3H55A

Crystal structure of human alpha-n-acetylgalactosaminidase, complex with galactose
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
387
structure length
387
Chain Sequence
LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 1.9 a structure of human alpha-N-acetylgalactosaminidase: The molecular basis of Schindler and Kanzaki diseases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Alpha-N-acetylgalactosaminidase
total genus 127
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3h55A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3h55A01
4XKYB 1TSIA 2VFEA 2CXGA 3NM1A 2NWSA 3W7IA 4YCOA 3DKLA 3EX1A 3BV4A 2UV8G 1BEUA 4XQ6A 1FCVA 4FNUA 5G1TA 1WPCA 4B9ZA 1AMKA 3C2FA 3NPWA 1VH7A 1QI5A 4UTHA 4RZ6A 3SZ8A 1DHPA 3GK0A 4MLRA 4NJJA 1MVYA 5CXPA 4O52A 3OVQA 3QQ1A 4S2BA 3BLEA 1JVNA 3NQGA 4JTTA 4JL2A 2NX1A 2ABBA 4GWEA 3BAJA 4UTMA 3BLIA 1CX9A 4WF7A 2YZRA 1H7XA 3GXNA 4E2DA 2J9XA 2F18A 3E96A 2XIIA 3CPUA 1OX5A 3EWYA 1TTJA 3S8HA 4AB4A 4FLOA 3UG4A 3C8FA 3O06A 4QITA 3KAOA 3VFLA 4JR5A 4GUJA 3TU9A 3W73A 4JIPA 1QMLA 3QMTA 1AK5A 2H8ZA 1K3UA 3BC9A 4J9JA 4AEFA 2HMCA 3KRZA 4LNYA 1GWJA 3VM5A 1H1YA 2Y7EA 3EDEA 5AYXA 3LPOA 3ZWSA 3WJYA 2CFFA 3PBVA 1VB9A 1LBLA 3LGEA 3TSBA 3IIOA 3VGHA 3OHIA 3IVTA 4ZQNA 1UD6A 3FIGA 3HGOA 5KZEA 3STGA 1SQ7A 1SO5A 4PCSA 3NL2A 3VKJA 2Q3RA 4MFEA 4UFMA 2EQDA 4JY9A 1SO3A 1VJSA 2IGTA 1WZMA 1H7WA 1FUYA 3LV5A 3S5NA 3K1DA 4CCCA 5F2MA 1E3XA 1GVRA 4GUGA 1H7PA 1VRDA 3EKZA 1JCMP 3ZT7A 1KWGA 4JXCA 1EIXA 3EDJA 2V3FA 3CGTA 4R7JA 4MPQA 2CZ5A 4FLSA 3S2CA 1JDDA 2ZWZA 4HOZA 3THAA 3JR2A 1CXLA 3L4VA 3RIKA 3DKJA 5TBOA 3U2OA 2A1YA 1FWRA 2ZTKA 1JCLA 4UQAA 2C13A 4GNJA 2C19A 1TV5A 1XDMA 4DPQA 3BAIA 3IIZA 3M16A 1ZAHA 3TROA 3CZKA 4EF9A 1ADOA 4EIVA 5LKYA 5DFAA 3FAWA 3AJXA 5HUPA 4JX6A 2PURA 4DF0A 2RDUA 1PS3A 1OFEA 5D30A 3HMJG 1ZENA 3WN6A 2BZNA 3IJ8A 4HPJA 1X1ZA 3QYQA 1TTQA 5CSSA 1B57A 1JXKA 2CZDA 4WUIA 1PAMA 3SGZA 3BW3A 1TTIA 3THQA 5FF3A 4A22A 2F2HA 2XN1A 3S0CA 3P74A 5CGMA 4U4MA 3QSRA 3W7GA 1XDLA 1EUNA 2Z2UA 1QR7A 4GFSA 2EACA 3ABQA 4LRSA 4PH6A 4Z1AA 3EWXA 4MUZA 3DFPA 3TW7A 2BXYA 1UH4A 4XZ9A 3LHWA 3WK3A 3UG5A 3A5FA 4M7SA 4DBDA 2CLLA 3BW4A 5I3GA 5LNRA 2BHZA 3PBWA 3W1XA 9CGTA 2R8WA 3LHUA 1G7VA 3W71A 4JN6A 1S5VA 3UXDA 3GDKA 3WELA 3W7KA 2A7RA 1FWSA 3LXCA 3KFTA 2PRLA 5CPLA 1O5KA 1R75A 4OV9A 1XBZA 5J5DA 3L5AA 4DELA 3LBMA 3W2UA 3EEGA 5FF0A 3F4NA 2VRKA 1BSIA 2A21A 5F4XA 1U83A 3M1ZA 4HPXA 1J2WA 3GXFA 3Q2DA 4HNNA 3IGSA 3TUUA 5LNSA 3NQFA 3C2OA 4DO6A 1UB3A 5H2ZA 2GJPA 4BFAA 3NZ1A 3HBLA 2E09A 4ICNA 2J25A 3EX3A 5AHMA 4M6VA 2XVKA 1SSDA 3GKFA 2ZUVA 2GVGA 4AF0B 2Y85A 4UZUA 3GNNA 3UY7A 1R2RA 2E5BA 1Q45A 1RD5A 1SUXA 3NQDA 3BAYA 3GAYA 4FX7A 5EYWA 2ZZ1A 5HWNA 2G96A 2PRHA 2GOUA 5DXYA 4JTUA 4MKNA 1A47A 1JXJA 3DC0A 4FNRA 2ZXAA 5AN7A 2YW3A 1LBMA 1TQSA 1E3ZA 1HL2A 2CLOA 5A6LA 4R34A 1CXKA 1XD1A 4UTJA 2QCGA 2V9DA 2D3NA 4LPCA 4LVFA 3ZR5A 2C7FA 3NEVA 2X1UA 1EWEA 2QLYA 5HJLA 3N2XA 3GIYA 3W2NA 4M6QA 2A0NA 1FXPA 1R33A 2QJIA 3E9AA 1CGWA 2TMDA 1G5AA 1XH0A 2XWDA 3WK1A 4O0KA 3NL3A 1ZJBA 4C1LA 1LRQA 3IJ7A 1JCYA 4N4QA 3S5YA 3HGSA 5KZMA 3WDHA 3IRDA 2QAFA 3ZOAA 2GQ9A 3N34A 1JDCA 3BVTA 2YA1A 1QPNA 4FXRA 1TTPA 2VEIA 1OK6A 2V3EA 1ZCOA 1C9DA 1ZS2A 2FLIA 1K02A 3OLDA 4BK9A 2E4TA 3NQMA 2D0FA 4WXYA 4CN6A 3EX6A 2A6NA 1V3JA 4JFUA 3GX9A 1WZAA 4OU1A 1Y0EA 2NT1A 4Z1BA 2F84A 5F1UA 3RK8A 5EMYA 1TPUA 2QCMA 3FKRA 1XM3A 2X2JA 2RFGA 3LLFA 3TA6A 3DXIA 4IX2A 4OWGA 3EWWA 3NNTA 1ONRA 3DX3A 2D2OA 3I7QA 2DZSA 3VGDA 1TQWA 5I24A 4LTSA 2QJHA 4N4PA 1L0PA 3CZEA 1KV8A 2YJQA 2Y6ZA 1G94A 1I2PA 1QFEA 2V5LA 3CZGA 5KINA 2FB3A 2E6FA 1XSIA 4JIQA 1TPB1 3LTPA 2VFHA 3P80A 3KVKA 2Y4SA 3DX4A 1H5YA 4LT9A 2ZX8A 5LGXA 5HQEA 3S9YA 5BMXA 3UPBA 1HXKA 4O14A 2ZA2A 1WP6A 1ML1A 5HNRA 5D2VA 1NSJA 1YLVA 3QPZA 5I23A 3LHTA 4CNPA 2VRQA 2WVVB 3HGRA 1OFRA 4LV9A 3BGJA 1W5PA 1W5OA 1Z48A 2C6QA 3N73A 3HPSA 2WKLA 1ICPA 3O05A 3W88A 2OX1A 2OZ0A 3NQAA 2VEMA 2QKFA 1GYNA 2ISSA 3G3DA 4EOUA 1EHAA 1LWHA 3BARA 2E77A 3R12A 4HNVA 2XIBA 5EPDA 3V75A 3VE9A 3P82A 3BLPX 3HZ3A 2QEZA 3L4YA 4JX4A 4X2RA 4JTKA 3W83A 4EWND 2J27A 2RH9A 1UD5A 4UQ9A 4WY0B 3I65A 3W7OA 5K4XA 3SY5A 5K9CA 3DFQA 2JKAA 2A85A 2QCNA 2B7NA 3FW6A 1LROA 3C2RA 3CEPA 4ZL1A 5KITA 3BO9A 1LLWA 1JJKA 1GEQA 1H60A 3W2KA 4AYGA 5L9FA 2A2IA 3PWAA 3Q37A 1ME9A 3A5VA 3HG2A 1I2RA 2FTPA 1WOBA 1SO4A 5AB3A 3KLKA 2O7QA 3PM6A 5AYYA 3DI1A 1VYPX 3LCWA 5K4ZA 3T78A 4MZ8A 3CTTA 5AC6A 4Z08A 1H62A 1H61A 2YFNA 3A21A 2XWEA 3STCA 4WSJA 3TXVA 3CZSA 3WEOA 4AW7A 1M5WA 4RZ4A 4YMZA 2NV2A 4DO5A 4UFLA 1CYGA 4FEZA 2WANA 3W7EA 4IGHA 4QNEA 4CCDA 2J6XA 3OIXA 2V8ZA 1HL9A 2F7PA 1MW1A 1NOFA 5IBXC 1P0KA 2Y62A 5EMUA 5I3JA 4AWTA 4UFHA 4OBTA 3G18A 3VCRA 4PFMA 4UUIA 1A5BA 4X9SA 3W2JA 3HPXA 1J4EA 1GVOA 1UA3A 3MP3A 3ZS4A 2BX7A 5A2AA 1W8SA 5CLTA 3M6YA 5AC7A 3W6YA 1KWKA 1EEPA 3NQEA 3ZWTA 2H3BA 2BY3A 3KXQA 1UCWA 3W87A 1LTDA 1TPVA 3TJLA 2CW6A 3MP5A 3UYCA 3HPZA 4ZQMA 4RR4A 4UIOA 1LOQA 2ZZ4A 4IJBA 2A7PA 3AJ7A 1R2TA 3G0UA 3STEA 3GVGA 2VT0A 4J3TA 1QPRA 1H63A 3DENA 3GYEA 4XWUA 3W1TA 4GI6A 1OHLA 1KCKA 4JL1A 1DJQA 3SGUA 2ALWA 5DO8A 5LHEA 3TMLA 3EJPA 2ZE0A 1OFBA 2E68A 1VPXA 1KW1A 3LXAA 3A9IA 1ZHAA 2FGZA 2YA0A 1IXPA 2ZRWA 4K8EA 5LGZA 4YL2A 5G4WA 4UZSA 1YDNA 4KFNA 2VEKA 3PBUA 3PB2A 2V2DA 1H1ZA 3VNDA 3CU2A 3BG5A 2WNWA 4O17A 1NM9A 3TTSA 1G67A 1QO5A 5GVJA 1WO2A 4GUHA 5F2LA 1LRNA 1DBTA 3LCHA 3WMSA 3WEMA 2QV4A 1GQNA 2X2GA 3FJLA 2NT0A 3DHUA 4OKDA 3CPRA 3I68A 3I7SA 3WJWA 2YYTA 1J0JA 2B4GA 3P62A 3VM7A 4EVZA 2YOCA 3PAJA 3TKFA 2QCEA 3P5YA 3NPVA 4O8RA 3UZ5A 3JS3A 1I75A 1LORA 3RLUA 3T7VA 3W1MA 2DZUA 3BK0A 4LC6A 4HA1A 4K7YA 1B3OA 3S1UA 2OYLA 3WDIA 1AQMA 1TJPA 4Y8FA 5DBUA 2C14A 2WNNA 1KM1A 2DZWA 1FY6A 2QMKA 1DJNA 2QAPA 3P5ZA 1OABA 5HMSA 1JUKA 2RDWA 4UQEA 3C52A 3FAXA 3L2LA 3GNDA 5HUOA 3MHUA 3LRKA 1SR9A 5FEWA 3M5VA 1QAPA 3NGJA 2YKKA 3MUXA 2I9EA 4KKXA 5C2XA 3B4UA 4S1FA 1L6YA 3UQNA 3N14A 3VSTA 2B0MA 2JBMA 4OE7A 4JFSA 1WDWA 1Q3NA 3M5YA 3DHFA 2PWDA 5LNVA 3BCDA 4X22A 4HP5A 1QOPA 3GXIA 3A22A 1KLYA 2JGQA 4E0CA 2WSRA 3NO5A 1WOAA 3W7MA 4N02A 2R91A 3I7RA 3P81A 2GJLA 1TRIA 3NL6A 1EPXA 4TMBA 1HO1A 1QWNA 3SIZA 1KV5A 2X2HA 2W0UA 3B05A 3IK2A 2V30A 2ZRUA 5DCDA 3UWVA 3VGBA 2FH8A 4MZ1A 1MW2A 4K37A 3STFA 1P6WA 3OEXA 2G3MA 1GYLA 3L66A 7CGTA 4LVBA 1WBJA 3NQ7A 2PE4A 2FDSA 2DIJA 4H6KA 3KVMA 3M9YA 3TSDA 1Q6RA 1JF6A 4OJYA 1P0NA 2X2IA 2H90A 1TPFA 4S2CA 1X8FA 1K03A 1VCGA 2GVJA 3KVJA 3CV5A 1QWUA 4AXKA 1QPQA 1OGSA 2E0PA 4NJKA 4AH7A 2Z1BA 4IX0A 1OF8A 2VUYA 5E0FA 2V2HA 2ZYFA 3DH7A 3ANYA 3VGGA 5D32A 2RHGA 3W3OA 1EP3A 3PBYA 3BMVA 1BTMA 1AW2A 3PF3A 3B0UX 1IXNA 3NAVA 4GC4A 4R53A 2GVLA 1JUBA 4O1AA 4MY8A 3NZRA 5DCEA 3QZEA 5ABTA 2YA2A 3HG3A 1VS1A 2QDHA 1DEDA 2VFFA 3P60A 5F2GA 3TAOA 1WYIA 1Q6QA 1UD3A 1JQVA 4K6AA 2Z6IA 1TQTA 4CN4A 2TRSA 4HNUA 1QX1A 1HX0A 4FNPA 3WNPA 2WV8A 1A53A 4Y9AA 3SFKA 5J5RA 1XD0A 1YADA 4LOCA 3INPA 1J0KA 3DFNA 1YXYA 4NZFA 3GDMA 4N9EA 3ZQ9A 3W72A 1LP6A 1DORA 3YPIA 1FX6A 4QAIA 2W79A 1W3NA 4UNLA 1O60A 2C0AA 1LOSA 1YXCA 1LRTA 1Z41A 2ZXDA 3HQ1A 4UFKA 4IQLA 1EX5A 2VC6A 5EL1A 2VR5A 2CLKA 1FBAA 4UQBA 1IXOA 4NXKA 3RILA 1F76A 4I9AA 4A2RA 6TAAA 3MHFA 3B0VC 2IQTA 4QIUA 4AHQA 5C5YA 4AIOA 1M7PA 4J7RA 4BF9A 3EWZA 1SMDA 2E1DA 2YX0A 1HVXA 4KFOA 3VX0A 1TREA 4L4LA 2TAAA 1YPFA 2CPUA 1GJUA 3M5ZA 3GXPA 3K8LA 3G1HA 1OT1A 1M53A 3MP4A 1EH9A 4J3VA 2WVUA 3B03A 2WNQA 1QOQA 1UUMA 4AHOA 1W56A 2WKGA 1PCWA 1E40A 1PS9A 1LZOA 1MW3A 5HWMA 3AXHA 2PRMA 4O1BA 4YCPA 1KA9F 4NJHA 2I14A 4O19A 1CGXA 5F4WA 3NM3A 4Y96A 1N55A 2Y7DA 2Q8LA 3C2VA 3FOKA 3L4WA 4PCTA 3LCXA 2WOQA 3DFOA 5HWJA 7TIMA 3LHYA 1Z42A 3S1VA 1G4SA 1LLZA 6CGTA 3PUDA 4YWIA 2EABA 4JX5A 3SR7A 3G1XA 1MEHA 2ZZ5A 1JULA 4FNSA 1K8ZA 4JTIA 3UNDA 2WSQA 4A3UA 3IJ9A 1TPEA 4UTWC 1VFUA 1JCJA 1U5JA 3UWQA 1I2NA 2ISVA 1KGXA 1UASA 2G97A 3OLEA 5HULA 1XUZA 3BUQA 5CKSA 1CXFA 1OG0A 5D04C 1FWNA 2QJGA 3CB8A 2DZTA 3HJEA 3UWZA 1OYCA 2QR6A 3BVVA 1KFEA 3EX2A 2DP3A 3EXSA 4YXGA 3BAXA 1QNVA 2ZFAA 3G8RA 2ZUWA 4FNTA 1RQHA 5I3HA 2PWHA 3GDTA 3M7WA 1SFLA 3VMNA 1QDSA 1KTBA 4HPHA 3LI0A 4X0NA 4C1KA 1O5XA 3DZ1A 4OT7A 4UFIA 1AG1O 1VFOA 4AMXA 1NEYA 1P5BA 2NX3A 3L67A 3TXZA 1WZKA 2ZWYA 1VHNA 1KB3A 3K8MA 4PSPA 1MSSA 4JCMA 3CM4A 2BY2A 3JRKA 1PZ2A 3TNOA 3HIJA 2X1TA 3T55A 4J3WA 1K8YA 5E70A 3C6CA 4NJIA 2ZZ2A 5I3IA 3LX9A 1K8XA 4M6PA 1H7OA 3TAKA 2Y63A 1A50A 3W2MA 2QMJA 2VEPA 2Q8ZA 2ZA3A 3OA3A 3BCFA 5I0DA 4WOQA 2LLEA 3FFSA 2BSLA 3G24A 4XKYA 1W5MA 3ELFA 1OFQA 4AMAA 4UQCA 1WE5A 1TPC1 1FWWA 4Q32A 1JCNA 4O1DA 4I7VA 4UCGA 2QPSA 4JNMA 4O50A 5D09A 1WV2A 1XFBA 3L4TA 1PJ9A 1JRBA 1XKYA 2QUTA 2QCCA 1XSJA 3UY8A 2XVGA 3GDLA 3VSUA 4D2JA 1G9HA 1PZ3A 5KSWA 4H3DA 1F7BA 3UEQA 1KFBA 3M47A 2BXZA 3MJYA 1FQ0A 4J3UA 4OV4A 4H8VA 3O6CA 2EJ1A 3MI6A 4TO8A 3IVUA 4KWVA 1MW0A 2AMGA 1D9EA 3L65A 3D50A 1DV7A 2ZCGA 3E02A 3BG9A 4K36A 1SZGA 2ZTJA 2ZZ3A 4LC8A 1CDGA 2ZUTA 3BLFA 4PTNA 2F1BA 3DHDA 2Y88A 1RZMA 2OT1A 1KFCA 3MYPA 5G2WA 3UG3A 4DBEA 3NPUA 3VO0A 3MBFA 4GKLA 4RJEA 5G5IA 1FXQA 1OFOA 1FCUA 4NX5A 3O6YX 1FDZA 3ZT6A 2YFOA 1KGWA 4IMEA 1T8XA 5AYZA 3EJTA 1V3MA 4Q33A 4HIBA 2VFDA 4RLIA 2HSAA 4JFVA 2WVTA 5CPNA 3TOPA 4J27A 4CGTA 2EPHA 5AHLA 2VKZG 1BKSA 4HHPA 1QW8A 1G6CA 1PE1A 2P0OA 4NXSA 2DU2A 1V3KA 4U2ZA 4W93A 5CSRA 3HF3A 1OYAA 5D2XA 3PG9A 3H53A 1DVJA 4DF2A 1V5XA 1W9XA 1V3LA 4HKPA 2FQIA 3D4YA 4O10A 1PL9A 4JD4A 1QHOA 3PS7A 4O15A 2FYVA 4X3ZA 2QUVA 2VFGA 1F74A 1IGSA 3W7PA 4BWLC 3M07A 4UTKA 2QCFA 3G0SA 3MMTA 1VLIA 2ZX5A 1Z44A 2OT0A 4JY8A 3FYPA 1YTDA 2YYUA 4H8HA 2BXVA 2D0GA 4IPIA 1UKTA 2QUUA 4N9BA 3WK2A 4FO4A 1WZLA 1RPKA 1OSEA 2C16A 3S1WA 1JL8A 5HR6A 3BPWA 3BMWA 4UTTA 1ME8A 4AMWA 4H4IA 3VGFA 3GR7A 4UR7A 5C6MA 2V0TA 1TCMA 1GJPA 3DX0A 3W9ZA 2CLFA 3N9SA 1CXHA 1K7EA 3BW2A 3UERA 1CGUA 2HTMA 3HJZA 4IXHA 3O8AA 4PL2A 3W7HA 3BAKA 1WXJA 2V81A 1ZAJA 4Q4KA 4LV4A 3EB2A 1HT6A 4Z0JA 3KRSA 2W6RA 3HGJA 1H7NA 4LY8A 2C15A 4QM1A 4CCEA 2YIHA 3F1QA 4NNAA 5H91A 4ADSA 3LCLA 3LXBA 3G3MA 4FF7A 1D3CA 2TPSA 3WFAA 5AHIA 3W70A 5MHBA 2GJRA 4LQ1A 4ALDA 1O94A 1WAUA 1H51A 2ZXBA 2FB2A 3MHGA 4ADUA 4IMDA 3I6RA 3PUOA 1GVFA 4U3CA 5FESA 3M5XA 1EO7A 1CGTA 1W1ZA 1H3GA 2F7QA 2OYMA 3USBA 3S1XA 5AHEA 4ADTA 4O1CA 3DGRA 4O18A 5HDRA 4MYAA 4CQ8A 5I3KA 1CI1A 1BG9A 4WOZA 1R46A 5CGTA 4CVWA 1UUOA 3W7JA 1G7UA 3NDOA 2X1SA 4LUJA 3LCIA 3W1PA 4JYEA 4MY9A 1TJRA 4AWUA 2NSXA 3WY4A 1E51A 3D52A 3LRMA 1GG0A 3GXTA 1WQ5A 3SECA 1IXQA 4M7TA 3KEHA 4X9YA 1I45A 2NXHA 3QMRA 3LLDA 1I4NA 2DH2A 1EA9C 3O1NA 2ZX6A 4M19A 1TIMA 4ZVJA 3UD6A 3BG3A 4IWWA 4M8UA 4IMGA 1ZAIA 3MBDA 1CXIA 1W54A 4H8UA 1T96A 3GDRA 3P67A 4I7WA 3TR2A 1VFMA 1JAEA 1UA7A 1ICSA 4U2YA 5IM51 4UTIA 3WJZA 2VNCA 2WQPA 3IIXA 2JK2A 3UWUA 4ZQCA 2QCHA 4UFJA 4ZQOA 2GPTA 3A23A 5DY3A 2GQAA 3U8GA 1PIIA 5BRQA 1VLWA 1QHPA 1DL3A 1UD2A 1P1XA 2ALDA 5E6YA 1KM2A 3W84A 1QO2A 2Y24A 2EKCA 3IVSA 2I1OA 4FIRA 3BUIA 4AYSA 1EWDA 3KHJA 3QFEA 4Y90A 5CPOA 3W37A 2WC7A 1OT2A 2VFIA 3DX1A 4WY0F 5G4EA 1HTIA 3FKKA 3GAKA 1I2QA 1M7OA 1B4EA 4GBUA 3II1A 4OQVA 5FI8A 1G4PA 2VELA 3FLUA 3QF0A 3W22A 3EXRA 3QRHA 1O95A 1CIUA 3UWYA 1QPKA 2BHUA 4AVFA 3R5EA 4IOTA 3C4UA 1H50A 3QW3A 5I3FA 1OVDA 5F1VA 3PY2A 1FDJA 3RMJA 3WNKA 2P1FA 1LCOA 1D7FA 4FIQA 2YPIA 4UQDA 3CZLA 2X30A 4WD0A 5U4NA 3VSVA 1RP8A 5C54A 5T26A 3CWOX 3ABSA 2H3DA 4WJEA 4UC5A 1CGYA 4J28A 1CW2A 1OFAA 3Q94A 1CLVA 1BPLB 1XGZA 2AQWA 3G22A 3RNDA 1KBKA 3EJQA 1PIFA 3AMKA 3OG3A 1I8JA 5D05A 5E1QA 3GLCA 4M5PA 4Y6GA 5D2WA 3W07A 2XFWA 1GJWA 1TQXA 3BVJA 4RCXA 1TQUA 3NA8A 1E43A 2YR1A 4WQ6A 1BAGA 3AMLA 1AW5A 4LS2A 5IBXA 1J5TA 3T4CA 5HINA 3UZJA 3G1AA 3DU0A 4MLJA 3PUEA 3H55A 4JFTA 3C2EA 3W38A 1EB3A 1K7FA 1SW7A 1AL8A 2EHHA 3BAWA 3EJRA 3LDVA 1OX4B 4YLWA 4JGDA 3EDFA 2NX9A 3G1SA 2OW6A 2WPBA 4LXFA 5BNKA 4ORIA 4E38A 1LBFA 4LW7A 3TFCA 1TV7A 1JI1A 1HO4A 3MW7A 3F4WA 1Y7VA 4Z0SA 5EY5A 1A5SA 1PHWA 5FF7A 2QPUA 1XI3A 4DQWA 3CHVA 2Z1KA 5A8GA 3QPYA 1PPIA 1JDAA 4GUFA 2EF9A 5CZ0A 1TMQA 3WK0A 2ZIDA 1KXHA 4UTUA 3NG3A 4FXSA 3WY1A 3L4ZA 3B8DA 5HR7A 2ZQ0A 4O57A 2YGYA 4WX2A 1XXXA 3L2IA 5TIMA 3QW4B 3PULA 3W1QA 3FJ6A 1CPUA 1Q4NX 3L0NA 4L4MA 3W1NA 2RKXA 3O63A 4RX0A 3L0KA 4CLMA 4IUOA 1ZFJA 3O6DA 4KWWA 2ZRXA 4DO4A 2WJZA 4FNQA 3P84A 1TPH1 3CC1A 2ZUUA 1GTEA 3B04A 1B2YA 1HG3A 2YSWA 1EUAA 5LNUA 4RV8A 1RV8A 1MXDA 1KXVA 3TSMA 3KRUA 4WSKA 1XCFA 1W3TA 2CU0A 3BLKA 1KLZA 3LV6A 5DCBA 4PL1A 5AHNA 1MFUA 3TDFA 2B7PA 5CZJA 3EX4A 4E2BA 1MEIA 1RVGA 1IF2A 4JTLA 5CGQA 1KM5A 5LNWA 5DY2A 1C8QA 4RKAA 5E0KA 3EWBX 1TPDA 3C3NA 2CZEA 3EKLA 4J3XA 1DKWA 3CT7A 1HNYA 2E8YA 1TMHA 3OVRA 2F61A 4AIEA 4XUGA 1EO5A 3QJAA 3N19B 2B7OA 1AQHA 4LS0A 3GB6A 3W7DA 3SSJA 5KTLA 2NV1A 1YDVA 2OYKA 3CTLA 3ZSTA 3WDJA 3LOTA 4I7UA 3UXAA 2ZX7A 3H54A 2FH6A 1KTCA 2BHYA 4K38A 1NAL1 4U28A 5D03A 1QWGA 1EA0A 3OBKA 3VX1A 4LUIA 2ZDRA 2JGYA 3W7CA 1KFKA 4NUWA 1OX6A 2V3DA 3VMOA 3N9RA 2J9YA 1JRCA 1RR2A 1BVNP 2FPVA 3ZO9A 1X1OA 2RDTA 3IGXA 3NYZA 2ZBTA 3DBPA 1Q6OA 3LHVA 2G5WA 3NQVA 4XBSA 4O0ZA 4GIAA 5A5WA 4NNBA 1KM0A 2GUYA 3NL5A 5BW6A 3UCQA 3W7NA 3WNNA 3E12A 3L2MA 3T44A 5EBUA 4BR1A 4MJMA 4UCFA 1AVAA 1VCFA 1UJPA 3A4AA 4JEQA 3VMPA 5TQLA 8CGTA 1BWKA 4QAWA 4O28A 3WY3A 4BZYA 1SZEA 1DQXA 4JTHA 4OHQA 3RLVA 1W5NA 3LHZA 5F2IA 5LZLA 4MYXA 4PA8A 1XH1A 4NU7A 3CLMA 5E9AA 3WFZA 3BH4A 5D02A 2F7RA 2Z0IA 1T99A 1SO6A 3ZR6A 2C3ZA 1G69A 5K2ZA 1KBIA 4KMQA 5F7UA 3VE7A 4MOZA 4JDYA 1IZJA 3VNYA 2NWRA 2CWNA 5A2BA 2YXGA 4UNIA 1H7RA 2C18A 2JKEA 4NNCA 5K3VA 3L5LA 3D4ZA 3M0ZA 1A5CA 4O11A 2VOMA 1F2JA 3GBEA 1W5QA 4FHAA 4IPJA 1OF6A 3UPWA 1OYBA 4ZMGA 1MWOA 3BUPA 4NT0A 4JS3A 4AF0A 3GXMA 2KZHA 1XSKA 1F73A 2ZZ6A 3K8KA 1GZGA 4TX9A 3ZFHA 4G1KA 4POCA 2CHNA 4J3SA 3VGEA 3BVWA 1EP1A 4WXZA 1RP9A 3W1UA 3RFAA 5D37A 3NQ2A 4ORMA 4DF1A 4RK8A 1KXTA 4WY0A 3TMQA 3S42A 3TW6A 3S5OA 1GVSA 1ZJAA 1XBVA 4QISA 4BI5A 2A6LA 3QMSA 1TYGA 3NVTA 2D3LA 3GTNA 3TIMA 1JR1A 1L9WA 2BTMA 2ZXQA 5FEXA 1RPXA 3DI0A 4GE8A 2BY0A 4CKQA 1XC4A 4MZYA 1SFJA 3KL3A 3M41A 5BMWA 3TX9A 3L4UA 3G1VA 4A2SA 5AHFA 4ZQPA 4FMVA 4K39A 4K7VA 1ZJIA 3NR0A 2WVVA 5FEPA 2FIQA 5DLCA 1KM3A 1U2YA 3S6DA 4U33A 2C1HA 3R89A 4A21A 3L21A 2FPTA 2NLIA 2GQ8A 2GUUA 4UMCA 2VXNA 3AXIA 3PSWA 2Y2WA 1LYXA 3CLWA 1AW1A 2YDAA 4NJGA 2Q3OA 1MZHA 1KBBA 1GPWA 3FS2A 4XBKA 4UMAA 5FEZA 1BWLA 1C29A 1VC4A 1B9BA 3G0XA 1OB0A 3B06A 2WCSA 1KFLA 1YYAA 3DFSA 3BGGA 1SW0A 2NXGA 2ZUSA 2ZA1A 3ABOA 3LM7A 2X1RA 2DJXA 3ABRA 1I2OA 2WCGA 5BRBA 3TTYA 1LM1A 3MYOA 1HUVA 1R47A 2FPYA 3P8JA 4TR9A 6ALDA 1VHCA 3SW6A 4HT3A 2X16A 4GRSA 2PC4A 2NUXA 1GVQA 4LWWA 1U30A 3GBDA 3WNLA 2E6AA 2FE0A 1GOXA 4GO9A 5CPMA 1L6WA 1XBXA 5BRPA 3F03K 1TPWA 2H6RA 3L68A 3BUBA 2E5CA 2ATSA 2WPGA 1KM4A 1FDYA 3NQ8A 4OGZA 5KMYA 2DZPA 3FEMA 1LOLA 1RQEA 1W37A 1M7XA 5CLWA 1K7XA 4RXGA 2DIEA 1VGAA 3BUDA 3KL0A 1A5AA 4LVDA 1KBJA 1WA3A 1TQVA 2ATMA 2NUYA 4FLQA 4PSRA 1SZNA 1ALDA 1JCXA 4GO8A 5HXMA 4AEEA 2HS6A 3W1LA 4HN4A 1GCYA 4O13A 3PC0A 3N3MA 1XL9A 1LWJA 1J0IA 4DPPA 1VR6A 1BLIA 4NQ1A 3NQ6A 2J88A 3A6OA 2G3NA 3OLGA 3GKAA 4UXDA 2YW4A 3HG4A 2XN2A 1XUUA 4O16A 4LU0A 4QJ1A 1IZKA 3DDFA 5AC8A 4QQ3A 3HG5A 1VYRA 4P2VA 2E8ZA 3BSHA 5G1YA 3L0GA 4QSHA 4GJ1A 4GUIA 4GXMA 1GG1A 3W23A 5LHFA 1IIGA 1R30A 1Q6LA 2DJLA 1UH2A 2FHFA 2V2CA 1UBSA 3BLBA 4P61A 4A29A 1U33A 3WNOA 2R14A 4N2YA 1XH2A 3D51A 4IXXA 2QDGA 2QF7A 3QQ0A 4GI9A 5A2CA 4JYDA 3GXDA 1UH3A 2PWEA 3CIXA 3T40A 1HWWA 4XTIA 3AO0A 3BSGA 3DHPA 1KXQA 4PCFA 4LVAA 1UOKA 3TCEA 1ODUA 3KWXA 4NI3A 1WX0A 1BVZA 2E5DA 1T0OA 3G1YA 3FYOA 4MFDA 4ATWA 3L9CA 4TMCA 2O7SA 4AHPA 1TO3A 2NZLA 3P61A 3EXTA 1QW9A 4IMCA 1W3IA 3M43A 3CQ0A 1OK4A 5G2IA 3DAQA 1UD8A 1S5TA 1S3HA 2ABAA 1FCBA 2F1AA 1SSGA 1YPIA 4H2CA 1G1YA 3PG8A 3QEZA 2Y7FA 4B9YA 1NFBA 4FB7A 4ZZ9A 4MB1A 4N6EA 2J9ZA 3W7RA 3KE0A 1YXDA 5D2YA 3O15A 3TE9A 3W85A 2BY1A 4EF8A 4JTGA 2FHBA 1X6UA 3MWAA 2NUWA 3DDGA 4UTTC 4ZQRA 4W9TA 3PVFA 3PR2A 2C8NA 3EDDA 1OX4A 5HPOA 1QI4A 1KFJA 1VJIA 1X7FA 2WNZA 4HSOA 1N7KA 4O4WA 1GTHA 3TC6A 3MO7A 3ZSSA 1JIBA 1DHKA 2E6DA 3GR8A 4UOZA 2FFCA 1ZY9A 3HO8A 3LI1A 5D38A 4BWLA 2H8XA 1ME7A 3PSVA 1PV8A 3TQ0A 1XV8A 1MEWA 3BVXA 1OJXA 2BLEA 1XCWA 2EGZA 2OMAA 3VU2A 1ZALA 2ZRYA 3A24A 2Y89A 3E49A 3GZ3A 3NQCA 3LTSA 5E6ZA 2F7OA 2HS8A 3DX2A 4BI6A 5I5RA 1L2UA 1L6SA 4CN1A 4N9CA 5FF4A 5DELA 3TQKA 1SMAA 2D73A 1ZNNA 1N8FA 2ZX9A 4MY1A 4JFWA 1O4UA 4QNWA 2WSKA 3IV3A 4KFPA 3QSTA 4PEEA 1TV8A 3WJXA 1PCKA 2CLHA 4HNTA 3QM3A 3WJSA 2CLEA 4UMBA 1PEZA 1NVMA 1JD9A 2CLMA 2OSYA 3Q58A 5A6MA 1SU5A 4U31A 2OSWA 3QH2A 2WSPA 3G1DA 4JTJA 4BA0A 2VENA 2TSYA 3NOEA 1F6PA 5KZDA 3QC3A 2GVYA 2EAEA 1AL7A 3TV8A 1EP2A 4AAJA 1V7YA 2V82A 4JTEA 1TCDA 2D0HA 5DBTA 1JG9A 1G4EA 3CIWA 1JFHA 3O16A 3TFXA 4PEKA 2TYSA 4LRTA 4JICA 1PIGA 4HSNA 4BI7A 1S46A 4H7VA 6TIMA 3EJUA 4CNNA 4PODA 2FJKA 3MI2A 3VI2A 4N9DA 2AAMA 3LPPA 3HB9A 3W86A 1HFBA 1P4CA 3LERA 4GI8A 3E0IA 5CZSA 1FWTA 5D33A 5DN1A 4HOWA 2ISWA 5G2HA 2XN0A 3WY2A 1XCXA 3TH6A 1C8VA 3G8EA 2NXIA 4R33A 1NF0A 1F6KA 1CXEA 1M6JA 3P8IA 4JTFA 4ML9A 1IV8A 3N2MA 1NF7A 2EAWA 1QPOA 3G1FA 3KL5A 2JKPA 2E9BA 4MIMA 5EA9A 3KVLA 1D3GA 4UOQA 5KEZA 3R13A 3EJSA 4DEFA 4JCLA 1UD4A 3W1AA 1KTNA 3CWNA 3WNMA 4DXVA 1B0IA 2QCDA 3ZR4A 3S5ZA 3W2LA 4JYFA 3M44A 3MI3A 4JTSA 1KGUA 4GQRA 1O7DC 4HOXA 1Z32X 5C55A 1PHQA 1VAHA 3QGVA 2OSXA 4CQ9A 3ATYA 4RXFA 1CGVA 3ZT5A 2DORA 4GQQA 2CZFA 1YTEA 5U7SA 3IIVA 3V1PA 2CLIA 1MXSA 4MAZA 1ICQA 3EWUA 4WZHA 1FCQA 2P10A 2WKJA 3W76A 2PCQA 5BOOA 4CNOA 3LCFA 2PWFA 4NVTA 4O53A 3WENA 5D2TA 5EKYA 1VCVA 1QI3A 2DH3A 3LB0A 3SJ3A 2ZZ7A 3NPXA 1DOSA 2ZRZA 2QCDB 3KX6A 4UTLA 5K9DA 5CZTA 8TIMA 1JQXA 5TD4A 1DTUA 3OVPA 1AMYA 1UKSA 4TVUA 1YDOA 1B4KA 2Y7GA 4MJZA 1IIHA 4PC8A 1OFPA 4UTWA 3PB0A 1F5ZA 1GVIA 1TQJA 4LVGA 4FLRA 3LBCA 7TAAA 1QCWA 2J24A 2Y61A 4N6FA 2Y5EA 3RU6A 3ECQA 4K8HA 2WVSA 2OCZA 2Y70A 4UR8A 3KOFA 3CZNA 3W1RA 1JF5A 4M56A 1F05A 3TONA 5CG7A 4OIFA 1VYSX 4UNKA 3D0CA 1W0MA 3NXFA 1VIWA 2AGKA 4O4VA 3HOJA 4FX6M 4Z1CA 4AWSA 4NZJA 5AFDA 2OW7A 3CEUA 1JD7A 3O07A 1BF2A 3DFTA 4RZ5A 3W7QA 3W7LA 2Z6JA 4MVAA 3K30A 2OJPA 2DZVA 1RQBA 1GT8A 3EDKA 1PVNA 3RF9A 1JI2A 3C61A 3BVUA 3FA5A 4ONVA 4AEOA 2G95A 2EO7A 1TRDA 5L6UA 1VQTA 3IIPA 1SZFA 1TB3A 1MXGA 3KLLA 3SI9A 1HTYA 2ZRVA 2QCLA 5K7JA 4E2OA 4B5NA 2YCEA 3L4XA 2A4AA 4FX8A 3U6WA 1KM6A 1SPQA 3R8RA 1MO0A 5F4SA 4Z1DA 3TQVA 3LTYA 1SW3A 1MFVA 4LS1A 2XVLA 4XTDA 5K9XA 1DQWA 1W31A 2B7QA 3C0JA 3TC7A 4WLCA 3TK7A 3A47A 3IEBA 1G4TA 2E6YA 4XB3A 2WSYA 2F7FA 1J0HA 3R2GA 1JGIA 2ZICA 3IGUA 5FF2A 2EEXA 3P7YA 2A5HA 5E93A 5DXXA 2GJNA 3OLIA 1R34A 4TU1A 1VZWA 3C56A 1D3HA 3B0PA 2V5BA 4KWUA 1UKQA 3VNZA 2BWGA 4CQAA 3W75A 4O12A 3TJXA 4JDBA 1S5WA 2WO5A 3LCGA 2A7NA 4GINA 1OFDA 1YTKA 4O54A 2R94A 1LDCA 2EADA 3L5MA 3ATZA 2FHCA 1THFD 1KCLA 2DZXA 5LSMA 1JUEA 4IMFA 4NX0A 5AOUA 1HL8A 3LRLA 1R2SA 3W74A 5SWUA 1XBYA 4TIMA 1WBHA 3UWWA 2PWGA 2AAAA
chains in the Genus database with same CATH superfamily
3CQPA 3IMVA 1X4YA 5CSYA 1WDPA 2VYRE 1W6WA 3VI3A 2LU4A 4N24A 4D9RD 3H9SE 4W9DC 4A2LA 3W7IA 4YCOA 5GS0H 5EV7A 3EX1A 2VDQH 1WWWX 5ESQA 1V05A 1FNEA 5TF1L 4DRSA 1VH7A 2VISA 4W7UA 1QI5A 3IAGC 4DHLA 1DHPA 1G7MB 3Q43A 4BCYA 4IGBA 1OC7A 1S8DB 1MNUL 1SY6A 3OVQA 4QDMA 4LHUD 4E0RA 5M7QA 1MZZA 4YSRA 1AD1A 1JVNA 4D0BA 5FJTA 4JTTA 5REQA 3NOIA 5DANA 2ABBA 3DG7A 3BAJA 4U6XB 5EIIB 1WTGT 5HYJB 2QT3A 4APXA 4HSHA 3WBWA 4XMZA 4WF7A 4H83A 1HCYA 3GXNA 1WEJH 4PRRA 3ZTJH 3IDMB 2QVNA 2WW8A 3DVNB 1F6YA 3MB9A 3UJ2A 4AQZA 5LXGH 4LUYA 2WTRA 3SCQA 4EXBA 1OX5A 2QUNA 1Q9KA 3Q5TA 5DMKA 3S8HA 2ICES 5EF1A 4DETA 4Y4KA 2WC3A 2EXOA 1RUPL 1J8VA 1T1WB 5AAWA 1H6TA 1EHLL 4E9RA 3GG0A 6TIMA 4P4KD 1XAKA 3QZWB 4G2AA 1XYBA 3C8FA 1E6ZA 2IPKA 2MUCA 1DQKA 4QITA 3KAOA 3VFLA 3FBQA 4K07A 5EC1A 1T41A 1ITXA 3TU9A 2XLLA 4GUJA 3GVWA 1JPMA 4XAYA 1QMLA 3CC5B 2MCG1 3QMTA 3VFVA 3BC9A 3RL2A 1YNTB 3N11A 2AJSL 2QQKL 3CXOA 3DN5A 4Z95H 3KRZA 3I3EA 1SJXA 5C0ND 1E70M 3B6SB 3GT6A 1LP9F 3QNXB 3I3DA 5IROC 3VM5A 3EGSB 3URAA 2VDNL 5AYXA 1GGCH 1OPGH 3LPOA 4JKWA 3MRCB 1J05A 4QHUA 3SJVD 1H0IA 5JOEA 4ELKB 3ASNB 3PBVA 1BHGA 2QQQA 1ZHKB 2G75A 5LCVL 4LDLB 3VGHA 2DKSA 3LY0A 3N1AA 5AYIA 4RLDA 3SCPA 1YPZE 3HGOA 5FD0A 3G5ZB 4A6GA 4FHBD 2B14A 1NFDA 4UF7C 1GZQB 4BCXA 5ANMB 3STGA 2OMVA 1TFPA 2CMRL 4G9DB 4L3FA 3VFNA 3SO7A 4XRCA 1K8IA 2GBAA 4MFEA 1DDTA 4E6MA 1DE6A 3VXRB 4FQXB 3ULVD 1QI2A 1CFSB 3FA3A 4TQIA 2IGTA 1DWHM 2P44B 3E9UA 1JNLL 1HJCA 1JPGA 4WENB 1WZMA 3H3PH 3N42B 2O5XL 2R59A 4JFXA 1JWSB 1U8PB 4W4OC 3REWA 5IJBC 4QTHA 5BQ7B 5LGJA 1H7PA 4B3LA 3RHWF 4E9LA 1JCMP 2Z1SA 4PWFA 4UAHA 5DZVA 1KPVB 1FVPA 3ZT7A 1ELSA 5DI8B 3KLHC 3G04B 3EDJA 4JUSA 4WU5A 2V3FA 3V0HA 3S46A 2CM5A 2GEEA 1S2TA 4FQXC 5I8CB 4Q6YA 1NLBL 2FJSA 1N12A 3IPEA 1HS6A 2VHLA 4OLZH 4S39A 1GXEA 4XP5L 4PP2A 3V5OA 5B7FA 2PCPB 2BODX 1IVLA 1VF5C 4LGXA 1NC4B 2WINA 4NENB 3WHE1 4YLCA 1YYML 4KOBA 4P59H 2OL3B 5E94A 2GUBA 4TLTA 3RIKA 4BFNA 3CJJA 2ZUYA 3QYNA 3DKJA 1BXVA 2QVKA 3N1FC 2Z4TA 3QZNA 1FWRA 3OGOE 5FB8B 2C13A 2K7QA 4RISH 4HJJL 4AENB 4F8TA 2I9LB 4HG4K 1TV5A 1XIMA 5AW5B 1QHZA 3V52L 2FVKA 1NGWB 4QXWA 2EBNA 3BAIA 4OZFG 3C5QA 1LO5A 1EUTA 1G9NC 2F19L 3CSPA 2NXZD 1AYRA 3QJFA 5KJRL 4DAGH 5F9AC 5IJKC 1IU1A 5BRZB 4HJJH 4EF9A 1ADOA 1RFDH 4UOW0 3VXTA 2GJJA 1MCNA 3HHSB 1PYWB 5H2BB 3SJVB 5L2JA 4BGLA 4DP1X 2YQ2A 3AJXA 1TZHB 3FRPG 5HUPA 2KX9A 3D08A 5DYOB 4JX6A 2FEEL 3TBSB 4KGLA 4MKMA 4U6HB 3AIQA 4AZIA 4DF0A 1RZIB 5T5NF 1OFEA 1CJYA 4KY1L 4FFYL 3IJ8A 5BQDA 4MBOA 2E6PA 1VBRA 3ID7A 4HPJA 3WD0A 3BW9A 4U3AA 2HPIA 2AVGA 1JXKA 2MQ0A 1E4WL 3VI4A 3NJMA 4PWJA 4QHMA 2PXYC 4MS8D 1HZKA 1OD8A 4NZ1A 3EJYC 4FJ6A 4AW4A 1P48A 3HR5A 1QBBA 4GQ9L 4Z7QF 3ZKXC 5I6XB 1A80A 3THQA 2Z92B 4FQXD 3WG7B 3OJMB 5KBKA 3W3BA 5CGMA 3UP6A 3IU3B 3UIZA 1XDLA 2YD8A 1EUNA 3MBEA 2XGZA 3V5KB 3LNHA 3UTSA 1DQQB 3FSTA 4E4PA 4U0RC 1TLKA 2GTQA 3ABQA 3QFJA 2VB5A 4LRSA 2VZUA 4PY8I 4RFEB 4PJAA 4MUZA 1WAAA 5CEXA 5C97A 1TSRA 2Y5JA 4LUSA 4XZ9A 2X6UA 5EZJB 1CDUA 4ZMTA 4XI5D 3R7MA 2PBOA 3ZKXB 3T2QA 3UG5A 3A5FA 5C08B 4LF1A 1FC1A 2NQZA 3SBWC 2ATKA 5DUPH 1IGTA 5IDIA 1RK7A 4TL4A 3W1XA 1F4WH 3P69A 4NRRA 4L8BA 3IFOB 1VFBA 1S5VA 4Y19B 3UXDA 5JHDB 3CQQA 1XIWD 4O5LL 4RGMB 4I5RA 2AQOA 3UJJL 1XYZA 2A7RA 1OP3K 1J1PL 1N2RB 2YPLE 1FWSA 3B1UA 2H0PA 2B2XL 2PRLA 5CPLA 5D9SA 1XYFA 1R75A 3DO7A 4BCEA 5CPTA 2DW7A 3GB7B 3GKWL 4M8QB 1E4XH 2FZ3A 1IM3D 3O8XA 3N29A 5DZNA 2OJEB 4BV1A 3L5AA 2RBLA 4I9TA 5FSEC 1NFIA 4Z7UE 1EJ6A 5FF0A 5HHOE 2VRKA 4RGMC 2FJHB 2XXCB 1U6AH 1UXSA 4XR8C 4RGOH 2A21A 5F4XA 4I18B 5DRNB 3W39B 1G7QA 1BVNT 1RULL 3M1ZA 4HPXA 5HGAB 1J2WA 2X8RA 2CR6A 3GXFA 1K8DA 1S5HB 2BIIA 3G6JF 2CGRH 4FYRA 3K46A 3TUUA 2WOBA 3C2OA 4DO6A 2YXOA 1N2VA 5CZXD 3IB4A 3U3HA 5BZWB 2BNUB 4K55A 2XN9D 4ICNA 3GK8L 3CASA 3QHTC 3OXSA 5AHMA 3PN8A 2X5PA 2F53D 1SN0A 4GNVA 1MQQA 3ZDYF 1ADWA 3TW9A 2NY0B 2DMGA 3QNZB 1HFUA 2VXTH 3D07A 2YUXA 3L9YA 1SLUA 3MV9A 4B53A 2ZUVA 4GBXA 3M45A 4NSKA 1RHHA 2A99A 2GVGA 4AF0B 4BQ2A 1ANUA 1FP8A 1R2RA 2E5BA 4YTTA 5B7EA 4EDWH 2ZXEB 4G7VH 4OD3H 1NAMB 3WI9A 1RJYA 3BAYA 5IF0A 4FX7A 1RAKA 4QOKA 5HHVL 3QEUB 3CQJA 2BH0A 3QHNA 4WHCA 2X4UB 4MQ7B 1YEHH 2AXGA 1TIUA 3GRGA 4MB5A 1U8NB 4O02A 4OZFB 5F88B 4AYEC 1IIKA 3LSBA 5E8PA 4MMZB 4I0PC 4RCAA 3UTTE 2NY0C 1UZ4A 4CD5A 1YCSA 4RIRB 1WKYA 4JTUA 4MKNA 2QBWA 4FFTA 5BXFB 2DQUH 2NDFA 3RY5A 4X4ZA 3SE8L 5DVKA 3DECA 12E8L 1A4BA 3KBWA 3SGEH 2AEPL 3M7FB 2YW3A 2FT7A 3MTRA 1FL3B 3GJFH 1DFXA 1AGBB 4PJ5E 4NUMA 2WHVA 5TDNA 3SCMB 3F7LA 3SKMA 4AXWA 1XD1A 2Q7AA 5IB3A 4C6EA 2V9DA 1SLXA 2D3NA 1WKEA 1E2ZA 1JHKH 1UR3M 3TNNB 1EGVA 1C1EH 5ESVA 1EWEA 5HJLA 3ARGD 3CH0A 3PV6A 1LLOA 3CVCA 3GIYA 5H94B 5AYUH 5FYLE 3GH4A 3SDXE 5J11B 1I8KB 2FECI 2QJNA 4ZUWB 2OZ4A 3S36X 1NOLA 1A0DA 4L6OA 4AV4A 4ZDHA 2OR8A 1BV8A 1C5BH 1G5AA 1U4EA 2ZYHA 5DGRA 1R38A 1UC6A 2DFAA 3MRQA 5EEWA 2J72A 4Y9OA 2PU1A 4TSBH 2G9KA 4C1LA 3U0PB 3IJ7A 3TEWA 4AC7C 2QYGA 6FABL 4N4QA 4CC1A 3HGSA 4E8GA 3UBXA 5KZMA 4RAHA 3IRDA 4RUBA 3NBNA 2QAFA 3ZOAA 4K8RC 4Z3EA 1C5BL 4RAVB 1KY7A 1JDCA 1KFAH 5AVTB 4B96A 3ZDYE 1QPNA 1V0KA 5HD8D 1G6RA 3IYLW 3TZNA 5C0RH 3IKCB 2YL8A 1C9DA 2CHXA 5FJPA 3RUGA 3HIZA 4DVOA 2AV7A 2FIRT 1PWLA 1C9WA 2X89D 4WSHA 1BDYA 4MSWA 1AXIB 1DLHB 1T21A 3CIQA 3HZKA 2WAGA 1M65A 2ROXA 4P5KB 3RGVB 2D7TH 1OZQA 5EO1A 5M03A 2R83A 4O2EB 1OAXH 1VSCA 4URKA 4OGAC 4TKWA 4CN6A 4XBEL 2CKSA 2VP8A 3HAEG 3HC0A 3GMNA 4FQCH 4HJGB 4O51A 3ZRFC 4ZI8A 3H7UA 3MJMA 3MR9B 4U7MA 3EBIA 4US5D 4P07A 3RK8A 4Z7NF 2OCJA 2P5NA 2VR7A 2JELL 2OZ4H 5AUMA 1S1RA 3L12A 4FFZL 1NIFA 4EI6A 2QCMA 4CSZA 3ARYA 1AJ7H 1FO0L 4Z76B 5F6IB 4J40A 4PGDB 5IEKA 2CIKB 4DNMA 5T1KD 3CMFA 2EILB 3NA4A 1NFGA 3O9WD 3TA6A 3DXIA 4IX2A 5CBIA 3H2EA 3AU6A 3EWWA 1ONRA 3DX3A 1QFPA 4X6FB 4R83A 2G3IA 4YDVA 1TA3A 2DZSA 1EV2E 3TZVB 5CC7A 2E9WA 4LTSA 3AB0C 2IOMA 3MRKA 2BOBB 1L0PA 3CZEA 2Z3FA 3VG9B 4L7ZA 3Q06A 3GZKA 1XEUA 3OJDA 3LHPH 5IIEA 1G94A 4MS6A 1QFEA 4GH3A 1Y07A 1Z6JT 2L4OA 3I6GA 5EWIL 2B4CH 3JWDC 4JY4B 4X7SH 5TPWL 4YIQA 5JXAL 1R0AH 4JFDB 3B9DA 5EU7C 2E6FA 4AQEB 3DX5A 3KVKA 2VM9A 1JCKA 3F5WA 1DJZA 3DX4A 5BZZA 5LGXA 1TQBB 4I1PA 3K1KC 1MIMH 4HC1H 3SYPA 5BMXA 1PZ1A 4V2CB 1HXKA 4Y1TA 4O14A 1TTGA 3CMOL 3V0AC 3EYQD 2PZNA 4CCZA 1BZDA 1AZNA 1JGEA 1HQRA 1UJ3A 5D7SH 3T0EB 5K59F 5FGSA 4DGVH 3Q6GL 2GY5A 2P53A 1E4XL 1RY7B 2VXUL 3H42L 3MLUH 4FAAB 1VFTA 1Z48A 3QWRA 3HPSA 2WKLA 4LLMA 1ICPA 3VIGA 3LDBC 1JPEA 3SHSA 4QY8A 2J1XA 2G3XA 4K23L 2NY4B 3FU8A 3QZPA 4G7RB 3X14B 4RDQF 3TFKC 3BARA 1U42A 5CBBA 4L9LA 1ML0A 2NR6C 2WUBL 2V33A 4P4KA 4IBWA 3ETTA 4JFPB 6PCYA 4IEFA 1PNDA 1H3PL 1M05A 4PH8A 2EYSB 4W9GC 3VNKA 5C0EB 1VZGA 3DTXB 4L1HA 3P82A 3BLPX 5D1ZC 3SQBA 5IMMB 3FKUS 1TZ9A 1CU4L 4JX4A 4E9YA 3O4LE 4RX4A 4PREB 3CIVA 3VXUD 1M68A 4JTKA 4YVVA 4M7LL 1I1AB 4M80A 3LKOA 4EWND 3PWPA 1K4HA 3WUWB 2YR3A 1U8OB 1RLDA 1UD5A 4EDXB 4PMRA 3I65A 1DCEA 3MV9E 3W7OA 5ITFB 3FU5A 1NWSA 4FQLH 4HUMB 4GBXC 3VI3E 4JO4L 3WF0A 5EN2B 4A37A 1KC7A 4MJ2A 5EB8A 2QCNA 2E47A 3BP4B 2I9TA 3P11H 4PMEA 4PJ7F 1LLWA 5KITA 3WHXA 1JJKA 3CFDB 3W2KA 2APBA 3O45B 4KI5C 5HYJE 2A2IA 2B9BA 3PHQA 3Q37A 1TVNA 4YX2L 5E4AA 2C9XA 2VQTA 4I2XE 5EMJA 3QI9C 1FCCA 4OBRA 3VH8A 5I18H 3KXFE 3NSDA 1ZLWK 1PG7H 3ZIZA 1HKLL 5AYYA 1UACL 1SFTA 4PUWA 3NGBB 1TV2A 1VYPX 2E40A 1BQLH 3S37X 3T78A 4MZ8A 2NXZC 5B1JA 4Z08A 1GL4B 4LEOA 1H62A 1BMWA 1TTCA 3GS6A 4QGCA 2Q76B 1GZPB 3QJUB 4M1GH 1JGUH 4HIXL 2D69A 2NVAA 3CH9A 3U46A 1CECA 4WSJA 1IEAA 1US0A 2CBUA 1B3WA 5D2NA 2VVNA 4DO5A 4OCRL 5CP7A 5GRUL 25C8H 1IWPA 2HK1A 1M1XA 4AIUA 4HU4A 1WBZA 3OIXA 1GOFA 4RZCA 2ZYSA 1HOEA 3GSRA 2V8ZA 1JXFA 5I66A 1FKWA 1CTMA 4WK0B 5H8DA 3VDAA 5IQLA 3APFA 4PG2C 1M03A 4WKFA 5DR5H 3AS2A 4M43H 2IALB 1GMEA 4EIUA 5J12B 5I3JA 3VFSB 5IBLD 3DEQA 1F3JB 3GK8H 4QHKJ 3T1WA 3VCCA 5D2LE 3MRLA 2OZ3A 4JFFB 4KO9A 1EEZB 4NASA 2O4QA 2ORBL 3KOXA 4X9SA 2CDEA 3NQKA 3W2JA 3H2NA 1UA3A 4MZ2A 4XBPB 4K3ZA 1M2OA 1Z9NA 2EO1A 4L9DA 3EADA 1AH3A 5HHQB 2AJ3B 3QO0B 2R1PA 4D6DA 5HGHB 4E8DA 4W9CC 1T5WB 5DJDA 3WIIL 2BNRE 4JO2L 1MIEH 3T6XA 1JGVH 3TBWA 4LUTA 1W16A 5GXBB 1UB6A 3NSXA 5DJAB 3BZEB 1P5UA 3LK6A 3TYBA 4X4YB 4P2AA 5I1EL 3W87A 4I9WE 1DQTA 2I24N 1SBSL 3U7YL 3GRWH 1KR1A 1NDGB 4ZQMA 5GHWH 2HJKB 4RR4A 3QSKB 1P1MA 4WW1B 2YO3A 3ARGB 2A7PA 4GD0A 3PUUA 3AJ7A 3RNQB 4JHUA 5HYSB 3VFUA 3MOAL 3S35H 1QPRA 2J7GA 4XWUA 2HX9A 1PZ5A 4N0FA 4UYPA 2DAVA 1ENUA 4FR6A 3W1TA 2DWEA 4JL1A 3KZPA 2ALWA 4IOFD 4WJ5A 4MD4B 3BPOC 1S1PA 5LHEA 1UC4A 4P2RD 5KS9A 5KSBB 1EEQA 3G2GA 5I1GH 5FFLA 3LXAA 1WFUA 4OY9A 2FTWA 5E2TL 3A9IA 2QF8A 2FGZA 1K5NB 4Z7VF 1PZSA 4WJ5B 4K8EA 3PRZA 4FRWA 5E7BA 1EDHA 2HFFA 2WZTA 1OAZL 4JTCA 4ODXA 4RFOL 5G4WA 1NKGA 2EDRA 2N3JA 1N6QH 1YDNA 4JKPH 2VZTA 2BGQA 1I3RB 4KFNA 4OU3A 3V52H 3C09C 3QIWC 1WCQA 4N1CA 5GSVA 5EEXA 3AHYA 3PB2A 4EUPB 3QRGH 2DQUL 1ZHBA 1ZWIB 3FB7A 1KFWA 4H8NA 5LGHH 4R7WA 2WLKA 3TTSA 3FV9A 5JVLA 2CWXA 3GY1A 4L3CB 1LRNA 2XA8H 4X6EA 2D7OA 2Z8SA 3CN1A 3HHMA 3QXAB 4QNPF 5JO5B 3TYFA 3WEMA 2QV4A 3RIFK 3RRQA 2ZCZA 3P2DA 3CK0H 1FVCB 5BJTA 2ZD0A 3F7YB 1YG9A 3GLDA 3I68A 4HYRA 4R5EA 1AZCA 5IVNA 4PCNA 1J0JA 1F41A 1JPKA 2Q09A 1NCNA 1KB5A 5DFWH 4WFGD 2DYPA 3QY7A 1EJ8A 1UZ1A 5L0QB 4HFWB 4HZAA 3T6QC 1BA9A 2VL5B 1P0DA 1TV3A 1Q7ZA 1AGCA 4D3CH 4H6EA 4NZ4A 1PL3A 2DM3A 4AJ0A 1ASPA 1BLNA 3FUJA 3VQ2C 2GJ6B 3RLUA 4M7LH 4R7DA 4I1RA 5J8LA 4LLAA 2AJZA 4D9QD 1YEFL 5ISZB 3S6CA 1ISWA 4GC3A 5DMMA 2POZA 3BK0A 4OT1L 2W38A 4TQTA 1I82A 1B3OA 2A6JB 3LQZB 2A1WL 1MFNA 5FYJD 5DBUA 2V7NA 5FYLH 2C14A 5CP7B 2WNNA 3M17B 5F1KC 3B0XA 2X0VA 2DZWA 1CLYH 1MY5A 2Z6FA 2QMKA 3DBXA 2CO6B 4XPAL 4Z78B 1V7AA 2QAPA 2WWDA 4UT9L 5I1CH 1YAZA 5JPNC 1JUKA 3BLOA 1AFSA 5HMSA 1S2VA 4AC1X 1X44A 1DQJA 2Q1EA 4UQEA 3SY0A 2HWGA 4FALA 3MA8A 3SBQA 5MENA 2QPFA 3GWQA 5HUOA 4AIZB 2ADFH 2QW5A 2AKRA 2YKKA 1DWJM 1TITA 2FVNA 3GJFK 3SD2A 4GT7A 4DGUA 1D5ZB 3FB6B 3EBVA 2EJAA 2WZPD 3TT1H 5BNXD 4AQAB 4L6DA 1L6YA 2PPAA 3WIFB 2ZSWA 3FMGH 4RGNB 4L4VA 3VXOA 2K45A 4R8WL 2MSPA 3CSYB 2KLRA 3VSTA 3PFUA 5JLZB 4JFSA 5JR1H 5KVDE 3QWOA 3CXDH 3UTTD 5MEOB 1ZSXA 3H8AA 2NY4D 1VKXB 2VN4A 2PDIA 1GNXA 1JGUL 4IIZA 3TT1L 4EXQA 5LNVA 3OJGA 3BCDA 2I9TB 1M56B 4YDIH 3KJ4B 1DQUA 3MC5A 3Q44A 1SJAA 3RWIB 1W8GA 3NTCH 4E0CA 2V2WA 3O4LA 1TE6A 4AKPA 3BH8B 3VYOA 1MDLA 4Z2KA 4FZEL 1QVBA 4IIHA 3SGKC 3TO2B 4OZ4A 3D6NA 5A94A 5FA4A 4N02A 1KIQB 3W7MA 2I9UA 2MEJB 3IJSB 3SE3C 1LE9A 4J23A 2Z1PA 2BSDA 3CDZA 3T04D 5IGXL 1BJ1H 3ULUE 4S38A 3LG3A 4BY3A 4TMBA 2CETA 2Z91B 3SIZA 4NFCA 2NNAB 3GSUA 1KV5A 2X2HA 2O1AA 2NNXA 2P5EA 2ON3A 3CLEL 2ODIA 4MZ1A 1DYZA 1M05B 3TTOA 2H0EA 1OL0A 2X3CA 3WOVA 1DVUA 1GYLA 1WLHA 7CGTA 5ISZD 1UJ3C 3GSNH 4JRXD 4XO9A 1Q94A 1ZANL 2EVIA 1WBJA 3NQ7A 5DRWB 4U1GB 2DIJA 1UQZA 3QQ9C 5CJMA 3KVMA 4PTUA 5K1VA 1J0ZA 3ERPA 3CV2A 5I3DA 2H90A 4WV1A 5HI3D 1P0SE 1EJRC 4S3JA 3AG1B 4AEHH 1VCGA 2GVJA 3OJVC 2VGIA 3ZZQA 3KVJA 3WHE0 1XCTB 4Z3GA 4HU2A 1L7TL 3T0EA 4KDVA 4MWAE 4MDOA 1OV8A 4AH7A 4K1GA 3C8KB 1OGAD 4GH7B 1DL7L 2ANUA 2WXJA 4KMTH 5FOOA 5E0FA 1IT9H 3NACH 4EBQH 3RJYA 1WUZA 6A3HA 1KJ3L 3FB5B 3MNVA 1BQSA 2P8MB 5D7KE 3VGGA 3GUWA 1M4KA 1EP3A 1RZGB 3ATAA 2HG5B 4W70A 5AC5A 3B0UX 3T4AA 5T1LB 2VGFA 4YIQB 1UM6H 4QNPE 5DCEA 1F4XL 1TJMA 3FO2B 2X0WA 5HBFA 4FP8H 1V08A 5CAHA 4NAJA 1AKPA 1NP2A 3P77B 4WHDA 4CBPA 5CINL 3WUBA 5D7SL 5ABTA 1EX0A 4XVUC 5HVFB 3O4LD 5I1AA 2VFFA 4BQ4A 3P60A 3IGLA 2CK0L 3NIGF 1UD3A 4ZMOA 4OZIF 1V6TA 2VH5L 3JBG7 1Z7AA 2XU9A 2FBJL 2TRSA 1QX1A 2XSBA 5AVRB 3TYAA 3RLHA 5MI0B 2WV8A 4YTRA 2YEVB 1RKRA 4FG0A 3PL6C 1MFMA 5EU6D 2MANA 5FM5M 2G2NA 3UAFA 2H32A 4PGBA 2HVNA 3INPA 4X9HA 3PWIA 1DVSA 2PW2B 2ZKHL 4UT6L 4X7TB 5FKYA 4Y2DC 1MCWW 2PPFA 4R7LA 1DORA 4HA4A 4IP5A 1IEHA 2FR4A 4DT2A 4OF6A 4X6DB 3SOTA 2FTAA 1LOSA 1O60A 1Z41A 2C0AA 2VDPB 1U92B 3HQ1A 2O4EA 5EO1B 1XW8A 2QULA 4US6A 4B5XA 5EL1A 3V55A 2VR5A 2WXOA 2YJLA 1FBAA 4N42A 4WDIB 4QRQA 1AOHA 2BVYA 1T1XA 3SKNA 1AJ7L 1FO0H 1F76A 3HE7A 4HCLA 4N68A 3MHFA 1U8MB 4DYKA 4DZHA 4XBGB 5GS0C 4KQ3L 4OJAA 1I9EA 2Y1HA 1SHXA 1KEGL 2PTYA 5I75C 4I9XA 1E27B 1GYWA 4P2RE 3T1FB 4TQEL 3VX0A 2OXGB 5EBGA 2FJFB 2V6HA 1GJUA 4GJJA 2GYIA 4KQ0A 1OT1A 2GUOB 4PW3A 1EH9A 3D25A 3QDMA 3QZLA 3RURA 2WVUA 3UACA 3K71A 5KANI 2WNQA 4XC3H 2DYSB 3S3JA 1QOQA 5KTEL 5FOJA 5JOPD 2DQXA 2BC4B 1E9YB 2PR4H 1PCWA 4LCIH 2CJSA 1FA4A 2R23A 3RFAA 4YDKH 5DXWA 1FFOA 3IDYC 4K7PH 3WS3A 3RX8A 1OAUH 3G3LA 5HWMA 1XLIA 2Y6TE 1CFNA 1EVTC 5ENLA 2EZ0D 5CCHE 4XZUA 4O1BA 1GA2A 2I5YL 4YCPA 4N8VB 3PL6D 1GKQA 1MCJA 3F62A 4H5SA 1PGRB 5CZVH 1AE6L 2I14A 3T8LA 4KTGA 4M5YH 1FA2A 1FNLA 1OAUL 3GO1H 3WD5L 3LCXA 3UXFA 3HA0A 2WOQA 1MQRA 1R0MA 3Q5YA 3SKMB 5IB3B 2PNDA 3T0VA 4AXWB 1G4SA 2J78A 3D2UB 3H4XA 1E0WA 1LLZA 3BGMB 3V10A 3PUDA 2PYEA 1J5DA 1E9ZB 5BOFA 2DSUA 1JHLH 2WLHA 4HEPA 4QRUA 2WSQA 5MKGB 4TNVF 3E0WA 3VGAC 1TPEA 1KYDA 2P24A 1JCJA 1H8OA 1I2NA 1UASA 1NQBA 4MCYA 4RFNC 2G97A 2HLAA 1XUZA 2AP2A 3BUQA 2HT2C 1DE4B 3K6FA 4DKAA 3NRQA 3HLAA 5EOQH 5D04C 3CB8A 3HPLB 1QWHA 3OTTA 3WLSA 1VADB 3HJEA 3WJLA 1I9JH 1QFHA 2APFA 4HUWB 3UWEA 2XZZA 4N0YL 4NQTA 3NZHH 3MV9B 2QIWA 3EXSA 5E08H 2VLKE 4X9FA 3BAXA 1QNVA 2OKTA 3EHBC 3G8RA 2ZUWA 3DVGB 3DV4B 4Q6JA 1RQHA 2BWIA 3N42F 4HZMA 1SFLA 4RFNB 4H26A 4KKLC 4C1KA 3IFNL 1ZE3C 4OF5A 3N15A 1Y6NR 1KRAC 1VFOA 5JMUA 3IDXL 4TNGA 5DUJA 1CTNA 3NEEA 4AGQA 3FUMA 1R3RA 1WZKA 4M6AA 3B4YA 5FHAL 1A3XA 4PSPA 3V6BR 1MSSA 3WH7A 2FEDC 2VSDA 4QRRE 1E4XI 5DRNA 1RZPA 1WGVA 4UIMB 3W39A 4KVNL 5EIQA 1NTHA 4ZFZB 1QLEH 5I79A 3T55A 4E9SA 4J3WA 1NGQL 4M93C 3QBUA 2P24B 4PYHA 3SYAA 5E70A 4JN8A 4NJIA 1TEGA 2CDGA 1UQYA 1Z9MA 1OIMA 1VFAB 4H2HA 4OVXA 4Z7NE 2J27A 2K9FB 2Y5QA 1D6EA 5TE6L 1RZ8B 2QR0A 3CHQA 1O6IA 3RX3A 1A50A 2VEPA 4GUPA 2Q8ZA 1JNNH 1PTDA 1OCNA 1EDGA 4WOQA 4K9JA 1G0CA 3FFSA 2BSLA 3ITYA 1VFBB 2FSEA 2XVBA 4LSPH 1W5MA 3S3SA 3CL8A 3CQHA 3DIPA 4LBUA 3V0GA 4YLQT 3MLVL 3S34H 3E2QA 1NAKL 5I2IB 2PO6A 3MTXA 3ZHDA 4ZSUA 1KN4H 2NQ3A 2EDOA 4GQBA 1ET5A 2QLVB 4AZHA 3B2MA 1EOMA 3SADA 5AZ2L 2E75C 5HDQH 3F2LA 3KCPA 4Y7OC 4I7VA 2QPSA 4JBRA 4L1DA 1MLCB 4JNMA 4O50A 5K93A 1AHMA 1MRQA 3SCMD 2F54E 2MCAA 3L4TA 3WO4B 1PJ9A 2X0SA 2JF1A 3AIEA 3TNBA 4Y4FA 3K2IA 4O02L 1XLAA 1NBVL 3IU3A 2VGGA 2X41A 5BUGA 2OSLA 5DK2B 1ONWA 2CBMA 2OXGA 4H3DA 1EBAA 1F7BA 4MVBD 3TJEH 3LB6D 1FJ1A 4CKVX 3MRDB 4QHMB 3M47A 1BEXA 1EQPA 5IFHH 3MJYA 3VI4B 4UDTA 4XGZB 4JRWA 2PYFB 3V0WL 4DVRH 1KCZA 3P0XA 1UENA 3K4DA 4N87A 5DD5L 3WO4C 5TQ2H 3VXMA 2AMGA 1E0UA 3D47A 3POCA 3HZYB 1SVBA 5KVDL 1DXIA 3VA6A 5HYEA 4IQHA 5DYOA 4IHOA 4KKQA 3O2VH 5A2LH 5KN5B 1SZGA 4IICA 2B5IB 1EX1A 3DRTA 1QAWA 2Y9RT 1CDGA 3CUJA 3SJVA 1JZEA 2NY1C 3GEFA 4GUOA 3AISA 5IQ9A 3ZYOA 2OGYA 2E7DA 1HJXA 2I26N 1OK0A 1K2DA 5G2WA 4ZFOL 3QQ3A 2Z1WA 4TLUA 4YSDA 4B6ZA 3MBFA 2CUAA 5FA3A 1UR9A 4MTVA 2VTFA 2VVSA 1DBML 2GGJA 4ZAKA 2P48B 3IGHX 2P80D 2B5IC 1E2VA 3QS2A 4P46A 3HVDA 5MERA 5TQ0L 1FCUA 2DPEA 3O6YX 1Q7MA 3J2PA 2YFOA 2AK4D 1EO8H 3S8GB 1HIML 4Z2LA 3DX8B 1F4AA 1BD2B 3RFZC 4JO1L 3C0LA 2YKLH 1WKFA 4HUUA 4TVDA 2A0LD 2B7DT 2GVEA 4E4UA 4G6AC 4GRLD 3FO2A 3WJMA 1EYWA 5F7DA 5JA8B 5CPNA 4IMKA 2X87A 4NO0D 4QR7A 4CGTA 2J55A 1JZ7A 1ZANH 4WU5B 3M88A 4E5XB 4JRYD 2F15A 1G6CA 4AXNA 5J1SC 1NFDE 2PTTA 4LHUA 2NV9A 3KBSA 1ZHNA 3GBMH 5E1AA 4JFOA 3IANA 4PUEA 4DLFA 1EKOA 4IZGA 3HF3A 4HHWA 1CFQA 4NRYA 4LKXA 5G4OA 2UZYA 1OYAA 2VLRD 1FZJB 2OO0A 4IP4A 3KOZA 4IKLA 1JPGB 5DZAA 3RE0A 1ZIBA 3PDDA 3H53A 4GMTH 5B8CC 2V4LA 4TUKL 2J88L 2N01B 1H49A 1A5LC 2KDGA 4JNYA 2QGDA 4A7UA 1PL9A 4JD4A 3PS7A 3QIBA 2ACRA 2FYVA 3BSZH 3SE6A 2Q9OA 5B7YA 1U58B 3JV5A 4XN1A 5IRPA 1TYEB 3HRPA 2IH1B 5KAQG 1TO5A 4PJFB 3Q4DA 3CVDA 1BEYH 3M07A 4HSAC 4QRPD 5LXGL 5EEZA 2R0KH 4M62L 1X7QA 2ZX5A 3BZ4A 3H9SB 3PAUA 4RISL 5AAWC 1Z44A 5CJOL 2OT0A 4JY8A 3KPNB 5AVYB 5J5EA 1GW6A 4IPIA 1BBJA 3R79A 4Q56A 2QUUA 1Q38A 3ILPB 1XQKA 2OZTA 3KOYA 3FU9A 1JZJA 1BQRA 3IJSA 4LMQE 1N67A 5DJZA 1U1HA 2EVJA 4ZJ9A 1H5BC 3EOBA 3P0GB 5EC1B 2C16A 1JL8A 4RDYA 4UTBL 1HHIB 3UTZB 3QZOA 3QC0A 3QZWA 2HRHA 3VAEA 1I1CA 2A6DB 2X4PA 3I02B 4UR7A 4WDTA 3RWIA 3L3IA 3ZYJA 2V0TA 4HD9A 3P4MB 4EPKA 1GJPA 4MFHA 3K4WA 1QSED 3W9ZA 3RI5F 4IXHA 5J57B 2TODA 2NVDA 4D6GA 1JF1B 3AABA 4RGNE 4ZX3A 1VKXA 4PUKA 3O8AA 3UP8A 3F58H 1S38A 4Y9PA 1A6VH 5J1AA 3TVMC 4Q4KA 2C1IA 3EB2A 3DI3B 3CHRA 4LV4A 2WCAA 4Z0JA 3HC4L 3DYOA 3GSQB 2PDGA 4CCEA 2C15A 3RYMA 6PAZA 5E9NA 4N2DA 4NNAA 1D5ZA 4UB0L 4ADSA 2PDXA 3LCLA 2AKRB 4TTGA 1G7MA 1LL7A 4PGJA 4U1HA 5MHBA 2Z7UA 4KIEA 4JPIB 1DQJB 1AOZA 3WXVL 1GGIL 3HE6A 2ZXCA 4HCRA 1HH6A 3FRPB 2DBLL 2WO2B 3NDYE 1VEPA 2G30A 4JZOB 1H51A 3PFRA 4IFKB 2AF2A 4LBEB 3O6MH 2HQAA 3PUOA 2CJ3A 1GVFA 4HZ8A 1RJLB 1UWQA 2O6FA 1FFNA 4LLQA 1EFZA 3AALA 4L4VE 1SUJA 4IM4A 2VX5A 4NSBA 1IC7L 1W1ZA 4HAGA 4Q89A 3F04A 4FI6A 4WKXA 4XX1G 3ULSA 4C8XA 2F74A 3LQZA 2IG2H 2A6JA 2ODHA 1R86A 1A2YB 1JRHH 1RA5A 2CA3A 4GKSB 4NN6C 3S1XA 3SDDA 3BIBX 3USBA 1KG0A 2RHEA 3BH9B 3C2AL 3FUDA 4KJWD 5ANME 4DESA 4HYTB 4RMUA 2X6MA 4IOSD 1BG9A 1G6RH 4WUUE 4ZUTB 3LGDA 4QPEA 4WOZA 2IDFA 2Y1AA 3MYJB 4C6QA 4Y5VC 1UB5B 5AAPA 3W7JA 1BLNB 1KGCE 4KETA 1XPYA 3VOCA 3VXRE 1GOWA 4GY7A 4S1FA 3OQ8A 4JYEA 2VL5A 4QXGL 3MXVL 4HFWA 4AWUA 1V3IA 1NCCH 3LKRB 3PJLA 1AR2A 1A5OC 4R26H 4P3CL 3OQRA 3RWGA 3GXTA 4HXAH 4AH2A 1PDZA 3F7YA 2IXVA 2A83A 1IXQA 4YIWA 4X9YA 3RVVD 2LT9A 2JEQA 3APDA 2XSKA 3BAEH 2W81C 3TYFB 3RDKA 2OMXA 1HXYA 1YBQA 3GHPA 2DH2A 3Q3GB 2CE6A 2Z0BA 1BIIA 3SPGA 3MV01 3QGKC 4ETYA 3TQPA 3SYCA 4M8UA 5F9OH 1MYRA 2OR9H 4DKFH 5LVEA 1SF5A 1D9KB 1SXAA 4FQPA 4PIBA 5CGYC 1S9KC 2ACQA 1W54A 1NMBH 3A3YB 3GDRA 3P67A 3NQIA 1PTAA 1VFMA 1MHEA 3GRWL 4IBYA 4XPHH 4S3EA 2IKIA 4U2YA 5C6PB 4UTAH 5I73C 4X98B 1K5NA 2HAZA 1PD0A 3UWUA 1HESA 3MKKA 1O6SA 5B22A 4B41A 4UFJA 2GPTA 4OZHB 1TX2A 1OF2B 1ZDQA 4HHAA 2A3CA 2GQAA 3L7EB 1I7ZA 4RE4A 3BWSA 1FFPB 2EIKB 1S9YB 3WFBH 2J79A 4RNRA 5C0CB 3PTKA 2IGLA 4DP6X 2ALDA 2C9SA 3IE9A 3CZUB 1JPFA 1KCUH 1PZ5B 4N0FB 4P2OA 1OTTD 4BUHA 4LDOB 1IEWA 3WF4A 4AISA 1FHUA 1WDQA 4WR3A 1LEGB 2NSQA 4WK2B 3PHSA 3DVIA 2VAAA 3TJIA 1R5IA 4R90L 2WLYA 5CPOA 1F9CA 3WTXA 1AKJB 2X28A 3QEQD 2HJKA 2A9MH 3IFLL 5G4EA 5JBEA 1NDGA 4WTZA 4ZX6A 2YXWA 3C6LC 5GRVK 2XPYA 1B4EA 1BVOA 4G8GA 5FI8A 1IEXA 4LLUA 5DJ0A 1P5UB 2BNQE 5C2UB 4LSTH 4PB0L 4YGVA 2KI6A 3L3DA 4N0UE 3TIEA 3SE4C 3H70A 2J6WA 2D22A 1CL7H 3UTPD 5IBXC 1THCA 1X5IA 3WN5A 3ZHKA 5KJ7E 1DBAL 3DK2A 2WNGA 4W1TA 2VH5H 2NY6B 3QW3A 1A66A 3EYFB 1OVDA 3D48R 1IBHA 5T33L 1KBGL 1S7QA 3MTWA 2CDEB 1GMIA 2JLPA 3C9NA 3WNKA 2P1FA 2ZSVB 2XHNA 43C9B 5GRYA 1MCBA 2PUQT 1KPRA 1HKWA 4AG0A 3WL1A 1LMKA 4Y5XA 5DDHA 1XGQB 2NXYC 3ULVH 4E3TA 5I1KL 4YEFA 5ICYB 4XD6A 5J9PB 2K9UA 2BX5A 4TQPA 4UANA 1YIXA 1RZ7H 3ABSA 1CTOA 4J28A 1OFAA 4WFHE 1N19A 3GSRB 4GCXA 2AQWA 1BPLB 1T7VA 1F0LA 3KYNA 3EJQA 1OEPA 3RNDA 2FWOA 1PIFA 1P7BA 2OTWB 1P7TA 2J66A 2D23A 3OG3A 2J1KA 1I8JA 5D05A 3SGGA 2DQTH 2DTMH 2R7EB 3F6JA 4UILL 3GLCA 4Y6GA 4C6PA 3NPZB 3DXAD 5AZUA 3BVJA 1ET8A 1NUFA 1TQUA 4RCXA 3NA8A 1K6WA 1WZ1H 1BAGA 5A3HA 1AW5A 3I85A 4GJTB 5EZPA 4KI1A 3OO2A 3G6JB 4JFTA 3C2EA 4F40A 1XCQB 5GS3A 1J1XL 1UWEL 2H6OA 2ZAGA 4RAUB 2OMTB 1EB3A 2OWXA 4ASTA 4DJEA 3X13A 2YD9A 4XOAA 1OX4B 4Z8FL 1T5KA 2Q6WA 4DWSD 1DJIA 1PSCA 3EDFA 3UPRA 2J2ZB 4QHKI 3P4LA 4FQJL 2CEQA 3F4VA 5DMGD 3G1SA 2GZXA 3U4BL 1UWIA 3NIDE 4H41A 1TV7A 3MW7A 4AT6A 1S7RB 4R4BB 4Z0SA 2W60A 1A7OL 3QUXC 1GZHC 2XETA 4K7FA 3PLYA 3V4UL 2FZNA 2R82A 1XI3A 3PZUA 4ZW5A 1NCJA 4GYKA 2IXQB 1KLFA 4CQDA 1GHFH 2OKMA 3QPYA 5A8GA 1J1OL 4IP7A 5ITFA 3VXGA 1XGYH 1JDAA 4C54A 4GUFA 1QRNA 2Q7NA 4M7ZC 4NFBA 2KAUC 2WM1A 3UF9A 3R06B 5MKGA 1TMQA 3FTGA 1EGJA 1NBQA 3MV8A 2EUZA 2BNJA 2BVWA 1WA1X 4YJZL 4APQC 4FXSA 3WY1A 3UGUA 3MNZB 3ITTA 5HR7A 3PGCA 2ZQ0A 4WUKH 3GUTA 2YGYA 2CDFB 1A5NC 2VSMB 1M42A 2VOTA 1XXXA 3L2IA 3QW4B 2YBRB 5CC3A 3FJ6A 4EI5D 4LYKA 5KYUA 5T5FL 4KDWA 1ID5I 4H9UA 1KTLA 4L4MA 1DTNA 2RALA 4C1NB 4F7EA 1HH9B 4FS9A 2J73A 1A4KB 3KM1A 3S4SA 2OMYA 1SGJA 1E5YA 2ZKYA 1ZFJA 2EXYD 2ZRXA 1KZYA 2ESVE 4M4PA 1BF6A 4G8IB 4ELMF 3CHCA 3S2NA 2YXVA 1TG8A 3P84A 3STLA 2HLFD 1ZP4A 2WGNB 3QJHA 2VRJA 3ARFB 1M7DA 1IC7H 4R9XA 2BMKA 4YDZA 4LLMB 5D5MB 4DP0X 1P5VA 1HG3A 4PMUA 2NUTA 1RV8A 3N43F 1KXVA 4PUUA 4WSKA 1XCFA 4Y2DD 4ZQKA 4Y8DC 3U57A 3M7SA 1AJ0A 5F9OL 4Y16B 4Z0BL 3SPHA 1BZ7A 2HKAA 3QOMA 1QVOA 4PL1A 2A4EA 4JW3A 1RUMH 1XPGA 5HAOA 4QLWA 2FATH 1MFUA 3N1GC 2EC9U 3KPMA 4DYEA 2QQNH 2PP7A 2E56A 5CGQA 1KM5A 3G5VB 3ESPA 2OZ4L 4R97C 4AEHL 1UR0A 2ROYA 1DLFH 5EO0A 4RKAA 3EWBX 3W53A 3HMXH 5C0GA 2HMIC 4WWID 4JY4A 5A8PA 4R26L 2CM6A 3LS4H 2X12A 1IGJB 5IIEB 1R85A 1QQDB 2FWUA 2X1QA 3B7YA 2I7SA 1VCAA 1ZK9A 5CKGA 2B7OA 1AQHA 3H6AA 3GB6A 1KGCD 4LS0A 4DY1A 4P48A 4Q9BA 3VU1A 3G5XB 3SSJA 1AD4A 5H4ZA 1YDVA 3FPYA 4D0CB 5CEZD 1GRWA 4NZRH 5IFJB 1HIZA 1JTPA 2IANA 2FO4B 1JCVA 3CTLA 5XINA 2OX5A 2YQ3A 3MLRH 2DVUA 1KTCA 4GYBA 5J06A 1YN6A 4H9TA 4EI6B 1ZLEA 1VBGA 1EA0A 5AUMB 4Y2DA 1ULVA 1J9YA 3FQWA 3F05A 5T1MA 1ZJHA 1X6LA 2QTEA 5IG7A 5IVXA 1JCTA 3KPLA 5AW7B 1MQPA 1OC6A 4G43A 1WISA 3HG1B 3TFBA 3PL6A 1JRCA 1VHPA 4XCCH 4MYWB 1MQKL 1X7IA 4CNUA 1ZGDA 1BXBA 1E4MM 3LZRA 1IGYA 5EOCL 3ZO9A 1RR2A 2QDEA 5CJXC 4WTZG 1R5VB 5G55A 1CEOA 2Q6ZA 1ZHLA 3EOTL 4NPJA 1URLA 4PRAB 4JANA 5IMOB 1SRDA 2G5WA 3TBVA 3KHDA 3NQVA 1T21B 2ICWA 3CUHA 3RB5A 1TO4A 4QG9A 3P3UA 5T33H 3R1ZA 3NL5A 5BW6A 3UCQA 4HEMA 3W7NA 5FW7A 4AUBA 1QTSA 3E12A 3MA9L 4G1EA 4D94A 3L2MA 3PDOA 3QJSB 2K6WA 2DEYX 5D96C 2RUSA 5EBUA 3P93A 1F3WA 4BFBD 4EIBA 4MXVE 4HK7A 4OLXL 4TUOA 3RO6A 5HI4D 5IJCC 3SFWA 1WS7A 2XRAL 5E6ID 5FM5O 5C09B 4IGNA 1UJPA 1LEIB 4X50A 4JEQA 1KB9K 4PN6A 1G7JB 3ATBA 3VMPA 2P52A 4DP8X 1A8ZA 1AQDA 2BS8A 2F5BH 1B6DA 3FO1A 5GGRY 3T0EE 4OB5L 4BZYA 4JTHA 2AITA 4OHQA 2Y22A 2BINA 1W5NA 3S88H 4LO9A 2WB5A 3NWRA 1G1OA 4B9GA 4H1ZA 4JPWL 3VFRA 5LZLA 2R56L 4X6BB 4ZUWA 2FX9L 3OR7A 1PCSA 1L3WA 5DJXA 3BQ5A 4NU7A 4JJOA 4K3EL 3UBHA 2JKLA 5E9AA 3CLMA 3PV6B 5FSDC 3RTQD 1MEXH 3ZR6A 1A14H 1IYXA 1ZPTA 4YS4A 3TNNA 3PY9A 4LEBA 4RMVA 1X8CA 2BOGX 3TZFA 1FAKT 2XWCA 4G2DA 1DQMH 3L3GA 4KV5E 5F7UA 1ADSA 1HIMH 3X2QB 4LARL 3MCYA 4KCUA 1HN1A 5EU6A 1SYTA 3MJ6A 4Z8FH 4ZMZA 2NWRA 4F7CB 1V7ML 4CD7A 2XWXA 1LWRA 1T0NB 1IFGA 1CE6A 1YZZA 1GONA 1ZVSA 2C18A 2RFXA 4RIRA 3WQDA 2NY2C 1IAKA 2BSTA 3M0ZA 1A5CA 3AICA 3O9WA 5DS8B 1U8NA 4J3OC 2XZQL 2AXGB 2IV8A 4O02B 4U1MA 3K13A 4PMVA 4U1JA 1R3WA 3EO1A 1W5QA 2DWTA 2RACA 5AZEL 4TVCA 4XO8A 4DP5X 3FYYA 4IPNB 4QOKB 3B2PA 1U6AL 3QZWG 3NJKA 4BF7A 1UM5H 3M8OH 1UA6H 2G2RB 1YNTF 5E8DL 2B31A 4JS3A 4NT0A 1RHHB 4AF0A 4MLIA 1FZOB 3HM7A 3GXMA 1XSKA 1F73A 3GU2A 1V10A 1MCQA