4UQDA

X-ray structure of glucuronoxylan-xylanohydrolase (xyn30a) from clostridium thermocellum at 1.25 a resolution
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
390
structure length
390
Chain Sequence
b'HMASATINLSAEKQVIRGFGGMNHPVWISDLTPQQRDTAFGNGEGQLGFTILRIHVDENRNNWSKEVATARRAIELGAIVSASPWNPPSNMVETFTRNGVPNQKRLRYDKYGDYVQHLNDFVAYMKSNGVDLYAISVQNEPDYAHEWTWWTPQEMLRFMRDYAGQINCRVMAPESFQYLKNMSDPILNDPQALANLDILGAHFYGTTVNNMPYPLFEQKGAGKELWMTEVYVPNSDSNSADRWPEALEVAHNMHNALVEGNFQAYVWWYIRRSYGPMKEDGTISKRGYMMAHYSKFVRPGYVRVDATKNPTYNVYLSACKNKKDNSVVAVVINKSTEAKTINISVPGTSIRKWERYVTTGSKNLRKESDINASGTTFQVTLEPQSVTTFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CARBOHYDRATE BINDING FAMILY 6
molecule tags Hydrolase
source organism Ruminiclostridium thermocellum
publication title Conservation in the Mechanism of Glucuronoxylan Hydrolysis Revealed by the Structure of Glucuronoxylan Xylano-Hydrolase (Ctxyn30A) from Clostridium Thermocellum
pubmed doi rcsb
total genus 138
structure length 390
sequence length 390
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uqdA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uqdA02
2VVNA 3BVVA 3U57A 4J3XA 5CXPA 1GOWA 5JIWA 1KXVA 1E4LA 1E55A 5AYBA 2VX6A 1QBAA 5CPTA 3W4RA 5I77A 2FHCA 3BSGA 3WH9A 1RH9A 3AS3A 4DO5A 3D50A 1G0CA 2BY1A 1JZ5A 2QMKA 1BGGA 4LQ1A 3SEPA 4JFUA 2MANA 4D6HA 1KFWA 1R7AA 2GDUA 3FNDA 4TVCA 1CXFA 2IGTA 3POHA 4HOWA 4PMNA 2X2HA 3VD4A 1V3LA 1CENA 3EMZA 4PTXA 4R5EA 3ARTA 2BVYA 2VOTA 1WDSA 1CTNA 2WSPA 4NRSA 3VPLA 1VFUA 2E3ZA 1BG9A 1JZ7A 3AIBA 2G41A 5EB8A 4JFSA 4FLSA 3WUGA 4UQEA 2ZX7A 4JAWA 1H1NA 1H5VA 5D9PA 4MPKA 4J3WA 4QCEA 3RM4A 4JKKA 4MDOA 2ZICA 4PRWA 2PI6A 3AIQA 5BROA 4GO9A 4DWSD 1JD9A 1W1TA 1FP9A 1OIFA 2D73A 1CLVA 1LL6A 3THCA 1NH6A 4MDPA 5AC4A 2ZUVA 2VTFA 1E70M 2NW0A 1S46A 4JKMA 3S6TA 2WC4A 2BS9A 3APGA 4X9YA 2XVPA 1IZKA 3L2MA 3GZAA 3UR8A 5F7UA 1NWRA 4Z2IA 2V3DA 4HMDA 1TUXA 3FAXA 4UOJA 3WF3A 3CZNA 4U31A 1U2YA 1ZL1A 1UR9A 2O9RA 1OD8A 4PTWA 4MB4A 3W6MA 2BV9A 1V6UA 3KZSA 2QPSA 1CLXA 2VNCA 3EJQA 2WZHA 1RD6A 4W5UA 2GUYA 4D72A 1A47A 1LQ0A 3CHCA 1BYBA 3PN8A 4XUYA 3VOCA 1W9VA 3ZJ7A 2GJPA 3HG2A 4D6CA 4IPNB 1XRVA 2ZIDA 1KR1A 4FNPA 1WO2A 4J3VA 2WVUA 3UG3A 4YN5A 4TTGA 1TQSA 4FNTA 1W2PA 5AYIA 4W85A 2XWEA 4E8DA 2EPMX 4AMCA 2C7FA 1JL8A 4DWSC 3WFLA 1TA3B 1Q4NX 3GNRA 4AZCB 3NDYA 4P7LA 2FE0A 1BFNA 3OGVA 3ZT6A 3OLDA 1EQPA 5A2CA 4AZGA 3F5KA 5A6SA 3PZ9A 3WNMA 2OW6A 4E2OA 1R33A 3NDZA 2VC9A 2UY2A 1EH9A 5E6ZA 5IXEA 1P6WA 3DYOA 1CGYA 3B9DA 1PIFA 2JEQA 3WY1A 5FIPA 1QNOA 3ARWA 5BYWA 4A3YA 4WSJA 2PB1A 5GQBA 1AVAA 4HZ6A 4TX6A 1J01A 2J62A 4AD1A 2FGZA 2CBIA 3SUTA 4B3LA 2UY5A 2X0HA 4W5ZA 1KB3A 1XH1A 2NT1A 3SCOA 3WQ4A 1K6AA 2W5FA 4W8LA 3PTQA 1US2A 2V3GA 1FFQA 2WVVA 2XVGA 1OBAA 2YJQA 1QNPA 4R27A 1BTCA 1GVIA 2WCSA 4EANA 1GW1A 1FH9A 3DX1A 1XYFA 4JHZA 3WD2A 1E6ZA 3L4XA 3NIYA 3TTOA 3CZEA 2DT0A 2BXYA 1BVNP 1LL7A 3LXCA 2A3BA 2YDRA 1BHGA 1W3KA 1GQLA 2J7GA 2F2HA 1DWAM 2EAEA 2WKGA 1E0WA 2F7OA 1UWQA 2EPLX 1MQPA 3CIVA 2CIPA 2J4GA 4TX8A 2JIWA 2XIBA 1UR1A 3SCVA 4NXKA 3WL0A 4FNRA 3MI6A 2FGLA 3E1F1 1UH3A 2J8FA 1G01A 1ISXA 1J0ZA 2FH8A 3ARQA 4NZFA 4H7VA 4GPNA 3ZT7A 1QWUA 3ALGA 5E0CA 1ESWA 4PMOA 4MJ4A 1ECEA 3VMNA 4P8VA 1C7TA 3B8SA 8A3HA 3J7HA 4ACZA 1OINA 2W67A 1BG4A 1HL8A 4OIFA 5D9NA 3L4TA 2CEQA 3D3AA 4UQAA 1JYWA 1EOKA 1E56A 2F7PA 5I78A 4E4PA 3K8LA 4P7OA 1NOUA 3BH4A 3W25A 2WLZA 1E6XM 1LG2A 4AD0A 3A3HA 4Z2LA 1UKSA 5I79A 4CD5A 5ABHA 2EPOA 4AYSA 3VVGA 3QGVA 2AMGA 2VI0A 5E0FA 1KQZA 1E9LA 3T08A 1NWSA 2PBOA 1E3XA 2QPUA 3AI0A 5GNXA 3LXBA 1W1YA 5BXTA 1QHZA 2Y4SA 3MKKA 1BF2A 1O7AA 2WM0A 4QP0A 3AMCA 1H0IA 1JI2A 1EQCA 2YKKA 4PMXA 3VX0A 2BY2A 1GQJA 1A3HA 5HXMA 3DHUA 2D3LA 1UD5A 5CQ1A 4QLLA 4M80A 5DT5A 1MW3A 1GUVA 4D6FA 2YFOA 4WIWA 4J27A 4AC1X 3WD4A 5A69A 5A2BA 1OGBA 1DWHM 1M01A 2XM2A 4W7UA 4HA4A 3CZSA 2A3HA 4B9ZA 1ITXA 3AMGA 4RE3A 4PEEA 1JDCA 1HIZA 3G6LA 1WDPA 2EBNA 3WELA 3M6DA 3PBGA 2YA0A 4PUEA 4F9JA 2ZUTA 2HISA 5CZKA 1KTCA 4W7VA 5C70A 1V3JA 3WN6A 1UYQA 1W3HA 4BQ2A 4Z2HA 3T0BA 4U3CA 2WMKA 4M82A 3ZMRA 4L4PA 3EMQA 4HMEA 2WZEA 3VMPA 3WBEA 1UKPA 3NSMA 1ODZA 3LRLA 2CBVA 2DT1A 5DFAA 1BSIA 3NSXA 1W9DM 3BUDA 2W61A 4V28A 4P8UA 1C7SA 1R7OA 2GFTA 4OJYA 3VTRA 2V5CA 1VFFA 1R87A 1HXKA 3VM7A 3N18A 2CESA 1UR4A 2WAGA 4N42A 1QWNA 4GZJA 1FFRA 1DHKA 3W0KA 2EJ1A 4PTMA 4XX6A 4CD7A 3VIPA 1XCWA 4AD3A 2F1AA 3PZTA 6CGTA 1J0JA 5DT7A 2YIHA 4MNJA 3CZGA 2XSBA 1HXJA 2OWWA 3EDKA 4HA3A 1EHNA 2YA1A 3EDFA 4WK9A 1VBRA 4BZYA 3T0AA 1JXJA 4IUGA 1UKQA 4UQCA 4WKAA 3BMVA 1C3FA 2ZOXA 3W6LA 1UH4A 3T2OA 1V3KA 4KRTA 3AICA 4UQDA 1Z32X 4NI3A 2JFEX 3WSUA 1H09A 5TD4A 1XHGA 4GINA 4AYGA 2D0GA 4WLCA 1E6PA 4D6EA 4V27A 4LYPA 3VDHA 3WH6A 4UOZA 4JIEA 1V02E 1O6IA 4A3HA 4URIA 1IT0A 1BYCA 1CBGA 1W3JA 2OLHA 3W81A 4IPLA 4UCFA 2E0PA 5BCAA 4YPJA 1B3VA 3WDHA 4E8CA 4CUCA 1QBBA 4HMCA 1JXKA 3WUBA 4AZ7A 1V02A 4OZOA 1SFSA 1Q6FA 5FD0A 1CGUA 3FAWA 2J79A 3GXDA 4JHOA 1VBUA 2DH3A 4S3JA 4BQ3A 2ZXAA 2XIIA 1WKYA 2D3NA 3RMEA 3PZQA 1M04A 1KBKA 2DGAA 1BQCA 5BRQA 2GJXA 4OOUA 3AS1A 3BUPA 3AS0A 3AJ7A 1XD1A 4CU8A 3QHMA 3ZSSA 5CG0A 3WNPA 3VO0A 2IUZA 5EFFA 3MUZ1 1CGXA 3FW6A 4PMYA 4W88A 1ODUA 4CN1A 2WMIB 1PAMA 1VEOA 1HP4A 4ATLA 1KGXA 1JZ2A 4XZBA 1H2JA 4M81A 3S2CA 1X6LA 2WW5A 1GCYA 2EABA 1GONA 1UQYA 4PUDA 5I5RA 1WCGA 3GBEA 1TVPA 3HG3A 3DX2A 1ISVA 1SZNA 4KGLA 4UTFA 1VFMA 3D4ZA 3SCSA 1W9XA 5EMYA 5BXPA 4GI8A 1WNOA 5FKYA 3T09A 2B31A 1JYXA 1ISZA 3K4AA 1KTBA 1QI0A 1DP0A 5HPCA 2WMJA 3AHTA 4GQQA 2ZE0A 1TVNA 3VD5A 3VDCA 1VF8A 5A6LA 1E6RA 4KH2A 3U7BA 2J7FA 1JYVA 1G1YA 3W28A 3NYDA 1LG1A 1HT6A 2YBTA 4WKFA 2QMJA 4TVDA 1CGVA 3PZUA 3WNLA 5HDRA 4HPGA 4V2XA 5DF0A 3DDGA 4KRUA 1BPLB 3SCPA 2Z1SA 3BC9A 6TAAA 1W32A 4H04A 1CXEA 3BAWA 2VCBA 4MB5A 4LPCA 4CCCA 4AISA 3KL3A 3TTQA 3GDBA 1E6NA 2DSVA 1KR0A 1SMDA 1FP8A 3AZTA 8CGTA 1KXHA 4MTVA 3ZSTA 3DDFA 1GQKA 5A94A 3F5JA 2E40A 5IFTA 2CHOA 2F1BA 1V08A 2IXUA 1CXKA 5I2UA 1NOWA 4W8AA 3GXNA 2RGMA 2JF7A 4Y7EA 3VUPA 3BUIA 5ECUA 2X2JA 4JL2A 2XFYA 4D6IA 2XJ7A 5JBDA 3PZNA 3AHZA 1W1PA 3VMOA 3UCQA 2VT0A 4ZXLA 1W9UA 5A2AA 1KCKA 3DX3A 4GZIA 4EAMA 1HTYA 1TFVA 2XGIA 1CEOA 1E73M 7A3HA 2VR4A 1BYAA 1AQMA 3IK2A 1GHRA 1T0OA 2ZX6A 3CZLA 3QHOA 4QFUA 4CD8A 1UWTA 2O9TA 3MANA 2EO7A 2JF6A 3RIKA 3LX9A 3A6OA 3CC1A 4JL1A 1TQUA 1JAEA 1NARA 3N17A 1DEDA 3OA5A 4QLJA 3NUKA 2XUCA 3PZIA 2VRKA 2YL9A 3RO8A 3CLWA 3MUIA 4ZENA 4U5KA 4MNMA 4AD2A 1D7FA 4AIOA 4PMQA 1GPFA 2A3EA 3AMKA 3N12A 4AZCA 3H54A 3CO4A 1VAHA 3WEOA 3D52A 2EADA 2ZUUA 3RCNA 2BHYA 1HVQA 1R85A 2PF0A 1BLIA 3N9KA 1WZAA 4W93A 1B90A 4TUFA 1V6YA 2CETA 2WHLA 3MO4A 5E6YA 4YHEA 2VR5A 1J0YA 1O7DC 3FHAA 1LWHA 1E43A 3H55A 1R86A 1FOBA 1U33A 1W3LA 2DQXA 2OYLA 1JF5A 4AY1A 3M07A 1CYGA 1PX4A 3PTKA 3AMLA 3EBVA 1XSKA 2UY4A 2VCAA 2O9PA 5HOSA 1J9YA 1G94A 5HNNA 2Z1KA 2ALWA 4QDMA 5IDIA 1ZB5A 1JNDA 2E9LA 5EFDA 1KWKA 1MFUA 2J7HA 3SUUA 1MQQA 3KE0A 3WDPP 4J3TA 4X0NA 1CECA 2Y5EA 3PZMA 1QVBA 2W92A 2A3CA 3HMCA 2C8NA 2F8QA 3VSUA 1C8YA 1HKIA 1JFHA 2PWFA 1UWRA 2QV4A 1PX8A 3BAXA 3MUY1 1US3A 4XZWA 4ZE5A 1PS3A 4W7WA 3CPUA 3BUQA 3CUFA 4GO8A 1W2VA 2G3JA 3PTMA 2DIEA 2XVKA 1JF6A 1E71M 3F4VA 2EQDA 1SMAA 1B30A 5D9MA 1TMQA 3THDA 2ZUWA 2DPEA 1LJYA 2PWDA 1CXIA 2F7RA 4MADA 2WSKA 4YHGA 3I3DA 3CHFA 1OD0A 2ZXBA 2X05A 4OUEA 2XN0A 1TE1A 1GVYA 1HX0A 4DO4A 4GZEA 2FHBA 4B16A 3IJ7A 2D0HA 2DSKA 3WMSA 3W38A 3A21A 3KLLA 1QW8A 2G3IA 3CUIA 1U30A 1QW9A 1PEZA 3SUSA 1I75A 3WDIA 1I1WA 4RL3A 3MSDA 1B0IA 2OSYA 1I1XA 3VD7A 3ZM8A 1KXQA 1OWQA 2W91A 1W1VA 3WY3A 4KGJA 3IAQA 3GXFA 2GK1A 3SCTA 3VIKA 3L4YA 4ZEPA 4CN6A 3GXIA 3UESA 2VMFA 3AOFA 3VINA 4UZUA 3L2LA 3AMDA 1CNVA 1B2YA 4GI9A 3WMCA 3VD3A 2J7BA 1B3YA 4FNQA 3EMCA 2GJRA 2O92A 1MW0A 1EO7A 2J78A 2YOCA 2DIJA 4LYQA 5GPRA 1OGSA 1GZJA 7TAAA 2E4TA 3VX1A 3WQVA 4PMDA 5CPQA 4AZ5A 3MU7A 2E9MA 2F61A 4GKLA 2WKLA 2WCAA 1OSEA 4NSBA 3VDBA 2J7EA 1C8QA 5JIPA 3ARVA 5IFPA 3HG4A 2QF8A 1JZ3A 1GQIA 1NOFA 1F4HA 5CGMA 4CGTA 1DTUA 4IISA 1OCQA 4OKDA 4FMVA 1ITCA 2G8ZA 3AROA 1WDRA 3N1AA 3OLGA 4UNIA 4AZIA 1UA7A 2W66A 1ISWA 5GNZA 1UKTA 3VIJA 4NZCA 2ZUNA 2EPNA 4AD5A 4S3KA 1YHTA 3WQ5A 1XH0A 4ZXOA 1QHPA 2DT2A 3MV01 2WVTA 1GHSA 1VRXA 3CHDA 3OZOA 3VKKA 3MUAA 2X09A 4D6DA 2FYVA 3AS2A 3GTNA 3CUGA 2VX4A 2BXZA 3AXHA 3UERA 1BYDA 3LPOA 3AYRA 4KMQA 1VEPA 3O2LA 5A6JA 1C8XA 1RP8A 3BVXA 3BAYA 4D71A 4AZHA 1VFOA 4A4AA 1G9HA 4PSPA 3ZJ8A 1QI3A 1JZ8A 3BAJA 3AIWA 4FLQA 3PZVA 3VD9A 3T2QA 3W24A 1OT2A 4AIEA 1AQHA 2OSWA 4HZ7A 3VIHA 1J12A 2FHFA 4K68A 5BXSA 3OLEA 1UD2A 1UWSA 2D2OA 1AQ0A 5A8NA 1EDTA 5CLWA 3D5HA 3WH7A 1XYZA 3UG4A 4NF7A 4PMVA 3S5ZA 2X8RA 1Q6CA 1ZU8A 3VNZA 4P7QA 4UR9A 1E5NA 5BRPA 4U5IA 3QHNA 2X1IA 2VRJA 2PWHA 1FA2A 3JUGA 3GM8A 5E1QA 4PSRA 1IZJA 4JCLA 1HKJA 1HJXA 4BA0A 3TP4A 4M8UA 3L4VA 4TOQA 1X1NA 5DEZA 2WXDM 4M29A 2VJXA 4F9DA 2RGLA 4C7DA 3EYPA 5I24A 1UD6A 3A5VA 1TQWA 2BHZA 3EDJA 1B9ZA 3MV11 1UA3A 4FNSA 3FY1A 1FHDA 1ZJAA 5AC5A 2DEPA 4ACZB 5A8QA 3WIJA 2X0YA 4CU6A 1B3ZA 1MYRA 3WD0A 3WF0A 2VZUA 2ZWZA 3WQ8A 1XGZA 3BVUA 4NRRA 2WNWA 1HKMA 1PZ3A 1OGGA 1E0XA 3HJEA 4DWSB 2WHMA 1KWGA 2YDQA 1HF6A 4Q7NA 4W89A 1UHVA 2JIEA 4DM1A 1GOQA 1HNYA 3VIOA 4Z2JA 2W62A 1UKOA 1QX1A 1Q6DA 2V5DA 4IM4A 3ARZA 3VGEA 3EJTA 3D4YA 2XFRA 3GNOA 1V6WA 1JFXA 2GSJA 3BAIA 1M7XA 3LPGA 3HZ3A 1Q6EA 1RPKA 3BVTA 5D4YA 3SUWA 1VIWA 2VO5A 3WDJA 4Z2GA 1UZ1A 5CSYA 3I3BA 2Y24A 1NWTA 2J7CA 4UFMA 2ZUSA 3DYMA 3CZKA 2XHYA 4UFHA 4AEEA 4BS0A 3BVWA 1GOIA 1HJQA 1ZBWA 5HBFA 3ZJ6A 3QOMA 4KWUA 2EEXA 5GNYA 2C0HA 1JDDA 4EKJA 2D0FA 1H4PA 1XH2A 1MWOA 3OBAA 1J10A 2CERA 3AHXA 3AYSA 2V38A 4Q22A 4TTUA 2PC8A 1D3CA 3AZRA 1MXDA 4CN4A 4ML4A 1CDGA 3WH5A 1HN1A 1H3GA 1W91A 1OB0A 1CGWA 1OIMA 3K8KA 3A24A 3VDAA 2W4XA 3A4AA 1DWJM 3RJXA 1TCMA 1MQRA 1V0MA 2BY3A 4PBGA 3WD1A 4NX0A 3UG5A 3FHQA 3TOPA 5FOOA 2VQUA 3G6MA 3DX0A 2IXVA 2PBGA 1V0KA 2WYSA 3WDQA 1PIGA 1PPIA 1UD4A 1UR2A 5D8ZA 4CCEA 3M7SA 3CZJA 2X2YA 4FLRA 3TTSA 2CPUA 3IJ9A 1ZBKA 4PYSA 4DUXA 1F4AA 4HOXA 2DSUA 3SCNA 5A95A 5C8BB 4QCFA 4HU0A 1OT1A 1ZS2A 4PMUA 4U33A 4ZFMA 2CCRA 2ZUMA 1WAWA 3WF1A 4UFKA 1TA3A 2BFGA 2OYMA 1V6XA 2XN1A 3B9AA 6A3HA 4PTVA 3BLKA 3BMWA 4FLOA 1TR1A 1XSJA 3CTTA 3VU2A 2Y2WA 3DC0A 2WPGA 3KEHA 2D20A 1H41A 3S5YA 3WDRA 1M53A 3ZQ9A 1MFVA 1TQTA 2WBKA 4WF7A 2CBJA 3PZOA 2Q8XA 1UR0A 1MXGA 3AQUA 5CSUA 3U7VA 1GOOA 3MMDA 2WWDA 2GVYA 4DM2A 2ZX9A 2FH6A 1V3HA 4D1JA 2V3FA 2BVDA 3DHPA 3I3EA 5FCZA 3OG2A 5A8PA 1WPCA 1XSIA 3IAPA 5CLTA 2WVVB 1UZ4A 2VQTA 2XVLA 5KEZA 3WKZA 1WZKA 1EXPA 3A4XA 3HU7A 3UR7A 2XN2A 2PWGA 3BUBA 2VL4A 3DYPA 5D9OA 1J11A 4LYRA 4OBSA 3W26A 1MW2A 2VX5A 1JDAA 3IANA 7CGTA 3ARRA 2G3MA 2GJXB 2ZWYA 1WP6A 3KWXA 1UG6A 1L8NA 4CU7A 5D8WA 2J75A 3EJRA 2ZXDA 1MVYA 2BY0A 1E6QM 4AMXA 2PWEA 1E3ZA 3ARPA 3ECQA 3DECA 2XVNA 2EXOA 1MW1A 3RPMA 2E8ZA 2WANA 2V3EA 1GJWA 3POCA 2DH2A 1EO5A 3VIFA 1SR0A 4CD4A 2WC3A 3UETA 1E0VA 3EDEA 4LX4A 2J77A 1QHOA 2XSAA 1CPUA 3CMJA 1PBGA 3A23A 2OW7A 3O6AA 1E1EA 4W87A 1UOKA 2HVMA 4HP5A 4BF7A 1XCXA 3A22A 4HA1A 3GXTA 1W9BM 5BWFA 4DWSA 5IHSA 5A6KA 2G3NA 3H53A 9CGTA 2ZX8A 4ATWA 1L0PA 2VRQA 1K9FA 4HPHA 4AEFA 1H0GA 3L4WA 1K9DA 3KL0A 4UQBA 2QLYA 5A6MA 5A8OA 1B3XA 1JGIA 4PMZA 3HN3A 1WZLA 1H11A 3RJYA 3L4UA 3GH7A 4QAWA 2O9OA 1JD7A 2J25A 3SCUA 3CZ8A 4JZ5A 1BVZA 4ZE4A 2VZTA 4ACYA 2WB5A 4AZBA 1R8LA 1HWWA 2WMFA 4PN2A 3VGHA 1C91A 3ARUA 3VIMA 4CCDA 1QI4A 1V3IA 2XFFA 1QOXA 4P8WA 3OGSA 3LXAA 1DWIM 3CBWA 1TQVA 5M5DA 1XD0A 2JEPA 1QNSA 1UWUA 4AXNA 4D6GA 1E72M 3LPPA 2CXGA 3O9NA 3IGUA 3ZT5A 4J3SA 2QHAA 1GOKA 2YDSA 2XGBA 2NT0A 1Q6GA 3FXYA 5CPSA 4H8VA 3WQ6A 4CVUA 5LA1A 5JBEA 5DO8A 1EDQA 1FHLA 1FH7A 3WH8A 5BXRA 3VGFA 2CHNA 1WB0A 3MS8A 4D6JA 3OZPA 5A6BA 1EOMA 2F7QA 2D1ZA 4CD6A 3T0DA 1UASA 2AAAA 1E5JA 3EJPA 2WMGA 2VZOA 3OIHA 3OLIA 4DUVA 2EPKX 2VCCA 3RDKA 1TG7A 5ABFA 2J74A 1CIUA 2WWCA 4MB1A 2UWFA 1UD8A 1X6NA 2Y8KA 3WF2A 4FK9A 4H41A 3AIVA 3B9EA 4BQ4A 1ZBCA 5A1AA 4GXPA 3W82A 3II1A 1E4MM 3N15A 3N13A 4D1IA 1PX3A 3ZOAA 5A6AA 5AY7A 4LGXA 4W84A 2CBUA 5LA2A 4JFVA 1KGUA 4TVUA 3K8MA 2XPKA 4Z2KA 3VSVA 1E4IA 1E4NA 4X0VA 2ZXQA 1BGAA 1JAKA 1LF1A 1FH8A 5M3WA 3GYCA 2WHKA 1PJ9A 3VIIA 1Y7VA 1VB9A 4OOZA 1W9PA 3WQWA 4NXSA 4WKHA 3WF4A 1KGWA 1EIBA 3VILA 2OWCA 4QLKA 4UZSA 4F8XA 3WNNA 3IJ8A 1EHAA 1CWYA 4JKLA 4JFTA 2XYLA 3VM5A 1CZ1A 4W8BA 4BCEA 1EGZA 2DDXA 3SCRA 1GNXA 4PMRA 1JZ4A 1OM0A 3NCOA 2W63A 2WBGA 3ARSA 3W53A 3TONA 2NSXA 4B3KA 4ATDA 1ZJBA 2VUYA 3EDDA 4HOZA 4JCMA 1E6SM 3BGAA 4U2ZA 4HTYA 2YFNA 2YA2A 3GNPA 3K1DA 2XTKA 4CVWA 3ALFA 3GH4A 3WBAA 1M03A 3LPFA 1B31A 3VGGA 3F5LA 3L4ZA 3VIGA 4C7FA 4OBRA 1NQ6A 2WHJA 5M03A 1EA9C 2ESCA 3AFBA 2F18A 1GJUA 1C92A 3TTYA 4J28A 1E15A 3AHYA 1R75A 1DWGM 4GIAA 4RE2A 5C71A 4F79A 4H2CA 1HVXA 3GH5A 3BLPX 2XG9A 4WSKA 3ZR5A 4OGZA 4LXFA 1UQZA 3WEMA 4NZJA 3AHVA 2BVTA 3GXPA 1KBBA 3LRKA 2FDMA 4TXEA 4MAZA 2WK2A 1CXLA 3AIRA 3BXWA 3ARXA 1ISYA 3BLBA 4W86A 1GORA 1J0KA 3W27A 3EJUA 2XWDA 1VJZA 3AZSA 3SURA 4UOQA 1HP5A 1PZ2A 3D51A 3CH9A 1NP2A 3T2PA 1K9EA 4PCSA 2G4FA 4U3AA 1NWUA 1K9TA 3WY4A 5JBFA 1B3WA 3DX4A 1J18A 1NM9A 3HG5A 1XV8A 2YLAA 1JNEA 4WJXA 4AW7A 2WMHA 4B9YA 3WFZA 2DT3A 3SUVA 4MAVA 2GDVA 1HJVA 1HL9A 3WMBA 3MMWA 3ZR6A 4MB3A 1ZBVA 2WVSA 4PCTA 5DMYA 3CV5A 4UQ9A 3FN9A 3PHAA 1LL4A 1HKKA 2WZIA 5A8MA 1EDGA 1RP9A 3BCDA 2ZX5A 4AIUA 5CJ5A 3ZO9A 3CUJA 3OGRA 2J47A 2WCGA 1KXTA 3CGTA 2OWXA 2E9BA 4L4OA 3WUFA 4RE4A 2J7DA 3RM9A 4U2YA 1C93A 2CKSA 3CMGA 1B1YA 1V03A 1V6VA 2WMIA 1G5AA 4HU8A 3LRMA 3K4DA 2A3AA 1UUQA 3WNOA 3VGDA 1VJSA 3SCQA 3SIMA 3M46A 1KCLA 1XC6A 5I3DA 1DWFM 3A4WA 4AMWA 3BCFA 4UFIA 4AD4A 3AISA 2XM1A 2VZVA 2UY3A 2Y8VA 3GBDA 4XB3A 2CKRA 1JI1A 1CGTA 2GK1B 2J8GA 4C7GA 1J0HA 3VNYA 2TAAA 4CKQA 3BAKA 3WL1A 2JE8A 1LWJA 2OYKA 5I23A 4F66A 4M1RA 1SYTA 3WUEA 4P7NA 1NP0A 2JALA 3LMYA 4M24A 4P8XA 2VVSA 2X2IA 1TZ7A 4B15A 4AZ6A 1IV8A 5KZ6A 1QNQA 3K46A 1JZ6A 1UD3A 3WEZA 3OB8A 4MJ2A 4UFLA 3AXIA 3ARYA 3WNKA 3N04A 3KLKA 3QOKA 1LLOA 4EK7A 3N11A 4P7RA 1V0LA 1H49A 2WLYA 1HJWA 1JYNA 1UH2A 1AMYA 5E9AA 2YL6A 3ZIZA 4AWEA 5ABFB 3WD3A 1QI5A 1HJSA 3SCWA 5FL1A 1R34A 3TA9A 3RM8A 4J7RA 4GQRA 5LYRA 1E1FA 4MNLA 1E40A 3VSTA 4FNUA 1J0IA 3GXMA 5IHRA 5E70A 3W29A 3WENA 5ABEA 3NJ3A 1V0NA 3MSGA 3NSNA 1HJUA 3TV8A 5A3HA 5FL0A 2WC7A 4FF5A 4J3UA 3U5UA 3CUHA 2DSWA 4XV0A 1VENA 1KQYA 3AIUA 3AIEA 1GOMA 4GI6A 1R47A 2VURA 4UFJA 1JG9A 4MNKA 5I0DA 2YL5A 1QPKA 1BAGA 1R46A 2EACA 2YLLA 4JFWA 2BHUA 2D22A 1N82A 5EBAA 3RILA 2CYGA 2CITA 5M17A 1V3MA 3WY2A 3VGBA 4BQ5A 3QR3A 5LA0A 1UWIA 1VEMA 2YBUA 4N0RA 4DUWA 2E8YA 3U5YA 4HZ8A 3W37A 5HPOA 2BNJA 5I6SA 3CHEA 3MMUA 2DSZA 5CGTA 4H8HA 1JIBA 4H8UA 1WE5A 1UR8A 2CNCA 4EE9A 1WDQA 2OSXA 1QI2A 1YQ2A 2YL8A 2AOSA 2D24A 3KL5A 2VX7A 5E09A 2D23A 2VZSA 4M56A 1C90A 1QNRA 3UEQA 3PZGA 1D2KA 5JUVA 5ABGA 3A47A 3BSHA 4DO6A 1WZMA 5A6BD 3AXXA 3EJSA 3ZJKA 1CXHA
chains in the Genus database with same CATH superfamily
1Z0NA 4OCWH 4R53A 3AB0C 3WFDL 5JHLA 1RH8A 1TQBB 3KJ6L 1RIHH 4HXBL 1C5DB 2XTJC 3O0LA 3T3PE 5AAPA 5HHME 3L9RB 4IMLA 1NFAA 1CI5A 1W3IA 3B0PA 3QZLA 5CXPA 3NQMA 5JIWA 3ZDZB 4LVBA 3FB8B 3RHWF 3WO8A 1PFCA 3LNFA 2BOGX 4TLTA 3GR8A 3N3MA 2UZYA 1JPHA 2WBJB 1MY7A 4WW1B 3GW0A 1C5BH 1F3DH 2XJLA 3V0HA 3BVDB 4PLOB 1V8EA 3R0NA 4NZ3A 4PRHE 5AQ0A 4AYID 3VFTB 2F2KA 4NYYA 4OSUH 3WH9A 1HSAB 3AS3A 4YK4C 1Z9SA 1C8VA 3DTUB 2G95A 5GHWL 1ZLPA 4OJAA 5L4FA 3SEPA 3GRIA 1ONRA 3TC3A 3R11A 4Z77B 4U1LA 3RWGB 5ICZB 2CJSA 1X38A 3E80A 1KFWA 2V8LA 2Y1ZA 3MV8D 1XDJA 2CALA 4PJDF 1XL4A 4XP1L 2GDUA 1EHKB 1L4IA 1SM3H 3HR5A 2DWEA 2W60A 5DJDA 5DHXB 2EDNA 4LARL 2XH7A 1JV2A 2XZZA 2CG9X 3AW5A 3FOLB 2XNAB 2OI9C 1I2RA 4MVAA 3LOTA 1L0YA 3IDMA 4PMNA 1PDKA 3Q9QA 4D94A 5MENE 3VD4A 1RHFA 1CENA 4OCMC 3BYYA 3EMZA 5IROC 1NBCA 4ZAKC 4PTXA 5IEHA 3VXSB 4HJTA 3CE1A 3K3QA 3O05A 1MJ8L 3CFEA 4AF0B 3ZDYF 1OD7A 3WFBL 2DD8L 3ZMEA 5BVJA 5KANI 2N7SA 3OAZH 4JY4A 4F7KA 2QPXA 2VE6A 1D3HA 4ELMF 3PGDA 1VFUA 2DMBA 2YQGA 5LGKA 3APTA 5EO1B 2WW8A 4W9EC 4AK2A 3AT9A 4QHNB 1FZMB 1ADOA 2CU9A 1SPQA 2QCDB 2H3DA 4IQDA 5M1TA 2XG4A 3K6NA 1FBIL 1QTYT 3CVDA 2ZX7A 1NCAL 5KN5A 3IWVA 1H1NA 1IEHA 1H5VA 4KTDL 4P2QA 2JKEA 1JGEB 2JKPA 5I73C 1KN4L 3U36A 1L5GA 4Z8FL 4O02B 3IRSA 2JF1A 2A73A 4N0FB 2E7FA 5E6IA 1G7MA 2LLLA 1BMGA 2ZG1A 4WHTB 4MKTA 1DN0A 5C8JB 2ASHA 4MDOA 4N3UA 4OR1A 3CTLA 2PI6A 4IJ3B 3AIQA 3UYRH 5BROA 4OV5B 1TZAA 4GT7A 3DBXA 4NKIH 1DQJB 1OM3H 3CVCA 3NMEA 5CSZA 4JEQA 4K71C 5A3ID 4Q7BA 4RNIA 4JPGA 4BYHA 3R6IA 2XWCA 4U1NB 2H6UA 1OIFA 2BGQA 3D08A 5T3XL 2D73A 2EIZA 5CEZD 3SSJA 3UJTL 2FUTA 1CQYA 3FQUB 1I4FA 2P9RA 2ZUVA 2H90A 4Z0XA 2I9LB 1X9UA 2AGJL 1H50A 3TLRA 4C5YA 4NWTH 1OLLA 2NW0A 2P26A 3S6TA 3G1VA 2DV6A 3N44B 4LLQB 2L7JA 4UANA 4UDTB 3ABXA 1ZD6A 1U22A 3JWDH 5AYTA 2ZDRA 1KCRH 3QFJD 4H1LG 3RNKA 2XVPA 3H2FA 4L8BB 2XWBB 1HI6B 3C6SA 3OZYA 5LA0A 3GZAA 1SLWA 1OSPH 5F7UA 5KOVC 1NWRA 1DLHA 2YD9A 3L23A 4RBPK 4Z2IA 3FT4A 2AL2B 3N2CA 5U7SA 3HFMH 2MQ3A 1UCBL 4MA3B 1TUXA 1OX5A 3OG3A 3M1BB 3AC0A 6FABH 5IR1A 3APNA 1QD0A 1Q9KA 3F01A 5KYUB 1NLBH 1JHKL 2ROYA 4GKSA 3CZNA 2DP3A 3UTOA 4KDTA 4OF6A 4PV8A 1GZPA 3CN3A 3OB0K 3BYTA 1KSRA 4APXA 1CG9A 1Q7MA 1R6WA 3VXRB 4LFHD 1SVDA 2PAJA 1UW9A 5DDHA 3L1GA 1EGMA 2VABB 4MB4A 5AOKA 2FATL 4HNCA 3U48A 4CJ1A 3FU6A 5FEPA 1XLJA 5JDSB 3QC6X 1JGDA 1IGIL 3MLTA 2QPSA 4PI0A 5LBSA 4MLIA 3B05A 2COVD 2VDKB 2VNCA 1IFHH 2VW4A 4PHXA 2A74B 2GUYA 3O81A 3IUHA 1A47A 4M7ZB 3KD4A 1UIPA 2GWNA 1QUNB 1W9VA 2DQGH 1UP0A 3GIZH 1G0YR 3DERA 4QNWA 5CPMA 1HINH 4I0PC 5T33H 1EEPA 1UB6B 3QWRD 4Z7OB 3PM6A 2XTLA 4FNPA 5GGRY 2DLFH 3WLLA 4WHYG 1PQZA 3M0JA 4JXCA 5HMEA 1BJMA 5AW7B 3K80A 5EY5A 3AUJA 2FJFB 3GHUA 3IF1B 1TPVA 5ALBH 3FFCE 4BFNA 4L6HA 3PGCB 3RKDC 2OMYA 1GC1H 1W2PA 1YDNA 5AYIA 4MA1B 2N3JA 3MNZA 4HIEA 4MSWB 2HFEA 3DETC 4N2IA 3V7MA 5C3IA 4H20H 3H70A 4RDYA 1DQXA 5H37A 4ZG1A 2ANUA 4AMCA 1JL8A 1P4BH 4Y2WA 3U4BL 5D9SB 1KN2H 2RUSA 5D2YA 3WX7A 4QE5A 4XNMB 2G37A 2XN9B 1ZPLA 4DWSC 2AVFA 3LZFH 3DFQA 2ZPKL 3FTWA 2XIJA 3I02B 5D30A 5DX7A 3WLOA 1TA3B 5BRBA 5HGBA 3ARDC 4W9GC 4CADB 5FO9B 3NDYA 4O0ZA 3STPA 2R4SL 2FE0A 3OZKA 1KJ2A 1BFNA 3IIPA 3KBSA 3OGVA 1B4JH 4JGDA 1P4UA 2ZFAA 3OLDA 3EXJA 1ZLWK 3P8IA 1A9EB 1JZIA 2AKRB 2R14A 1TJIH 1UB3A 1MCIA 3RX7A 4DKEL 3AALA 3KPMA 5M2FX 3PZ9A 4MDRA 3RDTA 1U3YA 1XZ0A 2Z0UA 1BKHA 1MIML 4JO2H 2OYPA 1Q94B 1W72B 1EH9A 4Q58C 3OQ3B 3FOKA 3N14A 1WTGT 1YNTF 4U3SB 5E99L 3K6SA 5RUBA 3OAWA 4ONHB 4ZQKB 4W9FC 3VRJA 5FCUH 5AAMA 5E4AA 5AYXA 4B2DA 2NY2B 3VG9B 5C0BA 4F33B 4DNLA 1MZHA 1MCCA 5IFAL 3A13A 4YYFA 1AFVL 2A9ML 5E03A 1QNOA 4WY7L 1U58B 5BYWA 1GY1A 2I5YH 4HV8B 2D7TL 4XRCB 4PRBA 4AG4H 1PCXA 1GTFA 3HPLA 4B4FA 1J01A 2Z7GA 5C0JB 4Q9BA 1NIAA 1WFMA 5IB5B 1AGEB 4JPKL 3UTZA 2P8MA 4OCXH 1BF5A 3MTWA 3SUTA 1E42A 1D9EA 2R23B 1CQKA 1HQRA 2IALB 4B27A 3QDAA 4W5ZA 4RR4A 4A04A 3PPHA 4P49A 3SCOA 3MRIA 1TTQA 1K6AA 3EJJX 1XB6A 4PUWA 3E49A 4BDVB 1AHWB 2HPOA 2NY1C 4AQOA 1US2A 1AGDA 4NU7A 4XBGA 2FLMA 4ZD3H 3OR6B 4N2BA 1IEIA 2V3GA 3ITGA 4XIMA 2W0FB 4DK5A 3EFFA 2XVGA 2G5UA 4QJ5B 2FWLB 5E4OA 2F6AA 3BDXA 4QTIH 2BC4A 3ZRFC 1BTCA 2FJGB 4ODWB 4Y2DD 5D7IA 4QM1A 5IOPB 1A0QH 2ZAHA 1XLLA 4IP5A 1D5XA 3EX3A 1K8XA 4RETB 3X13A 2VDOH 4U1GB 3IDJA 1FZJB 4ODHL 3GPEA 5HDBE 3PPSA 4WI0B 3ZQXA 3O8XB 4NHVA 2BIPA 3UZEA 1NL0H 1QFOA 3TTOA 4NWTL 1AOHA 1E65A 5ESQA 4HOMA 5FJRA 4LCWB 5AYUH 3SQOH 1T89A 5B39B 4GXWA 4I87A 5CMAB 2BXYA 5TJWK 1RBLA 1W6LA 4MJ6B 4E9QA 2AEWA 1TPUA 1W1ZA 2VUOA 3B7SA 1B54A 3V5HA 3PAJA 4O53A 2YC1B 3T9PA 1XAKA 2EAEA 2WKGA 3KPRE 1UWQA 3QJFA 4WK4B 4KCUA 4NQDE 5AB2A 3BAEH 1MRFH 1LLAA 1A5UA 2WXQA 3CIVA 2K70A 4TX8A 2XZ7A 4PLJD 4JFYB 4KRPC 3RNQA 3CK0H 4TIMA 4Y8EA 5K59F 4NXKA 1TRIA 3TWCL 5I0ZA 1E2ZA 3PWVA 3WS6C 3C2AH 4Z7NE 4GBUA 1JK9A 3GFZA 3SE9L 5TTRA 3S5NA 4RISL 3UROR 2YQ2A 1TX0A 5GS1C 3DPDA 4UV7L 5IROD 4K1GA 4HWBA 3B5GA 4OKVB 4GPNA 5KYXB 4XPBH 2TMDA 3DI3B 5IHUH 5BZDB 5KVGH 3SO3C 4LZKA 2YPKA 1I2OA 1M2OA 3IU3A 5F3HA 1JCJA 1MFNA 1KB5L 2YPLD 4QHUB 2AXGB 1IXQA 2AQWA 3PG8A 4LS0A 3VA6A 2POTA 4P8VA 4C6PA 3P4MB 3OHXC 4TQHA 3B8SA 4QF1B 1BYPA 3VB9A 4WGVB 3WHE1 5BW7C 5JPMA 1R3WA 1OINA 1CLOH 2L0DA 3D6GA 4YSDA 3W2DL 1BG4A 2W67A 3LCWA 5CBIA 3RITA 1HL8A 1RMFH 5HVHB 1R5IA 3TXZA 3T0XA 2G0LA 4UQAA 3ZKMC 4DP2X 3QZBA 4WNQB 1U3HC 2J6XA 3IB4A 2C3VB 3K8LA 3BKMH 3QIUD 4JYDA 5ICZA 1CLZL 2V2TB 1MUJA 2NY2C 3VG9C 2F84A 2X0SA 2H2PC 4C90A 5CP7B 1S9YB 1E9QA 1CE1H 2F8IA 3HOGA 3NA9H 3LZ5A 2OCCB 1IAII 2WXKA 2A6KA 2DQCL 3NAAH 2XNAA 5MKGA 3SYOA 3A3HA 4EPKA 5L2KE 3UJJH 5GRVL 4RMTA 1RIHL 2FX9L 4HXBH 4NCC2 2XTSA 5I6LA 4FXJA 3ECUA 1RLCL 3CV1A 1T21A 2ZRYA 4KFOA 2QGCA 3OZ9H 3N6HA 1QSEB 3O6FD 2K3TA 3AXLA 3QGVA 4JFOB 4APQA 4HWBH 1OAUL 3GSNA 1A0EA 2HP4A 2B81A 4NQVA 5E0FA 1N7MH 2PUQT 4BKLA 3GR7A 2BDNL 3T08A 4RCXA 4X9GA 1IAKB 4JZOA 4DHGA 15C8L 2ZSWA 1K6WA 4PRDA 2PCPB 5HINA 1GKOA 2IWFA 3L3HA 2CHRA 1Z41A 3RF9A 2YSTA 3JWOH 3OGCA 2OP4L 3P9MA 1ASOA 1BX2A 2ITDB 4XWGH 4WO4C 1HS6A 4ZMWA 1FV1A 4R0LA 4LRTA 3C5JB 4HH8A 2WIIA 2QQ6A 3EX6A 5IJVA 3QQ9C 3JTTB 4I13B 4XN9A 4JM4H 3HE6A 2WM0A 4O54A 2ATKA 4WUUA 4QP0A 4WCJA 1E1CA 2C9UA 5IMKA 3ATDA 2WBXA 2BNQB 3VFPB 3IFOB 4PJ5D 3G6DL 5HHVL 1JI2A 3V9EA 1VBHA 3QCTH 3FS9A 5IJKC 2HS6A 3DKLA 1DQJA 3IU4H 4HK3N 4IDJH 1EXUB 2AGKA 5E1HB 1BQHG 3LAFA 1T1ZB 2X4RB 4P3DB 1OAKL 5HXMA 5D6CA 2XXGA 3DHUA 3IK4A 4Q8QA 3NTYA 2WKOF 3FQUA 4Y4FB 1I4FB 3GUWA 3EWUA 4N1CA 2IPWA 1BQHB 3QZWB 4X7SH 3ZTEA 3PUUA 3TJEH 5DT5A 3VNMA 5IQ7L 4BFAA 3D3VD 4GXFA 4KUCD 5JNYB 4WIWA 4J27A 2P8LB 4AC1X 5A69A 4M6NL 1J8HE 1FJ1B 1OGBA 2HXTA 4AX7A 2XM2A 3ARBB 2DI8A 3MW7A 4AAJA 3KRSA 3ZFHA 3UC0H 2WNKA 4PEEA 3KHOA 3E2HB 5E6ID 4GSXA 3VFGH 5I28A 4K8RH 4QTHA 2DMKA 1X98A 1CB4A 1XH3A 5HVGB 1T83A 2MMXA 1XEUA 4I2XB 3RAJL 3CWOX 3GVRA 1EAQA 5DO2D 5AVSB 3QVQA 1YBQA 4H40A 4Z78B 2EKJA 1EFXB 3IDGB 4KTDH 5TK2A 2Q7AA 3TZVC 5JQIB 1A14H 3SQSA 1T96A 4Y9GA 2HJLA 1WV7T 4IRSB 2XINA 5C70A 3OIXA 1MCNA 1JNHB 4GUFA 1NTHA 3WN6A 1UYQA 4YU1A 2QSCH 1GGIH 2NY4D 3N41F 1TJGL 2NQLA 3APFA 4HU3A 3EOYG 4AV5A 3MCYA 4X4XA 1MJJA 1RUQL 2E6JA 1J6PA 5D2LF 4MXQD 3ZMRA 3TW6A 4DB7A 5CGYD 3DESA 1OF8A 4HMEA 3KBJA 4U0RB 1KUMA 2Z24A 2Z2AA 4B5UA 2EJAA 4JTFA 3K0YA 3LRLA 1LO0L 1MPAL 4FEIA 3LCGA 3MKVA 4Z1CA 2QCGA 4P5KB 1D7CA 1MCHA 4AQAA 2F8VA 2DT1A 3NSXA 3C0JA 3BUDA 3B0UX 4GAFB 4XCYB 5JZ7C 1JGLH 4HBQA 4Z0BL 1AZ1A 3BKCL 2GY5A 3TE9A 4CNIA 4V28A 3UR2A 3U9WA 2PCEA 1Q45A 2J1WA 1C7SA 1CFBA 4YO0A 5T1KA 5B3JF 1RHHA 2N59A 1R7OA 2BZCA 1NEPA 1Y5WA 3GHEL 2X42A 2WPBA 4KRPB 1KEMH 1ERNA 3SY0A 3LN4B 4ODUB 2PYFB 1M6OA 4ZUSA 1WA3A 1VFFA 4IQJA 1BM3L 5B1BB 3GVWA 1TWIA 5ABTA 4BH8A 3PJXA 2BVOA 2EG6A 1HXKA 3VM7A 5DSCB 5JXED 2FTYA 4AKPA 4QJ3B 3V0SA 2CESA 3ASWA 1S7UA 4JPIA 4YBQC 4MNQD 1Z5LB 3CSYA 4FQXC 3RN6A 2WUBL 3PJSB 4IKKA 3W0KA 5DC0A 1GGCH 3NRFA 1ZLDA 4JKWA 2OK0H 4FQ1H 4L2YA 4XCCH 4M61A 1QSFE 4QGTA 2QT6A 6CGTA 4ZSOE 3L6FB 1IEQA 4PTDA 2WWOA 4NC1C 1CDUA 3CZGA 3FO1B 4MNJA 2XSBA 1DQDL 5H94A 2VAJA 5ESAA 4XOBA 1X3DA 4XNDA 3V6FB 1HXJA 1NAKL 1L2UA 1MRDH 2V7NB 4M6UA 4WXYA 1AW2A 3E8UH 4ICXA 3WHXA 2ZZUT 2HT3C 5D2WA 5EPDA 1XX9C 3NFNA 1RZ8B 1J05A 1K72A 3MR9A 4MD4A 3UBFA 3ORWA 3CFBA 5FI8A 3MKGA 3KYNB 3QK0A 4Y5VB 1VBRA 3ARED 3QQ3A 2E6YA 3G0SA 1XIEA 4IOIB 3FRUA 4PJIB 5TGBA 3ZE1B 1BXBA 1OGAE 4O1DA 4A35A 2ZZ6A 2EYSA 3L65A 1NMAH 3C6LB 4ADSA 4W4OA 1AZVA 3H85A 5T5NG 1S38A 1GZHC 3TO4C 3T4WA 3VJ6B 3BMVA 4OCRH 2J3SA 1URIA 2C4FT 1GC1L 2PNDA 2Y8UA 4IZGA 3SKOA 1F61A 3W6LA 3FC8A 4GMSH 3WFEH 2IDFA 1V3KA 4UUJA 2FZ8A 4UT9H 4WW2A 4AH2B 4KRTA 3Q3GA 3UQNA 1P48A 1Z32X 4NB7A 1ZA6B 1GAFL 4Z3TA 3H2CA 3HO8A 4PBDA 2J73A 4KFMA 1AAJA 4DJFD 4D8PA 4GINA 3IYLW 3TYFA 2WZ6A 1EZLA 4FDWA 5DJAA 3EOAB 4LP4A 4D6EA 5JIHA 4P59L 3RHWK 4N0CD 5B38G 5FDWA 2NX5E 4QCIA 1IXNA 3MRLB 2V9DA 3K2GA 4I7VA 4KKNA 2TRYA 4HGWA 2QJHA 3NQVA 4I5BB 2WNQA 3OR7A 1NGYA 2WWKO 4N2DA 2CZ5A 2WYZA 1KCUH 1KYOJ 3DX7B 2CLEA 3NQ6A 2LW3A 4WAFA 4URIA 1T40A 4KKCD 1IT0A 2QGDA 3OC8A 4H5SB 3TYEA 1U5JA 2PPFA 1LE9B 1CBGA 4YDJA 1PVNA 5I9QC 5I76A 1W3JA 3W81A 5LNRA 2PDCA 5BCAA 3D0VB 4KTEH 4I0PD 4YPJA 4WHBA 2XI9A 3GPSA 3PABA 3IGAA 4M03A 3SYPA 1U36A 2HUHA 1ZVSA 3T3PF 5DUBA 2HTMA 1AKPA 4B5WA 3GMQB 2HZHA 1GOXA 4ZQOA 3S5SA 3DURB 1V02A 4OZOA 1SFSA 1Q0YL 4M5ZH 4A1RA 5DMLA 2X6MA 1LXMA 3ABMB 4XMLL 2HS8A 2PS2A 2X1UA 3GXDA 4JHOA 2DH3A 2HKFH 1EAOA 2ZXAA 1WKYA 4AX3A 5B39A 5GSVB 4XD4A 3RMEA 3G6AA 1LDPL 2DUXA 1M04A 1OC7A 1KBKA 2DGAA 3C5SB 4GUPA 4QE4A 4ZTPH 4IHCA 4KJPD 5F2GA 4MQXC 3IKCA 2A9NL 3AWEA 3LMJL 1MF2L 5KVEH 1W5MA 2VFEA 1Y1UA 4YR6B 3U9UB 4XSMA 3V36A 3DX6B 3L16A 1HH9A 4XPHH 2E6FA 3UEZA 5TDOB 4BKTC 4MWFA 4E0RA 3CEUA 1F4XL 1XD1A 4LBEA 5F72S 4JY5L 3OVGA 2EKSB 2ZG2A 1T89C 3MA9H 2AJ3A 4IBQA 4TNVF 2ERJC 1Q65A 5AUMA 3IIZA 2PDNA 2YAQA 5IIEA 5JW4R 3DGRA 3VO0A 2VH5L 3HPZA 1KMGA 3MUZ1 1IM3D 3KWWB 1AODA 5DCDA 3O6FA 1CICB 4Q8BA 3P74A 1LK2A 1AO7B 1ME7A 4QITA 4CN1A 3I7SA 1B0RB 3RWHB 1Q66A 3L4CA 5I0YA 4B92A 5EU3B 2H8PA 5F9DC 2ZNXA 1P6CA 1HP4A 4ATLA 1KGXA 3DO4A 4DGWC 1JZ2A 4DEWA 3QEHB 4M48L 3NPZB 3Q94A 3EWBX 3SDXE 1JVOA 4XZ4A 4Y7MA 3SY8A 1X6LA 4ANXA 2WW5A 3UTPE 4AUUA 3VI3A 4HEPG 3LBCA 1GCYA 4PUDA 3UNDA 4OLWL 3CHOA 4GNKB 1YPZF 2Z8RA 4FQ2H 5C7VA 4U1IA 3Q8EA 3DVGB 4WJKB 3PK7A 3KPTA 3TBYA 3MY9A 3RVUD 5FXCH 5ISZD 4G82A 1DQVA 3C8DA 1MO0A 4R4BB 4AGPA 4UTFA 3TX9A 3PGFL 3BQUC 4GVFA 2X53A 1IEAA 2J8TA 3CLMA 4Q32A 4WO4D 4L3CB 3W0WB 2WXIA 3KG5A 1EDYA 4JIPA 5EMYA 5BXPA 4XN4A 3BEVB 1YPZE 4Z76A 2EUWA 5F2LA 5SWUA 3CH1A 1QOKA 4X0KA 5IBLC 3VXOA 4ML9A 1ISZA 3K4AA 1QI0A 4F8TA 3FSVA 1DP0A 1ZHBA 4MMXC 3ETSA 2IDSA 4Q0XH 2R29A 1O1HA 4HNNA 3LV3A 3AHTA 2KAUC 5AZEH 5E2TL 5I1IH 3VAEA 1HL2A 2AV1B 2C9RA 3LHPH 4J1UA 1NWOA 1N8OE 1WHOA 1V7NL 4GB9A 4MBOA 4PW4A 3TBSA 4ECNA 1MI5E 5FEBA 5D70H 3VWKB 1U5VA 1VF8A 5DMKB 3QM3A 3HC4L 4G70B 5EOCJ 4QX4A 2F19H 2W80C 2KYIA 4N2EA 3GAYA 1JV5B 1YMHA 1LBFA 4DJEA 4DN4H 1A7OL 2NSOA 5SWSB 1AIZA 5IK3A 3P0XA 3AXLB 3GLDA 3RX4A 2XFXB 2VZ3A 3OYZA 4MJJA 1HT6A 3I74A 4OLUL 4X4YB 3D0LB 2QS8A 4TVDA 4M8RA 2PGWA 2HLAA 1SLXA 3B2VL 2BERA 2O6CA 3QNYA 2J9ZA 3NQCA 4Q4OA 1DVXA 3W2LA 3WNLA 3ASNB 3PAVA 1KM2A 4WNJA 4GE8A 5DLCA 1O4UA 5DRWB 2GSEA 3HB3C 1TNMA 5DF0A 3VG0H 3S35X 1E5UI 3HZYB 4FXKC 4KRUA 4UIOA 3DPBA 5KN5B 1MNNA 3F4CA 5AVHA 4NFCA 5CWSA 5DMJB 1TELA 3MSPA 5HP5A 1JBJA 2MQGA 3VNIA 5HPMB 4BHUA 6TAAA 2BNQD 1F8MA 1VGEL 1SOQA 4JHWL 3DKHA 1G7MB 1NAMH 1TETL 4W9HC 5C09B 3US1A 3W7OA 3BWSA 4NWUL 1R9FA 3GFYA 1IEBA 3KL3A 5KUMA 4HJFA 4WO4A 3IJIA 4QROA 3TTQA 2W38A 2NLIA 4PJXA 3GDBA 1E6NA 1VGKB 4OUOA 4ES9A 1SMDA 3L8QA 4N20A 3GIVB 4Z0JA 1KJ2H 4ONGL 2Y07L 5JIQA 4TL4A 1KXHA 4BY3A 3DDFA 3LHVA 4Q56A 1GQKA 5D32A 1FWRA 4QIUA 4OTKA 1XO8A 3U4KA 1NTDA 3WXVH 1M4KA 1PKQB 4Q4RA 4QG9A 4XP4H 4JFEE 1F58L 4C6FA 4KWVA 1KFJA 4LLDA 4HHAA 1W0VB 5GS0L 4F1SA 4LAUA 4M5YH 3ZL4L 2VLME 4K3GA 4XC3L 4IPNB 4A2SA 4XVEA 2XZAH 5CBAB 5FOJA 1FP5A 3BVNA 4J2QA 3O6YX 2ABBA 4A2FA 3VUPA 4KXDA 4ELKA 2FBJH 3Q6FA 4JGUA 2X1RA 2XFYA 4EMZA 3RWFB 1AZUA 1G7PA 1MHHA 2XJ7A 1GYVA 3GG1A 2KLTA 4IRSA 3ZJAA 2JCCE 1RA0A 5KSUB 1FL6A 4IF2A 3DX3A 4S1SH 1VLXA 4L4VD 2M1KA 2YRLA 1B6UA 3IU4L 1LK3H 4IDJL 1HTYA 3VFUB 5KBPA 1D9KC 3BH8A 3B40A 2XGIA 3S37X 2NQ9A 4Y90A 5CEWA 4NPYB 1G9EA 1DJNA 2X1SA 4I4WB 4AX6A 3DLQR 1IBDA 1UBPC 1GYAA 2PTWA 2VXVH 3OD3A 3GJFA 2MCMA 1JNNL 3R0DA 4Y2DC 2JCCF 5ACZB 2AABL 2FPVA 5CJOH 3RVTC 3CZLA 1AR1D 5D7KD 2H32B 1OVDA 2R0LH 3VGAC 4WDUA 4CD8A 4D8ZA 1KPRA 4S1QL 3ZN6A 2Y22A 4IRJD 2LLEA 2O9TA 3CN1A 1XPGA 3MANA 1SJMA 1MXSA 4LBUA 1P5UC 4WFHE 1V27A 3P81A 1JWUA 3ZLQC 1DBTA 4UR7A 3RIKA 2MKLC 2GQ9A 1OAXL 1U8CA 2WN2A 3WO4C 2HAZA 5HI3D 4F92B 1PEWA 2CUHA 3MUGA 3BH9B 1NARA 1IWBA 3M0IA 3QNXB 4QLJA 4MDJA 3RTQD 3SE4A 1LYQA 1BCIA 2P7TA 3CFMA 3W1QA 2WLMA 3CLWA 1RERA 4XAKD 1R38A 5BV7C 4KROC 4U5KA 4MNMA 1L3NA 2ZCLH 3BE1L 4JFEA 3VXSD 4AIOA 1OYAA 1MELA 1CD0A 1KPVA 1QNVA 1INQA 2QKSA 4UV4H 2Z27A 3E02A 3JS3A 3OJGA 1FO0A 1FVCB 5AVUB 1F3TA 3QN3A 4FI7A 1KV8A 1UYWL 5IW6B 1ADSA 3CO4A 4HEPA 1BWKA 4NNAA 3N06B 4G8IA 1A65A 4U49A 4AUJA 3IE9A 3V4LA 2ZUUA 4XPTH 3RCNA 2R69A 1HVQA 3OHXB 1R85A 3JTBA 1SOSA 3JT0A 2PF0A 1OC6A 4J2PA 2WOYA 1DFXA 1S2AA 3KBFA 2QR0B 1I9EA 3EYVB 3VXQB 4PGBB 3B56A 1BMWA 3AREB 1DEEA 1OVZA 4P4KC 1M7JA 4XSLA 6TIMA 3S9ZA 2ZUQB 3E74A 4C6JA 1ZXKA 1EP1A 2JIXD 4PQXA 1U8HB 2OM5A 2BJML 4QRFA 3QUMA 4KKBC 4PS8A 5FX3A 5BS0E 3EWZA 1O7DC 2G60H 3V0UA 1C9WA 2WLNA 5H6HA 1T0MB 4ONHA 3KM1A 3FQ1A 4XX1E 1S5VA 3I10A 1CR9L 4GCAA 1LWHA 4JM2A 3KVQA 1MRAA 1EEYB 1J87A 1KBWA 3STLB 5E9DD 1E43A 3H55A 4DP7X 5KS9A 1R86A 4NJGA 1U33A 1V10A 3C12A 4C6KA 2FBOJ 3OKEA 4WJ8A 1ZCRA 4NBZB 5T1LB 2OYLA 5J6HA 1SFLA 1QBML 4TS6A 3P67A 4IFKA 4AY1A 2KI6A 3SN6N 1PX4A 4PTUA 3P3YA 3OMNB 5ALCH 5FYKD 5IB5A 1XSKA 4GLRH 5GGVL 1KFKA 2UY4A 2P8MB 5T5FH 4N9DA 4K0OA 1G94A 3EFOA 5HI3C 2ALWA 5I1CL 3IDXH 1EHXA 4JPVH 4NM4L 5SWZB 3DFTA 4QDMA 4QR6A 1D5ZB 1HGYA 1OFPA 1SZEA 3D69B 3Q6GL 5ISZB 2RACA 4MD0B 4GG8B 3PJLA 4HUVB 4U6HB 3ROLA 3T2LA 2V30A 1R17A 1P53A 4HKPA 1G0DA 2HUEA 3R2GA 2QPEB 4X0NA 5HDQH 1UC6A 5IT2L 1L6ZA 4JHVA 1I7ZB 4LLYB 2Y5EA 3RGVC 1PL9A 4ZTOL 2W92A 4MRBA 2A3CA 3HMCA 3KXFE 1R3KA 1FX6A 4N8UA 3INOA 4PUBH 1JFHA 4ERSH 1HKIA 3IFNL 4UIMA 1BF6A 3D0VA 3E8VA 4JHBA 5GGSY 2FNBA 3UYPA 3CXOA 4FXRA 4LF3A 1T0NB 4ODSL 4UB9A 4E5TA 4AOFA 3L2NA 2PZNA 4NEHB 2Q6WA 5CINH 5ITBH 1NFBA 1WYIA 5G5IA 4G7YH 1PS3A 3SDCD 5LIKX 3AQXA 2GIYA 1SQ2N 2LVCA 4P2QB 4FXGB 4LF1A 4L7ZA 5GGSA 3WLJA 1W2VA 2G3JA 2B1HL 4AYFA 3AITA 2XVKA 3AG4B 2IPKA 5MEPA 2GQAA 4M5PA 4H3DA 1CF8L 2FEJA 3C5SA 4GUPB 1A3RH 1E71M 1PE1A 5T8IA 3CB8A 2DM2A 2LT9A 3PWLB 2E68A 2WBJA 4WW1A 4X9IA 2F5AL 1NC2B 4FI8A 3N4AA 4IKNA 2B4CL 5G2WA 4NRYB 4N24A 2DPEA 1BXNA 1N5AA 3NVQA 3W11C 1MSSA 2PWDA 3W56A 4MADA 2L3BA 2JSFA 4CC1A 2WSKA 3OKOA 5GJMA 1JHLH 4NQCE 3C5ZA 4Z7OF 4GRMA 2QW5A 4JR9L 3GMPB 4YHIB 5C08E 2R2EB 3WYRA 4Z7UB 4UTAL 3AGVA 1GVYA 1HX0A 3AWFA 3PG2A 4LLQA 4KVNL 4WWOA 1HZHL 5HGDA 3MV8B 1SHWA 4DO4A 3K4WA 4B16A 1D5IH 1AI1L 1N0XL 4V1DE 4X4ME 3RWHA 1G7IA 5GRJH 2DSKA 1XWVA 3EADA 3W38A 3HNTL 5PAZA 3CD4A 1JRHI 4Q6IB 4PRHA 1QW8A 3CUIA 1A7QH 5DFTA 4JTRA 5DU7A 5FYJE 3GJEB 2CK0H 2ZF8A 3BN9C 2ZP0T 3FSZA 1PEZA 4UBPC 3FO2B 4UWMA 1UWGL 4UILL 4R96B 3WDIA 1BZEA 5EZIL 1I1WA 5D4QA 2VEFA 4RL3A 1XHHA 2P46B 4LCQA 2DJMA 4KVCH 1P5VB 1TYJA 4XVJH 5F7EH 3B37A 5DZPA 2X7LA 2EDDA 3VD7A 4APXB 5CR1A 3MHUA 5IHZA 1PKNA 3ZM8A 1KXQA 3P0VH 2W91A 2OQLA 3B4NA 4LUTB 3O0KA 3NCJH 1RLWA 4W9CC 5T3ZE 5I1EL 4KGJA 2VM3A 2BNUB 3FDGA 3FJLA 3IAQA 3V95A 3GXFA 3RGTA 4I3RL 1C12B 3HI6L 4QHNA 4AWJC 4BV1A 3SB3A 3GHRA 5EIIB 3L4YA 3NEVA 4IMDA 3VIKA 3JWNC 4RGNB 4P9ML 3P4NA 3GXIA 3CHVA 3CAVA 2NLJB 5EUOA 1QKZH 4US6A 1AZCA 2ALAA 4P5UA 3THMH 4GVIA 3PXJA 2HT4C 2LV4A 4Z3JA 3IETA 2CJUL 4G7VL 2C26A 3BQUA 5CJQL 4UZUA 3WJJC 2EG8A 3OTRA 3X3GH 3AMDA 3O15A 4WKZA 3EEGA 2BOBB 3UY8A 3GDMA 2B8OT 1OSZA 3PQYE 4B7IA 4KFZC 5LNWA 3AACA 4L1TA 2PPEA 5AOMA 1R24A 4FNQA 4MNHA 3B34A 1NF0A 3EMCA 3QC3A 1XF3A 4DESA 1EO7A 4LHUA 2VDIA 3UPCA 4MAYA 1A5MC 4S3CA 2YD1A 4LYQA 1GZJA 4B9CA 2H0EA 4WFEE 1U8NB 2YAFA 3LN3A 2P5EB 2PCPA 5LB1A 3VXUA 1E8YA 4GKLA 2OQJA 1P7TB 3OQEA 4CVZB 3MX0A 4DF2A 4MVBD 2PWUA 4ZQMA 1ACYL 1A80A 4AQ1C 4KWWA 1B6DA 4IJCA 4GRWE 4FFYH 5KSAB 2QF8A 4MKVA 3QQ1A 1IX2A 2WXGA 4XTRC 1GQIA 4KCWA 1HDMB 1WVZA 4M6AA 4OLEA 2VDOL 5F6HJ 4POZC 5CCGE 1R5YA 3II2A 3N34A 4DJED 3GIQA 3KNBA 4EF8A 3FTZA 4GWEA 1OEZW 2YEVB 1M71B 4JDTH 3PAZA 3DI1A 1WDRA 1UZ6F 3OLGA 4GRWB 2BMKA 1GZPB 2EDMA 2I07A 1F8TL 2J6EA 2PP9A 3G9VA 4M7LT 4OIIH 3SSGA 3VE9A 3ZWSA 4M6OH 4N8PA 3IT8D 4GUHA 1DANU 4G9FD 4IIEA 1TFPA 3QUGA 4FZEH 3USBA 3VIJA 5JVLA 3I2CH 4PJ8A 4NZCA 3T8QA 3D3FA 5D7LB 5JOFB 4M3PA 2P5EE 1MCRA 3EUDA 3ARFB 1G4SA 4S3KA 2VQ4A 5FACA 1KENH 2W79A 1OJXA 3MBXL 4X3ZA 1QHPA 2DT2A 2H41A 4S2SA 1WLHA 4GKZB 5IROA 1NY1A 1WBZB 4ZTOH 2YUWA 1A7RL 2NXZB 4K3EL 4FJZA 4A55A 4FJYA 5FM5M 2EXYD 3VKKA 2VC2L 3LEYH 5FF0A 1O60A 1HQRB 1Z3GL 3AS2A 3GTNA 1SNRA 3RO8A 1IBGH 4IU2B 1NDYA 4DZBA 2KZKA 4DJFA 1FH5L 4TVPL 1QA9A 1U3JA 1EPFA 1IBYA 2OL3B 3B9KC 4XG1A 3LPOA 3AYRA 1PG7H 4GD0A 1K8IB 2IAND 3V75A 2CK2A 1T20B 3RWJA 1EBGA 1JNHA 3KPPA 4NQUA 1C8XA 2PDYA 3BVXA 1INDL 4P46A 5EBMB 4Z1BA 5EZJB 4UINH 1D5BB 3HZKB 5LHEA 3UP8A 3BIKB 1PLGH 1SO4A 3BG3A 2VC2B 4TQIA 1SQMA 4Q9CA 3KZPA 1MWAA 2WJFA 4I4WA 4FI6A 1MAKA 2X9XA 1J9QA 4CADA 4AIEA 3A6CL 1N8ZB 4KX8A 5F2IA 4MTMA 4MAUH 2ZG3A 4YSRA 1FCBA 3MNDA 3B0XA 3PP4H 1TPXC 3WIHL 2WQUA 1J12A 3QXAA 1C9DA 1XF1A 4AM0A 5BXSA 2Y7QB 1I7UA 4MMYB 5IGXL 3EJZD 4XT1C 2CA4A 4G8GA 5E5LA 2D2OA 1UWSA 4L8SB 3GNML 5FF3A 3FU0A 2XYCA 2MOGA 3FTSA 1RJZB 3MO7A 3H2OA 4WV1A 4RGNC 3BZEA 4L9XA 4BI5A 3WH7A 3SDXA 3F83A 2NVDA 1XYZA 4F8NA 2ZTKA 3UG4A 2F68X 3GWQA 2Q86B 3RLHA 4IL0A 4Y2DA 4CILA 1SDYA 4YOKA 3S5ZA 4I77L 1S9KC 1Q6CA 2X4OA 3MODL 4NPJA 2C7UB 2VDOB 3TFCA 5C0EA 1SEQH 5DUPH 3FH5A 3T0TA 2Q2EB 4RDWA 2XX0A 1S7WA 2Y6ZA 4LAZA 3AU2A 4XP1H 3GM8A 3BO8B 5MEQB 1TX2A 2I7GA 1GYWA 4PRBB 2C5DC 4PJGF 2IS7A 2NUPB 3QPQD 5H94B 4BA0A 2NXHA 3V4VH 2QNEA 3FLUA 4PB9H 3FU5A 3TEXA 5AAMC 1OQFA 1QFUL 2KDGA 3L95B 3ZPDA 2WXDM 2R23A 3HHRB 1HG3A 2ZBTA 4MIMA 2VJXA 4F9DA 5LGJB 4LBAA 3CBJB 3IGKA 3N25A 4OKVA 1YKWA 2LVEA 3VTMA 1KIQA 2XH0A 4AU0A 1UD6A 1ETZB 1OK0A 1IC0A 3A5VA 4HCGA 5F7MC 1TQWA 3EDJA 1B9ZA 4BDVA 2P76A 1WZ1H 2BX7A 1NKGA 3FRUB 4HK3J 1BWVA 1MFCL 4CMHC 3VWKD 1IU1A 2FDSA 4KMLB 1XLKA 4GOAA 4QDWA 5LUMA 4JO4L 2DEPA 5FGBA 3QUYD 2O56A 3SDAA 2AEIT 1M7PA 4MLRA 3QEGL 4CU6A 4XO7A 1YEKL 3WIJA 1KCBA 4O5LL 2FUQA 3CXHK 2UWEE 2DBLL 4OQTA 4JTQA 3UY7A 3WQ8A 1JTPA 5HDWA 5GISL 3ABKB 1N5YH 5ECGA 3BVUA 4MSSA 4AH2A 5H1WA 1NGXA 2ZKHL 3KXFB 4MDIB 3CAQA 3GU1A 1A6PA 2UZXA 3BD5A 3G5VA 1NU5A 2EPKX 4LSQL 4OM0H 3TZNA 1QRQA 1OGGA 2Z7UA 3HJEA 4HDIB 3M7OA 3V0JA 1VHNA 1VFBA 1HZLA 5EOTB 1IYXA 3TDFA 4DWSB 3MVTA 3ZUCA 1SJHB 4K2SA 3G1FA 1AJ2A 4P61A 4Q7NA 1NGWB 4NBYB 5TDNB 1FDJA 4TQTA 3P93A 4D9PA 1HAUA 4XWOD 4PRIE 2Q8AL 3SQRA 4HUVA 5IVZA 3T2NH 5IEHB 1TSIA 2OR7A 4QYAA 2VXNA 2DVXA 3W23A 2YQ3A 2YD4A 2XVBA 4ONFH 5L88H 1VIZA 3C61A 4F7MA 1UVQB 4HJGA 3QJFB 3WMPA 2W62A 1W31A 4JJOA 4BEIA 4EI5C 4Y1AE 1Q6DA 5JXAH 1FWDC 2MPAH 3EJTA 3VGEA 4R88A 4KQ3H 2VISB 3RLSA 5CJ8A 4GIEA 1D6EA 1DLFH 1ROWA 1EV2E 2Z8SA 4JDYA 4E0CA 2YGYA 2GSJA 3BAIA 4LL1A 3M17B 1W2KT 1Q6EA 4TSCH 1OCBA 1H8OA 1RPKA 2UUDK 2A6IA 3JQOB 3RU8X 3SUWA 2CH8A 2BFVL 1L5GB 3ITCA 3IMUA 4Z2GA 3MOQA 4HCRH 2EZ0C 3GSMA 3PP7A 5IMKB 1C9SA 3MRKB 1LWIA 2J7CA 4YLQT 1QR1A 1A49A 1FWCC 5I8OH 3GO2A 4YLBA 4ERAA 5DQ9B 3HMXA 4F37K 3CT7A 3DYMA 3DBXB 4UFHA 1ILSA 3II3A 3BVWA 3NIFF 1A3LH 3OKDB 4NFDA 2BSSB 2DM7A 3BWZA 4NRXB 5T5FA 2GUOA 1IT9H 1TPWA 4YWSA 5HBFA 4BGDA 1CT8A 2NUWA 2VW7A 4L56A 4Y4FA 4KWUA 2LGNA 3KX6A 1R5IB 2RBLA 3APMA 4K7PL 4XBKA 2FJHA 3TH2T 1S3RA 1H4PA 3BURA 3QW3A 3TEVA 4BGLA 3E9AA 3FA4A 5XIAA 2EH7H 1TEGA 1MWOA 1XF4B 3OBAA 1J10A 4JFED 5LNUA 4X5QA 5BW7A 4XR8C 3BPCA 2VGGA 2QDDA 4ML4A 1E8WA 2LQRA 4NQDA 4B9GA 1CDGA 2V5JA 1A4AA 3KDOA 1OB0A 4KKLC 3P69A 4Y4KA 1G4EA 4NSKB 1CGWA 5C0GA 1ICSA 3K8KA 2MCPL 2AF2A 4G6MH 1KCWA 3BFOA 4NC2B 3TV3L 1PG7X 3GSXA 1T1WB 1H60A 1SZRA 2QV5A 1DWJM 4ZQNA 1V0MA 5E8EA 1TPC1 1AGBA 4FFTA 3ROOB 3CSFA 1QACA 1FE8L 2N1TE 5F1KC 3FHQA 4ZW5A 3MLRL 1UATA 2I17A 3GU9A 1OSYA 3RVTD 2AXFA 3FKUS 5JU6A 1YY8B 1NBZB 2ZRXA 2IXVA 4YXKL 2IPUK 1RUKH 3MLTB 3FUFA 3WMQA 2X9WA 3TN6A 1SF5A 4O17A 2JLPA 3WDQA 1BX2B 2L8AA 1RJLA 2IIJA 1UD4A 2GBTA 4HX1B 1UR2A 1NIFA 2NQZA 3M7SA 2NYKA 3WIIL 3KTCA 5J11C 3TTSA 4KZDH 4GX8A 4U3HA 1YNLL 4R7NB 1YLVA 1PD1A 4NASA 4UTKA 4JO8A 4WUUB 2VFFA 2PFHA 2WD0A 1OKEA 3PWPE 4PYSA 3P3TA 4WKZB 1YUHA 1XLEA 3WKYA 3SO5A 2Y63A 3T3MB 4RNHA 4JDVA 4JPVL 2SODB 1TSRA 5F89A 4D9QD 5C9XA 3Q1SL 5I3JA 4QCFA 4ZODA 3GG0A 4Y8AA 1ZS2A 2HRGA 3FGCB 4IWWA 3P3SA 4P04A 4PMUA 2ITEA 4CEXC 4WFGE 4U33A 2D7OA 1F1GA 1PUDA 1OM9A 3R79A 1HHGB 4I8YA 3DXAD 1A6UL 2OZ4H 1Z2KA 3NCFB 3WF1A 1T2QL 5I5MA 5F1NA 4YSEA 2ATPB 4MNGE 3GSUB 4ZAKA 4XZIA 3LSBA 3U0PA 2OYMA 4DGYL 1K3UA 2KH2B 4ZUTA 1NCBH 2OLAA 3QGKC 4DPRA 3U6WA 1P4CA 4HG4J 1YEKH 2ZD0A 4HJ1A 4B96A 4H6RA 1MLCA 1I31A 1OAJA 3H3PH 4E6MA 1KLFA 3ZZ1A 1QFWI 3AFLA 5HHQA 3SPIA 2PP3A 2VR9A 2NTFB 3L3DA 4ZFGL 2Y69B 3BMWA 3QWNA 2YHGA 5TQ0L 2BP8A 5F1IA 3KW8A 2ZA2A 4ORMA 4DAIA 4F5CE 2Z64C 2EVFA 3WQOA 3LEXB 4UMAA 2WPGA 1VPQA 5GZNA 4ZFCA 4DZ8A 4U3SA 1H41A 3GMMA 1DLFL 2EYSB 2OXHB 2X88A 4PGEA 5IG7A 2NY5L 2QTEA 3D46A 1O95A 5JOPD 3BZGA 2CLZB 2B77A 5TQ2L 1U2HA 3S2AA 1E90A 3V8CA 1WDAA 4WF7A 5FJIA 3PZOA 4A2HA 1J96A 3FX4A 4LL9A 3LRHA 3R8GA 1G84A 2OKOA 5DC4B 2P3EA 4XCNB 5K1JA 3HCVB 4Z3IA 4GY7A 2NNRA 4Z17A 2AAVA 3AQUA 2EDJA 3ORJA 4LIQH 5I6NA 1G1OA 2PP1A 4JTSA 2VLRB 4TRPH 5FYKU 3R58A 5CSUA 2PO6A 5LGHL 3IIXA 2YOAA 3QUML 4PR5B 3MVIA 1EZ2A 1AY1L 2GVYA 3VVWA 2C1PB 1T7LA 4C83B 3G5YB 4NN7C 5L0QC 2HJKB 5I8CA 3CU2A 2FH6A 4FZ8H 4OZGA 4YWGL 5L2KA 4LFYA 1MFDH 3TYDA 4KPHL 4L4JA 2V3FA 3MRMB 4EXQA 1GG0A 3PHOB 4WTWA 1A9BB 4XBGB 2CGZA 1WPCA 1XSIA 3NJLA 4MYPA 1UUNA 3NGBB 4FXLA 4ONOA 2XKUA 3MNZB 4MSWA 1ZLUH 1F1AA 4FA7B 1GGOA 1IIKA 3WTTA 1PKMA 2VDQL 4HYVA 1UZ4A 1IUZA 4PREA 3UTQB 1OY3B 2B5IB 3D3VE 4JDTL 1E3FA 3SBFA 1E9PB 1DVSA 2HYMA 5I76B 4RGNE 3CZUB 2AI0H 3A4XA 3UR7A 4PJIF 5L2JA 2PWGA 5BXFA 4WI2A 4H01A 1EF2A 2ARWA 4IHOA 5XIMA 2G9HA 3T1FA 2CCWA 3GMQA 5LIXX 4O2EA 2VL4A 4PJCE 3U46B 3BQUD 2YZRA 3PTDA 3UGUA 3D2UD 4KQ4H 2D7QA 2DYPB 5IQ9A 3DH7A 4Z5RB 2Y7LA 4FQXA 1Y6NR 1PO9A 4TSAH 4M1DL 4N6FA 5F3FA 4XBPA 4PCYA 4S1RL 1ZANL 2NY5C 2XA8L 4PJGA 1ONQB 1IM9B 4YUEH 3VTAA 4OBSA 1KBGL 3W26A 1MW2A 1OYCA 2VX5A 3V5OA 1EF3A 5DRNB 3FDWA 3B7TA 5FPIA 3TAOA 4IBWA 3LCYA 5E2TH 2UXGA 4NENB 2GJXB 4E9XA 1O7SA 4E3TA 2K0RA 2JJVA 3VFTA 5DHMC 4Q4PA 3GK0A 1JULA 1BWLA 1XMWA 4J8RB 4NNXA 2QQLL 1ZCCA 2QQKH 1TWWA 3SKOB 4Z7AA 5D8WA 4WV1C 3G5XB 2DQUH 3MV8E 3O45A 4OTXH 2BY0A 2VERN 4G1MA 5DHYB 4AMXA 4EAEA 1E3ZA 2B7OA 3O6FB 1DQML 4AVOA 1KELH 1FE8H 1BGXL 3K5XA 4R84A 4M1BA 2CWXA 3ETBJ 3FQWA 2HKAA 1FWHC 2CHDA 3DOIA 2IALA 2NY3C 4JVUA 4Y4HB 3PDDA 3C8KB 4JN6A 3QCUL 1S7SB 2V3EA 3QRGL 3QUYB 2WCPA 1ICTA 1HEZA 1GJWA 3POCA 4PBVC 4ZCWA 1J8SA 5JXQA 4JHAL 1EXBA 1U1HA 4CD4A 1ET5A 2K7PA 2YEZB 4LJ3A 4UTJA 4WGHA 3CFEB 1MOEA 3EDEA 1RK0A 4RRPA 1TYGA 2PGFA 3IGSA 3W7QA 4AQ8C 4LC8A 1NAML 4P2QE 3ARDD 1D7BA 2XSAA 3F7JA 2QVHA 4C6BA 1U8PA 2PB1A 1NDZA 3H2EA 3KRBA 5DR5H 4R7JA 3FZUD 3CMJA 1NBVL 4ODTL 4DN3H 4NRZB 1GOFA 1OHZA 4JRFA 4DJMA 4W87A 5D96C 2HRPH 4GP4B 4PJAB 2HVMA 1CD1B 3GK8L 3WIHA 3WTVA 4JRXD 4HP5A 2JVUA 2Z1VA 4PJ5E 4ALDA 3DMMD 4BF7A 2D7TH 3SDDC 5H4ZA 4K6AA 1QSFD 2A4EA 1CDCA 5GRUL 1W9BM 4TUKH 4ISVB 2QT3A 1XR8B 2QUVA 2IANA 3FEQA 2A73B 5EN2A 1D6VL 2ESVA 4K3EH 3EWCA 3Q8BA 5C07E 4L9ZA 3VWKA 1QWHA 4XN5A 3UOAB 4ICNA 3JVGA 4G1EB 3H53A 4Z1PA 2ESVE 3FK3A 4URKA 2QFRA 5CSZB 4YE4H 5CBJA 4YGVB 3SDAD 2Z4GA 3DFNA 4JFOA 1XLCA 5F0MB 1KTLA 2VRQA 4GO6B 1K9FA 2R1MA 4YDZA 2YYTA 4C6IA 3MXWH 1H0GA 4KEUA 1LMIA 1K9DA 3GSOB 3PWGA 3ENEA 3QNFA 4JTCA 3NABH 1TZGL 4GUJA 4RA3A 4KQ0A 2J71A 2YKLH 3EJZC 4FHAA 4ABWA 3HN3A 1WZLA 3DETD 4GAJH 1H11A 4YDNA 4UDTA 5KVDE 1SYSA 1ML0A 1NPUA 3CUPB 1TE6A 1TTJA 5D02A 2A6IB 3GH7A 3KOYA 4LSUL 1MCOL 1ZDSA 4H8WL 1BIHA 2ALDA 1OGAB 2A4ZA 1I8UA 2Y3AA 4UOW0 4QDGA 4IEFA 3HZMA 4L3ED 2J25A 1R3JA 1DLHB 4XH2A 3ULUC 5IWLA 1GVFA 4AHPA 5JO5B 1FN4B 4HWNA 3MLYH 4NIRA 5KTEH 4BCYA 1ADQH 3CL8A 4F7TB 1OGTA 1ZT4B 2AABH 4PJFF 1AS8A 4X6EB 4RMBA 4AZBA 4GSRA 4YPGA 1GMEA 3X3FL 4PN2A 4P48A 3Q6GH 5T1DH 4KOBA 3R4DA 5F96H 4CCDA 3P4MA 5CSGA 8FABB 5E08H 1KULA 1PLAA 4WFFD 2NZ9D 3U7YL 5DDHB 3W1ZA 4NQSB 2ISSA 4M62L 4OZ4A 2VABA 4CBZA 1QOXA 3K81A 3P11H 4RZKA 3IS0X 3RZWA 3LXAA 1R3YA 3CBWA 1TQVA 4GVHA 4ODBD 4R9OA 1WD8A 1QNSA 3QWQB 4AXNA 2GUBA 4JJ5B 3MV8A 4PJFE 1W72H 1XQ4A 2F54B 1Y0LB 4BXVA 4TSAL 1S2VA 4QJ1A 1BYOA 4YMZA 1NPJA 2AJXH 5F21B 2G97A 1KRCC 1JGVH 3IGUA 4EN3C 5I74B 2VH5H 5I19H 2YS4A 3GO1L 1AW1A 2PDIA 1V8HA 4QHMB 5SX5H 3S3DB 1W3NA 3GMLB 3LKNB 4AT6B 1JF1B 1JR1A 3SI9A 3UWYA 1WDWA 2YZ5A 4J4KA 2EXWC 4N22A 3QQ9D 5K59E 4AHOA 1YEIH 3WQ6A 3AZUA 4DK6A 4JTEA 2WZPD 4R96A 2AL1A 4A6YA 3LEVH 3UFIA 1NDGB 1EDQA 2HXAA 5DO8A 4BFIA 2JV6A 4Y7OC 1JS4A 4Z1YA 2HJLB 3SPCA 2ZJSH 2KUTA 1VPOH 3H3BC 1VCAA 4NUMA 3MS8A 1Z8AA 4OE7A 4N6RB 5IK3B 3STEA 5D38A 2LTQB 4K7PX 5IHZB 2PYED 5FUCC 3H2WA 3VNLA 5A6BA 3AO0A 2IEPA 1OOAA 3V10A 2WZTA 3W2KA 3Q2DA 4GG9A 3MXVH 4JZOB 2VDRL 3RIAK 2BGNE 3M0KA 4BH7A 4CD6A 4GI4A 3QEQA 3T0DA 1EBPA 3H9SE 3LKPB 4QRQA 1EA0A 1EEUA 4FA8A 3V0IA 1CFSB 1YYLL 3WK2A 4R0LB 3GJFB 5CO1A 1XGTA 2IFFL 4YZFE 3PWNA 5EO9A 5CD5C 3D3VA 4PMEA 3F58L 4BCXA 1TEYA 1Q6OA 4IX2A 4UAOC 4BFEA 2WKJA 3VI4B 2DQUL 1EGVA 1F73A 2NWRA 4RWYH 5C0FB 2K6ZA 2VXUL 3CSPA 4X98A 3QJSB 4JREC 3I6SA 2NUTA 1UD8A 3SGDI 4M02A 3T77B 1WGVA 5I18L 3G04B 5FECB 3B97A 1RIUH 4JDVB 3DIVA 3UXDA 1DVZA 3DJTA 3MUGB 1IEVA 3HQPA 1FCQA 2H3KA 4KUZH 1VGKA 1WA1X 3DIPA 5A1AA 5IESL 1REIA 1XF3B 3N15A 2PO6C 2J13A 4D1IA 2W81C 5A6AA 4UT9L 1JFQL 4WWNA 1BQHA 2DQWA 3GK8H 2DQGL 3SPVB 4K7VA 5LIYX 1U8NA 2CBUA 2DZSA 1KGUA 3MBWB 4TVUA 1MEIA 1WYJA 3ZXAC 1IC7L 1R3TA 2OQHA 1FJ1A 3T0WA 1DPMA 3NG3A 4GISA 1JCLA 1R3HA 3NIGE 3NL6A 5LXGL 2RQEA 2ZXQA 4CMHB 4S23A 3ZW3A 1YEDA 1LF1A 3H24A 3FCSB 4KRPD 2I5GA 4UM9A 3JWOL 1MLCB 4FFZH 3WFCH 4AEHL 4H8NA 1PJ9A 3VIIA 3IJEA 1JPDX 1X9QA 4F91B 1Y7VA 1VB9A 2UY6A 4FABL 5FLVA 4WRLA 2PYEA 1SXBA 1W9PA 3NR0A 3CQKA 1I0BA 5HANA 1EO8L 1JNLL 2K8QA 2CGRH 3WIIH 3WF4A 1N64H 3OXRA 3CN4A 4Y5VA 3GIYA 1F6FB 2EC8A 2J44A 3EF4A 1AD4A 2V8ZA 4LEXH 1MCQA 5ABAA 3OJVC 1HHJA 3GEFA 3PL6D 5FUOL 3PWUB 4NYUA 2OXHA 5C2UB 4PMOA 1LRTA 3WLRA 2BSBA 3OL2A 1KCVL 4X4XB 2VDPL 1UR1A 1EEYA 4N87A 3SD2A 4CGUB 1DSYA 3VXUD 1XIDA 4P4KA 4Y5YA 1KKRA 3VE0A 1XCQB 1CZ1A 4BCEA 4L18A 3W74A 1KT2A 2X5PA 5BJTA 4X7SL 2DDXA 3QDGD 2HPIA 4HUKB 3LRGA 4IRSC 2IQAB 4O58L 4KTGA 1FZJA 1WBZA 4O1BA 3W1MA 4BWTA 1SLUA 1SM9A 5DMNA 4LIQE 1FAKT 2HX7A 1KPRB 2WYTA 4PRIB 2B9BA 5IM7A 2QUMA 3NCOA 2WBGA 3W53A 3TONA 4TMCA 4OGYH 1AL7A 2NY2D 4M6PA 5DD5L 2FPYA 3EOAA 2E9IA 3QIUC 5FHAH 1A50A 4OOZA 2GK2A 4EF9A 2IQ9H 1FDZA 1BLNA 3P02A 1UUMA 4JCMA 3AM8C 4FP8H 4NKQB 4U2ZA 3U30B 1DVUA 2YPVA 3QIWB 3FFSA 3V5HB 1RK5A 4OF7A 1PWMA 2GW5A 4N90D 4Z7VF 4QEEA 5GRXG 2V6AA 1SUXA 4Z7QE 4O4VA 1B31A 2X16A