3TE9A

1.8 angstrom resolution crystal structure of k135m mutant of transaldolase b (tala) from francisella tularensis in complex with fructose 6-phosphate
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
320
structure length
310
Chain Sequence
QKSVLEQLKQVTMVVADTGDFELIKKYKPVDATTNPSLILKAVKEQKYSNLVAETISKVKANNPDLNSDDLVKEIAIEILVSFGIKILDVIEGKVSSEVDARVSFNSATTIDYAKRIIARYESNGIPKDRVLIMIAATWEGIKAAKLLQKEGINCNLTLIFDKAQAKACAEAGVYLVSPFVGRITDWQMQQNNLKTFPAIADDDGVNSVKAIYKLYKSHGFKTIVMGASFRNVEQVIALAGCDALTISPVLLEELKNRDEHLEVKLTQISEADFRWLMNENAMATHKLAEGIRLFTKDTIELENIIKQNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transaldolase
publication title Adherence to Burgi-Dunitz stereochemical principles requires significant structural rearrangements in Schiff-base formation: insights from transaldolase complexes.
pubmed doi rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Transferase
total genus 138
structure length 310
sequence length 320
chains with identical sequence B
ec nomenclature ec 2.2.1.2: Transaldolase.
pdb deposition date 2011-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00923 TAL_FSA Transaldolase/Fructose-6-phosphate aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3te9A00
1TTIA 3STEA 2EF9A 2J6XA 4YCOA 2A85A 4TO8A 4L4LA 4MFDA 3UNDA 2WPBA 3M5YA 4NJJA 5HWNA 1K8YA 1BWLA 4E2DA 2RKXA 3W7RA 4QIUA 4AXKA 2W79A 3HBLA 4ZQMA 4HSOA 3PBYA 4PL1A 5BMXA 3W84A 4JTTA 1PCKA 1FCVA 3E49A 3NYZA 3LM7A 3M44A 1SQ7A 5F1VA 4WJEA 1YPIA 4ADTA 2DJXA 3HO8A 1FWNA 1MEWA 4W9TA 3S1WA 3UD6A 4TR9A 1SO5A 4LC8A 5DY3A 4NJKA 5F1UA 3W9ZA 2ZA3A 1WYIA 3NDOA 5G1YA 1M5WA 1SR9A 5KZDA 5TQLA 4MY8A 3GAKA 4ADSA 4ZMGA 4QNEA 4O18A 4HPJA 1THFD 4NNCA 1SU5A 2X2GA 3O8AA 4MYXA 4X2RA 1G7VA 1SO4A 1Q6OA 3IEBA 3LX9A 3CM4A 4QQ3A 1AW2A 3TXVA 4N6FA 3SW6A 2DU2A 4Y8FA 4ZQRA 4GE8A 4LUJA 4EF8A 1Z42A 1EUAA 4O1CA 3MI6A 4JD4A 4LC6A 4UFLA 1F5ZA 1S5WA 4O16A 3HG4A 4DEFA 4HKPA 1ME7A 3BLIA 3DBPA 3LV6A 1AL7A 1JQXA 3NQCA 1F2JA 3CT7A 1KTCA 1L9WA 3EWUA 5AHMA 3UQNA 3N2MA 1H1YA 2X1UA 1RR2A 2QCDB 1Y0EA 1M6JA 3EXSA 4PTNA 4TIMA 1YDOA 3S1UA 3TSBA 1GEQA 4UNKA 3VE7A 3S9YA 4IMFA 5H2ZA 3FLUA 5LGZA 3W88A 1HG3A 3TKFA 3U2OA 1RQBA 1W3NA 2C15A 1OFDA 1TSIA 2VEKA 1A5SA 3LHYA 2C16A 3G1HA 5FESA 1KM4A 5KITA 1OX4B 3NQVA 4MZ8A 1LRQA 4IXXA 3HPZA 1R30A 3NQFA 3WJWA 2AAMA 2NX1A 1MO0A 1XUUA 2JGYA 1WDWA 1C8VA 1XXXA 2Z6IA 3GR7A 3G1YA 1W3TA 3G0XA 3MHFA 4BI5A 3E12A 4LOCA 7TIMA 1LDCA 1TQJA 3GNDA 3THQA 1MEIA 4AHQA 2QCNA 3ANYA 1WQ5A 2B7PA 6TIMA 3YPIA 2A4AA 2C18A 3LTPA 2J88A 4O15A 2B4GA 1TREA 1TIMA 1K02A 3DAQA 3OBKA 3IRDA 3VCRA 3F1QA 1UCWA 2ZZ1A 3N73A 2WJZA 3CWOX 4JDBA 4K6AA 1CX9A 3P5YA 4JXCA 1IF2A 2PRHA 1TPFA 3ATYA 1VCVA 4FNUA 4O17A 1Q45A 1KTBA 1PIIA 2CLMA 3STFA 3HPXA 4UIOA 1QCWA 4LS0A 2WO5A 1KBIA 1GG0A 2HTMA 4O52A 1ADOA 4OU1A 5EA9A 4HSNA 4RR4A 3N9RA 3IIXA 5I3KA 3BARA 2AGKA 3A24A 5D03A 1GPWA 4TMCA 2ABAA 1JR1A 3KAOA 1LYXA 3C56A 3TJXA 4NU7A 4O4WA 3OEXA 4Q4KA 2V30A 2EHHA 4PFMA 3TQ0A 4ALDA 3BGJA 1XBYA 1OFOA 3BG5A 3W7CA 1EX5A 3CU2A 4Z1BA 3NA8A 4DELA 1DQXA 4GUGA 2Y88A 4EOUA 3HPSA 3PWAA 1EPXA 1YXDA 4GRSA 1V7YA 1UJPA 4MKNA 5LNSA 1OFRA 2X30A 1BWKA 2VFDA 3N2XA 5BNKA 5E1QA 1TPVA 1S5VA 4OWGA 2QCMA 2FDSA 3EKLA 4MVAA 4AEOA 3EX1A 4B5NA 4MY1A 4ML9A 4QNWA 4IXHA 3NG3A 4JX4A 4OE7A 1W5MA 3LXBA 1H5YA 4FNTA 1ALDA 3IIOA 3N19B 3OVPA 4R53A 3WJZA 4NUWA 2VELA 3G22A 5BW6A 2ZZ5A 1F73A 2QJGA 4ZQCA 4OBTA 3NPXA 1O60A 4UFMA 3UPWA 2R8WA 3EWBX 3IGSA 1XUZA 3NPWA 1A5AA 1LORA 3HG2A 1W5NA 2QAPA 1G4TA 1SFJA 3I65A 3UYCA 3W7MA 4WXZA 3MBFA 3QPYA 2E5DA 3MBDA 2BSLA 5F2LA 3ABRA 3G8EA 1QNVA 3HG5A 2A7NA 3MP4A 1WA3A 2J27A 2QDGA 3P80A 4MZYA 4MLRA 2E6DA 1JCNA 4FXSA 1FCBA 5DBTA 5CSRA 4N4PA 3GAYA 1TPDA 1VYRA 2WSRA 1IIHA 4IX0A 3DKLA 5D2XA 2RH9A 1XI3A 3M41A 1RV8A 2BLEA 2HSAA 2NZLA 1EWDA 4GBUA 4XTDA 1LCOA 5I3HA 1VLIA 1ZENA 2WSQA 3GDKA 3QFEA 2O7QA 4TMBA 3CB8A 2DJLA 1LBFA 3E02A 3FIGA 1RZMA 1A5CA 2DORA 1XCFA 4N2YA 1TO3A 1RQEA 5AHEA 1S3HA 3K30A 1IXNA 5AFDA 4UCGA 3B04A 4ZVJA 3FS2A 3BK0A 4JS3A 3PF3A 4PL2A 1I45A 5AC6A 2D73A 4JTJA 3S42A 3SY5A 1VCFA 4KFOA 1TPB1 1XL9A 3G1XA 2EGZA 4JTIA 3W7QA 3O16A 3L68A 3E9AA 4HPXA 3W1LA 2QCGA 1MEHA 1UBSA 2P1FA 4UXDA 1MZHA 2DZSA 4G1KA 3O05A 5HJLA 3TW6A 2PE4A 2NWRA 3M9YA 4BF9A 1QWGA 5LGXA 3VKJA 4CQ9A 4X9SA 3NQEA 2ZRWA 2BXVA 1KFBA 4LVDA 4HIBA 3IIVA 5D37A 2B7OA 3IVTA 3NXFA 1GTEA 1QO2A 2VOMA 5CPOA 1R2TA 3L5MA 1H62A 5DN1A 3T78A 3GVGA 4QSHA 3W1MA 1B4EA 4NX0A 4IUOA 3TQKA 4PCFA 1DQWA 1FY6A 2PRMA 2JKEA 3WK1A 4AWTA 3ABQA 2XN1A 3O06A 3IVSA 1OHLA 5I3FA 3QRHA 3W85A 3KVJA 1FCUA 3ABOA 1QO5A 2VEMA 3NL2A 1QPNA 1DJNA 2KZHA 4PA8A 1CW2A 5HUPA 4GUHA 3NZ1A 4YWIA 3C2FA 2E09A 2Q3OA 5LNUA 3FOKA 2TRSA 1KM2A 3DU0A 1QAPA 4Z1CA 2PC4A 3HOJA 4WXYA 1F74A 3USBA 1KBJA 3M5XA 4RXFA 5C2XA 1S5TA 1WAUA 3P7YA 5HWMA 3SZ8A 2W6RA 3JRKA 5G5IA 3GDRA 1FCQA 1BKSA 1RVGA 2ZTKA 2DZXA 3A22A 4LV4A 1X6UA 2CWNA 3W1TA 3QF0A 4O4VA 1ZY9A 3MMTA 2GOUA 3R2GA 4JEQA 2Y7EA 1IXPA 1OFQA 1W5QA 2Z2UA 2ATSA 4H3DA 3FFSA 3W2NA 3H55A 1BTMA 4JYFA 5AOUA 4O53A 4TX9A 5BMWA 3KVKA 1VQTA 1H7XA 2R91A 4NNAA 1HFBA 5AB3A 2V0TA 3KRSA 3VNDA 3W71A 1FX6A 3S1VA 2YCEA 1TPC1 1ZCOA 4I7VA 4K7YA 3TA6A 1W8SA 1RQHA 1YADA 2A1YA 4Q32A 1JQVA 2WNNA 4FX6M 4C1LA 1Z44A 3DI0A 4EIVA 2ZZ7A 3PBUA 3NM3A 5D04C 3BGGA 1XBXA 1GVOA 2A2IA 1LROA 3B03A 1AW1A 2F7FA 4O11A 4BR1A 1NVMA 3N3MA 3PUEA 3QSTA 4WY0A 5AYZA 4HNNA 2E6FA 2VFIA 3LV5A 4XTIA 3W87A 1YTEA 5HUOA 8TIMA 1FDJA 1WOBA 2VFEA 2A7RA 5FF2A 2QCDA 2PCQA 3AO0A 5AYXA 5D2WA 5EBUA 2WV8A 2B7QA 1SZFA 2YDAA 3EX3A 3UWVA 4UFHA 1XFBA 3TXZA 4GUIA 4CCCA 2NX3A 2R14A 3PSWA 1LBMA 1LM1A 2VXNA 3O1NA 3HMJG 1R46A 4K37A 3NQAA 4S2CA 1I2PA 1H61A 4CNNA 3TE9A 2NXHA 1YXYA 1ZALA 1ML1A 2QDHA 1K7XA 1XDMA 1ZAJA 3NQMA 3P81A 3W86A 3MHUA 2CZDA 3TROA 2NUYA 5AC7A 3SI9A 3DZ1A 4TU1A 3R8RA 1DJQA 1EIXA 5HWJA 3W2JA 1GZGA 1GVQA 4XZ9A 2GJNA 2RHGA 5J5DA 3O63A 4WX2A 4BI6A 3TFXA 1W31A 2CLIA 2GVJA 3INPA 5SWUA 1YLVA 4CNPA 5CPMA 3L9CA 2FIQA 2FB2A 3RU6A 3DHDA 4R33A 4LW7A 3U8GA 2H90A 3C61A 3KOFA 3UY7A 3TMLA 2HS6A 3I7QA 2XFWA 5G2HA 2JGQA 3LRKA 3NPUA 5FEZA 3A5VA 3BO9A 1EUNA 1G4PA 2V5BA 3B0UX 3C4UA 3L5LA 1N8FA 3LCFA 2FTPA 3DFPA 4IMCA 3W7HA 1U5JA 1W3IA 4UTUA 4AWUA 4LS2A 2NX9A 4RV8A 2OZ0A 4OV9A 4JTKA 5C5YA 3UXDA 1W5OA 4LVBA 4WOZA 3DGRA 1Z41A 3LTYA 4O1BA 1YYAA 1HUVA 2DZPA 3CPRA 2H3BA 1YDNA 4E38A 3S8HA 3NO5A 1GJPA 4I7UA 1KFJA 2Y89A 1DHPA 3TH6A 1VPXA 1XBZA 3LBMA 1P5BA 2XN2A 4AB4A 3WJYA 1Q6RA 5CGQA 2I14A 2YR1A 2ZFAA 4HHPA 4WQ6A 2LLEA 3LHUA 2QCHA 2NXGA 5AYYA 4WY0B 2C0AA 4WZHA 4XQ6A 1HO1A 1QPQA 3NZRA 2E77A 1B57A 4A29A 4KKXA 3P62A 3QQ1A 2RFGA 1OX6A 2CZFA 1PHWA 3LB0A 3PC0A 4LVGA 3FA5A 1RD5A 2A7PA 3GDTA 3STCA 2C13A 3SGUA 3O15A 1YTKA 2ZRYA 3FYOA 2H3DA 1X1OA 2QUTA 3PAJA 2CZ5A 5AHIA 2Z1BA 3OVRA 2I1OA 2FJKA 3MUXA 1TV8A 3W1NA 3S1XA 1FWRA 3LOTA 2YFOA 4Y6GA 3T4CA 1XM3A 3W6YA 1JCMP 1R2RA 4JTSA 1M7PA 4LNYA 3TC7A 1LRNA 5E93A 1GVFA 4LV9A 2OCZA 3NQ8A 3UZ5A 5CPLA 4AF0A 3W22A 3TDFA 1KM0A 2I9EA 1Z48A 1KV5A 4RLIA 4DQWA 1K7EA 3GKAA 3EB2A 4M7TA 3W1QA 1FWTA 1KTNA 1A50A 2IQTA 2YZRA 3C2EA 1GYNA 3PUOA 4UFKA 1W0MA 5I3IA 2BX7A 2E5BA 4WOQA 2FQIA 1EA0A 1P1XA 3DXIA 3PULA 1R47A 3M5VA 1KFCA 3CTLA 3THAA 3P74A 1OG0A 2DZVA 1JCLA 3W1AA 3SECA 1M7OA 3P60A 1VRDA 1W54A 3W7PA 3V1PA 3ZWSA 3GKFA 1VHCA 4GXMA 2DZWA 1C9DA 1KM6A 2ZBTA 2QEZA 3WK0A 2GQ8A 3W75A 5D09A 3BG3A 4FIRA 1O94A 1NEYA 2TMDA 1SSDA 1T8XA 3PY2A 1XC4A 3AJXA 2WKJA 3UWWA 3BLFA 2OX1A 2QAFA 3I68A 3P61A 4Z1AA 1F7BA 5T26A 1GTHA 1N55A 4H4IA 1UUMA 4M5PA 3GXPA 3W7NA 4RZ4A 3W7GA 2B7NA 3TNOA 5K2ZA 3CIXA 3A9IA 4AAJA 4FNSA 3DFTA 3W1XA 3SGZA 1A53A 4BK9A 3KRUA 1H51A 1I2OA 2Z0IA 2ISVA 3LHTA 4M6PA 4JICA 5IBXA 5LKYA 2EKCA 3LCHA 1PHQA 3EX4A 2FPVA 4JTLA 1ME8A 4LWWA 3TUUA 1L2UA 2V5LA 1OYAA 5L6UA 1PL9A 2HS8A 1HTIA 4CCDA 5F4XA 5BOOA 3B0PA 5LSMA 2ISSA 2VC6A 5CKSA 3DENA 3MYOA 2YW3A 2Z6JA 3M16A 4ZQOA 2C1HA 2V8ZA 3IGUA 3F4WA 3DFOA 4MFEA 3BW2A 4O28A 3M0ZA 2X1TA 5LHEA 2GQAA 4M7SA 3G1AA 4LVFA 1KM1A 5A8GA 1FXQA 2FPYA 4HT3A 3N9SA 4K39A 5D30A 4O14A 1H50A 1QOQA 4NXSA 3M5ZA 3EWWA 3IGXA 3FJ6A 2E6YA 3QW3A 4NZFA 2ZRXA 3QW4B 4FXRA 1GYLA 3S5ZA 1KA9F 3LI0A 3QEZA 3M1ZA 1O4UA 1GWJA 4MJZA 2OMAA 2FB3A 4MY9A 4JY9A 2QCEA 4AF0B 3P67A 4RJEA 1H7PA 2TYSA 3HQ1A 3TC6A 1TPUA 3SSJA 1DVJA 1TPH1 2VFFA 4FNRA 4JTUA 3RLUA 4CNOA 1UASA 3W23A 1Q6QA 3E96A 3W7DA 4IQLA 4DPPA 1D3GA 3GR8A 4CQ8A 5IBXC 2CLKA 1AL8A 5G4EA 3NR0A 3NGJA 4UFJA 4JR5A 1EP1A 5DBUA 3UZJA 4EWND 4RXGA 2A6LA 3BVJA 2DZTA 3B06A 4JY8A 3W2UA 3FKRA 5AN7A 4WUIA 4AHOA 3TMQA 1G4SA 4DPQA 3ATZA 3P84A 1LLZA 1B3OA 4NZJA 1Q6LA 3OA3A 3EEGA 1O5KA 1TV7A 4MZ1A 3I7SA 3W7IA 4S1FA 4K8HA 2ZZ2A 1NSJA 3GX9A 4NX5A 5DELA 1QFEA 5K9DA 5HR6A 3W74A 4FEZA 1B9BA 1FUYA 1H7NA 4JDYA 3LCXA 2VFGA 1N7KA 1A5BA 2XN0A 4MPQA 3NL3A 3EWXA 5U4NA 2V2CA 5TIMA 3EWYA 3W07A 2ZQ0A 4M6VA 3MI3A 5EYWA 2GPTA 5KZMA 3NL5A 2RDUA 1VCGA 4UFIA 1V5XA 4FF7A 2B0MA 4LU0A 1IGSA 1SO3A 2BTMA 5DY2A 2CLEA 1PVNA 1I2RA 2CFFA 4FX8A 3LCWA 1DOSA 4GFSA 3TX9A 1TJRA 2QUUA 3QZEA 4Y9AA 1FWSA 4MUZA 4WD0A 3L67A 4NNBA 4UMAA 4BFAA 1VS1A 2O7SA 3SJ3A 4QITA 4LVAA 1ZHAA 1SSGA 1RPXA 1GG1A 5HNRA 3M7WA 2NUWA 1ZJIA 4OV4A 5G4WA 4DBEA 2GVLA 4PEKA 1IXOA 4AMAA 3O6YX 3JS3A 3LHZA 4JYEA 2YFNA 4IPIA 4Y96A 1HO4A 5U7SA 3B8DA 1TPWA 5LZLA 2Y63A 2ZCGA 3S6DA 4Y90A 3UY8A 4O0KA 4RK8A 1LZOA 1OFPA 5FEPA 3TIMA 4ZQPA 3MP3A 5LNRA 3FEMA 4FNPA 4N9CA 3UWUA 4KWVA 2Q8ZA 2VKZG 3G0UA 4UMBA 1DORA 4XBKA 2W0UA 3UXAA 2YW4A 4R34A 1OFEA 1FBAA 2Y85A 5DXXA 5DLCA 4X3ZA 2NUXA 4OHQA 4Z0JA 3R5EA 3B05A 3LCGA 2CLLA 2Y7FA 2QCCA 4O8RA 3TSMA 1P0KA 2F84A 3NM1A 1H7WA 2Q8LA 3NOEA 3NNTA 1AMKA 2ALDA 4P61A 5C55A 3HGRA 5CG7A 2QF7A 3NQGA 4HNUA 5E0KA 4AHPA 3M43A 1K8XA 1I4NA 3LDVA 3PB2A 3QQ0A 1EP3A 2GVGA 2NWSA 4N4QA 3E0IA 1OF6A 2NXIA 1UUOA 1P4CA 3LRMA 5EKYA 5EL1A 1OFAA 3L66A 3NEVA 2OJPA 3ZS4A 2V2DA 1R2SA 1QDSA 4O10A 4R7JA 2H8XA 1PS9A 1JJKA 3PVFA 4UR7A 5L9FA 1TMHA 3TW7A 4OT7A 4MOZA 1PE1A 3DH7A 2ZRZA 1VC4A 4MYAA 2J9ZA 3IV3A 1W37A 2ZYFA 3WJXA 3EKZA 3WFAA 1JVNA 3DHFA 3QSRA 1JUBA 1TJPA 3RNDA 4QISA 5HULA 5BRBA 4KFNA 3GZ3A 1K3UA 3TJLA 1OJXA 3DKJA 3QJAA 3C2RA 1SPQA 1H1ZA 1NF7A 1OX5A 4MIMA 4AH7A 2TPSA 3RK8A 5LHFA 4YL2A 1VGAA 1SZNA 1ZAIA 5D2VA 2WSYA 4JIPA 2A21A 3PR2A 2BWGA 3C3NA 3ABSA 3A23A 5D2YA 3TU9A 4N9BA 1TB3A 2H8ZA 4QAIA 4U28A 5CSSA 3W7EA 5D2TA 3UWZA 4DBDA 4IJBA 4DF1A 1GVRA 3S5YA 3KXQA 4YLWA 3G1SA 4A2SA 2QUVA 4K36A 3TQVA 4RCXA 2V2HA 4BI7A 1TRIA 3L2IA 3HB9A 3HIJA 3W83A 4WY0F 2C6QA 4ICNA 1H7OA 3PG8A 3W7OA 5LNVA 5AHLA 1AK5A 3GDLA 3CC1A 3L65A 3PUDA 4RZ5A 1FQ0A 2VFHA 5HINA 1VH7A 3QYQA 4NVTA 1W5PA 1WBHA 5A5WA 4AVFA 1LRTA 5G1TA 1XBVA 1GT8A 3QH2A 1B4KA 4N02A 4NXKA 3L5AA 3MI2A 4K7VA 4POCA 4O13A 3DI1A 3ELFA 3B4UA 3HG3A 4LS1A 2TSYA 1EB3A 1X7FA 3C8FA 1ICPA 2GUUA 2QR6A 3EXRA 1NF0A 1KV8A 3N14A 1JULA 4HN4A 4UTLA 2DZUA 2V81A 2CW6A 5F4SA 5HMSA 3RLVA 2GJLA 1F76A 4JTFA 2CLHA 3FKKA 4N9EA 3RMJA 1AG1O 4K8EA 2PRLA 5D32A 1VR6A 4ZZ9A 1F05A 1O5XA 2C19A 3FYPA 3W2LA 1YPFA 3IIZA 5ABTA 3CWNA 1KFKA 4JTEA 1OF8A 3P82A 3LLDA 1Q3NA 4JX6A 5KSWA 1TCDA 1FXPA 4UUIA 3JR2A 3A21A 2Q3RA 3W76A 4JTHA 3LHVA 3NPVA 2ZZ4A 2X1RA 2C14A 4NJIA 2E1DA 1H60A 3C6CA 5K9XA 1MXSA 5I3JA 1QPOA 5F2GA 3ZR4A 4IX2A 3GDMA 4S2BA 1OVDA 1G4EA 3W1UA 2JK2A 3QMSA 1P0NA 5HR7A 4O57A 1QPRA 1QOPA 5FF0A 3VI2A 2RDWA 4E2BA 1KW1A 1VZWA 4JYDA 3VFLA 4X22A 4LRTA 2X1SA 3EXTA 1G69A 1TTPA 4UNLA 3BV4A 4A22A 3S5OA 3SIZA 1KM5A 1XKYA 1F6KA 1UB3A 1IXQA 1TYGA 4IMDA 3W7KA 3G0SA 4DO4A 3QPZA 5FF7A 4DF0A 2AQWA 4UTMA 2ATMA 2V9DA 4UMCA 3T44A 4LT9A 3EX2A 2CLFA 3LCIA 1G67A 1ZFJA 4KFPA 2Y6ZA 4DF2A 4FHAA 5CZSA 3LERA 1C29A 3PBWA 3CLMA 2QKFA 4CLMA 3VE9A 1OYCA 4MLJA 6ALDA 1K7FA 1SFLA 3MP5A 4NQ1A 1TRDA 2YSWA 4I9AA 4FB7A 1JUKA 2GQ9A 3W2MA 5K7JA 3LGEA 5K3VA 3W2KA 2VEPA 2CU0A 3BLEA 3NQ2A 4XUGA 3FJLA 5CZJA 3OHIA 5DCBA 1LLWA 2PURA 2H6RA 3LHWA 1TTJA 2ISWA 3GXTA 5G2IA 4H6KA 4ZL1A 5FEXA 4O1DA 4UTTA 3MJYA 3TV8A 4IOTA 4O1AA 4DO6A 5K4XA 5H91A 4FX7A 2ZA1A 1X8FA 2RDTA 5F4WA 1JRCA 3HF3A 4LRSA 3GB6A 1L6SA 1TPEA 1U83A 1WX0A 4XKYA 3G1VA 3GNNA 3QC3A 1KFLA 3HGOA 1J2WA 4Z0SA 1D9EA 4FIQA 3DFQA 4I7WA 2YXGA 3R12A 3L0GA 1TV5A 1JCXA 3LBCA 1JRBA 3UWQA 3M6YA 3KRZA 1LOLA 5MHBA 1DBTA 1SW7A 2ZZ3A 1AW5A 2ZRVA 4IMGA 4KWWA 1OK4A 1NAL1 3TAKA 1WOAA 4QM1A 3GLCA 1G7UA 3MYPA 5CZTA 3U6WA 1OK6A 5F2IA 2FFCA 4L4MA 3O6DA 5HQEA 2YGYA 4XWUA 4A3UA 3SFKA 3TR2A 5KMYA 4O0ZA 2E68A 1DL3A 2E5CA 3H53A 4GWEA 3DFNA 3NL6A 3Q37A 5IM51 1ONRA 2FLIA 2QCLA 4O50A 3W1PA 1I8JA 4O19A 1DV7A 3MWAA 4PH6A 3Q2DA 4O12A 4UTIA 2J9YA 3CHVA 4BWLA 4M19A 2YX0A 5K4ZA 3L0NA 1SZEA 3QM3A 5EY5A 4UTTC 5FF4A 3BW3A 5D05A 1K03A 5AHNA 1ZNNA 3W70A 1YDVA 2ZDRA 3TSDA 3IIPA 4IMEA 3RF9A 3NQ6A 3L0KA 1PCWA 4DXVA 4JTGA 1VYSX 3TFCA 5K9CA 5CPNA 4AWSA 5I3GA 1SUXA 3LLFA 3G3MA 5C6MA 1EP2A 1O95A 1EEPA 4IWWA 2Y62A 3PG9A 1D3HA 2YPIA 2FPTA 2A0NA 3G8RA 2QCFA 1XDLA 2C3ZA 1J4EA 4GUJA 4A21A 4U4MA 1WV2A 3DFSA 3LXCA 4UR8A 3WK3A 1VLWA 1ZAHA 3LTSA 2ZTJA 3F03K 1OYBA 4NJGA 3N34A 3L21A 4CCEA 3C2OA 3HJZA 2E6AA 2ABBA 1I2QA 2J9XA 3GXNA 3BW4A 1LOSA 2JBMA 3P5ZA 2CZEA 4EF9A 1L6YA 1EWEA 1G6CA 1FDZA 4K38A 1SO6A 4P2VA 3GK0A 4N6EA 4BWLC 3MHGA 3OG3A 3TAOA 1FWWA 1CI1A 3P8JA 4XKYB 1TQXA 3Q94A 5D33A 1BEUA 2G96A 4ORMA 5KZEA 5GVJA 3KFTA 1GOXA 2EAWA 4GUFA 4UTWA 4C1KA 3NQ7A 3TK7A 1QR7A 5D02A 2A6NA 1FDYA 5FEWA 2Y61A 1WXJA 4LUIA 1T96A 5AHFA 3M47A 2QJIA 4FO4A 1NFBA 4GNJA 3PS7A 3ZFHA 3PBVA 2ZA2A 1OFBA 1HL2A 2Y7GA 4N9DA 3S0CA 2CLOA 4GJ1A 4RX0A 4JN6A 2P10A 1J5TA 1LOQA 3I7RA 4HNVA 3PB0A 4ORIA 2NV1A 4A2RA 1ICQA 5D38A 1W56A 4FNQA 3C2VA 2DP3A 4YXGA 1WBJA 3KX6A 2G5WA 2G97A 4YMZA 3CEPA 1ICSA 4UTKA 3BG9A 3V75A 3LRLA 2WNZA 3G1FA 3KHJA 5EMUA 3CQ0A 3OIXA 1KLZA 2EPHA 2ZRUA 1LTDA 1MSSA 2WQPA 3W73A 4JIQA 1JCYA 2P0OA 3NQDA 3I6RA 3B0VC 3G18A 1SZGA 3T7VA 3H54A 4JGDA 3W1RA 4JNMA 1I2NA 4LTSA 5FF3A 3C52A 5G2WA 3GIYA 1YXCA 3UPBA 4ZQNA 5AC8A 1KLYA 2YYUA 3CEUA 5F2MA 3WK2A 1JCJA 3RFAA 4Z08A 4E0CA 1JUEA 3WJSA 4GC4A 3R89A 3C0JA 4JX5A 4UTWC 4ONVA 2NLIA 3EWZA 4J9JA 2YYTA 3CIWA 2Y70A 1SW3A 1W1ZA 3EX6A 1PV8A 1KM3A 3O07A 3T55A 3IVUA 4O54A 2JKPA 3BPWA 3HGJA 4QJ1A 4D2JA 3R13A 4IPJA 4EVZA 5LNWA 3KVMA 1E51A 3LCLA 3P8IA 4UTHA 3PM6A 3SR7A 4RZ6A 3D0CA 1VYPX 4IGHA 1LP6A 3LI1A 4Q33A 3O6CA 3G3DA 4PC8A 1SW0A 1T0OA 3GYEA 4ADUA 1DKWA 1K8ZA 2UV8G 3NAVA 2NV2A 3F4NA 4UC5A 1GQNA 3S5NA 3T40A 1ME9A 3STGA 3MO7A 4RKAA 1T99A 5TBOA 1YTDA 3QMRA 2VENA 1LBLA 3QMTA 5DCEA 1KFEA 1VHNA 2Y7DA 1L6WA 5DXYA 2X16A 3W7LA 4HNTA 5DCDA 1H7RA 1H63A 2WNQA 4NT0A 2OT0A 2BZNA 3ZWTA 4CQAA 4NJHA 3W7JA 5KTLA 1TTQA 2J24A 4Z1DA 4DO5A 3LXAA 2ZZ6A 3G24A 3HGSA 2G95A 2R94A 1IIGA 1VJIA 4OQVA 1F6PA 4XBSA 2JKAA 4PODA 2V82A 5KINA 3G1DA 1X1ZA 4UTJA 2HMCA 3W3OA 5EPDA 4M6QA 3W72A 5C54A 3MW7A 3A5FA 2OT1A 3NVTA 2QJHA 5J5RA 3PSVA 3OVQA 4YCPA 1GVSA 5CZ0A 2VEIA 5FI8A 2A5HA 3TCEA 3UWYA 1OABA 2WOQA 3Q58A 1QMLA 4LY8A 3KVLA 1OX4A 4OGZA 4MJMA
chains in the Genus database with same CATH superfamily
2Z24A 4G8TA 4RDYA 1K8YA 1BWLA 3MCOA 3H2MA 3LZ5A 2GGEA 3HBLA 4ZQMA 4HSOA 4D6FA 2VZVA 4JTTA 1PCKA 3E49A 3NYZA 3BLLA 3LM7A 4W5UA 3QV7A 1SQ7A 3ARRA 3VKBA 1MEWA 1NOWA 2NT0A 4P7RA 3GIQA 2VD9A 4FALA 1LWJA 1JXKA 4LCQA 3NDOA 1GORA 5G1YA 2Y8VA 3BH4A 3JU2A 2CBUA 1AH0A 4LJ3A 1NFPA 3EOUA 4ADSA 4QNEA 4O18A 4HPJA 4ZO8A 4NNCA 1HQTA 1K9DA 3O8AA 4X2RA 4XAGA 4PCSA 1G7VA 2BB0A 1GKRA 3IEBA 2CYGA 3VOHA 1XSIA 4N6FA 4HCHA 1NTHA 3A4WA 3L4TA 4LSBA 4ZQRA 2OSWA 3TA9A 3OW1A 4H6RA 2WMIA 3O2LA 5C9ZA 2DIKA 4XX6A 4C1NB 2XIMA 1IZCA 2J7HA 4O1CA 3MI6A 1Y5WA 4YNGA 3E5PA 4JD4A 3QR0A 2HXUA 3OLDA 1KWKA 3ZT5A 3CK5A 5JUVA 2VWTA 3RHGA 4AU0A 4Z17A 2XIJA 1L9WA 3EOEA 3T0CA 3OGSA 2PEVA 1RR2A 2QCDB 1M6JA 3EXSA 3AS0A 3ZM8A 5I06A 3GBDA 5GPRA 1GQJA 3WUEA 3VE7A 3BCJA 4IMFA 5H2ZA 4H2HA 3F4CA 5LGZA 1W3NA 5C70A 4HMCA 1OFDA 2VEKA 4S3BA 2WZIA 3LHYA 3UJRA 2PLKA 3VGFA 3K4WA 5KITA 1OX4B 4MZ8A 2FHCA 1LRQA 2DUXA 3AYVA 4EP8C 1XUUA 1XXXA 3GYCA 2Z6IA 3GC5A 1RJQA 4BI5A 3E12A 4LUTA 5C7HA 1LDCA 1TQJA 3GNDA 2QZRA 3RMEA 1MEIA 3THQA 1TVPA 3PZGA 1ZUAX 1JYNA 2GK1A 2YCKX 3YPIA 2B4GA 1H41A 2XIBA 2WJZA 2EG6A 5HK4A 2PRHA 1P48A 4FNUA 3LPOA 4JTRA 3VXGA 2CLMA 3STFA 3HPXA 3WD0A 3WLTA 2PDXA 2JE8A 2WO5A 5IDZA 3BICA 3ONCA 5HJYA 4OU1A 1XF0A 5EA9A 2PGFA 3TW9A 2PBGA 5I3KA 4IGSA 3IJ7A 2AGKA 2QUNA 4TMCA 4BQ5A 2WMFA 2D24A 3MJMA 1XH1A 1DPMA 1KR1A 3DUGA 3GFYA 1ZSXA 4KPLA 3QV9A 2PTZA 3OB8A 4GG9A 8RUCA 5GNXA 1EX5A 4KIRA 2E3ZA 2CBIA 4FR6A 3T6CA 1YMYA 4MGGA 1R9XA 2WMIB 1BQCA 4KGLA 3CGTA 3HPSA 4CN4A 3AMCA 2XGZA 1BWKA 3N2XA 2IQ0A 5BNKA 3TC3A 1JZ5A 3SUUA 1S5VA 2PLMA 1TR1A 3O6AA 2NQJA 1MRAA 4LAMA 4AVNA 4HZ7A 4AEOA 4B5NA 4ML9A 2VEGA 3RO8A 3VYLA 1XD1A 4JX4A 4A3HA 1NWTA 5FSEC 3LXBA 1U2YA 1ALDA 1XRVA 3QHNA 3OVPA 3WJZA 2VELA 3G22A 1F73A 2QJGA 3TWAA 2BHUA 4XAPA 3V5OA 4UFMA 4U2ZA 3WO8A 1PPIA 2PDGA 1E73M 4FMVA 3HG2A 2QAPA 3RM9A 3I65A 3W7MA 2Z2AA 4HHMA 3QPYA 3MBDA 2BSLA 1KKRA 5DRCA 4HP5A 3B8WA 3G8EA 3VD4A 3PP7A 1GOMA 2QDGA 2AMGA 3P80A 4LUTB 4FXSA 5A8NA 2J7FA 4LFYA 3PFRA 4Y2WA 1TPDA 2DT1A 1IIHA 1GVIA 1UP3A 3TZFA 4ATDA 2RH9A 1RV8A 4DWDA 1AJZA 2O4MA 4NAFA 1B3WA 4XTDA 5E70A 3KOZA 1LCOA 3AIEA 1ZENA 2WSQA 4Q8QA 3QFEA 2O7QA 3N3TA 4TMBA 3WDHA 1LBFA 4MTVA 2F6XA 5REQA 1R7OA 5LIWX 3W25A 2WM0A 2AKZA 4FI4A 3KBMA 1TO3A 4HOXA 3S3GA 1W32A 1RQEA 2OYKA 1S3HA 3AXXA 3TYBA 2X0HA 1IXNA 5AFDA 2QUMA 3B04A 1HZYA 1OCBA 4NZ1A 4JS3A 4PL2A 4F40A 1I45A 1UD5A 2HPMA 1EJRC 1VCFA 3GH5A 3K1GA 1CTNA 2CLPA 3CUXA 1J79A 2BGNE 3W1LA 4UXDA 5CLTA 1JZ2A 1OSEA 2DZSA 2GUYA 2NWRA 4XAFA 1EHNA 2PDFA 4CQ9A 4X9SA 1L8PA 2B7OA 1GTEA 1QO2A 1ISXA 4ZBCA 3T4WA 1T8QA 5PTDA 2VOMA 1FWBC 2ZUVA 3AZTA 3T78A 1KBKA 4QSHA 4A8IA 1B4EA 1NOFA 4FR1A 1BRLA 2XN1A 1JL8A 5AZ1A 3UGRA 5M3WA 2UWFA 3KVJA 3EYPA 3TN6A 2VEMA 3MV01 4LYPA 1DJNA 2B31A 4GX8A 3AMLA 4FS9A 1GZ1A 3BTNA 3EAUA 4GUHA 1MWOA 2Y8KA 1VFTA 1HKMA 3C2FA 4G9PA 3FOKA 1KM2A 3OGVA 3CV2A 4WXYA 4JTAA 1KBJA 5C2XA 4UQEA 1S5TA 4IH3A 4L65A 3VO0A 3SZ8A 5TNVA 2W6RA 5G5IA 4YTTA 4RUBA 4AEFA 4XZLX 1RVGA 2ZTKA 4PUUA 1DWHM 1ZY9A 1CXLA 3MMTA 2GOUA 4JEQA 2Y7EA 1W5QA 3KZSA 4S3GA 3KCJA 4MF4A 3SCSA 3FFSA 4NAFB 3H55A 3SCPA 3BOXA 1BTMA 2WCAA 3D3AA 4XO7A 5AOUA 4TX9A 3ZO9A 1VQTA 3QY8A 2OR2A 3BMXA 3UU0A 5REQB 3L4YA 4CGTA 1FFQA 3FXYA 3VKCA 3W71A 2WZMA 1FX6A 2ZUWA 1TPC1 2DSWA 1ZCOA 3N2BA 4I7VA 5I02A 1YADA 4U3CA 2CCRA 1J2BA 3ERPA 4E6MA 1LQ0A 2WNNA 2OOGA 4C1LA 1Z44A 1W9XA 3WQVA 1L2QA 3PBUA 1IWBA 1GVOA 2A2IA 3AIRA 1XSJA 1I75A 4PGLA 3ZLHA 2BS9A 3N3MA 2O56A 4JIEA 4RDVA 4XZHA 2PGEA 4F2BA 1B54A 3GUWA 1J6OA 2CESA 2E6FA 4GQ0A 3W87A 5C9RA 1LL4A 1WOBA 2A7RA 3F2CA 1PKLA 2Z1SA 2DH3A 1EKOA 1Y5XA 2QULA 3UWVA 1RAKA 4PMRA 4GUIA 2NX3A 2R14A 1BLIA 2ZX6A 5DT7A 3AIVA 2D0GA 3UXLA 3NQAA 4TV5A 4S2CA 4K68A 3FEQA 1I2PA 4CNNA 1YXYA 1ZALA 1ML1A 5I78A 1XDMA 1IE7C 2J7CA 1ZL1A 3TROA 4D71A 1HL9A 1QW7A 5HWJA 1GZGA 5IHSA 1S1PA 4LX4A 4WJXA 2Q09A 2WWCA 2GVJA 4F0HA 3T08A 1JD9A 2XVKA 1YE4A 4AD1A 3P2VA 2FIQA 2DGAA 4JAWA 3ABZA 2PF8A 4KCVA 4TV6A 5A8PA 2XVNA 3TMLA 3LBOA 3I7QA 5G2HA 3LRKA 5LA2A 2QJJA 3ORWA 3A5VA 3FHQA 4CD7A 3B0UX 2V5BA 1XYBA 5C71A 1UIOA 5CLWA 1TELA 3L5LA 4E5TA 4IQDA 1VJSA 3LCFA 2FTPA 1L8NA 1VEPA 2WLZA 3CH0A 2O9OA 4IM4A 3UXDA 4LVBA 4WOZA 3VKKA 1AMYA 1YYAA 1HUVA 3C8NA 2WC3A 2NQZA 4E38A 4N0RA 1GJPA 4JNZA 1QHOA 1KFJA 3TEVA 1YW1A 4GIYA 1KQYA 1VPXA 4ZENA 3LSCA 1W3JA 4AB4A 1K6AA 3RN6A 3WF4A 1TZZA 2I14A 2YR1A 1NDVA 4IFOA 3COTA 4WZHA 3T0DA 1DJWA 4NF7A 1PBGA 3K46A 3H2EA 3LYEA 1UA7A 4HA0A 5FCZA 3QQ1A 1K4HA 3LB0A 2AQOA 3K8LA 3FA5A 2ADAA 2EPKX 1BVNP 2I5GA 3IK2A 3QKZA 3ID7A 3GDTA 2DW6A 1DWGM 4DBWA 3O0KA 1E6XM 1OGBA 3VINA 2ZRYA 1F8MA 3FYOA 2H3DA 3PAJA 4J1OA 4BQ3A 3HV9A 3W1NA 2YFOA 1B2YA 1KFWA 2CWXA 2QIIA 1R2RA 1JGIA 2BY1A 1MW1A 3ARWA 1LRNA 2CHOA 1MRQA 2X41A 4YYFA 2OX4A 2CETA 3UZ5A 5CPLA 4AF0A 4FK9A 3TDFA 3L4WA 4DLMA 4S3FA 4GISA 3U5UA 3SUSA 4C91A 3W1QA 1KTNA 4ZSTA 2JEQA 1E5JA 4ZODA 1GOKA 5I3IA 1YNYA 4GX9A 4AZGA 4R5EA 4YYCA 2FQIA 4LUSB 4J3SA 3PULA 4XAYA 4BCEA 4Y9PA 3EDDA 2YIHA 1J0YA 1F3XA 1Q5MA 1E15A 1M7JA 3SECA 1M7OA 1XLKA 3T42A 5M17A 3V1PA 5HAOA 2ZX5A 5JXQA 1VHCA 4XB3A 3KP1A 4GXMA 2P76A 1U33A 1C9DA 1E1FA 2ZBTA 4QCEA 2QEZA 3E2SA 5D09A 4FOUA 2TMDA 1SSDA 3NO1A 1FA2A 1FTXA 1XC4A 4Z1AA 2AKMA 1GTHA 1N55A 3AU6A 4YTQA 1B3ZA 1RCQA 1V02A 3GXIA 3M0HA 3N12A 4NHVA 4EKJA 4P8VA 4JNYA 3TNOA 3VUPA 2IXVA 5CPTA 1ONEA 5ABFB 5CG0A 1A53A 4NKCA 1QK2A 5G4HC 3QN3A 1VBJA 1Q7ZA 1JPMA 4JICA 3F2DA 1YEYA 2PU1A 5A2BA 5EFFA 2FPVA 1E9ZB 3ISIX 4CCDA 5F4XA 5LSMA 4CN1A 2IPJA 3OYXA 1HVQA 2V8ZA 4H8HA 4C6OA 4MWAD 3DFOA 1MXDA 4RE0A 1W9UA 2X1TA 5E9AA 1TZ7A 3G1AA 2FPYA 3N9SA 4K39A 1E6NA 4O14A 3PWIA 1P0EA 4TX6A 4JEJA 1B31A 1OADA 4HOZA 3QV8A 3EWWA 3IGXA 2E6YA 3XINA 2JEPA 3LI0A 4JPGA 3H8AA 1GWJA 4MJZA 2FB3A 4A8NA 4AF0B 3ARTA 2VDIA 3PPGA 1DVJA 1TPH1 1W1A1 4FNRA 3RLUA 5E09A 3PJTA 4PTMA 3UP8A 3G5EA 1D3GA 2VX5A 3SB0A 4CQ8A 1XCXA 3NR0A 1OWQA 2D0FA 1OIFA 1EP1A 2XG9A 1POKA 4EWND 3E2RA 4DJDC 3K4DA 3NZGA 3W2UA 1CGVA 5AN7A 4UB9A 3TTEA 1XYMA 3URQA 3P84A 4DRSA 3CH9A 1XYAA 1Q4WA 1Q6LA 5FAGA 3RIKA 1LUCA 4L9XA 1ISYA 3SFWA 4Q8NA 3W74A 4HMEA 1FUYA 4IFRA 1DTUA 4ZGYA 3LCXA 3EB4A 2VFGA 3KOXA 4MPQA 3NL3A 1TV4A 2W62A 3LMZA 3EDFA 3VNJA 2ZQ0A 5EYWA 2RDUA 4FF7A 5I03A 3O3RA 4NIRA 2J75A 1PVNA 4B5SA 1UWQA 3L4XA 3FSTA 1I2RA 3L23A 1DOSA 1CNVA 3N17A 4WF7A 1KCLA 2HNEA 4RPQA 5A6BA 1FWSA 2PI6A 4MUZA 4WD0A 4UOJA 3L67A 2O7SA 1R9ZA 2PB1A 2J25A 4QITA 4WKAA 2GJXB 4BJHA 1LT7A 3T0AA 4PB5A 2EPOA 2EKGA 4FF5A 4R85A 4X63A 1XRFA 3JS3A 3O6YX 4Q4SA 4JYEA 1QW9A 2G50A 5U7SA 1TPWA 2VTFA 1GVEA 4Y90A 5BXTA 1MQQA 2BXYA 4O0KA 4RK8A 1RY0A 2EPNA 3SCOA 3S4TA 4LAKA 1I1XA 5LNRA 4LCRA 4FNPA 1Z3NA 2R1KA 1HXJA 2Z27A 3AAMA 4XBKA 2W0UA 4GZEA 4R34A 1REQA 4RNJA 2QT3A 4TQTA 1ESWA 2PC8A 3L12A 3R5EA 1BKHA 2SFPA 4O8RA 3WH5A 2F84A 4XSMA 2GGGA 2ALDA 4P61A 1S2WA 3VIJA 2V63A 4O1FA 4AHPA 1MYRA 2JIEA 1XIIA 4D6IA 4WKFA 3SRKA 4GLEA 4PMZA 4PMDA 3LRMA 5EKYA 1UUOA 4HYRA 3NEVA 2OJPA 1V02E 2V2DA 1QDSA 4O10A 2H8XA 3NEHA 4UR7A 1E4NA 1TMHA 4GC3A 2DPEA 3DH7A 5CBIA 2VI0A 4AQLA 5BXSA 1VC4A 3MUCA 4YVXA 2CHRA 5B7ZA 4AIUA 4C6FA 5A6KA 3WFAA 3DHFA 1W9PA 1MQRA 4QISA 3ZVIA 3G6MA 1SYTA 5BRBA 4KFNA 1XPGA 1FHVA 1TX2A 3QC0A 3TCSA 1SPQA 3GU1A 4XUYA 1H1ZA 3ENLA 1NF7A 2EJ1A 1KGWA 5EU9A 2XWEA 1ZAIA 3WDJA 2WSYA 4LYKA 4QXIA 3JUGA 3GC2A 4UCFA 9XIAA 2GUBA 2H8ZA 4U28A 2YA2A 2PP3A 2ODOA 2DT3A 4ILSA 3KTXA 1TWIA 4BS0A 1G94A 1US0A 4A2SA 3S2CA 3TVAA 4G1NA 2V2HA 4BI7A 3HB9A 3W83A 2C6QA 3PG8A 5LNVA 5AHLA 1QRQA 1AK5A 2WCGA 4GI6A 3CC1A 2YA0A 3MT1A 1FQ0A 3DFHA 3AICA 3MANA 4DUWA 4WJ8A 3C0SA 1LRTA 2Z7GA 4B2DD 1GT8A 1ZZMA 3HN3A 3V18A 3CBWA 4N02A 3MPGA 3MI2A 4HMDA 4K7VA 4LBUA 1EQPA 4H19A 3UNTA 3ELFA 3WELA 3B4UA 5JBDA 2WVTA 4G6CA 1EB3A 4PMQA 1ICPA 2GUUA 3R4IA 1NF0A 4JFUA 1NJJA 3VIMA 5MKGB 3WQFA 3C5QA 2ZXAA 1XJBA 4PBEA 3V5FA 3N14A 1JULA 3VPLA 4UTLA 2V81A 4AMCA 5A6TC 4JTFA 5ABGA 2CLHA 3ITCA 3FKKA 4N9EA 4P8UA 3RMJA 4EK7A 2OTDA 2OYMA 2QVHA 5D32A 1F05A 2WJEA 1HKVA 1YPFA 3CWNA 1RBOB 1RALA 1OF8A 4CD6A 3IAQA 4QTGA 4R7WA 5BRPA 1S2TA 3ITLA 3CLWA 3WH9A 2FZ8A 4UUIA 2OGJA 3A21A 1XYFA 4GCAA 2HVNA 3W76A 5I00A 3NPVA 2BY0A 5BZAA 3N2TA 1CWYA 4LEQA 1FWEC 1XIGA 3NDZA 4C6BA 4Q6XA 5I3JA 1QPOA 4G2DA 3IJ9A 2GVYA 5F2GA 4IG2A 4DBSA 5CQ1A 1A3WA 4S2BA 3MKVA 3GTHA 1RP8A 3MMWA 3OZYA 5B80A 1QPRA 1POJA 4B5TA 1QOPA 3VI2A 3UA3A 3TYEA 1QTWA 4E2BA 4B4FA 3EOOA 3ZIZA 3VFLA 3FA3A 3H2CA 3BAWA 4GPNA 4WCJA 2ONEA 4GI4A 3BV4A 4A22A 3SIZA 1TVNA 4GYPC 2RGMA 3W37A 4IMDA 2VP8A 4BY3A 4DF0A 1ZBKA 2V9DA 3T44A 2QIWA 3EX2A 2CLFA 1G67A 4KFPA 2ZX8A 4JL1A 3PBWA 1TJ1A 3KTSA 3VE9A 2CKRA 1K7FA 1N2VA 3UG5A 4G7EB 4CQDA 3BQ6A 1DTNA 3IUDA 4LH8A 1B1YA 3K8KA 3M0IA 1RH9A 3RCYA 1SZRA 1W3LA 2VHLA 2OG9A 1C7TA 4MAVA 3GIPA 3RO6A 4ZL1A 4O1AA 5H91A 2ZA1A 4GQBA 2PU0A 5D8ZA 4C7DA 3HF3A 3QC3A 3RM8A 3W53A 1KFLA 5XIMA 2C91A 3WF3A 3DFQA 4EACA 5FOOA 3R12A 1XSKA 5RUBA 4D6EA 1SFTA 3M6YA 4B16A 3KRZA 4IP5A 1A0CA 3GTIA 3NXLA 2JF7A 3N6HA 2XHYA 1UKTA 4KWWA 1XDJA 1ITCA 4QM1A 1QOXA 3U6WA 2FZBA 1OK6A 2E8ZA 1WZKA 2BNJA 1R5YA 2ALRA 1DE6A 4QLJA 3ZLFA 4XWUA 4A3UA 4Q4MA 2E68A 2E5CA 3APGA 1AQHA 3NL6A 3Q37A 3S6TA 3DX5A 3UESA 1W91A 3W1PA 1I8JA 4CQBA 3MWAA 4GABA 4DYJA 4D8AA 4O12A 4J3UA 5M03A 1DJIA 3GXFA 2YDSA 3CHVA 4ZB2A 3QM3A 4UTTC 4I6VA 5FF4A 4MJ4A 5BU9A 1XLGA 2REQA 1K03A 4ERAA 1KXTA 3MKKA 3TYUA 4RNHA 3CIVA 3ITGA 4NI8A 1E4IA 4IL0A 4DXVA 1FWDC 1XWYA 1TIWA 4L9ZA 1E72M 3WNLA 3MVIA 1HKKA 3FAXA 4LF1A 5K9CA 2HROA 4DY1A 3G3MA 4L80A 1EEPA 1YIXA 4IWWA 3PG9A 5HANA 1D3HA 1DWIM 2J62A 2YPIA 5CSYA 4GNVA 2A0NA 3G8RA 2QCFA 4WRHA 2WXDM 2D3NA 1XPYA 3K5XA 1WXZA 2NQLA 3LXCA 4FP1A 1YX1A 2ZTJA 5BCAA 1OYBA 3WQ8A 3G1RA 1SJDA 1GKQA 3L21A 2W92A 4CCEA 3KOWA 3TN3A 3HJZA 2E6AA 4DUOA 2EG8A 3QLDA 2J9XA 1DXIA 5I24A 3UR5A 2CZEA 1UG6A 4B5WA 1X98A 3AHYA 4AXNA 2YA1A 1C8XA 4KCWA 4Q8VA 1FWWA 3ZOAA 4HVXA 3P8JA 3Q94A 2BVTA 3KFTA 4UTWA 1UYQA 1QR7A 2NVDA 3BSMA 1WXJA 3PANA 1YBQB 1E0XA 3PS7A 3ZSTA 1TWWA 4U10A 3CZGA 3BANA 3CYJA 3R43A 1TWZA 3S0CA 1JF5A 1AJ2A 2CLOA 4P7QA 3GHRA 4KRZA 3I7RA 4ORIA 2NV1A 1UD4A 1ICQA 2DP3A 4QHRA 4JN8A 3MS8A 1EO7A 3VFCA 2PDWA 4NG3A 3CQ0A 1D7KA 2HE8A 4AY1A 4FXFA 3W73A 3TTQA 2P0OA 2OO6A 2DUZA 4DLFA 3EPNA 4JGDA 2D22A 3W1RA 2Y8UA 4JNMA 4F0SA 2EXOA 3UPBA 5G2WA 1KLYA 5DMLA 5ECVA 2FZDA 3B8SA 3RFAA 3PPHA 1S3TC 4HYWA 5GJPA 4AZ7A 3C0JA 3ZJKA 1U1HA 3WZ0E 3DEQA 3GG8A 3BAJA 1I1WA 2YYTA 4CVWA 3VC6A 1OB0A 1PV8A 3O07A 3T55A 2JKPA 3BPWA 4QJ1A 3BZJA 4HD5A 4EVZA 1BVWA 4B3ZA 1ZGDA 3N04A 1VYPX 5HNNA 4IGHA 4S3EA 4AD3A 3KM8A 4IL2A 4U5KA 3O6CA 4RNFA 4PC8A 3LUTA 1T0OA 1K8ZA 3ARPA 3F4NA 4HU8A 1GQNA 1V3LA 1F4HA 3S5NA 2UY2A 4DNHA 3RX2A 3LNMA 4GVHA 3RILA 3XIMA 4NZ5A 3A12A 1YTDA 3EMZA 3QMRA 3NFUA 1KFEA 3MSGA 2Y7DA 3N15A 2PDQA 2ASHA 3GY1A 1GUVA 3CUGA 2J78A 2WNQA 2BZNA 1QHZA 4W89A 3SUWA 4K1GA 3W7JA 2JALA 1NU5A 4EX4A 3OLIA 2OZ8A 2XVGA 3SY1A 1L0PA 2R82A 1IIGA 4GI9A 4JQ4A 4UOQA 4XD4A 3GDBA 1KRCC 2R1NA 2HMCA 5JMUA 1JYWA 5EMYA 3WL1A 3NVTA 4FA3A 4KCTA 4JQAA 4C7GA 5FI8A 2VEIA 3TCEA 3UWYA 1XX1A 2C79A 2RJGA 1LQAA 1KRAC 1VPQA 4GJIA 1BYAA 1TTIA 1ZJAA 3STEA 2J6XA 3WLHA 4ZOEA 4TO8A 4L4LA 3M5YA 4NJJA 4ML4A 1CPUA 1P7TB 3W7RA 4DWSA 3B9EA 4LEFA 4PL1A 5KZ6A 2YBUA 2OVLA 3M44A 2E28A 1YPIA 3IK4A 4CKQA 4DUVA 4Z2HA 4TX8A 3VIOA 4HYVA 3KBWA 5EGRA 2F61A 3E5BA 3UD6A 3CZLA 1WB0A 1A0DA 2BMBA 4V1YA 3LLXA 3ARZA 3VVGA 1XP3A 1W1YA 3TYAA 2VOTA 5KZDA 1VEOA 2YL8A 4TOQA 3SAZA 1GOWA 1A80A 4KGJA 3II1A 1HJVA 4IT1A 3VX1A 2Y0FA 1Q6OA 4H7ZA 1I0BA 5LXXA 3LX9A 3POHA 3TXVA 3TYCA 1EJ7L 4JOMA 4HTYA 3OPSA 1K6WA 4GE8A 2NT1A 2ZX7A 3TQPA 4TVDA 1ECEA 3VGHA 4R3UA 3P93A 3DHUA 1Z42A 1EUAA 4DVOA 4UFLA 1S5WA 4WSJA 3U48A 3HG4A 4W86A 4QEHA 1MW0A 1HF6A 4DEFA 3FY1A 3HPAA 3FXGA 2J7GA 1JQXA 2JQXA 1KTCA 4H7CA 4Q4RA 4IIHA 4L61A 2YB4A 1YDOA 3S1UA 3U2EA 3WN6A 4EPKA 4KS0A 5A6MA 3OP2A 3W88A 2C15A 1TSIA 1A5SA 2C16A 3G1HA 5FESA 2OLHA 1J0ZA 1KM4A 2PLCA 2VGFA 1XLEA 2BOEX 3DOPA 1EA9C 4V2XA 3MU7A 2NX1A 1MO0A 1Z6KA 1C8VA 5A6AA 4DWSB 4YPJA 2ZUSA 3K8MA 1E56A 1W3TA 1XD0A 4Q4PA 1B3VA 7TIMA 2QDDA 5M1TA 4AHQA 1K1DA 4R88A 1AQ0A 3A64A 3DERA 3G6LA 6TIMA 2A4AA 3FV9A 4O15A 3R7MA 1E0UA 4HU0A 3ARVA 3VCRA 1MUMA 3N73A 3K2GA 3RXZA 3CWOX 3P5YA 1PJ9A 3GNXA 1TPFA 1VCVA 4O17A 1PIIA 4UIOA 2ZE3A 4LS0A 2HTMA 4O52A 5J8LA 4HSNA 3IIXA 4HNCA 1FWFC 3BMVA 1R7AA 3A4XA 1PKNA 2YCLB 3KAOA 1LYXA 3C56A 3MC5A 5I7GA 2POTA 1IZKA 4Q4KA 5JIWA 1C93A 3V36A 4L1GA 3GHSA 3CJPA 3W7CA 4PBFA 3CU2A 4H7VA 2A79A 3FGCA 4GUGA 3FW6A 2WC4A 4EOUA 4Q8UA 3PWAA 2VGBA 3EA1A 3T2QA 1UJPA 4MKNA 4Q22A 1E1CA 1CECA 1TJ0A 4IPPA 5E1QA 4E4PA 3R0UA 4OWGA 2QCMA 2ZUUA 3U9IA 3AROA 1ZP4A 4G5DA 4US5D 4OFCA 4MY1A 3NG3A 3F2BA 3BUVA 1ELSA 1W5MA 5BXPA 1H5YA 3UZWA 1FHLA 5A2CA 4ZQCA 2W4XA 4W85A 3IGSA 1AQMA 1A5AA 2WVVA 3SIMA 2RJHA 1W5NA 1G4TA 5LA1A 4AG0A 4WXZA 3LNPA 2J7DA 3L4ZA 1F4AA 5C8BB 1N82A 3MP4A 1SJCA 1WA3A 1Z32X 4MLRA 2E6DA 1JCNA 2CEQA 2HISA 4XISA 1FCBA 3BL3A 2FFIA 5HXMA 1UMLA 3BLKA 2WSRA 3VD5A 2EEXA 2NVAA 4PFHA 3JZEA 3H23A 4C6NA 4OECA 1MDLA 4Z42C 1HJWA 5I3HA 2A3HA 1U1UA 1WE5A 4NSBA 3CB8A 4KWOA 3BSGA 4KETA 1J01A 1A5CA 1FH9A 2DORA 1XCFA 3SCTA 5AHEA 3SCUA 5JBEA 3UPMA 4UCGA 4ZVJA 5IXEA 4X0VA 3PK7A 3S42A 5KETA 1P1MA 5XIAA 1JNEA 4GIAA 4JTIA 3O16A 3S1GA 3L68A 4GGBA 1MEHA 1WXYA 4HSHA 5HJLA 2PE4A 4CU6A 1E1CB 2NVCA 3M9YA 4BF9A 3LMYA 1X6LA 5LGXA 3MDUA 4XIMA 4F2UA 2BXVA 3PN8A 2VZSA 3IIVA 5D37A 3RJXA 2YLAA 3IVTA 3S2NA 3AOFA 4WK9A 1HKWA 4AFYA 3L5MA 1EGMA 3L7RA 4IUOA 3QY6A 4PCFA 5A8OA 3BDKA 3M0XA 1RK6A 5A1AA 2D2OA 1UKPA 5I3FA 1QO5A 2B81A 1S5MA 2WVVB 3ABOA 4F3HA 1CT5A 4PA8A 1PSCA 5HUPA 4CD8A 4YWIA 3IPWA 2JF6A 3EDEA 3EMCA 2TRSA 4Z1CA 3DYOA 1F74A 3E0FA 1OZMA 3GVQA 2AGTA 3WYZA 3TTSA 5HWMA 1C8QA 4PTDA 1E0TA 4YS1A 3VDHA 5H8UA 1P0BA 2G41A 3WDPP 2BVYA 2PTYA 4J4KA 3R2GA 1IXPA 2ATSA 1YNQA 3KLLA 3W2NA 5E9XA 1NDWA 5BMWA 2CBVA 4PMVA 3KUMA 1VFUA 1T40A 4OOUA 1UR4A 4JHZA 1Q6DA 4CVUA 5JIPA 1TFVA 1J12A 2INFA 3VMPA 1XIFA 2A1YA 1KCKA 1JQVA 4W8AA 3DI0A 4EIVA 2ZZ7A 3IJ8A 3SQLA 4EPEC 1BXNA 5D04C 3BGGA 1X6NA 1V7AA 3B03A 3H7RA 4S39A 2PPGA 4O11A 3B9AA 1NVMA 2Y5JA 3FSUA 3POCA 4JIRA 5JU6A 1ENUA 1K4GA 1H49A 4WY0A 4HNNA 3CMGA 1ISWA 2VFIA 1DIDA 3HA1A 4C6IA 5LIUX 3A9BA 1QW8A 5AYXA 5D2WA 2EPLX 1UA3A 2WV8A 3HFYA 3R8HA 3EX3A 4PB4A 4LYQA 2W67A 2GDUA 3TXZA 4DN1A 3NQBA 5ABHA 4DX3A 3PSWA 2VXNA 3O1NA 1X1NA 3AIBA 4H9UA 3TE9A 2NXHA 5D9OA 2Q8XA 4GHRA 1CCWB 4DZAA 3W86A 5AC7A 3GG0A 1O7AA 3W2JA 4QAWA 1X39A 3B8UA 5J5DA 3PTMA 1OBAA 1UP0A 1W1PA 1R3VA 3INPA 1JI1A 2QLYA 3GVRA 3QTPA 2ZOXA 4MPKA 3I4EA 5DMYA 2Z4GA 1QK0A 3GUGA 1BPLB 2H90A 3N9KA 3ITTA 1YE6A 4LCSA 4CQCA 1JDCA 4AZ5A 3BO9A 4DIAA 2OKTA 3RX4A 4OJYA 1N8FA 3N2CA 1WZMA 3UETA 1W3IA 4UTUA 4ROPA 3VNYA 4AWUA 3UZXA 3BAYA 4LS2A 2NX9A 4KEVA 2OZ0A 3W82A 5C5YA 1RK5A 3WLSA 2GVEA 3LTYA 4YHGA 1UJQA 4F66A 4DJFC 3KE0A 5FJPA 1LJYA 2Y89A 3W27A 3NYDA 3MUZ1 4PBGA 1UD8A 3TH6A 1XBZA 4CNSA 3LBMA 2C1IA 2XN2A 4Q8OA 2NLYA 2ZFAA 3MSRA 4WQ6A 4YN5A 2LLEA 3LHUA 4XZBA 2NXGA 4WY0B 1XV8A 2WLYA 2E7FA 4JTQA 2GQ3A 1BXCA 3WFLA 4A29A 4KKXA 1E71M 2E4TA 3P62A 3WF0A 2RFGA 2X05A 2CZFA 1PHWA 3PC0A 4LVGA 4MDOA 3QYSA 3VIFA 2PDMA 1RD5A 1V6TA 3U2ZA 4PMXA 3VZZA 3STCA 3BC9A 4NZ3A 4ZO7A 1RD6A 2VZTA 3MZNA 3MSYA 1M65A 3WQEA 2WZTA 2CZ5A 5AHIA 2FMOA 3T4CA 1FWRA 4Y6GA 4AEEA 1UHVA 1CENA 4AZIA 5E93A 5I0DA 4P8WA 1GVFA 3BQ5A 1QHPA 4LV9A 1P6CA 1XLMA 3NQ8A 5ABEA 4PE8A 3CUIA 1UR9A 2I9EA 1HGYA 1JD7A 1JDFA 3IGHX 2YZRA 4UFKA 1NFGA 2DW7A 1AZ1A 2G8ZA 2QGYA 3BURA 1HKJA 4KBXA 4PSRA 1JPHA 3VIPA 3CTLA 1F3TA 2RGLA 3P74A 1JCLA 3GU2A 1OIMA 3NWRA 3WKZA 2KX9A 3W7PA 1CGWA 3LM3A 3H22A 1Q7MA 2DVTA 5EMMA 2OWCA 1PIGA 1KM6A 3SRFA 4IFKB 2FGLA 3T0BA 4FIRA 3BLDA 2QPUA 5A94A 4HPNA 1QI3A 2J7BA 2WKJA 2OX1A 2QAFA 1E40A 4MWAA 5T26A 4H4IA 3OZOA 2WCSA 4M5PA 3SADA 4UNIA 3ES7A 4L9YA 3GR4A 4RZ4A 4KIEA 4OBRA 3URNA 3W7GA 5K2ZA 3CIXA 2I16A 3A9IA 4FNSA 3W1XA 5E0CA 3KRUA 1I2OA 4QE5A 4GY1A 3LHTA 2VYOA 3EA3A 4EPDC 2BVDA 5LKYA 3QHOA 4C6LA 3NURA 4DZ5A 2CKSA 3EPMA 1EJXC 4LNCA 4LWWA 3TUUA 2V5LA 5AVNA 4L1XA 1I60A 4BEQA 2VR5A 2VRKA 2GWNA 3EOSA 3PZTA 2FHFA 4MB3A 2CXGA 1VFHA 2ZDSA 3M16A 4JBRA 3CS2A 2C1HA 3IGUA 4QLLA 4MFEA 4O28A 3W28A 4A3RA 1JDEA 2GQAA 1MQPA 5GNYA 1KM1A 3I4KA 3PWGA 1BVZA 1S2CA 2QV4A 3M5ZA 4DYKA 3L2LA 1KA9F 3QEZA 1CB7B 2J47A 4TTUA 2OMAA 4DUXA 5CC3A 1MMFA 4GIEA 1V3IA 4RJEA 2TYSA 1UC5A 1Q2SA 1DJZA 3TC6A 4DJDD 2VFFA 1J0KA 1XRSA 1Q6QA 3W7DA 4DPPA 3AS3A 4BQ4A 5IBXC 2CLKA 3OQ8A 3QGAC 4RXGA 3QGVA 2YLLA 1UWAA 4WUIA 1BYCA 4AHOA 4A8LA 3BGAA 4NZJA 4M6UA 3B9DA 4V27A 1O5KA 1XLHA 1U1JA 3I7SA 1UP2A 4K8HA 4V28A 1CGUA 3RDKA 3FDKA 5DELA 2XVLA 1PTGA 1QFEA 1BF6A 3QTGA 3S83A 1EJTC 4FEZA 2OELA 1A5BA 4H04A 3EWXA 4J3ZA 3TP4A 2OZTA 2V2CA 1RPKA 3EWYA 4MUPA 2GPTA 1V93A 3F7JA 1W1TA 4H8UA 1SO3A 2PCEA 2QS8A 2CFFA 1J9YA 4FX8A 4AZHA 3LCWA 4GFSA 3TX9A 2YBTA 3QZEA 4Y9AA 4Q3MA 3RR1A 3UJEA 1V0LA 2HCVA 4JTCA 5A8QA 1VS1A 1H11A 3LD5A 1VB9A 5HNRA 2FJUB 4X60A 5DO8A 2NUWA 2Q02A 3WLJA 5MF5A 4AVOA 3CNYA 3LHZA 5FJOA 3CASA 1VENA 1HO4A 4PN2A 2A3BA 3KBNA 5H8PA 1KD0A 1KO0A 3UY8A 2Y2WA 4IIEA 3IANA 1EL3A 4M1BA 3DESA 1X8CA 3UCQA 1LZOA 3Q45A 4XVDA 5JQ9A 3NVDA 1P0DA 6REQA 2PWEA 4I9JA 3FEMA 1GYMA 3K4AA 1E4LA 2Q8ZA 3G0UA 2X7WA 4GVGA 1DORA 3WBXA 1FBAA 4X3ZA 3NSNA 2PTXA 4KF1A 3B05A 3LCGA 4RPPA 2Q8LA 1O12A 3WEZA 1GJUA 3AXKA 5CG7A 2QF7A 4MNMA 4HNUA 3M0VA 1UQZA 2V38A 4DJEC 3KW3A 3M43A 1FWGC 1XQKA 2GGJA 2NWSA 2NSOA 3URBA 4MWAE 2VUNA 4QE1A 2NXIA 1G1YA 1BQGA 1VP5A 3ZS4A 1G01A 4D72A 1PS9A 4WLCA 1JJKA 3UYIA 1PE1A 3R25A 2QVNA 1KQZA 1Q8AA 1X97A 3IV3A 1W37A 2ZYFA 3PZIA 2VJXA 1KGXA 1F9CA 2HBVA 3RU8X 3WQCA 3ITVA 1JUBA 3RNDA 4CD5A 5HULA 3CQHA 3DKJA 3V0SA 4AZCB 4MIMA 4RE4A 4AH7A 2TPSA 2X42A 5LHFA 2HBXA 1R0MA 3AMGA 1MNSA 1SMDA 3C3NA 1O68A 3PZNA 3A23A 3BJFA 3TU9A 4N9BA 1ZS2A 1X38A 3N25A 1HKIA 3DG3A 1AJ0A 4JHMA 4DBDA 4QX4A 2J7EA 3PNZA 3AIWA 4C5ZA 3E0VA 5LYRA 4M24A 1GVRA 3S5YA 4YLWA 1Z8AA 4GZIA 3TQVA 2XFRA 4JKMA 3PTQA 8XIMA 1HX0A 4ICNA 4WY0F 1MDRA 2R9RA 2DQXA 4PSPA 2P8BA 5HPOA 5CEWA 3KS5A 1E6SM 4CCZA 4QG6A 4FLQA 3EEZA 4QBXA 6PTDA 4YTSA 1W5PA 4AVFA 5AKQA 2Z1KA 3M0LA 3AHVA 3L5AA 1QPKA 4Q8MA 3NSXA 4QG8A 5IFTA 3GFZA 2DIJA 1L6FA 2PAJA 4LS1A 5LIYX 4ROQA 1S2UA 3EXRA 3REQA 1KV8A 3V35A 1XLDA 3RLVA 3IRSA 1F76A 1J5SA 2VMFA 1AG1O 4B3KA 4PRTA 4Y9NA 3U7BA 4AWEA 1RBLA 1VR6A 3T09A 4D6CA 1O5XA 4QLKA 2C19A 1FKXA 3M46A 3MQTA 5DMNA 1DIEA 3A4AA 1Q3NA 3B9NA 4JX6A 5KSWA 3UCDA 1UZDA 1AODA 2F8QA 3R0DA 3WIJA 1R3SA 2X1RA 4C60A 1OCQA 1VF8A 3C6CA 2UBPC 2OB3A 4X0NA 3UWEA 1MXSA 4L6DA 3URAA 1V8EA 3S47A 3A6OA 3MMDA 3UERA 2YXXA 3ZR4A 4IX2A 3RCMA 1TMQA 4CUCA 3W1UA 3VCCA 4E2OA 4QJ4B 1Z89A 2JK2A 4L6OA 4K1WA 1OG6A 2WBKA 1KW1A 3CQIA 2DSZA 4JYDA 2XWDA 1CYGA 2PMQA 1UR8A 2X1SA 3EXTA 1JPIA 1TTPA 3WF1A 4PMOA 1LL7A 4GK8A 3MCNA 1UB3A 3CWHA 4FOKA 5HMFA 1TYGA 2ZICA 4DO4A 3QPZA 1EEXA 4EAYA 2D20A 3LCIA 2XJ7A 2FDMA 1FH8A 2DQWA 5CZSA 1TUXA 3WD2A 3CLMA 2QKFA 1OYCA 4MLJA 6ALDA 1RBAA 4NQ1A 3F5KA 3N29A 2Z1VA 4KWUA 4ATWA 2ZADA 5K7JA 2YBVA 4MAZA 2VEPA 2C1GA 5JBFA 3AQUA 3K1DA 3FJLA 3MDWA 2PURA 1Z9AA 2H6RA 3LHWA 3GHUA 2UY5A 3REQB 1D7FA 4MKVA 5FACA 5FEXA 4O1DA 3MJYA 3UZYA 4DO6A 4CD4A 2RDTA 5F4WA 3G77A 1UPMB 2HVMA 2VR2A 4XZMX 1TPEA 4QJ3B 3G1VA 1VBRA 2KAUC 2WMJA 1JFXA 1J2WA 3XISA 4IIGA 3UG8A 1WPCA 3VA8A 1W6TA 1JCXA 3LBCA 1JRBA 1LOLA 3LU2A 3P6LA 2XFYA 1DBTA 1CGYA 4WKHA 3UJ2A 5IFPA 1QT1A 1AW5A 2PD9A 4IMGA 2QNEA 4GA8A 4ACYA 1R9YA 1ZU8A 5F2IA 2HZGA 4L4MA 5D9MA 1XIHA 4REQA 1BD0A 3AMDA 4J3WA 5FD0A 1H3GA 2VVNA 2GL5A 4M3PA 2ZVIA 4C6DA 1J18A 1ADDA 1HJQA 2PDHA 2QCLA 4O50A 4QCFA 1ZRQA 4O19A 1DV7A 4PCPA 4PH6A 1ONWA 3ABXA 5GNZA 2AAAA 4M19A 3CHEA 1SZEA 5C7VA 4I6KA 4C90A 1FWHC 1OINA 2VT0A 4NL1A 3R0KA 3TSDA 4IMEA 7A3HA 4D6GA 4D1JA 3IJDA 3NQ6A 3SEPA 1PCWA 1X96A 1PXGA 4BF5A 2GK1B 4DNMA 5BRQA 1DJGA 5CPNA 4AWSA 5I3GA 1EXBA 2POZA 2WHJA 1EJWC 4YWSA 4F0MA 4XAZA 4E8DA 4DZIA 4GINA 4GUJA 1C90A 1WV2A 1P43A 5T8GA 1C9WA 1VLWA 4HCDA 1ZAHA 2J6VA 3LTSA 3AMKA 1C92A 1QJWA 2V5CA 3DGBA 5HQMA 2O92A 2VVSA 3TTYA 3C2OA 2IKGA 1I2QA 3H7UA 2JBMA 4EF9A 2XVPA 4K38A 3SN4A 4WDWA 2R6OA 1SO6A 4P2VA 2WBGA 1V08A 4H01A 2WZEA 3JW7A 4BWLC 2WYSA 3RM4A 2C0HA 5D33A 3QGKC 1NP0A 1GOXA 2EAWA 1NOUA 3TK7A 2PODA 2FVMA 3UG3A 2Y61A 2QJIA 4GNJA 3PBVA 1WAWA 1OFBA 4N9DA 3ANVA 1LOQA 3T05A 4JL2A 2V5KA 3QOMA 3WQWA 4AC7C 1WBJA 2G97A 3CEPA 2HDJA 1YNPA 2PWFA 1EQCA 3LRLA 2WNZA 3G1FA 3KHJA 4HTBA 3W6LA 4BHYA 2OPJA 5D4YA 3OIXA 5E6ZA 2ZRUA 1LTDA 1MSSA 4G7FA 2ZUTA 4LQ1A 4RW3A 2QPSA 1J93A 1BWVA 2VNCA 3B0VC 3WQ5A 4KWSA 2VEFA 3WFZA 1WKEA 3U57A 1I2NA 4LTSA 5AC8A 1YXCA 3VCNA 3VM5A 4XKMA 4OBSA 5JH2A 4ZEPA 3WK2A 1CXKA 4Z08A 3DIPA 1S38A 1JUEA 1UR2A 4KRTA 3BSHA 5DX7A 1XQLA 1OCNA 3CMJA 3AFBA 4WDTA 4J9JA 4I9TA 4XD3A 2DT0A 1LF1A 2PWUA 3HGJA 1UR0A 2X8RA 5LNWA 3KVMA 1E51A 1QATA 3VMNA 5HNTA 4J35A 1K9FA 3SR7A 3D0CA 2XM1A 2PSNA 1LP6A 4Z2GA 3IS4A 3GYEA 1DKWA 3RGTA 2Z1XA 2V5JA 2NV2A 4AYGA 5DQPA 4GYJA 4UC5A 4Y9MA 4B3LA 4JCMA 1T99A 5TBOA 4DI9A 4QS6A 3FN9A 4C6MA 1XG3A 4IPLA 5HJXA 5DXYA 2X16A 4IICA 4P7LA 2ZVRA 2VCAA 2UY4A 5DCDA 1H7RA 8CGTA 3E38A 4NT0A 3ZWTA 4GH1A 6TAAA 4CU7A 1NQKA 2J24A 2ZZ6A 3HGSA 4W5ZA 2R94A 1FP9A 4OQVA 1F6PA 2JKAA 4PODA 1V6XA 1X1ZA 4OIFA 4WGHA 4UTJA 4E8CA 3VOFA 3W3OA 1V0KA 1LLOA 1YHTA 3MW7A 2OT1A 4O8AA 2QJHA 2C7FA 3OVQA 4MM1A 4J28A 1X7IA 3O7UA 1ISZA 1E9LA 4MJMA 1BRLB 2A85A 4MFDA 4E2DA 2RKXA 4QIUA 3AUJA 3RUBL 3PBYA 5BMXA 3HQPA 2Z00A 5BOFA 4WJEA 4PMNA 4UQCA 2DJXA 1D8CA 1FWNA 1W3KA 1JZ3A 4W9TA 1R3YA 3S1WA 4TR9A 2JIWA 1SO5A 4LC8A 4NJKA 1H0GA 1W3HA 3MB9A 3EDKA 3M7SA 3WH7A 4HGXA 2PS2A 1SR9A 4LAZA 3UR7A 5TQLA 3CPGA 3FVMA 1THFD 1SU5A 3GW0A 4HNLA 4MYXA 4MKSA 1JIBA 3CAKA 1SO4A 1CLVA 4RW5A 3LQLA 3B0XA 4KEMA 4ACZA 4QQ3A 4WSKA 3SW6A 4NZ4A 3VD7A 4Y8FA 4H9MA 3ALGA 3MWCA 3A3WA 4EF8A 1KXVA 1HJSA 3GH4A 5FAJA 4LC6A 1F5ZA 5DEZA 3VDGA 3TJIA 3S9IA 2DVXA 3VGBA 3L4UA 3MA8A 2XDFA 4ZOBA 3DBPA 1R38A 3IACA 3RITA 1ZPTA 4JFWA 3CT7A 1J0IA 4HZ6A 3EWUA 1UH4A 1WDDA 5AHMA 3N2MA 2Y24A 1H1YA 4AD4A 1Y0EA 1AQFA 9XIMA 4TIMA 2IMRA 5C9UA 3TSBA 3D47A 4H8NA 3AXHA 1BF2A 3VAVA 1FHUA 4WGXA 1BXBA 4GY0A 3FAWA 4I5RA 3FLUA 3I6TA 3QZ6A 3SUTA 2MNRA 2HVOA 1M03A 3HPZA 2ACUA 2AAMA 2XU2A 4US6A 3QLLA 4IIBA 2JGYA 4AX6A 4OUIA 3OIHA 2FVKA 4LY4A 3G1YA 2ZWZA 4NZCA 1Y7VA 4LOCA 3ANYA 3W01A 1WQ5A 2B7PA 1F3EA 3LTPA 2C18A 2J88A 3VABA 4ENLA 1VPYA 1A49A 1TREA 1TIMA 3OBKA 3IRDA 1IEWA 3F1QA 2ZZ1A 4JDBA 2PD5A 3KWXA 4JXCA 1IF2A 2YL5A 3ATYA 7TAAA 3NOYA 1J6PA 1Q45A 1KTBA 5FIPA 3UCCA 2YZ5A 1QCWA 1QI4A 4MNJA 5D9PA 1D2KA 1QBAA 1J8VA 4HA4A 3WD1A 1I6NA 1ADOA 2IPFA 2V3FA 2WJFA 3BJTA 4US5A 4EAMA 4M80A 2WB5A 2D0HA 3WQGA 3ZT6A 3A24A 5D03A 4PMYA 4GBDA 1GPWA 4FAMA 3QY7A 2OOFA 3RRAA 3VDCA 1JR1A 2IXUA 4UQBA 3ALFA 3J7HA 2UY3A 4NU7A 1W8GA 4PFMA 1B0IA 3TQ0A 3BGJA 1XBYA 3BG5A 4Z1BA 4DELA 1DQXA 4PTWA 5GJMA 2DDXA 1D8WA 2Y88A 3CQKA 4GRSA 1V7YA 2GSJA 4KEUA 1UWUA 1OFRA 1UWSA 3PBMA 2VFDA 3PZQA 4E3VA 4K2SA 3TYZA 4U5IA 1TPVA 1DJYA 3AISA 3OLEA 1BFNA 3N6JA 4JIHA 2OSXA 2BOGX 3EX1A 3E6EA 4AC1X 3OLGA 4IXHA 4H2CA 5ENLA 1KKOA 3IIOA 4U2YA 1CXEA 3T07A 4NUWA 3N2OA 5BW6A 4I90A 3V0UA 1O60A 3UPWA 1QI5A 1KWGA 2H9AA 2R8WA 1GGOA 3EWBX 3NPWA 4R9XA 2I5IA 3A3HA 1EOKA 3KL5A 4HQVA 4NY2A 4WR3A 4A3YA 4EANA 4XV0A 1US3A 4AIOA 2FVLA 4ZTXA 4IIFA 3MBFA 1EH9A 4H1ZA 5F2LA 3ABRA 3ITYA 1QNVA 3HG5A 2A7NA 2J27A 3H7VA 3U5YA 1GW9A 3ZXWA 1R3QA 4QGCA 3ZYZA 1WP6A 2CNCA 1XLJA 4N4PA 3GAYA 4I8YA 4CNTA 1CZ1A 5LXEA 3OJGA 3R58A 5D2XA 1E5NA 1XI3A 2HSAA 2NZLA 1EWDA 4GBUA 2Z1WA 3QPEA 3H70A 2GGHA 1OGSA 1EC8A 1VLIA 2E1WA 3R8GA 4PUNA 2VGIA 2V5DA 2P50A 2OQYA 2JFEX 1EZ2A 3FIGA 4HA1A 1RZMA 1BGGA 1ZBCA 3R6IA 7ENLA 3S2JA 1GNXA 3OODA 4Q7NA 3KS6A 4PRRA 1UZ1A 3K30A 2WK2A 1MNZA 4FSAA 1M01A 4GVIA 5AC6A 4JTJA 3SY5A 1XL9A 3GO2A 4ICMA 3G1XA 4GI8A 3E9AA 1LG2A 1UBSA 2XSAA 4J40A 1MZHA 3O05A 3GXMA 1ZCCA 1WO2A 4HOWA 1QWGA 4QRNA 1C3FA 3VKJA 3NQEA 5EFDA 3QQWA 3PPFA 1E3XA 4LVDA 1H5VA 4HIBA 2VZUA 8XIAA 5CPOA 1H62A 3OGRA 3GVGA 4XD5A 3TQKA 4L4OA 1TKKA 1VFFA 2DFAA 3ABQA 4AWTA 4HJWA 3IVSA 2H9AB 4UQDA 3FJNA 2EG7A 1OHLA 3QRHA 2BXZA 3QOKA 3W85A 1FCUA 4Q4QA 1Q6FA 3T9PA 3WLIA 2KZHA 5E5CA 3DU0A 1QAPA 2PC4A 1XKJA 3USBA 2BBFA 1RSCA 2VC9A 4RXFA 3M5XA 1J0JA 3E2QA 4H8VA 3NJ3A 4PUDA 2PDKA 3MMUA 4RE3A 5FJUA 3L2MA 4F2TA 3GC4A 4CNUA 3A22A 1X6UA 2CWNA 3FDGA 1XLAA 4KESA 5FSDC 1OFQA 2Z2UA 3OA5A 1AD1A 3STPA 3WBEA 1KRMA 4H3DA 2PDCA 1S2AA 2RUSA 4NYYA 4O53A 3AHZA 3GNPA 3VOIA 1H7XA 5A6JA 4NNAA 2V0TA 1UR1A 3KRSA 3LQGA 3VNDA 3S5SA 2F2KA 4MDPA 3S1VA 2YCEA 1T6MA 1PDZA 4K7YA 3TA6A 1XR2A 1RQHA 3WL0A 2V67A 1K9TA 3ITXA 4Q32A 4FX6M 1LUCB 1OM0A 4S38A 4GGHA 4A6GA 4C1NA 4HHHA 1XBXA 4HU4A 2UZ9A 1UH2A 2BP1A 1AW1A 2PDPA 3DC8A 3D46A 4BR1A 1SMAA 1IEQA 4AIBA 1LL6A 1UOKA 2DH2A 3H2FA 2WHLA 4R27A 5AYZA 1NP2A 2PWVA 5CGTA 1PTDA 2PDYA 2BASA 3LV5A 4H6EA 5CZKA 2PDNA 3HMCA 5FL0A 8TIMA 1IQ8A 1FDJA 3S2LA 1GCYA 4IIDA 2QCDA 5I79A 1N8WA 5EBUA 4ATLA 5BROA 3SQMA 1SZFA 1CXIA 3V7PA 1E4MM 2G0WA 3MV11 2VURA 1LBMA 3WMCA 4Q7IA 1R46A 3AHXA 4QSFA 1B5TA 4JTDA 2HWGA 3GRIA 1H61A 2QDHA 4OVXA 3AUOA 1ZAJA 3NQMA 3P81A 3MHUA 1PAMA 2NUYA 3N4EA 3SI9A 3DZ1A 4TU1A 4P5UA 1DJQA 2NQ5A 1GQLA 1GVQA 2XIOA 4XZ9A 2RHGA 3WNPA 3HZ3A 3O63A 4BI6A 1K70A 1W31A 4PTXA 5SWUA 4CNPA 2TAAA 1QASA 2FB2A 3RU6A 3DHDA 5CC5A 3W38A 4R33A 3GD6A 4S3JA 4GQGA 4MG4A 4Z2KA 5CBBA 3E3HA 3C61A 2FKPA 1XGEA 2HS6A 2JGQA 4W7WA 1ODZA 1WZLA 1REQB 1DIOA 1G4PA 1ZB5A 3C4UA 3GTXA 4DJFD 4IJRA 3DFPA 4IMCA 4OTKA 3I3EA 3VOCA 4DWSD 3VDBA 4UZUA 4RV8A 1QUMA 2V6AA 4FZIA 3DGRA 3WQ4A 1Z41A 3WUGA 1JPKA 4O1BA 3BOFA 2DZPA 1OC7A 1YDNA 4E2VA 2Z7KA 4I7UA 1DHPA 4OKDA 2D2HA 2L5HA 2YCJA 4YVPA 1Q6RA 4C7FA 2P8CA 1JYVA 2C0AA 4JFVA 3HJEA 4LYRA 4XQ6A 3EWDA 1PYMA 1MXGA 3NZRA 4O1EA 1AFSA 1WKYA 3TN5A 3A13A 1SJBA 3ICJA 1DYSA 4ZB0A 4GXWA 1RY8A 3ECQA 2ZC1A 4ASTA 3PJWA 4K8GA 4Q8WA 2C13A 2G37A 1OCJA 3O15A 1H1NA 1X1OA 1ODUA 1GK8A 1TV8A 3LOTA 3W6YA 4L6HA 1M7PA 4LNYA 2ICSA 2DZAA 2VCBA 2NW0A 5HA7A 4M1RA 4U3AA 1DXEA 2WZHA 2VGGA 5B7YA 4WIWA 2MUCA 2QQ6A 3DHPA 4DQWA 2QGHA 1K7EA 4M7TA 1OY0A 1HL8A 2IQTA 3C2EA 3H4WA 2BX7A 2E5BA 2VL4A 4WOQA 2IW0A 4F79A 1VBHA 4YTRA 3DG7A 1XIMA 4JHOA 1R47A 3M5VA 3GWQA 1OG0A 2XZ9A 2DZVA 3P60A 1Q13A 1VRDA 1O1ZA 3WEMA 2ACQA 3LN3A 3GKFA 4B5VA 2DZWA 1XG4A 2PA6A 1MUCA 1HP4A 2J77A 2OXNA 3W75A 1V03A 1JDAA 1O94A 1CGXA 4L56A 1NEYA 1T8XA 3NCOA 3PY2A 3BLFA 1ZQ5A 3N4FA 3LG3A 4J27A 1F7BA 3KBSA 1FP8A 2B7NA 4B92A 3ZR5A 3DFTA 1IEXA 4BK9A 1H51A 5CAKA 1ZP3A 4F8XA 2ISVA 1VIZA 4DXXA 4ZFMA 1OEPA 1IEIA 1AVAA 3T8QA 4F0RA 2EKCA 3EX4A 2XIIA 4DJDA 1L2UA 1IT0A 2HS8A 1RCOB 5FJTA 1HTIA 5DRIA 5BOOA 1S5NA 1GHSA 2FHBA 4JZ5A 5CKSA 1VEMA 3DENA 3MYOA 2Z6JA 4ZQOA 4LB3A 3F4WA 4E8GA 3BW2A 3M0ZA 5LHEA 4M7SA 4E4UA 3WNMA 3AYTA 3E0WA 4LVFA 5A8GA 1HN1A 4IG2B 1QNQA 1EF3A 4GACA 1H50A 1XYLA 3FJ6A 3S5ZA 2OU4A 2ZRXA 1UWTA 1GYLA 2A3AA 1P6BA 4DXKA 1O4UA 4JY9A 2QCEA 3QV6A 1V6YA 3RRXA 3WDRA 2CIPA 3HQ1A 1TPUA 1V0MA 1XLLA 4JTUA 3HV8A 4ZR8A 1UASA 3BAKA 3W23A 4DM2A 2GSHA 3E96A 4KCUA 1MW3A 3QZAA 4QS5A 3GR8A 4IPNB 4LGXA 3MSDA 5G4EA 3NGJA 2VR4A 1ITUA 4JR5A 2NQHA 1TE6A 3NSMA 1OQF