3H55A

Crystal structure of human alpha-n-acetylgalactosaminidase, complex with galactose
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
387
structure length
387
Chain Sequence
b'LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-N-acetylgalactosaminidase
publication title The 1.9 a structure of human alpha-N-acetylgalactosaminidase: The molecular basis of Schindler and Kanzaki diseases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 127
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3h55A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3h55A01
4QITA 3UWUA 2NSXA 1C9DA 1ONRA 4UFLA 1XSJA 3M5YA 1TIMA 3CPUA 4UTJA 2I1OA 1DJNA 4I7WA 2VC6A 2O7QA 3TAOA 4CQ8A 1G1YA 4LQ1A 2CZFA 3M07A 4J9JA 1JRBA 3LLFA 3IVSA 1VS1A 5DY2A 3PF3A 1MW3A 3IGXA 1AW2A 2OYLA 3USBA 4ZMGA 2F7FA 4GI9A 4L4LA 1Q6RA 4XTIA 1AL7A 3HO8A 2A6NA 1MEWA 1YYAA 3L4WA 5I3HA 4M56A 2AAMA 5AB3A 2CLLA 2NXIA 3TCEA 4EF8A 1CXIA 5TBOA 1KM2A 1J2WA 2GJNA 3WFZA 2WSRA 2OSXA 1EUAA 2C13A 4TO8A 5A2AA 1KTNA 4X22A 1R2TA 3G3DA 3ZT6A 3O6DA 1B4KA 1M6JA 4DXVA 1ZENA 1WPCA 3G3MA 4IOTA 2OYMA 1V3JA 3CZKA 2QCCA 1NVMA 4X9YA 5CPMA 3ATYA 4DQWA 4GI6A 4CLMA 3I7SA 1CGWA 1Z41A 2Y88A 1CGXA 2QAFA 3ZS4A 3MP5A 5IBXC 1DBTA 4Z1DA 5K4XA 2ZWZA 4MPQA 2YZRA 3TW6A 1VYSX 1FWWA 5HQEA 4WJEA 4GQRA 4HPXA 3KRZA 4MKNA 4AF0A 2YGYA 3TH6A 2ZQ0A 3M0ZA 2Y6ZA 1IZJA 3GYEA 4UQCA 3W1AA 5HULA 3S9YA 2A6LA 3LB0A 4XZ9A 1W37A 5AHNA 3W7PA 1HXKA 1KXTA 1QOPA 4WY0A 1NOFA 4WOQA 2YOCA 2FFCA 1UD6A 3R5EA 3DFTA 4NX5A 2VFFA 4EWND 1UKTA 3ECQA 3KEHA 1VYRA 3W3OA 3N73A 4TU1A 1W3NA 4LU0A 3P8IA 4H8UA 3L0KA 1DOSA 4GBUA 5DN1A 3T4CA 2QPUA 1KWGA 3K30A 3LTSA 4FX8A 1QFEA 4AB4A 2FB2A 4N9DA 1K7XA 2DZTA 2QCMA 1ADOA 4J3WA 2QCGA 5F1UA 3D4ZA 1KFJA 3PSVA 3NPUA 5D33A 3ABRA 1X6UA 3W7RA 5E9AA 4A2SA 1F5ZA 4U2YA 1RZMA 4AAJA 3CC1A 3NZ1A 2PWFA 1SPQA 2C15A 3N2MA 3W7EA 1LTDA 3ZT7A 3BLEA 4OE7A 4FLRA 2VFEA 4RR4A 4BR1A 5HJLA 1EEPA 4DPQA 3ABOA 2G3MA 4DF0A 1G69A 3QZEA 1WAUA 3QRHA 3EXTA 3GAKA 3C2FA 4IXHA 4ZZ9A 1VLIA 1IXQA 3WNMA 1UUMA 1XCWA 2VEIA 4JIQA 3S6DA 3TXVA 3LXBA 1FXQA 1JUKA 4O15A 2EGZA 3NOEA 3BG3A 4Y90A 2XWEA 1MVYA 5I0DA 1T0OA 1BLIA 4UQ9A 1LZOA 3GZ3A 2VENA 3VSUA 2NXHA 1EB3A 3DAQA 1QOQA 1JIBA 2CZDA 3EEGA 3GR8A 5GVJA 4JTJA 2Y89A 4QISA 1RQEA 3ZWSA 4H7VA 1KM6A 1AMYA 1P0KA 1I2PA 1W0MA 3EDJA 3WJZA 1GZGA 5F2IA 1BPLB 3W7JA 5MHBA 1HFBA 1SO6A 1KXQA 3IK2A 2Z6JA 1RR2A 3NGJA 3DENA 1KGXA 3TSBA 2Y61A 3AJ7A 1KTBA 2P0OA 3ZSTA 3O63A 4QIUA 5E0KA 4GWEA 5U4NA 4CQ9A 3B4UA 4NX0A 2ALDA 1FY6A 5AHFA 8TIMA 3KXQA 4JTFA 3IEBA 3BMVA 1Q6LA 3E0IA 3B0UX 3UEQA 3EX4A 1OT2A 2WNNA 1TPC1 1CXHA 1PL9A 3YPIA 1AW5A 4ZQRA 2GQAA 3M7WA 2QMKA 3DKLA 1T99A 2EHHA 2WNQA 4WUIA 3LX9A 1VQTA 2ZRXA 1SZNA 2Y7GA 4OBTA 1IIGA 3U2OA 4ADSA 1WX0A 1QHPA 3GNDA 3S8HA 1U2YA 5DBTA 3BCFA 5LHFA 3ZSSA 1H60A 5KEZA 1R34A 3K8KA 1OFAA 1OX4B 1P4CA 2YCEA 3RF9A 3RFAA 3W74A 3NQAA 1FCBA 2X2JA 3TJXA 4KWWA 1W3IA 4M6VA 1IIHA 2B7PA 1QDSA 3QW3A 4NUWA 3B8DA 5D2VA 1PS3A 1LLWA 4I9AA 3L4VA 1JR1A 3PBYA 3TQVA 2X1SA 1TPEA 3WEMA 4IWWA 1BSIA 2FHBA 2W79A 2YYTA 4POCA 2E68A 2YW4A 1LORA 4GXMA 1XV8A 4QQ3A 5A2BA 2F7QA 5D2XA 3S5ZA 4OQVA 5BMWA 3UCQA 2CZ5A 1RPKA 1VJIA 1H3GA 1K8YA 1EA0A 2RH9A 2WVTA 4QSHA 1VCFA 5G2IA 1KV5A 2V3FA 2JBMA 1TQSA 2TMDA 4UTKA 1V5XA 4HT3A 4GO8A 3TFCA 1WP6A 2OW7A 3WDIA 1GG1A 1V3KA 4GNJA 4MOZA 4O0KA 3AMKA 2D0HA 1D7FA 1KBJA 3SGUA 3DFQA 3Q37A 5A5WA 3DX4A 4OJYA 3UY7A 4O16A 4ICNA 3W70A 5DCDA 2BHUA 3UG4A 2QCEA 4AYGA 1KM1A 3QMTA 4HNNA 4FO4A 4LS2A 3G8EA 1AQMA 1C8VA 4ML9A 1F6KA 3P82A 4Q32A 3UY8A 5E0FA 2Y7DA 3TDFA 1I2NA 4FEZA 3VGDA 1TQXA 2VOMA 4MZ8A 3W7GA 3A21A 2BY0A 2XWDA 1OK4A 3L2LA 2J24A 4MY1A 3IVUA 3L68A 3OLDA 2P1FA 2ABAA 3E12A 2ZUTA 3VGBA 4HSNA 1OT1A 2ZUSA 1LRNA 1ZNNA 1D3GA 4YWIA 1MXDA 5HXMA 1JD7A 2DH3A 3G1YA 3P74A 4FIQA 1NSJA 3R89A 3L65A 3BSGA 3SW6A 2Y2WA 3RU6A 2VUYA 1UD5A 3NPXA 2PURA 1WZMA 4MUZA 3W9ZA 1UKSA 3F1QA 3OA3A 1Q4NX 4HNUA 5C6MA 3FYPA 5LGXA 3LGEA 3VMPA 1B4EA 5F4XA 1VAHA 4N9EA 5F4WA 1JCXA 4UFHA 4MYAA 3U6WA 4JTHA 2BY3A 3CEPA 3WN6A 3NQDA 3E49A 1HO1A 4XBSA 4LVGA 3JR2A 1WZLA 3CM4A 2WOQA 1RP8A 4QNEA 2HS6A 4UFJA 3C52A 1IV8A 4Y96A 4AH7A 3FAWA 5AFDA 2V2DA 2NZLA 2P10A 1B9BA 1QW8A 1CXLA 1UH2A 3GXPA 1YPIA 5DXXA 2TSYA 1I45A 2PRMA 1ALDA 2WSQA 3S5YA 4GUHA 4A22A 3MI2A 3C2EA 5HWJA 4MYXA 1SFLA 5F4SA 3MI6A 3C2RA 2YYUA 3NQ8A 3A4AA 1AL8A 1S5TA 1ZAIA 2A2IA 3KAOA 3Q94A 2OSYA 2QJIA 4FXSA 5D37A 5DCEA 1KBKA 4AIEA 3P5YA 3TNOA 4R53A 2VKZG 1TO3A 1Q6QA 4DF2A 1KFEA 3EJUA 4HKPA 4K6AA 2E6FA 5TIMA 4CQAA 1OYCA 3IIXA 3L0NA 4GO9A 1HO4A 4JX5A 4CKQA 2Y62A 3W2LA 1A5CA 4BF9A 5I3FA 1MW2A 4GJ1A 4C1KA 1PZ2A 1FXPA 1KCLA 1RVGA 2EJ1A 1KFBA 5CGTA 1GVIA 1M7XA 3LHZA 3BG5A 4UTUA 3W75A 5FEXA 3L4TA 1LWHA 2EADA 2ISWA 1MFVA 1PZ3A 1JVNA 3VE9A 3BVVA 5I23A 1JDDA 3A23A 2EQDA 5CLTA 4O18A 3LI1A 4K39A 5AC7A 1XFBA 3BO9A 3C61A 2BXYA 1KM3A 2V30A 3W1RA 3HG5A 4X2RA 2V0TA 1YLVA 4HNVA 1JF6A 3EDEA 2ZUVA 2NX9A 4NQ1A 3BLIA 3W84A 3HMJG 4O0ZA 1K7EA 5I3KA 4U2ZA 3KX6A 1WQ5A 1MWOA 2F84A 5I3GA 3LCGA 3QF0A 4JDBA 4UXDA 3PVFA 1H7RA 3FKRA 3S0CA 3I68A 3VGHA 3NO5A 3NQEA 1UBSA 2Y4SA 2JKPA 1L0PA 4JTTA 2V82A 3A24A 3W2JA 3GBEA 3ZOAA 3Q2DA 4G1KA 3TQ0A 4L4MA 5G4EA 2D73A 1V3MA 1MEIA 3Q58A 3HQ1A 3LCWA 4M6PA 3TMQA 4E38A 1TRIA 4JY9A 1SMDA 5T26A 5EA9A 4AW7A 1JJKA 1YADA 3LDVA 5TQLA 1KCKA 2BTMA 1OSEA 3SFKA 2EO7A 2E5BA 2NV2A 1TTJA 1HL8A 5D2WA 5J5RA 1O7DC 4PEKA 3DKJA 3UWYA 1QAPA 1OFBA 5LKYA 3NL3A 3PY2A 3U8GA 3LTPA 1SSDA 4ZQMA 1YDVA 1LWJA 1U33A 3EKLA 3LV5A 4H6KA 4H4IA 3MWAA 4UMAA 2E6DA 4MJZA 4BA0A 1N55A 2X1RA 1QI5A 4M5PA 5CSRA 3KVMA 4IGHA 2UV8G 4JYEA 3B0VC 3P60A 5HNRA 4HPJA 4O52A 4ALDA 4TX9A 2PWGA 1WOBA 3QM3A 2G3NA 1RP9A 1H50A 2TAAA 1HWWA 4OWGA 5CGQA 4NJGA 3BAJA 4CN1A 3TE9A 3QMSA 2NWRA 2FE0A 3BCDA 1UUOA 2EKCA 1H5YA 3IIVA 2ZRVA 2V9DA 4TVUA 1ZJAA 3VMNA 2FHCA 5CZ0A 1JI1A 3WNLA 3D4YA 1KW1A 1SR9A 1BVNP 2VFIA 3C56A 2E5CA 1OX5A 1RQHA 3CWOX 3N34A 1PE1A 4O1AA 1PV8A 3QFEA 1LBFA 1JCNA 6ALDA 4UOZA 4FF7A 3KHJA 1VR6A 2YFNA 2RFGA 3BUIA 5FF7A 2DIJA 4N6EA 1HNYA 2B4GA 1HTYA 3CHVA 3IV3A 1SO3A 2QJGA 1CI1A 1R2RA 4JY8A 4O10A 2E77A 1WZKA 2F1BA 2FTPA 2QMJA 3R2GA 4NJKA 3QC3A 2ZE0A 4UCGA 3PUOA 2PWHA 3BLKA 3V1PA 5FF0A 1O4UA 3DI1A 5HUOA 4WQ6A 4Z1AA 4X9SA 3PUEA 5BMXA 3L4YA 3KVJA 2CLMA 3S5NA 3KL0A 1IXOA 3CWNA 2RDUA 1F6PA 1H7NA 1X7FA 3L21A 4LRTA 3BW2A 4J3XA 3P84A 3CTLA 4NU7A 2E6YA 3W07A 1UH3A 1KGUA 3F03K 4KFPA 4WD0A 3WK0A 3PWAA 3WNNA 4HP5A 1DQXA 2VRKA 1FBAA 4M19A 1TCDA 1OX6A 1QPOA 1AK5A 3VU2A 1QO2A 2ZXBA 3E96A 3MUXA 3LHYA 1LRQA 5A6MA 4AEOA 4CNOA 2YIHA 5F7UA 1CGYA 1KFCA 4QJ1A 3NQ2A 1EUNA 4LV9A 4U4MA 1CYGA 1P6WA 1JCMP 2ZDRA 4AF0B 1X1OA 3HPXA 2XVKA 2ZA3A 4N9BA 3KL3A 2CHNA 1I8JA 4LVDA 3HPZA 4MZYA 3P7YA 2FJKA 4WY0B 1XI3A 1N7KA 1Q45A 4UC5A 3UZ5A 1LM1A 3G1DA 3BGJA 1TRDA 1X1ZA 5BW6A 4UTHA 4DF1A 4AWUA 1JRCA 4FIRA 1CPUA 1F73A 3M16A 3LCXA 4GUIA 4UQAA 4PTNA 3WFAA 4R34A 3NQMA 4JEQA 1EWEA 1K3UA 5U7SA 1JQVA 4JS3A 5CPNA 1OFQA 1GTHA 1XM3A 1SU5A 4NT0A 5KMYA 4D2JA 5G4WA 4CCDA 4QM1A 4DBEA 1IXNA 4JDYA 1E51A 4NJIA 3DHUA 1JCJA 2Y70A 7TAAA 1OVDA 5AOUA 1FCUA 2DH2A 1YTEA 4O57A 1KM4A 3HGJA 4XKYA 1PPIA 1OF8A 3GR7A 4MFEA 2A7PA 1ICSA 3DFNA 1CGUA 3G0SA 3TMLA 1ICPA 3MBFA 5CZJA 2C18A 1CLVA 2A21A 3IIZA 2QDGA 4ZQPA 3SZ8A 3MHUA 3KRSA 4UTTA 1ZALA 2NT1A 4GUJA 3EDDA 3FIGA 1UKQA 2ZA2A 2Y63A 3L4ZA 3GXTA 3SECA 5BNKA 5CPOA 4EIVA 4LC8A 3M1ZA 2G5WA 1GQNA 3STGA 5KTLA 4OKDA 4U33A 1U83A 2QUTA 4AHOA 3WMSA 4R33A 1H7WA 2DIEA 5D2YA 1NAL1 3H54A 1TQVA 1H7PA 5AHIA 1I4NA 2B0MA 1H7XA 3HF3A 4FX6M 1VPXA 3NM3A 4O17A 4ZQOA 1PCKA 5F2GA 4GE8A 3HBLA 2AGKA 2ZRWA 2EEXA 1VYPX 2RDTA 1SW7A 2CLEA 1JI2A 3EDFA 3M44A 3L66A 3UWWA 1BF2A 3II1A 1IF2A 3CIXA 3KVLA 4LTSA 2FHFA 1PHQA 3EX1A 5E6ZA 3LPOA 1UJPA 4K36A 3G1HA 1VFOA 4RZ4A 4FNQA 4JCMA 1XBZA 3W87A 2Q3OA 2A7NA 4N4QA 4LRSA 3LHTA 4HHPA 4ZQCA 2BY2A 1G7UA 3W1PA 2FLIA 1M7PA 2DZVA 2DZXA 3EWXA 4NI3A 3PR2A 4IMFA 2D0FA 1AG1O 3BW3A 3BVTA 1OK6A 2B7NA 2W6RA 1OB0A 3NM1A 1ME7A 3WJSA 5LGZA 1J0HA 1WOAA 2QKFA 5G2WA 1THFD 3CZEA 1Y7VA 3DHPA 1L9WA 3CQ0A 3PS7A 2GUYA 1MXGA 4ATWA 3TQKA 3PBUA 1VHNA 1UA7A 3PC0A 4HIBA 1A53A 2E0PA 4EF9A 2PWDA 3KLLA 3JRKA 2ZZ6A 1OG0A 4NXSA 2LLEA 2YSWA 3EWWA 1AVAA 2TYSA 1IGSA 2FPTA 2CXGA 1GG0A 3A47A 3WJXA 4N02A 1S3HA 4IMDA 1CXEA 1W5MA 2JKAA 3P61A 1F7BA 2FQIA 1LROA 3EXRA 3BGGA 1DEDA 3WY1A 3DBPA 4A21A 4O14A 3TUUA 3KLKA 1TB3A 1JDAA 5FEWA 2QLYA 3O1NA 3PBVA 2R94A 3OHIA 4UTTC 2GJPA 1IXPA 5K4ZA 5CZSA 2NV1A 4IMEA 4JNMA 2QCDA 3NA8A 3QQ0A 1WDWA 5BRQA 1JXKA 3GXMA 3W38A 1TTQA 4UTLA 3W7OA 3DHDA 3QMRA 4PSPA 1HX0A 3TFXA 3O15A 4IX0A 4IXXA 4J3UA 2ZZ7A 3C8FA 3W2NA 2JKEA 2VT0A 1LOQA 1I2RA 4QAWA 3B04A 3ELFA 2F7PA 2Y7EA 1Z42A 3RLUA 2J9ZA 1MEHA 1F74A 2F7RA 2Z0IA 3T55A 2ZRZA 4WXZA 3LXAA 1FWRA 3EJSA 1AQHA 1XGZA 3NL2A 3FLUA 1XUZA 1XH0A 5A8GA 3GDLA 1EH9A 4AEFA 1EP2A 2YR1A 4YLWA 4MB1A 1QCWA 3QGVA 4TIMA 4OHQA 1XD0A 3R12A 3VX0A 2D3NA 3NQCA 1G4SA 3W7CA 3MP4A 4FNRA 1UCWA 2BXVA 1TV7A 3MP3A 2NUXA 4O54A 3DDGA 1JCLA 5E6YA 4OGZA 1VIWA 1W56A 4N6FA 4PH6A 2ZX9A 2YJQA 3GB6A 2GQ8A 4JX6A 3L5MA 3EX3A 1OFOA 1MZHA 4ZQNA 4AHQA 1XD1A 2QCHA 2DZSA 1CX9A 3G24A 3DFOA 4LY8A 1HT6A 3TU9A 4FHAA 2G97A 5K9XA 5A2CA 3O07A 1CGTA 3DFPA 3NL5A 3GXFA 2ZXDA 1GVQA 2C19A 3GKFA 5HMSA 1DV7A 2A85A 3HG3A 3GDKA 2WV8A 1N8FA 1Q6OA 4LVFA 2CZEA 1VB9A 5D38A 4RZ6A 1SMAA 4RV8A 3WELA 1VHCA 3UPBA 3HB9A 4GIAA 2NUWA 3W76A 4WXYA 1CIUA 3TJLA 3BAXA 1QR7A 3TXZA 3BAIA 2FPYA 4JTUA 4Q4KA 1KWKA 2GPTA 1NFBA 4RXGA 3G1SA 4PCSA 1PVNA 1G67A 1TTPA 2OMAA 4IMCA 1FDJA 5DFAA 1R2SA 3EB2A 4JTLA 1OGSA 2X2HA 4K7YA 4O4WA 2WPGA 1H1YA 1V3LA 4CN6A 2VFDA 4GQQA 3OLIA 4UCFA 1BWLA 3FYOA 4WZHA 1H63A 5C55A 3GAYA 5DO8A 4RK8A 2VRQA 2GUUA 4ADTA 4TMCA 4JFWA 1RV8A 4UUIA 3W23A 3UWQA 3THAA 4RZ5A 4FLQA 1S5VA 3BG9A 4LS1A 2H8ZA 3P67A 4LOCA 4CCCA 2VEPA 3C2OA 4HA1A 3LBCA 4O13A 4LVBA 2QUVA 4IUOA 3W71A 5D09A 1KXHA 3KWXA 3FOKA 3L4UA 1YTKA 3O16A 3PB2A 4AXKA 3LOTA 5HPOA 3MYOA 2OCZA 2X2GA 1BTMA 5G2HA 3T40A 1XUUA 3VO0A 5SWUA 2Q8LA 1NF0A 3C6CA 4GUFA 5CXPA 1JFHA 1KLZA 4K8HA 3VSVA 3TROA 2EAEA 1DHPA 3GKAA 5AC6A 3PB0A 1HG3A 3IJ9A 4JD4A 6CGTA 1LYXA 1VCVA 4Z0JA 1GYNA 4HOXA 4RLIA 4KKXA 2BHZA 3ANYA 4FNTA 3BK0A 3WNKA 1YXCA 5AHEA 5KINA 2CW6A 3KVKA 2C8NA 1LLZA 4PL1A 3G1VA 1UB3A 2OZ0A 1LOSA 1T96A 2V2HA 2JGQA 4BI7A 2V3EA 2F1AA 1DKWA 3F4WA 3DU0A 3ZR4A 1TJPA 3IRDA 3TW7A 2OYKA 5HWMA 3NQ7A 3BH4A 3SY5A 4AEEA 4PA8A 3C0JA 1OFPA 3G8RA 4JL2A 3BUBA 4UOQA 3DX3A 3W7LA 3DFSA 3QYQA 2HTMA 2J6XA 4JX4A 4JN6A 3C2VA 4BWLA 3GLCA 4WSJA 3ZT5A 1QWUA 2X30A 2VFGA 1R75A 2CWNA 5EMUA 2BX7A 2CLKA 2WCSA 3OLGA 3L0GA 1PCWA 4AWSA 1R47A 3FFSA 3CTTA 2D2OA 1DHKA 1M53A 3GDRA 3VGEA 1QNVA 4NJHA 4XWUA 4HOWA 4BFAA 2OJPA 4DEFA 1AW1A 3VM5A 3I7QA 1P0NA 3ABSA 4Z1CA 1W5PA 3STFA 2QAPA 1PIIA 4JYFA 4M7TA 4UR7A 4EVZA 3CZLA 3GXIA 1BEUA 2DZWA 2DZUA 1UH4A 1QPRA 1DQWA 2ZUWA 5A6LA 3W1QA 1P1XA 4AMXA 3JS3A 4WSKA 3L5LA 2ZX7A 2J9XA 2ZZ5A 2H6RA 3INPA 2PE4A 3LHWA 5D02A 1W9XA 2ZX5A 4UNKA 3BC9A 3MO7A 3I7RA 4IPJA 2VELA 1L2UA 1MW1A 3VNDA 1EO7A 2YPIA 3K1DA 3TKFA 4CNNA 3UNDA 1CDGA 1SQ7A 2ZZ2A 3GNNA 2OX1A 3LRKA 5DELA 2BY1A 4GI8A 1DVJA 1MSSA 3KRUA 3W1XA 2A5HA 3SSJA 3DDFA 1ME9A 1ZHAA 5F2MA 3IGSA 2QJHA 3D50A 3WEOA 1XCXA 3RK8A 1G7VA 5K9CA 1JL8A 3BAKA 4K7VA 1SZFA 3L2IA 4A2RA 1R30A 3GX9A 3LBMA 2GVLA 3TSDA 4M6QA 2ZBTA 2YA0A 4GKLA 3QJAA 4LT9A 1KXVA 3EJPA 3STEA 1XBYA 2E4TA 2FIQA 1A5AA 3FJLA 3L9CA 1UD4A 3P80A 2QR6A 5I5RA 2WNZA 1A5BA 5HUPA 3TC6A 2JK2A 3KFTA 4JIPA 4UNIA 4JCLA 2QUUA 4O28A 1HL9A 7CGTA 4GINA 1PHWA 2F18A 1YXDA 2C14A 2E5DA 3MI3A 3N3MA 3W37A 2J88A 4IPIA 4NNAA 1OYBA 2E6AA 3W2UA 1H1ZA 5EPDA 3ATZA 2H90A 3CEUA 3OVPA 3QSRA 2QEZA 2NLIA 3NXFA 1DORA 4OIFA 1TPVA 3BLFA 3EDKA 5D05A 4FNPA 1P5BA 4MLJA 1VCGA 2YA1A 4XUGA 2GVYA 4H2CA 4K37A 3VKJA 4AWTA 3BLBA 4OV4A 3FJ6A 5LNSA 1TPB1 2ZRYA 1B2YA 3UD6A 4Y6GA 1ZFJA 2YW3A 3GXNA 3PAJA 1T8XA 5TD4A 3DC0A 1XL9A 2GJRA 1RQBA 1GJPA 1TPUA 3VSTA 4GC4A 3H55A 1QPNA 1QW9A 1XXXA 3MBDA 2A0NA 2V8ZA 4BWLC 2BWGA 1TMQA 2C1HA 5HINA 2ZZ4A 3VNZA 3W22A 4Y8FA 3ZWTA 1BAGA 2AQWA 1OFRA 4NZFA 4BK9A 1LCOA 2Z6IA 1D3HA 1J5TA 3DXIA 4KWVA 3M47A 3S2CA 3CZNA 3M6YA 9CGTA 4PCTA 2O7SA 3WJWA 4TMBA 3MHFA 1EA9C 3CB8A 4TR9A 2JGYA 1TPWA 5DXYA 3LCFA 3E02A 4KMQA 4NNCA 4OV9A 1ML1A 2WVVA 3LPPA 4M8UA 3A22A 1GTEA 1A47A 4P61A 1GYLA 2ABBA 4M7SA 2OW6A 3QSTA 2Z1KA 3TAKA 2XN2A 5LSMA 4NVTA 2ZUUA 4LV4A 5HDRA 3A5FA 4LW7A 4GRSA 2R91A 3EX2A 3PG9A 2Y7FA 5AYYA 4AYSA 3NAVA 3V75A 3S5OA 5L9FA 3PSWA 4Z08A 3STCA 4XKYB 2D0GA 2BHYA 3CLWA 4J28A 1OABA 1TQWA 2DZPA 4MY9A 2ZWYA 1RPXA 4O11A 1PAMA 1SUXA 2OT1A 5CSSA 2BZNA 2Q8ZA 1WO2A 3ZQ9A 3AMLA 2G96A 5I3IA 4FLSA 3LHUA 1FDZA 1XDLA 1WBHA 3RNDA 1MW0A 4DO4A 3BV4A 4R7JA 3VE7A 3UQNA 3TV8A 1SW3A 1Z48A 3IIPA 1VRDA 1EIXA 1EP1A 2X2IA 1XH2A 1VFUA 4KFOA 4LVAA 1KBBA 2ZTJA 2B7OA 4UQDA 3UG3A 2Y5EA 2QCNA 1TCMA 1YDNA 4JTEA 4JTGA 2X1UA 3A9IA 3NQGA 2BLEA 4LWWA 2V5LA 4GUGA 3G0XA 3C3NA 1LP6A 3UWVA 1G9HA 5D04C 3LCLA 4P2VA 1S46A 4YXGA 1PIGA 1O60A 2F61A 4PEEA 7TIMA 3GIYA 4I7UA 4EOUA 2YA2A 1LDCA 1VFMA 2A4AA 4XQ6A 2D3LA 1K7FA 3VFLA 4E2DA 2EPHA 1QWGA 3N9RA 3O6YX 4JFVA 3UG5A 5LNWA 1WE5A 1GVOA 1V7YA 3HG2A 4OU1A 4A3UA 3QEZA 2ZX6A 2QCLA 3LRMA 3W1MA 4X3ZA 5K3VA 1BVZA 2I9EA 3E9AA 1TPH1 1JCYA 2H3BA 2C7FA 1JXJA 3G1FA 3TIMA 2RDWA 4JFSA 5E70A 4FNUA 4E2BA 4BI6A 3BARA 1ZY9A 5CPLA 3FS2A 2ZCGA 4IX2A 4MAZA 3FAXA 4WX2A 2WCGA 3KL5A 2V81A 2FB3A 1XDMA 1ICQA 4U28A 3L4XA 1DTUA 2QCFA 2BSLA 1ZS2A 3W85A 2E9BA 1R33A 4UNLA 4NXKA 1K03A 2KZHA 4Z1BA 4HPHA 3G1XA 3IJ8A 1OJXA 2A1YA 4RJEA 1R46A 1G4PA 4S1FA 3THQA 2ZICA 3WK3A 1TSIA 4AHPA 4H8VA 2FGZA 2PC4A 3ABQA 3RLVA 1HUVA 3TR2A 3RMJA 4RX0A 5FESA 4WOZA 2OT0A 4MVAA 1KFLA 2QF7A 1C29A 3N2XA 4UMCA 4CN4A 4LUJA 1MO0A 3WENA 4AIOA 3NL6A 1QWNA 3W7NA 5AHMA 3L67A 1VJSA 2WC7A 1EO5A 1S5WA 5DCBA 3W1UA 1W3TA 3W1LA 3UWZA 1CXKA 2J9YA 4FNSA 1KA9F 3CZSA 4HSOA 1KV8A 1VC4A 4MZ1A 3EJRA 1KGWA 2QCDB 3DX2A 2YDAA 3NNTA 4FX7A 3MMTA 3W1NA 3WDJA 3FEMA 3CV5A 4W93A 3L2MA 2VEKA 2PRHA 3HOJA 1W5OA 3TTYA 3OIXA 3HJEA 4HOZA 2PWEA 3VI2A 4MY8A 1I2OA 1E3ZA 4UTMA 4UZSA 2VNCA 4J27A 2NXGA 3BVUA 3CZGA 3WY2A 4UMBA 3G22A 1KTCA 1ME8A 3VNYA 2VR5A 3BW4A 2ZIDA 2R8WA 4XTDA 4KWUA 2GVJA 3LV6A 3WNOA 1YPFA 1ZAHA 3W7DA 2BXZA 1YTDA 2ZRUA 1JUBA 3GDTA 3LCHA 4O53A 3H53A 1NF7A 4UTIA 1QI3A 3QPZA 4H3DA 3ZO9A 3B05A 1DL3A 2NWSA 3G0UA 3O6CA 2E8YA 3L5AA 2QDHA 5AYZA 4WY0F 3GTNA 2XVLA 4MLRA 3BLPX 1TV8A 5E93A 3NG3A 3W7KA 3AXHA 2H3DA 2E8ZA 3PBWA 5FF3A 2J25A 2ATSA 1E40A 3DH7A 3UXDA 1XCFA 1TJRA 1VLWA 2PRLA 5BOOA 1G5AA 1XSKA 5EY5A 4H8HA 3I6RA 2YXGA 3B06A 5KZDA 3N19B 1Z44A 3QW4B 2ZX8A 4LUIA 1H7OA 4ZL1A 3EJQA 3HG4A 3W7IA 5FF2A 3CIWA 3HGSA 1U30A 5FF4A 3S1XA 1FWTA 3IVTA 3M9YA 3OVQA 4J3SA 2F2HA 3I65A 2EACA 1I75A 3UERA 4RKAA 3OBKA 4O12A 4ZVJA 3CU2A 2ATMA 3OVRA 2QV4A 3RIKA 1W54A 1WA3A 1KLYA 3FA5A 1LRTA 3WK2A 2WKJA 1EP3A 5H2ZA 2PCQA 1KM0A 1E3XA 5HWNA 1JGIA 4O1DA 1JUEA 1KB3A 1E43A 1QPKA 3W88A 1W5QA 5KZMA 1PEZA 2C6QA 1QMLA 5KITA 1JG9A 1PIFA 2ZA1A 5KZEA 1PJ9A 3LI0A 3T44A 4K38A 1UD2A 2X16A 3DZ1A 4QNWA 3EWZA 3DHFA 4J3VA 1W8SA 1OF6A 1YXYA 4UFIA 1KFKA 4A29A 2CLIA 2V3DA 1UA3A 4CVWA 5FEPA 2NT0A 3NQ6A 1JF5A 4DELA 1B0IA 3LTYA 3NR0A 2F7OA 5IM51 2WQPA 1TV5A 3A6OA 2FH6A 4PSRA 4AMAA 3NEVA 3BAWA 3GBDA 3IIOA 4WLCA 4MFDA 4B5NA 5EMYA 3EWUA 4GFSA 3QPYA 3G1AA 4PL2A 2GJLA 3GK0A 2WKLA 1JDCA 4BZYA 1J4EA 1JULA 2OSWA 1WXJA 3T78A 3CPRA 1NEYA 3TX9A 4ADUA 3VCRA 3B0PA 1OX4A 2H8XA 3EX6A 2J27A 3NPWA 5D03A 1VH7A 3SR7A 1XBXA 2WO5A 3UXAA 4YCPA 1O94A 2C3ZA 3WDHA 4UTWA 1Y0EA 4O1CA 1SSGA 1TQUA 4MIMA 1TTIA 1ZJIA 2WNWA 3TTSA 1OYAA 4NNBA 3W83A 2YFOA 3S1UA 5FEZA 3SGZA 4J7RA 3W7MA 3G18A 3LCIA 5F1VA 2DP3A 4BI5A 1WBJA 3FKKA 3CLMA 3W1TA 1WV2A 3WK1A 5CKSA 4YL2A 2ALWA 3VM7A 2VFHA 3NYZA 5EYWA 3TC7A 5C5YA 5K7JA 1FCQA 1IZKA 4WF7A 3WJYA 4NJJA 2Z1BA 1L6SA 5LNRA 5HR6A 4O19A 3D52A 1L6YA 1CW2A 1O95A 1D9EA 1RD5A 4JR5A 2EABA 3BMWA 4LNYA 4YMZA 4E2OA 1GVSA 3DGRA 3P62A 1G4TA 5G1TA 5G5IA 5G1YA 3W73A 3VGGA 1AMKA 3IGUA 3HZ3A 1MFUA 4JICA 2G95A 2I14A 1FX6A 1GJUA 3PULA 1J0KA 2C0AA 1JD9A 4JFUA 3EKZA 1GWJA 3AO0A 3MW7A 3OG3A 2XN1A 4HNTA 3CT7A 3LRLA 3MHGA 3BSHA 4RXFA 2WKGA 5ABTA 1QO5A 3M5ZA 2E09A 2FYVA 3HGOA 3LHVA 4PODA 3R8RA 4B9YA 1UD8A 3A5VA 1SO5A 3TK7A 5D2TA 3D51A 4JTIA 2DU2A 2XFWA 1H62A 3LLDA 2X1TA 3BUDA 1HL2A 1WYIA 1EX5A 2CPUA 4B9ZA 5I24A 1NM9A 1K8XA 5CG7A 2R14A 3DX1A 5D30A 2WJZA 1GVFA 2ZXAA 1FWSA 3GVGA 2RHGA 1FQ0A 2EAWA 1TREA 4C1LA 1XKYA 1WZAA 3TOPA 4JGDA 3UPWA 2WSPA 1GT8A 4KFNA 3LXCA 1FUYA 3M5VA 2EF9A 4S2BA 1GJWA 3FW6A 5E1QA 4I7VA 3W86A 1UD3A 1HTIA 1M5WA 2Z2UA 3W2KA 3O8AA 3K8LA 1GCYA 1O5XA 3AXIA 4S2CA 1G94A 4DO5A 1Z32X 2NX3A 3PG8A 5D32A 2A7RA 5EL1A 3GXDA 5CGMA 3N9SA 2AMGA 3ZR5A 1C8QA 5DLCA 1G4EA 1K8ZA 2YX0A 5AN7A 3BPWA 1H51A 4N9CA 2Y24A 4J3TA 4X0NA 1GPWA 2V5BA 2B7QA 2Y85A 2GOUA 3ZR6A 3EXSA 4JTSA 2CLHA 3SJ3A 3HIJA 4MJMA 4U31A 4PC8A 1W31A 3NPVA 5C54A 1F05A 2DJLA 3LERA 2ISSA 2CLOA 3HPSA 1KM5A 1FCVA 3ZFHA 3P8JA 4UTWC 1JAEA 3NZRA 1CXFA 3P81A 2ZYFA 3IJ7A 3VMOA 4JTKA 2TPSA 1A5SA 1H61A 3SI9A 4UFMA 4CNPA 3F4NA 2TRSA 5H91A 3GDMA 4UR8A 1YDOA 3NQFA 1UOKA 1B57A 4JFTA 4YCOA 4NZJA 2XIBA 4LS0A 1OHLA 1MXSA 4UQBA 1ZAJA 1KBIA 5CLWA 4JXCA 4UZUA 3AJXA 2IGTA 1XC4A 1TQTA 1W1ZA 3M41A 3UYCA 5AYXA 3B03A 3WNPA 1XBVA 5LHEA 2YKKA 2E1DA 3QH2A 1UASA 1TPDA 1SO4A 4O4VA 2NX1A 4E0CA 3KE0A 2HMCA 3T7VA 3VGFA 2WPBA 1EHAA 5K2ZA 4N2YA 3VX1A 1HVXA 1GVRA 2XVGA 4FMVA 3RILA 1G6CA 1PS9A 3W2MA 1XSIA 3W7QA 4PFMA 3OEXA 5LNVA 3N14A 4LC6A 5CZTA 4FLOA 3O06A 1J0IA 2FH8A 2ZZ3A 1GOXA 2C16A 1SFJA 4QAIA 2ZZ1A 2XN0A 3TA6A 2XIIA 3BVWA 5HR7A 3W6YA 1BG9A 2ZFAA 4IMGA 5K9DA 5BRBA 3W7HA 1SZGA 3TSMA 3S1VA 3R13A 4IQLA 2WVVB 5FI8A 4HN4A 1ZJBA 2ZXQA 2VXNA 3NQVA 4AMWA 3QQ1A 2ISVA 4W9TA 2VEMA 3UZJA 4DBDA 2WVSA 4LXFA 5EBUA 4U3CA 3KOFA 4JYDA 4O1BA 2NUYA 2GQ9A 5AC8A 1TQJA 3PUDA 5KSWA 2HSAA 3S1WA 4CGTA 4CCEA 2WANA 2GVGA 5LNUA 4DO6A 3MYPA 3TONA 2DJXA 4Z0SA 4RCXA 4OT7A 1SW0A 3BUQA 2WSYA 1VZWA 2DORA 2QPSA 4N4PA 1EWDA 1B3OA 2WVUA 3HGRA 1DJQA 3BUPA 5J5DA 4Y9AA 2CLFA 2CFFA 1K02A 1GEQA 1F2JA 4XB3A 1LBLA 2IQTA 4K8EA 5IBXA 1TYGA 4AVFA 1Q3NA 1VGAA 5C2XA 1BWKA 4O8RA 3MJYA 5L6UA 5BRPA 3M43A 2W0UA 3EJTA 4ORMA 4DPPA 3NDOA 4XBKA 3C4UA 1QHOA 3D0CA 3BVXA 3W72A 2FPVA 3S42A 1TPFA 1ZCOA 5F2LA 1XH1A 3EWYA 1FDYA 1X8FA 6TAAA 5AHLA 1EPXA 2V2CA 3NVTA 3BAYA 1OFDA 3LM7A 1I2QA 3SIZA 3OLEA 1A50A 2Q3RA 1O5KA 4IJBA 1TMHA 1OFEA 4UIOA 1D3CA 2WSKA 4UQEA 3P5ZA 1F76A 3M5XA 2ZTKA 3DI0A 1JQXA 2CU0A 3CGTA 5DBUA 2RKXA 1FWNA 5LZLA 5I3JA 5DY3A 6TIMA 3O05A 2HS8A 4UFKA 3WY3A 1QI4A 1LBMA 3WY4A 3DX0A 1QPQA 3BVJA 4JL1A 4O50A 1M7OA 4PCFA 3HJZA 1U5JA 1W5NA 3PM6A 1QX1A 5EKYA 4LPCA 4FB7A 1SZEA 4ONVA 4FXRA 4ORIA 3K8MA 2AAAA 1BKSA 2FDSA 1CGVA 1J0JA 8CGTA 1L6WA 4Q33A 1LOLA 1ODUA 3EWBX
chains in the Genus database with same CATH superfamily
5IB1A 4P0DA 4F7EA 2NSXA 3GHSA 4UTJA 7REQB 1DE5A 4WUKL 3H85A 4L4LA 1A0QL 5AB3A 1ORSB 2GJNA 3KYKL 1Q7QA 4FAAB 4TO8A 4EN3C 4XZIA 3TT1H 4I6KA 1SBBA 5GJSL 5KYYB 3OMAB 1A0DA 3HMCA 1V3JA 5FJPA 5CPMA 4YBQC 1DUYA 5GRVL 4REQA 2QAFA 3TW6A 5TQ2H 3MCNA 3QA3B 3AWNA 4JN2B 4YZWA 5JOPD 4YE4H 4D3CH 4NRXA 4JQXC 4NQXA 2ALAA 3S3SA 1A1NA 1YY8B 2R0KL 3BOLA 3W3OA 2DIBA 3P8IA 2DI8A 3K81A 4LLUB 4BQBA 5D6DA 5EEZA 2WJEA 4LNRA 5C07B 1ADOA 1N67A 2WJ7A 2R2BA 2XTJD 4Y9GA 4ELMF 4TV6A 2J12B 4PJFF 4HHAA 3D30A 4WI8A 1X9UA 2GJJA 1G69A 2A9MH 1ZTXE 2VEIA 1XCWA 4D6FA 1FNAA 4NENB 1JUKA 1T5WA 3SE9L 4DK5A 3K0WA 5E0QA 3BEWA 1QOQA 4YAQB 2UZXA 4JJ5A 4H7VA 4A6YH 3BE1L 2XUCA 2DI9A 1NLBL 3OQ3B 5DK3A 5F2IA 3KWUA 1LQAA 2PYFA 3C5JB 3DENA 5IHWA 4PB9L 3O63A 2AJ3B 4C7DA 2G30A 5KVFL 4MGXA 2NY3D 1MCIA 2AJZB 2VM9A 4QLLA 4WO4D 4DLFA 1PQZA 3W6MA 4WUIA 1UXWA 2Q7AA 4PRAB 3IJDA 1IIGA 3GNDA 3RIAK 3D18B 4PB0H 1OFAA 5BUAA 2X2JA 5D7LE 4KI5C 1IIHA 3KCPA 4LT7A 2IO5A 3L4VA 3PBYA 3EO0B 4D9RD 3QHNA 5D6DC 4OFDA 2Y23A 1ONQA 2HRPL 1VKXB 1RLCL 3BP6B 2AV7B 3B2UD 3CE1A 4AC2A 4XBGB 2F38A 2VC2L 2OZNA 1EQCA 1HE7A 3P0YL 5E5LA 4AEHL 3WDIA 4L6OA 1FBIL 2RHEA 3KBWA 4I13B 1XGPA 2XN9D 3RVWC 4PVMA 3LQMA 4NZRL 5F1NB 4AYGA 3QMTA 4FO4A 4LVOC 1FNGB 5TAOA 5GGVL 3CFKB 5IMMA 3IJHA 4OOUA 4AK1A 3A21A 4G6JH 2P1FA 5ESAA 1WNOA 2I5GA 3LY6A 4J4KA 1BYCA 2DH3A 3KCWA 1ZVHA 5F3HB 2GSEA 3HC3H 4OJEH 4X7DC 3GVVA 4ZXLA 3SGEI 4XIMA 3P9LB 5IW6B 1DVZA 1CB2A 4D0BA 4GAGH 4CD7A 4XD5A 3CEPA 3QDME 4B3KA 3P3SA 2XHYA 4Y19A 5T1LD 4BXVA 2X1WL 2TSYA 2WSQA 1YJDL 5HHOA 4BKSC 5ESVA 4E5XA 1AL8A 1A4KA 1NPNA 4P2RA 2EDDA 2JCCF 4LPUA 3ALXA 3B3BA 1D5XB 1G9MC 1EXGA 4KITB 3DRTB 1DN2A 3HHSA 1RVGA 3IGFA 2YPLB 2Q10A 3CFNA 3Q44A 3S3JA 4G3YH 5HDOA 1RUQL 3ZJAA 3VOHA 1U8IA 2XY2A 2V7HB 3QI9A 2O1AA 3ZUCA 3D9AH 4AENB 3HG5A 2NZ1A 4PTUA 3VI4A 4D8AA 2ZUVA 5AAMA 4IDJH 4R6UA 3DJSA 3T0TA 3REVB 1LL6A 2NTSP 4XAFA 3Q5TA 3NQEA 4F1SA 3RUGB 1CT8A 4QAMB 3RX8A 4U05A 2Q6WB 1KFAL 2R69L 1Y5WA 5G4NA 2ADGA 1FC2D 2CDEA 2QQKL 1JWSB 2CLRB 3AXLA 1H3XA 1CTMA 4HC1H 3LN9A 2JKNA 1JXDA 3QH3A 4IGBB 5J5RA 2V5MA 4OY9A 7PCYA 2NW0A 2CJUL 3AS3A 3MV7B 2NCMA 3NQBA 1OD9A 3FT9A 4AOFA 3I6GB 1YO4A 3DCPA 3V95A 5CSRA 4XRCA 4IGHA 2UV8G 3MJ7A 5IFPA 4PG9B 1W1B1 12E8L 1HWWA 2IXQB 3VMNA 5KUKA 4JQIA 3L3OB 4G2DA 3T77B 4S3FA 3CWOX 2R0ZH 5LBSL 1UZ6F 1ZT4A 1Z0NA 4BH7B 5JVLA 3CBRA 3QI9C 3GY1A 4E41D 5IR1A 4O10A 4U3HA 3B5HA 4GH7B 4PW9A 4R83A 5FF0A 2BVUA 2J57A 1YC8A 1AZBA 4WK0B 3L21A 4UB0H 1OXYA 1JGLL 1AHWA 1T7WA 1PLAA 3MYJA 4TNEA 1OLLA 3VU2A 5E09A 2VP8A 3UZWA 5TK2A 3SSGA 3KS6A 4QJ1A 4HJJL 3N6YA 2XJ7A 4L9LB 1BAFH 1AKJA 1EQPA 1OP5H 3TIDA 4LLQA 1BZ8A 3UZ5A 3BGJA 1AIZA 5HNTA 4B9KC 5JHDB 4KK5C 1XIHA 2PR9A 2YK1H 4E0RA 3LCXA 3S88H 1U42A 3CHOA 1JQVA 4NUQA 4MA8H 4QTFA 2G0LA 2YBRA 4CCDA 4QM1A 1OVDA 4QCEA 5CD5D 3DWTA 1ICPA 3KWWB 3QZWG 2NT1A 4TLTA 1NL0H 5L4IA 2PYEE 1BWMA 5HVWA 5BNKA 2V2XB 4B9JA 1ZGLB 3WMSA 2ARWA 2R8SH 3L9BA 1TQVA 3BN9C 3RWIA 2EDOA 1RY0A 5HHVL 1SW7A 1AHWC 1YA5A 4ZTPL 3ZKXB 5D71L 2UXVA 5L9DL 1QFWI 5LAXA 1IF2A 3L3GB 4LEOB 1CZ1A 2EE0A 4IHOB 3EX1A 4YTTA 3W87A 1IFGA 2DQEH 3LS4H 3PP7A 1HCYA 3M6DA 4TYUA 3ROOA 3KJ4C 3A6CL 1AG1O 3RWDA 4G5ZH 5AUMB 4BK5A 1OB1A 4H25B 2WINB 1XQKA 4P7QA 1KJ2H 3EYFA 2IPUG 1BKHA 3LN4A 3G6JF 4JRYD 3KPQB 1EFQA 3HFYA 2WLHA 2LLEA 2YSWA 4BS0A 3IANA 3RLGA 3LKQB 2GSGB 2QJJA 3BISA 1F7BA 3D0AA 3V0AC 3SCWA 1DEDA 3PWJA 3BPLB 4X5WB 5KG9A 5RUBA 5CZSA 5JW4R 4L9DA 4OZIA 2QCDA 3AQZA 3MCLH 5BRQA 2IPKB 4F2FA 1HX0A 2VT0A 4RX4D 4AE1A 2JKRM 4ZFFB 3P2DA 4OZGF 3SN0A 3OKDA 2VZ1A 2FLBT 2EPKX 4LCWA 1XRSA 5T5FH 2EDNA 4WI0A 4P3WA 3GD1C 3JWNH 1H11A 3CAFA 3BH8A 5E4AA 5AVHA 4WEBL 1UPMB 1BPVA 4HOMA 2BSED 4OGQC 4KCWA 2DQTH 3GJFK 4Q52A 1TQBB 1QNOA 1VZHA 1XD1A 4BK5C 1C5CH 2ATPA 4N4YB 3TU9A 5CSYA 3U4EA 3Q67A 3NZ8B 4NUGH 3H4WA 3U30C 1XCQB 1JZ7A 3QIUD 3VQLA 1FNSL 3GXFA 3UDWA 1CGSL 1KBLA 4JTDA 5F9OH 2ICWA 4EPSA 1DJXA 1JPSL 1OIFA 3MLVL 3B8VA 2ACSA 4Z0BH 4IMCA 3EB2A 5JPMB 4LESA 5DO8A 3IDMB 3MRIA 4PJ5B 3W23A 3LZRA 2ZUXA 4JTQA 1D7BA 2X9WA 2ZYSA 2Z26A 1YTKA 2UY2A 5CZVL 2AOSA 1KFWA 2NZIA 4DOHB 5AWNH 5KOVC 2HPTA 1SJHA 3MR9B 3N18A 4WI6A 4K8HA 2EAEA 2Z65C 1X8CA 2BODX 3O8XA 1GQLA 5D96B 3ANYA 4KXDA 5I16B 1XYCA 3JWOH 1ACZA 1LOSA 2XPKA 4G1NA 3DU0A 3CL6A 1CL7L 4WGXA 2XV2A 4FC3E 2GB2A 3FB6B 3OHXA 4JL2A 5IT2H 1RVFL 3GK8L 1ZK9A 2PDNA 2JF1A 1ZXKA 1IYXA 4IFKB 3UDWC 3RA7H 1O5QA 1AW1A 1XIBA 3W02A 4EVZA 1BEUA 4MM1A 1RZJH 4MB5A 3KW3A 4QLWA 4H9YA 2OTWA 3CSYA 2H6RA 1RSFA 3AT0A 1SDYA 1BZOA 1MW1A 2IANE 5I1CL 2YAFA 4UV7H 1SQ7A 3D5HA 5HD8C 2FEEL 5DELA 5EUOB 1NOLA 2ITCB 4U1SB 3ES8A 3BUVA 1DXEA 4UM8B 4FQLH 4P5TA 1JL8A 1MWAA 3LBMA 1DJYA 1PZBA 3QJAA 1AFVL 2Y07H 1MMFA 4KKLD 1A5AA 1W0WA 3IDGA 3L45A 3KFTA 3TV3L 3O8XC 3HS9A 2DLIA 3RKPA 3ARWA 2R29A 1AGFA 3QSRA 1GZHA 3GUFA 4OIFA 1TPVA 3BLFA 2WAHA 4OM1L 4X4YA 4NO5A 5K59E 1A3QA 4Y6GA 4HZMA 3VC6A 2ZKXA 3OHXC 1XL9A 3MJ9A 4JIEA 2P24A 5IW1A 2R1PA 3BRDA 2ZOKA 4C55A 3DGCR 1D3HA 4B2DD 1EHKB 3HI1B 2CO7A 5AAPA 5F6HJ 4Y4FB 2V37A 2VJ8A 3VA8A 4Y1AA 3ZDYF 4OV9A 2DS4A 5EUKB 2Q3AA 2GJXA 1N19A 3FF7A 3FO2A 3DJTA 1INQB 2Z1KA 5IOBA 5K69A 5LSMA 4NZDA 3RU8L 1SOSA 3D2UD 5EZIH 1OABA 5LAPA 1RPXA 1BEYH 1PAMA 4S11A 4MA1C 4P5TC 2ETWA 2X88A 2E7DA 4D0CB 4OI7A 5HQLA 3BV4A 3MDUA 5EU6D 1GZQB 5E1AB 1GHFH 4DEUA 3IJEA 4GUGA 2X4OA 1GZHC 5D1XA 5I8KL 3UWVA 2FO4A 1OGAE 4Y8AA 1DANT 1DL7L 1P43A 1PIGA 3PBMA 1FO0B 5H6HA 4QRTA 1JVLA 1YEJL 2W95A 1W3KA 1SHXA 3S5LB 4PREB 3UG5A 3TT3H 1QFWM 5I0WA 3G6AA 5J6GB 1E73M 3NJJA 1ILUA 3BZDA 2WK2A 1BZDA 1EFXB 5B22A 5IFTA 1IR1A 4HUWA 2BOBA 5C0RL 3E0FA 2CXEA 3SGGA 5DCCA 4PRDB 2NYZA 3KCOA 4FA3A 2A6DB 2A1YA 1R46A 2N01B 3GYCA 5IHBA 4OLEA 1CU4L 2FQGA 5AYBA 2OT0A 2Y5TB 3N2XA 4M1GL 1PO9A 1MO0A 4RA3A 3OIHA 4H5SB 1NCOA 4QEGA 2GITA 5J11B 4J1OA 1QVOB 1SRDA 3CZSA 1G0YR 3H7BA 4Z7WA 1K5NA 4ZZKA 1AQDA 4NZ8A 1E3ZA 1OW0C 3W01A 2GDUA 1ME8A 4US5A 3BAEL 2GIYA 4RAUB 4KWUA 5D1XC 2GVJA 5KN5A 5E94A 3EFOB 2PSNA 4ETQA 3W7DA 4UF7C 2G3JA 4NHCH 4DRSA 1TVLA 5A8OA 5JUEH 4OLVL 3VFUA 2NXZD 4QRQA 4PWFA 5JHBA 5FO2A 1U95B 5C0AA 5D8JH 5B3NA 1YMHB 5BOOA 4I9XA 4LCIL 2LABA 4PRBA 4GQPH 4DGYH 2EDFA 5GISH 1PKQE 5FF2A 4ZE4A 1GGYA 5TGBB 3QDJD 1FWTA 5L7XL 2Z4QA 4L18A 1W3HA 3KOYA 3MRBB 4HX1B 2QV4A 1NMCC 2FKPA 2Z25A 1ASOA 3DJ9A 5DK0A 3BFWA 3FQWB 2WBXA 1E3XA 5DR5L 3EO1B 5KZMA 2C6QA 1CFMA 1CENA 4GVIA 3V5CA 5AB2A 3PFUA 3N0PB 2FO8A 1NCWL 1OF6A 4IF2A 4RFNB 4PN2A 4DN3H 4AMAA 2DI7A 1BVWA 3TPKA 4ZMXA 4ZUVA 3FFCA 3ZE1B 2OSWA 2YRBA 2IPFA 2VL4A 2ZP0T 4J3OH 5LJYH 1TTGA 1S5HB 2WO5A 3PPFA 5F7LB 1Y0EA 3EWDA 3R94A 4KXCA 4OV5B 1Z89A 4BEIA 5GZNA 4XGZA 3FKKA 1WCBA 1LQBC 5EYWA 1QUPA 4M3HA 4NQEE 1XSOA 4O4YH 1O95A 3MCMA 1VGEH 3KPMA 5G1YA 2ADIB 2ZOXA 4M3JA 1ZBKA 3MV8D 3BQ5A 1IM3D 2IPTH 2YPVA 1JZJA 4RDZA 2HWZL 1P6CA 3MO1B 1IX2A 3HGOA 3ZVHA 1OE2A 3GTXA 3PHSA 3UTTA 5IB4B 2VISA 1EJWC 3LLDA 1LP9E 4AIZA 1CIDA 5EU4B 2EAWA 1AP2A 2NY5L 1BIHA 2CRMA 1RPQA 1FUYA 1RJZB 3PL6D 5D7IF 3EYVA 3CQPA 3GJFH 1WAPA 3O8AA 3EYUH 4NQSA 1N64H 2XZZA 3D1MC 1GW9A 5EIIG 3UYPB 1JPKA 3GLAA 3ZR6A 4FQ1H 5C54A 2NYKA 4AYID 4HNOA 4AI7A 3TO4B 1MRFL 4NP9A 4EMZA 3U9UA 2OS7A 5GZNC 4F2MA 3DVNA 2F8QA 1YDOA 1PKNA 4UQBA 2FX7L 1BTCA 5TDOA 1M7DB 4Q4PA 1P7KB 2YD8A 3WS3B 1XIEA 4UZUA 1EYWA 3TH4T 3B03A 4FHKA 4O4VA 4E0CA 4V1DA 3B9AA 1WCQA 3K91A 2ZOTA 4P9HL 4RDQF 2BC4A 5CHNB 1PS9A 4GPNA 1VPOH 2FH8A 4W9EC 1O5DT 2F58H 3W7HA 4R27A 4Y1SA 3TSMA 3R13A 4HN4A 1ZJBA 4X8GA 1Y18B 1P7HL 3BO8A 2EE3A 3KVQA 5F72S 3M0IA 4LXFA 4QR7A 4JYDA 3TBYA 4JRFA 3GPSA 2GVGA 3TF4A 1DCLA 4XMPH 4I89A 1TE6A 1VZWA 4DWSD 3KPPB 3T05A 2WIMA 5IBXA 1ZKAA 1QSEE 4ZPTB 3DYPA 4KHXH 3MUZ1 4PFEA 1WS7A 3F7RA 3KPSD 1FFPB 2XWCA 1UFGA 3L3KB 2IXVA 4NZ4A 3T65B 1MQRA 1FGVH 3C75A 1YNTA 2DVUA 5L4JA 4OFYD 4NOBA 2B3IA 1GOQA 2LGNA 3O05A 4BHUI 1G7QA 2FWLB 4NO0A 4XZLX 4F5CA 3HJZA 5BMFH 3QUKB 4WW2A 1E0UA 1YNLH 3K8MA 1BKSA 1CGVA 3DDMA 1L6WA 1C9DA 4JFXA 2WWNA 1TIMA 5IBTH 1G1YA 1WC7B 4AVKA 2BZCA 1MW3A 3IGXA 4QXUL 2OYLA 1K8DB 4X80H 4GI9A 4UM9B 5CKAA 1G1CA 5LLIC 3NXLA 3L81A 5TBOA 4MMZA 4PGDA 4MNQE 2CQVA 1TVPA 2C13A 3ALGA 1EVUA 4B6ZA 1B4KA 3HAEH 4NJAH 2OTPA 4S1QH 1MJ8L 5DJCA 3ATYA 3OAYK 4N3UA 1NIFA 5E5RB 3MU3A 5IBXC 3RR4A 5CGYD 2YLHA 5K1NA 4DP5X 1DJIA 2Y6ZA 1MJUL 2BRRL 3IM1A 2W66A 4Q6IA 4IPPA 2I9TA 2X6AA 3UTQA 1FZKB 3DVGB 5CFAA 1K3IA 1XGRB 3WIHL 2ZAGA 4WGVB 5TH2A 3CFDB 3WLMA 3LCYA 3PWVB 1IWAA 2KZWA 1XGTA 1RLWA 5JIHA 3EH3B 5D1QD 4H8WC 4WW2C 2AXWA 2BSBA 2A0LD 4E9LA 1A3XA 4ANUA 1CNVA 1JPHA 3RDTB 3HG1A 2I7OA 5ANMA 4DPQA 1TLMA 3S6DA 3QWOA 3MLXH 4NQCB 2BG5A 2ODIA 2PLMA 4WDTA 5A6SA 1IGCL 3GZ3A 1KYUA 2M1KA 4MMZC 1P0KA 4ZFZA 3S5LG 1MLCA 2UV3A 1S1PA 3UJTH 3NP4A 3SCMB 1XF4A 3AJ7A 4B5ZA 4BZ1H 2P88A 2RUSA 5I1AB 1L7IH 3ES7A 4D6DA 1M7IA 1Q8AA 3IDYB 1M56B 4CMMB 4Q6IC 3MODH 4S3CA 4OR1A 1QT1A 4ADSA 5PCYA 4EI5D 5AC4A 2VAAB 5IQ7L 5F88B 5D2VA 5D7SH 1WTGT 3GM0A 5J3HC 2XH2A 4NYLB 3HC0A 3RHGA 1BSIA 2XG5B 4WI2A 1RL1A 1SN2A 4YXHL 1CCZA 1ADWA 1MG3C 4Z7QE 3GLEA 5BMWA 4RE2A 2O26U 2WW5A 3A6BH 1VJIA 5EBLA 2WVTA 4A7GF 1QHQA 9XIAA 4Q7IA 4N85A 1TQSA 2TMDA 4FOJA 3T8VA 4IQEA 2FJFB 4O0KA 4K3DL 3SGUA 4OFCA 2J1WA 3TEWA 3PZUA 3GMRA 4Y16D 2QV2A 3WF1A 2R1XA 3KMDA 4QS6A 5FDYA 4MZ8A 4MY1A 3IVUA 1LEIB 1OT1A 4CKVX 2R2EA 1G84A 2DWXA 2I60L 1A6AB 2IFGA 1DDHA 3HS8A 3E2VA 2CA3A 5CQ1A 3D87B 1UD5A 3M1BA 2QVTA 3VMPA 1DFBH 5LGHH 3PDOB 4UFHA 1RHHB 4XO3A 5TE6H 1BMZA 3UTSB 2XBZA 2QUNA 4S3BA 3F4DA 4XBSA 5JZ7C 2WOQA 3S3PA 3FO0L 2X4PA 3ZRSA 1OADA 4HIXL 2V0AA 5E9XA 1IKFH 1N8OE 3VFGL 2VLLA 4URIA 3N25A 3R6IA 4L4VB 2J5LB 1KULA 4PGLA 1M9WA 1QFPA 1IT7A 4N8UA 5H35B 1TO3A 3LVTA 5EDSA 3BWWA 1OYCA 4GO9A 2G50A 2C4XA 4FQHB 3U7WH 4MRBA 3SOBL 4XP1L 2PDUA 2YUWA 1IBYA 4PJXA 1EFZA 3GGWA 3LMYA 3H2QA 4KK9D 1JPGA 1D5ZB 4KUCF 3EDEA 3GEWB 2Z4TA 2NX5B 5C2CA 2DEYX 1SVBA 1GH7A 4UOJA 2W92A 3VRJB 3KZPA 1EQWA 1F02I 1RZFL 4YX2L 4GXVL 3CYVA 4Y4KB 1FWAC 1QSFA 2EEBA 4Q4OA 5C0BA 3C9NB 1OSEA 2UWEE 1UJ3A 3WBWA 4Z3EA 1WBZA 1B5TA 5H2BA 3ZL2A 3PY2A 4QRNA 1ZXQA 3S2MA 3OKLB 2XETA 1ZTXL 2E6DA 5C8JB 5BVJB 1NFDF 4RGOH 2G3NA 4XXCA 3UTPE 3ULUE 3MX0A 5CMAA 1JYNA 2PU0A 1QVBA 3IIVA 3FMGL 1U58A 1XIGA 2DBLL 3WNLA 3C56A 5ALBH 4UILL 5E2UL 2E6JA 2YBTA 3E7JA 3TWCL 1D8WA 1NDVA 4GQ0A 4P07A 2AXHA 1OSYA 1CI1A 4P4KD 3AUWB 2E77A 5JBEA 4M8QA 2ZE0A 5LQBH 1XRTA 4FTVD 4MD4A 5DEFB 2HVKB 3WBEA 1H3VA 5F1SA 3QY7A 3S36X 3W39A 1X7FA 1P4IL 1R3KA 3CTLA 4GSUA 2Q8AH 3F04A 1G4MA 3TVMA 3HS0A 5EB9A 3E96A 3R1GL 3FN9A 1JZ5A 3NQ2A 1QKZH 4D2NA 4MNKA 4RDBA 5J6HA 1UJ3C 2F53D 1N7KA 3KOXA 3GIVA 1HHJA 1J9RA 3F00A 4IRJB 4MWAB 5U7SA 3RXZA 4XXCC 4ILDA 1DPMA 3KLSA 3GSOB 1PX3A 1S9VB 4UDTB 4DBEA 4NJIA 3T2NH 3KRBA 4G7YH 4O57A 3N1FC 5E8PB 3HGJA 1II4E 3BP5A 1LMIA 2XICA 3TBVA 1G7IB 1IEAB 4PJAF 2QDGA 4ZQPA 3HMWL 4GUJA 3UXIA 1JWMA 2ZA2A 3L4ZA 2EPOA 3P4OB 4KO6A 4MNGB 2X87A 4AMCA 5DWUH 4AHOA 1V54B 1HCFX 3K72B 2Z93B 1H7XA 3KJ6L 2G75A 3WO4C 2NY1D 1VYPX 3MUY1 1CQYA 1Q5MA 5AOZA 1UJTA 2UYLA 3TVMC 1S7WA 3HS0C 2X5PA 5FJUA 2JTDA 3C0LA 3N1MC 5E6ZA 4LCSA 4F8PA 5AOKA 2DZXA 5E00B 2FGBA 1ME7A 1WKEA 1BRLA 1F4XH 3D39D 3PS7A 4AU0A 4W9DC 1VHNA 4WGHA 2N59A 1A53A 4DJDA 4EF9A 3VFMA 1EEYB 3K1KC 3OAYH 4Z7VE 2WBJA 4YHGA 4FQQB 2YGNA 4HIPA 3QUZA 5D2NE 4QO1A 2GTQA 1JDAA 4U6HB 1J93A 4NKMA 3DO7B 4PJ9B 5I73C 4GBXD 5B38A 3FRUB 1JXKA 4F7CA 4PSPA 3DLQR 4GMSH 4IX0A 1YYML 1B2WL 3FCBA 4J3UA 5E8DH 1I2RA 4L61A 2X3CA 3SGEH 4L8CB 1X6NA 4ELDA 2HCVA 2Z7ZA 3X1GA 1PLGL 1WBYA 4XCCL 4JRXB 3P0WA 4HHMA 1EH9A 2MCMA 3NJKA 4LB3A 1MI5E 3P11H 3MBXL 4S1SL 3TN0D 1UCWA 5HI5D 1TV7A 2QDWA 4EWJA 4XNYL 2MNUA 3GB6A 2GQ8A 4ZQNA 4OCLC 2ZONA 2XSBA 3B8WA 1J11A 3WYZA 5D8WA 5FUCC 4W4QA 2I24N 3FO9B 3NL5A 4FHJA 1ZA6B 3O6KL 4JQ1A 4KKBC 4DJDC 3HUJE 3A67L 3ZYZA 5ACLA 2YWYA 2WBJC 4X6CF 2AXGA 3QUZC 3P4MB 2DQDL 4PGEA 1T7YA 4MNMA 2CESA 2OLSA 3GSNA 5FUOL 4DNMA 4PYSA 1BWLA 2V2WB 1DVUA 1IC4H 1RV8A 5AOIA 1EDTA 5B4MC 3C2OA 4OZOA 3K71B 4KDVA 4DQOL 1E3FA 2AQTA 2Q8LA 3M7OA 2SEBB 1JHLH 4BH8B 3QFDB 3P73B 5F6HI 1HG3A 3QORD 3IJ9A 1LYXA 1DO6A 4KRZA 4DUWA 3GTVA 3QHOA 3DSFH 1FJ1B 2B5IB 3UGVA 2OZ0A 3AY4A 4TVDA 5JDSB 5D5ME 4J3OF 4GQ9H 3CPLA 5DJXB 3C0JA 3W7LA 4ZXBA 3QYQA 4QRRA 1BFVL 4JN6A 4X6DA 2EG6A 2J71A 5LA0A 3BZGA 4M43H 3CTTA 4FOMA 5CSUA 1YQVL 3U1SL 1KPUB 4JHMA 2XISA 5BROA 3V0HA 2IALA 5C0IB 2ZZ5A 1CLCA 1M1BA 1W9XA 1FP9A 3MO7A 2K0RA 3K1DA 1P4UA 3MRQA 1AI1H 1FG2B 2AW2A 3F64A 1IQDB 4FQIL 3SURA 4DP2X 4J5VA 2PTTA 4P9ML 2A83A 4IT1A 2WXFA 1COBA 2KLRA 4G7QB 5HSFA 4L4TB 3RNQB 3CFMA 4JFEB 4JCLA 1P7TB 1HL9A 2C14A 1ZLEA 1K85A 2VLRB 4HKXA 3Q01A 3P4NA 5I78A 3AY4C 2OMXA 1X7SA 3ROLB 2HLFD 4OGXH 3RWJA 1TPB1 3BHBB 3RLSA 2JKSA 1E9YB 1KCZA 3PAJA 3DGGB 1DLFL 4GC4A 4ZXBC 4XI5C 2JIXB 1NMAL 1XB6A 4Q3MA 2GUOB 3ZWTA 1OY0A 1Z9PA 5I6MA 4LBUA 4PCTA 1P5UC 2O7SA 4Q4SA 4DIXA 4KMTL 3CB8A 5MEQB 3E02A 4KMQA 4Z3TA 1LO4H 1UR9A 4M8UA 5FM5O 1GTEA 4PRHA 4ZEPA 4O5LH 5GGQL 4IGSA 1IGJA 3X12B 4K8RC 2NNXA 3NAVA 1GAFH 2VM8A 2QV5A 1AGCA 4B97A 3IGKA 3EAKA 1Z8AA 1NFKA 5IEKB 4QRPA 1FSKC 2VDGA 4HTBA 1KTDA 5I71C 3VE7A 1SW3A 1HIZA 3CUZA 4DKFL 1RCXB 1VRDA 2XWJB 4HMCA 5HGHB 3NCJH 2EDMA 4IPLA 3W53A 5DT7A 2BB0A 1QFWH 1LYQA 25C8H 5ABDE 1J8SA 1T1XA 1BVKA 3Q9PA 1NWUA 4N0UB 3SIMA 3OU8A 4ZB2A 1K4DB 3TP4A 1EJ7L 3CXDL 5FUZH 3L3HA 1I8IB 4YOKA 4IRZH 5DT5A 1NLDL 1OLZA 2EO9A 2HROA 1FL6A 2D03L 5C9KA 2OSLB 3G5WA 4GT7A 5CPLA 1ED3B 4YHKL 3NGFA 1V93A 3MXWH 1POJA 3IGAA 3TBCA 2VC5A 5LB1A 4ORGA 3SCTA 4UNLA 3TZFA 1BM7A 3G1XA 3U46B 3OR7B 1U5VA 5DS8A 2FGZA 1XGYL 2V5JA 3GWJA 1W72A 4OB5L 5EBAA 4PJHB 3CLEH 2XC8A 3T6QC 4M7JL 3W7NA 1T21B 4L37B 4U1MA 5CN3A 4JN8A 4F7TA 3UZVB 1UZGA 3ZDXE 1FYTE 1E4XH 3ILPA 3WLWD 4LHQB 1LUCA 4MY8A 4UTMA 4UZSA 5E6UB 1S7UA 2VR5A 3ILQD 2GL5A 1T20A 3LV6A 2H9GA 2IWKA 1S3TC 4LEEA 3VQ1C 1GYUA 4UUJA 1UUNA 4D71A 2YGQA 5C09D 3SPCA 1QI3A 3QEUB 5H1WA 3L5AA 3E6FB 2RDXA 5I79A 4RWHA 5FO7B 4MTMA 5KYWA 3LIZH 3L95B 4QT5B 2W1NA 4H9UA 4LYKA 2OZ3A 2OXGB 4ZL1A 3S9DB 1HZHL 4MDJB 3M0YA 1XIWA 1QNIA 2DMHA 2NSOA 1J79A 3Q7JA 3OAZH 4G72B 3I65A 2OMUB 3H7LA 3NT0A 2X4QB 1VGKA 2TRYA 5KSAA 2WKJA 1TEGA 3JT0A 2XPGA 1A6UH 2Q6ZA 2YN5A 4LSQL 3VFRB 1QMLA 1CD1B 4LDLB 3CK0H 4TSCL 3HIZA 5HYJB 3PUGA 5AZEH 1MN4A 2NXYB 3ZN6A 5I07A 3CBJB 1YXYA 5TQ0H 2V3DA 3ZQXA 4JM4H 5ACZB 3FB5B 1NGWA 3EOTL 1J0ZA 2VLKA 5F9JB 5EMJA 4IJTA 3AGVA 3U5YA 4Y7EA 4ADUA 1R3SA 3SR7A 4QTHB 2QYGA 3GNMH 1U8HB 3EJCA 4NNBA 3VDAA 1MUMA 3SGZA 2DYPD 1UR3M 2IBZX 2P5PA 5CKSA 3K6SB 2ALWA 5K7JA 1TXKA 2ROYA 2PO6B 4N6RB 2ED8A 4G2AA 1R85A 3VGGA 2EPNA 1X97A 3PULA 2B20A 2JFEX 3BP4B 1XIWC 2WYIA 1UXMA 4KROD 3M5ZA 2PPDA 3V4PA 1MCFA 5F7DA 4LPTA 1OAJA 3AU1A 1WYIA 4NIRA 5KSAC 3FB7B 4A39A 1P0SE 2YXWA 4C1LA 4ZOBA 4OZFB 1QRNB 4QHPA 1A02N 1EEZB 2HLAB 4KFNA 3G5VB 2H2PD 1S7QA 2G3FA 1SYSB 2Z34A 5C0DA 4JGJA 5AOJA 1BXVA 2B9AA 1SFSA 6PCYA 2VVNA 3KBJA 3ICJA 5CGMA 1TELA 5DLCA 2NUTA 3WH8A 5ADOH 4JB9H 2Y85A 1IGFL 5IB3A 3EXSA 5DI8B 3MRRA 5GGRY 3WDQA 3FQNA 4N2IA 3VNKA 5DD5H 1SNRA 4XO4A 1KM5A 4HJFA 1Y6NR 3H6OA 1GZPB 5KYXB 2X2YA 3N5AA 2EE2A 3KLAB 3LEXA 4N8CH 1MPAH 2YAHA 4LSDA 4NN6C 4GP4B 3VWJB 5JXEA 3QZ6A 2CCRA 4DZBA 5I2IA 4AK2A 2P8BA 3ECBB 1A0CA 3ULVE 2P3ZA 2E1DA 2XLLA 2OXNA 4KUCD 4KW2A 3LKRA 3QHZL 1T4WA 1DVFD 4G1EB 2XVGA 3RILA 1X1NA 3W2MA 2RGLA 3N14A 4BEUA 5AKRA 2VXTL 4U49A 2AABH 5J56B 3T0EB 4XVJH 1A3HA 1N5AA 5DUPH 2APFA 1BVOA 1AZ2A 3OZLA 3QEQD 4Z3GA 1P53A 2V6HA 3H70A 2CEQA 4EDWL 3EAUA 3KOFA 3PUDA 2J88H 2WANA 3QQNA 1SM9A 1SW0A 5DJ8B 5EMMA 5D4HA 1L0QA 4IJCA 2DM4A 5HATA 4GXWA 1Q3NA 5L6UA 3D25B 2ZKMX 4JFPB 1ZA3B 2E27L 4XCNB 4JZNB 4HK5A 5BZWB 3VI3E 4YSUA 4YHZH 3FTYA 3L3DA 4LCUB 4A68A 1NDMA 4KY2A 1T5AA 5C0CA 3O3EA 1J88A 5JXEC 1LBMA 1QPQA 2WXPA 5AYUL 1U5JA 4K94C 3M7FB 4FB7A 3NCOA 4NPKA 5DHMC 1XHHA 1UM4H 3K2GA 1A65A 2IPUK 1PBGA 3MROA 1TVDA 4QITA 4JBSA 1WV7T 4WI9A 3HMXH 3M07A 2XTSA 1BBDL 4P2QE 2VDKH 5SWSA 3UGEA 5JR1H 4ZTOL 1MEWA 3WAKA 4R3UA 2XKSA 2FMNA 1I9JH 2YBGA 1C08A 2BINA 1K4CB 4AQAB 3MSRA 2NZ9D 2CIKA 4EUPB 4XZNX 1JE6A 3I7SA 3SGJA 5DRWB 1MVUB 2PLKA 3O9WC 4I48A 2JXMB 3SCNA 5C7HA 2ED9A 1BFOA 2ZQ0A 3APYA 4M6MH 5LXGL 5HULA 4F2TA 4ALAH 2FFCA 2AI0L 5BS0D 3RM4A 3KWTA 5IMKA 4LU0A 3FVDA 3X1BA 3BPNC 4C59B 4KZ0A 1I1YA 2DKMA 2GYSA 4XNBA 3V7AG 2IIJA 2DZTA 3WF2A 4J3WA 3CJPA 5FOBB 3D4ZA 2YD1A 3CLFL 4GACA 3NZ1A 2YRPA 4M6OH 4HDIB 3W7EA 5DMGC 1AGDA 1MF2H 2DQ6A 2DOCA 2VFEA 4BR1A 2ZOLB 4R2GC 5HYSA 5HNNA 3FUJA 4N26A 1E72M 1MIMH 2WWKO 1UM6H 1AG6A 4P2YA 3C2AL 1FZJB 4WV1B 3NOEA 1XLIA 1G7JA 3VSUA 1EB3A 4JDTH 1WKYA 2QNEA 5TDNB 1TV3A 4ADGA 4LKCA 4ZMAT 4US6A 1TZIA 2IDCA 1RR2A 3Q6FA 4Q4IA 4JR9L 3SM0A 3ZL4H 3SGJC 4BDVA 3K4WA 2Z00A 5CBEB 3BMVA 2V63A 3TCSA 4KJPD 1TPC1 2GTZB 4ZQRA 4IRSD 3M7WA 3TYBA 2F54A 1LEGA 2Y7GA 4I77L 4QXIA 3MV9A 1IC0A 1QBML 2GAZA 1UCTA 3RWEA 5LIUX 4UANA 3AYVA 4Q22A 4FZIA 3TQVA 1OM3L 1AJ0A 1BIIA 1E4XI 2JV6A 1F6AA 2PWUA 1TTBA 1DBKH 2CZ5A 2NY6D 2I17A 3ANUA 4QE5A 1KPRA 2VQUA 5I7GA 1DJZA 1KV5A 4NQVA 3PNRB 2JBMA 6REQA 3WE1A 4PJEE 5IB5A 3G9AB 4FPSA 3PXJA 3NA9L 2K7PA 4GIYA 4AYFB 1E6OH 3Q37A 2P8LA 3UY7A 1U8CB 4F15B 2Z31D 3LHPL 2L4OA 1RHFA 1Q6DA 1VFLA 4G8IB 4N42A 1KCUL 2IGFL 2PCFB 2YR3A 3T81A 4J6IA 2H0FA 1JRHH 4IKKA 3E9UA 5DRXA 5F7FA 3IMBA 4E9VA 1S9XA 1C16A 4OOZA 1RXOB 1W3JA 2WC4A 3W9ZA 1NWSA 1OAYH 4AGMA 3LGEA 5I8EB 1KPVA 3MGOB 4Z17A 5BV7C 4C6QA 4BUHA 4JKWA 4LVGA 1A6VH 2FK9A 1IV8A 4Y96A 1HAUA 3FFDB 4UYQA 2PRMA 4OVXA 3LS5H 5ID1B 1Y5XA 3RHWK 4I8YA 4RMWA 4LVHC 2QPFA 4G43B 3MA8A 1YPZE 3WFDL 5IM7A 2BSSA 5DCEA 3GW0A 2ZWSA 2HJFA 3LQAH 4TSBL 3QR1A 1UR4A 2GK1B 2E6FA 2VX5A 3O6ML 4H0LC 2VYOA 3MA7B 4JFFE 5DFVC 1S5MA 3BG5A 4XPGL 3KLQA 3LPGA 1G6RH 1AGEA 1MFVA 1FIEA 5IVXE 4NQTA 1PX8A 5E9DA 3D3FA 3LI1A 3BO9A 1NGYA 1K2DB 4RUBA 2V0TA 4J3OD 2YPKA 1IGIH 4CL7A 1LILA 3ME0B 3T6ZA 1MWOA 1A1OA 4Y0GA 2OI9B 1S7TA 4PWJA 1UT9A 2X1QA 3UPMA 2LVEA 4JFOB 3QNZB 3GBEA 2XWTA 4W9IC 1QI0A 5G4EA 1MEXL 1TOXA 2ORBL 4G6KL 4FG2A 1TRIA 1M1XB 3T0BA 3LMJL 4AW7A 1JJKA 4I5XA 3UL4A 1H4PA 4NM4L 1QA9A 1AKPA 1CE1H 4HBCH 5IHRA 5JW3H 4PEKA 4DEWA 4OZFG 2R2HA 2W3ZA 5L4FA 1A9VA 2V9UA 4N8PA 4LCQA 3D8MA 1R7OA 1IT9H 1H50A 2PS2A 2DW7A 1ACYH 3BAJA 4LBAA 2V3GA 1HH6B 1ZT7A 3FBQA 1ZLWK 4YHNB 2KS0A 1TWIA 2Z35B 3RNKB 1LBFA 2DT2A 3O0LA 3QY6A 4ODUA 1NFIB 1E1CB 5HDQL 3DUUB 5L2KD 3LS9A 1R2RA 2HPOA 2ICEA 4DHGA 4C6FA 1SYVA 4F0LA 5EO0B 1FNFA 3DI1A 1EMTL 5D1ZB 5J6SA 4PFHA 1PYMA 1D2KA 2CRYA 1QSZA 3VFVA 2RDUA 4FI8A 3IMWA 4WRLA 4A2HA 1UH3A 4QOKB 1MJJA 1KR0A 1AK5A 3MUGA 5IQMA 3V4BA 2EINB 5A6MA 4ZTXA 1OIMA 1U1UA 3UYOD 3KXFA 3LYRA 4U4MA 4AZ6A 1GGCL 1P6WA 2AQRA 4C83B 2XUWA 4Z2LA 2J1XA 5CBIA 4MZYA 3FTUA 3RPIB 4OLYL 1OW0A 1PDYA 5ENLA 1F73A 4YEFA 1EIBA 5GGTA 4UQAA 1K3UA 3S4TA 2VDNB 1UZ8B 1SU5A 3G5XB 1A6ZA 3L5HA 1YTEA 1CURA 1PZAA 4KZCA 4HGWB 1ICSA 2I85A 4GBDA 4U5KA 1NGXA 2A21A 3SZ8A 1YDPB 4ZUWB 2Q71A 2GFTA 4XX1E 3SGKA 4TQ8A 4Q97A 2RH0A 3MUIA 4APXB 2VLJA 4LSVH 4CU8A 2C9RA 4X98B 1H15B 4TOQA 2ICEC 4GZIA 1XZWA 4FKHA 3LRSA 2B0MA 3N1GC 3HF3A 5ES4B 4NHUA 4WNQB 2BVWA 3I9IA 2ADYA 3FTGB 3PGCA 4JM2F 3M17A 4PYHA 1NOUA 1BYNA 1RY7B 4M1RA 1T2QH 4WUUE 4HAGA 5GIRB 4WTWA 4H83A 3VIPA 2VQ1B 2VDIA 2FSEA 1RZKH 4WR3A 2B2XH 3DX7A 3U6RA 3QWRD 4PLOB 1XEUA 1CQKA 3O4LA 4WEMB 1QOKA 3HCVB 3EJYD 4TQEL 1IGSA 2HT4C 4M62H 4XPFH 3W9EA 4MD0A 3QVAA 1ELSA 5H37G 3SGKC 4Z7OE 1ADDA 1NAKH 3LN3A 4X6BA 3WFHB 3T3PB 5D9SA 1XB3A 4Q56A 1OAQL 3RTQD 4W9GC 1UOWA 3OTTA 5L2JB 3BDYL 3BGAA 3AXXA 4YTUA 2J9ZA 4ODHH 2QGBA 2HNHA 2ZRZA 3TJEH 1PU0A 2N0MA 1FUNA 2W8CA 1TEYA 4ZMQA 3ATEA 1WAAF 1NCDH 2NDFA 4Z23A 3W0WB 1IBGH 3VIGA 3QGVA 1U3NA 5EOTB 3R12A 2I5YL 3QUYD 4O54A 2C71A 3RYMA 2XVBA 1A6WL 3KHDA 1UENA 3ULUL 3RWGB 1H0IA 2REQB 5BOPA 1UXSA 3DFPA 2Y9RT 2CBVA 4TUJA 3ERPA 2N3JA 3D33A 4PMDA 1U22A 1DQLH 1VB9A 3COOA 3W00A 3WELA 1E9QA 5L8LB 3KPNB 4ZFOB 4TUUA 4GIAA 4BWTA 1Y5VA 2R56L 3BAXA 2FPYA 2H9AB 4H7CA 2G9HB 4IQHA 5EDXA 3NABL 5DFAA 4AZGA 1BQRA 4JTLA 3DV4A 2VFDA 1G43A 1H63A 4JFZL 4XCEA 3IJYB 1PG7H 1LDSA 1TO5A 3HC4L 3SCSA 4HKBB 4GVHA 3FOKA 3NGBB 4HS6A 3MZ2A 5HGGS 3LEYH 3T3ME 3C6CA 2E6QA 3DYMA 4PY7B 4W7WA 2MEJB 3A13A 4Z0JA 5ISZE 3WFBH 4KKXA 2BHZA 4UIKL 4HHHA 1YXCA 2CW6A 2C8NA 2NY4C 3RE0A 2VMCA 2V5RA 3MPCA 2P5WE 5DJ6B 5MEOA 1NBVL 5HWMA 4QXWA 1U5HA 2HWGA 4PA8A 1R19A 3G8RA 4JKMA 1JRHI 2J6XA 4PGBB 4JX4A 2B0SL 4WSJA 4M80A 2VFGA 4M5ZL 1K1DA 2J56A 4WHBA 4JG0H 3O3AB 3VXSD 2JQMA 3WFCL 5JDJA 4RDVA 4BFAA 2IMNA 5F8RC 1W5PA 3UF9A 4HSHA 1RH9A 4LLMB 3D85D 2DZUA 3TCXA 1P1XA 5JA9A 3GMOA 3T0XA 4PVNA 3IAGC 3VE0A 4WZ9A 5FSDC 1AR1B 4UNKA 1O9ZA 1ZRUA 1L2UA 4WDXA 1TJHH 1FP8A 3BW9B 5DLLA 4CNNA 5HHXH 5C71A 2MCPH 4AQLA 4HUUA 3S8WA 5DJYA 5F2MA 1TZ9A 1QEXA 1AXTH 5K9CA 1LK3L 3QV7A 2PD9A 3EJPA 4KTYA 4NZTL 1KG0A 2CKBL 1OSZA 5DRZB 1F4HA 4PJIB 1HCVA 5SWZE 4TQHA 4JIPA 5F2FA 4ABQA 1PHWA 2DL2A 3FXGA 1VRSA 1XMWA 4MX7B 5EPDA 1TDQA 1WUZA 4AVIA 5D05A 3JTBA 4H2CA 4MWFB 4YGVA 4OCMC 4OUUB 3RX3A 3GXNA 2OL3L 3L5XH 3RO6A 1SF5A 4XAGA 1RQBA 4RGNB 5J4MA 1Z6JT 3V6FA 2WLNA 3HI6H 4PJ5D 3W11D 1BECA 1KN2H 3IMVA 2YD9A 2OM5A 4XP4L 3VXUD 2Y1ZA 3IPFA 4Y5XB 2VDOB 4TR9A 1GYWA 3AACA 4IM8A 4Y9BA 3HA1A 4IQDA 3FT3A 4C56E 4KTEH 3PPHA 4DVRL 4KCUA 5C0FB 1XAUA 2ZVIA 2EYTB 1A66A 1V0KA 4Z08A 1BXBA 3DMMA 4D9LL 2IH3B 3CLWA 4KKNA 1TJGH 3F5WB 4Z8FH 4ICWA 1FFNB 1UZ1A 5F97E 5EEUA 2Z8WC 5CSSA 3AMLA 2EIMB 3S35X 2DWTA 3VFOA 4PUNA 3TV8A 2ZWKA 1PX4A 2G4GA 1PSKH 4K7PH 1L9MA 1XG3A 2ZSWB 4JTEA 1WAEA 1T2XA 1U2CA 3KW7A 5EU3A 1SVCP 3U57A 2G5BA 4OKVB 4LEBA 1WT5A 1ZLWH 2MJWA 4HFWA 1TFPA 3QO0B 3GIPA 2YZ5A 3CB3A 3G6DL 3EYQD 4HXBH 4JFVA 5CEZE 2QELA 1V7YA 3H3BC 3ME3A 1YSOA 5EU7E 4WGKA 1MY5A 5PAZA 4KEZA 4XNAA 1T0MB 3KM2A 2V81A 4GGBA 1DTUA 2X4NB 1MHCA 1R3QA 1R87A 1XF3B 2WB1A 1T6VN 4M02A 2ED6A 2D2JA 1NKRA 3SDXB 3AB0B 4H8VA 3QEGH 3RMJA 3HE6B 2CG9X 2AANA 3RRAA 3ZE2E 1VFHA 4S10A 1URZA 3SKJH 4ZUTB 1CK0L 4U0QB 3NL6A 4FL4B 3DMMC 3MSDA 5IQNA 2XXFA 3W1LA 2A77H 3EJRA 4XVUD 2C1PB 2Z91A 4XD6A 2UX7A 3TTYA 4HOZA 4NPJA 2J3SA 2VNCA 3H6JA 3BVUA 3AALA 1Y0LA 3RGTA 4UI2A 4XTDA 1V02A 5FJJA 1F58L 1IGYA 4IBLT 1WT5C 2F74B 1UQZA 4AD1A 4C6NA 3RWHB 1KIQA 3W27A 1E28B 1XIIA 4QCIA 5I74C 3PIQA 4LVEA 4LMQI 4GG8A 1OAZH 4LB4A 1QBLH 1TJRA 3HHMA 3EJZD 3VPLA 3O6LL 3I6RA 2YRZA 3MLSH 2PP1A 5G2NA 2XSAA 3CVHL 1PJWA 3QJZA 1XEDA 3L9EA 4FQCH 4ONHA 4U1HA 4XZWA 2XWRA 3OVRA 5C8BB 5IK3B 4OSUH 1KLYA 4MKTA 5JW4Q 5BVPL 4IBUA 3B2DC 4HZAA 1KB3A 3WMLA 3VTMA 4Z76B 2AJXH 2X9YA 3D3VA 2CDGB 1A9BB 1NJ9A 2APTA 4DELA 4H7ZA 1KGCE 1NDWA 4BFGA 4YSAA 3QPYA 2W81C 3BGFC 2VUOA 4BZYA 2GBUA 4WWKA 4XN7A 1F8IA 3VCRA 1U3HA