4UQDA

X-ray structure of glucuronoxylan-xylanohydrolase (xyn30a) from clostridium thermocellum at 1.25 a resolution
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
390
structure length
390
Chain Sequence
HMASATINLSAEKQVIRGFGGMNHPVWISDLTPQQRDTAFGNGEGQLGFTILRIHVDENRNNWSKEVATARRAIELGAIVSASPWNPPSNMVETFTRNGVPNQKRLRYDKYGDYVQHLNDFVAYMKSNGVDLYAISVQNEPDYAHEWTWWTPQEMLRFMRDYAGQINCRVMAPESFQYLKNMSDPILNDPQALANLDILGAHFYGTTVNNMPYPLFEQKGAGKELWMTEVYVPNSDSNSADRWPEALEVAHNMHNALVEGNFQAYVWWYIRRSYGPMKEDGTISKRGYMMAHYSKFVRPGYVRVDATKNPTYNVYLSACKNKKDNSVVAVVINKSTEAKTINISVPGTSIRKWERYVTTGSKNLRKESDINASGTTFQVTLEPQSVTTFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conservation in the Mechanism of Glucuronoxylan Hydrolysis Revealed by the Structure of Glucuronoxylan Xylano-Hydrolase (Ctxyn30A) from Clostridium Thermocellum
pubmed doi rcsb
source organism Ruminiclostridium thermocellum
molecule tags Hydrolase
molecule keywords CARBOHYDRATE BINDING FAMILY 6
total genus 138
structure length 390
sequence length 390
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uqdA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uqdA02
1V3MA 1GQIA 4QLJA 3ARPA 2E0PA 2VZTA 1UD2A 1BGGA 5D9OA 4AMXA 2ESCA 1JXJA 4PMNA 1KR1A 3GBEA 2WKLA 1TCMA 3WF1A 5EFDA 2ZUNA 5AYIA 2F61A 5E0FA 3PZQA 2XWDA 3AHYA 3VIOA 5KEZA 1QNRA 4IPLA 2WBGA 4Q7NA 1B3XA 5HBFA 4H04A 5BCAA 4J3SA 3ZO9A 1R85A 1ZS2A 1K6AA 1UZ1A 1K9TA 4Z2GA 3N1AA 3AZSA 1FP9A 4YHGA 2G3MA 1U30A 4BQ4A 2E8YA 1E9LA 3GNOA 4A4AA 2BHYA 1CIUA 3L4XA 5LYRA 1MWOA 2DPEA 3A24A 4DO4A 4KRTA 5DFAA 1BPLB 4TX8A 1B3WA 4HPHA 1JD7A 1WZLA 2WHJA 3AS3A 1QHZA 1H41A 3PZNA 5IFPA 3WH9A 1A47A 3BUIA 4HZ8A 5CPSA 4D1IA 3BVXA 1QW9A 5JIWA 4MB4A 4ATLA 2D3LA 3QGVA 2RGLA 1UQYA 3DDGA 1VJZA 2PF0A 4U31A 1E3XA 2WAGA 1UHVA 1XD1A 1H49A 4CCEA 2YA0A 3VIPA 4AC1X 4WLCA 3GXDA 2VURA 2JFEX 3VGFA 4NRSA 4ATWA 1E3ZA 4WIWA 3EDDA 1X1NA 3BVTA 2X0HA 3WUFA 2YJQA 3AS0A 5ABEA 4W86A 2QPSA 3VDBA 1FH8A 1E1EA 1OD0A 4ZE5A 3WD4A 3CGTA 2YLAA 4DWSA 1CYGA 5FD0A 2F1AA 1F4AA 1OGSA 2CHOA 3NUKA 2WHMA 2OSWA 2WMHA 1IV8A 2X0YA 1HVQA 4LQ1A 2WYSA 3VM7A 4GI9A 1U2YA 2WCAA 2AAAA 1NWTA 4Z2LA 4UFHA 1AQMA 1I75A 3AZTA 1ISWA 4FNUA 4HA3A 3VDAA 4ACYA 2ZWYA 1LJYA 2WPGA 5IHSA 3W29A 1J01A 3FW6A 3VD5A 3ALGA 1KCKA 2CYGA 3W0KA 1HJSA 4FF5A 2EACA 2OW6A 3LX9A 1Z32X 1BGAA 1JD9A 1TQVA 3NSNA 2ZXDA 3OLEA 3VIHA 4RE3A 4JFUA 5C70A 1EO7A 1KXVA 2WVUA 1VEOA 2QV4A 1Q6EA 2EADA 3RMEA 4NXSA 1JZ8A 4W85A 1EDGA 2XHYA 1WKYA 3MU7A 5DF0A 1JZ5A 4GIAA 1UWUA 3BAIA 4Z2HA 4IISA 3AXHA 3WNLA 3WNMA 2Q8XA 1WE5A 3ZQ9A 4MDPA 2VI0A 3MS8A 1DWHM 4J3UA 5A94A 1NWUA 1HN1A 3KLLA 2RGMA 1EXPA 3VSTA 2WC4A 1TUXA 1W2PA 3HU7A 5I0DA 1J11A 5A8QA 2WNWA 3FAWA 5BROA 1MYRA 3M07A 3RIKA 1GVYA 3VIJA 5C8BB 3EDJA 3CZEA 3BLKA 4QAWA 2G41A 2CETA 3W26A 2DH2A 1A3HA 3W82A 1TQWA 1C90A 2ZOXA 1SZNA 2CHNA 1LF1A 2F2HA 1H0IA 3SUUA 5BXRA 2YL6A 3GYCA 4DM1A 5A6BD 4PMOA 3MUAA 5E9AA 3VIFA 3EJTA 3MMUA 4CVUA 4PMYA 5CSYA 2O9TA 3KZSA 1ZL1A 2X09A 1E40A 4GKLA 2BS9A 4U2YA 1E4LA 2VCCA 4MB5A 4HOXA 3CUFA 5A2BA 3WQ6A 3K8MA 3MUY1 2W92A 1JAEA 3F5LA 1KQZA 4A3HA 1AQ0A 1QPKA 3MO4A 3QR3A 3WL1A 4CKQA 4U2ZA 4JIEA 5A6SA 4M24A 3I3DA 4QDMA 1U33A 4CU8A 4AIEA 1CWYA 1DWJM 1V6XA 2WMIA 1LWHA 3ARQA 4HA4A 2J7GA 3LXAA 2DT3A 1H1NA 3AICA 1R8LA 1R47A 3QHNA 5BRPA 2F7RA 2E3ZA 2BVDA 2BV9A 1OT2A 2J7EA 5A69A 2YDSA 1I1XA 3DX3A 1BG4A 3VSUA 4YHEA 4E8CA 3WF0A 3ZJ8A 2VRKA 1LL7A 1MW0A 5I3DA 2J7HA 1EQPA 4UNIA 1E4IA 3TOPA 5FIPA 4FNRA 1MQQA 1OINA 2E40A 4HU0A 3GNRA 3L4TA 2BVTA 3DDFA 1GQLA 2WC7A 3VMPA 3FAXA 1EO5A 4UQEA 1XH2A 5AY7A 3TTYA 2XVLA 3ZT5A 1WNOA 1RPKA 1ESWA 6A3HA 1QI5A 1MFVA 4PMUA 1CXEA 2FHCA 1QI4A 1WZMA 3TONA 2ZXQA 4H8UA 1G0CA 3EJSA 3WH7A 3RM8A 1JI1A 2EPLX 1R33A 3PZTA 3W6MA 1NWSA 1L8NA 1RD6A 1V0NA 1JZ7A 5E0CA 1ZBKA 3T2PA 5I6SA 3BLPX 2YDQA 3A4XA 1QW8A 2G3JA 2WZEA 3VOCA 4AWEA 1BTCA 4KRUA 3GDBA 3IJ8A 1H5VA 1ISZA 4UQDA 3VD9A 1QI2A 4UQBA 5ABHA 3KLKA 1O7AA 1UWQA 3PTKA 3WMSA 6CGTA 4MNLA 2EPNA 3N17A 3A6OA 3AIEA 4MTVA 4AD1A 1DEDA 4BQ5A 1CGVA 1KGUA 3ARZA 1Q4NX 4PMQA 4MB1A 3DHPA 2XM1A 3OLIA 3WELA 3ZR6A 1J9YA 1ZJAA 4MJ2A 2O9OA 1W3LA 3NCOA 4XZWA 4FK9A 3VGHA 1R7AA 4AIOA 3BUDA 4JKLA 3MSDA 1UD6A 1OSEA 1HIZA 4AYGA 3MUIA 3WY3A 3CTTA 4D6FA 5BXTA 5A2CA 3VD3A 4RL3A 1VB9A 1V0MA 3SCSA 3IK2A 1PJ9A 3ARXA 1CNVA 3B9DA 4MDOA 2WMIB 3F5JA 4V2XA 1PZ3A 3GXPA 4AW7A 3VVGA 1FH7A 3LPFA 4CD6A 1KGXA 2WZHA 1VFUA 3CZLA 1M7XA 1KQYA 4GXPA 3RCNA 3I3EA 1Q6DA 5FL0A 1C8YA 3UEQA 5GQBA 1TQUA 4UR9A 3WNNA 1L0PA 2DIEA 2QMKA 2XG9A 4U33A 1YHTA 1HF6A 4QCFA 1V6WA 3HN3A 1TZ7A 2Y5EA 1ECEA 1GORA 4HTYA 1UOKA 4B16A 2TAAA 3CLWA 4P7RA 1DHKA 4TVDA 1JFHA 2VNCA 3MUZ1 1JZ2A 2WMFA 3WDHA 1E6ZA 4B15A 3AIQA 3L4YA 3ALFA 5FKYA 4FLQA 4D6JA 3AIVA 3SUSA 5M17A 5BWFA 3O9NA 2J7BA 3L2MA 1UKQA 2X2IA 4URIA 4M1RA 1ZJBA 1CGWA 1FHLA 3VKKA 3LMYA 4AZIA 2XVKA 1QWNA 1JDCA 1JAKA 4AZCA 2V3EA 4GPNA 4DUWA 4GQQA 4C7FA 2BXZA 1C93A 2DT0A 3ZR5A 3T0BA 3LXBA 3EBVA 3RM9A 5E70A 3CZKA 1EA9C 1V3IA 5A6LA 5A2AA 3W27A 2XTKA 1XGZA 3CBWA 1M04A 2WLYA 2WLZA 4BCEA 1UR8A 1AMYA 3POHA 4B3LA 1E0XA 4NX0A 1CBGA 1VEMA 4M29A 3AMKA 3WNPA 4CN6A 2QPUA 4NSBA 3AYSA 4DO5A 1HTYA 1FH9A 3WY1A 4WF7A 3VPLA 2FGZA 1V6VA 4HPGA 2VOTA 4KMQA 2J47A 3OGVA 4BZYA 2D0HA 1PX4A 1UASA 4DM2A 5BXSA 3VIMA 3CHEA 2XVPA 4N0RA 1EH9A 1EHNA 1VBRA 4WK9A 2OYMA 5EB8A 1V6YA 4F8XA 4XV0A 5LA1A 4AMWA 2JALA 2OSXA 3AQUA 3UETA 2WHKA 1XSIA 1OB0A 4D1JA 4OKDA 2EJ1A 3BGAA 1JZ4A 3O2LA 3AJ7A 3BAYA 3B9AA 1OGBA 4JHZA 2J8GA 4W5ZA 1XH1A 3CH9A 1NARA 3CHFA 3T0DA 2PC8A 4YPJA 3ZSTA 1BHGA 3EYPA 5DMYA 2JIEA 4NF7A 1B3YA 2VR4A 1G94A 2OWCA 1E70M 2C7FA 3GXIA 1BFNA 1HL9A 4X9YA 2OLHA 2XSBA 2A3CA 3WY4A 1WCGA 3BSHA 2D0FA 1VEPA 4H41A 4C7DA 3DX2A 3GZAA 1H0GA 4QCEA 4W5UA 2YIHA 4JAWA 5CGMA 5DO8A 3NSXA 4W7WA 4PUEA 1X6LA 2VRQA 1LG2A 4CU7A 5F7UA 4TVCA 2EEXA 2J7FA 3OA5A 3W24A 1V3LA 3ARTA 1NP0A 2WVSA 3KL0A 2F7QA 2PWGA 1G01A 3AHTA 1QHPA 1UD3A 1WZKA 1W3HA 5GNXA 1K9DA 3IAPA 3WD0A 3NJ3A 3ECQA 1HJXA 3AMDA 2W67A 4H7VA 3U7BA 3HG3A 2HVMA 3FN9A 3PZVA 3VM5A 1TR1A 1VFOA 1IT0A 2E9MA 1B0IA 1B3ZA 3RO8A 2XJ7A 1Q6FA 4NZCA 2O92A 5GNZA 4NZJA 4AZ6A 4ZXOA 4LXFA 2WW5A 3WFLA 1HWWA 2PBGA 1HJQA 1J0HA 5ABGA 1OGGA 5M3WA 2V5DA 4AD2A 3S5ZA 1QHOA 4UFIA 3SURA 1CGXA 3PN8A 2GSJA 2J62A 2CPUA 3CC1A 2YL5A 4J27A 2BFGA 2FH6A 4AD3A 2YBUA 1UA7A 1LWJA 1LL6A 1LQ0A 3CUGA 4AISA 4GO8A 2VCAA 2XGIA 5IDIA 5D8ZA 2ZX6A 4P7LA 1W1TA 3SCNA 3JUGA 1TQTA 4EANA 4UZUA 1V0KA 1MXGA 2J75A 1WDSA 2WK2A 3D3AA 3L4VA 4D6EA 1BVNP 4CCDA 2DSUA 3GXTA 2EQDA 3WD2A 3WF2A 1B9ZA 4F66A 1DWIM 3NDZA 3MMDA 1H2JA 3WH8A 4UOZA 3WD1A 4CUCA 1B90A 1PX8A 4BS0A 5IXEA 4J3TA 1UR0A 3EJQA 4J3WA 3U5UA 4LGXA 3BUBA 1GJUA 2UY2A 2B31A 1M01A 1QNPA 2EPKX 2XIIA 1CXLA 2WB5A 2WMKA 3FXYA 5DT7A 1V6UA 3WY2A 4MNMA 4HP5A 4NRRA 1ISVA 4QLKA 1B30A 5CPTA 1UKPA 1GUVA 2PWFA 3OLDA 3W4RA 2BY1A 2WBKA 4TXEA 1UH2A 4EK7A 1KCLA 2X8RA 5LA0A 4TUFA 1J0ZA 4WJXA 1E0VA 4HZ7A 3VILA 2A3BA 4UFKA 3SCTA 1V03A 3ARVA 2GJXB 3VDCA 4HZ6A 3RJYA 3THCA 4PSPA 3K46A 3ZIZA 3MMWA 3EMQA 1VF8A 3DC0A 1GHSA 3WDRA 1FA2A 2J4GA 2Z1KA 1W9DM 4GZJA 2J77A 3AMGA 3WDPP 2CEQA 3GH5A 3OGSA 4UCFA 1CZ1A 1FOBA 4JL1A 2G8ZA 3KL5A 3TP4A 1EQCA 4H8VA 4UQAA 7CGTA 5I5RA 4KGJA 2VQTA 8A3HA 1W9BM 1HL8A 2QMJA 3ZJ7A 3AHZA 3IAQA 2ZUVA 4PMDA 4D72A 4NI3A 4OOZA 4LX4A 2OYKA 4H8HA 1UD4A 1UKTA 4MB3A 1KXQA 1K9EA 1W91A 3A21A 1V02E 1KB3A 1KWKA 2XN2A 2UY4A 1C3FA 4UOJA 5AYBA 3BLBA 3CUIA 3FHQA 5A8PA 2VX5A 2WSPA 1XSJA 3VIKA 2OWWA 1KXTA 1TVNA 3WMCA 2WWDA 4AMCA 2QHAA 3MV01 4W87A 3SUTA 1J18A 3SCVA 1XSKA 2VL4A 3AHXA 3EJRA 4PMZA 4W7VA 3T0AA 1C7SA 1S46A 1JF5A 1I1WA 2JF7A 1QX1A 1VFFA 2YDRA 3CO4A 4X0NA 1J0JA 4JFVA 1XYZA 3LRLA 1LL4A 2YKKA 2YOCA 2CESA 3NSMA 2XSAA 2GJRA 3A4AA 2WMJA 3WEMA 3PZ9A 4M82A 3WL0A 4CCCA 4TX6A 1ZBWA 2VO5A 2F7OA 4CD7A 1QBAA 2OSYA 1E43A 4OBRA 2O9RA 5CPQA 4GZIA 3ZJKA 2WC3A 1R75A 2J7DA 1VIWA 1XCWA 1HP4A 5CLTA 1UH3A 3UG5A 3DX4A 2GDUA 4FNSA 1W1YA 3VNYA 3WFZA 4AZCB 4IPNB 3N9KA 4HA1A 3U7VA 1XRVA 1B31A 2X1IA 5CXPA 1EDTA 2X2HA 3SCQA 2IXUA 3WSUA 2MANA 2VVSA 3D51A 2WCSA 1C91A 3DX1A 1OM0A 1RP9A 4C7GA 8CGTA 4ML4A 3GM8A 1G1YA 2CBJA 3FNDA 4JFSA 1X6NA 2DSVA 3NIYA 5E6YA 4S3KA 4CGTA 3B8SA 1DTUA 3WUGA 2ZXBA 1WAWA 2JF6A 3WEZA 3W6LA 4DWSC 2YFOA 2NT1A 1QI0A 5I79A 1HKIA 4U3CA 1UR4A 3KL3A 1KFWA 3VMOA 3U57A 2W4XA 1GOWA 1G9HA 1GHRA 4ZENA 4WKFA 1T0OA 4OZOA 3CZNA 2E9BA 1QI3A 4FNTA 2WZIA 1OD8A 3SUVA 1E0WA 4B9YA 3ZM8A 1UD5A 1W1PA 2VRJA 2CERA 1BYAA 2VTFA 4AD0A 1V0LA 2XVGA 3EMZA 5ABFA 2VX7A 2XWEA 1EGZA 4B3KA 1ISYA 4M81A 4CN4A 1W3KA 4TTUA 4F9JA 5D9NA 2BY2A 2WWCA 4ACZB 1DWFM 1XC6A 9CGTA 5JIPA 3ZOAA 4R27A 1KBBA 1WZAA 4W8BA 4AIUA 1CENA 3QOMA 2BHZA 1E4NA 3OLGA 1TG7A 3PZMA 3LPGA 3QOKA 1N82A 1BSIA 1JNEA 1R87A 3T2OA 1OBAA 1H09A 2DSZA 3CV5A 4BQ2A 3A22A 4WSJA 2J78A 1E6PA 2A3AA 3D4ZA 2J8FA 3WF3A 2DSWA 5I24A 1E72M 3ZT6A 1H11A 2ZICA 1NOUA 4Z2IA 1C7TA 3WKZA 3APGA 2Y8KA 4P8XA 1WO2A 4PCSA 4P8UA 2D3NA 2XVNA 3PTQA 2ZUMA 2DEPA 2D20A 3WUBA 2D24A 2CXGA 4ZXLA 1UYQA 4HMCA 4JL2A 3EDFA 4PSRA 2D1ZA 4E8DA 2E8ZA 4GINA 1VBUA 4UOQA 2QLYA 2NSXA 2NW0A 3BUQA 2G3IA 3W28A 2WVVA 3ZSSA 3U5YA 5FCZA 2W62A 2VC9A 2G4FA 4OUEA 4EE9A 1D2KA 2X2YA 4CN1A 1CXFA 3EDEA 3RILA 4L4OA 4TVUA 2F18A 3BVUA 3LXCA 2EO7A 2EPMX 1V02A 4AXNA 5JUVA 4XZBA 3ARYA 4CD5A 4JCLA 5A3HA 1OIFA 1XCXA 1HJUA 2XFRA 3CHDA 3WD3A 3KE0A 3DYMA 1HX0A 2WCGA 4GO9A 2XM2A 4KH2A 1SFSA 1XHGA 4P7NA 2XIBA 5LA2A 5ECUA 1GW1A 4B9ZA 2J25A 2WKGA 2FHBA 1VJSA 2OYLA 3VGDA 1JNDA 4P8WA 3AMCA 1V3JA 1UD8A 2CBVA 4FNQA 1GZJA 3VX1A 5I2UA 1WDQA 4LYPA 3BMWA 3BMVA 2GUYA 2XYLA 2V38A 3ZJ6A 5M03A 2GDVA 1Y7VA 3PZGA 1CEOA 1UQZA 3AROA 1ITCA 4UTFA 5GPRA 1E6RA 4W89A 1NWRA 2W63A 2W91A 4EKJA 2DH3A 2VJXA 2GK1A 3PZIA 3VGGA 1WDRA 2W66A 1MW3A 1DWAM 2ZIDA 3AFBA 4P7OA 3PBGA 3LRMA 2CBIA 3CMJA 3VD4A 2AMGA 1CLVA 3F4VA 1UR2A 4ZE4A 1CLXA 3BAKA 5KZ6A 2OW7A 1JDAA 3MV11 1BYBA 3WUEA 2VT0A 3EJUA 1C92A 3OZPA 1ZBCA 1MQPA 4W8AA 3ZMRA 1AQHA 4AEFA 1E71M 3K8KA 4JFTA 3ARRA 5GNYA 1PX3A 5FOOA 1UWTA 1GQJA 3BXWA 3CZGA 2XN0A 4KWUA 3F5KA 4BF7A 4PTXA 3S2CA 1RH9A 4V27A 3CZSA 2AOSA 5A6KA 3SCOA 1XV8A 1EOMA 4QLLA 1W9PA 2D23A 3D5HA 1CGTA 5D9PA 1CECA 4OJYA 1B2YA 3HG5A 1W9UA 5EBAA 1MW1A 2DDXA 4PTVA 3OG2A 4EAMA 2BVYA 2CKSA 1E4MM 3N11A 3VIIA 3UERA 2V3DA 4E4PA 4CD8A 2YL9A 4F9DA 4XX6A 3MKKA 2Y24A 4HMEA 4NZFA 1GOMA 2ZUUA 2YLLA 4AYSA 4PUDA 2Z1SA 4WSKA 2G3NA 5IHRA 3AIUA 3FY1A 2ZE0A 1TA3A 3GH4A 4PRWA 2X05A 2XN1A 1E5NA 4RE2A 1KTBA 2ALWA 4N42A 4RE4A 1ZB5A 4PN2A 4DO6A 3H53A 3WBAA 3IJ7A 1QVBA 1VENA 3O6AA 1HNYA 4OBSA 5E6ZA 5A6AA 2FE0A 1W3JA 3AXXA 4J3VA 1TA3B 3J7HA 1MQRA 1UA3A 3VO0A 4HOZA 3VGEA 3HJEA 3SCWA 3IGUA 1HKJA 2EAEA 2FDMA 2IXVA 5HPOA 3UG3A 4W8LA 1NH6A 3DYOA 1TE1A 3KWXA 1NP2A 2CIPA 1XYFA 1BYDA 1GQKA 1MVYA 3N13A 4ATDA 4XB3A 2A3HA 5M5DA 2CCRA 1JFXA 4FLRA 4AZBA 3UG4A 2VVNA 5CSUA 5A6MA 4OGZA 1QNOA 1VAHA 1UR9A 1R34A 1HP5A 4MAZA 5I78A 1GCYA 3VD7A 1CXKA 1Q6GA 1O7DC 1IZKA 4JFWA 3W81A 4UZSA 5CJ5A 4U3AA 1B3VA 4PYSA 3PHAA 5BXPA 2O9PA 2W5FA 3WF4A 1KBKA 3VTRA 3K4AA 1D3CA 2JE8A 1UH4A 3AIRA 4PEEA 3H54A 3A5VA 3B9EA 5EMYA 1JYNA 1ODUA 4UFLA 4OIFA 1UWIA 2PI6A 3PTMA 5A8MA 2DQXA 4AZHA 4GI6A 3UR7A 1ODZA 1JGIA 2J7CA 3WIJA 3AI0A 2CITA 3M46A 3T09A 5D4YA 3TTSA 1WB0A 4M80A 1P6WA 1HKMA 1UG6A 1GPFA 1VRXA 1C8XA 2JEPA 2A3EA 1JZ3A 2WSKA 5HOSA 1TMQA 1KR0A 3GTNA 1E5JA 2BXYA 2BNJA 2Y2WA 1V08A 4AY1A 3AXIA 2WANA 1GJWA 3KEHA 1O6IA 1US3A 1PIGA 4P7QA 5CQ1A 3OZOA 2CNCA 1MXDA 4Q22A 1HJVA 2BHUA 2V3FA 3H55A 4TTGA 3WH6A 1TFVA 2GK1B 3CPUA 3L4WA 4HMDA 1ZBVA 4E2OA 3GXNA 1BVZA 3VDHA 5TD4A 1UKOA 4D71A 3BH4A 3G6LA 1GVIA 1UUQA 1QNSA 3VNZA 2WMGA 3AZRA 4LYRA 2F1BA 4D6IA 1E6NA 3BAXA 4IM4A 5AC5A 1KXHA 4Z2JA 3II1A 3A4WA 3WBEA 4OOUA 2XUCA 1KTCA 1PS3A 4V28A 1WDPA 3VGBA 1PPIA 5EFFA 5AC4A 1JG9A 3WDQA 2PBOA 4UQCA 2UY3A 2V3GA 1BLIA 3G6MA 3EDKA 4NXKA 1GONA 3WDJA 2FYVA 3HMCA 3BAJA 1NQ6A 4D6HA 5A1AA 1DWGM 5JBDA 4JCMA 2YA1A 3WQVA 3WQ8A 4MADA 1JDDA 4W7UA 1HJWA 1Q6CA 3SCUA 1ITXA 1PIFA 4J3XA 3AIBA 2J74A 4D6DA 1CGYA 2D22A 3CHCA 4IUGA 4AZGA 2ZX9A 3GXMA 4W93A 4M56A 1M53A 2JIWA 3UESA 3AYRA 4DUXA 5A8OA 2BY0A 3OBAA 3D52A 1V3KA 2ZUTA 3UR8A 4BA0A 3W25A 4PCTA 1J0KA 3L4UA 1QNQA 4GI8A 1WPCA 3T08A 1E15A 3VINA 1E1FA 1LG1A 2Y8VA 2EPOA 1W9XA 2YFNA 1WP6A 5CGTA 3BVWA 2ZWZA 4Z2KA 2DT1A 3N12A 2PB1A 1CTNA 6TAAA 4K68A 4LYQA 4FNPA 3WNOA 3RDKA 5FL1A 5IFTA 2XFFA 3ARSA 2C8NA 4ZFMA 3NDYA 1RP8A 2VUYA 3POCA 1R46A 1GOKA 3THDA 2DT2A 2YL8A 1BF2A 4WKAA 2X2JA 5C71A 3HG2A 4J28A 3DECA 4PTWA 1R86A 2CBUA 1BG9A 5DT5A 1J0IA 2J79A 2DIJA 4X0VA 3BSGA 3BUPA 1HXJA 1E55A 2VR5A 5DEZA 4UQ9A 4JKMA 4WKHA 3A47A 4CVWA 3E1F1 2PWEA 2VMFA 4JHOA 3LPOA 3WQ5A 1GNXA 2W61A 4DWSD 3L2LA 3ARWA 3PZOA 1NOFA 2XPKA 3OB8A 4U5IA 4MAVA 3HG4A 4FLSA 2ZUSA 1UZ4A 3WH5A 4ACZA 5D9MA 3AOFA 3BAWA 2YBTA 1E6XM 4AZ7A 3A23A 3IANA 3AS2A 2ZXAA 1C8QA 3S5YA 2WM0A 3MSGA 2V5CA 5ABFB 2VZOA 3SUWA 2OWXA 2C0HA 2IGTA 2D2OA 3BVVA 2GVYA 1BQCA 4CD4A 4CU6A 3WQ4A 4FMVA 4F79A 1FFRA 1TVPA 5HDRA 3WENA 5CZKA 2F7PA 2IUZA 2UY5A 1PZ2A 1J12A 3QHOA 3CZ8A 4XUYA 4A3YA 1F4HA 1OCQA 5A6BA 2WXDM 3CIVA 1MW2A 3SIMA 4AD4A 5A6JA 1JF6A 2VZVA 1JL8A 3QHMA 4AD5A 5HNNA 1PBGA 2PWDA 3SCRA 1EIBA 2GJPA 4W88A 4QFUA 1E6QM 1EOKA 1HT6A 1SMAA 4PTMA 1EDQA 1BAGA 3WDIA 1VFMA 4JZ5A 1LLOA 4MPKA 5I23A 3RJXA 2E9LA 2E4TA 4LPCA 3WEOA 1PAMA 4PMVA 5CLWA 2HISA 2F8QA 3AHVA 3LPPA 3TA9A 2VCBA 3DHUA 3AMLA 4J7RA 1H3GA 1FP8A 1E73M 1D7FA 1JZ6A 3T2QA 4Y7EA 3WNKA 1UWRA 7TAAA 3DYPA 1JYXA 1OIMA 3AISA 4DWSB 1UKSA 5CG0A 3TTOA 4HU8A 3BC9A 1KGWA 1HKKA 1FHDA 2VZUA 1HVXA 1IZJA 3M6DA 1QWUA 3VUPA 3W38A 1XD0A 2DSKA 1MFUA 4PMRA 1US2A 3N15A 1FFQA 2VZSA 2WHLA 4PMXA 4KGLA 3VU2A 5BYWA 4D6CA 1YQ2A 2VX6A 1J10A 2VQUA 3K1DA 2EABA 1NOWA 3WMBA 3EMCA 1JIBA 1JXKA 3FHAA 2GFTA 1JYWA 1UWSA 3HZ3A 1SR0A 5JBEA 3AIWA 2D0GA 2QF8A 3VMNA 2VX4A 4FLOA 1QBBA 2FH8A 3RM4A 3ARUA 1NM9A 3OIHA 3OGRA 1JI2A 1B1YA 1CGUA 3AS1A 3S6TA 3TV8A 4QP0A 4W84A 3VSVA 5BRQA 3N18A 4U5KA 3CUJA 1JYVA 3PZUA 4DUVA 1GOQA 2UWFA 3VX0A 3D4YA 4JKKA 1GOOA 3W37A 1SYTA 3UCQA 5HPCA 1PEZA 4MNKA 2ZX7A 2XGBA 3CUHA 3GXFA 1BYCA 4HOWA 3CMGA 1H4PA 7A3HA 5I77A 4GQRA 2CKRA 5E1QA 4H2CA 1ZU8A 3WN6A 4P8VA 2D73A 5E09A 3L4ZA 3SEPA 4MNJA 4PBGA 2NT0A 3M7SA 2GJXA 5D8WA 2EBNA 2EXOA 1UR1A 1TQSA 2FGLA 5A8NA 4GZEA 5HXMA 2YA2A 1EHAA 4UFMA 1DP0A 3TTQA 3ZT7A 2ZUWA 1G5AA 1GOIA 1W2VA 1OT1A 1E56A 2ZX5A 2Y4SA 3BCFA 2WVTA 3GBDA 1QOXA 1R7OA 4BQ3A 3LRKA 4MJ4A 4S3JA 3D50A 4UFJA 1W9VA 4YN5A 1SMDA 3BCDA 2FHFA 4M8UA 5JBFA 4ZEPA 1ISXA 4TOQA 2ZX8A 3MI6A 4AEEA 3I3BA 1CDGA 3MANA 1CXHA 3RPMA 1CPUA 1CXIA 1W1VA 5A95A 1M03A 1E6SM 3IJ9A 3K8LA 2WVVB 1HXKA 1OWQA 1W32A 3A3HA 1K9FA 3N04A 1XH0A 2JEQA 3WQWA 4R5EA 2BY3A 4AZ5A 3VIGA 4L4PA 3CZJA 1J0YA 3NYDA 3EJPA 3GNPA 4D6GA 3K4DA 3W53A 1AVAA 2PWHA 1V3HA 1KWGA 3DX0A 2XFYA 3GH7A 2DGAA 3SCPA
chains in the Genus database with same CATH superfamily
2OXHB 4O58H 4IKJA 1V3MA 5FEXA 4AC4A 2ZQ0A 3BLLA 4UU9A 5DHEA 2W0KA 3C56A 4YVUA 1B57A 3KXFD 2VZTA 2V2CA 2HT2C 1HKLL 2JQAA 5BVPH 3PBMA 2CKBA 2D7PA 4F7TB 2AJ3A 2CLPA 4OF7A 5CLYA 2SFPA 4PMNA 2AVGA 5T5NG 1KR1A 3OJVC 1JGUH 1XIWA 5EU9A 3F7VB 5EFDA 1GIGH 4Y8FA 5E9DA 4POUB 3T2NH 3MRGB 4XPBH 5E0FA 3PZQA 3H7UA 4HSHA 4L4MA 4Q2ZA 1NQBA 5JR1H 2R1MA 3CHPA 3HE6D 1DJQA 1XF1A 5KEZA 1GG1A 3WLPA 2HLEB 1QNRA 4Y1SA 4IPLA 2A6LA 2A9MH 1TJRA 2R56H 4ZTYA 4X5WB 1G7VA 4Q7NA 2W38A 3VXMA 1B3XA 1WICA 4I85A 4RDVA 1R85A 4NASA 4PMFA 3T2NL 2EEAA 4L1SA 1ZS2A 3SODB 4CMHC 5H37A 4CNNA 1F1AA 4CQDA 5D7JD 4XOCA 4LK4A 4BZ2L 4N6FA 5EZLA 3G18A 3EOEA 3UY8A 2DZUA 3RVWD 5ID0A 5JA8B 4HA0A 4YQXL 4JX5A 1URZA 3N44B 5LXXA 2H3KA 5MERB 1BP3B 1YECH 2DM7A 2CLFA 3GBNL 3Q37A 3SAZA 2AL2B 5DA0B 3ZZQA 1VCBC 2QSTA 5C7VA 3BSZA 3LIZH 3BH9A 2BHYA 3SSZA 3L4XA 3KTCA 1RK1A 4Z7WB 3A24A 1XF4A 3QEQB 4RX4D 4NZ3A 5CPMA 1JMZA 1WK0A 5EU5A 1B3WA 2OT1A 3GKFA 5FWRA 1BG1A 4Y1AB 1WBXB 4HUNB 5SWUA 3RYMA 1ZHLB 1BOYA 2XV2A 4POZC 1XM3A 4DX3A 1CICC 4KZDL 3RLSA 3TCXA 5C0CB 1RVFL 4I18C 4K2SA 3NTCH 4XPAH 1ZTXH 5H2BB 5KS9E 4XVJL 5HYIA 5HHOA 4HAFA 4X6CA 2L0DA 4JZJA 2O5XL 3TGXA 1QOKA 3QYCA 1FWXA 3W9DA 4IBUA 1S2TA 3JZEA 4OT7A 4GXFA 4PJEA 2IQTA 4AC2A 3QS2A 5D8JL 1OOAA 4FFYA 2WZMA 3BUIA 2IBBA 4K9JA 4O02A 4D1IA 3DV6A 1L3WA 1HHJB 2QVTA 1NEZG 3BVXA 5D7IE 3SJVE 4GB9A 2VGLM 4KZCA 1NANI 3ILDA 4Y2OB 3ZTCC 4M1BA 4KROB 2P24B 1MDAA 1QLEH 4C1NB 1AR1C 3QGVA 3U9UB 1UQYA 3P3TA 2EYRB 4K1WA 1MHCB 3URAA 2HT4D 3MSPA 1HYSD 2OOFA 3B3DA 2Y7LA 2R0WL 5D6CA 2DQUH 3CQKA 5AN7A 3GHTA 4A6YH 1EJOL 4CCEA 5DJXA 3VIPA 4A7VA 4JQ1A 1BXUA 2IPKB 5I74B 4OFDA 3QPXH 2O55A 3GVWA 1TJXA 3NGBB 4NC2B 3GXDA 3OSVA 5MEPB 1QFEA 2JFEX 2EE9A 1UBPC 3N4EA 1I4FB 1B2WL 3SGKA 3TA3B 3HCVB 1KM4A 1X1NA 4WIWA 3AQZA 4TNWK 2AK4A 4P99A 4CNUA 4F8NA 4DK6A 4PV8B 4LC8A 3SCMB 1KBWA 4GT7A 5IIEA 4XO7A 3DK0A 4PJXA 4PS4H 1EXUB 2QPSA 4X9BA 1EJSC 2ZG1A 3HUJB 4HV8A 4W4OA 5FA3B 1S9WA 4WW2C 4Y1AE 4DQWA 4X2RA 3G08A 2GAZB 2YLAA 2VC2L 1CLOL 4Y89A 2OI9C 2VISB 4KCWA 3BPCB 1BJMA 3EOBA 4PB9H 4O0KA 4Y5YC 3HKFA 5I3JA 5B3JF 2XWXA 2NY5L 5ESQB 1P84J 3QJSB 3UYOD 1R17A 3SDXA 1P0NA 1JUBA 2WMHA 1IV8A 1MREH 1K4GA 12E8L 3OPZH 3SDCC 2P5WD 3TFKC 1E1CB 3QXAA 2YGYA 4HJ0D 2BP8B 2WYSA 3PB0A 1C5CH 4WQ6A 3GSOB 3K6SA 4F7PA 1BA9A 1U2YA 1TPXB 4YDZA 3CPGA 4JY8A 5C2GA 5DGRA 4TVPE 2OKMA 4TL5A 3EX6A 5B7EA 2F53E 1DXEA 1T96A 4UFHA 4Z2LA 2PCPB 3FFCA 1RCXB 1RZGB 3FOKA 5ETUA 2GVEA 2J20A 2OFJA 4NO2B 3QEHB 4CA4A 1BWKA 4CNIB 1KBIA 4I18A 3WQPA 3VDAA 2WYZA 4NCC2 4QX4A 2GK2A 4FG2A 3PG9A 3R13A 2ZD0A 1LJYA 2E75C 1TV8A 4EXKA 3H70A 1J01A 2CA3A 4BFEA 1LK3H 5D2TA 2DU2A 4PLKC 4J6RL 4ZQKB 2XHNA 2Z0IA 2FTWA 3W0KA 5SWSE 5D2NA 3FB8B 2Q86B 1GVOA 4FF5A 2AJXH 4R0LA 3IXTB 2EACA 2ITFA 5KZCB 4H00A 5FDYA 3RNQA 2OW6A 1A3WA 1BGAA 3PK7A 3TYCA 4TNFA 2OJZH 4I9MA 4M6VA 2NSQA 4UF7C 3VIHA 4DY1A 5E7FA 3LK6A 2YCEA 2MFNA 3X3FH 4JFUA 5H94A 1H3VA 1F8IA 1H5BC 1VEOA 4L2LA 4WUKH 2EDDA 4GXVH 2JCCF 5LXEA 3LM3A 3N6QA 4W85A 3TBYB 2FVNA 1J8VA 1OW0A 5DF0A 1TSIA 2FDBP 1GEQA 3KDMB 4OM0H 3SE4C 3V1HA 4X60A 1MCRA 2VDPL 1BIIA 1QFUH 4FQQB 4GIAA 1UWUA 3EWWA 4ZQMA 3BG9A 3F12A 4G2DA 3IS0X 1UT9A 2BG5A 4I0PB 3URNA 4Z2HA 3IJSB 1TLMA 4QHLB 3BPLB 5E99H 3ZQ9A 1JWMA 3DX9A 4B27A 2VI0A 3RWCB 3U1QA 1K03A 2Z35B 4IU3A 1HN1A 3KLLA 1RQHA 1U1HA 4YVPA 4F15B 1F4YH 4W4QA 2QCHA 2DLEA 4KROD 1N7ML 3UAJD 5J5EA 3E38A 4KHTL 3E96A 3PY2A 4W81A 1HYSC 5I17B 4OZHA 1W2PA 3VFCA 5I0DA 4IP5A 5GGQL 5A8QA 5FA4A 3Q65A 4WCJA 5G2IA 1PZ5B 5L8JB 2Y69B 3G3LA 1R5IB 4LPUA 2XXFA 3L3OC 3FU0A 4XNYH 1MYRA 1QUNA 2W0FB 3BHBB 1GVYA 5C8BB 4Z3FA 4K7YA 3Q8CA 3MX0B 1N4XL 5EMKA 4UINH 3N5AA 5H6HA 4OZIA 3BLKA 4L3EE 4QAWA 2SODB 2G41A 3OAYH 4AENB 2IANA 3KRZA 1U8KA 4AITA 1YE6A 4RNJA 3T1GA 4NT6B 2RJMA 3WFBH 1BBDH 2NW3A 4ES9A 1XCTA 4LVDA 1UXSA 2CHNA 1DV7A 3SOBH 4K6AA 3G6AA 4KKZA 4X6BB 4Q4SA 3N14A 4G5DA 2X3AA 5DI8B 1SFJA 5EY5A 4YNYA 1BZ9A 3QQ4B 2EVGA 2HNHA 3GYCA 4AH7A 2X4SB 1ZLWH 4LKXB 3R8QA 1KZYA 3VTMA 3ZE2E 3OWEA 4NKIL 3EJTA 5B1AB 4HHMA 3BVDB 4G6ML 1A7PH 2CGRL 3IGAB 1S5TA 4JREB 4K94H 2IMRA 3FYPA 2O9TA 4PMYA 5CSYA 1ET5A 1M7IA 4PJAF 5A7BA 4N1EA 2X09A 2Q8BL 4GKLA 4U2YA 3OB0H 1Z0MA 3JRKA 4IQHA 4M6OH 4MB5A 4KCTA 5FF4A 1P7QA 4Z7VA 5D37A 2EUXA 3WQ6A 5I0YA 1M7PA 4QTGA 1GHFH 1TWZA 1WAAE 4YC2C 2L7JA 4YHYB 3QJXA 2G3FA 4YVXA 1KPUB 1B0RB 2X2UA 5DEJA 1F13A 3MRNB 3NZRA 4YHOL 3MYZA 1BX2B 1DE6A 1DJHA 3CXHK 4YYCA 1CL7L 5EZIL 1O7VA 2Y7QA 3MCKA 4UDTA 4GG6B 3QR3A 4HK3J 3RB7A 4CKQA 1J5OH 2YPVL 4QHRA 4KXCA 4DQOH 5ANMA 3CIQA 5DUBA 5T5FH 1N0LA 5JHDB 3GQYA 3VG0H 3PJWA 1E8YA 5A6SA 3V5KA 4M24A 5EOCH 2NY1C 1RIUL 3VFWA 4BCYA 1WKFA 4ML4A 1WBYB 4WDXA 4ZW8A 2LLLA 4B97A 4CU8A 1CWYA 1DWJM 2X4OA 3ARQA 4I1RA 3PIQB 4DW2H 1ZAJA 4R2GC 4ZFGL 3T7VA 1YY9D 5FJRA 4G7YL 1ZA6B 1NUDA 3EO1B 3AICA 3SE3A 1NCCH 3HM7A 5TE6L 3CXDL 3IDYC 1A7RL 4IH3A 4LRIC 5GZNC 1OK4A 1IC5L 1TPXC 3BKMH 4G3YL 5DLML 4GUJA 2WWKO 4OY9A 5I1DA 5F44A 4X9FA 3INUH 5HHXH 4NYUA 2NQCA 2E3ZA 3QS3A 4QDGA 4TULH 1NGPH 2ESVA 1TV5A 5C3IA 4Z0XB 2YAMA 3TASA 5XIMA 4B95C 1G7QA 1TREA 4YHEA 5GGTA 3TV3H 4H26A 1ME9A 5JXAL 2AKRA 3ZJ8A 1RZJH 1PNDA 4MDJA 5T1KB 4ZFOA 1MW0A 3S8FB 3MBEC 3E6HA 2VUNA 2J8UA 4M9OA 5DD0L 1RJLA 2J7HA 4IRSD 5D2NC 3W2JA 4Y2DC 1HOCA 3MQIA 1MPAL 2YD1A 1W80A 4XB7A 2VL5B 4MCMA 4H20H 3PQYE 1YTDA 1A1NB 4I0PD 4I3SL 4ODHL 4RZBA 5D93C 1QMUA 1ED3B 3BO8A 3CQFA 1I7ZA 4EI5B 4BHUI 1XRSA 3LMZA 3M43A 1MQQA 4IFKB 4HU0A 5MKGB 1FN4A 1MFBL 4WUUB 4H83A 3SO3B 1X97A 4A2HA 3TWCL 4IPPA 4QHKJ 4PP1C 3QUXA 5SWQA 4WK2B 1ECYA 1ZT4B 3RJOA 3N40F 1MPAH 1GQLA 1MFCL 1NJ9A 3VI4B 1TX2A 3K1GA 1C9DA 3T05A 2AKZA 4ODHH 5DHXB 1OP5K 4UQEA 5CPNA 3W87A 4AGOA 4BEIA 4YX2L 5AY7A 2WQVA 1IE4A 3ZT5A 1WNOA 5G2HA 2XWTA 1RPKA 3NURA 1P7TA 1KIPA 1E9IA 2EE0A 4Y8DC 1QI5A 1MFVA 2F58H 1CXEA 5JOEA 1V7YA 3DI1A 4PMUA 5EU3B 3BOLA 2OBGA 3U2SA 4LAMA 1DCEA 1NKOA 1OPOA 3EH2A 3NDYE 4QOKE 2ZXQA 1WUZA 4I77L 1VQTA 2YYTA 3GDLA 4HBCH 3PNZA 3WH7A 1Y1DA 1LOQA 3N6JA 4HJ1A 5J3HD 4QIRA 3TCLA 1R33A 3PZTA 5AOZA 4YDJB 3X2QB 2CZEA 1G7PB 2B08A 5KVGH 3MY9A 4GHRA 1J2BA 1ENUA 1B2WH 1V0NA 1JZ7A 3CPRA 3U7YL 2G75A 1N7KA 5E0CA 2OPCA 1RA5A 2QQNH 5EUKA 3FUFA 2PDXA 2VR6A 4N8VA 4ACPA 4F9LC 2PCQA 1RPUA 2WB7A 1G7IB 3NZSA 5D2NE 5D71H 1AL8A 3KJ6H 2CZFA 2YDQA 2C7UA 3QJRB 2C3ZA 3BZ5A 4K3EH 3ARDA 3GXUB 4RLDA 1KB9K 2DZVA 3VOCA 2OELA 5ICYA 4L1HA 1FWSA 1G0DA 4ZOBA 3GTVA 3IU4L 2JJSA 1ISZA 1UCBL 1Q2SA 3BIKB 3LCLA 3TA6A 5LNWA 1TMCB 3IIXA 3S5OA 4JO2H 1E9OB 1HHKA 3D0AA 3QSKB 3VI4A 3ZKXB 3W1PA 2QZQA 2OK0H 6CGTA 1RZJL 3VXSD 4XNUH 4HWBL 4AAJA 3VFNA 3N17A 3PWPD 4KK6C 5DD6A 3OTTA 2KHAA 1K4CB 1TTIA 4MTVA 2J2ZB 3B9KB 4QRQB 2F7FA 1KGUA 2W81C 1YYLH 1KXVC 1A1NA 2BK8A 2XQ0A 2C4XA 1FFPA 1ZKAA 2CNZA 3KS0H 4N5EC 3IJYB 4HEMA 3ITXA 1KCUH 2AJVL 1XBDA 3GS7A 4FB7A 3OVGA 1XLKA 1CLCA 1MNUL 1SEQH 4MNGA 2NLYA 1NMBH 4HCGA 4YLCA 1IC1A 4MFDA 5CS7A 1X5HA 3QUXC 2Z7ZA 1SYVB 4KVPA 5BZZA 4GUOA 5FX3A 4HQQL 5A2KH 5IROD 3ULVD 2VEGA 4ZFGH 3WK0A 4B90A 1MJUL 3MV8E 1OK6A 3GJFH 1MRDH 1LWRA 1S7XB 3GMQB 2WWOA 3R0MA 4YIQA 4LAQL 1CCZA 4ADIA 2ACSA 4Q6YA 5FKAB 4MCZA 4PJ5E 3MSDA 4TPRH 1VD6A 4L9LB 5CINH 3SY8A 1MZHA 3QMRA 1NMAH 2B16A 5F7EH 1VFAA 3WY3A 4NNBA 4CSZA 2H2SC 4NAEB 3QHFL 3IVKA 3HG1B 4KAQH 2WD0A 4LAJH 3TO4A 5E8OA 2QPXA 4RL3A 4H7CA 1XINA 2K7QA 1NGWB 3ARXA 3IWUA 3PIQA 4UTAH 5IG7A 4ORGA 3HE6B 4ZYKA 4XZMX 3TC9A 4V2XA 1LBLA 3S6CA 3G24A 3GXPA 1BEYL 3GVVA 4AW7A 1NIUA 1N67A 1PD0A 5I8CA 3LPFA 4YSAA 4I5UA 4LF1A 1OFDA 4J3ZA 8XIMA 1OAQL 3UYPA 2WZHA 1T6MA 4UBPC 1NC4B 4WI2A 1OP3H 4H20L 5D7JB 3HRZB 4HCLA 5I6XB 3TN0C 3UEQA 4PMEA 3XISA 4QE5A 3B7RL 4KXDA 2CK0H 4HSQA 1AD0B 2YXOA 3WKMH 5F71A 1QLRB 1FGNL 2EXYC 4XVSL 3M9YA 4XAFA 1GKOA 2QMKA 4JM2A 2OO6A 3GS6A 2UUDH 4GYKA 3V0WL 2OMNA 1DBML 1YAIA 5B38G 1GYCA 3IPBA 4M7JL 1HF6A 1K02A 3N9SA 1F6AB 2R51A 3QULB 4QXUH 3HN3A 1DL3A 5DXXA 2CW6A 4BKLB 5KVFH 4LJ3A 2AQSA 4CDGC 1ECEA 2QQLL 3NJMA 3QUMH 3MRQB 3QWOB 4MNQA 5J6SA 4G6JH 1UOKA 3GS4A 4DEUA 4F33B 5ACZA 3BKML 1XLAA 1BZ9B 3QQ4A 2EUVA 4GY7A 1DBMH 3CLWA 3ZHLA 5JPMB 1OF8A 3NACH 3PPSA 2PE4A 2OX5A 2ZYIA 3MUZ1 5JIKA 1JZ2A 5D03A 4JTGA 3MRJB 3CFEA 1E6ZA 2QJGA 3VKDA 1OGTB 1QO3A 1TJGL 3R06A 1JCVA 4K3JL 4P2RD 4RGMB 4NENA 2EDJA 5EN2B 3UZQB 5JDSA 4PUWA 1CVRA 3GD1C 4X5PA 2IANB 4AENA 1FC2D 4FLQA 5F7WC 5I1IH 4DVBA 1NU5A 3XIMA 3SUSA 4D6JA 1QBLH 2PP7A 4GQZA 4L1DA 3TW9A 5C9UA 4ZOAA 2OOGA 2J7BA 2BVEA 4WHCA 1BQHG 5TPWH 2X2IA 4G83A 3R11A 4LCIL 1RJPA 1XDLA 3T4YB 3VVVA 3ZK0A 8FABA 4JTDA 1ZNNA 4L6OA 3VE7A 3GSQB 3GSNA 4O5LL 1TJHH 4GBXA 3SKMA 4X5XA 2N7AA 4URIA 2GC7C 1F58L 2Y23A 3V4VL 1ZJBA 4DHLA 4E42A 1AKPA 4M1RA 3GSXB 2QTEA 2K8MA 1FHLA 1M1SA 2E9IA 4C56D 1TITA 4PRDA 1JDCA 1S5NA 3IMTA 2KBGA 2IAMB 4R97C 4F9LA 2C18A 3NM1A 4B96A 4HJFA 1JUFA 4BDVA 5HGHB 2BXZA 1C93A 1I2OA 2WXOA 3ZR5A 1A53A 4Y4HB 1OIOA 5E5LA 5TDNA 4Q9BA 3LXBA 1BXVA 4MX7B 3SDXF 4QHLA 5GGSA 2YUXA 3T0BA 5C8JB 1Z8AA 3B9KD 1P4LB 3RM9A 4NN6B 3SGDH 4ZPTB 2P1FA 3BT0A 3QAQA 4TLSA 1XQLA 1LT8A 3GNDA 4R53A 3RURA 5T3ZL 3RAOA 1QBMH 3FB7B 1X5MA 1GAFL 5AB3A 4HZ1A 1A9VA 1W17A 4WTXA 4Z7IA 1QPQA 3H2MA 5D4JA 5A2LH 1GJIA 5EKYA 3UPBA 4LYKA 2WLYA 4ECNA 4D94A 1P5UC 2WLZA 4D2NA 6TIMA 4PJXF 4OFKA 3REVB 3TESA 3L9CA 3K30A 3QZBA 4FJ6A 4B3LA 4HUUA 1U9KA 2RA1A 4F92B 1K5NB 1VEMA 2IDFA 2VSDA 4D9QE 1CBGA 2XPYA 1E0XA 4U10A 4I4WA 5H94B 1BW8A 4CN6A 5C8JA 2HSIA 3MROB 4NSBA 2HX7A 4DO5A 5LSMA 2YMXH 4LVHC 1FH9A 4WF7A 1HXMB 2AJSL 1U8PB 3B2UC 2FGZA 4W9HC 1VCVA 2I07A 1XGPA 1ZP3A 2XCMC 2C0AA 4YHIA 15C8L 1IGIH 3CWHA 3H23A 1R3QA 2VOTA 2L4OA 1ORSA 3KZPA 3QI9A 4WK0B 3R1GL 4P07A 1WZ1L 4ZQKA 4ABQA 4KMQA 3HFYA 2J47A 2VDLH 3KBJA 2C14A 5ABZA 2WCPA 3ESMA 4X5XB 4K2UH 5EBMB 4BZYA 4DKEH 1UASA 3NQBA 5F7EL 3P5ZA 4WGXA 1W15A 4DM2A 5BXSA 4JE0A 5L2KE 4HH9B 1ITBB 4N0RA 3T4YA 3NA8A 3P80A 4NUPA 5C0AD 1EHNA 1UCBH 2POZA 1T0MA 3GU2A 4A2FA 2XV0A 2IKJA 2OYMA 3MLSL 5EB8A 4ZGYA 2F54A 1U92A 1OAUL 3Q8FA 3IDGA 4LLUB 4UTAA 2V8ZA 2JK5A 3RIAF 5LA1A 1QO3B 1KRCC 3NQ2A 3VQLA 1Z9NA 3K5SA 2VKXA 4QRTB 4AMWA 1QFHA 1SPDA 1JN6B 3UTZA 3SIZA 2JALA 4HUXA 3MLUH 2DZAA 3QEGH 2WHKA 4PG2C 4OKDA 3ITCA 3NEOA 4K5LA 4M9PA 4TL4A 1OZTG 2VXTH 3PFQA 5AZEL 3CQQA 3B9AA 5B8CA 2VAAB 4JHZA 4NUWA 4W5ZA 2Y5TB 3WGUB 4FQJH 4ICNA 1F6AA 5HI5D 4JRYB 2R2HB 1OSPH 4FQHA 2G5BB 4M62L 4M5PA 2GAZA 3LHWA 3S46A 3LH9A 4YPJA 4IBZA 5B3NA 1FUYA 1RZQA 4TX9A 4K7FB 2JJSC 2JIEA 4UV4H 4BSWB 4AH2A 3DIDA 3WHE0 3BUYB 2BVWA 5I5JA 4JFPB 3L5XH 4LLDA 5IIEB 1E70M 4YVNA 1UURA 3UG8A 4AHQA 1QA9B 1M9SA 4N24A 5A7EA 1QLEL 1DN2A 4ZI8A 2XFXA 4OLYH 1KFAH 3GXIA 2ADIA 1GS8A 2B0SH 3LKSB 4X9YA 3CT2A 3L5WA 2OLHA 2XZQH 2BVPA 4P4KB 2DQCL 4WI6A 5D6DC 4YSTA 1RAMA 3H4GA 5FGSA 1HKVA 2A3CA 1WCGA 2DWSA 1ONXA 3LI0A 3KDOA 3DX2A 3GZAA 3VD0A 5T9BG 2OZ8A 3LN9A 3OR7B 4N0UE 4JAWA 1JK9B 3IJ6A 3B97A 3CXHJ 1HGWA 2KPWA 3OG4B 4MAYD 4GYFA 5I1AA 3TFBA 4EI6B 3W00A 5GIRB 3EYUL 1SJCA 1YN6A 4RFOL 3TEWA 2CR3A 4PUEA 4HUUB 3TJHC 1LG2A 2VR8A 4CU7A 5DR5L 5F7UA 2MH4A 1E8WA 3T6ZA 2FB3A 4KEZA 3QQWA 2Z3FA 3QFGA 4L9LA 1LRTA 4IDJH 4MA7L 1WOAA 1EAJA 3D7PA 4AVHA 5CAKA 5HGDB 2QR0B 2J7FA 1E9PA 2PD5A 3C52A 2NQJA 4A2LA 2AVFA 1UCWA 3ARTA 3MRDA 3CN4A 3WS3B 3D85D 4PS3A 2VC2H 1R3JB 5AUMB 2WVSA 1NP0A 3UADA 3JU2A 1R5VA 3ABOA 4ZR8A 1ZE3C 1VC4A 5I1HL 3QV9A 4KXZI 4OQTA 1W3HA 3DO3A 3UYRL 4IIQB 1OAZH 1H3PH 4F15C 3GW0A 3SPCA 4Q8OA 4XMKL 4LU0A 3WD0A 1KTRL 3X1BA 2EILB 2BP0A 1CGSH 2GBTA 1XF4B 4G8AC 3ECQA 3LQZA 5F88A 2Y07L 3TPKA 5LKNA 2M8XA 4FX6M 1HJXA 3AMDA 4J2PA 3U6RB 2AL2A 2W67A 3CNYA 3FA4A 5D2XA 3P93A 3B0XA 3NZPA 3U7BA 2HRHA 4GAGL 4MXQD 4R26L 4B60A 4ZTOL 4L1GA 2QDVA 2IF7A 3PZVA 4MDOA 3NIFF 1MWAB 3VM5A 1TR1A 4GY4A 1VFOA 4FXGC 1GTHA 4XUGA 4PI2A 3JWNG 4YL4A 4P2AA 1NFBA 3RO8A 1YDNA 1A5FH 1Q6FA 3O6CA 5GNZA 5FUCC 3RZCD 2O72A 2BERA 3C60D 2DKMA 3FQRB 4ODTH 4BE6A 4BWLA 4LB3A 2WW5A 5B39G 3WFLA 3HB3B 2XINA 3KHDA 1P2CA 4HWZB 1PV8A 2PBGA 5I1CH 2VM8A 1A7NL 1J0HA 3MNWB 4L9DA 3TYAA 4Y8EA 2QT6A 2DWDA 1QQDB 5C0AB 2V5DA 1GGTA 1QHOA 4U1HB 3T71A 1C29A 3KRSA 4O50A 4ZS6C 4TV6A 3N1FC 4TMCA 4FS9A 2ZOLA 3D48R 1INEL 4H6KA 3BO9A 3T1FB 3FCTA 2XU9A 2B8OT 3BE1H 3MOBH 4OZFH 2GJ6B 3N29A 3S42A 4AU0A 3GI8L 5E94B 2GFBA 4U1IA 3FS9A 5AW2B 2YYUA 1Z9SA 2ZZ2A 2BFGA 3LUTA 2MOVA 4LOCA 4AIBA 2CUIA 1LWJA 2P8BA 3CUGA 4MJ5A 4K7PY 3EFFA 3RGVC 2EDKA 1QZNA 3K81A 1MHHA 2GHWB 3KNBA 4PRPA 4Y1TA 5I1JH 2UZ9A 5HWMA 1P53A 1ONQB 5H8UA 5E56A 2OMYA 5EO0B 1DSWA 1ETZA 1AGBB 1ZCRA 3PL6C 1MXSA 2J5LC 3QZPA 4I7VA 4PWIA 4QHPA 4BFIA 3JUGA 1ONQA 1TQTA 1AA1B 1XLIA 3G9VA 1BQGA 1IM3B 5C2BL 2OVLA 1MXGA 4CQBA 3IMWA 4L0YA 4LVNB 5IHWA 3FS2A 4Q6IB 2AQWA 2R0LH 3HGJA 4D6EA 4M8QB 4DRSA 7ODCA 3LLDA 3FUHA 4C90A 4K15A 3GXTA 5IF0A 1JPIA 4PCNA 4XSLA 5E8EB 3G5WA 2OMAA 3WF2A 1B9ZA 2IKIA 5GGVY 2WLKA 3FTSA 2A4AA 4ZQNA 4KUCF 1ZDQA 3QPQC 2QSCL 5AC7A 3NMEA 1R9YA 3AAMA 4J4KA 3BFWA 3PQYD 2BVOA 5GZOA 2JELH 1X7QA 4PGCB 3KPTA 5F1NA 1X9QA 4ZSOB 2YQ2A 3UZ5A 3F58L 1JHLH 3JWNH 4MYPA 4XPHH 4O13A 2JCWA 2XRAH 4RRPA 1P1XA 1NAKL 4J3TA 2ZCGA 5IXEA 3FOMB 2A83B 3K72A 4J3WA 3RGBA 3EWZA 3BP4B 4NUJB 1GJUA 2AJUL 4LGXA 1N4XH 2V5KA 3EO0A 1UWEL 4Y19A 5AYYA 4U6XB 1C08A 1J79A 1L6SA 1AQ8A 1HK6A 4E0CA 5DYFA 4RZCA 1YEDB 5D2LE 3UTPD 4O02H 2EPKX 4KTGA 4MFEA 4ZXBB 3L5HA 3KVLA 2WB5A 3EYVA 2VC5A 1AD9B 5DT7A 2HQAA 5FECB 2V5TA 5DZLA 3WBDA 1OAUH 3WY2A 3KLHD 4JTJA 3QWNA 2HWGA 4MNMA 4TUOA 2REQB 4MZ8A 2NY4C 3F7QA 5D2VA 2I1OA 3BDYH 3FTXA 5F3BA 3A9IA 1B30A 1WDAA 5G4MA 4Z7WE 3WIHL 2K45A 3KYAA 1LEGB 4LTSA 4FI7A 4BFGA 2QULA 1LO2L 4FALA 2XTLA 2BSLA 3K71A 1XIGA 5JLZA 3TDFA 3CDGB 5AVTB 4NZ8A 2ZDRA 2X8RA 1R19A 2L7QA 1F6LL 3T3MF 1YVLA 2UWEB 3WS3A 4HS3A 5MI0C 3RCYA 2DMHA 4LCQA 2WINB 3JWOH 4L8SC 3O9WD 2V81A 3RVWC 3FT2A 1JDFA 1OAKL 4KK5C 3ABXA 5SX4I 3MP4A 1VPOH 2FWSA 4JY4B 4O9HL 2FMOA 4HZ6A 3BGGA 5TDOA 3QZLA 1XBVA 4DF1A 2BBFA 2GTZA 4LQFH 2CO3A 1U8HA 4UDTB 4YOKA 3BK0A 4JTQA 4PS7A 1IAII 3W2NA 1HHGB 2WWMD 4PSPA 1UZHA 3F6LA 1OVZA 2GG1A 2RTTA 4R4ND 3SCMC 4ZSUA 3RNKB 3SDXE 5EO1B 1PZCA 5FAAA 3RZCB 4FIQA 3UXLA 3PY9A 2P5WA 1VCFA 4F5CE 2MQCA 1BVWA 3K2MC 4LOVA 4Z3GA 3VYPA 2A6DA 2ZNWA 3MXWL 1N3NB 3UAJA 5BRZA 5BVPL 5E93A 2UVFA 1XKJA 4Y88A 3H3BC 2XH7A 4QXTA 4RDBA 4FZEL 3QORD 3RFRA 3P62A 3TXVA 3GWQA 3CJPA 3A4FA 3D2TA 4HIXL 1PY4A 3X14A 3TYDA 1FWEC 5LWYL 4RXFA 4LP4A 1WVZA 3CZFA 4YNYB 1FHGA 3HQNA 4P2QB 3BL3A 4PJHA 4HWNA 4UQAA 1OGAD 1UXSB 1X9RA 1GMIA 4F2EA 4IJCA 3PJUA 3N44F 8A3HA 2Z27A 4HXBL 1H7XA 5TF1H 3A13A 1J5DA 4FQHB 4DIXA 4R5XA 1IKFL 5EEZA 3KW3A 4PMDA 4DJFC 2UWEE 4YZFF 3HG1D 1LVEA 3I85A 1A49A 4OOZA 4OW6A 3FONA 1XICA 1FX6A 1IT9H 5FW8A 4JM0A 2YPKA 3A9BA 4O51A 3SI9A 1E3FA 2FB4H 1IBGL 1LO3H 1P5VB 4HXBH 2WZPA 4IMCA 3QUHA 4EVNA 5IWLA 1UWAA 1K9EA 2XG5A 3EUUA 3QDGB 1DE4B 4ALAL 1T4KA 4US5D 5IQ7H 1KWKA 4HJTA 2VDPB 3GMMA 3MUHL 4X9IA 5AYBA 3IDGB 4HEME 3S1GA 1Y0LA 3FHQA 1PYWA 4LT7A 4HLZH 3STBA 5L2JB 3D46A 1QSEA 4RQQB 5A8PA 2OLDA 1XSJA 4L9LC 4PJ9A 4FX7A 1TQBC 2E27H 5F1VA 4DLMA 4XNZC 4LAOA 3DUUA 5DS8A 3SDDA 2DPKA 3U82B 4QJ3B 2KPNA 3GJFK 5K1NA 4R85A 2YARA 3F6JA 3O2DH 4BE5A 1GYUA 3V4PH 3W11C 4QJ4B 1RL1A 2P76A 2QHAA 1TELA 3WUWG 1VPOL 3OKLA 1YMYA 4WJG3 4X7EC 2VL4A 3KYMA 3EJRA 3UDWC 2PLMA 1NZRA 3CSFA 2VDKB 3QI9B 3VZXA 1S46A 2E6QA 2JF7A 4KTYA 1QX1A 2X40A 5M2FX 2D7MA 2KQNA 1I0DA 4X0NA 4AYFB 2E6PA 4ROPA 5CG7A 1WJ3A 3LEXB 2Q20A 1KA9F 5L4IA 2Y7DA 2ZRZA 3KOXA 3ABZA 2CESA 4FEZA 4GUFA 3W6YA 5BXFA 4M8VA 4M6QA 1IAOB 3L0KA 5CKSA 3RDTC 2XDFA 2WMJA 3DVIA 5EC1B 4NUGH 4OFQA 3WEMA 4NP4H 4XBEL 3PZ9A 4M82A 5CUSL 3USZA 2FQDA 3W0WA 3HUJF 1ZBWA 4H88L 2VO5A 3UCCA 3VXMD 4OBRA 1MRFH 3LZ5A 5IR1B 3NVTA 3QZWB 5DJZB 2VMEA 4P2RE 2WC3A 4NIYE 3P81A 2HJLB 1FDLH 3MFGB 2J7DA 4JPVL 1S8DB 4GNKB 1BQHB 4BSJA 5IKCB 5LGXA 1AODA 5HGHA 4BDVB 4IFRA 3DX4A 3NSFA 4I88A 4P3WA 1WWCA 5ETUB 3OO2A 3VNYA 2HVOA 1FKXA 1I3GH 2IAMD 4HA1A 2NNCA 1FNFA 4R5VA 4P2CG 4U1MB 2E6YA 1E6JH 4YQXH 1FDJA 2JLLA 3KH4A 4HNOA 1XRVA 3NCBB 4JGDA 4EE2A 2PPCA 5CD5D 3SKMB 4C56E 3SECA 3QXAB 1E1CA 1MNUH 1VA9A 2AV7B 1SEQL 1TZHB 3VXPA 1OVDA 3R7QA 1U8IA 2HTLC 2YLHA 4ZUVA 2WCSA 1C91A 3EYSL 3PS7A 2NVDA 1T1WA 4G8FA 4CMMB 4QOKD 2HH0H 1AFSA 4I9TA 3BPCA 3QO0A 4JHVA 1A0EA 1ID2A 4P8QA 2YR3A 5JDSB 3OMIB 4OLWH 3UXIA 2QADD 4H9UA 3K1KC 1DL7H 5CZXD 4ZNEA 4HVBA 1XIFA 1KJ2L 4HUMB 2CBJA 2O7SA 1KEML 4JZNB 1K7XA 2NV1A 4F7CB 1A7BA 1YEIH 1G69A 2J9ZA 3AWEA 4KY1L 3CZFB 4NGHH 3KCLA 5E6YA 3NIYA 3M0MA 1WIUA 3QWOA 5ACZB 3VFGL 1OW0C 2ZAGA 1IFRA 4YDIL 3FPXA 3WUGA 1L0QA 4RMUA 5D2LA 5I19H 5MHSD 1H6FA 1TJIH 2JF6A 3SPIA 5MEPA 3OEXA 3WK2A 3PV6A 4X9SA 5IGXL 4DWSC 2YFOA 4U3XA 5I8EA 1V6TA 3SGGA 4FULA 1XAUA 1J96A 1QI0A 3EBHA 3QH2A 3CQPA 5I79A 1UR4A 3APDA 3KL3A 4XD4A 1GW9A 2E7LA 3IGFA 4PJBF 1TZIB 1CS6A 2O56A 3W1QA 2W4XA 2EH8H 1K8DA 3FO0L 3QDGD 3U0TA 2PW1B 2MNRA 4O8RA 1GHRA 3GO1L 7TIMA 2HVJA 2BIHA 5E8PB 1EHXA 2WWNA 4ZMAT 1RIVL 5IOPA 2LABA 1OL0A 1H0DB 2Q10A 3NXLA 3W7EA 1PZAA 4GMTH 5F2IA 4O02B 4MD0B 5DRXA 4RBPH 2QUMA 4MY9A 4R90H 1N9PA 5FJIA 2XTJC 4M5YH 4S1DC 2X1TA 1OP5H 2WZIA 3QZOA 1OD8A 3PC0A 3RLGA 1SN2A 1E0WA 1QD0A 4PJEB 2HPIA 4DO7A 2OTPA 3KGRA 2OQLA 2OT0A 3ZM8A 1DYZA 2Z6IA 1Y1UA 2EUWA 2CERA 2VRJA 2JELL 1M7DA 4AD0A 4KRPC 1JCTA 1PDYA 1V0LA 4ILDA 5E8OB 3RZWA 3W7KA 3MXVL 2BO0A 1EJFA 1S7RB 1P69B 2J6VA 2R7EB 3A3XA 1K6QH 3KS6A 3H9YA 4M81A 4CN4A 5JPNA 3C5SA 3HHRB 4TTUA 4YVVA 2X1PA 4RFEA 4FP8H 1GGBL 2VDQL 3L2NA 1X6UA 4ERGA 1RQ5A 1TEFA 4QI3A 4KRPD 3FB5B 3RG6A 3WLHA 3EHBD 1GL4B 2VRAA 4G8TA 1KBBA 1MCQA 4W8BA 4EVZA 5FJUA 4H44C 4QTHA 4MLJA 2NWRA 5EZLB 1GVQA 3QV8A 4UMBA 4BGDA 32C2B 1NLBH 3ML9A 2DN7A 4DPBX 1S9KC 4ONHA 2Y1HA 1YEDA 3QOMA 3SRFA 3HHSB 3LPGA 1CFQB 4U7KA 3W39A 3ZTJH 1N82A 1BZOA 4GRLC 3T4AA 3R6IA 3U0HA 3IT8D 1VP5A 1OHQA 2ED8A 3DTXA 3JWNE 3BP4A 3D87B 4NUJA 4OFIA 3ZTEA 1A50A 1TZ9A 1G9MH 5KYNA 5DMMA 3S3CB 4W9CC 4EBQH 1QPPA 4N20A 2HP4A 4QRQA 2DSZA 2QUNA 3MRGA 1F3WA 3OJ2C 5F1NB 1WAAF 4PN6A 2A1YA 5EU4A 2YAOA 5KVEL 3UNTA 5MF5A 3DMMA 3RDTA 3W2MA 5DVKA 5AKRA 3FHEA 2BVUA 4H5SA 1KENL 4BUQA 1E72M 1HHKB 2F8OA 1IC4L 4IGBD 5E8EA 5FO2A 1E9OA 3ZT6A 4JIRA 4PB4A 4MBRA 3AB0B 4KKCD 4M93B 4GUGA 5G2NA 4HS6B 3FIGA 1Y18B 5GRWA 1SXSA 4L6HA 3LZNA 3D3VB 4X7TB 5I8OL 4OCXL 2YMOA 3R0KA 1WO2A 4JFFB 5DXYA 2YPLB 4BFIB 2NUWA 4P8UA 2C7UB 2QHRL 4ZT1A 2OODA 3KYKH 1KYUA 3Q67A 2D3NA 4HX1B 2F6AA 2QADC 2DF3A 4FEMA 2DEPA 4N87A 4WZ9A 4JDEA 1GZQA 4KWWA 1T66D 4IIQC 3KPOA 3SQLA 3SPGA 3I9GL 2FATL 2D24A 3KWWA 3FQ2A 1RIUH 3V4VB 1UYQA 1D2PA 1W0VA 3TN4A 2WWKT 5FESA 2QKSA 3ULUE 5D2LF 4GUHA 4HIXH 2A7RA 3M16A 1OYCA 5LGJA 2WGNB 3Q44A 1KTLB 4KKAD 3UPAA 1VBUA 1FH5L 3T3PE 2UZXA 1KJ2H 3G1RA 3MXVH 4YMPA 2G0KA 3LS5H 4M5ZL 3SDYH 2V8LA 2UX7A 2O4MA 2WVVA 4IIHA 5K5YA 3HE7D 4Y2DA 3ZSSA 4Z3HA 1A22B 1A14H 1WWBX 4KI5F 4XP4L 1RLDA 4HWZA 1V77A 1JJUA 2W62A 2NY2C 3MRMA 4BH8B 2G4FA 1NGPL 5KG9B 1H5BA 2GCYA 3ZE0E 4LDLB 2X0UA 2FTPA 3OMNB 2VLRB 5I16A 3USBA 5JUEL 3IS4A 1GVFA 4A8RA 3WJSA 2N59A 2B59B 2DDQH 4OVVA 3BI9X 2QDDA 1R3VA 4I9JA 3GUTA 2YAPA 3KPPB 1BQ5A 1NIAA 3NESA 4RMQA 4V1DD 3WMQA 2CLKA 3TH3T 5FO9B 3AM8C 4PS8A 3P11H 3ZKXC 5BUPA 1XDJA 1ZHAA 3V0SA 4P4RB 5TGBA 1R3KB 3D6NA 3RCMA 3BESR 1I3GL 1U8NB 2EO7A 2QGEA 2Z0BA 3DNKA 2EPMX 2R82A 1V02A 4JX6A 4IL2A 3QRLA 5FXCH 4CNOA 3WIIH 3GYEA 2LU3A 4GAAA 1WAPA 2P80A 2VL5A 3CFMA 3MOQA 4ONGL 4PYHA 3U6RA 3TXZA 4CD5A 4X6FB 5C9KA 1ZT7A 4XCCL 4N9EA 1XCXA 2M1KA 2PRHA 3CHDA 3IJQA 3DYMA 4PR5A 4H8NA 3LKNA 1XEDA 3L5IA 4PV9B 5T1KA 3CVHH 2BOCA 4ZAKA 1MEHA 1YADA 5HYJE 3LEVL 4XN8A 1CE1H 1WC7B 4UZGA 2B4CC 1R5VB 1SZRA 5AC8A 4KY2A 1R5YA 3QJFA 3S37H 3MRDB 2J25A 5EHFA 5HGBB 1XXXA 3NO3A 1RALA 1OADA 1TVLA 5GS0H 4Y9EA 3VGDA 1XBYA 1XLFA 2A5HA 3UO8B 5HHMB 2RDWA 3QNXA 2R2EB 3W74A 4Q9QH 1ROCA 4OCXH 3GZKA 3VX1A 5I1DB 1WDQA 3OVRA 2I5YH 4S10A 3C2YA 4ZOCA 2O61B 3F65A 3FK3A 3IWVA 3NO5A 4L2YA 1DDTA 5I0ZA 4TOYH 1KCBA 1WFTA 3PHQB 3HTWA 1E42A 2X9WA 1IQ8A 2OMZA 4WY0F 4AQAA 4LVFA 2WLJA 3PL6B 4QYOA 4ZNEE 3W9ZA 5GRZA 2PLCA 5M03A 5JHBA 1E2WA 3TEUA 1FCUA 1AXSB 5I75B 3SDCB 3L9RB 4QNWA 3DGCR 4G9PA 2GGJA 3R4DA 1UQZA 2ANUA 4UTFA 1QAWA 1X5XA 1CR9H 3JZUA 1FH5H 2OA9A 3CC5A 1E6RA 5HINA 1H51A 5DBTA 5HQMA 1ILSA 5ALCH 1JOIA 1G9ML 2W91A 3CXDH 4IU2B 2DH3A 2G2RB 2LGNA 5ID1B 1ZSDA 3MJ9L 2GK1A 3PZIA 1UVQA 1U8QB 4IGBB 1PG7L 3DIPA 1JTOA 1DWAM 3OZ9L 4RAUB 4N9CA 4ERSL 2XZCL 5B3SB 4PJ8C 3RF9A 2OQJA 3IDNA 5L8KB 1KLYA 4K73A 1FC1A 2XIMA 1U91B 1CG9B 3MKVA 5K69A 3S47A 1TVHB 3JSSA 2A9AA 2W27A 3H4XA 3RR4A 1SXBA 3QT2A 1M7IB 2YPLD 3TZVC 3C8KB 5EF0A 1S39A 2XKSA 4ODBD 4YBQD 2H3XC 1KIQA 5ES4B 4D3CL 1XH3A 1DQVA 4ZS7L 1MFMA 4H8WL 3U0WL 2PGWA 1VCGA 2F53B 2P49B 1J8RA 2NSMA 4L8SB 5KZ6A 5HVGB 1RUQL 3VKCA 3N9GL 4GCAA 4V11A 2X89A 1LNUB 1LQSR 2RDUA 3IPWA 5T1DH 4C1LA 3OZPA 1I3VA 2MCPL 1SN0A 1MQPA 2Z7UA 3SE6A 3KS0J 2CLIA 4S3EA 4W8AA 3HOJA 4YEEA 4EXAA 1Z7AA 1GPWA 6XIAA 2R6OA 2QDWA 4LLAA 3E2RA 1TMHA 1PX3A 1XWYA 3WIFA 1WSST 3ROOA 3TJHD 2BODX 4OCMC 4HNUA 2EAWA 4KWUA 3GDKA 4BR1A 1M7JA 4HKXA 2FO4A 5GGVL 3NQAA 2CMRH 1HESA 5I17A 4PTXA 4BF7A 1YUHB 4HK0B 4JE4B 4XMLL 2MQ3A 4LCYB 1SM9A 4P59H 2NQLA 4V27A 3KPSA 2VQ4A 5DEFA 3RY6C 1YDOA 3VYLA 2K6YA 5I71C 4YE4L 5EULV 4V1DB 2C15A 3SCOA 1AR1D 1XV8A 3BIAX 3CK0H 1EOMA 1FGVH 4ZO7A 43CAB 5C0JA 3D5HA 2DDQL 1YE4A 4DFIA 4IKKA 4QD2E 3LENA 4MCNA 4PU2A 4Z95L 5G4EA 1ZWIB 4HS8L 3HG5A 4JFOA 1K5NA 5D55A 3CFKB 3UMNA 4CC4A 1W9UA 3G5EA 5EBAA 2X4TA 2F74A 2P53A 2GGGA 2QELA 1T22B 2BRRL 4MMXA 1DANU 4I3RH 1YRKA 2QFPA 4YXHL 5IFAH 1XBZA 3HFTA 2QPEB 2CKSA 2B5IC 4F57H 1Q4WA 3MR9A 4XIAA 3TBYA 3MMEB 3UERA 1RCQA 3ZE2F 4HKZA 2ARJQ 4CD8A 4KV5F 2PTVA 1I9CB 1S2EA 1FZOB 3HNTL 4V1XA 3N1PC 2IPTL 4HHAA 1P5UA 3ZKMC 5T33L 3BT2H 2FFIA 1K6QL 4MD4B 4S0TD 3DFNA 2ASHA 1TUFA 4Y4HA 1DLFL 4LEEA 5EL1A 1REIA 4NZFA 1RUML 5HHMD 2VERA 3V0WH 5L88H 1OZMA 5ALBL 1ZALA 2OXGA 4UM8B 1I82A 4AYSA 2YXVA 2R29A 2X4RA 5DK2B 4NJHA 1G6VK 2DQ6A 2YN5A 2G3NA 3NFNA 2AQNA 5FEBA 1NINA 1WG3A 1RZKC 5INCB 4LLVA 1JQXA 3FY1A 3NJVA 1MCDA 3CU1A 3SQOH 1XF2A 3BW2A 3WTTA 3CIWA 2R23A 1NFIB 2DQEH 3QPQD 4UINL 4WHDA 3NIFB 1USQA 3FQNB 3P0GB 4RE2A 1DLFH 4GBXB 1XIHA 2FEEL 2J88L 3B7UX 3VB8A 1NBZA 2QLVB 5IJCC 2E1DA 3LQAL 3GG7A 4RE4A 3PBYA 2GOKA 3ZLFA 3H53A 1X38A 3T0WA 4Q9CA 4I18B 5J6HA 5BWAA 4H8QA 3WEXA 3EZ8A 1I31A 5LB1A 1HNYA 3NJJA 1T6WA 5HSFA 3GLCA 4OBSA 3G1VA 1RZGA 3UZQA 1W3JA 5BZWA 2E7FA 2PTYA 1JK8A 3AXXA 1KPRB 4GY1A 4QITA 2WQXA 1G9MC 1Q90A 2IH1A 1MQRA 3HNSH 4GRSA 3OX8A 5FYJE 3VAEA 1QSED 1E4XH 1MCWM 1JMXA 2RALA 3HI5H 4BRVA 4GW4B 4L1XA 4P5TA 4QCIA 2VN7A 4HPYH 3ZHNA 3SCWA 4U7MA 5CBBA 1G4PA 3CN0A 2HWZL 2OXGB 4UM8A 4F33A 1T2QL 1WIPA 1RK7A 2LU5A 3MRBB 2D03H 2P8LB 4FHBD 4Q74A 5FIEA 5I15H 5HPOA 4W8LA 2EVHA 4I9WE 1WFIA 3TM6A 3DWTA 4N2LA 2CIPA 3QLLA 4YDLB 4RLIA 4CMHB 4DKFH 2RFXA 3BWWA 1FZOA 1T7WA 4P4KC 1ZAHA 2HMCA 1DPMA 3D8MA 2CLEA 4RX4A 5AHEA 1RUPH 3T3MB 5AHLA 3HPXA 1QSZA 3BZEA 1NAML 5M5DA 6REQB 5C2CA 1AD0A 2UYLA 4AZBA 3UG4A 3EKZA 2EKCA 1CDBA 3ZE2B 3ASNB 3BGMA 3NFUA 1DIDA 1NBQA 4NIRA 3Q01A 5AAWC 4HIJB 1MUMA 3UWVA 2B2XL 1JCLA 5DJ6A 2X3CA 1O6SB 3FFCD 4N6RA 4O58L 1V5JA 5D1XC 3C6EA 1Z3GL 3VD7A 4IGBC 2Y0FA 3H1ZA 5DWPA 4BF9A 1VF5C 4FDWA 4WUIA 4XAPA 2GSMB 3FRPG 3O3RA 2NY0D 3D0VA 1MDTA 4E9XA 5BXPA 4ORGB 3IETA 2KC0A 1F1GA 3QXVA 4ZYKB 2IC2A 4ODSH 2WB1A 5HNUA 2ATSA 4IKNA 2J8HA 1YMMD 4TULL 4U49A 4BD4A 3SRDA 1UEMA 1CLZH 1KCSH 5EBGA 3CFCL 1UH4A 1PQZB 3N3TA 4Z1BA 3H54A 3NABH 3A5VA 1BOGB 5EMYA 1AR1B 4UBDD 1ODUA 4C6LA 2A9ML 2HJFA 4OIFA 4A68A 5KN5A 1UWIA 4BFFA 4UTUA 2XACC 4MCZB 4ZRGA 3QNYA 4GI6A 3VABA 5LIYX 1U21A 3QO1B 2J7CA 1Q9LB 3C08L 4R88A 1IARB 2OB3A 3WIJA 3AI0A 3F1QA 4BSVB 1RZFH 1T5XB 1TJGH 2WXHA 2I26N 3H6AA 2MKWA 4FKEA 5F9DC 4CC1A 3TTSA 4DPCX 4JS3A 2QUVA 4KIRA 3SY5A 4GKSB 3VFOB 2DQWA 1P84K 1ZHLA 3QFJD 4HK5A 3HPLA 2JEPA 1XGEA 1Q9WA 4A35A 2YZ8A 4OZIE 3CV2A 2WSKA 1TMQA 1KBGL 2CPCA 4EO5A 1KR0A 1YQVH 2JMRA 1FWAC 2BXYA 4E36A 3L9EA 1XIWC 4NBZB 4AY1A 3IEBA 2RR3A 1P1MA 1IEQA 3COTA 4FLHA 3HZYA 4E2DA 3NJIA 2PGRA 3M0ZA 2WANA 2WV3A 4I13B 2DORA 5GGUA 1SJEB 5F7FA 4I2XA 3AALA 1K4CA 4UTWA 1T83C 3PCYA 2CNCA 2WJ5A 4AYEC 2LT9A 2PZ0A 3MUGB 4X0KB 1LUCB 1U3HA 3WHXA 1YQVL 3OKDA 2BHUA 4S1DD 1U8CA 3OKOB 4K71B 3ORWA 2D7NA 3H55A 3SYOA 1CW2A 3WH6A 3HMXH 1XKYA 5ERWA 3D33A 4HXAL 4KU1A 5JHDE 2PXYB 2YGOA 1ZY9A 1YXDA 2ACRA 4L4LA 3LN4A 1DQMH 1W0WB 4A6GA 5D1ZC 5JYMA 3CC5B 4KHXL 4EKXA 3CSTA 3ZE1E 4IIZA 5AC6A 3PDGA 3NL6A 5A16A 1DQLH 1GVIA 3C12A 5DYOB 2G4EA 3C8DA 1PDKB 1DVZA 2QQQA 1XR8B 3VNZA 4CJ1A 1UUQA 4GBUA 2Z9TA 4CILA 2WMGA 3H7LA 1VKFA 4AGLA 1BJ8A 1BM7A 2F1BA 4POYA 1U8OB 1E6NA 1IC0A 5J06A 5DY3A 3LTSA 4LNVA 1Z5LA 3MUCA 2BJMH 2IH9A 2FJKA 3QDJA 4KRPB 3A4WA 1S2WA 4OV5B 3WBEA 5AB1A 5DVLA 1X7FA 3LTPA 2XUCA 5KMYA 4CGUB 1HW6A 4V28A 4MJIE 4KO7A 2RAGA 1XGTB 2R27A 5EU7C 1IVLA 2XTJB 2OL3A 5AC4A 3RTQD 3HPFA 1CLZL 1KCSL 1UIOA 5ICZB 2PBOA 4Q8NA 6PAZA 4ERSH 1EPXA 3TPUB 4F2BA 4I1PA 1W16A 1LZOA 2P8PB 1KY7A 1NPNA 2AEOA 4M6AA 3TJPA 3W9EB 1NCWH 4A37A 1XF0A 4E4FA 3WDJA 1AY1L 2AK1L 5KWYC 5I3HA 1P7TB 4G3YH 4Q14A 4D6HA 3OKMA 1UUNA 1DWGM 1GZHA 1OLLA 3UO1L 2YXWA 2YA1A 3BEVA 1L7TL 1WCBB 1S3KL 3EOTL 2VLKA 3MLXL 4PR5B 5CMAB 4AVJA 3RFZC 1AIFB 3L95B 1JDDA 3GAYA 4MADA 2IMNA 5I73B 1HJWA 5BS0D 2EDWA 2Q87A 3UJJL 2BOEX 3B5TA 4W7UA 1ZT4A 1D5XA 1R3LA 2YGQA 2H7WA 1NBYA 3LZFH 4JFEA 2JKLA 3AIBA 3UTSE 2P48B 1GOFA 4XVTL 3ARBA 2BSBA 4L3CA 4P4RA 3FQWB 5TGBB 1NBYB 1OEPA 3GXMA 2J8UE 2HFGL 3RWHA 2ZTKA 1M53A 2JIWA 4DVOA 4XCEB 4LPYA 4AUYA 4DUXA 5A8OA 5T26A 3TFXA 1KFGA 4RV3A 4YHZH 3D52A 1TVBA 3II2A 4IBLT 4MJ6B 4JFFD 4BA0A 4PCTA 2GJZB 5JW5A 2RMNA 1J0KA 2Y62A 2ZOKB 1MG3C 2V2WB 3BYTA 1VJIA 2DKSA 4YHPB 1PEWA 4GI8A 2HFGH 3ILPB 3PG2A 1WPCA 2F2KA 1E1FA 1LG1A 1TPH1 2EPOA 1HILB 1F9CA 4PGBA 1IZCA 1H6EA 1LP9F 2ZWZA 4TNVK 5F6HJ 2Y36L 1LE5B 2VMJA 2OZ4H 2IG2H 1MVFA 3LDVA 3U48A 5DEGB 3N12A 3W7CA 3C4UA 4LYQA 4FNPA 4KOBA 1AGDA 2HSAA 4NKCA 5C5YA 1XGRB 3OXSA 3WNOA 4RWYL 3RDKA 2JIXA 4Y8AA 3ULUC 1UB6B 3ARSA 4PJAB 1MLCB 5J0BA 5FYKL 4AC7C 4RGNB 1T5AA 2OX1A 3TSDA 1QTYT 3GI8H 3NDYA 2VUYA 4N9GA 3POCA 4QRRA 3THDA 4TV5A 1FO0L 1BF2A 4GMSL 4NWTH 3VGAB 3T6VA 1RU9H 4MQTB 4NJGA 4WTQA 3CX5J 4XP5H 3RI5F 5ELIA 1TTRA 5KW9L 5HQEA 3F64A 4MS8D 3FTUA 3ARGA 3DV4A 1ZIAA 1OX6A 1NCWL 4HGWA 3ZRSA 1J0IA 1U3HB 3WHXB 3ZZ1A 1J9SA 2BX5A 3MUJA 5EPMA 4NZTL 1FFNA 4X0VA 4NQVA 4R9XA 1JDEA 3TWCH 2ZKHH 3VD2A 4Y4KB 2Y3AA 4PGDB 1F4YL 4E9TA 4OBTA 2F1EA 3U4AA 1KC5L 2RCSL 1TTPA 4TU1A 1ZLVH 3G0SA 4NO3A 1E9QA 1SLVA 5KJRH 1GNXA 2W61A 4TV3A 5D6DA 1DQML 4WCYH 4XMUA 3G1YA 3T4WA 3BPNC 1ZCCA 2VDQH 1AQKL 1BXBA 5DBUA 4C6KA 1IEVA 4PJIB 1Q9WB 2Y2YA 3KVMA 1DANT 5K9JL 1TQJA 2GYIA 4X6BA 4U5IA 7PAZA 4HEPA 2VFDA 1CURA 1OARH 4G8IA 3QUKA 3WHE1 5L0QC 5DJAA 1XCTB 4JTTA 2YAHA 4JRXA 2ZUSA 4XN2A 2A0LD 3DGGB 2XTJD 4QUOA 3LH2H 5DHVA 3CK5A 3NL3A 3IXAA 2FX8L 4PVNA 3B34A 1A7RH 3GVRA 1CDJA 3PBUA 3MX0A 3AOFA 1I8MB 2L04A 4PRPE 4LEQA 5HHXL 5CC5A 4C57C 4ODTL 1CT8A 1Z7JA 1I85C 3VFRB 2ZXAA 1UC4A 1R5IA 4G7QB 5HVWA 3C5QA 1C8QA 5DCEA 5JH2A 4RISH 4TUJA 4P46B 1EZ2A 2V5CA 2VZOA 1RHHB 1RUPL 3FUEA 4QHUB 2ORBH 2UZPA 3PWLA 3ZYOA 3IAGC 1DOSA 3H8NA 2ROYA 2OMTB 3BVVA 1F3JA 2XWCA 4EUPH 4F8PA 5KYYB 3I50L 1ZHKB 1BQCA 1KFJA 4CD4A 4ICWA 4L0ZA 3WQ4A 3FMGH 4F79A 2HPOA <