4TMBA

Crystal structure of old yellow enzyme from candida macedoniensis aku4588
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
390
structure length
390
Chain Sequence
b'YMNFDPKPLGDTNIFKPIKIGNNELKHRVVMPALTRMRAIAPGNIPNTEWAEEYYRQRSQYPGTLIITEGTFPSAQSGGYPNVPGIWSKEQLAEWKKIFNAIHENKSFVWVQLWVLGRQAWPEVLKKEGLRYDSATDDLYMGEEEKERALKANNPQHGITKEEIKQYIKEYVDAAKKAIDAGADGVQIHSANGYLLNQFLDPISNNRTDEYGGSIENRARFTLEVVDAVVDAVGAERTSIRFSPYGTFGTMSGGENPGIVAQYAYVIGELEKRARAGKRLAFIDLVEPRVTDPFLPEFEKWFKEGTNEFIYSIWKGPVLRVGNYALDPDQATLDSKKPNTLIGYGRSFIANPDLVYRLEKGLPLNKYDRNTFYTFTKEGYTDYPSYEESV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Old yellow enzyme
publication title An Engineered Old Yellow Enzyme that Enables Efficient Synthesis of (4R,6R)-Actinol in a One-Pot Reduction System
pubmed doi rcsb
source organism Kluyveromyces marxianus
molecule tags Flavoprotein
total genus 142
structure length 390
sequence length 390
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4tmbA00
1GEQA 3W87A 4BFAA 3TE9A 3LCHA 4BI5A 3M0ZA 3HG2A 4FHAA 4UTWA 3MHFA 4Y9AA 4WUIA 4X2RA 4MZYA 4HNTA 4I7VA 1TMHA 2WNZA 4IMEA 1P5BA 2ZA2A 3LLFA 5AHFA 1VLWA 1TV7A 5D2WA 2YYTA 1JQVA 4WX2A 1NAL1 3DBPA 3LGEA 3UD6A 4ALDA 1ZENA 3T55A 4X9SA 3TQKA 4NXSA 2YW3A 3NQ2A 5F4SA 3BW3A 3LRKA 3LHZA 3PUEA 4PH6A 3K30A 4I7WA 5DCEA 1LRTA 3G24A 1F6KA 1S5WA 3B06A 3U2OA 5K7JA 2WQPA 2RKXA 5LGZA 2NXHA 3L68A 2G97A 4GWEA 3PY2A 1H63A 4JD4A 3UPBA 3W71A 4XTIA 3A5VA 3TSBA 4JTUA 5U7SA 5C54A 1F5ZA 3ABOA 5C55A 1FWRA 1ZAJA 3BGJA 2A7RA 1DVJA 5DXXA 1XUZA 1TSIA 3S0CA 2X1UA 2A6LA 5L9FA 3IIPA 2I1OA 3MBDA 2ZA3A 3MHGA 1C9DA 4BF9A 1GYLA 2ZZ5A 1D9EA 5F4WA 4EWND 3CHVA 4LVAA 1W54A 4XWUA 5CPOA 2Y7FA 2E5BA 3L5LA 4LVBA 3W2UA 1B9BA 4M19A 1HO4A 3PBUA 4NX0A 4O1DA 1KFJA 4WJEA 2P10A 4MKNA 4JX6A 3A22A 4MZ1A 1GWJA 4NJKA 5AFDA 1TV8A 3GK0A 2E09A 4QAIA 1OFAA 3THAA 4IXHA 1CI1A 4LS1A 3TKFA 3O6CA 5D04C 1DJQA 1QPQA 2ZFAA 3W3OA 1H7XA 3PS7A 4MFEA 4OHQA 1ZNNA 3G3MA 3PB2A 3NR0A 3FFSA 3M16A 1YDOA 2ABBA 4RKAA 3TAKA 3CWOX 1DJNA 2ISVA 2OZ0A 3WJSA 4UTKA 2ZZ7A 2YXGA 1WOBA 1YXYA 4ORIA 5D38A 3UWVA 3HB9A 2NWRA 3C3NA 4CQ8A 3NO5A 4L4LA 2GQ8A 4Z1AA 1RR2A 4JTIA 3UPWA 2Z2UA 3M43A 3LERA 3IGUA 2C13A 1JCLA 1WBJA 2QCGA 4MJMA 3N2XA 2NLIA 1KTNA 2Y88A 1GT8A 1S5TA 4OQVA 4JX4A 5I3HA 4BWLA 5TQLA 5KSWA 2DZUA 3W1XA 2QCNA 1PL9A 1SW0A 4MFDA 4GUFA 3USBA 3IRDA 1OVDA 3FS2A 2WOQA 1EP3A 2OX1A 2VC6A 4R7JA 5CG7A 5FEWA 5D32A 4CNOA 3S6DA 3INPA 2X30A 1VLIA 3M44A 5CZJA 1Q6OA 3F4WA 4DELA 1LP6A 5FF0A 3A23A 1ICSA 2A2IA 3PBVA 4HHPA 4FIQA 1JULA 4TMBA 3NXFA 2VXNA 5D02A 2FTPA 4MLJA 1ICQA 1CX9A 3WK3A 3G18A 1A5SA 1PE1A 3NPWA 1CW2A 1KM2A 1O5KA 3W1MA 1ME9A 2FDSA 3L65A 1Q3NA 2ABAA 5DLCA 1R30A 4EF8A 4AEOA 4LT9A 4IWWA 5HQEA 1ZY9A 3PF3A 2QCDA 3BG9A 2A6NA 2QCHA 1H7NA 3S1UA 3M5XA 1R2TA 5G1YA 2GQAA 4TR9A 1O94A 2WSYA 3M1ZA 2TPSA 1SO6A 1G4EA 1BEUA 3BV4A 5BW6A 2QKFA 3C2FA 1DKWA 3M5YA 5DCBA 4DF1A 1W3NA 3FJ6A 5CPMA 1W3TA 3W74A 3BLFA 1GVQA 1G4PA 2C1HA 3WK1A 3T4CA 1G4TA 1VCVA 1QMLA 3C0JA 4NJGA 3MYPA 3NOEA 2BLEA 2E1DA 3W75A 4CCCA 3GIYA 3D0CA 1Z41A 1M7OA 4R53A 2VFEA 5A5WA 5HWNA 4ZVJA 5K9CA 2ZBTA 1M6JA 1AG1O 5H2ZA 2DZTA 3DFOA 3EX4A 1YDVA 2PC4A 1K8ZA 1EWDA 4O50A 6ALDA 3MMTA 3L5AA 1LYXA 3UWWA 3WK2A 5LNRA 3CEUA 1TTQA 2XN2A 1TJRA 4FEZA 3BLIA 2R91A 4YCPA 3HMJG 3SIZA 3SSJA 3M9YA 4HNVA 1H60A 1FDZA 2RDWA 4UFMA 3NQEA 2E77A 1SSGA 2V2CA 2VELA 1R2RA 2ATSA 4O1AA 4N9BA 2E6FA 4QM1A 1K02A 4GBUA 3TNOA 1EUNA 5F1UA 1HFBA 1XDLA 3NQ7A 3G1HA 3CWNA 1XM3A 4GUJA 3QW3A 2QJHA 3A9IA 1K3UA 2VFIA 3W7OA 3FLUA 3S5YA 4HN4A 1YXDA 4ZQRA 3PVFA 1I2RA 3DFTA 4JX5A 4N6EA 3LLDA 4RJEA 1OK4A 1H7WA 1YXCA 3W1AA 1I2PA 5G2HA 1RV8A 1KW1A 1JCYA 3TSMA 3SGZA 3HG5A 1C29A 2C6QA 4N02A 2E6AA 3LBMA 1OK6A 2H8XA 2J88A 2V8ZA 4XUGA 4RXFA 2A7NA 3HF3A 3GXPA 2PE4A 1MSSA 4Z1DA 1DL3A 4IMGA 1YADA 3HGSA 3I68A 3KVJA 1DBTA 5DCDA 3WJWA 4FO4A 1OABA 3E0IA 1IF2A 1VCGA 4AWTA 1RQEA 3TFCA 1V7YA 3GR8A 3P7YA 1OFRA 3I7QA 4O8RA 2W6RA 1UB3A 4YWIA 1SZNA 5FF2A 1KM0A 1VH7A 3LCXA 1A5AA 2NZLA 1L9WA 5CSSA 2G95A 2Y70A 3FA5A 3BK0A 2EAWA 2QUTA 4NNBA 4QQ3A 4RXGA 1O4UA 3NQCA 3IGSA 3TC6A 1I2NA 4OV9A 2E68A 1HTIA 5EMUA 3R89A 3S1VA 4FNTA 2ZTKA 1OJXA 3EKZA 4RZ4A 3DHFA 1L6WA 1VYPX 4PEKA 2A7PA 1EX5A 3HJZA 5F2IA 1FQ0A 4MUZA 3PWAA 4K8EA 4WY0A 4HT3A 4LOCA 2NUYA 3PB0A 1IXQA 1GYNA 3NZRA 4QNEA 1OFPA 4GUGA 4WD0A 2BXVA 2A0NA 3N2MA 4HSNA 4ZQPA 2A21A 1YYAA 4O19A 1K8XA 2Y7EA 1G67A 4ZZ9A 3O15A 4M6QA 1NF0A 1GZGA 1ZCOA 1W1ZA 3LM7A 4RZ5A 1UASA 1TIMA 1B57A 3QW4B 1B3OA 1T8XA 2Q3RA 3MWAA 4M6PA 5AHNA 1AMKA 4JDYA 4JTKA 4XBSA 5AC6A 5KZEA 3ZWTA 4YXGA 1V5XA 4GNJA 3PSVA 2PRMA 5K9DA 4IGHA 2X1SA 1Y0EA 1WQ5A 3DXIA 1TV5A 5KITA 3T44A 1M7PA 3TU9A 4N9EA 2X16A 4AF0A 4OU1A 4UXDA 1RVGA 3BW4A 4BR1A 3DKLA 2Q3OA 5E93A 3THQA 1F05A 1SPQA 1P0NA 1EPXA 1JJKA 3G1DA 3W1LA 1JVNA 2CZDA 1F74A 1LZOA 4NT0A 3VCRA 5EA9A 3KHJA 3W1QA 3KFTA 3MUXA 3EX2A 4AHOA 4Y6GA 1BWLA 1XFBA 2DZSA 4DPQA 3C61A 1SSDA 1VC4A 3GDKA 3TXVA 1L2UA 4KKXA 4KFNA 4P61A 5FEPA 1F76A 1OF8A 1T99A 1ME8A 1N55A 3LXBA 1VZWA 2XFWA 3HG4A 2FB2A 4LRTA 2NUWA 5EBUA 3M41A 4LS0A 4XTDA 4E38A 3PC0A 3W85A 3W7RA 2NUXA 3KAOA 1P0KA 4UR7A 3W22A 3W7IA 2Z0IA 3SZ8A 1L6YA 4Q4KA 3N9SA 1OYAA 2PCQA 1TCDA 3C2VA 1FDJA 2JK2A 3BG3A 4AB4A 2NX1A 1RPXA 1PHWA 1LTDA 1XUUA 3IGXA 3OBKA 1FUYA 3UZ5A 2VFFA 3CC1A 2F7FA 4U4MA 4BWLC 4FNUA 4IX2A 4S2CA 5EL1A 1KFBA 3EXTA 1TTIA 3OIXA 3IIXA 2CLHA 2EKCA 3P5YA 1W5QA 5E0KA 3OVPA 1TPVA 2BTMA 4LV9A 4DO4A 1KFCA 3OVQA 3KRUA 3KVKA 4UFLA 4AVFA 1H61A 2NV1A 1GOXA 3NL5A 3RNDA 1I8JA 4RX0A 1QCWA 1H7RA 3FOKA 1JCXA 1H51A 2P0OA 4UFKA 3LI1A 3QPYA 1LRNA 4FIRA 3HGJA 4NQ1A 4ZL1A 1TO3A 4BK9A 1TPB1 1LOLA 3CB8A 4MYAA 3HPZA 3UWZA 4WXYA 4E2BA 3W83A 1MO0A 4R34A 4O1BA 5FEXA 4JS3A 3KVMA 1PS9A 3MI6A 1F7BA 2WSQA 2VKZG 3O63A 2RHGA 1I2QA 1TPC1 1OFOA 2O7SA 4UMAA 3HG3A 1FXQA 4G1KA 2VFHA 3TCEA 3LRMA 1K8YA 2CWNA 1LLWA 5L6UA 4DF2A 2GVGA 3IVSA 3RF9A 2V2DA 3ZS4A 4I7UA 3T40A 3UWUA 3QC3A 3C4UA 1Q6LA 1LM1A 1KM4A 3HO8A 4NNAA 1LCOA 4FB7A 3N19B 2A4AA 4JTHA 4LUIA 5E1QA 2DP3A 1D3HA 3CU2A 5IBXA 3T78A 5C6MA 2QCCA 2W79A 4X3ZA 1WXJA 4MOZA 3JRKA 4NJJA 3P60A 3DGRA 4I9AA 1QNVA 1LBFA 4JR5A 2E5DA 1RZMA 3BPWA 3GNNA 3MI3A 4WZHA 1SO3A 4ADUA 1VHCA 5C2XA 2PRHA 2G96A 4LS2A 3NL2A 5G5IA 4UTTA 1KM3A 4TU1A 4O28A 1KFKA 3W7MA 4HNNA 3QEZA 2Y6ZA 5D09A 5D2VA 4IQLA 4K39A 1GQNA 4UFJA 1QWGA 3CQ0A 1LLZA 5K4ZA 1Z48A 4HSOA 3M5VA 2GJLA 2A5HA 3SR7A 3ZFHA 3EB2A 3TW6A 3W23A 3B04A 5G4WA 5CZ0A 4CCEA 3DENA 1OG0A 2OT1A 5I3FA 3SY5A 1SZFA 3LRLA 4WQ6A 3O6DA 3TV8A 1TYGA 1KV8A 3Q37A 3NA8A 4FNQA 1S5VA 1GJPA 3LHVA 3ABRA 1JCNA 1O60A 2RH9A 3JR2A 2UV8G 3FYPA 1MEWA 4OWGA 3QQ1A 2ZRZA 3B03A 1SFLA 2ZRXA 5HR7A 1U83A 3TXZA 2I9EA 2NX3A 1UUMA 3W2MA 1OYBA 1KBIA 3G8RA 2CZFA 2ZYFA 2GQ9A 4JTSA 3SI9A 3TSDA 4RV8A 3W7GA 4BI7A 3LBCA 2TSYA 3O07A 4GUIA 5HWMA 4J9JA 4LW7A 2B4GA 2F84A 2WPBA 2OJPA 1QO5A 3S42A 4UTJA 8TIMA 2P1FA 4K37A 1SFJA 4D2JA 1JCJA 1PHQA 2ZCGA 3O1NA 3HOJA 4A29A 1TJPA 3GAYA 4N6FA 4NX5A 1LROA 1SZGA 2NX9A 1QAPA 1EEPA 1O5XA 5AHMA 3QSTA 3W07A 3MHUA 4CLMA 3STEA 2KZHA 3MO7A 2H90A 3NVTA 2GUUA 4H4IA 4M7TA 2CLOA 5I3KA 3DFQA 4HPXA 1G7UA 4JDBA 4MY8A 2YR1A 4EOUA 3R12A 2VEIA 1Z42A 1KBJA 3GDTA 2YCEA 3L0GA 4GE8A 1GVOA 1SW3A 4Q32A 5LHFA 2QCLA 2W0UA 3W7LA 1DQWA 1HG3A 1ICPA 5KZMA 1FCVA 2WO5A 3HBLA 1NVMA 5DBTA 3DU0A 4KWWA 1F73A 3MBFA 4K7VA 3G1XA 4A21A 3NZ1A 3NL6A 4Y96A 5MHBA 5I3IA 4EVZA 4MYXA 4O4VA 4XZ9A 3U8GA 2YFOA 4KFPA 1G4SA 4AXKA 3L67A 2YDAA 1ME7A 2ZRVA 3W7QA 4FNRA 3W76A 3LXAA 5HNRA 1AW1A 4JN6A 3C8FA 2XN0A 2H8ZA 4FX7A 1XBVA 3FKRA 1VR6A 3C2RA 3W1TA 1BKSA 3DI0A 5LNWA 1K7XA 2ZRUA 4FNSA 3W1NA 2YYUA 2QCEA 1WX0A 3PBWA 2FFCA 2OT0A 2VENA 3G3DA 3P5ZA 4TX9A 4K36A 1G7VA 3NQ8A 4XKYA 1RQHA 1WOAA 1P1XA 3NYZA 3IIZA 3LB0A 5TBOA 1SU5A 5D05A 1OX4B 1SUXA 3ABSA 1G6CA 5TIMA 1SZEA 3W9ZA 5KINA 3UY8A 1K03A 1I4NA 3S5OA 4RZ6A 1UBSA 4E0CA 1VGAA 4ZQOA 5LKYA 1LBLA 4A3UA 3NPXA 2ZZ2A 2YZRA 4B5NA 1DHPA 5AN7A 1YTKA 2VEKA 3EKLA 3EWBX 3V1PA 1WAUA 2QDHA 5U4NA 3P67A 3QMTA 3GDLA 4GXMA 1ZFJA 1FCBA 3WFAA 3CIWA 4LC8A 2WNNA 2AQWA 3P74A 1J2WA 3PSWA 1FCUA 2FLIA 1H7PA 4A2RA 1TB3A 3STFA 3B4UA 1YTDA 3DZ1A 2RFGA 4MIMA 3TMLA 1N8FA 2JKEA 3EXSA 2QCDB 3C2OA 4K38A 1XI3A 2R8WA 3O06A 2FPYA 5H91A 3A24A 4Y8FA 1W8SA 2NXIA 3H53A 4LNYA 3S5ZA 3E96A 3S5NA 1VPXA 5LGXA 1O95A 3TJLA 4JIQA 1YDNA 2V82A 3N3MA 2CLEA 1GVRA 1WDWA 3LV6A 1Z44A 4QIUA 1G69A 3UXAA 2B7QA 1TPEA 4OV4A 2ZDRA 2DZXA 4GJ1A 1KM5A 3TROA 4C1LA 4UUIA 1XL9A 1OX5A 5T26A 4MVAA 3E02A 4UNKA 4Q33A 1M5WA 4ADSA 1W0MA 3TC7A 4P2VA 1FX6A 1W3IA 2WV8A 3C52A 4LV4A 1T96A 1MEHA 1EP2A 4N9DA 3BW2A 4JGDA 1W5MA 3QRHA 4H3DA 5IBXC 1TRDA 3M47A 4WY0F 1LBMA 5DY3A 3HIJA 3PUOA 5BOOA 2FPVA 1VHNA 1KM6A 3B0UX 1H5YA 1MXSA 4AAJA 5DBUA 4UFHA 5DY2A 3MI2A 4UTTC 1KLZA 1A50A 3GNDA 2RDUA 5FF4A 3WK0A 5AHLA 1XBXA 5BRBA 4ML9A 3UNDA 3TQVA 1HO1A 3WJZA 3EWUA 4IPIA 2NWSA 4O10A 4QSHA 4EIVA 3NGJA 3NQGA 5LZLA 3LDVA 4DO6A 1ONRA 3NM3A 3I6RA 2YSWA 1IGSA 3W86A 3LCWA 4ZQCA 1X1OA 1TQJA 3O6YX 3NAVA 2VFDA 1JR1A 4ZQMA 1LORA 3LHTA 4CQAA 5HMSA 4FXSA 2CLIA 3NNTA 3EWYA 3G0SA 3F4NA 3B05A 4JTFA 5EPDA 3DFPA 2GOUA 1OF6A 3W7PA 1RQBA 4OT7A 3E9AA 3NL3A 4LC6A 3TK7A 3IV3A 4K7YA 1WBHA 3AO0A 2QJIA 3OEXA 4ICNA 3L0KA 2C18A 3MP5A 4M5PA 5HULA 4AHPA 2GVJA 3QSRA 2Y7GA 2QF7A 3LTSA 3N9RA 4M7SA 2JBMA 1THFD 4TO8A 1W56A 4RR4A 1DV7A 4Z0JA 3KVLA 5SWUA 5DN1A 1GVFA 5CKSA 2V2HA 1BWKA 3OG3A 3R5EA 4UCGA 3P82A 4LY8A 3IIVA 4YLWA 3FEMA 3P62A 5EKYA 3DAQA 1ADOA 3HQ1A 3EX1A 3QJAA 4WY0B 5K4XA 3NPVA 2CZEA 5ABTA 4UTMA 3PAJA 4NJHA 2TMDA 1VQTA 3TAOA 3NM1A 5A8GA 3EXRA 3STCA 2WKJA 3QMSA 4ADTA 1KM1A 4YCOA 3CIXA 3DFSA 1KLYA 5KTLA 3PG8A 3KRZA 4PTNA 1VJIA 3A5FA 4JTTA 2J9ZA 2PRLA 3CM4A 2C15A 1XBZA 4JXCA 3MP3A 4RLIA 4YMZA 2BZNA 3VE9A 1FWSA 1GVSA 2Y61A 2C14A 3VFLA 4S2BA 2G5WA 3MYOA 5G1TA 4YL2A 1TTJA 1FWWA 5F2LA 1AW2A 2C19A 3SJ3A 1SW7A 4AF0B 3N73A 1OFBA 3G0UA 2BSLA 1PCWA 2LLEA 4ZQNA 5LNSA 1SO4A 3GDRA 3W1RA 4Y90A 3RMJA 2H3BA 3H54A 3LV5A 3VKJA 2Q8LA 2BX7A 3F03K 5EYWA 3W84A 5I3JA 2A1YA 2JGQA 3O16A 1L6SA 2QUVA 3U6WA 2ISSA 2Z6JA 3IEBA 3W1UA 3GXTA 3PBYA 5HR6A 3I7RA 1H50A 3UWQA 2X1TA 1SR9A 4PCFA 3E49A 2QUUA 2Y7DA 4DEFA 5D03A 4FX8A 4L4MA 3S9YA 5LSMA 2QCMA 3AJXA 4O12A 4N4PA 3TDFA 1LOSA 3CTLA 2V5BA 4K8HA 3L5MA 1YPIA 1R47A 3T7VA 1PIIA 2ISWA 3RFAA 5F1VA 1FWNA 1RD5A 4UTUA 1TQXA 1IXOA 4IPJA 1H1YA 2JKAA 3W7CA 1KA9F 2CZ5A 3PULA 1XXXA 1FCQA 4JEQA 3BG5A 3P8IA 3W70A 2ZRYA 1A5BA 4UR8A 4HNUA 2WJZA 1W5NA 2CFFA 1W5OA 2NXGA 3L2IA 4POCA 4PL2A 3UWYA 2RDTA 1SO5A 3Q58A 1WYIA 1VYRA 2PURA 3ZR4A 4Z08A 1FXPA 3QF0A 1ZJIA 3MP4A 3QFEA 1Q6QA 5GVJA 4PL1A 1XBYA 4AH7A 4MJZA 3IVUA 2AGKA 3RU6A 1FY6A 3R2GA 4JNMA 4AHQA 3HPXA 1FBAA 3TX9A 4N4QA 3EX3A 4UIOA 1TPDA 3NQ6A 1JRCA 3WJYA 3EX6A 1N7KA 1ZALA 5FEZA 2TRSA 2FJKA 3OHIA 3P81A 1J4EA 1H62A 1ML1A 3QH2A 1SQ7A 1IXPA 1FDYA 1TTPA 1YTEA 4UFIA 1H7OA 1F2JA 3ABQA 5AC7A 4DF0A 1UJPA 5D2TA 2WNQA 3TQ0A 1EA0A 4IMDA 3FYOA 1LOQA 2E6YA 4GRSA 2QDGA 4TIMA 4LRSA 4CNPA 3G22A 4RCXA 1K7FA 1JRBA 1UUOA 2JKPA 4ORMA 3LCFA 3FJLA 4UTHA 3P8JA 5FI8A 2VEPA 3KRSA 1MEIA 3DKJA 5CZSA 2DJLA 5FESA 3NQVA 4UC5A 1E51A 4UTLA 2CLMA 3MW7A 3PUDA 4FXRA 4IMFA 5LHEA 4UTIA 1GG0A 1P4CA 3QPZA 2VOMA 2EHHA 2QR6A 1D3GA 1LRQA 2ZZ1A 4X22A 5CZTA 1OX4A 3DH7A 3G1AA 4LWWA 4PA8A 5BNKA 4GUHA 3VE7A 4PFMA 4TMCA 4UMCA 4S1FA 1X8FA 3KXQA 3QYQA 3HGRA 2H6RA 2J24A 3G1SA 3GVGA 4JY8A 3ZWSA 1FWTA 1AK5A 3BLEA 3NDOA 5BMXA 3KX6A 3WJXA 1QFEA 5G2WA 3LI0A 1OX6A 6TIMA 2J9XA 4DXVA 3W7DA 4NVTA 1TPFA 3L0NA 1YLVA 3W2JA 3C6CA 3NQAA 1IXNA 4DO5A 1KFEA 3W1PA 1F6PA 1U5JA 3W72A 2DJXA 3QZEA 2FPTA 1A53A 3S1WA 3B0PA 4NJIA 1B4KA 1QOQA 3GAKA 4U28A 4ZMGA 3RK8A 1LDCA 2Z1BA 4O18A 3SW6A 3TMQA 1AL8A 4N9CA 5J5DA 2B7NA 3NPUA 1JUEA 3G1YA 3R8RA 4PODA 4M6VA 3VI2A 2X2GA 2FIQA 3G1VA 5D37A 7TIMA 2DZPA 5DELA 5HINA 3ELFA 4WOQA 5FF7A 5CPNA 5FF3A 4DBDA 2TYSA 3UYCA 4PC8A 1W31A 5F4XA 3F1QA 3B0VC 4H6KA 2J27A 3W7KA 2JGYA 1KFLA 1GG1A 1X1ZA 2Y85A 4IXXA 4O14A 2CLKA 3MJYA 3HPSA 3VNDA 3G8EA 4JTGA 3GX9A 2HS8A 1DORA 3V75A 1MZHA 1VYSX 3DFNA 3GYEA 5D2XA 3GLCA 2CW6A 3LCIA 3PG9A 4IOTA 4IUOA 3A21A 1OHLA 2O7QA 3UQNA 1Q6RA 5HWJA 4JIPA 1AL7A 2R94A 5C5YA 5KZDA 4Z1BA 5AOUA 1PVNA 2B7OA 2C0AA 4RK8A 2HSAA 2C3ZA 3Q94A 4JTLA 1IIHA 3W7NA 2GJNA 2OCZA 5I3GA 1NFBA 1TREA 4NZJA 5CPLA 1B4EA 4FNPA 4LVDA 4CCDA 4LVFA 3I65A 5AHEA 2ATMA 3UY7A 5AHIA 4O53A 3EWWA 3OVRA 3M5ZA 2J6XA 2D73A 2DORA 2YX0A 3W7EA 1XCFA 3NQDA 1J5TA 2VEMA 5HUPA 4JYDA 3CPRA 1X7FA 3TIMA 1VS1A 3BGGA 4FX6M 2EF9A 3ANYA 5AB3A 1T0OA 4NNCA 4NXKA 3L9CA 3GR7A 3W7JA 3CEPA 2XN1A 4WXZA 1GTEA 5K9XA 1WA3A 4DQWA 4AMAA 4NZFA 1TPUA 4IMCA 2DZWA 1KV5A 4MPQA 5CGQA 4GFSA 3I7SA 1OYCA 3N34A 1W5PA 4IX0A 2QCFA 3SECA 2E5CA 3G1FA 5AYYA 2ZZ4A 2A85A 3C56A 1JUBA 1GPWA 4EF9A 3GDMA 3EWXA 1DOSA 4LTSA 4O15A 5D33A 3BVJA 4NU7A 3LOTA 3RLUA 4OBTA 2I14A 4DBEA 1ZAHA 4HPJA 4O11A 4AWSA 1OFDA 3EEGA 1TPWA 2C16A 3LTYA 3GB6A 4O0ZA 2YGYA 4HIBA 5K3VA 3L21A 1XC4A 4WOZA 3W6YA 4A2SA 3B8DA 3TR2A 4O1CA 4CNNA 4MZ8A 1HL2A 4Z0SA 2X1RA 5F2MA 2DZVA 3G0XA 2FQIA 5G2IA 4UTWC 4DPPA 4O52A 3C2EA 3GZ3A 2HS6A 4O16A 1NEYA 2ZQ0A 4KFOA 1QO2A 4MY9A 1QPNA 5AYXA 3LHWA 2AAMA 5EY5A 3OA3A 4JYEA 3W2NA 1S3HA 2R14A 4LUJA 2ZTJA 4O17A 1QPOA 1DQXA 3O8AA 1NF7A 2CLFA 4FF7A 2Q8ZA 2BWGA 2B7PA 4XKYB 1C8VA 3CT7A 3NEVA 4JYFA 4K6AA 5HJLA 1YPFA 4CQ9A 4JY9A 2IQTA 4GC4A 2ZZ3A 3LXCA 5HUOA 2YPIA 2CU0A 3LHUA 3HGOA 4O54A 3S1XA 2ALDA 4A22A 1I45A 3FIGA 4UMBA 1OFEA 1JQXA 4AWUA 2ZRWA 1IIGA 4UNLA 3KOFA 4XBKA 5LNVA 3NG3A 3R13A 3TUUA 3TA6A 3ATYA 3SGUA 3NQFA 1KTBA 2QEZA 3P61A 1QOPA 3JS3A 3Q2DA 3TW7A 2Z6IA 2VFGA 3QM3A 1VCFA 4JTJA 4O4WA 3P84A 1EB3A 3E12A 4QNWA 4XQ6A 1H1ZA 4ONVA 2GVLA 5K2ZA 2QAFA 4Z1CA 2EPHA 3O05A 4HKPA 2HTMA 3LCLA 3W88A 1XDMA 3ATZA 5DXYA 5G4EA 5KMYA 4OGZA 3P80A 3YPIA 3UXDA 1XKYA 3PR2A 2YFNA 1NSJA 4NUWA 1KTCA 3M6YA 3LTPA 1ZAIA 1TRIA 3W2KA 2Y63A 3TFXA 2J9YA 5AC8A 2YW4A 4IJBA 5LNUA 1ALDA 2ZZ6A 5AYZA 2QAPA 1I2OA 2NV2A 1PCKA 4BI6A 4KWVA 2Y89A 4W9TA 3PM6A 5CSRA 1ZHAA 4C1KA 1QR7A 1JCMP 1WV2A 1EWEA 3QQ0A 3IIOA 3SFKA 5F2GA 1PV8A 3N14A 3NQMA 1GTHA 3GKFA 1K7EA 3LX9A 2E6DA 4O57A 3L66A 2B0MA 3BARA 4QJ1A 3LCGA 1VRDA 4LVGA 5IM51 1QDSA 3QMRA 4QITA 2ZA1A 3GKAA 1JUKA 3RLVA 4N2YA 3TH6A 3DI1A 2FB3A 2OMAA 1TPH1 4OE7A 1EIXA 1QPRA 1OFQA 1R2SA 2V0TA 3EWZA 3IVTA 4E2DA 2CLLA 2GPTA 1HUVA 4LU0A 4R33A 1EUAA 1A5CA 4JTEA 2QJGA 3TJXA 3M7WA 3CLMA 2WSRA 3W2LA 3LHYA 4JICA 3BO9A 3S8HA 2V5LA 2HMCA 4O13A 3UZJA 3H55A 4QISA 2H3DA 4MY1A 1BTMA 2V9DA 3W7HA 2EGZA 2V81A 1AW5A 5J5RA 4MLRA 3DHDA 2V30A 3FKKA 1X6UA 1R46A 1W37A 3GXNA 1Q45A 3STGA 5D2YA 1EP1A 4O0KA 2Y62A 5BMWA 1UCWA 3W73A 5D30A 2DU2A
chains in the Genus database with same CATH superfamily
2PDBA 3M0ZA 3FVDA 4UTWA 2YJQA 4MHBA 3B9NA 3BLPX 2GSJA 4IMEA 1P5BA 5A8NA 2ZA2A 1DE5A 1E71M 1VBHA 1AVAA 3VGBA 5BXRA 2GDVA 4D6CA 2O4QA 4MWAD 4JN8A 2YW3A 2PODA 3BW3A 4QG6A 5CQ1A 5DCEA 1LRTA 1S5WA 1NQ6A 3Q4DA 3R0KA 3R79A 2NXHA 3BQ5A 2DT3A 3UPBA 1PX8A 1XSJA 4JNZA 3TSBA 3V16A 1PTDA 1ODUA 4LY4A 1R87A 5C55A 5I2UA 1FWRA 2G37A 1DVJA 1EX1A 4IPPA 1TSIA 3S0CA 5L9FA 2OSYA 1ISWA 2ZA3A 5A2CA 3PZUA 2ZZ5A 4LVAA 3W4RA 4XWUA 4GVHA 4PMDA 4A3HA 1B9BA 4DJED 4IISA 3M0VA 4QEHA 1HL8A 2BMBA 2F8QA 3PBUA 2WMKA 2YA1A 1KFJA 4MKNA 3DN5A 4Q8VA 4MZ1A 2OKTA 1OG6A 1TV8A 4QAIA 3MVIA 5HMEA 4Q3MA 4DYKA 1GHRA 4LS1A 1FWAC 3CUJA 4PTDA 1H0IA 1ZB5A 1R3VA 1QPQA 2ZFAA 1WO2A 3UA3A 4MFEA 5KZ6A 1E15A 2ABBA 1YBQB 3TAKA 3CWOX 1TG7A 2ISVA 4AWEA 5D4YA 4UTKA 2VMFA 3CQKA 3RN6A 1K70A 1BYAA 1NWUA 4ORIA 4DJDA 2W91A 2QUNA 2BOEX 3AIEA 3FYYA 2QV5A 1J0YA 3BAIA 1OCQA 3UF9A 4Z1AA 3WDIA 4PCTA 4B91A 3MMWA 3S2NA 3UPWA 3UG3A 3M43A 1SFSA 5B80A 2C13A 3N2XA 1Q6GA 4AX6A 4W8BA 2P8BA 1L8PA 3JZUA 1B3ZA 4ZO8A 3A4JA 2DZUA 3RO6A 2QCNA 2J7EA 1WCGA 4GUFA 3IRDA 1OVDA 3FS2A 5GQBA 2WOQA 5IDIA 4AY8A 1X39A 5D32A 3CUGA 3M44A 2X30A 4DB7A 4GA8A 1LP6A 2FVKA 2WYSA 1PPIA 2A2IA 4HHPA 4FIQA 3AUOA 4C6QA 5D02A 1B30A 2VQTA 2NV9A 3WK3A 1OGSA 1A5SA 3NPWA 1CW2A 1RBLA 2UY4A 1ME9A 2FDSA 1Y5XA 1Q3NA 1E4MM 3WO8A 5DLCA 5HQEA 4PE8A 4LEQA 1PJ9A 1WZMA 2KX9A 4A6GA 1N8IA 1QW9A 2J7HA 5BW6A 3CHEA 1W8GA 4HPGA 4FOKA 4ATWA 3GW3A 1GKQA 4FLQA 5I06A 4PULA 1G4TA 1VCVA 1L8NA 1QMLA 3KCLA 1RD6A 4IFOA 4NJGA 2EPNA 3AXMA 3LPFA 4WK9A 1DJHA 3NOEA 4X9YA 2BLEA 1TMLA 2GWGA 4CCCA 1EYWA 5CLWA 4NL1A 3BLDA 5EMMA 5A5WA 1HJQA 2YDQA 1QHZA 1MNSA 2QS8A 3AS2A 1VEOA 1YDVA 2PC4A 2HE5A 1EWDA 3TP4A 3MMTA 3L5AA 1EJSC 3IJ7A 3UWWA 4PMJA 4D6HA 4S3FA 4UQCA 2XUCA 1V6TA 4FEZA 1TJRA 3BJSA 2XFFA 4KRZA 3HMJG 4PMQA 2DSZA 3WX7A 3SSJA 3UJEA 4JQ4A 1VPQA 1P0BA 3M9YA 4MKSA 2NVAA 1H60A 2E77A 4FMVA 4Q8OA 2WCAA 2V5DA 4ZOCA 3GH7A 4L9XA 2ZE0A 3M0IA 3MZ2A 4AZHA 2IPFA 3F5JA 2V5KA 4WCJA 3I4EA 3K5XA 4REQB 1XCXA 4AIOA 3FX4A 4N6EA 1YNPA 2WVUA 3LLDA 4E2OA 3K2GA 4JL1A 1OK4A 2Q71A 3W1AA 3LENA 2EG8A 3IJDA 3QTGA 4DWSC 3U5YA 1JCYA 3HG5A 4KIEA 4MKVA 1RAKA 1BF2A 2A7NA 4D6IA 2WHMA 5T8GA 2P76A 2J8GA 2PE4A 4LALA 1Y65A 4IMGA 3HGSA 3KVJA 2BOFX 1DBTA 5DCDA 4FO4A 1WXZA 4BF5A 2GGGA 1RK5A 1KCXA 2OSXA 1UKOA 5FF2A 1VH7A 2WNWA 1A5AA 1CGUA 3CB3A 1QK0A 1XISA 3WQGA 4GIRA 2EAWA 4IL0A 3NQCA 3IGSA 4AZ5A 3QY7A 4OV9A 1HTIA 2DT1A 5EMUA 3S1VA 1C91A 1NWSA 5H6HA 3CZ8A 2PDGA 3R4IA 1GONA 3AXXA 4WHBA 3RJYA 1VYPX 4PEKA 2A7PA 1KRCC 3GTNA 4GYPC 2GOKA 1W1A1 4BQ5A 3IAQA 3ARRA 4F3HA 4K8EA 3PP7A 4RUBA 3EPMA 1IXQA 4QNEA 8RUCA 5M3WA 4WD0A 4ZQPA 3WEOA 1MXGA 5C9RA 2YXOA 1RJPA 3O15A 1TVNA 1IEXA 2DGAA 3GS6A 1UASA 3VD3A 1TIMA 3N2TA 1FH8A 1B57A 4HA1A 4AFYA 5AHNA 2AKMA 3MWAA 3RHGA 3UR2A 1AMKA 4JTKA 5A6TC 1UR8A 2G3JA 5AC6A 1C8XA 3LA4A 4KH2A 1JFXA 2Z00A 3RPTA 3PSVA 2PRMA 4AYSA 1XYAA 1SJBA 5K9DA 1W1IE 3POHA 3T0BA 5KITA 3T44A 1XX1A 4N9EA 2DVUA 2XZ9A 4XZWA 2VX4A 1HKWA 1P7TA 1V93A 3DKLA 4DJEA 4A8IA 3RCNA 1VFFA 2FZBA 1P0NA 3QHOA 4DWDA 4PUWA 1JJKA 3G1DA 3WN6A 2CZDA 3VKDA 3UERA 3HZ3A 5LXXA 3MUXA 4Y6GA 4DPQA 4HCHA 1W1PA 1H4PA 1AH3A 4PGLA 3VD4A 1KGUA 2DZAA 3MT1A 2D2OA 5HK4A 4P61A 5FEPA 3U7BA 5JBDA 1T99A 2OOFA 1N55A 2XFWA 2ONEA 2FB2A 1ZRQA 1B31A 4LRTA 1CXLA 4H1ZA 1LWJA 1HP5A 5BWAA 4XTDA 1X8CA 4OZOA 4B90A 3PC0A 1E0XA 4P7OA 1F3WA 1P0KA 1XH0A 4UR7A 3W7IA 1PAMA 4K2SA 4Q4KA 4ZSTA 1RUSA 1TCDA 1ZP4A 1QNQA 3WDPP 1RPXA 1XUUA 3IGXA 3W02A 1FUYA 2GUBA 3CC1A 3T08A 4ZO7A 4FNUA 2QHAA 1KFBA 1PKNA 3VC6A 4MWAB 2CLHA 1ITCA 1UP0A 5E0KA 2Y8VA 1KFCA 4IIBA 3KVKA 1H61A 3ABXA 2NV1A 5A2BA 3RNDA 4HU0A 3RPMA 4HB7A 1JZ4A 1DHKA 3Q45A 2WPGA 3FOKA 1E6NA 4UFKA 3QPYA 3HGJA 1NELA 1DP0A 4MYAA 2G4JA 3WQ4A 4PMUA 3W83A 4R34A 3AZSA 4H01A 3MI6A 1F7BA 3E0WA 1V3JA 2RHGA 4G5DA 3G5EA 5I78A 4G1KA 1TE6A 2PF0A 2CWNA 1IR1A 3WF4A 4HZ6A 4DF2A 2QUMA 1TFVA 3ZS4A 3T0CA 1TUFA 3QR3A 3K4AA 4H9YA 4XAPA 1Q7ZA 1LM1A 3WLKX 3GHSA 1KXTA 3HO8A 2ZVRA 4R9OA 3N19B 4JTHA 5E1QA 1EC8A 3CU2A 2E8ZA 2QCCA 1WXJA 2Q6ZA 3JRKA 4NJJA 3P60A 3CLWA 1QNVA 2HVMA 5XIAA 3E1F1 4JQ2A 1CENA 1SO3A 1VHCA 3VCNA 1M53A 1E55A 2G0WA 5C2XA 4CCZA 3KBSA 4BS0A 1CXIA 3SJNA 5CAHA 3W82A 1Q4WA 3TN5A 1C92A 1V03A 3ARTA 1CBGA 4YVVA 3W7MA 4C65A 3V4BA 3CH9A 3EA3A 5D2VA 2D23A 4X0VA 1HKIA 2F6XA 3CQ0A 3MMUA 5K4ZA 3NURA 2VZSA 3M5VA 2OVLA 2A5HA 3TW6A 5CZ0A 4C6PA 4IM4A 1PTAA 1J6OA 2Z24A 4QCFA 4D1JA 3ENLA 2OYMA 2ZUWA 5I23A 5A6MA 1H1NA 3SY5A 2QMJA 2WZIA 3LRLA 3O6DA 1KV8A 2WMFA 3Q37A 3NA8A 5MKGA 3CL7A 3CUXA 1XFCA 4A3QA 4XISA 1JCNA 1UD6A 4PR4A 4EX4A 2OLSA 3JR2A 1MEWA 3SBFA 1A0DA 4GKTA 3ID7A 4C7DA 5DMNA 4CD4A 4Q6JA 4XG1A 4IQEA 4DBUA 1K9TA 1XDJA 4CNSA 3UGRA 5HR7A 3GVWA 3DOPA 4QTGA 3N6JA 1AQHA 4PMXA 4Z2HA 1UUMA 3AJ7A 3GC4A 3OTRA 2CZFA 3FHQA 4JZ5A 4RV8A 4BI7A 2WLYA 3GVVA 1KXHA 2D2GA 1XLLA 4PRTA 3OGVA 2INFA 2OJPA 1C3FA 1QO5A 2Z1KA 4UTJA 3UR8A 2PDFA 3S2MA 3TN3A 4DJFD 4ZXOA 1FVPA 5C9ZA 4XIMA 3ITVA 4GLEA 1CEOA 3VCCA 1RJRA 2VL4A 1O5XA 5AHMA 2KZHA 3MO7A 3NVTA 2GYIA 4H4IA 3WKZA 3DFQA 4JDBA 1G7UA 1XHGA 4XAYA 3UVIA 1IV8A 4W84A 1P6BA 1GVOA 3AHZA 5LHFA 4Q32A 2QCLA 2W0UA 1DQWA 1HG3A 1FCVA 1TV2A 4NRSA 4KWWA 1F73A 3EA2A 3BGAA 5BU6A 2O9OA 3EDFA 3NL6A 1I1XA 3IJLA 4EVZA 3UBPC 4AXKA 4DHGA 3GC2A 2Y1HA 1PZ3A 1V8EA 1XRSA 2OSWA 3STPA 3A47A 2H8ZA 2WHJA 4JQ3A 4L9ZA 1XBVA 3FKRA 2BDQA 3AZTA 3W53A 3C2RA 3W1TA 2BGNE 1U22A 2DQXA 4FNSA 3R10A 2YYUA 3ARYA 4HYVA 2O9RA 3T42A 4Q7IA 3S46A 4K36A 3N9KA 3NYZA 4QAWA 1UC4A 3LB0A 3GFZA 4B4HA 1SJAA 2D0GA 1K6AA 5KINA 3PBMA 3WQPA 2YXXA 1UBSA 2EG7A 5CJMA 4GYJA 1BYDA 4A3UA 5HATA 3NPXA 2G3MA 4AISA 1W9XA 4CNUA 4YTRA 2V67A 5E6YA 3O0FA 1AQMA 1JI2A 3GDLA 1UZ1A 4GXWA 3WFAA 4GH1A 4XUYA 4FAMA 4HU3A 1H7PA 5CPTA 1R3TA 4M8UA 3V18A 1QHOA 1JZ3A 4RNHA 5I5RA 4M1BA 3WY1A 4GFIA 4B3ZA 3EXSA 1TJ1A 2QCDB 3TTYA 5BRQA 1JFHA 4N0RA 2GVEA 4IFRA 4OUIA 3QHMA 2FPYA 1W8SA 2X1IA 3WMCA 3E96A 3S5NA 2PDHA 3S3GA 1VPXA 1BGAA 5LGXA 3TJLA 4JIQA 3LD5A 7TAAA 1YDNA 2V82A 1L6GA 2BFGA 2E1WA 2AL2A 2PDPA 5KETA 1NDWA 1G69A 2WANA 3RM9A 2B7QA 1TPEA 2ZXQA 4RNJA 2DZXA 1KM5A 3NOYA 4UUIA 4V15A 1XL9A 5T26A 4MVAA 4Q33A 4OVXA 2ZX6A 1I60A 3CZLA 1W3IA 4H04A 2HQAA 1MEHA 4N7QA 2WZMA 3OO2A 2REQB 4JGDA 3EOLA 1KR1A 1TRDA 4WY0F 1RCXB 1LBMA 5BXTA 4UNIA 4GQQA 1AD1A 4KWSA 1W9PA 1VFUA 4PBFA 1VHNA 3BSMA 1CLVA 1ADSA 4HZ8A 3R43A 1PZ0A 4UFHA 4PRRA 1W3HA 2PP3A 3VTRA 1V7AA 1J5SA 2HV5A 1A50A 3REQB 3WK0A 4Q4QA 4LUTA 4R5EA 4ML9A 5BRBA 3SY1A 1N8WA 1DJXA 3WJZA 2ZKMX 5FACA 3NQGA 4AZCB 1OD8A 1PO9A 3BMWA 4ZQCA 1JR1A 4BEQA 1E1CA 3AHXA 4CQAA 5HMSA 4L6HA 2CLIA 5A6SA 3F4NA 1TA3B 3B05A 2GOUA 1A3XA 4OT7A 4WEVX 3ALGA 2W3ZA 4P7RA 5HQMA 1GKRA 3G6MA 4ICNA 3L0KA 1S39A 3GU1A 2FYMA 1ITUA 3LTSA 3N9RA 3B8SA 2JBMA 2OB3A 1THFD 4TO8A 4TTGA 3BURA 4DX3A 4G56A 3KVLA 5SWUA 5CKSA 2DVTA 1UH3A 2XISA 4F2TA 4LY8A 1JZ2A 1CGYA 5E09A 3IIVA 3CAQA 2WLZA 2FGZA 3FEMA 3P62A 5EKYA 4KCTA 1FWGC 2PWFA 1S2UA 3ZLHA 5PTDA 5FJTA 1KO0A 5ABTA 3NEHA 4UTMA 3ZR6A 2TMDA 4WDWA 1UOZA 3EXRA 3STCA 1WDDA 4ADTA 1KLYA 1CLXA 3PG8A 4YVPA 1F9CA 4P5UA 2VR4A 3AHVA 1VJIA 3A5FA 5EFFA 4V1YA 2FKPA 2PRLA 2X8RA 3SUUA 3UZYA 4FOUA 3MP3A 1GQJA 3VE9A 2MUCA 2C7FA 2C14A 3OZMA 2IKJA 1TTJA 1YE6A 2C19A 3W24A 1SW7A 5CPSA 2UY5A 3N73A 1OFBA 1E9IA 2G50A 4URIA 2ANUA 1PKLA 4GX9A 3WF1A 3LV5A 3JW7A 2PU0A 1HJXA 5EYWA 3CO4A 3K8LA 4KPLA 3W84A 5I3JA 1J6PA 3KWSA 1IZCA 3U6WA 2DSKA 2ISSA 1XD1A 4LGXA 1WPCA 3E5BA 3PBYA 3UWQA 1RLDA 1V3KA 3WLIA 2QUUA 3LNMA 2CITA 4F9DA 5LSMA 2QCMA 5LYRA 3NTYA 4O12A 3OJGA 1IWAA 1XLGA 4N4PA 2QF8A 1OZMA 4J27A 4KQNA 4HA0A 1PIIA 2I57A 1FP8A 1OIFA 4UTUA 1TQXA 1IXOA 3W7CA 1K8CA 2Y8UA 3VNMA 3T81A 1XXXA 3VD9A 1EHNA 2ZRYA 1VENA 4G6CA 4HNUA 1NP0A 3DERA 4DNMA 3QLDA 3T2QA 3K8MA 3Q58A 1WYIA 2E8YA 1KD0A 5HPCA 3ZR4A 2ACRA 3VA8A 5JU6A 1UBPC 2XG9A 1Q6QA 3UZWA 4Q4OA 4CNTA 1VJZA 1UZHA 1MNZA 4FLRA 1L6FA 3B9DA 4N4QA 3M46A 1JRCA 3OODA 3WJYA 4IJCA 3EX6A 2FTYA 4GVIA 4HCLA 5FEZA 2F6UA 2F38A 4UQAA 1J4EA 3QH2A 3N3TA 2PWHA 4F0SA 5I0DA 3A64A 4DYEA 1PXGA 5BU9A 4HN8A 2WNQA 4IQJA 4IMDA 1NM9A 1LOQA 4UTFA 4XSMA 3VUSA 2R82A 3CNYA 3G22A 3CV2A 6PTDA 2POZA 4ORMA 1K77A 5HBFA 3FJLA 3KRSA 3WBXA 4DWSD 3DKJA 1J10A 3N13A 4HHLA 3EMZA 5E6ZA 3PUDA 4FXRA 5LHEA 4B92A 2QNEA 3QPZA 4IQDA 3S83A 3AWNA 4W88A 2EHHA 5ABFA 1VFOA 2ZZ1A 3CPUA 3VGGA 3G1AA 3D47A 2Q01A 3VE7A 4TMCA 3C0SA 3U9IA 4S1FA 4H9TA 3GTHA 2OXNA 2H6RA 3BLEA 1FWJC 1V02A 1QFEA 3A4WA 4U31A 2QPUA 1MDRA 5REQB 2EPMX 3F2CA 1IEQA 1YLVA 3E3HA 1FRBA 1OC7A 3U57A 4DO5A 3T0AA 3ME3A 1KFEA 3KZPA 3KS5A 1B90A 1B4KA 2ZE3A 3V0UA 4ZMGA 1A5MC 1LDCA 3OU8A 3G1YA 2PGRA 1DIEA 1YKWA 3BE7A 3NIYA 2YDRA 1CGTA 1BD0A 3G1VA 1X1NA 3SADA 5FF7A 2ZUVA 4YTSA 3FHAA 5FF3A 2QPXA 1UIPA 2ISDA 2BB0A 4PC8A 5F4XA 4H6KA 3MUZ1 3W7KA 2JGYA 1GG1A 2CLKA 2WZEA 3WL0A 3VNDA 4L5ZA 2C91A 3GX9A 1V3IA 2HS8A 4CKQA 1CWYA 3RR1A 3GLCA 1UKSA 3LCIA 5RUBA 4C6IA 3F7JA 2O7QA 4H9ZA 1JGMA 1DIOA 2R94A 5AOUA 4LPCA 2B7OA 4J3WA 2X7WA 1MW0A 2HSAA 2C3ZA 5C70A 3KW3A 1IIHA 1K9FA 3RG6A 1W3KA 2OCZA 4IPLA 1RPKA 5I3GA 1NFBA 2I7GA 1P6WA 4PRWA 1B4EA 1H0GA 3MUAA 4CCDA 4Q4MA 4IG2B 4Q8PA 3I65A 2ATMA 3PFRA 3UY7A 2CXEA 1RY8A 3EWWA 4MPKA 1I1WA 3BH4A 3QC0A 2DORA 5J04A 3SCTA 4QSFA 1FKXA 4B5SA 3CPRA 1O7AA 2A3CA 5TAOA 1OT2A 1X7FA 5AZ0A 3AYVA 1VS1A 5EGRA 4D8AA 3WLJA 2GGJA 3BQ6A 4C90A 3SUSA 1S1PA 4YIWA 4WXZA 3CGTA 2E3ZA 3TCSA 4DXXA 2SFPA 2HNHA 3OLEA 2DZWA 1KV5A 2JIEA 4GFSA 1XLHA 1JPMA 4DM1A 4LAOA 1YNQA 2E5CA 4HHMA 5DRIA 3G1FA 3RCMA 4C6FA 3GG0A 1JUBA 1GPWA 3GDMA 1DOSA 4LTSA 4O15A 5I3DA 3IAPA 2JQXA 4NU7A 3AAMA 2X05A 3RLUA 2I14A 4AWSA 1KBLA 4GJIA 1M41A 3WH8A 1ZJAA 4HIBA 2Z2BA 1JPIA 1IE7C 3CT2A 4AZIA 2YL5A 2D69A 4O1CA 4MZ8A 4AZBA 4H9XA 1XQKA 5G2IA 4UTWC 1ZL1A 3AIRA 1GW9A 3ARWA 4PBGA 3LHWA 5EY5A 4PUEA 2J8TA 4GKLA 4JYEA 1S3HA 1QNRA 2R14A 5A6KA 4ROQA 4LUJA 3KP1A 3GHRA 1EIBA 3SCPA 1VBRA 3O8AA 4LB3A 1NTHA 2X0SA 5I7GA 2Q8ZA 4GINA 1C8VA 3NEVA 3U5UA 3I3DA 4JY9A 1GVIA 4QGCA 1GGOA 4FSAA 5B7YA 1B3WA 3LHUA 3HGOA 4H2CA 3TTQA 1A5UA 2P3EA 3HQNA 1XH2A 4GIEA 2OQHA 6XIAA 3FIGA 3WH7A 2WHLA 1JQXA 3KOFA 2QQ6A 3MWCA 3TUUA 3SGUA 3NQFA 2J8FA 3PPHA 3GH4A 3P61A 3WH6A 3Q2DA 3TW7A 2VFGA 4O4WA 3SM0A 1J0ZA 1GOQA 1EB3A 4PUKA 3A9BA 3H26A 1UUQA 2QAFA 4B16A 3O05A 2F2KA 1W9UA 1BRLA 1BHGA 3W88A 1REQA 2B81A 2VTFA 1XDMA 4B5UA 3CWHA 5EMJA 5G4EA 2R1LA 1WZAA 2CBUA 4C6EA 2YFNA 1NSJA 5C9WA 2AMGA 3LTPA 4JKMA 3TJ4A 1V6VA 2Y63A 3TFXA 3W2KA 1OBAA 1JGIA 3GG1A 3SO7A 2QVNA 1E4LA 2C71A 1I2OA 2PPGA 1NDVA 1O6IA 4BI6A 4KWVA 2Y8KA 7CGTA 3UNTA 2BY3A 3BJFA 2CCRA 1W9DM 5FL0A 3T05A 3N12A 2YCJA 1A49A 3N04A 1PV8A 3E5PA 2YCIX 3BC9A 2FGBA 2E6DA 3GTIA 3PZNA 4JTDA 1XPYA 2B0MA 4QJ1A 2BOGX 4QITA 2PWGA 3U2EA 2ZA1A 2YA0A 3H7RA 4KRUA 1JUKA 3CL8A 1H09A 2YBVA 4N2YA 4YNGA 3DI1A 1R2SA 2QLYA 3SRDA 1E4NA 2GPTA 2ZX7A 1XGZA 2UY3A 2BBFA 1NY1A 3S2CA 1EOKA 3TJXA 2VYOA 2OGJA 4Q8NA 3W2LA 3LHYA 4DWSA 1UKQA 1NJJA 2PGWA 1IT8A 4MY1A 2NQ5A 2O0TA 1BTMA 3CTTA 2DH3A 1GQKA 3BAYA 2EGZA 3N2BA 2Y5JA 3AMDA 5AYBA 3KOZA 3IUHA 1Q45A 2XVKA 2MNRA 3H4WA 2JF7A 1EP1A 3N25A 4O0KA 1XLBA 1UCWA 1GEQA 3W87A 1O5QA 2VWTA 3UEQA 6REQA 4V27A 4X2RA 3CZGA 4MZYA 4I7VA 1TMHA 2WNZA 1BYBA 1VLWA 1TV7A 3FCPA 5D2WA 4GZEA 1JQVA 4WX2A 5LIUX 3LGEA 1ZENA 2NQ9A 4IH3A 3EDJA 4K1WA 3HQPA 4GYPA 3D3FA 1C93A 1X98A 1Y7VA 4I7WA 3U2OA 1J18A 3VZXA 1Q6DA 1KRBC 4ZE4A 4WGXA 2Z1WA 5CG0A 4GH3A 1W1TA 4RL3A 4XTIA 3A5VA 3SUVA 2A3LA 6XIMA 4J28A 8A3HA 5U7SA 3WUEA 4MAZA 3CMJA 2BHUA 4YYCA 3ABOA 1ZAJA 3BGJA 2A7RA 2Z27A 3GTFA 2X1UA 3A12A 2AOSA 4ZTYA 3ZYZA 1UP3A 3QBUA 1GYLA 4J1OA 1D9EA 1W54A 5HJYA 4U2YA 3U2ZA 4XO6A 2E5BA 2PDLA 3L5LA 1IZKA 4LVBA 3W2UA 2ZWZA 3NQBA 3OP2A 2GK1A 2P88A 4O1DA 4PMNA 4WJEA 1UR4A 2P10A 4KBXA 4MNLA 3A22A 4C5ZA 1GEHA 4QJ4B 1GWJA 4NJKA 5A6LA 3ZVHB 2FZDA 1OFAA 4LEFA 5ABGA 4IXHA 1CI1A 5HNTA 1DJQA 1XR2A 3PHAA 4KGLA 1UR0A 4H6RA 4MDPA 2PWVA 4WRHA 4OHQA 4F0HA 3NR0A 3QR1A 5CH9A 3M0KA 1W17A 4RKAA 2OZ0A 1JF6A 3WJSA 2ZZ7A 1HJWA 2HXUA 3CK5A 2ZUMA 3UCDA 5D38A 3UWVA 3HB9A 2NWRA 3C3NA 1JDCA 4JAWA 3KS6A 4NYUA 2G3NA 2PTZA 1DWGM 2ALRA 2GQ8A 1F3EA 1X6LA 1KQYA 1V0KA 5AVNA 4U3CA 4JTIA 4LNCA 3BAXA 4GMEA 5I00A 3IGUA 4XVDA 4MJMA 1WBJA 2WSKA 1KTNA 3OLGA 1JIBA 1GHSA 5TQLA 5KSWA 3WLLA 4Q7BA 2C1GA 1SW0A 4MB3A 1NU5A 3USBA 1EP3A 4NZCA 2WJDA 3IUDA 3KZSA 3S6DA 1JAEA 1V51A 3VOHA 1Q6OA 4K68A 1TZ7A 1TX2A 1CXKA 5FCZA 5FF0A 4R88A 3L7RA 3PBVA 3TLLA 1JULA 2VXNA 1U2YA 1TJ0A 3NCOA 1ICQA 1UJQA 4MWAC 1O5KA 1PZ1A 1FHDA 3AUJA 3W6MA 1R30A 3E2RA 1E6ZA 2PA6A 1MW2A 1ZY9A 1DWJM 2QCHA 1H7NA 1R2TA 3BV7A 2TPSA 3FEQA 1SO6A 3ARUA 1GVEA 3GXDA 2WMIB 3FGCB 2W27A 1W3NA 3RITA 4O0QA 5CSYA 1J8VA 4MMWA 4ZOBA 5JVLA 3A4AA 3T4CA 4QR6A 5GJMA 3PANA 5M03A 1XV8A 1ZJHA 3MYPA 1Q7QA 2E1DA 2E25A 5JH1A 3D0CA 2D22A 4KEVA 3OW1A 2RJGA 2VFEA 4DJEC 5HWNA 4ZVJA 1AODA 1UC5A 2ZBTA 5K9CA 2ISFA 1XIFA 1JD9A 2GZXA 2DZTA 3DFOA 1XRFA 1NOUA 4O50A 3H4GA 4C6NA 1LYXA 1V77A 1TV3A 3VXGA 1TTQA 2V6AA 2R91A 1JAKA 3SIZA 4HNVA 2RDWA 3NQEA 1SSGA 1PZ2A 2VELA 2BY2A 4N9BA 2E6FA 4ENLA 3NQ7A 4XAZA 3CWNA 4GUJA 1D7FA 3QW3A 4D6EA 4AVNA 3NUKA 2ACSA 2VFIA 2P53A 3T1GA 2VZUA 4IICA 3FLUA 1YXDA 4ZQRA 2I9UA 3PVFA 1I2RA 4F2BA 2VD8A 4RJEA 1E70M 1YXCA 1I2PA 1TMQA 3UPMA 4Z2LA 3GXIA 4U33A 2Y0FA 3RR4A 3TSMA 3QPEA 1CTNA 1C29A 2C6QA 4N02A 2E6AA 3LBMA 2H8XA 3PTDA 4XUGA 4RXFA 3KTXA 4OUEA 2V38A 3K8KA 3M0XA 4P7NA 1MSSA 2A3HA 3I68A 3ZZ1A 3E0IA 2VVNA 1VCGA 4IZGA 1RQEA 3LYEA 5ECVA 3TFCA 1V7YA 1HQTA 4LBUA 1UB3A 1PKYA 1SZNA 3LCXA 3QGAC 2NZLA 3CL6A 2ZXDA 4RE3A 1S5NA 2QUTA 4NNBA 4QQ3A 4RXGA 1WE5A 2RGLA 3R89A 4G7EB 3EKZA 4RZ4A 3GWQA 3K4DA 1L6WA 1UQZA 2BVYA 1QI5A 4YWSA 1A3WA 3AMGA 3VNKA 4BKNA 3V0SA 4YTQA 1FQ0A 3PWAA 4MG4A 1V08A 3L4VA 3MB9A 4GUGA 4GX8A 4O19A 1K8XA 3ITGA 1G67A 2CBJA 4AZGA 2DVXA 1GZGA 4RZ5A 4NP7A 1NQKA 3DYMA 3LPPA 3LM3A 3PZMA 3QW4B 1T8XA 4M6PA 3P3BA 2BHZA 2D2JA 1E6PA 1A0CA 4DAFA 4GNJA 1W2PA 2ZUUA 4GVFA 1DWHM 1Y0EA 3I10A 3K13A 3P14A 2X16A 4AF0A 4IIFA 4GYKA 1RVGA 4AX7A 4BR1A 5E93A 3VKAA 1F05A 3WIJA 3PTKA 1OY0A 4MWAE 3B9EA 2DIKA 4U2ZA 4US5D 4NT0A 3VCRA 2GJXB 5EA9A 4Y9MA 1XIBA 3W1QA 1OC5A 4RDYA 3H2MA 3KFTA 1TWIA 1XFBA 2DZSA 2R9RA 4F66A 1SSDA 3GDKA 3TXVA 2Q09A 2AL2B 1GQLA 3VYLA 4KFNA 1CZ1A 2YIHA 2PZ0A 1XPGA 3QKEA 2NW0A 4KF1A 3HG4A 3H8AA 4HK7A 2NQHA 4HJFA 2NUWA 2D3LA 4E38A 1HJUA 1YE4A 3KAOA 4B5WA 5EFDA 1IYXA 1C7TA 1FDJA 2JK2A 3FDKA 3DFHA 4AB4A 1RP8A 4RPPA 1QU4A 2H9AA 3OBKA 4HOXA 2JIWA 4CQCA 2VFFA 4BWLC 3PFMA 3R6IA 4IX2A 5EL1A 2HE8A 3OIXA 2OLHA 3D46A 1EGMA 1W5QA 3H21A 3OVPA 4JFVA 4DO4A 3OVQA 3WYZA 4UFLA 1AQFA 3DC8A 1XS2A 4TVDA 1V6YA 4J40A 2C1IA 1H51A 4HQVA 3W28A 3ITLA 4L61A 3E38A 1EBHA 1TO3A 2O9TA 3CZEA 2JALA 4O1BA 1PS9A 1ESWA 5DMLA 1EH9A 4H9MA 2WSQA 2VKZG 3O63A 3WQ8A 4CN6A 5GJNA 3LMYA 2WSPA 1FXQA 2VFHA 4GY1A 3WQ5A 5L6UA 4ZB5A 3P6LA 1XIDA 3HM7A 2PDCA 3UWUA 3H2FA 2XSBA 1ADDA 2OYLA 1KM4A 2WC4A 1MWOA 4PSPA 1DTNA 1LCOA 1WKEA 2PLMA 8XIAA 4S38A 5D8WA 3NDZA 5ENLA 4EAMA 4GHRA 2HISA 4FOJA 1E5NA 1QI0A 4HYRA 2W79A 4HGXA 4MOZA 3N4FA 1A3HA 4JR5A 4XKMA 3MI3A 4OBRA 1U33A 1B54A 1WDPA 1ZZMA 4IGSA 3S4TA 4J3XA 3EMCA 2PRHA 1W9BM 3H22A 1GJWA 3VNLA 4DNHA 5AZ1A 5LIXX 3KOWA 1ISVA 4HNNA 3QEZA 4E4FA 4K39A 2IMRA 1OIMA 1LLZA 3PZ9A 1Z48A 4HSOA 3A4XA 1JDDA 1XLJA 7A3HA 4EPEC 3B04A 3NYDA 4L65A 3IK4A 1OG0A 3N29A 4Y9PA 2OT1A 4JHOA 3DYOA 2XM1A 4IP5A 1SZFA 4JFTA 3H7UA 7REQA 1XSKA 3VNYA 3IUIA 4KCWA 1S5VA 1RBOB 1VFMA 3HTWA 3PZQA 1FA2A 1JZ8A 2CKSA 4WJXA 3UGVA 2UV8G 3H70A 3H12A 1S2AA 4J3VA 2ZRZA 4BQ4A 1C8QA 3TOPA 4GZJA 2GSHA 4AC7C 2A3BA 3URQA 2I9EA 4Z2JA 3W2MA 4JTSA 3SI9A 3TSDA 1EC7A 2JF6A 3O07A 4GUIA 4LW7A 5DT5A 2F84A 2WPBA 3E0LA 3S42A 3GG7A 8TIMA 1U5VA 4M80A 2OEKA 3B0YA 3URBA 1V6UA 4HNCA 2GFTA 3GAYA 3VOIA 4IPNB 2OYKA 3UP8A 3GE7A 4BHYA 2NX9A 4EXAA 2EPLX 5EMKA 4HD5A 2ZX8A 1BXBA 2PTXA 4NG3A 1XJBA 3QSTA 3W07A 3MHUA 3VD7A 1ODZA 2VZOA 3URAA 3WDRA 3QFWA 4M7TA 4KEMA 5I3KA 1Z7AA 4HPXA 2YR1A 1OCBA 5FJOA 3HV9A 4AD5A 2J7BA 4GE8A 5XIMA 4PN2A 2VGFA 1SW3A 1RVKA 3W7LA 4AMCA 4D8ZA 4RE2A 4ZE5A 4LCRA 4R9XA 4QDWA 3U8GA 3ARSA 3L67A 3UESA 3LXAA 3RRXA 1WUFA 2E7FA 2XU2A 3CAKA 3BUVA 3C8FA 3SCNA 4XZLX 5IRPA 1Q85A 1BKSA 4LANA 3EDKA 1TJ2A 3W1NA 4E8GA 1WX0A 7ENLA 3PBWA 1Z6KA 2W92A 3NQ8A 1WOAA 1OZQA 3IIZA 1CDGA 1XGEA 1UOKA 5TBOA 1R3YA 3XISA 2O55A 2F9RA 3OBEA 1AA1B 3ITYA 3S5OA 4JQAA 1J12A 2ZZ2A 2DPEA 2YZRA 1DHPA 5AN7A 3EKLA 4DI9A 1GCYA 1CYGA 2GWNA 1ZFJA 4NZ3A 2WNNA 2OEJA 3N11A 4HU4A 3OHMB 3PSWA 1FCUA 1V4YA 5TD4A 4QXIA 3EOEA 3TJIA 1BLIA 1N82A 2GDQA 3UYIA 1X7IA 2XGZA 3N6QA 3B4UA 3IJ8A 1LWHA 2VZVA 3BXWA 3TMLA 1N8FA 1UWQA 1US3A 1A5OC 3VIIA 3WH9A 2R8WA 1TZZA 4AXNA 4DJFC 4L56A 2NXIA 2KAUC 3LZ5A 3S5ZA 4XZBA 4HA3A 4ACZA 1AMYA 2VWSA 4GY7A 1PYFA 1GOMA 4J3UA 1O95A 4P8XA 5IFTA 5DO8A 4QLLA 4IGNA 1GKPA 3CMFA 4ZTXA 1ZBKA 4Z2IA 4TUFA 1GVRA 1PKMA 2QDDA 1Z44A 4HOZA 4W7UA 1UD4A 4OV4A 4L9YA 3L4WA 1QWKA 3EOSA 2VDGA 3E02A 1FTXA 3IGHX 1PSCA 4ADSA 1OCNA 1T96A 1OEPA 4JTAA 4N9DA 1J0JA 3MC5A 2CWXA 4INFA 5DY3A 1XLKA 3A3HA 3H2EA 1XYMA 3HIJA 5BOOA 3PBGA 2FPVA 2PU1A 4LUSB 1H5YA 4AAJA 4NF7A 2NT1A 4LBRA 5DBUA 5DY2A 1YHTA 4UTTC 3GC5A 3O9NA 4Y9OA 4EACA 5E9AA 1XBXA 4KWOA 3TQVA 3QY8A 4GG9A 2WC7A 2NWSA 1UR1A 4O10A 5LZLA 4JFWA 4DO6A 1ONRA 3NM3A 3I6RA 1X1OA 2PLCA 3O6YX 1B9ZA 4GYFA 2PCEA 1QVBA 3EWYA 4E5TA 4ZA0A 3GZAA 3H2NA 4QG9A 3W7PA 3TK7A 4Y9NA 4W5ZA 3VIJA 3IV3A 3WQEA 4K7YA 3GXFA 3HURA 4AZ6A 2XFYA 2QJIA 3VMNA 2FDMA 2V3FA 3WLPA 4WKFA 3QSRA 4OFCA 1IWBA 6TAAA 1S38A 2PGEA 4AC1X 1NWTA 1BPLB 3V35A 1BWKA 3FK4A 1D8WA 3S6TA 1NH6A 3P82A 4LAUA 3GY1A 3R11A 1B2YA 1P6CA 1D2KA 1Y5VA 2GL5A 4YLWA 3DAQA 2DY3A 2O92A 4XZMX 3V1HA 4NIRA 3EX1A 4WY0B 4ERIA 9XIAA 1EJWC 4QCEA 1J96A 1E56A 1DEDA 2V5JA 4NJHA 3TAOA 1VQTA 4GI4A 3FJNA 4A35A 1S1RA 1HT6A 4B2DD 4YCOA 3CIXA 3DFSA 3KRZA 1JZ6A 1L0PA 1VF8A 4JTTA 2J9ZA 2FHBA 1UROA 3THUA 4AD2A 1FWSA 1GVSA 2Y61A 4PUDA 1KCZA 4YL2A 1FWWA 1J2BA 3EMQA 5F2LA 3QOMA 1YBQA 3SCRA 3S2LA 4GCAA 4KEUA 1EO7A 3ANUA 3KCOA 3BMVA 4H8VA 4TV6A 2LLEA 3QLLA 4ZQNA 4DZHA 1SO4A 3GDRA 2JFEX 4Y90A 4IIHA 3H54A 4UQBA 3GNPA 2OFJA 3F03K 1TIWA 2JGQA 2QUVA 3UCQA 2Z6JA 3IEBA 3W1UA 2PWEA 3GXTA 4XBJA 3ZT6A 4PCFA 3RPDA 3WUGA 2GGIA 2ZUNA 4IMAA 1RHCA 3S9YA 5FL1A 1JPKA 3P2VA 1KRAC 3T0TA 3T7VA 5F1VA 1FWNA 4RNIA 1RD5A 1H1YA 1KA9F 3PULA 2FH6A 1A5BA 1W5NA 2Q02A 3MCMA 2YCLB 3WMLA 4POCA 1SO5A 4OJYA 1VYRA 2PURA 1FXPA 4TVUA 2XIBA 2XWDA 3R94A 5DANA 3N4AA 1EF2A 1JNDA 5GVJA 1JNEA 3VUPA 2YL8A 3UXIA 4AH7A 1JL8A 4MJZA 3EOOA 5JMUA 2UBPC 1K4HA 3ZLFA 3LMZA 3GH5A 4JN7A 4YJ5A 3SEPA 2R1PA 1ZTVA 4AHQA 1JDFA 4NZ1A 3KBWA 3H2CA 1TPDA 3EZ4A 1LJYA 4KCVA 1WAWA 4GD0A 3OHIA 4EKJA 4O1EA 5JBEA 1ML1A 3BMXA 2QGYA 3DIPA 1SQ7A 1IXPA 1Z32X 4Z17A 1F2JA 3NGFA 1XIIA 5AVHA 3MUCA 5AC7A 1H41A 3GUGA 3TQ0A 2E6YA 2G4FA 2QDGA 4OOUA 3CBWA 4W8AA 2ZC1A 3ZSTA 1JRBA 3P8JA 3DEQA 5CZSA 1J11A 4RW5A 4H00A 4UTLA 2CLMA 4IFKB 3U4FA 3MW7A 4XD4A 4F2UA 1KGWA 1OX4A 4DVOA 1AJ0A 2CKRA 2DSVA 3ARPA 3RCYA 2FTWA 4PFMA 3M64A 3FN9A 3KXQA 3QYQA 2J24A 3G1SA 3GVGA 2X09A 3TVAA 5BMXA 3KX6A 4REQA 5G2WA 3LI0A 2J62A 4PCSA 4HZMA 1KR0A 1VBUA 3AS0A 1OX6A 3MCOA 3W7DA 3M7SA 3L0NA 3NQAA 4OECA 1Q2RA 1F6PA 2FPTA 1A53A 3RK8A 3OA5A 3TMQA 3BSHA 4N9CA 3NPUA 3MSGA 3G2GA 1R9ZA 3NSMA 4XAFA 5HOSA 4KIRA 4S3JA 4J3SA 3VI2A 3UT0A 2X2GA 1YQ2A 2UWFA 2YB4A 5DELA 1AD4A 4WOQA 1B3XA 5IFPA 2PP1A 4WDXA 5GNXA 3WBWA 4DBDA 1CIUA 2TYSA 1ZBWA 2FZ8A 3UYCA 3OZPA 4FALA 3RMEA 3F1QA 3B0VC 1X1ZA 4O14A 1V02E 1YMYA 1PX4A 1VFSA 1H49A 4TVCA 2D20A 3GYEA 4PBEA 5D2XA 4OKDA 4IOTA 4IUOA 1OHLA 3NVDA 2YCKX 4A8NA 1AL7A 2IS7A 3KL3A 4RK8A 4DUOA 4ZO9A 1TREA 4NZJA 4XB3A 3S6OA 4DZ5A 5AHEA 1XG4A 3OVRA 3K46A 4X0NA 4I9JA 3WFZA 3F5KA 4D71A 4AY1A 4GISA 3THDA 5HUPA 2VC5A 5HAOA 3H6OA 3TIMA 1GNXA 3VOJA 3QZAA 5LXEA 3L9CA 3ZJ7A 4X63A 3DX5A 4LAMA 1ZU8A 2XN1A 5TNVA 4ZBCA 4PB4A 4AMAA 1BYCA 1IHIA 3ZT5A 4MADA 3NDYA 1W3JA 3I7SA 3ECQA 1B3YA 1US0A 2OODA 5AYYA 2HZGA 5DRCA 1MDLA 1PTGA 4K3ZA 1S2WA 1YRRA 2QW5A 1OADA 4X61A 3V5CA 1ZAHA 3PAOA 4EWJA 3ZJ6A 3LTYA 1XINA 2HBVA 3WENA 2FHCA 2XTKA 3AU2A 2BY0A 3OYZA 2Q8XA 3W6YA 5C9UA 4Z1YA 2EO7A 3B8DA 1YW1A 3TR2A 5JH2A 4GIYA 1XRTA 2X1RA 2I17A 3VIOA 5F2MA 1NWRA 4QE1A 4O52A 2POTA 3C2EA 3GZ3A 2WZTA 1WNOA 3IJ6A 4KFOA 5AYXA 1QPNA 1S2VA 3E0FA 1KNWA 4NASA 3FSUA 3WD4A 1DJWA 1S2CA 4B9YA 2HRWA 4LYPA 2ZTJA 1DQXA 4H2HA 3BJTA 2BWGA 4XKYB 4JYFA 1YPFA 2Z1XA 3PNZA 1JZ5A 2G3IA 4GC4A 5CZKA 4XZIA 3FNDA 3LXCA 2YPIA 3GU9A 2CU0A 4MWAA 4O54A 1U1JA 4A22A 4PUMA 4UMBA 2ZWYA 3LPGA 4ICCX 4AWUA 4DBSA 3TA6A 5CBIA 4NZ5A 3JS3A 3GDBA 3AROA 5G1MA 4F48A 2R1KA 1VFLA 4JIHA 2W5FA 4XQ6A 4AD0A 5K2ZA 3VVGA 1FKWA 3LSCA 1Z9AA 1XYLA 5DXYA 4AD3A 3W00A 3TLQA 2EPOA 1YNYA 4OGZA 1XKYA 4NUWA 3M6YA 5JXQA 1X96A 1ZAIA 2P3ZA 4RV3A 1IWPA 2YW4A 4GPNA 2RGMA 3HQOA 3XIMA 2QAPA 4XD6A 2E67A 3ZT7A 1H2JA 1PCKA 4PUUA 1WKDA 1JPHA 4W9TA 1ZHAA 3MJMA 4B9ZA 2PDQA 3QQ0A 1Q13A 3AMCA 4QJ3B 3SFKA 1KB3A 1IGWA 3ZMRA 1GTHA 3NQMA 1K7EA 4M82A 1TELA 4O57A 3WLNA 3LCGA 1VRDA 1XLEA 5IM51 5CPQA 3QMRA 5EMLA 2ZC8A 3RLVA 3TH6A 2OMAA 4OE7A 5A6BD 1QPRA 4NAFB 1EQPA 2V0TA 3EWZA 3NSXA 1XRVA 4AEFA 2W4XA 4R3UA 4TXEA 3TN4A 1EUAA 1A5CA 2WMGA 2HCVA 3N2OA 4WF7A 2WSRA 2IPJA 4WDTA 2GSEA 2XVNA 3UZJA 2DEPA 3H55A 1MRQA 2J66A 3BOFA 1WXYA 4UQEA 1QK2A 1Q6CA 3MSYA 3W7HA 5B7ZA 3LGDA 5C71A 1EXPA 4WIWA 1BQCA 3F2BA 3JVAA 1EGVA 4W85A 4K8GA 2E28A 3AHTA 2V30A 3BAWA 1X6UA 1R46A 3AMKA 5IDZA 1ONEA 2BV9A 2Y62A 2INEA 3U0HA 3GFYA 4WSKA 5D9PA 1WB0A 1PIFA 5HA7A 4BFAA 4BI5A 2EJ1A 4Y9AA 4D72A 4WUIA 4HNTA 3VC5A 2VUYA 3LLFA 5KEZA 5D9NA 4KERA 1HKVA 4J2PA 4EE9A 2YYTA 1O1ZA 3UZXA 1NAL1 3DBPA 3SB0A 2VR2A 3T55A 3TQKA 2PDNA 3LHZA 2DFAA 3VNIA 2VDHA 4QX4A 5M1TA 3PUEA 1C7SA 4PH6A 3KLLA 5I02A 3B06A 5LGZA 1YPXA 2G97A 3PY2A 3VK5A 3VKBA 4GOAA 1ZCCA 3O2LA 4PTMA 2AKZA 4JTUA 1Q7MA 4M1RA 4YN5A 1XUZA 2A6LA 2MANA 1KFWA 3H24A 1EFZA 1JXJA 5HXMA 5C7VA 2FHFA 3SIMA 4G2DA 3AYSA 2FVLA 3HJEA 1HO4A 2WCSA 4HBKA 2EBNA 4JX6A 3PTMA 4PB3A 2YOCA 3GK0A 3THAA 4H9VA 1YDYA 4L64A 5D04C 3FJ4A 3MY9A 3PZTA 3E0VA 2VURA 3W3OA 1H7XA 2X41A 3FFSA 3M16A 5DF0A 1DQUA 1R3WA 1XCWA 4AW7A 5LA0A 3MANA 1EKOA 1ISXA 1WDSA 1WOBA 1YXYA 4HK6A 4JFUA 4CQ8A 4C1NA 4OOZA 4RDVA 1PEZA 4NKCA 4L4LA 5GNZA 1R3RA 3W0KA 4B4FA 2HVNA 3GHUA 1FWIC 3AWOA 3VILA 4E2VA 1RR2A 1WZKA 3LERA 1JCLA 2QCGA 2NLIA 1BWVA 1E6SM 1XIMA 4OQVA 4JX4A 5I3HA 4BWLA 3W1XA 2V3GA 1A0EA 1ITXA 5FEWA 2R24A 3VDAA 3INPA 1A5LC 1VLIA 4F9JA 5CZJA 3UXLA 5HNNA 3BCFA 1TWZA 2DQWA 4DELA 4GI6A 3RYSA 4HJWA 2QV4A 1SMAA 4TMBA 1J93A 3NXFA 3EDEA 3PUGA 1JI1A 3AC0A 1CX9A 3MPGA 3VKCA 4DIAA 1GPFA 3WCZA 3W1MA 5E70A 1C9WA 3L65A 5BWFA 1VJSA 2CHOA 1DJGA 1DTUA 4EF8A 4LT9A 2QCDA 3M5XA 5G1YA 2GQAA 4TR9A 2WSYA 1MVYA 4UOZA 1RCOB 1BEUA 3BV4A 1P43A 4PUJA 4DN1A 3AIBA 3C2FA 4CQBA 3M5YA 3SQLA 3FJ6A 5CPMA 5FAJA 5CJ5A 3W74A 2V3DA 2HJPA 3BLFA 4RE4A 1G4PA 3VU2A 2PDMA 1EHAA 2QZRA 3KLKA 3WK1A 3CZJA 4RDZA 4TX8A 3LLXA 4AUBA 2UZ9A 2W9MA 1VFHA 3H2AA 3BL3A 3W75A 3WD1A 4DI8A 2WWCA 1QNSA 1Z41A 2JE8A 4A3RA 4GZIA 2ODOA 2WK2A 2WZHA 4Z42C 1AG1O 4GK8A 4JKKA 4E4PA 2XM2A 1SFTA 3UETA 3SCSA 4HCDA 4W7VA 3WK2A 5LNRA 3CEUA 4UQ9A 3R8HA 2Y5SA 3BLIA 2REQA 1DE6A 4CGTA 3DECA 2OZ3A 4YS1A 4UFMA 1RALA 1XLDA 2V2CA 1E0TA 1R2RA 4EAYA 9XIMA 3KRBA 4QM1A 1K02A 1R5YA 3HPAA 1EUNA 2PDXA 3I6EA 1HFBA 1XDLA 3G1HA 1XM3A 3RXZA 2QJHA 3A9IA 1K3UA 3REQA 4DZAA 2VC7A 1A5NC 5BROA 5C2CA 3ONCA 3D3AA 2A3AA 3KWXA 3O0KA 4H8HA 1GOWA 5A69A 1H7WA 2DIJA 4HNOA 4AZCA 4F79A 2VGBA 1KW1A 2ZXAA 4NAEB 3NZQA 4BCEA 5M5DA 2FH8A 4HPNA 3WFLA 1DYSA 3AIQA 4D6GA 3I3EA 3SN0A 2V5CA 2F61A 2J88A 2V8ZA 3OPSA 5JBFA 2P0IA 4E8DA 1TA3A 3AYRA 1DL3A 1YADA 1OABA 4L7ZA 4Q4SA 3CHDA 1UH2A 3GR8A 4O8RA 3P7YA 2W6RA 1KM0A 4U3AA 1KC7A 4L1GA 1M7JA 2PLJA 1I75A 4RPQA 3WEMA 2NVDA 1CT5A 3FA5A 3BK0A 1O4UA 3TC6A 2EKGA 2E68A 2PB1A 1KXQA 4FNTA 4D6DA 1OJXA 1UPMB 3DHFA 5DT7A 3GTXA 5T9BG 1EX5A 4Q4PA 1HIZA 2XFRA 2HPIA 5FA5A 1OSEA 3T8QA 4QJ5B 1E3ZA 1QHPA 3ZM8A 3ITCA 1Y8BA 2NUYA 3PB0A 1GYNA 3AIUA 2NQJA 3A13A 2BXVA 2A0NA 3N2MA 4HSNA 3BLLA 4NYYA 2A21A 3U4AA 3WL1A 1HGWA 3UR5A 2J7CA 4ZZ9A 2XSAA 3LBOA 1W1ZA 1A4MA 4JKLA 3O3RA 3HPFA 1K6WA 4JTCA 1E3XA 3GR4A 1B3OA 1EL3A 4D6FA 2DW6A 3JZEA 4JTQA 4JDYA 3LN3A 4XBSA 3CJPA 5KZEA 4LCSA 3ZWTA 4YXGA 1UMLA 1XP3A 5I79A 5FIPA 5FOOA 2PBGA 4IGHA 2X1SA 4JOMA 1WQ5A 3DXIA 1TV5A 1M3UA 4UXDA 3OZYA 1X38A 4F0KA 1MUMA 3R58A 3VINA 2O56A 1DIKA 1VAHA 4HOWA 1UZDA 5H8PA 3W1LA 1HW6A 2IKGA 2BASA 1E0UA 1XLIA 3EX2A 3O7UA 4GCXA 3C61A 3UG8A 5AC5A 1L2UA 3BSGA 4KKXA 4M51A 4FS9A 3VNJA 1ME8A 4QROA 2OQYA 4QEEA 1CXHA 3NO3A 2J77A 5EBUA 4LS0A 1M9HA 3AYTA 2XGIA 1T41A 3W85A 4CU8A 2AAAA 3AHYA 3WLSA 2F6KA 2VRQA 3S47A 2VEFA 1V3LA 2G41A 3SZ8A 1L6YA 3V5OA 3N9SA 1HJSA 1OYAA 2PCQA 3C2VA 3BG3A 4QE4A 2NX1A 2P50A 1LTDA 3CV6A 5C8BB 1QBAA 2CC0A 2F7FA 4P7LA 1BKHA 1TTIA 4HA4A 1MZRA 1MYRA 1XG3A 3P0WA 2VHLA 2EKCA 3V36A 1TPVA 4C7FA 2AQOA 3QOKA 3GNXA 5A2AA 5LA2A 2XPKA 2CZVA 1GOXA 4FK9A 3QQWA 1I8JA 4Q8QA 3SGGA 1H7RA 4GJJA 2P0OA 1D7KA 4FIRA 1KWGA 4NQ1A 1R0MA 4DJFA 4IT1A 3H4XA 4BK9A 1LOLA 3UWZA 3CYJA 2VR5A 4E2BA 3WQ6A 2CYGA 4QRNA 1MO0A 5FEXA 4JS3A 7PTDA 3KVMA 4GACA 1V6XA 1UD8A 1UQYA 3HG3A 3TCEA 3LRMA 9CGTA 1TWSA 5EMYA 1K8YA 5D9OA 2NSXA 1EO5A 1E73M 4Z2GA 2V2DA 3IRSA 4I7UA 3T40A 4ASTA 5BRPA 1IEWA 3QC3A 5AECA 2XSXA 4D9PA 5T9CE 1EZWA 1BVWA 3ICJA 2EQDA 1LQ2A 3L23A 3UZZA 1OD0A 1MUCA 4BF7A 4LUIA 2GDUA 2DP3A 5E9XA 1D3HA 3T78A 5C6MA 1MW1A 3TWBA 3L4UA 1RY0A 3DGRA 4I9AA 1P48A 1UWRA 4KGJA 2BODX 2E5DA 1F4AA 4WZHA 4JIRA 4ADUA 1W91A 2VQUA 2G96A 3NL2A 1T6MA 1K9EA 2PP0A 4UTTA 3LU2A 3EAUA 1UWSA 4I9MA 1KM3A 4TU1A 4O28A 2ZDSA 1GJUA 5BXSA 5A8PA 5REQA 1E40A 4L1WA 4LH8A 2NLYA 2E9MA 4IQLA 1XIEA 4QHRA 5HQLA 3H7VA 5H8UA 5IOBA 4PTVA 2GJLA 3ZFHA 3EB2A 3MSDA 4PMRA 3W23A 5G4WA 4CCEA 3VABA 3BZGA 1BVZA 5CJNA 3ZXWA 2J47A 1G01A 1HZYA 3BAKA 1QUMA 3R7MA 4WQ6A 3TV8A 3FVMA 3OQEA 1HNYA 4ERAA 3SDOA 1FWCC 4GQBA 4ZO6A 3BZJA 3EDDA 3LHVA 3B8WA 3ABRA 4UWMA 1O60A 5LIKX 3N18A 2RH9A 1UWIA 1SJCA 3B0XA 3QQ1A 1PYMA 4GQ0A 3B03A 4A3YA 5A8MA 2PD9A 1MRAA 3TTEA 1AQ0A 4GNVA 3U3HA 6CGTA 3KTCA 1F8MA 3W7GA 3LBCA 3UU0A 3MCNA 4LAKA 4J9JA 2OQLA 4CU7A 1E72M 2B4GA 2DSUA 2X40A 1A80A 3TYBA 4YU1A 2VCBA 4XK2A 2VDIA 2P1FA 2DV0A 3KOYA 3MKKA 4IG2A 2FFIA 1NARA 1SFJA 1JCJA 4H7CA 1PHQA 4Y8EA 2ZCGA 3HOJA 4GQGA 3S1GA 4A29A 1QTWA 4N6FA 2YL6A 3AZRA 1I0DA 4B3LA 2J6VA 2IPWA 1QAPA 4ES4A 1BSIA 2I56A 4PB5A 4X2PA 3STEA 1JDEA 1PX3A 4P8VA 2H90A 1XIGA 1BSLA 3BOXA 1R85A 4TOQA 3GU2A 2Z1SA 4EOUA 1Z42A 1KBJA 4RE0A 4OIFA 2YCEA 1XGDA 4UR9A 4C6BA 3NZPA 1AH4A 5I09A 1ICPA 2WO5A 1NVMA 5DBTA 3DU0A 1T8QA 3MBFA 3SSZA 5CC5A 3G1XA 4A21A 1EPVA 2IKHA 2X0YA 4BA0A 5I3IA 4UOJA 1AJZA 1K9DA 2IQ0A 3CO8A 2PWDA 3WLRA 2WXDM 1JXKA 2YFOA 2V3EA 4KWUA 1EBGA 1W1B1 1G4SA 3B8IA 2YDAA 2G8ZA 2ZRVA 4FNRA 1XSIA 2QJMA 4ZODA 1TKKA 4B15A 3QV8A 5HNRA 1XH1A 2NT0A 2XN0A 3AIWA 1DPMA 1VR6A 1XWYA 1ZJBA 3EBVA 1K7XA 5A94A 2QCEA 3GUWA 3ITXA 3QV6A 3RLHA 2FFCA 2OT0A 1EJVC 2VENA 3G3DA 3P5ZA 4TX9A 1RXOB 1SR0A 3IANA 4V1XA 1P1XA 3I6TA 1JF5A 1E1FA 3AOFA 1ECQA 2WMJA 1W2VA 4KS0A 4BQ3A 2WB5A 1OX4B 3NO1A 1SUXA 3ABSA 2FZNA 5DMMA 1SZEA 3W9ZA 1K03A 1I4NA 4RZ6A 1VGAA 1EEXA 4ZQOA </