3TE9A

1.8 angstrom resolution crystal structure of k135m mutant of transaldolase b (tala) from francisella tularensis in complex with fructose 6-phosphate
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
320
structure length
310
Chain Sequence
b'QKSVLEQLKQVTMVVADTGDFELIKKYKPVDATTNPSLILKAVKEQKYSNLVAETISKVKANNPDLNSDDLVKEIAIEILVSFGIKILDVIEGKVSSEVDARVSFNSATTIDYAKRIIARYESNGIPKDRVLIMIAATWEGIKAAKLLQKEGINCNLTLIFDKAQAKACAEAGVYLVSPFVGRITDWQMQQNNLKTFPAIADDDGVNSVKAIYKLYKSHGFKTIVMGASFRNVEQVIALAGCDALTISPVLLEELKNRDEHLEVKLTQISEADFRWLMNENAMATHKLAEGIRLFTKDTIELENIIKQNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transaldolase
molecule tags Transferase
source organism Francisella tularensis subsp. tularensis
publication title Adherence to Burgi-Dunitz stereochemical principles requires significant structural rearrangements in Schiff-base formation: insights from transaldolase complexes.
pubmed doi rcsb
total genus 138
structure length 310
sequence length 320
chains with identical sequence B
ec nomenclature ec 2.2.1.2: Transaldolase.
pdb deposition date 2011-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00923 TAL_FSA Transaldolase/Fructose-6-phosphate aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3te9A00
2P0OA 5HR6A 3M47A 1EP2A 4IOTA 3W1PA 1KFKA 2WNQA 1MSSA 3CIWA 2P10A 1KM0A 3THAA 3SFKA 1FQ0A 3GK0A 4HPJA 1AK5A 1U5JA 3B0VC 2PCQA 3Q94A 4N9EA 5AHMA 2R91A 1Q6LA 2Y89A 3IVSA 4TX9A 4DO4A 2PC4A 4ML9A 2ZRXA 3UWUA 3EKZA 1F6KA 3JS3A 5D2YA 5BMWA 1N7KA 4MLJA 4JTKA 3TK7A 3BPWA 4ADTA 1A50A 1L6SA 1K02A 1IXNA 5CZSA 3TCEA 4ORIA 1MXSA 2H90A 4HHPA 2Y7GA 1K8YA 2XN1A 5I3KA 4Q33A 2TPSA 3GNDA 2VFFA 3RLUA 5TIMA 5C2XA 1RVGA 3HPXA 1AW1A 4FNTA 3ATZA 1TQJA 2ZTKA 5D38A 5HUPA 4LW7A 5AN7A 1YADA 3NQ7A 3DHDA 3LHYA 4R7JA 1M6JA 3GXPA 3WJXA 2EF9A 3F03K 4O54A 1XCFA 5HJLA 4S1FA 2BX7A 2G95A 3LRKA 3HG5A 3W7DA 1FXPA 3FLUA 4XUGA 1TMHA 1LZOA 3QH2A 4OV9A 2ZTJA 4PEKA 2H3BA 3ZFHA 2X16A 4PCFA 2A4AA 2AAMA 1F7BA 1JULA 1BKSA 5BMXA 4I7WA 5FF3A 3M5XA 3EX4A 4MYXA 1T0OA 3NPVA 3LRLA 3S1WA 5EBUA 3C2FA 3NL6A 1HUVA 2Z2UA 4O0ZA 3QJAA 3EX2A 3ELFA 2VFEA 5KMYA 1DJNA 3M5ZA 1ICQA 4PL1A 1OG0A 1GOXA 4M7SA 3GDMA 3USBA 3G8RA 1XDLA 1PL9A 3B0PA 3HBLA 4TIMA 4NT0A 3NQVA 2WNZA 1DHPA 3IGUA 1XBZA 3RFAA 4E2BA 4Q4KA 1UUOA 3P84A 1OFOA 3KXQA 4IMDA 3VI2A 3S8HA 3GDLA 3S1UA 4WQ6A 4QSHA 5AYZA 1G69A 1WA3A 1TRDA 3PF3A 1BWKA 1KV5A 1OFAA 1VCFA 4DO6A 3FYPA 3BVJA 1K7XA 1KFBA 3EX1A 1OF6A 4IWWA 5KINA 3KFTA 4WZHA 3MJYA 4K38A 5FEPA 2E6DA 5HWJA 1JCLA 3WK3A 2R14A 2H8XA 2Q3RA 2B4GA 3DFQA 2DZTA 1WV2A 3W7OA 4GE8A 3MBFA 3HOJA 1Q6RA 2A7PA 3W2JA 5J5DA 3F4NA 4JIPA 2BLEA 4UTUA 1OX5A 3EWZA 1H63A 4XKYB 3LCIA 3L21A 5HULA 3LX9A 1G7UA 4UTTC 5AB3A 4HNVA 5HUOA 4AF0B 5KZEA 3VE7A 3TIMA 3W23A 5F1VA 2CZEA 3NZ1A 4LS2A 4LVDA 2NUWA 1TV7A 3TNOA 1OJXA 4M5PA 2ZZ4A 4FNPA 4O1CA 3RK8A 2XFWA 4UCGA 4IPIA 3G1DA 1Q6OA 2E5DA 1T99A 4DXVA 4ZVJA 4EF9A 2E77A 4CCEA 3GXNA 4MY1A 5H2ZA 1ME9A 3C8FA 3TA6A 1VYSX 3P74A 2ZCGA 3GR7A 1XBXA 5BRBA 4EIVA 1TTJA 4K36A 5DN1A 3C6CA 4M6VA 3R2GA 2FB3A 2VEIA 1YDNA 4XBKA 4J9JA 3GDRA 1LBMA 1PHWA 4PL2A 4UTIA 2DJXA 1K7FA 3SECA 5DELA 4DPPA 2CU0A 1SSGA 3C3NA 3OA3A 1N55A 3GZ3A 4LC8A 2VELA 3G8EA 1Z41A 1UJPA 3MO7A 1SPQA 4CCCA 4O1AA 4FXRA 3NZRA 3I65A 3AJXA 4NNCA 2WQPA 1LYXA 2BSLA 3LHTA 4Y9AA 1H7NA 3NOEA 4LVGA 4FHAA 3M7WA 1OFBA 5AOUA 5CSRA 3LCWA 1X8FA 3LV6A 5AHFA 1QFEA 4UFHA 1G67A 2FJKA 4GBUA 5AYYA 3LXBA 2V2CA 3EX3A 2GQ8A 1L2UA 3R8RA 3TC6A 1HG3A 5CSSA 1ADOA 3NAVA 4IGHA 2WOQA 1SZGA 2QCFA 2YW3A 1FDYA 1I2RA 2QEZA 2QUTA 5FESA 2VKZG 2ZZ3A 5FEZA 3TW7A 4CNOA 4NZJA 4K7YA 4M6QA 3TAKA 1O95A 2C13A 3TAOA 4GUHA 3EWXA 5FI8A 4QNWA 3LTSA 3MHUA 4YCOA 3C52A 4WY0F 4DPQA 4S2BA 1OVDA 3CB8A 3NDOA 3W9ZA 3FS2A 2OCZA 3S0CA 1XFBA 1G7VA 3M5VA 2DZUA 5CPLA 3EKLA 2FPTA 2GVLA 1KA9F 2A0NA 4R33A 3SR7A 4MIMA 4O17A 3TXVA 1ZAHA 5HWNA 3BK0A 4RX0A 3TU9A 1O94A 2QCCA 4JY8A 2E6YA 4A21A 1HFBA 3O8AA 4XBSA 2W6RA 3UD6A 3S9YA 3LI1A 3IIOA 1ZCOA 3G0XA 4WOQA 4LY8A 3NM3A 2V5BA 3Q37A 3LM7A 4FEZA 3CEUA 4ZZ9A 2O7QA 3R89A 4PFMA 3HGJA 1KFEA 2FFCA 3HQ1A 5CG7A 5U4NA 1SZNA 1H7RA 5D37A 2YYTA 2B7NA 3UYCA 3F4WA 1VCGA 3LCHA 3ZWTA 4RZ5A 4NX0A 4EF8A 1P0KA 2X1SA 3RNDA 1H61A 1WBHA 3C56A 1WOBA 2CLIA 3AO0A 3PS7A 2DJLA 2VOMA 4TO8A 4GUIA 3N2XA 3O07A 3UWYA 3NA8A 3NNTA 1QDSA 3HJZA 3BGJA 1IXQA 1KTNA 1JR1A 2C19A 5D2WA 2A7RA 4NU7A 4ZQNA 1JVNA 1V7YA 3SGZA 1WBJA 3W86A 1E51A 3E49A 3LI0A 2GJLA 2J24A 4X22A 4TU1A 3KVJA 4A3UA 3W7PA 1GQNA 4UC5A 1XBVA 1GZGA 3EB2A 5LHEA 2ZRVA 3JRKA 4POCA 1ZJIA 3NM1A 2YX0A 2CLKA 3TMLA 3TMQA 1RQHA 2YPIA 2W0UA 3VNDA 1FUYA 2DZWA 4YMZA 3N19B 5HQEA 3QMTA 3QSRA 5K9XA 4MOZA 1KLZA 1W5NA 3O63A 4XWUA 1VZWA 3FA5A 1RQBA 4JR5A 5G2IA 3W7RA 3GVGA 1QO5A 2ZQ0A 3CTLA 4AXKA 3LGEA 4FO4A 4CQ9A 4LV4A 4BI7A 5I3IA 1GEQA 4KWWA 1TB3A 3W7QA 1RZMA 3T7VA 3TV8A 5CKSA 4NXSA 4I9AA 4DF1A 3QW4B 3B4UA 3O6CA 3S42A 2Q8LA 4ADUA 3G1XA 3VFLA 3A5VA 2CZ5A 3S1XA 4AF0A 4N2YA 3FOKA 4O57A 1SW0A 1UASA 3C2VA 2OJPA 3M44A 2ABBA 3EXSA 1TTQA 4Q32A 3FEMA 2CW6A 2VFHA 3W88A 1LLZA 4O4WA 3WFAA 2FPYA 3HB9A 3L65A 3G24A 1K03A 3QPYA 3GLCA 1XBYA 1XDMA 1LRTA 2Y7DA 2HSAA 3P82A 2CLHA 1KBJA 4JTEA 4AB4A 1TPFA 1HO1A 1H1ZA 2RKXA 3CHVA 4O50A 4WD0A 3V1PA 1IXPA 3NPWA 2VFDA 4QISA 4OU1A 1LOQA 4UTWA 1JCJA 3N34A 3TJLA 2CLFA 3IIPA 5CGQA 5D33A 3L0KA 4ZQRA 1F74A 3W74A 4JD4A 4FXSA 1AL8A 3BGGA 3G0UA 3HG2A 1SR9A 4NQ1A 1I8JA 1UCWA 3TE9A 4NNAA 1TTIA 2YR1A 3G1YA 2FPVA 2PRMA 3W2LA 4XQ6A 1A5SA 4YXGA 1TPC1 2CLLA 1FWSA 1DJQA 5FF0A 2PRHA 3W1RA 1O5XA 3NO5A 1QPQA 4ZL1A 1NAL1 1GVFA 1ZHAA 1PHQA 2IQTA 1JQXA 1TO3A 3FYOA 2ZBTA 3TSMA 3O1NA 1W3IA 1H60A 3GXTA 2H6RA 4JTHA 4PODA 1UBSA 2I14A 1OHLA 1K3UA 1Q6QA 4NJKA 1VYRA 4Y8FA 3BLIA 1QO2A 3C2OA 3NQGA 1M7OA 2ZRYA 1F6PA 5EY5A 3W1AA 2H3DA 3JR2A 5HWMA 5AYXA 4Y90A 3UPBA 1W5QA 5E0KA 4FNRA 4HPXA 1A5AA 2ZZ2A 4UFJA 4UIOA 4OQVA 4AVFA 2QKFA 3QQ0A 3TX9A 3C0JA 3PBUA 1PE1A 4H3DA 3W70A 4HNNA 3UPWA 5CPMA 1KM1A 3QRHA 3OVQA 5D2TA 5T26A 2C15A 3B05A 2ZZ7A 5FF4A 3W7EA 5D09A 2FDSA 3P67A 4FIQA 3NEVA 2Y7EA 4FF7A 3TJXA 4NJHA 5CZ0A 2QR6A 1R46A 4IQLA 3DI1A 3FKRA 4L4MA 1YLVA 5G1TA 3V75A 2KZHA 5IBXC 3N73A 2QJIA 3QW3A 3L9CA 2VFIA 5ABTA 3B03A 1YTKA 1F76A 2EAWA 4M7TA 1OYBA 1R30A 1XM3A 4O1BA 4ORMA 2E68A 1F2JA 3SZ8A 1J2WA 4CCDA 4DF2A 3HIJA 1ZY9A 1P4CA 1P5BA 3U2OA 1FCUA 1GVOA 1C9DA 2A7NA 4RXGA 1FWRA 3M41A 1SW3A 5AFDA 1AG1O 4HNUA 5K4XA 2GVGA 1RPXA 2A21A 3RLVA 1H51A 5KITA 1SQ7A 1D3HA 4C1KA 4RV8A 3BV4A 1M7PA 4WJEA 5BNKA 5A5WA 2ZFAA 3R13A 5E1QA 3MMTA 2W79A 2NV2A 4JXCA 1KM2A 1GVQA 3L5LA 4LC6A 3PSVA 1RD5A 3C2RA 4YWIA 2QCHA 5GVJA 3P80A 5H91A 3STEA 1D9EA 5I3JA 3S5YA 2QCDB 5LNSA 3A22A 3P8IA 4KWVA 4N4QA 1P0NA 5CZTA 1IIGA 2Y85A 4X2RA 4UUIA 2ZZ6A 2A6LA 1OYCA 1YXCA 2BTMA 2YCEA 2JGYA 4M6PA 3PM6A 3EWUA 3SY5A 1LRQA 3UNDA 3G1AA 3LHZA 3GDKA 3GX9A 2ISWA 2QCNA 2D73A 3DU0A 2NWSA 5DCBA 1X7FA 4JTSA 1WX0A 1TPH1 5AC8A 3KOFA 2V81A 2WV8A 3I6RA 2E6AA 2ZRUA 3QZEA 4UR8A 5FEWA 4IUOA 1TSIA 4LS1A 4YCPA 4N6FA 1MEWA 4ZQOA 2NV1A 3LTPA 5F2IA 2E1DA 2Q8ZA 1NSJA 1G4EA 3LCXA 5F4XA 4AEOA 2R8WA 2Y63A 3A21A 3UWZA 4LVAA 2WSQA 1C8VA 1NF0A 1KM4A 3RMJA 3S5ZA 1TPB1 1YXYA 4R34A 4RLIA 2RH9A 4UTTA 4UNLA 4PH6A 5KTLA 3TFCA 4H6KA 3DAQA 1NEYA 1CW2A 3PWAA 1Q3NA 3HG3A 5FEXA 4AH7A 1EEPA 2GPTA 1QMLA 4ALDA 2X1TA 4PTNA 3G0SA 3HPZA 2PURA 3N9RA 4RXFA 4N9CA 4QAIA 2VEKA 1TJPA 1VS1A 4HSNA 4MPQA 4JGDA 2NUYA 3OVPA 4O4VA 4MY9A 5HINA 4Z08A 4JTIA 3BG5A 1TPEA 4UTHA 4IX2A 2J9YA 4OV4A 3W7NA 1VGAA 1R47A 4MLRA 4IXHA 2JKEA 3NL2A 1NFBA 1TTPA 1Z42A 4MFDA 4ZQCA 1FWNA 3W7LA 1PV8A 3ABOA 5AC6A 1ZENA 2DZSA 1HO4A 4JYFA 1UUMA 3N9SA 3O06A 3TSDA 1BWLA 3G22A 4JEQA 3UZJA 3G1HA 1L6YA 2EKCA 1EP3A 1YDVA 2QUVA 2Z1BA 1V5XA 2B7QA 1JUKA 3TDFA 3L67A 4JTTA 3PULA 3W1QA 3CC1A 2WPBA 3T4CA 1SSDA 2FTPA 1F73A 5MHBA 2C1HA 3W7KA 5AHNA 1AMKA 1H7XA 4KFPA 3VKJA 1ZAJA 3NQ2A 4A22A 1LOSA 3PG9A 2B7OA 2NX9A 1I2PA 3WK2A 3W83A 2A6NA 4JYEA 4ZMGA 3MHGA 3PUDA 3LERA 3W84A 4UR7A 1LM1A 1TPWA 1C29A 2GVJA 4X3ZA 3TSBA 1QCWA 4XZ9A 4O19A 4O28A 4AAJA 2V2HA 1T8XA 3E9AA 4NJJA 4IMEA 3SJ3A 3IEBA 3OEXA 4WY0A 2QDGA 4BWLA 4U4MA 2E6FA 2GOUA 5EMUA 3GDTA 1MEHA 5F4WA 2RDWA 4BI6A 3G3DA 3DFSA 1W3NA 4MFEA 3IGXA 3I68A 1YDOA 1S5WA 4KFNA 1JCYA 1R2SA 2QCEA 2QJHA 3GAKA 1WXJA 2G96A 3LHVA 1OK6A 4JIQA 3W2UA 5IM51 3WJZA 2DZPA 5G2WA 4ADSA 3LHUA 1XUZA 4DBEA 1OFDA 1GPWA 3E02A 1FX6A 1I2OA 4TR9A 4UNKA 4UTMA 3CIXA 3DKJA 1X1OA 1TPDA 1FBAA 3PVFA 3W1XA 3BLFA 4JDBA 1K7EA 3W1LA 1W1ZA 5HNRA 1VH7A 4UMCA 3EXRA 1FWTA 4LV9A 1TJRA 2X2GA 3A5FA 1L9WA 2E09A 3M0ZA 4LOCA 2TSYA 4IMCA 4AHPA 3PSWA 3IIVA 1PCWA 1W5PA 1BTMA 3EXTA 1SO6A 5EYWA 2Y7FA 5K4ZA 5DBTA 4BF9A 4IMFA 2ZYFA 1LP6A 3LCLA 3YPIA 1DOSA 4MZYA 2RFGA 3G1FA 3O6DA 3MP4A 2Z6IA 3LLDA 4O1DA 5KSWA 1EUAA 1JQVA 1MZHA 3W7JA 1B4KA 3TXZA 4N9DA 3W3OA 3TQVA 5LNRA 1GYNA 1TRIA 4B5NA 1G6CA 2JKPA 2J6XA 1P1XA 2Y61A 4K6AA 3W72A 3GKFA 1PVNA 1GYLA 3NQAA 1J5TA 3ATYA 3GKAA 3OVRA 3M16A 4G1KA 1KFLA 1LROA 3L68A 3UZ5A 4MY8A 1O60A 1VJIA 2I1OA 2G5WA 2V9DA 3M1ZA 3DBPA 6TIMA 4RKAA 3CPRA 4DQWA 1JUBA 2LLEA 4LRTA 5F2GA 1SFJA 2X30A 1VR6A 1XXXA 6ALDA 4HT3A 1O4UA 2BZNA 3PG8A 1H7WA 2I9EA 1D3GA 5D30A 3UWQA 4LTSA 1OX4A 2V5LA 1AL7A 3MUXA 4QJ1A 3DH7A 4LRSA 2NX1A 1XUUA 3IRDA 4O13A 5DCDA 3ZS4A 1TV8A 3IIZA 1LTDA 4E38A 2ZA3A 1EWEA 5I3FA 4FX6M 4JN6A 4A2SA 4JY9A 2WSYA 3PBWA 3LCGA 2NXHA 4QM1A 1TPVA 1OFEA 4ZQPA 1SZEA 1H7OA 4C1LA 1G4SA 4GUFA 4FNSA 4IX0A 3W22A 3MWAA 1SO4A 2PE4A 1DQXA 2DZVA 3P60A 2CLEA 3NQMA 3BO9A 3QM3A 4BFAA 4NX5A 1W54A 5HR7A 2GQ9A 4MYAA 3LRMA 1GT8A 3K30A 1JCNA 1EA0A 3HGRA 3SIZA 4HNTA 5LKYA 2EHHA 3OG3A 3MP3A 4EWND 1VYPX 4NNBA 2A85A 3STCA 5DXYA 1OX4B 3L0NA 4AHQA 3DZ1A 1I45A 4MJMA 4OWGA 3BG3A 2HTMA 4MVAA 4A29A 1FDZA 3TFXA 5DY3A 1ICSA 2F84A 2VENA 3LXCA 1LDCA 3WK1A 3W7HA 3W7MA 2NZLA 1JRBA 3VCRA 4D2JA 4UFIA 2Z0IA 4I7VA 5CPNA 5K9DA 3ABQA 1KBIA 2YXGA 4UTWC 3P5YA 2ATMA 3OHIA 1KLYA 3IVTA 2J88A 3PY2A 3O05A 4JX6A 2CWNA 1EP1A 2H8ZA 1B4EA 2EGZA 2J9ZA 2ZZ5A 4IPJA 3PUOA 1J4EA 1I2QA 3W7GA 4K39A 4O14A 2FIQA 3GNNA 5K9CA 3CLMA 3GAYA 1FXQA 3M5YA 3H54A 2RHGA 2NXIA 4LVBA 4LVFA 3PUEA 4GWEA 1ME7A 3W85A 4XKYA 3DI0A 5L9FA 2VEMA 4HN4A 1KW1A 1YPIA 1XL9A 4GJ1A 3LV5A 1WDWA 3UY8A 3W71A 2ZRZA 1SUXA 3LB0A 3NPUA 4UTJA 4R53A 3WJSA 3E96A 2JBMA 4I7UA 3MYOA 2TMDA 3UWWA 1XKYA 1PCKA 3HF3A 3HGOA 2C14A 4O11A 4FNUA 3W7CA 3I7SA 3O6YX 3F1QA 2A1YA 4XTDA 2NX3A 3LLFA 1EX5A 4Y6GA 1LRNA 3QPZA 1QOPA 4FX7A 2GUUA 1SZFA 3Q58A 2Q3OA 1ZALA 3QMSA 3M9YA 1JJKA 1H50A 1KTBA 1YXDA 3DGRA 3KAOA 4UXDA 5J5RA 3B04A 1F5ZA 4WXZA 4P2VA 4JTGA 1F05A 1DVJA 1NF7A 4GRSA 1RV8A 2A2IA 2R94A 4JX5A 1H1YA 1DL3A 5HMSA 1IGSA 4BR1A 5TBOA 4AMAA 4GUGA 4NJIA 1I2NA 3L5AA 1G4PA 3NQEA 1TREA 3NQDA 4JS3A 3B06A 3VE9A 5IBXA 1PS9A 3TR2A 5DY2A 2FLIA 3HG4A 4YLWA 3PBVA 5D02A 1TV5A 1W5OA 4OT7A 4UMBA 2HS6A 1N8FA 3A23A 4N6EA 4A2RA 1QR7A 1S5VA 5KZDA 1EUNA 4GNJA 5BW6A 1SO3A 3FIGA 4MZ8A 4RK8A 3T55A 4QQ3A 1S3HA 2OT0A 1OK4A 3LTYA 3G18A 4EVZA 5D32A 3PAJA 4N4PA 1SW7A 3HO8A 4AWTA 3NYZA 4E0CA 4H4IA 3ZR4A 5K7JA 4NXKA 3KRUA 3PB0A 1PIIA 3P7YA 2YYUA 2QCGA 3INPA 5D2XA 3BW2A 5CZJA 3HMJG 1W31A 3BLEA 3CT7A 4NJGA 1ZFJA 1LORA 2GJNA 1OABA 1OFPA 5CPOA 3OIXA 4GFSA 1DORA 1SU5A 4U28A 3NVTA 1OYAA 3STGA 1H7PA 3NQCA 3M43A 4Z1AA 3RU6A 4JICA 4K8HA 5BOOA 3UY7A 1LCOA 3TQ0A 3D0CA 3QF0A 3C61A 5AHIA 4RR4A 1MO0A 4QITA 1JCXA 2QCDA 2QAPA 4JTFA 4BWLC 1ONRA 1WYIA 1X1ZA 2ZDRA 3C4UA 3L66A 4LWWA 4IJBA 4K8EA 1U83A 3H53A 3CWOX 3GR8A 4DO5A 1DQWA 1YPFA 1SFLA 4HSOA 2AQWA 3W1UA 1DKWA 5E93A 4K7VA 5EKYA 2VEPA 4AWSA 2JK2A 4ZQMA 4X9SA 3FJ6A 3N3MA 2C6QA 1WOAA 1KM6A 1YTDA 4TMBA 1A53A 1GJPA 4EOUA 3MHFA 4BI5A 4O10A 1FCVA 1R2TA 3E0IA 3MBDA 1B3OA 3RF9A 5SWUA 5L6UA 3W2KA 4Y96A 1GVRA 2A5HA 1QNVA 2QF7A 1GVSA 2OMAA 2RDUA 4AHOA 5D2VA 2ISVA 4HIBA 5FF2A 4KKXA 4ONVA 4L4LA 3EEGA 1TYGA 4O15A 1GG1A 4NVTA 4O52A 5G1YA 2E5BA 3GIYA 3IVUA 5AC7A 4WX2A 3PB2A 4GUJA 1Z48A 5K2ZA 4O53A 3UQNA 2G97A 4OE7A 5FF7A 5KZMA 5LSMA 3DKLA 2VXNA 1CI1A 1Y0EA 4PC8A 2VC6A 3W1TA 2C3ZA 1WQ5A 2GQAA 3TW6A 2WNNA 1W37A 2X1UA 4UTKA 5C6MA 2ZA1A 3P81A 5C5YA 1VHNA 3HPSA 3SSJA 1RQEA 4JTJA 3P62A 4PA8A 3Q2DA 4CLMA 3ABSA 4N9BA 3NQ8A 4QNEA 4MKNA 3MP5A 4O16A 1VCVA 2QJGA 4OGZA 5DLCA 1B9BA 2B0MA 3MW7A 2OX1A 3TUUA 4DELA 2E5CA 4DEFA 4RZ4A 4S2CA 2V8ZA 2BXVA 3NG3A 3W76A 3B0UX 3A24A 3W87A 3EWWA 1RR2A 2ALDA 2Y88A 4MJZA 5F2LA 1JRCA 2Z6JA 4Z1DA 1GTHA 1M5WA 3ZWSA 3WK0A 1IXOA 4JDYA 1H62A 3DFPA 3A9IA 3MI6A 4FIRA 5LHFA 3QMRA 1HL2A 2DORA 4JX4A 1W5MA 3IGSA 4M19A 1ZNNA 2J9XA 1VLWA 3G1VA 5G2HA 2ZZ1A 4O8RA 3PBYA 1CX9A 3EX6A 3FKKA 3CEPA 5I3GA 3ABRA 1KM5A 5D03A 3LOTA 4K37A 4OBTA 4Z0SA 1TPUA 3CU2A 3LBCA 2YFOA 1JUEA 1QPNA 4TMCA 4LS0A 4KFOA 2CLOA 2DU2A 4UMAA 2WJZA 3HGSA 2V82A 1K8XA 4XTIA 1T96A 3FFSA 3S5OA 1JCMP 3TC7A 1FY6A 1QOQA 3KVLA 1KFCA 4LUJA 4WOZA 1MEIA 4GC4A 1B57A 3NXFA 5LNVA 4P61A 1LBFA 4IXXA 2AGKA 4JTUA 5TQLA 3CQ0A 4LU0A 3TKFA 1EB3A 3QSTA 5C55A 3M6YA 1UB3A 2BWGA 4LUIA 4O12A 4GXMA 5EL1A 3L0GA 1YYAA 2ISSA 1EWDA 3H55A 3UWVA 1VPXA 2OT1A 3S6DA 2C18A 5D05A 4JYDA 5C54A 1L6WA 1FCBA 3WJWA 1QWGA 1K8ZA 3G3MA 4O18A 4RCXA 1GWJA 3NL5A 4WY0B 3P61A 5DXXA 3OBKA 2WO5A 3QEZA 3SI9A 1VQTA 3NQ6A 3THQA 1VHCA 3LDVA 4W9TA 4Z0JA 3KVMA 3LXAA 4MUZA 3IV3A 2WKJA 2X1RA 2ATSA 4Z1CA 2CZDA 1EIXA 1OFQA 4CQAA 2XN2A 1LOLA 2FB2A 1ICPA 2DP3A 3IIXA 1THFD 4QIUA 2ABAA 4FB7A 3W2MA 2V30A 3DFOA 3SGUA 3MI2A 2HMCA 2HS8A 1DV7A 3E12A 3BW3A 5U7SA 5A8GA 3CWNA 3QC3A 3TQKA 4AWUA 1BEUA 4RZ6A 3W75A 3G1SA 1SO5A 5LNUA 3DHFA 3NGJA 3P8JA 2J27A 2NUXA 5DCEA 3LCFA 4O0KA 2YSWA 3GYEA 1GG0A 3ANYA 2ZA2A 3KRSA 1KV8A 3R12A 3S5NA 2RDTA 3KVKA 5K3VA 4E2DA 2QCLA 3QQ1A 2Y70A 1Q45A 4DF0A 1LBLA 1A5BA 1R2RA 2V2DA 3T78A 1QAPA 2ZRWA 1IIHA 2TYSA 1FWWA 2YZRA 4OHQA 3UXDA 7TIMA 3I7QA 4HKPA 1H5YA 2NWRA 1ALDA 4NUWA 1O5KA 1A5CA 3T40A 2F7FA 1EPXA 3BARA 3NR0A 1IF2A 2Y6ZA 5F1UA 3STFA 3P5ZA 4N02A 4LT9A 2QCMA 3NL3A 1VC4A 1XI3A 3PR2A 2OZ0A 1Z44A 4FX8A 5EPDA 5F4SA 1ZAIA 5LZLA 4UFMA 1VLIA 3R5EA 2NLIA 1OFRA 2EPHA 3PC0A 4ICNA 3W1NA 3DXIA 2P1FA 3EWBX 3KHJA 1KFJA 1ME8A 2YGYA 1G4TA 3QFEA 2QUUA 3W1MA 2YFNA 3LBMA 1VRDA 2FQIA 4NZFA 5LGXA 1I4NA 4UFKA 1HTIA 1FDJA 4WXYA 2CLMA 4UTLA 3N14A 4IMGA 5G4EA 1LLWA 2JKAA 1X6UA 4CNNA 1TCDA 8TIMA 3N2MA 4Z1BA 2VFGA 1S5TA 1OF8A 2QDHA 4FNQA 2YDAA 3U6WA 1XC4A 2DZXA 1YTEA 2PRLA 2B7PA 2QAFA 3LHWA 3DFTA 3NQFA 1AW2A 4RJEA 3O16A 3UXAA 1W3TA 1WAUA 2O7SA 3BW4A 3W2NA 3MI3A 3SW6A 5AHLA 4DBDA 3W7IA 4YL2A 3DFNA 3C2EA 5G4WA 2JGQA 3TROA 2C0AA 1OX6A 5EA9A 4MZ1A 1TQXA 2WSRA 3KX6A 2UV8G 3WJYA 1ML1A 4BK9A 4JNMA 3I7RA 1KM3A 2CFFA 3CM4A 5D04C 1FCQA 3EWYA 1W0MA 1DBTA 3BG9A 4LNYA 3GB6A 3L5MA 3MYPA 2CZFA 2Y62A 3NPXA 5F2MA 5LGZA 5LNWA 4JTLA 3W07A 3W6YA 4CNPA 1TIMA 2NXGA 3DENA 3L2IA 1W56A 1KTCA 2XN0A 4WUIA 5DBUA 1NVMA 5AHEA 2YW4A 3U8GA 3T44A 1AW5A 1QPRA 3O15A 3KRZA 5G5IA 3QYQA 2TRSA 4UFLA 5I3HA 3S1VA 3TH6A 3W73A 3B8DA 1W8SA 1QPOA 2C16A 3FJLA 4CQ8A 2V0TA 1GTEA
chains in the Genus database with same CATH superfamily
3EDEA 2HNEA 3DG6A 1BXNA 1EP2A 4V1YA 2CERA 3W1PA 4ZENA 3GTHA 3BE7A 4BZYA 2OFJA 1FQ0A 2GZXA 3NO3A 4HA4A 3VNMA 2PCQA 4WKAA 5JBFA 4DO4A 3VU2A 4WSHA 1H41A 4W8LA 4QX4A 4CU7A 2PGWA 3F7JA 4HU3A 1N7KA 1A50A 4PMUA 2HNHA 3VD5A 1ZZMA 1JEZA 1FWGC 3CPUA 2Y7GA 2D69A 1R7OA 4Q33A 1JGIA 3E74A 3TZNA 4HK6A 1BXCA 4X63A 3GNDA 4ZODA 3RLUA 4EPBC 5C71A 2W66A 5C2XA 1AW1A 3LZ5A 2PWEA 1TQJA 5B80A 1YADA 3NQ7A 4MTVA 3QC0A 1OG6A 3MMWA 5FJOA 1HP5A 3CTTA 4ZTXA 3F03K 3LNPA 1MDLA 1XLJA 2BX7A 3MU7A 2G95A 2X7VA 3W7DA 3TWBA 4B5XA 4PR4A 1EQCA 4DJDA 1HQTA 3NZQA 3A3XA 3GG7A 2VOTA 2A3BA 3WNLA 2BXZA 4I7WA 1GOOA 4BF5A 4RNJA 4XK2A 1ADSA 1NIUA 3NL6A 1I1WA 2QLYA 2Z2UA 4B16A 4O0ZA 3RRXA 5KMYA 1DJNA 1ICQA 4M7SA 1GOXA 1NWRA 4PSRA 1JZ7A 4MB4A 5FAJA 2VZSA 1XDLA 3L2LA 1TIWA 1P43A 3B0PA 3O6AA 4XIAA 4TIMA 1Z32X 3G5EA 1DHPA 2YA1A 4PZVA 5M03A 1E6PA 4BY3A 2JEPA 3GDLA 4WQ6A 1G69A 1SFSA 1BWKA 3B8SA 2XVNA 3URNA 4J3TA 4KCWA 1KFBA 3EX1A 1OC7A 3KFTA 3MJYA 3TTOA 1DPMA 2E6DA 2Z2AA 3PZTA 3MVTA 2Q3RA 4IGSA 5I00A 1R85A 4GI9A 3N2OA 4DVOA 1Q6RA 4WDTA 1UZHA 1W1B1 3U2EA 5J5DA 5CG0A 4QTGA 3CV6A 3HU7A 3MMDA 4GYKA 4UTUA 4Z17A 1K4GA 1TV2A 2JQXA 4XKYB 3L21A 3N17A 4I3GA 1XIGA 1XH0A 3LX9A 3L4TA 5AB3A 4AF0B 3DFHA 2ZC8A 1A0EA 1ECEA 3MO4A 5DQPA 2WKLA 2CZEA 3NZ1A 2WSKA 3BJSA 4I5UA 4AIOA 3UA4A 4DYEA 4IPIA 1Q6OA 1GW1A 2EXOA 4EF9A 4DM1A 4MY1A 1ISXA 1ME9A 3C8FA 3VIHA 4EIVA 4AIEA 4M6VA 3H21A 2CHRA 2VEIA 2Y1HA 4LFYA 3CYVA 3GDRA 1LBMA 1UD2A 4PL2A 3MY9A 1XPGA 1MQPA 4DPPA 3LY0A 5DELA 1SSGA 3D3AA 1N55A 1UR9A 4LC8A 3CUZA 3U48A 4QE5A 3TYUA 2FTWA 2VX4A 1OY0A 4ZXLA 1YBQA 5XINA 4CCCA 2WQPA 4CQCA 1XKJA 3F4DA 3B8UA 3ARUA 3LHTA 4FOUA 4HSHA 5CJMA 3WCZA 4ROPA 8RUCA 5RUBA 4FHAA 1RLCL 3M7WA 5FJJA 2FHFA 2FZDA 3S9ZA 3NQBA 1X8CA 1X8FA 3AUOA 1VEMA 2GJPA 3RU8X 2FJKA 5FA5A 4GBUA 4KS0A 1A4MA 2GQ8A 4B5VA 2ONEA 1T8QA 1E6QM 3R8RA 2O56A 3TC6A 4AD3A 4GY0A 1UWAA 1SZGA 3BWWA 1S5MA 3MA8A 3GBDA 2EJAA 2VM8A 2VKZG 4JIIX 3TW7A 4K7YA 4M6QA 1O95A 3EWCA 3TAOA 3V7PA 3LTSA 4HU4A 3UXIA 4AVNA 3FS2A 4H01A 5AZ0A 3SY1A 5MF5A 5CPLA 1NWSA 2WW5A 5CPQA 3SR7A 2ZVRA 3TXVA 1ZAHA 1B3XA 1O94A 5IRPA 1MI3A 1HFBA 3O8AA 2W6RA 2OG9A 3UD6A 2I9UA 3LI1A 3Q65A 1GOWA 2FGZA 1XPYA 4IJRA 3G0XA 3Q37A 3LM7A 3CEUA 2O7QA 3CZJA 3R89A 2Y5EA 3IK2A 4W85A 1DJIA 2B7NA 3UYCA 3T2QA 1ITXA 4NX0A 4EF8A 1P0KA 1NFGA 1HF6A 4X2PA 3IAQA 3EOEA 3AIEA 2X8RA 3PZ9A 1WOBA 3LSBA 2CLIA 2DJLA 3N2XA 4YYCA 3UWYA 5EFDA 1K1DA 3MDUA 4IL0A 3HJZA 3BGJA 1IXQA 1KTNA 1JR1A 1XIIA 2C19A 3B9DA 3E0WA 5HDRA 4NU7A 3ID7A 4ZQNA 3APYA 1TVPA 2XH4A 5FSEC 2D0FA 1QNOA 4GPNA 3DG7A 3BSMA 4A3UA 3W7PA 1XYCA 1GQNA 4UC5A 2ACSA 1GZGA 1UR3M 3EB2A 4O0QA 4ZO9A 3VDCA 4POCA 1ESWA 2OSYA 2DSKA 2UZ9A 3VZZA 1OD8A 1V3LA 4MUPA 3T0DA 1XX1A 2YX0A 2CLKA 4M1BA 1B2YA 1XYAA 1FUYA 3N19B 5K9XA 1TA3A 4Y9MA 4KH2A 3O63A 4P7LA 1VZWA 3FA5A 5CH9A 4JR5A 4HHLA 4NRRA 2PGEA 3IK4A 2NQJA 5I3IA 4B92A 1PB0A 3W7QA 4NXSA 3QW4B 1RK5A 3EMZA 3CQKA 3O6CA 3S42A 2Q8LA 3UJFA 2PLCA 3G1XA 3VFLA 4GVGA 3CJPA 3WQDA 3S1XA 2VQTA 1T5AA 3L4XA 3M44A 3C0LA 1TTQA 2VQUA 4HCHA 1EKOA 1OZMA 3C0QA 3WLKX 4LUYA 4TV5A 2ON3A 2VFHA 3WFAA 2EPKX 1HZYA 2WC3A 4D6GA 1E3ZA 3HB9A 3WD4A 3ANVA 1EPVA 1K03A 3QPYA 4YPJA 1XBYA 2W61A 1Q7QA 4KW2A 2CLHA 3ARTA 3URQA 1TPFA 3K8KA 3VC5A 1V03A 1HO1A 2VUYA 3OA5A 2IPWA 3CHVA 1VD6A 2PP3A 4L61A 1XIMA 3NPWA 1T6MA 4WJ8A 2W62A 1LOQA 3TJLA 1LWHA 4H7ZA 5D33A 4PMXA 4XG1A 2OPJA 1BF6A 3LGDA 3BGGA 3VDGA 3G0UA 2NSXA 3HURA 1SR9A 3TWAA 3BUVA 4PRWA 2YR1A 2FPVA 3QY8A 4XQ6A 4J3UA 1YMYA 5GJPA 1O68A 1P7TA 4L80A 3SRFA 3EMCA 2XM1A 4XZLX 3SIMA 1UROA 2VX5A 4HA3A 1Q6GA 1JQXA 1TO3A 3FYOA 2ZBTA 1XINA 3LD5A 3O1NA 2CXEA 4JTHA 1Q6DA 1EC8A 2I14A 3MQTA 5AC4A 1Q6QA 3BICA 1VYRA 4Y8FA 3BLIA 1UR4A 2XGIA 1CXKA 3CQIA 5HWMA 5AYXA 2E0PA 4Y90A 1QRQA 1E0WA 1IT0A 4LYKA 2WMFA 2ZXBA 4A8NA 2EPMX 2ZZ2A 4UFJA 2WHJA 5HMDA 5I09A 3PBUA 4H3DA 3W70A 4HP5A 2PWFA 4B4FA 1KM1A 5D2TA 6ENLA 7TAAA 2C15A 3ZVHB 2Y5SA 1HIZA 5D09A 2J66A 1JIBA 1XLAA 2XGBA 2GVEA 3QZ6A 5BRQA 1V6XA 2AGTA 2VRQA 3S2NA 1ISVA 2QR6A 4IQLA 3DI1A 3FKRA 3EDJA 1K9FA 5IBXC 3PZGA 3N73A 1QW8A 4RL3A 2QJIA 4H00A 1J12A 3QW3A 2BY3A 3L9CA 2VFIA 4NZ1A 2DH2A 1L8PA 1LF1A 3L4UA 4G56A 1DE6A 3LMZA 4CNSA 3ARVA 4FMVA 3U2OA 3N15A 3T81A 1FWRA 4QLKA 4PB4A 5A69A 1AG1O 4MWAA 1RPXA 4PMNA 4PBGA 1H51A 3TCSA 2HK1A 2ZE3A 3IJQA 1BSLA 3BMVA 1ZTVA 4U31A 4WJEA 5BNKA 5A5WA 2ZFAA 1SMAA 3MS8A 4JXCA 5JVLA 1H09A 1PX8A 3UU0A 1GVQA 5A2CA 4GBDA 5REQA 4Q4SA 3PSVA 4PB3A 2V5DA 1V0MA 3KBNA 3PFMA 4YWIA 4Q8NA 4GZEA 1B90A 4LAZA 4DAIA 1K9TA 6TAAA 4KWVA 3N6JA 2Y85A 4QFUA 1Y5WA 3EDDA 3AIRA 1XIHA 1YXCA 2YCEA 1MUMA 2C1IA 1UOKA 2IKIA 3EWUA 3MSRA 3SY5A 4W84A 2BGSA 3G1AA 3GX9A 3W82A 2WMJA 3RG6A 5FAGA 3ZOAA 4JTSA 1BVNP 1XCWA 1E72M 3PAOA 4C6JA 3O9NA 2V81A 2WV8A 4Z2LA 4DJFA 3SCWA 3LTPA 2Y63A 3A21A 3NDZA 4LVAA 3BZJA 4H9VA 1KM4A 3RMJA 3O2LA 3WEOA 1R3WA 2YL9A 1V3KA 1Y5XA 3TFCA 3HM7A 4H6KA 4Q6JA 9CGTA 4D6EA 1CW2A 3C0SA 1IR2A 3U5UA 1WE5A 4PTNA 4DWSD 4N9CA 3CUFA 5HA7A 3AMCA 4HSNA 4JGDA 3F2DA 5HINA 4O4VA 4W4QA 3GXDA 5LIKX 3N18A 4JTIA 5AECA 3SN4A 2D3NA 3S1GA 1D3CA 1NFBA 4ZQCA 3WQ8A 1PV8A 3PHAA 4LCSA 1PTGA 3F5KA 3MUCA 3R11A 1UUMA 3O06A 2BVYA 4JEQA 2W67A 3G1HA 4KPLA 2EKCA 5BRPA 1EP3A 1JI2A 2QUVA 3TYBA 4ZBCA 1XV8A 1DTNA 1Y65A 3TDFA 1UD3A 2GGJA 2F61A 4JCMA 4AYSA 1BYAA 4WKHA 3T4CA 3WD3A 3SO7A 1HNYA 3GH7A 3KLKA 2C1HA 4L4PA 5AHNA 3VKJA 1ZBCA 3CWHA 3NQ2A 1LOSA 2B7OA 3SCNA 2DVUA 2I5IA 5IHRA 4ZMGA 1R3SA 1E73M 4NZ5A 1TPWA 3PZVA 2TAAA 2VRKA 1QCWA 4XZ9A 4AAJA 3IJIA 3E9AA 5C9ZA 5DMYA 4IMEA 3ZJ8A 3IJDA 4CEUC 3OEXA 1JNDA 4Q8VA 4BWLA 2DT3A 2AKMA 4DB7A 2VEFA 1V8EA 2UY4A 3TTSA 4JTCA 2XFYA 4RE2A 2OYMA 4MFEA 4WGXA 1CB7B 2QJHA 2YOCA 4I8DA 3OGSA 1WXJA 4NI3A 3GC4A 5IM51 1GPWA 2YCJA 1S3TC 3E02A 3OLEA 1FX6A 3QKZA 1I2OA 2OKOA 4UTMA 4BQ5A 1IWPA 1PZ2A 3W1XA 1K7EA 2Z27A 4KCTA 3AMGA 3FVDA 1FWTA 4LV9A 1HXJA 2E09A 3G77A 2EG8A 2NVDA 4XD5A 2ICSA 2BHYA 4MNKA 3EEZA 5A8PA 4P8VA 3FAWA 5K4ZA 1B54A 3F2CA 3PZIA 4O1FA 1LP6A 3DECA 2J7DA 1ZGDA 4MZYA 3TYDA 3KS6A 4RE4A 3O6DA 4PMYA 1MZRA 1E9ZB 2G0WA 3QLDA 3LLDA 1C8XA 3BSGA 5KSWA 4YTRA 1B4KA 4QLLA 4N9DA 3GNPA 5LNRA 3OG2A 4R9XA 2J6XA 3W72A 3PPGA 3WQGA 1GYLA 3OVRA 1LROA 3B3DA 4NRSA 3UZ5A 2I1OA 1O1ZA 5CC7A 2V9DA 1PDZA 2HWGA 4RKAA 1H11A 3QGVA 3WDJA 4PUNA 1J93A 3K1GA 1SFJA 3TA9A 3RCNA 4EXAA 6ALDA 4HT3A 4AYGA 1H7WA 5D30A 1JZ2A 3ZLFA 4ASTA 3EOUA 1MNSA 4CN1A 5HK4A 3FA4A 1D8CA 4FZIA 4E38A 1EWEA 5BXRA 2QDDA 5I3FA 4GINA 1UWUA 4A2SA 3ABZA 1ISWA 1FOBA 2XTKA 3LCGA 3OLGA 1DJGA 3MMUA 1OFEA 3PK7A 4C1LA 1VBJA 4GISA 4IX0A 4TTGA 1SO4A 1CCWB 1DQXA 2CLEA 2GYIA 6XIMA 4JN7A 2XSAA 4U3CA 3W0KA 3AIUA 4KGJA 1RALA 2OSXA 1JCNA 4XD6A 2EHHA 1EOMA 3VMNA 1VBHA 1EJSC 1ZB5A 1VYPX 1PYFA 2PODA 3C86A 3WN6A 5BROA 5AVHA 1VPQA 3FHAA 1CXEA 1J2BA 4FAMA 4A29A 2PDNA 3BXWA 2HV5A 2R1MA 1ICSA 2F84A 2IKJA 3GFXA 1HJXA 3LXCA 1LDCA 3W7MA 1CWYA 4D2JA 1KBIA 4H2HA 1UKPA 3P5YA 3U0HA 4D72A 1WKDA 3O05A 4JX6A 1C93A 5A8MA 1KCLA 3PUOA 1WXYA 2E9MA 3VIOA 4CU6A 5A6SA 4O14A 4QP0A 3WD2A 1I6NA 3WH9A 4J3SA 3WFLA 2PI6A 1BLIA 4LVBA 1SR0A 4LVFA 4GWEA 1ME7A 4Q7NA 1RXOB 4HN4A 3P6LA 3LV5A 1HKJA 4AXNA 1SUXA 3NPUA 4I6VA 2FZNA 4L9YA 3VM5A 2PA6A 4XVEA 4E2VA 4I7UA 4DZ5A 2EJ1A 2TMDA 3UWWA 3CK5A 1XKYA 1PCKA 3HF3A 4O11A 4FNUA 4PMOA 3SCOA 3O6YX 3A6OA 2HCVA 4ZB5A 4ERGA 4GI8A 3URAA 3QPZA 4R5EA 1QOPA 1M04A 2DVTA 1EL3A 1SZFA 1J0IA 5CAHA 1G9HA 3M9YA 4ZOCA 3KAOA 4UXDA 4QCFA 1F5ZA 2G3MA 4N7QA 4P2VA 1EJXC 3BJTA 2A2IA 2R94A 5BZAA 2VEGA 4YVPA 3M0KA 1H1YA 1DL3A 9RUBA 2DQWA 4H6EA 2VRJA 4BR1A 1I2NA 1G4PA 3NQEA 4DYKA 3UESA 1YE4A 3D3FA 3TR2A 1XLIA 1U2YA 4YS1A 1TV5A 1W5OA 4UMBA 2B31A 4LBRA 4AZCA 2FVKA 4N6EA 1JXJA 1P6BA 5KZDA 1ONXA 2E28A 1SO3A 3ECQA 4YJ5A 3UR5A 4QQ3A 1A5NC 2DV0A 3I3EA 1QBBA 3K4DA 3T0BA 3TONA 1SW7A 3UZXA 4AWTA 3VIJA 3D46A 3VM7A 4H4IA 1FWFC 3LQGA 3H2MA 3ZR4A 4NXKA 2V3EA 3WDRA 1A0DA 3P0WA 3PB0A 3INPA 4GXWA 1VIWA 2DT0A 1W31A 4HMCA 4GYPA 5EFFA 3MKVA 4GFSA 3GG1A 2P88A 1RA0A 3NVTA 1H7PA 3KBJA 3M43A 4KEZA 3BSHA 3RU6A 4US5A 4B2DA 4JOMA 1LCOA 1GW9A 3PBGA 4XVDA 4FALA 1ONWA 1YX1A 2PP1A 3CMFA 2QCDA 2QAPA 4BWLC 1NFPA 3VCCA 4NF7A 3F5LA 4LWWA 1RJRA 5T9BG 1VKFA 3H53A 3CWOX 3MUY1 1DQWA 1SFLA 5JIWA 3RJXA 3SBFA 3JZEA 4QG6A 4TVCA 2PPGA 5EKYA 3I4KA 4WSKA 4HCLA 1W3LA 3KOZA 4QEHA 1PDYA 1GJWA 1HL8A 2DDXA 1PAMA 3AXMA 4O10A 4JQAA 3N04A 3RF9A 5L6UA 1A5KC 3S6OA 1GVRA 2A5HA 2ZOXA 4NYUA 4YTUA 4MJ2A 5D2VA 4HIBA 5FF2A 1REQA 3VOFA 4ONVA 2FVLA 3R6IA 3P2VA 4O15A 1GG1A 3MSYA 4IQEA 4W7VA 4O52A 2BVWA 1K6WA 3GIYA 3IVUA 4IUGA 2CPUA 5AC7A 1ZRQA 3PB2A 4GUJA 3WLJA 4O53A 4CN4A 2GK1A 4GIRA 1V3HA 5KZMA 1S46A 5LSMA 4H9YA 3TQPA 1GVIA 2VC6A 3DBNA 1W37A 4UTKA 1ISYA 4W5UA 3BL3A 2FGLA 1YRRA 3SSJA 1WKFA 4YVXA 1A3HA 3WQ4A 3B9NA 4PA8A 4OECA 1EFZA 2PDFA 5FL1A 1UR8A 3FJ4A 3EWDA 1TJ0A 4IIHA 2WCSA 1R3VA 3Q45A 5DLCA 3TUUA 3SUSA 2FHBA 1DIEA 2ZADA 2RAGA 1XLHA 2GUYA 1BTCA 5TNVA 1KQZA 3PTKA 2Y88A 3NO1A 1UKQA 3BMXA 1GTHA 1J5SA 1IXOA 1W8GA 4PE8A 1H62A 3DFPA 3A9IA 3MI6A 4FIRA 2Z1KA 3QMRA 1HL2A 3OGRA 3KDOA 4HZ8A 4GIAA 5ABFA 3IGSA 3RMEA 1E9IA 1RD6A 1VLWA 3G1VA 2NSOA 1D7FA 2ZZ1A 2G3NA 2BOGX 4IFKA 1CX9A 3TC3A 3LOTA 4Z0SA 1RBLA 3I10A 3UCCA 1UP3A 2YFOA 1VBUA 1QPNA 3PNZA 4C6FA 2PWDA 3DHPA 3LLXA 1ZP4A 2WJZA 5HBFA 3OZOA 1K8XA 2IQDA 1JCMP 1FY6A 2JIWA 4I6KA 4GC4A 1B57A 4JTUA 1EA9C 1MW3A 3QSTA 5AKQA 1FTXA 3VIGA 3M6YA 4LUIA 2YCIX 5EL1A 4KRZA 1RJQA 4INFA 5HNNA 1EWDA 4CQDA 1XLEA 1RA5A 3UWVA 4B90A 5EU9A 1C8QA 1L6WA 3DIPA 3KP0A 4W8AA 4O18A 1EXBA 4M1RA 4NIRA 1ONEA 3H4GA 2Z1SA 3NL5A 4LYPA 2O92A 5DXXA 5ABFB 3V5FA 1JL8A 4HBKA 3V16A 3LDVA 4W9TA 7XIMA 4H9ZA 3KVMA 2XHYA 2WKJA 2WZIA 8A3HA 4FB7A 3SGUA 1XW8A 1DV7A 1E0VA 5U7SA 3T0TA 3SRKA 4DJFD 1BEUA 1G94A 4RZ6A 1A80A 5D4YA 3G1SA 2F8QA 5LNUA 2W27A 1FRBA 2CXGA 3RITA 5DCEA 3LCFA 4O0KA 2YSWA 2AQVA 3NGFA 3R0KA 3KRSA 3DYPA 2VX7A 3W38A 3S5NA 2RDTA 4E2DA 1Q45A 3NJ3A 1NDWA 2D2JA 1UIOA 1KCXA 2YL5A 4NI8A 2TYSA 4GJJA 1KGXA 1FWWA 2YZRA 3M0XA 7TIMA 1H5YA 4Y9PA 4Q4RA 1DIOA 1O5KA 2CYGA 2VD8A 3T40A 2J8TA 3HZ3A 6XIAA 1XIDA 3CV2A 4AUBA 3RILA 4N02A 1VC4A 3PR2A 4H8VA 1AZ2A 1BAGA 4FX8A 5LZLA 2X2YA 3R5EA 3HFTA 3PC0A 3SCPA 2AL2A 3EWBX 4MWAD 1KFJA 1ME8A 1XC6A 4ZR8A 1B3WA 8XIAA 4LSBA 2FQIA 4GMEA 1FWAC 3ZSSA 1EC7A 3BOFA 4JQ2A 1XLDA 3L2MA 3GHTA 2CLMA 4UTLA 2OOGA 1IT7A 5LYRA 3H7RA 4ZO7A 2YDRA 3UT0A 4XZHA 1KR0A 4GX8A 2VFGA 1OF8A 3AS2A 2V5KA 2YDAA 2R1PA 3VTRA 4DJDC 1T40A 4XZMX 2O4QA 4YTTA 2B7PA 4W7UA 1FFRA 1AW2A 4RJEA 3UXAA 6PTDA 4CQBA 3W2NA 1CYGA 1GZJA 2CNCA 1AUSL 3G6MA 3WKZA 5J04A 3VOCA 2PS2A 3FNDA 3TROA 3ANUA 5AVNA 4GYJA 2BOFX 2QMJA 4K1WA 3KBVA 4C6PA 1E1CB 1IV8A 1E4IA 1POKA 4HK7A 3I7RA 1E4LA 3CM4A 3I3DA 4LNYA 5CC3A 2VVSA 3MYPA 2CZFA 2Y62A 1XD0A 3ME3A 3W07A 4CNPA 1OBAA 2NXGA 1RBOB 1E6XM 1VF8A 2WC7A 3U8GA 2VWSA 2ZX9A 3AOFA 5C8BB 5DX7A 3VINA 3WL0A 5G5IA 3QYQA 4UFLA 3S1VA 3H26A 3CAWA 3FJLA 1VFFA 4U2ZA 5FKYA 3UW6A 4LC6A 5JH1A 1GYMA 1JF6A 2P0OA 3ARQA 1J0YA 2ACUA 3N6HA 4MWAE 4IOTA 1KFKA 4MG4A 3CIWA 2P10A 2DT1A 2WHLA 2P0IA 1AK5A 3ZVHA 4GIEA 3B0VC 5AYIA 4V27A 1BF2A 1EIBA 1ADDA 3WDPP 5GJMA 4B5TA 3UWUA 4HZ6A 3EKZA 3WQ5A 1PYMA 2J8FA 4YN5A 2FVMA 1OGSA 4QDWA 1V3JA 1UH3A 3BPWA 4TXEA 4ADTA 1K02A 2H90A 4JQ4A 1CXHA 1QNQA 3SUUA 2QHAA 2O9RA 2BXYA 1K8YA 4L65A 1GNXA 5I3KA 4AZIA 2PWHA 2VFFA 1HJQA 3S2CA 1RVGA 4FNTA 3ATZA 1UWRA 4E2OA 4LW7A 1W1PA 2WMIB 4R7JA 4IQJA 3BQ6A 4O54A 3RCMA 1XCFA 4S1FA 2YDSA 1EZWA 1OIFA 3LRKA 3HG5A 2VC5A 4XUGA 3HA1A 1TMHA 4QCEA 3QH2A 4OV9A 2ZTJA 4TX8A 2OLSA 2PD5A 3V3WA 1XWYA 3ZFHA 4HOXA 2XIBA 2AAMA 1JULA 3WMBA 4J28A 2V5JA 3EX4A 1ITUA 1UZ1A 1VBRA 3NPVA 1QPKA 3S1WA 3C2FA 4F3HA 1KXHA 3ITYA 4OBSA 3ELFA 5FJUA 3H2AA 3WLRA 4PL1A 4QEEA 3TP4A 3GDMA 1CTNA 4MNLA 4HYWA 3PZQA 2OU4A 1PX3A 3W29A 4NT0A 2GGHA 4PRRA 4GI4A 4PMJA 5XIAA 1NJJA 1SFTA 4E2BA 3BAKA 3W24A 2V3GA 1OFOA 4IMDA 3M0MA 3GHSA 3S8HA 3EOOA 4QSHA 4NZ4A 5AYZA 4F0HA 4UQAA 3OODA 3PF3A 2WZEA 3W25A 1VCFA 3FYPA 4JPGA 4GQGA 1K7XA 1Q6CA 5CSUA 2R9RA 1EDGA 3TN6A 3WK3A 2R14A 3QV9A 5FSDC 4JQ1A 3DFQA 1WV2A 2KAUC 4GE8A 1PBGA 3MBFA 4I90A 4JQ3A 3MWCA 1ISZA 2A7PA 4IGMA 4ACZA 1W1TA 3W2JA 3BQ5A 3IV8A 4DJFC 2XVPA 4JIPA 2DSUA 3GVRA 3R0UA 3R8GA 2P50A 1OX5A 2WVUA 4GD0A 3JZUA 3EZ4A 3LCIA 4S3GA 1GEHA 5HULA 4ZOEA 3AS3A 4JFVA 3BAJA 2O0TA 5D9OA 4JHMA 1G1YA 1REQB 4EAYA 2NUWA 3TNOA 1UKTA 4FNPA 5DMLA 7ODCA 4QS5A 5JXQA 4DXVA 3ARZA 4B4HA 2NQZA 3SY8A 3BTNA 3GXNA 4AMCA 4JFTA 3RDKA 5H2ZA 3VKBA 2ZWZA 3FXYA 3GSMA 2FTYA 2ZCGA 3A4XA 5BRBA 2YCLB 3KOXA 3LBOA 1XLLA 2FB3A 1YDNA 1PHWA 2QGYA 3TYAA 2XYLA 2DJXA 3LGGA 1CEOA 1V6VA 3OA3A 3GZ3A 3W53A 1QU4A 4D9PA 4ZSTA 2DY3A 3HFYA 1SPQA 1GORA 3M4HA 3SDOA 2PD9A 3NZRA 3AJXA 4NNCA 4RPQA 2WVVA 2BSLA 3AYTA 3WNNA 2X40A 3VABA 1UIPA 2Z26A 1AH0A 1GKQA 3LCWA 3LV6A 3WH5A 1RP9A 2GOKA 1G67A 4L1WA 4HK5A 2GGEA 1FH7A 3MVIA 2VO5A 3RLGA 2QUNA 3M64A 1HG3A 3UCQA 3QV7A 2YW3A 1I2RA 4XZWA 4Q6XA 1BFNA 2MNRA 1VP5A 1SYTA 4E8DA 2UWFA 5FEZA 3NSNA 4IG2B 2G41A 3BOLA 3F5JA 3RO8A 3EWXA 1JG9A 5ECUA 4QLJA 3LPPA 1OVDA 5JBDA 2XH7A 3BAIA 3W9ZA 1US2A 1SJDA 3ENLA 1HVXA 1VFOA 2DZUA 2PTYA 3PANA 1KXQA 3EKLA 2VP8A 2HJPA 3WF1A 3AI0A 5HWNA 3BK0A 1TWZA 2PB1A 4RX0A 4PUEA 2QCCA 1S2WA 4Z1YA 3VKDA 2VHLA 3OQEA 4XBSA 1QUMA 1V6WA 3S9YA 3BJFA 4OTKA 4PEEA 3H12A 2OSWA 1H0IA 1XS2A 4C1NB 1ZCOA 3UR7A 4AIBA 1UYQA 3M0VA 2V5BA 2Z28A 4ZZ9A 1RAKA 4YTQA 1KFEA 2QVHA 3HQ1A 1WXZA 4IP7A 5CG7A 1SZNA 4DWDA 2CESA 1H7RA 7REQA 1WUEA 3KCJA 3F4WA 1PXGA 3RNDA 1EF3A 3BLPX 4RV3A 3C56A 3AO0A 3E5BA 2ADAA 1GZ1A 4RDWA 3VDBA 3O07A 1WZKA 3WLIA 2WANA 2A7RA 3W86A 1E51A 1HVQA 3E49A 3LI0A 2VCCA 4X22A 4DJEA 4JKLA 4UQCA 2XIJA 1W6TA 3AALA 1ECQA 4GO9A 3H24A 1S5NA 2Y2WA 1RQHA 2YPIA 1X39A 3LK6A 3VNDA 2WJFA 4YMZA 4H8NA 4A8RA 4GZJA 1CGVA 2P53A 4GJIA 3CASA 2QUMA 1RQBA 1TV4A 5B7ZA 4AXKA 3LGEA 4FO4A 1ODZA 5ENLA 2BGQA 1TB3A 4JTQA 7PTDA 2W3ZA 5FJPA 3E6EA 1KWKA 1DE5A 4MAZA 4PUWA 4HTYA 4AF0A 3KCLA 1VPYA 1UASA 3C2VA 4C6LA 4HU8A 4Q32A 4AFYA 4E6MA 2BASA 2MUCA 1KGUA 1XDMA 3IRSA 2PLJA 2VGIA 3B8VA 6A3HA 1KBJA 1CXIA 3Q67A 3VC6A 3AROA 3UPMA 3WMLA 1UR2A 4PN2A 4QXIA 1CGXA 4O50A 4WD0A 3V1PA 4MWAC 3AIVA 1QI3A 3IIPA 5CGQA 3R25A 4ZQRA 3WQEA 1F74A 3K8LA 3W74A 2IXUA 1UHVA 1C91A 4NQ1A 1BQCA 1S1RA 1F3WA 2PRMA 3W2LA 3DUGA 1UPMB 2VR2A 2HXUA 1FWSA 2XFRA 2HBXA 1DJQA 1EGMA 1JF5A 2PRHA 5FF0A 4AZBA 3MJMA 1UC5A 1CGYA 5M5DA 4LUSA 1MNZA 4FLRA 4KRUA 4ZL1A 4V1XA 1NAL1 1GVFA 1ZHAA 4CD4A 2DIEA 4YHEA 4Q8MA 3M0JA 1P0EA 2DZBA 4NJKA 1TX0A 3GIPA 1UMLA 4CVWA 3C2OA 3NQGA 4UQDA 2ZRYA 3POCA 3W1AA 2C91A 4O8AA 4F4RA 1W5QA 3OPSA 1DJYA 4GACA 4TOQA 3UERA 4FNRA 4OZOA 1Q8JA 2FZBA 4AVFA 5CC6A 5C2GA 4ML4A 4US5D 1M41A 2E7FA 4MKVA 2PF0A 3VDAA 3PUGA 2A3HA 5T26A 4PSPA 1OIMA 1X1NA 3B05A 4LNCA 1UPPA 2ALRA 2BFGA 2P3ZA 5EGRA 3P67A 4AC1X 2HPIA 5HPOA 3G6LA 1W3KA 4NJHA 1R46A 5G1TA 3V75A 3GFYA 3RCYA 2PZNA 3CBWA 3KWSA 1TZ9A 2PDUA 1JDCA 1UUQA 1YBQB 1XLBA 3UG5A 3DGBA 2WAGA 5T9CE 1OYBA 2V68A 1F2JA 2OLAA 2WZMA 4CCDA 4DF2A 3HIJA 3T1GA 1ZY9A 1P4CA 2OYLA 3TYEA 1YPXA 1ZJAA 3EB4A 4HNUA 5K4XA 5DRIA 2AMXA 1OINA 1B31A 1RP8A 1IHIA 4C1KA 4RV8A 1KBBA 2IPJA 4MGGA 5E1QA 1W1IE 3L23A 1TUFA 1RD5A 1M9HA 4Q4OA 3STEA 3LM3A 2QCDB 3BV7A 3OIHA 4FLSA 3A22A 1A3WA 4G1NA 3B97A 3P8IA 1U1UA 3VGEA 4MF4A 1P0NA 5CZTA 1AA1B 1IIGA 3CXOA 4U5IA 2ZZ6A 1OYCA 2PZ0A 2BTMA 4UQEA 2JGYA 3AYRA 4QROA 3PM6A 3TTEA 1LRQA 1CZ1A 3WF4A 3UNDA 1EH9A 4ZB0A 2QCNA 5HANA 4D71A 5DCBA 1I1XA 2QIIA 3W28A 7CGTA 4PMDA 1DEDA 1MRQA 3I6RA 2E6AA 2ZRUA 1TSIA 3U9IA 1A47A 2VNCA 5LA2A 3SM0A 4JEJA 2DEPA 1WDPA 3N6QA 5A8NA 4MB3A 2WSQA 3VNKA 1A4LA 3S5ZA 1TPB1 4R34A 4J2PA 4AZCB 3W27A 1AODA 3KBMA 4EKJA 3D47A 5DRCA 2GPTA 4ALDA 4J3ZA 2PURA 1EC9A 2NUYA 3TVAA 4MY9A 3BG5A 4RZBA 5HOSA 1VGAA 3RGTA 3NDYA 4QHRA 1R47A 4IXHA 1Z42A 4MFDA 1FWNA 5IHSA 5DMMA 4XZIA 3W7LA 3FY1A 2RDXA 3WH7A 1PWMA 4JYFA 3RJYA 3K8MA 1ZLPA 2OWWA 1MUWA 3TSDA 1WKYA 3OHMB 3UZJA 3N9KA 1L6YA 4S3EA 1GQLA 2Z1BA 1BSIA 3PPCA 3RM8A 1JUKA 2YL6A 3L67A 4G6CA 4JTTA 1HW6A 3W1QA 5I2UA 1F73A 5MHBA 2WMKA 3RPDA 3W7KA 1H7XA 4KFPA 1RCQA 1ZAJA 1W9BM 2YZ5A 3MSDA 4H7CA 3PG9A 1EGVA 3WK2A 3CHDA 3W83A 2A6NA 4JYEA 3MHGA 1US0A 2JEQA 3W84A 1LM1A 3PJUA 5A6BA 3ZYZA 1SJAA 1W3JA 1T8XA 3ERPA 3GO2A 1UWTA 4HB7A 4NJJA 5CLTA 1B30A 3SJ3A 4DX3A 3IEBA 1OEPA 2QDGA 1N8WA 4GYFA 2GOUA 5EMUA 1XG4A 4ZGYA 3GDTA 3QTPA 4URIA 2OXNA 2Q8XA 1XP3A 1P0BA 1MEHA 3CUGA 3WH8A 3R8HA 1JGMA 4KFNA 1S5WA 1WDDA 2QCEA 2VJXA 2G96A 3BURA 4HHMA 3VGGA 3W2UA 3S5SA 5TF0A 2OKTA 2X41A 1OFDA 4DBEA 1GKPA 3UYIA 1H0GA 3WBEA 1V0NA 3DKJA 3AMDA 1FBAA 3PVFA 3BLFA 2V69A 1Q63A 1WDQA 1W1ZA 3VFCA 4LJ3A 2GSEA 3AXIA 2Z7GA 4UMCA 1TZZA 4AZ6A 3OBEA 4HU0A 5T91A 1L9WA 4LY4A 3M0ZA 3VZXA 1TJ2A 4LOCA 2J7GA 3MTWA 3IIVA 1PCWA 3PSWA 5HPCA 4OFCA 1VFUA 4MM1A 1BTMA 4M29A 3VMOA 3EXTA 5EYWA 4UNIA 3GQYA 1RUSA 1S1PA 2Z2BA 4BF9A 2EEXA 1CGTA 2FKPA 4GH3A 1J0JA 1EUAA 1MZHA 1UP2A 3W7JA 3GU1A 4J1OA 2XGZA 3IGHX 4WHBA 5E70A 4QJ4B 1OADA 1G6CA 3T4WA 1P1XA 4AX7A 2Y61A 2PU0A 3NQAA 1J5TA 2Y4SA 3WDQA 1IZJA 1ENUA 5AY7A 1O60A 1XRVA 1OCBA 1CXFA 1N2VA 4ZO8A 4LRTA 5F2GA 3KW3A 1AH3A 1KCZA 5I79A 5IXEA 2R6OA 3QHMA 4IJCA 1O4UA 3PG8A 1UW9A 2PU1A 1LWJA 2V5LA 4QG8A 3MCNA 3SCUA 1XSKA 1WZAA 4JKMA 3DH7A 3VX1A 4HNLA 2NX1A 1IT8A 4O13A 1G5AA 3IIZA 1LTDA 3WQCA 4BA0A 5D8WA 3CZGA 2F6XA 1V6TA 4LBSA 4JN6A 2WSYA 5D9NA 5JUVA 4CKQA 1QHOA 2HQAA 1XQKA 1TPVA 3N4AA 4P7QA 1HKVA 1H5VA 1H7OA 3RXZA 4CNTA 3P60A 1XIEA 3QM3A 4L5ZA 4D6IA 4IMAA 1I60A 4D1IA 1VFTA 2GQ9A 3WLSA 4S3FA 4XD3A 3K30A 4C6MA 3N13A 3SIZA 4HNTA 4ZOAA 4AY8A 5IDIA 3NTYA 3OG3A 3MP3A 4EWND 4NNBA 3KL0A 3IAPA 4AHQA 2AOSA 4F40A 1AMYA 4MJMA 2E9LA 3BG3A 1HJUA 2BV9A 3T42A 1HKMA 3LA4A 2VENA 5BXPA 3D6NA 4UFIA 4I7VA 5CPNA 4C5YA 3ARYA 3UFYA 3IVTA 2YIHA 1JDDA 3SCSA 1EP1A 3CNYA 1MQQA 1J4EA 4K39A 3QTGA 4GGBA 4L1XA 3U3HA 3HV9A 3UA3A 3GAYA 2RJGA 2DSZA 3H54A 3PZOA 4PTVA 2RGMA 2ZXQA 3SCRA 3DI0A 1XYBA 5L9FA 2D2HA 3WZ0E 1YPIA 1XL9A 2ZRZA 3LB0A 3KL3A 4R53A 3E1F1 4PTMA 4GQRA 3H8AA 3QVQA 4MDOA 4A8LA 2C14A 3MANA 2HPMA 4K68A 2HK0A 3W7CA 3WNMA 3BCDA 3F1QA 2NX3A 3LLFA 5REQB 4C7FA 3KBSA 1ZJBA 3PWIA 4FX7A 4NL1A 2GUUA 1RPKA 4DNHA 2FMOA 1ZALA 3VKKA 1JJKA 1H50A 1KTBA 1YXDA 3DGRA 5CPTA 1RV8A 3AHVA 1QI0A 5H8UA 4F2TA 4ZB2A 4NJIA 3VE9A 9XIAA 2WHKA 4DRSA 2XG9A 2NQ9A 4Z2IA 5DY2A 1Z69A 2FLIA 2Y0FA 4EXQA 1FA2A 3A23A 1KBLA 4GNKB 2J7FA 4LB3A 1EUNA 1I0DA 5FIPA 5BW6A 1O7AA 3T55A 4QAWA 3BZGA 1QASA 4NASA 3WELA 4LALA 2NW0A 5JH2A 5D32A 2DT2A 3DHUA 4N4PA 3VUPA 4P5UA 5LIYX 4KT2A 1J01A 2VX6A 4GI6A 1C90A 1XGDA 2WJDA 3FEQA 3P7YA 3DX5A 5D2XA 3LPOA 1LORA 2GJNA 1H4PA 3BGAA 3T0CA 3CV1A 5CPOA 3NSMA 3AS1A 4DUOA 1DORA 2V63A 5KETA 1SU5A 1XHGA 4FLOA 4U28A 1OYAA 3STGA 4B3ZA 4S3DA 2L5HA 3CHEA 4Z1AA 3VNLA 1A5LC 1SJCA 2DFAA 1CECA 1V3IA 3N2TA 1PKYA 1GHRA 4HZMA 1XDJA 3VGFA 3DESA 1JPHA 3AWNA 3ZT7A 4KWUA 1JZ6A 1YPFA 2PDYA 2PWGA 2VR4A 2JF7A 4HSOA 1HN1A 1V0LA 5A6TC 3W1UA 4K7VA 2OO6A 4AQLA 2JK2A 3FJ6A 3MZ2A 3CPGA 3T9PA 4KRTA 4QS6A 1ZJHA 2FZ9A 2C6QA 3NZGA 3CHFA 2I57A 8CGTA 3MHFA 1PIGA 2WLYA 3E0IA 2EO7A 3MCOA 4PMVA 3W2KA 1MW0A 4DO7A 2OMAA 2RDUA 1CT5A 2DW6A 4HPGA 2ISVA 2ACRA 1B3ZA 2D2GA 3GUGA 3VPLA 1QK2A 2HZGA 2VD9A 3GTIA 2Y8VA 5G1YA 3O0FA 1A49A 1E0XA 3AWOA 1OWQA 1E6SM 1Z48A 5K2ZA 2WHMA 2XWEA 3UQNA 2G97A 3GM8A 2VXNA 1CI1A 4NG3A 2WCGA 4P7NA 4DZAA 2HEJA 5C0QA 3W1TA 4WIWA 2GQAA 3TW6A 3G1RA 5C6MA 7A3HA 3HPSA 1GOMA 2J4GA 4L9ZA 3WNOA 3EGJA 2D24A 3TTQA 3P62A 3ABSA 2JF6A 3SQSA 2YBUA 4QNEA 4MKNA 1O12A 3OZPA 1JNEA 2BY0A 4DWSA 4O16A 1VCVA 1YW1A 5DANA 1B9BA 2B0MA 3MW7A 2OX1A 4C6KA 4S2CA 2TODA 3W76A 5C9XA 1TWSA 2ALDA 3AMLA 3EPNA 2V3DA 4MJZA 2Q71A 4BQ3A 3ZT6A 1W9UA 1E55A 2BHUA 3H2OA 4Z1DA 3AXXA 2C8NA 1X96A 5C70A 4XISA 2AKZA 1B3VA 3C8NA 4ZCWA 4D8AA 2ZICA 4QDMA 3UVAA 4M19A 1JPKA 4RUBA 5G2HA 3WLQA 5E6ZA 3PBYA 4H9XA 3EOLA 2JFEX 4A3RA 5H8PA 1J0HA 1EF2A 4RPPA 5D03A 4K37A 1YHTA 3H70A 1QXLA 4DZHA 4B91A 4O1EA 4X60A 2WVSA 3AIBA 1W1VA 2ZVIA 4CGTA 3HGSA 1V6YA 1T96A 3TC7A 1QOQA 4LUJA 3THDA 4DN1A 4UZSA 3NXFA 1LBFA 4IXXA 3N3TA 2AGKA 5LXXA 4L1GA 5C55A 4B3KA 1E0UA 2HXTA 4GXMA 4JIRA 1YYAA 1NP0A 4XZNX 2O4MA 1FWHC 2OT1A 3OW1A 4JYDA 1FCBA 3RR4A 1QWGA 2F6UA 4ERIA 1Q4NX 4W93A 4RCXA 1F3EA 3UR8A 4E4UA 3P61A 2BP1A 4A35A 1R9XA 4B5WA 3SI9A 3NQ6A 4N0RA 2PTXA 4GCAA 3L7RA 3K5XA 3WEZA 1DXFA 4Z1CA 4MNMA 2I16A 2AL2B 1LOLA 1E43A 1DJWA 2NT1A 4H9TA 2VUNA 3IIXA 2PTZA 1TWWA 2J25A 3BW3A 1JXKA 5A8GA 3QC3A 4AWUA 4MHBA 3W75A 1O6IA 1UD5A 2P3EA 3HQOA 3NGJA 3P8JA 1E56A 3SQMA 2PDBA 1GG0A 2ZA2A 4UB9A 4DWSC 4PGLA 3SADA 4JAWA 3KVKA 2QCLA 2J13A 3VNZA 1UR1A 1M7XA 1H49A 2XIQA 1LBLA 2NV9A 1R2RA 1XIBA 1QAPA 5DT7A 2JIEA 4OHQA 3K13A 5FJTA 4HKPA 4NUWA 2C1GA 3HQNA 3UWEA 4AD2A 1XRSA 4A3YA 2PSNA 4G2DA 1UBPC 3ONCA 2WC4A 3OLDA 2YCKX 4DUXA 4LT9A 2QCMA 4WVXA 1AVAA 4C1NA 1ODUA 3MUZ1 2OZ0A 1XYLA 4JL2A 4XAZA 3OO2A 3O0KA 1ZAIA 1PJ9A 1B0IA 1VLIA 3LENA 1OFRA 4ICNA 2DW7A 4WR3A 2GGGA 3W1NA 3ZM8A 4ZFCA 1XSIA 3DXIA 1F61A 5DF0A 2MANA 2YGYA 5ABGA 5EMJA 2C79A 2QUUA 3A3WA 1UZ4A 2YFNA 1VRDA 3RN6A 1I4NA 1IEXA 2PFHA 3VOHA 3QY6A 1HTIA 2WYSA 4H8HA 3EPMA 1ZCCA 3CQHA 1YQ2A 5FD0A 1EDTA 1DWIM 1CB2A 4CD5A 2BVDA 1C9WA 2JKAA 3E2QA 1X6UA 3T09A 1GVYA 1Q65A 3N2MA 4GO8A 1T41A 3VX0A 1J96A 4QQUA 3WMSA 3AZTA 2QDHA 2X1IA 2HDJA 3U6WA 1XC4A 4LEQA 2QAFA 3NQFA 4IIFA 1WAUA 3QQWA 4AY1A 3S9IA 4FR1A 3SW6A 3B8IA 2Z1WA 4E4FA 2Z00A 3AAMA 4MPKA 4YL2A 5HJXA 1P1MA 3DFNA 4R9OA 2JGQA 3EMQA 1OX6A 4YIWA 2QJNA 3A64A 3T0AA 4R7OA 3KX6A 3WJYA 1ML1A 4BK9A 2POZA 3UBPC 3EWYA 4FSAA 1DBTA 2EG7A 4EK7A 5F2MA 5LGZA 3VCNA 1PIFA 3W6YA 1QHZA 3DENA 1W56A 1KTCA 5DBUA 1NVMA 5AHEA 5I78A 1KRAC 1QPRA 1POJA 3KRZA 5JQ9A 3TH6A 3W73A 3B8DA 1HT6A 2QPUA 3QXBA 2C16A 5HR6A 3SGGA 3OTRA 3LSCA 1MSSA 4HPJA 2BNJA 4H1ZA 4HNOA 3R94A 1NTHA 3QN3A 3GWQA 1JAEA 3Q94A 4N9EA 3O7UA 3LMYA 5AHMA 5I23A 2R91A 5CQ1A 1VFHA 1UWQA 2ZWYA 1EO5A 4ML9A 3S6TA 3QHNA 1PO9A 4J4KA 1F6KA 1VJSA 3AFBA 5D2YA 5BMWA 4MLJA 3V4BA 3TK7A 4PTDA 3NOYA 4ENLA 4F0MA 4QG9A 5CZSA 4ORIA 3TOYA 5HMFA 2GQ3A 1T7LA 3LQLA 3WH6A 4C5ZA 1YE6A 2EPNA 2TPSA 3ORWA 3QYSA 1MMFA 1JFXA 2P5NA 5HUPA 1TKKA 1S2VA 3QR1A 3LHYA 3AXKA 1M6JA 3GXPA 5A6AA 4AVOA 2EF9A 1TMQA 3KM8A 5HJLA 4HMEA 1FXPA 3RPTA 2WQDA 1MW2A 4PEKA 4X9YA 2X16A 2BDQA 4HJFA 1R3QA 1BKSA 4XO6A 3S46A 4MYXA 3QPEA 3LRLA 4J3XA 3ZJ6A 2GGIA 2DQXA 1PZ1A 1HUVA 1BGAA 1HX0A 3EX2A 3FN9A 2VFEA 4Q7BA 1RBAA 4EX4A 4MKSA 1OG0A 4KMQA 4DXKA 1MVYA 3S83A 3G8RA 4X61A 3KE0A 1E5NA 1PL9A 2JALA 2XUCA 1HJSA 3HBLA 1KRBC 2Q6ZA 1IEWA 2UY3A 4BHYA 3SUWA 3EDKA 3RFAA 1E6RA 1IGWA 4Q4KA 3VI2A 1J6PA 3H7VA 2GDVA 1WA3A 5A95A 4H8UA 4NAFA 1U22A 3QR0A 1OF6A 4IWWA 3RIKA 2Z29A 5FEPA 4HQVA 3T07A 1BRLA 2H8XA 1U33A 1UC4A 5BU6A 1AQ0A 2FYMA 5GNZA 4DUVA 3PJXA 4LAKA 2HVNA 1DYSA 2BLEA 1UQYA 1LL7A 3QV6A 1FH9A 4XAPA 2ZXAA 2KX9A 4REQA 4UTTC 5HUOA 5KZEA 2OZTA 2VDHA 3VE7A 3TIMA 3W23A 4I8YA 4LS2A 4IPNB 1QW7A 2BY1A 1TV7A 2IS7A 4M5PA 1L0PA 2XFWA 4HMNA 1PTDA 1P6WA 1L6GA 4ZVJA 2FZMA 2E77A 4CCEA 3ALFA 2I5GA 4WCJA 1V51A 1VYSX 2XIMA 1XBXA 3ZJKA 5DN1A 1XYMA 2C7FA 1B1YA 2PWUA 2WKGA 4HN8A 3W6MA 4IH3A 4ATDA 2QNEA 4XBKA 3VD3A 4J9JA 4PUJA 4HOZA 1QJWA 1S2UA 2Y24A 4UTIA 4KQNA 2WWCA 3SECA 3VDHA 2CU0A 2GDQA 1NU5A 3G8EA 4C6EA 5AYBA 1LL6A 1UJPA 3MO7A 1O66A 1W17A 4FXRA 4PBEA 3I65A 1VEPA 3GXMA 1JFHA 3E3HA 4DJEC 4FF5A 1JDAA 1H7NA 3GNRA 4I9TA 4Y9AA 3NOEA 4LVGA 2AQOA 4DI8A 4DBUA 3BC9A 1A3XA 2VGFA 4H9UA 1WUFA 1PX4A 3AIWA 4F66A 3TYCA 1QFEA 1IEQA 5AYYA 3LXBA 5FACA 1XD1A 4GKLA 1W2VA 1ZL1A 2Y8UA 4YU1A 2QCFA 1FDYA 2QUTA 3AHZA 1EHAA 5C9UA 5FESA 2QULA 4WSJA 3RLHA 2ZZ3A 1M03A 4CNOA 3TAKA 1KB3A 2C13A 4GUHA 5FI8A 1GKRA 3MHUA 2FFIA 4YCOA 2Z4GA 1CXLA 3C52A 4WY0F 4S2BA 3APGA 3CB8A 3NDOA 1ITQA 2VR5A 2OEKA 3M5VA 4RW3A 1E1CA 4M81A 2GVLA 1WB0A 4R33A 4MIMA 1EJ7L 4DAFA 3FGCB 4A3QA 4JY8A 4A21A 1ZU8A 3WNPA 2NQHA 3ONBA 3OYXA 4U5KA 4P8XA 4FLQA 4WK9A 3GTNA 2G37A 1US3A 3IIOA 4LY8A 2F2KA 3NM3A 4Y7EA 1N8IA 3NVDA 1ZBKA 4PCPA 2FFCA 2CIPA 4DBSA 4GY7A 2QPSA 5M2FX 3PZNA 2XISA 3ZXWA 1JZ3A 1VCGA 1C7SA 3ZWTA 4RZ5A 5ABHA 2X1SA 1IEIA 1PKMA 1H61A 3VNJA 1KNWA 1OCJA 3APTA 4U33A 2ANUA 4TO8A 2Q01A 3NA8A 3NNTA 2WBGA 3BLDA 3KS5A 3WQPA 3R79A 3OB8A 3KOYA 2DH3A 3UGRA 3F2BA 5E9AA 4FI4A 4V15A 3NUKA 1JVNA 2FJUB 2GJLA 2J24A 4TU1A 1KRCC 1XBVA 2R24A 3E0LA 2EG6A 3NIYA 3TEVA 2ZRVA 1IYXA 3JRKA 4CUCA 1R38A 4J27A 1MQRA 4L64A 1V7AA 1WZLA 4Z2KA 2DZWA 2XM2A 3QMTA 3QSRA 1RCOB 1Q85A 1W5NA 4XWUA 4CD8A 5G2IA 1GOIA 1QO5A 4HGXA 5LIWX 3CTLA 4CQ9A 4A05A 4Q7IA 1OC6A 4BI7A 1GEQA 2VGGA 4KWWA 3T7VA 3TV8A 4C6OA 5CKSA 4EE9A 4DF1A 3OLIA 1EJUC 2YL8A 2E3ZA 1RY0A 4BKNA 3VYLA 3VMPA 1W9PA 3CT2A 3NFUA 4N2YA 1GQKA 3WQVA 2OJPA 5TAOA 1EJVC 4MMWA 2ABBA 3EXSA 4G8TA 2CW6A 2J7CA 1LLZA 4O4WA 4LF2A 2FPYA 1E5JA 3KTSA 4PB5A 3GHUA 2ZX5A 3L65A 3G24A 5A8OA 3GLCA 1TG7A 1LRTA 2Y7DA 3VGBA 4H6QA 4XIMA 4JTEA 3S4TA 4AB4A 4U3AA 4ACYA 5IDZA 5G1MA 3B9AA 1IXPA 1XFCA 1JDFA 2VFDA 2PDHA 2YB4A 4US6A 3B40A 3UCDA 4QISA 4OU1A 4EAMA 3N34A 1TELA 3TN3A 2CLFA 2FZ8A 3L0KA 3HMCA 3QKEA 3P0XA 1SMDA 3IJ6A 3HG2A 3F4VA 4NNAA 1TTIA 3WNKA 4M80A 3CUJA 3CGTA 4YXGA 2PDKA 3WIJA 4JNYA 1Y7VA 3EAUA 3ALGA 1NDZA 3W1RA 3NO5A 3UGVA 1QPQA 2O9OA 4R85A 1R8LA 3CMJA 4XAYA 2Q09A 1W3IA 3BANA 2J7HA 2H6RA 1UBSA 3ZLHA 3FXGA 3T2OA 1K3UA 3V18A 1TMLA 2OODA 2NQLA 3M0LA 2D22A 2OVLA 2CLPA 2QJJA 1M7OA 1HL9A 1WP6A 5EY5A 3JR2A 1KBKA 1YNQA 4W89A 3M0HA 3SN1A 2XFFA 3UPBA 4CCZA 5E0KA 4IF2A 1A5AA 3VUSA 1RLDA 2QKFA 2YB1A 3TX9A 3VIPA 3C0JA 1PE1A 1TR9A 3LPFA 3OVQA 1Z6KA 4IFKB 2ZZ7A 2IW0A 2BGNE 3PZUA 4R7WA 1EOKA 4KF1A 2Y7EA 2VWTA 1VENA 1QW9A 3TJXA 1WPCA 5HNUA 1YLVA 2KZHA 3WUFA 2FH8A 1JYVA 1W3HA 3VOGA 2VZUA 4ZE5A 4NKCA 2Y5JA 3CYJA 5BWAA 1YTKA 1OZQA 4M7TA 4TX6A 4ZA0A 4O1BA 4ORMA 2E68A 1Z8AA 3H2EA 1J2WA 3IANA 3VIKA 2REQB 2H9AB 4GHRA 1GVOA 1AJ2A 2A7NA 1F4AA 3M41A 5AFDA 1PZ3A 3R58A 2GVGA 2WCAA 2REQA 2GDUA 1SQ7A 2NT0A 1D3HA 2F9RA 1M7PA 5LIUX 1XIFA 3KTCA 1WCGA 3ARSA 3ZQ9A 2W79A 2NV2A 4Q4PA 3VKCA 5A6KA 3L5LA 3C2RA 3FV9A 3U4AA 2G3IA 3EKGA 2VTFA 5I3JA 5LNSA 2X0HA 2OR2A 3TOPA 4U2YA 2E8ZA 2XZ9A 4UUIA 4Y9OA 2ZUNA 3UEQA 5CZKA 1KCKA 1W1YA 2XZ7A 3LHZA 4AU0A 2XIIA 4AG0A 3ITOA 2D73A 2ODOA 4QE4A 3MUIA 2DZAA 3HTWA 3RX3A 4I9JA 3CZLA 5AC8A 3KOFA 4C7DA 3VAVA 3QZEA 1UOZA 4IUOA 4PRTA 4FR6A 4BS0A 4YCPA 4N6FA 1MEWA 2CWXA 2NV1A 5F2IA 2Q8ZA 1NSJA 4AEOA 3CUIA 3UWZA 4KCVA 1C8VA 4IFOA 1M68A 1Q2SA 4DUWA 4RLIA 4ZO6A 3KBWA 1Q2RA 4UTTA 1ITCA 4PH6A 4GC3A 3KEHA 1NEYA 4C6NA 5FEXA 4BF7A 4AX6A 3N9RA 2W5FA 4RXFA 4QAIA 4M51A 4L7ZA 3NZPA 4MPQA 3OVPA 1V79A 4Z08A 2PDXA 4EACA 4OOUA 3CIVA 4IX2A 4Q8PA 4AEFA 3N29A 4MLRA 4MWAB 2JKEA 2WVTA 5BOFA 1BXBA 3OZMA 2Z1VA 5AC6A 1ZENA 3H4XA 1HO4A 4E3TA 3N9SA 1KO0A 3G22A 2VZOA 3IARA 1CLKA 5FL0A 4DWSB 1UH2A 1YDVA 3JW7A 3ABXA 3GD6A 2B7QA 1SM9A 3B0XA 4G7EA 3PULA 1XH2A 4MJ4A 3N2CA 1V6UA 1TFVA 3U57A 3BOXA 1AH4A 1GCYA 2NX9A 5D9PA 4HVXA 2PTDA 3PWGA 3IWPA 3GG8A 3ZR5A 4UR7A 2PWVA 3AU2A 1PEZA 4KERA 2GVJA 4X3ZA 3UG3A 1DWAM 1LQAA 4QSFA 3R4IA 4O19A 2CBIA 3CAQA 1B9ZA 2ZUMA 3M0YA 1K4HA 1OM0A 3G3DA 3DFSA 3KWXA 2O9TA 5BCAA 2VZVA 3I68A 1YDOA 4AWEA 1JCYA 2ZUVA 4A8IA 3LHVA 1F8MA 4JIQA 5DEZA 3LHUA 4H19A 3B9OA 5EMMA 3P3BA 4UNKA 1VB9A