1A5SA

Crystal structure of wild-type tryptophan synthase complexed with 5-fluoroindole propanol phosphate and l-ser bound as amino acrylate to the beta site
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
266
structure length
258
Chain Sequence
ERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (lyase/inhibitor)
molecule keywords TRYPTOPHAN SYNTHASE (ALPHA CHAIN)
publication title Loop closure and intersubunit communication in tryptophan synthase.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 98
structure length 258
sequence length 266
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 1998-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1a5sA00
4QQ3A 3FS2A 3M43A 2VEMA 3TE9A 2QEZA 3P81A 1O60A 4XBKA 3IEBA 4UTTC 5D02A 1JVNA 2C13A 1FXQA 2C16A 1HO1A 2ZFAA 3GXPA 1H62A 4H6KA 3W7KA 1JRBA 1TTPA 1B57A 2JKEA 3N2MA 4NT0A 3MHUA 4AWSA 1I2QA 2YXGA 3TJXA 3CT7A 1FXPA 3TXVA 1H5YA 4RZ4A 4P2VA 5E93A 3W2MA 4K37A 2FFCA 3LV6A 3R2GA 4GJ1A 3UNDA 4A21A 4S2BA 3ANYA 2FQIA 2O7SA 2Y7GA 3G3MA 3TCEA 3L0NA 5LGXA 4HSOA 4LTSA 3NQGA 1OFOA 5HMSA 2A4AA 4EF9A 2WQPA 2FPYA 2NUYA 1W3NA 1RQHA 4QAIA 1OK4A 5CZSA 1FUYA 1TPEA 3BW4A 1GJPA 4WY0F 5KMYA 1RQEA 3T78A 5AHFA 1PVNA 1MXSA 4CNNA 4MLJA 5HR6A 3WJZA 1EA0A 1QCWA 2TMDA 3FKRA 2A0NA 3NL2A 5FEWA 4WJEA 3R12A 1OFPA 2KZHA 3O07A 1TPB1 4IJBA 1KFJA 3W7NA 5TBOA 3W3OA 4HNNA 1QPOA 1WXJA 3Q58A 2WKJA 1TQJA 3STFA 3MI6A 2H3BA 5DCBA 1GG1A 5AYYA 2J6XA 3HJZA 3KX6A 4FIRA 4HNVA 4CQ8A 1H7OA 3W7CA 4MVAA 3KVMA 5DBTA 2FJKA 4K7YA 1DKWA 4LRTA 1GVQA 4Y6GA 3BO9A 1KLZA 1JJKA 1OFRA 3NEVA 4IWWA 1Z48A 4ZL1A 1LP6A 2DZSA 1Q6RA 2V82A 2A6NA 3A5FA 5D2VA 3TQVA 1W3IA 4LV4A 2Y6ZA 1TIMA 5KITA 4IGHA 1TV5A 2P1FA 3A23A 2QR6A 3GX9A 2DU2A 1ME7A 3N73A 1U5JA 3O63A 4GUJA 2V30A 4JY8A 1SU5A 1ADOA 1TJRA 4O0KA 3NR0A 1VHNA 1DJQA 3G1AA 1ICPA 3G1XA 4JTLA 5HUOA 4BI7A 1XL9A 3DFQA 1T0OA 4HN4A 2BTMA 3C2OA 3KFTA 4ORIA 3F4WA 5DY2A 5A5WA 3TSDA 5LHEA 2J24A 4MFEA 3WK1A 4K8HA 3S0CA 1W31A 1MEWA 1UUOA 3CLMA 2YDAA 2QCDA 3M5VA 3QF0A 4LV9A 2V2CA 3FYOA 4JYEA 2R14A 4FEZA 3B4UA 1BEUA 3W7MA 5G2WA 1JQVA 3DFNA 4O50A 3GKAA 4UR7A 2YX0A 2CFFA 3IVSA 3AO0A 3T55A 1F5ZA 3NO5A 1Q45A 4I7UA 1HL2A 1B4EA 4JXCA 3TK7A 1VJIA 3FLUA 3TROA 4GNJA 2E6DA 4UFLA 1XCFA 3D0CA 1WA3A 3NXFA 3R8RA 4UTUA 2H3DA 1O95A 3W22A 4LC8A 2V0TA 4M6VA 3W7JA 1IXOA 4Q33A 1XC4A 3CEUA 5G5IA 1K8XA 4IQLA 4HPJA 1NF7A 3S5YA 4JTTA 4ZMGA 1FY6A 5DLCA 2ZZ4A 3E12A 3P84A 4JYDA 3I65A 3NPVA 1OF8A 1JUBA 4NZJA 4C1LA 1L9WA 1MZHA 2E6AA 4WUIA 3LCFA 2PC4A 1OK6A 2GQ8A 3C2RA 5DBUA 3RLVA 4DF1A 3T7VA 4M6PA 4O53A 1BTMA 2OX1A 3RK8A 1RVGA 1GT8A 3QYQA 4O14A 4Z1DA 3HMJG 5C6MA 4FXSA 1QO2A 5AHMA 3B04A 5FF2A 5GVJA 2V5BA 3JR2A 5CPNA 1OYCA 1EEPA 1X8FA 5KINA 3ABQA 2QCLA 3FOKA 3M1ZA 3HG4A 1NSJA 3P5ZA 1IXNA 4UIOA 2QJGA 1XUUA 3TAOA 4FNTA 3UPWA 1IGSA 2FTPA 3N19B 3ZWSA 3GKFA 1C8VA 3QMTA 1QFEA 4CLMA 2FLIA 4DF0A 2X2GA 2HS8A 4POCA 1ZAJA 3NVTA 2J9ZA 3M16A 3EX1A 3U2OA 3NA8A 3DGRA 4JD4A 3GXNA 2Y85A 1LRQA 3MW7A 1FWRA 4IMFA 4O19A 4ORMA 1FCUA 1X7FA 3MBDA 1H7PA 4FNQA 1ZNNA 2C19A 2CZ5A 4CQ9A 5D2TA 4LOCA 4YCPA 3W7OA 1ZHAA 1KLYA 2ZCGA 2W79A 5F2MA 2FPVA 1LYXA 4LVBA 4ADUA 2BX7A 2Y7FA 3ELFA 2YW4A 3L67A 2H90A 3NQDA 1JCMP 1PL9A 1SSDA 4KWWA 5G4EA 4FNPA 1JRCA 4LRSA 2HS6A 1X1OA 1DQWA 3QH2A 2QKFA 3C61A 1I8JA 3B0VC 1YDNA 3KHJA 4EOUA 4UMCA 3M5ZA 4FX7A 2CZEA 1OFQA 2CLHA 2QAPA 5FEZA 3MHGA 3W87A 3V75A 4PTNA 2Q3OA 1BKSA 5L9FA 3SSJA 3PUOA 2GVJA 4EWND 1WV2A 4XUGA 5I3IA 1SQ7A 3FIGA 2NV2A 3GDTA 3DFSA 5AHNA 3S42A 3WJSA 4X22A 5H2ZA 2WSYA 5J5RA 1KBJA 3E02A 4YWIA 3ZS4A 3BGJA 1Z42A 3CIWA 1F76A 3UY7A 4AF0A 4Q4KA 2GVGA 5AN7A 2C15A 4UTWA 4CCDA 2JGQA 3PUDA 5F4WA 2H8XA 3SJ3A 3ABRA 4H4IA 8TIMA 1EIXA 3PB0A 1I2RA 3LCGA 1EWEA 3MP4A 1TTIA 4N4PA 3JS3A 3W23A 4GRSA 4JS3A 1UUMA 4BWLC 3MI3A 3DXIA 1LBLA 5D37A 3HGRA 3P80A 4AEOA 4FB7A 1LM1A 4JICA 1M7OA 1N55A 4WOQA 3RF9A 2ZZ2A 3KRSA 1H50A 5CGQA 3QEZA 4LVFA 1GTEA 5H91A 3PS7A 1A5AA 4IPJA 4M5PA 3W07A 4FNUA 3TV8A 4UFJA 3BV4A 4YLWA 2YGYA 3DFPA 4XBSA 1YXDA 5IBXC 1GVOA 4MJZA 2ZTJA 1YXYA 3VE7A 3PWAA 4P61A 1JR1A 4MLRA 1AW5A 3C3NA 3TW7A 3PVFA 1PHWA 1JQXA 4BK9A 2Y88A 3N14A 4ZVJA 3C6CA 3MHFA 1K8ZA 4UTIA 3G1HA 3DH7A 5I3JA 3LDVA 4HHPA 1MSSA 1SW3A 2ZA1A 3TMLA 3OBKA 1OJXA 2J88A 4O52A 1O94A 4K8EA 3UY8A 1NFBA 2OCZA 3C52A 2QUUA 1XXXA 3CWNA 3IVUA 1ICQA 2WOQA 1I4NA 4DPPA 4LW7A 5AC6A 5AFDA 3MYPA 3C2EA 4LY8A 4UMBA 3IIXA 1EUNA 4AMAA 3MBFA 2BXVA 5HWJA 2ZQ0A 1HG3A 3B05A 3W73A 2E5BA 3FA5A 2BZNA 2QCNA 4M7TA 1G6CA 1QR7A 1SZGA 3W70A 5EYWA 3UZJA 3F4NA 1FWWA 3NQ7A 2FIQA 3H55A 3HGSA 5CPMA 1FDZA 5LGZA 2VFDA 1DOSA 3LCXA 3PBUA 4I7WA 3LCIA 2EKCA 4TIMA 1XKYA 4RLIA 5LNRA 4PEKA 4DELA 3MWAA 5F1VA 4Z1CA 3TSMA 3TC7A 2DZUA 3P8JA 3G1YA 3UWYA 2Y62A 3A24A 3B06A 1LOQA 3N9SA 4JTIA 3HG5A 2EAWA 4NJHA 3RU6A 1DHPA 4HKPA 4XWUA 3W2NA 2A85A 3LTSA 4EIVA 2QUTA 2ZZ6A 3S8HA 5E1QA 1P0NA 1SSGA 2GPTA 3FFSA 1R2TA 3LOTA 5CSRA 3SGUA 1TPC1 2VFFA 4Y96A 4Z1BA 4TMCA 2OZ0A 4NNBA 5T26A 3W7QA 1S3HA 4IMEA 2RH9A 4O18A 5FI8A 3LCLA 1R47A 4UTJA 4S2CA 1PV8A 1K03A 2DJXA 5L6UA 5I3HA 3W7LA 2ISSA 3GIYA 4M19A 2XFWA 1B4KA 5D38A 1QAPA 3Q37A 4JX4A 2CLIA 1TREA 3CU2A 3L5AA 4NXKA 3PUEA 2Y7EA 4UTHA 3W74A 3KOFA 3P74A 4U4MA 3THQA 3DENA 4CQAA 3CEPA 4Y90A 3A22A 3IGXA 4ZQPA 5FF7A 1FBAA 1W1ZA 3JRKA 3EXSA 3K30A 2NV1A 4JTEA 4O57A 2F84A 3PULA 4BFAA 1KM5A 3O6DA 3CB8A 2V2HA 3HGOA 5AHIA 5HWNA 5FEXA 1KW1A 4UMAA 2QF7A 1OABA 5EA9A 4OWGA 3EX6A 4HSNA 1ZY9A 4DF2A 1D3GA 4JIQA 1W5NA 2ZA2A 4OV4A 1TPFA 2E1DA 4XKYB 3C8FA 3O06A 5DXXA 3W88A 4NNCA 4Z08A 1TV8A 5SWUA 5A8GA 4DO4A 4MY8A 3DZ1A 2W6RA 3HO8A 3IV3A 4MJMA 2DZXA 5D30A 3PF3A 4X3ZA 4AXKA 2ATMA 1KBIA 1SZFA 4LUIA 3P60A 1KFKA 2IQTA 4WD0A 3G8RA 4JX5A 3LBCA 2JKPA 3GDRA 1OF6A 3M5XA 1JCNA 1YXCA 5AC8A 5DCDA 3LGEA 3W1AA 1R46A 3PG8A 2Z2UA 2G5WA 5IM51 1OVDA 1FX6A 2NXGA 1CW2A 4GXMA 4JX6A 4WOZA 1Q3NA 4O11A 2C14A 1JCXA 2B7QA 2E5CA 2ABBA 1B3OA 1XBZA 3G1DA 3QC3A 4EF8A 3TJLA 2A1YA 3DFOA 1LORA 4PL1A 1WBHA 2V81A 4R34A 2NUXA 3M0ZA 2B4GA 4ZQMA 2YPIA 3LHUA 2J27A 3P7YA 2ZTKA 3W2JA 1P5BA 4IXXA 4WX2A 1F05A 3G1VA 3IIZA 4TO8A 1QDSA 5F2LA 3NPWA 1YADA 4Z0JA 2XN0A 1WBJA 3FYPA 4ONVA 3DAQA 4O16A 3R5EA 3QMSA 1NVMA 3EB2A 2YR1A 2NX3A 3LX9A 2RDUA 4N9EA 4O15A 5E0KA 1ML1A 3P62A 2HMCA 4QNWA 3QRHA 2OT0A 3RFAA 1VCVA 1VR6A 4AHPA 1IIHA 3BG3A 4RXFA 3IIPA 1NAL1 3ABOA 4JNMA 4HNUA 1B9BA 3C56A 3SZ8A 3I6RA 4DBDA 5BNKA 2WSQA 3TX9A 3LXAA 3HG2A 1TPUA 4UR8A 4UTKA 2Y89A 1GVSA 3DHDA 3M47A 2AQWA 5EY5A 1WAUA 4WY0A 4O12A 2C18A 1EX5A 2B0MA 4N9DA 1TO3A 1ZAHA 3N9RA 1BWLA 1WOBA 2DZWA 3B03A 2VFEA 5D2XA 4OU1A 3S1WA 3QM3A 3V1PA 3W84A 2RFGA 3NL5A 5U4NA 3DHFA 1WQ5A 5I3KA 1F6KA 4E2BA 1TYGA 4JR5A 5G2IA 3UYCA 2HTMA 1H7XA 4AHQA 3PBYA 1ICSA 2ZRWA 3EWYA 3WK3A 1ME8A 2G96A 2CZFA 4O54A 4K39A 1S5WA 3UD6A 2I14A 1G69A 3W9ZA 2WNZA 3EX4A 2A21A 3QSTA 5CZJA 3NQ8A 3A5VA 4FNSA 4PCFA 5LKYA 5FF4A 1GVRA 2J9XA 5KZDA 1SO3A 1A50A 4JTKA 1GYNA 3F03K 4JGDA 3TQKA 2QCEA 2ISWA 2I1OA 5TQLA 1SFJA 3CQ0A 4RCXA 4U28A 2PRLA 2E5DA 4IOTA 3M9YA 1Z41A 4QJ1A 3A21A 3LRMA 4N6EA 3W1LA 5CPLA 2RDTA 4IMCA 2X30A 3E0IA 3W1QA 4FF7A 3SIZA 2QAFA 3TW6A 4A3UA 3TAKA 1VLWA 2A2IA 2YCEA 3BW3A 3NQ6A 2R91A 1GTHA 4K36A 3QW3A 1LLWA 1TCDA 2DZTA 2ABAA 1GYLA 1AG1O 3ATYA 3KRZA 1YTKA 1EP2A 1W5OA 2Z1BA 4NJIA 3EWWA 4O4VA 4MKNA 3NL6A 4OQVA 2D73A 3EWZA 5BMXA 1E51A 1L6YA 4NQ1A 4O1BA 4FX8A 3G8EA 1M5WA 1FDYA 1MO0A 4O0ZA 3O16A 2PURA 1ALDA 2NWSA 3TH6A 1KFBA 1I45A 1ZAIA 1OFBA 1ME9A 4N9BA 3STEA 1TPWA 4R33A 2E6FA 4ZQNA 2ZRUA 3LTPA 5LNVA 1D9EA 2ZA3A 3EKLA 1RV8A 2DJLA 1HO4A 3GZ3A 3FJLA 3G1SA 1K7FA 4A22A 1VHCA 1RZMA 4UC5A 2UV8G 4IX0A 2GOUA 1WX0A 3I68A 1XI3A 3G1FA 1DORA 2R94A 1DL3A 3BLEA 1WOAA 2VEKA 3GAYA 4ALDA 4NJJA 1VYPX 5ABTA 3O1NA 3VCRA 1AW2A 5CZTA 3G18A 1X6UA 1M7PA 3W72A 4EVZA 5LSMA 2V8ZA 1KFLA 3IVTA 3STCA 2A7NA 3OEXA 4ZQCA 5EBUA 3CC1A 4ADTA 3UWVA 4C1KA 4MUZA 3SR7A 5F2GA 1N8FA 4JTFA 4HT3A 1LLZA 1QNVA 1QO5A 3VNDA 3GVGA 1VS1A 2JKAA 1AL7A 3PSVA 3WJWA 2GJLA 3W7DA 2Q8LA 1TPVA 3BARA 2C3ZA 4FIQA 3TXZA 4R53A 4BI5A 3I7RA 2ZRZA 3NYZA 1YTEA 1Q6LA 2DZVA 3LHTA 2VEPA 1O4UA 4RK8A 1OHLA 4O1CA 4RXGA 3NM1A 1Q6QA 2QCDB 5AB3A 4JN6A 1W54A 4OT7A 1I2PA 1HFBA 1W37A 1H63A 1JULA 3NZRA 1F73A 1SZNA 3W2UA 5MHBA 4DXVA 1K02A 1J5TA 4YMZA 5J5DA 1JCLA 1EUAA 2G97A 2X1TA 4OBTA 1F2JA 2P10A 4YL2A 1DJNA 3GDMA 1JUKA 3EKZA 3GK0A 4JTGA 4UTTA 3NQAA 3OVPA 1OX5A 1OFDA 4N4QA 1PHQA 2G95A 3DBPA 2Q3RA 4AVFA 3C4UA 5FF0A 1VYRA 3G0XA 4IX2A 4ML9A 2WNNA 3TFXA 2QDHA 1K3UA 3UPBA 2CZDA 2TPSA 4O1AA 3PBWA 1A5BA 3HGJA 3NQCA 1GZGA 3F1QA 3CHVA 3M7WA 1P0KA 1W5QA 2PRHA 4XKYA 3EXRA 2Y61A 1YDOA 4LVAA 3UWQA 1R30A 3W1RA 3WFAA 5D09A 4PFMA 3LI0A 2E09A 3N2XA 3LTYA 3R13A 3QJAA 5AYXA 5HR7A 3W2KA 3LCHA 4Y8FA 1Y0EA 3QPZA 5I3GA 1UB3A 4D2JA 4CCEA 3H54A 3MYOA 1DV7A 1J2WA 4UNLA 1KV5A 1LBFA 2EPHA 1Q6OA 5HUPA 1G4SA 2VKZG 3NGJA 4AAJA 3L5MA 1G4PA 3PY2A 1SO5A 3B8DA 4FX6M 1XDLA 2FPTA 1RD5A 2QJIA 3HB9A 1QPRA 1TPDA 3H53A 3WJYA 5K4ZA 2BLEA 2NZLA 1JCYA 3PM6A 3W1MA 1VH7A 1XM3A 3M41A 3MJYA 3LLDA 3P82A 4NJKA 3GR8A 2JGYA 2RKXA 1P1XA 2BWGA 3DI1A 3TC6A 1H1YA 2YSWA 4DBEA 4DO6A 3W2LA 4GUGA 4A29A 3BGGA 1ZALA 3Q2DA 4FXRA 1IIGA 2ZRVA 3STGA 1W0MA 4AWTA 5BW6A 3G22A 5CKSA 2AAMA 4A2RA 3FKKA 4IPIA 3VFLA 2CLMA 3NG3A 2VC6A 1H61A 3OVQA 4NU7A 3P67A 1VCGA 2RHGA 4WXZA 3C0JA 3LBMA 3RMJA 3LI1A 3CTLA 4NXSA 1VRDA 2YW3A 4RZ5A 4UFHA 3LXBA 3TQ0A 1WYIA 3W71A 4X2RA 5G2HA 3OIXA 4K7VA 3N3MA 3O05A 3L0GA 3A9IA 2VFHA 3L66A 1PE1A 1YTDA 1T96A 4WQ6A 1C29A 3IIOA 5F1UA 2QCCA 1S5VA 3IRDA 4MY9A 1FWSA 5D32A 3GLCA 5D05A 1FQ0A 3LB0A 3GR7A 3NM3A 1A5CA 2PCQA 3NQVA 1LRNA 1R2SA 1VC4A 2VOMA 3KAOA 3TDFA 3TFCA 2B7NA 1FCVA 2NXHA 3WK0A 5EMUA 1ZFJA 4NNAA 1W56A 4NX5A 1T8XA 3QQ1A 1L6WA 4MZ8A 3OA3A 3G0UA 1TB3A 3IGUA 1KTNA 3NNTA 2E6YA 4MOZA 4ZZ9A 1GQNA 3KVLA 5G1YA 2GQ9A 2Z6JA 5C55A 3HQ1A 2WO5A 5D04C 5D03A 3W86A 3DFTA 4LVDA 3W1TA 3LRLA 1W8SA 3INPA 3BLIA 4ZQOA 4CNOA 5CG7A 2OMAA 1KM1A 1H51A 1AL8A 3ZWTA 1SZEA 3L0KA 1FWTA 3Q94A 4YCOA 3NQFA 1V5XA 3IGSA 1W3TA 3UQNA 3PG9A 3TKFA 4BF9A 1EP3A 5DCEA 5AHEA 5D2WA 3E96A 2XN2A 1LRTA 1F6PA 2PE4A 2TYSA 4PA8A 5LNWA 4R7JA 3W85A 3GDLA 1RR2A 3EWBX 3S1UA 3NQMA 3U6WA 1DQXA 2NXIA 2ATSA 1TPH1 5U7SA 2NUWA 3QPYA 1OG0A 3GYEA 4XZ9A 3L5LA 4O1DA 2B7PA 4J9JA 1VYSX 1GWJA 4K6AA 3MO7A 4E0CA 3SW6A 4IXHA 4O4WA 3UZ5A 1W5MA 1I2NA 2X1UA 5KZEA 1OX6A 4O8RA 4L4MA 1TJPA 3NL3A 2V2DA 3G3DA 4AB4A 1K7EA 1SR9A 2H6RA 1XDMA 2X1SA 5LNSA 2C6QA 5G1TA 2ZRYA 1L6SA 1KM0A 2NX1A 3MMTA 2QCHA 5F4XA 5C54A 5K7JA 4PL2A 5KTLA 3S6DA 3BW2A 1LROA 4TX9A 5AC7A 5BOOA 1KM4A 4UCGA 2WV8A 4KFPA 1LTDA 2ZDRA 3ATZA 2FDSA 3HPZA 1SFLA 2FB3A 2YFNA 3NOEA 5HQEA 1ONRA 3NPXA 1OYBA 1F74A 4OV9A 1YLVA 4WZHA 3HPSA 2Y7DA 2Z6IA 5AOUA 2ZZ5A 2HSAA 3L65A 5BMWA 1L2UA 4IUOA 3LHYA 3TR2A 3O8AA 4TR9A 4RZ6A 2OT1A 3QZEA 4ICNA 3SFKA 4FHAA 1TTJA 2I9EA 4KWVA 4GC4A 4Z0SA 4QITA 3GNDA 2PRMA 3LERA 3GXTA 1VQTA 3M44A 3NQ2A 1ZCOA 5DN1A 4QSHA 4LT9A 4UNKA 3C2VA 1M6JA 2GVLA 4MFDA 3W83A 3W7GA 4LNYA 1H60A 4QM1A 1NEYA 4O13A 5KZMA 3B0UX 1LDCA 3AJXA 5LNUA 1SO4A 3BG9A 1H7WA 3THAA 4O10A 5HNRA 3LLFA 2EGZA 4BR1A 4ZQRA 2O7QA 1H7NA 2Z0IA 1KFEA 4GFSA 3VI2A 5HINA 1SW7A 1IXQA 2WPBA 1F7BA 1PIIA 2GUUA 1AK5A 1FDJA 4NUWA 3WK2A 1SPQA 4XTDA 4LS1A 1G67A 3HBLA 1KTCA 3NQEA 2A6LA 3M6YA 4GWEA 3I7QA 1OX4B 3QFEA 1P4CA 2VELA 4NJGA 1THFD 3SI9A 1AMKA 2GJNA 1TRIA 4GE8A 4DPQA 4O28A 1J4EA 5I3FA 3CPRA 5C5YA 1I2OA 4QIUA 5D33A 3HPXA 1TQXA 1AW1A 4GBUA 4BWLA 1QPNA 2V5LA 1ZJIA 3OVRA 2YYUA 2NX9A 5F2IA 1XBXA 4Q32A 4MIMA 4Y9AA 2A7RA 3VE9A 3LRKA 3DKJA 1WDWA 3NPUA 1LCOA 4N6FA 4NX0A 5AHLA 1JCJA 3RLUA 5HULA 1EB3A 1D3HA 4RJEA 1KA9F 4JTSA 4PODA 1G7UA 2GQAA 3LV5A 4QISA 5FESA 1TTQA 4WXYA 2JBMA 3UXAA 4IMDA 1NF0A 3TNOA 3QW4B 3UWZA 4AHOA 2VFIA 5IBXA 3TSBA 5EPDA 3VKJA 2WNQA 4KFNA 3YPIA 3S1VA 1TRDA 2C1HA 1G4TA 3UWWA 5K9CA 2Y63A 4Z1AA 3ABSA 1QMLA 3I7SA 1VGAA 1YPFA 2OJPA 3ZR4A 3W7IA 2ZZ3A 3L68A 2W0UA 1GOXA 3LXCA 2C0AA 5LHFA 5CZ0A 2QCGA 1LBMA 1U83A 2CLFA 3EX3A 3O6CA 4K38A 3MI2A 4PH6A 2YFOA 2E68A 1YPIA 2EHHA 1TV7A 4UUIA 3W1XA 4DEFA 2P0OA 5KSWA 3RNDA 2EF9A 5K4XA 4CNPA 2WSRA 5FEPA 1VCFA 2XN1A 4OE7A 1GPWA 4HPXA 1XUZA 4JIPA 1X1ZA 4E2DA 5G4WA 3GAKA 1N7KA 1IF2A 5LZLA 3L9CA 3MUXA 2FB2A 2QDGA 3E49A 1QOPA 3GDKA 4S1FA 1RPXA 2CWNA 2YZRA 4UTLA 4A2SA 4QNEA 1UASA 3QSRA 4N02A 1PCWA 4NZFA 4LWWA 4OHQA 2DORA 1VLIA 4DQWA 2DZPA 1SW0A 1T99A 3BLFA 3GNNA 5K3VA 2LLEA 1OYAA 1VZWA 3EEGA 1EP1A 2ZZ1A 3EX2A 5DELA 4LS0A 5K2ZA 1Z44A 5AYZA 4PC8A 4FO4A 6ALDA 2BSLA 2QCFA 1VPXA 4MZYA 2JK2A 1KM6A 3W1UA 3R89A 4FNRA 4JTUA 1KM2A 3W75A 2R8WA 4L4LA 4UXDA 3W7HA 5EKYA 6TIMA 4LS2A 1R2RA 3S1XA 3W7PA 2VEIA 3T40A 3NAVA 4WY0B 4RKAA 4E38A 3B0PA 3M5YA 2NLIA 1ZENA 4M7SA 3S9YA 3DU0A 1XBYA 4W9TA 1H1ZA 1PS9A 3C2FA 4JDYA 1EWDA 3KRUA 1CI1A 3W1NA 2V9DA 4GUIA 3KVJA 3LHZA 2ISVA 1JUEA 4X9SA 2QJHA 3TUUA 4RX0A 3PR2A 1V7YA 3SECA 3P61A 4KFOA 5HWMA 3LM7A 4M6QA 3HIJA 3P5YA 2B7OA 3EWXA 4JEQA 5F4SA 2QUVA 1FCQA 1K8YA 2CW6A 4GUHA 3ZFHA 7TIMA 1KV8A 3PB2A 4N9CA 5FF3A 4JYFA 1K7XA 3OHIA 1QOQA 1UJPA 1YYAA 2WJZA 1GG0A 5DXYA 2VFGA 3WJXA 1XFBA 3E9AA 1HUVA 3IIVA 3PC0A 4CCCA 1LOLA 3TIMA 1G7VA 1O5KA 4XTIA 4ADSA 1A53A 4UFKA 4I9AA 3DI0A 3TA6A 3O6YX 3QMRA 3N34A 5CSSA 4IMGA 5BRBA 1MEIA 1W5PA 3KVKA 2VENA 2F7FA 1KFCA 4OGZA 4RV8A 4LVGA 2ZRXA 1FWNA 3KXQA 1DVJA 5K9DA 2X16A 2TSYA 2CLOA 1GVFA 3SGZA 1LOSA 2VXNA 1OFEA 1IXPA 2E77A 3UWUA 3P8IA 4MYAA 3MP5A 4MPQA 3G24A 3FJ6A 3TU9A 3LCWA 1KTBA 1EPXA 2Y70A 3UXDA 2H8ZA 3LHVA 2ALDA 3CM4A 2A7PA 3GB6A 2ZYFA 2NWRA 4MYXA 1PCKA 1XBVA 4LC6A 4O17A 3L21A 2Q8ZA 1LZOA 3OG3A 3U8GA 3BPWA 3L2IA 2DP3A 1OFAA 4AWUA 4MZ1A 3S5NA 3T4CA 1FCBA 4TU1A 2AGKA 4TMBA 1DBTA 2CLLA 3CWOX 1SO6A 4JTHA 4JY9A 3PAJA 2J9YA 4B5NA 4AH7A 2A5HA 1MEHA 4LU0A 1QWGA 1UCWA 4H3DA 3DKLA 1C9DA 2CU0A 4LUJA 1TMHA 1GEQA 4HNTA 2TRSA 1H7RA 5K9XA 4MY1A 4HIBA 3MP3A 3HF3A 4UFIA 2CLKA 4XQ6A 4UTMA 3O15A 4RR4A 3TMQA 3W7RA 3BVJA 3PSWA 2YYTA 5CPOA 3BK0A 3EWUA 1CX9A 3USBA 1G4EA 2CLEA 2QCMA 1YDVA 2ZBTA 5C2XA 4N2YA 5TIMA 1TSIA 3NZ1A 3S5OA 5EL1A 3W6YA 1O5XA 4DO5A 3W1PA 4UTWC 5DY3A 3NDOA 1RQBA 3HG3A 3QQ0A 4JDBA 5HJLA 4UFMA 4KKXA 2RDWA 3EXTA 3FEMA 4GUFA 3G0SA 1A5SA 4AF0B 1OX4A 3HOJA 4I7VA 1BWKA 1UBSA 5D2YA 1HTIA 3S5ZA 2X1RA 3LHWA 1KM3A 3SY5A 4NVTA 3PBVA 1S5TA 2ZZ7A 3T44A 3W76A 4BI6A 4JTJA 3BG5A 4G1KA 3W7EA 1SUXA 4YXGA 3CIXA 1QPQA
chains in the Genus database with same CATH superfamily
3TP4A 3TE9A 2QEZA 1HGYA 1V0LA 1OC6A 1WDSA 1FXQA 2ZFAA 1I1XA 1H62A 1XLFA 4X63A 3W7KA 4DIAA 2NVAA 1E4MM 3B8IA 4NT0A 4L1XA 1C8QA 2PSNA 4H9ZA 2YXGA 4H9TA 3TXVA 1H5YA 1H2JA 1PX3A 4P2VA 2MNRA 3R2GA 2X7VA 2CKSA 3QQWA 4S2BA 2FQIA 2O7SA 3V5OA 2W91A 4C6DA 4LTSA 4AZIA 5HMSA 2QLYA 2A4AA 1BPLB 4AZHA 1S1RA 2CKRA 1TPEA 5FJPA 1JL8A 2AMXA 2CERA 5KMYA 1V3JA 3QHNA 4MLJA 5HR6A 1JG9A 1QCWA 2WLYA 2TMDA 2A0NA 2V5DA 4NASA 3IJ9A 2J78A 3O07A 1TPB1 3VOFA 3F5JA 4G5DA 5TBOA 3PJXA 3UCDA 3FHQA 1WXJA 4EACA 1VFOA 2Y1HA 4AYGA 5DCBA 3S5SA 4UR9A 4DJDA 1FVPA 1ISXA 2J6XA 4YWSA 1HZYA 4HNVA 4CQ8A 3W7CA 5FL0A 3KVMA 3LS9A 4YS1A 2FJKA 1E0TA 4LRTA 1GVQA 3DG7A 3BO9A 1OFRA 3W81A 3VNLA 5HANA 5BCAA 1LP6A 4JTRA 2V82A 3WL0A 1PTDA 3K2GA 4S3FA 4KS0A 1TV5A 2P1FA 3N04A 1KCZA 3TYZA 1ME7A 1CT5A 1LLOA 1SJBA 3O63A 4JY8A 2XFRA 1SU5A 1TJRA 2OFJA 1VHNA 4HCHA 1DJQA 1S2AA 3G1AA 5HMFA 4PR4A 4AZ7A 4Z2LA 3PPFA 3G1XA 4PZVA 4BI7A 3PBMA 8XIAA 5DY2A 4MFEA 1QTWA 1R0MA 1QI3A 4H6QA 1ZBWA 4LV9A 2BGQA 2R14A 1H41A 3ZVHA 2BP1A 1BEUA 2WKGA 2WCSA 2XIQA 3QHOA 2W62A 2ZXDA 3GKAA 2YX0A 4NYYA 3ZLHA 4MSSA 3IVSA 1RP8A 3WBYA 1NOUA 1F5ZA 4X0VA 4I7UA 1ZQ5A 4G6CA 1B4EA 3GWQA 1A49A 3TROA 3VNIA 4UFLA 4FSAA 3EA1A 4LC8A 1KBKA 4S3KA 4M6VA 3W7JA 4S3CA 4L4OA 4Q33A 5LIXX 3A6OA 2QULA 3T08A 1E4NA 1NTHA 3O2LA 2ZZ4A 4JYDA 1ZLPA 2VM8A 3LCFA 3C2RA 2GQ8A 5DBUA 4DF1A 2FH6A 2YCKX 4O53A 3WDPP 2PDUA 4ZB2A 1RVGA 4MKVA 1ZBVA 4EP8C 2O9OA 4Z1DA 2FHFA 5C6MA 3L4UA 3AYTA 1UWRA 1CB2A 5GVJA 4HU8A 2BY3A 1OYCA 5KINA 4ZFMA 3ABQA 1B54A 3BAJA 1ZU8A 4B91A 3WLSA 3W02A 4F9JA 2YA0A 3N12A 4UIOA 1U1JA 1IGSA 4K1WA 2QGYA 3ZWSA 1C8VA 4DNHA 3OYZA 1C7TA 2X2GA 4POCA 3GNXA 3NVTA 3D3FA 3EX1A 2YXXA 3DGRA 4LAKA 1BHGA 3WDRA 1I75A 4DWSA 3MBDA 3KZSA 1H7PA 4HHLA 3PAOA 1US3A 2XIMA 1UD5A 5D2TA 4LOCA 3RX4A 4CQBA 2ZCGA 5F2MA 4KGJA 2FPVA 2PGEA 1W1B1 1A5OC 3ELFA 2YW4A 4NILA 2H90A 2JFEX 3NQDA 3FA4A 4JTQA 1XGZA 5H8MA 2PTDA 4OKDA 2P0IA 2DSUA 5G4EA 1A3WA 4I90A 2V3DA 1L8PA 3AXIA 3CHCA 1FWHC 1WXZA 4FALA 1X1OA 4LALA 4LY4A 2VCAA 3AMLA 3AI0A 1PXGA 3GVWA 3ZJ6A 3KHJA 4UMCA 2CZEA 1OFQA 3MHGA 3W87A 4BF7A 3T0BA 1XISA 4V1YA 3UG4A 5A6AA 2FVMA 5L9FA 1GORA 1UA3A 4IF2A 2GGGA 1SQ7A 2XIIA 2NV2A 5AHNA 3TZFA 3RPMA 5J5RA 3E02A 3ZS4A 1NP2A 1W3JA 4B5WA 2VX4A 5A6TC 1PEZA 1NFGA 3PPCA 3QZ6A 1U5VA 3PUDA 2OQYA 4LUTA 1IR2A 3SJ3A 1B9ZA 4H4IA 1OQFA 3M6DA 4H9VA 1A0CA 2PP1A 2ZE3A 1S2CA 3JS3A 2HK0A 3LPGA 3W23A 5DMNA 5I3DA 4C7FA 1TCMA 4BWLC 3WH5A 3PTDA 4F66A 3M0VA 2VVNA 3P80A 1VFFA 4AEOA 1LM1A 3O6AA 1M7OA 4JFWA 1N55A 4WOQA 4R9XA 3QEZA 1QRQA 3VNKA 2DV0A 1TJ1A 2PA6A 1E0XA 2XISA 3EDKA 2XU2A 2OYKA 3GW0A 2OVLA 1NFPA 3UA4A 3WF2A 2CEQA 3VM7A 2YGYA 3AMCA 1CEOA 4XVEA 3AISA 2OEJA 1UG6A 4GGBA 5CG0A 1ODZA 4KERA 3PWAA 1EQPA 2RAGA 1AW5A 3CQHA 3FV9A 4F2UA 2X1IA 2ZE0A 1CBGA 4K1GA 1JQXA 2Y88A 4WLCA 4ZVJA 3C6CA 3CS2A 3VNJA 3LDVA 1SW3A 3TMLA 3OBKA 1OJXA 2WAGA 3OLDA 4KF1A 4K8EA 5AKQA 3UY8A 1AQMA 3LA4A 1ICQA 3AHYA 3VDBA 4A3RA 4XZLX 4QLLA 1X97A 3IIXA 2G3MA 4NI3A 4AMAA 3IACA 3WFZA 2VT0A 2BXVA 3CUJA 4IFRA 1KXQA 3F2CA 3LNMA 3B05A 2XUCA 4AFYA 1KGWA 3GHRA 3W73A 2RGLA 3FA5A 4AD1A 2A79A 4PTWA 5CAKA 3F4NA 3TJ4A 1RVKA 1JZ8A 1DOSA 4OUIA 4GJIA 1DXEA 3ZT6A 2BHZA 2FZBA 3I10A 3UZWA 4H2CA 1JI1A 5LNRA 4FZIA 2OZ3A 3MWAA 5F1VA 3EZ4A 1GEHA 3TSMA 4NAEA 4XISA 1R87A 4RDWA 1E71M 2ZC8A 2WZTA 2Y62A 3NZQA 2WLZA 1LOQA 2EAWA 3RU6A 3SGGA 4HKPA 3GTXA 2BG5A 2QUTA 3IJIA 1P0NA 1XJBA 1XSKA 1Q66A 3TTOA 4F0LA 8A3HA 4Z1BA 2YCLB 3UCQA 4NNBA 3W7QA 3B3DA 4GVGA 1WKEA 5D4YA 1Q7QA 1EC7A 1PV8A 3VDCA 2DJXA 5I3HA 3CUXA 4E5TA 2ISSA 5D38A 4HMCA 2HEJA 2ZX5A 1QXLA 3W26A 4NKCA 2Y7EA 4UTHA 2PDGA 3W74A 2VZVA 4U4MA 1DWFM 4CQAA 3CEPA 4DBSA 4X9YA 3LQLA 1W1ZA 3GRIA 3FW6A 4JTEA 1BFNA 4WKHA 2XVGA 3AALA 3HGOA 5HWNA 2FMOA 1XRVA 2QT3A 4UMAA 3QY6A 3LM3A 5E9XA 3BURA 1PSCA 4D1JA 1ZY9A 4LAZA 4PCPA 1U22A 2PTYA 4WR3A 1TVNA 2J77A 2VO5A 1TPFA 3DYOA 5DXXA 3WBEA 3BJFA 3DZ1A 1ZJBA 4FI4A 1EO7A 3F2BA 2X09A 4HGXA 3FVDA 1QOXA 2DZXA 4MJMA 3PF3A 1TVPA 4HCLA 2ATMA 4HZ6A 4AISA 1N2VA 3P60A 4E2OA 1KFKA 3TN3A 1CECA 1PZ2A 4L6DA 3GDRA 1OF6A 1XYAA 1JCNA 4ACZA 3BLLA 3QTPA 3GU2A 1ZS2A 4WK9A 1R46A 1XG3A 4JAWA 1MDLA 1P6CA 1DJZA 2V38A 4O11A 2C14A 2FDMA 4PUJA 1JCXA 1P1MA 2B7QA 2E5CA 5C2CA 3TJLA 2PLJA 2A1YA 1E9YB 1LORA 4R34A 4Z2KA 4ZQMA 2YPIA 3VGGA 1P5BA 3L12A 3OG2A 5M5DA 3G1VA 1Q5MA 4XD3A 1XWYA 5F2LA 3NPWA 2XN0A 1QI0A 4MB5A 4O16A 1WKYA 1MUMA 2YR1A 2RDUA 4OZOA 2HMCA 4QNWA 3NDZA 1VR6A 3CLWA 3QYSA 4AHPA 2KAUC 1JFXA 3BG3A 3IAPA 4LBRA 4GPNA 5E9AA 4JNMA 1KB3A 4DJFA 5HDRA 4J7RA 1VRXA 4AIUA 3HG2A 4UTKA 3C3UA 3DHDA 2NVDA 4N0RA 2DIKA 4WY0A 1H3GA 3WBWA 2C18A 1C92A 1EX5A 2PGWA 2GWGA 1VPYA 3WLKX 1NOWA 4ZEPA 3S1WA 1QHPA 2QVHA 5A1AA 3W84A 4GZJA 3MDUA 1I1WA 1XIBA 5U4NA 3DHFA 1WQ5A 5I3KA 4PEEA 4HOZA 1TYGA 3EMCA 3UYCA 2HTMA 1NDWA 3JVAA 2ZRWA 5LA0A 2EPKX 4JFTA 1UKPA 2FHBA 2O9RA 3UD6A 3VIGA 1WUFA 3ITVA 1WZAA 4ERIA 3VUSA 1XLIA 2I7GA 1S2UA 4FNSA 2GYIA 3RR1A 5BU6A 3AHXA 4M0XA 4HYWA 5CC3A 3TQKA 2I1OA 3RGTA 2WHMA 4AU0A 4M6UA 3KCOA 3LRMA 3W1LA 2RDTA 1XLKA 4IMCA 2BHUA 3W1QA 4QCFA 5IFPA 4YVVA 1OC5A 1EX1A 3NQ6A 1RP9A 3BW3A 2YA2A 2R91A 2B31A 2D20A 4ERAA 3VZYA 2DZTA 2OQHA 1GOKA 4U33A 1RLCL 3KRZA 3VIMA 5DT7A 2Z1BA 4IIBA 4NJIA 2ZVIA 3EWWA 4O4VA 4AEEA 4JN7A 4GI4A 5XINA 3IWPA 3VFCA 4GH1A 1HL8A 3G8EA 1TFVA 4O0ZA 4Q8QA 5JH2A 5CAHA 1YMYA 3H2FA 4NZ4A 2DZBA 2YZ5A 3MKCA 1VEPA 4QLKA 1JZ5A 3TH6A 2OGYA 1IEXA 4KT2A 3PPGA 3WQGA 4FLRA 3BMVA 3L4TA 4BZYA 3STEA 3DG3A 1HJVA 5JIPA 1D9EA 2ZA3A 3EKLA 3W28A 1RV8A 3FJLA 4JN8A 4PTVA 3TZNA 2GDVA 3G1SA 4HU3A 7REQB 1VHCA 1WE5A 3DDMA 4UC5A 2RUSA 4IX0A 1EC9A 1Q65A 2FJUB 2GOUA 1ZUAX 2VZUA 4LANA 3WL1A 5AC4A 2I5IA 1DL3A 4G9PA 3BLEA 4AUBA 4S3AA 3GAYA 1VYPX 2NVCA 1AW2A 3G18A 1FRBA 2WVVA 3WD1A 2BVTA 1X96A 3IVTA 5C70A 3KP1A 3OEXA 5HQLA 3T42A 4QXIA 3N2TA 5D8ZA 3RCYA 1F8MA 3UWVA 4MUZA 4ATDA 4QTGA 1N8FA 3POHA 4HT3A 3N2BA 2V3GA 1LLZA 2D23A 3AU6A 3GVGA 3EMZA 2R1LA 4B3ZA 1UD8A 1AL7A 1FWEC 4V1XA 3RX2A 4QDPA 1CWYA 4AEFA 3BARA 3NZGA 4W8AA 4FIQA 3VIOA 1AH3A 3SCVA 3WF1A 3ITCA 5I24A 1PO9A 1WNOA 3I6TA 3LHTA 4RK8A 1ZSXA 2QCDB 4XAPA 1EL3A 4TTGA 1I2PA 1W37A 1FH9A 3NZRA 5MHBA 1XIGA 1UD3A 4DXVA 4W4QA 1J5TA 3CH9A 4YMZA 3WBAA 5FAGA 2X1TA 2VP8A 1F2JA 4C6EA 4CN6A 1DJNA 1IZCA 4O8AA 1HW6A 4NP7A 3GK0A 4JTGA 2VDGA 3NQAA 3OVPA 4MWAA 4N4QA 4XAFA 3AS3A 2VL4A 3BDKA 3G0XA 3K46A 2WNNA 4FPSA 2E1WA 2QDHA 1K3UA 3U7BA 1CXFA 4K2SA 1A5BA 3NQCA 1B0IA 3M7SA 3F1QA 3CHVA 1LG1A 1P0KA 2HCVA 2A3EA 1HVQA 3W1RA 3WUEA 4PFMA 3LI0A 3KOXA 2E09A 1S2VA 5HK4A 3R13A 1R8LA 3QJAA 2UY5A 1V3MA 3BMWA 5AYXA 2IUZA 5T8GA 2X0HA 1O6IA 1O1ZA 3E2VA 1YIXA 1IZJA 1C8XA 2VKZG 3TYAA 3WLHA 4KCTA 2CBIA 1XYLA 1VIZA 4GIEA 2QJIA 3GH7A 1JCYA 3W1MA 4W5ZA 1VH7A 3P82A 4M82A 2IS7A 2JGYA 4BQ3A 2BWGA 3TC6A 4XD4A 3W2LA 4GUGA 3BGGA 3CL7A 4R85A 2YJQA 3GNOA 4CEUC 2D2JA 4DUVA 3ID7A 2XG9A 4AWTA 3ZM8A 5BW6A 3QBUA 1GJWA 3FKKA 4IPIA 4IP5A 3NG3A 3TEVA 3E1F1 2VC6A 3OVQA 3T0AA 3P67A 1F6YA 3DFYA 1UMYA 4WXZA 3C0JA 3LBMA 3LI1A 4XV0A 4B4HA 3TQ0A 3VGFA 4ZO8A 4NZ1A 5HPCA 2XM1A 4IM4A 1BQGA 1E6SM 2OSYA 1SJCA 1C29A 4CNUA 5FJTA 3JZUA 4EX4A 1AA1B 4MY9A 3AIVA 3UF9A 4MDPA 2XPKA 1QJWA 3QC0A 2PCQA 1A5CA 2VOMA 3NM3A 2WNWA 1BYAA 5AECA 3URBA 4KH2A 3WQ6A 1I60A 2AAAA 4HOWA 1ZFJA 2PDKA 1W56A 2WMJA 3VNYA 5JU6A 1KFWA 1K9EA 4MZ8A 3RCNA 5DT5A 1TB3A 3HURA 4H00A 5EFDA 3WLMA 1GQNA 3E5BA 1ZBKA 1IEVA 3VC5A 2PB1A 5D03A 3W86A 1S38A 3SN1A 4LVDA 1F3TA 3VZXA 3W1TA 4AZGA 3LRLA 1OINA 4HHHA 3FSUA 1GVIA 3E0LA 4RNHA 1VBRA 2OMAA 4GYPC 1H51A 1AL8A 5IFTA 3TR9A 3KTXA 4QG6A 3VIJA 2PWEA 1FWTA 2POZA 4UQDA 1CGYA 1V5XA 1W3TA 1EP3A 5AHEA 1KCKA 3F4DA 3CZGA 2TYSA 3CO8A 3CPGA 1MW2A 3S1UA 4GZEA 2EPNA 3N9KA 1TPH1 2HXTA 1OG0A 3GYEA 4P8WA 4XZ9A 5E0FA 4UNIA 2WHLA 4HP5A 4MNJA 4E0CA 6PTDA 3MJMA 2X05A 2DVUA 2ZUMA 3WH9A 4PMYA 1OX6A 3AC0A 4US5A 1TJPA 3WEZA 2W3ZA 3G3DA 4ZODA 1K7EA 3EA2A 2H6RA 4B9YA 5LNSA 3UWEA 3DYPA 1KM0A 3FXGA 4P7OA 3OA5A 3WQ4A 3LU2A 5KTLA 3BAKA 3BW2A 4C6KA 4B2DA 3OGVA 3GG1A 5AC7A 2A3LA 1R38A 2IW0A 2L5HA 2ZDRA 3KS6A 2FB3A 4KRZA 5HQEA 3TTSA 1F3WA 4MPKA 2ESCA 2Z6IA 4GH3A 4YTTA 5BMWA 2XVPA 4IUOA 2EG7A 2NQJA 1SR0A 3LHYA 1UR9A 4TR9A 4ICNA 3MTWA 4UTFA 1L6GA 4FHAA 1BVWA 3GNDA 4J28A 4PRRA 3MDWA 3GXTA 3NQ2A 1HP4A 2FFIA 4QSHA 3KDOA 5A8OA 4G7EB 4LT9A 3C2VA 4CD4A 2GVLA 3W7GA 4LNYA 1H60A 3LN3A 4O13A 1QHOA 2V5JA 1SO4A 1KQZA 3DC8A 3THAA 4B16A 3LLFA 1GOWA 2GQ3A 2FGBA 2Z0IA 3RM9A 4GFSA 4AD5A 5HINA 3MC5A 2WPBA 4D6IA 4XTDA 2PODA 3UCCA 2P88A 4BEUA 1KTCA 2I5QA 3NQEA 4LB3A 4PGLA 1ZP3A 1TMQA 3ORWA 1FP9A 3NFUA 1TWZA 2ACQA 4CGTA 4C1NB 3WUGA 1CGWA 1UR1A 3UEQA 3VCCA 4RZBA 3ARXA 2GJNA 1J4EA 3GD6A 1ZP4A 3CPRA 1I2OA 3HPXA 1AW1A 4GBUA 5HPOA 4BWLA 1PBGA 3KBSA 4DZHA 1QPNA 2V5LA 2VC9A 2XIOA 5CC6A 2CXGA 1XBXA 2PBOA 4H41A 4MIMA 1FWIC 1AUSL 4HK7A 1GHSA 3DKJA 2XH4A 2GUYA 1LCOA 2DT1A 1C93A 5AHLA 3RLUA 2VR4A 4AZCA 3NVDA 1MXGA 4JTSA 4HTBA 1FHLA 2J7EA 4GO9A 1GCYA 3PZUA 3AZRA 1QNOA 4FAMA 3UR7A 4LYPA 3IUDA 2MUCA 3KE0A 1V3HA 3E0VA 3EKGA 4J1OA 2PDPA 2C1HA 3ABSA 1QMLA 1W17A 1YPFA 5ECVA 2OJPA 3R1ZA 3WNMA 4HNLA 3T05A 4DJEC 1O5RA 3LXCA 2C0AA 4LQ1A 3SRDA 2DIEA 1LBMA 2QNEA 2VDIA 3BZJA 1UQZA 4K38A 1ISWA 1E4LA 1OC7A 4B5UA 3M0LA 3B8TA 3SM0A 5EFFA 2OO6A 1Q4NX 3AUJA 3RNDA 2WSRA 5FEPA 1VCFA 2A3HA 2NSXA 5CGTA 3T0CA 5A94A 1XUZA 3FVMA 3CZKA 2EEXA 2VGBA 4UCFA 4E2DA 3I3EA 1KWGA 4H8NA 1CB7B 2BMBA 5A2CA 3AWOA 5LZLA 3L9CA 1LWIA 3LENA 3NSMA 4D1IA 2BY2A 3BXWA 3GDKA 3N2OA 4H9MA 4QNEA 4YHEA 3MKKA 1PCWA 2XFFA 3AUOA 4OTKA 1VLIA 4DQWA 2DZPA 3I4KA 1MI3A 1T99A 1PKNA 3CYVA 5A2BA 1JD7A 5K3VA 2LLEA 3EEGA 1BYCA 3KTCA 1EP1A 2ZZ1A 4QE1A 1UOZA 3EX2A 1XH0A 3CWHA 4H9XA 3ZSSA 1PTGA 3AOFA 3WDQA 1UBPC 3H23A 1DQUA 4YIWA 4NRRA 2O55A 5HAOA 4FO4A 4Q22A 6ALDA 4ML4A 4XZWA 3W1UA 1F3XA 3R89A 4JTUA 1Q85A 1KO0A 1ZB5A 1FHUA 2R8WA 1Y5XA 2DW6A 2VEIA 4L5ZA 4YTSA 5F7UA 5FJUA 1E6QM 3IJLA 2NLIA 1ZENA 3ALFA 1W1IE 3ZVHB 4LSBA 3N6HA 1WDRA 4W5UA 1XBYA 1XCXA 2GLKA 1PS9A 3C2FA 4X0NA 1EJ7L 2AKMA 3TUUA 4J27A 1NDVA 2XTKA 3PR2A 4DUWA 4GY0A 5MKGA 1RCOB 3P5YA 4BJHA 4K8GA 2R1KA 2B7OA 1CGTA 2BOEX 1UP2A 4JEQA 1W1VA 2QUVA 2IKIA 2V69A 5C9XA 3GO2A 2PWGA 3PB2A 3A4AA 4JIEA 4CEXC 5E09A 5DXYA 9CGTA 1XFBA 3OYXA 1HUVA 1P6BA 2QF8A 3IIVA 3O9NA 5HNUA 1G7VA 1O5KA 4XTIA 1LWHA 1GVYA 4I9AA 4GI8A 3GDBA 4PUEA 2GFTA 3GQYA 3O6YX 5DQPA 1U1HA 3N34A 4S3JA 1AFSA 1MEIA 1RUSA 3QR0A 2VENA 2F7FA 1U1UA 1BYBA 1BTCA 4RV8A 2ZRXA 3H2CA 5K9DA 1DVJA 1QT1A 2X16A 4A3YA 4ASTA 4LBSA 2V3FA 1GVFA 1S5MA 3SGZA 2VXNA 4Q8NA 3DG6A 3P8IA 4UZSA 3LCWA 4FS9A 1J01A 3ITOA 1OY0A 1QNPA 5HBFA 2A7PA 3GB6A 4Z2IA 5I06A 1PCKA 1TA3B 2F61A 3ITLA 4LC6A 4O17A 3L21A 5DRIA 4F2TA 4CNTA 3L2IA 3L4VA 4AWUA 4EAMA 1XFCA 4DWSB 3U9IA 3H2MA 5I5RA 4OJYA 5EMLA 3RDKA 4XZBA 3WBXA 1DBTA 4IL2A 4M56A 3N3TA 1SO6A 1HQTA 1XQLA 4JY9A 3ZT5A 4WF7A 3SCQA 1V3KA 4B5NA 2A5HA 1MEHA 5FSEC 4H3DA 4LUJA 2CU0A 5HNNA 1GEQA 3FA3A 1H7RA 5K9XA 4F3HA 1TELA 1C7SA 1N8WA 3MP3A 1OGBA 4EANA 3H22A 4MNLA 4XQ6A 4UTMA 3O15A 4RR4A 7ODCA 3ECQA 2JF7A 2ZVRA 3PSWA 4WKAA 5CPTA 2YYTA 1MUCA 1JGMA 3K8KA 3BK0A 4R27A 1CX9A 4K3ZA 1YDVA 5C2XA 4Q4SA 3NZ1A 3S5OA 3MV11 5EL1A 3W6YA 4DO5A 4UTWC 4IFKA 3COTA 1JZ3A 2QV5A 4JDBA 4ZBCA 1TWSA 4GINA 2CCRA 3W82A 1EXPA 2RDWA 5CZKA 1H11A 4UOZA 2IXUA 3R0UA 1OSEA 3VZZA 1OX4A 4I7VA 4F2BA 3Q4DA 1EPVA 1WPCA 4S38A 1JYVA 1HTIA 2ZXBA 2OEMA 4JFSA 4C7DA 3LMZA 3MB9A 3VOGA 2ISFA 4IQEA 3W7EA 1SUXA 4OOZA 4YXGA 3VINA 4QQ3A 3FS2A 4DJDD 2VEMA 5B7ZA 2BY0A 3P81A 3IEBA 3AAMA 1ZTVA 4HZMA 5BOEA 1HO1A 1X7IA 4E4UA 2ZC1A 4YTUA 3QTGA 3S46A 3CQIA 4A8RA 1I2QA 2XFYA 4RZ4A 4AZ6A 2Y2WA 1LG2A 2FFCA 5A6JA 2DT3A 3KCJA 2ZX7A 4PMZA 4A21A 4PMXA 1V6VA 5EU9A 2EJAA 2XH0A 3GW3A 4MM1A 1VFSA 2QIWA 1DJHA 3NSNA 1W3NA 1ZL1A 4PTXA 1EJWC 4GVHA 3CHDA 5CZSA 1FUYA 4H6EA 4CN4A 1GJPA 1KXVA 4NL1A 2WSKA 1XF0A 4M29A 3VDGA 1V3LA 3WJZA 5CJMA 2G3NA 1ZJHA 3CZ8A 3NL2A 2Y0FA 3K1DA 3F4CA 2Z7KA 3IAQA 1KFJA 3RYSA 3W7NA 2P3ZA 3UJSA 2CESA 2WKJA 1TQJA 4DY1A 3R10A 3STFA 2H3BA 2NQ9A 4Z2HA 3K8MA 5AYYA 3WG6A 2TAAA 3HJZA 3OZPA 4FIRA 1JYXA 2F6XA 4ENLA 1H7OA 4MVAA 2D2HA 5DBTA 4K7YA 1DKWA 4Y6GA 1KLZA 3NEVA 4IWWA 1J9YA 1Z48A 2DUAA 3LPPA 2A6NA 3AXMA 1IWAA 5D2VA 1ZBCA 1W3IA 5JBEA 4CQCA 2Y6ZA 1EA9C 3A23A 2DU2A 5HOSA 1E0WA 4NAEB 2V30A 4O0KA 3NR0A 4J2PA 5AYBA 3OZMA 4LGXA 1A4LA 3PBGA 4ZA0A 1ICPA 5I78A 4KBXA 4U31A 3DFQA 4ORIA 2BDQA 3CZLA 3K4WA 2R82A 3S0CA 1W31A 1POJA 2V2CA 1BLIA 1BD0A 4FEZA 1E6RA 3QN3A 1HGWA 3WNKA 3I3DA 3QV7A 1JQVA 3DFNA 2OXNA 3TA9A 2V5KA 2YL5A 4JXCA 4UQEA 4Q6JA 4PUUA 1VJIA 3LPFA 4DWSD 2E6DA 3VX1A 3OBEA 5FA5A 4UTUA 2E0PA 2H3DA 3BLPX 3SDOA 1O95A 3W22A 2A3CA 2YLLA 4PUNA 5GQBA 2V0TA 4HU0A 3UR5A 4MWAE 3CAQA 4DM1A 4JTTA 3R25A 1M01A 3FK4A 7CGTA 1CCWB 4NZJA 4C1LA 3PJUA 3WF4A 1L9WA 4WUIA 3P0XA 3KEHA 3RLVA 2R1PA 4M6PA 2W92A 5JH1A 2OX1A 3VGEA 1ESWA 4H2HA 1V6UA 2Y24A 1W9BM 1JGIA 3BE7A 1XYFA 1H4PA 1XD1A 4F79A 3BUVA 2IPFA 5CPNA 3ARWA 2BGSA 2DSWA 3RO6A 4RV3A 1X8FA 3GYCA 3AYRA 3R7MA 4LCSA 1UOKA 3EB4A 1RY8A 2YDQA 3M1ZA 1NSJA 2Y4SA 1IXNA 4FNTA 3UPWA 3JU2A 2PI6A 3M0MA 3N19B 3QMTA 2OKOA 5BXTA 4ACZB 2HK1A 3A9BA 5REQA 3GG0A 1L8NA 4WGHA 4HK5A 4DLMA 4JD4A 3H4GA 4AX7A 1PWMA 2Y85A 3L23A 1FWRA 3C0QA 1OG6A 3W25A 1X7FA 1ZNNA 2XGIA 3MCOA 3QFWA 3K13A 4YCPA 1PWLA 2VRJA 3WZ0E 4D6GA 4TX8A 4CU6A 4Y8EA 1PYFA 4CD8A 2W27A 4JL1A 1B3YA 1UWUA 1JRCA 4HK6A 1GW9A 4GKTA 4TVUA 4GABA 4W93A 3C61A 2YL6A 1HJSA 3HU7A 3SJNA 3V5CA 4GBDA 4DN1A 1BKSA 3MUZ1 1WV2A 1V03A 1SFTA 3AXKA 5I3IA 3FIGA 4IP4A 3BTNA 3DFSA 3GDTA 5DMYA 3WJSA 3WLRA 1KBJA 2ZXAA 4QSFA 4YWIA 3BGJA 4YVPA 2VNCA 5GPRA 2GVGA 5AN7A 1KQYA 4PULA 4YTQA 2PPGA 5A6MA 2JGQA 5F4WA 1XLEA 1BAGA 2H8XA 1BKHA 3ABRA 8TIMA 2JQXA 1M04A 1US2A 2J47A 3MP4A 3P14A 2W4XA 2AQVA 4L56A 4ZTXA 2DSKA 5E70A 5I0DA 3TYEA 3HFTA 3JW7A 1MW0A 5CGQA 3UZYA 2PUZA 3WNPA 4RDYA 5H91A 4IPJA 4PUWA 3U5UA 2YXOA 1EYWA 3GC5A 1W9VA 1Q2SA 4M5PA 3WY1A 4Q8MA 4GYPA 1HNYA 4FNUA 4DYEA 1LT8A 3RO8A 3SQMA 2GSEA 1E5JA 2YKKA 2REQA 3WQ5A 3NEHA 4Q7IA 7TAAA 3DFPA 1UWIA 1YXDA 3T81A 5IBXC 4XZIA 3BQ6A 3W27A 3QV6A 4MJZA 3WMSA 4QS6A 2NW0A 1J93A 3TYBA 1LUCA 3HJEA 1E1CA 2F9RA 3FSTA 1DWHM 1PHWA 1XRFA 1RXOB 3GU1A 3N14A 3WQPA 1UW9A 3EOOA 5J8LA 3G1HA 5I3JA 1MSSA 1D3CA 4EXBA 3LYEA 1F61A 3ZOAA 4LYQA 2OCZA 1IWPA 3C52A 1C8YA 3CWNA 3IVUA 3LZ5A 8XIMA 4G1NA 3ZQ9A 1JDCA 4LW7A 4V28A 3F7JA 4XD6A 4Q4QA 4LY8A 3AIQA 1Z6KA 4UMBA 3FJNA 4YPJA 3MBFA 1UZHA 3F2DA 4AY8A 5HWJA 5CC7A 3T8LA 2ZQ0A 2OELA 1UWAA 2J8TA 2QCNA 4M7TA 3WKZA 1G6CA 3W6LA 1SZGA 1W1PA 1JZ7A 2CETA 1FWWA 4NZ5A 2FIQA 2Y8KA 2H9AA 2PDIA 4UOQA 1V6YA 3LCXA 3PBUA 3L2MA 4TIMA 2WVVB 4M1BA 4ROQA 4DELA 3KLKA 4C90A 1XP3A 2PDJA 3ARRA 3SCOA 2HPIA 1LQAA 1Q8AA 3G1YA 1CLVA 4MJ4A 2WMIB 2VMFA 1UH3A 1E55A 4JTIA 3HG5A 3UXLA 1IGWA 4NJHA 1KRCC 2IMRA 2A85A 4MB4A 5E1QA 4GIAA 1UYQA 2PDQA 3BLDA 5CSRA 3LD5A 4LF2A 1E73M 1A5MC 2PDYA 3MU7A 1E0VA 3RU8X 2FKPA 4IPPA 2WVTA 4IMEA 4O18A 1R47A 4MAVA 4GJJA 3AS1A 4DRSA 2PCEA 4GYKA 5ABFA 3GIYA 4ECLA 4LB4A 1B4KA 4MADA 5HATA 1QAPA 4JX4A 4KRUA 1PKMA 3L5AA 4NXKA 2INZA 3KOFA 1HKMA 2C7FA 1F4AA 3THQA 1R85A 3H12A 1JPIA 1VPQA 5FF7A 1FBAA 1TUXA 1UMLA 2ZDSA 3QOMA 1E70M 3EXSA 3MWCA 1W1YA 3NUKA 3PULA 4QBXA 3SRFA 5TNVA 1KM5A 1A0EA 5KEZA 4OBSA 1H1NA 3V5FA 1NH6A 4MWAB 3GUWA 5CC5A 3OZOA 3C8NA 5EA9A 3TN4A 3EX6A 4LXFA 2YCIX 4GGHA 5C9RA 2ZA2A 1SGJA 4OV4A 5EMYA 1J10A 2E1DA 3O06A 4PSPA 3W88A 3HV9A 5SWUA 4D6FA 4DJFD 1M68A 4QJ4B 4MB1A 1EDTA 3GBEA 1Z3NA 3UXKA 4DLFA 3IV3A 5D30A 2IKGA 1W3LA 2GDUA 4JCLA 1SZFA 3QGAC 4FLOA 2D2OA 1PPIA 4J40A 3G8RA 3FGCB 3LMYA 4DNMA 2G8ZA 2GOKA 2X42A 4BY3A 4CCZA 3LGEA 5JMUA 2CHNA 2G5WA 1FX6A 2NXGA 1K6WA 4JX6A 3P3BA 3PNUA 4LEFA 1B3OA 4INFA 1B3WA 2J8GA 4A3HA 1CNVA 4D6HA 4U5IA 4PL1A 5BU9A 2PMQA 4AWEA 3S2NA 2J27A 2OO0A 3W2JA 3TCSA 1F05A 1KGXA 3IIZA 5DMMA 1YADA 4L64A 4Z0JA 3KRBA 4ZOEA 4ONVA 5DMLA 4QP0A 3R5EA 4I5RA 3QMSA 1HJWA 3EB2A 1XRTA 4WEVX 4O15A 2OT0A 1WAWA 1BSIA 3GE7A 4RXFA 1FWAC 5A6BA 4ZTYA 4HNUA 2WSQA 3TX9A 2Y89A 1GVSA 2DVXA 5EY5A 3GHUA 4JOMA 4O12A 4PYSA 3CV2A 2PTXA 2B0MA 3C0LA 4HPNA 1ZAHA 5D2XA 3U7VA 3B03A 2RDXA 1TJ0A 2OLHA 2RFGA 3AHZA 2XGZA 4KIRA 4C5YA 4AY1A 2ZIDA 1F6KA 4GA8A 1L2QA 3WNOA 4E2BA 3N1AA 3PBYA 1ZPTA 1LQ2A 3NJ3A 1A3XA 1ME8A 5IXEA 5JBDA 2WM0A 1DJXA 2WNZA 2VJXA 3QSTA 5CZJA 1CXIA 4GMEA 4KWOA 3A5VA 4H19A 5FF4A 1SO3A 1A50A 4HA3A 2QCEA 1HL9A 1GQIA 5D9NA 2Z27A 3RUBL 3CQ0A 3W4RA 4X2PA 4RCXA 4U28A 2PRLA 2E5DA 4IOTA 2PLKA 3QKEA 2E4TA 3D5HA 5CPLA 3ZLFA 4GACA 3EEZA 3SIZA 1RJQA 3LK6A 1J79A 1ODUA 1GKQA 3G77A 1UPPA 2IQ0A 1OGSA 4B90A 4R88A 3V0UA 3R8HA 2ABAA 3W37A 2Q8XA 1OD0A 1XSIA 2XSAA 1EP2A 3A3WA 1RPKA 1KCXA 3IRSA 2I5GA 1ENUA 4OQVA 2D73A 4IISA 4NQ1A 4WJXA 4WSHA 2OB3A 4FX8A 1NOFA 3VILA 3UT0A 3O16A 1LL7A 1KRMA 3W01A 1KFBA 3N11A 1I45A 1ZAIA 3SCWA 4PE8A 1OFBA 5CBIA 1TPWA 3LTPA 1HO4A 2DJLA 3GZ3A 4H1ZA 1UP0A 1XLAA 1HKIA 3EWCA 3MUAA 4LX4A 1XI3A 3ANUA 2R94A 3ARVA 3QV9A 4IGMA 4NSBA 2VEKA 3N2CA 3B9OA 2YIHA 4MWAD 1X6UA 3GIPA 3IANA 2VX7A 1HKWA 1XGDA 1CGUA 5EBUA 3CC1A 3R11A 1DP0A 1SJDA 3DERA 3IK2A 4J3ZA 1OADA 3SR7A 1CXEA 1ECQA 1I6NA 1VS1A 1WKDA 1YBQA 3W7DA 4RNJA 4GX8A 1KNWA 1U5HA 3EPMA 1TPVA 1RBOB 1IEQA 3TXZA 4R53A 4ES4A 1UP3A 1IR1A 2VEPA 4RXGA 1U2YA 1ELSA 4LAUA 5AB3A 1Y5WA 4EKJA 1W54A 4OT7A 1H63A 1F73A 1JXJA 3W2UA 1K4HA 1K02A 1RK5A 2WZIA 2F2KA 3WH7A 1EUAA 1TVLA 1JUKA 1GOIA 1M7JA 2GSHA 2E28A 2WYSA 4X61A 1L0PA 1X39A 4WRHA 4D8AA 3VD7A 1K1DA 3GZAA 4JIIX 1OX5A 2CHRA 4LAOA 4AZCB 4C6QA 3S83A 3C4UA 1TUFA 1VYRA 1XIJA 4AD2A 2XWEA 4Q4OA 3MANA 2BXYA 2VD9A 3EGJA 3UPBA 3BMXA 3BJTA 4Q8WA 4JFUA 1GZGA 1V3IA 1W2VA 3A64A 1BWVA 2Q71A 3AIRA 4XKYA 1W5QA 3N4FA 2J7FA 3WFAA 4S23A 6CGTA 3FAXA 2UY4A 3N2XA 4AW7A 5HR7A 1A5UA 1ZCCA 3QPZA 4W8BA 3U2CA 5I3GA 1LWJA 4GKLA 1J2WA 1KV5A 1QU4A 4JQAA 1UJQA 3VX0A 5HUPA 3POCA 3L5MA 1G4PA 3CHEA 3PY2A 1Q13A 5KETA 3B8DA 1XDLA 9XIAA 2C91A 1QPRA 5K4ZA 2BLEA 2NZLA 1WDDA 3PM6A 3S6OA 2O9TA 2WJDA 3M41A 3PPHA 4RPPA 1P1XA 3PFRA 1H1YA 1JNDA 1PIFA 1UD4A 3UJFA 3BC9A 3Q2DA 3UXIA 1ITXA 3WH6A 3EOUA 2PWHA 2ZRVA 3OQ8A 3STGA 5CKSA 1QI2A 2OQLA 3P6LA 4GYJA 1ADDA 3FX4A 1OIMA 4NU7A 3S9ZA 2RHGA 3AMGA 1VD6A 4RZ5A 4C6PA 1WYIA 2FGLA 1EJRC 4K7VA 4F0MA 5XIAA 4I6VA 3L66A 4D71A 1YTDA 3U2EA 1T96A 4ZFCA 3QKZA 1E43A 3DN5A 1FWSA 5ABHA 3WQFA 4M3PA 3LB0A 4GI6A 2PD9A 4HZ7A 4TUFA 1HN1A 2F8QA 2CHOA 2NV9A 4G56A 2OWWA 4US5D 4WKFA 3WLPA 3WEOA 1J0JA 1DXIA 3H8AA 1OIFA 2Y8VA 3L4YA 4PMOA 3GTHA 4BCEA 1XIIA 3NZPA 4HA4A 3IGUA 1F3EA 2E6YA 3AYSA 1T6MA 3STPA 4XAYA 4B2DD 5G1YA 1K70A 2GQ9A 8CGTA 3MCMA 3HQ1A 4NI8A 5D04C 4AD4A 3KS5A 5MKGB 4HNCA 3OLGA 3SCSA 1NIUA 2BV9A 1MZRA 3HMCA 2Z2BA 4Q8UA 2FZMA 4DX3A 3PG9A 3RIKA 3VXGA 4QR6A 5DCEA 4W7UA 2XN2A 1KCLA 3M0HA 2HXUA 4B4FA 4PA8A 2QPXA 3BH4A 3GDLA 3II1A 1RR2A 2EXOA 1M53A 4C7GA 5U7SA 2NUWA 4XZNX 4O1DA 2B7PA 1HXJA 3L4WA 1B3ZA 1OD8A 1EZ2A 4O4WA 1IT0A 1W5MA 1I2NA 2X1UA 1MW1A 5KZEA 2CLPA 3ES7A 1VKFA 3KBJA 1XDMA 2X1SA 1SM9A 1V4YA 2C6QA 3P2VA 3GR4A 5G1TA 2ZRYA 4C6FA 3E2SA 2QCHA 3RM4A 2P5NA 5K7JA 2BS9A 4PL2A 1J0HA 3VIIA 1YRRA 4J35A 2WV8A 3PFMA 2FDSA 3HPZA 3NPXA 4OV9A 1PTAA 5AOUA 1BQCA 2ZZ5A 4OFCA 3L4XA 3VOJA 3E0WA 2NQHA 3QZEA 4E3VA 2XH2A 4GC4A 3NCOA 1ZCOA 2BOGX 4QEHA 1US0A 2QJNA 2VD8A 4TQTA 2IPWA 4KPLA 4QM1A 1AQHA 5I00A 1LDCA 3WQDA 2QJJA 3J7HA 3AJXA 1FWGC 1KC7A 1TV4A 4O10A 5HNRA 2O7QA 3THUA 1H7NA 3SURA 1KRBC 3VI2A 2WCGA 1PIIA 4IFKB 2O4QA 3IS4A 1AK5A 4IL0A 3WK2A 1Q6FA 3AROA 4LYRA 1EF2A 2A6LA 1TR1A 1OX4B 2CITA 1UD6A 1P4CA 1R9ZA 3SI9A 3SUVA 1A47A 2V6AA 4DPQA 4O28A 4ATLA 5I3FA 5C5YA 1R7OA 4M24A 1TQXA 3URQA 2QMJA 3LNPA 3OVRA 5F2IA 4GI9A 3PZVA 4XX6A 4S3DA 3VE9A 1HKJA 2BVWA 4ZOBA 2D3NA 2BBFA 3LZ3A 3BAYA 2W9MA 4NX0A 2OSXA 1JCJA 2W5FA 4GXWA 4J3TA 2I9UA 3VGDA 1G7UA 2GQAA 1OGGA 3LV5A 4M8UA 4QISA 1CLXA 4LYKA 4F48A 5IOBA 3CL6A 4H7CA 3UXAA 4WHBA 1VFUA 4Q7BA 1NF0A 5JVLA 3TNOA 4F9DA 3CH0A 2X41A 4GFIA 5E0CA 3OW1A 4AHOA 1XIMA 5IBXA 4EPEC 2WNQA 3PZMA 3S1VA 1H49A 3MMWA 2Y63A 1EFZA 5I03A 1VGAA 2Y5JA 3U0HA 4JIRA 4J3WA 4ZR8A 3ARYA 4GISA 3BAIA 2ZX9A 4GY1A 4OECA 3RPDA 2CLFA 1RAKA 3MI2A 4PH6A 3M4HA 2EHHA 3GC2A 4DVOA 5KSWA 2EF9A 1CXLA 3DECA 1Z89A 1A5KC 1GZJA 2DQWA 2VEGA 4B15A 3AJ7A 2OODA 1IF2A 2ZX8A 3PK7A 3QVQA 1V93A 3MUXA 4EXAA 3E49A 2A3BA 2I57A 1UASA 4KCUA 3QSRA 4Z1YA 4HSHA 4NZFA 1NM9A 4E4FA 2B81A 1EOKA 1OYAA 2VGFA 1K8CA 1DXFA 3VKDA 1TIWA 3PP7A 3SY8A 4PC8A 1OZMA 2QCFA 1MYRA 2WKLA 4MZYA 4NAFA 2JK2A 4ZENA 3RPTA 2V5CA 1KR0A 3VMPA 3IV8A 1KM2A 3DIPA 3WDHA 3W75A 4UXDA 5EKYA 9RUBA 4LS2A 1RA5A 4G8TA 1R2RA 3S1XA 3U5YA 3T40A 3PZOA 3NAVA 4RKAA 2HV5A 4E38A 3SUTA 4LPCA 3S9YA 1Q6GA 3N25A 2WZEA 1DJGA 4W9TA 1H1ZA 4JFVA 3D46A 3DC0A 3KRUA 3W1NA 2V9DA 4GUIA 2QJHA 4UBPC 3W24A 4BA0A 3KWXA 3BJSA 1XICA 3EWXA 1YDYA 3ZFHA 3PANA 7TIMA 1P6WA 1UD2A 1NQ6A 4HCDA 4GX9A 4GQ0A 2VGIA 3WJXA 3OLEA 3WDJA 4P5UA 3QY8A 1B3XA 3PC0A 4CCCA 1J6PA 4ADSA 3MUY1 1IT7A 3AZSA 1A53A 3MMDA 1QW7A 2CBJA 1AMYA 3TA6A 2OGJA 5CBBA 3KVKA 2INEA 3UGRA 5BXPA 1IEWA 2VUYA 3AIEA 2HE8A 3ARZA 2GJRA 1FHVA 3LGDA 4LVGA 1XG4A 1GYMA 4PCTA 4FXFA 1D7FA 1LOSA 2E77A 2VX6A 4MYAA 2OU4A 1GOMA 1M3UA 3MP5A 3VPLA 3N6QA 4MPQA 4MF4A 1B1YA 3G24A 3TU9A 1KTBA 1EPXA 3UXDA 4REQA 1LJYA 4QHRA 2ALDA 4Q8PA 4D6CA 4GQRA 4AIOA 4EPDC 4DWSC 4AX6A 3QXBA 4MYXA 1XBVA 3QY7A 2AL2A 3UR2A 1XLLA 4H8VA 3OG3A 2ADAA 3OLIA 3NYDA 3U8GA 3KWSA 2DP3A 1MQPA 2BB0A 3H7VA 1OFAA 1V6XA 3EWDA 4ZOCA 1UQYA 4UQAA 3T4CA 2PTZA 1O1HA 3MMUA 3VMOA 4TMBA 2Z7GA 2WC3A 2JF6A 1KKRA 2PP0A 1UR0A 3CWOX 5KZ6A 3AU2A 2J74A 1XYMA 5C2GA 3UJEA 4GG9A 3KL0A 5AY7A 1FWCC 1QWGA 4C6MA 3OP2A 2OOGA 1D2KA 3UJRA 3DKLA 1MWOA 1TMHA 4URIA 4MY1A 2PDCA 3HF3A 3TMQA 4DZIA 3LY0A 3BVJA 3RAOA 3U4AA 5IHRA 3KTSA 3ZLGA 3EWUA 4HYVA 4N2YA 4ZO7A 1TSIA 3CB3A 3W1PA 3NDOA 1RQBA 1K4GA 1MUWA 1A5LC 4KKXA 4MKSA 3B97A 3FEMA 4GUFA 3G0SA 5EBAA 1BWKA 4AXNA 3U57A 1R3RA 1WO2A 3W6MA 2O56A 4AIEA 3S5ZA 1EGMA 2W63A 4U2ZA 4J3VA 3SY5A 4NVTA 5AC5A 2EPLX 5IRPA 4G1KA 1VP5A 2DT2A 3CIXA 3WNLA 1W8GA 3M43A 1R3SA 3WNNA 4GIRA 1O60A 2OG9A 2AKZA 4UTTC 4KRTA 2C13A 4PUMA 1V0NA 3VUPA 3H6OA 3RN6A 1V79A 3GXPA 2Q6ZA 3WYZA 2JE8A 1JRBA 4PB5A 3VKBA 1TTPA 3P0WA 2J6VA 1B57A 2JKEA 3U2ZA 1VJSA 4IQDA 4PRWA 1FXPA 1WZLA 1HJQA 1XKJA 3LV6A 2OSWA 2D22A 2REQB 3HQPA 4GJ1A 1UZ4A 4KIEA 3UNDA 6ENLA 3VDAA 1Q6CA 2Y7GA 3G3MA 3TCEA 1JF5A 3V16A 3N17A 5LGXA 4HVXA 2FVLA 3NQGA 3PWGA 4EF9A 1XLMA 2NUYA 1LUCB 1PZ3A 1RQHA 4QAIA 2DSZA 1E1CB 3BW4A 4CD6A 4WY0F 1RQEA 1PVNA 4W89A 3L4ZA 4CNNA 3ABZA 1AJ2A 3N15A 4YN5A 1JYNA 3FKRA 3V7PA 1N82A 4WJEA 3R12A 2KZHA 4AC1X 1ONWA 3T2OA 3W3OA 4HNNA 2J13A 1R9XA 4LUYA 4GZIA 1BXNA 3CBWA 3SIMA 7REQA 3WLJA 1EDQA 4CU7A 2YB4A 4PMVA 3EDJA 2OLAA 2VQUA 3KX6A 3PTMA 3W53A 5CBJA 3K8LA 5T9BG 4IPLA 1O12A 1R3YA 1M65A 3WMLA 2PEVA 2DVTA 4W88A 4WDUA 2BXZA 3PN8A 3T9PA 3H2AA 2DZSA 1Q6RA 2H9AB 3A5FA 4FLQA 3TQVA 3IJQA 3A13A 1XGEA 5KITA 4IGHA 2E7FA 2QR6A 3GX9A 2F6UA 3N73A 5A8MA 1JPMA 5A8QA 2XIBA 2WANA 2ZWZA 4P7RA 3KCLA 1X98A 3HQOA 1XCWA 3JUGA 2G41A 5HUOA 2VWSA 1XL9A 1T0OA 4HN4A 3WO8A 3C2OA 5FJOA 1VBGA 4XK2A 3VK5A 3F4WA 4PUKA 5A5WA 1E0UA 3TSDA 4EK7A 4A8NA 1DTUA 2J24A 3OODA 4K8HA 2FH8A 2DUZA 5CQ1A 1MEWA 1UUOA 3CLMA 2YDAA 1WP6A 5EB8A 2QCDA 3M5VA 3QF0A 4JYEA 4CUCA 2PDBA 4TTUA 1E9ZB 1YPXA 4MDOA 5E5CA 3B4UA 5I7GA 3NTYA 3MCNA 4UR7A 5ABFB 4V2XA 4CVUA 2CFFA 1B90A 3FDKA 2VGGA 4OUEA 4UQBA 1HL2A 4UQ9A 5T9CE 3MT1A 1DWGM 4PRTA 4GNJA 1TKKA 1XCFA 1WA3A 2I17A 1A5NC 1EQCA 2PZ0A 1UR4A 1IXOA 1XC4A 1K8XA 4IQLA 4HPJA 4QJ5B 4OIFA 2D0FA 4M1RA 3S5YA 4ZMGA 3E12A 3P84A 3SUWA 1R3QA 1OF8A 1JUBA 1UR8A 4L7ZA 1JZ4A 2E25A 1M03A 3IJ7A 3REQA 3RITA 2WCAA 1OK6A 3KDNA 3T7VA 3IJ8A 1CGXA 1BTMA 1OCQA 1BXCA 2WZMA 3H2OA 5ENLA 3I3BA 3RK8A 1GT8A 5I2UA 3QYQA 4PCNA 2Z1VA 1XW8A 1QO2A 5I09A 2QIIA 3KL5A 3B04A 1YX1A 5FF2A 3CAWA 3B4YA 4G2DA 4R7WA 2WHJA 1LQ0A 1EEPA 1NWTA 3CIVA 1EEXA 3HG4A 3SQLA 1S2TA 2J62A 1Y7VA 1RA0A 1XUUA 3TAOA 4A8LA 2FTPA 3GXDA 3VKKA 4CQDA 5IDZA 1QFEA 4Q8VA 2FLIA 1ZAJA 3EOEA 2J9ZA 2WBKA 1UWQA 2P53A 3M16A 1VIWA 1LRQA 4O19A 4ORMA 1FCUA 5GNZA 3SCUA 3TLQA 3UA3A 3DESA 3ERPA 3S3GA 2UWFA 3W7OA 1ZHAA 1H0IA 1KLYA 3R58A 1EJSC 3KLLA 1LYXA 4LVBA 4ADUA 4PMUA 4Y9MA 2GJXA 2D0HA 5CLTA 5FCZA 3B0YA 1JCMP 2BGNE 1TG7A 2QJMA 4U3AA 4LRSA 3CTTA 4CN1A 2C1IA 1BRLB 1DQWA 3GFYA 4DJFC 2UZ9A 2QKFA 3G6LA 1I8JA 1GGOA 1YDNA 4EOUA 2OYMA 3M5ZA 2CLHA 2QAPA 5FEZA 4ICCX 4PTNA 1S3TC 2Q3OA 1EJVC 3T2QA 3SSJA 3PUOA 4F4RA 3B9AA 4US6A 1ITQA 1S2WA 6XIMA 5CJNA 1IE7C 4O1FA 4YHGA 4U3CA 2PWDA 4Z2GA 1K6AA 3PB0A 4WGXA 1I2RA 1EWEA 2QS8A 4N4PA 4IMAA 4GC3A 5B7YA 4JS3A 1UUMA 1KXHA 3HFYA 3KZPA 3MI3A 4XO7A 4YVXA 3BAWA 4E3TA 5D37A 3HGRA 4FB7A 4JICA 2P8CA 2UBPC 3GTNA 1XIEA 2TODA 2ZZ2A 3KRSA 1H50A 1GTEA 3V0TA 3PS7A 4Z17A 1A5AA 3BSGA 3A3XA 4D8LA 4C6OA 3W07A 1J0KA 4RNIA 3ITXA 2G0WA 3R0KA 3TV8A 2FZ8A 2WHKA 2PP3A 1V77A 4YLWA 4WCJA 3SCRA 3BV7A 4XBSA 1ECEA 4E2VA 1T40A 4HD5A 2QDDA 4DB7A 3EDDA 1YXYA 3VE7A 4HJWA 2GJPA 1JR1A 1G9HA 2OTDA 2WB5A 4MLRA 1GHRA 3C3NA 3TW7A 3PVFA 4GY7A 4XO6A 3V35A 1QNQA 4BK9A 1JD9A 3HTWA 3VD3A 4HN8A 4LNCA 5EGRA 3MHFA 1Y65A 4DHGA 5BXRA 1K8ZA 4UTIA 2J79A 4HHPA 3TWBA 2VDHA 4XAZA 5D9PA 1MFVA 1NDYA 4ROPA 2WXDM 1O94A 1NFBA 2VEFA 2QUUA 1XXXA 4ILSA 5AC6A 5AFDA 3MYPA 3C2EA 3CJPA 4H9UA 4E8DA 1QK2A 4H8UA 1HX0A 1HG3A 3LBOA 1QBBA 2VYOA 1Q8JA 1UHVA 4XKMA 2E5BA 4Q3MA 3EOLA 5EYWA 5DRCA 3NQ7A 5CPMA 3H55A 3HGSA 5LGZA 1FDZA 1V8EA 5JQ9A 5HXMA 3HA1A 1NQKA 4G7EA 4W87A 3LCIA 1XKYA 4RLIA 1HKVA 5D9MA 4J4KA 3RR4A 3CV6A 4Z1CA 5FOOA 4UZUA 1B5TA 4F40A 1X8CA 4C91A 3UWYA 3PZGA 1S5NA 1IT8A 3B06A 2HZGA 3N9SA 3CMFA 1DHPA 4HMEA 4EIVA 2ZZ6A 3S8HA 2GPTA 3FFSA 3LOTA 1BVZA 1YBQB 3GHSA 1NY1A 3FAWA 3BCDA 4Y96A 3K1GA 1RD6A 3BAXA 2VQTA 2OZ0A 4HPHA 1S3HA 1E4IA 2RH9A 4I3GA 5FI8A 4S2CA 3QGVA 3GTFA 2QQ6A 2QUNA 5L6UA 1RY0A 1UZDA 2F6KA 3W7LA 5DX7A 3UYIA 1T7LA 1PB0A 4M19A 2EG6A 3NIYA 1V02A 3CU2A 1E40A 2YLAA 4A3QA 1XLGA 4HA1A 3P74A 3DENA 4B3KA 3TTQA 4MWAC 1JI2A 3NQBA 4ZQPA 4WJ8A 4XAGA 3JRKA 3K30A 4JIHA 4O57A 4GNVA 4DUXA 4BFAA 3T0DA 1AQ0A 3O6DA 3CB8A 5C0QA 2V2HA 2QYGA 1PDZA 1VAHA 2QF7A 2PDHA 4AVNA 1OABA 2XDFA 4HSNA 3EAUA 1R3TA 4EPBC 4ZO9A 4JIQA 4FR6A 4IUGA 1I9CB 1W5NA 1JAKA 2WMGA 2QXWA 4XKYB 3C8FA 3U3HA 4NNCA 5BWAA 1TV8A 5A6BD 4MY8A 4J3XA 1P7TA 4PBGA 2CZVA 1E72M 3HO8A 4X3ZA 1QK0A 3SUUA 1BF2A 3KM8A 4OOUA 2IQTA 4WD0A 1JAEA 4JX5A 3H7RA 1W2PA 2JKPA 2FYMA 5AC8A 5DCDA 2ZUSA 3W1AA 2Z2UA 1TV3A 2ZXQA 3OOQA 4GZ7A 2BFGA 1CW2A 2ON3A 4WDWA 1JPHA 2Z26A 2ABBA 1XBZA 3G1RA 3PTQA 3G1DA 3QC3A 4EF8A 4W84A 3DFOA 4GD0A 2IXVA 4JNYA 5I6SA 2V81A 1TWDA 2RJHA 2NUXA 2VRKA 2B4GA 3M0ZA 2PDWA 3LHUA 1MDRA 3P7YA 1UKSA 3FN9A 4IXXA 2E9LA 4I9TA 5T91A 1BXBA 5JIWA 1JZ2A 5DFAA 2X8RA 2IKJA 4W85A 2YOCA 1QW8A 3TN6A 1WBJA 3WLQA 2HVMA 3FYPA 3DBNA 3DAQA 4BEQA 1MRAA 4YNGA 1TX2A 4Y2WA 3SN0A 2NX3A 5E0KA 1K9DA 3P62A 3QRHA 1VCVA 1MQQA 2PTWA 2WVUA 1IIHA 1EJXC 3IIPA 1NAL1 3ABOA 2EPMX 1B9BA 9XIMA 1E9IA 1XLJA 4IIHA 2AMGA 3I6RA 4IIFA 5BNKA 4UR8A 1JXKA 3NGFA 1CYGA 3M47A 2QVNA 1EOMA 1OZQA 1WAUA 1QI5A 1EHAA 3N9RA 1DTNA 1BWLA 1WOBA 2DZWA 3PZIA 4OU1A 3UETA 3QM3A 3V1PA 1DIEA 2JEQA 1AZ1A 3NL5A 1SMDA 2G3IA 1E6ZA 4XIMA 5G2IA 3HN3A 1H7XA 4AHQA 3FY1A