4TMBA

Crystal structure of old yellow enzyme from candida macedoniensis aku4588
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
390
structure length
390
Chain Sequence
YMNFDPKPLGDTNIFKPIKIGNNELKHRVVMPALTRMRAIAPGNIPNTEWAEEYYRQRSQYPGTLIITEGTFPSAQSGGYPNVPGIWSKEQLAEWKKIFNAIHENKSFVWVQLWVLGRQAWPEVLKKEGLRYDSATDDLYMGEEEKERALKANNPQHGITKEEIKQYIKEYVDAAKKAIDAGADGVQIHSANGYLLNQFLDPISNNRTDEYGGSIENRARFTLEVVDAVVDAVGAERTSIRFSPYGTFGTMSGGENPGIVAQYAYVIGELEKRARAGKRLAFIDLVEPRVTDPFLPEFEKWFKEGTNEFIYSIWKGPVLRVGNYALDPDQATLDSKKPNTLIGYGRSFIANPDLVYRLEKGLPLNKYDRNTFYTFTKEGYTDYPSYEESV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Old yellow enzyme
publication title An Engineered Old Yellow Enzyme that Enables Efficient Synthesis of (4R,6R)-Actinol in a One-Pot Reduction System
pubmed doi rcsb
source organism Kluyveromyces marxianus
molecule tags Flavoprotein
total genus 142
structure length 390
sequence length 390
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4tmbA00
4L4MA 5D2YA 5AFDA 2ZZ6A 5AC8A 1SU5A 2Z6JA 1Z48A 3MW7A 5I3FA 1O4UA 1H61A 1CW2A 1JQXA 1NSJA 2CWNA 1K8ZA 2ZDRA 2QDGA 5SWUA 3LB0A 2JBMA 2QCMA 4QITA 3L9CA 3H54A 5EYWA 1KTCA 5BMXA 4WQ6A 1QPNA 5KITA 3MO7A 2HS6A 2C3ZA 2D73A 1Z41A 3N19B 3I65A 1YPIA 3G1VA 2C18A 4OHQA 3HOJA 3MHGA 1XL9A 4O17A 3HPSA 1XBYA 1B3OA 2BTMA 2BXVA 2Q3OA 1BTMA 3LCLA 4JX6A 4XTDA 2ZA1A 3G1FA 3HPXA 4DQWA 4YCPA 5AHFA 4ZQCA 4O53A 1GTEA 3LRLA 1JVNA 4MPQA 5CZJA 1SSDA 5KZDA 2G5WA 4HNVA 4MZYA 3P7YA 3W84A 4UTTC 1H63A 3SZ8A 2Y7FA 3NL3A 1H7PA 4MUZA 2E6DA 2QKFA 1LYXA 2CLLA 5HUOA 2NWRA 2E6FA 3WK2A 1G6CA 2HMCA 1BWKA 3W2KA 1D3HA 1VJIA 1VCFA 4O12A 2TYSA 5DLCA 3INPA 4Q33A 2ZBTA 4AXKA 2Z2UA 3N3MA 4JYEA 5DCEA 3GXPA 4DO5A 1NF7A 4IMGA 2QCDA 3LM7A 3PS7A 2Y63A 2CZDA 4ICNA 3QSRA 4IXHA 1W5PA 4NZFA 3M5XA 2ZZ7A 1KA9F 1Z42A 3W2NA 4CLMA 3C2FA 3W7JA 4RX0A 3W7DA 1KV5A 4RR4A 5TQLA 5E93A 5HNRA 3PSWA 1TRDA 4LS1A 2CLKA 3NR0A 4UTWA 4E0CA 3NPVA 3WK1A 1DV7A 2QJGA 3NQAA 1SFJA 3I7RA 4CQAA 2YR1A 4JIPA 2V5LA 2A6NA 3GX9A 2QJHA 3YPIA 2X1SA 2J6XA 1TPWA 3THAA 1SO5A 3G1SA 3STGA 1ALDA 1RVGA 4N2YA 3TC6A 1B57A 4M7TA 3PUOA 1OF6A 1F05A 4KWWA 2CLOA 1CI1A 3O05A 2QF7A 1AW1A 3DFPA 3DFNA 3GR8A 3SIZA 4DXVA 4I7UA 5KZMA 4WXYA 3W1RA 3C3NA 1SZEA 3M5VA 2W6RA 3W9ZA 1GVQA 4R53A 1E51A 5BW6A 1MZHA 1WOAA 2J88A 3S6DA 1AW2A 2ZRUA 4AWUA 4NVTA 4OGZA 1A5CA 3UWZA 3SFKA 2Y7DA 3DFSA 3GVGA 2AAMA 1VLIA 5A8GA 4ALDA 4ZMGA 4LVDA 4JN6A 2Y89A 3NQVA 3O6DA 3NXFA 4EOUA 2OZ0A 4GE8A 3ANYA 1YTEA 3MP4A 3CEUA 1JJKA 3ATZA 1MEIA 5U4NA 2F84A 2Z0IA 5TIMA 2C19A 1S5VA 2C14A 2H8ZA 2ZQ0A 3GKFA 4UMBA 2CU0A 5I3GA 4GUIA 3V75A 1C9DA 5CKSA 4WD0A 1DJQA 4K8EA 4A3UA 4CNNA 3HGOA 3GDMA 4RV8A 4NXKA 2V9DA 4Z1DA 4M6VA 3QFEA 3HG4A 2AGKA 4MYAA 3IGUA 1TV8A 4MJZA 1NAL1 5IM51 5EL1A 4Q32A 1H62A 3HIJA 4FNQA 4YCOA 4LVGA 3W75A 4AVFA 3L67A 4JTHA 1X1ZA 1J2WA 1F6KA 1VR6A 2J27A 3W83A 4CQ8A 1OF8A 3N14A 2QCLA 4ORMA 4GUGA 3W85A 3EB2A 1KFEA 4N9CA 3W7PA 4Z1AA 2J24A 5K7JA 3DU0A 4QNWA 4QM1A 3KHJA 5LGZA 3EWBX 3S1VA 2YSWA 3TE9A 1AW5A 1MXSA 3TC7A 3NA8A 3W76A 3PVFA 1W5QA 4ADTA 1LLWA 4BI6A 4UTIA 3BV4A 4TR9A 3CHVA 4UTMA 3RNDA 3TK7A 1R2RA 4WXZA 3TU9A 3S1XA 2FJKA 3EX3A 2NX9A 4AAJA 2OT1A 3LDVA 3HMJG 4S1FA 1OYBA 5D03A 4JXCA 4JDBA 4NU7A 4UR8A 2RDWA 2NXHA 3M5ZA 3CB8A 1O5KA 4CQ9A 3W7MA 3G3MA 2QEZA 5CSSA 1HUVA 4EF8A 1T0OA 1JUEA 1F2JA 1ZFJA 2RDTA 2W0UA 2DU2A 1UJPA 2WPBA 5FF3A 3GDTA 2FB3A 4O1BA 5KTLA 4B5NA 3S5ZA 1MEHA 2QAPA 2XN2A 4JX5A 2E68A 5BNKA 3Q37A 4DBEA 2RHGA 1YTDA 1P0NA 4O57A 3TW6A 3FKKA 3HQ1A 1S3HA 2QCGA 1OG0A 3IV3A 3W1QA 2WSRA 1XBZA 5F2MA 4UMAA 3OG3A 3UYCA 3W1UA 5CZSA 1A53A 2TPSA 3EXTA 1SZNA 1Q6OA 3NQFA 4JTKA 1XDLA 1B4EA 1OX6A 1L6WA 4OWGA 3PM6A 1KW1A 3CWOX 3QEZA 1K7XA 5F2LA 3W7RA 4UFHA 2YYTA 4M6QA 2P10A 5K3VA 5FESA 2YFNA 4UTKA 3VNDA 4A22A 4N02A 5FF2A 4QSHA 4N9EA 3M16A 1JQVA 3DAQA 1JRBA 3QF0A 5DBUA 3LHWA 2DZVA 3EWZA 4QISA 1JCLA 3UWYA 3BK0A 3S9YA 1Q6LA 3NDOA 2ZZ4A 5LNRA 4IUOA 1JCNA 5D37A 4GNJA 3WJYA 3BPWA 4DF2A 2A0NA 2WQPA 4WX2A 1G4PA 3DGRA 4TU1A 1OX4B 2CLMA 1R2TA 1XI3A 5K9DA 3I7QA 4O18A 1L9WA 4MOZA 4PEKA 3S1WA 1OVDA 1KM0A 3ELFA 5D2WA 3PBVA 4M19A 4I7WA 1ZAIA 3S5OA 3DI1A 4O1AA 5G5IA 3MMTA 2A7RA 3TFXA 1I2PA 1FX6A 2E09A 2YXGA 1ZHAA 3EX2A 1YDOA 3KRZA 2WNNA 3LGEA 3OVPA 3TJLA 2NUWA 1TSIA 3STCA 3LV5A 4WY0B 2R8WA 1I2RA 1KLYA 4FNUA 4K39A 3FJLA 2C6QA 5HINA 3F4WA 1TPB1 3LLDA 1LP6A 1EUAA 4UTUA 4BFAA 4O28A 4UFKA 3BLFA 2FPYA 3EEGA 3L66A 3TKFA 3IGXA 4XBKA 1KFBA 1LRQA 3BLIA 2VENA 2QUUA 1GG1A 5FEWA 2TRSA 2XN0A 3W73A 3LERA 3O15A 4IMEA 4LC8A 1IXNA 3UZ5A 2DJXA 1DKWA 1KM5A 3IVUA 1XDMA 1R2SA 1GVSA 2QDHA 1FCQA 3MYPA 4HN4A 3GNDA 2QUTA 4G1KA 1JCMP 4IMFA 1FY6A 3KAOA 4Y6GA 3DHDA 1QOQA 4O16A 2I1OA 3NQMA 2PE4A 4HNTA 3OA3A 4JEQA 2YW3A 4JTSA 4CNOA 4UNKA 2X2GA 4GRSA 3DZ1A 3P81A 3W7GA 5D2TA 3W7IA 3UQNA 3W87A 2A2IA 4IPIA 1N8FA 1TIMA 1ME9A 1VYRA 2B4GA 4MJMA 4X22A 4X2RA 3QMRA 3TAKA 4EWND 1L2UA 4OV9A 4UNLA 3B0VC 4FIQA 5EPDA 2A7PA 1SO3A 3TMQA 3KFTA 3RF9A 4CCCA 4K7VA 5FF4A 1O60A 1YXDA 1TV7A 4HSOA 3UXDA 4TO8A 2NX1A 4XZ9A 1SR9A 2Y88A 1QPOA 1RQBA 2ZRWA 4PCFA 4FNPA 5HR6A 3RU6A 5LNVA 4FX7A 5C5YA 3P5ZA 1TB3A 1OFOA 1SUXA 3OVQA 1T96A 3QM3A 4BI5A 3A24A 3ABQA 1WAUA 4O50A 2BSLA 1XCFA 4UC5A 3QRHA 5EA9A 3H53A 5HULA 4O4VA 4OT7A 1R30A 4LRTA 3C61A 1GJPA 1G7VA 3DFOA 3JR2A 3GAKA 3TXZA 3M41A 2ISSA 4QJ1A 2X16A 1YADA 4UTWC 1PHWA 2V82A 3A5VA 3TX9A 4FB7A 1G4TA 1IF2A 3P8JA 2VEPA 4H3DA 4JS3A 1WQ5A 1WBJA 3N34A 1H1YA 4RLIA 2OCZA 1QR7A 2NUXA 5G2IA 1SZFA 3B0PA 4O19A 3L0NA 1NF0A 2J9YA 3UD6A 1RQEA 5LNUA 1KM1A 4YL2A 4LOCA 3O16A 2R14A 3KRUA 2C1HA 3BW2A 2DP3A 1WBHA 4I9AA 4ORIA 2Y70A 3TFCA 3W74A 3W7EA 1LTDA 3LCWA 3IVTA 4FHAA 3OEXA 3QPZA 2WNZA 4DBDA 3U6WA 3LBCA 3UNDA 1KBJA 3LHVA 3M9YA 3A22A 1QMLA 4XTIA 3LCGA 1FXQA 5AHMA 4LVAA 4O11A 1SO4A 2CLIA 1VQTA 3SY5A 4AF0A 3H55A 4CCEA 4BR1A 3NNTA 2VFEA 2WSQA 3A5FA 4XQ6A 2H3DA 1JCYA 1LLZA 3NAVA 1TO3A 4KFNA 3S42A 2GUUA 3PBUA 2ALDA 4AHQA 4TIMA 3QPYA 4DO4A 2X1RA 4Z0SA 5CPMA 5F4SA 3E12A 1TCDA 2XN1A 1W8SA 2VC6A 3IIZA 3W1PA 1DL3A 3WJSA 2G97A 2FLIA 4NX5A 4M5PA 2Y62A 2B7QA 3VFLA 1H7RA 3CTLA 1K8YA 2VEMA 4JTFA 5K9XA 3HG3A 4S2CA 3LHUA 5T26A 3TV8A 2A4AA 1GEQA 3PY2A 3C8FA 4DEFA 3DFQA 3C6CA 3AO0A 2TMDA 1HTIA 3O1NA 4AHPA 1WYIA 2Z6IA 3O8AA 3B06A 4HPXA 3FIGA 3UY7A 2FQIA 4MIMA 1WOBA 3WJXA 3U2OA 4C1KA 4LUIA 4UXDA 1GPWA 4YLWA 1GT8A 3BO9A 1TPC1 4O52A 1K02A 3NM1A 1XBXA 1DQXA 2WV8A 3BGJA 3MBFA 3M1ZA 4PC8A 4QNEA 5DXYA 1LORA 3BGGA 4O10A 1MEWA 4KFPA 4NNBA 2PRLA 4N6EA 1KV8A 4Y96A 3TQ0A 1OABA 4QQ3A 3LTSA 5HMSA 3EKZA 3PUDA 3TMLA 1AL7A 3TUUA 1X6UA 4JTEA 4GC4A 3TROA 4EVZA 5L9FA 3RMJA 2VELA 3MP5A 4BF9A 1PCWA 1H5YA 4MY8A 2V2HA 4H4IA 4IGHA 2CW6A 4M7SA 1QO2A 1TPH1 1I4NA 3G8RA 1H51A 1W5MA 3W07A 3LTYA 5EKYA 1PS9A 4A2RA 1OK4A 4UTHA 4DELA 5L6UA 2PCQA 2A85A 2YW4A 4LVBA 4NJKA 1DQWA 5LNSA 1VYPX 3LBMA 5H91A 1TQXA 3BG5A 3MI6A 2TSYA 5I3JA 1VS1A 3OVRA 4UFJA 3LHZA 3GK0A 4ADUA 4ADSA 5FEZA 5F2GA 3L0GA 3T44A 3E02A 4MLJA 2LLEA 1PCKA 1TPFA 5CPOA 4UFMA 5KZEA 3BW3A 3P5YA 4JTJA 3NQ2A 4YWIA 1SQ7A 1HG3A 1TRIA 1RZMA 2V2CA 2ISWA 1OFEA 1KBIA 3FJ6A 3SR7A 5EMUA 4FNSA 5HQEA 4ZL1A 8TIMA 4IOTA 3MP3A 3W6YA 3LCXA 2VFGA 3P8IA 3G22A 1H7WA 5D30A 2ABBA 2ZRXA 1VH7A 4U4MA 3NL6A 4FO4A 1Q6QA 3GLCA 1N55A 1W5NA 5HWNA 2CLEA 3QH2A 3P67A 1XKYA 3BW4A 3SW6A 4Z0JA 2NLIA 4AB4A 4Z1CA 1IIHA 5FEPA 5J5RA 1ML1A 4H6KA 1ADOA 1LOSA 4EF9A 2V5BA 3P61A 5LZLA 2BX7A 2YCEA 3QQ1A 2DZPA 3ZR4A 3P82A 5FI8A 3T78A 3M7WA 3LHYA 1U5JA 4I7VA 3RLVA 3WK3A 3M47A 3W7QA 4DF0A 3TSBA 4MLRA 4A2SA 3C56A 1C29A 4HHPA 1ZAHA 1FBAA 1X7FA 1EWEA 4HNUA 2V30A 3TNOA 1LRTA 3LXAA 1FCBA 3EWWA 3B04A 4LS0A 4CCDA 3GR7A 2V0TA 1W5OA 2NXIA 4WJEA 1F5ZA 1W37A 5BMWA 1FDZA 3F1QA 3ATYA 3HG2A 3S5YA 2DORA 3FKRA 4Y90A 3DH7A 5DBTA 3M44A 1G4SA 1FQ0A 1I2OA 1WX0A 2JGYA 1GQNA 2YYUA 1OYCA 5ABTA 2WKJA 3A9IA 1O94A 2C13A 3NM3A 1SW3A 1FWTA 4XKYB 1DVJA 2PRHA 1L6YA 1KFJA 1BKSA 3LI1A 3W1TA 1J5TA 3P84A 1RV8A 1GYNA 2JKAA 4MY9A 1TJRA 3QC3A 2Q8ZA 3L21A 2X1TA 1KFKA 2Y61A 3ZWSA 2QCCA 4IMCA 2V2DA 1IXPA 4NNCA 1KFLA 4Z08A 3B8DA 1SPQA 2VFFA 2FPTA 3UWUA 5C2XA 1WDWA 2PRMA 4X9SA 2CLHA 1PVNA 5DY2A 2ATMA 4HSNA 1R46A 4AEOA 1XUUA 3NEVA 3R89A 3M6YA 3TAOA 4ZVJA 4RZ5A 3GYEA 3PR2A 1DORA 1K03A 2B7OA 4HPJA 4JICA 1A5SA 3LV6A 4AMAA 2AQWA 1K7FA 3I7SA 3LLFA 1KM2A 1AL8A 3C2OA 5CZ0A 5AHEA 3A23A 4IJBA 4O54A 4K7YA 5D09A 1KTBA 5I3HA 3M5YA 3QJAA 3EWUA 2E5DA 3G1AA 3G1DA 2C15A 2E77A 4MFEA 4MFDA 2DZSA 3AJXA 3DKLA 5D32A 4R33A 1VC4A 2QCDB 2UV8G 4S2BA 1TYGA 1PHQA 1FCUA 5DELA 3TH6A 3ABRA 1EPXA 4A29A 2E5BA 2V8ZA 2GJNA 1P5BA 2ATSA 4OU1A 3M0ZA 1KLZA 3G0UA 3MI2A 4OV4A 2VFDA 2GPTA 4LC6A 3WJWA 1GG0A 3L65A 2E1DA 4J9JA 3W7NA 3EWYA 4GXMA 3GKAA 4WUIA 3TIMA 2YZRA 1N7KA 2QCHA 5FEXA 2H90A 1XUZA 4JDYA 3CPRA 1H60A 1PL9A 4POCA 3NQCA 2J9XA 1U83A 1VHCA 3GB6A 1SZGA 1CX9A 1TPEA 3IIPA 5LHEA 3M43A 4Z1BA 5CPLA 1P4CA 2Z1BA 1I45A 4UIOA 4XUGA 3TCEA 3C2VA 4RJEA 4GWEA 4BI7A 4IXXA 3G8EA 3L0KA 3KXQA 3TW7A 4GUFA 2ZRVA 3QQ0A 3P62A 2QCFA 1OFBA 3W1LA 5AHNA 3HF3A 1RR2A 3GDLA 3U8GA 3BG9A 4JTLA 1KTNA 3UWVA 3MUXA 3PSVA 1T8XA 4JIQA 4DO6A 2B0MA 1YDVA 3W3OA 1TTPA 1K7EA 5F1UA 3PULA 4LY8A 3S0CA 2GVLA 1ME8A 5F2IA 3G0SA 3BLEA 4JGDA 3P80A 3W2UA 1TTIA 1FDYA 1ZCOA 1UUOA 3NQDA 1EEPA 5LNWA 1Y0EA 1JULA 1V5XA 3VI2A 3IGSA 4LWWA 2YFOA 1NVMA 2GQ8A 2ZYFA 1UASA 3FOKA 1HL2A 4LV9A 3NQGA 3QMTA 5IBXC 4FNTA 4JTGA 2C16A 1FXPA 3T4CA 3MJYA 3HBLA 3EX4A 4X3ZA 1KM3A 5F1VA 4Y9AA 1XM3A 2DJLA 5E0KA 3O6CA 3V1PA 3KOFA 3EX6A 1QDSA 4MZ8A 5AHLA 5AOUA 1HFBA 3NOEA 1OFRA 2KZHA 3LOTA 1I2QA 1FWRA 1NFBA 3W7HA 2X1UA 4TX9A 3CM4A 2OX1A 3CT7A 4LUJA 5D02A 1OFDA 4KFOA 1EIXA 5FF7A 4JR5A 1A5BA 3DI0A 3OBKA 2QCEA 6ALDA 2A5HA 4K37A 3TQVA 3N2MA 1ZALA 2CZ5A 3ZWTA 1GZGA 2A21A 3E0IA 1OFAA 4HT3A 4FXSA 4UFLA 2Q8LA 2ZZ1A 4N4PA 3C52A 3PG9A 4UCGA 1X8FA 2FFCA 4FX6M 5D2XA 1JUBA 1RQHA 1TTQA 3L5AA 3W1XA 2F7FA 4XKYA 3USBA 5AN7A 1K8XA 3FA5A 2OMAA 4IPJA 3EX1A 3THQA 1TPDA 2OT0A 5GVJA 2ZZ2A 4Q4KA 5D05A 3P74A 2H8XA 1ME7A 4TMBA 4W9TA 4O13A 1G69A 3T55A 3G1XA 5LHFA 3DBPA 3CQ0A 4NNAA 1EUNA 4NZJA 5I3KA 1SO6A 1TQJA 3O06A 1Z44A 1DOSA 1MO0A 5C6MA 4O4WA 1VCGA 5DXXA 1EP3A 3LHTA 3MYOA 3F4NA 1EB3A 3W22A 1EA0A 3UPWA 1S5WA 3LXBA 2ISVA 3TSDA 3VCRA 2DZUA 4O14A 2ZZ5A 4WOZA 3IIOA 3W7CA 3TXVA 1OX4A 5IBXA 1OX5A 3G1HA 1OYAA 3TSMA 1YXCA 1SSGA 2I14A 5E1QA 3E49A 4ZQMA 3NL5A 1SW0A 3HO8A 2QR6A 4DF1A 3GNNA 3O63A 1G67A 2HS8A 1JCXA 4BWLC 4IX2A 3B03A 4JX4A 3R2GA 4LU0A 4O1CA 2YX0A 1OJXA 1XBVA 4RXGA 4ZZ9A 1VRDA 1QFEA 4JTUA 4RXFA 5F4WA 3T7VA 1UUMA 1C8VA 1LROA 4WY0A 3NQ7A 1B9BA 2CZFA 3RFAA 3STEA 4UTJA 2R91A 1F6PA 1I8JA 1EWDA 1LBLA 3QW4B 3DXIA 2J9ZA 4TMCA 3R5EA 4PL2A 1THFD 4K38A 5CG7A 4CNPA 3LXCA 3PWAA 5AC6A 4UFIA 2WO5A 3W1AA 7TIMA 1O5XA 4HKPA 2YDAA 1HO1A 3W88A 4KWVA 2NV1A 3W72A 2EGZA 5K4XA 1G4EA 3NZ1A 1OFPA 4FXRA 4ZQRA 3W1MA 1AG1O 3NL2A 1M5WA 2ZA2A 5U7SA 3PAJA 1AMKA 1FDJA 2G96A 1ICQA 5CGQA 3QSTA 1TPVA 5K4ZA 4IQLA 1BWLA 4JNMA 3C2RA 2VFHA 3NYZA 3G18A 1Q6RA 4LNYA 4NUWA 5EY5A 1TV5A 5CZTA 1X1OA 4RZ6A 2B7PA 3G0XA 4UUIA 4ZQPA 3RK8A 3W7LA 4C1LA 4MYXA 1W3NA 3PG8A 3VE7A 2DZWA 3IVSA 1YPFA 1TMHA 2BWGA 3KVKA 1JUKA 2PC4A 3UWQA 5KINA 1OFQA 3CIXA 3SJ3A 5DCDA 4KKXA 2ZCGA 3E96A 3SGZA 4E2BA 2NWSA 3NGJA 1YYAA 3NPXA 1LCOA 2NXGA 4NJGA 3EXRA 4FF7A 3LTPA 2FIQA 3VE9A 3G24A 3GZ3A 5K9CA 2ZA3A 4UR7A 1WXJA 1TPUA 4UTTA 1JRCA 3NQEA 1WV2A 1W1ZA 3DKJA 1W56A 3CWNA 4QAIA 1D3GA 1W0MA 3HPZA 1V7YA 3R13A 1EX5A 2E6YA 2JK2A 4BWLA 4PH6A 2VEIA 4HNNA 1HO4A 3FYOA 4QIUA 1XXXA 3NO5A 1SW7A 4K36A 1ZENA 2E6AA 5KSWA 3NQ6A 3DFTA 2NX3A 5D33A 3PB0A 4O1DA 3WK0A 3W2JA 1QWGA 1XC4A 3HJZA 2DZXA 1FUYA 1LOLA 1OK6A 3CLMA 3GIYA 2ZTKA 3N9SA 2Y85A 1GOXA 2X30A 3L68A 4JTIA 3T40A 5CPNA 4BK9A 1H7XA 3BG3A 3QMSA 2HSAA 3DHFA 2DZTA 5G2WA 2I9EA 3GXTA 3E9AA 3PC0A 4O8RA 1A5AA 2RKXA 3IIVA 2FTPA 1IXQA 1F74A 3MBDA 4JY8A 3L2IA 1JCJA 3LCFA 1DJNA 3WFAA 4A21A 1GVRA 1ICPA 3K30A 5DN1A 1S5TA 4GBUA 3IEBA 4MKNA 1LZOA 4NJIA 2B7NA 3G1YA 1VCVA 3FFSA 4HIBA 2V81A 3G3DA 3Q58A 3S5NA 3HGJA 1GWJA 2P0OA 1BEUA 3ABOA 3W1NA 3OIXA 3PB2A 5LKYA 2CZEA 5HWMA 5CSRA 1F7BA 3FEMA 5F4XA 4UMCA 4NQ1A 3F03K 5DY3A 5AC7A 1SFLA 3HGSA 3O6YX 1R47A 1AK5A 3GAYA 2FB2A 1A50A 3C0JA 1ONRA 4EIVA 5AYZA 2GVGA 4NT0A 1IIGA 2GOUA 3MHFA 3FYPA 1PV8A 2GJLA 3EKLA 4ML9A 1W31A 3ZS4A 3N73A 2Y7EA 2FPVA 1W3IA 2HTMA 3NG3A 5BOOA 1ZAJA 5HJLA 2WNQA 4IWWA 1GYLA 3UZJA 1OHLA 3D0CA 1F76A 3I68A 2EPHA 1QPQA 2CFFA 1IGSA 3SSJA 2RH9A 3LRMA 4AH7A 3GDRA 4ZQNA 4YMZA 3B4UA 3S1UA 1GVFA 3KRSA 2O7SA 5A5WA 5J5DA 1VZWA 2JKEA 2JKPA 4NJJA 2OJPA 3DENA 1VLWA 1FWNA 1K3UA 5G1TA 3PUEA 5DCBA 2IQTA 1T99A 3C2EA 5AYXA 2RFGA 4OBTA 4M6PA 5D38A 3TQKA 2ABAA 2EKCA 1RD5A 3W70A 4PODA 4NX0A 2EF9A 5EBUA 2GVJA 5LSMA 3JS3A 1EP2A 2NUYA 5HR7A 4LVFA 5C54A 4XBSA 1RPXA 4FEZA 3R12A 2WJZA 4O0ZA 4WZHA 4GUJA 3UWWA 6TIMA 5D04C 4AWTA 5AHIA 1IXOA 1FCVA 4AF0B 1UBSA 4JD4A 3KVLA 4E2DA 3CEPA 1D9EA 1M7PA 1LBMA 3NQ8A 4O0KA 1MSSA 2R94A 1L6SA 5G2HA 3CIWA 2E5CA 3NPUA 4RCXA 4JYDA 4XWUA 1GVOA 1FWWA 3LRKA 3QYQA 4UTLA 4IMDA 1W3TA 3ABSA 5LGXA 1QCWA 4N9BA 2H6RA 3UY8A 3Q2DA 4LS2A 1EP1A 1WA3A 2JGQA 4DPQA 2FDSA 4P2VA 1KM6A 3KVJA 4LRSA 4NJHA 3Q94A 4FX8A 2ZFAA 3MI3A 2PURA 4LV4A 4O15A 1M7OA 3N2XA 3MWAA 3O07A 3N9RA 2BLEA 3FS2A 4IX0A 1W54A 4MVAA 4JYFA 3B0UX 1H1ZA 2QUVA 1O95A 2A1YA 4ONVA 4RKAA 2W79A 1VHNA 3SECA 1TREA 3SGUA 2WSYA 4PTNA 2XFWA 4U28A 3TR2A 1TTJA 1TJPA 4NXSA 4OE7A 2RDUA 1ZY9A 4PL1A 2WOQA 1Q3NA 2Y6ZA 4GUHA 3SI9A 5I3IA 3QW3A 1LM1A 2A6LA 3HG5A 1M6JA 3STFA 3TDFA 2NZLA 3B05A 1LRNA 3EXSA 3PBWA 3LCIA 4LW7A 1H7OA 3GXNA 3KVMA 4Y8FA 5G4EA 3C4UA 1FWSA 2VOMA 4LT9A 2ZZ3A 3L5MA 5G4WA 3WJZA 1NEYA 1QNVA 3W71A 3P60A 2C0AA 1LDCA 4GFSA 4LTSA 1QAPA 3UPBA 3QZEA 3W7KA 3TA6A 2GQ9A 1VPXA 1YDNA 2VKZG 4OQVA 3BVJA 3L5LA 4DPPA 1QO5A 2YPIA 4E38A 3W2MA 1P0KA 3LI0A 2Y7GA 1G7UA 4R7JA 5MHBA 2YGYA 1QOPA 1DBTA 2QAFA 3FLUA 3GDKA 1PIIA 1ZNNA 2ZTJA 4JY9A 4K6AA 2CLFA 3LX9A 5TBOA 5C55A 2G95A 2P1FA 4N4QA 1F73A 4MZ1A 2VXNA 4N6FA 4RZ4A 2NV2A 1QPRA 4JTTA 1VGAA 3W7OA 1LBFA 3IIXA 2Q3RA 3PF3A 2QJIA 2EHHA 5BRBA 1DHPA 1XFBA 1Q45A 2VFIA 3W86A 4ZQOA 5K2ZA 2EAWA 2A7NA 4WY0F 4L4LA 3UXAA 4PA8A 4GJ1A 4K8HA 3CC1A 1YXYA 3PBYA 4AHOA 4YXGA 1KFCA 1H7NA 1PE1A 4FNRA 1GTHA 5HUPA 4AWSA 4R34A 1H50A 3TJXA 5H2ZA 4RK8A 4MY1A 3R8RA 3S8HA 4PFMA 3NZRA 2O7QA 3ZFHA 1UCWA 3JRKA 3OHIA 3NVTA 1J4EA 3NPWA 2H3BA 4WOQA 1P1XA 4FIRA 3KX6A 3CU2A 3HGRA 2GQAA 1JR1A 5G1YA 3MHUA 3HB9A 3EWXA 5FF0A 2BZNA 1B4KA 3I6RA 3W23A 1ZJIA 3LCHA 3W2LA 5AB3A 2VEKA 3A21A 3RLUA 3VKJA 1LOQA 3IRDA 5KMYA 1I2NA 2ZRZA 1UB3A 1YLVA 4D2JA 1KM4A 5HWJA 1ICSA 2QCNA 4P61A 3BARA 1VYSX 5D2VA 5AYYA 4N9DA 2ZRYA 1YTKA
chains in the Genus database with same CATH superfamily
2GSEA 1Q6GA 4P7RA 3UP8A 2BOEX 1KCXA 5DMMA 4D6CA 2ZZ6A 2X41A 1B30A 2Z6JA 1Z48A 2WMIA 1NSJA 3NYDA 1EDQA 2QDGA 4X63A 1W1A1 4GQ0A 6XIMA 5BMXA 1KQYA 3UXLA 4D71A 2ZVRA 2D73A 2VNCA 2EPNA 5HMDA 2GVYA 3HPSA 1XBYA 1B3OA 4H8UA 5H8MA 3LCLA 4JX6A 2VDHA 4AQLA 3OLIA 4H9TA 2GWGA 4RNHA 4E8DA 4DQWA 1WB0A 1M04A 4YTRA 5AHFA 3TVAA 1JVNA 3WEOA 1NDYA 5CZJA 1QRQA 3P7YA 1Q85A 1H63A 1KCZA 3SZ8A 1H7PA 4MUZA 1DXIA 4KRZA 3A3HA 2CLLA 3VC5A 3GY1A 2KX9A 3WK2A 4DY1A 1D3HA 1GW9A 3PK7A 1P48A 4WKFA 1VCFA 3GQYA 5DLCA 3GHRA 4KQNA 1VENA 3S1GA 3R0UA 4IQEA 4DNHA 1TWZA 5DCEA 1SFTA 4IMGA 2QCDA 4DNMA 3PS7A 4LJ3A 1ZBWA 2Y63A 3QPEA 4XAZA 1KA9F 4CLMA 3GYCA 3BH4A 2WQDA 2CEQA 4RR4A 1JAKA 2A79A 1WE5A 5CXPA 2VGGA 3RM4A 2UBPC 3LS9A 1XIJA 1BSLA 3LSCA 4WGHA 3NPVA 3WYZA 3BSHA 1OC6A 1A0DA 3AWNA 4IJCA 3YPIA 1D8WA 1TPWA 3G1SA 3STGA 1IZCA 3CHEA 3D5HA 4KWWA 1XFCA 4MWAC 4IH3A 4DJFC 6REQA 1PKNA 3SIZA 5HMEA 1W32A 3VKDA 1SZEA 3SBFA 2W6RA 3W9ZA 4H9XA 3AIEA 2HDJA 1MZHA 4PUNA 4DYJA 3EPOA 2QXWA 4AWUA 2PTXA 4GIEA 4OGZA 1A5CA 1PBGA 4ALDA 1E6NA 3M07A 3S2MA 1EFZA 4EOUA 2BY1A 3WLLA 3WY1A 1QW9A 1MEIA 3MKVA 5TIMA 1MWOA 2Q71A 3GO2A 4V2XA 2ANUA 3GKFA 4NL1A 1QASA 1XLLA 3CTTA 4WD0A 4CNNA 1GZJA 3H4WA 1HJQA 1RCQA 1FWEC 4PB5A 3GDMA 1JPKA 1ZCCA 1TV3A 4E2VA 3IGUA 3DFHA 1JPIA 3T6CA 5HNTA 2C0HA 5EL1A 3FVMA 3HIJA 1HKJA 1P6BA 3W75A 4AVFA 3LGDA 4J40A 1X1ZA 1J2WA 1VR6A 3MMDA 3W83A 3N14A 1GEHA 2WHJA 4BQ5A 3W7PA 2D0GA 1E4MM 3APGA 3GG8A 3DU0A 9RUBA 5I00A 4WCJA 3NA8A 3PVFA 1W5QA 4LGXA 2CNCA 3OU8A 3CHVA 1YNYA 4H9YA 1XRSA 3TK7A 2CBUA 2XFRA 1GOWA 1ADSA 4RUBA 3VNIA 3CLWA 1ISYA 2VX6A 3LDVA 4UQCA 3HMJG 3GWQA 4JXCA 2D3LA 2PWDA 5C9ZA 2RDWA 3M5ZA 4PMQA 1O5KA 2ZKMX 4LF2A 1LUCA 3WQ4A 3ZVHB 3M0KA 1EKOA 2XH2A 2QEZA 4L6HA 3MMWA 3HM7A 3NXLA 5T8GA 3U48A 4PBEA 4OOZA 3DHUA 1FWJC 3WO8A 2P53A 4M24A 2Y1HA 1BVNP 1E9LA 3Q37A 4EP8C 5HANA 4O57A 3TW6A 4KGJA 3FYYA 4TTGA 3SCNA 1GPFA 2E9BA 2XM1A 1RCOB 2I7GA 4MDPA 1SZNA 2VDGA 3F5LA 3NQFA 1B4EA 4ATDA 1OX6A 1L6WA 3B97A 3EB3A 4DX3A 5FOOA 4BEQA 1E6QM 4YVPA 1MW3A 1K7XA 5F2LA 3PPCA 1UZHA 5FESA 2YFNA 1QVBA 4A22A 4C1NB 4PUWA 4GZJA 4Q4MA 2F8QA 5LNRA 3WJYA 4GNJA 3W37A 4DF2A 2WQPA 1G4PA 3DGRA 4TU1A 4TQTA 1MQRA 1XI3A 1UUQA 1AQFA 3I6EA 2XZ9A 4FLSA 2JFEX 3E2VA 2PZNA 5A8PA 1IWBA 2QVNA 1ECEA 1ZAIA 1DWJM 4W8BA 5I07A 3DI1A 4O1AA 5CAKA 1MQQA 3LZ3A 2DVTA 3EWCA 3TJLA 2QJMA 2XH4A 2VQTA 3MB9A 1GKRA 4EWJA 3PTQA 4CD7A 4F3HA 1KLYA 3VDGA 2PBGA 3WQFA 3AZRA 4K39A 2C6QA 1TR9A 3ZVIA 3M0MA 2QLYA 3LLDA 2F38A 5CQ1A 1BQGA 1LP6A 3LU2A 4XAGA 4H83A 4O28A 2WXDM 4UFKA 1DXFA 2G50A 1JNEA 3UZXA 2OZ8A 1BSIA 3WQCA 3TKFA 5AY7A 4DLFA 3NCOA 4XZIA 1KFBA 4PCNA 2QUUA 5C9WA 2XN0A 3W73A 3O15A 2Z26A 3UZ5A 4W88A 3IVUA 1JZ3A 2Z00A 1TIWA 4CU6A 2QUTA 1HKVA 4Q7NA 1JCMP 1UC4A 2PC8A 1NTHA 2V6AA 3EMZA 4KF1A 5ABGA 3M46A 3VA8A 4JTSA 2OU4A 4K2SA 4CD5A 2NQ5A 5GQBA 2R1LA 3GH4A 3P0XA 2X2GA 2Y0FA 3FSTA 3D3FA 2WYSA 1EJSC 4RW5A 2EXOA 3W7IA 3W87A 2A2IA 4IPIA 1P0EA 1HP4A 2PDIA 2B4GA 1VFHA 5M17A 4NASA 4X22A 3V0SA 1L2UA 4Q8UA 2F6XA 2AOSA 3B0VC 4D6EA 5EPDA 3WBXA 1FWCC 2A7PA 3B9OA 1JZ2A 1TA3B 4MWAD 4ZCWA 2C8NA 5FF4A 4HSOA 3NFUA 4C7FA 4JCMA 4XZ9A 1SR9A 3WUEA 1VBJA 2HE8A 1JI2A 4GINA 3RU6A 2PB1A 5C5YA 3OZYA 1NOUA 2XFYA 1TB3A 1XIBA 4A3YA 3UR8A 1T96A 1PZ2A 1QI4A 1WAUA 4MG4A 2W66A 2DFAA 1R30A 1E6PA 3XIMA 5C71A 1XIHA 2PWFA 2VVNA 4NAFB 2ISSA 2X16A 3N17A 4V33A 4FB7A 1G4TA 3P8JA 3CHFA 1JDEA 3ARTA 2GZXA 1WQ5A 4RLIA 1ISXA 5G2IA 2ZC1A 4AW7A 2R82A 4GIYA 3B0PA 3UD6A 1LL6A 1KM1A 4GVHA 4YL2A 2QJJA 4IG2A 3SQSA 3UA4A 4DZHA 4PBFA 3EPMA 4EPDC 3MVIA 5CJNA 4PMVA 1DWAM 4XSMA 2YL5A 4XD6A 4FHAA 1N2VA 3U6WA 3LBCA 3M9YA 4IUGA 2D2GA 3GG7A 1UH3A 3VD3A 4LVAA 5FJUA 1DE6A 4AF0A 2GQ3A 2X1IA 4WKHA 3KE0A 1JYNA 1F4HA 2WSQA 3A5FA 4ATWA 3DECA 2D0FA 4B5XA 4IQDA 1U22A 1AUSL 5H8PA 4DO4A 2PODA 2X1RA 5CC6A 5CPMA 1V3HA 2CPUA 1W8SA 1XGDA 3C0SA 3IIZA 3WJSA 5CJ5A 4NX5A 4WK9A 4JKMA 1K9FA 3AS0A 4FI4A 1K8YA 5K9XA 3HG3A 4S2CA 3TV8A 4ZTXA 3C8FA 4CD6A 4F4RA 3F2DA 1WZAA 4HZ7A 3AO0A 3K13A 3O1NA 2O9OA 2WM1A 3PZTA 3B06A 3FIGA 3VIMA 2FQIA 5ABHA 3VXGA 1TPC1 4Q8QA 2PDCA 4O52A 2VO5A 1K02A 3RCYA 2VGBA 1DQXA 1R3RA 3L4VA 3WMSA 4ZXOA 3N04A 4QNEA 5DXYA 2GUBA 3WN6A 1MEWA 3TQ0A 3MTWA 2PRLA 4B90A 1OABA 2JF6A 4XZLX 3KLLA 2HPMA 3EKZA 1J96A 4L1WA 4F0LA 5CGMA 1X6UA 3RHGA 4GC4A 1OD0A 3RMJA 1UG6A 2OODA 1PCWA 2J13A 1TPH1 4EXBA 3WQ8A 3LTYA 1M01A 3H26A 1O6IA 1W1VA 3GFYA 2OYKA 2WVUA 3TNBA 3U4AA 1Z9AA 1LWIA 2PCQA 4ZOAA 3KCOA 5GJMA 4X61A 1GCYA 1VS1A 1MUCA 3T2PA 2BGQA 1UWRA 5F2GA 5XINA 3T44A 1UHVA 2WHKA 2LLEA 2WHLA 1Q2RA 1EPVA 2YLAA 2IXUA 1S5MA 1VFTA 1HG3A 2WB5A 2OVLA 3BAXA 3IJ9A 4XD3A 3WNOA 2CBVA 4FNSA 1UJQA 3E2RA 4ZL1A 3MP3A 2ZWYA 3P8IA 4PULA 1H7WA 2QJNA 2ABBA 2ZRXA 1VH7A 3N9KA 1HKIA 3QH2A 4UQEA 3RM8A 3SW6A 2HVOA 4FP1A 2NT0A 3PN8A 5CPQA 3SN4A 2NLIA 4AB4A 1AZ2A 2FH8A 1ECQA 4H7VA 2GGGA 2WPGA 4LYQA 2Z1KA 5J5RA 3GBEA 1PPIA 5CPTA 4HB7A 1ADOA 1LOSA 4R9OA 2V5BA 3LMYA 3M0JA 5LZLA 4QSFA 2YCEA 3ZR4A 4A8NA 3COTA 1A0CA 3EDDA 3I3BA 3WK3A 2QPXA 4DF0A 1WZMA 1ZAHA 5DANA 4YNGA 3OQ8A 5E0CA 3UYIA 5LXEA 2VZOA 1FCBA 4IP4A 1XIIA 1TCMA 3EWWA 4HN8A 2ONEA 1S3TC 3GC2A 3F1QA 1D7FA 4L9XA 1RSCA 3KBVA 4WSHA 3WD1A 5A3HA 4IFKB 2ZX7A 1V6TA 1IT7A 3M44A 1I2OA 5E9XA 1B9ZA 2NSOA 1J8VA 1OYCA 5ABTA 3PTKA 4DYEA 4DBUA 4AZIA 4TV5A 1DP0A 4H6EA 3I3EA 3O0FA 2XISA 3REQA 1L6YA 4JKKA 4M56A 5MKGB 3W1TA 3TP4A 3P84A 5EMKA 3V4BA 2JE8A 3IUIA 2X1TA 2QULA 4PMOA 4HA3A 2PS2A 4ACZB 4EACA 1DIOA 4MB5A 2PSNA 4Z08A 5C2XA 4GZEA 1UKQA 2ATMA 4AEOA 3UESA 3M6YA 3QLLA 3QHNA 1C7TA 2WJDA 3WDJA 3ARQA 4LAZA 4KESA 3N25A 2VMFA 1DORA 2B7OA 2PCEA 4US5A 4GBDA 1K7FA 1Q6FA 1Q7ZA 1QW7A 3LPFA 1WUEA 3LLFA 1KM2A 2IQDA 1XIEA 5DEZA 1AL8A 4K8GA 5AZ1A 4MTVA 2CHOA 3DG6A 1V08A 4NY2A 5D09A 1V6VA 3MPGA 4Y7EA 5ECVA 3THCA 2ZADA 4ZOEA 3G1AA 4RL3A 4TXEA 2F2KA 4MADA 3KUMA 5FIPA 3MV01 4HK5A 4ZO6A 1GKQA 2UV8G 3N15A 5FSEC 1TYGA 1PHQA 5DELA 4L1XA 4GNVA 3SRFA 2GDUA 2V8ZA 5AYBA 1KLZA 1XG4A 3B8VA 2VFDA 2GPTA 4LC6A 3TONA 3WJWA 1GG0A 1PX8A 1B3XA 3L65A 4TV6A 3W7NA 3K4AA 3VOIA 4KIEA 4WUIA 2G3FA 3FEQA 2H90A 4HNOA 3N4FA 3CPRA 4ZFMA 1CXHA 4QJ5B 4G8TA 3GB6A 3IIPA 1TPEA 4CN4A 1OADA 3WBWA 4UIOA 3K8LA 3MDWA 3F2CA 4RJEA 2DSKA 2E4TA 3JUGA 4A8IA 1O68A 3TW7A 4GUFA 1I0DA 5BXSA 1CBGA 3QQ0A 4IQJA 1WO2A 3TTYA 2C1GA 4WLCA 3D6NA 1FWFC 3HFTA 3IV8A 3MUXA 4W7VA 3VNKA 3WIJA 1T8XA 4JIQA 4DO6A 3TOYA 2VC9A 4YWSA 2V38A 4F9DA 1TTPA 3MU7A 3NQBA 3S0CA 2GVLA 4E8CA 5C7HA 3NOYA 5FJTA 4DUWA 3PWGA 4J35A 3BLEA 4JGDA 3P80A 2CETA 3W2UA 1EJUC 3A4WA 4IZGA 2XSAA 5LNWA 1Y0EA 2WMHA 2ACRA 2POZA 1V5XA 4GY0A 5I3DA 3IGSA 1NVMA 2ZYFA 2REQB 1W9UA 1W3KA 3GG1A 4FNTA 4X3ZA 1ONXA 1KM3A 1ISVA 5F1VA 1XM3A 4EE9A 2DJLA 3UCDA 3O6CA 4MM1A 3PZUA 1QDSA 3WUGA 2BXZA 4UCFA 3FV9A 5AHLA 5AOUA 1HFBA 4UQ9A 5J8LA 2XPKA 4ML4A 4JFTA 1SMDA 4IP5A 4N42A 3LNMA 1I2QA 3W7HA 4EXQA 4FALA 1XX1A 3MCNA 3DI0A 2OYLA 5BOFA 2BG5A 1AVAA 2YXXA 4QFUA 4HYVA 2PFHA 2XZ7A 3ZWTA 1QBAA 3LM3A 4UFLA 2Q8LA 2ZZ1A 3VVGA 4MAVA 3WEZA 1BTCA 1CXIA 3PG9A 3QGVA 1I1XA 1JUBA 1CNVA 1OY0A 5AN7A 3CUXA 1K8XA 2OMAA 3UG4A 5I79A 3OLDA 1VB9A 3RILA 4DAIA 3THQA 2YBTA 1PEZA 1K9DA 3P74A 4W9TA 3T55A 3G1XA 1EBHA 5CSYA 4C1NA 1MO0A 4U33A 4Q8WA 4ZB0A 4B3LA 3WLNA 4S23A 4O4WA 5A94A 4XB3A 5DXXA 1ZP3A 2VD8A 3G2GA 2J7HA 3GR4A 1ZL1A 3MYOA 3GTXA 2R9RA 1V02E 3F4NA 1EB3A 5IXEA 2D0HA 5FJPA 2IPFA 1WCGA 1WPCA 2VX7A 3LXBA 4NI3A 3VCRA 1LWHA 1JAEA 1XQKA 2EPKX 3ZQ9A 4WOZA 1U5HA 3VX1A 4HSHA 3TXVA 5IBXA 2W5FA 1OX5A 1OYAA 3TSMA 4HZ6A 3TYZA 1YXCA 5E1QA 3WQDA 1EXBA 5GPRA 1SW0A 1XH2A 1XIDA 3CNYA 2O9RA 3HPAA 4XZBA 2SFPA 3GNNA 3O63A 1G67A 2HS8A 1AD4A 3VOCA 4JX4A 5FL1A 3ISIX 2OXNA 4ZZ9A 2GJRA 4XZWA 1C8VA 4PSRA 3NQ7A 4V28A 1B9BA 4RPPA 4HK6A 4W8LA 1ISWA 5JH1A 2DUZA 1LBLA 3K2GA 4EPBC 4JKLA 2J9ZA 3ZLHA 4CN6A 3LXCA 3EMCA 4DHGA 2PUZA 1WXZA 1R3SA 3UJSA 2ZXDA 1HO1A 1RP9A 5FSDC 2I17A 3LPOA 3RR1A 5JH2A 1EF3A 4GC3A 3NURA 4YIWA 2GVEA 4FXRA 1OFPA 4ZQRA 1AG1O 5U7SA 3RITA 4H6RA 1ICQA 3QSTA 3GH5A 1TPVA 3S3GA 5K4ZA 6TAAA 1BWLA 3WBAA 3FHAA 2UY5A 2YBUA 2HWGA 4AZCB 4E4PA 1TV5A 4MUPA 5CZTA 3GDBA 1UYQA 4E3TA 1BXBA 4MYXA 1RLDA 3CUJA 1B3YA 5BXRA 1JFXA 1FP8A 2BWGA 4W89A 1JUKA 4YTUA 2PBOA 4PUEA 4K1GA 1V6XA 3BSGA 4RDVA 5IRPA 1ZBVA 3SGZA 2NWSA 2PP0A 1W8GA 4I9TA 3CUZA 2HROA 3G5EA 3EXRA 3LTPA 5K9CA 1TA3A 4UR7A 1WXJA 1TPUA 1ZP4A 5AC4A 1JRCA 1XRVA 3NQEA 1W1ZA 1W56A 2E0PA 2V5KA 4QAIA 1E6SM 4PH6A 2VEIA 1SW7A 1PO9A 4K36A 1F3XA 4B92A 4CN1A 3NQ6A 1C91A 4HMNA 1P43A 3PB0A 4XZHA 5DRIA 1JFHA 3AS2A 4X0VA 5JUVA 1JXKA 1ZRQA 3N9SA 1WAWA 3KOZA 1GOXA 1PB0A 3VUPA 3AMLA 1GOMA 2W4XA 1EEXA 4LBRA 4BK9A 1BVWA 4IGNA 4D6GA 2DZTA 5G2WA 2I9EA 1J6OA 4O1EA 4U3AA 2PWGA 2RKXA 3CQKA 1IYXA 3BAKA 2BGNE 3ARPA 2YDRA 1Q4WA 4F2TA 4DM1A 3WFAA 1TVLA 4A21A 1GVRA 2WVTA 4MKNA 5BXPA 1Q7MA 4PSPA 2BXYA 2PDGA 4GX9A 3GZAA 5IFPA 4GZ7A 3W28A 1Q63A 3S5NA 4B5VA 1HJVA 3OIXA 3PB2A 4YU1A 5CSRA 3ZR5A 4GOAA 3FEMA 4NQ1A 1YW1A 1A5UA 5E0FA 1SFLA 4HOZA 1EC8A 4IP7A 3SEPA 3QKZA 2V67A 4R9XA 5ABFB 3C0JA 1AH0A 1ONRA 5AYZA 1NQKA 3MHFA 1MNSA 1PV8A 2OR2A 3URAA 4PN2A 1EDTA 1UMYA 1ZAJA 5HJLA 1LL7A 2WNQA 3RCMA 3OBEA 3MY9A 3CBWA 2CZVA 1JZ7A 2RH9A 4S3DA 4DRSA 1GVFA 2O7SA 5D8WA 1WKYA 1K3UA 5G1TA 3PUEA 5DCBA 2IQTA 3WLPA 2RFGA 4FK9A 1XSJA 2ABAA 1ZJHA 3WUFA 3RU8X 1OC5A 4PODA 4H19A 1PJ9A 2GVJA 2VZVA 3E0VA 2QUNA 3AOFA 2G8ZA 3PJUA 2E25A 2ZUWA 4WZHA 1OEPA 1VEMA 2PDYA 3OZOA 5A6MA 4ZBCA 6TIMA 1XH1A 2NVCA 4AWTA 3VCNA 1OINA 3KVLA 3CEPA 1R6WA 1M7PA 2FJUB 1LBMA 2QDEA 4H2HA 3U2ZA 4O0KA 5DQPA 2R94A 1UQYA 3CIWA 1VFOA 2PLJA 4RCXA 4ROPA 3V0UA 4XWUA 2QUMA 1FHUA 3MDUA 4A6GA 1FWWA 1EX1A 1E55A 2Y5SA 4IMDA 3ABSA 1NM9A 1QCWA 3Q2DA 3OZMA 4KRTA 3H23A 1KM6A 1R3WA 1PYMA 2PURA 4LV4A 4O15A 1U33A 4XSLA 2E8ZA 4IX0A 4JYFA 3B0UX 1UKOA 4ONVA 1UWAA 2W67A 2WSYA 3M7SA 4GYKA 2JIEA 5BRPA 2RDUA 1ZGDA 3A13A 4LAMA 4RE2A 2NVAA 3A3WA 3BCFA 3UFYA 4XVEA 1AA1B 2A6LA 3HG5A 3L4ZA 3O0KA 3PBWA 3EXSA 4WRHA 1H7OA 4GH3A 5A2AA 4DXKA 4AMCA 4Q4SA 4QHRA 1UKSA 4WDXA 3IAQA 1E43A 4DYKA 3L4TA 1GGOA 2J6VA 4LT9A 3H2MA 4NZ3A 3T2QA 1QNVA 1VP5A 2G3NA 1LDCA 5IDZA 1XIGA 2WANA 1E9YB 4GQBA 3GW0A 3QZEA 3W7KA 1RUSA 2GQ9A 1RK5A 1YDNA 3WF2A 4FPSA 1NU5A 3BVJA 4E38A 2Y7GA 1G7UA 2FGLA 3L23A 3GDKA 4PFHA 4JQ1A 5ABEA 2CLFA 3LX9A 4CQBA 5C55A 1GOOA 2P1FA 1F73A 5REQB 3DBNA 5J04A 3C0LA 2D22A 5CCZA 2DQWA 4E4UA 4XV0A 1JYWA 1XCWA 4JTTA 4V1YA 5IFTA 3A64A 3PF3A 2QJIA 4L61A 3OW1A 2R1NA 4AX6A 2VFIA 3W86A 4WHBA 3VIHA 3P3BA 4IPPA 3GUGA 2A7NA 4PA8A 5C0QA 4K8HA 3GNXA 3AI0A 4YXGA 1ITCA 1IE7C 3B9DA 4BY3A 2OO0A 2EG8A 4ROQA 2ZUMA 4GG9A 5H2ZA 3R94A 4MY1A 1RJQA 3A47A 4PFMA 3NZRA 1E72M 1UCWA 1BQCA 3BOLA 3NPWA 3BDKA 2D2HA 1P1XA 3KX6A 3HGRA 2XFFA 3UJFA 1V3KA 2P8BA 3FSUA 5G1YA 5FF0A 1ADDA 1B4KA 3I6RA 4IFKA 3W2LA 3RLUA 3VKJA 1LOQA 4AZGA 2QS8A 3V7PA 1ICSA 1V0NA 4GH1A 4MF4A 1RP8A 3WL0A 2XGIA 2ZRYA 1GW1A 2YA1A 2CCRA 4W7UA 3ZJKA 1XC6A 5AC8A 1TVNA 3MW7A 3UBPC 2IQ0A 1YX1A 4Q7IA 4QDWA 1U1JA 3TJ4A 4CVUA 2ACQA 2JBMA 4QITA 4ACZA 3H54A 3ARXA 3MO7A 3ES7A 2C3ZA 3A9BA 2OX4A 3WQ5A 1OBAA 1YPIA 2C18A 3MHGA 3UVIA 1XL9A 3QTPA 4O17A 2JEQA 2ZA1A 3TEVA 3WD4A 3UF9A 1E9IA 3HPXA 1SMAA 4N7QA 4YCPA 2QIWA 3AMGA 2G5WA 4HNVA 3RIKA 4J3WA 3CL6A 1Z7AA 2OFJA 2QKFA 3UT0A 3DC0A 2NWRA 1F4AA 2PTZA 2HMCA 4IIDA 3W2KA 3U5YA 4UTFA 3DYOA 1FHLA 1R5YA 1GJUA 1VJIA 4I3GA 1YKWA 1ZJBA 1E1FA 4DO5A 1T6MA 5JIWA 2EPOA 4A3RA 3ORWA 2YB1A 4AUBA 3QSRA 1TX2A 3DIPA 1W5PA 4NZFA 3BJSA 5DT5A 4U3CA 4FOKA 3SADA 4KEVA 3C2FA 3E0LA 4H2CA 5TQLA 3K8KA 1DJYA 2CLPA 1UR2A 1NFGA 1DV7A 4GQRA 1NDZA 3NQAA 1KC7A 2HJPA 1RY8A 2V5LA 3GX9A 2X1SA 3IJ7A 3M0VA 3ITCA 3V5OA 3IRSA 3OZPA 3H7UA 1ALDA 3DERA 3TC6A 1B57A 4BJHA 4OOUA 2CLOA 2DT3A 2P50A 1CI1A 4RNIA 4B2DD 3GR8A 4DXVA 2BVTA 4M0XA 4WKAA 3FJNA 2VT0A 1A4MA 3S6DA 4C7DA 3CL8A 4JFVA 2XIMA 3RJYA 3USZA 3GVGA 2VTFA 3C0QA 4CKQA 1ZPTA 4UBPC 3UR5A 4JN6A 4DLMA 2OZ0A 4GE8A 3B9AA 4HJFA 3W24A 1JJKA 5T9BG 2GJPA 3ATZA 2H8ZA 4UMBA 1NDVA 2FMOA 1IR1A 2O4MA 4GUIA 4IMAA 1LG2A 1DJQA 3EZ4A 3HGOA 2IPGA 1NH6A 3QFEA 1FP9A 4IIFA 1TV8A 1OQFA 1JZ6A 1KRCC 2PTYA 1H49A 2VC7A 1H62A 1YBQA 4Q6XA 5A8NA 4I8YA 4CQ8A 1V4YA 3AALA 2XJ7A 2VQUA 3GTIA 4NI8A 1KFEA 1J11A 3APTA 4F48A 4I5XA 1MW0A 1JZ8A 3V18A 3KHJA 1KBKA 3TE9A 1U1UA 1AW5A 1EA9C 3TC7A 3VDCA 3F7JA 3DEQA 2PTWA 3BV4A 1FHVA 1XLKA 3PZVA 4OFCA 4UTMA 2JEPA 3TU9A 3S1XA 3BMXA 2FJKA 3EX3A 2WKLA 4AAJA 2PWEA 1X6LA 2R24A 2G0WA 4CUCA 4GXWA 2DT1A 4S1FA 3SFWA 7TAAA 3VIGA 4UR8A 1GOIA 4HU3A 2NXHA 2P0IA 4YTSA 1HUVA 4EF8A 1F2JA 2RDTA 3M6DA 3I3DA 2DU2A 3T0BA 5KTLA 4B5NA 1DTUA 5BNKA 2E68A 1DEDA 1DWFM 1SJAA 2ZE3A 4PUKA 5HQLA 1C7SA 3IV3A 2WSRA 3VPLA 2IPWA 4AIUA 3R11A 4UMAA 4F2UA 2XG9A 1V93A 3OG3A 5LA2A 1R85A 2TPSA 7REQA 5FKYA 1XDLA 1K4HA 2J8GA 4D6JA 1HQTA 4OWGA 3BCDA 3PM6A 1TR1A 5FL0A 2YYTA 3AJ7A 5FF2A 4N9EA 3M16A 3DAQA 1JRBA 3QF0A 5DBUA 3EWZA 3IS4A 3U3HA 4C6MA 1HJWA 3S9YA 1Q6LA 1XH0A 5HJYA 3NDOA 5D37A 2OOGA 3VOGA 1M3UA 3ALFA 1E1CB 1OX4B 4F9JA 5K9DA 2OGJA 3I7QA 4O18A 3JZUA 1L9WA 4GPNA 3JVAA 1CYGA 3ELFA 3PBVA 1S1RA 4I6KA 4U5KA 2XSXA 4PMNA 3RRAA 4B4FA 3M4HA 3S5OA 1GORA 2A7RA 1R38A 4JIIX 4AZCA 5A69A 4W4QA 1CXFA 2NUWA 1EHAA 2BFGA 3LV5A 4WY0B 2R8WA 3FJLA 2TAAA 4UTUA 4BFAA 1UP2A 3SM0A 4KEUA 2I5IA 3EEGA 2WVVA 3DYPA 1ODUA 2VENA 2Z7KA 3GIQA 4LC8A 1KM5A 1XDMA 1R2SA 2UZ9A 3RUBL 4HYRA 2QDHA 1FCQA 1I0BA 3MYPA 3QBUA 5JXQA 4LYRA 1EF2A 5I78A 1QOQA 4O16A 2ZX8A 3NQMA 3W01A 1R9ZA 2OQHA 3OA3A 2X0HA 1KBBA 3ITGA 4UNKA 1VFFA 1XRTA 1MRAA 3FDGA 2PDMA 4C5ZA 2EPLX 3W26A 3DZ1A 5D2TA 2PLCA 2J74A 3EEZA 4QTGA 2ASHA 4S39A 4P7QA 5AVNA 2XUCA 2WW5A 3GVQA 1S39A 4MJMA 3ICJA 4W7WA 1TE6A 2ESCA 3WLJA 4FR6A 3QMRA 4EWND 4OV9A 3AYVA 1JEZA 3TMQA 3RF9A 4ACYA 4K7VA 3N12A 1SYTA 6XIAA 1RLCL 2WNWA 4TO8A 3TWAA 1QPOA 1RQBA 1AMYA 1B54A 4PCFA 3KCLA 2OEMA 1ESWA 1FA2A 1R87A 2WCGA 1AZ1A 3GC4A 3VD5A 4KW2A 1SUXA 4BI5A 5E09A 1G1YA 1XCFA 3TYAA 3QRHA 1TX0A 1X8CA 4OT7A 3QV8A 4LRTA 3WF1A 1G7VA 3JR2A 2HVMA 3ES8A 1NARA 3GAKA 4QJ1A 1YADA 1PHWA 3A5VA 4B16A 3RX2A 1IF2A 1CT5A 3G77A 4IIEA 1W9XA 1YHTA 3H7VA 1H1YA 2OCZA 3L0NA 4P8VA 2J9YA 1RQEA 3FN9A 4ZTYA 3M0YA 3R8GA 2YB4A 2WWDA 3LENA 1WBHA 1S2WA 3DCPA 1JZ5A 2RAGA 4EXAA 2Y70A 1PZ1A 3FDKA 4GGBA 4MSSA 3MUY1 3W74A 4Z2JA 1LTDA 2P3EA 3T07A 3LCWA 4AEEA 3IVTA 4MPKA 1E0XA 4QE5A 1CXKA 2PP3A 4XTIA 3GG0A 1JD9A 3VZXA 4EAMA 2WM0A 3SY5A 2CLIA 3DC8A 1K8CA 5D4YA 2VX4A 7PTDA 2AL1A 2XINA 4BR1A 4PUMA 3NNTA 5EGRA 1LLZA 3NAVA 4PMDA 1TO3A 3KL0A 2HNEA 2ALDA 1E5JA 4DIAA 3BICA 3SO7A 3QPYA 4Z0SA 1IEVA 3AXXA 2VC6A 2BY2A 4NZCA 3RN6A 5CAHA 2FLIA 3K5XA 1L6FA 2Y62A 1SZRA 2O55A 4FA3A 3EGJA 4J3XA 1H7RA 1XGEA 3CTLA 3BAJA 4CNSA 3W82A 5MF5A 1ZTVA 3LHUA 2HRWA 3PY2A 3N2OA 4LPCA 2QGHA 1HTIA 2Z6IA 3TJIA 5AZ0A 1X39A 3RX3A 1CGWA 3SIMA 3WJXA 4GISA 4C6OA 4DJDD 2PU0A 3U2OA 4YLWA 4QG6A 2ALRA 3NM1A 3CAVA 3PZOA 4M1BA 3MBFA 2GK1B 5FJJA 3BGGA 1CLXA 4L5ZA 4O10A 4QS5A 2VUNA 3HV9A 3CQIA 3TUUA 4EVZA 2VELA 3MP5A 4H4IA 1QO2A 1I4NA 1E0UA 5BU9A 1H51A 3W07A 1PS9A 4A2RA 3LZ5A 3GNOA 4MDOA 4PMRA 1FKXA 1Y8BA 4LEQA 5CC3A 3A6OA 4X9YA 4PMZA 4NJKA 1DQWA 1MVYA 4M6UA 2TSYA 5REQA 1NOFA 1YDYA 3WQGA 1B90A 1UIOA 1L8PA 3LHZA 3GK0A 4EX4A 4ADSA 3L0GA 4MLJA 1Q13A 1TPFA 4GGHA 5B7YA 2D23A 4F66A 3BW3A 4RE4A 2HBXA 1MUMA 2VRQA 3NQ2A 3VNMA 4YWIA 3GD6A 5I5RA 3AUJA 2Y8KA 2V2CA 2ISWA 4H9ZA 3SR7A 1O66A 4S3EA 2DH2A 5EMUA 1M7XA 1V8EA 3W6YA 1O5RA 2VFGA 3T08A 2UWFA 4JOMA 1RXOB 3JU2A 4U4MA 4MJ2A 7A3HA 1Q6QA 2FYMA 2CLEA 1OZQA 3P67A 3GTHA 3SCSA 3AIBA 3BW4A 1KNWA 4INFA 2PF0A 2FZ8A 2FZMA 4HNLA 3VKAA 1EQPA 3AXKA 2ZUTA 4MAZA 5JBDA 3S5SA 3GTNA 5FEPA 1ML1A 4IL0A 5JIPA 2NT1A 1UD6A 2XIBA 2JF7A 3T78A 1JYVA 2OEJA 2D24A 2HQAA 5CJMA 4IFOA 4JEJA 3VMPA 4QLKA 2P76A 1R3TA 1OT1A 2EQDA 1C29A 4HHPA 1PKMA 3PNUA 1X7FA 1UR3M 4KCTA 4L6DA 1EWEA 3I4EA 4BF7A 4HNUA 4JBRA 3KWSA 3TNOA 2YL8A 1F9CA 2PLMA 1C92A 4CCDA 3GR7A 4A05A 3QY7A 2V0TA 4ZR8A 1V02A 2PD5A 2OTDA 3DFYA 2NXIA 4WJEA 1F5ZA 3S6TA 1W37A 1W9DM 4ZGYA 3DGBA 2DSWA 3FKRA 1A5NC 2GLKA 5DBTA 3CZKA 4M1RA 3VZYA 3HMCA 2VOTA 3BTNA 4AY8A 1XLBA 1DXEA 2HZGA 1MXDA 1E3ZA 1FWTA 4XKYB 4GKLA 4PUJA 1KFJA 4OUIA 1BFNA 3VUSA 1AQMA 1RV8A 3A4XA 4MY9A 1UQZA 3S83A 4B4HA 3QC3A 3SCRA 2QQ6A 5F7UA 1BG4A 1FH7A 4JAWA 4JHOA 2V2DA 1Q8AA 2O92A 1SPQA 2FPTA 4PZVA 1WDWA 2CLHA 4XD4A 3NEVA 3R89A 4FS9A 4L7ZA 5GNYA 3RYSA 1AH3A 3GYEA 1SR0A 4CCZA 3M0LA 1XJBA 3PPHA 1A5SA 2AQWA 1O7AA 4MMWA 3I7SA 2QF8A 5CZ0A 5B80A 3L4UA 4IJBA 4O54A 4Y9NA 2A3BA 1X38A 1IZKA 2GJXB 2O56A 1UZ1A 3O6AA 3RLGA 3SURA 5I3HA 1M7JA 1DYSA 4IPNB 1CXLA 4G1NA 4P7OA 4MFDA 4HGXA 3TLQA 5HMFA 2DZSA 3AJXA 4IIHA 4R33A 4GQGA 3KEHA 2WWCA 1FCUA 3TH6A 3WDQA 3CUFA 1XLGA 3ANUA 1TKKA 2E5BA 4FOJA 2VR2A 1CLKA 3H22A 3MI2A 5PTDA 3EWDA 4J9JA 3VM7A 4J3VA 3HQOA 2QCHA 5FEXA 3QKEA 1RY0A 4QP0A 1XUZA 3NQCA 3WMCA 1M65A 3LK6A 1OB0A 2BHYA 3VGDA 4PYSA 3TC3A 3EMQA 8XIAA 4JN7A 5A6TC 5LHEA 4Z1BA 3V3WA 1P4CA 1I45A 3D46A 3TCEA 3TTEA 4AD0A 3C2VA 2ZX6A 1DJXA 3UA3A 2WBGA 3G8EA 3KXQA 3LBOA 2EBNA 3DYMA 3SDOA 1EC7A 4S38A 1RR2A 2FHFA 5DT7A 3HV8A 3R79A 1UP3A 4PTVA 2PWHA 1Q6DA 2VP8A 3NO3A 1YDVA 3WBEA 1YMYA 1TWDA 3QY6A 4OZOA 2BMBA 4WDTA 1G01A 1ME8A 4B2DA 3BWWA 1ZCOA 1UUOA 1BF6A 4F40A 1US0A 3FAXA 4PE8A 3VI2A 1F8MA 4LWWA 1HL2A 2BBFA 4LV9A 2YDQA 3NQGA 5IBXC 4DZ5A 4JTGA 2QV4A 4L4OA 3T4CA 5FCZA 1FHDA 5A6AA 2KAUC 3TA9A 5CC7A 3EA2A 1HP5A 4JIHA 3HQPA 3RM9A 5E0KA 3BAYA 1KCLA 4Q4RA 3EX6A 2V5DA 4NRSA 1J0YA 3LMZA 3MKCA 3K4WA 1SFSA 1W2VA 3MUAA 1WKFA 4LAOA 4TX9A 3CM4A 3VGGA 2PZ0A 4LUJA 5D02A 4L65A 5FJOA 1OFDA 4XAFA 1XS2A 4TUFA 4AD4A 1EIXA 3CHCA 1A5LC 1A5BA 2QCEA 1XLFA 6ALDA 3Q67A 3CMFA 2ZOXA 1FTXA 4QR6A 4K37A 1FWAC 2DPEA 1ZALA 1GZGA 1OFAA 4H01A 4AIEA 3HPFA 3C52A 3WLIA 2QYGA 4ZOBA 1QUMA 1BG9A 3L5AA 3W1XA 2F7FA 4Y2WA 3FA5A 3AUOA 4IPJA 1QHZA 4Q8OA 2VUYA 4PTMA 4CVWA 2ZZ2A 1HJSA 1AJZA 2H8XA 1XYCA 1ME7A 1YIXA 3DBPA 4D8ZA 3CQ0A 3CUHA 1EUNA 1SO6A 1DOSA 2W61A 5FJIA 1A4LA 1KXTA 3QHOA 4US5D 1EP3A 3SN1A 4JTRA 4C6IA 2INZA 5HNNA 4Q6JA 3KOXA 3KZSA 1P6WA 4O14A 2ZZ5A 4OBSA 4LUSB 4Y9PA 2H9AB 3PZ9A 1OX4A 3G1HA 1TG7A 1TWIA 3GIPA 5E9AA 2XIIA 2DVXA 4AD2A 3WNNA 2I14A 3E49A 3NGFA 1R8LA 3KLKA 4ZQMA 1VFUA 1XPGA 1MFUA 2QR6A 4R3UA 2YL9A 5BU6A 3N6QA 4GQQA 4DF1A 5ENLA 1JCXA 4IM4A 3VX0A 3B03A 4D1JA 3W6LA 4LU0A 3N3TA 2OOFA 3OIHA 2YX0A 1OJXA 2VCAA 1VRDA 1QFEA 2OSXA 3H8AA 4JTUA 5F4WA 4EKJA 2VJXA 4HCDA 1XPYA 2FTWA 3ZLGA 4WY0A 5C8BB 1LL4A 2CZFA 4BF5A 3RFAA 3STEA 4UTJA 3S9ZA 1XGZA 3AHYA 1W1TA 3AMKA 3QW4B 4HHLA 3U7VA 1PKYA 4RW3A 4CNPA 1OC7A 3PWAA 5DFAA 5AC6A 3WEMA 3CZLA 4UFIA 2WO5A 3KOWA 7TIMA 4IJRA 4OBRA 4HKPA 1O1HA 2VWSA 2YDAA 3V35A 3B9NA 1EGZA 3EAUA 1V6YA 3IK4A 3WH8A 3NJ3A 1CIUA 4I8DA 2NV1A 4KWVA 3W72A 2EGZA 5K4XA 1YE4A 4HBKA 2XVPA 3W1MA 1A47A 3NL2A 1FDJA 3GRIA 3VNLA 2ZWZA 2OLHA 3ZO9A 3EBVA 1NP0A 4JNMA 2VFHA 1KKRA 4GO8A 1TMQA 3G18A 1Q6RA 2FKPA 5EY5A 2B7PA 3MMUA 1ZU8A 4UUIA 4C1LA 3RK8A 2ZXQA 1XHGA 3B9EA 3C8NA 3QZAA 2DZWA 1LT7A 4MB3A 1ITUA 3KVKA 1MDLA 3UWQA 5KINA 2OZ3A 3KCJA 1OFQA 1EDGA 2XYLA 2ZCGA 3HURA 4KPLA 4AEFA 4KCUA 1YYAA 1KB3A 3NPXA 1QATA 2NXGA 4NJGA 4FF7A 1HIZA 2IXVA 3OLEA 1H11A 3DKJA 3CWNA 2X8RA 1W0MA 3HPZA 1V7YA 3R13A 1EX5A 4C91A 4MGGA 2E6YA 2JK2A 3RPTA 5BZAA 4HNNA 1Z3NA 4QIUA 3NO5A 1ZENA 5IHRA 5KSWA 3DFTA 2NX3A 1XD1A 3U57A 1FUYA 1OK6A 4LEFA 3H2AA 4JTIA 1Q6EA 2HSAA 3WLRA 1BF2A 3GXTA 2WMGA 3E9AA 3E74A 3IIVA 1A3WA 1IXQA 1ZSXA 1F74A 2IUZA 4W86A 3WLHA 1UW9A 3GTFA 3VZZA 4GBUA 1JDFA 1VKFA 4NJIA 3P14A 3G1YA 3FFSA 2V81A 3BLKA 3G3DA 3HGJA 2XHYA 2J7EA 3W1NA 1P7TB 4A8RA 1RA5A 2AL2B 4UWMA 1KRAC 4FXFA 2FDMA 3F03K 5C2GA 1OGGA 5DY3A 1R47A 3N2BA 4O1FA 4EIVA 4ZO9A 3FYPA 4UNIA 3IWPA 3KWXA 3N73A 3T05A 1W3IA 3PBMA 5AC5A 1QI5A 4IWWA 3G1RA 5A6JA 3UZJA 1OHLA 3CZGA 3PAOA 3D0CA 3FGCB 3VOHA 3I68A 1QPQA 5JMUA 1IGSA 3SSJA 4AC7C 2P8CA 1UP0A 3EDFA 2GSJA 3GDRA 4ZQNA 3B4UA 3KRSA 2EEXA 2B31A 1W6TA 4IGSA 3T81A 1VFSA 2WMIB 2OJPA 3DENA 4TVUA 3ITXA 2P3ZA 3D47A 2XWDA 1E9ZB 1T99A 4MKVA 4RDZA 1IWAA 4DI9A 5D38A 2EKCA 2AQOA 3WMBA 4IICA 1Z8AA 5EBUA 1H41A 4KEMA 4HA0A 3GXDA 3AFBA 3ZM8A 5HR7A 2DT2A 4FLOA 4LVFA 1KKOA 5C54A 1RPXA 3R12A 2WJZA 3MJMA 3CS2A 3W0KA 1VEPA 5AHIA 1FCVA 2A3EA 4E2DA 1QU4A 2ZUSA 1I60A 1D9EA 4A3HA 3U5UA 4XZMX 3ZIZA 4N0RA 2PDWA 1L6SA 5G2HA 1AQHA 1J12A 3BLLA 2E5CA 2YA2A 1GVOA 4D1IA 3XINA 2QIIA 3UY8A 1XICA 3TYEA 4LS2A 1EP1A 1S38A 4DPQA 4X0NA 4P2VA 4C6JA 3KVJA 1BYAA 1OCNA 4R85A 3Q94A 2OELA 2ZFAA 5CBIA 4LY4A 4Q8MA 3FS2A 7CGTA 1QT1A 2UY3A 4MVAA 3MUIA 3KTXA 3SECA 5D9NA 3SGUA 4UZUA 3GW3A 3GNPA 3TR2A 1K9TA 1TTJA 4OE7A 1GUVA 1US3A 1ZY9A 4BCEA 1W2PA 2WOQA 2Y6ZA 4GUHA 3SI9A 1VF8A 1Q65A 3QW3A 1T5AA 4XAPA 1HKWA 1M6JA 1Q7QA 3R0KA 1HVXA 4B5TA 2NZLA 3B05A 1LRNA 3VIIA 3SCVA 3GXNA 3ONBA 3KVMA 4LUTB 3WDIA 1HL9A 4DZAA 3SCOA 4ZFCA 5HOSA 5I06A 3C4UA 1BPLB 2VOMA 5XIAA 1BLIA 1YPXA 4DJDA 1NWTA 3FXGA 5G4WA 1NEYA 1RHCA 3W71A 2C0AA 6REQB 2E7FA 4KGLA 3IAPA 1UR1A 4TX6A 4Z2HA 4S3FA 3CO4A 1VPXA 1S2VA 2W62A 3S2CA 2YPIA 1V0LA 1P0KA 5H6HA 4S3KA 4UQAA 1QI2A 2FGBA 3AYSA 4JTQA 1QOPA 1DBTA 5EFDA 1R86A 1ZNNA 1KD0A 2AQVA 1PDYA 4GI6A 2G95A 3T0TA 1W1IE 4MZ1A 4N6FA 1L8NA 4RZ4A 2NV2A 3W7OA 1LBFA 3IIXA 2EHHA 1DHPA 3VABA 2OWWA 3ZMRA 2FZ9A 4Z2KA 4Y8EA 4GXPA 4L4LA 3UGVA 4C65A 3W38A 3PZNA 4G2DA 1UWQA 2XIOA 3E5PA 1KFCA 5DMYA 1H7NA 2WZEA 5HUPA 2DW6A 1JPMA 3R8RA 1ZUAX 1VIWA 2HV5A 4H8NA 4L56A 3I10A 3URBA 2W91A 3HFYA 3S2JA 4P7NA 2GQAA 1JR1A 4C6PA 3CV1A 1JPHA 1JZ4A 2PF8A 5AB3A 1BXNA 2VEKA 3A21A 1CB2A 1JPDX 5A6SA 1YLVA 3AIUA 2JQXA 3RR4A 4AY7A 2QCNA 1VBHA 1IEXA 1QNOA 1XLMA 2WCAA 2ZX5A 4XK2A 3WUBA 3FJ4A 1YTKA 4G7EB 3E5BA 1FH9A 4A4AA 4GY1A 1SU5A 3RPMA 1O4UA 5I3FA 1JQXA 4NIRA 5FAGA 1JI1A 2VM8A 4C6KA 2EJ1A 5SWUA 3LB0A 1CZ1A 4Q8TA 2QCMA 3L9CA 1HVQA 5EYWA 4UQBA 2J25A 1LUCB 1QPNA 5KITA 3NO1A 4G6CA 4DZIA 3G1VA 3N6JA 4OHQA 5KETA 4XO7A 4I6VA 4XTDA 3B0XA 3RXZA 2VD9A 1J0JA 4RE0A 4QJ3B 1TV4A 5AKQA 4ZQCA 4O53A 1GTEA 3LRLA 1Y7VA 4MPQA 1SSDA 1XW8A 3AICA 3VOFA 3VD4A 3W84A 2FGZA 4UTTC 2Y7FA 3NL3A 3BE7A 4B5WA 2E6DA 1Y5VA 4PCPA 1LYXA 4GI8A 3BQ5A 1E3XA 1ELSA 3ERPA 3UJ2A 1KRMA 2E6FA 2GJXA 1XISA 4AISA 4DN1A 3DOPA 1HNYA 1PX3A 1VPQA 2F61A 3INPA 2ZBTA 4AXKA 3BAWA 1VPYA 4JYEA 1NF7A 1H0IA 3LM7A 3OGSA 2CZDA 3SAZA 4ICNA 4F0KA 1ZB5A 4IXHA 3T09A 2OLAA 3M0HA 4REQB 5LIYX 1Z42A 3CPUA 3UPMA 3W2NA 3W7JA 4RX0A 1RK6A 5E93A 2WZHA 4YVXA 5HNRA 3PSWA 2BVWA 1TRDA 4LS1A 2CLKA 1BVZA 2L5HA 3NR0A 2HISA 4E0CA 2DV0A 2PP1A 2WAGA 1SFJA 3I7RA 2YR1A 5HJXA 4JIPA 2A6NA 2C1IA 2QJHA 3TR9A 3THAA 4QROA 1Q5MA 4XBJA 1RVGA 4N2YA 1M03A 2EG7A 3PUOA 3THUA 1OF6A 5RUBA 1NQ6A 1IT0A 1Z89A 4KEZA 5EMMA 3DFPA 2YZ5A 3DFNA 2I16A 4AVOA 3QOKA 3QN3A 3C3NA 4WXYA 3WQOA 1XYLA 1E51A 5BW6A 3SRKA 1RJPA 1G9HA 2J88A 4E4FA 2PDNA 4GY7A 2X7VA 2ZRUA 4NVTA 3T42A 3VGBA 1W17A 2W27A 3DFSA 5A8GA 4ZMGA 4LCQA 1OZMA 4OUEA 3N4AA 2CKRA 1IT8A 3O6DA 4CU7A 3VGHA 4AIOA 4H8HA 4PB3A 3U0HA 1RH9A 1YTEA 3MP4A 3CEUA 4Q22A 1B5TA 4BQ4A 5LYRA 5U4NA 2Z0IA 2C19A 2VR4A 4PCSA 2ZQ0A 5I3GA 1FKWA 3MC5A 4IISA 1UR0A 3V75A 1C9DA 5CKSA 4K8EA 4HPNA 2VRKA 1WDSA 2WK2A 4YTQA 3J7HA 3OYXA 4FZIA 4RV8A 2V9DA 4Z1DA 3AYRA 4M6VA 6ENLA 2ZUUA 3HG4A 4ZO8A 3NVDA 2AGKA 4MYAA 2GUYA 5IM51 4Z17A 3CZEA 4Q32A 4QE4A 4YCOA 3AXHA 4JTHA 4EK7A 4JIEA 1IEIA 2QGYA 2J27A 2J7CA 2QCLA 4V15A 3H2FA 2E9LA 4ORMA 1EJ7L 4GUGA 4JNZA 3W85A 2XM2A 4HHMA 3B0YA 1S2CA 4Z1AA 2J24A 1IQ8A 2X0SA 3EWBX 3S1VA 3PJTA 2YSWA 1MXSA 3W76A 1LQAA 1LLWA 3WBYA 4BI6A 4TR9A 3RNDA 1R2RA 3VYLA 4IPLA 5CSUA 2NX9A 3VD9A 3F5JA 3CAQA 1OT2A 2OT1A 4HMCA 2MANA 2I5QA 3TYUA 1OYBA 1XD0A 4NU7A 4FR1A 1KR0A 1MNZA 5CBJA 3CB8A 1AFSA 2Q6ZA 4LCRA 4B5SA 1UKPA 2DEPA 1JUEA 4G9PA 1ZFJA 2WPBA 5FF3A 4DUOA 4GVIA 2DVUA 1ZQ5A 1RAKA 4LUSA 3BMVA 7XIMA 3S5ZA 1HXJA 2XN2A 4JX5A 4DBEA 2CESA 1R7OA 1O5QA 4FLRA 1S3HA 4CEXC 3AMDA 3W1QA 1XBZA 4ERIA 5F2MA 2PDLA 2PGRA 1A53A 3EXTA 5FAJA 3S4TA 4JTKA 5G1MA 2XU2A 4GI4A 1V3IA 3MSRA 1V51A 3PPGA 1XV8A 4R88A 1Z6KA 3DDMA 2BODX 3CWOX 3ITVA 3QEZA 3W7RA 4UFHA 4M6QA 2P10A 3AROA 3WENA 4HPHA 4C6BA 4UTKA 3VNDA 4E5TA 1K6WA 4CQDA 1UD5A 1JQVA 3LHWA 1VAHA 2DZVA 4QISA 4B91A 1JCLA 4LAKA 3CUGA 3UGRA 5IDIA 2ZZ4A 3P6LA 1XCXA 4IUOA 1E5NA 4B3KA 3MVTA 2OWCA 4WX2A 4DWDA 1D2KA 1TWWA 1R2TA 2NQZA 4QX4A 3ZT5A 4MOZA 3BLPX 3S1WA 1OVDA 1KM0A 4NF7A 5D2WA 1XLEA 4H9VA 2Z4GA 2E9MA 4KETA 3IACA 5I77A 4J3TA 1F61A 3MMTA 1I2PA 4L9YA 5A2BA 1FX6A 5I02A 2E09A 2YXGA 1ZHAA 3EX2A 1YDOA 3B3DA 1EJTC 2CHRA 3LGEA 2C71A 5A95A 2Q09A 4QEHA 1XWYA 3OGRA 1AODA 5HBFA 1J79A 4ZB2A 1TPB1 1XLHA 4D6HA 1T8QA 3R4IA 4XZNX 4BEUA 4V1XA 3MA8A 1BRLB 1EUAA 1G0CA 3BLFA 3UZYA 1R3QA 5TD4A 4XBKA 1LRQA 1GG1A 2GGEA 4DUVA 4GD0A 4IMEA 3H21A 1IXNA 1Z69A 5DMLA 3EOSA 4CGTA 1WDRA 4H41A 2TODA 1GVSA 1IHIA 1OCJA 4MJ4A 3LEPA 2V68A 4IMFA 1FY6A 4Y6GA 3DHDA 2I1OA 1XINA 2PE4A 1ZBKA 4HNTA 2XIQA 3WNKA 1MRQA 3APYA 4K68A 5FJRA 2I9UA 4QE1A 1EJRC 4HQVA 2VZSA 3P81A 4R7OA 1P1MA 2DSVA 4XG1A 1N8FA 4GYJA 1TIMA 1ME9A 1VYRA 4L80A 1UOZA 1QW8A 4X2RA 4JPGA 4GX8A 4UNLA 5EMJA 5H1WA 3KW3A 1UA3A 1ZS2A 1SO3A 2OEKA 3VNZA 3V5CA 1ZZMA 3VNYA 1TV7A 4C6QA 3BUVA 2NX1A 2Y88A 3TWBA 2J62A 3AIQA 4FNPA 4J1OA 3A4JA 3WH5A 4AU0A 1P7TA 3ARVA 3P5ZA 2AL2A 5BWFA 3HTWA 1B0IA 3LY0A 3QM3A 1CDGA 3A24A 2BGSA 4HVXA 4O50A 2BSLA 3ZSTA 4LSBA 2ISDA 3H53A 4S3AA 2XVGA 3V36A 3KBSA 3DFOA 1W3LA 2IKHA 3ZVHA 1Y5XA 5I6SA 3TXZA 3M41A 3RGTA 4LX4A 3KL3A 1DIEA 4UTWC 1QJWA 2V82A 2AMXA 2WSPA 2J79A 2ZXAA 2PLKA 2VEPA 4H3DA 2ICSA 1WBJA 3N34A 1VFMA 1NDWA 3K8MA 2NUXA 1H09A 4A8LA 4U2YA 1SZFA 4CEUC 3VINA 4YHGA 2NQ9A 4O19A 1NF0A 1E56A 5LNUA 3WF3A 4LOCA 4OKDA 1J9YA 2MUCA 1KRBC 3BW2A 2DP3A 2R6OA 3RJXA 4H1ZA 2GYIA 4ORIA 4HOWA 4MWAE 3N11A 1OSEA 1GYMA 4DBDA 3UNDA 4QG9A 3R25A 1PTDA 2QT3A 1KBJA 3MZNA 1G5AA 4OTKA 3LHVA 1VIZA 3A22A 4RDYA 4O11A 1SO4A 1VQTA 1UWTA 7ODCA 5D8ZA 3H55A 1DPMA 5T9CE 4CCEA 2DQXA 3KDNA 3E2QA 2GDQA 2YKKA 4W5ZA 5LIWX 2WJFA 5A6KA 1WNOA 3S42A 2GUUA 2XVNA 3GXMA 3PBUA 1C8XA 4AHQA 3REQB 3SY1A 4U2ZA 4Q4OA 5F4SA 1GHSA 1TCDA 5FACA 2XN1A 1W1PA 1GVIA 3W1PA 3T8QA 1DL3A 3R6IA 2G97A 3TN3A 4QG8A 2B7QA 4F2BA 3VFLA 3TLLA 5D9MA 1QHPA 1HW6A 4JTFA 1WDPA 1PTAA 1GEQA 4TVCA 1DJHA 4U31A 4M81A 4KH2A 2WMFA 4FOUA 3DFQA 2CXEA 1HJUA 2FTYA 4HPXA 5HDRA 4J7RA 3AHXA 3UY7A 3QZ6A 1W9BM 4K1WA 4MIMA 1WOBA 3QV6A 2RGLA 4C1KA 4LUIA 4UXDA 1F8IA 1GT8A 1B2YA 3BQ6A 3FY1A 2POTA 3OODA 2R1KA 3R43A 1XBXA 4NZ4A 6A3HA 3N29A 8RUCA 1EBGA 4LUTA 2V3FA 1PSCA 3CPGA 4KFPA 3WDHA 2O9TA 2P5NA 4QQ3A 3PUDA 3TMLA 1AL7A 3K1DA 3T9PA 3TROA 3U9IA 2A3CA 5L9FA 2UY4A 2XTKA 1V79A 1GNXA 1XYFA 3VFCA 1H5YA 2W92A 2V2HA 3SQLA 3R58A 4M7SA 2GWNA 1W3HA 4J27A 2A3LA 2X05A 3DX5A 2QZRA 5EKYA 1QNSA 2YCLB 3KBJA 2PEVA 3POCA 1GKPA 1OK4A 1UWIA 3NSXA 5CGTA 4DELA 5L6UA 2CERA 1XYAA 2A85A 5I0DA 4LVBA 3UJEA 5LNSA 2BV9A 3MI6A 5I3JA 3ARWA 1TZ9A 4UFJA 3EB4A 4KIRA 2CYGA 1FH8A 1FWHC 1IEQA 2FH6A 3ZSSA 1UROA 2VHLA 3E02A 1PCKA 3TTQA 5KZEA 3ECQA 3VDBA 4WGXA 5DF0A 2UY2A 3WNMA 2INFA 2WC4A 1RBAA 1V03A 3HU7A 5T91A 1UZDA 2PGEA 1KBIA 2Z25A 3FJ6A 4UZSA 3V1HA 1GK8A 4IOTA 3LCXA 3WQVA 3L12A 3G22A 2C79A 3OVGA 3LPPA 5D30A 5LXXA 3WH9A 3NL6A 3GUWA 4FO4A 4OJYA 1UD8A 3T4WA 2Z1XA 1X6NA 4P5UA 4IIBA 5HWNA 1DTNA 1XKYA 4TOQA 4Z1CA 2QMJA 4NAFA 4LAUA 4W84A