4O0KA

Crystal structure of 1-pyrroline-4-hydroxy-2-carboxylate deaminase from brucella melitensis with covalently bound substrate
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
323
structure length
322
Chain Sequence
HHMLKAEIFSGVIPALMTPCKPDRSPDFDALVRKGQELIGDGMSAVVYCGSMGDWPLLTDAQRMEGVERLVKAGIPVIVGTGAVNTASAVAHAAHAQKVGAKGLMVIPRVLSRGSAIAAQKAYFKAILSAAPDLPAVIYNSPYYGFATRADLFFDLRAEHPNLVGFEFGGPADMRYAAENITSRDDGVSLMIGVDTAVFHGFVNCGATGAITGIGNVLPKEVIHLCNLSQAAALGDVDARQRAQELEQALAVLSSFDEGPDLVLYFKHMMVLKGDKEYTLHFNETDALSESQRGYVETQFRLFNTWYAEWSKLPGAVQRCKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrodipicolinate synthetase
publication title Crystal structure of 1-pyrroline-4-hydroxy-2-carboxylate deaminase from Brucella melitensis with covalently bound substrate
rcsb
source organism Brucella melitensis
molecule tags Lyase
total genus 121
structure length 322
sequence length 323
ec nomenclature ec 3.5.4.22: 1-pyrroline-4-hydroxy-2-carboxylate deaminase.
pdb deposition date 2013-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4o0kA00
1G6CA 2X30A 2CFFA 1I2QA 4UTMA 4RR4A 2QJGA 5DBUA 4UTLA 5FEPA 3W7OA 1H7OA 3PG9A 3NZRA 2E09A 3KVKA 1XBXA 4AF0B 5TQLA 5FF7A 4WXYA 4H6KA 3GYEA 3KOFA 4GC4A 2UV8G 2Z1BA 1WYIA 3STGA 3WK3A 3NQVA 4IMGA 4QJ1A 1SZEA 4I7WA 1R2RA 4JY8A 4BI6A 3EWUA 4HKPA 5D30A 4EF8A 1EA0A 3GB6A 2V81A 2RKXA 1ZENA 4OBTA 5AYXA 1NSJA 2Y88A 1LM1A 3W22A 4Y8FA 2NUWA 2H8XA 2E6AA 2C19A 3QPYA 1OF8A 1LLZA 1JCMP 3O6CA 1TTQA 2ZRZA 4CCCA 4O11A 1FWSA 3MYOA 2CW6A 4UTWC 3TXZA 1KM5A 3R13A 3GDMA 4UCGA 1YLVA 3P8IA 3DAQA 3NQAA 5LNUA 2XN2A 3BW2A 3O8AA 3QMRA 3L9CA 1D3HA 3LRMA 1J2WA 1TPDA 3GAYA 4JNMA 2NZLA 2YGYA 4AHQA 4TX9A 5IBXC 5CPNA 4N6EA 4AB4A 4ICNA 1G7UA 2YYUA 1VHNA 2D73A 3P81A 1W5OA 4MVAA 3DZ1A 1VCFA 5L6UA 5AFDA 1OFBA 5U4NA 4O1BA 1GT8A 2ZZ3A 2HS8A 3PG8A 2NXIA 5FF2A 4JTEA 4K36A 4LS1A 3QW4B 1W5NA 1PL9A 1JJKA 3SY5A 1SO6A 3WFAA 2FB2A 2G96A 1OHLA 2QCNA 5KMYA 1NFBA 2YX0A 4JTUA 3GXPA 1RR2A 2CLIA 4MFEA 1KFJA 5CZSA 4DXVA 4Z0SA 1T99A 3W7NA 1O4UA 2ZRVA 4N9BA 4ZQRA 5BNKA 1DORA 4O1AA 3SGZA 4LUJA 5D2YA 3DFOA 4AEOA 4AHPA 3FKRA 3QH2A 2G5WA 3ABSA 3GR8A 4IPIA 3E96A 3I7RA 2X1TA 5D2TA 3CIWA 3OVRA 2NXGA 2VEIA 3RMJA 5LNWA 1EIXA 4POCA 1K7XA 3LXAA 3P82A 2BLEA 5I3KA 4EVZA 4XBKA 3DHFA 5HJLA 3A23A 3NQDA 1XFBA 5CZ0A 3W86A 4NNAA 4YMZA 2CLFA 4BI5A 3KHJA 3C2RA 1GTEA 2C0AA 1KM0A 3DI1A 3GNDA 1Q6RA 2WSYA 3W72A 2NXHA 3B0PA 3IIVA 3LM7A 5K2ZA 3STFA 4TMCA 1ZNNA 4O53A 3QMSA 2CLEA 2WQPA 3W74A 1DOSA 1F74A 4M19A 1VYRA 4JDYA 1VHCA 2C1HA 5LKYA 5AHMA 3RU6A 4S1FA 4PCFA 4LT9A 1X8FA 1QPNA 1QR7A 2YXGA 4OWGA 3WJWA 5L9FA 2QUTA 3NL2A 5CPMA 3M5XA 4MZYA 3PBYA 3A24A 3NDOA 4UTHA 3PWAA 3QPZA 2NX9A 3CEUA 1AG1O 1OX5A 5AC6A 5HR6A 2R94A 1ALDA 3TCEA 3LI0A 4WJEA 3W7RA 3WK2A 3UY8A 3GDLA 3W1PA 3W70A 2J9ZA 1LOLA 2VC6A 1AK5A 1QDSA 3NPUA 5AHEA 3QMTA 1S5TA 2GVJA 3MP5A 3P60A 1D9EA 1UB3A 3M5ZA 3QQ1A 1XI3A 3QYQA 4QNEA 5AC8A 3N19B 2A85A 5FF3A 3BLEA 4AXKA 4KWWA 3N9SA 4Z1BA 1BEUA 1V7YA 3W1LA 1H51A 3CWNA 2QJIA 4UR8A 3E9AA 1TIMA 4N2YA 1YXCA 1G4TA 2C6QA 4CNPA 4NXKA 3I68A 2AAMA 4JX5A 3S1VA 4IWWA 4MY9A 4LW7A 1K8XA 4ZZ9A 3QSTA 1WV2A 3M5YA 2QAFA 3O05A 5LNSA 4GXMA 1LYXA 4IMCA 4PL2A 3UD6A 2OZ0A 1W5MA 1Z48A 2WV8A 3F03K 2FB3A 1NAL1 3G1FA 2C13A 3DU0A 1K8ZA 3G8RA 1FCVA 3ABOA 5I3IA 1P5BA 4K6AA 4M7SA 3W7IA 4FB7A 3HPXA 5DCDA 5A8GA 1ZAIA 2ZZ5A 1M7OA 3NG3A 2NWSA 1JVNA 1RQHA 1SU5A 3M43A 3PB0A 2OT1A 1OFQA 3G1XA 4FIQA 2X1RA 3OIXA 2CLHA 2DP3A 3G1YA 1SSGA 1KFLA 2PCQA 3IGXA 3CWOX 1HO4A 1O60A 1QOPA 2J6XA 3DI0A 2V82A 4NJHA 2BTMA 4NZFA 1KFCA 4ZQNA 1LP6A 2E5CA 1QPOA 3LRKA 5SWUA 5D03A 1A53A 2GUUA 1PCWA 2CZEA 4OU1A 3O63A 1JQXA 1XL9A 3U2OA 2VFGA 4NXSA 4UTIA 3CHVA 4UFHA 1QNVA 5LZLA 2A1YA 2A5HA 2HTMA 3GDKA 4YCOA 2W6RA 2R8WA 3SFKA 4UTUA 4R7JA 4GNJA 3B03A 3S5NA 3NQEA 5EY5A 4GRSA 4R34A 3L68A 3RLUA 1PHQA 3W7KA 3WK1A 5F1VA 4GFSA 4JDBA 1OG0A 5C2XA 3LTSA 5EKYA 3CEPA 2Y7GA 3M6YA 4HNVA 3W84A 4JTFA 4ZMGA 1G7VA 1JCLA 2V5BA 3EB2A 2C18A 5FESA 3L21A 2Y89A 3MI6A 5LGXA 1YYAA 1NF7A 5I3GA 1OABA 1TJPA 3PBWA 3OVPA 2AQWA 2G95A 4BK9A 4CCDA 1BWKA 2DZPA 2PURA 2X16A 2VEPA 3C61A 2GPTA 2VENA 4O10A 1TPWA 1X1OA 1TCDA 1HL2A 3UZ5A 4NX5A 3C2FA 1MEIA 2B7QA 2ZZ7A 3I7QA 1F76A 1J5TA 5AHNA 3H55A 2A0NA 4JXCA 5J5DA 4GBUA 1ZY9A 3N9RA 4EIVA 2XN1A 5CSRA 3E12A 4H3DA 4JYFA 4R53A 5G2HA 3EWXA 4O12A 4KFPA 4N6FA 5CZTA 3W9ZA 3EWBX 4DO5A 4GUHA 4LRTA 1EP1A 1IF2A 1R47A 4TR9A 2VEMA 2Y61A 4C1LA 2JKPA 1QFEA 3QRHA 3TROA 3L5LA 1YPFA 1FUYA 2QDHA 3G1SA 4UMCA 1HG3A 3IVSA 3IGSA 3M44A 1AW2A 1BKSA 5HINA 2ZDRA 3L0GA 3QJAA 1L6WA 3ATZA 5D04C 5D2XA 4O50A 3TIMA 5I3FA 4XTIA 2C15A 4YXGA 3NM3A 4JN6A 3W76A 2GJNA 1ZHAA 4JR5A 4FEZA 4JGDA 4JTGA 2Z6JA 1LORA 3LLFA 3NM1A 3KAOA 4JX6A 5DLCA 3VFLA 4AVFA 3O15A 3A5VA 4DO4A 2CZFA 2FFCA 2A21A 3S0CA 4IXHA 1LDCA 1T8XA 3YPIA 4E0CA 2P10A 1V5XA 1ML1A 1YXYA 4LVFA 3HIJA 4GE8A 3FIGA 3G0SA 1K8YA 2NX1A 3A22A 3IIXA 2NX3A 1KM4A 3T78A 4IUOA 1YTEA 4JTLA 2E5BA 5DY3A 5E1QA 3DFSA 3UPBA 2R14A 2JGYA 1ICSA 1W0MA 1O94A 1OX4B 1JRBA 3INPA 4DO6A 1WXJA 5C55A 3GNNA 1TO3A 2Y7FA 1WBJA 1L6SA 3C0JA 1YDVA 1OFEA 3TUUA 3THQA 2Y7EA 1GEQA 1I2PA 5D33A 2ZZ1A 1JCXA 4AMAA 5KITA 3B05A 5BRBA 1QWGA 4NU7A 4CNNA 3WJYA 2G97A 2QEZA 3HOJA 4XZ9A 3B04A 5G4WA 1HO1A 4UFMA 2PE4A 3TX9A 1XKYA 1XCFA 1XBVA 2V9DA 3W7MA 1ONRA 3N14A 3GLCA 4X9SA 3NR0A 3O16A 4RZ6A 4LS0A 4ZL1A 4MPQA 3DENA 3DXIA 3C4UA 3L67A 4XWUA 1X7FA 4OGZA 4U28A 1KA9F 1KTCA 3P8JA 4ALDA 4R33A 4MJMA 2BXVA 3HGSA 1KFBA 1OK6A 3GKFA 4ZVJA 1SUXA 2PC4A 3GXTA 3EXTA 3RLVA 1DHPA 1PVNA 2J88A 3NOEA 3TFXA 3PM6A 1OYBA 4Z1DA 1ME8A 3ANYA 5K4XA 4WY0F 1EWDA 4M6QA 2O7QA 2FIQA 3FA5A 3KRSA 4LU0A 4Z1CA 1G67A 2VXNA 2XN0A 1IIGA 3D0CA 4UIOA 3TNOA 1JUEA 1WDWA 2W79A 4QNWA 1LRNA 3TC6A 2TMDA 1O5KA 3S6DA 4HNTA 1LZOA 2QCMA 3HMJG 5AHFA 4B5NA 2BSLA 4NJJA 4GUGA 4O19A 1X1ZA 3S5ZA 3LX9A 3NZ1A 5EL1A 1ZCOA 3UYCA 4RZ5A 4IMDA 2Z0IA 1OF6A 1VYSX 1U5JA 3C3NA 3S1WA 3TSMA 4HPJA 3DFTA 4NJKA 2YPIA 5CZJA 3W7HA 3CU2A 1SPQA 1OFAA 3IIOA 4UNLA 3FEMA 1UJPA 4O54A 2DZTA 4LOCA 4HNNA 5CKSA 4J9JA 3MHUA 1A5SA 2GJLA 4ORMA 4UUIA 2RHGA 4LUIA 2CLMA 1S5WA 5DCEA 3TDFA 4HNUA 1LROA 4K8HA 3HBLA 3G1HA 1MEHA 1F7BA 4DBEA 3LGEA 5C5YA 2O7SA 3ZR4A 4CNOA 1SZFA 1DVJA 4Y9AA 1H7RA 4TU1A 2GOUA 1SO3A 2FDSA 1R46A 4NJIA 4UFIA 4JTTA 1VS1A 3E49A 4A3UA 5BMWA 4CLMA 2DZSA 1TQXA 3C2VA 3HB9A 4RV8A 4K8EA 1FCBA 3CT7A 1DV7A 3G3DA 5AHIA 5DN1A 2FPYA 3W1QA 4JX4A 1XUUA 3W1RA 3L5AA 4HHPA 3BPWA 2X2GA 3VNDA 1W37A 3GZ3A 4O13A 2RDUA 3UWUA 5G2WA 5H2ZA 1F73A 3N2MA 1KTBA 5HR7A 3QM3A 5KTLA 2Q8ZA 2DZVA 2XFWA 1C9DA 4L4LA 3WK0A 2ZRUA 5EA9A 1W1ZA 4HT3A 2YCEA 2WKJA 2Y63A 4IX2A 4RX0A 5DBTA 2Y85A 5G5IA 4ADUA 1DQXA 5DY2A 4MFDA 2ZRYA 1B3OA 4O57A 3W7QA 1DQWA 3EX1A 1TV8A 1W31A 2E68A 3CB8A 1KW1A 3EX2A 3HG4A 1M5WA 3P80A 3BK0A 4IXXA 3QFEA 2HS6A 5HNRA 1YDNA 6ALDA 1FWTA 3EKZA 5HWJA 2V2CA 1JQVA 1VZWA 3BO9A 4JIQA 2EAWA 2RH9A 1Q3NA 4K39A 3UXAA 3W7JA 1K7FA 2GQ8A 3SIZA 1JCYA 1H7XA 3TFCA 1YPIA 4JTSA 3DFPA 2DORA 3IVTA 3W1XA 3HJZA 3W7CA 3HGJA 3QC3A 4CCEA 1D3GA 2WJZA 4AF0A 4Q4KA 2PRHA 4EWND 3G0XA 1DBTA 1MSSA 3TSBA 3EXSA 2Q8LA 3HO8A 1OFDA 4MZ8A 3N3MA 3B06A 1K7EA 3TV8A 4DBDA 2WSQA 1JCNA 4JYEA 4Y6GA 1A5AA 3DFQA 4NT0A 3SW6A 2ZRXA 4PA8A 1FQ0A 3BGJA 2EHHA 1DL3A 3TAKA 3LCGA 4A22A 1F6PA 1Y0EA 4LRSA 2E6YA 5AOUA 5AB3A 1SO5A 4IQLA 3LHZA 4IMEA 3Q58A 5AYZA 4DELA 2V30A 1N55A 3L2IA 4FNPA 1SQ7A 4O14A 5F4XA 1VH7A 1FXQA 2HSAA 3BG9A 3OG3A 4O4WA 2Q3OA 4W9TA 3O07A 4WOZA 1OX6A 3PC0A 3VCRA 3MMTA 2FLIA 2Y70A 1I2RA 4FNRA 1VYPX 5U7SA 4LS2A 4BR1A 5I3HA 1ZAHA 3KVMA 3G24A 4A2SA 3UNDA 4A2RA 3C8FA 3VE7A 3TMLA 1ME7A 3G18A 1QAPA 4YWIA 3STCA 1B4KA 2DZWA 4RK8A 1F2JA 3EWYA 3W2NA 2X1SA 1GTHA 5HUOA 1FBAA 2DZUA 4LV9A 2CLOA 1PCKA 4S2CA 4C1KA 4NUWA 3GXNA 4DPPA 3ZFHA 1GVQA 4FNUA 4I7UA 3F4NA 4RXFA 1H1ZA 1SSDA 4FX7A 3EX6A 4Y96A 3JRKA 5K9XA 4JD4A 2CLLA 4FF7A 1L2UA 3UY7A 4FX6M 3W73A 4XBSA 1WX0A 4M5PA 3ABQA 2RFGA 5FF0A 4H4IA 3DBPA 1KFEA 5D05A 2I1OA 5K4ZA 1EEPA 3IVUA 4OT7A 1Q6OA 1DKWA 1Q45A 3ZWSA 1B57A 2CZDA 3VE9A 2VFFA 1HUVA 2Y62A 4IPJA 2NUXA 1VPXA 2JGQA 1RV8A 3W3OA 1MO0A 2GVLA 3FOKA 1Q6LA 2DU2A 4ML9A 3DKLA 3W87A 4HSNA 1IXQA 1WQ5A 3TW7A 2VKZG 4X3ZA 1LOSA 2YFNA 4O1CA 4G1KA 3C2OA 3L65A 3F4WA 4Z08A 2H8ZA 3RNDA 4DF1A 3O6YX 3W1AA 4N4QA 4OV9A 1GVOA 1TPC1 3PSWA 5G2IA 1A5BA 4P2VA 1TRIA 2V0TA 1B9BA 4XUGA 3TMQA 4BWLA 2V2HA 4N4PA 2QCLA 4FX8A 3WJSA 1AW5A 1RD5A 6TIMA 2TSYA 1TYGA 3W7PA 2J27A 4DEFA 4NNBA 3HPSA 2ZQ0A 5CGQA 2BZNA 3LCLA 4AAJA 2J9YA 1G4EA 3PUDA 4IMFA 3FKKA 4QSHA 3S5YA 3T44A 3TXVA 1TSIA 1XBYA 3LBMA 1I2NA 4UR7A 3THAA 1FCQA 4JTIA 4N9DA 3CM4A 4KFNA 3NA8A 1FCUA 4QQ3A 1C8VA 3NEVA 2ISSA 4YLWA 3BV4A 2WNNA 4O17A 4JTJA 4E2BA 5LNVA 4DF0A 3DFNA 2YW4A 3W2UA 1QOQA 1R30A 3UWVA 4DPQA 1NVMA 3UWYA 4O8RA 4WY0B 1YTDA 3SZ8A 3TQKA 5FEZA 3P61A 3ABRA 1LTDA 3P5ZA 4QISA 1LRTA 1LRQA 4AWUA 1TREA 3TR2A 1QPRA 5DXXA 3FYOA 2ABBA 1NEYA 3QW3A 4MOZA 4TO8A 4XTDA 3PF3A 4PODA 3Q37A 1PIIA 2ATMA 3USBA 2WPBA 4I7VA 1TV7A 4XKYB 4EF9A 3MP4A 4PTNA 3LTYA 4RXGA 3G1AA 3M47A 4MLRA 1EPXA 3S5OA 3UWWA 2WOQA 1MZHA 1CX9A 1P0NA 2Y6ZA 1GG1A 2V8ZA 4GUJA 4RJEA 1ME9A 4DQWA 1UASA 4Q32A 1A50A 4FNSA 1WA3A 4A21A 2NV2A 4PH6A 4ZQOA 2I14A 5CSSA 1KM3A 3B0VC 4IX0A 4Q33A 3HGRA 5HQEA 1VCGA 2EKCA 4QITA 4HIBA 3P74A 4JS3A 5IBXA 3RFAA 1OYCA 3RF9A 1AL7A 4FXRA 4UMBA 4EOUA 3LCXA 5CG7A 4NNCA 1YADA 4NJGA 3T7VA 1VC4A 4DF2A 3N73A 3I65A 1GQNA 2OMAA 3TJXA 2DJXA 2WO5A 4Y90A 2C3ZA 1TQJA 1OFOA 2TPSA 3Q94A 3KFTA 4BF9A 1R2TA 1OK4A 3G0UA 4OV4A 4TIMA 1H5YA 1LBMA 1PV8A 5TBOA 3L0NA 3TQVA 3G1DA 4ZQPA 4N02A 1RVGA 3S42A 1TV5A 3P84A 5AHLA 4MY1A 4PL1A 5D38A 1VGAA 1GJPA 2W0UA 1DJQA 1AL8A 3M1ZA 4IJBA 2CU0A 2QCCA 3TKFA 1I8JA 4NZJA 1EUNA 5A5WA 3U6WA 1VLWA 3M9YA 2B7OA 1GYLA 4RKAA 3LBCA 2QUVA 2VFEA 3PAJA 5EBUA 1HTIA 1YDOA 1IGSA 1I4NA 1BTMA 2YZRA 2QCGA 2EPHA 3CPRA 3NQMA 3G1VA 2QKFA 3W71A 3HGOA 1VLIA 4MKNA 1GVSA 1H62A 1THFD 2VFHA 2A7RA 4RLIA 5F2MA 3NPXA 1PS9A 2ZYFA 2ISWA 2NUYA 1LBLA 3C52A 3NQGA 4UMAA 1GYNA 3LHTA 3EEGA 3N2XA 2ZCGA 3W7GA 5T26A 2VFDA 5J5RA 5DELA 4AHOA 3NO5A 2B7NA 3LXBA 2PRMA 1TPFA 1GOXA 4PEKA 1S3HA 2E6DA 1IXNA 1OFPA 1RQBA 5AYYA 3FJ6A 2YFOA 5HUPA 5MHBA 1G69A 1H60A 3W2JA 1ZALA 1O5XA 3MW7A 3AO0A 3M16A 3VKJA 3R5EA 5LSMA 2QAPA 2QDGA 5TIMA 3UQNA 2C14A 1P4CA 4Z0JA 3CTLA 1F6KA 1N7KA 1I45A 5BMXA 1VJIA 1U83A 4NQ1A 3IV3A 3GKAA 4LWWA 1XUZA 3HG3A 2B4GA 5LHFA 2QF7A 1SZNA 3MO7A 3KXQA 1GZGA 3QQ0A 4WZHA 4M6VA 4JTHA 2ISVA 4LY8A 3KVLA 4L4MA 3LCHA 3QSRA 4WXZA 1W3TA 3TW6A 5IM51 4GUIA 2JKAA 5KZEA 2GQAA 4O0ZA 5C6MA 1H7WA 2FJKA 2VEKA 3I7SA 5G1YA 1MEWA 3SR7A 3OVQA 1E51A 4FXSA 2Z6IA 5G1TA 4YCPA 3W88A 4D2JA 4MYXA 5AC7A 2RDTA 1OX4A 4KWVA 3W2MA 1ZFJA 1UCWA 3DGRA 5D09A 3A5FA 3PUEA 3G22A 3GK0A 2DJLA 2CLKA 4MUZA 5F1UA 4QIUA 3HG2A 3W1UA 1AW1A 2H90A 3QZEA 3W83A 5CPLA 3NPWA 1W8SA 2J24A 2NV1A 2VOMA 1KBIA 4O15A 3RK8A 1Z42A 4X22A 1XDLA 1ICQA 1AMKA 3R89A 3NGJA 3W23A 2PRLA 1JULA 2F7FA 1JUBA 3W7LA 4JTKA 2TYSA 2H3DA 4X2RA 4BI7A 3SI9A 4CQ8A 3L66A 1KV5A 2E1DA 4TMBA 2ALDA 2EF9A 3LERA 3PS7A 2F84A 2WSRA 1OYAA 2R91A 5F2GA 1L6YA 5D37A 2HMCA 1W56A 2ZFAA 3MI2A 4I9AA 1ADOA 4UXDA 3W2KA 4KKXA 1KTNA 2E6FA 1C29A 2P1FA 3P67A 1EB3A 1TPH1 3LV5A 3MBFA 1FDJA 4PFMA 2Q3RA 3NQ8A 1TRDA 3OBKA 1WAUA 1EP3A 1SW7A 1KFKA 3UPWA 3M41A 3BG3A 1SO4A 1T96A 4AH7A 4WOQA 5F2LA 3DH7A 3L5MA 2A7NA 3G3MA 2TRSA 3M7WA 3TA6A 1FX6A 5AN7A 4WD0A 2X1UA 3O06A 4AWTA 3TAOA 4FHAA 3LHWA 2ZZ2A 3W6YA 1BWLA 2JKEA 3R2GA 5FEXA 4ONVA 4HSOA 3KVJA 3T4CA 2FQIA 4MJZA 3PULA 3CLMA 4QM1A 3MYPA 4CQAA 3W7DA 3PY2A 1XBZA 4JYDA 4UTJA 3KRZA 1LBFA 1R2SA 3LOTA 2EGZA 3NPVA 1H63A 1RPXA 3BVJA 2IQTA 4XQ6A 1TMHA 3HG5A 1B4EA 1GVFA 4FO4A 3LCFA 2QR6A 1K03A 3HQ1A 3W07A 1J4EA 1QO5A 5D32A 1KV8A 3O1NA 4QAIA 3NL3A 1GG0A 1UUMA 4GJ1A 3FYPA 3LXCA 3NXFA 3P62A 1TTJA 3EWWA 4MZ1A 1W5QA 3NQ7A 3GDRA 1GWJA 5EYWA 3TC7A 5D2VA 3B0UX 5DCBA 4LC8A 4PC8A 3V1PA 3WJXA 5D02A 1H7PA 4OE7A 2J9XA 1DJNA 3BLIA 4FIRA 3V75A 5BW6A 1TTIA 1ZJIA 1KM1A 2OX1A 3P7YA 3IRDA 1JCJA 1W3NA 4UTTA 2ZA2A 1EX5A 3LI1A 1CW2A 1SFJA 3K30A 2QCFA 4LV4A 3CC1A 2KZHA 1QCWA 2P0OA 1H7NA 3IIPA 5HULA 5FEWA 4IGHA 3TH6A 4IOTA 3IIZA 3E02A 3NNTA 1LLWA 3MP3A 3H54A 1S5VA 3IEBA 1LOQA 1Z44A 3NAVA 3EKLA 3OEXA 4K37A 2H3BA 2CZ5A 1K02A 8TIMA 3MBDA 2GVGA 2CWNA 1UBSA 1CI1A 3QEZA 3A21A 3FS2A 1RQEA 1TTPA 2B7PA 1IIHA 4U4MA 4M7TA 1JR1A 1K3UA 2FPTA 1XXXA 3KX6A 3S1UA 4O28A 1IXOA 1KM6A 3LRLA 3NQFA 3UWZA 3LCIA 3W1MA 3B8DA 2ZTJA 3R12A 5E93A 4ZQMA 3BGGA 2V5LA 3T40A 5F4WA 2ZA1A 4UC5A 1TPEA 3W1TA 5F2IA 4JICA 5FF4A 2ZZ4A 3C2EA 1F5ZA 1EUAA 4N9CA 3H53A 4NVTA 3I6RA 4KFOA 3LHVA 3SSJA 5K3VA 2YDAA 1L9WA 2YSWA 4LVBA 3EWZA 3MHFA 1GVRA 3NYZA 4OHQA 1OJXA 4O18A 5KZDA 5DXYA 1ICPA 4O52A 4P61A 2YW3A 3NL6A 3UWQA 1F05A 4S2BA 3LTPA 2QCDB 4OQVA 1KBJA 1SR9A 1QMLA 3CIXA 4LNYA 1X6UA 2ATSA 2ZBTA 3U8GA 1SW0A 3G8EA 3GR7A 1QPQA 4M6PA 5EPDA 2WNQA 1TPB1 3STEA 2ZRWA 3W2LA 2QJHA 3CQ0A 4FNQA 4JEQA 1FWRA 5EMUA 3LHUA 3KRUA 4HPXA 1H61A 3BW4A 4GWEA 3TQ0A 1VR6A 3FFSA 2I9EA 3A9IA 3T55A 2H6RA 5C54A 2YR1A 2QCEA 2JBMA 1FDYA 4LC6A 1HFBA 2ZZ6A 1SFLA 3UXDA 2ZA3A 2QUUA 3F1QA 3DKJA 3C6CA 3UZJA 4LTSA 2BWGA 3NQ2A 1N8FA 4RZ4A 4UNKA 4MY8A 3NQ6A 4NX0A 3S8HA 2Z2UA 3E0IA 3MJYA 3O6DA 3S1XA 3BLFA 5HWMA 4CQ9A 2V2DA 4JIPA 4E2DA 5LNRA 2OCZA 3C56A 1UUOA 3LDVA 4WX2A 1P0KA 5F4SA 3PBUA 4O1DA 1OFRA 5GVJA 4K7VA 3PB2A 1TPVA 3EX4A 2ABAA 3P5YA 1IXPA 3W85A 3JS3A 1QO2A 3WJZA 1I2OA 1ZAJA 1G4SA 4FNTA 3TU9A 1G4PA 1JRCA 3MUXA 3NL5A 4GUFA 4A29A 5LHEA 3LV6A 3PUOA 3TSDA 2NWRA 1KLYA 3GIYA 1M7PA 3DHDA 3BW3A 3N34A 1EP2A 3LHYA 2FTPA 4MYAA 1EWEA 1WOAA 2VFIA 4UTWA 4N9EA 2BX7A 4HN4A 5KSWA 5FI8A 1PE1A 1LCOA 4O16A 1Q6QA 3PR2A 3EX3A 3L0KA 4UTTC 1WOBA 1W5PA 5ABTA 4UTKA 3B4UA 3M5VA 1PHWA 3ZS4A 4ZQCA 1KLZA 3LLDA 1FDZA 1MXSA 4LVAA 2RDWA 4RCXA 3W75A 2YYTA 1VQTA 1FWWA 1RZMA 1XDMA 2OT0A 4UFJA 3ZWTA 5KINA 3S9YA 2B0MA 4MLJA 3GX9A 1P1XA 4O0KA 5G4EA 2E77A 1XM3A 1YXDA 4JY9A 5HMSA 4ADTA 3BG5A 1TPUA 2QCDA 2A6NA 1H1YA 2JK2A 1TJRA 4K38A 5K7JA 2LLEA 2FPVA 3SJ3A 2OJPA 1T0OA 2Y7DA 5K9CA 3OA3A 1VRDA 4BFAA 2DZXA 3IGUA 5BOOA 3W1NA 4AWSA 1FY6A 3MWAA 3LCWA 3R8RA 2E5DA 3HPZA 3TK7A 5H91A 2A6LA 2NLIA 3PBVA 1GPWA 1M6JA 3QF0A 5KZMA 1H50A 3GVGA 3FLUA 5CPOA 7TIMA 4ADSA 2WNZA 3FJLA 4WUIA 1A5CA 3M0ZA 1Z41A 3TJLA 3OHIA 1FXPA 3TE9A 4Z1AA 1YTKA 4WY0A 4UFLA 5K9DA 1XC4A 3PSVA 1O95A 1W3IA 5LGZA 3JR2A 3SGUA 3ELFA 2AGKA 4BWLC 1NF0A 2GQ9A 3GDTA 4MIMA 3PVFA 5E0KA 2QCHA 2ZTKA 3LB0A 1JUKA 3HF3A 3NVTA 1VCVA 3AJXA 1KM2A 3W7EA 2VELA 3Q2DA 3MHGA 3SECA 4UFKA 5HWNA 1OVDA 3EXRA 1FWNA 3ATYA 3BARA 2C16A 4XKYA 1SW3A 1WBHA 4K7YA 2A2IA 4ORIA 1TB3A 4LVGA 4O4VA 4E38A 4LVDA 4YL2A 2A4AA 2A7PA 5D2WA 3NQCA 3GAKA 1W54A 3VI2A 5I3JA 3MI3A 4WQ6A 1SZGA
chains in the Genus database with same CATH superfamily
1G6CA 2X30A 3DG3A 3VIGA 4UTMA 2P50A 2QJGA 5DBUA 4UTLA 2Y5JA 1Q6DA 1E4MM 1JGIA 4IG2A 3ZT6A 4WXYA 4LYPA 3GYEA 2GL5A 3KOFA 2UV8G 3WK3A 1V0MA 1NTHA 4QS5A 4QJ1A 5HXMA 5A1AA 1UR8A 3H7VA 1B3ZA 4JTCA 4BI6A 4HKPA 5D30A 4EF8A 2V81A 5GJMA 4JL2A 1ZENA 1SJCA 1SR0A 2NUWA 2PDXA 2H8XA 4DWSA 2BHYA 4IZGA 1JCMP 1MQQA 4O11A 1FWSA 4J3VA 3MYOA 2CW6A 2OXNA 3TXZA 1X38A 3GDMA 3GIPA 3U9IA 4UCGA 4KEMA 2F6XA 4UR9A 3L9CA 1D3HA 5ABFA 3QQWA 5ABEA 2O55A 4JNMA 2NZLA 2R9RA 5DMLA 2Q6ZA 5C9ZA 4AB4A 2YYUA 3PBGA 1W5OA 4RE0A 3A47A 1VCFA 5U4NA 3PG8A 3SRHA 4JTEA 2PP3A 4XSLA 4IQDA 4BCEA 2DSUA 3VIFA 1PL9A 1SO6A 3WFAA 2G96A 2QCNA 5FOOA 3IK4A 4I8DA 1KFJA 3LZ3A 4DY1A 4CNUA 4H9VA 5CZSA 4DXVA 4DM2A 3W7NA 4W8AA 3IJ8A 1MRAA 1DORA 1ZQ5A 4HJFA 4LUJA 1J12A 4KF1A 4AHPA 3N29A 3FKRA 5HMEA 3AXKA 2ZADA 3OA5A 4J5NA 4LUTB 2NXGA 4C5YA 5LNWA 3CLWA 3P0WA 3JZUA 3E2QA 1HXJA 3LXAA 3P82A 2BLEA 3UZWA 3AXMA 3VOHA 3DHFA 1S1RA 1XFBA 5CZ0A 2V38A 3KS6A 4YMZA 1XLDA 3KHJA 1S38A 3C2RA 1LQ2A 1QI3A 2WSYA 3W72A 3LM7A 5K2ZA 3T81A 2VGBA 3QXBA 4WSHA 4O53A 1R38A 3QZ6A 1XIEA 4M19A 2EPLX 4JDYA 1VHCA 4PTWA 3WNNA 2PFHA 1W6TA 3TYEA 1QR7A 2YXGA 3PZ9A 4PFHA 1XRFA 2YOCA 4E4UA 3CAVA 3EAUA 1W2VA 4UTFA 4HK5A 4FF5A 4Z1YA 3R8HA 4UTHA 5ABGA 3PPCA 1UP3A 3PWAA 4W8BA 1OX5A 3OGRA 2E7FA 5BZAA 3BURA 1ALDA 3TCEA 2DZBA 3LI0A 4WJEA 1TFVA 5M3WA 2I16A 3GE7A 2ZXAA 4HYWA 3W7RA 2P53A 3ZVHB 1RBLA 3UY8A 3APTA 4UOZA 3GDLA 1QNPA 3EZ4A 3VD9A 3W1PA 3W70A 4JKMA 3LY0A 4WKHA 5FL0A 2VC6A 1JI2A 1OM0A 5AHEA 1S5TA 2VQTA 2GVJA 4R5EA 3CZJA 3GG8A 1D9EA 2OOGA 3M5ZA 5REQB 4B3KA 3VINA 3BLEA 4AXKA 4KWWA 3KL5A 4Z1BA 1BEUA 3CWNA 2QJIA 4UR8A 1HJSA 3E9AA 3C8NA 4N2YA 1TR1A 1YXCA 1LUCA 2GDVA 5KEZA 2C6QA 2AAMA 4JX5A 4MY9A 1K8XA 2PB1A 4ZZ9A 1DJIA 4LBUA 3WLIA 2WMGA 2J74A 1W2PA 4IMCA 4I6KA 1W5MA 4N42A 4P7LA 1PIGA 3G1FA 2IKIA 4PTDA 2DDXA 4GJJA 1K8ZA 3S3GA 3E2SA 1FCVA 4JQ2A 1V3IA 5DCDA 5A8GA 1V6WA 2J6VA 1JVNA 1SU5A 3SJNA 2Z29A 1CGTA 3WQGA 4GI9A 3N9KA 1PTDA 3QGVA 2V5JA 4JTAA 2JEQA 1BG9A 1TG7A 4PUJA 2J6XA 1OY0A 1XGEA 1XG3A 2YXXA 1HJUA 4JQ4A 4F8XA 3F2DA 1A53A 3HQOA 1MQRA 4FSAA 1XL9A 2VFGA 4UFHA 5C71A 3ITOA 5CZKA 1QNVA 1E6QM 1Q4WA 5LZLA 1K1DA 4QX4A 2CERA 1O12A 4TTUA 3GY1A 1NWTA 1UD6A 4CEXC 4R34A 3L68A 4LUYA 1UKPA 1OT2A 5A2AA 4GFSA 3GC4A 3WQ5A 1OG0A 5C2XA 3LTSA 4LXFA 3VDGA 3GFZA 3AYVA 1J11A 3M6YA 1HF6A 4MDOA 4L64A 1ZSXA 4EX4A 4KWUA 3DHUA 4JTFA 1G7VA 1JCLA 2V5BA 3TONA 4O1EA 2VWSA 2C18A 2GUBA 3MI6A 4H9XA 3NIYA 4JIEA 1YYAA 1Q7MA 1NF7A 2CZVA 1IEXA 2XUCA 4UB9A 2A3BA 3GVWA 4AD0A 2G95A 4CCDA 2PURA 5HDRA 2X16A 4G7EA 2W67A 2GPTA 5G1MA 5BXPA 4O10A 1AA1B 3LGGA 1MEIA 3F7JA 2ZZ7A 3I7QA 3CUIA 3KHDA 4GY7A 1A49A 3E12A 4LJ3A 3EWXA 4O12A 5CZTA 4DO5A 1BG4A 3HV9A 4Z2GA 4GINA 4LRTA 2YL9A 1R47A 5I7GA 1E4NA 2JKPA 2CCRA 3L5LA 1B9ZA 4KCTA 4XO7A 1E6XM 1W9UA 2PPGA 2WNWA 3R0KA 3IVSA 4TUFA 1PKLA 3M44A 1AW2A 1L6WA 4ZCWA 2CESA 1BVWA 3CAWA 1TMLA 3TIMA 5I3FA 4XTIA 2YBVA 4YXGA 3IWPA 1A5MC 1T6MA 4JGDA 2Z6JA 4MWAC 1LORA 3NM1A 4JX6A 3VFLA 4WCJA 5F7UA 4IUGA 3VZYA 4PTMA 2CZFA 2A21A 3S0CA 1T8XA 2ZX9A 2PDHA 7A3HA 3QBUA 1ONXA 4LEFA 2WK2A 1V5XA 1KQYA 4J4KA 3B4YA 4GE8A 5C2GA 4NAEB 2NX1A 4HK7A 1ISZA 2JALA 1OG6A 1NQ6A 4HPNA 3S2JA 4CQBA 3UNTA 3W6LA 1WXJA 1RPKA 2Y7FA 4A6GA 4E6MA 2OGJA 4KQNA 5KITA 4AMAA 3FXYA 3SCTA 1SFTA 3COTA 4NU7A 1VBJA 3WJYA 2G97A 2XIQA 1FH8A 2QEZA 3V0UA 3GBDA 5G4WA 3TX9A 1XCFA 1XBVA 2V9DA 3GLCA 1P0EA 4LS0A 3BSHA 4US5A 3DXIA 3L67A 5E6YA 1KA9F 4QAWA 1KFBA 2F6UA 3OBEA 3M0LA 2ACQA 3EXTA 2WKGA 1TWSA 2J88A 1OYBA 4Z1DA 4LSBA 3ANYA 1MUWA 4M6QA 1FP9A 4PMDA 2WMIB 3KRSA 4H7CA 3WD0A 2J7EA 3JW7A 2OYLA 2WMFA 5H8PA 1Z89A 3TNOA 1JUEA 1WDWA 3RU8X 4HNTA 5A6SA 2XFFA 4ZTYA 3HMJG 2BSLA 4GUGA 1LJYA 1X1ZA 3CIVA 4PUNA 1QI2A 3OTRA 4GY0A 5EL1A 2VP8A 1VKFA 1LWIA 3T08A 4NRRA 1FWDC 3DFTA 4DAIA 2WM1A 3CU2A 4UNLA 4IGSA 1UJPA 1WKYA 4O54A 2XM2A 4LOCA 4Q7BA 2IMRA 3UA4A 5DCEA 4K8HA 3HBLA 4KW2A 3G1HA 1NM9A 4PMQA 3WX7A 1TMQA 3LGEA 4Q3MA 2O92A 2O7SA 4Y9AA 5A3HA 3ITLA 1H7RA 1IWPA 3H4GA 4W7UA 1MQPA 3E49A 3Q45A 4M1BA 5EBAA 3WMCA 3C2VA 3HB9A 1YQ2A 3UGVA 4S23A 2Y2WA 1DV7A 3TWAA 5AHIA 1F3XA 4QLLA 4JX4A 2X2GA 2X8RA 1W37A 4O13A 5CBJA 5FA5A 6REQA 3UWUA 5H2ZA 3AMKA 1Q85A 4MB5A 1FWGC 3VU2A 1C90A 4L4LA 6TAAA 5CC3A 2BFGA 2ZRUA 4A05A 5EA9A 2YCEA 2WKJA 4B90A 3AALA 4IX2A 1Q6FA 4RX0A 5DBTA 4ADUA 4DJEC 1DQXA 2ZRYA 3L4UA 2VT0A 1DQWA 3R0DA 4YYFA 3EOSA 5DO8A 3C0LA 3G1RA 3HQNA 2GGGA 4GOAA 1TVLA 4HHMA 4IXXA 1B3XA 1EBGA 5A94A 3O0FA 5CBIA 1OINA 1V3KA 1UR4A 1V4YA 3UJSA 1BGAA 2EAWA 1Q3NA 2HK1A 3TNBA 3TFCA 2GQ8A 1A3HA 1GOIA 2G8ZA 4OECA 1OADA 3RX3A 3H12A 4WR3A 1SMAA 5DX7A 3GSMA 3HGJA 1D3GA 4AF0A 3MUAA 4Q4KA 3ERPA 3PTMA 1FHLA 3TSBA 5GNZA 1OC6A 4PN2A 4Z2IA 3SCWA 2F8QA 1R7AA 2ZOXA 4DBDA 3CHDA 5JUVA 2HV5A 5PTDA 3BV7A 1TV2A 1TJ2A 3DFQA 4NT0A 4PA8A 3M0XA 4J27A 3BGJA 2EHHA 4AVNA 1P43A 4A22A 4B4FA 3LCGA 3VGFA 2EQDA 4LEQA 5AB3A 1E6RA 1P6WA 1S5MA 3SUTA 4DELA 4G1NA 2HBXA 4FNPA 1SQ7A 1QXLA 9XIMA 1C93A 4U2YA 4N0RA 4H9MA 1IEQA 2VRQA 3OG3A 4O4WA 3T8QA 3ECQA 3SQLA 4AZCB 2PGEA 2PLCA 1F3EA 1VYPX 4P7NA 1R9YA 4LS2A 1UD5A 3SAZA 2ZUTA 5HOSA 1N8IA 3NXLA 4FOKA 2GK1A 3WKZA 1XYFA 2P76A 1E71M 1WZAA 1BRLA 3DYOA 3RM8A 4DAFA 4RK8A 3EWYA 2X1SA 3RN6A 1GTHA 2CBIA 2PEVA 1M04A 1UPPA 5JBDA 3N4EA 1DWAM 2VR2A 2VOTA 3UR5A 1RLDA 3CQIA 2ZXBA 4IPLA 4Q4MA 3L4YA 2PTYA 1R3VA 4NAFA 4C6DA 1RK6A 1K77A 1TE1A 4Q4PA 4LAKA 4M3PA 4PSRA 5K9XA 4L9YA 2CLLA 1RD6A 1VFFA 4JIHA 1DWHM 3DIPA 3LN3A 3WDJA 4ZTXA 1WX0A 2ZWYA 3BCFA 3DBPA 2I1OA 5K4ZA 3C5QA 4P5UA 4GXPA 2VC5A 1C8YA 5LIYX 1Q6OA 1DKWA 1B57A 2CZDA 2BVDA 3VIPA 1HUVA 3B3DA 3CZEA 4PCPA 1CBGA 3G6LA 2BV9A 1RV8A 4MJ4A 2GVLA 3FOKA 1XIHA 4S38A 1W32A 2UY5A 2VGGA 5AECA 3W87A 1WQ5A 4KS0A 4X3ZA 4CD5A 3WH5A 1GQIA 3RPTA 1VD6A 3AMLA 3C2OA 4MF4A 2H8ZA 3RNDA 1NWUA 3O6YX 2X7WA 2WQDA 2W92A 4N4QA 4OV9A 1CGVA 3PSWA 3PK7A 1NARA 1B9BA 2ZXDA 2FH8A 4N4PA 2QCLA 4HA4A 4G8TA 2X7VA 2TSYA 1JL8A 1H09A 1TYGA 1XINA 1ADDA 1ZBCA 4DEFA 2CBJA 3HPSA 1EZ2A 2OLHA 2ZQ0A 1G4EA 1RY8A 3PUDA 3AIBA 3TXVA 1XBYA 1XD0A 3LBMA 2BDQA 4IPNB 4UR7A 1FCQA 4N9DA 4YNGA 3Q67A 4KFNA 3NEVA 2ISSA 3QTGA 4HP5A 4PMYA 2HNHA 1ZZMA 3BV4A 3SGGA 4DIAA 4O17A 2EPMX 3WIJA 4A3HA 2YW4A 1EJRC 2GLKA 3WQFA 4GGBA 3UWYA 3M46A 4WY0B 3SZ8A 1YTDA 1IE7C 3P61A 4QISA 1TREA 2PDFA 2PDNA 2Z1KA 4HNCA 1FKWA 2ABBA 4AEEA 4AYGA 4S3EA 4C7DA 4AZ7A 3CUGA 3URQA 2X05A 1QHOA 2ATMA 1E1CA 1UWIA 2ON3A 4I7VA 2A3HA 3FHAA 4PTNA 3ITVA 3EWCA 2BNJA 1EJXC 1JD9A 1MZHA 1GG1A 4GUJA 4US5D 4HNOA 4DQWA 1UASA 1BQGA 2AL2B 2DIEA 2OQHA 4G5DA 1XYCA 2PLMA 4KMQA 3VKDA 4AMCA 4UQCA 4FLSA 3MO4A 5CSSA 4ML4A 4TTGA 3B0VC 3AMGA 4D72A 2G37A 2EKCA 4C6BA 2XM1A 1DJYA 4UMBA 3LM3A 4HMNA 3SCQA 2BS9A 4XIMA 4DF2A 3N73A 1MFVA 3TJXA 1X8CA 3KS5A 1BPLB 1UP2A 2WO5A 4Y90A 3NSNA 1WZLA 1KRAC 1R2TA 4PMNA 2HJPA 5AC5A 3FNDA 2HNEA 3L0NA 3TQVA 3B8WA 2IKGA 1GQKA 1HKKA 4WJ8A 2W3ZA 3S42A 3P84A 4MY1A 4XVDA 5D38A 1JG9A 1VGAA 2Q09A 2FHCA 3VNKA 1UWTA 2QCCA 5A8QA 1QW7A 3NTYA 5A5WA 1R9ZA 3U6WA 3VM5A 1C7SA 1VFLA 2QUVA 4H7VA 1MDRA 5GNYA 1UD4A 1Z69A 1K9FA 4H9ZA 5MKGA 2VZUA 3VKAA 1BTMA 3AISA 1REQA 3AHXA 2QKFA 2WCGA 3K4WA 3S9ZA 1QI4A 4IIGA 1GVSA 3AXHA 1H62A 1THFD 1Q2RA 1CLXA 2A7RA 2HEJA 5F2MA 3WQVA 3NPXA 2J7GA 2ISWA 3UG8A 2NUYA 3OOQA 4AD4A 4ZR8A 1JGMA 3ALFA 4E8GA 3W29A 3UPMA 4MJ2A 4WJXA 2B7NA 1TPFA 1GOXA 3BAXA 4PEKA 4GMEA 1OFPA 1JNEA 2PGWA 1T41A 1UW9A 3PP7A 3SN1A 1H60A 3GH5A 2PWDA 5I3DA 5IHSA 3AO0A 5DQPA 4MKSA 1GUVA 3BANA 1S46A 3BWWA 4XB3A 3KCLA 5I07A 4IIHA 1XP3A 2XJ7A 4U10A 4PYSA 2BOFX 4H9YA 3N12A 3WD2A 4NQ1A 3AS1A 2XH4A 3IJIA 5CJ5A 1MWOA 2REQB 1VFHA 4AEFA 4L80A 4XZMX 1SZNA 1PPIA 4HCDA 3RCMA 4ZOEA 4L4MA 3MCNA 3QSRA 3SUVA 4WXZA 5LIWX 1W3TA 2EG7A 5KZEA 2MUCA 4O0ZA 1UD3A 2V6AA 1XD1A 4M6UA 1V02A 1C9WA 3D47A 5G1YA 2YA2A 1XIFA 2Z25A 4FXSA 1IYXA 1ZB5A 2Z00A 4D2JA 4MYXA 2BOEX 5LIUX 2FTYA 1ZFJA 3UXLA 4WVXA 3PUEA 1TZZA 3I3DA 1QNQA 3GK0A 3QHMA 3GUWA 5C70A 3W1UA 1AW1A 2OWXA 1DQUA 4PUUA 1J0IA 1NWRA 3ITXA 3QZEA 4GO8A 3V5OA 3W83A 4EE9A 5JBEA 1F4HA 4O15A 3GG7A 1Q5MA 5FJIA 1Z42A 4CVUA 1XDLA 1ZP3A 3TR9A 4LAZA 1JUBA 5DT5A 1GYMA 3K8KA 5DEZA 5CXPA 2FZNA 4DO7A 1UKOA 4NHVA 4KERA 3E38A 5A8NA 4PRWA 1L6YA 4HB7A 3MJMA 3QLDA 4HJWA 3MI2A 3HA1A 2F61A 1XX1A 2OWCA 1ADOA 3A3XA 5I5RA 5T9BG 2WVVA 4KKXA 3P67A 1EB3A 1TPH1 1E1FA 1M1BA 3OB8A 3SN0A 2Q3RA 1TRDA 3AMCA 3OBKA 1SW7A 3BDKA 1KFKA 1D7KA 3UPWA 3M6DA 3BG3A 1SO4A 1WKDA 1KWGA 1PDYA 1S2TA 2A7NA 3VNZA 4C91A 3BTNA 7REQB 4ZFMA 3SCVA 2AKZA 4WD0A 3O06A 3HMCA 2GVEA 1JDFA 4AWTA 4B2DA 2R1LA 4EPBC 2W4XA 4K8GA 2ZZ2A 2JKEA 1AQFA 1WDSA 3T4CA 2F38A 4AVOA 3W7DA 1XBZA 4JYDA 3BZGA 1LBFA 2VX5A 3LOTA 3I3EA 3NPVA 4PZVA 3A3WA 3V16A 3VX1A 1W1A1 4FO4A 1QATA 3SB0A 3KUMA 3HQ1A 3UR7A 1ECQA 4P7RA 3O1NA 1TZ9A 3NL3A 1WDQA 2J8TA 1GGOA 3P62A 1FWBC 2QGHA 5EYWA 3G6MA 2OKTA 4PSPA 4BZYA 1TKKA 1DJNA 4BQ2A 1GVEA 4BEUA 3T2QA 2OX1A 3P7YA 3IRDA 2OZ8A 1R3RA 2Y1HA 3RLHA 1SVDA 1SFJA 2QMJA 4D1IA 2P0OA 3IIPA 1R9XA 5FEWA 2VCBA 3NYDA 3PZTA 3TH6A 2NQJA 3BZJA 4D6EA 5A6MA 4OZOA 3NAVA 4CD7A 4K37A 4FR1A 2QPUA 1VFTA 4MM1A 1LQAA 3MBDA 1FFRA 1UZHA 2CWNA 2HBVA 3IV8A 3A21A 1XLHA 2QW5A 4M7TA 3EB3A 2FPTA 3F5LA 3BSMA 3W24A 1XXXA 1IEIA 3S1UA 1A5OC 4O28A 1GJUA 3LRLA 1TWWA 3UWZA 1OGSA 2ZTJA 4ZQMA 3AHZA 2V5LA 2Z24A 5F4WA 4UC5A 4KWOA 5FF4A 2NVAA 3C2EA 1NDZA 2ZC1A 3CASA 1H11A 1POJA 3OGSA 3SSJA 2YDAA 3UCDA 4ZSTA 4LVBA 1GVRA 1S3TC 1OJXA 4XAGA 4PMUA 5DXYA 2DSZA 4O52A 3NL6A 3T9PA 4PEEA 4S2BA 3LTPA 1MW3A 5BU9A 1QPKA 1X6UA 3SQMA 4H8VA 1FFQA 3PNUA 1QPQA 4Q8PA 5EPDA 2WNQA 3B8UA 3STEA 4F4RA 4Q8TA 4FNQA 1HN1A 1FA2A 4WRHA 1YPXA 1H61A 2D0GA 3GG0A 3B8IA 3U48A 4I6VA 1VR6A 5J8LA 3A9IA 3ZYZA 2VTFA 3EA1A 5C54A 2VL4A 1FDYA 1SFLA 3G77A 1Q63A 3R58A 3UZJA 3K4DA 3AZTA 1JEZA 3FJ4A 3U3HA 6CGTA 1N8FA 5I02A 4UNKA 4MY8A 1N82A 1BSIA 2Z2UA 2VX7A 3WF3A 3LNMA 3S1XA 4M51A 2V2DA 5LNRA 1UUOA 3ZMRA 4EANA 1D3CA 1KBLA 1JXJA 3GU9A 3KTCA 1TPVA 5MF5A 4GNVA 4Z42C 3EX4A 1GEHA 1HJWA 3KBVA 4GIEA 4ROPA 5XINA 3JS3A 4QJ3B 2O9TA 4S3GA 3V5CA 1PUDA 1I2OA 3H6OA 3VDCA 1G4SA 2PWFA 3TU9A 3QV8A 3H70A 3NL5A 1S2VA 5E9XA 2BB0A 1I0DA 3MT1A 3LV6A 2WM0A 3PUOA 3M0HA 5B80A 1K9DA 4TX8A 4CN6A 3V5FA 2IXUA 2OEMA 2WJEA 3NZGA 4C6OA 2FTPA 4MYAA 1WOAA 1YE4A 2CWXA 2BX7A 4HN4A 5KSWA 3DGBA 5FI8A 3BLOA 4PMVA 1Q66A 3TC3A 3L0KA 1WOBA 1W5PA 2RGMA 3GHTA 5XIAA 3N18A 1N8WA 3ARRA 2QUMA 4IG2B 4PUMA 1VQTA 3R11A 1RZMA 2OT0A 3MUCA 5KINA 3S9YA 3ARQA 5G4EA 1XM3A 3VOGA 3H26A 1TPUA 4K38A 1QI5A 2OJPA 2Y7DA 2XDFA 3KDNA 2PDQA 2JE8A 5K9CA 4HPGA 3OA3A 2YA1A 2X2YA 3DHPA 2QXWA 4BFAA 5BOOA 3W1NA 1BVNP 4MNKA 3LBOA 1TZ7A 3VKKA 1IQ8A 1IHIA 3HPZA 2UWFA 1TX0A 1IEVA 4CNTA 4DNHA 3QF0A 5D8WA 4WKAA 3FJLA 2OYMA 4WUIA 1KB3A 1NDWA 4H01A 4Z1AA 1WZKA 3TE9A 5ECVA 1YTKA 3CXOA 4GYKA 3AIVA 4UFLA 3IJLA 1CGUA 5K9DA 2I57A 1L6GA 4L6OA 3ZT5A 1O95A 1W3IA 3DCPA 4DZIA 3SGUA 4O1FA 3MMWA 4I3GA 4NASA 5E0KA 2YCKX 3AS3A 3VO0A 4MUPA 3GU2A 2PDCA 5B7YA 2BY2A 2D22A 3FEQA 3SECA 2VEFA 4HGXA 1FWNA 4NY2A 3ATYA 2Q01A 2C16A 3REQA 2VDIA 4K7YA 4OBSA 3W25A 4LVDA 3N6QA 4I5XA 1IR1A 1GNXA 3NQCA 2D2GA 4TXEA 5I3JA 3FK4A 4F79A 3TYAA 4WQ6A 1ELSA 1UC4A 4RNIA 4UCFA 2CFFA 1I2QA 4RR4A 2Y8VA 3W7OA 1H7OA 1NOFA 3O3RA 2G3NA 1XBXA 2W9MA 4J3UA 3CL8A 2QJJA 5FD0A 4GC4A 2Z1BA 1WYIA 3STGA 4XUYA 3NQVA 4IMGA 4I7WA 1R2RA 3UU0A 3UVAA 3O0KA 4JY8A 2HE5A 3GB6A 2WMKA 1GHSA 4XV0A 1ZJAA 4PRTA 5AYXA 2Y88A 1FWEC 3MC5A 1QW9A 1RBOB 3W22A 3MMDA 1EXPA 4B2DD 1TTQA 3EGJA 2I9UA 4ZSUA 2VCAA 1I75A 1NDVA 2OOFA 3HZ3A 1H3GA 4UTWC 2CXGA 1KM5A 2E0PA 4AG0A 3P8IA 1LL7A 2XN2A 3BW2A 4I90A 3UR2A 4C1NB 3PZQA 5AYBA 1J2WA 4HOXA 1DJZA 1JXKA 4Q8VA 3LENA 4RNHA 3CUHA 2GJXB 4TX9A 5CPNA 4N6EA 2YDQA 3A64A 2BOGX 3P81A 2WVTA 5M2FX 3DZ1A 4RDVA 2YXOA 2ZZ3A 5FF2A 2PZ0A 1TR9A 3WQ6A 3BJSA 1JJKA 2FB2A 4E2VA 4IGMA 3S1GA 4LCQA 1EPVA 1NFBA 4JTUA 1RR2A 1W8GA 2CLIA 3WYZA 2QHAA 4PB4A 4RW5A 3BQ6A 4HK6A 4ACYA 3V3WA 4X9YA 2ASHA 1V08A 3VOIA 1RALA 1O4UA 1OT1A 3P6LA 5AC4A 3PWIA 4I5RA 4GXWA 4AEOA 2VNCA 2WVUA 3QH2A 3I4EA 4IPIA 5D2TA 3ARYA 3CIWA 3OVRA 4LYQA 4POCA 3R6IA 3AWOA 1SJAA 2VEGA 4BEQA 5IFPA 1MXGA 5GNXA 3NQDA 4NNAA 2CLFA 1KNWA 2C0AA 4AX6A 1KM0A 4W84A 3GNDA 3WY1A 4DUVA 3CH0A 4IJCA 3QR3A 4AIEA 1YRRA 3IIVA 1OQFA 4OTKA 6XIAA 1OIFA 2WQPA 3NZQA 5M1TA 4QJ4B 1F74A 4MWAD 3V1HA 1AJ2A 3K1GA 3WNOA 3RU6A 4LT9A 2Z1VA 3U5YA 1QK2A 4OWGA 4B3LA 4HMEA 1L6FA 3WJWA 4GI4A 1GORA 1QNOA 3M7SA 4ZGYA 1IWAA 4W8LA 4MZYA 2I5GA 3PBYA 1H49A 4FPSA 3NDOA 5BWFA 3QPZA 1AG1O 3WNMA 5AC6A 1A80A 1HJXA 4J1OA 2R94A 3ZOAA 3IPWA 4LBSA 1U1UA 4AD2A 4NG3A 3RAOA 3VA8A 1LOLA 3AU6A 2PU1A 4L65A 1AK5A 1QDSA 2VYOA 3KOXA 4JNYA 1QK0A 3PBMA 4TVUA 4A8RA 3MP5A 2HDJA 3BLPX 2D2HA 1XI3A 4B16A 3B0XA 3CV2A 4UQBA 1S5NA 3ANVA 3Q4DA 1ADSA 3ES8A 4IGNA 5HNTA 1P7TA 2BHZA 3H2MA 1CEOA 4DWSC 4NXKA 3I68A 3S1VA 3W26A 4G7EB 3QSTA 3NGFA 4ZO7A 3M5YA 3DDMA 4FOJA 2QAFA 4GXMA 3OG2A 2DIJA 1Z48A 3ARZA 1ZBVA 3CPGA 3UD6A 3RX2A 1J0JA 1SJDA 1NAL1 1O5RA 2IQDA 2OR2A 2X1IA 4BA0A 1U5VA 1P5BA 4M7SA 3NUKA 2XZ9A 4LUSA 2ZZ5A 1M7OA 3NG3A 2NWSA 1PX3A 1RQHA 3GBEA 3PB0A 2OT1A 4Y9OA 1OFQA 4FIQA 3W4RA 4AYSA 1SSGA 3VX0A 4PCSA 3GG1A 2BHUA 3SUWA 1RUSA 3CJPA 3DC0A 4LCSA 3CWOX 2RAGA 1HO4A 1O60A 1UH3A 1A5LC 4NP7A 2TODA 3RO6A 1KWKA 3T42A 1WB0A 2PDIA 3AOFA 4HHLA 2E5CA 3LRKA 4AY7A 2GUUA 3KEHA 4P8XA 2NVDA 2YCJA 3II1A 1EJSC 2AQVA 1E9ZB 4Z2LA 4C6LA 4YCOA 2W6RA 3UYIA 4GYPC 1AZ1A 4UTUA 3OLIA 3PFRA 4GNJA 3S5NA 2Y8KA 4C65A 1FKXA 3D46A 1KGUA 5EY5A 2VMFA 3RLUA 2Z27A 1PHQA 3E0FA 4B5TA 4N7QA 5F1VA 4JHMA 4QE5A 5ABHA 3GZAA 3A4AA 1L2QA 4DJED 4UZSA 1MRQA 1XGZA 1E56A 4HNVA 1VFMA 4XAYA 3DC8A 2DSVA 3HQPA 3CQJA 4HQVA 3L21A 3WQ4A 2Y89A 2CHRA 4JFVA 5LGXA 4W7VA 4FI4A 5I3GA 4OVXA 4LQ1A 2ZX8A 3PBWA 2VEPA 3C61A 4KPLA 3RLGA 1OCBA 3RUBL 3UA3A 3IRSA 1TPWA 1X1OA 1TCDA 1DWIM 2INEA 3UZ5A 1R86A 4NX5A 3C2FA 1RP9A 5AHNA 2A0NA 4JXCA 3WLRA 1X98A 5J5DA 4PUWA 3QR0A 4WSJA 1TA3A 2XN1A 1DXEA 1UQYA 2PBGA 4R53A 4KFPA 3W9ZA 5J04A 4GUHA 4OUIA 4QLKA 1J18A 4TR9A 1AFSA 2E4TA 4C1LA 5HA7A 1AJZA 3TROA 5A6BD 3C2YA 1FUYA 1CWYA 5H6HA 5CCZA 3G1SA 2NLYA 4UMCA 4LB3A 3B9OA 2BVWA 3BOLA 2ACRA 3L0GA 3QJAA 5D04C 3WH9A 2PDGA 2PAJA 3KZPA 2W63A 3NM3A 4JN6A 4KIEA 1ZHAA 4JR5A 4FEZA 1HP4A 4X63A 1A5UA 3ZR5A 3LLFA 3KAOA 1WDPA 3GFXA 4IXHA 1LDCA 3YPIA 1R5YA 3QY6A 5A69A 4KH2A 1YXYA 2FVMA 1GONA 3VGEA 5I09A 3IIXA 1K6AA 3KTXA 5E6ZA 3DFSA 1M65A 3BC9A 3IARA 3VYLA 2R14A 1W0MA 3RDKA 1O94A 3I10A 3INPA 4DO6A 2UY3A 3WDPP 3GNNA 1WBJA 3UT0A 1YDVA 4OJYA 3THQA 4JTQA 1I2PA 1K8CA 3B05A 4JN7A 5BRBA 9XIAA 3OIHA 1RVKA 2XYLA 3HOJA 3W82A 4XZ9A 2NV9A 5FSEC 1AODA 4UFMA 1AQMA 2PE4A 3GD6A 3MA8A 3W7MA 1ONRA 3N14A 3NR0A 3O16A 4RZ6A 4ZL1A 4MPQA 2ZX6A 1LT8A 4XWUA 4OGZA 4U28A 2ZUNA 3F2CA 2VZOA 4GK8A 1UA3A 1B31A 3TOYA 4R33A 4GVHA 5D4YA 4MJMA 2BXVA 1OK6A 1SUXA 5HBFA 1YNPA 1ME8A 2VWTA 3I4KA 5EMMA 1X6NA 5K4XA 4WY0F 2GWGA 1EWDA 2O7QA 4YVPA 3FA5A 2ISFA 4DVOA 1DHKA 4C90A 3VGGA 4EXQA 3ZXWA 2VXNA 4NZCA 1IIGA 4UIOA 3TC6A 1H0GA 1WE5A 1O5KA 4RW3A 3HV8A 3IS4A 1LZOA 1XIDA 4GC3A 4NJJA 1ZS2A 3S5ZA 3GTXA 3LX9A 1NOWA 1XYBA 1AMYA 4FLRA 4IMDA 2Z0IA 1OF6A 2GWNA 2WMJA 3VNLA 4PUEA 4NJKA 4P7OA 1SPQA 3IIOA 1AD4A 1KR0A 4XAZA 2DZTA 4HNNA 5CKSA 1ZGDA 3EDJA 4UUIA 4ORMA 3VMPA 4RZBA 3C0QA 3HTWA 2RHGA 2CLMA 1W9DM 3B9NA 3VIHA 2B81A 4HNUA 1F7BA 2BGNE 2NQHA 3ARSA 1DVJA 3RJXA 4TU1A 3WEMA 2FDSA 3VCCA 1R46A 1DEDA 4UFIA 1VS1A 4A3UA 4MNMA 4RV8A 3UJFA 1FCBA 1UJQA 2G50A 1PAMA 5DN1A 5CGMA 1Y8BA 3W1QA 3W1RA 2GK1B 3KE0A 3C86A 1DJHA 4Q4SA 3GRIA 3PPGA 3N15A 2EBNA 5G2WA 5HR7A 1UR2A 3UR8A 5KTLA 3EA2A 2Q8ZA 2XFWA 1C9DA 3WK0A 5I77A 3SCOA 2OX4A 4HT3A 2Y63A 2Y85A 3OZPA 4MFDA 5BYWA 4EP8C 4QSFA 3BCJA 8CGTA 1ONWA 3EX1A 2NT0A 2A3CA 3OW1A 4DBSA 1M5WA 2O9PA 3BK0A 3K2GA 2WHJA 3EB4A 3EOLA 2OU4A 1E9YB 2EPOA 4JFTA 1FWTA 3EKZA 1JQVA 2G3MA 1VZWA 2C71A 2EJ1A 2XTKA 4JIQA 1H2JA 4S39A 3PANA 4K39A 4ZO6A 4JZ5A 3DFPA 2QDDA 1JDCA 3LA4A 3IVTA 3W1XA 3HJZA 5EGRA 3WFLA 2E8YA 4RL3A 3G0XA 1X7IA 1MSSA 3I6EA 2PSNA 3EXSA 4J3TA 1OFDA 3VM7A 3E0VA 4JN8A 4L5ZA 1CDGA 2WSQA 4M29A 4JYEA 1A5AA 4YS1A 4AIUA 1K4GA 1FQ0A 2WSKA 4HCHA 5C7HA 1F6PA 4LRSA 1Q2SA 2D20A 2E6YA 4B3ZA 1VIWA 4ICMA 4IQLA 4EXAA 4GQ0A 4IMEA 5F4XA 1VH7A 1IT7A 4K1WA 2VD9A 2QV4A 4WOZA 3MMTA 4GISA 2Y70A 1UH2A 3AS2A 5U7SA 3T0AA 1WAWA 4ZO9A 4BR1A 1ZAHA 5C9RA 4QEEA 1UMLA 4A2RA 2FGZA 3VE7A 1ME7A 4J3SA 1TCMA 3L4WA 5FSDC 1AD1A 4YWIA 3ID7A 1VB9A 3W01A 1KBKA 4BQ3A 1O6IA 4XAFA 4RDYA 1W3JA 2YDRA 4C1KA 4NUWA 3ZFHA 3GNPA 2ZE0A 4FNUA 1XLKA 3F4NA 4RXFA 3LPGA 5H8UA 1S2CA 4FX7A 1WO2A 3WQWA 3WBXA 3TZNA 1W1B1 3TJIA 3UY7A 3W73A 4XBSA 1E0WA 3FDGA 4R7WA 2F2KA 3NFUA 4L1GA 5D05A 1Z7AA 3ZWSA 3VE9A 1M7JA 1F8IA 2Y62A 2NUXA 1VPXA 2JGQA 4Q6JA 1E0UA 4PR4A 4X2PA 4ML9A 4OBRA 4DJDA 3QR1A 2VKZG 4IMAA 4O1CA 4NILA 2ACSA 4G1KA 4R9XA 4YWSA 2W61A 3W1AA 1GVOA 3WF2A 2DIKA 2V0TA 1C3FA 2Z28A 2GDUA 1EDTA 4DYJA 1AW5A 1UHVA 1CXEA 3L4VA 3SCNA 3S5YA 2YKKA 3WQDA 3THAA 4JTIA 4JPGA 3UF9A 3GTIA 2V3GA 3NA8A 5C2CA 1L8NA 2C91A 5HNNA 4GQQA 4QE4A 4LFYA 3CHEA 3D5HA 4H8HA 4W4QA 3SQSA 4JTJA 5I24A 3BL3A 3KW3A 7ENLA 1OC5A 2CHNA 2NT1A 1QOQA 1R30A 4HA0A 3UWVA 2BVYA 4C7FA 4DPQA 4EXBA 4O8RA 1V93A 4OOZA 4AZHA 3BAKA 4C5ZA 1LTDA 3EDKA 3TN4A 1LRQA 4DZAA 3TR2A 4RNJA 3FYOA 4GIRA 3MY9A 1DJXA 3QW3A 4AY1A 3PF3A 3UP8A 3Q37A 2GGJA 3N25A 2VX6A 3GH4A 3USBA 1TV7A 4XKYB 4EF9A 4HVXA 5CAKA 2YJQA 4RXGA 3RM9A 4JEJA 1D8WA 3ABZA 4S3KA 3S5OA 3UWWA 1ME9A 1RJRA 3TJ4A 1YNQA 1QOXA 2ZDSA 3SSZA 4XSMA 4A21A 2NV2A 4ZQOA 3CZGA 1KM3A 3FV9A 2ZIDA 3MQTA 4IX0A 2PF8A 4Q33A 4MSSA 1OYCA 3HM7A 2Y5SA 2X0SA 5CG7A 4NNCA 3WELA 3T7VA 1VC4A 4F0MA 3EPNA 2TPSA 3Q94A 3KFTA 4S3FA 3URBA 1OK4A 4BQ5A 4TIMA 1H5YA 4IL0A 1LBMA 1PV8A 4GG9A 3GWQA 4M24A 3TTOA 3CBWA 2WMHA 4GZEA 4N02A 1OD8A 1P1MA 1UC5A 1TV5A 1RCOB 1AVAA 5TAOA 2W0UA 3W81A 3AS0A 3TKFA 1OSEA 1UPMB 1I8JA 4QS6A 1EUNA 3M9YA 1V7AA 1GYLA 2PF0A 1H41A 5I6SA 1TWZA 3CYJA 5BWAA 2PWVA 1I4NA 5BXRA 2EPHA 3CPRA 3BOFA 4PGLA 1GCYA 4INFA 5CQ1A 3BICA 1VLIA 3ALGA 3AYTA 1PKYA 1OD0A 2XH7A 3THDA 2W27A 4RLIA 1PS9A 1LBLA 3EEGA 1VJZA 5C9XA 4ZE4A 3N2XA 5T26A 4GKLA 5DELA 4D8AA 3TYBA 5FKYA 4AHOA 3U4AA 3NO5A 3N11A 2PRMA 4R27A 2DT1A 4JCLA 3AHTA 1HIZA 2WVVB 4HBKA 4I9JA 1RQBA 1J01A 3FJ6A 3BGAA 5HUPA 3DOPA 1U33A 2Y4SA 1G69A 1JPHA 3CV7A 2IXVA 4K3ZA 1ZALA 4D1JA 2VZVA 3HJEA 3R5EA 5LSMA 1ONEA 3THCA 3WLSA 3VDAA 2C14A 1P4CA 1F6KA 1N7KA 4B15A 1EJWC 4E3TA 5BMXA 3VD4A 2FVKA 5BRPA 3CGTA 3ES7A 3GKAA 4LWWA 1XUZA 3HG3A 3RJYA 2B4GA 2H9AA 5LHFA 1GZGA 4WZHA 3W02A 4JTHA 1E0TA 1P0DA 4RE2A 2ISVA 4LY8A 1TJ0A 1SFSA 2NQ9A 3MCOA 2WC4A 5D9NA 1M41A 3FGCA 3WLMA 1AQ0A 1H7WA 2FJKA 2VEKA 2HCVA 3I7SA 3V35A 3H8AA 4UNIA 5T91A 3NQBA 1VF8A 2Z6IA 4MADA 1K9TA 1A3XA 2HVMA 2WHLA 4LANA 4FK9A 4UQAA 2MANA 3S6TA 2CLKA 1JZ4A 3VKCA 4MUZA 3UBPC 3NJ3A 4XZHA 1UZ1A 4H2CA 1OCJA 4DLFA 1ZJBA 4WKFA 2FZ8A 5CPLA 1W8SA 1KBIA 1UZ4A 5IFTA 3RK8A 1XR2A 3TW9A 3CWHA 3RRAA 2WC3A 1ICQA 3R89A 3NGJA 2BXZA 1JULA 2F7FA 4BI7A 1A0EA 1BYBA 3QY7A 3H21A 2ALDA 1W3LA 3PS7A 2F84A 4A8IA 4P7QA 5D37A 2HMCA 2R1MA 2ZFAA 3FN9A 1Z8AA 4I9AA 3R0UA 2J7FA 2OKOA 3ISIX 4BQ4A 5GQBA 1KTNA 3AUJA 1C29A 4MWAB 3LV5A 1FDJA 4PFMA 3RGTA 3L4TA 8A3HA 1WAUA 3M41A 1GW9A 5F2LA 3UJ2A 3L5MA 1O5QA 1OEPA 2WW5A 4B9YA 3WMSA 3G3MA 2OQLA 3R8GA 1KCLA 3ARPA 1CLVA 4GYPA 3PJUA 5AN7A 2X1UA 3KOYA 1JDDA 5EMLA 4FHAA 3LHWA 3EA3A 3R2GA 3UZYA 4US6A 5FEXA 4ONVA 1AH0A 2FQIA 3CLMA 1MXDA 4YTUA 4HYVA 1H5VA 4CQAA 3SUUA 4UTJA 1EO5A 4CVWA 1R2SA 2GJPA 3QHNA 3U7BA 5RUBA 4ACZB 1UWQA 1RPXA 3BVJA 2EG8A 5D9PA 4XQ6A 3VNIA 1BXBA 4ROQA 1E5NA 2AL1A 1GG0A 4KETA 1FWAC 4GJ1A 3NXFA 1FWIC 3P93A 4MZ1A 1W5QA 3NQ7A 4IFKB 3T0TA 3GC2A 3ZJ6A 3TC7A 3B0UX 3W0KA 5DCBA 4LC8A 3SCUA 3WJXA 5IRPA 3IJDA 1H7PA 3FAWA 3CYVA 2QS8A 2J9XA 3VGDA 3N4FA 1B1YA 1QHPA 1ZJIA 4W7WA 3PZOA 1KM1A 1PJ9A 3AHVA 1E40A 1JCJA 5HATA 4NI8A 3LI1A 2QCFA 1JFXA 1VBRA 3TOPA 4D6GA 2KZHA 3FSTA 1H7NA 1SJBA 1IR2A 4LAMA 5HULA 1UD8A 2PDMA 1EKOA 3E02A 3NNTA 3BLKA 4IIEA 3H54A 3ORWA 2V67A 4NKCA 3OEXA 1Q6EA 2H3BA 2CZ5A 3W28A 4AXNA 4IQEA 3QEZA 1JDAA 2ZC8A 1H1NA 1RQEA 1TTPA 2B7PA 2HK0A 4U4MA 1CT5A 4XD3A 1Q7ZA 4TVCA 4FR6A 1QTWA 3UEQA 3H2EA 1GKPA 3CAQA 4X60A 3NQFA 4PE8A 3DX5A 5E93A 7PTDA 2XU2A 5KETA 4GQRA 4XX6A 1TPEA 3SCPA 1JAKA 4JICA 1JNDA 2D1ZA 5HJYA 3VOFA 3WL1A 3UW6A 4N9CA 2NQ5A 4W5UA 4DX3A 4QDPA 3MHFA 3NYZA 4OHQA 3IJ9A 2QF8A 1EGMA 1DE5A 5BRQA 1ICPA 1UWRA 4P61A 2JEPA 3PZIA 3UWQA 1F05A 2CYGA 4GD0A 4OQVA 1Q6CA 2QIWA 1SR9A 3E1F1 1KKRA 1SMDA 4URIA 1JZ3A 2ZBTA 1M68A 4QCFA 4F3HA 3W2LA 5A2BA 2VGIA 4IFRA 4YU1A 1TV3A 4OKDA 5E09A 4HPXA 5CLWA 5FJPA 3SURA 3MZNA 5FJTA 2A3LA 1ZJHA 4AZCA 4HZMA 1E43A 2I9EA 4FMVA 1UR1A 2JF7A 2A3AA 4S3BA 2YR1A 4GIYA 1DE6A 1S2AA 1CIUA 2HPIA 2FDMA 4V2XA 4C6JA 2PZNA 2ZZ6A 2QPSA 3F1QA 3C6CA 4LTSA 2Q71A 3NQ2A 1UWAA 2PA6A 1S1PA 2VQUA 1DJGA 3BAIA 5HWMA 3QHOA 4ECLA 2OCZA 3LDVA 5F4SA 3S47A 1CPUA 3E2RA 1UR0A 5EU9A 1RLCL 2OGYA 1OFRA 4E8DA 1KCXA 3POCA 5FJUA 1EHAA 1IXPA 4G2DA 3OQEA 5DT7A 2YCIX 3WDQA 4WDWA 2PLJA 5AY7A 2AAAA 4GUFA 2P0IA 1PSCA 1L0PA 5LHEA 3TSDA 3DFHA 5E9AA 4KGLA 3BW3A 4U3CA 3N4AA 1EWEA 3U7VA 1PZ3A 3WN6A 2AQOA 4IL2A 3HFYA 1LCOA 4O16A 3ABXA 3N1AA 2DT2A 2PDYA 3V4BA 4LAOA 4UTKA 2D69A 3WLLA 1DXIA 4FXFA 3O9NA 1SYTA 1OZMA 1FDZA 1MXSA 1EIBA 1Z32X 2YYTA 1FWWA 4AIOA 1XDMA 4MLJA 1CENA 3GX9A 2Y0FA 3JVAA 4O0KA 2E77A 4GVFA 4JY9A 4HOWA 2XH0A 2QCDA 3HPAA 3F4CA 4AD1A 4B5UA 1T0OA 4C6FA 3F5JA 3UERA 4NRSA 3LMYA 5AVNA 4GI8A 1QWKA 1JZ8A 4C7GA 2QULA 1XC6A 3MWAA 2DUAA 1C8QA 3R8RA 2ADAA 2E5DA 3MTWA 4QDWA 5H91A 2PDKA 2A6LA 2DVUA 3PBVA 4DJFA 4V28A 2I5IA 3P3BA 5KZMA 1H50A 3L7RA 1A3WA 3CQKA 3QGKC 1UA7A 3M0ZA 1Z41A 2XISA 1RHCA 3OHIA 5BXSA 5E70A 1MVYA 4DWSD 4WY0A 4ZODA 1XC4A 5JQ9A 1PXGA 1C8XA 4BWLC 1WUEA 1E9IA 1EJUC 1NF0A 3DBNA 4MIMA 3PVFA 2QCHA 3PZGA 1JUKA 1C92A 3GFYA 3TQPA 3UESA 3WF4A 3M0JA 5HWNA 1OVDA 1M9HA 1SW3A 2DZAA 1WBHA 1ODZA 1RSCA 1SZRA 2A2IA 1JZ6A 2A4AA 2X42A 1U2YA 2ICSA 3MI3A 2G4FA 4L1XA 3H2OA 3WNKA 4JKLA 1HQTA 1PKMA 1E6NA 5JIWA 5HPOA 5FEPA 3CTTA 1PBGA 1H4PA 4IJRA 1O68A 3W53A 1JYVA 4QXIA 3K13A 2E09A 3KVKA 1I0BA 1G1YA 5TQLA 3FY1A 4H6KA 2J62A 2FHFA 3VDHA 2ZX7A 3LK6A 1SZEA 4G9PA 4X0VA 3FVMA 1ODUA 4O0QA 3R4IA 3EWUA 3VOJA 1EA0A 2RKXA 3LPFA 4DBUA 4GYJA 4Y8FA 4D6FA 3WLPA 1V6TA 2A3EA 1OF8A 2WXDM 3O6CA 3UWEA 3BSGA 3DYPA 5FIPA 4U5KA 3N2BA 3W27A 3P2VA 3LRMA 2YB1A 2J66A 1TPDA 4PBFA 3GAYA 1FOBA 2YGYA 4KIRA 4ICNA 1G7UA 1VHNA 2D73A 4EPEC 4YVXA 5L6UA 1V3LA 5AFDA 2V5KA 2HS8A 2NXIA 4U2ZA 4HSHA 1J0YA 3JU2A 1YX1A 4D6HA 1W5NA 1RAKA 4LX4A 5KMYA 2ZUSA 2P88A 2O4QA 3GXFA 3QOMA 2VX4A 2WWCA 2V3FA 1JAEA 1Z6KA 3AIRA 2PDJA 4H2HA 4WDUA 2XVGA 2TAAA 1T99A 4DWDA 1JPIA 2ZRVA 2ESCA 5BNKA 2PDBA 1NQKA 2DEPA 5D2YA 1X96A 2VUNA 2F6KA 3IUHA 2DV0A 3RRXA 3WQPA 2G5WA 3GR8A 3E5BA 3E96A 3I7RA 2X1TA 4XKMA 2OYKA 3T0DA 2V5CA 3APGA 2VEIA 2BODX 1EIXA 3WCZA 1K7XA 3L4ZA 3RYSA 5I3KA 3OHMB 3T8LA 5HJLA 3A23A 4JTDA 3W86A 4BI5A 1UMYA 1GTEA 1TX2A 3DI1A 1Q6RA 2PD5A 2G4JA 5EMJA 2ZE3A 3B0PA 4Q8MA 1XQLA 4V33A 3STFA 5CPTA 3RO8A 1HL9A 3W74A 3BAWA 1DOSA 8XIMA 2QZRA 3OQ8A 3SIMA 1XRVA 5LKYA 5AHMA 1GJWA 4S1FA 4PCFA 1V02E 3TTQA 3KOZA 1QPNA 1B5TA 1EQPA 3PJWA 4HU0A 4PULA 4GNKB 4HYRA 3IJQA 1G94A 3WLKX 3MSGA 4W86A 2G41A 4QR6A 4F2UA 2E9LA 5CPMA 2CNCA 2QNEA 3LMZA 3M5XA 1JDEA 3A24A 5FJRA 3B0YA 3UG3A 4EPKA 4F2TA 2NX9A 4Q8UA 4OFCA 4I8YA 3AXXA 2HRWA 5LA1A 4J2PA 2YB4A 2WZIA 3WBEA 3TA9A 3SM0A 4QCEA 4GA8A 3ITCA 2OELA 1JZ5A 3AC0A 1XLGA 3QMTA 2J7BA 4ZBCA 3P60A 3WLNA 2C1GA 1UB3A 1YMYA 1Q13A 4DHGA 5AC8A 3N19B 2VJXA 4GO9A 3LSCA 3W1LA 1XS2A 4H9UA 2J13A 1J0KA 3MB9A 5GJNA 1G4TA 1GOOA 3GIQA 4A3YA 5HPCA 4Z2KA 1M03A 1WV2A 5LNSA 4P8VA 1LYXA 3QV6A 3PAOA 2GUYA 3F03K 2FB3A 2HWGA 2UZ9A 3USZA 2OO0A 1K70A 1V79A 5I3IA 1TA3B 3HPXA 4D6DA 4GQBA 1ZAIA 4K1GA 3TTEA 3M43A 2DVXA 2D0FA 3L2MA 2X1RA 3XINA 2CLHA 6PTDA 4LBRA 1VBUA 4FP1A 1KFLA 1O1HA 1XLJA 5CPSA 2BVTA 2OTDA 1EOMA 4J3WA 1QOPA 2OEJA 3DI0A 2V82A 2BTMA 5KZ6A 1EC7A 5A6LA 5JMUA 4L61A 4HZ6A 5D03A 2CZEA 1A47A 2ZICA 1G0CA 4OU1A 3O63A 2UBPC 4KCVA 3IACA 1NOUA 1N2VA 2FHBA 4IP4A 4UTIA 3DEQA 3CHVA 2GJRA 3QZAA 3R7MA 4MG4A 1EF2A 3MSYA 2A1YA 1XICA 2A5HA 2RJGA 2BXYA 3GDKA 4KEUA 3EBVA 3SFKA 7XIMA 4R7JA 1XLLA 3B03A 2PLKA 4E2OA 2FVLA 3CL7A 3RPMA 1KCZA 4LF2A 4DUOA 1UBPC 4JDBA 5A8OA 2XSAA 5E0FA 3S2NA 1MMFA 3BAJA 3CEPA 2D2OA 1KD0A 2XGIA 3UCQA 3W84A 2OQYA 2GGIA 3EB2A 5FESA 2IPGA 4GGHA 1UKQA 3ZQ9A 5T9CE 3V36A 5JBFA 1OABA 4A3RA 4IF2A 3OVPA 1NJJA 2DZPA 4FA3A 2VCCA 4MWAE 4MPKA 3GUGA 3EPOA 2B7QA 3MWCA 1F76A 1AJ0A 2E9BA 1BVZA 2BY3A 4GBUA 3N9RA 3ITTA 2DW7A 2OLSA 4H3DA 4JYFA 1J0HA 1W1PA 4JHZA 4B92A 3CUJA 4DXXA 1IF2A 4ZOBA 1FVPA 4JQAA 4QP0A 1LG2A 2G3IA 2Y61A 1RJQA 1QFEA 4I5UA 4XZBA 3QRHA 1GOQA 1YPFA 5DFAA 2QDHA 4QE1A 3T0CA 1HG3A 4F2BA 3IGSA 2Q8XA 5HINA 2ZDRA 1LL6A 3APYA 5D2XA 4MMWA 4B5WA 1ISVA 5HNUA 3AHYA 2C15A 1F6YA 4CEUC 3W76A 3K4AA 3MSDA 1KXTA 1DYSA 2RUSA 3OU8A 5DLCA 4IHCA 3A5VA 4GYFA 1HL8A 3WL0A 1RY0A 4E0CA 1RJPA 2P10A 1ML1A 3T05A 3FIGA 2RGLA 2V3DA 5HANA 3G0SA 1K8YA 1B30A 3A22A 3HFTA 1KM4A 3T78A 3H2AA 3EOUA 4JTLA 2IPFA 3UPBA 3OGVA 1E4IA 2JGYA 3SFWA 1BKHA 1OX4B 2IPWA 3NSMA 2EKGA 4ICCX 5C55A 1HZYA 3C0JA 1OFEA 1GEQA 3ZLHA 1JCXA 2PBOA 1QWGA 4CNNA 3R94A 4XZIA 2UY4A 1WDRA 1HO1A 5BCAA 1UQZA 3V18A 3ZJKA 4X9SA 1F4AA 1CGXA 3AXIA 3DENA 3C4UA 1LLOA 1X7FA 4IP5A 1A4MA 4GH1A 3P8JA 3RIKA 3HGSA 1CXHA 3GKFA 1KKOA 3ARWA 3KP0A 2PC4A 2QVNA 5TNVA 2YL8A 1PVNA 1LQ0A 1DXFA 2C7FA 3NOEA 2QMKA 3IJ7A 2FIQA 3KBWA 3WSUA 1I1XA 4LU0A 1JIBA 1EGZA 3FA4A 4TV6A 4Z1CA 3HURA 1G67A 2GZXA 2XN0A 2W79A 4QNWA 1A4LA 2TMDA 1HW6A 1DJWA 2IQ0A 2QCMA 4ERGA 4O19A 3STPA 3UJEA 2R24A 3H4WA 1EYWA 5CEWA 1S39A 2CETA 1ZCOA 3PTKA 3UYCA 1PYMA 4RZ5A 5CC6A 3C3NA 3TSMA 3NDYA 2YPIA 5CZJA 1JPKA 1OFAA 3FEMA 4DM1A 2IW0A 4J9JA 4WF7A 3MHUA 1A5SA 4LUIA 2C8NA 1PZ0A 1TUXA 5AZ1A 3TDFA 1MEHA 1MNSA 4EWJA 2QGYA 7CGTA 1J6PA 5ENLA 3KBNA 4NJIA 4TQTA 5BMWA 4CLMA 1UOKA 2DZSA 3CT7A 4XD6A 3FAXA 3HU7A 1VBGA 2XVNA 2FPYA 1XLIA 1XUUA 2DGAA 4LGXA 4HHPA 3BPWA 3VNDA 3H24A 2RDUA 1F73A 3N2MA 1KTBA 3AI0A 4AIBA 1UR3M 2YCLA 3M64A 3AZRA 4ATLA 4J40A 1BGGA 1W1ZA 3VAVA 4W89A 4D6CA 2AOSA 2O56A 1VIZA 3RR4A 1B3OA 4HN8A 4HNLA 2PD9A 4BHYA 1TV8A 4JIIX 3CB8A 1KW1A 3HG4A 4MNLA 3H2NA 3SRKA 4BF5A 1DIKA 4F0KA 1M01A 4GY1A 4DNMA 4F9JA 5HNRA 2VRJA 6ALDA 4O8AA 4F0RA 3E6EA 2PC8A 2WHKA 3KWSA 1VFUA 2ISDA 3GW0A 3H7UA 1QW8A 2XGBA 3BO9A 3OPSA 4F9DA 3TVAA 1K7FA 4GH3A 4JTSA 1O66A 1P0BA 1VFOA 2DORA 5HK4A 3VD7A 4A3QA 3W7CA 4CCEA 2WJZA 2NQLA 3MUIA 4EWND 2IKHA 1DBTA 3F4DA 4LNCA 3LPOA 4V27A 3HO8A 4MZ8A 3P14A 3LSBA 3ZLGA 3NSXA 3R1ZA 2WANA 1V3HA 4ENLA 4Y9PA 1JCNA 3QVQA 4CGTA 2E3ZA 3R43A 4Y6GA 4IP7A 1F8MA 3OJGA 2ZX5A 1KQZA 3DERA 1WXYA 1DL3A 3TAKA 4DXKA 1Y0EA 4JKKA 1SO5A 3ONCA 4OOUA 3LHZA 2FMOA 5AYZA 1UOZA 3BMVA 3WDRA 3L2IA 4KRZA 1FXQA 4C1NA 3ONBA 2HSAA 3BG9A 3OZMA 3WENA 1OX6A 3PC0A 2GJXA 2FLIA 1I2RA 4FNRA 3VDBA 1CYGA 3N2TA 4XZWA 1HVXA 5I3HA 1PDZA 2CIPA 3KVMA 1R87A 3G24A 4A2SA 1HNYA 2FJUB 3C8FA 3SCRA 4ZOAA 1QAPA 3GTHA 1PKNA 2XIIA 3STCA 1B4KA 2DZWA 3VIMA 1F2JA 4QFUA 3EDEA 3MUZ1 1EGVA 2WWDA 3VIKA 1HKVA 4U31A 1EYEA 2ZUWA 5D9OA 5AVHA 4LV9A 3EMZA 4PTVA 2X09A 2CLOA 4NIRA 5CJNA 1E6SM