4UQDA

X-ray structure of glucuronoxylan-xylanohydrolase (xyn30a) from clostridium thermocellum at 1.25 a resolution
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
390
structure length
390
Chain Sequence
HMASATINLSAEKQVIRGFGGMNHPVWISDLTPQQRDTAFGNGEGQLGFTILRIHVDENRNNWSKEVATARRAIELGAIVSASPWNPPSNMVETFTRNGVPNQKRLRYDKYGDYVQHLNDFVAYMKSNGVDLYAISVQNEPDYAHEWTWWTPQEMLRFMRDYAGQINCRVMAPESFQYLKNMSDPILNDPQALANLDILGAHFYGTTVNNMPYPLFEQKGAGKELWMTEVYVPNSDSNSADRWPEALEVAHNMHNALVEGNFQAYVWWYIRRSYGPMKEDGTISKRGYMMAHYSKFVRPGYVRVDATKNPTYNVYLSACKNKKDNSVVAVVINKSTEAKTINISVPGTSIRKWERYVTTGSKNLRKESDINASGTTFQVTLEPQSVTTFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conservation in the Mechanism of Glucuronoxylan Hydrolysis Revealed by the Structure of Glucuronoxylan Xylano-Hydrolase (Ctxyn30A) from Clostridium Thermocellum
pubmed doi rcsb
source organism Ruminiclostridium thermocellum
molecule tags Hydrolase
molecule keywords CARBOHYDRATE BINDING FAMILY 6
total genus 138
structure length 390
sequence length 390
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uqdA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uqdA02
1IV8A 4OKDA 3BC9A 2G3MA 5CSUA 2XFRA 1BSIA 2V3FA 4PCTA 1JI1A 1MYRA 1UR9A 3WNNA 2XM2A 4KGJA 2W63A 2XYLA 1UR1A 2WLYA 1FP9A 4MNLA 4YN5A 1GHRA 3IK2A 1E55A 3A5VA 4KRUA 3ARRA 1G1YA 3VIIA 2VZUA 2VZSA 4F8XA 1CGYA 1PX3A 3CGTA 3VGDA 4Q22A 2YOCA 1W1VA 4GI8A 2XFYA 5BCAA 3RM8A 3DX4A 1QX1A 3WUEA 4D6HA 5A6AA 4A4AA 4NZFA 4UQAA 3CUHA 3CZLA 2ZXQA 3L4XA 4JL2A 1V03A 4CU6A 5BXTA 1XD1A 2VCBA 1W3KA 3EJPA 1OGGA 1LLOA 3AXXA 3OLIA 3VO0A 4QDMA 2E9BA 4W87A 3RDKA 4J3WA 3MSDA 3WQ8A 1C8QA 3L4UA 2Y8KA 2WZIA 2BVYA 5D8WA 3KLKA 1IZKA 1V6VA 3WQVA 5A2CA 3BGAA 2ESCA 4LQ1A 4GKLA 4U5KA 2VC9A 3BVUA 1CTNA 3SCSA 3WF1A 2A3EA 5I0DA 3HN3A 2EADA 3NDZA 2NT1A 3UG4A 3MMWA 3WEMA 3L4ZA 2X1IA 3OLEA 1V0KA 1ITCA 1E6ZA 4AW7A 1JNDA 1WP6A 3WQWA 1J0IA 3WY2A 2VZOA 3PN8A 4MPKA 2YA2A 2FGLA 3N11A 2WHLA 2C0HA 3TP4A 4JKLA 3VKKA 3FHQA 1W9DM 3MSGA 2A3BA 3UR7A 1PX4A 1NWUA 4JKMA 3F5KA 4WKHA 1JZ3A 2GDVA 1B30A 2J4GA 1OCQA 3CIVA 4PRWA 1E4NA 3PZ9A 3BH4A 3VINA 4JCMA 2YLAA 4CCDA 3KL5A 4J3TA 3TTQA 2WVVB 2BXZA 3LXAA 4XX6A 1UR0A 2PBGA 4H7VA 1GPFA 3SUSA 4HP5A 2NSXA 3AIEA 1CGTA 2WSPA 2J7FA 2VR4A 2VX6A 1XYZA 1ZU8A 4QLJA 2WCGA 1AMYA 3S6TA 3L4YA 5A8OA 3TA9A 1JNEA 1B31A 4CUCA 4PMYA 1KB3A 1BF2A 4CD4A 3FXYA 5GNZA 2CEQA 1US2A 2ZOXA 2VRQA 1WDQA 3TTYA 1FH9A 2F7OA 3VX0A 4HU0A 1TVNA 4PMVA 5ECUA 1EOMA 2GJXA 4JAWA 2GJRA 3EDEA 3GXFA 1HJXA 1JDCA 4U3CA 4UFJA 2V3DA 2IUZA 3K8LA 1QHZA 2DH2A 5DFAA 4UR9A 3GNPA 4FNRA 4H8UA 1KR1A 3ZSTA 3PTQA 1KGXA 3GM8A 2DSVA 2XHYA 2QHAA 4D6EA 1HT6A 5AC5A 1KXHA 2XSAA 1VENA 4WKAA 1H0IA 4BQ5A 1LQ0A 1OM0A 2ZUTA 1E71M 3NSMA 3SUTA 3WMBA 4MJ2A 1GQKA 3CC1A 2WHKA 3H53A 3DX3A 1BG4A 1WZKA 1JAEA 3GH5A 3GH4A 2CHOA 4UFLA 1OT1A 4AYGA 1W1YA 2XVLA 1W9XA 4EE9A 2VZVA 3N04A 4QCEA 3VIGA 3ARYA 3EJQA 1R34A 2BV9A 5D9OA 2ZUVA 1D7FA 2YFNA 3SIMA 1G01A 3F5JA 3KZSA 3OB8A 5A8NA 2X0YA 1CDGA 5A3HA 1BFNA 2PI6A 4AY1A 4J27A 5E0CA 3LXBA 4MNMA 4PTMA 2OSYA 2WMGA 5BYWA 4Z2LA 1MQPA 3ARTA 4FLOA 3GDBA 1B0IA 3OZPA 1BHGA 1XGZA 3KL3A 4M1RA 3WF2A 4AIUA 4XV0A 5M17A 3SURA 3AIRA 4GZJA 1K9EA 5DO8A 4D72A 1W3LA 3LRMA 2JF7A 5JIPA 4JFTA 4N0RA 3U5UA 5E9AA 2BY1A 2E4TA 1QVBA 4FLRA 1ISVA 3PTKA 3AIQA 1YQ2A 1E1FA 2J7DA 5A6MA 3AIBA 1KCKA 1QHPA 4D6GA 1RD6A 3ARXA 1UD4A 3CZKA 3LPGA 5HBFA 5CZKA 1ZL1A 4W84A 4Z2IA 2WMKA 3N18A 2X2IA 3AIVA 5ABFB 2CETA 1KWKA 4W5UA 5BXSA 1HJWA 1V3JA 2OSWA 2V5DA 1E6PA 4HPHA 3N12A 1UG6A 2Y2WA 2YLLA 4LYQA 4U31A 5I5RA 3RCNA 2VOTA 4FNQA 1JYVA 4TTGA 1VJZA 3ZJ8A 1VAHA 4UQBA 2XVNA 3TOPA 1HNYA 4U2ZA 1QOXA 2W4XA 1JYNA 5E0FA 4AEEA 1JDDA 3SUUA 3AHXA 3UEQA 3U57A 2EACA 3SCUA 1GOQA 1WCGA 1AQMA 1WO2A 2JIEA 2ZX7A 2DSKA 3MUY1 3RO8A 2PC8A 1TQUA 5CJ5A 1GCYA 2O9TA 4ACZA 2XG9A 3AHYA 3T0DA 2DSWA 4MADA 1CECA 6CGTA 4HA4A 1VF8A 1FOBA 1BYAA 5JBFA 1R33A 3T08A 1S46A 1E6SM 3L4TA 2XVKA 5DF0A 1XCXA 1AQHA 4HA1A 2ZX6A 1CWYA 1XSJA 1ESWA 2G41A 3SEPA 4YHGA 5LYRA 1NP0A 2V5CA 4UFKA 5C71A 3TONA 1WZAA 1EHAA 3UCQA 4MJ4A 1MWOA 2OWWA 5IHRA 1HL8A 1X6NA 3N1AA 2WWDA 2Z1KA 4CVWA 3VNYA 2WXDM 1UWIA 1V0MA 4TXEA 1TQSA 2WAGA 3POCA 2X8RA 3WKZA 2WCSA 5JBEA 3A22A 1BTCA 1NOWA 1EGZA 1VFOA 2XVGA 3O9NA 3QHOA 1VB9A 4ZFMA 3GXPA 4D6IA 1QI3A 1FH7A 2XIIA 3MUIA 4R27A 1GONA 5GNYA 4D71A 1QPKA 4ZEPA 1Z32X 2XN2A 1JZ8A 5M5DA 3WNPA 5HPCA 1SYTA 1E3ZA 3AICA 4IUGA 3ZJ6A 1CYGA 2J79A 2BXYA 1FA2A 3VILA 4AZBA 2GSJA 3K46A 4D6CA 1A3HA 1PJ9A 3BAWA 2EPLX 2E3ZA 4NX0A 4JCLA 3SCVA 4WLCA 1BVZA 3CZGA 4UQDA 4MTVA 4W7WA 3CZJA 3WBEA 3A47A 2J25A 1XH1A 1B3WA 3NIYA 1HN1A 1PX8A 1W32A 2CPUA 1NARA 5EMYA 2CCRA 1H1NA 4BF7A 3I3BA 1CGUA 4TOQA 2C7FA 2J7HA 2FH6A 2A3AA 4B9YA 1O7DC 3MV11 1CBGA 2WMIA 1QI4A 5FCZA 3PZNA 2OWXA 2UY2A 5A8PA 2GJPA 4JHOA 1CIUA 1CXHA 2VMFA 5IHSA 3BSHA 1VEPA 4DWSC 1CXEA 3IJ9A 3SUVA 4B3LA 1V6YA 1WDSA 2X05A 2YL6A 3WDQA 3VSTA 1HP5A 5D9MA 1QNSA 4AISA 3VGFA 4LYPA 1M7XA 1V0NA 1W1PA 3WF0A 3WELA 3MUAA 3HZ3A 1CXKA 1E6NA 3WD2A 3WFLA 1JYXA 1TCMA 3ZR6A 2F18A 3VPLA 1TQTA 3CMJA 3GXTA 1PZ2A 1WZMA 3AYRA 2YL5A 1NWTA 3W82A 4CCCA 1Q6FA 3VGBA 3HG4A 1I75A 4EAMA 2PF0A 1E1EA 4BCEA 2VR5A 3DX1A 1E70M 1E72M 2OWCA 2WZEA 2OYMA 5C70A 4UCFA 1NOUA 3RM4A 1MW1A 2W91A 4AIOA 3OZOA 5E6YA 4DUVA 1B90A 1ZJBA 2ZE0A 3DC0A 2O9OA 2XFFA 3VX1A 1H09A 2QMJA 3WNLA 2ALWA 2WVVA 1V3MA 4ZXOA 1JGIA 2WANA 4B15A 2FYVA 1Q6DA 4MAVA 3ZOAA 2VI0A 3BVVA 3PZIA 1R46A 1LL4A 2GVYA 1H4PA 1B1YA 1B3XA 3WQ4A 4FLSA 1UD8A 1BG9A 4GQRA 5TD4A 1EA9C 3VIKA 2ZX5A 1CGWA 2UY3A 2FHFA 1B2YA 2VUYA 1VBRA 1KXVA 3MANA 3UETA 2VVNA 3CMGA 1RH9A 2PB1A 1FHLA 1W9PA 4UZSA 5M03A 3M46A 4AD3A 2J7GA 4C7FA 4DM2A 3BVXA 2DSUA 3BUDA 1R7OA 5A6BA 4W8LA 2W66A 4J3XA 1B3ZA 1KBBA 1WZLA 1R75A 2HVMA 2XVPA 5JIWA 1VFUA 3MS8A 2ZUSA 2NW0A 3ZIZA 2XJ7A 1J11A 1WPCA 4GZIA 3QGVA 1LL6A 1E4MM 3FHAA 5BROA 5I6SA 4AYSA 1US3A 3D3AA 2WBKA 4PEEA 3CUIA 3PZTA 3CUGA 4CD6A 1UD5A 3K1DA 4CN4A 1OIFA 2VTFA 3SCRA 1JFXA 1W9VA 4AD5A 3CHCA 2VO5A 2HISA 1TE1A 1CXLA 3ARUA 2D0FA 4PTXA 3BLPX 4HOWA 2QPUA 1JG9A 2MANA 5FL1A 1E5JA 1UA7A 3A21A 3SCNA 2J74A 4OUEA 4FF5A 1E4IA 4JFUA 5A6BD 3U5YA 1BYBA 5A8MA 3WH8A 3WSUA 2OW6A 2F7QA 3WF4A 3WDIA 3EJRA 2DQXA 3KE0A 2WVTA 5A8QA 3OLDA 1HIZA 2BNJA 1OIMA 3ARZA 3KL0A 1TVPA 4AXNA 3ECQA 3T2OA 3ZT5A 4W86A 3W24A 1C8XA 3PZUA 1MW0A 4DWSB 3AS1A 4Q7NA 2VCCA 1JZ6A 3VTRA 2CXGA 2FDMA 1OGSA 4S3JA 1L8NA 4W7VA 4QCFA 2BY0A 1JD9A 4NI3A 2GFTA 5CXPA 1FP8A 2E8YA 1HKKA 1HX0A 1J9YA 5IFPA 5GQBA 3PZMA 2E0PA 5A2AA 1QNRA 4B9ZA 4AIEA 2W5FA 3EMQA 1QI5A 1XHGA 4U2YA 2BHYA 4P7LA 4TVUA 4AZCA 2JFEX 3AOFA 1UWUA 1SMAA 4H41A 4LXFA 4PMOA 4DO5A 2XGIA 3NSNA 1BYDA 1DWHM 2RGMA 4PMZA 3QOKA 2DT0A 1CLVA 1GZJA 4GI6A 2YKKA 3NJ3A 3W0KA 2WSKA 4IISA 5LA1A 1EXPA 1ODZA 3RIKA 2V3GA 3ZT7A 4W8AA 2AMGA 4H04A 5FOOA 1TUXA 2OLHA 2WZHA 4UFHA 3S5ZA 4CU7A 3WL0A 3NYDA 5A6KA 1JYWA 2OYKA 3FY1A 3RILA 2ZX9A 1ZBKA 2VRKA 5I79A 1ZB5A 2G8ZA 2JEPA 4AMXA 2OW7A 3CZSA 4W85A 4ACZB 4PTWA 1WDPA 1E6XM 3MMDA 4PSPA 3A24A 2DGAA 2F61A 2ZWZA 1ZBVA 4BA0A 3AQUA 3POHA 4J3UA 2EABA 4PSRA 1UUQA 3AS0A 4PMNA 1C7SA 1EQCA 3ZMRA 5AC4A 2PWDA 2WNWA 2UWFA 2EPKX 1XCWA 2D2OA 1TMQA 3RMEA 4YHEA 3WDRA 3EJSA 1LJYA 1W2PA 3L2LA 1TQVA 2WK2A 4B3KA 5JBDA 1UQZA 2GK1A 5I77A 1F4HA 1UQYA 1J01A 5HXMA 1KQZA 3WNOA 4N42A 2G3NA 2J62A 1GOIA 4AD0A 2QMKA 3K4DA 1KR0A 2WCAA 3APGA 3RJYA 2ZX8A 1QI0A 3CZNA 4RE3A 1H2JA 4M82A 2XPKA 2C8NA 1QNOA 3UG3A 4KWUA 3ZR5A 1V6WA 5LA0A 2Y5EA 1F4AA 2YA1A 5A94A 3THDA 1M01A 1EO7A 3FN9A 5A2BA 4HZ6A 4WF7A 1HF6A 3VIJA 3ARVA 2BY3A 4P7NA 1MQRA 1UWSA 1G5AA 2QPSA 2J8GA 1XH0A 5A69A 3DHUA 3W25A 2J77A 3D51A 2UY4A 1ZBWA 2XWDA 1W91A 3CBWA 3GBEA 4URIA 1KWGA 3PZQA 2FHBA 2CKRA 1GHSA 3FW6A 2GJXB 4M56A 2WC7A 2J7EA 3CHDA 3M6DA 3MV01 3NDYA 4UOJA 1SZNA 2WMJA 3ARSA 3TTSA 3HMCA 5BXRA 4LGXA 1NQ6A 2J75A 4AZIA 1K6AA 2X2JA 3DX0A 3VDBA 3WY3A 4DO6A 3A6OA 4NXSA 4NRSA 3VD4A 4F9JA 4JFWA 4JFSA 3VMOA 4PUDA 3VDAA 2BVTA 1V6XA 3N17A 3WENA 4GINA 1TR1A 3WN6A 3W6LA 3WUBA 1YHTA 1AVAA 5HDRA 4V28A 4K68A 5A6JA 4UTFA 4TX6A 5DEZA 3O6AA 4NF7A 4OBRA 3SUWA 2EO7A 2ZUMA 3CHEA 4F79A 5CLTA 3AISA 1UR2A 3A4WA 3AIWA 4CD8A 3WEOA 2F7RA 2WKGA 3VVGA 2ZICA 3GXNA 4D1JA 3BUPA 3L2MA 4OJYA 4GQQA 1IZJA 1GOKA 3VUPA 2W61A 2VVSA 2FHCA 1MFVA 2YA0A 2ZWYA 3VIHA 3VIPA 4AZ6A 3GZAA 1U2YA 2FE0A 2F2HA 2G3IA 5JUVA 3W4RA 4GO9A 3VD9A 1XYFA 3QHNA 5A6SA 4LPCA 1C91A 1HJSA 1TG7A 4HZ7A 3BAIA 3WQ5A 1GUVA 2Q8XA 4S3KA 7TAAA 1E9LA 2PWFA 3DDFA 4XUYA 3VD3A 3OGVA 5ABEA 3W26A 1LF1A 1O7AA 1HXJA 1QW8A 2YDSA 1CXFA 1B9ZA 1E56A 3KLLA 4AEFA 1CEOA 2XM1A 3VOCA 4ATDA 4EKJA 5E1QA 8A3HA 3OGSA 1VIWA 3RPMA 1PPIA 3WD0A 1HKIA 2WYSA 1XH2A 4P8VA 2OYLA 3ZM8A 2EPOA 2D23A 4UNIA 4OIFA 4A3HA 3GH7A 1C93A 2G3JA 2DIEA 2YJQA 2J78A 5FD0A 5HNNA 3VNZA 4GI9A 3H54A 3VM5A 1LL7A 4KH2A 2WPGA 4WK9A 1L0PA 2VCAA 4PUEA 4CD5A 1JXJA 3VMPA 2EXOA 3M7SA 3WIJA 1B3VA 1V3HA 3N13A 3WY1A 3ZJ7A 1PIFA 4CCEA 1UWQA 3FAXA 4V27A 1GW1A 4J3VA 3B9DA 1NOFA 2IGTA 1CPUA 2XN1A 1KXQA 3EMZA 5CG0A 1WE5A 1E0WA 5CQ1A 1NP2A 4D1IA 3B8SA 5I3DA 1X1NA 1JZ2A 2YBUA 4H8VA 5AYIA 3AI0A 1R87A 1UKOA 7A3HA 3CZ8A 3S2CA 1VFFA 5HPOA 5AY7A 2WVSA 3RJXA 4X9YA 3GNRA 4OZOA 4TTUA 2PWGA 3BCDA 2D24A 3WD1A 1GJUA 4QAWA 1R7AA 3PZGA 1EQPA 1UKPA 1BLIA 4OOUA 4AWEA 5EFFA 1GQLA 4Y7EA 2DIJA 1XV8A 4Z2JA 3AIUA 3WDPP 1KQYA 2D3NA 2WVUA 3BCFA 2X0HA 4PYSA 3II1A 3WQ6A 1Q6CA 4U33A 2OSXA 3CZEA 3SCOA 3UESA 1JZ7A 9CGTA 3AMGA 2PBOA 4RL3A 3VDCA 2CITA 1OBAA 3W29A 1JF6A 4M24A 1FH8A 1XRVA 1BYCA 4D6FA 5BWFA 1CLXA 2YFOA 4HOZA 1C8YA 2PWHA 4GPNA 4RE2A 2V3EA 4LX4A 1RP8A 3J7HA 4FNTA 1GVYA 4B16A 3VIMA 1GOMA 4JKKA 3HG2A 2EBNA 3AZSA 4QLLA 4MNKA 4W7UA 1W9UA 1JZ5A 4AD2A 4ZXLA 3ALGA 2D0HA 3BLKA 5FIPA 1V3IA 4GZEA 5DT5A 4UQCA 4W93A 1E15A 4AZCB 4R5EA 4PMDA 4XZWA 5A1AA 3N15A 1I1XA 3VU2A 1FHDA 4P7QA 2WC3A 4HZ8A 4J3SA 5BXPA 3WH7A 4Z2HA 2UY5A 2QV4A 4HU8A 1M03A 5I23A 3IAPA 2WMHA 2Z1SA 3QR3A 1PIGA 4E2OA 3VGGA 1UZ4A 2A3HA 3OGRA 3BAXA 3H55A 1VRXA 3D4YA 3EBVA 2WHJA 3O2LA 1U33A 3HG3A 4HOXA 1XC6A 2WMIB 1UH2A 1W3JA 5I2UA 4P8XA 2W62A 2JEQA 5LA2A 3EMCA 3LX9A 4MB1A 3D52A 3GBDA 1OSEA 2IXVA 2WW5A 3WDHA 2ZUUA 4OGZA 3EDDA 1MFUA 2WWCA 1EH9A 3D50A 1H5VA 1D3CA 1ZBCA 1VEMA 4PMXA 2CYGA 2DEPA 1JAKA 4PMQA 4UZUA 1QI2A 3EDJA 3LRLA 4E4PA 3CO4A 1P6WA 3F5LA 4ATWA 1WB0A 2DDXA 2Y8VA 1E43A 4PBGA 3BMWA 4X0NA 2VQTA 1E73M 4AD1A 2WHMA 5BRQA 4BQ2A 4AZGA 3MMUA 1VJSA 3WUFA 1O6IA 2X2YA 4W5ZA 5E6ZA 1LWHA 1PBGA 3AXIA 1EIBA 3S5YA 4L4OA 4D6JA 2EEXA 1ISYA 3VD7A 2BHZA 2W92A 2O92A 3IAQA 1JIBA 2DT1A 3OBAA 5EB8A 5EFDA 2BHUA 2Y4SA 4U5IA 5C8BB 3KEHA 4DO4A 5E70A 1HJUA 3BXWA 3W27A 3DECA 4D6DA 2YBTA 4UQ9A 1XD0A 4P8UA 3SCQA 4BS0A 1ZS2A 1TA3B 2EJ1A 4DWSD 1NM9A 4W8BA 1KFWA 1W1TA 2VQUA 2D20A 1G94A 1GQIA 1VEOA 2CBUA 3A23A 1DWAM 4XB3A 1C90A 3WNMA 1Q6EA 1CXIA 1ISWA 1FFQA 3BSGA 4HTYA 5CGTA 2CERA 1LG2A 1ITXA 1W3HA 4MNJA 1GJWA 1ZJAA 1J18A 1QHOA 5KEZA 1WDRA 1OT2A 3BUBA 3ZJKA 1QW9A 4YPJA 2VJXA 2J8FA 1HL9A 2EPNA 2G4FA 3VIFA 4NZCA 1JD7A 5M3WA 3VSUA 1JFHA 2WB5A 2XGBA 4CD7A 1K9FA 3TV8A 4BZYA 3VDHA 1UYQA 4NXKA 3LXCA 5F7UA 2BS9A 4Z2KA 1PAMA 3QOMA 1DHKA 3LPOA 1HVQA 4M8UA 3MUZ1 3PHAA 1HP4A 4JL1A 1J0YA 2VZTA 3AHVA 5A95A 4DUXA 1HWWA 1UKTA 1V3LA 1E40A 1R86A 2ZXBA 1TFVA 4NRRA 4WSKA 4GO8A 2XUCA 2O9RA 3WH9A 1R47A 3WD3A 1OD0A 4UOQA 3CHFA 1UH4A 1V02E 5D9NA 4KMQA 3THCA 5DMYA 2RGLA 1E0XA 3RM9A 2QLYA 3U7VA 3AJ7A 4NZJA 1UWTA 5FKYA 3ARQA 4TVCA 4P7OA 2J7CA 1BQCA 3UG5A 1H11A 2YL8A 2D22A 1E4LA 5AYBA 1GOWA 4FNUA 3LRKA 1TZ7A 4E8CA 1M04A 4IM4A 3AYSA 2V38A 3VGHA 2CKSA 1TQWA 1EO5A 3WH5A 5I24A 4PMUA 3PTMA 1HTYA 3PBGA 3MI6A 2ZUNA 1QNPA 3IJ7A 1UR8A 2ZXAA 1QWUA 4QLKA 5CGMA 4PMRA 1Y7VA 3AHTA 4JZ5A 2E8ZA 3VIOA 1NWSA 4DM1A 2BY2A 3EDFA 1MXDA 4WJXA 1C3FA 4IPLA 3CLWA 3WBAA 3CTTA 2XIBA 4LYRA 1UH3A 3E1F1 1NWRA 1QBAA 1BGGA 2IXUA 4U3AA 4CVUA 2VX4A 5GNXA 5KZ6A 1DWFM 1VBUA 4TUFA 1J0HA 4P7RA 2D3LA 1CGXA 1CGVA 3T2QA 1ISZA 2JALA 1UZ1A 3DYOA 1PS3A 1GQJA 1EDGA 2E40A 3HJEA 3VMNA 4MB3A 2CNCA 4RE4A 4AMCA 4HA3A 3FNDA 1BGAA 2NT0A 2JIWA 3WFZA 3CUJA 1HKMA 2ZXDA 3VSVA 2F1BA 2XWEA 3I3EA 2YL9A 1KGWA 1OD8A 1ODUA 1CENA 1UKSA 2XSBA 4IPNB 1CNVA 1V3KA 4H8HA 2ZIDA 3IANA 3WH6A 3VM7A 1EDTA 4QP0A 1JZ4A 3W81A 2D73A 5D8ZA 3DYPA 4MB5A 1AQ0A 4GIAA 3AZTA 3ALFA 2GUYA 3ZO9A 1W9BM 4MAZA 1HXKA 2GK1B 1GOOA 3DYMA 4AMWA 1N82A 3OA5A 3OLGA 1J0KA 3T2PA 2CHNA 1GORA 3GXIA 1NH6A 4E8DA 1G0CA 1WAWA 1MW2A 3GXDA 4BQ3A 2EPMX 2JE8A 3BUIA 3K4AA 2BFGA 4CU8A 2CESA 4L4PA 5CLWA 2A3CA 5FL0A 3K8KA 3BAYA 4HMEA 5GPRA 1Q4NX 3DDGA 1JI2A 3GNOA 3CUFA 4JHZA 2WLZA 1XSKA 1UOKA 4EANA 3AZRA 3VGEA 1KXTA 4M80A 4P8WA 3B9EA 4X0VA 2FGZA 3D4ZA 1V08A 1SMDA 3SCPA 4ATLA 2ZUWA 4ZE5A 1KTBA 1QWNA 4V2XA 2O9PA 6TAAA 3LPPA 1C7TA 1EDQA 3ZQ9A 3A4AA 4ZENA 1UD6A 4EK7A 2DT2A 3NUKA 4AZHA 1UASA 4J28A 4AZ5A 3W37A 2CBIA 3PZVA 4FK9A 2VT0A 5DT7A 1KCLA 3AHZA 5HOSA 4CN6A 4UFIA 1OB0A 1SFSA 1JL8A 2VNCA 3A4XA 3ZT6A 3L4WA 1DEDA 3D5HA 5CPQA 2YDQA 1DTUA 1E6QM 1V6UA 3UR8A 4TX8A 3SCWA 3OIHA 3MO4A 3N9KA 3G6MA 3AMKA 1DWGM 3MU7A 1XSIA 4UFMA 1UA3A 1HJVA 1V0LA 2CIPA 2Y24A 2J47A 3CPUA 3W28A 1Q6GA 1UD2A 4FNSA 2XTKA 3B9AA 4FLQA 1GNXA 3T0AA 1DP0A 5ABHA 5A6LA 1EOKA 1KBKA 3W6MA 3HU7A 3JUGA 3AMCA 1LG1A 1UWRA 1KGUA 6A3HA 4JIEA 4GXPA 4CN1A 3WEZA 4QFUA 1JXKA 2WKLA 2VX5A 5EBAA 4W89A 3LMYA 3ZSSA 4FMVA 5ABGA 5E09A 1DWJM 4UQEA 1MW3A 4AZ7A 4PCSA 8CGTA 3AS3A 2AOSA 1MQQA 1J0JA 4WKFA 4NSBA 3WDJA 2VRJA 4PN2A 1MXGA 3M07A 3I3DA 3BMVA 3OG2A 1OGBA 3GTNA 4MB4A 1B3YA 3AMLA 2F7PA 2QF8A 3ARWA 4PTVA 4AD4A 1E3XA 2WM0A 4M81A 3CH9A 1V02A 5IFTA 2WC4A 2WMFA 4WIWA 4A3YA 1W2VA 4WSJA 1RP9A 1FFRA 5I78A 3WMSA 1A47A 3GYCA 4MDPA 3VD5A 1LWJA 2FH8A 1H3GA 1EHNA 1C92A 1ECEA 1E6RA 3TTOA 4DUWA 3KWXA 3WL1A 3UERA 3WNKA 1E0VA 2DT3A 4M29A 1BAGA 4F9DA 3WY4A 4W88A 1M53A 1TA3A 1J12A 1WNOA 1QNQA 3WUGA 3IJ8A 4F66A 3AS2A 4OOZA 1JF5A 2VL4A 2X2HA 1QBBA 1VFMA 1HVXA 1UR4A 3K8MA 2DH3A 2D0GA 1PZ3A 2E9LA 3SCTA 1J10A 5ABFA 3AXHA 1UKQA 5IDIA 3WD4A 2DSZA 4AC1X 3T09A 3MKKA 4MDOA 4UOZA 3W53A 2GDUA 4ACYA 2F8QA 2TAAA 3WF3A 1UHVA 1K9TA 3GXMA 2CBJA 4H2CA 2B31A 4BQ4A 5CPTA 1X6LA 1G9HA 5D4YA 2W67A 1WKYA 4KGLA 3NCOA 5CSYA 4OBSA 3BAJA 1IT0A 1ISXA 2VURA 4ZE4A 1HKJA 3ARPA 2PWEA 2VX7A 1PEZA 2BVDA 3T0BA 2AAAA 4CKQA 4J7RA 3BVWA 1E5NA 2EQDA 4HMCA 1UD3A 5IXEA 2WBGA 2CBVA 5BRPA 4Z2GA 3BAKA 3BLBA 7CGTA 1J0ZA 3QHMA 3IGUA 3U7BA 2E9MA 1OINA 1R8LA 1D2KA 4XZBA 3PZOA 1BPLB 1OWQA 2YDRA 1GVIA 3A3HA 4TVDA 1H41A 3BUQA 2YIHA 3WMCA 4ML4A 4HPGA 4JFVA 1I1WA 1R85A 1HJQA 2F1AA 3W38A 2DPEA 1SR0A 3AROA 3FAWA 2D1ZA 2JF6A 3AMDA 2XN0A 5D9PA 3F4VA 3HG5A 3EDKA 1H49A 3EYPA 1CZ1A 3LPFA 1JDAA 4C7DA 1T0OA 3EJUA 1K9DA 3G6LA 3L4VA 2X09A 1KTCA 2J7BA 4CGTA 3AFBA 4FNPA 4C7GA 1DWIM 3EJTA 3DHPA 5CPSA 1MVYA 2EAEA 1H0GA 4KRTA 1RPKA 1U30A 3BVTA 3CV5A 3DX2A 3NSXA 4HMDA 1BVNP 4DWSA
chains in the Genus database with same CATH superfamily
1WG3A 1BD2E 1IV8A 4AG4H 2AQNA 3BJSA 1TTCA 3CXDL 1POJA 3S1XA 1KIRB 4MS8D 3DBSA 1W0VB 1BSIA 2FDBP 2ZJSH 4IW4C 4B5EA 1IXOA 5KYUB 1GTEA 3V0WH 4NNAA 4L9LC 1A65A 5HI5C 4ANUA 3C8KA 3MV9B 3VWKD 2J66A 1I8KA 1T0MB 4GT7A 5E4EB 4D9RE 4KK9C 3WQCA 1JI1A 1VFAB 2ZZUT 4LOUD 3TYFB 5C55A 4OLEA 1UR9A 3IPFA 2R9HC 5JW4N 2XYLA 4HOMA 4EIZC 4MNGA 2D7OA 3ALWA 1RI8A 4WUUD 25C8L 4R84A 4IBWA 1YNPA 5EDSA 3KWWB 1GHRA 1D5ZA 2I5IA 1NANH 4WY0A 5F96H 3NCEB 2HEJA 2HE5A 4QHPA 4MDIA 4KRUA 2JJSC 5T3ZH 4XCCH 3ELFA 3ARRA 3PSVA 4MMZC 1M6OB 4P48A 3VDGA 1OGAE 4JFDE 1CGYA 2IO5A 5FF7A 7REQA 2YSWA 4MA3B 3JZUA 4R7DB 4AM0B 3NSYA 2YOCA 1MG2C 3U25A 2KHAA 4X4KA 3LNEA 4J8RB 1XXDC 5EZOL 2OPJA 3GUWA 4Y96A 4ZQRA 5ICUA 3ZKXC 5BOZG 4XAFA 3RM8A 3QIUC 5CEZH 2VDNL 4P2VA 2YXFA 4X4ME 5CBAA 5H2BB 4MG4A 3WUEA 5I07A 1TPXB 4P0DA 4JDBA 3QR2A 1TZIA 1O6TA 5FYLH 3KTSA 4A4AA 1AQKL 3QUMB 4EI5C 3OXSB 1P9MA 2VGFA 4WGXA 3W02A 1OHZA 3PFQA 4FQQB 2XKNA 3HC3L 3ZE0F 5C0GB 5M7QA 5B7FA 2YCIX 3UT0A 1W3KA 5FM5M 5DTFA 3RXZA 4PG9B 4L4TE 2I07B 4IG2B 5C0QA 3OLIA 5HUOA 4QR6A 2IFFH 3GSWB 5BVPL 4QDMA 2IMMA 3CH1B 4S1DC 4RRPM 4N0UA 1MNSA 3PWNA 2FD6H 2E9BA 3AAZB 3MX0A 3U9UB 1YY9C 2ZUQB 2TYSA 4RMBA 3DUGA 5LBGA 5DCDA 2H3KA 4NQEA 3K2KA 3G04A 4YDLC 3KWSA 3RRXA 1C8QA 3L4UA 3HZVB 5GZNA 5D8WA 2BVYA 3RG6A 4F2EA 1PB0A 1V6VA 4P59L 3TVMB 3H42H 2H9AB 2O4MA 4M1DL 2PTXA 4H88L 4IOFD 3WS3A 3GJEA 1ADSA 5J9PB 1V55B 5AENA 3LLXA 4WSGA 4JTAA 2TRHA 1PDKA 1DEEB 4PJBE 3T0ED 3ICJA 3ZVVA 3N3TA 2YMOA 2R69H 3STZA 1OPGL 3CZFB 5TGBA 2W81C 4KROB 5FHBL 3PXJA 2AMXA 3VXSE 1H9VA 4M6MH 5D71L 4QF1A 1G9MH 3UCRA 4Y9AA 3UF9A 3QEQB 3ARGB 1CD0A 5D9SB 3L12A 3MMWA 3P3YA 1IGYB 5DMIL 5D1XC 1A7PL 1RJZB 1F7BA 1BJ8A 1N4XH 4TVPD 4WQOA 1TJ0A 3U36A 4Z1BA 4PI0A 4PEKA 4G1MA 2OTWB 5I1GH 2IQ9H 1XWVA 2H9GB 1F76A 4WXZA 4BI6A 1ZANH 3GTTA 3WY2A 2YJLA 5HQLA 4OCYH 4V1YA 2JLLA 3EO0B 3TBBA 1XLEA 5FHBH 4Q8WA 3S3PA 2P48B 1FNGB 4N2DA 4JKLA 2H6OA 4P2RB 4R9XA 3S35L 1AZBA 1BYNA 4D8LA 4X4YA 3D4GA 3BVJA 3MSGA 5I3IA 1YEHL 2VISA 3ZDYF 4JDVB 2V5MA 2WXJA 4FD0A 5I1KH 4O52A 4FJZA 3CJPA 1TMLA 2UV8G 4FX8A 2DUZA 3IWUA 3F5KA 5GJTH 1X5ZA 3KPRD 2W5PA 1MHPL 4A68A 3TQ0A 2VR8A 4TM9A 3PUEA 3O6ML 1B30A 2IH3A 1RUKH 2ADGB 2F19L 2FWUA 3BP7B 2J4GA 4Z7OF 1PG7L 4JRFA 1OTSC 4PLKD 2IDFA 3VI4A 1OCQA 2PDMA 4GACA 5LIKX 3IDNA 2BCMA 2A6JB 4PI2A 5DD3L 1DZBA 3WBDA 2GIYA 1YEYA 1NAML 2BNQD 2FDSA 3NN8B 4JCMA 3G08A 3KL5A 4J3TA 3TTQA 2F53A 2WVVB 2AQ2A 3LXAA 4Z7UB 2G2RB 1M7DA 4P5TC 2PBGA 4I9WE 1ODAA 4F8PA 3QXDB 4XBGB 1XIBA 4L5FE 4JVWA 4TNFA 4V1DE 5D1XA 5FYLL 4O53A 3EFDH 3MV9D 3GR4A 4Y4FA 4OVXA 1XYZA 3MREA 4P9MH 4MAUH 2PPFA 3IEBA 3UNTA 1QBML 2VDNH 3FSUA 2YXOA 3ATEA 3MRKB 3P81A 4Y1TA 1J1OL 3L4YA 1XZ0A 4H01A 1AODA 4ERAA 3Q9PA 3MGTA 1KB3A 4LEBA 4ALAC 1BF2A 4WKZB 1C8PA 3E96A 4PMYA 4XAZA 1S5WA 3QJFB 4NRZB 5F3HA 2J72A 4DESA 1EHLL 1A6AB 3S2AA 1DPMA 3W76A 5DJAA 2R29A 5D9MA 3JZYA 1GGTA 1FH2A 1US2A 2CEQA 3B2DC 5IF0A 5JQ6L 3BZFA 2ZP8A 1ZY9A 3D05A 4DGWC 4Q4MA 4E0CA 4HPOL 4H9VA 4AYID 2IGFL 1TVNA 2IDQA 4YSTA 2R56H 4KI5C 1EOMA 4ILDA 2GJXA 3ECUA 3EDEA 2QFPA 2B16A 3FCGA 4OD2B 2BOBB 2P5NA 3QNXA 1ROWA 2P80D 1URIA 5DURD 1NFIB 1RHHB 1TWDA 4LRIC 4M5ZH 4N2GA 4DBEA 1DE4A 3OMIB 3IDUA 3U0PB 1H3UA 3GUGA 4YTQA 1NFAA 4JTRA 3MR9B 1MJJA 2V3DA 2P24B 4F2TA 3WS6C 5B1AB 4NDMA 1DBAH 1NZRA 3C2AL 4U4IA 1GEHA 1LLWA 2ACSA 3APNA 4QEHA 4RV8A 5DFAA 3L5MA 1D6EA 2R27A 3LNFA 5FO2A 4UR9A 4H9TA 2AJSL 3O4LE 4MJZA 4F48A 5C9RA 5I1HL 2EVFA 3US9A 5JHLL 1NGZB 1LO5A 1UUSA 3NABL 3T40A 1X5GA 4MXWH 1MJ7H 3RMJA 4AWSA 3BLFA 3C6SB 4YK4C 1UZGA 1KJ3L 2J21A 4Z78B 1VYRA 5LBSH 1DYZA 4RBPH 4YVNA 3ZTEA 2WJFA 5HYJA 2YD3A 1LDPL 3TW9A 4D6EA 4NJ9L 3MLXH 2ESVA 4QO1B 4WKAA 4ODWA 1H0IA 2BOLA 3KLHD 1GYMA 2CKBL 3SAZA 3F04A 2ALDA 1CLYL 4IKNA 3UTTE 1A0QL 2EIJB 2DQMA 2PLTA 4HUXB 5FYJD 3NSMA 1BLNA 2H8PA 4MJ2A 3QYCA 5SWZD 3SUTA 3L3GB 1SFTA 4EN3C 1G1KA 1WFJA 4UTLA 1HJCA 3CT2A 4LEFA 4KNSA 2BSBA 3GH4A 1KLFB 4QDPA 2YQ2A 5D2NB 1IF2A 5HJXA 3B9KB 1KNWA 2PTUA 4HK3J 4GMTH 1A1MB 1W72H 4QXGH 4ZSTA 1OT1A 1MCWW 2X42A 1ACYL 1BBJA 3LIZH 4AYGA 4DOHB 1W1YA 3RFAA 4CNNA 4EE9A 1E5BA 1OCWL 5GVJA 4QCEA 4MMXB 4XCNB 3VOIA 2DQ6A 3STPA 1NA8A 2R2EB 4GH1A 1X5JA 1A6VH 1UC4A 4AY0A 3EKLA 3VI2A 4ZFFB 4U1KB 2M26A 5HHPB 3SO3B 3QJRB 4JMNA 4OTXH 3KBWA 3OKYA 2GPTA 3O8AA 1JZGA 4GIRA 2RACA 4M7KH 4HNUA 2YD8A 4N9OB 3MROA 3FYOA 5I1JH 2ZUVA 3RU6A 2NYYC 5JU6A 5IIEB 1VBJA 4X63A 3O05A 2EYSB 1XYAA 3PWJB 1Z89A 3NZSA 3OB8A 1KLGB 3UZYA 5LBVA 1FBIL 2FVNA 2I85A 3WSQH 4LCCC 4ZOAA 3VXOB 4NPJA 3UYRL 4CJ0A 3ORWA 4KF1A 3KPLB 4J27A 4O2EA 3UTQA 4DIAA 1RHCA 1BXUA 3DK0A 3LXBA 4NG3A 5DZ9A 4AY8A 1PHWA 5BYWA 4BKTC 4GGHA 1AFVH 2WIIA 3ARTA 1MQPA 1F2QA 1RQEA 3CLEH 3C9NA 3U1SL 1BHGA 1XGZA 3B9KD 3KL3A 4PP1C 5LBSL 3DUSA 1LTDA 2E76C 4XV0A 4KQ3H 4M6NH 4G72B 4XC3L 4UDTB 1CGSL 4F0RA 2FBOJ 3Q5OA 5DK3A 2PO6C 4XMTA 3MUCA 1FSKB 4KBPA 3D0CA 4Z76A 3FUEA 1M9WA 1EUNA 1NGYA 2NY1B 5ITFB 2RFGA 2BWIA 3VGAB 3SD2A 5JQIB 2CLMA 3T6CA 3BEWB 2P8MB 2QZ5A 4ZTXA 5E2WH 4PJAA 2NYKA 4MX7B 3ZXWA 4JFTA 2UXVA 3F7KA 3HAEH 4N0RA 4PUBH 3SDXE 1S3HA 2YRLA 5FWQA 2AXFB 4H8WH 4XZNX 2BPBA 4FLRA 2VFGA 4RNJA 3PTKA 3PWIA 1SXNA 1YXYA 4UTJA 5BO0D 5HTSA 4WHCA 2ZPKH 1MAMH 5FPIA 2PP8A 1YUKB 4DP8X 4GQ9H 4HF5L 4X5PA 3WO3B 1H8OA 4X50A 5EU6E 2WOQA 4UMCA 1KCKA 2QT6A 5DS8B 2AKZA 3BKYL 4HIBA 4OKVB 4Z0BL 4D6GA 2WO5A 3EJJX 4GEJA 3T3PB 1B0GB 3CZKA 2PCQA 1WXZA 3N42F 3L81A 2ITDA 2HPOA 2BOEX 3PG9A 3H9ZA 2N01B 4JQIA 3LENA 4FS9A 3E8UH 4NJHA 1GHFL 5EIQA 1IGJA 3RDTD 3S5LA 3N18A 2X4SA 2CR0A 2R29H 2WLKA 4ZMZA 2VMEA 1BX2A 1RXOB 2VXSL 4KXAA 3VXUE 3LCIA 4MKSA 4EPKA 1ZALA 4XXWA 5EIIA 5ES4B 3RWEB 4ZODA 4FQJH 3H8AA 2FWLB 3BUYA 5TE4L 3UO1H 3IGHX 2AEIT 4MOZA 4OHQA 3KOWA 3IMWA 1MEXH 4LNRB 1G4EA 4YPGA 4NAJA 4P8QA 2DQIH 2YPLA 5I74C 2YEVB 5TBOA 4C6LA 4IRZH 5DUBB 3DHFA 3WXVH 3GBMH 2QKIB 3UBXG 4LYQA 4NIRA 5KS9E 4HNLA 2VOTA 1TTUA 3NQ6A 4FNQA 4BY3A 3ZJ8A 5L6UA 4Q6YA 1U95B 3MLZL 4QHUA 4UQBA 1DQVA 2IWEA 2NY3C 4POZC 2XVNA 3GHBH 1MIML 2VR2A 1UWGL 4FC3E 4AWJC 3N2TA 5DD3H 1HEZA 5DEFB 5C0IA 1UYWL 4WY0F 5I0XA 1TV3A 3BVDB 2UVEA 3V5HA 2CW6A 4Y4HB 4PMJA 1NCBH 2HG5A 4FI6A 1AO7B 4PY8J 3B05A 4HCRL 2ZVIA 4YHPA 3TJEL 1M05A 3BIKB 5J0BA 4PS8A 2O1AA 4ODTH 3U4BL 2EUVA 1GOQA 1DQJA 3L5WA 2XH0A 5GJTL 3CK0L 4PJFA 1G6RB 2IAMA 3PHOB 4JRWA 3WS6A 1BZOA 2FT7A 4PP1D 2DSKA 2HT3C 2PC8A 5FJTA 4JUTA 2E6PA 5IV2B 3D39A 1GCYA 3DBXA 3BFOA 3Q8AA 4IQHA 4FMKA 2XJLA 2DSWA 4MADA 1S78D 2EC9T 3GSNA 4GUPA 4QTIH 1CECA 3R0UA 3D34A 5F4WA 4I7VA 5CJMA 5IEKA 3L4CA 2WMPB 3EF7A 1AOZA 4KCUA 1BAWA 2VENA 4UM9B 1SN2A 4HA1A 3P11H 1SFJA 4C4UA 3W6LA 3UZEC 2COVD 3LNPA 2O5XH 2HRPH 1MHHB 2CZNA 4TNWF 2NSMA 3DVNB 5FYKU 1UTDA 2XZQH 4GAAA 2V5CA 2QHLA 5AQ0A 3GZ3A 5C2GA 3QDME 4UFKA 3EYUH 3QW4B 4NQUA 5CU9A 1IC0A 1WZAA 1EHAA 3QO1B 3UCQA 3VFWA 3TNNB 3B4UA 1FWEC 4JFEA 3CG8A 4PJ5B 3TN4A 5GGVH 1JGLH 2Z1KA 3CAVA 2ATPA 4G5DA 1A5BA 4F57H 1BZ7A 1MZZA 3FTXA 4MBOA 5DEGB 1AI1H 1Q94B 1UWIA 1OFRA 2NQZA 2C9QA 4GQPH 5IROA 3VXQB 1PGRB 1TQSA 4HT1L 5CEXA 4MZIA 3L9RA 1IEBB 4JRLA 3NPZB 5EZLB 3EH3B 1AIZA 5DA0B 3VACA 5IJKC 4G11A 3E6FA 3MRDA 4I5BA 5C08A 2VEGA 4FPSA 4PE8A 5MERB 1G87A 4YDZA 2MHAA 4ZQNA 2WCSA 1JWUB 4DQAA 1R5YA 4G82A 1NOWA 4HGXA 5LGJA 3JTBA 1VFOA 3IF1A 3FT1A 4PJAE 4YXLH 4EI5B 1VB9A 3PJNA 3FUIA 5FJPA 1KRCC 5DBUA 5G4WA 1QI3A 3PUUA 2XIQA 3BOXA 2OMTB 2UVFA 1FDZA 4ZXBA 3R18A 5IOPA 3A3YB 4U1IA 3OKNA 5DHDA 3BZ4B 5BVPH 1NEZA 1A9VA 1PKMA 1OFQA 4AENB 1GONA 4GA8A 4JTQA 5KZCB 4R27A 3MLRH 4Z0XB 5DHYB 1ZT1B 1IXNA 4W70A 5HDQL 2R1WA 5C9KA 4DJEC 5BOPA 1SYTA 3DJSA 3FCTA 3HGOA 3CNKA 4XVEA 3CCHA 4YHLH 1NGPL 4U6XB 5KJ4A 4F2FA 3Q06A 1UIOA 4HUVB 1IT8A 3AICA 2A7NA 5D4QA 4L4LA 1U36A 3KLDA 4KY1L 4C58B 4IUGA 5DUPH 3RCMA 1GVFA 4WFGD 1TR7A 2FATH 1E30A 5EEYA 3MA9L 3UR5A 1CYGA 1TZGH 4S1SH 2CDGA 3A6BH 5J1TC 1FA2A 1KT2A 1SSGA 2X6BA 1FZOB 4RIRB 3T44A 3RWGA 3MYJA 1IC1A 3L3KB 3QPXL 5I8EB 4QJ5B 1XGEA 1H3PH 3FUNA 5AB2A 4NO2A 3I6TA 4ZMGA 3EBAA 3LKQA 5BOEA 1JHTB 4G5ZH 1PJ9A 2R1YB 2AJXL 3BAWA 1XB6A 3O8XC 3ULVE 2YBRA 4JLRA 4APXA 2EPLX 2I9LA 2R0LH 2HVKA 4NX0A 3Q2WA 3T78A 4ZMXA 4UMBA 4WLCA 4PUMA 2XA8H 4MTVA 2UYLB 3PU7A 4M7ZC 2I9TA 4YYCA 3V0SA 3A47A 1UZ6E 5FIEA 1XH1A 1B3WA 3NIYA 4AV0A 1T80A 4L64A 4BCXA 5ESAB 1QRQA 3LRHA 4DB7A 1YEJH 3BH9A 3V16A 5ALBH 4MAYC 3E2QA 1EZWA 2AQPA 5K69A 4HJGA 1RLDA 1W32A 3NXLA 3UACA 2P8PA 3Q0HA 5EMYA 1MZRA 2YHGA 3ESNA 4EZKA 2CCRA 1E4WL 5ACZB 5K9OB 4PC8A 3SE4A 1YNKL 4JPKH 4GY1A 4IRSA 3ZN6A 1ZS8A 2D9CA 2C7FA 5JYLA 4G1KA 4R8WL 4TOQA 4BQ9A 3TASA 5U4NA 3RUGF 5IB2B 1CICD 3EWXA 1EGJH 4XXWC 3TO4D 3MRQB 4YAQB 4B9YA 3ZZSA 4JM0A 5AEAA 2VM8A 4GQGA 3T0VA 2WMIA 5FCZA 1U2HA 3JVGC 4FG6D 1O12A 4AIZB 4ZX3A 5I3JA 5K2ZA 4E5TA 2GJPA 3IN0A 4O2CA 1I9RH 2LU3A 3RNKB 2VAAB 5DCCA 2Y22A 1MJUH 3U48A 2AAMA 5DEJA 2DQEH 4LSRH 4YSEA 3MRBA 3T3PE 4HNTA 3CTLA 1VEPA 4E2VA 1JGVH 1EAQA 3B1TA 3P62A 5D2LE 1NGQH 5HP5A 4DWSC 3MRLA 1ONWA 4KCTA 4R7JA 4KHXL 4MMYB 3CDZA 1MH5B 3SUVA 3T65B 1T8QA 4AAJA 3MBEB 4UTAL 2A9NL 3FU9A 3KGUA 4E9WA 5L7XL 1HP5A 1OFBA 4LF3B 4DP9X 1RQ5A 4O18A 4WUIA 4AISA 3IPBA 1KMGA 1MLBA 3SY8A 5H8PA 2X6AA 4ES8A 3ML8A 2JI2A 1MPAH 4GKSA 4NUQA 4XWOC 1M7XA 5LCVL 3SBRA 1NCWH 5B1CA 4D3CL 2AK1L 5I5JA 4RDYA 4GPVA 4DYEA 3D3VD 1I4FB 2V6HA 3WHE1 3EKZA 2XXFA 1JJKA 3MUAA 4I6KA 4MYAA 3M64A 4F15C 4I3RH 1XGYL 4OLZL 2K8MA 5HHVH 5L2KB 1XGDA 1UEYA 4B91A 3AQZA 2F18A 5I73B 4XHQA 5FUZH 4JY5H 5DD6B 1R3KA 2PSNA 3CV2A 1NJ9A 2JJSA 3FQUA 4DF9A 4HFUL 3QUYA 1I7TA 2CRMA 2X4UA 1KG0A 3QB7C 3PS6A 3WFEH 3X13B 3CN1A 2DW6A 2ZBTA 5D2VA 3OKDB 1ZA6B 2DM7A 4HT1H 4YDVB 1FC2D 3W82A 3VGBA 1GZQA 1Q6FA 3HG4A 1I75A 2I56A 1PQZA 3HVNA 5FUOL 3QUZB 3SSGA 4IBLT 4EEEA 4BCEA 1LORA 3SYPA 2JCCB 4XBEH 3GK0A 4OZ4A 4YGVA 1P0EA 4UC5A 1VPQA 3BWAB 12E8H 1TXKA 2V0AA 1E72M 2WZEA 3I6KB 5IM7A 2EIDA 4IIHA 4BR1A 2OYMA 4OCLC 1ME8A 3NZ8A 2E1WA 4C6FA 3G8EA 5C70A 3OAUH 1SVBA 3NFUA 2BOGX 3EBHA 1MW1A 2J56A 4IGSA 4Y4FC 3CFUA 4Z9KB 5C9WA 5ADOH 3IAGC 4PZVA 2Q8BH 5HDOA 1QXLA 2OTUA 4Y2WA 4HSAC 3MA7A 4DQOL 2OZ3A 1AZVA 1TZZA 4NN6C 2GC7C 1QABA 3LHPL 4ATTA 4YU1A 1JV2A 3O4OC 2CBOA 5DR5L 1IEWA 2HDJA 2O9OA 5I8KL 2QMJA 4N68A 3K30A 3BKJH 3CN2A 1T5XB 1YZZA 1JGIA 3GSOA 3KDPB 3G6DL 4ZSOA 1E4XL 2WANA 2PWUA 5KBKA 2IPTH 1U5JA 1H5BA 3AREA 3QIUB 3OHXA 5LJYH 4GY4A 1WBYB 2NY6B 2J88H 4G9FD 4M62L 5IHWA 1XIJA 2VI0A 4U05A 2C91A 4NHCL 4GKTA 2BX5A 3PZIA 5CMAB 2YWYA 1R46A 3N85H 4XWGL 3TJEH 3GIPA 4MFEA 4LGRB 1E9OB 3O9WD 4L9DA 3V5DB 3ULSA 3RWHA 3JT2A 2EJAA 3SIZA 1UWXK 1SBSL 3QQ4A 5BOFA 1UYWH 1JNNL 5TD4A 5KBLA 2HMID 4BWLA 3WUWA 2QCFA 1R3IL 4AK1A 1WAAF 2B7QA 3OTRA 3EHBC 2A6DA 2J6VA 4O19A 2BGSA 1NIAA 4NNXB 3NZGA 4PGJA 2VCOA 1BGXL 2NXZD 5G55A 1JPTH 3EX6A 2VUYA 5EY5A 1JPFA 3QQ1A 2JB6A 2ENYA 1XF3A 3GBNH 3TWYA 3MDWA 3O4LB 5E5UB 2HTLD 1T2QH 1Q8AA 2PB1A 1W9PA 4UZSA 4PUWA 5M2FX 2IAND 5ESQB 2LTQC 4JB9L 5GGUB 1KJ2A 2J7GA 3CYJA 4BEQA 4HS6A 1A5SA 4TUJA 4WNSA 2ZWKA 3RGVC 5DJ0A 2R9HD 4MXVF 4X6CA 4W8LA 1TYRA 5AYUL 3DFYA 1EEYB 1S38A 1KBBA 4GIYA 5HYQA 1VFUA 5DT1H 1TTRA 2WUBL 2ZUSA 1WIUA 4KIEA 2C9SA 1LWIA 4H26B 4BIKA 1J11A 3AW5A 1FWJC 4GJJA 1DL7L 5T5NF 3SGDI 2I57A 2K3HA 3QGVA 3NK4A 2XJKA 2GZXA 1NGPH 3BO8B 3QIBA 2WHVA 2AK4D 2YZ8A 3D69B 2NXZC 3UPBA 2LLNA 4PCFA 3QV9A 4QUOA 1AACA 3TA6A 3CM4A 1AHWB 3P3SA 3L9EA 4JX0A 4BUHA 2R39A 4G9FB 4P4KA 5DJZA 1LXMA 1EJ7L 1MCLA 3PV6A 3PZTA 4N9BA 3CUGA 4BWLC 1UD5A 1U8OA 1UUMA 4F58L 5G4EA 4AVFA 1TKWB 4XP5H 4ENEC 1F3DJ 1SN5A 2HMIC 1JFXA 1P1MA 1YRRA 5AHLA 3SCRA 1N19A 3GSUA 3RVTD 1OYBA 4I87A 2WQUA 1AG0A 4A2SA 1T1YB 2PRLA 4IJ3C 4QHKI 1CXLA 4FIQA 4A6GA 2FYYB 4JFZL 1HDMB 2BRRH 1JPGA 1F07A 1K3IA 5D2NE 4XR8C 4X2UA 3RU8L 4CC4C 4HOWA 4F9LC 2HRWA 2NPLX 2VDNB 1KJMB 1E5JA 1UA7A 3ONCA 3W1MA 3HHRB 4WI0A 2NSQA 3BWZA 3GMMA 4FF5A 1O1HA 2XY2A 1AKJA 1F1AA 3P2BA 4K94H 1BYBA 5HHOE 4RAHA 4NWTL 4O17A 4DFHA 4UMSA 3WF4A 3WQGA 3EJRA 4DWDA 1P7BA 2DQXA 2CLHA 2NQJA 3ILEA 4ZTOH 1QAPA 4JFDB 2ROYA 2WQVA 4MKNA 2DQJH 4WU5B 3HGSA 3TW6A 3IV3A 4I0PA 5DJ8B 3ZQXA 3H21A 4YE0A 1W3NA 4KKQA 5F7DB 3TPUB 1TVPA 3ECQA 4W86A 2CZVA 1JCYA 4P2RE 2TSYA 3P54A 5KSUB 3I7SA 3E0FA 5AOJA 4DWSB 1X1OA 4HZLB 3RDJA 3AWEA 4PGBB 4Q7NA 1VBRA 4NNYB 2ZRYA 5HQEA 2GBAA 4UQ3A 1MCDA 4YHZH 4PTNA 1GH7A 1VRSA 2AKRA 2FDMA 1OGSA 4FX6M 1JZFA 4S3JA 3X3GH 3DEQA 1FVCB 3PNWB 4W7VA 1L7IL 3O11A 1FF5A 1HXMB 4NJAL 4PGCA 5BQ7A 1SJEB 2X1XR 1HHJA 3QHZH 3C5SA 2A9BA 3FPYA 3R8BB 3ZX1A 2JLPA 3KCLA 3FQXA 4NI3A 1KM2A 2QKSA 1BQSA 3HPFA 3NQ2A 3I6EA 4TMPA 5CXPA 3N41B 4CNIA 3H2WA 3JZEA 1EX1A 4HVBA 3GO1L 1U3ZA 2LLLA 1XL6A 3U9PH 4KZEL 4KQ4H 3T7VA 2AJVL 2VN7A 4JY5L 3QUXB 1QNRA 2J1WA 2Z8SA 3KZ8A 2W5FA 1WA2X 1XHGA 4U2YA 5AW8B 2BHYA 4QI3A 5JW4R 5KWYC 4LS2A 3L21A 4WNQA 4LLUB 4TVUA 5CSRA 3AOFA 3GMNA 3VFPA 4EN3A 3ULUF 3ZUNC 2Y1YA 3QUZC 4LXFA 4PJBA 4UIKL 1LO4H 2XGIA 3NSNA 1ZEAL 2BTMA 3KTXA 1XZWA 1DQDH 3URAA 5KG9A 3QOKA 3USBA 4JQIH 3P0XA 2BDNH 3H1ZA 3BISA 4KPLA 1RBOB 3W1ZA 1YQVH 3CN0A 1ICQA 3PGDA 1KGCE 4YK4B 3G24A 4JFED 2D2JA 3W73A 2WSKA 1XGQA 5ADPL 1YBQB 3WLBB 3MBXH 1V7MH 2DQDH 4DGIL 4WDUA 1J79A 1LO0H 4LH8A 2BNUB 2FSEA 1KO0A 2NV9A 1MMFA 3ZT7A 2AMGA 2Z25A 4JG0L 2FJGB 3GJFH 2OLHA 4FKKA 4D9RD 3H2MA 1ZP4A 4AHPA 1WD8A 2R8WA 4OI9A 4MAYD 3NYDA 3DFHA 1EHLH 5F0LB 4MY1A 4GQ9L 3KOYA 3QIWD 4EWND 4AV5A 4AYDC 3IN2A 4KXZI 5JZ7C 2V2TA 4PL1A 4M03A 4LCYB 3HR6A 4KI1A 3RO6A 3WQPA 2EDMA 3FO1B 3RILA 2ZX9A 2A73B 3OKOA 3MNWA 4H00A 1KB9K 5I15H 1BF6A 4WUUA 3FU5A 3LIUA 5KS9A 1CBJA 1OGAB 3AXLA 3EGXB 4AMXA 3PBYA 4YHIA 4DELA 2ZOTA 3BJ91 3NACL 3RJDA 3CZSA 2Z34A 4XMLH 4KX9A 4TSAH 3VOJA 3MMDA 1A6ZB 3DO4A 3LZRA 2WZTA 1GZPB 1FUNA 2D31A 3VWKA 3HO8A 1KEGL 2ZWZA 5C54A 3MLUL 4YSAA 4MJ6B 5GGTH 3POHA 5CUSH 5FF4A 4J3UA 2QSVA 2VLME 1B4EA 3CS2A 3L13A 3O2WL 3OPSA 1KSRA 4Z1CA 2XBTA 4Z5RB 1C7SA 3WEAA 5KSVA 1AZRA 2Q9OA 1BZ8A 4M00A 4Y9BA 1EQCA 2VC7A 3CAWA 3MY9A 1IRAY 4LZKA 5F7YC 4UZGA 3RY4A 5FO8A 3VE0A 3SQOL 1DXIA 2EPKX 1XCWA 3ILPA 2D2OA 1KFGA 1RY7B 1TMQA 5GSRB 5GRZA 1YIXA 3GMLA 1RPUA 1YC7A 3EJSA 4YDIH 1RK6A 3L2LA 3UJJL 1LT8A 4MY9A 4XX1G 4EF8A 4ZQTA 3BJTA 2W0KA 3D0LB 7ENLA 4KTEL 3NQFA 1HH9B 4W4OC 2JCCF 1VZGA 2QADD 1EF2A 2F2KA 5JMUA 3EEZA 1ASOA 2MPAL 3DSNB 5FFOA 1ZSHA 1J01A 2DD8L 4L3AA 3OJMB 3W9EB 1TO4A 3WO4B 1JVOA 5HXMA 4F9LA 2X89A 4LMQI 1KQZA 3WNOA 4NKMA 3TN0D 3IE4A 4NJAH 1CFVL 3IVKA 4U0QB 1ACYH 2HUEA 4C4KO 1F8IA 2B5IC 1CLZL 2E67A 4AD0A 4N0FA 1I9EA 4M6OH 4E9VA 2QVMA 3RJYA 3OKLA 3QDGE 1QI0A 2WGXA 3WEXB 2FZNA 3VCLB 1G4RA 2KAUC 1A4JA 2XH7A 3B3DA 3BDYL 4MVAA 2GJNA 3TIDB 4ZOCA 1NUGA 3HIZA 1G0XA 2WCAA 1M6UA 4UU9A 4PJXA 1SHSA 4OQTA 1HQ4B 2VJ8A 3HHSA 3UC2A 3WKNA 4ALAL 1F58L 3DROB 1H9DA 1M65A 4FOKA 5EG6C 5A94A 1JV5A 4KFZC 1BEUA 4HJUA 4L0YA 3U3HA 4E41E 2Y61A 3UXLA 2Q3AA 4BRJA 1XIWC 5C0DA 4JMXA 4WF7A 5G5DB 2BY3A 3PWVA 4P7NA 1INDH 1FRGH 1MQRA 2QULA 4ONFL 4GG9A 4LLMB 2DDQH 3FB7B 1OFEA 2IPUK 4Y2LA 5I1HH 4P05A 1UMYA 2ZF9A 4ELMB 3DI2B 2OGYA 1UG9A 1K8DB 3QZMA 4AVIA 3N2BA 4CNSA 3OAZK 4EOUA 2J77A 3QXVA 3MJ9A 2XFXA 4NHUB 2AQVA 4IPJA 2Z8RA 3DV6B 1MFEH 1MDTA 2HT3D 3ITVA 4Y4KA 1A5CA 4LY4A 2PCEA 2JKRM 5DXXA 2E46A 5KYNA 1NWPA 4UILL 5CO1A 1HG3A 4DP0X 3QPKA 4K0OA 1A8JH 1KTKE 2YMXL 1O9ZA 5DC4B 5ESVA 2HWGA 4LCUB 4X2PA 3MLTB 4XP1L 3UADA 4QHMA 5TTRA 3HMCA 5BXRA 5IB1B 5L88L 4Y5YB 1R3WA 2D3VA 4N8PA 1IEIA 1Q6OA 5IG7B 4LNYA 5KSBF 2X2JA 2AS5M 5CPOA 5TF1H 3AXMA 4R97C 3VDBA 4JPVH 3M5VA 3HC4L 3S8FB 2CO6A 4JTLA 3A6OA 1LM8V 1M71A 3CUPB 2H47C 5DFVC 2EO9A 4GRMA 4NRSA 4F9JA 2ROXA 4FEZA 4AGNA 3VDAA 4J8QA 2C71A 4XD5A 3N3EA 1V6XA 3L3OB 1JPHA 6REQA 4BDVB 1DOSA 3PQYD 2E9WA 4WW1A 4EVZA 3R1GL 4ZPTB 1S9YA 4ZAKB 1RU9H 1L3NA 1ML1A 1TR1A 3CQIA 3NJLA 3C6CA 2A7PA 1R5VB 1ZFJA 5CC7A 4UDUA 3LS5H 4YDJA 3SODB 3FRUB 4RGND 1AVAA 5FOJA 4RNIA 1GGIH 4I3SH 4PRID 3SBFA 3V0UA 5F7EL 4TMCA 2VLRE 4NQQA 4V28A 1E5YA 4JHVA 4K68A 4UTFA 4TX6A 5DEZA 5L9DL 2QCNA 3MUXA 5TDOB 1KFAL 5ANMB 3UCCA 2JI1A 5ICYB 4YLCA 1Y8BA 4S3AA 4NF7A 4CQ9A 2GK0A 5C0AA 4DZ8A 4F79A 4A3QA 4NT0A 1YLBB 4AG4L 5C2CA 2OMYB 3KPPA 2HS6A 1RUKL 2F19H 4G56A 1J8HB 3LVEA 3MLWH 4L4OA 4MWAB 2WKGA 3VXGA 3GVRA 1OYCA 1M41A 3Q8EA 2ZICA 1YA5A 3O6FB 1OCOB 4JVPA 1K6QL 2B1HL 2EYTA 5IZ7A 1VZHA 4S2SA 2WAQA 1T41A 4LSPL 5MEPA 1YDYA 4WV1A 1QJWA 3VUPA 1OEZW 2D9QB 4FL4B 5EU4B 3G3MA 2VXTH 2UZYA 2W61A 2N3JA 2FHCA 3DV4A 2Z1XA 4UIMB 1G7VA 4EPSA 4MJID 4B5WA 3VIPA 3UTSA 3MP4A 1IBGH 5D1ZI 4NAFB 2FE0A 2Q76B 4GBXD 4H1LH 3NTCL 2F2HA 4J6RH 4LEOA 4RVBA 5IW1B 2WXMA 3FJLA 1UXSA 4JFFE 2BOCA 4WHDA 1YHPA 3FBKA 4JM2D 4LLVB 3D2UB 3PPEA 4UOW0 3FO2A 2V5YA 3VQ2C 1Q7ZA 1R38A 1XYFA 3QHNA 1VA9A 1HH6A 1AH0A 1K3UA 3RVVD 4Q6JA 3ZVIA 2X5PA 3C8HA 3OVUB 5CP7A 2A77L 3BP4B 5C07A 5DR5H 1KTJA 3OKKA 2DVUA 4N8CL 2APFA 2MQ3A 5C3TA 1FWIC 5D7HA 2DJXA 2J13A 4KJYB 4AYFB 1E9LA 4L1LA 4OV5B 1BVKB 3SDDC 5KYYB 3DX6B 1V5XA 1R1CA 4FG2A 2FECI 4IBQA 4B96A 3OGVA 4JX4A 5D4HA 5ABEA 4JIPA 5J56B 4L9XA 1SXCA 2CJ3A 3P3RA 5EOCH 3EX1A 7FABL 1UM4L 3LRGA 3T4WA 3LZOA 3IDIA 2DPKA 2B59B 2FTYA 5E1QA 3AQYA 2XN9B 5J12C 1MQ8A 3HE6B 4PJ5E 2X7WA 4QE1A 1H5YA 3LHTA 1LEKB 4GRLC 4M7JH 3O3EB 3ERPA 3RPMA 3SDOA 3BHBA 3WD0A 4L9YA 4OZFA 4DBDA 1WWCA 2WYSA 4ZQPA 2OLSA 3BDYH 3BT2H 1S7WA 2WLLB 1ZTXH 2R7EB 3KPRA 2IWGA 3QJUB 4OIFA 4X5WA 1FE8L 5B1BB 3VGAC 1GVQA 5B1JC 2E77A 5FFLA 2YJQA 3NJNA 4F8NA 4K3GA 4RFNB 1ZDQA 4GLRI 3MRGB 2WINB 5L8KB 2EKSB 2DORA 3K5XA 3L7EA 5K1VA 2WPBA 5GRUL 1KC7A 3ELAT 4L65A 4XNUL 4JDYA 4E42A 5GGQH 2ZCHL 2OMXB 4BFOA 3UP8A 2ZG3A 2B5IB 1LL7A 2BVPA 4IRJB 3KJ4C 1UOLA 5CJ8A 4WK9A 1L0PA 3EYOA 3NH7H 4NKDA 4QGCA 3GVVA 1AA1B 2CKBH 2YO3A 4UOW1 4RETB 5GGVY 4F7CB 3VMPA 3VWJB 4LAMA 3LKSB 3PE9A 2QIIA 1V3HA 5JYMA 3N13A 4N8VB 1S7XB 3E6HB 4NO5A 3D4CA 3MHGA 2DEWX 5C0JB 4IIEA 4M0XA 3FAXA 5FJOA 4D9PA 2Z35A 1JTTA 4LPYA 1RZKH 1E2VA 1KCRH 5TNVA 4NSKA 3GJFK 3GPSA 3BSMA 1F11B 2J5LC 1V93A 1FFOA 4UTBH 3EMZA 4W4NA 3FJ6A 3PULA 5D09A 5CQ1A 1NP2A 4AC4A 1NQBA 1TLMA 3HNVL 3QZWB 2OEKA 4JQ2A 3V6FA 3CO8A 2VSDA 1X1NA 5I3DA 3GHTA 1BFTA 4JTIA 2FGWL 3QYQA 1RERA 5AYIA 4L4TA 1JSYA 1WTGT 3HNSH 3E2SA 1E9YB 2PWVA 4HTBA 5JHDE 3L5IA 3CZ8A 3S2CA 3MRHB 2E74C 4B5ZA 1AD1A 1OE3A 5ALBL 5DMLA 1W2KT 1DLFL 1ZCRA 3DSFH 4AVKA 5AY7A 5AFDA 5IHUH 5D5MA 3RJXA 2O0TA 1A8ZA 1C16B 3VAEA 4ZFZA 3H8NA 3QQ3A 2NQ9A 3RAOA 4NQED 3RLUA 3UZXA 3BCDA 1LBMA 5AYZA 2IQTA 5J5DA 5DUMH 1HZHL 5BV7L 1ZAJA 4QAWA 5SWZE 1XRFA 1PNCA 1I8IB 1UKPA 2IQDA 4L0PB 4JDEB 5DFWH 1TWSA 1OHQA 4OOUA 5A16A 4DF2A 3QVAA 3TIMA 4WY7L 5AC8A 1GKOA 1FO0A 1OGTB 3AITA 4CRPA 3TESA 2P26A 3LHYA 1VHCA 1PZAA 1QSEB 1B4JH 2F54B 2EIZB 4OAWA 5GRYA 5GZOC 1J6OA 1TJRA 3R06B 1N6QL 1XFCA 2GQ8A 1NCOA 2BVOB 4GX8A 4AIBA 3WIHH 4GP8B 1K4DB 4X6FA 1U1JA 4Z2JA 4GG8B 5MEND 4D2NA 5HYSB 5HNTA 5TJWK 3PAJA 1HQRA 4OGAC 3MXVL 4O51B 1WCBB 2WVUA 3H85A 2ZCHH 4MCMA 4U1NB 1XJBA 2X0HA 4LBUA 6FABL 4AQ8A 1U58A 3EYVB 3VKAA 4UBDD 2VE6B 2X4OA 2PXYA 1GT8A 1NTHA 1OTSD 4PLKC 4U33A 5J6HB 3JWNG 5DD0L 5DD1H 4L8SC 4XN5A 3L1OL 4NQXB 3TBTA 3LHUA 3V35A 4DYKA 4QS6A 4ZAKC 4OCWH 2DWDA 2B4CL 3LSBA 3C60C 1QYGH 2XWTA 5KUKA 3AMGA 3NQDA 2PPEA 4N1CA 4RL3A 1YEIH 2ZP9A 3LEXB 4M8VA 2CITA 1OKEA 1I1YA 1HAWA 2DI7A 5D2XA 4RMVA 1NSJA 4APQD 4M24A 3ZTCC 4XP4H 1I82A 2AEPH 2HYMA 2DJ4A 3OZKA 3ZK0A 5I1CH 1LE5A 1CLXA 5E5CA 4YIQB 2IDCA 3INPA 1O7SA 1XMWA 3F01A 1PLGL 3AGWA 3T8MA 2PWHA 4HK0A 2V3EA 3PAOA 1D5RA 1OK8A 3D30A 2F8XC 2V9RA 1O75A 3J7HA 2CMRL 1UM4H 4GUCA 5KYUA 3WTTA 5ILTL 5JR1L 4MZRA 3GDRA 1UQSB 4H13C 3N0AA 4IHCA 4U10A 1J1XL 3S98A 1GOMA 4NFCA 4F27A 5D1XD 4XODA 3TYFA 2XI9A 2G37A 2O5ZH 3QFEA 1LL1A 5MKGB 2IKGA 5F6HI 3EOTH 5C0RL 4AD2A 3S3DB 3V7AE 1F2JA 4W9TA 3MOAH 4NM4H 4P4KC 3KWWA 5AW4B 2BGNE 3FC8A 4R4BB 1KIPB 2EIKB 3D87B 4UQCA 2ZF8A 1XLFA 5DJDB 2P5PA 2ENJA 1IKOP 1H3WM 2OR8A 3HOGA 3H22A 5TAOA 1KN2L 5EZIL 3AWGA 5FV2A 5A1AA 1ZHAA 3KAOA 3N15A 4XZWA 5FEPA 5XIAA 1X5FA 5CCZA 3CH0A 3ABKB 1I1XA 4DPPA 5DZOA 2Z91B 1ZVHA 2ZNXA 5HVFB 4IOFC 4J8RA 1ELSA 4J3SA 2HZGA 2HPIA 5JW4Q 1IFGA 3BGGA 3AUOA 2DD8H 1XT5A 1ETA1 4GRLA 2UY5A 1HL5A 2TSAA 1VGEH 3DPBA 3ET9F 4N1HB 1FA4A 1JQVA 1M03A 3AM8C 3OPUA 4Z95H 1YY9D 4BSVB 3IAPA 1FHUA 3ZE2F 2VN4A 1PIGA 1G5GA 4L8DB 4PB0L 3F2CA 2O6PA 5IOKA 3MMEA 4QRNA 3VGGA 4RDBA 1REIA 2A3HA 3EGDA 2JXMA 1EZ2A 2MPVA 2PO6B 1P0SE 2NQLA 5GS1C 4QM1A 1OY0A 4BZ1H 5FWRA 2VGIA 1PLGH 1KIUB 1JRBA 4H40A 1U33A 4JFQB 3OU8A 3QH3B 4ZO9A 1TJXA 2VM4A 4JZNA 3RAJH 3U79A 3WNIA 1NOLA 1UH2A 4N0UB 3PWNB 1FV1B 5I2IB 4OZHE 1W3JA 3NZPA 3GU2A 1T66C 3ZL4H 3CDYA 4CL7A 3QNZB 1EXHA 2ARJA 5CJBA 4AQOA 4NQEB 2J6EH 1GZ1A 3G04B 4XC1H 1ENUA 1U8HA 4G8FB 3THMH 1YPIA 4B3ZA 5GGTL 3GC5A 1KYOK 4Y9PA 5D30A 2BNRA 1UA6L 1ZIAA 4HD9A 4MB1A 4C1LA 4JANB 4OD3L 4ORZC 4RNFA 5IHHA 4GI4A 1S39A 4S3DA 4E0RA 3BOVA 3P30L 4D7PA 2PPCA 2GSGA 1ADWA 2JKXA 3WDHA 1AO7D 2X4NB 3BVNA 4WVXA 5FYLD 2DQTH 3C86A 4D0CA 1PD6A 3WIHL 3VJ6B 4WRHA 1E9PB 3S88H 3TQVA 1SXSA 1M9SA 5D93C 4U6HA 1H6FA 1H5VA 4DX3A 1D3CA 4G8GE 1ZBCA 3PSWA 2R29L 2JQMA 2EEAA 5B3NA 4RGNE 1E2WA 5FYKE 1XR8B 3BYYA 2BNRE 1IGYA 1XLBA 1ET5A 3UXAA 2PTTA 4UZUA 4IP4A 2PODA 3VZXA 5C9XA 2TSBA 3W2KA 3EDJA 4O02B 2OZ4H 4APQA 1R3QA 3Q45A 3W23A 4C6QA 4UTTC 4XUGA 2CBPA 4PJ9B 4I13B 4JO3H 4GC3A 3TH4T 1RHFA 4HBCH 1P7QD 2DZEA 1NFBA 2GDQA 4IHOB 3KBMA 3LGDA 1A50A 1MAML 3PC0A 4FG4A 4PBVC 4X0NA 4CSSA 1A5FL 2ZADA 1E73M 1KLZA 3P5YA 1BF8A 2YK1L 3CE1A 4XXCC 4F4RA 1YQVL 3HI6H 3TYGH 3C2OA 3MMUA 3EG9A 2NY0D 2ETWA 2DIBA 1MFEL 2B9AA 1TSIA 2W0FB 2WLHA 3FTUA 1MFDL 1FN4A 3QULB 1CFNA 4NUGH 2X2YA 3UW6A 1CE6A 4L4VA 5E6ZA 4K38A 5ABTA 1EERB 5CKSA 4DO7A 4HDIA 4LKCA 1Y1DA 1ZAGA 4AGOA 2AFNA 2J8TA 3NURA 4JHWL 5CILL 1ZT4B 4X0KB 1E6JH 2ENPA 3IDNB 2XDHA 3KW8A 3A4FA 4XC3H 3UFIA 1F90L 1R3IH 3FONA 1J9SA 4MKVA 4UNKA 4PVLA 1Q0EA 3IKKA 1VFBA 1A6UL 4M61B 3CFJA 3QEHA 4FRWA 3VD7A 3M7OA 3WTVA 2EUZA 1F3EA 4EIVA 2W92A 2O92A 2P5ED 4MMZB 4KFOA 4LBRA 1AR1D 1VGEL 3RTQD 4ML9A 3OBAA 3QAZB 4Q7DA 3VRLF 4B3EA 4XPGH 4HWZA 5EB8A 2EINB 5C0CA 4AVNA 3NEHA 3FYIB 2YGNA 2VDRH 4UB0H 3SQBB 1TVLA 4U5IA 3D1MC 3KEHA 5LNGA 3ULVF 5E70A 2BB0A 3KOZA 1TV8A 1SYVB 1ZA3A 1SLWA 3FDKA 2YBTA 4YWGL 3M1BA 4P4RA 1X5KA 3KLAB 2AEQH 5IMLA 2BWGA 4UQ9A 3W2JA 2JKPA 5KSAD 4AWTA 3TNMA 4E38A 5HMFA 3V36A 5FDYA 3DFNA 5EPMA 1ZS2A 4LL1A 5D4JA 3VXME 1TA3B 1ZTXL 4PRIE 1NM9A 2O6FA 1W1TA 2VQUA 3KLQA 1ITUA 1QO2A 4NY2A 3RX3A 1RJYB 1A6AA 1OCWH 4MSWB 2VEPA 4HSHA 4CJ1A 1MQKL 1S7UA 3QEQE 3ISYA 2PFHA 3V6OE 7XIMA 4ELKA 4ROPA 3S8HA 5C0EA 5K4XA 1J1XH 3G6AA 5IF0B 1K2DA 3ROLB 3WNMA 3GHPA 2ZA3A 3ZE0B 1T0NB 5D7EA 2O6EA 2JH2A 1CXIA 1QTYT 3TJHD 2IC2A 3MI3A 4JY8A 5REQB 3REQB 2ZKHH 2NQ3A 1JGMA 1EYWA 2GK2A 1L9WA 1KCSL 2DQFB 3AT0A 3GSNH 1MCFA 3FQWB 1VGKA 2Y36H 4IPIA 4UQIM 1QA9B 4LOEA 5FC9A 5KBDA 4D8AA 1F13A 2OSLB 2KERA 3GLEA 3QNFA 1Z9SB 5F2FA 3N44B 3P40A 2FEJA 2PKDA 2OB3A 4O16A 5SX4H 1ZWIA 3ITGA 4JM2C 3V4UH 3V8CA 3E5PA 4Q9QL 2IALA 1J8HD 1ZTVA 4XNMA 1HHHB 4UI2A 1N8FA 1FYTA 1T5KA 3GTHA 4ZTPL 1XCTB 4F9PA 1IBHA 3US1A 4OZFG 4YHNA 1E6JL 2HKHL 4BQBA 1NGZA 1GW9A 3HMWH 5LNRA 2YC1A 3M1CA 4JQXA 3G6JA 5DD1L 5E5MB 3KBJA 3JWDC 3L6FA 4NZCA 3JV0A 3VUSA 5DVPA 1JFHA 3ASOB 6FABH 3CXHJ 5HYJB 3K1KC 2CDFA 1K4CA 1K4HA 1ORQB 4ODWB 3TA3B 2F58H 2EKGA 1MF2L 3VDHA 3NRFA 1OZUA 3PHQB 3CC5B 4HIHB 4XBKA 3W3OA 5C2XA 2DWSA 1XCQB 1XF1A 2BS9A 2YK1H 4PJHE 5F7UA 4A2LA 3OO2A 3RN6A 4LCQA 2BLFA 4A8RA 4GAGL 1BVLA 1XO8A 2ADAA 4TMBA 1JGVL 1A3WA 4PRPE 5EIVA 3QEGH 3FTSA 2XZCH 4XMZA 5HGBB 5KINA 3MLVL 4FP8L 1EBGA 1HVQA 4JPWL 5E7FA 3B9KA 4IIQB 5ACMA 4RR4A 2NR6C 4AGMA 1J0YA 4JL1A 1HP4A 1U8LB 4I4WA 1U3YA 3S35X 4B60A 3R2GA 4U6YB 3P67A 4FQPA 4PJGE 3TM6A 1DUZA 3ZKMC 5AYUH 3S2JA 1KJVB 2K78A 5FB8B 4QLRA 1RJPA 4N9EA 2GJZA 2IEPA 5FKAB 4R8WH 1N0LB 1UKTA 3I2CL 3ZKNC 4ZFFA 2CHDA 2PNDA 4XI5D 3QWRD 3UPRA 1W5NA 1EV2E 1M7JA 1NPJA 3AUJA 1E40A 4HALA 1E4WH 4QHLA 1J86A 1G84A 5C0BE 5IQ7L 1KIQB 1R86A 4NRRA 4ZNEA 1FZMB 4DEFA 2WWOA 3UPMA 3PWJA 3BE1H 1B4RA 2O9RA 4CQAA 4XN2A 3WH9A 4ICWA 1JZ2A 3IIVA 1UW9A 2VIRA 4PFEA 1NICA 3GI8L 4Y19A 5TFSL 4LHJB 1KN4L 1TELA 1BQHA 3VI4E 3CHFA 3GUTA 3VFRA 3PS7A 1NC2D 3PAZA 4MJIA 1UWFA 2RGLA 3HIJA 5D7IF 3RM9A 1OCNA 2QLYA 2HJFA 2VLJB 1IYXA 2R0LL 3QCTH 1UWTA 4HCRA 4Q9QH 2V30A 1EVUA 3LQZB 3ML9A 4FXGC 1IT7A 3BOLA 3AG3B 2QFRA 4UDTA 3D85D 3SY6A 7PAZA 1D5IH 2I1OA 1HOCB 2GITA 2ZZ3A 2X9ZA 1CT5A 3KCPB 3G5YA 3UG5A 4F8QA 1P4CA 1NGYB 2WZPD 3RGBA 2VEFA 3ULVL 3LQGA 1BKHA 4S2CA 4FNUA 4L3CB 2CJSA 3VQMA 4E8CA 2EXWC 3GSNL 4U6TA 1I2NA 2DU2A 3RL1A 1OFAA 2F84A 4KY1H 3AYSA 3ULUE 2OX1A 2Q87A 5BQDA 1TQWA 4H25A 3HN5A 3WH5A 4EDXA 2UV3A 3D09A 3P82A 1ZHNB 1RZIA 3EBGA 4Z95L 1XIGA 2RFXB 3PBGA 3MI6A 5CSZA 1Q8MA 2TODA 3ONBA 3V6OA 2AQSA 1UR8A 3DIPA 2JV6A 1ESOA 3I6LE 5CGMA 3CUXA 4LAQH 3IGXA 3WJMB 3VNKA 2PUZA 3AHTA 2XNAA 3FA5A 4MKMA 4ONGL 5F0MB 2JBMA 4Z0SA 3TXVA 2E8ZA 4KVNH 4FFYA 1I60A 2C1IA 2BY2A 4MCZB 4LCSA 4WJXA 4DQWA 1A3ZA 2DTSA 3LN9A 2RA1A 3OMNB 2JK2A 4FXRA 2VWEE 3WBAA 2XIBA 4LYRA 3OPZH 5EN2B 4NZ4A 1X97A 2HKAA 1ZPLA 4EF3A 1EP1A 2ADJA 4JZJB 2X3BA 3IJHB 1ICPA 1A7QL 4NQSA 4U3AA 2QVNA 5JHAA 1W56A 2NSOA 1JFQL 2CKBA 4HXBH 4XPHL 4KQNA 1TZOA 1HXYA 4NN6B 1J0HA 2PA6A 5LGHL 4MNQB 1E28A 2R0WL 2HH0H 5TK4A 3WIHA 3NEVA 5JQ9A 3QK0A 5CILH 2YDSA 1TYJA 3HPSA 4EXQA 4Y4KD 2UUDK 4LALA 3L7FB 2MQCA 5HHOD 3LZPA 1O66A 1EYEA 1UZ1A 3QZAA 2JVUA 2C7UB 1ONQA 3QNYB 1HEZB 2QQLL 5EU5B 3KPNB 1GZHA 5D96C 1RJRA 3LN4B 4WHTA 1A7BA 3FVDA 1IQDB 2YD4A 3KPOA 4RE4A 4A63A 4TQEL 4AMCA 1HCYA 3PDGA 1OLZA 1HESA 3TZNA 1BGAA 4XVDA 2JIWA 4Q6IB 3WFZA 5F3FA 3U2SA 4LAZA 1HKMA 4MNQE 4YHKL 8XIAA 1WTLA 3WGVB 4YNGA 3BV4A 4M8QA 1F02I 4PRBB 4AX7A 4AVOA 3I3EA 3RVWC 2YL9A 2XFGB 4QRPA 1MCCA 2R1NA 1ODUA 1G9NH 4YBQC 5ECGA 4Z08A 3DGBA 5FJUA 3MQIA 4GUPB 1WBHA 2NQCA 1IM9A 1E27A 1DBBH 4N6EA 5J04A 1DBKH 1F8TL 1NL0H 5DMNA 2XSBA 5KZCD 1XBVA 1YPFA 1CN4A 1OAUL 4H8HA 3U4KA 2PMQA 2MNWA 2A6IA 1U8MA 2YN3A 3CVIH 5K39B 3P0VH 1EGJL 1XGRA 1EDTA 4GUIA 4LY8A 1LMIA 4NRXB 3UP6A 4KPHL 4YNYB 4QP0A 2H1PH 1E2ZA 1T7ZA 2AK4E 2GCYA 2OQJA 2R15A 5HVGB 3BUVA 4DGVH 2DYRB 1IR2A 3DVNA 4HG4K 3HPLB 1DE5A 4XCCL 3GO2A 3GRIA 4PBWD 4S3EA 3NSFA 1DCEA 2VXVL 5TQ2H 2DZPA 1VQTA 3QO1A 1T7LA 2X89D 3RRQA 2BJMH 4KO5A 5DHVA 1FWRA 1Y0LA 2PCFA 3P0GB 2DZWA 4OBTA 5TFSH 2VN3A 3OA5A 1JF1B 5IHUL 4O15A 1A4LA 2HCZX 5DEGA 5A2IH 2C3GA 2NR6A 1K85A 4UAOB 1QSFB 2FQGA 1ZHBA 2UWEE 3P73A 4PN6A 1T1XA 4WFED 4JCWA 4BGLA 4H8PA 1ND0A 1PLAA 2GJ6B 4WOQA 2CHNA 1E9IA 2ACRA 3MRDB 2OTPA 5F9AC 4ZMYA 3L67A 3N40F 1S9WB 2CR6A 2GW5A 2X4RB 3GD6A 2JE8A 3BUIA 4AQ1A 2LU5A 2YAQA 5F7AA 3VFTA 4NKOA 5IW6A 3MV7A 4D8PA 3ZLHA 4GFXA 4N4QA 4QHRA 5J6SA 3L1GA 4U1LB 5SWQA 4BZ1L 3QRHA 4HHGA 4ZSUA 1MWAH 4MA8H 4PY8I 3CSYB 2WOBA 1IIKA 3GHRA 1V8HA 3B6SB 3BDXA 3W56A 2OMWB 1NC4A 4IU2B 4LVNC 5CLWA 3O2VL 2H26B 3HBQA 2XZCL 3T0EA 1N10A 4OV9A 3O8XB 4Z7WA 4AGQA 3MBFA 5I3HA 5I19H 3MBWA 3NCWA 1VKFA 5FL0A 3BAYA 3UIZA 3SQLA 1Q4NX 4LAOA 3A3WA 4M3PA 1NLBL 3OR6A 2APSA 4JRYB 4WO4B 1M57B 2VLKA 5J5RA 1NEPA 1IAKB 2XWZA 5FM5O 3CIAA 2GOUA 3QIWB 3EWWA 4QQ3A 4DJFA 2BS71 5D1QD 5LB1A 1TVBB 4M80A 1H1YA 4P8WA 1ZTXE 3D4ZA 4XZHA 1SW3A 3S96A 1V08A 2UZXA 1SMDA 2W65A 3MYJB 1AS7A 3PHSA 5I8EA 4IGNA 3HMWL 3N2MA 2ZZ4A 3EGSB 5G2WA 1PCXA 3R7QA 4Y5XB 1QWNA 3ATBA 3LGGA 4Q33A 1K8CA 3WLRA 4E4UA 3TWCH 6TAAA 1JVNA 1C7TA 3CMOL <