1A5SA

Crystal structure of wild-type tryptophan synthase complexed with 5-fluoroindole propanol phosphate and l-ser bound as amino acrylate to the beta site
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
266
structure length
258
Chain Sequence
ERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE (ALPHA CHAIN)
publication title Loop closure and intersubunit communication in tryptophan synthase.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Complex (lyase/inhibitor)
total genus 98
structure length 258
sequence length 266
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 1998-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1a5sA00
1YXYA 5D32A 3S1VA 3HMJG 4S2CA 1G69A 3SW6A 3NQMA 3DENA 1J2WA 3B0UX 1SZEA 3PB2A 1OX6A 4LVGA 4HNUA 5ABTA 1GYNA 3IGXA 4O16A 4MZ8A 5LSMA 4KFOA 4MLJA 4TMBA 3TROA 4BK9A 1QCWA 1IGSA 2B0MA 3EX1A 3EWWA 1ML1A 2QJHA 4FXRA 3W7GA 3A5FA 3G24A 2V8ZA 1TRIA 1G7UA 2FPVA 2R94A 3L68A 3MJYA 1QOQA 3UZ5A 3MBDA 5DLCA 3V1PA 2ZZ2A 5BMXA 3W7JA 3S0CA 1ZY9A 1G4TA 3BLFA 3W72A 4JD4A 1GVFA 1FXPA 2HMCA 5AB3A 2CLOA 2NUXA 4QITA 3UWWA 4LV4A 1H7NA 2XFWA 3NR0A 1GZGA 3UPWA 2O7SA 1SUXA 1OFAA 2EGZA 1L2UA 2Q8ZA 4O13A 2CLLA 4LNYA 5HUOA 1PL9A 5I3KA 3N2MA 3ZWSA 1YYAA 4HN4A 3LDVA 4FNQA 2Y6ZA 4MFEA 5C54A 3NPVA 2YDAA 5G4WA 2NUYA 3SR7A 4RV8A 2Z2UA 5MHBA 5KITA 1N55A 3ABSA 1I2OA 1BWKA 1YLVA 1D3GA 1F5ZA 3FKKA 3UXAA 4JTTA 2A4AA 5G5IA 4WY0F 2C13A 4M6VA 1SO5A 3FA5A 4UTWC 3TDFA 1T99A 3D0CA 3A9IA 1FBAA 3W87A 3NAVA 1M6JA 1R47A 3W07A 3VI2A 4TX9A 1VS1A 4O4VA 3M41A 1IXPA 3G1AA 2WNZA 3TQKA 1TTPA 2VFGA 4Y9AA 4O11A 1J5TA 2HTMA 2ZA2A 5DY3A 3OIXA 3EXTA 3SGZA 3LHUA 2GJLA 5HWJA 4UC5A 3N34A 2WSRA 4PFMA 3ATZA 2DZUA 3B0PA 4L4LA 2NXHA 1FDZA 1VPXA 4Q33A 4ORIA 1RVGA 1P1XA 1WA3A 4JX5A 4GJ1A 1G67A 2TRSA 2V2DA 5FF3A 4WX2A 2C14A 4IMCA 2Y62A 3TCEA 1N8FA 2RHGA 1QPRA 3T55A 1H7OA 3B06A 1AW2A 2A1YA 1MO0A 3HG2A 4QIUA 3DU0A 2E6AA 5AYYA 5TQLA 1KFBA 4MYAA 4CNNA 3STFA 4O0KA 3CM4A 2BWGA 4JX6A 3GB6A 1L6WA 3H54A 4XQ6A 3FS2A 3BK0A 5F1VA 1PHWA 3WJYA 2C19A 4JTSA 5LNSA 4TR9A 3AJXA 3W75A 4ZZ9A 1GYLA 1SO6A 2XN1A 4S1FA 1NFBA 4ADSA 1K02A 1DBTA 4BI5A 3CU2A 4LS1A 2CLMA 5FESA 5CZJA 3W83A 2WO5A 2Q3RA 3TQ0A 4WXZA 1LLZA 2GVLA 4ZQPA 4XBSA 1L9WA 3HG3A 5I3JA 1XBXA 3QQ0A 4JDYA 3CT7A 4UTHA 2H8XA 2C1HA 3MI3A 5H91A 2Y70A 4P2VA 5DBTA 3GVGA 4L4MA 1KFEA 3THAA 1L6YA 3L9CA 2XN2A 3S5YA 1DJQA 5HULA 2QUVA 4O19A 5G2HA 1HL2A 4DO5A 2HS8A 4QQ3A 5E0KA 3ZR4A 4O12A 5AYXA 5HINA 5SWUA 2PC4A 1TPFA 1H50A 5EMUA 1GJPA 3GX9A 3LX9A 1GG0A 3FIGA 2OJPA 3DAQA 1OFEA 2KZHA 1XL9A 5EPDA 3TSBA 3GDKA 2AAMA 3NA8A 4A3UA 2P10A 2DZWA 4EF8A 3SJ3A 2YCEA 1RV8A 1LP6A 1I8JA 2A5HA 3CEPA 1VLWA 4M7SA 1WX0A 4NJGA 2NXIA 1ALDA 1FCUA 5I3IA 5FI8A 3NPUA 3KRZA 3EB2A 3NNTA 2PCQA 3DFNA 1EIXA 1TMHA 5TBOA 2VFEA 2V2CA 1V5XA 3EKLA 4HIBA 2QUUA 2VFHA 3QW4B 2R14A 5IBXC 2NV1A 2C18A 1BTMA 1SR9A 3R8RA 3TKFA 1H60A 1SW7A 5LHEA 5HJLA 3O1NA 3L67A 4GRSA 4NZFA 4NJJA 5G4EA 3PBYA 1WQ5A 1I45A 2WOQA 4UMBA 4YCOA 2QCLA 4MY8A 3G0XA 1HUVA 1UCWA 3UWVA 1WBJA 2EHHA 2VFFA 1UBSA 1W37A 3S8HA 1SZFA 5E93A 1XDMA 3TC7A 3A22A 2TPSA 4JTUA 4JN6A 2RDWA 3W1TA 3RFAA 4JY9A 4BWLA 2ISVA 5K4XA 2Y7DA 1O94A 1I4NA 3QMTA 3MUXA 3W7IA 1LOLA 2V9DA 1F2JA 3G0UA 3LTYA 3BW2A 2YW4A 5C6MA 4DPQA 1ZENA 4QNEA 4UTIA 3EX3A 4AXKA 3W1AA 1YTDA 3EXSA 1YDVA 4Z1CA 3IEBA 5U4NA 1T8XA 3Q94A 3M5ZA 2YSWA 4JIQA 4PA8A 2ISSA 1IF2A 4ZQCA 1Q45A 1PE1A 1LYXA 3LCGA 1G4EA 3TR2A 4O1AA 2NX3A 1RPXA 5K4ZA 4RJEA 5AHLA 1TQXA 3BO9A 3BV4A 1O60A 4LU0A 1LTDA 3W2LA 2C6QA 3GDMA 4RR4A 3W7PA 3EXRA 3TU9A 1TO3A 1DKWA 1ZAHA 3I7QA 2YR1A 1LRQA 1B4KA 3FEMA 1KLYA 4FX6M 5K3VA 1KM5A 1Y0EA 3R89A 4M6QA 3G8RA 2OT0A 1RQEA 2XN0A 4K39A 2CLIA 3MI6A 1KFLA 5EYWA 2NXGA 3R5EA 3ANYA 4O1DA 2JGYA 1KFCA 3WK0A 2BTMA 2J6XA 3IIZA 4LC6A 1DORA 3MP5A 4W9TA 3M1ZA 2YPIA 4UNKA 2FPTA 4KFNA 3KVKA 2OMAA 1J4EA 4UUIA 1P4CA 1RZMA 4PC8A 4IMDA 1SPQA 4HHPA 4IQLA 4UFMA 3CEUA 1X8FA 3P5ZA 4YCPA 3G1SA 1W5MA 1FXQA 4UTUA 1EA0A 3GXNA 4PODA 3W76A 1TPUA 1E51A 2QCHA 1K7FA 1IXOA 1KM1A 1W54A 2J24A 1H7WA 1UASA 4UFKA 1QWGA 3TJLA 2ZDRA 4IJBA 1H61A 4LTSA 2E6YA 2OX1A 2FQIA 1F74A 1K03A 3RNDA 4QNWA 1EP1A 1GOXA 2PRLA 5AC8A 5CKSA 2DZXA 1QPQA 3STGA 3P61A 3HIJA 1W0MA 3P84A 5EBUA 1TPVA 3C2FA 4N9BA 2V2HA 3NEVA 3W1MA 3W1QA 4B5NA 1XBYA 3SGUA 3PS7A 3RLVA 1KM6A 2RDUA 2X1RA 3KVJA 3W2UA 3MHFA 5AHMA 5A5WA 1JVNA 4WOZA 1PHQA 2DJLA 4NNBA 4OU1A 5HR7A 3U2OA 3DH7A 1W5PA 1YXCA 5DXYA 4FNUA 3GK0A 1GTHA 3BG3A 2ZZ5A 4K8EA 1QFEA 2VEKA 3UY7A 1A5AA 3PULA 1LRNA 2P0OA 3UWZA 4FIQA 5CPOA 4DF1A 3TW6A 2Y89A 4EIVA 1YADA 4GBUA 3G1DA 4BI7A 2B4GA 1S5WA 2QCNA 1H63A 1TSIA 4S2BA 3ZWTA 3O6YX 7TIMA 4N02A 3P80A 3QFEA 1TREA 2JK2A 4KWVA 1KTNA 2X1TA 3GDLA 4N2YA 2I14A 3DI0A 4JTHA 3NZRA 1FCQA 4QJ1A 1W3TA 3FJLA 2J9ZA 4G1KA 1KM0A 3IIOA 2YX0A 2WSQA 4CNOA 1LDCA 6ALDA 3S6DA 3TAKA 1LCOA 3CC1A 4R7JA 3KAOA 4MY9A 3KOFA 2CZDA 1GG1A 3GZ3A 3JR2A 1B3OA 3OBKA 1LOQA 2H3DA 3GDRA 3SSJA 3T7VA 4AWUA 3W7OA 3B05A 3TMLA 3OVQA 3A5VA 3WJSA 4NZJA 3EWYA 3W1NA 4TIMA 4Z0JA 3PBUA 3PUEA 4O14A 5LHFA 2WPBA 1ME8A 3MBFA 2ZRYA 1OYCA 1PV8A 2ZRWA 3W7CA 3NM3A 1JCMP 1H62A 1ME7A 2H6RA 3HGJA 2QJIA 2BLEA 2VEPA 3O63A 1Q6LA 3P60A 5GVJA 1WOBA 1NSJA 1B57A 1X6UA 4FIRA 4IMGA 1DQXA 3BG9A 4K38A 2P1FA 1H7XA 4J9JA 1QAPA 1ICSA 3L5MA 4JXCA 1NAL1 4WQ6A 4MZ1A 3L2IA 1QO5A 1TYGA 4UFJA 3BGGA 1H51A 4TO8A 1OFBA 1XBZA 4N9DA 5K9CA 4JYDA 4FEZA 2RKXA 4MIMA 2ZA3A 3L0NA 3N73A 1O5KA 3C56A 3QPZA 2YGYA 5KZDA 3W84A 3OA3A 2QAFA 3PC0A 5LNUA 3LCIA 3O6CA 2ZFAA 5G2IA 3W2MA 5C2XA 1JUBA 1PCWA 1P5BA 3N19B 1LBFA 3MP3A 2NX1A 2ZTKA 3SECA 1UUMA 2EPHA 3T4CA 3PM6A 1RR2A 4O50A 3I7SA 5AOUA 1JRBA 3T78A 1LROA 1LM1A 4UCGA 3UQNA 3HOJA 1Q6RA 2J9XA 4LVBA 2ZZ7A 3ZFHA 5AHFA 1BWLA 3PAJA 3M5YA 3CLMA 3TW7A 3OVPA 3S42A 2E77A 1TIMA 1B4EA 1GVSA 1K3UA 3LCXA 3C0JA 1H1YA 1MEIA 3C52A 4ICNA 5F1UA 1A5SA 4N4PA 3THQA 3PY2A 5K9DA 3DFQA 4A29A 2ABBA 4Y96A 1S3HA 5D37A 4WXYA 3PUOA 4NQ1A 2YZRA 4AH7A 3IGSA 1EUNA 3QEZA 1SW0A 4JGDA 6TIMA 1QO2A 3MYPA 3T40A 4WUIA 3QM3A 4ML9A 2PRHA 2DORA 5F2IA 2ABAA 3O16A 3ABRA 3DFSA 4UMAA 2EAWA 3L21A 3Q2DA 1OX5A 2VXNA 4GE8A 3P81A 5EKYA 3OG3A 2QCMA 3PF3A 2X30A 1FWRA 4JS3A 2TYSA 3DFTA 3NQGA 5D05A 3VE9A 2NX9A 3W7KA 2GUUA 4KKXA 2ATSA 4E38A 1NF7A 1Z41A 4PTNA 3TXZA 2G5WA 4Y8FA 4UR8A 4LUIA 4LV9A 4I7VA 2B7NA 1EB3A 4N6FA 4FB7A 4FNTA 5CSSA 1JUEA 2H8ZA 2RFGA 3PR2A 1SZNA 2GQ9A 3GYEA 2J27A 1SQ7A 2YFOA 3BARA 3CTLA 5C55A 1FDYA 3S5ZA 1I2NA 4YWIA 5TIMA 4MOZA 1U5JA 1KM3A 2DJXA 2W79A 4TU1A 5KZMA 4O1BA 4K6AA 4R33A 4AWSA 3P7YA 1VYSX 5CSRA 3GAKA 3EX2A 4UR7A 4XZ9A 3G1FA 4UTTC 3M47A 4UFHA 3LRMA 3G1VA 5FEPA 1AW5A 1VZWA 2A0NA 5LGXA 3C61A 2V5LA 4YMZA 1GQNA 4DQWA 5L9FA 5A8GA 1WDWA 4O53A 5AC7A 1S5TA 5FEXA 4N9EA 4DF2A 4LVAA 1W5OA 3NPWA 4P61A 2VELA 2ATMA 1SFJA 2AGKA 1EWEA 4RX0A 3IIVA 1NF0A 2B7OA 4OWGA 2X16A 2ZYFA 3LOTA 4MZYA 2YYTA 3MMTA 1KM2A 2BZNA 2X2GA 1SSDA 1ZCOA 3M5XA 4JX4A 3G1YA 3ELFA 1LZOA 5AYZA 3VE7A 2VEMA 3NGJA 1TPC1 2G96A 1Z42A 5D33A 2ZRUA 3W23A 1DVJA 3EEGA 3FYPA 3BW4A 2ZCGA 3LLDA 5FF7A 3R2GA 5BNKA 3NQEA 2ISWA 4GUGA 1G4SA 1SU5A 1ICQA 2WJZA 3CHVA 3VKJA 2QCCA 1THFD 3P82A 4GWEA 4IXXA 3W7MA 3LI0A 4UTMA 4UMCA 5D04C 1F73A 3NQFA 3FLUA 3N2XA 4LVDA 5LNRA 3CPRA 3LV6A 1KFKA 4BFAA 4NX5A 4O17A 3W86A 4XTIA 3S5NA 4ALDA 4RXFA 4PCFA 1BEUA 3SIZA 1SZGA 2CLFA 4OT7A 2Z0IA 3P8IA 3NZ1A 1EP2A 3SFKA 3I68A 2QDHA 2WQPA 1TJRA 1TCDA 2E68A 4Z08A 2HS6A 1SO4A 4RXGA 1A53A 1K7XA 2F7FA 4AWTA 4M7TA 4GNJA 1AW1A 3C2VA 3E12A 4AHOA 4DF0A 2Y61A 4UTWA 5K2ZA 5EL1A 4NU7A 4OV4A 3ZS4A 4XBKA 8TIMA 2FPYA 5D2XA 1AG1O 2ZZ4A 1WOAA 3QC3A 2QAPA 2A2IA 2C3ZA 3KVMA 1EP3A 3LCLA 1JCXA 3LXBA 1TTIA 4JTJA 3W2NA 3W74A 1SW3A 3NL5A 3UWYA 5CZ0A 4ZQNA 4EF9A 1ZJIA 3TAOA 1YPIA 4GUFA 3L5AA 4DO6A 4HKPA 1TPWA 2E6FA 3O06A 1QR7A 5J5DA 2HSAA 3HGSA 3NQ6A 2QCEA 4EVZA 4I7WA 3S5OA 5D30A 1M5WA 2CZFA 3C2EA 3KVLA 4K8HA 3B4UA 3NM1A 4OHQA 4DBDA 4UFLA 1H7PA 4X3ZA 4IMFA 1AL8A 3S1UA 1LOSA 5EY5A 3IVUA 1LORA 2QR6A 4JNMA 2GQ8A 1XXXA 3W7QA 5F2GA 4UNLA 3ABQA 5HQEA 1SFLA 1TPB1 1XUUA 2A7PA 3NYZA 2ZZ6A 4M6PA 3PBVA 1I2RA 3W7HA 4A21A 1ZNNA 4RZ4A 3LERA 2GQAA 3EWXA 1EWDA 4AAJA 1DQWA 3EX4A 2YYUA 4EOUA 5D2YA 3BLIA 4Z0SA 4AB4A 4K37A 1HO1A 3V75A 5I3FA 3O15A 2QCDA 3HBLA 4A22A 4FO4A 3EWZA 3LHYA 1I2QA 4UTJA 1OK6A 3MP4A 3DBPA 3HO8A 4O0ZA 5U7SA 3TK7A 3HPZA 1GT8A 4CNPA 4UTKA 3TE9A 1SSGA 2IQTA 3RK8A 3QF0A 3E9AA 4NVTA 5KMYA 3GLCA 4ZQMA 3O07A 1CI1A 2E09A 3NQ8A 4NXSA 4XKYA 1UUOA 4POCA 1YTKA 1WBHA 4H3DA 4NUWA 3LLFA 4X2RA 1IXNA 5F4XA 3K30A 3LHWA 3DZ1A 2DZVA 3A23A 5D2WA 3GIYA 3HGOA 1VRDA 1FCVA 4XTDA 3TX9A 3TH6A 1AL7A 4LY8A 3F4NA 3DKLA 1OYAA 3MO7A 3W7RA 2QJGA 1IXQA 3Q58A 3P67A 2X1SA 5AHEA 4IXHA 2Z6JA 4LW7A 3C2RA 1HG3A 1XDLA 2DZTA 1OF8A 1ZAJA 3VFLA 1FWSA 1KW1A 1XBVA 2A6LA 2QCGA 3B8DA 3W70A 4PEKA 3HG4A 1F6KA 1T0OA 2Y7FA 3NQAA 4M19A 2CLEA 4LC8A 2O7QA 3OHIA 5HMSA 4EWND 4ADUA 3NL3A 4IGHA 3OVRA 5AHIA 1A50A 3W7DA 2TSYA 3MHGA 1XUZA 3UNDA 1W5QA 3CWNA 1VCFA 3S1XA 5CG7A 3TUUA 1KM4A 3M16A 3PB0A 5IBXA 1TB3A 4RZ6A 1JQXA 1VLIA 2FIQA 1XC4A 3E96A 4U4MA 1H7RA 1OFOA 3UXDA 1VYRA 5HNRA 3R13A 2CLKA 3W22A 4A2SA 3NVTA 2A21A 1DOSA 1K7EA 2QCFA 5F2MA 4JTEA 4UIOA 3A21A 2Z1BA 1Z48A 4JYEA 1KLZA 2WNQA 2W6RA 5CZSA 3TSDA 1K8YA 2FJKA 4GXMA 4HSOA 4BR1A 1JULA 3NQ2A 1H5YA 3IVTA 2WKJA 2AQWA 2V0TA 3WFAA 3E49A 3GNDA 4FHAA 4IPJA 1EX5A 5DY2A 2FDSA 4I7UA 2JBMA 3QZEA 3LTSA 5CPLA 1OHLA 3WK3A 1DHPA 3JS3A 2CFFA 2TMDA 4K7YA 1EUAA 1Z44A 5LZLA 3NQVA 3CWOX 3C8FA 1X1OA 1YDOA 2F84A 2I9EA 3WJXA 3WK2A 2CU0A 3IVSA 2ZRVA 4PL1A 1QPOA 4AHPA 4PH6A 1VH7A 1TV7A 5I3HA 1JCLA 1R30A 1Q3NA 5CZTA 3F4WA 4AHQA 4LS2A 4E0CA 4UFIA 3HB9A 2DZPA 4I9AA 1KA9F 1QPNA 3NQCA 2QDGA 2LLEA 4OBTA 4WOQA 3DKJA 1M7OA 2WNNA 2NWRA 3KRUA 3PVFA 1FCBA 2DP3A 3O05A 2Y85A 2JKAA 3S1WA 1OFDA 3SI9A 1F05A 1R2TA 2Z6IA 3PSWA 4ADTA 3NOEA 1GVQA 4AF0B 4YL2A 3QW3A 4TMCA 4YLWA 2VEIA 2G97A 3W1RA 5D2VA 1R46A 1RQHA 5DXXA 3F03K 1OYBA 3UPBA 3I7RA 5J5RA 3WK1A 1W56A 1U83A 1EPXA 1G6CA 4JTKA 2FLIA 2CW6A 3W88A 5F4WA 2WV8A 1OVDA 1TV8A 2ZRZA 4NT0A 4X9SA 1W3NA 5E1QA 1JUKA 4M5PA 4WY0A 5D03A 1L6SA 1RD5A 4JTIA 1OF6A 3KHJA 4ZQOA 4JY8A 1RQBA 2VENA 3N3MA 3NO5A 4C1KA 3GR8A 2A85A 3PSVA 4YXGA 3CIXA 1K8ZA 1CW2A 1DL3A 1Q6OA 1YDNA 5DCBA 3IIPA 2DU2A 2ZZ1A 4JYFA 2EKCA 4JDBA 4E2DA 4ZVJA 3N9SA 1M7PA 1FWTA 1A5BA 3BLEA 2RDTA 4IX0A 2ZTJA 4C1LA 1WV2A 2FFCA 5HWNA 1PCKA 1ICPA 3O6DA 4WJEA 2ZA1A 3M43A 3FYOA 4MY1A 1OABA 4X22A 2E6DA 4JTFA 1JQVA 3W7EA 4DPPA 2QCDB 3KFTA 1QNVA 1VCVA 4FX8A 3LV5A 3N9RA 3QRHA 4JTGA 3QMSA 3CIWA 4HSNA 3OEXA 3B03A 1W31A 4RLIA 3B04A 3GXTA 1XFBA 1TJPA 3EKZA 1K8XA 1TQJA 3P5YA 5K9XA 2Q8LA 4Y6GA 5LNWA 3NG3A 1OX4B 5L6UA 4CLMA 1N7KA 1FWWA 3FKRA 1VHCA 3BPWA 4XKYB 4R34A 3HPXA 3LBCA 4O8RA 3GDTA 4QISA 4N4QA 5KINA 1VHNA 1KV5A 4BWLC 4RK8A 1LBMA 2CZEA 4OGZA 5LGZA 2FB3A 1TPEA 3IRDA 5BRBA 3GKAA 1I2PA 4LWWA 4FF7A 3TQVA 3N14A 2H3BA 2NZLA 3L65A 1R2RA 3C6CA 1F6PA 4N9CA 1V7YA 1PS9A 2E5DA 4Y90A 3DXIA 1PVNA 4JIPA 3IGUA 1QDSA 5CPNA 3G3DA 3LGEA 2JKPA 3E02A 2C16A 3E0IA 3FOKA 5BOOA 1O95A 1XCFA 1P0NA 2NUWA 5AC6A 4BI6A 3W2KA 3EX6A 3ATYA 3G8EA 4NNCA 3L0GA 1C9DA 3RLUA 2ZRXA 4O10A 3W85A 4U28A 3Q37A 1OFRA 4WZHA 2BSLA 4MFDA 5FEZA 3W1UA 4MLRA 2A7NA 4IOTA 2Y7EA 2GVJA 4RKAA 2V30A 2GPTA 3TJXA 4JR5A 4O1CA 1XI3A 3GAYA 1JCYA 5KSWA 4AEOA 4NXKA 4CCEA 1FWNA 3M7WA 3O8AA 1AMKA 3HQ1A 4GUIA 3TNOA 2FTPA 3MHUA 2RH9A 2GOUA 3UD6A 5AN7A 2V81A 2PRMA 3MWAA 4D2JA 3LRLA 1LLWA 3HGRA 2QUTA 2X1UA 3RF9A 4O57A 1O4UA 1TTQA 1IIGA 4FXSA 4IX2A 3L66A 3HJZA 3MW7A 5LKYA 4RZ5A 1FX6A 2Y63A 4OQVA 3G0SA 1P0KA 5HUPA 3NDOA 1B9BA 4HNNA 3QMRA 3LHTA 4LOCA 1W3IA 4RCXA 1X7FA 3G18A 3G22A 4LUJA 1AK5A 3WJZA 3BG5A 4MVAA 3FFSA 4MKNA 3PWAA 3TIMA 1IIHA 3QYQA 5D09A 1O5XA 4E2BA 3M44A 1ME9A 4CCCA 1VGAA 3P74A 5LNVA 5G1YA 5HR6A 4GFSA 1C8VA 1C29A 1MEWA 1X1ZA 3TV8A 3S9YA 4ZL1A 3LCFA 1TPDA 2R91A 4CCDA 3QSRA 1OFPA 3W71A 5BMWA 3G3MA 5FF2A 1MSSA 1XM3A 4FNSA 5G1TA 1VQTA 3BGJA 2UV8G 1JCJA 4NJHA 1ZFJA 3LCHA 2DZSA 3G1XA 4GC4A 3ABOA 3W1LA 5KZEA 2A6NA 2PURA 3M9YA 4DBEA 3GNNA 2CWNA 3QSTA 1OG0A 3USBA 3A24A 3TC6A 1A5CA 3QH2A 4DEFA 3STEA 2Q3OA 1KFJA 1ZALA 3LM7A 1JRCA 3C2OA 4AF0A 3HPSA 1W5NA 2VOMA 1UB3A 2NWSA 2WSYA 2ALDA 1ZAIA 5AHNA 5D38A 1TRDA 1QMLA 2NLIA 5DBUA 1VJIA 4OV9A 3TFCA 3W6YA 3IIXA 3KRSA 1FUYA 3LI1A 4ORMA 3HG5A 4UTLA 2R8WA 1JR1A 3CB8A 3I65A 3UWQA 2ZQ0A 5F4SA 2QF7A 1ONRA 4NJKA 4HPJA 4MUZA 4N6EA 4WY0B 3HF3A 5DCEA 1XKYA 4O54A 4XUGA 3PUDA 4HNVA 4QM1A 3WJWA 2GJNA 2B7QA 1W8SA 3L0KA 4O52A 1GPWA 1OJXA 4H4IA 4JEQA 1W1ZA 3DFPA 3BW3A 3NQDA 3TXVA 5D02A 4XWUA 2A7RA 4FX7A 4O18A 4ZMGA 5FF0A 5IM51 2JKEA 5HWMA 4NNAA 1T96A 3CQ0A 3EWUA 4KFPA 1D3HA 3DGRA 4Q4KA 3C4UA 4HPXA 1FY6A 3DFOA 4CQAA 2JGQA 1S5VA 2Y88A 3W2JA 3UWUA 1PIIA 1WAUA 3M5VA 2G95A 3PG9A 3IV3A 3LXCA 4KWWA 1YPFA 2I1OA 3VCRA 1G4PA 1YXDA 3W1XA 3W7LA 4UXDA 4LT9A 3SZ8A 4UTTA 4LRTA 4BF9A 1HFBA 4IPIA 4IMEA 4Q32A 3P8JA 3NPXA 1EEPA 3NXFA 3M0ZA 1HO4A 1OX4A 4LRSA 5AFDA 4O15A 3TSMA 1LBLA 2BXVA 3NQ7A 3F1QA 3GXPA 2NV2A 5D2TA 2YW3A 5H2ZA 3UZJA 3RU6A 2PE4A 3SY5A 2VFDA 1LRTA 3EWBX 4K36A 1JJKA 1GEQA 1KTCA 1OFQA 3STCA 3LHZA 2D73A 4WD0A 4MYXA 1CX9A 3NL6A 1DJNA 1MZHA 2Y7GA 3AO0A 2EF9A 3LHVA 5G2WA 5K7JA 1VR6A 3L5LA 2VC6A 4K7VA 3P62A 5F2LA 5FEWA 4MJZA 4MPQA 2OZ0A 5DN1A 1NEYA 2VKZG 1GWJA 2VFIA 5DELA 1FQ0A 4HNTA 2H90A 4CQ8A 4DELA 4DXVA 4OE7A 4AVFA 1NVMA 3KX6A 4Z1AA 1KBIA 1SO3A 1D9EA 3QPYA 1QOPA 3LRKA 3PBWA 1VCGA 2CZ5A 2ZBTA 2V5BA 3U8GA 1H1ZA 3W9ZA 2W0UA 3DHDA 4A2RA 3H53A 4O4WA 2J88A 3BVJA 3LTPA 1F76A 2E1DA 4LVFA 2OCZA 3U6WA 4JICA 3LBMA 5C5YA 3KXQA 2E5CA 1KBJA 1HTIA 3W7NA 2C15A 3GKFA 1G7VA 4O28A 3W3OA 3PG8A 2E5BA 4FNPA 1TV5A 4NJIA 3NL2A 2YFNA 2QEZA 1OK4A 3TA6A 3W1PA 5EA9A 3QQ1A 3MI2A 5KTLA 1DV7A 4LS0A 1WXJA 4ONVA 3I6RA 1MXSA 4MJMA 1TPH1 1GVRA 4HT3A 5CPMA 1R2SA 1VYPX 4QAIA 5BW6A 1VC4A 5I3GA 3H55A 3UYCA 2CLHA 5FF4A 3LXAA 3INPA 4GUJA 3LB0A 3C3NA 3DHFA 4PL2A 3FJ6A 4Z1BA 1ADOA 3RMJA 5T26A 3QJAA 4JTLA 2OT1A 4AMAA 5CGQA 3GR7A 3MYOA 2ZZ3A 1KV8A 1GTEA 3TFXA 3B0VC 2BX7A 2FB2A 3R12A 5DCDA 4GUHA 2QKFA 4IWWA 3VNDA 2YXGA 3DI1A 2GVGA 4FNRA 4NX0A 1MEHA 3M6YA 3TMQA 1KTBA 3LCWA 1ZHAA 2J9YA 1GVOA 4H6KA 1JCNA 3G1HA 2C0AA 1YTEA 4QSHA 2V82A 4IUOA 1TTJA 3YPIA 2B7PA 3T44A 4ZQRA 4CQ9A 1UJPA 3W73A 1FDJA 1Q6QA 4R53A 4Z1DA 3UY8A 4DO4A 1F7BA 3JRKA 1WYIA 1BKSA
chains in the Genus database with same CATH superfamily
3HMJG 3S1VA 1RJPA 4S2CA 1U1JA 3GIPA 2OFJA 4UQ9A 4HZ6A 4LVGA 1GYNA 1PKLA 4PTDA 3L23A 4KFOA 2PDMA 5I23A 7ENLA 3TROA 2XPKA 2WM1A 4C65A 1I75A 3EA3A 1M41A 3MB9A 1KNWA 2PDPA 3G24A 2AL2B 2R94A 1GONA 1SJAA 5ECUA 5DLCA 1V93A 3ZLHA 3MSRA 3W7JA 2WZTA 3WLJA 3FSTA 2DT1A 2ASHA 1FXPA 4PB3A 4RV3A 1WPCA 3R25A 3VIHA 2ONEA 4QITA 2HPMA 5FJPA 2XFWA 1W9PA 4FPSA 3E0FA 1GZGA 4NYUA 2O7SA 4LYKA 1SUXA 2J7GA 4ATDA 1OFAA 3NQBA 3UR5A 2WB5A 1UR2A 4AEEA 1L2UA 3V7PA 4HK5A 2Q8ZA 1RUSA 4H6QA 2PCEA 4QG8A 1UZ4A 1C8YA 4FNQA 3IAQA 2Y6ZA 3NPVA 3WF4A 2ON3A 2NUYA 2IPFA 4W88A 1EJWC 1IHIA 4R85A 1I2OA 1YLVA 4NRRA 4RDYA 3N11A 2NVCA 4QE5A 1SO5A 3TDFA 5A8PA 3OYZA 3SN0A 4O4VA 3M41A 3WL1A 1IXPA 3G1AA 4NYYA 4GABA 3EOLA 1TTPA 1BWVA 2VFGA 4O11A 2OU4A 3OIXA 3WMCA 5HWJA 2XVNA 3DG6A 2WSRA 3BJTA 2YKKA 2PP3A 1QPKA 3B0PA 4C6EA 1A5NC 2R1NA 4ORIA 5CJMA 2BMBA 3A3XA 2TRSA 4S38A 3AQUA 2XIIA 1XPGA 4W5UA 2C14A 4IMCA 1MXGA 2Y62A 4KW2A 1TE6A 1EZ2A 1QPRA 3XINA 2E6AA 5M5DA 5AYYA 1BYBA 1CT5A 4RL3A 1GKQA 3G6MA 2YL9A 4O0KA 1L6WA 3OODA 4PMNA 3W53A 3WFZA 4GZEA 4H9MA 1OCJA 1E6ZA 2C19A 3NURA 3TYBA 3RO6A 1C9WA 4MWAB 3RPMA 4ZZ9A 3C8NA 4S1FA 4AX7A 2OZ3A 3IUIA 3L2MA 1HJUA 3QKZA 4PUEA 3RX3A 5GNZA 3W83A 3FNDA 2RJHA 4GA8A 3DX5A 4QLLA 3QQ0A 1US0A 1RBOB 3HN3A 2C1HA 3VMOA 4P2VA 3WKZA 3RM8A 1KFEA 5EMMA 1L6YA 4RE3A 3WMLA 3WX7A 4HD5A 3VKBA 4WGXA 1OZQA 4Q8TA 5HULA 2QUVA 4QLKA 3UVAA 4O19A 4FA3A 4ACZB 4QQ3A 2WVVB 1XKJA 1ZP4A 5LXXA 4GH3A 3V18A 1TPFA 1CGXA 4DWSB 4GYFA 1GG0A 3E2RA 3FIGA 3SAZA 1H3GA 1ZQ5A 1US2A 3LG3A 5EPDA 3WUGA 3H8AA 4A3UA 2P10A 2DZWA 1U5VA 3ZXWA 3S46A 2E67A 1I8JA 2A5HA 3NIYA 4RUBA 1TCMA 1CXKA 3DFNA 2FHFA 1EIXA 1TMHA 1E55A 2DSUA 2VFEA 3EKLA 3KP1A 2R14A 2W63A 2C18A 3I6TA 4XD4A 3AIBA 3IK2A 2VURA 4GKTA 4NZFA 3U9IA 5G4EA 4YTSA 2YCJA 1EJVC 1N82A 3CH9A 3HPFA 3BCJA 4YCOA 2QCLA 1JD9A 4MY8A 3G0XA 1HUVA 3F5LA 1UCWA 1F3TA 2EHHA 3S2CA 4I5RA 1UBSA 4NZ5A 4AC7C 1J10A 3S8HA 2F6KA 1XDMA 1M3UA 3SFWA 5C2CA 3HZ3A 3A22A 2X8RA 1GORA 1WE5A 4JN6A 3ECQA 3KZPA 4L6HA 1F2JA 4H9ZA 1Q4NX 3LTYA 3BW2A 4RPPA 2YW4A 1ZENA 3UJ2A 3EX3A 4HOXA 1EBGA 1T8XA 1UR8A 3M5ZA 5CLWA 5I0DA 1LYXA 4PRRA 2CXEA 3GC2A 5E6YA 1G4EA 3WQ4A 3GWQA 1Z7AA 2E8ZA 5K4ZA 4RJEA 1AJ0A 4JAWA 1RXOB 3QR1A 1O60A 3DHUA 4LU0A 1A0EA 3W2LA 1PX3A 1ISVA 1I1XA 3GDMA 3W7PA 3KWXA 4ZSUA 4JTRA 5A6KA 1DKWA 2OSXA 2VC9A 3IGHX 2R82A 1B4KA 3FEMA 4FX6M 4Q4PA 5K3VA 1KM5A 1Y0EA 2VEFA 1P0BA 5C71A 4TVCA 5I07A 4K39A 3MI6A 1KFLA 1M03A 4LXFA 2NXGA 3R5EA 2F6XA 3WLIA 4O1DA 2JGYA 2OG9A 3P93A 2BTMA 5I77A 3IIZA 3KCLA 1ECQA 4MWAD 2W91A 4UNKA 4DB7A 3PTQA 2OMAA 4UUIA 4HHPA 4UOQA 2P3EA 3ZJKA 1VF8A 2IPJA 3H2FA 1X8FA 4CD4A 2BOEX 1EBHA 4YCPA 3G1SA 1NQKA 3BJSA 3GUGA 1FXQA 4HTBA 4UTUA 1CGWA 3GXNA 2DT0A 4XO7A 1E51A 1XC6A 4GPNA 1IXOA 5HATA 2J24A 1UASA 1QWGA 1H61A 4LTSA 2FQIA 1K03A 4UOJA 1EP1A 1GOXA 1K9DA 1WAWA 3NFUA 4IFKB 4WIWA 3SCPA 1CGVA 2XISA 5EBUA 5FJIA 3T09A 1SVDA 3PS7A 3PPCA 3EOOA 1PB0A 2OR2A 1WDDA 2X1RA 4I6VA 3QHOA 3MHFA 3VX1A 3LD5A 4F0SA 5HR7A 1W5PA 1YXCA 2VGGA 1HKJA 1XQLA 1ZBCA 2YOCA 3GK0A 5EMKA 1LG2A 1RJRA 2ZZ5A 3BG3A 3SN1A 1PUDA 2VEKA 1E71M 3WQ6A 3UY7A 3UF9A 1Z3NA 3PHAA 3RR1A 1A5AA 2WWCA 1LRNA 3HM7A 3PBGA 4LF2A 4DF1A 3TW6A 1JEZA 3G1DA 1XLHA 4UZSA 1TSIA 5EFDA 2O9TA 3DDMA 4S2BA 1XLEA 2ISDA 2EKGA 1QW9A 1TREA 4KWVA 4RW3A 1JD7A 3U4FA 1W2PA 2I14A 3GBDA 1FWIC 1HKVA 3MA8A 2J9ZA 2CCRA 1HIZA 3KW3A 1KM0A 2YX0A 1JI2A 1JZ5A 1C7TA 1F4HA 4DZAA 2E3ZA 1M7XA 5D8ZA 1KGWA 2R1PA 3VX0A 1FVPA 4HU0A 4R7JA 3H2NA 1K77A 4M51A 3SCWA 3OBKA 5D9MA 2H3DA 3TZNA 3T7VA 5I06A 4D6CA 5IFTA 4AWUA 2PDNA 2XGBA 4PUUA 4F9JA 1XFCA 3RPDA 4B5SA 1PWMA 1RCXB 4Z0JA 4GQ0A 3PBUA 4H6RA 2WPBA 3K8KA 5D8WA 4IPNB 1PYMA 5C7VA 4U5KA 3O63A 4FP1A 3DC8A 5I09A 3ZJ6A 1B57A 3ITOA 2PD9A 3GE7A 1OWQA 3GNRA 4MZ1A 4C6NA 1TYGA 2GDQA 3EDJA 1H51A 1E1CB 4TO8A 1OFBA 2OLAA 1XBZA 2OWXA 3FAXA 4C90A 1PXGA 2RKXA 2D2HA 4LX4A 3N73A 1O5KA 4AD0A 4RPQA 3RJXA 2YGYA 5KZDA 5LIYX 3H24A 5A8MA 1VBGA 3OA3A 2QAFA 1UP2A 3O6CA 3R4IA 2VCAA 1EJRC 3BH4A 3WNMA 4NI8A 1NQ6A 3CZJA 3MANA 4O50A 1FHLA 1LROA 2YXXA 1YNYA 1DJGA 4ZFMA 1W6TA 3PPFA 2DQWA 1DXFA 1YQ2A 4LVBA 3XIMA 1PYFA 5E09A 4QR6A 1UH4A 2FH6A 3DFYA 4D6EA 3ZFHA 5AHFA 4XD5A 2J79A 1K4HA 3TW7A 4Q7IA 3CH0A 1POJA 5JH2A 4A3YA 3S47A 4XIMA 5HNTA 3LCXA 1E0WA 1OADA 1H1YA 2R1LA 1UZ1A 3PZMA 4RDZA 3PY2A 2YZ5A 1N8IA 2WPGA 4C7FA 4LAOA 2ABBA 4Y96A 3WUFA 1S3HA 2VX5A 3PUOA 2CYGA 4GI9A 3H26A 1SW0A 3B9DA 3VKDA 6TIMA 1UZHA 3N4AA 2G4JA 1VPQA 1WCGA 4IP7A 4E8GA 4EP8C 1OX5A 4J3XA 2QCMA 4IIHA 4IGMA 3TYAA 3TNBA 5D05A 3PWGA 2VP8A 1Z41A 4ATLA 1HN1A 3RJYA 4IP4A 3EDFA 3IK4A 1PWLA 5JUVA 4G1NA 4I7VA 3PJXA 4XISA 2QDEA 4N6FA 3CT2A 2PWFA 4FB7A 3BAJA 4Z2LA 5C7HA 5BRQA 1V8EA 1UWIA 2H8ZA 2RFGA 5C55A 1FDYA 1ZLPA 3KS6A 3KOXA 3S5ZA 3A13A 1HP4A 3I6EA 4C6QA 4ZOBA 1J11A 5KZMA 5LXEA 4R33A 3M0KA 3G5EA 5FJJA 5CSRA 4BCEA 2QJJA 2CHOA 4XZ9A 1GQKA 2DGAA 4DHGA 2GSJA 4AFYA 1LQ0A 4H9TA 1V02A 5IHRA 5A8GA 4C7GA 1HXJA 1WDWA 2D3LA 3L4ZA 5FOOA 4DAFA 4GJJA 2QF8A 2IS7A 2AGKA 4AMCA 3K8LA 2VGBA 4MZYA 5EU9A 2YYTA 2X2GA 3R79A 4Q8NA 3ELFA 1R3RA 1R85A 3VE7A 2VEMA 3NGJA 5FL0A 3ZQ9A 1JPDX 1R9YA 3EEGA 1QK2A 3NQEA 1SU5A 1ICQA 3VKJA 3ZR6A 3NO1A 4IXXA 3AUJA 3WDRA 1BF6A 2V63A 1LT8A 3R10A 4GNKB 4LVDA 5DQPA 5BXTA 3MVIA 3W82A 4KESA 3BE7A 1UMLA 4DUXA 3SCOA 1QU4A 3O3RA 4GVGA 1DWJM 2QV5A 3GFZA 2O9PA 2NT0A 2QMKA 2WQPA 1TJRA 2HS6A 1A53A 1K7XA 2QS8A 4AWTA 4B2DA 1YPXA 4YNGA 4DF0A 7REQA 2ZE0A 1C93A 3LNPA 2YCKX 3EA1A 5EL1A 1B90A 2YBUA 3EPNA 2FPYA 1AG1O 4NRSA 3UR7A 3N6JA 3VOHA 3WLTA 1TTIA 3W74A 3V16A 4ZQNA 2I5GA 5FD0A 4OVXA 4GUFA 1LJYA 4DO6A 2Y5SA 1DE6A 2E6FA 3BC9A 1XCXA 4N42A 1RA5A 2RGMA 2HSAA 3M7SA 3UZXA 4I7WA 3V5FA 2CZFA 3KVLA 2W61A 4K8HA 3MT1A 3VDBA 1MUMA 1WZKA 3NM1A 3QQWA 1TZ9A 1H7PA 4X3ZA 3IVUA 2QR6A 2GQ8A 1XYLA 4UNLA 3MC5A 2GGIA 4KS0A 1R3WA 1E0TA 1ZU8A 2A7PA 3NYZA 4GK8A 4M6PA 1I2RA 1FP9A 4A21A 1CBGA 3WEZA 3LERA 1E6PA 3NWRA 3NCOA 4EOUA 3BLIA 3TCSA 1PDZA 1YX1A 3V75A 4I5XA 2ZUVA 1E5JA 3LMYA 1TR9A 1IYXA 4P7OA 3EWZA 3G1RA 3PPGA 1I2QA 3TN4A 4O0ZA 4KWOA 3PZTA 2YBTA 1BQCA 1PKMA 1XW8A 4PMQA 3TK7A 3BCDA 2IQTA 3QF0A 3E9AA 5KMYA 3GLCA 4OZOA 5FA5A 4NXSA 1VB9A 1TV4A 5D9OA 2C1IA 4NUWA 3KWSA 4A6GA 3LLFA 1IXNA 5F4XA 3LHWA 1ELSA 3R58A 4GY7A 5CCZA 4ECLA 2DZVA 1YMYA 3FA4A 3Q65A 4M24A 3TX9A 3FV9A 4LY8A 1UROA 2V68A 3MO7A 2G0WA 4C6PA 2IUZA 1VFSA 3C2RA 1ZAJA 3W70A 2QCGA 2PU0A 4WVXA 3CUGA 1PX4A 3W28A 1F6KA 2DY3A 1T0OA 4LC8A 4ZODA 2O7QA 4KPLA 5HMSA 3LSBA 4ADUA 2HNHA 1JF6A 1A50A 4QDMA 2F8QA 1B3YA 3MHGA 3WQWA 3URNA 3QHNA 4HNLA 3S1XA 3H7UA 2HBVA 3SJNA 3UXLA 4RZ6A 3RAOA 1J96A 4L56A 4HGXA 3BAWA 2E7FA 3UXDA 3T0DA 4ZB0A 2CBVA 1VYRA 5HNRA 3R13A 6REQB 5G1MA 3NVTA 1CGYA 3LY0A 3A4JA 3TONA 4FF5A 2ZXQA 3WNOA 1UUQA 1SM9A 4PN2A 4B5UA 3IJ6A 4JYEA 3UJEA 1KLZA 1T7LA 3NSXA 5CZSA 2FJKA 4HSOA 4BR1A 2CETA 3IVTA 2V0TA 3E49A 3IJLA 3VDGA 5LIWX 4KCTA 5DY2A 2FDSA 1GOQA 4J1OA 1CPUA 1EDQA 1WNOA 1OHLA 3SY8A 3WCZA 2TMDA 3UGRA 1IE7C 4CD5A 4JHMA 2P5NA 4BQ4A 3T2PA 3R1ZA 1E6QM 1UIPA 1YDOA 2CU0A 3S2MA 2C71A 5DX7A 1CNVA 1VH7A 2ACUA 1TV7A 5I3HA 3ARSA 4E0CA 3HB9A 1RY8A 2DZPA 1KA9F 4XB3A 4DJDD 3WO8A 1QPNA 1OCBA 2QDGA 1HJSA 2BY0A 3OG2A 2DV0A 3TYCA 3B9NA 3KRUA 1S2AA 1ZS2A 1FCBA 3DECA 5LIXX 1KWGA 1TWWA 2JKAA 1OFDA 4M56A 1F05A 1R2TA 3OTRA 4HMNA 3E3HA 1XRSA 1P1MA 3AC0A 4WKFA 2VEIA 4AD3A 3F03K 3I7RA 3BDKA 1EPXA 1G6CA 4KF1A 3AXIA 3W88A 1QW7A 1AFSA 2I7GA 2BHUA 5F4WA 2WV8A 1XRFA 4HJWA 3QY7A 2Q02A 4OJYA 4J3TA 4GH1A 3LZ3A 1W3NA 4X9SA 1D3CA 5E1QA 1L6SA 4ZO8A 5HK4A 1VBRA 1OF6A 1UPMB 1EOMA 3SQSA 1QBBA 4KRUA 2VENA 4DXXA 4F0MA 4GGBA 5B7YA 3TYEA 4X60A 1EHAA 1D2KA 1CW2A 5ENLA 1Q6OA 3CIVA 2ZZ1A 4JYFA 1HGYA 4ZVJA 1A4LA 1FWTA 4NZ3A 4A8RA 3BLEA 4IX0A 2CNCA 1RH9A 2FFCA 1KRAC 3MPGA 2DFAA 3GHSA 4WJEA 2ZA1A 2PDKA 3M43A 3FYOA 4B4HA 2PWVA 3AHTA 5I3DA 3QMSA 2WK2A 4KMQA 2P0IA 1W31A 3B04A 3P5YA 1TJPA 2Q8LA 4Y6GA 4KRZA 1F8IA 1UR9A 4QDPA 1HKMA 2Z1SA 4QISA 1QNQA 6PTDA 4W8AA 1IGWA 4N4QA 3E5PA 4BWLC 2YCLB 4RK8A 1OINA 5LGZA 4HU3A 3GKAA 2EJAA 3L65A 1R2RA 2X2YA 2WC7A 1W17A 4N9CA 2DUAA 2E5DA 3SUVA 2JALA 3PJWA 3UZYA 4JIPA 4G5DA 2NVDA 2QULA 5CGMA 3NTYA 2CBUA 3FGCA 5CBBA 3B9AA 3FOKA 5BOOA 4H8HA 4EACA 1EL3A 4LF1A 2BNJA 4H7CA 3L0GA 3GVVA 5PTDA 3EAUA 2VD8A 4C6CA 4U28A 3OHMB 3GH7A 4W87A 5FJRA 4QJ3B 3EBVA 5H8PA 2Y7EA 3QXBA 2GVJA 2GJPA 4RKAA 2V30A 3TJXA 1XI3A 3BLDA 1JCYA 1EZWA 4HCDA 1VAHA 5KSWA 3U57A 4CCEA 1DWGM 4URIA 4LAMA 1KXVA 3O8AA 5FSDC 3TNOA 3MHUA 4NY2A 1UW9A 3DUGA 3CQJA 3UD6A 5AN7A 2P50A 6XIAA 5CSUA 3MWAA 4D2JA 3LRLA 1LLWA 4E8CA 2VWSA 3EDDA 1IEXA 1KCZA 3BOXA 1XR2A 2QIWA 1DJIA 3VZYA 1DTNA 2DZAA 1B9BA 3QMRA 4LOCA 1W3IA 3G22A 3WJZA 2BG5A 1XH0A 3WYZA 4MKNA 2WSPA 4GG9A 3QYQA 3UWEA 3HPAA 1ME9A 4U31A 4B5XA 5LNVA 2OOFA 3LCFA 4HCLA 1LUCA 1NY1A 3KTSA 3NZGA 3QSRA 5BMWA 1QHOA 3G3MA 3SQMA 3G77A 3L4XA 3QYSA 5G1TA 5BZAA 3HV8A 1HZYA 2PDYA 1CGTA 2WVUA 2DZSA 1AA1B 3ES8A 4QSFA 2DIJA 2CWNA 2FDMA 3DYOA 1W1A1 3TTYA 4BS0A 5BOFA 2PDBA 2G3MA 3WD3A 1MNZA 1JRCA 2Q01A 3HPSA 4J7RA 1ZB5A 2VOMA 2ANUA 2NWSA 2WSYA 4Q8QA 3OO2A 1ONEA 3IIXA 3LI1A 1E9YB 5DT7A 1B5TA 1H1NA 4TUFA 4CQCA 5DCEA 1GGOA 3L4WA 4FALA 2ZE3A 1W8SA 1A5KC 2PWEA 1CXFA 1OJXA 1A5UA 2AQVA 4CEUC 1L6FA 1MZRA 2VO5A 1R86A 4ZMGA 5FF0A 3WF0A 4NSBA 4AXNA 3ZSTA 5HWMA 1B54A 4UQAA 3R8GA 4KFPA 3MQTA 1RSCA 1UD3A 4HPXA 1WKEA 1S5VA 4YVVA 3W2JA 1ZP3A 2V5KA 3AROA 3WSUA 1GJUA 4KWWA 3MU7A 1XINA 2ZUMA 1IEWA 3V0TA 4UXDA 4LT9A 4QRNA 2BOFX 2PGFA 1XJBA 1Q63A 1X98A 3R94A 3NPXA 3NXFA 1HO4A 3FDGA 1BFNA 2GK1B 4PUWA 4MB4A 3F1QA 3GXPA 1Q6GA 3SRKA 1M65A 4LH8A 3UZJA 1XRTA 3OGRA 2PE4A 3ONCA 4L1WA 4K36A 1KTCA 4PCSA 3STCA 2XVLA 2F2HA 1XIMA 3FAWA 3NL6A 5C70A 1MZHA 3AIQA 3K46A 1VR6A 5JQ9A 1F61A 5FEWA 4MJZA 5ABEA 2OZ0A 5AKQA 4WDWA 1GWJA 2C1GA 5DELA 4IIDA 4DELA 3W29A 1GOWA 4AZCB 2HJPA 1SFSA 1UD8A 4F40A 2D1ZA 5JXQA 4P8UA 3KX6A 1KBIA 1SO3A 4FXFA 1OY0A 1QOPA 3L12A 3PBWA 2V5BA 1CYGA 1J0KA 2W0UA 1JZ7A 1E72M 3H53A 4I3GA 1SMDA 4LVFA 1TA3B 1U1UA 1UWAA 3U6WA 4JICA 1U1HA 2PLMA 2W66A 2DZBA 2A3BA 1R6WA 1HJWA 1G7VA 3GKFA 3IRSA 3OVGA 4MNJA 3W3OA 1EHNA 1FKWA 4ERGA 3NL2A 4H04A 1GZ1A 7XIMA 3WELA 5EA9A 3AHXA 3CJPA 4LS0A 4ONVA 1JFHA 1DIKA 4MJMA 5M1TA 5BXSA 1R2SA 1XLCA 5BW6A 4JKKA 1VC4A 3WDIA 3SRHA 3V5CA 1H2JA 3WENA 3QJAA 2PDJA 4JTLA 1HX0A 4GVIA 4AMAA 3MY9A 4Q8WA 3MYOA 4OUEA 6XIMA 4EPEC 3B0VC 3R12A 3WLRA 2ZDSA 1E3ZA 4GUHA 1A5LC 4BQ2A 4XAFA 2WNWA 2YBVA 1V6TA 4FXJA 3CL6A 2P8CA 4NX0A 1KTBA 3LCWA 1ZHAA 4C6DA 2NQ5A 4H6KA 2WVSA 1OZMA 2WMGA 4J40A 4H9YA 3ZOAA 4J28A 4YU1A 4ZQRA 1SJCA 4RE4A 3W73A 3BLPX 4A8LA 4QFUA 4DO4A 1WYIA 2QPXA 1J79A 4K8GA 3M64A 3SW6A 1FKXA 1GOIA 1J2WA 2GUYA 3DENA 3ZO9A 1E6NA 2BY3A 3PB2A 4AUBA 4HNUA 1WKFA 1XH2A 4MLJA 2GWGA 3BZGA 4MNKA 4RW5A 4BK9A 2CBIA 1UR4A 3EWWA 2QJHA 3OB8A 1XD0A 3DYMA 2V8ZA 1TRIA 1XD1A 2FPVA 3MJYA 2V3FA 3T8QA 2VI0A 2ZX6A 3V1PA 2W92A 2OYKA 4P7NA 2IKGA 3BMVA 4KCUA 3GNXA 2HMCA 3LYEA 5AB3A 2CLOA 2NUXA 4P8WA 4XVDA 4NAEB 5M2FX 4JL2A 2PTZA 3C3UA 4PTMA 1F07A 3NR0A 3UPWA 3FW6A 1W1TA 3TYUA 3B40A 1ZJBA 1TMQA 4LNYA 3GM8A 4PFHA 4F8XA 3N2MA 1EGMA 1E4IA 3O7UA 4P7LA 5E9AA 2VRQA 5G4WA 2A3EA 3WH9A 4HNOA 4MADA 1KC7A 2Z2UA 1XDJA 5KITA 3ABSA 1E43A 3GYCA 4CKQA 3CMJA 1W9UA 3KLLA 4M6VA 3FA5A 4UTWC 3D0CA 3A9IA 4WKHA 2FZ9A 6CGTA 3VI2A 1PZ3A 4XAGA 3OW1A 1BYAA 3AZSA 5B7ZA 2WNZA 2GGHA 2XINA 5CAKA 2ZA2A 5DY3A 1WDQA 3LHUA 4HCHA 4J2MA 3SCRA 3KL3A 4UC5A 3N34A 3M0IA 4DAIA 4LUSA 2WJEA 4A4AA 4DZHA 1MNSA 3TYDA 1JYWA 4L4LA 3HA1A 5ABHA 1RVGA 4Z2JA 1U2YA 4Z17A 3WNKA 4GO8A 1JAEA 2IPGA 5FF3A 2Q8XA 3VO0A 4WX2A 1TELA 3S2LA 1DIDA 3SIMA 1I1WA 1GJWA 4C6OA 2OYMA 5DO8A 3T55A 1H7OA 3B06A 4I5UA 1JIBA 4DXKA 1YDYA 5BROA 5IDIA 3QTGA 4Q8UA 4MYAA 4CNNA 3W38A 3MCMA 3MUCA 3CM4A 1CXEA 2BWGA 4JX6A 5T91A 4E4UA 5BXRA 1L2QA 3CYJA 4U2ZA 5CLTA 5CPQA 1E4MM 3OLGA 3TYZA 1OCNA 4JTSA 4RE2A 2AKMA 4JQ1A 1IR2A 2VCBA 3W75A 1N8WA 4WLCA 2TODA 2XN1A 2OQLA 2GVYA 4KCVA 4D6DA 2YIHA 4WSKA 4ADSA 1OT2A 1BD0A 4S3DA 2Y1HA 3VUPA 1XICA 2WO5A 1U30A 1LLZA 3KM8A 3RX4A 4JFVA 4ZQPA 1L9WA 4CNSA 5I3JA 8XIAA 5CZKA 5FKYA 1XYZA 4JDYA 4UTHA 2UZ9A 4F0RA 5DBTA 1A3XA 3THAA 5M03A 3TVAA 3ISIX 2AL1A 5D4YA 5G2HA 3VTRA 2HS8A 3QY8A 2JF7A 1TJ0A 4OECA 6TAAA 5AYXA 5HINA 4YVPA 1H50A 1YBQA 1NWRA 3LX9A 2ZC8A 3ICJA 1OFEA 1ZPTA 4RZBA 2G3IA 4GYPC 2R9RA 3BQ6A 4FAMA 1H41A 3SJ3A 2YCEA 1RV8A 4Q8OA 4GO9A 3FY1A 1VLWA 4NJGA 5GQBA 2NXIA 1FCUA 3SO7A 3KRZA 5LYRA 3WD1A 3EB2A 8XIMA 3NNTA 2PCQA 1FWDC 1HVXA 4XD6A 3W4RA 1V5XA 4AEFA 1V79A 2FVMA 3DEQA 1NU5A 4HIBA 2VFHA 3QW4B 5IBXC 5HMFA 1BTMA 3PZQA 3R8RA 5LHEA 3K5XA 1DPMA 4MUPA 2QNEA 4NJJA 5CC6A 2BODX 3PZ9A 3QV8A 3D3AA 1Q7QA 2V5DA 4AX6A 1V0NA 1WZMA 3QZ6A 5HMEA 3UG5A 4PMUA 4HVXA 3LSCA 1QOXA 2J25A 1AH3A 3CQHA 3VD4A 1AZ2A 4JTUA 4DX3A 3AMGA 2RDWA 4PEEA 4IIGA 2CESA 1RK6A 4BWLA 1O5RA 5ABFA 5A6SA 3QMTA 4CU8A 4YJ5A 1LG1A 3UG4A 1OG6A 1V02E 5C9XA 2J75A 3W1AA 2ACQA 1YDVA 3HV9A 4Z1CA 5U4NA 4LYRA 4TX8A 4LEQA 3MUY1 3H2CA 2ISSA 4ZQCA 1PE1A 3LCGA 3T07A 3OGSA 2E8YA 4ASTA 3WUEA 4GIYA 4QHRA 4HTYA 1RPXA 3VC6A 3N1AA 4XZWA 3EDKA 4LQ1A 3EA2A 3WDPP 3BV4A 2J6VA 4CNTA 5MKGB 4RR4A 1EKOA 3L2LA 3EXRA 5JBEA 3TU9A 2GJXA 3I7QA 4DRSA 1LRQA 3TLQA 4M6QA 3G8RA 2Y0FA 2WZMA 3QR3A 2WYSA 3VDAA 4E4FA 2CLIA 2RGLA 5TAOA 5HJXA 3S6TA 4Q4QA 1DXIA 1KFCA 3WQOA 3WK0A 7PTDA 3ZT6A 3MZ2A 1DORA 3MP5A 1MW1A 3M1ZA 4KFNA 1FH9A 4ZB5A 4HA4A 4UWMA 1XRVA 3A3WA 2A3LA 3A4XA 1UD6A 3VIMA 3CEUA 2XVKA 3H6OA 3CB3A 3P5ZA 4EXQA 3W25A 4GISA 1IEIA 3PZIA 1EA0A 3GW0A 5J04A 1TPUA 1K7FA 4PBGA 1KM1A 4WEVX 4UFKA 1BF2A 4IJBA 2E6YA 1VD6A 1KR0A 5JBFA 3SCVA 2GUBA 4HZMA 3ITLA 5CKSA 3P2VA 2DZXA 4JHOA 1QPQA 1FWJC 1LF1A 3HIJA 3C2FA 4BEUA 2V2HA 2NSXA 2W3ZA 1A0CA 1PPIA 4B5NA 4BHYA 3SY1A 3WF1A 4W8BA 2RDUA 2XDFA 3AZRA 2AOSA 4S3CA 4NNBA 5IDZA 4YS1A 1AUSL 2C79A 4U33A 2FMNA 5BU6A 4EE9A 1NM9A 3GR4A 1QHZA 4FIQA 2DW6A 2JIEA 4EIVA 1XX1A 1HJXA 4QX4A 3CHCA 3T2OA 4BI7A 2FVLA 1H63A 4HOWA 2PLKA 3NZQA 9CGTA 3QFEA 3OA5A 3VNLA 1KTNA 4N2YA 4P5UA 4I8YA 3DI0A 2EXOA 4QJ1A 4L7ZA 2X40A 1UD4A 2PI6A 3IIOA 4CNOA 4G7EA 6ALDA 4RNFA 2O9RA 3TAKA 1LCOA 3MDWA 1B2YA 2CZDA 1GG1A 4XZMX 3UERA 4HZ8A 4FK9A 1DJZA 2VX6A 2OQHA 4QJ5B 4AZIA 3B05A 1EYEA 1UQYA 4MF4A 3S2NA 3EWYA 3KS5A 1G94A 4JHZA 3VMPA 4IT1A 4QXIA 3W1NA 4BJHA 4F0LA 4K3ZA 4ZEPA 3CL8A 1ME8A 3S6OA 2ZRWA 1WUEA 2FHCA 1ME7A 4LY4A 4CD6A 3HGJA 4E6MA 2BLEA 4P8VA 2VEPA 3P0XA 3SCSA 1Q6LA 3P60A 1EOKA 3M0YA 4RNHA 1NARA 6A3HA 1WP6A 2P1FA 4J9JA 5CJ5A 4PR4A 4C5ZA 5G4HC 1RALA 4E2OA 3BGGA 1RCOB 5FSEC 1GW9A 2WVTA 3CWHA 2YL6A 4N9DA 4FEZA 3UJSA 1HP5A 2QVHA 1MRAA 1QNOA 1CDGA 1R3VA 2DSVA 5LNUA 1W91A 3BGAA 4BF7A 1NWSA 1EO7A 2IQ0A 3CPGA 4LJ3A 1PCWA 3WD2A 1PJ9A 1P5BA 1V0KA 3N19B 2J74A 3LUTA 2EPHA 1R3TA 1BVZA 2NQ9A 1RR2A 1UJQA 1C90A 3T78A 1LM1A 3TTEA 1MI3A 4UZUA 1S5NA 4UCGA 3UQNA 3LLXA 2XSAA 2OTDA 2PLCA 1R7OA 3BCFA 1ESWA 1G01A 1XV8A 1TZZA 1K9TA 4QJ4B 3EB4A 2PGWA 2X7WA 1QTWA 1PZ0A 2GOKA 3OVPA 5JU6A 1JZ2A 1JPKA 1W9XA 2OELA 1NDVA 2WMKA 4U10A 4MG4A 1GVSA 1K3UA 3IJQA 4AIOA 5F1UA 4ICNA 2DSZA 3MVTA 1Q4WA 4ATWA 3THQA 4GYJA 1V03A 4A29A 3AIUA 4AC1X 1AODA 3KOYA 2YZRA 5H6HA 3KEHA 1UIOA 1TWIA 1IZJA 1AD4A 3QM3A 2PRHA 4KEMA 5AVHA 1NWTA 7A3HA 4ROPA 2ABAA 3B8UA 2GJRA 3ABRA 4ZSTA 2NT1A 2XZ7A 3Q2DA 2VXNA 3CXOA 4GE8A 3P81A 1LL7A 5EKYA 1EYWA 3PF3A 5HPCA 2YA2A 1XYBA 3KZSA 2HNEA 1Q65A 2NX9A 1EF2A 3W7KA 4A8IA 4KKXA 2QPSA 4IICA 1NF7A 4PTNA 5AZ0A 4C6JA 3WMSA 1X39A 3AIRA 1FWCC 1G5AA 2JIWA 1JL8A 2CKSA 4MPKA 1EFZA 3ENLA 4DBUA 4L9ZA 4V28A 5CSSA 1JUEA 2XG9A 4XD3A 2B31A 2V67A 2OEMA 1TUXA 3N29A 1NOWA 4YWIA 5TIMA 3EOSA 1R7AA 1U5JA 2OLSA 3N18A 4D6IA 1Q6DA 4NZCA 3GY1A 4AWSA 1XGDA 2WJDA 4Q8PA 1JNDA 3GAKA 3AIVA 3EX2A 1B30A 2X1IA 3M47A 3GBEA 4GI8A 2OWWA 2PTYA 2CKRA 4JTAA 1AW5A 2V69A 3CV1A 2A0NA 4YMZA 3F7JA 3UCDA 4DQWA 5L9FA 1TV2A 4RNIA 4Q8MA 5FEXA 1W5OA 2D2GA 4P61A 4RX0A 4H6EA 2IQDA 2B7OA 1N2VA 2WMJA 1GZJA 2INFA 1FA2A 3OLEA 2BZNA 2JF6A 3AALA 2HK1A 3W27A 1SSDA 1UP3A 2F6UA 3TJIA 1GQIA 1DWFM 4L4OA 1TPC1 1Z42A 4BQ3A 5D33A 4YN5A 4PGLA 1U5HA 4H8VA 4DBSA 3BW4A 2ZCGA 3LLDA 2PZ0A 4GUGA 3A12A 1BGGA 2NV9A 2DEPA 4ICMA 3C0LA 2PFHA 3P82A 1DXEA 3W7MA 3LPFA 1XIEA 4LAUA 3GRIA 3NQFA 3ZSSA 4S3KA 3WH6A 3CPRA 3LV6A 5T9BG 3UCQA 1JF5A 2XVPA 1KFKA 1QHPA 3WQVA 4O17A 4XTIA 3ERPA 4PCFA 3SIZA 4MWAC 2A3CA 4OT7A 3P8IA 2HK0A 3P3BA 4KGJA 2INZA 4GQGA 3AXKA 3VIFA 3B4YA 3H70A 2F7FA 3NGFA 2GLKA 4GNJA 3E12A 3C2VA 3MZNA 4AHOA 4Z2IA 2Y61A 4UTWA 2ESCA 4UOZA 2DQXA 2FH8A 8TIMA 3LPGA 3FJ4A 4MNLA 3ZJ8A 3QC3A 1WOAA 4HA1A 4GIRA 4PMYA 3NL5A 1UD5A 4L64A 3UWYA 4AY1A 4ZO6A 1J8VA 1ZJIA 4XAYA 1TPWA 1TX2A 1L8NA 5TF0A 2WKLA 3O06A 3TTOA 3W81A 3KCJA 4M1RA 4DWSC 5J5DA 3AS1A 4GKLA 4EVZA 5A1AA 4L1XA 3S5OA 3C2EA 1P43A 1GOOA 2W67A 3S1UA 6ENLA 1LOSA 2P88A 5EY5A 4A3QA 4JNMA 5F2GA 4W4QA 1GUVA 4TXEA 1IT7A 2E9LA 1XUUA 1LQAA 3LU2A 3KOWA 4YTQA 1KD0A 5DMNA 2VT0A 4M29A 4DLMA 2VZOA 5LIKX 2GQAA 3EWXA 1EWDA 4D8ZA 3GU2A 2YYUA 2RJGA 4AB4A 2WBKA 4A22A 2P53A 3LGGA 1MYRA 3LHYA 3HTWA 3REQB 2PTWA 3MP4A 1V7AA 3HO8A 4ZTYA 3OZMA 5U7SA 2REQA 3B8TA 1SSGA 3CYVA 1R5YA 3OZPA 4V15A 1BAGA 2D69A 4ZQMA 1FWHC 3WG6A 3FYYA 1UR0A 3LS9A 4XZHA 3CTTA 4POCA 1PBGA 3L4UA 5DEZA 2XSXA 8RUCA 4GD0A 5DT5A 2FGBA 3GG7A 3UG8A 5EBAA 1TX0A 3A23A 2H9AA 5D2WA 1RA0A 3HGOA 1M04A 2VTFA 1AL7A 3E2VA 3DKLA 1V3LA 1T41A 3ABXA 3P67A 3VAVA 1E1EA 2Z6JA 4D1IA 4LW7A 1HG3A 1XDLA 3VFLA 1OBAA 1FWSA 1KW1A 1XBVA 3B8DA 4GYPA 4R3UA 3HG4A 2Y7FA 4M19A 5J8LA 1JFXA 3GNOA 2VEGA 4MHBA 5CC5A 4NAFB 4IGHA 1H49A 2ISFA 3T08A 3KL5A 1DYSA 2L5HA 1UWRA 1UP0A 4ZXLA 1Q7ZA 4M3PA 5CG7A 1H4PA 5IBXA 1TB3A 1JQXA 1VLIA 4JEJA 2FIQA 1IZKA 1H7RA 2ZUNA 1OFOA 3W6MA 1K70A 4A2SA 3AS2A 3NDYA 1KO0A 4I9JA 1DOSA 2QCFA 3VGGA 4A3RA 1IV8A 2P3ZA 2Z28A 1GNXA 2W9MA 2D2JA 4XX6A 4HNCA 3A21A 4LUTB 1Z48A 3E6EA 1WB0A 4EPKA 3SM0A 3QTPA 1XLGA 2VDHA 1JULA 5HJYA 1H5YA 5A6BD 2WKJA 2G8ZA 3WFAA 4C6LA 1KBBA 3NZPA 4Q6XA 4IPJA 4LCSA 1EX5A 1ISWA 2O56A 4I7UA 3LTSA 3GC5A 3L4YA 4KT2A 4QDWA 1LLOA 2CFFA 4PUJA 3W00A 3CV2A 5ECVA 1JYNA 3VNYA 1ISYA 1GQJA 4C1NA 3BJFA 1Z44A 4DNMA 5C2GA 1XLDA 3IPWA 3LNMA 2PGEA 1TE1A 3KBSA 3MUZ1 2F84A 3WK2A 4H9VA 2ZRVA 1O1ZA 1Y5XA 1P6BA 3GVQA 1PO9A 2XVGA 1XG3A 4Q8VA 1E5NA 1R30A 3ANVA 1GKPA 2PLJA 5DMYA 3F4WA 3F4VA 5FJUA 4AHQA 2WCGA 4UFIA 4OIFA 5GJMA 4I9AA 3AYTA 4M0XA 4OBTA 1VRXA 4WOQA 3DKJA 3SADA 1ISXA 3THCA 4U2YA 2NWRA 4CGTA 2DP3A 3B8SA 3O05A 3S1WA 1Q6CA 3RCNA 1J2BA 4IM4A 3D5HA 3PSWA 4ADTA 3N15A 5CSYA 3LK6A 1EC7A 4TVUA 3NOEA 4GVHA 1EDGA 4HJFA 4PMVA 1W1PA 3QW3A 4YLWA 2G97A 4F2TA 5A95A 1VFLA 1RQHA 3CZLA 2ACSA 5J5RA 1W56A 3AFBA 3MCNA 5A6LA 1U83A 2O4MA 4JTKA 4XVEA 5H8MA 2WCSA 2C7FA 3VOCA 1TV8A 3M4HA 2FFIA 2VGFA 4WY0A 4IGNA 4JY8A 3A9BA 4ZO9A 4PYSA 3MSGA 3GR8A 2CLPA 4ZFCA 4LSBA 1KQZA 3O0KA 3FJNA 4N0RA 2A3AA 3IIPA 2EKCA 3DESA 4JDBA 4OBRA 1X8CA 3N9SA 1M7PA 2UY2A 4HU4A 4M6UA 3RG6A 2RDTA 2YLLA 3RU8X 5A6TC 4JNYA 5HA7A 1CWYA 1E9IA 1PCKA 1ICPA 2FZBA 1WUFA 2PODA 4MY1A 4HMDA 1W9DM 3LPPA 4X22A 3GU9A 3VOJA 5LA0A 4GNVA 4YVXA 3OQEA 2QCDB 4MM1A 4FX8A 4DO7A 2GQ3A 3O9NA 2WMIA 3REQA 3OEXA 4RLIA 1XFBA 3GXTA 3EKZA 3PTDA 1JGMA 1U33A 5LNWA 2PDGA 1ADSA 1KWKA 2HVNA 5A2AA 2DSWA 4XZIA 2ICSA 3TTSA 1VEMA 1VHCA 4XKYB 3HPXA 3LBCA 3W02A 2DW7A 4XV0A 3GDTA 4QS5A 3WLQA 5KINA 1VHNA 2MANA 1BRLB 4PBEA 5IHSA 1OC5A 2FB3A 1TPEA 4LWWA 4FF7A 3TQVA 2ZWZA 3SDOA 3P6LA 4B4FA 4QAWA 3C6CA 1F6PA 1V7YA 4G6CA 1NDWA 1O5QA 3IGUA 2CERA 5CPNA 4EWJA 4DYEA 3LGEA 1X97A 1XYAA 3E0IA 5BWFA 5I6SA 1P0NA 3WQGA 3R6IA 2Z29A 3GO2A 1EIBA 2ZVIA 3EX6A 2ZADA 1J6PA 5I03A 3DIPA 1CGUA 3G8EA 4NNCA 1RHCA 4DN1A 4O10A 3Q37A 1OFRA 3QLLA 4WZHA 2HPIA 3THUA 4ZR8A 3VOGA 1HJVA 1QJWA 3AHVA 2ZX9A 4CU6A 3GZAA 3FSUA 4IOTA 2Z1VA 2D0GA 4ML4A 2FJUB 4F9DA 4NXKA 1HL8A 2PTDA 3N17A 4GUIA 4LFYA 1XWYA 3L4VA 2PRMA 3HGRA 3RF9A 4O57A 2DIEA 1IIGA 1G0CA 4FXSA 4B5TA 3GXFA 3AXMA 3MW7A 4QCFA 4RZ5A 3QOKA 2Y63A 4OQVA 3G0SA 1FH8A 3LGDA 1P0KA 4AVOA 5HUPA 1F3XA 4JCMA 3EMQA 1TJ2A 3BG5A 1HNYA 2O55A 3FFSA 3UU0A 1DJWA 2ODOA 2PP1A 1DJYA 4HPHA 3TIMA 5D09A 4HBKA 2VNCA 4E2BA 4CCCA 1VGAA 3P74A 5G1YA 5HR6A 3SEPA 1VFOA 1MEWA 1X1ZA 3TV8A 1CLKA 1UQZA 5CPSA 4CNUA 1TVPA 1R0MA 1D8CA 1V77A 1JCJA 2HBXA 1ZFJA 4PMRA 1XQKA 3E38A 4GC4A 3W1LA 3GVRA 2Z00A 4XSMA 1BLIA 2DUXA 1UBPC 1OG0A 4I6KA 2O4QA 3A24A 1A5CA 4DYJA 3M0XA 2J78A 2DVTA 3EEZA 1KFJA 1ZALA 3V0UA 3GD6A 3E5BA 3GSMA 1W5NA 5DMLA 1UB3A 5A2CA 2ALDA 1ZAIA 5JIWA 3T4WA 4FZIA 3W01A 5DBUA 2DT2A 1VJIA 2C91A 2AL2A 4MMWA 1FUYA 3VGBA 1WKDA 3HG5A 3RO8A 3UNTA 2R8WA 1JR1A 1V0LA 3CB8A 3I65A 3UWQA 5F4SA 2QF7A 3RR4A 1ONRA 3EOUA 4HPJA 4MUZA 4N6EA 3HF3A 4GZIA 4O54A 4GX9A 3PUDA 4XUGA 3VIKA 4HNVA 4QM1A 3LQGA 3L0KA 3SSZA 4H4IA 5ABGA 1EGZA 3K4WA 3BW3A 4GLEA 4O18A 1S3TC 2JKEA 4NNAA 4DJED 1M68A 2HQAA 1LT7A 4UR9A 1D3HA 3DGRA 1FY6A 1AMYA 3SBFA 4IQEA 1P7TB 5H1WA 3DERA 3F2DA 3M5VA 2G95A 4KEVA 4H00A 3PG9A 3LXCA 1YPFA 3WIJA 3ORWA 1LWHA 1KGXA 3W7LA 1RY0A 4Q32A 4IPIA 1EEPA 5I02A 4LRSA 5AFDA 4L6DA 3DG7A 4GQBA 2F61A 2WMHA 2NV2A 3EWCA 2YW3A 3UCCA 2G4FA 2DSKA 5MF5A 2CBJA 1QRQA 3TEVA 3EWBX 5I78A 3RIKA 1UPPA 3LHZA 2NQLA 1VBHA 2EPNA 3FA3A 3WEOA 2E4TA 2AKZA 1BHGA 1FHDA 5F2LA 4MPQA 2Q71A 1KQYA 4Y2WA 2VKZG 5EGRA 4IG2B 3ZVHB 1T6MA 4YWSA 4HNTA 3CL7A 3U4AA 4AVFA 4UQCA 1Y65A 1NVMA 4DJDC 1RJQA 4Z1AA 5A6MA 3TN6A 4FLRA 2HRWA 3OGVA 1EX1A 2VUNA 1XLKA 3NVDA 2JFEX 3U8GA 3M6DA 3W9ZA 4B9ZA 2WC4A 1SYTA 4DWSD 4H8UA 3HJEA 3B8IA 5CQ1A 1F76A 4UBPC 3OBAA 2E1DA 3LBMA 4MWAA 3IJ9A 1QNRA 2E5CA 1R87A 4ZTXA 3W7NA 2ZVRA 2C15A 4EX4A 4O28A 4FNPA 1Q7MA 3WH5A 3P0WA 1E4LA 1VFFA 3TA6A 4AZHA 3W1PA 2Z25A 4KBXA 4HU8A 3I6RA 2HVOA 3Q45A 1TPH1 2GSHA 4QP0A 4HT3A 1FWEC 1EA9C 4M8UA 3UYCA 4DUWA 1TR1A 4REQB 5FF4A 1NFPA 3DC0A 4ACZA 3C3NA 2CWXA 2WVVA 3CAVA 1B3WA 3HQPA 4O1EA 2IMRA 1XS2A 3BAKA 3KBMA 1WXZA 1FHUA 3FX4A 4DWSA 1JDAA 1SJDA 1XLAA 2QPUA 2ZZ3A 3IV8A 3HFTA 1GTEA 4F3HA 2BX7A 3UBPC 2X0SA 5T8GA 1POKA 1WKYA 2GVGA 4NZ1A 4H7ZA 1JCNA 3G1HA 2C0AA 2Z1WA 3R0UA 1GOKA 1KKOA 1XSJA 2V6AA 1JNEA 2ZXAA 2XIBA 3QR0A 3UY8A 2D20A 3JRKA 3IAPA 1EF3A 4GQRA 1G69A 1JG9A 3V35A 1OX6A 3M07A 1IEQA 2XM1A 5ABTA 1PTAA 2VGIA 4O16A 4MZ8A 5DMMA 5LSMA 3T2QA 4TMBA 2OPJA 1XIGA 2OO6A 2BGQA 1KXHA 1IGSA 2B0MA 4X2PA 1UWUA 1ML1A 3APGA 3F5JA 5A69A 3ARVA 3W7GA 5AYBA 3T81A 3ITCA 2ZKMX 4G56A 9XIMA 3L68A 5XIAA 1QOQA 3VCNA 3UZ5A 2WHKA 4D6FA 4F79A 5BMXA 3S0CA 1ZY9A 2PDHA 1DEDA 4RDWA 1G4TA 2R6OA 2G41A 3BLFA 1GVFA 4H9UA 5BXPA 5FJTA 3R7MA 3AZTA 2QUMA 3J7HA 3WY1A 1AD1A 1H11A 4O13A 2CLLA 5I3KA 3ZWSA 4HN4A 4AY8A 4MFEA 5C54A 1HJQA 3AU2A 4C5YA 2Z26A 4RV8A 4W5ZA 5MHBA 3RPTA 1N55A 4TTGA 1BWKA 3SQLA 1D3GA 1F5ZA 3FKKA 1E6RA 2A4AA 2BV9A 1R3QA 4H19A 2GVEA 3BWWA 1FBAA 3W87A 3W07A 1DP0A 1VS1A 4TX9A 4GMEA 4AWEA 2B81A 3A4AA 3MMUA 3D6NA 3TQKA 2PDIA 4ACYA 4W89A 3HURA 1J5TA 1V6VA 1YE6A 3EXTA 3SGZA 2WW5A 2GJLA 3SUSA 4ES4A 3ZMRA 2QYGA 2QJMA 4PFMA 3QGAC 3ATZA 4L9YA 5A6JA 1FDZA 4JFWA 1P1XA 1WA3A 3O6AA 4AD2A 1VJZA 2V2DA 3MKVA 2WAGA 1RLCL 1PEZA 1NELA 2XFRA 1WDPA 4M1BA 1N8FA 3TCEA 2RHGA 5FACA 1AW2A 1MO0A 3HG2A 4IFKA 3DU0A 1UZDA 2J8GA 3STFA 2PDQA 4C6MA 3K1DA 3CS2A 3H54A 3IS4A 3FS2A 3BK0A 1PHWA 1U22A 4C7DA 3WJYA 5M3WA 8A3HA 1NDZA 3H2OA 4TR9A 2XFFA 1SO6A 4CD8A 1EQCA 1NFBA 5CG0A 1K02A 4BI5A 2CLMA 4US5D 1Z69A 5CZJA 2EG6A 1HW6A 2Q3RA 2OOGA 4Y9PA 3MKCA 4WXZA 3H4XA 2GVLA 1T8QA 3CQKA 2OKTA 3C86A 2H8XA 1O1HA 3MI3A 3QPEA 1XG4A 2Y70A 3BLOA 3GVGA 4L4MA 4TX6A 2XN2A 3T42A 3S5YA 1ITXA 4LBSA 1DJQA 4CN1A 4X0VA 2XGIA 3T0BA 1HL2A 3BTNA 3C2YA 3E1F1 1MDRA 2NLYA 1JDDA 5SWUA 2PC4A 1OM0A 3SCTA 2DPEA 5DRIA 1Q2SA 3TN5A 5EMYA 3DAQA 3GXIA 2KZHA 1XL9A 4HHMA 3TSBA 3GDKA 2AAMA 2CC0A 2BVDA 1CXHA 1UH2A 3VIPA 2IXVA 4LCQA 3PZOA 4US5A 4M7SA 1K9FA 3T0AA 5FI8A 3NPUA 5AECA 1F6YA 4BEQA 1XIFA 4JZ5A 2V2CA 2YDRA 1CZ1A 2QJNA 2QUUA 3N2TA 1C3FA 3H7VA 1REQB 3LQLA 1R3YA 3MV01 1SR9A 3ONBA 1SW7A 3VCCA 5HJLA 3O1NA 1H0IA 3MWCA 2PDUA 2QW5A 2XWEA 1JI1A 1I45A 1XLLA 1RLDA 2ZUTA 3VM5A 4LGXA 1EJXC 1PTDA 2POTA 3B9EA 3SB0A 2XIQA 1WBJA 3PPHA 2Z1XA 2ZWYA 2RDXA 2VFFA 1W37A 3OU8A 1L0PA 1SZFA 5E93A 3TC7A 2J66A 1MWOA 4G7FA 4JFUA 1YIXA 1E1CA 2TPSA 3N04A 9RUBA 4JKLA 1ZUAX 2ISVA 4NZ4A 4AZGA 2Y7DA 4XK2A 3W7IA 4D71A 3G0UA 1BG9A 5C6MA 4XZLX 4QQUA 4DPQA 4HMCA 4TTUA 1V08A 4QNEA 4UTIA 4AXKA 3UESA 3ES7A 1BQGA 2YDSA 4JIQA 1M1BA 2D2OA 4UTFA 1Q45A 4HN8A 1C8QA 1E6XM 3CUIA 5GNYA 4O1AA 4Z2HA 3VD5A 2Q09A 1W8GA 5AHLA 3WFLA 4FOJA 3BO9A 3ALGA 1IWAA 5EB8A 3M0JA 1BVNP 4J2PA 1JPIA 2VX7A 2C6QA 2GGEA 1X38A 3BOFA 3QV7A 3SURA 1TO3A 1AJZA 1ZAHA 1DQUA 1E6SM 4GYKA 1K9EA 4D8LA 3AU6A 3T9PA 2OT0A 4AYSA 2PTXA 3K1GA 3II1A 5EYWA 4FLQA 3RYSA 2J6XA 3SUWA 3UA4A 3ITVA 4W9TA 2FPTA 3KVKA 4PC8A 4IMDA 2XIOA 2FZ8A 1M53A 4B3KA 4IQLA 3ZIZA 2PGRA 4UFMA 2OX4A 4DNHA 4ZE4A 2OB3A 4UNIA 1A0DA 2FHBA 4L1GA 1GEHA 1BSIA 4PODA 3WBEA 1MUCA 1W54A 2P8BA 4ZGYA 3E0VA 3TJLA 2ZDRA 1QT1A 1UKTA 5HQMA 1WZLA 4G8TA 4QNWA 3TC3A 3UGVA 2PRLA 3MSDA 4MSSA 3ITYA 1PTGA 1EO5A 3P61A 4U3CA 3P84A 1KRBC 4N9BA 3W1MA 3W1QA 3EGJA 3EWDA 3RXZA 2PA6A 3S4TA 3W2UA 5A5WA 1NTHA 1JVNA 1PHQA 2DJLA 3U2OA 1QK0A 5DXYA 4FNUA 3B9OA 3ZVIA 4LCRA 1GTHA 1UA7A 4B15A 3EOEA 1QFEA 2ALRA 1E9ZB 4AVNA 2BY2A 1JZ3A 1OIFA 5CPOA 3CO8A 2Y89A 3JUGA 1YADA 2J4GA 1S5WA 1XP3A 2QCNA 3O6YX 3D3FA 4OTKA 4N02A 3P80A 3F2BA 3MJMA 4R27A 5CJNA 5JBDA 3GDLA 2PWUA 2X1TA 3Q67A 1VP5A 4L5ZA 3IJ7A 3VKCA 3KTCA 4XZNX 4Q3MA 3QV6A 2WSQA 2UY4A 2I5QA 4C91A 1LDCA 3S6DA 7TAAA 3CMFA 2XGZA 2XZ9A 1LQ2A 3IARA 4MY9A 3R43A 3KOFA 3BAIA 3EKGA 3GZ3A 1B3OA 3VKKA 4FLOA 2NQZA 1R9ZA 4R9OA 5DANA 1Q85A 3VNIA 2JEQA 3TMLA 5DRCA 3LPOA 1YNPA 3AI0A 3WJSA 4NZJA 3WQEA 4TIMA 4IJCA 3AAMA 1V6UA 5E0FA 4EANA 3W7CA 2OVLA 3NM3A 1RBAA 3U5UA 1JZ6A 1OD8A 5GVJA 1WOBA 1NSJA 3GTHA 1X6UA 2Z7GA 2IKHA 1RCQA 4FIRA 1QI2A 4IMGA 1DQXA 4K38A 1WDSA 1H7XA 1ICSA 3L5MA 1NAL1 2XFYA 3L2IA 3DCPA 2YL5A 4OOZA 4GGHA 5E70A 1B9ZA 1EEXA 3PZUA 2PMQA 3AJ7A 4ZOAA 1WDRA 5K9CA 1B31A 3JU2A 4JYDA 3L0NA 4GI4A 3C56A 3QPZA 2NQHA 1F4AA 3PC0A 2E40A 4B5VA 2X09A 3TOYA 3W2MA 5C2XA 5HNUA 1LBFA 3SECA 2NX1A 2ZTKA 1XLJA 1K4GA 1PZ2A 3T4CA 3TOPA 3IJ8A 1V3HA 3VIIA 3ARZA 1JRBA 5CBIA 3AUOA 3OLDA 4DJDA 3HOJA 1Q6RA 1M9HA 4BA0A 2NVAA 3URQA 3QGKC 1RP9A 2TAAA 1BWLA 2XJ7A 3M5YA 2X7VA 2E77A 1TIMA 1B4EA 4WDUA 1PIFA 2I5IA 3MS8A 3C0JA 1MEIA 4J5NA 1A5SA 4PCPA 5GPRA 3VYLA 4N4PA 3CGTA 4H2HA 3BQ5A 1Z9AA 1V6WA 4IFOA 4WXYA 4AH7A 3QEZA 4JGDA 1QO2A 3T40A 5IXEA 4ML9A 4MAZA 3ARXA 1FOBA 1RVKA 3V5OA 3AHYA 3O16A 3DFSA 4LYPA 4UMAA 3L21A 4AZ7A 1V3MA 1OSEA 4HYRA 3B3DA 2HDJA 2X0HA 3POHA 2X30A 1FWRA 4JS3A 2TYSA 3H4WA 3N6QA 2ATSA 4IPLA 4H01A 3CQIA 3TXZA 2G5WA 1TVLA 4Y8FA 4UR8A 4LUIA 2B7NA 2VC7A 3OJGA 4PMDA 4GINA 2OLHA 3UYIA 3PR2A 2J27A 1AQ0A 2YFOA 3BARA 4E3TA 1DWHM 3CTLA 1E73M 3ARYA 2ZC1A 4JBRA 3TJ4A 4GXWA 3H22A 2Z24A 4TU1A 4Z2GA 4O1BA 3RRXA 4JL1A 4X63A 2PWDA 4B92A 2WXDM 1CIUA 4UFHA 3LRMA 5FEPA 2V5LA 6REQA 1GQNA 3VKAA 3SUUA 5I5RA 4O53A 3QLDA 1J0YA 5AC7A 1S5TA 2X42A 4N9EA 4DF2A 1KR1A 2P76A 1SFJA 4J3SA 3BLLA 3IIVA 2DIKA 4OWGA 4AD5A 2X16A 3B97A 1UHVA 2ZYFA 1JDCA 3LOTA 4H2CA 3MMTA 1KM2A 3AWOA 3SGGA 3WQFA 2HE8A 3M5XA 1UOKA 1LZOA 2BB0A 2OEKA 1J0HA 3WF2A 2G96A 1A47A 2ZUWA 5C8BB 4PMOA 3W23A 1DVJA 4DIAA