3H55A

Crystal structure of human alpha-n-acetylgalactosaminidase, complex with galactose
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
387
structure length
387
Chain Sequence
LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 1.9 a structure of human alpha-N-acetylgalactosaminidase: The molecular basis of Schindler and Kanzaki diseases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Alpha-N-acetylgalactosaminidase
total genus 127
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3h55A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3h55A01
2PWEA 2ZWYA 3GXIA 4WUIA 3TC7A 3NL2A 1K3UA 3PAJA 4QITA 1E3XA 4O50A 3EX6A 4ATWA 3USBA 1EA0A 3CPUA 1UA3A 3LTPA 1ZNNA 3WNOA 1ML1A 1JD9A 3C2VA 4NZJA 2ZTJA 4O0ZA 3DAQA 1KWKA 3OLEA 4B9YA 1FDYA 3EWBX 3LHUA 1GOXA 2ZZ4A 2DIJA 1CXLA 1AW1A 4O12A 2A7RA 2FH8A 3L4UA 3PG9A 1KV5A 4WXYA 5TBOA 1H7OA 1WA3A 3O06A 3PUDA 4TIMA 3DDFA 1RQEA 1SZGA 1XI3A 3BAIA 1EP3A 1VFMA 4JCMA 5DBTA 3BVUA 1KM3A 1XC4A 3FKKA 3HIJA 1UUOA 4BFAA 1QI3A 5HUOA 3S5OA 1CXKA 3MBFA 1SW0A 4U2ZA 2QCDA 1KTBA 4X9YA 5U7SA 4JX4A 4O0KA 3MJYA 1R75A 2VELA 3LHVA 4H6KA 4P2VA 1QW8A 3TQKA 2NZLA 2GVGA 4S2CA 1BEUA 1H7RA 4UZUA 1KFEA 4JD4A 1SFJA 3KEHA 2Y2WA 3KL5A 4LVBA 1K7EA 2FLIA 3F4WA 3S8HA 2JBMA 1DJNA 1FCUA 3VGGA 3PBYA 1OJXA 2ZX5A 1LDCA 3TAOA 1PS9A 2WPGA 1TCMA 3EDKA 3NQ6A 4AMXA 4O14A 2ISSA 2YYTA 1Z42A 1XD0A 2F7RA 1QPNA 3TK7A 2YGYA 3IRDA 2YXGA 3UEQA 4ADUA 1P4CA 4K8HA 1ZAHA 2CLOA 2XN2A 2ZUTA 1W5NA 3DENA 3CIXA 4X2RA 1ZAIA 3BC9A 3CV5A 1JI1A 3T44A 1TRIA 3ZS4A 4BZYA 1H63A 1V3MA 4ZVJA 3CTTA 1B3OA 3W70A 5EBUA 3WY2A 3RU6A 3BSHA 1JUEA 4WQ6A 1DQWA 1Y0EA 4IMDA 2D0HA 3BVTA 1L6WA 1JGIA 2P1FA 1MEWA 1Z41A 3VMPA 4JFWA 1TV8A 5HWJA 1T0OA 3DFPA 1JFHA 2DZPA 3ZT5A 4OU1A 3PB0A 3S1WA 2XVLA 2ISWA 1EIXA 1SSDA 2E68A 4PEEA 2VENA 5KZMA 5HR6A 2J6XA 1ALDA 4S1FA 3AMKA 4FIQA 2PWGA 5D38A 4EWND 1Q3NA 3LXCA 3P84A 4XKYA 1K8XA 4UTJA 2GJPA 1X8FA 1EO5A 3G0XA 2C13A 2BXZA 5CZTA 2A1YA 3QGVA 3F4NA 3ATYA 1YDOA 3LRMA 3P67A 3LCGA 2WKJA 4H4IA 3M5YA 1OFEA 2GQAA 4UQAA 5ABTA 4HA1A 3W1LA 2VFEA 4RZ5A 3WDIA 3PWAA 1JCXA 4JTEA 1RPKA 2V81A 3NPVA 2Q3OA 3VNDA 5IBXA 3LHYA 3VM7A 3WDHA 3PSVA 3I7SA 3CM4A 3BLKA 1G4SA 2Y89A 4QM1A 3SECA 3UYCA 1OT1A 3C8FA 3BGJA 3V75A 1I2RA 4GC4A 2ZX6A 3EXRA 4UTTC 4HT3A 4HPXA 1H60A 2YSWA 1SO6A 3P82A 4HNTA 4RV8A 4XBSA 2OW7A 4E0CA 3W87A 3RK8A 2EF9A 1HX0A 4XB3A 1TJPA 4K36A 2WNZA 5A5WA 3VGHA 1GVFA 3F1QA 2VC6A 2OSWA 2ZRVA 2BY3A 4CQ9A 1QCWA 1QI4A 3TQ0A 3LDVA 1JRBA 3L4XA 4PSRA 1PIGA 2H6RA 3NXFA 3HB9A 3QRHA 3TA6A 3Q37A 4CGTA 3EXTA 2WCSA 4YCPA 3GXTA 2V0TA 2NLIA 3R5EA 2R8WA 4TO8A 5HNRA 3EWYA 1EEPA 1WZAA 2ZUVA 2ZZ1A 1UOKA 1A50A 4MVAA 5L6UA 1OX4B 3G8EA 5K9XA 3W1RA 5K4XA 1A5BA 2FYVA 4UNIA 1ICSA 4UR7A 3TQVA 4CNNA 1MEIA 1QOPA 2QUVA 2R14A 1MW2A 4U3CA 3LM7A 4LQ1A 4HOXA 1FX6A 4JDYA 4J3WA 4OIFA 1Q4NX 1XL9A 1VHNA 3UPWA 3UD6A 2I9EA 3GAYA 2ZZ5A 1H1YA 2ZA3A 3TXZA 3KE0A 3DFQA 4MJZA 1BVNP 3QPYA 4UCGA 2J9XA 2QCHA 3NA8A 4FX8A 3UWQA 2WKGA 4AHOA 2QJIA 1NVMA 3T78A 1JG9A 3GAKA 3S1VA 4KFPA 1LWJA 1YDVA 3BGGA 4LVAA 4RJEA 3BUDA 4O1CA 1O60A 3CIWA 5D03A 3DKJA 1OK4A 5DO8A 1W37A 1F74A 1TQXA 2J9YA 3G3MA 1LLWA 4GI6A 2F84A 5F2IA 1GZGA 3HG4A 3G0SA 2X1SA 4M6QA 2WC7A 3BPWA 1L2UA 2FHBA 1L6SA 4QNWA 2RDWA 4JTTA 3L4WA 3VKJA 4ZL1A 2VFHA 1KBBA 3P81A 2VR5A 4NVTA 1GCYA 3EJPA 1KV8A 1PPIA 3IJ9A 3A23A 1OX6A 3CZSA 2HS6A 1GQNA 3C2FA 3MW7A 2NUWA 4HNUA 1BTMA 1JAEA 3VI2A 1XCXA 1TPC1 1J2WA 2B7QA 3W22A 3VGBA 1TMHA 3FJ6A 3W7EA 2PRLA 5EMYA 4JTIA 1XH0A 2J9ZA 2A85A 3O6CA 3PSWA 3OBKA 1X1ZA 4MYAA 4AH7A 3L2MA 4M6PA 2Y7EA 2Z0IA 2YA1A 2I1OA 2Y24A 3LOTA 2V2HA 3BCFA 3W75A 3R8RA 1W5QA 4IJBA 2DIEA 3G1HA 3L67A 1OFRA 4N4QA 1WE5A 2QPSA 4KWWA 4CKQA 1HUVA 3W73A 3G3DA 5LHEA 4WD0A 3NQGA 2CFFA 3NQEA 1LOQA 3GR7A 2Y62A 3QJAA 1XSJA 3QC3A 3SR7A 2FFCA 3M5ZA 1KBJA 5AC8A 5CZJA 4AHQA 4H8HA 5A6LA 3VU2A 1H61A 2ZQ0A 1RQHA 2EEXA 4N9BA 2QMJA 4UFHA 3GR8A 3SJ3A 3CLWA 5CLTA 4GFSA 1VAHA 2AQWA 4JXCA 1KTNA 5I23A 1P0NA 2F18A 2CZFA 3L21A 1AMKA 3M44A 1YTDA 1JQVA 3A6OA 4LT9A 5H91A 2GQ9A 3BVJA 1M53A 2BXYA 3L2IA 2E8YA 3FS2A 3D4YA 1N55A 3N9SA 4K7VA 3QMRA 2CLIA 2NWRA 3C2EA 5H2ZA 1TPDA 4NT0A 1UD2A 5G2HA 5KZDA 5AYYA 3C61A 2D3NA 3L66A 1I2NA 1YLVA 2C1HA 4MB1A 1L9WA 3HJZA 4O1BA 4UQCA 1DHPA 2TSYA 2WCGA 2ZUUA 3FLUA 3ZWSA 3BVWA 1Q6LA 1ZFJA 4J3UA 3IVSA 5FF0A 3JR2A 3EKZA 4MZ1A 3IGSA 1G5AA 5J5DA 3VSVA 3HZ3A 1SPQA 2NV2A 3LCWA 3WJSA 1KLZA 3W37A 1JR1A 4CNOA 4IQLA 4OT7A 2RKXA 5AHIA 4IWWA 2HS8A 2VUYA 4U4MA 4RKAA 3P60A 4POCA 1QPKA 4NZFA 1DQXA 1VCFA 3W2NA 3DX1A 1LBLA 3BG3A 4JX6A 3L5AA 4YMZA 1LYXA 2C0AA 2KZHA 1I8JA 3W1AA 4X0NA 2EGZA 1FWRA 3EDDA 1QO5A 1KM5A 1QWNA 7CGTA 3DZ1A 5GVJA 2IGTA 1XSIA 2C8NA 3RF9A 3OA3A 3GKFA 4IPJA 1GJWA 3QQ0A 3WNKA 4UCFA 5FEWA 5DELA 3M43A 1WX0A 1FUYA 3M47A 4BR1A 1F5ZA 2BTMA 4WXZA 3M7WA 4MAZA 3W76A 3BH4A 4S2BA 2ZDRA 1XH2A 2GJRA 4GRSA 2ZRUA 4QAIA 1W3TA 1VZWA 4O10A 3SY5A 4HOWA 3TH6A 2NSXA 3KWXA 5C55A 4FNUA 1QR7A 2BHZA 3PUEA 3YPIA 1OX4A 4FXSA 5LNUA 3TUUA 1R47A 1WDWA 2OMAA 1OF6A 2CLHA 1JQXA 3OVRA 3NGJA 3QEZA 4L4MA 3W1XA 3W1MA 2E6FA 2FB2A 3ATZA 5TQLA 4ZMGA 2OSYA 2C18A 1GTEA 1UASA 5AFDA 4JTJA 3AMLA 4AF0A 1BPLB 1J0KA 1KM1A 3HGOA 1I2PA 3E9AA 2G97A 4HPHA 1OG0A 3MHUA 5EYWA 4XUGA 5A8GA 4MOZA 3TSMA 4AIEA 1VYSX 3SI9A 2QLYA 1KXVA 4OWGA 1PEZA 1HL2A 3K1DA 2JKAA 3LHZA 3A5VA 3ZO9A 1OFBA 3WENA 4K8EA 3WK0A 2A7PA 3A47A 2WVUA 1K7FA 3P8IA 1F6KA 4MY8A 4RZ6A 4Q32A 2ZRZA 1BWLA 3S6DA 4DF2A 1DL3A 1D3HA 2ISVA 5F2GA 1RD5A 3P7YA 4W93A 1IXNA 3E96A 4Z0SA 2VEKA 5HINA 4IUOA 5HR7A 2YFNA 3SZ8A 1OX5A 5AYZA 5E0FA 3W6YA 3B04A 3G18A 2ZZ3A 3BAJA 1UA7A 1TSIA 2NX9A 1U83A 1QMLA 2YCEA 3NAVA 4YCOA 3W74A 3R13A 3P61A 3K30A 5CG7A 4K6AA 2X2IA 5K4ZA 4GI9A 4AIOA 3VSUA 1BG9A 3M41A 3I7RA 1ZALA 3MO7A 4ML9A 3LRKA 2VKZG 5CGTA 4N9DA 5LGZA 2F2HA 1YXCA 1THFD 2CLKA 1TPEA 1P6WA 2FH6A 1ZJBA 3RIKA 3E12A 4H3DA 1MXDA 3ANYA 1B2YA 4PCTA 1T99A 4PCFA 4O15A 1C8QA 4A2RA 4Y6GA 1TQUA 1YDNA 5U4NA 1VJIA 3V1PA 1RP9A 7TAAA 2QDHA 1VJSA 5E70A 3NDOA 3TU9A 2V3FA 3NR0A 2D3LA 4AF0B 2EPHA 3FA5A 4FB7A 5T26A 2X2HA 4A29A 3H55A 3ABOA 2AAMA 1LOLA 2EO7A 3AO0A 1HFBA 3O16A 1CW2A 1B9BA 1W1ZA 2EADA 4AYGA 4YWIA 4O54A 1FCBA 1XGZA 2VFIA 5EPDA 2E9BA 3JRKA 2F7PA 3GNNA 1JCYA 3OLGA 1R2SA 3Q58A 3QW4B 4Z08A 3KL3A 4WX2A 5G4EA 3T55A 1HO4A 2CLFA 2WNNA 1UH3A 5A2CA 4E2DA 1KB3A 3W7DA 4AAJA 4Z1BA 3VFLA 3TDFA 2C19A 1PZ3A 1H3GA 5D05A 3WK2A 2X2GA 4UC5A 2Z1KA 2DZXA 2CWNA 2QUUA 1IZKA 1C29A 4CN4A 1XM3A 4YLWA 3U2OA 1WBHA 1F76A 3HQ1A 3I68A 1JCLA 5I3FA 1CXEA 5KTLA 2E5CA 5F4SA 3GXDA 4W9TA 4O17A 3NM3A 3GX9A 2BX7A 3WY4A 3W7LA 3HPSA 1ONRA 4C1LA 1JXKA 3E0IA 3EDEA 1KBIA 4LV9A 1OFDA 3EJUA 4WF7A 5E9AA 2Y88A 5DY2A 4Y9AA 1IV8A 1SO4A 3WK3A 4GUJA 1H7PA 4GUGA 1LORA 2VOMA 5E6YA 5D33A 2GJLA 2VRQA 1MWOA 1QNVA 2E6YA 5EKYA 3BVXA 1A47A 3CZEA 3TOPA 4PTNA 3BMVA 3CZLA 1KGWA 3MP3A 1CLVA 2TPSA 3BW4A 3MUXA 1TCDA 1SUXA 4MY1A 4FF7A 4X9SA 2YIHA 2P10A 3M16A 1GWJA 3HJEA 1OABA 2ZA1A 4HSOA 4JY8A 3BAXA 2YDAA 1LWHA 3A9IA 1GG0A 4WY0A 1LCOA 1TTJA 5HDRA 2R91A 2OSXA 3DBPA 3LV5A 5F1VA 1PIIA 2V3DA 4O1DA 1EP2A 3LCLA 3L2LA 3WNMA 3BUPA 5G5IA 2VEIA 3FJLA 1PHWA 1SW3A 3B06A 2G96A 1NM9A 1KM6A 1UD3A 1L6YA 2W6RA 4O28A 3TCEA 3W83A 2E5BA 2ZZ7A 2X2JA 2HSAA 4O16A 4JFUA 1PIFA 1SU5A 3MYPA 3KL0A 4ZQRA 5HUPA 1PJ9A 4FNTA 4E2OA 3CT7A 3KVJA 1AQHA 3TONA 3BLFA 2ZZ2A 1VYPX 4ZQCA 2YA2A 1QWGA 1UKQA 1F73A 1KM4A 4JYDA 4KFNA 3DFTA 1V5XA 4GJ1A 3MI6A 2WSRA 3L4TA 2DJLA 2XWDA 2YOCA 1JCNA 4G1KA 4ICNA 3A21A 3P80A 1H7XA 4O57A 4UFJA 1ZY9A 3W2JA 4CVWA 4UTHA 2YX0A 3NPUA 5K2ZA 1OFPA 3VGEA 5KINA 1CGTA 1KFKA 3R12A 4JTHA 3EJSA 1J0HA 2IQTA 2WSPA 2CU0A 4AMWA 1HTYA 3CHVA 1MSSA 2WPBA 4PA8A 5EY5A 1G67A 5DN1A 1P5BA 2Y70A 4GXMA 1TQVA 1TV5A 3CTLA 1GEQA 4MFDA 2NWSA 4PODA 3KHJA 2V8ZA 1W5MA 3ABQA 3PG8A 1NF0A 4FX6M 3WFZA 1YPFA 1K03A 1XUZA 1PE1A 2FJKA 3CC1A 3CZKA 4FLSA 1BKSA 1UB3A 4FX7A 2NX3A 4UXDA 3GK0A 5FEXA 4N02A 3QYQA 2QCLA 3ELFA 1TJRA 4ORIA 3PB2A 4NQ1A 1KW1A 3TJLA 1DJQA 3CWOX 2B0MA 4GINA 1DOSA 2PE4A 1OF8A 2QCMA 5DY3A 2EQDA 4RR4A 1RPXA 5HJLA 3UY8A 4ZZ9A 2RFGA 1Y7VA 3S5ZA 3S2CA 5CSSA 3W7OA 2FQIA 1OYAA 4JS3A 1KXQA 4JFSA 1SMDA 1CGUA 1YXYA 4TMCA 4NNBA 2G3MA 3W1PA 2ZRXA 4R33A 2Z6IA 4JICA 1AVAA 3TTYA 3NVTA 4LC8A 3PUOA 4J27A 3BVVA 3EX3A 2PCQA 2EAWA 4JY9A 3EKLA 1IXOA 1U5JA 4WLCA 3VM5A 3TROA 3QSTA 1I45A 1AL7A 4AVFA 2XVKA 3UWUA 3L0KA 6CGTA 3WJWA 4KKXA 1FCVA 3NQFA 2I14A 3K8KA 4N9EA 3W7PA 4E38A 2YZRA 2ZXQA 1BAGA 2TYSA 2A7NA 3RILA 3F03K 3VMOA 2QPUA 3LPOA 3TTSA 1NFBA 3FKRA 3HPZA 5AC7A 2X1UA 1AQMA 3LTSA 3STCA 1Q6RA 3TW6A 1JI2A 3DHDA 1AW5A 1AL8A 2C6QA 3WJXA 4O53A 5C6MA 3D4ZA 2OYKA 4JIPA 3LI0A 4IGHA 2F7FA 3TSDA 5CSRA 4UFLA 3KVLA 4Y90A 1TPFA 2A4AA 3GB6A 5DCBA 1EH9A 3W88A 2FPTA 3O15A 3RLUA 4MLJA 3N73A 3KRUA 3G8RA 2Z2UA 3GIYA 3N34A 2C7FA 1H7NA 3LB0A 5K9CA 3VX1A 8CGTA 3CGTA 2Z1BA 2NT0A 3M6YA 1XUUA 1T96A 1CDGA 3ZSSA 4K39A 3DC0A 1ODUA 4J7RA 1XKYA 4U28A 1XCWA 3NQ8A 3UG3A 3N2XA 1ZJAA 3I7QA 1OGSA 3NPWA 2NUYA 4TR9A 2ZX9A 1ME8A 1S3HA 1PVNA 4XKYB 2O7QA 4O13A 1R33A 3WJZA 2F1BA 3IEBA 1LTDA 1W9XA 3IIOA 5I24A 5L9FA 3DX0A 4FLOA 4KWVA 5D32A 3CPRA 3W3OA 3M07A 2H3DA 5CKSA 3CZGA 3UXAA 4PL1A 3KRSA 1A53A 3ZT6A 2VFFA 3GDTA 3OEXA 2TMDA 1MVYA 4EVZA 5DFAA 4UMCA 1G9HA 3DKLA 4XTDA 4NI3A 4O11A 3NQVA 2F7QA 4GUIA 4AMAA 1GVSA 4LUJA 3ZR4A 2ZICA 3RFAA 4NXKA 5BRQA 3N2MA 3G24A 5I3HA 2RH9A 2WVVA 1QO2A 4ALDA 3W7JA 4HHPA 3W2KA 7TIMA 1MFUA 2GVLA 3BLEA 3BG5A 3D51A 4LUIA 4XWUA 4LVDA 3W7NA 1OFAA 1WOBA 1P0KA 4OKDA 3W7KA 1AMYA 4UTTA 5F2LA 3WY3A 4I7VA 3HGRA 1GVRA 3L68A 4FEZA 3TSBA 3C4UA 4HSNA 3QSRA 1H1ZA 3DFNA 1XV8A 1I4NA 3S5NA 4GO9A 2AGKA 3BARA 5D2VA 3INPA 2DORA 4FIRA 1QAPA 4A22A 3NL5A 1KXHA 3EEGA 3N14A 2QKFA 1TIMA 2F61A 3WDJA 1MXSA 1O5KA 2TRSA 3T40A 4U2YA 1S46A 2FPVA 1OSEA 1WZKA 1EX5A 5AHEA 1PV8A 1RVGA 4M7SA 4H7VA 1R2RA 1N8FA 2JK2A 1VS1A 3EDJA 1ZHAA 2YJQA 1I2OA 1RZMA 2QCGA 3EB2A 3ABSA 1DVJA 4LRSA 2WV8A 2AMGA 4PEKA 1IGSA 2OYMA 4JCLA 5CPNA 3FOKA 3WEMA 1CYGA 4FNRA 2CLMA 1TQJA 1V3KA 4ADTA 3S1UA 1FWSA 4LY8A 2E8ZA 4HN4A 1SO3A 3N9RA 2B7PA 2JKEA 5AB3A 2BLEA 3L4VA 3TX9A 5E6ZA 3VO0A 1K8ZA 3ZFHA 1JRCA 3KXQA 4IMGA 2XFWA 3OVQA 2YR1A 4O18A 3BCDA 1UD6A 1XBVA 3N3MA 2D0GA 1O4UA 4MIMA 4K37A 3BW3A 6TIMA 4MPQA 4JFVA 3VGFA 2OW6A 4DF0A 2CZ5A 5LNVA 1C8VA 4Z1CA 1F05A 1VIWA 4PFMA 5FESA 1LROA 1B57A 3EJQA 3LI1A 1JL8A 2RDTA 1KCKA 1V3LA 1LRQA 1HXKA 1AK5A 1XBZA 2H8ZA 4M8UA 2Z6JA 3CB8A 3HBLA 3MI3A 1VFOA 2B7OA 2ZBTA 3DI0A 1NF7A 1H50A 5SWUA 1DHKA 2A2IA 3C3NA 3G22A 4YXGA 3S1XA 1VGAA 5EA9A 2B7NA 5D2TA 2JGYA 4DO6A 4JL2A 3O6DA 4AWUA 4LC6A 3M0ZA 1TPUA 3STGA 5HXMA 4GUFA 3CEPA 1EUNA 1O7DC 1TO3A 5AOUA 2QAPA 5E0KA 2J25A 1VFUA 1TV7A 2A6NA 2DZWA 1FXQA 3W7RA 3PULA 2QF7A 1W54A 3GXPA 3G1SA 3BK0A 2FIQA 5DBUA 2ATMA 2JGQA 4FLRA 4JX5A 5FEPA 4BF9A 4UMAA 1VYRA 4BA0A 3H54A 3LLDA 1K7XA 5BMWA 2BHUA 5AN7A 3THQA 1TRDA 3C52A 3NEVA 3MYOA 4J3VA 3NPXA 2XN0A 4UTIA 3LERA 3CLMA 3HPXA 1PCKA 1TPB1 2C3ZA 2CZEA 3DDGA 3VNZA 4JR5A 2Y61A 1KA9F 2CLEA 4WOQA 3WJYA 3S42A 4LTSA 3BAWA 3OLDA 4GWEA 3G1AA 4UQDA 4BI6A 3LV6A 3DGRA 1WV2A 1TTQA 3EJRA 1B0IA 3KVMA 2YYUA 1G4EA 3K8LA 4IXHA 4JDBA 5IM51 2CPUA 5CPLA 3LCXA 3MHGA 5J5RA 4J3TA 1E51A 1W5OA 4TU1A 3II1A 1SR9A 4NNAA 4O19A 3EWZA 2B4GA 3UERA 1DKWA 1T8XA 1U33A 4U31A 2ABBA 4AW7A 3DFOA 1FDJA 3NQCA 4ZQOA 3TR2A 4PH6A 5LGXA 1ZCOA 4Q4KA 1HWWA 4MYXA 3QH2A 2A0NA 4OQVA 2D0FA 3B4UA 1KXTA 3P62A 4M56A 1CXIA 5I3IA 1J0IA 4OV4A 1PL9A 4O8RA 3IJ8A 1JXJA 5AYXA 3NQDA 4N6EA 2EKCA 1Q6QA 3B03A 4LS2A 5EL1A 1GVOA 1YXDA 1DTUA 3L5LA 3NG3A 1FXPA 1NEYA 4RCXA 1TB3A 1TPH1 3RLVA 2OT0A 3PY2A 1E40A 3C56A 1LBMA 5D2WA 3HMJG 3DI1A 2FPYA 4FXRA 3TMQA 4ZQNA 3PC0A 1EPXA 3BUIA 1XFBA 5CGMA 1U30A 2V3EA 3QFEA 1TQWA 1OT2A 5AC6A 4I7WA 4JTGA 5F4WA 3BSGA 1QOQA 3EX4A 5LHFA 3W2LA 3N19B 2Y6ZA 3E49A 1W0MA 3NL6A 1EP1A 3GTNA 2ZX7A 3GVGA 3PR2A 5FI8A 1NSJA 2FB3A 4CN1A 2E77A 4PCSA 3TFXA 2XVGA 4YL2A 2F7OA 4JEQA 5HWNA 1OHLA 1FWWA 4NJJA 3TNOA 1R30A 3EWWA 1SW7A 2J27A 3P5YA 3UWZA 1DV7A 3ABRA 6TAAA 3QMSA 5MHBA 1IXPA 1SZEA 2E6DA 1BVZA 2XIBA 3IIZA 3W07A 4BK9A 1EHAA 1PS3A 2ATSA 4JFTA 2TAAA 2VRKA 1CX9A 1KGXA 4FO4A 1A5SA 3LLFA 6ALDA 1H62A 1SZFA 3R2GA 4LW7A 4R7JA 5C54A 1CPUA 2NX1A 1J0JA 2Y7DA 3IIXA 5F4XA 3RNDA 1VB9A 4OHQA 2VEMA 1CGYA 3HOJA 3FW6A 4AWSA 2QCNA 1KFJA 4AYSA 3WNNA 4QQ3A 1LM1A 5FF3A 3EDFA 2DZUA 2FHFA 4J9JA 4RLIA 2YW4A 4U33A 2WSKA 1QFEA 1G94A 3GYEA 2X16A 2QDGA 5EMUA 4X22A 3UWWA 4DO5A 1KFCA 1G7VA 2V9DA 1UKSA 4JTUA 1XDMA 1XDLA 4KFOA 3ZQ9A 2V82A 2EACA 2ZE0A 3NZ1A 3P8JA 1A5CA 3G1YA 1XSKA 1Q6OA 1VHCA 2DU2A 4AEEA 3UG5A 4IMEA 4J3XA 4A21A 2NXGA 2E09A 3THAA 4LS1A 2CHNA 2NV1A 3NOEA 4M7TA 5LNRA 1JCJA 5LZLA 3NYZA 2VNCA 2VT0A 2GJNA 3L0GA 5BW6A 5I0DA 1OVDA 2G5WA 4L4LA 3D50A 1MZHA 2QJGA 5CGQA 3O07A 3ZR6A 4IPIA 3K8MA 1WPCA 1SSGA 3UWYA 3W7QA 3FIGA 4IX2A 3SSJA 4CQ8A 1W3NA 1IIGA 1WZMA 1R2TA 1V3JA 1WAUA 4BI7A 3DHPA 3G1XA 3KOFA 4OV9A 1EUAA 4NNCA 4UFMA 4LVGA 4WSKA 1JULA 4AXKA 3A24A 1CXFA 1R46A 3DX4A 3MMTA 3NQAA 3MP5A 1S5WA 4HIBA 3VCRA 4UNLA 1FY6A 3UZ5A 1U2YA 5D2XA 4WY0F 1E43A 4HNNA 1ZENA 3W1UA 3VGDA 2H8XA 3BUQA 3UWVA 1EWDA 1GYNA 1LLZA 2ZUWA 1ME7A 2DP3A 3CQ0A 3BMWA 4XQ6A 4CCEA 3WN6A 5LSMA 3UZJA 4DBEA 1WBJA 4EIVA 2CLLA 1QPOA 3IIVA 1X6UA 1HL8A 1KFLA 1XBXA 2BZNA 2C15A 4R34A 3SFKA 2GQ8A 1QWUA 2DJXA 4CN6A 3BUBA 4J28A 3WELA 5I3GA 5G2WA 3BAYA 3W7CA 1XD1A 3FAWA 2WO5A 1WYIA 5C2XA 2VEPA 1OB0A 3VSTA 2EHHA 1GT8A 4KMQA 1CGVA 2OZ0A 3GDLA 1M7OA 4DPQA 1OYCA 2H3BA 4MZ8A 3GDMA 4LU0A 3QZEA 3Q2DA 1B4KA 4OBTA 3SGZA 3W38A 3B0UX 4UFKA 1KGUA 2FGZA 2GVYA 1WZLA 5TD4A 3UCQA 3W7HA 1PZ2A 4WJEA 4IMCA 3WMSA 2V2DA 1RP8A 4GUHA 4HP5A 4LPCA 1JD7A 4CNPA 1NAL1 3T7VA 1G4TA 2ZUSA 5FF7A 3A22A 1K8YA 3L4ZA 3EWXA 3NQ7A 3BLIA 1VC4A 1JF5A 4MFEA 2GUUA 4FMVA 2QAFA 5I3KA 3MP4A 1FWNA 1XCFA 1NOFA 1KM0A 3O8AA 4GO8A 1VLWA 3TKFA 4EF8A 2DH3A 3HG3A 4AEFA 3BG9A 1KFBA 5CPOA 5A2BA 3MBDA 4J3SA 3W2UA 2V30A 4TX9A 3W85A 3U6WA 3WNPA 1EO7A 1SMAA 3DXIA 1JUBA 1BWKA 3LCFA 5D09A 8TIMA 4UTUA 3L9CA 4QAWA 2J88A 4P61A 3WY1A 2WSQA 3LBCA 2ZCGA 4Q33A 3Q94A 4DEFA 1N7KA 4GQQA 1M7XA 4AWTA 1Z44A 3WNLA 1AG1O 3HO8A 3L0NA 2XN1A 3PBWA 3GDKA 2H90A 3UPBA 2D73A 3CEUA 1OFQA 3WK1A 2ALDA 1FWTA 1JIBA 2O7SA 1W3IA 1UD5A 1FDZA 3IGXA 3W86A 1MFVA 2PWHA 5F7UA 3LHTA 3VNYA 4JTLA 4JYFA 1DORA 3M5VA 5LNSA 4O4VA 4CCCA 3HG2A 3TE9A 2Y7GA 2R94A 4O1AA 1D3CA 3FYPA 3A5FA 2Y4SA 2Q8LA 5E93A 5KZEA 1TMQA 1M5WA 3BLBA 1VLIA 3DH7A 3UNDA 4HNVA 2WJZA 5KITA 2DZVA 2G95A 1XH1A 1OFOA 5G2IA 1RV8A 1BLIA 3BAKA 3PBVA 3NL3A 2RDUA 3GKAA 4K7YA 3DHUA 3ZWTA 2Y5EA 1CI1A 1G69A 4M19A 4NX0A 2NXIA 4JTSA 1G1YA 2EAEA 1E3ZA 4FNQA 4N2YA 1JCMP 4RK8A 4X3ZA 3IIPA 3W2MA 5FF2A 3KVKA 2ZWZA 3CU2A 3OVPA 2BXVA 3C2RA 5BRPA 3TV8A 5DCEA 1KWGA 4FNPA 2QEZA 4AHPA 5A2AA 4MLRA 4I7UA 5I5RA 5FF4A 2ZXBA 3MHFA 3RMJA 4FHAA 3D0CA 3M5XA 4DBDA 3W84A 4JTFA 4CLMA 3BLPX 1TQTA 1Z32X 3EJTA 3VE7A 4JIQA 4WZHA 2QMKA 3HGSA 4H8UA 5KMYA 1KM2A 2ZRWA 3LHWA 1W31A 3PBUA 3L5MA 4UIOA 4UTWC 1ZAJA 4UQ9A 2C16A 5DXYA 3EXSA 3S5YA 1EA9C 2ZRYA 3KRZA 2D2OA 3FAXA 4BWLC 2WANA 1VCGA 3UXDA 4LNYA 2FDSA 1WO2A 3DX3A 5A6MA 1LRNA 4FNSA 3G1DA 3B05A 4MY9A 3NQMA 5G4WA 5CLWA 2E1DA 4H2CA 1OYBA 2V5LA 1X7FA 5TIMA 2WVSA 3C0JA 4UQEA 5LKYA 2X1TA 2QCCA 2YW3A 4RX0A 2ZXAA 3GXNA 1JDCA 4UUIA 1GYLA 4XZ9A 2BHYA 4QSHA 1ZJIA 1CGXA 4UTMA 5KEZA 4FLQA 1FCQA 3FEMA 3GLCA 2ZZ6A 1WXJA 3TW7A 2PURA 3QPZA 4UOZA 3D52A 1HT6A 2OCZA 4WSJA 1S5TA 2ABAA 2WNQA 1GVQA 4I9AA 1FQ0A 3AXHA 4ZQMA 2E6AA 3G1FA 3PF3A 1DBTA 4UZSA 3IVTA 3VX0A 1MEHA 1X1OA 2HMCA 2Y85A 1PCWA 3AXIA 2Q3RA 1LZOA 3W1QA 4E2BA 3CWNA 1IIHA 3NO5A 3STEA 3S9YA 2EABA 1PAMA 3BV4A 3LRLA 5KSWA 1D9EA 2NUXA 4M6VA 1ICQA 2ZTKA 2AAAA 3W7MA 4RXGA 4XBKA 3W1TA 5BOOA 1UBSA 4ORMA 1IXQA 4NU7A 3HF3A 4NJIA 1JF6A 2BWGA 1UKTA 2WVVB 1ICPA 5CZSA 4HKPA 4NJHA 4AB4A 2OYLA 1R34A 2WKLA 4K38A 1GG1A 4OE7A 4ONVA 2V2CA 4N4PA 4OGZA 3UG4A 3W7GA 3ZT7A 4DO4A 4QNEA 3LCIA 4GIAA 1LRTA 4IX0A 2Y63A 5BRBA 4DF1A 3LXAA 5IBXC 1FBAA 1GJPA 5K9DA 2YPIA 2VXNA 3NQ2A 3VE9A 3L4YA 1O5XA 2E5DA 4WOZA 4XTIA 2QCDB 4MJMA 3HG5A 5F1UA 4IMFA 4DELA 5AHMA 2YFOA 2VFDA 2PRHA 2DZTA 1L0PA 3VMNA 1MW0A 3O05A 2QCEA 4Z0JA 3OHIA 2PRMA 5AHFA 5AHNA 2CZDA 3O63A 1GVIA 4GNJA 4MUZA 1SQ7A 1BSIA 3W23A 3QQ1A 3C6CA 1GPWA 4D2JA 1JUKA 2FE0A 2QUTA 1P1XA 1D7FA 1QPRA 3C2OA 3KAOA 4LS0A 4LVFA 1UD4A 2QR6A 5F2MA 1CIUA 1C9DA 3IGUA 3W71A 4BWLA 2GUYA 1G6CA 1QI5A 2DH2A 4UTWA 3QM3A 4Z1AA 3EWUA 4JL1A 1YTKA 4UQBA 3QW3A 5HMSA 4LOCA 1XBYA 3M9YA 5D30A 2C14A 3KLLA 3W72A 4WY0B 4MKNA 3AJXA 5K7JA 1AW2A 1ADOA 3W1NA 3TAKA 4QISA 1GJUA 1WQ5A 3MI2A 2ZA2A 3OG3A 4Z1DA 3HGJA 3LXBA 2A6LA 3STFA 2F1AA 1WOAA 4NJGA 1MW3A 2XWEA 3DX2A 1W8SA 5K3VA 2EJ1A 1S5VA 5CXPA 5CPMA 3A4AA 4LXFA 2ALWA 1VR6A 5CZ0A 1LOSA 1V7YA 4C1KA 2BY0A 4NXSA 4QJ1A 4NUWA 4JNMA 1F2JA 1F6PA 5AHLA 3G0UA 3L65A 2YKKA 3WEOA 4N6FA 3B0VC 1QHPA 4PSPA 1JDAA 4RXFA 1HL9A 1YPIA 3KX6A 1QW9A 3GNDA 2CW6A 3TMLA 1VCVA 1UD8A 1WP6A 3IK2A 1GTHA 4HPJA 1MW1A 1VH7A 1VQTA 1UCWA 1EB3A 2ZYFA 1TREA 3WFAA 4AEOA 3BO9A 3SW6A 4LWWA 5D2YA 3AJ7A 1YADA 2FHCA 1Z48A 2Q8ZA 3UY7A 3IVUA 4QIUA 5LNWA 3EX2A 5I3JA 1B4EA 1J4EA 2QV4A 1CGWA 1ZS2A 1HVXA 2W79A 5G1TA 4O52A 3GXMA 1O95A 3O1NA 2OT1A 2DZSA 5G1YA 2HTMA 5FEZA 3LCHA 4DXVA 2GVJA 5HPOA 4JYEA 2OX1A 1OK6A 3LPPA 5C5YA 2X30A 2E4TA 2PWDA 2ZX8A 1G7UA 1RQBA 1SO5A 3LTYA 5HULA 4H8VA 3E02A 4RZ4A 3ZSTA 3TFCA 1QHOA 4GKLA 2LLEA 4MZYA 2WSYA 1JJKA 1MO0A 3EX1A 3ECQA 5HWMA 1HNYA 2WNWA 2OJPA 4IOTA 1BF2A 1W5PA 2YA0A 3ZOAA 4LRTA 1TQSA 2FTPA 3W9ZA 2WOQA 1IZJA 2QJHA 1PHQA 5DXXA 3IJ7A 9CGTA 1G4PA 4BI5A 2VFGA 2GPTA 3MWAA 4GBUA 4GE8A 4UFIA 4UMBA 2A21A 2BSLA 1YTEA 2ZIDA 3OLIA 1TPVA 1QPQA 1HG3A 2ZFAA 2NXHA 3ZR5A 1TPWA 4GQRA 1K02A 3NZRA 3TJXA 4UTKA 4ZQPA 1F7BA 3M1ZA 4B5NA 3P74A 1Q45A 3PS7A 1M6JA 3FYOA 3CZNA 4TMBA 4A3UA 3DU0A 3H53A 4N9CA 1M7PA 1UH2A 3GBDA 3TIMA 1I2QA 4Y8FA 4DQWA 1O94A 1YYAA 5DLCA 4KWUA 3T4CA 3DHFA 1DEDA 3S0CA 3QF0A 1D3GA 2V5BA 2J24A 2Y7FA 3I65A 3LBMA 2ZXDA 2WVTA 4JGDA 3SGUA 4M5PA 3LX9A 4UOQA 3GZ3A 3JS3A 3PM6A 2WQPA 4B9ZA 4UR8A 3TC6A 3P5ZA 4A2SA 2NT1A 1TTIA 3FFSA 1J5TA 1TYGA 3KFTA 4JTKA 3DFSA 4DPPA 4NJKA 2W0UA 4CQAA 1VRDA 2BY2A 3SIZA 3TXVA 4PL2A 3GBEA 1H7WA 4JN6A 3IV3A 1I75A 2PC4A 1UJPA 1XXXA 1SFLA 4PC8A 1IF2A 3W7IA 2A5HA 2G3NA 3BW2A 1MXGA 2XIIA 4OJYA 3O6YX 1ME9A 4ADSA 1W56A 1HO1A 3B8DA 1A5AA 1VPXA 5E1QA 1KLYA 4R53A 1CXHA 2UV8G 5BMXA 4UTLA 2GOUA 2PWFA 3KLKA 1H51A 1EWEA 1LBFA 4IXXA 3GXFA 3NM1A 4LV4A 4Y96A 1UUMA 5BNKA 5DCDA 1KTCA 3B0PA 4EF9A 5HQEA 3G1VA 3UQNA 4EOUA 2RHGA 2BY1A 1UH4A 3U8GA 4UNKA 1H5YA 1JVNA 3R89A 1QDSA 4CCDA 4GI8A 3NNTA 3I6RA 1RR2A 4TVUA 4NX5A 5D02A 1QX1A 3GDRA 1KBKA 3PVFA 4O4WA 1KCLA 1JDDA 2JKPA 5D37A 3LGEA 2P0OA 2E0PA 2X1RA 3QMTA 4HOZA 1LP6A 3OIXA 5D04C 1SZNA 1HTIA 1TTPA 2CXGA 2QCFA
chains in the Genus database with same CATH superfamily
1GYVA 3NABL 4WKHA 3AREC 3B7SA 2FR4A 4WUIA 3D25A 2D7PA 4LDCA 1E3XA 3U2SA 1KFAH 1BOYA 3QXTA 1NDZA 6REQA 4P48A 3CVIL 5EC1A 3N6QA 2O30A 1SN5A 3CPUA 1EA0A 4CW1A 2CIIB 3QDMD 1S5NA 5BU9A 2YGQA 1J6PA 4PU2A 1HKFA 3WNOA 1ML1A 2PSNA 3C2VA 1GC1C 3MTRA 1M2OA 5FO8A 4NJ9L 5AG8A 4OF3A 3M0VA 4DWSA 1NDWA 3OLEA 2LOEA 1PG7L 2UWEA 3NOYA 3LHUA 5CD5D 1GOXA 1E2WA 1ETZB 2CZVA 3G1RA 1AW1A 1GOFA 3H42H 4KJWD 3WHE1 4QTHA 2PW1A 1RU9H 2ICEB 3I6GB 5B7EA 2VDLL 1IWPA 3PG9A 5E4OA 4ZUSB 1KIQA 3V4VB 1OO2A 2IANB 1KV5A 1PSCA 2HXUA 4PBGA 1WITA 2XWTB 4OLZH 1WA3A 4WXYA 5F93C 3H2CA 3SCRA 3DDFA 2EIZA 3CUPA 3V6ZB 1EP3A 4AK1A 4YXLH 2AOSA 5DBTA 4Z7OF 4FFVC 3NPSB 4JO4H 4HK0B 1KM3A 4ZK8A 5JHAA 1EFZA 3HAEB 3WIFA 1UUOA 3HIJA 2W9MA 1T5WB 1NU5A 1EZUA 3S5OA 1A6VL 1CXKA 1RZQA 4U4BA 1DQDH 2ZUQB 3QQDB 1WYJA 2DYPB 4U2ZA 2VH5L 1FKXA 4RQQA 1YRRA 1YMYA 2XWCA 1WDQA 4TNWK 3IU3A 3LHVA 2QVMA 4P2VA 4P5MA 4AJWA 1EXUA 1AFSA 1BEUA 1H7RA 4JD4A 4XG1A 1AD1A 3LS4H 3RDTD 2MJWA 4YHZH 4ZSOB 4H9YA 4N9GA 4QYOB 4F58L 1UP2A 5BO0D 2Y2WA 4R0LB 5CIPB 1J9SA 1P43A 2R4RH 1MREH 2WLLB 4TQPA 2GB2A 3CDGB 3T0XA 1SY6A 3UTTE 4JQIA 4ABQA 2DGAA 2FLIA 1YEEH 4Q9QH 3VWJA 2F8OA 4XODA 5AVWB 5TFSH 2JBMA 3SPGA 3EPNA 3R6IA 1NPUA 1JNNH 4FZ8L 2H2PC 3PTDA 3DSNB 3W0WE 3TAOA 1AHWB 5J11B 1TCMA 4GSDH 1I1WA 1PS9A 1G01A 1NFAA 4S2SA 3BO8A 2YGYA 1KYOK 1CC3A 3HR5A 3GG1A 3IRDA 3U4FA 4ERIA 3N44B 4O8AA 5EMKA 1FBIL 1P4CA 3WH5A 1XGRB 1EXPA 3EWDA 1UQSA 1ZAHA 1RY0A 2CLOA 4LVEA 2ZUTA 4XC3H 5AZUA 4KZCA 3HN5A 1ASOA 4XAKE 5DS8A 2YDRA 2AXJA 1K9EA 5IZ7A 4L5ZA 4NZ3A 1XZWA 3LNDA 5FJOA 2PGWA 3O3DB 2FZMA 4DZAA 2YGVA 3N85L 5FYKL 3G9AB 1S2AA 5D9PA 2O6FA 1NEZB 4YC2C 3PJWA 4FK9A 3T44A 4YSOA 3FUEA 3SGKC 4K7FB 1IC0A 3SADA 1P7BA 1OC6A 5A6BD 1P1MA 2ADJB 5C0IA 3EO9L 3HQPA 3NGFA 2YRPA 4O2CA 4BHUI 2CE6A 5BUPA 1JUEA 3C09C 3EOTL 5DMJB 2F6AA 2JJTC 1Y0EA 3BVTA 3PHOB 1UATA 2BSEA 3UC0L 2X53A 1B3YA 2HK1A 4YHGA 3UTPE 4UDUA 2P1FA 4WIQA 2VYOA 5K59E 4KJPD 3ZT5A 1PY9A 1ETJA 1V0MA 4OU1A 4N2KA 2IADA 4NUJA 5KETA 5DRCA 3VILA 3GG0A 2HMIC 2R4RL 4L3CA 3QULB 3CHRA 4XKYA 2VUKA 4WGVB 2YS4A 5GS2D 3ZBMA 3QR0A 1HZYA 2DIBA 3D2TA 5EZPA 2D1ZA 3AMKA 4IOFC 1QEXA 4Z7WE 4FIQA 2GIYA 4PMYA 5LYRA 5CGBA 3W2DH 1JS4A 4GXFA 1FL6A 3DVIA 3F2DA 4GXVL 2VJ8A 4ESKA 1A5UA 5K69A 4UTJA 3OXSB 4HKBA 4DAGL 4Y2WA 2DEWX 3G0XA 1H9DA 4KTDL 2VJ0A 5LBSH 5IB5A 2H6UA 1DE6A 2A1YA 3NWRA 3VNMA 3GTVA 3VGAC 3LQLA 4MMXB 1NDVA 3KYNB 2WKJA 4F2TA 3FUIA 1RCYA 1HP4A 5CINL 4HA1A 3KWUA 2Z31A 4P4KC 1K5NB 4GQZA 1XEUA 2VFEA 2N01B 4Z0XB 5F7HA 3PWAA 2PW2B 3F7VA 3EOLA 1DLHA 4QG9A 2H6PA 3NPVA 4Z7WA 5IBXA 3LHYA 4F37K 3J7HA 2V5SA 4P8VA 5E5RB 1RMFL 1DQML 1QOXA 2C9SA 4OGAC 3SECA 4URTB 1OT1A 1Y0LA 3VA2C 3V75A 4S3GA 5A6JA 5IB2A 2XQ0A 1LO5A 2ZX6A 4C6FA 2XV0A 4UT6A 3CZFA 4BA8A 5L2KD 1EMTH 5DHMC 4Z3TA 3EXRA 5CCKH 5FUZH 3TLRA 1BIHA 5MERB 1SO6A 3P82A 3UXIA 3VOFA 4HULB 1XBRA 4IU3B 3V2AR 2BP8A 2OW7A 2FL5B 3T4WA 4LBEB 5F89B 3PZOA 3GHPA 1HX0A 3DETD 4GSUA 1TJPA 4HZ6A 2WNZA 3HZVA 5JR1H 3AG1B 2R83A 3VGHA 3QZOA 1ACCA 4K8RH 4P4RA 2ALRA 3F1QA 5A5WA 1JGLH 1TIWA 4HS3A 1KC5H 3X11B 2Q9OA 4Q97A 3L3KA 2VC6A 3VIIA 4HMDA 2NY6D 5I74C 1DWJM 1QI4A 1NEPA 5EU7C 3TQ0A 3LDVA 2W38A 1NCWL 2D2HA 2QS8A 3L4XA 3RVXD 1ISVA 1JMZA 4ZS6C 2H6RA 3HB9A 4GYPA 4WY7L 4I9MA 3Q37A 2WCSA 3V9EA 1J05B 1C08B 4N5UA 2V0TA 3OAZH 1TU2B 2HJLB 3KDMB 2PP3A 3R5EA 4TO8A 2V7HB 3X1FA 1XAUA 2FEDD 3R11A 3I50L 2V5KA 1S2TA 1WZAA 4JO3L 3WFDH 1UOKA 1JVLA 2I24N 3NP3A 5IESH 5DA0B 4JFFD 4KU1A 1XR8B 1DE4A 5FW8A 1NMBL 3S3CB 3GU1A 4OFPA 4XPHL 5AYTA 3GTIA 3R25A 3FH7A 5EZLA 2BDQA 5D9SB 1YPZF 2JCCE 2R1YA 1ICSA 4NAEA 4L8DA 3TQVA 1YE4A 2R14A 4XN4A 4O02H 5ETUA 4QXWA 4ZO7A 1ILUA 2GSHA 2V5DA 4G7SB 1SM9A 1P4BH 1BQCA 5TAOA 3UJJL 3QQ4B 5I8EB 4N42A 4UAOC 4PUNA 3UPWA 2H3XC 3ATAA 3FUNA 4B3ZA 1HJUA 2FNWA 3LEVL 4YQXH 3QULA 3DFQA 4N87A 3A3XA 2BOGX 5DI8B 1XQ4A 5FDWA 2NY1D 2J9XA 3VXGA 1QA9A 7FABL 4JGNA 2HCZX 4QGCA 3LD8C 2PDMA 2O9TA 2KDGA 1KC5L 1NVMA 4JNYA 3ZJ7A 4JG0L 4AHOA 4DPAX 1NCOA 2CITA 1JZEA 1E27B 3MYJB 5E23A 1LWJA 1T4KA 1YDVA 4LVAA 4W88A 2ARJQ 5CJNA 1UZ6F 2DZBA 4K94C 3EO1A 1X5LA 2P7TB 2X4QA 5DO8A 1FNGB 3UTPD 2CEQA 1PUDA 4H40A 3CU7A 4JAMA 1QTSA 1IGFH 2JXMB 4PJHE 2AQSA 4U7SA 3S35L 3WKQA 3R1ZA 1DN0B 3SUTA 4GI6A 3ZQWA 1PZ5B 2F84A 1N59B 2F5AL 2UZYB 3CFDA 1C1EL 1NICA 3KR3L 4GBXD 1H5BB 4RESB 4FTVD 4EVNB 1NKRA 3G0SA 1F4YH 2E47A 1INDL 1IL1B 1EMTL 5G5DB 1AQDB 3WNJA 2A3HA 2WC7A 3IAQA 4AT6A 4EEEA 1BZ9B 2FBOJ 1T4WA 1SJAA 1VBJA 2RDWA 3BP5A 1FYTA 4H20H 4JTTA 3KPRB 2AK4D 4R5XA 1LT7A 2ITCA 3SD5A 1JCTA 2VD8A 5I16B 3B8VA 5DRWA 3ENEA 3FQTB 3S47A 1JZDC 4R7VA 1NFGA 2OMUB 2KZBA 1GCYA 3BVNA 2KHAA 3THAA 1OX6A 3CZSA 2OOFA 3BDYH 1TWSA 1GQNA 4HNUA 3S3PA 4BFRA 1J1OL 1RXLA 4ZG1A 5HGHA 5AKTA 1ZTXL 1JAEA 4C47A 5LBSL 1XCXA 1J2WA 2NY5H 4YLQT 4GYKA 2ED7A 4KJQC 2AVFA 3RWFA 3W22A 5BRZD 3CFEB 2A6KA 3ARGD 1Q9OB 1AJ7H 1FFPB 4QYOA 1X6NA 3H0TB 4XWOC 4JTIA 3PJLA 4NG3A 5E94B 2J9ZA 2N1TE 2YEZB 4JO3H 3BYTA 4TQHA 4LLMB 1LO0H 4AGNA 3FO1B 2RD0A 5REQA 3AW5A 4KIRA 1PNCA 1WFTA 4CVZB 2BMKB 3PWVB 2YA1A 5T1DH 2Y24A 1JZ6A 3T08A 2V9QA 3LOTA 1SXBA 2PPAA 3U1SL 2MNUA 4J3OC 4JQVA 4PY7B 3SYCA 3VE0B 1IFHL 3VXRA 3NPSC 5I71B 1MI5E 3QFWA 2IV8A 3DX5A 1OGAA 1UOWA 3IWPA 1U2HA 3MCNA 1CGSL 3V55A 2MTAA 3GBNL 5CP7A 2JB6B 1TSHA 2BFVH 1NCAH 4FFVD 1TTAA 2HN7A 3SDYH 1O5PA 1ID5I 2C7UB 4IPNB 2WWMD 4Z77A 4CKQA 4YSCA 4X8JA 3PNWB 4NM4L 4LF2A 4ELMB 4WD0A 4WHTA 3NQGA 5LHEA 1PL3A 5DHYB 4LX4A 2EXSA 2IGLA 3OGOE 1D2KA 1R8LA 2CFFA 5CBEB 1SJHB 3N04A 2A1WH 3WQ4A 1F90L 3HI6L 4B2DD 2ZKMX 2K6YA 2QBWA 2B15A 1CLYH 5XIMA 1JFQL 2FIKA 2C4XA 3OR7B 4DKAA 3O11A 4L4VD 1KBJA 3BZ5A 2Y1HA 5AC8A 5M2FX 4U7KA 5CZJA 1AIZA 2QUMA 5A6LA 4RMSA 2YAQA 4UUJA 3GTHA 3HMCA 3S2MA 1Z6KA 1CLKA 4JPGA 1RQHA 4E9SA 2HT3D 2KZKA 4LKCB 3REVB 5FOBA 2AS5M 3UFYA 5C0RH 3R18A 4PB0L 4PP2A 3W9DA 2AQWA 4PG2A 4N5EC 3DFYA 4JEJA 1BDYA 1F3JA 2NY4C 5D7HA 5J13B 4IRSB 1XYZA 3M44A 4ENZA 3GC3A 3LN5A 4NGHH 1A9BA 3QIWB 3A6OA 3EOBA 5BW7A 3TQPA 2XHNA 4OZOA 3CSYB 4EZKA 1EF3A 3BVJA 2ZF8A 4M5TA 5I6SA 1NIBA 2E8YA 5KSBB 4X6DF 1T5XB 1FWDC 2HLFC 1IIIA 4NAFA 3SO7A 1LT8A 3WSQL 4WJ8A 5I1DA 4KNSA 3QV9A 5H2ZA 1R3LA 5C0CB 1WKYA 2BP0A 1T1YA 1NCCL 1MNUL 2FMOA 2GITA 5G2HA 1CLZL 4HPGA 4NQVA 5AYYA 3DEQA 3KVQA 4XIAA 2PETA 1AJ0A 1N5YH 4QEEA 4MB1A 1X9QA 2HPOA 1L9WA 2WM1A 4GVGA 3LXUX 4HGKC 2WN2A 1LD9A 3GMLA 5SV3A 4DK6A 5EFFA 3RJXA 6XIAA 2BVQA 3T8LA 3FLUA 3BWUF 5DYOA 5IWLC 5H35B 3TBWB 1YUKB 4IFOA 4F8TA 2P26A 1HKWA 4DNLA 1J5OL 5AW8B 2OFJA 3IVSA 5FF0A 3QUZC 3UGXA 4TTGA 3BRGC 5J5DA 3HR5B 3HZ3A 4PJIB 3NJHA 4HWBA 1HXMB 3WJSA 5C97A 5ISZE 1KLZA 2AQ3A 1TJ2A 2J21A 5JOPE 1RU9L 3WD1A 2YKLL 1XF2B 3N3EA 1BBDH 1FNSL 4A68A 3PTMA 5JH1A 1OEZW 4ZW5A 2J5LB 4YUEL 2HFGH 3VZYA 1RUMH 3DVGA 4YL9A 3GFXA 1DWGM 4W7WA 2XV6B 1FGVH 4MNQA 3BP4A 1BQHB 5CLXA 3ZIMA 4U1HA 3SM0A 3LA4A 1MH5A 1QASA 5D1ZB 1FL3B 3UACA 5CEZL 1Z89A 3L5AA 4ZGYA 3FZUC 1RJZA 4I89A 1I8JA 4X0NA 4WR3A 3UGRA 2VIRB 4OGYH 1NAKL 1E6OL 1RZ8B 2K4AA 1DVUA 3GO1H 4XCYB 3TTOA 2G9KA 4JPWL 3P3RA 3ZMRA 2GFBB 2XG5B 4IBTA 3D0VA 5GS1A 1BSLA 3N6HA 3KW3A 3DOSB 5LWYL 2JTDA 4X6DB 3WNKA 1IAKB 2VDKL 1KGJA 1T0MB 3MRIB 5DELA 2NY5L 4IGBC 1OD8A 4ZFOB 3O7UA 5DS1A 2FUQA 5FHBH 1BF5A 5AW2B 1F5ZA 1SOQA 5DHVH 2Y07H 1NOUA 1GTFA 3MRIA 3FH5A 5K9OA 5E6UB 3BH4A 3CJJA 3W76A 2YPVL 1DWAM 1J48A 1HHIA 3C60B 5DVPA 1AI1H 1XH2A 2PW1B 2ZQKA 6FABH 3JQOB 5DK0A 3MCLH 1VZWA 2HVNA 4GY4A 3R43A 4GXWA 3IVKA 4UV4L 1TA3A 1WFNA 1QR7A 2AXGB 2OI9B 2OR2A 1L6FA 9XIMA 1DYSA 3L3IA 3MA7A 4MCZA 3AIEA 1XR8A 2PF6A 1JPDX 4XMKH 1R47A 2DQCL 3NJVA 4FYRA 4HG4K 1OF6A 3RU6A 5BXFB 4WWPA 5HWNA 3OVRA 3AZUA 2ESVE 3B3IA 1BWMA 3NGJA 3QEZA 1I85C 3S6OA 3ORWA 1FG2A 1HHKB 1EGJH 3F12A 3ATZA 3GS4A 4O4YH 4ZMGA 3FFCE 1FP5A 1P6FA 2VXQA 3HC0A 1YECL 3O6ML 1EBHA 1UASA 4LCRA 1FAKT 3K4AA 4NQQA 1BZEA 1TNNA 2WP3O 3L3IB 3MA7B 1KM1A 3T8QA 2AGTA 1D2PA 3MJ7A 3L6FA 2NCMA 2XU2A 2P42B 3HGOA 4QG6A 3VNLA 4C7DA 4ODBD 3A6CH 1SQMA 3D2UB 4I85A 4HPHA 4LARL 1Z2KA 1A6PA 1HSAA 5FM5M 1HKLH 5EOCL 3MHUA 1S7RA 1K9TA 2AEIT 4F2MB 5HGDA 2IG2H 4Q6YA 1QR1B 4RE3A 3B2DC 2QLYA 1PEZA 3TYFB 5IJKA 4LSVL 2VDKH 5H2BA 2ED9A 1GPFA 1W0WA 2YSTA 2JKAA 3A5VA 1TQCB 4R8WH 3WENA 3ZO9A 4DT2A 1OFBA 4K8EA 3FA3A 1RKRA 3CZFB 3GYRA 2A7PA 2DSUA 2NQZA 3S4SA 2PODA 3LUTA 3RHWF 2CPCA 4PHXA 2GGHA 4XAGA 3P8IA 1U3HD 2YPLB 4RZ6A 3NACH 4IDJL 5D6DA 4B5TA 5C0AD 4DF2A 1SMOA 5EWIL 4AM0Q 1DL3A 3SCUA 1RLBA 1D3HA 1V79A 2KQMA 1FFTB 4U6VL 2B7DT 3O6LL 1A4JA 3VXQA 1T1YB 4OF6A 1WFOA 3P7YA 4HEPA 2APXA 2OGJA 1O12A 3WAJA 1RL1A 2VW4A 1LK3L 1ZT7A 5CSGA 1IXNA 3ARGA 2TSBA 5IXEA 2VLKD 1PDYA 5I1IL 2VEKA 4HW6A 3DIDA 3GE7A 3QUYA 4TQEH 4IUOA 1ZV5A 3FUMA 3DGCR 4MNQB 3B8SA 3BH9B 4NQSA 1OX5A 4S3EA 5F9WC 4BINA 4C90A 3VXSB 4NO3A 2ZZ3A 1HOEA 1R86A 1OGAD 1U83A 3TC9A 1UT1A 4G70B 1FE8L 2UXFA 2YCEA 5F6IC 1KEMH 2B08A 3JVGC 4F80A 4B16A 4YHNA 1CFSB 4MSWB 5DYFA 3EH3B 3QZ6A 5DRZB 4GI9A 4I5BA 2XVNA 4AVKA 3E1F1 1PDZA 1BG9A 1MCOH 3BQUB 1EGJA 1FFNA 3EHBC 1MSPA 4MRBA 3ZE0B 3QXAA 4KUZH 4D9RD 3WH8A 4PH8A 4MMYB 1W0VB 4Y4KA 4MASA 4DGYH 4X4MA 1NLDH 1TZ7A 1N2RA 3MO7A 3LRKA 2DMCA 2ZSWA 3ESUF 4RAHA 2ZC8A 4N9DA 2EDNA 3V6FA 1VKFA 1TPEA 3NIGB 2ITEA 4W9HC 2DICA 3LG3A 5A7BA 1QYGH 3RIKA 3V5OA 3ZUCA 3RUGB 1DVFC 3PP3H 1GTNA 4CSZA 4ZTXA 4Z2HA 1B2YA 1NDYA 2PP0A 3V6OA 3PF2A 3QJHA 1UWFA 2H9GB 1RCQA 1T99A 4IM4A 4REQB 3S9IA 3V0HA 4GHRA 4PCFA 2FRGP 3P9LB 3QWQB 3KCPA 4PIBA 4CNTA 3C6EA 3SUWA 2EKGA 1YDNA 4G9DA 2EE9A 1Z42A 1T40A 4ZXLA 5I79A 3P0VH 4P4KD 1RP9A 7TAAA 2OCCB 1TMLA 1VJSA 2BVUA 4TUFA 3BSZH 4FXKA 2PYEA 1F3JB 2VO5A 2XVBA 3JV0A 4KKLD 3NR0A 2CGRL 5DT1L 3NNTA 4NZCA 4QHPA 5JNYB 2Z2AA 4DEPB 4XCNA 2PDWA 5IMKA 5T26A 4A29A 3H55A 2NUTB 3T2PA 3NTCL 5MEOA 1VDGA 3N1MC 1US0A 1OT4A 2AERT 2EO7A 4JFZH 2AAMA 1F6AA 3NIDF 5KAQG 1HFBA 1QFWH 2XJLA 1XLHA 1TCRA 1MRAA 5FWQA 4C8XA 1W1ZA 2EADA 5DWUH 3WHE0 2AHIA 4CQBA 5CC3A 2DL9A 3INOA 1EFXD 5SWZB 2J2ZB 1SOXA 2AK4B 3F83A 2VSDA 3I9IA 4KAQH 2D24A 2WB5A 4JFXB 4YWGH 2E9BA 2GJJA 4LUSB 3OC8A 4PJFB 4XZUA 2V5MA 2PDIA 4GZ7A 1S6NA 2XY1A 4JPKH 1GY1A 1YEWA 2JJSC 4HCHA 4Z08A 4E5XB 2IKJA 1Q6GA 4BFOA 5IB2B 2O4MA 1WFIA 2XFRA 2HE8A 4WX2A 2IKHA 3T55A 5IQ9B 2GTZA 2WNNA 4B9CA 1BVLB 1M7DA 4G7EB 1KJMA 3SJNA 1KB3A 4XMPH 4ATLA 4E2DA 4Z1BA 1HOCA 4HZAA 1QQDB 3GEFA 2HA1A 3RJYA 4HHLA 2C19A 3FFDA 4PFEA 1C91A 4L56A 4PUUA 3NUKA 4LB3A 3LQAL 1YEGH 1PZ3A 1H3GA 4WO0A 2OULB 3DUUB 1GOQA 2FECI 3R8QA 1GK8A 4WDUA 2DZXA 1IWAA 4W87A 1A6ZA 2VERN 3DRQB 4N0RA 1OSPH 1IZKA 2FJHB 3HUJF 4CN4A 5LXXA 1UOZA 3CHXA 3M46A 4Z5RB 1FPTL 3AALA 4JN7A 3RAOA 4HS6A 4N8PA 3HQ1A 2JIXA 2YL9A 3C2YA 4M5ZL 3WTYA 2JWYA 4JPVL 2BVOB 4LCQA 2V37A 3PL6B 1ZXKA 5FUCE 4DWSB 2W9LA 1GMEA 1O7SA 3APDA 4LOUD 4A38A 2NQ5A 4ZTPL 3W7LA 2XX1A 1JCKA 4BQCA 3TTEA 4Q6IB 4OUUA 4W9LC 1MCJA 3QQ3A 1U8MB 3P9MB 2WZIA 2VR8A 1Q1JH 3NSNA 3QT2A 2VDKB 3BZJA 5L8LB 2ESVB 3HI1A 4MDJA 2PTXA 1R9XA 1IV8A 1SO4A 3B9VA 4ODUB 3QHNA 5C0FA 3DV6A 3O9WA 1H8NA 4DH2A 1U6AL 1XMEB 5GNXA 1Q9KB 3ZUNC 3EYSH 1JCVA 1C8PA 4B5SA 2OLHA 1ORSA 4YDMA 3ULVL 1AKPA 1E72M 3WUBA 1ZGDA 1UVQB 5U7SA 5EKYA 2YXVA 3US9A 3AQZA 4Z7AA 1LF1A 4PTNA 1FL5B 1MVUA 4JPIB 2OMZA 1KGWA 3GRWA 1H11A 1I6NA 2DKUA 4X42A 3SGJC 4F48A 2XSXA 1G1OA 2HXTA 2XETA 3MZTA 4PJXE 3MUXA 4KK9C 4N2FA 3X12A 2YXXA 3Q67A 1Q9KA 1XO8A 2F53A 2XKSA 4JN2B 3VXPB 3D0AA 4X9SA 4JFHD 3KOZA 1AHKA 3OR6B 3EOUA 4KUCD 2BOFX 4WW2B 4LEBA 4KI5C 1J79A 3VFSB 2NNCA 4WY0A 1OK8A 1RJLA 1TTJA 5A6BA 5HDRA 1O9VA 1T66D 5F1VA 2V3DA 1VACB 5HJ3A 5ABAA 1SJBA 4S2SB 4XVUC 5GGUA 5AW6B 3GSQB 1T22B 5D1XC 1NBYA 5DD5H 3EXLA 1VF8A 1NGQH 2N7AA 3WFBL 3AOFA 1EP2A 4IMLB 5LHDA 1FV1B 2PLCA 1LO5B 1AC0A 1SGKA 3H9SE 4MNGB 3US0A 2FAUA 1GJIA 3FJLA 2ENJA 4IQHA 4K3ZA 4P2QE 1K4GA 1PHWA 4LSQH 5E99L 5TE7H 2HJKA 2G96A 4O28A 1GKRA 4L1SA 3MUUA 4JRXE 4P49A 4NGHL 3FF8A 3ZJAA 2BGNE 1QLEB 4NZ8A 3W83A 1K6WA 4M1BA 4Z2GA 4JFUA 1PIFA 3KOWA 3S6TA 2QVNA 1OTSC 5IRPA 2FDBP 1OE1A 3WK0A 3MCMA 3T3MF 4UBPC 1AP2B 3KS0J 3GSXB 4WDXA 1W6LA 1ET8A 2APSA 5KVEL 3TONA 3MKGA 3BLFA 1D5BB 3HLAA 2ZZ2A 3W1QA 3KBVA 1OTTC 4OCSL 1QSEE 1XIWB 2BINA 3IBEA 4N0YL 5IQ7H 1WBZA 5C3LD 1QWGA 1AXSA 1FNEB 4LB4A 3TBSA 5TTRA 3ES6A 4QRSB 3IMBA 4JFZL 2HJPA 1MRCL 1W0WB 3VYOA 2WSRA 2XWDA 2AKRA 4QO1B 4YFDB 2YOCA 1NBZB 2HX8A 1AGDA 2J8UE 4J39A 4ICNA 5A2FA 3AXLA 1H7XA 4F2MA 4O57A 3RX5A 5DMYA 1G1KA 3I6GA 5ES4B 1DIDA 3NPUA 3BPCB 4OCRL 2ZG2A 4Y5VC 5DD1L 3WJJC 1KFKA 2O26U 3PV7A 3RWFB 2JKTM 2GK0B 3AHVA 2WSPA 4XSMA 3FKUS 3L6FB 2CU9A 4DX3A 4AC2A 1HTYA 4H9VA 3IDMA 1MQKL 1UJ3C 2BSSB 4XHQA 3AAZB 4QXUH 4Q7DA 5GGSA 3L5XL 5D7EA 1YZZA 5DN1A 2A9MH 2BZDA 5FGBA 1OP3K 2Y70A 1A9EA 4GXMA 4NO2A 3FCPA 2IAMD 5EORL 1X98A 4B92A 1U41A 5I16A 1J8VA 1CUOA 3BFQG 1GEQA 4RFEA 2FZNA 4FGMA 4TN9A 1KENL 4UTBH 3WF4A 4NCDA 5ACLA 1PVHA 3WFHB 1DQJB 3QZLA 4DOHB 1W5MA 4Z0XA 1P2CA 1URLA 3ESNA 4A8NA 1NKOA 2AXGA 4UILH 3TCLB 3PG8A 1HH6B 1F4WL 3U1PA 1K03A 1XUZA 1YG9A 1O0VA 4MWAD 4F9JA 2DMGA 2EDKA 3PGFH 5I2IA 2QIIA 4A3RA 3MACH 1UB3A 3CZKA 4XOEA 5EO9A 1N2VA 2DT1A 2NX3A 4FX7A 5FEXA 2J8OA 1HQ4A 1GGIH 3OKOA 3TBVA 5A7EA 3ELFA 1TJRA 2OXHB 1UQSB 1EBAA 1FNGA 3KHQA 5F9WB 1UA6L 4LCUA 5DMGC 4EDWL 1KW1A 1QP1A 3SDCD 2QADC 2WXPA 1NFPA 2Y7MA 5CWSA 3W39A 3X3GH 2B0MA 1DOSA 3FSTA 4IJCA 5CSUA 3UABA 3DK0A 3H9ZA 2HTLC 1B4JL 2CLZB 1WA1X 4RISL 1GZQB 4DBSA 3W70A 4LCVA 5C9WA 1NQBA 2ZG1A 2EYSA 4KY2A 5I77A 1BMGA 4HKXB 4ZQTA 4OSUL 2NQLA 1G7MB 4PRTA 1G9ML 4ZZ9A 4PRAA 1Y7VA 2MIZA 1JGMA 4OZFG 4DYKA 3W56A 3MRPB 5E4IA 1H4PA 3ATDA 5BVPL 2I5IA 4JFSA 1SYSB 2XFXB 2OFQA 2GBTA 3VZXA 3E6EA 3BWUC 4J6IA 3O6DA 5ABZA 1QI0A 2REQA 3F7JA 4GMSL 5HHNA 3BJFA 1MDRA 2CGZA 1IAII 2G3MA 1ZE3C 2IDTA 3P3YA 3PP4H 5GS0D 1OCQA 4JICA 3FJ4A 4YXKH 2X44D 4F7TA 2X7WA 4A8LA 5HHNB 5DR5H 4ZX3A 4XAKD 4A2EA 5BS0B 1SJMA 3LB6D 5AB1A 3U4BL 3VKDA 2OXGB 2IPJA 4U1LB 3TN5A 2JKNA 2ICCA 2WB1A 3BVVA 4M48L 3UIZA 4UT7H 3UPRA 3EX3A 4QHMB 3BISA 3FCTA 2PCQA 2D3VA 4Y19D 2VP8A 4JY9A 4W8BA 5CGYC 3EKLA 1IXOA 2R0WH 3RWJA 3RJOA 4AZBA 3MBWB 1UCBH 1I45A 1AL7A 5HYJA 1HDMA 4XO6A 3U2JA 3V95A 2DN7A 1IILE 1UXSA 3BWAA 3VSQA 2ZE3A 3AWGA 3T1FA 3GC2A 4PUEA 4DJFD 5C0QA 2GSEA 35C8L 1FDLH 4DEPC 1FCVA 3NQFA 3ARPA 3L95A 4JTFA 3UTTD 3L1GA 3E6HA 4WUKH 3VTTA 4M8QA 5FFLA 3V18A 1ROWA 3NIGE 1F1AA 4V15A 4CRPA 4I8DA 4PJAB 1N0XL 4ZZKA 1RK6A 1J7VR 3LY6A 2GITB 4OIBA 3VMOA 3DPBB 5C0CD 4FFYA 1T7LA 1JK9A 2QSVA 2XG4B 3MBWA 4TUKL 5JXEC 4AMCA 5AD0A 4AKQA 2CNCA 1VCBC 1LP9E 1LL7A 4U49A 1M71B 5MERA 1AQMA 3H7VA 4UTCA 5F97E 1OC7A 2Q0ZX 3D85A 3FO9A 3IKCB 3STCA 4P5MB 1JI2A 3WN5A 2XPYA 1AW5A 2JK5B 3V6OC 4DYEA 3CN4A 1A21A 1ZANH 3IMSA 3M88A 3D4ZA 4HD5A 4BD4A 1EPVA 2DT0A 4O53A 3I6EA 5JTWA 4WNQA 4XTRD 1A80A 2E3ZA 2Z7UA 2Y36L 4YE0A 2R0LL 4IW4C 1CD9B 3V4UL 3LI0A 2I85A 4UWQB 2Q6WA 3QQ3B 2F7FA 5E00A 2J47A 2YMXL 2A73A 3XINA 1G0CA 1UBPC 2QVIA 4H00A 3GB6A 2IAND 1HINL 1I7UB 4BKLA 2LFEA 4G6JH 4E42A 5J1SC 4OD3H 1Q6DA 2FPTA 2R29A 4LCWA 1ID2A 3DESA 3MMUA 4I2XB 1YCSA 1P84K 3O15A 2QGEA 2BSSA 1K8CA 1A3HA 4LASH 4KROB 4XAWH 3NIDE 3M6DA 2Z2UA 2QQQA 3G6JE 4OD1L 3GIYA 3KDOA 1U8PA 5AYQA 4DKFL 1YY8B 1EJVC 5K9CA 4PJEB 3VX1A 4QXUL 8CGTA 5D1ZD 2PXYB 3TPUA 3A0OA 1YEDA 3KAAA 3CGTA 4N2MA 1JV5A 1Q7QA 3MROB 2J55A 1RLDA 4ZOEA 2YD8A 2CJSA 3N85H 3CBRA 1E9YB 3M6YA 2VWEC 4WUKL 3RRAA 1CDGA 2M26A 4CAGA 3JTTA 3FUHA 1BEYH 1JERA 3CVHH 4JFPB 4LFHD 4M7JH 3CASA 4YYFA 1WVZA 3CBKB 3UG3A 4FQ2H 3AVEA 5TE6H 4AQEA 3N2XA 2WJDA 4FXJA 4X2RA 4XKMA 4ECLA 4DJDC 3SN4A 3NPWA 1MRDL 3DJZA 4KZ0A 4NDMA 3QUYC 1S3HA 1X5GA 4XKYB 2WNKA 4WO4A 1EVTC 3MBED 2F1BA 3WJMB 3IEBA 2VDPB 3WN5C 4XNYL 1KLUB 4MS8D 3MCOA 4TUOB 1RERA 3W3OA 1RK0A 3UXAA 3CMOL 3KRSA 3RPDA 3ZT6A 2VFFA 1BJ8A 4KVPA 1L2QA 2VW7A 3CIAA 4KTEL 3CAWA 2TMDA 1MVYA 1SHMA 2IH3B 4XTDA 4S0HA 4ZMZA 4IIQB 5LQBL 2J88H 3FC8A 4F2BA 2VDPH 4M6OL 3S3JA 4KEMA 2K4WA 1NQKA 4EZLA 2BOBB 4AMAA 3ALXA 1RSCA 4I0KA 4U3SA 4Y0GA 3ZTEA 3I4KA 3RFAA 5BOEA 2Q02A 5DGRA 3MLWH 3AZSA 2J7EA 5GJSH 5EZOH 5C9JB 5JIPA 1JPST 4HVBA 1B30A 4LYQA 3N50A 1RIUH 3QEQA 3WHXA 4IPPA 5H37A 5I1CL 4P5SA 5AEAA 3D51A 5DWUL 2YD0A 3J07A 3BEWB 4LUIA 3ABLB 3IRZA 2B5IC 4QOKE 1BYCA 4PRPD 4CSSA 4AXWB 1E65A 1OFAA 5GHWH 2HVMA 1WOBA 3NSMA 4EVNA 2FGBA 1R5IB 3W7KA 3WQCA 2KC0A 3UNTA 4C5ZA 4L1DA 2GYSA 4JFEE 3FFCA 4XP4L 2VQ1A 2EUZA 1T2JA 5EOQH 3CPGA 5D1QE 5KBPA 1BBJB 5D2NA 4KWOA 1WHPA 3CDCA 3X14B 1XIHA 4RFOH 1JVKA 3IFPB 4H1LA 4IIFA 5HHOB 1XV8A 1UVQA 4V1DD 4JRLA 2AGKA 2E6PA 2AJSL 2OTPA 4K7PX 3IDNB 2R1PA 2DORA 3INPA 4FIRA 1N12A 3I75A 4B9IA 3OKNB 2CD0A 1F58H 2FSDA 1TO4A 4YDIH 4S3BA 1KXHA 4M1CC 4FA8A 3N14A 1Z3NA 5IHRA 3NEEA 1GSMA 2EG7A 4GRWH 4Y19A 2AQRA 5IJDC 4U6TA 2QJMA 3WDJA 4LUTA 3T40A 4XAWL 4U2YA 3IFOB 1R3JA 2FPVA 4ZPTB 1RVGA 4UV7L 3U0TA 4H7VA 2AEQL 5TFSL 3F2LA 3ILDA 3VW3H 1OB1A 4LCIH 2DKMA 4FZ8H 4XP1L 1VS1A 4D6DA 3EDJA 4IGBA 3TEUA 4QXIA 1IAOA 2NVDA 5HJ3B 1RZMA 3NCJH 3GINA 1RVKA 1NC4B 1UJTA 2P8PB 4JQ2A 5IQNA 2AFNA 1BXUA 2IWKA 1GGBH 4MQXD 4XX1E 43C9A 3VNKA 1B90A 1IGSA 4GRWE 4X2PA 4GW4A 4Y89A 4ODXB 1R3RA 1CYGA 3ZY7A 3ZLGA 2NY0C 1OAXH 2INEA 1C12A 1KTDA 4YX2L 5K9KB 3S1UA 4ADTA 3WUWA 1FWSA 2PABA 2OQLA 4HN4A 3SE4C 3TCLA 3L7EA 4GW5B 2DTSA 1WBYB 4H0IA 5EBWB 5C6WH 1BVWA 3BIKB 3DROB 1FLRH 3SN6N 2VN6A 2BLEA 4A2GA 1N4XL 2H32B 5HY9B 1ZUAX 1J05A 2C3GA 3OAWA 2XN9D 4MXVE 3C87A 1GONA 4XISA 5M95B 4DZHA 1H15A 3V9FA 4HLEA 5FB8A 1V0NA 1EAOA 4JX0A 4BKSC 1TJMA 4BZ2L 3TA9A 1KIUB 4JFVA 1B0WA 3Q44A 3VGFA 3VXTB 4F15C 1YDPB 2ZOUA 5TH2A 1PG7H 2VLRE 5CJ5A 1N67A 3HBZA 3A64A 3HA1A 1VIWA 4GP5B 1EF2A 5JMUA 5FESA 5E9DA 3MFFB 4EUPA 4XZUB 5DC9B 3EJQA 3VOHA 3ZTJG 4FCHA 5C0EA 1O7DE 2VR7A 4PMDA 1KCKA 2YAMA 1I1AC 1XBZA 5BXSA 1SOKA 3C75A 2R1MA 2Z6JA 2HWGA 4GKNA 4EUPB 1ZBCA 2GSIA 2VR9A 2YPKB 4DWDA 3QUXD 1QNPA 3WXVL 2AW2A 2ZBTA 3DI0A 4GIEA 5SWUA 3NBNA 5BMFH 3BE1H 3NRQA 3QVAA 1G0DA 4G3YH 4K23H 3LTVA 5BS0D 2A2IA 1HH9B 4W9FC 4LLWA 3VI4A 3CFIC 5EBMB 1T21B 3CFQA 1OPGL 2IC2A 4HIIB 1M6OB 4PV8A 5E0QA 4YJZL 3BKCH 4ODWA 5T5FH 1J96A 1VGAA 4I1RA 2HKFL 3HE7B 3KLAA 2WHKA 1ECZA 4JL2A 1A6ZB 4FN0A 3VFGL 3WFDL 3QC6X 1GC1H 2VC9A 3U0PB 4PJ5A 1AR1B 1HJSA 3JTSA 1TPUA 2F6KA 2HG5A 2PO6D 4GFIA 4MCYB 2OJEB 2IKGA 3BFWA 3VQLA 3ID7A 3STGA 4L1TA 4PJGA 2OXGA 5I71C 1J0YA 3KM2A 4WI9A 1LL1A 3QDJE 4AT6B 1QLRA 5JHLL 3UU0A 1O7DC 4TNVF 1KTDB 1OIOA 2O72A 1AOHA 5BW7C 2Z4GA 5AOUA 2ITDB 3BAEL 4NKDA 2VDPL 3U9PH 5E0KA 3WMBA 4AVOA 2FYYA 3H9HA 3P69A 1QJWA 3HUJA 32C2B 4LP4A 4OTXH 4XNMB 5FGRA 1VFUA 3UFIA 3KPSA 4IKIA 2DZWA 1NFDE 5F6HI 4WUUE 2QF7A 1ZE3H 5HDBE 3RAJH 5IHHA 5DBUA 2JGQA 2P49B 4QCEA 3HAEH 2HFFA 1YRKA 2J4WH 4YQXL 3CHEA 3FHQA 5KVFL 3M4HA 4BF9A 3WKMH 3MBXH 2R4SL 4EIBA 3TR9A 1D5MB 1C7TA 4WU5B 2VLKA 1FHDA 3IGAA 4ZMTA 2BHUA 3L9RA 3THQA 4K8RL 5E4AA 3C52A 5DJ2B 1YNTB 1GA2A 3MYOA 4J3VA 3NPXA 2JB5H 4UTIA 2GUBA 2WAGA 4K23L 1AFVH 5F72S 4M1CD 3S5LG 3AM8A 4L0YA 4DI8A 5F3FA 4KVCH 3STLB 4PUMA 4DAFA 3GSMA 2Y5TA 1I3GL 2CZEA 4LEFA 1MH5B 3DDGA 5D1ZA 4JR5A 4TQTA 1KPUB 1KQYA 1TX2A 2CLEA 2IFFH 4WOQA 3S42A 4P7RA 1XL4A 2Z7WA 3QXBA 4RSYA 4PRWA 3BW9B 4BI6A 5C6PB 3EGJA 4IOFD 2H47C 2WIMA 4XNUL 1V6VA 5I8CB 4RW5A 3RR4A 3U2ZA 1B0IA 1Q0XH 4YDLB 5L2KA 4QF1B 1YYCA 2HG0A 3KVMA 2YYUA 4BQ8A 3G5YA 1QRND 3PFMA 4AKPA 2AJXH 1V7MH 3TBTB 1F1DA 2OJEA 5C86A 5CPLA 3I6LD 4UTAA 5GRJH 1E51A 2PLKA 3LCXA 2ZZUT 1L6ZA 2HLEB 3C0LA 3KGRA 1J8HB 3V5FA 1FP9A 4NNAA 1JNHB 2CNZA 1YAZA 1UXWB 3EWZA 3V36A 3MRRB 3CFCH 1Z7AA 3AU2A 2BNQE 4PMEA 1JPMA 1U8QA 1ZHBB 2Z8SA 3DTDA 4Y1SA 1DKWA 4RL3A 2YCJA 4GZIA 2M8XA 4KTDH 3C0QA 2OMVB 3ESPA 2X70B 4MXQD 4AW7A 3DFOA 2ICSA 1EEYA 5LGXA 1LE5B 3LV3A 2NTFA 4MA1B 4XD4A 4OQVA 3VG9C 2V9TA 1KXTA 1NCJA 4TQ8A 5FYJL 2COQA 3HM7A 1Q63A 2IH3A 1CXIA 3W1ZA 3RJDA 1NBCA 1J0IA 3M0HA 2AJZB 1ULVA 3IJ8A 5AVTB 3RX4A 2FBJH 2PUQT 3C08L 1FZJB 4KJWC 5I1HL 2PTZA 3JUYA 1A4LA 3H6JA 2RIKA 2VDOH 1DTUA 5LA2A 3RTQC 2BSDA 5KSUB 5EFDA 3HC0B 2HPIA 4AC1X 4HBCL 1OEPA 2ZDSA 1PKQB 1R3VA 2OT0A 1E40A 3GLEA 5T1KA 3WDQA 5I17B 4R2GD 5I1EL 4E9WA 3TMQA 1RY7B 3F00A 3K71A 4ZQNA 5EEVA 4PWEA 4PP2B 4XAFA 1NIUA 3BUIA 5DTFB 3GLAA 5CD3A 5CGMA 5ITBH 1S2UA 1XFBA 4DK5A 5A6KA 1JYVA 4AJYV 3MCKA 1S5HB 2X88A 3ARUA 1M56B 5ANHA 4JQIL 2YLKA 2AV7B 4NN5C 5LG6A 2FLRT 2HJKB 4FQXD 2NLYA 3PJSA 4Q74A 3W2LA 4QJ4B 1JGUH 3MNZB 3QIWD 3NL6A 4L4TD 3CYJA 1AR1D 2AV7A 2PPEA 4OKVB 5DUBB 3PR2A 5FI8A 4WI7A 1NCWH 5DSCA 1NSJA 2FWOA 2IALA 1U8LA 1J9CT 1YJDC 4HXAL 5KVMC 4YL2A 1FZOB 1Z9SB 2OQJA 4YWSA 3OU8A 3X1NA 4X7TA 2FWUA 3RPKA 1IAKA 1FWWA 1I8AA 1OHLA 5G1MA 3EWWA 1MLCA 3AGWA 4I48A 4IIGA 1HGYA 1SXZA 5D2LB 1IEVA 3GH7A 3ABRA 5E8DH 3RKPA 4LPYA 1N18A 2Y6TE 1NMBH 5DZPA 4HWBL 2J7HA 3SB0A 3ETBF 1SLVA 4AZHA 2NZIA 4POYA 3PWGA 1S9YA 1PS3A 4XO5A 3K4WA 3V7PA 4BK9A 2VRKA 3PWPE 3KLHC 1AZUA 4LVOC 2KLTA 2QIWA 5JLZA 5C70A 4UB0H 2XDFA 1CU4L 2VMFA 4GG8B 4HCDA 3C6SB 4QWWD 4GH7B 1U95A 2AJYH 3QO0A 4OHQA 1DZBA 2I9LB 1LEGA 3FW6A 4OV5B 2BNRD 5EIIA 5I5JA 2QCNA 4M1DL 4NERA 4KRPD 4JN6A 4LDLB 4OAWA 1UC4A 4QMEA 4FABL 2FHFA 3BZ4B 4K9EL 4P59L 3SDDB 3QXAB 4U33A 4IHCA 2Z8WC 2G5UA 4L5FH 3MUAA 2BERA 3KPPA 5D1QB 4W6WB 5I82A 4IGNA 4QS6A 4BQ5A 2HAZA 2X16A 3HI5H 2QDGA 1L7IL 4JG1L 4FFZL 5A8QA 4WFHE 1IAIH 2A6DB 2C3XA 5H94A 3QTGA 4OOUA 3TJIA 4U1IB 2IWFA 1T1XA 3QR2A 4P9HL 1G7VA 4H8QA 2FBJL 2R29H 4GRLB 2CO4A 5LAXB 1SPDA 2FVMA 1UKSA 4KEZA 1T7ZA 3BWSA 3VI3A 3T4YB 3QIBB 2HK0A 1XDLA 1TF4A 4AD0A 4WEEA 2A3BA 2HRHA 4HUUA 3QPQC 5BU6A 4KC3B 2D03L 3WS3A 3LMYA 4XI5D 3NZ1A 3P8JA 5HOSA 3QZWG 1XSKA 2E5EA 2Q7AA 4L5FE 3VCLA 3OG2A 4OZ4B 1U36A 3G3LA 1VHCA 4AU0A 5T8IA 5CIPA 3IB4A 3BPNC 5H1WA 3SQRA 4LJ3A 2CKBB 2WUCL 4J4PD 2Y0FA 5HQMA 4M29A 4IKNA 2JKSA 5I6KA 4AZ8A 3K2KA 3PK7A 5GRJL 1XSOA 4GVFA 5LNRA 1F6FB 3A6CL 1Z0NA 1JCJA 4HKXA 5E7FA 4FKKA 5BW6A 1OVDA 4FPSA 4L4LA 3LZ3A 3SURA 2WJFA 1KELL 2GBAA 3F2BA 1MLBA 2OZ8A 3K8MA 1WWWX 1MHHB 2EIZB 3CUPB 4Y1TA 3REVA 3TT3H 3UAJC 3V6ZA 2I32A 1J01A 5EU3B 3MLXH 1EYWA 2OPJA 4PJ7F 1SGJA 2JKWA 1KRMA 1W3NA 2Y8UA 4G1EB 4I0PD 1XIFA 3WLJA 1V05A 1EAJA 3VFNA 3ECBB 1MDLA 4JFYA 4UV4H 1TJXA 1PAZA 4NKDB 2E9MA 4L1BA 1HYSD 1YE6A 1HQ4B 3IDGA 3KS0H 1SOSA 5EZLB 3RZCC 3G1XA 2EDXA 3U1SH 3U79A 2NSQA 3QFJA 4UFMA 3S2LA 3KPLA 2O5XL 4LVGA 3AG2B 1WICA 2DJUA 2J7LA 3HNSL 2OMYA 3QFJD 4MJHA 1GY2A 1ND0B 2C1OB 3KEDA 3BJTA 4FULA 3TWCH 4ZUWA 2C7UA 3ABXA 4QHNA 4GG8A 1EAPA 1S5WA 4PRHA 1XGEA 1U8OB 4PGEB 3UPAA 1RVFL 2WO4A 3P6LA 4HIBA 1NWTA 5FYLL 1MJJA 1U2YA 3ARBA 4MGGA 1WBXA 4YO0A 2O5ZH 4UM8B 1S9YB 1SDAB 4GT0A 5T5NG 3ECVA 3KPLB 1NMAL 5IG7B 1PWLA 2H8XA 2PA6A 5HANA 2KLRA 3KJ6L 2Z91A 2BMKA 3PWVA 3O2VL 5GJTL 5L2JB 1LLZA