4RL3A

Crystal structure of the catalytic domain of a family gh18 chitinase from fern, peteris ryukyuensis
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
271
structure length
271
Chain Sequence
b'KVFREYIGALYNGVQFTDVPINSGVTFHFILAFAIDYTSAAAATNGVFNIYWQNSVLTPAAVQAIKAQHSNVKVMVSLGGDTISGSPVQFTATSVSSWVANAVSSLTSLINQYHLDGIDIDYEHFDQVSTSTFVSCIGQLITQLKANNVISVASIAPFDGVESQYTALFGQYSSVIDLVNFQFYSYGAGTSASQYVSLYNTAASKYGGGAKVLASFSTGGVGPAPSTVLSACQQLKSSGTLPGIFIFSADGSYASSAKFQYEQQAQTLLTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase A
publication title A class III chitinase without disulfide bonds from the fern, Pteris ryukyuensis: crystal structure and ligand-binding studies.
pubmed doi rcsb
source organism Pteris ryukyuensis
molecule tags Hydrolase
total genus 100
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2014-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4rl3A00
1W1PA 3EMQA 3EDJA 1EQPA 1W9BM 2E40A 3L2LA 4UZUA 3POCA 1B2YA 3W28A 1Q6DA 2AOSA 1LWJA 1EHAA 1IT0A 4QFUA 3T0AA 1J12A 5D9NA 3T2PA 3AFBA 4P7RA 3GXMA 4PUEA 1HNYA 4DUWA 2WZIA 3EDDA 4ACZB 1HX0A 3MUIA 4P8WA 4WKFA 2O9PA 1C8XA 3AIWA 1W9PA 1UWTA 1H11A 1H1NA 3OZPA 2G3IA 2A3AA 1JG9A 4CU6A 3PZUA 5GPRA 3WEOA 3L4TA 2DSWA 2WSKA 2EPOA 1ECEA 1BGGA 4J3TA 2VNCA 4B15A 2XG9A 1E1EA 3II1A 4S3KA 2X1IA 4NRSA 2WLZA 3AYRA 3WDJA 5CPSA 2JALA 5I24A 4JZ5A 3ZT7A 3W6LA 5I6SA 2V3DA 1E3XA 1LF1A 3THCA 3FXYA 7TAAA 2VJXA 5HOSA 1UD8A 2CERA 1NOFA 2GDVA 5JUVA 3VINA 1JZ2A 2CCRA 4J3XA 3CUIA 3SEPA 3AJ7A 2PWGA 1E6SM 1FP9A 3O6AA 5EBAA 3WUEA 1V3IA 4AISA 4FF5A 3W4RA 1MQRA 2PC8A 2GVYA 3GNRA 4GI8A 3WQ4A 3VIHA 1E40A 1US3A 1VB9A 3WDRA 2W61A 4D6EA 3PZMA 2JIWA 4ZXOA 3N11A 1UWRA 2ZUUA 1DWFM 3PTQA 1CIUA 5CPQA 4EK7A 1TUXA 3N17A 4HU0A 4QLLA 4OZOA 1OGBA 4D72A 1GJUA 3RIKA 4GQRA 3VNZA 3ZR6A 3MMUA 1EXPA 3LPPA 3QR3A 4HA4A 1KGXA 5E0CA 1CLVA 2WAGA 2XSAA 1XCWA 4HTYA 1OIFA 1Y7VA 3TTQA 2CITA 3PN8A 1V0NA 4UTFA 1BFNA 1QNSA 4M29A 3DC0A 1B3VA 1JDDA 2Y24A 1FFQA 3HMCA 3UG5A 1WDPA 1KB3A 1JZ3A 4MDOA 5E09A 1AVAA 2XVKA 4MNJA 4M1RA 3VD5A 3WFZA 4ATWA 2D0FA 1JZ4A 5BYWA 3TA9A 4P8VA 2G4FA 3RM4A 4FK9A 1WNOA 4GPNA 1UD6A 4PSPA 1ISXA 2D3LA 4CCDA 4P8UA 2PBGA 3VDAA 2WWDA 3WMBA 4MDPA 3ZM8A 3WQWA 4Z2JA 3VGGA 3AHYA 3CUHA 1UQYA 3AIVA 4IUGA 1TA3B 3OA5A 1E71M 1Z32X 2IXUA 1UQZA 1OCQA 3A47A 3WUBA 2X8RA 3OLGA 1UR2A 1W3HA 1W2VA 3VIPA 3L4XA 3O9NA 1TZ7A 4WSJA 1CGXA 3W26A 5AC4A 2CEQA 1M01A 4QCEA 1BLIA 2J4GA 4LGXA 4LYRA 3WH9A 1DWAM 1J18A 5DEZA 1MXDA 1ZL1A 5CGTA 3SCOA 2G41A 3VU2A 2D23A 3KL0A 1HT6A 3MMWA 2D0GA 3GTNA 5IFTA 5A6BD 3VIFA 1E4IA 1LL4A 4AZ6A 3W82A 2CESA 3BAWA 3CZEA 3ARPA 3EYPA 1H0GA 1JNEA 4TX6A 2EBNA 3WF4A 5CPTA 3WH6A 1W1TA 1V3JA 3NSNA 2PB1A 3WENA 2ZUVA 4KGJA 1TE1A 1CGUA 4PEEA 3W81A 4EKJA 2DH2A 1LG2A 1MW2A 4WJXA 4FMVA 4TTGA 3EMCA 5D9MA 2QF8A 3WD4A 1KFWA 1E6ZA 3BMVA 1GQJA 2WKGA 3AHTA 4W8LA 1C92A 1KQZA 5JIWA 3CLWA 3OGVA 1FFRA 4HPGA 2AAAA 4D6FA 3WQ5A 4MNLA 3WDHA 1NWSA 4QP0A 2J8FA 2PI6A 4W89A 4XUYA 1OD0A 1GVYA 2DSUA 1AQHA 1E0XA 2CHOA 2VMFA 2CHNA 2NT1A 3VGHA 1GHSA 1XH1A 2WANA 4UCFA 3CPUA 1G94A 4W93A 3QHOA 3PBGA 4UR9A 2YDQA 1MW0A 2XVPA 1E6XM 3BCFA 4UQBA 4AXNA 2DSZA 1VFOA 1VIWA 3W25A 3ARTA 1CEOA 1B30A 2XVLA 2ZXBA 3PZNA 4UOQA 5M03A 4U31A 1W9DM 2V5CA 1UHVA 2DSKA 2PBOA 1I1WA 4URIA 2YOCA 3WUFA 4BF7A 2J7DA 2WMIB 1KR1A 2FGZA 4J28A 4JCLA 3QHNA 3ARUA 1CXKA 3JUGA 4JKKA 4PCSA 3WEZA 2X09A 3ALFA 3AXIA 2ZX9A 4OOUA 4N0RA 1RD6A 4Z2GA 3NIYA 1AQ0A 4AIUA 3VDCA 3N15A 4JCMA 3MSGA 1QNOA 1AQMA 1B3XA 2VL4A 3AS1A 4DWSC 1K9DA 2OLHA 3FN9A 2VZTA 2DIEA 1LL6A 3MU7A 4AZHA 4BCEA 1GZJA 1BF2A 1E70M 4BQ5A 3AS3A 5HXMA 1VEOA 4PSRA 2BHYA 3KL5A 1ZBVA 4M81A 1KXVA 5M17A 1VEMA 3AHXA 2V5DA 1EDQA 3VD7A 2YA2A 4HA1A 3SUTA 2UY3A 3CUJA 3FAXA 3VIIA 2GSJA 3OGRA 1CXLA 1GJWA 2EPNA 3AZTA 1JL8A 1LLOA 3LPFA 4ACZA 3OZOA 3B9EA 5C70A 3RJXA 1Q4NX 3N1AA 3A4AA 3PZOA 4B3KA 4OBSA 5C8BB 1FP8A 1L8NA 3W37A 1G0CA 1LL7A 3E1F1 1UWSA 1IZJA 2GUYA 1JF6A 1WZKA 2QPSA 5HNNA 3NCOA 1DTUA 3I3DA 9CGTA 1R8LA 3F4VA 2XWDA 1WKYA 4GIAA 2CIPA 5EMYA 2GJPA 4WIWA 4HOZA 4AD4A 4TVUA 1J01A 4B16A 1UD4A 1FHLA 2DH3A 4BZYA 4D6DA 2QV4A 1NOUA 1H09A 1WO2A 2O9RA 3BH4A 2RGMA 3F5JA 1JD9A 3ECQA 5I23A 2E8YA 1D3CA 3RMEA 4GO8A 1JFHA 1OB0A 3GH7A 1JAKA 5ABFB 1ISVA 3IK2A 2QLYA 3AMKA 2DSVA 2WZEA 4HZ7A 1SFSA 2WHMA 3QOKA 4W8BA 1CXIA 6CGTA 4PMOA 4Z2LA 4FLOA 3L2MA 1UZ4A 2C8NA 4OJYA 1HVQA 3AMDA 3T2QA 3AHZA 2BHZA 2VX4A 3PZTA 1KGWA 1ZBCA 4UFMA 5CGMA 4F9DA 3WD1A 5LYRA 1GQIA 1CXEA 4HA3A 2WC4A 2FHCA 2EO7A 3TP4A 2J25A 4E2OA 1JYNA 1GVIA 3WSUA 3VX0A 3WF2A 4RE4A 4XZBA 4WLCA 2WBKA 1OBAA 1UKOA 1U33A 5M3WA 2E4TA 1OSEA 2CYGA 1E6QM 2EPMX 3VGFA 4W87A 3RILA 3O2LA 3WF1A 3SUVA 1B3YA 3IJ8A 1UYQA 4AZCB 4BA0A 1ZU8A 4J3SA 1NM9A 4M80A 3BGAA 4RE3A 3BAXA 1J10A 3ARZA 1KGUA 1B90A 2C7FA 3AIBA 3WNMA 2GJXB 1ZJAA 4D71A 1W1VA 2BNJA 1EO5A 3CGTA 4ZENA 2J47A 2OWXA 2VURA 4LYQA 3RM8A 2VCBA 2ZE0A 4LXFA 4EANA 4H8VA 4PMUA 3UCQA 3ZJ7A 1BG9A 3MMDA 2OSWA 1WCGA 5CG0A 5EFFA 4D6JA 1V6WA 2BY3A 1WPCA 4D6CA 1E72M 1M04A 3WY1A 3B8SA 4HMEA 2WC3A 1V3MA 2WMFA 4JHZA 3LMYA 4J3UA 5CXPA 2XFRA 4PRWA 4H7VA 1XYFA 1WZLA 3ZSSA 1TVNA 2XSBA 5A8PA 1QHOA 2EPKX 1JYXA 2XGIA 3UR8A 3PZQA 3VD4A 3U7BA 4AD3A 1UOKA 1HP5A 7A3HA 1E15A 4MJ4A 2W63A 1U2YA 1UH2A 5ABEA 2WZHA 3SCTA 2XVGA 3GZAA 4QLKA 3EDEA 4UQ9A 3WMSA 2J78A 3I3EA 3UETA 1QI0A 4TTUA 2VQUA 4V28A 4GINA 3WKZA 1XSIA 5D8WA 4NI3A 4Y7EA 1JYVA 2WHLA 3N9KA 2E8ZA 3HJEA 1UD2A 4CUCA 2VCAA 2FH8A 4AC1X 3WBAA 5I2UA 1CNVA 2YDRA 2Y5EA 1UH4A 1TG7A 2DIJA 1H3GA 2A3HA 4H2CA 3T09A 1BYBA 3PTKA 4JAWA 4U5KA 4H04A 1VJSA 4BQ2A 2WC7A 4CD5A 4W8AA 3SCQA 4C7GA 2YDSA 2CBIA 3WF0A 2Z1KA 3G6MA 4GI9A 2HISA 4UOJA 4LPCA 1M53A 1JZ6A 4DUXA 4BQ4A 3F5LA 3ARRA 3THDA 5AY7A 4PMVA 1MFUA 4U3CA 3RDKA 1H49A 2Y4SA 4P7LA 2VQTA 2VZVA 1YHTA 1C90A 4X9YA 1Q6EA 3WF3A 4DWSD 3GNOA 3WFLA 2XFFA 2CKSA 3A3HA 2YLAA 4F8XA 1V6YA 2WSPA 1QNRA 3GBEA 2WVSA 1D2KA 2WCAA 2DT3A 2W67A 1GPFA 1VENA 5A6SA 5AC5A 1VJZA 4AYSA 3L4UA 3EDFA 5DO8A 5A1AA 3J7HA 1HN1A 3VVGA 4YPJA 5A95A 2ZIDA 3MUZ1 5BXRA 1F4HA 2UY2A 3N12A 2GJRA 3AIEA 2DPEA 2VRKA 1UG6A 2Y2WA 1MQQA 1QBAA 2XYLA 4LQ1A 4ZE5A 4V2XA 2XGBA 3WELA 3VTRA 1TR1A 5A6KA 5HPCA 1F4AA 2O9TA 3OB8A 1GOIA 4GO9A 3I3BA 4JHOA 2XIBA 3OLDA 2G3JA 1NP0A 3AIQA 1PX4A 4J3VA 5DT7A 5JIPA 4PUDA 1GNXA 1WDQA 1XRVA 1J0KA 4IISA 4CGTA 2ZXAA 1CDGA 1HKMA 2WVTA 1V6XA 1JXJA 5FL0A 1EOKA 3IAQA 4UQDA 1ISZA 2E9LA 4OUEA 1E6PA 3CHEA 4JIEA 3GH5A 4X0NA 1KQYA 3TTYA 2XUCA 2XM1A 2YBTA 3AQUA 2V3EA 1V0MA 3NDYA 1JI1A 2BY1A 1GOQA 3BXWA 4MNKA 4AWEA 2G3NA 3G6LA 1W1YA 2DT2A 4R5EA 2OYLA 2FH6A 3VD3A 2WVVB 2EEXA 3CHDA 1I1XA 4YN5A 1OGGA 2VX5A 4W5UA 4BQ3A 2YL8A 4PTMA 2ZX7A 1BHGA 5IXEA 2WWCA 4ML4A 2IUZA 4W88A 3U57A 1UA7A 4W7WA 5I0DA 2EJ1A 4QCFA 3QGVA 6TAAA 1DWIM 1PJ9A 3QHMA 3CHCA 4U2ZA 1YQ2A 1KCKA 1VFFA 2WCGA 1XD1A 3CZ8A 3CZLA 2CETA 4RE2A 2WK2A 2VTFA 3B9AA 4M8UA 3WD0A 4WKHA 5GNYA 1MXGA 1JDCA 1CGTA 4WSKA 5A6AA 5ABHA 5JBEA 1K9FA 5ABFA 4OIFA 1UKQA 3T08A 3PZGA 4MAZA 5DF0A 1BVZA 1MW1A 3U5YA 4AY1A 1GHRA 3ZJ6A 2VT0A 4MB3A 1QNQA 3ARXA 2YA0A 1JAEA 3SCSA 3A4WA 1XV8A 1R87A 4CKQA 3ZO9A 5I5RA 5FD0A 1R85A 4TX8A 2VX6A 4FLRA 2CXGA 2A3EA 4FLSA 3BSGA 3WNKA 4LYPA 3U7VA 4JKMA 1NOWA 1E9LA 2PWEA 3W24A 4AD2A 2W62A 4WKAA 4KMQA 1WAWA 2BVDA 4PMDA 3VPLA 1ISWA 1QBBA 3CZGA 2W91A 2WBGA 3KL3A 3ZJKA 2FHFA 3T2OA 2WYSA 2VI0A 4XB3A 1V02E 3PTMA 1VEPA 4ATDA 1KBBA 2EPLX 3RCNA 1H0IA 4UOZA 4JFWA 4X0VA 3NUKA 1H5VA 3SIMA 4U5IA 5BRQA 3BLKA 3N13A 1PAMA 1GQLA 5EB8A 2PWHA 4MADA 1BVNP 2WXDM 2OSXA 2G3MA 1ZBKA 2TAAA 2WMJA 1QI3A 4B9ZA 1ISYA 2D22A 4CN1A 3MUY1 3HN3A 4XV0A 2ZOXA 2JIEA 5A6JA 1OM0A 3KWXA 1J0IA 2DT1A 3IJ9A 1RPKA 3OBAA 2VZSA 1S46A 1UH3A 5D9PA 3OIHA 5EFDA 3W38A 3M6DA 3WNPA 1W2PA 2GK1A 1EQCA 4KRTA 4XX6A 1MQPA 1J0JA 2C0HA 1UD3A 3HU7A 1KR0A 4AZ7A 3MANA 3VMNA 1UWUA 2BS9A 3W0KA 4UFLA 5AYBA 1OWQA 3VMPA 5A8MA 3POHA 4D1JA 4P8XA 3AISA 1DWGM 1VFUA 1E5JA 1EO7A 2QMKA 4GXPA 4Q22A 1B1YA 3CZKA 2DT0A 5HBFA 1W3JA 5ABGA 4D6HA 1LJYA 3MO4A 5C71A 4HU8A 4P7QA 1JI2A 3ZT6A 3WL0A 2V3GA 1E43A 3PHAA 5E9AA 3GYCA 3SCUA 1XSKA 3AZSA 3K4AA 1RP8A 3WQ8A 4D1IA 1EGZA 4P7OA 5FCZA 1X6NA 2CKRA 1UA3A 1QOXA 1O6IA 1FH7A 4MAVA 4JFUA 1UR8A 1JGIA 3VNYA 3B9DA 3M07A 3CTTA 2BXZA 3KE0A 1V6VA 3ZR5A 5FOOA 1PBGA 1EHNA 3VIKA 5A2BA 1KXQA 1B0IA 1M7XA 4CD4A 4OOZA 1TFVA 4CU7A 3KEHA 3LPOA 1RP9A 3VGDA 4PBGA 2J7HA 5D4YA 3W27A 3M46A 4QAWA 1QHZA 1OD8A 2QHAA 1UR9A 3VILA 3SCVA 5A8OA 3IAPA 3SCWA 2PWDA 1D7FA 1GORA 1WZMA 2CPUA 1MVYA 1W9UA 2BVTA 1CECA 3TTOA 1BPLB 3PZIA 4AEFA 2ZX6A 4F9JA 3M7SA 1Q6GA 3VIMA 3UG3A 3K1DA 1CENA 4PN2A 4MPKA 3AS2A 3AIRA 1BGAA 1JYWA 1XH0A 1VFMA 5HDRA 4LX4A 3GDBA 3N04A 1FH9A 1E4NA 4OKDA 2WMHA 5GNZA 1UKSA 4W84A 2ZUNA 3FAWA 4H8UA 3UESA 2A3CA 2J62A 1HL8A 1J11A 4KRUA 4E4PA 4CVUA 1CGYA 2ZX5A 4IM4A 4DM2A 1QI2A 2FGLA 3D5HA 3WBEA 1KXHA 2J79A 1EIBA 3APGA 1QW8A 4TVDA 2Z1SA 1XD0A 4A4AA 4U3AA 1DWHM 1NH6A 3MSDA 1KBKA 1CLXA 2V3FA 1XC6A 2ZWZA 3WDQA 4JFSA 2YL6A 1WP6A 3WD3A 5BCAA 5KZ6A 5CSUA 1CGWA 1P6WA 3MV11 2CBVA 1M03A 5DT5A 2X0HA 2OSYA 2ZX8A 2FDMA 1E55A 2PWFA 3VM5A 1X6LA 4ZEPA 1AMYA 4WK9A 4KGLA 3WDIA 2VR5A 3CHFA 4NZCA 2XJ7A 3AMLA 1TA3A 1PX8A 4PTWA 2F8QA 2BV9A 4M56A 4J7RA 1IV8A 1J0HA 2YKKA 1Q6CA 3NSMA 1SR0A 2WVUA 3CO4A 5FKYA 3AICA 1NQ6A 2EQDA 5AYIA 4N42A 2YL5A 2ZUMA 1WE5A 5IHRA 1ODZA 4GI6A 1MWOA 3AS0A 5I78A 1G9HA 1JZ8A 3WNNA 4FLQA 3EBVA 4AD1A 4J3WA 3U5UA 4AEEA 2XHYA 1OIMA 3BMWA 2XM2A 3SCNA 5GNXA 4Z2HA 1FOBA 1VBUA 1CTNA 2YL9A 4EE9A 4C7FA 1JD7A 2VRQA 2VRJA 1QW9A 4ACYA 1TMQA 1C3FA 2BY2A 3WH7A 5CJ5A 1DHKA 4D6GA 1NARA 1K6AA 1ITCA 4MJ2A 3ZJ8A 2WB5A 3F5KA 2XVNA 4Z2KA 4ZXLA 2ZUSA 2D2OA 3ARVA 5A6BA 3VOCA 1HJXA 1NWUA 1MW3A 1CZ1A 1HKIA 3UR7A 3ZT5A 2JEPA 1W3LA 3K46A 1HP4A 5TD4A 2ZUTA 3GBDA 1LQ0A 2YIHA 1B3ZA 1V6UA 5GQBA 3A6OA 3D3AA 2OYKA 2E9BA 4EAMA 1TVPA 1NP2A 2VOTA 4HOXA 1R86A 5LA1A 4HPHA 2CNCA 4CN4A 3EMZA 2J8GA 5D8ZA 4CVWA 2O9OA 1ITXA 4YHEA 3VMOA 1EH9A 2G8ZA 1V03A 4PTVA 1W9VA 4HOWA 3T0DA 1BYAA 1HIZA 1V3KA 2X05A 3QOMA 3AXHA 1CXFA 4AZIA 2RGLA 1QI5A 3L4WA 1XSJA 1CPUA 2QMJA 1KWGA 5DFAA 5F7UA 1BQCA 1UKPA 2D0HA 1C91A 3GXIA 1QHPA 5LA2A 1EDGA 4DWSB 3CH9A 4L4PA 4TXEA 6A3HA 2E0PA 4UZSA 1C7SA 2WMIA 2WNWA 3CZJA 4UFJA 4PTXA 1UR0A 3WN6A 1NWRA 4J27A 1TCMA 3ZOAA 4W7VA 1C8QA 1OINA 4K68A 1JZ7A 4PCTA 3CBWA 3WL1A 4NF7A 3CIVA 2BXYA 4W85A 1CWYA 1E4MM 4NSBA 4W7UA 1CGVA 1J9YA 1BAGA 1WDSA 1K9TA 3BAKA 3ZMRA 1G5AA 5I3DA 4S3JA 3CUGA 4M82A 3AROA 3PZVA 1V02A 2XIIA 4PYSA 1UWIA 4UQAA 5BXPA 2UWFA 4HMCA 3FHQA 2AMGA 1W91A 4CCEA 3VDHA 4QDMA 2W92A 4UNIA 2OWWA 1VF8A 3VM7A 3AXXA 2WHJA 4A3HA 3L4ZA 5IDIA 1NWTA 3ZQ9A 3ZSTA 4E8DA 4AW7A 2B31A 1MYRA 5A94A 4L4OA 1XGZA 4B9YA 1H41A 5IFPA 3DHUA 2DDXA 1VRXA 4AD0A 2D24A 1BTCA 4JKLA 4RL3A 5LA0A 1HJVA 3ARYA 5I79A 1G01A 1B9ZA 4PMXA 3K8MA 1E73M 3ARWA 5BWFA 2WMKA 1ZS2A 5ECUA 4GZIA 3RM9A 1GW1A 3WMCA 1PPIA 1EOMA 3KZSA 1VBRA 1B3WA 1JF5A 5CLWA 4ATLA 1JXKA 2VCCA 3BAJA 2ESCA 3FW6A 1C93A 1E6NA 5KEZA 1Q6FA 1ODUA 3WUGA 1JZ5A 1LWHA 1FHDA 4PMRA 2W4XA 3SUSA 1MFVA 1HKJA 4IPNB 1WZAA 2DGAA 3AIUA 5D9OA 4GZJA 4TUFA 2YLLA 2HVMA 5IHSA 3MS8A 2OYMA 2NT0A 3ALGA 2VC9A 2E3ZA 5A6LA 5CLTA 4PMQA 5BROA 3WDPP 3DYMA 5E6YA 3ARSA 4M24A 1VAHA 1HF6A 3FHAA 1GOKA 1DWJM 2ZUWA 1QVBA 2W66A 2BVYA 1E6RA 4GKLA 4B3LA 3BCDA 1C8YA 2ZXDA 1ESWA 1GQKA 2J77A 2VUYA 1W32A 3WNLA 1PZ2A 3CUFA 1U30A 2YJQA 2WHKA 3W53A 3AI0A 3BLPX 4CCCA 4CU8A 3AZRA 3GXFA 1PX3A 1DEDA 3NSXA 1JFXA 1K9EA 1OT2A 2ZWYA 3AMCA 4AZCA 1UD5A 1WDRA 3UG4A 1H4PA 1HXJA 1SYTA 2JEQA 2NW0A 1FH8A 3RO8A 4H8HA 2GDUA 1G1YA 4W86A 3CMGA 3WH5A 2GJXA 2PF0A 5M5DA 2WLYA 1UR4A 4AIEA 2QPUA 2Y8VA 2F61A 5JBFA 1GOOA 1E4LA 3K8LA 5E6ZA 2BFGA 3ZIZA 5BXSA 2A3BA 1QPKA 3VIJA 4GQQA 1EDTA 1HL9A 2VVSA 3VUPA 3VGBA 3GH4A 1BYCA 3S6TA 2X0YA 1LG1A 1R7AA 5FIPA 2J7FA 4HP5A 3VDBA 3SCRA 2WW5A 2JE8A 5BXTA 3WD2A 1E0VA 1I75A 3GM8A 1SMAA 2XPKA 4UQEA 3WQ6A 2W5FA 4Z2IA 1V08A 3LPGA 1QI4A 7CGTA 5BRPA 4QLJA 5JBDA 1PZ3A 2MANA 3W6MA 2Q8XA 4C7DA 3K8KA 1W9XA 1QNPA 3DYPA 3BC9A 1BYDA 1CXHA 4AZ5A 3TONA 3IANA 1UUQA 3NJ3A 1OGSA 4UFKA 1X1NA 3AHVA 4KH2A 2WPGA 1ZB5A 4F79A 1N82A 2WMGA 2NSXA 2CBUA 1J0ZA 2BY0A 1UWQA 2CBJA 2JFEX 3W29A 4XZWA 3GNPA 4KWUA 4DM1A 1JNDA 4CN6A 3VIGA 3GXDA 2J74A 4PMYA 3VGEA 2DQXA 2D3NA 4JL2A 5CQ1A 3AMGA 3AOFA 1V3LA 1W3KA 5A69A 2YA1A 3SURA 4PMZA 2XWEA 3S2CA 5A6MA 3VO0A 3PZ9A 1E56A 2FHBA 2J75A 1GUVA 5HPOA 1PEZA 4AMCA 3VX1A 2J7BA 4IPLA 4H41A 2J7EA 1BG4A 2JF7A 4GZEA 1HKKA 1KXTA 5DMYA 2OWCA 1E1FA 3DHPA 4CD7A 4BS0A 1PIGA 1HJWA 4AZGA 3SCPA 1UR1A 1WB0A 2Y8KA 2D20A 3OGSA 1XYZA 3WH8A 2UY5A 3WQVA 2D1ZA 5A2CA 1GOMA 5A8QA 4HZ8A 4A3YA 5FL1A 4CD8A 1KWKA 2JF6A 4V27A 3T0BA 4E8CA 4DUVA 4WF7A 1PIFA 1V0LA 3BAYA 3IJ7A 3RJYA 3TTSA 1HJUA 5A8NA 1OT1A 4YHGA 1V0KA 3FNDA 2ZXQA 1R7OA 8CGTA 2DEPA 1GOWA 1DP0A 4MNMA 3TOPA 1XHGA 4D6IA 5E0FA 3L4YA 4ZE4A 1EA9C 5A2AA 1E3ZA 5CZKA 3DYOA 4CD6A 4F66A 1HJSA 4AZBA 2IXVA 2VZOA 1FA2A 4HZ6A 3SUWA 4DWSA 3BSHA 1IZKA 3N18A 1UZ1A 4JFTA 1XCXA 4HMDA 1H2JA 3VD9A 1L0PA 3NYDA 1UKTA 2J7GA 1E5NA 4U33A 3SUUA 2O92A 2XTKA 2ZICA 5A3HA 4TVCA 3CMJA 1HJQA 3MKKA 4TOQA 3WNOA 4W5ZA 3WEMA 1BSIA 3K4DA 4NRRA 4MB5A 2WKLA 4U2YA 2E9MA 1E0WA 1KCLA 1ZBWA 2F2HA 2J7CA 2VZUA 3VIOA 3MV01 3FY1A 2BHUA 3BAIA 4PMNA 2VR4A 5CSYA 1SMDA 4AIOA 3VKKA 1O7AA 3L4VA 1HVXA 2XFYA 1US2A 8A3HA 3DECA 2YBUA 1V3HA 2WCSA 3EDKA 3RPMA 3OLIA 1A47A 5E70A 3UEQA 1CBGA 1RH9A 3AYSA 4UQCA 4Q7NA 4UFIA 1JIBA 3ARQA 2UY4A 4P7NA 1CYGA 2VX7A 1B31A 1GCYA 3NDZA 3UERA 1XH2A 3OLEA 1C7TA 4ZFMA 4JFVA 3WIJA 1J0YA 3A4XA 3MUAA 2X2YA 2WVVA 4R27A 2GK1B 1GONA 1ZJBA 2EXOA 2GFTA 1A3HA 5I77A 4AD5A 4MTVA 2VVNA 2VO5A 4UFHA 4MB1A 4MB4A 3OG2A 2V38A 4JL1A 1JDAA 4OBRA 2WM0A
chains in the Genus database with same CATH superfamily
3WQOA 4ADTA 3OIXA 5HR6A 2ZZ2A 3AUJA 4WHBA 2E40A 5G1MA 1JULA 3GIPA 1IT0A 5D9NA 3RG6A 4LAZA 1KFCA 2PGRA 3VNIA 1H7RA 2YDAA 3PBUA 1H63A 1HNYA 4DUWA 4NYYA 3EDDA 3LHZA 1HX0A 5ENLA 1J6OA 1XUZA 3TLLA 2NUWA 4MKNA 2FFIA 3ZVHA 5TAOA 3UNTA 2A3AA 1TWSA 1DQXA 1N7KA 4M19A 4UTLA 4GNJA 2Z6JA 5GPRA 4BR1A 2DV0A 3BLDA 3USZA 4LC8A 2EPOA 3O6YX 3NQ7A 3WLQA 2VNCA 2XG9A 3NQFA 1ME7A 1E1EA 3AYRA 1HL2A 4Q4MA 3WDJA 4JZ5A 1QMLA 3S2NA 3O8AA 1YYAA 3THCA 3V0UA 4WZHA 3GFZA 2PCQA 4FNUA 5G1TA 1REQA 3ABSA 4BF9A 4C6EA 1TWIA 3N19B 3GXTA 4N6EA 2GDVA 2H9AA 4NIRA 2BX7A 4P2VA 1LRNA 4H1ZA 3T4CA 3SEPA 4Y2WA 2PWGA 1E6SM 1FP9A 4M7SA 5EBAA 2GSEA 1OC7A 3O6CA 2QQ6A 3DFPA 5IRPA 3ITCA 2GVYA 3WQ4A 3QSTA 1US3A 2ZBTA 4IZGA 4TQTA 1H7OA 1MEIA 4NKCA 5C55A 1Y5WA 4ZXOA 1UWRA 3PANA 1DJGA 3N17A 4OZOA 4RZ5A 5HQMA 1TMLA 1UP3A 3ZR6A 1EXPA 3G1FA 3LPPA 3E0WA 5E0CA 5EBUA 2WAGA 1OIFA 1YTKA 3TTQA 2X41A 3LOTA 1E9IA 1EF2A 1PDZA 3DC0A 3UT0A 3HMCA 3AWNA 1JZ3A 5HANA 2UV8G 3DHDA 1UOZA 3VD5A 3WBYA 2OT1A 1LUCB 4ADSA 4IMEA 5BYWA 5GVJA 4P8VA 5I06A 4P5UA 4KF1A 3LV6A 4QG8A 4MZ8A 1GT8A 4JTCA 1KRMA 4EAYA 2DORA 1BRLA 3W88A 1A4LA 2R1KA 2Z1XA 1WUEA 1PYFA 3GNDA 2D3LA 2VYOA 1ZP4A 3UVIA 1U5JA 1JCNA 2HWGA 1TZZA 2X1UA 3VGGA 5H8PA 3AHYA 2VR2A 3AIVA 3DG3A 1TA3B 3OVRA 3OA5A 4FNPA 1OF6A 2Y88A 3H70A 1FWTA 3FJ6A 4DEFA 5D04C 1R9YA 3WQPA 2X8RA 3M4HA 3OLGA 3SSZA 4KETA 3T55A 4WSHA 2L5HA 3UYIA 4WSJA 2CEQA 1DXIA 2FIQA 2VDHA 3UZJA 1EJWC 1VCGA 3WH9A 4NYUA 1Q5MA 1SVDA 2ZRYA 2ADAA 3SCOA 2QR6A 3GTNA 4XUGA 1E4IA 2CESA 4XZHA 3BAWA 3CZEA 3NQDA 4NJHA 1JNEA 4TX6A 2ZZ4A 3WF4A 1OF8A 4OUIA 3WH6A 4JIHA 1W1TA 2FPYA 1XQLA 3PPHA 3UFYA 2DH2A 4ADUA 4LAKA 3AYVA 1PUDA 4WJXA 1NFBA 1RPXA 2GVLA 1KFWA 4GIEA 1E6ZA 2FVMA 5HWJA 1C92A 1KKOA 4ZTYA 3PJTA 1ZFJA 4XZLX 2AAAA 2UZ9A 4LFYA 3TEVA 3WDHA 4QP0A 3AUOA 1ADOA 4PCPA 4MLJA 3FGCA 1OD0A 3CS2A 3STEA 1AD4A 1KTNA 1N8FA 2HE8A 2NV2A 2E77A 1G94A 3PM6A 4ZQOA 4W93A 3QHOA 1QATA 2YDQA 2HTMA 4NY2A 1MW0A 2XVPA 4AB4A 3M5ZA 4UQBA 5JXQA 5LNRA 1FCQA 1TPFA 1IXOA 4AXNA 2NWRA 3U2CA 4JN7A 3UA3A 1KLZA 1CEOA 2XVLA 3PZNA 5M03A 4H2HA 3S47A 2PBOA 1I1WA 2R24A 1U5HA 4BF7A 3FX4A 3O6DA 2WMIB 5D09A 3ARUA 3QW3A 4HNTA 3DGBA 1BVWA 3WEZA 3AXIA 2ZX9A 4OOUA 1KRCC 3TWAA 4DF2A 3TW9A 1R3SA 4V1XA 1SJAA 4UTWA 3VDCA 3BICA 3RN6A 3P0XA 5I3KA 4JCMA 3AC0A 1Q65A 3NQAA 3BJSA 3KM8A 4IFOA 3H22A 4MWAE 3ICJA 2P8BA 2AQOA 4AZHA 5LIXX 1FXPA 3AS3A 1G6CA 1B4KA 4H9XA 2Z6IA 4C6DA 1DV7A 5M17A 3CPRA 3VD7A 1OG0A 3S5YA 3CUJA 4GX9A 1K8YA 3L12A 2GSJA 2BB0A 4X9SA 4EIVA 3MVIA 4ICMA 5DBUA 3B9EA 4QSFA 4K38A 2FZMA 5FJTA 3A4AA 3PZOA 4B3KA 4O0KA 1G0CA 4CEUC 1KM4A 3RCMA 2ZA1A 1PXGA 3UR5A 4JQ1A 1UWSA 3RU8X 1JF6A 1J8VA 4AFYA 4J35A 5HNNA 3A5FA 1D3GA 3NPVA 4Z17A 1XYCA 3VOFA 3I3DA 1PVNA 3KVJA 1R8LA 5EMYA 1T0OA 3FSUA 3CYJA 3A9BA 2ZZ6A 3QPYA 3SDOA 4R7JA 2O9RA 1EL3A 1E9ZB 2Z7GA 4ZO7A 3VKBA 1VH7A 5I23A 1LRTA 2E8YA 3GH7A 3RF9A 2TSYA 2X40A 4LAUA 3W86A 4DHGA 2DSVA 1CXIA 1SZRA 3SECA 1W8SA 2IQDA 4Z2LA 4FLOA 1JCLA 1QPOA 1LBLA 4XKYA 3MMTA 3V1PA 1YNYA 4S23A 2VX4A 3PZTA 1ZBCA 4F9DA 4Q8QA 3NGFA 3WD1A 1CXEA 3KCLA 2VFHA 2QW5A 4F2BA 1JYNA 3WSUA 4WLCA 1WXJA 4Q4PA 5D33A 7REQB 1MRQA 1G4TA 4NHVA 2VGGA 4L6OA 1L2UA 4F0HA 3RILA 1X8CA 1ZU8A 3KXQA 4M80A 4I8YA 1J10A 4OVXA 2C7FA 1I4NA 3AIBA 3WNMA 2GJXB 1ZJAA 3GNNA 1AJ0A 2BOGX 2BNJA 3UXIA 1EO5A 1NF7A 4RE0A 5FEZA 4ZENA 4ZQNA 5KINA 2PRMA 3HPZA 4PUJA 3ZJ7A 3W2NA 1N55A 1L2QA 2OSWA 1WAUA 4MUZA 5CG0A 4D6JA 2SFPA 1WQ5A 4TMCA 1M04A 5LHEA 3C3UA 5CJNA 1VKFA 4J3UA 5CXPA 3WJSA 5C7HA 1XIGA 3Q58A 4LVBA 1JDEA 3ZSSA 4GQGA 3O1NA 1QK0A 1ZAJA 1JYXA 4CQCA 2XGIA 4HNCA 3U7BA 1L8PA 1V79A 4O19A 3UNDA 3W7EA 4C6QA 1F73A 3I6RA 3GC5A 4UQ9A 5EGRA 4IGMA 2J78A 3B06A 3P5YA 2VQUA 1YDOA 4GINA 3NL2A 3R8RA 3MHFA 1OZMA 3HJEA 5CZTA 3OTRA 4JQ3A 4HVXA 3WZ0E 4NXKA 2PLKA 2Z25A 5CBIA 3DESA 5I2UA 3LZ3A 1R3TA 1H3GA 2P3ZA 4F0LA 3ABQA 2FZ9A 1PTGA 1VJSA 4IPIA 5AZ1A 4CD5A 3GSMA 4UIOA 2FJUB 4QHRA 3G6MA 3OZMA 2PMQA 2RJHA 1U1HA 1MEHA 3GAYA 1U5VA 1YXCA 4JYFA 1JZ6A 3N14A 5D37A 4O52A 5BW6A 3M64A 5FI8A 2CZVA 4WDUA 2HRWA 3QFEA 2WNQA 3BOXA 3R43A 4F4RA 4HN4A 2CC0A 1YXDA 3SFKA 1FKWA 2YGYA 1TWZA 4QDPA 1KV8A 3S1UA 3G0XA 2ZE3A 3A3HA 1A49A 5DY2A 5CBBA 1HGWA 1V6YA 2A7PA 1VS1A 4QNWA 5T9CE 3MKCA 4Y96A 1GPFA 5AC5A 5A6SA 3EDFA 5A1AA 3VNDA 1RD5A 3VVGA 2I5QA 4BWLA 1Z6KA 2BBFA 1XW8A 1XIIA 3IS4A 4HCLA 2WQPA 4KFOA 1M5WA 2GJRA 4C1NA 3AIEA 2VRKA 2Y2WA 4E4UA 2E28A 1QBAA 2NQ9A 5AC8A 1XP3A 3DI1A 4WVXA 4QJ5B 3NPXA 5HPCA 1F4AA 3GHSA 1GOIA 3WK1A 4JHOA 4B4HA 2XIBA 3M43A 3REQA 4ZODA 1NP0A 3AIQA 3MP4A 3BDKA 2Z29A 4J3VA 2F7FA 1R0MA 1K77A 3F4CA 4IIGA 2F6KA 4E8GA 1TPEA 4IPJA 2TMDA 3G1DA 3QKZA 2ZXAA 2Z28A 2NQZA 2QCDB 3W7MA 2QYGA 3CXOA 3IAQA 2DZWA 4D9PA 3TUUA 2R8WA 1KQYA 3AQUA 3NDYA 1JI1A 2BY1A 5HINA 4MNKA 4DXVA 3G6LA 2DT2A 5K4ZA 2WVVB 3CHDA 4BQ3A 4MWAA 3SGGA 3GG1A 4PTMA 2IPWA 1XX1A 1H7WA 5I0DA 4QCFA 3QGVA 4LTSA 1AG1O 2HVNA 1VPQA 3CHCA 1KC7A 1FWRA 4NQ1A 1KCKA 5LSMA 1VFFA 4WX2A 2OR2A 4RE2A 4JIQA 1F9CA 2BMBA 4WDTA 5GNYA 3KBNA 3KS5A 1MXGA 1UJQA 4ZTXA 3GXNA 5ABHA 2ZRUA 4OIFA 3PPCA 3SY1A 1MW1A 3U5YA 3ZJ6A 1CX9A 1QNQA 3YPIA 1XV8A 2TPSA 1R87A 5JH2A 4CKQA 2ZA2A 4FOUA 4TX8A 4H83A 3W87A 4L56A 2QUNA 5G4EA 4A8NA 3GWQA 4AD2A 2W62A 3DCPA 3FJNA 4QIUA 4EF9A 2BVDA 4AXKA 5BMXA 4C6KA 3S5NA 2W91A 4KWOA 1YTDA 2WBGA 3FVDA 3KL3A 4NJJA 3QFWA 4JDBA 3PS7A 4BFAA 1UPMB 1O1HA 2G37A 3T7VA 1KBBA 2EPLX 3RCNA 4GWEA 6PTDA 4FZIA 4UOZA 3ITLA 2IQ0A 4L7ZA 4U5IA 5BRQA 1GQLA 2V30A 5EB8A 3HFTA 2I1OA 2HXUA 4JTIA 1G4EA 2G3MA 2BLEA 3L66A 4B5XA 1AH4A 4B9ZA 3GW3A 1YBQB 4XK2A 5HQEA 4CN1A 2RDTA 4XV0A 2NVCA 1D8WA 3IIXA 1SFJA 1TTJA 3KWXA 3JS3A 1OY0A 4GJJA 1RPKA 1JQVA 5HMSA 2HNEA 5D9PA 1Z48A 5E9XA 3TWBA 3W38A 3W22A 2YYTA 4JIRA 4OQVA 1Y5VA 1MQPA 1J0JA 3BJFA 3JZUA 4DX3A 4PEKA 1KR0A 4LBUA 5XINA 3S6DA 1UWUA 3W0KA 5IBXA 1XICA 1S5VA 4D1JA 2IPJA 1VFUA 1EO7A 2FPVA 3IRSA 4Q22A 4GVGA 2Y7FA 3URAA 3G22A 1W3JA 1S5WA 5ABGA 3MO4A 5C71A 3B40A 4HU8A 1GKRA 3IV8A 4PCFA 3PHAA 3SAZA 4JY8A 3SCUA 1TB3A 4G5DA 4D1IA 1X6NA 1MSSA 3GX9A 1QT1A 4MAVA 1M9HA 1I60A 3HJZA 3RX4A 1MUCA 3A64A 3TTEA 1RJQA 2Y63A 3VNYA 2BXZA 2V81A 2BGSA 4JTEA 1PBGA 5DY3A 1M7XA 1IWBA 4OOZA 4PUKA 1TFVA 2Q8LA 4HHLA 1DJWA 3LPOA 1YPXA 3CTLA 3VGDA 4PBGA 3R58A 1IWPA 1O60A 1QHZA 4F48A 2QHAA 3VILA 3SCVA 6REQA 3C61A 1KFJA 1D7FA 2CPUA 1WZMA 4I3GA 1W9UA 1F2JA 1GWJA 3BCJA 2YZRA 3A23A 1BPLB 1MRAA 4AEFA 1XLJA 3GU2A 1PKNA 4FIRA 4MPKA 3AS2A 2PURA 3AIRA 1BWKA 4S2BA 1NDZA 1IEXA 4LX4A 1A5SA 1UIPA 3RLGA 3W2JA 1FH9A 3G8EA 1E4NA 3N2CA 5FJUA 3BW4A 3H2NA 4I6VA 3N3MA 4BJHA 3ME3A 1VIZA 5CAKA 1GVQA 4E4PA 3SW6A 3VI2A 3LYEA 3QV8A 2ZX5A 4IM4A 4DM2A 1WBJA 4TVDA 5HJYA 3GKFA 4IFKA 4A4AA 2OT0A 1A4MA 3MSDA 3QLLA 3KDOA 2VEKA 4LVDA 3E0IA 1A5AA 4EACA 3BQ6A 4K7YA 1WP6A 1H62A 2QIWA 1SFLA 1LOSA 1XIEA 3ZXWA 4GYJA 4MJMA 2CBVA 5CPNA 1TVLA 1Q6RA 5T8GA 2QUUA 2PWFA 1NDWA 3EXSA 4AX6A 5FJJA 3T0TA 2DUAA 4B4FA 1YIXA 1J2WA 2XJ7A 4GXWA 2AL2A 3LQGA 3UJRA 3LB0A 2J8TA 1CB2A 4IGHA 2PU0A 1ONEA 3CO4A 1UC4A 2W27A 1X7IA 2X1RA 2YL5A 2ZUMA 1WE5A 4N42A 1MWOA 3EBVA 5D03A 3U5UA 3EOSA 1OFOA 4AVNA 3H2OA 1ONRA 2XN1A 1EP2A 3AXMA 4A2SA 4YTTA 3BE7A 2FMNA 1NFPA 4X3ZA 4KCUA 1TV2A 3W7PA 4I7VA 3FEQA 2XSXA 3MKVA 5EA9A 1ZJHA 2VRQA 3V35A 3UY7A 4O13A 1UP0A 3JR2A 2XH2A 1W1A1 1QW9A 2ATMA 2BY2A 3BQ5A 2PDFA 1NARA 4MJ2A 3M5YA 1AJ2A 4DY1A 3W7JA 4QEHA 1PIIA 2D2OA 2FZ8A 1LQ2A 3ZLHA 2Y1HA 5DMNA 2JEPA 1W3LA 3HGJA 1HP4A 3SRFA 2FTWA 3I6TA 1LQ0A 3H24A 3G1YA 3QYQA 9RUBA 2E9BA 4EAMA 1TVPA 2VOTA 1KM6A 4HOXA 3T07A 1R86A 1KFKA 4S2CA 4HPHA 2CNCA 3S1WA 3EMZA 1EWDA 3FDKA 1PCKA 1V03A 4PTVA 1W9VA 1RY0A 1BYAA 3T0DA 1V3KA 2ZDSA 3AXHA 3UR2A 2CWNA 2ASHA 2QMJA 1KWGA 1EC8A 5F7UA 3FXGA 1YNQA 3I4EA 3WJWA 4PZVA 3G18A 3W7KA 1UZDA 2NQ5A 1HGYA 7PTDA 4YIWA 2WNWA 2WOQA 3DKJA 4UFJA 4PTXA 3S8HA 3E96A 5T26A 1TCMA 3LCGA 1C8QA 3QY8A 3O15A 3CBWA 3WL1A 2BXYA 4W85A 5MF5A 1CWYA 4MSSA 3LA4A 1CGVA 1BAGA 3MTWA 4DJDD 3ZMRA 5I3DA 1O68A 4L1WA 3TKFA 1G4SA 2XIIA 5BXPA 2UWFA 4HMCA 3WX7A 4GBUA 3LLXA 2X30A 1W91A 2C13A 4CCEA 2Z26A 3GVVA 1O66A 3E9AA 1LZOA 3THAA 3TJLA 3TAKA 2QJNA 2E5CA 2Q8ZA 4L9ZA 3NXFA 3K2GA 4REQB 1H41A 4I5XA 5LNVA 4UMBA 2EG8A 3KBSA 4RW3A 4JKLA 4JNZA 2BSLA 1Z89A 3HM7A 3NQGA 5I79A 5BU9A 1B9ZA 4PMXA 3ARWA 3NG3A 2WMKA 1ZS2A 4D8ZA 1L6YA 3RM9A 2YBVA 4JQAA 1EOMA 3FS2A 1K7FA 1B3WA 1BKSA 3E2VA 1JUEA 4ATLA 2W6RA 2ESCA 4ZO9A 3QQWA 3VZXA 3PJUA 4X61A 4H3DA 2Y70A 3L2IA 3T1GA 1UP2A 3CK5A 1XIHA 1XI3A 1QJWA 5DLCA 1R3YA 4B5VA 4KEZA 5D32A 2DGAA 4GZJA 3CIXA 4YCOA 2ZRXA 2I56A 4DBSA 3PJWA 1L6GA 3GAKA 2NT0A 2PP0A 2VC9A 5D38A 4ZVJA 4RV3A 2AKMA 3IVUA 3E38A 3K5XA 3QM3A 2VEMA 4OV9A 4INFA 3VFLA 4XKMA 1HF6A 3VKAA 1GOKA 3U0HA 1IGWA 1BF6A 2BVYA 1SJDA 2OMAA 5RUBA 4J9JA 1ICPA 2OB3A 4HHPA 3QF0A 4GKLA 4O8RA 3KHJA 1J93A 3SJ3A 4IWWA 1KW1A 2J77A 3SY8A 1V8EA 2OFJA 3N2BA 2YJQA 2XZ7A 3BLPX 4CCCA 3K13A 3AZRA 3NM1A 3NSXA 1JFXA 1VJIA 3VZYA 2ZWYA 1M7OA 4AZCA 1XGDA 3CV7A 3WJXA 4YLWA 2NQLA 2CLOA 2NW0A 2IKGA 1IT8A 4HU4A 2GDUA 3U9IA 2DZPA 4HBKA 4AIEA 4MIMA 4GNVA 2F61A 1E4LA 3BARA 2BFGA 4O1DA 1XRSA 3H2MA 1EZ2A 3SCRA 4AEOA 2WW5A 4WGXA 3WD2A 4D8AA 3IJLA 5LHFA 3GM8A 3I65A 4E6MA 2TYSA 2XPKA 4JEQA 3W2LA 5LNUA 3TYAA 1YKWA 5D2VA 3QRHA 1QI4A 3H54A 4LSBA 3UJFA 4UBPC 1GVOA 5BRPA 4LALA 1PZ3A 2J6VA 2ZRWA 3HG2A 2Q8XA 3DYPA 3IANA 1P1XA 1OGSA 1LT8A 1Q6LA 2W79A 4Q4RA 1XLMA 4KH2A 1IYXA 4BI7A 4J5NA 2NSXA 5AYXA 3BK0A 3PULA 3MA8A 1JNDA 4CN6A 3VIGA 3VGEA 2GGHA 2J13A 4JL2A 3EKLA 2HE5A 4M6UA 1W3KA 5A69A 3SURA 3VO0A 3NNTA 1PEZA 3OHMB 4GZ7A 4AMCA 3W02A 5CKSA 2J7BA 4H41A 2J7EA 1BG4A 2JF7A 1Z8AA 5DMYA 4NILA 1E1FA 4RR4A 1AMKA 1QOPA 1RBOB 2DUZA 1EJ7L 4NI8A 2PDCA 2DFAA 1XG3A 4QDWA 5TIMA 2D1ZA 5A2CA 4IGSA 1AD1A 1SW3A 4QS6A 3GXPA 2JF6A 4K1GA 3UJEA 4WF7A 5BU6A 4ZSTA 3RJYA 3LHVA 1OT1A 2OU4A 2PEVA 2IPGA 5D30A 4YHGA 3NM3A 4YTQA 1R7OA 2DEPA 1W5NA 3UYCA 1DKWA 4O15A 3TOPA 4DJED 1XHGA 5DMLA 5LXXA 1SGJA 5A2AA 4HIBA 3MJYA 1E3ZA 5CZKA 2HK0A 3DYOA 1HJSA 2IXVA 3M1ZA 3JZEA 3BWWA 4DWSA 3NGJA 3HQ1A 3SUWA 5B7ZA 2ANUA 1POJA 4IX0A 4E2DA 4JFTA 4OHQA 2POTA 2YXGA 3RCYA 5DN1A 1L0PA 3NYDA 3S4TA 4U33A 2O92A 3STCA 4XSLA 4O16A 3PK7A 4KT2A 1FDYA 3CJPA 2A21A 2E5DA 4JIIX 3MKKA 2OKOA 3ABZA 3K4DA 1JRCA 2Y5JA 2WKLA 1NSJA 3FYOA 2XIQA 2VZUA 2ICSA 1ZBWA 3LRMA 2J7CA 3CUXA 2HJPA 1IGSA 1E1CA 3M5VA 3FY1A 1R38A 2VR4A 3HOJA 4AIOA 3VKKA 1O7AA 2XFYA 3L5LA 2FDSA 3W6YA 3BOFA 2P0IA 2QULA 2DZSA 2CFFA 1XDMA 2DW7A 2CLKA 1J5TA 5E70A 4IHCA 3W85A 2VD8A 1RH9A 1XLLA 2PWUA 4IQLA 2GLKA 4UQCA 3B3DA 4ZB5A 2MUCA 1NY1A 2VX7A 4MMWA 3UGRA 1XH2A 3OLEA 1FUYA 3W2MA 3WIJA 3A4XA 2BTMA 1EUNA 4J1OA 2GK1B 4ML9A 1A3HA 4IIDA 4U4MA 2YCLA 5I77A 4PC8A 1S1RA 3CT2A 3MSYA 2VVNA 1TX0A 2VO5A 4UFHA 3PAJA 4O1CA 1W1PA 2CWXA 1W9BM 4X2PA 3NTYA 4UZUA 1B2YA 2P1FA 3W28A 3BURA 5EMKA 2AOSA 1M65A 3OBKA 4WGHA 2ZTJA 4R33A 3N6JA 4PUEA 1QTWA 2WZIA 3MUIA 3IIPA 4P8WA 4WKFA 4F0RA 3E3HA 1EXBA 3AIWA 1U1UA 4K6AA 1UWTA 1H11A 2OELA 4KPLA 2A2IA 4NAEB 6ENLA 2OEMA 2AGTA 3L4TA 3Q2DA 2DSWA 3UXAA 2DZBA 4YTRA 1BGGA 4JD4A 1IT7A 3MI2A 3DG6A 1IXQA 5CPSA 2JALA 3ZT7A 3HV8A 1E3XA 3QZAA 5FAGA 5ABTA 4C6MA 7TAAA 2VC7A 2W3ZA 4S39A 1JEZA 2VJXA 1TPWA 3EPMA 5HOSA 1UD8A 3B8IA 3QPEA 2CERA 4Z1AA 3NQ6A 1RZMA 5TNVA 2EAWA 4DELA 5G5IA 3WLMA 3R94A 3VINA 4LY4A 1XM3A 3HPXA 3W7DA 1TJPA 5AYYA 3CUIA 3NA8A 3EOEA 4NT0A 1O5XA 2R1PA 3TN3A 1K8XA 4AISA 1XFBA 3D46A 3W4RA 2PC8A 3KFTA 4GI8A 3VIHA 3GR4A 3WDRA 2YSWA 4JQ4A 4WY0A 1IF2A 4JGDA 5CGQA 2JIWA 2HDJA 2ZUUA 3DFQA 4XD3A 1TUXA 4HU0A 1OGBA 4D72A 1Q63A 3VNZA 3QR3A 3QV9A 1LORA 1VFSA 3GRIA 2XSAA 1XCWA 4HTYA 4W4QA 4ZOEA 2QDHA 1MZHA 3PN8A 3W3OA 4UTFA 1BFNA 1JDDA 5EY5A 2HEJA 3UG5A 3WG6A 4XZ9A 3RRXA 1HUVA 3N9RA 4ZQPA 2Y7EA 4GISA 3N6QA 2FJKA 3W07A 1A5UA 1XLDA 3L21A 4J2PA 3MWAA 5CPOA 1ISXA 1PDYA 2QF7A 1RY8A 2FPTA 4P8UA 4ZA0A 3VDAA 2FZBA 2H8ZA 1E71M 3MUCA 3P93A 1UQZA 1OCQA 1WXZA 2QDEA 1F6YA 3MY9A 2WJEA 4I9TA 4UXDA 1R46A 3EWZA 3L4XA 3V0SA 4OU1A 3FJ4A 4FSAA 2YCJA 1CGXA 2IQTA 3W26A 1BLIA 1TTPA 3USBA 4LYRA 1BXCA 5DEZA 5DMMA 2CLFA 2G41A 2D23A 5LIKX 1W56A 3VIFA 4UR8A 4OTKA 3W82A 1AK5A 3E02A 5AKQA 4WCJA 2EBNA 3HIJA 5BRBA 4AF0B 2ZVIA 5C0QA 5DRCA 3RPDA 1TE1A 4CNTA 1CGUA 4PEEA 3W81A 2VWSA 3BSMA 4MYAA 4NVTA 4G7EA 4Q4KA 4H4IA 1J79A 4PRTA 4F40A 4FMVA 4TTGA 3EMCA 5D9MA 4UWMA 4GVIA 5LGZA 1ME9A 3AHTA 3WK0A 4DF1A 4QAIA 1KQZA 4B5WA 1FFRA 1PCWA 2NLYA 4GC4A 1PYMA 4R53A 2PI6A 1AQHA 1E0XA 2CHOA 2F84A 3ES8A 3FCPA 4QITA 2NT1A 3W70A 1TTIA 1UROA 1C29A 3CPUA 3TR2A 1QUMA 4N4PA 1Q4WA 4K8HA 3F4WA 3NVTA 1Q8AA 3UZYA 3ZYZA 1VFOA 3NYZA 1B30A 1ZGDA 4JDYA 4UOQA 2V5KA 4U31A 1KM0A 3OU8A 2DSKA 4LOCA 4URIA 3APTA 1KR1A 2QNEA 3B9OA 1D7KA 1E9YB 4J28A 4JCLA 2HCVA 3ZLFA 1NFGA 5REQB 2QV5A 3VCRA 1RD6A 1AQ0A 1XGEA 3MSGA 1VBHA 3W7RA 3P5ZA 1ZALA 4PGLA 3AS1A 1K9DA 2PD9A 5AN7A 2DIEA 3MU7A 3TMQA 4BCEA 4L9XA 1GZJA 1E70M 3TN6A 4WEVX 4PSRA 2BHYA 4O18A 4M81A 1KXVA 3V5FA 3DDMA 1VEMA 3URQA 2C79A 1EDQA 4Y9PA 1KM5A 3MVTA 2VFIA 1CXLA 1GJWA 4GHRA 1JL8A 1LLOA 2QCGA 4IMFA 3P0WA 4ACZA 1KD0A 1C8VA 5J04A 3RJXA 3T44A 3K1GA 2R6OA 4KWSA 3AAMA 4Y8EA 5C8BB 2YCKX 1L8NA 2ZTKA 1W3IA 3N4AA 1ECQA 1PHQA 3ZWTA 3P6LA 4MWAB 3E12A 4DJFC 2OG9A 3BJTA 1OYCA 1A5OC 1XLIA 3NCOA 1I2OA 1OFBA 1Z41A 1DTUA 4IPPA 2PDIA 1O12A 1VYSX 4V33A 3F4VA 2CIPA 3QMSA 4QISA 1UD4A 4AC7C 1FHLA 4GYKA 1NOUA 3PBWA 2HSAA 1F6PA 1WO2A 3BH4A 2RGMA 3F5JA 3HGSA 1JD9A 1VLIA 2GYIA 4ICNA 1JFHA 5EKYA 3IK2A 1VBGA 2QLYA 1SFSA 3QOKA 1XLFA 3XIMA 3DERA 1YMYA 5PTDA 3HG5A 4FR1A 1KM1A 2P53A 4FX7A 3BLFA 5JVLA 4C60A 2OQYA 1UZ4A 2C8NA 4IX2A 4ASTA 2HVOA 2YW4A 5DQPA 4Y9NA 1QW7A 2VEFA 1CW2A 1KKRA 3AMDA 3CV2A 1NQKA 1R3VA 1JCJA 8TIMA 4QG9A 1UC5A 1GQIA 2WC4A 2FHCA 3TP4A 2VUNA 3Q65A 4OECA 1GZGA 3VX0A 3WF2A 4XIMA 1UKOA 3GUGA 3IGUA 2E4TA 3G1SA 3V7PA 2QCCA 5MKGB 1EUAA 4JY9A 3PG9A 4BI5A 4DBUA 1B3YA 3E5BA 4BA0A 1NM9A 3BGAA 3BAXA 1HFBA 2OKTA 3ARZA 1QFEA 2NXGA 4EWJA 2QJMA 5DCDA 3LDVA 2OWXA 4LYQA 4XD5A 1B5TA 1FY6A 2VCBA 4LXFA 1RK6A 2YW3A 2HZGA 4UTTA 2P76A 2G3FA 1QO2A 3GY1A 1WCGA 3GQYA 3KRSA 1OCBA 3SGZA 5HQLA 4RDZA 5EFFA 1V6WA 3C2EA 2ZCGA 1WPCA 3RR4A 3CMFA 2ZZ7A 3B8SA 4N2YA 1V3MA 1FHUA 4BK9A 5JU6A 2XFRA 4EPDC 3CWNA 4YU1A 4H7VA 3LBOA 1M68A 1QHOA 4X63A 2Z1BA 2EPKX 4AIBA 2G0WA 5F2LA 1PZ0A 5FF4A 1E15A 4MJ4A 1U2YA 5ABEA 5HNTA 3EDEA 3VC6A 5XIAA 4D2JA 3VZZA 2ZZ1A 1NDYA 4KEMA 1QI0A 4Q8MA 2OEJA 3M0XA 3WKZA 1XSIA 3IJDA 5K9XA 2QCEA 4NI3A 2NX3A 4Y7EA 4GUJA 2PSNA 5D2WA 4EOUA 1JYVA 3N9KA 4ZMGA 1LOQA 1X39A 4C6OA 3DHFA 4LRSA 3EEZA 4H2CA 1JPKA 4EPKA 4W8AA 3TCEA 2C16A 3W74A 1Y0EA 4LCRA 2PD5A 3WF0A 2Z2BA 2Z1KA 1K70A 3FKKA 4UOJA 4LPCA 4A6GA 3KVKA 1OK4A 1QPRA 4LUSB 4DUXA 4NZFA 1K3UA 3V4BA 3THDA 2QCLA 4PMVA 1MFUA 5XIMA 2V6AA 4U3CA 3M16A 1H49A 4PULA 5F2MA 2GQ8A 2VQTA 1YHTA 1XYLA 4X9YA 3BGJA 1TV5A 4CNUA 5C2GA 3GTXA 3TX9A 3DZ1A 3PSVA 2EKGA 3DEQA 2YLAA 3GIQA 3OZYA 4NZ4A 4GUGA 1QNRA 3GBEA 3VUSA 1FWGC 2WVSA 1D2KA 2WCAA 3PF3A 1H61A 5H91A 2W67A 1VJZA 5LIUX 2BG5A 1AA1B 5E93A 3N2XA 1MUMA 3FDGA 4HPNA 3MUZ1 5BXRA 1UMYA 4RDYA 4MZ1A 1RQHA 4M3PA 2I16A 7ODCA 5I7GA 1TPB1 3N12A 3C56A 4ZE5A 3WELA 3NL3A 3VNKA 5A6KA 3ABOA 4DBDA 1O5QA 2PF8A 3OLDA 3VABA 1FBAA 1PX4A 2C1HA 3RLHA 4GD0A 4GNKB 1DIDA 4E3VA 2PDGA 4UTJA 5JIPA 4LW7A 4WJ8A 1OCJA 3IIOA 4PUDA 4JTHA 1GNXA 3CU2A 4YL2A 1TJ2A 5CG7A 1B57A 1TE6A 1V6XA 3FVMA 4EPEC 4V1YA 4PRRA 2QAPA 1EOKA 1FCBA 3R2GA 4UTUA 2VGBA 4Q32A 2LLEA 2X1TA 3TTYA 1W1B1 2XM1A 5CAHA 2F6XA 4KERA 5J5DA 4QEEA 1KBLA 3BXWA 1G4PA 3DENA 1W1YA 2NVAA 3THQA 4R5EA 3VD3A 3IACA 3A4JA 4IMAA 1I1XA 1OGGA 3L0NA 3MYPA 2ZX7A 2OQHA 4ML4A 4W88A 2I9UA 2EJ1A 1OC5A 1DWIM 4N9EA 3LGDA 3N2MA 3BZGA 1VCVA 3RX2A 1YQ2A 3C0LA 4Y90A 4UTWC 4R7OA 2WK2A 3NZGA 3BW2A 4WKHA 2Y89A 4NAFB 2YFOA 8XIAA 4WSKA 1SM9A 4AU0A 5JBEA 5ABFA 5CSSA 3TYBA 3W1UA 1S2WA 4S3AA 3UF9A 2VT0A 1DL3A 2NQHA 3PC0A 4MB3A 3ARXA 5T9BG 1YPIA 1QR7A 2HXTA 5LNWA 1GVRA 3ZO9A 1R85A 2ALRA 2C19A 3DH7A 4FLRA 1EGMA 5SWUA 4LWWA 3AJXA 3BSGA 2ABAA 2PWEA 3LM3A 4KMQA 3FJLA 4GJIA 1WAWA 4PMDA 4Z0JA 4O54A 1VHNA 3PUEA 4IP4A 3KRZA 1TQJA 1H5YA 1V02E 1GEQA 2QCHA 4ATDA 1MEWA 4DZHA 3FA4A 3MI3A 3NZ1A 4A3UA 4CCZA 4QX4A 3TYCA 4UUIA 4LV4A 4JFWA 2NLIA 4K8GA 1WKEA 3NUKA 2PWVA 4X0VA 1Q85A 3BLLA 3LGGA 3BLKA 4GMEA 5BOEA 2PWHA 4Q7BA 3QGKC 4ZL1A 2TAAA 4HK7A 1QI3A 1K4HA 2NXIA 4GYFA 4CQBA 3Q67A 3R11A 3LI1A 3P8JA 3W1PA 1OM0A 4H9MA 3GYEA 2VZSA 3CYVA 5G2HA 3E0LA 3GB6A 2G97A 3TJIA 4KRTA 3FEMA 1IEVA 2C0HA 2DQWA 1P1MA 3MANA 1XIDA 2WQDA 4FAMA 4R9XA 2Q6ZA 3KVLA 1UW9A 1VGAA 2DJXA 5AB3A 3EB2A 1F61A 3LHYA 1AW5A 2ZRZA 3LENA 3TZFA 4FOKA 3G1VA 4GXPA 3CZKA 4CNPA 1XCFA 4HKPA 1LJYA 1TX2A 3H7RA 4ZB0A 1JI2A 3CUZA 3WL0A 1P0NA 5E9AA 1ME8A 3G8RA 4GKTA 1YDYA 3WQ8A 4DI9A 4IG2B 5KZMA 1HO4A 2CKRA 3EAUA 4C6LA 1Q7MA 3PJXA 3B9DA 3FV9A 1V6VA 1XLKA 3CQHA 2C14A 3HPAA 5FOOA 2GJNA 1EHNA 3VIKA 1SR9A 1I6NA 2JBMA 4DYJA 3KEHA 3GVWA 1RP9A 1DTNA 5D4YA 1ADSA 3OODA 3M46A 4QAWA 5E0KA 4DYEA 5KZDA 1UR9A 3LLFA 4IL0A 3WBWA 4GY7A 4MF4A 2PWDA 3WJZA 3TIMA 2BVTA 1UWAA 1CECA 3TTOA 2ON3A 4LUIA 4MJZA 2GL5A 2ZX6A 3M7SA 3OPSA 4GK8A 3VIMA 5E1QA 4PN2A 4JYDA 1Y65A 1MNSA 4IIBA 5HDRA 1TRIA 1W0MA 3MI6A 2HV5A 4PH6A 3TH6A 2ISWA 3FAWA 5U4NA 4DN1A 2OX4A 4CVUA 3ISIX 1EF3A 1VHCA 3L9CA 2J79A 4GX8A 3APGA 1TIWA 4FALA 2Z1SA 3C3NA 1XD0A 2CU0A 2QUTA 4U3AA 1UUMA 1T7LA 4KQNA 1KBKA 3OVQA 1CLXA 2V3FA 2Z0IA 2ZWZA 4GE8A 4GOAA 2BXVA 2DZXA 3HQPA 1GVEA 4FXJA 1P6WA 1KM3A 3TW7A 4BKNA 3UA4A 3G3MA 3VM5A 1X6LA 4ZEPA 1EP3A 4WK9A 4KGLA 1LYXA 1JCXA 2VR5A 3CHFA 3GDKA 4NZCA 1TA3A 2B0MA 1PX8A 4PTWA 2F8QA 2BV9A 3SRKA 1IV8A 1J0HA 2YKKA 3PB0A 4NZ5A 3NSMA 4LB3A 1SR0A 5FKYA 4Q7IA 4Q33A 2VENA 5AYIA 1AUSL 1ODZA 1P7TA 3MZNA 4AD1A 3HG3A 4J3WA 3H21A 4BWLC 1OIMA 1PZ1A 4H9YA 3GS6A 4XZMX 3KP0A 1V77A 2ATSA 4X2RA 2WSRA 4XG1A 5AHNA 2PDJA 3RX3A 1FOBA 2PGEA 3CQIA 1VBUA 3I7RA 4FP1A 3V18A 3LXCA 2V69A 4U28A 3W2KA 1KTCA 3A24A 1XC4A 1TMQA 1C3FA 4IQEA 5BWAA 4D6GA 4GG9A 3LN3A 4LF2A 1SSGA 3M47A 2Y8UA 2GPTA 5K9DA 3CPGA 1NWUA 1MW3A 1CZ1A 1FWSA 1HKIA 3LBMA 1VBJA 3ZT5A 1Q3NA 3K46A 3OP2A 2ZUTA 3GBDA 3T78A 4YS1A 3A5VA 3LTYA 4Y9AA 5GQBA 3D3AA 5GJNA 3KAOA 1W8GA 3A13A 3XISA 4E0CA 1EC7A 4HYWA 4CN4A 3EB3A 3TROA 5D8ZA 4G8TA 1ITXA 3CB8A 4C5YA 4FX6M 1EH9A 2G8ZA 1RBLA 2PCEA 3HFYA 4WOQA 4MWAC 3QOMA 4AZIA 2PTDA 3R13A 1O5KA 3QR0A 3H6OA 2EGZA 1BQCA 2D0HA 1GJPA 4DWSB 2BOFX 3CH9A 4N9BA 4QRNA 4HSNA 6A3HA 4UZSA 4MY1A 1C7SA 2WMIA 3CZJA 3P80A 1QAPA 3DI0A 3O7UA 4E2BA 5I07A 4W7VA 4A3RA 1OINA 1W3TA 4K68A 3WLTA 1JZ7A 2ACSA 3EWDA 3LSCA 4O1EA 4NF7A 3CIVA 1WDSA 1E51A 4PBEA 1ZJIA 4JTFA 3CUGA 3F2CA 2GUBA 4UQAA 1V02A 2IKHA 1IEQA 1KV5A 2AMGA 5H2ZA 1S1PA 3QSRA 4G56A 4CNOA 3VNMA 4GGBA 1JUKA 1VYPX 4QDMA 1XKYA 4IQJA 3AXXA 3TDFA 2WHJA 5IDIA 3PR2A 1DXEA 3LCWA 4AAJA 2B31A 1MYRA 4L4OA 4B9YA 4KCWA 3NEVA 2DDXA 2VC6A 3PB2A 1BTCA 1ONXA 3IGHX 4XWUA 4KFPA 2FZDA 4RL3A 3SY5A 1HJVA 2NSOA 1BXNA 3K8MA 5ECUA 3BGGA 4DWDA 4PL2A 3KZSA 3SFWA 1RUSA 4GACA 1VBRA 1VQTA 2BVWA 3QGAC 4NX5A 1IR2A 2ISDA 1SW7A 2VCCA 3BAJA 4MM1A 5KTLA 4POCA 1M3UA 3FW6A 3C8FA 5I09A 3GDMA 1E6NA 5KEZA 3CEPA 3C0QA 4YYCA 3QMRA 2VEPA 4PMRA 3QH2A 5K2ZA 1F05A 1HKJA 4IPNB 4B3ZA 4EPBC 1I0BA 4RK8A 2OZ0A 2PTWA 2C0AA 4F0SA 1R6WA 2I9EA 3AIUA 4QE1A 4TUFA 1KRBC 2GGJA 3O16A 2HVMA 4GUIA 2OEKA 3M41A 4WD0A 3QBUA 3ALGA 5A6LA 1DJXA 5HNUA 5IBXC 3ANYA 1NVMA 5E6YA 4DF0A 3NZQA 4M24A 2REQA 1MXSA 1S2UA 3FHAA 1XKJA 4FNSA 4PA8A 1VFLA 1A3XA 1DWJM 2ZUWA 3WFAA 1Q6OA 1BTMA 3CM4A 3VFCA 1JCMP 1E6RA 4O8AA 4JQ2A 1NAL1 1ESWA 2GVEA 2VUYA 4K36A 4PUWA 1W32A 1PZ2A 1GPWA 2WHKA 3W53A 2Z27A 3SIZA 4CU8A 7REQA 1PX3A 1A3WA 2RDWA 1CB7B 1RLCL 3I6EA 4J4KA 1OT2A 1UD5A 1WDRA 3BUVA 3SZ8A 3T6CA 3UG4A 3NOEA 1H4PA 4C6PA 1NU5A 3UZ5A 2JEQA 3RO8A 3EX2A 3WH5A 2GJXA 5HUOA 4WUIA 1RVKA 1P4CA 3WLHA 5JBFA 5E6ZA 3BZJA 2WZTA 3GFYA 1EDTA 4NJKA 3VUPA 3VGBA 3NURA 3C0SA 4RZBA 3IK4A 2OODA 4S38A 3S6TA 2X0YA 1LG1A 3W7CA 4HP5A 3E2SA 2PRHA 3VKJA 2A0NA 5BXTA 5CPLA 4R34A 4IXHA 5BOFA 3O63A 1SZGA 3GZ3A 5CC6A 4A05A 1HTIA 1XLAA 5C6MA 3HQOA 4C6JA 1V08A 3LPGA 1I8JA 5L9FA 3DFTA 5FSEC 3EEGA 1ZP3A 4NZJA 3GG7A 1QNPA 2PZ0A 2ACQA 3BC9A 1BYDA 2RFGA 4GCAA 4FF7A 4ZGYA 1CXHA 3TVAA 4QBXA 4DZ5A 4IIHA 3WK2A 1H1YA 1OG6A 4UFKA 3ELFA 3AHVA 1RJPA 2AGKA 3CNYA 3WQGA 4F79A 2WMGA 1J0ZA 2BY0A 2ALDA 4L1GA 3MHUA 3OJGA 4TV6A 4UB9A 3RPTA 3GNPA 1VP5A 4KWUA 2QIIA 2J74A 2OX1A 4PB4A 4UCGA 3AMGA 3AOFA 1V3LA 4FA3A 1PB0A 3QJAA 4PMZA 1EJRC 5A6MA 1OC6A 1P0DA 2J75A 3SJNA 4B5NA 5HPOA 3DU0A 4IPLA 4GZEA 4A2RA 2OWCA 1VR6A 3DHPA 2A6LA 4FR6A 1GTHA 5A8GA 3B8DA 1TJ0A 4AZGA 3SCPA 3G0UA 3MWCA 3OGSA 2Q02A 4DO6A 1XYZA 3WH8A 3WQVA 3NPUA 4MZYA 5A8QA 4HZ8A 4A3YA 5FL1A 1ENUA 1R5YA 3W1XA 4E8CA 4EXAA 2C3ZA 1XBZA 2GQAA 5DANA 1PIFA 1V0LA 1W17A 3RLUA 1HJUA 5A8NA 3CO8A 5JH1A 2VP8A 2ACRA 4IIFA 1V0KA 1ZSXA 5F2IA 2ZDRA 1P48A 3UBPC 4MNMA 4F3HA 5E0FA 1FX6A 1GOXA 2FTPA 1PHWA 4ZE4A 5C54A 1WBHA 2ISFA 4F66A 2VZOA 3BSHA 3W83A 1DJIA 3W23A 3N18A 5CC3A 2QS8A 3LNPA 4HMDA 3I68A 1OX6A 2J7GA 3W84A 3R7MA 1TWDA 1QO5A 1IIHA 4DNHA 3L5MA 2ZICA 3S2LA 5A3HA 4XZNX 4RNHA 1AW1A 1HJQA 4FX8A 4EXQA 4W5ZA 1BXBA 2D69A 3U3HA 3ID7A 3ORWA 2PODA 5I3FA 4L6DA 4ZOBA 4U2YA 2PUZA 3SQMA 3IV3A 2F2HA 1MNZA 4GYPA 3KW3A 3BAIA 4PMNA 3L23A 3BW3A 1G69A 3UCCA 3WBXA 3QMTA 1US2A 1AJZA 4FS9A 1KTBA 4DXKA 2WCSA 5DXYA 1F74A 4J40A 1R2RA 3OLIA 1A47A 1YDVA 2PLJA 3C52A 3WLKX 1CBGA 4HD5A 3AYSA 4HMNA 4UNLA 4EX4A 5FF3A 1J4EA 3NVDA 1JIBA 3ARQA 2UY4A 1H60A 3P14A 1CYGA 4I7UA 4AH7A 1UBSA 4ZQMA 1XIFA 3H12A 1S5TA 1T6MA 1C7TA 4ZFMA 4JFVA 1J0YA 2WVVA 1GK8A 1GONA 1XLBA 2EXOA 1GZ1A 4MOZA 4MTVA 3HPFA 4MB1A 4WDWA 3IIVA 3HURA 4JEJA 1ML1A 1JDAA 4OBRA 1IWAA 2PDXA 2VDGA 3EMQA 4HPJA 3EDJA 1EQPA 3N25A 3NQBA 3M0ZA 1I2QA 1LWJA 1EHAA 4QFUA 1EBHA 3T0AA 3M44A 3T2PA 3GXMA 3LGEA 4ACZB 2HMCA 1PTDA 1ZTVA 4H7ZA 3O07A 2HQAA 4XD4A 3RITA 1H1NA 5KSWA 3W71A 2G3IA 1K6WA 4QGCA 4L4MA 4YMZA 4YVPA 5JMUA 4QR6A 3W00A 3GO2A 4S3FA 1YE4A 3HGOA 3RK8A 1SFTA 4US5D 3DN5A 3PZUA 2WSKA 1ECEA 3B97A 1TYGA 2A1YA 3NQMA 5CZ0A 4B15A 3LG3A 1XQKA 2B7PA 4S3CA 4S3KA 2X1IA 4NRSA 3QV7A 1X1OA 3M9YA 3W6LA 1A5CA 3BG5A 4I6KA 5FEPA 2V3DA 3OYZA 1LF1A 3ABRA 4LANA 1I2PA 3CV1A 1FWWA 2A79A 1FCUA 1H7NA 1NOFA 1LDCA 5ECVA 4A3QA 5JUVA 1JZ2A 2CCRA 4J3XA 5F2GA 4IXXA 2V0TA 4LT9A 5DRIA 3TN5A 3AJ7A 4R9OA 3O6AA 4O53A 1TZ9A 2Z2AA 3WUEA 4N6FA 2I5IA 2VWTA 1QOQA 1EBGA 3C2YA 4N02A 1V3IA 1DVJA 3V5CA 3EOOA 4LVAA 1YBQA 2QPXA 4JTQA 2CLMA 3AXKA 4I5RA 2QDDA 1EYWA 3U8GA 4D6EA 3PZMA 2QXWA 3BANA 1DWFM 1N8WA 4JBRA 3MBFA 4QLLA 3IJIA 3RIKA 4GQRA 3MMUA 3AWOA 4JN6A 3N29A 2PAJA 3P81A 3UCDA 1KGXA 1FWNA 1CLVA 2VGIA 1Y7VA 1V0NA 4M29A 2P8CA 2Y24A 1FFQA 2YB1A 1KB3A 3WK3A 4MDOA 3M0YA 5E09A 1AVAA 3V36A 4OGZA 2XVKA 4MNJA 2JK2A 4CNNA 1X7FA 3WFZA 2PLCA 2D0FA 3G3DA 3CAKA 4L9YA 2ABBA 3RR1A 1OYBA 2ACUA 2G4FA 3RM4A 4FK9A 1OX4B 4PSPA 3S83A 1F3EA 1FWEC 4KWWA 4RW5A 2CXEA 2PBGA 2WWDA 3ZM8A 4Z2JA 1JPIA 3NXLA 3LCHA 3CUHA 1UQYA 4K1WA 4IUGA 4JTSA 4HCHA 3BL3A 2KZHA 1Z32X 4JTTA 3WUBA 3LQLA 1UJPA 1KNWA 1UR2A 4LNYA 4MKVA 1R3QA 3P7YA 1HKVA 3TNBA 1W2VA 2P50A 5HJLA 1TZ7A 5AC4A 1XWYA 1NF0A 1M01A 4K39A 1DORA 4DBEA 4QCEA 3MP5A 3WLRA 2Z1VA 1LTDA 4HT3A 1MXDA 1PKYA 1ZL1A 1Q7QA 5A6BD 2OOGA 4K8EA 4AZ6A 3T0CA 3KP1A 3OYXA 2KX9A 2AAMA 4TO8A 2C91A 1V3JA 1IE7C 3KTXA 4KGJA 3UWYA 4EKJA 3UGVA 1LG2A 1XG4A 1K02A 3DC8A 2NX9A 4MKSA 3OEXA 4JICA 2V9DA 4DI8A 4LV9A 3UXKA 3WD4A 3RYSA 1GQJA 1RSCA 1T41A 3MO7A 4W8LA 1L6SA 3VE7A 4E3TA 2OZTA 1J6PA 3OGVA 4HPGA 1OK6A 3TYZA 4MNLA 2J8FA 1Z69A 1Q2RA 1L6FA 4W89A 4XUYA 3H2EA 4OT7A 3M0KA 1GHSA 1XH1A 2WANA 5HNRA 1PWLA 4C5ZA 3NO3A 4UCFA 3S46A 3U4AA 3CQ0A 1OYAA 3GTHA 3PBGA 2NQJA 4UR9A 1E6XM 5HJXA 2X16A 3PBYA 1IR1A 4GRSA 1PO9A 2C71A 4AVFA 2O4MA 2GWNA 2EJAA 3LCIA 1W9DM 2BP1A 3ITXA 1UHVA 3TLQA 3WUFA 4XO6A 3D6NA 4ENLA 2FGZA 3W7OA 1DHPA 4XBJA 4R3UA 3HQNA 4JKKA 2X09A 4GH1A 2GSHA 3M0HA 3TAOA 2BDQA 4Z2GA 3LBCA 4HYRA 3NIYA 3N15A 3RHGA 4GCXA 1QNOA 1AQMA 3W7IA 2VL4A 1D3HA 3B9NA 1XLGA 2PDHA 3GNXA 4DWSC 2R1NA 3C86A 2OLHA 3FN9A 2VZTA 3PWIA 2VXNA 1QASA 1J5SA 1LL6A 1BF2A 4NJIA 1OVDA 4BQ5A 1VEOA 4G2DA 3TA6A 1A0DA 1A80A 4I90A 2YA2A 3SUTA 3VIIA 4A22A 2G5WA 1ZRQA 4A8LA 1DQWA 1A0EA 1YEYA 3AZTA 3NQVA 5AHMA 3U2ZA 5C70A 1Q4NX 4N9CA 3N1AA 4GGHA 4QSHA 3GVQA 3W37A 3EA1A 1FCVA 1LL7A 1IZJA 2XISA 5AFDA 3BG3A 4NZ3A 1I0DA 3TC6A 1PWMA 2AMXA 5KMYA 2QKFA 2XWDA 5AYZA 4JTLA 3JVAA 4JR5A 3F2DA 4EF8A 2GJPA 1YTEA 4WIWA 4E2VA 4AD4A 1XRTA 1J01A 2PGFA 3EPOA 3LD5A 3Q45A 4BZYA 2QV4A 4WQ6A 1TCDA 5K4XA 1H09A 1O1ZA 2OCZA 3KUMA 3U2EA 2GDQA 5AVHA 3ECQA 3DIPA 1D3CA 3RMEA 3M0MA 2DZAA 2P0OA 1OB0A 1JAKA 5ABFB 3AMKA 2WZEA 4I8DA 1Q66A 4IICA 4TMBA 6CGTA 1SSDA 3MCOA 4NNCA 5FJIA 3DFYA 1SQ7A 2XU2A 3U4FA 4Z1CA 2YCIX 4Z1BA 4KCVA 1NTHA 3KBWA 4IL2A 7TIMA 1ICSA 2YB4A 4XTDA 3AHZA 2XDFA 3AU2A 2BHZA 4H6QA 1KGWA 4CEXC 4YWIA 1BSLA 2RJGA 4E5TA 5CGMA 3RO6A 4UMAA 3GTFA 5TF0A 2EO7A 3ATZA 4RE4A 4XZBA 2WBKA 1WX0A 1OBAA 4ORIA 5M3WA 4TV5A 2PP1A 3VCCA 5KETA 3VGFA 3IUHA 4W87A 5FJPA 4DO7A 3IJ8A 2F38A 4J3SA 3GHTA 3QEZA 4RE3A 2PFHA 1KGUA 1B90A 1V4YA 4DJDA 2YYUA 4H9TA 4REQA 2V67A 2J47A 1F8IA 2ZE0A 4NL1A 4EANA 4H8VA 3MMDA 4PUNA 2WM1A 1PS9A 4MHBA 3NQEA 5CZSA 2C18A 2J9XA 1KBIA 4D6CA 1YE6A 1Q6QA 4HMEA 3EXRA 3W1QA 4JHZA 3LMYA 5DELA 8XIMA 4IP7A 1K8CA 4PRWA 4RKAA 2D2HA 1IEWA 1WZLA 3KZPA 1TTQA 2XSBA 3RUBL 4AHQA 3VD4A 4AD3A 3HMJG 4MG4A 4AQLA 1W1ZA 7A3HA 1N2VA 1UH2A 1MUWA 1UMLA 3SCTA 3GZAA 1YNPA 4QLKA 3UWUA 3STFA 3QZ6A 3WMSA 5A6TC 3UETA 1EGVA 2XZ9A 3UQNA 5D8WA 1FHVA 5CBJA 5G1YA 4XAGA 2WHLA 2E8ZA 1XRFA 4UTHA 1A0CA 1JCYA 4IGNA 3WBAA 3B4UA 1OFRA 3QN3A 3M0LA 1TG7A 3GHUA 3PTKA 3LEPA 4JAWA 3CL7A 3SB0A 2VGFA 4U5KA 1C9WA 2WC7A 3SCQA 3LX9A 3B0YA 2CBIA 4GI9A 2HISA 2P3EA 2FGBA 1G67A 4BQ4A 1BEUA 2IMRA 3ARRA 3S9ZA 5LZLA 5AY7A 3RLVA 4JTDA 1DJYA 3UY8A 3B0VC 1Q6EA 1E0TA 4AHPA 5HULA 3GNOA 3KBVA 2E25A 2CW6A 2CKSA 3GE7A 2DVUA 3QLDA 1WYIA 1H51A 3OVPA 2WSPA 4XAZA 2DZVA 5LKYA 4LUYA 1EZWA 2DT3A 4HNLA 4IMCA 2D73A 1VENA 4KEVA 4AYSA 3L4UA 4JOMA 5M1TA 3RAOA 4YPJA 1XUUA 4Z1DA 4KIEA 3MBDA 2BWGA 1F4HA 3TK7A 5D05A 4IOTA 4L5ZA 1NIUA 2NWSA 2Y7GA 1PTAA 1WXYA 3KDNA 2YPIA 4LQ1A 3G0SA 4Q4SA 2RHGA 4V2XA 1W5PA 4DJFD 2HNHA 4P61A 5K3VA 4YVVA 3OB8A 4FB7A 3QC3A 3I3BA 1FWAC 4RV8A 2NZLA 3IPWA 3EWXA 5J8LA 2G3JA 3QV6A 3P3BA 4R7WA 5D2XA 2GUUA 1Q7ZA 3SRDA 4HSOA 1WDQA 1XRVA 1CDGA 1HKMA 1Q45A 2OPJA 1TPVA 5I03A 4HNVA 1TSIA 3CL6A 2QVHA 3U2OA 1E6PA 4GI4A 4G1KA 2BGNE 3H7VA 4B5TA 3GG8A 4QG6A 3GH5A 1KA9F 4X0NA 3QQ0A 2OZ3A 2YBTA 1YXYA 4QJ1A 4GC3A 4DXXA 1GOQA 2G3NA 6XIAA 4LCSA 3LMZA 2OYLA 3TV8A 2RDXA 4ROQA 3B8VA 1P7TB 4W5UA 4PBFA 2Y62A 1AODA 2E67A 2W9MA 2IUZA 3U57A 4PB5A 3KRUA 3PFRA 1M7JA 2Y0FA 6TAAA 3B0UX 3T9PA 4LUTA 4U2ZA 1XYAA 1S3HA 2WSYA 1W5QA 5FJOA 3C5QA 3KTSA 2VTFA 2Z7KA 3B9AA 1TV8A 2QGHA 4M8UA 3WD0A 1SO4A 4QE5A 3NPWA 5A6AA 2CHRA 2RKXA 3STGA 1UKQA 3LTPA 4MAZA 4ONVA 5DF0A 4BHYA 4AY1A 3ZVHB 3DOPA 4IMDA 1P43A 1QPNA 3DFSA 1LBMA 3S2JA 1JAEA 2Q01A 3A4WA 1I2RA 1RJRA 4DVOA 5C2CA 4ZSUA 3L0KA 4GH3A 1VCFA 5FD0A 1KM2A 1L6WA 2VX6A 4EXBA 1P0KA 2PTYA 4ZOAA 3WQFA 4LYPA 4JKMA 4MY8A 5FSDC 4DJEA 5H1WA 1E9LA 3R8GA 1IQ8A 1TMHA 4RZ4A 1XLHA 4WKAA 3UP8A 3PNUA 2HBVA 5HUPA 4YTSA 4QQUA 3VPLA 1QBBA 3CZGA 2PDLA 3DBPA 4AUBA 3IGXA 4AWTA 4FXFA 1RXOB 2FHFA 3HB9A 3QY6A 4IP5A 5E5CA 1A50A 2VI0A 4XB3A 1I9CB 1REQB 2PDQA 2Q09A 4KWVA 3L7RA 1VEPA 2H9AB 4O4WA 4LVFA 3GKAA 5F1VA 2O56A 3MCNA 4IUOA 2IKIA 2PDKA 4O0ZA 2GGGA 4M6VA 5G4WA 1H5VA 3SIMA 3APYA 3LRLA 3N13A 4HHMA 1PAMA 1EFZA 4MADA 2Z00A 1BVNP 2WXDM 2OSXA 5AVNA 1ZBKA 2XIMA 2ISSA 4QJ4B 3G1HA 3F2BA 2PRLA 4S1FA 3TYDA 3MUXA 5CSRA 2JIEA 4WXYA 1J0IA 1A5MC 2VC5A 2DT1A 4DPQA 1LROA 3OBAA 2POZA 3OIHA 1ZQ5A 1ZAIA 1JJKA 5FESA 3M6DA 1RQBA 3WNPA 1W2PA 2GK1A 1EQCA 3HGRA 3KX6A 4XX6A 1D8CA 4C6BA 3WQEA 3P60A 1UD3A 4N4QA 3VCNA 4OWGA 2BS9A 2CLLA 1PKMA 4WXZA 4B90A 5AYBA 4I5UA 1OWQA 3VMPA 2ONEA 4Q4OA 5A8MA 3POHA 4P8XA 3AISA 3HO8A 3GK0A 4MPQA 3PSWA 3GR7A 2QMKA 1B1YA 3RFAA 2DT0A 1A53A 3WLLA 4D6HA 2CLHA 2R9RA 4P7QA 1BRLB 2V3GA 2XN0A 1BKHA 3HA1A 1RLDA