4RL3A

Crystal structure of the catalytic domain of a family gh18 chitinase from fern, peteris ryukyuensis
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
271
structure length
271
Chain Sequence
KVFREYIGALYNGVQFTDVPINSGVTFHFILAFAIDYTSAAAATNGVFNIYWQNSVLTPAAVQAIKAQHSNVKVMVSLGGDTISGSPVQFTATSVSSWVANAVSSLTSLINQYHLDGIDIDYEHFDQVSTSTFVSCIGQLITQLKANNVISVASIAPFDGVESQYTALFGQYSSVIDLVNFQFYSYGAGTSASQYVSLYNTAASKYGGGAKVLASFSTGGVGPAPSTVLSACQQLKSSGTLPGIFIFSADGSYASSAKFQYEQQAQTLLTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase A
publication title A class III chitinase without disulfide bonds from the fern, Pteris ryukyuensis: crystal structure and ligand-binding studies.
pubmed doi rcsb
source organism Pteris ryukyuensis
molecule tags Hydrolase
total genus 100
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2014-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4rl3A00
3BAWA 1PZ2A 4M80A 1V02E 3ZJ7A 2FGLA 5DO8A 3WNMA 3F5JA 1VRXA 3ZJ6A 3SCOA 3CMGA 4F79A 1VBRA 2Y2WA 3D5HA 4R5EA 4KH2A 5FCZA 2GJXA 1UHVA 2NT1A 1BF2A 1GHSA 1JI2A 1JYWA 2CBUA 1MW3A 3NDZA 1H4PA 1W2PA 5GNYA 4HU8A 1PZ3A 3ZIZA 3WQ8A 1WB0A 1W9BM 4XX6A 1JDAA 3CHFA 1A47A 1Q6FA 1V3HA 4NI3A 3WSUA 3QHMA 1KGWA 1TG7A 1QHPA 1HXJA 4RE3A 3WMSA 5JBDA 1V6UA 3NSXA 4W87A 2DGAA 1W3HA 2WMKA 2WSPA 1SFSA 1FH7A 3DYPA 1M03A 1JF6A 2WBKA 5HDRA 4UR9A 4PRWA 4FF5A 1B3XA 1W1VA 2B31A 3ZM8A 4D6CA 3CGTA 1MVYA 2VRJA 2AAAA 4HOWA 3EDFA 1WPCA 1JZ3A 3WIJA 4PMQA 1JZ4A 3GH5A 1JAEA 2ZX7A 1QBBA 1FP9A 2ZX9A 4W89A 4UOZA 1JFHA 5D9NA 5DF0A 4BZYA 2JEQA 4U3AA 4A3YA 4A4AA 2ZUVA 3GXMA 1CZ1A 4P7NA 3UG5A 4UTFA 4N42A 3WF2A 1E70M 1UR0A 1GJUA 1UD6A 3WUGA 4F9JA 3VD4A 5A6BA 2F61A 2XVNA 1HX0A 4MNJA 4KMQA 4AZHA 1E0XA 2D0GA 1E6SM 1GUVA 3K1DA 5GPRA 3CUFA 4AXNA 3ARSA 4P8VA 3W26A 4FMVA 1US3A 3IANA 2VT0A 3VPLA 2W66A 1W9DM 2VQUA 2J77A 2PI6A 1OIFA 2CCRA 1KQYA 3ALFA 1AMYA 1HJXA 1L0PA 4F8XA 3W25A 4ACYA 5ABGA 1PX4A 4OKDA 1BYBA 2ZUMA 5BXPA 2WHMA 3SCPA 4CU6A 3WUBA 3LPGA 3VIHA 2WCAA 2ZX8A 4ZXOA 3NCOA 3FHAA 2J74A 1KGXA 1CLVA 2VCCA 2YKKA 1B9ZA 3ZT7A 1BPLB 4TVUA 2E3ZA 4RE4A 1H09A 1CGXA 3VD5A 3VD7A 3ZT6A 3CHDA 1JZ5A 1CENA 3PTKA 3OGRA 5FKYA 4MDPA 4UFHA 1E15A 2BXYA 1X6LA 2VUYA 2ZX5A 1CXLA 1J01A 2DIJA 5CJ5A 2J7FA 3KEHA 2WMIB 4MTVA 4DM1A 1HJUA 2YLAA 4YHGA 1J0JA 2E9LA 3VDAA 3ZJ8A 2J62A 5A69A 4B3KA 1TVNA 2VX5A 3OB8A 5A94A 4P8WA 1U2YA 3SUUA 3N12A 4CCEA 4CUCA 1GQJA 2J8GA 4PTMA 1DEDA 1M01A 3PHAA 4Z2JA 3VGEA 3NDYA 4N0RA 5D8WA 4MAZA 3DYMA 3UG4A 5I2UA 1LWHA 1GONA 4J7RA 4KRTA 1HNYA 3OIHA 3CZGA 3M07A 4W5UA 3VDBA 5BXTA 1FH8A 1JD7A 2GK1A 2D2OA 3N11A 4W8AA 2RGMA 3WH7A 1E40A 2O9TA 3ALGA 4J3SA 1XRVA 4QCEA 3RM4A 1LG2A 3EDDA 5I3DA 2PWDA 2J8FA 1UH3A 2DIEA 2DSWA 3KL5A 1XH2A 1H2JA 1MW1A 2CETA 3BAYA 5AC4A 3PTMA 3AZRA 5E6ZA 2VR4A 3EDKA 3FN9A 2V38A 1O6IA 2J79A 4P8XA 3WD4A 7A3HA 1VFOA 3MMWA 3OG2A 4GI6A 2QMJA 3WQ6A 4PTVA 4DWSB 4DWSD 4XZWA 3AMDA 1UOKA 1QNQA 1UR2A 5IFPA 3RM8A 4HP5A 1DP0A 2VZVA 4AZGA 1GOOA 2CNCA 2OSXA 3KE0A 3WF0A 3NUKA 2YBUA 3VDCA 1KQZA 2BFGA 1FFRA 2GDVA 3BH4A 4CD4A 3IK2A 3RDKA 2BNJA 4QLJA 1Z32X 1WNOA 5CLTA 1G94A 2VZTA 1EIBA 3AXIA 2JIEA 4F9DA 1JF5A 2BY3A 2J7DA 2YIHA 3AROA 2BVTA 3WQVA 3GYCA 1ODZA 2VVSA 3W81A 1K6AA 1HVXA 3BAKA 2WMFA 3K4AA 1KXQA 3TTOA 4Y7EA 4ML4A 1DHKA 2NW0A 1BFNA 1UKPA 1QBAA 4B9ZA 3CHEA 3O6AA 2CHNA 3M7SA 4EKJA 1V0MA 3JUGA 2QPSA 2WSKA 1LL4A 1W1TA 1WP6A 1ZBVA 4AY1A 4CU8A 1X1NA 3VGBA 4MPKA 5AY7A 2ZUUA 7CGTA 5BXRA 1X6NA 1TA3B 3QOKA 4CN1A 3T0AA 1E6RA 1E6ZA 2QV4A 2JF7A 3UR8A 2J7BA 4V2XA 4M56A 1BQCA 5LYRA 1NWUA 1E73M 1CGYA 1XSIA 2VX6A 3W4RA 3U7VA 1V0NA 2A3EA 1UD2A 4DUWA 1UR9A 2XGIA 3WUEA 3LPPA 1ODUA 4UFIA 2YA2A 1EA9C 4RE2A 2G4FA 3AIQA 3DHUA 3ZMRA 5I23A 3BCFA 1CIUA 2WZIA 4TOQA 2WK2A 3AJ7A 3MO4A 4PCSA 2E8ZA 3CTTA 1TR1A 1PBGA 4W84A 4U5KA 2XUCA 1JYVA 4MDOA 1CGTA 1C7TA 3AS3A 4HZ6A 3SCUA 1ECEA 3TONA 1MQRA 2XIIA 2ZXAA 4M82A 4U5IA 3IJ7A 1AQ0A 1UUQA 2GDUA 1UG6A 1JI1A 2IUZA 1UWSA 1H0GA 1GQIA 3CBWA 1VIWA 2V3DA 1G0CA 1NQ6A 1GCYA 1ZBKA 2F2HA 2E8YA 1ZL1A 3VIIA 4PUDA 4LQ1A 3MUZ1 4QFUA 2DH3A 3BXWA 3CZLA 3ARXA 1FP8A 1DWHM 3A6OA 1Q4NX 3MSDA 1EGZA 2VX7A 4PMUA 2PBGA 4QAWA 1MW0A 1KXVA 4MJ2A 3AIEA 5M5DA 1QHZA 4OOUA 3WN6A 1XV8A 1ZBCA 3GXDA 2VR5A 3SCRA 1TCMA 4ZE4A 3QR3A 1V3JA 3N1AA 1WE5A 5BRQA 4UQAA 3VX1A 4E8CA 3AS1A 3EMZA 2IXUA 2WCSA 1Y7VA 2XM2A 2V3EA 1GQKA 1F4HA 4IISA 4HU0A 4MAVA 2DQXA 3ZSSA 2X0HA 3VIFA 1DWIM 2VJXA 1JZ2A 3WMBA 1QI2A 1QI3A 1R7AA 2WPGA 5AYBA 2BVDA 3WNNA 4XV0A 1W1PA 3MV11 4U3CA 2EO7A 3VKKA 3WDJA 1E3XA 3AZSA 4WK9A 5JBEA 2WMGA 4M29A 1XYZA 4AZCB 1GNXA 1VEPA 1KXTA 1D7FA 1NM9A 2V3GA 3DYOA 4GZJA 3IJ9A 3AIVA 4P7LA 4PSRA 4FLQA 2VZSA 2WAGA 2Y8VA 2FH8A 3SCTA 1ESWA 3I3BA 5A2AA 2YL8A 1JXJA 3SUSA 1RD6A 1BYCA 2JIWA 2FGZA 1QNRA 2Y24A 1GOMA 5HBFA 4EAMA 2J78A 1XYFA 3AMCA 1IZKA 2WLYA 3VIGA 1UKSA 3WQWA 4PMVA 4AMCA 3AYSA 2PC8A 3L4ZA 3WMCA 3WDIA 2EXOA 1RP8A 3GBDA 1HJSA 1DTUA 3L4TA 1J0ZA 4CCCA 3CHCA 3WFLA 4URIA 5A2BA 3N9KA 3FAXA 1SMAA 1CECA 2Q8XA 3RCNA 5CPQA 3WF1A 2BXZA 2XVGA 1CGWA 3IAPA 1HKJA 4IUGA 4Z2KA 5AC5A 3A4WA 5FL0A 2CKSA 3GM8A 1OM0A 3VD3A 3L4UA 4UOJA 2CHOA 1MQQA 4OJYA 1EO5A 4EE9A 2WMIA 5A6LA 3MUAA 2C0HA 1KCLA 3WNPA 2D20A 1E9LA 4HOXA 1EQPA 2FHFA 4JFUA 3T09A 2XSAA 3MV01 3TA9A 2EPLX 1V6XA 4XB3A 3NSMA 4H8VA 4D6DA 1NH6A 4JKLA 4JHOA 1WDQA 1C91A 1TMQA 4WSKA 3SUVA 2E0PA 4WIWA 3U7BA 2GJPA 3G6MA 3AS2A 1OGSA 4ATWA 4WF7A 2WW5A 2G3JA 5E0FA 4EANA 1LL6A 1JL8A 1M04A 2CBIA 4AD0A 1GOIA 4YN5A 3BSGA 2E4TA 3BSHA 1QI4A 1ZJBA 1FOBA 2X0YA 3NYDA 1FHDA 3EDEA 3A3HA 5CSYA 1GOKA 1UR8A 1OCQA 3K8LA 4QLKA 5I77A 4E2OA 1K9FA 2ZUTA 5E0CA 1OT2A 2AOSA 4ZXLA 1JFXA 3WKZA 3FAWA 5FL1A 1MFVA 4PMDA 3TOPA 1KFWA 1WZLA 1V03A 2OYLA 1J18A 2DSVA 3KWXA 5AYIA 3SCSA 1BHGA 3A4AA 1EH9A 3AHYA 3CMJA 5CSUA 2OSWA 3II1A 4DWSC 3S6TA 1G9HA 1BVNP 2XWEA 4HOZA 2Y5EA 1CYGA 4DWSA 1H49A 2VOTA 2UY2A 4KGLA 3WH5A 1XCXA 1JNEA 4K68A 3UERA 2J47A 4NRSA 1GOWA 4LYRA 4Z2IA 2EPOA 4MNLA 5CGTA 4GO8A 1UZ4A 4WKHA 1MFUA 1I1WA 3VU2A 4YPJA 2GSJA 1B1YA 3S2CA 2VZOA 4A3HA 2XM1A 1NOWA 1GJWA 2XVLA 3VNYA 3WQ4A 3OA5A 1J12A 4XUYA 4GI9A 2VNCA 4GINA 3WL1A 4TVCA 2CIPA 1E4MM 4MJ4A 4S3KA 3WNLA 1TUXA 2D3LA 5ABEA 4U2YA 2V5CA 1OINA 1CPUA 3UR7A 2VURA 2Z1SA 2DSUA 4UFJA 3OZOA 2BHZA 5A6KA 4HMDA 3WF3A 3RIKA 3O2LA 2VVNA 4DUXA 1W3LA 5JUVA 3OLGA 3OLEA 4AD5A 1UQZA 3ARYA 1FA2A 4ACZB 2WVUA 2BVYA 1GHRA 4D6EA 2C7FA 1EOKA 2DT1A 3ZOAA 1E56A 5IFTA 1LG1A 3BLPX 1G5AA 2XWDA 3T0DA 4JL1A 3AISA 1TA3A 5I6SA 1KXHA 1XC6A 3CZEA 2QLYA 1CXFA 2VL4A 3CO4A 1BLIA 4FK9A 1EHAA 3W29A 2CBJA 2GJXB 4AZ7A 3WBAA 1V6YA 3U57A 2WZEA 1ISYA 3WENA 1W9XA 4ATLA 2JEPA 3A47A 3GZAA 2O9PA 1TVPA 1V6WA 4CU7A 1BAGA 1DWFM 1TE1A 2ZE0A 3AZTA 4J27A 4AEFA 4Z2HA 5GQBA 4HA1A 3BGAA 5I79A 3VINA 2ZOXA 3CUGA 5JIPA 4CN4A 1BTCA 4TTUA 4ATDA 3AHVA 2ZUNA 2XJ7A 3WF4A 4AC1X 3BMWA 2J25A 1LQ0A 1C7SA 1UQYA 2WMJA 2ZXDA 1CGVA 1XCWA 2XVPA 2PF0A 3UEQA 3AXHA 3TTSA 5FIPA 2D0HA 1AVAA 4C7GA 1XD1A 2W5FA 3B9DA 3WDHA 2G41A 1B3VA 3RMEA 2WMHA 2W91A 3QHOA 4J3UA 1E6QM 3T2PA 1NP0A 3PZ9A 4PN2A 3RO8A 1Q6CA 3NSNA 4D6FA 1HJVA 1MXGA 4PMRA 3W37A 1VJSA 3MMUA 2W63A 4JHZA 4J28A 2XYLA 2GVYA 2VCBA 2GJRA 3BC9A 1VB9A 1H5VA 4L4OA 1UR4A 3GXIA 2D1ZA 1R7OA 4M81A 5DFAA 3WELA 1EOMA 5DMYA 3ARTA 4AZIA 1ZJAA 1PIFA 4JL2A 4UOQA 3WQ5A 1MYRA 1DWAM 1HJQA 1V3KA 1ZS2A 2UWFA 6CGTA 1YQ2A 3WH8A 5A6MA 4OZOA 4ZENA 1OT1A 1CXKA 2VC9A 1CNVA 2NT0A 3ECQA 3CUHA 3PZNA 4AEEA 1GW1A 3ARRA 4D1JA 2WZHA 1UZ1A 3ZO9A 1BG4A 1CGUA 1CBGA 3FXYA 4OIFA 1OWQA 5CLWA 5D9PA 3CIVA 3SEPA 3UG3A 1FHLA 4W93A 5ECUA 4D6JA 3F5LA 4W8BA 1W2VA 3THDA 1BYAA 2BS9A 2Y4SA 2WC7A 2A3CA 1K9TA 3G6LA 3MANA 4GPNA 2V3FA 2YDRA 4H04A 3IJ8A 1PX3A 2OYMA 5BROA 1HF6A 3DC0A 4CVWA 1OB0A 2WHLA 1CXHA 3GDBA 2WBGA 2VI0A 1GZJA 4JFTA 3AHTA 1R86A 4AZCA 1J0YA 2XSBA 2GUYA 3BLKA 5M3WA 5ABFB 1LLOA 1V3MA 2D3NA 4CVUA 5DEZA 4UNIA 2JE8A 2W67A 2DT2A 3WEOA 3W82A 1L8NA 4PUEA 3HU7A 3PZQA 4Q22A 3PZIA 4HA3A 5A8NA 3AICA 3GH4A 2YA1A 3KL0A 4F66A 3F5KA 3AIRA 3U5YA 4C7FA 1YHTA 3MMDA 4MNKA 1HKIA 3A4XA 1WAWA 3POHA 2YBTA 3GH7A 4H8UA 1HIZA 1VENA 2J75A 1VFFA 4WSJA 1GORA 2UY5A 1QNPA 2QF8A 5BWFA 4GKLA 4JFVA 4BQ3A 2CXGA 3AHZA 4B3LA 3DECA 3HMCA 2VRQA 4CKQA 4W8LA 1IV8A 4LGXA 4GZIA 4NSBA 5CXPA 1O7AA 4KWUA 2NSXA 2DT0A 3U5UA 4D6IA 2ZICA 5LA2A 1UWIA 2AMGA 2E40A 1ZBWA 2XTKA 4QP0A 1H3GA 3ARVA 2DSZA 1KWKA 4PTWA 4AIEA 1UA3A 3HJEA 2VTFA 5TD4A 2OLHA 3L4WA 3I3DA 3WL0A 3BAIA 4W7WA 1B90A 2VO5A 3LPOA 3W27A 3VM7A 1KWGA 2XFRA 4M24A 3N13A 1H11A 5HOSA 5BXSA 2HISA 4UQDA 1GVIA 1QHOA 1JXKA 1C90A 4AD3A 1B31A 5ABHA 4HMCA 2BY2A 4HA4A 4B16A 4V27A 2CERA 2CYGA 1JD9A 3PZUA 1HKMA 1UWUA 4KGJA 3AI0A 3L4VA 4QDMA 4R27A 2VRKA 4PTXA 2JALA 4S3JA 1MXDA 4LXFA 1PAMA 2WVTA 1WKYA 1GPFA 2WVVB 2O9RA 1ITXA 1E0WA 5GNZA 3VGFA 1R8LA 2CKRA 3OZPA 4BQ4A 5EB8A 2W61A 1B3ZA 2E9BA 4TX6A 4AWEA 5E9AA 3NJ3A 2G3NA 5C8BB 1J0HA 1J9YA 1UA7A 2O92A 5HNNA 4AIOA 3ZT5A 4DM2A 4W5ZA 3WFZA 1OIMA 4X0NA 1UH2A 1E71M 1E1EA 5BCAA 2C8NA 2A3AA 1EDTA 2WNWA 3D3AA 2J7CA 1XD0A 4LX4A 3RJYA 2MANA 4TXEA 1ZU8A 4D1IA 1VFMA 1BYDA 2RGLA 3AFBA 2UY3A 1WO2A 3CPUA 3CUJA 3SIMA 2WYSA 1V0KA 1QNOA 1B3WA 5KZ6A 2ZUWA 4RL3A 1JIBA 4NRRA 3WUFA 3BCDA 1JZ7A 1E4IA 2W92A 2XPKA 3RM9A 3AIWA 1DWJM 4CD8A 1B0IA 4MB3A 2XVKA 4HPGA 2X1IA 4AZBA 2YDQA 1OD0A 5EFDA 1EDQA 3PZMA 5D9OA 1NWTA 5A3HA 3VD9A 1UR1A 3EMCA 5BYWA 4H7VA 2EPMX 2IXVA 1MQPA 4FLRA 4H8HA 3CZ8A 1BVZA 6TAAA 3SCNA 2OWCA 3ZR6A 5JBFA 3KL3A 4JAWA 4JKMA 5A6SA 5A1AA 3VOCA 1TFVA 2A3BA 3FNDA 2UY4A 3WDPP 1NARA 1KB3A 4CCDA 3WEZA 3QOMA 1XH1A 1NP2A 3AS0A 1KR1A 2WKLA 3RILA 4ACZA 1ZB5A 2PB1A 3ARPA 2DEPA 1LF1A 2Z1KA 1R87A 2G8ZA 1S46A 4HTYA 2XFYA 2ESCA 1IT0A 1LL7A 5EMYA 2OWWA 3AXXA 1XSJA 3BAJA 1JDDA 3WY1A 5JIWA 2XFFA 3T08A 1KCKA 4UFLA 1UD3A 2XG9A 1E5JA 4AD1A 3M6DA 1QI5A 2ZXBA 3MUIA 4YHEA 3ZJKA 3PZGA 1BSIA 1UWRA 2D0FA 1HP5A 1EHNA 3T2OA 3OGSA 2CEQA 9CGTA 1EO7A 2OYKA 5I0DA 1RPKA 3WD3A 5I78A 2DPEA 1QW9A 1OBAA 1FH9A 4JIEA 1PJ9A 1J0IA 1UKTA 4GIAA 3CUIA 3MU7A 4AISA 1KBBA 1QNSA 4PMYA 5E70A 3AIUA 4UQEA 2EQDA 2O9OA 5A8PA 2YJQA 2QMKA 1HL9A 4OBSA 3K46A 1W3KA 1ITCA 5D4YA 3W6LA 1CXIA 3CLWA 3W28A 5CPSA 1XH0A 2EBNA 3TTYA 3T0BA 1AQMA 3VIKA 3N15A 1SR0A 5HPOA 3LPFA 7TAAA 1H0IA 3EBVA 1QOXA 4AW7A 1H1NA 1ISXA 1HJWA 2DT3A 1WZMA 1W91A 3CZKA 1NOFA 2XGBA 1CDGA 3ARZA 5E6YA 1G1YA 3PZOA 5C71A 1VBUA 1UKQA 4PMXA 4B9YA 4PMOA 2QHAA 2EEXA 1JZ6A 5CG0A 3AMGA 3PZTA 2WKGA 5A8QA 1UD5A 3L4YA 1OSEA 5DT7A 3APGA 1WDPA 2FHCA 4JFSA 3VUPA 1V0LA 3AOFA 2TAAA 1FFQA 3VGDA 1UD4A 1E1FA 2X2YA 3BMVA 4W7VA 4NZCA 3VIJA 3TP4A 1CXEA 4PEEA 4W86A 2OWXA 1ISVA 1US2A 2X05A 2VZUA 2WCGA 1A3HA 4ZE5A 3EMQA 1XSKA 4OOZA 3GTNA 3QHNA 2CBVA 1MWOA 8CGTA 4J3TA 2ZXQA 2PBOA 4MNMA 1CTNA 5ABFA 3L4XA 3POCA 1B2YA 2PWEA 1VEOA 2WB5A 3WD1A 1SMDA 3VILA 2JF6A 2OSYA 1E3ZA 3FY1A 4CD6A 5CQ1A 1PIGA 3W0KA 1D3CA 3GBEA 4AZ6A 2BY0A 4FLOA 3ARUA 1C8YA 4D6GA 3K8MA 2ZIDA 3WH9A 1E6NA 1MW2A 4MB1A 1V3IA 2HVMA 4GXPA 4H2CA 1HVQA 1V6VA 3MSGA 4IPNB 1UWQA 4AD4A 2CESA 4JFWA 4DUVA 1E4LA 4IM4A 4NF7A 1VF8A 3WDRA 3WD2A 1B3YA 3VIPA 1JZ8A 1C93A 4M8UA 2ZWYA 3RJXA 3N18A 4OBRA 5M17A 2DDXA 3WEMA 1JNDA 3CH9A 1H41A 8A3HA 1HP4A 4P7OA 1AQHA 1VFUA 5LA1A 5IHRA 2FH6A 2YLLA 2F8QA 3EYPA 3ARQA 2QPUA 1U30A 3ZR5A 1DWGM 4MB4A 3WBEA 3M46A 1UYQA 5HPCA 4GQQA 3E1F1 4V28A 1QPKA 2PWHA 5A6BD 3THCA 2XIBA 1OGBA 4BQ5A 5CGMA 6A3HA 1PX8A 4P7QA 5BRPA 1C3FA 4TTGA 3VGGA 4Z2GA 1R85A 2DSKA 3B8SA 1BGAA 2EPKX 1UKOA 2A3HA 2J4GA 1PPIA 4PCTA 2WC3A 3PBGA 1W3JA 3VIOA 4U2ZA 2WVVA 4GI8A 4EK7A 5EFFA 4JCLA 3K4DA 1QI0A 1GOQA 3WH6A 4D6HA 2D22A 2BHYA 1RH9A 4U31A 3MKKA 1BGGA 3O9NA 1SYTA 2BY1A 4HZ7A 3ZSTA 4AD2A 1PEZA 4WJXA 2WWDA 1NWSA 1WZAA 5LA0A 3VMNA 3ARWA 1EDGA 4PMZA 5A8MA 3W6MA 5A8OA 4M1RA 5IDIA 2YOCA 1W32A 3AMKA 1HT6A 3AIBA 3W53A 2X8RA 1NOUA 1V02A 2VMFA 2YL9A 1E43A 5C70A 3VMPA 3B9AA 3VGHA 5FD0A 4HPHA 3VX0A 1GQLA 4GQRA 4PBGA 2VX4A 4QCFA 5HXMA 1ISWA 1UD8A 2CPUA 2J7GA 4TUFA 5M03A 4P8UA 4UFKA 2J7EA 1JAKA 1V08A 4J3WA 4BF7A 2E9MA 3UETA 1LJYA 3T2QA 5GNXA 2GFTA 3VVGA 5KEZA 3SCVA 1K9DA 1OD8A 1HL8A 4W88A 1JYNA 2D23A 4HMEA 3UCQA 2G3MA 1C8XA 1LWJA 1UWTA 1IZJA 1K9EA 3QGVA 3FW6A 1G01A 1J11A 3F4VA 1W9UA 4C7DA 3PN8A 1Q6DA 1XGZA 2Y8KA 3MS8A 3SCQA 1KGUA 2D24A 5IXEA 2BV9A 2JFEX 4BA0A 5EBAA 4UQ9A 2GK1B 1XHGA 4AIUA 5A95A 4KRUA 4UZUA 1JDCA 4BQ2A 2W4XA 4IPLA 1N82A 4MADA 4Z2LA 5I5RA 2PWGA 5A2CA 2WLZA 2WANA 3AHXA 2PWFA 1C8QA 3OGVA 4CGTA 4D72A 1E0VA 4JCMA 3UESA 1NWRA 3OBAA 2DH2A 2YDSA 4JZ5A 3PZVA 1RP9A 4ZEPA 3AYRA 2G3IA 4LYPA 4XZBA 4UZSA 3W24A 1OGGA 4GZEA 1VAHA 4PYSA 2V5DA 1HN1A 4U33A 2EPNA 4J3VA 1M53A 2FDMA 1JG9A 3GNOA 5F7UA 3GNPA 2VCAA 3HN3A 3J7HA 4OUEA 3MUY1 5A6JA 3FHQA 4BCEA 1E5NA 3GXFA 1TZ7A 1CLXA 4WLCA 3SURA 1E4NA 3IAQA 1QVBA 3SCWA 4BS0A 4B15A 4W7UA 1CEOA 2ZX6A 3WD0A 1JGIA 2WWCA 1HKKA 3SUTA 1E6XM 1WDSA 1W9PA 1KBKA 2YL6A 3OLDA 3GNRA 4JKKA 3L2LA 1WZKA 3VMOA 3N04A 4TVDA 1M7XA 2J7HA 2FHBA 2VQTA 4AYSA 1JYXA 1P6WA 3WNOA 4PMNA 3L2MA 2WC4A 1WDRA 1E72M 3AQUA 4E4PA 4AZ5A 5CPTA 4CN6A 4UQCA 1F4AA 1KR0A 1C92A 2WXDM 4TX8A 3N17A 4QLLA 3CZJA 4LYQA 4UQBA 1VEMA 2EJ1A 1W9VA 3ZQ9A 4GO9A 2WHKA 3VDHA 3I3EA 2W62A 2CITA 3OLIA 1ISZA 2XHYA 4D71A 4HZ8A 3K8KA 5I24A 4W85A 4UCFA 1WCGA 4CD7A 5A6AA 3TTQA 1EQCA 5IHSA 3B9EA 4PSPA 3WDQA 3DHPA 1B30A 1J10A 1J0KA 1GVYA 4CD5A 1E55A 4WKAA 1QW8A 1Q6EA 3VTRA 5CZKA 1EXPA 1E6PA 2ZUSA 5D9MA 4E8DA 3BAXA 1W1YA 3VNZA 4J3XA 4P7RA 4L4PA 4LPCA 1BG9A 2WVSA 4X9YA 3AMLA 3VO0A 1Q6GA 3W38A 3EDJA 4WKFA 2YL5A 1D2KA 4X0VA 1VJZA 4MB5A 2WM0A 1V3LA 4Q7NA 4UFMA 1I1XA 1U33A 3VIMA 5D8ZA 1I75A 3WNKA 3KZSA 5FOOA 2BHUA 1UH4A 2ZWZA 4H41A 2YA0A 3VM5A 5DT5A 4ZFMA 3PTQA 3NIYA 4FLSA 2X09A 3LMYA 3SUWA 1CWYA 3RPMA 5E09A 2WHJA
chains in the Genus database with same CATH superfamily
1SO4A 3WCZA 4Y9NA 1PZ2A 3WNMA 1QTWA 4I9MA 3NR0A 3ZJ6A 3CMGA 1GPWA 4R5EA 3GAYA 5FCZA 3T55A 1UHVA 1EUAA 4L9YA 1MW3A 3NDZA 1W2PA 5GNYA 2ZZ6A 4XX6A 3CHFA 4H9XA 4NI3A 4E2DA 4C91A 1KGWA 2F38A 3TCSA 1TG7A 4Q8WA 1A5BA 1HXJA 3QZAA 5BU9A 3BG5A 3WMSA 2YYUA 1V6UA 3NSXA 2WMKA 3GHRA 5I07A 2WSPA 3G0XA 1FH7A 1MO0A 3GQYA 4IHCA 1JF6A 5HINA 4PRWA 4FF5A 4PTDA 4Z1AA 4FF7A 1K4GA 2ZFAA 2QW5A 4PH6A 1L6WA 2AAAA 3LHUA 4HOWA 3EDFA 4P61A 2EG8A 3GC5A 1WOAA 1E1CA 1LBLA 3WIJA 4PMQA 5A5WA 1QPNA 4O18A 2VEGA 4FOJA 1O5KA 4JN8A 1VYRA 4NQ1A 4I8YA 2JEQA 5DMMA 4GBDA 4A4AA 3GXMA 4DXVA 4Q4PA 4P7NA 4A3QA 3CAWA 4N42A 2GQ9A 3O16A 1UD6A 3WUGA 4F9JA 1Z6KA 1HX0A 3UXKA 2AKMA 1R2RA 2FVKA 1F8MA 1GUVA 4UIOA 2AMXA 4AXNA 3ARSA 5LZLA 3HQOA 3SRFA 2QJMA 1US3A 3IANA 2VT0A 4JTEA 2W66A 4QDWA 3B06A 4G1KA 2PI6A 1OIFA 1KQYA 4XD5A 1LQ2A 4ACYA 4OKDA 1BYBA 5AVNA 3LPGA 2OLSA 2WCAA 3BW2A 2YKKA 4LBUA 3ZT7A 3LSBA 1CGXA 1THFD 1CENA 3PTKA 3MCMA 4MDPA 1XIHA 2DIJA 3SAZA 3MC5A 2J7FA 3KEHA 4LVAA 3FIGA 4IP5A 2VGFA 4YHGA 3NGJA 1RBOB 2E9LA 3ZJ8A 3DBNA 1TVNA 2VX5A 2IMRA 3LS9A 1MRQA 3QLLA 4DI9A 4P8WA 4RJEA 4RDYA 1OFQA 4JTLA 2J8GA 3PHAA 5D8WA 4G5DA 1W1A1 5I2UA 4LH8A 3A23A 1XGEA 3EKLA 3E74A 1GONA 1UUOA 4J7RA 2PTWA 3IJLA 3VABA 1HNYA 4W5UA 1T8XA 1Q2RA 1OHLA 4FB7A 4PMJA 3TMLA 2BOGX 5AZ1A 1ZJIA 4PGLA 4QX4A 3WLJA 5AC8A 4AQLA 1FY6A 1R3YA 3W1UA 1E40A 3LCHA 3FVDA 4KIRA 1XRVA 4QCEA 1RLDA 4ZQNA 3EDDA 4QSHA 2FFCA 4H00A 1DORA 3S47A 2DSWA 3MP5A 3NQCA 1XH2A 4ADUA 3O3RA 1S5WA 4GUFA 3ZR4A 3C2FA 2PCEA 3TFCA 2YXOA 2J79A 1W1B1 3WD4A 3GVWA 4LVFA 5T91A 2OGYA 3FKRA 1YLVA 2E6FA 3LA4A 4GI6A 4PTNA 2ABBA 5LNVA 3PFMA 5BWAA 4JN7A 3MP3A 4A6GA 3M0XA 1QNQA 5IFPA 2V68A 3OA3A 1K8XA 3KVMA 1F9CA 2FFIA 2ZC1A 4AZGA 1GOOA 1OX5A 2CNCA 2OSXA 2RFGA 2YBUA 4MZ8A 3TCEA 2BFGA 4LWWA 1QXLA 4CD4A 3BUVA 4JQ2A 4DX3A 5HATA 2R6OA 1FRBA 3DFYA 3V18A 4F9DA 3AROA 1U1JA 3WQVA 3PPCA 1ODZA 4XKYA 1JDEA 3QPYA 3HV9A 3C0QA 3GFYA 1XIMA 1ONRA 1KXQA 4G7EA 3E0IA 1NFPA 3FYPA 2GL5A 4OT7A 1IYXA 1AODA 1RLCL 3R43A 2OELA 3HIJA 4HK5A 1UKPA 2ISDA 1S5TA 4EKJA 5HANA 2WSKA 2Y7EA 3BARA 1E0TA 4PEKA 4Z08A 1VC4A 1ZTVA 4AY1A 3V16A 3VGBA 5AY7A 3ZZ1A 4MM1A 4N4PA 1P7TA 4QM1A 5EPDA 2JF7A 1T5AA 2J7BA 4M56A 4ZZ9A 1E73M 3BLLA 1XSIA 4MWAC 3T0CA 3W4RA 3KUMA 1V0NA 4A29A 3TKFA 2QXWA 3WUEA 3LPPA 2WZTA 1TQJA 1PVNA 3SJ3A 2YA2A 4HZMA 2QUVA 1SZGA 2BSLA 1ICQA 1W0MA 1QR7A 5DMNA 4HQVA 4TOQA 2WK2A 2E8ZA 4PA8A 3CTTA 4U5KA 3LQGA 2XUCA 1JYVA 3CH0A 1U83A 3HOJA 3NL5A 1C7TA 3GIQA 7REQA 3TONA 1K3UA 3EAUA 3KVKA 3IJ7A 1KCZA 4ZO9A 3UQNA 1GT8A 2YDAA 1UUMA 4PL2A 1UWSA 1H0GA 4NUWA 1G0CA 1NQ6A 1GCYA 3WQPA 3FGCB 1Z7AA 3F4CA 3G77A 4JNZA 4B2DA 1F74A 3N2OA 4IPPA 2E8YA 2Y7DA 3GXPA 4LQ1A 4QJ5B 4QFUA 3BXWA 1FP8A 1DWHM 1RXOB 1Q4NX 3R25A 3MSDA 1UP3A 2VX7A 3GDKA 3B03A 1QWGA 2BODX 3W7EA 1QHZA 4OOUA 3HB9A 4PE8A 2RDUA 3G24A 1XV8A 3CWNA 4A3UA 1TCMA 5REQA 2NVCA 4UQAA 3AS1A 3TXZA 5LNSA 4JX4A 2VFEA 2GWGA 3MBFA 2F6KA 3CS2A 4RPPA 1DWIM 1X6UA 2ANUA 3W1MA 3MHUA 1JZ2A 1GYNA 1CB7B 3DKJA 3WNNA 3DC8A 2O4QA 3MV11 2C15A 3FEMA 5JBEA 4ERIA 3RCMA 3TJ4A 4C1NB 1HFBA 4LY8A 2YW4A 1I0DA 4GGHA 1NM9A 3DYOA 4GZJA 3DFOA 3AIVA 4PSRA 2WAGA 3KP0A 2FH8A 2VFDA 2X42A 1EKOA 4WD0A 4XISA 3N2MA 1BYCA 2JIWA 3KM8A 1QNRA 5HBFA 1KRMA 1N8IA 3M4HA 3WLHA 3CQIA 3AMCA 2WLYA 3RCYA 3WQWA 4PMVA 4AMCA 3H70A 3W76A 3L4ZA 3F4NA 3WMCA 4E6MA 9XIMA 3LCLA 3WDIA 1RP8A 1HJSA 3RLVA 3LGGA 1CW2A 1QPRA 4GGBA 1LM1A 3WFLA 5I03A 4URIA 3FOKA 2QNEA 3N2BA 3ZLHA 1CECA 3LNPA 3RCNA 3IGUA 3WF1A 2BXZA 1CGWA 1UBPC 3H55A 4LUYA 4Z2KA 3N4FA 3A4WA 5FL0A 1F61A 2CKSA 3GM8A 4A3RA 3LM3A 2GJLA 3VD3A 1RY8A 4UOJA 1VLIA 3H2EA 1EO5A 2P88A 3OEXA 5A6LA 2GOKA 2OPJA 3WNPA 1YYAA 1GVOA 4B5WA 1E9YB 1PTAA 1QK0A 3V1HA 4HOXA 4E8GA 4ERAA 3NSMA 4PB3A 3F2CA 2FZ9A 4D8ZA 3E49A 2Z25A 1TMQA 3SUVA 3U7BA 5EMMA 3IIXA 3AS2A 1OGSA 4NAEB 4WF7A 4XZNX 1T0OA 3FDGA 3VFCA 2G3JA 3W00A 5E0FA 2QDGA 4EANA 2CW6A 3GE7A 3NO3A 4YN5A 1VCVA 1FWJC 3QRHA 5LGXA 4OGZA 1ZJBA 3TZFA 2X0YA 3GUWA 3EDEA 4DF0A 1GOKA 2HZGA 1S38A 5RUBA 1UR8A 1K9FA 5E0CA 1MMFA 4ZXLA 3CL7A 4MZ1A 1JFXA 1B3OA 2E5BA 3C0SA 2VELA 4H6KA 4Z17A 1O12A 2Z2UA 3F1QA 2I14A 4PMDA 3DH7A 3PTDA 2CZEA 3PNUA 4KKXA 4PC8A 1UB3A 1J18A 1S3TC 1A5AA 2EG7A 5CPLA 3CMJA 4OE7A 3ITYA 2X41A 3M5VA 1G4SA 3AXMA 2OO0A 4GYPC 4HOZA 3PWGA 4C5YA 1H7RA 4KS0A 1IT8A 5E1QA 3UJSA 2UY2A 3BWWA 1XCXA 1ITUA 2DZXA 1W8GA 4XD6A 3I6TA 2QT3A 4Z2IA 2EPOA 5CGTA 4JPGA 4GO8A 1TIWA 3CAVA 4WKHA 3H4WA 4AEOA 3FLUA 1ZRQA 4WOQA 4YPJA 2I56A 3M0MA 2VD9A 2GSJA 1J8VA 1BXBA 2FJUB 4NX5A 5BOFA 3WQ4A 3NQ6A 1JEZA 3OA5A 3QY6A 2ACRA 1J12A 3W1XA 4GI9A 2VNCA 4GINA 3WL1A 1DJWA 1I2RA 5JQ9A 3H22A 4NZFA 1QASA 4AU0A 3EWWA 1TV4A 1TUXA 3OPSA 1PKYA 3UG8A 3ITOA 1X98A 1Z69A 1UCWA 2Z1SA 3I7SA 4O8RA 2NQLA 3MTWA 2DSUA 2R24A 3GU9A 2CXEA 3WK2A 4UFJA 4LEFA 2VVNA 3OLGA 3ARYA 4ACZB 4DJEC 2YSWA 2WVUA 2Y85A 4KRZA 4J2MA 3QPZA 1EOKA 4WEVX 3S6DA 3JRKA 1LG1A 4IMEA 1GWJA 2E6AA 4FR1A 1TWWA 1TA3A 5FA5A 3GR7A 1GK8A 2J8TA 2YB4A 3UA4A 1KXHA 2I5GA 3QMTA 4LYKA 2AQOA 3G3MA 1SJCA 1EHAA 2CBJA 4JTTA 2Z1BA 4AZ7A 3IRDA 3ANYA 3WBAA 1ISYA 4C6FA 3GVQA 3GZAA 1Y5WA 1V6WA 3GC2A 5MF5A 3M0YA 4U10A 4J27A 5DQPA 1DJNA 4HA1A 3SN4A 4UTTC 1BTCA 3MVTA 4ATDA 2ZUNA 1DE5A 4AC1X 2J25A 1U22A 1UQYA 2WMJA 2BOEX 1CGVA 2XVPA 4IGHA 1VPXA 3AXHA 5FIPA 3TQKA 1XD1A 3QGKC 2W5FA 3WDHA 2O7QA 2HQAA 4Q4MA 2FVMA 4HNCA 4UTJA 3ATZA 4J9JA 1GEQA 3PZ9A 1XDJA 4D6FA 4PMRA 1D9EA 2W63A 3MMUA 4J28A 1VFSA 2GVYA 3SQLA 1VB9A 3MCOA 4CQDA 2X1TA 3SGGA 4HNLA 5DFAA 1EOMA 1H62A 2GQ3A 4AZIA 1ZJAA 5LHFA 4CLMA 1MYRA 4KCTA 1DWAM 3CQ0A 1K6WA 2AL1A 1EJVC 5A6MA 4ZENA 1OT1A 4R9XA 3QBUA 4NJKA 4S1FA 4TR9A 4AEEA 1RJQA 3ARRA 2WZHA 3ZO9A 5SWUA 4L61A 3BJTA 2OT1A 2YFNA 2B7PA 3NNTA 3KTXA 1J4EA 3CIVA 3SEPA 1WV2A 1I2PA 1SSDA 3Q37A 1XLAA 4JIPA 5ECUA 4D6JA 1W2VA 4JS3A 2ZTKA 3TC6A 1JUKA 4IFKA 5CH9A 4F40A 4KW2A 4US5A 3G6LA 1TREA 3NVTA 4H04A 2OYMA 5BROA 3DC0A 1OB0A 3GDBA 3QV9A 2A4AA 3WLKX 3LUTA 1ZNNA 2Z29A 3LTYA 3NQBA 4AZCA 3AHTA 2GUYA 3BLKA 4DZHA 5ABFB 4N9CA 1LZOA 4PFHA 2D3NA 1TPDA 4AVNA 1NTHA 4IMCA 3PPGA 2DT2A 4PUEA 3DZ1A 1LROA 4G7FA 4HA3A 5A8NA 5KTLA 3GH4A 1HUVA 1PHWA 3KL0A 1F2JA 3U5YA 3HJZA 4UWMA 4MNKA 1WAWA 3POHA 4HCDA 4DYEA 2NXGA 3GH7A 3LG3A 5K9CA 1VFFA 1WXYA 2PDQA 2QF8A 4GKLA 1JCYA 2CXGA 3WLQA 3DECA 4IOTA 1P1XA 4NSBA 2P3EA 5CXPA 1RD5A 4JIQA 2IQTA 3HPXA 2OR2A 2WJEA 2ZRWA 2DT0A 3HGSA 5LA2A 1UWIA 2AMGA 3DFPA 5LIXX 1GEHA 3E12A 1EX5A 3A5FA 2ZA1A 4W7WA 1B90A 2XIOA 3VOIA 1H11A 5HOSA 1FWIC 2HISA 4UXDA 3W74A 4O52A 4GIRA 1Z3NA 3KVLA 4B16A 2CERA 2CYGA 2BGNE 3AI0A 3VNLA 3V5CA 2E68A 4L65A 3EKZA 4DJFA 5GNZA 3SGZA 4YTTA 1W3NA 2CKRA 4Q6JA 3BK0A 3GG0A 4O57A 2DU2A 1ME8A 4GD0A 4DBUA 4O0QA 1B3ZA 4AWEA 5E9AA 2G3NA 1UPPA 3P8IA 1OYBA 1UA7A 5EY5A 4Q8OA 4QAIA 4AIOA 4PCPA 3ZT5A 3DGRA 2QGHA 3WFZA 1O5XA 4X0NA 5H8UA 3N6HA 3B0VC 2Q02A 3SSZA 4IIHA 1E1EA 5DCEA 2A3AA 3N3MA 4WZHA 3GRIA 2OQLA 2DUAA 1XD0A 3RJYA 1N2VA 4TXEA 1ZU8A 2R8WA 1ECQA 3UFYA 4Q7BA 2OKOA 1OF8A 1BYDA 3AFBA 3CUJA 1AD1A 5G2WA 2WYSA 3F03K 3EWCA 3B8TA 1QNOA 3NFUA 3SRHA 3A3WA 2GGHA 4N4QA 1JZ7A 1RZMA 4HD5A 2XPKA 3AIWA 1B0IA 4P5UA 4F3HA 1BKHA 3P60A 3S6OA 3SRKA 1QT1A 1E9ZB 5L9FA 5D9OA 1QCWA 1BWLA 4JDBA 2EPMX 1ZSXA 3GNNA 2IPWA 4LF2A 1B4EA 4H8HA 3CZ8A 3SIZA 2ZDSA 4JYEA 2OWCA 4ZSTA 2JK2A 3KL3A 4JAWA 3C4UA 1SM9A 4FOUA 3AYTA 5A1AA 1TFVA 1W56A 2FZMA 4O1FA 1NARA 4IIBA 2OFJA 3S5NA 4CCDA 3VK5A 1KV8A 4HJWA 2SFPA 3DFHA 5HQLA 2QVHA 2VWTA 4M51A 1S2VA 4Z42C 1REQB 2PB1A 3ARPA 2C18A 4DF2A 2Z1KA 2G8ZA 1S46A 3RU6A 2ESCA 4XUGA 4NVTA 1UJQA 2OWWA 4FXJA 3AXXA 5TQLA 4PB4A 1H5YA 4MIMA 1L9WA 3T08A 1FCBA 3LCFA 4ES4A 3M6DA 1QI5A 5BU6A 3CWOX 4YHEA 3LXCA 3ZJKA 3PZGA 2J6XA 4Q4SA 3BTNA 3TA6A 5AOUA 1M1BA 2CEQA 3OGSA 2VEKA 3BLEA 1TQXA 4JTQA 5I0DA 3BLFA 1LOQA 4GXMA 5I78A 1OBAA 1FH9A 4JIEA 5BMXA 1KBIA 2I17A 3MU7A 4H6EA 5CAHA 1QNSA 3AIUA 1AH0A 1IE7C 4Q6XA 4UQEA 4JD4A 2EQDA 4NZ5A 2Y61A 1Q2SA 2CLIA 2YJQA 5B7YA 3TSMA 4XAFA 3DFSA 3EPMA 1JPDX 3W28A 8XIAA 1XH0A 2Y5JA 3TJXA 1O66A 3VIKA 3WLRA 2HWGA 4ADTA 4C1LA 3IVSA 1DKWA 1JRCA 3EBVA 3MUCA 1LRTA 1HJWA 2PAJA 2DT3A 3CZKA 3A4JA 1NOFA 4ZR8A 1GYLA 3ARZA 5D33A 2VEPA 3PZOA 2GJNA 5F2LA 2HPIA 1T99A 4CCZA 3IUHA 4LUSA 1JZ6A 5CG0A 3TNBA 3PZTA 4YVXA 1TPVA 3APGA 4JFSA 4GNJA 4IIDA 2NUWA 4JIHA 1FFQA 5HAOA 1UD4A 3IARA 3KBSA 1E1FA 2X2YA 3B0UX 1BRLA 3C2VA 5B7ZA 3VIJA 1A3WA 2YXXA 3URNA 2QJNA 3LY0A 5DELA 2PCQA 4C6MA 2HTMA 2VEIA 1GKRA 1OEPA 4DO4A 4HSOA 2X7WA 3CV7A 4S38A 2R94A 4LF1A 1RPXA 2O4MA 2ZXQA 3EB4A 4MNMA 1OFPA 4AG0A 1S1PA 1B2YA 1VEOA 3H2AA 1K8YA 2VD8A 4S3CA 1E3ZA 1DQWA 4HU3A 1W8SA 1R3VA 2BY0A 4FLOA 4O4WA 1C8YA 1LLZA 1GG1A 4DWDA 2ZIDA 1KV5A 2PLCA 3QZ6A 3WH9A 3HURA 3I6RA 1P6BA 4I5UA 1H50A 4BEQA 1GVFA 3W7KA 4IM4A 4W9TA 2H90A 2QJIA 5HA7A 3WD2A 1B3YA 1TJ2A 1Y8BA 1H7OA 4MHBA 1EYWA 5M1TA 4M8UA 4EOUA 3N18A 2NUYA 1AW5A 1RK5A 2CZVA 2GVGA 1U1UA 3FGCA 3E96A 1UMYA 5HK4A 3CQJA 1TX0A 3B8WA 4GVFA 2YLLA 3ARQA 1ME7A 3WBEA 4YTQA 5HPCA 1LBMA 4GQQA 1TYGA 3WLPA 2G95A 4JTSA 3E1F1 1QPKA 1WQ5A 2BMBA 2XIBA 1A5UA 4BQ5A 2TRSA 1NAL1 3PJUA 1YXCA 3RF9A 2CWXA 4FOKA 3IS4A 3VOGA 2NQ5A 5LIUX 4GCXA 4YWSA 1IXNA 5JMUA 1W3JA 3S1VA 2GGEA 2HVNA 3PG9A 1UP2A 2HS6A 1A49A 5HMDA 3K4DA 4MF4A 3V5FA 1FQ0A 3KRUA 3WH6A 1DIDA 1OC5A 4U31A 5AHLA 1OFOA 1UIPA 2VGGA 4AD2A 4JTCA 5AHEA 2WWDA 1NWSA 1E0UA 2FYMA 2QCHA 5LA0A 3ARWA 1EDGA 5A8MA 3TH6A 3W6MA 1D3GA 2IKHA 5G2HA 5C2GA 3W53A 1V02A 3QSTA 4LTSA 2QCLA 3G1XA 3R1ZA 4WDXA 1G4PA 3KTCA 2X2GA 5HJYA 4Z1DA 4HPHA 3VX0A 4GQRA 4IP7A 4DY1A 1KFJA 1TJRA 4QCFA 4UCGA 4RXFA 4JTGA 1UP0A 2QUTA 5LIYX 4ZODA 3RK8A 2E9MA 1XYBA 3PBYA 2P8CA 1LT7A 3H24A 4GUHA 1I0BA 5KEZA 3SCVA 1OD8A 4W88A 3WK3A 4PUNA 3UCQA 3L0GA 3V7PA 4IG2A 4ONVA 1UWTA 1IZJA 1K9EA 3BW4A 3UF9A 1PSCA 2IQ0A 4BEUA 5K4XA 1W3TA 1G01A 1DJGA 4QG9A 1FWNA 3PN8A 1TJ1A 1SFJA 4NZ3A 3SCQA 2XSXA 4KESA 5IXEA 2BV9A 4XBKA 1KLZA 4BA0A 4BQ2A 3S42A 2GDQA 2DY3A 5CSSA 1N82A 4MADA 5DY3A 4Z2LA 3QN3A 1C8QA 4CGTA 4HYVA 3KBWA 3OBAA 4LUIA 2IPFA 4DBDA 3ABXA 4E5TA 1H7NA 3CQHA 1PE1A 3O6YX 3ZVIA 4RKAA 4O15A 4ZEPA 5DCBA 2G3IA 4LYPA 4UZSA 3W24A 4QE4A 3E02A 3M5XA 4A2RA 3QY7A 4A2SA 4GZEA 3STGA 4IQEA 4QHRA 1HN1A 5CAKA 3TN3A 1B57A 1SPQA 2F9RA 4M1BA 3CEPA 3MI6A 3APYA 3W88A 1TPUA 4XO7A 3FXGA 4ZMGA 1ZAJA 4BCEA 1AH4A 1TZ7A 1CLXA 3GHTA 3SURA 2J13A 5I3HA 3W9ZA 1ICPA 3MB9A 4AUBA 4W7UA 3RGTA 3PFRA 1CEOA 3N73A 1HKKA 3SUTA 1IXOA 1W9PA 3W6YA 5I3GA 2YL6A 3L2LA 2Y7FA 3N04A 1V7AA 5E0KA 1KRCC 2GWNA 4OQVA 5DANA 3NZQA 2FHBA 3VNDA 3DHDA 1H51A 3R2GA 1XBVA 3L2MA 2W6RA 4MYXA 1WDRA 5FJIA 4FALA 1C92A 2WXDM 3GTIA 4LC6A 4LYQA 4WY0B 1W9VA 1EYEA 3BW3A 1ISZA 2PGRA 2A0NA 2VOMA 1K7EA 3LHTA 3CL6A 3LCXA 3TTQA 4ASTA 3BOLA 2ACUA 3DHPA 3VCNA 2HNHA 1J0KA 3OHMB 4ZOCA 3S5YA 5D9MA 4FX7A 4MWAB 2A2IA 3NA8A 1I2NA 1XIGA 1XXXA 3AMLA 3QR1A 2ZCGA 2OOGA 4AHPA 3AO0A 2V8ZA 4WKFA 3GDRA 4GUGA 1D2KA 1KBLA 4QQUA 2WM0A 3TOYA 4Q7NA 2D73A 1XUZA 3L12A 4O4VA 1K8ZA 1I1XA 3OP2A 5F4SA 4O1BA 2GYIA 1Q85A 2ZWZA 5J04A 3VM5A 4PBEA 3RR1A 4F0LA 3KTSA 3NIYA 4FLSA 2YCJA 4WVXA 5T8GA 1CWYA 4QXIA 4HBKA 2XINA 4F0RA 4B2DD 3WLOA 1RK6A 1VRXA 4UMCA 4F79A 2QCEA 2ZRYA 3SJNA 1JI2A 2CBUA 1F6PA 2C79A 2E28A 5FSEC 2W0UA 1H4PA 2B81A 3EA3A 1A5NC 5FF3A 1PZ3A 1W9BM 3QFEA 1Q6FA 1V3HA 3KX6A 4Q8UA 2DVTA 3BE7A 3RRXA 5LSMA 4RE3A 4RZ6A 3VKJA 3TV8A 3W2NA 5JU6A 5TIMA 1GZGA 1M5WA 1OFBA 2EAWA 4XK2A 2WBKA 2B31A 3CGTA 1TV3A 1JZ3A 1UMLA 4IWWA 1PYFA 3LX9A 3KLKA 2DFAA 5F2GA 1ZAHA 3GD6A 3URBA 2ZX7A 1QBBA 3KVJA 3UJFA 1V93A 1JFHA 5D9NA 4BZYA 4IPJA 2BVWA 2RH9A 7PTDA 3UG5A 3HZ3A 4UTFA 1IIGA 3OVPA 2W79A 2Y62A 1X97A 2F61A 1E0XA 3R13A 4GVHA 3DFTA 5GPRA 4DZ5A 1CT5A 3G1SA 3VPLA 4XWUA 1R30A 1KKOA 1VFLA 4MKNA 1L2UA 3NOEA 1AMYA 1HJXA 4F8XA 4PCFA 5K3VA 2C0AA 3LLXA 3SCPA 4CU6A 9XIAA 2QQ6A 1G7UA 2FJKA 3VIHA 5L6UA 3O7UA 3NQDA 2VCCA 4RE4A 2CLPA 2NQ9A 3VD5A 3CHDA 4FNPA 3OGRA 1W1ZA 2FZNA 5FKYA 1M65A 3A64A 5AKQA 2BXYA 1ONEA 3SY8A 3VKBA 2WMIB 4DM1A 1XFCA 7XIMA 5C6MA 2VGBA 3CUZA 2PU0A 4IQDA 2KAUC 5A69A 6ENLA 3ZS4A 3ITVA 1W3IA 4NNAA 3VE7A 1QPOA 3OB8A 5DRIA 1IIHA 5A94A 4Q33A 2BB0A 1DEDA 1LDCA 3IUIA 1DIKA 3DYMA 3MWCA 3PY2A 3P80A 2GSEA 4KRTA 3OIHA 3CZGA 3M07A 1ZY9A 3KCOA 3VI2A 4LUJA 1EWEA 1FH8A 1JD7A 2GK1A 4XSMA 2D2OA 4W8AA 1XGDA 4NXSA 3UWVA 2O9TA 3ALGA 4J3SA 3RM4A 2YR1A 3FCPA 4O1EA 4YL2A 2FLIA 5I3DA 2Z24A 2J8FA 1UH3A 3KL5A 4CEXC 2Y6ZA 4JTHA 3PTMA 4CNPA 1NQKA 4C6KA 5E6ZA 2VR4A 2LLEA 3FN9A 3GY1A 3DAQA 3GU1A 4L7ZA 4L6DA 1VD6A 3DESA 2IPGA 1GOXA 2C14A 3P5YA 7A3HA 2V5JA 3GSMA 2PDWA 3OG2A 2QMJA 3WQ6A 1WUEA 1YNQA 1S3HA 5KZEA 5DY2A 1XRSA 2EPHA 4HKPA 3AMDA 3C6CA 1UR2A 3RM8A 3BZGA 1TTQA 3K13A 2VZVA 1XX1A 3WF0A 4GKTA 3VDCA 5FAJA 1KQZA 3RPTA 3BH4A 3FA4A 4TX9A 2BNJA 4QLJA 2X1UA 1WNOA 2FGBA 1EIBA 4JICA 3TWAA 4R88A 4JTKA 2JGQA 1FCVA 2BY3A 1O68A 2BVTA 2VVSA 1UZHA 1K6AA 3IIZA 4J5NA 4ZL1A 4Y7EA 3BO9A 1ZQ5A 2G5WA 3O0FA 3ZVHB 3VC6A 3CHEA 2V5LA 3M7SA 3UR2A 2G0WA 4HU4A 3TZNA 1KO0A 4XD3A 4ENLA 1N8WA 3CO8A 1LL4A 1W1TA 1YBQB 1WP6A 3KAOA 4CU8A 1EBGA 1X1NA 2WJZA 1QO2A 4KETA 2ZUUA 4IH3A 5BXRA 2ZBTA 1X6NA 3FS2A 4YTSA 4MY1A 1E6ZA 1KKRA 4WGHA 1TWZA 2QV4A 3W07A 4C6OA 3UR8A 1KM5A 4MZYA 2ZTJA 4F0SA 3KFTA 1BQCA 1NELA 2J88A 3USZA 1FUYA 3KBNA 2A3EA 4DUWA 3TUUA 1UR9A 2XGIA 2V9DA 4QROA 1ODUA 4C6QA 1EA9C 4H4IA 4RE2A 2G4FA 3S1WA 4DXXA 1PWLA 1IR1A 3SADA 2Z6IA 2VC7A 4GBUA 3EA2A 1LQAA 4W84A 3W7GA 1CGTA 4Y2WA 3B3DA 4Y96A 3SCUA 1ECEA 2CLOA 1MQRA 3EXSA 1G4TA 2ZXAA 1UUQA 3GXTA 5AHIA 1UG6A 1JI1A 2IUZA 3S5SA 3CBWA 2ATSA 3MT1A 1ZBKA 4PL1A 2F2HA 2VFGA 1KFCA 1T96A 1VCFA 4QQ3A 2DH3A 3T4CA 3CZLA 3SY1A 3A12A 4I90A 4PMUA 3B05A 2PBGA 1KXVA 2E09A 1QW7A 2OEMA 1MUMA 1QO5A 3ME3A 4MJ2A 3AIEA 4G2DA 5D2YA 2QF7A 4GIYA 3GXNA 3W85A 3GXDA 3N2CA 2BP1A 1XPYA 3SCRA 3SDOA 4ZE4A 3QR3A 1V3JA 3QXBA 3WJZA 3RX3A 3N1AA 1WE5A 5BRQA 1QPQA 4Y9AA 3CAQA 4IJCA 5AYZA 3GIPA 5T9BG 2XM2A 2W27A 3TFXA 1PYMA 2RUSA 3G3DA 3TROA 1VLWA 4HU0A 5BRBA 3R5EA 3ZSSA 1AJZA 1G67A 2FTWA 3LXAA 1BKSA 1Z8AA 4QJ3B 1KRAC 1R7AA 4ZQMA 4AHOA 1F76A 4US5D 4XV0A 5FF2A 1W1PA 2VHLA 4U3CA 4ZQCA 3VKKA 4QS6A 1E3XA 3PBUA 4M6QA 2O7SA 1R3QA 1NY1A 2C91A 1D7FA 1Q45A 4P7LA 2E5DA 3DX5A 1XBZA 2VZSA 3CIWA 1ESWA 2BZNA 4OFCA 4US6A 2YL8A 2YZRA 4J2PA 1T7LA 3WQFA 1UIOA 2JQXA 2FGZA 3SB0A 3RUBL 2Y24A 3P93A 3CQKA 3SGUA 1YPFA 1YDNA 4G6CA 3IVTA 1UKSA 3LCIA 4BY3A 4NJHA 2EXOA 3GBDA 2P0IA 3PSWA 1DTUA 3L4TA 3SFKA 4QBXA 1MNZA 3C2OA 3ZWTA 2PDLA 3V0UA 3P8JA 3HPAA 4K7VA 5CPQA 4B4HA 2XVGA 3BMXA 3IAPA 1HKJA 2O55A 4IUGA 1GG0A 4GFSA 2WNZA 2ICSA 1LUCA 3EWYA 4EE9A 2KX9A 4AX6A 3NM3A 3MUAA 1KCLA 3R8RA 4AFYA 4B5SA 2FZBA 1HKVA 3T09A 3S2LA 1R5YA 2B0MA 2OO6A 3PJXA 3DENA 2XZ7A 1Y5XA 4JHOA 4MFEA 3IJIA 3KOYA 3CASA 5CPNA 2E0PA 3W2LA 3TR2A 3G6MA 1XBYA 1D3HA 5EYWA 3UZXA 1KFBA 4QG8A 3S83A 4MY8A 3STFA 1LL6A 1JL8A 4JDYA 1M04A 2CBIA 1RQHA 2DZAA 3SN0A 1WOBA 3NPXA 3NYDA 3EX1A 2R1MA 1FHDA 4OUIA 3YPIA 3W7RA 2DVUA 1SQ7A 4E2OA 1OT2A 2AOSA 1TMHA 5FJJA 2Y63A 3UBPC 3D47A 3W72A 1IGWA 3FAWA 1MFVA 3T6CA 1R2TA 4EXQA 4KBXA 3NAVA 3S2NA 4NJIA 4KEUA 4LVBA 4E2BA 4WCJA 1Z89A 3KWXA 3O0KA 1SR9A 3AHYA 5CC3A 2QAPA 2V6AA 3S6TA 3NQGA 3BJSA 1G9HA 4LU0A 1BVNP 3MKCA 1O1HA 4D8LA 1XLFA 3QR0A 1CYGA 4DWSA 3WH5A 3QTGA 4Q8TA 1P0KA 4NRSA 1GOWA 4LYRA 3EWZA 1UZ4A 2TYSA 1M9HA 2XFWA 1EBHA 3M0VA 1EF3A 1B1YA 3S2CA 2VZOA 4A3HA 2XM1A 1GJWA 2XVLA 3NOYA 3VNYA 3N3TA 3TE9A 2CIPA 1E4MM 1KFEA 2PDXA 1Q13A 2WM1A 4ZB0A 3UR7A 4NNCA 3S9IA 2QCNA 2NXHA 5FSDC 2BHZA 1TMLA 1N55A 3TJLA 4GZ7A 3UT0A 4WY0F 2F84A 2NLYA 2BVYA 4KEMA 2C7FA 1OFAA 2G50A 3DFNA 3PUGA 3UR5A 5I00A 2DT1A 4JL1A 2AGKA 3UZYA 1O4UA 5I3JA 1XC6A 3CO4A 4ERGA 1BLIA 3IV8A 2GJXB 1AL8A 4UTHA 4JBRA 5EMUA 2X1RA 3U57A 1Y5VA 1FWCC 3K5XA 3NPUA 2HK0A 1KW1A 4RNFA 2JEPA 4V1XA 2R1NA 1O94A 2GQAA 1NJJA 1DWFM 3AZTA 1XR2A 2YCKX 1MXSA 1P0EA 3BGAA 2QV5A 3A9BA 5I79A 2PLJA 5JIPA 1JUBA 4JIRA 3ZXWA 3AHVA 3WF4A 3BMWA 1LQ0A 3ABQA 1C7SA 3TIMA 4RZ4A 3UNDA 2PF0A 1FWWA 3TTSA 4C7GA 1KM2A 2G41A 4I5RA 1OFEA 3W7NA 3B4YA 3QHOA 1AW1A 1E6QM 4AWTA 5D09A 3UZWA 4PN2A 4NIRA 3RO8A 4JY9A 4MKVA 4JHZA 2XYLA 1FX6A 2AL2A 2Q6ZA 2QDDA 2GJRA 3U48A 1EC7A 4HCLA 1H5VA 4L4OA 3GXIA 2D1ZA 5CJNA 5EL1A 1R7OA 4M81A 1RHCA 4AVOA 5DMYA 3ARTA 1PIFA 4UOQA 4HK7A 3WQ5A 1TPEA 3OVQA 1OYAA 1YQ2A 1TO3A 1V79A 4OZOA 1CXKA 2PDYA 1CNVA 3CUHA 4DO5A 3WFAA 1GW1A 4Y90A 1OC7A 3P5ZA 1UZ1A 1CGUA 3FXYA 1XC4A 1LOSA 1Q3NA 4OIFA 3HMJG 1SZNA 3N6JA 4CEUC 1VHNA 1OWQA 5AFDA 1XFBA 3N4EA 2FZ8A 1RVGA 4ZVJA 2C71A 3THDA 1BYAA 4X61A 1Z41A 4QISA 1S5MA 2BS9A 3IWPA 2A3CA 1K9TA 5HNRA 4MSSA 3P62A 3MPGA 2YDRA 4LT9A 3TDFA 3ZLFA 1TPFA 2ISFA 3G1YA 4CVWA 4LRTA 2VI0A 2Q09A 3Q67A 4H8NA 4TV6A 5FEWA 1K1DA 1VRDA 2XSBA 4WUIA 4E4UA 2EJAA 1EPVA 3M44A 1EB3A 1GVQA 5DEZA 4WDTA 3W1LA 3AUJA 4G9PA 3HU7A 5CBBA 1R3RA 4JN6A 3B04A 1Z42A 3AICA 4Q8PA 4MYAA 4DB7A 4C7FA 3GHUA 3MMDA 5JVLA 1RUSA 1XKJA 2UV8G 3N9RA 3UY7A 3PAOA 4H8UA 1VENA 2OTDA 4K1GA 4QGCA 4WSJA 3LRMA 4FNRA 4K8HA 2UZ9A 5F1VA 4JFVA 4H9MA 4B3LA 4AWSA 3HMCA 4W8LA 2OODA 3ONBA 4C6NA 3WLLA 3QW4B 4GZIA 4Y8EA 3UWWA 3OBEA 1O7AA 1ONXA 5T9CE 4D6IA 1DYSA 3CXOA 4RCXA 3ABOA 1ZBWA 2R82A 1P4CA 2XTKA 3DKLA 3S4TA 3ARVA 3PF3A 1QJWA 4REQB 1AK5A 3HJEA 2PZ0A 1MDLA 3L4WA 3GVRA 2YCEA 2D2JA 3W27A 3VM7A 1KWGA 2XFRA 3FK4A 1JPIA 3U4FA 2B7OA 3QC3A 3ITTA 4XIMA 3SQSA 4GX9A 1CB2A 1XF0A 1XJBA 4BI7A 4R53A 1QHOA 1GVIA 2OZ0A 4PBFA 1FWDC 1C90A 3XIMA 3EGJA 5HWJA 2BY2A 3VCCA 2Y88A 4HA4A 5KSWA 3PZUA 5CC6A 4DJFC 1YMYA 4MLJA 3H2NA 3VAVA 2VRKA 4S3JA 4RXGA 5D05A 1MXDA 4LXFA 2WVTA 1GPFA 2WVVB 1ITXA 4NZ1A 1R8LA 3OZPA 4BQ4A 2HXUA 3NQVA 3G0SA 5EB8A 4A8LA 3GZ3A 4TX6A 2E9BA 3C61A 3RLGA 3BLOA 1YKWA 1J0HA 1ADDA 2O92A 4N2YA 4DM2A 1GJPA 2FTYA 5LNWA 1UH2A 2V30A 3URAA 4HNOA 1EEPA 2C8NA 3WK0A 4GUIA 2GVJA 2WNWA 4G56A 3O6DA 4TMCA 1FWTA 4D1IA 1VFMA 4XZLX 3RFAA 2RGLA 2UY3A 1H7XA 1O95A 2J9YA 1B3WA 5H91A 2ZUWA 3KBVA 4RL3A 2ZRXA 1E4IA 2XH7A 1DWJM 2Y0FA 4CD8A 2QJGA 4MB3A 4HPGA 3G22A 1MUWA 1OX4B 3UNTA 3W86A 3VD9A 4FNQA 1PB0A 2ZA3A 3ABZA 3FJ4A 4NG3A 3H53A 1BVZA 2XZ9A 2ATMA 3SCNA 1R38A 3ZR6A 1NSJA 3ZYZA 4JKMA 3VOCA 2CFFA 1Y0EA 1L6GA 1KB3A 3B40A 3IVUA 3WG6A 1X1ZA 3QOMA 2QUMA 2EGZA 1NP2A 4EAYA 4UR7A 4LW7A 1OABA 4JTRA 5JH2A 1ZB5A 7ENLA 2DEPA 1LF1A 1R87A 3C3UA 4BWLA 3O07A 2V2HA 3N34A 5FF0A 1XSJA 3LBMA 3WY1A 3FSUA 3UYIA 1KCKA 4UFLA 1UD3A 2NVDA 4K39A 3TJIA 4JQ3A 3NGFA 1Q7QA 1HP5A 1Q6QA 3REQB 9CGTA 1AL7A 3GS6A 2OYKA 2Q3OA 4HSNA 3B9NA 2DPEA 1QW9A 1J0IA 4AISA 1KBBA 1TKKA 1NDWA 1F6KA 3VXGA 2O9OA 5A8PA 3IGHX 3NWRA 2MNRA 3K46A 1ITCA 3HGJA 1CXIA 3TAKA 3KRBA 1I9CB 1Q7ZA 4LY4A 1VFTA 4K37A 3L0KA 2EBNA 4MKSA 4AF0A 4NYUA 1KTCA 5HNUA 5K9DA 3B8IA 1O1ZA 3LPFA 4ZOBA 1H0IA 3QGAC 3RLHA 3HM7A 3K30A 1ISXA 2OZ8A 1GTHA 1PKNA 1CDGA 5I7GA 5E6YA 1G1YA 5C71A 3UJ2A 5D2TA 1VBUA 3FVMA 2XIMA 3E5BA 1UKQA 2FPYA 4PMXA 4CNOA 2CHRA 4FNUA 2FTPA 2QHAA 4PMOA 4ZBCA 4DVOA 1WXZA 4Z1CA 3KZPA 1E9IA 3R8GA 4DYKA 1A0CA 5I09A 3COTA 1V0LA 3AOFA 3DOPA 4A22A 3LV5A 3IJ6A 1TRDA 1QK2A 1TX2A 1CXEA 4GX8A 3QQWA 5ABTA 3W7CA 4AX7A 4N9DA 4KIEA 4QIUA 1TJ0A 1US2A 2WCGA 4DLMA 1YBQA 3EMQA 2H9AB 1M3UA 4RLIA 2PC4A 1XSKA 3GIYA 1XQLA 4FIRA 3GTNA 4OOZA 2DQWA 1AD4A 2DZUA 2OEJA 8CGTA 1I2OA 1RBAA 2PBOA 3M16A 4LAUA 4Q4QA 4HA0A 3L4XA 3UWEA 4A35A 3WD1A 1KCXA 1TV5A 3VILA 1P5BA 3FY1A 1MEWA 1PUDA 4AZ6A 4DPPA 4EP8C 3A24A 3M1ZA 1X38A 3TNOA 3FKKA 3TSBA 2ZRUA 4QJ4B 1RBLA 2XDFA 4MB1A 3LNMA 1HGWA 3QY8A 4Q3MA 1HVQA 1V6VA 2G97A 1UWQA 2CESA 1POJA 1JCMP 1VF8A 1TTIA 1EZWA 3G8RA 1HG3A 1JZ8A 4H1ZA 2F7FA 4LCQA 1C93A 1ALDA 3S2MA 2QCFA 3RJXA 3HGOA 1JR1A 4UTUA 2DDXA 1E1CB 1JNDA 5FJOA 2JBMA 3NO1A 3CH9A 4C6PA 4UTWA 2ZE3A 3HG2A 3F2BA 1OF6A 3CIXA 3XISA 3NQ8A 5LA1A 4GQBA 1LWIA 5IHRA 5F4XA 2IPJA 3GFXA 2QPUA 3ZR5A 2A85A 4MB4A 2A79A 4V28A 4R3UA 3THCA 4A21A 4HSHA 3TMQA 1YW1A 6A3HA 3W3OA 5BRPA 1ZZMA 4O53A 1I6NA 5DX7A 2EPKX 4YCOA 2ZDRA 4O14A 3UVIA 1XQKA 1EX1A 4L6OA 4MMWA 5CG7A 2GGIA 2PRMA 2PE4A 3TX9A 3U9IA 1FVPA 1XLIA 4D6HA 4NT0A 1UC5A 3MKKA 3O9NA 4CQ8A 2BY1A 2QR6A 1DOSA 1BD0A 3P0WA 4UMBA 5I02A 5A8OA 3RR4A 4M1RA 2QCDB 3IRSA 5IDIA 2YOCA 1W32A 1HT6A 3AIBA 3T07A 1U1HA 2YL9A 1E43A 2X1SA 3VMPA 2A7PA 4L80A 4L1GA 3U0HA 3VGHA 5H8MA 4PBGA 1M7PA 2VX4A 5MHBA 2BOFX 4AY7A 2CLMA 1ISWA 4LEQA 1ZHAA 4LSBA 2CPUA 3W7QA 1I4NA 2J7GA 4TUFA 4UFKA 1W37A 4HN8A 4GA8A 1JQVA 2HSAA 3T05A 5CPMA 4L4LA 5C0QA 4IIGA 3UETA 4DF1A 1LJYA 2OCZA 2ABAA 4C60A 2GFTA 3EWUA 1TB3A 1HL8A 2ALDA 2D23A 4ZTXA 1B5TA 3NEVA 2NQJA 2R14A 1C8XA 3PNZA 1ZFJA 4IMAA 1KM6A 3ANUA 1YTDA 4R7JA 4H6RA 3NZPA 3F4VA 1W9UA 4DEFA 2WOQA 4R34A 3EX6A 2Y8KA 3QKZA 4LALA 3MS8A 4HGXA 4K6AA 5IOBA 2YCIX 4NZ4A 4RR4A 1KGUA 2D24A 4KRUA 1HGYA 4UZUA 1JDCA 3RYSA 2Z7KA 3QJAA 4KWSA 5I5RA 2WLZA 3PS7A 2WANA 3AHXA 1OCBA 2PWFA 4D72A 3UESA 1NWRA 1TTPA 1QUMA 3W2UA 2DH2A 4JQAA 1TWDA 4JZ5A 1RV8A 1M7OA 1RP9A 4HNVA 3AYRA 1HO1A 3MZNA 2BX7A 3ISIX 1WDWA 3B4UA 1S39A 3VOHA 1TV7A 2V5DA 4XAPA 4J3VA 4X9SA 4D2JA 1M53A 2FPVA 1JG9A 5F7UA 2DUZA 3SBFA 3FJNA 3BVJA 4FEZA 3DI0A 3MUY1 1N7KA 3USBA 3VUSA 1E5NA 2PDCA 4WLCA 1E4NA 1QVBA 3SCWA 4BS0A 3MA8A 4B15A 4ZB2A 1CX9A 4DIAA 1JGIA 4YTUA 1KC7A 2XH4A 3FA5A 1Q5MA 1WZKA 2RJHA 4XKYB 1XYLA 1BQGA 5AYXA 4HYRA 1Q66A 4G7EB 4YVVA 2VQTA 4PFMA 2WC4A 3K1GA 4XSLA 4L5ZA 5CPTA 4ROPA 3RNDA 2QCCA 4UQCA 3Q65A 1VH7A 2C1GA 1FXPA 3CZJA 4UQBA 2OB3A 4XZHA 4BI6A 1TZZA 4GO9A 2WHKA 2W62A 2CITA 3HFTA 3QVQA 2XU2A 1VKFA 1XLDA 3K8KA 4W85A 3JVAA 4H19A 4UCFA 4CD7A 3SECA 5A6AA 4L1WA 1KM4A 2E5CA 2PEVA 4TMBA 4RZ5A 1B30A 1E55A 1Q6EA 3VTRA 2HE8A 1EXPA 2ZUSA 3M0IA 4E8DA 3LSCA 1W1YA 3VNZA 3OVRA 4P7RA 4L4PA 3LI0A 1BG9A 3WJYA 1YPXA 2VXNA 3S2JA 1W5NA 2DV0A 3Q94A 2POZA 2I16A 3W38A 2Z28A 1NIUA 3PUOA 3EDJA 3RRAA 3KOFA 4UTKA 2ACQA 1VJZA 2HV5A 3R7MA 4GVIA 2XIQA 5IRPA 1U33A 3ZLGA 3WNKA 2PP0A 1ML1A 2BHUA 2BBFA 4NAFB 2YA0A 3CHVA 3CNYA 3VFLA 3IK4A 3QF0A 2X09A 3UA3A 3LMYA 3SUWA 4EWJA 5E09A 2OEKA 4M80A 3ZJ7A 3OYZA 1H1ZA 3S8HA 2VKZG 4RV3A 2REQA 3N2XA 2Y2WA 3D5HA 4M3PA 3B0YA 3OZYA 2GJXA 2NT1A 4XKMA 3ZIZA 3WQ8A 1JDAA 2YFOA 4OVXA 4HNUA 1A47A 2GVEA 1EA0A 3I65A 1ADSA 1W17A 3CUXA 3LTPA 2DUXA 5REQB 1HL2A 2OG9A 3LCGA 2DGAA 1W3HA 1KTNA 1RQEA 1MUCA 3FA3A 3U2EA 2O56A 1YADA 3W87A 3S5OA 1B3XA 2TMDA 3ZM8A 4D6CA 2RJGA 2VRJA 2QIIA 5G1MA 1I2QA 1JZ4A 5BOEA 3EOUA 3HQ1A 4NXKA 1S5NA 3GH5A 4XBJA 1JAEA 5M2FX 1XRFA 2NZLA 1FP9A 2ZX9A 3UWUA 4W89A 3IEBA 4UOZA 2PUZA 5DF0A 5F2IA 4U3AA 2JKPA 3P67A 3CTLA 1UR0A 1GJUA 2NQZA 1YDVA 1EJ7L 3VD4A 2YCLA 2XVNA 4LUTA 4MNJA 1UR3M 1FWEC 3EPNA 3IV3A 2PGWA 3S0CA 2PSNA 4P8VA 3W01A 2VDIA 4FMVA 1SO3A 1DJIA 3GTFA 4A8RA 5LXXA 2VQUA 1SGJA 3WLSA 5BMWA 2CCRA 1J93A 1LORA 3ALFA 3MDWA 4Z0SA 3W83A 1WAUA 3V3WA 3NM1A 1VHCA 1R0MA 1G4EA 4IGMA 5ABGA 1PX4A 2BGQA 5BXPA 4GY0A 2C3ZA 2WHMA 1HTIA 3TW7A 3WUBA 4B91A 3RG6A 1KGXA 1B9ZA 4IGSA 3RO6A 2E3ZA 1MNSA 4BHYA 1JZ5A 3ZT6A 4IXXA 3N4AA 1TPC1 2Z2BA 1SFTA 4UFHA 3KS6A 3KW3A 1X6LA 2BDQA 8XIMA 2VUYA 4IFRA 2VGIA 1J01A 3QQ0A 2NV2A 2DW6A 5CJ5A 1HJUA 3UW6A 1J0JA 3IUDA 4C6DA 1XINA 3W1NA 4JTJA 1I60A 3SUUA 3M43A 4PTMA 5XIMA 1WX0A 4UTIA 3IACA 3PPHA 3VGEA 4N0RA 4Z2JA 4MAZA 1WKFA 2POTA 2YYTA 3UG4A 1LWHA 4I7WA 1WBJA 2P5NA 3DG7A 3PM6A 4RNIA 1EJRC 3VDBA 1GW9A 3AWOA 4EPBC 4C6BA 4CQBA 4ZQPA 3AUOA 5FF4A 3N11A 3LZ3A 3VZYA 4F2TA 2ONEA 2RGMA 4O17A 3WH7A 2XH2A 4QSFA 2OVLA 4X3ZA 2ACSA 3RHGA 3EWXA 2IKGA 2DZBA 2DIEA 3NQEA 3A3XA 2PURA 1H2JA 1MW1A 5LNUA 3VA8A 5JXQA 3EDKA 1YXYA 4JEJA 3P7YA 4NY2A 1WA3A 3LK6A 5CZSA 4FAMA 2PRHA 4KQNA 3HGRA 2QAFA 2CLEA 4DWSD 1A3XA 3G18A 4Y6GA 4HP5A 3O15A 5B80A 1DP0A 1U5VA 2EKGA 3NUKA 1XCFA 4EF8A 2V5KA 3RDKA 5H6HA 1YNPA 1Z32X 2QJJA 3QW3A 5CLTA 1G94A 4N6FA 1AH3A 2VZTA 5G1TA 3AXIA 1EP1A 4O0KA 2YIHA 3L21A 1JCNA 3GYCA 4MG4A 2R1PA 3W81A 5DXYA 1GYMA 1S2UA 1FCQA 4A8IA 4LC8A 3BLDA 2PODA 4PUUA 2DZSA 4ZOEA 4ML4A 1DE6A 1DHKA 2WQPA 1EXBA 4UNLA 1ELSA 1V0MA 1W6TA 3FJLA 3JUGA 2QPSA 2D2GA 5H1WA 1V7YA 4HMNA 3TK7A 5HJXA 1ZBVA 1DBTA 1X8FA 1N8FA 3THUA 3L9CA 7CGTA 4XBSA 1UJPA 1TA3B 3T0AA 4IJBA 3TR9A 1XLEA 3H7UA 4CQ9A 4UMAA 4V2XA 3SZ8A 1K8CA 2ZQ0A 1CGYA 1AG1O 3SRDA 1UD2A 3TN4A 4Q4KA 4N9EA 3GX9A 2A5HA 3T4WA 1XRTA 5J5RA 3L2IA 3AXKA 4UFIA 5AZ0A 5CC5A 5FAGA 2AGTA 4QRNA 2WSQA 3AIQA 3DHUA 5I23A 3CL8A 2E7FA 3BCFA 1TIMA 1CIUA 2WZIA 3ZFHA 4GH3A 3HBLA 1L6FA 3AJ7A 4PCSA 3UXIA 1TR1A 1QOPA 3LBOA 4MDOA 1K03A 4GY1A 3W1QA 2ZADA 1Q6OA 2PP3A 4E2VA 2XIIA 1UWAA 4DNMA 4U5IA 3FJ6A 2GDUA 2IKIA 4ICNA 1UBSA 3UWQA 1GQIA 1VIWA 2V3DA 1ZUAX 4F0HA 3MHGA 5AC7A 2NUXA 3T81A 1ZL1A 3MUZ1 1IEWA 1EJSC 2QKFA 3PBMA 3QV8A 2CLLA 3A6OA 3REQA 4TO8A 1EGZA 1NU5A 5U4NA 4QAWA 1MW0A 2AQVA 4FS9A 3H8AA 2I5IA 3DIPA 4GYFA 3VX1A 4E8CA 3EMZA 4L9XA 1OFRA 3P2VA 1UOZA 2EG6A 2P10A 4EACA 3CM4A 3P0XA 2PGEA 4JX5A 2DQXA 4RW5A 3VIFA 4JTFA 2VJXA 1P0NA 4S3GA 3WBWA 4B5VA 2ZRZA 2NWRA 3WMBA 3L66A 1QI2A 2I5QA 2P53A 1QI3A 5CJMA 3M9YA 2WPGA 1FBAA 4IFKB 4ZO7A 5AYBA 2ZVIA 4YLWA 4IUOA 1LOLA 2EO7A 1EL3A 5HWNA 3KOZA 2PPGA 1RJRA 4H2HA 1XYZA 4AAJA 4AZCB 1IHIA 1VEPA 1A5OC 1KXTA 2FKPA 3M64A 2WNQA 3NL3A 2Y8VA 4GXWA 2V5BA 5DLCA 2V2CA 3PWAA 4J35A 5A2AA 3SUSA 1Q7MA 1RD6A 4L56A 4F4RA 2OZTA 3BG3A 5XIAA 3H23A 4MWAD 4QR6A 1XYFA 3NVDA 1JVNA 3VIGA 2HK1A 4TU1A 3I68A 3AYSA 2PC8A 3QEZA 4K36A 3T0TA 4O19A 4GRSA 1J0ZA 1VPQA 1XLCA 4HPNA 4Z1BA 4CCCA 1XI3A 4OTKA 2Z00A 1XDMA 5A2BA 3OIXA 1SMAA 4RV8A 2Q8XA 1YDOA 3RLUA 3VDGA 1YXDA 4QITA 2H9AA 4X60A 2ZVRA 3WJWA 4IX2A 2QCGA 3T8QA 5C9ZA 3FEQA 4LVDA 3W7LA 2FMOA 4W4QA 3DHFA 4ICMA 4UB9A 2CHOA 3EWBX 1VZWA 2I7GA 2D20A 2FB3A 3G1AA 1EQPA 2FHFA 3ELFA 5CBIA 3W73A 2R9RA 3G0UA 1V6XA 4XB3A 4ROQA 4GFIA 4D6DA 1J79A 4PUKA 3A5VA 1WDQA 1C91A 1VJIA 3KCLA 4WIWA 4HNNA 3T9PA 4DXKA 3G1VA 4ATWA 3T40A 2WJDA 4FXFA 1GOIA 3W7OA 1TV8A 4GJ1A 3BSGA 3BSHA 3MJMA 1QI4A 1FOBA 2E25A 4V15A 3V4BA 5CSYA 3A3HA 1AQFA 4XZIA 3K8LA 3V35A 4IZGA 4F0KA 5I77A 2CLKA 4LB4A 2ZUTA 4AIBA 1A5CA 1IWBA 3WKZA 1L6YA 1SO5A 3BG9A 5FL1A 3MP4A 1EJTC 4O1AA 3VCRA 6PTDA 3VNKA 4GC4A 2HMCA 1WZLA 1ICSA 4B5TA 2OYLA 1XLBA 1Z48A 1S2WA 3L68A 1BHGA 5CSUA 4O0ZA 4LANA 2FZDA 3TQPA 4DWSC 5BZAA 1FWBC 5D32A 3H6OA 4ORIA 2PRLA 4B5NA 1H49A 2DP3A 4CQAA 3T42A 3FYYA 2GPTA 1JNEA 4K68A 3UERA 2GUUA 1R9YA 1P1MA 1EZ2A 1MFUA 4QDPA 1FDZA 4D9PA 3VU2A 1FWFC 3PWIA 1K77A 5FI8A 1P48A 5TNVA 5XINA 1A4LA 2WNNA 1XWYA 3W1PA 3NZGA 4K3ZA 3ES8A 1W54A 2GSHA 4DBSA 5EBUA 3ID7A 4MJ4A 2NX3A 5E9XA 2HNEA 3WNLA 1AZ2A 4BF9A 2QCDA 1KA9F 5ABEA 4U2YA 1OQFA 1LYXA 4NU7A 2VC6A 4MPQA 1EC8A 2VURA 1EPXA 1HW6A 3TN6A 1D8WA 4JIIX 1XKYA 3V75A 3OLEA 4AD5A 1B9BA 3GHSA 1KM1A 3UCDA 5BNKA 3QSRA 1LBFA 1TVLA 1GHRA 4D6EA 1CI1A 4H9UA 4GIEA 5IFTA 1E56A 4Q4OA 3T0DA 3INPA 1LLWA 5I6SA 5DBTA 1WBHA 3CZEA 3GK0A 3STPA 4A8NA 2X16A 2VL4A 5LIWX 3O06A 3ATYA 4FK9A 3AU2A 2FMNA 2WZEA 1W9XA 4ZO8A 3LM7A 3LRKA 4C6IA 2O9PA 3PAJA 3TC7A 1TVPA 2OX4A 5IBXA 5CGQA 1BAGA 2VUNA 4FNTA 5FEPA 1A0DA 4Z2HA 1O5QA 2PDKA 3VINA 4XZMX 2XJ7A 3GO2A 3TQVA 3P84A 4O50A 2ZXDA 4OU1A 2F6UA 3UEQA 1V5XA 1IQ8A 1AVAA 3Q58A 4DJDA 1B3VA 3RMEA 3T2PA 4J3UA 1HZYA 1NP0A 3A21A 5I06A 1XIEA 2QS8A 3WBXA 1VJSA 2HXTA 2VCBA 3KDOA 2VWSA 2PDIA 3IGSA 3VOJA 3ABSA 1PZ0A 4L1XA 3CPRA 3S1GA 1RR2A 2XISA 2EHHA 2YB1A 3MY9A 4S2BA 2UWFA 3HQPA 4GMEA 3B0PA 2F2KA 4LUSB 2DZVA 4KFNA 1XIIA 4JTIA 2VC9A 2NT0A 1EJUC 3MSYA 4D1JA 2NVAA 2G37A 1ZCOA 3SN1A 1CBGA 3UXLA 2HDJA 1PKMA 2OU4A 4YNGA 1Q6LA 3U3HA 3U8GA 5D9PA 3UG3A 4WSHA 4W93A 4PRTA 3F5LA 4W8BA 1BRLB 2J24A 3BLIA 1I8JA 1A0EA 3T7VA 4M0XA 2Y4SA 2WC7A 3HFYA 5H8PA 4GPNA 2V3FA 4LOCA 3G2GA 1DIOA 1HF6A 4DJED 4RNJA 2WHLA 1CXHA 4ZCWA 4C1NA 2ZZ5A 2WBGA 2GVLA 2VENA 1U5JA 4Q8VA 1GZJA 1R86A 1V77A 2HBXA 4B92A 1KTBA 5M3WA 3QMSA 4RW3A 1V3MA 3DI1A 5KINA 1JCJA 1XLHA 2QVNA 3CB3A 3BJFA 3QV6A 1L8NA 3EX3A 3PZQA 4Q22A 4AC7C 2YBVA 2YA1A 4F66A 3F5KA 1A5MC 3FV9A 4LRSA 4LAKA 4QS5A 4HHMA 1YHTA 1F07A 3CT7A 4GCAA 1Z9AA 1SFLA 2QDHA 2YBTA 4RK8A 3BGGA 2AQWA 2J75A 4KFPA 3PUEA 1GORA 2UY5A 2Q8LA 3LMZA 4I7VA 4IQLA 2VRQA 1R6WA 3MQTA 1IV8A 1LCOA 1J2BA 1MZRA 2PU1A 3L23A 4AYGA 2RHGA 4KWUA 4NAFA 1RCQA 2ZICA 3ANVA 3IIVA 1VR6A 2C6QA 4QP0A 1H3GA 1KWKA 4J40A 4PTWA 4K7YA 4PCNA 4UTLA 2EF9