1A5SA

Crystal structure of wild-type tryptophan synthase complexed with 5-fluoroindole propanol phosphate and l-ser bound as amino acrylate to the beta site
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
266
structure length
258
Chain Sequence
ERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Loop closure and intersubunit communication in tryptophan synthase.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Complex (lyase/inhibitor)
molecule keywords TRYPTOPHAN SYNTHASE (ALPHA CHAIN)
total genus 98
structure length 258
sequence length 266
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 1998-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1a5sA00
3DFTA 2ZZ2A 1C9DA 2OZ0A 1FWRA 3LHZA 3N9SA 1P0NA 1VCVA 5F1UA 2R14A 2YSWA 3G1VA 1TTQA 3IVUA 1GQNA 1UBSA 3OVPA 1A5CA 3L67A 1EB3A 1ZHAA 2E68A 2NLIA 3HPZA 1NF7A 5FEZA 3SY5A 5DY3A 3T55A 1I2QA 4LY8A 1QWGA 3T44A 3MJYA 3IGXA 2GJNA 5A8GA 2DZVA 2WSRA 2VEIA 2WNQA 3L0NA 5D2VA 1TV5A 3KRUA 1LRQA 3KOFA 2BZNA 3MMTA 5EKYA 1TMHA 1A50A 4BK9A 3W1TA 3NL2A 2YR1A 3E96A 3DFOA 3W7NA 2ATSA 1YXCA 4WJEA 4JNMA 1QR7A 3TQ0A 3P8JA 1P1XA 2Y88A 1ICQA 2YFNA 1MZHA 4MIMA 3WJSA 1Z42A 4UFIA 1SO4A 5AFDA 3NXFA 4FNPA 4HSNA 3LI0A 1P4CA 3W2UA 4LV4A 2E77A 5LNSA 5KMYA 5SWUA 4K38A 3TUUA 2FJKA 3NA8A 5KTLA 5F2GA 5HINA 1Y0EA 3Q37A 4DXVA 1T96A 3G1DA 3HOJA 2NUWA 1JRCA 4TMCA 4FIRA 3IIVA 2FIQA 4RZ4A 4O4VA 4ZQNA 3SGZA 3W1QA 1X6UA 4Q33A 1YDOA 4AB4A 4IWWA 4IJBA 3PR2A 1QNVA 3TAKA 3S0CA 1KM3A 2CZFA 4CNPA 4E38A 4TR9A 3DFSA 3IGUA 4M7SA 5EY5A 4K6AA 1M7PA 4JX6A 3E9AA 4AXKA 1DBTA 3DI0A 3W1PA 3W7LA 2NX9A 1S5TA 4R33A 2C16A 3LDVA 2Y7DA 3CB8A 3BLFA 3NQFA 1A5BA 5DBUA 5F4SA 3W1MA 1GG1A 4R53A 3QRHA 1VQTA 4FO4A 1P5BA 3SR7A 3C8FA 1TJRA 3W1XA 1ZY9A 3Q58A 4Y8FA 1GVOA 4O1AA 1QDSA 3THQA 2OJPA 2ZYFA 2H3DA 3GKAA 5BW6A 3DKJA 1KTBA 4K36A 1DOSA 4YCPA 4NQ1A 1H63A 3QF0A 1QPOA 2ZA1A 2CLKA 2W79A 1EWEA 3RMJA 4DF0A 3P5ZA 2G5WA 3G3MA 3IGSA 3C6CA 2ISVA 3ELFA 4XBSA 3W07A 1WYIA 3A22A 4NJKA 1T8XA 1TPB1 3H53A 4WOZA 1C8VA 1VYPX 4NNBA 4CQ8A 1YYAA 1NAL1 1W5NA 3W7OA 4Z1BA 2J9XA 5AN7A 3MHUA 1TPVA 4XKYA 5KITA 5J5DA 5EBUA 2FFCA 3SW6A 3A24A 2DJXA 3WJWA 3P5YA 4HPJA 1YLVA 4QIUA 5F1VA 4LU0A 1KV8A 1GPWA 5EPDA 3U6WA 4UC5A 2ZQ0A 3RLVA 3PSWA 3HPXA 2ZRXA 2Y70A 3KX6A 4M5PA 3EB2A 2FPTA 1EWDA 4PL1A 2CLFA 4GUJA 3M47A 3MW7A 5IBXA 4OE7A 2PRLA 3ABQA 4EOUA 4YL2A 2B7QA 4YWIA 2QCMA 2VFIA 3PBWA 5CPLA 4LW7A 4FNRA 3GXPA 3DXIA 2QJGA 4QITA 1ZENA 2Q8ZA 3W85A 4O11A 2EPHA 4O13A 2CFFA 3FJLA 4IOTA 3G1AA 1VH7A 4N9BA 3NYZA 2BWGA 4JTTA 4PEKA 3RFAA 3A23A 2A7RA 1H50A 1OABA 2H90A 1KFBA 3TROA 1JJKA 3QQ1A 3L0KA 1LBFA 2JBMA 2ZZ7A 1GVFA 5KINA 3I68A 1R2TA 3O6YX 4MY9A 3AJXA 4FNSA 1W1ZA 1TYGA 3FKRA 5HJLA 3TSDA 3W7JA 1R2SA 4LC6A 4M7TA 4UIOA 2HS6A 1Q6RA 3UQNA 4DPPA 2GQAA 4AVFA 1TTJA 2WSYA 4BWLA 3EWUA 1CW2A 3SSJA 1R46A 3MHFA 4UMCA 4YLWA 1XM3A 4N9EA 5FF4A 1W3IA 3GAKA 2CLMA 4A21A 4C1KA 3SIZA 3CQ0A 2GQ9A 4Y96A 4OWGA 5HR6A 4MYAA 1OFRA 1NSJA 5D32A 5IBXC 3BARA 1OK6A 3CT7A 2TRSA 2ZFAA 4CCDA 1L9WA 2YCEA 3EWXA 4NZJA 1EP3A 3NQAA 3NQEA 2PRHA 3KVKA 3NEVA 3W2MA 4MY1A 2XN1A 5HWMA 1Q6QA 3MO7A 3C52A 4YCOA 4Z0SA 3QMTA 2OT1A 3BVJA 3W76A 2I9EA 4UXDA 3LCLA 4UNLA 2A6NA 1VHCA 4LUJA 4DO6A 4X9SA 1OJXA 3L5MA 3CEUA 1NEYA 1OFQA 1SZNA 3EWZA 3EX1A 3TKFA 5K4ZA 2GJLA 1JQXA 5J5RA 3EXTA 4JX4A 2BXVA 2B7PA 5E0KA 1FDJA 3M5YA 3PG8A 2A7PA 2ZZ3A 3NM3A 5KZDA 4GFSA 3DAQA 3P74A 2YDAA 3B03A 1W31A 4LS1A 3C2FA 3UD6A 1FWWA 1F73A 2QJHA 2P1FA 3NAVA 1EUAA 4AMAA 1PS9A 3NQ7A 3DHDA 3Q94A 3IIPA 1RQEA 1X7FA 2BTMA 3NO5A 1XUUA 2NX3A 1PL9A 4KWVA 4JD4A 3TH6A 2WJZA 4IUOA 3M43A 2WV8A 3NQCA 4NXKA 3VNDA 4BR1A 4N02A 1T0OA 4W9TA 3GB6A 3CIWA 1DORA 3M16A 2LLEA 2DP3A 4HN4A 3UNDA 3EX3A 4E2BA 3ANYA 5K9XA 1ZNNA 1UCWA 3UWYA 4A3UA 4O53A 4IXXA 3S1VA 2RDWA 2ZA3A 3O15A 5CPMA 4A29A 4A2RA 3BG5A 4MFDA 3KRSA 1JCNA 3JR2A 3R8RA 4IGHA 2G95A 1ME8A 1TV7A 4K39A 1RPXA 1ONRA 1TIMA 3ZWSA 1XUZA 4RK8A 3YPIA 3E12A 3IEBA 4UTHA 5C5YA 5F2MA 4LRTA 5CPNA 2TYSA 4UTKA 3MBDA 4WOQA 1GZGA 1GYLA 3NQDA 3NG3A 4KKXA 1F5ZA 4HNNA 3NR0A 1TPFA 3SGUA 3NZ1A 1I45A 1AW5A 4CQAA 5CG7A 3PC0A 3HF3A 3DGRA 5CZTA 4A22A 1W0MA 3ABOA 1OFEA 4UFJA 5CSSA 4MKNA 2H8XA 4QNEA 3S42A 3W70A 1G7VA 3P67A 1JUBA 1K03A 4P2VA 1VRDA 1MEHA 1PCKA 3G0SA 5HR7A 4K8HA 5L6UA 5D2WA 1OFDA 2ZTKA 4Y90A 1NFBA 3ZFHA 2FPVA 1W8SA 3HBLA 2GVLA 3BLIA 2CW6A 2FLIA 4WD0A 4JYEA 3CPRA 2H3BA 2WKJA 2A1YA 1VHNA 2OT0A 2QCGA 2W0UA 5FF0A 2C6QA 5DBTA 3W7CA 5FEWA 1KBIA 3KVMA 1T99A 3G8EA 4JY8A 3W74A 1TPC1 5H2ZA 2NXHA 3TV8A 4UTJA 1TREA 1SO6A 1OX4B 2W6RA 1ICPA 3EEGA 1TPUA 2VELA 4JDBA 1W56A 4FIQA 3S1UA 4DO5A 1MEWA 3NDOA 3T40A 4LUIA 3ATZA 3QJAA 2DZTA 4GE8A 3B05A 2QCNA 3B4UA 1BWLA 2J9YA 2A6LA 1TQXA 4X3ZA 1BEUA 1ME9A 2OMAA 1WA3A 5EL1A 2J9ZA 1L6WA 2PRMA 2JGYA 3NL3A 1BTMA 3PWAA 2JKAA 4O57A 1OFBA 3PVFA 3G1YA 4HNUA 5BRBA 2Y7GA 1WBJA 4M19A 4M6VA 1E51A 4XTIA 2I1OA 2VFHA 4XWUA 3BO9A 3KFTA 3W1RA 4IPIA 1YTKA 3OIXA 1OX5A 1WV2A 3EWWA 2E5BA 3HJZA 4UR8A 4EVZA 4JTUA 2TSYA 3L0GA 5DCBA 4UTTA 2Z6IA 1L6YA 3Q2DA 2JK2A 4QM1A 3NQGA 2EF9A 3KAOA 4DF2A 4ORMA 1FXQA 4N2YA 1JUKA 1TPEA 1Z41A 3LLDA 1EP2A 1MEIA 1R30A 2RH9A 1YADA 1RZMA 1DQXA 2Y7EA 4GUIA 2FB2A 1KM4A 2YW4A 1K02A 1DJQA 2HSAA 1U83A 3DH7A 1W5PA 3DFNA 1FDZA 4XBKA 3H54A 1FCVA 2V5BA 4UR7A 1HFBA 1F2JA 4ADUA 5EMUA 1ZFJA 3W1NA 4O19A 4KFOA 3O63A 2ABBA 5CSRA 3W75A 1XXXA 2XN2A 4FX8A 2VXNA 2X1RA 1FDYA 5IM51 3MBFA 1OX6A 2WQPA 4O28A 1YDNA 2NZLA 3ZWTA 3O06A 5DXXA 1R2RA 4TU1A 1FX6A 1JRBA 1XCFA 1ZAHA 3LERA 1GJPA 3M1ZA 3N9RA 4LS2A 3W7QA 4JTKA 5K9CA 1ZAIA 3UWWA 4JICA 1A5SA 1OFPA 2F7FA 3W2NA 1QPQA 1WOAA 1LOSA 5D04C 3I65A 2NUYA 2DJLA 4OHQA 5HUPA 1GWJA 5LKYA 4PC8A 3MHGA 2EGZA 2CLLA 2Y63A 1SQ7A 4GJ1A 4B5NA 2ZBTA 1B4EA 2I14A 3BK0A 5FF2A 1IIGA 2E6YA 1VCFA 2ZRUA 4DO4A 1DQWA 4JEQA 2RFGA 1O95A 2A85A 4ZQPA 4ZMGA 3BG3A 5KZMA 1B3OA 4P61A 1QCWA 4UCGA 2Y61A 3OBKA 1MSSA 4RZ5A 3G0UA 4QSHA 4FNQA 3OEXA 3MI6A 5AYYA 1SO3A 2B4GA 4GBUA 5HWJA 3PY2A 4WX2A 3W84A 3U2OA 5DCEA 1SW7A 3DBPA 3CEPA 3F1QA 3BLEA 2JKPA 4LWWA 4M6PA 3TX9A 5HNRA 1WX0A 3NL5A 2GQ8A 1VR6A 1VGAA 1AG1O 3T78A 2Z6JA 4JYDA 3TA6A 3W7KA 3PG9A 5FI8A 1ML1A 2QUUA 3HO8A 5F4XA 1IXPA 3PB0A 1YPIA 3QFEA 3WK1A 2BLEA 2VFGA 1UJPA 4DQWA 2C18A 5KZEA 3IIOA 3MP4A 4O8RA 1OYAA 4BI6A 3W73A 4LVAA 4LVBA 1JULA 3IIZA 1TRIA 3PBVA 1JUEA 3HG4A 2V82A 3S5YA 1GOXA 3B06A 2DZWA 1DVJA 4ZQCA 1H7PA 4LRSA 2QCFA 4XUGA 5F2IA 2Y6ZA 2C15A 4L4MA 2ZRZA 1FY6A 1LTDA 4WZHA 4UTMA 2GPTA 3EKLA 1TRDA 3W7RA 1ICSA 2JKEA 3R2GA 1OFOA 4ADTA 1LLZA 3MI3A 1W5OA 3TFXA 1B57A 3DENA 1DL3A 1VCGA 1RQHA 3QC3A 3TSMA 1UASA 1GEQA 3A5FA 2ZCGA 4DBEA 3G1XA 4S1FA 4O17A 1SFJA 2FB3A 2WNZA 1KV5A 3A5VA 5CZJA 1Q45A 1O5XA 3NZRA 5DY2A 1A53A 5EA9A 4LVDA 4UMAA 1MO0A 3VKJA 4OU1A 5EYWA 3GDTA 1SZFA 5AC7A 4N9DA 4HPXA 1F6KA 3VE7A 3EXSA 4UTWC 2QAPA 3NPXA 1KTNA 3S6DA 1N55A 3C0JA 5G5IA 1VPXA 3O05A 3GDLA 1GTHA 3TDFA 3K30A 4NZFA 2YXGA 1G67A 2FDSA 4ONVA 1S3HA 3ATYA 3P61A 1HO4A 5HMSA 5I3GA 3THAA 4JTEA 2Q8LA 1FCQA 2QCHA 1K7XA 3LBMA 3S5ZA 2A7NA 3TJXA 1WQ5A 3DI1A 1FXPA 1Q6OA 3QZEA 5K2ZA 2KZHA 3NQMA 1ZALA 3LHUA 1TB3A 4CNOA 2PC4A 4ADSA 3DFPA 3M41A 3G8RA 3M5VA 5AHMA 5I3FA 4R7JA 2YZRA 3B0UX 1OFAA 1PHWA 1I2PA 1OVDA 3FFSA 2WPBA 1OF6A 3LOTA 4NXSA 5D09A 1FCBA 2ZRYA 4C1LA 4PA8A 3TC7A 2B0MA 5HUOA 4O14A 2ZZ6A 3P80A 3CIXA 4MJMA 3H55A 1DKWA 1JR1A 3C56A 2R8WA 4Q32A 4UFHA 5FF7A 4WXZA 1KM6A 5LHFA 3GKFA 3NQ2A 3QQ0A 1WXJA 5DXYA 3CWOX 3C4UA 2CZ5A 1OHLA 4AHQA 1H7XA 1QFEA 4CNNA 2NXGA 1I2NA 4KFPA 2NV1A 4O1CA 3WK0A 1SZEA 3TQKA 1G7UA 3M5ZA 2X1SA 2TPSA 3TJLA 5LZLA 1MXSA 4RV8A 3W1LA 1SW0A 3LCWA 2E6DA 4MZYA 3KHJA 3C2OA 4LVGA 4UMBA 4O54A 3DHFA 2CLEA 4WY0F 1O60A 1A5AA 2Z1BA 3VCRA 3NPWA 4ZVJA 3W9ZA 1H61A 3WK2A 2YW3A 5HWNA 5T26A 4LNYA 1RV8A 4JDYA 4FX6M 4FEZA 5LNUA 4AWSA 1FWTA 3FOKA 3TR2A 3QH2A 5D37A 1O4UA 1YPFA 2NWSA 3LV5A 3GR8A 3BW3A 4HHPA 1UUOA 4PH6A 4K7VA 3N2MA 4JN6A 2J6XA 1TSIA 5D30A 2V81A 2ATMA 4GC4A 2C3ZA 2QCEA 4GUHA 5AHLA 4FXSA 3QYQA 1KFCA 2ZZ4A 1M7OA 1VZWA 1W3TA 3PBUA 1H62A 3NQ6A 4MPQA 4K7YA 1EA0A 4NJJA 5CZ0A 3JS3A 1LM1A 3RK8A 3L2IA 5LHEA 3A9IA 5FF3A 2G96A 1ALDA 2CWNA 4M6QA 1G69A 5E1QA 1DHPA 4MOZA 3T7VA 2CLOA 1TPDA 3TU9A 4DELA 4EF8A 4FHAA 3CWNA 4LTSA 1K7FA 3TXZA 4ZQMA 2RKXA 3I7SA 5D2XA 3F4NA 4OQVA 4RX0A 1IXNA 1X1ZA 4AWTA 2H6RA 1C29A 1K3UA 1O5KA 5BMWA 4MZ8A 4TO8A 3MYOA 3RF9A 1AMKA 3GK0A 1V5XA 2NUXA 3U8GA 1UB3A 4ZQRA 1JCMP 5G2HA 1JCYA 3BGJA 4R34A 3S5NA 5G1TA 4ICNA 3PAJA 1W5QA 3ZS4A 4LT9A 2O7QA 3SECA 3P7YA 1OG0A 3LHVA 3R12A 4OV4A 4OBTA 1GVRA 3FS2A 3W1UA 1EX5A 4HKPA 3TFCA 1QOQA 4UTTC 2IQTA 2YPIA 2QDGA 4Z1AA 5I3HA 4MLJA 3W2JA 5LNVA 2VOMA 3W7PA 1EIXA 3FYPA 1LROA 2DZUA 1W54A 3JRKA 2V0TA 4IX2A 5D2YA 1PV8A 2QJIA 4JXCA 1HG3A 1I8JA 4UUIA 4WY0B 1VS1A 1GVQA 5AC8A 1W3NA 1SZGA 4UTIA 3TC6A 4EWND 3GNDA 1KLZA 3TIMA 2G97A 1EP1A 5G4WA 4KWWA 3LXCA 3DFQA 3E0IA 3TMQA 3D0CA 5AYXA 3MP5A 3STEA 3UXAA 1D3GA 1KFEA 1GTEA 3PULA 2QF7A 1SO5A 1TCDA 1KM2A 4S2BA 2ABAA 1XBXA 3BV4A 1FWNA 5CKSA 1KA9F 3TXVA 1LBMA 5H91A 1AL8A 1M5WA 3N19B 1VJIA 1VYSX 5K9DA 3TNOA 1WAUA 3CTLA 2CU0A 1AL7A 4NX5A 1TTPA 3CM4A 1PHQA 2J24A 1Z48A 5GVJA 4FB7A 2CZEA 2E6FA 2QR6A 3R13A 4FNUA 3QPYA 3W23A 4JTJA 1ME7A 2QEZA 3WJZA 1IGSA 1XBYA 4XQ6A 5I3IA 1G4PA 4RCXA 3W86A 1TV8A 1JQVA 2YGYA 5LGZA 1XFBA 2QUTA 4CLMA 3O16A 2X1TA 5G1YA 4O50A 3W83A 4DBDA 2VFFA 2B7NA 3A21A 4NUWA 1FBAA 3EWBX 1H60A 3G1SA 3W7EA 5DCDA 1IIHA 4UFLA 1SU5A 5FEXA 1XC4A 4JTHA 3SJ3A 1VYRA 5I3JA 5C2XA 1AK5A 1KW1A 2FTPA 3M6YA 4NVTA 1K7EA 5U7SA 2GUUA 3P81A 1SPQA 3P8IA 3P84A 1EEPA 2YX0A 2X2GA 1Q6LA 1PVNA 1XDMA 1H51A 3L9CA 1XKYA 1YDVA 3W72A 3KVLA 2DU2A 3TCEA 4NNAA 3UWVA 1Q3NA 3RLUA 3LCGA 1JCLA 2WSQA 4OV9A 4UFMA 2C0AA 1ZAJA 3TE9A 4JR5A 2V30A 3GDRA 3WK3A 1J2WA 1F74A 5TIMA 3S9YA 1NVMA 4MUZA 5K4XA 5KSWA 3LCHA 4AH7A 4Q4KA 1SW3A 1YXDA 4QNWA 4AHOA 3O1NA 4JGDA 4DPQA 3QW4B 3HPSA 3GXTA 1G4EA 1UUMA 1N7KA 5TQLA 1LZOA 3LRMA 2GOUA 3PUDA 3HG3A 2E6AA 1G6CA 1KFJA 5D03A 4NNCA 3WJXA 5C6MA 2B7OA 4I7WA 2XFWA 5LNRA 4UTWA 2ZRWA 4FXRA 1G4TA 1YTEA 2WO5A 2AQWA 4BI5A 2Y89A 5BNKA 5AC6A 4GNJA 1SR9A 1LBLA 1H5YA 1Z44A 2FPYA 1K8YA 4TMBA 3TK7A 5CPOA 3L5AA 2EKCA 2WNNA 2OCZA 4LV9A 4IX0A 5MHBA 4PL2A 1H7OA 3PSVA 3NL6A 4K37A 4Z0JA 1QO2A 3HG5A 1OYCA 4GUFA 2ALDA 3PUEA 1GT8A 3EXRA 4NU7A 2ZZ5A 2J88A 4CCEA 4CQ9A 4MLRA 4RXFA 3W6YA 4HNTA 3LTSA 3W71A 3W7HA 2ZTJA 3FKKA 1U5JA 1FUYA 4YXGA 3GNNA 4UNKA 2J27A 1I2RA 1W37A 2RDUA 4I9AA 3GVGA 4OT7A 3NQVA 2Y85A 3NNTA 4N6EA 3QPZA 4GXMA 4MZ1A 4I7VA 3T4CA 1PIIA 2CZDA 3LHTA 2VEMA 3MYPA 1KM5A 1VLIA 3BW4A 4PTNA 3O6DA 4U28A 2Z0IA 4JTSA 3RU6A 5G4EA 1LRTA 3LHYA 3UPWA 4UTLA 5E93A 3LTPA 4QQ3A 3BGGA 3W2KA 5C54A 2CLHA 4N6FA 4GUGA 1JVNA 4TIMA 1CX9A 3O8AA 3F4WA 1OF8A 1QPNA 4ZZ9A 5BOOA 2A2IA 1JCJA 3LGEA 4LOCA 4E0CA 2CLIA 2D73A 3FIGA 4AAJA 1KM0A 3ABSA 3S1XA 2QCLA 3UY7A 1FCUA 3QEZA 2C19A 3G1HA 4ALDA 1TPH1 4H6KA 2E1DA 1H1ZA 4HSOA 3R89A 3G24A 4AF0B 1S5WA 1DJNA 3LXBA 1AW2A 3PF3A 4XZ9A 5F2LA 1CI1A 4J9JA 2NXIA 4RKAA 2H8ZA 4S2CA 2ISWA 3PS7A 3C3NA 1QMLA 1PE1A 4Y6GA 2BSLA 5LGXA 3OHIA 4O10A 1X1OA 1YXYA 3LRKA 3O6CA 3OVRA 2HS8A 4UTUA 2X1UA 5AHIA 4D2JA 1XL9A 3LX9A 1OX4A 1SSDA 5D2TA 2DZSA 1OK4A 3W7MA 4BFAA 3QSRA 2ZDRA 3FEMA 3P60A 3HGOA 2QCDA 3G18A 2E09A 5D05A 1KTCA 4AF0A 4WXYA 4O1DA 2X16A 3G1FA 4LVFA 3IIXA 1LLWA 3TMLA 4IMFA 3SZ8A 4MY8A 1EUNA 1OYBA 3OVQA 1G4SA 3HGJA 3NVTA 4JIPA 2EHHA 3EX6A 1KFKA 1WOBA 2O7SA 3DZ1A 3TAOA 2VC6A 3QMRA 2QDHA 4ML9A 3LV6A 2R91A 4CCCA 4O15A 2BX7A 3LBCA 3SFKA 2PCQA 4O52A 4Z08A 1SUXA 3LRLA 4DF1A 1H7WA 3KVJA 2Y62A 3HGRA 4XKYB 3GAYA 2GVJA 4MVAA 4I7UA 4X22A 2NV2A 4A2SA 4RLIA 4UFKA 3MUXA 5D38A 5L9FA 3NPVA 1HUVA 2DZPA 2RDTA 5LSMA 2ZA2A 4MFEA 2HTMA 3LHWA 2GVGA 3OA3A 3EWYA 3DKLA 5G2IA 4JX5A 3WFAA 1QO5A 2XN0A 3QW3A 1HTIA 3AO0A 2P0OA 6ALDA 3W7DA 1RR2A 3HGSA 1R47A 1F6PA 3TSBA 4IXHA 3PM6A 3LCXA 4MYXA 3HQ1A 3W7GA 1F7BA 4RZ6A 1XDLA 4IMGA 2E5CA 3VI2A 3GXNA 1RQBA 4RR4A 3STCA 3L68A 5U4NA 4FF7A 4WUIA 3W2LA 1VLWA 3P62A 1KBJA 1RVGA 3QMSA 3UWQA 1GVSA 3TW6A 1J4EA 3LXAA 1D9EA 3LM7A 4DEFA 1O94A 2E5DA 5K7JA 4H3DA 4JYFA 3HMJG 4E2DA 4JTGA 3CHVA 3UXDA 4HNVA 1TJPA 2R94A 1B4KA 2VEPA 2UV8G 1IXOA 4BI7A 4NJIA 1L2UA 2Y7FA 4POCA 3INPA 3N34A 4O4WA 1X8FA 4AHPA 1H7NA 3M7WA 2PURA 2QAFA 1FWSA 1L6SA 3R5EA 4RXGA 3KRZA 4AEOA 5FESA 2NWRA 1WBHA 3B0PA 3M44A 3C61A 4PODA 4GWEA 1KFLA 4EF9A 1BKSA 4N9CA 1IF2A 5AOUA 3M0ZA 3STFA 4LS0A 1K8ZA 3MI2A 4QAIA 3B04A 5D02A 2YFOA 3NOEA 4GRSA 2JGQA 4NJGA 3W3OA 3CU2A 1LORA 4FX7A 1LYXA 4AWUA 3QM3A 3GLCA 2ZZ1A 3EX2A 3I6RA 5FEPA 6TIMA 3UZ5A 3LCFA 2HMCA 3ZR4A 5DLCA 3GDMA 1H7RA 2Q3RA 4MJZA 5CZSA 3BPWA 3UWUA 3F03K 5D33A 1TQJA 3IRDA 5A5WA 2A5HA 3PBYA 3LLFA 1HL2A 4NX0A 1LOLA 1YTDA 3GR7A 4WY0A 1LOQA 5HQEA 3IVSA 4G1KA 3HB9A 3W1AA 3MP3A 1HO1A 1F76A 5AB3A 4HIBA 2DORA 5K3VA 4O18A 3USBA 8TIMA 1QAPA 3PB2A 5DN1A 4ORIA 3UYCA 3C2EA 4TX9A 2ZRVA 2AGKA 3G22A 2QCDB 1W5MA 4IMCA 4FNTA 3S1WA 4JTIA 3B8DA 4OGZA 3LCIA 2FQIA 1S5VA 1TO3A 5F4WA 1RD5A 2VFDA 2RHGA 1XBVA 2WOQA 3C2RA 3N14A 4JIQA 3W22A 4KFNA 1LDCA 3G3DA 1BWKA 5AHEA 2C1HA 3LB0A 3FYOA 2ISSA 4ZQOA 3S8HA 2P10A 4LC8A 3ABRA 4O12A 1I4NA 1PCWA 3B0VC 4YMZA 4QISA 2AAMA 4HT3A 1TPWA 4WQ6A 1DV7A 3W87A 3V75A 2QKFA 3IV3A 3O07A 1H1YA 3RNDA 1IXQA 4IMEA 3V1PA 2Z2UA 3EKZA 3GZ3A 2A21A 1EPXA 1XBZA 3KXQA 2V2CA 1LRNA 2NX1A 3N73A 3L65A 2V2HA 4JTLA 1M6JA 1I2OA 2A4AA 3HIJA 2YYUA 3TQVA 1QOPA 5HULA 1V7YA 4BWLC 2VFEA 3N3MA 4N4QA 1ZCOA 1B9BA 1GYNA 3S5OA 3MWAA 5I3KA 1N8FA 1SFLA 4O16A 3L21A 4JS3A 4EIVA 2VKZG 2F84A 2V2DA 4BF9A 3VFLA 2PE4A 3HG2A 4NJHA 4JTFA 1AW1A 2QCCA 3L5LA 5DELA 3STGA 3NM1A 4O1BA 5AYZA 2V5LA 4RJEA 3LI1A 3I7RA 3GIYA 3PUOA 2X30A 3G0XA 3L66A 2Q3OA 3M9YA 3UZJA 5C55A 4NT0A 3CC1A 3UPBA 3WJYA 2V9DA 5AHNA 2OX1A 3I7QA 2VENA 3E49A 4O0KA 5LNWA 1J5TA 3FLUA 3SI9A 1ZJIA 1F05A 3C2VA 7TIMA 3BW2A 2C14A 3E02A 2DZXA 3QSTA 3NPUA 1GG0A 2TMDA 4IPJA 1JCXA 3UWZA 1QPRA 1K8XA 2A0NA 4O0ZA 1TTIA 1LP6A 4IQLA 2QUVA 2C13A 3P82A 4N4PA 4L4LA 4U4MA 1WDWA 4K8EA 4PFMA 3FJ6A 1XI3A 4Y9AA 4JY9A 4Z1DA 1KLYA 3W88A 3FA5A 3DU0A 3GDKA 2VEKA 4XTDA 3NGJA 3OG3A 5G2WA 3NQ8A 3BG9A 3TW7A 4PCFA 3IVTA 1FQ0A 4X2RA 1D3HA 3VE9A 5BMXA 1ADOA 2YYTA 2EAWA 4QJ1A 2V8ZA 1P0KA 4IMDA 3UY8A 5ABTA 5TBOA 3CLMA 3N2XA 5AHFA 1LCOA 3GX9A 4H4IA 1KM1A 3EX4A 3LTYA 3W7IA 1NF0A 4ZL1A 1SSGA 1VC4A 3GYEA 4Z1CA 5CGQA 3M5XA 1THFD
chains in the Genus database with same CATH superfamily
3M0JA 4ZA0A 1C9DA 4C91A 3SUUA 1O5RA 1OC6A 5F1UA 2YSWA 2G3JA 2XM2A 1UBSA 3PZ9A 1E4IA 3L23A 3T0AA 1DJHA 1QBBA 2E68A 3HPZA 1J12A 5FEZA 3WQOA 3B8TA 4BF5A 1JIBA 2PPGA 4GZIA 1VEOA 2XGZA 3P0XA 1QWGA 3IGXA 3VO0A 2VEIA 3VKCA 3KRUA 1PZ3A 1W1VA 1LRQA 1XH1A 2BZNA 1A50A 5HMDA 2YR1A 1BGAA 3FA4A 1K6WA 1RAKA 4X61A 2YFNA 4B3KA 1CPUA 4MIMA 1E6XM 5JIPA 1P4CA 3AYSA 1F3EA 1H11A 4J3ZA 1K6AA 2PWDA 5KTLA 3MZNA 4OOZA 2Z27A 3IV8A 1BF6A 3E5BA 1UA7A 4FIRA 1GEHA 1XYLA 1JFXA 3W1QA 1YDOA 3S6TA 3TAKA 1QNPA 3NZPA 4E38A 3DFSA 3WQWA 1DQUA 2CKSA 4M7SA 4WKHA 1P0EA 3W28A 1BHGA 4JX6A 4W4QA 3E9AA 3DI0A 2Y7DA 2O9TA 3NQFA 5F4SA 5HPOA 3AS2A 4KQNA 3GBDA 3UVAA 2J8FA 3SR7A 3ITOA 5JIWA 3NSMA 2BVTA 4Y8FA 2C71A 2PA6A 2ZYFA 4K1GA 3GKAA 5BW6A 3TN5A 1ZGDA 1KTBA 5CPTA 1SM9A 3MSYA 4NQ1A 2QMKA 4PUMA 1QPOA 4C60A 2OYLA 1TIWA 2J7EA 5CSUA 3FHAA 5C9WA 2IUZA 3VIOA 3P5ZA 3IGSA 2Q71A 3C6CA 1Q6CA 4GY0A 2ISVA 5A6BA 3A9BA 2J8GA 1G1YA 3VIJA 2FZMA 3VU2A 3VDBA 4JZ5A 1C8VA 3W27A 2DSWA 1W5NA 4Z1BA 2J9XA 1IWAA 2PMQA 3MHUA 5KITA 3USZA 5J5DA 3U5UA 4W5ZA 4BJHA 2F6KA 4A4AA 3BSHA 3P5YA 1UKPA 1YLVA 3K46A 4QIUA 1FH8A 3RN6A 6REQA 5EPDA 5C2GA 4FLQA 2ZQ0A 2HK0A 4IIBA 2Y70A 3TYDA 1WE5A 2GVEA 3BTNA 2XZ7A 4C1NB 2VZUA 2PRLA 1TG7A 2WBGA 5CBIA 1NTHA 3VD3A 2PDCA 4YWIA 7REQB 2QCMA 5CPLA 4FNRA 1L2QA 3RPDA 2QJGA 1X6NA 2IKHA 4DRSA 3A3HA 4UB9A 2QNEA 2P8CA 2IKIA 2EPHA 3WMCA 2Z1KA 4V15A 5FA5A 2ZUWA 5FJIA 4N9BA 1O12A 4PEKA 2J62A 2INFA 3RX2A 4GXWA 3B9AA 3U2ZA 2DZAA 2ZZ7A 1ZJBA 1MXGA 4XSLA 5LIYX 3I68A 3L4TA 3VM5A 4MY9A 4JCMA 2EG7A 4IIFA 1W1ZA 3WQDA 2YA2A 3DG3A 2BVYA 2BP1A 3OYXA 4DPPA 1XW8A 1TTJA 2WSYA 1R46A 3H24A 4YLWA 1XM3A 4N9EA 4QDWA 4A21A 4C1KA 3SIZA 4Y96A 1OFRA 3GTHA 5D32A 2O56A 1T6MA 1U22A 3AU6A 3CUGA 2J7CA 2WMFA 3CH0A 4Z2IA 4NZJA 3BUVA 2X41A 3NEVA 3W29A 2GJXA 3BCDA 4MY1A 2JEPA 5HWMA 1Q6QA 3C52A 1JD9A 4Z0SA 2EPNA 2AAAA 2JF7A 1VEPA 2DSVA 5XINA 3WLMA 5CH9A 3KZSA 1OJXA 3CEUA 5M1TA 3WLSA 1SZNA 1EGMA 3EWZA 3QHNA 3L4UA 4Q22A 1PPIA 2ZX5A 3TKFA 3UJFA 2GQ3A 5K4ZA 3MVIA 1PXGA 2J8TA 3RDKA 1TJ2A 3WNMA 2B7PA 1ISZA 3GUWA 4JL1A 4YTSA 2A7PA 2CESA 3NM3A 3DAQA 3P74A 2YDAA 3B0XA 2WAGA 3C2FA 1CXKA 5GJMA 2QJHA 3NAVA 3VC5A 1I1XA 1PS9A 3Q94A 3IIPA 5JH1A 1RQEA 1X7FA 2NX3A 1OINA 1PL9A 3TH6A 2WLZA 4F2UA 1A0CA 3TTEA 3M43A 5I5RA 2BY1A 3AWOA 2ODOA 2W9MA 4D6EA 4W9TA 3GG7A 3CIWA 2YDSA 5EU9A 5JQ9A 3H2OA 4IZGA 4PTDA 1LUCA 4S3EA 3DYOA 1QHOA 3B8VA 3CIVA 1KXVA 5K9XA 4AZ6A 3MO4A 1E6SM 5AVHA 3QGAC 3F4DA 4GYFA 3PPFA 2VD8A 2ZA3A 1LG2A 3ABZA 1ZTVA 1SYTA 5LA1A 1VBRA 2DT1A 1UWTA 1J5SA 3PNUA 1Q2RA 3O0KA 1A80A 3E2QA 4QE5A 2XSXA 2W27A 1BRLA 2VRKA 1JI1A 3SUSA 3ALGA 4AG0A 1XDJA 4AD3A 5C5YA 1MDRA 5CPNA 2W5FA 1A0EA 1AQHA 1F4HA 3VZZA 4MB1A 4B3LA 1LUCB 4YWSA 3NG3A 3HFYA 4J3WA 4CQAA 3SGGA 2G41A 3NYDA 1A5MC 1XLMA 1W8GA 4QNEA 2PDIA 2DVTA 2WJDA 1VRDA 4U2YA 4F8XA 5HPCA 1GOQA 1P0DA 3U4FA 1QT1A 1XIEA 1EOKA 5L6UA 4P7LA 2OLAA 1OFDA 1A3WA 2E8ZA 3BXWA 2CW6A 2PAJA 4JYEA 3QYSA 1U5VA 1US2A 1ZCCA 2BXYA 3B0YA 1VHNA 2OT0A 3L7RA 2W0UA 1BTCA 1ELSA 1EGVA 3W38A 2YKKA 3KVMA 1T99A 1Z3NA 1TJ1A 4JY8A 3W74A 1BG9A 3QV7A 1POKA 7TAAA 2FVMA 3R7MA 2NXHA 4MM1A 1SGJA 3TV8A 1TREA 4GQQA 2W6RA 3EEGA 3WDJA 1TPUA 2ACQA 1W56A 2WSPA 4XG1A 5FJUA 2WHLA 2VZTA 1MEWA 3QKEA 4FK9A 5FAJA 4C6OA 1JPMA 2DZTA 3IRSA 4ZOBA 1E5NA 3VABA 1V6XA 4D6CA 4OBRA 3T2QA 1UG6A 1TQXA 1AVAA 3TZFA 4EXQA 2OMAA 5EL1A 2WM1A 2J79A 3NL3A 1RY0A 1BTMA 1TMQA 2JIWA 2J7HA 2JKAA 2J7DA 1KRAC 2FZ9A 3CHFA 1WBJA 4M19A 4M1RA 3KUMA 4NZCA 2I1OA 3QHOA 3WBXA 4XVDA 4MWAA 1EBGA 3I4KA 2ONEA 3EWWA 1DIOA 3PAOA 1FWBC 2X0SA 2TAAA 4B9YA 3H70A 1VENA 5DCBA 1HKJA 1PTAA 4GLEA 1L6YA 3NQGA 4PRWA 2ANUA 1NOUA 2AQOA 4HD5A 1WCGA 4ORMA 4N2YA 1KRMA 1TPEA 2WYSA 1JCTA 1YADA 4Y2WA 2PZ0A 4GUIA 4GVFA 2FB2A 4C6QA 1KM4A 1LT7A 1DJQA 2HSAA 1W5PA 4A8NA 2P5NA 1KR0A 4UR7A 2QT3A 4ADUA 1ZFJA 4YTRA 1PZ0A 1UR1A 1G01A 4HJFA 3S2LA 5CSRA 1EO5A 1CXEA 2EQDA 1XXXA 1EJWC 2YL5A 2EPMX 3CL7A 3T81A 3PWGA 2WWDA 4OJYA 1FDYA 2PDWA 3PTQA 1VPQA 2DFAA 3T2PA 5MKGB 1FX6A 3VMPA 3ZZ1A 3M0IA 1ZAHA 3LERA 4MWAB 1EC8A 3M1ZA 2GFTA 2UY2A 4L56A 3IANA 3KLKA 3UWWA 4JICA 2F7FA 3LENA 4KEUA 4F0MA 5LA0A 3I65A 5IHRA 5CAHA 3K4AA 3MHGA 2EGZA 4MJ4A 2WVVA 4JCLA 1OIMA 4GJ1A 3BK0A 5FF2A 3ZJ8A 3QR1A 2WVVB 1HVQA 1VCFA 2GK1B 4JEQA 3IAQA 5EBAA 4ZQPA 1B3OA 1QCWA 1W9PA 1J0IA 3CUJA 2Y61A 4RZ5A 3G0UA 1RVKA 4IM4A 5AYYA 4TVCA 4GBUA 5HWJA 5A6BD 4A35A 1PYMA 3DBPA 5FJRA 3RR1A 3WQVA 2JKPA 5JBDA 2VCBA 3UG3A 1WX0A 1ISWA 3NL5A 1VGAA 1AG1O 4JYDA 3TA6A 3W7KA 3PG9A 1HJQA 4QX4A 2VEFA 1HJWA 3V5FA 4B2DD 1YE4A 3WLRA 1IXPA 3PB0A 3ZVHB 1CYGA 1A4LA 5KZEA 1PDYA 4BI6A 5CPQA 4LVBA 1TE6A 1JUEA 1XX1A 1GPFA 4CVWA 1V0MA 1VFHA 5E70A 2XFFA 3I10A 1J0HA 1HGYA 1SJCA 4UTMA 2GPTA 3EKLA 4JNZA 3R2GA 2PBOA 3WQ8A 1LLZA 4XZHA 3MI3A 1W5OA 1UWQA 3TFXA 2I5QA 3DENA 3UA3A 5JXQA 4GOAA 1DL3A 4J3UA 3RJYA 3WD3A 3HFTA 5DT5A 5A95A 3CGTA 2ZCGA 3E0LA 3U9IA 2QVNA 5DMLA 2VI0A 5I7GA 4A8IA 2JALA 1O5XA 5EA9A 4XD5A 4DJED 1HW6A 1M53A 3RRAA 2Z25A 3VKJA 5EYWA 3N17A 3RPTA 4X9YA 4HPXA 1F6KA 4I8DA 3IUIA 1OD8A 4NL1A 1N55A 5G5IA 1VPXA 1UA3A 3V0TA 4QG8A 4R9OA 3CO4A 2VUYA 3UETA 3SO7A 5FJOA 3KBWA 1NJJA 3C8NA 2VURA 5HMSA 1ESWA 3THAA 3GUGA 4D1IA 2PLJA 4OOUA 2QCHA 3AHXA 2A7NA 4Y7EA 1MW3A 3UEQA 1WQ5A 3DI1A 2QYGA 3N3TA 1SMDA 1GOWA 3G6LA 3AXXA 2Y5EA 3NQMA 4RE0A 2VYOA 2WNWA 1TB3A 1CLKA 1E0XA 2PC4A 4IFKA 3TJIA 1MMFA 3B0UX 1OFAA 1PHWA 2DT0A 1LL7A 2I16A 2FKPA 1WKYA 3FFSA 2HE8A 2PDUA 1S46A 2WPBA 5D09A 1B3VA 1OGSA 1FCBA 2J78A 4R88A 4ZFCA 4C1LA 4PA8A 4OTKA 3CIXA 4ZBCA 2R8WA 4PEEA 1KM6A 1JEZA 3RO6A 1OHLA 1QFEA 4CNNA 1I2NA 3OIHA 1M3UA 3M5ZA 3S2CA 4J5NA 4HZ6A 5C2CA 5LZLA 4Y9OA 4RV8A 3DEQA 1SW0A 4MZYA 3I3BA 3KHJA 1UR0A 5ABEA 1O60A 3VCRA 3REQA 3RUBL 2R24A 1H61A 1T5AA 3A4JA 2YW3A 4Y9PA 2BOEX 4JDYA 3T1GA 1NFGA 4J35A 1GNXA 1O4UA 4PMJA 3WX7A 3VXGA 4QHRA 4I9MA 1QXLA 3M0XA 4HHPA 1EX1A 4JN6A 1KFWA 4LJ3A 5D30A 4GUHA 5AHLA 4FXSA 3FN9A 3WDRA 2ZZ4A 1M7OA 3EZ4A 1XYBA 1H62A 3OB8A 4V2XA 2D24A 2XDFA 1EA0A 5E0CA 4HGXA 3KCJA 2P3EA 1YNQA 3GDBA 4M6QA 5A8OA 2BFGA 4KCTA 4QEEA 3PZGA 4FHAA 1A5LC 3UGVA 3CWNA 5DMYA 4GKLA 4PUJA 2RKXA 3F4NA 4UBPC 4OQVA 4IJRA 1X1ZA 1WDSA 4C5ZA 4TO8A 4AEEA 1VIZA 4PB3A 1AD1A 5EFDA 1AMKA 3GK0A 3SSZA 4H01A 2UY3A 1X38A 5HJYA 2DQXA 3UR7A 5G2HA 1IZKA 2VRQA 5G1TA 1PTDA 4S23A 4MWAC 3PAJA 3LS9A 3SECA 4Z17A 3QY6A 3LHVA 3R12A 1Z9AA 2ZC1A 1U33A 1R3WA 3E3HA 4OV4A 1T8QA 2ZUUA 3N4FA 4H8UA 1QOQA 2F2HA 2YPIA 2QDGA 5I23A 1EJTC 4BZYA 1VPYA 3UZXA 4MLJA 2VVNA 4G1NA 1EIXA 4W89A 2DZUA 3IPWA 3H4WA 3JW7A 3ISIX 4GJJA 3JRKA 1J96A 2FZNA 2QJIA 4UUIA 1VS1A 1GVQA 9RUBA 5AC8A 1SZGA 4ZO9A 3GNDA 3VZYA 1FFRA 1V79A 3TIMA 2J66A 1WDQA 1DJXA 2ZXDA 4HU4A 2WZMA 5LXEA 3DFQA 3E0IA 3D0CA 3UXAA 1D3GA 4HBKA 3PULA 2DIJA 2QJJA 1KM2A 4S2BA 1XBXA 4DUOA 4D8ZA 2DT2A 1KA9F 4D1JA 5T8GA 2E67A 3N19B 3PZMA 3TTQA 3TNOA 1WAUA 3CTLA 1DWAM 4PSPA 1EIBA 3GVWA 2J24A 2NQHA 4ZGYA 1EDTA 3WLKX 2FMOA 5GVJA 4FB7A 1R3RA 4JTJA 1ME7A 3QLLA 4QS5A 2PD9A 5M17A 4XQ6A 2V5DA 4OECA 1IR1A 1QW9A 3W86A 1KCLA 2EG8A 3RM4A 3N2BA 3MKVA 1JQVA 2YGYA 4C6BA 4H8NA 4YTQA 4O50A 2A3AA 7REQA 4YU1A 4NUWA 1FBAA 3WH5A 1H60A 5DCDA 1W17A 1SU5A 2ZXAA 1EYWA 1DPMA 1FWCC 5I3JA 3M46A 4DUVA 1KW1A 2FTPA 3D5HA 3M6YA 1O1HA 1CIUA 5U7SA 3OW1A 2XZ9A 3HJEA 1GGOA 4GYJA 3BZJA 1EEPA 2YX0A 3KS5A 3W82A 3CJPA 1UROA 1XDMA 2Y24A 4KMQA 3W72A 2DH2A 3KVLA 2DU2A 4NNAA 3UWVA 1TA3A 1H0IA 2VL4A 3KEHA 1MUMA 3BDKA 5D9OA 2GDQA 2ZUSA 4LAUA 1E3ZA 1FWDC 2BDQA 2V30A 3GDRA 1RH9A 3VX0A 4IQDA 4XAYA 1J2WA 4MUZA 5KSWA 1CB2A 5CPSA 3JUGA 1RPKA 4QNWA 3O1NA 4YTTA 3GXTA 3V36A 4OKDA 3Q45A 1UC4A 3LZ5A 1GQLA 1G6CA 3AMGA 4GISA 1ZBKA 3WJXA 4PMDA 2XFWA 5LNRA 4KIRA 4UTWA 4IL0A 1R3YA 1CGYA 3H6OA 4QDPA 3SUTA 4C6NA 4GY7A 3IJ7A 1UOKA 4AD5A 4NZ5A 5FAGA 1Z44A 2J47A 1KGWA 5E6YA 1K8YA 1SVDA 2PODA 1OC5A 3WBEA 3ORWA 5JBEA 3PJWA 4IX0A 4YVVA 5MHBA 4PL2A 5REQB 1H7OA 1S5NA 3HG5A 1OYCA 4GUFA 4Q6JA 3W53A 2ZZ5A 1JF6A 2PWVA 1YEYA 3W6YA 4HNTA 1UD5A 1EDGA 3FKKA 2HNEA 3ZR5A 1FUYA 3GNNA 4UNKA 4MNJA 2J27A 1I2RA 1W37A 1U1UA 3NNTA 4N6EA 3QPZA 4GXMA 4MZ1A 4I7VA 3T4CA 2W62A 3MUIA 1V6TA 4GG9A 1V93A 2Y2WA 1VLIA 1RBAA 3ARPA 3EOSA 4M0XA 1CB7B 4HNCA 2D0HA 2QF8A 2RGMA 4Q8TA 4TXEA 3B8UA 1KWKA 3CL8A 4UZSA 1DJYA 3VNZA 4AEFA 3F4WA 1QPNA 1WKEA 1MW0A 3LGEA 4GX9A 4LOCA 4E0CA 5A6LA 4PUEA 4QRNA 3LNMA 3NVDA 5RUBA 3OHMB 3UYIA 3QEZA 2Z2BA 3G1HA 4ALDA 4CN1A 1E9LA 1I6NA 4WJ8A 1J0JA 2B81A 4IQEA 3U2CA 3G24A 1YX1A 1S5WA 1VRXA 8XIMA 3LXBA 4QR6A 4AYGA 4RNIA 4XZ9A 3U3HA 1CI1A 4I9JA 5I02A 3PS7A 3AUOA 4NRRA 4JIRA 3TA9A 4XZBA 3OHIA 3O6CA 1NH6A 1BYAA 3VAVA 3WBAA 3FYYA 4D2JA 1XICA 4XD6A 4D8AA 2V5JA 1SSDA 2OWXA 4B9ZA 1GUVA 3W7MA 4BFAA 3QSRA 2ZDRA 3FEMA 4Z1YA 3GHUA 1W91A 3WELA 4H7ZA 4J28A 1JGMA 4IISA 1Q7QA 4EANA 3R58A 2IXVA 4JTAA 4O1DA 5AVNA 4KH2A 3K5XA 1MUCA 4JQ1A 3AXMA 3EB3A 4MJ2A 3IIXA 3TONA 4UNIA 2XHYA 4IMFA 4H8HA 3SZ8A 1OYBA 1G4SA 5AC5A 1LWJA 1WOBA 3DZ1A 3TAOA 3VD7A 1UKSA 2X09A 2VC6A 1XLAA 2ZX8A 3NZGA 3A47A 4O15A 4OZOA 1PB0A 5HMEA 1YKWA 1XSIA 2FYMA 5BXTA 3J7HA 3WL0A 3AIEA 3BAKA 4HQVA 3WDQA 3WQ6A 2VM8A 1CNVA 3KHDA 2RDTA 2WANA 3UGRA 3LHWA 3EWYA 3WLTA 5G2IA 2XG9A 3WFAA 1QO5A 6ALDA 2P0OA 1RR2A 4ZFMA 1QATA 3E38A 5A94A 2RJHA 3V16A 2VGIA 3PM6A 1IEIA 3AIVA 5CSYA 3HQ1A 1POJA 3W7GA 4IMGA 2E5CA 2AKZA 3GXNA 4RR4A 1EGZA 2HRWA 3L68A 4FF7A 2XTKA 1B3WA 4WUIA 3NXLA 3FCPA 3QMSA 1I0BA 2HPIA 3MQTA 3R10A 3D46A 1J4EA 3LXAA 2WKGA 4NI8A 3LM7A 3AZSA 3I6TA 4E2DA 2HJPA 4UQAA 1B4KA 3S46A 1ZBWA 1L2UA 2DH3A 5A6TC 2Y0FA 2R1KA 4O4WA 4J2PA 1X8FA 4AHPA 1H7NA 1R6WA 1UQYA 3QV8A 4JQAA 2GK1A 4LANA 5H8MA 4U2ZA 1WBHA 2PDFA 3C5QA 1KFLA 4V1XA 1IF2A 4H9TA 3STFA 3MI2A 4QAIA 8CGTA 3UWEA 4JTDA 1B0IA 2VC7A 3MCNA 1K1DA 3CU2A 5I24A 2KX9A 2ZZ1A 4M6UA 3WKZA 4J4KA 2BY0A 1Q7ZA 3ZR4A 1H7RA 3LMYA 2WC7A 2Q3RA 2F61A 3PZUA 3WNNA 1MYRA 3UWUA 2UY4A 5D33A 3M07A 3EMZA 1UMYA 1EC7A 1XYMA 5HQEA 4Q7IA 1V3IA 5ABFB 3N2CA 4HMEA 4C6FA 2CHRA 3WSUA 4HIBA 2FDMA 5C9RA 4O18A 8TIMA 3PB2A 1XYFA 3K8LA 1KKRA 4GFIA 5FJTA 3VGEA 4QS6A 3LCIA 2FQIA 1S5VA 1TO3A 1EHAA 1RD5A 4XZIA 2VFDA 4QSFA 1H2JA 4RZBA 1NQKA 4WF7A 1QU4A 2PGRA 3HPAA 1EFZA 2PU1A 4L1WA 3LNPA 3CXOA 4XAZA 1VJZA 1V77A 2IXUA 3CPGA 4EXBA 1Q63A 1L6FA 4DY1A 3W24A 4O12A 2MUCA 1I4NA 1PCWA 4YMZA 2REQB 4HT3A 4ML4A 1DV7A 1X8CA 3W87A 3V75A 1NFPA 5EMJA 4IMEA 4F79A 3LLXA 4EP8C 2A21A 1Z7AA 2V2CA 3AAMA 3HM7A 1XYAA 5TAOA 3OLEA 1I2OA 1IEXA 3MUZ1 3HIJA 3TQVA 1HKKA 2PTXA 2Z1WA 1SFLA 3C0QA 4JS3A 2F84A 3AI0A 4BF9A 1PUDA 5H8PA 3OVGA 4GNVA 3GNPA 4JTFA 1AW1A 2QCCA 4C5YA 3BQ6A 1XLKA 1BYDA 3OZPA 4P7QA 2HZGA 2WMKA 3I7RA 3U7VA 3PUOA 2DDXA 4RE2A 2CETA 1ZRQA 1HT6A 1UP2A 2PD5A 3JVAA 2R82A 1OT2A 1U1HA 4LAZA 2VENA 3H2MA 1QK0A 5LNWA 3FLUA 7TIMA 3PZTA 4JL2A 3BW2A 2V63A 3LY0A 3QSTA 3M0HA 5AC4A 2PBGA 3NPUA 1B9ZA 5GNZA 4ACZA 4E4PA 1K8XA 3DG7A 4KWUA 1LP6A 1P7TB 2OVLA 1UKQA 3ZJ7A 2QUVA 2ZVIA 3LUTA 3KDNA 3APGA 4L4LA 2P53A 5DMNA 3FJ6A 1XI3A 2C0HA 2ACRA 2CITA 1RCOB 4Z1DA 4F4RA 5G1MA 1P48A 3PBMA 5G2WA 3TYBA 3DYMA 3NQ8A 2YA0A 5I77A 3W6LA 1FQ0A 3VE9A 2EAWA 5A2AA 3ARVA 4HYRA 2D20A 4L61A 1BF2A 5B80A 4DZIA 1RCXB 1YBQB 1XRTA 3SRDA 2QV5A 3T08A 3AJ7A 2PFHA 3O6AA 2GGHA 2V69A 3HPFA 1WDRA 4MGGA 4BY3A 3W6MA 2ZZ2A 1UP0A 3N9SA 2OQHA 1P0NA 1VCVA 4H6QA 4A05A 3G1VA 3OVPA 3OZYA 4NI3A 1BXBA 3BURA 4CGTA 2NLIA 4TOQA 2OZ8A 3N25A 5BXRA 2OSYA 3KOFA 4MPKA 1R3TA 3WD4A 3AICA 1RHCA 4BK9A 3NL2A 3UXKA 3E96A 2Z1XA 1HP5A 3DFOA 4BCEA 2ATSA 4JNMA 1Z32X 3UJEA 3P8JA 1P1XA 4IP7A 4JHZA 1UWAA 2OO6A 4EE9A 1UIOA 2YL9A 2C79A 4UFIA 3FJNA 5LNSA 2BS9A 2E77A 4K38A 3TUUA 1OGGA 3BOFA 1W3JA 5F2GA 2PWUA 3Q37A 4D6DA 3HOJA 2NUWA 3VOFA 1JRCA 5C9XA 4ZTYA 3EDEA 2W61A 3IIVA 2FIQA 4UQDA 4ZQNA 2D22A 3SGZA 4AB4A 4IWWA 4IJBA 3PR2A 1FWGC 3HZ3A 1QJWA 2CZFA 4TR9A 1J10A 2Q6ZA 1F61A 1WO2A 2YL8A 1EF2A 2MNRA 3BLDA 3N4EA 3SY8A 3W01A 2J74A 1U5HA 3W1PA 3M4HA 1CZ1A 2GSEA 2C16A 3LDVA 1E4NA 3BLFA 1S39A 5DBUA 5DF0A 1GG1A 4R53A 1VQTA 4H6RA 4FO4A 4NYYA 1T7LA 4EPKA 1WXZA 5TF0A 3CHDA 3Q58A 1GVOA 1OG6A 4O1AA 4P8XA 2H3DA 2ACUA 4YCPA 4D9PA 1H63A 2ZA1A 1MFUA 2OWWA 2SFPA 4HOWA 3M7SA 4Q4QA 2G5WA 3OLGA 3ELFA 3W07A 1WYIA 3KM8A 4ENLA 4PRRA 3H7RA 3OQ8A 3NCOA 3H53A 4TX6A 4WOZA 3UFYA 3SUWA 3VILA 4ATWA 4NNBA 4KCUA 1MWOA 3GC5A 4U5IA 1TPVA 4WR3A 4XBJA 4DI9A 4PUWA 4RE3A 4I8YA 2ON3A 1KXQA 4MB3A 2DW7A 3D3AA 4H7VA 1W6TA 4HA3A 3WJWA 5F1VA 2O55A 1BXNA 4R27A 3UBPC 4B5XA 1KV8A 4UC5A 3AOFA 2ZRXA 3AHZA 3KX6A 4M5PA 2FPTA 4WJXA 2HXTA 2VP8A 2ZVRA 4L9YA 2CLFA 1ZJAA 4CD8A 4GUJA 3OODA 1RCQA 3MW7A 5IBXA 4OE7A 4W7WA 3ABQA 2GDVA 3LPOA 2B7QA 3WNOA 4FLSA 3PBWA 4MSSA 5G4HC 2Q8ZA 3W85A 3FGCB 3AHVA 4O13A 4GINA 3FJLA 2BWGA 4J3VA 3GWQA 3RFAA 4QLKA 2H90A 3VX1A 1JJKA 3QQ1A 3OZMA 4RNJA 2JBMA 4WK9A 3GG0A 3C3UA 5T9BG 3O6YX 2DUAA 4FNSA 3E74A 3WLIA 2YCKX 5HJLA 4H9VA 3TSDA 3CMJA 1W9BM 4DYEA 2EPOA 4L1GA 1Q6RA 2GQAA 4Y8EA 4AVFA 3U48A 1XD1A 4U33A 4GGBA 2PGWA 4BWLA 4G6CA 1MRQA 3MHFA 4UMCA 5FF4A 3THCA 2I7GA 3CQ0A 4K68A 3WQGA 4MYAA 1NSJA 5IBXC 1UR8A 2E8YA 2X40A 3CT7A 3SCRA 2ZFAA 4CCDA 4PBFA 2P8BA 3WLHA 3HA1A 1CXFA 4YCOA 2OB3A 2PUZA 1B3XA 3BVJA 3W76A 1VBUA 2I9EA 4UXDA 4UNLA 9CGTA 1R9XA 2QPXA 3L5MA 3ZJKA 4H1ZA 1NEYA 1AJ0A 3EX1A 4M80A 4DJEA 1EXPA 2GJLA 1JQXA 4GIYA 5J5RA 4TV6A 1BSLA 2XVLA 1D3CA 3GS6A 1N8WA 4UTFA 1Q6GA 1V3JA 4GFSA 1S1PA 4O8AA 2VEGA 3UD6A 4Q8NA 5T91A 3TYAA 2Y4SA 1ITXA 4AMAA 1W3KA 3NQ7A 3IJIA 5CQ1A 4BQ5A 2BTMA 3NO5A 2OO0A 4EPEC 1ADSA 5BRQA 4OVXA 2WV8A 4NXKA 1EH9A 1Z89A 4N02A 3XISA 4Q3MA 1T0OA 4KESA 3N2TA 3GB6A 3URAA 3M16A 2W91A 2EBNA 4HN4A 3WFLA 3UNDA 4QLJA 3EX3A 3BAIA 4E2BA 3UU0A 2ALRA 3JZUA 2EG6A 4PBGA 1ZNNA 4A3UA 1K4HA 3CMGA 2E1WA 4IXXA 4JN8A 3N6JA 4GI8A 3O15A 3AQUA 2CBUA 4ATDA 3MVTA 4A2RA 3R8RA 4MUPA 2W63A 2G95A 4IGHA 1ME8A 5AYIA 4FALA 2HV5A 4AISA 4B5SA 3APTA 5DEZA 4DJFC 1ONRA 4Q8VA 3ZWSA 4F40A 3T9PA 3R4IA 1WKDA 2Y1HA 3E12A 3IEBA 3DFYA 4Y9NA 1CWYA 2IKGA 3MBDA 4WOQA 3ICJA 1GYLA 4EXAA 4M8UA 4KKXA 1F5ZA 1ZSXA 2IPFA 3SGUA 4EX4A 2OKOA 3NZ1A 4K2SA 7XIMA 1BQCA 1I45A 3EEZA 5CG7A 3PC0A 3SCTA 3DGRA 5I03A 2NQ5A 1W1PA 5A6SA 1A5OC 1W0MA 4UFJA 4EKJA 5CSSA 4MKNA 3OU8A 2H8XA 4AZHA 4IF2A 2PCEA 1G7VA 3P67A 2VNCA 1K03A 2PLMA 2XVNA 5HDRA 3G0SA 4Y90A 4G56A 1L8PA 1W8SA 2FLIA 2X7VA 4JBRA 1YNPA 4AYSA 1V02A 4HYVA 4NG3A 3VD5A 5FF0A 1X6LA 3WLJA 5FIPA 1R38A 4LBSA 5H2ZA 1XLIA 1MNSA 3MKKA 3AS3A 1I75A 1OX4B 4LALA 4ZXLA 1ZQ5A 3VDAA 2VELA 2J25A 4Y9MA 1W1TA 3GTIA 3NDOA 3ATZA 4GE8A 1PWMA 1BWLA 1GVEA 1H0GA 2A6LA 3ITTA 4X3ZA 1ME9A 2PSNA 2OU4A 4ILSA 1WA3A 4IIHA 5A6MA 2YB4A 1JZ5A 1OFBA 3G1YA 3F2BA 5BRBA 2OOFA 1DTNA 4M6VA 2OYKA 1UKTA 3PNZA 1VJSA 5BRPA 2VFHA 4XWUA 1IQ8A 3BO9A 1QI0A 3C2YA 3ZVHA 3R0DA 1XG3A 3EA3A 1OX5A 3DIPA 1O7AA 1TWDA 4E5TA 5E6ZA 3HJZA 3THDA 3WH8A 2PDBA 2TSYA 2XISA 1D8WA 2Y5JA 4AU0A 1LLOA 2MANA 3KAOA 3JZEA 3NSXA 4GC3A 2YJQA 4K1WA 1JUKA 4MWAD 1Z41A 2E4TA 3GR4A 1MEIA 1R30A 4ZR8A 2W67A 2ICSA 3EBVA 1OIFA 2PWEA 4HNOA 3N11A 3DFNA 1FCVA 2OZ3A 3CAWA 1VEMA 1HFBA 4DZ5A 3N12A 4WLCA 3W1NA 3EPOA 4O19A 4LAMA 3H12A 3O63A 3GM8A 1D8CA 3BMXA 1E4MM 3TNBA 2CLPA 1E1EA 1HX0A 2WQPA 2I56A 2D0FA 3L4WA 3WDIA 2VDHA 4E3TA 3QN3A 5GNYA 2JQXA 1PTGA 5DXXA 3CPUA 1V3KA 4MAVA 3ES8A 1GQJA 2NT1A 1TUFA 2P50A 3WLOA 2AKMA 1A5SA 4D6FA 1O1ZA 3PZOA 2NQJA 2NUYA 1HJSA 2DJLA 4KEMA 4QLLA 1GWJA 4PMXA 2WZEA 1XP3A 5LKYA 3U5YA 3NDZA 2BGQA 4PC8A 1K9EA 5E9AA 3VNYA 2CIPA 3BJTA 3WENA 1IIGA 1MW2A 3IWPA 2ZRUA 1JYVA 3PUGA 3N13A 1O95A 1ZJHA 2PGFA 3ITYA 2VQUA 1K8CA 1TKKA 3CZGA 1QNSA 3SCQA 1AZ1A 1EBHA 2ZXQA 3ARWA 3WH7A 4QSHA 4FNQA 2VO5A 4I90A 3UVIA 2G4JA 3N6HA 3FDKA 3W84A 3ZQ9A 3U2OA 1M04A 3F1QA 4LWWA 4M6PA 3TX9A 4CU6A 1WPCA 2Z6JA 4WIWA 4E4FA 3SCOA 2HVNA 5HJXA 1TVLA 4QJ4B 4PMUA 1YPIA 1RD6A 3GVVA 1RSCA 4KRZA 3QFEA 3DN5A 3MCMA 2C18A 1JZ7A 2I9UA 1DEDA 2BY2A 4AD0A 1JULA 3IIZA 1TRIA 5I06A 1GOXA 3B06A 3LQGA 4XIAA 3G5EA 1DVJA 4ZQCA 5C0QA 4BQ3A 2QCFA 1KCXA 4XD4A 2VWTA 1B5TA 4G5DA 1LTDA 4WZHA 1TR9A 4ZOEA 1TRDA 1IE7C 2INEA 1XPGA 4GKTA 3L4YA 3GNXA 1QW8A 3QC3A 4ZO8A 1UASA 1XC6A 3KOXA 3KE0A 4DBEA 1JDCA 3G1XA 4BKNA 4O17A 3CV2A 5EMMA 1Y5VA 1ITCA 3CZJA 1Q45A 2DT3A 3NZRA 2BOGX 1JDAA 4GI4A 4LVDA 2GJXB 4PB4A 1XINA 4OU1A 1E4LA 2QV4A 3C0JA 2OEJA 4HOZA 3GDLA 1REQA 2WW5A 1GTHA 1M65A 2XIOA 1AMYA 3K4DA 4Z2LA 5KEZA 2YXGA 3M0MA 3UZYA 3OA5A 4KPLA 2FDSA 1V02E 4ONVA 4GK8A 1UJQA 1HO4A 4GMEA 1GQIA 3WUEA 1VFLA 1K7XA 1UR4A 3LQLA 1RJRA 3H7UA 3TJXA 1FXPA 4CN4A 1UQZA 1C8YA 1LT8A 4A3RA 4F9DA 1SJAA 3GE7A 1DXIA 4CNOA 4ADSA 3M41A 4HMCA 3G8RA 5AHMA 3FDGA 2E7FA 1E55A 1GKPA 1OVDA 2YCLB 4IPPA 4M82A 2VOTA 2XUCA 4NXSA 3EDFA 4C65A 1GONA 2DQWA 1E40A 4HZ7A 3LMZA 2J7GA 2XVGA 3TC7A 4X60A 1CT5A 4PCPA 2ZZ6A 3P80A 4C6PA 4XKMA 1DWJM 3A4WA 3VNKA 4WXZA 4L5ZA 1W9UA 2G8ZA 3QQ0A 1WXJA 3CWOX 3C4UA 1H7XA 1XIIA 1EF3A 2NV1A 3TQKA 4LQ1A 4AVNA 4GIAA 3CV7A 3H4XA 2FH8A 4DWSA 3LCWA 1PKLA 2IMRA 2G3IA 3C2OA 1OADA 4UMBA 4O54A 1LQ2A 1Q66A 3DHFA 2CLEA 3FA3A 4WY0F 4AIBA 3NPWA 4ZVJA 4W7UA 2XWDA 3RU8X 4IG2B 1FWJC 3WK2A 2XJ7A 4LNYA 1R3QA 4JOMA 4HCHA 3QBUA 2X2YA 5A8NA 1E9IA 1YPFA 3GR8A 2IPWA 1XS2A 1E6RA 1WDPA 3AHYA 1RALA 1TSIA 2ATMA 3KCOA 4UWMA 4I9TA 1HP4A 3K1DA 5BOEA 5IFTA 4LH8A 1KFCA 4O1EA 1Z8AA 3T6CA 3NURA 4OFCA 1XCXA 4ES4A 4D6JA 4H9XA 2VX7A 1NWUA 3RK8A 2D23A 2POZA 5LHEA 5FF3A 4NZ3A 4S3GA 1LWHA 2CWNA 2HXUA 7ENLA 4AY1A 1DHPA 2CLOA 2X1IA 2XH7A 1TPDA 2JIEA 2VGBA 3CQHA 5XIAA 3XINA 4EF8A 4XV0A 1JF5A 1K7FA 3EMCA 3K4WA 3TXZA 1EZWA 5D2XA 3GNRA 1C29A 3AIRA 5BMWA 1JPHA 2XYLA 3RF9A 3RLHA 3U8GA 1UB3A 3UR2A 1G9HA 1JCMP 4GQGA 4S38A 4AIOA 4R34A 6A3HA 1E15A 3MUCA 3PPGA 1W5QA 4IMAA 3P7YA 2BASA 1MDLA 3UESA 4OBTA 3QZAA 1OB0A 4NAFB 1EX5A 3WMSA 1Q4WA 3TFCA 1Q13A 4Z1AA 4LUTA 2YBTA 5I3HA 4GABA 3UERA 3ZLFA 3FYPA 1LROA 2GGJA 4WY0B 4EWND 2XIQA 1KLZA 1S1RA 5G4WA 4GYPA 1IZJA 2ISFA 5EGRA 2FGLA 5AYXA 3ZIZA 3STEA 3T0BA 2QF7A 2OELA 4CNUA 6PTDA 2CPUA 4JQ2A 1AFSA 3U2EA 1FWNA 1M5WA 2XPKA 5K9DA 4PSRA 2CU0A 4HTBA 3TOYA 1PHQA 2EKGA 1Z48A 5A6AA 2FHFA 3V1HA 2CZEA 3R13A 4FNUA 4IGMA 3VDCA 3W23A 1OGBA 4R9XA 1XBYA 2R1MA 3AISA 4RCXA 7ODCA 1E71M 1C93A 1JAKA 2WMGA 3COTA 3JU2A 4C7DA 5LGZA 4MWAE 2E25A 3ARQA 2X1TA 1A5NC 3T0TA 1W9DM 3AALA 4GNKB 3W7EA 4HU3A 4UFLA 1Q7MA 1X96A 3MB9A 3GW0A 3QOMA 1AK5A 2GGIA 4NVTA 1JZ3A 1MW1A 1WP6A 3OJGA 3P81A 2TODA 2UZ9A 3FNDA 2Z1SA 3DCPA 3MDUA 1YDVA 1M01A 2V38A 2W4XA 4DJDA 1UHVA 3TCEA 1JPIA 3RLUA 2WSQA 3ZLHA 4X0VA 1J0ZA 4X63A 3GFXA 4JR5A 1KB3A 3N4AA 4YYCA 2QJNA 3S9YA 1HJVA 5K4XA 5LA2A 1DE6A 4Q4KA 1SW3A 4LCRA 3QY8A 4AHOA 3KL5A 3AMDA 3GW3A 2VMFA 4JGDA 3SQSA 3VIIA 1QASA 4QJ3B 3R0KA 2V67A 3QHMA 5TQLA 1LZOA 4PBEA 2GOUA 3A64A 2ISDA 2VZSA 4B5WA 1KFJA 4I7WA 1KCZA 4HP5A 3WD1A 3H2NA 2ZRWA 5FD0A 2Z24A 3EYPA 3UT0A 4BI5A 5BNKA 2DGAA 4MF4A 1WKFA 1XKJA 4Z2GA 1H5YA 1EA9C 2FPYA 4TMBA 4RDVA 5GJPA 3EPMA 4I5RA 2WNNA 2GJPA 4AQLA 2D69A 2IQ0A 4B16A 3PSVA 5GQBA 1WXYA 2IPJA 1DIKA 2O0TA 1GVYA 3IACA 1GT8A 1M9HA 1XLLA 4H00A 9XIAA 4H2CA 1KKOA 4MLRA 1VFUA 4RXFA 2XFYA 1A49A 2ZTJA 1PEZA 1EJXC 1RK5A 2RDUA 4OT7A 4I9AA 3NQVA 1QNRA 3EB4A 1FKWA 1PIIA 4P5UA 3LHTA 2HVMA 3QV6A 2BXZA 3BW4A 1C90A 1XIBA 3O6DA 2Z0IA 1V3HA 5G4EA 3STPA 1GZ1A 4HHHA 1PJ9A 4IHCA 4QQ3A 2BMBA 1R3SA 3W2KA 3GYCA 2YBUA 3V0SA 1BYBA 2QZRA 1FH9A 3AU2A 1CX9A 2XGBA 4YVPA 3E0VA 1OF8A 4EK7A 2B31A 1JCJA 1E0TA 1E9YB 3VKKA 4AAJA 2QPSA 5I09A 1IT7A 1FCUA 4GVGA 5DQPA 4GA8A 1PKNA 1H1ZA 4E4UA 2CBJA 4HSOA 3GZAA 2NQLA 2DW6A 4REQB 4KBXA 1AW2A 1ZZMA 3PF3A 1BYCA 3N15A 3RLGA 3O2LA 4WCJA 4Y6GA 1VP5A 1X1OA 3LRKA 3GH7A 3CUZA 3VIPA 4YN5A 1IGWA 4KT2A 3FVMA 3CO8A 3B8SA 1XL9A 3H4GA 3BV7A 3LX9A 1C7TA 4E8DA 3PP7A 1F07A 3CZEA 4KIEA 1S2TA 1W3HA 3TYCA 3S47A 1KCKA 1OK4A 3B9NA 4LB4A 3OTRA 2QCDA 4W8AA 3G18A 5D05A 3CT2A 4DO7A 3G1FA 4LVFA 3NEHA 1LLWA 1TWIA 1EUNA 1E6NA 4H04A 3CQJA 3NVTA 3HGJA 4JEJA 2EHHA 3LV6A 6CGTA 4CCCA 2BX7A 3Q67A 3SFKA 2PCQA 4NASA 3AROA 1SUXA 3LRLA 4DF1A 1YE6A 6TAAA 3GTFA 4UOZA 3KVJA 3POCA 4NILA 3GAYA 1UKOA 1ITUA 2HISA 4MVAA 2D2GA 1TVPA 1XLFA 3VGGA 2NV2A 4A2SA 4DUWA 3NPVA 1HUVA 4L6OA 5LSMA 2PDGA 3DKLA 2V3EA 4Q4MA 1JDDA 4JIEA 1A47A 2NVAA 5CGMA 5HQMA 4FAMA 2VWSA 3N29A 3HN3A 3TSBA 2P88A 2PDXA 1XLHA 1QW7A 3LCXA 1K4GA 1XYZA 1YDYA 4HZMA 3T0CA 1DP0A 3SDOA 4AZCA 3P62A 1GJWA 5IHSA 1GVSA 2AQVA 1BQGA 2A3BA 2WVUA 4PTWA 4QTGA 4IGSA 4CD6A 4JTGA 1TJPA 3RO8A 1HKVA 2QUNA 3MSGA 3TVAA 5HAOA 2FTYA 3BQ5A 1YHTA 4GIRA 1IT8A 2VEPA 1C3FA 4DXXA 1E9ZB 1NOFA 4POCA 2X42A 3UCQA 1FWSA 2E9MA 3R5EA 1L6SA 3ARRA 4RXGA 3KRZA 5FESA 3WF3A 2NWRA 4F2TA 1CGWA 4I6KA 4GVHA 1BKSA 4ROPA 1JYNA 1F9CA 2VQTA 3D3FA 3B04A 4CQBA 1XSJA 2YFOA 3NOEA 2JGQA 2F6UA 3URNA 1AH4A 4NJGA 3PJXA 1LORA 1EOMA 4PMVA 1W1A1 1LYXA 2CXGA 4AWUA 2NQZA 1WDDA 3EX2A 3I6RA 5FEPA 2GUYA 2O4MA 1A5KC 3ARSA 5DLCA 2VGGA 4PN2A 2FHCA 4MJZA 4K3ZA 1EJRC 3PBYA 1HL2A 1YTDA 3GR7A 1LOQA 4UCFA 1YIXA 3IVSA 1RA5A 2Y8VA 3BCFA 3W1AA 1F76A 5AB3A 3KS6A 5K3VA 1BVNP 2ZX6A 5DN1A 3C2EA 3Q65A 1DWGM 1XBVA 2XINA 1W1YA 3C2RA 3N14A 4DBUA 1CDGA 4ZSTA 1JG9A 3UJ2A 3W22A 4KFNA 1DJWA 1BWKA 1UWUA 3LB0A 1H09A 1V0LA 2V3FA 4LC8A 3S1GA 1QI5A 3N1AA 5EMLA 4JIIX 4QISA 1WZAA 2QKFA 3IV3A 4G2DA 2NSOA 1QTWA 4TVUA 3EKZA 1EPXA 1XBZA 2OEKA 3EDJA 5DFAA 1Z6KA 5HA7A 4WGHA 1NM9A 2A4AA 2OX4A 1X98A 3B40A 4DI8A 2FGZA 4KWOA 3SRKA 4WKFA 2XH0A 1AQMA 2HWGA 5HULA 1V7YA 4ERIA 4FP1A 1GYNA 1R7OA 2F6XA 4E8CA 1ZS2A 3VIMA 1N8FA 2E3ZA 1OBAA 2DSUA 1HXJA 2CEQA 2PE4A 2QQ6A 4Q4PA 3R43A 2BGSA 1O5QA 4XZNX 7PTDA 3TP4A 2O9RA 2V5LA 4FZIA 3WNKA 4KW2A 4AY7A 4YTUA 3G0XA 4JKMA 2Q3OA 3ME3A 3UZJA 3SN1A 1Q8AA 3KRBA 3MMDA 2PP3A 3UPBA 2V9DA 3E49A 3ZO9A 1ZJIA 1F05A 2UWFA 5A69A 1JYWA 2C14A 2BV9A 3PBGA 1NDZA 3MU7A 3UWZA 3AS1A 3QXBA 1N82A 2WJFA 1TTIA 1G5AA 1UD6A 1C8QA 4DNMA 2C13A 4V33A 4J40A 1MXDA 1WDWA 4K8EA 2WC4A 3FA5A 3DU0A 2VEKA 1PX8A 3NGJA 4TX8A 3BG9A 4DYJA 1D3HA 1XRVA 1CECA 3RXZA 4QJ1A 2V8ZA 1FWFC 3UY8A 1O66A 1OCQA 1SFSA 4IH3A 1ZUAX 2VZVA 1NP2A 1JZ2A 3CMFA 1LG1A 3N2XA 5AHFA 2AOSA 1YPXA 1LCOA 3SN0A 5HANA 4H4IA 3EX4A 3W7IA 1HL8A 1SSGA 4GI9A 4Z1CA 5CGQA 4IFKB 1JI2A 4IGNA 4AWEA 3O7UA 1B3ZA 2OZ0A 1NIUA 2YOCA 5FSDC 3LHZA 2F38A 2G3MA 5JBFA 3LYEA 1PZ1A 3IVUA 2QS8A 3BICA 2HDJA 3BE7A 4GIEA 3TYZA 3HQOA 3FX4A 1YNYA 2WCGA 4N42A 3SY5A 1WAWA 1RY8A 1V6YA 3T44A 3F4VA 3MJYA 1TWZA 5D2VA 2WCAA 3MMTA 5EKYA 3SM0A 1US3A 4XO6A 4O1FA 1EPVA 3F4CA 4UQEA 4IPNB 1B30A 4WJEA 5D9PA 2G0WA 2ZX9A 3TQ0A 3POHA 2Y88A 1ICQA 3WJSA 1E73M 1Z42A 1R7AA 2Z28A 5AFDA 4DZHA 3WLNA 3NXFA 4L64A 3LI0A 3W2UA 4LV4A 3OOQA 3PFRA 5GNXA 3GTXA 3IGHX 4AD4A 5HINA 1Y0EA 1R0MA 1T96A 4GQ0A 3TN4A 4DXVA 4TMCA 2WJEA 3HQNA 4RZ4A 4O4VA 1X6UA 2V5CA 4Q33A 3V3WA 3K1GA 1GJUA 1KM3A 4CNPA 4HVXA 1JNEA 1AUSL 3UJRA 3IGUA 3UCCA 5EY5A 1EL3A 4RL3A 1R3VA 5TNVA 4NSBA 1D2KA 4DWSC 2HBVA 4ACYA 3UW6A 1SJBA 1V0KA 4AXKA 4MNKA 3W7LA 3VOGA 1R5YA 4R33A 5BWAA 1A5BA 3W1MA 4CU7A 1RK6A 1XGZA 5DRCA 4F2BA 1P5BA 1FHLA 2OGYA 3C8FA 1TJRA 2DY3A 3VTRA 2QDEA 1ZY9A 3THQA 4JTRA 4ZODA 1TWWA 3VUPA 4U3CA 1DOSA 1EJVC 3GIQA 3ONCA 4LBRA 5HATA 2CLKA 2W79A 1EWEA 3RMJA 4F3HA 2YCIX 4NRSA 3LPGA 4XBSA 4DYKA 3FAXA 4NJKA 1T8XA 1KC7A 4HA0A 1FHVA 4Z2HA 1VYPX 4CQ8A 4Z2JA 4FI4A 1NAL1 3DC0A 4XKYA 4DWDA 1JDEA 5EBUA 4ICMA 3SW6A 3M6DA 4FXFA 3U6WA 2PLCA 2PDJA 3RLVA 4PL1A 4W8LA 3EGJA 5CC5A 1F4AA 2VT0A 1CGTA 2XWEA 3BAJA 4EOUA 2AGTA 4YL2A 1CLXA 1XLJA 5J8LA 1XIJA 4LW7A 3TJ4A 3ZM8A 1QHZA 5I00A 3GXPA 1ZENA 2EPKX 2HQAA 1BD0A 4WSKA 1W1IE 4HA1A 1VH7A 1XR2A 4JTTA 2VZOA 3DERA 3A23A 1GHSA 5CBBA 4ECLA 3TROA 1N2VA 4L6HA 4REQA 3BOXA 2OWCA 3I3DA 5CXPA 5KINA 5ECUA 1R2TA 3AJXA 1BSIA 3C0SA 1C7SA 3WBWA 2NQ9A 1TYGA 3FKRA 2BVWA 3ANUA 3PZIA 4LC6A 1HJXA 4L4OA 4UIOA 5JVLA 1YQ2A 2WPGA 3EWUA 1CW2A 1QUMA 1W3IA 3BSGA 4CN6A 3GAKA 2GQ9A 4OWGA 4JKKA 5HR6A 2WZHA 4B5UA 1OK6A 4A3HA 4MAZA 1WZMA 1L9WA 1NQ6A 3NQAA 3NQEA 2PRHA 3W2MA 1GOMA 3H2EA 4WDWA 3QMTA 1UH4A 2OT1A 2QUMA 3LCLA 1IV8A 3R8HA 1TV2A 4LUJA 1RP9A 4HB7A 5CEWA 3RIKA 3NFUA 2QXWA 3FJ4A 3CNYA 1S38A 4QGCA 1OFQA 4ACZB 2HEJA 4LAKA 4H7CA 1UZ1A 1UMLA 3KBNA 2ZKMX 5D8ZA 2H9AA 4B4HA 4WDXA 4JX4A 3KTSA 2BXVA 4IG2A 4S39A 4CNSA 3M5YA 3BLPX 3PG8A 2VX6A 3B03A 3T05A 5BU6A 2ASHA 4JHOA 5JMUA 2ZDSA 2P1FA 2BHZA 2FZDA 3ZVIA 1H3GA 3BMVA 2PWFA 3DHDA 3OYZA 2A79A 1ONEA 2QGYA 4JD4A 4KWVA 4IUOA 4YHGA 3MT1A 3U7BA 5B7YA 3VNDA 4BR1A 4HHMA 3VNJA 3NO3A 5FL0A 5FCZA 4B92A 2GLKA 3TLLA 2DP3A 4FMVA 3NQBA 4H83A 1DWHM 1CTNA 4JQ4A 2VHLA 1UCWA 1K9DA 2OFJA 5C7HA 1VBHA 2XIIA 3IAPA 1AZ2A 3MUY1 4DJDD 4O53A 4TQTA 1J01A 1L6GA 2DVUA 8RUCA 2RDWA 4A29A 2WMIB 4ZEPA 3BG5A 4MFDA 4V1YA 1JFHA 3JR2A 4KEZA 3GHSA 1RPXA 4NAEA 1TIMA 3ITGA 1XUZA 2L5HA 3UJSA 3YPIA 4Q4RA 3U57A 3FY1A 1P6WA 5F2MA 2OGJA 2A3LA 2I5GA 4ERAA 1KQZA 3QPEA 3DESA 1ECEA 1MQRA 2BHYA 1OFEA 4GYKA 2FGBA 1V3MA 1F8IA 1JUBA 4P2VA 3VIFA 1MEHA 3II1A 1PCKA 5HR7A 4NZ4A 4AZCB 3LD5A 1NFBA 1J0KA 2GVLA 3KWXA 3GH4A 3CPRA 2H3BA 4DM2A 3PTDA 1DJIA 1W9XA 2WKJA 4ZSUA 2A1YA 1M41A 4FF5A 2QCGA 5D4YA 2ADAA 2C6QA 5DBTA 1AQFA 3A3XA 3W7CA 3T4WA 5FEWA 1KBIA 3G8EA 4KRUA 1UD2A 4UTJA 3IUDA 3ECQA 1ICPA 4KERA 1CXHA 1EJ7L 2WVTA 3T40A 3QJAA 3GXIA 2EJ1A 2QCNA 1ZP3A 3DG6A 5AKQA 1HQTA 5IXEA 2J9ZA 1L6WA 4QG6A 4LGXA 4R7WA 4HK5A 3PWAA 4LUTB 2V5KA 4O57A 1QNQA 2Y7GA 4LF1A 4AZ7A 4XTIA 1E51A 3H7VA 4PZVA 4FXJA 2D0GA 4YS1A 3W1RA 4IPIA 2QHAA 4JNYA 3E2SA 4IJCA 1HF6A 4JTUA 3L0GA 4ZO7A 2NT0A 3WY1A 4UTTA 5I6SA 4AUBA 2Z6IA 4AY8A 3Q2DA 2JK2A 4QM1A 3SBFA 2EF9A 1BPLB 1SJDA 4DF2A 5D9NA 3EKGA 5C9ZA 3LLDA 3ARTA 1DQXA 2Y7EA 1HKIA 3AWNA 3VCNA 3VUSA 3DH7A 1LL4A 4DX3A 3H54A 2QLYA 2V5BA 1F2JA 3AFBA 2ZUMA 4M3PA 4D6HA 1E0UA 3G2GA 4DVOA 1ONXA 1IZCA 1CCWB 3LM3A 3W75A 4H19A 3V35A 5I78A 4FX8A 2VXNA 1TE1A 2X1RA 2X05A 2PDPA 3MBFA 3QY7A 5HMFA 4BQ4A 3QZ6A 2ZICA 4GQBA 4HK6A 1R2RA 4GZ7A 2V3GA 2ZADA 4S3FA 3WQ4A 3RG6A 5M3WA 4KRTA 3W7QA 4JTKA 5K9CA 3UXLA 2O9PA 4W86A 3SY1A 5M2FX 3GC4A 1OFPA 4DAFA 4RV3A 1QPQA 5DMMA 1LOSA 3KTXA 1JNDA 2PP1A 5D04C 5IDIA 5HUPA 2CLLA 3VCCA 4PE8A 4H9YA 3H2CA 4S3KA 3EWCA 3GY1A 2DEPA 2E6YA 4DO4A 1DQWA 1QOXA 2FFIA 2RFGA 2A85A 2QMJA 3BG3A 4P61A 1MVYA 3MSDA 2OXNA 3WNPA 1IEWA 3MI6A 5LIWX 1SO3A 2B4GA 4QEHA 4LEFA 4XX6A 1SW7A 1F3WA 4KEVA 3BLEA 1VFOA 1M68A 3F2DA 1UZHA 1XIHA 3EAUA 4XZWA 4HNLA 1XIFA 1ML1A 5AECA 5IDZA 5IOBA 3HO8A 4PUUA 5F4XA 1ZBCA 3FXGA 4IICA 1GKRA 5BU9A 2DIEA 3WK1A 1JYXA 2BLEA 2VFGA 4DQWA 3IIOA 3LBOA 4QCEA 1OYAA 3W73A 4GH3A 3REQB 3LPFA 3PBVA 3HG4A 5CAKA 2V82A 3S5YA 2RGLA 1V4YA 4LRSA 1HL9A 4XUGA 3EOLA 2Y6ZA 3MDWA 4DLMA 2BNJA 1CGVA 1FY6A 3IJ9A 4L80A 2JKEA 3GC2A 3LK6A 3S9IA 1OFOA 4PMOA 3ONBA 3ABXA 4ADTA 4GX8A 1B57A 4IUGA 3ZOAA 3PK7A 6XIAA 1L0PA 4JAWA 2ZX7A 4S1FA 3A4XA 2CKRA 4H9MA 1SFJA 4CUCA 3WLPA 2FB3A 3A5VA 5CZJA 3F5KA 5GPRA 2GGEA 5DY2A 3KOYA 2HVOA 2OR2A 2W3ZA 3MMUA 2ZE3A 4UMAA 4H9ZA 3GDTA 5AC7A 4TVDA 1E1FA 1Q85A 3CAVA 4W8BA 3VE7A 4CQDA 2QAPA 1KTNA 3S6DA 1W2VA 4DJEC 4LYPA 3P14A 4C1NA 1KO0A 4C6KA 3F7JA 1XH2A 5HOSA 1L8NA 1PZ2A 2D3LA 3VGDA 2VX5A 3ATYA 5CBJA 3WQFA 3W00A 4FLOA 1XRFA 1KXTA 3TN3A 3FXYA 4JTEA 2Q8LA 1KGUA 2C7FA 3T07A 3S5ZA 4DJFA 3EA2A 4WSHA 1J2BA 1ISXA 4HN8A 2FTWA 4W88A 3QZEA 4CKQA 5LIKX 2H9AB 3E0WA 2KZHA 3L4XA 3EOEA 1UWRA 3VZXA 2F2KA 5C9UA 2QGHA 3DFPA 3M5VA 1FWAC 2UY5A 2YZRA 4AZIA 2GWGA 3GU1A 4AVOA 4C6IA 3MAN