3H55A

Crystal structure of human alpha-n-acetylgalactosaminidase, complex with galactose
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
387
structure length
387
Chain Sequence
LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-N-acetylgalactosaminidase
publication title The 1.9 a structure of human alpha-N-acetylgalactosaminidase: The molecular basis of Schindler and Kanzaki diseases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 127
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3h55A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3h55A01
2RKXA 1ZENA 4UCGA 1KB3A 3S5ZA 2TYSA 3GDKA 2V8ZA 1UOKA 4OE7A 1UD4A 1K7XA 2EACA 4AHPA 1OYBA 1FWSA 4UTUA 5MHBA 3HGOA 4JTTA 2DZSA 5K4ZA 1XD0A 4BI6A 1UUMA 2XN1A 1VLWA 2BY3A 1VR6A 5G2WA 5HUPA 1W5OA 4AAJA 4UFHA 2D3LA 5BMWA 4RV8A 3LHVA 2WCSA 2Z0IA 3KWXA 2E5BA 2OMAA 1YDNA 3A5VA 1B4EA 3TDFA 1R2TA 1EA0A 1O5KA 3G1VA 2QDHA 4Y8FA 2QUUA 4IX0A 1C8VA 2V5LA 1N8FA 5FEPA 4FLQA 1JXKA 3S2CA 3EXSA 3JRKA 3ZS4A 1QX1A 3WENA 3GVGA 4LU0A 2AAAA 1H7PA 5A6LA 4M6VA 1MEWA 3NM3A 3WJXA 2V2HA 1QPRA 3FAWA 1PEZA 2Y2WA 3EJUA 3W07A 3QJAA 2DZPA 3BUPA 1ZAIA 2PWFA 3MHFA 3V1PA 4QQ3A 1GTEA 2JKEA 2QJGA 1XI3A 3UPBA 4NJHA 3W7LA 3ZSTA 4CNPA 3L2LA 4MLRA 2ZA1A 2D0GA 4K37A 3SIZA 3LHYA 1XKYA 2WKJA 1QO2A 1PCKA 5EYWA 2GJLA 4LUJA 1YXYA 2BXZA 4QITA 3ZT5A 3C61A 3L5MA 5AN7A 2PWEA 5LHFA 2FH6A 3A9IA 3TK7A 2R91A 3I68A 3DI0A 1MEIA 4MIMA 2ALWA 3T40A 2H8XA 4O0ZA 4FO4A 4OHQA 3L4VA 2TRSA 5HINA 3ZT6A 3S8HA 5EL1A 3M43A 2FFCA 3T44A 1NEYA 2GJRA 1OFBA 1DQWA 1RPXA 4H3DA 1G6CA 1KW1A 3LOTA 3LTYA 2D2OA 4JYEA 1C8QA 2V2CA 1HT6A 3PBVA 1SZGA 1BSIA 3DFNA 3FYOA 4ADTA 5I24A 2YPIA 1WOAA 1KXTA 3W85A 1A5CA 3BW3A 3W2NA 4J3WA 1QAPA 3WY4A 5D03A 3EX4A 1Y0EA 3EDDA 1J0JA 4O54A 3V75A 3VE9A 2VFEA 1CX9A 4ZQCA 5D32A 1JUKA 3ZWSA 1CXKA 1V7YA 4JFUA 2PRLA 1CPUA 4IQLA 4P61A 3EKZA 3IEBA 2EAEA 2JKAA 2YA1A 5G5IA 3EKLA 1LOLA 2RHGA 4LS1A 1SZFA 1UUOA 3TV8A 1WQ5A 1P6WA 4IGHA 2QV4A 2ZUWA 1OFOA 4JYDA 2PE4A 4ZQOA 1JUEA 2WOQA 3PUEA 4R33A 4XTIA 1UA7A 4R7JA 2ABAA 3TROA 1R30A 1D3CA 4M19A 3GNNA 3HJZA 4UR8A 2E77A 1I2NA 1V3LA 3G8EA 1SW0A 3NPUA 2AQWA 3K1DA 3EDJA 2B7NA 1XUUA 2WSQA 1HO1A 4FMVA 3BG5A 1KFKA 4FX6M 4BWLA 3PBWA 3AMLA 3QM3A 1O7DC 2PC4A 4RZ6A 3M07A 2G3MA 3ZFHA 1FWRA 1O95A 1Q6LA 3UWVA 5HDRA 1GWJA 4BWLC 2E8YA 1W8SA 1H7RA 3VI2A 5FEXA 1OT1A 4UTKA 1JJKA 4NI3A 1CXEA 2DJXA 3W23A 4DF1A 5I3GA 3BVUA 2OYMA 1H60A 5HWMA 3NAVA 3L5LA 3B06A 5AHEA 4YWIA 2Y85A 3GKAA 1VFOA 3UG4A 4AEFA 3I7QA 2TPSA 3O63A 4WOQA 2VRQA 1B0IA 4HNUA 1SU5A 3DFOA 4JYFA 1RVGA 1Q6QA 3S42A 3G1YA 3BVXA 3KLKA 3G0SA 1JULA 3WN6A 4MJZA 2VC6A 4LC6A 1OFEA 3MI2A 1A5SA 3QC3A 2ZRZA 1VFMA 2OYKA 1JRCA 4U4MA 3SGUA 1RQHA 4A2RA 2DH2A 1LOQA 2EHHA 1GYLA 2AAMA 2J24A 2VOMA 3W76A 1FDJA 3GBDA 8CGTA 4O4WA 3I6RA 3O16A 2YZRA 4HN4A 4XBSA 3EWUA 4TR9A 4MYAA 1Y7VA 2NXIA 4MKNA 5AOUA 4FEZA 3RK8A 3GLCA 2ZWZA 3P84A 3GXMA 3NQEA 3NQ8A 3VMOA 5K9DA 2BXVA 1XFBA 3LXCA 4GFSA 4PODA 5CPNA 2CLHA 1AK5A 1IZJA 2J27A 3HQ1A 4A2SA 3W37A 1HVXA 3CIXA 4IXHA 5I0DA 4O18A 3DDFA 1JVNA 1DTUA 4CGTA 3W1RA 2PRHA 5DCBA 3THAA 2NV1A 1SZNA 2ZA3A 4O17A 3PY2A 4UTJA 1ZY9A 4HA1A 2X2JA 3GK0A 4MZ1A 4AEEA 1CGVA 2VEMA 3IIZA 4PC8A 1JL8A 4JTHA 3EWYA 4JDBA 3VGEA 3NO5A 1G4TA 3LERA 3FAXA 3OVPA 5SWUA 9CGTA 1DJQA 1OGSA 4LC8A 1J5TA 1AL8A 2OW7A 3BK0A 1CLVA 3TOPA 1TPVA 2XVLA 1D9EA 1NF7A 1KBJA 3OLDA 1TPWA 3BVTA 3PC0A 3BMWA 3PSVA 2R94A 5LHEA 1TTQA 4DO4A 4CN6A 4UFJA 3W1PA 1OFAA 3A24A 4EWND 3UEQA 1BVZA 2YFNA 2J9YA 4R53A 3RLVA 3W7DA 2FGZA 3TTSA 1WPCA 3DX1A 1TPEA 4OIFA 1U83A 2C14A 3TCEA 4W9TA 2CLMA 4NUWA 1FXQA 2ZA2A 4J3SA 1VC4A 2WKLA 3C0JA 3L0KA 4AB4A 3BW2A 3KXQA 2ALDA 2J25A 4IMCA 1GJUA 2VR5A 2YIHA 2QUVA 1DVJA 1CIUA 1EP1A 4AYSA 3BUDA 4J27A 3O6YX 3TU9A 4LS2A 3O07A 3W9ZA 4JICA 3LB0A 3M5XA 1AW5A 1JFHA 4WSJA 2EF9A 1QMLA 1PS9A 2TAAA 1MXDA 2F7QA 3IJ7A 1PHQA 2Y88A 3IGXA 3IK2A 2PURA 3SZ8A 3BCFA 2FJKA 2B7QA 2ZUVA 3RILA 3TXZA 2C8NA 3LXBA 4W93A 3CLMA 1CYGA 1TIMA 3PF3A 2ZZ1A 3OA3A 3IGSA 4Q32A 1PJ9A 1QOPA 2ISWA 3C6CA 1QW9A 2D0FA 1W5MA 2ZXBA 1KWGA 3G1SA 3L0GA 2ZRYA 1N7KA 1H61A 3W7QA 4S2CA 3CV5A 4WD0A 4BR1A 3W1MA 2NSXA 4POCA 1E40A 2ZWYA 1I75A 2VEPA 4GI9A 4H6KA 1ZS2A 1V5XA 2JGYA 2DZTA 4FIQA 3MP3A 4K6AA 3SR7A 4NNAA 4UIOA 3D4YA 1BAGA 3BLIA 4IMDA 3L4YA 4MOZA 3P7YA 5F2MA 5IBXC 1QI3A 2G97A 4B5NA 3W38A 3I7SA 4HHPA 2QPUA 1JD9A 3WY3A 3LHUA 4K36A 2B0MA 5G4EA 2R8WA 1O60A 3OBKA 3S0CA 2QPSA 4JFTA 3DH7A 2ZZ4A 4O0KA 3U8GA 3M1ZA 3VFLA 2V0TA 5EA9A 3TA6A 4EF9A 1LP6A 1KFJA 2E68A 1QHPA 1QR7A 3KX6A 3F4NA 1R34A 3LHTA 3NA8A 4RZ4A 3KRUA 3L68A 1KTCA 1KV5A 1RP9A 1GEQA 4EF8A 1MEHA 5L6UA 2I14A 3SECA 3Q2DA 1AW1A 4IXXA 4PL2A 4M8UA 1IZKA 4HPHA 4E0CA 1PVNA 3WJZA 2DZVA 3DXIA 3TC6A 4FNQA 1KXVA 3DX4A 4PEEA 3LI0A 2ZXAA 2QCDA 3LDVA 7TIMA 2C18A 5HJLA 2X1SA 3IIXA 3TW7A 1MSSA 4HPJA 2C16A 3KVJA 4Z1BA 3Q58A 1YPFA 3R5EA 4NX0A 1QPNA 3G3MA 1LM1A 5DN1A 5FEWA 3HG4A 1O5XA 1J0IA 1KBIA 5LSMA 1OFRA 1X8FA 2NT1A 1CGUA 3N3MA 4MJMA 5F1VA 5FEZA 4K39A 2VENA 2WQPA 4JFWA 4MAZA 3TFCA 2X2GA 2GJPA 4YMZA 5KSWA 1BF2A 3PG9A 6CGTA 3TIMA 1YXCA 3EWXA 1XSIA 1TMQA 2YA0A 1JCNA 3DHDA 4JY8A 3C2FA 4OBTA 4ZVJA 3W1QA 3W7MA 5K2ZA 2ISSA 1K02A 4AIEA 1DEDA 3FIGA 1SSDA 1VYRA 3W87A 1IGSA 1YADA 1VB9A 4D2JA 2QKFA 4HT3A 3PSWA 1PS3A 5K3VA 1TQTA 4IMEA 4LWWA 3W7HA 3WY1A 1NAL1 1IF2A 1OX6A 2BSLA 4GJ1A 3PBYA 1H7OA 2QCDB 3VE7A 2FPYA 1VHCA 3B0UX 1QWUA 1TV5A 4I7WA 3BAYA 3S5OA 5HR6A 4JFVA 3W7NA 3AJ7A 1B9BA 4O53A 4N02A 3PG8A 1GPWA 3TW6A 3W1UA 5I3FA 5AC6A 1J0HA 1UH3A 4X9SA 4O14A 2H90A 3C8FA 3BG9A 4FX8A 5KINA 3TMLA 1JQVA 3EX6A 1NFBA 4PH6A 2YSWA 3E9AA 1XBZA 3C4UA 2BHUA 3E96A 3M5VA 4M6PA 1DV7A 1TPFA 1WBJA 3A21A 4DO5A 3NQAA 1DBTA 2ZX9A 3AXHA 1RR2A 5FF4A 5I3HA 3W7JA 1EA9C 3D52A 3BVWA 2WSRA 4ZL1A 4JN6A 3GYEA 4O1CA 2OX1A 1S5VA 3NG3A 1I8JA 3VX1A 4JIQA 2PRMA 1G4EA 3P82A 2Z2UA 2Y89A 4HP5A 2J88A 2WNQA 1H7NA 1UA3A 3QSTA 5AHIA 2CLLA 2FHBA 2NUXA 1CXHA 4AMAA 4GO8A 3UCQA 1ADOA 2XFWA 3VNYA 4QAIA 3CZEA 1T99A 1OABA 5KZDA 4XBKA 4FHAA 5EBUA 5KMYA 4GUJA 4AHQA 3EDEA 4O1DA 1LBMA 1F05A 1G5AA 1AG1O 1ICSA 1EWDA 4X9YA 4Y9AA 5C54A 3L4ZA 3WDJA 4K7VA 1W9XA 4DF2A 4A29A 2C6QA 2G3NA 3HIJA 4N9BA 2WSYA 4LVFA 2E8ZA 1X1ZA 4JDYA 2HS8A 1EIXA 3T55A 3MUXA 3STCA 3HGSA 1MWOA 2D73A 2J6XA 3LCGA 2J9ZA 1W31A 4ML9A 5H91A 3NEVA 2YCEA 5AYYA 3BSGA 3TONA 3NL5A 2H3DA 4TO8A 2QAFA 4UTMA 1NVMA 3NGJA 5TBOA 3G1XA 5TD4A 1WXJA 2BZNA 3G1FA 4N9EA 3OLIA 3NDOA 1VPXA 5D33A 4PCSA 1XCFA 3LCWA 3BLKA 3CC1A 3S1UA 1KM3A 5E93A 1B2YA 4QJ1A 2PWHA 5A2AA 2ZX7A 5I5RA 1VAHA 1JIBA 1HL9A 2CZFA 5CSRA 4GI6A 4IWWA 4WXYA 2OW6A 1JR1A 2Y24A 3UWZA 2DZUA 3W2KA 4WSKA 2X2HA 1L9WA 4KKXA 4NJIA 1TQVA 1L0PA 3JS3A 4RLIA 3W6YA 3A47A 1JF6A 3QSRA 1QPQA 4YCOA 2PWDA 3TAKA 3W1LA 4O50A 5CPMA 1LCOA 2A1YA 2E5CA 4Y90A 4TVUA 2GQAA 4GUFA 5C6MA 4XWUA 4YL2A 1XH2A 4JTSA 4JX6A 4GRSA 4FB7A 1XDMA 3C2EA 3EJSA 5CPOA 3W7RA 2V81A 5F2IA 3D50A 1MW0A 1GZGA 1W5NA 1W3NA 2QCLA 3VSUA 3SW6A 1JDDA 2Y7EA 3OIXA 1XM3A 5F4SA 2P1FA 3NM1A 1EH9A 4Q33A 4UC5A 1ME8A 4JL1A 3LCIA 4PSRA 1LZOA 2BXYA 1LRNA 2EABA 4UNIA 1SR9A 4CQ9A 5K9CA 4PCFA 2WV8A 1WYIA 2R14A 1UBSA 1JXJA 3PM6A 4QSHA 3B03A 1C29A 1KXQA 2ZRVA 3L4TA 3BG3A 3BO9A 1WV2A 2FQIA 2EQDA 4Z1DA 3FFSA 3A22A 4O4VA 1VYPX 1JCYA 5KEZA 3GX9A 1LRQA 2QF7A 2TSYA 3QPZA 4JIPA 5KZEA 5TIMA 2X2IA 1G9HA 5CZ0A 5D05A 4BI5A 3W2MA 4WY0A 2QLYA 5J5RA 3TX9A 5G1TA 2NT0A 3W88A 2BX7A 2GVYA 4WY0F 1FY6A 5CZTA 4LRSA 1XCXA 2A6LA 1U5JA 2V82A 1EUNA 3TC7A 1T0OA 4JL2A 2E6AA 3ABRA 5G2IA 4CQ8A 2XIBA 1OVDA 4GINA 4DELA 3ANYA 2ZRXA 4XB3A 1A5AA 3BPWA 3KRSA 4JTUA 4OV9A 4JS3A 2VRKA 3VGDA 3S6DA 1KLYA 2JKPA 3LCHA 3MJYA 4NJJA 3BC9A 5DELA 3DFTA 3G22A 4DPPA 3QH2A 2GOUA 4CCDA 5F4WA 1QFEA 3L21A 4WZHA 1R75A 2QJHA 3S5NA 1QOQA 1QW8A 3EWZA 3N14A 2Q3RA 1N55A 4WUIA 1HNYA 1FCBA 4HIBA 4OKDA 3WDIA 1SW3A 4UQ9A 4M5PA 4KMQA 2C15A 1PV8A 4O15A 3FYPA 4BFAA 1ZAHA 3K8KA 4MY9A 4WY0B 2A0NA 1CGYA 4RK8A 4MYXA 3A4AA 1W56A 1F6KA 3DU0A 2ZUSA 4PL1A 4NVTA 3PULA 3CZNA 2WNWA 4RX0A 4AHOA 5HQEA 1CXFA 1UH2A 3BGGA 2EGZA 3M9YA 4FX7A 3L4XA 3W7PA 2CU0A 3SGZA 5LNVA 3EJRA 4J3XA 1X6UA 1GJWA 4JTJA 3HG5A 4JR5A 1CGWA 2CHNA 1HWWA 4S2BA 3LXAA 2OSXA 1M6JA 2CW6A 1YTEA 4K38A 5HPOA 1TPUA 3O6DA 3E02A 3G1HA 3UPWA 4TX9A 1QO5A 4NNBA 3PAJA 1LTDA 4DBEA 3NR0A 3GBEA 2A7PA 4JTEA 3ZR4A 1G94A 3BARA 3MWAA 3AXIA 1MO0A 2YX0A 2WNZA 4GE8A 2DORA 1XC4A 1QPKA 2FH8A 2EKCA 3PUOA 3BLEA 3KVMA 1CI1A 1KGWA 1LBFA 3AJXA 4O16A 3DFQA 1KGUA 4NJKA 5D2XA 4O1AA 3W7EA 3IVTA 3CTTA 1VJSA 3MP5A 1UD3A 5U7SA 1RP8A 2YKKA 1E3ZA 3RU6A 4X3ZA 4E2BA 2XN0A 1F6PA 5LGZA 3G1DA 4KWWA 2DP3A 4X2RA 1R33A 1EWEA 2VXNA 4IJBA 2ABBA 4JTIA 1HFBA 3QW3A 4LV4A 5E9AA 3KL0A 5T26A 2Q8ZA 3CIWA 1WZAA 1TV8A 3WELA 2FE0A 3MI3A 2P0OA 3HG2A 3VNDA 3ECQA 4OT7A 3NQ6A 1UD5A 4FXSA 4LY8A 1AL7A 3L66A 3QGVA 1OK6A 3QMSA 3MBDA 3U2OA 2Z1KA 3RFAA 1B4KA 1JRBA 4FLOA 1FWWA 5G4WA 4AXKA 1TQJA 4NNCA 1L6WA 3MMTA 4YLWA 4B9YA 1WA3A 2Y62A 4ORIA 3UXAA 2Z1BA 3CPUA 2ZCGA 4PFMA 1XBYA 5K9XA 3CM4A 5D2TA 2G5WA 2GQ9A 2JGQA 5LKYA 4WF7A 4LW7A 1K03A 1XV8A 4ORMA 1YPIA 1KLZA 1FDZA 1QWGA 1X7FA 1OHLA 5DBUA 4U2ZA 1KM4A 4MUZA 5E0KA 1JD7A 4LVDA 3GXNA 2OCZA 2Y4SA 1EP3A 2ZE0A 1TPC1 3WJWA 5CPLA 3GR8A 2X1TA 1JUBA 3P61A 5J5DA 2GPTA 2GUUA 5A2BA 4FF7A 5TQLA 3WEMA 3LHZA 1AQMA 2E5DA 3IIPA 1L6YA 2YYTA 4CVWA 3RMJA 4U33A 2PWGA 1QPOA 5AFDA 3LV5A 1G69A 1PZ2A 4HOXA 2B7OA 5AYXA 3PS7A 2G95A 3E12A 3E49A 3MYOA 3OEXA 2DIJA 1JCLA 1LROA 1TTJA 3LCXA 1GYNA 1K7EA 3G0XA 4N6FA 4JY9A 4O13A 5D37A 4GI8A 1NOFA 3EEGA 1FWNA 4C1LA 3GXPA 2ZYFA 1DL3A 3EXTA 4AW7A 1S5TA 3KEHA 4WLCA 1H7XA 4Y6GA 2QR6A 1MW3A 4XKYB 5AHNA 1FCUA 1PIFA 4GKLA 3GXFA 4JX5A 4XTDA 2QDGA 3W7KA 4LPCA 1ICPA 4NQ1A 1U2YA 4IUOA 1F76A 1VQTA 5D2YA 1QI4A 4I7UA 2C19A 3II1A 4TMCA 1OT2A 1E43A 1L6SA 2ZFAA 3VMPA 3KVKA 3WJSA 3WMSA 4RKAA 3BVJA 5E6ZA 1XUZA 2VUYA 4LXFA 2X1RA 3DC0A 1GJPA 4NU7A 2WKGA 2PCQA 3K30A 1W3IA 3PWAA 1XD1A 1W5PA 2YGYA 3FA5A 1WX0A 4AWSA 4NJGA 2BHZA 3THQA 3NL6A 1JDAA 4O8RA 1CXLA 2QMKA 2YW4A 5D02A 3FS2A 1FBAA 4Z1AA 4HPXA 5C2XA 2NWRA 2GJNA 5IBXA 4HOWA 1IXNA 2YA2A 3VGGA 2HS6A 3VM7A 1IXPA 3M47A 4R34A 3R89A 3R12A 5F1UA 1KM0A 3FEMA 7CGTA 5HNRA 4OGZA 5D2VA 3BMVA 4UZUA 5EKYA 3CB8A 4X0NA 2HSAA 4AEOA 1KM1A 1ZJIA 1LRTA 2CLOA 2P10A 4RR4A 3TSDA 2ATSA 1H1ZA 1FWTA 1MZHA 4J7RA 2IQTA 1XBXA 4LVBA 4LQ1A 4XQ6A 3MW7A 4N9DA 1EO5A 3QFEA 3TQ0A 4HNTA 2WVVA 5AHMA 4O19A 3BUQA 1TTPA 5KITA 2ZTJA 1XSJA 3W3OA 4UNKA 2F2HA 5EMYA 3EDKA 1HUVA 4DQWA 4UFIA 1BVNP 2Z6JA 1X1OA 4QISA 2NZLA 5FESA 1EEPA 1QHOA 5LNUA 1KTBA 1H51A 1WZLA 4MB1A 3LGEA 1CDGA 4HNVA 5K7JA 3K8LA 3BUBA 3BAIA 1VZWA 5LZLA 2WPBA 3KRZA 3W2JA 4LVAA 1I2OA 2CZEA 5E6YA 3EX2A 2F1BA 1PIIA 4FNTA 1R47A 2EEXA 3STGA 2VNCA 2JBMA 3CZLA 2FHFA 3N9SA 3W7OA 4LRTA 1OSEA 4DEFA 5HWNA 1UASA 1ZJBA 1YXDA 2IGTA 3HOJA 3VGHA 1LYXA 4H7VA 2BWGA 5A2CA 4UUIA 5ABTA 2BTMA 3HPSA 3O6CA 4IMFA 1P1XA 3N73A 4JD4A 1UKSA 4N6EA 4HSOA 1VH7A 3EB2A 4GQQA 2WVVB 3P5ZA 4UMAA 4NT0A 1RQBA 2FDSA 3FJ6A 2RFGA 4NZJA 3LLDA 5CLWA 4EVZA 1K8YA 3HGJA 5DXXA 3BGJA 2CFFA 3TUUA 5DFAA 2NX1A 4OQVA 1P0NA 2X1UA 3C2VA 5E0FA 2EAWA 4O12A 1RZMA 4TMBA 4UFMA 4FNUA 1J0KA 3GZ3A 1ZNNA 1E3XA 2WVUA 5CGTA 2OJPA 3CU2A 3IJ9A 3CTLA 2X16A 1SO3A 1EPXA 3NOEA 2CLIA 2YYUA 1GVQA 1GTHA 1SZEA 3P67A 4O52A 3LRKA 2B7PA 1S46A 2C7FA 2E1DA 2YJQA 5BMXA 1VIWA 3B8DA 1XL9A 1Z42A 1AMKA 1HX0A 3HF3A 4YCPA 3B4UA 1A50A 3P74A 3LPOA 2Y70A 4GQRA 2A21A 1H63A 4JXCA 5BRPA 1UKTA 2CZ5A 3FLUA 6ALDA 3RF9A 3GNDA 1SMAA 1LDCA 1JCXA 3ZR5A 1QNVA 2I1OA 1K8ZA 4AF0A 2F7PA 2H3BA 4N4PA 1T8XA 2ZZ5A 1TB3A 4EIVA 1LLWA 4UTIA 1SFLA 5G1YA 3ATZA 3UZJA 1JG9A 2YDAA 4JGDA 2D3NA 3NXFA 1KV8A 5D2WA 1LOSA 4EOUA 3DZ1A 4PEKA 2E9BA 1WOBA 1KFCA 2ZZ2A 4ALDA 4ADSA 3BAXA 3CHVA 4QNEA 3EJPA 1UJPA 3NPXA 5E70A 1H1YA 3CPRA 5F4XA 3VU2A 6TIMA 2F7FA 4A22A 7TAAA 4KWVA 4BK9A 3LI1A 3S9YA 1HTYA 4QAWA 1H5YA 2QUTA 3JR2A 1XH0A 4UTLA 1OG0A 1SMDA 3QMTA 4ZZ9A 3UQNA 3WK2A 3NZRA 2C13A 3WDHA 2YW3A 3NQVA 3UNDA 1TJRA 1SFJA 1VS1A 4K8EA 1PL9A 2J9XA 3MBFA 3TKFA 2WCGA 4M56A 1R46A 2H6RA 4GNJA 2C1HA 3Q94A 1GOXA 4DF0A 1TO3A 5D09A 3SJ3A 2E6FA 3G24A 1ME9A 1F2JA 1GVOA 3ABOA 1HXKA 1EO7A 5HULA 3YPIA 1QWNA 2WPGA 1MFVA 2A7NA 4RCXA 1GVSA 4AF0B 1U33A 1B3OA 1BG9A 1XSKA 1ZALA 3W86A 2JK2A 2OT0A 4O28A 3NQFA 1MFUA 5DBTA 3CZGA 2FIQA 3EWWA 3N19B 2XIIA 1ZFJA 2ZQ0A 3G0UA 3VSVA 3ZO9A 5LNWA 5DCEA 5HWJA 3UERA 4AMWA 2NXGA 3OG3A 3GXIA 1M7PA 5BW6A 1PE1A 5FF3A 4CCEA 1DKWA 1DHPA 2G96A 2YXGA 3W72A 5I3KA 1TTIA 1THFD 3D0CA 3QF0A 3W83A 1UH4A 4AVFA 3HMJG 3O05A 4FLSA 1VCVA 3W7CA 2CZDA 3CEUA 3BLFA 1ZAJA 1M5WA 1OK4A 2VEKA 4BF9A 2ZZ7A 3VM5A 3MHUA 3UYCA 1JCJA 5D30A 1AMYA 1XXXA 3EX1A 3W1NA 1Z32X 1OF8A 4J9JA 3BSHA 4FLRA 3EJQA 1W3TA 3OVQA 5E1QA 1TPH1 4RXFA 3W84A 2V3EA 2V2DA 3W22A 5A6MA 2BY2A 2YFOA 4DBDA 2V3DA 2NWSA 3R13A 3L2MA 2WO5A 3NNTA 2VKZG 3LBCA 4IOTA 1W54A 1BPLB 1XCWA 1YDVA 2TMDA 1FCQA 3DKLA 3NQ2A 2F84A 3AMKA 1OB0A 3W1XA 5D38A 3TTYA 1P5BA 3L2IA 4XUGA 5DXYA 4OU1A 5DO8A 3INPA 2O7SA 4OV4A 3NPVA 3OHIA 3ELFA 1KBKA 1AW2A 3EX3A 3O06A 2W6RA 1VLIA 1WAUA 4GIAA 4N9CA 4H4IA 1BKSA 2Y7DA 1G1YA 5BNKA 4IX2A 3GDLA 5AC8A 1KCKA 2VEIA 4AWUA 3UZ5A 4MY1A 3VCRA 4KWUA 3C2OA 3HG3A 1Q6OA 5EY5A 2Y5EA 1VCGA 1TCDA 3HO8A 2HTMA 1PCWA 1V3KA 2CLKA 1RD5A 2FTPA 2OZ0A 5KTLA 4UOZA 1ODUA 4AIOA 4UQCA 1YDOA 1D3HA 2I9EA 4DXVA 4JCMA 3VO0A 3QQ0A 5CZJA 4UFKA 3ATYA 3BW4A 1JI2A 3DX3A 4CKQA 3DX2A 4UXDA 3VNZA 1JF5A 4E2OA 3P8JA 3HZ3A 2GQ8A 3F03K 3LTSA 3WEOA 5DLCA 3FW6A 4Z0SA 3VSTA 1CW2A 3LHWA 2NUYA 2F1AA 3GDRA 5FF2A 3CWOX 3TJLA 3O1NA 3WNLA 5CXPA 4U3CA 2RDUA 1Q3NA 1GVFA 2V30A 3L67A 3A23A 2ZXDA 3CEPA 2NLIA 4UZSA 1KM2A 5CGQA 1CGXA 3LBMA 1P4CA 5D04C 2ZXQA 1DOSA 2EADA 2YOCA 4JTKA 3TSMA 4XZ9A 1P0KA 3MO7A 4L4LA 3GXDA 3C52A 3I7RA 1WZKA 4MZ8A 3UWUA 1O4UA 1H7WA 3SFKA 1KM5A 2XN2A 1MW1A 3F1QA 4DO6A 4M7TA 1UD2A 3DX0A 3UWWA 3L4UA 3M6YA 1W1ZA 2E4TA 1WO2A 4UQEA 2VFFA 5F2LA 1T96A 1CGTA 3ZR6A 2NUWA 3DKJA 3NQMA 3MHGA 5LNSA 1GVIA 2GVJA 3PB0A 5C55A 1W5QA 3O8AA 3KL3A 3TFXA 2W0UA 4ZMGA 1OJXA 2E09A 3T78A 1HTIA 3B0VC 3ZOAA 4Z1CA 3P5YA 3BCDA 3CQ0A 2XVGA 3OLGA 1AVAA 1OFPA 3U6WA 2WJZA 3LRMA 2BHYA 2V3FA 3K8MA 1RV8A 1M7OA 3SY5A 4JNMA 1I4NA 1D3GA 3FJLA 2ZICA 3TE9A 1Q6RA 5BRBA 3DDGA 3W2LA 1HL8A 4GO9A 2QCHA 4GC4A 1BWKA 3TQVA 2B4GA 2FPTA 2ZRUA 4QIUA 3F4WA 3GTNA 3GR7A 4BZYA 4FNRA 4J3TA 1UD8A 4C1KA 2VT0A 4LNYA 1V3MA 3VKJA 4JEQA 5GVJA 1UCWA 4UTTA 1M53A 3CLWA 1W0MA 1TQWA 4UQAA 1Q4NX 4JX4A 2WSKA 4UTTC 4H8UA 4QNWA 1DQXA 2YR1A 4U28A 1A47A 2OT1A 4KFNA 3WFZA 4CCCA 1CXIA 3QRHA 4LOCA 3NQCA 3UG5A 4O1BA 5CKSA 1IXQA 1GG0A 1HO4A 3M41A 3L4WA 2O7QA 1F74A 3PUDA 5AHLA 4O57A 4AH7A 3D4ZA 3IJ8A 4UFLA 2ZTKA 1G4SA 2RH9A 5I3JA 1M7XA 1O94A 3KVLA 3CWNA 4LT9A 4Q4KA 2V5BA 3P81A 4ONVA 1G67A 1KTNA 2NX3A 4MLJA 2DH3A 1D7FA 2CXGA 1TJPA 3DHFA 1Z48A 4FIRA 2GVLA 1KXHA 2WVTA 1JCMP 3TJXA 1H3GA 1TQXA 4NX5A 5I3IA 1SPQA 1SSGA 8TIMA 3MP4A 5F2GA 2FB3A 1AQHA 3VGFA 3S1XA 3W75A 1TPB1 4H2CA 3W2UA 2ZUUA 2BLEA 1QI5A 3FKRA 4J28A 3IRDA 1NSJA 3GKFA 2LLEA 4ICNA 2E0PA 3LLFA 3W1AA 2DU2A 2WC7A 1XDLA 3UXDA 3GDTA 2F18A 2QCNA 1PZ3A 2GVGA 4JTFA 2FLIA 3M5ZA 3VGBA 4ATWA 4MY8A 3ZQ9A 2VELA 3M7WA 3PR2A 2VFGA 4XKYA 4FNSA 1WE5A 1MXSA 4NZFA 1LWHA 1G7UA 3GAKA 3DENA 4PA8A 3Q37A 3WNOA 2Y7FA 1SUXA 5KZMA 5EMUA 3WJYA 3L0NA 5BRQA 3FKKA 1FCVA 2QCMA 1SO4A 2NV2A 4I7VA 1DHKA 3D51A 3W7GA 4HOZA 3HPXA 4M6QA 2QMJA 3GDMA 1PPIA 3G3DA 4ZQMA 2V9DA 3M0ZA 3IIOA 3ZSSA 1I2RA 2VFHA 1B57A 4MFEA 1GVRA 3O15A 1BLIA 2NXHA 3B05A 1I45A 5G2HA 4IMGA 1ICQA 1ZCOA 2DZWA 2Y61A 3P62A 3KL5A 1OFQA 2WVSA 1J4EA 2A2IA 1JAEA 4A3UA 1SO5A 2EO7A 3R8RA 3W71A 4ZQNA 2QJIA 2F61A 3GIYA 1UB3A 1G4PA 3IGUA 3N2MA 3TNOA 3M44A 1VGAA 3W70A 2ZDRA 3NQ7A 2WNNA 1PIGA 3AO0A 3IV3A 2F7OA 2QCEA 1F5ZA 4GWEA 4LTSA 4E38A 3DAQA 1RPKA 1ML1A 4H8HA 2FB2A 3G1AA 3GB6A 2AGKA 4CNNA 3L5AA 3T7VA 4PTNA 3HJEA 3KAOA 1GCYA 4MVAA 5I23A 2C0AA 5DY2A 1VHNA 1TYGA 3PB2A 1WBHA 2XWDA 3DHPA 5AC7A 5LGXA 1KWKA 4M7SA 4MFDA 1F73A 4WXZA 1J2WA 3KFTA 3C56A 1FUYA 1DJNA 3QEZA 4JFSA 3WNNA 3QZEA 2OYLA 5F7UA 1YLVA 3NQDA 4LUIA 3LX9A 4HSNA 3S1VA 1S5WA 2QEZA 3QYQA 3VMNA 3BLPX 2ZBTA 3BAWA 2EPHA 1KCLA 3CZSA 1KM6A 2Y63A 3LCLA 1TMHA 1EUAA 1IV8A 1VFUA 3CZKA 3PVFA 3QQ1A 3S5YA 4O11A 1V3JA 1KA9F 1I2QA 3BUIA 4UQDA 2NX9A 2W79A 3DBPA 4BA0A 1OX4A 1JDCA 1OYAA 4WQ6A 5A5WA 3WNMA 3TMQA 5FI8A 3EDFA 3NPWA 4YXGA 3DI1A 2A4AA 3A5FA 4N2YA 1NF0A 1OX5A 2D0HA 2A7RA 3GAYA 5A8GA 2E6DA 3NVTA 1TV7A 3UWYA 1ALDA 1ONRA 1EB3A 2FPVA 3KE0A 3MYPA 1FQ0A 4G1KA 3SI9A 1Z41A 5H2ZA 2BY0A 1SO6A 4FNPA 4J3UA 3WFAA 2QAPA 4DPQA 2XVKA 5CZSA 4Z0JA 3WNKA 1PAMA 2FYVA 4GUIA 3R2GA 2Q8LA 2Y6ZA 3BAKA 3HPZA 3TXVA 1TRDA 2WSPA 1EHAA 1RQEA 2OSWA 3NL3A 4AYGA 4QM1A 1YYAA 2X30A 3ABSA 3OVRA 5CSSA 4UCFA 5CLTA 3L65A 2CLEA 2FHCA 3WY2A 3M16A 2ZRWA 1TQUA 1JI1A 3P60A 3BV4A 3QMRA 1KGXA 4Z08A 3RLUA 4UTWA 2Q3OA 1IXOA 4CQAA 3G8RA 4HNNA 1ME7A 4ZQPA 4UTWC 3KOFA 1OX4B 1IIGA 1BTMA 3CT7A 3HB9A 2ATMA 3LM7A 4JTGA 3TAOA 1XH1A 1TPDA 4I9AA 3HGRA 2ZUTA 3TQKA 4RZ5A 4CN1A 2CPUA 3RIKA 4GBUA 3S1WA 1L2UA 2ZX8A 3DHUA 1TSIA 1Q45A 1QDSA 3UG3A 4ZQRA 1VJIA 3W73A 3A6OA 1G7VA 2UV8G 3P8IA 3KLLA 2CWNA 3UWQA 4O10A 1A5BA 1WDWA 4HKPA 1JGIA 1KFEA 4GXMA 5CG7A 3BLBA 2DJLA 5CGMA 2WANA 5AHFA 3UY7A 3USBA 1BWLA 1EP2A 4PSPA 3STEA 2AMGA 3LV6A 6TAAA 4UOQA 2VFDA 3WK1A 1W37A 2ZX5A 4LV9A 3C3NA 4B9ZA 5HXMA 5DCDA 4AMXA 1GQNA 4L4MA 4K8HA 1E51A 3NZ1A 3QW4B 3BVVA 4U31A 2ISVA 4Y96A 3BAJA 1S3HA 3C2RA 1HL2A 1ZJAA 5BOOA 3NL2A 1LLZA 3STFA 3VX0A 4IPIA 2Y7GA 1IIHA 3UY8A 4UTHA 4RJEA 1Z44A 3M5YA 3EXRA 1UD6A 1KBBA 4KFPA 1I2PA 3WNPA 3NQGA 5AB3A 3I65A 2F7RA 2QCCA 1VRDA 2DZXA 4TIMA 4JCLA 3GXTA 1OFDA 2HMCA 1OYCA 4A21A 2RDTA 5FF7A 1DORA 1K8XA 4AWTA 1MXGA 3CGTA 3WK0A 4E2DA 3ZWTA 3L9CA 1TQSA 3N34A 3MI6A 1VYSX 2XWEA 3SSJA 2E6YA 4U2YA 1FX6A 1NM9A 1H62A 1LBLA 1UKQA 1WP6A 3H55A 5FF0A 4LS0A 3FOKA 2Z6IA 3NYZA 4P2VA 3H53A 1TREA 4MZYA 5U4NA 1TCMA 3TSBA 3DGRA 1F7BA 4OJYA 3N2XA 1GG1A 2A85A 2ZZ3A 1BEUA 3EWBX 4LVGA 3G18A 1K3UA 4KFOA 4UMCA 4N4QA 3P80A 4IPJA 3WK3A 5HR7A 1VCFA 4GUHA 5LNRA 2ZIDA 3DFSA 4MPQA 5IM51 3UD6A 2RDWA 1MW2A 4WJEA 4FXRA 1LORA 1FXPA 2VFIA 3OLEA 3KHJA 1K7FA 4X22A 4WOZA 1WZMA 3B0PA 4NXSA 1C9DA 1SQ7A 1YTKA 3W1TA 4UR7A 5C5YA 4JTLA 1GT8A 4K7YA 2A6NA 3IVUA 5L9FA 3N9RA 5HUOA 4GUGA 3H54A 3BH4A 4BI7A 4CNOA 5EPDA 1KFBA 2H8ZA 3DFPA 2EJ1A 4TU1A 3E0IA 1QCWA 4UMBA 3W7IA 4NXKA 5K4XA 5HMSA 4OWGA 1XGZA 2KZHA 3W74A 4CN4A 4S1FA 2C3ZA 4UNLA 3ZT7A 4UQBA 1OF6A 1EX5A 4WX2A 4CLMA 3RNDA 2ZZ6A 1U30A 2DIEA 2GUYA 3LRLA 3IIVA 5DY3A 2A5HA 3LCFA 1YTDA 3EJTA 2CLFA 1TRIA 3TR2A 3TH6A 4ADUA 1XBVA 1SW7A 3B04A 3LTPA 3IVSA 1LWJA 4PCTA 1FDYA 3ABQA 1HG3A 1PHWA 1JQXA 1MVYA 3HBLA 3QPYA 4H8VA 2QCGA 2ZX6A 2BY1A 1H50A 1KFLA 1ZHAA 3LPPA 5AYZA 1A53A 1R2RA 2QCFA 1R2SA 3T4CA 4J3VA 4RXGA 2OSYA 3PBUA
chains in the Genus database with same CATH superfamily
2VIRB 5EEVA 5GS0L 1G7HA 4OUEA 2YJLA 1JCVA 2FQFA 2UZXB 5JXEA 2WMPB 2WXRA 1UUMA 2XN1A 1C5DB 3TBYB 3R4RA 2K9UA 4C6PA 4DGYH 4HS3A 3RNQA 4KY1L 4YDJA 5AW1B 2FKPA 4K94H 4AJVA 1IEBB 1X5MA 1C8VA 4Z7UA 2WO2B 4FLQA 5LAXA 1NIBA 2X0HA 1QX1A 3ABZA 2QQLH 3E6HA 4Z77A 4Z7OB 3MOBL 3WJXA 2EDOA 2GTWA 3NCFB 1X5FA 4BQ8A 4AIBA 4H04A 4U1HA 2JKEA 5G2NA 2GC4C 4OIIL 2D2CC 4F2MB 1UM4H 1ET8A 4NWUL 1S9XA 4GUPA 1A21A 2CRIA 4PJGB 3TNBA 2Z7WA 3S35X 3PJUA 3NSCA 3HNSL 5AW3B 7A3HA 2QVFB 4BFRA 4WSHA 1NEYA 2JMRA 2VLLA 4CDGC 5JMUA 1SQ2N 4Q8BA 3NIYA 3UWEA 1S7TB 3QQ9D 3WD2A 1NCNA 4GXVL 1PQZB 2DLFH 3TC3A 4HX1B 3WY4A 5D1ZD 3PL6C 3ARTA 2N4IA 4HK3N 4R7VA 5D32A 3CIVA 4P61A 2JKWA 3BZEB 3H12A 2QADC 1EJOH 5A43C 1RZPA 4IK7A 1HIZA 2QSCH 1JK8A 4YS4A 4XTIA 3X1FA 4RDWA 2VD8A 3GR4A 1PZDA 2DI8A 3WFDH 2Q76B 5M95B 3NPUA 1IAMA 3VH8G 4BWTA 3QDMA 1P48A 4ELKA 3P2DA 3UAEA 4FX6M 5D72H 1SZRA 4BHUA 1Q6LA 1US2A 1H7RA 2CKBH 1WICA 4UTKA 3SDYL 5E7FA 1M71B 4HEME 1FWBC 4XMLH 4YN3A 5AHEA 4JX0A 4UDTA 1I9RH 2NX5D 4X99A 3DWTA 4LU5L 5AOIA 1ZTMA 4PTMA 4Q97A 2BS71 4IJ3C 3FQ2A 4WFHE 2CETA 2ITCB 4HH8A 2XHYA 3VFMA 1YQ2A 2DQIL 5LGHH 3F5JA 4DUXA 1GYLA 2GGJA 4KJQC 4DGVL 3NQEA 3QO0A 3LXCA 4GFSA 4IRJC 1HOCA 2F08A 2BCMA 5I30H 1RIVL 4XNXH 3ZDZB 4X4ME 4KROD 5GSVA 4G7SB 2MANA 4O17A 4NHCL 2LE9A 4PW4A 3QDAA 1JL8A 4PC8A 1V55B 3OVPA 2PO6A 2NXZB 2FEJA 1OCBA 1LQBC 2HKAA 4U7MA 1FIGL 4ZFOL 3WNJA 4WEUD 2WXDM 3W1PA 5C9UA 3AXXA 4JANB 4BUGA 1CG9A 3E5PA 4QHKJ 1PD0A 2EEDA 4Q4QA 3L0KA 5FOBB 4UT9L 4KT2A 4L8SA 3AT0A 3VXME 1MAKA 2NZ1A 3DXAE 4PRHB 4XVJL 3IE9A 3LEXA 1RJYB 3FULA 3IU4H 2VVSA 2ZXBA 3QZWG 1SJHB 5D7SH 1A3ZA 4BR1A 1YEDA 4OFYD 4YIQA 3I4KA 3W82A 3N6QA 4FYRA 2HSIA 4MMZB 1FUNA 4L8CB 4LNRA 4UIOA 3W26A 3EOUA 1SXAA 4CA4A 3P7YA 1S9WA 4UQ2A 4OZIA 3MCLH 2FNWA 4MQ7A 4JPGA 1N6QH 3SUVA 3LHUA 4K36A 1MJ7H 4J4KA 3V7AG 1PNCA 1UVQA 3KYMA 5F96H 4PJ7A 1Q6GA 2G37A 3BQ6A 1QHPA 3RCMA 1GGUA 3LB6C 3LHTA 5RUBA 4C4KO 3QXAB 4HPOH 3NSMA 3FQNB 4YO0A 4PRPD 3TC6A 3ZIYA 3GMPA 1T04B 1ZLWK 2OMBA 3P11L 4C5ZA 4ABVA 5ID1B 5BU6A 3JT2A 3CU7A 3QIWD 3NIDF 4JGJA 1P4LA 2VXTL 5F9AC 5GJSL 2GSHA 3P4MB 3SOBH 1FWIC 1MQKH 5AVQB 5DMGD 4J1UA 5JHLH 1TMQA 3W1QA 4WTZG 2YD7A 3HNVL 5CEZH 3OR7A 5JDJA 4PE8A 4QX4A 1FNGA 3WY1A 3GLAA 2ZSVA 2NNAA 1DIDA 3WO4C 1OF2B 3KWWA 4XBGB 2WXGA 3Q2LA 4TUOB 3TW6A 1CFNB 1W0WB 1UMYA 5AC6A 3AS0A 3GI9L 4O14A 4UTBL 1UWIA 5IGXH 4PH6A 1FHVA 4DKEH 5D9SA 1ZQ5A 4F2UA 3TBTB 1TWWA 4DO5A 1FQ9C 1EA9C 1ANUA 4E2VA 4NC2B 4MZIA 4N24A 4JN6A 4O1CA 2J8OA 2OX1A 4QRTB 1U8JB 1NAMH 3P82A 1DXIA 3IF1B 4JRYA 5HHXH 1FV1B 5E2WL 3NZGA 5I8KH 4K71B 2DT1A 5DT1L 5EBMA 1OABA 5EBUA 4E68A 4YN5A 1S39A 2X89D 4PW9A 4A29A 1ADWA 3HGSA 3B7RL 2B3IA 1W31A 3KYOB 5AYYA 3BSGA 4G7EA 4QRQB 3TV3L 4MD4B 4PZVA 2VABA 1XCFA 4MCNA 4YBHA 3FPXA 4KRMB 4TUJB 3RJDA 1UT1A 5J3HD 4KUZL 2PGEA 3GC4A 3HR6A 2GDQA 3QIBC 4YXHL 1L9WA 8XIAA 2BWIA 4MMXC 1FNHA 3C87A 1LUCA 4X5LA 3TJHC 2ZVRA 4YCOA 1M4KA 5CPMA 2E5CA 4HPNA 4RAVA 3E74A 1KNOB 3RWCA 3WLBA 3F4VA 2ZKHH 4ZYKA 3ICJA 1XRTA 4JQ4A 2QKIA 1M9WA 3P0YH 4Q33A 4CILA 3CO8A 1CGSH 3BUYB 4IRSC 2CDEA 4JW3A 4PCFA 3O11B 3LKQA 4I0PB 3SADA 3WL0A 4TN9A 4BZ2A 3GF8A 5FL1A 3MGOB 4LNVA 4JZ5A 5TDOB 4DAIA 2OZ4L 4DP4X 4MB5A 2HFEB 5DJ2B 1YPZB 4MKTA 1WFIA 3MRMB 4NAMA 5T1LD 3BPWA 4JFED 4JRLA 4DY1A 2MJWA 3QJTB 2FLRT 3SZKC 3CFUA 4IRZL 4U5IA 1VBUA 3U0PB 2H0FA 1QSED 1QOQA 2Q3RA 2VHLA 4G7YH 4GRLC 2LV4A 5DX7A 1FBIH 2WIMA 4MXVE 3MBEC 3MUZ1 5EZPA 2ACSA 2I17A 3ROOB 4KHXL 4M43H 4DHGA 1YY9D 1CXFA 1TELA 2J4GA 5IOBA 3L4XA 4GS7B 1L3NA 3UBPC 2YWZA 3HG5A 2D4DA 3LXAA 3D39A 3CXHK 5D7IF 3G1HA 1QO5A 3NA4A 2V5YA 1U9KA 4O02L 5IIEB 4R97B 1JHKL 1YC7A 2RQEA 3BQVA 1EJTC 5KSBA 3MP5A 5ITBL 4RZCA 1Z7AA 1GGCH 2LVCA 3UZYA 4RDVA 2DJUA 4FXLA 3SM0A 5EPMA 2I69A 4LBRA 3NDZE 5H94B 1THCA 4TQPA 2ZXGA 3UXKA 3G3LA 5HDQH 3IVKA 3FFCA 4X7CC 5DTFA 2C3XA 1KBWA 5FIEA 1AL7A 3F3HA 1BLNA 4RGNC 4YVNA 3DX6A 4TQIA 3U2OA 1PWLA 2CRZA 4RGNE 2KPWA 3REVB 1YW1A 5SX4I 5EIIA 5AD0B 4EXAA 2WWMD 4I3RH 1GOFA 4M5SA 1YYML 5D2TA 4CGUB 1NDVA 1BFNA 5DBUA 4U2ZA 25C8H 5E0KA 2J74A 2IPTH 1AKJA 5B8CA 1XCQB 4ILDA 3F7RA 4HCLA 3MRDA 1G6VK 4FXGB 3SJVD 2KQMA 4NNYB 5HK4A 5SWZB 4M1CD 4D0BA 3RGVB 2IPKB 3N1MC 3G9VA 1KELL 1HEZA 1DL3A 4YLQT 2J72A 1TG7A 5AHNA 1BD0A 1M03A 3MA9L 4LPCA 1ICPA 3QI9D 4PREB 3HS0B 1RPQA 5KVFE 1JDFA 2VDPL 1EMTL 4BK5A 3ARGD 3QNXB 4FQLH 4LLMB 1KDJA 1GJPA 1KR0A 2PCQA 2G9KA 3ETTA 4CVZA 3KWTA 4ZA0A 4ZMLA 4O58H 3HAEA 2O6FA 5C08D 4N6QA 1EPFA 1S8DB 3AIBA 1JDAA 1WAAF 3IFLH 5D02A 5DJAA 5JW4Q 3E1ZA 4LCQA 4QO1A 4HOWA 1ZEAH 3LM3A 4ZO6A 5JPMA 1R24B 4DBWA 3I6SA 2ARJB 1XCTA 1YNQA 1PBGA 4H5SA 1XBXA 2L5HA 3PXJA 3N44B 1W9BM 2ICEC 2CHRA 4UTFA 3NCCB 2F2HA 1OT4A 3EDKA 1TZIA 1DIOA 2F15A 3H85A 1TR9A 2XZQH 5LNUA 1I8LC 1N5AA 3CXDH 4NIKB 5T9BG 1W17A 3BUBA 3BAIA 5LZLA 1Y18A 5AL8A 3SDCB 4P46D 2X9WA 2GKIA 5CEXB 3RCNA 1GW6A 4BXVA 2PDBA 1DFXA 3W7OA 4Q8PA 2VQUA 3VGHA 4ZZKA 5ABTA 4Y19D 5JQ6L 1YVLA 2VDNH 1R8LA 3M0XA 4J2QA 1SXBA 2B4CL 4FD0A 4A05A 1G9MC 2YMXL 3NFSH 5E8OA 5FO8A 4NO3A 3HB3B 2OJPA 3Q4DA 3TESA 4DK6A 1VCBC 5DRIA 2CLIA 1GTHA 3SGKA 1S46A 5KYNA 4G6AC 5DJZA 4QTFA 2Y70A 5ALCH 5DZVA 4YWGL 1P53A 1E6OH 3FLUA 1UWEH 5G4NA 3B3IA 1U1JA 3MX0A 4KI5F 3URAA 2OX4A 3ES8A 2Y7LA 2VDLH 1RZ7L 1JG9A 3K5XA 1I1YA 4JGDA 4DEUA 5CJOH 1U8LB 4QNEA 3KW3A 3CPRA 3H3KA 4LPXA 3HI1A 5MHSD 3IDXL 1JRHH 2XZZA 1VFFA 2H45A 4JHWH 4N8CH 2WCGA 3CFTA 4WO4D 1DXEA 4IMAA 4DI8A 4HJ0D 3LQMA 4Q6IC 5KSAB 3AG1B 3II3A 4EANA 2CHWA 5CSZB 3ZXAC 4KO6A 3EOAB 3WQVA 5IK3B 3W86A 2DQUL 2NUPA 3DX8A 4JY6B 3HFFA 1DWGM 2EG8A 4ELMA 2WLIA 1XGRB 2DKMA 4U7SA 1YJDH 1BF6A 5A8QA 4IHOA 3CN3A 1Q66A 3W7CA 4JQ3A 3HZKB 2LU7A 3UYCA 3QHMA 2G2NA 5FCUL 1S2VA 3OVQA 4ZR8A 3IAGC 1IT9H 2EDEA 5JW4M 3DGCR 1OSPL 3GSXA 2Y5TA 5KZCB 1MUJB 2VKZG 3WEBA 4WV1C 3NABH 3VH8A 4QHNB 2HXAA 1FCQA 3DKLA 4KI5D 1H0IA 3CHEA 4N1HB 3TEWA 1W72A 2CJTA 1AANA 2NCMA 5AC8A 3LZOA 1ET7A 3VCRA 4QHMA 5ALBH 5GGSB 1J5IA 4AIOA 3ZDXB 5FO9B 3BO8B 1HNFA 3QVAA 4KRLB 2K9FB 4YZFF 1IE4A 2A83A 5EZLA 3RRAA 1JSYA 3VIFA 1IVLA 1AHWB 3MV7B 5KWYC 2ZXEB 1NWUA 2WUBH 3LSBA 1NGPH 2IH3A 3BDYH 4X98B 2AZUA 1I82A 4ROQA 4YYCA 2HJLA 3TZVC 3MRQA 1CGTA 2YKLH 3TFXA 2QQKL 2XVGA 3RWEA 2BCKB 4G5AA 2H3NA 2AK4D 3KCPA 1A7PH 5B3SB 2MOVA 1MVFA 3HCVA 1JNLH 4GC4A 3WF1A 5AZEL 4NZUL 1W3HA 2FGWH 4DF9A 2ITDA 4NUPA 3HMWH 4H9XA 5ESQA 5EU6E 3LKPA 4HK7A 4UQAA 2CBIA 3UZEC 2ICCA 4L9LB 1NDMA 1QO3A 1O7DE 3BH8A 1U8PB 2ZG3A 4XPAL 4H9VA 3HG1E 4MXWH 1LO2L 3IJ8A 1THAA 4TSAH 4N4YB 1O94A 4ONVA 5EUKA 4PJ9C 1FHGA 2WVTA 4XIAA 3TJXA 3A6CL 3SDDA 3QZWA 2AVFA 1IGYB 4LE8A 2OAAA 1NSJA 3DKHA 3QUZA 2J13A 5A7EA 3QPQD 3S2AA 4YHZL 2HVJB 4JTFA 4YSTA 1EDQA 4LB3A 1TCRA 2RH0A 2GJZB 5EMLA 2OCFD 5EA0L 3T4WA 2OMZA 3B7TA 2XWTB 3S88H 2AJYH 2YXOA 3BFWA 2VQ4A 3NXLA 1JGLH 1TETL 4XBPB 1NGQH 1XF2A 2V9DA 3BUVA 3DO7B 3JT0A 4JOMA 4Q8VA 3MBWB 3EB3A 3V4PB 3Q13A 2HN7B 3P62A 2WQVA 1E4NA 1YN7B 4BQ4A 2OI9C 1WC7A 3IJLA 2QQ6A 3HR5A 1GS8A 4QIRA 1DQIA 1P2CA 3WUEA 3H4GA 3QV8A 4NLHA 3PJLA 4GMEA 4LLWA 4RDYA 2EE2A 2XWJA 2UX6A 3DI3B 3D5OF 5JUEH 1HESA 2N7SA 5LGXA 2EXOA 3D0LA 4LCCB 4DP9X 2L0DA 1NC2B 4WTZA 4NQSB 4G8GA 2F5AL 3GI8H 2Y63A 4W84A 1UZ8B 2BX5A 1FKWA 2X3AA 2NX9A 3ARED 1JDCA 5F9WB 3KHOA 1G4MA 4QXUL 2A4AA 3O4LD 3BKCH 1BG1A 1OX5A 4L3CB 5GGRB 1NOLA 1SO6A 1OD8A 2YUWA 3EFDH 3IGKA 2R0ZH 4S3EA 2UVFA 2Q8LA 3HPZA 4FQCH 3EMQA 4S3BA 2BS9A 5TFSH 3EPMA 3MREB 1S7UA 1RCQA 4QM1A 4JAMA 4U1JB 3F01A 4PB3A 2HA1A 1S2CA 4NNXB 1WBZA 5D55A 2XFGB 1V27A 3HE7C 4N2IA 3AVEA 4PJ8D 1ML0A 3IJEA 1IAIH 2EG6A 2QUMA 3KYKH 4HYVA 1QDSA 3UG3A 4LIQE 1OARH 2FLBT 3A6OA 4K4KA 1A5BA 3MUUA 4PLKC 4D7PA 2AW2A 2VFDA 1U6AL 2A99A 1EUUA 1HWGB 2XH2A 3LKNB 1WAWA 1N0LB 3NL2A 1ZD6A 4AD2A 4FF5A 4KKBD 3CWGA 4TNGA 1I3RB 3M5YA 1FI8C 3ATAA 1X6LA 2P5NA 3C5ZC 2ORBL 2CD0A 1VGKB 3I65A 2QCCA 4L8BB 4TIMA 2YPVH 1N2RB 5AZ1A 1X5AA 2IG2H 4FTVD 4QOKA 3MQTA 2J8UB 4AYMC 1I9EA 3AZTA 2P42B 4PJIB 3PDDA 2FBJL 3FKUS 4C59B 1KTJA 1RIHH 1PDYA 4MWAE 3SDOA 3BT2L 1FC2D 3UD6A 3CZUB 4RUBA 5C7VA 4PFHA 4FXRA 1DUZB 3L23A 2I27N 3VABA 4HD9A 4R7WA 2F8VA 4NKQB 4RDZA 3F58H 2CEQA 4A38A 1OIFA 4TNEA 2VW4A 4U6VH 4B91A 3C3UA 2LW3A 1OAUL 4PGEB 3RRXA 4ZUVA 2XYLA 4QD2E 3HN5A 5H37G 1MEXL 1X4ZA 2PC8A 4AG4L 3QFDB 4AL8C 2V17L 1DUYB 1UXSA 3AFBA 1DBMH 5DJ8A 3LCFA 2HT4C 4M5YL 1TRIA 3GY1A 5DD1L 2ALAA 2VM8A 1MVYA 1DJYA 5AYZA 3H7BA 3STPA 4DPCX 4IU2B 3D4GA 4UCGA 4AQLA 3HE6C 3V5HA 1SQMA 2X1IA 5BYWA 1UR4A 4N2KA 3F6IA 2KX9A 3WMCA 2DQHH 2WJ5A 1VR6A 2C9UA 4IU3A 3VQ2C 4AAJA 1W5OA 4JY4A 2OJ1A 4RV8A 4OFCA 3MV9D 5DC2A 3A5VA 4XI5D 2G2PA 2YHGA 3BL3A 4Y8FA 2P9RA 4WKFA 3SPGA 3SKMA 5C71A 3WENA 3VIHA 4L4TD 3UOAB 4LU0A 5JOPE 2Y1YA 4Z6AT 2G8ZA 2D03H 3VIIA 4G2DA 5I8OL 5C7XL 3NPSC 4YVPA 4NYYA 1L0QA 1W6LA 5DRWB 2D0GA 5ICXB 1Q0XL 1QRKA 5EYWA 4GXFA 3TJIA 1RLWA 3VWKB 5DJCB 5BZAA 3HI6L 1D5BA 3QDGE 2OQJA 2B0SH 3BN9C 1M57B 4K7FB 4DH2A 4NF7A 3LOTA 2D2OA 4UQ3A 5GS0C 4DP1X 1HQRB 2DTML 3BW3A 4J3WA 1A9BA 5D2NB 1A0QH 1ZHBB 3JV6A 2W80C 1NKRA 5F70A 4B92A 5CWSB 1A64A 1UWXK 2DDQL 1Q0YL 4NQCD 1TWDA 4PJXA 2REQA 3EH1A 2QV4A 2ZUWA 3MV8E 1K2DB 3GG1A 2E3VA 3TROA 2NY4D 3GNNA 3V4LA 3KXFA 3G8EA 3UJ2A 2PYFB 3K1DA 2WSQA 2CESA 3KPLA 3BG5A 2APSA 4BWLA 5JXED 1J8HE 2HEJA 5FYJH 2WXLA 5FR3A 1A6VL 1ECEA 2XSAA 3ZTDC 4ABWA 2QVKA 4GUCA 5I3GA 1XMWA 1R7AA 2Z7GA 2X41A 2X28A 4JG1L 2OR8A 3ZHFA 4WOQA 5FCSH 2CDGA 2XSXA 1KOAA 1OFEA 3SKNA 3N85H 2BSRB 3D08A 4ANUA 1B3WA 4O4WA 3H4HA 2PFHA 3GUFA 4FFZA 2R56H 2VO5A 1WSST 1OM3H 4CD8A 1W6TA 1N7ML 4QXIA 4ZS7L 3F05A 4DWSA 1MZYA 3MACH 3WFLA 3CAWA 4L4VA 4FFYH 3K74B 2BNUA 3GK0A 5T91A 2IQAA 4DXXA 3FT3A 1LVEA 4LC8A 3DUUB 4N2OA 1UFGA 2PA6A 4BE5A 4DO4A 1MREL 4ZFZB 1NFIA 2A9DA 1MNNA 4WNSA 3QUXC 3TWBA 3GBNL 1UR8A 1VC4A 3Q0HA 3KXQA 1CIUA 3QDMD 3PPHA 4YQXL 3TU9A 3LB0A 5EZOH 2TAAA 1W8NA 2BBFA 2HK1A 2XZ9A 1ASPA 1UXWA 4F92B 5KVEH 4UAHA 3K7UA 1DWAM 3OZPA 4S2CA 4LBAA 2VRAA 4R5EA 1AZUA 2WZTA 4FADA 4PJDB 1J2BA 4I77L 4JE4B 4H6KA 2G9HA 1ZS2A 3KGRA 4R3SB 2H9GA 2WLLA 4GP8B 3NCYP 2B1AH 3I7SA 3OKYA 3UCCA 3FJTA 3WTTA 3M0VA 4HHPA 5ISZB 2EDRA 3H22A 5G4EA 4GO6B 1O60A 1HJWA 1IQWH 4AEHH 3PYCA 2W60B 1FNFA 4PJ7F 3TA3B 5CFAA 5L0QB 1FAKT 4FQ2H 2YAEA 4PGBA 1BQLH 3JWNC 4HPHA 4E0CA 4Z2LA 1AG6A 3ZYOA 4WHBA 2KBGA 2VXQH 2W0FB 1AY1L 2PO6D 1AOZA 2W07B 1CDJA 1JK9B 4FQQB 4I4WA 3IIXA 2XUWA 3U46B 3T3MF 5IMMA 1Z9MA 1ZZMA 2Q8BH 3T6WA 4XMUA 3PHOA 2P5WB 3PNUA 2F19L 3V10A 3FO9B 5DHMC 2BH0A 2R23A 4UIKL 3WQ4A 3OZOA 4HT3A 1I53A 3LH2H 2O5XL 3LSCA 1DQLL 5ANMA 3GH5A 4O53A 1NGYB 2BMBA 1NFKA 1UH3A 5KINA 2ZDSA 3RU8L 4YXLL 4FS9A 2PF6A 1KKRA 1MQQA 5ICYA 5JPNB 3N1GC 5HVHC 3EOYG 4PUDA 5EC1A 4JIQA 5EIVA 5JVLA 2C1IA 3QSTA 1RA0A 2XICA 5GGTH 2NY0B 4GUJA 1IGCL 3I6GA 3TH2T 1GGYA 2C6QA 3S6OA 1IGMH 4W9EC 4C6KA 1EC9A 5M2FX 3R10A 1G1CA 2D73A 4KRPC 4PGZA 2FR4A 5HI4D 3FQXB 4UTMA 2VSKB 5EOQH 3D85A 3HC4L 2X6AA 4BFBD 4YR6A 2WZHA 1VAHA 2X9YA 2Y25A 3QDJE 4RNRA 1MRDL 3WYRA 2A9ML 4ZMPA 3Q05A 4GXUN 4KKXA 2V7NA 3UETA 3QG6B 3IDGB 3CBKB 4L8DB 4JJ5B 1YAZA 1G7LB 2ZPKH 3NVQA 3E3QC 4GZEA 1V77A 3E3QE 2WNKA 3N43F 3W7RA 2R1XB 3C9NB 5A94A 1VZGA 4FP8H 5EDSA 2FO1A 2AEIT 3LVEA 1CD8A 1FYHB 4DJMA 1ME8A 3LCIA 1DVSA 3S2MA 4XCYB 1NBQA 2DQMA 4HK0B 3O0LA 3PM6A 1WT5C 3BO9A 3RVXD 4KQ3L 4DZHA 4O4VA 2VAAA 2C7UA 1X97A 5E0QA 3GX9A 1SDDB 4S1SH 4JRYD 5ETUA 4L1SA 3UC0L 3D06A 5J5RA 2G0LA 3G5ZA 1R85A 2ADJB 1MF2L 2QPDB 5EEXA 5DUBB 4LOUC 3EBGA 4XAPA 3RY6A 4JL2A 4HTYA 4P4KB 3IRSA 1BFVH 2CO3A 1X7IA 3WQEA 2UZ9A 4HHHA 4WK0B 4HMCA 3DFTA 4F5CA 3OAZK 4WHTA 4IIFA 3IPWA 3P1VA 3QQ4B 2JJUA 1OP5H 1ZT1B 1CF8L 2A4CA 4HIBA 1KYOK 1T1WA 1L6PA 1XH3B 3U4BL 1XRFA 5H1WA 1QFWL 2Q3AA 3GTFA 5I6XB 3URQA 1C08A 4R0LB 5AC4A 2F54A 3HZYB 5TGBA 3UYPA 2OXGB 4LCWA 5DS8A 4XN9A 1GC1L 3HS8A 2X1WL 2OLHA 5FO7A 3PPFA 1I7RB 4S2BA 4P5MB 4F1SA 3CSYB 1YTEA 3INUH 3QPKA 3D18A 4ZS6C 4D9RD 1MI5B 2QGCA 4DBEA 3AAZA 3O3EA 4ZNCD 3OHMB 4JTEA 4XZMX 2AMXA 4OB5L 2ZOKB 2AF2A 1QPKA 1WFJA 1JFQH 3AJXA 3G5YB 3AWFA 2YKKA 5JIMA 1SXZA 1A02N 1E3ZA 3NP4A 1V02E 2C34A 4APQC 4Q0XL 3N1PC 5KBKA 4L4JA 1T7VA 3W9DB 3HG2A 2OU4A 5HMFA 1UGNA 3DDMA 1H3PH 3NK4A 4DW2H 5B38G 3MBDA 3RFAA 3W00A 1JRBA 5C0JB 3QG7L 2AXGA 1TNMA 3MMTA 4ORIA 5I71B 2IWFA 1EZUA 1AD9A 2YL8A 3DEQA 1YPIA 2EDJA 4KJPD 43CAB 2CHZA 5HI3D 5EN2B 3GXNA 4OUOA 1A4BA 5CPLA 4FQIL 1TU2A 1K8CA 5A3IC 2VM3A 3ZX1A 4MKVA 3NO3A 2YC1A 4NWTL 3F4CA 3KPPB 1ZGLB 2X0WA 4L3FA 1ADQL 1LROA 5LHDA 1UROA 4ZTPH 2BWDA 3UR2A 1AQFA 4N6FA 1ACZA 4F0MA 3TN0C 3D39D 5CPSA 1KPUA 4GYBA 3KEHA 4H44C 3BKYL 4NS0A 2OKOA 1GKQA 3E9UA 4F7EB 5H4ZA 3NAAL 3DO3A 1VPQA 3IPBA 4EZLA 2FO4A 2NR6C 3WQPA 4OIBA 3IJHB 1RY8A 1DE6A 4HA4A 3NDYA 1TKKA 5BQ7B 1V6UA 4H9TA 2FB4L 4JREB 4P7RA 3FBKA 4BWUA 3CSFA 3NL6A 3UZVB 3HW7A 2N0KA 3WH8A 1BM7A 3HEIB 3FFCD 4L1LA 3VXMB 4DEPB 3DV4B 2E27L 4QRRA 3DXAB 2Z7YA 5FKYA 5T1KB 3Q3GA 1T6VN 1FG9C 4PJCA 3WO3B 1OAQL 3PCYA 5JW3L 1ZJIA 3MSPA 3WF3A 3QH3A 1W15A 3I6KB 1FZOB 2Y7OA 2Y0SA 5MERA 4YX2H 3SUTA 1HHGB 3LJ3A 1AKJD 4UFIA 4MA1C 5BVJB 3V79C 1EEPA 1QLFB 1E2VA 3LGEA 5FFOA 2AQVA 1SNRA 5DRXB 2VX5A 4MS8D 3K8LA 4UM9A 1VZWA 4GG6F 4K8GA 4AX3A 3QJSB 2VR7A 1FWFC 1U58A 4XXCC 3EKCA 4D0DB 3RI5K 1FLRH 1R3TA 2BTMA 5H37A 4RE0A 3EB2A 3NJGA 5CLWA 3BOLA 3IGFA 4EPKA 3TUUA 2NX1A 3EFFB 3SCMC 3IU3A 4I85A 3IFOA 4NQEA 2X16A 3VFSB 2YJQA 3P9MA 5TDNB 1HX0A 4YHOH 2BSEA 2BRRH 1W0VB 1HINL 1N6VA 1BVLA 4G43B 2CLRA 1E4LA 1NZRA 5FL0A 2J7FA 4IMKC 3FU3A 3GSQB 3FDKA 1HEHC 4N4PA 4RAHA 4Y2NA 3E7JA 3VXQB 1RMFH 3KYNB 4LKCB 4HJEA 1KV8A 4JPWL 4PB9H 4FI4A 3T0BA 2FT8A 4ALDA 4ADSA 4B4FA 3BAXA 3NPXA 4FHKA 2H1PL 3RDTB 1EGJH 2R0WL 1K77A 3HRZB 2B4CC 4QF1B 4FG4A 3I4EA 2WMKA 1LJMA 3UBXB 2VLJE 4PS7A 3S36H 3RUGA 4NKCA 2R69A 2XV3A 4AF0B 1KT2B 5A2LH 4KGJA 3AROA 3KYAA 1KZYA 2JSFA 5DBTA 4NO5A 3EWWA 3VSVA 4ELMF 4HVBA 4AMWA 4XPTH 4XVEA 1X5HA 4A7QA 5K59F 5DFTA 1ZPTA 4MG4A 3KDNA 4Q2ZA 4DVOA 1NJ9A 1V0MA 1N26A 4JQ2A 1HYSD 1XXXA 5FGRA 5I3DA 3T6QC 3EJQA 5I03A 2YDRA 5CR8A 4TQ8A 1TT6A 3GHRA 1FGNH 1LYQA 3AMKA 1S3RA 3QY7A 1OB0A 4IP7A 4GG9A 3ELFA 1KBKA 5CPTA 2BP0A 2P5EB 4P7QA 4NBYB 5C0BA 5BNKA 4CVUA 5FGSA 3FEQA 4WW1B 1U95A 4LQFL 2WTRA 1EAPB 1E90A 4AD5A 1MIMH 3LTSA 3GQFA 5D7LE 4MZ2A 3QOKA 2NUYA 1IGIL 5FF2A 4MJ4A 1JPSH 2YRBA 2NLIA 3L6FB 1QRNA 3O0RH 4JMNA 1CN4A 3S37H 1GPFA 2AI0H 1NCJA 4D7BA 4DO6A 1XIDA 5EZJB 5CPQA 2E4TA 3V0FA 1NBYA 4B5UA 3VFVA 2W0UA 2OPCA 3OJMB 3WBWA 4PBVC 4TNVK 1U8MB 2WJZA 4H0GA 2P8LA 1OGTA 5I16B 4N85A 4DZ8A 5DJXB 1TO4A 5EOTA 3W2LA 4X6CB 3ALPA 4PN2A 3K4DA 4S1DC 2VR8A 2FGBA 4I9WD 4AD0A 3HKFA 3WLRA 1W0MA 1YEEH 3WUWA 4U49A 1C9WA 2OEKA 2WSKA 4H8UA 3MLRL 1RZQA 2OT1A 3WSQH 3RB7A 2VMJA 5AG9A 3UG5A 4FF9A 1XGTA 3CVDA 3WH9A 1IXQA 3J7HA 4BFOA 4A4AA 4Z8FL 2A73B 4MDOA 3ZYJA 4U1NA 4LT9A 3V1HA 1IKFH 1P6BA 2FWOB 4PS8A 5EU4B 1H6TA 5I3IA 4HBQA 1KTDA 1B3VA 5AG8A 3K2UH 1KIRA 4LYRA 4Q4OA 5DR5H 1J8VA 1AZ1A 1BTCA 4MQXC 3BLLA 1FL6A 3TEXA 3OKDB 2GVGA 4ZXBC 3VWJB 5C0DA 2VFGA 4YL4A 2CR3A 2H9AA 2J4WL 1XRSA 3BP4A 4HA3A 4HUNB 4M6QA 1ES0A 5JMRA 3UTSA 4CMMA 3UPRB 2E1WA 4ZAKA 3GRGA 3DJZA 5JU6A 3HMXH 1BYCA 3KL5A 4JNXA 3WD1A 1Q1JL 2IV8A 4WNJA 4MA8L 1VHPA 1WZ1L 2NXYC 2ICES 5I1CL 3LDBC 5DQPA 2X4PB 2PB1A 1PIGA 3L5WB 4KV5F 2YD2A 3G1AA 5T5FA 2PDKA 3VI3B 3NEHA 2RBLA 4P59L 3AXLA 1A6WH 3I3BA 4DIXA 1V54B 2ED9A 5HYJB 3VTAA 2ONEA 1CDHA 4K15A 3QEZA 3S3JA 3CZSA 1IV8A 3LIZL 4DJEC 4DIAA 3GSUB 4P3DA 3SDDD 3SPHA 2EIMB 4XH2B 1NF0A 2BVDA 4UDUA 1C7TA 1SBSH 4ZMYA 2COQA 3QUZD 1Z41A 1E9OA 3G6AB 5FC9A 1P9MA 3WNKA 2HTLC 3WDPP 3HC3L 4E5XB 3GTXA 3UU0A 3L65A 2B31A 5I02A 2HT2C 3AIQA 3IDYB 4ZMOA 5JW4R 4L1WA 3VC6A 3U2EA 4LSQL 1EV2E 2Z91A 5E6IA 3G08B 4D8PA 5L9DL 3T42A 2CPUA 5BS0E 2UWEA 2R2BB 3P8IA 1TEFA 3H2FA 3OX8A 1JGIA 5CG7A 4IFKA 1H0DB 3UY7A 1DANT 3STEA 4OT1L 2VURA 3C3NA 1UM5L 4ANWA 1CNVA 3ARVA 4K8HA 4I1NB 5DA4A 4U31A 4BRJA 3I6TA 4MNHA 2R1NA 5I09A 2WWNA 5B7ZA 1I2PA 4DLFA 4G8GD 1IE7C 4X2UA 2DQJL 1HXYA 4MHHI 3RY5A 3VTTA 3N9GH 4XVSH 2Q7AA 3CN4A 2ZKWA 4R8WL 3L9CA 2CUIA 3N41B 4MFHA 3Q1SL 2MQGA 3NYZA 3I50L 2V67A 1IU1A 3QXBA 2QSVA 1N8WA 3W2DH 3BKMH 1Q6EA 2Z29A 4IPJA 1O6SB 4ZUUA 4JGNA 2V5TA 4NGHL 2R27A 3Q8BA 3KHJA 1K7FA 1CIDA 2R7EA 2KKQA 1IEHA 1HZLA 4EN3A 4UR7A 4HJGB 2CKBA 3MRPB 1UADC 4XNAA 3E0IA 4JS7A 4NXKA 2F0CA 2FZ8A 3I02B 12E8L 5MF5A 5D9NA 3CQQA 1OF6A 1ED3A 1E6RA 1EX5A 2GUYA 3OXSB 3MMEA 2R1MA 5H2BB 1NPJA 3AS2A 4HFWA 1E0VA 3TR2A 4CAGA 3GYCA 1JNNL 3MLVH 2NNFA 3QPYA 3WCYA 2E7BA 2DBLL 2E59A 4WU7A 3SYOA 2C1PA 3OKMA 8FABA 1KEML 4DP8X 1FL3A 4RWYL 4PD4K 5BOZG 3VD0A 2IXUA 3STBA 4BEUA 3U9UB 4YIWA 4PP2B 5IMOB 5CSBA 4BQ5A 1Z9OA 4N2FA 4QOKD 3FCSB 3G1VA 3MRNA 3BWZA 3LMZA 3PP4L 1WS7A 2PLCA 3OKNB 4AC4A 3BD3A 3WMBA 2DWYA 4PRWA 4V15A 1ZAIA 4JQVA 3LS5H 2BFVH 1ZLVK 2QJGA 1XI3A 4IOSA 4OI8A 3RM9A 3VTRA 5LNGA 5GHWL 3OZ9H 3DMMA 2H6PA 2PDJA 2KPNA 4OHQA 2FFCA 2OZ8A 3EYSH 3VW3H 5L8KB 1DQWA 5KSUB 3NJHA 4I0CC 4M5ZL 3FYOA 3WH6A 3TZFA 2OO6A 1S5HA 2H3KA 4EP8C 4EAMA 3IDNA 4CW1A 4LS1A 4F80A 1A4MA 3GMLB 2YLKA 3ZE2F 4PJXF 3RVUD 2IPGA 2EDLA 1RJLA 2ABAA 3T8XA 3EOBA 1V3LA 2YBGA 5KYWA 1SW0A 2Z2AA 4HGKC 1X3DA 5F9JA 3WIHL 3W0WE 4ZPTA 2PLMA 4ODTH 1JYVA 4DYJA 3VFWA 3AMLA 1I31A 3UWVA 5C2CA 2YBVA 4OV5A 5FM5M 1B30A 4YUEH 1K8IA 3ORJA 3KBWA 4XGZB 7PCYA 2VRQA 3G9AB 1B0IA 2Y1VA 3DFOA 3HLKA 1N70A 3BVXA 1OTUC 3G0SA 1VFTA 1WLHA 4AVIA 4WUUE 1VFMA 1I9IH 5EU6B 4PTTA 3Q7JA 1OP3H 3GSVA 4MYAA 3WN5B 5GNXA 4MJIB 4FEZA 5JHLA 5H6HA 3M7OA 1TVHA 2X42A 3QZMA 3MC0A 4FG0A 4XBEH 1UR3M 3CIXA 1NDZA 3ZTJH 4M7LL 1UFUA 3X3FL 1J5SA 4Q6YA 3PZIA 2G4FA 2A6KB 4AEEA 4XO4A 2YSTA 1Z2KA 4FZIA 1JPTL 1DJQA 1OGSA 4NZ4A 3KPSA 4K7PL 4QLKA 3T1FB 1S1RA 3VOHA 3EO1A 4GQ9L 1UP0A 1EEQA 2Q6WB 4QWWC 1VJZA 1ORSB 3ZO0A 1AD0B 3CLFH 1NAMA 4AGNA 3VQ1C 3WTWA 4B41A 1TXKA 3KXFD 3WXWL 3QFJB 2ALDA 2QUVA 3CX5K 1DVJA 1H9VA 2PCXA 2CO2A 3MY9A 1JFHA 1ZHKB 3IJ7A 4CD4A 2Y88A 3V6ZB 3UMTA 5FLUA 3MTWA 3CLMA 3K6DA 1AR2A 3IGSA 4Q9BA 3WJMB 1W5MA 4UNVA 1JGEB 3F5WB 2YLAA 1YZZA 3EH3B 5FYKD 1LP9B 3PHQA 2VEPA 5GS1B 4ODXB 32C2B 3PPCA 3R0NA 4K6AA 1AQ0A 3D4YA 5EEWA 1VA9A 1UACL 1BQGA 1HC1A 2D69A 1RIUH 3ZL4H 4C7GA 3W38A 2QPUA 3NMEA 2QELA 4P04A 3OBKA 4MD5B 4N2MA 3VFLA 5FKPA 2J2ZB 2GAZB 4FE9A 3WTUA 2VXUH 2IUZA 3TOYA 4RZ4A 3GIQA 4DWSD 1R7OA 2EE6A 3CN1A 3OKOB 3L7RA 4L4VD 1XF3A 4QJ5B 4PL2A 3N42F 3X13A 1HYRC 3HIZA 5DQJA 4FNQA 2P46B 2YGOA 1ESWA 7TIMA 3DFHA 2UX7A 3GJEA 3FXYA 5REQB 4ERGA 2VLME 3LBOA 3V9FA 5I18H 2XTLA 3AYTA 3L3OB 2O4QA 4G82A 3STZB 4IGBA 4ECNA 2FBOJ 4YMZA 5JBFA 3CL7A 4KKZA 1DJGA 1TSHA 2YA0A 5IXEA 4MHBA 1CB2A 5BUPA 5IB5A 3V95A 3AY4A 2Z31B 4M81A 3PSWA 1PS3A 4ZTXA 2XG4A 4JG9A 3HPAA 3ILPB 2BSTB 4XZLX 3WTXA 2PS2A 1EFXA 3ARDC 2P8MB 4N02A 3PG8A 1GPWA 3P0VH 5LG6A 3GVWA 4B60A 2AV7B 3QIUB 2FZDA 5HYEA 3PWJA 3PUUA 4EE9A 1K4DB 4NUQA 2PP1A 1DBTA 2EXSA 3AXHA 1GGOA 3LNMA 4U6XB 4GGHA 4YH6A 5E6RB 3GIPA 2J88A 5INDA 4YFEA 1R38A 4OBRA 3D09A 4PMVA 3VNYA 3G6LA 2NSMA 4AVJA 3O2VL 1G5AA 4L6HA 3L4ZA 3WDJA 1A5FH 3SDAA 3P9LA 2J6XA 2J8TA 2YD3A 2VQTA 4YNGA 1NVMA 2WWOA 3H3PH 4MWAB 2QJNA 3G1FA 4MPKA 4RISL 3V3WA 3MOAH 3CC1A 4P2YA 4ZFCA 5EO9A 1EXBA 4ZUTA 3GE7A 1N12A 5CSRA 3WS6A 4NSBA 5CMAA 2DZUA 1E5BA 5EOCH 3NVDA 2ZG1A 2VB5A 1EZWA 1RL1A 3CZJA 3GSNL 4JO1L 3HLAB 1KNWA 5LXGH 5C09E 3TBCA 3WIJA 3RTLA 1MHPH 4FB7A 3EJSA 1W6WA 1ZV2A 4I9TA 4JM4L 5DLMH 2PPCA 4G1EA 4HGXA 4G5ZL 2BVOA 1MHHA 4Q9QL 1BGGA 1K4GA 4NZDA 4XXDA 3B03A 5EZIH 4KXDA 2HKFL 1LEGA 5H35A 4E9XA 4W8LA 4ZFMA 5KEZA 4MAYA 1BEXA 3THDA 5HHQB 5F7BA 3VRJB 5EUOE 5KYXA 1UQYA 4LRSA 2RFXA 3OPZL 1E4WL 5IF0B 4A2EA 3WD3A 3TYZA 1IGWA 2BSDA 1DSYA 3OG6B 5DS2A 4NN5B 2I7GA 2XJLA 3NIFF 3D85D 3GKWH 4FXKA 4IIQB 1IWAA 4PS4L 3PFUA 2L7QA 3CPLB 2A0NA 3HUJB 4XPHL 5FUOH 4HZ8A 4AHOA 4Q89A 1S3KH 4N1EA 3WUFA 5LNVA 3PK7A 1U3ZA 1CGWA 4GXUM 4WEBH 3O6DA 2NQDA 1S78C 5FUZL 4FR1A 4N87A 4JY5L 5I8CB 3DFQA 3C5SA 1UD3A 1FPTL 3U48A 3MV8B 2IF7A 4YEEA 5LGZA 1ITXA 5GRVL 3JW7A 1EWEA 3HN8A 1BG4A 3KL0A 4Y5YA 3OKKA 5IQNA 1W91A 4Z0BH 1J8HB 3Q1EA 5CJ5A 4PRBA 3QRBA 5DEFB 1Z6KA 3VYPA 5GZNC 3BSMA 5F9OH 3G5WA 4B9YA 3IKCB 1GC1C 1ZLWH 4V33A 1KLZA 3H6AA 5EEYA 2NY6D 4OV6F 3I9AA 4PUJA 1Z3RA 3P0WA 4GAYA 3OAUL 1CEOA 5I17A 5HYSB 4D9QE 3H2CA 2ZYRA 1EJWC 5SWSA 3KPTA 2PWGA 4FLHA 2C3GA 2PDLA 4NJ9H 1Y6MR 2F54D 2RMNA 3H3BC 4BFJA 3LZFL 1HCYA 1U41A 3DX7B 3JUGA 2ZYFA 1FDLL 1VF8A 2EUVA 5CR1A 1QI4A 1AJ7H 4WW2B 1WFUA 3UR5A 2ZFAA 4XHQA 3Q2WA 2MKWA 2VXSH 2VUYA 1HS6A 2BM3A 1G87A 2C9PA 3OKEA 4NP4L 5J5EA 2HJPA 1FBAA 1XF0A 2YPLA 5F7NC 2HS6A 1UXMA 5AOKA 3R12A 4BDVA 2Z1PA 1XIGA 2WIIA 4OGZA 5D2VA 3N2TA 3CB8A 4IBLT 1LRTA 3OSVA 4HQQL 1ZKAA 2CLOA 4U3AA 3TSDA 4TUKL 3RM8A 2YO3A 1H6FA 4J7RA 5ICUA 3VKDA 4N9DA 3MUJA 4XTRD 5IBUB 1JTOA 1TTPA 1E56A 2PDYA 1HUVA 2ZJSL 4HC1H 3F6JA 4F91B 3OP2A 2MEJB 4FQ1H 1RZIA 4PY8I 4RGOH 1H51A 1D5XB 2D2JA 5F2FA 4PM1A 1J1OL 4YNYA 3T07A 4QYOB 4G6FD 3KRZA 2AV1B 2E7LA 3WTYA 2FYYB 4NDMA 3QNZA 4YBQC 1E4HA 4C5YA 1QFHA 4I9MA 1QR1A 4IOIA 4KEUA 5HWNA 3QJOA 2CKNA 1WD9A 4EIZC 4LRIA 4IBZA 1P1XA 3N73A 4QHUA 4HWUA 4Q8OA 3FJ6A 5J11B 2AMUA 3HGJA 4FN0A 3BGJA 2A2QT 1EXUA 2OZTA 3R58A 1SOXA 5SX4H 4ELDA 2J73A 3EHBB 1ZLDA 1ZLVH 4LDLB 4P57B 4XNZC 5DEGA 5KOMC 4XNBA 5BRPA 1AGDB 4DPRA 3GPEA 1TSRA 4HUXA 2AXWA 3COOA 4OJFH 1XR8A 5ILTL 4QRRD 3AT8A 3BJTA 2NQHA 2XGBA 5D2WA 3RZCB 3A3YB 2RJGA 3EJPA 4UWQB 1MQPA 1UJPA 1IFGA 1P6FA 1S9VB 4AJYV 4BSJA 4GW5A 5CIPB 1EDYA 3G6JE 2BP3A 5HBFA 1OVZA 5BJTB 2E6FA 1JN6B 1MY7A 3M8OH 2HX8A 3TYBA 3RUGF 4UM9D 1XSKA 2ED6A 1FNSL 2ZQ0A 1GYAA 4OSUH 1IBHA 3U0TA 5CBBA 4QRFA 1XXDC 2EDBA 5E4EB 5DJ6A 3F7VA 3W72A 2CCWA 4FQXB 4BQBA 1VCVA 1G7JA 1KJ3H 3LZPA 1ZAJA 1OK4A 1WWCA 2QQNH 4GW4B 3QEQA 4F9PC 1JCJA 1VFBB 4KQ0A 4AIZA 3A3HA 1JWMA 3OGCB 2ZONA 4YHYB 4IS6B 1VFHA 2EYRB 4P5TC 4NQED 4WNQA 3FRUA 3QDJB 3C5JB 3NCXA 1U36A 2BSED 1MH5A 3LBCA 5KYUA 2W0KA 2HZGA 2C9QA 4JO5A 4PRIA 1NMBH 4OTXH 1CICB 3F64A 2WHMA 4MB4A 1NMAL 4JVWA 2NY1C 3MCNA 1SVBA 2R1WB 4IISA 3EO0A 2DEWX 2HLFC 3S7GA 1AXIB 4Z7UF 2O9PA 4YFLF 4JQXC 2Y5EA 4Y4HA 4Q7NA 4D3CL 3CMJA 3QCVH 4Z7WB 3VO0A 4UFKA 4FMKA 2XWZA 3XINA 2YDSA 4OLZH 3MJGX 4WWNA 2XACC 3F03K 4LSPH 5DLCA 5GQBA 1JVOA 3GDRA 4GBXD 2RDUA 1UCBL 1GVFA 4R84A 3A23A 1IC5H 4G7FA 3NIGB 1DTNA 1P4CA 1MY5A 1WZKA 4O5LL 4X6DB 1W2KT 2N01B 5E2VH 4QLRA 4RRPM 4UBDD 5F2LA 4WCJA 3C08L 1N67A 3B5HA 4HV8A 5BZWB 3GC2A 2ADGB 1HTIA 1I1AC 1OFPA 2M2DA 1INEL 4JJHA 4OTKA 3V0WH 3VXOB 3LPGA 3UAFA 3MLPA 1K6QH 1MFAH 5KAQG 3DOSA 4V1DB 4UTTC 2GSGA 1A47A 3L48A 3RP1A 4HH9A 4LOCA 1CE6A 4YHKL 4FL4B 3WKNA 5I3JA 4X7SH 4OF6A 4JZOA 5C0BD 4Q4KA 3KLHC 1R1CA 4Z76B 1NL0H 1HAUA