4LV4A

A noncompetitive inhibitor for m. tuberculosis's class iia fructose 1,6-bisphosphate aldolase
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
345
structure length
320
Chain Sequence
PIATPEVYAEMLGQAKQNSYAFPAINCTSSETVNAAIKGFADAGSDGIIQFSTGGAEFGSGLGVKDMVTGAVALAEFTHVIAAKYPVNVALHTDHCPKDKLDSYVRPLLAISAQRVSKGGNPLFQSHMWDGSAVPIDENLAIAQELLKAAAAAKIILEIEIGVVGEKLYTSPEDFEKTIEALGAGEHGKYLLAATFGPDILAQGQQVAAAKLGLPADAKPFDFVFHGGSGSLKSEIEEALRYGVVKMNVDTDTQYAFTRPIAGHMFTNYDGVLKVDGEVGVKKVYDPRSYLKKAEASMSQRVVQACNDLHCAGKSLTHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-bisphosphate aldolase
publication title A Noncompetitive Inhibitor for Mycobacterium tuberculosis's Class IIa Fructose 1,6-Bisphosphate Aldolase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase/lyase inhibitor
total genus 133
structure length 320
sequence length 345
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4lv4A00
4KFNA 2X2GA 3JRKA 1JCYA 2ALDA 3GB6A 3LI1A 1NF0A 2GVGA 2YW3A 3GVGA 2UV8G 3QW4B 5LSMA 5HULA 3STFA 3DFSA 1TIMA 5AYXA 5EBUA 4O50A 4CCCA 2WNNA 4HNUA 2FQIA 4YL2A 1FXPA 1S3HA 5AYZA 1DORA 4JS3A 1J4EA 3B8DA 4N9DA 3SZ8A 1VQTA 3OIXA 2Z6JA 1OK4A 3UYCA 4ALDA 3DENA 1T99A 3I7QA 2NUXA 1JJKA 1TSIA 1FY6A 3TUUA 4OGZA 1G4PA 3HGOA 1OYBA 3EWXA 3S1WA 3DZ1A 1UJPA 5I3KA 2VFIA 1K7EA 4DBDA 3NDOA 3PAJA 5D30A 2A21A 5F4WA 3P61A 3STEA 2F84A 1O60A 4XBSA 4ZVJA 5HMSA 3W9ZA 1QR7A 1LM1A 3PUOA 2C14A 3P84A 3P60A 5A8GA 3W1AA 3DXIA 1A5CA 2WOQA 3IIPA 4GUIA 4CNOA 1H63A 3P5ZA 1QPNA 5K9CA 3O06A 3PG9A 1KFKA 3M7WA 4UC5A 5HWNA 1G69A 4O10A 3MI6A 1YDOA 4JDYA 4PA8A 3HIJA 1WV2A 4TMCA 4WY0B 1VYRA 1SQ7A 4ZQRA 1QOQA 4Y8FA 4A2SA 1LRNA 5U7SA 1KTNA 3QQ1A 2DZTA 2YGYA 2ZRYA 4NJIA 4PCFA 3QW3A 1M7OA 1W5QA 3G3DA 4O19A 1TPDA 4JTIA 1FWSA 1PHQA 5K3VA 4NQ1A 5I3JA 2OZ0A 3MW7A 3NM1A 3P82A 1H7RA 1CX9A 2CLMA 4OHQA 3VCRA 3MWAA 3C3NA 1FBAA 2NX9A 2YZRA 4O1AA 4UTWA 4N6EA 1W31A 5CZJA 1AMKA 1XL9A 1TREA 5L9FA 3N9RA 2XN0A 2Q8LA 4IX0A 3DH7A 2NXHA 3PBVA 1RD5A 4Y6GA 1DBTA 4N9BA 3RLUA 5AHIA 3TX9A 4O14A 1XDLA 1MSSA 1WBJA 2FJKA 3IVUA 3UXAA 3B03A 2QDHA 1FUYA 4N9EA 4MZ8A 5DY2A 3FJLA 3IVTA 4EVZA 3T40A 3L67A 5KZDA 4Y9AA 2WKJA 1D3HA 2V8ZA 1W5PA 2QCNA 3G1AA 2JGYA 2YFNA 1PS9A 3RU6A 1G4EA 3SSJA 1CI1A 4YCPA 5CPNA 3QMRA 4Z08A 1TV8A 3Q94A 2YW4A 4EOUA 1JVNA 5KZMA 3P8IA 3G0UA 3E0IA 3QRHA 2GJLA 1RZMA 4NVTA 3C2RA 1EX5A 8TIMA 4K8HA 3TSDA 3GXTA 3WJZA 5H2ZA 2QCMA 2A7RA 1VHNA 4XKYB 1U83A 4NX0A 5DCDA 2Q3OA 2EKCA 1P0NA 3H54A 2O7QA 1VLWA 5BW6A 3FJ6A 1IGSA 2GPTA 4DPQA 1NFBA 1AL8A 3WK0A 1IF2A 1KTCA 2HTMA 4NXKA 2A6LA 2R14A 1JQXA 3GIYA 1H60A 3GX9A 2QKFA 4O4VA 3SFKA 4UTTC 1VH7A 1RV8A 4RX0A 1EP2A 3EKLA 5FF3A 4X9SA 2DZPA 3LLDA 2ZRVA 1OX4B 2TPSA 1W3NA 2C3ZA 1GJPA 2VEMA 3NO5A 3KOFA 3TXZA 3P8JA 2VKZG 2BSLA 2ZZ1A 4OE7A 3MHGA 3CPRA 5G5IA 2NLIA 3F4NA 4MKNA 2Q3RA 4IUOA 1Q6OA 3CB8A 3PG8A 1PVNA 3W85A 3DGRA 3KVJA 3LXAA 3WFAA 1KLZA 2BZNA 1NSJA 4IMCA 1W3IA 4Q4KA 1B4KA 3C2VA 5T26A 1GYLA 3W1NA 2J24A 3IGSA 1FXQA 5D05A 1FCBA 1O4UA 4QSHA 4JTEA 1CW2A 1ONRA 2A4AA 2V2HA 3HF3A 1UASA 3LM7A 4UMAA 3A9IA 2R91A 2YXGA 1MEIA 4NNAA 4O12A 1DL3A 1Q3NA 2EHHA 3IIOA 3JS3A 4MYAA 1N8FA 2NXGA 4JY8A 4AHQA 3KRZA 2J9ZA 1ZNNA 2ISVA 3IV3A 4JIQA 1R47A 2B7NA 4LOCA 4K6AA 4UTMA 1AG1O 1GQNA 1OF6A 2A7NA 1F76A 3EWYA 2PC4A 3G8RA 2YFOA 1IXPA 3W7GA 3MI3A 3DBPA 3TSMA 1AW2A 5D38A 1DVJA 4KFPA 1W0MA 3BV4A 3QYQA 1FDZA 1TMHA 5LGXA 3NL6A 4PODA 2Y6ZA 1JRCA 4Q32A 3W1QA 1MEHA 2AQWA 1W5NA 4BI6A 3MP5A 3RF9A 4HSNA 3SGZA 3NL3A 4ZL1A 5C6MA 1KFEA 4FNPA 2ZRWA 4OBTA 3W7QA 1ZHAA 1F2JA 2E6YA 3OHIA 3HPSA 3PUEA 1EPXA 2GVJA 4RXFA 4IMFA 5U4NA 3B06A 3STGA 4DF0A 4DF2A 1KBIA 1LBLA 4ZQCA 3KHJA 2GJNA 1JULA 1SSGA 3BGGA 3W07A 5CZSA 1LBFA 5G1YA 1SZEA 3FLUA 3ABQA 3S1XA 2WSRA 3QPYA 2RDTA 2QCDA 2DZWA 4WY0F 3NQ6A 3W7HA 5K7JA 1H7PA 3IIXA 4DPPA 1PL9A 1FDJA 1S5TA 2NWSA 3TE9A 3MMTA 4PTNA 1HFBA 1PIIA 4M7SA 1OFRA 4IPJA 4AWSA 3U2OA 2I9EA 2Y7FA 5BRBA 4IMGA 4MY9A 3PSWA 1Q6QA 3EWZA 2ZDRA 4LUIA 4BWLA 1GTEA 4A29A 3SJ3A 1GT8A 1UB3A 1OJXA 1SUXA 1R2TA 3G22A 2P1FA 2VENA 4R33A 5HUOA 1WOAA 2V2CA 3BARA 2G96A 3I6RA 1G6CA 4FX8A 3W7MA 3QFEA 1KA9F 1XDMA 3H53A 1KM3A 3W1PA 4Z1BA 3PBYA 1E51A 4N02A 3KAOA 4M6VA 1W56A 1Z41A 3LCGA 1SZGA 5LNWA 2HS6A 2ZZ6A 1OVDA 3PY2A 4UFLA 1LYXA 2WPBA 3BLEA 3W88A 2GQAA 3LTPA 4JTFA 4JD4A 5FF4A 3UWWA 4DQWA 3C0JA 1TB3A 4TMBA 1RQHA 4LWWA 4Z1DA 3TQ0A 1B4EA 2FPVA 3E96A 1MZHA 4KFOA 4C1LA 3S5YA 2W79A 1GVOA 4OV4A 4IMDA 5F2GA 3ANYA 1IXNA 3S42A 4NZJA 3JR2A 4LC8A 1KBJA 1IXQA 2PE4A 3M0ZA 2KZHA 2A7PA 1GVFA 4OV9A 3NA8A 4C1KA 1T96A 3W7KA 3R12A 1KTBA 3CWOX 2RDUA 3S9YA 2QR6A 3CLMA 4FB7A 5HJLA 1G7VA 1ICQA 3N34A 3DFNA 3C2FA 3UXDA 4AH7A 4JTKA 2Y70A 2FLIA 1ZCOA 4ZQOA 3C61A 2R94A 3IRDA 1OYAA 4D2JA 2C19A 5D03A 4LVGA 3W22A 3EX4A 3MUXA 3EWBX 4CQ9A 4E0CA 1W54A 5I3GA 3OVRA 4AF0B 1O94A 3STCA 5I3IA 3M47A 3W1LA 4DO4A 4O8RA 4R34A 3MJYA 5I3FA 3PC0A 1QO2A 3NPUA 3E02A 4AHPA 2NV2A 4POCA 2WNZA 4BI7A 5IBXA 3NOEA 2GOUA 5F1UA 3TROA 2OMAA 3OVQA 4M6QA 1F7BA 1VCFA 3IIZA 3NQGA 4NXSA 1TTQA 4FXSA 2QUTA 4IWWA 1ADOA 4UFIA 4RV8A 3Q58A 4E38A 1SFLA 4XWUA 1H62A 4EF8A 5HNRA 1SR9A 1NF7A 3Q2DA 1TTJA 5E1QA 5AHEA 2GUUA 1K8XA 4H6KA 3PUDA 5D04C 4H3DA 1YDVA 2ISWA 2C18A 4UFJA 2TYSA 3M6YA 5AC7A 1OABA 3UY7A 2FPYA 3EX6A 2XN2A 4S2BA 3MHUA 2XN1A 4KWWA 1YTEA 5EA9A 3G24A 4ML9A 5G4WA 4Z0SA 1J5TA 2RH9A 1EWEA 2C0AA 2FFCA 3L68A 2V9DA 3PVFA 2Z1BA 1XUUA 4JYDA 3BW3A 1K03A 1ZAHA 3MHFA 2H8XA 1SW0A 5J5DA 4LV4A 2QAPA 4G1KA 4HN4A 5HQEA 3HMJG 2E5BA 5FEWA 3DU0A 1AL7A 1LORA 1V7YA 1YXYA 3G1XA 5EMUA 5LZLA 2NWRA 4YXGA 3G3MA 3NL2A 1YADA 5ABTA 5TQLA 3G1VA 5AOUA 3LRLA 1KFBA 3C6CA 3HG5A 3S1UA 4ZQMA 1DJQA 3OBKA 1B57A 3EX1A 4FHAA 1Q6LA 1YTDA 4AEOA 3CU2A 4J9JA 3W2UA 3NYZA 3TQKA 1LRTA 4L4MA 2A6NA 1I4NA 5DCEA 4JX5A 1F5ZA 4GUFA 3LTYA 3FIGA 3CIWA 4ORIA 1X1OA 2FB3A 4BFAA 3N2XA 2O7SA 4JGDA 2FTPA 3DI0A 3B05A 5AHMA 3W1UA 3TJLA 2AAMA 5TIMA 3NNTA 4LRSA 1YYAA 1ICSA 1I2PA 4K7YA 2E1DA 4MPQA 1WOBA 3B4UA 1TYGA 3NQMA 1GWJA 3S8HA 3R5EA 3VFLA 4WUIA 3TR2A 2JKEA 3DKLA 3UNDA 5D37A 2OCZA 3LHUA 2EAWA 3UD6A 2B7OA 1MO0A 3C52A 5AYYA 4CCDA 4DBEA 2TRSA 3SIZA 1ZALA 2BLEA 1ZAJA 3BPWA 2E6DA 1GPWA 1I2NA 3NZ1A 1LDCA 3GDMA 1TPC1 3N3MA 5K4ZA 1EWDA 4RJEA 3G1SA 3LHVA 3IIVA 3L0GA 5TBOA 3S0CA 1LOLA 2P0OA 3TC6A 3W86A 1Z44A 4MY8A 3S6DA 1O95A 1H7NA 4HSOA 5AC6A 1PCKA 2OJPA 2WJZA 2QF7A 3PBWA 1SO3A 3M5ZA 3NG3A 2CLEA 2LLEA 3LHWA 1QMLA 2V30A 4HT3A 3ZWSA 3L9CA 5KITA 3VKJA 2CFFA 1M6JA 4JY9A 4JX4A 3SI9A 4O0ZA 1FWRA 3G1YA 3LCXA 1I45A 4O13A 4FNSA 2H8ZA 4DO6A 3QM3A 1Z42A 1DQXA 2Z6IA 4I7WA 3NGJA 5LGZA 3GKAA 2J27A 1KV5A 1XI3A 3EX2A 4QIUA 4LW7A 4ORMA 1N7KA 1R46A 2CZFA 3FOKA 1FCQA 2CLHA 4MZ1A 4MZYA 4QAIA 3FYPA 1QWGA 2NX3A 4RR4A 5J5RA 3OVPA 3GR7A 3VE9A 2B0MA 1AW5A 3E12A 3W71A 2I14A 1H7XA 4WQ6A 3FEMA 1QPRA 4M7TA 4FX7A 2NZLA 1EA0A 3LV5A 1TPEA 2YCEA 3CM4A 1HUVA 3W2NA 4TO8A 3WK3A 5CGQA 4B5NA 3MBDA 3BVJA 3C4UA 1O5KA 3U8GA 3W1XA 4JICA 5F1VA 3PR2A 1G7UA 4MFDA 3GYEA 4TU1A 5D33A 3W7NA 4AB4A 1LBMA 1LLZA 3FA5A 4UXDA 5D32A 5G4EA 3R13A 1OFOA 4N4QA 3GDKA 2Y7GA 1JCJA 2A85A 2ZZ3A 4LNYA 4LS1A 3OEXA 1ALDA 2OX1A 1FWNA 3BO9A 3L0NA 1JUBA 1ME8A 3HPZA 1SO4A 3L0KA 1RQEA 3K30A 5D2YA 1SZFA 3BG3A 5AHFA 2ZZ7A 2E09A 1K8YA 4GC4A 1I2QA 4NU7A 4DF1A 4U28A 3R2GA 2QUVA 3EEGA 3THQA 2WV8A 2YYUA 1V5XA 5BMXA 4ZMGA 4YMZA 3ZS4A 4A22A 1MEWA 2AGKA 4UMCA 2G5WA 4NJJA 1TPVA 2QCCA 3O1NA 1FDYA 4E2BA 1G67A 3W74A 4NJHA 1ZENA 4HKPA 2VC6A 4O17A 3UPWA 1YPIA 4O1BA 2QAFA 3M5XA 1F6PA 3LTSA 4XQ6A 1BKSA 2R8WA 1OFAA 4GE8A 4UTIA 4JDBA 3GZ3A 1KFJA 2V2DA 2CZDA 3UZJA 1Q6RA 3TCEA 4FNUA 3LCLA 1L6WA 3GNNA 2A1YA 3O07A 2C13A 3CIXA 4BR1A 1R2RA 2X16A 5HINA 4TR9A 2E6FA 3GDTA 1VC4A 2A5HA 3LHYA 3LERA 3DKJA 1KM5A 4LVDA 1JCXA 1FWTA 2ZZ4A 3LCWA 2VEPA 4K8EA 3N9SA 3GAYA 4N2YA 3NQDA 1W37A 2BTMA 5CPMA 3A23A 3HO8A 4ZQNA 2J6XA 3VI2A 3T44A 1C8VA 5EYWA 3W72A 4O54A 1XBYA 5AC8A 4OU1A 4O11A 2QCFA 1RR2A 4O28A 1SW3A 1AK5A 4N9CA 1H7WA 1VR6A 2QCLA 3UWZA 2OT1A 3AO0A 1A5SA 3M41A 5G2HA 4JX6A 1P4CA 4KKXA 5CPOA 3MYPA 5LNUA 1LP6A 1VYPX 4RXGA 3LBMA 3PB2A 4MY1A 2H90A 4JXCA 1D3GA 1L9WA 2CZEA 4WY0A 3T4CA 5LHFA 3F1QA 5C55A 3ELFA 2ATSA 1QPQA 1QCWA 5C2XA 3FYOA 3Q37A 3TH6A 3ZR4A 1XUZA 3ATYA 1W3TA 4LC6A 1RPXA 3NQEA 1JCNA 3W7OA 1VJIA 2PRLA 4L4LA 3A21A 3PB0A 4R7JA 2V0TA 3OA3A 3W2LA 3QZEA 3USBA 2NUWA 3ZWTA 4QQ3A 3CQ0A 1FCUA 3LLFA 4AWTA 2VELA 4MFEA 5LHEA 3W1MA 2ATMA 1PHWA 3O05A 5AHNA 1KW1A 2VFEA 5D2TA 4PEKA 2B7PA 1LLWA 4FO4A 4UR8A 2HSAA 1C9DA 3GDLA 4K36A 4MVAA 5DXXA 5I3HA 1DV7A 1TPB1 1GTHA 1KM2A 4H4IA 4X3ZA 1EP3A 2VFGA 4O1CA 4O1DA 5FF7A 4LVAA 2BWGA 2JKAA 2CWNA 4MJZA 5EPDA 2ZRUA 3LRKA 1F05A 3WJXA 3EXSA 1TJRA 2JK2A 2B4GA 3TXVA 1D9EA 2P10A 3ABRA 3GDRA 3HGJA 2Y89A 2CLOA 1WYIA 3TU9A 3B0UX 2IQTA 4MOZA 4MJMA 4LVFA 3NQVA 3LRMA 4ICNA 5EKYA 3RK8A 1MXSA 3G18A 4O18A 3EXTA 3ZFHA 4ZQPA 4EWND 2Q8ZA 4K7VA 3SECA 2ZFAA 3W83A 5CZ0A 5CPLA 1ZFJA 4RCXA 4CNPA 3B04A 2TSYA 2XFWA 3ABSA 1DHPA 1JQVA 1W8SA 4IMEA 1NEYA 3O8AA 3SR7A 1VCVA 4NZFA 1H7OA 3CWNA 2X1UA 4RLIA 1S5VA 4I7UA 1BEUA 3N2MA 3EWUA 3W70A 1KFCA 4XKYA 5G1TA 3LGEA 3UWYA 2G95A 5DBUA 4IXXA 4HNVA 4M6PA 1VS1A 1YPFA 1X1ZA 1X8FA 4UTTA 1R30A 1THFD 5CZTA 1K7XA 3QSRA 3P80A 5C54A 4P61A 1OFDA 2Y7DA 4XUGA 2H3BA 1K8ZA 3TAOA 3DAQA 5AHLA 4GUJA 3O6YX 4JTJA 4FNQA 1F73A 1WQ5A 3MI2A 5DCBA 4CLMA 3LHTA 5D02A 5G2WA 6ALDA 3B0PA 4RZ5A 3W2KA 3IGXA 5L6UA 3GKFA 1H51A 3NL5A 4RZ6A 1SW7A 2ZZ2A 3W1RA 3TFXA 1WX0A 3F03K 1OX4A 4QM1A 3GK0A 3UWUA 2W6RA 1XBVA 2ZTKA 3TMLA 3FS2A 1SZNA 4GXMA 4UTWC 3P5YA 4K39A 1XM3A 3SGUA 1ICPA 4GRSA 2F7FA 3BLFA 3NQ8A 3TQVA 1JCLA 4LS2A 1KV8A 1Y0EA 3TDFA 2YPIA 3U6WA 2CW6A 4N6FA 3VNDA 1XBZA 5FF0A 5FEZA 3BLIA 4JTSA 1VCGA 4FEZA 4Q33A 3W73A 1IIHA 1WDWA 3L66A 2ABAA 4HPXA 3EKZA 1TV7A 1X6UA 4ADUA 2C15A 4AVFA 5CG7A 2DZXA 3BGJA 2DZUA 2TMDA 3G0SA 1W5MA 4TIMA 3MBFA 4UTHA 1HG3A 4BF9A 1RVGA 3HOJA 1T0OA 3OG3A 3W7DA 5D2VA 1ZJIA 4PFMA 2VOMA 4XTDA 2WQPA 1C29A 3LXBA 2A2IA 2Z0IA 3UZ5A 2CU0A 4JTUA 3W3OA 2ZRZA 3E9AA 4UNLA 2DZSA 1PE1A 3DFTA 1B3OA 4I7VA 3QF0A 1JUEA 3W7RA 2B7QA 4IQLA 4MIMA 4KWVA 1VZWA 4QJ1A 1QFEA 5IM51 3LDVA 4BI5A 5EY5A 5HWJA 4YCOA 1WXJA 2H3DA 5KSWA 4IXHA 1OFEA 3NEVA 3DFOA 4HNTA 2ZA2A 4GBUA 1F74A 4S2CA 3C2EA 3T55A 4CQAA 1WA3A 2QCHA 4UUIA 1DQWA 4UNKA 4Z0JA 1GYNA 1HO4A 3PBUA 1A53A 4HNNA 4CCEA 4ZZ9A 2X1TA 1PV8A 2PRHA 3GNDA 5DXYA 4RZ4A 2OT0A 2VFFA 3W7PA 2DJXA 3G1DA 4X22A 4UTUA 5F2IA 5K2ZA 1N55A 4WXZA 2BX7A 2CZ5A 1UUMA 3NQCA 4AWUA 3LCHA 5SWUA 4HHPA 1R2SA 5HWMA 3NVTA 2WSQA 5MHBA 2J9XA 4O15A 1TPH1 3W2MA 3M5VA 3QSTA 2C6QA 1HTIA 5KMYA 1QOPA 3RFAA 1K02A 3L2IA 2ZBTA 1JCMP 4NUWA 3S5OA 1I2RA 1GOXA 1W5OA 1TJPA 1NAL1 3N73A 3HGRA 4QITA 2NXIA 4JTGA 3QQ0A 5AB3A 1GVSA 3W76A 3IEBA 4HIBA 3BG5A 5CSSA 3TKFA 3INPA 2VEKA 2QJGA 1Q45A 3NAVA 2FPTA 3KVMA 1OX6A 1RQBA 2I1OA 4UMBA 5BNKA 3B0VC 4AXKA 1VPXA 1O5XA 4X2RA 3W87A 1LOSA 2DU2A 1EIXA 3ABOA 3W1TA 3KX6A 4ADTA 5FI8A 2WO5A 1ZAIA 5AN7A 1VGAA 1VHCA 3W7LA 4UFMA 4M5PA 4UTJA 1VYSX 2YYTA 5F2MA 4IJBA 3IVSA 3LHZA 4I9AA 5LNRA 4A2RA 3S5ZA 2PCQA 3GAKA 4JR5A 1I8JA 2RKXA 1LRQA 1S5WA 4LVBA 4WOZA 2C1HA 2VXNA 4Z1CA 3HPXA 5DLCA 3D0CA 1YTKA 3P67A 3QPZA 4MLRA 4MUZA 4IX2A 5K9DA 2QCDB 3HG4A 3TIMA 3TK7A 4FF7A 2ABBA 3A24A 4QNWA 3QMTA 4U4MA 1G4SA 1OX5A 1A5AA 5FEPA 3DFPA 1TQJA 3FKRA 4LT9A 2VFHA 5DBTA 3NPVA 2DP3A 2FDSA 3C2OA 3GXPA 2A0NA 1KLYA 4GJ1A 5H91A 4AF0A 1P5BA 1XXXA 2D73A 3TJXA 3L21A 5LNSA 1KM6A 3EWWA 5HR7A 1DJNA 1LROA 1JUKA 4CNNA 3G0XA 4FX6M 4LTSA 2CLIA 3SY5A 2E68A 4NX5A 4YWIA 3W7JA 1SPQA 2QJIA 2ZRXA 3E49A 3HGSA 5AFDA 3SW6A 3I7RA 4BWLC 2GQ8A 3W7IA 1VLIA 3UQNA 1EEPA 4MLJA 4LU0A 3DFQA 2HS8A 3MP4A 4PL1A 3UWVA 1EP1A 2QEZA 3LCFA 2H6RA 2Y85A 3H55A 1XCFA 3MO7A 1H50A 4NJKA 4O57A 5FESA 1QO5A 1TRDA 4UIOA 3RMJA 1ME7A 3LI0A 3R89A 4UCGA 2YDAA 3W23A 2PRMA 3NQAA 2YSWA 4NJGA 1IIGA 5D2XA 3KFTA 4GUGA 3PWAA 3TFCA 1G4TA 3M44A 2ZA1A 2JBMA 4O0KA 3O6DA 3HQ1A 4GNJA 3ATZA 3QC3A 4PH6A 3A22A 3BK0A 4A21A 1ME9A 1YXCA 4HPJA 1TO3A 1OYCA 1YLVA 1LCOA 1GG0A 1H1ZA 3NQFA 1HO1A 4GUHA 3FFSA 1AW1A 2VFDA 1TTIA 5BMWA 1SSDA 2V5LA 4ONVA 5KTLA 4AHOA 3L5MA 2RDWA 5FF2A 1FQ0A 2E6AA 4O52A 1OK6A 3NQ7A 3NR0A 5G2IA 2QJHA 3T7VA 3TSBA 3M9YA 1FX6A 4PC8A 1TRIA 2EF9A 1SO6A 2Y62A 4PL2A 5FEXA 1XC4A 1P1XA 2BXVA 1M7PA 2ZCGA 1A50A 4EF9A 2G97A 1YXDA 2CLKA 1L6SA 4LRTA 1K7FA 4FXRA 1OFPA 3DHFA 3PULA 3TMQA 4ADSA 2ISSA 3V1PA 3L5AA 2C16A 1DKWA 2J9YA 5LKYA 7TIMA 1A5BA 4UTKA 5HR6A 3I7SA 5CKSA 3L5LA 4GFSA 4JYEA 1FCVA 2X30A 1VRDA 2NUYA 5F4XA 1Z48A 1TPUA 2QUUA 1GZGA 2EGZA 5IBXC 1P0KA 3CC1A 5DELA 4O4WA 3F4WA 4Y90A 4BK9A 5KZEA 3NXFA 1W1ZA 2WNQA 3C56A 4IOTA 3LBCA 1X7FA 3DHDA 4OT7A 1EB3A 2VEIA 1M5WA 3L65A 3AJXA 4JIPA 1BWKA 3KRUA 4EIVA 5C5YA 3P74A 2V82A 2Y7EA 2NX1A 4JYFA 2Y88A 5CSRA 2FIQA 3KVKA 4RK8A 3VE7A 4QNEA 3TNOA 4Y96A 1EUAA 2DORA 2ZYFA 3KVLA 2NV1A 2CLFA 3S5NA 5E0KA 1TCDA 3HJZA 4MYXA 2ZZ5A 4JTLA 4LS0A 1GEQA 3CHVA 3QMSA 4N4PA 3HG3A 1QDSA 3WJYA 2GVLA 3NZRA 3LV6A 3WJWA 2FB2A 2X1RA 3CEPA 3EB2A 4GWEA 2W0UA 4A3UA 1QPOA 5DN1A 3BG9A 2RFGA 1J2WA 1OHLA 3HG2A 2PURA 2E77A 2DZVA 1WAUA 4JEQA 1QNVA 3TW7A 4FNRA 4IGHA 4M19A 3G1HA 5LNVA 4JTTA 2YR1A 3PSVA 5HUPA 5EL1A 5K4XA 1QAPA 1OG0A 1SO5A 3KXQA 4P2VA 1ZY9A 2X1SA 3A5FA 3O6CA 1WBHA 3N19B 1SU5A 2Y63A 3LCIA 1KM0A 4FIRA 5D2WA 5D09A 3BW4A 3KRSA 3CEUA 3UWQA 1UUOA 1H5YA 3FKKA 4DXVA 3O16A 3GLCA 3NQ2A 4AMAA 1KM1A 3LXCA 2EPHA 3T78A 4WJEA 3EXRA 2ZA3A 1IXOA 1PCWA 4YLWA 4QISA 1JR1A 3QH2A 3W84A 4O16A 2JKPA 4LV9A 5E93A 1LOQA 2GQ9A 3M5YA 4K38A 4LY8A 3UY8A 1OFQA 2DJLA 2ZQ0A 3UPBA 3W75A 4RKAA 3WK2A 1UBSA 3TA6A 3R8RA 3LB0A 2WSYA 4R53A 5F4SA 1FWWA 2Y61A 3G8EA 1T8XA 4JNMA 3TV8A 3HB9A 1LTDA 1GVQA 4NNBA 1UCWA 4WZHA 5GVJA 4K37A 1L2UA 2E5CA 2CLLA 3W7CA 1OF8A 3RLVA 6TIMA 3P81A 1K3UA 3A5VA 3O63A 4XBKA 4DELA 4DEFA 3LOTA 3TAKA 5F2LA 3GR8A 3WK1A 1BWLA 3NPWA 4FIQA 3S1VA 2QCGA 3I68A 3G1FA 3QEZA 3GXNA 2JGQA 1DOSA 4UFHA 4CQ8A 5A5WA 1KM4A 4NNCA 1NVMA 1B9BA 1SFJA 1F6KA 3M16A 1JRBA 3PM6A 5DY3A 1I2OA 4E2DA 4WOQA 1XFBA 2ZTJA 3CTLA 4TX9A 3BW2A 2J88A 3YPIA 1GG1A 3IGUA 1H61A 5KINA 4W9TA 1XKYA 2YX0A 3V75A 4OWGA 3O15A 3W7EA 4S1FA 4XTIA 3EX3A 4JTHA 1H1YA 1LZOA 1XBXA 4UR7A 3TW6A 4XZ9A 3CT7A 1U5JA 2V81A 1HL2A 2HMCA 1EUNA 4WX2A 4LUJA 3M1ZA 2E5DA 4JN6A 1TV5A 4O53A 3W2JA 3MP3A 4IPIA 3LX9A 2QCEA 3MYOA 4WXYA 1TPWA 1YDNA 4UFKA 1L6YA 1KFLA 2Z2UA 3N14A 4DO5A 3THAA 4FNTA 3TC7A 3WJSA 3DI1A 4Z1AA 1TTPA 4UTLA 2RHGA 3RNDA 3QJAA 4NT0A 2QDGA 3I65A 3PF3A 3HBLA 1TQXA 2V5BA 3P7YA 3W6YA 5K9XA 1BTMA 3PS7A 3NPXA 5BOOA 4AAJA 3M43A 4WD0A 4OQVA 3NM3A 1TPFA 1OFBA 1GVRA 3C8FA 1ML1A 3P62A
chains in the Genus database with same CATH superfamily
3BOLA 1HW6A 1PKMA 3QVQA 1T41A 3SCUA 1WE5A 3N2BA 1NF0A 1CB7B 2GVGA 2XG9A 5LSMA 1OEPA 3QGVA 1TZ9A 5HXMA 1TIMA 5EBAA 1OCBA 4ROPA 1HKVA 4CNSA 4YL2A 4ZODA 1DORA 2AL2A 1J4EA 5AC5A 4N9DA 3M4HA 2W9MA 3FGCB 1T99A 1UH4A 7XIMA 2QW5A 1CEOA 1FY6A 3TUUA 4MB3A 4GO9A 4OGZA 1GW1A 3CIVA 1RJPA 2R9RA 2EPMX 1HNYA 3NDOA 3CZJA 3KS6A 3OU8A 3VD5A 3P61A 2KAUC 4XBSA 3RUBL 3P84A 5A8GA 2AOSA 2WOQA 3D5HA 2UY5A 1QPNA 1IQ8A 3AYVA 5HNTA 1KFKA 3M7WA 4WSHA 5HWNA 1G69A 2P76A 1XCXA 1EJSC 4E3TA 2ZX5A 4M1BA 4WJXA 4ZQRA 4Y8FA 3CHCA 3RPMA 1XLLA 4A2SA 5U7SA 3GVWA 4IGNA 4ZOAA 2OR2A 4D6CA 3QQ1A 2DZTA 4NJIA 3QHOA 3QW3A 1P0DA 3BXWA 1TVPA 4O19A 3VILA 5KZ6A 1OC7A 3OYXA 4NQ1A 4D8ZA 1HJWA 1POKA 4NI8A 2CLMA 3VCRA 2HPMA 4JFUA 3KWXA 3EOLA 4DM2A 1XL9A 4JBRA 4CCZA 5AVNA 2Q8LA 3DH7A 3N4EA 1DHKA 1UP0A 4MTVA 3VINA 4N9BA 4WEVX 1H49A 3QGKC 2XIBA 3UESA 1XQLA 3RX4A 1XDLA 1WBJA 3MCMA 3B03A 1FUYA 1UD3A 1XP3A 4URIA 3FHQA 4HOZA 3FK4A 3T40A 4LCQA 5KZDA 1U30A 4Y9AA 3KRBA 1M01A 3ALGA 4ZO7A 3CQHA 4EACA 1B9ZA 1CXEA 4JZ5A 2JGYA 5I0DA 4TVCA 1PS9A 2PDIA 1E0WA 4L5ZA 3SSJA 4YCPA 4YYFA 5EU9A 5CPNA 1R86A 5LA0A 2XSAA 2YW4A 3KEHA 3SCVA 1S2AA 4EOUA 1JVNA 3URNA 3HV9A 3WLTA 3CV1A 1FH9A 2XFRA 3T2PA 2AMGA 2HVNA 3TSDA 1VHNA 1ISXA 2OPJA 1C8XA 4NX0A 5DCDA 3GVRA 2EKCA 4MM1A 3VCNA 4J4KA 4MMWA 4BS0A 2GPTA 4DPQA 4UQ9A 4LB3A 2PWFA 3WK0A 4E2OA 1FFQA 2HTMA 1OCNA 1UPPA 4NXKA 4HA0A 5GJMA 3VIIA 3GX9A 3LA4A 2QKFA 4O4VA 3SFKA 3FVDA 3KBSA 5GPRA 5GNYA 2E7FA 2XVKA 5EB8A 2ZRVA 2QMJA 2TPSA 3WNNA 1XRTA 3QYSA 4DXXA 1W3NA 3MUIA 4JTCA 4H8UA 3TXZA 3QKEA 4DUVA 2E40A 1UHVA 2V3DA 2G50A 2WHKA 3VC5A 1J10A 2Q3RA 3CB8A 1TUXA 4F8XA 3ZT5A 1U2YA 3W1NA 3C2VA 1GCYA 4KH2A 4OUEA 1ONRA 3PJXA 3ABXA 3HF3A 1MQPA 1UASA 3FV9A 2CBUA 3LM7A 3A9IA 4KEZA 1PYMA 9XIAA 5JXQA 1MFVA 1DPMA 1Q3NA 2D2GA 4JY8A 4AHQA 1ZNNA 3IV3A 3WCZA 1JCTA 1R47A 1L2QA 1BG4A 1IEIA 5CPQA 3OVGA 1EHNA 1OF6A 4AX7A 1F76A 3IJQA 2PC4A 1CENA 2FGZA 4E4PA 4QJ5B 2ZX9A 2GJXA 1W1A1 2H9AA 1YBQA 3GG8A 1AW2A 4REQB 1FWHC 5LGXA 1MRAA 1UR8A 3NL6A 4PODA 2Y6ZA 2GDQA 1MEHA 2AQWA 1IHIA 4OUIA 2VZVA 4ZL1A 2IKGA 4OBTA 1JZ5A 1ZHAA 4WKAA 4DJFC 3WNPA 2GVJA 3B06A 3STGA 3KUMA 1HT6A 4PB3A 2PAJA 7A3HA 1LBLA 1ZP3A 2EPNA 1AQMA 2WZIA 2SFPA 4PB4A 2J7GA 2NT0A 3K8LA 5CLWA 5DT5A 3A3WA 1F07A 2Y8VA 3OW1A 4EPDC 1DJGA 2OEMA 4J3SA 3AALA 2BVYA 2QCDA 1U22A 2DZWA 3W7HA 3WLLA 3M0YA 2NWSA 3EWDA 4KESA 5D9NA 1PIIA 4EAYA 4WHBA 1CLKA 1IT8A 3LQGA 2GQ3A 3H2EA 3A6OA 1SM9A 1VFFA 1A5UA 1O1HA 1XIMA 3UEQA 1OJXA 1K1DA 1SUXA 4C1NA 3B0XA 1BSIA 2BY1A 2VENA 4GACA 1JYWA 2V2CA 3MDWA 1B2YA 1H41A 3W7MA 1US2A 1Z69A 3B9DA 2XDFA 3A9BA 3PBYA 1E51A 1VIWA 3KAOA 1UKQA 1H2JA 5LNWA 1SZRA 4PCPA 1DXIA 3PY2A 3WENA 1TCMA 1LYXA 2WPBA 3OA5A 4FI4A 3BLEA 4RPQA 3LTPA 2XISA 3UJRA 1A3XA 4JD4A 1JIBA 1TB3A 3MUCA 1B4EA 1MZHA 4KFOA 5BROA 4C1LA 3R25A 3S5YA 1GVOA 2BY3A 2VX7A 3UZXA 4IMDA 5F2GA 2X05A 4IF2A 5JQ9A 1S5MA 1TV3A 2ISFA 3M0ZA 5E0FA 3T8QA 2KZHA 1DE6A 2JIEA 2J7CA 4OV9A 2OYLA 1EGVA 2I9UA 2PWVA 1ICQA 1XW8A 2REQA 3C2FA 3UXDA 4AH7A 4FXJA 1IEVA 1TWWA 1ZCOA 2R94A 4JN7A 1OYAA 4D2JA 3U7VA 4RNHA 1M7XA 3ITOA 3TCSA 3V0SA 1WXZA 4EP8C 1GJUA 4C6OA 1W54A 3AWOA 4F0SA 3DG7A 4DAIA 4AF0B 1HJQA 4HZ8A 1GOMA 1VBHA 2CCRA 4DO4A 3EAUA 2XJ7A 1VFUA 1B0IA 4BI7A 4LUYA 4CU6A 3TROA 1F7BA 2OWCA 1VCFA 1J12A 3RPDA 2DUXA 4RV8A 3Q58A 4E38A 1SFLA 2YBUA 1CGVA 2VVNA 2V5CA 1A5KC 1NF7A 1TE6A 2C1GA 5AHEA 3V0UA 2GUUA 3CUFA 4Q8QA 4H6KA 2J74A 5J8LA 1YDVA 2VX5A 3NDZA 1VJSA 2TYSA 5AC7A 1TR9A 4ZTXA 1EO7A 1KBBA 1OABA 3U5UA 3UY7A 3WBAA 3EX6A 5F7UA 1E0XA 1GW9A 4TV5A 3VKAA 3AMKA 2XN1A 4KWWA 4F0KA 3KL3A 5E9XA 1PZ0A 3G24A 4Z0SA 4U3CA 1YKWA 2BV9A 4AZ6A 4FOUA 2FFCA 4P8VA 2Z1BA 4JYDA 5CEWA 3SJNA 2D2OA 4JN8A 1W1YA 3TTQA 3ZQ9A 3HMJG 4DVOA 1V3HA 5FEWA 3UYIA 4R27A 3NYDA 5CGMA 2NWRA 3G3MA 4QROA 5ABTA 1JI1A 2I5IA 3H2AA 1KFBA 2PWEA 5LIWX 3HG5A 4HJWA 4ZQMA 4GI4A 3OBKA 3DFYA 4B5WA 3NYZA 4R3UA 3TYEA 4ZE4A 4H04A 3OQ8A 1JZ2A 3FIGA 4ORIA 1ZL1A 4E5TA 4BFAA 5REQB 4I8DA 3SN0A 3GTXA 1HJXA 2OQHA 3Q4DA 4Z1YA 3B4UA 2WMJA 4TVDA 6XIAA 3S8HA 5C2CA 1I75A 1FWGC 3TR2A 2OZ3A 1NJJA 2EAWA 3C52A 1QPKA 4GISA 2TRSA 1ZALA 1ZAJA 2QHAA 4BQ5A 1U1JA 3NZ1A 1LDCA 3G1SA 2QYGA 4R85A 4PRRA 4QXIA 1E56A 1Z44A 3S6DA 1GKPA 1O95A 3OG2A 1V51A 5JBDA 2CLEA 5EGRA 1TA3A 1FWFC 1PX3A 3KCJA 3ZWSA 4NIRA 3CV7A 4M56A 1M6JA 4DWSB 2WHMA 3L4ZA 3VXGA 4HB7A 3UJ2A 1SMAA 3THUA 3G1YA 3LCXA 4O13A 3KL5A 4J40A 3QM3A 4I7WA 4WKHA 4E6MA 1S2WA 2J27A 3AUOA 4FR1A 2XIOA 3VABA 1J96A 3EX2A 5HANA 4ORMA 1K8CA 4H6RA 1N7KA 3FOKA 1FCQA 4MZ1A 3BZGA 2W63A 4KGLA 2PP1A 3L4WA 3VD4A 3ICJA 1Q13A 2NX3A 1IR2A 4RR4A 3OVPA 4DZ5A 3GR7A 3AXIA 4GOAA 1JNEA 3E12A 1YNQA 3TQPA 4C6NA 1QUMA 1PTGA 2WZMA 1BQGA 3K5XA 4L4PA 2ISDA 1R3SA 1TELA 5FL1A 4DJDC 2IPGA 5A2AA 3ARYA 3A13A 3M7SA 4GKTA 1BVWA 4HU8A 3C4UA 3VOIA 5F1VA 3PR2A 1E72M 1G7UA 3IJLA 3AZRA 4JCMA 2P50A 4TU1A 2WMIA 5D33A 4AB4A 1LLZA 2PDWA 3KW3A 4UXDA 2EBNA 3H7RA 3WQ8A 3VIKA 3S3GA 4LNYA 3MCNA 2HVOA 1EFZA 3L0NA 3HPZA 2F2KA 3K30A 3VUPA 5AHFA 2WSKA 1V6VA 2FYMA 3IGHX 4GC4A 1I2QA 4NU7A 3C8NA 3R2GA 2QUVA 4MUPA 4A35A 3SRFA 4ZMGA 4YMZA 3GS6A 1U1HA 1MEWA 1CECA 1X97A 3LQLA 1XG3A 3F2BA 5CAKA 2CBJA 1MMFA 5CXPA 1XLBA 3GG1A 1YPIA 4XQ6A 2R8WA 2BHZA 3SCNA 4JDBA 2V2DA 4W5ZA 3DCPA 1ECEA 1EC8A 1JZ3A 1Q6RA 1XIGA 1TV4A 4RPPA 3V36A 1UD5A 1L6WA 3ITGA 2X16A 2J75A 3FSUA 1EJ7L 2JF6A 5FSEC 2ZZ4A 2VEPA 3GAYA 5HK4A 1EIBA 1ZJBA 3ITYA 8XIAA 4CQBA 2W91A 3A23A 5DRCA 1PPIA 1S1PA 3MU7A 2WK2A 1FH7A 4B5SA 3W72A 1XBYA 4O11A 2VDIA 1AK5A 4N9CA 1DJWA 2GDUA 1VR6A 4KCTA 3PPGA 1LP6A 3CAKA 3GY1A 2D24A 1D3GA 4WY0A 5LHFA 3F1QA 4XKMA 5C55A 1QPQA 4C60A 4QDWA 5C2XA 3ZR4A 1XUZA 1RPXA 3AC0A 1VJIA 4M80A 4NP7A 3FXYA 4L4LA 2V0TA 1VENA 3QR1A 3M0XA 3VIMA 1Q7QA 3WDRA 4D6HA 3A4XA 5BU6A 3ZWTA 3EOOA 2QV5A 3SCSA 1UWSA 3ONCA 2WCSA 4FXFA 3NSMA 4W4QA 3O05A 1KW1A 5IFPA 2PTDA 1LLWA 4HA4A 2AL2B 3E5BA 3BSGA 2HSAA 4K36A 4NHVA 5I3HA 3P0XA 5KEZA 4UOZA 4ZA0A 1DV7A 1LQ0A 3PN8A 4Q8PA 1ZBWA 1UZ4A 3VZYA 4EE9A 3FYYA 5FF7A 3GC4A 2CWNA 5LYRA 5EPDA 3SB0A 5A6KA 2V5JA 1EH9A 2B4GA 4AIUA 3QR0A 1V3KA 5CJNA 2PDHA 3CB3A 2CESA 3NQVA 5EKYA 3G18A 4GNVA 2DIEA 4O18A 4GVFA 1P6CA 3A4JA 3OP2A 2FGLA 2Z1WA 4NKCA 1P48A 2CHNA 3H2NA 4D6JA 4Z2JA 4IIDA 1KR1A 4CNPA 2XFWA 1NEYA 2ACSA 3WKZA 3LGGA 3SR7A 2FZ9A 1MUWA 3CWNA 5A3HA 1S5VA 1KFCA 4XKYA 3LGEA 3UWYA 2G95A 4HNVA 4CU8A 1YPFA 1X1ZA 3MZ2A 2Z27A 5XINA 5CZTA 4H01A 4HCDA 3QKZA 1HXJA 1UD6A 2HNEA 4XUGA 3TYUA 1QHOA 4AD1A 2DVXA 3MI2A 3QC0A 3LHTA 5D02A 3RCNA 3B0PA 1UR9A 3W2KA 3IGXA 5L6UA 3GKFA 3VDAA 4DI9A 2W27A 4RZ6A 5BZAA 6ENLA 2QQ6A 3TFXA 3BCFA 3GNXA 2W6RA 1XBVA 1EJRC 1OINA 1MNSA 3FS2A 4N42A 4DYEA 1ICPA 3TQVA 2Z26A 1Y0EA 1XYBA 3BDKA 4XZIA 1PBGA 3TDFA 5I03A 2ZC1A 4QP0A 3PJWA 2NSOA 3SCQA 1SMDA 3IS4A 3W73A 1WDWA 3I3DA 2AKZA 1ESWA 2ABAA 2VQTA 1TMLA 4ADUA 2OSYA 2DZXA 3AIBA 2TMDA 1W5MA 1M68A 3NURA 1WKYA 4H00A 4UTHA 1HG3A 1T0OA 4B2DD 1Z7AA 1ZJIA 1NDVA 3H70A 1QI3A 2A2IA 5TF0A 4OOZA 3WL0A 4KW2A 1JG9A 1YE4A 1QNOA 4F66A 1RA0A 2PF8A 1JUEA 2IUZA 3W7RA 1U5HA 1YRRA 2VEGA 1PX4A 2YLLA 3OB8A 4KWVA 1VZWA 4AXNA 1WXYA 2AAAA 2TAAA 4GIYA 5EY5A 4XZLX 2O9TA 3PZQA 1RBOB 3ZXWA 5DT7A 5KSWA 1VFSA 5T9CE 1HX0A 3VNLA 1JL8A 1GYNA 3TLLA 4UOQA 2F8QA 2XWDA 3WQFA 1V0NA 2PA6A 2WJEA 4M81A 3RM8A 4BY3A 4S3AA 1KC7A 1WUEA 4HGXA 1OB0A 3G1DA 4UTUA 5F2IA 5FJOA 1N55A 5K2ZA 3H7VA 5ABFA 3NQCA 4AWUA 4MJ4A 3NVTA 4O15A 2G3MA 2PD5A 1HTIA 5KMYA 2RUSA 3WQCA 4NUWA 1JF5A 1W17A 1I2RA 1BAGA 1TJPA 4W8BA 3TYCA 1YHTA 1ZJAA 3T2OA 3W76A 3MKCA 1KB3A 4HIBA 3BG5A 3TKFA 2QULA 2ACUA 3QV6A 2J13A 2HE5A 2GJXB 4TQTA 2FKPA 2GOKA 2H9AB 1YBQB 2I1OA 3KTSA 1RSCA 1XYAA 5BNKA 2CBIA 3H4GA 4XUYA 3BAJA 4GYKA 2OLHA 3W87A 1HQTA 1ONWA 2W66A 3KX6A 3UCDA 2VGGA 5FI8A 3I6TA 5HJXA 1RH9A 5E9AA 4XG1A 4A4AA 1O1ZA 1VYSX 4FMVA 1YQ2A 3GWQA 2KX9A 3M64A 3S5ZA 1QK2A 1UWIA 1NWRA 1SYTA 3GAKA 4JR5A 3BSHA 4MNMA 4JIIX 4GX8A 1S5WA 2IXUA 3R8HA 4LVBA 2Q6ZA 3UJSA 3RCYA 3CZKA 3HPXA 3QPZA 1ODZA 4KGJA 4IX2A 5K9DA 2QCDB 4CUCA 4OECA 3EA3A 2DVTA 1QU4A 1QT1A 1UR4A 3H6OA 3UR8A 3C2YA 5FKYA 1TQJA 2GJRA 4WDTA 2Y5EA 1IR1A 3GO2A 2F9RA 1MUCA 2MNRA 3R94A 5H91A 4C1NB 2D73A 3AHXA 4RE0A 3VK5A 2WVUA 1KM6A 5A6BD 2YL5A 2Y5JA 2O0TA 1JUKA 4U3AA 3G0XA 3A4WA 1YX1A 4LTSA 2CLIA 4LUTA 4YWIA 4EK7A 3F4DA 2QMKA 2BOFX 3NFUA 4V27A 3W6LA 7REQA 2XYLA 1WCGA 1XH0A 1E6XM 3UQNA 2FH8A 4JIHA 1EEPA 4C65A 3EDDA 3MP4A 4PL1A 4FZIA 1EGMA 3UJEA 1G1YA 3KTCA 3TYDA 2QEZA 3LCFA 3EDFA 3WH7A 4ZB5A 3H55A 2PLKA 2DH2A 4L1XA 1TRDA 4LYQA 1DWHM 1FWIC 4UCGA 3W23A 3HA1A 3NQAA 2YSWA 1BXNA 4NJGA 1IIGA 3TFCA 3G6LA 2JBMA 3QBUA 3HQ1A 4GNJA 3BK0A 4A21A 1ME9A 1YXCA 1K4HA 5HAOA 5A94A 3WO8A 3NQFA 4TTGA 2REQB 2BASA 1AW1A 1TTIA 3QN3A 1KR0A 5BMWA 2V5LA 1ONXA 3GFXA 4GY7A 4Q8VA 4H6EA 2E6AA 1QNRA 2G4FA 3TWBA 1DE5A 3NR0A 2QJHA 4J1OA 4PMRA 3T7VA 1AA1B 1SFTA 3OGSA 4AW7A 3LYEA 4LEQA 1QI5A 1W1VA 1F61A 4B90A 1OIMA 2BXVA 2ZCGA 4Z2KA 1S3TC 4GLEA 4X9YA 4LRTA 1XYZA 1DIOA 1E1EA 4OKDA 4A3YA 4ADSA 3L5AA 2C16A 2YXXA 3ARRA 5LXEA 5CLTA 2DSZA 4LBUA 5CKSA 4GFSA 4E8DA 1FCVA 1Y65A 2GUBA 2PDGA 3L4XA 5F4XA 2QUUA 2EGZA 4C6FA 5DELA 4QE4A 1TR1A 3MKKA 5KZEA 3NXFA 1W1ZA 4IOTA 1AQHA 3L65A 3AJXA 2RAGA 5ECUA 3KRUA 4EIVA 1GZJA 3J7HA 2INFA 3JZEA 5HNNA 4JYFA 2Y88A 3KVKA 4WSJA 3VE7A 4AC1X 1RY0A 4QNEA 3DC0A 1EUAA 2AMXA 2ZYFA 4ZSUA 3S83A 5E0KA 1TCDA 3HJZA 4PUJA 1WZMA 4LBSA 1QVBA 3H23A 4N4PA 5I24A 3PNUA 4XSLA 2IS7A 1RHCA 3OZOA 3WJWA 3CEPA 2O4MA 3N3TA 5DN1A 3WBXA 4R7OA 1E9YB 2ZC8A 2PURA 2A3LA 2VO5A 1V0MA 2L5HA 2DZVA 1GOKA 4A3QA 2WXDM 3G1HA 4LXFA 3MY9A 4Q8WA 3LUTA 5LNVA 3IJ8A 1XPYA 1ADDA 1OG0A 3CQKA 1VFLA 3WD2A 2V5DA 4KRUA 1R8LA 3B8WA 4BQ3A 5FCZA 3WFZA 1S2TA 2TODA 4DHGA 1V6UA 3C0QA 3NQ2A 1EGZA 1DWAM 3LXCA 1F3TA 5AC4A 1VD6A 4DJFD 3AZSA 1IXOA 1V79A 4YLWA 4KS0A 2GL5A 3V0TA 1V4YA 2Z1VA 3W84A 3P6LA 4OTKA 3T0DA 2Q01A 3U2ZA 4PMZA 3SSZA 2BVWA 3R8RA 3C86A 3CZLA 1CXIA 1T8XA 4P8WA 3AWNA 1LTDA 4B9YA 4GD0A 4AU0A 4WZHA 2QPXA 5GVJA 5IDIA 4NZCA 1OF8A 5C8BB 3P81A 1K3UA 2OG9A 2PU0A 3O63A 3EOUA 4DEFA 3LOTA 3K2GA 3GNRA 1X1NA 2ZUSA 4GHRA 4YS1A 1CIUA 3KBVA 3WK1A 2EJ1A 1XIJA 3I68A 3WDJA 3FW6A 3H26A 2DDXA 3QEZA 4W93A 1DOSA 5I2UA 1KM4A 1WNOA 3PWIA 4NNCA 4C6JA 1SFJA 1JRBA 3PM6A 1XLEA 1POJA 1XFBA 2ZTJA 1RPKA 2MANA 2GK1A 2YA2A 1GG1A 1H61A 3VZZA 1XKYA 2G37A 3EWCA 3CYJA 5H8MA 2P3ZA 1ZB5A 5DMMA 5CBBA 2OX4A 4MKSA 4I5RA 5JBEA 2E9LA 4B4FA 2J47A 2BNJA 4JTQA 5A8NA 1XICA 1EUNA 1EJXC 1IGWA 4AY8A 2WMIB 4JN6A 4O53A 3E1F1 3NZQA 3WF3A 3QR3A 4HYRA 2QCEA 1ITQA 3EPNA 1EEXA 2VUYA 2VJXA 2JE8A 3MQTA 1V02A 5DMNA 4FNTA 4FLSA 1BQCA 3DI1A 3LPOA 3WJSA 1V93A 1TTPA 2EPLX 4HZMA 3W24A 4HTYA 4P5UA 2DSVA 3PF3A 3I65A 2V5BA 3VGFA 3GC2A 4PTDA 3NPXA 3UZZA 4Z2GA 1GOWA 3O7UA 3M43A 2PC8A 1R6WA 3C8FA 3VFCA 7ODCA 3S2NA 2DT2A 4YNGA 2X2GA 1X96A 3ALFA 5BYWA 1UOZA 1GNXA 2ODOA 3LI1A 2YW3A 3AICA 3GVGA 4AWEA 4QFUA 2ZUVA 4LGXA 1E6NA 3U48A 4AFYA 5EBUA 1OC6A 1ISYA 3QOMA 3PJUA 1R9XA 1S3HA 1XLJA 1BYDA 4Q8MA 4DZHA 3MZNA 2HNHA 3SZ8A 1VQTA 3LSBA 3UYCA 4Z42C 5AYIA 3W0KA 2HEJA 3KOZA 3AXKA 3HGOA 5I3KA 4EXAA 4DBDA 1OC5A 1BVZA 5D30A 3TLQA 1EX1A 3RO6A 2UY3A 1GKRA 2YL8A 4PUEA 1LM1A 3T6CA 2FZNA 2PDKA 4QE1A 1UR3M 3DXIA 1V7AA 4B3ZA 4GUIA 4BQ2A 4WDUA 2E25A 3PG9A 1GQJA 3MI6A 4MDPA 1YDOA 4JDYA 1RUSA 1R3YA 4WY0B 4V33A 4LYKA 4DRSA 3ZLGA 5A95A 4IFOA 2YGYA 1A3WA 2ZRYA 4PCFA 4HVXA 3VGBA 2DW7A 3OZMA 1FWSA 1I60A 4NRSA 2PWDA 5K3VA 4RV3A 5I3JA 1XR2A 3MW7A 3G1RA 5C9XA 3VNIA 1KCXA 1JFHA 1JD7A 1H7RA 1EJTC 3VVGA 4OHQA 3SFWA 4MWAE 2NX9A 2VRQA 4O1AA 1S38A 1W31A 1UKSA 1AMKA 2VZOA 2VMFA 2XZ7A 5L9FA 4PMXA 1J0YA 4U2YA 3DYMA 4IX0A 1XIBA 1RD5A 1DBTA 2WC3A 1JDAA 5CAHA 4O14A 3RO8A 3IANA 2XM1A 3IVUA 3UXAA 3WF2A 1MVYA 7CGTA 4EVZA 2E1WA 4L6HA 3HV8A 2VR5A 2X0YA 4D1JA 2QCNA 3G1AA 5JVLA 2YFNA 2VD9A 4D9PA 1D7FA 2PLCA 3DEQA 1CI1A 4Z08A 1TV8A 2OYMA 3IARA 2ZUNA 1RCXB 2OSWA 4NVTA 3C2RA 4ZTYA 5H2ZA 2J62A 1Y5VA 3S9ZA 1TX0A 4XKYB 1XH1A 3W37A 2Q3OA 1LUCA 4HK5A 3N1AA 4W89A 1G5AA 1NFBA 3TYAA 1AL8A 1EQPA 4H8VA 4GI9A 1ITXA 2G0WA 3N4AA 3ES7A 2UZ9A 1KGUA 2R14A 3NWRA 1KXHA 3UA3A 1JQXA 4H19A 4W84A 3TJ4A 1TJ2A 4UTTC 3F4CA 3LMZA 4X9SA 4IJRA 3DHPA 3LLDA 1NP0A 2PUZA 3MCOA 1UJQA 3HURA 4F0MA 3NO5A 2OQLA 3KOFA 4DJDD 4YVVA 2GUYA 2OLSA 2P8CA 1C7SA 2XIQA 2ZZ1A 3ARSA 4M0XA 4OE7A 3VOHA 3CPRA 3NEHA 3F4NA 2VM8A 1Q6OA 3W85A 2ZX7A 3DGRA 2VRJA 1JPMA 3NZPA 4IMCA 1LT8A 2Y24A 1FXQA 1LL6A 4W7WA 1B3XA 4QS6A 1DWIM 2VHLA 2X8RA 2I16A 3E74A 3GBEA 1DL3A 3PHAA 3JS3A 3LPFA 3K13A 2NV9A 8CGTA 3TWAA 2HCVA 4K6AA 4UTMA 2G4JA 2HJPA 4CEUC 3GUWA 3G8RA 1IXPA 3MC5A 1NFGA 3W7GA 1KGXA 4PSRA 3PP7A 4CN1A 4I6VA 2P88A 1E4IA 5D8ZA 5AYBA 4KWUA 4MB5A 4YIWA 4IP4A 1N82A 3B9OA 1E6SM 3ERPA 4C6BA 1QTWA 4Q32A 3U0HA 2BVDA 3ZR5A 4AC7C 3N13A 1W5NA 3CMFA 3SGZA 2OO6A 3I4EA 5C6MA 1CBGA 2DEPA 3ZSTA 4WDXA 4IPLA 1F2JA 3BLPX 3HPSA 1EPXA 4RXFA 3BSMA 4IMFA 5U4NA 1GVIA 4EPBC 3RITA 3AI0A 2ZXBA 3VPLA 1XF0A 3I3EA 1KBIA 4DF2A 4OBRA 4ZQCA 4FPSA 5HDRA 1JZ4A 1NQ6A 3VIOA 5BXTA 1EYWA 2QNEA 1XISA 4U5IA 3FLUA 4JTRA 2Z7GA 2WSRA 3JUGA 4X61A 5ABFB 1UP2A 1MQRA 4YTSA 1X39A 3CL7A 1Z9AA 5K7JA 1H7PA 1XV8A 4DPPA 4GK8A 3TE9A 4PTNA 5XIAA 1HFBA 3SQMA 4M7SA 2V38A 1REQA 4Q4OA 4AWSA 3U2OA 2I9EA 2Y7FA 3S2CA 3CUXA 5BRBA 3GQYA 3EDKA 4GZ7A 3EBVA 1UR0A 4LUIA 3NSNA 1GT8A 4FLQA 4BF5A 5GJNA 1Y8BA 2VQUA 1UWRA 1R2TA 3G22A 5FJTA 1RCQA 1L8PA 1ZP4A 2J78A 3BAKA 2YL6A 4XVEA 3VGDA 4LH8A 2XIMA 1SGJA 1KA9F 1E55A 1XDMA 2HRWA 4HBKA 4Z1BA 4GA8A 4PRTA 3K46A 1WB0A 4N02A 1W56A 2HS6A 1J93A 3MTWA 2D2HA 4UFLA 1W9DM 3AMDA 1IZCA 2GQAA 3NXLA 1FVPA 4FLOA 3C0JA 3G6MA 4NYYA 4TMBA 4PMNA 3CV6A 3TQ0A 2FPVA 4AQLA 4LANA 4RDYA 4OV4A 3UG4A 1IXNA 1RA5A 3S42A 3JR2A 1WAWA 4LC8A 4EX4A 4IJCA 1IXQA 2PE4A 2NVCA 1VEMA 4XZHA 3E2QA 1MXGA 3R12A 1TJ1A 3CWOX 3S9YA 3E0LA 2QR6A 1W91A 1UQYA 5G4HC 5A6SA 3MV11 2Y70A 3W02A 2Z4GA 3TOPA 1KGWA 1VBJA 3W22A 1Q8AA 4J3XA 3JU2A 1Q6GA 3PAOA 1JXJA 1OGSA 3MUXA 4MF4A 3EWBX 3PZTA 1K6WA 4E0CA 1RAKA 4DLMA 3F7JA 3TA9A 1O94A 2QDDA 3WBEA 3WEOA 1OCJA 5I3FA 3PC0A 1QO2A 3E02A 2NV2A 4LUTB 5IBXA 5E0CA 3NOEA 2GOUA 2O9PA 5F1UA 4A8NA 3CTTA 4M6QA 1JZ7A 3NTYA 7REQB 2PPGA 3I3BA 4JEJA 1E5JA 1PKLA 3BH4A 1XSJA 5DANA 2C7FA 1H62A 4I5UA 1SR9A 1XIEA 3Q2DA 1XGZA 4GQBA 4KEUA 5I3DA 3PUDA 4DJEC 3MPGA 1JYNA 3OBEA 4UFJA 3FN9A 3M6YA 4ICCX 4GCAA 3N04A 2RGLA 2CETA 2FPYA 2R1MA 2JALA 4IIBA 2XN2A 2WLZA 1VFHA 4GXWA 4S2BA 4XIAA 3TN6A 1R3VA 4ML9A 5G4WA 4DNHA 3HFYA 1J5TA 1PTAA 2RH9A 1PIFA 4UNIA 3RCMA 3BW3A 5A6MA 4QLLA 1K03A 1OT2A 2Z2BA 2QAPA 4G1KA 3VIHA 3LENA 2O9OA 3FX4A 2O55A 3D46A 1LLOA 3VOFA 4XB3A 3BQ5A 1NP2A 5LZLA 1XLGA 5TQLA 3G1VA 2PLJA 1HKWA 3LRLA 2GSJA 2OGYA 2VL4A 4HNOA 1B57A 2Q8XA 3CH9A 3EX1A 4DM1A 4DUWA 3SBFA 2WW5A 4AEOA 3CU2A 4J9JA 3W2UA 4JQ3A 5DMYA 1LRTA 1I4NA 3AYRA 4GUFA 3LTYA 4F9JA 1Q7ZA 3O2LA 2O92A 5FAJA 4HA3A 1DXFA 3N2XA 3DI0A 3T0BA 3B05A 5CJ5A 1O12A 4M82A 3NNTA 2D22A 1YYAA 5IOBA 4I5XA 3ZVIA 2XIIA 3NUKA 1WOBA 1C91A 3NOYA 3R5EA 3VFLA 4WUIA 5FJPA 2JKEA 3DKLA 5XIMA 4LY4A 2ZUTA 5D37A 4Q6JA 3UD6A 2WYSA 2B7OA 3MJMA 4YTRA 1HKJA 4DBEA 1CXLA 3RLHA 1UA3A 4LNCA 1GPWA 1QBBA 1E4LA 3GDMA 3U4AA 3AYTA 1VP5A 3L0GA 5TBOA 4GIRA 4CKQA 1EF3A 4HA1A 1J6OA 5I02A 1HZYA 2WVTA 2OJPA 1SO3A 1VEPA 1V0LA 3EA2A 2V30A 2WANA 3L9CA 5KITA 2Z28A 3VKJA 4QS5A 1I0BA 2CFFA 4H41A 4JY9A 4X63A 2Q09A 1I45A 4PUMA 4JPGA 4C6MA 4PSPA 5M03A 5LGZA 4PCTA 3GR4A 3DYOA 1B5TA 1XRSA 4QIUA 1R46A 4NG3A 4C6IA 3K8MA 1PB0A 2PGFA 4MZYA 5IHSA 4QAIA 5CBIA 3TP4A 1QWGA 2P0IA 3RM9A 3URQA 1BVNP 2I14A 1TWZA 3LGDA 4JNYA 4WQ6A 3Q67A 2VEFA 4M7TA 3CZGA 1GOOA 3WFLA 3CAVA 2EEXA 1T5AA 2WJFA 2GGIA 7ENLA 3CM4A 3SEPA 3W2NA 2I56A 3VNYA 5CGQA 1CZ1A 4GXPA 4LAUA 2PTYA 2PDNA 1GHRA 1JI2A 1TZ7A 3FAXA 3RG6A 2C79A 2FVKA 1LBMA 3FA5A 5BOEA 1UROA 2ALRA 3ZJ6A 1EDTA 4IGMA 3P14A 2VOTA 4NYUA 4N4QA 3GDKA 1J9YA 4J35A 2A85A 2ZZ3A 1ALDA 3GFZA 3BGAA 1SO4A 4D8LA 1S2UA 5D2YA 2WWDA 2ZZ7A 2E09A 5RUBA 4MB4A 3QV8A 4L9XA 3BAXA 3GE7A 1ISWA 1P6BA 1W2PA 3AIVA 3ZS4A 4UMCA 2G5WA 1WO2A 5JH1A 4NJJA 4A6GA 4PGLA 4D6FA 2CXEA 3W74A 4Y9MA 4HKPA 4LBRA 5C9RA 4O1BA 3M5XA 1PYFA 2GK1B 3QLDA 3LTSA 3WNMA 4BHYA 4GE8A 4A3RA 2DVUA 5BXPA 2CZDA 2W4XA 3O07A 2A1YA 3WUFA 3GDTA 2A5HA 3ZLFA 4LVDA 1KM5A 4K8EA 3N9SA 3U9IA 3NQDA 4WCJA 1W37A 3UFYA 2BTMA 3DC8A 3WUBA 4ZQNA 2J6XA 3VI2A 3E0WA 1PX8A 2HBXA 4JHMA 2WCAA 3W81A 1QBAA 4O54A 1SR0A 3T08A 1RR2A 2CWXA 3KTXA 1H7WA 3PPFA 4Y8EA 3AO0A 1A5SA 1Q6DA 4HU3A 3M41A 1AZ1A 5LNUA 2XIJA 9RUBA 5A6BA 3LBMA 3PB2A 1HJVA 3CPUA 4MY1A 2AKMA 1LWHA 2YOCA 3P3BA 4JXCA 1OBAA 3VX1A 3T4CA 4BEQA 3S9IA 3L4TA 7PTDA 1DIKA 3Q37A 4WJ8A 2ZXDA 1JCNA 3W7OA 4H9YA 4INFA 4CN4A 3HFTA 2QT3A 3QZEA 3KCLA 2NUWA 2FMNA 3ZO9A 4PB5A 2YDQA 2NW0A 4QQ3A 3CQ0A 1FCUA 5CPSA 2ATMA 1PHWA 3ARTA 1M3UA 5AHNA 5EMKA 2VFEA 3GZAA 3OZPA 5D2TA 1R85A 2B7PA 4LF1A 4H2CA 5HMEA 3GDLA 4B5XA 1XS2A 4HMEA 5DFAA 3GM8A 3DN5A 4HP5A 4EANA 1KM2A 5FJUA 1NY1A 6REQA 3MT1A 4QG9A 3EMQA 1Q5MA 4IG2A 2JKAA 3D6NA 4MJZA 2ZRUA 3TONA 4E2VA 3AIWA 3WJXA 3H24A 4PTXA 1D9EA 2P10A 3W26A 3GU9A 3ABRA 4F2TA 2POZA 4G5DA 3HGJA 1A0EA 1WYIA 2PEVA 5GNZA 4GH1A 5MKGA 1J18A 5G1MA 8XIMA 1DEDA 5FAGA 3RX2A 1MXSA 4U10A 3EXTA 4EWND 4K7VA 3SECA 2E3ZA 1G9HA 2VVSA 5CPLA 1EO5A 1A0CA 3GTNA 4LAKA 3ABSA 1VBRA 4AYGA 1CTNA 3O8AA 1R38A 1Z8AA 4M6UA 3UCCA 4ZFCA 4M3PA 3VOGA 1BEUA 3CHDA 3W70A 2EG8A 2ZE3A 1HKKA 5DBUA 4LSBA 4M6PA 1VS1A 4NZ3A 1K7XA 3QSRA 5C54A 4P61A 3WLHA 3PZMA 2Y7DA 2H3BA 1XYCA 3GTFA 3DAQA 3THDA 3O6YX 4JTJA 2J7BA 4N0RA 3WD4A 1WQ5A 3MDUA 1LL7A 2BGSA 2E0PA 4CLMA 1XGDA 1QW8A 4RZ5A 3T9PA 3I6EA 3JZUA 2OODA 3TOYA 3GIPA 2P5NA 1OX4A 5M2FX 1QW9A 3GK0A 3UWUA 1HVXA 3RX3A 1SZNA 4O8AA 4UTWC 1VF8A 1BGAA 4GRSA 4GYFA 2F7FA 2WAGA 4ZOEA 2PS2A 3M0LA 3TC3A 4N6FA 1XBZA 5FF0A 1S2VA 5FEZA 4HPHA 1V77A 4FEZA 1H0IA 1XC6A 2GVEA 2YL9A 2WHJA 4H83A 3WQGA 4P7LA 1X6UA 2V3GA 4L9ZA 4V1XA 5IRPA 2F6XA 1Q2RA 3G0SA 4J2MA 3MBFA 3DGBA 4BF9A 3OG3A 2QXWA 1FA2A 1DIEA 4TXEA 1B3YA 3R43A 5D2VA 4K8GA 4PFMA 2QS8A 2WQPA 1LUCB 1C29A 4LF2A 4OIFA 1FRBA 4JTUA 2ZDSA 2ZRZA 1PE1A 5BXSA 1B3OA 4DJFA 3QF0A 5H1WA 3AUJA 2HROA 4IQLA 4BZYA 3QZAA 4Q7NA 2QLYA 4QJ1A 1QFEA 4LPCA 4JQ1A 3AS0A 1YE6A 3CT2A 4MNKA 3ZOAA 4RE3A 1KCZA 4FOKA 4IXHA 4MWAC 5C0QA 1UOKA 2FJUB 3DFOA 4HNTA 2ZA2A 2HISA 2PDJA 4GBUA 4BQ4A 3C2EA 3T55A 1DWJM 3WIJA 2QCHA 1DQWA 1FFRA 2IPFA 1ZUAX 1A53A 3CHEA 4O1EA 2DUAA 1PV8A 3LNPA 3QY8A 3ANVA 2PRHA 3GNDA 3T8LA 2OT0A 1F8IA 2OO0A 3EB3A 4WXZA 4ZO8A 3DG6A 4FK9A 5A8MA 2GGJA 3LCHA 4HHPA 3II1A 1TWDA 5DEZA 3W25A 4AZCA 2J9XA 1TPH1 3LS9A 3M5VA 3QSTA 2PDPA 1QOPA 3RFAA 3S5OA 1W5OA 2Y1HA 3HPAA 4F40A 3N73A 4LB4A 3HGRA 3P93A 2OXNA 2GGGA 3N2CA 1GVSA 1JYXA 3IEBA 3INPA 1Q45A 3F4VA 1Y7VA 2ACQA 4H9XA 1RP9A 1UR2A 3B9EA 4AXKA 1KCKA 4X2RA 4S23A 2A3HA 1DJZA 1BG9A 3VDCA 2DU2A 2XHYA 2NQ9A 5HPCA 3W1TA 4ADTA 1EL3A 5H8PA 1D8WA 1DJHA 4J27A 3UZWA 3HN3A 5AN7A 4ZE5A 1PUDA 4UFMA 4H1ZA 5JMUA 4S3KA 2YYTA 4AISA 4IJBA 3IVSA 4I9AA 4ZR8A 5EMJA 3VMPA 4Y9PA 3ZMRA 3CLWA 5FL0A 3EOEA 3R1ZA 4CEXC 1A0DA 2YBTA 1I8JA 4HNCA 4LYRA 2RKXA 2C1HA 2VXNA 4DO7A 2EXOA 5DLCA 2HWGA 1YTKA 3D0CA 4K1GA 4XD6A 3WH5A 4GINA 4R5EA 4GH3A 3V35A 4FF7A 5IXEA 4QG8A 1KCLA 4ACZA 1A5AA 1YIXA 2WMHA 3PZIA 1REQB 1HL8A 3FKRA 2Z1SA 2PI6A 4DWDA 2DP3A 2FDSA 1AJZA 1GQLA 3C2OA 4KCUA 3GXPA 1F6YA 2ZIDA 4UOJA 4GJ1A 1CXFA 4UZUA 4CQDA 1DYSA 3SRHA 3VUSA 2VP8A 1DJNA 3CASA 1EBHA 3APGA 4CNNA 4HD5A 4FX6M 1IYXA 1A47A 3E6EA 4UQCA 4ATWA 3W7JA 2ZRXA 4AYSA 4JFTA 3V5OA 5BRPA 3PTDA 4BWLC 3W7IA 1VLIA 3AJ7A 3K1DA 1O6IA 2QUMA 4HOXA 2BODX 4C7GA 3XIMA 4IP5A 3AIRA 3UWVA 4XZWA 1EP1A 3WLJA 4DB7A 4FAMA 2H6RA 2Y85A 1XCFA 4NJKA 4O57A 5FESA 2V5KA 1QO5A 3WLMA 4QDPA 2J8TA 1F3WA 3LK6A 4Z17A 3RMJA 3R4IA 1I9CB 3R89A 4BF7A 3S47A 3UP8A 4W7VA 3EYPA 3KFTA 5I07A 1K9TA 3BANA 3O6DA 3V5CA 1WZAA 3WDIA 2Y0FA 4PH6A 3R58A 1OYCA 3MMDA 4PULA 3FFSA 5KTLA 3MSYA 2NVAA 4MHBA 3G77A 2RDWA 3EDEA 3A64A 3N29A 4O52A 4XZNX 3WDPP 3CMJA 2ZICA 1EC7A 5G2IA 3QOKA 2Y62A 3QZ6A 3E0VA 1XC4A 1P1XA 1R5YA 1M7PA 1A50A 1JDDA 1JD9A 1QNSA 2PGEA 1L6SA 3QY6A 4FXRA 1VFOA 2IW0A 3DHFA 3PULA 3V1PA 2ON3A 1JFXA 4KERA 5FJJA 3CNYA 1M53A 3LD5A 1A5BA 5HR6A 1A4LA 1DJYA 1C3FA 4EXBA 2W61A 3LZ3A 1AD1A 4Q4MA 3QPEA 4B3LA 1E71M 2FVLA 4GVHA 3WLRA 3F4WA 2IPJA 3I4KA 2WNQA 3BV7A 1EJWC 4OT7A 5C9ZA 1EB3A 3WF1A 1BWKA 5C5YA 1ISVA 4QLJA 2V82A 2ZKMX 1FWDC 2DZAA 2DW6A 3WLQA 2VGFA 5HATA 5B80A 1W1B1 2AGTA 4QJ3B 3SN1A 3TNOA 1EJVC 5GNXA 4Y96A 2NV1A 2OELA 3S5NA 2ZZ5A 4JTLA 2X7WA 3GTHA 3ITXA 5EMMA 1GEQA 3CO8A 2CBVA 3QMSA 3WEMA 3AU6A 3HG3A 4WVXA 2HE8A 3WJYA 3NZRA 2CKSA 3OYZA 2ANUA 2FB2A 2X1RA 3BG9A 3OLDA 2RFGA 4GI6A 4YVXA 3BAIA 2E77A 4D72A 3WD1A 1VPYA 4JEQA 4UB9A 5FSDC 3BAWA 3M0HA 1KXQA 3UPMA 4B5VA 1GJWA 4C91A 4ATLA 5CC7A 1QAPA 5KETA 4DJDA 4P2VA 4H9VA 2X1SA 4HPNA 2VCAA 1WBHA 3AISA 1XQKA 3C0LA 5BWAA 1AUSL 2YB1A 1K70A 4AEEA 3BW4A 2JQXA 4H9TA 1FH8A 4B5TA 4FP1A 1H5YA 1VJZA 2HVMA 1BWVA 3O16A 4M24A 4GJJA 4WJEA 3L2LA 4ZCWA 1WPCA 2ZA3A 1UWAA 3HU7A 1W3JA 3QH2A 2J7FA 4UBPC 2GLKA 3PTKA 3UJFA 3M5YA 4LY8A 3UY8A 2YZ5A 2VT0A 4IGSA 1BKHA 3WK2A 3KZPA 2PGWA 2CHOA 1J0HA 2FH6A 2Y61A 5CPTA 4H6QA 4Q4RA 3TV8A 1CGWA 4NNBA 3WH9A 3BLKA 2HK0A 1XDJA 1UCWA 3H22A 1ENUA 2OYKA 1OIFA 4K37A 1L2UA 3PUGA 2CLLA 2E8YA 1XFCA 1AH4A 1C9WA 2R1PA 1UIPA 3TTYA 1RBLA 1I6NA 3VA8A 1UMLA 3EMZA 1WKEA 4I9TA 1PKYA 3MANA 5DO8A 2JGQA 4ZO9A 1MFUA 4PUDA 4I9MA 1B9BA 2CZVA 3M16A 2WBKA 3FVMA 4E2DA 3AS2A 3T07A 3CTLA 4GNKB 5AZ1A 4LUSB 1XYFA 3VX0A 1CPUA 3H4WA 4TVUA 5KINA 4HK6A 2E8ZA 3K4WA 3RRAA 1PDZA 4Q3MA 4NAFA 3V75A 4OWGA 2J7HA 1V0KA 1PSCA 3EX3A 4AD3A 4R88A 1LZOA 2F2HA 1KBKA 4JQ2A 4WGXA 4XZ9A 1N8WA 3CT7A 1U5JA 1HL2A 3Q45A 1Z6KA 2HMCA 5JIWA 5HMDA 3EPOA 2WPGA 4IIEA 4WX2A 3M1ZA 1MRQA 1XX1A 2E5DA 3WQ4A 1TV5A 3MP3A 1JGMA 1I0DA 2QV4A 1GHSA 3A3HA 3MO4A 4WXYA 5JU6A 2MUCA 2CEQA 3EGJA 3STPA 4UFKA 1PTDA 2Z2UA 3MB9A 5I7GA 3N14A 3AAMA 3THAA 4IPNB 2F6KA 2RHGA 1W3LA 2RGMA 1C92A 3AXHA 4G56A 2PDCA 2EPKX 1TQXA 3P7YA 1QXLA 1BTMA 2A3CA 5E70A 4OQVA 2OOFA 1TPFA 4R9OA 3U7BA 1GVRA 3E3HA 4ICMA 2QZRA 3JRKA 3GB6A 1J8VA 4GZIA 2UV8G 3QW4B 3HM7A 4P8UA 5AYXA 4DXKA 4O50A 4QAWA 4CCCA 1FXPA 3L23A 2PZNA 4JS3A 3B8DA 3OIXA 2V63A 3WUGA 2Z6JA 4ALDA 3DENA 1CGUA 3VDHA 1A3HA 1Q8JA 3I7QA 2NUXA 1JJKA 1TSIA 2BY2A 4OZOA 3N17A 3WH6A 4DJED 3JW7A 2Q02A 2X7VA 1OYBA 3EWXA 4KRZA 3TW9A 1UJPA 2VFIA 5I5RA 5HJYA 1EOMA 3PAJA 4WGHA 2A21A 3N6JA 4RL3A 3STEA 3W9ZA 5HMSA 4IL0A 4EKJA 3PUOA 2C14A 1CB2A 3P60A 1Q2SA 2V3FA 5AKQA 3IIPA 4LCSA 1H63A 3P5ZA 2CIPA 1XH2A 3O06A 1W1TA 4XISA 4UC5A 4NF7A 4O10A 3WMSA 2FZMA 1H1NA 4UQDA 2DH3A 3HIJA 1WV2A 4MAZA 4P7NA 4J3ZA 1SQ7A 2HBVA 1QOQA 2XVGA 3RXZA 2XTKA 4XSMA 4MG4A 1KXVA 4WKFA 1JPHA 4CU7A 4IH3A 3KLLA 2OZ0A 3S4TA 3NM1A 3P82A 4ILSA 2RJHA 3MWAA 3C3NA 3L4VA 1PWLA 3PNZA 4PMVA 3WD3A 4QX4A 4EAMA 1TREA 1KO0A 3N9RA 3L2MA 4U5KA 6REQB 1JPKA 4YU1A 5EMYA 4Y6GA 4IG2B 4JQ4A 3RLUA 3P2VA 3NO1A 3TX9A 2NQLA 1JYVA 1FWBC 2NVDA 2FJKA 4O0QA 3WUEA 2QDHA 1E43A 4N9EA 5DY2A 3KOWA 5M17A 3IVTA 1J0JA 4DX3A 3ITLA 4DN1A 1D3HA 5MKGB 3F2DA 3N18A 4S3GA 2NQZA 3RU6A 3NDYA 3WBWA 1XJBA 3QMRA 5CCZA 3SY8A 3SADA 2PF0A 3P0WA 3G0UA 3JVAA 3QRHA 4JL1A 3APYA 3ECQA 4YVPA 2P3EA 3K4DA 4JFSA 1DJIA 4K8HA 3GXTA 3WJZA 3UR7A 2CLPA 1E9ZB 1U83A 4MSSA 1T8QA 3DG3A 1ECQA 3AOFA 1P0NA 3H54A 2O7QA 1VFTA 5BW6A 4Q7BA 3BC9A 2PDLA 3VKCA 4CD5A 3E5PA 1XLFA 2YCJA 3GIYA 4C6CA 1VH7A 1RV8A 4RX0A 3TN4A 5FF3A 3S46A 1FWEC 2DZPA 1OX4B 3FCPA 1UKPA 3B9NA 3TZNA 4CD8A 3DDMA 3MVTA 3PBGA 1GJPA 2VEMA 2FTYA 1T6MA 3KP1A 3DBNA 3MHGA 2VZUA 4L64A 1XYMA 5BRQA 4K2SA 4MKNA 3DX5A 3CL8A 4IUOA 1PVNA 3LPPA 2XH7A 3H7UA 3KVJA 3WFAA 1YNPA 1R3QA 4XVDA 1NSJA 1W3IA 4Q4KA 1B4KA 1GYLA 2J24A 5D05A 1XIHA 4QSHA 4JTEA 1CW2A 3TTSA 2V2HA 4GC3A 2G41A 3VKDA 2QPSA 3FJ4A 3D3AA 2Y4SA 4UMAA 3GH4A 1MEIA 4NNAA 4O12A 2EHHA 1BLIA 4P7RA 1E3ZA 2GWGA 4QR6A 2ISVA 4JIQA 2DIJA 3R79A 2B7NA 4LOCA 1AG1O 1GQNA 4H7VA 3EWYA 2ZOXA 4GQGA 2YFOA 1GKQA 1ZJHA 3N12A 3TSMA 4GKLA 5D38A 4KFPA 3WQEA 4B92A 2V68A 3QYQA 3CUJA 5GQBA 3LZ5A 1JRCA 3BJFA 3W1QA 2VX6A 2OFJA 3B8IA 4LFYA 4BI6A 3RF9A 4GMEA 1KFEA 4DBWA 4FNPA 6XIMA 2ZRWA 2ZADA 2X09A 1TJ0A 2E6YA 3OHIA 1SJBA 1B3VA 3KM8A 3CK5A 3VIPA 4PFHA 1B30A 4KCWA 2GJNA 1PKNA 1YW1A 3BGGA 4QJ4B 5CZSA 1SZEA 4GGBA 2HPIA 1V6TA 4ATDA 3ABQA 3S1XA 4J3WA 2ONEA 3HZ3A 4Z2HA 2RDTA 1NM9A 4WY0F 1ZTVA 3BUVA 4AZCB 1VAHA 5FIPA 3IIXA 1XCWA 2WBGA 5ABEA 1PL9A 1S5TA 3BQ6A 3MMTA 3M0MA 5E09A 1OFRA 4IPJA 2PDFA 2EG6A 4IMGA 1QASA 1LQ2A 2Y2WA 1Q6QA 3EWZA 2ZDRA 3AHTA 2HDJA 2WZTA 1GTEA 3SJ3A 2A3AA 1UB3A 3LBOA 4D6DA 4JQAA 3APTA 2P1FA 4R33A 5HUOA 4D6EA 3I6RA 2G96A 3VNJA 3CS2A 1G6CA 1UMYA 4FX8A 3W82A 1SVDA 4U33A 1M41A 1KM3A 4S39A 2VDGA 3GHTA 3VO0A 2GVYA 3SUWA 4M6VA 1Z41A 3LCGA 1DWFM 3W88A 3OODA 1D3CA 4JTFA 2G3IA 3NCOA 3N4FA 5FF4A 3UWWA 4DQWA 3WQWA 5CBJA 1GUVA 3GTIA 4LWWA 5CC3A 4Z1DA 3VDGA 2PDQA 3REQA 2W79A 3ANYA 3S6OA 5A6JA 3TVAA 1GORA 4G6CA 1GVFA 1Q7MA 3R6IA 1XLMA 2Y8KA 1T96A 3W7KA 1KTBA 2RDUA 3CLMA 2VURA 4FB7A 3CGTA 3N34A 3DFNA 4IT1A 4JTKA 2FLIA 3BCDA 4PEEA 4ACZB 4ZQOA 1X38A 3C61A 3IRDA 2C19A 3OJGA 5D03A 5CQ1A 3EX4A 2YCKX 1R0MA 1V6YA 1MWOA 1ZBKA 4A05A 1AFSA 3OVRA 1O68A 3MUAA 4XV0A 3VD9A 1BXBA 3W1LA 4C7FA 4O8RA 4R34A 2OVLA 1OWQA 4E8CA 3NPUA 2XPKA 4AHPA 2YA1A 3IJ9A 4POCA 1RK6A 2WNZA 1CXKA 3OVQA 3UG5A 3CUZA 3IIZA 2DY3A 3URAA 4S3FA 4NXSA 4FXSA 3A12A 1ADOA 1WDQA 4UFIA 1IZJA 2ZUWA 3U4FA 3WLOA 4EF8A 2IQDA 5E1QA 1E15A 5TNVA 1E4MM 2GSHA 2ISWA 4DI8A 4KBXA 2FHFA 5AY7A 4BCEA 2NQJA 5HQLA 2G3FA 3KBWA 4R9XA 4YJ5A 3B0YA 2W92A 1CYGA 5C70A 2BOGX 3MHUA 4AD0A 1E73M 1YTEA 2YA0A 5EA9A 1Q65A 3TNBA 3V1HA 4AVOA 4PBEA 4US6A 3GH7A 3M0JA 1EWEA 1VFMA 2VC9A 2VC5A 2FVMA 1XUUA 1ZAHA 2OEKA 2R1NA 1FKWA 3NJ3A 1AL7A 1LORA 3G1XA 5EMUA 1G0CA 1GOIA 3NL2A 1YADA 3ZJKA 3BOXA 4JKKA 1NDZA 2VDHA 1H0GA 4AZHA 5AOUA 2EPOA 2NQHA 3S1UA 5CGTA 3ISIX 1OZMA 4NY2A 3AHZA 1YTDA 3TQKA 5D9MA 4L4MA 2A6NA 4ES4A 2PB1A 5C9UA 4J3UA 3BAYA 5T8GA 1LF1A 1X1OA 2FB3A 4JOMA 3NVDA 4HU4A 2VGBA 2O7SA 3L12A 2ZUUA 4C6DA 5AHMA 3W1UA 3TJLA 2AAMA 3MUY1 2OKTA 4A8IA 1ICSA 1I2PA 4K7YA 4MPQA 4MWAD 4YYCA 2Z29A 3UU0A 3NQMA 4QLKA 3UNDA 3LHUA 3FSTA 1EXBA 3BTNA 3FJNA 1I2NA 1XD0A 1TPC1 4ZSTA 3T1GA 3S1GA 3GUGA 3PZVA 3LHVA 4KMQA 3WD0A 3IIVA 4PMOA 3S0CA 3VOJA 3TC6A 3W86A 4L65A 2Z24A 1UKTA 4LAZA 3AQUA 4PYSA 3RHGA 1US0A 2WJZA 3PBWA 3M5ZA 3NG3A 2LLEA 4ZOCA 4S38A 1QMLA 1O5QA 2UY4A 3SM0A 4XD5A 4TOQA 5C9WA 3EZ4A 5JIPA 3SI9A 4O0ZA 1FWRA 1P43A 4QE5A 2YJQA 3N2TA 3PFRA 1RJRA 4PMYA 3OTRA 2WSPA 3GKAA 4XX6A 3AS1A 1N2VA 1KV5A 1NWUA 1XI3A 1MW2A 1F9CA 1AZ2A 4DWSC 2VR2A 3VU2A 1LT7A 3AFBA 1GZ1A 5J5RA 4L1GA 2PWHA 2B0MA 1AW5A 3W71A 3OO2A 3FEMA 4RE4A 4FX7A 1EA0A 3ZR6A 2ZE0A 4IICA 5HPOA 1E1FA 1EHAA 4TO8A 3RYSA 3WQ6A 2E9MA 4JHOA 3WK3A 1GQIA 4B5NA 2OB3A 3BVJA 4WRHA 1O5KA 3U8GA 3W1XA 5BCAA 5BWFA 4W88A 5FOOA 1E6RA 1W9XA 3W7NA 1E1CA 4GYPC 4UTFA 3ARWA 4JCLA 4HMCA 4AMCA 5D32A 4Q4PA 1OFOA 1GONA 3W01A 3SUUA 3FDGA 4PUUA 1JCJA 4LS1A 1V6WA 3MKVA 3BO9A 4AD2A 2IQ0A 3W38A 3L0KA 1BD0A 1SZFA 2INEA 3UG8A 1K8YA 3LEPA 3NZGA 3WDQA 4M29A 4DF1A 4U28A 4LYPA 3GBDA 3THQA 1VRXA 3WLSA 2F38A 4F79A 2YYUA 1V5XA 4A22A 2AGKA 2QCCA 3O1NA 1O5RA 4E2BA 3VGGA 2QAFA 3DECA 4YN5A 1MNZA