4O0KA

Crystal structure of 1-pyrroline-4-hydroxy-2-carboxylate deaminase from brucella melitensis with covalently bound substrate
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
323
structure length
322
Chain Sequence
HHMLKAEIFSGVIPALMTPCKPDRSPDFDALVRKGQELIGDGMSAVVYCGSMGDWPLLTDAQRMEGVERLVKAGIPVIVGTGAVNTASAVAHAAHAQKVGAKGLMVIPRVLSRGSAIAAQKAYFKAILSAAPDLPAVIYNSPYYGFATRADLFFDLRAEHPNLVGFEFGGPADMRYAAENITSRDDGVSLMIGVDTAVFHGFVNCGATGAITGIGNVLPKEVIHLCNLSQAAALGDVDARQRAQELEQALAVLSSFDEGPDLVLYFKHMMVLKGDKEYTLHFNETDALSESQRGYVETQFRLFNTWYAEWSKLPGAVQRCKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Dihydrodipicolinate synthetase
publication title Crystal structure of 1-pyrroline-4-hydroxy-2-carboxylate deaminase from Brucella melitensis with covalently bound substrate
rcsb
source organism Brucella melitensis
total genus 121
structure length 322
sequence length 323
ec nomenclature ec 3.5.4.22: 1-pyrroline-4-hydroxy-2-carboxylate deaminase.
pdb deposition date 2013-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4o0kA00
4HSOA 3WJSA 1BKSA 3G22A 5G4EA 1SO4A 4Z08A 2Y70A 1B4EA 3I7SA 2WJZA 3OEXA 1OX6A 1AW5A 3AJXA 3QQ1A 3CT7A 4X22A 3BLEA 2NUXA 5BW6A 2X2GA 4RLIA 3PBWA 4ZVJA 2Z2UA 4W9TA 1P0KA 3S1UA 2RDTA 4OWGA 4RX0A 3P8JA 5IM51 2H3DA 4GFSA 3P84A 1WX0A 5C2XA 4TIMA 2Q8LA 4FHAA 4MPQA 1PCWA 1BEUA 4KFOA 1H5YA 1LZOA 4OU1A 1FCUA 3B05A 4MZYA 2B0MA 2E5DA 4O19A 4BI6A 1TTPA 2V5LA 2ZFAA 2CLLA 3C61A 2Y61A 3S5NA 1JCNA 1ICQA 1L6WA 4XZ9A 3ATYA 1UBSA 3KVKA 4NX0A 4RKAA 1JQVA 3TJLA 3EWYA 4OV4A 3R89A 4CNPA 5E0KA 5FEPA 3QH2A 2ZZ1A 3WK2A 3CEPA 1I45A 3SIZA 3TK7A 3WJYA 2CWNA 2Y63A 4JTEA 3CQ0A 1W31A 3E96A 3W2NA 5KITA 2AQWA 1FUYA 2J88A 4CQ9A 1ZAIA 2RDWA 1LBLA 5DCDA 4JTJA 1W3NA 3EXTA 3NNTA 2QCHA 3KVJA 3L0GA 2Y7FA 1LBMA 1EWEA 4RXFA 2QCCA 1UB3A 1OHLA 2W6RA 1YXDA 1T99A 3DFQA 2E68A 2NZLA 1KLYA 4UFLA 2ZA2A 1IGSA 1NFBA 1SQ7A 4WXZA 3TAOA 2QUVA 1SO3A 5D32A 3S9YA 4A21A 1W37A 5AHMA 3BG5A 1OX5A 3W70A 2CZEA 2J9ZA 1G67A 4ORIA 3CPRA 3PG9A 3FYOA 4JY9A 4UC5A 1A5CA 2GOUA 4HPXA 1VYPX 4CCCA 3ZR4A 2OT0A 3W76A 2ISSA 3VE9A 2CLMA 2QCGA 3PAJA 3IIPA 3W88A 3EX3A 1QOQA 5AHLA 2ZYFA 4K37A 3LGEA 5CSSA 1WOBA 5DY3A 1TO3A 3I65A 1OF6A 3UPWA 2WPBA 4PCFA 4LVDA 4JX6A 1Q6LA 4MYAA 1EP1A 1K03A 2C13A 1OF8A 1TJPA 3C0JA 3LV6A 2ZZ5A 4JTHA 3S5OA 3HF3A 4B5NA 4WOZA 1FDJA 4RZ5A 1FXPA 3OHIA 3W1QA 3GDKA 3TU9A 3DKLA 5HMSA 3E49A 3TNOA 4MLRA 1DKWA 1U83A 4E2DA 1H7WA 1VYRA 5HUOA 5D02A 4ICNA 2C16A 3DFTA 3NDOA 3WJWA 3BG3A 4CCDA 4UMCA 4NVTA 4WY0A 1OFQA 2CZ5A 3W7GA 4NXKA 3WJXA 3W1NA 3PG8A 1ICPA 2ZDRA 1EP3A 1ZCOA 4O16A 1MEHA 3CIWA 2NUWA 1X8FA 4R7JA 3IIOA 3G8EA 3FJLA 4LWWA 3SSJA 3M5YA 4AWUA 3GZ3A 3LERA 3W1AA 1AW2A 3UWUA 2BLEA 3FLUA 2ZRUA 2CLIA 3G1VA 5LSMA 1VYSX 3L5MA 4IPIA 1EIXA 2QUTA 4Y6GA 2V8ZA 3NL6A 3GNDA 3TH6A 1DVJA 1KFLA 1AL7A 4ONVA 1FY6A 1SW7A 1XI3A 3PR2A 3UNDA 4JIQA 1C8VA 1XCFA 3N9RA 4MUZA 1OFAA 1QPQA 1K8YA 2P0OA 2ZA1A 3GX9A 1F73A 2C18A 2FPYA 2V5BA 5EKYA 3LHZA 4S1FA 5KZEA 1GOXA 5HWMA 2F7FA 5HUPA 2C3ZA 6TIMA 3CLMA 3F1QA 1J4EA 1XBZA 1UCWA 2Q3RA 3M6YA 1DORA 3S0CA 1SFLA 2C14A 3QW3A 4OBTA 1HTIA 2Y89A 4MZ1A 2VFDA 1GJPA 3LHUA 1D9EA 4GUFA 3W1RA 1D3HA 5K9DA 5LNRA 3EXRA 4GBUA 3EX2A 4M7SA 3NQ8A 3GKFA 3A23A 3UXDA 4QQ3A 2Y7EA 1A53A 3UWVA 1GVRA 5CZTA 3Q94A 3QMTA 5TIMA 1GVSA 5I3GA 4UTTA 3W6YA 2ZTKA 1HG3A 1N8FA 1OVDA 5K3VA 3KVMA 3ZWSA 4AWSA 3LTSA 1TQXA 4DBEA 1F74A 3B4UA 3UQNA 3P62A 4ZL1A 3UZ5A 1RR2A 4EVZA 1OJXA 4N2YA 4RZ4A 3N3MA 3CWOX 3W75A 2OJPA 4YXGA 1P4CA 3E02A 4A2RA 2ATSA 1KTNA 3W83A 1KM6A 2DJXA 5HWNA 3QC3A 1VRDA 3W7IA 4S2BA 4OQVA 3W7OA 1TTIA 3G24A 3PVFA 1H51A 1ZY9A 3M16A 5TBOA 2B7QA 2JGQA 5LNVA 3TW6A 2WSYA 3BVJA 5DBUA 2BXVA 4HHPA 1MZHA 2AGKA 5DCBA 1VLWA 2I1OA 1D3GA 3DI0A 4H4IA 3E12A 3UYCA 3S5ZA 3O05A 3W1LA 3KAOA 5KZMA 4GUHA 1N55A 2ZZ6A 2OZ0A 1LRTA 1FWTA 3N73A 2GQ8A 3CEUA 4O4WA 3SJ3A 3PSWA 1H50A 1UUOA 4MOZA 4UR8A 4LS0A 3EX6A 4IGHA 4ADSA 3BLFA 3W87A 4XWUA 3W07A 1F76A 5D05A 2KZHA 4YCOA 2VEIA 1KFJA 3MBFA 2CLEA 4K39A 2A85A 1O4UA 1ZENA 3DKJA 3P80A 4UNKA 3U6WA 1G7UA 3H55A 3W86A 4MY9A 5AHIA 3HGSA 3UWZA 4HNVA 1K02A 3P61A 4NJJA 3STEA 4BK9A 2E6FA 4IJBA 3VCRA 3W1TA 3TR2A 5DBTA 4O52A 4JEQA 4E0CA 3NL2A 4ZQMA 4IMGA 3NPXA 3TFCA 1SU5A 4FIRA 5F1VA 3MP4A 4FNPA 3NOEA 3W7LA 2H8ZA 1BWKA 3M9YA 2NLIA 5KTLA 3MWAA 2FIQA 3GK0A 3TKFA 1I8JA 3QZEA 2V2DA 1H60A 3WK3A 3G0UA 1KM0A 1RV8A 2YX0A 1EP2A 3VKJA 2QCNA 1QO2A 3W1UA 3WJZA 2R8WA 3G1YA 3NQFA 1J2WA 4LC6A 5K9CA 4MLJA 1H63A 4DQWA 3IIXA 2E77A 1QCWA 1W0MA 3GNNA 3NAVA 5FF7A 1LLWA 4DF1A 2A6NA 5EMUA 3F4WA 4M7TA 3G1AA 3PUEA 1PIIA 4HN4A 5BMXA 3D0CA 5D2VA 4HNTA 2QF7A 4MJMA 4DPQA 4H3DA 2YGYA 2V2HA 5AFDA 1ADOA 5TQLA 2NWRA 2Y6ZA 3HGOA 3PM6A 4JYDA 5K9XA 1JUBA 3MHFA 1QPNA 2IQTA 2QJHA 2RH9A 4IX2A 3SFKA 2C6QA 2TMDA 1MSSA 3W7CA 2W79A 3PC0A 5SWUA 2HSAA 1S3HA 4RZ6A 5EA9A 3W3OA 1YXCA 1XBXA 4ZMGA 4UTHA 4O57A 1H7PA 1V7YA 5CZ0A 5F2GA 4XBKA 3YPIA 4TMBA 2QCEA 1BTMA 3CWNA 3LB0A 4UFKA 4FEZA 5KMYA 1X1ZA 1K7EA 3NQCA 5LNWA 4EIVA 4JTFA 4LW7A 1P5BA 2Y88A 1TIMA 1HFBA 1JUEA 2G96A 1Q3NA 4DF0A 4TO8A 2YW4A 5DN1A 1Z41A 1K8XA 3CM4A 3ABSA 2Q3OA 3OIXA 1OK4A 3FS2A 1OX4B 7TIMA 3PBVA 2WSRA 3NL5A 5DLCA 2PE4A 4DF2A 1JCYA 3JR2A 4JDYA 2ISVA 5D03A 5E93A 2XN1A 1B4KA 1TV7A 4PA8A 3O6YX 2QCLA 3N2MA 3T44A 4BI5A 4JTTA 2VFGA 1FWWA 2CU0A 2QDHA 4Q32A 5LKYA 1TPUA 1WAUA 1HUVA 3HPZA 3BGJA 3NQ2A 4JTIA 3GDMA 4OE7A 3PSVA 4POCA 5KZDA 1TPH1 1YTDA 4K7VA 1WOAA 4CCEA 4WXYA 1ME7A 4NJKA 3OVRA 3P67A 1VCVA 2WKJA 3LBCA 3LLDA 1DQWA 2CW6A 4O14A 4WD0A 1GQNA 2C19A 4QIUA 2NX3A 1O60A 1A5BA 3OVQA 1Z42A 2NV1A 1A5AA 1KV8A 2QJIA 5ABTA 4RV8A 4PL2A 3C56A 1MO0A 2NUYA 3GDRA 4FO4A 5FEXA 3LI1A 4WZHA 1O5XA 1O5KA 1WYIA 3GVGA 4DO5A 3MI3A 3UWQA 4CNOA 3OA3A 3BLIA 1XM3A 5D33A 4AXKA 1O94A 2OX1A 3HIJA 1QOPA 2DZXA 1DHPA 3MJYA 1I2NA 4FB7A 4O17A 1LLZA 3O06A 1VH7A 3DZ1A 1LOSA 1MEIA 1XDMA 1XUZA 4X9SA 2QAPA 3USBA 2C1HA 3S1XA 2OT1A 3HB9A 4UTWA 3S5YA 3MYOA 4AF0B 2XFWA 2HTMA 4H6KA 3LRLA 2H6RA 4CQAA 4N9CA 2I9EA 3SY5A 1FX6A 2D73A 4U4MA 2O7QA 4IMEA 3FJ6A 2GQAA 3LX9A 2F84A 1SFJA 4AB4A 3R12A 1F7BA 1IXNA 3NQ7A 3C4UA 3DFNA 3LTPA 4O1BA 1RD5A 2ZTJA 4KFPA 4N4PA 3VNDA 4BF9A 2BTMA 1OFDA 2GVGA 2Z1BA 3B0UX 5J5DA 3KRSA 4ZQRA 5EBUA 1L2UA 2A21A 3NM3A 1JUKA 3TXVA 2PC4A 3T78A 4M6QA 4IWWA 4QJ1A 3LV5A 3G1XA 2Y85A 4MKNA 3TX9A 2E09A 1GYNA 3M5XA 1KW1A 2A2IA 4NX5A 3ANYA 1FDYA 2E5BA 3ABQA 3UD6A 2E5CA 4UTUA 2GJNA 3P74A 4EF8A 5KSWA 5F4XA 4XKYB 6ALDA 3TMLA 1GWJA 2HS6A 3LCLA 1KM5A 1TTJA 3QMRA 2ZZ7A 3UXAA 3EEGA 1OFRA 2NWSA 5G4WA 3EX1A 4N4QA 2ZRWA 4YMZA 1YDVA 3DBPA 3TSDA 5KINA 3L5LA 5U4NA 5HQEA 5D30A 1FQ0A 1RZMA 2YXGA 3NO5A 4DELA 4ZZ9A 1W3TA 3W2KA 3B03A 2H90A 1WQ5A 3OVPA 2NXIA 5G2WA 4O1AA 3E9AA 5EY5A 3U8GA 3ELFA 5CZJA 4NZJA 3Q2DA 4WOQA 4PEKA 1P1XA 2J6XA 4IXHA 3MW7A 2V30A 5HJLA 2J27A 3A5FA 2NXHA 1AW1A 2YPIA 5LNUA 3G18A 4MJZA 4RCXA 3HMJG 3O15A 3ZS4A 2CLKA 2V81A 4J9JA 1OX4A 4LVAA 3HOJA 1KFCA 3BG9A 4LOCA 5CPMA 4JR5A 3L9CA 1AK5A 1ZFJA 3PUOA 3LXBA 2EGZA 4MFEA 3UY7A 4UCGA 3C2EA 2E6AA 1SPQA 4Z0SA 3IGXA 4EWND 1OYAA 5FF4A 4FXRA 1QFEA 3STFA 1JRCA 4K6AA 1B3OA 4LC8A 4K38A 1ZNNA 4UIOA 4PFMA 1YYAA 5F4SA 3CU2A 4PODA 3M47A 2X1UA 4IXXA 1Q45A 5F2LA 1G4TA 3QSTA 5IBXC 4LRTA 3M0ZA 1F6PA 1X6UA 1LDCA 1TB3A 2ZCGA 5AC7A 2QCDB 3W74A 3C6CA 3T7VA 3V1PA 2R14A 2WV8A 4GXMA 3QQ0A 1YXYA 2G97A 4LNYA 3L65A 5AB3A 4Q33A 3DFPA 3KRZA 4JTSA 2WSQA 2AAMA 1H7RA 4MYXA 3P82A 4FX8A 2DORA 4ZQPA 4X3ZA 3Q58A 4NNCA 2VKZG 2BZNA 3C8FA 3IGUA 2EKCA 5D09A 2VFEA 2DZVA 1PL9A 2CLOA 4CLMA 1C29A 3O1NA 1DQXA 3MI6A 3HGJA 1QMLA 3C52A 3DI1A 4GWEA 3DH7A 4JS3A 4AF0A 1OFEA 2FB3A 3M7WA 4O4VA 4FX7A 4TMCA 4MIMA 2I14A 3IRDA 3LCXA 1FWRA 3C3NA 4Z0JA 2CLHA 4QISA 5J5RA 3VE7A 1G4PA 4NU7A 3LHVA 5AHNA 1W5MA 3NXFA 3STGA 1W56A 1DOSA 2YCEA 4DEFA 1G4EA 1I2OA 3P60A 3W2UA 4BFAA 4FIQA 1THFD 4EOUA 1GYLA 5LHEA 3B06A 3QMSA 2BX7A 3PF3A 1J5TA 4UTKA 4LUIA 1HL2A 2HS8A 2DP3A 3L67A 1IXOA 1JCJA 4AEOA 2B7OA 3F4NA 2A0NA 5FESA 1VJIA 2Z6JA 1PV8A 3QYQA 3V75A 2DZTA 3HG3A 4UFJA 2DZWA 1F5ZA 2E6YA 2EPHA 1TSIA 1GVQA 3NZRA 2QCMA 3TW7A 2QJGA 3G0SA 4YLWA 5G1YA 2WNQA 2ABBA 3TC6A 1TCDA 1H61A 1JVNA 3GLCA 3MBDA 3P8IA 1WA3A 4MY1A 1K3UA 4HT3A 4XUGA 5K4XA 1NSJA 1HO1A 2ZRZA 1H7OA 4ZQOA 3KRUA 3L2IA 1XUUA 3RF9A 3DAQA 2B7NA 3MHUA 1G6CA 2FJKA 1LBFA 4DBDA 4GUIA 4D2JA 4QAIA 2ZRXA 2FTPA 5F2IA 4R34A 2RFGA 3M5VA 2Q8ZA 2A6LA 5HR6A 3HPSA 4NXSA 3W7PA 3UPBA 5C6MA 2QDGA 4KWVA 3Q37A 1S5TA 4FNUA 5A5WA 3A22A 3L0KA 4JYEA 1FBAA 1M5WA 4RK8A 3P81A 3RU6A 3C2OA 5CPLA 1K7XA 3CIXA 5K2ZA 1I2PA 3LCFA 1YDOA 2ALDA 5CZSA 3LLFA 3TDFA 2BWGA 1TV8A 3NPUA 3QPZA 3QRHA 5E1QA 3MHGA 2ZZ4A 1VS1A 1LYXA 1ONRA 5CGQA 3RNDA 3N2XA 1QAPA 3W1PA 2EF9A 1OG0A 2A1YA 1KA9F 2TSYA 4ZQNA 2QAFA 4GRSA 1W5NA 1G4SA 4U28A 5EL1A 4BWLA 1W1ZA 2R94A 1PHWA 4FF7A 4JD4A 3T40A 1IF2A 2X30A 5LZLA 4HNNA 3R13A 5D37A 4AAJA 2X1SA 2GJLA 4O15A 5AYZA 3W1MA 3SZ8A 3W7MA 1HO4A 2OCZA 3M5ZA 3CTLA 3LDVA 3NQMA 5F2MA 1NAL1 3JS3A 4TX9A 1PE1A 1TMHA 4ALDA 4IMFA 1M7PA 2H8XA 2YR1A 1JULA 2NX9A 3PY2A 1ZAHA 2QCFA 5DXYA 1TRIA 1JQXA 1OFPA 4KWWA 1LRQA 3EWUA 2UV8G 1T96A 1VLIA 1VHCA 3DFOA 1K7FA 3EB2A 4ML9A 2A7NA 2XN2A 1GVOA 1NF7A 3MP3A 1B9BA 3W85A 3NQVA 5D2TA 3HG5A 3GAYA 3LRMA 4YWIA 1SZNA 4N9EA 1VCFA 4M6VA 3T55A 4N6FA 3SW6A 3N34A 3BK0A 4JX4A 2C0AA 5C55A 2FB2A 1TV5A 5F1UA 5CPOA 4LUJA 2QEZA 1VCGA 2VFHA 4P61A 1H7NA 3BW2A 3IVTA 3HBLA 3ABRA 1KFEA 3RLVA 1K8ZA 2WNZA 4UMBA 1FDZA 4NT0A 2DZSA 4MY8A 3C2FA 2V2CA 4GE8A 3H54A 2FFCA 3W22A 4XTDA 3G3MA 3N14A 3FFSA 5D38A 2CLFA 3INPA 4O1CA 1XBVA 3IVUA 1GTHA 3NYZA 3PULA 2JK2A 3TSMA 1PCKA 4N02A 4N9DA 3SGZA 4NNBA 1R2TA 3GB6A 4UTLA 3AO0A 4C1KA 3TV8A 3NVTA 4FNTA 4WY0B 4TR9A 5FF3A 3TQKA 4IPJA 1P0NA 4M19A 1TQJA 3M43A 1V5XA 4GUJA 3O16A 5BOOA 3O6CA 3B04A 3LXCA 4NNAA 5I3KA 3MP5A 4K8HA 4YL2A 1W5PA 1SSDA 1M6JA 3HGRA 3GYEA 3W84A 1W5QA 3VI2A 4XTIA 4WUIA 2CZFA 3HG4A 3LBMA 3QEZA 1TPB1 5CPNA 3W7EA 5HNRA 4UNLA 3STCA 1U5JA 1QNVA 2X1RA 2Z6IA 4RR4A 3DHFA 5HINA 1TPC1 3C2RA 3FA5A 3NZ1A 4IQLA 5H91A 2PRMA 4A3UA 1FWNA 5EPDA 2GVJA 1GPWA 4LV4A 1IXPA 1WBJA 3GXNA 4O18A 3GIYA 5LGXA 3MYPA 2E6DA 1RQEA 1KLZA 1SZEA 4NJIA 1BWLA 1WXJA 4PH6A 1UUMA 1LOQA 3KHJA 1CX9A 3GR7A 3G3DA 3GKAA 1TPEA 4GC4A 1KTCA 1G69A 3S1WA 3EKLA 4Z1DA 3C2VA 2J9XA 4Q4KA 1NF0A 4UTMA 3W71A 4KKXA 2DJLA 3QM3A 1CW2A 2FPVA 1Z44A 1QO5A 1GG0A 3R8RA 3KFTA 1LP6A 1LOLA 3S8HA 5BRBA 1LROA 1EB3A 5D2XA 1ZJIA 4JIPA 2Z0IA 1CI1A 2RDUA 3R5EA 4WY0F 1TPVA 4JN6A 1I2QA 4E2BA 4QNWA 4A2SA 4K36A 1SW0A 3NL3A 2YFOA 3B8DA 1SW3A 1QR7A 4IOTA 4O53A 1O95A 3GXPA 1AG1O 5DELA 4I7VA 4PC8A 2VC6A 3PB2A 1VHNA 4OT7A 3G1DA 3EX4A 3FKRA 3LCHA 1N7KA 2FDSA 1YTEA 5IBXA 4C1LA 3WK1A 3CC1A 3UY8A 1SZFA 1TJRA 3NR0A 3W72A 1ML1A 4CNNA 3DU0A 1OFBA 5LNSA 3TXZA 3UWYA 3W23A 3OBKA 4AHOA 1GTEA 3KVLA 2ATMA 1LCOA 5K4ZA 4WJEA 1X7FA 5HWJA 2B7PA 1DL3A 3QFEA 3A9IA 3NGJA 3W9ZA 5I3JA 3U2OA 4DXVA 5L9FA 4ORMA 3UZJA 3LXAA 1FCVA 4LT9A 4JTKA 4UFHA 2FPTA 2YDAA 3FIGA 1R2SA 4S2CA 3G8RA 1JCMP 3MO7A 1ME8A 1PHQA 5AC8A 4NUWA 4AHPA 3FOKA 3QSRA 3THAA 1XKYA 3EWZA 2VFIA 3ZWTA 4JTGA 1GT8A 4DPPA 1SZGA 4O13A 4LV9A 4RJEA 4LY8A 1EPXA 1S5VA 1UJPA 2V0TA 2YZRA 3W7RA 5G1TA 4PTNA 4UTIA 5CKSA 1H1YA 4O50A 2Y7GA 2JBMA 2YW3A 3TE9A 4UFMA 1YADA 4RXGA 2VOMA 5GVJA 4I7WA 1FWSA 3BO9A 4LVFA 3BGGA 5AHEA 3P5ZA 3N9SA 1ME9A 5CG7A 5D2YA 1S5WA 2ZQ0A 1L6YA 1JR1A 3G1FA 3LM7A 1L9WA 2FQIA 2X16A 5G2IA 3THQA 1KV5A 4ADTA 1Q6RA 5F4WA 1TYGA 2A4AA 3NG3A 4P2VA 4G1KA 3GDTA 4L4MA 4O11A 3NM1A 5I3FA 1SUXA 4Y8FA 5K7JA 1T0OA 3QPYA 4BR1A 4GJ1A 3LCGA 3HG2A 4UTWC 4NJGA 2FLIA 5I3IA 2RKXA 4FXSA 1LRNA 3OG3A 2Y62A 1JCLA 3IEBA 3R2GA 3HQ1A 1R47A 1ZHAA 1KBJA 5A8GA 4Z1CA 2WOQA 1H7XA 2YYUA 1FCBA 4LRSA 3LCWA 1UASA 1SR9A 3A5VA 3VFLA 4O0KA 2VFFA 1PS9A 1TRDA 2QUUA 4Y96A 4JNMA 2EAWA 1XXXA 1IXQA 2PRHA 3L21A 5CSRA 3TSBA 3M44A 2GUUA 1WDWA 4WQ6A 2B4GA 4LS1A 3CHVA 1M7OA 1Q6QA 1TPFA 3L66A 5HULA 3LTYA 4JICA 4M6PA 2TRSA 1B57A 1EX5A 3P7YA 1VR6A 4OV9A 2HMCA 2VENA 4WX2A 3IGSA 3WFAA 4DO6A 5G2HA 1OABA 4HNUA 3DFSA 2NX1A 1EA0A 4AMAA 4JXCA 8TIMA 4AHQA 1TPWA 3CB8A 3L0NA 4IMDA 3O8AA 5D2WA 4MVAA 2GPTA 2H3BA 5AOUA 2X1TA 3G1HA 3PS7A 1YTKA 1ALDA 4NJHA 3RFAA 5DXXA 1F6KA 1GZGA 2GVLA 4X2RA 5HR7A 3I68A 4DO4A 3K30A 3I7RA 2V82A 1OK6A 2Y7DA 4Y90A 2ZBTA 2O7SA 2WQPA 4JTUA 2DZUA 4LVBA 1XDLA 4Z1BA 4EF9A 1W54A 3NPVA 3TIMA 4ADUA 3G0XA 1X1OA 4LS2A 3PWAA 1H1ZA 2J9YA 3BPWA 4O1DA 4QM1A 1ICSA 4NQ1A 4UMAA 1EUNA 3IVSA 4GUGA 1T8XA 1R30A 3SR7A 4YCPA 5AYYA 1OYCA 5BNKA 3PB0A 2A7PA 1RQBA 4M5PA 4R53A 1Q6OA 4QSHA 3TC7A 2JKPA 3NQAA 5FEWA 4UTJA 3B0VC 3L68A 3TJXA 1JJKA 3TA6A 1EWDA 3O6DA 3MUXA 3W7NA 5LGZA 1NVMA 1A5SA 1W8SA 3I7QA 3W73A 1TPDA 1VC4A 2WO5A 5H2ZA 3NQGA 3TMQA 3EWBX 1DBTA 1KM3A 2VEPA 3W7DA 1VGAA 3TAKA 1MXSA 3PUDA 4N6EA 3BV4A 4XKYA 1VPXA 3ABOA 2DU2A 4O0ZA 2PCQA 4FNSA 1AMKA 3NQEA 3LOTA 4MZ8A 4R33A 1I2RA 2LLEA 4TU1A 2ZZ2A 5AC6A 2ABAA 5G5IA 1YPIA 2PURA 4IX0A 2J24A 1H62A 2W0UA 3TCEA 4UR7A 4Y9AA 3NQ6A 1G7VA 1RQHA 5FF0A 3DXIA 4AH7A 1KTBA 3LHTA 1DV7A 3MI2A 5DCEA 1QPRA 1W3IA 1XFBA 5AN7A 3S6DA 1YLVA 4NZFA 2BSLA 5BMWA 3EXSA 3UWWA 1ZAJA 3DENA 1YDNA 5EYWA 3W7QA 1EUAA 2A5HA 3KXQA 1F05A 4JYFA 3H53A 1TTQA 3I6RA 3LCIA 2YSWA 3DGRA 5D04C 1MEWA 3O07A 2A7RA 4JY8A 1Y0EA 1GG1A 3T4CA 5FF2A 3N19B 2YFNA 5DY2A 5FI8A 2G95A 2NV2A 5AHFA 1WBHA 5I3HA 1EEPA 1L6SA 3G1SA 1AL8A 3L5AA 4JX5A 3F03K 4LU0A 2VXNA 3SGUA 3FYPA 4LTSA 2CZDA 4HPJA 3JRKA 1QPOA 1WV2A 3BW4A 3P5YA 1TREA 3TROA 2TPSA 3BW3A 4UTTC 2DZPA 3WK0A 2RHGA 2CFFA 5FEZA 1LTDA 3LHWA 3KX6A 4JDBA 2GQ9A 3BARA 3GAKA 3IIZA 3QW4B 1RVGA 2WNNA 1A50A 3W2JA 1KM1A 4JTLA 4A29A 1JCXA 4HKPA 4QNEA 2R91A 2QCDA 3MMTA 4GNJA 4OHQA 5AYXA 1PVNA 1R46A 1KFKA 1F2JA 5T26A 1FCQA 4AVFA 3TQ0A 1FXQA 4ZQCA 3KOFA 1QDSA 1ZALA 2E1DA 3QF0A 2QR6A 2P10A 4HIBA 5LHFA 1W5OA 3PBUA 3GXTA 4XQ6A 4E38A 2NXGA 1SO6A 2ZZ3A 2VEMA 4JGDA 2XN0A 3EKZA 4K7YA 1VZWA 3FKKA 4O10A 4O12A 2YYTA 2JKAA 3QJAA 2ZA3A 1LM1A 4I7UA 3HO8A 3LRKA 4LVGA 2PRLA 2JGYA 3EWXA 1RPXA 1E51A 1SO5A 5C5YA 2TYSA 3W7JA 4AWTA 4K8EA 2VEKA 2QKFA 3S1VA 3GR8A 3RK8A 4UFIA 1DJQA 4FX6M 1KM4A 4L4LA 3EWWA 3W7KA 3M41A 3LHYA 1QWGA 4UXDA 4IUOA 1OYBA 4O54A 3M1ZA 3SI9A 2ISWA 2ZRVA 4IMCA 3NEVA 3A24A 4O28A 4I9AA 1LORA 4KFNA 4A22A 5U7SA 3TQVA 3W2MA 2V9DA 3NPWA 3PBYA 3TUUA 3SECA 3E0IA 1IIHA 2G5WA 5MHBA 3HJZA 3IV3A 1IIGA 4BI7A 1Z48A 3HPXA 3ZFHA 1GVFA 2VELA 3O63A 4N9BA 1R2RA 3TFXA 4CQ8A 2EHHA 3FEMA 5L6UA 3RMJA 4XBSA 4UUIA 2OMAA 4HSNA 1OFOA 4QITA 4OGZA 1VQTA 1KBIA 3S42A 3W2LA 2P1FA 2JKEA 1SSGA 4FNRA 4O8RA 3W1XA 3LI0A 3ATZA 1KFBA 1C9DA 1XBYA 1XL9A 3RLUA 1KM2A 1YPFA 4FNQA 3NA8A 4Z1AA 3IIVA 3DHDA 3B0PA 3GDLA 4MFDA 5C54A 3W7HA 3NQDA 1DJNA 4BWLC 4PL1A 3A21A 1GEQA 2C15A 1JRBA 1XC4A 1I4NA 1NEYA 2ZRYA
chains in the Genus database with same CATH superfamily
3G22A 5G4EA 3ZMRA 3AROA 2HE8A 1XLIA 1B4EA 3I7SA 3AIEA 3SJNA 1ODUA 1OX6A 2PDQA 1GOMA 1C93A 3QQ1A 1HVXA 3F4DA 2X2GA 4ZVJA 3PBWA 1XQLA 4O8AA 4W9TA 2RDTA 4OWGA 4EXQA 3DHPA 4JTCA 5C2XA 3K2GA 1BEUA 1UMYA 1PTDA 3QHMA 4BI6A 4REQB 3T0CA 3C61A 4NZ5A 2Y61A 3S5NA 1L6WA 1RJRA 1WCGA 4V1YA 3KVKA 4XD5A 4NX0A 1PBGA 1V0NA 4D9PA 4ATLA 1FWGC 5FEPA 3S83A 1I45A 3IACA 5D9OA 2Y63A 1W31A 4TVUA 1OGBA 5KITA 2AQWA 1FUYA 3AS1A 2J88A 1EYWA 3PZTA 4X0NA 2WZTA 3SBFA 2FKPA 1S38A 5C2CA 3EXTA 3NNTA 2QCHA 3F4CA 2YA2A 3L0GA 1U5VA 4RXFA 2WVSA 1JYXA 1S2TA 1WKEA 3NSXA 5A6JA 5IDZA 1T99A 4WLCA 3BOLA 4HOXA 1RJPA 2NZLA 4J3WA 1IGSA 3TYDA 3MUAA 2C79A 3ZO9A 1W37A 1WDQA 3BG5A 1Z9AA 3CPUA 3CPRA 3IK2A 4B5UA 3GVWA 3COTA 2GOUA 1BHGA 3MQTA 3KE0A 3EOSA 3W76A 4A35A 2G41A 1VFMA 5FSEC 4DYEA 1OGSA 5TNVA 1WOBA 4B90A 4DJDC 2ODOA 1TO3A 1XLMA 3I65A 1PIFA 3RN6A 2GLKA 4PCFA 1KCKA 4LVDA 1UA3A 3MUY1 1PX8A 4A8IA 4CEXC 2OLAA 1EP1A 1K03A 4W85A 2ZZ5A 4JTHA 4PTDA 3S5OA 3HV9A 1F4HA 4WOZA 4RZ5A 4ZBCA 3THUA 3E49A 3TNOA 1CWYA 1LQAA 2BVYA 5HUOA 3UCDA 3DFTA 4GZEA 4IZGA 2ACSA 4UMCA 4WY0A 4P7QA 4QCFA 4WEVX 1GK8A 2UBPC 1Z32X 4AY8A 4JAWA 4O16A 2R82A 4ILSA 4MNKA 2NUWA 2PP3A 1W3HA 2PGRA 3G8EA 4LWWA 2W91A 1H49A 2IMRA 2OYMA 3SSJA 5FA5A 3UWUA 4K1WA 4L1WA 3FLUA 5B80A 2CLIA 5LSMA 3L5MA 4G1NA 2DW6A 4HMNA 4Y6GA 2A3CA 1MUMA 1DVJA 1JPIA 1AL7A 1DPMA 1KCXA 1I9CB 5JH2A 3CZEA 3GX9A 2C18A 4XZHA 3GY1A 4H2CA 2XZ7A 2GDUA 1IWAA 1J4EA 4Q6JA 2ZWZA 5E5CA 1GQLA 1XHGA 2AKZA 1A5OC 3WFZA 1HTIA 1TWWA 4PYSA 3O3RA 4G8TA 3FK4A 3SSZA 4B92A 4D1IA 1RK6A 4GUFA 1H41A 2BY0A 5LNRA 4RDWA 1GW9A 4M7SA 2FVLA 1H2JA 5CBIA 1A53A 3UWVA 4LEFA 2Y8VA 1MZRA 3EB3A 3QMTA 5TIMA 4OBSA 1CXLA 3W6YA 3PUGA 1HJQA 3PZ9A 2A3LA 4JFSA 4XAZA 1N8FA 3CTTA 3EA1A 3NOYA 3CT2A 2J13A 1B2YA 1XYBA 1TE1A 3UG8A 2EEXA 2F6UA 3UZ5A 2D23A 2HK0A 4RZ4A 3CWOX 3T0TA 3TVAA 2OJPA 4CVWA 4YXGA 4JFWA 2J7BA 1KM6A 5FJIA 4PTMA 3MCMA 2PTWA 1VRDA 3OA5A 4S2BA 3VZZA 3EPMA 2D0GA 3QY6A 3LLXA 1FHLA 5TBOA 3FYYA 3B9OA 3TW6A 2QJJA 3MCNA 2ZIDA 2WSYA 2BXVA 3WLLA 2ISDA 3WH7A 2AGKA 1ZBCA 4HOZA 4H4IA 3S5ZA 1V3LA 3W1LA 3QZ6A 1GHRA 4E8GA 2QF8A 1UBPC 1TA3B 4R88A 1E6NA 4IUGA 3PSWA 3VNYA 4TVCA 2YZ5A 1Z7AA 2Z27A 4XWUA 4XZIA 1A0DA 2PD9A 1X6LA 3VD9A 2V38A 2CLEA 3DKJA 1JYWA 3P80A 4GH1A 5E9XA 4Y9OA 3U0HA 1HZYA 4AU0A 1ZGDA 1UUQA 4NJJA 1YDYA 5D4YA 3FGCB 3STEA 2DSUA 3FJ4A 1KXTA 4IJBA 3W1TA 5DBTA 1GJUA 4E0CA 3CL6A 2JALA 1JF6A 1A0EA 2X40A 1JPKA 4FOUA 3CZ8A 3NOEA 3W7LA 3AYVA 2H8ZA 3VIKA 4HNOA 3M9YA 2NLIA 5KTLA 3MWAA 1I8JA 4AZ5A 1H0IA 1H60A 3M0IA 4Z17A 3AU2A 3SURA 2PTXA 5KZ6A 1EP2A 1WZKA 1QO2A 4BEUA 3VDCA 2R8WA 3NQFA 4DJFD 3AISA 3O0KA 1BQGA 4DQWA 1QNRA 1BGAA 2UY3A 3WLNA 3IIXA 3NJ3A 2ZX5A 1I75A 3CB3A 1LLWA 2ZXQA 4M7TA 3G1AA 2XH2A 2HPMA 1UIOA 3A47A 4HNTA 1QATA 1JFHA 3CWHA 1ADOA 2TODA 3GYCA 3RLHA 1OG6A 2NWRA 1KFWA 5K9XA 2IQTA 3A64A 4IX2A 1EC7A 2C6QA 2TMDA 1MSSA 3W7CA 3TTQA 3ANVA 1S3HA 4H9ZA 4RZ6A 3W3OA 1YXCA 1XBXA 1H7PA 4UBPC 5CZ0A 2CXGA 4TMBA 3HU7A 3OZMA 1VFSA 2VZOA 2J7HA 3N04A 4GQBA 4UFKA 2Q8XA 3MSDA 2GVYA 1K7EA 4JTFA 1P5BA 3WQDA 1O66A 4MWAA 2FMOA 1C8XA 2G96A 1Q3NA 4DF0A 4LAZA 1Z41A 4NP7A 4WHBA 2Q3OA 4HHHA 7TIMA 2J7DA 1FVPA 1B9ZA 3PBVA 4RW5A 2OQYA 1UWIA 1H09A 4KGLA 2XN1A 5JXQA 1UKQA 2BBFA 3PFMA 5HQMA 3WMLA 3WX7A 4QG9A 3IUHA 2CU0A 4F2BA 5LKYA 4E8CA 1HUVA 1BPLB 3VX1A 2ZXBA 4G56A 4OE7A 1TPH1 3VIMA 3KBWA 4KWSA 1U1UA 4MKSA 3O0FA 4LCQA 3ONBA 1M68A 1EF2A 1OT2A 3BAYA 1F9CA 3RRXA 3LBCA 4O14A 1YBQA 4PUMA 2OG9A 3UR2A 3EBVA 1P0DA 2AQOA 1JDFA 3VMOA 1K9DA 3U9IA 2QJIA 2WC7A 5CQ1A 4NG3A 4PUJA 4QDWA 3C56A 1MO0A 8CGTA 4BJHA 3IK4A 3GVGA 1AFSA 4CD5A 1CXIA 5AECA 1XM3A 1O94A 2C7FA 3UNTA 4QLKA 4JHMA 5AZ1A 4A8RA 4GYPC 3MJYA 1I2NA 4FB7A 4O17A 4P8WA 1MEIA 3A3WA 3VA8A 4CN6A 3AU6A 3S1XA 1Q6DA 4I5UA 4CD8A 3S5YA 1ITCA 2OSXA 4UZSA 2G3IA 5JH1A 3RPTA 3LRLA 1L0PA 3GS6A 3AXHA 2JF6A 4U4MA 5C7HA 2J7FA 4PTWA 4KETA 2O7QA 4IMEA 3FJ6A 2GQAA 3LX9A 3S2CA 3WN6A 3R12A 3NQ7A 3DFNA 4O1BA 1RD5A 2CZVA 2D3NA 3BDKA 3WNNA 2ZVRA 4KFPA 2W63A 4M1BA 3VNDA 4BF9A 4IT1A 1RUSA 1DXFA 2WJEA 3SN1A 3I4EA 5EBUA 3T78A 2X42A 2VVSA 2DH3A 4M6QA 3UWEA 1UP3A 2J8FA 3G1XA 4Y9MA 2NVAA 4H83A 2E09A 4LUSA 4X63A 4JIIX 3ANYA 3V18A 5RUBA 3IAQA 1WXYA 3G1RA 5I77A 4M3PA 4UTUA 3ITLA 2GJNA 4EF8A 2HV5A 5KSWA 3CH0A 3LCLA 4NSBA 3QMRA 2ZZ7A 1WP6A 3UXAA 1ONXA 1OFRA 2NWSA 4B5XA 4N4QA 3PZOA 1YDVA 1O5RA 3WBXA 3L5LA 2CLPA 5H6HA 2WBKA 3NO5A 4ZZ9A 2W61A 4HYVA 1H0GA 4J3VA 4KCVA 1ELSA 3OVPA 1GNXA 4LH8A 1K8CA 5EY5A 3DG7A 4PEKA 1OINA 4OOUA 2QW5A 2J6XA 4L61A 3MW7A 3G6MA 2OZTA 1O68A 4MJZA 2IKGA 1V6VA 4ACZA 5FAJA 4QRNA 3O15A 5E09A 1WZLA 4GZIA 3CIVA 5D8ZA 2V81A 4MWAD 1OX4A 4LVAA 3WLIA 1KFCA 1P0EA 4Q4QA 4GNVA 3QGKC 1AK5A 1ZFJA 2Q71A 5CC7A 3LXBA 4UCGA 3C2EA 2VCBA 2E6AA 1OYAA 1W2PA 3STFA 4LC8A 1QI2A 5D9MA 1TR1A 1DWIM 3VVGA 1QBBA 2X0HA 3TJIA 5D9NA 2ZICA 3MSGA 4IXXA 1Q45A 5F2LA 4GJIA 5MF5A 3QSTA 5IBXC 1F6PA 4PBGA 2R6OA 3APYA 2Y4SA 5AC7A 1CEOA 5C9ZA 3V1PA 4DAFA 4M82A 1V3MA 1XIEA 4TTUA 3QQ0A 1YXYA 2G97A 3S2JA 1T7LA 3EOOA 4Q33A 3SEPA 3ARXA 1ENUA 3HA1A 3KP1A 2AAMA 3KCJA 1DIEA 3A3HA 1RALA 1H7RA 2AMXA 3WD4A 5B7ZA 1EJXC 3M0HA 1F3EA 2C0HA 4FXFA 3FVDA 3GW3A 1JAKA 3VUSA 3MMWA 1QHOA 2E8YA 1BYBA 3BLKA 4I5XA 3G6LA 4PZVA 4CLMA 2OTDA 2F9RA 3DH7A 3DDMA 3L2MA 4AF0A 1OFEA 1FHDA 2PTZA 2FB3A 3LZ3A 1ISVA 1ODZA 5IXEA 5A6AA 4MIMA 3D46A 2I14A 3LCXA 4J3XA 1TJ2A 4Z0JA 5TF0A 2CLHA 4GQRA 2D0FA 3SUUA 4JTAA 1W56A 2PDJA 1Q65A 1V0MA 4TXEA 4BFAA 4ECLA 4FIQA 4EOUA 3UT0A 5LHEA 4HBKA 4Z42C 1J5TA 3F2CA 1JCJA 5AY7A 5JBEA 1E4IA 1M41A 3CZLA 7PTDA 2Z6JA 1CXFA 3H8AA 2DZTA 3S5SA 1VBGA 3NYDA 1F5ZA 1XWYA 4ZO6A 2E6YA 2EPHA 2BASA 1TSIA 3PAOA 4M1RA 4JQ2A 4ZO8A 1BKHA 3QR1A 1JVNA 3IJQA 4WCJA 1WA3A 2XVPA 4B5SA 4HT3A 2CCRA 2VWSA 3EEZA 2VZUA 4ZQOA 1KRMA 3KRUA 3RHGA 1OB0A 3GHUA 1P7TA 4HCHA 4LNCA 5F2IA 3SRHA 1LT8A 3BUVA 3GTNA 4HA1A 2R24A 5C6MA 3ZJ8A 4KWVA 1S5TA 2O9OA 1EO7A 3UGVA 1M5WA 4IISA 1HW6A 4M56A 3J7HA 3RJYA 2FTYA 3R6IA 4Q8TA 1EX1A 5K2ZA 1JIBA 2DV0A 3I6EA 3GH5A 1YDOA 1FWBC 2ASHA 3RCYA 2VX5A 5CZSA 1VJSA 4UB9A 2BWGA 1TV8A 3CV7A 4YNGA 1BRLB 3UJFA 4C6CA 4GBDA 3MHGA 1VS1A 1LYXA 5CGQA 3RNDA 3N6JA 3W1PA 2EF9A 2VHLA 2XFRA 4MSSA 4C6LA 2TSYA 3B8SA 2GK1B 4WKFA 2VX4A 2QAFA 3WEZA 1K70A 5EL1A 1WDDA 1W1ZA 4FF7A 2FHCA 1IF2A 1NDWA 5LZLA 3L4UA 4HNNA 3R13A 5D37A 4AAJA 3WQ6A 3M0YA 4O15A 5H1WA 4W7UA 3W1MA 1GYMA 2WM0A 3W7MA 3GWQA 3RUBL 3VINA 3CTLA 2OR2A 4HTYA 4XD6A 3ZIZA 2HVNA 4ALDA 3H23A 4GQ0A 4IFKB 4GNKB 3PY2A 1POKA 1W3LA 3U3HA 4KWWA 3SCRA 3RR1A 2V3FA 3FDKA 1VHCA 1JI1A 4JNZA 1GVOA 1NF7A 3MP3A 3W85A 3NQVA 2HDJA 5D2TA 3LRMA 4B4FA 1GJWA 1XFCA 5CC3A 1EBHA 3OGRA 3T55A 3SW6A 1UH4A 4B2DD 5C55A 3OBEA 4FLOA 2NSOA 1UKSA 5CPOA 5LIKX 2V5KA 1P6CA 1Q4NX 1H7NA 3BW2A 3KP0A 3ABRA 2WNZA 5EMJA 3AYTA 1EJRC 1FDZA 1Q7ZA 3PZQA 4MY8A 4HZMA 4E4UA 4GE8A 4AZCA 1P0BA 1ISXA 3G3MA 4FLSA 3VKBA 3TLQA 1UROA 3IVUA 3GHSA 4L1GA 5IDIA 4BQ5A 3ZZ1A 1NDVA 2EJ1A 1PCKA 4N02A 3SGZA 4US6A 3GB6A 4UR9A 4UTLA 3EKGA 5REQB 2YL8A 1FWHC 1V6UA 3CO4A 3TV8A 3NVTA 3AXXA 4HVXA 4GCAA 2PWUA 3O16A 3O6CA 1ITQA 4TV6A 2XH7A 3B04A 5I3KA 4B3ZA 1C3FA 1VBRA 3W0KA 1MQPA 1M6JA 4FZIA 1O6IA 3NO3A 1UC4A 1A80A 1KD0A 4YTUA 4A3RA 2HVMA 3HQPA 2QVHA 1ZRQA 2KAUC 1EQCA 2OZ8A 3BQ6A 3ALGA 2YLAA 1XP3A 1OWQA 3C2RA 3NZ1A 1XKJA 1WKFA 4H9MA 2HBXA 2GVJA 1GPWA 2DGAA 1IXPA 4LV4A 4DI9A 1HKVA 4MG4A 2PTYA 3F2BA 3GIYA 2WQDA 4NY2A 2ESCA 1KLZA 1CXEA 1BWLA 6REQA 3H4XA 3KHJA 1OC6A 3KTCA 1XCWA 4AG0A 3ICJA 3NSMA 1LF1A 4Q8PA 1BAGA 3B40A 4US5A 3XIMA 4KKXA 5LIUX 1V03A 2FPVA 1Z44A 1PX4A 1LP6A 5BRBA 2Z0IA 4WY0F 2YCKX 1E0VA 3WFLA 4UQEA 2DUAA 4K36A 4HZ8A 3E0LA 2YFOA 3UA3A 1GQKA 1QR7A 3EOEA 4O53A 4B3LA 6XIAA 1AG1O 1JZ3A 4I7VA 4PB3A 2VC6A 3UEQA 4D6HA 1VHNA 3MKCA 4OT7A 2FGLA 3OIHA 4LXFA 3T0BA 1H5VA 1N7KA 1X96A 1YTEA 2PDYA 4C1LA 2E9LA 2WZHA 3VD5A 2O9TA 1XLHA 3GVVA 3W82A 4K8GA 4AHOA 4C6EA 3UA4A 1YQ2A 1X7FA 3QFEA 1KQYA 2AQVA 2OKTA 2EPKX 3NFUA 1XX1A 3USZA 4QX4A 4JFTA 3KS6A 4ORMA 1MW3A 4XISA 4EWJA 4LT9A 1PWMA 1FRBA 4UFHA 2FPTA 3PNUA 1UWAA 2MUCA 4EXAA 4L6HA 1XICA 2I7GA 3BAJA 1J10A 5HOSA 3THAA 3ZWTA 3S3GA 2OEKA 1SZGA 5JMUA 3OW1A 1UJPA 4YWSA 3W7RA 5A8OA 2QJNA 2PLCA 1YE4A 1R3RA 1MUWA 3IRSA 3ARPA 1KNWA 4UFMA 2VOMA 5GVJA 3IPWA 1AJ0A 3AWOA 2WVTA 3GXFA 5LA0A 4RE2A 5AHEA 2XIIA 3N9SA 3CV6A 5D2YA 3LM7A 1L6YA 2G4JA 5G2IA 2X16A 2QUMA 3ZT7A 1O1HA 2I5QA 4G1KA 4O11A 3NM1A 5K7JA 4HU4A 2NQZA 1T0OA 5BXRA 3E74A 4MADA 4IL0A 4FXSA 1BYAA 2O4MA 3AHVA 3CK5A 2VDHA 4C65A 1FA2A 4KW2A 3IEBA 4QSFA 4FS9A 1XYMA 1J0IA 3HQ1A 2I5IA 2ACRA 3THCA 1IT8A 1KBJA 1U1HA 5A8GA 3BGAA 5AKQA 3PZMA 2XIOA 2J8GA 4HJFA 4ML4A 1UZ1A 4BF5A 3VFLA 3ZSSA 1PS9A 1B3WA 2PSNA 7REQA 2BP1A 5CCZA 2FVMA 1XXXA 2PRHA 2BY1A 3M44A 1KXVA 5A69A 3HQNA 1XJBA 1A5LC 4LS1A 3L66A 4LUTB 3KM8A 4XZMX 3T4WA 4M6PA 4FPSA 1G0CA 4OV9A 2HMCA 3RGTA 4DWSD 2PI6A 3ITYA 2EXOA 4M51A 3CHCA 4IMDA 1XYAA 5D2WA 2CXEA 2GPTA 2OGYA 5AOUA 2X1TA 3G1HA 3PS7A 4GYFA 4IMAA 1DWHM 1F6KA 1GZGA 2GVLA 4US5D 1OK6A 3GC5A 2O7SA 2UWFA 2DZUA 4LVBA 1PTGA 5BROA 2GWNA 2FMNA 3OLGA 2BNJA 4NIRA 4XG1A 1L8PA 2XHYA 2FZNA 1QNPA 5EFFA 5FKYA 2VEGA 1O5QA 2WMHA 4KWOA 3UG5A 5AYYA 3HJEA 4WRHA 1XH0A 4QSHA 1VPQA 4Z2IA 3NQAA 2X2YA 3L68A 1JJKA 4IP4A 3TA6A 3TJXA 1R85A 4JEJA 2PU1A 1A5SA 3W73A 4DI8A 5H2ZA 1RBOB 4ZODA 3EWBX 1DBTA 1EJVC 3BV4A 4N6EA 4XKYA 2DU2A 3LOTA 3VIHA 4R33A 1IEQA 4TU1A 2WMKA 3KZSA 5G5IA 4YU1A 2PURA 4QXIA 1Q6CA 3AOFA 4MDPA 2J24A 2PGFA 3TCEA 3GG8A 5FF0A 1US2A 7ODCA 1KTBA 1NWTA 4S38A 3CV1A 3KBJA 1F8IA 1YLVA 1EOKA 4NZFA 1ZP4A 2ZUVA 5HNUA 3JUGA 2REQA 4H41A 3AZSA 2VZTA 1YDNA 5EYWA 3KXQA 4C6KA 1FHUA 4OECA 1NM9A 3DGRA 3AS0A 3THDA 3K1DA 1TJ1A 3L4VA 1DJGA 2A7RA 1Y0EA 5FF2A 2ZADA 3DYMA 3MJMA 4H01A 4R85A 3GNPA 5FI8A 2G95A 2NV2A 5AHFA 4FOKA 2QMJA 3G1SA 1AL8A 3GXMA 4JX5A 1UZHA 3ZLFA 1XSJA 5FD0A 2OZ3A 4A8LA 3JRKA 3P5YA 2E9MA 2O4QA 2CHNA 3RG6A 2DZPA 4S3DA 5AYIA 4C6BA 3SCQA 2CFFA 5FEZA 1LTDA 4JDBA 3BARA 4I8DA 4W7VA 3S9ZA 1E72M 3QBUA 1J9YA 2WNNA 3DESA 5HMEA 1ZU8A 3W2JA 1PUDA 2R91A 2QCDA 2WB5A 4GNJA 1PVNA 1KFKA 3BAWA 1F2JA 3HN3A 4ZQCA 3KOFA 1J12A 2I17A 4U5IA 3QV7A 3QF0A 2PBOA 2DUZA 1KKOA 2QR6A 1IGWA 2P10A 1PB0A 5LHFA 2WHJA 3T2PA 4XQ6A 2ZZ3A 4JGDA 2XN0A 5IRPA 4O12A 2HROA 3AJ7A 3LY0A 2Z1WA 4I7UA 2GGHA 4Q8MA 2TYSA 4R27A 5JUVA 4DZHA 4TVDA 3GR8A 4FX6M 4M0XA 4L4LA 2XSAA 4YVVA 1QWGA 4UXDA 4O54A 3R0DA 3M1ZA 3ITTA 2ISWA 3SN0A 3QHNA 3A24A 5MKGB 1FP8A 3TQVA 3PBYA 3TUUA 3E0IA 5MHBA 3HJZA 3U2CA 1Z48A 3CHDA 4H8VA 3ZFHA 4CVUA 2VELA 1NQ6A 3WD3A 5EU9A 2XSBA 2OB3A 5L6UA 1W3KA 4AZHA 4CU7A 3W2LA 2I56A 2D22A 1SSGA 2VCCA 5FIPA 3VNJA 3ATZA 1XL9A 4HYRA 3RLUA 4HA4A 2O9PA 5C54A 4PL1A 4W8BA 2PDHA 3APTA 4W5UA 3CBWA 5BCAA 4IIDA 4WSHA 4HSOA 1L6GA 1BKSA 4RNHA 4JIRA 1JGIA 4EACA 1CXKA 2WJZA 2VX7A 4C1NA 5CPTA 1AW5A 3NO1A 3CT7A 4X22A 5BW6A 4NAFA 4HCDA 4GI9A 1J0ZA 5IM51 3S6OA 3DCPA 4QAWA 2Q8LA 2VCAA 3SDOA 4YIWA 1B3YA 3B05A 3CUXA 2B0MA 2V5LA 2X8RA 2Z1SA 2NSXA 1TZZA 2IKIA 1UMLA 1ICQA 4MNMA 1GEHA 3AUOA 3TJLA 2DFAA 3P14A 4CNPA 4JQ3A 3SO7A 2ZZ1A 1IE7C 3ZJKA 3KBNA 4H04A 4JHOA 2GL5A 2CWNA 3CQ0A 3W2NA 2QIWA 2Z1KA 4B91A 5C7VA 1E0TA 4CQ9A 1ZAIA 2RDWA 4MWAC 3SUSA 2DZBA 1W3NA 1T41A 1W1YA 3RM9A 3L4WA 3TYUA 3F7JA 3MO4A 4G7FA 4IGMA 2QCCA 2J62A 1UB3A 3WQCA 3NGFA 1TG7A 1V6TA 4B16A 4NAEA 4B3KA 1YNYA 4UFLA 2J66A 4L6OA 3TTOA 1KCZA 2QUVA 4MNJA 5J04A 5AHMA 1OX5A 3W70A 4KF1A 2CZEA 2J9ZA 4LFYA 1TX0A 1MDLA 3CHEA 3V3WA 4PUNA 2GSHA 1K9FA 3FAWA 1HQTA 1GKRA 4HPXA 2QYGA 1VYPX 4CCCA 5A1AA 2DDXA 2GDVA 4KRTA 4A8NA 5ABHA 2QCGA 4K37A 3WQ5A 5CSSA 4IJRA 5DY3A 4MWAE 2VUNA 4RE0A 3UPWA 3QR0A 1TUFA 3QVQA 4KERA 4MUPA 2WLZA 2VUYA 3KUMA 2IPFA 1IR2A 2FZ9A 1QI0A 3C0JA 1WDSA 4AQLA 3QC0A 2OOFA 1FDJA 4FP1A 1FXPA 4QS5A 3ISIX 3TU9A 3SCTA 5HMSA 5BOFA 5M5DA 3CL8A 3LSCA 4E2DA 1JDEA 1VYRA 3ZJ6A 5D02A 1JZ8A 2J8TA 2VRKA 3BG3A 2PZ0A 1VFTA 2YXXA 3B8TA 3OU8A 3GTXA 1T8QA 4S3EA 4YVPA 1OFQA 4JPGA 2CZ5A 3LQLA 1EQPA 4D6GA 2JF7A 2BOEX 3MDUA 4AC1X 3HM7A 3PG8A 1ICPA 2NQ9A 1I0BA 3T08A 5GNXA 1P6BA 4F48A 1MEHA 1ISWA 2YA0A 1UQYA 3VTRA 4R7JA 3IIOA 2FFIA 3FJLA 3OP2A 3VKCA 2YOCA 4H19A 3GZ3A 4WDXA 2NQLA 2Y24A 2Y0FA 5HA7A 4CEUC 2EPNA 3AHTA 4FXJA 3H2EA 3WZ0E 5LIYX 2ZRUA 3G1VA 4RW3A 1EIXA 2QUTA 1HVQA 3GNDA 1KFLA 2VR2A 1XI3A 5HMDA 3T05A 1XCFA 1OFAA 1QPQA 2P0OA 2ZA1A 4DX3A 1EJUC 1AA1B 2EBNA 4BHYA 4AX6A 5KZEA 1GOXA 5HWMA 2F7FA 1HKIA 2OVLA 3CLMA 3F1QA 3UXLA 1ZUAX 3HTWA 2O92A 3MANA 2Q3RA 4PMXA 4XVDA 3Q67A 3SCNA 3UYIA 4PUWA 4H8NA 2C14A 3WDHA 1Q6EA 1REQB 3OOQA 2V67A 2W62A 3QW3A 4YS1A 1EEXA 1UYQA 2HRWA 1ZSXA 1VB9A 3TYBA 2VFDA 1GOIA 3LHUA 1D9EA 3W1RA 5K9DA 1X6NA 3GR4A 1Q66A 3EX2A 1TV2A 2VDIA 4L5ZA 3NQ8A 1E9IA 3LK6A 2Y7EA 2XIBA 3EDJA 4JN8A 1GVRA 5CZTA 3Q94A 2RDXA 1TMLA 5E70A 3AMLA 1HG3A 3UZWA 5K3VA 3KVMA 4KCTA 3ZWSA 1U2YA 1TQXA 1WUEA 3B4UA 4ZEPA 3GM8A 4ZL1A 1E0UA 1LJYA 3UGRA 1RR2A 3N3MA 3CUHA 2ATSA 2Z00A 3B9NA 3ARSA 3GHTA 4Q4SA 3WQ4A 4EK7A 1PEZA 1XLAA 4MTVA 4GH3A 3W7IA 4D6DA 3E2RA 1J6PA 4OQVA 1AMYA 3G24A 4MAZA 4GVHA 5T91A 3AMKA 3N3TA 4AZBA 1QNOA 2CITA 3SIMA 1NOUA 1YBQB 3BVJA 1L8NA 3ARRA 1KCLA 4J27A 1MFVA 2I1OA 2CKSA 1D3GA 3DI0A 3UYCA 4GUHA 1HGYA 1XIJA 5FJUA 4XK2A 2J47A 2GQ8A 1YNQA 1KRAC 4L1XA 1FWDC 2WWCA 4LS0A 3EX6A 3W24A 1EH9A 3QN3A 3SQLA 4ADSA 3BLFA 3W87A 1JXJA 5D05A 2KZHA 2VEIA 4K39A 1X97A 1PTAA 2A85A 4UNKA 3N6QA 3H55A 4MY9A 1UD3A 3UWZA 3K5XA 1DJIA 3CMGA 2E6FA 5CGMA 3VCRA 4ZOAA 3WBYA 4DBUA 3NL2A 1HL8A 4ZQMA 2QDDA 4JOMA 2F6KA 1SU5A 4FIRA 5F1VA 3CUGA 1MW0A 3MP4A 4FNPA 3L23A 1B90A 1V0LA 3BCFA 4ERAA 2DQWA 2A3BA 4EX4A 1RCXB 2FIQA 4ATWA 2Z7GA 4E3VA 2V2DA 1UR1A 3WK3A 3G0UA 1KM0A 2P88A 3VPLA 4RL3A 2YX0A 3VKAA 2QCNA 4GZJA 5EMMA 1J2WA 1TJ0A 4IGNA 4LC6A 5DEZA 5M17A 2VZSA 1UWUA 2D3LA 3B9DA 3ZR5A 2DZAA 2E7FA 3GNNA 4DUXA 3SCSA 9CGTA 5EMUA 4HN4A 2GJRA 5D2VA 2QF7A 1FWEC 3KLKA 1XIDA 2YGYA 4H3DA 2H9AA 5TQLA 3U7VA 3TTEA 1VIZA 2ACUA 2YDSA 1JUBA 2FYMA 4N42A 2ONEA 5IHRA 3P6LA 1HF6A 3U7BA 2W79A 1E56A 4DBSA 5SWUA 1A5UA 3II1A 4UTHA 4FMVA 1Q6GA 4O57A 1V7YA 3RPMA 1O7AA 3YPIA 1LUCA 2QCEA 5XIAA 3LGDA 2PWGA 1CGTA 3LB0A 3SFWA 5KMYA 2Y5EA 3BLDA 3VGDA 5LNWA 4PTVA 3VABA 2Y88A 4BQ4A 1BG9A 4ACZB 4TO8A 5DN1A 1HGWA 1JYVA 3WMBA 1VBJA 3B8WA 1WZMA 3VM5A 3CM4A 3ABSA 3FS2A 1OX4B 3IJ6A 3C3UA 2VD8A 2WSRA 5DLCA 3TZNA 4DF2A 2I16A 2AL2B 4J3TA 1S39A 3O6YX 4YHGA 3T44A 3DBNA 4JTTA 4GD0A 2VFGA 1FWWA 1QTWA 5A6SA 4UQ9A 1TPUA 4TTGA 3VOJA 3AYSA 1WAUA 3HPZA 3BGJA 3NQ2A 4JTIA 3GDMA 3FVMA 4POCA 4K7VA 1WOAA 2CPUA 4CCEA 1GOQA 2DH2A 1IZJA 4NJKA 3OVRA 3P67A 1YIXA 2DSVA 1VCVA 1GUVA 4TUFA 4MPKA 4NILA 4GXPA 1QHPA 3NDZA 5C8BB 1WNOA 2ZX9A 1QBAA 1O60A 1A5BA 3W27A 3N2TA 1FHVA 3AXKA 4RV8A 3GDRA 4B9YA 4XAYA 1S5NA 3WD2A 5EBAA 3MS8A 5D33A 3CUJA 3HIJA 2DZXA 3R11A 1DHPA 1B54A 1LLZA 4GABA 1TZ7A 1XDMA 3USBA 4X9SA 4ZB2A 2XZ9A 2XSXA 3EZ4A 5LA2A 2PDBA 2OT1A 3HB9A 1EFZA 4AF0B 5CSYA 2H6RA 1O12A 1R3VA 4C60A 1FX6A 4D6IA 1JPHA 1NOFA 2E67A 4GIYA 3SADA 4LX4A 5JIPA 3TC3A 1F7BA 3H24A 4GJJA 1IXNA 4XZWA 4H8HA 4LB4A 4N4PA 1X98A 1BSLA 2XPKA 3B0UX 4JFUA 3KRSA 1L2UA 4MJ4A 4QJ1A 2VO5A 1PXGA 4FK9A 3K4WA 3TWAA 4DM1A 2XJ7A 3TX9A 1XD0A 1BQCA 1GYNA 1HN1A 3M5XA 4NX5A 2VZVA 1E40A 5XIMA 3ABQA 5CXPA 2FHFA 2E5CA 4IG2A 1HJWA 4I9JA 4QS6A 4G2DA 6ALDA 3TMLA 2VQTA 1ITXA 1RAKA 3SUWA 3EEGA 1AH0A 4IFRA 2ZRWA 4YMZA 3E1F1 1R6WA 2P8CA 5KINA 1C91A 4LSBA 4EE9A 5HQEA 3GBDA 2QPUA 2Y5SA 4DELA 1OSEA 1UR3M 1XGDA 1WQ5A 2BG5A 3E9AA 3LNMA 3ELFA 3MCOA 3Q2DA 3MVTA 3OQ8A 5I78A 1P1XA 4LYRA 4IXHA 1EIBA 4TX6A 2V30A 5FJJA 3G18A 4YPJA 5LXXA 1J96A 3N4FA 4EPKA 3HMJG 4D6EA 2CWXA 2ZUWA 3EDKA 4HQVA 3ZSTA 6ENLA 1UD5A 2PP1A 2Q02A 4GHRA 4V33A 3FX4A 2VVNA 4PMNA 3WLMA 2BODX 2EGZA 2O0TA 4H1ZA 4Z0SA 3IGXA 4EWND 4FXRA 2DVXA 1R5YA 3AIQA 3TZFA 3V0UA 1JI2A 3PZIA 5HJXA 2XFYA 3IANA 3A4WA 4PFMA 3H7UA 2QVNA 4PODA 3M47A 1OEPA 3W38A 4LRTA 3M0ZA 1E9LA 1X6UA 2CBUA 1PZ1A 4WF7A 2ALRA 4W93A 3ENLA 3BANA 2PF0A 1OM0A 1MRQA 1KO0A 4BS0A 1AD1A 1GKPA 1KGXA 3L65A 1CGUA 4JTRA 3PJTA 1UKPA 1F4AA 4DZIA 3R94A 1CIUA 4ERGA 2ZUMA 3DFPA 4JTSA 2DT2A 2DW7A 1Q4WA 3P82A 5DX7A 4REQA 5HK4A 2BY2A 4HHLA 3P3BA 1P1MA 2DSWA 2DORA 2J75A 2VKZG 2AKMA 2BZNA 3C8FA 3SCVA 1M01A 2EKCA 1QXLA 2VFEA 2O56A 5IOBA 3O1NA 1UD2A 2IS7A 4GWEA 2VC9A 2VURA 3CLWA 1FWRA 2YIHA 5KETA 1G4PA 3UR7A 3OLEA 3ZYZA 4HPHA 3W2UA 1XIFA 1GYLA 3B06A 4W87A 3L67A 1IXOA 4ZGYA 4WSJA 1HL9A 3ZVIA 2Q01A 3IJIA 1QK0A 5CC5A 3UCCA 5M03A 1GVQA 3NZRA 2F2HA 4NL1A 2PB1A 5DQPA 3REQB 3WQVA 3A4AA 3JVAA 1JNEA 3WO8A 3G0SA 2WNQA 4PFHA 3TC6A 1U22A 1H61A 4MY1A 3S2MA 4KS0A 2C8NA 3E38A 5ABFA 2ZRZA 1GQJA 3DAQA 3I4KA 1G6CA 2FJKA 3O6AA 4D2JA 2GJXB 4QAIA 4JCLA 2W27A 3U2EA 2ZRXA 3WQ8A 4LQ1A 2RGLA 1DWAM 3S2NA 2RFGA 1JD9A 2Q8ZA 2A6LA 3LGGA 4GKTA 3W7PA 4AX7A 3LNPA 1FTXA 3F2DA 2QDGA 1R8LA 3I10A 3B4YA 4FNUA 3L0KA 1EJTC 3RU6A 1LQ2A 1R9YA 5CPLA 3UJ2A 5H8PA 4F40A 3CIXA 3OTRA 3AIBA 2HNEA 1V3KA 3WQPA 3BAXA 4Q8WA 3TDFA 3QPZA 5AVNA 2CETA 3QRHA 1ONRA 2IXUA 1QAPA 3UF9A 3IARA 1ZLPA 3T0DA 1Q85A 1D7FA 1RBLA 1W5NA 4JL2A 3FHQA 4LJ3A 4U28A 4AEEA 2R94A 4L65A 1PHWA 3T40A 4PB4A 2X30A 3NEHA 2VQUA 1X8CA 2X1SA 3SZ8A 3B9AA 1WB0A 2OCZA 1W32A 5F2MA 1NAL1 4YN5A 4TX9A 3CUZA 1UPMB 1PE1A 1HKKA 1HXJA 3IV8A 3VCCA 3ZVHA 4B15A 5A95A 1V6YA 1JFXA 4PMRA 4XAGA 3EWUA 1T96A 1VLIA 3DERA 1PKMA 1K7FA 2X41A 3EB2A 4ML9A 2A7NA 3VK5A 4J5NA 4IIGA 2AL1A 4CCZA 1B9BA 1XLCA 4QR6A 4N9EA 2YLLA 4URIA 1E6RA 3SB0A 3W01A 5CAKA 3W4RA 2VGBA 1XLFA 4YJ5A 2C0AA 2GFTA 2FB2A 5F1UA 4F79A 1B1YA 4LUJA 3VZYA 3W28A 2QEZA 1KR1A 3WDRA 3HBLA 4N0RA 2PP0A 1M7XA 4DLMA 4NT0A 2DSKA 1OQFA 1KRCC 4I9TA 2F6XA 2FFCA 2OEMA 4MKVA 3W22A 4XTDA 1M03A 3BJTA 3LUTA 3CZKA 3KHDA 2CLFA 1XBVA 1NARA 2JK2A 4E4FA 6PTDA 4PMYA 4O1FA 3L7RA 3AO0A 4CQDA 3BV7A 4RE4A 3I6TA 1FWIC 2QXWA 1R3SA 5A8QA 4NI3A 3WNKA 5FF3A 5DMMA 3TQKA 4IPJA 4KCUA 5CPQA 1TQJA 4LYQA 1R38A 2GGEA 4GUJA 3TNBA 3N13A 4NNAA 4CU6A 3ITCA 2ADAA 4ASTA 3CYVA 4PMVA 1SSDA 3MU7A 5TD4A 5BYWA 3W84A 3LZ5A 1W5QA 5IFPA 4GYKA 3LBMA 3VAVA 3KOZA 1VKFA 3ARZA 4DJDA 1KXQA 4EPEC 3TLLA 3RDKA 4UNLA 3STCA 3C0QA 5LXEA 7REQB 4LALA 4RR4A 3ITVA 1ZBVA 5HINA 2YCLA 2ZC1A 4AY7A 4A3UA 4Z2JA 1WBJA 9RUBA 3QY8A 1FWFC 2WVVB 2YXOA 1TE6A 1S2WA 3WNPA 1RQEA 5I02A 4PH6A 1DIKA 4ZA0A 3VUPA 3GNRA 1NWSA 1RHCA 1NDZA 1XPYA 3G3DA 3GKAA 3WH8A 3PTKA 4GC4A 5LYRA 4GA8A 4B4HA 1F8MA 4Y8EA 4IPPA 4UTMA 2DJLA 1XIMA 4GZ7A 3CH9A 3FGCA 1QO5A 1GG0A 2D24A 3TOYA 3KFTA 3A4XA 3S8HA 1XR2A 3AHYA 1EB3A 5D2XA 2I5GA 1CI1A 3AMCA 1TPVA 4JN6A 4LGXA 3AZRA 4RDYA 4FR6A 4QNWA 1CLVA 4LCRA 2GUYA 4IQJA 3B8DA 1RA0A 7XIMA 3G2GA 3V36A 5DELA 3PB2A 3G1DA 1RCOB 3FKRA 3LCHA 4Y7EA 3CQHA 3UU0A 1SZFA 3EA2A 2YL5A 3W72A 5HPCA 1ML1A 3D6NA 1OFBA 2F2KA 5LNSA 3UWYA 1ADDA 4IH3A 3W23A 2AOSA 1MNZA 2ATMA 2CESA 3NZQA 2V5CA 3WF2A 2B7PA 3EOLA 4Q7IA 3A9IA 2PD5A 3W9ZA 3RPDA 3MSRA 3N2CA 4D6CA 4EP8C 3KRBA 3QGVA 3UZJA 2UY4A 5EMKA 1KRBC 1TVNA 4PCTA 4W7WA 4JTKA 3GTIA 2YDAA 3FIGA 5C0QA 1R2SA 3G8RA 4PBEA 3MO7A 2P5NA 4NUWA 3FOKA 3QSRA 3RR4A 4KEUA 1GT8A 4GVFA 1Q13A 1SR0A 3WKZA 3KL3A 2DIEA 4F9DA 5G1TA 4PTNA 4DRSA 2Y7GA 2XVNA 2YW3A 4J3ZA 4JFVA 1R7AA 4PGLA 1FWSA 3P5ZA 1ME9A 1S5WA 2PF8A 3G1FA 5I09A 3AIRA 2DVTA 2QNEA 4I6KA 4ZXLA 1Q6RA 1YE6A 1TYGA 3NG3A 3EPOA 3VGEA 2VD9A 4Y8FA 3RILA 3LCGA 3HG2A 4KH2A 4UTWC 3F5KA 3P93A 2FLIA 2RKXA 2XH4A 4P5UA 3T8QA 4WR3A 3R2GA 1UR4A 1R47A 3WF1A 1ZHAA 4Z2LA 1BF2A 1A0CA 5HJYA 2YYUA 4LRSA 5DMLA 4DJFA 2VFFA 3OYZA 2ZUNA 2YBUA 4Y96A 3NTYA 3ARVA 1IEIA 4DJDD 4NHVA 1XLLA 3H2OA 4QHRA 3VFCA 4AZ7A 4U2YA 4AVNA 3CHVA 3BLPX 1Q6QA 5HULA 4NYYA 4H7VA 3VILA 4GXWA 3LMZA 3W02A 4CNTA 3SY1A 5CG0A 2WZMA 3NZPA 3UPMA 4WX2A 3IGSA 1FKXA 1OABA 1SZRA 3ZT6A 4ROQA 2NX1A 2G37A 1EA0A 3B0YA 4AMAA 4JXCA 3K4AA 1Q7MA 4MVAA 2H3BA 1UP2A 1JDDA 3GFXA 3R0KA 1YTKA 3RFAA 2XDFA 4XB3A 2V82A 2Y7DA 4JNYA 2WQPA 4EF9A 2ZXAA 2HXUA 3TIMA 4LS2A 5HDRA 1C8YA 1H1ZA 4O1DA 3BPWA 3ITXA 3VMPA 4AMCA 4OVXA 1LL7A 2OU4A 3IVSA 1GGOA 5BNKA 3VNMA 3PB0A 1RQBA 4M5PA 3TC7A 2JKPA 4UTJA 3W81A 3WH6A 3B0VC 4Q8NA 1EWDA 3O6DA 1W8SA 3I7QA 1TPDA 2EKGA 1UQZA 3CJPA 3TMQA 1O1ZA 3M4HA 1KM3A 2VEPA 3W7DA 4RPPA 5LIWX 5HANA 3C0LA 1VPXA 4O0ZA 1AMKA 4QE1A 4MZ8A 1I2RA 5IFTA 3PPCA 3BOXA 4PCSA 4IX0A 1OY0A 4JHZA 2XWEA 5M3WA 1QUMA 4HK7A 1H62A 4JQ4A 1E4MM 2W0UA 4C1NB 4S3GA 3VX0A 1W2VA 3DXIA 3GC2A 1NJJA 1W9PA 5DCEA 1W3IA 1XFBA 3B8VA 1H3GA 5JIWA 5AN7A 3P0WA 5BMWA 6XIMA 1DIOA 2INZA 4GGBA 3W7QA 2VGFA 2XVGA 3CASA 3RLGA 1F05A 4JYFA 4WDTA 3T1GA 1TTQA 1WE5A 3A9BA 3R8GA 2YSWA 3WD1A 1LQ0A 2OEJA 3RO6A 1GG1A 3T4CA 1EL3A 2WMIA 4CNUA 2BHZA 3KCOA 4MGGA 7ENLA 1E9YB 4LBSA 1G5AA 2IXVA 2G3JA 1L6SA 2VXNA 3FYPA 3OGVA 2OFJA 1CTNA 1GVIA 2CZDA 5JBFA 1WV2A 1TREA 3LPFA 3RCNA 3W6LA 3WK0A 4ZOBA 3M0MA 4Q4OA 3GAKA 1D8WA 1D7KA 3IIZA 3QW4B 1RVGA 3O9NA 4PUKA 1A50A 3LMYA 1KM1A 1QI3A 3OJGA 4Y9NA 4E3TA 5HXMA 1JCXA 4HKPA 3GFZA 1V0KA 5BZAA 1PX3A 4DWDA 2HBVA 4KT2A 3PZUA 4AVFA 3TQ0A 2WW5A 1QDSA 3UVAA 1QU4A 2RJGA 2OPJA 4QDPA 4HIBA 1CGVA 3PBUA 1J0HA 1CLXA 4X9YA 1SO6A 1GZ1A 2GDQA 1XSKA 1W8GA 1VZWA 1US0A 3FKKA 4O10A 5C9UA 2ZA3A 3SUVA 1LM1A 4KQNA 3LRKA 4LVGA 1V79A 3W25A 5T9CE 2JGYA 3EWXA 1RPXA 4AWTA 4UQBA 3S1VA 3S46A 3N4EA 3RK8A 1DJQA 3EOUA 3AUJA 1KM4A 3EMQA 2OYLA 3GSMA 5ECUA 3MKKA 3EMCA 2OQHA 4IUOA 1OYBA 3QV9A 2C71A 3PZGA 3GVRA 4NZ1A 4L9YA 2OO6A 4IMCA 2QDEA 1LLOA 2RAGA 4E8DA 1P43A 1LORA 4I9AA 4CN1A 4KFNA 2X7VA 2PLJA 4HK5A 2V9DA 1BF6A 1E6PA 1DYSA 2G5WA 1J01A 4DBWA 3IV3A 1IIGA 3HPXA 1E70M 2BVTA 1CLKA 4XBSA 4UUIA 3N9KA 4HSNA 3VYLA 1OFOA 3NCOA 1KBIA 3WY1A 3VZXA 3N2BA 4FNRA 1JZ2A 2G4FA 1R86A 4Q8UA 4Z1AA 2PLMA 1V7AA 3B0PA 4L4PA 3GDLA 3LPPA 4MFDA 5C9WA 2P3ZA 3W7HA 3NQDA 4BWLC 3NUKA 2C15A 1LWJA 1CPUA 4GI6A 3VD4A 4YYFA 1MVYA 2XH0A 2VC7A 3WJSA 3PK7A 2Y70A 4GLEA 1PKNA 3BLEA 2QGHA 2AGTA 5TAOA 4JKMA 4RLIA 3HFYA 1IQ8A 3S1UA 1IZKA 2H3DA 4IM4A 2VYOA 4GFSA 3P84A 1WX0A 1PKYA 4GY1A 1PCWA 1H5YA 1OCQA 4OU1A 2E5DA 4O19A 1TTPA 2ZFAA 1M7JA 2WJFA 1QI4A 1R0MA 1JCNA 1XIHA 4XZ9A 1BRLA 3ATYA 1UBSA 4XZLX 3EWYA 2XUCA 2CHRA 2BMBA 3R89A 4L9XA 3WLJA 2QJMA 2GK1A 1FH9A 3CEPA 4HMEA 2DIKA 3VIPA 3SIZA 3TK7A 4C6NA 3E96A 3WUGA 3GU1A 3E0VA 1RLCL 4MB1A 1Z69A 2EJAA 1JZ7A 3SGGA 4JTJA 4PEEA 3KS5A 2Y7FA 1LBMA 1OIMA 1E6QM 3GXIA 3WLOA 5CAHA 3C8NA 1IHIA 2W6RA 5CGTA 1Z3NA 3CUFA 1W9XA 1KLYA 2ZA2A 1NFBA 4J2MA 4WXZA 5D32A 4A21A 4K1GA 4JIEA 1D8CA 8RUCA 3H2FA 4UC5A 5EMLA 5PTDA 3IUDA 3WG6A 3UFYA 2ISSA 4GIAA 2CLMA 5HBFA 3LQGA 1W3JA 3W88A 2E28A 1YKWA 1QOQA 2W4XA 4PN2A 2ZYFA 4C6PA 4DNHA 4M29A 5I5RA 1OF6A 4UQAA 1DE5A 1PPIA 2GZXA 4Q4PA 3F5LA 2VGGA 3WDIA 2V69A 1Q6LA 1AQMA 1LT7A 5M2FX 4KRUA 2P0IA 3BICA 3LV6A 4PSRA 3HF3A 3W1QA 3GDKA 3ITOA 4LANA 4ICNA 4AIUA 3NDOA 5CC6A 1IWBA 5D8WA 4C6IA 3W7GA 4NXKA 3WJXA 1VF8A 2FZMA 4U3CA 3RCMA 1C7TA 3KCLA 1VIWA 3R8HA 1ZCOA 3MT1A 4GIRA 2R1NA 3CIWA 3ERPA 3BE7A 2P50A 3BQ5A 4FF5A 3M5YA 3LERA 4RNIA 1VFOA 4ZSUA 2IQ0A 4HMDA 3RJXA 3ABZA 4RDVA 4IL2A 2PDNA 4IPIA 3ARYA 2V8ZA 1C7SA 2PODA 4QTGA 3R79A 1FY6A 1SW7A 3QLLA 3S1GA 3PR2A 1E1FA 4JIQA 3N15A 4TOQA 3TYAA 4GQQA 4MUZA 3E5BA 1K8YA 2WZEA 1F73A 1NTHA 2E25A 1VPYA 3R43A 4R3UA 4XIMA 3CQKA 6TIMA 2H9AB 5ENLA 1XBZA 4GOAA 3M6YA 1DORA 4B2DA 3WLTA 1SFLA 4MJ2A 3PWIA 3RIKA 1YHTA 3UZXA 1PJ9A 1HJUA 4OBTA 3NZGA 4MZ1A 2GVEA 1TX2A 1GCYA 1XIIA 4DXKA 4Z1YA 1D3HA 4JTQA 1SM9A 3Q65A 3EXRA 3HFTA 3T09A 1LUCB 4X60A 3WDPP 4ZENA 4QCEA 3GE7A 5DRCA 4OOZA 4UTTA 2ZTKA 4OFCA 1W91A 4C6DA 1JGMA 4AWSA 4DBEA 1XCXA 3P62A 1OJXA 3B97A 1F3WA 1CCWB 3CUIA 4N2YA 1AZ1A 1CECA 3ARQA 1FWJC 1P4CA 3E02A 3TA9A 4A2RA 1KTNA 3W83A 3FN9A 1P6WA 1VENA 5HWNA 5C9XA 1I0DA 5FOOA 1TTIA 2DVUA 2QGYA 4JCMA 2B7QA 1W1PA 4AWEA 2JGQA 3R25A 1WKDA 5LNVA 3UVIA 2OX4A 3UETA 5DBUA 4HHPA 4U33A 4B9ZA 2ZX7A 5DCBA 1VLWA 1TUXA 3DOPA 3O05A 1JPDX 5KZMA 1FWTA 1HP5A 3CEUA 4O4WA 1CGXA 3QYSA 4LF1A 4KCWA 2DY3A 1VJZA 4RNJA 4XZNX 3CMJA 4IGHA 5BXSA 1HP4A 3M0JA 1JZ5A 3WF4A 3KWXA 4M80A 4EANA 3W07A 5E0FA 3MBFA 1KFJA 2WVUA 3WLKX 1XLBA 2XU2A 4KEVA 1POJA 3AIVA 1G7UA 3W86A 4DJEA 3HGSA 4YVXA 4DUVA 1RCQA 4HNVA 1K02A 3P61A 2I57A 4AIOA 3UP8A 4BK9A 2GGJA 4IMGA 3NPXA 2BV9A 1QK2A 4H9VA 3UXIA 2E4TA 4F3HA 2WMGA 2FJUB 2X0SA 5BU6A 3TP4A 2Z1XA 2QS8A 2YDRA 3TKFA 5DMYA 2XYLA 1IT0A 1RV8A 4V28A 1S2AA 3VKJA 4TV5A 1RY0A 1FOBA 4IICA 1BVWA 3DC0A 1U33A 1H63A 1UOKA 4Z2HA 1ESWA 4F9JA 3WLQA 1VBHA 4IG2B 3H22A 2B81A 1W0MA 5FF7A 4DF1A 5GJPA 2A6NA 1PIIA 1KQZA 2PEVA 3D0CA 4LUTA 2P53A 4MJMA 4DPQA 3UCQA 5AFDA 1J0YA 3V0SA 4LY4A 3HGOA 1ISZA 1BXBA 4JYDA 3IAPA 4G6CA 3MHFA 1QPNA 4C90A 3SFKA 1NP2A 3L4XA 3RITA 2J74A 8XIAA 2PUZA 1JEZA 5F2GA 5CZKA 4XBKA 1I1XA 5BOEA 3OO2A 4JKLA 3KEHA 4X2PA 3TN3A 4GK8A 3V5CA 4FEZA 1TR9A 2XM2A 1X1ZA 3NQCA 4EIVA 3SRDA 4LW7A 1TIMA 1R3YA 1HFBA 3S2LA 3PZNA 4F2TA 4PSPA 2YW4A 2UY5A 4I5RA 4J2PA 1K8XA 2ZX6A 3NVDA 2HVOA 1AVAA 2PE4A 4I9MA 4PE8A 1JCYA 2A79A 4JDYA 1MRAA 1ZPTA 2ISVA 1JDAA 3N2MA 4BI5A 3STPA 5H8MA 1VFHA 1XLKA 4Q32A 1DQUA 5H8UA 4BY3A 3ME3A 3QR3A 1PZ0A 4AC7C 3H7RA 1XG3A 3AS2A 1EOMA 1ZL1A 3PSVA 5KZDA 1YTDA 3BSMA 5GNYA 4RZBA 3AQUA 1I60A 4AD0A 1XLJA 4KEMA 3H2MA 3SCWA 2OELA 1JPMA 1BGGA 3T42A 1YX1A 4WD0A 2C19A 1V93A 4QIUA 2NX3A 2E3ZA 3VIGA 5E6YA 3OVQA 3G5EA 2NV1A 1A5AA 1KV8A 4AD1A 2NUYA 4FO4A 3CV2A 4J40A 3IJ7A 5FEXA 3LI1A 1O5KA 1WYIA 4DO5A 1Z6KA 3MI3A 4IQEA 3UWQA 3ES8A 4CNOA 5I23A 3OA3A 3BLIA 4KGJA 3URNA 1BXNA 1BTCA 1Q63A 4PCNA 1QOPA 3H4WA 4FSAA 1EXBA 4DWSA 3SCPA 1GVYA 1TVLA 2PU0A 3DZ1A 1LOSA 2C1HA 3L4ZA 1E5JA 1CGYA 3K8MA 1ADSA 2HTMA 3WENA 4DJED 4N9CA 2I9EA 3SY5A 2GSJA 4L7ZA 4P8VA 2D73A 3VD3A 3UR8A 3LTPA 2BTMA 1E0WA 2GVGA 2Z1BA 4PR4A 4F66A 3TXVA 1JUKA 2NVCA 3PBGA 1NU5A 3LV5A 2Y85A 4GISA 4MKNA 3ZM8A 2VR5A 3GDBA 3L4TA 2G3NA 3ANUA 4CN4A 1KW1A 2ZUUA 4AY1A 4FLQA 1G1YA 2E5BA 2WK2A 1EGZA 4ZOCA 2UY2A 1RY8A 3P74A 3M7SA 5I24A 2D2GA 2E0PA 3KBMA 3WLPA 5F4XA 1J2BA 3VDAA 1Q2SA 1EC9A 2A3AA 1WKYA 4R5EA 1GWJA 3M07A 3N29A 1KM5A 1TTJA 4JZ5A 1BVZA 5ABFB 5IHSA 3I3BA 4S3FA 3V5OA 4LUYA 2BFGA 1UR2A 1Q5MA 4J28A 1R87A 4I3GA 2BHYA 3QXBA 2BB0A 3TSDA 3H2CA 4M81A 5D30A 1RZMA 1UJQA 3R10A 1KXHA 3W2KA 5DFAA 3BOFA 4F0SA 3CXOA 2NXIA 3WLHA 1CT5A 5G2WA 4O1AA 1JDCA 1KKRA 3U8GA 3VIIA 3E0FA 4PTXA 3BZJA 5MKGA 5HATA 1B3VA 4CQBA 2J27A 3A5FA 4INFA 5E0CA 2YPIA 1GQIA 4V27A 4N7QA 4RCXA 1XSIA 4DM2A 3RRAA 3GQYA 1ZBWA 4ES4A 1IEWA 2R1LA 3TEVA 3VDHA 3TYCA 1KBKA 5CPMA 2XVKA 1L6FA 1TZ9A 3E0WA 3RX4A 1MW2A 3UY7A 2ANUA 3H70A 3OLDA 1SPQA 2QUNA 4XO6A 1QFEA 4DUOA 4K6AA 3QV8A 2BS9A 4GI4A 1DJHA 1ZNNA 1Y7VA 3W00A 3ITGA 4I8YA 3IUIA 4UIOA 3WSUA 3D3FA 2X1UA 1A47A 1GZJA 1YEYA 4OKDA 3FCPA 3VXGA 1EXPA 1LDCA 1TB3A 2ZCGA 3ZVHB 1B3ZA 3H26A 2WV8A 3BSHA 5LIXX 4ZOEA 5AB3A 3SM0A 3WNOA 1UWTA 4OJYA 1S46A 2OOGA 3ID7A 4UCFA 4I6VA 4MYXA 4FX8A 1UZDA 3W26A 1R3TA 2WKGA 4X3ZA 1GKQA 3Q58A 4XV0A 2YA1A 3VNKA 3OB8A 4MDOA 5D09A 4NZCA 2DZVA 4AD4A 1PL9A 2CLOA 3BJSA 4HPNA 1FH7A 4GVIA 1C29A 1DQXA 1QMLA 3C52A 3DI1A 1TMQA 3M7WA 2PGWA 4TMCA 2O9RA 5GQBA 3IRDA 4W84A 4QISA 5FJPA 5J5RA 3TN4A 3VE7A 3LHVA 4J35A 5AHNA 1W5MA 3NXFA 4K3ZA 3STGA 1UHVA 1DOSA 4DEFA 4G9PA 3B8IA 4MB5A 2XG9A 4E2OA 2BX7A 4UTKA 2EG8A 4LUIA 2OODA 3WMCA 1XIBA 4AEOA 2ZXDA 2A0NA 1PV8A 1FP9A 2F8QA 3HG3A 3ZQ9A 2DZWA 1QNQA 3T9PA 1HJVA 4GC3A 3L2LA 4CUCA 3TW7A 2QJGA 1E6SM