4TMBA

Crystal structure of old yellow enzyme from candida macedoniensis aku4588
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
390
structure length
390
Chain Sequence
YMNFDPKPLGDTNIFKPIKIGNNELKHRVVMPALTRMRAIAPGNIPNTEWAEEYYRQRSQYPGTLIITEGTFPSAQSGGYPNVPGIWSKEQLAEWKKIFNAIHENKSFVWVQLWVLGRQAWPEVLKKEGLRYDSATDDLYMGEEEKERALKANNPQHGITKEEIKQYIKEYVDAAKKAIDAGADGVQIHSANGYLLNQFLDPISNNRTDEYGGSIENRARFTLEVVDAVVDAVGAERTSIRFSPYGTFGTMSGGENPGIVAQYAYVIGELEKRARAGKRLAFIDLVEPRVTDPFLPEFEKWFKEGTNEFIYSIWKGPVLRVGNYALDPDQATLDSKKPNTLIGYGRSFIANPDLVYRLEKGLPLNKYDRNTFYTFTKEGYTDYPSYEESV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Engineered Old Yellow Enzyme that Enables Efficient Synthesis of (4R,6R)-Actinol in a One-Pot Reduction System
pubmed doi rcsb
source organism Kluyveromyces marxianus
molecule tags Flavoprotein
molecule keywords Old yellow enzyme
total genus 142
structure length 390
sequence length 390
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4tmbA00
1MEWA 3L5AA 1UJPA 1LOLA 1Y0EA 2IQTA 3FYPA 2W79A 3W1PA 3Q2DA 5D37A 2VEIA 3W7GA 3HPSA 5DY2A 3VI2A 5D33A 1GYLA 4FNSA 2AQWA 5FEPA 4YCOA 4G1KA 1IXPA 1LCOA 3C56A 4O0KA 5K9XA 3UZ5A 1JCNA 4O52A 4UIOA 4LRSA 5FEZA 2W6RA 4FX6M 3LTSA 1U83A 2B7PA 1FDJA 1SQ7A 3VE7A 4MY8A 2R91A 3OHIA 2FPTA 4QIUA 1JJKA 3GDTA 3S1VA 1IXOA 3UPBA 4RX0A 3MP4A 3UYCA 1QWGA 3PUEA 2VXNA 3NQ6A 1PHWA 3N14A 3C2RA 2V9DA 3CIXA 6TIMA 1TYGA 2GJLA 1MEHA 2FPVA 2BLEA 2GQ9A 5MHBA 1TIMA 2A1YA 4DBEA 1JRBA 2C0AA 2C3ZA 1ZAJA 2BTMA 5I3HA 1W5OA 4QNEA 4IUOA 3IIVA 3EXRA 5EKYA 5G5IA 1PCKA 3NQ7A 2ZZ3A 1L2UA 2VFIA 4MIMA 2DZUA 3UWQA 3E9AA 3TSMA 4JD4A 4HSOA 3G1DA 5AHFA 5LSMA 1GVOA 1SUXA 3M1ZA 4NXKA 1OYAA 3LHWA 1LZOA 5EYWA 2ZZ5A 3EWBX 3OEXA 3L66A 5KZEA 4O18A 4ZQPA 3TAKA 3I7QA 3EEGA 1R2SA 2DJXA 1ME7A 3HQ1A 2WV8A 3CQ0A 4NZJA 4UTWA 5D2WA 2JGYA 2Q3RA 1YADA 3EWUA 5KSWA 3LM7A 3GAKA 3IIPA 3UPWA 1VH7A 1VHCA 3TW7A 4FX8A 1GVFA 4K7YA 5ABTA 2ZBTA 5CZJA 2WQPA 1Q3NA 1T8XA 1E51A 1T96A 3G0SA 4CCDA 3LI0A 2BXVA 3C61A 1TV7A 5T26A 2A7NA 1N55A 3STFA 4X3ZA 1TB3A 2DJLA 4GUJA 5HULA 1Z48A 3W7KA 2OMAA 1FCVA 1KW1A 4GE8A 3MP3A 2HTMA 1OG0A 8TIMA 1M6JA 4BWLA 3R2GA 1W54A 3TR2A 3CEUA 3V75A 1OFPA 3TROA 5D2VA 3MYOA 1EWDA 3TU9A 3TV8A 1LDCA 1DJNA 2A21A 1KV5A 2OCZA 1WOAA 4CNPA 3M5YA 3CEPA 4WXZA 1Z42A 5TIMA 4X9SA 1KBJA 3PSWA 1WDWA 4RXFA 3QMSA 1VLIA 3EWXA 3EX3A 4O14A 2VOMA 1P4CA 3UWUA 4ZQMA 3W88A 3I6RA 5D03A 3W1TA 1QAPA 1KM0A 3G1XA 1S5WA 4FX7A 5KMYA 3G24A 3W7DA 3UWZA 2CZFA 2TRSA 2JBMA 3NPUA 4MVAA 3KVKA 3BG5A 4NNAA 5AFDA 1IF2A 1XUZA 3D0CA 2YYUA 1TTPA 4IQLA 3TAOA 3EXSA 1TRDA 1WQ5A 4LVDA 4NJHA 4JTJA 1SSGA 1SO4A 3RLUA 3QRHA 3ATYA 4A2SA 4QNWA 2RDWA 3JR2A 4N9EA 1KFLA 1JR1A 4NX5A 3N2XA 4PA8A 3SSJA 3WK2A 1LBMA 4O12A 4GNJA 5G2WA 4JR5A 3BW4A 5AHLA 3PB2A 4WY0A 4N2YA 2C1HA 1LM1A 4O28A 1DKWA 1JUKA 1SZGA 1YTDA 3TKFA 2E1DA 3HG4A 2QDGA 3HPZA 2DP3A 1VJIA 4XKYA 1B4KA 3F4NA 4S1FA 2NV2A 2E6YA 3BLIA 3EX1A 4CNNA 1BEUA 4IOTA 2RHGA 2JGQA 5G2HA 1RPXA 3DGRA 3RU6A 3W2MA 3MHGA 5EA9A 3IEBA 3GDRA 4MLRA 4O15A 3UXDA 1JULA 2J88A 1TPVA 3V1PA 2C13A 1ZY9A 3QH2A 2TMDA 5D09A 4UFMA 3P5YA 4ONVA 2VEKA 3STEA 1OFRA 2DZXA 2QDHA 3NPVA 1SZNA 5DCDA 4HIBA 1AK5A 3HG5A 4GJ1A 4UTWC 5KTLA 1MSSA 3INPA 1KV8A 4UTTC 1GPWA 3BW2A 1K8YA 1I2QA 2ZRUA 1OFAA 3LLDA 3USBA 1YDNA 1QOQA 3UD6A 4LT9A 3CHVA 4OGZA 1W5NA 3DFNA 3G1FA 2Y7EA 3O1NA 1OK6A 3W72A 3P62A 3M5ZA 2VKZG 2Z2UA 3TMQA 3SI9A 1OYCA 4E38A 4GC4A 4RJEA 2GPTA 5LHFA 1VS1A 1KBIA 4OQVA 3OBKA 3EWZA 1JQVA 5HINA 2BZNA 1FCUA 2NXGA 2QCMA 3P5ZA 3FJLA 2QCCA 3GXPA 3TFXA 3TQ0A 4M7TA 2R94A 3G3MA 4MFEA 4O8RA 3LCXA 1JQXA 2YFNA 3M43A 3DXIA 4JY9A 2E77A 1FUYA 3GYEA 3L2IA 3CLMA 2Y89A 3MI2A 2ZTJA 1W5QA 2ZZ6A 3KXQA 2J9YA 1TPDA 4QAIA 4BI7A 4HNUA 1F6KA 3G1AA 4YWIA 3G0UA 3LB0A 3S6DA 5I3JA 3DFSA 3NZRA 5EY5A 1QOPA 3THQA 4NT0A 1KFBA 2E6FA 5I3FA 2GQAA 1PHQA 5DXYA 3KFTA 3QM3A 4N02A 3Q58A 1VYPX 4UTUA 1DQXA 2X1TA 2Y70A 3BARA 4NVTA 3W6YA 4HPXA 4H4IA 1K7EA 3HOJA 1ZJIA 3PSVA 3PWAA 2W0UA 5HWMA 4ZZ9A 3QZEA 1OFDA 4IX0A 1ZALA 2A6NA 1RV8A 3EB2A 3NQ2A 4FIQA 4OV4A 3EX6A 4OWGA 1TTJA 2J24A 4FNTA 1VLWA 1HO1A 2XN1A 1GYNA 4JTSA 2ZRZA 4ZVJA 2CLMA 3TQKA 4RZ5A 1F2JA 3PS7A 3QPYA 1FY6A 1A5AA 1V5XA 3EWWA 3L5LA 4Z1AA 2CU0A 4FXSA 1B57A 2OZ0A 3BK0A 1M5WA 3RK8A 3WJZA 1CW2A 1KLZA 2CLFA 1GG1A 1UASA 1W31A 3W75A 3DKJA 3QC3A 2H6RA 3ABOA 1FWRA 1Q45A 1SW3A 1GVRA 3BW3A 5D38A 3GX9A 1A5CA 3B0VC 5J5DA 1W0MA 2YFOA 4WZHA 3ANYA 4O53A 4MZ1A 3P61A 4NXSA 4DF1A 5AC6A 5CZTA 1GWJA 1I8JA 5D05A 3KRUA 3LV6A 3TCEA 1KFKA 1Q6RA 3N9SA 4UCGA 3SZ8A 3M47A 4RR4A 2HSAA 3L5MA 4XUGA 3W7QA 4C1KA 4DXVA 4DELA 2CFFA 1W3TA 3W7EA 4DF0A 5I3IA 4CCEA 3WJWA 1JCMP 4L4MA 3E12A 4AEOA 4ZQOA 1DV7A 1SFJA 1R2TA 3N73A 2VEPA 2B7NA 4GFSA 3HGJA 2HS8A 3QSTA 5EPDA 4ML9A 1TSIA 1GEQA 3IIZA 2DZTA 4OHQA 5K9CA 3NL6A 1G69A 3W74A 2C15A 3NO5A 3ZR4A 2V30A 1P0KA 5F1UA 2NLIA 1XCFA 3NGJA 3NYZA 1PE1A 3GXTA 3AO0A 3N3MA 5I3GA 1ME9A 1X7FA 1XC4A 2YSWA 3G22A 4EF8A 1MO0A 1RD5A 5K7JA 1FXQA 5AHNA 3LHZA 5AHIA 1GOXA 4JTUA 5D2YA 3OVPA 3GDLA 4AB4A 2ZA1A 2WNQA 1FDZA 4QITA 2JKAA 3NM3A 4ORIA 4N6EA 3ZFHA 3MHFA 5AYXA 2NX9A 1H7RA 2NX1A 5KINA 4DO4A 5CGQA 3SFKA 3S5OA 4LY8A 5HWJA 3GDMA 5J5RA 3W7OA 3C2FA 2Y7GA 4LC8A 5I3KA 3NQVA 1TPFA 5FF2A 2OT0A 1IXNA 1ML1A 3P8JA 3T7VA 4FNUA 1SO3A 3ELFA 4UTIA 3P8IA 4IMFA 2Z6JA 1NSJA 3O6DA 1VQTA 4P2VA 2FQIA 1FCQA 1CI1A 3I7SA 2QCDA 1EUAA 1NAL1 2ALDA 1SO6A 4IMGA 1O94A 4IPJA 4LS0A 5EL1A 1P5BA 2H8XA 3W7LA 3W9ZA 2JKEA 2ZFAA 4Z0JA 4QQ3A 3TFCA 5F1VA 4TR9A 3GR7A 4Y6GA 2X30A 4IPIA 2WPBA 2EF9A 1O95A 4HNVA 1GQNA 4YCPA 2ZRVA 2B7QA 5CPLA 4DBDA 3SR7A 1QDSA 3QSRA 2J9ZA 2A85A 4E0CA 2V5BA 2NV1A 3SECA 4JS3A 5D2TA 4DF2A 5F4SA 3ZWTA 2J27A 1G4PA 1DQWA 2CWNA 1YDVA 3ABSA 5K4XA 5H2ZA 2A4AA 3W23A 5G1TA 3TC7A 3BVJA 5LNSA 2GVLA 5HJLA 3LRMA 3TXZA 2NX3A 1VCFA 4RXGA 3OVQA 1OVDA 4IJBA 4IGHA 4JEQA 1KFEA 2V5LA 3W2KA 4ICNA 1DOSA 3ABQA 1KTCA 3W84A 7TIMA 3QQ1A 5BW6A 3QQ0A 3PULA 2O7SA 4QISA 2RFGA 1ICPA 4Z1CA 3S1UA 1TPC1 1TPEA 4LW7A 2V82A 3MBFA 1LROA 2C6QA 2WNNA 4N4QA 4RCXA 3BO9A 1K8ZA 3TUUA 1S5TA 4JTIA 1HO4A 5HUPA 3WK1A 2YZRA 4O19A 5LHEA 3P82A 2Y62A 3L0KA 2BSLA 5AHEA 3G0XA 1YPFA 3TNOA 1H61A 3FFSA 3NQMA 1H7OA 4RZ4A 3PUDA 3KRSA 3PB0A 4CQAA 2Z0IA 2B0MA 3W7CA 3B0UX 1U5JA 4I7UA 1OYBA 3H54A 1DL3A 5D2XA 4IWWA 1NF0A 1PV8A 2ZRXA 2CZ5A 2QEZA 1XDLA 4LC6A 3EX2A 4L4LA 3BGGA 1LORA 1LTDA 6ALDA 3C0JA 2B4GA 4Q4KA 5BOOA 5D02A 2ATMA 2RDTA 4CQ8A 1LLZA 2YCEA 1H7PA 4H3DA 4JTGA 1TJRA 4JX4A 1HG3A 4JTFA 3DHFA 2G5WA 3UY7A 3E02A 1ICSA 4PH6A 3IVSA 3B04A 1BWKA 3GVGA 3LLFA 4PC8A 1WV2A 4Q33A 4MZYA 3TX9A 3WK0A 1D3HA 1H51A 4JN6A 4WOZA 4JTHA 4QSHA 4HPJA 3EWYA 1JUBA 1FDYA 1N7KA 5DBTA 4RV8A 3IV3A 2FLIA 5FF4A 3VCRA 5AC7A 4KKXA 4JGDA 3W73A 1RVGA 5LNWA 1VC4A 4XTDA 4NJJA 1G7UA 2WSQA 4BFAA 2QUUA 2FJKA 4NJIA 4KFNA 2F7FA 3LHYA 4UR7A 4JYFA 5K4ZA 4M6VA 4IX2A 3TE9A 4EWND 5F4XA 4PCFA 4Z0SA 5L6UA 1H7XA 1WAUA 3KAOA 2FFCA 2YYTA 3SGUA 2G96A 3STGA 3DFTA 1FCBA 3NL3A 3S5NA 3NVTA 3FA5A 1TREA 1G4SA 1W3IA 1GJPA 2C14A 2ABBA 5A5WA 2H90A 3Q94A 1KM3A 4O57A 1RQEA 4UTMA 1OHLA 1X6UA 4TMCA 4NNCA 1JCLA 1FQ0A 1KM4A 3ZWSA 2NXIA 4WUIA 4AWTA 2QCFA 3CB8A 4K6AA 4Q32A 3LBMA 4UTTA 1KLYA 5IBXC 1K3UA 4IXHA 3QEZA 2A6LA 2V8ZA 3C2OA 4R34A 2YR1A 1AMKA 4M6QA 3P67A 4UFLA 1VR6A 1KTNA 3QMRA 1YYAA 3LCGA 3MI3A 4U28A 4K38A 5F4WA 3HBLA 1WBJA 3TA6A 4O50A 3B06A 3W1UA 3A22A 5C2XA 4NJGA 3ZS4A 2WOQA 4Y96A 1G7VA 3W7IA 5AYYA 4K8HA 2YW4A 4CNOA 4K37A 1IIHA 2TSYA 3NL2A 2NXHA 3LTPA 3O63A 5H91A 3LRKA 1ADOA 5F2IA 5LZLA 3B0PA 3KVMA 2ZZ7A 4AWSA 3CPRA 2LLEA 4M6PA 2A2IA 1W37A 1ZNNA 4R53A 3DKLA 1K7FA 2FPYA 2P0OA 4UFKA 4ALDA 1F6PA 1OK4A 4ZMGA 1KTBA 1SU5A 4FNQA 3HB9A 2QJIA 4P61A 1H1ZA 5AC8A 5TBOA 2J6XA 3R8RA 2NUYA 5AB3A 4PTNA 3QW4B 3LXAA 1S3HA 3GAYA 3P60A 3P7YA 2Q8LA 5LNRA 4NNBA 1MEIA 3LXCA 1QCWA 4ZQCA 3OA3A 1EWEA 2QCNA 3QF0A 1YXCA 4EOUA 2Y7FA 2F84A 3IRDA 3O8AA 2DZWA 1K8XA 5D30A 1H7NA 3DENA 3W76A 1X8FA 5AYZA 5F2MA 4YXGA 3B03A 1KA9F 1XI3A 2G97A 3KVJA 3TQVA 2QCGA 4A22A 1TQJA 2CLEA 1TV8A 4O10A 3SJ3A 1XDMA 3G1HA 4YL2A 2E09A 1QPNA 3U2OA 4DQWA 3E49A 3PM6A 3PVFA 1TTIA 1UB3A 3E0IA 2ABAA 3GK0A 4ADUA 4O4VA 2GJNA 1D9EA 3FS2A 5AN7A 3NQEA 5CZ0A 5DELA 4QJ1A 2CZEA 3LHVA 4GBUA 2VFEA 1WA3A 1YDOA 2R14A 4R33A 1FXPA 5DXXA 3THAA 2ZDRA 4UFJA 3O06A 4MLJA 4DPQA 3TXVA 1TQXA 2VFFA 3M41A 3G8EA 1QMLA 4PODA 1EX5A 5F2LA 3KHJA 3VKJA 1SW7A 5LNVA 1OF8A 3GKAA 4BWLC 3W83A 1OF6A 1KM5A 2PURA 5E93A 3HPXA 2PC4A 4PEKA 4U4MA 3DZ1A 5FF3A 1T0OA 3LBCA 4DEFA 2FDSA 2NUXA 3PBVA 3MUXA 4UTJA 4KFOA 4R7JA 3WJYA 1KM2A 4ADTA 2X1SA 1C8VA 3P84A 1I2OA 1W56A 4JXCA 3HG3A 3HIJA 3L68A 3W70A 1W1ZA 1TPB1 2XN2A 3RLVA 1T99A 3PC0A 4N9CA 4O17A 4JTTA 4UTKA 3OG3A 4KWWA 1LBFA 3A21A 2QJHA 3QYQA 3CIWA 4FXRA 2ZA3A 3LHTA 3NQDA 2ATSA 1LP6A 2I1OA 3MO7A 4JDYA 4FEZA 4PFMA 4AWUA 2QKFA 3NPWA 4JIPA 5E0KA 2EGZA 2V2DA 3CT7A 1XBXA 3T44A 4WD0A 3IIOA 3NR0A 3UY8A 4DO6A 1WYIA 4FF7A 2DZSA 5C6MA 1EB3A 4MOZA 1QO5A 3W71A 3LERA 3W7NA 1M7OA 3KX6A 4NQ1A 1FWNA 4XBKA 5CG7A 5CZSA 4WY0B 4XWUA 1NEYA 1ZHAA 2RKXA 4TX9A 4WY0F 1R2RA 5E1QA 3IVUA 4LVFA 4JICA 1CX9A 1VYSX 4LS1A 5G2IA 5K9DA 2HS6A 3IGXA 2FIQA 3O15A 1R30A 5CPMA 4N9DA 2UV8G 2V81A 2QUTA 5HR7A 1SW0A 1XBVA 1LBLA 3O05A 2I14A 3U8GA 1OFEA 3R89A 3M7WA 2E5CA 2EPHA 4IMDA 1F73A 1A53A 5DN1A 3TK7A 4BK9A 4JDBA 3QJAA 3BLFA 1B9BA 3T4CA 4M19A 1EUNA 4OBTA 3G3DA 3W1AA 3A9IA 1AG1O 5AHMA 1OFQA 3LCHA 3HG2A 1VYRA 4UNKA 3S9YA 5DCEA 1P0NA 4A29A 1F5ZA 4HNTA 1AW1A 4ZQRA 4UTHA 3SY5A 3T40A 3I7RA 4PL1A 1OJXA 1J5TA 1EP3A 3W7RA 2A0NA 1EIXA 4ADSA 3RFAA 5AOUA 3NOEA 1WXJA 3HF3A 4UXDA 1TCDA 1YPIA 5D32A 5LNUA 1VRDA 3S42A 3F1QA 1W5MA 3BGJA 5FEWA 4MJMA 4XQ6A 5CPOA 2DZVA 2ZYFA 2ZRYA 3G1VA 1B4EA 2Y7DA 4UTLA 1TMHA 1VGAA 1LYXA 3OVRA 5FF0A 3H53A 3NA8A 2Y85A 3W2NA 1VZWA 3LHUA 3AJXA 2ZRWA 2I9EA 5K3VA 3L65A 4A2RA 3Q37A 3HJZA 4AH7A 3PUOA 4UMCA 3UZJA 4JNMA 3LX9A 3NNTA 4MKNA 2H8ZA 3MP5A 2Y6ZA 3IGSA 4HT3A 4HSNA 1YTEA 5HWNA 4TU1A 1O4UA 2QCEA 3C8FA 1RZMA 3NQAA 4ORMA 4WQ6A 1JCXA 5SWUA 1YTKA 3CM4A 4S2CA 5U7SA 4K36A 2QR6A 4GUIA 1PL9A 3ATZA 4K7VA 2X16A 1EEPA 2V2HA 4FIRA 2R8WA 3LCIA 3B4UA 4IMEA 3PBYA 1S5VA 3TH6A 2GOUA 4BI5A 1I4NA 2G95A 3KOFA 2ZA2A 1LLWA 5FI8A 3O16A 3TMLA 5LGZA 1TTQA 2AGKA 3JRKA 1MXSA 1JUEA 1A5SA 1G67A 3O07A 1UUOA 3MHUA 4A3UA 1VCGA 4K39A 4X22A 1GTEA 1XFBA 4O0ZA 3T78A 4MY1A 2VELA 1QNVA 3EKLA 1Z44A 2QAFA 3LTYA 3LRLA 2E5DA 5EMUA 1XM3A 3DBPA 4NZFA 2GQ8A 4LVGA 3S5ZA 3GNDA 3W1NA 4O1DA 4LRTA 2V0TA 4O1AA 4EIVA 3VE9A 4AMAA 3TIMA 2Z1BA 4KFPA 1NFBA 4O54A 1OX4A 4K8EA 4WJEA 3QFEA 4MUZA 1XBYA 4Y9AA 1FX6A 1VPXA 4RKAA 1L9WA 5KITA 2P1FA 1DHPA 3HO8A 1Q6QA 3M9YA 1PCWA 1R46A 4JTLA 2ZZ1A 1H50A 1QFEA 3YPIA 4IXXA 3W86A 3TJXA 3BG9A 2VFGA 4PL2A 2B7OA 1MZHA 4OU1A 3QW3A 3WK3A 1X1ZA 3H55A 3DFPA 3S5YA 3QPZA 1TPWA 1L6YA 1GVSA 4JY8A 4E2DA 3WJSA 1QPRA 4Y90A 1TJPA 3MJYA 4I7WA 2JK2A 1WBHA 3GKFA 3DI0A 2HMCA 2Y88A 1DBTA 4IMCA 4I7VA 1BKSA 5C5YA 1ZENA 2Q3OA 1AL8A 1YXYA 3M5XA 3R5EA 5G4EA 4GXMA 1OX6A 3U6WA 1ONRA 3PBUA 3SGZA 2YX0A 1PIIA 4LU0A 3C2VA 3GR8A 1LOQA 1THFD 3S1XA 3CU2A 4N9BA 1QPQA 5CSSA 3LCFA 4GWEA 1RQHA 3NXFA 1TPUA 4UNLA 2E6AA 3P81A 2ISVA 3W3OA 5K2ZA 1M7PA 4MPQA 4JTEA 3MMTA 1HUVA 3W1QA 4B5NA 3PF3A 3M0ZA 3PG8A 1KM6A 2QAPA 4NX0A 1OFBA 1JCYA 5EBUA 3LOTA 1I2PA 1SO5A 1ME8A 1AW5A 1HFBA 3N34A 4LNYA 1JRCA 5F2GA 3W2JA 1AL7A 3IGUA 3CWOX 4ZQNA 3L9CA 1JCJA 3EKZA 1O5XA 3DFQA 4DO5A 3W1RA 5FESA 3LCWA 2PRHA 1EP1A 4MJZA 4JYEA 3DH7A 3C3NA 3PAJA 1ALDA 1ZFJA 1Q6LA 2H3BA 2WSRA 1UCWA 1ZCOA 1V7YA 2EKCA 3FOKA 4YLWA 3W7JA 1XUUA 2Z6IA 1FBAA 4NJKA 1SR9A 4GUHA 1NF7A 4LOCA 5A8GA 3RMJA 1F7BA 4HKPA 1H1YA 1ZAIA 1O60A 1H5YA 1SSDA 1VHNA 3A23A 3BG3A 3GB6A 5CPNA 2NWRA 4TO8A 5BNKA 3A5FA 3LGEA 2CZDA 2Y63A 4FNPA 3W7MA 1OABA 2CLHA 2ZTKA 2YXGA 1Z41A 3MWAA 4AHPA 3NQCA 1R47A 2EHHA 5C55A 4MFDA 1I2RA 4FB7A 1SZEA 4WOQA 3NM1A 3LXBA 3C4UA 2WNZA 4Z1BA 5HUOA 2YW3A 1JVNA 1XBZA 3F4WA 1C9DA 3R12A 1HL2A 2VEMA 2NWSA 3STCA 4A21A 4KWVA 5L9FA 4GRSA 3MYPA 1FWTA 3HMJG 3BLEA 2QF7A 1SZFA 5DY3A 4M5PA 1G6CA 1L6WA 3L67A 4WX2A 4AF0B 3DU0A 5BMXA 5FEXA 3RF9A 1W3NA 3DFOA 3FKKA 2QCLA 4UMAA 2OX1A 2CW6A 1AW2A 5LKYA 4RLIA 3W2UA 1L6SA 4WXYA 1BWLA 4LVBA 5HMSA 3HGSA 1G4TA 3W2LA 4HNNA 1RR2A 5CSRA 5D04C 2DU2A 1LOSA 3N2MA 2RH9A 5IM51 4XKYB 3PR2A 1IIGA 1H60A 3GXNA 2PRMA 4UFIA 3FKRA 2OT1A 3FLUA 3T55A 4N4PA 3W7HA 4Z1DA 1GTHA 2DORA 1OX4B 4FHAA 4I9AA 3A5VA 3C6CA 3GNNA 3TSDA 2Y61A 4O1BA 3R13A 2GUUA 3M6YA 3NZ1A 3GZ3A 3E96A 4LUIA 3M44A 3TDFA 2VFDA 3W22A 1FWWA 3DAQA 1J4EA 4CLMA 1OX5A 2E5BA 2DZPA 1TV5A 4UR8A 2C16A 3NPXA 3UNDA 1WX0A 2TYSA 4EF9A 4LWWA 4XTIA 4MYAA 4W9TA 1A50A 4AAJA 2ZZ2A 1PS9A 1YLVA 1G4EA 3HGOA 3LCLA 4RZ6A 4EVZA 3TSBA 2YGYA 3M16A 1KFCA 3PY2A 2A7RA 2ZQ0A 2VC6A 4C1LA 4O4WA 4AXKA 2FB2A 1GVQA 3HGRA 3L0GA 3UWYA 4UUIA 3UQNA 3L0NA 3CC1A 4ZL1A 1TPH1 1C29A 3G1YA 5BRBA 5HR6A 4N6FA 1H62A 4O11A 3NQFA 4HN4A 2XFWA 2P10A 1QPOA 2QCHA 3LI1A 3OIXA 4E2BA 2XN0A 3NDOA 2YPIA 3N19B 1N8FA 3GLCA 3JS3A 1WOBA 3K30A 4J9JA 1IGSA 1VCVA 2WKJA 1EP2A 3EX4A 3WJXA 1UBSA 4FO4A 4LV9A 5KZDA 2QUVA 4TIMA 2NZLA 1W5PA 4LVAA 1SFLA 3SW6A 3TJLA 1XXXA 1I2NA 2FTPA 3GDKA 3W1XA 2VENA 3FIGA 1YXDA 3M5VA 3PG9A 4RK8A 3BV4A 3CWNA 2CLLA 4AHQA 5CKSA 3S0CA 1H63A 3NAVA 3TW6A 1GZGA 3L21A 2Q8ZA 3FYOA 3NQ8A 3P74A 1LRQA 4UFHA 1PVNA 4OT7A 3LV5A 2OJPA 3FJ6A 4X2RA 4NU7A 2NUWA 2GVGA 1Q6OA 1QO2A 2X1RA 3B8DA 3NL5A 2QCDB 4JTKA 5IBXA 3QMTA 2KZHA 1I45A 3PBWA 3G8RA 1F76A 3ABRA 2RDUA 4POCA 4GUFA 4D2JA 4DPPA 1TO3A 3FEMA 5DLCA 2J9XA 3P80A 1NVMA 3GIYA 4AF0A 3G1SA 3I65A 3KVLA 1BTMA 3S1WA 1K02A 1GT8A 3IVTA 4O16A 2QJGA 4LV4A 4H6KA 2JKPA 5U4NA 3UWVA 1A5BA 1F05A 3O6CA 1J2WA 3C52A 5TQLA 3MW7A 5DCBA 4S2BA 5GVJA 4Z08A 1ICQA 2CLKA 1DJQA 2ZCGA 3LDVA 3CTLA 2CLIA 2O7QA 1ZAHA 2ISSA 4HHPA 3TC6A 3I68A 4BF9A 3C2EA 2C18A 4GUGA 1F74A 4M7SA 2BWGA 2ZZ4A 3W85A 2D73A 4CQ9A 1K7XA 3UWWA 4LUJA 2CLOA 4O13A 4XZ9A 3O6YX 4YMZA 3SIZA 3VFLA 3W87A 5BMWA 3F03K 5G4WA 1D3GA 1QR7A 5FF7A 1X1OA 1EA0A 3W7PA 1GG0A 4OE7A 4QM1A 2PE4A 3W07A 4LS2A 3NEVA 4UMBA 4AHOA 1XKYA 3S8HA 2E6DA 5LGXA 4Y8FA 1UUMA 3KRZA 5KZMA 5G1YA 3W1MA 1LRTA 2VFHA 3W1LA 3VNDA 3MBDA 2EAWA 1LRNA 2AAMA 2WSYA 3RNDA 2C19A 2V2CA 5DBUA 2PCQA 3DHDA 2BX7A 3N9RA 2FB3A 1OFOA 4JYDA 3WFAA 4MY9A 1IXQA 4CCCA 1FWSA 1RQBA 4OV9A 4FNRA 2X1UA 3B05A 2H3DA 1TRIA 3A24A 5HQEA 3EXTA 2TPSA 1KFJA 3G18A 4MZ8A 1K03A 1P1XA 1B3OA 4AVFA 4LTSA 2A7PA 2A5HA 1O5KA 2GVJA 4JX6A 4JX5A 4UC5A 3UXAA 1XL9A 3BPWA 4MYXA 1HTIA 2E68A 3NQGA 2ISWA 2WJZA 2X2GA 4TMBA 2PRLA 1SPQA 1DORA 4BR1A 3DI1A 1W8SA 5C54A 4O1CA 3MI6A 1EPXA 4BI6A 1DVJA 1H7WA 4NUWA 3NG3A 3IIXA 5HNRA 2YDAA 2WO5A 1KM1A 4JIQA 4XBSA
chains in the Genus database with same CATH superfamily
4E5TA 4LANA 3L5AA 2IQTA 3DC8A 3FYPA 4BCEA 1A5LC 5D37A 1DXEA 2E9LA 1ITCA 1GYLA 4JHOA 3JVAA 4BKNA 2OOGA 3KZPA 2J7EA 2V6AA 2AQWA 3TZFA 5A95A 5MKGA 3R10A 1IT8A 5FEZA 2W6RA 4ZOAA 4IPNB 3LTSA 1U83A 3LGDA 1EO5A 1JNEA 3BZGA 2O4QA 1S1PA 4MY8A 3F5LA 3OHIA 2FPTA 4QIUA 3TJ4A 2VJXA 3UYCA 4Q7IA 3PUEA 3GDBA 2VCAA 1NWUA 1PHWA 4Q8PA 2D0HA 4JZ5A 3CIXA 1H2JA 2GQ9A 2CXGA 3GG7A 1JF6A 4LUTA 1JRBA 4HNLA 4L7ZA 5EFFA 2G3JA 4JCLA 4D6CA 2WBGA 3WMCA 4G56A 3IIVA 5C9ZA 1RHCA 2WM1A 4MIMA 5CQ1A 1MDRA 2XFRA 1C8YA 4IMAA 4JD4A 3C0LA 4C6MA 1JF5A 3LHWA 2NQJA 2NQZA 5CGMA 4O18A 3A64A 4ZQPA 1W3HA 1PZ1A 2JGYA 4NASA 4EX4A 3GAKA 3MVIA 2GJPA 1AH0A 1GVFA 4K7YA 2ZBTA 5EMLA 2TAAA 3WD3A 1E51A 4PFHA 4HOZA 3LI0A 2Z7KA 3GH7A 3RR1A 5T26A 1XYZA 4KCUA 2F38A 1GVYA 3LN3A 2DJLA 1BQCA 1Z48A 3W7KA 2OMAA 5JH2A 1RBAA 4GE8A 5HQMA 4PTDA 3GO2A 1I9CB 2HTMA 8TIMA 3S1GA 2OQYA 4JHZA 3FA4A 2ZX6A 3L4XA 3TROA 5D2VA 4I5RA 1IEWA 4NAEA 1EWDA 5GQBA 1V8EA 2I16A 3WDPP 3TV8A 1LDCA 4LNCA 3ZJ6A 1QK2A 1IZCA 3M5YA 4GJJA 3CEPA 2OKTA 5TIMA 1GOOA 3CV2A 4PRTA 4X9SA 1KBJA 4RXFA 4GBDA 1MNSA 3P3BA 3EWXA 3EX3A 2VD9A 1HKVA 5AYBA 1E55A 3ITLA 4ZQMA 2Z1SA 1NH6A 4Y9PA 1VIWA 5HK4A 4H8VA 4FX7A 3G24A 3W7DA 2VR5A 4A4AA 4QDPA 3KDNA 4NNAA 2ZXQA 5ABFB 2OGYA 4J28A 4R88A 4D6HA 5CSYA 2XGZA 3F2CA 3N1AA 2ZXDA 1EC9A 3BAJA 4NJHA 4ACYA 2GK1A 3U2ZA 3WEZA 1VFHA 3RLUA 1WPCA 1XYLA 2DT2A 3BMWA 1FKXA 3MT1A 4J1OA 1KFLA 2DT3A 1JR1A 1EJUC 2QPSA 4PMVA 3H2FA 4MB4A 3PB2A 1BAGA 4WY0A 1QRQA 4Z2GA 1C9WA 5ABGA 1DKWA 3AXMA 1QI5A 1YTDA 1RP9A 3TKFA 2VI0A 2ZC1A 3B0YA 2E1DA 1EO7A 4XBJA 1PWLA 2DP3A 2ZKMX 1WZKA 2NV2A 4US5A 4CD7A 3FVDA 1LUCA 4Y2WA 1BEUA 4IOTA 2JGQA 2WMFA 4A3QA 3DGRA 2C0HA 2PDFA 3I10A 4MLRA 1TPVA 1ZY9A 2TMDA 3IWPA 4TX6A 2DZXA 1SZNA 3DX5A 6TAAA 4GJ1A 3IACA 3INPA 1MYRA 4F79A 4LH8A 1KRBC 1IEXA 1KXHA 1OFAA 1ITUA 4N0RA 3H22A 3CHVA 3TYUA 3E2RA 1CLVA 3SRFA 3PAOA 4YN5A 4CNTA 1OK6A 1GOKA 2XGBA 3VMNA 4C6DA 3SAZA 2Z2UA 3VD5A 4RJEA 1QHPA 3KOZA 4IG2A 5BZAA 3OBKA 2OEMA 1M65A 2NXGA 5GJMA 1QUMA 2C79A 4RW5A 4NAFB 2E8ZA 1JQXA 4H19A 3WF3A 1UD6A 4JQ2A 4JY9A 2XH7A 3GYEA 3T08A 3W29A 1VEPA 6PTDA 2Y89A 4J3UA 1W5QA 3KXQA 3PTMA 4QAIA 1FWCC 2VL4A 2I7GA 3G1AA 4YWIA 4PBEA 5M03A 5I3JA 4HU3A 3WH8A 1GHRA 3DFSA 3DYMA 4GA8A 5EY5A 4L1WA 2E6FA 4CUCA 4J7RA 3KTSA 3KFTA 4N02A 1P0DA 4B5XA 4UTUA 2XIOA 1E6XM 4HPXA 1ZJIA 3PSVA 1YNPA 2W0UA 3QZEA 2OO6A 4L6OA 3DESA 4S23A 4EXQA 4IX0A 1XLAA 4XZNX 4FIQA 3ZZ1A 3EX6A 3T0TA 4FNTA 2OTDA 2WMIA 2WJEA 2XN1A 4PB3A 1WKYA 1I0BA 4JTSA 3TQKA 4DJED 2VZTA 3QPYA 3L5LA 1HKKA 1DXIA 3WJZA 3O0FA 2OOFA 3A3WA 3GXMA 1CW2A 1KLZA 3PWGA 1YE6A 1BGGA 3MVTA 3BAWA 2WAGA 1Q45A 3URQA 1SW3A 1A5CA 4HCDA 2EPOA 2P53A 3B0VC 2UY4A 1CGTA 5J5DA 4X63A 1RBLA 2YFOA 4RNJA 3BJFA 2WCAA 3ANYA 2OWXA 2PB1A 2NLYA 3P61A 1VP5A 4AW7A 2BG5A 1I8JA 3ES8A 1NM9A 2ACUA 3KRUA 3AMDA 4RE0A 1F6YA 3P6LA 1JL8A 5C2CA 3V5OA 4GQQA 4UCGA 4ZOEA 2IXVA 3W7QA 4DELA 4GYJA 4PUKA 4CN4A 2GGIA 5I3IA 1XYMA 4AEOA 1RA0A 3N73A 1ZU8A 2GLKA 1R3VA 2CXEA 4B90A 4QLJA 4I8YA 4XAFA 2OLSA 1TSIA 2DZTA 1MQPA 1CWYA 4ATDA 5M2FX 3T42A 5K9CA 3PZ9A 3NO5A 3ZR4A 4HYRA 1VKFA 3UBPC 3B9NA 2NLIA 4LAZA 3CZJA 3W37A 4GIYA 3GXTA 3EDJA 3M4HA 3N3MA 4FI4A 5I3GA 1X7FA 2G8ZA 4YVPA 4EF8A 1R3TA 4QDMA 1QI0A 1GOXA 1JXJA 4JTUA 1MWOA 5D2YA 1E6NA 2DSUA 3GVWA 4KEMA 2WNQA 1FDZA 2V63A 3ZFHA 3RUBL 5FSEC 2Z1KA 5KINA 5CGQA 3SFKA 4LY8A 3BZJA 3MU7A 5FF2A 1ZL1A 4HBKA 3PJXA 3VTRA 1ML1A 1DTUA 1YBQB 3T7VA 3ELFA 4UTIA 4IMFA 4IHCA 3O6DA 1VQTA 1X6LA 4F2TA 4UZUA 3EOEA 2W27A 1G5AA 4HPNA 2ALDA 5I09A 2HK1A 1P5BA 4RDYA 4Y6GA 3AXKA 4IPIA 2WPBA 2WHJA 1XJBA 4GYPA 3T0DA 4MM1A 4B5VA 2FGLA 4I6VA 1XQLA 2B7QA 3WF2A 1BYCA 1UWTA 4DBDA 1Y5XA 1QDSA 2W3ZA 5BXTA 2J9ZA 2NV1A 2PDUA 4E3VA 3V7PA 5D2TA 4DF2A 2PDQA 5CC3A 3TLLA 2CWNA 3HJEA 3ABSA 3GTNA 3TN5A 4B4HA 3TC7A 3GH5A 5HJLA 3LRMA 3TXZA 4R27A 3V0SA 4WR3A 1OVDA 4F40A 3GC4A 4IJBA 4MJ4A 2GGHA 5BXSA 4CVUA 4KETA 3GVVA 3QY6A 1O66A 3AALA 4M6UA 2YCJA 7TIMA 3JU2A 1N8WA 5A8QA 3K4AA 2O7SA 1TPEA 4PTXA 4CCZA 4FF5A 1RP8A 4P8XA 4ERAA 4LAMA 3IJQA 3TUUA 4JTIA 3WK1A 2YZRA 3P82A 2V5KA 2J7FA 3UZZA 4ML4A 4NZ5A 1H7OA 3NUKA 1FWFC 2Z0IA 2PFHA 3W0KA 2W67A 4V1YA 4YHEA 3W7CA 3B0UX 1U5JA 1BHGA 3H54A 4MHBA 1XV8A 4M56A 1PV8A 4C1NA 3ONBA 5HBFA 3CAWA 2OKOA 4L4LA 1ONXA 6ALDA 4I3GA 2J7GA 1XICA 4AZCB 1PYMA 1SR0A 2ATMA 2YCEA 2P3EA 5CPTA 3CS2A 3U48A 2G41A 3DHFA 2G5WA 3UY7A 1VRXA 2YL8A 4EE9A 3SUWA 3IVSA 1FHLA 1BWKA 2G0WA 1ITXA 3VNLA 1JZ2A 3TX9A 3WK0A 3CZKA 4JN6A 1H51A 4WOZA 3WQFA 2BV9A 3K13A 4GI8A 3UWEA 2ZUMA 4V28A 4HPJA 1XD1A 3EWYA 1JUBA 1UR0A 3F7JA 4CD8A 1W3KA 1W91A 2GDVA 1P6BA 4ZR8A 5AC5A 4KKXA 4JGDA 1E0XA 2CIPA 4NJJA 2WSQA 2VC5A 2VVNA 2QUUA 4M6VA 3LLXA 4QE5A 1VFFA 4Z0SA 1GCYA 1W1IE 1UIPA 4PGLA 3ZVHA 2FFCA 3SGUA 3STGA 2WNWA 4JTRA 3IS4A 4US5D 3FA5A 1TREA 1W3IA 1FA2A 3NO3A 3W81A 1BRLB 4MKSA 1M53A 4ZOCA 1RQEA 1OHLA 2WBKA 4GVIA 3VIFA 3OYXA 3AHVA 3VOHA 3QVQA 4IGMA 4YJ5A 4XISA 2NXIA 3WELA 2QCFA 3LBMA 5IBXC 1K3UA 4FPSA 4AZHA 1Z8AA 1AMKA 2Z1WA 4UFLA 1GNXA 1IEQA 3K5XA 3QMRA 2G3FA 1PYFA 2Y0FA 1QOXA 3OPSA 3QV6A 3F4DA 1EQPA 1RBOB 2GVYA 3W1UA 1AQFA 5C2XA 3ZS4A 1JAKA 1G7VA 3W7IA 1UIOA 2OELA 3NL2A 2GGJA 1W3JA 3LTPA 2BNJA 4P8UA 1JZ4A 4PTMA 2IQDA 1W1TA 1OCQA 3B0PA 3GD6A 3OIHA 2ZZ7A 5BXPA 3URBA 3GVQA 3DKLA 2J8GA 2FPYA 4IL2A 1OK4A 2VGIA 3M07A 2OPJA 4FNQA 4DY1A 1E15A 2EEXA 3ME3A 3B9OA 3B9DA 5AC8A 5TBOA 3N17A 3TA9A 4WDXA 2GFTA 3CL8A 3SRDA 3QW4B 4PSRA 1EJTC 3UJ2A 3A3HA 3K1GA 3P60A 3P7YA 5LNRA 4AYSA 1MEIA 1UZ1A 5CAKA 3SSZA 4KS0A 4R7OA 4RE3A 3TYDA 2XIIA 3QF0A 3VVGA 4JN7A 4EOUA 2Y7FA 1Z89A 2DZWA 3CIVA 1H7NA 3DENA 2B81A 5FIPA 3W76A 4YXGA 1XI3A 2G97A 2HXUA 1R3RA 1E9YB 5JQ9A 1CB2A 1CTNA 3WDIA 4CU8A 2PTDA 1TV8A 4NAFA 2V3FA 1QPNA 4DQWA 3PM6A 1UB3A 2QJMA 4M0XA 3GK0A 1CZ1A 3EOUA 3PZNA 4AYGA 3IARA 3LHVA 2VFEA 1WA3A 1TKKA 3VNKA 1R7AA 3FGCA 4H9VA 4MLJA 2NT0A 1EJRC 1QMLA 1GK8A 3TNBA 3VKJA 1SW7A 4YTQA 4BWLC 4DXXA 1IR1A 1OF6A 2PPGA 1XIIA 3GYCA 3ZOAA 4DUWA 4V27A 1VD6A 2D23A 2EO7A 2PTYA 3DZ1A 2PBGA 3PBGA 4DEFA 3L23A 4OBSA 4GO9A 1PX8A 3VNZA 3MUXA 3T9PA 1UWUA 5HNUA 3LGGA 1ONEA 5C9UA 1HJSA 1DWFM 1W1ZA 4FOUA 4JTTA 4BZYA 3SADA 4UQCA 4KMQA 3EPOA 1LBFA 4B91A 3CIWA 4JBRA 4MNKA 5ECVA 2VTFA 4HQVA 3LHTA 1LP6A 4J35A 3VAVA 4PFMA 1GOWA 3IGHX 3ZLGA 2EGZA 1XPGA 3KOWA 5LIKX 4B2DA 3CT7A 4OOZA 1V0NA 3W7NA 4NQ1A 3H70A 4K3ZA 4WY0B 1ZHAA 1QNRA 4TX9A 4WY0F 4ERGA 4GPNA 5E1QA 3ARUA 1B90A 4JICA 4DUVA 4ZODA 5CPMA 4Q8VA 4Q3MA 2UV8G 3U7BA 2V81A 4DZHA 5HR7A 4ACZA 1KGUA 3UEQA 3VGBA 3W00A 4PMOA 4OTKA 5DX7A 2EPHA 1EXPA 1F73A 3TK7A 1R7OA 1W3LA 2OU4A 2OEKA 3BLFA 3VK5A 2YDSA 1EUNA 2G4FA 4AY1A 5DT7A 1V3HA 3G3DA 1V03A 2WMIB 3A9IA 1AG1O 1LQ2A 3DYOA 3LCHA 1VYRA 4MWAA 3S9YA 3HV8A 3CWHA 1VB9A 5DCEA 3UP8A 3AS2A 3PUGA 3ARQA 4XAGA 1F5ZA 7ODCA 4KH2A 5IHSA 4CQBA 3I7RA 4QLKA 4DVOA 1OJXA 1A5UA 1FH8A 1EP3A 1J6PA 3MS8A 2BHUA 1EIXA 4ADSA 4NAEB 4C6FA 5XIMA 1IWPA 1XGDA 2DT1A 3CQKA 9CGTA 1MRQA 1VFUA 1ZQ5A 4HB7A 3VDCA 1NP2A 3B0XA 3BAXA 4XQ6A 4AEFA 2ZRYA 1TMHA 4Z2JA 2IKJA 2JIWA 3OP2A 3OVRA 5FF0A 4YTUA 1OC6A 1VZWA 4UNIA 4XD4A 3GC5A 3TZNA 1WDQA 5K3VA 3L65A 3GG8A 4AH7A 2XU2A 3AUOA 3PUOA 1FP8A 1J01A 3NNTA 4MKNA 1F9CA 2H8ZA 2HPIA 4B3LA 4I5XA 3CH0A 3PJUA 2Y6ZA 4U5KA 3VNIA 4KEVA 4TU1A 3VZXA 4UOZA 1TJ1A 3NQAA 3PFRA 4H2CA 4ORMA 1AH4A 1D2KA 1JCXA 1XH2A 3H23A 3CM4A 3FXGA 1UC4A 5D8WA 1ECQA 2X42A 3UA3A 4G7FA 4K36A 3R79A 1PL9A 1FWBC 1TFVA 2EG8A 2X16A 3AUJA 2IW0A 4FIRA 2J47A 3LCIA 3B4UA 3PBYA 3TH6A 4BI5A 3REQA 1I4NA 1F07A 2GUYA 1Q5MA 3IUDA 2ZA2A 1JPIA 4GISA 3W6LA 4H2HA 3O16A 3LQGA 1EJVC 4HGXA 3WH6A 3CV7A 1IR2A 1G67A 3MHUA 1VCGA 4XIMA 4GMEA 1X96A 4X22A 3T78A 4O0ZA 4MY1A 1AH3A 1QNVA 3EKLA 3LZ3A 3GTFA 4FXFA 5EMUA 2PDMA 4LVGA 1BF6A 4HPGA 2YCLB 1R3YA 3GNDA 1PKLA 2QYGA 4O1DA 4LCSA 3WLOA 4EIVA 1KBBA 1UUQA 1NFBA 2FKPA 4XSMA 1QHOA 1TR9A 4QG8A 1OX4A 1K77A 4DJFD 2NVDA 4E8GA 2O92A 1XBYA 3ARRA 4Y9AA 3GFZA 1VPXA 3CMJA 2P1FA 1Q6QA 1RK6A 3BOLA 4JTLA 3QKEA 1K1DA 1H1NA 1H50A 1QFEA 2EPMX 2DVTA 1X1ZA 3BSHA 1VENA 3BE7A 4S3FA 1TPWA 2HNEA 4YU1A 3VDGA 2E67A 1QPRA 4Y90A 4GVHA 3MJYA 4JNYA 4JTDA 4NZ3A 2BGNE 1ELSA 1DBTA 1L0PA 3ALFA 2W5FA 2PZ0A 4DYJA 5C5YA 1LQAA 2YLAA 3BV7A 4Y7EA 3ITYA 3BGAA 3R5EA 4PMXA 2IMRA 3VKAA 3U6WA 1OIMA 3PBUA 2XIBA 2IPGA 4MB5A 3C2VA 5HJXA 1XIBA 3IAPA 3KE0A 1S38A 1FHDA 1HIZA 4UNLA 3DHPA 1E6RA 5K2ZA 1ZBKA 2IPJA 3AU6A 4KQNA 5DMMA 2INFA 1HUVA 4A8LA 3OU8A 4OZOA 3AYSA 3M0ZA 2QAPA 1OFBA 2OYLA 1EF2A 3VUSA 1SJDA 1H41A 5ECUA 4HK7A 1SO5A 3R6IA 5I2UA 4K2SA 1QJWA 3SCVA 4LNYA 1NDVA 3AU2A 1AL7A 1K4HA 1M04A 3GG0A 3EKZA 4IISA 3DFQA 1KKRA 1CLKA 2XG9A 2G3MA 3M0JA 1PDYA 2XSBA 1EEXA 3CUHA 4XAPA 1RY8A 4HTBA 1O68A 1ZFJA 1L8PA 1EOKA 2WSRA 3FOKA 4Z1YA 1V7YA 2BS9A 2Z6IA 1FBAA 4NJKA 1SR9A 2VC7A 1F7BA 2D22A 1VHNA 5DF0A 1RH9A 5BNKA 3LGEA 3WDQA 2Y63A 3W7MA 3VKBA 1GHSA 1XLHA 4AHPA 2XIJA 1R47A 3AHXA 3BLDA 4IP7A 4CD6A 1SZEA 4J4KA 2WNZA 1JVNA 3F4WA 1V3IA 1PJ9A 3N04A 2VEMA 2JF7A 4GYFA 3AXHA 1LL4A 1ZP4A 2WPGA 1UR1A 5HPOA 1H4PA 4P5UA 5L9FA 4GRSA 3WLMA 2VGGA 1PZ2A 1GVIA 5RUBA 3BLEA 2I5IA 4DNHA 2X7WA 2AGTA 4O8AA 4HVXA 2VEFA 3DU0A 3FKKA 3W25A 2QCLA 4B5UA 2J77A 5LKYA 4HN8A 1VJSA 1UD4A 3E5PA 1KRCC 3PBMA 1OINA 3L4TA 2YDQA 1ISWA 5D04C 2RH9A 3GH4A 3PR2A 3GXNA 1HGWA 4PR4A 4UFIA 3FKRA 3KOXA 1HKIA 4GKLA 4N4PA 3W7HA 2HE5A 1FH9A 1QBBA 4PB5A 3W4RA 3FNDA 4I9AA 2D3LA 4O1BA 2Y8KA 3R13A 2GUUA 2FZBA 3NZ1A 3AIUA 2NQHA 2DQXA 3TDFA 2VFDA 3DAQA 1J4EA 5ABHA 2XHYA 1P48A 1KKOA 3O3RA 1TV5A 4UR8A 3UNDA 1HP4A 4UOJA 4EF9A 4LWWA 4AZIA 4AAJA 2ZZ2A 2DFAA 3LCLA 1JCTA 1UR9A 3KBWA 3TSBA 2YGYA 1BG9A 1EDTA 3M16A 3KLKA 1KFCA 1O12A 2REQA 1J0JA 5IDIA 1UKSA 1GZJA 3HGRA 5CLWA 3UWYA 4UUIA 3T0BA 4Q8MA 2PDXA 3VIIA 4C6OA 4CGTA 4FOKA 4N6FA 4IP4A 4Q8WA 1O1ZA 2XFWA 1QPOA 2QCHA 4GIRA 3OIXA 1N2VA 1A4MA 5HMFA 3TC3A 3JS3A 3WF4A 2BGSA 1WUEA 3KL0A 4J9JA 5CCZA 2OSWA 2Z27A 3H2CA 4FO4A 3EZ4A 1SFLA 3GE7A 2AL2B 5I78A 3S9IA 1XGEA 2VENA 3ABZA 1B2YA 1VBJA 2WCSA 1XLLA 4ZTYA 3CWNA 4IJRA 1VBRA 4M82A 2WVVB 3WBXA 3FYOA 3NQ8A 1KQZA 3GSMA 4DLFA 4UFHA 4X2RA 3PZVA 1UH4A 2X1RA 3ID7A 1R6WA 4IZGA 4S39A 2KZHA 4NILA 1F76A 4GUFA 1BXBA 2PA6A 1WDDA 3FEMA 5CGTA 1QPKA 1TA3B 5FD0A 3G1SA 3GTXA 4DIAA 3KVLA 1ZS2A 3MMUA 3IVTA 4LV4A 5LIYX 1DXFA 3DERA 4U31A 5U4NA 3K4DA 1QW8A 3O6CA 1J2WA 4Z2LA 3D3FA 2WHMA 5GVJA 4FA3A 2QPUA 1A5MC 2VGBA 4IM4A 3TC6A 2PGEA 3C2EA 1V6WA 4ZTXA 1AQ0A 2ZUUA 3W85A 1LWHA 1J0YA 1VEOA 1LJYA 3TYAA 4XZ9A 3SIZA 3L4YA 4LUYA 5BMWA 3U57A 5G4WA 3N4EA 1Y5VA 4N42A 1X1OA 1EA0A 4H9YA 5DMNA 1Q6GA 4QM1A 4HJWA 3LNMA 1GKPA 3UXIA 1F4HA 3VIKA 2D1ZA 4IT1A 3C0QA 5LGXA 4Y8FA 1UUMA 3AWOA 3RLGA 3VGEA 5G1YA 1M7JA 3AC0A 1LRTA 3VNDA 3UG8A 3CAVA 2C19A 5I07A 2PCQA 3QXBA 4HA1A 4ZXOA 3BQ6A 4WGHA 2CHOA 4XD3A 3UYIA 1E1EA 3WFAA 4MY9A 1T7LA 3QKZA 5CPQA 4FNRA 2X1UA 2DSKA 3K8MA 4H6RA 3Q4DA 2H3DA 2HRWA 3I4EA 1XIEA 5HQEA 2J13A 3H6OA 1KFJA 1LG1A 4MZ8A 3K2GA 1P1XA 2WVSA 2W4XA 3UXAA 1HJWA 2IQ0A 1XL9A 1J93A 1JPMA 3T05A 4LYPA 2WJZA 3OZOA 1GOMA 4W85A 1DORA 3MDWA 5GNYA 3ALGA 1DVJA 3NG3A 3ZLFA 3A47A 3NZGA 2MNRA 1SJAA 4JIQA 2HQAA 1MEWA 3G77A 1WNOA 1UJPA 1Y0EA 3R0UA 3GU9A 2F61A 1DWAM 3W1PA 4HCLA 4XZWA 2YA0A 1KWGA 1CDGA 5DY2A 3VI2A 2CHRA 4FNSA 2AQOA 1I0DA 4F4RA 5G4HC 3WN6A 1P6CA 4YCOA 4G1KA 3CAQA 1LCOA 3C56A 4O0KA 2E25A 2WM0A 4D1IA 2XWDA 3OB8A 3WD1A 3PTDA 3VE7A 3VIMA 3UJSA 5D9OA 1KQYA 1XLKA 3MP4A 1QWGA 4DHGA 3CT2A 1XLCA 3N14A 1OD0A 2V9DA 2GJLA 1MEHA 2FPVA 1HVQA 2WK2A 2A1YA 1TWIA 3TWAA 2R1NA 4DBEA 1X38A 3BCFA 1ZAJA 3VXGA 1XIFA 1UR2A 4QNEA 1FTXA 4ZB0A 3AISA 1UR3M 4Z17A 5G5IA 3WNOA 3NQ7A 2ZZ3A 2DZUA 2ALRA 2Z1VA 3UWQA 3BOXA 4E8DA 2XSAA 1V6VA 3E9AA 3G1DA 4XUYA 1GVOA 1SUXA 3AOFA 4LCRA 5CH9A 3S5SA 5EYWA 3N2BA 4GKTA 3EWBX 5KZEA 2ISDA 1MW2A 4QHRA 3EEGA 1R2SA 2DJXA 1ME7A 4UTWA 2Z28A 3MWCA 4AMCA 3EWUA 3LM7A 3IIPA 3GNOA 1V0MA 1Q3NA 1T8XA 1T96A 3C61A 1TV7A 3JZEA 1YW1A 4LBSA 1N55A 1UP3A 5AY7A 1V3JA 1TB3A 1FCVA 3UERA 4KRZA 4PULA 1UHVA 2PDWA 4WDUA 3SCNA 3UT0A 3HQNA 1EGZA 2PDHA 4C6NA 1XIMA 2HV5A 2P3ZA 1MQQA 5BOEA 2IUZA 3S3GA 4D6GA 1QW7A 2IPFA 2A21A 1DJNA 4O1FA 1WOAA 1NY1A 3KW3A 3LBOA 2E40A 1VBUA 3D5HA 3PPGA 3OGVA 3URNA 3VD3A 5D03A 1J6OA 3CLWA 3QTPA 2C7FA 5EMYA 4JFSA 1WB0A 3G1XA 1S5WA 4YPJA 3T0CA 5KMYA 1IZJA 1E4IA 3B8VA 1CGVA 3RX3A 4PZVA 2CZFA 3NPUA 4R9OA 4MVAA 1O5RA 3HPAA 1IF2A 3QN3A 3NIYA 1TTPA 3H2NA 3TAOA 3EXSA 4LVDA 1A47A 1WQ5A 3QRHA 2A79A 1VPQA 2FMOA 5CJ5A 4WCJA 1LBMA 4GNJA 5I7GA 3FDKA 2C1HA 4LB3A 3AIEA 2Q8XA 1SZGA 1SFSA 2DIJA 1HJQA 2D2GA 4MJ2A 4OJYA 5I23A 1VJIA 4ICMA 1B4KA 4HPHA 4Q8QA 1YBQA 3ARXA 4GNVA 2E6YA 4LQ1A 5I03A 2ZUVA 4CNNA 2RHGA 2W66A 2A3CA 1CXHA 1Z69A 2CPUA 4B5WA 3W2MA 3A6OA 4INFA 5EA9A 3IEBA 3COTA 2G37A 4W8BA 1PIGA 1OT1A 4DJFC 4ZEPA 2J88A 4H8UA 3LEPA 3MUIA 2WHLA 3V1PA 4UFMA 3P5YA 4GX8A 3H4WA 2QDHA 5I77A 2W9MA 1LUCB 2OQHA 4XVEA 1QVBA 3HG5A 2XZ9A 4HK6A 1MSSA 1KV8A 4UTTC 3RLHA 1K8YA 1WZAA 2QXWA 1I2QA 3M64A 4YTRA 1XINA 1R0MA 4S3BA 4B15A 5A1AA 2ZRUA 3MZ2A 2VWTA 3TTQA 3UD6A 3H2OA 1XLJA 4V15A 3ZVHB 2RUSA 4LT9A 2GUBA 4OGZA 1W5NA 3G1FA 1WXZA 3ECQA 3WQ6A 2VKZG 3EKGA 3CB3A 4E38A 4GC4A 3GUGA 4QE1A 2PGWA 3EWZA 1MNZA 4A3RA 3V18A 1FCUA 2QCMA 2WLZA 4TV5A 3TFXA 4M7TA 3G3MA 4ZXLA 2V5CA 2BXYA 1H49A 1B30A 1AUSL 3CLMA 3MI2A 5EB8A 2ZTJA 2Z24A 3OG2A 3M0VA 4BI7A 4HNUA 3G0UA 3EA2A 1DJHA 1QOPA 1OT2A 4W5UA 3M46A 5I3FA 5AZ1A 4KESA 4GVGA 3QM3A 4XSLA 4H83A 3Q58A 5PTDA 1DQXA 2Y70A 4NVTA 4JKLA 4H4IA 1K7EA 3HOJA 4GGBA 3NZPA 2QIWA 3PWAA 3HMCA 1OFDA 3H4GA 3EB2A 1US0A 2NW0A 1UJQA 2J24A 4KCVA 1NDZA 3TWBA 1FHUA 2QDDA 2ZRZA 1YX1A 4ZVJA 3QLDA 5CZKA 1V5XA 3RK8A 4X61A 3NTYA 1GG1A 4B92A 2ACQA 3QC3A 3FA3A 4IFOA 2XTKA 1GVRA 3G2GA 3GX9A 1WDRA 1XRTA 4R5EA 4O53A 1AA1B 4ZB2A 3C86A 4NXSA 4DF1A 5AC6A 3E0LA 2OZ3A 4PSPA 5D05A 5T8GA 2CC0A 1VIZA 1KFKA 1Q6RA 4H9TA 4DWSA 4BF7A 5A2CA 3L5MA 1S5MA 4XUGA 1KBLA 3VDBA 4I9JA 2CFFA 5LYRA 4JAWA 4ASTA 1W3TA 2PWFA 5BRPA 5KEZA 2PU0A 5A94A 4GCXA 4L4MA 1DV7A 3MC5A 2VEPA 2WVUA 1P43A 2J74A 3VD7A 4GX9A 4NYUA 4B5TA 3T2PA 2YB4A 3L7RA 4E3TA 4OHQA 2Q6ZA 3ZXWA 3TYBA 1E71M 4AFYA 1W2PA 3VNJA 2FTYA 3BAKA 4E2VA 3OHMB 3ZLHA 1FP9A 3FSUA 3F2BA 4AZ6A 2VRKA 4GZ7A 5F1UA 5CBJA 1GQKA 1XCFA 1PE1A 4O1EA 3THDA 3DECA 3AO0A 1NWRA 3FAWA 3G22A 4EPKA 4JKMA 5K7JA 3GG1A 4XO7A 4ZFCA 5AHNA 1EOMA 2FFIA 1TVNA 2X05A 1E9IA 3S83A 4AIEA 4PCSA 5E0CA 4AB4A 4AD4A 2VX5A 3FY1A 4P7QA 3S46A 4B3KA 1J12A 4BEQA 3NM3A 3SGGA 5CC6A 4IJCA 2VZSA 3MHFA 2Z2AA 4GI9A 3NSMA 2NQLA 2OSXA 2NX9A 5AYXA 3WL0A 1K6AA 1H7RA 5FSDC 3S5OA 3H12A 5HWJA 1J0IA 3GDMA 5I3KA 3NQVA 3CJPA 1TWSA 4DBWA 1LQ0A 4GOAA 2OGJA 4FNUA 5ABFA 4TVUA 5A6JA 1JD9A 1NSJA 2Z6JA 1CGXA 3UVAA 4AXNA 1FCQA 3AYTA 1VFTA 4C91A 4LS0A 1O94A 3BH4A 4IPJA 5EL1A 2H8XA 3W9ZA 3M0XA 4Z0JA 3AFBA 3TFCA 5F1VA 4TR9A 2FVMA 3TTOA 4MMWA 1S5NA 3AROA 4A05A 3XISA 1GQNA 4LJ3A 2ZRVA 2WZTA 5CPLA 3KM8A 4CVWA 3ONCA 3FJNA 1EZ2A 1TE1A 2X2YA 2D2HA 1JPKA 4E0CA 2V5BA 1U33A 3TOYA 2P76A 2J27A 3HU7A 1M41A 4L9YA 7CGTA 3PZIA 5I06A 3UFYA 1R5YA 2ZICA 4FALA 5CSUA 2NX3A 5CPSA 1E4LA 4MG4A 3T8LA 4XG1A 1TWZA 1Q85A 5XINA 3W2KA 2O9RA 1BSIA 1YEYA 4IQDA 1KTCA 1O7AA 3W84A 5BW6A 3EMCA 1NDYA 5EGRA 4RE4A 3CGTA 3MBFA 4MAVA 5I00A 1LROA 4N4QA 3BO9A 1K8ZA 2GSJA 3SN1A 3MA8A 4GZJA 4M3PA 4AIOA 3JW7A 3TQPA 1YPFA 2R24A 3KRSA 3PB0A 4CQAA 2B0MA 1JZ8A 4JCMA 1DIOA 1OYBA 4YNGA 1DL3A 4IWWA 1FWHC 2VCCA 2P5NA 2ZRXA 4I9TA 1XDLA 3OLIA 5H6HA 4LC6A 3EX2A 3BGGA 1XKJA 3USZA 1XX1A 5FA5A 5D02A 4G2DA 1XLMA 1H7PA 1XF0A 1ODZA 1V77A 1WDPA 4MB3A 1BLIA 2WW5A 1TJRA 2E0PA 1HG3A 1ICSA 5BWAA 3E0WA 2VMFA 3LLFA 1DWIM 1WV2A 3WH7A 2G4JA 4A8RA 3AI0A 3EDKA 4QSHA 3BJSA 1ZJHA 6REQB 4IIDA 4W7VA 3MCMA 1FDYA 2VR2A 5DBTA 3IV3A 2VOTA 1RVGA 1GYMA 1XCXA 5LNWA 4ZBCA 4XTDA 2W92A 1G7UA 1CGYA 4NJIA 4KFNA 4RNIA 1CBGA 5K4ZA 4IX2A 3TE9A 3E0FA 3V5FA 1V4YA 5F4XA 3A9BA 3KAOA 1VBHA 2G96A 1SVDA 3DFTA 1FCBA 5G1MA 2DEPA 5EFDA 1WE5A 2DY3A 2ABBA 2H90A 4O57A 4WLCA 1RVKA 3GM8A 1OZMA 3RCMA 1X6UA 3KP0A 5KETA 1R38A 1KM4A 3ZWSA 2I56A 1UWIA 4DZIA 4AWTA 3U2CA 5I0DA 3IANA 2CZVA 4ZCWA 8A3HA 4C60A 1JYWA 4IXHA 3QEZA 2A6LA 3KHDA 3P67A 1YYAA 4K38A 4C6KA 3WDHA 3MV11 1GVEA 4I5UA 2RGMA 5GJPA 4NJGA 2WOQA 4Y96A 2FZMA 3ARWA 5AYYA 3M0KA 4K8HA 4TUFA 2NXHA 5H91A 4RDZA 5AC4A 3LRKA 5F2IA 5LZLA 4E4UA 4QDWA 1JFXA 5BU6A 4H41A 4AWSA 1XSJA 2A2IA 1A3WA 3LS9A 4ALDA 5HMEA 1F6PA 4A35A 1KTBA 4HZ8A 1Q63A 3HB9A 1H1ZA 4D8LA 1YIXA 3WLRA 2FH6A 2J6XA 2A3EA 1Q6CA 2NUYA 4FK9A 1D8WA 3BURA 2PDKA 3VIHA 3GAYA 2XVKA 4ZO7A 3HTWA 1OEPA 2WZIA 3OA3A 1ZBCA 1JZ7A 2ZX9A 1AQHA 4WSHA 1U2YA 1YXCA 4LUSA 2F84A 3ITXA 3O8AA 2G3IA 5JBFA 4HCHA 3D3AA 3MCOA 4GG9A 4EPBC 2ZUSA 1R9XA 3TEVA 2QCGA 4HA0A 3J7HA 3WO8A 1WDSA 1AMYA 3RM8A 6XIAA 3CTTA 4JQ1A 4O10A 3SJ3A 1XDMA 2QW5A 4PTWA 2YDRA 4HA3A 3K4WA 1TTIA 2F9RA 3EBVA 1SM9A 3NEHA 5AVNA 3P14A 3NQEA 4QJ1A 2PP3A 3G6LA 2XM1A 4M51A 1YDOA 2R14A 1FXPA 2RJHA 2ZDRA 4UFJA 4K1GA 3GHUA 3TXVA 3T09A 3G8EA 5F2LA 2QGYA 5LNVA 3DG6A 1OF8A 3GKAA 3WL1A 4AX7A 3W83A 2PURA 2ACSA 5E93A 2WB5A 4PEKA 4U4MA 1T0OA 4KT2A 5AZ0A 2FDSA 2VVSA 2BB0A 4UTJA 2X40A 4R7JA 2X1SA 1C8VA 3P84A 5DEZA 5D4YA 5LIWX 1W56A 3HG3A 4C7FA 2MUCA 3NZQA 3W70A 1T99A 3EPMA 4O17A 5E6YA 4QGCA 2YJQA 3WNKA 3U7VA 4UTKA 2FDMA 2QJHA 3QYQA 2X0YA 4DO7A 5BU9A 5AKQA 2PDJA 3KLLA 2ZADA 3KCJA 1W1YA 4JDYA 3BCDA 4DWDA 2BASA 5HJYA 3NPWA 4JIPA 5E0KA 1AQMA 5KZ6A 1ZBVA 1XBXA 3QOKA 1UA7A 2JIEA 3RM9A 3IIOA 3NR0A 3EOLA 3TJIA 1WYIA 4FF7A 3W71A 3EPNA 3GBDA 8RUCA 4RDVA 2OQLA 4XBKA 4XWUA 1NEYA 3WMSA 4CQCA 1JD7A 3IVUA 1D7KA 1ITQA 4G8TA 1CX9A 4LS1A 2YCLA 4QEHA 5G2IA 4AD5A 2PDCA 3PPCA 2HS6A 3IGXA 1E73M 3O15A 5A2BA 3VOGA 5CC7A 1ZGDA 3UPMA 4DJEC 2XINA 1Q66A 1SW0A 2ZX5A 3SBFA 1Q13A 2I14A 3U8GA 3KCOA 1UD3A 2PGFA 1UKOA 4IMDA 1JYVA 1MXDA 5JBDA 3EA1A 4WK9A 7ENLA 3CUIA 3QJAA 3SY1A 1KD0A 4M19A 1WO2A 4CNUA 7REQB 1YMYA 2F8QA 5ENLA 3W1AA 3GHTA 4L4PA 3IPWA 1Q7MA 1FFQA 1OFQA 1QW9A 3Q67A 3DFYA 1GUVA 4AD1A 1UWAA 3MPGA 1P0NA 2DDXA 1UC5A 4ECLA 1AW1A 4ZQRA 3KBMA 1P7TB 1Y65A 3T40A 2GSHA 5LXXA 3PZQA 1F8MA 3W7RA 2XUCA 4S3EA 1RJQA 3F5KA 4BF5A 2XH0A 1C91A 4NZ4A 1I1WA 3DIPA 4UXDA 1DIDA 1UQYA 1ADSA 5D32A 3UR5A 4UQBA 5LNUA 1VRDA 1W5MA 3BGJA 5FEWA 2Z00A 4QFUA 2HVNA 5CPOA 4RZBA 3RDKA 2Y7DA 1FHVA 1R85A 4BQ5A 1MW3A 3H53A 3IJ9A 2QHAA 3NA8A 3LHUA 3AJXA 2ZRWA 2I9EA 4WGXA 4A2RA 4U3AA 3Q37A 3ENLA 4GYPC 4A3YA 4HHMA 4RL3A 5DRIA 3VPLA 1NWSA 4R85A 4YWSA 5HANA 3UA4A 5HWNA 2QCEA 1E9LA 3NQBA 3C8FA 1JYXA 5BYWA 5SWUA 1YTKA 3PPHA 3EOSA 5U7SA 4L6DA 1HF6A 1H11A 4ZGYA 4MPKA 2QR6A 1XIGA 1UKTA 4K7VA 1EEPA 1PKYA 2V2HA 4IMEA 4KRTA 1S5VA 4RW3A 2ZE0A 1QBAA 4ZSTA 5FI8A 3QV9A 4XKMA 1TTQA 2AGKA 3P93A 5DMLA 4NHVA 4W86A 3O07A 4B9YA 3WDRA 4Q4RA 5JUVA 4AU0A 1TUFA 2QAFA 2OYKA 2ICSA 4XZLX 2GQ8A 3FGCB 1KRMA 3N6QA 3AQUA 3B8WA 1X39A 4O1AA 3ZYZA 4HOXA 2AL2A 3VE9A 3TIMA 2Z1BA 4KFPA 3GW0A 4HMEA 4JTQA 1GJUA 4K8EA 5JBEA 3SJNA 1ENUA 1KB3A 1W9XA 3ARZA 3VX1A 5FJIA 3WQEA 4KCTA 2RAGA 3F4CA 4LBRA 1VFLA 4ZE5A 3YPIA 4IXXA 3TJXA 4PL2A 2VQUA 3UF9A 4KIRA 1MZHA 4GVFA 3WK3A 3EMZA 1U30A 3G1RA 3WBEA 2ZDSA 4JIRA 2FVLA 3MUCA 4EAMA 3QPZA 4IH3A 1GVSA 4FLOA 3BDKA 2PMQA 4JY8A 2OLAA 4WKHA 4GINA 4I7WA 3VCCA 1WBHA 3VOIA 3DI0A 4V1XA 2WZHA 5A8PA 4IMCA 1IWAA 4TQTA 3GU1A 3D46A 4J3TA 1AL8A 4DZ5A 3M5XA 2O0TA 3R8HA 1EHAA 2PWEA 3N2OA 5GNXA 4LU0A 1ZTVA 1THFD 3S2JA 2WVTA 3CU2A 3N12A 4GWEA 5XIAA 1LT8A 1XP3A 1TPUA 4HD5A 3UG5A 1CNVA 4IGSA 4JTEA 3W28A 3MMTA 3QGVA 3W1QA 1W6TA 1A5NC 1FOBA 1KCXA 4L5ZA 3PG8A 4YHGA 5EBUA 4PN2A 1EF3A 1ME8A 1W8GA 1PB0A 5LIUX 3ITTA 5D8ZA 1HFBA 4BEUA 4P7NA 1EH9A 4ZQNA 3CWOX 2PZNA 4DLMA 4D6JA 3LYEA 4IL0A 1PPIA 4TTGA 4DO5A 2DQWA 1L2QA 4BY3A 1ZCCA 3I3BA 3LCWA 8CGTA 3GUWA 3DH7A 3PAJA 1ALDA 4TTUA 1F3WA 1UH2A 1ZCOA 2EKCA 4RNHA 4YLWA 3B8IA 3C0SA 1NF7A 4LOCA 3RMJA 1E72M 3SO7A 4W93A 1H1YA 2Y4SA 1TZ9A 4QE4A 3GB6A 5CPNA 2ZC8A 4TO8A 1UR4A 4PBFA 1J10A 2CZDA 2XDFA 4UCFA 4P7OA 3GWQA 1Z41A 5HMDA 1TWWA 4QCFA 4GQGA 2BOFX 1XCWA 3NM1A 3CAKA 3LXBA 3NJ3A 3KL3A 4PE8A 4F0LA 1MUMA 2OG9A 4ZA0A 1C9DA 1VFMA 1U1HA 4H7VA 4JPGA 2HE8A 4HA4A 4A21A 3MYPA 1FWTA 4S3GA 3WDJA 1EDGA 1LWIA 2HBVA 2QF7A 2E9MA 1UBPC 3WUGA 1UD2A 5DY3A 3PANA 2HJPA 1PZ3A 1L6WA 3OZYA 4WX2A 4AF0B 3CH9A 5IHRA 1PTDA 3N18A 1UKQA 3DFOA 2FZDA 2CW6A 1AW2A 1POKA 1TX2A 3QPEA 2PD9A 2AKZA 4C90A 4NZ1A 4QP0A 5HMSA 2F2KA 3HGSA 3Q65A 4PCPA 4HNNA 1GGOA 2DU2A 4QG6A 1XYAA 4Q4PA 1XLBA 1IIGA 1QU4A 4DBUA 1EC7A 2PRMA 3T55A 3C3UA 4WRHA 3OOQA 1GTHA 4FHAA 1REQB 1V02A 3GNNA 5A3HA 3E96A 1EL3A 3M44A 1DWHM 1JG9A 1AVAA 3W22A 3GXIA 4CLMA 4GLEA 4AZ5A 3DYPA 1R3SA 3WY1A 3WQCA 2WSKA 3NPXA 3HQOA 5A6SA 1VPYA 1UZ4A 1WX0A 2TYSA 1CT5A 4XTIA 4MYAA 4UBPC 2C1IA 1FKWA 4RZ6A 1G4EA 3TN6A 1T41A 4Q7NA 3WLTA 3L4UA 4YTSA 1GQIA 3LD5A 1MW0A 2ZQ0A 4C1LA 4BQ3A 3UQNA 4CD5A 2VZUA 4XZBA 1AJ0A 1BWVA 4ZL1A 3N9KA 4PBGA 1JYNA 2FZ8A 2IKGA 4A6GA 5BRBA 1RK5A 1TA3A 2YBVA 4HU0A 4YYCA 1TMLA 2P10A 5MKGB 2PF0A 3NDOA 1XRSA 1Z7AA 3VABA 3FN9A 1VFSA 1EP2A 4F8XA 4Z2IA 3ZSSA 2P8BA 2GWNA 4TIMA 1E0TA 2NZLA 1W5PA 3TJLA 4MKVA 1IE7C 3N4AA 3UG4A 1TZZA 4ZO6A 3SCPA 1I2NA 3ZM8A 1ONWA 3GDKA 1XYCA 3W1XA 1OBAA 2CLLA 3S0CA 3TW6A 4MNLA 3M0LA 3SIMA 4XX6A 3KS5A 2DUAA 3L21A 3CYVA 2UY5A 1TV3A 4P7LA 3ITGA 2O56A 2OJPA 4Q6XA 4NU7A 4MB1A 1CXFA 1Q6OA 3B8DA 1RA5A 2QCDB 3R58A 4C1NB 1MUWA 3MANA 3ABRA 4POCA 1E3ZA 4DPPA 5T9CE 2J9XA 2QQ6A 3VIJA 4GZIA 4AF0A 1SGJA 3RGTA 3OZPA 1MRAA 1F3XA 1GT8A 4O16A 3S6OA 3AZRA 3UWVA 1A5BA 1F05A 5IOBA 5TQLA 3I6EA 3FHQA 5DCBA 3V4BA 4WF7A 1DJQA 2ZCGA 3THCA 2CLIA 1EIBA 1E6ZA 4OUEA 3MSDA 1ZAHA 4Q4MA 3RIKA 4L1GA 3SQMA 2C18A 2ZZ4A 2D73A 4CQ9A 2ISFA 1K7XA 2QIIA 2VO5A 4O13A 2I57A 2L5HA 3CV1A 3VFLA 4LEQA 1GQJA 3AWNA 1E0WA 4GNKB 5FF7A 3KWSA 3OBEA 1OG6A 4OE7A 3BICA 3M7SA 3IUIA 3P2VA 3NEVA 4GJIA 5JU6A 1V6YA 2PI6A 3BL3A 1XKYA 3S8HA 1CXEA 4I9MA 2E6DA 4R9XA 1E1CA 2EPKX 1JEZA 3LSCA 1M1BA 3W1LA 2B31A 2Y8UA 2PAJA 2WSYA 3RNDA 5C2GA 3L12A 3VC5A 3H4XA 3E6EA 2FB3A 1BFNA 1OFOA 3T0AA 1RQBA 4OV9A 3LM3A 1NWTA 3QHMA 4RPQA 3EXTA 1J0KA 4PMNA 2O4MA 2CNCA 4FLQA 1O5KA 1NIUA 4NSBA 4UC5A 3BSMA 1OADA 3NGFA 1LL6A 3ZQ9A 4GXWA 1POJA 4H8NA 1NDWA 1HTIA 2E68A 2WKGA 2ISWA 2CBJA 4O1CA 3SDOA 3K46A 4NUWA 3UGVA 3L2MA 3IIXA 2WO5A 4Q8NA 1KM1A 4JFUA 4XBSA 1NELA 1L8NA 1LOLA 4AIUA 3LNPA 2W79A 3Q2DA 4EPDC 2VEIA 4MAZA 2VUYA 5JIWA 3RM4A 5LXEA 3F4VA 1TZ7A 1VFOA 1EA9C 4HYWA 4XIAA 3WLIA 3VMPA 4KGJA 3UZ5A 5K9XA 2Y5SA 1E0VA 4AWEA 3GHSA 4E8CA 1BPLB 4F2BA 3GDTA 2NV9A 4RX0A 3SN4A 3CPGA 3NQ6A 1C93A 3C2RA 1TYGA 2VEGA 2DIKA 1XDJA 3OLGA 3PZUA 4L64A 1PKMA 3T81A 4B4FA 3E2VA 3HURA 4HZ6A 5MF5A 4HP5A 3OZMA 1CGWA 2V5JA 5I3HA 3AZTA 1W5OA 4FR1A 3KOYA 3EXRA 5EKYA 1DTNA 1L2UA 1JPHA 3BMVA 3TSMA 1J9YA 3LY0A 3IJDA 5BXRA 3M1ZA 3CPUA 4NXKA 1OYAA 1LZOA 2R1MA 4G6CA 5I24A 3SRHA 3I7QA 3UR2A 4CEXC 1H09A 3CQ0A 2Q3RA 3UPWA 1H3GA 1VHCA 2ZVIA 1IQ8A 1W17A 5ABTA 5CZJA 2WQPA 4NF7A 4JIHA 2BXVA 4CD4A 3AIQA 1W1PA 3AMLA 2A7NA 5C7HA 2J8TA 3VKDA 3STFA 4X3ZA 3AJ7A 1E6PA 3DCPA 5HULA 1JDDA 4B2DD 2Y5EA 1KW1A 1RUSA 2DUZA 2P50A 4I6KA 3MP3A 1HL9A 1OG0A 3ARVA 3B97A 3ZT5A 2ANUA 1M6JA 4BWLA 3R2GA 1W54A 3TR2A 1B1YA 4GH3A 1KR0A 3CEUA 1OFPA 2VDIA 3N15A 4Y8EA 1A80A 2HK0A 3WLKX 3RHGA 1FWAC 3H21A 2R1PA 3WG6A 1XWYA 1U1UA 1KV5A 2PDNA 3LSBA 4WXZA 5M17A 2PEVA 3OBAA 1Z42A 1Q2SA 3A4WA 3PSWA 5A6KA 3VOFA 3OQEA 3QV8A 3CHFA 4Q7BA 4O14A 3SUSA 4U33A 1S46A 4U10A 2PS2A 2C91A 3W88A 3I6RA 1D8CA 1D3CA 4Q8TA 1QAPA 3FW6A 3LMZA 3UZXA 3WZ0E 5E70A 3OLDA 5AECA 2ON3A 2JBMA 3VGHA 3MSGA 1MVYA 5AFDA 4UZSA 1I1XA 2CETA 4IQLA 5A8NA 1TRDA 5IRPA 2CHNA 3KP1A 4JTJA 1H5VA 5I5RA 4HTYA 3ATYA 2BVWA 3IV8A 4FAMA 3ITVA 3N2XA 3SSJA 3WK2A 1EC8A 4JR5A 1GQLA 4N2YA 3C8NA 1LM1A 4O28A 1JUKA 3HG4A 4BA0A 3HPZA 1LF1A 2C1GA 3I3DA 4S1FA 4Y9NA 1XG3A 3BLIA 3WEMA 3WENA 5G2HA 3AYVA 1V51A 1RPXA 3WUBA 4B9ZA 3CHEA 4GI4A 1TG7A 3O7UA 3KTCA 3QH2A 2VEKA 2OR2A 1OFRA 3STEA 1X98A 3QHNA 2C71A 3CMFA 5DCDA 1EGMA 4HIBA 4UTWC 3B8UA 4X0NA 3RCNA 3CASA 3BW2A 4OECA 3P0WA 2HPMA 2YA1A 3USBA 3UXLA 1ISVA 3RAOA 3I6TA 4PUNA 3BLKA 2Y7EA 3O1NA 3P62A 1FWIC 4AZ7A 3QR3A 2ZX8A 2X41A 5EMMA 1OYCA 5LHFA 1KBIA 4OQVA 1TVPA 3QV7A 3P5ZA 1X7IA 3PNUA 3GXPA 3TQ0A 4O8RA 4MFEA 3LCXA 3GIQA 1F3EA 1UZHA 1GW1A 2YIHA 2D69A 2ZZ6A 4GABA 4IICA 3OODA 5H8PA 4DJFA 3AMGA 4PMRA 1XIJA 4Z42C 1XHGA 4QXIA 4REQA 1VJZA 1KFBA 4R3UA 2GQAA 3R4IA 6REQA 3NCOA 4A8NA 2X1TA 1BSLA 1OCJA 1YDYA 3EEZA 1XG4A 1GJWA 3OW1A 4EP8C 4ZZ9A 1NOFA 5FKYA 5A6BD 2EG7A 2A6NA 3NQ2A 2J7HA 1HO1A 5J8LA 4PCNA 2CLMA 2OXNA 1FY6A 2UY3A 3UCCA 1A5AA 3EWWA 4Z1AA 4XV0A 4FXSA 4IPLA 3AHTA 2OZ0A 1M5WA 3N11A 1OC7A 2VD8A 4ZO8A 4LAUA 1BRLA 4GQRA 1E5NA 1AJ2A 1W31A 3AIRA 2H6RA 1FWRA 4IP5A 3IUHA 2E28A 5TF0A 3BW3A 3PN8A 3WLPA 1PX3A 2EKGA 4L1XA 4HMNA 3FV9A 4WZHA 1SZRA 2FYMA 4XZHA 1BVWA 4REQB 3D47A 3WQ8A 3PTKA 4DXKA 4DWSD 3LV6A 2OZTA 1V3KA 4EXAA 1W9UA 3SZ8A 3CNYA 3OGSA 4RR4A 4C1KA 5FACA 1E70M 3W7EA 4CCEA 1JCMP 2ODOA 3E12A 4ZQOA 1HX0A 1SFJA 1R2TA 1R87A 4GFSA 3O0KA 3HGJA 1H0IA 2HS8A 5EPDA 2QV5A 5T91A 1JZ5A 3S6TA 1J5SA 1GEQA 3IIZA 1W9VA 4UQ9A 4S3JA 3SURA 3MUZ1 1B0IA 1G69A 3W74A 2C15A 3WMLA 1P0KA 4AEEA 4BS0A 1TVLA 3NGJA 3SCTA 3NYZA 2P8CA 4EAYA 1HKJA 3GW3A 2ZVRA 2EPNA 1FXQA 3DFHA 4LUSB 3E0VA 2NSXA 4AD2A 4YYFA 1WZLA 5H8MA 1EGVA 3K1DA 2ZA1A 3PHAA 3EOOA 4QITA 1P1MA 2A3BA 4ORIA 1JNDA 5GJNA 3GBEA 2NX1A 2GSEA 2DW6A 3W7OA 3UVIA 3O9NA 4DM1A 1E0UA 1E6QM 3GR4A 2I5GA 1EJ7L 1IXNA 3P8JA 4HU4A 4XD6A 2ASHA 2YXOA 2AMXA 2CKSA 4P2VA 1CENA 1CI1A 2QCDA 1NAL1 1SO6A 2HCVA 3N29A 1UR8A 3FK4A 1G0CA 4QQ3A 1JDEA 3GR7A 2X30A 3EB3A 4D8AA 3UJEA 2Q09A 4HNVA 4YCPA 4U3CA 4WIWA 1E1FA 3NFUA 2E7FA 1CPUA 1R86A 2PTWA 3QSRA 2A85A 3SECA 9XIAA 5F4SA 3SUUA 1G4PA 2YBTA 5K4XA 3W23A 3H2MA 5TD4A 4WSJA 4GC3A 1A3HA 1ZPTA 2VWSA 1GOQA 1R3QA 4RXGA 4C6LA 3GFYA 3E2SA 3OVQA 3H2AA 3WCZA 2V5LA 1HVXA 1E5JA 4M80A 4LEFA 4MUPA 2PDLA 4ICNA 2CESA 3ABQA 3EGJA 1T5AA 3QFWA 3QQ1A 3QQ0A 3PULA 2RFGA 1ICPA 3S1UA 3QZAA 4LW7A 4MWAE 4PTVA 1XH1A 2O55A 4C6EA 3MUY1 2WNNA 3GU2A 3AXXA 4K68A 4CU7A 4NRRA 1PBGA 5HUPA 3UZWA 5LHEA 4QSFA 3OYZA 2BSLA 5AHEA 3TNOA 1H61A 3WLNA 3NQMA 3S47A 4RZ4A 3PUDA 2PU1A 4LYKA 2NQ9A 5D2XA 1KRAC 1NF0A 1TUXA 5D9NA 2CZ5A 3CUZA 5DQPA 4DJDD 3WLHA 4DUXA 3TLQA 3ITCA 3FVMA 1OGBA 4ROQA 4OKDA 3C0JA 2B4GA 1XYFA 5BOOA 4R7WA 1RXOB 2OZ8A 2RDTA 4X60A 4CQ8A 1IYXA 1LLZA 2PWVA 2INZA 4AY7A 4D1JA 4JTFA 3E02A 2INEA 4JHMA 3E1F1 4PH6A 3GVGA 4PC8A 4AG0A 1D3HA 3KBVA 2GOKA 2CERA 2XH2A 4JIEA 3RXZA 4HK5A 3UETA 4RV8A 2FLIA 3VCNA 3NYDA 4OBRA 1VC4A 2CBUA 1W1VA 3OA5A 4XAZA 4QRNA 5A6TC 2F7FA 4UR7A 3LHYA 2VZVA 1LL7A 3GY1A 4ZE4A 2DUXA 2YYTA 3NL3A 4U2YA 3D6NA 3AZSA 1L6GA 2HROA 1G4SA 2C14A 5A5WA 4L4OA 2VX7A 1KM3A 1U22A 2Z2BA 3N6HA 4WJXA 4KEZA 1AD1A 1K70A 3TW9A 3O6AA 4NNCA 1JCLA 4KBXA 1FQ0A 1FRBA 4J27A 1PXGA 4JTAA 5IXEA 4W7WA 2DH2A 2YR1A 4WKFA 1FH7A 4M6QA 2IPWA 2I17A 1KTNA 3MI3A 3HBLA 2R1KA 1WBJA 3TA6A 3S9ZA 4O50A 3QR1A 2JEQA 3A22A 3DC0A 5EMJA 3ZJKA 4M1BA 5D9MA 4J5NA 2YW4A 4L9XA 4K37A 1C8XA 2TSYA 1UROA 3O63A 1QI4A 1KCZA 1EPVA 1PEZA 4IF2A 1EKOA 4LPCA 2BFGA 3NDYA 3KVMA 4PMUA 3CPRA 3WIJA 4B5SA 2BBFA 4H6EA 4UFKA 2VDHA 4ZMGA 3GNRA 3E3HA 4P61A 4QJ4B 1XLDA 1V7AA 3VFCA 3R8RA 4JIIX 3PNZA 3WQVA 1NFGA 4A8IA 5AB3A 1PZ0A