4UQDA

X-ray structure of glucuronoxylan-xylanohydrolase (xyn30a) from clostridium thermocellum at 1.25 a resolution
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
390
structure length
390
Chain Sequence
HMASATINLSAEKQVIRGFGGMNHPVWISDLTPQQRDTAFGNGEGQLGFTILRIHVDENRNNWSKEVATARRAIELGAIVSASPWNPPSNMVETFTRNGVPNQKRLRYDKYGDYVQHLNDFVAYMKSNGVDLYAISVQNEPDYAHEWTWWTPQEMLRFMRDYAGQINCRVMAPESFQYLKNMSDPILNDPQALANLDILGAHFYGTTVNNMPYPLFEQKGAGKELWMTEVYVPNSDSNSADRWPEALEVAHNMHNALVEGNFQAYVWWYIRRSYGPMKEDGTISKRGYMMAHYSKFVRPGYVRVDATKNPTYNVYLSACKNKKDNSVVAVVINKSTEAKTINISVPGTSIRKWERYVTTGSKNLRKESDINASGTTFQVTLEPQSVTTFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CARBOHYDRATE BINDING FAMILY 6
publication title Conservation in the Mechanism of Glucuronoxylan Hydrolysis Revealed by the Structure of Glucuronoxylan Xylano-Hydrolase (Ctxyn30A) from Clostridium Thermocellum
pubmed doi rcsb
source organism Ruminiclostridium thermocellum
molecule tags Hydrolase
total genus 138
structure length 390
sequence length 390
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uqdA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uqdA02
4BQ3A 5E70A 4CD4A 3WSUA 3CZ8A 3W6LA 4U31A 3L4WA 1EQPA 3WENA 1KR1A 3WFLA 3GYCA 2J7CA 2VCAA 3L4VA 2OWWA 2VVSA 5AYIA 3A21A 1MW2A 2YLLA 1PX8A 4LYRA 1LJYA 1DTUA 4FLOA 3ZT6A 3ARQA 8A3HA 2CBIA 4WSKA 1X1NA 3AIQA 4HA1A 1E6NA 1OD0A 4WKAA 1UD8A 1W9VA 1GZJA 1GOWA 4UOQA 4ATLA 2E9MA 2X0YA 5A8PA 3POHA 1KR0A 1L8NA 2XGBA 4AXNA 3OLDA 4FLQA 3VO0A 3VGEA 3AZTA 1FH9A 3SURA 3UR7A 1LLOA 1OIMA 5I78A 3II1A 4HOXA 1VIWA 4AD0A 1OBAA 3WH7A 2V3DA 1R86A 3ZQ9A 3AHTA 3RCNA 3VIMA 1GOIA 1EA9C 4ACZA 2PI6A 1HXKA 5FCZA 3BGAA 3GXFA 2DT2A 1E15A 4AZBA 5A8MA 4J3SA 1P6WA 2J47A 4DM2A 2CBUA 5A6BD 4PMNA 1KQYA 4IISA 1C8QA 1Q6EA 1RP8A 1QBAA 4U3AA 1UWTA 1HL9A 1QNQA 4B9ZA 1H49A 2PC8A 3MMUA 5I6SA 3B9AA 3OG2A 4JFVA 3MANA 2JEQA 4H7VA 2FGZA 3K8KA 2BY0A 3RIKA 3GDBA 3VMPA 2PWFA 4ZE4A 4PMRA 4MB3A 1US3A 4AY1A 1JI1A 2ZUWA 2XUCA 1N82A 1BGGA 1BVZA 4QP0A 3ZOAA 5HDRA 4QCFA 3A6OA 1WDRA 4DO4A 4M80A 2X2YA 2GJRA 1NOWA 3WBAA 4Y7EA 2EADA 2DEPA 1ISYA 4CVWA 3OLIA 3N04A 2ZUUA 3CZGA 3TTOA 4JAWA 2BHZA 3W6MA 3VM7A 3NJ3A 4F79A 3CLWA 3BVUA 3E1F1 2EO7A 4J28A 1MQRA 1E4MM 3AIUA 3AMDA 2OWXA 4UCFA 5CPSA 4LYQA 1HWWA 5CXPA 4XV0A 1PEZA 3A4AA 4UQDA 3WF0A 1C90A 4FNPA 1JI2A 1G0CA 4FNRA 3DDGA 4MNMA 4D6GA 1MQPA 1GQJA 1UR8A 2PF0A 1NOFA 2XFFA 5IXEA 5D9MA 2GJXB 2XJ7A 1VENA 1E70M 1CENA 3BVTA 1V6UA 3SUVA 1H41A 1DWGM 1TA3B 4F8XA 3AXIA 4AD3A 4ATWA 4HU0A 3B8SA 4BQ5A 4LQ1A 1CGWA 4OZOA 3RJXA 1W9UA 5FOOA 2GSJA 6A3HA 4ZE5A 2J62A 1E3XA 2CKRA 2FDMA 4FMVA 1VFMA 3B9EA 4NZFA 3HG5A 4WLCA 1XSIA 2CHNA 5FL0A 3CGTA 5E0CA 3LX9A 1UOKA 3IJ9A 3WL1A 2AOSA 4CN6A 2JF7A 3FXYA 3OBAA 1O6IA 4R5EA 4ZEPA 3W81A 2D73A 4L4OA 3AISA 1JDAA 4N42A 4D6CA 1UASA 1V08A 1WKYA 1XH0A 2OSXA 1E0WA 1JYXA 1G9HA 1ECEA 3NCOA 1C7TA 4JFUA 3SUUA 2OLHA 5LA1A 3N11A 1MXGA 3M6DA 3VIPA 3T08A 3HU7A 3VDAA 3EMCA 4U2YA 1M03A 2BVTA 2EEXA 2AAAA 3W29A 1PX3A 5A6AA 3U7BA 2WZIA 3AZSA 3CHDA 3LPOA 1R46A 4WK9A 3KL3A 1UH2A 5JIPA 4BA0A 1V3LA 5M03A 2ZUSA 3MKKA 3BSHA 4UQCA 5HOSA 3WNLA 1W1YA 2EABA 3LRLA 3AHYA 3ARUA 1QVBA 1OM0A 3GH7A 1R7OA 3UERA 3H54A 5GQBA 4KWUA 3M46A 2W62A 3GXMA 4QLLA 4Q7NA 3BAIA 1JYVA 4UOJA 4GQRA 4M81A 5HNNA 4W93A 1UKTA 2DH3A 3GXIA 1FHLA 4JFSA 2JE8A 3VNYA 5ABFA 1WNOA 3VX1A 1AQHA 3MUY1 4HA4A 2D3LA 1HKMA 1XH2A 1V3KA 4PN2A 2J7DA 4ZENA 1RP9A 1UWSA 4Z2GA 2OSYA 2D3NA 3GBDA 2IXVA 4AD1A 4OGZA 1EO5A 1DHKA 1XCXA 1ITCA 3EJSA 3SCQA 3VD3A 1JD9A 3WELA 4UFJA 1Q6CA 1JXJA 2X09A 3U5YA 2OYMA 3FHQA 4JL2A 3HZ3A 1HNYA 4GZEA 3QOKA 3PBGA 1M7XA 3AYRA 4AIUA 1HXJA 1C92A 2ALWA 3LPGA 1LG1A 1R47A 4IPLA 3L2MA 4FNQA 1UKPA 1NWUA 3MSDA 2D0FA 1B30A 4E8DA 5A1AA 3ZSSA 2YA2A 1JNDA 1W91A 2VX4A 1H5VA 4IPNB 1FH8A 4A4AA 1VB9A 2XVLA 2WW5A 3W38A 1OT2A 3CC1A 1D3CA 3VIKA 3CTTA 1TQTA 2XIIA 5CG0A 4WKHA 2ZUVA 4CD8A 4TXEA 1EOMA 1E40A 2DDXA 4J3VA 3VKKA 2YLAA 1TE1A 1B3VA 4CD6A 1C8YA 3DX3A 3EJTA 1VJZA 4CD7A 1JZ7A 3HJEA 1E4IA 5D9PA 2EQDA 1K6AA 3ZJ8A 4BF7A 2PWHA 1UH4A 4OUEA 1GQLA 2BHYA 1PAMA 1OIFA 3VIGA 2WVVA 4HMDA 1ITXA 2ZXQA 3MS8A 1TVPA 1W1PA 3QHNA 1A3HA 3NDYA 3WMCA 4BQ4A 4J3UA 3BLBA 5BXRA 1UR1A 1Q6GA 3VD4A 3U5UA 4BQ2A 3FW6A 1H4PA 4PMQA 1B31A 4MJ4A 5EFFA 2YL8A 4CD5A 1ZBWA 2WVUA 3EJQA 2VQTA 5I2UA 1VF8A 2IXUA 1CLVA 1V0KA 3CH9A 5I0DA 4JKKA 1MWOA 1XSKA 5GNZA 4JCMA 1E6XM 4IM4A 4WIWA 3WUEA 4IUGA 2VZOA 2CPUA 1UWUA 2WMIB 5DMYA 1K9FA 4CKQA 1T0OA 2VMFA 1CNVA 1HJSA 4NSBA 1TQVA 3WNKA 2G41A 2G3MA 2WLYA 3UEQA 3QOMA 4PMUA 3WF2A 5M5DA 3RO8A 3T2QA 3WF4A 4WF7A 3VVGA 4MNLA 4MJ2A 3W4RA 4NXSA 3BUDA 2XYLA 1UD5A 1CXIA 3TV8A 2CEQA 3WDPP 3AMCA 3WF3A 1IZKA 3BC9A 2JIEA 3LXCA 1B3YA 6TAAA 3AS0A 3WFZA 1BYDA 1E72M 5D8ZA 2E4TA 5A6JA 4GQQA 1J12A 3OB8A 1CPUA 3CZJA 4MDOA 2EPLX 4UFHA 1E6QM 4TVDA 2A3HA 3OGVA 4MNKA 3VSVA 4J3TA 4TX6A 3ZJKA 1LG2A 1H0GA 3N13A 5LYRA 1I1XA 3BVWA 5DEZA 4W88A 3WKZA 3T0DA 1ZL1A 2VO5A 4EK7A 2X2IA 1W1TA 1WP6A 1MW3A 4M29A 5JBFA 3CHEA 3SUWA 1JFXA 3A23A 4S3JA 1J0IA 2YKKA 2NSXA 1EHNA 4HOWA 1B9ZA 2VT0A 1GVIA 1QW9A 1UZ4A 1KB3A 1E55A 1OCQA 3SCSA 1ZBCA 4PTVA 1B1YA 3L4TA 1JAEA 3UG4A 2WZHA 1BF2A 1HJVA 1QHZA 3CUGA 2GDVA 2ZWYA 2J7BA 3BVVA 3CZSA 1ZB5A 4TTGA 2XVKA 2BY2A 1W3KA 2FHCA 1UA3A 1DWFM 1HIZA 4JL1A 3MI6A 1JZ3A 3THDA 3TTSA 4GI8A 3DYOA 1VEPA 3HG4A 3VGGA 1QWUA 2GJXA 3A22A 2A3AA 5BROA 2WCAA 1PPIA 4JFTA 4AYSA 1GONA 1TA3A 3BSGA 4D72A 5CSUA 4CVUA 1HP5A 3FHAA 1E1FA 4MADA 1O7DC 1VEOA 3GNRA 1NOUA 2E0PA 4TTUA 1CXLA 4EAMA 3ZSTA 1HN1A 2QPUA 3SCNA 3PZGA 2XWDA 5A94A 5CZKA 2J7GA 1UQZA 1U33A 4D6FA 1G94A 3WL0A 4U5KA 3WUFA 1R75A 1WZKA 1RH9A 3T0BA 4FNUA 1V6YA 2W4XA 1KQZA 1BSIA 2XGIA 3SUTA 5JBDA 4QDMA 2A3BA 1KXQA 4AZ5A 3OZPA 3MUIA 4UNIA 3POCA 2VCCA 4QLKA 3WH8A 5IDIA 2J7EA 1QNOA 1ESWA 1WDSA 1X6LA 3T0AA 3OGRA 1V0NA 2WMFA 3THCA 2BY1A 2VC9A 2CBVA 3F5KA 3NIYA 3O6AA 3OGSA 4NZCA 4HZ8A 2YFOA 3W53A 4UFIA 1ISZA 3RDKA 4J27A 1VRXA 1V0LA 3NUKA 1HP4A 1WAWA 2DQXA 2CETA 4NRSA 3AOFA 3LRKA 2ZXDA 3LPFA 2D0GA 3L4ZA 2WCSA 1LF1A 2UY3A 3I3BA 4P7NA 3BAXA 1VJSA 1ISWA 3WQVA 2WSPA 2X0HA 3DHPA 1GUVA 4U33A 3D51A 1GHSA 1MW1A 2XIBA 4AIEA 1BQCA 3DX2A 4RL3A 2FHFA 3EYPA 1PS3A 2C0HA 3CMGA 2WBKA 1ISVA 2JEPA 4NX0A 5A69A 1DWIM 1BVNP 4BZYA 2VX7A 4DUWA 4LYPA 4MNJA 5IFPA 4FF5A 1FOBA 4PRWA 3MMDA 1WO2A 2V3FA 1QX1A 3DYPA 2ZUNA 1TMQA 4P7OA 1W9BM 3CMJA 1TQSA 5JUVA 2X2JA 2VTFA 3PTKA 2BNJA 1UZ1A 1QNSA 7CGTA 1FHDA 3APGA 2WNWA 5E1QA 3ZR5A 1KBKA 2NT1A 1EXPA 4V28A 1QPKA 1BHGA 5A2AA 2F61A 4NZJA 3O2LA 2MANA 3O9NA 1E6RA 1E6SM 1NP2A 3BAWA 3ARSA 1D2KA 1EQCA 2OW6A 4Z2KA 1KWGA 3PTMA 2J77A 3FNDA 2WSKA 1H2JA 2VX6A 3U7VA 4U3CA 2EBNA 4W5UA 4OJYA 3PZ9A 5CQ1A 2E3ZA 1CXKA 4H04A 3L2LA 1TUXA 5CLWA 2XG9A 3I3EA 4U5IA 4NI3A 1E0XA 1J0JA 4QLJA 1XRVA 2X8RA 1J0HA 1JXKA 4TVUA 5GNXA 3TONA 1RD6A 2PBOA 3VIFA 4AIOA 5I3DA 4LXFA 5BWFA 3TOPA 4D6HA 3ARRA 3BVXA 1R34A 1QHOA 5D9OA 4P8VA 1GOQA 3TA9A 2EJ1A 5IHSA 2E9BA 5CSYA 4Z2JA 3AHZA 4JHOA 1WDPA 8CGTA 4H41A 3S2CA 3FN9A 4WJXA 5LA2A 4HMEA 1XSJA 3WN6A 5BRQA 3SCOA 3WD2A 3GXPA 2ZX5A 3F5LA 4JKMA 4KGJA 4D6IA 4JKLA 3GXTA 3ARPA 3TP4A 1HJQA 3KLLA 1R87A 5AY7A 2ZX8A 3PZNA 2O9TA 1C93A 1FH7A 2FHBA 2WMIA 4ACYA 2YOCA 2Z1SA 1WZAA 4K68A 5JBEA 1SZNA 4AZCB 3WQ8A 4DO5A 4PSPA 3WH9A 1HTYA 1ISXA 1XCWA 4GKLA 1WZLA 2F1BA 3M07A 4DWSA 1HJUA 3CPUA 1D7FA 1E56A 3WD0A 1JZ4A 5E09A 1EDQA 1E5JA 4TX8A 3BCDA 2WC4A 4FLSA 4HTYA 4MAZA 2ZICA 3BAYA 5A6KA 5E6YA 3U57A 2VVNA 4W89A 2DIJA 1BAGA 4M24A 4MB4A 4E4PA 4M56A 3VOCA 3AIVA 3DX0A 5EMYA 4UQAA 2XFRA 1WDQA 4FNSA 2OW7A 2W61A 1JIBA 3PTQA 3QHMA 1DWJM 4B3LA 4BS0A 3WF1A 3D4ZA 1WB0A 1HJXA 3FAWA 5HXMA 2XTKA 1GW1A 3BLPX 4GZJA 3AIBA 3WD4A 1NM9A 1AVAA 4UFLA 3W0KA 1OSEA 3KWXA 3GNOA 1QWNA 1CBGA 3WMBA 4CCCA 1VAHA 2DT3A 4MAVA 5E9AA 1E73M 2Y24A 1MXDA 2GUYA 2WANA 2ZXAA 3D52A 4QAWA 1W2VA 2W92A 5M3WA 4AMCA 2WKGA 2YDSA 2EPNA 2Y8KA 2HISA 4XX6A 3PZOA 4HMCA 4NF7A 1BLIA 2HVMA 2QF8A 3BUQA 1UD2A 1U30A 4WKFA 4W8AA 3RM9A 4NXKA 1LQ0A 1BFNA 5ECUA 1GHRA 4YHGA 4QCEA 4CGTA 3J7HA 2D22A 1CGYA 4F66A 1W3LA 1CEOA 2WWDA 3SCTA 5A6LA 3AZRA 2WPGA 2NT0A 2XHYA 1E5NA 1JZ8A 1R33A 3G6LA 2EPMX 4YHEA 4CN1A 4W87A 3UCQA 1AMYA 3CUJA 1JYWA 4OKDA 2PBGA 5DFAA 4HU8A 1B0IA 5AC5A 1WE5A 1Z32X 1KTBA 4XZWA 3CZNA 2GK1A 1V6XA 1YQ2A 2WHKA 3CHCA 2WLZA 3WH6A 4JFWA 4N0RA 1MW0A 3S6TA 3ECQA 3ZM8A 2X2HA 3AHVA 5EBAA 4MB5A 4DWSC 4GZIA 2E8YA 3HG3A 2QV4A 1IT0A 2GVYA 1LL4A 2V38A 2GDUA 3RMEA 3VNZA 2JALA 2ZX7A 1UHVA 2EACA 4LGXA 2G8ZA 4D6DA 2YA0A 2VJXA 2XPKA 3NSMA 4AZGA 1UKQA 2YJQA 2F18A 5ABGA 4D1JA 3NYDA 4J7RA 2FGLA 3N9KA 3IK2A 1E4NA 1W9DM 2XM2A 1OB0A 1CXHA 3K8LA 1ZJBA 4LPCA 1MFVA 1V3IA 4PUEA 1XYFA 3N18A 3ALFA 1A47A 2VOTA 2YDRA 3AI0A 1KTCA 1EO7A 2CXGA 3PZUA 4H8VA 3W37A 4M1RA 1XYZA 5IHRA 2FH6A 3JUGA 5GPRA 1ZBVA 2VZVA 3ZIZA 2GJPA 2QLYA 2FYVA 1EIBA 1V6WA 3N17A 1GJWA 3WUGA 3KE0A 5A3HA 3TTQA 4PCSA 2F8QA 2XFYA 3I3DA 2O92A 2W63A 4JCLA 2F2HA 1AQ0A 1UG6A 4EKJA 4DUXA 4QFUA 3PZQA 3GTNA 4X0VA 2E9LA 3IJ8A 1SFSA 2ZOXA 2W67A 1ZU8A 1Q6FA 2C7FA 1B90A 1CGTA 1E6PA 3MUAA 4KRTA 2V3EA 1UUQA 1V3JA 2WBGA 1MVYA 3ARXA 1TVNA 3WDJA 5FD0A 1QNRA 4E2OA 1SMDA 1HX0A 3ARYA 3BMVA 1Q4NX 1GOKA 3VD7A 2Y8VA 4H2CA 2XN1A 1QI4A 4PYSA 2RGMA 2RGLA 2WC3A 3VDCA 2CIPA 5A2CA 3S5YA 3VSUA 1BGAA 4RE2A 4KMQA 3VIOA 2FE0A 3EBVA 1J9YA 3BH4A 3WY3A 3CUFA 3WNPA 1J11A 3VUPA 2QMJA 5FKYA 3T2PA 1M53A 1ZS2A 2X05A 1V6VA 1E1EA 4E8CA 1KWKA 4H8HA 1J0ZA 2YL9A 1QNPA 3W82A 3SCPA 4P7LA 2QHAA 1JZ2A 3KLKA 3WQ4A 1IV8A 2OWCA 4B9YA 2X1IA 4PEEA 2YBTA 4ZXLA 1EH9A 1CYGA 1GQKA 3WQWA 2VUYA 1ODZA 2DGAA 3OZOA 3EDJA 1OGGA 2CESA 3PZMA 1CXEA 3N1AA 3UG3A 3SCWA 1UWQA 3DX1A 1LL6A 3VU2A 1XH1A 3WQ5A 1WPCA 2IGTA 4KGLA 2ESCA 5E6ZA 2B31A 4OIFA 1WCGA 1OT1A 4AZHA 2AMGA 4UFMA 1LWHA 3EJUA 4W8BA 3K8MA 3IAPA 1UD6A 5GNYA 4GXPA 2CITA 5HPCA 2PWEA 1I1WA 5A8OA 1KGXA 2EPKX 3WDHA 2ZUMA 3ALGA 4PSRA 1TFVA 2CHOA 3GXNA 4HZ6A 2WZEA 1V03A 5D8WA 5A6BA 2WB5A 3A4WA 4FNTA 1UH3A 1E9LA 3M7SA 1KXVA 1UQYA 5D4YA 1C8XA 1QBBA 3RM8A 2CERA 2WYSA 4W7WA 1UWIA 3VDBA 3SCVA 3LMYA 2JF6A 2XVPA 5DO8A 1QI3A 4X0NA 3BLKA 4MDPA 2V3GA 4PMZA 1UKOA 2CBJA 4V27A 3SIMA 2BXZA 2WMJA 4AZ7A 3FY1A 3NSNA 2ZIDA 3A5VA 1GORA 4P7RA 1AQMA 2WVVB 4F9JA 2XVGA 1J01A 1F4HA 4FLRA 4X9YA 3DYMA 1ZJAA 5D9NA 1BYAA 3H55A 2F7QA 2VL4A 1V3MA 1FFQA 1PBGA 2WHLA 1PZ2A 5AC4A 4ATDA 3LXAA 3H53A 4L4PA 1GPFA 5EFDA 1GVYA 4V2XA 1UR2A 4WSJA 4TOQA 5DF0A 4KRUA 1JL8A 4Z2LA 1PIFA 3ZJ7A 3W27A 3BCFA 3T09A 3OLGA 4AD4A 3UESA 1CXFA 1EDGA 5I23A 1TCMA 2UY4A 2F1AA 3SUSA 1JF6A 5A8QA 1V02A 3CBWA 2WKLA 3NDZA 2VCBA 1GQIA 3VSTA 4MB1A 4F9DA 3AQUA 1SYTA 3PZVA 3GBEA 4HP5A 5CJ5A 2XN2A 5BXPA 5HBFA 3D3AA 1GNXA 1QOXA 3F5JA 5I24A 3L4YA 4PTXA 3N12A 1QW8A 4AMXA 1VFOA 3VD5A 2F7RA 2VZSA 2ZWZA 4LX4A 4AEFA 5JIWA 2DSWA 3PZIA 1JDCA 4EANA 2Q8XA 1HF6A 2D2OA 2ZUTA 2J8FA 4W85A 3KL0A 3WIJA 3MSGA 1NP0A 1UKSA 4UQ9A 5ABEA 1XD1A 1DEDA 7TAAA 2WHJA 1NWRA 2WWCA 2D1ZA 3BUIA 2NW0A 4A3YA 1B3ZA 3PN8A 4P8UA 1O7AA 2F7PA 1XD0A 1PJ9A 2Y4SA 3QGVA 1W3HA 2FH8A 1NARA 4M82A 3VM5A 1U2YA 2XN0A 2XVNA 3CHFA 2EXOA 2WAGA 1ODUA 1V02E 2BHUA 4CU8A 3VMNA 4PBGA 2VZTA 3ARZA 1Q6DA 4J3WA 3K1DA 4XB3A 1BTCA 3WMSA 1BPLB 4UQBA 3CO4A 2J7FA 4EE9A 3MU7A 1HVQA 3MUZ1 3AMKA 1R7AA 4PMYA 2DSVA 5EB8A 1BYBA 1H0IA 2GFTA 4Q22A 1QI2A 1J0YA 1YHTA 1HKIA 3D5HA 1JFHA 4PCTA 1LL7A 2XSBA 2W91A 4PMDA 4GPNA 2WM0A 1UR9A 5C70A 5I79A 2W66A 1HJWA 3AIEA 1QHPA 3VIJA 3GH4A 2DPEA 1HVXA 3EMZA 2E8ZA 1EGZA 2BFGA 2CYGA 1JG9A 2J7HA 4GIAA 3CV5A 3RJYA 3K4AA 3VTRA 4AC1X 2J8GA 1M01A 1UR0A 4D6JA 3DECA 3IAQA 5C71A 4RE4A 2EAEA 3GNPA 2J25A 4AD2A 4B16A 4JZ5A 3BMWA 1ZBKA 4UFKA 3MMWA 1B3XA 1KGWA 3BUPA 1CGUA 1H11A 3B9DA 3AXHA 1JGIA 4W84A 1TG7A 1GOOA 1XHGA 3CUHA 3AFBA 3D4YA 3SCUA 4CCEA 2BY3A 1OGSA 4MPKA 1MFUA 7A3HA 3A3HA 5CPQA 1MYRA 3WNMA 3AIWA 1W9XA 2O9PA 2G3NA 2PB1A 1H3GA 3WBEA 3KL5A 3AROA 3UR8A 1GJUA 3EDDA 2XWEA 4DUVA 1OWQA 3WD3A 4TVCA 2EPOA 3LRMA 3WDRA 4UR9A 3ZMRA 5CGMA 3RPMA 5CGTA 3QHOA 2C8NA 4HA3A 1MQQA 1KBBA 2BV9A 1GOMA 5C8BB 1E43A 3RILA 5ABHA 3OIHA 3W26A 1CGXA 1BG9A 3VGDA 1E71M 3AICA 1J10A 2DIEA 2A3CA 3OLEA 1B3WA 2DH2A 1CDGA 3AXXA 1JDDA 1XV8A 2D24A 5DT7A 1H1NA 5FL1A 3ZO9A 2VQUA 2J79A 2VRKA 3UG5A 1OGBA 4C7FA 2YA1A 4W7VA 1FP9A 3VIIA 4MTVA 3BAJA 4PMXA 3VX0A 3CIVA 5FIPA 1CECA 3VIHA 5A95A 1CGVA 3AS2A 2DT0A 3RM4A 4ACZB 2VRQA 2Z1KA 3DX4A 3LXBA 3WEZA 3AS1A 2O9OA 3VILA 1M04A 1C3FA 4PMOA 4PUDA 1XGZA 2BXYA 2D0HA 4URIA 3S5ZA 2D23A 3DDFA 4AZ6A 1UYQA 4CU7A 1X6NA 3AJ7A 1W2PA 4AZIA 2BVDA 5CLTA 2UY2A 1W9PA 2JIWA 1LWJA 1KXHA 1W32A 4XZBA 4DWSD 4HZ7A 4AEEA 4D6EA 4S3KA 3VGFA 1CLXA 3EDEA 3ARTA 4DO6A 2G3IA 4GI9A 4FK9A 3EMQA 2WMHA 3GXDA 2BS9A 4UTFA 2G4FA 1E6ZA 4AD5A 3EDKA 4AW7A 2VRJA 1V0MA 2QPSA 3AYSA 4U2ZA 3L4UA 1G5AA 3AMLA 1JF5A 2J75A 3VD9A 5I77A 4Z2HA 2WXDM 1J0KA 2VI0A 2WVSA 3N15A 2Y5EA 2TAAA 1E3ZA 1G1YA 1BG4A 3EJPA 3ZJ6A 3ARVA 2V5DA 5BCAA 4GO8A 1CZ1A 2CNCA 1TZ7A 2WK2A 1IZJA 1NH6A 2J74A 1CIUA 2J78A 4CU6A 4C7DA 3VGBA 1DWHM 1Y7VA 2Y2WA 2IUZA 3BXWA 3AMGA 3T2OA 5I5RA 1VEMA 1J18A 3ZR6A 4R27A 1VBRA 3ZT5A 5IFTA 1OD8A 5LA0A 4OOZA 3ARWA 2BVYA 4AMWA 3F4VA 3A4XA 2PWDA 3GZAA 4W7UA 2DSKA 2ZX6A 2XSAA 4ZXOA 3SCRA 4CN4A 4P8WA 4RE3A 4P7QA 1C91A 1CWYA 5A6SA 4OOUA 3W28A 3WH5A 2VZUA 1R85A 4GINA 2V5CA 1I75A 3FAXA 3WNOA 2E40A 1UD4A 3VINA 4CUCA 1E0VA 3NSXA 4JIEA 2YL6A 3UETA 1SR0A 3ZT7A 5KEZA 3WQ6A 1TQWA 2CCRA 4P8XA 3VGHA 1XC6A 3IGUA 5A2BA 1QI5A 4AWEA 3CUIA 3PHAA 4DWSB 1KGUA 1JZ6A 3W25A 1G01A 4AISA 5BRPA 5AYBA 3VMOA 2WMGA 5BXTA 2ZXBA 4AYGA 4HOZA 3HG2A 4OBSA 3A47A 2ZE0A 1JD7A 2WMKA 1FA2A 1US2A 9CGTA 2VR4A 1WZMA 1K9EA 4HPHA 4A3HA 3MV01 4KH2A 3AHXA 3CZEA 3IJ7A 2WVTA 3EDFA 1UR4A 1NWSA 1RPKA 5CPTA 2VNCA 3D50A 3WY2A 1W3JA 1W1VA 2YL5A 2OYLA 5TD4A 3MV11 4HPGA 3GH5A 2OSWA 1UWRA 1KCLA 2YIHA 2J4GA 2D20A 4C7GA 4YN5A 3HMCA 1NQ6A 1FP8A 1TR1A 4W8LA 2WC7A 1HKJA 2A3EA 3VDHA 3K4DA 3MO4A 1CTNA 2G3JA 1EDTA 1K9DA 4D1IA 2DT1A 2VR5A 3LPPA 4GO9A 1NWTA 1VFFA 4UQEA 3W24A 1HT6A 4M8UA 2VX5A 3WD1A 4CCDA 5ABFB 4GI6A 1QI0A 3AS3A 1HL8A 3WEOA 1V3HA 1L0PA 4XUYA 3OA5A 4B3KA 2CKSA 4YPJA 3SEPA 3G6MA 1DP0A 3WNNA 3WEMA 2O9RA 4DM1A 1PZ3A 1KFWA 4B15A 1JYNA 3DC0A 3L4XA 2F7OA 5F7UA 2WCGA 5BYWA 4PTMA 1K9TA 2YBUA 3BAKA 2UWFA 3WY1A 2JFEX 1KXTA 1SMAA 4ML4A 4J3XA 1BYCA 3CZKA 1JZ5A 1DWAM 1EOKA 2YFNA 5BXSA 2W5FA 3AIRA 1EHAA 2VURA 4Z2IA 3QR3A 3KEHA 2YDQA 4H8UA 4UOZA 1FFRA 1PX4A 1C7SA 3BUBA 4JHZA 3WY4A 1TQUA 2DSUA 2QMKA 1JNEA 3TTYA 3GM8A 4D71A 2DSZA 1JAKA 4NRRA 1UD3A 1VFUA 3WDIA 2UY5A 3CZLA 4OBRA 1KCKA 1PIGA 4TUFA 2OYKA 2GK1B 3WDQA 1R8LA 1H09A 4AZCA 2XM1A 5M17A 1E4LA 1OINA 1GCYA 4UZUA 4ZFMA 5KZ6A 1HKKA 3HN3A 4PMVA 3IANA 1S46A 5A8NA 4W5ZA 1UA7A 3K46A 3KZSA 5E0FA 4PTWA 3EJRA 6CGTA 1VBUA 2PWGA 3PZTA 4W86A 5A6MA 1F4AA 3VPLA 2ZX9A 3A24A 3DHUA 5DT5A 4BCEA 4UZSA 2WHMA 5HPOA 1B2YA 3WUBA
chains in the Genus database with same CATH superfamily
4XMXA 2AJYL 4F8QA 5KBNC 3NQIA 3MODH 3ATYA 4ODUB 3CUZA 2ZA2A 4P46C 3SB0A 3HQPA 1Y8BA 1DTUA 3NMEA 4Y4HC 1IIKA 3DV6A 4H1LH 5IZ7A 4EUPA 1Z48A 2GOKA 3WIHH 3FQNB 3II1A 2IKHA 3T0ED 2XX0A 3Q1SH 1HHIA 3HB3B 3AHTA 1DSFL 5H91A 1S9YB 3FRPG 5FKAA 3QO1A 4N5UA 3OZ9L 3EYSH 1NBZA 1U9KA 4PJEF 5D7IF 3ILPB 5FDWA 3RFAA 4I6VA 3KPQA 2HRPH 4WJ5A 3VXRB 2R69L 3NQ6A 1QBLL 1KO0A 2EYSA 3P0VH 4ELMB 2WTOA 4ACPA 1ZT1A 4JFZL 1US3A 4AY1A 1IILE 1CLKA 3RWJB 2XUCA 1I2NA 3L5WA 1BGGA 4E42B 1BVZA 4MNQB 1R9YA 5FCSH 3ZOAA 4US5D 2R2CA 3BISA 4KEZA 3THQA 3G5ZA 4EDWL 1XI3A 3O63A 4Q8WA 4RIRB 1WDWA 3OXRA 3OLIA 2X40A 3BGMB 1PWLA 4AHQA 1TZZA 1CI3M 2BHZA 1KBIA 2DMBA 3FQXB 2BG5A 3H9SD 2DW6A 5T33H 4JTQA 3V2AR 1G0CA 3SE9L 2WNKA 2V69A 2XJ7A 3ARBD 4FCAA 3W7LA 5F88B 3NYZA 4ATWA 4HLZH 3E2SA 4Z1AA 2R1YB 5I1AB 1AE6H 3L4CA 1OG6A 3UT0A 1QTYT 3ZHKA 3HAEG 5DJYB 3UWZA 3HG5A 5BZXA 4GIOA 4H25A 2G30A 4BGLA 4M7LL 3WL1A 2BSDA 2E5BA 3LNGA 2YEZB 3UEZA 4GXFA 4RSVA 4YS1A 4BFGA 4N0UA 3RGVD 1ECEA 1OFEA 1J1XH 5F0MB 2FPVA 7REQA 5J12B 4IDLA 4O02H 2Q6ZA 2LOEA 1S5WA 3HHSA 2I60L 3AM8C 3WQFA 1IKNC 3P3YA 3LCLA 4PV8A 3ZKND 4XXCA 3U7BA 3VXUD 1BQHA 4JDYA 5ICZA 1R46A 3SB3A 4DYKA 4A67A 3QHFL 5FO7A 2ZUSA 3AACA 4AKOA 4A63A 3L3HA 5AVXB 4DFHA 1XLDA 3V4UL 1WZ1L 4ODHL 4RPQA 1NTDA 1SDDA 1CE1L 3TCXA 5EIVA 3QNYA 1HKMA 1SOSA 3WU1A 3SCMC 4IMKA 1QYGH 1JD9A 3P11L 5CCJA 1HHHB 1V7ML 3X14B 3A64A 1KN4H 3FHQA 3SY6A 3HZ3A 3CUPB 3FO0H 3K0YA 2I5QA 1J5SA 1B30A 3ZSSA 1G84A 3SDYH 1MNSA 4Q6IA 2LT9A 1T41A 5BUGA 3RFZB 5DELA 1CQKA 3H9ZA 2J2ZB 3M7OA 4O1BA 1F56A 3DX3A 4B5SA 1Q65A 2YEQA 4ZOEA 2I16A 2EQDA 4RQQA 4N8PA 4MA1B 3VIGA 5EULV 5ADPL 1PG7H 1ZSHA 4KDWA 1RU9L 3NDYA 2CBTA 1UMYA 2BSCA 5FCUL 4HXAL 1DLHA 3FTSA 2ZXWB 4JN1L 1ZANH 5EU5B 1MI3A 3W3OA 3PABB 1ZT7B 5LCVL 4PGJA 4N1CA 3GIYA 5FF0A 1K1DA 2Z8SA 4GAAA 3IVSA 3MBFA 2X9YA 4YLWA 3EF7A 3WUZA 4MNLA 1YDPB 1UUSA 2O6PA 3OVGA 3L1OL 5GGTH 2IXQA 4J8RB 1T6BX 4N4YB 4Y1AB 5K9QI 5CEZD 2Q0ZX 4K3ZA 3VFRA 3OKDB 4UV4L 3QR1A 1YE6A 3GJFA 4DKDC 4AH2A 2KZWA 3CXDL 1RCYA 1QKZH 3A23A 3HKFA 1KB5L 2QVIA 1KYFA 1Q9WB 5JPNC 5JHDD 2FPTA 1QO5A 1BJ1H 2VXUH 1GZHA 3DZ1A 4TNGA 2RQ8A 3VRLE 1ZB5A 1CURA 1ZAHA 4YNYB 2IAMA 1DWFM 2VUKA 4IX0A 3TTSA 3QPYA 2NUTB 5ACLA 4LVGA 4UDUA 1JZDC 3HLKA 2APTA 5HVGB 3FHAA 3EWZA 5EUOF 1O7DC 4KWOA 5HHQB 3HMXA 3VFWA 3D33A 3TPUA 1JHTA 2H47C 4DK6A 1LK2B 2UVEA 3K2IA 1X7FA 4HPYL 3W1AA 3WIAA 2WJ5A 3WUFA 5JW4N 5A3ID 5AQ0A 4B5EA 5C0GB 5FF4A 4QDMA 4L8DB 1AGCA 5GIRB 2G9HA 5BVJA 3C0LA 3POCA 4LUSA 5MP6H 3CN3A 5DK2A 1WDSA 2V9QA 1E2WA 4PRPA 4JO2H 6XIMA 2A6DA 4HZ8A 3A6BH 2C3HA 4BSJA 5BQDA 1UM4H 4WD0A 5ECJE 5HNRA 2C4FU 2Y6ZA 2DQXA 4HBCH 1U3HC 1UENA 3VE0B 2B08A 4HCFA 2VISA 3SDXA 3I3BA 2NY2D 3WQVA 2YJLA 4YHMH 3MV7B 2C34A 4RL3A 4Q56A 1PFCA 3CFEB 3AUOA 4MNJA 3OHIA 4FF5A 3O16A 1N68A 1A3WA 1QX1A 2Z35A 4C56A 5FS5A 2OX5B 2CLEA 1YHPA 3C5ZB 3CVIL 3C2EA 3VZXA 4JFFA 1OC7A 5K9XA 3GBNL 2BLFA 2JB6A 3QKZA 2VJ8A 3DN5A 1ZAJA 1EXBA 4LRIC 4URKA 4ELMF 5CQ1A 3GSOA 4GUFA 2QLVB 1TUXA 1X3DA 3MODL 3CQIA 1F2QA 3H3PH 3T3PF 2ZXEB 5INDA 4JTUA 1U2HA 1R3HB 4XO7A 3LZLA 4LHUD 1R34A 4X5WB 1QHOA 1AJ2A 3WIHL 2JKJA 4K4KA 5FKPA 2MNJB 3F4NA 1RIVH 2GQHA 4KKAC 3V0JA 3Q1SL 3FN9A 2HH0L 3WLLA 2A4CA 4FG2A 2XXGA 3ARGA 3RK8A 1HTIA 4D6IA 5EDSA 3EYSL 3PZNA 2ACUA 4ZPVA 1FXQA 2Q8AH 3AQXA 1A21A 1WV7T 5I1HH 1JPST 1OTSD 3W72A 4CILA 1VACB 3ATAA 1XCWA 4NNYB 1NDWA 4JRYB 2Q10A 2QBWA 3GSVB 1HI6B 4ZCWA 5B7MA 2PZ0A 1AKPA 5JXAH 4YWGH 1JMZA 1AXSB 4DX3A 2I1OA 4A7QA 2XNAA 4JFYA 1YA5A 5HGDA 5EMYA 3M4HA 1EUTA 4FNSA 1AXTL 1F1DA 1LDPL 4WV1B 3OR7A 1AHMA 5T33L 4PJXA 2WOQA 5I8CB 4NENB 3CFKB 1ECZA 1FVEA 3WMBA 5D2TA 3L3GB 1H9VA 4B2DD 3R8QA 5HYIA 1WLHA 3U2IA 2CC0A 2K78A 2EDQA 3DTUB 4LFHG 5K9JL 3EO0B 1EEPA 3J7HA 4P5TD 4YAQA 4NZUL 3QJZA 1CEOA 3ALXA 1YVLA 2NT0A 3WJMB 1R33A 2I5YH 4R34A 4O02L 5CC7A 4BK4A 1V6XA 1B0RB 3WH6A 3NFUA 4H6KA 4BUHA 4AY8A 4NQEA 4FFZA 4KKBD 3DESA 1AGFB 2F84A 3RPBA 1I8IB 3RDTD 3RG1C 2YA0A 1GSKA 1HOCA 3LKPA 2REQB 2TMDA 3HFYA 2GCYA 3D8MA 3CFDB 1KIPA 3WFEH 2P3ZA 4M6VA 4JAMB 4YFLF 4LUTA 4JFXB 1X7SA 3NACL 2K8MA 3TYGH 1Z9LA 4OF3A 1QYGL 4MIMA 1S9WA 4L8SB 4OV5B 3LZRA 1KN4L 3MJGX 5CZTA 2WUCL 5DS2A 4H9UA 3FO0L 2QFRA 3PFRA 3WYRA 1EMTH 1L9PA 5H8UA 3VFCA 1UG6A 3SZ8A 4EKJA 3NP3A 4H6RA 4LPVA 3MBEB 2Z31C 3J07A 2O4QA 3OKOA 1A65A 2WQXA 4KRTA 1ED3A 1E5YA 3AQYA 3QDGB 4DP4X 3PGCB 1SJAA 3WI9A 2AF2A 3T0XA 5DJ6B 1QI4A 4S2SA 4PYSA 4K1GA 1PG7L 4XN8A 4FERA 2FE0A 3EBVA 1J9YA 4A68A 3TWAA 2YPVH 3HG1A 2I9LB 3L3DA 4KCUA 3T2PA 4FFYA 1MFCH 2OSLA 5BZZA 3OA3A 1LHZA 1MRFL 4MHHI 4NGHL 2J6EA 1ZANL 3K7UA 5AAPA 2OWCA 1NSNH 2CAKA 1CFNA 4RKAA 3C4UA 2VUYA 1XRTA 2GK0B 2OV0A 1OGGA 2X1WL 1ACYH 2NY3B 5A16A 3DX1A 4Z1BA 1F0LA 3F01A 1BCIA 1C12A 4XB8A 4AYDC 1RV8A 4RXFA 2E5EA 2EXTA 5E99H 3KW8A 3EGDB 5GGTL 1MCIA 3V4PH 3LQLA 1FWTA 1I1WA 4G43A 1FL6B 1F02I 1GYWA 4HHPA 4L4VA 1RPQA 1UXSB 4PRAA 1CE6A 1KXVA 4TLSA 4W7WA 4G8IB 5DO8A 2OFJA 4BSVA 1KKRA 5GGVY 1QKZL 2YO3A 2WMJA 2DV6A 3A5VA 1WUNT 4XCNB 2D2GA 2GUOA 3N0AA 1FFQA 1PBGA 3Q2DA 2FBRA 5AC4A 4KESA 4QRUA 2E46A 5IB2A 3IFPA 5F7HA 4U6XA 1O5KA 4GUPA 4P05A 2I5IA 4CMHB 4JFPB 2NLYA 3ZDXB 3TVMA 3N55A 3TF4A 4Z3GA 1ZPUA 3K13A 4G8GA 3QM3A 1TV4A 3C5JB 1D5BA 5TIMA 1MAMH 1XZ0B 1O94A 2R82A 1O1ZA 5I24A 3N12A 4FZ8H 1BXAA 3L0GA 5DRIA 1WFMA 5HGHA 2D2OA 4GXUN 4P2AA 1QLRA 3FDGA 3WEXB 4R53A 4PCKA 2D1ZA 3MHGA 1W3HA 3M44A 3A4FA 4TNWF 4C5YA 3ABZA 3CHFA 3P3TA 1KYUA 2HYMA 3TBTB 4PBGA 1KRAC 4JO2L 1T0PB 4XB3A 3MNVA 3A6BL 3BARA 1C16A 3FYOA 1B57A 4LDOB 1UM4L 4UQBA 5EEXA 3JW7A 5HWJA 3RE0A 1MCKA 4Z3EA 1BYBA 4BJHA 5HGGS 3H3KA 2GI7A 2LLEA 4JJ5A 2BNQA 3WUWA 2H90A 3L7FA 4PMDA 1U91B 2X6VA 4MQ7A 3WLQA 5C70A 4PJCE 4YHML 3ULUD 2NY4B 3ERXA 4YE4H 4JLRB 3SN0A 1UR0A 4WQOA 1KJ3H 4N6QA 5GSRB 3KDMA 3V6FB 5IW3A 2J25A 4UFKA 2G75A 4P2YA 4G9DB 2LLLA 3BJLA 1USZA 3P9MA 2I17A 5ESVB 1UWAA 3QQDB 3BQ5A 4TVCA 3LAFA 3IDMA 5AZEH 3PJUA 4OVXA 3OIHA 1DQQA 4NDMA 2HVJA 2YEVB 3H3PL 2NLIA 4XCYB 2IVFC 5D1XA 1YNTF 5DT1H 3U30C 3LPWA 3WTXA 1NEPA 4HNTA 4DIAA 3DXAD 4P2VA 2VXVH 5I17A 3S42A 1IC1A 1RIVL 2DFAA 3TU9A 2VN4A 5AB9A 4HS8H 4HSAC 3EZ8A 4KNTA 5I15H 1BKHA 4I8DA 1I7UB 5I6OA 5TQLA 4N0UE 1EX0A 4GRLC 3W0WE 4PMOA 4LPYA 4PREB 1EBAA 2Q8AL 4G9FA 2P5EB 2DJUA 3AJ7A 1GVQA 3IJSB 3EFDH 3IF1A 2BVDA 1PZSA 5E9DB 3UABA 3DFQA 2EG7A 1PIIA 3NIDE 4JO4H 3VFVA 4AEIH 3FKRA 3IDXH 4YDVB 2AQVA 3KPPA 1M1XA 3P77A 1EZLA 1FZOA 4L6HA 4GI9A 1U8PA 2VLJD 3QWOB 1Y1UA 5JXAL 4JFOB 2VRJA 5HHOD 4YWGL 2QPSA 3AMLA 3V6ZA 5I77A 3CN1A 1P6FA 4LK4A 3ZJ6A 1MEWA 4PFMA 3O4LB 5I3GA 1ZSDB 3H21A 3I7SA 1MF2H 2EKSA 3M41A 1XTLA 3VDGA 3KOZA 2NNXA 3T2OA 1GOGA 4X6FA 5G4MA 3WO4B 3VWKA 5IEHA 3LVTA 3A4XA 3LHZA 2RH9A 2JBMA 2OLAA 3X11A 2ZX6A 4OLVL 2CZNA 5FM8A 5C0AB 2W65B 2XV0A 4IRSA 2VGFA 4OOUA 3TJ4A 3W28A 3H23A 4HPJA 1S39A 2IWKA 4YUEH 1MVUA 4MUPA 5EHFA 2OXGB 5AYTA 5GGVH 2LTQC 4OFDA 1RZ8A 2I5YL 1OQOA 5ERWB 1NF7A 4ZNEA 4IFKB 4YNGA 1RPXA 2VR4A 3NDYE 3UTSE 3NL3A 3K80A 2MH4A 2FIKA 4OJAA 4GUIA 1UTDA 1F74A 2UY6B 1ND0A 3D50A 3F7QA 3ZTNH 3RL1A 4N87A 4XC1L 3EJYC 3NURA 3O9WB 4XODA 5E8EB 3RL2A 3CU7A 3FN3A 4CQCA 2DT1A 1IGTB 1Z5YD 3WFEL 4IJBA 1OFPA 3M5YA 4UTUA 4B60A 3CWGA 2ATAA 3DBSA 2R9HC 5IHHA 3NJFA 2AEQH 4IK6A 5FJUA 3NGFA 1EGVA 3MO7A 3V55A 3MUHL 2ISSA 1S2TA 1IEWA 3RGBA 1EMTL 1A02N 5FV1L 4YE0A 3UBFA 3QR3A 2QTVA 5D1QA 4QHMB 4HHAA 1TJRA 1UVQB 4HUWB 3Q5YA 3VFSA 2GK1B 1UZDA 1YE4A 1TSHA 2J1WA 4M3HA 4C47A 2IFGA 4LVAA 4W5ZA 3N50A 4PTWA 6CGTA 1F4AA 4H9MA 3IIOA 4NZ3A 5DT5A 4N28A 3W6LA 3RWCB 4NS0A 1XUZA 3NQDA 5G4EA 3EYUH 1NSNL 1PZCA 3EHBC 4WSKA 3SIKA 2PXYD 5EU6B 3STZB 5HPMA 3ETSA 4U4IA 3H7RA 1ACYL 2NUPB 4QDWA 4IS6A 2Y1ZA 4LANA 1ZGDA 3MYJB 2OCFD 3AZTA 3MGAA 4HOXA 1DTNA 2V3DA 1R86A 3B2UD 1A2YB 3GG0A 2BVPB 3U9UA 3V4PL 1ACXA 3GFUA 1TV7A 3N2TA 3IWPA 3AZUA 3NSDA 2XFGB 2JQMA 3ZDXF 5D33A 3GXFA 2DT2A 3SFKA 2QGEA 1FVCB 1C8QA 4C4KO 5CJXA 1IARB 3SPVA 4Z7NE 2V17H 1S7TB 3Q9QA 4C6CA 3K8KA 3GDBA 2W5PA 3U0PA 4YXLH 2WO2B 4N2MA 1N82A 2APWA 3RWFA 5EEWA 1PZBA 3RJDA 4U49A 4ZB5A 4RNRA 3SDXE 2PDUA 3R7MA 3SN6N 5BU6A 3JWDC 3LU2A 3I6KA 4X2PA 2EIJB 2NNRA 4N6FA 4J28A 2QVTA 1LEKB 3V9EA 1AQDA 1HWWA 5CXPA 3RKDD 3KVQA 2G3XA 1NMAH 4N68A 4D6GA 1NCOA 3HPAA 5D9MA 4LUJA 4ANUA 4RCXA 3QORC 3BWUF 1M7IA 2X6CA 4OM0H 2E27H 2HCVA 4QG6A 9XIMA 4LQ1A 4W68A 3AO0A 1MAML 5LO7A 3WE6A 1I1FB 2GSJA 2IPUG 4M48L 1LEGB 3RVUC 3PDOA 3S3DB 4AF0A 3ZW3A 4GUHA 4ZDHA 3TO2B 5I9QC 4BZ1H 4NSKA 4XMUA 1HHJA 3HI5H 1TR9A 4K94L 3MTRA 3T3ME 3PBVA 1V08A 5D5MA 2WLMA 5IIEA 4AWTA 2EF9A 2X28A 2C3XA 2FUQA 4RGND 1J9SA 4GFXA 1DEEA 3VDAA 1ETZB 1X9RA 2X3CA 5CZXD 3WJYA 2WZIA 5IB4B 4IIGA 4MWFA 3B7YA 2J43A 4POYA 5JORA 4HCGA 2WAQA 2R2BA 3KVMA 3TO4C 3V5FA 4FFVC 3GXMA 1HE7A 3BAIA 4UOJA 4PR4A 2JCCA 3CDFA 4RMQA 4UMCA 1HJCA 4AZ8B 1ZTXH 2JE8A 2DEWX 2PDWA 3MUY1 4X7EC 1KJ3L 2CU0A 4WO4B 4Z3TA 1H8NA 3TWYA 3SDAD 4DHLA 2A0LC 4CBZA 1RK0A 2XZAH 1KFAL 1F1GA 4FE9A 3QUMH 3MJ7B 1NBYA 1HXJA 5KITA 1BAWA 4FQLH 1XWYA 3OKMB 3VH8G 4PJXE 5AZEL 5BW7C 5T1LD 3VFGH 2WXOA 1A7NH 4C83A 2ZUVA 2MNWA 2V9UA 1U8LB 5A2IH 3V0FA 4IM8A 1DE6A 1JWMA 4YWSA 1X44A 1TVPA 2LVEA 1KZQA 5L4IA 1XLIA 5DRXB 2EGZA 2ALDA 3BLBA 4HS8L 1Q6QA 2DU2A 5I15L 3S3CB 2JKTM 3LH9A 2X88A 4R2GB 4BBWA 4JFHE 4Z0JA 1JPTH 3MN8A 3MXWL 1QO3A 1PNCA 4LLUB 3CH9A 3GI9H 5C0ND 3EFDL 1K6QH 5ENWB 4EX4A 2G5BA 4NSBA 3RVVD 4F7EA 2G41A 4JO4L 4LS2A 4AEIL 3WF2A 3RO8A 3IDXL 1I7ZA 3VVGA 4Z3IA 4NQEE 4J9JA 1CF1A 1FLTX 2E74C 2FB3A 3TV8A 4S1RL 2FVKA 3T8VA 5I0ZA 2PC4A 2FIRT 2PETA 2CFFA 2JKXA 5AKTA 4IL0A 4NQQA 1E6QM 3FUFA 3GQYA 3ROLB 2QJJA 1W3NA 3B04A 4NZ1A 3QUXA 3NG5A 4PGZA 5KBMA 4IU3A 1UZ4A 1K5NB 1OTTD 1ZLWK 5J11B 4HBQA 2IQ0A 2FQEA 2BIHA 3QXDA 1F4XH 3JWNE 5KYUA 4QHRA 3VXTB 4MA7H 2J7BA 3NA4A 4U28A 2XVKA 4QUOA 2P3EA 2W9EH 1YBQB 3QQ0A 4AW4A 5MENB 3TJPA 1T21A 1TFHA 4KJWC 4OCLC 5IQMA 4WRHA 5GGVL 4FGMA 5IVXB 4DO7A 1VEOA 5JW3H 3HR5A 3QT2A 4LVHC 4UAHA 3W5MA 2QCNA 1NMBH 5EU3B 1CL7I 2HT4C 4JFQB 1LEIA 3HG1E 3HAEH 4NQDA 4XKYB 5BXFA 1V6YA 3PNWA 3Q2LA 5IHBA 3ZTNL 4G6CA 1IEBA 3W7GA 1EGJA 1QAWA 1REQB 4TUJA 3MUIA 5F7FA 2PZNA 4MVBC 3KHOA 4X6CB 5DYOA 3PUDA 2Z7ZA 2QUVA 4DEPC 4OD2A 5EZLA 4GRMA 3MHFA 2A9DA 3HE7B 3KHQA 2OYPA 2V5MA 1Q7ZA 1QQDA 4QYOB 4OBTA 1ZP3A 1WCBA 4Z95H 5AOIA 4XRCA 2ZXDA 4PD4J 2Q09A 4D9RD 4ZB2A 4L4VE 3BAXA 2R1NA 1LP6A 2XWZA 3HZVA 5IV2A 3EYPA 3H2MA 2YYTA 4JQ2A 5FAJA 4NX0A 5B1JC 4JGJA 3KYKH 3T8MA 2J8HA 4XNQB 5BJTA 5LGJB 4ODTH 1N64H 3GD6A 3N1GC 2X7LA 3QUZB 3RPIA 7CGTA 3APGA 1I8LC 1KBKA 4V28A 2HT2D 4AUJA 3O6MH 3WBWA 3GTVA 2D4DA 4JFEA 3EO9H 4KJYA 5SWSE 3PTMA 4LEOB 4HIEB 4TO8A 1OSZA 1USQA 1MHEA 2MKWA 4DP1X 1URZA 3DMMA 4GKSA 4U5IA 5B39B 3EYQD 4CW1B 4G8GE 1LUCA 3EYUL 3TIDB 3MJ8A 4QLJA 3U2JA 3YPIA 4IIZA 2PPGA 3IMUA 5GNXA 1RD6A 5DHVB 1PKOA 4D6HA 1H3TA 3BVXA 4F7MB 3BXNA 4Y5XB 2FQFA 4L9DA 2I9TA 3Q3GA 3V4VA 4Z2JA 3AHZA 1WDPA 1ZHLA 5E00B 5J6HA 2VLME 3OJMB 1TTAA 3UBXI 5HVWA 3U4EB 3CZUB 4N8VB 2P0OA 5AY7A 1DFXA 1GEQA 4UT6H 2YOCA 3I2CL 1J5OH 3UTTB 5HR6A 2XQYG 1ZCCA 4PSPA 3HIJA 3P81A 4XAPA 3M07A 4YXLL 4KTYA 1PMYA 4UINH 1D7FA 3N25A 1AAJA 1EDQA 3GSRB 3V8OA 4OFCA 2M2DA 3VXMB 4GG8B 1XAUA 1TRIA 5K1VA 5E56A 4QJ3B 5B1BB 1UWEL 4PPTA 4RA3A 1KPVB 3GHRA 4QRRB 4L1WA 2VVNA 3EBIA 4JGDA 1SJBA 2XETA 3Q44A 5KSAB 4ZL1A 4N20A 4ETQA 4B3LA 4AXWA 3K71A 5C7VA 4LDCA 1NMAL 3L3OC 4GZJA 4BEUA 1OSEA 3K6IA 5BOOA 1U0QA 4HV8B 2SEBB 3D52A 4UTWA 4B9KC 5FF7A 3PAYA 3ARFD 4CVZB 3UJFA 4H7CA 3RBGA 5D96C 1LRNA 2PTWA 3M5XA 3DUSB 4RCAA 1W6LA 4BZ1L 3F4WA 4OCMC 1CGYA 3DBPA 1W3LA 3HI5L 3LY6A 2WPGA 3C75A 5D1XE 1PLAA 3BPWA 1S1PA 1U58B 5I6MA 4KDTA 1AANA 4MYAA 2D8KA 3U0HA 2YD3A 4LLMB 5LNVA 3CZNA 4P5MA 4W6YB 4UQIM 4AYMC 5FFGA 3TZVC 5LXXA 1JUFB 2A74C 1LL4A 1YADA 3QG6A 1BD0A 4KFOA 5KOVC 2YJQA 1UZ8B 2OJZL 1YYCA 4G9FE 5K59E 1E4NA 4YSAA 1UWXK 4XBPA 2YSWA 4PJ8A 1MFVA 2PTVA 2J24A 2GJLA 5DUPH 2BMKA 1SZGA 2CXGA 4YK4B 2ICWJ 3GMQA 4JB9H 5KVEH 3NSCA 3MKVA 4PY8I 3HFMH 3BJTA 4PBDA 1Y07A 3IK4A 5DD1H 2XZAL 1XIGA 3DI1A 1TQCC 3QUML 1FFOA 3ES6B 3KRBA 2CLPA 4ZQTA 1S2CA 1IVLA 1N6UA 1X7QA 3MUGB 1KGJA 3N17A 2B7NA 4PCSA 1PFOA 4FQLL 3DRTA 2MPAL 2PDBA 5F2IA 3DIFA 5F6IB 3IJ8A 1WDDA 3H6AA 1UIPA 4QHPA 3VFGL 1A7NL 4OUUA 4TS6A 1EPFA 3UZQA 3IS1X 1SM3H 2VFEA 1AZ2A 1ZJHA 3FTWA 2OI9B 1TT6A 4MAYA 5DXYA 4LSTL 4DERA 4O11A 2EXYD 4PP1D 1W37A 1BGAA 3CBJB 5AC8A 5CFHA 2NY1C 3V95A 3GMNA 4KI5D 3HQ1A 4WU7A 1RK7A 2JJTC 3O2VH 1JPTL 1MH5A 3WTYA 3PIQA 3D09A 3GI9L 5EWIL 4XP5H 2OKTA 1K6QL 3TN0B 3F58H 4W9IC 5KVGH 4ZNEE 2EE3A 3PZMA 1FV1B 3SPHA 1HCFX 1QR4A 3D07A 4UMGA 3L12A 2WTRA 4KCVA 3B0UX 2XU9A 1CDIA 2XKSA 1T0NB 1GZGA 4A6GA 4MWAC 1W2KT 4ZVJA 5C0CD 3TR9A 1KGXA 4YC2B 3ALGA 4I0PC 3UMNA 4HMNA 1NEZG 1BKSA 3HN5A 1UJTA 5E2VH 5EBUA 3FT3A 3M47A 2AJ3A 3V5HA 2BNUB 2H9AB 4UF7C 4ZSOB 4XN7A 4F24A 4GBXB 5KN5B 2CBJA 3NZRA 1KPRA 4OF0A 4JIRA 3O3BB 4YHYC 3TEWA 3GRWA 3IDUA 3MRIA 4EP8C 4A7TA 5HQMA 3FOLA 1AL8A 1OL0A 2WHLA 3K4WA 3GKZA 5GZND 4WJEA 4EI5B 1PIFA 1IGCH 5CBBA 1QSEA 5D1QE 4X6CF 2W9EL 3QUKA 3TNMA 4K15A 3KWSA 4OKVB 1OQFA 2OMVB 1SYTA 3TC9A 3TNNA 5JW3L 4FJ6A 1XF0A 4FMFA 4ELKB 1QOXA 1XR2A 3RNKB 5ALBH 3FSVA 1VFOA 2BO0A 1YN6B 5BUAA 3BZJA 2A77H 3ET9F 4PJCA 3GSQA 1WAAA 3GK8L 4XE5B 1O7AA 1XGDA 4LVEA 1XL4A 4I7UA 3QFGA 3H9HA 4LCRA 5FYLH 3T3PB 4BQBA 2LHAA 2ODIA 3L95A 3FTYA 1AD9A 4FXTA 43CAA 1P7QB 1MFMA 2EE6A 4YSSA 4M1CD 3BOVA 3TBWB 4KPHL 1T99A 5L4MA 3QDMB 4Z95L 2GITA 4JRXB 5I82A 1J96A 1ONRA 4NP9A 3PL6D 3C60D 4YPGA 4OIBA 1KNOA 2Z26A 4WKZA 3GMPA 3OHXA 2J7HA 2ICEA 3H9YA 2KL6A 3KYKL 2BOLA 1BZEA 4CNOA 4D6JA 3RX4A 5E0KA 4LL1A 1DDTA 3P9LA 4ODTL 1N64L 1HXYB 2VM9A 4AD2A 5C08E 3AGWA 4RVBA 3BMWA 4BEIA 1KGWA 1TG7A 5DZLA 3O6ML 2UUDK 4R96A 4WUKH 3EO9L 1NCDH 3SSGA 6FABH 2P50A 4BQ8A 1L0QA 3DGBA 3SBPA 3UR8A 1S9VA 3W0WA 4WFED 3QEQD 5CILH 1FWNA 1I9CB 3VXGA 5DQ9B 3LRMA 4PJGF 3G5VB 4I18A 4LY8A 4Z77A 1OAQH 1N6QH 1U93A 3GZOA 3NFNA 1Z3RA 1FQ9C 1KYOJ 4LLYA 4MX7A 4JDBA 1A6ZA 3BQUA 2GTWA 1CD8A 2YA1A 5EA9A 2XWJA 3SY5A 2ZP8A 4I9XA 3COTA 3S8FB 5F96H 5TE6H 2TRSA 2QYGA 5T1MB 2QR0B 5BPPA 5H4ZA 1R3WA 3X3FH 5D5ME 4M3JA 3MROA 4XH2B 1E27B 4ZOBA 4UT6L 2ZC1A 4Y8DC 1EJSC 1EWDA 3CHSA 1LE9A 1C9DA 1J5OL 2JKSA 2A9CA 3M1ZA 2Z8VC 2WJFA 1A22B 3OQ8A 4UINL 3VRJB 1M3IA 3ZVVA 1G6RH 3NEOA 4W9KC 1JPGA 5TH2A 3PP3K 1A0QH 1V0MA 4OCRH 2APBA 2WVSA 2JCCE 4QNWA 4QY8A 1BG4A 3JYBA 3QEUA 4QNPE 1FSKB 4NUWA 5EC1A 2PDNA 3CFTA 5D1ZB 2Z24A 1EJWC 2B7DT 3OR6A 3EG9A 2IUZA 3GG8A 1J05B 4NIKB 2A7NA 2B1HH 1WAUA 1MOEA 3UW6A 3URBA 3A12A 2JVUA 3GJFK 3V10A 2NZIA 3UTSA 3S8HA 2FFCA 4W7UA 4FQIH 3OQRA 3TQVA 1KRBC 4CN4A 3WQGA 5GJTH 2EDJA 3IXAA 1F73A 1CWYA 2XX1A 3QH3A 3V0DA 3MRRA 4Y5VA 1F58H 2G0LA 3NSXA 2X4QA 1XDTT 3VFNB 3WQ6A 1BOGB 4FYSA 1ZA6A 1F6AA 3U36B 3VKAA 3TCSA 1YPFA 2H2PD 4QRSB 1UR3M 3TR2A 4Y4KD 1GYUA 5LGHH 4KK5D 4IGSA 2IBZX 5CAKA 2AJZA 3UWEA 4OV4A 5E5UB 5HGBA 4BRJA 3T5WA 4AYFB 5L9DH 1Z0NA 4IIEA 3VAVA 1Y18B 4WK2B 1F8IA 3UOAB 1FTXA 1W0MA 1Z44A 4M7LT 3WLWD 5FO8A 4C7GA 4ZUSA 3KCJA 5TE7H 2V0AA 3F2DA 3BGJA 4A6YB 1BQ5A 4PWEA 4EPSA 3NBNA 3SGEI 5IG7A 4D1IA 3HB9A 5DUPL 3W24A 2OTDA 1KTKE 5IJKA 3KGUA 4MRCA 3ZVHA 1E9PA 5ABFB 1QI0A 1ZWIA 3OOQA 2R0LL 5AVUB 3LEPA 4HCRA 1HXMA 4JB9L 5KVEL 3SEPA 3JWDH 1DP0A 4OV6F 4B9JA 2WCGA 1RZMA 2OTWA 1XEDA 2F9BT 4Y0GA 1AJ0A 1BWKA 4J3XA 3LERA 1DWAM 1EZWA 4J4PC 1RQEA 2NWSA 1YXDA 3NQGA 2DSUA 3EX1A 3GM8A 1E28B 4XWGH 3GIVB 1UJQA 3HC0A 3FVMA 3PV6B 3CSGA 4L9LC 5FGRA 1T4KA 3HN3A 2AW2A 3B34A 5JNYA 1XF1A 3ITTA 2VKZG 1E1CB 1AZCA 3CHOA 5DHYB 3DG3A 2FB2A 3A24A 2N7AA 1RAMA 3S36X 5EBLB 1QLEH 3K6OA 2ZOKA 2WWMD 5L0QC 4OFPA 3WENA 1TWWA 5F4XA 2FYYB 5B4MD 4UTTA 4U1HB 2WYIA 2I32A 3T0TA 1BWWA 3O2VL 3L66A 3WAJA 1X98A 3EO1A 3P3BA 2CHRA 5EBMA 2Q6WB 4XP5L 4MJMA 2IAAC 3F58L 2EH8H 5KVGL 5ISZA 1HYRC 4QRAA 2L5HA 3QZPA 2G3FA 1KIQB 4NQDE 4NIRA 1WAPA 2VN6A 1OBAA 2Y85A 1TIUA 3X2QB 4Z1CA 5FCZA 4I1PA 1BV8A 4J3SA 2CBUA 1KQYA 5IBTH 3OZMA 3CLMA 2IALA 1QNQA 3RZCC 4NT6A 3BZFB 4DPPA 2DM4A 5KVMC 3B0VC 1PHWA 2YX0A 3LYEA 5KSBA 3US1A 2OLDA 1OP3K 4YBHA 3BVNB 4Y19D 5IVZB 2C9RA 3WBAA 4Y7EA 3GKFA 3LHTA 1C5CH 1NAMB 5T5NG 4HH9A 1I8JA 5DRWA 2VCOA 1IGCL 3VM7A 1MQRA 1P7KA 1POKA 1TQXA 1WT5A 4FIQA 4ZQRA 3W7NA 5LGKA 2Y0SA 1MKFA 3LH2H 4QE1A 5C9KA 5ID1B 1MQPA 3HPJA 1MIMH 4U1GB 5L2KA 1FUYA 3ABQA 2W80C 2Y7QA 3NOIA 3OKEB 1TF4A 3LKQB 3VUAA 1YNKH 4TULH 1UOVA 5CWSA 4OZOA 4JFEE 1D7BA 4MCZA 2F54E 4F15C 4J2PA 1VFMA 4Z7OE 4IFOA 3L21A 2ESVD 2EDTA 2HRPL 4JZNA 1UOKA 4DH2A 1S5HB 3UBXG 4UOW1 3TA3D 3ZHNA 3TSMA 3P0VL 3KS6A 3C87A 5IMOA 1SHXA 3S8GB 4PBWD 4PRIB 4KKLD 4U1SA 1E0WA 3HCVB 5A2FA 2HMCA 1FL5B 4PIRF 5FYLL 1P0DA 4NC1E 1EPXA 1YNTB 5AWNH 4KFZC 4JRWA 4QT5A 1I0DA 1XEUA 4JM0A 3U2ZA 1TIMA 2FZ3B 4UUJB 3LI0A 3LN4A 7ODCA 2HX8A 4PE8A 4KK6C 4BA0A 1G67A 3QWRA 3AG2B 2YB1A 5DMGD 5CD3B 5GQBA 2BZ7A 3KWWA 5DK0A 4W70A 3TT3H 4E3VA 1B4LA 2R27A 4PB5A 4P2OD 1UB6A 3BO8A 3SRHA 4J6RH 1NGXB 1RZIA 2HFEB 2YCLA 2ENSA 1AE6L 2FWLB 3ABGA 1UXWA 4NQCB 3BP5B 2BP8A 1BZDA 3QXAA 3I9GH 4RWHA 4QQUA 2QTEA 3CX2A 2HXUA 2RH0A 1MHPH 3RX3A 4NYLB 1JXJA 4PGBB 2BZNA 2PU0A 1BEUA 3KXFD 4JL2A 4JQ4A 1NCDL 3AYRA 3LPGA 6FABL 1AZRA 1FNGA 2BWQA 5F6HI 2CDEB 1EDHA 1DN0B 4UM9A 5CILL 4FA7B 1XIFA 1J1XL 2WW5A 3QDHA 1OAQL 4Q8BA 4CD8A 1TTQA 3TS8A 3QA3B 5GGQH 4PRDA 5E4EB 1J9RA 2PWHA 3E2RA 2VWSA 1PAMA 3MS8A 4K6AA 4U1IA 4HZLB 1DQIA 1P53A 3L2IA 2QR6A 2PLKA 1W6TA 1IM9D 4X61A 5F96L 3VD4A 2XTLA 1KA9F 4PU2A 4B5UA 2DQJH 3GC2A 5TE6L 3G9AB 3EJQA 5HYSA 3NL5A 4XP4H 4H6EA 3X3FL 1R5WA 4HS6A 1NZRA 4JHVA 1LBFA 3C9NB 4JKKA 3WUEA 5F0PB 3WK1A 2ITEA 3E6HB 3OKKA 3ZDZB 5D37A 5D7JA 3BJSA 4CADA 5C6MA 3AAZA 3B03A 3T2QA 2RJGA 3M0HA 5FO9B 4OQVA 4NXSA 1G6RL 1CXIA 1NPUA 1T03H 3TWCH 4KTDH 1A0QL 1DJWA 3WFHB 3WFZA 1E72M 4OCRL 3KPSA 3SDYL 1DVXA 1W5OA 4ZQPA 4TVDA 5BO0D 3D2UD 4V33A 3ZJKA 3BVJA 3ILDA 4NC0B 5IKCB 2WNQA 3OG4B 5HYJA 4EIVA 3D12B 2Z64C 4JIPA 3AITA 2ADIB 3DFTA 1J8HB 1NGWA 4QHKJ 2B1HL 4XVTH 4JEGB 1KB3A 4ONHA 1XYCA 5C07B 3AU1A 1DJHA 4FQIL 2FZMA 3FF7A 1LM8V 3NJJA 3C2SA 1SDAB 5GJTL 3UDWA 1QR1B 3IVKA 2ZYFA 1JZ3A 1F58L 1T7XA 1VEPA 3GK0A 4NQXA 3BQVA 5JQ9A 1S7VB 1JMXA 2QJGA 2FVNA 3H42H 4GYFA 5GRVK 4TTUA 5FEXA 2FEEI 1GY1A 5K3VA 5LGHL 2OTUB 3TBSA 3P69A 2W9DH 1UQZA 1EFXB 4V1DB 3P82A 3QTPA 5E5MB 1YMMD 1QSFB 3CPLA 2J71A 3NVTA 3DFHA 5TGBB 3QXVA 2ZAHA 1U3JA 5E2JA 1PZ1A 3WH8A 1TMLA 1V0NA 3LZNA 4LCWB 5DJZA 2VXUL 4GS7B 3N2XA 4WU5B 1T1YB 5I0WA 4FYRA 3LKSB 3JWDL 5SWSA 2I9EA 5KSVA 3W7QA 4J12A 1HILB 4GW4A 3HS0B 2P5WA 5BMWA 5T3XH 2E47A 3WKNA 4PVBA 1BQCA 2HVNA 1WISA 4FCHA 1OHZA 1GYNA 5AKSA 1X6UA 4I0KA 3W2MA 4XWGL 3UQNA 1FYTA 1W9BM 3ESPA 1I8MB 2J1ZA 5G4WA 3Q5TA 5FJTA 4NN7B 1A4CA 3FQWA 4U1KA 4UBDD 2V5YA 4U1JA 3O9NA 1E6SM 3WN5A 4FXGA 1QSEE 2DZTA 3GSNB 2WSKA 4NL1A 4POUB 1LNUB 1QLEL 3FDKA 5MP6L 2VXTH 2CIKB 3A13A 1Q5MA 4F92B 5A2LH 2W0UA 1P6CA 4FHJA 3C6EA 3QI9B 1DIKA 3V5DA 3NTYA 1OYCA 2G0KA 4X98B 4HBCL 3WLRA 3RLSA 1NBQA 3KRUA 3CK0H 1I53A 4CNSA 1CB4A 2J21A 3H4FA 3IPFA 1PZ5B 2CZVA 3BLIA 1XVSA 1KFCA 1WAAE 3QIBA 1HJQA 3N1MC 2IPFA 4ZFCA 2A21A 5IBTL 2XH0A 1Q1JH 4LB4A 1XDMA 4N0CD 1FFNA 4K5OA 4DZ5A 4AZCB 2FFIA 1MRQA 3RAJH 3BN3B 1HJBC 3CPUA 1BZ9A 4QRBA 5C0FA 5SWZD 4N4PA 2VC6A 4KXZI 4Y2DC 3RRQA 1VYSX 3MKCA 3KRSA 4NVTA 1C5CL 3E2HB 5LAXB 5F9JA 2ATKB 5DUMH 2VXSH 2OOGA 1FL3A 3NNTA 4PRHA 1DBMH 1ZGLP 2WO5A 4ERAA 3GG7A 1QNIA 3G1YA 3KLAA 3LH2L 3H9SB 4X6EB 2XH7A 4CCCA 1MIML 3MLTA 3F05A 3L1EA 1YNKL 3HGSA 2KI6A 2W92A 4NRZA 2WKGA 4PUBH 2BSTA 5I71B 3O3RA 2A3TA 3E02A 2QF8A 1UJPA 1UD2A 4LARH 3HW7A 1SY6H 3QE5A 1FNSH 3F84A 5HHMD 4CGTA 5I1HL 1ZJIA 1QABA 2AJUH 5LNDA 3WOVA 4X8XA 3OVQA 4HWNA 1E5NA 3NN8A 1IWAA 4DJEA 4MMZB 3RGVB 2I26N 4UMBA 4BFJA 1P0EA 5AWNL 3Q2NA 2PD9A 3QIWA 4YDLB 2X2HA 3IDJA 3INPA 3MREA 4GE8A 3B9KB 4ZMWA 1U6AH 3HS8A 2VJXA 1DANU 4GQBA 3ITYA 3V35A 4LCCC 1L8PA 1L0YA 2GFBA 4LVNC 3TT3L 1CXHA 5IBXC 3DX6B 5E08H 4JPVH 2ZQKA 1A47A 3TCLA 1LQAA 4J6RL 4BH7B 2BERA 4DT2A 3DTXB 2P76A 4Y7OC 4IMAA 2OL3B 3W37A 1MCEA 2G4JA 1MHPL 4XWUA 1QFOA 3O3EB 1AD0A 2JKIS 4DF1A 3VD0A 3ZDZF 2XFYA 2PDGA 5LNSA 2F2HA 3GHPA 5DYFA 5HJ3A 2ZWLT 4XUGA 1NDTA 3P60A 2Z8RA 4NO0D 4ORGA 3ARXA 3OGCB 2HSAA 1UB3A 1JFQH 4JZJB 3ARYA 3BMVA 1F2XK 5FYJU 2EEFA 2RJHA 1BJ8A 4S23A 4G8EA 3BPOB 5HDOA 5HDLA 1II4E 2JF1A 2R51A 4Y16D 1BF5A 1HKLH 5J13B 3GWQA 2KMWA 2QMJA 1F1AA 2B77A 3L9YA 3FH8A 1Z5LB 4O1DA 1IEXA 3V6BR 5D4HA 4ZUTB 3EDJA 3TYGL 4PTUB 2JV6A 1LL6A 3QTGA 4ATTA 4DGVH 5JW4M 4R3SB 5I16A 5E6ZA 1V79A 5C6WH 4YIQA 3FV9A 4BK5C 1V93A 3I4KA 4ZTPH 5JIIA 3TWCL 2KERA 4KTDL 1ASOA 1X5AA 3N73A 3D0CA 3QUYC 2HLFC 4UQ2A 2C1HA 3WMLA 1A4KA 1E6JH 5PAZA 4O51A 4XAKD 4ZB0A 5KJ7E 1SVCP 4IOFD 4V27A 4NCDA 1A4JA 3QY6A 4NUPA 4DN3H 4XVTL 1C1EH 2INZA 4XNMA 2H3KA 5JHDB 2UZXA 2YPVL 5KETA 1OSPH 3GEFA 4L4PA 4P23C 1MFCL 2BHFA 4KXZH 3VCLA 4Z2LA 2CKNA 3ZJ7A 2GHWB 4XOEA 2AQPA 1AR1C 1U8MB 1VZHA 2FK9A 3FTGB 4X5XA 4B9GA 4DJFC 1YPZA 3R13A 2UYLB 1C8PA 3RNDA 1WBZB 1CICC 2YAHA 3VSQA 4QHNB 3H42L 4KJPC 4Z0SA 3KJ6H 5BXPA 1ET8A 3GIPA 1FX6A 4A04A 1GNXA 5E99L 2ZOUA 1VCFA 2DYRB 4NN6B 3TLLA 1XF3A 2W9DL 3M7WA 4LX4A 5HHNA 5L8KB 3EYFA 3MSGA 4WW2C 3FA5A 1BZ7A 4L2LA 4JNXA 3IN2A 2KLSA 5CBAB 4GMTH 4GAYA 3CV6A 3S5OA 4CU8A 5ISZE 3USZA 3VMNA 2VZTA 1J8RA 1TR7A 5C08A 4AJVA 2F68X 2XQ0A 5SX5K 3HNTH 3RY6A 2X1XR 1T8QA 2Y5JA 4GG6F 4KJQC 3U2SB 2PTTA 1YXYA 1ZVYA 3UAJD 3ITOA 5FJOA 4UAOC 4OFVA 4FSAA 3MNMA 1QI2A 3T6CA 1LBMA 4QD2E 2PDFA 2Y1HA 1OB1A 3K6FA 3H4WA 5T3XL 4X5PA 2PDYA 2OEKA 3R5EA 3KJ4C 4HSHA 4QPEA 4X6BB 1EX1A 4AC1X 1FH2A 1GS8A 2J8GA 5KSBE 4IF2A 3F7PC 4AMKH 4HWZA 3MFFA 4FZ8L 2DORA 4B16A 2DMHA 1BFVH 2WO3B 4XAWH 3BURA 1E5AA 3KYNB 4FG4A 2CLKA 4HKZA 3M88A 4KNSA 1OGSA 1H7RA 1MFUA 5LKYA 2CLVA 3AIWA 1OFBA 1RK6A 3SKNA 2VZ1A 4PWGA 4R4BA 3IGFA 4DUVA 5I1KH 5BS0A 2VXTL 5CCZA 4HHGA 5DSCA 3XINA 5L2KE 3NPSC 4XGZA 3S96A 2VM8A 4YBQD 5AC6A 1SFDA 1EWEA 5EIQA 1KFEA 3G3MA 2MOQA 4F37K 3ARDA 4Y8EA 5FL1A 2ZZ5A 1ZSXA 3IJLA 1OGBA 4LHUB 4M43H 4JQ1A 3VI3A 3FX4A 3AS2A 3HG0A 1SPDA 1XGRA 4EOWH 4YE4L 3IETB 4YSEA 4URIA 3JXAA 4BKTC 1LGVA 3QJRB 1AIFB 4GI4A 3MLZH 5DJ2A 4IOIA 3UZXA 4DCQA 1W9PA 1RJYA 3RAJL 3QZWB 5D6DA 1HSAA 1IBZA 1PJWA 2PP7A 3UYIA 2ADYA 4FK9A 2AKRB 4TKWA 4UTHA 3KOXA 4AD5A 4JDTH 2FL5A 3MRMB 5FYKD 2VDMH 3PWIA 1CBVH 4Q97A 1K4GA 4CMMB 5DUML 2VXSL 1DBML 3W11C 3NIGF 5BCAA 3HVNA 3GEWB 5DT1L 4OW6A 1KIUA 1CBJA 3BXWA 4MFEA 2QS8A 3KS0J 3DIVA 4L4TD 1DVFB 5IFTA 2A6IB 5D04C 5LA0A 5DQJB 1IXNA 2UVFA 2VXVL 4HW6A 5B3JF 2BVYA 4PUBL 3ULSB 5C0IB 4OT7A 4BFIA 4ZXOA 4W4QA 4FAMA 5E6IC 4LARL 4AQOA 2QJDA 3THUA 4GINA 1SY6L 2V5CA 1FNSL 2QCEA 3ATZA 4P5TB 4Q89A 3D0LB 1O66A 3A9IA 2AJUL 3BHBA 1GZQB 2ICSA 4DWSB 3PHAA 5IHUH 2YN5A 3MCMA 4Y8FA 1KGUA 1PD6A 3D7PA 4AISA 5BRPA 7PTDA 2JKAA 3ZLQC 1IGJA 3T8LA 2YS4A 2QUMA 3MV01 2EC8A 1I3VA 4MA3A 3NGJA 2WVTA 2VDKB 1ZPLA 1JVNA 4KW2A 3WY2A 2YSSA 2YL5A 3HZMA 4AZUA 2OQJA 3GH5A 5SWQB 1CFVH 1UWRA 5IJDC 1OW0C 1MF2L 4M6QA 1OCCB 1FP8A 4H1ZA 4W8LA 4D8OA 5FUCC 3EA1A 3AJXA 4JPVL 4PJDF 1NWTA 1F3DJ 3WLOA 3W2NA 4UQEA 2WCPA 2E3VA 1EAJA 1TOXA 3T4WA 3C2YA 5E8PA 1ZLVK 1J6OA 3HO8A 3OAZK 5L88H 4ZMNA 5TJWK 4URTB 1D9KA 1SVBA 2GI0A 2PNDA 2J27A 3BE7A 1K9TA 2DVUA 3KPSE 2J88H 2UWFA 2E7BA 3WE1A 1QPQA 2IOOA 4YUEL 4I4WB 5LG6A 2YFNA 2ADGA 3QQ4B 5HYJE 2YDQA 4UOZA 1UB5B 3GLAA 2GJNA 2OMYB 3DU0A 1TQUA 4IMDA 4BHUI 1NC4D 4G72B 4NWUH 2VEGA 2GGHA 1QG3A 2XSKA 3HE6A 1UIOA 3BP7B 3V7AE 3UG8A 5CAYB 4E9RA 4FS0A 4PMVA 4PJ9A 3O8AA 3SDDA 3K46A 2AXGB 4U3SB 3BOFA 3DVNA 1F18A 3AADB 3E1ZA 2VZ3A 1HKLL 5CJ8A 1S3HA 4Y4FC 3LHWA 3DFYA 3I6TA 3NK4A 2IMMA 5H37G 5KANI 2YLLA 5MHSD 1LMKA 4FLOA 1KCRH 3N1PC 4I6KA 4NZTH 3AIQA 1WBYA 4YGVA 2AEQL 1MCNA 3BT0A 4OGYH 4JMNA 1AKJA 2VYOA 3PAVA 3UR2A 4DGVL 4ZXBD 5F7MC 5ESQA 4GC4A 4BWUA 2GPZA 3L81A 1L6PA 4GXUM 3U4BH 2EZ0D 4ZTPL 3FB6A 1EA9C 3D3VB 1FZKA 1PZAA 1ZHNA 2Z2AA 2FLBT 4LSVH 5A8MA 3ZHFA 1XF2A 1Q2SA 3IDYB 4FMKA 4BUGA 1KTNA 1E6JL 3VA2C 4XVEA 1X5FA 2PWFA 1L5GB 1YDOA 2HTKD 4FG6D 2PLJA 4IQEA 3NM1A 1L4IA 3UGEA 4DN3L 2F54A 4PTDA 1C1EL 2TSAA 3ESVF 1JWUB 5HI3C 1OSPL 2OMUB 2P5WE 3MNWA 3O45A 1ISYA 3N04A 2XPYA 4KDVA 3BP4B 2IBZY 3ZKMD 3AREA 3CLWA 2EO7A 3G8RA 2VEKA 1Z9MA 2IADB 3CAFA 5FW7A 3O1NA 4UILH 4FNPA 5CIPB 1AP2B 2LW3A 4MNMA 1FYTE 1UR8A 1CJYA 5IXEA 1VENA 5HD8C 1DWGM 3KJ6L 1FH5H 2HEJA 3VU1A 4PGDA 4O2FB 3GF8A 3OHMB 2ZSVA 3TIMA 4NP4H 4ZO9A 3DUUB 1BIHA 2BNRA 4NZFA 3UCCA 3O4OC 2FZBA 4I1NB 1HL5A 5DUBB 1ADOA 3GO1H 1OP5K 2V17L 5B8CB 4H5SB 4PJGB 4DGYH 3SGZA 4IBLT 4C6KA 1XH0A 4GMTL 3FO9A 1M6UA 4MD4A 3T1FA 2OJ1A 4OZ4B 4OD1H 3M6DA 4OCNC 4Z7WB 5JXED 2NLJB 1YY9D 2ED7A 2F6KA 3HNTL 2ZBTA 4QLRA 3AZSA 1LOSA 5AVSB 3RWDB 2XIQA 5FXCH 4NILA 4B5WA 2FJGA 2D4FA 1P9MC 3S2LA 1OM0A 4WX2A 4QLLA 2XQBH 4MDRA 4G83A 5HNNA 2X6MA 1I4NA 4JFSA 5C55A 2L4OA 4KVNH 4OM0L 2E27L 2IQAB 1WNOA 3GO2A 5EH1A 4ZX5A 1V3KA 1ZRQA 5EO9B 3TEYA 2PPAA 1KB9K 1ITCA 1YNLH 2P8PB 3IJQA 1ICSA 4IJCA 4P4RB 4XAWL 2MTAA 8FABA 4Q4QA 2APXA 1TUFA 2GVJA 5IFJB 2FLIA 1H7OA 4PRHE 2Z93B 3B8TA 3PBGA 1O75A 1GHFH 1NWUA 2D0FA 3QC3A 2ZZ7A 1KLFA 3VQMA 3TGXA 4EQ3A 3NCYS 1VFBA 5I1KL 3PHQA 1YTKA 3M1OA 4TXEA 2VGLM 3ORWA 4KVCH 1E4IA 2XZCH 4BF7A 3QFJA 1HHGB 1BLNB 4LOVA 5CMAA 2ZXQA 2W59A 4ILSA 5K2ZA 4M43L 1CL7H 5AAMC 4Q8UA 2Z9TA 4E8GA 4BQ2A 2CR0A 2E77A 4PB9H 4S10A 4Y9CA 4PLJC 1IGYA 1ZTXL 5CJQH 2VQTA 1G7LA 2WOYA 4EOWL 1JPMA 4WIWA 4FX5A 2XWCA 5KYYA 2PU1A 2PWVA 1YEYA 2TSYA 3KG5A 1GKEA 2IEPA 3GNDA 3U48A 3WDPP 3AMCA 4JDTL 1ZUAX 5HHOB 3I7RA 1CBVL 3WLNA 2Y89A 3SY8A 1TJMA 3N6HA 5FPIA 4G5DA 4GKTA 2ZG1A 1H0GA 1ORQB 3AWOA 4MDJB 4PUUA 2QKIC 1ZL1A 2VO5A 1GJPA 3NL6A 1W1TA 4Y4HA 2RACA 1XKJA 2FTAA 3I6GA 1N8WA 4X9FA 1BXBA 1GVIA 3SYQA 3KZ8A 2AERT 3T05A 3W1XA 2HKHH 3BSZA 4DBUA 3FYYA 1TTUA 4R9HA 4PJ5D 2WZHA 4O00A 1U8QB 2ZWYA 1A6AB 4PFEA 3CZSA 3V3WA 3U79A 4QDGA 4Z7UF 3TN5A 1UA3A 4A38A 4L1DA 1BWLA 2H3BA 2Y6SD 2C9UA 3FZUD 1FZJA 5IR1A 1A9VA 3TFKD 2W9MA 1GONA 2W0KA 2H9GA 5IHUL 1Q6RA 1Y0LA 3TYFA 1IBDA 3SCNA 3F7RA 1FDLH 4O52A 4D6FA 1IM3D 4B7IA 1KM5A 4H6QA 4DVOA 1NQBA 1VYRA 5DBTA 3I6EA 1G7HA 1CFVL 3FCUB 1TV5A 2F74A 1FG2A 3T4AC 1X6LA 3EOAB 1EJXC 3R0KA 4DYEA 2ONEA 4E38A 1SMOA 2KS0A 3G6DH 1F4XL 3KAOA 4HYTB 3E5PA 1GW9A 1B9BA 3QH2A 4LWWA 1WA2X 5L88L 4MA7L 4JNZA 3RBSA 5U4NA 3AOFA 3CL6A 4A21A 1TCDA 4DYJA 3D08A 2J88L 3H7VA 3F1QA 3BWSA 1XGQB 4JS7A 2ABBA 2NY0B 2EDKA 3RWEB 3DHPA 5JPMC 2WV8A 1QZ1A 3EYOA 3UZVA 4AIEA 3F5WB 4WDUA 2NZ9C 2P9RA 4JNMA 5FI8A 1FCVA 3MQTA 3ANVA 1AHWC 1KLGB 1KV7A 1P5UB 2N1TE 1TQSA 1NMBL 2WNWA 1RCQA 2RFXA 4Z0BH 3O3DA 3R12A 3VWJC 2LLNA 1TVHB 3BAWA 3VYLA 3L9RB 4Y5YC 2KZKA 1Q6LA 3MA8A 2EC9T 2QQKH 3S2NA 3CM4A 2QF7A 3L2LA 1BGXH 1YPZE 4FXKB 1U41A 5FW6A 4OF5A 5BVPH 4K5NA 3H2WA 3QIUC 4DZIA 5INCB 1KCRL 2NXIA 4NZTL 4EPKA 4AMAA 5BWFA 4XMWA 1ZVSB 1XR9A 1VFAB 2WXHA 3EUUA 4P8VA 3IE4A 2BOEX 3TV3H 3U4BL 1ASPA 3DKHA 4HUUB 2PDIA 3MRGB 3F5LA 4LSVL 2AV1B 1QXLA 3ARPA 3L3IB 4AVFA 1CZ8H 1G1OA 1DZBA 3IXTB 5KS9F 3ANYA 4EPBC 4NHUB 4WJ8A 3OV6A 4DRSA 3WH9A 1H5BB 5EBGA 1N0LA 1Q9KB 3UYPA 5I75B 5HY9B 3LD5A 3WD0A 1GH7A 1T7YA 1JZ4A 1JV5B 3GYEA 4XZUB 2QDWA 4NI6A 4P4KC 1BIIB 4MG4A 4FKEA 2BIPA 2E5CA 3UJSA 4TV3A 5CJBA 5HATA 4LBAA 4Q33A 4XMZA 4GACA 2Q3AA 4M56A 3GZQA 3AU6A 3VZZA 2W61A 1J5IA 4Z7WF 3QHMA 1RD5A 1EL3A 2XKNB 4UILL