3H55A

Crystal structure of human alpha-n-acetylgalactosaminidase, complex with galactose
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
387
structure length
387
Chain Sequence
LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-N-acetylgalactosaminidase
publication title The 1.9 a structure of human alpha-N-acetylgalactosaminidase: The molecular basis of Schindler and Kanzaki diseases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 127
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3h55A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3h55A01
4UQDA 1RD5A 3TU9A 1YXYA 4J9JA 4LWWA 4HN4A 4UTWA 4DPPA 3TC6A 4TX9A 5AHIA 3DXIA 2Q8LA 4DO4A 3CM4A 3G1SA 3NPVA 4NJJA 1VGAA 3KRSA 3HG4A 1LRNA 1EUAA 1QOQA 3SR7A 4CNNA 3WY4A 4OIFA 2V2HA 5ABTA 5LHEA 4YCOA 1P4CA 1H7RA 4XBSA 1F7BA 2V3EA 3STEA 2E8ZA 2BXVA 5LNRA 2VOMA 3W7QA 1DEDA 4XTDA 1ZHAA 4ORMA 3IJ7A 3W83A 2ATMA 3HJZA 2WSQA 2BY1A 3GDMA 3SECA 3STGA 5D02A 5E9AA 3WNNA 2RDUA 1XCFA 1S3HA 1UD2A 2OZ0A 1B57A 1WZKA 3B0VC 3W7MA 1PS3A 4EIVA 3NVTA 1TQXA 1TMHA 5DXYA 3O05A 1QPKA 5K4XA 4EF9A 1KFBA 5TD4A 4LVDA 5E93A 2B4GA 3L2LA 3QPZA 4UZUA 1TCDA 1OT2A 4UTLA 3NL2A 4GUIA 4LW7A 4GUHA 4RZ4A 1JFHA 3MYOA 1QHPA 3HBLA 3VI2A 2YOCA 5AHNA 4PSPA 2X2JA 1W5MA 4O17A 1QWUA 3FAXA 3TMLA 2V30A 1CXKA 3EB2A 3KL3A 2ZX7A 3ZO9A 3NOEA 3TDFA 3ZR5A 2WKJA 1IZKA 1CXIA 4OV4A 1PE1A 1VYPX 4GBUA 4OV9A 3S42A 4EWND 4N9BA 4OJYA 5AC7A 3OBKA 4RJEA 3BAJA 1QI5A 2QDHA 2O7SA 5U4NA 3Q58A 1QWNA 2QCMA 4ALDA 3G3MA 2NUWA 4JTUA 1I8JA 4K6AA 4Q33A 2YXGA 1LDCA 1PZ3A 2TMDA 2W79A 3FKRA 1KTBA 1AK5A 2NWSA 3NGJA 1H61A 4NJIA 1QMLA 1HL9A 3H55A 3B4UA 3WN6A 1PEZA 4QQ3A 1CGWA 3LRKA 4ATWA 1KLZA 2D2OA 7TAAA 2ZX6A 4MLRA 3B0UX 2F1BA 4KWUA 5DFAA 2QKFA 5D30A 3G0UA 2W6RA 3NL3A 3HGJA 2A7NA 5F4WA 2BY3A 4UCFA 1AW1A 1JDAA 2FPTA 1SPQA 3HGSA 3KRZA 2YKKA 3RLUA 3S1XA 4BI5A 3S9YA 3M44A 2EPHA 4PA8A 4I7UA 2E9BA 4E38A 4LVGA 3HPZA 1Y7VA 1RP8A 1TTJA 1OYBA 3HJEA 3PM6A 3TH6A 3BMVA 2NUXA 4QISA 3BG3A 4AEEA 4FNRA 2A6LA 4JY9A 1A5AA 5DY3A 1JDDA 3S6DA 1IXNA 3UG5A 1FQ0A 4ADSA 3UY8A 5G2HA 1AMKA 3D50A 3PULA 3A5VA 1XUUA 5E0KA 1PHWA 3P8JA 4QIUA 3II1A 3BO9A 3HF3A 4JXCA 4PCTA 3SY5A 2C7FA 4NX5A 2WSPA 1VAHA 3L4YA 1YXCA 5CSRA 2WNWA 5D2WA 5I3IA 4DF1A 1LCOA 2V82A 4N4QA 1MEHA 4GO9A 5AOUA 1TPC1 5E1QA 5FF0A 1AQMA 4MPQA 2C0AA 1FWRA 2WKGA 1TPFA 3KL5A 2JKPA 1G4EA 3VNYA 3O6YX 4UCGA 1G9HA 2PRHA 3WNOA 3GKFA 1TPB1 5E0FA 1JUBA 1OFRA 2V8ZA 3TJXA 4U4MA 3QMRA 1TJRA 2E77A 5EY5A 2YX0A 3RMJA 1NFBA 3G3DA 1E43A 1IXPA 2YA2A 3MBDA 1XM3A 4GKLA 5C5YA 1JR1A 1OYAA 2E1DA 5DCEA 3QQ0A 1K8YA 3PAJA 2E6AA 4CCEA 3LCIA 1M7PA 1KXQA 2GJPA 2QPSA 1TV8A 2EEXA 4NQ1A 4NX0A 1TYGA 4UFHA 5A6LA 4UTUA 2QUUA 3LCWA 1SMDA 4AMAA 4WXYA 2G96A 2ZZ1A 3CB8A 2H8XA 1ZS2A 2D0GA 5DCBA 5BMXA 4J3VA 1CGUA 4O16A 1XKYA 4GUJA 4ORIA 1Z42A 3IIVA 1WE5A 3ANYA 2QMKA 3C4UA 4NUWA 3BLFA 1XXXA 3ZR6A 1FWNA 1KBJA 2NWRA 2YW4A 1XSKA 1F73A 3DKJA 4IGHA 2OYKA 5CLWA 1I45A 3LTSA 4O50A 4OHQA 5CPOA 2F7OA 4IOTA 5C2XA 1RVGA 2DZXA 4M5PA 4O53A 3KHJA 2ZIDA 3W7GA 5D38A 4Z1BA 3GXDA 1RR2A 5I3HA 3O06A 2AQWA 4S1FA 1WQ5A 3W1RA 4UTMA 3O1NA 1U30A 3EDFA 4Z1DA 5LNVA 1B0IA 4JD4A 1PIIA 1SSDA 4FLSA 1F6PA 4HOZA 3VNDA 5DY2A 5G1TA 5AYYA 4QITA 1VZWA 2QJHA 3L5AA 1T0OA 4QNWA 1UD3A 1GVFA 3GBDA 3FLUA 4UFMA 5HINA 1JCNA 3ATZA 5F4XA 3L9CA 1SUXA 1V3KA 1CGVA 3STFA 3BAXA 1QAPA 3VNZA 3BG5A 3OA3A 4K8EA 3PBYA 2VR5A 4N6FA 1QX1A 2AMGA 2F7PA 4X9YA 1PIFA 4JYFA 1NVMA 4JYEA 1NOFA 4UNKA 1W3NA 3WMSA 1LM1A 3VKJA 3BVXA 1S5WA 1G6CA 3R13A 4CNOA 2E68A 2TSYA 3M7WA 2OSYA 5F2GA 1U5JA 2PE4A 1UH3A 1MWOA 1LORA 2EHHA 3B06A 3KAOA 3QMSA 3QQ1A 4XUGA 3MJYA 4WX2A 1VFOA 2XFWA 3IIZA 3NA8A 4MLJA 3EDDA 1FCQA 3WK3A 5D2VA 5EMUA 1D7FA 5D05A 4FIQA 5F4SA 4CGTA 1GPWA 4LOCA 2VFEA 3W7IA 1TPVA 5KEZA 3B03A 2NT1A 4RXGA 1KXVA 4JFUA 1ZALA 2J9ZA 4NXKA 4RZ6A 5A8GA 2FH8A 5AHMA 3EX3A 4MYXA 2EADA 3BMWA 1UD4A 3L4TA 5AB3A 4BF9A 4OBTA 4AEOA 2C3ZA 2V81A 3UZ5A 3C0JA 5CG7A 3EJUA 3GB6A 1OYCA 1CI1A 5AYXA 3EXSA 3B05A 4GIAA 1R34A 5CZJA 2NV1A 3TSDA 4BI7A 3BK0A 2VNCA 4AWTA 3P62A 1KBIA 1B4EA 1LP6A 2C18A 3EKZA 5CLTA 3FOKA 3IRDA 3TSBA 4CLMA 3PS7A 1L9WA 3W71A 4WLCA 1LBLA 1ZAJA 3PC0A 3FKKA 1E3XA 4HIBA 3BW3A 1UH2A 3CWNA 2YZRA 1LLZA 4JIQA 4HA1A 2FJKA 3LBCA 1HUVA 1PCKA 4CN1A 2FFCA 3W7DA 2G97A 3ZSTA 1MVYA 4M7TA 4Q32A 3VX1A 5D04C 2VENA 2GVJA 1FWSA 3IIOA 3O6DA 2DU2A 2GJLA 4HSNA 5HWJA 1FBAA 4H8UA 1XC4A 1QFEA 4BA0A 3W1NA 4JFWA 4O12A 3LPPA 4NNAA 1OFOA 3JS3A 1OX6A 1MXDA 4O1BA 4AVFA 3WNKA 1JCMP 3CV5A 4Y6GA 3G1HA 4LV9A 5I23A 1DV7A 3IJ8A 2QJIA 3N3MA 2GJRA 2WVSA 4AIOA 2ISWA 4IMEA 1JUKA 1VC4A 1O5XA 3VU2A 4FEZA 3W3OA 2EACA 1XBZA 3GIYA 3L21A 2ZWZA 2XIBA 3QZEA 4O57A 3WNPA 1A5BA 1OFDA 5G2WA 1TPUA 3L2MA 2BXZA 4WUIA 2ZRXA 1H7XA 4O13A 1IXQA 3H54A 5CGTA 3CC1A 3WNMA 3HPXA 3VGEA 4I9AA 3K1DA 4OKDA 3WENA 1BLIA 3GDTA 2C8NA 4AMXA 3ZWTA 1FDYA 3PF3A 2R94A 3W1TA 3NR0A 3LHUA 1EO5A 4QNEA 3S1VA 4DF2A 2GVYA 3HG5A 1GT8A 1TIMA 3TQKA 2BY0A 4MFEA 2AGKA 3L4ZA 1NEYA 3EXTA 1A50A 2IGTA 1K7FA 4NZFA 5F2IA 4CKQA 3A47A 1IIHA 2PWFA 3I7QA 1AG1O 1TQTA 2UV8G 2NX3A 5HWNA 2A4AA 5TIMA 3W2NA 1TPEA 3Q37A 1DVJA 2DZUA 3MHFA 3P60A 1AL8A 2NXHA 3RK8A 1UA3A 3BAIA 4UMCA 3WJYA 4TR9A 4IUOA 2A7PA 2WSRA 4LS1A 3KLLA 2ZA1A 2I9EA 1KTNA 4KWWA 3S1WA 3NQCA 4JIPA 3NQMA 2OJPA 3VMNA 3DU0A 2EKCA 2GPTA 3EJTA 3IIXA 4HP5A 2XWEA 4M6VA 1OFPA 3NQAA 1XD0A 2Y5EA 5AHFA 1O7DC 1MW0A 1QWGA 1EO7A 2XVLA 3CZKA 3O15A 2FTPA 5FF2A 3NQ6A 4A3UA 2RFGA 3M6YA 1DBTA 2YA0A 3F1QA 1UB3A 1HG3A 3SZ8A 3P74A 2Y6ZA 3G1AA 3LBMA 4TVUA 2A0NA 3GXIA 2QAPA 2TRSA 2E6FA 3DFOA 1KLYA 1YDNA 3OLDA 2GUYA 2E6YA 1VHNA 3AO0A 3K8LA 1PZ2A 3DFTA 1JF5A 1CXFA 1TQJA 3CPUA 3DI1A 1Q6OA 3W75A 4FB7A 1VIWA 4LT9A 1D3CA 4N9DA 3W1MA 3L68A 3N9RA 3BCDA 4AMWA 3QM3A 1LZOA 1VYSX 4DO5A 2VC6A 3B0PA 4H8VA 4O8RA 2AAAA 2XN2A 1ME8A 2NZLA 3BG9A 2LLEA 2H3BA 3MI6A 3W7CA 1EWDA 1KGUA 4DQWA 1IGSA 1A5CA 1G94A 2BHYA 3AXHA 3W1PA 1UBSA 3WJSA 4JTGA 2ZXDA 2E09A 2FPVA 3ELFA 3TQ0A 4B9ZA 1K02A 2OT1A 1IV8A 1Q3NA 1VHCA 2EO7A 4AYGA 3BUPA 5HMSA 4PH6A 1W31A 1DJQA 4EF8A 2YIHA 1KFKA 4LY8A 4FMVA 1AQHA 1RQHA 3A9IA 1B2YA 3BVJA 3V75A 2FH6A 3KWXA 3DENA 4Z0JA 1QW9A 3DFQA 1L6WA 2YSWA 1ONRA 5GVJA 3CWOX 1PCWA 1KWKA 2WNZA 3IV3A 2FHBA 4J3TA 4U33A 2ZA2A 5IBXC 2H90A 3NEVA 1WXJA 4GWEA 5I5RA 2V0TA 2ZRUA 3AMKA 2YCEA 3HB9A 1JF6A 1MW2A 4JX5A 3EWXA 2CXGA 4UR8A 1ZENA 1G1YA 3RLVA 1GG0A 3G1DA 3QC3A 3MMTA 1JD9A 4NZJA 1F74A 5G4EA 1XCXA 1VLIA 2WQPA 1CXHA 4AW7A 5CPLA 2JGQA 3MWAA 3QYQA 1XUZA 1WZMA 2GQ8A 2QJGA 4NVTA 3QH2A 1QNVA 3TTSA 3G0SA 4IPJA 3W07A 4C1LA 1YDVA 2C16A 3TJLA 3W70A 4JL2A 2G5WA 1RQBA 1W3TA 2Z1KA 2Z0IA 5LGXA 2ZTKA 4U28A 3CZGA 3FYOA 1M7XA 3TSMA 2TYSA 1KCLA 1PS9A 2CLFA 3DFSA 2BTMA 5T26A 2WJZA 2V5BA 2XN0A 3SI9A 1U33A 3W7PA 1GVRA 3L2IA 2J9YA 3BVWA 3M43A 4O28A 3M0ZA 2Y62A 1MXGA 3H53A 4GE8A 2B7NA 1DHKA 8CGTA 1UASA 4JFTA 1TCMA 2QDGA 3BPWA 2BX7A 5K9CA 4FX6M 1TV7A 4IWWA 2R91A 1OSEA 3GZ3A 3CQ0A 3ZR4A 4LVBA 5KZMA 2A2IA 2HMCA 2FQIA 3TAOA 3VGBA 2ATSA 1O94A 2YW3A 1I2OA 1LRQA 2C14A 1KB3A 5EBUA 1LBFA 4RV8A 1LWHA 4O0ZA 3DX3A 3EWWA 1ZCOA 1Z48A 4O11A 1XBVA 1J4EA 3D0CA 5BMWA 1H51A 3C2OA 3IGSA 5AC8A 2ZBTA 3ABOA 3M41A 1SO6A 1JVNA 4LVFA 1W37A 4JTJA 2P1FA 4JL1A 2WO5A 3ZT5A 4LS0A 3S0CA 1ME9A 2DZTA 4J3XA 1KA9F 2ISVA 4GUGA 5H2ZA 2VELA 2W0UA 4W93A 3IJ9A 1MEWA 1RV8A 4GRSA 3G0XA 1EP3A 3TE9A 1G4TA 2DH3A 4FX7A 1QPNA 4FNUA 5HULA 2Q3OA 1EP2A 1S5TA 4JX6A 1VYRA 1GG1A 1JQXA 3DC0A 4AHOA 1ZFJA 1V5XA 1YPIA 2O7QA 2JK2A 1XH1A 4NJHA 1V3MA 2XWDA 3VX0A 4IX2A 1K03A 3EDJA 4IMCA 4UC5A 1X6UA 3LV6A 3M1ZA 3D4YA 3GAKA 1W9XA 3WK1A 2ZXAA 1F5ZA 3B8DA 4Y8FA 2ISSA 3W22A 3EWUA 1HO1A 4GJ1A 1BKSA 3KVMA 1OB0A 4CVWA 1WYIA 3QSTA 1RQEA 3ABRA 4MZYA 5LNSA 4HHPA 2ZXBA 2X16A 1JCJA 1H5YA 2C13A 4M56A 3P5ZA 1H62A 1W56A 5CZSA 3C8FA 4Z1AA 3I65A 1R46A 1YTEA 4E2DA 2X1SA 5I3KA 3K8KA 1O5KA 3W7EA 1H7WA 3C6CA 3S5NA 1KBKA 3E0IA 3VGDA 3QPYA 1WPCA 3CPRA 3OLEA 2V9DA 2OYMA 4BWLC 2VXNA 3NPXA 4KFNA 3R8RA 2XIIA 3BVUA 3GXPA 1H7OA 3P82A 2OW7A 3NNTA 3NAVA 1KBBA 2G95A 3ZOAA 4JTFA 4PC8A 5LNUA 1P6WA 3A24A 3W1UA 3E9AA 4MJMA 3BGJA 1PAMA 4RLIA 1HVXA 4MJZA 3S5YA 1BWKA 2CLIA 2WV8A 1SZNA 2OCZA 3KRUA 2V3FA 3VSUA 4TU1A 1TV5A 1JXKA 4H7VA 3TV8A 3TTYA 3RILA 1LWJA 1JUEA 1R75A 1R33A 1H50A 2BZNA 4WOQA 5TQLA 1KGWA 3L5LA 1Q6RA 3BUQA 4RKAA 3TQVA 1TPH1 5LGZA 5BNKA 3BUBA 1YYAA 1I2NA 1TPDA 3I68A 4N2YA 1YADA 1J0KA 1Y0EA 2ZTJA 3OVPA 1RPXA 3LOTA 3UY7A 2NT0A 1CPUA 4JGDA 4NJKA 1YTDA 4QJ1A 3M5XA 3EX2A 3TOPA 2QF7A 3DZ1A 4UTKA 5LKYA 2CHNA 4MY9A 3DH7A 3LI1A 5FI8A 3D52A 5A2BA 2OX1A 4I7VA 4MY1A 3LCLA 1D3GA 4C1KA 4GINA 1GTEA 3DKLA 1CXEA 3IK2A 1KW1A 3W85A 2CW6A 2AAMA 1KFCA 4UR7A 4JX4A 2B7QA 4M7SA 1XCWA 3ABQA 2E5CA 5D2YA 4CCDA 1TRDA 2X2IA 1GVSA 3ZWSA 5HUOA 3ZQ9A 2TPSA 5KTLA 3L0GA 4H2CA 4IJBA 2DZSA 2ZUWA 2H3DA 1GCYA 3R12A 3TFXA 6TIMA 4JDBA 3VCRA 3A22A 3P61A 3DX2A 2Y4SA 3FJ6A 5FF7A 1SZFA 3TXZA 5A5WA 4JTEA 4WOZA 4ZQPA 4Y9AA 1JCLA 4P2VA 1XBXA 1AW2A 2WANA 4IQLA 4B9YA 3PUEA 2DJLA 1XFBA 5I3GA 2FPYA 3NG3A 1ICPA 4UTIA 3UWZA 3NDOA 4HSOA 2A21A 4WY0F 3CGTA 4UQCA 2B0MA 2ZRWA 4CQAA 1H60A 5D09A 4BI6A 5DO8A 3WJXA 3NZ1A 3DX1A 1KV8A 2G3NA 1V3JA 3P5YA 1JQVA 3BAYA 2V5LA 1BWLA 1TTQA 4JYDA 4X3ZA 2WVVA 4K39A 4UTTA 4K37A 5HXMA 1HNYA 2F7RA 3W37A 2PRLA 5F2LA 1I75A 1T8XA 3STCA 4K38A 5AN7A 1GYLA 3CIWA 1ALDA 1DOSA 2IQTA 4ZVJA 2QAFA 2VEMA 3I6RA 1VCGA 2ZX9A 1F76A 1VCVA 3EJRA 3NO5A 4WZHA 3VM7A 4FNPA 1QHOA 3LLDA 1B4KA 2ZZ7A 3WFAA 5HDRA 1KM3A 4U2ZA 3NQ8A 1JL8A 4FHAA 8TIMA 1F05A 2CWNA 4PL1A 1VH7A 1A53A 4E2OA 3K30A 3UWWA 1BVNP 1ADOA 4O4WA 1QCWA 3LHVA 4JICA 4QSHA 3C52A 1K8XA 4DF0A 4TMBA 2XN1A 4LRSA 4H8HA 1SSGA 1Z41A 3C56A 4ZQMA 3NQ2A 1L2UA 4NNBA 1KTCA 1OVDA 1UUOA 2FE0A 5FF3A 1GOXA 3CT7A 1JXJA 1UOKA 1RZMA 3QF0A 2YDAA 2YYTA 1JAEA 4ZQRA 5G1YA 3UQNA 3UYCA 1RPKA 2WKLA 1PL9A 3IVUA 4JTSA 5FESA 4XTIA 4WY0A 2J6XA 2F1AA 1Q45A 3O6CA 5KINA 5LSMA 3NQVA 2Y88A 1EHAA 2NX1A 4LQ1A 3LX9A 2NLIA 3E02A 2ZX8A 3VMOA 2YFNA 3CTTA 3CZNA 1WZLA 1A5SA 3GXTA 1G4SA 4UQEA 2WOQA 1SQ7A 4R7JA 4ADUA 3RF9A 5K4ZA 3MHGA 4YXGA 3WEMA 1GJPA 3TONA 3LPOA 2QCDA 1SW3A 5DLCA 2ZZ3A 1ZAHA 1EH9A 2NXGA 2TAAA 2GQAA 5BRPA 3WJZA 3QSRA 4UQAA 2GOUA 3HG2A 2E5BA 4PODA 2VKZG 4O18A 4BK9A 4JCMA 1DKWA 1UJPA 2QLYA 3MP4A 4YWIA 1WOBA 3BGGA 4ZQOA 2DIJA 4FLQA 2PRMA 2QUTA 3GXNA 3UPBA 2ZUUA 3N2MA 1L0PA 4E2BA 1SW0A 1D9EA 1BEUA 3ZS4A 1QPOA 2XVKA 2PURA 4J3WA 1LTDA 3NM3A 4JTLA 1OJXA 1T99A 4HPHA 3P84A 1GYNA 2FGZA 3EJSA 1PIGA 3BAWA 4JCLA 4MFDA 3W7JA 3IVSA 3A21A 3DDGA 2HS8A 3BLBA 4WSJA 1H63A 1W54A 4O4VA 2FDSA 2P0OA 3CLMA 3SJ3A 5EMYA 3T4CA 3QEZA 3THAA 1JULA 3W1QA 1FX6A 3BLPX 1G7VA 4HKPA 2A85A 3U2OA 3EX4A 2F7QA 5C54A 4TIMA 4FLOA 3PVFA 4XZ9A 3ZT7A 1OX4A 1QDSA 3S2CA 4RR4A 1TO3A 4NNCA 3NQGA 2BLEA 3N2XA 1BAGA 3GAYA 2VFGA 3CEPA 4MYAA 1OK4A 3BCFA 3MI3A 3HPSA 1Z32X 3W38A 3SSJA 1XH2A 3ATYA 5CKSA 5K9DA 3KX6A 1Q6QA 1LYXA 3MP5A 3HGRA 3EWZA 3NQ7A 3PR2A 2ALDA 5SWUA 1SO3A 4K7YA 2E5DA 1OGSA 3GBEA 1JI2A 1EEPA 1CGXA 1P0NA 1V3LA 2QUVA 3G1FA 4H6KA 2Q8ZA 3A23A 3G8RA 4O54A 3KVLA 1ZJAA 3AXIA 3LCXA 2ZX5A 4S2CA 3E49A 1UD8A 4XB3A 1BG9A 4A29A 1IZJA 3M07A 1FWWA 3N9SA 4JFVA 4FX8A 4P61A 4NI3A 1GJWA 4PEKA 4CNPA 4ML9A 4DBEA 3WNLA 1ML1A 1IF2A 1TREA 2DORA 2ZUVA 1EA9C 1UD6A 1VCFA 2DZWA 1J0IA 2OYLA 3EX1A 4KFPA 4ZZ9A 3OHIA 3M47A 7CGTA 2CZDA 4U2YA 4XKYA 4WJEA 1HL8A 3QMTA 2CLMA 4UTHA 1LOSA 4FIRA 5KSWA 3P67A 4FXRA 2C15A 1BF2A 1G7UA 2C1HA 3PB2A 1HTIA 3C2EA 2EAWA 3HQ1A 1XSIA 2YJQA 4KFOA 3W73A 3L5MA 3L4XA 3VMPA 1H7NA 1SFLA 2P10A 3EDKA 5FEPA 3FJLA 2CPUA 2VFIA 5EL1A 3GNDA 4AF0A 2RDTA 5G5IA 3BW2A 3I7RA 3G22A 4X9SA 5H91A 1G69A 2ZUSA 2VFHA 5U7SA 5BW6A 3KVJA 1VFMA 4FNSA 3WY1A 2Z2UA 4HNNA 5F1VA 5I3JA 1OABA 3KL0A 5CGMA 1TSIA 1R2RA 4MUZA 5HQEA 4CQ9A 1JI1A 3OLGA 4O15A 1HXKA 3BUIA 3DHDA 3GDLA 3NPWA 2YFOA 3BSGA 1MFUA 2D73A 2HSAA 2I1OA 4KKXA 4AXKA 4LC8A 2ZZ5A 4PCFA 4A22A 2WNQA 1GEQA 3GDRA 3W2LA 4L4MA 1H3GA 3HOJA 4XBKA 1QW8A 1OHLA 3LHZA 2ZZ6A 5HPOA 3WDJA 9CGTA 2FHFA 4U31A 1TTIA 1J0JA 3LTPA 4GI6A 1XDMA 1FY6A 4GQQA 4FXSA 2VUYA 2YA1A 1JIBA 4ZL1A 2C6QA 3GYEA 3UXAA 3ZSSA 1GWJA 5CPNA 3CZLA 1AVAA 1KFJA 1NSJA 1O60A 1KM4A 2GJNA 4Y90A 3UZJA 2VEIA 5E6YA 3NM1A 4JTIA 1MSSA 3W23A 2QPUA 3GR7A 1CW2A 3G8EA 2Y85A 5D2TA 4QAWA 3WFZA 1MO0A 2GVLA 2Y7DA 3O07A 2CZ5A 3DAQA 5EPDA 2D3NA 3NXFA 1THFD 2ABAA 3GDKA 4JTHA 2XVGA 5A2AA 3G1VA 2EF9A 3DBPA 1HO4A 1MFVA 2X1UA 3LB0A 1M53A 2V2CA 3TAKA 2RH9A 4FNQA 3W1LA 2PCQA 3D4ZA 1JRCA 4UNIA 2Y7GA 4L4LA 4O1AA 4AHPA 2NV2A 3RNDA 4PL2A 2Y89A 1WDWA 2WSKA 2QCNA 3DFNA 3DX0A 3THQA 3UD6A 5DN1A 2WVVB 2ZA3A 1DHPA 3SW6A 3CZEA 3DHUA 3VSVA 5IM51 3E96A 1X1OA 4UOZA 4PEEA 2D0FA 2FB2A 4N9EA 2GUUA 1JDCA 2PWHA 4AHQA 4UOQA 3GK0A 3FYPA 2I14A 3O63A 4AWUA 5D37A 3EX6A 3W88A 1FCUA 1H1YA 3W86A 4KMQA 4J27A 2BSLA 5CXPA 4K7VA 2ALWA 1CIUA 3TNOA 1TTPA 4YLWA 5AFDA 1G4PA 4KWVA 4PTNA 4GNJA 4ADTA 1I2RA 1YXDA 5L6UA 1WA3A 2QV4A 3USBA 1HWWA 1DQXA 2YR1A 1IXOA 3NQFA 1QR7A 2CLKA 3FA5A 1WV2A 2CZEA 1TB3A 1LROA 1FXQA 1GVOA 1BSIA 2X1RA 1VFUA 1BTMA 5HR7A 4WY0B 5A2CA 2HS6A 5DXXA 2OSXA 2ZFAA 3NL5A 2OT0A 1KV5A 1E40A 2DP3A 1EUNA 1AW5A 3M5YA 5TBOA 1F2JA 1UUMA 3TK7A 3U6WA 3MP3A 3EXRA 3T40A 2BXYA 3NYZA 1P5BA 3ECQA 4CN4A 3CEUA 3EKLA 1PV8A 3BLEA 1WZAA 4RX0A 2ZICA 2QCDB 5J5RA 4WSKA 3N34A 3OG3A 1HX0A 3G18A 4NXSA 1QI3A 4EOUA 2ZRZA 2EQDA 4DELA 2Y2WA 1K7EA 3LCFA 1SU5A 4IMDA 2BHUA 1N55A 4IMGA 2Y70A 2FIQA 3DDFA 2RHGA 3HGOA 1GTHA 4NJGA 4TO8A 3HO8A 4JR5A 1QO2A 1R30A 1QOPA 1Z44A 3MO7A 2V3DA 4O14A 3RIKA 3GVGA 1P0KA 1JJKA 1TPWA 2G3MA 4UTJA 2QCEA 3LRMA 4UMBA 2X2HA 3LM7A 2CLHA 1KCKA 2E4TA 1H1ZA 4OWGA 2J88A 4N6EA 3WELA 4HNVA 1OX5A 1FCBA 1CLVA 3W7OA 3QW4B 3EWBX 1AMYA 3GX9A 3BSHA 4MIMA 3TA6A 1TQWA 3PWAA 3VGFA 4LU0A 4A21A 1EP1A 3M5ZA 3S1UA 3C61A 2DH2A 3GXMA 2ZRYA 4UNLA 5A6MA 1S5VA 3CLWA 3VSTA 1U2YA 2CU0A 4AYSA 4RXFA 2QMJA 4O10A 3OEXA 1OX4B 4AB4A 4CQ8A 4LPCA 3W2KA 3GLCA 4J3SA 3TFCA 3GNNA 2EAEA 1KM1A 2JKAA 1Q4NX 3MBFA 1HT6A 4GO8A 2Z6IA 1O95A 1M7OA 1V7YA 3PUDA 3KOFA 1ZNNA 3EWYA 4AH7A 3W84A 4HNTA 4XQ6A 3MI2A 4DBDA 3QFEA 3EDEA 5F7UA 2KZHA 3OLIA 4MZ8A 1AL7A 1WP6A 3LXCA 1YPFA 2C19A 3F03K 2VFFA 1W5NA 3UG3A 2JBMA 4UXDA 3CHVA 5F1UA 1MZHA 4GFSA 1HFBA 5L9FA 1EIXA 4JS3A 1KFLA 3LXBA 1YTKA 3PUOA 3WK2A 1KM2A 4H3DA 3UWQA 3EEGA 3LI0A 2RKXA 5CZ0A 2H8ZA 1C9DA 4UTWC 3LCGA 4LUJA 1KM5A 3NZRA 4IXXA 5DCDA 5C6MA 5LHFA 3BLIA 3SGZA 3PY2A 5DBTA 3T7VA 1IIGA 3C2RA 3UWUA 1Q6LA 4MAZA 1VQTA 5CSSA 2CFFA 4XKYB 4R34A 1JGIA 1FCVA 2ZZ2A 2YGYA 3IIPA 5DBUA 1G67A 3P81A 3L4VA 3RU6A 5K7JA 5AHLA 4LRTA 1PPIA 3Q94A 2QCHA 4AF0B 4LXFA 3C2VA 1J0HA 3A4AA 3BARA 4ICNA 4M19A 5EYWA 1BVZA 1K7XA 3BAKA 2A5HA 3B04A 3GR8A 1WO2A 4UZSA 1HL2A 1OG0A 3CIXA 3OVQA 4N4PA 5HNRA 3A6OA 4LC6A 3VM5A 4ZMGA 4O52A 5LZLA 4DO6A 3W2JA 4JEQA 3JR2A 3INPA 3UXDA 3DHFA 3CU2A 1I2QA 4LNYA 2E0PA 5K9XA 4K36A 2GVGA 3VE9A 2WNNA 1TMQA 2JGYA 3PBWA 4R33A 3CZSA 1NM9A 4LUIA 1N7KA 2ZRVA 4O1DA 1SFJA 2X30A 4JDYA 1MW3A 3W1XA 2J24A 2EJ1A 2ZZ4A 3F4NA 5KZDA 3G1XA 1CYGA 4Y96A 1J2WA 4J28A 3LXAA 1K8ZA 1X8FA 3P7YA 2Y63A 3VE7A 5I24A 3YPIA 1C8QA 2PWEA 2QCCA 4JNMA 4YL2A 3TROA 2CLLA 4O0KA 5BRBA 1GQNA 3UERA 1LOQA 1WX0A 1XL9A 4B5NA 1CXLA 1L6SA 2WSYA 1UCWA 3L0KA 3N73A 1TRIA 3C2FA 4WF7A 1JCXA 3TW6A 3KEHA 1PJ9A 1ME7A 3NQEA 2Y61A 3T78A 3VFLA 1DQWA 4OQVA 1CDGA 4Z0SA 3MUXA 1B3OA 3KFTA 4G1KA 5D33A 4HOWA 2A6NA 3CTLA 4M8UA 6CGTA 2HTMA 3DHPA 2JKEA 1UKSA 2D3LA 2B7PA 3O16A 1C8VA 4K8HA 3W72A 4RK8A 2A7RA 1W1ZA 4HPXA 3W7LA 3W6YA 3TCEA 5KITA 2YPIA 1J5TA 3OIXA 3HIJA 2EGZA 4MKNA 4MZ1A 1UH4A 1JRBA 3O8AA 3KLKA 2VRKA 2ZXQA 3PBVA 2NSXA 2OMAA 5E6ZA 4UMAA 1MEIA 1SW7A 1OFEA 3QGVA 4J7RA 4GXMA 3W76A 1W8SA 1ZJIA 4FLRA 3PB0A 3UCQA 3F4WA 4X22A 1L6YA 3IGUA 3BC9A 3AMLA 3DFPA 3FEMA 1GZGA 1M6JA 4UFKA 3HMJG 3LTYA 1ZJBA 4UQ9A 3S5ZA 1TQSA 2WCGA 1U83A 3PSWA 5AYZA 2ZQ0A 1WBJA 4RZ5A 3PSVA 4ZQCA 3R2GA 1GVQA 1MXSA 4HPJA 4PSRA 5MHBA 3IVTA 1QPQA 1I2PA 1JD7A 2Z6JA 3BH4A 1W3IA 4DXVA 2Y7EA 3QJAA 3LGEA 3NPUA 1S46A 1OT1A 5FEWA 3WDIA 5FEZA 1FXPA 2BWGA 1W5PA 3UWVA 4GQRA 2Y24A 3W7RA 2ZCGA 1BPLB 2QEZA 3I7SA 5F2MA 3DGRA 4LTSA 4MVAA 7TIMA 3UEQA 2D0HA 4E0CA 5J5DA 2QCFA 3G24A 1ODUA 4UIOA 1G5AA 3K8MA 2PWDA 2H6RA 4UFJA 4X2RA 2NXIA 4QAIA 4GI8A 1YLVA 2Z1BA 4JY8A 1OK6A 3EJPA 1LRTA 4YMZA 1R2TA 3A5FA 4IXHA 4Q4KA 2FB3A 4LV4A 1VLWA 4Z08A 2F61A 3HG3A 3M16A 3UG4A 3E12A 5DELA 3TX9A 3S8HA 3QRHA 5EA9A 3HZ3A 1QI4A 3TMQA 4AWSA 4DEFA 3KXQA 1KXTA 3L0NA 3L67A 3PBUA 1VJIA 2CLOA 4AEFA 3TW7A 1WAUA 3W74A 3W2UA 3LHTA 1JCYA 4UFLA 1XH0A 6TAAA 2Q3RA 2ZWYA 2ZDRA 5I3FA 3SIZA 2A1YA 4UTTC 1XV8A 4GC4A 2VRQA 1XI3A 1ICQA 3LHWA 5AC6A 1XBYA 3SGUA 1XD1A 3AJXA 5D2XA 3MHUA 5HWMA 5CZTA 4JN6A 3TKFA 4BR1A 1DORA 3W1AA 1VB9A 1I4NA 1VRDA 4NU7A 3R89A 3BW4A 3RFAA 2YYUA 2VEPA 3DI0A 1NF7A 1D3HA 3C3NA 4EVZA 3L4UA 4LS2A 3W87A 2QR6A 1DL3A 1LLWA 3VO0A 3UNDA 4R53A 4QM1A 3W7NA 4Z1CA 1FUYA 3MW7A 3L4WA 5G2IA 5HUPA 1FWTA 4X0NA 3WY2A 4FO4A 1CX9A 1FDJA 1W0MA 2WC7A 3IEBA 5I0DA 1ZY9A 2QCLA 1EWEA 4GI9A 3VGHA 2WPGA 3Q2DA 3BVVA 3TXVA 4OGZA 5IBXA 4MB1A 4I7WA 2WVTA 1VJSA 2ZE0A 3LLFA 3EJQA 2EABA 3W7HA 3BUDA 3FS2A 5C55A 1SO4A 1X1ZA 2FLIA 3WEOA 1QPRA 2E6DA 3FW6A 1GVIA 2J25A 2FYVA 1OFQA 3BLKA 1KFEA 1OFBA 1X7FA 4A2SA 4TMCA 3BVTA 3N19B 4HNUA 4JTTA 3TIMA 5K2ZA 4AIEA 1PHQA 4JFSA 3ZFHA 2F18A 1TQVA 1W5QA 4BZYA 3LDVA 1KXHA 2DZVA 3BV4A 1WOAA 4M6QA 5LNWA 1TJPA 3N14A 4YCPA 1OF6A 4M6PA 5CGQA 5K3VA 2WCSA 3WDHA 3LV5A 1A47A 2R14A 4OE7A 4BFAA 3JRKA 4GUFA 4IPIA 1UKTA 4U3CA 4H4IA 3NL6A 1SMAA 1JG9A 1LOLA 3P8IA 2DIEA 1K3UA 3GKAA 4JTKA 4IMFA 4UUIA 2B7OA 1XSJA 1UD5A 2F7FA 1QO5A 3P80A 1NF0A 4IX0A 4XWUA 3WJWA 1KM6A 1W5OA 1N8FA 1LBMA 3M5VA 3GTNA 1H7PA 1EX5A 1E3ZA 5HR6A 1UKQA 3PG8A 1DTUA 3SFKA 2J27A 1MW1A 2VT0A 1EB3A 1XDLA 2VFDA 4N9CA 3T44A 2VEKA 3UPWA 2DJXA 4A2RA 2X1TA 5AHEA 3AJ7A 1CGYA 2Y7FA 3IGXA 4J3UA 2GQ9A 3LHYA 3S5OA 1KM0A 3FAWA 3WY3A 5KMYA 3QW3A 4POCA 1RP9A 2F2HA 4O19A 1C29A 5G4WA 4O1CA 2WPBA 4WD0A 4HOXA 1T96A 2E8YA 4CN6A 1PVNA 5HJLA 2BY2A 1F6KA 2QCGA 4FNTA 2PC4A 2CLEA 4WXZA 3LRLA 4NT0A 1TQUA 4CCCA 2WVUA 2F84A 3VGGA 2NX9A 3G1YA 4PCSA 3ZT6A 3L65A 5KZEA 2OSWA 1SR9A 3V1PA 1UA7A 4MOZA 1YDOA 5D32A 1KWGA 5EKYA 5BRQA 2BHZA 4UFIA 2X2GA 4LVAA 1SZGA 5D03A 2J9XA 1NAL1 3ABSA 3PG9A 4HT3A 3DX4A 4WQ6A 2OW6A 1OF8A 4AAJA 2DZPA 2ABBA 3FFSA 1GJUA 1SO5A 2R8WA 1FDZA 1VR6A 4DPQA 3LCHA 2RDWA 2ZUTA 4OU1A 4RCXA 4ZQNA 2NUYA 3R5EA 3MYPA 1R2SA 1HTYA 1VPXA 1SZEA 3W7KA 4S2BA 3KVKA 3W9ZA 3L66A 6ALDA 1E51A 3T55A 3TC7A 3UWYA 1ZAIA 3U8GA 5FF4A 2ZYFA 5BOOA 3TUUA 1VS1A 3TR2A 3FIGA 1O4UA 4D2JA 3W2MA 2PWGA 5CPMA 2CZFA 4N02A 1ICSA 1CGTA 1B9BA 5E70A 3NQDA 4UQBA 2V2DA 4BWLA 4FF7A 1EA0A 3OVRA 1KGXA 1EPXA 3KE0A 2FHCA 1R47A 4MY8A 1M5WA 4PFMA 1P1XA 4OT7A 3D51A 4W9TA 4ONVA 3GXFA 1OFAA 3M9YA 3WK0A 5FEXA 3LERA 1DJNA 1XGZA 1WBHA
chains in the Genus database with same CATH superfamily
3IFNH 2AK4D 5MP6L 2J6WA 5AW1B 3BRFA 4H8NA 4OZ4B 1MDRA 3CM4A 3H2PA 3RP1A 1V7NL 3AFBA 5E6UB 1QOQA 1Z66A 2VLJD 3VIGA 1H7RA 1F7BA 3OMZA 4M5ZH 1ZCCA 4XTDA 5DYOB 3IJ7A 2ESVE 4B97A 1A6TA 1E0OB 1MI5B 4P99A 2DYPA 1JCTA 4EIVA 4MX7B 1QA9B 2AS5M 1IGFH 5E93A 3QPZA 4PG9B 1Q9WA 3RY6A 3NSFA 4GUHA 2H3NA 5HHNB 1R3JB 2WLYA 3IMWA 3SUSA 2Y7QB 2X1XR 3SN6N 3GUTA 5CD3A 3T0EA 1S7TB 4AQ8A 1KYDA 2ITFA 4D9RD 4BRVA 3RI5F 4M7LT 3KCWA 2EDRA 3N29A 2TMDA 1AK5A 4BH8B 4ATWA 3B0UX 2VQ1B 5D72H 5F1NA 4NIYE 5IW1A 2Q8AH 3T2OA 3H42L 1XIGA 3GQYA 1Z1WA 1A9EA 2NY4C 4AEEA 2XN9D 4WDUA 4RH4A 3UG5A 3U46A 1XF0A 1XIDA 3RTQB 2X7LB 2F1EA 4PJHF 3EGDB 3FU7A 4TUOB 1CS6A 5I3IA 4GRWF 4RNHA 1MHCA 1MEHA 4EOWL 1S7QB 5CSGA 3BP5B 2CDEB 3WNOA 1T6MA 7PCYA 3ZIZA 4QRRB 1MNUL 5B3NA 2VZSA 2I27N 4B9GA 2YX0A 3RMJA 2DN7A 3RWIA 4KZEH 3PAOA 1GZQB 3N2BA 3S3GA 2QPSA 5EFDA 4Z8FL 1ZLSH 1YEDA 1QACA 5E9NA 4ZSOA 2CNZA 4J3VA 3MRHA 3MBWA 3NIFB 2YD3A 4RFNB 3ZR6A 3VFRB 1YNPA 4ZXOA 2B8OT 5F7KC 4M3PA 2PDMA 2F7OA 4IOTA 2NCEA 1OP5K 2OP4H 5E2VH 3R58A 5HHOA 3W7GA 4CU8A 2AQWA 3CSYB 5ICXB 4UTMA 4PBDA 1S6NA 3TWCL 5I8KH 3IARA 1RUKH 2VCAA 2EJAA 3G08A 4HCIA 4LCIH 1FA4A 4XBGA 4QITA 2A3AA 1Y8BA 3QY7A 1KNOA 5D1XA 1GVFA 3HUJA 4OCWL 1MPAH 3ATZA 5F4XA 2E7CA 3BG5A 3PBYA 3WD2A 2N3JA 4A04A 4KAQH 2WUCL 5DJ2A 3QNXB 3UVIA 5F2GA 1SXBA 2Y3NA 4KKCD 5BZDA 1LORA 1B3VA 1YYLL 5BMFH 3NQKA 1UCTA 1TPVA 1PY4A 2NT1A 2VLRB 3PP3K 4JFUA 5A8GA 4YSSA 2ISDA 3JSSA 4ZGYA 2Q0ZX 2Y69B 3KPLA 4OJEH 3S36H 3MRQA 2Z92B 5DJCB 3PL6B 4P59H 5LAXB 2JIWA 3BAEH 5HGHA 2JALA 3GVRA 1DPMA 3PGCB 4ELKA 5D04C 1DDHB 3DETD 4H8QA 4JQXA 1P6AB 3STZA 3QUKA 1FBAA 4FXFA 4OF7A 1N2VA 3UJTL 4HPYH 2O5ZL 3DARA 3DX9B 5IJDC 2K9UA 4ZW7A 4PV1C 5A2JH 1AIFA 3H7BA 5SV3A 1ZDQA 3S3BB 4EUPB 5F1OB 1A5BA 4TVSa 4WUIA 4AX7A 1N0LA 1UR8A 3H54A 3GTFA 3DO4A 2ENPA 1BYBA 1J9RA 1QG3A 3CC1A 3HPXA 1NFIB 3K1DA 1QUNB 3QWOA 2VVSA 3ETBF 1ND0B 4YJ5A 1MLCB 4UT7L 4GYFA 1M04A 1UJ3A 3MV9D 3L4ZA 4NC2B 3OX8B 1IEWA 2KI6A 1MHHB 1UWIA 4LSRH 2VW7A 3BN9C 5C0CA 3KTCA 4XN2A 3ISRA 2ATPB 3NQCA 4JIPA 2OJPA 5GGSY 4GRWH 2GGHA 5IBTH 4B0MM 5CR8A 1MW0A 3RDJA 4DO7A 4E42B 1SN0A 4URKA 1KCVL 2BP8A 3LBMA 3LY0A 2A0NA 3R10A 4BWUA 4UV4H 4A7VA 3D3VD 4LLYB 5I77A 4EDWL 1QBML 3EGJA 3DFTA 1JF5A 1B4TA 3CPUA 3DI1A 4M00A 4XMPL 3W4RA 3WUFA 3CHEA 1FE8H 1WFTA 1LT8A 1OEPA 3QA3B 3KNBB 4P2YA 3BG9A 1TQCB 3WQ5A 4Y5VC 2C3GA 4HUWB 4NAJA 2O5YL 3OG4B 3ELFA 1GOHA 3O6ML 2DDQH 1AQ0A 1VHPA 4HV8A 2I7OA 4UT9H 4YDKL 4UYPA 2GJZB 2LGNA 5H4YA 4MQ7A 4AVKA 1TTRA 1R3KA 1GXEA 3HHSB 2FH6A 2BG5A 5FKAA 3HZYB 5FLVA 4PJGF 2A74B 2H3XC 1M68A 4IPPA 3ONBA 2FB4L 3ZDXB 1FC2D 1RZ8B 2AC0A 1BA9A 5MENE 3N6JA 4L4VA 5E1IA 5KSAD 3CQPA 3UJIL 1ASPA 2F54B 1XZ0A 2NOYA 2R83A 3ZDZF 3H7VA 3F4VA 2DWSA 4GQ9H 1U8QA 4H1LH 5I6LA 1QTPA 3NQBA 3W7PA 1HEZA 1BZ9A 3BVWA 2JTYA 1WS8A 4YLQT 3SE8H 2CHXA 3HPLB 5C2UB 3ZTDC 4FX6M 5FUZL 1BEYL 4RGNC 2VXTL 3TAOA 1GK8A 3W9EA 3DX3A 3EWWA 4KK8D 1XBVA 2ZBTA 5AOJA 3JWNH 4F24A 4OKVB 3CMGA 3OAWA 9XIMA 3D2UB 2YARA 2DZTA 4CILA 1KA9F 3D8MA 4W93A 1FYTE 3IJSA 4GS7B 5AYUH 1I1WA 5HJGA 1GQIA 2Q3OA 2B0SH 4MTVA 1JQXA 5JHLA 2J5LB 1PEWA 5DMMA 4PJCE 3HE6D 4IX2A 5FO9B 1F5ZA 3B2MA 1LL1A 2YAFA 4HD5A 1ZTMA 3ABRA 3QEUA 4HHPA 4HEPA 1CVRA 2WJ5A 5IREA 4M3JA 5I5MA 1IEVA 1WA2X 3GRWL 3K8KA 3V6OC 4B3KA 1KDJA 4TSBH 5IBUG 4K15A 2B1AH 1T1XB 3JWDL 2INFA 4W8AA 2GHZA 2NY3B 4FEIA 2VW6A 1HVXA 2CLVB 4L8DB 2K8MA 5H94A 3G5YB 4E9VA 2WV8A 4F0LA 3H9SD 3W28A 4FAAB 1M1SA 2NSQA 3RO8A 1Q6RA 2WKOA 3ARBB 3B0XA 3L3IA 4KK9D 5K59F 1RPXA 2AABL 4DJEC 2VCCA 4NO3B 4OAWB 4WVXA 4UB0H 3ZDXF 4BDVA 4A7QA 1LO5A 3U6RB 3RIFF 5DTFA 2CW6A 4LF3B 5DJZB 5KVFH 3HCVB 1VGEL 3MDJA 1FWBC 5E9DA 5EOTA 3GYRA 3ZE0F 1OM9A 3R12A 5I78A 1DWIM 3PZMA 4JDBA 1ORQA 2ENSA 1XDJA 5E2WH 5H35A 4XAWL 2WANA 3P93A 5I3GA 2HVJA 3BKCH 3V6ZB 3CGTA 1QMUA 5C09A 5DO8A 1CF1A 1DO5A 2X4QB 2NPLX 2Z35B 4ZD3L 5I0XA 1N64H 1U3YA 4UQIM 2INEA 4C83A 3CIWA 2QAFA 2E7MA 2ZX9A 3O4OB 3CH8A 3LYRA 4U2ZA 4M29A 5GHWH 4TTDC 1RZFL 4IM8A 3MYZA 1NUGA 5K9OA 1BYAA 2WXIA 4ZO6A 2H1PL 2DYRB 4HS3B 1UUOA 1BFSA 1PL9A 3VG9C 4R88A 4WY0A 2F1AA 2EO9A 2DQWA 1VIZA 3B5HA 2ZX8A 3FXIC 3CZNA 2WGNB 1ITQA 4MD5B 3WQDA 1U8OB 3ZKXB 1M4KA 4D3CH 2R15A 2NXGA 3VH8A 2H47C 4XCYA 3WJZA 4R2GC 2VKZG 4YWIA 3AIBA 5F89A 1WOBA 1MDAA 4XP9L 3U4AA 4ZTPH 1GHFH 4TVDA 1YX1A 2ICSA 1FZKA 1SW0A 5AVWB 1G9NC 1EJUC 3ILQC 4XUYA 3FOLA 1RIHL 1A1MA 3ZZQA 4HK0A 2W80C 2DSVA 2FDSA 1XGYH 4L61A 5J3HC 2UY3A 4NNCA 3VK5A 3BTNA 5EUOB 3IUHA 2N1TE 1CB2A 3V1HA 4R90L 1T89A 1B4JL 1LG2A 3J07A 1JI2A 3V7PA 3EUDA 4IBLT 4PB3A 3W6MA 2WO3B 1K8DB 2Q8ZA 4R3SA 4AC4A 5C0ND 3QNYB 5E09A 1RUAH 1I7ZB 5T5FH 3K1KC 5JPMC 1FFQA 3P4MB 4YYCA 1Q94A 1OIFA 2VABA 2ZADA 2LU7A 5JXAH 1UD6A 3TT3L 3DLQR 1U3JA 3FCSA 7CGTA 3WFLA 2F6AA 1ANUA 1HE8A 3LENA 4AX6A 4JFEA 3G9VA 2P10A 2ARJQ 5FEPA 3HR5A 5FL0A 4C91A 5HI3D 2VFHA 3HZMA 3P3TA 3SIKA 4Q8TA 4FE9A 1JWUA 3LEVH 3KZSA 4G6FB 2FGBA 2Y7MA 1QUMA 1QW8A 5JNYB 5DT7A 3XINA 3SDXF 3AAZA 3PAYA 1J0JA 5IMLB 3GHSA 3E6FB 4X7EC 4FXSA 1QSEA 5DFVD 4P9HL 3GYEA 1A4LA 1E1FA 3HI5H 4FL4B 5EBMA 1AVAA 4FJZA 2WZMA 5J1AA 1MSSA 5EN2B 2V0AA 1N3NA 4LE8A 2BSDA 4FQLH 1Q0XH 1E7UA 5FGBC 4OZIA 1XDTT 4ZR8A 2IPFA 1TZAA 3OAZK 5IJBC 4O58L 2Y89A 1KTJA 3H56A 3NJLA 4WK0B 1B0GB 3CFCH 2QCNA 3RWGA 2AJUL 3BFQG 3QYCA 2PDFA 5D7JC 2D0FA 2FB2A 2GEEA 4JHAL 3UOAB 2GUUA 3C6LD 3CT2A 3QORB 2ZCLL 1UC5A 5D7LB 1NGWA 2QQQA 2A6IB 4XO4A 3OM3B 1ZT4B 2AJYL 4AUUA 3DBXA 5JOPE 3KLHC 4KWVA 3BUVA 1QRNB 2UY6B 2WLLA 4EMZA 3ZIYA 3UJSA 5KAQG 4DK5A 3I10A 2EYTB 2IXQA 5EZOL 3FZUD 4ZFGL 5AOLA 1QSFA 2DSWA 4BFEA 1KV5A 2AMXA 1JZHA 2BODX 4Y16C 4GKSB 1URIA 5HHVL 4ZS6C 1WZAA 2GIMA 3IAQA 1A6WL 2J2ZA 4UM9B 2PTZA 3HQPA 2EQDA 2VWEC 4XH2A 5C1MB 4NJGA 3N06B 3HO8A 1R30A 5AVXB 1JRHH 4EE9A 5TE7L 4XNDA 4CQDA 1IEBB 4C56B 3U7AA 4HT1L 4GAAA 4A7GA 4KERA 3LNFA 1CLVA 5IVZB 3BSHA 1MJJB 4F27A 2H4EA 2FR4B 3DSFH 1GOOA 4US5D 3BPCA 1Q0YH 2CCVA 2IJ0C 4AB4A 3ZX1A 2ITCB 3NCXA 1FQ9C 5TDNB 3H3BC 1MFMA 1Q2RA 3R0MA 3EDEA 4EJ1C 5FFOA 4FRWA 1HFBA 2HH0L 3EGSB 1DN2A 2CO6B 3LLXA 5REQB 4W9IC 1LK3H 3NSJA 1CGSH 4AQ1C 4LHUB 4LUJA 3VFVB 3VWJD 5HI4D 1GOQA 1JK8A 2OMVB 3IDIA 3WKMH 3O0KA 1TIWA 4Y4HB 3C8KB 2FIKB 1R3IL 2OKOA 4IHBA 1MCBA 4YIQB 1J0HA 3U2JA 4DWSB 1FL5A 5EF0A 3OVQA 3WX7A 4NZRH 3VM5A 4UUJB 1VKXA 1WBXA 4GG8B 4FCHA 3KPNB 2ADFH 1HFUA 2WNNA 3ZDYB 4O1DA 2DQTH 4JBRA 4JDYA 4XMZA 2OL3L 4XWGH 4G70B 3W1XA 1R3SA 1OQOA 3NDYE 1NCWL 4M0XA 1FZOB 1UWGH 3TZNA 3AABA 1UM5L 5DD1H 3ALXA 4NKMA 3DOSA 4RGOH 1ZTVA 3CTLA 4M8UA 2W0LA 2EEFA 1SOQA 3A67L 2Y7NA 2A7RA 2VDRL 5KITA 3QOKA 3TT1L 1Y6NR 4HU2A 5KVDL 3THUA 4N0UB 1SW7A 2HRWA 4F80A 4PW9A 2HV5A 2VX4A 3F4WA 4XNZB 2XDFA 1ZJBA 4O5LH 3QUHA 3W5NA 3IVTA 3ZJAA 1I2PA 4NQCB 5DT1L 4FXJA 2ICWI 1XYAA 2P46B 5FEZA 3KP1A 2N7SA 5KJ4A 4ZA0A 4IRZL 1K5NB 2QEZA 4MVAA 3KJ4C 3WD1A 1NSNL 3VRLF 4KCUA 4KZDH 3EFDH 4MDJA 1LRTA 3D0LA 1BD2D 4D9QE 3V8OA 4OCSH 2EKGA 3W56A 4WIQA 1E0XA 4DEFA 5FJOA 5FA4B 4KUCF 3TW7A 2FECI 4F1SA 6TAAA 1S9WA 3DIFB 3JT0A 1NAMB 1LDPH 4JM4L 5AC6A 5KOMC 2X2UA 5HWMA 3W1AA 2VDGA 3R89A 1T2JA 1IT8A 4UOW1 1AFVH 5IJVB 2MPAH 1T21B 4LANA 3VO0A 2MIZA 4J3ZA 3W7NA 5FA5A 2ACSA 5HYJA 4F15B 3GHBH 2RCSH 1A6ZA 4GH3A 5AC4A 2NR6D 4PV8A 3APDA 1IL1A 3UX9B 4V11A 4FFZA 1BTCA 4TUKL 3SHSA 4KQ3H 3CVIL 3COOA 3CUZA 1G84A 3BKJH 5JIHA 3NMEA 4RRPM 2WMPB 2JKWA 2OWCA 2HKAA 4KO7A 1AGBA 1OF6A 4KJQC 5L6YH 5K3VA 3S8FB 3WDHA 3H2WA 5EZJB 1WKEA 3QZLA 3TN4A 2WAHA 4KMTH 3I4KA 2DJ4A 2AL2B 3D18A 2O5XH 2J1XA 3BGMA 4A63A 4R83A 1FWJC 2PDHA 1I4FA 1HSBA 1UB6B 1EX5A 4PTXA 4PTVA 1AMXA 3WE6A 5EEXA 3BD3A 5J57B 3GKZA 4NZDA 4GKTA 2F2HA 3BHBB 2YPLB 4O1FA 2WPBA 2EILB 1S3RA 3AXLB 2O9TA 2CLEA 3WYZA 2HT2C 2H26A 5DA0B 1RZIB 4HX1A 3HB3C 2R0ZH 4GVHA 2CR6A 3KTXA 3L7EA 1F3WA 2CRYA 2PF6A 3DX4A 4GA8A 1DVXA 5T1LA 2NUPA 2E7HA 4F37K 4XOEA 2D03H 4KKPA 3WUWB 4JG1H 4P5RA 3K91A 5EPMB 2P5EA 3GT6A 3DSNB 3MLYH 5JUEL 2BGNE 1VPXA 3KPOA 1I7RA 1E51A 3FTGB 1FAKT 5FF4A 3TBVA 3TR2A 5CPMA 4FQXB 2E7LA 4AVHA 3SPVA 4GK8A 1CGTA 3AALA 4LF2A 2G75B 3DGGB 3RTQD 5T3ZH 1GGTA 2Z1XA 4OGYH 1G7PB 2DPKA 1KY7A 2FTAA 4XVJL 3U1QA 3DXIA 1GW0A 4DO4A 4Q58C 1AHWB 2BSEA 3QGKC 3NG5A 4QRRD 4NHVA 4X2PA 3V5DB 2FBJL 2V2HA 5ID1B 2DMHA 1ZA6B 4A2HA 2BXVA 4J1OA 3FSOA 1DEDA 5F0JB 2FO4B 2R4SL 3HMXH 3DX7B 2JI1A 2DT1A 5CJXC 2ATMA 1UXWA 1L9OA 3WNNA 2IO5A 3MLWL 1ORSA 4EF9A 1KFBA 2ZONA 2JJSA 4ONHA 1H9VA 4P48A 5FM5M 4BFKA 5DI8B 1KXTB 3U0TA 2VN4A 3WEBA 2D2JA 2PW1A 4YTSA 4OV9A 3RU8H 1R3TA 1AHMA 3PPSA 1QWNA 2NNRA 1J5OH 2D4FA 2Y72A 1RVFL 2GG1A 2WV3A 2W79A 2GJJA 3NGJA 1U91B 2YO3A 1C5BL 4OZHE 2VOTA 5LA2A 2XQYA 2F1BA 4KWUA 2QKFA 2NUTB 1OCRB 1AS6A 3BE7A 1AW1A 5F72S 4OFDA 1U1JA 1P0BA 3HFYA 2DTSA 3BMVA 3QR0A 5B7EA 1F9CA 4HCRH 3PUCA 4OI9A 5FA3B 3PULA 2ZJSH 5DJAB 4XI5D 1L3WA 1YXCA 4KO9A 3MJWA 1WFUA 3IDUA 2VLRD 1IBYA 2C0AA 3IN2A 1TPFA 4N1HB 2HCVA 1PG7W 2PRHA 4M6ML 4E8GA 1JUBA 2CMRH 1ZEAL 5IVXB 2CA3A 1LLAA 1LEKA 4OGQC 5DQ9B 4Q8MA 4JFOB 4QRTB 4U6YA 1RI8A 4NRXA 5IWLA 5CCHE 2UYLA 3ESPA 2J66A 4HVBA 4GUJA 1E0TA 4NPYA 4PN6A 5EA0L 2ODIA 1U3HB 2EYSA 5C2XA 4PI0A 1S1RA 3ARPA 2PCYA 4G7VL 2X53A 1VEPA 1FVCB 4ZK8A 5DJYB 2I9LA 4PMVA 3L5AA 1O6IA 5ACMA 3J2PA 4P5TA 4PJ7E 1UENA 1Z0NA 2G5UA 3B2VL 4QBXA 4PJBE 2EVHA 2HNHA 1ZTXH 4ADIA 2KYIA 4GX9A 3F01A 3S34H 4MQTB 4UDUB 2WB7A 2OSYA 2DUXA 4YVPA 1I8MA 5HA7A 3MUJA 3IF1A 3ARSA 5BO1L 1AKPA 5IY5B 3B03A 3SB3A 2PDYA 1Z7JA 3GKWH 4EN3C 3NTCH 2VIRB 5E8OB 3EXSA 4ELMA 1QFHA 3W39B 3KBSA 1X8CA 5ALCH 4FQ1H 3W71A 1D5ZB 2FJKA 2WWKO 2FFCA 3FN3A 3GS6A 1J12A 4UDTB 4ERGA 6FABL 3PK7A 4ZOCA 3T6CA 4P8XA 2JXMA 1USQA 4TNVF 5FYLD 2QJMA 4Y6GA 5IVXF 5I23A 3HRZC 1YCSA 5EMMA 3ARXA 4FEZA 2FYYB 4IRJC 2XACC 3IETA 4FAMA 4PGLA 4LUYA 4ROPA 1GC1C 2FWOA 1V02A 1U41A 3ZTJG 3VXUE 7ODCA 3LHUA 2YBGA 1MRDH 4BZ1L 3MUAA 1XR8B 3U7WH 1NCOA 2F54D 8RUCA 1W17A 2CALA 4DETA 2GGEA 3T8QA 4LY4A 4IUOA 3DG3A 1CFVL 1GYWA 1MHPL 3F2DA 2B3RA 3NQMA 4KUZH 1THCA 2WMFA 2XWCA 4YHOL 1CQYA 4LH8A 1EO7A 4QGTA 4QT5A 4Y4KA 2J7CA 2M8XA 4KIRA 1DBTA 1XX1A 1U8NA 5L2KE 1A65A 4J1UB 3DFOA 4FXKB 1YDNA 3VXSE 2CLPA 4KGJA 3BIKB 1D6VH 5HGDB 3IDNA 3SBWA 1GONA 1M7UA 2RBLA 5B7MA 3L68A 4JZOB 1NWOA 1VERA 3UCDA 1D2KA 1AZCA 1VRXA 5DS2A 4O8RA 4L3ED 3WUEA 2W63A 4ZE5A 2J8OA 3ULVE 4DQWA 5C7XH 1R3HB 1E1CB 4Z77A 1IV8A 1Q3NA 2OO0A 3BUPA 2FQGA 3N85H 3FH7A 4FMVA 5A94A 5D70H 2Y1YA 5DZPA 3DX6A 1CB7B 1KWKA 2DLEA 3AREC 4J3TA 2DEPA 2WJDA 1F58H 1XF5A 3FRPB 3TTQA 4JRYB 1JF6A 5D1QA 1FO0B 3JQOB 4LCUA 4TTGA 4NZJA 2F53B 1VLIA 2DQEL 4KV5E 2VDPB 2GYSA 2NY3D 5GS1C 4RPQA 3FYOA 1J8RA 3QPEA 2CLFA 3QFJE 2PGEA 5FO7B 3ARBD 5F9JB 3RXZA 3LJ3A 2FEDC 1IBZA 1IBFA 3F85A 5K9CA 4S3DA 3BYYA 3K4ZA 4RMQA 4I9MA 1DWFM 3WS3A 4J6RL 4XVUD 2QW5A 1ZCOA 4OH2A 4JFYB 3C2OA 5F7HA 3ABOA 4JTJA 1LJMA 4GNKB 1HYSC 5GGQH 4D7PA 2ZXEB 4G59C 4MWAE 3UWEA 2XWDA 1ADQH 1K03A 4MCYA 5EGRA 3A4JA 3B8DA 3WH9A 1NEZB 1DQKA 5GQBA 5AL0A 3R8HA 3T4AA 5TH2A 3L6FA 3T4WA 3N04A 1XLAA 4LU5H 1H62A 1QVOB 3QIBB 1OAZL 4MDIB 4WGKA 2X0UA 3SDCB 4X2UA 1RZQA 3BZDA 3FJTA 5C2BH 1KBKA 3E0IA 1WPCA 3CPRA 4Z3FA 3Q48A 4EAMA 2V9DA 4HWUA 2X4UA 1I8UA 2AQOA 3NNTA 1KY6A 1P6WA 4WW2B 4GLRH 3UA4A 1KELH 1PAMA 1ZLVK 1BWKA 4PMUA 5M94B 4JHZA 1JXKA 1WHPA 5IB4B 1JUEA 4TUJB 3Q3GA 4Z7UE 4NZ1A 4S38A 5JMRA 1TPDA 1OD0A 3SYCA 3ELAT 2QT3A 2FJHB 1SFHA 4DW2H 4FQ2H 3EX2A 3TOPA 1JBJA 3D52A 5A2BA 1KO0A 4EDXA 4A4AA 4WTWA 3PQYE 2H6PB 2J44A 4H6RA 2XVBA 5BV7H 3TYUA 4F2UA 3HPFA 5DZNA 3FT9A 3BQUC 3TO4C 3BZFA 3LQLA 2XQYK 5HNUA 2C9VA 4F58H 3GMOA 3KWVA 3BUYB 1R38A 2ADYA 3ORJA 1WEJH 2VZUA 2CSPA 1OARL 1SEBA 3E3HA 3SCSA 2PRLA 1T8XA 4HKXA 1YEYA 3STCA 3OHXA 5ICYA 3SRDA 5FFGA 2Z7UA 3NYDA 3GNRA 1F76A 3NUKA 2FT6A 4YUEH 2IH8A 3WFAA 1BYNA 3U2EA 4RMBA 4EN2A 2YBVA 1KIRA 3LHVA 3IJYA 1XTLA 3CVHL 2J13A 4MMZB 4LGXA 3C56A 4JUTA 2O0TA 1T7ZA 1RZMA 4OZGF 4EO5A 2ED6A 1BWMA 3LPFA 3F7YA 1XGUB 2VLLB 2WD0A 4MNQE 3CK0L 4K7FB 3I9PA 3SIMA 2X4PB 1E4XI 5A8OA 1T1WA 3CIVA 3T77A 3HNTL 5F9WB 3OZ9H 4R7JA 1QD0A 3R6IA 5K4ZA 3MNZA 3BMXA 3LPOA 4JPIA 4ZAKD 4R7XA 4M43H 1RBAA 3S37H 1EKOA 2GQAA 3EOYG 3PWIA 3QSRA 2Z8RA 2LR4A 2YUVA 2AEOA 4G6FD 4PJ7A 1IC7H 1UATA 5DHVB 3HI1B 4X5LA 4PJBA 2DTML 3FFOA 4E2BA 2HNEA 1BEUA 2MQGA 5CUSH 5E08H 3MSRA 3OKOB 2FGZA 1JFXA 3KBNA 3A21A 3AZRA 4CVUA 4GJJA 3W1QA 7XIMA 1FX6A 2H3NB 4PI2A 3R0KA 1PQZB 3PVFA 3ERPA 1B88A 3WKNA 2C91A 4D6JA 3GUTB 3MI3A 3T0EB 2OTUB 2OJZL 5IDIA 3EWZA 4LVNC 3V5OA 1EEPA 1KPRB 2HE8A 5DUBA 4JFDA 4KROC 4S2CA 1MCPH 1IZJA 1JPIA 3QORD 4RISH 5DT5A 1RHFA 1XKJA 2D7OA 2OZ4A 1Q9LB 1IT9H 2ID5A 4KU1A 2DZWA 2BJMH 3BP7A 1RKRA 4KX9A 1QRND 3G9AB 3OO2A 4XB7A 2J1KA 3MV7A 1DE6A 3EDKA 5EBWA 2CPUA 5G5IA 3ARUA 4UOJA 3BOXA 4YLCA 4FNSA 3H70A 2Z2UA 4YSEA 3WUZA 4F7PA 3CHPA 4NUPA 5CGMA 1TSIA 4BQ5A 1MHCB 3MCLL 4TSAL 3NIGF 4EI5D 3WD5H 4PJEF 3PWNA 3MJMA 6PAZA 2X1OA 3NACH 5FOBA 1CVSC 2DQHH 4I1NB 4UM9D 1ZUAX 5HGAB 5I1KH 3C3UA 4Z7VB 2VUYA 1EMTL 4LSVL 3VTRA 2AVGA 3NP4A 3CUHA 4G9FA 2RJHA 4JREC 3U4EB 4Y90A 5DJDA 3D39E 4G8IA 4NP4H 1CW2A 2Q09A 2GVLA 1IEAB 3V6OE 1G7HA 1ESWA 1ZWIB 3QIUB 1H8OA 4Y1AB 2V7HA 4L4LA 4HNOA 3ABLB 1QI2A 1WDWA 3G08B 1JV2B 2VXSL 3NCJL 3T0WA 2P5NA 5C9ZA 5JQHC 2PWHA 4UOQA 2UBPC 1G6RH 4YTRA 1MCLA 4D0DA 1EVTC 1W3LA 4J27A 4I18C 4LHUD 3TLLA 3H2OA 2B20A 2GY7B 4KUCD 5BZDB 2DQIL 1KJMB 4U0QB 3B2DC 1AJ0A 3SDYH 1ZHBB 4V1YA 1BOGB 2MOVA 2YL5A 5A6TC 3VB9A 4H8WL 3POCA 4NQVB 3T0TA 4DWSD 2DQFB 3RVTD 1NFAA 2F38A 3FT4B 1G7MA 3V5FA 3ABKB 2CESA 1NPNA 3P30H 1KCZA 4LDEB 3QULB 2BHUA 3DDFA 3G6JB 2DB8A 2O1AA 5AZ1A 5D71H 3RURA 3T3MB 2VZOA 4DEWA 4URIA 2PU0A 5CH9A 2UXFA 1XXFC 2BRQA 1TJXA 4AENA 1XWVA 2XBDA 2XRAH 1WBZB 2NXZC 2J8UF 4AYSA 1W72L 3LSCA 2PZ0A 4EZLA 3FL7A 1S9YB 4BJLA 3PWUA 3QKEA 1UR4A 3HQOA 2H32B 2B14A 4N0FA 3QFEA 3MZNA 3OLIA 1ZBKA 2IWFA 2YRPA 3ULVC 4F9JA 4GVGA 1M3UA 3TN0D 1ML0A 4R84A 5G5DB 2GSEA 5CZ0A 3NCYS 3LCGA 4G9PA 3VZYA 4Q7IA 2EPKX 3SGZA 3K72B 1Q6LA 2EZ0C 3DUUB 1K9FA 1RK0A 2YGYA 1E9QB 4M7KH 1A9BA 4QDWA 2WQ8A 3P81A 2YDRA 2Q71A 4XPGL 2YAPA 3Q94A 3VFTB 1W0VA 2Y0SA 5EYWA 3BAKA 2F6XA 1Z8AA 3QS3A 4HBCL 4ZW3A 3A6OA 1GQKA 3VI4E 1KYOJ 4ZMGA 1GYAA 2X0VA 1XYFA 1GPOL 2H9GA 1B4RA 1HKMA 3NVQA 5BW7C 4NSKB 4ROQA 5ABEA 3RVVC 4YN5A 3CDFA 2AGJL 5HY9B 3MTXA 1YDPB 4G8TA 2MKLC 3KR3H 1K8ZA 3KPRB 3PBMA 3NZQA 2Y63A 2YD2A 3ZHKA 5I17A 2CLLA 4HJEA 5D9MA 4HCHA 2W9EL 4TQPA 4PS3A 1S9VB 4WF7A 1P0DA 1E6XM 1ME7A 1ZHNA 4J5VA 4MQ7B 3U36B 3KFTA 4HOWA 4GIRA 1R3KB 2HTMA 1EAJA 4NJ9L 5FGCB 4RK8A 4JHWH 1SDYA 1FH5H 3TCEA 1RSFA 4UWMA 4MWAC 4UV7L 3OIXA 4MZ1A 1PG7X 2FX9L 4IOFD 4O2CA 1ZJIA 4X4KA 2Z27A 4A38A 4X22A 1L6YA 3BC9A 1XZ0B 2G4EA 4R85A 4LO9A 1U83A 3P2VA 1M3JA 4MTMA 3I9GH 2R69H 4KVNL 1QPQA 3BH4A 2GCYA 2YGOA 3SYOA 3GDCA 1T7LA 3WDIA 2HSIA 4MA1B 5B7YA 1OPOA 1CF8H 4PRIA 3REVB 4U7KA 2H6RA 3HA0A 4RFEA 1ELSA 4H6EA 3WFEH 3CXHK 4HKBA 4X7TA 3QI9A 3BKML 1EYWA 2G4JA 5DELA 3E12A 1U93B 3FO1A 4PVMA 3S8HA 4LT7A 3SGEI 1QLRA 2HKHH 3UXFA 5FYKU 1CURA 1MAJA 3BIAX 5IMMA 4PRAA 3IJSB 2YPLD 3C0QA 3VVGA 1XI3A 1E4WL 3H9ZA 1UZ1A 3E6HB 4I1PA 4QRPA 5CZTA 2X4RA 1BQHG 5AW4B 2AEQH 4JN2B 5D7IA 3WGUB 4Y5VA 1AD9A 3JTTA 1XGTA 3KYMB 1A7OH 3NPSC 3SCMC 4X0NA 3UTSE 1QWKA 4W6YB 1OCCB 3DUSB 1REQB 1RHHB 5HYQB 1GGIL 3NIFF 4MJ2A 3N40F 4FQXD 1XJBA 3UZVA 2CHWA 1ZT7B 2KH2B 1QPRA 3FFCE 3QV6A 1CICC 4PBWD 4JRWA 1OFBA 2Y2YA 2EC9U 2ICWB 3T0VA 2VWEE 4AIEA 1E9IA 1JGUL 1JPTH 2PDQA 4NQEB 2WCSA 3GTIA 3M45A 3UIZA 1FNLA 2DEYX 2R6OA 3FTSA 1NIFA 1CZ1A 3CDCA 4A68A 1SGKA 4UMSA 5DHDA 4FTVB 1ZGLB 3VRIA 5IESH 1N8IA 1DTUA 1QRKA 1WFMA 5FCUL 1UXLA 2DJXA 3MRJA 4J3UA 3AG3B 2OO6A 3DERA 4R0LC 1QWHA 3DGCR 3TXAA 3A4DA 3FHEA 1UURA 2FGWH 3G1YA 3L65A 1DUYB 3FU8A 2Q7YA 4MLSA 1OE3A 1NMBL 3FYEB 1TO5A 4HT3A 4AAJA 3VPLA 5LCVH 3PZNA 4A67A 4F2MA 5I1GL 1TWSA 4F92B 4R7DB 3R5EA 5EEZA 2C3XA 1L0YA 3KG5A 4O51B 3TA3B 4OJCA 1JE6A 5EUKB 3V6OA 1DFXA 1UUQA 3UZZA 2Z7WA 2AJXL 3OVRA 2YCIX 4AXWB 1RULH 4NS0A 1PZ5B 4CU7A 3G77A 5GGRY 2XGBA 5T1DH 3HU7A 4LWWA 4WNQA 4BQ2A 3PAUA 4K8RL 2VMFA 4C59B 5I02A 3ARVA 2LHAA 3KRSA 2MQCA 3O2VL 4TOYL 4NB7A 4CNNA 5JXED 1RJYB 4EIGB 3H22A 4YCOA 4WHYG 1NBYB 2JKTM 2FEEL 2JCCE 1WG3A 3ROLA 3B0VC 2VITA 5FD0A 3L2LA 4UZUA 1FHLA 4QIRA 1A1MB 3VG0H 1GGCH 1EF2A 4CNIA 1UACL 4N87A 4C5YA 1U3HD 2FZNA 3BE1H 3HN5A 4LBEB 4GBUA 3LDBC 1X9RA 2O7SA 3OKEA 3GI9L 2Q20A 3TEXA 1VCAA 3GMPA 4B3VA 1HKVA 4D8LA 5HYSG 4PB5A 5CO1A 7TAAA 2ZX6A 2ESVA 3CQHA 3UESA 3T5WA 2MWCA 3K4AA 3F2BA 4HJ0C 2YMOA 3B8UA 5D7KD 1P5UC 4OFYD 1K4GA 4LVGA 3HJEA 3KOXA 1SFSA 2XSKA 2BCMA 4DXKA 3I4EA 2XPGB 2XTJB 2VDNL 2GKIA 3ULAB 3UZYA 2CUIA 3B9KB 3SY5A 4NX5A 5EU3A 4M1RA 3FHAA 1KR0A 4XSMA 3GUFA 5AOUA 3BXNB 3CZ8A 4AW4A 1A6UL 2JKPA 1G4EA 3O3EA 1TPB1 4LYKA 4AM0A 5ESVA 3BPOB 1JR1A 5DCEA 5ISZB 5F7EL 1WWCA 4KXAA 4HAKA 2E6JA 5DMGC 3QCVH 3UYRH 1YPZE 2B3IA 5FYKD 4J4PD 5BMXA 1EC8A 5IFTA 1XKYA 3KLSA 4C90A 5DJ6B 3GK8H 4XN5A 2CDGA 1KBJA 4IS6A 3IANA 4KVPA 1U4FA 1N3NB 3VWKB 1LL6A 2YMXL 4QYAA 1A5FH 2HN7B 2BPBA 1WQ5A 1D5BB 1I9EA 4OZIB 3IJHA 3SN4A 5LG1A 3MUGB 1B0IA 5IHUH 3BH8A 4E0RA 1F6PA 1YEJL 5HATA 3MC5A 2ORBH 2IANB 4AKPA 1KTRL 1VFAA 5DUJA 1HI6A 2Z8SA 4YYFA 3TCXA 4NOBA 1KBGH 4HSAC 5FC9A 4HDIA 1HAUA 2XV6B 2X28A 3OA3A 1R5VB 4PMXA 1AODA 2OTDA 3SGDH 2W95A 5L2JB 4ALAL 2R2EB 4JYEA 2OMWA 1PZSA 2VXUL 2NW3B 2WQAA 3GSXB 5KVGE 3BVXA 1S5WA 2QVHA 4CRPA 2YK1L 1ETZA 2QHAA 4AITA 5BOPA 1UH3A 3QQ1A 5JPMA 3QXDA 1C7SA 3VFSB 3WL1A 2CIIB 4CGTA 2VFEA 4EUPH 5B21A 2XTSA 3RJOA 4QXTA 1FNEA 5C9XA 1UD4A 3IT8D 4AEOA 3CSFA 3EJUA 3KBJA 3MUZ1 3TSDA 5FL1A 1BD0A 5EIIG 1B4EA 2Z4QB 3FOKA 2OI9C 3FUIA 4NQDB 4XH2B 1LLZA 1JAKA 4G6KH 5GRXG 2Z1WA 2VAAA 1KPUA 1NFDB 3EH4B 3QUYC 4M7TA 4S1QL 2NX5B 3E2HC 2AQTA 2CHOA 2AL1A 3O6DA 1XC4A 4AVFA 2VR7A 4RRPG 5JUVA 3GMMB 5IIEA 2WIIA 1EJTC 1XIEA 3CN4A 3CSGA 3BPCB 4XPBL 4MWFB 1SLXA 5C9KA 2ON3A 3WKQA 3FS9A 1WC7B 5FGBA 1HOCB 1ID2A 2ZCZA 4KRPC 2QVMA 1Z3NA 1K1DA 4JRYD 4PR5B 2M1KA 3BOFA 3CPLA 1TETH 5F96H 1T04B 3S1VA 2F53D 1HKFA 2OLSA 4KXBA 3K71B 1SVCP 2AZUA 4F7MA 1YEEL 5MKGA 5D7JA 2VEFA 5FYLH 5EMLA 5IFPA 3TJIA 3Q43A 9RUBA 1TPEA 1A0QH 1I3GH 3ZJ7A 3O3DB 5EO9B 3DURA 1TZ9A 4UMCA 3USZA 4UQ3B 1W9BM 2A7PA 3KLLA 3MCNA 1W80A 3DVGA 4KWWA 3VCLA 3L3JA 5JR1L 3VMNA 4FXGB 4JRFA 4MJHA 3EJTA 1NFPA 3GB7B 2YLAA 2EUVA 5AHFA 4XAKE 3V16A 3NQ6A 4RWHA 2NQ5A 5IEKA 3EBVA 1KLGA 3SE9L 3F1QA 1HILB 3U2SA 4APQC 1FL5B 4LKXB 2DWDB 1DFBL 3FQRB 4F2FA 3MNDA 1EPFA 5FWRA 3NCOA 1EO8H 1BJ1H 3U83A 5DXWA 2UY5A 2AEPH 4ASTA 4Y16A 4HPNA 1K3IA 4L6HA 2CO7A 4E4UA 1XPGA 1UWEL 1OSPH 1TUXA 1PFOA 1RURL 3W7CA 2W8CA 3P4NA 5FK9B 3VCNA 1IBHA 1FWCC 2ZXDA 3DGDA 3QZWB 2JF7A 4MBRA 4QRSB 1DJQA 3GM8A 3OZPA 1IQWH 2E3ZA 1Q6GA 3GC3A 4XBMA 3BVJA 1BJMA 2CLZB 1JN6B 1OAXH 4IJRA 3KWXA 1L6WA 2DY3A 1PCWA 2YZ1A 2FHBA 5LGHL 3QIBD 5I5RA 2V0TA 5AZEH 1PTGA 4UR8A 1YNTA 2V3GA 3MRKB 1F74A 4AW7A 5INDB 1U5HA 2QJGA 3QH2A 3AWEA 4LQFL 5DDHB 4JL2A 1RQBA 3MCKA 5BOFA 3R0DA 4WJXA 3Q1SL 4MDPA 2ZG3A 2JJUA 1JFQL 2PB1A 5EUOF 1R85A 3M0ZA 4AQ1A 8CGTA 1UASA 3AIVA 3UXKA 2OEMA 5E8PA 2JI3A 1MDTA 1DTNA 4GAJH 3KPMB 1Q8AA 2EUZA 3THML 3LRSB 2CJUL 2V7NB 4HIEB 4GSDH 1XIJA 1GYVA 4NQTA 5FB8A 5MENA 3O9WC 1FGNH 4IISA 3A12A 3FQXB 2CUHA 3M41A 2QPXA 3QEQE 2PDUA 2W0UA 2IAMB 5GRJH 2VELA 4IFKA 2GJ6B 1MEWA 1FSKC 4OOUA 2Z1SA 1G4TA 2E9GA 2GK1A 1RZJL 2HX8A 2HYMA 1VPYA 3R8QA 4YDJA 3ARFD 3LV6A 4IFRA 5T3XE 3DTUB 4X4ZA 3EWUA 1R6VA 2D7PA 1TJHH 1P53A 1JGVH 1QQDA 1YC7A 1O5KA 2KDYA 4US6A 2VXNA 2OZ3A 5AW5B 1T83C 5I73C 2XIIA 4HWBL 5F3FA 1SVDA 4PV8B 1FYTA 3A24A 2EDMA 3H3PH 2W07A 4Z5RB 1SJAA 1CFBA 4H7VA 3TV8A 4HUXA 4PJCA 4XAFA 5CJQL 4I0PB 4N22A 5BNKA 3P0XA 2DYSB 3CYVA 3QG6A 4MA7H 2D2HA 2IG2L 4ZQKA 3QUXD 2PTYA 3EOTL 3SRFA 2XFFA 4GINA 1TELA 3MJ6A 4M7SA 3ABQA 3LNDA 1TRDA 3OGVA 4IJBA 1V6WA 3D18B 1ONWA 3BGMB 2R1NA 3OBAA 1FWHC 1MRFL 5LIWX 2BCKB 4Y9AA 3BSZA 2AQ1A 2Y8KA 4WGHA 4JJOA 1OF2A 2A1WL 4FGMA 3D2TA 5EOCH 4CSZA 1JMXA 3P5YA 2EICA 2ZG2A 4N2EA 4K37A 4O00A 1RU9L 2CJSA 4WAFA 3GHEH 1DOSA 3LMJH 1SGJA 4N85A 4WK2B 4DPAX 4WZHA 4DP5X 2FD6H 3OWEA 1M9SA 4KKBD 1E71M 1TV2A 4OVXA 1X5JA 3Q5TA 3RG6A 3FT1A 4MXQC 3ZHDA 3PWLA 1RV6X 1Z41A 2VDKB 3TBVB 3E6EA 2IQAA 1U6AH 5CM1A 1IQDA 3SPVB 5IMKA 1QZNA 1RPKA 2NYKA 2J6XA 1ES0A 2RQEA 2DKSA 1K72A 4O2FA 3DOIA 1G4SA 1OOAA 4XPAL 3UYPB 4DZ8A 3IAGC 1EH9A 2ED9A 2GOUA 3RIAK 1JCVA 4XMLL 2PLJA 4FLQA 4A6YB 1X5AA 2ZUUA 3S4SG 3NJJA 4P7QA 4MD0B 2PURA 5L88H 2KL6A 5LN8A 3QXWA 3O2DH 1ORSB 5DVLA 3P84A 3EJSA 5A2IH 3L48A 4AT6A 5LB1A 4LCWE 5F6IB 1A80A 1A66A 1CBJA 1ID5I 3U2OA 1HHGB 5C0AE 1FG2B 2XPYA 3QIUD 3S35H 4NWUL 4Y1AD 2H2PC 5ACZA 1SQ2N 2X9ZA 2J6EL 1BWWA 1A7QH 1S4IA 1KACB 1ZAGA 3QNZA 3LCXA 2A5UA 3V0HA 3ZDYF 4NRZA 1LK2B 4LVHC 2Q3ZA 1KRAC 4Q4OA 4P57A 3EX1A 4NRYA 4U2YA 1I1RA 7PAZA 1LOSA 1YN7A 2C1HA 4OGAC 2PTVA 4KRMB 4Z2HA 3MR9A 5EL1A 4QRFA 1RPQA 5L0QC 3G22A 1DJGA 3GZAA 4HWEL 1HZHL 4CBPA 4CMMB 4B6ZA 5HQEA 4AUYA 3KDPB 2GDQA 3NPWA 4K3DL 1RUQL 1F11A 2R27A 1HNGA 1NLBH 1U58A 1UT1A 4NYUA 4OTXL 5EBLB 3JXAA 3IJ6A 4U31A 4GEIA 1NQ6A 3S5SA 4NL1A 5HGBB 4A39A 1MI5D 3V52H 2GJNA 3WNIA 5CJXA 4BELD 3WIIL 4G7EB 3EMQA 2BV9A 1M6OA 4U5IA 2OYPA 2D3NA 4HFUH 1YYMH 3B4YA 2GSHA 3SYAA 4I5BA 3UEZA 3LB0A 3UAAA 3MVIA 1M53A 3X3FH 3D4ZA 1JRCA 2Y7GA 2ENYA 3RNDA 4X98A 3DFNA 2HG0A 1JTTA 1T5WB 2WMHA 3OYZA 4K1WA 5J56B 4RNJA 5IBLD 2H41A 4A55A 2QDVA 4KWOA 1JDCA 1FV1A 5IT2L 3CLEL 4GW4A 2I14A 3ZQWA 1H1YA 1FFPA 1TE1A 4K1GA 3TNOA 4BJHA 3UC0L 1XLDA 4JR9H 2EIJB 1YXDA 2ZSWB 1IKFH 5ETUB 1E5ZA 4G1MB 5EU5A 3F7VA 3Q44A 3NZ8B 5EOQL 1Q5MA 4F8LA 1L9MA 6PTDA 4XKMA 2VXQL 1ZHKB 4D72A 2YL8A 2WLHA 1AW5A 2F68X 1KBLA 2IBGA 1IAIL 1K8IA 1P5BA 4NAEA 3BLEA 4CU6A 2QCDB 1WBYA 1PD6A 3PGDA 4IQHA 1XF2B 3FQWB 4HPGA 1ZVYA 2HT4C 4I6VA 1Z44A 1N70A 4AG0A 2ADAA 3GVGA 3SUVA 1P1ZA 4M6NL 2CLHA 3V4PH 2BP5M 2QKSA 4BKLA 3WL0A 1UT2A 4IEFA 2VDQL 3EW3B 2ZF8A 4PJAE 4A21A 4IG2B 2LE9A 1IAKB 3NZUA 4O02A 2EDLA 3WIAA 3S3PA 1FL3B 3LEXB 1NY1A 4V2BA 5DJXB 4ZX5A 3TNMA 1QFUL 3LD5A 3WIJA 2ZNWA 4IBTA 4JKKA 3LKOB 1MIEL 3HRPA 3WIFA 5F1UA 1ZVSB 4QTFA 4HEME 4H3DA 1VEMA 3K81A 1AYOA 3IPWA 2H8ZA 4FZEH 1C9DA 4NUMA 1KRMA 1CYXA 2OX5A 4QXGH 1I9IH 1OINA 3IFLH 3EYQD 5H4ZA 4N2IA 2J8TA 2ADGA 2O61A 4TRPL 5F97E 2ARJB 3SOBH 4CW1B 1JZIA 4MA8L 4HYWA 4CC1A 2Y5QA 3RRQA 5JHDB 4L8CB 2YPVA 1CJYA 3ZJKA 2REQB 4LC6A 4LSBA 3HFFA 3CU2A 4EN3A 4K36A 3PL6D 1XIWC 5H2BB 3BZ5A 1XLMA 3WJLC 2HT3C 3VE7A 1N68A 3GS0A 4M03A 2ZT9C 4NM4H 3MFFB 5CCGE 4XVDA 1BQLL 4G42A 2AF2A 1XF3B 2APVA 1JTPA 5MEOB 1JCXA 3WI9A 5HHPB 2B1OA 2R4RH 4MS8D 3RUGB 4OQVA 3V0IA 4N5ED 4AY1A 1B3OA 2SODB 4XPFL 4PUMA 3KLDA 1BZOA 3N4AA 4D8OA