4TMBA

Crystal structure of old yellow enzyme from candida macedoniensis aku4588
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
390
structure length
390
Chain Sequence
b'YMNFDPKPLGDTNIFKPIKIGNNELKHRVVMPALTRMRAIAPGNIPNTEWAEEYYRQRSQYPGTLIITEGTFPSAQSGGYPNVPGIWSKEQLAEWKKIFNAIHENKSFVWVQLWVLGRQAWPEVLKKEGLRYDSATDDLYMGEEEKERALKANNPQHGITKEEIKQYIKEYVDAAKKAIDAGADGVQIHSANGYLLNQFLDPISNNRTDEYGGSIENRARFTLEVVDAVVDAVGAERTSIRFSPYGTFGTMSGGENPGIVAQYAYVIGELEKRARAGKRLAFIDLVEPRVTDPFLPEFEKWFKEGTNEFIYSIWKGPVLRVGNYALDPDQATLDSKKPNTLIGYGRSFIANPDLVYRLEKGLPLNKYDRNTFYTFTKEGYTDYPSYEESV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Old yellow enzyme
molecule tags Flavoprotein
source organism Kluyveromyces marxianus
publication title An Engineered Old Yellow Enzyme that Enables Efficient Synthesis of (4R,6R)-Actinol in a One-Pot Reduction System
pubmed doi rcsb
total genus 142
structure length 390
sequence length 390
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4tmbA00
1Q6OA 2VFGA 4NUWA 1WOBA 3ANYA 3F1QA 4RLIA 5D33A 1C29A 4NXSA 2VFDA 3LBCA 3L2IA 3A24A 3NQFA 2A7PA 1KW1A 3HGRA 4A2RA 2ZZ6A 4LNYA 4WJEA 1LYXA 4JTJA 4QM1A 1SFJA 1W37A 4MFEA 3NR0A 3PBUA 1M5WA 4NQ1A 4K7YA 4O15A 4G1KA 3MP3A 1T0OA 1DL3A 2R94A 1NVMA 3B0UX 6TIMA 4Y8FA 4QNWA 4IUOA 3D0CA 4AAJA 4JYDA 5FEPA 4NU7A 3GXNA 2CLEA 3G3MA 1S5WA 3PWAA 4PEKA 1VHNA 4WY0A 1VHCA 3KFTA 3W72A 3WK1A 1SUXA 3ELFA 4JTLA 2HMCA 1RV8A 1SO4A 4UCGA 5T26A 5LHEA 2ZA3A 1TB3A 1LRQA 1K02A 2VELA 3STCA 1XUUA 2C15A 3CWOX 4WD0A 3I7SA 2WNQA 4Y6GA 4FXSA 4P61A 3G1FA 2LLEA 3E12A 4WY0F 1W5NA 3RF9A 1SO6A 2ZZ7A 3H53A 4E38A 4JS3A 1B9BA 2DZWA 5DY2A 5CZJA 4K8HA 2QJHA 1WBHA 3L9CA 4JNMA 1EP3A 1EUNA 5FEXA 4TU1A 1OVDA 2EAWA 4IMDA 2G97A 2YX0A 3N19B 4O1BA 4MUZA 4N9DA 3GVGA 2EGZA 3NZ1A 2ZRWA 5LKYA 1TV8A 2WOQA 1N55A 1GQNA 3HG4A 4HNVA 1ICQA 1YXCA 5AB3A 4NZFA 1FY6A 1GYNA 3QC3A 3UQNA 3N2XA 2VEMA 1NFBA 5A8GA 1ZCOA 3CLMA 2J24A 1SQ7A 3P5YA 4A3UA 1X8FA 3LX9A 3CIWA 1XBZA 1I45A 3IIVA 1I4NA 3W7PA 5D04C 3BLIA 3O06A 2WKJA 1A5CA 1KA9F 2QCCA 1GT8A 1LZOA 2QJIA 3EX2A 2Z1BA 3TSDA 1Q6RA 3MYOA 3R2GA 4OV4A 3WJSA 3OA3A 5FEWA 4OV9A 1VZWA 3HOJA 5DCBA 4Q4KA 1KTCA 3NA8A 1AL7A 4O57A 4RK8A 3W7HA 3VKJA 4MJZA 2YFOA 5BNKA 2QDHA 4O50A 4ZQPA 2TRSA 1A5AA 4GNJA 4BR1A 1W5OA 4JY9A 4AMAA 3S5YA 3QM3A 2FB2A 3Q58A 4FB7A 2C1HA 3IIPA 3KVJA 3FKRA 3W86A 3SECA 3ZR4A 3BW2A 3LDVA 1SW3A 3NYZA 1AW5A 1KM3A 3NQEA 5K9DA 3P61A 2DZXA 3ATYA 3HGOA 2ZYFA 4M7TA 1YXYA 4JX6A 3M0ZA 2QCDA 3MHGA 3HO8A 2QAPA 1YXDA 2R14A 3IGSA 1G6CA 1TTPA 3N14A 2PE4A 3LRKA 3LXCA 1THFD 2WO5A 5FF3A 2AQWA 1LM1A 1VCFA 1GVFA 4NXKA 2H90A 3S1XA 1R2SA 2OJPA 3QEZA 3QPZA 5FF2A 1A50A 3S42A 1OJXA 3G0SA 3W7NA 1UBSA 3W1MA 1X1ZA 3MO7A 3T40A 5KSWA 2CW6A 3W23A 3A9IA 4XZ9A 4YCOA 5BOOA 3DI1A 3P81A 3I7QA 4PFMA 4OE7A 4EOUA 5D2VA 3TK7A 5KINA 2WNNA 4LVDA 4O1DA 4UFMA 2PCQA 4AH7A 1W3NA 3GDKA 3KOFA 3PM6A 3TQKA 1M7PA 1KFLA 2Z6IA 5I3GA 5D2YA 4BK9A 1G69A 1O60A 3NQVA 5DCEA 3TH6A 2DJLA 2GVGA 2NX9A 1YADA 4OWGA 3TC7A 3UWQA 2H3DA 3C52A 3U6WA 4CCDA 1FXQA 3LB0A 1TPEA 1GPWA 3N34A 1EP1A 3L0NA 2A1YA 4QNEA 2QKFA 4N2YA 1ZJIA 4KFOA 1GG1A 2GPTA 5HULA 2FQIA 4RR4A 1WA3A 1ALDA 3B03A 3BLFA 3KRUA 4HN4A 1AW2A 4PC8A 3W7CA 3QSRA 3YPIA 5KMYA 1H60A 4DPPA 2RH9A 2E1DA 4JR5A 4K36A 4TMCA 5AHNA 1KLZA 3LLFA 3NL6A 2FJKA 2ZFAA 3V75A 3THQA 5LSMA 4AEOA 3FFSA 1TQXA 1K8YA 1TRDA 3E96A 5I3FA 3PG9A 2RDWA 5AHMA 5C2XA 2QCMA 1OG0A 7TIMA 1VRDA 4HKPA 3C2RA 4Z1DA 1EP2A 5H91A 2ZCGA 2TMDA 3IEBA 4Y9AA 5LNVA 1XBVA 3PVFA 2B7QA 3LTYA 3W1TA 3LHVA 2P1FA 4PH6A 1OFOA 2V0TA 4ZQNA 4LVFA 3TJLA 5HJLA 1IXNA 1SSGA 5CPLA 3DKJA 5U7SA 3L21A 4LW7A 3IV3A 3SW6A 2ZZ2A 3VE7A 2C0AA 1GVRA 2Z2UA 3H55A 3LLDA 3P8JA 3SI9A 2ZRZA 1TRIA 1SFLA 3W7GA 4LU0A 1W8SA 2FIQA 2WSQA 3NQDA 4M6VA 4O0ZA 2YYTA 1MO0A 1RQEA 1TV5A 3L0GA 1N7KA 2J6XA 2C3ZA 3U2OA 1U83A 4ORMA 3S5OA 3C56A 1VYSX 1HO1A 4UIOA 5HR7A 3EX6A 2Y7FA 4RJEA 1EWDA 5G4EA 3T78A 2H6RA 1H7RA 2WPBA 4NVTA 1ZY9A 1LLZA 1H7NA 1K3UA 3L66A 3V1PA 1HTIA 3I7RA 5AC6A 1H62A 3QMRA 4M5PA 2O7QA 2TYSA 3QRHA 5DXYA 2O7SA 3R5EA 2G96A 3KRZA 1G4TA 2VEKA 2E09A 3G18A 3WJWA 4S2BA 4BWLC 5SWUA 2AAMA 2XN0A 4U4MA 1VYRA 4I7VA 2GJLA 2J27A 4CQ9A 1WX0A 1Z48A 4BFAA 4OGZA 1EPXA 1IGSA 3FIGA 1KM6A 2ALDA 2B7PA 3M47A 4JDBA 3VNDA 1TPB1 5DCDA 4LRTA 3UPWA 1IF2A 3MUXA 4O54A 2CZEA 3GK0A 1OABA 3EWXA 4A22A 3W73A 3E49A 3UWYA 3UWVA 2CLIA 3LERA 1XM3A 2RKXA 3THAA 4RZ5A 4JICA 3RFAA 3I68A 3CM4A 4XQ6A 4IX0A 3RNDA 1EUAA 3UXAA 4GFSA 4PA8A 3G0UA 3PF3A 3DH7A 3F03K 3PBWA 1MXSA 3CHVA 1DQWA 2NXIA 1YDOA 2YGYA 4UR7A 4IXHA 3UWUA 3E9AA 3L5LA 1WBJA 4JYFA 1OX5A 4FHAA 4ONVA 1TSIA 2ZQ0A 2PRMA 3ZFHA 3UZJA 3IIZA 2JKAA 4BF9A 2V81A 1I2QA 3BVJA 1JQVA 4MYXA 4U28A 5LGXA 3R12A 3CT7A 5A5WA 3HBLA 1GEQA 1BWLA 4WXYA 3W84A 3CWNA 3LRMA 5F4XA 2QEZA 3PB0A 1JULA 1HO4A 2A21A 4HPJA 1DJQA 5K2ZA 3LCWA 3QSTA 1OF8A 3W1NA 1JCMP 4XKYA 1FBAA 2BXVA 1ZALA 3L0KA 3EX4A 1KBIA 4UMBA 3HIJA 5LZLA 3LCLA 2ZRYA 1GJPA 1TPC1 3PS7A 4NNBA 4ZQOA 1YTEA 3W22A 3NAVA 5D02A 3N3MA 6ALDA 1DVJA 2DZVA 1SO5A 4IMFA 5EY5A 4JTEA 4O11A 1A5SA 5HINA 1D9EA 3EXSA 4UTIA 3MHFA 2C16A 4LC8A 4ZQCA 4KWVA 3IGXA 4M7SA 1GVSA 1MSSA 2BTMA 4X9SA 3MJYA 4WUIA 1QO5A 3W75A 3W1AA 2EPHA 3O6DA 1FCQA 4LC6A 2XN1A 2GJNA 5F1UA 3NPUA 2HSAA 1IIHA 1TO3A 2VOMA 2Y63A 3G0XA 1JCNA 5F2GA 1GTHA 3M16A 1LBMA 3KVMA 2A5HA 3EB2A 4WXZA 4MVAA 3TX9A 3M44A 3QW4B 5HWJA 4AVFA 1H50A 3LHWA 1AMKA 4JIPA 2ZZ5A 5DBTA 2YCEA 3S8HA 5DXXA 1IXPA 3GKAA 4DELA 3S6DA 5I3KA 3L67A 4AHOA 3NL3A 4M19A 3SZ8A 2GVLA 4HPXA 4WZHA 2WJZA 3RLUA 1XCFA 4X22A 3W2LA 2CLFA 1AL8A 3TE9A 4UFLA 2I14A 4J9JA 3SGZA 3BPWA 3GNNA 4AWTA 1TREA 4IJBA 3TQVA 4IQLA 3NQGA 2C13A 1LOSA 1KM4A 4CCCA 4GXMA 1ME7A 3PUOA 3RLVA 4FIRA 4RZ4A 4O53A 3MWAA 3PUDA 1SSDA 4UTTC 2C14A 5KZEA 4O8RA 2V82A 1MEHA 3NO5A 1I2NA 3FA5A 2DZTA 4QJ1A 3LHYA 1TPWA 3LCIA 2H8ZA 3TFXA 5E1QA 1F7BA 1UUMA 3P8IA 4AXKA 4K37A 5F2LA 4DO5A 1TPVA 5TQLA 1EA0A 1T99A 1HUVA 1EX5A 4OBTA 3QW3A 1KBJA 4OHQA 3W87A 3LXAA 2QCLA 4JDYA 4IWWA 3BG9A 3LGEA 1WOAA 3LHTA 3FKKA 3OIXA 4R34A 5FI8A 3JS3A 3SY5A 3O05A 2ABAA 5TIMA 5K9CA 5D2TA 1EEPA 1ME8A 1SU5A 1YLVA 2V2HA 3LI1A 5EMUA 2PRHA 1QWGA 3MHUA 1Z44A 2NX3A 5HWMA 2NUWA 1FWWA 3G3DA 2V9DA 4JGDA 3TMLA 3S0CA 1QMLA 4YLWA 2P10A 3HPXA 4JTKA 3NQMA 3CIXA 3TFCA 1VQTA 1L6SA 1KM2A 4O4VA 4GUFA 1RR2A 3GDRA 3FOKA 4AWSA 5TBOA 3DHFA 1YDVA 3KAOA 4RXGA 2QCNA 1PHQA 1G4PA 2DZUA 3S5ZA 2BLEA 3TDFA 5K7JA 2DORA 2XN2A 4UFKA 4GJ1A 3NL2A 1W56A 5CKSA 3MP4A 3Q94A 3T4CA 5HWNA 3DFSA 4MFDA 4LY8A 1OFRA 4JN6A 1XDLA 4P2VA 1F73A 3KVLA 1OFAA 3VI2A 1QNVA 1R2TA 3PY2A 3O6YX 3FJ6A 4MLJA 4FNTA 5LGZA 3G24A 5EYWA 1EIXA 1ZAIA 2DZSA 2C19A 5FF4A 4CQAA 2YDAA 4Z1AA 4UFIA 1D3GA 2DJXA 1YPIA 4XBSA 4JTIA 4AB4A 4CNOA 3QF0A 4FX7A 4HNUA 3MI6A 3NZRA 3TSMA 3GNDA 2F7FA 4AHPA 3P82A 1QPQA 4E2DA 1C9DA 2V5BA 3FYOA 5AC7A 4UTWC 4DXVA 3KHJA 4FO4A 3VFLA 4EWND 5AFDA 3LHUA 4JTUA 1FX6A 1GOXA 4WOZA 2FFCA 1F5ZA 1G4EA 3ZWTA 3LV6A 1L6YA 3NQ8A 4GWEA 2C18A 1TCDA 2NUYA 3HPZA 4O14A 2A0NA 2WSYA 4O16A 4BI7A 3TA6A 5DBUA 1J5TA 2J9ZA 3LV5A 3O1NA 2FB3A 1X7FA 2Z0IA 1UJPA 2AGKA 3IVTA 3SIZA 1PHWA 3W85A 4EF9A 1RD5A 3GAYA 1VJIA 3UNDA 2H3BA 2GVJA 1OFBA 3DGRA 4YMZA 4HIBA 8TIMA 2A7RA 3CU2A 1VGAA 3P84A 4HHPA 4DBEA 1JUKA 1KM5A 3SR7A 3A21A 3NEVA 1B4EA 3DFQA 4LS2A 5AC8A 1O5XA 4GRSA 1QR7A 3W74A 3NL5A 3LXBA 3MYPA 2E6AA 1KFCA 2FLIA 2ZDRA 3W7QA 5G2WA 5D2XA 1BTMA 4ZVJA 2Q8ZA 1OFQA 4QISA 3W1LA 2CFFA 3TXZA 2ATSA 3NPXA 4JEQA 4N6FA 4NJHA 1NAL1 4IXXA 4UNKA 1QAPA 1I8JA 5F2MA 5DLCA 4Z0JA 2UV8G 1PS9A 3GR8A 3PULA 1SR9A 5AYXA 5LNUA 1S3HA 1ONRA 3P62A 3DFTA 4H6KA 4TMBA 1Q45A 1GG0A 1BEUA 3JRKA 3GDLA 3TW7A 1OX4A 1JQXA 3B0VC 2YFNA 3PB2A 3W76A 1CW2A 2JGYA 3QMSA 4IMCA 3EEGA 3A23A 3MI2A 4XWUA 1ADOA 1F6PA 1Q6LA 1G7UA 4LS0A 1MZHA 4ALDA 3Q37A 3UXDA 5G1TA 3W7LA 4O52A 4OU1A 1KLYA 3QQ1A 3DXIA 3NM3A 4FXRA 4LV9A 4BI5A 5FF0A 1H5YA 3T55A 5H2ZA 5EA9A 1EWEA 3PBVA 1JUEA 2B0MA 5HMSA 3ZWSA 1S5VA 4C1LA 1FDZA 1Z42A 4O4WA 1FDYA 3G8RA 2VFFA 2I1OA 2EF9A 3OVRA 3NPVA 1FQ0A 2GQAA 3UD6A 5F1VA 4GUIA 3UZ5A 1Y0EA 3WJYA 1AG1O 1KTNA 1O95A 3LCFA 3QJAA 2CLMA 3L65A 5G2HA 3VCRA 3G1XA 3LI0A 5CZSA 1YPFA 4LVAA 5AOUA 3EWZA 4RZ6A 3AO0A 1VC4A 4GBUA 2J88A 4ICNA 5CPNA 3MW7A 1YYAA 4UTKA 1RQHA 4UNLA 1KFEA 4UTUA 3ABRA 3GXPA 3P74A 3GXTA 2B7OA 4JIQA 1FDJA 3C2FA 3T44A 3EXRA 5G2IA 4Q32A 4LVGA 4MPQA 4R53A 4IGHA 3S1UA 1F2JA 2EHHA 1W31A 1LCOA 3UY7A 3KXQA 3GIYA 3DI0A 1SZGA 1KFKA 3G1HA 3HG3A 3W7KA 1OK4A 3I65A 3B8DA 3W7JA 2ATMA 2VFHA 4GC4A 5EKYA 3W7IA 3L5AA 1LRTA 4TX9A 3M43A 4XUGA 5EBUA 1K7FA 4IX2A 3W7EA 3GDTA 3DENA 4JTTA 3CPRA 5F4WA 2ISVA 4ZQRA 4AWUA 1H7OA 3NDOA 4KFPA 2B7NA 2E68A 1OK6A 4L4LA 1FCBA 2QF7A 1ZFJA 3ATZA 4DF2A 2J9YA 3IGUA 2X1TA 3AJXA 3P80A 1KM1A 3U8GA 3CTLA 1PIIA 5L9FA 4GE8A 3TCEA 1AW1A 3LCHA 3GAKA 3TAOA 4ZMGA 4Z08A 1LOLA 3HQ1A 4O0KA 1VLIA 1DJNA 3RK8A 4QQ3A 2YPIA 3F4NA 4HNNA 1BKSA 1KV8A 3NQ2A 3PSVA 4O18A 3BG5A 2Y6ZA 3O63A 3UPBA 1ME9A 2ABBA 1W5QA 4DO4A 1N8FA 4KFNA 4QAIA 3M5ZA 1A53A 1NF0A 3QZEA 5HQEA 1LORA 3LCGA 1XDMA 3TU9A 4X2RA 3C2EA 3CQ0A 5D38A 4YCPA 2QCFA 2FPVA 4JXCA 3W1PA 3W9ZA 4IPIA 3W1XA 5BRBA 3S9YA 1TPUA 1PL9A 2A6LA 4ZZ9A 3HJZA 4NX5A 3QH2A 2ZA2A 3N2MA 4MKNA 3TJXA 2ZA1A 1G4SA 2DP3A 4OQVA 1D3HA 1LRNA 3W2NA 1OYBA 3R13A 4BI6A 5AHIA 1O4UA 1W1ZA 1H51A 2QCHA 3ZS4A 3GZ3A 3BLEA 4HSOA 1JCLA 4N9EA 2V2DA 3G1AA 3DFPA 3EWUA 4O17A 3P67A 1G7VA 4FIQA 2CLOA 3I6RA 3UWZA 3NPWA 1JCYA 4IMGA 4DEFA 2A7NA 5LNWA 5K4ZA 1JCXA 2OT0A 1TYGA 1TTJA 3MBFA 4OT7A 4PODA 3OVQA 3MI3A 3EWYA 3W1QA 2ZTJA 3R89A 2E6YA 2RFGA 2NXGA 3SFKA 4TO8A 3G1YA 3M5XA 4MZ1A 1JJKA 1XC4A 4M6PA 1OFPA 1ICSA 1WYIA 4XTIA 3OVPA 4QSHA 5AYZA 2A6NA 1MEWA 3M5VA 4W9TA 3ABOA 3PBYA 4MY9A 1TTQA 4MJMA 1K8ZA 3EWWA 2YXGA 5D30A 4FNUA 3FYPA 4JTGA 4D2JA 1E51A 1H7XA 2TSYA 4DO6A 5AYYA 3IVSA 2E5CA 2FDSA 3UY8A 1GZGA 4O13A 2G95A 1GYLA 4O12A 1LBLA 2QUTA 1H1YA 1VR6A 2FPTA 1O5KA 1HFBA 4XKYB 1GVQA 2HTMA 1TJPA 2D73A 3MP5A 3G22A 1A5BA 2VFEA 3IRDA 1P1XA 3NQAA 1OYAA 3HB9A 2ZZ3A 4S1FA 4UTJA 1EB3A 2BX7A 1LDCA 1VYPX 1SW0A 5K9XA 1RVGA 2VXNA 2YW4A 3OBKA 4FNRA 3DFOA 2CZ5A 1OYCA 5BMXA 1H7PA 3W6YA 1PCKA 1JVNA 4UXDA 2Q8LA 1T96A 3O16A 5CG7A 3TROA 5HR6A 5AHFA 1QPOA 4JX5A 4NT0A 1W5MA 3PC0A 3NG3A 1ZENA 4YL2A 5G4WA 1QPNA 1WV2A 1Z41A 5KZMA 3OHIA 1SZEA 2Y88A 1P4CA 3KVKA 1ZAHA 2H8XA 2VENA 3T7VA 2NXHA 1VLWA 3N73A 1PE1A 4O1CA 5K3VA 3LTPA 4NJGA 2I9EA 3G1DA 2Y62A 1VCVA 3M7WA 2PURA 3ABQA 4RCXA 5G5IA 1FWRA 4FEZA 3W7OA 1GVOA 4A29A 1P0KA 3GKFA 1DQXA 3C6CA 4JYEA 1P0NA 4JTHA 1ML1A 1M6JA 1XUZA 2Q3RA 2ZZ4A 3QPYA 4MLRA 4WY0B 1TPDA 1I2OA 2RHGA 1K8XA 2JGQA 1K7EA 1IXOA 3DZ1A 5CPMA 1L2UA 1SPQA 2W6RA 3HG5A 3H54A 3W07A 2ZZ1A 3W2JA 5J5RA 1HL2A 1NEYA 3BW3A 3ABSA 2CLLA 3M9YA 1VS1A 4R33A 3HGSA 1GWJA 1LBFA 5LNRA 2JK2A 2OMAA 3CEUA 5I3IA 4UTMA 2G5WA 3LRLA 1I2RA 3TQ0A 1ZNNA 4WX2A 3FS2A 4UFJA 1J2WA 2JBMA 4XTDA 1KM0A 5E0KA 3TKFA 3CEPA 1FXPA 1WQ5A 5AHEA 4IMEA 3GDMA 3SGUA 1QDSA 1W54A 2XFWA 5DY3A 3C8FA 5D32A 3W7RA 3LM7A 2NWSA 1O94A 5L6UA 3W88A 4LS1A 5FEZA 1OX4B 3STEA 4K6AA 3W1UA 5J5DA 5K4XA 2NZLA 1GTEA 2ZTKA 4N4PA 2QUUA 2RDUA 5U4NA 3IIXA 1KFJA 4AF0A 5G1YA 2ISWA 3W3OA 1FCUA 4FF7A 1LOQA 5D37A 4CNNA 3NOEA 2BSLA 3S5NA 4I9AA 4N9CA 4LT9A 3RMJA 1TIMA 4BWLA 1TV7A 3C2OA 3QFEA 3NQ7A 1B4KA 4CCEA 1CI1A 1UCWA 4L4MA 5FF7A 3TXVA 4UTHA 3N9RA 4XBKA 3BV4A 3STGA 4HT3A 4LUJA 3W1RA 5F2IA 1CX9A 4DQWA 4N02A 4ZQMA 3BGJA 5FESA 5BW6A 3BO9A 4ZL1A 3EX3A 4IPJA 3M41A 3DFNA 2QCGA 3PG8A 3QYQA 4GUGA 4WQ6A 3WK3A 3GB6A 1JR1A 3CB8A 1QFEA 3LTSA 1YDNA 1FWNA 5E93A 2QDGA 1WXJA 2OX1A 2V2CA 2YW3A 1DOSA 5ABTA 4NZJA 1H7WA 4FNSA 2A2IA 2VEIA 1FWSA 1XBXA 5GVJA 5D2WA 2ZRVA 4JY8A 1JUBA 5AN7A 1OFEA 2V8ZA 3TIMA 4FX6M 1F74A 4A21A 3F4WA 3FLUA 2QUVA 1KTBA 4I7UA 3GLCA 2Y7EA 4O28A 1WAUA 2NLIA 3INPA 2TPSA 3WJXA 1SO3A 3W7DA 1TPFA 3NQCA 1XL9A 3P60A 5DELA 4EF8A 1J4EA 2X16A 2Y61A 4DPQA 2VFIA 1IXQA 3CC1A 2NWRA 1R46A 3TNOA 1H63A 3DBPA 3NXFA 1DKWA 4CQ8A 4E2BA 1W5PA 2V5LA 2OT1A 1KFBA 4K8EA 4UMAA 4IOTA 4NJKA 3MMTA 4WOQA 3C4UA 3P7YA 1L9WA 4S2CA 1SW7A 5CGQA 2WV8A 4PL2A 5C5YA 3BGGA 5CZTA 3A5VA 4X3ZA 2NX1A 2YZRA 5AHLA 3STFA 3S1WA 4LVBA 2V30A 1QCWA 4KKXA 3SJ3A 4ADUA 1C8VA 5DN1A 4M6QA 3B06A 3G1VA 2NV2A 2GQ8A 3B04A 3S1VA 2JKPA 1SZFA 2F84A 3C3NA 3TR2A 4AF0B 3TAKA 1OHLA 1I2PA 5KTLA 5LHFA 1RZMA 1B3OA 4DF0A 1FUYA 4JTSA 1AK5A 5C6MA 1FWTA 2OCZA 2GOUA 3UYCA 1LLWA 3G8EA 2GQ9A 4DBDA 5CPOA 1TQJA 3DKLA 3VE9A 5HNRA 3NGJA 2CZFA 5BMWA 4HSNA 1W3IA 1BWKA 4O10A 1Q3NA 2QCEA 3OEXA 3IIOA 4ADTA 4GUJA 3W83A 2CLKA 2X1RA 4JX4A 4DF1A 4ORIA 4B5NA 2E77A 1WDWA 4MIMA 4MOZA 2BZNA 2IQTA 2VC6A 3G1SA 1OX6A 4YWIA 2Y7DA 3HG2A 3EKZA 3NVTA 3FEMA 3UWWA 1NSJA 1W0MA 3FJLA 3R8RA 4Y90A 2ZBTA 4E0CA 3C2VA 4JD4A 1TMHA 1H1ZA 2WNZA 2ZRXA 3W71A 3OG3A 3C61A 4CNPA 3QQ0A 4LOCA 2DZPA 1B57A 4C1KA 4UR8A 4ML9A 1NF7A 3B0PA 1R30A 2E6DA 3O15A 1UUOA 3BK0A 3HPSA 2KZHA 1UASA 2E5BA 4MY1A 3M5YA 2PRLA 2X30A 3RU6A 1TJRA 3P5ZA 1DBTA 3BW4A 4NJJA 4NX0A 3E0IA 4YXGA 4I7WA 3M1ZA 5CSSA 2JKEA 2C6QA 1TPH1 1H61A 4PTNA 1QOQA 4POCA 1MEIA 3O07A 5HUOA 4ADSA 2QAFA 3WK0A 5C55A 2DU2A 3NM1A 5EL1A 1JCJA 3W70A 1DHPA 2W0UA 1F05A 3TSBA 1OFDA 2NUXA 3LHZA 2ZRUA 2Y70A 3M6YA 1R2RA 1DV7A 2WQPA 4MZYA 4LUIA 3LBMA 2RDTA 3A22A 2Y85A 4K39A 4NJIA 2YYUA 2FTPA 3K30A 1VCGA 2NV1A 4TIMA 3BG3A 3L5MA 2HS6A 1K7XA 3E02A 4PL1A 5KITA 2A85A 4QITA 4QIUA 5CZ0A 4LRSA 3TW6A 3LOTA 3WK2A 3DU0A 3EWBX 3GX9A 1T8XA 4O1AA 2PC4A 4N6EA 5I3HA 3N9SA 2R91A 3EX1A 4R7JA 4EVZA 1YTKA 4H3DA 1X1OA 1P5BA 3PSWA 2OZ0A 4RXFA 1S5TA 2Y7GA 2GUUA 4LTSA 1RQBA 1LTDA 3W2UA 4LWWA 5I3JA 1XFBA 3EXTA 5D05A 1G67A 1XBYA 4UMCA 2R8WA 1XXXA 3L68A 4Z1BA 4MY8A 3TC6A 1L6WA 3MBDA 1VPXA 1JRBA 3B4UA 4H4IA 3WFAA 4EIVA 4Z1CA 3LCXA 3DAQA 4N9BA 2ISSA 2Z6JA 2W79A 4UUIA 1FCVA 3KRSA 1VH7A 1KV5A 3HGJA 2X1SA 4RX0A 2VEPA 5IBXA 1RPXA 4FNPA 2E5DA 5CSRA 3KX6A 1LROA 2CWNA 1TTIA 4HNTA 3TMQA 5C54A 2CLHA 1QO2A 1SZNA 1QPRA 1XI3A 3IVUA 2Y89A 4K7VA 1DORA 4FNQA 3HF3A 2EKCA 1ZAJA 4Y96A 1PV8A 4Z0SA 1PCWA 1HG3A 1PVNA 4UC5A 3QMTA 3A5FA 5D09A 4MZ8A 5D03A 1M7OA 1JRCA 2VKZG 4N4QA 3GR7A 2E6FA 1UB3A 3TUUA 1YTDA 3DHDA 4A2SA 3W2KA 4K38A 1ICPA 3EKLA 4PCFA 1Q6QA 3W2MA 2J9XA 1R47A 4AHQA 4UTWA 3TV8A 2YR1A 4TR9A 1IIGA 5F4SA 5IM51 2Q3OA 3SSJA 1LP6A 2WSRA 4UFHA 2BWGA 1U5JA 1V7YA 3O6CA 3PUEA 3PAJA 4UTTA 3PR2A 2QR6A 2CZDA 1F6KA 3JR2A 2QJGA 2HS8A 1XKYA 4KWWA 1QOPA 3Q2DA 1W3TA 4O19A 4FX8A 2X1UA 4RV8A 3GYEA 5MHBA 4NNAA 5HUPA 5LNSA 3NQ6A 3O8AA 3WJZA 1X6UA 4RKAA 1ZHAA 2P0OA 2QCDB 2B4GA 1F76A 1OF6A 4CLMA 3USBA 3B05A 3HMJG 4MYAA 4UTLA 4LV4A 2X2GA 5IBXC 3W7MA 2A4AA 3NNTA 1V5XA 1K03A 2CU0A 2YSWA 3BARA 4JTFA 5EPDA 4NNCA 5KZDA 2FPYA 3C0JA 4GUHA 4Q33A
chains in the Genus database with same CATH superfamily
4HTBA 2VFGA 4OKDA 3ANYA 4OOZA 2VFDA 4J35A 3L2IA 4J3ZA 3A24A 1LJYA 2XM1A 1ZL1A 2YA1A 1V08A 3BCFA 1KW1A 5A6BA 2W91A 4WJEA 4HA1A 1LYXA 4JTJA 4EACA 1SFJA 3RDKA 4MFEA 5D9NA 2FGZA 1W9BM 1TWSA 4K7YA 4G1KA 2HE5A 1DL3A 4R85A 2Y4SA 5DT5A 3ZJKA 3WQCA 2IKJA 1RCOB 2ZE0A 2CLEA 4L80A 2O55A 4A6GA 3FY1A 2Z26A 4CEXC 1XSIA 4FR1A 4N7QA 4LAKA 1RV8A 1SO4A 2VGIA 2C15A 4MWAE 2WNQA 1VIWA 1W9PA 3BWWA 4FXSA 3G1FA 2CHRA 1KO0A 4Q7BA 3RF9A 3RPMA 1Z89A 4JS3A 2ZKMX 1QK2A 1XLHA 5CZJA 2QJHA 4GO8A 1WBHA 4JNMA 3VTRA 5BCAA 1H41A 2J62A 1OVDA 1IEWA 1ZLPA 2INFA 4RUBA 3GVGA 4BJHA 5A6AA 3NZ1A 3ZSSA 4LCSA 2YCKX 6PTDA 4OIFA 3WLQA 5AVNA 1GQNA 4C6MA 1WO2A 1ICQA 3BLKA 3V0SA 3B9EA 3QC3A 1PZ2A 5A8GA 3CLMA 3EMQA 4EPEC 2J24A 3AYRA 1CPUA 2OKTA 4A3UA 4J2PA 4W84A 3SQMA 3WNMA 4HP5A 1D8CA 2GDVA 1A5CA 4C5YA 4HNCA 4ZFCA 5BYWA 1FP8A 3N11A 4LUSA 2QJIA 3ZLHA 2Z1BA 2J78A 5ECUA 3WQ6A 4HZ8A 4BZYA 5I0DA 4OV4A 5FEWA 4OBSA 1WZAA 4OV9A 1VZWA 1B54A 5ECVA 3N15A 4O57A 5M5DA 3GIQA 2YFOA 2QDHA 3GHUA 3CS2A 1ZBCA 4DJDD 4DJEA 2NSXA 1A5AA 2HISA 4BR1A 2NLYA 2PTXA 4JY9A 3QM3A 4MB4A 1RH9A 1ADDA 5BRQA 3SFWA 3ZR4A 1ZJHA 3QV8A 3I3EA 5B7ZA 3P61A 3FA4A 3E5BA 2ZYFA 1GKRA 2QMJA 4M7TA 5FJRA 1QI5A 2Y8UA 4JX6A 3HO8A 3TNBA 3ORWA 3R0UA 1S2WA 2QIIA 1J11A 2PE4A 3LRKA 3LXCA 4HU3A 2AQWA 1LM1A 4CQDA 1GVFA 3S1XA 1P0BA 1KR0A 3LBOA 2OJPA 3QPZA 2DSZA 1E6PA 4L5ZA 1OJXA 3W1MA 5A95A 2PEVA 3B8UA 2CW6A 1FKXA 4Q8NA 3GW3A 4XZ9A 1CTNA 2XVKA 2P53A 2XVPA 4PFMA 3WQDA 2NT0A 4OE7A 4QLLA 4JQ3A 3A6OA 1XG4A 4LVDA 4O1DA 4UFMA 4DWSB 4F0SA 4AH7A 2ZX7A 3KOFA 3MWCA 1NTHA 3PM6A 4MWAC 2CNCA 1E3XA 3VGFA 1VPQA 3TH6A 2DJLA 1GOWA 5BROA 3KP0A 2GVGA 2D2JA 4OWGA 3UXIA 3UJEA 2EJAA 3DESA 2H3DA 4UTFA 2XZ9A 4CCDA 1OCBA 3K4WA 3LB0A 6A3HA 1GPWA 4DWSD 2PSNA 3WNOA 3U7BA 1EP1A 2CETA 3WEMA 4PCPA 5XIMA 2CYGA 4N2YA 2GFTA 5JBFA 1KNWA 3LYEA 1YIXA 1A4LA 1R9ZA 2GPTA 5HULA 4QLKA 4RR4A 4PUMA 3W7CA 5KMYA 3QSRA 3U7VA 3DDMA 3U48A 4F3HA 2RH9A 1MQQA 2E1DA 3N29A 3EMCA 2V5KA 1NDZA 5CCZA 5HBFA 5AHNA 2DUZA 2VC7A 1UWAA 1LT7A 2O56A 1TRDA 3TTYA 3GHRA 1UG6A 2HXUA 5D8ZA 4Z1DA 1EP2A 5LNVA 1KXTA 3PVFA 2B7QA 4HMDA 3T6CA 4UQBA 1EQCA 3JVAA 3E2SA 1TA3B 3M07A 1BYAA 4DHGA 3CXOA 5HJLA 1J9YA 3CUIA 1IXNA 5CPLA 1Y8BA 5CGTA 5U7SA 4LW7A 1EPVA 1DIEA 3B40A 3SW6A 4A8RA 2EJ1A 1HL9A 2C0AA 4WJ8A 1GVRA 1WDSA 3CO8A 3SI9A 3I10A 2D1ZA 1FHUA 5GNYA 5HPOA 2WSQA 1MO0A 1TV5A 1QNOA 2PWDA 4ZA0A 1VYSX 3N4EA 1V0MA 1H7RA 3VIHA 3WMBA 2WPBA 1LLZA 3I3DA 3SIMA 1H7NA 3VKAA 2WMIB 3L66A 3WIJA 3V1PA 1HTIA 3I7RA 1QNSA 3MSDA 3CTTA 4RE4A 2I5QA 1AUSL 4E3VA 2D69A 3AIUA 4PRWA 3WMCA 3EOSA 2VEKA 3WBXA 2E09A 1XICA 1VYRA 1Z48A 1HGYA 4BFAA 4OGZA 4A05A 3FIGA 1KM6A 1UPPA 2ALDA 3UJSA 2WWDA 1YQ2A 3VC5A 4LRTA 1IF2A 3G6MA 2CZEA 3FW6A 3W73A 1HW6A 5AECA 1CWYA 1N82A 1GZJA 4J3UA 4JICA 1ISVA 3CM4A 2V3FA 1PWLA 4C5ZA 3I6EA 4JTRA 2G50A 3CPGA 3UXAA 3R6IA 3PF3A 1R87A 3DH7A 1C91A 1UWRA 3ARSA 5I03A 1SJBA 3OB8A 3P6LA 2BOEX 3GNOA 1A3WA 1YDOA 5I78A 3W81A 1GVIA 4JYFA 4Y2WA 1XLBA 3WEOA 1TSIA 4XK2A 1K9TA 2D0HA 3UZJA 1DWAM 1I2QA 3GBDA 1JI1A 3CT7A 2C71A 5A5WA 4B2DD 3OHMB 2OZ8A 4WXYA 2QEZA 4YWSA 5LA1A 1JULA 1UH3A 2ACRA 1HO4A 2WZTA 1BF6A 2V3GA 4AQLA 3I4EA 3W1NA 6CGTA 4XKYA 4DZIA 1ZALA 4HCDA 4MNJA 3VGDA 3GNPA 5LZLA 3LCLA 1H49A 2E8YA 2V5DA 1Q63A 3NAVA 3N3MA 1M3UA 4HYRA 3B97A 4JTEA 1A5SA 5DQPA 3JZUA 2FTWA 4IGNA 5HINA 2C16A 1QHPA 3IGXA 1MSSA 4X9SA 3PAOA 4S3BA 2V68A 2NQ5A 4ROQA 4BQ3A 4H41A 2GJNA 5F1UA 1OG6A 4KPLA 4Z2HA 2VOMA 2PDXA 3DUGA 1P1MA 4PMOA 1TKKA 1EKOA 3M16A 2Y0FA 4IG2A 4MVAA 2W5FA 3I6TA 3TX9A 2BVDA 1DPMA 2GYIA 4AVFA 3AUJA 3GNXA 1BVZA 3KBSA 3UGVA 5DXXA 3GKAA 4DELA 3PJUA 4AVOA 4AHOA 3L67A 3UW6A 2GVLA 4B5XA 4HPXA 1FWFC 1XCFA 3RLUA 4X22A 1UZHA 2OGJA 3TE9A 1RUSA 1NOWA 3A47A 3SGZA 4OOUA 1TREA 3JUGA 1XCXA 1IEVA 4IQLA 3NQGA 2C13A 3UCQA 3KL3A 3RGTA 1EJWC 2G3NA 4GXMA 1ESWA 4FIRA 4TVUA 2UBPC 3PUDA 4DZHA 1SSDA 2J66A 4NKCA 5CSYA 3RX2A 1AZ1A 3NO5A 1VFOA 4QJ1A 1XX1A 5IFPA 3LCIA 2H8ZA 3TFXA 2YZ5A 2PP0A 4AXKA 4DJED 3WDIA 1HUVA 1UOKA 3QW3A 4ZFMA 3WQPA 3A4WA 4X2PA 5I2UA 1V4YA 4OVXA 4IWWA 3TZNA 2XHYA 1XIIA 3OIXA 3IJ6A 4MWAD 1V6WA 3O05A 2ABAA 5TIMA 1YLVA 3VIIA 1QWGA 2HXTA 1FWWA 4XZIA 5JUVA 1Q7MA 2P10A 3NQMA 4JFTA 4GUFA 4X0VA 5CZKA 3MY9A 3FOKA 1VENA 4AWSA 3DHFA 3UZZA 1HIZA 3CAVA 3H70A 4ACZB 4J1OA 1O12A 2VNCA 3TDFA 5HPCA 2XN2A 3MP4A 2AKMA 4GIEA 3TWAA 2ZXAA 3DFSA 3T4WA 4LY8A 1DYSA 4JN6A 3GD6A 1XDLA 4P2VA 4UQAA 1EDTA 3VI2A 1QNVA 2O4QA 3ZO9A 1B1YA 4ZE4A 4B16A 4MLJA 1ZSXA 3G24A 1JI2A 3OVGA 4X0NA 2YDAA 4J3SA 4FZIA 4AB4A 1D3GA 1YPIA 4QE4A 4FX7A 2VYOA 1YKWA 3GNDA 1NWUA 3P82A 1PWMA 5AYIA 1C9DA 4FO4A 4JTUA 3GTFA 1XLIA 3WNKA 2DH3A 3L2LA 2P5NA 1OM0A 2HBVA 4O14A 2AKZA 3TA6A 5DBUA 1J5TA 1U22A 4A8NA 2EPLX 3N9KA 5CEWA 3MCOA 2FB3A 4XBJA 1X7FA 1UJPA 2WZMA 1PHWA 3SIZA 1RD5A 2ZDSA 3ZLFA 2QW5A 4QAWA 4YMZA 3QZAA 2A7RA 3C2YA 4YHGA 1DQUA 3VGGA 2WSPA 3A21A 3HFYA 3POCA 1J2BA 3XISA 3NL5A 4C6EA 4ZO8A 2E6AA 2QGHA 1RCQA 1SZRA 1BTMA 3PZQA 3GDBA 2Q8ZA 3AI0A 1QK0A 3W1LA 1CEOA 4LUTA 5I23A 4N6FA 4GY0A 4KCUA 1QAPA 4F2TA 1I8JA 1HN1A 4Z0JA 1SR9A 3N2BA 3PULA 1XLKA 1ZTVA 4IT1A 1R85A 2A79A 3DFTA 1BEUA 3JRKA 1S5NA 3TW7A 2BFGA 1G0CA 1OX4A 2YFNA 4H2CA 3PB2A 5CGMA 4HZ7A 2J25A 1MUWA 4XWUA 1K6AA 1G7UA 1GORA 4BY3A 2R82A 4ALDA 4L61A 3Q37A 3UXDA 5G1TA 8A3HA 3B0XA 3KL5A 3QQ1A 1VBUA 4LV9A 5DF0A 5FF0A 3GWQA 3M0HA 2FYMA 4NP7A 4ZTYA 1BVNP 3OZMA 5JH1A 1FDZA 3SN1A 2XGZA 1O5RA 4RPQA 2VFFA 4YU1A 4A3QA 2GQAA 2IS7A 3UJFA 4GUIA 1Y0EA 2V67A 1KTNA 3EEZA 1QU4A 2Y8VA 2CLMA 2C0HA 3HV8A 5G2HA 2YLAA 5LYRA 3G1XA 1ZZMA 5AVHA 3QR1A 5CZSA 1YPFA 4LVAA 4H19A 1E9LA 1V77A 3IUHA 4GBUA 2J88A 3B9AA 1I1XA 3MW7A 1YYAA 3UA4A 4UTKA 3WKZA 4UTUA 2WM0A 3GXPA 1UW9A 1GQIA 3C2FA 1NQKA 3CAKA 4LQ1A 3W6LA 3ICJA 3KOYA 4R53A 3S1UA 2V5CA 3IAQA 1LCOA 2DZBA 4PUDA 2QQ6A 1IWAA 3KXQA 2FH6A 3DI0A 3G1HA 1XLFA 1H1NA 1VAHA 3W7JA 2ATMA 4GC4A 5EKYA 4TX9A 5EBUA 4FAMA 1JIBA 4AWUA 2E68A 3ATZA 2CKRA 3PJTA 3QOKA 3T07A 3EOOA 3ARQA 3AAMA 2OO0A 3CBWA 3ITCA 4RNJA 3CAQA 2J79A 1KR1A 3U8GA 1EDQA 2P76A 1KQZA 1R9XA 3W29A 2PF8A 3TCEA 3FHAA 2VVNA 1OC5A 3QV7A 3LCHA 3GAKA 3NDZA 4J3WA 3HQ1A 4M51A 4NYYA 2PU1A 4QQ3A 1KV8A 2ZXQA 4DJFA 4O18A 3BG5A 4O1EA 1N8FA 4GX9A 2VX4A 2WJFA 3N1AA 3B9NA 1NF0A 3QZEA 3VIMA 2R1NA 5HQEA 2WAGA 1EYEA 3GH4A 1XINA 1TV4A 1E6QM 1QI4A 3H26A 3VDCA 4JXCA 3QV6A 3W9ZA 3M0YA 2C79A 3R94A 3CZLA 4U33A 3EA1A 3GSMA 1PKMA 4J4KA 4MKNA 2WJDA 1J0YA 4E8CA 1G9HA 2DP3A 4OQVA 1C3FA 4QCEA 1P7TA 3ES8A 1CXLA 2NVCA 4ZOEA 1OYBA 1H51A 2PTYA 3QLLA 4C7DA 4FALA 1JCLA 1AQHA 3NQBA 1NU5A 1OC6A 4P7RA 2PP1A 3G1AA 1QWKA 3DFPA 1HJWA 1I6NA 3P67A 3T2OA 1R3RA 2GLKA 3R25A 4L1GA 5K4ZA 4H8VA 2B81A 4WDTA 1JDCA 2Q71A 3GR4A 4U2ZA 2ZTJA 2Z28A 3R89A 2RFGA 4L6OA 1VFSA 4Q8MA 4TO8A 3BLPX 1R86A 1XC4A 1TG7A 3SDOA 4M6PA 4Q6JA 1WYIA 3ZT7A 3OVPA 3GU9A 1W17A 2VRKA 2G3MA 1U30A 1RJPA 1TUFA 3M5VA 3RRXA 4BF7A 4XAPA 3EWWA 4G6CA 5CAHA 1DP0A 1H7XA 5AYYA 3K46A 4LANA 5BOEA 2C8NA 4O13A 4IQJA 2ZADA 3WQ5A 4HD5A 1GYLA 4O12A 1LBLA 2QUTA 4J3VA 1H1YA 2FPTA 4CD5A 4XKYB 1JZ3A 2HTMA 3MP5A 1A5BA 3IRDA 1P1XA 3DC0A 2HVOA 4H2HA 3HB9A 4QSFA 3R79A 3ES7A 5BWAA 5K9XA 3OBKA 3DFOA 4PEEA 1G5AA 1LG1A 3LMZA 2PA6A 3H2FA 2CWXA 3ZT6A 3W6YA 1T8QA 2WWCA 1T96A 1VBJA 1B3ZA 3O16A 5CG7A 3TROA 1MNZA 4JNYA 4UOJA 1QPOA 4P5UA 1S39A 3KBWA 2WPGA 1ZENA 4D6DA 3W4RA 1QPNA 1Z41A 1SZEA 2Y88A 1XDJA 4M3PA 3KVKA 3RIKA 1JDDA 1KRCC 2VGBA 3T7VA 3T05A 1MZRA 2X1IA 2G3FA 1PE1A 1A3XA 3LTPA 4NJGA 1VEOA 2Y62A 4RCXA 1WCGA 3M7WA 5G5IA 5CPSA 1FWRA 1U1JA 3GVQA 4A29A 1P0KA 3SEPA 4C6JA 3C6CA 4IF2A 2OSYA 4AY7A 5LIKX 2PDBA 4PMJA 4RDVA 1XUZA 4MLRA 3AZTA 1US2A 2FFIA 1R7AA 3K8KA 4Z2KA 1K7EA 4Z2IA 1IXOA 3AQUA 3VILA 4XAGA 1ECEA 3COTA 3GTHA 3HG5A 4XSMA 3S4TA 1IV8A 4KQNA 1EOKA 2Z27A 4A8LA 4IH3A 3M9YA 1VS1A 1LBFA 1C93A 3PZ9A 3GNRA 5C71A 4DYJA 1I2RA 4P8VA 1HKMA 3CQJA 1X97A 4XTDA 5E0KA 3BJSA 3W38A 4B91A 3GDMA 2P0IA 2TODA 6XIAA 1QDSA 1W54A 3C8FA 1PSCA 4Y9OA 2NWSA 4ZEPA 3M0LA 4P8WA 4F9JA 4TOQA 1VD6A 2NZLA 2RDUA 4GG9A 1RSCA 1RY8A 3IIXA 4AF0A 3THUA 3SUUA 1UWTA 3RXZA 4AZCB 1FCUA 3QOMA 3NOEA 3A3HA 4N9CA 3AICA 1TMLA 3RMJA 3ZVIA 1XG3A 3QFEA 3DHUA 3WUGA 1B4KA 1MWOA 1UCWA 4EP8C 4HT3A 4LUJA 3FDGA 4GYPC 4N02A 1J0ZA 2XU2A 1B2YA 2ALRA 5CJMA 4ZL1A 3GHSA 3QYQA 3WNPA 1A47A 4A8IA 4MM1A 2OG9A 5A2AA 2QJNA 4L65A 1GONA 4QR6A 3PP7A 2WW5A 4HMNA 4AWEA 4B5WA 2O9OA 3KLKA 2V2CA 5ABTA 1ITUA 4NZJA 1AJ0A 2VEIA 4HJFA 1FWSA 1XBXA 5GVJA 4JY8A 4FPSA 1YE4A 5BXTA 5AN7A 2E1WA 4FX6M 4F9DA 3PBGA 4A21A 2QUVA 2REQA 3GLCA 2Y7EA 3INPA 1Y5XA 2QZRA 3KUMA 1TPFA 1XL9A 4DXXA 3P60A 1CGUA 5C9RA 2F6UA 1EJUC 2X16A 4AYSA 1E4MM 1E72M 1UD3A 1HNYA 3S6OA 4E4FA 3TNOA 4GH1A 4A4AA 1Q7QA 3QN3A 3NXFA 1DKWA 2OWXA 4UBPC 1KFBA 4K8EA 4UMAA 1VJZA 1MW3A 2DIEA 4RW5A 3Q67A 4ZB0A 3WO8A 1UR8A 3CQIA 1QBBA 2BMBA 3ALFA 4DJEC 3BGGA 3RYSA 3VM5A 2GJPA 5D9MA 3E0LA 8CGTA 2YZRA 2OZ3A 2V30A 2WLZA 4KKXA 4ML4A 4XX6A 1RK6A 3AHTA 4WSKA 5DMLA 2NV2A 4BF5A 1XIEA 2BS9A 3VD3A 4XZHA 3K1DA 4AZCA 2ZUNA 4AF0B 1OHLA 4IZGA 1FKWA 5KTLA 5LHFA 1B3OA 3KTSA 3UG4A 1AK5A 3ARYA 5FCZA 3WQFA 2CESA 1LLWA 3G8EA 3WENA 1OWQA 2ZUUA 2GQ9A 3M0KA 4DVOA 4MB1A 3CGTA 3KZPA 4UWMA 7A3HA 5M1TA 1M9HA 2HV5A 1W3IA 4O10A 1Q3NA 3IIOA 4ADTA 4IUGA 2F6KA 1PX4A 2I57A 1EGMA 4JX4A 1GHSA 3NTYA 4MB3A 4MIMA 2Y7DA 4LEQA 3EKZA 3S1GA 1GW9A 3FEMA 3MSRA 2XFYA 1W0MA 3FJLA 2DW7A 3C2VA 1SR0A 3U5YA 1H1ZA 4JIHA 2FKPA 2ZRXA 3OG3A 4JHZA 3QGAC 3MDUA 3DYOA 4C1KA 4ML9A 3VD7A 3CZGA 3AMKA 2AL2A 1QHZA 3M5YA 4Q4MA 1AFSA 3QTPA 1ELSA 3VCNA 3NXLA 5DRCA 2WMFA 3BW4A 4NX0A 1TE6A 3WZ0E 2J6VA 3H4XA 1K4GA 3BOFA 2CZVA 1CGWA 4ADSA 2QAFA 2YLLA 3WK0A 5E5CA 5EL1A 4UB9A 3W70A 1DHPA 4PMRA 2PD9A 6ENLA 2XIJA 3TYCA 1EH9A 1UMYA 3M6YA 2YJQA 3UCCA 1EF3A 1RLCL 3F4VA 5M3WA 3A22A 3SURA 3NEHA 2YYUA 4ICMA 3T81A 4LYQA 3UF9A 1VCGA 2WQDA 4LALA 4PL1A 2ZICA 2YA0A 4LRSA 2EPMX 3TYAA 2CBIA 3WK2A 3GW0A 3H2MA 3MKCA 4PTVA 3VNIA 4N6EA 1E71M 3EX1A 3WBYA 2BGNE 2WBGA 4TX8A 2NQHA 3QR0A 4LTSA 3MANA 3M0XA 3T0DA 3UT0A 3W2UA 4LWWA 5EMKA 1W6TA 5D05A 4UMCA 4Z1BA 3RN6A 2I9UA 4LCRA 3F2CA 3KBJA 3K4AA 1M7XA 1MQPA 2C7FA 2ZWYA 1P0DA 3KRSA 2OQHA 4UOZA 1KV5A 2X1SA 4RX0A 3U4FA 4K2SA 1CGTA 3KX6A 2X8RA 4HNTA 3N6JA 4JCLA 4UZSA 1BPLB 1QO2A 2CLHA 3D47A 1QVBA 1P6CA 3ZLGA 2Y89A 1DORA 2A3HA 5I7GA 5C0QA 1K9FA 4Y96A 3L4XA 1JCTA 1LG2A 2UY2A 3QMTA 1PTAA 3TJ4A 5C9XA 2YKKA 3UPMA 4QCFA 1OIFA 1TX2A 2VKZG 4N4QA 3GR7A 3WNNA 1UB3A 4Z42C 3GZAA 3W2KA 4PCFA 4U3CA 2XG9A 2ZX9A 3W2MA 3TA9A 3CL7A 4AHQA 1ITCA 3TV8A 4PBFA 1ISYA 1IIGA 2RUSA 4KMQA 5IM51 4GYJA 4R3UA 1UBPC 1XYCA 2DSVA 1IT0A 2WSRA 1U5JA 3PTQA 1V7YA 3O6CA 4C91A 4NZ4A 3PR2A 1HX0A 2QR6A 1YX1A 2QJGA 2J7EA 5C9UA 4JCMA 4KWWA 4YS1A 1W3TA 2E7FA 1DXFA 4PR4A 4YTRA 2RGLA 2HJPA 3WDRA 5HUPA 5LNSA 3NQ6A 1RPKA 2B4GA 1W9VA 1OF6A 3USBA 3U2EA 3TN3A 1JZ7A 1S3TC 1DJWA 5IBXC 2A4AA 1IZKA 2JF6A 3AXMA 1UIOA 5EPDA 5KZDA 2FPYA 2PCEA 2WMIA 4QJ3B 2CXGA 4AFYA 2OFJA 4I9MA 3BDKA 1ONEA 2VCBA 1WOBA 3CNYA 4RLIA 1C29A 4INFA 1LQ0A 2OVLA 3LBCA 4U5KA 1C7TA 3EB3A 3AALA 5A6JA 3IK2A 3VIGA 3VGBA 5ENLA 4AD5A 2ZZ6A 4C6LA 4KW2A 2R1KA 3BJTA 3CZ8A 1W37A 4W4QA 3NR0A 1RY0A 3PBUA 4AMCA 3PPGA 3AIQA 1M5WA 4AIUA 3FSUA 4O15A 1HVXA 3MP3A 2PLMA 4LBRA 4RDZA 2ZOXA 2R94A 2J74A 3GU2A 4IFKA 2OU4A 4QNWA 5LIWX 1MNSA 4NU7A 2PBOA 2QMKA 3PWAA 1UD4A 2DQXA 1VHCA 5PTDA 4DJDA 1KCLA 2WKLA 2Y5JA 1BWVA 3ELFA 1XLGA 5LHEA 1TB3A 2VELA 3STCA 3FX4A 3M46A 3NWRA 4P61A 1OT1A 3GTXA 4WY0F 1SO6A 4MAZA 2WBKA 5DY2A 3L9CA 5C2GA 3ITTA 4IMDA 3N19B 2DQWA 5LXXA 2FHBA 2XYLA 3KEHA 1N55A 3N4AA 4KWUA 1YXCA 4NZFA 1FY6A 1GYNA 3TTQA 2CC0A 4FOKA 1IQ8A 1WPCA 3UQNA 4FLRA 2VEMA 1ZCOA 1PAMA 4HGXA 3P5YA 2UY3A 1XCWA 2HPMA 3W7PA 1EDGA 5D04C 2VX7A 3UU0A 2WKJA 2F61A 3M0MA 1XLLA 1KA9F 1GT8A 5HMDA 1LZOA 3EX2A 3TSDA 1A0EA 3R2GA 4YN5A 3F5JA 3M7SA 3HZ3A 2D3NA 1G01A 4D8ZA 1E6NA 4AUBA 3TYUA 5FJTA 1SM9A 4I3GA 4O50A 4ZQPA 2Z25A 2TRSA 4GNJA 5E09A 4AMAA 3ABZA 4M29A 1JF6A 3KVJA 3FKRA 3W86A 3R4IA 2BVWA 4D8AA 4F0RA 1AW5A 3NQEA 5K9DA 4JQ1A 3S83A 3ATYA 4GI9A 3VM7A 2PDYA 3D3AA 1YXYA 2QCDA 3E0FA 3MHGA 1YXDA 2R14A 4KH2A 1TTPA 1THFD 1QNRA 4XUYA 4HA0A 2Q01A 1R2SA 3ZMRA 5CBJA 4PCSA 5FF2A 2HDJA 3N6HA 3G0SA 4UOQA 4JFSA 3WLNA 3T40A 1WDDA 3O0KA 5KSWA 4D1JA 1O7AA 2HPIA 2QYGA 3LZ3A 3A9IA 4YCOA 1TUXA 5BOOA 4F0MA 2BGQA 3I7QA 3UGRA 7TAAA 1LLOA 3TK7A 2WNNA 3ARVA 3QGVA 2BV9A 3DECA 3WF2A 3E1F1 2P3ZA 5I3GA 1G69A 1ZP3A 2NX9A 3ENLA 3UWQA 4D6FA 3U6WA 1FXQA 3RO8A 1V3HA 4QNEA 1VIZA 3KS6A 4Z2GA 4DO7A 4B4HA 1ZJIA 1PBGA 1FWHC 2FQIA 3IANA 3QY6A 2AGTA 3BLFA 4PC8A 3NGFA 4DPPA 3GUWA 1UA3A 3F5KA 3OYZA 2ON3A 1J96A 1YNQA 1MRQA 2PBGA 3NL6A 2FJKA 3LPPA 4CQBA 4DAFA 1K8YA 2PWVA 5I3FA 1UOZA 5I79A 2RDWA 5AHMA 3RUBL 2QCMA 1OG0A 4S3EA 3PN8A 3URQA 1HKWA 3VVGA 4GACA 1BXBA 1XBVA 4DJFC 3A3XA 3W1TA 3LHVA 4B15A 3WELA 1DJZA 4B5TA 3TJLA 1Z32X 3AZSA 2JEPA 3SCSA 1VFHA 1SSGA 4PUJA 3DKJA 3L21A 2ZXBA 3IV3A 3ITOA 4X9YA 2ZZ2A 2YBUA 3VE7A 4GQBA 4XSLA 2OLSA 3H55A 2R24A 3SM0A 2WK2A 4PMZA 1TRIA 1SFLA 3W7GA 4LU0A 1KRAC 1U33A 3EOUA 3NQDA 2Y8KA 3LY0A 3U2OA 1OGSA 1U83A 4ORMA 3S5OA 3C56A 4DLMA 4DRSA 1MFVA 1VEMA 5G4EA 2AOSA 3T78A 2H6RA 1WDQA 4NVTA 1V03A 1ZY9A 1HQTA 4LPCA 3MZNA 1EJTC 3RM4A 4YNGA 3GU1A 4BQ5A 1B5TA 2AL2B 3QMRA 4M5PA 2E9BA 3HJEA 1EGZA 2DUXA 3HM7A 3UR2A 3EA3A 2OOGA 1QPKA 1WDRA 1GQLA 3KRZA 3G18A 2HNEA 3WJWA 4S2BA 4BWLC 4JFUA 4RDWA 2XN0A 3PFRA 4U4MA 4I7VA 1NARA 4C90A 3WQ8A 4QE1A 4CQ9A 2VOTA 4URIA 3WQEA 3WDPP 2ZIDA 4L56A 1EPXA 1IGSA 2B7PA 2G4FA 2BHZA 4KCTA 5DCDA 1E0XA 1PTDA 1OABA 3GK0A 4HPNA 4E2OA 4LYKA 1SGJA 4M1BA 5I07A 3I3BA 2CLIA 1B3YA 4PMXA 1A3HA 2RKXA 3NSMA 4GY7A 4C65A 3I68A 4IX0A 4PYSA 3G0UA 3A64A 1OSEA 3QQWA 2GSJA 1J6PA 4RW3A 2ISDA 3WLKX 5GJNA 2NQJA 2YGYA 4IXHA 4AY8A 3L5LA 4WJXA 3TC3A 2TAAA 4G2DA 4ONVA 2ZQ0A 2PU0A 1MUCA 2QLYA 1AQFA 4XZMX 2A3LA 3MV11 1W9DM 3VDHA 1UA7A 3SAZA 3R12A 3HBLA 2GWGA 1BWLA 4H9XA 1C92A 3W84A 3CWNA 4NG3A 2JE8A 2PDGA 4HNLA 1EO5A 2BXYA 3QSTA 4ATLA 1TR9A 1AD4A 1W3HA 2BXVA 3PWIA 2ZUTA 1KBIA 3HIJA 1V79A 1ZP4A 1OADA 1GJPA 1TPC1 4NNBA 4ZQOA 1YTEA 2JFEX 1CXKA 4GJJA 6TAAA 5FIPA 4JKKA 6ALDA 5E0CA 3VC6A 3DN5A 2RAGA 3N13A 1V93A 4IMFA 3WDJA 4Q22A 4Z1YA 3L23A 4C6PA 4ICCX 4UTIA 3MHFA 4LC8A 1FWJC 3MSYA 1GVSA 3VKKA 4LC6A 2D24A 2XN1A 1EYWA 5FJJA 2DFAA 1CIUA 3A9BA 4GFIA 1B30A 4LJ3A 1IIHA 2Y63A 4R5EA 1S1RA 2J7HA 1ZBKA 4HNOA 3T08A 1LBMA 3KVMA 1EJ7L 3EB2A 4GQRA 3M44A 2VQUA 2NT1A 3K2GA 3QW4B 4P8UA 4ERIA 2QXWA 2Q09A 5HWJA 2VEGA 1FA2A 2VT0A 4PTMA 1H50A 4D6CA 4JIPA 2ZZ5A 5DBTA 4R9OA 4C6BA 5I3KA 1EJXC 4TV6A 3PZNA 4WZHA 3ARUA 4ASTA 5DANA 3S2MA 3W2LA 4S3DA 1X98A 1AL8A 1JDAA 2GJRA 4UFLA 4TVCA 1W1YA 4ZODA 2X05A 1WAWA 3BPWA 4AWTA 4IJBA 1OINA 1VF8A 2W61A 1R6WA 3PUOA 3RLVA 1H0GA 4RZ4A 3MWAA 8XIMA 5IDZA 2D3LA 3C0QA 4O8RA 3D3FA 4EPKA 2HBXA 2FZNA 3FA5A 1X8CA 1Z8AA 4YVXA 4IP5A 5CLTA 1F7BA 3TLLA 4DO5A 3OZOA 4LCQA 1EA0A 1KD0A 4NAFB 4OBTA 3KTCA 3T09A 1KBJA 1V6TA 4NSBA 3W87A 3LXAA 2J13A 3VUPA 3NIYA 1UZDA 1QNPA 2HVMA 1I1WA 3GG7A 5A8PA 3LHTA 3EOEA 1K1DA 1WXYA 3JS3A 3AISA 2B31A 1L2QA 5K9CA 5RUBA 4HOXA 1TVPA 2YIHA 5EMUA 5M2FX 1E0WA 2WZEA 3MHUA 3T8LA 3WQGA 5HWMA 3DG6A 3W00A 1JZ6A 3BLOA 2DIJA 1UC5A 3CIXA 4Q8TA 1VQTA 2L5HA 1RR2A 3GXIA 5IFTA 2BBFA 3TOPA 4H8UA 2Q6ZA 3TVAA 4QX4A 2XWEA 1BD0A 3MPGA 3S2CA 1PHQA 3WFZA 2DZUA 5EMLA 2BLEA 3KZSA 1FHDA 5AZ0A 1IWBA 2DORA 1TWIA 4UFKA 5E70A 4H00A 1TFVA 4UQDA 3LLXA 4J40A 3T4CA 4XO7A 2CIPA 4Y9MA 1XLJA 3ARXA 4M0XA 4JKMA 4MFDA 4V1XA 4M8UA 4BS0A 1F73A 1FWGC 1OCNA 4FR6A 1ADSA 4S3AA 3O6YX 3FJ6A 5A6TC 4GK8A 1EIXA 1OT2A 2GL5A 4IQEA 4A3HA 5FF4A 2QDDA 1V6XA 3V3WA 3VA8A 4CQAA 5A8MA 2PS2A 4UFIA 4XBSA 2A3EA 4HNUA 2EG6A 1SVDA 3NZRA 2F7FA 1CB2A 4E2DA 4JPGA 4AZIA 1UROA 4Y8EA 5AC7A 3PZVA 4UTWC 4DXVA 3VFLA 4KS0A 4D6EA 4IIGA 4IMAA 5AFDA 3LHUA 1FX6A 1GOXA 4WOZA 1HKKA 1F5ZA 4L7ZA 2C18A 1TCDA 1XH0A 4JBRA 2A0NA 2D0GA 2WSYA 3HQOA 4O16A 4H1ZA 3BJFA 3O1NA 3H23A 2G41A 5BU6A 3ZM8A 2ZXDA 3MS8A 4F79A 3ZJ8A 1U5HA 5I00A 3GAYA 3OGRA 2GVJA 1OFBA 3AU2A 8TIMA 2R9RA 2G8ZA 4DBEA 1JUKA 4L6DA 4J3XA 1KM5A 3SR7A 1KQYA 1B4EA 3DFQA 4LS2A 4GZEA 2XIMA 1KFCA 4H9TA 1XGDA 2ZDRA 4ZOCA 3HFTA 4CCZA 1OFQA 3EDFA 2HZGA 3NPXA 1UJQA 2FGLA 4KIRA 5EB8A 5EFDA 1NAL1 4IXXA 3T0TA 3BSMA 5F2MA 5DLCA 2UV8G 3SY1A 4PUWA 4AEFA 3VDGA 1GG0A 1Q45A 3VOHA 9XIAA 5LIUX 3GXFA 3B0VC 3RG6A 3UZXA 3R11A 1L6FA 4IMCA 3EEGA 5ABFB 3MI2A 2ZX6A 1F6PA 2GUBA 1Q6LA 2ZX5A 1NFGA 1MZHA 4O52A 4OU1A 1JDFA 3UG3A 3DXIA 1LL6A 5ABEA 1PB0A 5HMSA 2F8QA 1SMAA 4C1LA 3FGCA 4I5UA 2CEQA 1SJDA 5HMFA 2FVMA 1NELA 5A6KA 4UCFA 3L4WA 5F1VA 4EAYA 1AG1O 4G56A 3VMNA 5CC6A 5JH2A 3IK4A 2AMGA 1QXLA 3JU2A 3EDKA 3RM9A 1P7TB 4QBXA 1KWKA 4AZ7A 3VINA 1R0MA 2VUYA 5BOFA 4KCVA 4ZR8A 2XH4A 1I60A 1UC4A 1VC4A 1GJUA 4ICNA 4F66A 2FHFA 1S2VA 1GZ1A 2BY3A 3OPSA 2ESCA 2VTFA 1KFEA 3LK6A 1IR2A 1HXJA 3IACA 3OBAA 1RVKA 2OR2A 4JIQA 1V0NA 1FDJA 2OX4A 4L1XA 4PN2A 5HMEA 3VK5A 3WUEA 2Y1HA 4B5SA 3ONBA 2WCGA 2FZ8A 3M4HA 4NILA 3VIKA 5DO8A 4H7VA 1F2JA 1W31A 4I9TA 1E43A 1F8MA 2GSEA 3GBEA 4U5IA 3GIYA 4ZB5A 4DWSC 1SZGA 2P8CA 3ZR6A 3B8DA 2Q8XA 5HXMA 3H4GA 4XUGA 1K7FA 3WH8A 1DWJM 4JTTA 4S38A 3H22A 5F4WA 1H7OA 4QTGA 3NDOA 2OODA 3VZYA 4D8LA 1FCBA 2QF7A 3BE7A 3ARWA 3IGUA 2X1TA 3W24A 1JFXA 1XRVA 4XZBA 3RMEA 1KM1A 2PDMA 3CT2A 4I5XA 4Q7IA 3TAOA 4P8XA 4ZMGA 4Z08A 4CD4A 3UZYA 3DCPA 3WF4A 1T5AA 1VLIA 2RJHA 2YPIA 1ODUA 1Z69A 2PDNA 4Q8PA 1UR3M 1GOMA 4XD4A 2W4XA 3ITGA 1ME9A 1W5QA 1Z7AA 4DO4A 4IGSA 4KFNA 1JPHA 2QVHA 4RPPA 4QAIA 2YL5A 1F3TA 3CHFA 1LORA 3LCGA 1MMFA 1XDMA 1EGVA 3BL3A 4YCPA 2XSAA 3AIVA 1M03A 3W1PA 2EG7A 3S9YA 3QY7A 4L9YA 2PDHA 3JW7A 2PLJA 2EKGA 5HK4A 3RRAA 3N2MA 4ERAA 4XKMA 1E4NA 3W2NA 3F2DA 4P7QA 3R13A 5AHIA 1O4UA 1M04A 1W1ZA 3CPUA 2QCHA 3ZS4A 3VIFA 2Q02A 3BLEA 5D9PA 3M0VA 2PDFA 3AOFA 2QNEA 3BXWA 5LNWA 1TTJA 3MBFA 4WIWA 1QBAA 1M65A 3MI3A 1KCKA 5HNUA 2E6YA 2NXGA 4X60A 3TN5A 2CXEA 3M5XA 3PHAA 2WKGA 3KM8A 3OZYA 2EEXA 1DWFM 1OFPA 2VDHA 4E8GA 2V6AA 4QSHA 3BC9A 4NRSA 4BA0A 4W9TA 2ZVIA 3PJWA 4CU6A 2GQ3A 1E51A 2FDSA 2EPKX 1Q6GA 1GZGA 2G95A 4V27A 3QKZA 4M80A 3CH9A 4DNHA 3C0SA 3GXMA 2WVVA 4AEEA 1O5KA 5TNVA 1Q8AA 3G22A 1BYBA 2VFEA 2WMGA 1EZWA 2ZZ3A 1HL8A 3U5UA 3GTNA 4MG4A 4XVEA 5JXQA 5JBEA 4LNCA 5I24A 1RVGA 2BOFX 1IWPA 4FNRA 3S9IA 1OYCA 2ACUA 4AZBA 2D0FA 1ZU8A 4J28A 3L2MA 1JVNA 4UXDA 2Q8LA 4W7UA 2WMHA 2VCCA 3NG3A 2XFFA 1R3WA 1QW7A 5BU9A 2H8XA 2VENA 1X7IA 1WKFA 5K3VA 5I3DA 2GWNA 4MDPA 4R7OA 1VCVA 4RNIA 4GYPA 3W7OA 4DM1A 1DQXA 1GOOA 4DUWA 3GS6A 3AS0A 4JTHA 1WZMA 3QPYA 3OODA 1TPDA 2MUCA 1I2OA 1Q4NX 2W63A 9RUBA 3MUZ1 3WG6A 2PDKA 2HWGA 1L2UA 1SPQA 3SN0A 1A5MC 4H9VA 4YPJA 3H54A 4DUOA 3W07A 6REQA 4REQB 3W2JA 3K8LA 4C7FA 5HJYA 1OQFA 1SMDA 3MVIA 4R33A 4CNUA 5LNRA 4ZB2A 4Q8VA 2XIQA 3KCLA 2E28A 4UTMA 2C1IA 3P2VA 1ZNNA 4WX2A 4E4PA 3E5PA 3FS2A 5GQBA 2RDXA 4H8NA 1J0KA 2JBMA 3SCOA 4US5D 2MNRA 2DSWA 1GOQA 1H3GA 4KESA 4IMEA 3SGUA 3LM7A 4LS1A 3KOXA 1KXHA 2YB4A 1PZ1A 1OX4B 3MCNA 5J5DA 2OPJA 4WGHA 2YL6A 5K4XA 3GUGA 4N4PA 2QUUA 5U4NA 1KFJA 4B3LA 4JFVA 4ZOBA 3N04A 5E9XA 5G1YA 2O9PA 1X1NA 2IPJA 3FA3A 4EANA 3WH5A 4FF7A 3V0UA 2BSLA 1ZGDA 3WL1A 1TIMA 4B2DA 4BWLA 1TV7A 1VFFA 3C2OA 3GFZA 1EBHA 4CCEA 1UKTA 1ODZA 3BAWA 4CNSA 3TXVA 4UTHA 3STGA 3W1RA 4FLQA 3F4CA 1W1IE 1B31A 3WDHA 3KDNA 5D8WA 2QCGA 1GVYA 1JGIA 3PG8A 4GUGA 4RE0A 4NIRA 1NFPA 5JQ9A 3GC4A 5A6BD 4WQ6A 3P0WA 2BHUA 3GVWA 3T9PA 3W28A 4CN6A 2I56A 5IRPA 3CB8A 4ZOAA 3LTSA 1M01A 1YDNA 5E93A 1MDRA 4BEQA 4NZCA 1H7WA 3UR7A 4CVWA 4FNSA 2A2IA 2MANA 1VEPA 2JIEA 3GQYA 4GJIA 4JIIX 1E0TA 2OEJA 5D2WA 1YDYA 1CXIA 4L1WA 3TIMA 3GH5A 2QPSA 4BHYA 3UBPC 1KTBA 2XIIA 1WAUA 2NLIA 1OGGA 3WJXA 1CXFA 3W7DA 3L4TA 3IJ7A 1OBAA 1LL4A 3NQCA 2WC4A 3MMWA 5DELA 4EF8A 3VIJA 1P6BA 3ABXA 4R9XA 4REQA 4CQ8A 1W5PA 3THDA 2V5LA 1NP2A 4GVIA 2WC3A 4BKNA 4JTDA 4WOQA 4PE8A 3P7YA 1L9WA 1XD0A 3T2PA 1FVPA 2OSXA 5CGQA 2CBVA 1KB3A 2HK0A 4LEFA 3G6LA 5CZTA 1MW1A 3A5VA 4X3ZA 3VKBA 1UR2A 5AHLA 1WNOA 3S1WA 1OIMA 4LVBA 1IEIA 1TJ0A 4FOJA 1QCWA 1U1UA 2F6XA 2JF7A 3E2QA 2J75A 3VKCA 4KRZA 2QHAA 2FVLA 4KRTA 3W02A 4HPGA 5CJNA 2GVEA 3S1VA 1SZFA 3VDBA 4G5DA 2AMXA 2F84A 3C3NA 3TR2A 1HJVA 1I2PA 3KLLA 4DF0A 2YOCA 1JD9A 1FWTA 2GOUA 1U2YA 1J0JA 3CJPA 1DJHA 4FF5A 3VO0A 3DKLA 1JG9A 4A35A 3GO2A 2KAUC 5HNRA 2NW0A 5JIPA 3WQVA 1JZ8A 1KRMA 1DTNA 4HSNA 1BWKA 1SJCA 1WE5A 4W88A 5C9WA 3A4XA 2X1RA 1C8QA 5CC3A 2DT0A 1UWSA 2XVLA 2IQTA 3G1SA 4YWIA 3HG2A 3MUIA 3NVTA 4DY1A 4Y90A 4E0CA 4JD4A 4FI4A 2OTDA 3C61A 4LOCA 2EO7A 3FDKA 4IIFA 1A5NC 3B0PA 1E55A 3O15A 1XLMA 4WK9A 4I8DA 3WQ4A 5A2CA 1UASA 4JEJA 4MY1A 1AQMA 4V33A 2PRLA 2X30A 1TJRA 2XINA 4ZE5A 1DBTA 4XIMA 2Z1VA 4YTQA 4YXGA 2ZUWA 4LSBA 4NAEA 2JKEA 1H61A 1TR1A 4PTNA 1D3CA 1T41A 3O07A 3ARRA 1TELA 3AS3A 4NY2A 1RBOB 3NM1A 1E5NA 2J7BA 3TSBA 2NUXA 4FSAA 3BZJA 3K5XA 4IL2A 5XINA 2ICSA 4NRRA 4MZYA 4LUIA 2WVVB 2UZ9A 4F48A 4NJIA 2YCIX 2NV1A 5HA7A 3H2OA 1H5VA 1TA3A 3BG3A 3ZR5A 3TYBA 3WUBA 3USZA 3ISIX 4B90A 1DE5A 2A85A 4QITA 5CZ0A 1VP5A 3NCOA 1M7JA 3DU0A 3EWBX 1T8XA 4EXBA 1NDWA 1HKVA 4P7OA 1OCQA 2VP8A 1JD7A 4XB3A 2W66A 4H3DA 4AU0A 1X1OA 4R7WA 2J77A 1P5BA 3A12A 1S5TA 2Y7GA 1XR2A 3KWSA 1YHTA 3DBNA 1MW0A 3EXTA 1G67A 4WDXA 2R8WA 4ZGYA 1L6WA 3CASA 1VPXA 5LIYX 4PB4A 3ITXA 1VRXA 5FSDC 2IUZA 3LCXA 2ISSA 5LA0A 2SFPA 2OO6A 3V7PA 2VEPA 4FNPA 1LROA 5H8UA 1TTIA 4PCTA 4IGMA 4PBEA 1SZNA 1AA1B 4FNQA 3HF3A 2EKCA 3AHYA 5LIXX 4UC5A 1PVNA 1Q66A 5C8BB 3A5FA 3MC5A 1M7OA 3SSZA 4G7EB 4WSHA 3LNMA 3MVTA 1JRCA 1ZQ5A 2E6FA 3EDEA 3TUUA 2R6OA 2XSBA 4A2SA 1FH7A 3G2GA 3V5FA 2QPXA 4UQEA 4ACZA 2AQVA 2PB1A 1XS2A 1WDPA 2J9XA 3KHDA 1Q5MA 1W1B1 3ME3A 4LUSB 4Y9NA 2YR1A 1KKOA 4TR9A 4XVDA 3SCUA 5F4SA 5IXEA 4Z17A 4CD7A 1LP6A 5I02A 1J6OA 5GPRA 1US0A 4LUYA 4UTTA 4GNKB 1UWUA 2CZDA 1F6KA 1ISZA 3MMUA 2DSKA 1QOPA 3Q2DA 5F7UA 1HJQA 2X1UA 4RV8A 3F2BA 3GYEA 5MHBA 3AIRA 5CG0A 2FZMA 3WJZA 2P0OA 1Z9AA 1PX3A 1IYXA 2VCAA 4CLMA 4S23A 2WNWA 1GCYA 3CV7A 4LV4A 4UTLA 4ES4A 1UH4A 1PZ3A 4LB4A 2GGHA 2CU0A 2VURA 2YSWA 3AHXA 1PKLA 3AIEA 3C0JA 3JZEA 3VPLA 3MTWA 1UMLA 3A4AA 3PZMA 1MVYA 3F1QA 5G4HC 2W9MA 2FVKA 3RX3A 1PEZA 5BRPA 4KRUA 1QUMA 1KBBA 4H9YA 1GOIA 2BHYA 3KBNA 1FWDC 2I5IA 3RO6A 2PWFA 3T2QA 3VNJA 1POKA 4NQ1A 1OC7A 1HF6A 3FXGA 4I90A 3NUKA 1W8GA 3B0UX 1AVAA 6TIMA 4C6DA 3D0CA 4AAJA 1W2PA 5FEPA 5E0FA 1QNQA 1QT1A 4MKSA 4AD3A 3WF1A 1PPIA 7PTDA 1R7OA 1S5WA 1FRBA 1FP9A 3KFTA 3QPEA 4GH3A 3WK1A 3RR1A 4WDWA 1R3TA 3HA1A 2IXUA 4JTLA 4C7GA 5T26A 2DT2A 1LRQA 3IPWA 3VIPA 1K02A 3CWOX 4HZ6A 3I7SA 2YXXA 4NI3A 3PZGA 4Y6GA 4I6KA 1ZBWA 2BNJA 2LLEA 3FXYA 4GHRA 1W5NA 4E38A 3H53A 1JL8A 3PK7A 1B9BA 1EZ2A 1F07A 2PC8A 4R27A 4TU1A 3SQSA 3IAPA 4MUZA 4N9DA 3RLHA 2EGZA 4XAZA 1LUCB 1OD8A 3QHMA 3HG4A 4HNVA 1BTCA 1P6WA 1CZ1A 1NFBA 4AZGA 1MDLA 3CHDA 3BMWA 1F6YA 1SQ7A 3LX9A 3CIWA 1XBZA 4FXJA 1I45A 3P93A 3IIVA 2E25A 1I4NA 1FH9A 4H01A 3NDYA 3BLIA 2INZA 4B9ZA 4QRNA 4ACYA 2QT3A 3FK4A 3UZWA 2ASHA 1Q6RA 3HMCA 2V69A 3T42A 3OA3A 3HOJA 5DCBA 3BAIA 4Q4KA 4S3CA 1KTCA 4RK8A 4JOMA 4WSJA 1GGOA 1JZ4A 3VKJA 4MJZA 3IJDA 1E6SM 3WDQA 1GEHA 1W5OA 3UNTA 4FB7A 2IPWA 3BSHA 3IIPA 1YNPA 3SECA 4MADA 2Y2WA 3BW2A 5HJXA 1SW3A 3NYZA 1BKHA 1KM3A 3RR4A 2QDEA 3O6AA 4JHOA 3SY8A 4C6CA 3HQPA 1IT8A 1N8IA 3G5EA 1G6CA 3S5SA 1YRRA 2ISFA 2WO5A 1C90A 4NXKA 4PTXA 3QEZA 2W62A 1A50A 5AC4A 4GYFA 2DW6A 1UBSA 2P3EA 3SRFA 3BTNA 3W23A 2WMKA 1QTWA 1Q2SA 3SRHA 3DI1A 1JPKA 2ONEA 3P81A 4UZUA 2GOKA 2F9RA 4EOUA 3B9DA 4JL2A 5KINA 1XIHA 3GDKA 3MKVA 1NJJA 4H83A 5D2YA 1O60A 5DCEA 1LT8A 1YADA 1E5JA 3B0YA 3RU8X 1TPEA 3L0NA 1BQGA 2QKFA 2A3AA 1KGUA 5FD0A 1GG1A 1ALDA 3KRUA 3YPIA 3O3RA 3VMOA 4F40A 3L4ZA 3OLDA 1HKJA 4HMCA 4TMCA 5A6SA 2GGEA 3TWBA 3UJ2A 3WBAA 3LLFA 2ZFAA 3V75A 3THQA 5LSMA 4AEOA 3FFSA 1UQYA 4M56A 3PG9A 7TIMA 3K4DA 5CBBA 2WHLA 4IL0A 5H91A 2ZCGA 2TMDA 3IEBA 4Y9AA 4NHVA 4GZJA 2XTKA 3LTYA 4OECA 1S2AA 4PH6A 1UQZA 1XV8A 4ZQNA 3QHOA 4S3JA 1E6ZA 2WZIA 4FS9A 1UZ1A 1S2TA 3OQ8A 3N17A 5EMYA 4UQCA 1CGVA 3DIPA 1W8SA 3DYMA 4M6VA 4O0ZA 2YYTA 3C5QA 2R1LA 1T40A 3WYZA 1RQEA 1HJSA 3L0GA 2C3ZA 1WUFA 5HR7A 3EX6A 4RJEA 2WMJA 2OKOA 2XPKA 1EWDA 4HVXA 1XRTA 1JYVA 1MXDA 4W86A 5HQMA 3WMSA 1K3UA 2OQYA 3DC8A 2ODOA 1H62A 1D7FA 2O7QA 5DXYA 2O7SA 2CITA 2G96A 4GXPA 4HBKA 2DT3A 2VC5A 2AAMA 2PODA 4WEVX 3PNUA 5IHRA 3AXHA 3BAXA 5CBIA 3E74A 1WX0A 2YCJA 1ZJAA 2PZ0A 2DSUA 3M47A 4JDBA 3VOFA 1JFHA 1TPB1 3U2ZA 2GVYA 1V0LA 4KWSA 5G1MA 4O54A 3EWXA 4A22A 5A6LA 5REQB 2V38A 3UWYA 1TWWA 1CB7B 2PLCA 3LERA 5FA5A 1XM3A 3S3GA 3THAA 3UWEA 2XUCA 3RFAA 2Z00A 2BODX 3RNDA 2Y24A 4GFSA 4PA8A 3UXKA 2YDSA 1XFCA 4Z2LA 3F03K 3PBWA 3REQB 3EBVA 3CHVA 2NXIA 1WB0A 2PRMA 3IIZA 4WCJA 4GZIA 2JKAA 2V81A 4HZMA 1SFTA 3BVJA 2YA2A 5LGXA 3E2VA 1LWHA 2J8GA 3SB0A 3SO7A 1GEQA 3MO4A 1EQPA 2PTZA 4JIEA 3S2LA 4QP0A 3PB0A 4NZ5A 2VO5A 1VBHA 5EFFA 1X39A 2A21A 1B3WA 4HPHA 4GIYA 1DJQA 4OZOA 3VOIA 1OF8A 1JCMP 2BASA 4Q8WA 1FBAA 3GTIA 3URAA 3IARA 3PS7A 4H6RA 4JL1A 3F5LA 4K3ZA 3KCJA 3CMGA 3GIPA 2INEA 5D02A 1DVJA 3UVAA 1SO5A 1HP4A 1ECQA 1D9EA 3EXSA 5BXSA 2CHOA 3H8AA 1V02E 4KWVA 2BTMA 3R0DA 4XG1A 3VD9A 1QO5A 3W75A 2EPHA 3WF0A 4AD1A 1FCQA 3RHGA 3WLPA 3NPUA 2HSAA 1TO3A 3G0XA 3FAWA 1JCNA 1O66A 4N0RA 3WD3A 4WXZA 5FKYA 3FAXA 4QXIA 1A5UA 4DWDA 3LHWA 1AMKA 2ADAA 4D6HA 1CECA 3AMCA 4XZLX 5CPTA 1C8YA 3NL3A 4M19A 2VVSA 3SZ8A 5CJ5A 2WJZA 1DIOA 3S47A 5KETA 4JQAA 4DLFA 4J9JA 4PFHA 3V5CA 2W3ZA 3TQVA 1LOSA 1JNEA 1KM4A 4CCCA 3LPGA 4JIRA 3NSXA 4G7FA 1I0BA 4I6VA 4DI8A 1F3XA 2X42A 4UTTC 1US3A 2CCRA 2J8FA 3KE0A 3GG0A 1C7SA 3LHYA 1TPWA 1E9YB 5E1QA 4IPNB 1TJ1A 4K37A 5D9OA 5F2LA 1TPVA 5TQLA 3TP4A 2POTA 1JYNA 4Q4RA 1MUMA 4IJRA 4OHQA 2XM2A 5EU9A 4GI8A 2QCLA 4JDYA 1FFRA 3LGEA 4XD6A 1WOAA 3TYZA 4R34A 5FI8A 1E70M 3D6NA 4W7VA 1A0DA 4CN4A 2X40A 1ONWA 2YBVA 1F61A 2V2HA 4TVDA 3LI1A 3W01A 4YYFA 2XIOA 3G3DA 3S0CA 3PZOA 4JTKA 5A8OA 1CNVA 4F8XA 1BXCA 3TFCA 4O4VA 5KZ6A 3GDRA 3DGBA 2HRWA 4HSHA 1TVLA 1XPGA 3SJNA 4PRRA 5DMYA 1G1YA 1UPMB 4KIEA 3MV01 1G4PA 4PUNA 1PTGA 3S5ZA 4XIAA 5K7JA 4MSSA 3LZ5A 1FFQA 4GJ1A 5TD4A 1W56A 3W53A 4DYEA 3BMXA 1LWJA 4AC1X 5JU6A 4GQQA 3T8QA 1OFRA 2WCSA 3K13A 5KEZA 1NDVA 4V15A 1R2TA 1QI0A 4FNTA 5LGZA 3LNPA 5EYWA 1JZ2A 1NOFA 1ZAIA 2DZSA 3CUFA 4CNOA 4JTIA 4CGTA 4Q3MA 2BB0A 3R0KA 3TSMA 1PO9A 4AHPA 2RGMA 1QPQA 1UP0A 3PPFA 2V5BA 3FYOA 3NVDA 1W2VA 5AKQA 3J7HA 3KCOA 4D6JA 3WLSA 4P7LA 4C1NA 1G4EA 3LV6A 4GWEA 3O7UA 1WP6A 1K70A 2VC9A 3UR5A 3RM8A 4PMNA 4BI7A 3QVQA 2J9ZA 3LV5A 1REQB 3EKGA 2FZDA 2VDGA 3MMDA 3KW3A 5A69A 3IVTA 1ISXA 4NAEB 3UNDA 3CMJA 2H3BA 3DGRA 3UEQA 4HIBA 1VGAA 4WGXA 3WQOA 1K8CA 5AC8A 1QATA 2QULA 3W74A 4MHBA 3MYPA 3CYJA 2FLIA 3QR3A 3W7QA 5G2WA 3S2JA 2PTWA 1PX8A 4ZVJA 1ZJBA 2CFFA 2ATSA 4XD3A 4DNMA 1YEYA 4NJHA 4TTGA 5E6ZA 2A3BA 1PS9A 3ANUA 3GR8A 5AYXA 4HU0A 1HVQA 3N2OA 1ONRA 3P62A 4H6KA 2QPUA 4AW7A 2VZUA 3GDLA 3C8NA 3W76A 3ZJ6A 1CW2A 2JGYA 3QMSA 3WLHA 3VNLA 3IV8A 4DJDC 4W93A 2R1PA 4LS0A 2PMQA 2WYSA 3W7LA 2DIKA 3NM3A 1F4HA 4KF1A 4BI5A 4O0QA 2XGIA 5EA9A 4QROA 4PMVA 3PBVA 2DVTA 2B0MA 4QFUA 4QJ5B 3ECQA 3IJ8A 3I4KA 4JKLA 2G37A 3G77A 1FDYA 3G8RA 3U3HA 2EF9A 2IKIA 4HB7A 3NPVA 4PMYA 3UD6A 5ABHA 4QDPA 1PDYA 1LUCA 1ZPTA 1W1A1 1O95A 3LCFA </