4TMBA

Crystal structure of old yellow enzyme from candida macedoniensis aku4588
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
390
structure length
390
Chain Sequence
YMNFDPKPLGDTNIFKPIKIGNNELKHRVVMPALTRMRAIAPGNIPNTEWAEEYYRQRSQYPGTLIITEGTFPSAQSGGYPNVPGIWSKEQLAEWKKIFNAIHENKSFVWVQLWVLGRQAWPEVLKKEGLRYDSATDDLYMGEEEKERALKANNPQHGITKEEIKQYIKEYVDAAKKAIDAGADGVQIHSANGYLLNQFLDPISNNRTDEYGGSIENRARFTLEVVDAVVDAVGAERTSIRFSPYGTFGTMSGGENPGIVAQYAYVIGELEKRARAGKRLAFIDLVEPRVTDPFLPEFEKWFKEGTNEFIYSIWKGPVLRVGNYALDPDQATLDSKKPNTLIGYGRSFIANPDLVYRLEKGLPLNKYDRNTFYTFTKEGYTDYPSYEESV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Flavoprotein
molecule keywords Old yellow enzyme
publication title An Engineered Old Yellow Enzyme that Enables Efficient Synthesis of (4R,6R)-Actinol in a One-Pot Reduction System
pubmed doi rcsb
source organism Kluyveromyces marxianus
total genus 142
structure length 390
sequence length 390
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4tmbA00
1XFBA 3GDLA 3S1UA 3B06A 1NAL1 1R47A 1QCWA 3NL2A 4I7WA 3W7MA 4BWLA 2CLEA 1TTPA 1D9EA 1G6CA 4J9JA 1KV8A 2NV1A 2H90A 3DFOA 1H1ZA 5F2IA 3KOFA 4Q33A 1Q6LA 2WV8A 2H3BA 1OFBA 5I3HA 4FXRA 3W72A 2VFGA 2A6NA 2EPHA 3L0GA 2BZNA 3UD6A 2ZBTA 3W2LA 1JVNA 1TTIA 2Y85A 1C9DA 4N9BA 4Y8FA 2G5WA 1TIMA 2PCQA 2Z6IA 5KINA 4JS3A 4HSOA 3DGRA 4HSNA 3SZ8A 3MW7A 3P61A 3OEXA 4U28A 2J88A 3W7RA 1EIXA 1LOSA 3LX9A 2A7NA 3M5VA 2E5DA 4OGZA 1GVFA 1ONRA 1WYIA 3C4UA 1RQEA 3GDKA 2C13A 4K6AA 3C2OA 4O1CA 2CLMA 1N55A 4LTSA 1HUVA 2QCCA 3LLFA 3FLUA 2H3DA 3LOTA 2EKCA 1FWRA 4MJZA 4HNNA 3W6YA 1MO0A 4IPJA 2CW6A 3STEA 2PRLA 3T4CA 2TMDA 5CPOA 1FWNA 1R30A 1L6WA 3T55A 2RHGA 3NQAA 4DF1A 5H91A 2YGYA 1KBIA 5K7JA 1OFOA 3LCXA 1L9WA 3GXPA 3TU9A 2ZDRA 4XBSA 3WJZA 5AHIA 4CLMA 2W0UA 5G2HA 1KM4A 1TV5A 1DQWA 1I2RA 3SSJA 2B4GA 3W7DA 4AXKA 5CPLA 3W84A 4QSHA 5LNUA 2E5BA 3NL6A 3B8DA 4TR9A 4DF2A 4O57A 3S9YA 2A5HA 2QCMA 2Z0IA 4YLWA 4NJJA 4XBKA 4JDYA 5H2ZA 3DFSA 4Z1BA 2I14A 2PC4A 1JUEA 4CQAA 2WPBA 4ORMA 1W3TA 4HPXA 3SGZA 1PS9A 2QCGA 3KVLA 4I7UA 4IUOA 4XKYA 2ISSA 3CTLA 4LVAA 3L5MA 4NVTA 2A4AA 3C61A 1VYSX 2CZEA 3N3MA 4JN6A 3SY5A 1G4SA 1GTHA 2YYTA 3ANYA 1SR9A 5LNWA 1EUAA 2CZFA 4MPQA 3W1UA 1N8FA 5DXYA 1G7UA 2ZA2A 1W5QA 2C6QA 1KFKA 5FF3A 1EWEA 3PAJA 5LNVA 1YLVA 3QQ1A 3O07A 5CSSA 3SI9A 1KM2A 1G4PA 3NQMA 2HMCA 2QCDB 1W5PA 2KZHA 3LRMA 2V5BA 1TTJA 3F03K 4C1KA 3TW6A 2A21A 3USBA 2TRSA 1RQHA 2QJGA 3UPBA 1H63A 4LV9A 3S42A 2G95A 3L5LA 3FFSA 1F76A 1OX4B 2RH9A 4IPIA 4FX6M 3Q2DA 1FUYA 3P7YA 2GJLA 1K8XA 2Z2UA 5D2YA 4O52A 3E02A 2ZA3A 4NNBA 3W1TA 1WOBA 3QEZA 3STFA 4M5PA 1K7XA 3RFAA 3CLMA 1P0KA 2Q8LA 2CWNA 3QMTA 4HT3A 1JRBA 1W3NA 5AHMA 1Z48A 1LORA 4GRSA 1X1OA 4JR5A 3GYEA 4EF9A 1TREA 4DBDA 2Y7DA 3OBKA 3EWZA 1SU5A 6TIMA 2FDSA 3AJXA 4LVDA 1CX9A 3IIZA 4N2YA 1PCKA 5KZMA 4O13A 1AMKA 1QO2A 2HTMA 4ZMGA 4FNTA 3NQ8A 4QJ1A 3LCFA 3QC3A 2WNZA 1W31A 1BTMA 4EWND 2YXGA 3EWWA 3R12A 1TV8A 4Y6GA 4MIMA 1MEIA 3P60A 4RLIA 1EA0A 3G0SA 1FWSA 2QF7A 3HG5A 1FWTA 4MFDA 1H5YA 3WK0A 3C2RA 1PHWA 5I3GA 3P8IA 3LHVA 3W85A 3GAKA 3M1ZA 1XBVA 2B7PA 3LLDA 3OVPA 3W86A 1H7NA 4JTSA 1LRTA 5KITA 2P0OA 3V1PA 1WA3A 5FF0A 2WQPA 3ABRA 4K36A 4MOZA 3AO0A 2JGYA 3G3MA 4JYFA 4LC8A 1K02A 1MEWA 2GOUA 1S5WA 3NQCA 4K38A 3TXVA 3LV5A 2C19A 1WOAA 3WFAA 1RVGA 4IXXA 3EWXA 2Z1BA 5DXXA 3VE7A 2CLLA 3IIVA 3V75A 3NQEA 1BWKA 2O7QA 4JY8A 2D73A 2ZRYA 1JCNA 3NDOA 4O4WA 1VHNA 1G4EA 1F2JA 3NVTA 1WXJA 3PSWA 3P67A 4CNPA 2V8ZA 1LDCA 1RQBA 4PTNA 5DCEA 2FTPA 2NZLA 4LUJA 3W7OA 2QKFA 3PB0A 5IM51 3H54A 3B0UX 1TPDA 3S1WA 4UNKA 2C14A 1TTQA 5LNRA 2AGKA 4N02A 1ME9A 1AW2A 2C15A 1EPXA 2RDWA 3I6RA 3LI1A 3NOEA 3L0KA 4FX8A 3TR2A 4EVZA 3HGRA 1N7KA 1Z41A 5EYWA 1IXNA 2NX1A 2FIQA 3EWBX 1SFLA 3QW3A 2ZRUA 3BK0A 4RZ6A 5HWNA 3NXFA 3PUEA 5LKYA 1OFDA 3LXAA 3W7IA 3EXRA 4GBUA 2OT1A 2PURA 2E6FA 3EWYA 3MI6A 3A22A 3P84A 5D04C 5DCBA 4UTHA 2A7PA 1SUXA 3TFCA 4JY9A 4OT7A 5HQEA 4PH6A 1W8SA 4MYXA 2RKXA 2V5LA 5K9DA 4Q32A 3MJYA 1VCGA 3TMQA 3PG8A 4Z0JA 1XKYA 4UTKA 3P80A 2RDUA 5KZDA 3NM3A 1K03A 5FI8A 1QPOA 1OFPA 1F6KA 5LHEA 1ZENA 1M5WA 2OX1A 1XBXA 4ONVA 5F1VA 4LRSA 4JTUA 4O4VA 5CPNA 2QAPA 3NL5A 4P2VA 4JGDA 3GR7A 4JTIA 2ZTKA 4ZQNA 1G4TA 2VEMA 1A5AA 5C5YA 1DV7A 4JEQA 3T78A 4K7YA 1Q3NA 4NZFA 4A21A 4HNVA 1K7EA 5FF4A 4X9SA 3A24A 2V9DA 1LOQA 4TX9A 2CLIA 2OCZA 2QCHA 1KA9F 1D3HA 2A0NA 2FB3A 3W76A 5HR7A 1IIGA 3QSTA 2ZZ4A 3DI1A 4AF0B 3M6YA 1JCXA 5DY3A 4JIQA 1QWGA 5F2LA 3FJ6A 4BF9A 1EB3A 3NG3A 3W1QA 3E12A 1BEUA 1VLIA 4UFJA 3I65A 1ICQA 2ZZ2A 3G3DA 3DHFA 2RFGA 5SWUA 3P74A 1MEHA 2VFIA 3GB6A 4M19A 5HULA 3UWQA 3L21A 5TQLA 2WKJA 1ZAIA 2CLOA 4O15A 3FJLA 3W87A 2ABAA 3FS2A 4UFMA 3TE9A 4AMAA 1XCFA 1ZFJA 2J9XA 5F4SA 3TSBA 1SZGA 5LGZA 2V2CA 3S5NA 2V0TA 1LYXA 3QYQA 5HUPA 1XL9A 3MI3A 5BOOA 3TSDA 4KFNA 1JRCA 1QDSA 3NL3A 3B0PA 3BGJA 3IV3A 3FIGA 5DBUA 2NXGA 3K30A 3NQDA 3HF3A 1DQXA 3PR2A 1PVNA 1DJNA 1YXCA 3KFTA 1U5JA 1J2WA 5DBTA 4BI5A 3NQ2A 5HJLA 1TYGA 1M6JA 3CIXA 2XN2A 1GG1A 4DBEA 4RX0A 1OJXA 2VFEA 3HGJA 4EIVA 2QCDA 1W0MA 1TPWA 4MZ1A 3W2KA 1JQXA 3M47A 3WJXA 1DJQA 3NPWA 3W2MA 4WOZA 3UWVA 3DH7A 4PA8A 4WZHA 3IGSA 4YCPA 2I1OA 4IX0A 1ZJIA 1AK5A 4GUFA 3QPZA 3LHZA 3KAOA 3VKJA 3P62A 3EKZA 2Y7GA 1MZHA 2FLIA 3QW4B 3TJXA 1OYAA 4LVGA 3O6CA 4PFMA 1QR7A 5BMXA 1EP1A 1QO5A 3O05A 1K8YA 4Z0SA 1VYRA 1YPIA 5FEXA 4XUGA 1LBMA 5A8GA 3W7NA 1YTDA 4U4MA 4FNQA 4DEFA 1HO1A 3OA3A 3DFQA 3BG5A 3G1AA 5D33A 4AHQA 4FEZA 1SPQA 4UCGA 1UUMA 3ZWSA 1XBYA 1ZAHA 3VNDA 3PBVA 2FJKA 3A9IA 1JUBA 3UWUA 1FCVA 3HO8A 3M16A 3EX1A 3EX3A 1KFBA 3TSMA 4ADTA 3NPUA 5EMUA 3DENA 1TV7A 1LLZA 2AAMA 4O12A 2W6RA 1IGSA 4R33A 5BNKA 3TJLA 3TQ0A 1ALDA 1TB3A 3LHYA 1GVRA 4UFLA 1SZNA 2TPSA 3CB8A 4QIUA 5G5IA 4LRTA 4NNCA 4RR4A 1ME8A 3W7QA 1HFBA 4E38A 1A50A 1VJIA 4UXDA 3DFPA 1TPVA 4O17A 4O16A 1LOLA 3VE9A 1NFBA 2H8XA 3PUDA 2YX0A 3TCEA 2ZRVA 1SO6A 4IMGA 3E9AA 1A5SA 2CLFA 4AWSA 3CC1A 3G1YA 4RZ4A 1OX5A 1F6PA 3PVFA 4NQ1A 4NX0A 5CSRA 2CZ5A 4JTFA 5K4XA 4WX2A 2C0AA 4OWGA 1RPXA 1F5ZA 4FB7A 1LBLA 3UYCA 2XN1A 4Z08A 2P10A 4I7VA 3CPRA 3GK0A 3LM7A 2R14A 1T96A 3IRDA 1EP3A 4JXCA 1GG0A 5LSMA 3A5FA 3QSRA 3UZJA 5FEPA 5D05A 5I3KA 2WJZA 4ZQOA 4NUWA 3W88A 1PHQA 4PC8A 3W75A 3NQ6A 1OYCA 3BV4A 4B5NA 2R94A 3MHUA 3U8GA 3GDRA 3QMRA 3NZ1A 4P61A 4RXFA 5D2TA 3KVJA 4IQLA 1CI1A 3IGXA 2QCFA 3TDFA 4WJEA 5AC6A 3G1SA 3G8EA 3EWUA 5J5DA 4O54A 5F2GA 4QQ3A 5DN1A 1W5OA 1H7PA 1VYPX 3TH6A 3F1QA 4O0ZA 3IIXA 3W1LA 3TXZA 3DAQA 2ZQ0A 4M6VA 3C3NA 3PBUA 4UTJA 1Z44A 3WK3A 1YDOA 3CWOX 4RK8A 1NF0A 1S5VA 3R13A 3W83A 4UNLA 2E5CA 3M9YA 1RV8A 3W1PA 1TQXA 3QRHA 2GQ8A 5BW6A 1WDWA 2YPIA 2P1FA 1WV2A 4ZQRA 3MYOA 1OG0A 2G97A 2ISWA 4LY8A 5I3IA 1KTNA 4LS1A 5C55A 4UTMA 3QMSA 5CKSA 4G1KA 3HOJA 4O14A 1FDZA 3DFNA 4NJKA 3U6WA 1H60A 1C8VA 1GJPA 1TRIA 5DCDA 3L67A 1O4UA 2FPTA 4X3ZA 2J6XA 2GQAA 3W1AA 5D03A 3PC0A 4QITA 2QDGA 5K4ZA 3IIOA 4N6EA 2QCEA 3HG2A 4TMCA 3S1XA 4Z1AA 1SQ7A 1EWDA 3G1XA 3LXBA 3N9SA 2LLEA 1LM1A 4RV8A 1OVDA 3RMJA 2YFOA 3G1VA 4UR8A 3G0XA 4QM1A 5FEZA 4ZZ9A 3LBMA 3NEVA 1TJRA 4GWEA 4IWWA 3W7GA 2GUUA 5EL1A 4AB4A 4JTGA 1PIIA 3TMLA 3JRKA 2C16A 1NSJA 2PRMA 3DFTA 3DU0A 2FFCA 3CU2A 2GQ9A 4DQWA 1GVQA 2BSLA 4S1FA 1AW1A 1LZOA 5AFDA 1H7OA 2RDTA 2GPTA 3W1NA 3NPVA 4JTTA 5FF7A 2Y88A 2NX9A 2ZRZA 2DZSA 5HINA 4N4PA 2ABBA 1UB3A 1H7XA 3IGUA 4NNAA 1T8XA 1TRDA 4RCXA 3R89A 3UXAA 1TPB1 2ZZ1A 4QAIA 1TO3A 3P5ZA 3VI2A 1ZAJA 3G24A 5D32A 1GTEA 3HJZA 5C2XA 1IF2A 1DHPA 5G2WA 1TPUA 4GUIA 1HG3A 1TPH1 2EGZA 1W37A 3R5EA 5I3FA 1XC4A 3TW7A 3WK1A 1GVSA 3W22A 2FPVA 2VFFA 2J27A 4POCA 3B0VC 1ZCOA 3STCA 1LCOA 5L9FA 4TO8A 3UPWA 3QQ0A 3MHGA 2DU2A 2HSAA 4IXHA 3CEUA 1KM3A 3GNNA 3S8HA 3P81A 2A2IA 3PS7A 5E0KA 5U7SA 4GUJA 1OFAA 3JS3A 3HIJA 1OF8A 1O94A 3PWAA 4JTLA 1HL2A 1WBHA 4WXZA 4LNYA 2VEPA 1OFRA 1VZWA 1P4CA 1KTBA 3BLEA 1QPRA 2ZFAA 1NF7A 3G1HA 4JICA 4OQVA 1BWLA 3DI0A 1OF6A 2BX7A 5LNSA 4XZ9A 4PL1A 2VEKA 1YTEA 1Y0EA 1MSSA 3FKKA 4O1BA 3ELFA 4PEKA 3MBDA 4IMEA 4CNNA 4CQ9A 5BRBA 4DXVA 4ZQCA 5LZLA 2DZUA 3DKLA 1SO3A 3EXTA 3OHIA 2J24A 3G8RA 2WSQA 3GR8A 1L2UA 2BLEA 4YMZA 3LGEA 1OX6A 3FOKA 3KRUA 3W2JA 1ZY9A 2BXVA 2JK2A 1KLYA 5KSWA 1TMHA 1WX0A 1GPWA 3RNDA 1VC4A 4JYEA 3HMJG 1GQNA 2CU0A 4MLRA 4MZYA 2DZPA 2OZ0A 3NYZA 4K7VA 1I4NA 3I7SA 3DXIA 2QUTA 4A22A 4PODA 3W73A 5CG7A 1C29A 2YCEA 1VPXA 5CZSA 4ZQPA 3E0IA 4N9EA 4D2JA 3NNTA 3MI2A 4Z1DA 3M7WA 1ME7A 2B0MA 3SW6A 3W74A 1XI3A 1QFEA 4MLJA 1A5BA 5KTLA 3NO5A 3IVUA 3O6DA 1XBZA 1TPEA 5CGQA 3TV8A 4UFKA 2X1UA 4WY0B 3M41A 5FEWA 5J5RA 4R53A 4L4LA 1PCWA 4O19A 1O60A 1QOQA 1MXSA 3LHTA 1KFCA 3T7VA 2ZCGA 3W7PA 3B03A 3LTSA 4LW7A 3N2XA 1VQTA 4FNPA 2H8ZA 4KFOA 1TPC1 1R2TA 4NT0A 1OK6A 4MYAA 3LERA 2R91A 3NQGA 4CQ8A 4FO4A 1LRQA 4EOUA 2VC6A 4MZ8A 3W3OA 3O8AA 5KMYA 3EX4A 2ZRXA 5AYZA 3TIMA 3HG4A 1SSGA 3MMTA 3C8FA 2Y62A 2UV8G 5EBUA 5CZTA 1KFEA 3W7HA 1U83A 3BO9A 4GUGA 3P82A 2QCLA 1H7WA 3MO7A 1DKWA 3QM3A 2V82A 3MBFA 3L0NA 3JR2A 3BARA 4DPQA 1YTKA 1FDYA 1OK4A 1QPQA 3R8RA 4KFPA 2NUXA 3GVGA 1AW5A 3NQVA 4O1DA 3C2EA 1ML1A 1K8ZA 4UR7A 2DZVA 1DOSA 3CWNA 2ZRWA 4HPJA 4LC6A 2TYSA 3GNDA 3KXQA 1SFJA 3ATYA 2YR1A 3W7CA 2V30A 1X7FA 1EEPA 3NGJA 3S6DA 4LVBA 2GVLA 3BLIA 4NZJA 3DHDA 1J5TA 1FDJA 4YXGA 1DVJA 3TK7A 4UTWC 3GXNA 1QAPA 1JQVA 1KTCA 3NAVA 1IXPA 1DORA 3GZ3A 5FF2A 4QNWA 3W71A 1OFEA 2OMAA 3N34A 2W79A 3ZWTA 3KVMA 4CNOA 1RZMA 1B3OA 1QMLA 3INPA 4R7JA 4DF0A 4WXYA 1K3UA 4TU1A 4QISA 3LCWA 2X1SA 1SZEA 5TIMA 1X6UA 4N4QA 3QPYA 3GAYA 3TUUA 4IMCA 2WO5A 1JULA 2YZRA 3FA5A 2YW4A 4K37A 3GKAA 4FNSA 2X30A 1G69A 1GWJA 3WJYA 3TAKA 5K9CA 3KRZA 4JDBA 2X2GA 4NXSA 1B4KA 3O16A 4RKAA 1TCDA 2QCNA 1D3GA 2VEIA 2VKZG 3SJ3A 4BFAA 5HMSA 2TSYA 2ZA1A 4IMDA 5K3VA 1F7BA 3FEMA 1Q6QA 4XTDA 2Y7EA 4N9CA 1OX4A 3TNOA 4O1AA 3W2NA 1SW7A 1CW2A 1OYBA 1E51A 2JKEA 2XN0A 1PL9A 4GXMA 1F73A 3HGOA 4UTIA 3LXCA 3ZFHA 6ALDA 1LP6A 3W1MA 5AHFA 4A29A 4JTJA 1ICSA 3DKJA 4O18A 1A5CA 2YDAA 3LI0A 4X2RA 3C2FA 1OHLA 3L9CA 2Z6JA 4RXGA 3C52A 2NLIA 4LS0A 3LTYA 3NQ7A 2H6RA 3RK8A 4NX5A 2DZTA 3I7QA 1M7PA 3H53A 4ADSA 4OV9A 3TX9A 1UUOA 3CM4A 2CLHA 3G18A 4YWIA 2QEZA 1EX5A 1QPNA 1IIHA 2CZDA 3HPZA 2XFWA 1VH7A 3NR0A 1RD5A 3BLFA 4AEOA 3TQVA 5F2MA 3PB2A 1KFLA 1V7YA 4CCDA 3EX6A 2WSYA 3GXTA 4UMCA 3GIYA 4M7SA 3QF0A 3CHVA 3S0CA 3Q58A 4UFHA 1JCYA 3ABOA 2I9EA 3BW3A 3OVQA 4FNUA 1GEQA 3QZEA 3O6YX 1QNVA 3W23A 1JCLA 3PSVA 2JBMA 3W70A 2Q8ZA 4MKNA 1XUZA 3HGSA 2WNNA 3EX2A 4A2SA 3PF3A 3PUOA 1OFQA 1JUKA 3L65A 1H1YA 2E6AA 5T26A 4E2DA 4JX4A 4Y9AA 2JGQA 3IVTA 2NWSA 1GYNA 1GOXA 1FXQA 3TFXA 4XQ6A 3MP3A 2JKAA 1R46A 5G2IA 2BTMA 4O50A 1PE1A 3ABQA 2A1YA 4NJGA 4UMBA 3QFEA 5GVJA 1KV5A 3E49A 1TSIA 4IGHA 2DZWA 3TA6A 4FX7A 1AG1O 1HO4A 4I9AA 2WOQA 5HNRA 4O28A 4AH7A 5CZ0A 3F4WA 3PM6A 4FIQA 4BI7A 3FKRA 3L68A 1Q45A 5AC7A 1P1XA 1SZFA 5LHFA 1DL3A 2VFHA 5F1UA 7TIMA 5L6UA 3EB2A 4CCEA 1THFD 3PULA 4DELA 2WNQA 2GVJA 1BKSA 1UBSA 3I7RA 4UTWA 4K8EA 5AC8A 2NUWA 4IOTA 3QJAA 3FYOA 3L66A 1FCBA 1ZALA 5HUOA 3HB9A 3W7EA 3T40A 4XTIA 1W54A 3O1NA 3GDTA 2C3ZA 3BVJA 2QJHA 3NQFA 3OVRA 3LRKA 4MY8A 3O06A 1OABA 3IIPA 3RLVA 4RZ5A 1GT8A 4EF8A 4PCFA 2VOMA 1S5TA 2Q3RA 4IJBA 1S3HA 4AVFA 3BGGA 2NXIA 5D38A 2ATSA 2WSRA 4Y96A 2J9ZA 4GJ1A 4WY0A 5AB3A 3G0UA 1EUNA 1H62A 1LROA 2E6YA 4GUHA 4E2BA 1W1ZA 1R2SA 5LGXA 2NWRA 1FBAA 4HN4A 4WQ6A 1HTIA 3ATZA 1FY6A 3M44A 1KM1A 3MWAA 5EY5A 4ZL1A 4UFIA 3RLUA 2F84A 3BG9A 1W3IA 3YPIA 4O8RA 3TAOA 4A3UA 4KWWA 2YFNA 3UXDA 5F4XA 1FQ0A 4HIBA 3HPXA 4HNUA 2E6DA 1SSDA 1H51A 1T99A 4LUIA 4LS2A 1I8JA 2NUYA 2X1RA 5HWMA 3C56A 3WK2A 1Q6OA 3A23A 4H6KA 3N19B 1XDLA 2ZZ3A 3O15A 3MP4A 1TQJA 1H7RA 5DLCA 4OE7A 4M7TA 5AHEA 5AHNA 3NZRA 4ADUA 3B4UA 3P8JA 3CQ0A 1SW3A 2QJIA 3IEBA 3G1DA 2VXNA 2A85A 3S5OA 3LCLA 4Z1CA 4ZQMA 2NX3A 4TMBA 3UQNA 4LVFA 1M7OA 3ZS4A 4DO4A 5U4NA 3CIWA 3PBWA 2A6LA 2V2DA 4Q4KA 3SIZA 4AAJA 2QR6A 2V81A 4BI6A 4C1LA 4AF0A 3C6CA 1UASA 1W5NA 3U2OA 2VELA 1PV8A 1I2PA 4H4IA 1NVMA 4X22A 3LCIA 3KX6A 1ZNNA 1UCWA 4NXKA 4WY0F 5EKYA 1T0OA 5FESA 2HS6A 4MFEA 5AN7A 3THQA 1FCQA 3W9ZA 3ABSA 1I2NA 1ADOA 4H3DA 3CEPA 2Y70A 5G4WA 5D2XA 3TQKA 3N2MA 1LBFA 1YPFA 3P5YA 1W5MA 3KVKA 3HQ1A 4A2RA 4UMAA 1Z42A 3O63A 1VCFA 3L2IA 3DBPA 5K9XA 5KZEA 1B9BA 3STGA 1JR1A 3TKFA 1X8FA 3UWZA 1KM0A 1LRNA 4FHAA 1FX6A 1YXDA 3HPSA 5E1QA 4LU0A 8TIMA 1QOPA 3RU6A 4JNMA 3TC6A 4L4MA 1FCUA 3T44A 1VRDA 1KW1A 4UTTC 1F05A 3G22A 1GYLA 1KM6A 4MY1A 2ZYFA 5DY2A 4DO6A 4GFSA 3TROA 1FWWA 3M5YA 2DJXA 1VGAA 4S2CA 2R8WA 4S2BA 1X1ZA 2Q3OA 3GDMA 3PBYA 1A53A 2Y61A 3OIXA 3F4NA 1YDVA 4DO5A 1SO4A 4TIMA 1G67A 3Q94A 2E77A 3SGUA 1IXOA 2BWGA 4IMFA 4R34A 5G1TA 3MUXA 3L5AA 2QDHA 2JKPA 5EA9A 5EPDA 4K39A 1R2RA 4FXSA 2V2HA 1GZGA 5G1YA 2Y6ZA 3S5ZA 2G96A 5CZJA 3KRSA 1H50A 2C1HA 3M0ZA 3B04A 1TPFA 2ZZ6A 2NV2A 3OG3A 3SECA 4ML9A 4ICNA 4UUIA 4MY9A 3KHJA 1KM5A 2E09A 3E96A 3LB0A 5AHLA 1IXQA 1I2OA 2X16A 1JCJA 3W1RA 1XUUA 4LOCA 2DJLA 3M5ZA 5C6MA 2YSWA 4FIRA 4RJEA 1G7VA 3HBLA 3M43A 1XM3A 4XKYB 4GNJA 4HKPA 4YL2A 2QUVA 4BK9A 3BPWA 2Y7FA 2AQWA 5IBXC 5K2ZA 1YXYA 3W1XA 3M5XA 4DPPA 4QNEA 4GE8A 4Y90A 4M6QA 2PRHA 4FNRA 1DBTA 5AOUA 2QAFA 4BWLC 3VCRA 4N9DA 4AWUA 3R2GA 2FB2A 2E1DA 2VFDA 4NJIA 3UZ5A 3N14A 3SR7A 2CFFA 4AHPA 2FQIA 3C2VA 2EAWA 1SO5A 3WJWA 1B57A 3NA8A 3BW2A 5E93A 3EEGA 2E68A 4JTKA 2OJPA 2ISVA 3A5VA 1L6YA 5I3JA 1W56A 3TC7A 1F74A 3NPXA 2Y63A 3IVSA 3VFLA 3UNDA 3BW4A 3WJSA 5BMWA 3LHWA 1O95A 4JYDA 3LTPA 5D30A 4YCOA 5D2WA 1GVOA 4NU7A 3N73A 5AYXA 3W2UA 4MUZA 2YW3A 4WOQA 2NXHA 1I2QA 1V5XA 4N6FA 3UY8A 3RF9A 1YADA 3MYPA 3MP5A 2ZZ5A 3UWWA 2HS8A 4ALDA 2IQTA 5D09A 1ZHAA 1J4EA 1I45A 4O11A 5F4WA 3S1VA 1ICPA 1VCVA 1VLWA 3GLCA 4ORIA 1TJPA 4W9TA 2ZZ7A 1WAUA 4JIPA 4BR1A 2YYUA 2EHHA 2F7FA 1WQ5A 4WD0A 4XWUA 4MVAA 3N9RA 4KWVA 1KLZA 3PY2A 3NM1A 5HWJA 4GC4A 5G4EA 5C54A 2C18A 2J9YA 3EKLA 4HHPA 3A21A 5MHBA 2GJNA 5TBOA 5HR6A 3G1FA 2Y89A 4ZVJA 2ZTJA 3LCHA 5DELA 3THAA 3W07A 2OT0A 2A7RA 1UJPA 4PL2A 4UTTA 4O0KA 4K8HA 3LRLA 4LV4A 1VR6A 2EF9A 2ALDA 4JX5A 5D2VA 3PG9A 5D02A 2PE4A 3S5YA 4UTUA 1P5BA 1AL7A 2B7OA 4O10A 3LHUA 5A5WA 3DZ1A 4NJHA 3GX9A 1Q6RA 1WBJA 3W7LA 3LDVA 1H61A 1KFJA 1AL8A 3LV6A 4JTEA 3UY7A 2VENA 3LCGA 5ABTA 1K7FA 4UTLA 4JX6A 3QH2A 1XXXA 4AWTA 1YDNA 3SFKA 2CLKA 1FXPA 1YYAA 1NEYA 1O5XA 4MJMA 1JCMP 4WUIA 3HG3A 1P0NA 1SW0A 4OV4A 2DZXA 4AHOA 1B4EA 2DORA 1LTDA 3BG3A 1EP2A 3I68A 2B7NA 4E0CA 3W7JA 2GVGA 1LLWA 5AYYA 3FYPA 4OBTA 5CPMA 1JJKA 2B7QA 4LWWA 3EXSA 4IX2A 3CT7A 2X1TA 3MHFA 4UC5A 1O5KA 2FPYA 2DP3A 3Q37A 4KKXA 3B05A 2ATMA 4FF7A 3UWYA 5D37A 4JD4A 2O7SA 4HNTA 1VHCA 2QUUA 4OHQA 1XDMA 3C0JA 4M6PA 1RR2A 4LT9A 4UIOA 1L6SA 3D0CA 3H55A 4JTHA 4CCCA 3GKFA 4O53A 3ZR4A 1VS1A 3LBCA 4OU1A 3W7KA 5IBXA 1KBJA
chains in the Genus database with same CATH superfamily
1XIFA 1NAL1 2VZOA 1QCWA 3MMDA 4I7WA 1UMLA 4DLFA 4BWLA 2EEXA 3VPLA 1AQMA 1TTPA 3WQDA 1G6CA 2BY2A 1O5RA 1JG9A 2Z2AA 3BICA 3T8LA 2H90A 3UR8A 5E6ZA 3NTYA 5F2IA 4C6LA 4PUWA 2Z28A 4ROQA 5I3HA 3W72A 1VPYA 3L0GA 4N0RA 3W2LA 2DT1A 1JVNA 2DSZA 2E9LA 2XYLA 4N9BA 4LBRA 2GUBA 2PCQA 2DQXA 3MUCA 5B7YA 1LOSA 5E9AA 3ARRA 4Q8OA 3ID7A 2J13A 5MF5A 4MUPA 3ZVHA 2CLMA 5ENLA 1E40A 5LIUX 1UWRA 3LOTA 3EDKA 4MNLA 3WBWA 4MJZA 3R25A 4IPJA 3TC3A 4CNUA 4GPNA 3SY8A 3JZUA 5MKGB 1R30A 3MKCA 1E9LA 1L6WA 3NQAA 2PDMA 2YCKX 4GH1A 4LB3A 3MS8A 2Y8VA 2YZ5A 4ILSA 4XBSA 1FWBC 6PTDA 4GGBA 1M9HA 2B4GA 2NVDA 2FTYA 4IHCA 3W84A 3VCCA 3NL6A 4P8VA 1FHVA 1CT5A 4O57A 1NDZA 3CO8A 3S9YA 3WFLA 2O9OA 4UOQA 4H9VA 3DFSA 3SJNA 5CBJA 4Z1BA 2I14A 2PC4A 2GJXB 3T81A 3WF4A 2WPBA 2PWUA 4HPXA 3SGZA 2QCGA 4IUOA 4XKYA 3CTLA 4LVAA 1QK0A 4JN6A 2GGGA 3L23A 3LQLA 4AG0A 4MPQA 1O7AA 4FP1A 3CZEA 1G7UA 3BCJA 4QLJA 2WZIA 1EWEA 3KBNA 5CSSA 4S3JA 2QCDB 4PYSA 4JFVA 4PMXA 2KZHA 1OT1A 3VGDA 3UCCA 2CBVA 3ARXA 2IMRA 3TOYA 5CPSA 2A21A 2E8YA 3RHGA 4P8XA 1H63A 3S42A 2G95A 1RP9A 3IGHX 1UKSA 1OX4B 3IK2A 1MNSA 3P7YA 3AXKA 2FHCA 4GK8A 5D2YA 1PKNA 7REQA 1DJGA 3TNBA 1W3JA 3SN0A 3AIUA 1V3KA 1XLMA 3KOWA 4WR3A 4F0LA 5H6HA 2W9MA 3AYTA 1R6WA 4GRSA 2CHRA 4PMVA 1X1OA 4JR5A 4QTGA 2W66A 1UD6A 4EF9A 4DBDA 1PTDA 1IE7C 4ZTXA 1MW1A 4FXJA 1ZJHA 4YYFA 4NAEA 7CGTA 1HKWA 5FJRA 3OZMA 5KZMA 2Z27A 1AMKA 4TTUA 2HTMA 4ZMGA 3N4AA 1RJPA 3GXMA 4H9MA 3GH4A 2YXGA 3TYAA 1TV8A 1D8CA 2YA0A 3T42A 1EA0A 4PB5A 2QF7A 3SURA 1FWTA 1H5YA 3DYOA 3WK0A 3KLLA 3MZNA 3P8IA 2ZWYA 1PXGA 1IYXA 3GAKA 3PZOA 2PUZA 1XLLA 4R27A 3HZ3A 3BJTA 4Y2WA 3LLDA 1HJQA 2VGFA 3E1F1 4JTSA 4H2HA 3EOUA 1FWFC 2NQZA 3KBMA 2WHMA 3SGGA 4K36A 4TX6A 3N12A 3PZMA 3IANA 1XD1A 1Q6CA 3A4AA 3TXVA 3QV9A 3LV5A 2C19A 3WQ8A 4IJRA 5I5RA 3AS2A 1AA1B 4IXXA 3EWXA 4TX8A 4JKLA 2PDCA 2VYOA 4NYYA 3PNUA 4O4WA 2FZ9A 2ZRYA 1U1JA 1VHNA 4P7QA 1F2JA 4UQAA 4Y9PA 1A3HA 3CYVA 3ORWA 3P67A 1ZBKA 4CNPA 4R9XA 2FTPA 1OG6A 2P50A 3W7OA 5HA7A 4QS5A 3PB0A 1BYBA 3GU2A 2OXNA 1V7AA 3OYXA 1GKPA 5LNRA 4QR6A 3TTOA 3ARUA 3VOFA 1HN1A 4HCLA 3SN4A 3T07A 3L0KA 4S23A 3TR2A 4G7FA 4EVZA 3HGRA 3PTDA 2FIQA 3QW3A 3VM5A 5A69A 4HYRA 4FLRA 1E71M 3NXFA 3PUEA 5A8MA 3LXAA 3TONA 3EXRA 4W86A 2I16A 1SR0A 3EWYA 2W92A 1LJYA 3P84A 4UTHA 1K6AA 2ZX7A 2A7PA 3TFCA 4JY9A 1VBJA 5CSYA 5XINA 4D8LA 2J6VA 4MWAD 5HQEA 5K9DA 3T1GA 4FI4A 3TMQA 4MAVA 3PG8A 1TV2A 4HPGA 2EPOA 2A3EA 1XKYA 4UTKA 3P80A 2RDUA 3DHUA 6A3HA 2X0HA 3P2VA 1OFPA 3QY7A 5LHEA 2Z29A 1WUFA 7TAAA 4NAFA 5F1VA 2HK1A 2JALA 4LRSA 5CPNA 4U5IA 4P2VA 1HJWA 3WBAA 4E2VA 4JTIA 1G4TA 2VEGA 1A5AA 1DV7A 3CZKA 4JEQA 2OB3A 4GZIA 4IFKB 4K7YA 3RGTA 4AZCA 1WDDA 4NZFA 3II1A 4QROA 4D9PA 3IARA 4A21A 1MFVA 4XZBA 4M56A 2INZA 1W3KA 5FF4A 4GIRA 3CQKA 2PDIA 1MYRA 4MGGA 4ERGA 2CLIA 4PULA 1IR1A 2A0NA 3AHTA 1IIGA 3MWCA 3M6YA 5F2LA 1C3FA 3W1QA 1V79A 5CC6A 4UFJA 1NP2A 4A3RA 4HZMA 2PDNA 3G3DA 3RN6A 4B5TA 2XSXA 2RFGA 4FAMA 1OCQA 3GB6A 3UWQA 2CLOA 4O15A 3FS2A 3M0JA 4AMAA 5CSUA 1XCFA 1IGWA 3TSBA 2CC0A 4PCNA 3PFMA 3ZVIA 3DC0A 3S5NA 1IZJA 3UJFA 3TZNA 3TSDA 4KFNA 2C1IA 4NZ4A 1OGBA 4IIBA 1TCMA 3N29A 3NL3A 3PWIA 1AQ0A 3T05A 5DQPA 3IV3A 4U31A 3K30A 4OBRA 3UF9A 2E25A 4INFA 1B5TA 3HF3A 1XLAA 4J1OA 3PR2A 1PVNA 1ISVA 3WO8A 5HJLA 1PO9A 2DT3A 1JEZA 1SFTA 2OEKA 2WJFA 1GG1A 5LA0A 1TVLA 2WBGA 2WWCA 2D1ZA 3HGJA 2P5NA 4UQCA 1PYFA 1JYVA 4HD5A 3PK7A 3HPFA 4MZ1A 3M47A 3ZR6A 3NPWA 3SRFA 1HXJA 3CYJA 5HMDA 2ZUSA 4WOZA 4XZMX 5FD0A 3B9EA 3UWVA 1WZKA 4HCHA 1CGUA 4BCEA 2BY1A 3QPZA 1GVYA 1UIPA 3KAOA 3HA1A 3VIOA 2Y7GA 1MZHA 3GD6A 2FLIA 3QW4B 1YNYA 2Y8KA 3O6CA 4PFMA 3BSHA 3H21A 1JIBA 1VYRA 2OKOA 1UKPA 1ECQA 4REQA 2QUNA 2XU2A 4U4MA 2PLMA 4UB9A 3OA3A 2D3LA 4RE2A 5D33A 1KGXA 3ZWSA 2FGBA 3FHAA 1EYWA 3KDNA 2CKSA 2XH0A 1ZSXA 3R58A 1FCVA 3PPHA 3M16A 3QGVA 4F9DA 1S46A 3VIHA 1AD1A 4WGHA 1VFSA 2YCJA 3TJLA 3TQ0A 1HP4A 1GEHA 4GX8A 1CB7B 5BXSA 4FXFA 3EMCA 2AQVA 2VRJA 3OO2A 3GIQA 1IQ8A 1HL9A 1HFBA 4E38A 2CEQA 4MB1A 1KCZA 2EPKX 1VJIA 4GOAA 3N2TA 5HPOA 4YN5A 2VX5A 5E6YA 2ESCA 2ZRVA 3E9AA 4S3FA 4MNKA 1PYMA 4MSSA 1A5LC 2HRWA 4WX2A 3OQEA 5CGTA 2C0AA 1J12A 2PEVA 3QBUA 3EOLA 4ZFCA 4RV3A 4Z08A 1W3LA 3CPRA 5LIWX 1UR9A 2WVUA 3LM7A 4KCVA 4B4HA 3IRDA 2OGJA 4JXCA 4JHMA 2WJZA 1ZBWA 3USZA 3TN4A 1TWWA 3GR4A 3VVGA 4LQ1A 1MQQA 3NQ6A 1OYCA 4HHHA 4R7OA 3MHUA 5C9WA 3U8GA 1YW1A 3CXOA 4P61A 5D4YA 1P6CA 1CI1A 3IGXA 1VB9A 4LF1A 5AC6A 3G1SA 3LSBA 3GRIA 3RR4A 3EWUA 1YHTA 4HVXA 5F2GA 1W5OA 2QF8A 3CQJA 2PF8A 3PN8A 1VYPX 1BRLA 3K4WA 3IIXA 3WL0A 3TXZA 4JQ3A 3BLOA 3C3NA 4UTJA 1Z44A 3WK3A 1NOWA 3ENLA 2GUYA 5H8UA 5CAHA 3TR9A 5EBAA 2WVTA 1ZBVA 5EU9A 3M9YA 1TQXA 2CHOA 3FK4A 5GQBA 3BCDA 2Y0FA 5AYBA 4EKJA 4ZQRA 2FFIA 5HQLA 4QCFA 5I3IA 1KTNA 1ZZMA 4L6HA 2PF0A 4UTMA 1JNDA 5HDRA 1TZ9A 2NV9A 1FDZA 4J3VA 3U6WA 4NJKA 1KKOA 1TRIA 1R38A 1QWKA 1O4UA 5A6BD 3A6OA 1MWOA 5D03A 2QDGA 1JPIA 3HQOA 5HXMA 4LYPA 4IJCA 1SQ7A 5HNNA 4E8CA 1XIIA 3N9SA 3GHUA 4A3QA 2P0IA 4IPNB 4E6MA 2YFOA 4MKSA 3G0XA 4GQ0A 3NEVA 1TJRA 3ARQA 3AIBA 2Q02A 5EL1A 2JQXA 1EXPA 3HMCA 3NOYA 2FFCA 5GJPA 3CU2A 3G2GA 4DQWA 1GVQA 4S1FA 3R7MA 2DVUA 4C6QA 5AFDA 1H7OA 3W1NA 2W67A 3NPVA 1OZMA 1GGOA 1UR2A 2DZSA 5HINA 1CGYA 2ABBA 4KERA 3IGUA 2QGYA 4NNAA 4EWJA 4GXPA 3W38A 3A12A 3R89A 1V6WA 3VI2A 4AUBA 4AWEA 4GI4A 3HJZA 5C2XA 1DHPA 4UWMA 4GZEA 1I0BA 2Y1HA 4RDZA 1HG3A 3NCOA 5I3FA 1A80A 3BXWA 4JHOA 2IKJA 4GYPA 4MMWA 2IUZA 5M5DA 2WC4A 3QQ0A 3RJXA 3MHGA 3UJSA 2DU2A 2I5IA 3CEUA 1D7FA 4RE0A 1R9XA 1W2VA 3GNNA 4KF1A 5EFDA 3P81A 3URNA 1OFAA 1JXJA 1K77A 1O94A 1AJ0A 3VUSA 1HL2A 2NQ9A 4WXZA 4LNYA 2VEPA 1OFRA 2R9RA 1I75A 1B3ZA 5I2UA 1EX1A 1NF7A 3KS5A 4H7VA 4LSBA 4RE4A 3BQ6A 4OQVA 4XV0A 1OF6A 3LZ3A 1VFTA 1RCOB 4PL1A 1UMYA 1TMQA 3FKKA 1GOKA 1QBBA 4CNNA 4H00A 1TA3B 1LG2A 3G8RA 2VR2A 4ACYA 4YMZA 1Z32X 3W2JA 1ZY9A 3F2DA 2BXVA 2JK2A 1MNZA 1WX0A 1GPWA 3RNDA 4GIEA 4DAFA 3HMJG 1GQNA 2CU0A 2DZPA 3AU6A 3FGCB 4W85A 1I4NA 2EO7A 2Q8XA 4A22A 4PODA 3QR1A 1TUFA 4A3YA 1BGGA 4Z1DA 3N15A 2DUZA 3SW6A 1A5BA 3AS0A 3NO5A 4NYUA 5KTLA 4M24A 4TVDA 4UFKA 1F3WA 4D8AA 3WEOA 3M41A 3TTYA 1RA0A 5M03A 3ZQ9A 1BXCA 4JOMA 1QOQA 4LUSB 1MXSA 2R1PA 4C6OA 5AY7A 5I06A 3B03A 4FNPA 3W26A 1OCNA 4CN6A 4MYAA 3KOZA 3T2OA 2R91A 3NQGA 2VURA 4EOUA 4AZIA 1RALA 3QTPA 3WNPA 2ZRXA 2Z7KA 1LUCA 1W9UA 3SM0A 5EBUA 1S5MA 1U83A 3LNMA 4GUGA 2IKIA 4ZGYA 2QLYA 1UOKA 2V68A 1NDVA 2XHYA 2V82A 4G6CA 3L0NA 3JR2A 1E6NA 4DPQA 1XIGA 4AIEA 4B5UA 3AXIA 1YDYA 3BC9A 5MKGA 2PWVA 4O1DA 1JNEA 4HB7A 3C2EA 1G94A 2GFTA 4GKLA 5I00A 2CBJA 1SMDA 1E43A 3W7CA 2HNEA 4GH3A 1X7FA 1EEPA 3NGJA 2WWDA 4LVBA 2G8ZA 3FA4A 3RX3A 1HKKA 1J5TA 3OLGA 1ZL1A 4IZGA 3TK7A 4UTWC 5A2AA 2ZUUA 1QAPA 5IOBA 1W9XA 4Q8NA 3GZ3A 4WKAA 4QNWA 3W71A 1OFEA 2OMAA 3AAMA 2WMKA 4GI8A 5JMUA 1OGGA 3KVMA 1RZMA 1QMLA 1R87A 4DF0A 1RY0A 3LCWA 4IQEA 4UQ9A 3E0FA 3OOQA 2QDEA 3W82A 1JULA 1ELSA 3WX7A 2YZRA 2YW4A 3KLKA 3HTWA 2WZTA 3UT0A 1K9FA 1HKJA 3U2ZA 3GZAA 2CETA 2X2GA 3CWHA 4I9MA 4X63A 2XIJA 1TCDA 1D3GA 4Q4MA 2VRQA 3UCQA 2TSYA 2QV4A 4IMDA 1OX4A 3MV01 4JFTA 4O1AA 2PI6A 4PTVA 1E51A 1RVKA 2CERA 1PL9A 4JTAA 3ZT7A 4HHLA 3HGOA 3H2OA 4UTIA 4L6OA 4GG9A 4A3HA 1LP6A 4Q8VA 5AHFA 3POHA 4A29A 4JTJA 1MW2A 1ICSA 5T91A 3DKJA 1PTGA 1A5CA 1JFXA 3VXGA 2YDAA 2XH7A 1FWHC 5LYRA 2WC7A 3P3BA 4L9XA 5E0FA 4LGXA 2J7CA 4L61A 1KNWA 2I9UA 3BV7A 5EB8A 4ZBCA 2CLHA 4GIAA 4OECA 2FVMA 5EMKA 4YWSA 1VBHA 4JPGA 3TQVA 4G56A 1KFLA 3RIKA 1V8EA 3GIYA 3MMWA 3VIIA 4W7UA 3N25A 1NQ6A 3KZPA 3TLQA 1JCYA 3WQ4A 4FNUA 5I0DA 3MSGA 2JBMA 1WZAA 2X0YA 1J18A 3HGSA 1IV8A 3VIFA 4A2SA 3PF3A 3L4VA 3TQPA 1JUKA 5T26A 4JX4A 3GW3A 4V33A 3IVTA 1UOZA 3BLDA 1W1A1 3PUGA 3SUWA 4GQRA 1R46A 4HZ6A 3DFYA 1UZ4A 2A1YA 4IPLA 4UMBA 2G4JA 3QFEA 4B5SA 1TSIA 4FX7A 3PPCA 1AG1O 5A8OA 1V0LA 1OADA 1PDYA 1GJUA 5DEZA 3PZIA 1R9ZA 5A6LA 4ZB5A 4FIQA 2WMFA 1P1XA 5LHFA 3SUVA 4MJ2A 5F1UA 7TIMA 3ERPA 3VDCA 4KEMA 3I7RA 4UTWA 4D6JA 2CXGA 1EIBA 4KCWA 4GJJA 2EQDA 3FYOA 1ZALA 4Y9MA 1B54A 4KT2A 4PEEA 2DIJA 3GDTA 1HKIA 3WDRA 1TJ0A 1J0IA 3NQFA 2BP1A 1GK8A 3OVRA 3M6DA 1B0IA 1XR2A 1AODA 5I79A 3U57A 1PBGA 2ONEA 3KBWA 1UP2A 4DUOA 4RZ5A 1GT8A 3ARVA 3UZXA 4R88A 2OR2A 1S3HA 1AZ2A 2X0SA 4FALA 4LH8A 1DP0A 5D38A 2ATSA 3EA2A 2J9ZA 3VD9A 3S2NA 4W5UA 1H62A 3CHFA 1BVNP 1BYCA 3MSDA 1W1ZA 1R2SA 5LGXA 2OLAA 3ARYA 2XIQA 4WQ6A 3TWAA 2OSWA 1FY6A 5JIWA 4M1RA 2ZUTA 3MWAA 3ECQA 5EY5A 3ONCA 3BG9A 5EFFA 3EA1A 4KWWA 5F4XA 3L4UA 3HPXA 4HNUA 2E6DA 1T99A 4LS2A 1I8JA 2OG9A 2GGJA 4ZSTA 3C56A 3EA3A 2OLHA 2YKKA 4F79A 3H2MA 2ZZ3A 5DLCA 5DT5A 1M7XA 4M7TA 4FOJA 4A8IA 4AY7A 4JAWA 1XW8A 2OSXA 3ONBA 2QJIA 3IEBA 4IFKA 2DVXA 2EXOA 2A85A 4GYKA 4ZQMA 2BVTA 4LVFA 2YL9A 3W53A 1BGAA 3VDAA 3BTNA 4DO4A 2UY5A 5FAJA 1BTCA 1XCWA 1KXHA 2QZRA 3SIZA 1YNQA 3LM3A 2HEJA 3ZYZA 1UASA 4ENLA 1EC8A 1W5NA 3U2OA 2VELA 3TP4A 2J7DA 4WY0F 1A0EA 1EC7A 1HT6A 5TF0A 2BXYA 1FCQA 3ABSA 4H8UA 4TVUA 2PDPA 2CESA 1XIHA 1UKQA 2Y70A 5G4WA 1XGZA 4LF2A 4HYVA 1GQLA 4LJ3A 1CBGA 1IR2A 1MQPA 1A4LA 3FDKA 3BE7A 8XIMA 4A2RA 1GOMA 1BYAA 1Z42A 3VU2A 5K9XA 5KZEA 1W8GA 4GQQA 2QJJA 1X8FA 1TE1A 2VCCA 3U4AA 3RU6A 1QNQA 1VRDA 5CG0A 2GJPA 4OOZA 1OINA 1X6LA 1QATA 1FWWA 1CXEA 4R3UA 4YVPA 4S2BA 2Q3OA 5AC4A 3VOCA 1A53A 3FSUA 3V35A 2V3EA 3GHRA 4DO5A 1SO4A 4AZHA 4IISA 1G67A 3AMLA 3KE0A 1E0UA 3K4DA 2BWGA 4ZE5A 3M0HA 3H4XA 4R34A 3WH5A 4HK6A 3L5AA 4DM1A 2XGIA 1NOUA 5EA9A 3WD3A 3VGGA 1U2YA 3CK5A 1GZGA 3MTWA 2Y6ZA 3OBEA 3S5ZA 5CZJA 2WCGA 4C5YA 3B04A 3CUGA 1TPFA 4E5TA 4Q7NA 4LYKA 1VFUA 4ML9A 2WMIB 2E09A 1W6TA 3H6OA 4MWAB 1I2OA 1J9YA 4LOCA 1B1YA 4JHZA 4V15A 3S2MA 1G7VA 1UWSA 1FKXA 3T2PA 2Y2WA 4YL2A 5C70A 2XFRA 3KOXA 4BK9A 1FFRA 2AQWA 1XIEA 1R7AA 5IBXC 2WM0A 3ZJKA 1JAKA 3WLRA 4M6QA 3KP1A 1TWIA 1VFFA 3WSUA 2UBPC 2FB2A 2VFDA 1UA7A 2CFFA 5A2BA 2EAWA 3UXLA 5CZKA 1M7JA 2E68A 1IEWA 3WQPA 2QT3A 3UJEA 4PUUA 6XIAA 1L6YA 4U2YA 4EANA 4EPEC 5CEWA 3TC7A 1F74A 3B8IA 4V2XA 2Y63A 4C7GA 2XIIA 3UNDA 4LAMA 1J0JA 3BW4A 1V0NA 2VI0A 3IV8A 1I0DA 3AWNA 5D2WA 1GVOA 1FWGC 5AYXA 1W1IE 4V27A 2Z4GA 2PTXA 1I2QA 1V5XA 2FMOA 4XVEA 3UWWA 4P7OA 1ZHAA 1U30A 1I1WA 2RUSA 4A8NA 1KCLA 1E55A 4XSMA 1VLWA 3ITYA 4W9TA 4IF2A 4JIPA 4BR1A 3RUBL 3RCYA 2YL6A 1QUMA 5G4EA 2C18A 3RCNA 3A21A 4MDPA 4ZVJA 2ZTJA 1FVPA 2WHLA 1B3XA 1G9HA 2A7RA 1XFCA 3I4EA 4M8UA 1TJ2A 4PL2A 2RGMA 1ODZA 4KRTA 5D2VA 2ALDA 4JX5A 4C6EA 4UTUA 3B3DA 1P5BA 2B7OA 1UR4A 5A5WA 4DBWA 4F0MA 3DZ1A 4GVFA 1Q6RA 5CQ1A 5FAGA 2PAJA 2ZC1A 1H61A 4DUWA 1AL8A 1NFGA 2HVNA 3RO6A 3SCSA 1OD0A 3HQNA 2CLKA 1EF3A 1FXPA 1YYAA 3VZYA 3PBGA 3HG3A 1SW0A 4OV4A 4Y9NA 3WQ6A 1KC7A 1LTDA 1EP2A 3I68A 2AOSA 3W7JA 3THUA 2GVGA 3EKGA 3WBXA 2OU4A 1HVQA 1H5VA 2RDXA 5H1WA 2Z1XA 4UC5A 4DXKA 2DP3A 3Q37A 3B05A 3BH4A 3QOKA 2D2OA 3UWYA 1M65A 3GTNA 5D37A 4JD4A 2VL4A 4WKHA 4PSPA 2J7GA 4UIOA 3VOJA 2PLJA 4AU0A 3FVMA 3H55A 4JTHA 5AECA 1CNVA 1GPFA 4Y9OA 5IBXA 1KBJA 1M03A 3B06A 4LFYA 1R47A 3PJXA 2IKHA 4IG2B 3GVVA 4JTCA 2NSXA 1UH2A 1TV4A 2OO6A 2A3CA 1EA9C 2NV1A 3MVIA 3FN9A 1EBHA 3DFOA 4IIFA 4Q33A 1Q6LA 3HFTA 2XSAA 2H3BA 1OFBA 5HJXA 1DIKA 2FKPA 2VFGA 1MRAA 1KB3A 4HU4A 4JNZA 4ZCWA 4AXNA 4JNYA 3K4AA 1ADDA 1TTIA 1C9DA 4DHGA 4K3ZA 1TIMA 3VDBA 1R3VA 1WDSA 3PHAA 1EJXC 4J40A 2Z6IA 5KINA 4HSOA 5E0CA 3DGRA 3XINA 4U28A 3P14A 3W7RA 3DGBA 5E9XA 3ZXWA 2A7NA 2E5DA 4C60A 4D6IA 1BVWA 2PWFA 3FW6A 3GDKA 3ZJ7A 2C13A 1N55A 4Z42C 1HUVA 4S39A 4F40A 3ANVA 1UIOA 3E2VA 3PZQA 4GO9A 3OTRA 3RCMA 1KQYA 4HNNA 4IMAA 1MO0A 2CW6A 1TV3A 3D46A 3STEA 2PRLA 4AMCA 2TMDA 3UG4A 1UWTA 3ARZA 2RHGA 3T55A 3LS9A 2WSKA 3UW6A 5A8NA 1KBIA 1OFOA 1FA2A 1L9WA 2ZADA 2CKRA 5HANA 2OYMA 3AICA 4CLMA 1WDPA 1KM4A 4PN2A 1I2RA 5CPLA 1NARA 4QSHA 1LT7A 5LNUA 2V5CA 3JVAA 3B8DA 4TR9A 5ABFB 3OIHA 2FZMA 3KL3A 4JDYA 2HV5A 1IT0A 2BOEX 1N8WA 3MZ2A 4CQAA 2WANA 4W8AA 3VIJA 3STPA 2R6OA 4NVTA 2A4AA 4ZA0A 2CZEA 1A5OC 1XLBA 2J47A 4UZSA 3SY5A 3IWPA 1ZUAX 1G4SA 2V5KA 3ANYA 3FJ4A 3WBEA 5A6KA 1EUAA 2CZFA 4H9XA 1J93A 5DXYA 4PMOA 3UZZA 1VENA 2B81A 1AH4A 1KFKA 3BCFA 3MT1A 1T5AA 2J77A 1YLVA 3QQ1A 4L80A 4DO7A 2VP8A 2HE5A 1KM2A 3SI9A 1G4PA 1GJWA 1EYEA 3A9BA 3LRMA 3BSGA 2V5BA 3QGAC 2EJAA 1QW7A 1RQHA 3V0TA 4TV6A 3L5LA 3W24A 3AHXA 1F76A 3KCLA 5CH9A 3V5FA 1K8XA 2PFHA 4O52A 1A4MA 1CXKA 4ZO8A 3W02A 3WN6A 3R0UA 1FP8A 2ZA3A 1XS2A 3C5QA 4NNBA 3W1TA 3STFA 1AZ1A 3PNZA 2W63A 1NP0A 1J6OA 4M5PA 1Q65A 4P5UA 3URBA 3CIVA 1P0KA 3NO1A 1EDGA 1NIUA 2CWNA 3QMTA 1PUDA 5D8ZA 1QI2A 2FVLA 5CJ5A 1W3NA 5AHMA 1Z48A 3B97A 1TREA 1R3YA 5DMNA 3OBKA 4YVVA 3EWZA 3FHQA 6TIMA 2EPNA 2FDSA 3AJXA 4LVDA 1CX9A 1PCKA 4R85A 4O13A 4YPJA 3QOMA 5IXEA 5FSEC 1BQGA 4FNTA 2WNZA 3CPUA 4HU8A 1BTMA 4EWND 1SYTA 3R12A 4FR6A 4Y6GA 1EJUC 4MIMA 2IS7A 4GY0A 1FWSA 4BJHA 2R1MA 4WDUA 3LMYA 2VGGA 5EGRA 5I03A 4MFDA 1PJ9A 1X6NA 3CUXA 4OUIA 3H2FA 1UPMB 3ES7A 2OZTA 1UD4A 3LHVA 3W85A 5D9OA 1V6UA 1XBVA 2VVSA 2YDSA 3KDOA 2DT0A 4Z1YA 1LRTA 1AH0A 5FF0A 3XIMA 1HZYA 3T0TA 4EP8C 2VDIA 3CMJA 3AO0A 3ZJ8A 4HTBA 3ZJ6A 4JYFA 1G5AA 2W91A 1CGVA 1S5WA 3NQCA 5G4HC 4RNFA 4K38A 1KD0A 3SCQA 2Q01A 5EMYA 1F6YA 1RVGA 2GSEA 5C9UA 5DXXA 5FOOA 3VE7A 6XIMA 4OUEA 2FZ8A 3TOPA 3NQEA 1E0TA 3NDOA 1JCNA 3GE7A 1FKWA 1S5NA 3F4VA 1YEYA 4PTNA 2PBGA 2NZLA 2GWNA 2QKFA 2BASA 3B0UX 4IIEA 4UNKA 3QHNA 3WF3A 1GONA 4ZR8A 1F4AA 4JTRA 1EFZA 3QC0A 3VIKA 4DUXA 4DYEA 1MRQA 3RDKA 3NOEA 1KCXA 1V0KA 1E9IA 1Z41A 5EYWA 4M29A 2NX1A 3GXIA 3G5EA 5EMMA 1GQJA 2NQ5A 3AMKA 1HL8A 2WC3A 3N3TA 5LKYA 1BF6A 5CC3A 4GC3A 1VFHA 3AI0A 3NDYA 4EXAA 4F0KA 2E6FA 4QQUA 5DCBA 4I9TA 4JN8A 3SUTA 3RYSA 3TTSA 4I90A 3GUWA 3T4WA 4PH6A 1W8SA 2RKXA 1OZQA 4P7RA 3N2BA 4QE4A 5KZDA 1CGWA 1QPOA 1TVPA 1F6KA 3AISA 1PZ1A 2OX1A 3A4WA 4TTGA 4ONVA 4W7VA 1W91A 4JTUA 3N4FA 4BA0A 1OC6A 4ZQNA 2BFGA 4CGTA 3E2SA 2QJNA 2PB1A 4AFYA 1O68A 1WUEA 5CBIA 4PMRA 3KOYA 2VO5A 3MSRA 4FLSA 1Q3NA 4ERAA 4ROPA 5I07A 4B9ZA 2IXVA 2WLZA 2OCZA 2QCHA 1KA9F 3HPAA 4UR9A 4I5RA 1WB0A 2FB3A 3W76A 3SCWA 1PIFA 2J79A 3QSTA 2ZZ4A 4AF0B 1QWGA 3C3UA 1BEUA 3E2RA 4DZHA 2ZWZA 4D6DA 1XIBA 4IH3A 1MEHA 2VFIA 3DIPA 5DMLA 4M19A 3W87A 3L21A 2WKJA 1ZAIA 3BZGA 3FJLA 1QNRA 4UFMA 3TE9A 1U5HA 2J9XA 5F4SA 4HA3A 2V2CA 2VTFA 4MWAC 1QNPA 1US3A 2AMXA 5BOOA 2FH6A 4ZOCA 3TJ4A 2WPGA 1JRCA 2JF6A 3B0PA 4N42A 4OKDA 5C0QA 3FIGA 2PDXA 5ABEA 3CT2A 3IJLA 4FR1A 3Q65A 1DQXA 2C8NA 1XH0A 3KCOA 3AZRA 1E3ZA 4Q6XA 1DJNA 4MTVA 1U5JA 1X7IA 1X96A 5DBTA 4EE9A 2ALRA 3SCNA 3NQ2A 2ISDA 4D6CA 2DDXA 5IHRA 1XSJA 2ZXQA 1EJ7L 4ZOBA 1OJXA 3TZFA 3SDOA 1W0MA 1TPWA 3SQMA 1DJQA 2D2JA 3FXYA 2WVVB 4RNHA 3SFWA 3VOHA 1F8MA 1I60A 2I1OA 4CU8A 1AK5A 4GUFA 5HMFA 3P62A 1R8LA 1OYAA 4Z2HA 3O05A 1K8YA 4Z0SA 1XRFA 4XUGA 4XG1A 1LBMA 4KBXA 1Y5WA 1JXKA 3H4WA 3QYSA 3RX4A 4FEZA 4PSRA 3NSXA 3VNDA 3V0UA 3PBVA 4H9UA 2J8FA 2QS8A 4IGMA 2BDQA 3OQ8A 1XG4A 1B3VA 5JH2A 1TR9A 1UD2A 1VBGA 3EX3A 1KFBA 5EMUA 1LLZA 2AAMA 2XFFA 1IGSA 4R33A 3GU1A 8CGTA 4AX6A 1GVRA 4L56A 1OCJA 3CB8A 5G5IA 4LRTA 4RR4A 5I09A 1JZ7A 3QV6A 4GGHA 1A50A 1R85A 4JIRA 3DFPA 4O16A 1LOLA 1MXGA 4Z2GA 1AJZA 3TCEA 3D5HA 3T08A 1SO6A 2PGFA 4AWSA 1NDYA 2O92A 4XX6A 4NQ1A 5CSRA 3POCA 2DW7A 3M4HA 4OWGA 4PCTA 4PRRA 1LBLA 2XN1A 2P10A 4I7VA 1AQHA 4W88A 2XH4A 2R14A 4A05A 1F07A 1GG0A 5M2FX 5C7VA 5LSMA 3QSRA 2Y5SA 5FEPA 5D05A 4J3ZA 4I9JA 3VMOA 3CHEA 1WNOA 3ES8A 1XWYA 3G6MA 1JPDX 1VFOA 3N18A 4W87A 4PC8A 8XIAA 3BV4A 2QULA 2XGBA 3QMRA 3NZ1A 2ANUA 4XZHA 3KVJA 3R10A 1E6XM 5FJIA 5T9CE 4IIDA 2FTWA 3BUVA 5J5DA 3WNKA 3GWQA 2WMIA 5DN1A 3UGRA 1FHUA 3F1QA 4MWAA 4H8VA 4XD4A 3W1LA 3PZ9A 2ZQ0A 3ZSTA 2I7GA 3TYZA 2D0GA 1R3RA 3PBUA 1SVDA 1DPMA 1E56A 1HX0A 4XZWA 1YDOA 5C7HA 4JZ5A 2EKGA 3E5BA 4DY1A 1NF0A 2MANA 3W1PA 3QRHA 1FH7A 5BW6A 1WDWA 3AJ7A 2P88A 2P1FA 1JDDA 2ZE3A 2G97A 3N6QA 5C55A 3AUOA 1TVNA 4WDXA 4DZAA 1F3XA 3QMSA 4O14A 4GINA 1C8VA 3BL3A 1MFUA 3DC8A 2BHYA 3HU7A 3L67A 2OTDA 3GVWA 1MDRA 3QZAA 4X3ZA 3ALGA 2YDQA 3IIOA 2QCEA 3HG2A 3S1XA 2QGHA 4ATLA 8A3HA 4RV8A 1OVDA 3RMJA 3G1VA 3KBVA 4E3VA 4QM1A 3W7GA 1EZ2A 2GUUA 3ZLFA 3VABA 4JTGA 3JRKA 3WZ0E 4UZUA 2IPGA 4HCDA 1AW1A 2RDTA 1Q13A 3VKAA 4MG4A 3B9NA 5ABGA 4JTTA 2NX9A 2ZRZA 5E70A 4NF7A 2YCLB 1QVBA 1H7XA 2BY3A 2QHAA 1T8XA 2PD9A 1L0PA 4US6A 1Z3NA 3TJIA 4TV5A 4RCXA 2AKZA 1UA3A 2ZZ1A 1UR0A 4QAIA 3G24A 5I78A 3PZTA 5FJPA 2HVMA 4D71A 4W84A 2DQWA 4LBSA 2DV0A 4G2DA 2FVKA 1A5NC 5EMJA 4W7WA 2EGZA 1W37A 2OQHA 1XC4A 1XSKA 4XAPA 1OCBA 2FPVA 4G5DA 1CTNA 1LCOA 5L9FA 3H7RA 1Y7VA 1L2QA 4TO8A 4DBUA 4HA1A 2NVAA 4WIWA 2CCRA 4IXHA 3MUIA 3PPFA 2F61A 3PS7A 4GUJA 3CV1A 1EXBA 4DWSD 2DEPA 1NOFA 3J7HA 3VO0A 1EGVA 3B9OA 2OO0A 3SSZA 2J7FA 1QHZA 1CXIA 1LQAA 2ZFAA 1E4IA 3V5OA 3KEHA 3O0FA 1FWIC 4NI8A 1IHIA 2F2HA 2V5JA 1E9YB 1H0IA 1QI4A 3DI0A 3WNOA 3EAUA 2BX7A 5LNSA 4WSJA 4O1BA 4PEKA 3ELFA 3B8TA 1BQCA 2VD8A 5DMYA 3PJUA 3CV6A 3OHIA 3DKLA 3WQOA 3GR8A 1L2UA 2ON3A 2VM8A 5JBDA 1OX6A 4GMEA 1VP5A 5KSWA 4B15A 4QGCA 1VC4A 4JYEA 1J01A 3QVQA 4BQ2A 1OY0A 5JBEA 4LBUA 4MLRA 3R8HA 2OZ0A 3OYZA 1RLCL 4D8ZA 1W1TA 3VNLA 4Y7EA 3AHZA 5CG7A 4IT1A 5CAKA 4ZQPA 1U1UA 4AIBA 3VUPA 1SM9A 1B90A 3M7WA 6TAAA 2B0MA 4DJED 3W74A 3KZSA 3KTCA 3CAKA 3BMVA 4KIEA 4DRSA 3KCJA 1BSLA 2FZDA 2G4FA 4J3XA 3H24A 4BZYA 4WY0B 1WAWA 1EO5A 3F2BA 1T41A 3T7VA 2ZCGA 3W7PA 3U3HA 3R94A 2YBUA 1TUXA 4EPDC 1J11A 4C90A 1WO2A 2FH8A 4GIYA 2VD9A 3DOPA 4M3PA 1OK6A 2GGHA 2R1LA 3A3WA 4FO4A 4C1NB 3PZNA 2B31A 4O0QA 3W3OA 1S38A 3FVDA 4RW5A 5AZ1A 1QHOA 5AYZA 4RPPA 3HG4A 1LG1A 3MCNA 4NP7A 3L4ZA 2PC8A 1A0DA 1JFHA 3C8FA 2Y62A 3F4CA 3SRHA 4ICCX 5CZTA 1UPPA 1EOKA 2FDMA 2HXUA 3WQCA 3HV9A 5BZAA 1RHCA 3P82A 3IUDA 4Q7BA 1H7WA 4GQGA 2Z24A 4J2MA 1TKKA 3BMXA 3VYLA 1OK4A 1KGWA 4QEHA 4KFPA 3GVGA 1J5SA 1EJTC 3R4IA 1EC9A 4PMQA 1ISXA 3CWNA 2ZRWA 2XTKA 4HZ7A 4LC6A 1SFJA 1IEVA 2PD5A 3DHDA 4YXGA 2YLLA 3GXNA 3VZZA 4DI8A 5B7ZA 5HK4A 5HATA 5A6BA 3WLQA 5FF2A 3BAYA 4GHRA 1ZB5A 1UR1A 3ZWTA 1PDZA 5HMEA 1ZQ5A 4E3TA 1RD6A 3INPA 4TU1A 4QISA 5TIMA 2I5GA 3CQHA 1B3WA 4F3HA 1P1MA 4I8DA 4ACZB 2PCEA 4CN4A 4HA0A 3AUJA 3HN3A 3V1HA 7A3HA 3VNKA 3WJYA 1L8PA 2V3FA 5JU6A 5JH1A 4OJYA 1B4KA 3NWRA 3QHOA 1OC7A 2FGZA 5HMSA 4PMYA 4NRSA 1PX8A 1F7BA 3HM7A 1XQKA 4XTDA 2Y7EA 9XIMA 5FIPA 1LF1A 1Q8AA 1CW2A 1JI1A 4GXMA 3W00A 4QJ3B 4KRUA 3CQIA 3WLLA 3ZFHA 2Y4SA 2G41A 4XBJA 4W4QA 4ZO9A 4OOUA 3WQFA 3C2FA 1EQCA 1OHLA 1E15A 2Z6JA 3GFZA 4RXGA 3UA4A 1VEOA 3CUFA 3LTYA 3U0HA 3FYYA 3RK8A 4CU6A 2PGWA 4ADSA 4PB4A 4W8LA 4GI6A 4B5XA 3G18A 3D3FA 3VA8A 2O9TA 1QPNA 1IIHA 2CZDA 2XFWA 4C7DA 1VH7A 3NR0A 5FL1A 5F2MA 1UD5A 3NUKA 1OIMA 3GXTA 4UMCA 2PPGA 3QF0A 5T8GA 2BVDA 3CHVA 3S0CA 3E5PA 3BW3A 3OVQA 4MJ4A 1ITCA 1KO0A 3AYVA 3W23A 4NIRA 3WDIA 3W70A 3NJ3A 2RAGA 1C8QA 3WD2A 2WNNA 3EX2A 3TYUA 3LPGA 1PZ0A 2J78A 1GZJA 3L65A 3FJNA 4Y9AA 5LXEA 2JGQA 3UBPC 3VFCA 3EDDA 2YXXA 1GOXA 2F2KA 4XQ6A 4M51A 4XZNX 2JKAA 5G2IA 4O50A 1E6ZA 5GVJA 4B92A 3E49A 2PGRA 9CGTA 3TYEA 2WOQA 3VDGA 1V6YA 2Q71A 3BAWA 3NXLA 3PTKA 1HKVA 3F4WA 1LLOA 3FKRA 4BI7A 5A8QA 5AC7A 4X61A 3OPSA 3SIMA 4CKQA 2E9MA 3L7RA 2ACUA 3MCOA 3B0XA 4CCEA 4C6DA 3DDMA 4KWOA 2WNQA 1PAMA 4C6IA 4G7EB 1XLGA 3B8SA 3GTHA 1VF8A 4FOUA 3FA3A 2OLSA 5A95A 2NUWA 3SN1A 1MI3A 4FK9A 1XYMA 4S3CA 1M01A 1FCBA 5HUOA 3H2EA 1KXQA 4GFIA 4WCJA 1V6TA 5M17A 4XSLA 1I1XA 3WLJA 5REQB 5XIAA 1TFVA 4MY8A 3QKEA 2ZXDA 3WQ5A 4CNTA 1F4HA 3O06A 3IIPA 1QNOA 3B40A 4EF8A 3EYPA 2VOMA 2Q3RA 3NURA 4XKMA 3DG6A 4GI9A 5I24A 3O7UA 3BGGA 2Z2BA 4IGNA 1ONXA 4CN1A 1JDFA 4GJ1A 5AB3A 1EUNA 1LROA 4GUHA 4E2BA 4RDWA 1MUCA 2GGIA 3ARTA 1K1DA 4D6EA 2J7HA 1V02E 1KM1A 4ZL1A 1E1CA 1W3IA 3YPIA 4A3UA 3DEQA 1BFNA 2YB1A 4L1GA 1EJSC 3ITTA 1H51A 4LUIA 1JZ6A 4L7ZA 4TOQA 2ISFA 2P8CA 3H70A 3WK2A 3RG6A 1J79A 4L4PA 1NELA 2BGNE 3MP4A 3VKBA 3TTEA 4C6FA 1MVYA 5CLWA 3NGFA 5AHEA 5AHNA 3NZRA 4CD4A 3B4UA 3P8JA 2BS9A 4H8NA 2ZX8A 3G1DA 2P8BA 4H7ZA 1TELA 3KBSA 3S5OA 4Z1CA 2P3ZA 5G1MA 4MDOA 3PBWA 1Q2SA 4DI9A 3DECA 3KWXA 2V2DA 3NIYA 2PZ0A 1B3YA 3S5SA 1XINA 4AF0A 3C6CA 2EPMX 4UOZA 2GYIA 1PV8A 1NVMA 4X22A 3KX6A 3ALFA 1ZNNA 5EKYA 1CXFA 1T0OA 1XV8A 4UQBA 2GWGA 3W9ZA 4HPHA 2NT1A 1YX1A 5D2XA 1YE4A 3OGVA 3TW9A 2IPWA 1W5MA 3CNYA 2VZUA 4E4PA 3KHDA 3W0KA 1GW1A 3DBPA 2VR5A 1VIZA 2XSBA 3IJQA 3LYEA 1VAHA 4A8LA 1SGJA 4CVWA 3HQPA 1KM0A 1LRNA 2VUYA 1YXDA 3HPSA 5E1QA 4LU0A 1C91A 3TC6A 2O9RA 3GC2A 4PUJA 3T44A 4UTTC 4QDWA 3T8QA 1QRQA 1ZJAA 4MY1A 2ZYFA 3SRDA 5DY2A 4DO6A 1IEIA 4GFSA 3ZVHB 2DJXA 2VC5A 4S2CA 5LIYX 4QDPA 1T7LA 3GDMA 3LY0A 4XAYA 3AXXA 3E0LA 2Y5EA 4D1IA 2INFA 3AOFA 4F0HA 2PTWA 2POTA 5JBFA 3CUIA 2PDHA 5EPDA 4K39A 4UCFA 2PLKA 2WYSA 5D9MA 1H50A 2C1HA 1H41A 3BURA 2GVYA 3OG3A 4K2SA 4ICNA 4MY9A 3KHJA 5D9NA 1KM5A 5AHLA 3DCPA 4DVOA 1IXQA 3MKKA 1AFSA 4QLLA 2X16A 1L8NA 4C5ZA 1GVIA 2DJLA 4XO6A 4X9YA 4DBSA 3TWBA 1Q2RA 4D6HA 5A2CA 4FIRA 4H8HA 1QHPA 4YU1A 3WMSA 2JIWA 3CPGA 4XKYB 4GNJA 4JIEA 2Y7FA 4H7CA 5K2ZA 3W1XA 3M5XA 2PP0A 1V51A 4LXFA 3M7SA 3RM8A 4QNEA 3O6AA 4Y90A 2PRHA 4FNRA 1QI0A 2UY3A 3VCRA 2WQDA 4AWUA 4NKCA 3OU8A 1C7TA 3UZ5A 3B0YA 3N14A 4B9YA 4RNJA 3C2VA 5IDIA 1E6PA 3NA8A 3BW2A 5B80A 3CASA 4JTKA 4CCZA 3LENA 3L4YA 1S3TC 3GG0A 3GG1A 1W56A 4RZBA 4FF5A 3FY1A 3S1GA 3M0YA 3LPFA 3WJSA 5BMWA 3R43A 1Q8JA 1NWSA 3LTPA 4BF7A 1C93A 5D30A 4YCOA 7REQB 4FZIA 4NU7A 2QQ6A 4WOQA 3IJ6A 4QCEA 1W1YA 3UY8A 1YADA 3MYPA 4H2CA 3UR2A 3QFWA 4C6CA 1J4EA 2YL8A 2O9PA 1ICPA 3UVIA 3GLCA 2ZZ7A 4L1WA 4B2DA 1F61A 3AIRA 1GKRA 4GC4A 5CCZA 2J9YA 3QKZA 4HHPA 4H1ZA 5HR6A 5AVNA 3G1FA 1UR8A 3W07A 3IJ9A 1XG3A 1UJPA 3BOLA 3C2YA 3ZO9A 4UTTA 4K8HA 3LRLA 4K1WA 5AYIA 3Q67A 1C90A 3PG9A 5D02A 2PE4A 3S5YA 1AL7A 4O10A 1KWKA 4QP0A 3LHUA 3MQTA 1CECA 4XZLX 3EPMA 3V5CA 2XZ7A 3GX9A 2BB0A 3W7LA 4S3GA 3LDVA 3LCGA 3M0IA 1QW9A 1K7FA 4ASTA 4JKKA 4UTLA 3C0LA 4HN8A 1NEYA 4F0SA 1P0NA 4JTQA 1R3WA 1B4EA 2DORA 2B7NA 3APYA 1PEZA 5CPMA 1S1RA 4UQEA 2B7QA 5GNXA 3EXSA 3WH9A 1REQB 1YMYA 4AY8A 2X1TA 3L12A 1W2PA 5CGMA 1KCKA 4AY1A 4KKXA 1PWLA 1B9ZA 3WD0A 3AC0A 2ATMA 4IQJA 1VHCA 5BYWA 2D20A 2IPFA 4M6PA 3FV9A 1RR2A 4YNGA 1PX4A 3D0CA 1EHNA 3LBCA 3D47A 1FWCC 2ASHA 3MUY1 1IZCA 3U48A 3WL1A 1Q6GA 3W01A 3NL2A 4N7QA 3CJPA 1QTWA 1JYXA 4RE3A 4L1XA 2CLEA 3ANUA 3CL6A 1P6BA 2W62A 3SQLA 1JDEA 3GU9A 5A6SA 3KOFA 5FSDC 2W27A 2WMJA 1ZGDA 4FXRA 1W1B1 1XJBA 3NO3A 4HBKA 4JQAA 2EPHA 3UD6A 2BZNA 1N82A 4AD1A 2Y85A 1WCGA 4Y8FA 3ICJA 3GNRA 1JYNA 3GG7A 3OGRA 2ZUMA 2J88A 3CH9A 1K4HA 1S2VA 2TAAA 1RQEA 3G77A 4K6AA 1VBUA 4XD6A 5CJMA 2QCCA 4B90A 4AZCB 2EKCA 1FWRA 5FKYA 1DJZA 1JGIA 4U3AA 3GH7A 3VD4A 3T4CA 2G3JA 2YGYA 3UXKA 4JQ2A 4NRRA 3GXPA 2VQTA 5ECUA 5G2HA 2HDJA 3WEZA 1TV5A 3T6CA 3SSJA 1RLDA 3I6TA 3RM9A 2AAAA 2E5BA 4WHBA 4EPBC 2E28A 3KTSA 4YLWA 1XH2A 4NJJA 1KRAC 5H2ZA 3N04A 1XH1A 3WQWA 1JUEA 4ORMA 3LN3A 1PS9A 4I7UA 2ISSA 4PFHA 4A4AA 3CAWA 1Q4WA 3N3MA 4X2PA 4FLOA 1GTHA 1UJQA 1SR9A 2H9AA 1Q63A 4PCPA 1O66A 5C2GA 3BLKA 2O4MA 2ZA2A 3VAVA 3GC5A 3FDGA 3CUHA 4KEZA 4W5ZA 2WW5A 1DQUA 3O07A 1ESWA 4CU7A 2OOFA 2WAGA 3WLIA 4C1NA 4KS0A 4C91A 3SY1A 1JDAA 2A3BA 1UC5A 5I3DA 2O55A 1TTJA 4UOJA 3F03K 1UWIA 1E1FA 3TW6A 2RGLA 2WMGA 1E4NA 2TRSA 3LD5A 1W9PA 1K8CA 1RSCA 2RH9A 4IPIA 4D6GA 3Q2DA 1LWHA 2GJLA 3VD7A 3ITXA 2HPIA 3S6OA 5BXTA 1WOBA 4OFCA 1K7XA 3RFAA 3CLMA 2Q8LA 4R9OA 1JRBA 2W5FA 1UH4A 2CBIA 5JQ9A 1LORA 4CNSA 4JL1A 3GYEA 2WHKA 2CZVA 2Y7DA 4JCLA 1UP0A 4LEQA 4DWSB 1VBRA 3IIZA 1NWRA 3IJIA 1NJJA 4ATDA 5IFTA 4QJ1A 4HMNA 3KL5A 2WKLA 4KWSA 4K1GA 4H19A 1A3WA 3A4JA 3B8WA 3CL8A 4RLIA 5HAOA 3BLLA 3PBMA 2YOCA 1SJBA 5AVHA 3C2RA 1EQPA 1TWSA 3UFYA 2UY4A 3UGVA 5I3GA 1PKLA 4GVGA 2ZDSA 3REQB 3M1ZA 4GABA 3VX0A 3O2LA 4JFUA 5C9RA 2VCAA 3TCSA 2CPUA 3OVPA 4GD0A 4C6JA 4F2BA 2VC9A 5KITA 1OBAA 3V1PA 2J62A 4HNLA 2DIEA 2WQPA 4LUTB 2J8GA 4J27A 4MOZA 4ZB0A 1M41A 2JGYA 3EDEA 1CWYA 1K02A 1MEWA 2WMHA 2PP3A 5C71A 4HGXA 1VRXA 4HSHA 5FACA 3WH8A 4IIGA 4QG6A 2XVKA 1XDJA 2Z1BA 3MDUA 4LANA 2XM1A 3IIVA 2XJ7A 3WELA 1BWKA 3GBDA 3MANA 4JY8A 2D73A 3WNLA 4CVUA 4B3KA 2Y24A 7PTDA 3NVTA 1CZ1A 1QOXA 1AQFA 1NWUA 1WXJA 3PSWA 3N17A 1LDCA 5DCEA 3SB0A 3VCNA 1BRLB 2BHUA 3EMZA 5IM51 3H54A 1KRBC 4YTQA 2C14A 1Q4NX 1TTQA 1VPQA 4GVHA 3P0WA 3WMBA 1E70M 3WMCA 1AW2A 2G37A 2D3NA 2VGIA 2YBTA 3SCRA 2RDWA 3ME3A 4YTTA 4FX8A 4WJ8A 3GQYA 1IXNA 2ZRUA 3BK0A 1V77A 1OD8A 5HWNA 3UYIA 2OT1A 2PURA 3GC4A 3PWGA 1BXBA 2PDKA 4NZ3A 2IQ0A 3FXGA 1RP8A 1SUXA 2GGEA 1YBQB 1SFSA 1XP3A 2YA1A 3LMZA 1TX2A 4OT7A 2WZEA 3PJWA 1VCGA 1E6RA 4ZXOA 5F7UA 3NM3A 4PMNA 2HCVA 2HK0A 5DANA 1QU4A 2XINA 2E7FA 2VC7A 3NL5A 1EEXA 1I6NA 1RBOB 4LAOA 2VQUA 2VCBA 2ZTKA 3B8VA 2I56A 4PBFA 4IFRA 1ONWA 1Z89A 1R5YA 3W6MA 3NZGA 3WH7A 1K7EA 2V9DA 1FP9A 4TX9A 3UESA 1UROA 3GNPA 1EJVC 2X7WA 3AXMA 3GSMA 5HR7A 1DJIA 4H9YA 3U5YA 3I3EA 3RX2A 2XZ9A 3FJ6A 4GNKB 4BF9A 3E12A 1VLIA 4HOXA 3GDBA 3EGJA 3OA5A 4QXIA 1Z9AA 3DHFA 3M0MA 1IWPA 5SWUA 3S4TA 4NZ5A 3P74A 3WMLA 3JUGA 5HULA 5TQLA 1ZFJA 3WF0A 1SZGA 2GJXA 3WF2A 3MV11 5C9XA 5HUPA 1XL9A 4JIHA 1FTXA 2X2YA 3T9PA 1Q6EA 5BRQA 3ITLA 4GNVA 2GSHA 3BGJA 1F3TA 5LIXX 1R3TA 1TJ1A 3NQDA 1YXCA 3KFTA 2GSJA 4D1JA 3MC5A 1J2WA 3MY9A 4BI5A 4DLMA 2XIMA 1H49A 1TYGA 5FJTA 1UYQA 4DBEA 1AVAA 4RX0A 2VFEA 2QCDA 5FCZA 1UZDA 1NWTA 2E9BA 1RJRA 1JQXA 2VX4A 3WJXA 4FA3A 2V6AA 2HWGA 4AW7A 5CC7A 3DH7A 4WZHA 4YCPA 1BWVA 4IX0A 4PZVA 3DX5A 1ZJIA 3RO8A 5BU9A 3GFYA 1KWGA 3LHZA 4US5D 3VKJA 4FPSA 1O6IA 3EKZA 1NU5A 1K4GA 4LVGA 2EG6A 5BMXA 1EP1A 4U10A 5TNVA 2CIPA 3VGBA 3GHSA 4PRTA 3ZT5A 4HJFA 3EZ4A 5A8GA 1OT2A 3CZ8A 1PZ2A 3K8KA 4FNQA 1BD0A 3DFQA 3LZ5A 3BG5A 5I77A 1UUMA 1XBYA 2UWFA 4S3BA 3A9IA 3E0VA 3CHCA 1JUBA 4P7NA 3UWUA 1EGMA 3EX1A 2PP1A 4CD7A 4ADTA 5AZ0A 1BVZA 1TV7A 4O12A 4L9YA 3PFRA 2W6RA 1E6SM 1H1NA 4G1NA 4J7RA 2PWEA 3LHYA 1FH8A 4UFLA 1SZNA 4KCTA 3CV7A 4NNCA 4Q4QA 1ME8A 3W7QA 1TWZA 3VM7A 1POJA 4QAWA 2BHZA 2XISA 4UXDA 3PP7A 3VE9A 3QTGA 3PUDA 1WPCA 2YX0A 3OHMB 1LUCB 1QNSA 4PTXA 3UWEA 3CC1A 3MDWA 1V6VA 1BHGA 1V4YA 3UA3A 1OX5A 4LX4A 1KFWA 2VZSA 3LUTA 3QQWA 1XD0A 1RPXA 4FB7A 2DZBA 3T0CA 2HNHA 3GK0A 2OYLA 1ZU8A 3I3BA 1GORA 3RLHA 1N8IA 4Y8EA 2AKMA 2DPEA 3W88A 3VC5A 3VD5A 4ZO6A 3W75A 2BXZA 1OSEA 4KMQA 4B5NA 2R94A 3GDRA 1C92A 3SCVA 5D2TA 3QV8A 4IQLA 3LNPA 3DBNA 5BRPA 1JPMA 5DX7A 3TDFA 2QCFA 4WJEA 3VILA 2MUCA 1LL6A 3G8EA 1XYZA 1UR3M 3UNTA 4QQ3A 1E73M 3ZMRA 3K2GA 3VK5A 3UPMA 2VDHA 4DZIA 1C8XA 4M6VA 4AVOA 5FJUA 4PUKA 3CMFA 3N1AA 2CWXA 4L65A 3CL7A 2QMKA 2QUMA 3E2QA 4AEEA 3R13A 4UNLA 2E5CA 2WB5A 1RV8A 1J10A 4M0XA 4TXEA 2A3AA 2YPIA 3UERA 1WV2A 3VDHA 3QN3A 2PS2A 2GK1B 1OG0A 2ISWA 4BQ4A 4LY8A 4LS1A 1S2WA 2V67A 3WD4A 2IKGA 1LWIA 3LGGA 5GNZA 1H60A 1A49A 1M1BA 1PZ3A 1C9WA 1GHSA 1YIXA 1XSIA 4GKTA 5K4ZA 3KRBA 3EOSA 3VMNA 4DIAA 5PTDA 4A35A 5CPQA 3LXBA 3TVAA 4ZZ9A 3LBMA 4GWEA 3VIMA 3RAOA 4AB4A 1PTAA 1PIIA 3SRKA 3TMLA 2C16A 3D6NA 1JZ8A 1NSJA 3DU0A 2W3ZA 1J8VA 1LZOA 3SUUA 4AIOA 3MCMA 5FF7A 5JVLA 4N4PA 5DRIA 4QHRA 3UXAA 1TPB1 2QMJA 1TO3A 3P5ZA 3IJDA 1DIDA 5D32A 4BQ3A 1V3HA 1IF2A 3RITA 1SJAA 3R5EA 1JZ3A 3TW7A 3WK1A 1GVSA 3IACA 4GCAA 3E0WA 4I6KA 3RPDA 4POCA 1ZCOA 3STCA 4U5KA 1W1PA 2SFPA 3O9NA 2HSAA 5AKQA 1PSCA 1P0DA 3S8HA 1OEPA 1W17A 3CS2A 2A2IA 5U7SA 1UKTA 3JS3A 4B3LA 1OF8A 2WVSA 3W81A 4JTLA 2AGTA 1WBHA 3W29A 1VZWA 3JZEA 1V0MA 1KTBA 3BLEA 1QPRA 4DZ5A 3G1HA 4JICA 2WM1A 4XZ9A 2JE8A 2VEKA