3H55A

Crystal structure of human alpha-n-acetylgalactosaminidase, complex with galactose
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
387
structure length
387
Chain Sequence
LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Alpha-N-acetylgalactosaminidase
publication title The 1.9 a structure of human alpha-N-acetylgalactosaminidase: The molecular basis of Schindler and Kanzaki diseases
pubmed doi rcsb
source organism Homo sapiens
total genus 127
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3h55A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3h55A01
1FDJA 3HIJA 3EX3A 1O5XA 2Z1BA 3LI0A 4LUJA 4MY9A 5G4EA 4MFDA 4M8UA 3W38A 2DU2A 4FNPA 4MJZA 2AGKA 1FDYA 1D3CA 4GC4A 3KLKA 4TU1A 2VFGA 4OHQA 4QSHA 4NVTA 5E0KA 2BTMA 1W5QA 3ELFA 4Q33A 3W1UA 4FB7A 1PIFA 2EQDA 5KMYA 3R89A 3BARA 1A53A 2E5CA 4LWWA 3ZT6A 1WOAA 5ABTA 4FLOA 1XBVA 1FCBA 4MAZA 2DZPA 3C2VA 5DBUA 5FF7A 2P0OA 3HBLA 2ZX7A 3W1LA 3MJYA 3TTYA 3H55A 3RILA 3NQEA 4WOZA 1B4KA 4HIBA 3PAJA 3TNOA 5KITA 5HUOA 2Y2WA 5I3JA 3WK0A 2H90A 1ZNNA 1MW0A 2NSXA 3MMTA 3LI1A 1GT8A 3UXAA 1TB3A 2WNZA 4XZ9A 4TVUA 4EF9A 1IV8A 2ZBTA 2QCDA 3LHZA 2XIBA 3BUIA 5G1TA 4GUIA 4G1KA 4A22A 1L2UA 3CWNA 1JGIA 2YXGA 4JTTA 1G67A 4UZUA 1F2JA 2NX3A 4LTSA 4LXFA 1WA3A 2ABAA 1XBXA 4PCSA 4AXKA 4FIQA 2D73A 4UQCA 2PRLA 5DXXA 4DF1A 5GVJA 3K8MA 2ATSA 2JKAA 3DFTA 1BPLB 3EWZA 3VE7A 2GUUA 2JBMA 2WC7A 1ZJBA 3A6OA 4UTWA 1F76A 5H2ZA 3YPIA 3IJ9A 4O19A 4GRSA 1KBIA 1JD9A 2BHZA 2EAEA 1JJKA 4WQ6A 5AC8A 3CIXA 3M41A 1K8ZA 1FCVA 3G3DA 3HO8A 4NJGA 2WNQA 2C14A 4K8HA 4PTNA 1QOQA 3HQ1A 3S1VA 1D7FA 1UUMA 3STEA 1JQXA 2NZLA 1W3TA 1CGXA 4LRTA 1KTBA 1BWLA 2B7PA 2RDWA 4AEOA 3ZR5A 2VUYA 1RV8A 3P74A 5DBTA 2F1AA 2ZXDA 2GVYA 4GO9A 3HPSA 4NUWA 4I9AA 1TPDA 1YPFA 4DO4A 2GVGA 3GVGA 1RR2A 4E0CA 2O7QA 1KFKA 4JIQA 1MVYA 2C13A 4J3WA 2GUYA 2WSYA 1KM2A 3G22A 3W2MA 4UFIA 1JDCA 1T0OA 3W7MA 4JL2A 1AL8A 3GBDA 4FEZA 1G9HA 2WSKA 1MXDA 3WFZA 2Q8ZA 3FYPA 2EEXA 3L0NA 4O1DA 3LRKA 1VHNA 3O6YX 3DHDA 3HG3A 4KWWA 3R2GA 3OVRA 4RX0A 3UZ5A 3MBDA 1TPFA 3W70A 5DY2A 3AMLA 5HQEA 1CYGA 1UJPA 3KVMA 3TXZA 3W1QA 1QHPA 4L4MA 2F1BA 3L5AA 5D02A 1JULA 2EKCA 3MBFA 1ODUA 1HX0A 2XN2A 3LRMA 4UOZA 4RR4A 4O1AA 1KLYA 3P80A 2YW3A 1PS9A 3KOFA 4UNLA 1TTQA 4FMVA 4MYAA 4IMCA 4RXFA 5LHFA 2PRMA 3CPUA 3BH4A 5EYWA 2B7NA 3FA5A 4EF8A 1H1YA 1H60A 3EKLA 3IGSA 1O60A 2ZZ6A 4NJHA 4HT3A 3MWAA 5A6LA 2YA2A 3NM3A 2ZUVA 2DH3A 3WDIA 4HOXA 1XDMA 2ZUSA 1G4TA 3C3NA 1EP1A 1EB3A 1VYRA 3NZ1A 4QISA 3HJEA 3LHYA 3SECA 1XCWA 1FWRA 4QNEA 5KINA 3TV8A 4AMWA 1BEUA 2OSYA 1E3XA 2VT0A 2TRSA 5CZSA 3HGRA 3TSBA 1G4PA 3CB8A 3LCIA 3EJRA 1OK4A 4UUIA 1UA3A 4DPQA 1LYXA 1FWWA 1DKWA 3WJZA 1YTEA 4PODA 2QUVA 4RXGA 1OF6A 1W37A 4N9CA 3KRUA 1QOPA 3PY2A 2C6QA 2WJZA 5F2IA 3QQ0A 5CLTA 1V5XA 5TIMA 1W5MA 4P2VA 1Y7VA 2NLIA 3W71A 2BY1A 4K7YA 1TPB1 4O12A 1XGZA 3FJLA 5EL1A 2Y88A 2AAAA 3EWYA 3VFLA 1R33A 5AHLA 3GAKA 4JY9A 4PEEA 1LDCA 1TRDA 1NM9A 3EXSA 1R47A 1DHKA 1AQHA 2NUXA 5J5RA 4PSRA 2QAFA 4LC6A 2I14A 3LB0A 4UOQA 2QEZA 3PBWA 3W7HA 3WENA 3W3OA 1OYCA 4ZVJA 2I1OA 1U83A 3NL6A 5AC7A 2O7SA 3VMNA 1M7XA 4IUOA 3LX9A 1CGTA 1P6WA 3K8LA 3W7OA 4DPPA 3NL3A 4FO4A 3DX2A 1FQ0A 1LLZA 3TQKA 1TV5A 3N14A 4S1FA 1YLVA 1GYLA 3NQ8A 5DLCA 3DFPA 3W1TA 3P7YA 3GR7A 4QNWA 4WY0F 3L4ZA 4JDBA 3AO0A 1LRNA 1WX0A 4PL1A 5E6ZA 3BSHA 5G2WA 1GWJA 3EX2A 3KE0A 5F1VA 3VI2A 1OX5A 4NJJA 1FWTA 1MZHA 5LGZA 4ZQCA 2F61A 5I23A 2H8XA 3LGEA 1R30A 2A1YA 4O8RA 3GBEA 4AEEA 1GVFA 4R53A 5FI8A 3GXNA 4M6QA 5HMSA 1W5OA 1QW9A 2DZVA 3UWZA 1JG9A 1M7PA 3L5MA 2DZUA 3W2KA 4S2CA 2BWGA 1AG1O 1WOBA 3BLEA 4LV9A 1RVGA 4J28A 2WVSA 4UQBA 3QMSA 3C8FA 5BNKA 3T4CA 3N73A 3S5ZA 3DI1A 2VENA 1VFOA 1X1OA 3GXIA 1ZCOA 3QSRA 1OFEA 3TSDA 4X9SA 5K4ZA 3W7CA 1KWKA 4ADTA 1PVNA 2X2GA 1IXPA 3UCQA 1M5WA 3NXFA 3EWBX 1HG3A 2A5HA 2CLOA 1JR1A 3TU9A 3KFTA 3LCHA 1WZMA 2BY2A 1IGSA 4OE7A 2EADA 3WY4A 2XWEA 3IRDA 4IXXA 1PPIA 3TW7A 3GKAA 1UD6A 2C15A 3QMTA 4UCGA 3NQMA 2FH8A 4HNUA 3DFNA 1I2NA 1R75A 2DJXA 1YPIA 3CTTA 5F7UA 5HDRA 4XTDA 1SO6A 2FPVA 3NPXA 1TCDA 2D0HA 3STCA 1KM1A 2Z6JA 3W1XA 2A7PA 1LP6A 4Q32A 3ZS4A 3NZRA 2YSWA 4LUIA 2JGYA 3WK2A 3QH2A 2VOMA 3P61A 5D04C 3NO5A 5I3GA 2Y85A 2OW6A 5KZMA 2OJPA 1P0NA 3P8JA 2B7OA 2F18A 3G1YA 4JYEA 1YXYA 4GUGA 4UTLA 4EOUA 1CLVA 1XI3A 1QO2A 3PG9A 4UMBA 4U28A 4GI6A 4JCMA 4O4VA 1TQSA 4Y96A 4AHOA 4CQ8A 1K03A 4FLSA 3UG5A 4NT0A 5I3HA 4KFNA 3W7LA 1LBLA 3PWAA 3IK2A 5DN1A 1N7KA 1VYPX 1LRTA 1ZALA 3ZWTA 1TTJA 1CDGA 1Q6LA 2QF7A 3M5VA 4ML9A 1CGUA 3EXRA 3TE9A 1JCXA 4Y90A 2UV8G 3TQ0A 4AB4A 1XD0A 1GJPA 3EDJA 3P5ZA 2V2HA 3QMRA 4N9DA 1K8YA 1OX6A 4MY1A 1PS3A 3INPA 5E70A 1W54A 2ZTJA 2H8ZA 3TSMA 4YCPA 2VEIA 1Q6RA 1ICQA 1TPC1 1BG9A 1Q4NX 3IVUA 3L4YA 1NEYA 4MB1A 2YGYA 2ZZ1A 1QPNA 2DZSA 4J9JA 5D05A 4B9ZA 3TAOA 1TQUA 5C54A 4JFVA 1SO3A 1Z41A 2WV8A 4N4QA 3TFXA 1A5SA 3O6DA 1PZ3A 4A2SA 1JDAA 3PULA 3S2CA 3OLEA 1DHPA 1YXCA 4CGTA 4B9YA 2E77A 3ANYA 3L0KA 3LHTA 5A8GA 4UTHA 4GUJA 3IIPA 4PCTA 3DX0A 3II1A 1V3MA 4XQ6A 4XBSA 4WY0A 5C2XA 4IQLA 3MHGA 1Q45A 3AXHA 4N9BA 1VAHA 3N19B 1LM1A 3BCDA 1JFHA 2VKZG 4MKNA 1GTEA 5K9XA 4Y9AA 4O11A 2PWGA 1JVNA 3UPBA 1B0IA 2E6DA 4TX9A 4FNSA 1MW1A 3W23A 3FFSA 3W83A 1JUBA 3SR7A 4PCFA 3G1AA 1J0KA 1R2RA 1SMDA 1G7VA 4DO6A 3IGXA 1GEQA 3KRZA 2WKJA 4AYSA 3JRKA 3M1ZA 2QPSA 3TOPA 4TMBA 3BLFA 1I75A 5D2XA 3LTSA 1UD2A 5D2WA 3ZQ9A 4JY8A 4DEFA 1ZAIA 2Z6IA 3L4UA 1TTPA 4O13A 3LCWA 1KBJA 2YR1A 1VFMA 2ZICA 4BFAA 4HPHA 2E4TA 2F7RA 4Z1CA 4YWIA 2WOQA 3CQ0A 3S42A 3TMQA 3DDGA 4X0NA 9CGTA 3PG8A 2XVKA 4N2YA 4NXKA 2YFNA 3TXVA 1MWOA 1FCQA 1KA9F 3FIGA 1W3IA 4GWEA 4LT9A 1KM4A 3WNNA 5TD4A 1K7XA 2VFHA 5AHIA 2BY3A 4J3TA 1X8FA 4KWVA 2RKXA 2PURA 4DF0A 1SZFA 2I9EA 3BPWA 4YXGA 2QCMA 3F03K 3RK8A 1H63A 3GX9A 1YTDA 1QDSA 2CZFA 2H3BA 1OB0A 2YPIA 3NQ2A 4IMGA 4RK8A 1SW7A 3STGA 3M5ZA 2X1UA 5CZ0A 3C2OA 3QF0A 3EXTA 6TAAA 1GQNA 4JS3A 1OT1A 1UH3A 1UH2A 5LSMA 5KZEA 5CZJA 3ZR6A 5F2MA 3EDEA 3BVWA 3T44A 2ZA1A 4JX5A 4NJKA 3HMJG 1SO4A 1LOQA 4BK9A 3HZ3A 4A2RA 1I45A 4A29A 5D09A 1JCMP 3CU2A 3LPOA 5FF3A 3PM6A 2ZUWA 1AW2A 1TREA 4I7VA 3WN6A 5AHEA 2F2HA 1KXHA 7TAAA 2QDGA 4FX7A 5I3FA 3NQDA 2D0GA 3CPRA 3V1PA 4RCXA 1OFPA 3D51A 4K6AA 3OVPA 2DH2A 2NWRA 1XBYA 2EPHA 2J9YA 4UTUA 3FKKA 4O10A 1XUUA 1ADOA 3KX6A 4JTIA 4UTTC 2E8YA 1QR7A 3PS7A 3BW3A 4RZ4A 3KAOA 5DFAA 4WF7A 3C2FA 4JYFA 2QCLA 1TTIA 4N9EA 2ATMA 5MHBA 3OHIA 2GQ8A 1BWKA 1P1XA 1QWUA 1VS1A 3UWWA 3MYPA 1PHWA 3B8DA 2PCQA 1FX6A 4GQQA 1MXGA 2A7NA 1H3GA 1UD5A 3IV3A 2J9ZA 2Y70A 3Q94A 1UB3A 3UYCA 4UTMA 5HNRA 2WVUA 3BV4A 4CKQA 3SW6A 3BUDA 3G0SA 3STFA 4XB3A 3EDKA 1GVOA 4Y8FA 4GFSA 1UKTA 2X2IA 3O07A 1HO1A 1ICSA 1OFAA 4H8VA 5CPMA 3C4UA 1K02A 4RV8A 3W74A 4HPXA 1HXKA 1AL7A 1IZKA 3L65A 3OA3A 2FB3A 4B5NA 2WPGA 3FS2A 3U6WA 4JTUA 2NXGA 5AHFA 3IVSA 4J3UA 4WSKA 4WLCA 2VNCA 1DTUA 1VLIA 3W1NA 3WEOA 1WPCA 3QGVA 3M5YA 1L6WA 2G3NA 3IIXA 2WVTA 1HL2A 1ZY9A 1Z32X 4W9TA 4AWSA 1UD3A 5CZTA 4MJMA 3LCGA 3LERA 2ZX5A 3GB6A 4JTHA 3GKFA 4CNOA 4GO8A 5K7JA 3WEMA 1NOFA 3ZOAA 1M6JA 4EWND 2ZWZA 4ZQMA 2E5DA 3BUPA 3HGOA 1QI5A 2VFEA 3SFKA 1JRCA 3WNOA 4NNCA 3IIZA 5KZDA 1GZGA 2FE0A 3D4ZA 4AAJA 4FXSA 3CZNA 5AYXA 4IPIA 3GXMA 1XC4A 5K2ZA 3Q2DA 3PR2A 4JICA 4AWTA 1FXQA 3ZWSA 1NF7A 3IIOA 4JR5A 4JFSA 5EY5A 1T99A 4WX2A 3NDOA 4O4WA 3DAQA 1J5TA 2CLHA 2HS8A 3NQAA 1KFEA 3W86A 1MXSA 1JI2A 1W5NA 4JN6A 1FWSA 2A0NA 2WNNA 4FIRA 1VCGA 2ZIDA 4FF7A 4IMDA 1UASA 3KWXA 4JIPA 4H8UA 1QPKA 1G4SA 3E49A 1XSIA 3CTLA 2V2DA 3I65A 4JTJA 3UD6A 2JK2A 1KGXA 1QI3A 1TPWA 3D0CA 1JF6A 2WSQA 2V3EA 2PRHA 3G8EA 4AEFA 2ZX9A 3VCRA 2EJ1A 3Q37A 4UMAA 1EHAA 1VR6A 2YX0A 1KBBA 3RF9A 1FCUA 4M5PA 1ONRA 1VZWA 2QJIA 3KL3A 5LZLA 1OFQA 1VHCA 2IQTA 1EUAA 3GDMA 2WANA 1OG0A 4JTEA 5AFDA 5G4WA 3N9SA 4X22A 4DQWA 8CGTA 1VQTA 4U4MA 2BSLA 5IM51 3NPVA 1RPXA 3B03A 1F5ZA 2EAWA 3NQVA 4XBKA 2C3ZA 3RFAA 3W75A 1B9BA 3LHUA 3FYOA 3CT7A 3NAVA 3C2RA 2Q3OA 5DCBA 2Y7FA 4Q4KA 4UIOA 3CZGA 1XUZA 1ML1A 2NXHA 1WYIA 2E09A 3G24A 4NJIA 1VCFA 5BMWA 3NQ7A 1LBFA 3NPWA 1XD1A 3EWUA 5A5WA 3UG4A 3TJLA 2ZE0A 1V3LA 4RLIA 3NPUA 4E38A 2RDTA 3UWYA 3W1AA 4UR7A 4WUIA 3WJSA 3B0UX 1W8SA 1S5VA 4N4PA 3UWVA 1OFBA 3GZ3A 3B4UA 1XH2A 2YYTA 2ZCGA 1OX4A 5CSSA 5LNUA 1OFDA 3LXBA 1H50A 1XDLA 4A3UA 3EX4A 3W2UA 2CZDA 3BC9A 2D2OA 5HPOA 4RZ6A 3LV5A 3WJWA 4FLRA 1ZS2A 3IGUA 3VU2A 3ABSA 3NVTA 3W7DA 4N6EA 2G5WA 3P60A 1SSDA 4JD4A 3HPXA 4UFLA 3ZFHA 4IOTA 2QCCA 1CGVA 2CZ5A 4J3XA 4DXVA 2C19A 3VO0A 1CXKA 4LVBA 1KFLA 5CKSA 3M07A 4AW7A 3EX1A 3NM1A 3BCFA 3I7SA 4MIMA 5U4NA 2VR5A 4QAWA 1QI4A 5A2AA 3QQ1A 2GJPA 1E40A 5HULA 3EB2A 5EKYA 3W85A 2JGQA 2YCEA 3O1NA 1PAMA 3R12A 4LRSA 4KMQA 3TAKA 2ZXBA 3GXTA 1Z44A 5AHMA 8TIMA 1I2QA 1HL9A 5KTLA 2ZRXA 4M19A 3F1QA 1OK6A 3EDDA 2J27A 4JYDA 2ISVA 2VEKA 4BI7A 4LU0A 5CSRA 1FUYA 3UXDA 1DORA 3K8KA 5HUPA 4E2OA 5CLWA 1G5AA 2C7FA 2EO7A 3A5FA 4AHQA 1HL8A 2FYVA 1K8XA 3W7NA 3MI2A 1JCJA 1UCWA 2X16A 2F7OA 1G94A 2V3FA 3WNLA 2H6RA 1SFLA 3L21A 2CXGA 5F2GA 1JQVA 2A4AA 2C1HA 2Y61A 4EIVA 3L2MA 5AB3A 2WVVA 2TYSA 2ZX6A 3MUXA 4JTGA 3SSJA 1KTNA 3W6YA 3VGFA 3VM5A 3G18A 1WQ5A 4ADSA 4NNAA 2Y62A 2PWFA 5D03A 4XKYB 2GVLA 3NNTA 5CXPA 1K7EA 2NX9A 3G3MA 4HN4A 3RU6A 1TQWA 2XIIA 3PUOA 2XVLA 3A23A 2QCDB 1RQBA 4UMCA 3S1WA 4WD0A 2QUUA 1PEZA 3L9CA 5HR7A 2D3LA 2FHCA 1M7OA 3CLMA 1ME9A 5AOUA 3AMKA 2Q8LA 1YDNA 1KV8A 2BXZA 2WKGA 1TYGA 3E02A 2ABBA 2HTMA 2NXIA 3H54A 2OMAA 1RD5A 4Z0SA 1KB3A 1IF2A 1KM0A 3IJ8A 4C1LA 3DZ1A 5CGTA 3T40A 1JAEA 4AYGA 2ZRVA 4R33A 3G1HA 5CG7A 4GQRA 1U5JA 4WXZA 4JFWA 4D2JA 2ZRUA 2IGTA 2QCHA 4MZYA 5LNSA 2X30A 2AQWA 4J3SA 4FX8A 1V3KA 1JD7A 1TMHA 2HSAA 1OFRA 3QC3A 5LKYA 4H4IA 5BW6A 3UG3A 1B3OA 3CM4A 5CPNA 3VX1A 1DV7A 1F6PA 2OT1A 1VYSX 4MPQA 4NX5A 3ZR4A 3VM7A 4IX2A 3KXQA 3TONA 4Z08A 1EWDA 1S5WA 5AYZA 5E9AA 3B05A 2CLMA 1QNVA 3MYOA 5HJLA 3T7VA 3FJ6A 1TQVA 5L6UA 2HS6A 1H7WA 3A22A 3HF3A 3O8AA 2X1RA 1PV8A 3L2IA 4RZ5A 2E8ZA 2PWDA 5FEPA 3T55A 1HTIA 1VRDA 3LTYA 2OYMA 2RDUA 2OX1A 1NF0A 1KGWA 4OV4A 4LNYA 2B4GA 3NYZA 1NSJA 2WSPA 3O16A 4UFJA 5FEXA 1IZJA 1TPH1 1JIBA 2NV1A 1KLZA 1OYAA 1C9DA 1LOLA 3GXFA 1SO5A 1JUKA 3P5YA 2Y24A 3QFEA 1CGWA 2A2IA 4QQ3A 3W7RA 3MI6A 1WV2A 4GNJA 4BA0A 5G2IA 4GKLA 1VB9A 2ZWYA 1ZAJA 1OT2A 5C5YA 3AXIA 4U31A 1VC4A 1KGUA 3N2XA 1R34A 3BW2A 5CGMA 4PSPA 3M9YA 1EH9A 1N8FA 1OYBA 3GYEA 1L0PA 2X2JA 4WOQA 2BZNA 1RZMA 2VFIA 1IXOA 4GE8A 3LHVA 5E0FA 1H61A 4IGHA 2FTPA 1PCWA 1JCLA 3S5NA 2ZRZA 2W0UA 3W22A 1ZHAA 2EF9A 2Y89A 3M6YA 4PH6A 4ALDA 4MZ1A 3CZLA 3SIZA 3LM7A 4UQDA 1BSIA 2OT0A 3NOEA 3LCLA 3WNMA 2ZYFA 1PE1A 1T96A 2YA1A 1OJXA 2E6YA 1EIXA 2FPYA 4O18A 3C61A 3EEGA 1VFUA 4OGZA 1TPEA 2AAMA 1GVSA 2ZQ0A 3HJZA 3W7QA 4DBDA 4UNIA 3OEXA 5LNVA 4O1BA 5EA9A 3IVTA 4CN1A 3MHFA 1BLIA 5C6MA 1YADA 3THAA 4YCOA 2ZRWA 1O5KA 4JL1A 3L4TA 3I7RA 5G5IA 3UEQA 2V0TA 2F7FA 3S0CA 4K36A 1D9EA 1VJSA 3E0IA 3B04A 4DO5A 3TW6A 4OQVA 3W2NA 1NAL1 1DOSA 4GJ1A 1SW3A 3DU0A 4I7WA 1S46A 4MLJA 3S9YA 5T26A 3DX3A 3CEPA 2TMDA 4NI3A 3NQCA 3BVXA 1KXVA 4TO8A 3R8RA 3WY2A 1TQTA 3M47A 1SFJA 4O1CA 2Z2UA 2AMGA 3W84A 3I68A 1I2PA 2A21A 3VMOA 4GXMA 4O15A 3MI3A 2Z1KA 1NFBA 1JF5A 2X2HA 1SZGA 3DXIA 2X1TA 3F4WA 4JEQA 4TIMA 3A47A 1QO5A 4H6KA 4LPCA 2V81A 2ZDRA 4UZSA 6ALDA 3O15A 3DHFA 3LCXA 1LWHA 1EP3A 2FHFA 5K3VA 1WBJA 1CX9A 1O4UA 1ZJAA 3GIYA 4LC8A 4BWLC 1SZEA 4NNBA 3L4VA 4HP5A 3KLLA 4AHPA 3WDHA 4IPJA 5CPLA 1LTDA 2G96A 4GUHA 4HHPA 3SZ8A 4U2YA 4O0KA 1QWNA 1OSEA 1WBHA 2JKEA 3GLCA 3DBPA 3D52A 3FLUA 1YDVA 1BAGA 2C0AA 3H53A 5DO8A 3NQFA 3DHPA 2QDHA 5E6YA 3UY7A 4N6FA 3RLVA 1JCYA 3S8HA 3QRHA 3BW4A 1J4EA 3E12A 3M44A 1EX5A 1H5YA 2ZZ3A 1GVIA 3G0XA 2NT0A 3LV6A 1I8JA 3I6RA 3CLWA 2VFFA 3N3MA 4P61A 3NEVA 5D37A 3GTNA 5F4WA 3VNZA 3R5EA 1CGYA 4K8EA 3TC7A 1QHOA 2QJGA 1G1YA 1GPWA 2YZRA 3W2JA 1HWWA 1Z42A 3LLFA 4RJEA 3SJ3A 3ABOA 3BVJA 2V5LA 1BVZA 4HNVA 3VGDA 1JL8A 3LHWA 4O57A 4JTSA 2NV2A 1Y0EA 4PC8A 4O16A 1HVXA 1TPVA 1Q3NA 3B0PA 3HPZA 3BG9A 2Y5EA 4OJYA 3DC0A 1V3JA 4CN4A 2VELA 2CWNA 4GUFA 4LOCA 2V3DA 4JX6A 5E1QA 2VRKA 2WQPA 3W7PA 1UKSA 1DQXA 5CPOA 4AIOA 1G6CA 4HNTA 5EPDA 3ATZA 1WO2A 4CN6A 3MP4A 5FESA 2GQAA 1TIMA 3LLDA 4K37A 2E6FA 3G0UA 4JDYA 1G7UA 2NWSA 3UNDA 3PB2A 1XV8A 4FHAA 4AMXA 4A21A 1MW2A 4NZJA 4YLWA 4FNQA 1PIIA 3PVFA 3K30A 1WZKA 2FIQA 2CLFA 3QW3A 4OWGA 3L66A 2VC6A 3UQNA 3DFQA 1KW1A 2PE4A 3GNNA 2VEMA 1A5AA 2QCNA 3GXDA 3LXAA 2QMKA 4Z1DA 3NR0A 2ZRYA 2EHHA 2D3NA 1X1ZA 3FAWA 4LVFA 4JFUA 4OT7A 1ZAHA 1XXXA 3D4YA 5F1UA 5D33A 5G1YA 3L4WA 3A4AA 2B0MA 3P82A 4LQ1A 3LDVA 2EGZA 3GAYA 1EUNA 1ICPA 3WDJA 3PSVA 1VLWA 4IXHA 2OYLA 2BX7A 5BOOA 3BG5A 4FNUA 4WSJA 4U2ZA 1S3HA 4ICNA 4PA8A 4JTLA 2WSRA 4CLMA 2GOUA 4CCDA 3BK0A 1ZJIA 1W56A 2V9DA 4AF0B 1KTCA 3U2OA 1A50A 3VGGA 1P4CA 3TDFA 1MSSA 1J0JA 3HG2A 1EA0A 4ADUA 3OLGA 3KL5A 1H7PA 3VE9A 1CXLA 3L68A 3Q58A 4MY8A 3JR2A 3FOKA 1J0IA 2OYKA 3DGRA 3QW4B 3I7QA 4CNPA 1P0KA 1TSIA 2XN0A 1TV8A 3L4XA 2QJHA 3LCFA 3W37A 3BUQA 2G95A 5DXYA 3TFCA 5HR6A 4O53A 1S5TA 1AW1A 3PB0A 1FXPA 3UPWA 4MYXA 3VKJA 2QAPA 3BLBA 5G2HA 3RMJA 2A6LA 1SU5A 5K9DA 4Z0JA 4UC5A 5F2LA 3MP3A 1I4NA 3TX9A 4YMZA 7CGTA 1MEWA 4M6PA 3TA6A 2WO5A 2QR6A 1RQEA 2R94A 3HGJA 1LLWA 4XKYA 2EACA 1CXEA 3VNYA 2GVJA 3CC1A 3KVKA 1Q6QA 3KRSA 1HFBA 2YJQA 3PBVA 1UKQA 4O50A 3THQA 2NX1A 1B2YA 3L2LA 4WY0B 2Y4SA 1JXKA 1WZAA 4IX0A 3U8GA 4HOWA 5K4XA 1F6KA 5E93A 3NG3A 4LV4A 3V75A 1TJRA 5IBXC 1E43A 1KXQA 1H7NA 2BLEA 5HINA 3W7IA 1VIWA 2QCEA 1LZOA 5C55A 1DJQA 2C18A 2J6XA 3EJUA 3OLDA 3BVVA 1OHLA 4M7TA 4IWWA 2OSXA 1E3ZA 3UWQA 3WJYA 1ME7A 3DKLA 2DZTA 3DFOA 1LROA 3CV5A 2WNWA 3DKJA 3OVQA 4CCCA 3W7JA 4J27A 5L9FA 1XFBA 4XTIA 4JCLA 2Y7EA 2DJLA 3C6CA 3KHJA 4O28A 5D2TA 3WFAA 3M0ZA 3OG3A 1EA9C 4X3ZA 3KEHA 1PL9A 1SSGA 4GI8A 5KEZA 2E5BA 3CWOX 3BG3A 3NQ6A 2YW4A 2TSYA 4WJEA 1A47A 1Q6OA 2OCZA 5LHEA 1OFOA 3BVTA 2XN1A 2QPUA 1L6SA 3TK7A 2VEPA 3SI9A 4PEKA 4EVZA 2WPBA 1YTKA 2Q3RA 3W7EA 2RHGA 3W1PA 3QEZA 2XVGA 3VSUA 2ALWA 1XBZA 1W3NA 5K9CA 2E0PA 3HG4A 5DY3A 5CGQA 1OGSA 4ZMGA 1TV7A 4M56A 4CQAA 3BAIA 2Y6ZA 3JS3A 1SMAA 1SR9A 1SPQA 4I7UA 4LW7A 4H2CA 3DI0A 1TQXA 3P67A 4Y6GA 3R13A 3MP5A 5H91A 1HNYA 4QAIA 1VGAA 1XH0A 3QSTA 1MEIA 1H7RA 4CVWA 3G1XA 1N55A 2Y7DA 1FY6A 3HGSA 3O05A 3EJPA 1KFCA 3GDRA 1RQHA 3W07A 4KWUA 3GDTA 2RFGA 1IIGA 3A5VA 1GJWA 1JXJA 3CHVA 1QPOA 3ZSSA 1VCVA 2CLKA 3GNDA 1QPQA 3S1XA 1SUXA 1E51A 2P1FA 1EEPA 1OF8A 3T78A 1GG0A 3W7KA 3G1VA 4BWLA 4AH7A 1TCMA 3C56A 1J0HA 2FQIA 2ZUUA 5FEWA 3ZT5A 3VGEA 3L5LA 3NGJA 4LVGA 1QMLA 3AJ7A 3A21A 3MW7A 4PFMA 1IXQA 3W7GA 1TO3A 4FXRA 1U30A 1R2TA 3GDKA 2JKPA 2FH6A 2WCGA 3P84A 4UQEA 2V82A 3LBCA 2Z0IA 1EWEA 3M7WA 3C2EA 5D2VA 4HSNA 1YXDA 3O6CA 3DENA 3G1SA 1THFD 3E96A 4FX6M 5I5RA 3CZSA 1O94A 1H1ZA 4DBEA 3W1RA 3HB9A 1W0MA 4OV9A 3CGTA 4JXCA 2CHNA 2W79A 1KM5A 2C8NA 3L67A 3WMSA 4J3VA 3EJTA 1CXFA 1TRIA 4O17A 3QPYA 4R7JA 2E9BA 1UD4A 1LORA 5BRPA 2BHUA 5U7SA 2NUWA 2V5BA 1JUEA 2F84A 4OBTA 1AK5A 3S6DA 4CCEA 4JFTA 2TPSA 1VPXA 2YYUA 5I24A 5D38A 2FB2A 1EPXA 5BRBA 4IJBA 3KVLA 2D0FA 3WNPA 2YDAA 4UCFA 2P10A 1IIHA 5A2BA 4S2BA 2ISSA 2DORA 4UNKA 4ZQNA 3LTPA 3W2LA 2DIJA 3O06A 3CZKA 4K7VA 4YL2A 1L9WA 3TKFA 4UTJA 3SGUA 2YA0A 3PUEA 4KFPA 2CLLA 2BXVA 6TIMA 1UH4A 1KM3A 3BO9A 1OVDA 3G8RA 3KL0A 1A5CA 1HT6A 2QLYA 2FDSA 1D3GA 2FGZA 3FW6A 1QW8A 2A7RA 5D2YA 2ZZ5A 4UTTA 2QKFA 2GPTA 3W1MA 1GJUA 1FDZA 1OABA 4O52A 1GTHA 1JI1A 4ZQRA 2VFDA 3CIWA 2ZX8A 3NL5A 1EP2A 4UFHA 1XL9A 4ORIA 3BMWA 1K3UA 4KKXA 3WK1A 3G1FA 1PCKA 4IMFA 4M6VA 4NX0A 3WJXA 1KBKA 2QMJA 2FHBA 1JDDA 4W93A 5BRQA 5AYYA 1ZFJA 1X6UA 4JX4A 3KVJA 4HPJA 4QJ1A 1FBAA 2GQ9A 3BGGA 4JNMA 3USBA 5TQLA 2XFWA 3VNDA 1WXJA 4X9YA 3B06A 1CXHA 1DVJA 1DBTA 4FLQA 5KSWA 1BVNP 3GXPA 1U2YA 1XH1A 5J5DA 2CLEA 3EWWA 6CGTA 1KXTA 1VH7A 2ZXQA 3PBYA 1G69A 4LS2A 4MLRA 4C1KA 3PC0A 3TMLA 1AMYA 3GDLA 3OBKA 4M7SA 3TH6A 3N2MA 3GR8A 1KCLA 3P62A 3BLKA 1MO0A 3S5YA 1YDOA 3OIXA 2NUYA 4O0ZA 3A24A 2BXYA 3BAJA 3FAXA 2J25A 3F4NA 5D32A 3NL2A 3LRLA 1CW2A 5FF0A 3ZO9A 4U33A 3W87A 2ZXAA 4BF9A 1W31A 3EJSA 2A85A 1WE5A 3BVUA 2OW7A 5EBUA 1QFEA 3VSVA 1AMKA 3N34A 3QJAA 1QPRA 1F05A 2ZTKA 1GOXA 4BZYA 1M53A 5DCEA 4JTFA 2Y7GA 5DELA 2LLEA 1UD8A 3BLPX 3PF3A 4BI6A 4GI9A 3VX0A 1HUVA 4UTWC 4ZQOA 3UWUA 2PWEA 2V2CA 4TR9A 3BAXA 4H7VA 1UUOA 4DELA 1QAPA 4GINA 4MUZA 2CLIA 5I3KA 4X2RA 3TC6A 4BI5A 3HG5A 2C16A 3ABRA 3ATYA 3VSTA 4UTIA 3EWXA 1PZ2A 1IXNA 3MHUA 4H8HA 2ZZ7A 3QM3A 2PC4A 1PJ9A 2YOCA 2FJKA 1G4EA 3K1DA 1U33A 5AC6A 1UA7A 3UERA 3B0VC 1SZNA 1UOKA 2ZA3A 3BAYA 3D50A 5EMYA 1OX4B 2Y63A 2V8ZA 4UFMA 1LOSA 5IBXA 1FWNA 2F7PA 3QZEA 1CIUA 2BHYA 4AIEA 5SWUA 3W88A 4CQ9A 1KM6A 3DHUA 4L4LA 3SGZA 3N9RA 3S5OA 2CPUA 3TROA 2PWHA 5I0DA 4LVAA 4NQ1A 3BLIA 4AF0A 4XWUA 4UQ9A 4ORMA 2FFCA 1TPUA 4AMAA 1DEDA 2ZZ4A 3PUDA 1XSJA 4WXYA 3GK0A 1KV5A 3M43A 3TQVA 1B57A 3TR2A 1C8QA 2QV4A 1GG1A 1F7BA 2A6NA 3LPPA 3BAWA 3EJQA 3L0GA 2QUTA 1H51A 1H7XA 3DH7A 3W73A 4WZHA 3G1DA 4J7RA 4H3DA 1SW0A 3DX1A 4HNNA 4UXDA 1GYNA 5AN7A 3UZJA 3EX6A 5F4SA 1T8XA 3RNDA 4NU7A 2J24A 3VGHA 2E68A 4OU1A 5HWNA 1O7DC 4QIUA 1PIGA 4OKDA 3M5XA 1AVAA 4NZFA 2TAAA 4MFEA 1MEHA 4AWUA 3RIKA 3BGJA 5LGXA 1EO5A 3WY3A 1W9XA 3W76A 1QX1A 2R14A 3LBMA 2OZ0A 1ME8A 5D30A 1EO7A 3TTSA 1VJIA 4LVDA 1MFVA 4HSOA 1XKYA 3WK3A 2ZZ2A 4N02A 4UQAA 1UBSA 4PL2A 1WP6A 2HMCA 1ALDA 2ZFAA 3BMVA 2X1SA 3TUUA 1XCXA 1AW5A 1YYAA 3LXCA 1DQWA 3IEBA 4RKAA 4MOZA 4LY8A 5LNRA 2VXNA 2G3MA 3PBUA 4Z1BA 4Z1AA 4FNRA 1RPKA 1LWJA 3NQGA 4QM1A 1HTYA 3O63A 3FEMA 2CU0A 4O14A 1HO4A 4HA1A 4MZ8A 3CEUA 2CZEA 1QWGA 3MO7A 1BF2A 2DP3A 1MFUA 3DDFA 1R46A 4HKPA 1TJPA 3SY5A 2WVVB 1H7OA 1O95A 3BSGA 4GIAA 1BKSA 1KFJA 4ATWA 1F74A 3IJ7A 2GJRA 2BY0A 2FLIA 3QYQA 1XM3A 4JGDA 4E2BA 1I2OA 1TQJA 3M16A 2FPTA 3S1UA 3ZT7A 4UR8A 1DJNA 1R2SA 1RP8A 2DZWA 1RP9A 1K7FA 3EKZA 5EMUA 1H62A 1X7FA 4TMCA 1GVRA 1WAUA 2QCFA 1GCYA 2WKLA 2NT1A 3WY1A 5FEZA 3C52A 3DFSA 1MW3A 2QCGA 2GJLA 1I2RA 1W1ZA 3RLUA 3P81A 5I3IA 3AJXA 1PHQA 3W72A 2OSWA 1CI1A 5F4XA 3TCEA 2ALDA 3UY8A 2R91A 1L6YA 4LS1A 3DX4A 4DF2A 3WNKA 1JRBA 3LOTA 4GBUA 2XWDA 2E6AA 3EDFA 4POCA 4HOZA 1CXIA 3WELA 1KFBA 3VMPA 1XSKA 1C8VA 3HOJA 3CZEA 3P8IA 4BR1A 1AQMA 3IIVA 5FF4A 4QITA 1P5BA 2YFOA 5HXMA 1W5PA 2E1DA 2ZA2A 3W9ZA 1CPUA 3FKRA 1F73A 4LS0A 2WCSA 5A6MA 3NA8A 3QPZA 4O54A 5BMXA 4KFOA 1KCKA 1WZLA 4AVFA 2KZHA 2EABA 4K39A 1NVMA 4UFKA 2ISWA 2CW6A 3C0JA 4MVAA 5TBOA 4OIFA 3BAKA 2DIEA 3PSWA 2V30A 2H3DA 1TMQA 4FNTA 1B4EA 1A5BA 1LCOA 1ZENA 2ZUTA 3A9IA 4ZQPA 3ABQA 5HWJA 4UTKA 2RH9A 1QCWA 1BTMA 2DZXA 2VRQA 2YIHA 3TJXA 2CFFA 2GJNA 2W6RA 5LNWA 3ZSTA 1SQ7A 3E9AA 4JTKA 2J9XA 3TIMA 4ONVA 1LBMA 2YKKA 2F7QA 3OLIA 1D3HA 3BUBA 1KWGA 5AHNA 2G97A 4K38A 1J2WA 3ECQA 1WDWA 1V7YA 5DCDA 1DL3A 2J88A 1JCNA 2B7QA 1LRQA 5HWMA 3VGBA 5FF2A 2R8WA 4U3CA 4ZZ9A 4CNNA 4ZL1A 1XCFA 4IMEA 1GVQA 4R34A 7TIMA 1C29A 4E2DA 5A2CA 4XUGA 1Z48A 4NXSA
chains in the Genus database with same CATH superfamily
4N68A 1X7QB 4AJYV 3CUZA 3WLRA 5AC5A 1BMZA 3ITOA 4R2GD 1GZPA 4OHQA 3T2QA 1GA2A 3KOZA 1JPGB 2INEA 3TR9A 4D6JA 3FDKA 5E2TL 4WOZA 2H90A 5JMOC 1ITXA 1P0EA 1Q8AA 4ML4A 2FD6H 1OE3A 3EBAA 4GZ7A 1M05A 1CBVH 2PA6A 3DPBB 4LSRH 1P7HL 5DRIA 1FJ1A 3SPCA 1JGIA 1M03A 1V7MH 2GIXA 4WRHA 4ELMB 2FWUA 5GQBA 4XBGB 2JKAA 2N59A 2WC7A 2Y9RT 2EKSB 3A6OA 1ACYH 5KOVC 4BXVA 3DXAB 4IOIA 1XIWC 1JJKA 3AU2A 3EA1A 4JKKA 3NIDE 3O9WD 1QTYT 4QS6A 1AGBA 3AQZA 4PRPB 1Z66A 4PUEA 1I1CA 4PMNA 3LS4L 1RH9A 2RDWA 2VUYA 4LLMB 4IRSC 1EDHA 4R8WH 5I6OA 4E9WA 3B0YA 2LU3A 4MVBD 2L5HA 1UOWA 3IJLA 3MV8B 2R23B 4L3EB 3GBDA 4U6XA 5DYOA 5L4JA 3OAYH 3FYPA 3LRKA 4OLVH 5ECVA 2P8LB 2K3TA 4Y1AE 4PFEA 4UT9A 1NGQL 1FO0H 2YQBA 1S7SA 3WCZA 1NOAA 4L56A 5AW3B 2EUWA 3CNKA 2HFGL 2DDQH 4N2EA 4RW5A 2RIKA 3LXUX 3NCYS 1PS9A 3RURA 3NO1A 4LKXB 5F96H 1KIQA 3SUUA 3OMAB 1P1ZA 2GK1B 4K8RC 3TBYB 3OC8A 4UT9H 3TV8A 4ZMAT 3TSBA 3BUVA 4QX4A 3FO1B 4PJCF 2ZXEB 2X4QB 5F2IA 4AX7A 5JO5B 5L8KB 4JY9A 4DXKA 1LDCA 2POTA 1EX0A 5EDXA 2QAFA 4LZKA 7FABL 2QEZA 4CVXB 1URLA 3FB5B 1FFQA 4QHUA 4R85A 3K8LA 2AGJH 4XXWA 4J6RH 5INDB 1TWDA 1K5NA 1JRHI 5DLCA 4WY0F 5L2KB 1E5JA 4Z0BL 2MPAH 3BSHA 5TGBA 2OL3A 4ELMF 4AVJA 1UC5A 1E6JH 3QV8A 4XHJD 3T9WA 4ZW3A 3QFJB 2VVNA 2VWTA 2GJ6D 4X6DE 5IESH 4YR6B 3CQKA 4D3CH 2YDRA 3C8FA 4XPHL 3WQDA 3R18A 4XAZA 2ISDA 1BZ9B 5HK4A 3GLAA 3A12A 5F0LB 2KX9A 5FJPA 2BP0A 3MVIA 1FVDB 1MIEH 5B1BB 2B1HL 1Q6CA 2H2PD 1JR1A 5T8GA 1EJOH 3SIKA 1JWSB 4QJ4B 4UCGA 5GXBB 4WGHA 1R75A 4W7VA 3GNMH 5DJ2A 1NC2A 3I6SA 2N1TE 3VFMA 3ZS4A 2W0FA 4W8LA 3WK2A 1T3FB 4P23B 5CWSA 5I73B 3S96B 4PUWA 1R38A 5C08A 2R56H 1DWIM 1WFOA 4RPQA 2H8PB 3GUFA 4Q6IC 5LKNA 1ZALA 4BQCA 4OZFA 1Q6LA 2H32A 3L45A 4FJYA 3HZMA 4Y90A 4G11A 2GTQA 4HIXL 3MS8A 4Q6YA 4Z2IA 3QMRA 1NTDA 2O6PA 4M6ML 3INPA 1W54A 1F41A 1YY9D 4J2XA 1UCBL 1ORSB 3GO2A 4MWAD 3F5LA 2J8GA 3KM8A 4JAWA 1SO3A 1KULA 3HG1E 4N4QA 2I7SA 3ZRSA 3M17A 4OZFH 1YXCA 3X3FH 5A8GA 4GUJA 4XQ6A 3WMCA 2PN5A 2V17L 4V33A 3GVQA 4V1XA 2IPKA 4OZ4A 2H6UA 4MKNA 5K9XA 1IGCH 1UPPA 3TCLB 3MRNA 2B4CL 4LPVA 5LHDA 4G9FD 2JI3A 1XL6A 4Y7OC 4HUKB 2IJ0C 4P46B 5D2WA 3PABB 3LH9A 2DEXX 2OI9B 3P30H 4HNOA 4O13A 3IPBA 4OIIH 4I0CC 1VFMA 2H0JA 2WIIB 4M4RA 2HKAA 4EPKA 4MHBA 1IC0A 2RJMA 3CQ0A 1L9TA 4X0NA 1PSKH 2DQIL 4NXKA 1MWOA 1RZJC 1YBQB 4WJ5B 1K7XA 5HANA 2XWTA 1IC4H 2NTFA 3AXKA 4YDKL 4IU2A 3MGOA 3RK8A 1NCAL 1G4RA 4FZIA 3FK4A 1KPVA 3DURA 4KRTA 3ZZ1A 3PPCA 4NWUL 2Z7YA 2LAAA 1UHVA 3IDGB 4L37B 4OM1L 2LOEA 5HJ3A 3L6FB 3NUKA 3PWPB 2MQ0A 2NWRA 5K39B 1NC4D 4H26A 2J78A 3R94A 1ADOA 4W8AA 1QR7A 5LXGH 4WF7A 2DMGA 5BCAA 1P1XA 5IQLA 3U48A 5HYJD 5IBUB 4Y9MA 5C0RH 3P11H 3OB8A 3SY0A 4Q7DA 4OZIF 5I0ZA 4XVJH 3BV4A 2J8UE 4F3HA 4QG9A 4PMJA 2G5UA 1IBZA 4QR6A 2K4AA 2PP7A 1BRLA 4RV8A 5C07B 5ES4B 3FS2A 1KELH 3FU0A 4DP1X 5K1VA 1IKFL 3WEOA 3O11B 4DEUA 1HL2A 3LCGA 2CDEA 4EWND 4LHJB 4LAKA 3HGOA 3DNKA 3DV4B 1F3DH 4ZUTB 4LVEA 3AC0A 4Y1TA 4F0KA 3Q2DA 4C6OA 1KENL 5I8EA 3UJJL 2CLHA 2WYTA 1MXSA 5FSEC 4PJIB 4LCQA 5MP6H 1IGTA 4ZMQA 3E49A 3D0CA 3PZ9A 3RWHA 1M65A 3VCRA 3GK8H 1VR6A 2QJIA 4G7YH 4X4KA 2IQTA 4KX7A 3GDMA 3IMTA 3VDCA 2C4FU 3DTXA 3HRZB 1MHHB 1W6TA 3NPVA 4I5XA 2YRZA 3W75A 3SN0A 3BXNA 3FYOA 4TF4A 1UWUA 1JZJA 3QCVH 4HETA 5CPQA 4JRLA 3L8QA 2Y06H 5FF6B 4MZ3A 3NQ7A 2RR3A 1ZKAA 1NWRA 4AQ1B 4TVCA 5SWZE 4AL8C 1EAOA 3SQOH 4XCNA 1MLBA 2NUPA 4QCIA 3KBEA 3ABSA 1F58L 4LAOA 2HRWA 1M7JA 3N1QC 1F61A 2XFXA 4NPKA 4A1RA 4TLUA 5JIPA 3QCTH 4BSVA 1TR7A 4YYFA 2BNQB 2XACC 4Q4SA 8TIMA 1HL9A 3MZ2A 4PY7A 5MI0B 4ZUSA 4JYDA 2A1WH 3A4DA 5HUPA 3VNLA 1T1ZB 1USZA 3QPKA 4H25B 2QADC 3LKOA 1NPUA 3U0TA 3HPLA 1E2WA 2A9CA 2CLVA 4J5VA 4Y9PA 1X5IA 4ZBCA 3G18A 3BSZL 4WUUB 3I02B 4R2GC 4A6YL 1EZVY 3BT2H 3CVHB 5IOBA 1HCYA 2DV0A 4FS9A 2C1OB 4FTVE 5AOUA 2BS71 2X2UA 1L0YA 5IHRA 5ADOL 4WW2A 4XT1C 1LF1A 3KLSA 2ICWI 3GFUA 1IGJA 3EYUH 2JJWA 5EA0L 1R87A 2ZRUA 4LSQL 1UQSB 4H4NA 3UBFA 3LZ5A 2M2DA 3HLAA 1CI3M 5I0XA 1NFPA 5FX3A 2F8QA 4Y19A 4MPQA 4NX5A 1EWDA 3GJEA 1CD0A 4RAHA 4JO3H 2WYSA 1CG9B 3EYSH 1O6VA 1HZKA 5C3IA 2MCAA 3ZL4L 2H9GB 5KVEH 1IKNC 3PWJB 4PJ9A 1Q7MA 5AAWA 3GXFA 4FP8L 1WV2A 3T4AA 1DDTA 4ELKA 1ZAJA 4ZS6D 4MVBC 4ATTA 4WY7L 5I5JA 1PCWA 3S5NA 1W72L 4ALDA 4AENB 1BGGA 3QDJA 2OMBA 4HPGA 3CQIA 2H3XC 1IT9H 1QP1A 2AQVA 2KQMA 1XW8A 3SQMA 3STPA 1EIXA 4O18A 2R1MA 4AMKH 1F3XA 4BKNA 4CN1A 2A74A 3PCYA 2V3GA 2HCZX 2EILB 2FMNA 1F3DJ 2P76A 3E0IA 4YXKH 4MTMA 4GJ1A 4F9PA 4LSTL 3S9YA 2C1PA 4NI3A 5LN8A 4O1CA 1J9QA 3P73B 2A3HA 1V0KA 2AERT 3OKMB 3NCMA 1S8DB 3O15A 1C16B 2X5PA 3BQUB 4NJ9H 1QRNE 5CJ5A 3EOSA 3ULUL 2YGPA 1JOIA 4O2CB 3K71A 1K9DA 3IAPA 1BAGA 3HNVL 2OQYA 2IAMA 4WI7A 2VW4A 3B6SB 4OLWL 2HKFH 4L0YA 4X99A 3DIFA 3DX7A 2NT0A 1SJMA 3I6RA 3N3MA 4N2MA 3ESMA 4DPBX 2A99A 5I76A 1BLNA 3ERPA 3V4VH 2YZRA 2NZ1A 3CUPA 4IHCA 3WQCA 5JIQA 4DGWC 3AS3A 1L9RA 3STZB 1V3JA 2JIEA 2DLGA 4K8RH 4XNQA 4XHJC 2VQ1A 1YNKL 1NCCL 1HI6B 3GNXA 4PE8A 5CU9A 4AKOA 1PZ1A 5T9BG 3ATZA 2XVNA 3WIFB 5B3SB 3LG3A 1TVNA 3E0WA 5FOOA 4JANB 4F40A 4K73A 1IFGA 1OCWH 4P8VA 3GNNA 5IUSA 1PNDA 4AC7C 2A4ZA 4NBYB 4JFUA 4LSDA 4OT7A 2XNAA 3NCJL 3TA4D 2NOYA 4NQVB 2YWZA 4GT7A 1ZE3C 3NTCH 4Q89A 3G5WA 1NPJA 4PJGA 3PSVA 3PDOB 4KHTH 3FTZA 4US5A 2X0UA 3TEVA 4ESKA 2ADJA 1MSSA 4IGBC 1UFGA 1W72B 4JN7A 4ALAL 4PU2A 1J0IA 4R96B 4ANUA 3ZJKA 3TIDB 2FVMA 1I82A 3GI8H 2GY5A 5EZPA 5EU4A 3V0WH 4H0IA 2IC2A 1S78D 5KBMA 3MP3A 1I4NA 1Y8BA 4PBGA 4PGZA 3USZA 4GIYA 4KETA 2OR8A 5T33H 2HWGA 3PZOA 2EJAA 3L2LA 3P3UA 4IX0A 4MAYB 3VZZA 1U8LA 1F6KA 1PKOA 4XBEL 5D1XE 4A8RA 3AG2B 1FV1A 4QXVA 3S4TA 3ARGD 4POZC 3L7FB 4PG2C 3KLDA 1HKIA 5EWIL 3JTBA 4JFXB 3QEQD 1ACZA 1E6XM 2FZDA 2PW1B 2NQLA 3KM2A 4KRLB 4YPGB 5HHMB 3GU9A 2QPUA 5EU6D 3SI9A 4ACZB 4EVZA 1KB5B 2J55A 4PGCB 5EZLB 1U8QA 2Z26A 4CQAA 3VTAA 2X4RA 2EXTA 3FBQA 4B3KA 4X8JB 4C6PA 3Q43A 3LN5B 1NFIA 5D72L 4GBDA 2LW3A 4N1HB 2DWSA 4NZUL 1HNYA 2P0IA 5EFIB 3HGSA 4WI5A 1KNOB 1HAWA 4NQEE 4R3SA 2VLJB 3D3AA 3K72B 5ENLA 2IDSA 4AH7A 5ACMA 4LALA 2YBGA 1BZ8A 5KVMC 1PZBA 4MWFA 1TZ7A 3C2EA 5L4IA 5D2VA 1Q7ZA 3QUKA 3CZSA 2NMSA 4GIOA 3MHZA 4J3VA 3FKUS 4PMEA 4BCZA 4W87A 1MFNA 5B38A 3QGKC 4Z8FL 1LQSR 1LXMA 3BRDA 3MOBH 4G1EA 2YSSB 2ATPB 3E8UL 2P10A 5A2BA 4LRNL 3PUGA 1RZJH 3KPPA 5TF1H 2DAVA 1MKFA 1GOFA 1E8ZA 5KYUA 1ZT1B 4NC1C 4KVCL 2OKMA 4PTDA 2Q20A 1MAKA 2FGZA 2QEJA 1QW8A 2DYRB 4KVNH 4Q8VA 1ETZB 3SO3C 1W0WA 3MRDB 1NMAL 3E7JA 4K23L 2PTUA 1K3UA 1CR9L 3WJXA 4LLUA 3FPYA 4YS1A 1X6UA 2GSMB 4DJDD 2Y7MA 4OLUL 4D0DB 3EZJB 5KSWA 3EA3A 1BVNP 3OSVA 3OKKB 4ODSH 6CGTA 3AHXA 5F7HA 5E94A 2DT3A 1AMYA 2QVHA 1YNPA 3N2MA 4OLYL 2N3JA 1F02I 1WISA 1JPFB 1K2DB 1RKRA 4O0ZA 3A24A 35C8L 2HMIC 1JK8A 3ZJ8A 4AITA 2ZKXA 4HUVA 4W81A 2XG4B 5J11C 5AKVA 1PD0A 1Q6GA 1QPRA 2MQCA 3MMEA 5TDNA 2Y1VA 3VX0A 4NLHA 4UTWC 4PJXA 3V4PA 4C60A 5I3KA 3TX4A 3VSTA 1FWBC 4DWHA 2QVTA 1YRRA 1G4EA 3LA4A 1UA7A 4PYSA 3CUGA 5IBXA 5BO1L 1CIUA 2BHYA 2WAQA 1IQ8A 4CQ9A 4HZLB 4H1LA 4U7KA 2BDNH 5GS2D 5FO2A 4XH2A 3HM7A 2AF2A 3TR2A 1F7BA 4LLWA 3V4PH 1YEIH 3W0WB 1H7XA 3W73A 1VGEL 1OM0A 5CPTA 2Y5JA 3EGSA 3VI3B 1U3JA 2YUVA 1NL0L 4IGMA 1OAYL 4RX4D 3FQ4A 3R79A 4AKQA 3KBFA 3ZN6A 1D5ZA 4L1WA 3P9WB 3ULUE 1FIEA 3Q45A 1BECA 3HKZA 1QAWA 4X4YB 3C75A 4Z1BA 4B53A 5D1QA 3UDWA 2GL5A 5L9DL 1L5GB 5E6IC 4KI5C 4ZFGH 5LIWX 5FO7A 1J87A 1R46A 4DOHE 5FOJA 3QIUD 1J86A 5AB1A 4W70A 3B9KD 4YWSA 4H9ZA 2VX4A 1V7AA 2J57A 4JFDE 1NCDH 2QGHA 4KQNA 4X50A 3A4FA 2BOBB 4PY8J 4I9WD 1XO8A 5F4XA 1MQQA 15C8L 3VFTA 4QHKJ 4GBUA 4WK9A 1E0VA 1KFBA 4BR1A 1DJHA 2GAZB 4QITA 3HCVA 3KR3L 3OZKA 2UX6A 4K3ZA 4KFOA 2CETA 2JCCA 3V6ZB 2J20A 1RVFH 4QTHA 1HHIB 3XISA 3UTTD 3V0HA 3HE6A 5C9XA 3RGBA 4KDTC 2BLFA 4YTQA 1QSED 5LNWA 3G3LA 3E9AA 2K7PA 4MHHG 4ZD3H 4G7EA 2ZWLT 1ADWA 2CLRA 3ALGA 2R8WA 1R6VA 1M42A 1F4AA 4ZL1A 2N7SA 3WHXA 1OY0A 4IMEA 2R0KL 4R34A 5IW6B 1C29A 5A2CA 5CEXB 3UTPE 3RAJL 3LI0A 5GJMA 1LK3H 2EPLX 1QTSA 4KQ4L 2HPIA 2Q86B 1Q9KA 2VFGA 4U4BA 2PPEA 4Q33A 1YECH 4F2ME 3GZAA 4AZBA 4GRLD 5ANMB 1D2KA 2FTWA 3B2MA 1R3JB 5LN4A 4BQBA 4YBLB 2I69A 2GI0A 4MYPA 3V5DB 3CPLB 4QCEA 5CR8A 5HUOA 4R7NA 3QZMA 1RA5A 2VC2B 2XTJD 4Z42C 2DLFH 3TYBA 1NAML 2G3JA 1XDTT 5CHNB 2WQUA 2ICWB 4H19A 3CDFA 2LVCA 3RGHA 2R83A 3O9WA 3T4YB 4FZEH 3BGFC 3GIZH 2AJUH 3FO9B 4YLQT 4ONGL 1WBYA 3EWZA 3VE7A 3YPIA 1BBDH 5E8EB 3UIZA 1OSZA 3CIXA 1K8ZA 1OTUC 4MD4A 1W15A 4U0RB 3MRHA 2PO6B 3I9GL 3STEA 2QW5A 5J56B 2IV8A 2R1PA 2ZAHA 3WL0A 2OXGA 1YHPA 3W39B 2CKBB 1HHKA 2ZXDA 1D7KA 3LMYA 2TSBA 1K8CA 4XRCA 5ENWB 2WSYA 2CPCA 2J1XA 1BGAA 4NUJA 3ARFC 1Y5VA 2DQHH 3BN3B 4Q7IA 1SEQH 4I18B 3IGFA 4Y8AA 1EF3A 3CXHK 1N3NA 4OB5H 1RBOB 4C56B 1KLYA 5F6HI 4DAFA 4RISL 4A38A 4DCQB 4BQ5A 1AI1H 1BHGA 4ZMWA 3EKLA 5IIEA 3TM6A 4OF6A 1U95B 1NFDB 3ICJA 1NANI 4EACA 1OE1A 1VYRA 4WEBL 4HKJB 3CVIL 4LGSB 4BGDA 2OSYA 2VDQB 4Z7QB 2HVMA 4L4TE 1AY1L 1L9NA 4TVPL 3FU9A 4XCFH 2KBGA 5TIMA 2CO6B 1HKMA 1MRDH 1B3XA 3M0HA 3QEGL 5KYWB 2OSLA 2Q9OA 4PEEA 1TRDA 2PXYD 4HC1A 1KGCD 5J5RA 1U3HA 4FCHA 2Y7SA 2I14A 2P48B 1SJVA 3W3OA 3RM8A 1ZTXL 3Q2WA 3AIVA 3W0KA 1KLFB 3P0YH 4JBSA 3W7OA 1J79A 1FQ0A 4WGKA 5DK0B 3ONBA 2EDOA 4G7RB 4HC1H 4HAKA 2COQA 2F61A 3RIFF 1NAMB 1E9OA 2HTKC 5JH2A 1L2QA 3L5MA 4J3BA 1V10A 1TV2A 3HKFA 1S78C 3OGCB 25C8L 2AOSA 3WLJA 1OFEA 4AEIL 3BPLB 4TQPA 3W7CA 3SE6A 3AT8A 5AW1B 2ZOOA 1YE6A 3CXFA 4LAQL 1HNFA 1V0MA 1ZK5A 2BMKB 4YUEH 2IANE 2BY2A 4TNEA 3VXUD 2A0LC 3PP4H 3VZYA 1FFRA 3GKAA 2D1ZA 2Q7NA 5I71C 3LIUA 1HU8A 1FZKA 1ZE3H 1A6TB 5EGRA 4UYQA 1KM1A 4MNGA 2A7PA 1LP6A 3T8MA 5TFSL 3NZRA 3LRSA 2BSCA 5I1JL 4L4VE 5DCCA 5DGRA 1M6UA 4RBPH 5IMMB 1TSHA 4IIQA 2AXHA 4GSDL 3RU8L 5CZRA 3G1YA 4JYEA 4IJTA 2HFTA 4C4KO 1OV8A 1QO2A 4HCHA 3ZX1A 2OWXA 4AHOA 3SE9H 3UG5A 4MWAA 2WHVA 5L0QC 2EIMB 3JTTA 3IK2A 3VIIA 3D47A 2VN3A 3IMSA 3PHAA 3EXRA 3EF7A 1CGSH 1U91B 4B9PA 3C0QA 3EDJA 2OTUA 5KZCD 4V1YA 4KWOA 3MODH 3SDAB 3GSMA 4AT6A 3NPSC 4HDIA 3TSMA 1A0DA 4JKPL 4G9FA 3VQ1C 5D2LF 2IQ9H 1OCQA 5C9JB 2ACQA 4PGDB 4LLDB 1KBPA 4F2EA 3MLXL 4P3WA 4FFZA 2ZZUT 1OLLA 3FQNB 4JM0A 1JF1B 4O11A 5EBMA 3SGDH 3DBNA 3H2EA 3Q5OA 4LKCB 5FA4A 4IRSD 1JZ8A 2Y6SD 3W83A 3SR7A 3BD5A 4P9HC 5LNDA 2JKRM 5B39A 3LTSA 8XIMA 4JY8A 1XIFA 3WEXA 4APQC 2Z6IA 4FFZH 4IJ3B 4D9PA 4A2MA 3D39A 3OKNA 2GYSA 2ZCLL 3NJFA 5EUOF 2WGXA 2IPTH 3PG8A 3ZJAA 2D7OA 1NOWA 1O6IA 3VXNB 3STLA 2ACSA 4LT9A 1WAWA 1G9NH 5GRUL 2WNXA 2BY3A 3QDGE 1BJ1H 5LGHH 1OQXA 3FF7A 2OMXB 3TWCL 4IBUA 3NQ2A 4PW4A 1NC4A 4QE5A 4HSHA 4YIWA 3DFYA 4G7SB 4X83A 4XBPA 4XPFL 1UH3A 1ZEAL 4HFWA 1YEYA 4X98B 3ZR6A 3BVWA 3T44A 3QC0A 4QDPA 4IRZA 1J9SA 4XN9A 4UAOC 2BASA 4PH8A 5EN2A 1KDJA 2NY4B 3HN3A 2IALA 4LSBA 4RIRB 3OVPA 2Z1VA 2DH2A 2WJDA 5E4EB 3M0KA 5ESVA 4KPHL 2CIIB 1MH5A 4ZFCA 4PB4A 3BHBA 3LMZA 5DR5H 3C5SA 3O6ML 3OHIA 1RK0B 5HY9A 4OD1L 4N8VB 1PHWA 2LE9A 4PJEE 2ROXA 2YSTA 1S7XA 1CLYH 3Q94A 4QGYA 2O5ZH 2DWDA 1L7IH 5HNRA 1G0DA 1BIHA 3STFA 3EDKA 1XF4A 3FVMA 2X2IA 3NAAL 3O6KH 3TVAA 4H8VA 3VFPA 4GBXB 4JCWA 2Z27A 3MFGB 3PWVB 4JTUA 3RTQB 5G5DB 1HIML 3IVSA 1RLDA 2UYLB 2VWSA 1B3ZA 3HI6H 4H88H 2QTEA 4HUNB 5I1KH 4AWSA 3S37L 2N0MA 4LLYB 1A1MA 2VDOH 4E0RB 3CN2A 1PB0A 3AACA 3O6LH 3CZNA 4U1NA 2BZ7A 1V0NA 4JFSA 1T99A 3MLYH 4FNLL 1QVOB 4S39A 5JHBA 3MZGB 4K71C 2OP4L 1NAKL 3WFBL 3IN0A 3SO7A 5EU5A 5ISZA 3QSKB 2JALA 4G6KH 4UMAA 3QUXD 2VYRE 3NCXA 1XYFA 4X80H 3BEWA 4L29B 4ZSUA 5G4WA 3EO0A 5E0CA 3GS0A 1YEJL 3HUJE 1ES0A 4ZFFA 3NQVA 3CT7A 4UIOA 1XUZA 4P2OB 4D9LL 3ZKXB 3WDQA 4GAGH 4MM1A 1MY7A 3AVEA 1MUWA 3VOIA 5I17A 2YYTA 5G4OA 4F0HA 3ABZA 3IXAA 1A6UH 5IB1A 2GGEA 3N44B 1NKRA 1ZS2A 3F3HA 3IPWA 2ZJSL 3UZXA 2YWYA 2W3ZA 4UFLA 5HPMB 4TVPE 1W1A1 2QCCA 2NW3A 3EX1A 3PBMA 3MA9L 3ISIX 2Y07L 3V0EA 5A2AA 1UG6A 2DLHA 2I5YH 5D4IA 4XD5A 1UW9A 1GPFA 5KTLA 4MBRA 1ZTXE 2J27A 1YMHA 5I1HL 1H3PH 1SLUA 1FNAA 4WKHA 4AHQA 2DD8H 4OUEA 4YFEA 1ZIAA 2JH2A 1MMFA 2QVIA 1WYJA 2V5CA 3OVUB 3F4VA 1UXSA 4LLQB 2Z4TA 1N6VA 2PWFA 5CXPA 1TZIB 2YGQA 5DJXA 1IGIL 1TQWA 3RNKA 4AQ8C 1MHEB 4LMQE 2AEPH 3AGWA 5LBSA 5IHSA 3RUGB 1KB3A 1KJMA 2JSFA 1WKDA 1K6QH 2XTJC 3VG0H 1FHUA 4MGXA 1B0GA 3MGAA 3R8GA 1OFRA 3FO0H 1CEOA 2ZT9C 1VFAA 5HBFA 4M7LT 2P7TB 3IJSB 2CRZA 4PI0A 1VFLA 1BQCA 5LBSH 4RMQA 2E8ZA 1GPOL 3G6AA 1VRDA 3FUDA 2OYMA 3RY6C 3JTSA 1OVZA 5LYRA 4ZW8A 2UXGA 4TM9A 1JIBA 5IHZA 3GRWA 2D31B 2R1NA 2A2IA 1O68A 4GNJA 3A4EA 4GKLA 5EU7E 1KGUA 1DWHM 3RVVD 3AIEA 1TKKA 1N8FA 1OYBA 2R0LH 3N1FC 2LFGA 3N44F 3M8OH 2W0UA 1TV4A 4PV8B 5D7SH 4UAHA 2A38A 4I1PA 4XODA 1MCWW 1QBAA 3OEXA 4AY0A 3THAA 3UEQA 3HB3B 1PTZA 4K36A 5JXAH 4ZTYA 4P5UA 3DU0A 3WQEA 3F58L 1BOYA 4G8AC 4IS6A 4LUSB 3FT1A 4PBDA 4JHWH 4JMNA 2DWTA 4B0MM 4NCC2 2ZDRA 4Z76B 3WQPA 1WBJA 3B40A 3INUL 3TEWA 1AGCA 4QRRD 2ZADA 4O0KA 4GFXA 3C6LB 4GKSB 1YDVA 1TITA 2WMJA 2YEZB 1OP5H 1EX5A 4PM1A 1CLCA 4P61A 3LS5L 2XDHA 2PCXA 1JHLH 2J7CA 1BVZA 3LHWA 3CX2A 1XYMA 2AQQA 2H1XA 1BM3L 1HYRC 1V6VA 2X0YA 3EYFB 5EPDA 2FGWL 1G7IA 3QXAB 3B8VA 4LIQL 1TIMA 4Z3JA 4LCWB 4NQCD 1V02A 1YE4A 2YB1A 1HH6A 2JKIS 5TDPA 4MJJA 3C86A 1EDYA 3FQ2A 3DFQA 2NY7L 2ZRYA 1WT5A 3T0EC 1OCBA 5IKCA 1UKOA 3PJSB 5G1YA 5EO9B 3P82A 4ZZFA 4M1DL 2QADD 1EUNA 3GY1A 1VLWA 3HMXH 4G8FB 3B4NA 4PUMA 4AGLA 4IZGA 4PJCB 4MDJA 4O02L 1P4CA 3TDFA 1HKFA 2OJZL 3ZQXA 1UOLA 3DGRA 4PBWD 1P0KA 2WKOF 3TFCA 1Y5WA 4YLBA 1P7BA 4HMCA 2HXAA 3BLBA 2A6LA 2HAZA 3VXME 3ARGA 2FR4A 5JZ7D 1TVBA 3G6DL 3UO1H 1G7MB 4S1SH 2XKUA 1KPRA 1T5KA 4AYBA 4NKOA 1W17A 4WY0B 3QEQA 4IDLA 5BOEA 3I6EA 4Z77A 2C3VA 3SCUA 3NG3A 1UB6A 2WBWB 2BLEA 3KPMA 1UXWA 4RVBA 4KJQC 4XOCA 1J8SA 3GFZA 1TWWA 5EU6A 1U92A 3WIIH 1MVFA 1ONEA 1SNRA 3LIZH 4I2XE 3L3GB 3OG3A 1P69B 3N0AA 4YSQA 5DTFB 1JNHB 1TEYA 1FO0A 1A47A 2Y6SC 4BFGA 1BV8A 2BWIA 4HALA 2WPBA 3BWAA 4AD0A 3W7EA 5F8QC 1E9PB 1M2VA 5K9CA 2R1XA 3HG4A 1BD0A 43CAB 2VUNA 4GVIA 4F0SA 1RUMH 3Q5YA 3P67A 4LGXA 1OZUA 2A9BA 4HIJA 1HHHB 2DLEA 3EKCA 3SCWA 4OT1L 1EHXA 3H9YA 2NXZB 3GDRA 4XPAL 1GJWA 1EGZA 2DSUA 1A2YB 4MJ5A 3G1VA 5G4NA 3C56A 1CE1H 4N2FA 3ZT5A 1CICC 2XPGB 4W6YB 4PS4L 1GKQA 4HUUB 5K69A 1AIZA 4NCC1 3DO3A 3O6CA 4QHNA 4KJYA 5I5RA 1A3HA 1H1ZA 3OWEA 5FUCE 3MNDA 1E0TA 4PJHF 4P9HH 3MOAH 4C4KT 1AJ7H 2E9BA 4Z7IA 5LO7A 2NVDA 1VPXA 2X10A 3KWWA 5AZ2H 3KCJA 5L88H 3KVLA 4O02B 1PD6A 4GS7C 4JFZH 4MAUL 3IMVA 3FV9A 1BXXA 3W2LA 4OGAC 2YA0A 5L2JA 3ZKQD 4DJDA 1JGUL 4DNLA 1QQDA 3GBNH 2JIXD 1JUFA 4JQIL 3N6HA 2FQGA 3ANUA 1HH9B 3OGRA 5EBAA 1PZ5B 3S9IA 2FHBA 2Q71A 1DBML 5K1JA 4HPJA 1QNZL 1FBAA 4P7OA 1FVEA 3GH4A 2VN4A 3JWOH 2E9GA 1OINA 2CLEA 3CDYA 3PANA 4IQEA 3PBYA 5DUMH 2RGLA 3BD3A 2CKSA 4WTZA 1FSKB 2WUCH 3GR8A 4NAFA 4PCPA 1XLKA 3P0XA 2J74A 3B3IB 3I9PA 2Q3XA 3LHPL 5EU9A 4ERGA 5FF0A 4RNJA 1J88A 1W1PA 3V5FA 1R5IB 3PP3K 5I1CL 4EVNB 1XGUA 1OAKH 2XRAH 3QUXC 3BPCB 4N8PA 4MUZA 4IGBD 4HJTA 3AM8A 4KCWA 3WUWB 1SJEA 3Q8CA 4AXWA 5JIMA 3UERA 2ZA3A 1E5ZA 4IU3B 5HGDA 1I7RB 4RX4A 1YEHL 5IK3A 4XWUA 4OZIB 5CCKH 3SCSA 4BFNA 5GS2H 5DT7A 1CD1A 3ME3A 5AN7A 2BSRA 3T0VA 4ELME 4QLRA 1PIGA 3CHXA 2GABA 4L3CB 1DJSA 1UWTA 5BZZA 2VLKB 4POZD 1K4DA 3DXAE 4AV0A 3G5YB 3QIUA 1KCRH 2D3VA 2WHLA 3B9KA 3BMVA 1ADQL 4PRPE 1E6RA 2HRPH 2XZZA 4GIRA 2AS5M 4MZ8A 2W88A 5E7BA 5FW6A 1NIBA 1F11A 2IH8A 5FM5O 1FDLH 2VEFA 1BKSA 4BWUA 3H8AA 5TDOB 3QYQA 3U36B 4GMTL 2FO4A 4IK6A 3MV8E 4L3EE 4AZ8A 5HOSA 4PBEA 5HHXH 5EMUA 5GNZA 4KMTL 3MDWA 3IJDA 3MCG1 4BQ4A 1W1ZA 3H1ZA 1KCWA 4R7OA 5H94B 4N2DA 3UTTA 3NIFB 4G6FD 5I15L 4MMWA 3UZVB 3GU1A 5BMFL 4L9LA 4TQEH 3H2NA 4LLVA 2OFJA 4QGCA 1EL3A 1QSEA 1XSKA 4DHLA 1ZXKA 3QTGA 5E51A 3P8IA 5GSRB 2AV7B 4XG1A 3HZVB 3GMPB 3QZOA 1I7TB 2Z7GA 4O54A 3PAOA 4EI5D 4HEPA 4H5SA 3MJ9L 5AAPA 2DB8A 3VYOA 1PF3A 1BYPA 3LKNB 1FC2D 1E9LA 3PSWA 2V30A 2JKNA 3PDDA 3BFWA 2Q02A 5BVPH 5EV7A 1H9VA 1ADDA 3UJEA 1J2WA 5JA8B 1WDWA 1AOZA 3E2QA 2G3ZA 3VGBA 3LBOA 4GRLA 3OV6A 3RQ3A 3N17A 1GGIH 4B5SA 1CE6B 4F9DA 3EX3A 4TNGA 4MY9A 4GG8B 4M8UA 4WUKH 4H83A 1BGXL 3U4KA 4UNVA 2I26N 3DGGB 4XPGH 1S3KL 2Y1YA 1MLCB 3QC5X 5L2KE 3DROB 1V5JA 1U8CB 2NQCA 3RVVC 4DP9X 2WGNB 2P5NA 5F0JB 4XMTA 1PFOA 1QWHA 3QFJE 5AYIA 3UXAA 2LFEA 3CIQA 3CVHL 3RY6A 3L5JA 1MCWM 4EF9A 1IV8A 4MJ4A 2ORBH 4JFEB 1V6TA 4PRNB 1F2JA 2D8KA 4N28A 2O6EA 1HJWA 1B5TA 1UVQB 3NN8B 2D73A 3LN9A 3GS4A 1E1CB 5AWNL 5CSZA 2BHZA 4ADJA 2HMID 2HXUA 3MKCA 3KS5A 1QLEH 2IWGA 4F80A 1OARH 3ILQC 5BVJA 5IGXH 3MRMA 4Q2ZB 1XLGA 2BC4A 3ATEA 3P74A 5C6TL 1R24B 3NIFF 4GYJA 5IDIA 1LT8A 4BEQA 2DQJL 3E0FA 1MVUA 5MERA 2XIJA 3W7MA 4CAGA 1HJCA 2XA8H 3OVRA 1FLRL 4F20A 1IBHA 4UIMB 1JULA 3TIEB 1HX0A 4PMDA 1HEJC 3MV9D 4RA0C 2YW3A 3KOFA 2HT4C 1TTQA 1UT9A 2R1WA 4H6RA 1RZKL 1G01A 3ESNA 2ZUQB 2IH3B 3P0VH 3VQLA 3IGSA 5HMDA 3STBA 4HOXA 1OCZB 3AB0B 2PXYA 1HZLA 2VX7A 1JZHA 2J13A 3FT2A 2IPJA 1BYAA 5ANHA 4JN1H 5DDHB 4H40A 5GGVL 1C90A 1ASOA 5I6KA 2X09A 3U46B 4M29A 1GCFA 3A4XA 3W71A 4NZ5A 5E6ID 5EL1A 4KI5D 4L23A 2QF8A 2IKJA 3OPUA 1MZZA 3B8YA 5G4HC 3S35L 1DHKA 2OWWA 4N2HA 1I85C 2WXOA 4UOQA 1GK8A 4UOW0 1J5OH 4ZFOB 4YHML 1UZHA 2WBXA 2GUBA 1QPPA 1OGAD 3LX9A 3WUZA 2C9QA 3DX2A 2VMFA 3AZSA 1PTDA 3LB6C 3P6LA 5I02A 2PDNA 1YPZF 3MA8A 1SXNA 5FO8B 3FS9A 3IJQA 4D2NA 2O5XL 1KRCC 3O4LB 3KE0A 4U3SB 3ZRFC 3FCPA 5DSCB 3GBEA 3GUWA 3GSRA 5HYQB 4DZHA 5FI8A 4M6QA 1QW9A 5E99L 3T8LA 4X7SH 3BLEA 1LP9A 3GDCA 2KKQA 2APXA 3PGCA 1ZANH 4L8SB 4U7SA 2WUBL 4PPTA 4MNHA 5JZ7C 1X1OA 4BFIA 1FBIH 2UZXA 2E6JA 1XF5A 4LOFA 2DMBA 1FYTB 3MLVH 5CG0A 3UU0A 2NY3D 4Q3MA 1M5WA 4P05A 3PWPE 2A5HA 3H2WA 1HOCB 3ULAB 5G2NA 1PW3A 5ACZB 2ITCA 1ZV9A 3VXRD 1JGEB 5DRWA 3H42H 2VD9A 5AZ0A 8XIAA 3I10A 1JV2A 1QR4A 1EJXC 4P2RD 2NTSP 2VR2A 2OJPA 4UTLA 1U8IB 2QKIC 1I9IH 1XI3A 4UMBA 4GI6A 4J1OA 1H3VA 4F7CA 2YD5A 4ZO6A 4F4RA 3U4BH 1AZRA 4YPJA 1JZ4A 4KFNA 1LBLA 3U4EB 5C07E 2OMYB 4NP7A 1S7QA 3LNEA 2F58H 3UXIA 1ROCA 4UT7L 1XIWA 2DJMA 3BVNB 1G0CA 1B90A 1DBKL 1IE7C 5DZ9A 1A0QL 1AP2A 1KYOK 1IILE 2ZTJA 3ARVA 4NIYE 3BJTA 3IVUA 2VLMD 2DZSA 5EN3A 1KEMH 4IRSA 3P40A 4Z0XB 2RAGA 5EIIB 2A6DB 1YCSA 2BBFA 5TE7H 4ZE4A 5HJGA 3ME0A 4NRYB 4UTHA 1OTUD 5IEHA 4LFHG 4PJIE 1Q45A 3GRGA 1ZP4A 4WHTA 3P54A 1QBMH 1UGNA 4Y9AA 1JVNA 5E23A 4R97C 3TN0C 3ROOA 3HQOA 3KCPB 3WLKX 3GMQA 3WO4C 2P53A 3ZIMA 3CMOL 5F89A 3M1ZA 4HSCX 3V4VA 3PTKA 4OGYH 3ARFD 1W2PA 5KVFH 2H26B 3J27A 5GGTL 3TO2A 3F2BA 1QD0A 5EEVA 4FFYL 3TMQA 1X1NA 2E9MA 2X70B 3D9AL 1KB5L 3LQAL 1SFDA 3MTXA 5DVOA 2SEBB 1NJJA 4R4BB 2OX5A 5DJDA 2JCWA 5KJRL 1QDSA 2EXYC 4HH9A 1OLZA 2WZPD 2EYSA 2DQCL 4GO6B 4YWGL 2FX7L 4NB7A 5IREA 1PD1A 1ESWA 2Q8BH 1ZT7B 4GW5B 1A3QA 2W5PA 1LOQA 1F6LL 2HPTA 3OODA 3CU2A 1J1XH 1P48A 3N85L 4G8GB 3E74A 2LTQB 3CSGA 1I1AB 4IG2A 2BNQE 1GTFA 3MTRA 2ITDB 3OKLA 2B77A 3SGEH 3KPNB 4JYFA 1RFDL 2J1YA 4XI5D 1O7SA 4EUPH 4TSCL 1MWAB 3EYVB 2PCQA 1CL7H 5IFTA 3UYCA 2LGNA 4K7PY 2EYRA 4PBVC 4JY4A 3UTSD 3E6EA 4ICCX 4GFSA 1B0WA 4WFHE 3NZ8B 1IAKA 3MACH 4WUUE 2QNEA 4HPXA 1EF2A 3ERXA 3EOAA 3DJSA 3GMNB 3RWDB 1IE5A 2HTKD 4QE1A 1T1YA 4J3UA 4WSKA 2VNCA 5TPWH 2X6UA 1W32A 1LGVA 2WYHA 4XZBA 4JUSA 2R39A 1M6JA 4FOKA 2VFEA 1HYSD 3VTRA 1SDAB 3OKOB 3T6WA 1YEWA 4X6FB 1NF7A 4M48L 1N8OE 3J7HA 3C5QA 2A0LD 1MCDA 2WNNA 5DJ0B 4CMHC 2A3CA 3QNYA 4Q6IA 1NGWB 4YK4C 4L18A 3FXIC 1ONRA 2FZ9A 4HFUL 2W07A 3SBQA 2RMNA 5AFDA 5FYLD 3K6DA 4X22A 4ZB2A 4R5VA 4U4MA 1S5HA 3GHEH 4XBKA 2YOAA 4XC3L 2Q3OA 2Y7FA 4YHKH 4ZG1A 3TWAA 1XD1A 1GL4B 4NM4L 1L3WA 3UG4A 5C0FB 2RDTA 3UWYA 1IIIA 3TU6A 2Y1HA 3EG9B 1I4FB 1DYSA 3VAVA 4ODVL 4RFNC 1IGFL 1GZQB 4QO1B 3FH7A 1BFNA 5EFFA 2C4FT 2ZOUA 2G9HA 2CXKA 5EUKB 3IGUA 1ETA1 1TU2A 3EO1A 1A4LA 5D7JB 2G5WA 4JDVB 4EDXB 3ZFHA 3GZQA 3Q9PA 4EI5C 4PGLA 1CXKA 2IG2H 4F33A 1RI8A 4TL4A 1PAMA 2K3HA 4RGOL 4FFVC 2MCPH 3APDA 1R3LA 1YDPA 1PBYA 3RJQB 4YQXL 4OUUB 1JK9B 2QHRH 5IBUG 4HX1A 1P4BH 4APQD 3SPIA 1XHHA 1HJVA 1HILB 4S1DC 3IRZA 2QFRA 2VISB 3L21A 4R90H 1A9EA 1JQVA 2X7VA 5BOJA 1Z8AA 3BANA 1TQBC 4PUDA 2VO5A 2WVVA 4FQLH 1AIFA 1P6FA 2APSA 4NNAA 5IQMA 3AIUA 4FABH 3GMMB 3TH4T 2OJEB 3FJTA 3B9EA 4NQSB 5I8CB 1BVLB 1C3FA 4NM8L 4FQXB 2NXIA 2ZOWA 2UXTA 1ZPUA 3BDYH 1PZAA 3ESOA 1NTHA 5LVEA 2P50A 2X7LB 3QC3A 4KGJA 4HHHA 2RUSA 1U58A 1HJQA 4AOFA 4ZMZA 5BQ7B 2F8IA 1JYVA 4QBXA 1WBZA 4N0UA 2Z34A 5A40E 1BREA 4F66A 2WWMC 1NF0A 1E2VA 3X3GH 4FA7B 1JDFA 4YNYA 4JJOA 4BFJA 2I07B 2PC8A 2DQUL 2QV2A 1SO5A 3MMUA 2X44D 3F64A 2WC4A 1VB9A 1ORQB 4BHYA 1R3KB 4PSPA 2G60L 5E8NB 3QRLA 4A7QA 3SCMC 3SQLA 2XZCH 3JVFC 3IRCA 1JCLA 2XJ7A 2CJ3A 3V6OE 3W22A 2Z2BA 1UWAA 1U8HB 4QYAA 1A4MA 1OK0A 2ZYFA 5CF3A 3UXFA 1IVLA 4NDMB 4LCUB 2ZQ0A 2VC2L 4DBDA 2INFA 5TE4H 4OZOA 3QJUB 4CNIA 4HJWA 1QBBA 4JPKH 2JMRA 3W2NA 1NAL1 2UWFA 4TOYH 1SW3A 4QRRA 3LKSA 2IPFA 3WSQL 2CAKA 3N6YA 2FEDC 1U9KA 2XQBL 1SF3A 2MUCA 3VRJB 3QEUA 4M8QA 2JJSC 2XSAA 5DD3L 3JYCA 2VWEC 3MX0A 2ZUNA 1W8NA 4H6KA 3SDCC 4UZSA 3R0DA 4CVUA 2WIMA 4X5XB 3GPEA 5K5YA 2FHFA 4QXUH 2LABA 4YVXA 4BWLC 5GGQH 3KVPA 1CK0L 4HP5A 2BRQA 1NDMB 3ZM8A 1ZLSL 3FGCB 4U2YA 5HHME 3LDBC 2CKBL 3GMOA 4LEBA 2ARJA 4YE0A 3GC2A 1MNZA 3UY7A 3W57A 1GMEA 1HQRA 4OZHB 3EZ8A 3BIAX 1I3RA 3LV6A 3DOIA 5D37A 4QHMB 3IDJB 4DKFH 4FHBD 4NQQA 1FL6A 4K8EA 2PI6A 5F7EL 3QZ6A 4CJ1A 4YHZL 4JTSA 4AL8H 2Q5BA 3N55A 2VLJE 1RH8A 1WFUA 1I85A 4DEPC 3SO5A 1BFOA 4UTAA 5F97E 2WQPA 3QHZH 3F4DA 3CIVA 1WO2A 4CN6A 5LXEA 4K37A 3L3JA 2E6FA 1AFVL 2FLMA 3VW3L 1KG0A 3NSCA 5FA3B 1PIIA 1T04A 4QKXB 2VDQL 3HN8A 1U8MB 4LF3A 2NY3C 2BWDA 3SOBH 4UTAH 2ZCHH 3GXDA 4O5LH 1NLBH 2YAOA 2D3NA 1CBGA 5F1UA 5E2VH 1GOHA 4M7LH 3KJ6H 1E71M 4GJIA 4AGOA 4MDOA 4JN8A 2CGYA 4U2ZA 4YXHL 4OJAA 4ICNA 4CLMA 4MD5B 3QUZB 4CCDA 1SOSA 3E0LA 3BZ4A 5DHDA 3DO7B 1QHZA 4N26A 4U6HA 3UGXA 4K2SA 2A6IA 5I75C 1LD9B 4KTDL 1KLUB 5D9SA 1NU5A 4HXBL 1TZGH 3H6JA 1S5TA 3PB0A 4MJID 2GITB 2QAPA 1SU5A 2WN2A 1BKHA 4DF9A 2QR6A 3S2AA 5ITBL 2GSGA 1Q6QA 3EB4A 2NW0A 1GYMA 2QDEA 3TJHD 1CURA 1U8JB 1IKNA 4P99A 1WZAA 2MKWA 2YAMA 1E15A 5ERWB 1QKZL 4HCDA 4WCYL 3ZTJH 3PJTA 1SXAA 3QFDA 3HR5B 2NW2B 3LOWA 2VE6A 1L6PA 1LROA 3S3DB 4AEHL 1PKNA 1N67A 3GIQA 4OZHF 1UGKA 1NBZA 1O7DE 3O4OC 4G8IA 3T81A 3QHNA 4Q0XL 4GUOA 5AYQA 2TSYA 3HTLX 5D9PA 1GHFH 3WIAA 1X5ZA 3TT1L 3I85A 1RJPA 4HUXA 5B3JF 3D46A 3FRPB 4W7UA 1EXUA 1W3NA 2EICA 3UBXI 3WH8A 3JS3A 3FDWA 1XR9A 3D85B 4D6EA 1C5BL 4GY7A 4PLJD 1TQXA 5J12B 1FFOB 3RM4A 1MEIA 1T1XB 2VXSH 2VOTA 2Q8AL 3A4WA 5ID1B 5D9OA 1DVFB 1RHFA 5HNTA 5E9DD 3W0WE 4OFCA 4XV0A 6A3HA 4YDNA 2CBJA 5JYMA 3GG1A 3VI3E 3UPRB 5CJQL 3NGJA 5DRZA 2ADIA 3EUDA 4RE3A 2FB4L 3OG6B 2ISFA 3G1RA 5IJKC 4KRPB 4Z7VF 2AKMA 3IU4H 1EWEA 2MOVA 1KTLB 4AYEC 5B80A 1M1XB 4LEOB 4JPGA 4APXA 3CGTA 5ICYB 4I0PB 1U3ZA 5MENB 5H4YA 3WMSA 5T5FA 1CXFA 5D2LB 4MX7B 4ZW6A 3QPYA 4ZFZB 3OX8A 1LO0L