4RL3A

Crystal structure of the catalytic domain of a family gh18 chitinase from fern, peteris ryukyuensis
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
271
structure length
271
Chain Sequence
KVFREYIGALYNGVQFTDVPINSGVTFHFILAFAIDYTSAAAATNGVFNIYWQNSVLTPAAVQAIKAQHSNVKVMVSLGGDTISGSPVQFTATSVSSWVANAVSSLTSLINQYHLDGIDIDYEHFDQVSTSTFVSCIGQLITQLKANNVISVASIAPFDGVESQYTALFGQYSSVIDLVNFQFYSYGAGTSASQYVSLYNTAASKYGGGAKVLASFSTGGVGPAPSTVLSACQQLKSSGTLPGIFIFSADGSYASSAKFQYEQQAQTLLTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Chitinase A
publication title A class III chitinase without disulfide bonds from the fern, Pteris ryukyuensis: crystal structure and ligand-binding studies.
pubmed doi rcsb
source organism Pteris ryukyuensis
total genus 100
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2014-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4rl3A00
3CHCA 3HN3A 1NH6A 2G3NA 4AIUA 1MYRA 3DYPA 3NYDA 1IT0A 1UD5A 1HN1A 4WKFA 3UR8A 3D5HA 3AMLA 1A47A 1H11A 5FD0A 3RJXA 2X0YA 4QCEA 2EEXA 2VJXA 1VFMA 3S2CA 3WF0A 4MNJA 4N0RA 1VFFA 1JYXA 4HOXA 4PEEA 4AIOA 1V6WA 4HZ6A 1HKIA 4Z2KA 4AZ7A 1HJVA 1UR9A 3CUFA 3BSGA 3AHZA 2DT3A 3WQ5A 3KL3A 4AXNA 5AYIA 2QV4A 3K4AA 1MXGA 5FKYA 4C7FA 3DYOA 5A8MA 1HJUA 2WZIA 1J0IA 1W1YA 5IFTA 4HA3A 3PTMA 5EBAA 1LQ0A 2HVMA 3CLWA 3L4ZA 4WIWA 4K68A 1C91A 3PTQA 2YBTA 4H7VA 2D0GA 1JL8A 3WDIA 3SCTA 1KQZA 3VIKA 4EKJA 5E70A 4WLCA 1XSJA 4Z2JA 1FHLA 4ZENA 5HXMA 1ISXA 1OD8A 7CGTA 4DM2A 1M01A 3MSDA 2XPKA 2X09A 1BVNP 5CLWA 1CXLA 2GDUA 4XX6A 1SFSA 3JUGA 2BV9A 5HNNA 2J74A 3GXDA 3QHMA 1EIBA 4GZEA 3W6MA 1KB3A 2CHNA 1US3A 4J3SA 1OGSA 2PI6A 3OG2A 5IFPA 3MUY1 1ODZA 3I3EA 1W9VA 2GDVA 3WEZA 4HU8A 3WH7A 2DSKA 1TFVA 1UQZA 5M03A 1BYAA 1KR1A 2EPNA 3T2PA 3WL0A 2JIWA 4ACZB 1WPCA 1DWFM 3WD2A 2E3ZA 4Z2HA 4C7DA 1HVXA 2G41A 3AIVA 1KGWA 5FCZA 1JFHA 3ZO9A 2WZHA 3PBGA 1ISYA 2WHKA 4HMEA 1DTUA 3VNZA 4PCSA 2EPMX 3WFZA 1UKPA 3ARTA 1E6XM 1PX8A 3VM5A 1QI4A 2A3BA 2XVNA 1J0ZA 3WN6A 1V0LA 5CSYA 3VTRA 3ZT6A 5A1AA 4UFKA 1KCLA 4CUCA 4D1IA 4A4AA 3PZMA 3VMNA 2WC3A 1J9YA 4AEFA 4CD5A 1WZMA 1PX4A 4PUEA 5E9AA 2XG9A 1B3WA 2PF0A 2Y24A 5E6YA 1Q6DA 2J7DA 2NW0A 1JGIA 4CCDA 5A69A 2ZX9A 3MUAA 3N9KA 2EPOA 4AZGA 3VX1A 3EDKA 2PC8A 2ZOXA 2YIHA 3WDHA 3W38A 3SCWA 1ZB5A 2VL4A 3THDA 2FH8A 1E0XA 2VVSA 3GDBA 3NSNA 1OINA 5I0DA 3SCRA 3VPLA 1VFOA 4OUEA 4M24A 3SUTA 3CUIA 4CN4A 1EO5A 4LXFA 4F9DA 1G01A 2EXOA 2VZTA 1V3KA 4HZ8A 1LLOA 3WKZA 2EQDA 2QF8A 1UD8A 2XIBA 2CPUA 2WWDA 4TVDA 4HU0A 4UQAA 2J79A 3T2QA 5D9PA 4WKHA 2UY4A 3B9DA 3MKKA 1M53A 2X8RA 1NARA 2VCCA 3B9AA 1JZ8A 1CGTA 2CEQA 2J62A 2VQUA 1BF2A 4AISA 1NWRA 2PWEA 4OOZA 1HKKA 2XWDA 2ZWYA 5A6AA 2VRJA 3AFBA 4ATWA 4P8UA 3AMKA 1OGBA 4JKKA 2FH6A 6A3HA 4TVUA 5BRPA 4PMOA 1SMAA 1XC6A 3T09A 1VBRA 2BS9A 4U3CA 4ACYA 1TCMA 1OM0A 2WAGA 2GJPA 2OSYA 3GH4A 1K9FA 3DC0A 5DEZA 5IDIA 1E56A 3MU7A 4AWEA 2G3MA 1QHPA 2YL9A 3RO8A 1E3XA 3CZJA 4JFWA 1Y7VA 4PBGA 3WMSA 4XUYA 1Q6EA 2G3IA 4UFIA 2V3EA 1EDQA 1XH1A 1D7FA 5EFFA 5AYBA 2XGIA 4D6FA 4CU6A 2CESA 2WWCA 1QI3A 4MNLA 1OIFA 2MANA 4E8DA 6TAAA 1NQ6A 3W82A 3OBAA 4ZFMA 1JNEA 2QPSA 3AS3A 2DDXA 1UR4A 1UWTA 2YDSA 1JG9A 5CJ5A 4U33A 1VEOA 4XZBA 4QP0A 2WKLA 1CIUA 5ABFA 2XGBA 4GIAA 2WMIB 3DECA 3ZSTA 1R86A 5A6LA 2W91A 2QMKA 3MO4A 3AXXA 3UG4A 5A8QA 4ZE4A 3OLEA 4GZJA 4HA1A 3U57A 4LYRA 4S3KA 1QNSA 4URIA 1UOKA 1DWAM 3UCQA 1ECEA 1UH4A 2VUYA 3M7SA 1HKJA 1UWUA 4AY1A 1F4HA 2WPGA 4KMQA 1BLIA 1QBAA 5ABGA 5AC5A 3QHOA 2GJRA 2D24A 4PMRA 3N13A 1JF6A 3SCPA 3BAJA 2X2YA 3A3HA 1H0GA 1UR1A 4UQCA 1V3IA 2UY3A 1VF8A 4AZCB 4FLOA 1UKOA 3BSHA 4AZ6A 3I3BA 3WQWA 2DSWA 5BWFA 1B3XA 3T08A 4TUFA 1J0JA 3AS0A 3PZVA 5HDRA 4HA4A 4L4PA 4TX8A 5I3DA 4KGJA 1TG7A 1E4MM 3FY1A 1G1YA 1QHZA 3MS8A 1TA3A 4JFUA 1W1TA 3GNOA 1WP6A 2QLYA 1E5JA 3AIQA 2G4FA 1CXKA 2JF6A 1UR8A 4QCFA 3CH9A 4D6CA 2ZXAA 4L4OA 4UOJA 1C90A 3PHAA 1K9DA 1H1NA 3PZUA 2ZX5A 2W63A 2GVYA 3IAPA 1KR0A 4KH2A 3SURA 1CLXA 3N12A 4P7NA 3KWXA 2C8NA 3BAYA 1GOKA 3ZIZA 2WYSA 1VJSA 1PIFA 3WD4A 1LL7A 5CLTA 5DT5A 4RE3A 1NWUA 2VC9A 1GOOA 3W28A 3ZT5A 2BY3A 3F5JA 5FOOA 2W61A 3I3DA 3OLDA 2GFTA 1TVNA 4GI9A 1KFWA 2VX7A 2WHLA 1OCQA 1WZLA 4JAWA 2DSUA 2DQXA 2YDQA 4UNIA 2JIEA 5JBDA 3SCVA 2PWFA 3CMJA 3LPPA 3NCOA 4MB3A 4MTVA 4AD4A 2GJXA 1XSKA 2YA0A 4GINA 4BS0A 1M7XA 1V0KA 4D6EA 5DO8A 3SUSA 3OZPA 4LX4A 2Y5EA 4WKAA 1GQJA 3SCQA 1XD1A 4MNKA 4MADA 5CPQA 1GOWA 3GXMA 2YLAA 3PZOA 4BCEA 2WHMA 1CGUA 2B31A 2DH2A 2VR4A 2D2OA 5ABEA 4IISA 1V3HA 3WUEA 1JZ2A 2A3EA 4JKMA 4E8CA 2CHOA 5F7UA 2WVSA 1JZ5A 4MPKA 1H5VA 3BCFA 1CWYA 4PMUA 1TZ7A 3CBWA 3ALGA 1R7AA 7TAAA 4NF7A 1B1YA 3N1AA 4D6HA 1CGYA 3VIGA 4D6JA 4AD1A 1JAKA 2CKSA 1LL4A 3RIKA 3L4YA 3ALFA 3MMWA 2WC4A 3ARRA 1W3LA 1TR1A 2WVVA 3EBVA 3TOPA 2BVTA 3GZAA 1W3JA 5I24A 1HJQA 3AJ7A 3ARWA 1V03A 1EH9A 4PN2A 2VT0A 1B90A 2EBNA 1PZ3A 4HTYA 4W88A 2VTFA 5D8ZA 4J3XA 1U30A 4PTVA 2ZXBA 3K4DA 4H8HA 3LPFA 4H8UA 3ZR5A 4GQQA 4GI6A 4UFHA 3AZRA 3QGVA 1E1FA 1V0MA 1UKTA 3ARZA 4H2CA 3TTYA 4TVCA 4D72A 3EDJA 3CZLA 4GXPA 8CGTA 1GQKA 4DUWA 3T0AA 3A4WA 4MB5A 3AHYA 3AZSA 3KL5A 3WF4A 4EK7A 3AYSA 4Q22A 5E6ZA 4DWSA 1WDRA 3CTTA 4F66A 3SCOA 1JFXA 1EDGA 3FAWA 5I5RA 5CQ1A 1GHRA 1EO7A 2Y8VA 3EDFA 1VENA 2ZUTA 3VKKA 1V08A 3VMPA 1E4NA 3M46A 3WQVA 2EJ1A 1E70M 5CPSA 2F2HA 4WF7A 3B9EA 4W7UA 2BXZA 2PWHA 1NP2A 3IAQA 2WVTA 4AD2A 3O6AA 1W9BM 2YL6A 4CD7A 2V38A 4KGLA 2WK2A 3TONA 2WMFA 5M5DA 1CBGA 1R8LA 3L4TA 3RPMA 3W0KA 2ZXDA 1A3HA 3CMGA 5EB8A 2XJ7A 4GZIA 4KRUA 2DIJA 4AZIA 4YHEA 2VZSA 1HNYA 1VB9A 3W26A 1R87A 5DF0A 3FAXA 2WC7A 1NWTA 1FFQA 1KGXA 1CGWA 4ZEPA 2WBKA 5BYWA 1Q6GA 4MJ4A 3BMWA 1B31A 2AAAA 2J7CA 5A2CA 4CU8A 3MV01 5DMYA 3F4VA 3WH8A 4Z2LA 1GZJA 1LF1A 3J7HA 3KE0A 3WDJA 3WNOA 2YL5A 2AOSA 5HPOA 1G94A 4R5EA 2JF7A 3CO4A 1B0IA 3CZGA 3O9NA 4ACZA 4ML4A 4CGTA 1E1EA 3L2LA 1B9ZA 3VIIA 1WDPA 1I1WA 2BY1A 3BCDA 3VIMA 1CNVA 3UEQA 3AOFA 3WQ6A 4KRTA 2CYGA 2FHCA 2CCRA 1EHAA 3II1A 1OT1A 5A2BA 1JZ4A 4JIEA 2V5CA 2XSAA 3L4UA 2WNWA 2E8ZA 3WFLA 1GOQA 4P8WA 1QI5A 1U33A 2VOTA 3VVGA 1H0IA 3WDRA 1DWGM 2YOCA 3QOMA 1H41A 2IXUA 4U2YA 1H09A 4J27A 1VEPA 1ZJBA 1TVPA 1IZJA 3BGAA 2WW5A 1OGGA 3GXIA 1EXPA 1BGAA 2XUCA 1GQIA 3SUWA 2J7HA 1XCXA 3CZEA 2NT0A 1VFUA 1UWRA 1BQCA 3T0BA 5HBFA 1AQMA 2DSVA 3WUBA 1DP0A 1FH7A 2A3AA 4W86A 3U5UA 1KXQA 3ARQA 5CGTA 3CZKA 1EOKA 4E4PA 4X0NA 1W32A 3UG3A 4UQBA 1QI2A 1J0KA 5TD4A 4AD3A 3VIOA 1UZ1A 1AQ0A 5A8PA 5GNZA 1CXIA 3VDBA 1NOFA 2J4GA 3CPUA 2GK1A 1G9HA 4MB1A 2DIEA 3ECQA 3O2LA 3VM7A 1CEOA 1MW1A 2CBJA 2DT0A 2XVGA 3VDAA 2ZE0A 1ESWA 4GO9A 4EE9A 1W2PA 1PAMA 3T0DA 3UG5A 2J78A 1VRXA 3E1F1 3AIRA 1Q6CA 1WB0A 5IHRA 4IPLA 5A3HA 1H49A 3IANA 4UQDA 3SCNA 1HX0A 3BC9A 3GNRA 3LPOA 2OYLA 1WAWA 2WM0A 2Y4SA 3WH9A 4GI8A 4UOZA 3WDPP 5JBFA 1L0PA 4WK9A 5A94A 5E0CA 4UZUA 2WXDM 5ECUA 2FHBA 4D1JA 4UFMA 3AS2A 2W66A 1Q4NX 2D3NA 1E6SM 3L4VA 2VRKA 4JKLA 3AIBA 1GCYA 3RM8A 2VZVA 5E09A 3RILA 1H2JA 4J3VA 3VILA 1J11A 4JL1A 3PZQA 4A3YA 3MUIA 3MSGA 1IV8A 2WVUA 3ZJ6A 2NSXA 1RD6A 3EMCA 1W1PA 3TTSA 4FMVA 2VCAA 5M17A 1MW2A 1JDDA 2WMKA 3DHUA 3GH7A 3K1DA 4H41A 2UY5A 4RE2A 2VZOA 4P7QA 1LJYA 2XHYA 1XGZA 1O6IA 5A95A 3GXFA 3ARPA 3WUFA 2BHUA 1WE5A 2G3JA 1QI0A 1JZ3A 4PMXA 3A47A 4X9YA 3BMVA 3IJ8A 2Z1KA 3BAKA 3W27A 4CCCA 4XV0A 3SUVA 1N82A 4AC1X 1HJXA 1E0WA 1EA9C 4J3UA 1NM9A 3MUZ1 1ZL1A 1NOWA 2BVDA 2CIPA 1US2A 4NI3A 5A6SA 2J7BA 2WANA 2X1IA 4PMQA 1GJWA 4CVWA 2EO7A 2BNJA 1E5NA 1W9PA 2YJQA 2BHZA 1X6LA 4M82A 1SYTA 2D20A 3N04A 1C92A 3EDDA 3K46A 4FLQA 2VX6A 4NRRA 4S3JA 3FXYA 4XZWA 1E4LA 1P6WA 1UZ4A 1MW3A 4HOWA 3WNKA 3RDKA 1LL6A 1LG2A 5C8BB 5CPTA 2VX5A 5ABFB 5LA2A 2VI0A 4JFTA 1PX3A 3EMQA 3A4XA 1MQQA 4QLJA 5EFDA 1JDAA 3NJ3A 3AYRA 4QFUA 1QBBA 3WEMA 2E4TA 1LWHA 3SUUA 4PCTA 1PBGA 1GOMA 1J01A 1MW0A 1DWJM 2WSPA 4WSJA 1Z32X 4AD0A 1V6YA 4AZCA 4CD8A 1UH2A 1HJSA 1I1XA 1KCKA 1HF6A 3AHVA 3WH5A 1FHDA 1JD7A 1UUQA 3NDZA 2J77A 1Q6FA 5A6MA 3OGVA 1RP9A 1E73M 4BQ4A 1CENA 2ZUUA 3IJ9A 3AISA 5IXEA 1BTCA 1W3KA 4OBSA 2QHAA 2YKKA 5CZKA 4JCMA 1PZ2A 2VX4A 5AY7A 2YLLA 1BHGA 4ZXLA 1AMYA 5A8NA 3RCNA 2PBGA 3MV11 1ODUA 2XVPA 3CIVA 1YHTA 4H8VA 4AEEA 3BAXA 2W4XA 3DYMA 2HISA 1WZKA 2E9BA 3OA5A 9CGTA 3GBEA 4W7WA 5I6SA 1M04A 1B3VA 2XTKA 3CGTA 3S6TA 2WHJA 1JZ7A 2TAAA 1E6ZA 3WY1A 3VX0A 4AMCA 8A3HA 1WKYA 2E0PA 2ZUMA 4J3WA 2AMGA 1DWIM 2CBUA 3ZQ9A 1AQHA 2WLYA 5D9OA 1VEMA 2PWDA 3FW6A 2OYMA 2WBGA 1B30A 2CITA 3OGRA 4M81A 1C3FA 3VMOA 2W62A 4CN1A 1CGXA 1H3GA 5CSUA 1JZ6A 3VD7A 1NWSA 2WB5A 4H04A 1SMDA 4ZE5A 4PYSA 5D4YA 2JFEX 3VIPA 3AIWA 1V3MA 1O7AA 4HP5A 2JEPA 4M80A 4AW7A 3SEPA 2ZXQA 1GJUA 3VGGA 1UR0A 3PZIA 4YHGA 4PMZA 4ZXOA 1FH8A 2CXGA 1X1NA 3SCSA 1GQLA 1J18A 4B16A 4PMVA 1GNXA 1HJWA 2Z1SA 3W24A 2GJXB 1C7TA 2BY2A 4UCFA 1UQYA 3VGBA 2VQTA 4HMCA 2E9MA 4Z2IA 3VD4A 4MDOA 5A8OA 1C8QA 2F8QA 1I75A 1TUXA 1MVYA 1QHOA 4CVUA 2C7FA 2BXYA 3W37A 4IPNB 3OLGA 4TTUA 1WDSA 1HP4A 2QMJA 1CZ1A 1E3ZA 2O9TA 2VMFA 1UKQA 1ITCA 4PTXA 1V0NA 4GKLA 1E15A 2WMHA 2J8GA 2JEQA 3RJYA 4P7OA 1BSIA 1QW9A 3W4RA 1XV8A 3W81A 4D6DA 2F61A 1GORA 2ZX6A 3VGFA 1JI1A 1G5AA 1GONA 3SIMA 4PTMA 3WQ4A 5BROA 3IK2A 3FNDA 3AIUA 2WSKA 3AQUA 5BXRA 3FN9A 3ZMRA 4OZOA 1D2KA 1W9XA 1FP9A 3BH4A 4J7RA 4X0VA 3POHA 1UH3A 4D71A 2OWWA 4JHOA 3PN8A 4KWUA 3ARYA 1HT6A 3BAWA 4OOUA 3NSXA 4C7GA 1JDCA 2ZUVA 4W85A 2ZUSA 4D6GA 2WKGA 3ZM8A 1OBAA 3EMZA 1VIWA 1JYWA 3VNYA 1JI2A 2WCGA 2CERA 1YQ2A 1G0CA 1W9UA 4TXEA 1HL9A 4DUVA 1JD9A 2J7EA 5E0FA 2ZWZA 4GPNA 2D3LA 4U2ZA 3B8SA 4LQ1A 4CD4A 5M3WA 3WEOA 1XYZA 2X0HA 1OWQA 2XVKA 2IXVA 1E9LA 2E9LA 1FA2A 3AROA 5FL0A 2W5FA 2PBOA 3AICA 2OYKA 3WD1A 1UYQA 1VBUA 1PIGA 3U5YA 3WNNA 4BA0A 1OB0A 1ZBCA 4DWSB 3M6DA 4HPHA 4PSRA 2J7FA 1V6VA 3EYPA 3VIHA 4AYSA 2G8ZA 2PB1A 2W67A 1V3JA 3GM8A 4RE4A 4BF7A 1B3ZA 4MAVA 3THCA 2CBIA 5LA0A 1VAHA 3AMDA 1CGVA 5KZ6A 2BHYA 1E6RA 2BFGA 2Y8KA 1GW1A 1J10A 1ISWA 1KWKA 2PWGA 1LG1A 1MQPA 5A2AA 2YA1A 1E6QM 4OJYA 5DFAA 1CXFA 2XWEA 3BXWA 1HXJA 3MMDA 1EOMA 3ARSA 5JIWA 4N42A 3VINA 1HL8A 3QHNA 1WO2A 1NOUA 2EPLX 1K9EA 3AHTA 1XD0A 4UTFA 3A4AA 2O92A 3AIEA 4QLLA 5CGMA 3TTOA 1WCGA 4W93A 1ZS2A 1EQCA 2VRQA 3ZOAA 1OSEA 3QOKA 4IM4A 1AVAA 1QNPA 1BYDA 4ATLA 2J75A 3F5LA 4PUDA 2CBVA 2CKRA 3VO0A 4P7LA 1UD2A 3U7VA 3N17A 3AS1A 3AHXA 1QOXA 2ESCA 6CGTA 3ZR6A 4TTGA 3VU2A 1UD6A 1HP5A 3CUHA 4E2OA 4FLRA 4HMDA 4GQRA 5LYRA 2ZIDA 3NUKA 5HPCA 1E55A 3WNMA 1C7SA 1UWQA 4PTWA 2ZX8A 4P8XA 4CCEA 2BVYA 3GYCA 1QPKA 1KXVA 3GH5A 1UR2A 5GNYA 4UQ9A 2WZEA 3ZJ8A 4UOQA 3PZ9A 2BY0A 2XSBA 2VZUA 1E0VA 3PTKA 1JYVA 1B2YA 5JBEA 3N18A 2CETA 3WF2A 3MANA 1QW8A 3UETA 3VIJA 1X6NA 4UR9A 3GNPA 5A6BD 3VDHA 2DT1A 3AMCA 1W9DM 4HOZA 1MFUA 5I78A 4PMNA 3RMEA 4FF5A 1UWSA 1L8NA 3F5KA 4JFSA 4AD5A 1UD4A 4D6IA 4PMYA 2C0HA 4JFVA 4TX6A 4CKQA 2CNCA 3OZOA 4UZSA 3BLPX 1ZBWA 3FHAA 3UR7A 4MJ2A 3GTNA 4M8UA 2DSZA 1GPFA 4LYQA 1BVZA 2YL8A 2IUZA 3UERA 5JIPA 4FK9A 1KXTA 4F79A 1WDQA 1KQYA 2D23A 4U3AA 1E40A 2OWXA 4U31A 3CUJA 5C70A 3VGDA 3W29A 5BRQA 4CD6A 2GK1B 2YDRA 1FP8A 4FLSA 5BXPA 2DGAA 2XM2A 5JUVA 4B9ZA 2VNCA 2UWFA 5BXTA 2DPEA 1V6UA 3A6OA 3K8KA 1KGUA 2RGLA 4M29A 3BAIA 3DHPA 1HKMA 2DH3A 1E71M 2D0HA 4MDPA 3WENA 5I2UA 3CHDA 4LYPA 1BGGA 4GO8A 5I79A 2WCAA 4IUGA 4AZ5A 3ARXA 3M07A 4UFLA 4W84A 1JXJA 3WD0A 4MNMA 1E72M 4M1RA 3VIFA 1J0YA 3WIJA 3VOCA 1WZAA 3VD3A 4PSPA 5IHSA 5C71A 4W5UA 3LMYA 3WMBA 3ZJ7A 1KWGA 4W87A 1MQRA 2DEPA 1XHGA 1UWIA 1PPIA 4BQ2A 1XYFA 1E6NA 1OD0A 1UHVA 5ABHA 4B9YA 4WSKA 4NZCA 1F4AA 2A3CA 2YBUA 3N15A 4XB3A 1EDTA 5A6KA 4PRWA 4HPGA 1NP0A 1V02E 3L4WA 4W7VA 3WBAA 1UD3A 3RM4A 2OLHA 3WSUA 3IJ7A 5FIPA 4V28A 1E6PA 4EAMA 1K6AA 1C8YA 3VDCA 4Q7NA 1FFRA 4OKDA 3KL0A 2VVNA 2J47A 1ISVA 5CXPA 4AZBA 1R85A 4W89A 1UA3A 2ZICA 1QNOA 4DWSD 2WMIA 1CPUA 3UESA 1HVQA 3VGEA 4M56A 2FDMA 3OGSA 2OSWA 3ARUA 3T2OA 2VURA 4JL2A 4NSBA 4J3TA 1JIBA 4U5KA 2W92A 2A3HA 3WELA 1CTNA 2FGZA 4DUXA 4OBRA 2XIIA 1ZJAA 3L2MA 2D22A 4W8AA 4HZ7A 3QR3A 2DT2A 1D3CA 3VUPA 2XM1A 1K9TA 2EPKX 5BXSA 4W5ZA 3CHFA 1BYCA 3TP4A 3WQ8A 2V3DA 4P8VA 4DWSC 2V5DA 1PJ9A 3RM9A 5BCAA 3G6MA 3AI0A 2O9OA 2WCSA 1W2VA 4V2XA 1C8XA 2ZUWA 3NDYA 4B3LA 3W53A 4MB4A 3PZGA 2Q8XA 1BYBA 1GVIA 1XRVA 1BPLB 4MAZA 2J7GA 2WMJA 1EGZA 5FL1A 1OT2A 3WD3A 2GUYA 1FOBA 1QVBA 4YPJA 3U7BA 2XVLA 3APGA 3EDEA 4OIFA 4W8BA 3VGHA 1FH9A 4LPCA 1W1VA 2XFYA 5EMYA 5LA1A 1MWOA 4JZ5A 3NSMA 3ARVA 1JXKA 3WNPA 3ZSSA 5HOSA 2X05A 4B15A 1SR0A 3L4XA 3GBDA 1ZU8A 4QDMA 1XH0A 3MMUA 4W8LA 3WF3A 3CHEA 4J28A 1TA3B 2J25A 3AMGA 1C93A 1OIMA 2RGMA 4BQ3A 4F9JA 1V3LA 1GVYA 4JHZA 2JALA 4R27A 2OSXA 3D3AA 5A6JA 5DT7A 2XFRA 3WDQA 4AIEA 4NRSA 2UY2A 5AC4A 3AXHA 3W6LA 3CUGA 3K8MA 4RL3A 4AZHA 1ISZA 1R7OA 5CG0A 4WJXA 1RP8A 2FHFA 1BG9A 3OLIA 3VD5A 1MXDA 1IZKA 1DWHM 1GHSA 2OWCA 4V27A 1BG4A 3KZSA 2D1ZA 4U5IA 2XYLA 1JAEA 3WBEA 1CDGA 1U2YA 3OIHA 3NIYA 2ZUNA 1J12A 2WLZA 3FHQA 5A6BA 1GUVA 3TTQA 5KEZA 4F8XA 3TA9A 2V3FA 4P7RA 1CECA 1WNOA 1EQPA 2O9PA 4JCLA 5GPRA 1HIZA 3CZ8A 3HJEA 1KXHA 4PMDA 2Y2WA 3HMCA 3OB8A 5D9MA 3WNLA 3ZJKA 3VD9A 1M03A 4BZYA 3ZT7A 7A3HA 2JE8A 1UKSA 3PZNA 1TE1A 1V02A 1UA7A 1CYGA 1DEDA 4ATDA 5D8WA 1RPKA 1GOIA 2V3GA 3KEHA 3AZTA 2O9RA 4CN6A 1BAGA 1DHKA 5GQBA 1ZBKA 1JYNA 1E4IA 1XSIA 3K8LA 2YA2A 3WH6A 3WMCA 2XFFA 2VCBA 1KBBA 3W25A 3N11A 1BFNA 4DM1A 2GSJA 1UG6A 1E43A 1PEZA 1KBKA 4QAWA 1J0HA 2WMGA 4QLKA 1LWJA 4A3HA 1MFVA 2ZX7A 1TMQA 1RH9A 1VJZA 2QPUA 3WL1A 3WF1A 1JNDA 1EHNA 5I77A 4Z2GA 1S46A 1CXEA 3G6LA 1ZBVA 4TOQA 4LGXA 4CU7A 3BLKA 4EANA 4Y7EA 5D9NA 4UQEA 1QNQA 3LPGA 4BQ5A 2WVVB 2FGLA 1ITXA 4UFJA 1CLVA 3AXIA 1B3YA 4B3KA 2E40A 1JF5A 2NT1A 3SCUA 2J8FA 3PZTA 2E8YA 2VR5A 1W91A 1V6XA 3HU7A 1W3HA 1H4PA 1QNRA 5GNXA 2D0FA 5I23A 2VO5A 1XCWA 3POCA 1XH2A 3WUGA 4YN5A 1CXHA
chains in the Genus database with same CATH superfamily
3HN3A 4JHMA 1H7PA 1UD5A 1MZHA 3D5HA 1A4LA 1ELSA 3SY1A 4QCEA 2H6RA 4JIIX 4N0RA 1JYXA 4PEEA 3R5EA 4KWOA 1HKIA 4MHBA 4AZ7A 1VFSA 1HJVA 1M7JA 3M0HA 3BSGA 3RMJA 3LDVA 5GJNA 3WQ5A 2X1RA 4L65A 2QV4A 1MXGA 2V82A 4YCPA 3DYOA 3HURA 2WZIA 1W1YA 3T7VA 3PTMA 5EBAA 1LQ0A 1KBLA 3W70A 1LOLA 4B5XA 1KM3A 4AH7A 4PUUA 2DZSA 3GC4A 1XIMA 3A9BA 3PAJA 4ZOCA 1P48A 3QF0A 2AMXA 3BOXA 3CL6A 3CASA 2P1FA 3GR8A 2HRWA 4ZENA 4IQEA 4DF2A 5HXMA 3G3MA 1M01A 3M0JA 2ZKMX 3KLLA 2BOEX 4AXKA 2X09A 4NZFA 1KC7A 8TIMA 4KFNA 4LC6A 3W02A 1CXLA 4C1KA 4IHCA 3JUGA 3QHMA 5HJYA 4GZEA 1KB3A 1US3A 3SJ3A 2H9AA 3I3EA 2RDXA 4OE7A 3U48A 2DSKA 3G1VA 2V69A 2I7GA 1KR1A 3GRIA 4XO7A 4OTKA 3WL0A 1FCVA 1U83A 3WD2A 4BWLA 4Z2HA 3GW0A 4C7DA 4KEVA 1HVXA 2ZZ1A 4GIYA 5HNRA 3W00A 5C55A 1ME8A 4YWIA 4FA3A 4YMZA 4EIVA 1LOQA 1FTXA 1E6XM 1K6WA 4LBRA 2A3BA 2AL2B 1V0LA 3VTRA 4IMDA 3VFCA 2NLIA 4JTJA 3VMNA 2WC3A 5LIWX 4AEFA 4CD5A 4JPGA 4FOJA 4PUEA 2A85A 2PF0A 3GG7A 4M6UA 2NW0A 1XPYA 1R3QA 4CCDA 5A69A 3FXGA 4FXFA 3C2VA 3WDHA 4GIEA 2VL4A 3OEXA 4FNRA 4ZODA 3TLQA 2J6VA 4JYDA 2Q09A 3GDBA 3NSNA 2QCNA 4JBRA 1OINA 4GCAA 3VI2A 4KCWA 2Z1XA 4M24A 1UUOA 4CN4A 4LF1A 3BV7A 2F38A 1G01A 1S2CA 1V3KA 3A22A 4QROA 1DQUA 1UD8A 3S5ZA 4MOZA 4ZOAA 2XIBA 3P67A 2WWDA 5ENLA 4HU0A 4KEZA 1JUEA 1KM1A 2NQ5A 4UQAA 4LWWA 2XIOA 1GK8A 2X8RA 2BWGA 5IBXA 3BO9A 3EX6A 3HPSA 3W7GA 3L7RA 3BGGA 3VUSA 4XZ9A 1BF2A 1GG0A 1NWRA 3QEZA 2HPMA 2XWDA 5A6AA 3PK7A 4JKKA 4MFDA 1ZALA 5BRPA 1GTEA 4QX4A 1SMAA 1GZGA 1XQKA 3E2RA 5G1TA 3KCLA 4U3CA 2CLMA 4NZ3A 4WY0A 3DC0A 3BWWA 2OEJA 2NSOA 3VABA 4G5DA 4HN4A 1T96A 2EJAA 1NY1A 1E3XA 2QVNA 2E6YA 4YS1A 3WMSA 5CC3A 4XUYA 3QMSA 2V5JA 1XH1A 4WD0A 5LKYA 5EFFA 2XGIA 4EX4A 4D6FA 4MNLA 1C9DA 2PZNA 4WOZA 1WBJA 4ZFMA 4FX6M 2IKHA 2V67A 3AS3A 1UR4A 3CWHA 1UWTA 3OYZA 4LUSA 4KW2A 5MHBA 3OQ8A 4GK8A 3LENA 3ZSTA 3FDKA 2W91A 2P0IA 3MO4A 4N4PA 3UG4A 5CKSA 3OLEA 3DC8A 3UZJA 4HA1A 1QNSA 4URIA 4H9TA 1EL3A 2PD9A 2R8WA 3UY7A 3B03A 3TW6A 2VUYA 3SI9A 3MCMA 1GVOA 1F2JA 3WQCA 1K3UA 1PKLA 3SSZA 3D0CA 3WG6A 2WPGA 4LRTA 1O5RA 4Q8VA 3QHOA 3ZXWA 3N13A 3SCPA 3A3HA 3A4JA 2UY3A 2H3DA 1NF0A 4AZCB 3S8HA 1NDYA 3WQWA 3T42A 1XBVA 3QTPA 1J0JA 3PZVA 4KFOA 5J8LA 5G4HC 2GZXA 2VUNA 4L4PA 1TJPA 2YCLB 3W7JA 3FY1A 1A5MC 3I68A 4JNZA 4FSAA 3G8RA 3UCCA 2OZ8A 4DJEC 1XIIA 3GNOA 2QLYA 1E5JA 2A79A 2E77A 2G4FA 2YW3A 2JF6A 4DI8A 4QHRA 1OCJA 1UR8A 4JQAA 4QCFA 1FWFC 3CS2A 1C90A 1YE4A 5F2MA 1H1NA 2OVLA 1HFBA 2W63A 3IAPA 2D69A 3WLQA 4N9BA 1FKXA 5EYWA 1W3NA 3N2BA 1HO1A 2C8NA 3QC3A 3UXIA 2WYSA 3BJSA 1VJSA 1PIFA 1OK4A 2QDDA 4LU0A 3T81A 3O05A 1Q45A 3AO0A 4IT1A 2W61A 4EWND 4GI9A 2VWTA 1IF2A 1OC6A 3RRXA 4J5NA 5KINA 4KWSA 2OGYA 1FWAC 3L66A 2YDQA 3B8WA 1PYFA 4L9YA 4ASTA 3A9IA 3BL3A 3CMJA 3NCOA 4MB3A 4DB7A 4MTVA 4AD4A 4LVBA 3KVLA 1OFAA 4UXDA 4Z42C 1XICA 4ZB2A 4GINA 2DJLA 4BS0A 4MZ8A 3Q58A 3TC6A 4RXGA 4E2BA 3OZPA 3LBOA 2CZ5A 3MPGA 4QISA 4LSBA 1G4TA 2DVUA 2INEA 1XD1A 2G95A 1XDJA 3V1PA 1VIZA 1SSDA 2PDYA 3LCLA 3LM3A 3WLOA 1W1A1 3WUEA 2FZMA 1PL9A 3DFQA 3R0KA 3RUBL 4JKMA 4XZMX 3PPFA 1A0EA 1H5VA 1CWYA 4N6EA 5LHEA 4ZFCA 1R7AA 4NF7A 4JTHA 3OVRA 2ISWA 4XD5A 4LCQA 1KV8A 4AD1A 1TPB1 2CKSA 1W1IE 1RLCL 5LZLA 3ARRA 2VEIA 4GBUA 1ZRQA 3RPTA 3EBVA 1EJRC 3WLIA 3QYSA 3RX4A 4H9MA 6XIMA 3C2EA 3AJ7A 4FX8A 4RDWA 3E9AA 3AALA 3N4AA 2VT0A 1EJVC 3TW9A 3M64A 2Z24A 1QAPA 3WBWA 4NNAA 4JTLA 4J3XA 3UCDA 4PTVA 2ZXBA 3LPFA 3B8TA 3ZR5A 2YCKX 2QUMA 3M0LA 4GQQA 4N02A 4UFHA 3LU2A 3AZRA 2TSYA 3TTYA 4Q8WA 3VAVA 1GQKA 1XLKA 3HA1A 4GVIA 3WF4A 2VR2A 3AYSA 1WDRA 4OWGA 1F6YA 2HBVA 1TV8A 5CJMA 4I8DA 5LIKX 3W71A 1XFBA 5I5RA 1OCNA 1GHRA 1EO7A 1EPXA 3EDFA 1V08A 2J66A 3WK0A 4H9YA 2Z2UA 4S3FA 5C9ZA 2EJ1A 5U7SA 2F2HA 1YXYA 4O18A 1NP2A 2WVTA 4AD2A 4WHBA 4CD7A 1RQEA 3MDWA 3TONA 5I00A 1TV3A 1UUMA 1ZJHA 3L4TA 5H91A 1FWWA 4PRTA 3W0KA 3B97A 1H63A 1WYIA 2POTA 4GZIA 3TC3A 1M7OA 1PWLA 3PJUA 2ISDA 1NWTA 2VC6A 3M7WA 3P61A 3W3OA 3TAOA 1BVWA 1XPGA 4F4RA 2QGHA 4ZEPA 4MJ4A 4NHVA 1XLJA 1B31A 3GTXA 5CC5A 4DNHA 2C1IA 5DMYA 4Z2LA 3W86A 2C18A 2D2HA 2PDWA 5FF0A 1XIJA 3CO4A 1MDLA 5F4WA 4CGTA 3V16A 2GGJA 3U2OA 3BCDA 3VIMA 1SZNA 5LNVA 1UBSA 2CYGA 3GR7A 3G77A 3RR1A 1EHAA 3R4IA 2R82A 1OT1A 1TVLA 1RPXA 3AWNA 3E02A 2AL2A 4IUOA 1GOQA 5EU9A 1QI5A 3WDRA 4BF5A 3LCIA 4J27A 1TVPA 1IZJA 3BGAA 2WW5A 5KTLA 1OGGA 3GXIA 1BGAA 4RK8A 1H5YA 1W0MA 3CZEA 1VFUA 1VFHA 1BQCA 4PZVA 1AQMA 4UTTC 4Z08A 3WUBA 3FVMA 2A3AA 3H70A 1U5VA 3NURA 1KXQA 4HKPA 1THFD 3CZKA 5G4WA 1DJQA 1US0A 4L1GA 4E4PA 1QI2A 4K36A 4DO5A 3RX3A 4AD3A 4NNCA 1EGMA 3E12A 2Z29A 3U2ZA 2Y85A 3M5VA 1I2OA 3BDKA 3ZLHA 1NOFA 2HXUA 3NQVA 2ATSA 3HQNA 3MUXA 4ICMA 4G6CA 3PTDA 5DQPA 1CEOA 3VDAA 3LLXA 1AFSA 3NPUA 4GO9A 3DFSA 3F7JA 1W2PA 2J78A 3AIRA 3NQ6A 3GVVA 3IANA 5F1UA 1HX0A 3BC9A 1A0DA 3TSMA 2H3BA 3VOHA 2Y4SA 2Q6ZA 3WH9A 3FJLA 3O07A 4UOZA 1DBTA 2W3ZA 4XAZA 5JBFA 3UGRA 1XUUA 4D1JA 4UFMA 3AS2A 2W66A 4NIRA 1VS1A 4HSOA 4YIWA 1DHPA 1XKYA 4IFKB 2NVAA 4JKLA 3AIBA 1GCYA 3L0NA 5E09A 1W5QA 4OU1A 2IW0A 3LYEA 4H6EA 1VRDA 4J3VA 4L1WA 2QKFA 3MSGA 2WZTA 3GC5A 1IV8A 3EMCA 3UPBA 3QGAC 3W7EA 3TTSA 1YBQB 2FIQA 5DN1A 1RBLA 3C2FA 3S6DA 1W8GA 1JDDA 3WLJA 3GH7A 2JK2A 3G1DA 4H41A 4X2RA 5DRCA 1FWGC 2FLIA 2UY5A 1OZMA 3NZGA 4ZMGA 4IPIA 4A21A 1WE5A 3DHDA 3HQPA 3A47A 3BMVA 2PUZA 4MIMA 4MM1A 2Z1KA 1HUVA 4ADTA 1XBYA 4Z1DA 4AAJA 4XV0A 3W1MA 3EAUA 4GNJA 3MUZ1 2CIPA 2J6XA 3PFMA 4LBSA 3TMLA 3LCWA 3IARA 1OY0A 2FYMA 2X1IA 3OVPA 4PMQA 5JQ9A 4CVWA 3OBEA 1I8JA 2BNJA 1W9PA 1NU5A 4U4MA 3TCEA 4FLQA 3NR0A 4WJ8A 4IX2A 5KITA 2VI0A 3ES7A 3A4XA 5EFDA 4ILSA 1JDAA 2IMRA 3NJ3A 3EXTA 4H6KA 1LWHA 3R10A 1MW0A 1TTQA 2WSPA 3O63A 4WSJA 4AZCA 5HQEA 1KCKA 1HF6A 1FHDA 2Q01A 1JD7A 4JYFA 1VPQA 4IIFA 1JPKA 2YCLA 2O7SA 4GWEA 3NG3A 3ELFA 4O8RA 1CENA 3IJ9A 3AISA 3BZJA 4DYJA 1W3KA 4HGXA 5CCZA 4JCMA 3PM6A 2YLLA 4RXFA 3IJIA 3U6WA 3MV11 2XVPA 2Y7DA 3FSTA 1S2TA 3KUMA 3BAXA 3BLLA 2Z1WA 2HISA 2E9BA 9CGTA 2XTKA 4O4WA 4GJ1A 1P0KA 1E6ZA 3WY1A 2AMGA 1DWIM 2EHHA 1GVQA 2PODA 2QUVA 2REQB 1XIDA 1VEMA 2PWDA 3HIJA 4POCA 3OGRA 3S5OA 2F6KA 2GGEA 1KCXA 3KCJA 4JEJA 5XINA 4ENLA 1P1XA 1U1HA 2GUBA 3LSCA 4QJ5B 4ZE5A 4ES4A 2JFEX 3OOQA 4XD6A 3AIWA 2BDQA 1DJYA 1P5BA 2JQXA 1O7AA 3C5QA 3KRBA 4NYYA 2JEPA 4CQDA 4M6QA 4ZQCA 2EG8A 4AW7A 1GJUA 1S2UA 3W7LA 3VGGA 3PZIA 2PDHA 4M3PA 3C61A 3FOKA 1FH8A 2CXGA 4O19A 1R3SA 1DE5A 2OCZA 4MYAA 3GVGA 2BY2A 4LJ3A 4HMCA 1M7PA 3XISA 4MDOA 5A8OA 2PTZA 4IJBA 3WO8A 1I75A 3IVUA 3GFXA 2E7FA 1SW0A 4TTUA 2QMJA 1N2VA 2VMFA 1Z44A 4G7EB 2QEZA 3M44A 4ONVA 4GKLA 4P7OA 2ZRVA 3UXAA 2TODA 1BSIA 4BHYA 3E5BA 1MEWA 4D6DA 4E0CA 1Q5MA 2TRSA 2ZX6A 4RPPA 3HM7A 3PR2A 1GONA 5BROA 3M0VA 2PC4A 4W4QA 4KKXA 4L6HA 5AOUA 1DXFA 2FPTA 4IOTA 3FN9A 2EG6A 1D2KA 1W9XA 4QS6A 1FP9A 3BH4A 3TW7A 1WKFA 4JTDA 4X0VA 2OWWA 3PN8A 5DELA 4RV8A 1JDCA 4LB4A 2OKTA 2W0UA 3QM3A 3S46A 1OBAA 3IV3A 3SADA 4Z1CA 1VIWA 2YDAA 1QWGA 2ACUA 2CERA 1G0CA 4FIQA 3WLTA 2O4MA 4M51A 3MWAA 1I2RA 3KFTA 2DZBA 5IBXC 3F4CA 1F3XA 4GPNA 2D3LA 4HJFA 1TWIA 1KV5A 3DUGA 3R58A 2Y7EA 5C9UA 2XVKA 3CAWA 4IG2B 2E9LA 4A2SA 4LUTB 4BA0A 3W87A 3WD1A 3WNNA 1HL2A 5REQB 1HZYA 3IRSA 3AYTA 4PSRA 3RG6A 2J7FA 4WUIA 1JQVA 2PB1A 3M16A 5CBJA 5AC7A 1N8IA 1GYLA 3IUDA 4MAVA 2NUXA 5LA0A 4NXSA 3GXTA 1VAHA 4HCDA 1POKA 3WMLA 1O95A 3XIMA 2BHYA 3S1XA 4AVFA 1Y5VA 1ISWA 4EOUA 1LG1A 1P0BA 1XBXA 3MKCA 2WSRA 2XWEA 4M5PA 3WQPA 3LRLA 4GA8A 3CWNA 1EFZA 4DXXA 3CQIA 4MZYA 2YYTA 3EB3A 5T9CE 4IFOA 4B2DA 1Y5WA 3NQMA 3APYA 4XIMA 3QHNA 1WO2A 2EPLX 1K9EA 3AHTA 3A4AA 3N9SA 1G6CA 5CGMA 4GUGA 3UZ5A 3VKBA 2MNRA 3TTOA 3UY8A 4X60A 1WCGA 1H62A 5CGQA 3UU0A 4W93A 4N4QA 2VRQA 1OSEA 4ROPA 1AVAA 1REQB 3IIOA 3E0LA 4O0QA 1ME7A 2VXNA 4DJDC 5KETA 1QATA 3N17A 2E6AA 3ITYA 4EXBA 6CGTA 3VNDA 3ZR6A 2PRHA 3VU2A 1TRIA 4FLRA 4HMDA 4GQRA 3NUKA 1ZTVA 1MO0A 1E55A 5M2FX 2NLYA 3WNMA 3L12A 2YB4A 2BVYA 3GYCA 1IXNA 1MRAA 2J88A 5GNYA 4LW7A 4UOQA 2HZGA 3PZ9A 3PS7A 3GKFA 3SFWA 5EMUA 2XN0A 3L5LA 1JYVA 3G0SA 1OADA 1Z89A 2OT0A 2PDUA 3W07A 5AVNA 5LGXA 2PU0A 3OBKA 1X6NA 1MNZA 3GNPA 4UR9A 3AUOA 2HBXA 4ZQOA 1TMHA 1Q65A 4ROQA 1MFUA 4Z1YA 3WZ0E 3LZ3A 1WX0A 1UWSA 1Z69A 1B54A 4L7ZA 4AD5A 1KFKA 3I4EA 3B8DA 4N9EA 1UD4A 1PZ0A 4A8IA 4D6IA 4E2VA 4ADUA 4EACA 5CEWA 3BJFA 2OB3A 1LBLA 4MJ2A 1R30A 4M8UA 5DMNA 2DSZA 1GPFA 3ME3A 5AC6A 1BVZA 3MP4A 4QG6A 4IWWA 3VZXA 4FO4A 1WDQA 1KQYA 3B0VC 2D23A 5FF7A 1TWSA 2ZDRA 3IGXA 2OWXA 4U31A 3EWUA 1GVSA 3VGDA 1D3GA 4CD6A 5I3KA 2GK1B 4TQTA 4LY4A 1RJPA 1B4KA 4XKMA 2DPEA 1V6UA 1UOZA 2ZTKA 4M29A 1HKMA 2DH3A 3JW7A 2Y7FA 3MDUA 4IGSA 5I2UA 4LYPA 3VOJA 3Q2DA 4ZQPA 3UP8A 4WXYA 3WBXA 4H9VA 4UFLA 3WD0A 1UJPA 3JR2A 3R94A 1SQ7A 3VOCA 1WZAA 5DANA 5C71A 4W5UA 3ZJ7A 4HMNA 2OMAA 1H51A 3R0UA 1XHGA 1YBQA 1PPIA 1LQ2A 1LRTA 3UBPC 1XYFA 1Q6LA 2DVTA 1UHVA 2OX1A 2R1PA 3MA8A 4I5RA 2G5WA 2WNQA 2YBUA 3N15A 3W76A 2VDGA 4JQ4A 4PRWA 3H54A 3FVDA 3SQLA 1V02E 2OLHA 1VH7A 3UVAA 2R6OA 3WSUA 1Q13A 3IJ7A 5FIPA 5DMLA 3GTHA 3VDCA 3KL0A 4LVAA 2PWUA 5LNUA 2J47A 3N2MA 4HJWA 2VFGA 1FVPA 1XRFA 3O06A 4DWSD 3IJQA 1HVQA 2CFFA 1W37A 1UC5A 3ARUA 2PE4A 1IIHA 2IQ0A 4NSBA 4G1KA 1JIBA 4DZAA 3NM1A 3ZVHB 1M41A 1CTNA 4NJIA 5AYYA 3HBLA 2FGZA 2WPBA 2XIIA 3L2MA 4TMBA 1B5TA 4GABA 4W8AA 2ALDA 3QR3A 3FX4A 1UIOA 3VUPA 3MO7A 3FK4A 3MT1A 3N29A 2PLMA 5HK4A 3NTYA 4QJ1A 3TR9A 2V3DA 5FF2A 2VEFA 3LTSA 4GC4A 4F0KA 1LBFA 2GGIA 3P8IA 4RKAA 2ZUWA 1XYMA 5I06A 3GVRA 1NDWA 4INFA 4PUMA 3PZGA 1SO4A 2Q8XA 1Q7ZA 4IF2A 1XRVA 3O16A 5B7ZA 2G50A 1EGZA 1W8SA 4YCOA 2OGJA 3HGOA 2GUYA 4YPJA 3TNOA 1HTIA 2XFYA 3LBMA 1MWOA 4C6DA 4JZ5A 2PDPA 2IPWA 1SR0A 4NZJA 3GBDA 1TZZA 2CU0A 4QDMA 1XH0A 3RU6A 3T78A 3DBNA 3LI1A 3LG3A 4Y9AA 4QTGA 4LYKA 3WK3A 2ZRYA 4W8LA 3CHEA 3H53A 4J28A 2PEVA 4E4UA 3GTFA 2OSXA 3DFPA 2CZFA 4V33A 2V63A 3WDQA 4FF7A 1B9BA 4AIEA 3LNMA 1OHLA 3AXHA 4H8NA 3SY5A 3CUGA 3K8MA 4HA0A 3P62A 4HHPA 4WJXA 3RRAA 3UZYA 1BG9A 3VD5A 4C6MA 1MXDA 3IGHX 1V7AA 1GHSA 3TXZA 1ZPTA 4V27A 3KZSA 1A5SA 1LQAA 2Z00A 4IIEA 5GVJA 4J4KA 1JAEA 1KTCA 1W1ZA 3MCOA 4Q7BA 3NIYA 2ZUNA 1J12A 2WLZA 3FHQA 3QQ0A 1TJ0A 4CQAA 1LOSA 3TA9A 3GDRA 3VKDA 2V3FA 4ERIA 1WNOA 1XP3A 3KHJA 2VENA 1U5HA 2R1MA 2FJUB 3NQEA 3GG8A 4LAMA 3OB8A 4PCNA 2UBPC 3NXLA 3ZWSA 1FKWA 4BZYA 3ZT7A 4ZQMA 7A3HA 4Q32A 2JE8A 3PZNA 3DI1A 4D8LA 4QJ4B 2DFAA 1DEDA 2EF9A 3BG3A 1GOIA 3NQGA 1RR2A 1Q7MA 4GACA 2G4JA 3MI2A 3AZTA 4MG4A 1EJUC 5LNWA 2C14A 2O9RA 4Q8TA 2ZA3A 3NNTA 2ZRWA 1FXPA 3H2NA 1J2WA 1Z41A 3EWYA 1XSIA 2EG7A 2YA2A 4G56A 4CNUA 2Y62A 1VQTA 1K03A 3N11A 1BFNA 1IZCA 4DM1A 4E8GA 4C6JA 1QXLA 1MSSA 1UG6A 1E43A 2IPJA 1KBKA 1KM0A 1J0HA 3P2VA 1NDVA 3FYYA 3WL1A 3NL2A 3BW3A 3WF1A 4B5UA 1EHNA 3TR2A 1V8EA 4XZHA 3NQ2A 1S46A 1CXEA 4S3EA 3DFOA 1X6UA 4TOQA 2QJJA 3BLKA 4Y7EA 2X40A 1TCDA 1ONRA 5D2VA 3V5FA 4AMAA 4MWAC 4PTNA 1WUEA 1IEWA 3LCXA 3N2TA 5K9CA 1OABA 2NT1A 4X3ZA 2J8FA 4IL2A 2VR5A 1IIGA 3ZLGA 3HU7A 3ITVA 2WJDA 4HSHA 4AF0B 4BK9A 4EVZA 1XCWA 4YJ5A 5DY3A 3UQNA 2A7PA 1XH2A 3WLHA 4YN5A 4MZ1A 4Y8FA 1KM2A 4NQ1A 1MYRA 4WKFA 1EC7A 2QCEA 3AMLA 1A47A 3CT2A 2R94A 4HQVA 1H11A 3UJSA 4LUTA 2X0YA 2EEXA 3WLNA 4S23A 1VFMA 2FVKA 3S2CA 3LI0A 1VFFA 3N14A 1EUAA 3UD6A 3W1NA 4TIMA 3NOYA 5IOBA 3IVSA 2C1HA 4YNGA 3AHZA 7REQB 3KL3A 4JDYA 1PE1A 2HS6A 3WJSA 3W1LA 1J0IA 5IFTA 2V68A 4HBKA 2HVMA 3CLWA 2YCJA 8XIMA 3CPRA 1DIDA 3NO3A 5AECA 2D0GA 3MI6A 2RKXA 4YXGA 1JL8A 3I6TA 3U0HA 3SCTA 3BLEA 4S3BA 3VIKA 2CWNA 4MYXA 5E70A 1F05A 1XSJA 4Z2JA 1RJQA 4O15A 4JD4A 3H7VA 3T6CA 4X63A 3P7YA 4REQA 2OEKA 4Q4PA 2RUSA 1SZEA 1OD8A 4DM2A 1A80A 3LQLA 3MSDA 2CZDA 5CG7A 4WSHA 3KP0A 1BWKA 2GDUA 4XX6A 1SFSA 1UMYA 3PBWA 2J74A 1X96A 2JGYA 3GX9A 5H8MA 2HWGA 1C9WA 3E0IA 2PI6A 3OG2A 3MUY1 3UWYA 3UWQA 1V5XA 9RUBA 1ZENA 1UQZA 4UTMA 3HTWA 4HNCA 2P3ZA 4KETA 3PPCA 2EPNA 3P5YA 4RDVA 2JIWA 3C6CA 2VHLA 2Y89A 2WZHA 2BXVA 4HMEA 3E2SA 3EB2A 4RZ5A 5EMLA 1KW1A 4IMCA 1KKRA 3VNZA 4PCSA 2EPMX 1SSGA 1UKPA 3KHDA 4YTSA 3SR7A 2WSYA 3VM5A 2XVNA 3QY6A 1M9HA 3WN6A 3ZT6A 3VC6A 1KCLA 4CUCA 4F0MA 4A4AA 3PZMA 4DELA 2NVCA 1I9CB 1J9YA 4YWSA 2GVGA 1UMLA 5E6YA 1IGSA 3ATYA 4IMFA 4WGHA 3IUIA 4CEXC 3B0YA 3QMRA 2ZX9A 2C16A 1LYXA 4AZGA 3VX1A 1R5YA 4ZZ9A 1XM3A 4QE1A 3SW6A 5C7HA 1ZB5A 3ICJA 3NXFA 3FGCA 2FH8A 1F07A 4H1ZA 1VCFA 2DVXA 2GOKA 1YKWA 4O1CA 4A2RA 4ZO8A 3SCRA 3ONCA 4KWWA 1SJBA 4CQBA 3CPGA 5XIMA 1TIWA 4H6QA 4LXFA 4F9DA 2DORA 2VZTA 2RAGA 5HINA 2BSLA 2EQDA 4TVDA 4QJ3B 4LS2A 3H21A 1Y65A 3LXCA 3T2QA 3MKKA 1M53A 4PH6A 2CEQA 2J62A 2VQUA 3P6LA 5HWJA 2PWEA 3W7HA 2ZWYA 4RNHA 2VRJA 4L4LA 4MUZA 2FH6A 3CU2A 1ITQA 3QR1A 1IXPA 5DXXA 1VBRA 4ACYA 1OM0A 2GJPA 2Y88A 4AHOA 1I2QA 2V5LA 4LH8A 5EBUA 3GTIA 5BOOA 5ECVA 1W5MA 3JZEA 2GJLA 5DEZA 5IDIA 3NL5A 2ABBA 3EPMA 2V5BA 4WGXA 4AWEA 3BJTA 4RW5A 1R2TA 2ISFA 4JFWA 2FVMA 3PWIA 4PBGA 4C1NB 2QIIA 5BMXA 2G3IA 2XDFA 4H9ZA 1D8WA 4O17A 2V3EA 4FNUA 4HK7A 4LUJA 3N6JA 4ZQNA 1J93A 2DZXA 2CESA 2EAWA 3INPA 2WWCA 1QR7A 1OIFA 2MUCA 2MANA 3C8NA 4E8DA 3W2UA 1NQ6A 2QGYA 1JNEA 3W7CA 2YDSA 4O12A 3C52A 5ABFA 3CYVA 3KVMA 2WMIB 5A6LA 3AXXA 5DBTA 3HZ3A 5A8QA 4U28A 3NZ1A 2OZ3A 1X38A 2HVOA 1UOKA 4ERAA 3UCQA 3S5YA 1S39A 1ECEA 3DGRA 1HKJA 2CZEA 2Y5SA 1T0OA 4XSLA 3S1VA 4HZMA 4KMQA 3G3DA 3B04A 4QG8A 1JF6A 3BAJA 1ZAIA 2X2YA 4IIGA 4PGLA 1V3IA 4EF9A 4F0SA 2FZDA 1IWPA 1VF8A 3CB8A 3ITTA 2AKZA 3BSHA 4NVTA 5BWFA 1UBPC 1B3XA 3CV6A 3IIVA 3T08A 2Z4GA 2XGZA 4GKTA 5HDRA 4HA4A 1BXBA 1G1YA 2Z2AA 1QHZA 3MS8A 3OZMA 4JFUA 5BU9A 3V1HA 3C86A 4JIRA 3W7RA 4IIHA 2QJNA 3BLOA 3M4HA 2UV8G 3ZS4A 2RDTA 3E5PA 4D6CA 2QJMA 4UOJA 5H1WA 3PHAA 1K9DA 2E28A 1BWLA 2HMCA 5FEXA 4BEQA 1CLXA 3N12A 3KWXA 3BARA 1YDNA 2FJKA 3CXOA 4AIBA 1F3WA 3BUVA 5DT5A 5CPMA 4AC7C 3W28A 1NFPA 3PB0A 3ZT5A 2AGTA 4HVXA 5C9RA 4PFHA 2NVDA 4IPJA 2B7NA 4I9JA 4PEKA 2WHLA 2ZA2A 1OCQA 2NQHA 4WDWA 2DSUA 3C2RA 5C9XA 1IQ8A 4IGHA 1XL9A 3SO7A 2QUUA 1HG3A 4OQVA 4ZGYA 2PU1A 3HJZA 2GJXA 1XSKA 4F2TA 1JPHA 1YPFA 3QLLA 2YA0A 1V0KA 3TC7A 3NQAA 3REQB 4AB4A 2ZBTA 1XIFA 5AC8A 4MNKA 5AHNA 1GOWA 2WHMA 1P0EA 1V3HA 3KTCA 1EZ2A 4LAZA 5F7UA 2WVSA 2OODA 1UP2A 3VC5A 1JZ5A 4MPKA 3BCFA 4LRSA 1EZWA 3PUEA 3O1NA 4ZO7A 1B1YA 3EX2A 1GZ1A 1EWEA 3BCJA 1JAKA 2ZRZA 1LL4A 3S4TA 3MMWA 3QZAA 1TR1A 2BGNE 1DJNA 1PKYA 2J8TA 5C7VA 3VDGA 2RFGA 4FR6A 3M0ZA 1VHCA 1HJQA 2DU2A 4PC8A 4N6FA 4PCFA 1TV2A 3HFYA 4AF0A 1KM4A 4IPPA 4HTYA 1NVMA 2VTFA 3SGGA 3NQ8A 4H8HA 5D2WA 4H8UA 1JCYA 3W7QA 2ZCGA 4CCZA 1IHIA 1RSCA 2W9MA 4H2CA 1QT1A 3CNYA 3KOFA 3DZ1A 2NQZA 3K13A 3SN1A 8CGTA 4DUWA 1PKMA 1AA1B 1TELA 2PCQA 3KL5A 1J6PA 4EK7A 3GFYA 1JULA 3CTTA 1F9CA 1L6WA 3C4UA 2HEJA 3GU1A 2P88A 1JFXA 3BLIA 7REQA 3FAWA 3JVAA 4HPXA 3C2YA 2Y8VA 3TNBA 3VKKA 3Q45A 5HQLA 1K4HA 4FALA 3WQVA 3S5NA 3ZZ1A 1SJCA 5CPSA 4MVAA 1YNYA 3OW1A 2YX0A 4W7UA 2PLKA 4XVDA 1OX5A 2YFNA 1OYCA 1W9BM 1K7XA 2BTMA 3QTGA 2WK2A 4UNKA 3FEQA 3CQ0A 3GDTA 2EKGA 1QMLA 2ZXDA 1A3HA 3GUGA 4NY2A 1PO9A 4KRUA 4AZIA 2WM1A 4O50A 1LBMA 2CWXA 2QT3A 1QOQA 1VYRA 4KWVA 2WC7A 4R9OA 4UTHA 3KS5A 4MY1A 1KGXA 2QCMA 1MXSA 2WBKA 2J7CA 3EOLA 5A2CA 3MV01 1QDSA 1RD5A 2YL5A 3WNOA 3TU9A 3Q37A 4ZTXA 3PJXA 1XWYA 1DQWA 5HPOA 1GGOA 3CZGA 1WDPA 3P80A 2BY1A 3SZ8A 4KERA 2CLKA 2H9AB 3UEQA 3AOFA 3WQ6A 4AY7A 2BBFA 4IIDA 1P4CA 4MLRA 5DRIA 4Y9MA 5A2BA 1JZ4A 3VNMA 4AYGA 3KW3A 3V36A 3VOFA 3TYEA 3W22A 2E8ZA 3VNIA 1O12A 3H22A 5D03A 4BI7A 3HB9A 1HKWA 1U33A 1TB3A 3TJIA 1DWGM 3QOMA 1X97A 3G24A 3B8IA 2IXUA 2OZ0A 2VC7A 4M0XA 3EA1A 3KOXA 3MBFA 2XUCA 2QVHA 3TDFA 5AZ1A 3SUWA 2J7HA 2F6XA 2NT0A 2CZVA 2DSVA 3W2MA 2TMDA 3UXLA 1L6GA 4A3RA 3TJXA 3PAOA 5HATA 4NASA 1ME9A 4X0NA 5TD4A 2I9UA 4ZSUA 3VIOA 2X16A 4R7OA 2A6NA 5C2CA 1KRAC 1JUKA 1SO3A 1CXIA 3QPEA 5T26A 3VDBA 4CEUC 1KA9F 3NQCA 3CPUA 1PKNA 3GS6A 5LIYX 3ECQA 4PMJA 2GSEA 3SGZA 3VM7A 3W85A 3NWRA 2ZE0A 3N34A 3BV4A 5AHFA 1EGVA 2ZC1A 3T0DA 4JICA 3KXQA 2QNEA 5IHRA 4Q8MA 5A3HA 1H49A 1JPIA 1LUCA 1E51A 3V3WA 4FR1A 1EP1A 3VYLA 2C13A 2OYLA 4GI8A 3WDPP 2ZE3A 5A94A 1XLGA 4UZUA 1TO3A 2WXDM 2RDUA 4GYFA 1QFEA 5KMYA 1Q4NX 3MTWA 2D3NA 5D2YA 1E6SM 4NJJA 1H2JA 3RLHA 3CL7A 3BMXA 4MKNA 3MUIA 3AC0A 2WVUA 2QIWA 2NSXA 3GVQA 3DOPA 3KX6A 2B7QA 1RVKA 3SM0A 1GW9A 2WMKA 3DHUA 4C1NA 2PLCA 3ES8A 1CCWB 2V0TA 3B0PA 3B40A 1VYPX 1XGZA 3V4BA 1O6IA 3A13A 3P81A 3LERA 2OTDA 4I6KA 2G3JA 3N9RA 5KSWA 1JZ3A 4LCSA 1XINA 3QV8A 4X9YA 3IJ8A 1H61A 3BAKA 3EX4A 3IK4A 3FKRA 5FJJA 3SUVA 1N82A 1HJXA 1E0WA 5HNTA 1ZL1A 3CV1A 2FZNA 3QBUA 3UG8A 2ZADA 2FB2A 4O1DA 1WXYA 3COTA 2C15A 3ZFHA 2R1NA 3UT0A 5JXQA 2X1UA 2EO7A 2YJQA 5C6MA 1SYTA 3GB6A 3N04A 1C92A 3EDDA 4ECLA 3KBWA 3K46A 1A5LC 1A5OC 5BU6A 4NRRA 4S3JA 4FPSA 1FY6A 1W56A 1P6WA 2ZTJA 1SPQA 1FQ0A 4XK2A 3WNKA 4LUSB 1LL6A 4Y9NA 3IACA 2YCIX 1LG2A 1LROA 5CPTA 2VX5A 4Q6XA 5LA2A 4JFTA 1MQQA 4QLJA 4E3VA 4JGDA 2H8XA 3AYRA 4QFUA 4XBJA 1PBGA 2HK0A 1Z32X 4B2DD 4AD0A 3EPNA 4CD8A 3OO2A 3HV8A 3AHVA 1T40A 2POZA 3C0LA 3G1XA 2BB0A 3CEPA 1UUQA 2I56A 2J77A 4P5UA 3WLSA 4JDBA 4C65A 2ZUUA 7PTDA 4AFYA 2IS7A 3QYQA 3SQMA 2A21A 3MHFA 2OO6A 1RK5A 5CZKA 2VX4A 4S38A 4L61A 4O14A 2PBGA 4OV9A 4XISA 3E49A 4O0KA 4AEEA 5FEPA 2BVWA 2DUXA 4UTTA 1M04A 1B3VA 1YTDA 3LXBA 3UA3A 3S6TA 1L2UA 4UR8A 1KFCA 3W2LA 1GTHA 8A3HA 2HNEA 1FCBA 2XIJA 2R1LA 2HNHA 4B5TA 4PE8A 5D9OA 1OFPA 1B30A 4G1NA 3VMOA 2W62A 2CW6A 5CAKA 3L5MA 2A5HA 1H3GA 4IQJA 5CSUA 2ABAA 3VD7A 4H04A 1SMDA 4NX0A 1UASA 2WJZA 2Q3RA 2RJGA 4ERGA 2WQDA 3VIPA 3DIPA 1BXNA 4ZO9A 4HP5A 3C0JA 5F2GA 3REQA 3SEPA 2WJFA 2ZXQA 1GKPA 2ZFAA 1UR0A 4YHGA 4I90A 3DBPA 1XG3A 1GNXA 3VCCA 1YTKA 4TV6A 2PDFA 4NJGA 4PUNA 1F8MA 4J40A 5AHMA 1TUXA 4AEOA 4PL1A 3H12A 1A5UA 3EEZA 3W37A 2F9RA 1E9YB 4IPNB 1HP4A 3N2XA 1SFJA 4LEFA 3HPAA 3KOYA 3LX9A 4PTXA 1QUMA 1E15A 2WMHA 1QPQA 3RJYA 2FVLA 2PWVA 4QG9A 3I10A 4C90A 1K8XA 3W1XA 2Z7KA 4DBSA 2V81A 1GORA 2VGFA 3AXKA 3VGFA 3SRDA 3SIMA 3WQ4A 1K7EA 5DXYA 4ZA0A 1M1BA 4KCTA 4M6PA 1GYMA 3IK2A 3U9IA 3RAOA 3GW3A 2WSKA 2RDWA 3AQUA 2F7FA 4OZOA 3TH6A 3V0UA 3VZYA 4N7QA 3ARYA 1HT6A 4UTJA 3NSXA 4ZB5A 2OZTA 2CLFA 4C7GA 1XGEA 4FEZA 1W1B1 1JYWA 3VNYA 1G4PA 1OCBA 4LNCA 3KRSA 2QDHA 4GC3A 1VC4A 4EPDC 3OZYA 3E3HA 1JD9A 1JCMP 1NIUA 3EOSA 3B8SA 1M65A 4DXKA 5M3WA 1AJ2A 5HJLA 1EB3A 1XR2A 2X0HA 3ONBA 2IXVA 1E9LA 4D9PA 2IKGA 3AROA 1FWJC 3M1ZA 3SB0A 3T44A 3CV7A 4GGHA 1DJWA 1TPC1 2OYKA 1UYQA 3GHSA 3U5YA 4WXZA 1O66A 1ZBCA 4HPHA 3OYXA 2PA6A 1V6VA 4AYSA 1V3JA 4JQ2A 2OQHA 1YPXA 2PF8A 1S1RA 3THCA 1R2RA 4OUIA 1IEVA 2V30A 1GW1A 3PB2A 2VFIA 1K70A 1KWKA 2A7RA 1EJTC 2YA1A 1E6QM 4OJYA 1CXFA 1WDWA 3HQOA 3O7UA 4O57A 4UTUA 2WQPA 3IVTA 5JIWA 3GDMA 2A2IA 1NOUA 4UC5A 4QSFA 4QLLA 1TPFA 2GLKA 1X8FA 1S5VA 1YXCA 2X2GA 3ZOAA 3QOKA 3S1GA 4DYEA 4BY3A 1X8CA 4PUDA 3GNNA 3W83A 2CKRA 4EXAA 3KRUA 5BOFA 3LV6A 4R9XA 3IIPA 4GBDA 5D38A 4BFAA 3EZ4A 3NGJA 5DLCA 1KRCC 3H2EA 2IKIA 1KFEA 1JRBA 1TPEA 4RNIA 3LHZA 4P8XA 1Q8AA 1SM9A 1WV2A 1UR2A 4H9XA 4HYWA 4UQ9A 3ZJ8A 3W1RA 4GUFA 2BY0A 3G1AA 1AW1A 2ATMA 1R38A 2XSBA 1ZGDA 3FDGA 1O68A 3E96A 3PTKA 5I09A 3O0FA 1B2YA 3R89A 4O1BA 3LA4A 3WF2A 4C6BA 1EWDA 3EWDA 3UETA 2F2KA 3VIJA 4E3TA 2FPVA 1K1DA 3QFWA 3VDHA 2DT1A 4LV4A 1UP0A 3AMCA 4H7CA 4ZOBA 1W9DM 3T9PA 4HOZA 2I57A 4PMNA 3RMEA 1D8CA 3TV8A 2RHGA 1XQLA 3R8GA 5T91A 3T0TA 5AB3A 2AQWA 4XAGA 3S42A 4DUOA 2DZAA 2FB3A 1MEIA 2XINA 3P14A 4UWMA 3N4FA 3FHAA 4XAYA 2GWGA 3GY1A 3L0GA 1Q6RA 2IUZA 3CUZA 1FBAA 3DG7A 3VE7A 4JXCA 1F3EA 3TMQA 3IJ6A 2QDEA 3CUJA 5C70A 3W29A 3LGGA 1FP8A 2DGAA 2XM2A 3RO6A 2PZ0A 2TYSA 3ABQA 4NZ1A 5BXTA 3TN3A 4E4FA 4PUJA 2YCEA 2B81A 4MWAB 3A6OA 2RGLA 4KBXA 3DHPA 2GQ8A 1KLZA 1R9YA 5EY5A 3WENA 3PANA 5I79A 1XCFA 2WCAA 4AZ5A 3ABRA 1JXJA 1TV5A 4GXMA 3MJMA 4MNMA 2GSHA 3VCRA 3N2CA 3S9YA 3WIJA 2P3EA 3DERA 3VD3A 4M19A 1DL3A 4W87A 4UMCA 1VP5A 1JUBA 4BQ2A 1RBAA 1ZP3A 2G3FA 1OD0A 2NV1A 4B9YA 4NZCA 1F4AA 3F2DA 2WNZA 4K2SA 2EPHA 2A3CA 4XB3A 4LS1A 1EDTA 5A6KA 3N6HA 3L4WA 4W7VA 3WBAA 2OKOA 2XZ9A 3IJLA 4C5ZA 3TYUA 3ABSA 4V28A 1K6AA 3QN3A 4K37A 4AWTA 4Q7NA 1TTIA 1EKOA 2QCLA 1ZAHA 4GYJA 3R1ZA 3URNA 4GMEA 4AZBA 4W89A 5HUOA 2ZICA 3G22A 3ISIX 4P61A 3VGEA 3DKLA 2OSWA 4PULA 2X30A 1FUYA 4R53A 1TPDA 2ZZ4A 4JL2A 4I9MA 3EGJA 1KM6A 3E74A 2W92A 3T8QA 4IP5A 3LD5A 1XLBA 1GT8A 2A0NA 3MUCA 4FHAA 1RJRA 1XDMA 1QCWA 3CTLA 4HZ7A 3VXGA 2V8ZA 1K9TA 4DJDA 4W5ZA 4MSSA 3BTNA 2KX9A 2YB1A 4A6GA 2E68A 2V5DA 5FJTA 4BI5A 3AI0A 2FZBA 2O9OA 1C8XA 3NDYA 5CPLA 4B3LA 1YLVA 4GVGA 1LP6A 4L6DA 5I02A 3WLRA 2ZZ6A 3R11A 3RHGA 4GQ0A 1BPLB 4WCJA 1OT2A 4LVGA 4RX0A 3APGA 3PWGA 2JKEA 3EKLA 4KCVA 5LA1A 3O6YX 3VOIA 4L9XA 1QO2A 3NSMA 4KRZA 2X05A 4B15A 3MZ2A 3M0XA 4LY8A 3MMUA 4F3HA 3S47A 3KVKA 2QCGA 4GYPA 1TA3B 1C93A 4F9JA 5BOEA 2JALA 1GPWA 5A6JA 4Q4QA 1CI1A 4UTWC 1GEHA 3W6LA 1F73A 1GVFA 1UB3A 4RL3A 4AZHA 2FHFA 2NX1A 2W6RA 1IZKA 1DWHM 1Z8AA 4QNWA 1BG4A 1PDYA 3DCPA 2XYLA 1RQBA 4MJZA 3IIXA 5KZEA 1U2YA 2Z1BA 5C2XA 5A6BA 4EXQA 2DZWA 3TK7A 3TTQA 4PUKA 4DPPA 3S2LA 1KO0A 4R33A 1CECA 3WJYA 4UUIA 4DO6A 1VBGA 3H2AA 4H19A 2Y2WA 1EJSC 3WNLA 1O4UA 5EMJA 5AYXA 1H7RA 5F1VA 1UKSA 2DZTA 1V02A 4H3DA 1VJIA 1CYGA 5XIAA 1IT7A 1W3IA 3W9ZA 5D8WA 1PUDA 1JPDX 1RPKA 3KEHA 4GJJA 1TPUA 4K1WA 5BNKA 3TWBA 1DHKA 1ZBKA 3K8LA 2XFFA 2VCBA 1W5PA 3S83A 3W25A 3DU0A 3FKKA 5LHFA 5A5WA 3URQA 2GUUA 1R3RA 3R8RA 4KS0A 2GVEA 4QLKA 2VEKA 1LWJA 4OGZA 3B06A 4Y9OA 1VJZA 5C0QA 2CXEA 3AAMA 3W7MA 3STCA 4Z2GA 1GKQA 2IPGA 4EANA 2ANUA 4JTFA 1QNQA 1QWKA 3SQSA 2V2DA 4JY8A 5CZJA 3BOLA 3G2GA 3LPGA 1PCWA 2WVVB 1ITXA 4UFJA 3AXIA 4DRSA 4B3KA 1JF5A 2E8YA 3GG0A 1IE7C 2QPXA 3FV9A 2DQWA 3LS9A 4O8AA 1QNRA 4O1EA 4JTAA 3GK0A 3MCNA 2E5CA 4S39A 2Z27A 1OF8A 4JY9A 3CHCA 1NH6A 2G3NA 4WRHA 4AIUA 1H1ZA 3NYDA 1WAUA 3UNTA 3MZNA 5D2TA 2GQAA 1TE6A 1A3XA 2SFPA 1BXCA 1FDZA 2YXOA 4MNJA 2NV2A 1AODA 3EKGA 3P82A 4AIOA 4GLEA 1V6WA 3DI0A 2ZZ5A 4HZ6A 3QC0A 5G1YA 3C0QA 3NEHA 3EX1A 4O0ZA 4M1BA 1XUZA 2DT3A 1S1PA 3W75A 4JQ3A 4AXNA 5AYIA 3KS6A 4UTKA 2Z0IA 3K4AA 1FCUA 5FKYA 2R14A 3B0UX 5A8MA 4LEQA 3BQ5A 3CL8A 1UROA 4HA3A 2G97A 1S2VA 4L1XA 3L4ZA 4B91A 4K68A 3PTQA 4H7VA 4C6PA 4UTLA 1T6MA 1KQZA 2PD5A 4EKJA 3A23A 5K3VA 1JCLA 1FHLA 1XLIA 4RW3A 4JTEA 4WZHA 2A1YA 3WJXA 5LSMA 4US5A 1QNVA 4Q33A 6REQA 2XPKA 1BVNP 3MKVA 4MF4A 2V6AA 4Q7IA 5CLWA 3BVJA 1H7NA 1GWJA 3T0CA 4PFMA 5HNNA 1EIBA 2Q02A 2CHNA 1OF6A 4J3SA 1OGSA 4HU3A 2GDVA 3WEZA 3WH7A 4YTQA 1BYAA 4GY0A 4WDUA 3RLVA 3ZWTA 4GYKA 3T2PA 4AU0A 4EPEC 2I5GA 2E3ZA 3GQYA 3AIVA 1BEUA 1XYLA 1KGWA 2FDSA 1JFHA 4KCUA 3U3HA 2X1SA 3PBGA 5FCZA 1ISYA 1VPYA 2WHKA 2GWNA 3LHTA 2PCEA 3HF3A 1JJKA 1GKRA 1A50A 3RR4A 4GY7A 3LCGA 3TYZA 3H7UA 3P74A 4UIOA 1FWHC 1O60A 4HPNA 1QI4A 3JRKA 3M5XA 3UGVA 5CSYA 1TUFA 3H7RA 2QZRA 3EOEA 3M0IA 3GR4A 2QW5A 4UFKA 2AAMA 4R34A 5HUPA 4G9PA 2WKJA 3W6YA 2ISVA 3UWUA 3NEVA 2X1TA 2XG9A 1B3WA 2BGQA 4PODA 2Y24A 3NZRA 1OK6A 4O16A 1E9ZB 4XVEA 3UA4A 3T05A 4C6EA 3I7SA 4FI4A 3MUAA 1EJ7L 5CH9A 2G0WA 2ZOXA 2YIHA 1RALA 4QDWA 3L2IA 3HPFA 3SCWA 3THDA 5C2GA 3QFEA 4FIRA 2QULA 4O1AA 1OYAA 1E0XA 5FJRA 3QRHA 2Y0FA 4OVXA 3NQDA 1NF7A 3VPLA 1VFOA 1UW9A 3TFCA 3MYOA 1P0DA 3O6DA 3CUIA 3GWQA 1LWIA 4QSHA 1OC7A 5AFDA 4GCXA 4NKCA 3TYCA 1F6KA 1EO5A 1LM1A 4TMCA 4MWAA 4NJKA 4J35A 2LLEA 1X98A 4HZ8A 3WKZA 3WFAA 1MEHA 2FFCA 3NPVA 2CPUA 3P84A 3CK5A 1BKHA 3EKZA 1YDYA 2J79A 4TV5A 4PBFA 4WKHA 4ZO6A 2UY4A 1LORA 1K8YA 1NARA 2VCCA 1JZ8A 1CGTA 1BRLB 4AISA 4S3CA 4OOZA 1HKKA 4ICCX 3V0SA 1DIEA 4ATWA 1OGBA 4ZVJA 3MVTA 3WX7A 4PMOA 3T09A 3L65A 1TCMA 3GH4A 4A8RA 5G2IA 3UXKA 6PTDA 5G1MA 1QHPA 2YL9A 4ZOEA 3KWSA 3CZJA 1WBHA 1H1YA 4GX8A 1U22A 3P3BA 4LTSA 3LY0A 4UFIA 5GJPA 2OOGA 1D7FA 5AYBA 1I0BA 2BOFX 4FNPA 2VD9A 4CU6A 1IR1A 3S3GA 1Q2SA 1HO4A 2OFJA 1UC4A 6TAAA 3NL3A 4PB5A 2PDGA 3T8LA 2X0SA 4K6AA 5CZSA 4C91A 2P76A 1ALDA 5CJ5A 4DBUA 4U33A 4RLIA 4KESA 3CJPA 3DECA 1R86A 4JTTA 3S0CA 2QMKA 4B4HA 3B4YA 5JH1A 3I4KA 2HS8A 3Q67A 4LYRA 3UXDA 5HWNA 3TN5A 1UH4A 3M7SA 6TIMA 2BP1A 1Z42A 3QMTA 1UWUA 2Y63A 4DJED 3OHIA 1BLIA 3KBVA 3U4AA 1QBAA 3IGUA 5AC5A 2GJRA 3M0KA 2D24A 4PMRA 5E93A 4HNVA 1O94A 1XI3A 1H0GA 1QPOA 4UQCA 3BQ6A 1M6JA 3WJWA 1S2WA 3DX5A 2FKPA 3H4WA 1UKOA 1F61A 4AZ6A 4TUFA 3MQTA 4F0LA 5I3DA 4KGJA 2QAFA 4DX3A 1PDZA 3SAZA 4MY9A 1TA3A 4NZ4A 3I65A 1W1TA 3LSBA 1WP6A 3NQBA 1EEPA 3AIQA 3BK0A 1ZHAA 5J04A 3TE9A 5PTDA 5EGRA 5LGZA 1S3TC 3CH9A 3W84A 4L4OA 3LZ5A 5T9BG 4QDPA 2GVYA 1KR0A 4KH2A 4LNYA 3SURA 1RUSA 2P8CA 3OU8A 4GRSA 1X7FA 3BAYA 1GOKA 3PY2A 4UMBA 3LHVA 1AK5A 2Z26A 4AVOA 1LL7A 2PSNA 4PBEA 5CLTA 4RE3A 1H7WA 3F5JA 4KF1A 2C6QA 3P0WA 3I3DA 3OLDA 2GFTA 3LOTA 4MJMA 1TVNA 3LTYA 3NA8A 5T8GA 2VX7A 1E1CA 1WZLA 3V35A 4F0HA 3USZA 4AWSA 3B8VA 4W9TA 5JBDA 5TQLA 3N2OA 2PWFA 1QU4A 3LPPA 4JIQA 4YVVA 3MY9A 3LUTA 4R88A 2YR1A 1KFBA 5JVLA 3N4EA 1PSCA 5I3IA 1M7XA 1RA5A 2I5IA 4D6EA 3GAYA 5DO8A 3TKFA 3HMJG 4LX4A 4XZNX 3W01A 2CLOA 2Z6JA 3QV7A 4WKAA 3DH7A 1B3OA 2PRLA 5J5DA 1DOSA 1PS9A 3GU9A 4GIRA 4MADA 2ZQ0A 3GXMA 2Y61A 2YLAA 4DZIA 4BCEA 3VNLA 1CGUA 5ABEA 3GC2A 4JX6A 4IISA 1JZ2A 2A3EA 3H2CA 1RK6A 2O0TA 1LT7A 1EPVA 1IR2A 5C54A 3WQEA 4PMUA 1TZ7A 3FIGA 3PC0A 6ALDA 7TAAA 1XIGA 1CGYA 2NQJA 4JX4A 2XH7A 1GYNA 1XG4A 2PDMA 1TWDA 3RIKA 2FTYA 4PB4A 4YVPA 1W3LA 1T7LA 1IYXA 1TTPA 2WVVA 1R6WA 4KT2A 3TOPA 4DJFD 4NX5A 2BVTA 3GZAA 1W3JA 3E0WA 1XLEA 2QQ6A 4ZL1A 4HHLA 3OA3A 4MPQA 4PN2A 1KNWA 1B90A 1ADDA 2EBNA 4W88A 1AH4A 1KBIA 2Z1VA 3A3WA 2IPFA 3K4DA 1EP3A 3PUDA 4GI6A 3DN5A 2ZRUA 5K4XA 3GD6A 1DIOA 4MB5A 4O4VA 2OT1A 1DQXA 1P43A 2JKPA 2DUZA 4NI8A 4DWSA 2B4GA 1W17A 3B8UA 4GX9A 3RLGA 3RFAA 5FSEC 1GG1A 4AUBA 1J5SA 4X22A 1EDGA 3PUOA 4F0RA 3CMFA 5A8GA 3GDLA 4Q4SA 3GLCA 1LLWA 5CC6A 3SN4A 1T41A 1X7IA 1YXDA 3M46A 3B05A 3R79A 1JCNA 1WQ5A 1EC8A 1CB7B 1AL7A 1F74A 3IAQA 3TOYA 3O6AA 2YL6A 3QKEA 4DN1A 3OTRA 3S1UA 3QQWA 4E6MA 1R8LA 4I7WA 3RPMA 3VNKA 3CMGA 1QO5A 1SZFA 3OHMB 4NNBA 1EX1A 4H4IA 1YADA 2VZSA 1HNYA 1VB9A 3W26A 3KTSA 3NGFA 3GKAA 3FAXA 4IL0A 3ZYZA 1TZ9A 1CGWA 5BYWA 1Q6GA 4CQ8A 2AAAA 3KM8A 1UP3A 4CU8A 1FWCC 3WH8A 1LF1A 3WDJA 4REQB 2OQLA 2AOSA 4QS5A 1W3TA 2I16A 4LUIA 3QQ1A 1G94A 2JF7A 1B0IA 4Q4OA 3O9NA 3PG9A 2PAJA 1R9XA 2IQDA 3AJXA 3VIIA 3R7MA 4G7FA 2GL5A 2P8BA 2PGWA 4J3ZA 4WDTA 2XU2A 1RXOB 1MUWA 1JCTA 1W54A 4QRNA 3QPYA 2YGYA 1SVDA 3II1A 1LRQA 2PRMA 4AX6A 4JIEA 2PTYA 3L4UA 3ANVA 3FLUA 3MMTA 1A5NC 1ZCCA 4ZSTA 4O13A 2VOTA 1H0IA 1QJWA 4DNMA 1VEPA 1ZJBA 3PULA 1MMFA 1PTDA 1XCXA 1VFLA 1UWRA 4JNYA 1RLDA 1TJRA 4GYPC 3LGEA 1XLMA 1DP0A 3AXMA 3EEGA 3U5UA 3PNZA 3M43A 5AZ0A 1WOAA 1EOKA 5FI8A 3TJ4A 1W32A 3MP3A 1J0KA 1IGWA 3UJ2A 1UZ1A 1AQ0A 1XLAA 5GNZA 1XLLA 2J4GA 2PDJA 3W72A 1G9HA 3DFHA 3QVQA 3O2LA 4Q4RA 1MW1A 2CBJA 2DT0A 2XVGA 1ESWA 4IQLA 2NZLA 3QW4B 1EEXA 1RCOB 3FGCB 4RE0A 2CLHA 1A53A 3E1F1 4QQUA 3F4DA 5K9XA 4JQ1A 3LV5A 4IPLA 3I7QA 4GVFA 1G7VA 1XS2A 3M5ZA 4UQDA 4KIEA 3GNRA 2A6LA 4V1YA 3P8JA 2QCDA 2WM0A 2QYGA 5FAJA 3RCMA 1BRLA 1L0PA 4WK9A 3ABOA 4D8ZA 5ECUA 4V15A 4ZCWA 4L56A 2VYOA 1IEXA 3LM7A 4V1XA 3K2GA 2GJNA 7ENLA 4JR5A 2ZVIA 1PHWA 3VILA 4B92A 1ZY9A 3ZJ6A 1I60A 1SO5A 1W1PA 2DW7A 2QDGA 3WLKX 4IX0A 3L21A 2VCAA 1MW2A 4U10A 1H7XA 2HJPA 2VZOA 3O8AA 1LJYA 1OJXA 4P7QA 1BKSA 5A95A 3GXFA 3ARPA 3BPWA 4DAIA 1PZ1A 3S2MA 4BI6A 1QI0A 4M7TA 4PMXA 2V5KA 4LVFA 4ZBCA 2VEGA 3W27A 4H83A 1WDDA 1M3UA 3LCFA 4GOAA 1PIIA 1NM9A 4E38A 2PP0A 1NOWA 2BVDA 3THQA 2E6DA 4NI3A 1Z7AA 2WOQA 1TSIA 1J4EA 2J7BA 4K8EA 2WANA 1X1OA 1GJWA 3M0YA 5CSRA 3E38A 3APTA 2BHZA 4M82A 2KZHA 2D20A 6ENLA 4JTIA 3I7RA 2BGSA 2VX6A 2H90A 3FXYA 1E4LA 1GOXA 1UZ4A 3UVIA 1MW3A 4HOWA 3B4UA 1K77A 5ABFB 1Z9AA 1TPH1 3KAOA 3EMQA 4NAEA 3M6YA 2WNNA 5CC7A 3WQGA 3W7NA 2O7QA 1Q66A 1GOMA 1J01A 4JYEA 1VYSX 1Q3NA 1DWJM 3PSWA 2R1KA 3R6IA 4LAUA 3HPXA 2Y70A 4XD4A 3EXSA 4C6IA 4C5YA 3RLUA 3ZVIA 2GDQA 1Q6FA 1FWIC 3OGVA 1RP9A 3PPGA 1E73M 4IXXA 1B4EA 3GHTA 5IXEA 1BTCA 4HNNA 4Y2WA 1SR9A 4K7VA 2QHAA 5JMUA 1PZ2A 3L9CA 3HG3A 4X2PA 4ZXLA 1AMYA 3FFSA 3LGDA 3RCNA 1XYBA 1ODUA 1OX4B 1YHTA 3ERPA 1K02A 2GPTA 1ZQ5A 4H8VA 2V2CA 1VD6A 3PBMA 3GBEA 4WR3A 2Q8LA 1TR9A 1YTEA 4RPQA 1H50A 2WHJA 1JZ7A 2TAAA 3VX0A 3CV2A 3QV6A 4J3WA 2CBUA 1AQHA 2WLYA 3P5ZA 2EKCA 1P7TB 4YLWA 3FW6A 4CQ9A 2WBGA 4FAMA 1WOBA 1C3FA 3NL6A