4RL3A

Crystal structure of the catalytic domain of a family gh18 chitinase from fern, peteris ryukyuensis
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
271
structure length
271
Chain Sequence
KVFREYIGALYNGVQFTDVPINSGVTFHFILAFAIDYTSAAAATNGVFNIYWQNSVLTPAAVQAIKAQHSNVKVMVSLGGDTISGSPVQFTATSVSSWVANAVSSLTSLINQYHLDGIDIDYEHFDQVSTSTFVSCIGQLITQLKANNVISVASIAPFDGVESQYTALFGQYSSVIDLVNFQFYSYGAGTSASQYVSLYNTAASKYGGGAKVLASFSTGGVGPAPSTVLSACQQLKSSGTLPGIFIFSADGSYASSAKFQYEQQAQTLLTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase A
publication title A class III chitinase without disulfide bonds from the fern, Pteris ryukyuensis: crystal structure and ligand-binding studies.
pubmed doi rcsb
source organism Pteris ryukyuensis
molecule tags Hydrolase
total genus 100
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2014-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4rl3A00
3WBEA 4MNKA 1Y7VA 2OLHA 4UFJA 5E6YA 3L4TA 5JIWA 4TTGA 1H49A 1OM0A 2DSKA 3VIKA 3WL0A 4A3HA 1B3YA 1XYZA 5FL0A 1C3FA 2CESA 1PIGA 2GJXB 1HNYA 5AC4A 3W38A 1TR1A 3AIBA 1MQPA 3L4WA 1U33A 1QVBA 4MDPA 1JNEA 3LPPA 1UKQA 2VNCA 3DHUA 3VNZA 1X6NA 2XSAA 2JEQA 2JFEX 5FOOA 3ZR5A 2YDQA 4JFUA 2ZX5A 1H1NA 4GQQA 4B9YA 1OCQA 3WL1A 2WWDA 4UFKA 2CETA 1K6AA 3WKZA 1CBGA 1C93A 1VFFA 1I1XA 3N13A 3WNKA 1GONA 5C8BB 2PWGA 3AIVA 5E0FA 3ARXA 4UFLA 1C92A 1WKYA 3NJ3A 1QNOA 1E4LA 4WIWA 3WQ5A 1IV8A 2XIBA 2CBJA 4EE9A 4DM2A 5KEZA 2VL4A 3UG3A 4AZ7A 4B16A 4CN1A 2DSZA 4FK9A 4IUGA 1VF8A 3CMGA 4PTMA 3AMGA 3ARUA 2XGIA 1ZBWA 1R86A 5I24A 3N11A 3GZAA 2VX5A 1BGGA 1QNSA 4U3CA 4ZXOA 1NOUA 4QLKA 4Z2IA 2BFGA 2PB1A 1DTUA 1LL6A 1JYNA 3IANA 4WF7A 3L4ZA 2WW5A 3VU2A 3MS8A 2ZXAA 4H8UA 3IJ8A 2XFRA 1JYVA 4GZEA 1DWHM 3BCDA 4Z2LA 4E4PA 2CKRA 3OIHA 4PBGA 4H04A 1HVQA 3SCVA 4AD0A 4UQCA 1R85A 4XZWA 1HKMA 3LPGA 1IZKA 3ALGA 3MU7A 1JZ2A 2WYSA 1KQZA 1IZJA 1DHKA 3PTKA 3VDAA 4AZGA 3SUSA 3ECQA 1VFOA 4BQ3A 1KFWA 3GNRA 4AZCB 4DWSC 5A3HA 2WMKA 4M8UA 4UFHA 3GBEA 3PZ9A 4PN2A 5LYRA 5I5RA 1UWUA 2XGBA 4JL2A 3WBAA 4LYPA 4D72A 2CBUA 4CD8A 6A3HA 4GIAA 5D4YA 1G5AA 1TE1A 1XH1A 2J75A 2C0HA 1W9UA 4BCEA 3EDJA 3WUFA 3AYRA 1OT1A 4HMDA 3WD4A 3SUTA 1E3XA 3WF2A 2VCBA 1UYQA 4QLLA 1UD4A 4W85A 1UUQA 1CTNA 3G6LA 3IJ9A 3EMCA 3BSGA 2VRJA 4OBRA 5GPRA 4JIEA 3BSHA 5JIPA 2JF7A 5IHSA 1EDGA 3NIYA 1VEMA 2W4XA 4H8HA 4P7RA 3M46A 3TTQA 5CSUA 1B90A 5CXPA 2JIEA 1C7TA 4HPHA 2IUZA 3UERA 2E40A 3BMVA 2FHFA 3TTSA 3TONA 1JXKA 3KL5A 3L4UA 4S3KA 1FFQA 3N1AA 5M17A 3AIQA 2VQUA 3BLKA 3WF3A 3VD5A 2HISA 4YHEA 1FP9A 2D23A 5M3WA 1UR1A 4W88A 4Z2HA 6CGTA 3N04A 3HN3A 4DM1A 1WO2A 3PZOA 4M29A 4J7RA 4S3JA 4C7GA 1EGZA 1JZ3A 3SURA 2E4TA 1HJVA 4D6GA 4JCMA 3K46A 4U5KA 3WNNA 2CEQA 4OZOA 2FHCA 4RL3A 1GOMA 1PJ9A 4BF7A 4B3LA 2CBIA 4HA4A 4F9JA 1WCGA 1UD3A 4OJYA 4H8VA 4UQDA 4HMCA 2PWEA 4EANA 4GI6A 3WEOA 1BFNA 1SYTA 4AZCA 3AIRA 3AHTA 4TX8A 1JDAA 2VR5A 4ZE5A 4LX4A 5DF0A 4AIUA 1XSJA 6TAAA 1CWYA 3DYPA 4EKJA 1GCYA 4AZBA 2OYLA 1UQYA 4PSPA 1E9LA 4PUEA 2YL9A 1GOIA 4IPLA 3WF0A 3ZO9A 3OA5A 3OZOA 3BAWA 3OG2A 1HL8A 1WDSA 4KH2A 3OLEA 3VINA 1BPLB 2O9TA 2E9MA 3MANA 4B15A 4BS0A 3VILA 1EOMA 1HX0A 1R87A 1JZ5A 2DIEA 1KGUA 3MV01 4JKMA 2O9OA 4H7VA 3A6OA 4UQAA 5CZKA 1B9ZA 4ACYA 4PUDA 2G4FA 4W8AA 1BLIA 1J01A 4AMCA 3ZT5A 4BQ5A 3WUBA 4GO8A 1M04A 2TAAA 4OOUA 5AC5A 1RP8A 2QPSA 4MB3A 1C8QA 1V3IA 4FLQA 1OGGA 2E8YA 3PBGA 1UWQA 3BH4A 5KZ6A 1W1YA 1LG2A 4PTXA 1WDRA 1ISVA 2VZOA 1KQYA 4WKHA 5I78A 3HJEA 4W8BA 4ACZA 2YDRA 1W9BM 4KGJA 1XSKA 1GOOA 3WQ8A 2D0GA 3ALFA 3RO8A 4AD1A 1J12A 1BYBA 1GOWA 3BAIA 1K9DA 5A6BD 3SUWA 3DHPA 3IK2A 1KR1A 3MO4A 3WENA 1WZAA 1VJZA 2DSUA 1E6SM 1L0PA 4L4OA 4PRWA 3VIJA 5BXRA 2WC4A 1X1NA 2D24A 2XTKA 5AY7A 1K9EA 5CLTA 2UY3A 4YHGA 3WNPA 3FN9A 1H11A 1BYDA 4BQ4A 1O7AA 3ZJ6A 4BA0A 5E70A 4EK7A 1JL8A 3RILA 2ZWYA 1BYAA 4U2YA 1KGWA 4KWUA 2QMKA 1LF1A 2Y2WA 2WNWA 4P8WA 3MUY1 3VVGA 4WK9A 2ZUNA 2RGMA 1LWJA 1R7AA 2CHNA 3II1A 3SUVA 4UZUA 3WQWA 3ARRA 2XVGA 1UWSA 2CHOA 1ODZA 1S46A 3GXDA 2PWHA 3W37A 4AYSA 4CD4A 5IXEA 2WHJA 4RE2A 4TXEA 3JUGA 2J74A 5A8OA 4Y7EA 2WVTA 3CUHA 3MSGA 3VDBA 1EQPA 3THDA 2WBGA 5IFPA 4CVWA 3SCOA 5CG0A 4D6CA 2J7HA 4E8CA 1O6IA 2VMFA 1JZ7A 3PZTA 1BVNP 2J4GA 4HU0A 1CXKA 2OSXA 3EBVA 4MB4A 1MYRA 1V3KA 1KCKA 3FW6A 2BVTA 5A8QA 5LA1A 1UZ1A 3AOFA 1UR2A 1VEPA 3RM9A 4Q22A 3CLWA 1BGAA 3GXIA 1US2A 3WEMA 1XC6A 1QBBA 3AS0A 3N9KA 1H0GA 4MPKA 2FGLA 2J7BA 4GI9A 5BXSA 1R7OA 1V02E 1NWTA 3VD7A 5E6ZA 2DQXA 1PX4A 2CITA 1CGTA 1AQMA 1RP9A 1HP5A 3AYSA 1E6XM 3WH9A 2BHZA 3I3BA 3UEQA 3K8MA 3W82A 4CGTA 1JF5A 2JEPA 2ZUVA 3AMDA 4OUEA 4UQ9A 5ABGA 2BNJA 3BMWA 1UWIA 1XD1A 8A3HA 4MTVA 4UR9A 2Y8VA 2EPNA 2WKGA 2DT0A 2VQTA 3MUAA 4GKLA 4MADA 4KRTA 2FH8A 4IPNB 1W1TA 3WD1A 4AIOA 4M80A 5JBEA 2OYMA 1CLVA 1XSIA 4HZ7A 1JGIA 4QFUA 3VIHA 3A47A 2GDUA 1WB0A 4PCSA 2W5FA 4HP5A 5EB8A 4LPCA 2BY0A 1ZBKA 2XWDA 1P6WA 1PAMA 1L8NA 1W9DM 3A4XA 1CEOA 1J9YA 3EMQA 2WM0A 4CCEA 2X0HA 1H4PA 4EAMA 4HZ6A 1QNPA 1RD6A 5D9MA 1CXHA 2AMGA 1C8YA 2YJQA 3UCQA 3VTRA 1I75A 3AS3A 3CZ8A 2GJRA 4JCLA 4F8XA 2Y4SA 5DEZA 2VURA 1JDCA 2XFFA 3CMJA 4W5ZA 3W27A 1UKPA 2WHLA 3CUJA 3TP4A 4PMNA 5ECUA 3MV11 4W87A 3ARZA 3NSXA 1CLXA 4FMVA 1HP4A 1H3GA 3AHYA 1JYWA 1ESWA 1MVYA 3PN8A 1SMAA 1VEOA 3W26A 2E3ZA 2DDXA 2BV9A 4P8VA 4WLCA 4TOQA 2F61A 5FCZA 1VAHA 1PEZA 1PIFA 2EPKX 2B31A 4AD5A 4W86A 4UOZA 5HOSA 1ZBVA 5HPCA 1CNVA 2ZUMA 1V6WA 3VM7A 4MDOA 3VPLA 3IAPA 2NSXA 3QOKA 1E56A 1KXTA 2FHBA 3O2LA 1VB9A 1GQLA 2J25A 4JZ5A 1E6RA 4XX6A 1LJYA 5GNXA 1M01A 1RPKA 1J0YA 3ARWA 1UQZA 5BWFA 1ZBCA 3NDYA 3WMCA 3NSNA 4V28A 4AZ6A 1E70M 1OGSA 3OBAA 2NW0A 1V0MA 5HDRA 1UKTA 3AZRA 3IAQA 4JFTA 3F5LA 3MKKA 2VJXA 5A8PA 2EPOA 4HMEA 2XHYA 3VD4A 2CPUA 5BROA 2F2HA 3A4WA 1ZB5A 1GQIA 1BG9A 4GO9A 5IHRA 1TG7A 1ZU8A 2WAGA 3WQ4A 2OSYA 2J77A 1OD8A 2X1IA 1OBAA 3AXHA 2D2OA 1JZ8A 2GJXA 3TOPA 3RCNA 1U30A 1VJSA 3ARTA 5EBAA 5A95A 1HKKA 4J3UA 4CD7A 2WVUA 1CZ1A 1E0WA 1LWHA 1HKJA 1VENA 1IT0A 1LL7A 3CZEA 1DWGM 3L2MA 3SIMA 3MSDA 3UETA 4XZBA 1HJSA 1JF6A 1NQ6A 2VI0A 2GK1B 1V6VA 3T2QA 4W93A 2V3DA 3POHA 3TTYA 3SUUA 4QDMA 5ABFB 2O9PA 1EQCA 2AOSA 1BF2A 4DWSD 3WF1A 1JYXA 3SCNA 1CDGA 4Q7NA 3WUGA 5AYIA 1J0IA 3CZLA 5GQBA 3WH7A 5JUVA 1Q6CA 1JZ6A 3DC0A 3ZSTA 2BY3A 3CUIA 4UQEA 2CIPA 1UH4A 1MW1A 1E73M 1FOBA 1HT6A 5D8WA 3SCSA 2J78A 2WSPA 4AD4A 2OWWA 1MW2A 2ZE0A 3ZJ8A 4UNIA 1M03A 1MFUA 2G3JA 3I3EA 2XVNA 2WVVB 3DYOA 4J3WA 2YL8A 3RPMA 3CZGA 4NF7A 1B2YA 4ATWA 2HVMA 1QNQA 3RMEA 5CQ1A 1E1EA 1X6LA 1E6PA 2YA1A 3ZT6A 1J11A 1HXJA 3MMUA 1YHTA 4P7LA 1XV8A 3M07A 4PMDA 3VUPA 2WHKA 2WCSA 1CGXA 5CGMA 3RJXA 1LQ0A 2ZUTA 2AAAA 1PZ2A 4WJXA 5CGTA 2J8FA 5HPOA 1TCMA 2ZUSA 4TUFA 5A6BA 3AZTA 2UWFA 1MWOA 3QHMA 1WP6A 1E40A 4H2CA 3FHQA 4J3XA 5GNYA 4GPNA 5TD4A 2YA2A 3AI0A 1HN1A 1QOXA 3GXMA 4R5EA 4ZE4A 2XFYA 2X8RA 3PZQA 4J3TA 2XIIA 1UZ4A 3MUIA 4P8UA 3WDRA 4W5UA 1J0ZA 2G8ZA 4MJ2A 3BCFA 1NOWA 4MNJA 5CJ5A 4ZEPA 5A94A 3BLPX 3PZVA 3GNOA 1B3XA 3N12A 1JD7A 2IXVA 4UFIA 3EYPA 4B3KA 1UKSA 1K9FA 2ZICA 2WVSA 3K4DA 4A3YA 3ZT7A 4A4AA 3J7HA 1WZLA 1LL4A 4ML4A 3KWXA 5DT5A 1E5NA 3GXFA 5A1AA 3M7SA 4W89A 2WCAA 3WQVA 2BS9A 2YKKA 3W29A 2XG9A 1H2JA 3NSMA 1UD5A 3RIKA 2UY2A 3WH6A 2BVYA 2O9RA 3KL3A 1TVPA 4JAWA 1V02A 1MFVA 4NRRA 2EQDA 3PTMA 1E4MM 1KXQA 1M7XA 1B3WA 1BSIA 2J47A 1EIBA 4K68A 3ZIZA 3B9EA 2NT0A 3WD3A 3SCUA 5HXMA 5BRPA 4UTFA 2WWCA 2C7FA 5FKYA 5A2CA 4D1IA 1QI0A 1OWQA 2ZXQA 1WDPA 3WDPP 3W53A 1US3A 1E72M 3POCA 3W25A 2Y8KA 2DSVA 1HJXA 5ABHA 3SEPA 3T2PA 4CN6A 1JNDA 3CIVA 3AHVA 4AC1X 1MQQA 1CGWA 1FFRA 1GHSA 1MW0A 1KBKA 1EA9C 1HVXA 4D6IA 1UG6A 1UH3A 4QP0A 2IXUA 1V3HA 1UWTA 1BAGA 2XVKA 2X05A 3WD0A 3F5JA 4AEFA 1W91A 5HNNA 1CPUA 3CHCA 2EBNA 2WLYA 1CXEA 1UR8A 1W32A 3AMKA 4AD3A 2VVNA 4MJ4A 3WFZA 3AQUA 1CENA 2WZEA 2WMFA 4MAZA 5A2AA 4E2OA 5M5DA 4JFSA 1XGZA 3OLGA 1JD9A 2CNCA 1Q6GA 4CU8A 4JKLA 3GNPA 4PMRA 1JAEA 5A6JA 1OB0A 1KBBA 4J3SA 2DPEA 1NP2A 2DT2A 2A3BA 4CCDA 4L4PA 3QOMA 4JFWA 1OIFA 3L4XA 1J18A 3VD3A 4N0RA 4PSRA 4OOZA 4U33A 2WLZA 3N15A 2X2YA 1ISWA 1V6XA 2VX7A 4RE4A 1ISYA 4QLJA 2V5DA 1EH9A 1C8XA 2WK2A 4U3AA 1G01A 1W9VA 1W1PA 5D9PA 5E09A 3UR7A 2VX6A 3VKKA 1W3JA 5CPTA 1A47A 1K9TA 2D0FA 2D3LA 4QAWA 3WN6A 5IFTA 1E3ZA 1W3LA 1BQCA 1W1VA 2VTFA 2ZUWA 4N42A 4D6DA 5A6MA 1BG4A 2CKSA 3BGAA 3S2CA 1B1YA 2E8ZA 4GXPA 1QI2A 3SCRA 3T0BA 1OINA 2WXDM 2YLAA 3VX0A 1NARA 5I2UA 1DWIM 2NT1A 2XWEA 1TZ7A 4LGXA 1JAKA 3VM5A 1B30A 4P8XA 1V6YA 4PMVA 3KE0A 3VIPA 2Z1KA 2WMHA 1J0JA 5D9NA 4HPGA 4U5IA 1G94A 4C7DA 1GOKA 3EDEA 3EDFA 3VGHA 1AVAA 3OLDA 4IISA 1OT2A 1UD8A 2E9LA 2WSKA 2BVDA 2DT3A 3U5UA 5AYBA 4DWSB 3AFBA 4E8DA 3CBWA 3VDHA 4UQBA 2GDVA 1VFMA 2CYGA 3ZR6A 1BYCA 1C7SA 3VGGA 1GVYA 3F4VA 4W7WA 1H0IA 2D20A 1LG1A 3UG5A 1E5JA 2W61A 3CHEA 3GH5A 4R27A 1J10A 1JIBA 2VR4A 1OGBA 1GVIA 1H09A 4P7QA 1AQ0A 1V03A 2OWCA 4OIFA 4FLOA 3AMLA 1HIZA 3PTQA 3AIEA 4LXFA 3ZOAA 4WSKA 4J28A 5EFFA 3RM4A 2W92A 2XVPA 4X9YA 3VIIA 4WKFA 3WDJA 4TTUA 3VD9A 1UD2A 5CSYA 3EDKA 3FAWA 3KL0A 3DECA 4X0VA 2XPKA 3CZJA 4AZIA 3KZSA 1ISZA 1OIMA 4UOQA 3ARYA 4MNMA 1QI5A 4J3VA 3WIJA 1W3KA 4J27A 1QW9A 4D1JA 3F5KA 3ARSA 3BAXA 4LYQA 1NM9A 3DYMA 3VMNA 1EOKA 4CD5A 1Q6DA 1R8LA 3ZM8A 1ITCA 2XJ7A 3FAXA 5A8MA 3AICA 5I77A 2PC8A 3O6AA 4UZSA 2Z1SA 2W66A 2ZX7A 4DUWA 4JFVA 4YN5A 4CN4A 4ATLA 4AIEA 1NWSA 1HL9A 1BTCA 1EDTA 3W0KA 3B9DA 2ZWZA 1J0KA 4WKAA 3W6MA 1SFSA 1KGXA 3LPOA 2VX4A 4ZFMA 3PZMA 1NOFA 1GJWA 1M53A 1UA3A 1E6NA 2WC3A 4DWSA 2ZX6A 2QF8A 5E9AA 4IM4A 2QLYA 4F79A 2VVSA 4GI8A 3WDHA 3CHDA 4PYSA 2XYLA 1B3ZA 1KCLA 3AMCA 1MXGA 2YLLA 1HJQA 4AY1A 4JHZA 5BXPA 2WB5A 3A3HA 1GQJA 3MMWA 4M24A 1ECEA 2G3IA 5JBFA 1B3VA 4XUYA 4NI3A 7CGTA 1ZJBA 5A6KA 5I3DA 3PZUA 3WH8A 1AQHA 2DH2A 1XH0A 2JIWA 2YL5A 2RGLA 2BXYA 4GZIA 4OKDA 3BAKA 3CPUA 3WMBA 1B0IA 1VFUA 1TA3B 2VT0A 3WNMA 3UESA 5A6AA 1WE5A 2J7FA 1UKOA 3B9AA 4HOZA 1EO7A 2PI6A 2V38A 4AEEA 2ZXBA 1C90A 4AWEA 1V3LA 4KGLA 1ODUA 5DFAA 4CCCA 4D6EA 3S6TA 5A6SA 2VRQA 2BHUA 3N18A 2VRKA 3ZQ9A 1FHLA 3VIOA 3WF4A 2UY5A 2J62A 2X09A 1WZMA 2V3FA 2V5CA 2FH6A 5BYWA 4C7FA 1UR9A 1H41A 3OLIA 2EXOA 2A3CA 4XB3A 3ZMRA 1JG9A 9CGTA 1EHAA 4AD2A 3ARPA 3K1DA 1SMDA 1WPCA 3W24A 1I1WA 1XD0A 1QI3A 1U2YA 3GTNA 3OZPA 2OWXA 2PBOA 2VUYA 2WC7A 2WPGA 2CBVA 4B9ZA 2ZX9A 1G1YA 2OYKA 5FD0A 4PMUA 1HF6A 2D0HA 1EDQA 4HU8A 3WSUA 2BHYA 1EXPA 1CYGA 1EO5A 4UFMA 3GYCA 2XM1A 4QCEA 3CZKA 1GORA 4W8LA 2EO7A 2JE8A 3U5YA 2FDMA 1HKIA 1F4AA 4W7UA 3GBDA 4U2ZA 4JKKA 4FLSA 1V0LA 4BZYA 3CO4A 4NRSA 4AXNA 5DT7A 1NWRA 5D8ZA 2PWDA 4QCFA 3CHFA 3PZNA 4AW7A 4PCTA 1RH9A 3UG4A 3LPFA 4AZ5A 3T0AA 5LA0A 3MUZ1 3UR8A 3RM8A 3GH4A 3W6LA 2VO5A 3SCWA 4UCFA 2A3AA 2DEPA 3T0DA 5C70A 2VZSA 4D71A 3O9NA 4UOJA 4JHOA 1V08A 1VBRA 5BRQA 1QI4A 1D2KA 2YA0A 4GZJA 3VIGA 1NP0A 4TVCA 1HJWA 1TA3A 3AIUA 5FL1A 2BXZA 4HA3A 4OBSA 2D22A 1KB3A 1E55A 1V3MA 5EMYA 3W4RA 3WNOA 3U57A 3VNYA 1TUXA 2J7GA 4FLRA 1CGYA 1UOKA 2E9BA 3WY1A 1FH9A 3L4YA 2ESCA 1CXLA 2DT1A 4NSBA 2ZXDA 2MANA 2WHMA 3GM8A 3W81A 4XV0A 1E0VA 1SR0A 1PPIA 2WBKA 1VRXA 3EDDA 3FY1A 3GDBA 3M6DA 1UH2A 1GHRA 3VOCA 4WSJA 1JFXA 7TAAA 1G0CA 1QHPA 2YIHA 1OSEA 2XVLA 4H41A 3VIMA 4PTWA 3TA9A 4TVUA 1DWJM 2E0PA 4CD6A 2CERA 2ZUUA 2W91A 3K8LA 3WH5A 2C8NA 1V0NA 2YBUA 5A69A 3OGVA 2BY1A 1QBAA 3SCQA 1C91A 1ZS2A 2QHAA 3WNLA 4ACZB 2VC9A 3WDIA 5M03A 1PZ3A 2BY2A 3CUGA 2YOCA 4PMQA 4Z2KA 4D6FA 4M82A 1GUVA 1XH2A 1H5VA 3AXXA 1CXFA 2GK1A 1ITXA 5DO8A 4PMOA 5ABFA 1FA2A 3CUFA 3WEZA 2ZOXA 3CH9A 3AISA 2J8GA 1MXDA 1AMYA 3D5HA 3U7VA 1V3JA 1XYFA 1E6QM 2DIJA 1XCWA 2XUCA 2EEXA 2VCCA 2PBGA 4NZCA 1N82A 2DSWA 4D6JA 1E4NA 4MB1A 4AISA 2QMJA 3L4VA 1DEDA 1KXVA 3G6MA 1W9XA 4HOWA 5BCAA 3NCOA 1TMQA 1JXJA 3BC9A 1JI1A 5GNZA 1A3HA 4JL1A 4CU6A 4CU7A 1BVZA 3SCTA 2Y24A 2DH3A 3NDZA 4ATDA 2J79A 2WVVA 1E4IA 3OGRA 4P7NA 4ZENA 1UR4A 1DWFM 2VOTA 3W28A 2D3NA 3VMOA 5A6LA 3L2LA 5HBFA 1GPFA 1KWKA 1G9HA 1W9PA 1WAWA 4Z2GA 3WQ6A 1NH6A 1V6UA 4PTVA 1W2PA 1CGVA 1FHDA 4TVDA 1W2VA 1FH8A 2YL6A 1OD0A 3AS1A 3AS2A 1CXIA 1UD6A 2VZVA 2GUYA 3PHAA 3T08A 3CGTA 1DP0A 2W62A 3ZJKA 3PZGA 4PMYA 2J7DA 1CGUA 1GNXA 1Q6FA 3SCPA 3FHAA 2UY4A 4LYRA 2A3HA 4KMQA 4W7VA 2Q8XA 4MB5A 2VCAA 3PZIA 1W3HA 3VMPA 4DUXA 3VIFA 2EJ1A 2CXGA 3AXIA 1NWUA 4Z2JA 4CKQA 5BXTA 2PWFA 3U7BA 2PF0A 3A4AA 3LMYA 3THCA 1XCXA 4KRUA 4AZHA 4YPJA 1D7FA 1CECA 3K8KA 1Q6EA 2JF6A 1PX8A 3HU7A 1FP8A 4URIA 5IDIA 3OB8A 1JZ4A 3BXWA 1KXHA 1ZJAA 1JDDA 2D1ZA 1F4HA 2O92A 2V3GA 4M1RA 4TX6A 1YQ2A 4HTYA 2V3EA 4U31A 4RE3A 3AIWA 3E1F1 1PX3A 1MW3A 1GOQA 2WMIB 5LA2A 3VDCA 3ARVA 3WDQA 1UHVA 3BAJA 4W84A 1E0XA 2G41A 3NUKA 1J0HA 4ZXLA 1DWAM 4MAVA 3FNDA 5E0CA 3AJ7A 4MNLA 2Y5EA 4LQ1A 2WMJA 3QHNA 1TFVA 5DMYA 2G3MA 2GJPA 1V0KA 4BQ2A 1TVNA 3WUEA 1EHNA 1WNOA 1GJUA 3VGEA 1E1FA 2F8QA 5FIPA 2EPMX 1UA7A 3RDKA 1VIWA 3ARQA 3EMZA 3T09A 4V27A 3HMCA 3FXYA 4D6HA 4F66A 3APGA 4GINA 1WDQA 3BAYA 4PMXA 4GQRA 1BHGA 4HOXA 2FGZA 3WFLA 5I23A 4FF5A 1PBGA 3K4AA 4M56A 1QHOA 3N17A 3T2OA 3ZSSA 5I0DA 1GQKA 3VGBA 5CPSA 2QPUA 4CUCA 4HZ8A 2VZTA 1Q4NX 3IJ7A 1VBUA 2WCGA 1JFHA 3WELA 1E15A 2X0YA 3VGFA 5F7UA 3B8SA 4CVUA 5EFDA 2WANA 1E6ZA 2WZIA 2CCRA 3OGSA 1FH7A 4P7OA 1B31A 1LLOA 2QV4A 1QNRA 3MMDA 3AHXA 1GW1A 2OSWA 2JALA 1Z32X 1XRVA 1GZJA 3I3DA 3GH7A 4DUVA 2EPLX 2GSJA 2J7EA 3QR3A 4X0NA 3NYDA 2YBTA 2A3EA 2G3NA 2VZUA 2ZIDA 1HJUA 5I6SA 4PMZA 3AZSA 3ZJ7A 4F9DA 1E43A 3RJYA 3AROA 5I79A 3TTOA 7A3HA 5D9OA 2XSBA 5CLWA 5ABEA 5C71A 1KWGA 2YDSA 3VX1A 2WMIA 2W67A 2WKLA 3WMSA 4V2XA 1D3CA 5A2BA 4HA1A 2J7CA 1UR0A 2GFTA 1MQRA 3D3AA 8CGTA 1E71M 3AHZA 1JI2A 1WZKA 1QPKA 1QW8A 3VGDA 2WMGA 4M81A 5A8NA 1QHZA 1UWRA 3CTTA 1XHGA 1CIUA 2XM2A 1ZL1A 2DGAA 1KR0A 3VO0A 2GVYA 3KEHA 4PEEA 2WZHA 2ZX8A 3QHOA 3WD2A 5JBDA 3QGVA 2W63A 5CPQA 1ISXA
chains in the Genus database with same CATH superfamily
3WBEA 3C5QA 3FX4A 3KRSA 1Y7VA 5E6YA 3PBWA 1WDWA 5I07A 4N4QA 5KZMA 1EGMA 2J6VA 2DSKA 4JYDA 4WOQA 4Y2WA 4A3HA 1B3YA 1C3FA 3EPNA 1PIGA 1I8JA 1T0OA 1TR1A 1MQPA 1T41A 1QVBA 2GLKA 2F2KA 3C0SA 1NFGA 2VNCA 4H9UA 3QSTA 2XN0A 3AALA 4LS0A 4XBJA 2REQA 3CUXA 3DHFA 4MWAB 4TV6A 4M6QA 4B9YA 1P0KA 2WWDA 2DP3A 2CETA 2ZZ7A 4E2DA 4HJFA 1GVFA 3CV1A 5D32A 1TPDA 3N13A 1J6OA 2OZ8A 3AIVA 4AVFA 3G0XA 3ABSA 1WKYA 3NJ3A 1QMLA 1E4LA 1S2UA 2TRSA 1QT1A 1PHWA 1ZP4A 1XBVA 4Q8UA 2E5BA 4IUGA 1DORA 4GNJA 3S3GA 4IFOA 2XGIA 3N11A 1PKMA 3RUBL 3GZAA 3CL6A 4LAMA 4U3CA 4ZR8A 4IHCA 4NY2A 1DTUA 3IANA 3C0LA 3GVWA 3FK4A 3G1RA 1RBLA 3R0KA 1JYVA 1YXYA 1T8QA 1XIEA 2WJFA 3JS3A 1UJPA 2H90A 4LSBA 1ADSA 3MSRA 4H04A 1EZWA 4XZWA 3I4KA 1HKMA 4D8ZA 5K7JA 4N7QA 3MQTA 1IZKA 3Q58A 3W9ZA 1F73A 4KEMA 4PH6A 1DIDA 3HV9A 3OQ8A 3SUSA 3O06A 3IV3A 4PL2A 3L66A 1XLGA 4M8UA 2ASHA 3MWCA 5LYRA 1TV2A 5I5RA 1UWUA 2XGBA 2Z29A 4PL1A 3ABZA 4XZNX 4D72A 4CD8A 4ZODA 4Q7BA 3I6EA 1G5AA 1TE1A 3R43A 2V6AA 2ZZ2A 3INPA 4UMBA 3H2CA 4BCEA 3PTDA 4OU1A 3AYRA 1TZ9A 4NJKA 4HCLA 1UYQA 4QLLA 4W85A 4S3FA 3G6LA 4IGHA 3BSGA 2VRJA 3BSHA 1T40A 5JIPA 2JF7A 5IHSA 3E0WA 1TREA 1IT8A 3WJSA 2W4XA 2PGRA 1YIXA 1B90A 3I7SA 3VYLA 2ZA2A 1C7TA 3DBPA 4WGHA 3TTSA 5H8MA 3KL5A 1IXNA 3FJ4A 4JTSA 1ZY9A 3AIQA 3BLKA 3KZPA 3VD5A 2HISA 3BGGA 3T81A 3BLLA 3PULA 2D23A 2Z2BA 4GE8A 1UR1A 3S2NA 4W88A 2CLMA 3LMZA 1WKDA 4HCHA 4LCQA 1W1IE 3MYPA 4Q8PA 4DM1A 1VPQA 4CQDA 1WXZA 4S3JA 4A22A 3QR1A 3CU2A 1JZ3A 1HJVA 3CMFA 4DF1A 2OFJA 4HYWA 2CEQA 1AH0A 1GOMA 4BF7A 4B3LA 1Q7ZA 3SY5A 3HG5A 4FXJA 2ZRVA 5I06A 3M41A 1X97A 4GG9A 3DFTA 4EANA 3WEOA 2ABAA 2VFIA 4TX8A 4ZQOA 1S2WA 3C8FA 1W5QA 1FWNA 2QUTA 3CEPA 2E67A 3HGSA 3QC0A 6TAAA 3DYPA 4EKJA 1GCYA 4AZBA 2OYLA 1GOIA 5HMDA 3KTXA 3BOXA 3W70A 1BKHA 1XQKA 3BAWA 4XIMA 4C1NB 1HL8A 1WDSA 2BTMA 3ATZA 4HHMA 4TR9A 1BPLB 3VINA 4ZBCA 3OYXA 4I5XA 4DO7A 1HX0A 3MV01 4DXKA 2W9MA 1SU5A 2V2DA 4XSMA 2V2CA 3BARA 3A6OA 4UQAA 5CZKA 2KX9A 2OGJA 5TBOA 3WFAA 4ACYA 4PUDA 4F4RA 3JR2A 4BWLC 9XIMA 2OPJA 3V3WA 3BQ6A 4H19A 4H9ZA 3ZT5A 1JGMA 3UY8A 1M04A 1K8ZA 1FCQA 3TA6A 3GXTA 1K03A 3B04A 3UU0A 1UWQA 3U2EA 1XLJA 1Z42A 4IGNA 1THFD 1YDNA 1WDRA 3I7RA 4K2SA 3TKFA 2H8ZA 4WDWA 2D0GA 1LYXA 5AECA 1K9DA 3SUWA 4P61A 3DHPA 4N6EA 1L6SA 3MB9A 4IL0A 1EC8A 3JU2A 5DCBA 1CB7B 2DSUA 1UPMB 4UNLA 4PR4A 5BXRA 2WC4A 1Z8AA 2FMOA 3W74A 4IWWA 2C13A 5DCDA 4UTMA 4WD0A 1H11A 3L21A 2FLIA 2C1IA 1R9XA 3F4WA 3UCCA 2JGQA 1WDDA 1BYAA 4IOTA 4HNLA 5I3JA 4TO8A 2QMKA 1LF1A 4OT7A 4AF0A 4AC7C 3S9IA 3GUWA 4O15A 1POKA 4ECLA 3UWZA 3ORWA 1A5AA 4IH3A 4JPGA 1LWJA 3W1XA 4KERA 2XVGA 1UWSA 3CAVA 5KZDA 4JYFA 3REQA 1R3RA 4AYSA 4CD4A 4MY9A 4TXEA 4RV8A 3UYIA 4Y7EA 5FSDC 5IFPA 3LHYA 1VS1A 4E3VA 4ZTYA 1L6YA 4MB4A 5LIYX 4EP8C 4XTDA 1XG3A 3BTNA 3R6IA 1KFKA 4L1XA 3PUGA 5LA1A 3AOFA 1VEPA 1UC4A 3EB4A 1RA0A 3DERA 1HQTA 4O10A 4Q22A 4M6PA 4K3ZA 1LRQA 1US2A 1FDYA 3W86A 1L9WA 1XC6A 1QBBA 4MPKA 1R7OA 4J2PA 1RP9A 3WH9A 4GOAA 3TYAA 4N9EA 2IPGA 4RCXA 2FPYA 4E8GA 2ZUVA 2YCIX 5ABGA 4JTRA 4Q8TA 2Q8ZA 4WDXA 1J79A 3C0QA 4NT0A 2Y8VA 2EPNA 2VQTA 3MUAA 3DI1A 3B8TA 2PD5A 1V51A 4KRTA 4IPNB 3WD1A 1SSGA 3CQKA 4M80A 3TCSA 2ZRWA 4RNHA 2OYMA 3OIXA 1H7NA 4PCSA 2YX0A 1PAMA 1W9DM 2GVEA 4JTDA 4L61A 4HZ6A 1QNPA 3NQCA 1RD6A 3HFYA 4O57A 5EGRA 3S8HA 3UCQA 3KRZA 2Y4SA 2Z1WA 4L9YA 4LEFA 2VURA 2XFFA 3CMJA 4W5ZA 3BANA 4DF0A 2BZNA 4AMAA 3DDMA 4DUOA 2WHLA 3W1LA 1GJPA 3NQVA 3TP4A 3IIZA 3K13A 3MV11 4PFMA 5AZ0A 4ZB5A 1AD1A 3SN1A 2GPTA 3TWBA 1HP4A 1VR6A 3AHYA 1JYWA 3S1GA 2IKJA 1JRBA 2GJNA 3BMXA 1MVYA 3PN8A 2FFIA 4IMEA 1VEOA 4KWSA 3NPUA 2BV9A 1AW1A 4WLCA 1PEZA 4DF2A 2EPKX 4AIBA 1W31A 4UR8A 4AD5A 3SJNA 4W86A 4UOZA 1D3GA 1ZBVA 3WQOA 4GIRA 3RX4A 3Q4DA 5RUBA 1OYCA 2VR2A 4MZ8A 2NSXA 1QRQA 1KXTA 1VB9A 1Y0EA 4JZ5A 1M01A 3E0LA 2HK1A 3MYOA 1QK0A 1UQZA 3NO5A 2QUVA 5BWFA 4DPPA 3UJSA 5F4WA 3H24A 3ITGA 3NSNA 4O52A 3W87A 1QPQA 3T8LA 4IICA 4IIEA 4H3DA 1NAL1 4H83A 2Y62A 5TAOA 2DUXA 4MF4A 1PO9A 2CZ5A 1ZLPA 1FWJC 3AYVA 4QS5A 3VD4A 1JDFA 1S5WA 1DJQA 2NWRA 3TOYA 4A8LA 1O68A 5IHRA 2ZZ5A 4HNNA 4GJIA 3BG5A 3V36A 2Z2AA 3QKZA 1OD8A 1NDYA 4R9XA 1F07A 4S1FA 5CZJA 3TLQA 2GJXA 1EUNA 3O7UA 1VJSA 1GYMA 3ARTA 4CD7A 1QAPA 4HU3A 3SN0A 3HG4A 1A3WA 2KAUC 1IT0A 4AFYA 2G0WA 2VEFA 4Y9NA 3VCNA 3WQPA 3ZLGA 4XZBA 1V6VA 4QDMA 5AOUA 5ENLA 3GX9A 4NHVA 2AOSA 4HD5A 2NVDA 3WF1A 2J27A 1JYXA 5FSEC 3RGTA 4Q7NA 3WUGA 1J0IA 1JZ6A 5D33A 4H6KA 4PC8A 3ZWSA 1SZRA 4ZOAA 2Z27A 3O05A 4C6NA 1K4HA 1HUVA 4KEVA 3QQ1A 1E73M 3UZJA 2QEZA 1BRLB 4YYFA 2R1KA 2RHGA 2YXXA 1RJQA 2PDMA 1YMYA 2P0IA 1M41A 3M5YA 3BV7A 4Q4SA 1XYBA 4DI9A 3H2EA 5AB3A 1E1EA 1X6LA 2P8BA 3PUOA 2YA1A 4M6VA 2RUSA 1J11A 2XIJA 4GYKA 3O63A 2I5GA 4IPIA 3L0NA 2F84A 4CQAA 3M07A 3GXNA 3A64A 4MOZA 2ZBTA 4ZO8A 3G24A 4QE4A 1CW2A 1ICSA 1Z48A 1H7RA 4NZ3A 3UGRA 1PZ2A 3TX9A 2ZUSA 4TUFA 4HNCA 1F3XA 3E9AA 4KEUA 4IG2A 4H2CA 3FHQA 1WX0A 2I56A 4DWDA 3S0CA 5TD4A 3LBCA 3XISA 2XFYA 3N2XA 4O0QA 3U9IA 4QHRA 4ES4A 4YYCA 1RA5A 1Q13A 4MJ2A 3BCFA 3LCLA 5I03A 3PJWA 4ZEPA 5A94A 1RBAA 4R34A 3PZVA 2HCVA 1VFSA 4JTJA 4ICCX 2ZRZA 1UKSA 2ZICA 4GZ7A 4NXSA 4V33A 3GXFA 1I0BA 2PSNA 1UW9A 3O0FA 1A5CA 1JVNA 3NSMA 1VPXA 3RIKA 3GR7A 3UZZA 2AL2A 2O9RA 2OZTA 5CC7A 3NR0A 3S2MA 3PTMA 1KXQA 3UWQA 2HVNA 4K68A 2XIMA 1S5NA 3H7UA 3B9EA 3WD3A 3SCUA 5HXMA 2QCNA 5A2CA 4DYJA 1WDPA 4EIVA 1US3A 1E72M 3M0XA 9RUBA 4ONVA 1K8YA 3KCLA 3W25A 2Y8KA 3NM3A 2OKOA 3NNTA 1T8XA 5ABHA 4RZ4A 4L4MA 3T2PA 3TSBA 4CN6A 3VCRA 3AHVA 3L5AA 5I3GA 3LHZA 4E4FA 1CGWA 1KBKA 2PDNA 1EA9C 1UH3A 3GG1A 1REQB 4AY8A 1BAGA 3TSDA 1B57A 4LW7A 3VNKA 1V93A 1W91A 1CPUA 1W5OA 3UA3A 5C9XA 5MHBA 1SJDA 4IQEA 1EIXA 1FWBC 1CXEA 4C6KA 3BVJA 3AMKA 5FJUA 3O6YX 4AD3A 2VVNA 4MJ4A 2VP8A 3GAKA 4E2OA 1VFLA 3HPFA 2HE8A 2PMQA 1RBOB 3RG6A 4LJ3A 2YB1A 1XGZA 2CNCA 1S5VA 1I2OA 4PMRA 3W1TA 3CWNA 3ZS4A 4J3SA 3VXGA 1Y5XA 4CEUC 4AWSA 3QOMA 4JD4A 3VD3A 2RAGA 4O0KA 4OOZA 2X2YA 1VHCA 4PCPA 3GU9A 3NAVA 3SY8A 3UR7A 3GW3A 3LX9A 5CPTA 1HZYA 2D3LA 4DPQA 1MZHA 3KVLA 1E3ZA 1ZRQA 4D6DA 1VIZA 1SO3A 2PRMA 4AUBA 3SCRA 4NILA 2QUMA 2WXDM 2YLAA 2GGGA 1DWIM 5CC3A 2IQ0A 3P60A 2XWEA 2E7FA 2PURA 4KETA 2VGGA 1TE6A 1JAKA 4PRRA 3VM5A 3A22A 3G1SA 3KE0A 1JULA 4FEZA 1H63A 5D9NA 4HPGA 1G94A 1GOKA 4NX0A 4YWSA 4O53A 5HJYA 1PE1A 1KW1A 1IWAA 4DWSB 3VOHA 2V2HA 3VDHA 2CYGA 1C7SA 2HE5A 1DTNA 4Z0SA 4C6PA 1UJQA 1LG1A 3UG5A 2W61A 2V82A 3DFPA 4UMCA 2VR4A 1KM5A 3KLKA 1K02A 1OGBA 2PRLA 4P7QA 1AQ0A 1QXLA 2QW5A 3GU1A 3E5BA 4FLOA 4XO7A 3RMJA 2Y61A 1L6WA 2OKTA 5JH2A 3FYYA 4NZFA 4HMNA 2NQZA 3AIEA 1XLKA 4J28A 3IVSA 1DXFA 3PBMA 4X9YA 3SY1A 1IWBA 3H2OA 3VIIA 4D9PA 3WDJA 1UD2A 4DYKA 3WJYA 5LIXX 3EDKA 3KL0A 3DECA 2X1RA 4X0VA 3LHWA 3P84A 3THAA 3TYUA 5HMFA 1OIMA 3ARYA 7REQB 2GSEA 4J3VA 4RPQA 5CPLA 1W3KA 3WIJA 2ISFA 2QGYA 3C2YA 3EOOA 3VMNA 2BGSA 3BLOA 1WV2A 4Z42C 1EOKA 1Q6DA 4GX8A 2FFCA 3IK4A 1B5TA 1PVNA 2VEKA 2Z1SA 4C6OA 1O12A 1RCXB 4S38A 1NWSA 4AIEA 3NTYA 1HL9A 1U5HA 1EF2A 3CUZA 4YNGA 3B9DA 1DIKA 1EJ7L 3W7RA 1YNQA 3XINA 1IGSA 4ZQMA 1KGXA 4ZFMA 3PZMA 1XDJA 5HINA 3GC2A 3P0XA 4GK8A 4OQVA 1AH3A 4HHHA 2C18A 3LSCA 1GVOA 2QF8A 3N2OA 2QJMA 3G1VA 1HKWA 4OE7A 2YFOA 4LUTB 1MXGA 5AVHA 1GQJA 3MMWA 4M24A 4N9BA 4NI3A 4Q6XA 7CGTA 5A6KA 5FF2A 3QEZA 3WH8A 1AQHA 4M6UA 4PUKA 4EPEC 3DU0A 2YL5A 4GZIA 3CPUA 3WMBA 3CWOX 3KBJA 5E93A 3F4CA 4JN8A 3WLKX 3S2JA 2PI6A 4AHQA 4AEEA 3W7GA 2ZXBA 3UJFA 2V5KA 1C90A 3VKAA 1V3LA 3E74A 2BVWA 1SW3A 3RN6A 1F6YA 3R0UA 4RDZA 4D6EA 1MZRA 2OODA 3S6TA 4YTTA 2VRQA 4LCSA 2BHUA 4OGZA 2HQAA 3QTPA 3SW6A 3ZQ9A 2QJIA 3VIOA 1NDWA 4NXKA 4JNZA 4NJIA 3U8GA 2V5CA 3S9YA 5BYWA 4KQNA 3WK1A 1H41A 4JICA 1GG0A 3E2RA 4XAFA 9CGTA 4XISA 2ZE3A 2WO5A 3ARPA 4QXIA 4CQ8A 2PE4A 1I45A 2WJDA 5T9BG 3DI0A 1RJPA 3OJGA 1B4KA 3OZPA 3Q67A 2X42A 2IQDA 2OYKA 1RALA 1XUZA 1HF6A 1EDQA 4INFA 4L65A 3LRKA 3DG3A 1ZQ5A 2XM1A 4QCEA 1P1MA 3U5YA 2JE8A 2FDMA 3T7VA 3SR7A 5DRCA 1F4AA 2PDFA 3SFKA 4RX0A 4BZYA 1ZALA 2C19A 4NRSA 1LOSA 5CC5A 1NWRA 4AW7A 2PLKA 3EB2A 3HF3A 5HQEA 3T0AA 3MUZ1 4C6DA 3LDVA 4UCFA 4XO6A 4UIOA 2VZSA 2R91A 4PB3A 4JHOA 1V08A 1AD4A 1TIWA 4O1DA 1QI4A 4A8NA 5AZ1A 1D2KA 1XS2A 3FSTA 1NP0A 1HJWA 3AIUA 2CLEA 3TNBA 5KSWA 4OBSA 5E5CA 2EJAA 5CSSA 1KB3A 1E55A 5EMYA 3W7PA 3QN3A 4S39A 2VDGA 2ZVIA 2WNZA 1DJGA 1TUXA 2FIQA 2E9BA 4U4MA 2HMCA 3GDRA 4UTKA 1Z6KA 4XV0A 1E0VA 1SR0A 3ZXWA 1PPIA 5D30A 5AYYA 3LLDA 3FY1A 1K8CA 1AL8A 4EPKA 3FLUA 1JFXA 4DJDD 1OFEA 7TAAA 3DGRA 1QHPA 2P88A 4HSHA 1OCBA 2YIHA 3NZPA 5H91A 3VIMA 1OABA 1QOPA 2I9UA 4S3AA 3TA9A 1GG1A 3GWQA 2NLYA 2E0PA 4CD6A 2YCEA 2CERA 2ZUUA 3G2GA 5I3HA 4YTRA 3S4TA 1XLMA 1QUMA 2NV2A 4EPBC 2W91A 3K8LA 3FOKA 5FI8A 1S2VA 3OVGA 1QBAA 1ZS2A 3WQCA 2ISVA 1PZ3A 2HSAA 3KCJA 2BY2A 5A6TC 1FWGC 2ACSA 2Z2UA 3EX1A 4PMQA 4M82A 3H6OA 3MY9A 1GUVA 4S23A 3M7WA 1P7TB 1S5MA 3AXXA 5DO8A 4PMOA 4FX6M 3W22A 3RYSA 1KRAC 4QX4A 1BTMA 3C2EA 3BW2A 2ZOXA 4RW5A 2QDGA 4HKPA 4RZ6A 1V3JA 1XYFA 2DIJA 1XCWA 2XUCA 2GVGA 2VCCA 2QULA 1QNVA 2I16A 4IJBA 5C55A 1E4NA 3MBDA 3M16A 4REQA 3TC6A 3L4VA 3IV8A 4PUWA 1KXVA 4H1ZA 1JCJA 3MBFA 1A3HA 4AEOA 1GVQA 4UTUA 2JK2A 1TRIA 3ELFA 4O1AA 1F3EA 1NDVA 2H9AA 1IXQA 2J79A 3RHGA 4H9VA 3NZQA 3R11A 2GUBA 1RVGA 3W2LA 2C14A 3DGBA 1DWFM 4FX8A 2FB3A 2D3NA 3VMOA 1OG6A 2I7GA 1P0DA 3L2LA 3M5ZA 5IOBA 3GUGA 1V6UA 4NG3A 5C54A 4XD4A 1B9BA 1MO0A 4J5NA 1HO4A 4JYEA 3AS1A 1XIDA 4LBRA 1CXIA 4Y9MA 2GUYA 4EAYA 1KLYA 3T78A 3T08A 2NQJA 1DP0A 3I7QA 2GZXA 1HFBA 3CL8A 4I5UA 2PU1A 4JNMA 1GNXA 3HBLA 4IXXA 4KMQA 1BSLA 2CLLA 4MWAE 4DLFA 3IGXA 2UBPC 3EA3A 3JW7A 1ICPA 1KA9F 2PS2A 1M1BA 3B0PA 5EU9A 1IIHA 2CLKA 1A5NC 3A4AA 3CPRA 3THCA 1XCXA 1K7XA 4AZHA 4YPJA 4E5TA 2JF6A 1PX8A 1Y5VA 2XDFA 3HU7A 1FP8A 4URIA 5IDIA 3OB8A 1ZJAA 2G5WA 2NQHA 3PFRA 2NUYA 5CPOA 4IX2A 4QQ3A 1GOXA 2AGTA 2QPXA 3AIWA 1XM3A 1JUBA 3E1F1 3ENLA 2WMIB 3CT2A 2BXVA 4W84A 3KOFA 2CU0A 2QF7A 4IJRA 4KFOA 4MKSA 4MNLA 3NFUA 4LQ1A 2WMJA 1TFVA 3B03A 5DMYA 3WUEA 5DY3A 3VGEA 4YXGA 5CAKA 1DQUA 4Y9AA 2F8QA 5REQB 1A0EA 3VCCA 4V27A 3FXYA 5DCEA 4KT2A 1WDQA 4GVGA 1O5QA 1R46A 4PMXA 2FGZA 1PBGA 4L5ZA 4C6MA 3ITCA 1TQJA 5CPSA 1XGDA 2P8CA 1VBUA 3ITXA 1FKXA 2X0YA 3EGJA 2QCCA 5EFDA 1IEXA 4C1KA 1E6ZA 2OJPA 3OGSA 4PULA 3WJZA 2ZDRA 4XUGA 4RE0A 2D2HA 5LGXA 2REQB 4BY3A 2WQDA 2OSWA 1XRVA 4ZQCA 1SW0A 4KFPA 2PTWA 4GXMA 3OHMB 3NYDA 2G3NA 4R7OA 1PZ0A 3Q37A 5CC6A 4LVAA 2XSBA 3T07A 4O54A 4JQAA 5ABEA 4GGHA 1XIMA 3QJAA 3VX1A 2YGYA 5H8PA 2W67A 4BF9A 3M0HA 1PIIA 4HSOA 3E96A 1RPXA 4HA1A 2CLOA 2GFTA 3D3AA 1LOLA 1XIJA 1P4CA 2X1SA 3MUCA 3CV7A 4KF1A 3UPBA 1JI2A 1WZKA 1QPKA 1QW8A 4KWOA 4M81A 1QHZA 3WQGA 3D47A 4X3ZA 4LS1A 1ZL1A 1M3UA 1VGAA 5BU6A 4N6FA 1I2QA 5JBDA 3DFHA 3MPGA 3QGVA 1MEHA 3PBUA 3WLLA 2ATSA 1OFOA 1H50A 3L4TA 1ADOA 3HJZA 3ERPA 1H49A 4O1CA 1RD5A 2OLAA 3VUSA 3RLVA 2CESA 1VCFA 4E4UA 4UTLA 3NA8A 1UKQA 3L0KA 4RKAA 6ENLA 1IIGA 3RX2A 3DHUA 2ON3A 4LNYA 1FDJA 2JFEX 3U0HA 3BDKA 2V8ZA 3O6CA 1H1NA 3GIQA 4GIEA 4JTAA 1OCQA 4QQUA 3WL1A 1K6AA 3WKZA 4IIHA 1C93A 1VFFA 3WNKA 2ISWA 2QV5A 4UFLA 3MSYA 3HV8A 4DELA 2Q3RA 1P0EA 1G4SA 4WIWA 3WQ5A 1IV8A 5FEPA 4EE9A 3B8VA 2O56A 3P62A 1RLDA 5KEZA 1ZZMA 4C6JA 4DYEA 3UG3A 4B16A 4CN1A 4DJDA 1SJCA 4FK9A 1QTWA 1VF8A 3UT0A 3EB3A 4PTMA 2A7NA 5I24A 1MNZA 3AAMA 3E5PA 1AW2A 4WVXA 1NOUA 4Z2IA 1XIIA 2QCLA 1LL6A 1V77A 2ALRA 1RXOB 4WF7A 1RY8A 2FVLA 2V30A 3VU2A 3MS8A 2ZXAA 2P76A 4H8UA 3B0XA 2YSWA 2XFRA 1DWHM 3BCDA 5HQLA 3WLHA 5LHFA 3FFSA 4PBGA 1ELSA 3P6LA 3T40A 1NSJA 3SCVA 2PZ0A 1R85A 4KFNA 4GUHA 4BHYA 2Z1BA 3CTLA 1UROA 3ALGA 3MU7A 1EBGA 3HM7A 4D8AA 3I68A 3TAOA 3L5MA 2BWGA 3TQVA 1EJSC 3EKLA 3MCNA 1PKYA 2OCZA 3Q45A 5KINA 3MP5A 1T7LA 4LYPA 4XTIA 4LB4A 6A3HA 4GIAA 5D4YA 2VGFA 4DBSA 1KM3A 3MJYA 1K4GA 1KM0A 1Z69A 1OT1A 2FQIA 4HMDA 3G8RA 1WXYA 1E3XA 5E1QA 1UUQA 1Y65A 3LK6A 3EMCA 1YPXA 4OBRA 2X41A 3WQFA 1RK5A 2QDEA 1VEMA 1KO0A 3BL3A 4H8HA 3M46A 4P7RA 5FEXA 3TTQA 8TIMA 4I9AA 2JIEA 5C7VA 4K36A 3STGA 5G4HC 2FHFA 3DG6A 4AXKA 1JXKA 1EP1A 1EJTC 3VZZA 4S3KA 3N1AA 1Z7AA 4I6KA 2VQUA 4WR3A 4MFDA 1E9IA 3VE9A 4JIPA 3M6YA 5M3WA 3VNLA 1VH7A 3ABOA 2HK0A 6CGTA 4GVHA 3HN3A 3WLQA 1P6BA 3V5FA 3E0VA 4QE5A 4NX5A 2V81A 4JIQA 4K38A 4O4WA 1KRBC 1EGZA 3IRDA 4U5KA 4Q6JA 3IVTA 3EWBX 5CCZA 4OZOA 2FHCA 1IWPA 2ICSA 1Q6RA 2ALDA 2PDHA 2HVOA 2GQAA 2CBIA 3IEBA 1XBXA 3ONBA 2ZC1A 2SFPA 1FBAA 1YXDA 1GEQA 3QLLA 3PSWA 4F48A 1BFNA 1SYTA 3AIRA 3AHTA 4LX4A 2GJLA 4C60A 3A3WA 4AF0B 2ZADA 5E9XA 3NVTA 4ZFCA 3GG7A 4PUEA 4O1BA 2EAWA 4DZAA 2BODX 4UUIA 3WF0A 1J5TA 2FTPA 1A5OC 3OZOA 3BWWA 3H2NA 3T4WA 1YXCA 3VOIA 3M1ZA 2POTA 1ZP3A 2ATMA 2O9TA 1S38A 3MANA 2LLEA 5T26A 3VILA 5C2XA 4TMCA 1KGUA 4B2DA 3SN4A 3QV8A 3K30A 2W79A 4NASA 4JDYA 4C6IA 1SO5A 1UR3M 1TJ0A 1J01A 4W8AA 3R8HA 4AMCA 2HXUA 2TAAA 5AC5A 1E9YB 3QY6A 1RP8A 3N9SA 3RFAA 2QPSA 1NVMA 5K9DA 4FF7A 1EJRC 3TN5A 1OGGA 2E8YA 1NFBA 3BH4A 1W1YA 3BW4A 1LG2A 4PTXA 1ISVA 3WQEA 1O1HA 2VZOA 2BOFX 4R33A 1KQYA 5I78A 1W5MA 1ONWA 4KIRA 4W8BA 1JPHA 1M65A 1TPVA 3IUIA 4QG8A 1GOOA 3RO8A 3H22A 3BAIA 1NELA 4MVAA 1KR1A 2J6XA 3GFZA 1YTDA 4ZGYA 1E6SM 1L0PA 5HQMA 4L4OA 1X1NA 3H70A 2HNEA 1TJPA 2XTKA 3N19B 3W88A 1O1ZA 1K9EA 3ZVHA 1ONXA 4HYRA 4MIMA 1N8IA 3FN9A 4BQ4A 1O7AA 3ZJ6A 3TUUA 4H9XA 5E70A 4X63A 1JL8A 4ALDA 4LUYA 1TTJA 1YKWA 4OV9A 1VC4A 5LNWA 4XVDA 1KGWA 4KWUA 2OEMA 1SJAA 2WNWA 4XD6A 3RCMA 1CLKA 3APYA 3SO7A 1R7AA 3W7JA 3ARRA 3URQA 4AB4A 1GPWA 1OCNA 1SZGA 2CHOA 1QPRA 2I9EA 3AXKA 2OR2A 5HANA 3SQSA 1ODZA 1S46A 3GXDA 2PWHA 2PDCA 2OT1A 6TIMA 3CC1A 4UMAA 4Y8FA 2PCEA 2C1HA 2AMXA 1F8MA 3VDBA 3CB3A 3THDA 3G18A 3SCOA 4H6RA 1SW7A 4E8CA 1XLFA 1JZ7A 1PXGA 3FSUA 3PZTA 3MI6A 4HU0A 1CXKA 4US6A 2ZTKA 4H6EA 1AZ2A 3LHTA 4R7JA 1V3KA 1C9DA 4KW2A 4L9XA 1UR2A 2XGZA 2G37A 3E49A 3PY2A 1AZ1A 3IPWA 1DJHA 3RM9A 3CLWA 4ZB0A 1DV7A 3AS0A 3N9KA 2ISSA 2J7BA 2X7VA 4GI9A 3DX5A 5BXSA 3RO6A 3KS6A 5E6ZA 2DQXA 5GJNA 3W2UA 2CITA 1LUCA 3TMQA 2G96A 3AYSA 2AAMA 3W7KA 4GY0A 1R3QA 1TSIA 3SFWA 3T55A 3LY0A 3W82A 4CGTA 5F1UA 3BG9A 4UQ9A 2BNJA 1XD1A 3LXAA 4UR9A 1ZENA 2WKGA 2DT0A 1P0NA 5K9CA 3B8UA 6ALDA 5LGZA 4I7UA 3W7HA 2BSLA 4LCRA 1W3NA 2FH8A 3O8AA 1W1TA 2GGHA 1ZAIA 2A1YA 1OZQA 3VABA 4A8IA 3HGOA 2ZZ3A 3IGSA 3A47A 4BI5A 3ITVA 3V1PA 4UTJA 1VP5A 2DUAA 5EB8A 4LPCA 1EJWC 1ZBKA 3LI0A 2XWDA 4IP7A 1J9YA 1EWDA 3EMQA 3NZRA 4Q4RA 1PWMA 3TEVA 2X0SA 2VEMA 4ZOCA 4RNFA 2PTZA 2AMGA 2YJQA 3GG0A 3VTRA 1I75A 3KBSA 4TMBA 5T91A 4O28A 4F8XA 3KP0A 4FIQA 4NAEA 2IS7A 3W27A 3KCOA 3CIWA 1Q7MA 1YRRA 3TXVA 1V7AA 1JCTA 3NSXA 4NZ5A 5CJMA 2VFHA 1ESWA 4HTBA 4AY7A 1SMAA 3MCOA 2OU4A 5F4SA 2NXGA 2O7SA 1Q4WA 4LV9A 4P8VA 1TPC1 2NQ5A 1D9EA 5FCZA 1PIFA 1KFCA 1XJBA 2A4AA 2E6FA 3HPZA 5HR7A 4JGDA 5HOSA 3LV5A 5HNTA 5HPCA 1CNVA 2I14A 4FXFA 2OX1A 4MUPA 2FHBA 1L6FA 1GWJA 5FF7A 3UXAA 2J25A 1XYMA 1M68A 1LJYA 1OK4A 3ARWA 1ZBCA 4MYXA 4ENLA 3M0KA 3EPOA 4AVNA 1FCBA 1E70M 3W01A 2OQLA 4GISA 3OBAA 4GCAA 5KMYA 3QYSA 1FWFC 4UBPC 1H5YA 1BVWA 1A5KC 3RU8X 2PDGA 2BASA 1LROA 4HMEA 1K1DA 5BROA 2W3ZA 3A5VA 1IF2A 2TYSA 1KRMA 2J8TA 4JQ1A 1ZSXA 4ZO6A 1FVPA 4Z08A 3BJFA 1R38A 3WQ4A 2OSYA 3LV6A 1QWKA 2X1IA 3CIXA 1OBAA 1QO2A 5HR6A 3AXHA 2D2OA 2CLFA 3TOPA 1HKKA 4HHPA 4F0HA 1EYWA 1KNWA 2ZC8A 1E0WA 3EWCA 3B0UX 2CFFA 4KKXA 2OXNA 3CZEA 1DWGM 3USBA 4AWTA 4PRTA 2PCQA 2GK1B 1UZDA 4F0RA 3KLLA 3TTYA 2QJNA 2O9PA 1MRAA 4U10A 1CT5A 4FALA 3NOEA 5CEWA 3A9BA 3SCNA 1TTIA 5AYIA 2B4GA 3HA1A 1A0DA 1FCUA 4JQ3A 2BY3A 4UQEA 3LZ3A 1YYAA 4Y9OA 1UH4A 2AL2B 3F7JA 3QV9A 4Q4OA 1HT6A 5D8WA 3SCSA 1SPQA 1DJWA 4AD4A 4WEVX 3EWUA 2ZE0A 2OOFA 4I9TA 3ZJ8A 4UNIA 3KOXA 1PYMA 4GI4A 5BU9A 2G3JA 3I3EA 4FHAA 1JPMA 1SZFA 1VHNA 3QMRA 1QNQA 4EXBA 1UUOA 1Z3NA 4IFKA 4LVFA 4WZHA 1QK2A 1TWDA 4H9TA 4PMDA 1GKRA 1PTAA 3VUPA 4G1KA 4J2MA 1CGXA 4Q8VA 5CGMA 5BOEA 2PLJA 1SVDA 2ZUTA 2FZDA 4DO5A 5HPOA 4P2VA 5C6MA 1V79A 2CWNA 5AFDA 1E40A 5LXEA 5DQPA 5J8LA 1NFPA 5GNYA 2YA2A 4XD5A 1HN1A 4F0KA 1QOXA 3GXMA 2DV0A 1SFTA 1OQFA 1XDMA 3AU6A 4W5UA 1AW5A 1J0ZA 5A5WA 2G8ZA 4ZOBA 2OMAA 4DJFC 3VKBA 3AO0A 3GNOA 1B3XA 3SGUA 3EYPA 4B3KA 2W0UA 2OGYA 4A4AA 4YMZA 5BNKA 1RQHA 4GVIA 1LL4A 4ML4A 2NWSA 5B80A 1DXIA 1JQVA 5A1AA 2PDKA 2BGNE 4FSAA 2PDXA 2NSOA 4A29A 2BS9A 1T99A 3CASA 2E6YA 2XG9A 2I5QA 3MP4A 4B5WA 3AWOA 1H2JA 1UD5A 1XLHA 4XBKA 1TVPA 3QV7A 4JAWA 5H6HA 1V02A 1MFVA 2Z6JA 1W1ZA 1B3WA 2R8WA 3ZIZA 3ATYA 4QEEA 3NOYA 4QE1A 5BRPA 5FKYA 1KKOA 5D37A 3CQHA 4PB5A 3DBNA 3A24A 2X40A 3SEPA 3W7IA 4QBXA 1JNDA 3BUVA 1MW0A 4GNKB 4PUNA 1UG6A 3CH0A 4QP0A 4NIRA 1UWTA 1KKRA 3M0VA 4HNTA 1SGJA 5EYWA 1WKEA 4AEFA 3LEPA 2P10A 1Q3NA 1A80A 2EBNA 2WLYA 4N2YA 4IQJA 1TJ1A 3LCXA 1UR8A 1W32A 3TW7A 1A5LC 3WFZA 2VYOA 4L1GA 2WMFA 4O12A 5FJJA 4Y8EA 2ZA1A 4LF2A 3QW4B 4JFSA 1JD9A 1Q6GA 2GGEA 3GNPA 1JAEA 5C5YA 1OB0A 3VKCA 4E2BA 1NP2A 4Y6GA 7ODCA 2PDUA 3W7QA 2BB0A 3SGZA 2VEIA 4U33A 2VX7A 4RE4A 3FGCA 1JRCA 1EP3A 1ZAJA 4QLJA 2V5DA 1W9VA 5D9PA 5E09A 2QR6A 1F05A 3PNZA 1XWYA 1PUDA 3C8NA 1NDZA 2VTFA 2Y0FA 4R7WA 3TMLA 1KFEA 4G56A 4NNBA 1BG4A 2CKSA 1B1YA 2E8ZA 4GXPA 1QI2A 1HW6A 4YVVA 1NARA 1NEYA 2QIWA 4QJ5B 1KTCA 3HMJG 3P93A 2OOGA 4DAIA 4NJJA 4GLEA 1V6YA 3PJXA 3FYOA 3AWNA 3KBNA 1TPUA 4TU1A 3SRHA 3DIPA 4RDVA 4U5IA 2Z0IA 2C79A 1S3HA 2PP3A 4LB3A 3VGHA 4EOUA 1AVAA 3EEGA 1JUEA 3Q65A 1L6GA 2VC6A 2XH0A 4IISA 3SADA 3WLOA 1L2QA 1NIUA 3U5UA 4RK8A 2DORA 4LAUA 3AFBA 1BYCA 1GVYA 1E5JA 4R27A 3CHEA 3PP7A 4E2VA 3L23A 4EF9A 3NQEA 5LIUX 2YB4A 4QTGA 1GVIA 4ZOEA 1ZGDA 4IMCA 1U22A 3AMLA 1ECQA 3FJLA 3PTQA 3GHTA 3ZOAA 3H4WA 1TPH1 5DMMA 1XL9A 2XVPA 5HJXA 4WKFA 3VD9A 3R2GA 3B0YA 3I4EA 2BOGX 3FAWA 1EX5A 1XFCA 2NVAA 2Y7DA 2A2IA 1XRTA 2XPKA 1FRBA 2TPSA 2NVCA 6REQA 3HGRA 3KTSA 3SRDA 2GSHA 3IGHX 4MNMA 3B4UA 4KCTA 1OADA 4FP1A 4DNMA 3F5KA 4LYQA 3BAXA 5I09A 4AH7A 5TIMA 1FWHC 1R8LA 3ZM8A 2DZXA 3AICA 3O6AA 4BR1A 3EKGA 3KW3A 2W66A 1UCWA 4YN5A 4JY8A 1CI1A 4ATLA 1LLWA 2Y8UA 4GBDA 3WLNA 3BE7A 2ZWZA 1J0KA 1V7YA 3W6MA 4WXYA 2QCHA 2NUWA 1SFLA 4GIYA 3R7MA 3WCZA 2C15A 2VX4A 4PB4A 1NOFA 3P8JA 5AC6A 1M53A 1UA3A 1E6NA 5D03A 5ABTA 2ZX6A 4FOJA 1DKWA 3DKLA 2VVSA 3WDHA 4PUJA 2XYLA 3H4GA 3PB0A 3QQWA 4OBTA 3IIPA 2PDWA 4DQWA 3UW6A 4A2SA 1KTBA 1B3VA 4BI6A 4OECA 4JY9A 1F6KA 1XH0A 2JIWA 1VFTA 2EG6A 3E0IA 3BAKA 1ZPTA 3EAUA 1VFUA 3WNMA 1PZ1A 2R94A 1R6WA 4HOZA 1EO7A 4AHOA 3DKJA 1NQKA 2NV9A 1N7KA 2ABBA 1ODUA 3W23A 4H9MA 1EWEA 1LOQA 4FAMA 2FB2A 1A0CA 3JZEA 2VRKA 1G7UA 1SO6A 2J9ZA 2UY5A 4XKYB 4WDTA 4WQ6A 4LAZA 1XKYA 1W5PA 4C7FA 1UR9A 1DL3A 3OLIA 3PWGA 2EXOA 2A3CA 4O4VA 4XB3A 3SIZA 4LWWA 1LRTA 4AD2A 3K1DA 1SMDA 5I3KA 1H60A 1GVEA 2PRHA 1I1WA 2Z7KA 2DU2A 1QI3A 5AYZA 3GTNA 4C65A 2PBOA 5JMUA 2ZX9A 6XIMA 4F40A 1YE4A 5FD0A 4PMUA 3WSUA 1VYSX 1EXPA 1O94A 1W8SA 1OF6A 3A21A 3ITYA 3TLLA 3CZKA 1GORA 4KWVA 4Z1YA 3M0ZA 3EKZA 2BBFA 3EOUA 4JKKA 2C6QA 1PKLA 1JQXA 1V0LA 3CO4A 1H7PA 5D8ZA 2PWDA 4QCFA 1AJ0A 2QGHA 2FDSA 3UG4A 4LT9A 3RM8A 1UUMA 3W6LA 3OBKA 2A3AA 3PC0A 2DEPA 4QITA 4M3PA 3T0DA 5C70A 2O55A 4QEHA 4UOJA 1OYBA 5EY5A 1QOQA 3S42A 3DEQA 3VIGA 3MC5A 3VOFA 3LN3A 2PLMA 4HA3A 3ZLHA 4CNTA 2OZ3A 1V3MA 3TC3A 3W4RA 2QJHA 2DVXA 1AUSL 3BJSA 3UG8A 2J7GA 4FLRA 1UOKA 1RR2A 3FS2A 1X38A 2HEJA 4N02A 1CXLA 2DT1A 1VQTA 4NSBA 2WHMA 1P48A 5A8GA 1KCZA 2WBKA 2JBMA 4RXGA 1JPIA 1UH2A 1GHRA 3N2MA 3VOCA 1FUYA 1H1ZA 1QJWA 2ZRYA 1OSEA 4H41A 4M7TA 4PTWA 5IBXC 4LOCA 1UBSA 3RCYA 1TCDA 2POZA 4DBEA 5AVNA 4LUJA 3PG8A 4G5DA 5FJTA 4A3UA 4Q3MA 4O19A 4QJ3B 2PGEA 4IP4A 3OHIA 3O07A 4ACZB 3M47A 3IRSA 3D6NA 3CUGA 1WKFA 4Z2KA 1R3VA 1XH2A 2WSQA 3CO8A 2HBXA 4DJFD 1BWLA 1ITXA 5K4XA 1VFHA 3W2KA 1OG0A 4ZO7A 1PWLA 3DAQA 4IQDA 1FA2A 3CUFA 3WEZA 3CH9A 2GWNA 1MXDA 1AMYA 4FX7A 1GTHA 3U7VA 4L56A 3PJUA 1E6QM 2EEXA 4BEQA 3KM8A 4JQ2A 4D6JA 4JX6A 3GVVA 3KUMA 5EMJA 2QMJA 1M9HA 4HOWA 3NCOA 1J96A 1TMQA 3RRAA 3BC9A 2RJGA 3P14A 4CU7A 1BVZA 2Y24A 2DH3A 3NDZA 1OX4A 3NPVA 2HS8A 3EX2A 3PWIA 3ITOA 4C6CA 3ZVIA 1QASA 2JKEA 3OGRA 1I0DA 4LS2A 3W7LA 5LIWX 3BLEA 1YNPA 4UC5A 1VYRA 2VC7A 5A6LA 1GPFA 2ONEA 1W9PA 1NTHA 3W7EA 1NH6A 3C2VA 3NGFA 1FHDA 3R10A 4ZCWA 2A7RA 1FH8A 2A79A 1P5BA 1PHQA 1W17A 3BLIA 1RCOB 2FMNA 1MDLA 3AS2A 1UD6A 1XR2A 2VZVA 2CZDA 1XLBA 5BZAA 1GKQA 4CLMA 3ZJKA 3ZWTA 1CGUA 1TTQA 3NXLA 3SB0A 1JPKA 1Q6FA 5DX7A 3FHAA 1MUMA 1K77A 2IKIA 2QNEA 4G7EA 1W3HA 4QAIA 4DUXA 3VIFA 2CXGA 3AXIA 3UNTA 3CYJA 2QVHA 2XISA 4Z2JA 4CKQA 5BXTA 2PWFA 5K3VA 4JTUA 3B8DA 3U7BA 2VC5A 1YEYA 4Q8WA 2L5HA 2ZZ4A 1D7FA 1CECA 2BG5A 4Z1CA 4XZLX 1JZ4A 1BEUA 3QLDA 1KXHA 1JDDA 2QUNA 2XSXA 3BW3A 2V3GA 5DMNA 4Z1AA 4S3EA 1OCJA 2R1PA 2R14A 3V5OA 4A8RA 2Q8LA 4KESA 1PX3A 1MW3A 2Z25A 5LA2A 4QDPA 1O5XA 3WDQA 1UHVA 3ABRA 2EG8A 3TQ0A 1J0HA 1DWAM 1DQXA 3FNDA 3OZYA 3V16A 3KHDA 5E0CA 4ADUA 4W4QA 3RK8A 3AC0A 3DESA 2DZBA 3QHNA 3FJ6A 4ZSTA 2GJPA 1V0KA 4BQ2A 1TUFA 1WNOA 5G1TA 2NX9A 5JXQA 2V68A 5FIPA 3TC7A 3S5YA 5FF0A 2IPWA 1UPPA 4MKVA 3CWHA 3EMZA 3BG3A 4G6CA 3APGA 1ME7A 1XISA 3BAYA 4XVEA 4RUBA 3RU6A 4HOXA 4FF5A 2IW0A 4M56A 2IPFA 1GGOA 3C3NA 2GQ3A 2NXHA 1M7JA 3CAQA 3V0SA 1Q4NX 3IJ7A 1NJJA 3TVAA 2WCGA 4NP7A 3UR2A 3EOEA 3CV2A 3WK3A 4JN6A 3B8SA 3M44A 2WZIA 2YXOA 1FH7A 3LENA 1Q65A 2AL1A 2HPIA 3L0GA 2VFFA 4ROPA 2QV4A 3MMDA 3W7OA 1GW1A 2Y7FA 3QBUA 3YPIA 1Z32X 1EJVC 4IQLA 1TV8A 3URBA 3GH7A 4B5XA 2GSJA 5EMKA 2YBTA 3LCHA 2A3EA 2ZIDA 1HJUA 1Q63A 1TPEA 1V8EA 1LORA 3AZSA 4W9TA 3GHSA 1MUCA 3TTOA 5D9OA 3EWYA 4JTGA 4E0CA 1EP2A 3H8AA 1KWGA 5U4NA 2YDSA 4UXDA 4GUIA 1A4MA 3URAA 1O5KA 4B5SA 3G3DA 5A2BA 1EKOA 1MQRA 4O13A 3ID7A 3W02A 3CLMA 2WMGA 1RZMA 1IEQA 1XHGA 1CIUA 2DGAA 3MKCA 3ZZ1A 3GQYA 2P3EA 2GVYA 4PEEA 3JZUA 2ZX8A 3QHOA 2HDJA 2PFHA 2W63A 4WY0A 1PV8A 3W2NA 4YCOA 4H6QA 4JTIA 1BXNA 4GUGA 3IGUA 2PF8A 4UFJA 4BF5A 3UBPC 4TTGA 1RLCL 3CPGA 2A6NA 2ZQ0A 3TFCA 5BMXA 5FL0A 3DFQA 3C0JA 4R88A 1HNYA 3W38A 4L80A 4RLIA 3L4WA 1U33A 4R85A 1G4PA 1B54A 3N4EA 1JNEA 3WZ0E 1U5VA 3LI1A 4GYFA 1RAKA 4JTFA 2RDUA 1POJA 3VNZA 4RZBA 2AQVA 3H7RA 5FOOA 4MM1A 3B06A 3ZR5A 2YDQA 2VM8A 3N4FA 3WJXA 3E38A 1VPYA 2ZX5A 1FHVA 4GY7A 2PDLA 4V1YA 2VEPA 1KFBA 2NQLA 4CNSA 1I1XA 2YPIA 1GONA 3K5XA 1SQ7A 5E0FA 3VE7A 3OBEA 3ARXA 1GK8A 4RXFA 3VI2A 2OX4A 1BWVA 3PR2A 2E1WA 3C6CA 4M0XA 4DVOA 5D02A 2VL4A 4GQ0A 2PTDA 3S1WA 3T9PA 1AMKA 3HG3A 3CMGA 3AMGA 2E5DA 1ZBWA 1R86A 2VX5A 3W2JA 1QNSA 4A05A 4ZXOA 4QLKA 2ANUA 4JBRA 4LFYA 1KBJA 2WQPA 1RV8A 3L4ZA 2WW5A 1JCYA 4JEJA 3UWWA 1GQNA 4GYPA 4DXXA 5HWJA 4GC4A 2OT0A 4GZEA 1S1PA 4QRNA 1UWAA 2TSYA 1M7OA 3BGJA 3H2AA 1E51A 3ES7A 4DJFA 2O4QA 4E4PA 3ZLFA 3OIHA 2WSRA 3G1XA 1HVQA 1XPGA 1T96A 4UQCA 3VC5A 1DE6A 3JRKA 1XICA 4NL1A 4IP5A 1BKSA 4PUUA 3LPGA 4LBSA 4GBUA 4JOMA 1EC9A 3BICA 1MEWA 5BOFA 2JQXA 1DBTA 2WYSA 1UMYA 1KQZA 1XG4A 1QO5A 4JHMA 3FIGA 3GLCA 4XZIA 1DHKA 1S39A 2VOMA 3PTKA 4AZGA 3W84A 5IRPA 1VFOA 4BQ3A 3GNRA 3IJQA 2XN1A 5KITA 5A3HA 2WMKA 3W00A 4UFHA 3GBEA 4PN2A 1GVSA 4JL2A 2CBUA 4QM1A 1LCOA 4POCA 3O6DA 1XH1A 3VNDA 1W9UA 3LD5A 1X6UA 3NURA 3WUFA 3IIXA 2XIQA 3LLXA 3WD4A 5I7GA 4QISA 4XSLA 2VCBA 4B3ZA 5C9UA 1UD4A 2FJKA 1TYGA 3HFTA 3OYZA 4FI4A 1K7EA 3QPEA 1DJYA 1EDGA 1H51A 4PCNA 3QYQA 3L9CA 3KHJA 1J5SA 3UERA 8RUCA 2BX7A 2VENA 3QC3A 3BMVA 3GNDA 3U2ZA 3L4UA 4C91A 3O15A 4NUWA 3LBMA 3NL6A 3PM6A 2WPBA 3WF3A 1PTGA 2GYIA 4OWGA 2X30A 4Z2HA 1IXOA 3S1UA 2A7PA 2Z6IA 1LBMA 1TIMA 1WO2A 1TV4A 3PZOA 4M29A 4AX6A 4J7RA 4QJ4B 2QCMA 4C7GA 4N9DA 3SURA 2E4TA 4D6GA 1ZJIA 4IMFA 3K46A 3N34A 1R2RA 3PVFA 3OPSA 3PAJA 4BKNA 4HA4A 1XBYA 1LQ2A 2ZFAA 3BCJA 1A5BA 3HURA 3F2DA 4OUIA 1UD3A 2G97A 4OJYA 1OC5A 2XINA 3ZVHB 4UQDA 2GGIA 4HMCA 5C0QA 4C6BA 1MNSA 3C2OA 3NWRA 2PDPA 4Q8MA 4GI6A 1OHLA 4AZCA 3B3DA 3TN4A 1JDAA 3H26A 4AIUA 1IEIA 1LBLA 2WJEA 1XSJA 2ZZ1A 1CWYA 1IXPA 3BZJA 4A3QA 1UQYA 1E9LA 1FWRA 3COTA 2YL9A 3QGAC 1DVJA 4HK7A 5CSRA 2Z1VA 3ZO9A 3OA5A 4GACA 3P82A 3K1GA 3OG2A 4KH2A 1OFPA 4B15A 1H7XA 1EOMA 3T44A 1R87A 2DIEA 4GFIA 4HSNA 4Q8OA 4O11A 4JKMA 2O9OA 2ADAA 5LXXA 5XIMA 3PAOA 1F3WA 2G4FA 5HJLA 1BLIA 4BQ5A 3DC8A 1XIHA 1XLDA 3KBWA 1C8QA 1V3IA 1S3TC 4CQBA 1XW8A 4FLQA 3PBGA 4US5D 2F6UA 1HTIA 2X16A 3C61A 1RY0A 5C2GA 2Y88A 2QIIA 4QGCA 1NF0A 3FDGA 3LYEA 4HGXA 4YLWA 4OFCA 1F8IA 3R13A 3W75A 2YDRA 1M5WA 4KGJA 1XSKA 2ZKMX 3WQ8A 1ADDA 1J12A 2UZ9A 1IR1A 1GOWA 5A6BD 1P7TA 5G2IA 1Y8BA 3WLTA 3IK2A 1O60A 1LUCB 5DBTA 3NQ6A 1WZAA 3T4CA 5C9WA 3TAKA 2GGJA 4PRWA 4JTLA 2PP1A 4I6VA 2D24A 5IDZA 5AY7A 3GS6A 3WNPA 4YCPA 2ACUA 1BYDA 3FA4A 4BA0A 5DXXA 3P2VA 4EK7A 4GX9A 2ZWYA 3LXCA 2Q01A 4U2YA 1F76A 2BDQA 3RPDA 3BJTA 3TROA 2ZRXA 4X2RA 4P8WA 2Q02A 2FZBA 5D04C 3TDFA 3MUY1 4YWIA 1OC6A 4XAYA 5CAHA 2CHNA 3WQWA 1RHCA 3L7RA 1J93A 4Z1DA 5FF4A 3QR0A 4RE2A 1CCWB 1R5YA 3OZMA 1FXPA 3PPGA 3TCEA 2J74A 5A8OA 1RSCA 4ORMA 4XQ6A 3UXIA 4B4HA 2E77A 1EQPA 4FNPA 3E2SA 2J7HA 3E2VA 4S2CA 1S5TA 1BVNP 2J4GA 1WXJA 4GC3A 1EL3A 2PU0A 4FS9A 1W1A1 1WBHA 3FW6A 5G4WA 4OTKA 2Z1XA 4CQ9A 5A8QA 2PWUA 1UZ1A 1EPVA 3NYZA 1OYAA 1J2BA 2A5HA 3B9OA 1MMFA 3PF3A 3VZXA 1YPFA 1BGAA 1OF8A 3VK5A 3WEMA 4L64A 4DEFA 3IS4A 1H0GA 3QZAA 1OZMA 5HATA 2FGLA 1BF6A 3A3XA 3OP2A 1PX4A 4G1NA 2I1OA 1FWTA 1AQMA 3V7PA 1GT8A 1E6XM 2BHZA 5ECVA 1GYLA 2C71A 1OJXA 3UEQA 5F2GA 4IMGA 4HN8A 3NQ7A 2VFDA 1OK6A 1OEPA 5CPNA 1C29A 3BMWA 2KZHA 2EPHA 3V1HA 5AC8A 8A3HA 3UY7A 2HJPA 4MADA 5G2WA 1F3TA 2C0AA 4LEQA 4AVOA 3STFA 4JN7A 1TWZA 5JBEA 3HGJA 1DXEA 1CLVA 1XSIA 1JGIA 3GSMA 3VIHA 5D38A 2BMBA 3R8GA 4D2JA 2NUXA 1WB0A 2W5FA 1O95A 4HP5A 2BY0A 4JIIX 1P6WA 4WY0F 1L8NA 1CEOA 2CWXA 1H4PA 1C8YA 5AN7A 1LWIA 4X60A 2QVNA 3AS3A 4ASTA 3WO8A 2GJRA 2BP1A 4IZGA 3GVRA 1DJXA 5DEZA 1XQLA 5EL1A 3SSZA 4I7WA 1LP6A 3NO3A 4N9CA 4Q32A 3AJXA 1IGWA 5D2WA 2A0NA 3JVAA 4MUZA 1P43A 4GJ1A 3TYBA 2GQ8A 3CUJA 2VEGA 4Y96A 1XIFA 4PMNA 3N25A 3ARZA 1E1CA 1CLXA 4FMVA 3CJPA 3N2TA 1JCMP 1TJRA 2E3ZA 1E9ZB 4IFRA 2DDXA 4UB9A 2F61A 3CAKA 4GHRA 1BXBA 8XIAA 4PCFA 3G0UA 1IYXA 1Y5WA 1V6WA 4YTQA 4MDOA 3IAPA 4GJJA 2IPJA 3QOKA 2JKAA 4R9OA 2VGIA 3IJ6A 4XKMA 1J0YA 3UWEA 2HNHA 3BLDA 3NDYA 3WMCA 1EEXA 2QCFA 4V28A 4AZ6A 3NL3A 2W27A 4PGLA 2X7WA 1OC7A 1V0MA 5IBXA 4YVXA 2V5LA 5HDRA 3CQ0A 1AJZA 3IAQA 3MKKA 3OQEA 4IFKB 3NQ8A 3ITLA 4CNUA 4WHBA 2PC4A 2Y5JA 4FZIA 1AQFA 3MWAA 1XLCA 2F2HA 3QFWA 1AG1O 3A4WA 1ZB5A 1GQIA 3LM7A 3LTYA 4GO9A 4IF2A 1TG7A 4YJ5A 1ZU8A 2WAGA 5CG7A 5CH9A 1RUSA 1YX1A 1FX6A 2QCGA 4H2HA 3DHDA 4LVDA 1JZ8A 1O4UA 3GC5A 3RCNA 3N9RA 3UYCA 5A95A 4I3GA 2WVUA 1CZ1A 1QU4A 1XINA 1LWHA 2CZEA 3ZR4A 3W1RA 4FNUA 2PP0A 3MSDA 3UETA 1HJSA 4V15A 4W93A 2V3DA 5ABFB 1AA1B 1KM2A 3SQLA 1EQCA 1I2PA 3TV8A 5CBJA 5PTDA 3I65A 2FVKA 1BF2A 4H01A 5GQBA 1Q6CA 3DC0A 3M0JA 2EF9A 1XXXA 5D2XA 2CIPA 2RDTA 3E02A 5AKQA 5M2FX 1FOBA 1TPWA 2ZA3A 2O4MA 3SAZA 2OWWA 1U5JA 1MW2A 4NU7A 2I17A 1MFUA 4MLJA 3DYOA 2WVVB 1J4EA 2YL8A 3TE9A 3CZGA 4BWLA 3W85A 1V6TA 2HBVA 4AG0A 1J8VA 1B2YA 4ATWA 3RMEA 4US5A 1EGVA 3SSJA 1HXJA 3FKKA 5FEZA 1M6JA 3NL5A 4P7LA 1XV8A 2QCDA 4HJWA 5FJPA 2PA6A 2WHKA 2WCSA 2WNNA 3HQOA 3Q2DA 3RJXA 1LQ0A 1QDSA 4GNVA 2J88A 3GAYA 3TN6A 1JEZA 5A6BA 3HOJA 4NYUA 1MWOA 5EBUA 3QHMA 1WP6A 4O14A 4O8RA 2QCEA 5AHIA 3S2LA 4ZE4A 4R5EA 3TW6A 3V35A 3N4AA 2X8RA 4J3TA 1TX2A 3RRXA 4G2DA 1UZ4A 1TKKA 3MUIA 1KD0A 1DYSA 4MGGA 4ICNA 5AYXA 1NOWA 5CJ5A 3BLPX 3TTEA 3BV4A 3N12A 2HWGA 1W0MA 4UFIA 2WZMA 3UZWA 3K4DA 4ZVJA 4RV3A 1EJUC 3PPFA 3ZT7A 3J7HA 4NZ4A 1XLEA 1EZ2A 1WZLA 1JPDX 3KWXA 3FGCB 1XYCA 3M7SA 4W89A 2FPVA 3WQVA 4PE8A 3DFNA 5JQ9A 5F2LA 2UY2A 2O0TA 3TXZA 2CZVA 3LU2A 3TW9A 4NRRA 5AHNA 2E5CA 4JNYA 4R3UA 1E4MM 1M7XA 1SZEA 4I7VA 1EIBA 1J2WA 4MWAC 3M64A 5HMEA 3P5ZA 1W3IA 4UTFA 1S2TA 1QI0A 1OWQA 2ZXQA 3WDPP 3LB0A 4Y9PA 3W53A 3POCA 2I5IA 1HJXA 2HTMA 4HPXA 5SWUA 4E6MA 3TQKA 2CHRA 3L12A 4X22A 3D46A 7ENLA 3HTWA 1ZUAX 2VELA 1FFRA 5LSMA 4YS1A 1V3HA 4AYGA 1UIPA 3PNUA 2X05A 3F5JA 2ZYFA 4ML9A 5HNNA 2RDWA 4H7CA 3GDTA 2GQ9A 4HPNA 4M1BA 4O50A 3AQUA 1CENA 3NPWA 2WZEA 4PODA 2YCKX 1XUUA 4MAZA 5M5DA 1NU5A 3H2FA 4B5VA 3OLGA 4JKLA 5A6JA 3A4JA 2R24A 2OEJA 3W07A 1KBBA 2DPEA 2DT2A 2A3BA 3NL2A 4L4PA 3ES8A 1J18A 4N4PA 4N0RA 4TV5A 2WLZA 2XIOA 3C2RA 1V6XA 3M5XA 1ISYA 3TJLA 1C8XA 1G01A 3RAOA 2VX6A 3WK0A 5JU6A 4FOUA 3DG7A 1W3JA 1A47