4UQDA

X-ray structure of glucuronoxylan-xylanohydrolase (xyn30a) from clostridium thermocellum at 1.25 a resolution
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
390
structure length
390
Chain Sequence
HMASATINLSAEKQVIRGFGGMNHPVWISDLTPQQRDTAFGNGEGQLGFTILRIHVDENRNNWSKEVATARRAIELGAIVSASPWNPPSNMVETFTRNGVPNQKRLRYDKYGDYVQHLNDFVAYMKSNGVDLYAISVQNEPDYAHEWTWWTPQEMLRFMRDYAGQINCRVMAPESFQYLKNMSDPILNDPQALANLDILGAHFYGTTVNNMPYPLFEQKGAGKELWMTEVYVPNSDSNSADRWPEALEVAHNMHNALVEGNFQAYVWWYIRRSYGPMKEDGTISKRGYMMAHYSKFVRPGYVRVDATKNPTYNVYLSACKNKKDNSVVAVVINKSTEAKTINISVPGTSIRKWERYVTTGSKNLRKESDINASGTTFQVTLEPQSVTTFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords CARBOHYDRATE BINDING FAMILY 6
publication title Conservation in the Mechanism of Glucuronoxylan Hydrolysis Revealed by the Structure of Glucuronoxylan Xylano-Hydrolase (Ctxyn30A) from Clostridium Thermocellum
pubmed doi rcsb
source organism Ruminiclostridium thermocellum
total genus 138
structure length 390
sequence length 390
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uqdA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uqdA02
1WPCA 1W3LA 3A5VA 1CGYA 3SCQA 3MI6A 1VJZA 1BF2A 2D2OA 1NOWA 2YBUA 3WY4A 2NW0A 5A94A 4UCFA 2O9RA 1KBBA 2HISA 4AIUA 4ATLA 2ZXQA 2J7HA 3OZOA 3OGVA 1E6NA 2Y4SA 4PYSA 3AS0A 5EFDA 1Q4NX 3HG3A 3WDIA 2WCGA 1WDRA 4E2OA 1FFQA 3N17A 1ISYA 2EPKX 5HBFA 4WKAA 1TVNA 2OW6A 3PZMA 4PMVA 1R46A 4UOZA 5A95A 1JYVA 3EJSA 4TX8A 3SURA 1BVNP 2IXUA 3N1AA 2YFOA 3TTSA 2X1IA 3ZR6A 5A6BA 2WMGA 3NSNA 3ZJ8A 5FIPA 3S6TA 1PIFA 3WKZA 1HF6A 2GJRA 1CECA 7A3HA 5IHSA 4EANA 4H2CA 5A8QA 1KB3A 4CGTA 3VPLA 1EA9C 1CXFA 2QPSA 1FOBA 4OZOA 3DX0A 3PZUA 1OB0A 2VR4A 2WCSA 3OG2A 3TV8A 2ZXDA 1EDQA 2XVLA 3WMBA 2IGTA 4FK9A 1UD5A 4QCEA 1NP2A 4UZSA 4Z2JA 2CNCA 2F1AA 1E3ZA 3WL0A 4MNLA 4AD3A 1IT0A 1JNDA 1H1NA 1O7AA 1WCGA 5CXPA 1UA3A 4ACZA 1HKMA 1KQYA 2OSYA 1XD1A 4BQ5A 3WDHA 3A4AA 4N0RA 3OLGA 1GQIA 8CGTA 1VJSA 3UETA 1JI2A 3WQ5A 2TAAA 4RE4A 2CXGA 1BSIA 1UHVA 5E6ZA 1QHZA 3S5YA 4LQ1A 1E55A 4LPCA 2WBKA 2OW7A 5M3WA 1H2JA 1F4AA 3A6OA 3UR7A 3RM9A 2XWEA 3VD4A 3VNYA 5HXMA 1MXGA 1R47A 1GVIA 3DX2A 1R7OA 4M1RA 2AMGA 3ZSTA 2GSJA 2UY3A 3ARRA 4QAWA 4U2YA 1OINA 2W67A 2Z1KA 2CKSA 1R75A 2X2JA 3TA9A 4GKLA 5D9PA 1MW2A 5A8MA 3WUFA 1EHAA 1WDSA 3PTMA 3BAKA 3PZNA 4TTUA 3AHYA 5A6KA 3AJ7A 2CBIA 4F66A 2Q8XA 2D0FA 1P6WA 4WF7A 2ZUNA 1OGBA 1UWSA 1DEDA 3AIRA 4W85A 1WB0A 1GOIA 1GNXA 2DH2A 3AISA 2WK2A 2E9MA 1W9VA 3POCA 1QNQA 2WMJA 1GVYA 4GZIA 3L4ZA 4UFHA 4PTMA 3U7BA 3WF1A 3CUIA 3GH4A 2YL8A 1M53A 2DGAA 4F9JA 2CITA 2EO7A 5A2BA 2OSXA 5BXRA 1E6RA 1GQLA 3O9NA 3OA5A 1VFFA 4D6FA 2Y8VA 2HVMA 4CD6A 1W1TA 2WMHA 1NWUA 3ECQA 3VIJA 1U33A 1C8QA 2YA2A 1GOQA 3U57A 2F1BA 3M6DA 1OGSA 1LG1A 3WNLA 1WP6A 2EEXA 2QMKA 2GJXB 3BUDA 3ARTA 2YIHA 1J12A 1KQZA 1J0ZA 1UWTA 2ZUWA 3L4VA 1V3IA 1AQ0A 4HA1A 2DIEA 1XH0A 4GI6A 1OWQA 4CU7A 2FGZA 4D6IA 2YL5A 1UKOA 4W89A 1NOFA 1OD8A 5JBFA 1UKPA 3BAJA 4PN2A 5CGMA 3OLIA 1LQ0A 1GCYA 1MW0A 3GDBA 3N15A 3VX0A 2FGLA 5IHRA 1J0IA 1WAWA 4MB5A 4CKQA 3D4ZA 1WDQA 3L4XA 2PWGA 2WHKA 2VR5A 3D50A 3TOPA 4JKLA 4CN4A 4CU8A 1M04A 1WDPA 4M24A 4H41A 2VZVA 5E0CA 1BVZA 1WE5A 3AZRA 5A6AA 3VIIA 4PMYA 2JALA 4MNJA 1PPIA 4QDMA 1W3KA 1QWUA 2DSKA 3VU2A 5I5RA 4H8UA 2XYLA 1UD8A 2DT3A 3MMWA 2DT0A 1CGVA 2PWDA 4FNQA 4UNIA 1JZ8A 4AEFA 1HVXA 2XWDA 4EK7A 3DDGA 3BAWA 2PWEA 1M01A 4HZ6A 5LA2A 1C92A 2FH8A 4HPGA 2BHYA 1B2YA 2EADA 5IFPA 4WLCA 1V3MA 1NP0A 4W87A 1VFOA 3OGRA 3KLKA 1G5AA 5I6SA 2UY5A 3WIJA 5DEZA 3VDAA 1XH2A 1XC6A 3CBWA 1JDCA 4F8XA 1VBUA 3AIWA 5BXPA 4AZ6A 3SIMA 1MXDA 3MUAA 4UFMA 1H41A 2GK1B 1CGWA 3EDFA 3KWXA 3SUVA 6TAAA 1VFMA 3VM5A 3K4DA 5CSYA 1JXJA 1FH7A 4UOQA 1PZ3A 1TZ7A 2XM1A 2VVNA 2J78A 3WD1A 3RMEA 1UR9A 1OT1A 1HL8A 4M82A 5FOOA 5D9MA 1L0PA 5LYRA 3AMLA 2UY4A 2VL4A 4GXPA 3VDHA 3LRKA 3SUWA 5D8ZA 3A21A 1BGGA 3W6MA 3WMSA 1UKSA 2J8GA 4J3UA 4W93A 1I1WA 2YA0A 4OUEA 4AD5A 3K8MA 2XVPA 1RP8A 1E73M 3ARSA 3IJ7A 1ZB5A 2XN2A 4W7WA 3VIGA 2NSXA 3VUPA 1V08A 4BQ4A 2YLAA 2J74A 2CBVA 3B9DA 2BS9A 3N18A 4UZUA 1ZL1A 1HKIA 2O92A 3BVUA 3G6LA 4U3CA 3DHUA 3L4YA 1EQCA 3NJ3A 4AZ7A 2C8NA 3BSGA 2Y8KA 1UKQA 4J3WA 4AZGA 3VDCA 1YQ2A 2IUZA 3W53A 5E9AA 1TMQA 4AWEA 1OIFA 1GQKA 2WLYA 3LPFA 3CUHA 1SYTA 3H55A 4HPHA 1UD2A 4WSJA 2UY2A 3NDYA 4CN1A 1V6UA 4AD0A 1GOWA 2GDUA 1R87A 5AYBA 4D1IA 3EDDA 4W88A 3LPGA 5D4YA 4W86A 3BXWA 3PZ9A 2CYGA 3PZVA 2W5FA 4OJYA 2FHBA 1HT6A 3SCOA 1H0GA 4QLJA 1SMAA 4NXKA 2XHYA 3A22A 4W7UA 1G9HA 2WNWA 2E3ZA 1X1NA 3M07A 4P8UA 1GQJA 5A69A 2XTKA 1WZLA 4KH2A 1NM9A 1DWIM 1W3JA 1ZJAA 1W9XA 3BUBA 1K9EA 4PMXA 1TUXA 3FY1A 3VINA 3VIMA 3HZ3A 2VZOA 4QLKA 5A1AA 1BFNA 4GQRA 1UH3A 1GJUA 5BYWA 5EFFA 3K8KA 1DWAM 4YPJA 1Y7VA 3VMPA 4W8BA 4HA4A 2W4XA 1KGXA 2D20A 1TFVA 1OGGA 4P7NA 3RILA 2XIIA 4M8UA 2WC4A 1J10A 3MSDA 3W25A 5DT5A 3ZSSA 3TTOA 4DUWA 4FNRA 3RM8A 4AYSA 2VC9A 2QF8A 1VEOA 3WH9A 1VEMA 1JZ4A 1ISWA 3ZT6A 2EPLX 1JDDA 2F7OA 1W1PA 4QP0A 2DSVA 3NCOA 1VAHA 4KGJA 1KCLA 1E4IA 1EIBA 3MMDA 1QX1A 1KXVA 2EPOA 4J27A 3CHEA 1EH9A 1E56A 4H8HA 1ODUA 1V6XA 1QHOA 2FDMA 2PC8A 2VCCA 3OBAA 5TD4A 2O9TA 3CMJA 3AIVA 4KMQA 3ALFA 2V3DA 1E70M 4Q22A 3OLDA 1TQSA 1PX8A 4HZ8A 3J7HA 3L4UA 1KGWA 1R33A 3CIVA 5M5DA 1WO2A 1Q6DA 5HNNA 4HOWA 3SUSA 2XN0A 5E6YA 2XVNA 3PTKA 1TQTA 1NQ6A 4HTYA 5A3HA 2V3EA 3K1DA 1FHLA 4AISA 1TA3B 2EACA 3WD3A 1JAEA 3QR3A 1PJ9A 1DWFM 4A3YA 3LXAA 5M17A 1JNEA 5C71A 2J4GA 3IGUA 2BHUA 4Z2HA 4PMOA 3AZSA 4HMEA 1DP0A 2ZWZA 1LJYA 1QW8A 3A23A 2YL9A 3W82A 4D6JA 4PEEA 2ZOXA 1KTBA 1J11A 2VUYA 3CZNA 3ALGA 3OLEA 1W9PA 3VIPA 2Z1SA 2D3LA 4BQ2A 1B3XA 4FLSA 3AHTA 4FNSA 4JZ5A 3BLPX 3N9KA 2DSZA 3QHOA 5JIPA 1HJVA 2YJQA 2XM2A 1AQHA 4AEEA 3VIKA 2WSKA 5ABEA 3D51A 4MADA 2WM0A 3IANA 2J62A 3WNOA 3GH5A 4AD2A 2ZX9A 3CLWA 4MB1A 1NWSA 4JFSA 1VF8A 2EBNA 1KFWA 3AXIA 5ECUA 2W91A 2WB5A 5DF0A 4AZHA 2WCAA 1SZNA 1MQRA 1C90A 1NARA 1WZMA 3AYRA 1W1VA 3ARQA 3RM4A 4JHZA 3AICA 3GYCA 1LL7A 3LXBA 1QNRA 2EXOA 2F8QA 4UFIA 3WEMA 9CGTA 1B90A 1V6WA 4WK9A 1UKTA 4FLRA 1NWRA 3MUZ1 1GONA 1ZBCA 1QNPA 3T0BA 1W2PA 1D3CA 3AMKA 2NT0A 2WHJA 3FXYA 5A8OA 4GZJA 1ZBVA 3AXXA 4DM1A 3CGTA 4PRWA 3ARZA 3KL5A 3T2QA 3UEQA 4B16A 1A3HA 2G3JA 4WKFA 2DEPA 3CO4A 2WMKA 1WNOA 1UASA 2VX6A 5IFTA 2MANA 4D6EA 2YDRA 3AIQA 5CQ1A 1BPLB 3WQ8A 4EAMA 2WVVA 4MTVA 2X0YA 1E15A 3ARUA 2JF7A 1DWGM 3SUUA 3JUGA 4HU8A 1G01A 1VENA 4MDOA 4DM2A 1ITCA 4F79A 4YN5A 2ZICA 3I3EA 3BC9A 3SCTA 4U31A 4GI9A 2F18A 4CVWA 3EYPA 1ECEA 3VGFA 2JEPA 3GNPA 4TXEA 4CD4A 3GH7A 2CERA 3AZTA 2BY1A 5KEZA 1B9ZA 5ABFA 4ACZB 5I2UA 1CYGA 1TQWA 1FH8A 4AZCB 5E0FA 1KGUA 4PBGA 2F2HA 1RD6A 2X09A 4Z2KA 3T0AA 2ZWYA 3VNZA 4FF5A 2J8FA 5BCAA 2JEQA 4XB3A 3PZQA 3NYDA 2EQDA 1R85A 4OOUA 4MAVA 3AQUA 3W28A 3CHFA 2PBOA 3DC0A 3CZJA 3VOCA 2BVYA 1XYZA 4TOQA 5CJ5A 4N42A 3MO4A 1YHTA 2BY0A 4AD1A 5GNZA 1CLXA 3UG5A 4CN6A 3RJXA 4H8VA 1JFHA 4NZCA 1ZBKA 2PWFA 1QWNA 4TUFA 2WVTA 1H5VA 1KXQA 3AS1A 4R27A 4CD8A 1HWWA 2FYVA 1HJWA 3VGEA 1JYNA 4JFTA 1BTCA 3RCNA 1CZ1A 4PMZA 5A8NA 4HZ7A 3BAYA 1ZJBA 4L4OA 2JIEA 4DWSB 3IJ9A 1PAMA 1HVQA 1SFSA 3NDZA 4IISA 2J25A 4JAWA 1CWYA 1GOMA 4D72A 2XIBA 1ISVA 3FN9A 1ZU8A 3WNPA 3FNDA 2CCRA 3PZTA 1KR1A 3W24A 1MFVA 1K6AA 2VRKA 1BG9A 3MKKA 4OOZA 2VMFA 2WANA 3BCFA 3VKKA 1EOKA 2WWCA 2J7GA 4M29A 2PWHA 1BYCA 4PSRA 3A4XA 2ZUTA 1QI4A 2YL6A 3UESA 3F4VA 1L8NA 4FMVA 1IZJA 2PB1A 2VX4A 1E72M 3PHAA 4ZXOA 2GJXA 2WVSA 4UFKA 4B3KA 3UERA 1JZ3A 2D23A 3N13A 3TTQA 3ZR5A 4AXNA 1CDGA 3T09A 4U5KA 2BVDA 3WDPP 4B15A 5HOSA 3K8LA 4A3HA 1XYFA 2DT1A 2FE0A 3MV01 3AS2A 1C8XA 2XPKA 2WHLA 3AYSA 4HP5A 2CHOA 1ZS2A 1MWOA 2X05A 2BY2A 1TVPA 3DECA 3VVGA 4KGLA 4XUYA 4BQ3A 4QCFA 3AIUA 5CPSA 4AW7A 3CMGA 2DT2A 1C8YA 1HJXA 3EMQA 5FKYA 5C8BB 1UUQA 3UG3A 3BVWA 1JIBA 3DX3A 1V0KA 1CTNA 4XZBA 3THDA 3CPUA 1E3XA 3ARXA 4TTGA 4AY1A 3F5LA 3HN3A 2WAGA 1XH1A 3VMOA 2VRJA 3BMVA 1OSEA 3GXTA 3FAWA 3EBVA 2VNCA 2ALWA 1D2KA 5BWFA 1DHKA 1ISZA 4AZBA 3DDFA 4UQ9A 1GHSA 1CGXA 2EJ1A 2OYLA 4MNKA 2E40A 1UG6A 1WKYA 3VMNA 6A3HA 1UZ4A 2JFEX 3MV11 4C7DA 5KZ6A 3BLKA 4CUCA 2W66A 4HMDA 4TVUA 1J01A 3OIHA 1JL8A 3K46A 2PBGA 4DUVA 3WQVA 5CSUA 2OYKA 4HOZA 2BXYA 2V3GA 1V0LA 4P7LA 1IV8A 1CLVA 2YOCA 1QVBA 4LYPA 3CUFA 1NOUA 3AHVA 3AHZA 1V02E 3DYMA 1UWIA 1KWKA 1MW1A 3CV5A 3NIYA 1MW3A 2WMIA 4UR9A 4BCEA 3SCUA 1E6QM 1J0KA 2A3EA 4NZFA 2WPGA 3WQ6A 1H49A 4UQAA 2JE8A 3GNOA 2CKRA 3ZMRA 3WH6A 1V02A 1PX3A 3APGA 4LXFA 3WN6A 3VO0A 1J0HA 1MVYA 2YFNA 3WL1A 1W2VA 4UQBA 4IPLA 1XSJA 1EDTA 5HPOA 2ZUVA 1QW9A 1NWTA 3PZOA 2D1ZA 1I75A 3T08A 2VQUA 2A3CA 3IK2A 4C7FA 1E43A 3AIEA 3DHPA 3SCWA 2WMFA 1US3A 5JUVA 2ZX6A 2VRQA 2X2IA 2WYSA 2C0HA 3WDJA 3SEPA 3B9EA 1UWRA 3LMYA 3TONA 4A4AA 4AMCA 2ZUSA 2J7BA 1XV8A 1ODZA 3BH4A 1B3WA 2G4FA 1F4HA 3TTYA 3CHDA 4Y7EA 1HNYA 3WD2A 5AY7A 1DTUA 1HX0A 5F7UA 1FP8A 1JFXA 4J3XA 1V6YA 2DIJA 1E1EA 3W29A 1C91A 6CGTA 2YDSA 1TE1A 4LGXA 3H53A 2A3HA 5GPRA 4CD7A 5LA0A 4MB4A 3VSTA 4U3AA 3WBAA 3VD5A 3POHA 3VSUA 3WF0A 2VJXA 3MSGA 3KL3A 1JZ6A 1HP4A 1T0OA 5I3DA 2ZXAA 4WJXA 3CZKA 3NSMA 2WZIA 2FH6A 3DX1A 3LXCA 2CHNA 4E4PA 3ZO9A 2BXZA 1HJSA 4ACYA 4RE2A 1VFUA 4PMUA 1GHRA 2VT0A 4PSPA 3UCQA 1FP9A 4UFLA 2EAEA 1CXKA 3BUQA 1LG2A 1ISXA 3EDEA 2C7FA 3WELA 3GXDA 1EDGA 2PI6A 4GIAA 2XG9A 1JGIA 2O9PA 2ZXBA 4JFVA 5I0DA 2NT1A 3VILA 3EJQA 2YKKA 2WKGA 3BVXA 4J3VA 4M56A 4E8CA 4FNUA 2WW5A 3CUGA 1KCKA 3QHMA 1C7SA 4IUGA 1ZBWA 2J47A 3VX1A 1C3FA 4UQCA 1JZ7A 2BVTA 3EMZA 3W81A 2RGLA 2D22A 1LWHA 1UR2A 1M7XA 1HJUA 1G1YA 1JF5A 3ZQ9A 4NRSA 1HN1A 4W8LA 1W1YA 5A2CA 1E4LA 1E6PA 3GXIA 4GZEA 3E1F1 3WY2A 1C7TA 5BRPA 1E4NA 3AS3A 1J9YA 3CTTA 4AMXA 2VX7A 3O2LA 2VZUA 3L4WA 1GOKA 2VX5A 3AHXA 3PZIA 1OIMA 2E9BA 2QPUA 1R86A 1WZKA 2RGMA 3CHCA 1V3LA 4GO8A 2X2YA 2YBTA 3CH9A 3GBEA 2GDVA 3W0KA 1GORA 4LYRA 4JHOA 4JCLA 3EMCA 1V3HA 2CETA 4Z2LA 1B3YA 1GOOA 4UOJA 2F7PA 3FW6A 1LL6A 4U2ZA 4DO4A 1TA3A 5DO8A 3A3HA 4YHEA 4CD5A 2QLYA 4RE3A 1QPKA 3W38A 4Q7NA 1W9BM 5FD0A 3ZM8A 4JFUA 2XGBA 1TQUA 4PMQA 3CC1A 1UWUA 1KXTA 5CPQA 2J7CA 3GXFA 3ARWA 3VD9A 1DWJM 4S3KA 3WY1A 3BMWA 1O7DC 1B3VA 3SUTA 5A6BD 4QFUA 2YA1A 2J75A 4L4PA 4KWUA 4PTXA 1EOMA 3VGDA 2AAAA 2ESCA 2J7DA 5I77A 4ZXLA 4K68A 2OYMA 4AC1X 3WF3A 2ZX5A 3UG4A 5EB8A 2OWXA 1VEPA 3H54A 2VQTA 4U5IA 3EJPA 3AFBA 3ARVA 1US2A 2XVKA 2JIWA 4P7OA 1V0NA 4W5ZA 4P8VA 1B31A 2WHMA 1V6VA 2EPMX 3EDKA 3LX9A 1JF6A 1BGAA 3N04A 4FNTA 5GNYA 4XV0A 5CLWA 3U5YA 3S2CA 2DQXA 4CCEA 4BZYA 1E0VA 1JI1A 1NH6A 3U5UA 3VTRA 2Y24A 4HMCA 2G41A 1HKJA 4GPNA 1RH9A 1HJQA 1SR0A 1UR4A 3B8SA 2WXDM 1EHNA 1XHGA 4JKKA 3VM7A 1Q6CA 3WFLA 4B9YA 1GW1A 4D71A 4AIOA 4DO6A 3WF4A 5JBDA 4OBSA 4W7VA 1U30A 4ZENA 3RJYA 4CU6A 3DYOA 1UQZA 3T0DA 4X0NA 2CPUA 3BGAA 4LX4A 4TX6A 4P8WA 2GJPA 3BSHA 3W4RA 1MQQA 1E40A 1XRVA 1B30A 5LA1A 3M46A 5CG0A 1CXLA 1UH4A 4XZWA 4XX6A 3EJTA 1QBBA 4RL3A 1KTCA 5DMYA 3A4WA 2G3NA 1RPKA 3ZIZA 3W37A 4D6GA 5A8PA 1BAGA 2D3NA 2VURA 2B31A 2WVVB 2OSWA 1CXHA 3I3DA 4DWSD 3WEZA 1UH2A 1JYXA 1H4PA 1QI0A 2JF6A 2W92A 3KZSA 2WBGA 2G3MA 4MPKA 3WNNA 4BF7A 4J3SA 1E1FA 1HIZA 2ZUUA 3RDKA 1E71M 4V28A 5CGTA 5HDRA 3D5HA 4Z2GA 2XSAA 3GTNA 5A6LA 2IXVA 3GZAA 1UOKA 4UQEA 3IJ8A 4AZCA 3ARPA 2F61A 4AIEA 3GNRA 5ABFB 3ZJ6A 3QGVA 1BHGA 3CZLA 1MQPA 4PMRA 2Y5EA 2ZE0A 4HOXA 1BYBA 4NI3A 4KRTA 1E5NA 1QI3A 4NXSA 1EGZA 2BFGA 4HA3A 4DUXA 3BVTA 5E70A 2DPEA 4IM4A 4EKJA 3VDBA 3MU7A 1C93A 1TG7A 3AROA 4TVDA 2O9OA 3RPMA 2CIPA 4URIA 2V5DA 3CZEA 4ZFMA 5A6SA 5GQBA 1CPUA 1BLIA 2FHFA 2J7EA 4FLOA 2D73A 4WIWA 3LRMA 1XGZA 2WC7A 3WF2A 1E6XM 3VGBA 7CGTA 5I78A 1FFRA 4V27A 3SCSA 4DWSA 3D52A 2W62A 2V5CA 3GXPA 1IZKA 4R5EA 2VO5A 3WEOA 4PCTA 1BYDA 3VD3A 4C7GA 2ZUMA 5HPCA 1W9DM 1H09A 5FL1A 4BA0A 1GUVA 4LYQA 5CZKA 4OBRA 2WC3A 3BUPA 4CCCA 3FHAA 1E6SM 2G8ZA 2F7QA 2QV4A 1XD0A 5GNXA 5C70A 1E0XA 2DDXA 2XFYA 3G6MA 1XSIA 1I1XA 1UYQA 1HP5A 2BV9A 2XJ7A 5I24A 3BAIA 2FHCA 1PZ2A 3BAXA 4H7VA 3CUJA 3SCVA 4WKHA 5DFAA 1QNSA 2X8RA 1HTYA 2CBJA 3MS8A 1AQMA 1XCXA 1HL9A 1MFUA 2OLHA 1H3GA 1CXEA 3BVVA 2X0HA 5AYIA 3ZJ7A 4NSBA 4MDPA 2XVGA 3W26A 4EE9A 1E6ZA 1EQPA 3MANA 1O6IA 4PMNA 1JD9A 3THCA 1OCQA 3FAXA 1MYRA 1FA2A 4WSKA 2E9LA 4NX0A 2OWWA 3T2PA 3LPOA 2ZX8A 3SCRA 3BLBA 2EABA 3HJEA 4W8AA 3EJRA 3B9AA 4W5UA 4HU0A 3VGGA 3O6AA 4U33A 2BY3A 1W9UA 4OKDA 2GVYA 4MB3A 5A6JA 4JIEA 4QLLA 3D4YA 3PN8A 3AOFA 5ABGA 1WZAA 1H0IA 2CESA 1ESWA 4H04A 2D0GA 4CCDA 1KBKA 4NRRA 4ML4A 5AC4A 1W32A 1S46A 4X9YA 3VSVA 3MMUA 1GJWA 1JZ2A 2UWFA 1DWHM 3ZOAA 1CIUA 1TCMA 3L2MA 1JZ5A 3QOKA 1GPFA 1ITXA 3ZT7A 3PBGA 3WQ4A 3A47A 5BXSA 1UD6A 1R34A 2DH3A 2ZX7A 1UD3A 1QI5A 3I3BA 1KR0A 3NSXA 4ZE5A 3PTQA 5AC5A 1PBGA 4ATDA 1HKKA 3IAQA 3AMGA 3RO8A 2W61A 5I79A 4PCSA 1H11A 1QBAA 2GK1A 1KXHA 5CPTA 1LL4A 4S3JA 4AZIA 3MUIA 3CZGA 4PUDA 3VIFA 3HG5A 4M80A 1JG9A 5EBAA 4KRUA 3RIKA 8A3HA 1SMDA 4PTVA 1CGTA 3ZT5A 1PS3A 1VBRA 3MUY1 4OIFA 4UFJA 2E0PA 4GI8A 5IDIA 2WMIB 2QHAA 3UR8A 1CNVA 1JXKA 1RP9A 3K4AA 3VD7A 1FH9A 4J3TA 1OD0A 2GFTA 1UA7A 3L4TA 4J28A 1QNOA 3D3AA 1D7FA 4AD4A 3SCPA 3BCDA 3BUIA 3LRLA 1OBAA 3U7VA 1XCWA 4JL1A 1UQYA 3WD4A 2J7FA 3ARYA 3WDQA 2D0HA 3II1A 3F5JA 1J0JA 3WH7A 1AMYA 2VI0A 1W3HA 3CZ8A 4PUEA 3VGHA 1Z32X 2E8YA 3NUKA 1OT2A 1R8LA 4J7RA 2WSPA 5DT7A 1G0CA 2DSWA 1JAKA 1R7AA 2PF0A 1QI2A 1JD7A 3GM8A 3QOMA 3WH8A 1G94A 3EDJA 3S5ZA 2XUCA 5M03A 1V03A 4F9DA 1E5JA 1HXJA 1FHDA 4GINA 2XFFA 1Q6EA 3T2OA 3DYPA 3WDRA 2A3BA 1W91A 5IXEA 4OGZA 1XSKA 3WBEA 2OWCA 5BXTA 4UQDA 4B9ZA 1JYWA 1PX4A 1CXIA 3F5KA 1V3KA 2VZSA 2VVSA 3AI0A 4E8DA 1UWQA 4IPNB 2J77A 5D8WA 1U2YA 1TQVA 2XSBA 1B3ZA 1EO5A 5E09A 2V38A 2CEQA 3PZGA 1LLOA 3HG2A 4JL2A 5A6MA 1A47A 4DWSC 1TR1A 4JFWA 2XN1A 5D9OA 5JIWA 1VB9A 2CBUA 3HU7A 2QMJA 3WUBA 1CBGA 2WZHA 2VZTA 3N12A 4B3LA 1X6NA 1N82A 3TP4A 1X6LA 5D9NA 4BS0A 1LWJA 5JBEA 1J0YA 3GBDA 4P7RA 4MJ2A 3VIHA 3DX4A 1UZ1A 3HG4A 2ZIDA 1K9FA 2Y2WA 1AVAA 5BROA 2W63A 4P7QA 2XFRA 2GUYA 3WQWA 3KLLA 2G3IA 4GO9A 5BRQA 3WFZA 3WUEA 2VTFA 4NZJA 4MAZA 3A24A 1VIWA 3GXMA 3W6LA 1UR0A 1LF1A 4FNPA 3WD0A 2VCBA 4PTWA 1J18A 2WKLA 5E1QA 1V0MA 1EO7A 3IAPA 3WH5A 2DSUA 3QHNA 2F7RA 2WWDA 1Q6FA 3EJUA 1CGUA 1E9LA 5EMYA 4M81A 4P8XA 3KE0A 1CEOA 1BYAA 1EXPA 4DO5A 4Z2IA 1HXKA 3FHQA 3WNKA 5CLTA 3AMCA 1JDAA 2EPNA 3WSUA 4ATWA 4NF7A 3CZSA 4AYGA 4X0VA 4FLQA 1BG4A 2YDQA 5FCZA 2V3FA 2WZEA 2D24A 2J79A 2WLZA 2X2HA 4W84A 2WVUA 1E4MM 3W27A 2YLLA 3M7SA 2AOSA 2VOTA 3OB8A 1UD4A 4AZ5A 4D6HA 1CENA 4D6CA 4ZE4A 7TAAA 1QOXA 1UR8A 2XGIA 4ZEPA 4D6DA 2VCAA 3AXHA 4GQQA 1E0WA 5FL0A 3GXNA 3AMDA 2E8ZA 1QHPA 4AMWA 3WUGA 3N11A 4JKMA 2BHZA 1Q6GA 4YHGA 3OGSA 5I23A 4CVUA 1VRXA 3KL0A 1BQCA 3WNMA 1V3JA 3AIBA 3WMCA 5ABHA 3L2LA 3OZPA 2A3AA 2E4TA 4MJ4A 4D1JA 3HMCA 1UR1A 4JCMA 4MNMA 3SCNA 2BNJA 3KEHA 1B1YA 1PIGA 3WENA 1KWGA 1M03A 3ZJKA 1K9DA 3LPPA 4TVCA 1PEZA 1GZJA 5A2AA 1K9TA 4V2XA 3WY3A 1B0IA 1OM0A 4UTFA 3VIOA 4PMDA
chains in the Genus database with same CATH superfamily
3Q6FA 1N5AA 3MTWA 5E2VL 5CJOL 2J21A 3SCQA 2V5KA 5BS0E 1Z0NA 5IQMA 4K5LA 1NOWA 1PY4A 3U4BL 2V81A 1LTXA 3S8FB 1AO7E 3OGVA 3WK1A 3VG9C 2Y4SA 1RIHL 5I3KA 1IILE 5LGJA 4R2GD 1EZLA 1WDRA 5BU9A 4A8LA 2BOLA 1TREA 2XTJB 4AGQA 4HHHA 3WE6B 3NCWA 4BI5A 1TVNA 1HO4A 1RALA 4APXA 5B3JF 4UOZA 3DCPA 1U8JB 4Q6XA 2AGKA 4QIUA 5LCVH 3H2EA 3ZR6A 1HSAA 1YJDH 3E2HB 1KY6A 4GRWE 3RNDA 2J43A 4Q6IA 1R3TA 4P99A 1ZLEA 1IM3D 3LVTA 4GMSL 4AWTA 1OB0A 2HYMA 4ZFOL 3HC2A 2OMVA 5J06A 2WZPA 3TPUB 2IGTA 1RUMH 3LV3B 4KWWA 1R5VA 1KBGL 2VO8A 1T22B 3R10A 4JZOA 1O7AA 4PJEA 4MYXA 4PGDB 4XG1A 4UC5A 1KJ3L 1JPGB 2VDNL 1XGPA 3VXMA 4PJBB 1BSIA 1HEZB 2Z4GA 1OGTA 4EIZC 2RJHA 3TROA 3UR7A 2PPFA 1IFHH 2MNWA 1FHGA 2AQ1A 1NIAA 4LBEA 1R47A 3EFDH 1IBFA 4QSFA 4IBZA 4PTTA 1TO4A 3TYZA 2I9TA 2AEIT 4GKLA 4PJAA 1I53A 1YC7A 4LASL 3AHYA 1RHHB 3O6DA 1S7UB 5AOZA 5FV1L 4I0PB 3QJQB 4IF2A 4DXXA 2MWCA 1AZBA 4JPSA 3NOEA 1DJGA 2YPVA 4JFPA 1UMLA 1AXSA 4F40A 1GQNA 3SDCD 2HVMA 2IPTL 3H26A 1SYVB 2PW2B 5CAKA 5IEKA 3SDAC 4NZ1A 3ONBA 3UBFA 2ZWLT 1VFBB 2PO6B 4UILH 3T6XA 1Q38A 4LVNC 3OLIA 1FIEA 3F05A 1ZSDB 2R0LH 3WU1A 4JKLA 4C1NA 3RNKA 3EKCA 2YCIX 4R7VA 4PBXA 2CIKB 3LCLA 3AZRA 5DK3A 4PS4H 5I6PA 1A1OA 3MJYA 1R9FA 3KHDA 3QAZB 3VWJA 1W5OA 1IXOA 4YHZL 3OVGA 4KROC 1DQDH 2P7TA 3KPPB 1JZ8A 3D47A 1JDEA 1ZNNA 3HPJA 5LA2A 1E30A 4MY1A 1KYAA 3L48A 4YDVB 2X28A 4JO2H 4JN8A 2P8PA 3P9MB 2JIXD 1JHKH 5L9DL 2ZOWA 3V7AG 4DERA 4NG3A 4NAEA 3RMEA 4EXKA 1Y65A 4B3VA 1N3NB 1ADQL 3LRKA 4PUKA 3A21A 3HS8A 5CJQH 3ARBB 1B5TA 2ENQA 1UWEH 3DX6B 2WJFA 1HXYA 3VIGA 4DGYL 3SO3C 1NCWH 1HL4A 4PODA 2ZAIA 3SPVB 4M5YH 3TXVA 3BWWA 4Z1PA 2PR9A 3NJ3A 5TQ2L 1JV2A 4XBPB 4A2LA 3BUYB 4BXVA 5CZJA 4ADTA 1WA0X 1OTUD 1IEHA 2MPVA 3X1GA 2UY2A 6TIMA 4D9RE 3F4WA 4DJED 2IADB 3JXAA 3KLSA 3N0AA 3FZUC 4AC2A 4GP5B 3QP3A 4YLWA 4LSTH 1MWAB 4OB5L 5J0BA 3URQA 1OGAD 1HH6B 4P8UA 2XJKA 1AQFA 4S1QH 1W3JA 1FWEC 4FXGC 4CADA 4M93C 3DETD 4EXQA 2BC4A 1GJUA 3QJHA 1VA9A 3I50H 2ODOA 5FO8B 1XIEA 4H8WL 4NT0A 3JWNG 1UWXH 1W0MA 3RILA 1E8ZA 2VUNA 2QCHA 4K9JA 1ZTXE 3IS1X 1AIFB 3QUZB 1XIMA 1XBXA 5IM7B 1A9VA 3LMJL 5F3BB 1X5LA 1GKQA 2DV0A 4G5DA 3ML9A 5TD4A 4XVTL 4Q4SA 2DQTL 4UMGA 2N4IA 4CEUC 2FMNA 3L4UA 2GBTA 5LAPA 2DWDB 4M1GL 3R0MA 2XVNA 4IU2B 2FQEA 2H45A 2VR2A 2EACA 4MNGB 1OP5K 1GTHA 3JYBA 1XH3B 1PYWB 2VDRB 3IWPA 4ZUUA 2FRGP 4FOKA 5JOEA 3SJVE 4X50A 4R0LA 5T3ZL 1LE5A 2YXMA 2YKLL 4L05A 4H9ZA 1LVEA 2IALB 3OLEA 2Z1SA 4BQ2A 5LCVA 4KDWA 1MEIA 3W2LA 3DX9B 1OPGH 2NSOA 1FG9C 1UFUA 4Z7AA 1T80A 2EBNA 1T03H 1INEL 2XCMC 1MHPL 4IMFA 1IGYA 3JW7A 3FIGA 4JHZA 3GYCA 5F2LA 4WK9A 3SOTA 3NPSB 3QV6A 2H32A 1Y6MR 3N4EA 1A7NL 1OW0A 3AXXA 1CBJA 4PRWA 3HGSA 2LLNA 2Z1PA 1FY6A 2VCOA 4Z3GA 2QPFA 1P0DA 4PJBF 4HNNA 4EPKA 2GYSA 1F9CA 4XPFH 4GAJH 2ZOTA 1ITCA 3B4UA 3EX2A 4JAMB 4A2MA 1GC1L 1S7RB 1G7PB 2H7WA 2UY6A 3VGFA 1IL1A 1OF2B 1MCEA 1SOQA 4LEQA 1FWIC 3TAOA 5E0FA 5C0NC 3NABH 3BW2A 4B3EA 1DYZA 2CK2A 3R6IA 3WUWG 3ESVF 4C6PA 4TF4A 1Y18A 4BSWB 3ZVVA 2PBOA 1VADA 3DKLA 3UZZA 3VFWB 3NIFB 4TOQA 5C6TH 3UO1L 1IM3A 4N42A 4KRMB 1C12B 4LSPH 4O14A 3WLWD 4M61A 1RUSA 4FRWA 1A2YA 3IGAB 3OKEB 5JA8B 1KSRA 3UA3A 6XIMA 1GTEA 4DWSB 5SWSB 1HVQA 2J25A 3ZKMD 4RRPA 2Z4QB 1XR8A 1ZU8A 5DA0B 4RNRA 2BCKB 1OOAA 1HINL 1TZIB 3OAUL 3GGWA 1HH9A 1PCXA 1Z9SB 1QI4A 4B9GA 4AGMA 1SDDB 1BQLH 3BGMB 1YEWA 3VFGL 4M4PA 2YXFA 1KM0A 1R3IL 1W5PA 5D2YA 4RQQA 3QJVB 3QDGB 2ID5A 4AXNA 1ADWA 1SO5A 2VAAB 3R0KA 3A4JA 5HHMD 1P5UB 3D85B 2Z28A 5DJDA 4LLWA 4RMUA 3EYVA 2HXTA 2ZCHL 2PPAA 3VVGA 3ATDA 4MQXC 1KELH 5DBUA 4ROQA 3W88A 3EOBA 4B6ZA 3FOKA 4GX8A 4EN3D 3EMQA 1IQWL 3UG3A 1SW7A 2PFHA 1KKOA 4F2ME 3CPUA 2GABA 2MQGA 2FL5A 1FWWA 3SDCA 5I19H 2MCPH 4ESKA 2E7MA 5CHNA 2X16A 5JOFB 2QCNA 1FWNA 1DHKA 1WBXA 2WLIA 3S7GA 2X40A 1RK0B 4UQ9A 3T0VA 2HKFL 3WTVA 1JUBA 5DLCA 3W7NA 5DD3L 5IB5A 2L7QA 4A6YB 3ES7A 1XP3A 3WFHB 5F9OL 1T1WB 1CICB 1S9YB 1M7OA 5EZJA 3KP0A 3BKMH 4A7TA 4XZNX 1FFOB 3UP6A 3QYMA 5C9RA 3B7TA 1AUSL 2VISB 4M6AA 4WDIB 4RZCA 3MNZA 2CKRA 3J8F7 2JCWA 1V02A 3APGA 3MI2A 3RG1C 4N2NA 4PUMA 4HNCA 3TC7A 2K6WA 3LGEA 3FB5A 4X0KB 1QW9A 4F2FA 3IK2A 4LRTA 5CPMA 1BD2B 2HLFC 4MWAC 5E4OA 1I2NA 2ZX6A 2NX3A 2DQ6A 5T8IA 1NCNA 2WNNA 5EUOF 1VPOL 4HWEL 4M43L 5T1MA 1MAMH 2JIXA 3E0VA 3QFEA 4MXVF 2YDSA 4NUJB 2Q02A 4ZZKA 1G7VA 4U3AA 3WBAA 2F8OA 2XTSA 1AG1O 1H5YA 1CB4A 1RH8A 1NDGB 3H6AA 1KN2H 3F7VB 4PYHA 3DX5A 4JD4A 1A65A 2Y06L 1XIDA 2CHNA 5E0QA 4HCRL 4H8WC 1ZSHA 2A9BA 1CT5A 3GUTB 4GG6A 3LA4A 3WQOA 2QHRH 3ITYA 4PGBA 5C0IA 4QF1A 4NKOB 2XG9A 4HH9A 3RGVC 5AZ0A 1T8XA 4J3VA 3QHMA 3NRFA 3ULSA 1D2PA 3PJSA 4JKWA 1BVKA 3TFBA 2D22A 3GZ3A 2A9ML 4GS7C 4DJEA 3CDZA 4W8LA 3BRGC 3OHMB 3WY2A 1EA0A 1M57B 1XF2A 5BZZA 2HS8A 4ZQNA 1U6AH 2YO3A 5AZUA 1OGAA 4XD5A 4O53A 5M1TA 2P8MB 5C0BD 3ZO0A 2IPGA 3VUSA 4JCLA 1SZFA 3MLRL 4QRSA 1GOOA 3DVIA 3ABXA 1XDLA 2IPWA 4KAQH 3W38A 3QJOA 4HX1A 1XUZA 2Z2BA 3GI8L 1Z9PA 3TT3L 32C2A 3X14B 1C8VA 4WV1B 2A6LA 5F8QC 5A6BD 2JMRA 2J75A 3LNIA 4POZC 4WHTA 3B9NA 3UMTA 4F20A 4IBLT 4MS8C 1P6BA 1I7UB 4JB9L 2QAFA 4AC1X 5HD8C 4LCIH 2KQNA 4KRPB 4DT2A 2HDJA 3G5XA 1JBJA 5LXXA 3UEZA 3O0RL 4WVXA 5I76A 5G4HC 1S3TC 3KBVA 1B31A 5DURD 3CPLA 4LFHD 4LDEB 1BGAA 3M17B 3IN2A 5HI4D 4FX5A 5EZOL 1I8AA 2I26N 3C8NA 1KBLA 5J5EA 4BZYA 1FAIH 1LQ2A 1M1BA 4MRBA 5J5RA 1HKJA 3SRHA 1EHNA 3E0LA 3QY7A 3TNMA 1GW1A 3WF4A 1ZLDA 2F9RA 3VFLA 2PWVA 4O1EA 2Z8WC 1SFTA 3DG3A 3KYKL 3BFWA 1XIWC 1E50A 3DLQR 1ZVHA 1BSLA 3E0WA 5D6CA 2X9XA 5CG0A 2BDQA 4NPJA 3ASNB 3FSTA 3RWFB 3IRPX 1FDZA 5DMYA 5C0CD 3F2DA 4NRXA 2X4TB 1BFVH 2WZTA 1LNUA 4TSCL 1OP3K 1H3XA 1W56A 3Q67A 3BFQG 4NPYA 2MEJB 3KZSA 4D9PA 3NIFF 4QT5B 1E1FA 2H8PB 1R17A 5I2IA 2ATMA 4RBPK 2OKTA 3NA9H 2ED9A 5LIUX 3ESUF 1AH0A 4DQOH 3ABGA 4AIEA 3CVIH 3WMLA 3DGCR 4NFBA 4XBMA 3TO4B 2Y5EA 1FJ1A 2PR4L 3V6OE 5KJ7E 1CU4H 5ALCL 3U6RA 3SAZA 5JW5B 4DUXA 3ZTNH 1UBSA 4QHKI 4UINL 3RPMA 4X99B 2ZPKL 2CIPA 3CMOL 2ORBH 1PTAA 4MSSA 5JQ6H 3KH3A 4HWZB 2VLRE 4IX2A 3UWWA 2HBVA 2YEVB 2R24A 1G6RL 1T66C 4G9PA 4YDKL 3WG7B 1S5IH 3GU2A 4OLWH 5HJDA 2R1NA 4ZCWA 4MLIA 3PUDA 3GXPA 2HBXA 3GMPB 3IPBA 7TIMA 1U0QA 3HBZA 3EHBD 3TEUA 2CC0A 1KRAC 4ZVJA 1L6YA 3KD4A 4QTHB 3WHXB 4OCXL 1NA8A 5C0RL 2FHCA 4WWKD 5FO7A 3EJCA 2QQNH 4XR8C 1OFOA 3TKFA 3KS0J 5TE7L 4HMNA 2ISWA 4PB5A 1WOBA 5IB3B 3ZJ7A 4F3HA 2CIIB 1L6WA 4JDZA 1YNTA 3ZX1A 1EZSA 3THCA 3IEAA 1OCQA 3PSWA 1KIPB 1PLGH 5D71H 4QBXA 5GSRB 3KVDD 4H88H 2UX6A 4LLAA 4BCZA 3O06A 3ZVHA 3EJRA 5I30L 4N2HA 4P3DB 1DQLL 4P57B 5C3TA 3W1AA 2Y69B 4M62L 2ITCA 3CC5A 2R0ZL 1MFBL 2FCBA 1L6ZA 3SE9H 2YB4A 1TPH1 4P4RB 4CCDA 1X5YA 4ML4A 3RWGA 1S46A 4Y4FD 1M9WA 3THUA 1R34A 1PG7L 1AH3A 3NEHA 3KAOA 5E9XA 3GSNL 3IAQA 4H25B 2H3XC 3PAVA 4MCYA 4OJCA 3RF9A 2CWRA 2DZVA 3GSVA 2YYUA 3L9CA 1BFSA 3MUIA 1KIQB 3KNBB 3KM8A 3CB3A 4N5UA 3FU7B 3O6CA 4OJAA 4I18B 4ZUSB 3J27A 3D30A 4L1HA 3DG6A 3UR8A 4KCVA 3WQFA 1A6PA 2E47A 1XCFA 1MHCB 2GUBA 4QGCA 4LESA 1TB3A 3RAJH 4JRWA 3F7QA 3ZLFA 2EIDA 3P5ZA 1R8LA 3WXWH 1J6OA 4AY7A 4U1HB 3GNML 4XMUA 1NAMA 2VH5L 4ZMVA 4L1WA 2J4WL 1X8CA 3KGSA 4K8HA 3CFEB 4TXVB 3PWPD 2OWCA 4FQIH 1Y0EA 3GRIA 4YZFE 1O5XA 1CWVA 5F1IA 3LKOB 1GAFH 4E8DA 3LXUX 1G9ML 3NDOA 3DX8A 5L2KE 4GRMB 3E2QA 3EOEA 2X3AA 3VXRD 4N25A 5LXVA 1JVNA 1EUAA 4F8PA 3P3SA 1Z6KA 1U8MA 3SJ3A 1ZHAA 5F1UA 3HU7A 2DZWA 3U30C 4YHLH 3JWDH 1MCDA 3QXTA 3BCJA 5BROA 1PCKA 3C2VA 2A77L 2XH2A 2V5YA 1SGKA 1MREH 3G7TA 2BSRB 4M7LH 2BNRE 4R9HA 5CR1A 1W17A 3IAPA 1IT7A 5K59F 1YXYA 3L6FB 3EOYG 4OGYH 4PJ9D 3O6YX 1EK3A 5FGBA 2VYRE 3O8AA 2BNQB 3FQ2A 1LUCA 4HPYH 3RWCA 4NF7A 3H22A 4NQDA 1AGFA 3CH8A 4I7ZC 2J79A 5BZDB 3NPXA 5FOBA 1SZRA 4RX4D 3QQDA 2V33A 1J1PH 4AZ5A 1J87A 3O3AB 2EVGA 3LKSA 2AV7A 4D6DA 4DGUA 3KVKA 1IGCH 2EDQA 3WUGA 4XAGA 2FEJA 3T3MB 5KSAB 3WNMA 2G5RA 1OX4A 5DMKA 5GJSL 2UZPA 5HY9B 3QWQB 5E99L 4DJDD 4IKNA 1CGYA 1QYGH 1TWZA 3T8QA 3CXOA 4FX7A 2ADYA 3ZPDA 4ATLA 5C0BA 3VB8A 1TU2A 5DXYA 2DVUA 5EFDA 12E8L 2WCGA 1LROA 3SBWC 5EDXA 3WBYA 3NCJH 4QJ4B 1YEDB 3H2FA 4IOIB 1I4FA 1Y0LA 2W9EH 5A6BA 2GJ6E 1CECA 1W8NA 2QCGA 5A8QA 4M00A 4CGTA 3HC3H 1EA9C 3CSTA 4MSWB 2PTZA 4LCRA 4NUQA 4W70A 4L0ZA 3V95A 3DUHA 2E56A 3WTXA 4E9RA 4BH7A 4S2SB 4UZSA 1ZWIA 2OR7A 4N90D 4OCMC 4Z2JA 3PRZA 1YAZA 7FABH 4Y2DB 4XBEL 3DNKA 2N1KA 4R26L 2TYSA 4B95C 4IGBC 5CLYA 3D69B 2JB6B 1L2QA 1GQIA 2BWQA 4RFNB 2EG8A 3HE7C 3QIUD 4GKOA 3TK7A 3S5YA 1ODAA 3S5OA 1DLFL 3OJDB 4AMAA 1FBIL 4GXUN 4YDIH 3PANA 4FQJH 4WZHA 5AVRB 2E27L 3V3WA 5E9DE 1H61A 3KLDA 3DVGA 3FDWA 4MKNA 5C0CA 3WUFA 4G8IB 3T4AA 3WIFB 3BMXA 1YMYA 3W0WE 4GZIA 4PTMA 3WF1A 4JDTL 2Q6WA 1A9BA 4CNUA 2GUOB 2IEPA 4FEZA 3LEXA 3BSZL 4K3JL 3S35L 1EXBA 1QRND 4XOBA 1O5DT 4HU3A 3TH4T 3MTRA 3RJDA 3BUDA 2VWEC 1J0ZA 3W1XA 5DZLA 4WI2A 3ZZLA 4XTIA 1OWQA 4GQ9L 2AEWA 4D6IA 4K8GA 2IGFL 2WQVA 4ZTXA 1JQVA 4E9SA 3SKJH 2IJ0C 2M2DA 5IQ7L 1YIXA 5MKGB 4DCQA 1A50A 3UCCA 4RFOH 4R4FH 3LRSA 3HR5B 5DO2C 4C1KA 4NNXA 2OJ1A 5KBPA 3NPVA 5B38B 1H8LA 4L5FL 1A14L 2VMDA 1QWUA 2FT8A 5LAXA 3K72A 4QWWC 5JIMA 4ZAKC 4D2JA 3IEBA 4WWKA 3TBYB 1IO4C 2FJHB 1GG1A 2R9HD 1E67A 4RKAA 3QPYA 3ZYIA 3NZ8A 3BAWA 2HPOA 1M2VB 4HZ6A 3IDXH 4WK0B 3FT3A 2DM3A 4LOCA 5ACZB 4W87A 4ABVA 4JM4L 3A67H 4DAGH 5DRZA 2WV8A 2G9KA 5EOCH 1H62A 3AIWA 4OI7A 1XUUA 2YPLE 1E27B 4E42A 1DVFB 2SEBB 6TAAA 3K4DA 1MCWW 3I6RA 4BE5A 4JYDA 5D2WA 2NCEA 4K9EC 2VVNA 4M5ZH 4H01A 4MOZA 3G08B 1OAYL 1ZVYA 2EIEA 4NZRL 4QE1A 4ABUA 1EF3A 1FGNL 3WD5L 3NN8A 5TGBA 4Y4FA 1A5AA 5I15H 3HNTL 1RUKH 2W5PA 3WJMA 1UEMA 4MKVA 3CHOA 1ZB5A 3HUJA 1C9DA 1IEAB 3BARA 3MA8A 5B39A 3O45B 4GAYB 3NDYE 2NQHA 1ZVNA 3L5HA 3G6LA 3U6XS 1W8SA 4AQ8A 1PL3A 4TMPA 3P0VL 3B7UX 4A63A 1R3JB 3F03K 1GQKA 1XQLA 2BX5A 5AB9A 4FOUA 4Y6GA 5FC9A 4KNTA 4BFAA 4YSAA 2W5FA 1N64L 4POUB 4WEBH 1VRDA 3GHRA 1T7LA 1GTNA 4XZHA 1SMAA 4XVUD 3QSKB 4PJXA 4PMXA 1R2SA 4DWDA 4UUJB 3AYTA 5EFFA 4NRYA 4HOMA 3CN3A 5TQ0H 4WW2B 3CFUA 4DPPA 4MBOA 2E6AA 5DUPL 4MDRA 5CF3A 3NA4A 4M8UA 3PWPA 2GL5A 2RDXA 1OHLA 1NMAL 4ZUWA 3RL2B 1QLRA 3PFQA 1AIZA 4Y5VA 3HFML 2GQ8A 3TPKA 4KXDA 1EEYB 3MXVL 3VXRA 1E4IA 2HXUA 2OQHA 3QXAB 2F19L 1X96A 2Y6SD 4X6BB 3DBXB 4Q7IA 2O9TA 5KAQG 4GKTA 1AZVA 1YDVA 5C2CA 3WI9A 7PTDA 1UZHA 3CIVA 1NUDA 5M5DA 3TFXA 2F6KA 1FWHC 2H2SC 1FHLA 5DVOA 1PJ9A 1BM3H 4DEPB 2XJLA 3O2VH 3ILQC 2E75C 2J4GA 3K2MC 2EDLA 4DEFA 3JQOB 1DP0A 1QR7A 1LJYA 3WSQH 4PJ9A 4OT1H 4PJFE 1KZYA 4I77L 1XKYA 1VZGA 3TW6A 1J11A 2W07B 2IKGA 4L9LC 1JQXA 3UPCA 3GBNH 2ODIA 4DYJA 4CAGA 3MFFA 3TNNB 1XICA 3QDJE 4X4XB 4RX4A 3RA7H 3AXKA 1SVZA 1PTDA 3PWJA 4TVPE 4JO3L 1KFWA 3H4XA 3AXIA 1Z5HA 2INFA 3TN6A 1RQHA 1C90A 4PB3A 3FU3A 2HX8A 1MQ8A 2VDLB 2E86A 3NA8A 1KJVB 2Z31B 2FB3A 4MMXB 3SN1A 5D4JA 4C6IA 3NH7L 1XCQB 4MKMA 2FAUA 5GJNA 4XP4L 2CFFA 3CGTA 1YEJL 1K2DB 1U3ZA 4B16A 1Q6QA 3KOXA 2Y1HA 1YMME 2LAGB 3IXAB 4LPYA 2F6XA 4DJDA 1FHVA 4OBTA 4Q8TA 3QM3A 2XN9E 1G01A 2VXUH 3PABA 2N59A 1TZGH 3NZPA 2R1MA 3PQYE 2VRAA 1B9ZA 5KTLA 1FH8A 2X4OB 3KAAA 3WO4B 4WJEA 5D1XB 4TOYL 3H12A 5EU9A 3HLAA 7REQB 1QJWA 1UA6H 5DJAB 4UM8A 4K9EH 4XE5B 1OSZA 3GK0A 4RZBA 4U3SA 3CHFA 3HAEG 3BH8B 5EBMA 4JQAA 2DTSA 1BV8A 1CLXA 3NAVA 3UG5A 3C4UA 3E02A 1JFHA 1TZOA 3MRBA 3TYCA 3EB3A 4R33A 3DKJA 5HNTA 4C4KT 5JIHA 2FQGA 1PZ0A 2BCMA 2EE9A 3NZUA 1MFVA 2DBJA 3IDGA 2DQJL 4NYLA 2MH4A 4G11A 4OOZA 3CUZA 3QIUA 1UXSB 4FMVA 1R0MA 4B3KA 5HI5C 2GT9A 1NCAL 3T09A 2E7HA 4Y1SA 3O0KA 4B15A 1UYWL 4ZS6C 2PDWA 1S9XA 3OXSA 1CIDA 3GMNB 2R1XA 5C0AE 1ZS2A 4PWEA 4GAFB 4PWHA 4CRPA 5JQHC 4NLAA 3GEFA 1E0TA 3V5KA 5KAQF 5DJ0A 3ZL2A 1Q72L 2D03H 3BVWA 3CFQA 4OFVA 3TT1H 2RAMA 1TCDA 3PG2A 1WISA 3R06A 2BFVL 1K8XA 3NPZB 2Z7GA 5C9ZA 2WAGA 3VMOA 4LF3A 4C83A 2NQ5A 3IETB 2VNCA 1H0DA 1QRNA 1D2KA 1BXXA 5BWFA 2IG2L 1YC8A 4NWTH 2YQGA 2YCLB 5EN2B 2BP8B 3T6WA 4M8RA 1IAOB 5F0LB 2E40A 4FG0A 1WKYA 3QS2A 1OKEA 5EO0A 1A66A 3GLEA 3B2XA 5AVZB 3M1BB 4HJGB 3G1DA 3QJTB 5F1VA 5ESQB 5DCCA 4GW4A 3FNKA 2ZOLA 3D4GA 1J1OH 1MRDH 2HX7A 2HFGH 4M5TA 1N18A 1SQ7A 1KIRB 3QCUL 4QXUL 1DE4B 3DYMA 4NN7B 1LLWA 1AHWA 1GMEA 3SRDA 3QW4B 4YEFA 2IO5A 3F2BA 2N56A 3D25A 5CCJA 5BVPH 1F3DH 5DJ2B 2DZPA 3TYGL 1C5CH 1GJPA 3S8GB 3TEVA 3QJFA 4TSAL 4JG0L 5HBBA 3DHDA 4XP9L 3KPNA 4NHUA 3VXSD 5FFOA 3AIEA 1US3A 3DI3B 4JEQA 2X2IA 3BXNA 4G5ZL 3MT1A 3HMWL 2ZUSA 4L29B 3VW3L 4OZHE 2J7BA 1J8HE 1KTRL 2NNXA 2UZIH 5JU6A 2G3FA 3T44A 3VCRA 5AY7A 2Y6TE 1JFXA 3MRIA 3G6AB 5H4YA 4MGGA 2IQAA 3LBCA 3TYAA 2V2HA 3QEHA 3VD5A 3IJSA 3SGJA 2NY4B 5AVQB 1A1MB 2ZXAA 1EANA 4CMMA 5KSVA 3L5WA 3QFWA 4OWGA 2CGZA 1E90A 3O6FC 3L65A 3ZO9A 2HAZA 2E5DA 2Y5QA 4PSPA 4HFWB 1BQUA 4K5OA 4DSYA 4S11A 2O9PA 2Z35B 4DZ5A 2RIKA 3O8XB 5D7SL 2X4RA 4XCYB 4CNNA 4IDJH 4IUGA 2G2NA 2WJDA 3QQ4A 1IWAA 3TVMD 1QTSA 2WQXA 1DEEA 4MZRA 1XMWA 5DJCA 4UTUA 5I3GA 4Z77B 1KFEA 4O57A 2Y72A 2MNRA 3QXDB 2Z0IA 3IPFA 2W9MA 4V1DE 2K7PA 3DVFA 3QUHA 4JR9L 2GKIA 3MV7B 3EMCA 4PCNA 3ZJAA 5E2WL 3PJUA 5HGAA 3T9WA 3SJNA 5F96H 4Z2LA 1GGCL 4MA1C 2FO8A 4WSGA 1KGYE 5GJTL 3C12A 5G1TA 2DQWA 3LZFL 2EDKA 3EGDA 1KXTA 2A21A 1E8XA 5IG7B 2VN5A 4H4IA 5IVZB 5CMAA 5BQ7B 4IIHA 2GAZA 4JJHA 1THFD 3WBXA 4XPTL 3PPFA 5DMJB 4NN6B 4LUYA 3QI9B 1I31A 1VEPA 4FMKA 2YZ5A 1VLWA 3MHFA 3UWVA 4BWWA 3LX9A 2FX9L 1P7HL 3PAZA 3UJJH 1S8DA 2R4RL 2IDCA 4XNYH 3UTPD 3KZ8A 3VTRA 1NZRA 1A1NA 3OHXB 4XO9A 1RH9A 2WXDM 1EAJA 2WTRA 3P30H 3IVSA 4KXBA 1P2CB 3A3XA 3B05A 1ZQ5A 1H7NA 4U3XA 2FECI 2VEIA 3W9ZA 3F1QA 3TCLB 2OTUA 4QTGA 2FBJH 4HSNA 1BBJA 4FKEA 3EJTA 1GOXA 1A5BA 4RL3A 1KTCA 3FH5A 5C86A 1T2JA 4ZOAA 4Z7NE 5G5DA 2AL1A 1BZDA 3WG6A 4MQSB 1A64A 3CEUA 4XXDB 1ITUA 4XMLL 4ADUA 2QUTA 3UPMA 3D39B 3OF6D 3APMA 2QQQA 3I75A 5EGRA 3IBOA 4FYTA 2F61A 2ZCLH 1F3JA 5J12B 1I7RB 1OY0A 4EOWL 1RLWA 4ES4A 4JFZH 1E5NA 2JK2A 4NOFA 3V4VH 4TVDA 1TG7A 1KPRA 4N8CH 1OCNA 5B1KA 1NFDB 5A6SA 3LLXA 3TF4A 4WIWA 4BQ9A 2RCSL 5J11B 1X7SA 3KPQA 2WC7A 2YD4A 1I9RL 4Z08A 3ECBB 3TJIA 1J48A 2V5CA 3K6DA 1IZKA 2VO5A 1A6UH 4PCTA 1NSNL 1W9DM 5FL1A 3V4PL 2AVFA 2B1AL 1RQBA 3DFTA 4PBEA 1U8IB 2G8ZA 2P43B 1F56A 3EH1A 1OFRA 4HJUA 5LIKX 3UWUA 5LDUA 1AAJA 5LUMA 1BEXA 4H7VA 1EXUA 4ZTEA 2PDJA 4IQEA 4WKHA 2FATH 1CFQB 2DI8A 1E8YA 1J88A 3MS8A 3OVPA 1KTKE 4YSDA 3SADA 1P6FA 3QFJE 4IEFA 4G42B 2XV2A 3MODH 2V5SA 4PMNA 2C15A 1AXTL 4NYUA 3E3QE 4ZB2A 1ET5A 3LPOA 3EUUA 5ES4B 3L3GB 5DQ9B 4LHJB 5KYYA 3CAVA 4MD5A 4R4BB 3G0SA 1G9NL 3UJRA 2Y1VA 4MA7H 3UZWA 3UX9B 4G82A 3PFMA 5DJZA 1K5NB 3NRPA 5ABGA 2CESA 2P76A 4B41A 2XU2A 4JFYB 4MRCA 2EH8L 4ZI8A 5E2TL 3ITVA 3LZQA 5CCKL 3NL2A 4NZTL 4L8DA 1IGJA 3E9AA 1W3TA 5JHAA 2C1HA 3N2TA 4AH2A 5I79A 4FQ1H 4P59H 1H11A 1NMBL 4LSDA 1NFAA 1KJMA 4LHQB 1FWTA 2AK1H 4DP5X 4H44C 1OANA 2ICEC 3CIQA 4AF0A 3W39B 4ODUA 4ZQCA 3VIFA 3HG5A 2WBJC 1CD1B 2WKOA 3SGEI 1PS3A 3W5MA 4GI8A 5IDIA 3G22A 3UJIL 1CLKA 5GIRA 1G7MA 2ATPA 4XNZC 4PC8A 4HNLA 2CA3A 2XX1A 1OBAA 2J7FA 4KBXA 3WH7A 2V7HA 1TPXC 3MA7A 4GYPA 3GYEA 2FB2A 1W6WA 4M8QB 3O0FA 5IFAL 3BLDA 1PKYA 3NUKA 5AB0A 1KIUB 1A22B 3EYSL 3HMXH 1F7BA 2XWTA 4J12A 4X5PA 5M03A 4BHUA 3P0GB 4MQ7B 1CDBA 3T2OA 3IRCA 3OGCA 4OGZA 2MOVA 4AQZA 3C8DA 1PTZA 3OEXA 5FB8A 4DNHA 1ET8A 4IRJB 1EX1A 3GC3A 3P4MA 4GG6E 2W0UA 5LJYH 2Z26A 5EU5A 5JW4Q 3G04B 4G9FD 1JF1B 4J1UB 2V38A 2REQA 4LKCA 3HG2A 5A6MA 4WI9A 1VB9A 2V2WB 1ORSA 3GYRA 1URZA 5FS5A 3ZHNA 1YEFH 3S35X 2EP6A 1M05A 4JY4A 3SDAD 1J0YA 3VXSA 2O5XL 5EUOB 1W5NA 1AVAA 1J1XL 2A3LA 1Y6KR 3IS0X 4KX7A 5G4WA 2ZKHH 4FA3A 3GXMA 4BQBA 2GJZA 1J18A 2NY0B 1C1EH 1L9PA 5FYLD 5IVNA 4GXMA 1A8JH 5CZVL 2V2CA 2ENPA 4JFXB 4EACA 1L6FA 3WUWB 2GHWB 4PVMA 4XNXL 3U2IA 4AUYA 1JDAA 3FYIB 1V93A 5FCZA 1ONQB 3PUCA 3B6SA 2VFGA 3MV9E 1XF1A 4HGWB 1PZUB 4WU5A 1K8ZA 4MDJA 2OZ4L 5AZ2H 3OZLA 4IBQA 3UAAA 1RULL 3UGUA 3L23A 2I9LB 5HHVL 2X1UA 3TVMA 3QY6A 4G6CA 3MACL 1KCWA 4Z0XB 2OP4L 3P0XA 1ZA6B 3N3MA 3OWEA 2BNUB 4ZNEA 2NTFB 4WY7H 3M7WA 3V7MA 3R7RA 4UCFA 1B0WA 4QPEA 2EH7L 1AKJB 1F4WL 1RJZB 1BJ1J 2BDNL 4PJ5D 3MOAL 2AHIA 4HC1L 1J05A 1ISYA 1SPDA 4WFEE 5FYLH 4WW1A 3FMGL 2YR3A 3BOXA 5DVNA 4XMPH 2OW6A 5FW8A 1FSKC 5KZDA 2LTQB 2NSQA 3FT0A 4AWUA 1TPEA 4B97A 4NOBA 4YL4A 3GO2A 2OTWA 1KGIA 4YQXH 5HGGS 3FZUD 1GPWA 1MZZA 3V2AR 4GY0A 3OZ9H 1E9YB 3PWVB 4AWSA 2M26A 3BPLB 4MUPA 1OFDA 3MROB 4U28A 2F1AA 1NFDF 4ECNA 2VENA 1XD1A 3WDHA 3UTTB 2RFGA 1IM9D 2CR6A 3A4AA 5DWPA 3U4EA 2AQOA 3MA9H 1FC2D 5HYFA 3FTVA 3GQYA 2WQAA 4AQAB 1N6VA 1SO6A 1NCBH 5EMUA 1HWGB 1DBBL 3TZVC 5C2BH 5M3WA 4JZNB 1H2JA 1SEBA 1RLDA 1KC5H 5IW6A 2FSDA 5E1HB 4ELKA 3PNWB 4NM4H 3MMEA 2RACA 1NGXA 3F65A 4MVAA 3PZNA 1A9EA 5A6KA 1DBML 4GBUA 4LRIC 3GRGA 4YHML 2FZ3B 1SYSA 2ALRA 3POCA 2YPKA 1DIDA 3STGA 3A6BH 3OF6A 3GH4A 2DMGA 2Z24A 3IXTA 4F9JA 4FF9A 4H5SB 1PKMA 1WRFA 1S5HA 1RZPA 4N2BA 1KXVC 2ACUA 1VFFA 3EOAB 1D5ZB 2VXVL 3C2YA 2C18A 3LSOA 2PODA 1JGVL 2F1BA 2JJUA 3M6DA 4I4WB 1KB5H 2BLFA 3WNLA 3ANYA 1RERA 3MRRA 4DKFL 1MNSA 5E8DL 3BHBA 1J12A 4Y1AE 4F7MA 4PJDA 1IAIL 3H1ZA 3WLNA 1FGVH 3GHBH 3Q8EA 4KCWA 4PJ7B 5SX4I 3FO0L 5B21A 5D2NA 1LT8A 2C26A 5EZLA 1Z0MA 5KZCB 4KUCF 3LQAL 4N8VA 5DSCA 3BOVA 2FGLA 3QNZB 2R1WB 4UDTA 2ESVB 2F84A 1ZHLB 2XH7A 3S46A 4RDVA 4JPIB 4WOZA 2ATKA 4YVPA 1ILSA 4L3ED 3VFRB 2ONEA 1SZGA 1T1YA 1W3KA 1NDMB 1A4KA 2Y70A 2GDQA 2X6VA 1FVCB 3LIZL 1KLUB 2VDMH 3WJLA 3CO8A 2ZVRA 2XLLA 3EGXA 1GEHA 2QKIA 3OA3A 1A4BA 1IBDA 3DRTA 1KYOK 2PA6A 2MPAL 2FH8A 4PUBH 4W9EC 2EADA 1B2WL 4ZMLA 3T1FA 1VFOA 5F6HI 1U58B 1I2OA 1S2UA 1L2UA 3HMXA 4C6NA 4LBSA 4I13B 4JDEB 5GSVB 5KSBB 3FJTA 2PDCA 4DGVL 2QJHA 2D4DA 5JIIA 2P5EB 5E8EB 3LN4B 1XWYA 3VM5A 4DB7A 5CSYA 5GGSY 1ZVSA 2WD0A 3RFRA 4GMEA 5E2VH 5CJOH 2Y5SA 1GPOL 5C0ND 1KRCC 1DBKL 2UZXA 2WWOA 4PRID 1PF3A 5D8ZA 2IXQA 1TOXA 3U4BH 2J8UA 1F6YA 2BOBB 3OQ3B 3PXHA 3KGTA 4KHTH 4MMZB 3B9OA 3IGLA 1TWWA 1M7IA 2HFTA 2YLAA 3B9DA 1YDYA 1HKIA 1GY1A 1JVOA 5F6IB 1SJCA 2H3BA 2C8NA 5DC9B 3H6JA 1RLBA 4KRZA 1KFLA 2FTAA 5AD0B 3MRGA 4XMWA 4FX6M 5DT1H 3I02B 4CN1A 1V6UA 3L3KA 4G71B 2A1YA 1ZA3B 3LPGA 4W86A 2H1PH 3HCVA 4GG9A 3I7QA 4WFFD 4H83A 1I1YA 4BWLC 4KUZH 2WNWA 2E3ZA 1KBGH 4UV4H 3SGEH 2XA8L 4Q4OA 5E4EB 3K91A 2BINA 2WXRA 4GUJA 5A1AA 1MH5B 5GZND 1YEYA 3K8KA 1FUNA 2VDNH 1AR1B 3HHSB 4G6JL 1YZZA 2ABAA 3NP3A 4MQXD 4NQDE 1NCOA 1J10A 1QD0A 4X6CB 1S9KC 3L1OL 1VPYA 4Q4EA 3C6SB 1KLYA 2A79A 3MP4A 5HK4A 1LDSA 1HZLA 3HS0B 5AYQA 3QTGA 2X87A 4G9FA 1PO9A 4H8HA 1HHHB 3LZLA 4I90A 4FQQA 1RK1A 2FLIA 4N5EC 1E70M 1SJXA 3QQ3A 2GTZA 3SDAA 4OCYH 3O9WB 2X9YA 4HB7A 3SUSA 1BWWA 4UWMA 2XN0A 1X7FA 4HTYA 4HYRA 4WJ8A 2WSYA 2C3WA 5G55A 2RUSA 4C65A 5INDA 5CILL 1A80A 4HMEA 1DBAH 4UTAH 4H26A 4K0OA 1I8KA 1BVNT 3ZL1A 1ADSA 3SBQA 1DQQA 4TUJB 3NJLA 1IYXA 3ALGA 1EZWA 2XWJB 1U93B 3AHTA 1PB0A 1OZMA 4GBDA 2WSKA 4L9XA 4YSQA 4LU0A 3GH5A 1S9WA 4CNOA 1FZJB 1JWMB 3N1MC 4JRXD 4N0CC 4Z3JA 4MWAD 2HLFD 3BP7A 4YFLF 3AYRA 2CW6A 3LG3A 3P77B 2PS2A 1NWRA 1F4XL 2OX5B 4X60A 1WHOA 1NC2D 3NSJA 1Q3NA 3HZMA 3PU7A 4BFKA 4EIUA 2IFFL 3MJ8B 4WKFA 2Z6IA 3ULAB 1W0WA 4XCCL 5IJBC 2XIMA 5J3HD 1XEUA 1OIOA 1GC1C 2I7OA 3CLEL 2RKXA 4Z3EA 4HK0B 5B3SB 3BYYA 3ITTA 1B9BA 1CYWA 2X4UA 3G1YA 4PJ5A 5FF6B 1LEIB 3EYPA 2KT6A 4JY9A 4C54A 4YS1A 1OAQL 5HJBA 4HU4A 4PR5B 3AZTA 1P48A 4X2UA 1CYGA 2QZQA 3V6ZA 2ZXCA 5C0CE 3RGVD 1TEFA 2BB0A 4U1LA 3MSRA 2Y7LA 4OLZH 1MI5B 5TH2A 1P7KA 2YS4A 4A7GF 5JVLA 1GGBL 2E7LC 1KB5A 4DGYH 4ZMTA 4AD1A 1FIGL 4IMAA 2OELA 1ZAIA 4NZCA 1DUYA 3STLB 1PDKA 2HRPL 3D09A 5TQ2H 5I07A 3B5HA 4F3FB 3RCNA 1CZ1A 4PMZA 4PJ7F 5F21B 3GS0A 3SZ6A 3Q3GA 4FXGA 4GRSA 5CD3A 1BYPA 1KR1A 3OJVC 1IM9A 4QO1A 2PPEA 4X8JA 1O6TA 1RVKA 3P69A 2JXMB 3VKKA 5JMOC 1M6OA 2PWHA 4OB5H 1POJA 5I00A 1G7QB 3F4VA 3VFUA 3T8MA 1PMYA 3FX4A 3PWUB 2ACRA 4GISA 1JZ3A 3F6IA 3N13A 4MJ5A 4R3SB 3F4CA 4POZD 4XXCA 6REQB 3RGTA 3H9ZA 2OQJA 4MS8D 2DM2A 1PKQB 4Z0SA 2NXZC 1C8XA 4HSQA 5HD8D 5DHVH 5DRCA 3AYSA 4H8WH 3FU5A 1J5DA 1YKWA 1BQHA 4XUYA 3SPGA 4LPWA 4AV0A 1URLA 3KHJA 2E4FA 4RMBA 1T1ZB 1Y5XA 4JS3A 4XZBA 2XRAL 1E3XA 4RPQA 5IBLC 1FV1A 5KSBF 5AVTB 1IJ9A 3UYOD 3KLAB 4O4VA 5CJXC 4XVTH 4P2OC 2PTTB 2DQTH 1LEKA 4IK6A 4MWFB 1HHJA 5XIAA 5KVFE 3IIVA 1AD9B 3DUSA 2VLLB 1XIWD 4M1GH 1TYGA 1P69B 1DQIA 4O18A 2V3GA 2X1PA 1QVBA 5KYWA 3BZ4B 2XACC 4PJ6A 5SX4H 1JNNL 1A5UA 5T3ZH 1FFTB 4MMYA 2YKLH 4EN3A 5FWRA 4QHUA 4L3EA 4UQ2A 2GGHA 2COVD 4KQ0A 2Y7DA 3ARDB 1J0HA 4FZ8L 2EYRB 3HIZA 4YXKL 5EU3A 4YTUA 1I1AB 1A3QA 2GC4C 4QTIL 2AXGA 1QMLA 4LLUB 3U2JA 1LRTA 8RUCA 1INEH 1MHPH 4L0PB 1E43A 2BSSB 3NL3A 4WNSA 1R38A 3UXDA 3KWTA 4XP5L 5AHIA 1U8KB 2C0HA 3MJ7B 2BRQA 4JHUA 3ZGIA 4IBYA 1N8WA 2HJLB 4WDWA 4JQVC 2ZZ3A 3BH4A 3R13A 4MS6A 3R79A 1A7NH 3Q05A 1T66D 4OM1L 1F2XK 4ZO8A 1ZLUK 4XMKL 1NF7A 2HKHL 4JDYA 4O9HL 2DQFA 4JO8A 4GVGA 4G1MA 2XQYA 2ADIB 3SKOB 3V4LA 3VXPA 3VXGA 4ZX3A 1JK8A 2W9DL 4JHVA 4PRIA 2HNHA 4X6CF 1JZ6A 1T0OA 2YSWA 4DVRL 5DC0A 4OD1L 4PGEB 4UZGA 3K1GA 1UVQA 2PC4A 1JJKA 1VLXA 3D34A 4EVNA 3BUQA 2VXTL 1ISXA 4Z5RB 5FK9B 1EDGA 5IHUL 2Q3XA 1MIEL 4PJHB 2FTYA 1X9RA 3AY4C 4JPKL 1YY8A 1N4XL 1TTAA 1KCZA 4L3CA 2HX9A 3VX1A 3EWDA 1W8GA 2GK0A 3FQXA 1PBYA 1F07A 4Y4KB 3UO1H 4PR4A 4NRSA 3ZZ1A 4QY8A 3QG7H 4UTAA 3FQNA 1OAXL 4S2CA 2BIIA 4LOVA 2PDYA 3QVQA 2O30A 3MC5A 1CE1H 3AHXA 2NQ9A 2C1OA 4D8OA 4U1MA 1XIHA 2HT4C 2GDVA 1AD0A 5GGQL 2ACSA 4LYRA 3NO3A 1ETZA 5GZNA 4Y16C 2R2HB 3EPMA 5JW3H 4KV5E 2YD7A 1QPKA 3ZM8A 4ALAL 2X1TA 4ZFZB 2B7QA 2KQMA 2F58L 4S3KA 3CTLA 1R3IH 3ME0A 4PYGA 5AOMA 1B3VA 4JVUA 4HUUA 3GTTA 4H20H 5DMIL 3BRDA 3P11H 4NT6B 3QJRB 1TNMA 3WN5C 4CVXA 1PDYA 5HJ3B 2ZCHH 5MP6L 3ZVIA 3NVTA 4KDVA 2W59A 2XG5B 3CX5J 1HWHB 3ETSA 3PUEA 4PW4A 4F57L 1IQWH 1G7UA 4B4HA 3P4OB 3VD1A 2DU2A 5HYJB 3DXAD 3WKNA 3VRJB 3OWRA 2GCYA 1BQSA 1AR2A 3FTUA 5IQ9B 1KM5A 3E6FA 1H15A 2Y24A 2R2EB 5FKPA 5F2FA 1C5DA 3RX4A 4NQED 1ELSA 4AIOA 2HKFH 2Q86A 4TUOB 1EJSC 1HFUA 4HULB 3QFDB 1XLHA 4ELMF 1A8ZA 5F9OH 2ZP8A 4JTKA 5JHDB 1RPKA 2AL2A 1BYNA 2CLOA 1U8NB 4OF5A 5ELIA 4BF7A 4JRXA 4IFRA 3ZY7A 2A73A 3QPZA 4ENLA 2LT9A 4MWAA 3CIWA 1N6QL 1EAQA 3OX8B 3WLBA 2XBZA 4QKTA 3WFBH 3T0EB 3D0VB 3CU2A 5D96B 3MLVL 1T4KA 4IMKC 1NC2A 5K9CA 3S5LA 3QJUB 4LNRB 1RAKA 3HGJA 2B14A 1MZHA 2BFGA 2BSTB 3MZ2A 1MNUL 2EGZA 4IBTA 4KFPA 1C93A 3PFRA 5J8LA 4JR5A 5FUZH 2FR4B 3ITGA 5IGXL 5DJ8A 4ODWB 5D7IE 3FEQA 1VPOH 3VGBA 3PK7A 7CGTA 5I78A 5CJNA 5TDPB 2EDBA 1HESA 4R6UA 5AC7A 4LNYA 4WHCA 5DHVA 2CLLA 1ZKAA 4PWJA 1US0A 3E0FA 5F1SA 3W84A 4A2GA 3RGVA 2B8OT 4KC3B 2PUQT 4AIZA 4UQ3A 4AXWB 3RU6A 2Y06H 5FCUL 4XO8A 4RDZA 2CLVA 5DFAA 4HCRH 4DZBB 2AXWA 1VH7A 3S2AA 1OEPA 4UIKL 4N68A 4U05A 2X0HA 3VQ1C 4OZGE 3SGDI 4AGLA 5FM8A 4I5UA 4JEJA 2FBOJ 3V5DB 1EZVX 4NX0A 1Z9NA 1SMOA 1KLGA 1JHTB 2HUEA 1S39A 3APDA 3F3HA 1ROCA 3IJYB 3DTXA 3O6AA 2A9MH 1W9UA 1TG8A 3IDUA 3N1FC 5HYSA 1QSVA 2CHWA 1NGYB 3E5BA 3UC2A 4JIEA 2FGWL 1NCHA 1U3HC 3D4YA 1ND0A 1K4HA 3VKDA 1SVDA 4AYDC 4HT1L 3AFLA 3MRQB 5EBLA 4C6EA 1L9QA 1ZK9A 3MGAA 4P2RB 1KENH 4AZUA 4JHWL 1T6BX 2NLYA 1VHPA 4JVPA 3Q2NA 4QHNA 3QF0A 2C3VA 5BXSA 2DAVA 1UD6A 3C5SB 2QDEA 5EFIA 4PRPE 3N5AA 3EEGA 3PTQA 2APSA 3IDNA 3VI3E 1CLYH 3TJLA 3OW1A 2DQEL 4TRPL 3ARGC 1OK6A 1TVBA 4GFTB 3C6LC 5ETUA 3O1NA 4LCCB 2E67A 4OV6F 2A74B 1E4XL 1OO2A 4JB9H 4IGBD 3BV4A 4YYCA 5ESVB 4LALA 3PGDA 2A99A 1WTGT 5D5MA 4P2QE 2OMXA 3KYMB 3HE7D 1MSPA 3O0RH 4JL1A 2E76C 5DJ6A 1JNJA 2VM3A 4GXFA 4NBYB 1JPMA 1XF0A 4KPHL 5DLML 1XIWA 1R7AA 3MRJB 4LSVL 1JD7A 3GM8A 3WH8A 2OJEA 3CWOX 2R7EA 3CDGA 1NCDL 5I18L 3ET9F 3N85L 1G9MC 4NDMA 2J57A 1SN0A 4EVZA 1PX4A 5I1IL 3HB3C 2CWXA 3FTGA 2JKLA 3PG8A 4PJHF 1FDLL 4ADGA 5IOPB 5D8WA 4O10A 1LRQA 1EO5A 3GSUB 4TSCH 2DJLA 4JL2A 1A47A 2Y7EA 5KBNC 3CHPA 4LIQH 4EP8C 4Y19E 2FJGA 4B3LA 1NJ9A 5D9NA 3HNSL 3VIHA 3N1PC 2ZIDA 2EE6A 2Y2WA 4ANXA 1XZ0A 4FXKC 2EUVA 3G1AA 5BOPA 5GRJL 1H3TA 2AAMA 1E51A 4E41E 4GO9A 4C6KA 3H2QA 2PR4H 2INZA 2KX9A 1ZT7A 5ALCH 5CBEB 4C56E 1AGBA 4UINH 5EWIL 5DO2D 1CGUA 2ZPKH 3FONB 1GCFA 3L1GA 5C08B 3W7CA 3HAEB 3TWBA 4QWWD 1G6RH 1MHEA 4ZAKD 4YDKH 5FF0A 1D6EA 4O12A 2FGBA 5D4HA 3M7SA 4J4PC 2AOSA 3OR6A 4FP1A 1S7XB 1DUZA 3VXTB 1GKEA 3IDJA 1MVUB 4XBKA 1MFAL 1C5BL 3MYOA 3N11A 3BIBX 2LE9A 1ZIBA 3WV0A 4A66A 5C0RH 4QHMB 4DYEA 4MJ4A 5IMMA 4REQB 3HMCA 5KZMA 3HVDA 3C60B 3KEHA 5KVEE 4AHPA 3WENA 2BGNE 1K9DA 5I16B 3WO8A 3TURA 3MX0B 1B0IA 3VIOA 2WSQA 1WPCA 3B3IA 1KTJA 1XRSA 4LBUA 5E00A 2EDWA 2Z91B 3GMRB 2YBUA 1Z2KA 1QFHA 3CCHA 1LO5A 4K5NA 2A6DA 2IPKB 3DMMB 5I30H 3UTSB 1DQLH 4C6FA 5I1KL 3AS0A 4M62H 1GOGA 2R0ZH 3CFMA 3N17A 2PDXA 1MFBH 4Q2ZB 2OB3A 5BMFH 4DZ8B 3WKPA 2Y7FA 1CJYA 1PCWA 1A7QH 3G6JA 4JMXA 3SURA 1WFMA 4CNIA 4AYBA 2YXXA 1UP0A 3SW6A 3A0OA 3V5CA 3T2NL 3LDBC 2G3ZA 1EO8L 3WIIL 3PIQA 4PJEE 1V8EA 3D0CA 3FGCB 3ITLA 3WMBA 1BF8A 3VXME 4LGRB 5F88A 6PAZA 1E3ZA 4M1BA 4ROPA 1IEIA 1JPFA 3B0XA 1SOKA 1NFBA 3DXAA 3WKMH 2VXQL 1W72B 4E0RA 4NQEA 5D7KD 4PJAE 1E55A 1F4AA 1ZXKA 3VD4A 3VNYA 2WUBH 4YS4A 3SGUA 2OTPA 3EXLA 1UMYA 5K2ZA 4HKXA 3HNVL 4HCRA 2Y1ZA 2B59B 2J4WH 2Q8XA 5ECVA 1QUNA 3N1GC 3AU1A 3DV6B 2E6PA 1X9LA 3VC5A 3GJEA 3MLZL 1P7QD 3L9BA 2WYIA 5FV2A 4E4FA 2DWEB 1G9MH 1M53A 3CV1A 3MXWL 2V30A 4XISA 2H2SD 4XHJC 2K4WA 5EL1A 1PFCA 2DY2A 3WQDA 2QLVB 1IVLA 4LANA 3ILQD 3KPMB 1DLHB 4G6MH 5DJXB 5HMEA 5MI0C 3SDOA 1R1CA 3O6KH 1H7XA 1UWTA 1QTWA 4LLMA 4YFDB 2A77H 2YL5A 4IS6B 4UIMA 2AK4D 1ZTMA 2AABL 3BAJA 5CGMA 3P8JA 5E51A 1BVLA 1AH4A 4XZLX 1H50A 2O26U 2WHKA 1FZMB 2ZXGA 6ALDA 5LXEA 3LS5L 5JDSA 4K3EL 1D7DA 4U1SA 2YB1A 1PPIA 5C6WH 5EEZA 1FLRL 4D9LL 3ZE2E 1K3UA 1BOGB 5C0GA 2CO7B 3DSNA 4A55A 1K72A 2NY1B 3ZKXB 1QEXA 4EK7A 1PFOA 1YNQA 1M01A 2BRRL 2QTEA 1KFJA 4JY5L 5JTWA 2JJWA 1NVMA 2VDOB 4IIGA 3LNGA 1ZT1B 4UU9A 5GJSH 4JJ5B 4KVCL 1G1KA 1G0XA 4X9GA 4Y5XB 3LD8B 3SGDH 2JI1A 1CC3A 4P5KA 3LV6A 3S48A 4A7QA 3HZKA 2H26A 4PZVA 5FYKD 2EEDA 3LD5A 1WS8A 5E99H 1EERB 2PDIA 1HAWA 1KPUB 1P1MA 3K0YA 3F7JA 3SGGA 1AMXA 2UY4A 3HFYA 4HUKB 3RPBA 3W6MA 3BQUB 3JV5A 4OF6A 3OMAB 4ENEC 3FT4B 1ZDSA 2UY7A 3PDOA 3UZQB 3UYIA 3QZPA 3FUFA 4CMHB 2ZONA 2GVJA 1G4SA 4Y5YB 1R3QA 5IMOA 3RYMA 2F53D 3KFTA 2UV3A 3MLXL 4HPHA 3VE9A 3NQDA 3ES6B 4IGBA 4B9KC 3R8RA 3QUKA 5CC6A 3MRDA 3HE7A 3BKCL 4XNMB 2XHYA 1D5MB 4W7UA 3A4EA 1WZLA 1GS7A 2ZFAA 4XBEH 1MUJB 2IV9A 2OR8A 3MRHB 5HI5D 4R26H 1TJHL 4ZQTA 3HZ3A 2VZOA 3SYAA 4WJ5B 1XGRA 3C5ZC 4YPJA 4HJFA 2R56L 1T3FB 4ZS6D 4HPXA 3GW3A 3MLSH 1KGXA 3V0WL 3GIYA 1QSFB 2FJFB 5FYKH 2GPTA 4LAJH 1L0QA 2DQIL 1DLFH 3P84A 3MSDA 1FBIH 5D9SA 4QR7A 1P7TA 2Q2LA 2JH2A 3SB0A 2E27H 2HFFB 1JDDA 3S3DB 3JV4A 1QBML 4OV9A 3WQGA 3VWKB 1VAHA 1DIOA 1GRWA 2IAMB 3D12B 1E56A 4S1SL 4FALA 1QNVA 4D0BA 3CMJA 3IVKA 3ALPA 4QOKB 2AZUA 5HHNA 4NPKA 3VGAB 3DUGA 3UT0A 1XGUA 4XGZA 1J9RA 1R33A 3O3RA 2C3GA 4LCWB 5FYJD 3BZDA 2PCQA 2V3EA 1TA3B 2VLJD 2EDEA 3S35H 2HB0A 5M17A 2WQPA 1OF6A 4JFFB 1CK0L 1PG7X 5I26A 4PY7B 3IVUA 1IF2A 4PP2A 1T7XA 4WZ9A 2OLAA 4L1SA 4FABH 2ZOXA 3TNBA 2XG4B 4GQ9H 2VUYA 3CZNA 4PCPA 2IGFH 4N8UA 2COQA 4HSAC 5AVWB 1AQHA 4ANVA 4F0KA 3DJTA 4ZAKA 4LEOB 5E8NB 4PQXA 3GS6A 2C14A 4MB1A 1MEXH 4H3DA 2CKBH 1RZ7L 3DGDA 1H5BA 2AJZB 2HP4A 3H70A 3MFGB 3FFOA 5EA0L 1JGLL 2WCAA 4R7NB 1ED3B 4L5FH 1LL7A 1A14H 4XZUB 4UFIA 3KJ4B 3WJWA 4LRNH 1AYOA 3D2UD 1W2PA 4E9XA 5B7FA 1AGEA 1KFBA 4GZJA 5DUMH 5EEYA 4POYA 1CB2A 3K71B 2XKUA 1EJXC 3N9GL 1EV2E 1KNWA 1EFXD 4F7EA 5AW9B 1MLBA 2IH8A 4BKLB 4HXAL 3UXKA 3FTSA 1ITBB 5HMSA 5FYJH 4U31A 5JXQA 2OR9H 4G6FB 1QXLA 2X9ZA 3O6FD 2ITDA 4QNPF