4LV4A

A noncompetitive inhibitor for m. tuberculosis's class iia fructose 1,6-bisphosphate aldolase
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
345
structure length
320
Chain Sequence
PIATPEVYAEMLGQAKQNSYAFPAINCTSSETVNAAIKGFADAGSDGIIQFSTGGAEFGSGLGVKDMVTGAVALAEFTHVIAAKYPVNVALHTDHCPKDKLDSYVRPLLAISAQRVSKGGNPLFQSHMWDGSAVPIDENLAIAQELLKAAAAAKIILEIEIGVVGEKLYTSPEDFEKTIEALGAGEHGKYLLAATFGPDILAQGQQVAAAKLGLPADAKPFDFVFHGGSGSLKSEIEEALRYGVVKMNVDTDTQYAFTRPIAGHMFTNYDGVLKVDGEVGVKKVYDPRSYLKKAEASMSQRVVQACNDLHCAGKSLTHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase/lyase inhibitor
molecule keywords Fructose-bisphosphate aldolase
publication title A Noncompetitive Inhibitor for Mycobacterium tuberculosis's Class IIa Fructose 1,6-Bisphosphate Aldolase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 133
structure length 320
sequence length 345
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4lv4A00
3C2VA 1SFJA 3W83A 4NJGA 3N73A 3W7LA 4MZ1A 3CIWA 3UY7A 2GQ9A 2YXGA 3T40A 3CWNA 2Q8LA 1ZJIA 5CGQA 1KW1A 3UWYA 4M6QA 3WFAA 5TIMA 1BWKA 1K02A 5SWUA 4NJKA 1R47A 3HGRA 1TSIA 4O52A 3W7MA 3BARA 3BGGA 1YXCA 1OFQA 1EWEA 4LTSA 2J9XA 2OT1A 1ADOA 2Z2UA 4E0CA 1A5BA 2ZA1A 2E68A 4OHQA 4UMAA 2FJKA 4AH7A 1SO5A 3BGJA 4JEQA 2LLEA 4AXKA 3SGZA 1O94A 2QUUA 1OG0A 5G2HA 4RLIA 3TK7A 1ONRA 4O4WA 4WJEA 1RQBA 3W2UA 5TBOA 2A7PA 3M1ZA 1YYAA 3LHZA 3R8RA 2A4AA 3W9ZA 4JN6A 1JCXA 5HR6A 4M6PA 1QO2A 1P5BA 2ZZ2A 1W0MA 3M5XA 3G1FA 4UMBA 1AK5A 3TQ0A 3L0NA 1JCNA 4UIOA 3IVUA 2ZZ7A 4K8EA 4LUJA 3QFEA 1RPXA 2PURA 2J9ZA 3CC1A 5TQLA 4BI7A 4Q33A 3W2KA 4R7JA 1EWDA 2OJPA 1FCUA 4FIQA 3HGOA 1S5VA 4RX0A 1EPXA 1GTEA 4AMAA 1GOXA 2ABBA 1IIGA 3TSMA 4KFNA 4AB4A 3KVLA 1F74A 3KRSA 3NVTA 4O8RA 2NXGA 1SQ7A 4UNKA 1Q6QA 1EA0A 2O7QA 3VE9A 1SZFA 5D04C 1SW7A 1JCMP 4A29A 1I2QA 4K6AA 1LBFA 3CWOX 1KTNA 1Q3NA 4UR8A 1ZAIA 1KM5A 4JTUA 4IXHA 3CEUA 4LV9A 4O17A 3S8HA 2FLIA 3TE9A 1WA3A 4I7UA 3SSJA 3STGA 4N4QA 5EA9A 1N8FA 2TPSA 4GUHA 3NR0A 1AW2A 4ZL1A 2A2IA 4IX0A 3FKKA 3E02A 3MMTA 4TMBA 3W6YA 2F7FA 3KRUA 3G8RA 2RDTA 3NQDA 5FF7A 1ZNNA 2FQIA 4CCDA 1GVRA 1GVQA 2AAMA 3R13A 2ZTKA 4BWLC 1CX9A 3WJYA 4A2SA 3Q58A 1ZCOA 2ZA3A 4FX6M 4UCGA 4Z1CA 1YTKA 3PF3A 1M6JA 1G69A 2YX0A 3EKLA 1N7KA 2YYUA 3P62A 3UY8A 3P7YA 1J5TA 1XC4A 1S5WA 3C0JA 3M0ZA 3CLMA 1DV7A 3DFSA 2QCLA 3IIZA 3P74A 4JX6A 4S2CA 2WKJA 2EKCA 3S5ZA 2RHGA 4E2BA 4DO4A 3LCIA 3NAVA 3I7RA 5J5DA 2W0UA 1U5JA 4IPJA 1W3NA 2HMCA 1TPB1 1KTBA 3GXNA 1LZOA 3LTPA 4H6KA 4XZ9A 4CQ8A 4FHAA 4R53A 4JTLA 4K8HA 5EYWA 5IBXC 3HO8A 1H7WA 4JIQA 5DXYA 4XTDA 3GAKA 3WK2A 3FIGA 2C19A 2CLLA 2ZQ0A 4NZJA 4O11A 3B0PA 3PBUA 4AWSA 4O0KA 2BTMA 4FXSA 5FEZA 1L2UA 2ABAA 2HS6A 3ZWSA 1D9EA 2E5DA 4JTSA 4AAJA 4QNEA 1GWJA 5FI8A 4MKNA 3LDVA 2E6DA 3TSBA 4MJZA 3M47A 1KBJA 4O50A 1A53A 1T96A 4HPXA 3DENA 3P60A 4RZ4A 1RR2A 3O6DA 2C13A 1OHLA 3QZEA 3DAQA 4RZ6A 4W9TA 4L4LA 4O19A 3W1UA 2E6FA 1G4PA 4ZQCA 2CU0A 3NDOA 5CZTA 5I3HA 1KM1A 1F76A 1FXPA 3UWZA 4PEKA 4H4IA 2DP3A 2X1SA 1AW1A 5LNSA 5LSMA 3TH6A 1SPQA 1LRTA 1OK4A 4OU1A 4M5PA 2RDWA 3EXSA 1NAL1 3MYOA 2V5LA 2WJZA 1TPUA 4UFKA 1WQ5A 4RKAA 4DPQA 3GR8A 3NGJA 4C1KA 1QMLA 3NQVA 3HB9A 1NFBA 4MY1A 3MBFA 4HSOA 5HQEA 3A24A 4ICNA 1SW3A 4JICA 3SY5A 2QCCA 5AFDA 3UQNA 3FJLA 1FCQA 4I7VA 1SUXA 1VLIA 3QPZA 1XBVA 4FNSA 2B7OA 1GEQA 3QC3A 2J88A 2ZZ6A 3OEXA 3NL6A 1TPWA 1DKWA 2RDUA 4MYAA 1IIHA 2CLMA 1A5AA 3WJXA 1F6PA 4UTTA 5FF3A 1Q45A 1LM1A 4Y6GA 2ZRVA 3T4CA 1RQHA 1XDLA 4MIMA 5AHFA 2YW3A 4TU1A 1R46A 4LVBA 4AVFA 1O95A 1CI1A 1XKYA 4M7SA 2ZRYA 1H1ZA 4PODA 1HL2A 1QDSA 3LLFA 1FDYA 4NZFA 2QF7A 3C4UA 4JY9A 3SGUA 1PL9A 3HMJG 4WQ6A 2FPVA 1JVNA 4YXGA 3OVRA 1YLVA 3NQGA 3W7CA 1EP3A 1OYBA 3UWQA 1DVJA 4DBDA 1THFD 3E12A 3MHFA 5G1YA 1VHNA 3LERA 3S1UA 4FNRA 3N34A 5D02A 4ZQNA 1LOLA 3W7IA 5DCBA 4JYFA 4CCCA 3C2RA 5CPMA 3A9IA 3LX9A 4X9SA 5I3FA 4XUGA 3W1TA 3L2IA 1B3OA 1FQ0A 2WNQA 4E38A 4OQVA 1AL7A 1WX0A 5AC7A 4GBUA 3W86A 3G3DA 1OFBA 3BLEA 4KFPA 5KZEA 4QNWA 4LV4A 3LOTA 1QCWA 2WQPA 3M44A 3W1RA 2VEKA 4XBKA 1LDCA 3DKLA 1W8SA 4IJBA 4X22A 1MZHA 1TO3A 3DI1A 3W1XA 1HG3A 2C3ZA 3PY2A 1SZNA 4IMDA 1TTIA 2DJXA 3C61A 4I7WA 5CZSA 3T55A 4IMFA 1QPRA 3I6RA 3W07A 3NO5A 3TC7A 5AHMA 1XDMA 3WK1A 3O6YX 3H55A 4LS1A 4Z08A 3TIMA 2QCGA 1PVNA 3GX9A 1XM3A 3PG9A 5FF0A 1PIIA 2ZRWA 4ZZ9A 2Z0IA 3LGEA 1N55A 1KFBA 3G8EA 2QDHA 1EUAA 4GJ1A 1F05A 4FF7A 1O5KA 1GTHA 3PBWA 2CLIA 3TA6A 2ZA2A 3NPVA 1TIMA 1AMKA 2ATSA 1V5XA 1NVMA 4IMGA 1QO5A 4Y96A 3GXPA 3NL2A 1O60A 3IIXA 4TR9A 2WNNA 4XTIA 2C16A 2YCEA 1DQWA 2ZRUA 4NVTA 5CSSA 4EF9A 3MI6A 1I4NA 5LNRA 2A85A 3G1SA 3E96A 2YYTA 1W54A 4NT0A 1YTEA 5DBUA 3O16A 3ABRA 1L6YA 2QUVA 3P5ZA 5G5IA 2B0MA 5CZJA 3PB0A 5U4NA 2A1YA 3RLVA 3VE7A 2VFIA 4JR5A 3ZWTA 2J27A 3PC0A 3FJ6A 3VI2A 3P61A 3IGXA 3UZ5A 3TW7A 3T7VA 2W79A 3GXTA 1X1ZA 3LI1A 2DZPA 4MLRA 1OFPA 2Y89A 1XUUA 4BWLA 5D09A 1OVDA 4ZQRA 1F2JA 3NQ2A 1VJIA 3S1VA 3TKFA 3KAOA 2H8ZA 3GLCA 1F7BA 2E6AA 3NQCA 1QPOA 4G1KA 3RLUA 4N6FA 2J6XA 1F5ZA 1EEPA 4OGZA 3TNOA 3W75A 3B03A 4M6VA 2ZDRA 1VCFA 1KV5A 3HIJA 3NA8A 3S5NA 4M19A 3UXDA 3G1DA 4BR1A 1LBLA 1UB3A 1FDZA 2ZZ3A 1RV8A 1PHWA 1KV8A 1XL9A 2V8ZA 3W85A 1G67A 2E5CA 2VFDA 3GDKA 3LCXA 1I2NA 3FFSA 3MO7A 3W88A 4FNQA 2R14A 3W84A 2G5WA 1Z44A 3G22A 3NPXA 3CM4A 4QISA 1TRIA 3VFLA 4N02A 4IXXA 3MJYA 2NXIA 1K7EA 3C56A 1H5YA 5BNKA 3LHYA 4TMCA 4EOUA 4DQWA 1TMHA 2I1OA 3RNDA 1DBTA 2GJLA 4IGHA 2P0OA 5L9FA 3S9YA 4WX2A 3QSRA 5EBUA 3B0UX 4QM1A 1VR6A 5D37A 4LWWA 3PSVA 3MHGA 4HN4A 4O0ZA 2H3DA 3DGRA 2B4GA 3EX3A 4EF8A 1VZWA 4NX5A 3MI3A 3DBPA 4PTNA 1KTCA 3U8GA 5AB3A 3OG3A 5C54A 2V2DA 3UYCA 1YTDA 1JUKA 2ZZ1A 1KM0A 4JTIA 3E9AA 3H54A 1WDWA 1YXYA 4ADTA 1VS1A 4HNTA 1RQEA 3PBVA 5D32A 1YDVA 3B06A 2JBMA 2Y63A 4O15A 3QF0A 1GQNA 2A7RA 1XBYA 1HTIA 4JDYA 5AC8A 3EXTA 5LNWA 2NV2A 1K8ZA 3RFAA 4C1LA 1T0OA 3HG4A 1VRDA 3QMRA 4N9EA 4N6EA 2CW6A 2VOMA 3CTLA 3S5OA 1W3TA 3EKZA 3W1PA 2VENA 5HWNA 4O4VA 4CCEA 2RKXA 2CZFA 1BTMA 5ABTA 2HS8A 3TX9A 5I3IA 3IV3A 3F4NA 3SIZA 2ISWA 3DXIA 2A6NA 3GKFA 4UFIA 1ME7A 1WOAA 5LZLA 3DHDA 4UC5A 5G2IA 4WOZA 3B0VC 3B8DA 4POCA 4MUZA 2KZHA 3TR2A 1G4SA 1EP2A 1MSSA 2CZDA 3IRDA 1JRCA 4LT9A 1W31A 1IXNA 3LM7A 4XBSA 3GB6A 4NNBA 2B7NA 2GQ8A 1GZGA 3LRLA 2ZBTA 3W2NA 1FWWA 1CW2A 1OFDA 4QITA 1TPEA 1VYSX 4O1CA 1ZAJA 1I2RA 3NQ6A 3ELFA 5HNRA 1UJPA 3M6YA 4YL2A 5HINA 1KM3A 4ORIA 4YMZA 1TCDA 5D2YA 1WYIA 1G7VA 1LBMA 4OT7A 4AHPA 1VYPX 3G0SA 2NWRA 2DZWA 2JGQA 4MPQA 4UTHA 4YWIA 2CLOA 1D3HA 1SO4A 2QDGA 3I7SA 4HPJA 1HUVA 2XN2A 4MJMA 4K7VA 2WOQA 3ATZA 1OX6A 3TQKA 5DCDA 1OF6A 1QOQA 2E77A 1OABA 3PBYA 2BX7A 3L67A 3BLIA 1Z48A 2VEPA 4X3ZA 1Q6LA 2WV8A 1SO3A 5J5RA 1ME9A 5DY2A 2D73A 4AHOA 5F1VA 5HMSA 3L21A 1NEYA 3IVSA 1R2TA 3QQ0A 3HOJA 3JS3A 2CZEA 2I14A 3CHVA 2E1DA 1QOPA 1KFLA 2VKZG 2TRSA 2QJGA 3T78A 2QAFA 4IQLA 3IGSA 4BFAA 2DZXA 5FEPA 2JKEA 3DFOA 1VYRA 4TO8A 1OJXA 1H7XA 5D2XA 2HSAA 3EEGA 4WUIA 3L0KA 4CNNA 4LNYA 1W5NA 1AW5A 2DORA 3G1VA 4JYDA 3BW3A 4A2RA 1QPNA 3RK8A 4GFSA 2ZZ4A 1Z41A 3MW7A 2B7PA 5T26A 3L5LA 2NZLA 5DLCA 1OF8A 4LC8A 3TXVA 5FF4A 4TIMA 3STCA 5U7SA 1W5QA 1OFEA 3G1XA 1J2WA 2WPBA 2QUTA 4JY8A 5D33A 1DORA 3OIXA 4PH6A 1ALDA 1FUYA 1LYXA 3MWAA 3LCGA 5KITA 3P5YA 1TPH1 4N4PA 4NJIA 4DF1A 2ISSA 3CIXA 3TCEA 1WV2A 1QR7A 3IVTA 3PM6A 2BSLA 3UPBA 4K37A 5DY3A 2VFFA 2Q3OA 1UUMA 1SO6A 1JR1A 5I3GA 1G7UA 5EKYA 1JQXA 4WY0B 2VXNA 3THQA 2V30A 2EHHA 2BZNA 1QNVA 1B9BA 3P8IA 3E49A 3E0IA 4BI6A 1T8XA 4ALDA 3LHTA 2YPIA 4OE7A 4ML9A 4KKXA 1E51A 1ICSA 1H62A 2IQTA 3TROA 2X1UA 2Y7EA 4RCXA 4IWWA 5H2ZA 1MEHA 3BPWA 4FNPA 3HPZA 3A5VA 1SU5A 3IEBA 3HPSA 1TQJA 3CT7A 3IIOA 1HFBA 3R2GA 1KFCA 3KX6A 3QPYA 2V82A 4Z0JA 4O14A 5BW6A 1TV5A 3KRZA 3WJWA 3KVMA 3BG9A 3SECA 4OV9A 1KLZA 5KSWA 3S1WA 3W1NA 2Q8ZA 2VC6A 3SW6A 3TUUA 2CLFA 3W87A 4DELA 2NV1A 2QCMA 4YLWA 2PE4A 5F2LA 1VPXA 1BWLA 3W1LA 1GYNA 2Y6ZA 3TAKA 4FXRA 4YCPA 4HNNA 4NX0A 1I2OA 3IIVA 4QQ3A 2QAPA 4JD4A 1TREA 4IOTA 3EWXA 6TIMA 1SSGA 5LGXA 5KINA 1TJRA 3UWWA 3W7PA 4PC8A 4PCFA 1NF0A 2QCNA 5FF2A 3GR7A 1FCVA 4JTFA 3F4WA 4UTWA 3TSDA 4N9CA 3HPXA 1TYGA 3TMQA 4UTKA 1LRNA 1XXXA 3DH7A 4FO4A 1RVGA 3LXBA 1GYLA 1SZGA 1MEIA 2FPTA 1A5SA 4CQ9A 5LGZA 5CZ0A 3OHIA 3EWZA 4UTLA 3KXQA 1YDNA 4Z1DA 1OX4B 2J24A 4HNUA 5C55A 4WOQA 2YW4A 3QM3A 2ZYFA 3A22A 4X2RA 5DCEA 3UWUA 4GRSA 1FY6A 3F1QA 1XUZA 4O57A 3TMLA 2Z6JA 1QPQA 3F03K 5E93A 4WY0A 3LV5A 1YDOA 2ZTJA 1O5XA 1K8XA 2EPHA 2YFOA 4M7TA 1X7FA 3NZRA 3UNDA 1WAUA 4MZ8A 4DEFA 2ATMA 2PRMA 2V2HA 2FTPA 2V5BA 2B7QA 3OA3A 3NQ7A 5F4XA 3WK3A 1FWNA 2X1RA 1KFKA 5K2ZA 3GNDA 5D38A 1F73A 4WD0A 3I7QA 3QEZA 4WXYA 3TXZA 2NUYA 1P0NA 3BG3A 3R5EA 4ONVA 3C2OA 2YFNA 4PL1A 1C8VA 4UTJA 4BI5A 3D0CA 1H61A 2X2GA 3Q2DA 4ZQPA 5D2VA 4PA8A 1X1OA 3NZ1A 1WOBA 3DFTA 1TV7A 5KMYA 3LBMA 4NXSA 5AYZA 5AHEA 2X16A 4JS3A 5FEWA 3W76A 4GUJA 4OBTA 4IMEA 1IXOA 2O7SA 3U2OA 3HJZA 2GUUA 1GG0A 3W2LA 1B4EA 3DFQA 2WO5A 3V75A 4K39A 3UPWA 1ZENA 4B5NA 4O13A 2TMDA 3GYEA 4CNPA 1Z42A 2A21A 5KZMA 2DZUA 2I9EA 1NSJA 4K38A 4LVAA 3PUDA 5HWMA 1YPIA 3W7EA 3W3OA 2RH9A 5H91A 3M41A 2NUWA 1VCGA 1EUNA 1KM4A 4MFEA 4BF9A 4NQ1A 1JUEA 3RF9A 1IGSA 5EMUA 2OX1A 4NNAA 1SFLA 4O1BA 3S1XA 3KVKA 1KFEA 4MOZA 2R94A 3LHWA 3W1AA 1OFAA 4E2DA 4EIVA 4EWND 3N2XA 3HG3A 2PRHA 3STEA 3W7GA 3OVPA 2V9DA 1FWRA 4OWGA 1VH7A 1OX4A 5EL1A 1KBIA 1LLWA 3JRKA 4DF0A 3QH2A 1TB3A 1TJPA 3V1PA 3CU2A 5IM51 1FXQA 3N19B 3HG2A 5HULA 1C29A 2VEIA 3SR7A 2P10A 4YCOA 3VNDA 3EB2A 4JTKA 5G1TA 3EWYA 4OV4A 3PS7A 3M43A 3MUXA 3W70A 3N9SA 3PAJA 2ZRXA 3L5AA 1TTPA 1W56A 1X6UA 3BO9A 4NU7A 1UUOA 3HGJA 3W7HA 5G4WA 2H3BA 3UD6A 2QCEA 4JDBA 1M5WA 1I45A 3MHUA 3ZR4A 1LORA 2YSWA 3EWUA 5LKYA 3W1QA 3FYPA 2A7NA 3BG5A 5HJLA 3O15A 4GUGA 3NL3A 3NEVA 7TIMA 3M5VA 5D05A 3N14A 2EGZA 5LHFA 5HUOA 2X30A 3MP5A 5HR7A 2Y7GA 5G4EA 4GE8A 2ZCGA 3S42A 5KZDA 1KLYA 2F84A 3STFA 2OMAA 3O1NA 4UTWC 2ZZ5A 4RZ5A 1OFOA 4FNUA 2CLKA 3EX4A 3M16A 3UWVA 4Y90A 3N2MA 4AWTA 1MO0A 2QJIA 2ZRZA 1R2RA 1GJPA 2Z1BA 1FX6A 1DOSA 1GT8A 1WXJA 4JYEA 5DELA 1PCKA 1GVFA 5C6MA 1GVOA 4UFMA 4TX9A 3LHVA 3HGSA 2DZVA 3N9RA 1C9DA 2W6RA 3PULA 3EX2A 3LRMA 3LI0A 1LTDA 3NPWA 1VLWA 2FB3A 3C8FA 3GAYA 4LVGA 1DL3A 3NXFA 2YZRA 2VFHA 4LVDA 3IIPA 1X8FA 2EAWA 3TQVA 4R33A 3KVJA 1P1XA 4NJHA 1XI3A 3NQAA 3ZS4A 2JKAA 4ZVJA 5C5YA 5CPLA 3ZFHA 3LLDA 1YPFA 4DPPA 1FCBA 4LRSA 1EIXA 3LRKA 3W23A 4CNOA 5I3JA 3L65A 4MYXA 2CLEA 4QIUA 3HQ1A 5AOUA 3GDMA 4UTIA 3W2MA 3L9CA 1H7NA 2RFGA 1RD5A 2J9YA 1SZEA 4MLJA 3RU6A 4O53A 3LCFA 4A3UA 3HG5A 1S3HA 4RJEA 1VGAA 3W7JA 4NXKA 2BWGA 1TPC1 3O8AA 2DJLA 1OYCA 2DZTA 3DFNA 2VFEA 2GQAA 3ANYA 1MXSA 4ZMGA 4KWVA 4S1FA 3C2FA 1TPFA 2FDSA 3ABOA 4UFHA 1ZFJA 4J9JA 3G3MA 1KFJA 3MYPA 1K7FA 3BW2A 5BOOA 1I8JA 2G96A 3G18A 2CLHA 3Q37A 4JXCA 1A50A 2GVGA 1DQXA 2E6YA 5HUPA 1IXQA 3H53A 1XFBA 3P82A 1G4TA 1TRDA 2NXHA 2Y61A 3TJXA 3B4UA 3B04A 2CFFA 3PUEA 3W1MA 4KWWA 4AWUA 4FX7A 3R12A 4JNMA 4HNVA 3NM3A 1SSDA 4AF0B 4GWEA 3LV6A 4ADSA 3QMTA 4I9AA 3FYOA 1H7OA 1R2SA 3GDTA 1ZHAA 2OCZA 4O16A 1QWGA 4CQAA 1NF7A 3C6CA 4GXMA 4UFLA 3NQMA 3VKJA 3C3NA 3JR2A 4JX5A 4A21A 3SJ3A 2Y88A 2H8XA 3P80A 2C6QA 4FX8A 2Y85A 1P4CA 3FEMA 3MP4A 1H7PA 4EVZA 1DHPA 3WK0A 1JUBA 1ZAHA 2QCDB 1M7OA 2X1TA 2C15A 2FIQA 2OT0A 3NOEA 4UR7A 2Q3RA 3FLUA 3A23A 3DFPA 4IMCA 2HTMA 3WJSA 4XKYB 1HO1A 4MY8A 1T99A 5AYXA 1EX5A 3O06A 1H51A 4UUIA 3GDRA 4XWUA 1KA9F 5C2XA 4P2VA 3S5YA 5K9XA 2EF9A 5FEXA 1JCLA 4O12A 4MVAA 1WBJA 1W1ZA 4HSNA 2VEMA 3GIYA 1L6SA 1LCOA 3FS2A 1PE1A 1W5OA 3I68A 4AHQA 2NLIA 4HHPA 4UTMA 1V7YA 3NYZA 4O10A 2V0TA 2PRLA 4N9BA 3TDFA 1XBXA 3MBDA 1F6KA 3EWWA 1LOSA 2A6LA 4R34A 4IX2A 2OZ0A 2CZ5A 5CSRA 1SR9A 1M7PA 3QQ1A 1K3UA 4LY8A 5KTLA 5BMXA 4Y9AA 4DO6A 4FNTA 1K03A 3GNNA 4O18A 5AYYA 3W7DA 5BMWA 1PHQA 5F1UA 3LCLA 4HKPA 3M7WA 2AGKA 2GVLA 1D3GA 4RK8A 4QAIA 4LVFA 1ZALA 4FB7A 4DBEA 1AL8A 2V81A 3O63A 5LHEA 4U28A 1H60A 5K7JA 3G24A 3LCHA 4AF0A 5CKSA 4Z1AA 3PVFA 4ADUA 3TJLA 2FFCA 3G0XA 3L0GA 1ME8A 3SFKA 2XFWA 3BV4A 3FA5A 4WXZA 3R89A 1LLZA 3FOKA 3TW6A 3L68A 3QSTA 4RR4A 3NQEA 3W7KA 2QKFA 4P61A 1H7RA 3TFCA 1HO4A 5D30A 3I65A 2DZSA 6ALDA 2QCDA 5MHBA 3CQ0A 1TQXA 3W74A 4GUIA 1ICQA 2UV8G 3P81A 1MEWA 1K7XA 4JTJA 3N3MA 3OVQA 4LC6A 1OX5A 4JTGA 2JGYA 1W37A 2YR1A 4GNJA 4UXDA 4XKYA 3LTSA 1A5CA 3NQFA 4U4MA 3TU9A 5LNUA 4WY0F 2E5BA 1K8YA 4D2JA 2WSYA 2C18A 5F2MA 1GG1A 4K7YA 4MFDA 3KOFA 1IF2A 2P1FA 2QCFA 5A8GA 1GVSA 2NUXA 3PR2A 3W72A 4K36A 2Y7DA 3WJZA 3SZ8A 5EPDA 5K9CA 3M5YA 3G1AA 4NJJA 3U6WA 3L5MA 2R8WA 1IXPA 4LS0A 4O54A 4H3DA 1Y0EA 2A5HA 3LXCA 4IUOA 1S5TA 3QYQA 4NUWA 3TFXA 1TPVA 4UFJA 4Z0SA 3PWAA 3OBKA 4PFMA 4CLMA 3MP3A 3W71A 3W73A 3HBLA 2C14A 4JTEA 1XCFA 4S2BA 3GDLA 4GUFA 3DKJA 3IGUA 3GVGA 1PS9A 4NNCA 2YDAA 4LOCA 4LRTA 3PSWA 5K4ZA 2QEZA 5EY5A 4O1DA 5DBTA 1P0KA 5DXXA 3BLFA 4KFOA 5AC6A 3G1YA 1XBZA 3RMJA 1DJQA 3B05A 2R91A 4JGDA 2WSQA 2XN0A 3A5FA 1AG1O 1ML1A 1LP6A 4HT3A 3LB0A 1J4EA 3W7OA 3GKAA 1G4EA 2H90A 3DI0A 3BW4A 1OFRA 3CPRA 4UNLA 3BVJA 5AN7A 1JCJA 1LROA 3AO0A 4Q4KA 3PB2A 3W2JA 3O6CA 2FPYA 1BKSA 4RV8A 3ABSA 1LOQA 1KM6A 1G6CA 3LBCA 4A22A 1H1YA 2QCHA 3EX1A 2ISVA 4RXFA 1ICPA 4DF2A 5K9DA 3TV8A 1ZY9A 4LUIA 3O07A 3HF3A 3NPUA 3M9YA 3P67A 2CWNA 5AHIA 8TIMA 1FWSA 4MY9A 5F4SA 1EB3A 2QJHA 4QSHA 3UXAA 2PC4A 2WSRA 1TTQA 3W22A 3P8JA 3QW3A 4JTTA 4Z1BA 4RXGA 1OYAA 2GPTA 2JK2A 1UCWA 3Q94A 2V2CA 5D03A 3NQ8A 3L66A 1VHCA 1RZMA 2PCQA 1R30A 3A21A 3ATYA 4JTHA 4LW7A 5F4WA 5FESA 3S0CA 1TTJA 2TSYA 4DXVA 1EP1A 2G97A 3INPA 3PUOA 3EWBX 4GC4A 3NL5A 1FBAA 3W7RA 1FDJA 4Q32A 5GVJA 5F2GA 5G2WA 2VELA 2FB2A 2GJNA 2NWSA 1YXDA 3W7NA 1GPWA 5D2WA 2ALDA 1JRBA 4XQ6A 3TAOA 3O05A 1SW0A 4UTUA 1Q6RA 3KHJA 2NX9A 4LU0A 3LXAA 1YADA 3KFTA 4ZQMA 1H50A 3AJXA 5A5WA 3NNTA 3LCWA 1JCYA 3GZ3A 1TV8A 5E0KA 2XN1A 3T44A 3LHUA 5HWJA 3CB8A 3GK0A 3P84A 5E1QA 4ORMA 1OK6A 5AHNA 5CPNA 5BRBA 1B4KA 1JJKA 1JULA 3QJAA 2Y62A 4AEOA 3THAA 3QRHA 2DU2A 4WZHA 1VC4A 2C1HA 1W5PA 2NX3A 3BK0A 2H6RA 2TYSA 5K3VA 3DZ1A 4HIBA 3YPIA 4DO5A 3NG3A 1W5MA 3W7QA 1I2PA 4FIRA 2BLEA 4PL2A 2G95A 4FEZA 2YGYA 2GOUA 2Y70A 1O4UA 3FKRA 1H63A 4QJ1A 4ZQOA 2A0NA 1QFEA 4N9DA 3G0UA 4L4MA 2ZFAA 1QAPA 3LTYA 2VFGA 2NX1A 5D2TA 3TC6A 3ABQA 3NM1A 3C2EA 3CEPA 1VQTA 2Z6IA 3QMSA 2BXVA 3USBA 5I3KA 2Y7FA 4MZYA 5AHLA 1U83A 2E09A 4IPIA 1L6WA 1B57A 3UZJA 1UBSA 1LRQA 4N2YA 3QW4B 5K4XA 3S6DA 1BEUA 3DU0A 5LNVA 2WNZA 3PG8A 1W3IA 2AQWA 1UASA 4JIPA 3VCRA 4UMCA 4LS2A 4O1AA 3G1HA 3M5ZA 4BK9A 5IBXA 3DHFA 1VCVA 2GVJA 1L9WA 4UTTC 3EX6A 2JKPA 1JQVA 5CPOA 1TPDA 4O28A 1WBHA 1Q6OA 1PV8A 2QR6A 5F2IA 1KM2A 5DN1A 2C0AA 3SI9A 1PCWA 4Y8FA 5CG7A 5L6UA 1DJNA 1FWTA 3EXRA 3MI2A 4JX4A 3K30A 3C52A
chains in the Genus database with same CATH superfamily
4MZ1A 2GSHA 3R1ZA 3T40A 5CGQA 5GNXA 3AIVA 5I06A 2XVKA 5TIMA 1BWKA 1K02A 1TSIA 2X8RA 4HJFA 5KETA 2J9XA 1A3XA 4ICCX 4OZOA 3UERA 3BZGA 2EXOA 1JYVA 1TMLA 2VGIA 3ZT6A 2ISFA 2FJKA 5H8PA 4AH7A 1SO5A 3VZYA 3BGJA 4JEQA 1O94A 4W5UA 1ECEA 4OECA 1ONRA 3SN4A 3VKKA 3TW9A 1RQBA 4ZO9A 2A7PA 3M0KA 2ONEA 4ILSA 3WD4A 3S2MA 1TELA 4JN6A 5CCZA 5HR6A 3S9IA 2PDBA 2WMIA 1M9HA 4X0VA 1W0MA 3G1FA 1E1CA 3CL8A 1BRLA 3GH4A 5CBBA 4WKHA 3QFEA 2D1ZA 2J9ZA 3KL0A 1DJXA 2OJPA 1PKYA 3H7RA 1KXQA 3HGOA 1R0MA 4BQ3A 2D2OA 1GTEA 2P53A 4IUGA 1GOXA 4H9ZA 1IIGA 3B8IA 2E3ZA 4PMNA 4GO8A 3KVLA 3NVTA 4I8DA 4O8RA 1EA0A 3T07A 1Q66A 4ATWA 3VGBA 4A29A 4KF1A 4D1JA 2W92A 3CWOX 1QXLA 4V2XA 1Q3NA 4QQUA 4S23A 3CEUA 2VUNA 4G5DA 4KRTA 2FLIA 3TE9A 4E4FA 1WA3A 3SSJA 3STGA 3WNOA 4N4QA 1N8FA 4ZL1A 3Q65A 1EL3A 2A2IA 4R9OA 5C71A 6TAAA 3E02A 3MMTA 1DWGM 2O9TA 2F7FA 1NOWA 1BG4A 2RDTA 3RJYA 2GGHA 4FPSA 2FQIA 5GPRA 4BCEA 3R13A 1CB7B 2J79A 4A2SA 1TVPA 4Z1CA 1YTKA 1M6JA 4PTVA 1M65A 2YYUA 3P62A 3LZ3A 4L80A 2FGBA 3DFSA 4JX6A 3IIZA 4IG2B 3S9ZA 3MUCA 3WBWA 2RHGA 4E2BA 1HXJA 3CS2A 1DIOA 1AH4A 2Z1VA 4GD0A 1AVAA 1JZ8A 1UD5A 4W89A 3LTPA 1KCLA 4H6KA 4JQ1A 1NDWA 5FL1A 4XZ9A 2QIWA 4K8HA 5IBXC 3HO8A 1H7WA 4JIQA 5DXYA 2OSWA 3WK2A 2CLLA 1Q6CA 3U5YA 4UOZA 2OFJA 3CBWA 4A8RA 2I9UA 4O11A 5D8WA 3PBUA 2OQHA 4FXSA 3SRDA 1XINA 2DQWA 2HS6A 3ZWSA 2V5JA 4JTSA 1MRQA 4DYKA 4MKNA 4F0HA 3GU9A 2QF8A 4O50A 3T9PA 4HPXA 2PF0A 3P60A 3QZ6A 1RR2A 3O6DA 2C13A 4OVXA 3S6OA 4MADA 2G41A 4L4LA 2GDVA 2PWFA 1G4PA 3OVGA 4ZQCA 3ITLA 4GA8A 1KM1A 1DJIA 1FXPA 5GNYA 1VIWA 4H4IA 2DP3A 1EO7A 3TH6A 2OEJA 3A4WA 4XZHA 1NAL1 4GX8A 5LIUX 4PMVA 3M0VA 4UFKA 1XIFA 1WQ5A 4IZGA 2IPGA 3EDJA 4DPQA 1BWVA 4S3FA 4US5A 4CN4A 2FVKA 4HMCA 4MY1A 5M03A 3CQKA 3A24A 3RLHA 1J96A 4JICA 1TUFA 3SY5A 2QCCA 4QR6A 3UQNA 4LXFA 1OCQA 1A47A 3AROA 3QPZA 1XBVA 2OYKA 2ZZ6A 3GM8A 3EBVA 4PUMA 3B9NA 2VCCA 4PZVA 3WJXA 4UTTA 3MSDA 4KCUA 1XDLA 1BQCA 5AHFA 4BEQA 4LVBA 4AVFA 1O95A 1MFVA 2G50A 1HL2A 3PZNA 3LLFA 1FDYA 5A1AA 3VIIA 1FH8A 3C4UA 1X8CA 1DIKA 3IJ9A 4YXGA 2W62A 1UROA 1YLVA 4X63A 4NL1A 3W7CA 3BQ6A 1DWHM 5DX7A 2SFPA 2PWDA 3MHFA 1FHUA 5G1YA 1UR4A 1DTNA 4EX4A 4C6JA 3N34A 1MQQA 4ZQNA 1LOLA 4CCCA 1RJQA 1GYMA 2NQJA 2AQVA 1E6NA 4X9SA 3W4RA 4IISA 4XUGA 3L2IA 1B3OA 3T08A 3JZEA 1KFWA 5AC7A 1BG9A 4GBUA 3W86A 3G3DA 5CAKA 3CHEA 3BLEA 3RCMA 3GTIA 3UGRA 1KO0A 2BNJA 3WH7A 3W1RA 3CHFA 4X22A 1MZHA 5JVLA 3W1XA 3B9OA 3FJNA 1SZNA 1JAEA 3GBDA 1TTIA 2PWVA 2DJXA 1T7LA 3QFWA 1EJ7L 4YVPA 3B97A 3NO5A 3TC7A 5AHMA 3WK1A 3O6YX 4IFRA 2PP1A 4WDTA 3N11A 3TIMA 2X0HA 1PVNA 3GX9A 3TN3A 5J04A 4BZYA 1PIIA 4ZZ9A 1V6WA 3LGEA 1V3IA 3HQPA 1UH4A 1EUAA 1G9HA 3NFUA 3CUXA 3QKZA 2CLIA 4RDWA 3NPVA 2EO7A 2ATSA 1FH9A 2Z7GA 1HJSA 1HGYA 4IMGA 1EJTC 3VNYA 1VJZA 1XRVA 1O60A 2BVTA 3IIXA 2WNNA 2QJJA 3VKBA 3BV7A 3A3WA 3OLIA 4NVTA 4EF9A 5LNRA 2ESCA 1D7FA 3KWXA 4GNVA 3CMJA 3PFRA 4CN1A 3VZXA 4XAZA 1JYWA 3N1AA 4A3YA 1KRCC 1FWGC 1MMFA 1L6YA 3ABRA 1TWDA 3P5ZA 5G5IA 1XLIA 3RLVA 3PB0A 3VE7A 3ANUA 2J27A 3FJ6A 3VI2A 3NO3A 3RR1A 2W79A 3GXTA 1X1ZA 3E2QA 1OFPA 2Z1XA 3TTSA 1PZ0A 3AU6A 3NQ2A 3BZJA 5DMMA 4JTRA 4L1WA 2GWNA 2OVLA 1TMQA 3OOQA 3E0LA 4N6FA 1A5UA 4DZAA 2W67A 2J6XA 1PXGA 3PPFA 1Q4NX 5EMMA 3WLSA 3TNOA 2DT0A 1SFTA 3B03A 4RNJA 4M6VA 4FSAA 2E28A 3S5NA 1CPUA 2BOEX 1RBAA 3UXDA 5JU6A 3G1DA 4BR1A 4WJ8A 1TR9A 1EDTA 3BLDA 3N2TA 4UQ9A 2ZZ3A 4ML4A 2V8ZA 5E0FA 3W85A 3GG0A 3FFSA 3RIKA 1I0BA 6XIAA 3W84A 2X09A 2WPGA 2G5WA 2XGIA 1NWTA 3G22A 3NPXA 1TRIA 3E5PA 1WDRA 1Z3NA 2F2KA 1A5NC 2J8GA 2FTWA 3LHYA 3KBNA 4EOUA 1EGZA 4PSRA 4BA0A 1DBTA 1U1JA 4WX2A 2ZE0A 3OTRA 3VOCA 3AMKA 1VR6A 1XRSA 5HA7A 3MHGA 4KCTA 4HN4A 4XUYA 5JBEA 3CV2A 4NIRA 2H3DA 1QU4A 3EX3A 1VZWA 1TIWA 2WMFA 3UYCA 1A4LA 4XD6A 5AZ0A 1YTDA 1PPIA 1JUKA 2ZZ1A 4JTIA 2W5FA 2PDIA 1V0MA 1AQ0A 1WDWA 3TN5A 4HN8A 3ID7A 4GZ7A 4O15A 1T6MA 3KLKA 1IEQA 3MB9A 4G1NA 3GHUA 1J6PA 5AC8A 1PEZA 3QC0A 3EXTA 1U33A 2NV2A 3RFAA 1W1IE 1O6IA 4ICMA 1M03A 2R24A 3UR7A 1H2JA 2CW6A 3CTLA 1J0ZA 3S5OA 4KT2A 4AZGA 3U57A 3M0XA 3GC4A 4US6A 2GGGA 4O4VA 2RKXA 1E6SM 3CB3A 4ZB0A 3UG4A 3ES7A 4AVOA 1BTMA 2HS8A 3IV3A 3F4NA 1EYWA 3DXIA 3GKFA 5HDRA 4UFIA 5C7VA 3B8DA 1TJ1A 3C5QA 4M80A 1MSSA 5LA2A 5XIAA 1JRCA 3LM7A 4XBSA 1F61A 3ZVHB 4FP1A 4UQDA 3VDAA 1RY8A 1A5OC 1IEWA 1FWWA 1DJYA 4JIIX 4KH2A 1XYBA 1H1NA 3OGSA 1VYSX 2XISA 3KCJA 3K8MA 1ZAJA 1I2RA 2BOFX 4QBXA 5HNRA 1UJPA 1RBOB 2HROA 1E71M 3EA1A 3SN0A 1G7VA 4OT7A 2NWRA 4MPQA 3MUIA 3TQKA 1OX6A 2V3FA 1OF6A 2BVDA 1OABA 1I9CB 5I0DA 3MTWA 5M3WA 4X3ZA 1ME9A 5DY2A 5FAJA 4AHOA 3XINA 1R3TA 1XIBA 4GI9A 3GFZA 4XKMA 5LIYX 2YCLA 4C5ZA 4GI4A 1S2TA 2XH7A 1QOPA 2X0SA 3R7MA 4Q4QA 2TRSA 3A47A 1NQ6A 3T78A 4IQLA 3W6LA 3IGSA 1YEYA 1VYRA 4TO8A 3E3HA 3U2EA 4H6EA 1OJXA 1X38A 3I6TA 3I4EA 5D2XA 5DT5A 5C9RA 4TXEA 4XV0A 1RVKA 2OSXA 3EEGA 2R82A 3L0KA 4CNNA 5M1TA 2ACRA 1IEIA 3RK8A 4LYKA 4AD0A 3PTMA 2WSKA 3MW7A 3IUIA 1UMYA 4DWSC 4HU3A 2PODA 5U7SA 1W5QA 1OFEA 3G1XA 5KZ6A 2WPBA 1PTAA 4JY8A 3ZVHA 5FSDC 3H26A 2CHOA 3MV11 5I2UA 3P5YA 3WH5A 1EKOA 2XJ7A 1TPH1 3KM8A 4CQDA 5C9XA 1OY0A 3V0TA 1EDQA 3CIXA 1Q6EA 4HNOA 3UPBA 3PJXA 5H1WA 1XR2A 1J0YA 3TWAA 2W9MA 4KGLA 5I3GA 1G7UA 5EKYA 4XZBA 5CC6A 4QAWA 3OYXA 1WPCA 3THQA 3A4AA 2EHHA 2AGTA 2NT1A 3GH7A 4FLQA 4HMNA 3VZZA 3SQLA 3AHVA 3E49A 1XCWA 5EB8A 3QLDA 3LHTA 5A6SA 4AIUA 5HPCA 1KNWA 3FVMA 1VP5A 2X1UA 1Q6DA 1EOMA 2AKZA 4FNPA 1RA0A 3IJDA 1XIGA 1VEPA 1W9BM 3IEBA 3MV01 3W37A 4NRSA 4RPQA 4YHGA 4MDPA 2VWSA 1WXYA 4DVOA 1PZ2A 1TV5A 1DQUA 3IS4A 3WJWA 3KVMA 3SECA 3E2RA 3CQJA 3S1WA 4DJFC 4O1FA 3W1NA 3V0UA 2WAGA 7XIMA 2QCMA 1Q7MA 3BICA 4OJYA 4KEVA 4GQBA 4Q8NA 3WLTA 1BWLA 4NASA 4IQDA 2Y6ZA 3WD1A 3G1RA 4FXRA 4YCPA 3GXMA 1NWRA 3D3FA 4NX0A 1XIDA 3IIVA 2QAPA 4IOTA 6TIMA 1M41A 2HVNA 2FZDA 3UWWA 3W7PA 1HKVA 2YA1A 2QCNA 1CXFA 1PO9A 2E9BA 1UKTA 3EKGA 3SFWA 3FX4A 3OIHA 3SDOA 1LWJA 3LNMA 1LRNA 3LXBA 3TONA 2FPTA 2DV0A 3GO2A 2Z26A 3AC0A 1Q65A 4AX6A 1OX4B 4NYYA 1F8IA 1EA9C 2ZYFA 3B8TA 3UWUA 4LAOA 4GRSA 2I57A 1IT0A 4LUSA 3VD9A 1WZAA 1MQPA 1TX2A 3F03K 2ZICA 4GQGA 4OOUA 4JFUA 3HTWA 1V6XA 5HNNA 3UNDA 1WAUA 2ATMA 1R3YA 1E40A 2FTPA 2V5BA 3HQNA 2Z1SA 3NQ7A 2HBVA 3WK3A 4PULA 4AC1X 3CPUA 1F73A 1HVQA 3QR3A 1BYDA 4PSPA 2Y8UA 4E4PA 2XM2A 3R5EA 1A0DA 4HHHA 4UTJA 3D0CA 1H61A 1JZ7A 4E3VA 3MVIA 2WMHA 3DFTA 1TV7A 5AYZA 5CPSA 5IOBA 3HU7A 4JS3A 1XH0A 1XD1A 4HOZA 2R1KA 4FXFA 2Y2WA 1LQ0A 3CZJA 4I3GA 3ZYZA 2GUUA 1GG0A 2WO5A 2YDQA 3ARTA 1ZENA 4B5NA 1EO5A 4B5WA 3NSMA 1Z42A 2DZUA 2I9EA 1NSJA 4K38A 3W7EA 4LBUA 3M41A 2PA6A 2NUWA 4B91A 4H9MA 4MFEA 2G3MA 1L6FA 3RF9A 1JUEA 3T4WA 4CNTA 5EMUA 2OX1A 1KR0A 4DJED 2Q6ZA 1XG4A 1IWBA 3MU7A 5I02A 3EOLA 1OFAA 4EWND 1P0BA 3HG3A 4C7FA 2PRHA 1RY0A 2W91A 3OVPA 2RJHA 2BHYA 2NLYA 2PMQA 1OX4A 4BJHA 3JRKA 3QH2A 1TJPA 3N19B 3K4DA 3BH4A 5LXEA 1GONA 2VEIA 2P10A 2JF6A 2O9OA 4S3DA 4UOJA 3DN5A 4W84A 3MUXA 4A3RA 1UBPC 5A8MA 2FZMA 1HJVA 3T1GA 5TNVA 3F5JA 4JTDA 1M7JA 2UY5A 2V67A 1I75A 2QCEA 4JDBA 3MS8A 4LSBA 3UT0A 3MHUA 4ACZB 3EWUA 3GIPA 3W1QA 2VDIA 4C6PA 5I3DA 4GUGA 7TIMA 3WUEA 2DGAA 1GQIA 2EGZA 3VA8A 4CQBA 2X30A 4JL2A 2Y7GA 1CEOA 4GE8A 1NJJA 2ZWYA 3PN8A 3N6JA 1F4AA 2CHRA 2OMAA 3O1NA 2QGYA 2V3DA 3LUTA 4FOKA 4DUWA 3UR2A 2HRWA 1OFOA 4LNCA 1MUWA 5CJ5A 4AWTA 4WF7A 1PCKA 1GVOA 4MJ4A 3CUIA 2DZVA 1C9DA 2F38A 3O6AA 3PULA 3CAKA 1PYMA 1P0DA 3NPWA 3C8FA 3B40A 2YZRA 5DMYA 4PUUA 3MQTA 4ZSUA 2XVNA 3KVJA 1OG6A 3LK6A 3TJIA 1BFNA 3I3DA 3PBMA 3REQB 2PD9A 4LRSA 3W23A 4CNOA 4MYXA 4OTKA 1N8IA 4QIUA 5G4HC 5CBJA 4HP5A 5DRCA 1ZQ5A 1ZZMA 4HHMA 3W0KA 3L9CA 4M0XA 1H7NA 1HW6A 3WQGA 2J9YA 4MLJA 3RU6A 1J93A 2DY3A 3L4TA 4O53A 3CLWA 4DNHA 4PUEA 4QG9A 1NIUA 3TYEA 1S3HA 1VIZA 5EMJA 4GVHA 3H12A 3OGRA 2GUBA 2YCIX 1X97A 3MPGA 2X2YA 3C2FA 2J4GA 4ACZA 5JBFA 3VIJA 4UFHA 3TOYA 3WUFA 1J11A 2OGYA 1K7FA 4XAFA 4QE4A 5BXPA 2CLHA 3KTSA 3ZT5A 3Q37A 1OCJA 5HUPA 3CV7A 4V28A 1B3XA 1XFBA 1TCMA 1G4TA 1TRDA 2NXHA 2FTYA 2CFFA 3KOYA 1XH1A 1BLIA 2X0YA 4AWUA 4AF0B 3QMTA 4I9AA 3FYOA 3NUKA 4AD4A 2VDHA 3NO1A 4N0RA 4C6QA 5CEWA 4CQAA 1BQGA 1NF7A 2WANA 2WVTA 3C6CA 1MNSA 2WC7A 4F40A 2WNWA 4ZO7A 3AMCA 1J0JA 3KTCA 2H8XA 3T8QA 2Y85A 4KW2A 4RNIA 3MP4A 1H7PA 3VOIA 2GJRA 5DEZA 3N6QA 2F6KA 4LJ3A 2RDXA 1ZAHA 2QCDB 2D0GA 1M7OA 4PBGA 5CXPA 3BL3A 2FIQA 2WM0A 4L7ZA 2OT0A 3NOEA 4UR7A 2D2HA 5FSEC 2OXNA 3A23A 3PPGA 4GXWA 4MAZA 5DMLA 4IMCA 5CLTA 3WJSA 5HQLA 4XKYB 2J47A 2ZXBA 3PZTA 5DT7A 4MY8A 1T99A 4RDZA 4UUIA 2OLHA 3REQA 4AIBA 1LG2A 4U10A 3U7VA 4JIRA 2P88A 1JCLA 4MVAA 1W1ZA 2VEMA 4MWAC 3SEPA 4AHQA 1V7YA 2V0TA 5IHSA 5C8BB 2PDQA 3SM0A 2O0TA 4W8AA 4R34A 1LQ2A 5CSRA 8RUCA 2VRJA 2HJPA 4JCMA 4G7FA 3LA4A 5EMLA 4LY8A 4D8AA 5BMXA 4Y9AA 1XYCA 4DO6A 3WN6A 4C6FA 3VD3A 1B54A 1Z8AA 1K03A 4AUBA 1HIZA 3GU2A 3I6EA 1WCGA 1CBGA 2ZX7A 1YIXA 3HPFA 4GI8A 1ZB5A 2NSXA 5F1UA 4AW7A 1HJQA 2AGKA 1ADSA 4QAIA 3ME3A 1ZALA 5E6ZA 3HMCA 3URAA 4XX6A 1C90A 5LHEA 3GR4A 1PBGA 3MVTA 2Y4SA 1H60A 1UJQA 5CJNA 5T9BG 4AF0A 2XGZA 4ADUA 2BBFA 3S2JA 3G0XA 4E4UA 3BV4A 2BY2A 3DCPA 4HA4A 3TW6A 3G77A 3EOUA 3N25A 3ARVA 1UKSA 2QKFA 3TFCA 1W3JA 4GKLA 1BVWA 1YNYA 3S2LA 2QCDA 5AECA 3OZPA 3P81A 4JTJA 4LC6A 3AJ7A 2Z00A 1W37A 4NG3A 4XKYA 3VMPA 5FJIA 5LNUA 1EJUC 4OUIA 1GG1A 1OGSA 2FVMA 2HCVA 1SYTA 4MFDA 4IMAA 4TVDA 2ZUVA 1IF2A 4C60A 2P1FA 2QCFA 4QDWA 3WJZA 1V02A 2HZGA 3G1AA 3RLGA 3L5MA 5FJUA 3OP2A 4B5SA 2XSXA 2A5HA 3LXCA 5I77A 5D9OA 1TVNA 4NUWA 2WCGA 4HMDA 2D22A 4CLMA 3MP3A 4P8XA 3ZLGA 2C14A 2CYGA 1MQRA 4QS6A 1IEXA 2FH8A 1BVZA 3GVRA 1POJA 2YDAA 4LRTA 3GW3A 1QUMA 3LPFA 5K4ZA 5EY5A 4MNMA 1ISVA 5DXXA 3BLFA 1XLJA 3SIMA 4IIDA 1XBZA 1DJQA 1S5MA 4HYRA 2R91A 1BHGA 4GZIA 2ZUUA 3QPEA 2WSQA 3FNDA 1AG1O 3T2PA 4IL2A 5C70A 3L7RA 3KBJA 3BSHA 3BDKA 3W7OA 1NH6A 3UZZA 2EG6A 4Z17A 4WLCA 1BYCA 4H9UA 1LROA 1XWYA 2CIPA 4Q4KA 1M3UA 3DX5A 3O6CA 1BKSA 4QROA 4O0QA 3ABSA 1LOQA 4HHLA 4XZMX 3EX1A 2GJXB 3FA3A 1T40A 3NPUA 3CHCA 8TIMA 1TZ9A 1FWSA 1U1HA 3O2LA 5F4SA 1EB3A 4IICA 2QJHA 3UXAA 2PC4A 2WSRA 3W22A 5BOEA 3E2SA 3QW3A 3KBSA 1CYGA 4PMJA 3VX0A 1UCWA 3GTHA 3S4TA 3NQ8A 1VHCA 1CXEA 1R30A 3AXHA 3A21A 1VPYA 3ATYA 1B3WA 4LW7A 3TYUA 5F4WA 3S0CA 1EP1A 1KRBC 4GC4A 3NL5A 4V15A 1WUEA 5GVJA 2REQB 3GVWA 5CBIA 1F07A 3QOMA 4RV3A 3W7NA 5FD0A 3WFLA 3O05A 3WQOA 3KHJA 1ECQA 1U1UA 4LU0A 2HISA 4ZQMA 1O1HA 2BY1A 5E0KA 4A3QA 3P84A 1Q5MA 4ORMA 3WL0A 3T8LA 4PB4A 4AEOA 2JFEX 3WUGA 3THAA 1GK8A 1P6BA 4L4PA 2H6RA 3UJEA 3DZ1A 4GVFA 2O56A 4R85A 1J12A 1FRBA 2HE5A 3NG3A 2EBNA 1I2PA 2DPEA 4QRNA 5DANA 2VNCA 4PL2A 1ONEA 3WY1A 2YGYA 3K5XA 3FKRA 4QJ1A 4CU8A 2NSOA 4Y7EA 4F8XA 4ZGYA 4LBSA 4LY4A 3CEPA 1NQKA 2C91A 3UA3A 1KWGA 2BXVA 2GJXA 3USBA 3F5LA 4MZYA 3J7HA 1VJSA 1W1A1 2VWTA 2PF8A 3GFYA 1U83A 3GHSA 4B5VA 1X6NA 1ZPTA 3N4AA 4IPIA 3WLIA 3SADA 1VFMA 2P76A 3OZMA 3WD0A 4PMYA 1UBSA 2BG5A 1NWSA 2DZAA 3LPGA 3QW4B 4D6JA 1L8PA 1G5AA 3PTQA 1BEUA 3IJLA 3AMGA 4J35A 3PAOA 3PG8A 1XSKA 1KWKA 2VMFA 4UMCA 3MUY1 3DHFA 2GVJA 2CXGA 1QJWA 4NZ4A 1PKNA 4D8LA 2JKPA 3M0MA 1TV3A 2HK0A 5AYBA 4B16A 2FH6A 1EBGA 1GQJA 1Q6OA 1EHAA 2QR6A 5I23A 5CGMA 5DN1A 3CUFA 3SI9A 1PCWA 1FHVA 4PTMA 2DIJA 1S46A 2PWGA 4GIEA 3LU2A 3FGCB 3O7UA 5A8PA 2JALA 2PDHA 2Y5EA 3K30A 2PDFA 4NJGA 4O1EA 3W7LA 5A6BD 1XSIA 2GDUA 5HJYA 4EXQA 2YXGA 2Q8LA 4M6QA 3WFAA 5SWUA 4QS5A 4TQTA 3W7MA 2RUSA 5HMEA 2QT3A 3CASA 1TWZA 4G6CA 4LTSA 2OT1A 4H83A 1LL7A 1A5BA 2ZA1A 2E68A 1W9DM 2XPKA 4HA3A 1BXBA 2AAAA 2OU4A 1NTHA 1U22A 2LLEA 4AXKA 4XZWA 4YYFA 1OG0A 3VYLA 4RLIA 3TK7A 3W2UA 1BGAA 5A8NA 3FAXA 5TBOA 2PS2A 3TQPA 1YYAA 3ZVIA 3VTRA 2Q02A 3APGA 1TUXA 1SZRA 1JCXA 4PTDA 1YNQA 4QJ5B 1P5BA 1QHZA 2WCSA 3M5XA 1K4GA 3CMGA 4P8WA 1YE4A 2WBKA 3WEMA 1UWRA 3TQ0A 3L0NA 4MPKA 1JCNA 3IJIA 4QCFA 4YS1A 1QBBA 4K8EA 1L6GA 2QZRA 5TQLA 1OB0A 4HOXA 1QK0A 2DT2A 1PDZA 4FIQA 4XIMA 2OG9A 2BB0A 2XIOA 4BQ5A 3SCNA 3TSMA 4MSSA 3KRSA 1ZS2A 1B9ZA 1SQ7A 2BHZA 2O7QA 3K8KA 4CQCA 1SZFA 3VD5A 2XSBA 1JCMP 5IFPA 4NSBA 3SY8A 1I2QA 3L4VA 2WCAA 4AZIA 1E0TA 1WNOA 4PCSA 1W3LA 4O17A 1W91A 3S8HA 3K1DA 4I7UA 1T41A 3FGCA 2TPSA 3L23A 2QW5A 3MSYA 3FKKA 1DJHA 2PBGA 3KRUA 1ODUA 4M3PA 1ZNNA 4QE5A 1E0WA 1I1WA 3B0XA 4CCDA 3CGTA 4Q4MA 2P8BA 3MZ2A 2WK2A 3WQ8A 2ZA3A 4LYQA 2FYMA 4FX6M 3RPMA 1DEDA 4YPJA 1G69A 3II1A 1N7KA 5FA5A 4MDOA 4AD1A 3HV8A 1XC4A 2D2GA 1C9WA 2QCLA 2DVTA 1VFUA 2EKCA 4GH1A 1Z7AA 3S5ZA 4GCXA 2D69A 1PUDA 3F2DA 4DO4A 2BOGX 3XIMA 3I7RA 4GIRA 2PDMA 1S38A 2W0UA 4IPJA 1W3NA 1FWDC 1TPB1 1LZOA 1UD2A 4DM2A 2ICSA 4JTLA 5EYWA 1O1ZA 2CBVA 3AUOA 1RK6A 1QI5A 1MVYA 4HJWA 2ZOXA 4MNLA 4TV6A 2Z27A 4O0KA 5E09A 5FEZA 3R58A 4D6EA 1E9YB 4QG8A 3ITXA 2GFTA 1PX8A 1XISA 3PNZA 1D9EA 3AIUA 5HNTA 1GWJA 4J3ZA 4Q22A 1A5LC 1HJUA 2E6DA 3M47A 5E70A 3HFTA 1T96A 2XSAA 3MSRA 2QS8A 1V3KA 1HP5A 1OHLA 4DNMA 3QZEA 2EPKX 3DAQA 4FF5A 4DZIA 2E6FA 2YBTA 3PJWA 2BP1A 2J7DA 2WZEA 3SCRA 3NDOA 5CZTA 5I3HA 3UWZA 4PEKA 4EE9A 1BXCA 2X1SA 1AW1A 4KGJA 5FJOA 2WMJA 3IK2A 4YTTA 4MM1A 3V16A 2WJZA 5JUVA 3UR5A 3B3DA 1PJ9A 4RKAA 2WQDA 4JKLA 5A6KA 3C0LA 4QEHA 3VNKA 1KXHA 5HQEA 3QHNA 4KWSA 4HVXA 1DPMA 2VO5A 2B7OA 3QC3A 2EPOA 1F3TA 1Y5XA 1WKYA 3OEXA 1DKWA 2RDUA 4PN2A 1IIHA 1A5AA 1MW3A 2D2JA 1Q45A 1NP2A 4Y6GA 3T4CA 1GJUA 4GH3A 1RQHA 1C3FA 4MIMA 1RALA 2YW3A 1R46A 1CI1A 3BOLA 2ZRYA 3RCNA 4PODA 3VKCA 4R27A 1EJWC 2X42A 2INFA 4YJ5A 3SGUA 4H8NA 3HMJG 3OYZA 1EP3A 4LX4A 1OYBA 4XZIA 1FHLA 4LQ1A 3L4UA 4HCLA 3UWQA 4DBDA 1TR1A 1THFD 2VQUA 3LS9A 3L2LA 1VHNA 3VUPA 3LERA 4GJIA 3BLOA 4GG9A 3LX9A 2VDGA 4PGLA 1VBGA 5I3FA 1WDSA 5G1MA 4ERGA 4E38A 1AL7A 1JF6A 1WX0A 2Z1KA 1VBJA 4XAYA 4DYJA 4IIFA 1SGJA 2F6UA 4M24A 3MC5A 5KZEA 2Y8KA 1NDYA 4PMXA 3M44A 3AWOA 2J74A 3VNMA 3TTQA 4DLMA 3GC2A 1GUVA 4IJBA 1HG3A 4IMDA 2NQ5A 3C61A 3RG6A 4E3TA 4J2PA 3UZXA 5JH2A 3QTPA 5CAHA 1T5AA 1P6WA 3WLRA 1QPRA 3I6RA 3W07A 1W2VA 2A3AA 1JI2A 2KAUC 5A94A 4A4AA 1HP4A 2QCGA 4CEXC 2ACQA 2WYSA 2Z0IA 1POKA 1FWAC 3ITGA 1N55A 2PUZA 3G8EA 2QDHA 4ZODA 2VVNA 4GJ1A 4FF7A 1O5KA 4GIAA 4LAZA 3DYMA 3DFHA 1AMKA 3W01A 1V5XA 1IGWA 2I5IA 3GXPA 3NL2A 5T9CE 4Z2LA 4QGCA 1DQWA 2ZRUA 1WO2A 3R79A 5CSSA 4JTCA 4LF1A 1ZBKA 5TF0A 3G1SA 1YTEA 3M0LA 1AZ2A 3O16A 2VX6A 3N18A 5CZJA 5U4NA 4CNUA 2VFIA 4JR5A 1B2YA 3ZWTA 4ZOEA 3TW7A 3F4CA 4MLRA 2FGZA 4CEUC 1P48A 1F2JA 3TKFA 3KAOA 3DHPA 2H8ZA 5A6AA 2XFYA 3UJSA 4UBPC 1F7BA 2XVPA 1B0IA 2W63A 1DWAM 1F5ZA 4ZFCA 3W75A 5HQMA 3C8NA 1KKRA 3T05A 4OBSA 4IGNA 1JDAA 4QE1A 3TWBA 4PUDA 1Z9AA 1DWIM 3RX2A 3LCXA 4HD5A 2OEKA 3ES8A 4J3UA 3CZKA 5DF0A 2R14A 3B8SA 4RNHA 4DAFA 5EGRA 1UC4A 3VFLA 3FDKA 4W86A 3H24A 1ONXA 3B4YA 1H5YA 5BNKA 4TMCA 1TMHA 2PFHA 3VIMA 1UZHA 2FGLA 1JYNA 4Q8TA 1BF6A 1IR2A 4IGHA 4NHVA 2P0OA 3OW1A 3B0UX 2OZTA 3WBEA 3URBA 4EP8C 4LWWA 2DUXA 4GCAA 5HJXA 3ZJKA 3DGRA 2B4GA 4EF8A 4XO7A 3CUGA 4PTNA 1KTCA 5AB3A 5C54A 2V2DA 3TN6A 3R6IA 3I3EA 1RQEA 1JCTA 1G94A 1YDVA 3B06A 3DG3A 4TUFA 2JBMA 4R9XA 1FHDA 3D5HA 3QF0A 1GQNA 1GOWA 2A7RA 1UP3A 1H5VA 4IIEA 3WDHA 1HTIA 1XLKA 5IDZA 3CZ8A 3HG4A 1AODA 1AD1A 1BGGA 3QMRA 3MT1A 4H19A 3PWIA 2VOMA 4GINA 3FV9A 2FFIA 1F6YA 1B90A 2F8QA 7REQB 4DJDC 2CZFA 3PTKA 3TYCA 1R9ZA 3FCPA 3RO8A 4DZ5A 1OZQA 3D46A 1KRMA 3SIZA 1V4YA 4RUBA 1SM9A 2A6NA 4QLLA 4XB3A 3UEQA 1ME7A 2YZ5A 3UYIA 3VC6A 1QVBA 5LZLA 1RLCL 2CERA 2KZHA 3TR2A 4Q4RA 1RUSA 2R1NA 1HJWA 3TN4A 3RRAA 4LT9A 2E0PA 3GB6A 1US3A 4Y2WA 1VFOA 2VD8A 1GZGA 4GYKA 5ENLA 2BODX 3FAWA 4C6CA 1OFDA 2O4QA 1T8QA 2OSYA 3UCCA 3NQ6A 4CGTA 1G01A 3ZSSA 2RAGA 5HMFA 5HINA 1KM3A 4ORIA 4YMZA 1W1TA 3WLPA 1DWFM 1WYIA 3VIGA 4LUYA 4US5D 3S5SA 4AHPA 4BS0A 3G0SA 4AC7C 4UTHA 4YWIA 1W32A 2CLOA 1D3HA 1A3HA 1C91A 4H00A 3WLKX 4HPJA 2ODOA 3ATZA 1BF2A 3D6NA 3QGVA 3L67A 1Z48A 2X1IA 1R85A 2D73A 3O0KA 1JZ5A 3IVSA 4J3XA 1G0CA 2DDXA 3ITTA 1R2TA 4KPLA 3ZSTA 4LAUA 3HOJA 3M6DA 3AZRA 2CZEA 2V3EA 2QHAA 3CHVA 2E1DA 4GYFA 4RZBA 3W53A 2VKZG 3TC3A 3S2CA 3KTXA 3GVVA 7REQA 5FEPA 5A6BA 2VD9A 4IPNB 1WDPA 2QPUA 4OFCA 2WW5A 1MDLA 2HSAA 4P7NA 4LNYA 1AW5A 3G1VA 4A2RA 1IR1A 1FWFC 3ZJ6A 4CU6A 5T26A 1DYSA 2FZ8A 2NZLA 2CKRA 4LC8A 3TJ4A 1E43A 2XFRA 3M0IA 1AQMA 3UF9A 3ONBA 3RCYA 2QUTA 3DBNA 3RM4A 1GOIA 4F9DA 1DORA 4PH6A 1FUYA 1LYXA 2HQAA 2J8TA 3OLGA 4AZ7A 3QY7A 2OEMA 3ZR6A 4MAVA 3ANVA 1YKWA 2G4FA 3ZOAA 1ZBWA 4N4PA 4URIA 1CECA 3T0CA 1R86A 3M64A 2OGJA 4J2MA 2ISSA 3TCEA 3GH5A 3PM6A 4ZE4A 1PKLA 1JEZA 4D6IA 4K37A 2VFFA 1UUMA 1JG9A 1XLEA 1JR1A 4DUOA 3EWCA 1JQXA 4WY0B 2VT0A 2CLPA 4AXNA 2R9RA 1HL8A 1K77A 2BZNA 3QHMA 3E0IA 2J7GA 3VX1A 2GQ3A 5M5DA 3FK4A 4S3GA 1H62A 2IQTA 2NVAA 3EMQA 3T0AA 1MEHA 3BPWA 1PB0A 1CIUA 2GSEA 1FFRA 2HNHA 2AQOA 4GO9A 3HPSA 2QV4A 2DFAA 2ACUA 2XWEA 3IIOA 3H2CA 4QP0A 3MKCA 2G8ZA 1ISWA 3OGVA 9XIMA 4O14A 4PBFA 5BW6A 3WDPP 3WO8A 4DJEC 3UPMA 2ALRA 1XYLA 4OV9A 5KSWA 4IIGA 2D24A 3TUUA 3W87A 4DELA 4YLWA 2VX7A 3V35A 4LYPA 5EMYA 2NQZA 4F4RA 3LPPA 4L61A 4HK7A 4HNNA 1I2OA 2UY2A 4JD4A 4PCTA 4YN5A 4PR4A 1CLXA 4AFYA 5LGXA 3WFZA 3SGGA 4PCFA 1XV8A 1UYQA 1XHGA 4Z2HA 3WF2A 3TSDA 4N9CA 4UTKA 3RM8A 2G3IA 4FO4A 1Q6FA 1RVGA 1GYLA 3UETA 2AMXA 3WEOA 3KOXA 4L5ZA 1A5SA 5LGZA 3EWZA 4C6MA 3KXQA 4Z1DA 4NZ1A 4WOQA 2YW4A 4Y9MA 1CGTA 2ZX8A 2GLKA 3TMLA 2Z6JA 1XG3A 4WY0A 3LV5A 4BF5A 4HU0A 2ZTJA 3URQA 2YFOA 2VX4A 4AZCB 1AUSL 2EPLX 1X7FA 4LAKA 5A95A 5C9WA 3PPHA 4IGSA 2PRMA 2WHMA 4AEFA 3OA3A 4XSMA 3LNPA 3E0WA 2X1RA 1OSEA 5E5CA 3WYZA 1R3RA 3MO4A 1XICA 5A2CA 2DH2A 1GHRA 4HU8A 2JIWA 3GRIA 5EMKA 1LUCA 1UWTA 3Q4DA 1D3CA 3WQ6A 1EC8A 1OM0A 3TXZA 4ONVA 5FOOA 3C2OA 4LEQA 4PL1A 5A6JA 2IPFA 5D9MA 4B2DA 1P7TB 2J62A 5BU9A 5M17A 4PA8A 1X1OA 3NZ1A 4U31A 1WOBA 3EMZA 2QMJA 3KE0A 4GUJA 4W5ZA 1RP9A 2NVDA 1IXOA 2O7SA 3WQFA 3W2LA 1B4EA 3DFQA 3BAYA 4K39A 2VCBA 4O13A 4DO7A 3WNPA 3GYEA 3VIOA 1E9ZB 1VBUA 3BAJA 3P3BA 2BDQA 2PDKA 4PRRA 4G56A 1H4PA 2WWCA 3DEQA 4Q4OA 4LB3A 5H91A 1GZJA 4D8ZA 4QEEA 1EUNA 5AKQA 4Q8VA 4NNAA 4A6GA 2HPIA 5BXSA 1EDGA 3RXZA 3CJPA 3S1XA 2WLYA 1AMYA 1XX1A 4B5UA 1CGUA 1TWWA 1WKDA 4AY8A 3W1AA 5ECVA 4E2DA 3OBEA 4C6IA 3UG3A 2ZC1A 3VNZA 3W7GA 2V9DA 4UQAA 4I9MA 3CUJA 4D6FA 4XIAA 1V8EA 3V1PA 1AJZA 4NI8A 3PZ9A 1A4MA 1FXQA 5LIXX 3B0YA 5HULA 3TEVA 1C29A 1PZ3A 5EFFA 1MYRA 1DIDA 3VNDA 3EB2A 3QBUA 3NJ3A 1VEOA 3MCMA 1FWHC 4FOJA 4IT1A 4AZCA 2R1PA 1W56A 2CESA 3KLLA 1ZSXA 7CGTA 1KGWA 4NU7A 1E1CB 1UUOA 3F4DA 3HGJA 3W7HA 1L2QA 1XYFA 2DIEA 4WEVX 4M1RA 5LKYA 3VXGA 3FYPA 5HJLA 4GGBA 4GABA 2GZXA 3NEVA 4PMRA 1QASA 5D05A 3N14A 2XUCA 5LHFA 5HUOA 4EPEC 4IGMA 1PZ1A 5HR7A 3P6LA 4JIEA 2P50A 1XS2A 3SUWA 2VRQA 1EOKA 1XJBA 2Z24A 1KLYA 3QR0A 4C1NA 2J78A 4ZEPA 2DT1A 4UTWC 2ZZ5A 3RR4A 4Q8MA 2CLKA 3M16A 2QULA 3UWVA 1JNDA 4DRSA 3N2MA 2Z1BA 1FX6A 1DOSA 2OTDA 5DELA 4I5RA 1S5NA 1K9EA 4TX9A 1RLDA 3ZXWA 4AYSA 4L1XA 3OPSA 1S1PA 2WBGA 1C92A 2VYOA 2CBJA 3LI0A 1GCYA 1LTDA 3CYJA 1DL3A 3ARWA 5FAGA 3HJEA 4LVDA 4YHEA 3IIPA 4IJCA 1O5RA 4L56A 4LUTB 2EAWA 1XIHA 1P1XA 4W8BA 2QDDA 4U2YA 2JKAA 3TOPA 7ENLA 2G37A 5CPLA 4WIWA 3OODA 3QHOA 3QKEA 4ZXOA 5I3JA 3RM9A 1IT8A 3IV8A 3HQ1A 3GDMA 3JU2A 4UTIA 2RFGA 1UWSA 1WE5A 1SZEA 3OA5A 3LCFA 1E3XA 1S2VA 1VGAA 4NXKA 2BWGA 7A3HA 5M2FX 2Z2AA 5HXMA 4HOWA 1SJAA 2GQAA 3AS1A 1RPKA 3ZLHA 3H6OA 1TPFA 5D8ZA 3ABOA 5LXXA 1KFJA 3MYPA 4CNSA 4F79A 3TYAA 5BOOA 4Y9NA 5C9UA 3O3RA 4JXCA 2DIKA 2XZ9A 2Y61A 4A3HA 2O9PA 3W1MA 1OWQA 1L0PA 3NDZA 4FX7A 3MUZ1 1ZUAX 3LV6A 4ADSA 1UPPA 3W24A 3WX7A 1ZHAA 4RPPA 1OT2A 5D9PA 4UFLA 3NQMA 3C3NA 2JQXA 4IJRA 3S83A 4FZIA 4JX5A 4B5XA 1DE5A 3HZ3A 4FX8A 3WBXA 2E4TA 3FEMA 1UQZA 4BY3A 1UR0A 3RMEA 4EVZA 1JUBA 1SJBA 4RW5A 2PI6A 2X1TA 1QI3A 2C15A 4Z1YA 3E1F1 1OQFA 4GOAA 3IANA 3VUSA 4LUTA 1HKJA 5AVHA 2AL1A 1U5HA 3TLLA 3GDRA 1GQKA 3PWGA 1W8GA 4P2VA 1GZ1A 4O12A 4GGHA 4C6KA 3SQMA 3WMCA 1C7SA 3GIYA 2PCEA 4HHPA 1XW8A 3WH9A 5AZ1A 1XBXA 3H8AA 3DUGA 2A6LA 4IX2A 4GZJA 3QQ1A 3V18A 1K3UA 3WLJA 4MB4A 1BYBA 1HQTA 5KTLA 4FK9A 4FNTA 5LA1A 4V27A 5CH9A 1J0HA 4O18A 2BS9A 5AYYA 1PHQA 4GVGA 1J0KA 3LCLA 4I9JA 4WVXA 3KOWA 3CL7A 3ZR5A 3UR8A 5A6LA 4LVFA 1R38A 3RX4A 1V0NA 1AL8A 1IT7A 2V81A 3VDHA 1L8NA 1Q85A 1KCXA 4U28A 5K7JA 3M7SA 4Z42C 3IAQA 3QV8A 3W81A 4ENLA 2BY0A 1ME8A 3SFKA 1MUMA 2VC9A 4F2UA 4WXZA 2ZVRA 4F66A 2IXUA 3R0KA 2WLZA 3QSTA 4S3EA 1Y7VA 3R43A 3W29A 3NQEA 2DSKA 3QR1A 4P61A 1H7RA 5GJMA 4H6RA 1HO4A 3VU2A 3I65A 2DZSA 6ALDA 1NOFA 2XIQA 5MHBA 3CQ0A 1TQXA 3AXKA 3AIWA 3N3MA 3OVQA 4C91A 3TA9A 4GNJA 3AYSA 1JYXA 3LTSA 1E9LA 1QPKA 1A5CA 4U4MA 4Z2KA 4WY0F 2E5BA 1Y8BA 1K8YA 1Q63A 2FHBA 5F2MA 5A8GA 3PR2A 3W72A 2Y7DA 4L65A 5EPDA 5K9CA 3U6WA 3RAOA 1IV8A 1E15A 4IUOA 3ERPA 3TFXA 4KEZA 4FALA 1TPVA 1XD0A 4H2HA 3PWAA 4PFMA 3VPLA 3W71A 2QQ6A 1XCFA 4M1BA 3SCVA 4S2BA 3GDLA 4LEFA 3PZVA 2XVGA 3DKJA 1PYFA 1PS9A 3AUJA 4J28A 2CHNA 3VNIA 1UG6A 5DBTA 3F5KA 2CPUA 5AC6A 3WLMA 4YU1A 4NP7A 4K2SA 3BOXA 4HYWA 4ZCWA 2FMNA 2XN0A 1VBRA 4C6OA 2DH3A 1LP6A 1QI4A 2GVEA 4HT3A 3LD5A 1OEPA 2XINA 3ISIX 4W8LA 3GKAA 1G4EA 3DI0A 4UNLA 3BVJA 1FOBA 4P7LA 2FPYA 4MHBA 1KM6A 1JL8A 3BTNA 2ISVA 1F8MA 1ICPA 5K9DA 1ZY9A 3KZSA 3HN3A 4NZ5A 1TZZA 2VC7A 2CWNA 4MY9A 3GY1A 1TTQA 3P8JA 2C8NA 1TFVA 2V2CA 4IIHA 1ZP3A 1PKMA 4NRRA 3EPOA 2PCQA 2XIJA 4JTHA 4PUNA 2D0FA 2E8YA 4DXVA 4EANA 3PUOA 2XM1A 1FBAA 1FDJA 5F2GA 4JQ4A 1K4HA 1H41A 1VB9A 3RU8X 2NWSA 1YXDA 4KETA 3F2BA 3L4YA 1GPWA 3FN9A 3TAOA 4UTUA 1XLGA 4MKVA 1Q6RA 3WNKA 3VNLA 3TYBA 2GGJA 3LXAA 4PB5A 1H50A 3AJXA 1JCYA 2XN1A 3PZQA 2O55A 4JN8A 1XIEA 3O0FA 5E1QA 5AHNA 4FR1A 3LYEA 1HX0A 5BRBA 2J7CA 1JULA 2A3CA 3FA4A 2E40A 2A79A 3QRHA 4GYPC 2DEPA 4WZHA 3BK0A 2TYSA 5K3VA 4QXIA 2OELA 3YPIA 3EYPA 1W5MA 3W7QA 4HZ7A 2ZADA 1PX4A 4ROPA 1QW9A 4FEZA 4JKMA 3TVAA 4MGGA 4QCEA 3H2MA 3G0UA 4L4MA 2XIMA 4LB4A 3SB0A 5FCZA 4XAGA 9RUBA 1E1FA 3TC6A 1KBLA 3C2EA 3A3XA 1B31A 1ELSA 5I78A 4U3AA 5I3KA 3WSUA 5AHLA 2E09A 1UHVA 3H23A 1LRQA 2VZOA 3VGFA 4WSHA 1RD6A 3AAMA 4G9PA 4GQ0A 1W3IA 1UASA 3VINA 4BQ2A 4LS2A 3BSGA 1V6TA 4O1AA 3N4EA 1RK5A 3G1HA 3M5ZA 5IBXA 5CJMA 1EX1A 1FKXA 3H22A 3ARQA 3KCLA 5CPOA 1A80A 2TODA 3NQBA 3OLDA 3MCOA 2CC0A 1PV8A 2YDSA 2ZX5A 2C0AA 2F2HA 3KHDA 1C8XA 3VGHA 3N2BA 1S2UA 4Y8FA 5CG7A 1NDVA 5ECUA 2O92A 2GUYA 3BWWA 3QTGA 4HA0A 3MI2A 5A6TC 2OB3A 2VQTA 3IAPA 3C2VA 3W83A 3N73A 3CIWA 3JVAA 3UY7A 4JIHA 8XIMA 3CWNA 1R7OA 1V08A 1I60A 1KW1A 1HVXA 1UZ4A 3S47A 3UWYA 4D6GA 2ACSA 2A3EA 4NJKA 3HGRA 4O52A 1VFLA 1XQLA 1YXCA 1OFQA 4ZFMA 2Z2UA 3MWCA 1ODZA 2YCLB 3GXIA 3T0BA 3UJFA 4X0NA 3ITYA 1I1XA 3R8HA 1N8WA 1CGYA 3QOKA 4M6UA 2JF7A 3M1ZA 3BAWA 4DIAA 3R8RA 4JNYA 1UMLA 2VGBA 2ZUMA 3KDOA 1CXLA 1FVPA 1TWIA 3CV6A 1SMDA 2Z4GA 4LGXA 4UMBA 1AK5A 1U30A 3TZFA 1DXIA 1E0VA 4KMQA 1HKKA 4Z2IA 3IVUA 2ZZ7A 3SO7A 4LUJA 1RPXA 1YPXA 4GQRA 3V36A 4NZ3A 3NXLA 4P8VA 4R7JA 1EWDA 1FCUA 4REQA 3AHYA 4RX0A 4AMAA 1OADA 1ZLPA 2ZWZA 4EACA 4GJJA 4KFNA 3BXWA 2VR5A 4AB4A 3WMBA 2NXGA 2GK1B 1E70M 1NP0A 4AY1A 5C2CA 3VGEA 2CNCA 1NELA 2C0HA 3VE9A 3PZUA 2HXTA 5HAOA 1WKFA 4GNKB 3DHUA 5B80A 1NOUA 1C8YA 1KM5A 4JTUA 1Q8AA 1H09A 3T0DA 3GG8A 5EA9A 4ATDA 3NR0A 1AW2A 1B5TA 1CLVA 2XH0A 3H2AA 5I07A 2YL8A 4IX0A 4GVIA 1ISXA 2G3FA 1EHNA 4TMBA 3W6YA 4WJXA 3WEZA 1RHCA 3B9EA 2I17A 3FY1A 1GVRA 2ZTKA 4KQNA 1ADDA 4BWLC 1KBKA 1CX9A 3T6CA 3WJYA 1WB0A 3Q58A 1ZCOA 3EPMA 9CGTA 2YX0A 3QLLA 1J5TA 4HPHA 3C0JA 2D20A 1UP2A 1DV7A 4S2CA 1C8QA 2QUMA 3M46A 2WKJA 3BAKA 4CD8A 1V02E 4DX3A 3WKZA 3RJXA 3PNUA 1E55A 3LCIA 1IQ8A 1ZGDA 3WENA 4XZNX 2HMCA 2ZXDA 1KTBA 3GXNA 1ZCCA 3EB4A 5ABFB 4CQ8A 4FHAA 4R53A 3R0UA 3GAKA 3FIGA 2DZBA 3DYPA 4DXXA 4AG0A 5I09A 1CB2A 4NZJA 3AI0A 4S3JA 4KCWA 5GNZA 1AH0A 4AWSA 1XLAA 2ABAA 4WSJA 1UR2A 2IW0A 4GIYA 4DBUA 4AAJA 4EAYA 1F3XA 4K1WA 2GK1A 3UCQA 1DJGA 5MF5A 1WZLA 4UZSA 3MDUA 3CT2A 2WM1A 4C90A 2FZNA 3RGTA 1A53A 1E5JA 1KQYA 4RZ4A 1CLKA 1JZ2A 3KWSA 4WSKA 3QVQA 4LCQA 4W9TA 4O19A 4TX6A 4LUSB 4XO6A 3CTTA 3WNNA 4WDXA 1EIBA 3V0SA 3PZOA 4A35A 2CU0A 3LEPA 4KCVA 2F61A 5D4YA 3PZMA 5LSMA 5LNSA 2CETA 2UBPC 3CL6A 1SPQA 3MKKA 4RE2A 1GOMA 4OU1A 4M5PA 2YBUA 2RDWA 2VUYA 2UZ9A 3EXSA 3MYOA 1VBHA 1R87A 1TPUA 4LH8A 4LANA 3S1GA 1WP6A 3GR8A 4A8LA 3NGJA 4C1KA 4DHGA 3HB9A 3BCFA 4UWMA 3NZGA 4HSOA 3AMDA 4ICNA 1SW3A 4AWEA 3MKVA 2PDJA 4D71A 3FJLA 4JL1A 3H4GA 1FCQA 4LF2A 4I7VA 1SUXA 2XH4A 4IF2A 3T2OA 3WG6A 1HZYA 2X7VA 1F6PA 3CAQA 1J5SA 1GEHA 1LM1A 3GG7A 1KKOA 1H0IA 2H9AB 5ABFA 4TU1A 1XKYA 4M7SA 5CC5A 1V3LA 1H1ZA 4IP5A 4NZFA 2QF7A 1PL9A 3CIVA 2FPVA 2WVVB 5AYIA 1K6WA 3OVRA 5CPTA 5FJJA 1OGBA 3E12A 2V38A 1UKQA 3E0FA 1JDFA 4G2DA 4H41A 3HFYA 3S1UA 3UWEA 3ZQ9A 1JGIA 4GX9A 5D02A 4S3BA 3C2RA 1Q13A 1YW1A 3U4FA 4QG6A 3W1TA 2WNQA 4OQVA 4ECLA 4GY0A 3K4WA 4HBKA 4KFPA 2GGEA 1XIJA 1HKMA 4RDVA 1UQYA 3L4XA 1A0CA 1ZJAA 1UUQA 1W8SA 1A0EA 3TP4A 3T2QA 3DI1A 2YB1A 2B81A 3PY2A 3TTOA 3B9DA 5CZSA 4HB7A 5I24A 2WJFA 4XK2A 4CD5A 1XDMA 1E9IA 3H55A 4LS1A 4QX4A 4ZTYA 4Z08A 2VL4A 4L4OA 2ZRWA 2AL2B 5B7ZA 3UXLA 1V3JA 1VPQA 4YWSA 5CLWA 1GOQA 4JQ2A 3UJRA 3OLEA 3TA6A 4HZ6A 2ZA2A 2OX4A 5C7HA 5C9ZA 3LSBA 1X39A 1X98A 1QO5A 4Y96A 2H9AA 3EDFA 2YL6A 3VOFA 3UGVA 2C16A 2YCEA 4AMCA 1OIMA 3VM5A 2A85A 2WVVA 2YDRA 1UD8A 1W54A 4WGXA 2QUVA 3B9AA 1PIGA 1C93A 4P7QA 2OKOA 2XVLA 3AXIA 4PRWA 4J5NA 2GVYA 2A3LA 3P61A 3IGXA 3UZ5A 3PZGA 3T7VA 2DZPA 4FAMA 4BWLA 3AWNA 3S1VA 1HT6A 3WZ0E 3NIYA 4GZEA 4G1KA 3LN3A 3MY9A 4OGZA 3GHRA 2OYMA 1KV5A 3WQ5A 3HIJA 2BXZA 1NWUA 2PDLA 4H9VA 1UB3A 4F0SA 1RV8A 2YOCA 1PHWA 2HXUA 1KV8A 3AQUA 4ASTA 2VFDA 2E5CA 3GDKA 3MO7A 4PTWA 4AEEA 4FNQA 1Z44A 4AQLA 1QWKA 3CM4A 4QISA 4FLSA 4V33A 4QTGA 4CN6A 3V5FA 4IXXA 4DI8A 3MJYA 3C56A 4CCZA 1XH2A 4GFIA 4DWSA 3SSZA 4S3KA 1DJWA 4LYRA 2AL2A 3RNDA 3RYSA 4JFTA 4ROQA 4AU0A 1UPMB 3CNYA 4QM1A 5D37A 3PSVA 2O9RA 3K2GA 4PUWA 4X61A 1OCNA 1HKIA 2E1WA 3MI3A 3DBPA 4ZB5A 3U8GA 2IPWA 3WDRA 4MB1A 2OPJA 3H4XA 4XVDA 3E9AA 3WF1A 3H54A 1YXYA 3KBMA 3PBVA 4AZ6A 2IKIA 4DLFA 2Y63A 2DSWA 2I16A 2XIBA 5XINA 1WAWA 2ZUSA 4KWUA 3LM3A 1EQPA 1XBYA 1CTNA 2HK1A 1J18A 5LNWA 1K8ZA 1IE7C 1IEVA 4AZBA 4H01A 2F9RA 1KGUA 4LPCA 4N9EA 4KEMA 3UFYA 4UTFA 4GISA 4N6EA 2BGQA 3KP0A 1XIIA 3RDKA 3DERA 3KRBA 4B3KA 2POTA 3AS2A 2VENA 3BMXA 1UR3M 2MANA 1RAKA 3BUVA 3H4WA 2WB5A 3QV6A 4Q8OA 2ASHA 5T91A 4KEUA 3CH9A 2V5DA 2UY3A 2ISWA 7ODCA 4DBSA 4WDWA 3M07A 4DJFA 4I5UA 4H8UA 1NARA 4UC5A 5G2IA 2FZ9A 4POCA 3CHDA 1SR0A 4MUZA 2BV9A 3ABXA 1G4SA 2B31A 2CZDA 2CBUA 1GGOA 1X7IA 5HNUA 3M0HA 3GTNA 2OWCA 2EG7A 2GQ8A 1ZJBA 1LWHA 3W2NA 4AISA 1CW2A 4CD7A 4QITA 3A4JA 1O66A 3TTYA 4K68A 1EYEA 4QSFA 3VMNA 4MJ2A 4YL2A 3FHQA 4L64A 5D2YA 3D47A 2YLLA 1LBMA 1J79A 4B9ZA 3UP8A 2IXVA 4XISA 2DZWA 1FFQA 4W7WA 1SO4A 1XGDA 3I7SA 3VC5A 2XDFA 2XN2A 4MJMA 2BHUA 4C5YA 1D7KA 4XG1A 4RE0A 4EAMA 4F48A 3UG8A 3EPNA 3E2VA 1QOQA 2E77A 3BC9A 5DCDA 3PBYA 1KR1A 3SCTA 2VEPA 1Q6LA 4FS9A 1SO3A 5J5RA 5HK4A 3SCSA 5HMSA 4C7DA 2ZKMX 3QQ0A 1X1NA 4D6DA 3NOYA 2Z1WA 3DECA 1ZBCA 3JS3A 1B1YA 2I14A 3GQYA 3V1HA 2PTXA 4F3HA 1KFLA 5E9AA 1UKOA 5IRPA 2QJGA 1GPFA 3D3AA 4P7RA 2QAFA 3FHAA 3WLLA 2R1LA 1E4LA 1W9XA 1WUFA 2DZXA 4R3UA 2JKEA 4ZOBA 3QZAA 1J2BA 1H7XA 1UOKA 5CG0A 5EBAA 5CGTA 2CXEA 1GVIA 3CMFA 4W88A 3W27A 4GQQA 4WUIA 1XPGA 2J6VA 1W5NA 3MSGA 1FWJC 1QPNA 4J3VA 2QGHA 5BWAA 1UW9A 1Z41A 4F0MA 2B7PA 3L5LA 2WVSA 2FKPA 5DLCA 3TXVA 1QNQA 5FF4A 1XC6A 3STCA 3LLXA 2WC3A 2YBVA 3NZPA 1J2WA 5D33A 3VDGA 1IHIA 3OIXA 3MWAA 3LCGA