4O0KA

Crystal structure of 1-pyrroline-4-hydroxy-2-carboxylate deaminase from brucella melitensis with covalently bound substrate
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
323
structure length
322
Chain Sequence
b'HHMLKAEIFSGVIPALMTPCKPDRSPDFDALVRKGQELIGDGMSAVVYCGSMGDWPLLTDAQRMEGVERLVKAGIPVIVGTGAVNTASAVAHAAHAQKVGAKGLMVIPRVLSRGSAIAAQKAYFKAILSAAPDLPAVIYNSPYYGFATRADLFFDLRAEHPNLVGFEFGGPADMRYAAENITSRDDGVSLMIGVDTAVFHGFVNCGATGAITGIGNVLPKEVIHLCNLSQAAALGDVDARQRAQELEQALAVLSSFDEGPDLVLYFKHMMVLKGDKEYTLHFNETDALSESQRGYVETQFRLFNTWYAEWSKLPGAVQRCKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrodipicolinate synthetase
molecule tags Lyase
source organism Brucella melitensis
publication title Crystal structure of 1-pyrroline-4-hydroxy-2-carboxylate deaminase from Brucella melitensis with covalently bound substrate
rcsb
total genus 121
structure length 322
sequence length 323
ec nomenclature ec 3.5.4.22: 1-pyrroline-4-hydroxy-2-carboxylate deaminase.
pdb deposition date 2013-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4o0kA00
3FKKA 4FX8A 2DP3A 2IQTA 1A5CA 4BI6A 2X1UA 3LCLA 4PCFA 5C5YA 4E38A 3M9YA 2E6DA 2E6YA 3GDRA 4XUGA 1LTDA 1SO3A 3GAYA 1FBAA 4XBSA 3P8IA 1IXNA 3W73A 4JTUA 1KFCA 4JTTA 2QJGA 4NU7A 3LCWA 4WJEA 1KFEA 4UTJA 2FLIA 2ZQ0A 3N2MA 3C4UA 4TX9A 3E0IA 3VKJA 2QJHA 5DCEA 1TPWA 2Z6JA 2H3BA 3W7JA 1ZAIA 1LRQA 4UFJA 3BG9A 2PCQA 4LV9A 3PG9A 4NNBA 3W2MA 1OHLA 1TTJA 4O13A 3TXZA 1K02A 1BWLA 1K8XA 1VLIA 1X8FA 3WK3A 1XC4A 3QQ1A 3TH6A 4N6EA 3PR2A 2VFDA 2W79A 3NQEA 1NAL1 3HPZA 3THAA 4IPJA 2E09A 3B0PA 4JTIA 3TFXA 3LGEA 1C9DA 2V2CA 3JR2A 3LBMA 3LHUA 1LDCA 3DI0A 3QSTA 1KM1A 2YCEA 2WNNA 3PC0A 3TJXA 5CPOA 3G0SA 1FUYA 5AHIA 4DO4A 1DQWA 1XUUA 3H54A 2VC6A 1KTBA 4P2VA 4JX5A 4NJHA 4CCDA 5TBOA 4LW7A 4IWWA 6ALDA 4IJBA 3R8RA 5AC7A 2ZRZA 4JEQA 4A2SA 2ZZ7A 1JRCA 1SO6A 1OFAA 1G4SA 3HJZA 3QPZA 3L67A 3OVRA 4HHPA 1R46A 4JD4A 3A5FA 1RVGA 2FDSA 4O54A 3I7QA 3TQVA 3W7QA 1TREA 5K2ZA 3HGOA 2Z2UA 4DQWA 1UJPA 3TV8A 5J5RA 3LRMA 1AK5A 2Y88A 3C8FA 4JTFA 1EUNA 4BWLA 3O6DA 4O12A 2FPTA 4B5NA 3DHDA 3FEMA 3GX9A 3NQCA 2WSRA 3W7MA 1ZAJA 1S5VA 3TQKA 3G1DA 4MY1A 4G1KA 5LNUA 2DZXA 1W56A 3LI0A 4JX4A 5F2IA 1RV8A 5G2WA 3STCA 1LOQA 3W72A 5DELA 3W7IA 3ATYA 2A0NA 5U4NA 2C3ZA 3P62A 3SIZA 1TJRA 1GOXA 3EWWA 4H6KA 5BNKA 4O14A 3EKLA 1SZGA 3HIJA 3C6CA 4OE7A 3S5NA 1XI3A 3G0XA 1F5ZA 1LRTA 1OYCA 5K7JA 4Y6GA 1TRDA 2CZFA 2GPTA 1QPNA 1DQXA 2RKXA 3TFCA 1WX0A 2E1DA 2ZRYA 2DZVA 1ZJIA 2E68A 3QPYA 1OFPA 1Z42A 1MO0A 4O1AA 3LXBA 4X9SA 3WK1A 4RX0A 3PVFA 2Z0IA 2NUXA 4LVAA 3N9RA 1J4EA 5LNVA 5K4XA 2QUTA 3LXAA 4RK8A 1VRDA 5D02A 3W1PA 3TKFA 3B05A 4K8HA 4IUOA 1LBFA 1Y0EA 1U83A 1SSGA 4X22A 4HSOA 2QCGA 1G4PA 4K38A 2NX1A 1W5OA 3L0GA 4LRSA 4W9TA 3LCFA 1AW1A 4MUZA 2WKJA 4D2JA 4YCPA 3KHJA 4R7JA 4S2CA 3LV5A 4GJ1A 1GTHA 3BK0A 5F4WA 4HKPA 3H53A 3W1RA 3DGRA 2PRMA 3FFSA 4BR1A 4UMAA 2XN1A 2A4AA 4HNTA 4LNYA 4Y90A 1SO4A 4MY9A 1G7UA 3MHGA 3R5EA 4NNAA 4Z1AA 4HT3A 5HULA 4DPPA 1AW2A 3MBFA 1B4EA 2ISWA 1AW5A 3MI3A 3PF3A 2QKFA 1HTIA 4J9JA 1XDLA 5K4ZA 5K9DA 5D2TA 3NL5A 4MYAA 2YSWA 4Z1CA 1F05A 3F03K 4GC4A 5D2WA 2R8WA 2BTMA 3ABRA 3WJSA 1VJIA 1SQ7A 5FEPA 3W74A 3EB2A 2V5LA 2ZA1A 2R94A 4DEFA 1TIMA 2C1HA 5EY5A 2CLFA 4Q33A 1TTQA 1B4KA 1HG3A 2G97A 3SSJA 3N34A 4FNTA 2I1OA 2VKZG 1FX6A 2NV2A 3GB6A 2VOMA 4HIBA 3W1NA 5H2ZA 2B7QA 4UMCA 3GDTA 2ZZ3A 1BWKA 1RQHA 3C2VA 4K6AA 3O05A 1ALDA 3NL3A 2CLKA 2FQIA 4AB4A 3IIZA 5L9FA 1Q6OA 3NEVA 2BLEA 2NX3A 2Y61A 4UTTA 2EGZA 5IM51 5HUOA 7TIMA 2CLLA 1EWDA 4XWUA 2G96A 3LTSA 1QNVA 1XBYA 3S9YA 4JTHA 1TPEA 2YDAA 3KAOA 3GYEA 3W2JA 1O95A 5BMXA 3LCXA 2CZEA 1D3GA 4UFKA 2EHHA 4LTSA 1GWJA 1YTEA 5KTLA 3O6YX 2JK2A 2J9XA 1R2RA 3ZWTA 1GG0A 5FESA 4E2DA 3DU0A 3NG3A 4O0ZA 3ABSA 3A24A 3Q2DA 3ZS4A 3B0VC 4FIQA 1HUVA 4UTMA 5AHFA 1WOBA 3MP3A 1TPDA 2FFCA 1W31A 2ZA3A 3I68A 3VCRA 4LVDA 3HO8A 1YADA 4O17A 1H60A 2RFGA 3O6CA 5D33A 3S1UA 3DFNA 2ZZ6A 3G1SA 1T8XA 3MI2A 4MPQA 3NGJA 4UTWC 1EUAA 2AAMA 4UCGA 3TX9A 1H7XA 4UIOA 1LRNA 1GJPA 3G1XA 4LUIA 5CPLA 3B04A 1QWGA 3Q58A 2BSLA 4O1BA 2E5BA 5T26A 2V30A 3IIOA 3MBDA 4I7UA 4O0KA 2Y70A 2W0UA 3TSBA 1TTPA 1ICPA 4ONVA 1X7FA 1TPB1 1S5TA 5G1YA 5HR7A 2AQWA 1ZENA 2V5BA 2NZLA 1SZNA 3RLUA 2OZ0A 3G3MA 4OQVA 3IIXA 3NPWA 1W0MA 1TMHA 2QF7A 1TJPA 5TQLA 4NZFA 5DY2A 1W54A 4QM1A 1VH7A 3L0NA 1OFQA 1HO4A 2ABBA 3PBVA 3UWVA 4RZ6A 3M16A 2PE4A 3BV4A 3INPA 3TW7A 2QCNA 1VGAA 5CZTA 2ZZ4A 1AL7A 2QCDB 2LLEA 5CPNA 1K7XA 1IXOA 3P67A 3LHVA 4FX7A 1JR1A 5KMYA 4GRSA 1KBIA 1ZHAA 1WBHA 4KFOA 3EKZA 1C8VA 2F7FA 4UTUA 2FPVA 2QCLA 1TV8A 2QUUA 1PHWA 1MXSA 3M44A 4MYXA 4YCOA 4Z0JA 1G7VA 4CNPA 2YFNA 5AN7A 1S3HA 1W3IA 2QCCA 1KM0A 4M7SA 5LHEA 3GR7A 1L9WA 1LYXA 4PL2A 3TAOA 1W5QA 3G22A 3IVTA 3NA8A 2J27A 2VFHA 3M41A 4N6FA 3G18A 5K9CA 1SZEA 4GBUA 2AGKA 1LORA 4ZQMA 4LC6A 1J5TA 1N7KA 1FCVA 3HB9A 3QMRA 1JCLA 2CU0A 1A53A 2ZA2A 3HG5A 4DXVA 4JYEA 1KFKA 2J9YA 2JBMA 3W83A 4DF2A 1EX5A 3S1XA 3PG8A 3DENA 4MJMA 2Q3RA 1DJQA 4BI7A 3WJYA 4UTLA 4O15A 1TPC1 1KTNA 4NJJA 3P5ZA 1EPXA 1VHCA 4YWIA 2A1YA 4IMFA 3MP4A 3HG3A 4AF0B 4FIRA 1QPQA 3K30A 4ORIA 3DFPA 3QFEA 1L6YA 3M6YA 3NO5A 4I9AA 1LLWA 1H50A 4BWLC 2QAFA 3T7VA 4GUHA 3M43A 1SW3A 1CW2A 5HNRA 2GQ8A 4DO5A 2EF9A 1LBMA 3H55A 1QOQA 3UWZA 3KVKA 4N2YA 1XBZA 1H1ZA 4OWGA 3NQ8A 4FNPA 2CLEA 4LOCA 3KRZA 1KBJA 3N14A 3SGZA 2CZ5A 2J9ZA 1H62A 3S1VA 1IIGA 4MIMA 1W8SA 5FF3A 4HPJA 3PUDA 3EWZA 1K7FA 5HQEA 2HMCA 3IRDA 4GUGA 1EWEA 3TNOA 2Y62A 4PA8A 3DKJA 3CPRA 1GZGA 3LRKA 4AXKA 4JY9A 3P5YA 4DO6A 2CLIA 1H7PA 4CLMA 4PEKA 4PFMA 4IX2A 3NPVA 2YGYA 1GTEA 3W7LA 3MJYA 1FQ0A 1WDWA 5G1TA 4HN4A 2E5CA 4EVZA 1AG1O 3NPXA 1WAUA 3HG2A 4AWSA 1DBTA 3O07A 5CZ0A 2EPHA 3M5VA 4UNLA 3THQA 4FX6M 1HFBA 1VCGA 3VNDA 4UNKA 2WOQA 5I3JA 5KZEA 1GVQA 5F2LA 4ZL1A 4JIPA 2YFOA 3LOTA 4S1FA 4E2BA 4O16A 4O4WA 1Q6RA 2Y7GA 3A21A 4UFIA 3EX3A 3PY2A 3DKLA 1QPOA 3EEGA 1V7YA 4IMCA 3S5YA 3AO0A 1Z48A 1GVOA 4CCCA 1FXPA 1RQEA 3LXCA 3N2XA 1LZOA 2ALDA 3SFKA 1QAPA 1JQXA 2HSAA 4ZQCA 4CCEA 5D09A 3G1HA 4CNOA 2QR6A 3QC3A 8TIMA 3SZ8A 3LI1A 4O10A 1ME9A 1KFJA 3IIPA 4Q4KA 3OVQA 4NX0A 4A22A 3NPUA 3LCIA 1ZFJA 5FF4A 3F1QA 3M0ZA 2C14A 1NSJA 4JTJA 2C13A 3TW6A 5HWMA 4N4PA 3EXSA 3TUUA 1JVNA 1JCYA 3LHTA 4JTKA 1A50A 1YLVA 3DH7A 5E1QA 1I2RA 5AB3A 3CEPA 1IIHA 1TQXA 3G1FA 2ZTJA 1ZCOA 2C0AA 4R53A 5AYXA 1LOSA 1QR7A 3N9SA 4O57A 4FO4A 3UZJA 4O50A 3O16A 3WK2A 2WSYA 1UUMA 5AHEA 4IXXA 1IF2A 3ZFHA 2DJLA 1GVRA 3L5MA 1PCWA 1TO3A 1BTMA 5HJLA 3HGRA 4FXSA 3L68A 5IBXA 2YX0A 1GQNA 1VR6A 2Y7FA 5DBUA 3C56A 3YPIA 4ZZ9A 1EA0A 4M7TA 4POCA 5LGZA 5EYWA 3QSRA 1KV8A 3Q37A 3I7RA 1OYAA 5I3FA 3W70A 3UWWA 3GXNA 1NF7A 3F4NA 3O8AA 1H7OA 4PTNA 3B03A 2YPIA 2QCHA 4NUWA 2Z6IA 3S6DA 3T4CA 3C2EA 5BRBA 4IXHA 4HNUA 2V2HA 3L2IA 4CQAA 3IIVA 4EF9A 3NM3A 4QSHA 5L6UA 4K7VA 4TR9A 1FWTA 1OFEA 1ZNNA 5F2GA 1D3HA 3GDKA 1XXXA 3FJ6A 2E5DA 3DFTA 3QMSA 2VELA 4M6VA 2FPYA 3LLDA 1SPQA 5D03A 4MFDA 1I2OA 3DAQA 4MZYA 1A5BA 1QO2A 5EKYA 2PC4A 1ZAHA 1QO5A 4LU0A 3RLVA 2XN2A 2HS6A 1Z44A 4ZQPA 1W37A 2FJKA 3FYPA 4WUIA 1QCWA 3A23A 3NVTA 1T99A 1VHNA 2A7NA 3LHZA 4Z0SA 4I7VA 1FWRA 4MLRA 3RK8A 4I7WA 1RQBA 1GYNA 4KWWA 3UXDA 4LUJA 2J24A 4AHOA 3I6RA 1C29A 1FCQA 2QUVA 2CZDA 5C6MA 4JTSA 2E6AA 4QIUA 1KLYA 5LNRA 4PC8A 4LT9A 4DELA 2X1TA 4UTWA 1ME8A 3KXQA 1EIXA 3FA5A 1VCFA 2FIQA 2X1SA 3NM1A 5D32A 3QQ0A 4XTDA 2DZWA 4DPQA 2GQ9A 2P0OA 4EOUA 3HMJG 4FB7A 3BLEA 4JGDA 4NXKA 1FCUA 1TPVA 3MUXA 2FB3A 1YXCA 4H4IA 2BXVA 2A6LA 3CU2A 3GZ3A 3FYOA 1LP6A 1H7WA 3AJXA 3KFTA 3LERA 2WJZA 5FI8A 5HMSA 3TCEA 1OF6A 3OEXA 3KOFA 1BEUA 3NQVA 1R30A 4NQ1A 4NJGA 3W7GA 1G67A 5F2MA 4C1LA 3W22A 2Y7EA 3N3MA 4LVGA 3L9CA 1ICSA 1TRIA 4MVAA 1FWNA 2QDHA 2VEPA 4HPXA 1PCKA 4NJKA 4AWTA 4C1KA 3EX1A 1K3UA 3NQ7A 1G4EA 3UPWA 3W87A 3LV6A 3MMTA 3MYOA 3GKFA 3MO7A 3OHIA 4RR4A 3DI1A 4XBKA 1OYBA 4HSNA 2H8ZA 3CTLA 2HS8A 1XKYA 3R2GA 1TCDA 2ABAA 2GUUA 3HQ1A 4RCXA 4FF7A 3BW3A 1UCWA 3L21A 3BARA 2V81A 2YXGA 4RXFA 4O8RA 3O1NA 2VENA 4L4LA 2PRLA 3CEUA 4O4VA 3RNDA 4JICA 2ZZ2A 1GG1A 2RHGA 3EXRA 4R33A 3T55A 3UXAA 1JUEA 5LNSA 5D05A 1G4TA 2RDWA 2QJIA 1OX4B 3LB0A 3C3NA 1N55A 1FWWA 5KZMA 3W6YA 1ADOA 2QEZA 1GVSA 4O11A 5I3IA 2OT0A 3JS3A 3W86A 3WFAA 3EWUA 4UR7A 5DXYA 3GDMA 4LVBA 4BK9A 2Q3OA 3IEBA 3S5OA 3DXIA 3ABOA 3WK0A 1F7BA 2YYTA 3HBLA 1XL9A 5EMUA 3EX2A 3KX6A 4WY0B 2VFGA 3M5ZA 3PM6A 1DHPA 2WPBA 1MEWA 1YXYA 3W2KA 3TK7A 1P4CA 3DZ1A 3G1YA 3NZRA 3W7OA 3W1AA 3UYCA 2OX1A 4UUIA 3DFQA 2Y63A 4ZQNA 4PH6A 1XDMA 3FJLA 2QCDA 3CLMA 2VEIA 1JJKA 3G1VA 4GXMA 4XKYB 1KM5A 2WV8A 2HTMA 3NXFA 3IVUA 3P84A 1YPIA 4IOTA 2ZZ1A 3G8RA 2UV8G 2EAWA 2Y7DA 2WSQA 2R91A 1V5XA 3UZ5A 4XTIA 4YXGA 1IGSA 3HGJA 1JCNA 2CLHA 3A5VA 3B0UX 2NWRA 5H91A 3L5LA 1T0OA 1F73A 3W7KA 1F2JA 2FB2A 3W3OA 4LRTA 3HOJA 3WJXA 2R14A 3LHWA 3PB2A 2ZFAA 5A5WA 2C6QA 2QCMA 3B8DA 4UXDA 4JX6A 3T40A 2H8XA 4OBTA 1EEPA 2NUWA 3BG5A 4JTEA 4UFHA 4NXSA 4QITA 1H63A 4JY8A 4IMDA 1AL8A 1JRBA 3STEA 1P5BA 2C15A 3LLFA 2DZUA 1F6PA 3HPXA 2NLIA 3T78A 1B9BA 3W07A 3GDLA 3TAKA 2EKCA 3CIWA 3QJAA 4TO8A 5HR6A 2H6RA 3SJ3A 4LVFA 2Z1BA 1H1YA 1G69A 3TSDA 1PS9A 1H51A 4N9EA 1F6KA 2ZZ5A 1D9EA 4LV4A 3TU9A 1PVNA 3UD6A 2G5WA 3BG3A 4XQ6A 4AH7A 5EPDA 3A22A 1G6CA 3QEZA 2ATSA 3SI9A 2YW3A 4FXRA 5HWNA 5E0KA 1I2QA 3P74A 3NDOA 3TC6A 1TPFA 4N9BA 1SFLA 3DFOA 1EP1A 5AC8A 1P0KA 2D73A 4AMAA 3C0JA 3SW6A 2NXHA 4O1CA 3OG3A 5AHNA 1H61A 2B4GA 5G5IA 4Y9AA 4QNEA 3LM7A 5DN1A 3MHFA 4JYDA 3EX4A 2BWGA 4Q32A 5D37A 4LC8A 1EP3A 3PBWA 4WZHA 2OJPA 3TA6A 5AYYA 4RXGA 1ME7A 3GR8A 3TE9A 3HF3A 4XKYA 1L6WA 1E51A 3VE7A 4FNSA 4WXYA 1KM3A 4IQLA 3V1PA 1Q6LA 2YZRA 4K8EA 2XN0A 4KKXA 4AHQA 4GUJA 3NR0A 5KSWA 4O52A 5BOOA 1FWSA 4QQ3A 4K7YA 2ZRXA 1K8YA 3W7CA 4ZQRA 4DBEA 2Q8ZA 1O5KA 3EWBX 1GYLA 4QAIA 5G2HA 4PODA 1UBSA 2WO5A 1YPFA 2VFIA 3SR7A 5IBXC 3OIXA 3NQ6A 2NWSA 3RMJA 2B7NA 2ZYFA 2Q8LA 3GLCA 3W1MA 4RV8A 2TPSA 4A21A 1H7RA 3B4UA 1W3TA 1M6JA 3QM3A 5DCDA 3W1UA 1YTKA 2DZSA 3L0KA 4Y96A 2NUYA 1B3OA 3PAJA 3KRUA 1KFLA 4JDBA 1SFJA 5DY3A 2NXIA 3G3DA 3EXTA 2W6RA 5K3VA 5KITA 2NV1A 1X6UA 1GT8A 1KV5A 3W7DA 5HINA 4JS3A 4LWWA 5G2IA 4UTHA 1LCOA 3NQMA 1VYRA 3JRKA 1HL2A 3LHYA 3P8JA 3S5ZA 1L6SA 4AEOA 5LGXA 3G8EA 3SECA 3W7EA 3GNNA 2X16A 5FF2A 2TRSA 2ISSA 1PV8A 2GJNA 3NL2A 3PUOA 1DJNA 3CWNA 1Q6QA 1A5AA 3ABQA 3UPBA 2JKAA 5D2XA 3IV3A 4A2RA 1F74A 4OHQA 3GXTA 3UWYA 3NL6A 1EB3A 3W75A 1R2SA 2C19A 1GPWA 1LBLA 5C54A 3LTPA 2GOUA 3M5YA 1EP2A 2PRHA 3MHUA 1YDVA 5LZLA 3OVPA 1JCMP 5CZJA 3RF9A 1H7NA 3FS2A 4WY0F 1WOAA 2G95A 1OF8A 1GEQA 1SZFA 1WBJA 1KM4A 3P60A 4AHPA 1KM6A 2A6NA 2XFWA 2X30A 4JTGA 5A8GA 1TTIA 3PUEA 3UNDA 2GVGA 4NX5A 4XZ9A 5D38A 3BLFA 3W1LA 1IXPA 5AHLA 2VFEA 3FOKA 3TSMA 3S1WA 3MI6A 1FDJA 4OV9A 4ADTA 3ATZA 3FKRA 1U5JA 1J2WA 1W1ZA 1O60A 3R89A 3L65A 1I45A 2VEKA 3KVJA 3UQNA 1Q45A 5EA9A 3WJWA 3W71A 2ATMA 2KZHA 1VYPX 3QRHA 4MKNA 3C2FA 1CX9A 4O53A 2WNZA 2C18A 3OA3A 1YTDA 3LX9A 4A3UA 4JYFA 1SO5A 2CLMA 4GUFA 3S42A 1OX6A 4MLJA 4WY0A 5FF7A 3PWAA 3BGJA 3IGSA 5AYZA 3WJZA 3NNTA 2X2GA 2ZRUA 1FY6A 3CM4A 4X3ZA 4DBDA 1ML1A 2DZTA 1KA9F 2F84A 2BZNA 4WOQA 4RJEA 5F4XA 1DKWA 3F4WA 5F1UA 5LSMA 5CSSA 3T44A 1WA3A 3W76A 1WV2A 4GFSA 3DFSA 4OGZA 3G0UA 4ICNA 4KFNA 3TMQA 1OABA 5I3GA 1YXDA 2QAPA 2QCFA 2GVJA 3R12A 3NAVA 1KFBA 4ZVJA 4O28A 3VI2A 1YDOA 3MW7A 2J88A 3NYZA 5CG7A 3SGUA 3TC7A 2DORA 2ISVA 1PIIA 2JGYA 4OV4A 3GKAA 1JQVA 2BX7A 2H3DA 2A21A 2CLOA 5J5DA 3KVMA 2TYSA 3PSWA 2NX9A 1XBXA 3G1AA 2J6XA 3P81A 2O7SA 1SUXA 1TV7A 4Z1BA 3KVLA 1W3NA 4N9CA 4AF0A 4TIMA 4X2RA 3TROA 4BF9A 3L5AA 1X1ZA 4ADSA 1M7PA 2P10A 4OT7A 4RZ5A 4GWEA 4JDYA 4WXZA 3L66A 5HUPA 5U7SA 5I3KA 3E49A 2QCEA 3G24A 3CHVA 3C2OA 4BI5A 1JUBA 1OFDA 2PURA 1VQTA 5SWUA 5EL1A 3BVJA 3STGA 1I2PA 1OVDA 1QOPA 5E93A 3SY5A 4O18A 2H90A 4UTTC 2E77A 3NQAA 2I14A 5G4WA 4CQ8A 1TSIA 2DU2A 3A9IA 3ANYA 2FTPA 4ZMGA 3S0CA 1K7EA 1FDZA 4NVTA 2GQAA 1JULA 4EF8A 4YLWA 4ALDA 1SU5A 4DF1A 3C52A 2JKEA 4WX2A 1K8ZA 4RLIA 4AVFA 4LS1A 4GE8A 1OFOA 3V75A 3W7HA 4E0CA 4ORMA 3FIGA 4M6QA 4ADUA 1R2TA 2YYUA 3LBCA 4UTIA 3W1QA 5CPMA 3P80A 1MEHA 4KFPA 3QF0A 2A5HA 4QNWA 1FCBA 5CGQA 4YMZA 4EIVA 5CZSA 4OU1A 5BW6A 1I8JA 4NJIA 2A85A 4IPIA 5BMWA 5F1VA 1XM3A 3W1TA 3W7RA 1UASA 3D0CA 1WQ5A 3TQ0A 1MEIA 3OBKA 2VFFA 3C61A 2GJLA 1A5SA 3IVSA 4QISA 2TSYA 1R47A 1XFBA 2ZCGA 4FEZA 1RZMA 2B7PA 1FXQA 1TV5A 3LTYA 5KINA 1DVJA 1IXQA 3MWAA 3O15A 3NZ1A 3W2NA 1ZALA 4IX0A 4MOZA 5KZDA 1JCXA 4NT0A 2OMAA 1UB3A 4TMCA 4A29A 1RR2A 1KW1A 5LHFA 4Y8FA 4U4MA 1TYGA 3EWXA 3GAKA 1K03A 3BLIA 1XCFA 2V9DA 3R13A 1OG0A 4TU1A 5TIMA 1LOLA 4N02A 1KTCA 4FNUA 2YW4A 2ZBTA 1DL3A 1OK4A 4TMBA 4S2BA 3CIXA 5DCBA 3P82A 3HG4A 5LKYA 1HO1A 3RU6A 4GNJA 2RH9A 1QMLA 1THFD 3IGUA 2WQPA 3PB0A 4LY8A 5AOUA 2JKPA 1P1XA 1QFEA 4RZ4A 3TMLA 4MZ1A 1QDSA 4P61A 4WQ6A 3M7WA 2I9EA 3E02A 3USBA 3N73A 3PBUA 3TDFA 3I7SA 3M47A 1NEYA 1OFBA 4ML9A 3NQ2A 5C2XA 2DZPA 1TPUA 3NQFA 2Y85A 1ZY9A 3NOEA 3W7NA 1SW0A 3E12A 4O1DA 1YYAA 3IGXA 1MZHA 3W2LA 3M1ZA 3QMTA 1VZWA 2JGQA 4IMGA 1KM2A 3W84A 2A7PA 5AFDA 4MJZA 2CFFA 3HPSA 3LDVA 3UWQA 4LS0A 4M5PA 1Q3NA 1LROA 3E96A 4U28A 5DXXA 4Z1DA 1M5WA 1N8FA 2V2DA 3LCHA 4FNRA 4KWVA 1WXJA 4MFEA 1OK6A 3ELFA 1I4NA 4BFAA 1F76A 3C2RA 2WNQA 4DF0A 3KRSA 2P1FA 4UC5A 4UTKA 1XBVA 5EBUA 3MYPA 3O63A 5D2VA 1H5YA 3TJLA 3TIMA 4HNVA 1MSSA 2CW6A 5ABTA 5I3HA 1OFRA 4UFMA 2ZDRA 5F4SA 3QW4B 5MHBA 4HNNA 4UR8A 4LS2A 3O06A 4FHAA 2RDUA 4M19A 5AHMA 2OT1A 3RFAA 3QW3A 1YDNA 3UY8A 1OX5A 3VE9A 1ICQA 1SR9A 4R34A 4YL2A 1LLZA 3W1XA 5C55A 3P7YA 2O7QA 4K37A 4GUIA 3CWOX 1JUKA 2C16A 4IGHA 4N9DA 5FF0A 1T96A 4CNNA 2YR1A 3CC1A 3PSVA 3P61A 3TXVA 5HWJA 1VCVA 1RPXA 2V82A 2OCZA 5G4EA 3HGSA 4AAJA 3GNDA 1AMKA 4UFLA 3W9ZA 1UUOA 2A2IA 5D2YA 3N19B 3LRLA 4FNQA 5FEXA 4O19A 4JTLA 5CSRA 3QZEA 4NNCA 1JCJA 1TPH1 4K39A 1VC4A 1FDYA 1X1OA 1O94A 4N4QA 5D30A 3M5XA 4MY8A 3MP5A 1CI1A 3GIYA 4AWUA 1M7OA 2B7OA 4JXCA 4WD0A 2VXNA 3STFA 4EWND 5GVJA 4ZQOA 1OX4A 1L2UA 4PL1A 2V0TA 3LCGA 1GVFA 3BO9A 3PBYA 5D04C 3QYQA 2ZTKA 2CWNA 3Q94A 1Z41A 2ZRWA 2RDTA 3EX6A 3CQ0A 2V8ZA 6TIMA 3I65A 4M6PA 1VPXA 2GVLA 2Y89A 3TR2A 4NZJA 3W88A 1P0NA 2VEMA 2E6FA 4L4MA 1B57A 2QDGA 1NFBA 4UMBA 1TB3A 4MZ8A 4Z08A 3U8GA 3W85A 3CT7A 5FEWA 3DHFA 5AC6A 1W5NA 3VFLA 1DV7A 1W5MA 3BW2A 5CKSA 3E9AA 5K9XA 2Y6ZA 1WYIA 3GVGA 3U2OA 3DBPA 3NQDA 3BGGA 1OJXA 1TQJA 3W23A 1I2NA 1XUZA 3B06A 3QH2A 2ZRVA 3BPWA 4K36A 1KLZA 1NF0A 1BKSA 1W5PA 5DLCA 1LM1A 1QPRA 1ONRA 3S8HA 3NQGA 3GK0A 4JN6A 3PULA 4IMEA 2X1RA 3W7PA 2TMDA 1S5WA 3GXPA 5FEZA 4JNMA 3UWUA 4CQ9A 1VS1A 5LNWA 1PL9A 1DOSA 1SSDA 4WOZA 3U6WA 1VYSX 3PS7A 3EWYA 3UY7A 4RKAA 4JR5A 1VLWA 1SW7A 2B0MA 1RD5A 3BW4A 1PE1A 1NVMA 3CB8A 3FLUA 4JIQA 4H3DA 2NXGA 2A7RA 3ZR4A 3ZWSA 1DORA 1PHQA 5DBTA 2DJXA 1O4UA 4QJ1A 1O5XA 3W2UA
chains in the Genus database with same CATH superfamily
4FX8A 1ECQA 1S1PA 4BI6A 2X1UA 3LCLA 4PCFA 3E0WA 1OT2A 2E6YA 1JYWA 1PYFA 3GDRA 1ADDA 4R3UA 2EG8A 4XUGA 1LTDA 1SO3A 5EB8A 1IXNA 3QN3A 4GYKA 4QG9A 4AD5A 2UZ9A 3ZJKA 2CITA 3B9DA 3VOIA 4PUNA 4Z2JA 3VABA 4J3SA 5C0QA 4ATLA 3HN3A 3C0LA 1A0CA 3MCNA 2FLIA 2ZQ0A 1CXIA 2D0HA 2X40A 3SRDA 2Z6JA 2NT0A 4NZ1A 3ITOA 2PCQA 2PPGA 4LV9A 3PZQA 4O13A 2QUMA 3SUUA 1BWLA 4DRSA 1XC4A 3QQ1A 3ONBA 3TH6A 2VFDA 2W79A 3HPZA 3B0PA 4JTIA 5DFAA 3TFXA 4XO7A 2WKGA 1KM1A 4OUEA 2J66A 4H9UA 1VPYA 3B40A 3EOOA 1FWJC 2PDXA 3CUJA 5HNTA 1W1TA 3WEZA 5AHIA 2QGYA 3H54A 4GFIA 4P7RA 4FOUA 4P2VA 4WKFA 4NJHA 4LW7A 4P8UA 4J2PA 4J3TA 1JRCA 4TQTA 1JDDA 1UZDA 2QUNA 3QPZA 4HHPA 1R46A 4JFTA 1VFFA 1J18A 1GOIA 1IE7C 4F2BA 4RDZA 1AMYA 3ZJ6A 1QI0A 7ODCA 5HAOA 2Y88A 1XF0A 4ZB0A 4GO8A 2ZDSA 2CEQA 2FPTA 4S3BA 4B5NA 3KOXA 2WMIA 1XINA 3DHDA 3SGGA 1S5VA 3G1DA 4MY1A 4MWAE 1A5KC 1S39A 1W56A 3LI0A 1WXYA 4KF1A 3STCA 4QLKA 2GWNA 3V16A 5DO8A 5XIMA 3ATYA 2A0NA 1CECA 3SIZA 4BJHA 1TJRA 1OD8A 2QDEA 3RMEA 2F8QA 4Q7IA 1EGMA 3TLQA 2OEJA 3FSUA 5T9BG 3S5NA 1OYCA 3WQ4A 5D8WA 4Y6GA 1UIPA 1WX0A 2E1DA 2XVGA 4MJ4A 4LBUA 3QPYA 3H26A 2D2JA 3EPMA 4WKAA 3WK1A 1XLGA 3VO0A 5H8UA 1JZ5A 3IANA 4RK8A 5D02A 1FH7A 2PDLA 2Z4GA 3EYPA 1K9EA 3DGBA 3KOWA 1SSGA 3RLHA 3GH4A 3AYVA 4TX8A 5BXRA 1FOBA 3R8GA 4GINA 3K1DA 2OQYA 4LRSA 1AW1A 4YCPA 1UC4A 1XR2A 3LV5A 4GJ1A 1GTHA 2OKOA 3BK0A 5F4WA 2VOTA 1OB0A 5D9PA 1SFTA 5CEWA 3DGRA 5FSDC 5LA0A 3TN5A 4BR1A 2XN1A 2XVLA 3PFRA 1EJWC 1XYZA 4MY9A 1IT7A 1QPKA 2PF8A 1NOFA 3L23A 4HOZA 2OOFA 4HT3A 5HULA 5EFFA 4RE0A 1B4EA 1AW5A 3OA5A 4LAOA 3VNKA 1A0EA 4ZTXA 3TCSA 2QJJA 4UOZA 4AVNA 4Z1CA 1F05A 2RUSA 2R8WA 3ABRA 3FNDA 3WJSA 5FEPA 3W74A 3EB2A 3QY6A 1XGZA 1AQFA 2C1HA 2WVSA 4M6UA 1TTQA 1HG3A 2G97A 2ONEA 1V6VA 3SSJA 4PCSA 1Q8AA 2I1OA 4GCAA 1FX6A 5G4HC 3SFWA 4DJFD 5H2ZA 2B7QA 3KCOA 4UMCA 4JQ2A 4HCLA 1RQHA 3C2VA 2JF6A 4D6GA 3O05A 3RXZA 4FLQA 1NARA 4XZBA 2EGZA 1A5OC 1J79A 1OG6A 4YTSA 7TIMA 4XWUA 4US6A 2YDAA 2YXOA 3QOKA 3ARTA 1D3GA 4S38A 1QNPA 4LTSA 1B3WA 1YTEA 2UWFA 2R9RA 3CZ8A 2HZGA 3CZLA 5KTLA 1S2UA 3O6YX 5D9OA 3KZPA 2A3BA 3SIMA 3BL3A 3P2VA 3M0XA 1Z32X 3RR1A 4O0ZA 2PTYA 1QUMA 3A24A 1NJJA 1E0XA 3B0VC 4UTMA 4ZR8A 3MP3A 5F7UA 3SRFA 2YDQA 3I68A 3N1AA 1YADA 3MB9A 1B5TA 4PUMA 2RFGA 3WQPA 4RZBA 1XYFA 2BY2A 2BY3A 1AFSA 1T8XA 3BSHA 4DJDC 4CD8A 3NGJA 4FSAA 4UTWC 1LRNA 1GJPA 3G1XA 4LUIA 5CPLA 3B04A 5A6BA 1QWGA 3Q58A 3MBDA 2BG5A 2W3ZA 2PDUA 3T2QA 2IPFA 4ONVA 1MQPA 2YA2A 4CN4A 3Q67A 5CQ1A 3ZIZA 3WQWA 4MNMA 4UQCA 1ZENA 3VAVA 4FMVA 3KLLA 4OQVA 1W0MA 2W62A 3T0CA 2GSEA 1TJPA 5DY2A 1OFQA 4AG0A 4Q7NA 2ABBA 3UWVA 5FIPA 3M16A 1Z9AA 3AHZA 3BQ5A 2PDFA 5LIWX 4FXJA 4TTGA 2FZMA 3LBOA 2LLEA 1Q6FA 1UR8A 3WNMA 1AVAA 3LUTA 1IXOA 1E4MM 4KIEA 2PDKA 1AA1B 1KBIA 1ZHAA 2OVLA 4YPJA 1C8VA 5JU6A 4RW5A 2F7FA 2ZUTA 3QLDA 3WX7A 4UTUA 2V63A 1C93A 2A3LA 1TV8A 3M44A 1QXLA 2XM2A 1KGUA 3BLPX 4YCOA 8CGTA 2WLYA 3DDMA 3B3DA 2DSUA 1T5AA 2D24A 5CXPA 1WB0A 3AOFA 1L9WA 4PL2A 3ZOAA 1W5QA 2WPGA 3G22A 3NTYA 3IVTA 3NA8A 2J27A 2VFHA 3L4UA 2FDMA 4TV6A 3ALFA 1LORA 4ZQMA 4WSKA 4KBXA 3HB9A 2GGIA 2ZA2A 3CZGA 3RX3A 3DHUA 3K4AA 1TELA 4XUYA 3BE7A 2VZVA 4KS0A 2Y5SA 1KFKA 2PDBA 2J9YA 3DENA 1YNYA 1XD1A 3TONA 1DJQA 4BI7A 3WJYA 3AIWA 4UTLA 3VDBA 4GI9A 2IXVA 2FFIA 1KTNA 4HHMA 4E2VA 1VHCA 3JU2A 1FWIC 1BWVA 3HG3A 2R1MA 1XIBA 4AF0B 1QPQA 4CD5A 1VB9A 3DFPA 1L6YA 2BGNE 1H50A 3LYEA 3GR4A 3V18A 4PYSA 3WLNA 4J28A 3PZTA 4L4PA 1WZMA 2GQ8A 9RUBA 3KBSA 3QZAA 3UWZA 3ZSTA 1IEXA 4E2OA 3NWRA 1KBJA 3VYLA 3IJDA 3SGZA 4X61A 1H62A 3S1VA 1H41A 1W8SA 5FF3A 4GIRA 5HQEA 3B0XA 4GUGA 1YKWA 2SFPA 3CPRA 3LENA 1XW8A 1NP0A 4JY9A 4DO6A 4S3KA 1M53A 4NKCA 4M1RA 3WH5A 4JFVA 1VFHA 3T0TA 1RK5A 4AFYA 1XIMA 2JFEX 1FQ0A 5G1TA 4U2YA 2XSAA 4XAFA 4Y9MA 3NPXA 1WAUA 1XLIA 3PAOA 3WQ5A 3VIPA 1S2WA 4IIHA 2CC0A 2EPHA 3WNOA 3PZVA 1HFBA 3VNDA 3T81A 5F2LA 3T0DA 2OU4A 2QIIA 3HTWA 2DH2A 6REQA 3LOTA 4E2BA 4O16A 3MANA 1Q6RA 4OOUA 3I3DA 3TWAA 4MDOA 4PMUA 3OVGA 3QGKC 3SCOA 1EEXA 1Q2RA 3DKLA 3EEGA 1V7YA 4BKNA 3H21A 3DC0A 3AO0A 1Z48A 4CCCA 3V5CA 4UQAA 3LXCA 3N2XA 1LZOA 3UG5A 3SFKA 4C6QA 4DN1A 2DPEA 2PTWA 4HA4A 4IF2A 3TTEA 2EPLX 1UZ4A 3GG8A 1EGZA 1EDTA 4KRTA 1KFJA 1MW3A 2E67A 4NX0A 2FZDA 3NPUA 1ZFJA 4HGXA 5FF4A 3F1QA 1NSJA 4JTJA 2PLMA 1GVYA 3TW6A 4DWSA 2FZ8A 4N4PA 2I17A 4Q6XA 3KBVA 4YTRA 2ON3A 1JG9A 2XIBA 3LHTA 3HFTA 5E1QA 5AB3A 1JCTA 3GH7A 3G1FA 3GW0A 4H9XA 5AYIA 1XC6A 3GG7A 4KIRA 2C0AA 3L2MA 4NF7A 1XS2A 1KKRA 4CEUC 4NZ5A 1UUMA 5AHEA 4JTDA 4A8IA 3ZFHA 1UWQA 3N4AA 1W9VA 3KWSA 1EXBA 2Z27A 4UOQA 4RDVA 3L68A 5IBXA 1GQNA 2PWDA 1RH9A 3C56A 4ZZ9A 3FY1A 4JKLA 1A5NC 2UY3A 3IACA 5LYRA 4F9JA 1IR1A 1KWKA 3I3EA 3O8AA 4GKLA 3WQOA 2GQ3A 2WQDA 2YPIA 2QCHA 3AXMA 2O9PA 4N0RA 3S6DA 2XFYA 3RM9A 3VPLA 2YOCA 5BRBA 2HE5A 2NVCA 3RPDA 3FEQA 4CQAA 1DIKA 4HP5A 3NM3A 5AZ1A 1ZU8A 4JL2A 4H04A 1ZNNA 5F2GA 3GDKA 2DSZA 3BJTA 3FVMA 4AZHA 1XXXA 3OZYA 3PK7A 2VC9A 1BGGA 5A94A 2X42A 2Z26A 3MKVA 2VELA 5I09A 4JAWA 1SPQA 1V3KA 4F2UA 3AHTA 1I2OA 1HJQA 4MZYA 5EKYA 2VQTA 1JAEA 4Z2KA 3THCA 1QI5A 1QO5A 5CBJA 3CUHA 3CMJA 4ZQPA 1W37A 4Q22A 1S2VA 4WUIA 4KCTA 4UR9A 1E43A 1VHNA 5D9NA 3LHZA 5IDZA 4HNOA 1GYNA 3M0VA 4DAIA 1ZGDA 4FP1A 1BSIA 1F3TA 4GACA 4URIA 3TVAA 2VZUA 1HGYA 4QIUA 1KLYA 4PC8A 2EPKX 4WGXA 2X1TA 4CQDA 4DJDA 2ZX6A 1ME8A 3LK6A 1EIXA 4C7GA 1Q2SA 2AMGA 3Q4DA 5D32A 4XTDA 2GQ9A 5BU6A 4DXXA 5DRIA 3NFUA 5AZ0A 1FCUA 1TPVA 3MUXA 2FB3A 3K4WA 4H4IA 1TX2A 1KCKA 4ATDA 2A6LA 3GZ3A 1LP6A 4V28A 3OZPA 1PKYA 5HMSA 2WJZA 4AMCA 3KOFA 1BEUA 3NQVA 1R30A 3S46A 1QATA 1JPMA 1G67A 4Q8NA 2XGIA 1WKDA 4GQBA 1PCKA 1US2A 2OSYA 1CPUA 1K3UA 2D2GA 5CAKA 3W87A 3LV6A 3MMTA 3SJNA 3MO7A 4YS1A 2Y1HA 3QTPA 3DI1A 4MG4A 3VUSA 1QBBA 1UG6A 3WUEA 3UT0A 1UD5A 3R2GA 1TCDA 2GUUA 1OGSA 4FF7A 1UH4A 3UG8A 4PR4A 1NQKA 1AQHA 2V81A 2YXGA 4XAZA 3O1NA 2PRLA 4KGLA 3TNBA 3CEUA 3M0KA 4JICA 2TAAA 1E6NA 3EXRA 3CQKA 1JUEA 5LNSA 1W6TA 2RDWA 3KEHA 1OX4B 1V7AA 3N18A 4F0RA 2Q8XA 4GVIA 2E3ZA 1GJUA 2OT0A 3JS3A 4UR7A 2GJRA 1E9YB 3ABOA 4RNJA 2V5CA 4BA0A 3E2QA 4ZXLA 2VFGA 4ACZA 2WPBA 4QE1A 3VIJA 2BXZA 3N3TA 1Q63A 3DFQA 2Y63A 1XDMA 3AROA 3FJLA 2QCDA 5BYWA 4HZMA 3G1VA 1XIDA 4XKYB 3WUBA 2Z2AA 3KTXA 1YPIA 2PODA 3PPHA 4AIEA 4IOTA 3G8RA 2EAWA 1VD6A 2VVSA 5AC5A 1NM9A 4JTCA 3MKKA 3UZ5A 4C6JA 2PMQA 2CLHA 3CTTA 3B0UX 3CHEA 2NWRA 4GHRA 4F66A 3L5LA 1T0OA 1F73A 2HPIA 2WVTA 3NDZA 1F2JA 4LRTA 5D8ZA 3WJXA 2R14A 3F2BA 1UWIA 2HEJA 1PAMA 2C6QA 1O66A 3CQIA 2VX5A 3B97A 1UH3A 2VR2A 4LANA 4JX6A 3T40A 3UETA 1EEPA 2G0WA 2OB3A 1I1XA 1IWPA 3GHTA 4JTEA 4F0SA 4QITA 3QHNA 4K1WA 4Q8TA 1AL8A 3WFZA 1JRBA 3EOSA 5HMFA 1F6PA 1RP8A 3V5OA 1MQRA 4D6CA 3EDFA 1RUSA 4TO8A 5LA2A 2VJXA 2BHYA 3WBXA 4N9EA 3TQPA 4MNJA 4LV4A 3TU9A 4QJ4B 1PVNA 5FOOA 2E9BA 2G5WA 2IQDA 5BOFA 5EPDA 1G6CA 2RJHA 5HWNA 1I2QA 3WLIA 1EF2A 3DFOA 1DE5A 1EP1A 2JIWA 1FWBC 4NL1A 2D73A 4GIAA 3RM8A 2VGFA 3C0JA 2O55A 3HPFA 3OG3A 1BG9A 2B4GA 4LCQA 3W81A 3KL5A 1JI2A 3EX4A 2BWGA 2IQ0A 4Q32A 1MFVA 5I02A 4Q3MA 3TYDA 1XH2A 4LC8A 1E72M 5CSUA 1S2TA 3KLKA 1HJWA 3PBWA 3KDOA 2OJPA 5AYYA 3WY1A 3GR8A 1R87A 2EEXA 3FK4A 1VF8A 4GABA 2C91A 3OLEA 1J2BA 3FGCA 3W25A 4DO7A 1KM3A 4IQLA 3WENA 3V1PA 2J47A 2YZRA 3RRAA 3AHXA 4KKXA 1E56A 5BOEA 4GUJA 1E1CA 1XCWA 3UWEA 1EZ2A 5BOOA 3NDYA 3UXIA 1K8YA 1OM0A 3GZAA 2Q8ZA 1GYLA 4QCEA 4WR3A 4JQ1A 1UBSA 1YPFA 2VFIA 3AXXA 1W17A 5A6TC 5IBXC 3H7RA 1YMYA 2B7NA 4JEJA 5A6KA 4OOZA 2NQZA 1ECEA 4AZCB 2FVKA 1B3OA 3EB3A 3SO7A 4OKDA 1KFLA 3AIRA 3SN1A 1OWQA 5JH2A 4L80A 2VVNA 2NXIA 3AU2A 5HJXA 1WDQA 3EXTA 2W6RA 2NV1A 3RITA 2FGLA 1G01A 4KESA 5H6HA 5HINA 3MUZ1 3FDGA 1ZUAX 3WN6A 3SDOA 2X0SA 4P8XA 1VYRA 1E3XA 4LYRA 4WGHA 3G8EA 2W67A 3FAWA 4GYPA 3SBFA 2ISSA 1E3ZA 1PV8A 7XIMA 3EDDA 3UPBA 5D2XA 4OHQA 3LPOA 3KP0A 1DWJM 1R2SA 1LBLA 3LTPA 4ERIA 3N15A 4E8DA 1CLXA 1JZ2A 1JCMP 1Q6CA 1VIWA 1H7NA 1MUWA 4WY0F 5TAOA 2ZUSA 2G95A 1CGUA 3U48A 1E6SM 1WBJA 1KM4A 3VIIA 1HNYA 3WNNA 2XH7A 5E6ZA 4YTTA 2XDFA 3MDUA 4JTRA 3C2YA 1ODZA 4BEUA 1K9DA 4LJ3A 3ZLHA 1FDJA 1XGDA 3T08A 3MSDA 5I7GA 4GI4A 1J2WA 4K8GA 4AW7A 1XLHA 1TV2A 4JFUA 3V0SA 1KWGA 2ZX5A 5CZKA 3H8AA 2KZHA 1QHPA 1CX9A 4C6IA 2V3EA 4O53A 2WNZA 2C18A 1GNXA 4RE2A 3OA3A 1DTUA 3OZMA 1CEOA 4A3UA 4Z2IA 1SO5A 4GUFA 3NYDA 3AZSA 5H8PA 3PPFA 3IGSA 2J79A 2X2GA 2C0HA 3I3BA 3E1F1 1IT0A 1DIDA 3VGDA 2BZNA 1JL8A 3MMWA 3UFYA 1DKWA 3F4WA 5LSMA 4H19A 1N8IA 4DZIA 4AIUA 4H9YA 4UNIA 2GZXA 4GGHA 4GQGA 1HVXA 2RGMA 4KFNA 3GHUA 4ZODA 1QWKA 1OABA 5I3GA 3VXGA 2BY1A 2EPOA 4WRHA 3LZ5A 3R12A 4O28A 2Z1WA 3VI2A 3NZGA 1LWHA 4YNGA 4GH1A 3NYZA 3SGUA 4L64A 3NOYA 1TJ2A 2DORA 2ISVA 1PIIA 1ZBKA 2BX7A 3WL1A 4X2PA 1K9FA 1ISZA 1TWWA 4ZB2A 3W26A 5J5DA 2TYSA 1PSCA 5FCZA 3CV6A 3PSWA 2J6XA 4QE5A 1ZJBA 2O7SA 2Y5EA 1V77A 3PTMA 4TIMA 3ZQ9A 1QW7A 4X2RA 4AWEA 1XLMA 3CUZA 4ZE5A 4DYJA 4ADSA 5M3WA 1M7PA 3ZMRA 2OZ3A 2WM0A 4WXZA 3T09A 3L66A 1ONEA 4RNIA 1T8QA 3K4DA 2QCEA 1BVNP 1BQGA 4H2HA 3C2OA 3T4WA 3C3UA 5E0CA 1I2PA 3FW6A 3NEHA 1OVDA 1QOPA 5D9MA 3M6DA 2QPXA 7TAAA 2YJQA 1FKXA 2I14A 4DX3A 4EPDC 2FTPA 4AXNA 1V6UA 1FDZA 4NVTA 2VP8A 1KFWA 4DHGA 3GWQA 4YLWA 1ZZMA 3BOFA 2W5FA 2J7HA 4AZCA 4DF1A 3C52A 1Z3NA 1GOOA 1K8ZA 3A3HA 4RLIA 3VVGA 2WWCA 5FD0A 4R7WA 4GE8A 1OFOA 3HPAA 4ZCWA 5T9CE 1MFUA 3B8UA 4JIHA 1KXTA 4YYCA 4W84A 4DUXA 2QV4A 1JXKA 4KFPA 4QNWA 3F5JA 3RG6A 3DECA 3FDKA 4GLEA 3LMZA 3SAZA 1H1NA 1LL6A 2OPJA 3NO3A 4JTAA 4DLFA 1M1BA 1E1CB 1EOMA 4NJIA 4IPIA 3QZ6A 1XM3A 1B30A 4HA0A 4CQBA 4XSMA 1TCMA 3W7RA 1POJA 1UASA 3VNLA 1WQ5A 2GLKA 2BNJA 3TQ0A 1MEIA 3W24A 3OBKA 2VFFA 5A2CA 1UHVA 2TSYA 2DSVA 4ILSA 2ZCGA 4HD5A 1R8LA 2B7PA 1P0BA 5KINA 2QS8A 3D3FA 5C9RA 3N13A 4LGXA 2VUNA 3IAQA 4CN1A 1MXGA 4TMCA 4A29A 1ZB5A 1Z69A 4Z1YA 2CWXA 2E4TA 4E3TA 1TYGA 3EWXA 1K03A 3BLIA 2V9DA 2YBTA 3P93A 4LAMA 4D6IA 3TA9A 3BXWA 4J5NA 1YE6A 3UCQA 1BF2A 3Q45A 2PLCA 4S2BA 5DCBA 4HK7A 1UJQA 5LKYA 3RU6A 4GNJA 2RH9A 4F79A 4KMQA 5AOUA 4LY8A 1WDRA 2WQPA 3IGUA 4BQ2A 2JKPA 2D3LA 2F38A 1BYDA 1UWAA 3IK2A 4OFCA 4WQ6A 2PTXA 2UY5A 3N4EA 1QVBA 3I7SA 3M47A 1RJPA 4JFSA 5C2XA 1UWUA 2DZPA 1TPUA 2Y85A 3NOEA 1RD6A 3E12A 1JDCA 4ERGA 2J62A 3S9IA 3WLKX 3IGXA 4HCDA 3W2LA 3GNXA 3LDVA 3MQTA 3FJ4A 4M5PA 1Q3NA 3HV9A 3R0UA 5I07A 2P8CA 4Z1DA 2V2DA 3LCHA 1OZQA 1WXJA 4A05A 3WELA 3ELFA 1CTNA 1JYXA 1I4NA 2PC8A 2FZ9A 1NWRA 3KRSA 4UTKA 5EBUA 1H5YA 3TJLA 2XH4A 3VIHA 4HNVA 1MSSA 2CW6A 3UR8A 1H0GA 1OFRA 4UFMA 4LS2A 3O06A 5FJTA 5CJ5A 4XX6A 4OBSA 5JH1A 1OX5A 4X0NA 4PUEA 2DUXA 1JDFA 5HATA 5C55A 1V3LA 1NY1A 2WHJA 3P7YA 3VNIA 2O7QA 4IL2A 4GUIA 1JUKA 2C16A 3E2SA 1LUCB 3T05A 2WMHA 4XZHA 3N04A 3BV7A 4A8LA 3P61A 4PGLA 3TXVA 3W9ZA 4Q6JA 3ZVHA 2PZNA 5D2YA 4GGBA 4RL3A 3LRLA 2XWDA 5FEXA 2GJXA 3CAQA 3QZEA 3ARVA 1TPH1 1X1OA 4N4QA 3STPA 4LB3A 5D30A 1G0CA 5EMMA 5CSYA 5AVHA 4AWUA 1M7OA 4WCJA 4WD0A 1E5JA 3IUHA 4ZQOA 1OX4A 4PB4A 1L2UA 1M65A 4PL1A 4NZ4A 1UOKA 3LCGA 4JOMA 5D04C 3QYQA 2ZTKA 2XHYA 3VD5A 4H9VA 3ANVA 1WUEA 6TIMA 2HXTA 3BC9A 3TR2A 4GPNA 5FJRA 4DJEA 1NFBA 4C5ZA 1TB3A 4Z08A 3W85A 1LUCA 4AD2A 1NTHA 3CNYA 3UR5A 4KWSA 3H2OA 3MT1A 5K9XA 2Y6ZA 3S47A 2Z28A 3U2OA 4IFOA 4GYJA 1W1PA 1V51A 5KEZA 4A35A 4H01A 2ZRVA 5H1WA 1W5PA 1EO7A 1D8CA 3HJEA 2FYMA 3DYOA 1FHLA 5AY7A 2NQ9A 3RPTA 5FEZA 3KW3A 1SSDA 3U6WA 4RKAA 4JR5A 1VLWA 1PE1A 4ZGYA 2CCRA 3A6OA 3CB8A 3FLUA 5KZ6A 2EG6A 2NXGA 2VDHA 2A7RA 1XH1A 1DORA 1W9XA 1E0TA 3GBDA 4XD5A 2Z00A 2ESCA 1J0ZA 1MW1A 4TOQA 1EJUC 3ITXA 2E6DA 4CCZA 3N12A 2PWFA 4GIYA 3I6EA 3W73A 4JTUA 1KFCA 7A3HA 4JTTA 2QJGA 5MKGA 1XIHA 1GW1A 3GDBA 3GTFA 1XX1A 4WJEA 4B3KA 4DJEC 1KFEA 5A6MA 3E0IA 3VIGA 2XSXA 3W7JA 1ZAIA 1C9WA 3FA4A 1UR9A 3IAPA 2E0PA 2F6KA 1PB0A 1TTJA 5FACA 1VLIA 1X8FA 3VC6A 4N6EA 2Y4SA 3ITYA 3NQEA 1NAL1 3THAA 4IPJA 2GK1B 2PLKA 3LHUA 1AQ0A 1GZ1A 3QSTA 1I60A 4HA3A 2PD5A 4PBGA 2WNNA 3QKZA 2ZVIA 4AX7A 1TA3B 1DQWA 5HXMA 2EJAA 4WIWA 3MJMA 4HPNA 2FZBA 3S2JA 1AH3A 2PDYA 1E6RA 1UQYA 4IJBA 1SO6A 1KBBA 2UY2A 3VGFA 4XD3A 4F0HA 1WNOA 4JD4A 3A5FA 1FWHC 4NIRA 2OQLA 4O54A 5CC5A 1M04A 1F61A 3VOJA 3TV8A 4IGSA 1AH0A 1I75A 2VI0A 1L8PA 3E74A 1FFRA 3O6DA 3VGBA 2CERA 4O12A 4Z42C 3GX9A 3UGVA 3B4YA 1XLBA 4H6EA 1QBAA 3BCDA 1Q8JA 1W1YA 2IKJA 3BCFA 5CJMA 3TQKA 3S2MA 3TYCA 1TVNA 3UR7A 3F4CA 4ATWA 2VZOA 4HNLA 2OSXA 3KL3A 4D71A 1RV8A 4XBJA 2YLAA 5BWAA 1LOQA 3T2OA 4U5IA 3W01A 1B0IA 2DEPA 1VFLA 5U4NA 3S6OA 3MC5A 3EWWA 5BNKA 1ISYA 3MTWA 1O1HA 4GQ0A 3G5EA 1T41A 3HIJA 1LRTA 5K7JA 1R7AA 3WLSA 2TODA 2GPTA 1QPNA 1DQXA 1R38A 3TFCA 3GU9A 3KDNA 2DZVA 3BTNA 2E68A 2I16A 1MO0A 4O1AA 4X9SA 4DNHA 2D0GA 3LPGA 3PVFA 1QU4A 2Z0IA 3UJFA 3ZJ7A 1EYEA 1J4EA 5K4XA 3LXAA 3W1PA 4K8HA 4IUOA 1LBFA 1NFGA 1Y0EA 3UP8A 1U83A 4HSOA 3VIKA 1ZLPA 5E0FA 3B9EA 1QT1A 3QVQA 1X6LA 3LCFA 4W9TA 5A6AA 4OZOA 2REQA 1FHDA 2P8BA 3H7VA 4S2CA 1YQ2A 4HKPA 3H53A 3W1RA 3OQEA 4ZO8A 1E6QM 3W53A 1P48A 3B8IA 1RP9A 2A4AA 3H70A 3KOZA 3WLRA 1WZLA 3KRBA 3S83A 5BROA 4B15A 4B3LA 3WH9A 3R5EA 1R7OA 1BVWA 2ISWA 4FI4A 3QOMA 1DJYA 3PN8A 2QKFA 4J9JA 5XINA 5B7ZA 5K4ZA 4GNVA 1AZ1A 4GC4A 5B80A 1SQ7A 4IIEA 4W88A 2GDVA 2OGJA 1TIMA 4HU3A 4FR1A 4HZ8A 4PUDA 4FNTA 4H00A 5BWFA 4LCSA 3T07A 3VILA 2PDNA 3GB6A 4HIBA 3CB3A 5EGRA 3W1NA 1SGJA 2F61A 2WBGA 1V0NA 4K6AA 2X41A 5ABEA 3WDJA 3ARYA 1W3HA 2ZIDA 4AB4A 1BQCA 1PKNA 3CYVA 2BLEA 3WKZA 3AIBA 5DF0A 1PKMA 5C9ZA 1TIWA 5HUOA 3WL0A 4JCMA 2CLLA 1EWDA 3KAOA 2PUZA 2A3HA 2CZEA 4UFKA 3VMPA 2EHHA 1GWJA 1MVYA 4CVUA 2JK2A 2J9XA 1R2RA 1C3FA 1QK2A 3DU0A 2PF0A 3Q2DA 5GJMA 1HKWA 2EPMX 2XIQA 1TPDA 3WNKA 2POTA 4LVDA 3HO8A 1HVQA 3NSMA 4O17A 1H60A 3VDAA 1EFZA 2XGBA 3G1RA 4GZJA 3A3WA 3GXMA 1NDVA 4WDUA 2AAMA 3AICA 4UCGA 1H7XA 3U2EA 3CAVA 1OC7A 5IDIA 4B5VA 3TZFA 1O12A 4AZGA 2BSLA 4IG2B 1J0IA 3CWHA 1CLVA 2ODOA 4I7UA 3POHA 1NWUA 2OXNA 1MMFA 4GY1A 2OELA 3H2EA 3UCDA 1X7FA 1R3YA 2FTYA 1TPB1 5FSEC 1XPGA 5HR7A 1XDJA 2AQWA 3EEZA 1UH2A 2NZLA 2YDSA 3IIXA 1Y5XA 3CLWA 3OW1A 5JBEA 1HO4A 1JDEA 1Q85A 1W2VA 2QCNA 2ZUNA 1GQKA 2YBUA 5CZTA 3V0UA 1JF5A 2QCDB 4J27A 4PTVA 2BB0A 3P67A 3LHVA 4Q4OA 1JR1A 4GRSA 1P0EA 4KFOA 2RDXA 2V68A 3AUJA 3SB0A 2PDJA 2FPVA 2X1IA 1WUFA 4D72A 2QHAA 4MYXA 2CKRA 1S3HA 1W3IA 2QCCA 4BZYA 3APTA 5LHEA 4F0KA 3GR7A 3EZ4A 5CCZA 1ISVA 4W7VA 1GCYA 2WVVB 4K3ZA 1E71M 4N6FA 4W8BA 5HK4A 2AGKA 6TAAA 4LC6A 3P0XA 3SCNA 3QMRA 1FCVA 1JCLA 3DYMA 2CU0A 3ALGA 3NCOA 2BP1A 2W61A 3ZM8A 4JYEA 3OGSA 1EX5A 2YCJA 4MJMA 3MU7A 1P6WA 4US5D 4O15A 1TPC1 3UG3A 2FGBA 4JKMA 4G8TA 3VKAA 1XIEA 2A1YA 4IMFA 5I0DA 3BH4A 5GQBA 1OT1A 1HKMA 1RBLA 2YCIX 4ORIA 3K30A 3VCNA 2PA6A 3M6YA 2AMXA 4I9AA 1SYTA 3UERA 1MUCA 4BWLC 2PWVA 3T7VA 1RCXB 3M43A 5HNRA 4YVVA 3H55A 4NHVA 2PLJA 4J35A 1H1ZA 2VQUA 4OWGA 3BWWA 5DX7A 4FNPA 2FVMA 3CL8A 4LOCA 3S5SA 3N14A 2PWHA 3IUDA 4MIMA 4HPJA 1EBHA 1K7FA 1TMQA 3TP4A 1EWEA 1GK8A 3TNOA 3UYIA 2QXWA 3DKJA 4KEMA 4PTWA 9XIAA 1H7PA 4PEKA 1EX1A 3VKDA 5CG0A 4DM2A 5I6SA 4HN4A 2ZXQA 4RNHA 3N6QA 3DC8A 1VPQA 1PZ0A 3ZO9A 4AWSA 1DBTA 1UMYA 4MAVA 3U4FA 4GY7A 3WLMA 3M5VA 5TNVA 4GG9A 5KZEA 1GVQA 1JZ6A 4IIFA 4JIPA 3R0DA 1IGWA 1R9ZA 1UR1A 4O4WA 4QR6A 3ES7A 1CIUA 3A21A 2XIIA 4BS0A 3PY2A 4W7UA 3GUWA 1A5UA 2XGZA 2BHUA 2L5HA 4IMCA 3S5YA 1GVOA 2VUYA 5E5CA 1FXPA 3QKEA 3A4JA 4J7RA 1H5VA 2E9LA 2HSAA 4QS6A 3TYUA 4Q8WA 4A6GA 1S2CA 2QR6A 3QC3A 1V3MA 1ISWA 4PBFA 2OODA 3LI1A 4E4UA 4Q4KA 3OLGA 5C8BB 4A22A 5FL0A 5C2CA 2C14A 3EDEA 3CL6A 2BBFA 3H4WA 3OODA 4C6KA 4L6DA 3LLXA 3SQSA 1GOWA 2EPNA 3KCLA 1A50A 3OIHA 2D2HA 4AISA 4OBRA 1IIHA 1ZCOA 1O5QA 5AYXA 3AYRA 4L1WA 3VTRA 5A6LA 2YXXA 3VX0A 1CB2A 3H4XA 3O16A 3DIPA 3TOYA 2DJLA 3L4YA 4H6QA 1GVRA 4UBPC 1ZQ5A 5HJLA 4LCRA 3CIVA 5DBUA 2CBUA 1KRBC 3EPNA 1W1VA 5LGZA 1S1RA 4X60A 1QASA 3Q37A 3I7RA 4DXKA 2FMOA 1QRQA 1XFCA 4XZWA 2NLYA 3GC2A 3VINA 4NSBA 3E38A 4MHBA 3AXIA 3T4CA 5GJNA 2Q6ZA 4IXHA 1ZPTA 4KGJA 4LBSA 4NY2A 4EF9A 4ZBCA 3W38A 4TR9A 3ICJA 1YE4A 4MAZA 4B4HA 1SR0A 4G56A 1BD0A 1EYWA 5BZAA 1QI2A 1UKTA 2OFJA 3RCMA 3V36A 5A8PA 3D47A 4UZSA 3OOQA 1QO2A 2PC4A 2DV0A 4LU0A 1DQUA 1EZWA 1R3QA 1Z44A 2Y8VA 3IJ8A 1JZ7A 2FJKA 3M0JA 3FYPA 3BSMA 3NVTA 1T99A 2YLLA 4Z0SA 1RVKA 5E70A 4MLRA 3RK8A 1RQBA 3L7RA 1ZL1A 2PGWA 3EMQA 3I6RA 3AZRA 2GVYA 1BYAA 4XZIA 1FCQA 1TV3A 2CZDA 4M1BA 5C6MA 4RDWA 2E6AA 1PKLA 5LNRA 1EOKA 1H3GA 4DELA 2FHFA 3ZYZA 3DOPA 3AYSA 3IJ7A 4JQAA 1XV8A 4JKKA 3KXQA 4OIFA 3O7UA 3FA5A 5LA1A 3I4KA 2X2YA 3PNUA 2DZWA 1XQKA 1BFNA 4PUUA 4Q8UA 3BLEA 1KBKA 3QV9A 1WE5A 4EWJA 2BXVA 3V3WA 3QV8A 2W92A 3E3HA 3FYOA 4GZ7A 3H7UA 4E5TA 3HQPA 3PJXA 4YTUA 1W2PA 3KFTA 3LERA 3OEXA 1UWRA 1E40A 2ADAA 4D1JA 2DSWA 2ZVRA 2ZWZA 1B3YA 1D2KA 3N3MA 1R86A 4LVGA 1KCZA 1ICSA 4XIAA 4DYKA 4MVAA 1FWNA 3WBWA 4HPXA 4MB5A 1VP5A 4NJKA 3CZJA 1G4EA 3UPWA 5CBIA 4H7VA 3MUIA 3TYAA 2NQJA 4EXQA 4I5UA 2P88A 1OYBA 4HSNA 1I6NA 2XVNA 2HS8A 3U5UA 2ISFA 1IWAA 3M0LA 3VDGA 3BW3A 2CYGA 4XZNX 3M0HA 3ZT5A 4L4LA 5M03A 1GQLA 3DX5A 2RHGA 3L4XA 4AU0A 3UXAA 1XLDA 1JGMA 3LQGA 3QY8A 1G4TA 2CHOA 4LSBA 3LB0A 1V6YA 3C3NA 1N55A 5DT5A 3RX2A 3CH9A 3UJEA 4GQQA 3W86A 4OTKA 4LVBA 4BK9A 2Q3OA 3IEBA 4NAFA 2OWWA 3VKCA 3WCZA 4JN7A 3QFWA 3WK0A 1F7BA 1CLKA 3PJWA 5EMUA 3KX6A 4W86A 4D8ZA 3BDKA 1R3VA 4PMOA 4I3GA 1YXYA 3A3XA 4MKVA 1N8WA 4V15A 1RY0A 1LF1A 2HRWA 2PWGA 2WM1A 4ZQNA 4ACZB 4PH6A 1TWIA 1YDYA 1TJ0A 2VEIA 1ESWA 3VA8A 3L4ZA 2WV8A 4O8AA 5TD4A 3NXFA 3GRIA 3B8TA 1G94A 1U5VA 3E5BA 1UWSA 3XISA 4U31A 2PSNA 4D6DA 1P6CA 4FAMA 2GSHA 1U30A 1UQZA 3URBA 1V5XA 1N2VA 4CEXC 4Z2GA 1VAHA 2EO7A 4XTIA 3EAUA 3BAJA 1JCNA 3WQEA 5H91A 1KNWA 3AS1A 2GGHA 1DJGA 2PDGA 2HV5A 1LG1A 3QQWA 3LHWA 4MUPA 2G3IA 5JMUA 4O0QA 4IG2A 4IFRA 2WSKA 2QCMA 2X05A 4JQ3A 4ENLA 4NZ3A 4OBTA 2NUWA 2GOKA 4LYPA 4UFHA 3U4AA 3O9NA 5C71A 4D1IA 1H63A 4JY8A 4LAKA 1UMLA 3TTSA 4R85A 4XD4A 1SM9A 3GS6A 4YIWA 4XSLA 3ARUA 3T78A 1B9BA 3W07A 3GDLA 4I9JA 4TTUA 3SCQA 3TAKA 2EKCA 3W82A 4LVFA 2Z1BA 1H1YA 2Y0FA 3TEVA 1G69A 3OP2A 1H51A 1CXFA 5CPSA 2BVDA 3K8LA 2ZZ5A 2V67A 4YN5A 2IPGA 2OX4A 3MUY1 5EFDA 1IZJA 1ZRQA 3QEZA 3URAA 2YW3A 4FXRA 3BGAA 3KBJA 3WH8A 3TC6A 3WD0A 2I57A 3CHCA 4ASTA 1EJVC 1PZ3A 4Y7EA 4UQ9A 3VX1A 4EACA 3QXBA 1UD6A 3SW6A 4D6HA 2NXHA 3EOLA 4QGCA 5AHNA 1I1WA 5G5IA 1D7KA 4INFA 4Y9AA 2C1GA 5LIKX 4XB3A 1KRAC 2J7DA 2CESA 3AALA 3NURA 1EP3A 2VDGA 3CBWA 3F4DA 4W7WA 1MRAA 3TA6A 2XM1A 1ME7A 4XO6A 3H2CA 3IJLA 2OR2A 4TVDA 2HBVA 4DY1A 3TE9A 4XKYA 4AIOA 3CO4A 3VE7A 2INFA 4M24A 4QG6A 1T7LA 1L0PA 3T1GA 1U33A 1UROA 3NR0A 2WAGA 1XRFA 2ZRXA 3GHSA 3SUTA 3IRSA 4FR6A 2YB1A 4DBEA 3EWBX 4QAIA 2BGQA 4PMNA 2NWSA 3RMJA 2XIMA 1DJWA 4A21A 3GLCA 2VR4A 1M6JA 3QM3A 3NQBA 1S38A 3OG2A 3UPMA 5FKYA 3N2OA 4MPKA 2DZSA 1V6TA 3CUFA 4ZOBA 4AD1A 1HKJA 3H2NA 4PMQA 1SFJA 1EC7A 5FJJA 5KITA 1X6UA 1GT8A 1KV5A 2ANUA 4GX9A 3W7DA 3S2CA 2VGIA 3IJQA 4DWDA 3W00A 4LWWA 1RPKA 4MB4A 4JBRA 2V3GA 1FWGC 3SCUA 1DPMA 2VURA 3SECA 3W7EA 4J3VA 2C8NA 2X16A 1O7AA 5FF2A 3BUVA 2TRSA 3GNNA 1QI3A 3EB4A 2WC4A 1A5AA 3ABQA 2JKAA 4A2RA 1CGXA 2OYLA 3NL6A 3GNPA 4RPPA 1EB3A 3S3GA 3NSNA 4JCLA 1XKJA 2PGEA 3EDJA 1UA7A 1O5RA 3RF9A 2BVTA 4NP7A 2YKKA 4M51A 4DLMA 2J13A 3B0YA 3RX4A 4D6JA 3PZNA 2A6NA 4PCTA 4JTQA 2X30A 2WMIB 1TTIA 4WSJA 2OYMA 4XZ9A 5A2BA 4ECLA 2ZC8A 3UZWA 4IJCA 3W1LA 5AHLA 2V3DA 4OV9A 1V03A 3WLLA 4ADTA 2ZUMA 1TG7A 3FKRA 3PPGA 1W1ZA 3L65A 4LNCA 5HQLA 2VX4A 1K70A 1A4LA 1ZBWA 2PB1A 3TN6A 1QW8A 3SRHA 3W71A 3BOXA 3GXDA 6CGTA 1VYPX 3UZZA 1B3ZA 3S6TA 1QNQA 5A6BD 4I6VA 5I3DA 3AYTA 1VBUA 3LX9A 2VRKA 2VEFA 2CLMA 2XZ9A 3S42A 1OX6A 3D5HA 4WY0A 1MNZA 1NFPA 3EKGA 2PBOA 3WJZA 5C7VA 2UBPC 5RUBA 1FY6A 1ML1A 1M7XA 3RJYA 2F84A 4GXPA 4B2DA 1J0KA 3ITTA 4RJEA 3ITLA 3WQDA 2ZX7A 2C1IA 3VZYA 5D4YA 4IIGA 3T44A 1WA3A 5HPCA 2Z7KA 1BLIA 1V4YA 3JW7A 1VFUA 1QI4A 4ICNA 5CC6A 1DWHM 1YXDA 3ID7A 2QAPA 2QCFA 3U0HA 2PTDA 1R3RA 4L65A 1UP0A 2BFGA 4Y9PA 3NAVA 3LGGA 2DUAA 4NILA 1YDOA 3MW7A 2J88A 3W27A 1J9YA 1YW1A 3TC7A 4MGGA 2JGYA 3VM5A 4XAYA 2A21A 3WFLA 1W1IE 2CLOA 3KVMA 1F4AA 1PZ2A 3EOUA 2VCBA 2HXUA 1ONWA 4WHBA 3P81A 1SUXA 1TV7A 3KVLA 1W3NA 2J74A 4AF0A 4BF9A 4L1GA 3L5AA 1TR9A 1RCQA 4JDYA 4C1NB 5HUPA 5U7SA 1O68A 1CXKA 3G24A 3CHVA 3C86A 3H2FA 4UCFA 3APGA 1JD9A 5SWUA 5EL1A 5E93A 3MY9A 4H9TA 3SY5A 1AJ2A 2H90A 1TSIA 4BQ3A 3E2RA 2DU2A 2OYKA 3E0VA 1K7EA 3AMGA 1CDGA 1JI1A 3EOEA 4J3XA 1YBQA 2GQAA 2WVVA 4IJRA 3CT2A 1RCOB 1JULA 4I8YA 4AZ6A 4EF8A 4ALDA 1SU5A 3QTGA 2ALRA 1J6OA 1KXQA 2CXGA 1RSCA 2DZAA 4ORMA 3LBCA 2WWDA 4UTIA 4S3EA 3AC0A 3M07A 1QHOA 3P80A 1VBRA 2IMRA 1MEHA 3BOLA 3M64A 4JHOA 1LL4A 4HCHA 6REQB 4OU1A 1I8JA 2AAAA 4QCFA 2CNCA 4MTVA 3W1TA 3AXKA 2NVAA 1TUXA 4UWMA 1UR3M 2VR5A 5CC7A 4IP4A 2EJ1A 3C61A 2GJLA 3A4AA 2VTFA 1R9XA 4FEZA 1ENUA 1XIFA 3CHFA 2NT1A 1MZRA 4AZBA 2OMAA 1DXEA 2C7FA 4HU0A 1KW1A 2PBGA 2QJNA 4U4MA 1XCFA 3PJTA 2E28A 1H11A 1OG0A 4TU1A 1GHRA 2YW4A 3WH6A 2BVYA 3W37A 3P82A 3ZVHB 3HG4A 3EWDA 1QMLA 3A47A 4TUFA 2BV9A 5E6YA 4B2DD 3M7WA 2WZTA 2I9EA 3SRKA 4AY1A 2WMKA 5IXEA 2JQXA 3N73A 3USBA 1L6FA 1ZBCA 1OFBA 3EA2A 3NQFA 1SW0A 4C6FA 4PTXA 3M1ZA 3QMTA 1VZWA 2JGQA 4IMGA 3W84A 5AFDA 3A13A 3VC5A 1JGIA 3U9IA 4LS0A 1LROA 3TYBA 1Q6DA 3DCPA 2J8FA 2OKTA 3N6JA 1OK6A 2W9MA 1F76A 3KS6A 3UW6A 3GU1A 4FPSA 1HGWA 3LA4A 5M2FX 3MYPA 5D2VA 5I3HA 2XSBA 2ZDRA 3QW4B 1EHNA 1C8YA 4HNNA 4C6MA 4FHAA 4M19A 3KZSA 1K6AA 1US3A 1YNQA 3QW3A 2IUZA 3WNPA 1SR9A 4R34A 4WKHA 4YL2A 2E25A 4HMDA 4S3AA 1C8XA 4AX6A 4HYWA 3CWOX 2OZTA 1DIOA 4FOJA 4NAEA 4IGHA 2I56A 3NXLA 2ZE0A 2CBJA 4IPPA 5FF0A 4B4FA 3BMVA 2YR1A 3LD5A 3PSVA 2HE8A 4UFLA 5J8LA 3N19B 4FNQA 5EU9A 5CSRA 4NNCA 1JCJA 1YRRA 1E9ZB 1FDYA 3MP5A 1CI1A 3UXLA 4L6HA 3EMZA 2B7OA 3STFA 4IUGA 1HKVA 2XIOA 2BGSA 1O1ZA 1QJWA 3UJRA 2NSXA 1GVFA 3PBYA 1HQTA 3AIUA 4KCUA 1M01A 3CQ0A 4M6PA 4W5UA 2Y89A 4LAUA 3VD3A 4BQ5A 3QLLA 4NZJA 3SSZA 1P0NA 4L4MA 1B57A 2HWGA 5I06A 1IZCA 4UMBA 3F7JA 3U8GA 1NDYA 5FEWA 4ZO6A 5AC6A 1W5NA 4K68A 3VMNA 3VFLA 1W3LA 2DZBA 3BW2A 2J78A 2YL9A 3UBPC 3MWCA 3W23A 1TQJA 1I2NA 3ZVIA 3QH2A 3BPWA 4K36A 1BKSA 5DLCA 3CZEA 1K8CA 4Q4PA 1ONRA 3GK0A 4PUKA 4EXBA 1JZ8A 4IMEA 2X1RA 3W7PA 3GXPA 4EANA 1OADA 5LNWA 1VS1A 4DBUA 3AMCA 1DOSA 3DHPA 4WOZA 3PS7A 3SY1A 3UY7A 2MUCA 2XISA 1RD5A 3P0WA 4DVOA 3MKCA 4FK9A 2WMFA 4JIQA 1HP5A 2ACQA 2R1NA 3WD1A 3L4TA 4PBEA 4PFHA 1O4UA 3KWXA 1O5XA 3W2UA 1P7TB 1E9LA 3FKKA 2DP3A 2IQTA 3ANUA 1KKOA 5C5YA 4E38A 4G7FA 3GTXA 3FAXA 2Z1KA 2GGEA 2QPUA 3GAYA 4XBSA 3GY1A 4F9DA 2XIJA 4NU7A 1TZ9A 2ICSA 1XYMA 3LGDA 4Q7BA 4A3HA 2CBVA 1HJXA 2X7WA 5REQB 4JQ4A 1FRBA 3U2CA 4HYRA 3CV7A 5PTDA 4XD6A 4JNZA 1ONXA 3N2MA 3C4UA 3M7SA 4TX9A 3S9ZA 3JVAA 1TPWA 2H3BA 5G1MA 4UFJA 4DBWA 3FHQA 3PG9A 4NNBA 5EBAA 3W2MA 1OHLA 3DESA 1K8XA 3WK3A 3PR2A 1UZHA 2NQ5A 1VEOA 1GW9A 4QLLA 2BOFX 3O6AA 5ECVA 1VBGA 2YCEA 4AC1X 4AEFA 1MXDA 1S5NA 1UIOA 3TJXA 4KW2A 3W02A 4DO4A 1PX4A 1XUUA 3SUSA 4TX6A 1AJ0A 4P8VA 1V3JA 3V1HA 2QNEA 4GYPC 5TBOA 5HMDA 1V0KA 1VFMA 1UA3A 3WD3A 3L67A 3OVRA 3AS2A 4AQLA 3ARRA 5JQ9A 4QJ5B 4IM4A 4CGTA 4ZOAA 4Y2WA 3MZNA 3CZKA 3SCWA 3N2BA 3W7QA 1U1HA 2QDDA 5K2ZA 3HGOA 4PMVA 1LG2A 2Z2UA 4DQWA 3K1GA 5J5RA 3THDA 3LRMA 1AK5A 3UR2A 2FHCA 3C8FA 4L7ZA 4JTFA 4IZGA 1J10A 4NRSA 4XV0A 1NDZA 1ZBVA 1EO5A 2J7FA 3SQLA 3PWIA 3NQCA 2O9RA 2D20A 3W7MA 1ZAJA 8A3HA 4AZIA 2XPKA 3ZLGA 3UA3A 3RAOA 3OYXA 2OOGA 4JX4A 4ICMA 5F2IA 3CV1A 5DELA 4DM1A 5IHRA 2PP0A 3LM3A 2C3ZA 2W63A 3P62A 1PX8A 1DWIM 1SZGA 1OCNA 3VMOA 8XIMA 2QLYA 3G0XA 1TKKA 3DFHA 1JYNA 3RU8X 4C6LA 3ARPA 2CZFA 1EXPA 2RKXA 3AWOA 3WLQA 1ZJIA 3IV8A 1OFPA 1Z42A 4C6NA 3LXBA 2QIWA 4CN6A 1NIUA 2NUXA 4IQEA 4LVAA 3W4RA 2OLHA 5LNVA 4HOXA 2QUTA 2YBVA 2VZTA 3TKFA 4WLCA 4GJJA 4C91A 5JUVA 4X22A 1U2YA 2QCGA 3IJIA 4K38A 4TXEA 3CS2A 1W5OA 1OINA 3L0GA 1BVZA 2E9MA 3WMLA 3KHJA 2OO6A 2POZA 4R7JA 2YA1A 4YVXA 2W27A 2PRMA 1TFVA 1LT8A 3PZIA 4Y90A 5FJPA 1ZJAA 4IH3A 3WF1A 3MHGA 1OGBA 1KQZA 3TTYA 2ZICA 4B90A 4LFYA 4PE8A 1EJXC 1XRSA 3MI3A 3PF3A 3L4WA 1HTIA 1Q7ZA 1SJDA 1XDLA 1R3TA 5K9DA 4YHEA 3ZT7A 5D2TA 3WD2A 2WW5A 4EP8C 2V3FA 1E1FA 2XJ7A 2YSWA 1C91A 4MYAA 1CXLA 1UD2A 2BTMA 2ZA1A 2VDIA 4WK9A 4DEFA 4L61A 2CLFA 4Q33A 1C7SA 3O0FA 2XWEA 4OECA 4QXIA 3V4BA 4B16A 3GO2A 2VKZG 2NV2A 4BF5A 2VOMA 2GDQA 2ZZ3A 1BWKA 1UR0A 4R7OA 4S3JA 4DIAA 2FQIA 3GXFA 3QV7A 3PWGA 2QQ6A 3IIZA 5L9FA 4MSSA 1Q6OA 3NEVA 2NX3A 2Y61A 3N2TA 3CMFA 2VZSA 4B9YA 2AOSA 2WZHA 2G96A 2HK0A 3L2LA 1XBYA 1TJ1A 3OJGA 3S9YA 2ZWYA 1TPEA 4JTHA 4DWSD 3GYEA 5BMXA 3LCXA 1US0A 3UJ2A 1REQB 4X0VA 4P5UA 4PMYA 1Z6KA 3ZWTA 1GG0A 1FHUA 3ABSA 3WG6A 3RCYA 1W1B1 1HUVA 3VKKA 1WOBA 1DJHA 2Z1VA 2FFCA 3VCRA 4JFWA 4UOJA 2PDIA 1HX0A 2VGGA 5ABHA 7ENLA 4RDYA 1DJIA 1JFXA 3GIPA 3TYZA 1C8QA 3ME3A 2QPSA 1EQCA 3DFNA 3MI2A 4GQRA 4FALA 1FA2A 1UD3A 3LEPA 2VX6A 2HISA 3A4WA 3TX9A 3TOPA 4UIOA 5CGMA 1X8CA 1OBAA 2HBXA 4KEVA 3RUBL 4GCXA 4O1BA 5BRPA 5T26A 2OSWA 2OEKA 4O0KA 2Y70A 3HZ3A 2W0UA 2JE8A 2BASA 4HPHA 1B2YA 1S5TA 5G1YA 3U7VA 1X97A 3BMWA 2V5BA 1R0MA 2ACRA 3NPWA 2DUZA 3FSTA 5TQLA 4NZFA 3NGFA 4P7QA 3L0NA 4U33A 2W4XA 4H1ZA 4RZ6A 2PE4A 4Q4SA 2HNEA 3TW7A 1IEVA 1VGAA 3VCCA 3CAKA 1AL7A 4F0MA 3RRXA 4DAFA 5CPNA 4U10A 2AKMA 3G6MA 4XAPA 3RO6A 3PZ9A 4LUSB 4FX7A 5KMYA 4MWAB 1OGGA 1V3HA 3RYSA 1AUSL 3VIMA 3OQ8A 1LT7A 1DWGM 2QUUA 3CK5A 2WCGA 3GM8A 3A12A 1RJQA 3CPGA 1G7VA 2F2HA 4IPNB 5AN7A 4GH3A 3M0YA 1NQ6A 1KM0A 4M7SA 1SJCA 5I23A 1LYXA 3TAOA 5C9UA 1IZKA 3GIQA 1HJUA 2GGJA 3BCJA 3G18A 1BHGA 3AJ7A 4H41A 4DI8A 3ES8A 5JVLA 1N7KA 1XIIA 1A53A 3ARZA 1VENA 4C6EA 3K46A 3K13A 4J40A 2JBMA 3W83A 4ZO9A 1TZ7A 3MVTA 3S1XA 3PG8A 1E5NA 1KCLA 3LQLA 4IIBA 1R3WA 1EPXA 3SQMA 4YWIA 3VNMA 3TJ4A 3REQB 3AS3A 3FN9A 3NO5A 3H2AA 2QYGA 1SW3A 1CW2A 5A3HA 1LWJA 3C8NA 3S4TA 2EF9A 4MWAA 3CMGA 4M8UA 2CHNA 3KVKA 4HK5A 1H2JA 3NQ8A 3C5QA 3VOFA 4A4AA 2CLEA 2YIHA 4LEQA 2R24A 3IARA 3FVDA 4H7CA 1IIGA 1WAWA 2CKSA 2G3FA 2IKHA 4XKMA 4LYKA 4S23A 3A64A 2JIEA 3IRDA 1WKFA 4Q8QA 1GZGA 3DBNA 4EPKA 1Q6EA 1EC8A 4R27A 4CNSA 1EBGA 4CKQA 3JZEA 1GOMA 2CLIA 4CLMA 4PFMA 4IX2A 5C2GA 1WXZA 3G77A 3R43A 2YGYA 1GTEA 3W7LA 3MJYA 3QC0A 4H8HA 5FJUA 3MSYA 2VWSA 2WLZA 4LB4A 2AQVA 3QHMA 1VBJA 1IV8A 3HG2A 3VDHA 1I0BA 3VD4A 4XAGA 1DJZA 3FA3A 3DEQA 3O07A 3WSUA 1RLDA 5A6JA 4UNLA 3U3HA 3THQA 1GHSA 3M0IA 2V69A 1VCGA 3CASA 4UNKA 3THUA 3TLLA 3MCMA 1I9CB 4ZL1A 4KCVA 2YFOA 4QAWA 3WH7A 1RJRA 2VO5A 4C6PA 3EX3A 1DJXA 3IGHX 3CQHA 1QPOA 3ZR6A 4DUOA 3ECQA 1YNPA 3RCNA 1U5HA 2ALDA 3TZNA 2BDQA 4S3GA 1JQXA 3GC5A 4CCEA 1UR4A 3G1HA 1KR0A 4LQ1A 4O10A 1ME9A 3OVQA 3LCIA 3M0ZA 4LUYA 2C13A 1EDGA 2YL6A 5HWMA 5JXQA 1JVNA 1JCYA 1KQYA 3IPWA 1A5MC 4JTKA 2VRJA 4FLRA 3DH7A 4DUVA 2W91A 3CEPA 3CH0A 1TQXA 1CCWB 4R53A 1LOSA 1BRLA 5IOBA 4O57A 4FO4A 1MI3A 2Y8UA 2WSYA 4Y9OA 3IWPA 4IXXA 1VFTA 4W89A 4C6CA 5A8QA 4QBXA 2NVDA 3L5MA 1GYMA 4FXSA 4YWSA 1V0MA 2OEMA 2YX0A 3PNZA 1ZCCA 1VR6A 2Y7FA 1EA0A 1OY0A 4HHHA 4C6DA 4M7TA 1CYGA 4MNKA 3QSRA 4L56A 1JNEA 1B3VA 1R3SA 5HDRA 2F6XA 3UWWA 1RAKA 1E6XM 3LY0A 4BY3A 4PTNA 1P0DA 3B03A 1A47A 5LXEA 4DWSB 1WDPA 3C2EA 3IJ6A 2EBNA 4H8UA 2DH3A 3N11A 2V2HA 3L2IA 3WQGA 4HNUA 1Y65A 1BKHA 4GIEA 4Q8MA 3OLDA 1W9UA 5L6UA 4K7VA 1OFEA 1D3HA 1VEMA 1V93A 3HU7A 3FJ6A 3O2LA 2E5DA 3DFTA 1NOUA 2XH0A 4G7EB 4AZ7A 3QMSA 2PU1A 3P3BA 4M6VA 2FPYA 4REQB 4Q4RA 2GVEA 3LLDA 1K77A 5D03A 1VEPA 1W8GA 4AUBA 1XLLA 3VGEA 2XN2A 3KTCA 1EHAA 2E40A <