3TE9A

1.8 angstrom resolution crystal structure of k135m mutant of transaldolase b (tala) from francisella tularensis in complex with fructose 6-phosphate
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
320
structure length
310
Chain Sequence
b'QKSVLEQLKQVTMVVADTGDFELIKKYKPVDATTNPSLILKAVKEQKYSNLVAETISKVKANNPDLNSDDLVKEIAIEILVSFGIKILDVIEGKVSSEVDARVSFNSATTIDYAKRIIARYESNGIPKDRVLIMIAATWEGIKAAKLLQKEGINCNLTLIFDKAQAKACAEAGVYLVSPFVGRITDWQMQQNNLKTFPAIADDDGVNSVKAIYKLYKSHGFKTIVMGASFRNVEQVIALAGCDALTISPVLLEELKNRDEHLEVKLTQISEADFRWLMNENAMATHKLAEGIRLFTKDTIELENIIKQNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transaldolase
publication title Adherence to Burgi-Dunitz stereochemical principles requires significant structural rearrangements in Schiff-base formation: insights from transaldolase complexes.
pubmed doi rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Transferase
total genus 138
structure length 310
sequence length 320
chains with identical sequence B
ec nomenclature ec 2.2.1.2: Transaldolase.
pdb deposition date 2011-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00923 TAL_FSA Transaldolase/Fructose-6-phosphate aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3te9A00
4CQ8A 1RD5A 3PG9A 1U83A 4R7JA 3W74A 4JTFA 1AG1O 4RCXA 2O7QA 3MYPA 3W3OA 4HT3A 4WUIA 1HG3A 3W2NA 2ZZ2A 1X8FA 3S1XA 1LDCA 3PSWA 4MY9A 3QSTA 5ABTA 3L0GA 5LNWA 4HSNA 4JDBA 1ML1A 4JNMA 4JTEA 1D9EA 5HJLA 3CHVA 3L66A 4QISA 3L2IA 1PVNA 1OFOA 3N19B 3MP5A 1VYRA 3B8DA 4O1DA 1XBXA 3S5YA 1QMLA 4UNLA 4GRSA 3PS7A 3N3MA 2JKEA 3DKJA 4JTIA 1NVMA 5DCEA 5C6MA 1GG1A 5D33A 3U2OA 2XN2A 5C54A 5HMSA 5D38A 1CX9A 4HNTA 3QYQA 2E6YA 3PR2A 5DXXA 2V81A 1TPEA 3TIMA 5FF0A 2CLMA 1TPB1 3DFNA 8TIMA 3L5LA 1LOQA 1B4KA 1NAL1 3N34A 1X6UA 1C29A 1BWLA 3VE9A 1TTIA 1KFCA 4H6KA 3D0CA 3EX6A 1WXJA 3P81A 1P5BA 4CQAA 2PE4A 3P5ZA 1S5WA 1V5XA 1KLZA 3LHWA 5D2WA 3W7GA 1ICQA 4AVFA 2Z1BA 3MW7A 2LLEA 3TK7A 4NJHA 2VENA 5FF7A 5IBXC 5AC8A 3NEVA 3PVFA 3W84A 4JTKA 1K7XA 1OF8A 3HPZA 3AJXA 2GOUA 1D3HA 2V5BA 1TPWA 2A21A 2YYTA 1AMKA 1TV7A 4ONVA 3NPXA 3P82A 3MP4A 4RZ5A 1VJIA 4NU7A 3S5OA 5G1YA 2C16A 1H5YA 3PBUA 3TAOA 1SZNA 3P74A 1OABA 5H91A 1YXDA 3STFA 4UTKA 3FJLA 3LCGA 4O11A 1B3OA 3L5MA 3UY8A 2WSQA 3GDMA 3L65A 5CZ0A 2HMCA 4IOTA 5C5YA 2ZFAA 3QSRA 5CZSA 3EX3A 1CW2A 3ATYA 4IMFA 2ZTJA 4GC4A 4NX0A 4JDYA 2V30A 3TXVA 2XFWA 2ZA3A 3STCA 3MHGA 1VH7A 1P1XA 1KFKA 3DKLA 1TJPA 1KM1A 3PUOA 1LORA 3I7QA 2YFOA 4JN6A 5EYWA 1W54A 4N9BA 2CLFA 3NQVA 1KW1A 3W2LA 3FJ6A 2E09A 4O54A 1UCWA 4E2BA 5I3IA 4HPXA 3NQCA 5KZEA 2GUUA 4UIOA 4FNUA 2C1HA 2QF7A 1JQXA 4M7SA 3UWWA 2FIQA 3IVTA 3LHUA 2VFDA 3OG3A 2GVLA 3NM1A 3JR2A 1W5NA 1XI3A 2WOQA 3RFAA 3I65A 3DFOA 2C19A 3WK0A 4FXSA 4NNBA 4JIQA 2H3BA 3C61A 4MIMA 1OFBA 1KM0A 2ZRUA 3WFAA 1M5WA 1V7YA 1DHPA 2A7PA 2I9EA 2VFEA 1ZCOA 4JTUA 4TU1A 2ZZ6A 4NXKA 2QCDA 3Q2DA 3PB0A 2DZUA 3G1XA 5I3KA 3ZWSA 3QC3A 1M7OA 4Y96A 3YPIA 5I3JA 1PIIA 3SY5A 4IMEA 4FNQA 5D37A 1WDWA 1RZMA 4LC8A 2JGYA 3A5FA 3CIXA 4MLRA 1B4EA 1Q6QA 3KVJA 3GAKA 4N6FA 4Y6GA 4XTIA 4LVAA 2GQ9A 3BGJA 1SQ7A 3LXAA 1ALDA 4FX7A 3B04A 5FF3A 1KFLA 4MJZA 1A5BA 3WK3A 1PCWA 4Y9AA 4NJKA 2NUYA 3W7MA 4A3UA 1I2PA 2OZ0A 4WXYA 2QAPA 1SW7A 2Y89A 4MFDA 2VKZG 3W72A 3TR2A 1EWDA 3NA8A 1S5VA 1GYNA 3GDTA 1FWTA 3R13A 2CZ5A 4YXGA 4KFNA 1TREA 3UWZA 2G5WA 2H6RA 1LCOA 3NVTA 3W7JA 1CI1A 5AYXA 4A2SA 1H1YA 4HN4A 4ZQMA 2PRMA 4MZ1A 1B57A 1GTHA 2R91A 3QJAA 1EEPA 3E9AA 1EIXA 2FJKA 3V1PA 1DKWA 1KM2A 3DAQA 3P7YA 1WA3A 2GJNA 2DZXA 2E6DA 3W1MA 3WJZA 2R94A 1ZENA 4DPQA 4GUGA 3CM4A 3FIGA 2W0UA 2CLIA 2NV1A 5LNVA 1GVFA 3GAYA 4O52A 2FLIA 3NL5A 4AHQA 3R5EA 4GXMA 4DF1A 4O17A 4NJIA 4FNPA 4TMCA 1EP2A 3MBDA 1IXOA 2HSAA 2ZZ4A 3KHJA 2WKJA 4O13A 3VI2A 3BPWA 4XBSA 1G7UA 1JUBA 1DVJA 1YPIA 4GUFA 1SSDA 2GVGA 3STEA 3QPZA 1WV2A 1YADA 2V2DA 4FNTA 2C14A 4R33A 2I14A 4DO5A 5CPNA 1YDOA 2X2GA 1F6KA 2VEPA 4ZVJA 3PAJA 2Y61A 5AFDA 3B0UX 3LCLA 3MYOA 3RNDA 3HG2A 4TX9A 3TH6A 1KM5A 2YPIA 2HS8A 5LNRA 4AWTA 2EKCA 4IWWA 4DELA 1J2WA 4HPJA 4WQ6A 5EL1A 3T44A 3M47A 1W3IA 3N2XA 2QEZA 1U5JA 1TPUA 2WJZA 3C56A 1G69A 1TMHA 3B03A 3W86A 4BI5A 1TRDA 1K02A 2GVJA 5MHBA 2ZDRA 3N73A 3W85A 4Z1DA 1VYPX 3O06A 1T0OA 2DP3A 2CFFA 1E51A 4XWUA 4Y90A 1F74A 1JCYA 3TJXA 3C8FA 3UD6A 3IIVA 3GLCA 2NWRA 4O1AA 2DORA 1QNVA 3ABQA 2J24A 4OV9A 2QJGA 4ADSA 3M5YA 1IIHA 4BK9A 4N4PA 1RQEA 3S5NA 2AQWA 2QCDB 4O0KA 1LM1A 2A6NA 2W79A 1VCVA 1KBJA 1TCDA 3HG4A 3L67A 2Z2UA 4NX5A 2Z6JA 5I3HA 1O95A 4MOZA 1G4SA 3M6YA 2H8XA 4AB4A 5AHNA 1FWNA 1WOAA 4C1KA 3KVLA 1QO5A 3FEMA 1A50A 1MEIA 3KAOA 3TUUA 3HQ1A 3KFTA 2NZLA 1UB3A 2ZBTA 4IPJA 2CZEA 1J4EA 5CZTA 3QPYA 3WJYA 1ZJIA 2E5DA 3NZ1A 2CZFA 5DCBA 1VCGA 1OJXA 1VPXA 3LLFA 4ZQCA 3R12A 3IVUA 5D2YA 4EWND 3GKFA 1I45A 3W7PA 5CPMA 3TU9A 3S1VA 2P0OA 2OJPA 3P62A 1EX5A 1M7PA 3TQKA 3WJSA 1SZEA 3MJYA 3S1WA 5U7SA 2W6RA 1RPXA 3HOJA 1H62A 2Q8LA 4EVZA 2Q3RA 5FEXA 5IBXA 1KTNA 3C52A 2G96A 3O6DA 1NEYA 2C15A 3BLEA 1SPQA 3CTLA 2TPSA 3CB8A 2EHHA 3C4UA 4O4WA 1O5KA 1SU5A 1W3TA 4E38A 5HUPA 1T99A 1ME7A 3E49A 1GTEA 2ZYFA 3SSJA 4MUZA 3CQ0A 4LT9A 4UTMA 4WX2A 4FF7A 5EY5A 3NG3A 1I2QA 4LUIA 3TSDA 1FDJA 1SSGA 3JS3A 4P61A 4AHPA 5K9CA 3NO5A 1FXQA 5GVJA 1ME8A 3BG5A 2E1DA 3F4WA 5D2VA 4WD0A 5DY2A 2R8WA 3PBYA 4FB7A 3ANYA 3G1SA 3IV3A 2DJLA 4UTJA 2FQIA 5F1UA 4LVDA 3HG3A 3GVGA 1GZGA 4RX0A 1SO3A 4KFOA 4RV8A 1HUVA 5LKYA 5SWUA 3MHUA 3W71A 1YTDA 3WK2A 3BARA 3MMTA 1I2NA 3W1RA 3BGGA 4OU1A 3M1ZA 3E12A 4ZQNA 2ZTKA 3W7LA 2QCCA 3DI1A 4NJGA 4BI6A 1W5MA 2DZWA 4H3DA 3W7NA 4HNNA 1O4UA 2JGQA 5DXYA 2BSLA 4UCGA 4CCDA 4JTGA 4A2RA 1KTBA 3LCIA 5KMYA 2BTMA 1TSIA 5L9FA 5E93A 1B9BA 5KSWA 5D04C 4G1KA 1Q6LA 3E0IA 3TA6A 4WY0A 4MFEA 1PV8A 2A85A 3CWNA 3JRKA 2NX1A 3OBKA 1PS9A 3LOTA 3LCHA 2QJIA 1Z48A 2FFCA 2YW4A 5LNUA 3GIYA 5J5RA 3MP3A 2F7FA 5TQLA 4JICA 2QCFA 4OT7A 3G18A 5J5DA 1XXXA 1Z44A 1OFQA 4M7TA 3OA3A 1I2OA 1XC4A 1QCWA 2G97A 1NF0A 4A21A 2X1UA 1JUKA 4UNKA 1AW1A 3QMRA 4JYEA 1LYXA 3FKKA 3RLUA 5CPLA 4DO4A 3BK0A 1PE1A 1I4NA 4NNAA 1H61A 1QFEA 2DZPA 5G2WA 3UPBA 3W7EA 5HWMA 2J9XA 3W2JA 4P2VA 2ZZ1A 5KITA 5T26A 4JX5A 2FDSA 2DZSA 3P60A 3S9YA 3M43A 2PRLA 3HPXA 4UTWA 1NFBA 1A5CA 3QRHA 2XN0A 4YL2A 4C1LA 3W22A 3A21A 4RXGA 1LLZA 5KZMA 2VEKA 3L21A 3N2MA 1TO3A 2RFGA 4GUHA 3BVJA 3GDLA 1MZHA 2JKAA 4EOUA 3SGZA 4Z0SA 4HIBA 5I3GA 6TIMA 2C6QA 1TQXA 1GQNA 4IX0A 4FIQA 2QKFA 1RQBA 2A1YA 5AOUA 5IM51 1JR1A 3VNDA 2QDGA 1TJRA 3B06A 5D05A 3W7DA 3GXTA 5HR6A 3EXSA 2RKXA 5DY3A 4IMCA 1RVGA 1QPOA 1JUEA 2BZNA 5K9DA 2NUXA 1EPXA 1KTCA 1FBAA 4AWSA 3TFXA 4LV9A 1ZAIA 4RK8A 3G1FA 3G8RA 4YLWA 3QW4B 1QPNA 5BMXA 3N9SA 2P10A 4FNRA 4M19A 2PCQA 3LBMA 3LCWA 3G0XA 1F2JA 3GNDA 3N14A 3W76A 2E68A 1TIMA 4N2YA 2V0TA 1BKSA 1KM4A 4PL1A 3NOEA 1OF6A 4HKPA 1X1OA 3MI2A 2P1FA 1QDSA 3VCRA 1H60A 2ISVA 5BNKA 1DBTA 1M6JA 4O0ZA 4FX6M 1H7NA 4HNUA 1ZNNA 2OT1A 5DBTA 1MO0A 1FCUA 2Y7GA 3M16A 4PC8A 5F4SA 5FEZA 3NDOA 4WOQA 5FF4A 2A6LA 1MEWA 2GQ8A 1OFPA 4UMBA 3S0CA 4UFHA 1YYAA 3DH7A 1PL9A 2DZTA 3SJ3A 3NQAA 1OYBA 1GJPA 1UUMA 1C9DA 5D30A 1SR9A 1TV8A 2VEMA 3BG3A 3DFTA 5HULA 2WV8A 4WOZA 2CLKA 4JD4A 5DLCA 2QJHA 2YYUA 3W1LA 3T40A 4WY0B 4IGHA 1H7WA 5F4WA 4RXFA 3EB2A 1I2RA 3G3MA 3GYEA 1N8FA 4RJEA 4XUGA 2E6FA 3A22A 3NM3A 3SZ8A 4DF2A 3UPWA 5HWNA 3RU6A 4DQWA 5HINA 1XUZA 2JK2A 5TBOA 3W1QA 2WO5A 1TB3A 3LERA 3O07A 3B0VC 4IX2A 3KRSA 3TFCA 4LS2A 2B7QA 2V2HA 3FKRA 3SGUA 4BF9A 1Q45A 3FYPA 3I7SA 1DORA 5AC6A 4JEQA 3UWVA 4LWWA 1KFEA 1GOXA 4IJBA 2B4GA 1LLWA 4N9EA 4GUJA 3HB9A 3W7HA 2NX9A 3EEGA 1G7VA 3FA5A 2UV8G 3F1QA 3GR8A 2NUWA 1Q6OA 4QJ1A 4ICNA 3QH2A 3PG8A 2E6AA 2ABAA 1JCXA 3C2OA 3IVSA 4NVTA 4BWLC 2ISSA 4Z1AA 2JKPA 4K7YA 3VE7A 1G4EA 3PULA 4IPIA 4XKYA 4O8RA 1LRQA 3G0UA 4QNEA 4CNOA 1OG0A 1R46A 5AC7A 3ZFHA 3TCEA 5FEWA 1W5QA 4I7VA 3K30A 4UTWC 4ORMA 5U4NA 1VGAA 2XN1A 3W88A 1RR2A 3LI1A 3H54A 1GG0A 1ICPA 4UFKA 1KLYA 1WYIA 3LCFA 3GXPA 5DBUA 4MZYA 3B4UA 1DV7A 2BWGA 1MEHA 5F2MA 3LXCA 3W75A 3DFPA 1OVDA 5CZJA 3V75A 1VYSX 4DBDA 4AEOA 1JRCA 1LZOA 3N9RA 1YXCA 2CLEA 1SFLA 2ZRZA 4A22A 4UR7A 1H7RA 2RDTA 3OVPA 2YZRA 3O15A 2X30A 4Z1CA 2RH9A 5LZLA 1ZAJA 1F05A 3H55A 4NXSA 1KFBA 3DENA 5G4EA 3G1AA 3UWUA 4HNVA 4FEZA 4PFMA 5G2HA 3CWOX 1L6YA 3CT7A 3TQ0A 1OFDA 4Z1BA 2H90A 4QIUA 3W2MA 4CCEA 4N02A 5CGQA 1XDLA 4TMBA 3W7IA 1H7OA 1L2UA 2QUTA 4UR8A 1VLWA 3UZ5A 5G2IA 2OX1A 3LHYA 2QUUA 1YTEA 3SW6A 4CCCA 1R30A 2ZRYA 4GFSA 4OBTA 4UTTC 4K38A 4AF0A 1TTQA 1F6PA 2B7PA 2A7NA 5E1QA 3GKAA 2WNQA 4M6QA 3NNTA 1RQHA 4O12A 4K37A 1THFD 3QQ1A 4FXRA 4NZFA 1VHCA 3KXQA 2J27A 4X9SA 5F1VA 3TJLA 5EKYA 4N9DA 3EKZA 1VHNA 1W56A 4CNNA 4LV4A 3TX9A 1OX6A 3MI3A 2WPBA 2FPYA 1TPH1 1UUOA 2X16A 4TR9A 3BW4A 1ZY9A 5EA9A 4KWVA 2VEIA 1C8VA 1W3NA 4LS0A 4ALDA 1SW3A 1W5OA 3KX6A 4JYDA 4UMAA 4RR4A 1F5ZA 1EP1A 3KRZA 4E2DA 5A8GA 2Y7FA 1QAPA 2J6XA 3DFQA 3TC6A 1FDYA 3HGRA 2EGZA 4K36A 2VFGA 4BI7A 4GBUA 3HBLA 3M7WA 3NQ7A 3NQ8A 3NAVA 1W8SA 3C3NA 3DBPA 4O14A 5G5IA 3EWZA 4L4LA 5D03A 1WAUA 5K7JA 3GNNA 2PRHA 2V82A 4O57A 4WZHA 1NSJA 3CPRA 2V8ZA 4JS3A 4ZQRA 2WSRA 3NL3A 3AO0A 4MZ8A 1OFRA 1SFJA 2CLOA 4XZ9A 1OYAA 4JXCA 5DELA 4RZ6A 1QPQA 2BX7A 2NXIA 4NUWA 3FS2A 1AL7A 1OYCA 5BMWA 2WSYA 1FXPA 3C2FA 1LBLA 4Z0JA 4XKYB 4TIMA 3P8IA 1SZGA 4JYFA 3EX1A 3LTPA 1SZFA 1ME9A 2J9YA 3TAKA 2FB3A 2ZA1A 1GEQA 3ABOA 3MI6A 3DGRA 3DU0A 1TPC1 3QF0A 4ZQPA 3I68A 3T7VA 3QMTA 1ZAHA 5AHMA 3TC7A 5CSSA 1JRBA 4U28A 1D3GA 5FEPA 2FPTA 1DL3A 3MO7A 4JR5A 4S2CA 1LBFA 4LU0A 3NGJA 2DJXA 2ZZ5A 3IIOA 3PUDA 4O1CA 3C2RA 1TTJA 1UBSA 2CLHA 5K2ZA 1AK5A 1FCVA 2YX0A 2ZCGA 3GK0A 5E0KA 1QOQA 2BXVA 2H3DA 4NZJA 1BEUA 2ZZ7A 1TQJA 4RZ4A 1TTPA 2YR1A 2A4AA 4OHQA 1HL2A 3Q58A 5AHEA 4YCPA 3W1TA 5AHLA 4PCFA 3EX2A 4W9TA 1TV5A 3W1UA 5C2XA 4QAIA 2BLEA 3UXDA 1OFAA 1IXPA 1WX0A 2Q3OA 3LHVA 1XKYA 2QUVA 3EXRA 4WY0F 2V2CA 4AF0B 5D02A 1Z42A 4OE7A 1EB3A 3O6YX 2ABBA 4JY8A 2E77A 5EPDA 4LVFA 3QQ0A 1MXSA 2VFHA 4JTJA 4GE8A 4MKNA 1YTKA 3A23A 1XBVA 1FY6A 4FHAA 5BOOA 4POCA 4DPPA 5AHIA 1SUXA 4LNYA 4MVAA 1XM3A 2IQTA 1GWJA 1TPVA 4K8HA 1TPDA 3G0SA 1HO1A 3EKLA 3O63A 4ADTA 1JQVA 3I6RA 4MLJA 2RHGA 1J5TA 1EUNA 3M5ZA 1ZHAA 1JCLA 1F73A 1WQ5A 4NQ1A 3GZ3A 3T4CA 5HUOA 3CEPA 5I3FA 3W07A 4IXHA 3LGEA 2QCMA 4O4VA 2CW6A 3LV5A 3UXAA 2F84A 3WK1A 2A0NA 3A9IA 3OVRA 1VCFA 3OHIA 1IIGA 4QSHA 5CSRA 3THAA 3NR0A 4RLIA 3M9YA 3DHDA 3G8EA 4OWGA 4IXXA 4EF9A 1QWGA 3EWXA 4UFLA 2NWSA 4L4MA 5HWJA 3IEBA 3TMLA 3W2KA 4AAJA 4AMAA 4AH7A 1XDMA 1Q3NA 2NXHA 2YFNA 4X3ZA 2Q8ZA 4BWLA 3ELFA 5HR7A 1Z41A 1K8YA 5EBUA 5AN7A 3NQ2A 3E96A 2GJLA 3HG5A 2ZA2A 3RLVA 4LVBA 3B05A 3HPSA 5KINA 2QCLA 5K3VA 1FWSA 3PC0A 4Z08A 4GNJA 5F2LA 4NJJA 2HS6A 2OCZA 1K8ZA 3IIPA 3LX9A 1TRIA 3W1NA 1P0NA 1O60A 1FUYA 5BRBA 1EP3A 4UTHA 5DN1A 3NL2A 4JGDA 5AYZA 3BW3A 3NQGA 2QDHA 3VFLA 1QPRA 2ISWA 3LCXA 1HFBA 3TROA 4E0CA 3S6DA 2OT0A 4JX4A 1AL8A 5LGXA 3GDKA 3PM6A 3LTSA 4ZZ9A 2ATMA 3BO9A 3R2GA 2TRSA 4K39A 3E02A 4O18A 1TYGA 3B0PA 3MHFA 4LS1A 3MBFA 4PA8A 2R14A 3H53A 3PBWA 2Y85A 4M5PA 3PUEA 3NPUA 1GVOA 4I7UA 4IQLA 1S5TA 2YSWA 3LRMA 4LRTA 1SO4A 4ZL1A 1IF2A 3F4NA 3Q37A 4X2RA 1XUUA 3O8AA 4ZMGA 2D73A 4QNWA 4UTTA 2Y6ZA 1G4TA 3TXZA 3S42A 1K8XA 4O1BA 1KM6A 4DBEA 1A5AA 4IUOA 4JY9A 2QAFA 5D09A 1GT8A 3TKFA 2Y62A 3HGJA 6ALDA 5FESA 3W2UA 3GX9A 1Y0EA 2Z0IA 2VFFA 3M5XA 1XFBA 2Y70A 1DJQA 3CLMA 4JTHA 3EXTA 4PODA 1YPFA 3TV8A 3M41A 1MSSA 3UNDA 2DZVA 4LW7A 3W7OA 2FPVA 3OEXA 3P5YA 4DEFA 1W5PA 4LVGA 1ONRA 1OX4A 4M6VA 3A24A 1K7FA 3LDVA 1LOLA 3A5VA 4JTTA 1LRTA 2Y7DA 3ZWTA 2RDWA 4U4MA 3P84A 3S8HA 1SO6A 5KTLA 4PH6A 5F4XA 3W1AA 2YGYA 4MJMA 1XBZA 2VC6A 1JVNA 5AB3A 2VOMA 3HF3A 2C18A 4ADUA 3MWAA 4PEKA 2A5HA 4LC6A 3TW7A 1DQXA 1RV8A 4ML9A 3CEUA 4S2BA 2PURA 1H50A 1N55A 1JCMP 2Y7EA 2ZQ0A 4FIRA 3KOFA 4J9JA 3O1NA 2EAWA 1AW5A 3HIJA 3LXBA 4CNPA 4O10A 1JULA 3UYCA 1ICSA 5HNRA 4ORIA 4PTNA 3FLUA 1QR7A 2I1OA 5G4WA 3SECA 2YW3A 4BR1A 1NF7A 1GYLA 2V9DA 1LRNA 3NQ6A 3L68A 1GVRA 3FYOA 5DCDA 1VQTA 2B7OA 3O16A 3W7KA 3NPVA 3IGUA 2VXNA 5FI8A 2QR6A 1S3HA 4IMGA 3IRDA 3LB0A 4GJ1A 3UY7A 3CC1A 4Q32A 4NT0A 5A5WA 2KZHA 3G1YA 3L9CA 3ATZA 3INPA 3G1VA 3OIXA 4KWWA 3UQNA 4LTSA 3NYZA 5D2XA 4XBKA 3LRLA 1AW2A 1LOSA 4AWUA 5F2IA 5CPOA 1WBHA 4UUIA 1EWEA 1YDVA 2WQPA 1R2RA 4OQVA 4UTIA 3SFKA 4R34A 3IIZA 2YDAA 4EF8A 3BLFA 3W23A 4WJEA 2TSYA 2C0AA 1OFEA 4MY8A 1R2SA 1KV5A 4OGZA 3SI9A 4AXKA 3R8RA 3L0NA 3P80A 3CIWA 3LBCA 3TE9A 3NQMA 3WJWA 1FCBA 4N9CA 4HSOA 1A53A 1IGSA 3HGSA 2Y63A 4YCOA 5K4ZA 3O6CA 5LHEA 4UMCA 2WNNA 3DI0A 5C55A 4OV4A 1H1ZA 1GVSA 3PF3A 1HO4A 4M6PA 1HTIA 4O28A 3DHFA 3WJXA 2X1TA 3BW2A 5D32A 1XCFA 2V5LA 1VS1A 7TIMA 1LBMA 2QCHA 2YCEA 2YXGA 5H2ZA 2NLIA 1K7EA 2G95A 1KM3A 1LTDA 2ZRXA 3W6YA 1ZFJA 3P8JA 1OX5A 1EA0A 1ADOA 5CG7A 2E5CA 4UFIA 3UWYA 4LOCA 4DXVA 4Q4KA 5K9XA 4N6EA 3NL6A 1KFJA 4JTSA 4QITA 3DFSA 3VKJA 1W0MA 3LHZA 1A5SA 5D2TA 3G1DA 3C2EA 5LNSA 4IMDA 3M44A 3ZS4A 4GUIA 1FWWA 1TPFA 4EIVA 2A7RA 2VFIA 3EWWA 3QW3A 3M0ZA 4LRSA 3TSMA 1OX4B 3QZEA 4JTLA 1W1ZA 5FF2A 1H63A 1DOSA 4O50A 4MYXA 3PBVA 2NV2A 1VR6A 2X1SA 1SW0A 3IGXA 3S5ZA 4CLMA 5BW6A 3W1PA 3M5VA 4PL2A 3ABRA 3BLIA 4UTLA 4YWIA 3TNOA 3C6CA 3RMJA 3LV6A 2ALDA 2EPHA 4UXDA 3W73A 3LTYA 3KRUA 4O53A 1P0KA 3S1UA 2WNZA 3FFSA 4I7WA 3LRKA 3USBA 1F76A 1BTMA 1O94A 2PC4A 3SR7A 4WXZA 2EF9A 2QCGA 2CU0A 4FO4A 3ZR4A 1YXYA 2RDUA 1H51A 3NQDA 4GWEA 1G4PA 1VRDA 1VZWA 2CZDA 1QOPA 1I8JA 3GXNA 3O05A 2TYSA 3DZ1A 3G22A 1PHWA 3TSBA 4D2JA 4O16A 1H7PA 1KA9F 2FTPA 4JX6A 3C0JA 4UTUA 2X1RA 5HQEA 1W31A 3QMSA 3C2VA 2VELA 4FX8A 4DF0A 2J9ZA 2B0MA 1JJKA 1K03A 2ZRVA 3DXIA 1QO2A 4XTDA 2CWNA 3LLDA 5L6UA 1L6SA 1WBJA 1FDZA 3EWUA 4KFPA 4QQ3A 1FWRA 2DU2A 2ZRWA 3NQFA 1BWKA 3NPWA 1OHLA 3RK8A 3IGSA 2FB2A 4K8EA 4UC5A 1T8XA 1EUAA 1O5XA 4NNCA 3TMQA 1R47A 1UASA 4MYAA 4RKAA 1T96A 3ABSA 3HGOA 4MY1A 4K6AA 3EWBX 1XL9A 2NXGA 2QCEA 3FOKA 3T55A 3RF9A 2B7NA 5G1TA 2GQAA 3QM3A 3U8GA 1X1ZA 2O7SA 3R89A 1FQ0A 4JIPA 3TDFA 3W7QA 2TMDA 3L0KA 3U6WA 5LGZA 3G1HA 1IXNA 4O15A 5LHFA 1FX6A 3GR7A 3HO8A 3W87A 3Q94A 2J88A 2C3ZA 3LI0A 1DQWA 4HHPA 5K4XA 1JCJA 4Y8FA 5AYYA 4AHOA 2ZZ3A 5CKSA 2CLLA 1PCKA 3GB6A 2NX3A 2H8ZA 4I9AA 4H4IA 3SIZA 3BV4A 2Y88A 5EMUA 4KKXA 3G24A 1LROA 3LHTA 1N7KA 4QM1A 5LSMA 4K7VA 2AAMA 3MUXA 3KVMA 3OVQA 1OK6A 4UFJA 1Q6RA 1X7FA 3GDRA 2OMAA 2GPTA 1OK4A 3KVKA 1DJNA 3W70A 2C13A 3P67A 3T78A 1K3UA 4BFAA 3W83A 5F2GA 1F7BA 4LY8A 2ATSA 1L9WA 1PHQA 1KV8A 3L5AA 4MPQA 3P61A 1P4CA 3IIXA 3PSVA 4X22A 2AGKA 3W9ZA 4R53A 1KBIA 4N4QA 1G67A 1GPWA 4ZQOA 1H7XA 3CU2A 1VLIA 2Z6IA 3NXFA 4TO8A 1SO5A 1UJPA 5TIMA 3PB2A 4O19A 3PWAA 4CQ9A 4UFMA 3LM7A 4LUJA 2A2IA 3QFEA 3PY2A 3STGA 4XQ6A 3TW6A 3EWYA 4YMZA 3TQVA 3THQA 1ZALA 2JBMA 3F03K 1FCQA 1WOBA 1LP6A 1YLVA 3UZJA 2E5BA 1XBYA 1JCNA 1G6CA 3I7RA 3W7CA 1GVQA 1IXQA 2QCNA 3NQEA 3QEZA 1YDNA 3UWQA 3W7RA 3W1XA 3HMJG 4FNSA 1R2TA 1L6WA 3EX4A 3BG9A 4A29A 4Q33A 1W37A 5AHFA 2HTMA 4S1FA 4DO6A 1VC4A 4B5NA 3NZRA 5KZDA 3G3DA 3HJZA
chains in the Genus database with same CATH superfamily
2EPKX 2AOSA 3ITXA 1U83A 1XW8A 1DJYA 1S2VA 2IPJA 4A05A 4JTFA 2ZC8A 3W6LA 1E56A 2O7QA 3MYPA 3OQ8A 1X8FA 4UOZA 2QJNA 1EJSC 4JNMA 3TN4A 1HJWA 5HJLA 4AWEA 3L2IA 1OFOA 4O1DA 1R3SA 4U5IA 1QMLA 4UNLA 2FZBA 4GRSA 2QPUA 3VD7A 1OT2A 3DKJA 5HMSA 1RP8A 1BRLA 3PR2A 2V81A 3A3WA 4QE1A 5IOBA 3DFNA 2QV5A 3K8KA 3GTIA 3M7SA 4MB3A 3AXKA 1XIGA 1X6UA 4OUIA 3MV11 1C29A 1UWSA 1XLAA 4H6KA 3URAA 3D0CA 3P5ZA 2HVNA 1V5XA 1KLZA 1DWFM 4EPDC 2PDMA 1EJUC 4P7NA 3MW7A 4NJHA 2F6XA 3SGGA 5FF7A 3JVAA 1GOMA 2GSJA 2GUYA 4CN4A 4GKLA 2YKKA 1IV8A 4ZTXA 1E3XA 2ACSA 4B4HA 2A21A 1PX4A 2YYTA 3WLKX 1AMKA 1TV7A 3P82A 1KCKA 4I9TA 4RZ5A 1SGJA 3EB3A 5G1YA 1JCTA 1XG3A 2C16A 1H5YA 3TAOA 3F4DA 3P74A 4NSBA 4HK7A 2PDQA 3STFA 1XSKA 2XVNA 6ENLA 1W32A 5DANA 3PJXA 3L5MA 3C0QA 3RPTA 5CZSA 2ZIDA 2V30A 3TXVA 3VGHA 4G7EB 3OGSA 3ZVIA 3T6CA 2RGMA 1UMYA 4F79A 3MHGA 1V03A 3IK2A 3R10A 3PUOA 4EXBA 1ZPTA 5EYWA 1W54A 2EPOA 4OTKA 2BVWA 3W2LA 1JDFA 1TUXA 2E09A 1TZ7A 4IIFA 4HPXA 3GZAA 3ALFA 2C1HA 1MXDA 3UWWA 2FIQA 3ITLA 3B3DA 3IAQA 3NM1A 3JR2A 3VOCA 1W5NA 1V3LA 3V4BA 3UFYA 2C19A 1W1PA 4UWMA 3P0WA 4TV6A 3N04A 1NWUA 4NILA 4BQ2A 4MIMA 4KT2A 4QSFA 1IE7C 1CXIA 1DHPA 3AMLA 3NOYA 3VX0A 1KQZA 3R0UA 2NSXA 4D9PA 4NXKA 4XD3A 3S2CA 3PB0A 5I3KA 3L4WA 4KPLA 1F8MA 1M7OA 3YPIA 4FR6A 5FACA 3WQ5A 2PDYA 3SY5A 2OGYA 5C9UA 1UR9A 2VVNA 3S6OA 4LC8A 3LNPA 3JW7A 1QI5A 2JGYA 5C70A 1UD4A 4Q8TA 1BYAA 4MLRA 1OEPA 3GAKA 4N6FA 4XTIA 4LVAA 4B3KA 2B81A 2PDBA 5FF3A 4MJZA 1A5BA 3VGGA 1TWDA 1UR1A 4Y9AA 4AIOA 2NUYA 3SQSA 3W7MA 5CLWA 1I2PA 2QAPA 3D47A 4F3HA 1R9YA 3VK5A 2DVUA 5C9ZA 3W72A 1EWDA 5A6AA 1S5VA 4XK2A 3HA1A 3GDTA 1IEVA 1BWVA 3NVTA 3W7JA 5AYXA 2A3AA 2G3JA 4GZIA 1NTHA 2P88A 3R79A 3QJAA 3V1PA 1WA3A 4GUGA 1E72M 3CM4A 2VC9A 2CLIA 4PSRA 2NV1A 2FLIA 3NL5A 4AHQA 4GXMA 4O17A 2V3GA 5B7ZA 4TMCA 1IXOA 1POJA 3K4DA 2ZWZA 5HAOA 4O13A 1ZBWA 2OWCA 1G7UA 1JUBA 3II1A 1CNVA 2WHLA 3STEA 3E3HA 1YADA 2I14A 3TWBA 1YDOA 2XSXA 1HJQA 2X2GA 1F6KA 3WLSA 2Y61A 3V18A 3LYEA 3LCLA 4U31A 3MYOA 3RNDA 4EXQA 3HG2A 2PB1A 2YPIA 1BTCA 2Q02A 2GDVA 2BFGA 3M0HA 2HV5A 4DUWA 2Z28A 2YA1A 1U5JA 3FXGA 4DWDA 2D3LA 1VFFA 2PDXA 3BV7A 5FD0A 1R3YA 3W86A 3VMOA 3R8GA 3M0IA 2GGIA 4HBKA 1TRDA 4C6IA 3DFYA 1K02A 4MUPA 3WF3A 1NFPA 2CBVA 4YJ5A 3VKAA 1VYPX 2CWXA 5FL1A 2ZUUA 3TJXA 4XKMA 3C8FA 3UD6A 3IIVA 4O1AA 4ZB0A 2J24A 2QJGA 4ADSA 2EG6A 4BK9A 1IIHA 3MY9A 4N4PA 3FY1A 4AG0A 2QCDB 1Y5WA 2CXEA 1RCXB 4MWAA 3HG4A 2R24A 2Z6JA 3LK6A 1X38A 1XLMA 5GJPA 3NO1A 1E9LA 3CBWA 1CPUA 1MFUA 1WOAA 4F0HA 1QO5A 1MEIA 1QWKA 3NZPA 3DG3A 4QE5A 3TUUA 1IZJA 3HPAA 5CZTA 3MDWA 1F07A 2CZFA 4ICCX 5M17A 3PK7A 3PBGA 3M0KA 5IHSA 1VFTA 3IVUA 5D2YA 3USZA 3G1RA 1I45A 3AC0A 1JPKA 3QR1A 3ZQ9A 1PTGA 3MA8A 4GYPA 3MT1A 3MJYA 2W6RA 1RPXA 2OKTA 1JI2A 3HOJA 4B5UA 2Q3RA 4A8NA 1BSIA 1XYBA 1TCMA 3EWCA 2A3EA 3LS9A 2IPWA 3E38A 2AKMA 3CB8A 3VNJA 1UZ1A 1V0NA 5EFDA 3BOFA 1SU5A 1W3TA 3SB0A 3R25A 1ME7A 2EJ1A 3RIKA 4Z2LA 3WUFA 1Q5MA 3SSJA 5HQMA 4WX2A 3AIRA 3LEPA 4LUIA 4K2SA 5K9CA 5GVJA 2HEJA 3SRHA 2WSPA 2R8WA 1A0DA 3PBYA 3ANYA 2YLLA 3G1SA 3IV3A 4S38A 3B9DA 4PMDA 1A3HA 5F1UA 4CD8A 3VD9A 1AA1B 3PN8A 4J28A 2RUSA 4XSMA 3ARUA 1I0BA 1KC7A 5HNNA 3OBAA 5REQB 2QXWA 4Z2GA 3BARA 3UG8A 1I2NA 3WL0A 4OU1A 3E12A 4JQ2A 2WXDM 1XYFA 2J77A 3WLPA 2F6UA 3BSHA 5G4HC 4NJGA 4H3DA 3W7NA 4HNNA 1O4UA 2JGQA 4PMJA 1XG4A 3OBEA 2WC3A 1H1NA 3LCIA 2ZOXA 3SCPA 4EK7A 2Z1KA 1BF2A 2PTYA 5KSWA 4MJ4A 5C71A 4MFEA 1PV8A 4B4FA 4AYGA 1MW1A 4GIRA 4CN6A 3LOTA 2J7EA 2VR2A 4ZXLA 2YW4A 1Q7ZA 5LNUA 4I5RA 1KQYA 2I7GA 1L6GA 4E5TA 2X0HA 1J96A 1GHSA 5J5DA 1PYMA 3CV6A 4M7TA 3VYLA 2G97A 1NF0A 2INEA 4A21A 1JUKA 1NDZA 1AW1A 3QMRA 3FKKA 5CPLA 4DO4A 3XIMA 1PE1A 1I4NA 4NNAA 1QFEA 3KOZA 5G2WA 2J9XA 5BXSA 3AFBA 3M0LA 2ZZ1A 5KITA 1KRBC 4E2OA 5AKQA 4JX5A 3RX2A 2DZSA 3S9YA 4YHEA 1XX1A 2R1PA 4XVEA 1NFBA 4XX6A 1A5CA 3QRHA 2XN0A 3GYCA 2V38A 3W22A 1NFGA 3E2QA 3GRIA 2VEKA 3O2LA 2DV0A 4XAPA 5A6KA 1TO3A 1I6NA 2PWDA 1NDWA 3W25A 1MZHA 2JKAA 3SGZA 4HIBA 5I3GA 3B9NA 4J7RA 8XIAA 4IX0A 5LA0A 1RQBA 3H7VA 2A1YA 5AOUA 2UY4A 4K68A 4GYPC 3W7DA 2RKXA 4ZBCA 2BVYA 3UF9A 3BMXA 2GWGA 4JHOA 3UGVA 4W8AA 1L8PA 1GZ1A 4WCJA 1JUEA 2BZNA 4KIEA 3BJSA 3KRBA 3VKKA 2O9PA 4AWSA 5JVLA 1ZAIA 5HPCA 4RK8A 1NWTA 3G8RA 3UJ2A 1TMQA 2C1IA 3N9SA 2VVSA 2P10A 1IZCA 1F2JA 3W76A 2BXYA 2E68A 2V0TA 1M1BA 5BRQA 1W17A 2JF7A 4HKPA 3KW3A 3GW0A 2FHBA 2BB0A 1E6SM 5CC6A 1EBGA 3BAWA 2YBUA 1M6JA 1V7AA 4GVIA 4D6EA 4AIUA 2QDDA 4A8IA 2OZ8A 1ZNNA 3FDKA 4PC8A 5F4SA 2WJDA 1VBUA 3TYCA 4NKCA 3IACA 1EF2A 1MEWA 2GQ8A 1OFPA 7PTDA 1S2UA 1EEXA 3S0CA 5A95A 3F5JA 3N29A 4DIAA 1ZBVA 3CZ8A 3NQAA 3B8VA 1GJPA 3SQLA 3BMVA 2YOCA 1C7SA 3EKGA 1TV8A 4M1RA 2VEMA 4GBDA 2WV8A 3HMCA 2YYUA 3W1LA 3PZIA 2OLAA 3G3MA 1FH9A 2P3ZA 3GYEA 3EPMA 1A5OC 1TWZA 1E1CB 3T2PA 3ZJKA 4JQ1A 4WSJA 3CMJA 4HA0A 4IX2A 2ZWYA 3KBJA 1E5NA 3R4IA 3FW6A 5JMUA 3SGUA 2XPKA 3I7SA 1DORA 5AC6A 3BAKA 4LWWA 1UR4A 4I9JA 1KRCC 5I77A 3NJ3A 3QOMA 4GUJA 3W7HA 4W5ZA 1KGWA 2GUBA 3QHMA 1OZMA 4GI8A 1MW2A 3QH2A 1BYDA 7XIMA 2E6AA 4NVTA 4IFKB 4LF1A 4LCQA 3EBVA 4LCSA 1G4EA 2DSUA 2J7CA 4GK8A 4ACZA 4O8RA 2XTKA 3G0UA 1X1NA 2PDUA 1IEQA 4FR1A 3TCEA 4KH2A 4I7VA 3KWXA 4PMZA 4ORMA 5BWAA 3W88A 3PZVA 1ICPA 3DFHA 4W7UA 1KLYA 1WYIA 5CQ1A 3FSUA 4JOMA 1X7IA 3B4UA 2BWGA 4Z2KA 3B8TA 1FRBA 3LXCA 3W75A 3DFPA 2I5GA 5CZJA 3F2BA 1AD4A 3LY0A 4IIDA 4DBDA 4GA8A 1PWMA 3WO8A 1LZOA 2VC5A 3WQOA 3N9RA 1HGYA 1SFLA 4A22A 1FH7A 2WHMA 3VZYA 2X30A 4Z1CA 5LZLA 3H55A 3W24A 3DENA 1J2BA 2QS8A 4FEZA 3CWOX 2V6AA 3S3GA 4LNCA 4G9PA 9CGTA 2DDXA 5CGQA 2DW6A 4TMBA 1UD3A 2VNCA 1L2UA 1QBAA 2AL1A 5G2IA 5REQA 5DT5A 1QHPA 4GFSA 3AXMA 4OBTA 5AECA 1QOXA 4J5NA 4CU8A 3RAOA 2QDEA 4M6QA 4K37A 3SUUA 1LG1A 4MHBA 1F6YA 2WMGA 4NL1A 3TJLA 3WBXA 4N9DA 4LV4A 3N13A 2Q01A 5CGMA 1XYLA 2GQ3A 2WPBA 1Z69A 2VR5A 3VIKA 4LBSA 2X16A 1ZY9A 4LS0A 3DGBA 2VUYA 1US3A 4RR4A 4F0MA 3CZLA 1IR2A 5A8GA 2ZVRA 1Q7MA 1VPQA 3VIIA 1B54A 3R0DA 3HGRA 1PB0A 2VZTA 4BI7A 5BYWA 1TV4A 3EWZA 1ESWA 2HDJA 2YBTA 3D6NA 5K7JA 4ATDA 3GNNA 5I3DA 4IPNB 2F8QA 4CGTA 2JE8A 4WZHA 4P8UA 3CPRA 2V8ZA 1RY0A 4J3ZA 2WSRA 3NL3A 1JXKA 1VIWA 3STPA 2CBJA 1SFJA 4XZ9A 1IT7A 4JXCA 1EDQA 2G4JA 2PEVA 4RZ6A 4TVDA 1HF6A 4NUWA 1AL7A 1QHZA 1O1ZA 2WSYA 5E0FA 3C2FA 1EL3A 2D2GA 4V15A 1ISZA 3T08A 5D9OA 3V16A 4XD4A 1RLCL 4I5XA 1WDRA 3ABOA 3LGGA 1TPC1 3QF0A 2PGEA 3OA5A 3KLLA 3QMTA 5FJOA 1LWIA 5E6ZA 1XGZA 4U28A 4BZYA 1D3GA 5FEPA 3MO7A 2XSBA 4C6PA 3BUVA 3W4RA 2DJXA 3IIOA 1R3QA 1P7TA 5DX7A 1TTJA 1V6TA 3IJ6A 5TAOA 3U57A 5K2ZA 1VBRA 3VDBA 1FCVA 4DY1A 1U5VA 2H3DA 1S2AA 4MPKA 4XVDA 4EANA 2ZZ7A 2GK1A 2FHCA 4TTUA 1QNPA 3APGA 3PFMA 2E1WA 4BHYA 4QDPA 2DEPA 1UP2A 4RW3A 4PCFA 3UJEA 1TV5A 4C1NB 4QAIA 1GQKA 2BLEA 4W87A 3UXDA 1IXPA 1XKYA 3EXRA 4WY0F 4AF0B 3WNPA 2PSNA 1EB3A 3ABZA 3O6YX 4XO6A 4JY8A 1YNQA 1MXSA 4WIWA 1GVIA 1U30A 2DW7A 2PU0A 2CPUA 1XBVA 1CXLA 1DWAM 4DPPA 4GQ0A 3TN6A 3E5PA 4MVAA 1XM3A 2XYLA 2IQTA 4JEJA 1TPDA 2HPIA 3EKLA 4ADTA 4MLJA 1EYEA 1RD6A 3HQOA 2E25A 3L7RA 3F2DA 1HKWA 5HUOA 1WCGA 2PLMA 5I3FA 3FV9A 5CPQA 2VZSA 5HNTA 2C8NA 1E1CA 2OOGA 3VFCA 2QCMA 2CW6A 1OGSA 1WP6A 4OVXA 3A9IA 3TLLA 3UP8A 3TR9A 1IIGA 1ZBCA 3DHDA 4Y7EA 4IXXA 3PWGA 3N4FA 3UNTA 3BLLA 1JZ4A 4IMAA 2XVPA 4AMAA 4GYFA 5I78A 2NXHA 1J10A 1K8YA 5AN7A 3EYPA 3NQ2A 3BAXA 3PTKA 1IEIA 3FEQA 4BQ3A 1V77A 3MCNA 1RLDA 3VX1A 3KBNA 3WDIA 4C60A 5FKYA 3UJRA 4Z08A 4GCXA 1F4AA 3IARA 1TX2A 1K8ZA 3RITA 2Y5EA 4REQB 1EP3A 4LAOA 1JG9A 1AZ1A 4PTVA 4JGDA 3COTA 1Z89A 3B40A 3NQGA 2QDHA 1IWPA 3TROA 3PPCA 4YTRA 5CZKA 3LSCA 4B9ZA 2G41A 3LTSA 2V69A 1NM9A 2XGBA 1TYGA 4PULA 2BS9A 3VIJA 4XZWA 2REQA 3MBFA 3H53A 4M5PA 4AIEA 4H8VA 3NPUA 3TNBA 3CH9A 3TZNA 3WDRA 4HA3A 2PPGA 2FJUB 3LRMA 4LRTA 4X2RA 3O8AA 2OELA 2XIJA 4ZE4A 5E0CA 4UTTA 5D9PA 2EPLX 2ZDSA 3S42A 3WFZA 1K8XA 2FZDA 3CB3A 3AMGA 4CD5A 4K1WA 4RDZA 3FNDA 4PUMA 1UWQA 2WCSA 4O1FA 3W2UA 1Y0EA 2V3FA 1J0YA 3M5XA 4QG8A 2ALRA 3GBEA 3M41A 2ZX6A 2DZVA 9RUBA 3W7OA 3OEXA 1W5PA 5MKGB 1OX4A 4M6VA 3A24A 3UXIA 4IIEA 3S8HA 4KW2A 4PH6A 5F4XA 2BVDA 2YGYA 3KDNA 3W1AA 3CHFA 4CQCA 4L4OA 5AB3A 1JPDX 2VOMA 2VDIA 3TW7A 4ML9A 4NAEA 1ZRQA 1JCMP 2Y7EA 3OGRA 3I3DA 4J2MA 3NSMA 2D1ZA 3O1NA 2EAWA 4S23A 3HIJA 4CNPA 4Y9NA 1NDYA 2AQOA 4Y9MA 3UYCA 1ICSA 4NP7A 1UR8A 4KMQA 4JIIX 2J8FA 1QR7A 2EQDA 1JZ5A 2V9DA 1LRNA 4S3CA 4U3CA 3NQ6A 3L68A 3FYOA 5DCDA 2VOTA 2B7OA 3O16A 3EMCA 5I02A 3W7KA 4QLKA 2PC8A 2WMJA 2QR6A 3IRDA 3ME3A 4XZBA 1WDSA 2E7FA 1DJXA 1UZ4A 4GPNA 2KZHA 3G1YA 3POCA 1T6MA 3WNOA 2PWFA 3U7BA 3INPA 3M64A 5BOFA 3PNUA 5D2XA 4XBKA 2A79A 1LOSA 5LA2A 3VOFA 4OECA 4DRSA 1OWQA 2YDAA 1BQGA 5T8GA 1R2SA 1Y7VA 1FVPA 3BAJA 1XRVA 1D8CA 2PD9A 1WKDA 4GGHA 2OWXA 3CIWA 4HA4A 4HOZA 4MG4A 1KBKA 3KBWA 1ITCA 3HGSA 2P76A 5K4ZA 3O6CA 3DI0A 3PANA 1XLIA 1H1ZA 4S39A 2IQDA 1HTIA 4E8CA 2NQHA 4Y9PA 2PDWA 2X1TA 3O7UA 3SQMA 4DWSD 5D32A 5JIPA 7TIMA 5A6BA 4Q22A 1LUCB 2YCEA 2YXGA 4ES4A 3VM5A 4NG3A 3A64A 1KM3A 4B92A 2WQDA 4WDUA 1AQFA 1ZFJA 4DJFA 5M3WA 5CG7A 5M03A 2E5CA 3UWYA 4IQDA 4Q8QA 1PX8A 3HFYA 3UYIA 3LHZA 5D2TA 3G1DA 4DYKA 4IMDA 3KEHA 1FWWA 2ACUA 2F38A 3EWWA 3QW3A 2J8GA 3AI0A 4JTLA 4Z17A 4MYXA 3BZGA 1XIEA 2X1SA 1V02E 1OCBA 2DSWA 3IGXA 3S5ZA 4D6IA 4V33A 4C6MA 1OC7A 2ZVIA 3ABRA 1OD0A 2PTDA 4YWIA 1VIZA 4OZOA 3IJ7A 4Q6JA 1WKEA 2ALDA 4UXDA 4H6EA 2CCRA 2DFAA 1V6VA 2XDFA 3H8AA 1BXCA 1BTMA 1SJAA 4ENLA 1LLOA 1C7TA 1HX0A 1F3XA 4Q4PA 3O3RA 1K9EA 3AYVA 1W1IE 3AU6A 1G4PA 1VRDA 3A13A 4D6JA 2CZDA 1I8JA 3UW6A 2QHAA 4IICA 3O05A 1PHWA 4IGSA 3WQGA 1KA9F 2FTPA 3WEOA 1D3CA 2Y5SA 4JX6A 3C0JA 2VZOA 3QMSA 3C2VA 4DF0A 2J9ZA 4WJXA 3VZZA 5AC4A 4M81A 1RP9A 1GOOA 2VURA 1TJ2A 3L23A 2OXNA 5LIXX 4FPSA 3PNZA 1XLCA 2XIMA 1CLKA 1JDCA 2QGHA 3WH8A 4RL3A 1BWKA 3IGSA 2EG7A 3WQVA 1EJ7L 1T8XA 4EXAA 4QGCA 3TMQA 4AISA 1TA3B 3WNKA 4CU7A 4QCFA 4RKAA 3HGOA 3OYXA 1WUEA 3EWBX 1XL9A 4NY2A 4LYKA 4LBUA 1E6QM 1Z32X 1SFTA 3RF9A 5JUVA 2B7NA 1VD6A 2GQAA 3QM3A 5JBFA 1GOIA 1X1ZA 4WKHA 1NH6A 4M6UA 3L0KA 1FKWA 1GCYA 3MMUA 5LGZA 1XISA 4QDWA 3CAKA 2FZMA 3TTSA 1EC7A 3HO8A 2XM1A 3Q94A 3RXZA 5K4XA 3CAQA 5CKSA 4LXFA 2CLLA 1PCKA 3GB6A 1DIDA 3VTRA 2POTA 3GG0A 1C91A 4WSHA 3WBYA 5EMUA 1LROA 3LHTA 1N7KA 4QM1A 4RE3A 4Q4RA 2YCKX 3OVQA 4F0SA 1LJYA 4LALA 4DJFC 1X7FA 3T0AA 1KCXA 1E6PA 1Y5XA 3KVKA 1OK4A 3GH7A 3ZT7A 5F2GA 4LY8A 5A8OA 4JFUA 4MPQA 3P61A 3T0DA 2J8TA 4ZQOA 1H3GA 2Z6IA 3TN3A 1NU5A 5TIMA 4CQ9A 1RK5A 3U2CA 1UWRA 1XSIA 4JZ5A 1BXNA 1IGWA 3PY2A 3STGA 4EKJA 4YMZA 4NF7A 3TOPA 2Z4GA 5H1WA 4LAKA 3F03K 1Q8JA 3WLQA 1YLVA 1W9UA 2QIIA 4PFHA 1XBYA 3TONA 1JCNA 2I5IA 3DBNA 1IXQA 2QCNA 4PUJA 1L2QA 3ZR5A 4LSBA 1J93A 3W1XA 1Q8AA 3GH5A 1T41A 4AZHA 3AHTA 4NRSA 3EB4A 3LUTA 4S1FA 1ECEA 1VC4A 3HJZA 1RD5A 1EGMA 3PG9A 1VJSA 1AJ0A 4DN1A 4RCXA 4IIBA 1HG3A 3BC9A 2MNRA 2WMIB 3S1XA 4R88A 2GJXA 2HPMA 3RRXA 3VOJA 4MY9A 3RCYA 3L0GA 3XISA 3PZNA 4JDBA 1BAGA 1ML1A 2VMFA 4JQ3A 4P7OA 3PJTA 3MVTA 3L66A 1W2VA 3MP5A 1EHNA 1XBXA 2ZX7A 3IRSA 4XIMA 3N3MA 2JKEA 3V0TA 1NVMA 5DCEA 5C6MA 4HJWA 5D33A 2XN2A 4GFIA 3E1F1 4HNTA 2E6YA 3UERA 2J4GA 2D2OA 3VC5A 4CEXC 2CLMA 4F0RA 1TPB1 1JZ7A 5IRPA 1LOQA 3N34A 3PZQA 2PWUA 4D6DA 3WD3A 3VE9A 1KFCA 3EX6A 3U4FA 1WXJA 5D4YA 4CQAA 1UD5A 1TELA 3LHWA 4GI6A 3W7GA 4B5VA 1LUCA 1CBGA 1UZHA 2Z1BA 3QHOA 2LLEA 3TK7A 4K3ZA 4QS5A 5AC8A 1EX1A 1OCJA 4UOQA 1TZ9A 2ZUWA 4JTKA 4UBPC 2DUAA 2GOUA 2O9TA 2V5BA 4YWSA 3E74A 4US5D 3SUWA 2A3CA 2HQAA 2HJPA 1VJIA 1FWGC 5FJJA 1UKPA 2HE8A 3PBUA 5BXPA 1HKMA 1YXDA 1XLEA 4GIEA 4HTBA 4UTKA 3FJLA 4GNKB 1B3OA 1IHIA 5CZ0A 5C5YA 2UZ9A 3QSRA 3ATYA 5CAHA 1TE6A 4NX0A 3K13A 2BOFX 1A4MA 4KBXA 1XF0A 2XFWA 3UR5A 3RILA 4GMEA 1VH7A 1P1XA 2WKGA 1KFKA 1JXJA 1TWWA 4Q8UA 1Z6KA 1UH4A 1WXZA 2O4MA 3DOPA 1D7KA 3S2NA 3KWSA 1YNPA 3TZFA 5JH2A 5ABGA 3GFYA 1KW1A 2YDSA 2MUCA 1UCWA 5I00A 2GUUA 4UIOA 5FIPA 4M7SA 3OG3A 3W00A 2HBVA 2GVLA 2CHNA 2OLSA 1XI3A 3I65A 4WDTA 4AU0A 3WK0A 3BCDA 4QTGA 1BSLA 4IISA 4JIQA 1GVEA 1UR0A 4H9ZA 3L4UA 3WENA 4I8YA 4TU1A 5E70A 3BLPX 3Q2DA 1V6WA 4L1XA 1P6WA 2DZUA 3G1XA 1TR9A 4MB4A 3PZUA 1ITUA 3VUSA 3GTNA 1AJZA 1PEZA 4FNQA 4M56A 1WDWA 2VCCA 3OOQA 3M6DA 3KHDA 4NYYA 3ARRA 5DF0A 1B4EA 3QXBA 1Q6QA 5JBDA 1VF8A 1TA3A 2GQ9A 2W61A 1MUMA 1JIBA 1SQ7A 1CGTA 3N2BA 4JPGA 3DYMA 4ZOBA 1J01A 1CGUA 4EAMA 2VDHA 2Y89A 2BNJA 2XZ7A 3VKCA 3NA8A 1HQTA 2DH2A 1FWTA 3R13A 4D1JA 4YXGA 4FOKA 1A49A 4GY7A 1B57A 2PLJA 2GGEA 3RM9A 2YBVA 3CGTA 1EEPA 2FJKA 4L64A 3DAQA 1QK0A 4HOWA 5HQLA 2GJNA 3W1MA 3QY6A 4O8AA 2W0UA 4ZTYA 1J79A 5LNVA 1EF3A 3R5EA 4NJIA 1R3WA 4TQTA 1EP2A 3ARYA 3MBDA 4UZSA 3KM8A 2HNHA 2VGBA 3KHJA 2ZUTA 1EIBA 2WCAA 3BPWA 4YU1A 4XBSA 4GUFA 1YPIA 1SSDA 2FTWA 4IHCA 3QPZA 4MB5A 1QW8A 1WV2A 3MUCA 1MDRA 4FNTA 2C14A 1KXVA 1CXEA 1IEWA 3WH9A 4DO7A 1BG4A 4ZVJA 2VEPA 3NUKA 4DNMA 4BKNA 5CCZA 5LXEA 1F4HA 3FJ4A 3H2CA 2ZX5A 2HS8A 2J7FA 2GJRA 4Q8MA 3OVGA 2WBKA 1PX3A 4EP8C 1UMLA 3T44A 1GPFA 3N2XA 4OOUA 4KWOA 1R5YA 2ZUSA 1JGIA 2XG9A 3C56A 4L6OA 2VT0A 4HK6A 4GQGA 1Q2RA 1EZ2A 2P3EA 2GVJA 4IL2A 5MHBA 2ZDRA 3OZOA 2GVYA 4QEHA 4Z1DA 2Z00A 2UY5A 1QASA 1XYAA 3WQPA 1T0OA 2G3MA 1E51A 4Y90A 1F74A 1GYMA 2UY3A 3SRDA 3OW1A 1XH0A 1CTNA 3EOLA 3S5NA 3S5SA 2OZTA 1LM1A 4OIFA 2W79A 5FJTA 2OVLA 2VGIA 2Z2UA 1Q66A 4LGXA 3RJYA 5I3HA 1O95A 3M6YA 1UA7A 5C8BB 1JD7A 4AB4A 1YBQA 3BE7A 2PS2A 3IV8A 4QP0A 2EKGA 3MUZ1 3FEMA 1A50A 2PCEA 4GXPA 5C7VA 3LBOA 3KAOA 1AUSL 2NZLA 1UB3A 1NY1A 1EC8A 2ZBTA 4IPJA 4FALA 3QPYA 1DWHM 4LFYA 2E5DA 4GIYA 3B8UA 3KCOA 1VPXA 3LLFA 3UCCA 3WMLA 3WEZA 4QLLA 3VNMA 3G6MA 3W7PA 1PSCA 3DECA 4BQ5A 3BXWA 3TU9A 1D2KA 3LA4A 1EX5A 1M7PA 3TQKA 3WQDA 2RAGA 4AZIA 4WGXA 2Y8UA 1AODA 4A3RA 5IBXA 1KTNA 2G96A 4C6LA 1J5SA 1VFUA 1EDTA 3BICA 2ZE3A 3HTWA 2TPSA 5ABHA 4AX7A 3REQA 4DJDC 2EHHA 4R3UA 2CERA 4HJFA 2VX4A 3LZ3A 4XD5A 1GTEA 3CQ0A 4UTMA 2QLYA 4FF7A 5EY5A 3NG3A 1I2QA 3W29A 1F3EA 3BSMA 1MRAA 4AHPA 1X39A 2DIKA 4MKSA 5A69A 3NO5A 4ZB5A 4CNTA 4G1NA 6CGTA 1ME8A 3BG5A 3WLRA 3KS5A 5D2VA 4WD0A 1QJWA 2CHOA 4FB7A 1VFOA 1S1RA 4L6HA 4YPJA 2IKJA 2FQIA 1KXQA 5FOOA 1B3WA 3HG3A 3SSZA 1GZGA 4RE2A 4DZHA 5LA1A 4RX0A 4KFOA 1ADDA 2HZGA 3VDGA 2OOFA 5SWUA 3UCQA 3C0LA 3GW3A 4IQEA 5AZ0A 3W71A 2DUXA 4G5DA 3W1RA 5HPOA 3MUY1 2O9OA 4ZQNA 5LYRA 2ZTKA 4URIA 1E0VA 1J6PA 4GIAA 3FGCA 2GSHA 5DMNA 5H6HA 2F61A 4AEEA 4HCLA 4GD0A 4LEQA 4CCDA 3UT0A 4A2RA 1SM9A 4JL1A 4X9YA 2FGZA 4DLMA 4JTAA 1Q85A 2HVMA 5E93A 1ZLPA 5D04C 1REQA 4G1KA 4NAFB 3TWAA 1OGGA 3WD0A 4ZSUA 3FX4A 2C91A 1C3FA 3CWNA 3JRKA 2NX1A 1PS9A 1UWTA 3OBKA 4JKKA 1JNEA 1Z48A 1CGYA 4BS0A 3WH5A 5RUBA 3W82A 1G9HA 4A35A 2BASA 4LBRA 2X2YA 1MW3A 3ZVHB 5M2FX 1AZ2A 2HE5A 1OFQA 1B3YA 2Q8XA 5AVNA 3OA3A 1EJWC 4MWAE 2X1UA 3IPWA 4JYEA 3B8SA 3RLUA 3EDDA 2PZNA 1H61A 3ZXWA 5HWMA 3W2JA 4IQJA 5C0QA 3AMDA 3G6LA 5T26A 1CLVA 2W92A 7REQA 4E4PA 3M43A 2WPGA 4AC7C 3M0MA 2R9RA 3HURA 3AXXA 3CPGA 2GDQA 3PZTA 1F61A 3QV9A 1F8IA 2L5HA 3OQEA 1WXYA 2RFGA 4GUHA 3BVJA 1RVKA 4EOUA 1WZKA 3R94A 6TIMA 4MB1A 3FAWA 3TYEA 1TQXA 5CSUA 3P6LA 3KOWA 3HJEA 1ZL1A 1V0MA 3VNDA 1TJRA 1EA9C 3GXTA 3F4CA 2X40A 5DY3A 4M8UA 4JAWA 2DIJA 5K9DA 3WQ6A 1EPXA 1FWHC 1FBAA 4UQDA 1UD2A 3HV8A 4D6GA 3G1FA 4LAMA 8CGTA 3QW4B 4RPPA 5BMXA 1DWJM 3MMWA 1GKQA 5EFFA 2G3IA 3N14A 1TIMA 4N2YA 2YXXA 1Q6GA 3DYPA 1KM4A 3V3WA 5DRCA 1ZB5A 3PPFA 4GVHA 1RH9A 5PTDA 3P93A 3ZZ1A 1QDSA 2PI6A 3UG5A 1Q13A 3DG7A 1H60A 1B2YA 3C2YA 2GGGA 4HYRA 4O0ZA 2CIPA 2WHJA 4GGBA 1FCUA 3HZ3A 4XAGA 3PPHA 4BF5A 5FEZA 1UQYA 3AHVA 3G77A 4LX4A 2NQ5A 4MNKA 4LPCA 1WDQA 2O4QA 4UMBA 3MO4A 2XSAA 2WVTA 1V02A 4UFHA 3DH7A 4R85A 3SJ3A 1UJQA 1B31A 1Y5VA 5E6YA 1C9DA 4F4RA 4RV3A 3BG3A 3N25A 3APTA 4AY7A 1PIGA 3T40A 4WY0B 4IGHA 4GJIA 3T2QA 1EOKA 4UZUA 5FAJA 4CQBA 4RJEA 4XUGA 2E6FA 3A22A 1OC5A 1O6IA 1KKOA 4DF2A 4BEQA 5HWNA 3WMSA 3PAOA 2D69A 3B0VC 3O07A 1TB3A 4JNZA 3KRSA 1ECQA 4LS2A 2B7QA 2V2HA 1Q45A 4PMXA 3HQNA 4GG9A 3VIPA 4ZOCA 3NWRA 1DXEA 3KZSA 1XICA 4IJBA 1DIKA 2HXTA 3ANUA 2CEQA 2NX9A 3EEGA 2DZBA 4M3PA 2UV8G 3GR8A 2NUWA 5ABFA 4QJ1A 2DT0A 2ABAA 3C2OA 3IVSA 3UXLA 4HMDA 4PEEA 3H24A 3VNKA 2ISSA 2JKPA 3VE7A 2GLKA 1QVBA 3V35A 4XKYA 4I6VA 6A3HA 3VKBA 4CNOA 3ZO9A 1R46A 4JBRA 5AC7A 1W5QA 3VIGA 5U4NA 4HZ7A 1VGAA 2WMKA 3ARPA 3F5LA 3LI1A 1J8VA 1PIFA 1YKWA 3LCFA 5AYBA 1T5AA 4GISA 4U2YA 3AROA 4L1WA 4W88A 4C6FA 2BY2A 3V75A 3IUHA 4AEOA 1CENA 1DTUA 1YXCA 3QVQA 4UR7A 1H7RA 1M04A 3WDQA 2GZXA 1JYVA 1W8GA 3G1AA 3UWUA 4AZCA 1ZP4A 3WUGA 5G2HA 1H0GA 1ITXA 1W91A 3OYZA 1XLBA 1R0MA 3T81A 4N02A 2CHRA 2PGRA 1H7OA 4GH1A 2QUTA 3DN5A 2QUUA 3A6OA 3K8LA 3RM8A 4B15A 3N6QA 4K38A 4J1OA 2DPEA 3IJDA 1TTQA 1F6PA 4FS9A 1FWBC 2B7PA 3W28A 1KCLA 4XG1A 4PUDA 3GKAA 3EA3A 3QQ1A 4FXRA 1VHCA 4HPGA 5A1AA 3KXQA 1K9FA 2J27A 3MKVA 1KXHA 5F1VA 1DJHA 3MUIA 4ZFCA 4DM1A 5EKYA 1EPVA 1ODZA 4NAFA 3TX9A 1MQRA 1OX6A 2G37A 1NOFA 4UQ9A 1UUOA 2VDGA 2FGLA 2Y24A 2OGJA 1KO0A 4QBXA 4C7FA 3BW4A 1TX0A 3H12A 5EA9A 3URQA 2VEIA 1C8VA 1W3NA 3EOEA 1SW3A 1W5OA 3ARVA 4IGNA 4FAMA 3B9EA 2VEGA 3H2EA 2WAGA 3DFQA 1MNZA 4PB5A 3OZPA 4GBUA 4Z42C 4J3XA 5HMDA 4LUTA 3HBLA 2O56A 1W8SA 3C3NA 4ZSTA 4BCEA 1ZJHA 3W37A 3ES7A 3N15A 2V82A 1RA5A 3UETA 1NSJA 4JS3A 3SCTA 2VD8A 3AO0A 1OFRA 1V4YA 4LAUA 5DELA 1I0DA 1JFHA 1OYCA 1W9XA 1XC6A 1FXPA 1P0EA 4C7GA 5IHRA 1LBLA 2PAJA 3QQWA 3O9NA 3SCNA 1SZFA 1GZJA 2OX4A 1X98A 4DX3A 3TAKA 2FB3A 3ECQA 3PZMA 3OGVA 3RLGA 2POZA 3MDUA 2E28A 2W4XA 3I68A 3M07A 4WVXA 3TC7A 1UC5A 1XLGA 3E5BA 3MTWA 1BKHA 4JR5A 4S2CA 1PAMA 1JDEA 1MZRA 3VXGA 3GTXA 3AIUA 1J0HA 4O1CA 1KCZA 3EWDA 2DGAA 1R3TA 3T07A 4HHMA 2YX0A 4PUNA 5CC5A 2ZCGA 3GK0A 2BXVA 3CUXA 2OO6A 2R1KA 3VMNA 4LB3A 3RU8X 2YR1A 2A4AA 1HL2A 3K4AA 3NEHA 3Q58A 2JF6A 2JEQA 4H6QA 1TJ1A 1IWBA 3W1UA 1NP0A 2O92A 3CS2A 3OTRA 3RPMA 1V6YA 3QZAA 1Z42A 4BEUA 4OE7A 1XIBA 5EPDA 2WANA 3QQ0A 4NI3A 3VKDA 3T4WA 1VENA 1FY6A 5BOOA 1JYWA 5J04A 4LNYA 4FLRA 5T91A 5CLTA 3DX5A 3CL7A 1HO1A 1JQVA 3W01A 1L8NA 1ADSA 2RHGA 1Y8BA 5HBFA 2Z2AA 1EUNA 3M5ZA 4H00A 3SN0A 3GU1A 1WQ5A 2XIBA 3GZ3A 3T4CA 4PB4A 3IUIA 4J4KA 4H2HA 3W07A 3UG4A 4PCSA 1QNRA 2ZXBA 3WLTA 4A3YA 4O4VA 2Z7GA 3B0XA 3UXAA 1J0KA 2F84A 3W0KA 1WDDA 3GNRA 3OVRA 3THAA 3NR0A 2D2JA 4MTVA 2X0YA 3NYDA 4H2CA 3G8EA 4OWGA 4EF9A 3WUBA 4UFLA 4L4MA 3T8LA 2E4TA 3TMLA 3WCZA 4Q4OA 1CGXA 4D8LA 1XDMA 4BWLA 1XQLA 3ELFA 4PYSA 1CDGA 3OG2A 3E96A 3HG5A 2PWVA 2Z1WA 3IANA 3RLVA 4KWSA 4PSPA 1HGWA 4DAIA 4J35A 3VPLA 4JIEA 3HPSA 4EPBC 4ROQA 4FMVA 3QY8A 1CT5A 1XIDA 1UBPC 2IUZA 5F2LA 4NJJA 1HIZA 2HS6A 3GNPA 4LANA 1YQ2A 1O60A 1FUYA 2CETA 4RNHA 5BRBA 4IZGA 4KEMA 4B90A 2OEJA 2D24A 3U3HA 3BGAA 1HFBA 1KRAC 4QEEA 4EPKA 1LF1A 4MM1A 3NQBA 3S6DA 1NP2A 2OT0A 1V3HA 4JX4A 4XBJA 3K1GA 3R8HA 1UIPA 3JZUA 4ZZ9A 3LG3A 3BO9A 3DG6A 4K39A 3E02A 3ALGA 1IEXA 4BY3A 5F7UA 3FA4A 5DT7A 1WZAA 1EDGA 3PBWA 3GG7A 5I23A 1XKJA 1O5QA 3VM7A 4IQLA 3TYZA 3S47A 3W02A 4QFUA 3E6EA 4ZL1A 3F4NA 1IZKA 1XUUA 4ZMGA 2D73A 4QNWA 3EOUA 2Y6ZA 1G4TA 2GDUA 4KGLA 4LYQA 4XZMX 1XHGA 3ANVA 5CBJA 4DBEA 1A5AA 4IUOA 4JY9A 2XVGA 1ITQA 2QAFA 1CXFA 4YVVA 3CUHA 2V5CA 2BMBA 3SUVA 5FESA 2Z0IA 2HROA 1DPMA 2Y70A 1ONEA 2GVEA 3WIJA 4JTHA 3EXTA 5H8MA 3UNDA 5FJPA 2YCLB 4LW7A 2FPVA 3BQ5A 4DEFA 4LVGA 1AH3A 3AMCA 1LRTA 1B3XA 2H9AB 4U4MA 1X96A 3T1GA 3WBAA 3CHEA 4KIRA 2G0WA 1BHGA 1KRMA 3BMWA 1JVNA 2R6OA 4ERIA 3ARXA 1TG7A 4ATWA 2A5HA 2GL5A 2PURA 1H50A 4FOJA 3ZT6A 2ZQ0A 3SUTA 1VEOA 4FIRA 2Y1HA 1P6CA 3KOFA 4LF2A 3WF4A 3VIOA 1LL6A 2AL2B 1E9IA 1AW5A 1LG2A 2ONEA 4WHBA 3TTEA 2WM0A 4ORIA 4PTNA 3FLUA 4L9XA 2OB3A 1K6AA 4KQNA 1GW1A 5XIAA 3CL8A 3PP7A 1E0UA 3KBVA 2ZUVA 3NSXA 4XD6A 3EDKA 3IGUA 4QQUA 3UVIA 4AY8A 1S3HA 3LB0A 4GJ1A 4FLOA 4NT0A 1A4LA 3KCLA 2YB1A 3GC2A 4DWSA 1FHUA 3K46A 6REQB 3CHCA 3WKZA 5XIMA 3UQNA 2Z1VA 3SY1A 3LRLA 1EXPA 3KP1A 3HM7A 1JAEA 5F2IA 2YDQA 3CNYA 4UUIA 1HP5A 5CPTA 1JAKA 4UTIA 2VP8A 3IIZA 4EF8A 3BLFA 2C0AA 4Q8NA 1TUFA 1RJRA 2D23A 3TN5A 4YIWA 4XIAA 1JPMA 3AZRA 4OGZA 4PUEA 3L0NA 2Z29A 3WJWA 1A53A 1S2WA 4JCLA 1A3XA 4YS1A 4YCOA 4R9OA 5LHEA 4UMCA 3PF3A 3V5OA 1QI0A 1GONA 2AMXA 4O28A 3BW2A 1N2VA 3GO2A 4A3HA 3AICA 1HP4A 3A3HA 2O9RA 4GQRA 2QCHA 5H2ZA 1UPPA 3N18A 1FFQA 3VCCA 3VZXA 2ZX9A 1FWFC 1LTDA 2OTDA 1OX5A 3WF0A 4ZFMA 1S3TC 3BDKA 1B3VA 1EO7A 2KX9A 3N2TA 4QG9A 5K9XA 2Z2BA 4CD6A 1KFJA 4JTSA 4YTQA 4QITA 3VKJA 1W0MA 1A5SA 4HOXA 5FA5A 1QNOA 3M44A 1US0A 1VEPA 4GUIA 2NV9A 4WF7A 3LM3A 2VFIA 4PUUA 3LSBA 2INFA 4QR6A 4J2PA 5AVHA 2PF8A 3ZYZA 4E4UA 5HANA 1GGOA 4M24A 3TYAA 3QZEA 5FF2A 1H63A 1TVLA 1DOSA 4B5WA 4U2ZA 2OLHA 4PUWA 3PBVA 1OB0A 1G0CA 1EBHA 3M5VA 4IP5A 5JBEA 4UTLA 3TNOA 3RMJA 3GU2A 1PZ0A 3WFLA 2YL5A 3MU7A 2Z1XA 3I10A 3R6IA 3KRUA 3S1UA 3PTMA 3FFSA 4I7WA 3LRKA 4B5SA 1F76A 3WDHA 5EMKA 4V28A 3UVAA 3QKEA 2PC4A 2EF9A 2QCGA 3K4WA 5FJUA 2CU0A 4X60A 2QVHA 3L12A 2RDUA 1XRSA 4GWEA 1OCQA 4E3VA 2BGNE 5CJNA 3DZ1A 3G22A 1EGZA 2DVTA 3SY8A 3GDBA 4FZIA 3MZNA 1J0JA 1GKPA 1N82A 4C6KA 4FX8A 7ODCA 3BJFA 2VZUA 2W5FA 3MQTA 1KWKA 1JJKA 1K03A 2ZRVA 1K8CA 1QO2A 4DWSC 3LLXA 2CWNA 3LLDA 1WBJA 1FDZA 2GGJA 3EWUA 4KFPA 3T9PA 4HU3A 3TOYA 4HA1A 4L80A 3BSGA 5CC7A 1XFCA 2DSVA 2E9BA 2EG8A 1EH9A 4CCZA 3RK8A 4UC5A 4C5YA 1RUSA 4NNCA 3OLIA 1R47A 4MYAA 3ABSA 3CYJA 4IJCA 2E0PA 4K6AA 1A0CA 3BTNA 2DUZA 4B2DD 1EYWA 2D2HA 2NXGA 3FOKA 4DB7A 5G1TA 1CCWB 3U8GA 4AFYA 2DT2A 2WZIA 1RBOB 3PPGA 1O68A 1FQ0A 2UY2A 3AUJA 4JIPA 3TDFA 1A0EA 3QR0A 1IXNA 3ZLFA 4D6FA 4OOZA 1XPYA 1FX6A 3ZJ6A 2PDIA 1DQWA 3LI0A 1XSJA 4Y8FA 2ZZ3A 4DJEA 2V5JA 3UXKA 3LPGA 1R86A 1SMDA 4UB9A 2NX3A 3BCFA 5GPRA 3BV4A 5LSMA 4F2BA 1CECA 4ZOEA 1OK6A 4HNLA 1Q6RA 1A5NC 2GWNA 2GPTA 2R82A 5I03A 2C13A 9XIAA 5IDIA 3FN9A 1CYGA 1LT7A 1TVPA 2DT1A 3CTTA 3SIMA 3L5AA 1U2YA 3IIXA 4XAFA 2AGKA 3W9ZA 4R53A 4QS6A 3CU2A 1VLIA 4G7EA 4RW5A 4TO8A 4UQAA 1TJ0A 1UJPA 1E6NA 5BCAA 4AYSA 3TTYA 5IFPA 4UFMA 2VX5A 4IG2B 1Y65A 4DXXA 4XQ6A 3TQVA 3THQA 2VL4A 3ZR6A 1WOBA 2CBUA 4LY4A 4Q7NA 1RCOB 1J12A 3C0SA 2VYOA 3V7PA 2DY3A 3I7RA 3W7CA 1GVQA 1R8LA 5CBIA 1G5AA 5E09A 1R2TA 2G50A 3B97A 3BG9A 3L2MA 1XV8A 4L6DA 2FZ8A 5IFTA 4B5NA 4MF4A 3WD4A 1D8WA 4R7JA 3TP4A 3VOGA 4J3SA 6REQA 4HTYA 3N9KA 2QGYA 3WY1A 3W3OA 4HT3A 1ODUA 4WUIA 5C7HA 2XVLA 3I6TA 3W2NA 1Q65A 2ZZ2A 4YVXA 1LDCA 3PSWA 1K70A 1J9YA 1VB9A 5ABTA 1PTDA 5CPSA 5LNWA 1MMFA 4HSNA 1S39A 4JTEA 2WC4A 3CHVA 4QISA 2DIEA 2JEPA 1PVNA 4AIBA 1VYRA 4H9YA 5HJXA 4US5A 4AD5A 4MWAC 4UQCA 3T42A 3UU0A 1R38A 4JTIA 3ARWA 1CX9A 2D0GA 5I6SA 2HCVA 1XQKA 3M0YA 1WKYA 5DXXA 4LYRA 1TPEA 1W1VA 1Z9AA 1L6FA 3BAIA 3BCJA 1LWJA 1ISVA 3HU7A 2WBGA 3L5LA 1BWLA 4ASTA 2ZKMX 4GYJA 1CWYA 4DUVA 6PTDA 1N8WA 3U9IA 1S5WA 5D2WA 3A4XA 4AW7A 4AVFA 2Z24A 3GQYA 2BBFA 2VENA 3GVQA 3NEVA 3PVFA 3N12A 3DESA 4ZOAA 2KAUC 1H5VA 4W86A 4C6BA 5EGRA 1EJTC 1UC4A 2ZADA 4ONVA 3WQ8A 3NPXA 4QJ3B 1DJZA 3GHTA 2QZRA 2F9RA 4NU7A 3S5OA 1K9DA 3K2GA 3W53A 3CAVA 2HK0A 3UCDA 3SCUA 3KL0A 2CKSA 1EHAA 4QG6A 2AGTA 4GINA 4O11A 3GNOA 2WSQA 3AS1A 2WZHA 2HMCA 3UG3A 4IOTA 2NVCA 3K8MA 3ZLGA 2PDNA 3EX3A 4IMFA 3EOSA 1Q6FA 1TV3A 4GVGA 2NSOA 3DYOA 3WDPP 2WM1A 2ZUNA 3STCA 3L2LA 5A2CA 4CD4A 3DKLA 5FJIA 2NLYA 3GC5A 5EMLA 1TJPA 1KM1A 4GX9A 2YA2A 4JN6A 2ISDA 4BQ4A 3NQVA 3FJ6A 4KESA 1CZ1A 4PMYA 4O54A 3C5QA 5CAKA 1PTAA 3NQCA 4Q4QA 5CBBA 2YZ5A 2QF7A 1JQXA 2WVVB 5HXMA 3LHUA 2VFDA 1VFMA 4CNSA 3B8WA 2J79A 2WCGA 2WOQA 4MNMA 3RFAA 4WKAA 4NNBA 1QTWA 1CB2A 2H3BA 3C61A 1OFBA 3EMZA 1NOWA 1KM0A 2ZRUA 1M5WA 1V7YA 2A7PA 4JTUA 2QCDA 1WNOA 3ZOAA 3ZWSA 4DVOA 1M3UA 3IJLA 4HB7A 3RMEA 2P50A 5I3JA 2VI0A 2V67A 1H49A 2WLYA 3GFXA 4Z2IA 6XIMA 3A5FA 4YTUA 3APYA 3S2MA 2FH8A 1LWHA 3NGFA 4Y6GA 1XLHA 3BGJA 3OJGA 3OLGA 2GYIA 4CKQA 2BOGX 4R7WA 4W8LA 5TF0A 1HZYA 2OZ0A 1GNXA 1JEZA 2EJAA 4JKMA 3I6EA 3TR2A 2QPXA 1RA0A 3D3AA 5CC3A 1GYNA 4GLEA 4W7VA 4WDWA 2CZ5A 1TREA 3OZMA 4DLFA 3KS6A 1XLFA 2H6RA 3RO8A 1CI1A 4A2SA 4HN4A 2PRMA 4JFSA 1GTHA 4P7QA 3E9AA 3UWEA 1EIXA 1DKWA 3P7YA 1QXLA 2DZXA 1ZENA 4WKFA 4KEZA 3FIGA 4ZO8A 4O52A 3TEVA 4FNPA 3TW9A 2EPMX 2WKJA 3FAXA 4JHMA 3ZMRA 3VGBA 1W3HA 1DVJA 4IFRA 1O5RA 4UTFA 1F3WA 1W9BM 4R33A 3P0XA 4MNLA 1UP0A 2XZ9A 4C6QA 3RCNA 4DO5A 4R7OA 3ENLA 5CPNA 3VOIA 2BOEX 1CGWA 4HD5A 3B0UX 3LN3A 2OSYA 3LPFA 1KGUA 4TX9A 3Q45A 1KM5A 5LNRA 4AWTA 3EDJA 4F9DA 4DELA 4HPJA 1QI4A 3M47A 2Z26A 2BDQA 4Y2WA 2QEZA 2WJZA 4G8TA 1G69A 1C8YA 4HYVA 4PB3A 3V0UA 4D6HA 3B03A 3UA4A 4BI5A 3OP2A 1JZ3A 1U5HA 1UUQA 2G3NA 3G5EA 3WLOA 3RYSA 1HT6A 3IK4A 1PWLA 2DP3A 3QFWA 1JCYA 4LH8A 2DORA 3ABQA 4H8UA 4OV9A 1ZJAA 3M5YA 3FHQA 2WZMA 2A3LA 1RQEA 3TYBA 5E5CA 1WE5A 1MW0A 1VCVA 1KBJA 4NRRA 4HQVA 4XO7A 3WQFA 4NX5A 1G4SA 3KDOA 4C1KA 3KVLA 2CXGA 3DC0A 1ZBKA 3HPFA 3HQ1A 3B8IA 3KFTA 2INZA 1KFWA 5JU6A 3VDCA 2YA0A 3WJYA 1ZZMA 4PTDA 3NZ1A 3GVVA 2R1LA 1Z7AA 3MC5A 5DCBA 1UWUA 1VCGA 4WRHA 2GJPA 3SRKA 3DCPA 4ZQCA 3R12A 4EWND 1XGDA 1XLDA 4DXKA 5CPMA 4O0QA 2P0OA 2OJPA 1VP5A 3WJSA 2CBIA 4JTCA 3MVIA 5BROA 1H62A 4EVZA 5I5RA 1PKMA 3OHMB 3C52A 1NEYA 1W1B1 5DEZA 3CTLA 4IH3A 3GXDA 1Q2SA 4O4WA 1ISWA 4E38A 1UIOA 1T99A 5C9XA 4BF7A 3WQCA 4LT9A 3TSDA 1SSGA 2DQXA 2WHKA 2ZXQA 1RHCA 3CQHA 1XPGA 1FWCC 2E1DA 3BJTA 1XS2A 4YHGA 3QV6A 2P0IA 3OB8A 3R43A 3SFWA 3ZSTA 3CZJA 4UTJA 5ECVA 1H41A 4LVDA 2FKPA 4UOJA 3UR7A 1HUVA 5LKYA 3CUJA 4TVUA 4AZ5A 1R87A 4HCHA 4CVWA 1ZP3A 1UG6A 3F4VA 3QLDA 3BGGA 1OQFA 3AIWA 3W7LA 1TR1A 1GVYA 1KB3A 3DI1A 1HJUA 4GZ7A 5EB8A 3RGTA 3SURA 2BSLA 4JTGA 4OKDA 1KTBA 4FXFA 5KMYA 2EEXA 3KE0A 3L4TA 2BTMA 5L9FA 4HK5A 1B9BA 3UBPC 1Q6LA 3E0IA 2OYMA 3DEQA 3VMPA 2ZICA 4UQBA 3U2EA 2A85A 3LCHA 2QJIA 4OUEA 1RJPA 3GIYA 4RDYA 1YDYA 3ES8A 2ZUMA 3VOHA 5J5RA 3MP3A 2F7FA 5TQLA 2QCFA 4OT7A 3GTFA 1CXHA 3JU2A 1Z44A 4K1GA 2C71A 2PDPA 1I2OA 3RM4A 3MKKA 3CWHA 1XC4A 1XRTA 3CUGA 2ACRA 1U1HA 3TLQA 2FZNA 3A9BA 5HMEA 3CPUA 4UNKA 1PO9A 2F2KA 2QULA 1LYXA 4MWAB 3BK0A 3KBSA 2VRKA 1YE4A 4P2VA 4L7ZA 4DZ5A 3T0TA 4IFKA 1FKXA 1MWOA 2V5KA 4U3AA 1BVNP 2V3EA 4UTWA 3N4AA 1QUMA 2PGWA 3GU9A 4KRZA 3A21A 1LLZA 5EBAA 5KZMA 1FHLA 4AQLA 4CNUA 3L21A 5HATA 2J7DA 1DE6A 3GDLA 4H9UA 3WELA 2PDCA 3ONCA 2C6QA 4ZB2A 1GQNA 4FIQA 1EGVA 2QKFA 3ZM8A 2X0SA 4AUBA 5IM51 1E6ZA 1JR1A 1E5JA 3B06A 5D05A 1YRRA 5HR6A 3EXSA 1BF6A 1T8QA 4IMCA 3UZXA 1KBBA 1C8QA 3RX3A 1QPOA 1K4HA 1KTCA 4Z2HA 4OBSA 1OZQA 2I17A 2Q71A 3TFXA 4DZIA 3VGFA 4YLWA 3DDMA 1T7LA 1QPNA 2Y8KA 4FNRA 2VD9A 2YDRA 3L4VA 2PTWA 4B3ZA 3V5CA 4IPPA 1ZJBA 4PL1A 2PBGA 4XAYA 1HL9A 3NOEA 1OF6A 3WN6A 4HGXA 4H7CA 3MI2A 4IPLA 2P1FA 4HNCA 3Q65A 3FVDA 4M80A 3CMFA 1UP3A 2ISVA 4JTQA 4WEVX 2XIQA 4LUYA 1TMLA 4GZJA 4AD1A 4FX6M 1DYSA 4J3VA 4HNUA 4C7DA 5HA7A 4J27A 4P7RA 5DBTA 4TXEA 2Y0FA 3B9OA 1P0BA 4FSAA 2Y7GA 2ESCA 4OFCA 2A6LA 2JFEX 4GI4A 1ONXA 3PTQA 1HVQA 1GK8A 1UWAA 4S3JA 1PL9A 1W1A1 1CGVA 5D30A 4M1BA 1SR9A 4B91A 5HULA 5DLCA 4Y8EA 2QJHA 3M0XA 4DNHA 2WVUA 5C2GA 3CZGA 3EDFA 1ZUAX 3EB2A 3EOOA 5BZAA 2BHZA 1E9ZB 1N8FA 3UPWA 3RU6A 4DQWA 1QI3A 3AXIA 2JK2A 1MYRA 4H9VA 5TBOA 3W1QA 3LERA 4IT1A 8XIMA 3IJ9A 3ZIZA 3FKRA 3RR4A 4BF9A 3FYPA 4HCDA 4UNIA 4JEQA 3UWVA 5LIKX 1WPCA 4ZODA 5C2CA 3QN3A 4N9EA 3HB9A 3OIHA 2NQ9A 1A5LC 1WZLA 1DQUA 4E4FA 2YLAA 3ZSSA 1FHDA 3F1QA 1Q6OA 4ICNA 3PG8A 1FWJC 3N2OA 4JFTA 1JCXA 5I0DA 1QT1A 3SBFA 3PULA 1TE1A 4PBEA 5A3HA 3LMZA 1LRQA 3H4WA 1OG0A 4FK9A 3FHAA 2HISA 2X1IA