4RL3A

Crystal structure of the catalytic domain of a family gh18 chitinase from fern, peteris ryukyuensis
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
271
structure length
271
Chain Sequence
KVFREYIGALYNGVQFTDVPINSGVTFHFILAFAIDYTSAAAATNGVFNIYWQNSVLTPAAVQAIKAQHSNVKVMVSLGGDTISGSPVQFTATSVSSWVANAVSSLTSLINQYHLDGIDIDYEHFDQVSTSTFVSCIGQLITQLKANNVISVASIAPFDGVESQYTALFGQYSSVIDLVNFQFYSYGAGTSASQYVSLYNTAASKYGGGAKVLASFSTGGVGPAPSTVLSACQQLKSSGTLPGIFIFSADGSYASSAKFQYEQQAQTLLTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A class III chitinase without disulfide bonds from the fern, Pteris ryukyuensis: crystal structure and ligand-binding studies.
pubmed doi rcsb
source organism Pteris ryukyuensis
molecule tags Hydrolase
molecule keywords Chitinase A
total genus 100
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2014-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4rl3A00
1PJ9A 1GOQA 4Z2HA 1B31A 4J28A 5I6SA 3EMZA 3QHOA 1IZJA 2WMGA 2D0FA 3J7HA 4AIUA 5ABHA 2BHZA 2VRJA 4PTVA 4NZCA 2PB1A 2PI6A 5BRQA 4GZJA 4JCLA 4JKLA 4W7VA 4AEEA 4KGJA 4HU0A 3TTQA 3VMPA 5JUVA 5GNXA 2V3EA 2CKRA 1FOBA 5DT7A 1QNOA 4PSRA 1C92A 1S46A 1J11A 4PUDA 5DEZA 1G94A 5D9NA 3T09A 1D3CA 4UCFA 4AZ6A 4LGXA 2DSVA 3VGFA 3K4DA 3RJXA 3VIIA 3AOFA 2UY4A 2GJPA 4ATLA 4W89A 4XZBA 3WN6A 4K68A 2XWDA 4CCEA 4ZXOA 4MPKA 1W1VA 3WD1A 3AIRA 3VGEA 3WFLA 4FLRA 1B1YA 1HP5A 1TFVA 4F9DA 2CPUA 3AISA 2D0GA 1V6VA 2NSXA 5AYIA 2G3NA 2VRQA 4M81A 1O7AA 3CLWA 3AIEA 2VX6A 3AFBA 2V38A 1MVYA 1KXHA 1QI3A 1XH1A 2VX7A 2XGBA 3BH4A 5ABFB 4PTWA 4UR9A 2O9PA 1VFMA 5FKYA 1H11A 1E56A 1SMAA 5I2UA 4DUVA 4PCTA 2CIPA 3MU7A 3WSUA 3HMCA 3W24A 5GNYA 1E4NA 5D9MA 3LPPA 1SYTA 2ZX5A 1J9YA 1C7TA 2DEPA 1TE1A 1EHAA 3WDRA 4C7DA 4BQ2A 2Y5EA 3AIWA 3VILA 1M04A 5GQBA 2VZTA 1GW1A 4X9YA 2BY2A 2J75A 1M01A 2DPEA 4W86A 1US3A 1J0JA 4HMCA 1PEZA 4KRUA 7TAAA 2VRKA 1EGZA 1TR1A 1HL9A 4W7UA 4XUYA 1UHVA 4TVDA 4JFTA 4ZFMA 3T08A 3ZJ6A 2IXVA 3WBEA 1WZLA 1KFWA 5E09A 1X1NA 1HNYA 3ARSA 3CBWA 4HA4A 1DHKA 1JZ7A 3BSHA 3GDBA 4TX6A 4D6GA 1V3IA 3K46A 3L4TA 4Z2JA 1DP0A 1W9XA 3WQ8A 1QHPA 4ZXLA 1ECEA 2YIHA 1QHZA 1H4PA 4QP0A 1KQYA 3VVGA 4ZEPA 4YPJA 4H8VA 4V2XA 3W29A 1HJXA 2WHKA 4OOZA 4EAMA 1GPFA 2J74A 3N17A 1CYGA 4E8CA 2VI0A 2DT1A 4KRTA 3AMGA 4J3VA 1OGGA 1VJZA 1OIFA 3BAYA 3MUZ1 1HKIA 1OB0A 1CLXA 1PX8A 1QPKA 4GI9A 4A4AA 1C90A 2YOCA 2XIIA 1H3GA 2EPLX 3AJ7A 4HZ6A 4Q7NA 1LG1A 2YL8A 3VX0A 4EK7A 5BYWA 1E6QM 2DSZA 1UOKA 4UQCA 3WEZA 4JFUA 3ZOAA 3NYDA 4PYSA 1K9DA 1CWYA 4KWUA 3VD5A 3RILA 4AISA 1EHNA 3PZUA 2W4XA 3PZMA 3QOMA 1MFVA 1XCXA 2XTKA 4H2CA 3VGDA 3GTNA 1UZ4A 1BG9A 3CZKA 1HJWA 4AD1A 4QCEA 1E4MM 1JAEA 3AIUA 4OUEA 8A3HA 3ARYA 2WNWA 2VCCA 2WC3A 3WQWA 1U33A 1WZKA 4M56A 1HX0A 2W62A 4PMUA 3CUGA 1BHGA 3RM9A 4TTUA 1KXTA 2WKLA 4N42A 4GIAA 4CD4A 1UKPA 1N82A 3B9AA 3VOCA 3W25A 3BAJA 2J78A 1W32A 2ZX8A 2ZX6A 3QR3A 4FLQA 5I78A 4J27A 3EYPA 2CNCA 3RJYA 1GUVA 4PMYA 1EDQA 5A1AA 1ISXA 3PTKA 3JUGA 5HPOA 3MSDA 4MAVA 4MAZA 3VGHA 3ARVA 4QLJA 3MUAA 3FNDA 1OWQA 5LA1A 4FF5A 1ISVA 1CZ1A 4MNLA 2J7BA 1HP4A 1YHTA 3HN3A 4UQDA 1E6ZA 3CMGA 1LLOA 1LQ0A 1FP8A 1F4AA 5D8ZA 3VUPA 4OBRA 3VGGA 3BAWA 5BXTA 3T0DA 1L8NA 1LL6A 2Z1SA 4AZCB 1AMYA 2BHUA 4ACYA 1W1YA 4CUCA 2ESCA 2X0HA 2D0HA 2XFFA 4AD3A 4PUEA 1CTNA 2G8ZA 2WSKA 3GH7A 1UA3A 2XSAA 2WZHA 2CETA 2WHJA 3ARTA 3WQ5A 1AVAA 3WF3A 1XD0A 1EO7A 1B3ZA 3AI0A 3NUKA 3UEQA 4AD2A 2CCRA 2ZUVA 3ZT7A 1E73M 2WMFA 3L4XA 2EQDA 1VRXA 2PWEA 1PIGA 5IXEA 1QNQA 3II1A 3WQ6A 3IK2A 4L4OA 2WSPA 1J18A 1OGBA 4DUWA 1CGTA 1WDPA 1CECA 1PAMA 1V3KA 3IAPA 5DFAA 3RIKA 5HNNA 1EXPA 2J7DA 1J01A 4HP5A 2DH3A 3WD4A 2XSBA 1OIMA 2CHNA 3VPLA 2ZXDA 1ZB5A 3F5KA 3FHAA 4UNIA 1RPKA 1DWFM 1H0GA 1WDRA 1V3HA 1WP6A 3VIKA 1W9UA 5A8PA 2ZOXA 5M17A 4P7LA 3SCRA 4JL1A 1AQ0A 3RM4A 3PZGA 5DMYA 3W38A 1KWKA 1SR0A 2JEQA 5E6YA 4P7OA 3AMDA 4UOQA 3ZJKA 4OKDA 1KBBA 1TVNA 1B2YA 1H09A 1Q6EA 5CPSA 1WDSA 3AXHA 2E3ZA 4ML4A 4WLCA 4QDMA 1UKOA 4PTXA 4J3XA 2DT2A 3N18A 2E4TA 2WMKA 2X2YA 1JI2A 1BVZA 5ABEA 3VIOA 2VOTA 4LPCA 3LPOA 3MMDA 1MXGA 1E15A 4MJ4A 3MV11 3A4WA 3UETA 2CYGA 2DIEA 4OZOA 4TVCA 4GI8A 4AC1X 3N9KA 4GQRA 3FW6A 3AIVA 3ARPA 4LQ1A 2BVYA 6A3HA 2A3AA 5E9AA 1JG9A 2J4GA 3W6MA 4EKJA 4S3JA 1CEOA 3BLPX 3GNOA 1IV8A 1UWIA 1GOWA 2CBJA 2IXUA 1LJYA 2WM0A 1WZAA 1J0ZA 2NT1A 1Q6CA 1C3FA 2OSXA 1J0IA 1E6XM 1MFUA 2EEXA 2Z1KA 2OWCA 3NCOA 3MO4A 2HISA 1M7XA 2C7FA 3AYSA 1UWRA 2VQUA 4J7RA 3CIVA 2VL4A 2JIEA 2WKGA 1RH9A 4AZ7A 1Y7VA 1CNVA 1AQMA 4PCSA 3OZPA 1FFQA 5A69A 1KR1A 3KL5A 4QLKA 2J8FA 2ZUSA 4X0NA 5EMYA 5IHSA 3L4ZA 3VMNA 1C8XA 3WDPP 5CSUA 5C8BB 2ZUNA 5GNZA 4B9YA 3UG4A 4MNMA 2WZEA 3BC9A 3MMWA 4U31A 4ZENA 4PSPA 2PF0A 3W81A 3MKKA 2D24A 2VURA 3WMBA 5FL1A 2TAAA 3WD0A 1US2A 3QOKA 4JKMA 1UG6A 3M46A 4UFLA 3SCUA 4D1JA 2YDRA 4WSKA 5CGTA 4DWSD 5IFPA 1EQCA 4IISA 1UR2A 3WNMA 5BXSA 2J7HA 3WIJA 3VD9A 4WKFA 1E6PA 2VR5A 3CHEA 4M1RA 1BYBA 4BS0A 3W4RA 4B16A 4FMVA 5JBEA 2E8ZA 2XIBA 4RE3A 1R7OA 4OBSA 4HMEA 1CXFA 4EE9A 4AXNA 3WL0A 2OYMA 3FXYA 2WLYA 4JZ5A 5HBFA 9CGTA 3K4AA 4FLOA 4B3LA 3THDA 1KWGA 1UD4A 2JALA 1R7AA 2C8NA 5FL0A 4WKAA 3A6OA 5EFDA 2QMKA 2CBIA 3AZTA 2OSWA 3SUWA 4WSJA 1E0VA 4W7WA 1HKJA 2IUZA 3WDHA 1E9LA 2E0PA 3QHMA 5A6AA 3NIYA 1MW0A 1I1XA 1CXHA 1QNSA 3ARRA 5CPTA 1O6IA 2V3DA 2XVKA 1NWUA 4PEEA 1GCYA 1ZL1A 2G3MA 1LF1A 3PZVA 2J77A 1JI1A 2YBTA 1UR1A 2QPUA 4HPHA 4IM4A 3RO8A 1E6NA 1GONA 1NOUA 2PBGA 1PZ3A 4Y7EA 1HJUA 5EFFA 3ZO9A 1CGUA 4UZSA 3NSXA 3WENA 2YJQA 2WC7A 3VNZA 2DDXA 3VM5A 1WB0A 4BQ3A 2BHYA 2Y24A 1WNOA 2EBNA 4CN4A 2VR4A 1R86A 2J7FA 3QHNA 4GKLA 1RD6A 1OBAA 4UFIA 1QNRA 1ZBVA 3L4UA 3FY1A 1UZ1A 3POHA 4AYSA 1LL7A 3L2LA 3AMLA 3K1DA 4J3UA 2WVUA 1UWUA 2VJXA 3ALGA 3AZSA 1BLIA 5C71A 2CITA 3B9EA 2XVPA 1RP9A 5A6JA 1ISYA 3GZAA 3DYPA 4F9JA 1HL8A 1TA3A 3UG3A 1W3KA 3AHXA 3SUUA 1JGIA 3U7VA 1V0KA 2X05A 3ZM8A 3K8LA 2WC4A 3NSNA 4PMVA 1B3XA 2GDVA 4DWSA 2ZWYA 1DWJM 1W9BM 1NP0A 1JZ5A 4H7VA 3UR8A 4D6JA 2WB5A 2Y4SA 1VEMA 1R85A 5D9OA 3VIHA 1E72M 1UYQA 2VVSA 2W5FA 5EBAA 4WK9A 3O6AA 2DSWA 1UH4A 2ZUUA 1HF6A 1XC6A 3FHQA 2VNCA 4TVUA 5TD4A 1A3HA 3W53A 3AHTA 4E8DA 1EA9C 1UD6A 1MQPA 1VJSA 3ZR5A 3KL3A 1B3VA 4PBGA 2W63A 2BY1A 2UWFA 1KGWA 3VU2A 3OZOA 2EPNA 4TX8A 1WZMA 4P8VA 1XYZA 3CGTA 4JIEA 4MDOA 1C91A 4BQ4A 2BNJA 1G9HA 2J7GA 3RM8A 2WCSA 3MV01 4U33A 3WL1A 1V0LA 1H49A 2VZVA 3BMVA 1BF2A 5A2AA 3BMWA 1EOMA 4XX6A 2WHMA 3ALFA 3GBDA 2AAAA 4IUGA 3ZIZA 2X1IA 1ZS2A 2XGIA 4M80A 3WDIA 2QHAA 1G01A 3L4WA 2YKKA 2A3CA 4RL3A 2WLZA 3W0KA 5E70A 3WMSA 4ZE4A 2W91A 3O9NA 1FH8A 4MNJA 5A94A 4P7RA 2Y8VA 4Z2GA 4TTGA 1UD8A 3WUEA 3WF4A 1KCKA 3A4AA 2BY3A 3GM8A 2W61A 3WMCA 3WNPA 1YQ2A 1EOKA 1CXEA 1GOOA 1LWJA 3D5HA 4AW7A 3N04A 3W26A 2XVGA 1GQKA 3OGSA 3KL0A 3AZRA 3MSGA 4E4PA 5D9PA 3TTYA 2JE8A 1GQLA 5I3DA 1MQRA 1ZBKA 2J7EA 2VMFA 2QMJA 2WVVB 4GO9A 4AZBA 4A3HA 3OIHA 3VINA 2XFRA 3WH7A 4GXPA 2D2OA 3W37A 3RMEA 3RPMA 1BTCA 2XM1A 4PMXA 3WQVA 3OA5A 3PZOA 5IDIA 1B3WA 1UD3A 1QI0A 3L2MA 2JIWA 3VTRA 3GXMA 5BRPA 4UFKA 3ARUA 3L4VA 1UQZA 3ZQ9A 3VIGA 3UERA 1QI4A 2GJXA 5CSYA 5I77A 5CXPA 2RGMA 3SCWA 1V3JA 3U5YA 3WDQA 3B9DA 3T2OA 1GHSA 5BXPA 1MW1A 2G4FA 1B9ZA 1LG2A 3BXWA 1QI5A 2YL6A 1MQQA 3WELA 1PIFA 2A3BA 1KGXA 1C93A 4CVUA 2Q8XA 2VVNA 4ZE5A 2QV4A 1K9EA 2WCGA 2BXYA 3ZR6A 1OT1A 3WF2A 1V6XA 3T2PA 5A95A 3M7SA 1HXJA 3CZEA 4AD4A 3GH5A 3K8MA 4B9ZA 4GINA 4PMZA 1QI2A 1KBKA 5C70A 1UR8A 2WBGA 3CHDA 2BS9A 4UQEA 3LPFA 3SCVA 4CD5A 2UY3A 1LL4A 2YDSA 4WIWA 4GQQA 1DWGM 2HVMA 4CVWA 4HU8A 4Q22A 2WVTA 3UG5A 4UQAA 5M03A 4U3CA 1TA3B 1JZ6A 3BCFA 2O9OA 1FHDA 4P8UA 3WD2A 3W28A 2ZUMA 4AIEA 1G1YA 1VBUA 4UTFA 1XH0A 3IJ8A 3SEPA 1E0WA 3T2QA 2BV9A 3ARXA 2WK2A 4URIA 3WEOA 2DT0A 5DF0A 3OLIA 2BXZA 3BAKA 1CXIA 1TUXA 1VAHA 5AC5A 5A6SA 4CU7A 3MANA 2D3LA 2DGAA 4BZYA 2JF6A 3GNRA 3AICA 1ESWA 5A6LA 1EDGA 1MW2A 2ZX7A 1KXQA 1JXKA 1E71M 1WCGA 2ZXQA 3APGA 1QBBA 3VDHA 3F5LA 3VNYA 1PZ2A 1GNXA 2D22A 1GJUA 3G6MA 1BSIA 1U2YA 5CJ5A 3VX1A 3EDDA 1IT0A 4UZUA 2YA2A 4NI3A 2WMIB 4MB1A 2J47A 4LYQA 1A47A 2PWHA 1Q6FA 2XPKA 4MB5A 3CMJA 4CGTA 5A6BD 1UD5A 2CEQA 2WMIA 2D20A 4UFHA 4D6HA 1HN1A 5LA2A 5M5DA 1ZJAA 4ACZB 1CXLA 3WUBA 4R27A 5AYBA 3IAQA 4WJXA 3GBEA 1V3LA 3TP4A 4F79A 1XSJA 1NOWA 3CZGA 1NP2A 4D6IA 2YL9A 3UESA 2XG9A 1FHLA 4OOUA 2VCAA 3VIJA 5AC4A 4CD7A 6CGTA 2E9LA 1JYWA 4D6EA 5I23A 1PX4A 4GZEA 3I3DA 3FAWA 3EMCA 4NF7A 5CLTA 5A6MA 3ZSTA 5A3HA 1UKTA 2V5DA 4UFJA 5CPQA 2V3GA 1Z32X 4MTVA 3BSGA 1E5JA 2GUYA 3WNLA 1VEOA 3AHZA 2E9BA 1E3XA 1I75A 3N1AA 3PBGA 2CXGA 4IPLA 1J12A 1TMQA 3VD3A 4D6FA 4Z2LA 2X8RA 5HPCA 1HJVA 5E6ZA 3AQUA 2VZUA 3KZSA 2J79A 3SIMA 2X09A 1XD1A 2YLAA 1JL8A 1GORA 1EO5A 4BA0A 1PX3A 1GJWA 1UH2A 3KEHA 2PWDA 4MJ2A 4AMCA 1BGGA 3PZIA 2E8YA 3AMKA 4GO8A 2G41A 2W92A 4HOXA 1EQPA 3CO4A 4BF7A 4D71A 3I3BA 3WF0A 1Q6GA 4D6DA 2ZICA 1VF8A 2XVLA 1DTUA 1MWOA 5FCZA 2MANA 2PWFA 1W2PA 1J0KA 1W3JA 2E40A 2J7CA 4H8HA 1VFUA 3GYCA 4BCEA 2WXDM 1U30A 2WMJA 1EDTA 2PWGA 2B31A 1H5VA 2EPMX 4AWEA 5I79A 2XYLA 3GXFA 1ODUA 3A4XA 1V08A 4P7NA 3OBAA 2OSYA 2D3NA 3CHFA 3N12A 4U5IA 1W9PA 4D72A 2QPSA 4N0RA 2NT0A 1BQCA 1CENA 3S6TA 2EXOA 3SCSA 1OD0A 3BCDA 3GH4A 4UOZA 2WW5A 1E40A 1ISWA 3BGAA 3OGRA 3VM7A 5ABFA 4M24A 2GSJA 3CUHA 3ECQA 1UKQA 1QVBA 4B15A 2YA1A 5A6KA 2PBOA 5HOSA 1JNEA 1OT2A 2FH6A 3WEMA 3SUVA 3ARZA 1UH3A 4PTMA 1JYNA 3BAXA 2WVSA 2OYKA 2WZIA 3W82A 3SCNA 3DHPA 1UR0A 3ZT6A 1HKMA 2JF7A 5LYRA 1XYFA 4TOQA 4PMNA 3RDKA 3AIBA 1ODZA 3PZ9A 1FP9A 1WKYA 1QNPA 3GXDA 3OG2A 1W3LA 7CGTA 3WH9A 1B0IA 3AXXA 1KR0A 5JIWA 2F8QA 1WDQA 1B90A 1Q6DA 2F2HA 1NQ6A 3WUGA 5M3WA 3ZJ8A 3NJ3A 4C7GA 1OGSA 4NRSA 2OWWA 6TAAA 2RGLA 3QGVA 1DWAM 3WDJA 3CHCA 2OWXA 4JHOA 1I1WA 4P7QA 1D2KA 1W3HA 4HOZA 1M03A 3ARWA 3CTTA 4CN6A 4QAWA 3KE0A 1W1TA 3DC0A 3MUIA 3WH8A 4CD6A 3SCPA 3SUTA 2ZWZA 1BYDA 2Y8KA 1BVNP 3AROA 4HPGA 1KB3A 3W6LA 3OB8A 2XUCA 4ATDA 3AXIA 1ITXA 1HT6A 4JFWA 1E5NA 1FH9A 3N11A 4HMDA 5CGMA 4OJYA 4CCCA 1NARA 1OD8A 2O9RA 2DH2A 1ZBWA 2XJ7A 3KWXA 4AZCA 3AMCA 3OLEA 1TG7A 1V03A 3NDZA 1W9DM 4QCFA 1JIBA 1GVYA 1WO2A 3K8KA 2XM2A 3WNKA 2A3HA 1UQYA 2EPKX 4U3AA 1E3ZA 3F4VA 1QOXA 1V6YA 4HA1A 3WNOA 4AEFA 3WBAA 4H04A 2GFTA 1ZBCA 3CZJA 1GOMA 2WBKA 4W85A 4ATWA 5KZ6A 1JF5A 5E0FA 4DM1A 1H41A 4WKHA 2AMGA 1XH2A 3SCTA 2CBVA 1UUQA 1E1EA 2WWDA 4JHZA 1Q4NX 5D8WA 1JYXA 3LMYA 2A3EA 4LYPA 3B8SA 3OGVA 1XSIA 1JDCA 1E6SM 3CUJA 3BAIA 4CU6A 2WVVA 5CLWA 3TOPA 3ARQA 3U7BA 1WPCA 1J0YA 3UCQA 4X0VA 2W66A 1JZ3A 1R8LA 4EANA 1F4HA 2X0YA 3VIPA 3UR7A 1OCQA 4W5UA 2YBUA 3VKKA 3VIMA 4DWSB 1JYVA 2F61A 2EPOA 2UY5A 5IHRA 4A3YA 4CCDA 1VEPA 3AS3A 1V3MA 3CZ8A 1MW3A 3WH5A 3O2LA 7A3HA 4Z2KA 1E4IA 1BYCA 4U2YA 5LA0A 4W5ZA 5ECUA 4YHEA 1JZ8A 2V5CA 3AS1A 1XRVA 4R5EA 1VFOA 1HVQA 2EJ1A 2QLYA 3SCQA 3ZT5A 4UOJA 1C8QA 1XCWA 1G5AA 3THCA 3AYRA 1OSEA 4XV0A 3MS8A 1SFSA 4MDPA 1L0PA 1FH7A 1M53A 4W93A 3EDEA 1BFNA 1E6RA 1C7SA 4HA3A 2GVYA 1XV8A 1JDAA 1GOKA 2G3IA 1SMDA 1CIUA 1JFHA 4F8XA 1OM0A 3T0BA 2WANA 4HTYA 2ZIDA 2JFEX 3WH6A 1GVIA 1KCLA 2YLLA 1E1FA 2VX5A 5CQ1A 4XB3A 2VZSA 4AZ5A 1NOFA 4AD5A 4J3SA 2ZX9A 1ZJBA 1FA2A 1JXJA 4U5KA 3M6DA 5A8MA 1AQHA 4WF7A 1K9TA 1V6WA 2VQTA 2GJRA 3HJEA 1NWTA 1J0HA 2D1ZA 2VO5A 1JD7A 2J25A 2OYLA 1UR4A 2FHFA 3W27A 4CD8A 1HJSA 1FFRA 4UQ9A 3WKZA 1PBGA 1JDDA 3GNPA 2CHOA 1K6AA 4H41A 3NDYA 4W87A 2XWEA 2XHYA 1V02E 2QF8A 3VGBA 1E55A 1X6NA 2GDUA 5EB8A 2VX4A 3CUIA 4OIFA 3HU7A 1EH9A 3GXIA 3A3HA 3PTQA 4PRWA 4AIOA 2FH8A 4KH2A 1UWSA 3WNNA 1VENA 4J3TA 5JBFA 5JBDA 2FGZA 1KXVA 1XHGA 3VO0A 1JF6A 2DIJA 4TUFA 2O92A 1TVPA 2E9MA 2GK1A 1W9VA 4AY1A 1E0XA 3PZTA 4W84A 2NW0A 1CBGA 1VB9A 4HZ7A 3AS2A 1QW8A 5ABGA 1QBAA 4YHGA 2WCAA 2VC9A 4RE4A 1X6LA 1UR9A 3DYMA 3SCOA 4GI6A 2BVDA 2D23A 5KEZA 2BFGA 4HZ8A 4W8AA 3TONA 3FN9A 1JAKA 4AZIA 1LWHA 1CGYA 3VDAA 1CPUA 2JEPA 1NH6A 4AZHA 1JD9A 3T0AA 1JZ2A 4GPNA 3CH9A 2VCBA 4JKKA 1JFXA 5D4YA 4JAWA 3TTSA 3NSMA 2XFYA 1JZ4A 1WE5A 1CGWA 3VIFA 1XGZA 3N13A 5A8NA 5JIPA 4P8WA 1RP8A 4V28A 4E2OA 3S2CA 2DQXA 4ACZA 1V6UA 3OLDA 5E0CA 2ZUTA 4XZWA 1HIZA 3EMQA 3VMOA 2VTFA 4HOWA 3D3AA 1QW9A 3ZJ7A 4LXFA 1V0NA 2WPGA 3TTOA 5BCAA 1BG4A 2ZE0A 5I24A 1TCMA 3RCNA 2GK1B 1CDGA 1GZJA 4UQBA 1NWRA 4W88A 2DSKA 4PMRA 3DECA 2FHCA 1KQZA 3E1F1 2ZXAA 4S3KA 3CPUA 1W91A 1UWTA 4LYRA 3PHAA 3SUSA 1VIWA 4MB4A 1DEDA 2BY0A 2CESA 3WFZA 4MNKA 4V27A 1B3YA 4AD0A 3WUFA 4W8BA 3LPGA 5A8QA 4GZIA 5FIPA 4RE2A 4FLSA 5A2CA 1BPLB 4M8UA 4D1IA 1BGAA 1XSKA 3U5UA 3POCA 4BQ5A 2ZUWA 3BLKA 3G6LA 4H8UA 3ZMRA 4IPNB 3U57A 2UY2A 4PMQA 4MADA 4Z2IA 3EDKA 3M07A 4B3KA 4QLLA 1DWIM 1ZU8A 5IFTA 5CZKA 4FK9A 1E43A 5FOOA 3MMUA 4KMQA 1CGVA 1IZKA 4YN5A 1MYRA 1EIBA 3SURA 1J10A 3VDCA 4M82A 2G3JA 3DYOA 3AIQA 4CN1A 2WHLA 4MB3A 2J8GA 1CGXA 3F5JA 1K9FA 3VDBA 3A47A 2WAGA 2CKSA 1HKKA 1R87A 4M29A 3I3EA 1D7FA 2OLHA 8CGTA 1GHRA 1G0CA 1MXDA 3MUY1 1NWSA 2ZXBA 3IJ9A 5HDRA 2AOSA 1OINA 2FDMA 4PMOA 4AZGA 4NRRA 1BYAA 4DM2A 4JCMA 4W8LA 5BXRA 4PMDA 3WY1A 4DUXA 2BVTA 4DWSC 3ZSSA 2YA0A 2YL5A 2VUYA 2FGLA 2V3FA 2CBUA 3EBVA 3PZNA 5CG0A 1WAWA 1DWHM 3AS0A 1CXKA 4LX4A 4PN2A 4JFSA 1CLVA 1KGUA 1PPIA 5BWFA 2CERA 2GJXB 1V0MA 5GPRA 2DT3A 1JNDA 2FHBA 2VT0A 4JL2A 3WD3A 2C0HA 3WQ4A 3EDFA 4NSBA 1ITCA 1GOIA 4CU8A 3AHVA 3AHYA 2EO7A 3CUFA 1NM9A 1VBRA 2W67A 3L4YA 1W2VA 4J3WA 3IANA 1UA7A 4F66A 1H1NA 5F7UA 3VD4A 1HVXA 5I0DA 3TA9A 3PTMA 2WMHA 5AY7A 1QHOA 3WF1A 1HJQA 1E70M 3N15A 1BAGA 5BROA 2VZOA 4P8XA 4JFVA 5A2BA 5DO8A 4CKQA 3EDJA 3IJ7A 1E4LA 5A8OA 1H0IA 1H2JA 3PZQA 4UFMA 3VD7A 3DHUA 1VFFA 4D6CA 5A6BA 1C8YA 1V02A 4L4PA 3CZLA 3FAXA 1P6WA 2O9TA 4QFUA 2WYSA 1UKSA 1ISZA 2PC8A 4KGLA 2WWCA 5I5RA 5HXMA 4U2ZA 1UD2A 3OLGA 2YDQA 1GQJA 1UWQA 4TXEA 5DT5A 4C7FA 1TZ7A 5FD0A 3PN8A 2J62A 2DSUA 1B30A 2Y2WA 2XVNA 1W1PA 1GQIA
chains in the Genus database with same CATH superfamily
1YXCA 3KOFA 4Z2HA 2KZHA 1B31A 1W1IE 1R9ZA 1VKFA 4BFAA 5I6SA 1TREA 3WLSA 2QIWA 3W7KA 1IZJA 3UPBA 4EAYA 3NQ2A 4NZCA 3CK5A 4DNHA 1ADSA 4JCLA 1SO5A 1TTPA 4NXSA 2WZMA 1T99A 4IP7A 4Y8FA 3TTQA 3DFHA 3VMPA 5GNXA 2X1UA 3N19B 4O0KA 5DT7A 1KM1A 4PSRA 2A21A 5AC8A 3G3DA 5D2VA 4B4FA 1HGYA 5D9NA 1TTJA 3T09A 1D3CA 3SAZA 1QXLA 1V79A 3E12A 3DESA 4ATLA 1FKWA 3VAVA 1MDRA 4FXRA 4K68A 3WD1A 2JGQA 4FLRA 1OG6A 4BI6A 2CPUA 1T8QA 4DHGA 3M44A 1V6VA 4K37A 5DQPA 1FDZA 5AYIA 3CQJA 4M81A 3UFYA 5AC6A 3PWAA 4XD6A 3AIEA 2VX6A 3GVWA 3U48A 1AQFA 1VQTA 3UWUA 4DNMA 3KLLA 1VRDA 2VX7A 4BR1A 3HGJA 4NZJA 1KM4A 2VXNA 4PTWA 5I09A 4UR9A 1H11A 3PUOA 3TAOA 4LCSA 4MIMA 4PCTA 1G7VA 4IG2A 6ENLA 3G8EA 2CIPA 1PYFA 1W5PA 3W24A 3SBFA 4BF9A 4DUOA 1JPIA 1TE1A 4LUIA 1XBXA 4HIBA 3VILA 1M04A 1YKWA 3CQIA 4XQ6A 3G77A 1XP3A 3MDWA 2NQ5A 5AHFA 1US3A 4IFRA 5DLCA 4GQGA 4DYEA 3S6DA 4IG2B 4NJKA 5TF0A 4TVDA 2VFHA 4ZFMA 4A05A 3T08A 3ZJ6A 3M0JA 3WBEA 2YYUA 5E09A 1X1NA 3U2OA 2Q3OA 3BWWA 4IX0A 3UJRA 3GDBA 1HL2A 4OFCA 4TX6A 3L4TA 4XZNX 1A53A 1S2WA 4ZXLA 2CHRA 2PGWA 3FS2A 3EGJA 1H4PA 4QP0A 3VVGA 4MJMA 4V2XA 4JTTA 4INFA 4ROQA 4OOZA 2ICSA 1GPFA 3QZ6A 1S5TA 4OV4A 2J74A 4RZ4A 1GT8A 2VI0A 4KWSA 4AVOA 4JY8A 4C65A 3BAYA 5E1QA 1PX8A 1GQNA 4GI9A 4A4AA 3MI3A 1YDVA 2XIIA 4M7TA 2EPLX 3AJ7A 4WD0A 1A5CA 4HZ6A 3LCHA 4Q7NA 1LG1A 2E77A 3GW3A 1E6QM 2IW0A 4NKCA 4QSHA 4G2DA 4LALA 3RN6A 2VGFA 2PUZA 3NYDA 4PYSA 2DUAA 2V5LA 1K9DA 4KWUA 1J2BA 2NQJA 5G4WA 4B2DA 3F4DA 1LRQA 4AISA 4LNYA 3PZMA 3PBYA 3V0UA 2WM1A 4A2SA 1SJBA 3QPYA 1EC9A 5H8MA 3OOQA 1H1YA 4IGSA 3ARYA 2VOMA 4IFKA 5BMXA 3KTXA 2WC3A 1XLGA 5LNWA 4M56A 3TOYA 1WXYA 2I5QA 4KFNA 2C14A 2NX3A 3B9AA 3KZPA 3PB2A 3VOCA 5BOEA 2J78A 2IMRA 1VFLA 3KOWA 2ZX6A 4FLQA 5I78A 1DJHA 3QR1A 4ADUA 4F48A 5A1AA 2Y70A 1W1ZA 4H6RA 1EFZA 1B5TA 1AH3A 3MBDA 3MSDA 4MAVA 1GVQA 3VGHA 3ZFHA 2Z25A 1SVDA 1CZ1A 4MNLA 3JW7A 1Q8JA 4UQDA 3TYZA 1E6ZA 4MWAC 4GUIA 1O95A 2OQLA 4PMJA 3M0XA 3SW6A 1FWHC 3RG6A 3CTLA 1TWIA 2CWNA 4D8AA 2Z1SA 5TQLA 1WX0A 1AMYA 2UV8G 2INFA 3KUMA 1RCOB 2X0HA 2D0HA 3FJNA 1VHNA 4X22A 2WSKA 1UA3A 1VYPX 2CETA 1FCUA 5HWJA 3G0XA 3RU8X 2E6FA 3ARTA 4ZQCA 1AVAA 3Q45A 7ENLA 1V6TA 2QCFA 4B5XA 3L4XA 2ABBA 1S1PA 2PWEA 3CT2A 4PC8A 3IGXA 4RDVA 1R3QA 3IK2A 1PTAA 5DMNA 3KAOA 5HANA 1CGTA 3EWDA 1PAMA 1V3KA 2QXWA 3DEQA 1XS2A 3PTDA 3SDOA 4HP5A 1XYCA 1EJUC 1ZB5A 2ZRWA 1NJJA 1GWJA 4PUMA 1EIXA 1PYMA 1DTNA 3GK0A 5M17A 3FYPA 1G67A 3I6TA 4LUSB 1S3TC 1UC4A 2ZQ0A 3F4NA 3N2MA 2DY3A 1SR0A 3TU9A 2FTYA 1XLMA 3AMDA 1MO0A 4HN4A 3ZJKA 3OHMB 1XIMA 1A0DA 4A22A 1Q6EA 4IIEA 4L65A 1WDSA 2E3ZA 4ML4A 2TYSA 1DPMA 4DX3A 2C16A 1UKOA 4J3XA 3N18A 2WMKA 4ICCX 1BVZA 1F6KA 3QYSA 3CXOA 2VOTA 4TMCA 1MXGA 1TV8A 1LBMA 2EG7A 3BURA 4OZOA 3U4FA 3BO9A 4GQRA 4GNKB 1IWBA 3CLMA 1YE6A 5E9AA 3P67A 4S3JA 1CEOA 4Q4MA 3BLPX 1W1B1 3G1YA 1KO0A 2VEKA 4JQ3A 1LJYA 1WZAA 4ZA0A 2SFPA 2OSXA 4Z1CA 1J0IA 4UTKA 2W3ZA 4Q3MA 1HQTA 2C7FA 3CIWA 1UWRA 1V93A 3CIVA 2VL4A 2NQ9A 2WKGA 3KOZA 5AZ0A 4AIBA 1FFQA 3P7YA 4FNTA 4QLKA 1JUBA 3ITGA 1N8FA 1RVGA 1N2VA 2HNEA 1GPWA 1K8YA 2ONEA 4HZMA 1C8XA 1P4CA 4AHPA 3R8HA 4U31A 4G9PA 4WVXA 4RDWA 3W81A 2PTZA 3WLLA 2P76A 1F6YA 1MUWA 3WMBA 3GSMA 3VUSA 3KP0A 5FL1A 3WD0A 4NYUA 4J1OA 3S0CA 6PTDA 2YDRA 4L64A 1KBJA 4DWSD 1EQCA 3U9IA 2XN1A 4NNCA 3U3HA 3IGSA 1J96A 1GKQA 2J7HA 3U2CA 2O7QA 3HG4A 4AVFA 1YNQA 1O5XA 1O60A 4BS0A 4HKPA 3NOEA 5JBEA 5HAOA 2E8ZA 5CBBA 3TSBA 4AXNA 2XN2A 3NR0A 3SRDA 2PGRA 1OX4A 4JZ5A 2XDFA 9CGTA 3K4AA 3B8TA 1QWGA 2C8NA 1OFQA 3BV7A 4GNJA 1DJIA 3ZVIA 3G1RA 3OG3A 2ACUA 3AZTA 2BBFA 4WSJA 2VGIA 1E0VA 2WSQA 3N9SA 1UMYA 1E9LA 4HA0A 3QZAA 1HGWA 1YXYA 1MW0A 1HG3A 3NL5A 2Q8ZA 2V3DA 3NL3A 1IXNA 4ZL1A 3B4YA 4UCGA 3A21A 2GQ8A 4WRHA 1W31A 3TZNA 4L9YA 5HJYA 1GONA 3CUXA 3FYYA 1YNYA 2PBGA 1PZ3A 4RDZA 5EFFA 1WUEA 4XIMA 3XINA 3ZO9A 4DBDA 4UZSA 3H7RA 2E1DA 2PGEA 2BLEA 1PV8A 3VNZA 1LORA 2IKIA 5F2GA 1DJGA 1WB0A 3R11A 4LB4A 4R9OA 2PDCA 2VR4A 3UJSA 5I7GA 1R86A 2J7FA 2VDGA 4QBXA 3O1NA 1RD6A 1OBAA 1QNRA 1SSGA 1QNVA 3STFA 1UZ1A 1EJRC 4XVDA 5I07A 3K1DA 2H8XA 4H7CA 2VJXA 1SR9A 4ZVJA 3VCNA 2GVLA 1RP9A 1ISYA 1HL8A 3UG3A 2J6VA 7REQA 5JH1A 3AHXA 3M0YA 1V0KA 4H9XA 1JCLA 3NSNA 1EX1A 1PKMA 1B3XA 1JVNA 2ZWYA 1DWJM 4JTDA 4J2MA 1PHQA 4EP8C 4IFOA 4D6JA 1VEMA 1R85A 3QZEA 4AWSA 3VIHA 3UJFA 3C52A 3RO6A 2IQDA 2WJDA 4NQ1A 5EBAA 4WK9A 1SW7A 4LT9A 3SR7A 1UH4A 1UIPA 1KV5A 1IEWA 3NZRA 4TVUA 1UASA 4LF1A 1LLWA 3MCNA 3LRLA 3WBYA 1MQPA 1Z7AA 3ZLGA 4ZQNA 5CPNA 2W63A 4FOUA 1K6WA 2UWFA 3NVDA 1KCZA 4BEQA 3S5ZA 1WZMA 4P8VA 1KFCA 4BWLC 3LD5A 3NG3A 2ZADA 3TYAA 4MDOA 3FA3A 4DJEA 4LUSA 3P5YA 1AZ2A 4DVOA 3QMSA 4JIPA 1H49A 3TTEA 2FJKA 1BF2A 2WHMA 3R25A 1OFRA 2VM8A 3WZ0E 1ZS2A 1OFPA 1P5BA 3VZZA 3U0HA 5T9BG 4RL3A 1YBQA 4OTKA 3W0KA 2RJHA 3EKLA 3N73A 5E70A 4F0LA 3WMSA 2OKOA 3GVVA 2W91A 4MNJA 5H1WA 3E2SA 3BOXA 4Q32A 4W4QA 3LGEA 3B3DA 3LNMA 4Y9OA 1YQ2A 2TRSA 3C0QA 4D8LA 1IEVA 4JD4A 2YXXA 1OCNA 1T0OA 3MC5A 5ENLA 2XVGA 1NDYA 1J5SA 3TTYA 1K70A 3KVJA 1MQRA 3BLFA 3QQ0A 1ZBKA 2J7EA 3M5VA 4KCUA 2WVVB 4OGZA 2O0TA 2GQ9A 3VINA 3W37A 4I9AA 1E0TA 3IS4A 4LB3A 3MP3A 2XIMA 4YVVA 3KFTA 1H7XA 1BTCA 3WQVA 4WXZA 5IDIA 1XIEA 3NPWA 1RHCA 1QI0A 3STCA 3L2MA 3TFCA 5AOUA 3W2MA 2QAFA 4UFKA 1GYMA 4HHLA 3ITYA 3TWBA 4N9BA 1UQZA 2Z1XA 3VIGA 4QGCA 1OF8A 3UERA 5I77A 1LCOA 5CXPA 3U2EA 3P8IA 3SCWA 1NTHA 1W3IA 5SWUA 3FYOA 5BXPA 4Y90A 1Y8BA 4GJJA 2GGGA 4JDYA 3WELA 3A22A 4CNPA 2H9AB 1DXIA 3LCLA 1KGXA 1I9CB 4H01A 1O1HA 1X7FA 3QC0A 4CVUA 2BZNA 2Q8XA 2VVNA 2QV4A 3W7IA 4XVEA 1MEHA 3HMJG 4XAZA 3SRKA 3WF2A 3CZEA 3MCMA 3C0LA 1KBKA 2Y63A 1UR8A 1ZUAX 3WJXA 3R12A 1LL4A 2XN0A 3TNOA 4TMBA 4M6UA 4B5WA 1KA9F 4Y8EA 2WVTA 2YW3A 3RLVA 1OYCA 3H4GA 4JBRA 3QVQA 4RZBA 1JZ6A 3BCFA 3KOXA 4P8UA 3WD2A 4OQVA 1QDSA 1ZAIA 2DT0A 5DF0A 2NXIA 1CXIA 3UZZA 1VAHA 5AC5A 4HPXA 3DKJA 4PR4A 5F2LA 4BEUA 1CCWB 3S9ZA 1KXQA 1JXKA 4Y9MA 3F5LA 4XIAA 2Q02A 4O1BA 2POTA 1GW9A 5F2MA 1R6WA 3MSYA 3N4FA 4X63A 1VFSA 1RSCA 1U2YA 1K7EA 4YS1A 3SY1A 3EDDA 1LOLA 4HNTA 2YA2A 3RF9A 4QG8A 3R0UA 3CMJA 3FJ6A 1OFDA 1UD5A 4JTRA 5LKYA 2D20A 1GKRA 3M0LA 3CL8A 3PANA 4UFHA 5G4HC 5M5DA 2REQB 2GYIA 3WUBA 2VFIA 2OEJA 1POJA 3QXBA 5EMLA 1IXQA 3ITOA 1XSJA 1NOWA 3W1UA 5FA5A 2DVXA 2HK0A 3CZGA 1NP2A 4D6IA 1VCVA 4FR1A 5FJUA 3HURA 3N2TA 1H50A 4OOUA 3LOTA 4ZOCA 3L9CA 4U10A 4ZOEA 4WY0F 2A0NA 4DJDC 5F4WA 3TXVA 4FEZA 2V68A 3OP2A 4M0XA 1Q6RA 3CO8A 3OHIA 3T4WA 3AXKA 4GZEA 1UW9A 1B4EA 1WUFA 5A6MA 3DBNA 3QJAA 3LHUA 1UKTA 3FEQA 3UZWA 5CPQA 4JS3A 1N8WA 4GYFA 3BW3A 4JQAA 1E5JA 2E6DA 2YXOA 2NV1A 1FWWA 3LHYA 3N1AA 3URQA 1J12A 3H22A 3OVQA 4KBXA 4YTSA 3E2RA 1VD6A 2X8RA 2J79A 3SIMA 2Y5SA 1WKDA 3DXIA 1EO5A 3NQAA 3DI0A 4E2DA 1B4KA 3LLFA 2E8YA 3ICJA 3GHSA 4GO8A 1K7XA 4BF7A 1V4YA 3WF0A 1Q6GA 1VF8A 3ABQA 3WJWA 1DTUA 4WDWA 1W2PA 1F9CA 1FWCC 5A8GA 4NP7A 1OFBA 3ZVHA 3R1ZA 4AC7C 1AZ1A 2WXDM 1MDLA 1U30A 3ATZA 4LVDA 2WMJA 3VKAA 3LCGA 3W74A 2BVWA 2B31A 2QCNA 1V08A 4ZO9A 2OSYA 1SSDA 2D3NA 3NO3A 3CHFA 4U5IA 3W7LA 3EX4A 4GXWA 2NT0A 1OD0A 4GA8A 1G4TA 3GH4A 2WW5A 3FDGA 1R2TA 3BGAA 2AKMA 1F07A 1XGDA 2GSJA 2E7FA 5FJJA 4CQCA 1TE6A 1U1HA 4HD5A 3LRKA 1KW1A 4DQWA 1QVBA 3MT1A 4I9TA 3BCJA 2PBOA 3W86A 5HOSA 1JNEA 1OT2A 1TJPA 2Y85A 3WEMA 3GIPA 4QTGA 5I00A 3SUVA 3DC8A 2X42A 1XLCA 3K4WA 3OU8A 3GNXA 4JN7A 3TXZA 5DMLA 2WVSA 4LY8A 4IPPA 3W82A 3D0CA 3DX5A 3GX9A 3UXKA 3VFCA 3GR8A 3WQEA 1PL9A 1LLZA 3T8QA 3BOLA 4ZB5A 3GXDA 3GG0A 1YTEA 3VE7A 5HQMA 1KR0A 4GJ1A 1L6GA 7TIMA 2PU1A 3BOFA 4M19A 1UIOA 4I7WA 2J66A 3WUGA 3EKZA 3ZJ8A 3NJ3A 2OQHA 3LLDA 1OGSA 6TAAA 2RGLA 3QGVA 3W70A 1DWAM 1REQB 2OWXA 4JHOA 5JVLA 3P81A 4P7QA 1LBLA 1L6FA 1M03A 4HOZA 4US6A 3H23A 3CTTA 1SW3A 3GUWA 5JH2A 1XYLA 3MUIA 1JQXA 1NIUA 3GTXA 2EG6A 4HPGA 1KB3A 3W6LA 1WBHA 1W17A 2Q01A 4ATDA 1ITXA 4XSMA 1E5NA 4P5UA 1FCQA 5CGMA 4OJYA 1OD8A 2OGJA 1WOAA 1ZBWA 2XJ7A 2C1HA 3IUIA 5HUOA 3NDZA 1V03A 3FVDA 2I16A 1XLEA 3W1PA 1WO2A 3K8KA 4IIHA 4IP5A 2EPKX 3PSWA 1Z6KA 4AEFA 1SFJA 4H04A 3SRHA 1A5NC 4IGHA 3HPAA 2QCCA 3CZJA 1GOMA 2EHHA 3MW7A 4QE5A 2CBVA 2FGBA 2WWDA 4JHZA 3H24A 5D8WA 1THFD 2A3EA 4DELA 3E6EA 1XFCA 1IT7A 3OGVA 1E6SM 3VOHA 3BAIA 2WVVA 4Q4QA 3H2FA 3EB3A 3B4UA 1WPCA 3KDOA 3UCQA 4X0VA 2W66A 1Z3NA 4E4UA 1I2PA 3KVLA 3QEZA 1GOXA 3VA8A 4W5UA 3TW9A 2YBUA 1FWAC 3VIMA 4DWSB 5IHRA 4A3YA 1ZHAA 4XK2A 3WH5A 3CQKA 4IQDA 1E4IA 1BYCA 4JTGA 3W1NA 1Q65A 4JIRA 2I9EA 1JZ8A 2PRHA 4LBUA 3LNPA 2Q09A 4O54A 4UOJA 3FLUA 4G1KA 4O4WA 1ME9A 4AF0B 3E0WA 4O53A 1OYAA 1BFNA 1UWAA 1F3WA 2E25A 1E6RA 1LBFA 4Q6XA 1JDFA 2PLKA 4HYWA 5CC7A 5HMFA 3FX4A 4WOQA 1GOKA 3L66A 1NF0A 3O8AA 3VKJA 3GDKA 4LNCA 5DCDA 2PLJA 2Q8LA 1SO3A 3KBSA 2JFEX 3IIPA 3PC0A 1TJ2A 4JQ2A 1KCLA 3PPFA 2VX5A 2VZSA 3HJZA 1EL3A 1ZJBA 1FA2A 1TPUA 3AO0A 1JR1A 4Q4PA 4QDPA 4U5KA 4WF7A 1V6WA 2VQTA 3LTSA 3TC6A 4JIIX 1NWTA 1J0HA 1JPMA 4IIBA 1UR4A 4LU0A 4UQ9A 1FFRA 4JTIA 1MNSA 4UTTC 1P1XA 4W87A 4BJHA 2FZDA 2HROA 1N55A 4KESA 3W88A 3KP1A 4CCZA 3C2YA 1EA0A 3TNBA 1EH9A 1ITQA 1LYXA 2AQOA 4UNLA 2IPWA 4PRWA 5HR6A 2C3ZA 1IWPA 4PCNA 3DGBA 3P60A 1VENA 3DFTA 4J3TA 2FZBA 4S3CA 5CAHA 5FAGA 2FGZA 1TZZA 3VO0A 3KTSA 3QKZA 1TVPA 3NQCA 1J6PA 2GK1A 3V4BA 5HMDA 3GZ3A 2J9ZA 4FB7A 1BTMA 3MHGA 4UR8A 3EWUA 3F4CA 1SJCA 3VC5A 1EJSC 1QW8A 5ABGA 1QBAA 1ZCOA 4YHGA 2WCAA 3LHWA 2IS7A 1QCWA 1UR9A 3SCOA 2D23A 4DZAA 1C8VA 3GHTA 3ITVA 2AKZA 2XH2A 5LNVA 4AZIA 2Z1WA 4M6VA 3DG6A 5FI8A 1CPUA 5EU9A 5HNRA 3G2GA 4GPNA 3RK8A 4OWGA 5K4ZA 4LUTB 3TTSA 3L67A 3ES8A 1R9XA 2OPJA 3NL6A 1XGZA 2XFWA 1KNWA 2CC0A 3NPVA 4V28A 1ZCCA 3S83A 3W1XA 1SZFA 2Z29A 4PGLA 1HO1A 4Z0SA 5D2YA 2JKAA 1EP2A 4QEHA 1KM3A 4WHBA 2QJHA 1OVDA 3BG9A 4Y2WA 4L9ZA 4KCTA 4GVGA 5I3JA 4IFKB 5DRIA 3SADA 4JPGA 1BG4A 5I24A 3RCNA 3LHZA 1RQEA 4UQBA 4GK8A 4PMRA 3T42A 1KQZA 3EAUA 1ICPA 3V75A 2B81A 4GYJA 1XDLA 3BJSA 6XIAA 1UWTA 3SUSA 3C2OA 4MOZA 1VCFA 1LQ2A 1Q3NA 4JIHA 4RW3A 4M51A 2QJNA 1B3YA 4GD0A 3V3WA 4EX4A 5A8QA 4GZIA 5A2CA 1P0DA 4D1IA 4A3UA 2IKGA 1LDCA 1EC8A 2V82A 4ZMGA 2UY2A 3EDKA 3DENA 1EJWC 5BWAA 1AW1A 1ZU8A 5IFTA 1JPDX 1EJVC 4FZIA 5FOOA 4YN5A 1EIBA 3RMJA 4NX0A 5LZLA 4M82A 2R1NA 4H9UA 3IGUA 1F8IA 4CN1A 2WHLA 4KWVA 1TV7A 4AY7A 3FOKA 1UZHA 1F76A 3ONCA 3MHUA 4M29A 1XKJA 1EB3A 4NNAA 1TJ1A 3MUY1 3GAKA 4C1NB 4F3HA 1XPGA 4L6HA 4JIQA 4DO6A 4UTWC 3BW2A 5HDRA 1J2WA 4E3VA 3APYA 2DW6A 1EP3A 5BXRA 3WY1A 4DUXA 3W7OA 4UTLA 3A23A 5KZEA 2VUYA 2V3FA 3Q58A 3PZNA 4O0ZA 1KD0A 4JFSA 5I3GA 2GJXB 1V0MA 5GPRA 3WD3A 3THAA 2VR2A 3WQ4A 3EDFA 3M6YA 3AU2A 1GOIA 2XISA 3AHVA 5E9XA 3TQ0A 3R89A 1DIKA 1UA7A 1XW8A 4PUWA 1H1NA 2H6RA 4JOMA 5LIXX 1EGMA 2VZOA 3H2AA 4JFVA 1H7NA 1NDZA 2UZ9A 3A64A 1A5BA 4CKQA 3TCSA 1QW7A 4UFMA 4ZB2A 3NZQA 3CAVA 4EPEC 4ZTYA 4S3EA 1TPWA 4IJRA 4GHRA 3ZR4A 2O9TA 2WYSA 1QWKA 1DJWA 4NJJA 3TK7A 2PC8A 5CJNA 3NEHA 3CIXA 1EJ7L 5CJMA 1NQKA 1UPPA 5CGQA 3SQMA 2XVNA 2QEZA 4CQBA 3LN3A 1PJ9A 1GOQA 4Q7BA 4GY0A 4QNEA 3LTYA 5CSRA 4S2CA 2PE4A 3EWWA 2OELA 5EMJA 3TYCA 4AWTA 4DB7A 2PB1A 3SSJA 1OQFA 3PJXA 2RH9A 4NJIA 4W7VA 4QEEA 4HU0A 4LV4A 3CC1A 3SM0A 1C92A 2HXTA 1RXOB 4PUDA 5DEZA 3RX3A 1KCXA 1IXPA 3USBA 1G94A 3HB9A 4UCFA 5C6MA 1B9BA 2J88A 4GX8A 1TIMA 4L61A 4I5UA 2DSVA 3VIIA 3AOFA 3GS6A 2GJPA 3KRUA 5DY2A 4Y9NA 3WN6A 2XWDA 4MPKA 1F3EA 3OPSA 4JX5A 3ZWSA 4F9DA 4XKMA 2D0GA 5KZDA 3OZMA 2G3NA 1KKOA 1IYXA 3CLWA 4L1WA 1ZSXA 5MKGA 3RX2A 2V38A 3KOYA 1KXHA 1QI3A 1QPQA 2XGBA 3BH4A 4V1XA 1VFMA 1H7OA 1SMAA 4KW2A 4DUVA 4MYXA 1R3TA 1F5ZA 4TQTA 1FHVA 2QCMA 3MU7A 4ZOBA 3HMCA 3STEA 5FEZA 5GNYA 3QV6A 1TJRA 4J5NA 2OG9A 4C7DA 3L12A 2Y5EA 3AIWA 3IWPA 5GQBA 1LTDA 1XLLA 2BY2A 3KW3A 4XKYB 1M01A 2DPEA 5AHMA 3S3GA 3FSUA 5JXQA 1J0JA 4ZOAA 4YXGA 1PEZA 2VEPA 3CS2A 2HNHA 3P84A 4KRUA 7TAAA 1HL9A 4Q7IA 4MG4A 3O05A 4XUYA 3DUGA 4K8HA 1UHVA 3TFXA 1RPXA 2B7NA 1WZLA 2ZZ2A 3R13A 4LAMA 2JK2A 4UTIA 3CBWA 4HA4A 3UWQA 1XIDA 3GFXA 3F2BA 4EPBC 3K46A 3IV3A 1DP0A 1W9XA 3VI2A 3WQ8A 1U5VA 3PNUA 5DXYA 2RDTA 4IGNA 3CM4A 1QHZA 1KQYA 1XFBA 3TSDA 1Y5VA 4A6GA 2WHKA 4EAMA 2TSYA 3WLIA 3R6IA 3SRFA 2DT1A 2P3EA 3CJPA 3R2GA 4J3VA 3WLMA 1JQVA 3KBJA 3TJXA 1CLXA 3TVAA 1QPKA 3GTFA 4L80A 2VEFA 2GGJA 3KLKA 3R8RA 4G1NA 4IIDA 3NOYA 2DUXA 2ALDA 5HQLA 1UOKA 2ALRA 2HZGA 3ZOAA 3EKGA 4QSFA 1CWYA 4QQUA 5HNUA 3QMRA 3QOMA 1DIEA 4PUUA 4H2CA 3VGDA 3GC4A 4M1BA 3QYQA 5L6UA 4XO6A 1A4LA 1EGVA 2PCQA 3UCDA 4I7UA 4PL1A 1HJWA 2J8TA 4AD1A 4MWAE 4BF5A 4QCEA 4YTUA 1JAEA 4BKNA 2GGHA 4OT7A 1NFGA 4JQ1A 2ACRA 4L7ZA 3WLRA 1C9WA 5T91A 3T4CA 4FNRA 1SGJA 3N9RA 2HEJA 4N42A 4UTTA 2X1SA 2DVUA 1N82A 2Z26A 2W6RA 1W32A 2F7FA 1FDYA 1UP0A 2CNCA 1GUVA 1UZDA 4PMYA 1EDQA 2FMOA 3PPHA 3W1QA 3R94A 5HPOA 3QFEA 4FHAA 2I57A 4QLJA 3FNDA 1OWQA 5LA1A 4RUBA 3W1LA 3TJ4A 4E38A 4ROPA 1Q8AA 4NIRA 2P50A 4JTAA 5D8ZA 2XH7A 3RUBL 3GNDA 2PPGA 4GQBA 4LVGA 4S23A 2VFGA 3BAWA 1WKFA 4AXKA 1PXGA 3TN3A 2BHUA 4ACYA 3EWZA 4CUCA 4V33A 2XFFA 4AD3A 2G8ZA 3AWOA 4HNOA 1I60A 5CC6A 1QASA 3WF3A 2HDJA 1B3ZA 3AI0A 3NUKA 4H9TA 4XZLX 3UEQA 2CCRA 2ZUVA 5TAOA 1E73M 3VNDA 2VWTA 5FJOA 2EQDA 1VRXA 5BW6A 3SZ8A 1E51A 3UXDA 1QNQA 3IUHA 3II1A 1SPQA 3WQ6A 4MZYA 4LSBA 1J18A 3GU1A 3ITXA 5DN1A 1CECA 5C54A 5D2WA 1XLIA 3IAPA 4H9VA 1EEPA 3RIKA 3MCOA 4JYFA 3NQ6A 1J01A 4ZO6A 3WD4A 4L56A 3L2IA 2Y1HA 4AH7A 5G1MA 2X16A 4XO7A 2HBVA 1KFKA 4UNIA 1WP6A 3VIKA 1OF6A 1W9UA 2ZOXA 3TMLA 4JTFA 2YB1A 4XAYA 1AQ0A 3TN5A 4B5TA 1RY8A 4GUFA 3WLKX 2JEQA 5E6YA 3CUZA 1P43A 3KHJA 4UOQA 2OODA 3LLXA 3OVPA 4IMCA 4WOZA 4XBKA 1B2YA 5CPSA 3AXHA 4O1DA 2Y0FA 1V7AA 3LX9A 1RJPA 1QU4A 1LT8A 2DT2A 5JQ9A 2E4TA 3WLNA 3BUVA 2BXVA 3UBPC 1YPFA 2H8ZA 2GVGA 4LPCA 3MMDA 3OODA 5EGRA 4C1KA 3MV11 2PC4A 1RD5A 3UYIA 2CYGA 4GI8A 1EEXA 4AC1X 3E5PA 3FW6A 4LS2A 4HK7A 3ARPA 2AQVA 4GJIA 6A3HA 4G8TA 1IIGA 2IPGA 1JG9A 2J4GA 1E1CA 3W6MA 4CNSA 3ITTA 5AKQA 2AMXA 3GIQA 1CLKA 1DJNA 2NT1A 4G7FA 1EF2A 1GJPA 4H9ZA 5MHBA 2OWCA 2HISA 1F3XA 3AYSA 2NX1A 1IE7C 2PTXA 1ONXA 4HBKA 4LJ3A 1Y7VA 3NURA 4PCSA 5A69A 1EKOA 1KR1A 5EMYA 3PY2A 4TX9A 5IHSA 5AYXA 3W2KA 4H6EA 4PUNA 2YXGA 3WDPP 5CSUA 3DGRA 1DIOA 1A5UA 1IHIA 4GQ0A 5GNZA 3ZLFA 4B5VA 4B9YA 1AH4A 3K5XA 3ZZ1A 4Q6JA 1ICQA 4CLMA 4LUTA 3C0SA 4AQLA 2PF0A 1AL8A 2PF8A 2ATSA 3QY8A 4DLFA 2NXGA 2OOGA 1US2A 2GJNA 3VC6A 4UFLA 4E2BA 4B5NA 3LCIA 5CGTA 4PTDA 1UR2A 7XIMA 5BXSA 3WIJA 1DIDA 3MHFA 4WKFA 2JKEA 3MKCA 1JCMP 2J9XA 4RW5A 3W4RA 4FMVA 4HVXA 2F84A 1YPIA 1LOSA 4RE3A 4I8DA 3UA4A 3E0IA 1AD4A 1CXFA 1DQUA 3PVFA 1I6NA 3RPDA 2V63A 1UPMB 2OLAA 1D7KA 1UP2A 3N14A 5HBFA 4FLOA 1KWGA 1UD4A 2JALA 5ECVA 3AYTA 5FL0A 4WKAA 5EFDA 2W0UA 3IJDA 5D2TA 3W07A 4K7VA 4W7WA 2GL5A 1S5NA 4K38A 3WDHA 3AALA 1BKSA 3I65A 3NIYA 2Y7EA 1QNSA 3ARRA 5CPTA 5CAKA 3TROA 2WPBA 1DE6A 5AVHA 1DKWA 2XVKA 2B7PA 2P8CA 1UUOA 1ZL1A 3PZVA 1LQAA 2J77A 1JI1A 2QGHA 4E4FA 4DJFA 1PDYA 2QPUA 4HPHA 3RO8A 1KRMA 2PRLA 5EBUA 3SY8A 1AL7A 3DI1A 1CGUA 1IIHA 4NZ4A 1XR2A 3DDMA 3MP4A 5HJLA 3PUDA 2EF9A 2WC7A 3I4EA 2V2DA 4G7EA 3M0HA 1TPEA 2Y24A 3QFWA 4J4KA 3PG9A 4LVBA 1A5MC 3LZ5A 3BZJA 1ZBVA 4CNTA 3L4UA 3G1DA 2HBXA 3QGKC 2HQAA 3FY1A 4AYSA 1LL7A 3AUOA 3AMLA 4AF0A 1LZOA 1J5TA 1OHLA 1BLIA 3AZSA 3M4HA 4FIQA 3EOOA 1L8PA 4QROA 1O1ZA 2XVPA 2YB4A 2YZ5A 3QY6A 2GLKA 2OGYA 2G97A 4RNJA 4HPNA 4F9JA 1TA3A 4LC8A 2R6OA 1VFTA 4MKSA 1RA0A 1W3KA 3E3HA 1JGIA 2X05A 3ZM8A 1Q85A 3K8LA 1VYSX 5FEXA 4PMVA 4DWSA 4O0QA 3LBCA 1JZ5A 3VCCA 3TV8A 2PAJA 3UR8A 2WB5A 3D46A 2QGYA 2WJFA 4BWLA 2Q71A 3HQNA 3WJYA 1E72M 3O6AA 3QW3A 3S1WA 1HF6A 3A5VA 3FHQA 1ZALA 1ZGDA 4Y96A 3W53A 4DEFA 3AHTA 5J5DA 3DFYA 1Y0EA 1UD6A 1VJSA 1H61A 3P2VA 1B3VA 1GYNA 4TX8A 5MF5A 1XYZA 4Z0JA 4N9DA 3KWSA 2CLHA 1JRBA 4GLEA 2WCSA 4XTDA 4DWDA 3BL3A 4N6FA 1Q7QA 3GG1A 2VZVA 1XLKA 2PMQA 3BMVA 5A2AA 1EOMA 4KWOA 1W3TA 3WBXA 3ALFA 4O13A 3GDLA 3H4XA 4IUGA 3ZIZA 1SZEA 2XGIA 2FVKA 2QHAA 3T8LA 4MGGA 1G01A 5LNSA 4XAFA 1PWMA 3EPNA 2VENA 4ZE4A 3O9NA 4L1GA 4P7RA 2Y8VA 4Z2GA 4TTGA 1UD8A 1K8ZA 3N2BA 5HULA 2ZRYA 3IV8A 3S1UA 3WUEA 4ADTA 3CQ0A 2BY3A 1XRFA 4MFEA 5CKSA 1NELA 4GISA 5AC7A 5C9UA 3W71A 1W5MA 3D5HA 4AW7A 1G4PA 3VXGA 8XIAA 3OGSA 1K4GA 3B0UX 3CV1A 4C6PA 4E4PA 5D9PA 1S2CA 5I3FA 1GQLA 3T7VA 1ZY9A 4XUGA 3LQGA 2GVEA 4JQ4A 4AZBA 2BGNE 2FDSA 4JTUA 2YYTA 4EXBA 3O06A 1JUEA 3RRXA 3LXBA 2O56A 2D2OA 5ABTA 3MY9A 1R9YA 3GR4A 4KETA 3UF9A 1GEHA 2P5NA 2YCLA 2ZA2A 5EL1A 4EIVA 4RKAA 4PMXA 4HNNA 1MXSA 3ONBA 3GWQA 2JIWA 4GUHA 5BRPA 3ARUA 4MMWA 3GE7A 3N2OA 4KCWA 5DBTA 1ZLPA 1VZWA 2NQZA 1ELSA 3ZQ9A 1KC7A 5LIUX 2GJXA 3OQ8A 2RGMA 5G2IA 2ACQA 3OTRA 4YVPA 3B40A 4H3DA 5CZJA 3NQDA 1MW1A 4UTMA 1QI5A 2YL6A 2QUUA 3I4KA 5GVJA 1OEPA 1PIFA 5G1YA 2GJLA 3KS6A 3D3FA 2A3BA 2DORA 3URAA 2R1PA 3OBKA 4X60A 3W1MA 4HQVA 2WCGA 1BF6A 1OT1A 1V6XA 3B9NA 1VJIA 3PFMA 3ME3A 5H2ZA 1LT7A 1EYEA 3CYVA 5HK4A 3UXIA 2FLIA 1OG0A 3SCVA 4CD5A 4EXQA 2YDSA 3WK1A 3TC7A 2FFCA 3W7JA 2ZTKA 3G1VA 3HFYA 4UMAA 3UG5A 4UQAA 1M3UA 1HKVA 3W28A 2ZUMA 1G1YA 1WA3A 2DZVA 3T2QA 1YEYA 4H9YA 2HJPA 2PDJA 1H51A 3OLIA 4IL0A 3R0KA 2PDIA 4CU7A 2DGAA 2J27A 3W1RA 4O10A 1VHCA 3AICA 3BMXA 1EDGA 1MW2A 2QDDA 2ZXQA 3APGA 1QBBA 3LDVA 3SQSA 1J93A 1PZ2A 5LGXA 1GJUA 2E6YA 2DQWA 4GGBA 4YTQA 1NEYA 4A8LA 2NLYA 3RLUA 3VX1A 3UYCA 1GVSA 4NI3A 2CFFA 4MB1A 3AJXA 4Q8VA 2DW7A 2PWHA 4F2BA 2NWRA 2V6AA 3TX9A 4CGTA 1KTCA 2DZSA 4DXKA 1HTIA 1T96A 4CNNA 1Q7MA 1TTQA 3WG6A 1YE4A 3H21A 4K6AA 1DV7A 4DJDA 2H3BA 1K77A 1V3LA 1YW1A 4C6EA 4HN8A 4R88A 4F0SA 4G5DA 1PWLA 1A49A 1EZWA 1FHUA 1EX5A 5AC4A 6CGTA 3V1HA 5I23A 2VUNA 3I3DA 3UGRA 3EMCA 2INEA 3V0TA 2QPXA 4NF7A 3S8HA 2NUXA 2MUCA 5A3HA 1Z32X 2HPIA 2DZXA 4K3ZA 1I0BA 3PM6A 1R2RA 1TPH1 3WNLA 1VEOA 1TV4A 2ZRVA 2R8WA 2WQPA 3B0YA 5HA7A 3PBGA 4DF1A 2CXGA 1TMQA 3EPMA 4D6FA 3P0WA 3LXAA 3FCPA 1F73A 3QSRA 3HFTA 2Z7GA 2X09A 3CH0A 3ELFA 3VZYA 3ANUA 5K4XA 1GORA 1Q5MA 1GJWA 3KEHA 3VK5A 4MJ2A 1BGGA 1K7FA 4CQDA 1KKRA 2V5KA 4D71A 1XL9A 2B7OA 4YYFA 2PS2A 2E40A 2J7CA 3B03A 4C6JA 1VFUA 4BCEA 5KZMA 4N6EA 3PK7A 3RLHA 2NX9A 2VGGA 1EDTA 2PWGA 3OBEA 4R7JA 1FWGC 2EPMX 1K3UA 2OVLA 3HF3A 3T81A 4ORMA 4ZO8A 1BRLB 2HS6A 3B8VA 3N12A 3H53A 3DHFA 2QPSA 4N0RA 3EA3A 3BCDA 3BG3A 5FF4A 3BJFA 3OJGA 3L5AA 3PBMA 3RPTA 3VM7A 3EB4A 2DZTA 5AHLA 5ABFA 4F0MA 4YCPA 4O8AA 3MUXA 3EXSA 4LVAA 3SB0A 5A6KA 1QAPA 1TPDA 2W9MA 1IXOA 3NQFA 4QE1A 4ZQPA 3E9AA 2A4AA 3ARZA 1UH3A 4A8NA 2IQTA 4IX2A 3C61A 5J5RA 3C3UA 2OYKA 1XIIA 4KERA 4IPJA 3DFSA 4HNCA 3ZT6A 2JF7A 5LYRA 1XYFA 5FJIA 4PFMA 4IMFA 4TOQA 1I2QA 2Y8UA 3AIBA 4IMDA 1ODZA 4DF2A 1JULA 1FP9A 4BI7A 7CGTA 3G0UA 3UGVA 1B0IA 1QO2A 4IMGA 1KBLA 1VFHA 5PTDA 3PJUA 3TJIA 3UXLA 5CEWA 1WDQA 3IJLA 1B90A 1Q6DA 4QE4A 1NQ6A 4EF9A 1TX0A 3H54A 2C15A 3T78A 1B3OA 2A5HA 3UPMA 3NWRA 4NRSA 4Q8OA 3WDJA 1V51A 2DVTA 2AGTA 4D9PA 3GQYA 3GB6A 1D2KA 1UUMA 2Q6ZA 5JU6A 2ISVA 3I7RA 2QJMA 3FA4A 3CWNA 1W3NA 4UC5A 1YDNA 2V5BA 3LCFA 4QDWA 4QAWA 1W1TA 4CN6A 3WH8A 1G69A 3NPXA 3GAYA 3SUTA 1X7IA 3S1VA 3R5EA 2CLKA 3AXIA 4GYKA 1DL3A 1QO5A 1P0KA 1H1ZA 4M5PA 4NU7A 4NL1A 4CCCA 1TPVA 1OK4A 1P0NA 3SO7A 3UZJA 1J8VA 4HSHA 1A50A 1JIBA 1RBLA 3N29A 3NQ8A 2XM2A 4ES4A 4LH8A 3TUUA 4C6IA 1TMLA 2PTWA 1QOXA 1D3GA 4MHBA 3OO2A 3WNOA 4HK5A 4N7QA 3WBAA 1GVRA 1XINA 2GFTA 3TZFA 5C9XA 1M7PA 2WJZA 2WBKA 4W85A 4YIWA 4NY2A 1YLVA 1F61A 1OZQA 1D8WA 1UUQA 3NZPA 3NVTA 4DF0A 5C55A 1Q4NX 1JYXA 4R33A 2OOFA 4LYPA 3BQ5A 4F2UA 4PTNA 1JDCA 5M1TA 4PBFA 3KRBA 1N8IA 3R10A 1OK6A 4HNVA 1MZHA 3UVAA 3U7BA 1J0YA 3VNJA 4AHOA 5E0KA 1ONWA 2C18A 4LVFA 3W7PA 3UT0A 2BODX 2QDGA 2QVHA 2F61A 2EPOA 1ALDA 3C4UA 1DBTA 4XD4A 3N4AA 3CZ8A 4KFPA 3MPGA 3VKCA 4HU4A 4PRRA 2Y89A 5ECUA 5HINA 4YHEA 2X2GA 2EJ1A 2GWGA 1G5AA 3VZXA 3VNIA 4ML9A 4C1NA 1L0PA 1FH7A 1M53A 4W93A 2YCIX 3C5QA 1ONEA 4WY0B 2FPVA 3W2NA 2CZFA 4S2BA 1TV2A 4Z17A 3KBMA 4GE8A 2CLEA 4HA3A 2GVYA 3O15A 1JDAA 3WQDA 3HM7A 4K36A 1BWLA 1T7LA 1CIUA 3A9IA 1MRAA 1JFHA 1HW6A 1OM0A 3T0BA 1EPXA 1TB3A 2WANA 3RX4A 1PTGA 4HTYA 1U5JA 2YLLA 1E1FA 2J9YA 3GNNA 4M7SA 5DMMA 4J3SA 3LBMA 5GJPA 1B54A 3VFLA 1JXJA 1AQHA 1FWNA 1K9TA 3HJEA 1DXFA 2GJRA 2VD8A 2VD9A 2D1ZA 2VO5A 2J25A 1FXQA 5I3IA 2FHFA 3QRHA 3W27A 3N3TA 4H41A 2Z00A 3NDYA 1YDOA 4FR6A 3R7MA 2XWEA 2W27A 2XHYA 1S5MA 4C5YA 3BDKA 4P2VA 5EB8A 2VX4A 3MMTA 4HCHA 3PTQA 4PODA 4GVHA 3TEVA 3G5EA 4KH2A 4O19A 1JCJA 4KQNA 1EUAA 1KXVA 1RR2A 5H8PA 1JF6A 4CQ8A 4NJGA 2E9MA 4U28A 1W9VA 4UTHA 3SJ3A 1E0XA 3PSVA 4W84A 1E0UA 1PZ1A 2NW0A 1VB9A 1XUZA 3AS2A 3LU2A 5K9XA 2VC9A 3F03K 4GI6A 3UJ2A 1XYBA 1ZAHA 4HZ8A 1JPKA 2CZ5A 3TONA 1JAKA 2HE8A 2P88A 1CGYA 4PRTA 2F6XA 3SN0A 4ZQRA 1JD9A 4I6VA 1SJAA 3U8GA 4C6MA 1TVLA 3WLJA 2Z2BA 4G7EB 1CGWA 2HSAA 3VIFA 3N13A 4Q8WA 5I3HA 5K9CA 5JIPA 1AW5A 1RP8A 4ICMA 4L4MA 3G22A 4OU1A 4E2OA 1T5AA 4ACZA 1X98A 2KX9A 3O07A 1HIZA 4NXKA 3IIVA 3EMQA 1TPC1 3EWCA 3VMOA 2VTFA 3DFOA 4A3RA 3GDRA 4QR6A 5LIKX 2PWVA 4JTCA 4QAIA 5BCAA 2ZE0A 3H2OA 2OT1A 2GK1B 1CDGA 2GVJA 4JTLA 1GZJA 1O66A 4W88A 2F9RA 1XDMA 4AHQA 2BOFX 1Y65A 3CV6A 3E1F1 4YU1A 4MUPA 4POCA 4N9EA 3WFAA 3INPA 4BI5A 2ASHA 1XDJA 3CASA 4K1GA 4JX6A 1VIWA 4MB4A 5EPDA 2BY0A 2CESA 3WFZA 1K03A 4V27A 1ZENA 4QHRA 1BXCA 4RE2A 2OZ0A 4FLSA 3XISA 3NQMA 2XU2A 1XSKA 3U5UA 4EPKA 3HZ3A 2TMDA 3OQEA 3BLKA 3W85A 2WQDA 3M0KA 1W5NA 3DH7A 1QR7A 2ODOA 4Q8QA 4B3KA 4GFIA 3PR2A 1YIXA 5CZKA 1A5KC 4MY9A 3SURA 2OXNA 4HB7A 3VDCA 4DBEA 1S2AA 1JCNA 4K2SA 4B4HA 5DELA 5TIMA 4S3AA 2QT3A 1OZMA 4GOAA 1GYLA 2XZ9A 2CKSA 3S9IA 4HT3A 1R87A 1UJPA 1NFPA 4ENLA 8CGTA 1GHRA 2WSYA 3GRIA 5TNVA 2PFHA 1MXDA 3EEZA 4NX5A 1ZNNA 2ZXBA 3IJ9A 4DJED 4N9CA 3CYJA 2CXEA 1VPQA 2G4JA 3C86A 4NT0A 4RPQA 4R34A 1B57A 9XIMA 2F38A 3HO8A 4W8LA 3IRSA 2BVTA 1GKPA 1YNPA 4DWSC 4KEUA 4YWSA 3G8RA 1P6CA 2YA0A 2C0AA 5CG0A 3UR2A 3P74A 1CXKA 4LX4A 1O5RA 3F2CA 1PPIA 1JCXA 4JL2A 4ZR8A 1LP6A 2Z27A 1DJZA 2C0HA 4NSBA 1WXZA 4WDTA 4ZSTA 4NG3A 4DZ5A 2Z28A 4GZ7A 4LYKA 2Z1VA 3W7GA 1TRIA 2EO7A 2W67A 4J3WA 5CH9A 3IANA 4DXVA 4F66A 3VD4A 5G5IA 4DZIA 3EXRA 3TA9A 3PTMA 5LNRA 2X41A 3WF1A 3DFQA 5BROA 2NV9A 1BAGA 3CAWA 1QMLA 3DAQA 1G4EA 5D32A 4QS5A 2C19A 1YMYA 2QAPA 5D02A 3ABZA 2V81A 3EDJA 3IJ7A 4MPQA 1H2JA 3PZQA 1K1DA 1OFEA 1RCXB 5A6BA 1Q2SA 4Z08A 5LHEA 3H2NA 3G1XA 3DERA 1KM2A 1P6WA 4XSLA 4DIAA 1UKSA 4H9MA 4U2ZA 1UD2A 1R3RA 2YDQA 1GQJA 4KPLA 4QQ3A 4O1AA 4LW7A 5DT5A 5KSWA 5FD0A 1ZAJA 5IM51 2J62A 3I7SA 3A12A 2G95A 4FNUA 3GFZA 3G0SA 3V1PA 1FWFC 3GVRA 3DCPA 3UP8A 1EYWA 4J28A 3URNA 3EMZA 3J7HA 1ZJIA 2D0FA 3W7CA 2VFDA 4AIUA 2OMAA 4B5SA 4Q8UA 2VRJA 3RYSA 2PI6A 4O4VA 1TX2A 1OX4B 5BRQA 3LUTA 1YYAA 2I5IA 4JKLA 4ZSUA 1PKLA 1W0MA 3MI2A 1R46A 1PCWA 1PTDA 4AEEA 4KGJA 5JUVA 2V3EA 1BD0A 1HZYA 5KINA 1FOBA 1QNOA 1MSSA 1S46A 3ABXA 2QZRA 3HQ1A 1Z9AA 4IZGA 3VGFA 2JGYA 3K4DA 2OO6A 3RJXA 4CCEA 4ZXOA 3AIRA 3VGEA 1U1UA 2AAMA 2DU2A 3TCEA 1HP5A 3S47A 2P10A 3AISA 5KETA 5AZ1A 4I8YA 3OIXA 2NSXA 1IEIA 2VRQA 2AL2A 4M3PA 1E9IA 3DU0A 1L6YA 2X1TA 3MUCA 4WEVX 3SN1A 3CQHA 2REQA 1RBAA 4QJ3B 2O9PA 5FKYA 1E56A 5D33A 3ERPA 5HWNA 3EX2A 3WSUA 1JCTA 2Y61A 5D9MA 3LPPA 2ZX5A 1J9YA 2PEVA 2DEPA 2QJGA 3TR2A 4BQ2A 3M47A 4RJEA 4X9YA 5J8LA 1AG1O 3PULA 1AJ0A 7REQB 4QIUA 4DBUA 2J24A 2ZRZA 4HMCA 1RV8A 3IIOA 1EGZA 1TR1A 3W7QA 4J3ZA 4W7UA 4JFTA 1R5YA 2IXVA 3UNTA 3UJEA 1FWRA 3QPEA 3V16A 1DHKA 1JZ7A 3BSHA 4QX4A 1A3WA 4Q8PA 4D6GA 4Z2JA 1QHPA 3BSMA 2YIHA 1A4MA 4YPJA 4H8VA 4RX0A 1TKKA 3W29A 3R43A 1HJXA 3O7UA 1C29A 4RDYA 3N17A 1CYGA 2OKTA 4JR5A 4LY4A 2Z2UA 3EOLA 4RE0A 1VJZA 5L9FA 3MUZ1 1HKIA 4K8GA 4H83A 3RGTA 3T05A 4JNMA 2HRWA 4F2TA 4DJFC 4HYRA 3SN4A 4IJBA 3IUDA 4QM1A 2DSZA 4X9SA 4UQCA 3FGCB 3WEZA 4JFUA 3TQPA 1GK8A 4EXAA 2OX4A 5FF2A 5RUBA 4C6NA 3VD5A 4JNYA 2RDUA 3QLDA 2PDXA 4NUWA 2PDQA 3FJ4A 1P48A 3TYDA 1F74A 1MFVA 1XCXA 2FMNA 1XUUA 3GTNA 5EKYA 3MYOA 1UZ4A 3TR9A 3CZKA 3QN3A 3SGUA 1X1ZA 1ZP4A 8A3HA 4ALDA 3BG5A 3GTHA 4DXXA 2VCCA 3WQWA 4M6PA 5IRPA 4NYYA 2W62A 4PMUA 3CUGA 5TBOA 1KXTA 4PEKA 3LCXA 4RXFA 3EWXA 3DFPA 3W2LA 4DRSA 2ZX8A 4L5ZA 4O1CA 4ZFCA 3CWOX 3RCMA 3S1XA 3W76A 3F4WA 4J27A 4PBEA 3EYPA 3AXMA 3IJIA 4I9JA 3PTKA 4DLMA 4UMBA 3JUGA 3U2ZA 3EA2A 4RCXA 4TR9A 4MAZA 5C0QA 3PJWA 1DJQA 4FF5A 3N6JA 1ISVA 1NAL1 2J7BA 4ECLA 4AMAA 3TIMA 3CMGA 1LLOA 1LQ0A 1FP8A 3W7NA 1F4AA 4WX2A 3VUPA 1PE1A 2B0MA 4OBRA 4L6OA 1VH7A 1L8NA 1XRSA 1LL6A 3O6CA 2ESCA 1SUXA 3ANYA 4DBSA 1IWAA 3GH7A 2XSAA 1PHWA 2QV5A 1X96A 3I7QA 1XD0A 4AD2A 4GMEA 3ZT7A 3TMQA 3LV6A 1PIGA 1VLWA 4GI4A 1CW2A 1RUSA 1U83A 2WSPA 1OGBA 1ZPTA 1W5OA 4DUWA 3HG3A 3PWIA 1WDPA 1SO6A 4C90A 2TODA 5KITA 3L68A 1EXPA 4GY1A 2DH3A 5REQB 2DZAA 3CWHA 2XSBA 2CHNA 3LI1A 3VPLA 2ZXDA 2DFAA 3FHAA 3JZEA 4X2RA 1RPKA 1DWFM 1H0GA 1R3VA 2EPHA 3S2LA 3SCRA 3RM4A 4QRNA 3B9OA 1RVKA 4P7OA 2ADAA 2O55A 5DCEA 4KEZA 1TVNA 4N2YA 4YNGA 1H09A 4F0HA 4WLCA 3GC5A 4QDMA 1JJKA 1MUCA 4PTXA 3ABOA 2OX1A 3O0KA 5G2WA 2X2YA 1WBJA 1JI2A 1XQKA 4AX6A 3MSRA 1BEUA 4U4MA 3P0XA 5H91A 4CNUA 3A13A 3QM3A 4US5A 4IT1A 5D05A 4YL2A 2BASA 2DIEA 4TVCA 3E0VA 3S5NA 2FB2A 4LQ1A 2BVYA 2PZ0A 2A3AA 4EKJA 3B8IA 3VE9A 1TV3A 2Q3RA 3EXTA 3R0DA 3S2MA 3LCWA 3MZ2A 2IXUA 2POZA 2WM0A 2Z1KA 5AVNA 3MO4A 4E6MA 5K7JA 4LAUA 3A3XA 3L0KA 2ZZ6A 4AZ7A 1AQMA 1OC5A 4JNZA 4PZVA 3ITCA 3KL5A 2ZUSA 5T8GA 1NY1A 1VLIA 3BQ6A 2J13A 3BGGA 5KTLA 5FESA 4AFYA 2A85A 2PSNA 3VOJA 3VMNA 4XZMX 4WGHA 2ZC8A 4CQAA 2X40A 4MNMA 2X0SA 2WZEA 3BC9A 3MMWA 6REQA 3EX3A 1F3TA 4PSPA 5XIAA 2BG5A 1H5YA 2VURA 3NFUA 3WLQA 2BWGA 4WZHA 1YTDA 5LIWX 3UZYA 1UG6A 3VOGA 1K8XA 4C60A 4WSKA 4KEVA 2PP0A 2BP1A 2FZMA 4IISA 1Q7ZA 3WNMA 4JTSA 3HV9A 1GVOA 1TO3A 3CHEA 1K02A 1RK5A 3W7HA 4M1RA 3M0VA 2VP8A 3HQOA 1DQXA 3W2JA 1Z44A 3DZ1A 3R79A 4WR3A 3V35A 1XQLA 1FRBA 1R7OA 4HMEA 3ITLA 3HPSA 2ISSA 4EE9A 3WL0A 2NLIA 1QJWA 4L9XA 3KCLA 3FXYA 2ZCGA 4C5ZA 3LHVA 2YCEA 3FKKA 1R7AA 2AL1A 2ZVIA 5I3KA 3LGGA 4FOJA 3W9ZA 2QUNA 2XSXA 2OSWA 3SUWA 4Y6GA 2RHGA 2IUZA 2CZVA 1JCYA 1PS9A 3G3MA 2E0PA 3QHMA 4YMZA 1V8EA 1I1XA 5GJNA 5D2XA 2AGKA 5DBUA 4KKXA 1NWUA 3SIZA 5LNUA 1GCYA 3KDNA 2YBTA 3PNZA 1UR1A 5I02A 3DG3A 2QNEA 1FCVA 1HJUA 1QPOA 3NSXA 4MFDA 3WENA 3EPOA 3T40A 2DDXA 3B06A 4BQ3A 2BHYA 3CB3A 1NDVA 1S39A 1TRDA 4PCPA 1AA1B 2JBMA 3APTA 4UFIA 4BY3A 2PP1A 3GTIA 3POHA 3ALGA 1SZRA 4XAGA 4OV9A 4NAFA 3NA8A 4BHYA 3KM8A 5A6JA 2FKPA 3GZAA 5CSSA 4XD3A 3U7VA 1IR2A 1J4EA 2GDVA 3FKRA 2BMBA 3M5ZA 1NP0A 1XPYA 3LERA 4ERGA 4IQEA 2BGQA 3VDGA 4ZB0A 3A24A 2Y4SA 3WO8A 1XX1A 5D9OA 1FWDC 4R53A 5LHFA 2V8ZA 1M7OA 5FF7A 2VDHA 4IPIA 2OO0A 3UPWA 2VVSA 4PFHA 1QATA 2W5FA 3KRSA 5AYYA 2OB3A 4IL2A 2DSWA 3MWAA 3TN6A 3GR7A 3WQFA 4MF4A 3M1ZA 1KRAC 1EA9C 2HE5A 4FI4A 4PBGA 2A1YA 3VU2A 3FDKA 1FQ0A 3CAKA 4GC3A 3UWVA 4ZQOA 5B7ZA 5C2GA 3CGTA 3S4TA 2DIKA 4AEOA 1C91A 4BQ4A 3QV7A 1KM5A 1G9HA 3TKFA 3RM8A 4U33A 2R94A 4PE8A 1LUCA 4H8NA 3ZXWA 4HGXA 3BMWA 4XX6A 1TYGA 3GBDA 2ZDSA 2AAAA 4O28A 4M80A 4MY1A 3WDIA 2EJAA 4H6QA 4JTJA 3L4WA 5HMEA 3UCCA 2GWNA 3AWNA 1EBHA 3GKAA 5HMSA 3L7RA 3USZA 4HHMA 1KFLA 3WQPA 3ZWTA 3WF4A 4LEFA 4CEUC 3GM8A 3C2FA 2AQWA 3GFYA 2ZZ3A 1W8SA 3WMCA 1DJXA 3WNPA 4NZFA 9XIAA 2Z6IA 5C9ZA 3L0NA 1GOOA 3E0LA 3W26A 4I7VA 3MZNA 2FJUB 1ITUA 3AZRA 3UWYA 4L4LA 3MSGA 1IGSA 1CB7B 2JE8A 1AODA 3RRAA 2VMFA 1XLBA 4GO9A 2ZE3A 3UW6A 3PFRA 1IT8A 1Y5XA 3L21A 2DP3A 5G4EA 3OIHA 2V9DA 4KWWA 2XFRA 4XWUA 3WH7A 1W1A1 4MKVA 3VOFA 3JU2A 1NDWA 1K4HA 3TQKA 3PZOA 1B3WA 1T6MA 3IJ6A 4C6QA 4LAKA 1UD3A 3H2CA 4F4RA 4Z42C 3ISIX 2QUMA 4H19A 4IQJA 1TZ9A 2E68A 3L4VA 2DZBA 4B92A 4UWMA 2ZA3A 5CSYA 1EJXC 1QPNA 1V3JA 2KAUC 4C6OA 3U5YA 4GXMA 3B9DA 3T2OA 2EAWA 2QF7A 1I2NA 2Y7DA 3IVSA 1R0MA 3BXWA 1SFTA 2CLPA 1MQQA 2RAGA 1PSCA 3M5XA 3T0CA 1C93A 3FGCA 2QJJA 1I4NA 1K9EA 4MZ8A 2BXYA 1SFLA 2C1IA 2Y7FA 3GH5A 4JY9A 3WQOA 4B9ZA 2H9AA 1FWTA 1FWIC 4RK8A 1QI2A 5C70A 2P1FA 3CHDA 4DPPA 2BS9A 4UQEA 3LPFA 4FS9A 4AY8A 1P1MA 5BOOA 3P93A 4GQQA 5BRBA 3NQ7A 1XG4A 4YTTA 4UBPC 4GH3A 2BSLA 2BTMA 3W73A 3B8DA 3HGOA 4U3CA 1F6PA 4FXFA 2O9OA 4EWND 3W2UA 2R14A 4AIEA 1VBUA 1XH0A 2NSOA 1GZ1A 4URIA 4WSHA 4E5TA 1Q6LA 5DRCA 4XBSA 2OLSA 3LK6A 4PB5A 4S39A 3UZXA 3MANA 2D3LA 4BZYA 5C9RA 4UMCA 2JF6A 3GNRA 4EVZA 4FA3A 1WCGA 1OCJA 3VNYA 4XG1A 1GNXA 1E9ZB 2D22A 2OFJA 3QQ1A 3VNMA 3S5SA 5CJ5A 1MMFA 3O16A 3NYZA 3Q94A 4PUKA 4UZUA