E9LA 1CDGA 1EDGA 3CHCA 5A6SA 2QHAA 2VRJA 3O6AA 1F4AA 3UG5A 3VGBA 3KL3A 4WKFA 1HXKA 3GXDA 1U33A 2PF0A 1EO7A 3GZAA 3BSHA 5GNXA 4DO6A 2J79A 1NQ6A 2XN1A 2J8FA 1VF8A 4M29A 3AIRA 4WSKA 4AD2A 4NXKA 2B31A 2DSZA 1GQKA 2ZXQA 3WUGA 3W0KA 3A6OA 4BA0A 3OZPA 3CUFA 5A8OA 4FNSA 2WLZA 1C92A 1E4NA 1QI0A 1JYXA 3F5JA 2QLYA 5BROA 2ZUNA 1B3VA 2CHOA 4XX6A 4DWSA 2G3IA 1FA2A 2FH8A 1NOUA 4J27A 1V3MA 2FHCA 4TX6A 3DX4A 1WDRA 1UD5A 1TQWA 3VTRA 3AS0A 1G1YA 4QAWA 3GXTA 1GOOA 4GPNA 1E4LA 3AYSA 2ZWYA 1UR2A 2QPUA 3IJ8A 4H2CA 2WMKA 3AOFA 1QBBA 3WD2A 3GYCA 1CXEA 3SUTA 3VIGA 2XPKA 1CEOA 3QR3A 2VQTA 1G01A 2BY0A 3VPLA 1E6SM 3TTQA 3WL0A 5E0FA 2E3ZA 3RCNA 2CBJA 3MUY1 3WMBA 4GI9A 1V02A 5AYBA 1XH2A 2QPSA 3MMUA 1K9EA 4Q7NA 5A6JA 3UETA 2XGIA 3RMEA 3WY2A 3PZGA 4BQ2A 2WKGA 4WKHA 1CGVA 2PBGA 3POCA 2E40A 2NW0A 1OGGA 2YL9A 1QVBA 3ZT7A 4HOZA 4E2OA 2YKKA 3VDBA 4HU0A 4NF7A 2NSXA 2VCCA 4TUFA 1JZ6A 5CLWA 2WCAA 1M53A 1VAHA 2CCRA 1R86A 1VEOA 3BUDA 1WDSA 1GONA 2D1ZA 2D0GA 1KB3A 3WENA 3O9NA 1M01A 1J0IA 2BHUA 1GOQA 5FKYA 4JKLA 2CXGA 3AIQA 4BQ5A 3OLEA 1UR4A 5AC5A 1H1NA 3WL1A 1LWHA 1WZLA 1QWNA 4AWEA 2VR4A 2GK1A 5CSYA 5A8MA 4W8LA 4EANA 4OOZA 4JZ5A 2D20A 1UH4A 2WNWA 1UG6A 3PZNA 4BS0A 4U5KA 5AY7A 1UWSA 3G6LA 1JXJA 4CUCA 2OSWA 2WMJA 3KZSA 5A8PA 1JZ2A 4Z2HA 4CN1A 3ARWA 1J0HA 3KE0A 1E6NA 3FNDA 1E72M 5A6BD 1AQ0A 4HA4A 3L2MA 2HISA 2XVGA 3A21A 1I1WA 3BMVA 3N04A 5EFDA 2EADA 4A4AA 2BY3A 4S3KA 2A3HA 2VOTA 4PN2A 4X0NA 3VO0A 4H8HA 2ZX9A 3N9KA 4GI8A 1JDDA 3OGSA 1H0GA 3CZJA 3CHEA 3QOKA 3UR8A 4NI3A 3M6DA 4WSJA 1V0MA 3B9AA 5DFAA 3BAYA 9CGTA 2ZUTA 3NUKA 4URIA 1JYWA 1OSEA 4JCMA 3L4ZA 3TTSA 2WW5A 1W9DM 1E71M 4W88A 4CD5A 3NDZA 3AS2A 3MKKA 2RGMA 4H04A 3PZQA 4AY1A 2CYGA 4B9ZA 3VOCA 1ZB5A 3VD9A 3WF4A 4XZBA 1MVYA 5LA1A 3VIHA 1KCLA 1UQYA 1OD0A 4JFVA 1B31A 3M7SA 2VMFA 2D22A 2F1BA 3GNRA 1ZBKA 2F7PA 3WD1A 1MW2A 1GOKA 1C3FA 3WUEA 5I24A 3A4XA 1W2PA 2WXDM 3BAKA 4NZJA 4UFIA 2VX6A 3WQ4A 1X1NA 1US2A 1C90A 4PBGA 2E8YA 1P6WA 3W81A 1UR9A 4W85A 5HOSA 1HJWA 4R27A 2X2HA 3T2OA 3IJ7A 4ATDA 3WQVA 1JAKA 1E6PA 1VIWA 1HJVA 3BC9A 2J8GA 4FK9A 3CUHA 4HTYA 5CGMA 3CUIA 1UD6A 5M3WA 1IT0A 3I3BA 2DT1A 3WDQA 4D6DA 4ACZB 4UQCA 4NZCA 7A3HA 5DMYA 1EXPA 5M5DA 4P7RA 4OKDA 3KLLA 1HVXA 4AYGA 5A3HA 3RM8A 5E9AA 3BAWA 4M1RA 4EK7A 1XSKA 4D6JA 2J78A 2DEPA 1G0CA 5ECUA 1JXKA 5I78A 2EACA 4XZWA 2IXVA 2DT3A 1WZMA 5AYIA 3K8MA 1CGUA 1TVNA 3GH5A 1FFRA 1GVYA 3GXIA 4OIFA 1XCWA 3MO4A 4UQDA 2IXUA 3W6MA 1CWYA 4JHOA 4V27A 3NIYA 3BAXA 1J9YA 1GHRA 3D5HA 2AAAA 2EPOA 2JFEX 2W4XA 3SCRA 3WQ6A 2EXOA 1VJZA 2YL8A 5CSUA 3EMZA 1UZ1A 2BVYA 3CLWA 4HMEA 3THDA 5FL0A 1NOWA 3VMOA 1CGYA 2VX4A 3KL0A 2OLHA 1G94A 4X9YA 4JCLA 3WNKA 1Q6EA 2C8NA 4UQAA 1HJXA 3W37A 4LX4A 3D52A 3GXNA 2V3EA 2D3LA 2EAEA 1E6QM 3CIVA 4OGZA 1R47A 4AZ7A 3ARVA 3WF2A 1NP0A 4U5IA 3A23A 1UKOA 1HNYA 2J47A 2XVNA 2W67A 2EO7A 3RM4A 2EPMX 4A3HA 2CKRA 4P7OA 1HT6A 4E8DA 2DDXA 3EJTA 5BXTA 2JIWA 1E43A 3HN3A 4AZBA 3AISA 4AZCA 2JEPA 2BVDA 3AIEA 1GPFA 1HJSA 3AYRA 3CUGA 2G3MA 1LG1A 1NM9A 2XFFA 1ISWA 1EHAA 5I0DA 5I77A 2VCBA 2WZIA 1KXTA 3N13A 4CCEA 1WCGA 2BV9A 3SIMA 2CBIA 3VVGA 3WQWA 5A95A 4YHGA 2O92A 1C8QA 1NWTA 4D1JA 2BY2A 4P8XA 1W3HA 4LPCA 4WJXA 3EMCA 1VFUA 4JKMA 1R34A 1GZJA 3RDKA 4W7VA 2C7FA 4CN6A 4OJYA 1J01A 4GZEA 5E6YA 1Q6DA 2VZOA 5CZKA 1JZ4A 1XGZA 1KGUA 2YIHA 1DHKA 1XC6A 4PSRA 2O9RA 3N11A 3W53A 1BG9A 1NH6A 1XH0A 3WEZA 1HX0A 2WZHA 1V3KA 3VMPA 2D2OA 2WMFA 1B3XA 3FXYA 4B3KA 4FLOA 3VNYA 1A47A 1W3JA 2Y8KA 3VINA 1OINA 3SURA 4CVWA 3DYMA 4PCTA 1V0NA 5ABEA 4DWSD 1VJSA 3AHZA 4QLLA 2WKLA 3EDEA 3VD7A 1Y7VA 3S2CA 1TE1A 3VSTA 4NZFA 2VI0A 1F4HA 5A94A 3MUZ1 1BF2A 1PAMA 2UY2A 5CXPA 3CZ8A 3N18A 3ZM8A 4PSPA 2GVYA 3LPFA 4AISA 4A3YA 3BUPA 2EJ1A 3AJ7A 3M46A 4KGJA 3WDRA 2W91A 1BYDA 1ITXA 1K9TA 1GOMA 4AZHA 4FLQA 4FNRA 3CH9A 1XD1A 1JZ7A 3AHVA 1AMYA 1J0ZA 5D4YA 1ODUA 1B3ZA 3AIVA 5ABGA 3LRLA 2VURA 2W92A 1UA7A 4L4PA 4ZENA 3A24A 1QW8A 3OLGA 2VX7A 3QHMA 2WHMA 2GJXB 4HPGA 2DPEA 5GQBA 2WVSA 3A4WA 1GJWA 4IPLA 3AZTA 2DT0A 3CGTA 1QHPA 5D8WA 3EDFA 3AS1A 1QI4A 2OYLA 3W24A 3LMYA 4CCCA 3AS3A 5EBAA 2WK2A 3ECQA 2J4GA 2GDVA 4GQRA 1C8XA 4V2XA 4UFKA 5A2AA 4JFTA 1EOKA 3CBWA 3AZRA 1FP8A 1RH9A 1TA3B 1KWKA 4J3UA 3VIMA 1E3ZA 4AZIA 3GH4A 1HP4A 3UR7A 1OBAA 4E8CA 1RPKA 4ZE4A 1PZ3A 2PB1A 3J7HA 1XSIA 4KH2A 3GDBA 1BGGA 1ZBWA 1UKPA 1DP0A 5A8NA 4MNMA 5CJ5A 1CNVA 2IGTA 2CERA 3DX2A 1MWOA 4CD7A 1SZNA 4FLRA 4AD1A 2XG9A 2V3GA 3PTMA 1UR0A 4GZIA 3IK2A 4J28A 3VIFA 2J7DA 3DDGA 2ZXBA 3S5YA 1E4IA 2ZUSA 1JYNA 5E6ZA 2WWDA 5E09A 2PWFA 3CHDA 3L4UA 2W66A 2YBUA 1PX3A 3RJYA 4EKJA 5FOOA 2GFTA 3ARSA 3JUGA 1MXGA 4AYSA 4PUEA 4JAWA 1CYGA 3DYOA 4N0RA 4HU8A 2G3JA 3AHTA 4NX0A 4DO5A 2V3FA 1H0IA 3MU7A 3VNZA 3OGRA 1GJUA 2F1AA 2XSBA 3ARYA 3CMGA 1TMQA 1CXLA 1W3KA 2ZUVA 1UWQA 4P8VA 4HZ6A 1FFQA 3F4VA 1OGBA 5I6SA 3EYPA 4KWUA 1JAEA 5HNNA 1CPUA 5CPQA 2YJQA 1UH3A 2J75A 4MAZA 4F9JA 4MDOA 2VX5A 4NRRA 4M56A 2XN0A 2XWEA 3SCUA 1KBBA 5BWFA 2XJ7A 3WDIA 2DSVA 2FGZA 8CGTA 3WNOA 4ZXOA 1QI3A 4KRTA 4PMZA 2XVLA 3T08A 4CVUA 4JFSA 3VMNA 1JF6A 4V28A 3TA9A 1OIMA 1ISXA 2D24A 4CD8A 1MFUA 5LA0A 3A47A 1R85A 1MQRA 2EPNA 4CN4A 2VJXA 3HG2A 4CKQA 3WDJA 1E1EA 1ZJBA 2QMKA 3U7VA 1BYAA 3MMDA 3ZJ7A 3IAPA 4AD3A 1V3HA 3SCSA 3WBEA 4J3TA 4MNKA 1US3A 3S6TA 3ZMRA 1W9VA 4HP5A 4MNJA 2DSKA 4PYSA 5M17A 1HKMA 2GDUA 1LF1A 2VC9A 1MYRA 2PI6A 5CPSA 5C70A 2DQXA 3N15A 4Y7EA 3ZSTA 4EE9A 1EHNA 1EO5A 3PTKA 1QNRA 1E5JA 1KCKA 3VGDA 1EA9C 4KRUA 5D9OA 2YA2A 3F5KA 4QLKA 4GXPA 2WVVA 2BHZA 5EMYA 4PMUA 4P8UA 2F7OA 2X0YA 4MPKA 1QNOA 2A3AA 3W6LA 1QPKA 4Z2JA 4QFUA 1JZ5A 1E4MM 2ZX8A 1EQPA 2DSUA 3ZR6A 3KLKA 3IANA 3VGGA 4OZOA 1WZAA 3SCTA 3CZEA 4QCFA 1GVIA 4JHZA 1WB0A 3WDHA 2DGAA 4QDMA 4UQ9A 2WSPA 2ZE0A 5FCZA 1MQQA 4D1IA 3ARUA 3FHAA 3MSGA 3RIKA 5D9PA 2WMIA 3L4TA 1BLIA 3EDDA 1BHGA 7TAAA 2A3EA 4W5UA 1H11A 2VCAA 2YBTA 4AZCB 3SCNA 2XUCA 3VM5A 4GQQA 1MQPA 3UEQA 4W8AA 3AIBA 2NT0A 3O2LA 3PZVA 3ALFA 3AZSA 4B9YA 8A3HA 3WKZA 3WY1A 3T0DA 3WD0A 4UFJA 2JE8A 2X05A 5FIPA 5BYWA 2XIIA 1JDAA 1E40A 5EFFA 1JD7A 5BCAA 4TVDA 1JNDA 4W7WA 4XV0A 1BSIA 1VEPA 1ZJAA 1JG9A 5LA2A 1JZ3A 3WQ5A 1H3GA 3H55A 4BQ4A 4QP0A 1NWSA 3A3HA 3NJ3A 1B3WA 1QW9A 1EIBA 4OBSA 3BCFA 5GPRA 3RO8A 4TTUA 1JIBA 2WANA 1VBUA 2CBUA 4P8WA 2WM0A 4DM2A 5JIPA 3EJPA 1ZBCA 6CGTA 1B9ZA 2JALA 4UFHA 1DWHM 1V0LA 2J7EA 3PBGA 4E4PA 2VVNA 1I75A 4X0VA 3N12A 3WNPA 5I2UA 3SUSA 4K68A 3U5UA 2ZOXA 1KGWA 4P7QA 4MB5A 5IFPA 5I23A 1RD6A 1JYVA 1KR0A 1W1YA 1V3JA 1BYCA 5LYRA 1UD4A 4FLSA 1GCYA 4D6IA 3W4RA 1TR1A 2WYSA 2VQUA 2PWHA 4AC1X 3VIPA 4PMXA 3WF0A 4BF7A 1BVZA 3IGUA 3CC1A 4M82A 1ZS2A 3CZSA 3OZOA 1ZBVA 3EDKA 2CIPA 5ABFB 1HP5A 1C7SA 2YL5A 2X2IA 5A6KA 3VX1A 3DECA 1BAGA 1V3LA 1UR1A 2J62A 4MDPA 5F7UA 3GXFA 4UQEA 4YN5A 3WEMA 4IM4A 1KWGA 2XM1A 3WH6A 1OT1A 1WE5A 1PJ9A 4PTXA 1SR0A 5JBFA 3FW6A 1NARA 5CG0A 1PX8A 2ZICA 2YLLA 1E55A 2EPKX 3RJXA 3L4VA 4L4OA 2XSAA 5DF0A 1DWIM 1T0OA 4CCDA 3HG3A 2OW6A 3EJUA 3UCQA 5HXMA 4TX8A 3VD3A 4RE2A 1CGTA 1BPLB 3WY3A 1CZ1A 1PBGA 1OD8A 2DH2A 1TQVA 1E15A 2F2HA 1E6XM 5JBDA 2CHNA 5E70A 3ARTA 3K1DA 4UQBA 3K46A 4J3WA 2BHYA 4OBRA 1HF6A 1KXHA 4C7FA 2YA0A 4JFUA 5A6BA 2E0PA 4CGTA 1WDPA 2VR5A 3VIIA 1KQZA 1FP9A 4PMNA 1KR1A 3L4WA 4C7DA 3U7BA 1E0VA 3PHAA 4YHEA 3ALGA 3VSUA 2WC7A 1LG2A 1E0WA 4PTVA 3WNMA 1VFMA 4Q22A 3FHQA 4IISA 1PX4A 3WD4A 4CD6A 5A69A 3OA5A 3RPMA 3F5LA 3DDFA 3D50A 3ZT6A 3MV11 3I3DA 2YFOA 1V6XA 2D3NA 1U2YA 2VRQA 3GNPA 2Z1KA 1W9PA 4PRWA 3OGVA 2EQDA 3W26A 3VM7A 2J74A 5JBEA 3UG3A 4Z2KA 1W1VA 3U57A 2BFGA 3EJRA 4UZSA 3N1AA 1UD2A 2NT1A 2XHYA 4NRSA 3AICA 3KEHA 1D2KA 4MB4A 5A2BA 5ABHA 4CU7A 4KMQA 3TTOA 2V38A 1JL8A 2WBGA 4D71A 4M80A 2FYVA 3MUIA 3K8KA 3L4YA 2EEXA 4GZJA 4RE4A 2WZEA 2WPGA 2O9TA 3OIHA 3UG4A 4ACYA 2OWCA 4DWSB 2WMHA 3GNOA 2F18A 2DIEA 3OBAA 1MFVA 3LPPA 1GQJA 2PBOA 3WELA 5C8BB 2BS9A 3DYPA 2Y2WA 2ZX5A 1R87A 4CD4A 1JNEA 3BVUA 4AIUA 7CGTA 2WBKA 1TCMA 3D3AA 1DEDA 3WH8A 3MMWA 1R46A 1DWGM 5BXSA 1XHGA 1HN1A 1L0PA 4FF5A 1R7OA 3RM9A 2YDRA 3QGVA 1FH7A 2CITA 5JUVA 1XSJA 1QOXA 1W9BM 2J7FA 3MSDA 1UH2A 2FE0A 2GJPA 2VTFA 1CGWA 1R75A 2XFRA 2E9BA 2WAGA 3CZLA 1H2JA 4ZFMA 2YDQA 4PMOA 4MTVA 2J77A 1CBGA 1TQUA 3AHXA 2FHBA 3TONA 3TTYA 2DIJA 4PMRA 1QHOA 4ZXLA 4Z2IA 1EH9A 2W62A 2F61A 4AEEA 2J25A 3VILA 4JFWA 2WLYA 3HJEA 1M7XA 2GSJA 1UWIA 4AXNA 3ZO9A 4UCFA 3GXPA 4HPHA 3PZMA 3VSVA 4AZ5A 1FOBA 1QBAA 2DSWA 1CXIA 3HMCA 2CEQA 1WNOA 1XYFA 1BFNA 5E1QA 1O6IA 3II1A 1PS3A 3AROA 3PZUA 1C91A 3BLPX 4TOQA 4TXEA 4J7RA 2C0HA 3CPUA 1S46A 2GK1B 4ACZA 1HWWA 1JI1A 3BVVA 5I5RA 3SUWA 3WFLA 2VRKA 4GI6A 1IZKA 4XUYA 1HKJA 4UNIA 4ZEPA 4AW7A 4FNUA 2A3CA 1QNPA 3BXWA 4WK9A 3PZOA 3WUFA 4GKLA 1QHZA 1V6UA 2G8ZA 2WCGA 4AD4A 1SYTA 3NDYA 2ZXAA 2VVSA 2Y5EA 5DO8A 1FHLA 1E1FA 3QOMA 5A1AA 1DWFM 3WNNA 1E6RA 1K6AA 1XYZA 2J7GA 1LLOA 3T0BA 4RL3A 5M03A 3A5VA 2ZXDA 2QF8A 5HPCA 1M03A 5A6AA 3UESA 1J0JA 5BXPA 2XVPA 3GM8A 4BCEA 1B3YA 3ARZA 4WLCA 1W9UA 2HVMA 4PMDA 1ISYA 4OUEA 3ZIZA 3SUUA 1KQYA 1ZL1A 1J18A 1TUXA 3BLBA 3WFZA 1W2VA 1X6NA 2XYLA 4UTFA 2ZUMA 3AHYA 2YA1A 1VB9A 1JF5A 3GTNA 3LRKA 4ML4A 1UYQA 3FAWA 3VU2A 4TTGA 5E0CA 1U30A 1V0KA 1BGAA 3OLDA 1UKQA 4JL1A 4FNTA 2J7CA 2W61A 3EJQA 1G9HA 5BRPA 4AD0A 3BMWA 4UOQA 3WH5A 1DWJM 1B1YA 1ISVA 1CLXA 3SEPA 4CU8A 2PC8A 2ZUUA 1EOMA 1R33A 2XIBA 4F79A 3WQ8A 1V02E 1Q6FA 4S3JA 1QI2A 4MJ2A 1HL9A 5CQ1A 1NWRA 2FGLA 1CXHA 3DHPA 3W38A 4PMQA 4GO9A 5HDRA 2PWGA 2VT0A 1KTBA 1J11A 3VUPA 2V3DA 3WMSA 3VIKA 2W63A 3VD5A 1VFOA 5CGTA 1J0KA 1YQ2A 3BCDA 2ZX7A 3BGAA 3HG4A 2CETA 4ATLA 1AQHA 3GBDA 3AXIA 3AMKA 2YOCA 4NXSA 1PIGA 1UKSA 1KXVA 1CXFA 3B8SA 4ZE5A 1VRXA 3AMCA 3ZSSA 2BNJA 2VNCA 1UR8A 2UWFA 1O7DC 2VO5A 3AMLA 4J3XA 3BAJA 2ZIDA 3T0AA 2O9PA 4U2YA 3D51A 1H5VA 3MS8A 3ZJKA 2GJRA 4AIEA 3FN9A 4N42A 2AOSA 1SMAA 4D6CA 1NWUA 2X09A 1LJYA 3BAIA 1CENA 1UKTA 1N82A 3AXXA 3NSXA 1UQZA 4PMVA 3KL5A 4TVCA 5A8QA 4Z2LA 4PMYA 2E8ZA 4H7VA 3TV8A 4LYRA 4C7GA 1TVPA 1ECEA 3K4DA 2BVTA 4LXFA 3L2LA 2EBNA 4DUXA 1X6LA 1JDCA 2VUYA 3AXHA 3FAXA 3FY1A 1BG4A 1W1PA 4W93A 1J12A 1E0XA 4XB3A 4HZ7A 3WY4A 1W3LA 4R5EA 2Z1SA 4JKKA 4AZ6A 4AEFA 4UZUA 2VL4A 4H41A 4WIWA 5IDIA 5KZ6A 3A22A 4H8VA 1EQCA 1K9DA 3VX0A 1HKKA 3PTQA 5A6MA 1GUVA 3ZR5A 2IUZA 2YDSA 1OT2A 3AMGA 2J7BA 2GJXA 2W5FA 1JFXA 1E5NA 3ARXA 1FH9A 5IHRA 4DWSC 5DEZA 3LXBA 4BZYA 3WSUA 2YL6A 4YPJA 4GINA 1HJUA 3H54A 4PTWA 5AC4A 1BVNP 4TVUA 1C8YA 2WHJA 4M81A 3WEOA 1VEMA 4D6GA 2D0HA 3W82A 4ATWA 2D23A 1CXKA 2G3NA 3BLKA 2F7RA 1CTNA 1DWAM 1YHTA 2VZSA 3THCA 3WF1A 1Q4NX 1VFFA 2FH6A 4LGXA 1EDTA 1UWRA 3NCOA 2PWEA 1TA3A 1JGIA 1L8NA 4M8UA 5GNZA 3LX9A 3H53A 3GH7A 4B15A 3CTTA 3HG5A 3VGFA 1HKIA 3BSGA 3NSMA 2BXYA 5GNYA 2Q8XA 3AMDA 3M07A 1CIUA 4BQ3A 2F7QA 1D3CA 3AQUA 1CLVA 3GBEA 3B9DA 3OB8A 3U5YA 2OWXA 4AZGA 3VDAA 2OSYA 5JIWA 2YLAA 1UUQA 3LPOA 4F8XA 2FHFA 3BUIA 4NSBA 3CZKA 1ISZA 1KGXA 3QHNA 1ITCA 3SCVA 3LPGA 1TQSA 1UD8A 3WH9A 2DT2A 1Z32X 3K4AA 4AIOA 3UERA 1GOWA 2VZUA 2WHKA 3ARQA 2V5DA 3NSNA 3KWXA 2WMGA 1ODZA 2ESCA 4U3AA 2D73A 2JIEA 3CUJA 3D4ZA 3WUBA 4U33A 5HBFA 3WNLA 1OCQA 4UOZA 1V6VA 2CKSA 1B0IA 1SMDA 4DUVA 1MXDA 2O9OA 1MW0A 3NYDA 3W25A 4RE3A 4UOJA 1B30A 2VZVA 1CGXA 1IZJA 1GQLA 4W89A 4EAMA 2OW7A 4W5ZA 1K9FA 4W86A 3ARRA 1I1XA 3BUBA 2FDMA 2WC3A 2V5CA 1MW1A 3MUAA 3DX0A 1E9LA 3OG2A 3LRMA 4HOWA 1H4PA 3AI0A 5IFTA 5EB8A 4IPNB 3CZNA 2WHLA 4U3CA 1E6ZA 2X2JA 4J3VA 2OSXA 3W29A 1HXJA 3VIOA 2Y4SA 1FHDA 1OM0A 1TZ7A 1D7FA 1KTCA 2WCSA 1VBRA 4AD5A 4B16A 2XTKA 4CU6A 1QNQA 5IHSA 1JD9A 2J7HA 4UR9A 3VDHA 2A3BA 3I3EA 2QV4A 1XCXA 1ZU8A 4HMDA 1BQCA 5A2CA 1H49A 3SCQA 1GW1A 2D0FA 1HL8A 1SFSA 1V6WA 3IAQA 5DT5A 1BYBA 1KBKA 1R8LA 2YFNA 3APGA 1UWUA 1H09A 1GOIA 3PZ9A 1AQMA 4HMCA 3AFBA 5HPOA 3EMQA 5D9NA 3MI6A 2ZUWA 4WF7A 2WSKA 3DX1A 1Q6GA 2F8QA 3SCOA 1QX1A 1M04A 5I3DA 3EBVA 3ZT5A 3SCWA 4MADA 4MB1A 3EDJA 1A3HA 1LL7A 2ALWA 3ZJ6A 1LL4A 4FNPA 2DH3A 1UWTA 3MANA 1XH1A 3PZTA 4AMCA 4DUWA 4U31A 1V6YA 1OWQA 3ZOAA 3LXAA 1JI2A 1TG7A 3DX3A 1BTCA 1OIFA 4MJ4A 1C7TA 2XWDA 3GXMA 4F9DA 3POHA 4Z2GA 2Y8VA 2AMGA 1GORA 5C71A 4DM1A 2G4FA 3HU7A 1EDQA 3K8LA 3AIWA 4LYPA 6TAAA 3WF3A 2X1IA 3AIUA 3SUVA 3OLIA 1R7AA 1EGZA 4PEEA 3IJ9A 1IV8A 4P7LA 1HJQA 4GIAA 3VGEA 3DC0A 1J0YA 1GQIA 3ZQ9A 3CV5A 2UY4A 4W87A 5D8ZA 2JF7A 5CLTA 2E9MA 1HVQA 4D6FA 3BVXA 1FH8A 4PCSA 1V08A 4U2ZA 2CESA 1UASA 5FL1A 1LL6A 2UY3A 2GUYA 3MV01 5A6LA 4W84A 3PN8A 3S5ZA 1NOFA 1RP9A 3BVWA 3CO4A 4MAVA 2UY5A 1QNSA 2X8RA 1MW3A 2X0HA 4MB3A 1NP2A 3VD4A 4MNLA 1VENA 1C93A 5BXRA 1OB0A 1JZ8A 3ARPA 3T09A 2TAAA 3D4YA 4DO4A 1WKYA 6A3HA 4F66A 3CHFA 3T2PA 4PTMA 1O7AA 1WAWA 3B9EA 5KEZA 1UA3A 1ESWA 2OWWA 4UFMA 3ZJ8A 1XV8A 1XD0A 4AMXA 4W7UA 3HZ3A 2CNCA 4FMVA 2VZTA 2BXZA 3WN6A 4W8BA 2OYMA 2XGBA 3QHOA 1KFWA 2EABA 3WH7A 2XN2A 1OGSA 2CPUA 2JEQA 3WBAA 5I79A 2WB5A 1G5AA 1TQTA 4HZ8A 1V3IA 2WC4A 2PWDA
chains in the Genus database with same CATH superfamily
3FQNA 5FJUA 1GWJA 1JPST 2EE0A 3SKMA 2XFYA 4HD9A 4M24A 1ZLUH 1W9XA 3FO1A 3G5XA 2RHEA 4J3SA 1CQYA 3S42A 4HOXA 3NJXA 3PWJB 1NMCB 3W57A 1PIFA 3O0RL 1OXYA 4OR1A 3MCYA 3MRPB 2QF7A 3VKKA 1G7JA 2Y24A 1SR9A 3N0PB 4RNRA 1NLBL 2R1XA 1HYRC 2J6EL 4KK6C 3OPZH 4DXXA 4S3DA 3IDMA 4OGYH 4PUBL 5IDZA 4Y4HB 3V2AR 4IIDA 4CNSA 3GTXA 2VB5A 1YRKA 2ICES 1ZXKA 5G5DB 3P11H 5CZRA 5CEWA 4PJDE 5CF3A 5GZND 3Q37A 2XIQA 5MERB 4JTLA 4HIEA 4BBWA 2VGIA 1X9QA 4IFKB 4Q8NA 4E4UA 4NQQA 3UG5A 4G5DA 3FQWA 1WSST 3S8FB 2BM3A 3C52A 1CT8A 1XDTT 2VLJA 2GYSA 2OODA 2DIKA 1D5MA 4TMPA 1JRHH 3A6BH 5IB3A 3TCLA 1P5UA 4S0TD 3ROOA 3EB4A 4OJFH 2ZUYA 5DQ9A 3T1FB 1DQVA 1NPJA 1DJQA 1UR2A 5AKQA 1J8KA 1CFNB 3P4MA 4KX7A 2OT0A 4QYOA 5EYWA 1J1OL 4JFFD 5E2VH 4ZTYA 4FJYA 5AFDA 3QDGB 1V02A 3CJJA 1Y8BA 2OELA 4OV5B 3UPCA 2E40A 5M95B 5DMIL 1QVOA 1DANU 2ZZ7A 3L5WA 4FP8H 3ZT7A 4E3TA 3KLDA 5EKYA 2Q3AA 3SHSA 4BSWA 2ZTJA 1VEOA 1ID2A 3P62A 5F4WA 3R1ZA 4V11A 2ZP9A 3UTSB 8FABB 2PPAA 2R1LA 3ARFD 1G84A 1ZANL 1U8MB 5AECA 5BV7B 1WZLA 4BCZA 1G7MA 2VR4A 5FEBA 3MXWL 2QSCL 2L7JA 3Q3GB 3HTLX 3CFIC 1ZPUA 2BOGX 4Y2OB 3L3KB 4LF2A 1CB4A 1P5UC 2OSWA 3LB6C 3SRFA 2J72A 3KW8A 3MT1A 3QTGA 4ZO9A 4FJZA 3E5PA 4BE6A 5GGTL 1RCQA 3FUNA 4XCEA 3WFHB 3PUUA 3PM6A 4DVRL 3GY1A 5GRVK 3O3DB 4JFFE 3TEZA 4JM0A 4X0NA 1I9EA 1MUWA 4DY1A 1UOLA 3MNMA 1QFWM 1H0GA 3L65A 3K5SA 3MNVA 3GX9A 4FXJA 3QBUA 5DHEA 3GSOB 4HMNA 2FWSA 1XWYA 1F6AB 3PXJA 1KKOA 1FVCB 4WENB 3GUFA 2GBTA 4MOZA 2P3YA 2XZCL 1Y5WA 1C9WA 4F91B 3GI8L 1JVNA 4NWUL 3ZO0A 2R4SL 7TIMA 4IZGA 3VOCA 5E08H 3WF4A 5LA1A 3QHTC 1A53A 1UQYA 3RZCD 1T2XA 4DXKA 3NSCA 1KLGA 4GIEA 3P5YA 2JQAA 1U8JB 2KDGA 4PGLA 2YC1B 4XNMB 1YPFA 5I24A 3QPYA 3G9AB 2FGWH 4LUTB 1QK2A 1TJIH 3WLNA 1PE1A 1MH5B 3CAWA 4OFYA 4G9PA 1KTJA 1HJWA 2FATL 1I0BA 1TWSA 3ZHLA 2DUXA 3TBWB 4D6DA 1TJ2A 5LDUA 1ME9A 4RMRA 4LWWA 4EF8A 4FG4A 1TWIA 1M1XA 3BAWA 3QY8A 4N26A 4IICA 3PP4L 1JXKA 3GHTA 2EACA 1MREH 4ORIA 4AQOA 3N3MA 2NX3A 4BH7B 4F92B 1SXSA 3QH3A 3K7UA 2YAPA 3ETTA 3KBPA 2IXUA 4IBYA 5C6PB 1IGJA 3ZLGA 3X17A 3WQ6A 1H8LA 1AJ7H 1K4CA 4GBDA 5CSUA 3L3HA 2G0WA 1TCRB 2OTPA 4H4IA 4ALAH 1T83A 3QJRB 4NQVA 5H35A 2VLLA 4NT6B 4LB3A 2JTYA 1AH4A 4PWJA 4JG1L 4XMKH 3VXUD 2EAEA 4OGZA 3A23A 3O3EB 2NWSA 2Y62A 3RFZB 4A22A 2WINA 3LRSA 4LSSL 2OV0A 4K3HA 3KFTA 1V5JA 4G7QB 4PTDA 3T42A 3Q65A 1KYAA 1OYCA 2BVDA 2VDKB 4QRQB 5JR1L 5CR1A 5CBAB 5IESH 3U46B 4QCIA 3BKMH 4U1NB 4PB9L 2A4AA 4MY1A 4B0MM 3LTYA 3QUXA 4BGDA 3OXRA 5D7IA 3VE9A 4FGMA 4Q6IA 2FQFA 3WEZA 1OW0A 4LSVH 2OMUA 1V3KA 4GGBA 4QTIL 1P5VA 4JDTH 3RWJB 1W3JA 1OINA 3QRGL 4OF8A 3TH6A 4J3OH 3GHEH 3UL4A 1Y7VA 3VXUE 1BZ7A 3B9KD 1IEVA 1CW2A 3KXQA 4Y16A 1BVKB 3CZ8A 1N64H 5EEUA 1RUQL 2EJ1A 2G60L 4HC1A 2W6RA 5KBPA 4JUTA 2IH1A 2OA9A 3FVMA 3PFMA 1T1ZA 2P8PB 4HTBA 1AD9A 4IP4A 5ABGA 2VURA 1A6ZA 3D0LB 3NZ1A 3HKZA 1HSBB 1XIBA 1QACA 3LRHA 3Q6FB 2AKZA 4NI6A 1OTTC 3DPBB 1ICQA 4HJUA 4BZ1H 1TU2B 2ALAA 5KJRH 1KD0A 1BKSA 3REVA 1C8XA 2VD8A 2H6UA 4LCWB 2VP8A 1FP8A 1UA6L 5IVOA 3MAWA 2A6IB 4O4YL 3RWDA 4Q6IC 1FVDB 1OW0C 3VIMA 4OD3L 5HYSB 4GW5A 2HP4A 1A14L 4BHYA 1T7XA 2HA1A 1ZQ5A 1XSIA 1G4EA 4AF0B 5HI4C 2F38A 3MHGA 1SZNA 5EZLB 4UT6L 3VD1A 5T9BG 3BZFA 2PWFA 1T1WA 1EPVA 2Y7SA 3BAEH 4PUEA 3EYOB 3MJYA 4M7LL 5L9DL 3MRDB 1U8KB 1U3HB 2UY6A 1K5NB 1EC7A 4U6XA 3G8EA 4NO5A 1WZ1H 4N8CL 2V3FA 4U6YA 3JWOL 1NCNA 4YFDB 3W1NA 2OMZB 1CXLA 3PB2A 2MCPL 1UC4A 4P8VA 3WJXA 1E2VA 4IWWA 3SM0A 1EUUA 4OJDH 4D8AA 1NGZA 5CZ0A 3VAEA 1FL3B 2DSVA 4NJAL 1ADQA 4ZXOA 3EAKA 2CZ5A 1DQJA 3KXFB 4I48A 2VXVL 2PDPA 1ZLWH 3BTNA 1G6RB 4CN4A 2VJXA 3CPRA 4AJYV 3V5HB 1XF5B 5J13B 2VR6A 3IAPA 1DL7H 1R0AL 4HP5A 2DSKA 3B5GA 4ORZC 1A9BA 2OQJA 2ZBTA 1HKMA 2GDUA 4QWWD 3TC6A 1EBPA 5J6SA 4RR4A 3VFPA 3PTKA 2NNAB 2NLJB 2PP0A 2XN9A 2YSWA 1GSMA 4MAUH 4ABVA 3SKNB 2YA2A 4KQ3H 1HYSC 1GRWA 5DSCA 4XBKA 2ZWKA 2PYFB 1AJZA 4HUUA 1JZ5A 2N4IA 1EP3A 3H0TB 1NC2A 1D6VL 3MJ9A 4UQ9A 1BQ5A 1FFPB 5FCZA 5DHYB 3CIWA 4OJCA 5EOQL 4BE5A 1I0DA 3N50A 1B4KA 1BHGA 4A04A 2OX4A 1O5KA 3N42B 2J88H 2XCMC 2YBTA 3LKSA 3APDA 3NJFA 2EVGA 1LGVA 3O2DL 1W72B 5CP3H 2FJHB 4XNZC 3HFFA 2MNRA 3WLJA 2BODX 3O2VL 2BGSA 3OJDB 4QHNA 4AYBA 1R3TA 1CICC 5L9FA 1H3GA 3RDTD 4EPSA 1JGLH 3P0XA 5DJ6B 4N2NA 2H41A 2OZ0A 1Q85A 2OJEB 4F58L 3ES7A 3ZKNC 4HWEH 1MSSA 1ZAJA 4ZUSA 2RFGA 4HH9B 1K7EA 1IC5H 1WJ3A 3NABL 4GISA 2XZ9A 3QULA 4K68A 1T8XA 4DN3H 2WTPA 3TNMA 2DQUL 4KTYA 4KXDA 4HJTA 5ID0B 4UWMA 4LAQH 4GLRH 1CFVL 2Q3XA 2MOVA 4LEOA 3UTTB 3LKQA 2N56A 1ROCA 5TQ2H 5C08B 1HP5A 2ZA1A 2BNRB 2EVHA 3WTYA 3SDAD 1V3LA 4WHYH 3CVIH 4AM0Q 3WKQA 3ZU8A 1DKWA 4HCLA 2PODA 1MI5D 4K9EH 1E5BA 3VFUA 5DI8B 4Z7UA 1JUKA 1DSFL 3BSZH 3STZB 1SLWA 3RAJH 3TS8A 2NY3B 4M8RA 5DY2A 2Q20A 3EJUA 5D2YA 2AQOA 1BPLB 4IKIA 4NAFB 4F8NA 3OODA 2Z0UA 2PDUA 3DG3A 5K9XA 4DKFL 3WIAA 4UU9B 4JHBA 3UBGA 1NFGA 1XGEA 1VESA 1R3JB 4OZGA 1TR9A 2E0PA 1G0XA 1KQZA 1T4KA 1DBAL 3C60B 1YECL 1YX1A 3VSUA 3S36L 1E0WA 3LLDA 2NY5L 5MEPA 1WFJA 5JA9A 5AZ0A 3WD4A 1HHIA 3L7FB 5BUAA 3D50A 1NCOA 4I88A 4PJ8D 4YNGA 4Q9QH 1KB5L 4HNVA 2RR3A 1PDKA 3FTXA 2X41A 4G7VL 4HS6B 4RFNB 4Z1DA 3QDJB 4FEMA 3EO9H 3CQKA 2WBGA 1MI5E 3D4GA 3SYPA 4N22A 1MFAL 1MKFA 2E1DA 3NIGB 2C9AA 3GO1H 3WK0A 2DIEA 1HHGB 5D93B 1BXBA 1KB9K 4UM8B 3RRQA 2BS9A 3MJ7A 4CD4A 3A13A 4ZBCA 3L1OH 5TPWH 1BCIA 1OE3A 2QGYA 5BXSA 2H32H 1HN1A 4B90A 5LG1A 1FH7A 4LNRB 5GRYA 1JNNH 1S78D 1RH8A 3OAUH 2J77A 1FL5A 2FQDA 2FHBA 1P6BA 3H7UA 1BFOB 4XBPB 1S7QA 3S96A 4AEEA 5LGJB 3VB9A 1JJUA 4FE9A 4HPHA 3QQ4A 2X9XA 1PCXA 1WK0A 2H3BA 1HL5A 4IPJA 4ELMB 5J1SC 3HC0A 5K69A 2JELH 4J7RA 4JN1L 1C12B 1MNSA 4PRTA 3HRZA 2ZJSL 5IQ7H 2VE6A 3N43B 3X3FL 3EX1A 3GR4A 2CLRB 1QG3A 5EMLA 4KKPA 5HPCA 1RBLA 4WGVB 2IQDA 1LE5A 5I2IA 5CBEB 1DDHA 1OFQA 3FT3A 4APXA 1UB6A 3TN0B 4JY4A 2G3FA 4M93C 4GPVA 1TSRA 5JW5B 3IDGB 4FZ8L 1UYQA 4RPPA 3NACL 1ECYA 1E9QA 1V0KA 2FKPA 3G2GA 4IIBA 1NDTA 1U8QA 1UKQA 4PV9A 1ASOA 3IU3B 4FS9A 4O50A 4AD0A 2P53A 3NCBB 3NOYA 4CDGC 5EUKA 3SEPA 4XP5H 3TW6A 3QY6A 3E8UH 4M5SA 4HHGA 2Z7GA 2UWEA 3DBXA 4XMPH 3DJZA 1P7KB 3UT0A 4GO9A 1U92B 2GAZA 2BSLA 3TZNA 4XN4A 3SO3C 5TTRA 4LAMA 3FSOA 2AC0A 5H8PA 5JW4Q 3VD5A 1VFOA 3O6MH 4MNGB 2NLYA 2X4QA 4ACTA 4MFDA 5LXXA 2IAND 4X8CA 1FF5A 4HJ0D 4U1HB 3IGSA 1JE6A 1H8SA 4P5MB 5JQ6L 1MNUL 2VN4A 1VRXA 5TQ0L 1S9KC 4U2YA 3QC5X 3D51A 3UGRA 1DJWA 2GJRA 1OTSC 4WNSA 4L9ZA 1CX9A 1AOHA 1RQEA 1G4SA 1LP9F 1KFJA 1VACA 3NSXA 4PGBB 4YR6B 3K4WA 5DD5H 1ME8A 4MJJA 4P48A 1JPFA 5I19L 1W8GA 2V8MA 4U6VL 1CGSL 3DESA 1FE8H 3TZVB 2K8QA 3FAXA 4LUJA 4XB3A 5F3FA 3W7LA 1VFAA 3VXMD 1HOEA 1TPXC 1O9ZA 3G1HA 2PDNA 1LP9E 4HNLA 3UROR 2L7UA 1C9DA 5C0DA 32C2A 3PTQA 1GUVA 3OG4B 1XGDA 3TH4T 3LXBA 2IANE 2RH9A 3TAOA 3SY0B 3QSRA 2ITEA 4QTHB 1VC4A 5C0FA 5C07D 4NQEB 3NTCH 1UWRA 3NCOA 1TA3A 4Z3IA 2QHRH 1MHHA 1F18A 1NAMA 3GBML 1O68A 2DL9A 2EKGA 4ADSA 4ODWA 3FT4B 4BQ3A 4BWWA 3WS3A 4JTKA 1CN4A 3NJVA 3GBEA 4OZ4B 4FG6D 1BQLL 3MYJA 4JQXA 2OSYA 5JIWA 2IBZX 4PJFA 4O1CA 1OGAD 4O18A 1NM4A 4HIJB 3NPXA 4PR5B 3CCHA 4RGNC 3QXWA 5FYJD 4MUZA 2Q01A 5FV1L 3HLKA 4M7LT 4MAYB 3VXME 1RULH 3UYCA 3OR6A 1CWVA 3D4ZA 1XISA 5KSVB 1ZT7A 3NH7L 4I9JA 4DUVA 1MW0A 3D7PA 3ANYA 4K0OA 1Z41A 1FI8C 1IFGA 4Q8WA 3FUIA 5HBBA 2WQDA 5C07E 2LU3A 4HQQH 1EXGA 1RJYB 2VKWA 4AD5A 4Y1AA 43C9A 4P23B 4MHBA 4L8BB 1AC0A 5B39A 5EA0H 2XWXA 2BSCA 3CSYB 3NESA 1HHJB 3VACA 4JQXC 4L5FH 2YARA 3SZKC 1T3FB 1YEIH 2OCJA 1EUTA 1RY0A 4U1KA 3QQDB 4HMCA 2KQMA 2CK0H 1TQXA 1LM8V 2AP2A 4JO3L 1O6SA 5D8JL 4NZRH 4Z78A 1KOAA 3OD3A 3LNEA 4DUWA 3MC5A 3BARA 1UM5H 1WVZA 4W9ZA 1AODA 2PUQT 3Q5TA 3LA4A 4HT1H 1FKXA 4PRHB 2QGHA 4EP8C 4F9DA 1OAUL 4Y4KA 1WTGT 2R51A 3D39B 2K7QA 1MQKL 1KDIA 1JPTH 3AIUA 3CLFL 2O61B 1ZTVA 1FP5A 4WEUD 5D8ZA 4DEPB 3FU9A 1DBBL 1EF3A 1EUAA 1Y1DA 1VBJA 3U7AA 4ADIA 4NS0A 2UY3A 3B8UA 2GVLA 4X7SH 1NSNH 4MAVA 4LOEA 2DW7A 4MB3A 2YKLH 4LBAA 4DO4A 3LTPA 4G8FB 2OULB 4RZKA 4X7EC 4AMXA 3HZ3A 1FWEC 3QFJB 2XGBA 5DWUH 4RW5A 1YE4A 1H15A 4HDIA 2TRHA 4ODBD 3GI9H 3APCA 2Z0BA 4FFYA 5FYJL 4Y4KC 3FB5B 4LEXL 5C8JB 4AG4L 3S36X 3FCSA 4WCJA 1JPDX 1WC7A 3SGGA 3DGDA 2R1NA 2E25A 3FBQA 1WPCA 3WLKX 1B90A 1QWUA 4LV9A 1F05A 2VLRB 3S47A 5FW6A 1A4KB 2Y23A 8TIMA 3HGSA 1IBFA 1VBHA 5HGHB 3QUMH 2J1XA 1ZTMA 2ZVIA 2NXZC 2WMIB 2IWFA 1X97A 1DVTA 3D48R 4ILSA 1TNNA 1MJUL 5FJTA 2XYBA 1WUFA 3BGJA 3RIFF 2RAGA 2NQCA 3WTXA 5IB2A 2OMWA 4R0LB 2PO6D 2R6OA 3QMRA 2OMVA 3MRLA 1T21B 1HZHL 2I25N 4OLZL 3QUYC 2QDHA 3WN5C 2CMRL 1ORQA 5ALCH 3FJLA 4ERAA 3ISIX 1XIFA 1E9IA 4INFA 5CZTA 2DY3A 4WVXA 2Q7YB 4GXVL 2VITB 3NJGA 1OJXA 5CIPA 5HYSG 2BOBB 1TZGH 5AW4B 4M1CD 1BF6A 3RWIA 1NBQA 1W1IE 3KBEA 4X4MA 2NPLX 2WQAA 4HK6A 3H2NA 4MKMA 4KCVA 2WLMA 5DQJB 3QJQB 4D0CA 1X5XA 12E8L 5HYFA 3F5JA 5J12B 3CV1A 2G3IA 1DR9A 1ZZMA 4IOIA 3QK0A 4LLDB 3N06B 5EN2A 6REQB 2JI3A 1GEHA 4WEBL 3W7PA 1E4LA 3QDMA 3AYSA 3BYYA 1QBBA 1RVFH 2EDNA 3UEZA 2Q6WA 1MZZA 3DV6B 4OCRH 3GC4A 5DRCA 3NQ7A 3BJLA 5EMJA 1QLEL 2HJLB 3U6RA 3MMUA 3F7VB 1MPAL 4N4QA 1YEHH 1BGXH 1VPYA 1HI6A 3IJYB 4G9FA 4NAJA 8XIMA 3QWOA 5FFLA 5F7YC 4AH2B 1M53A 3FH7A 4O5LL 3PHSA 1LLWA 4NFDA 1CE6A 4YO0A 3X12A 3EKLA 4FHKA 4K8GA 2M8XA 2XFXB 2CXGA 4CNOA 4LAJH 2UUDK 5CD5D 2GK1A 4X6CB 4M7ZC 3VTAA 5E1AB 3VWKD 1V7YA 5JPNA 4U1JB 1JZ2A 3OJMB 4B6ZA 3CX5K 1SJAA 5BZDB 4XN2A 1NIFA 1JV5A 4MWFB 1JWUA 5ICXB 2R2EA 1KJVA 4EPEC 5K39A 3MJ8B 1KBJA 3QHZH 1NFIA 4B92A 4W88A 2OB3A 4JTAA 2E5EA 4ZW7A 2OU4A 4QROA 2DWEB 3ELAT 4NRYA 3BZEB 4B9ZA 3O6DA 4TLSA 4LVFA 2CLPA 2YZ5A 3M6YA 2DKMA 1JTOA 1NJ9A 5EU5B 1N8ZA 3RWGA 2I7GA 3REWA 1D5ZA 3ILPA 3MLRL 4H40A 4D3CH 3BZDA 2F7PA 4UNUA 1A5UA 2WXDM 4Z77A 4ADGA 4I2XE 3W1RA 1P6WA 4B5ZA 1ZIBA 1I7ZB 3PP7A 4KHTL 4ATDA 4EN2A 1BIIA 4LUSB 2BP0B 1W37A 3SGEH 4YHYB 4JQ2A 4GRWH 4U6HA 5M3WA 3VC6A 3UR2A 3N1QC 2ESVA 4LZKA 4GNVA 2P52A 4MMZB 1DE5A 1GHFH 1KCVL 2GY7B 3BPLC 1OK8A 5C09D 2JCWA 3IJEB 1GVYA 3ITVA 1YEKL 1OVZA 4V27A 2GZXA 2ZNXA 4HUVB 3C08L 4R3SB 4I9XA 2N1KA 1QFUL 3W7OA 1SY6A 3THDA 1ADWA 4M4RB 1R3IH 4TVPL 2PTDA 4JHAL 2Z3FA 2XA3A 3WXWH 1RLWA 1W31A 4I3SH 4OM1H 5HJYA 2VLKD 2JKPA 3MNWB 4PBWD 4N2KA 3FMGL 1EIXA 4XO6A 3GMMB 2AITA 2O0TA 1KIPB 4Q6XA 1JHKH 2LU7A 4JUSA 2QUMA 1GPFA 1H50A 1DJHA 5DQDL 4JTCA 1E28A 5HVHC 5G2NA 2I60H 4C6NA 2A9BA 4MTMA 2VC6A 3SIMA 1WBYB 1WFMA 3HUJA 4P59H 1HQ4A 5C09E 3B1UA 3WSQL 4JIRA 1S3KL 2Y1VA 2K1MA 4PGCA 3FQYA 5DVOA 4IRSB 4PSRA 3TX4A 1NH6A 2IGFL 5E8OB 1SN5A 1YNPA 4CSZA 4PG2C 2H0PA 5KYWA 2MNWA 2CRYA 5F7HA 4AKQA 3VNYA 1XF3B 5HYIA 3UVAA 5ENWA 2QVTA 3IRDA 4OI8A 1I8LA 2N0MA 2P8MA 4GFIA 2VLKE 3RRAA 3QCVL 3EBIA 1RMFH 1JGEA 3F85A 2F53D 5GGSB 4KGJA 4HF5L 1ZLPA 3ITTA 3MI3A 2ACUA 4AZHA 4OHQA 2CBPA 5LGHL 1BEYH 1TEFA 2ZZ5A 3LQZA 2OOGA 1H7PA 3K6OA 4G71B 2F6XA 3MOBH 1UA7A 3KJ6H 1WUZA 2BSDA 5C9WA 3LYEA 3GFZA 2WHMA 2Z2UA 2GJXB 5JLZA 3KCPA 1EZSA 3CGTA 1E5YA 2P3EA 4YDVA 1QUNA 2D2JA 3IDYB 1RZGA 2Y61A 4MVAA 2EIMB 2RD0A 4UUJA 3SBWA 3HPFA 5DD0H 2Z2BA 2QBWA 4ZNEA 1RPKA 2JKSA 4NSKB 4APQC 5D33A 1PZ3A 4KRPD 1C5DB 3X3GH 2CUMA 1DP0A 2HJKA 1MY5A 2CERA 3CDGA 1I8LC 2ERJB 1IC0A 3MZ2A 4RISL 2FLBT 4JPWL 3IPWA 5EU4B 1YC8A 1UCBH 3IFNH 2PXYC 4EKJA 2F53E 4LVNC 4X9FA 5FOOA 1Z3GH 1VLWA 4PD4J 1N19A 4F27A 4JFQA 5LBSA 3KBHE 1FO0H 5F97E 2QJHA 5A40E 2HXTA 4HU8A 3FT0A 3JWDH 1S7TB 2EKSA 3EGSB 4O0QA 3BHBB 5HI3C 3KYMA 2B39A 5FPIA 3SYQA 1CLZH 3P74A 1MVUB 3DX6B 1KCSL 3ARYA 2CIIA 2EUZA 1QBLL 3D3VB 4HZ6A 2IDCA 3F4VA 3T4CA 5KZCD 3D12B 3F2BA 5ANME 2VDPB 5DANA 4LF3A 1A6UH 1IJNA 2BOLA 3W83A 5F2IA 5AW3B 1QI3A 5T3ZH 1NGYA 3FO2A 3T6VA 3SSZA 1RVKA 3T4AA 1Y0LB 1U8IA 4F7KA 1RZJH 4N6RB 4DB7A 3N9SA 1FG2A 2CU0A 2EPNA 1IE7C 4CKQA 4PRPB 5DZVA 1BYAA 4HZ1A 5T1LB 3O05A 4JTHA 3S6TA 1Q3NA 4MBOA 1UGKA 1SOXA 1WEJH 1M6JA 2J9YA 4E5XA 3S9DB 5DCCA 1BFTA 4F8PA 3UC2A 1TTAA 3BKCH 2FSDA 5FHAL 1QNRA 2ITDB 1I7UB 4RNHA 4LFYA 1RLDA 3ZL4H 4OZFG 2PGFA 2A4EA 2R15A 5A2IH 2UZIL 1N8WA 3MX0B 5KTLA 1YMYA 1C5BH 3WL9A 2X6AA 5ICZB 3PBUA 5C55A 2YGVA 3CAFA 3PDOB 4DNMA 4GUOA 1BWWA 1NZRA 3G77A 3T4AC 1OCZB 4EUPB 2WZ6A 5GGRY 2QDWA 2CH8A 2E6QA 4LNVA 5EFFA 4GUFA 5AYUH 1I1RA 3VFSB 1A5LC 5B1CA 1KBGH 3HEIB 5DDHB 1GTFA 2A6KA 2OZ4A 4NHCH 4FHBD 5I8OH 3LM7A 1EEZB 5RUBA 1DWHM 1V0LA 5D7JA 5H2BA 2PTTA 2A5HA 2QKSA 3JUZA 1I2QA 5IMOA 3MRBB 4XSLA 1MCSA 3D07A 5AB1A 3GFUA 1TR1A 1WBXB 4AC1X 4MYPA 1A21A 1K8CA 2ODOA 4OFCA 4RZBA 3N2CA 1J87A 2E76C 3CPLB 4L1HA 3TFCA 5H8MA 3I6SA 4H9ZA 3SDCB 5F1NB 4EZLA 2AQNA 2K6WA 1E0TA 1FLRH 2WZ0A 5HDBF 1W17A 5MEQB 1F4XL 4A38A 2ZICA 3E5BA 2WWKO 3W9EA 1H6FA 1LT7A 2H5UA 1H1ZA 1BAFL 3JWNE 1ZGLP 3GTIA 4K7PL 4C7FA 5HDBE 5DD6A 1TTIA 4RDVA 1T04A 5GJTH 2R23B 4MG4A 2X89D 3L4WA 5ETUA 4JTQA 3VRIB 1OB1B 3RJOA 5FK9B 2DZPA 5C9UA 4UTBA 2EDTA 4IISA 1LO0L 2A74A 1O66A 2R9HC 4YHNB 5BJTB 4PJ5A 1ADDA 3T55A 1MLCB 3ZDZF 3UVIA 1JNLH 2ITCB 3ULSB 4PJHA 3BGFB 4U1LA 4AIZA 4CU7A 5LBVA 2FEDC 1R2SA 3NQCA 2UUDH 1F4WH 3Q2WA 3UG4A 4EIBA 2FLIA 2K9UA 1KJMA 3MA7A 3ZDZE 2ENPA 1XLBA 4AYID 3QJFA 1F2XK 5L7XL 3KVPA 4GSXA 4XZIA 1LEIA 5JDSB 4G6MH 4K4KA 1UGNA 5FACA 1CGWA 3F7YB 4ONHB 4JFPA 4UM9B 5EWIH 3WQFA 4P5TC 3R94A 2A74C 4LS2A 4JDZA 2ZUQC 1WS8A 4XTIA 4K2UH 1EFQA 1SW7A 3II2A 3PF2A 5JIIA 5C6MA 1H0DA 3GRGA 4ACZA 1FGNL 3FB7B 4G8EB 2ZWSA 4O52A 4DJDC 1EKOA 2HYMA 2EG8A 1JQXA 2AL1A 3KS6A 3NL5A 3J2PA 4YHKH 5IF0A 4PJDF 3GGWB 3KYOB 2RB8A 3E38A 1OTUD 2WQWA 2R1WB 1TR7A 1GC1L 3RTLA 3V4BA 5FI8A 2NY6C 2VH5H 3M0JA 1EMTL 3NQ6A 1SM3H 4US5D 3BJTA 1CK0L 1J88A 1X4XA 3WFZA 1NFDA 2HH0L 3V4VA 1Z5YD 3C0LA 1G7HB 1VB9A 4B5TA 3I02B 4B50A 4O02L 1U30A 1P0DA 5LGXA 5SWSB 1RURH 4TXVB 2BX5A 3EWXA 1YAIA 5C0AD 4A66A 1RA0A 2MQGA 1ISVA 2W88A 5FO7A 4M6OL 1A0CA 4ZMAT 2XIBA 3WQ8A 1DVSA 1XYMA 1KELH 2DQHH 1UQSB 1T20B 3L7EA 5AVYB 3O4LA 3RLUA 3HB3B 1RZKL 2VXSL 2UXFA 1T66C 4JZNA 1JPMA 4WUUD 5FW7A 3GDLA 4ES4A 5D5MF 1NCBH 2XPGB 4OLWL 2XPYA 3DN5A 1NCTA 3RPIA 3AMLA 3IFOB 2AZUA 5IVNA 2H2SC 4IMFA 3IJSA 1KPVB 4MBRA 2XXMB 4CC1A 4ICXA 5G1MA 3RWCB 1V6TA 3C3UA 4D7PA 4B5NA 1F8IA 1G7PB 1JRCA 5D5ME 1S3TC 4TVCA 1VGKB 3MZNA 4KX8A 2E8ZA 5C0AE 4G8AC 2GC7C 3GNML 4YDZA 3TPUA 5IBLD 5SV3A 1F2QA 4JRYD 3HR6A 2OZNA 3CK5A 5HSFA 2AJSH 3UZVA 4R5EA 3MP4A 4AEFA 5E8NB 3FU7A 3T2LA 5M2FX 2N7SA 5FKAB 1P7HL 4IQDA 2CBOA 2R0LL 3DURB 5DXWA 4AXKA 4FQIH 3GFXA 3LS4L 4FI6A 4XVJH 2YCEA 3L3DA 4XSMA 4TV5A 2R82A 4RFOL 4WUUE 4ZSOE 3BEVA 4Q8MA 1OQFA 2FH6A 3MW7A 1GVQA 3U4BH 2Q7NA 1QA9B 5ELIA 5I71B 4J12A 2Q8XA 4LRSA 3AB0B 4O2EA 2DV6A 1ADSA 2OWXA 3QIBD 4M7JH 1W0WB 3RG1C 4JRYE 2VDNL 3IJHB 4JR9L 4XBEH 3NM1A 3K6FA 3F4DA 1BFVL 3MRKB 7FABL 1UEMA 3C6LB 5AWNL 3V5KA 1B0IA 3DOHA 5D70H 2VZVA 1ZA3A 4W89A 1F5ZA 5I1DB 3DUSB 4CJ1A 1PKOA 3GJFK 1I1XA 2X4PA 5KAQG 2EG6A 5HI5C 4AL8C 4PJ9A 4UYQA 1FFTB 2B1AH 3WXVH 5EBWB 1R3WA 4H8QA 1HXJA 1L9OA 4P2OD 1N0LA 5BVJB 1FY6A 3NZSA 3UBHA 2AF2A 3O6KH 2YB4A 4UTAH 5E6IB 3NZHH 5IM7A 1F45A 4QR7A 1IGFL 4X2UA 3W23A 2HMCA 5D1ZD 4KAQL 3AFBA 4HGWB 4WF7A 2HT4C 1U58A 1I8KB 3HNTL 1EBGA 1VBGA 3KBMA 1AE6H 4DPRA 2X6UA 4V1DB 1QR4A 1YYLH 3H56A 1IBDA 4MB1A 4HV8A 4FNPA 3N9GL 2KL6A 1PZ5B 1OWQA 2QADD 4HCRL 2H1PH 2EIKB 1EJSC 3RVUC 1WAPA 2Y88A 3BIKB 5IR1A 1JWSA 5IP4A 4IMGA 3TYGH 4QY8A 5HULA 3VGEA 5HMSA 1UJPA 2VYRE 1DBMH 1BWKA 3PJXA 1B88A 3C6CA 5L2KA 4TSCH 5AYXA 2MPAL 2NYKA 5AW7B 1FH8A 4UDTB 4JM4H 1DQQB 1GJPA 3MRJA 1F86A 1WG3A 3MV01 5DD1L 4PP1C 1NOFA 4HHMA 1QNSA 4EAYA 5EU7C 3HI1A 1JWMB 4EN3B 1UUOA 3SO7A 4JMNA 4YBHA 3KHQA 1RD5A 4WXYA 5ADPL 5EO0B 4IBUA 1G7LA 3EO1A 2BXZA 3KGRA 3MUJA 3MRGA 1T83C 5CHNA 1OPGL 1NFKA 3M47A 2NQZA 3Q8CA 3WBAA 4K7PX 4M3PA 1S7VB 3C56A 3QEHA 3NIFB 4XZNX 4HIXL 4PRNA 4R7VA 3FV9A 2MNJB 2Q86B 2YXWA 4OZIB 2AHIA 3UWEA 3TU6A 3FCGA 5HHXH 4JVWA 2EKCA 4NYYA 4XCFL 3ESNA 1XGQA 5I30H 1W3TA 1HIZA 2WBJB 3NQ8A 4UWQB 2YPVH 3MGOB 3QUXC 4M62L 3VFGH 2HFFB 2PPFA 3TOPA 3WTSA 3RE0A 1MWAH 1J10A 1QI5A 5JORA 3BH4A 4YNYB 3QPQC 4GJIA 1KXQA 2G96A 4F8OA 5CJOH 5J7CC 1LEGB 4XXCA 2FZBA 4KX9A 2ZX6A 4XP9L 4I4WB 1LWJA 2YXGA 2R2CA 3P3YA 4PLKC 3ZDWA 5H1WA 4A3UA 3I9GH 4HX1A 5DJXA 4Y16C 4M9OA 3VGBA 3O11B 4IRZL 5KINA 2CR0A 1EO7A 4OKVA 4DP1X 2IS7A 3P9WB 1FRGL 4OSUH 3FYPA 3N91A 4Z76A 4Z7OF 1CBVL 3OJVC 2YUWA 5L0QC 1KGYE 3OZPA 4HSOA 4HFUH 2VXUH 1XLCA 2GSEA 5GGUA 4WNJA 3WD5H 4RAVB 4LB4A 3T04D 4M03A 1XLMA 1FA2A 1Q94B 2FH8A 1TWDA 4HYRA 1FNSH 4IMLA 4TLUA 4XBGA 2R69A 2OX5B 3O45B 4XPHH 3B8WA 2EDEA 4DP2X 4I7WA 1OAXL 4RCAA 2Y7DA 1FH5L 3IJ8A 2APSA 1YDNA 4Z7OE 2FVMA 5REQB 1CXEA 1TITA 1EFXB 3GLDA 4LGPB 3KRZA 4O1BA 2WWKT 5EORH 4LAOA 2FWUA 1D3HA 1GTHA 3WMBA 5J0BA 4ZB0A 4HK3N 4XXCC 2CHRA 4H8PA 2B7DT 4AJVA 4F40A 2WSRA 3LGEA 3FOMB 4RRPA 3POCA 1EERB 3VNDA 4E2OA 3VDBA 4NF7A 3PFRA 3KCJA 2NY2C 2CALA 1VAHA 2PYEA 3QFEA 4Z7NF 3BPCA 3D9AH 1DBJH 2QFPA 5XIAA 5E9NA 3WJWA 3S5OA 5DXXA 2C1OB 3C5ZB 3SECA 3RUGA 4C5ZA 1WDWA 4BHUA 3WL1A 1WX0A 1E65A 1W5OA 4R88A 1ZVHA 4GJ1A 2D20A 1FNLA 4IMEA 2I9LB 3FZUC 2AJZA 4Z7NE 1UWSA 1WYIA 3ZUNC 1Q5MA 1C08B 3WLWC 4Z2HA 4YEEA 5HHQB 4NO0A 1U4EA 2GSIB 4NM4H 4P9HH 1AQ0A 4PL2A 2Z92B 2C1GA 5EFDA 1AKJD 4A4AA 2KPWA 2A83A 4S3KA 1X5MA 5I02A 2HFTA 3IPEA 4AX7A 4JREB 1JDDA 4KXZH 1NICA 4LKXA 3Q9QA 3TZFA 3UR8A 2G75B 2DB8A 4Y8EA 4FHAA 4CD5A 3K71A 4AM0B 4ODXB 4AGMA 2BP8A 2CYGA 4NQSB 1WD9A 4EUPG 4XTRC 2E9JA 1LO4L 4JX4A 1MJJB 3ASWA 1YDVA 1Y18B 3PS6A 3WD1A 2PDFA 4A3RA 3Q8FA 3DROB 2NYZA 5E2JA 1TIUA 5E5UB 4G80A 1LK3H 4RZ5A 4FIQA 1BQHA 3PAYA 3AYTA 3NEEA 1QYGL 1FVEB 1FFOB 1HSAB 4P05A 4MM1A 1ACCA 4X63A 4ELKA 3CUHA 1FNEA 3O8XD 2A0LC 1UD6A 2WLLB 4Z7WB 2AVFA 4OFVA 4LESA 1TZHB 2WPBA 3L0NA 1O9WA 5M5DA 3R4DA 5A3HA 3HAEB 3WE6B 4M1RA 2DQJH 5ESVB 1OY3B 2DEPA 1H5BB 5I78A 1A22B 2RIKA 4HIHA 2AXGA 3EYVA 4K3EH 2CUHA 2DUAA 4RRPM 3ME0A 5EUOA 1HKLL 2GDQA 5DJ0A 2NY7H 4A2MA 1PZ0A 1UYWL 1UZ1A 2BVYA 3R8RA 3GHPA 3NN8B 1KPUB 4BJHA 3PL6D 4OCWL 4DGIH 4MGGA 5DT1L 4Y2LA 1OQOA 5AD0A 2Z6JA 3CIVA 3NJHA 4YDIH 2AK1L 4GAYA 4ZS7L 4WO4B 4XVOA 4WK4B 1OFPA 1EEYA 1WV7T 4L5ZA 1RU9L 3BWSA 3OPSA 1WA1X 4LPUA 4NWTH 3LEXB 5LHDA 3QYSA 3K2KA 2PDQA 4KMLB 1F0LA 2VFDA 4BI6A 4A6YB 3FNKA 4QHUA 4MQSB 3QJUB 1XMWA 4DCQA 3B0XA 4DP4X 4YHGA 2K70A 1YYMH 4MASA 4DFHA 1IVTA 4LQFH 5AVSB 4LL1A 3G1DA 4UR8A 3TA3A 1MG3C 1SYVB 1C29A 3MLPA 2CLZB 2FTAA 3GLZA 1I9RH 3FB8B 4YFLF 4DPAX 1YLVA 2JBMA 1B3XA 4B3KA 3P3UA 4R4BB 1Q9KB 4DQAA 3GC3A 4RMTA 3OKNB 3I50H 3VINA 3QZLA 5I74B 4CVWA 3L5MA 4PCTA 5ABEA 1UB5B 1VJSA 2AQPA 3NAAH 1QFPA 1VCVA 3C5QA 4X4YA 4QUOA 4KEMA 1RUMH 4LSDA 5AKVA 2Y5JA 3G6DH 3PWLB 1N4XL 1LO3L 4OZFH 3RU8H 3L54A 3PBVA 4UILH 1AGFB 1L9TA 3P0VL 3FUHA 3WZ0E 4L4PA 2HVKB 4M6NH 2XWTA 2JCCB 1QW8A 2VX7A 1JFQL 5IEHA 1N8FA 3QHMA 5ISZD 4HPGA 3WBXA 3P3SA 4LLUA 3N85H 4BFEA 2A77H 3V6FA 4OUUA 2ZKHL 3ECQA 3GJFH 3KWWB 3TBTB 1AZNA 3TA3C 3BDBA 1F5WA 4J4PD 3DJRA 2EDKA 3WAJA 3IIVA 5E5MB 4GUPB 4OFKA 4MJIB 3LTSA 1FCGA 1FTXA 4NQDB 4DGVL 3L5AA 4ECNA 3MPCA 2YN5A 1AO7D 3H2FA 3PWPA 4YDJA 1BD2A 2D31B 2X1PA 3TDFA 2D03H 3K6SA 2W66A 1AGEA 3TVAA 3RFRA 4DZ8B 1MXGA 3A4DA 3I85A 1CS6A 3LBOA 3S8WA 3RWFB 4N0RA 3L3OA 1HHKB 1SZEA 4GYJA 2W3ZA 3ABRA 4Y9GA 2WLIB 3HRZC 4TIMA 5ISZE 3OGRA 2F1AA 2BP3A 2WJ5A 1B4JL 3MFFB 2Y7OA 5CPQA 2J75A 4P2QD 4YE4L 1Q0YL 5HYJD 2VX5A 1PLGH 3KJ4C 4UMAA 2BSRB 1BFSA 4XPBH 3WDIA 1N5AA 5EZIL 3JV5A 3P4NA 5KW9H 3WBDA 4NAQA 1LT8A 3TA9A 4XCYA 3QI9B 3NCYP 4IF2A 1Z9OA 2CHWA 3E3HA 3ZKXB 1AO7E 2OLDA 3W6YA 2WB7A 2WKOA 4ZTPL 2R24A 4AMKH 1V3HA 2HBXA 3WX7A 3SFWA 2VC9A 3SFKA 3N15A 5HUOA 3G24A 2K6YA 3SO5A 5EMYA 2HTKC 1EJVC 4LCIH 4JTJA 4Z7VF 1XTLA 1S5IH 2VDMH 3UAJD 4WKXA 4NJGA 2W59A 1MQQA 4EI5B 2VZ1A 4P2QE 2B16A 4IGBA 3L4TA 5HYJE 3PJTA 3BPOB 1SEQL 5HMEA 4AZCB 2SFPA 4AKOA 2V5JA 1VF5C 2PTVA 3UBXA 4NP7A 2Z24A 1HDMA 4WWKB 4Z7VE 3TJIA 3EH2A 3CEPA 5FDYA 1FX6A 4TOYH 2BVQB 1SDDB 1IB5A 3JU2A 1NWSA 5D37A 1QMLA 3F7LA 2CBUA 3QC3A 2H3NA 2F54A 4FFZH 4ZQKA 4X6DA 2ICCA 1ZVSB 5EF1A 4UFHA 5DYOA 1JZFA 3QW4B 5DZAA 1CC3A 5ICYB 1ND0A 1CCZA 4YYCA 4FQCH 5HWJA 5LUMA 1LDSA 1BXAA 3QISA 4WY0F 1KR0A 1INDL 1IGIL 1MFCL 3FTVA 4DPBX 3TC3A 3IGUA 4AGLA 4DKDC 1ADOA 1J48A 1BEUA 1YNTF 5KYYA 1N9PA 4CVZA 5TF1L 4IGBC 4FN0A 3R6IA 3VX1A 2HMIC 4OU1A 4BFAA 2QCCA 1G7IB 4F7MB 4L29A 1L7IL 1HFBA 1LNUA 5FGCE 3O3UN 1NARA 5EZOL 5F9JB 5FYLH 2YLLA 3DI3B 3B2DC 2GB2A 1W1ZA 5GS0D 5HXMA 4TX8A 1P7BA 2YCLB 1T0MB 5FHBH 1E6XM 1QLFB 5JXAH 4IK7A 2P26A 4HEPA 4F9LA 3R4IA 2DVXA 2J20A 1HF6A 5CJXA 3L3JA 3CS2A 3QG6B 4CGTA 3RX4A 3QJZA 4BEIA 3L5JA 3O0KA 1IBHA 3ALGA 1EYWA 1NBZB 3WNMA 1JPKA 5L8KB 3AAZA 4ODHL 4K94L 1VYSX 5FEPA 1HH6B 4XZLX 3IV8A 3NEVA 2PDCA 1KGCD 3V55A 1LDCA 4YBQC 1MIML 3IM1A 1U2YA 2V6AA 3PNWB 1E6JH 1KM0A 4PRWA 4P2RB 3EA2A 3P77B 3IMUA 2W0LA 3W26A 4GQ9H 5JHBA 1NDGB 2J74A 3ZE1B 3U57A 1IQWH 4AGQA 1YHPA 5EF0A 4UIOA 3R8QA 2PLTA 3HNVL 1NLDH 5EF3A 3ONCA 3M41A 1ZLSL 3KYNB 2AJVL 4L1XA 3SCMB 1IEWA 1QPXA 3OMAB 2OWCA 4ZQPA 1LVEA 4Z7QF 5AHIA 3QEZA 4ZTEA 3GDCA 3OBAA 3GO2A 5IOKA 5A16B 1NPNA 3NEXA 1UPMB 3NA9L 3HHMA 4F9LC 2NQ3A 3LIZA 2Z6IA 4JAMB 2FR4A 4XMXA 1TJHH 5CJXC 4FQHB 2XRAH 4G1MB 3MMWA 4DP5X 1HE8A 1M5WA 3RM9A 3NGBC 1A6WH 1QOXA 3AG1B 2CLHA 4Z7QE 2BNQD 1TV2A 1R75A 4FG2A 4PMOA 4MTVA 1TQUA 4HKZB 2FYYA 5C0RH 3TTYA 3KH4A 4ZXLA 1KGCE 1RIVL 4GFXA 4I0KA 3W9DA 4NY2A 3U9PH 4X50A 2V5SA 2ZOOA 4UCFA 2OO0A 5JXQA 2DSWA 1BZ9B 1C91A 4TXEA 3QSTA 3QMSA 1JI1A 3WFLA 1TQCB 4GI6A 4NI8A 1S38A 2W1NA 3WLMA 3BW9B 4C83A 1FN4B 1KDJA 4IHBA 1YBQA 4P2CG 4PP2B 2X9YA 4Q9CA 1UZDA 3ZX1A 2QT3A 4JQAA 3M64A 1XIMA 2P10A 4GUIA 3L5XL 4CNUA 3MRRA 2AQ1A 5IB1A 1HEJC 4RMVA 4IIEA 4DOHB 5CINH 5HGBA 1QFWI 2P5WA 1ED3B 2BNQE 1FORH 2D7TL 3S4SA 3UZ5A 1AQFA 4UTFA 3FSTA 4TUOA 4OF3A 3DXAE 4NIRA 2J43A 4ML4A 2XXFA 4CLMA 2FB4L 1YEFL 4OCXL 4QRBA 3WH5A 1TO5A 4KVNH 2YR1A 4NUPA 4YQXH 5BOFA 5JYLA 1QZNA 1A5SA 2R0ZL 3K81A 2C1IA 1TFPA 1OF6A 3WFEH 3W38A 4YEFA 4GYPA 1ILUA 1UXLA 2XNAB 3QC6X 3IF1A 4ODUA 4TMCA 5FEZA 1LQBC 5I9QC 3IDNA 2O7QA 4K8RD 1XRFA 1ZJIA 4YSCA 1LD9B 3T4YB 3MHZA 2B9BA 4QHLA 4C4UA 4IEFB 1TJ1A 4ZE5A 3R5EA 1Y0EA 2Y70A 3DU0A 4J3XA 3PHQB 3RZWA 3UG8A 1KV8A 1VCBC 1CL7I 3M1BA 3SQRA 3S6OA 4N42A 3MLVL 2ZC8A 2AOSA 4D6CA 3T8QA 2XWJA 4FX5A 1LJYA 3NQAA 4ZW6A 3CFDB 4KRMB 4JN2B 3TH3T 1TT6A 4YXKH 3OZMA 5CGBA 2X70A 1G4MA 4AYDC 1XRTA 3LZFH 2DQCH 3U0HA 4YVPA 3F5WA 3PSWA 1FC2D 1E0XA 4R4FL 3ULVH 1W3LA 1F02I 4AZ6A 1N18A 4JE4B 3GSUA 2NZ9D 4GYPC 2FEJA 1YN6B 3KBSA 2C79A 3N34A 2GIYA 4MY9A 3FJ6A 3THMH 4BXVA 3QR0A 3ARXA 4XN8A 2I5QA 5KUMA 3IXTB 1IEXA 4TNFA 4QOKA 2DYPB 1BVNP 3S8HA 3CK0H 2B9AA 3W82A 1GYLA 4EACA 2QTEA 5DJYB 2G3NA 2NR6D 2Y7FA 1T5WB 1EDTA 4F7PB 3G1SA 3MGTA 2Y6SD 4WGHA 1QABA 3BIAX 3H53A 2YXOA 5DVKA 2QGCA 1OFBA 3IJQA 3U2CA 1WKEA 1HAUA 4IIGA 3VCLB 3RGTA 5TH2B 2OZ3A 3OB8A 4QJ3B 1CB2A 1DE4A 5HDQL 3D3FA 1E5ZA 4Q8OA 1BQRA 3HZKA 3IU4L 1Z0NA 4OZHF 1E27A 1QTWA 1QFEA 1IAMA 4KUZL 1Z9NA 1KLYA 1UBPC 2CHZA 5LCVA 4JGJA 3WH9A 4DNLA 1J5CA 3G1RA 2B59A 3DOSB 4HETA 3UERA 1JV2A 4QKXB 1ODZA 4FMFA 3WUBA 1EWDA 1OCQA 4AYEC 3A5FA 1SMDA 1XBYA 4JTDA 4OZHE 3VXTB 3DX9A 25C8L 1B30A 3FFDA 5SWZA 1GY2A 3TO4B 5JPNC 5E99H 1VRSA 1YPZF 2M26A 1H4PA 1SVZA 2BLEA 3CVBA 3IXAB 2INFA 4IPNB 2WHLA 1E6ZA 5DUPH 2HLFC 3UJFA 4EVNA 1FHDA 4WVRA 1G5GA 4ONGH 2FRGP 4QMEA 5EU3B 3NDOA 5GGVH 1TV3A 2QV4A 4YSSA 5FYKH 1YPZE 3FKUS 1XC4A 1EHLL 3GG0A 4WW2F 3GSNB 1SFSA 2PZNA 3HAEG 2P7TB 4FX7A 4C6LA 4LNCA 4CDHA 2ZUWA 3HHSB 4Z95H 4UIMB 3FRUB 2QCLA 1QDSA 1QO3A 2NQ5A 1AAJA 4H5SB 5AOJA 5C0EA 1J6PA 2GPTA 4MLRA 4XZMX 3RGVB 3CQHA 4G7SB 1YW1A 3DETC 2NUTA 1MEXH 1W0VB 4MIMA 4S3AA 1KY6A 4YVVA 4X5XB 5BRBA 1I85A 4DYEA 3MGAA 3KBFA 4NAEA 6PCYA 3NFPA 2GOUA 1MDTA 2E9MA 1V08A 2CESA 4L4VB 4YVXA 4NNPH 2PTWA 3G9VA 3SB3A 1E50A 2Y7GA 1X7SA 3FVDA 3L67A 4NBXB 3EWWA 1BM3L 1UXMA 3VD4A 1HL4A 5G5IA 4IBTA 5DRNA 3SDDA 5F6IB 4KZDL 4TQIA 1Q6LA 4DF0A 5D9SB 2OTUB 4ETQB 4DP9X 2HPMA 2C1HA 3FRPA 2F6KA 2E86A 2YW4A 5I79A 3OYXA 2CHDA 1NA8A 1V3IA 2EEAA 3TO2B 5J06A 1TFVA 4CNTA 4I18B 4JYEA 3C09B 5LAPA 2FUQA 1NC4D 2ATSA 3S98A 3U6WA 5ABFA 3J27A 2C91A 5LNVA 4ECLA 5FKPA 4HJIA 3VNIA 4IRJD 5DMKB 5E00B 4AQZA 1NBCA 4PI0A 3U9IA 5I1HH 1ET7A 5D1QA 3P4LA 5DEGB 3R13A 4P4RA 3FIGA 1RQ5A 4DAFA 1H3UA 4TQEL 1EPFA 3SSGA 4P7NA 4BF9A 3OQ8A 4YHZH 2OYKA 2IQAA 3SDDC 4NKOB 3L95A 2Q8AH 1H41A 4KKAC 2BIHA 4A2GA 1S7SA 1EO8L 1LQ0A 5E8PA 3K6IA 2Q9OA 3IPFA 5CWSB 4R33A 4FTDA 3WMCA 4EQ3A 3BW3A 2E9LA 5A6SA 1EXBA 5BU9A 5LXEA 2YRBA 3GZAA 2J8FA 5C9ZA 3I7SA 3EWUA 2B31A 4D7BA 4GSQA 4OTXL 1URZA 5D1QC 1JYXA 5BROA 1LK2B 1EPXA 1ZS8B 2WUCL 1FV1A 5DVMA 2OM5A 3DVNB 3KVMA 4XX6A 3B8VA 2QPEB 3QSKB 2FHCA 3P82A 1E4WH 1G1YA 1ZNNA 1A3LH 4FFWD 5AW0B 3H2AA 4LCCA 4ZFOB 2FDBP 4OF6A 1GSKA 2HT3D 4PZVA 4H9VA 5EU6A 3OHXA 2YRZA 2DP3A 3SBWC 3MHFA 3WL0A 4RK8A 3RCNA 3T8XB 3PGFH 1S3HA 4U3XA 3MMEA 4B91A 1CDJA 5ABDE 2ACRA 1E9OA 3ARDB 1T1XB 3NVQA 4RESB 3MV7A 2AGKA 2YEZA 1KM3A 1PLBA 4R83A 4L3AA 3Q67A 1QSFB 2ZPKH 1JZ6A 4TUFA 1XINA 3B8TA 3WENA 1PQZA 4WKZA 4YDLC 3L68A 4TO8A 3SW6A 1R9FA 3FQTA 1HU8A 1OD9A 4UI2A 2XJKA 5D2NB 4YX2H 1MRFH 3RBGA 3JZYA 3NZUA 3VI4B 1N6QL 1IAKB 2Z7KA 3ROLA 3G6LA 2VABA 3KDPB 3KH3A 4HIIB 2E9GA 4WZ9A 3Q05A 1VD6A 2OPCA 3RG6A 1RVGA 4O1AA 3QRLA 3WMLA 2Q2LA 4U6TA 4QEHA 3ZQWA 5DFWH 2XVGA 2V6HA 3TBVA 3GZOA 1I1WA 3OHXC 5JNYA 2Z27A 4J5NA 2OL3L 4JJHA 5HGAA 2C15A 1JHTB 3WBWA 3AXLA 4NJKA 3M43A 3ZQXA 3S88H 4LU5H 2VDLL 4XP6H 4NIKB 1ZVYA 4ZS6D 2DM2A 5D2LB 5DFAA 3C4UA 4R7LA 9CGTA 3NUKA 1LTDA 4M6MH 1OCWH 4L3FA 4AH7A 4JM2B 1OSEA 1CFMA 3LN4B 4PVNA 3CXDL 4S2SB 1P43A 5G1YA 4GMTL 3NDZA 5I17A 4ZJ9A 1BX2A 1A7RL 5HJDA 2NQLA 1J7VR 1XXXA 4AY1A 1MF2L 3D2UD 1EQWA 4MD5B 1YNKL 3H9HB 4I5UA 5FO9A 1MVYA 3VABA 1RK1B 4PPTA 4UTIA 4I77L 1EBAA 5DRWA 5EO9A 2MCAA 4K3ZA 4DP7X 2X3AA 3QXBA 3HC4L 3B43A 5ITFB 4OLUL 3UACA 2CM5A 4PBGA 4PJCF 4HWNA 2A6NA 1I3RB 3F12B 3GSQB 5MKGB 1TWWA 4KCTA 3IJ7A 4YHOL 2AJYH 5KBNC 1JAKA 1HJVA 3BC9A 3V0WL 1ESOA 4B9IA 4E36A 4XZUA 3WLBA 4GS7C 2IXQB 4IXHA 2B8OT 3SOBH 1Q6QA 3FEQA 1RSYA 4EK7A 4PJCE 5HHVH 3GU1A 3QZBA 3FUMA 1B54A 5FUCC 1EZVX 1MZHA 2DT3A 1L0XA 1IGYB 3K8MA 3MLWL 1G9NC 5LXGH 3MR9A 5E2UL 1S5VA 4JHOA 3UXAA 4Z8FH 5IV2B 3ZRSA 4I0PD 3HGOA 3C9NB 3FX4A 4KETA 4HJJL 2HZGA 4HMEA 3IGAB 3VMOA 5I1EH 3VGAC 5IW6B 5D7JC 5D4JA 2PLJA 1YEEH 3TJEH 3W37A 3D52A 3EPNA 1SZGA 4WFFD 4EDXA 4XVSL 2J47A 1IBGL 4XHJD 2Y5TA 3ZN6A 1E43A 4ABQA 1CO1A 5AVQB 4U1IA 3KVJA 1QASA 4ZO6A 1S8DA 2O4MA 4GP4B 5BNKA 3UJIH 3E2RA 5LZLA 4TN9A 2XBTA 2BY2A 4KO5A 1TKKA 3PE9A 1W3HA 2PTZA 5I16B 2DV0A 3RDKA 4W7VA 3BKYL 1RUSA 5L88L 1CE1H 2VZOA 1JZ4A 1XGZA 4BIKA 2V5LA 4RGMC 4I5BA 2WLNA 4WOQA 4PAZA 4QRAA 3QQ3A 3WGVB 2W80C 2W5PA 3JVAA 2Y7NA 4CEXC 4L4TA 1KNOB 1ZRQA 3LJ3A 5B4MC 1TE1A 5KVFE 2NY0C 2WSYA 5FF3A 3QEUA 4AXWA 4WFFE 2DWDB 4ZODA 4B96A 3DXIA 2ZXCA 1A6AB 3PJSA 3JV6B 1FSKC 3LHPL 4GXUN 4JO1L 5IHUL 1BBJB 2DI9A 3A24A 2B0SL 5EEZA 3I2CH 2DPEA 3PAJA 4YAQA 5BV7H 4JZJB 1MFNA 3LGGA 1XZWA 2EDQA 3PWAA 2R27A 2J4GA 4E41A 1HXYB 1NVMA 4V2XA 5GRUL 3GIQA 4F0KA 4QNEA 2I32A 4DT2A 2DD8L 5F0JB 4AZIA 4O8AA 1QPNA 4G42A 2WJFA 2AV1B 1E2ZA 3GDBA 3DNKA 1WWAX 1T6MA 4CD7A 4J28A 1AFVH 4YPGB 2J7DA 3QH2A 1QTSA 1WAAA 1IC7H 4OT1H 1TE6A 3TEUA 3IVSA 1KCXA 1YEDA 4NRZB 4KV5F 4LSPH 1NGQH 3HBLA 4NNXB 4L7ZA 4WQ6A 5D4HA 3UTPE 1V8HA 2OTDA 3VFOB 1VLXA 1JZJA 2XLLA 1A02N 4DO5A 2DORA 2F5BL 5C0NC 2E7LA 2W60B 1H0IA 3VNZA 1JK8A 3TM6A 3K72B 4AEHH 3CTLA 3EIFA 4UQ2A 4FJ6A 4JPKL 5TE6L 4L37B 4KV5E