4LV4A

A noncompetitive inhibitor for m. tuberculosis's class iia fructose 1,6-bisphosphate aldolase
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
345
structure length
320
Chain Sequence
PIATPEVYAEMLGQAKQNSYAFPAINCTSSETVNAAIKGFADAGSDGIIQFSTGGAEFGSGLGVKDMVTGAVALAEFTHVIAAKYPVNVALHTDHCPKDKLDSYVRPLLAISAQRVSKGGNPLFQSHMWDGSAVPIDENLAIAQELLKAAAAAKIILEIEIGVVGEKLYTSPEDFEKTIEALGAGEHGKYLLAATFGPDILAQGQQVAAAKLGLPADAKPFDFVFHGGSGSLKSEIEEALRYGVVKMNVDTDTQYAFTRPIAGHMFTNYDGVLKVDGEVGVKKVYDPRSYLKKAEASMSQRVVQACNDLHCAGKSLTHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Noncompetitive Inhibitor for Mycobacterium tuberculosis's Class IIa Fructose 1,6-Bisphosphate Aldolase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase/lyase inhibitor
molecule keywords Fructose-bisphosphate aldolase
total genus 133
structure length 320
sequence length 345
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4lv4A00
1CI1A 2QUUA 1TB3A 4JICA 5HWNA 4TMCA 3C4UA 2RKXA 4DO5A 3VKJA 3R2GA 3LHYA 6ALDA 2RDWA 1LBFA 2D73A 3ZWTA 2CZFA 1JR1A 1OK4A 5D04C 4TIMA 4ZQOA 3W75A 3G1YA 4OE7A 3HGRA 3TXVA 3VE9A 3S1WA 1F76A 3P7YA 5BNKA 3PBYA 1K03A 3NYZA 1PVNA 4RCXA 3W7RA 3NPUA 1EUNA 5DCDA 1WQ5A 1PIIA 5CSSA 5LGZA 1WBJA 2CLOA 3A5VA 3BO9A 1FXQA 2C19A 4RZ6A 5I3HA 1D3GA 3GVGA 1ZJIA 2YR1A 2G96A 3W1UA 2R94A 4CLMA 4O19A 1XDLA 4MY1A 3Q2DA 3B05A 1RQBA 5C5YA 4HIBA 4HSOA 3PUOA 1RVGA 3IV3A 4IMGA 3QW3A 4Y96A 2QR6A 1EP1A 3FS2A 3L9CA 4M7TA 3LHVA 5EA9A 3N9RA 3C2EA 1PS9A 3NQDA 3LXAA 1L6YA 3W7DA 2XN2A 1JUKA 3HG5A 5HULA 3THAA 1OX6A 4Z08A 1SW3A 3BVJA 3F4NA 1OVDA 3GKFA 1FY6A 1H7PA 2QCLA 2PE4A 2WOQA 2NX3A 3PULA 3CHVA 2A2IA 3LTPA 1EP3A 1XFBA 1BWKA 3LXCA 2DZPA 4YWIA 4LOCA 4MKNA 1M7PA 2WSRA 3IIVA 4RKAA 3STEA 2G5WA 4IX2A 3P5YA 3TQVA 3TDFA 2Y63A 4Q33A 1EB3A 1ICPA 4PL1A 3C0JA 2I1OA 4BFAA 4BI5A 1J5TA 3STGA 1GVFA 2YDAA 5K4XA 2HTMA 3G1SA 1S5WA 4AWTA 3VNDA 1SUXA 3LCXA 4KFPA 3CTLA 1TREA 2ZZ4A 1VYRA 2EPHA 2HS6A 1G7VA 4O8RA 3GAYA 4K7VA 3KVMA 4JTFA 4EVZA 1HFBA 3W73A 3W1AA 4XZ9A 1TTQA 1R2RA 2C1HA 3MW7A 3TXZA 1F05A 2PRLA 1KA9F 2YW3A 2EGZA 1ZCOA 2EKCA 4WD0A 3LX9A 3R12A 1K7EA 4MLJA 2C0AA 5A5WA 1R47A 2XN1A 5HUPA 3DHFA 2EAWA 3NM3A 3UWQA 3B4UA 4O0ZA 4FHAA 2QJHA 3QEZA 3M16A 2CLIA 5K4ZA 3P84A 5AHEA 5DXYA 4OV9A 3RFAA 1H1ZA 4ZQCA 1P5BA 5IBXA 1BTMA 2ZYFA 4O11A 3QH2A 1LLWA 3E96A 1FWTA 3SGUA 4LVBA 1WXJA 3V75A 1TPFA 1OF6A 2ABBA 4LT9A 1QFEA 5FEWA 5G2WA 4Q32A 1V7YA 4PA8A 3NQCA 5KMYA 5DXXA 1FDJA 1X1ZA 2DJXA 3N3MA 4YLWA 1SFJA 3HMJG 3NQ6A 1RD5A 3W74A 1G6CA 1AG1O 3HPXA 3PUDA 2WPBA 4IWWA 4DELA 3PWAA 1GYLA 1EWDA 1VC4A 2VXNA 5CG7A 3N9SA 1SPQA 5I3IA 2ZRWA 2TMDA 1OX5A 3P81A 1LRNA 2FB3A 5LKYA 1ADOA 4MZ1A 5LSMA 2CLLA 2TYSA 3W1XA 4UFJA 3P74A 4NJHA 1LLZA 4WOZA 3DI1A 1W3TA 2QCDA 1U83A 2WSYA 3HF3A 1GTHA 3EWYA 3CEUA 2VEPA 1GYNA 3O05A 1R2SA 1XBZA 3S1UA 3WK2A 5TBOA 1IXNA 4N02A 2Z1BA 3DBPA 3W2JA 5K3VA 3P8IA 1GOXA 1LOLA 1LROA 4MUZA 2JKEA 2DZUA 5F2MA 3ABOA 4UTHA 4RXFA 3W1LA 1XUZA 3MWAA 2PC4A 3I7RA 4IQLA 4JTLA 3PB0A 1SO6A 4AHPA 2XN0A 2ZRXA 3W7OA 2E6YA 4ML9A 2VKZG 1B3OA 1W5QA 3WJZA 1QAPA 5CPLA 4IMDA 1TPWA 2FIQA 4IMCA 3DKLA 3LXBA 3UWWA 3LHWA 3HGSA 3S1XA 3GKAA 3CIXA 1VCFA 4TO8A 3BPWA 2E77A 1QDSA 5TIMA 2YYTA 4DF0A 1PCWA 3G3MA 3ATYA 1LYXA 1W3IA 4UTWA 3RLVA 4X22A 3DFTA 3QF0A 4AH7A 5AC8A 3UXAA 3W72A 4PODA 5DY3A 4J9JA 3PBVA 1VR6A 3TA6A 1RV8A 1PCKA 2A6NA 4ORMA 4QNWA 5DLCA 4NJJA 1KTCA 1Q45A 1VYSX 2V0TA 2DZWA 4ZL1A 5FF2A 4P61A 2X2GA 1NVMA 3P5ZA 1VCVA 3O1NA 2ISSA 3L68A 4OWGA 2VFDA 3HG4A 4FNUA 4GUHA 1DHPA 2AGKA 3P61A 4MY8A 2VENA 4DPQA 3FJ6A 1JQXA 1GQNA 1TIMA 5FF4A 3PB2A 5CZJA 1G4TA 3MYOA 2EF9A 3TUUA 3T55A 3UY8A 3OEXA 4CQAA 5HWMA 3C2VA 4MY9A 5AHNA 5G5IA 4YL2A 1ALDA 3GDKA 3L0NA 3N14A 2QDHA 5BOOA 3NZ1A 2FQIA 3DH7A 2X30A 3LCWA 1AK5A 1YDVA 4FF7A 1W8SA 3NPVA 1SW7A 3LGEA 3TK7A 4GUIA 3WFAA 4OV4A 1EPXA 1NF0A 4FB7A 3NL5A 1KLYA 3W7KA 2Y88A 5DCEA 1GEQA 3CU2A 1SZGA 5CPMA 3A5FA 2TSYA 4JTGA 1H51A 1RPXA 1XUUA 4WXZA 5K2ZA 3TR2A 5LNUA 3NL3A 1OYBA 1VZWA 1EUAA 3G1VA 1O5XA 3I65A 1OABA 3W7HA 3IIPA 1OG0A 3W3OA 3DHDA 5HQEA 5D32A 4FNQA 1WX0A 4I7UA 4RZ5A 5F4WA 2TRSA 4RX0A 4JS3A 5LNRA 1F5ZA 1TPH1 3W23A 4CCDA 2QEZA 1VPXA 4JYDA 6TIMA 4X2RA 2X1TA 4AB4A 4NT0A 3E02A 1F2JA 3HPZA 4FXSA 4XQ6A 3T40A 1JULA 2NUXA 4K37A 4PC8A 2CLEA 1Y0EA 4EIVA 1O94A 3QMRA 5U7SA 1JRBA 3KVKA 2QUTA 1C9DA 3P80A 2WSQA 3GXNA 2PRMA 1UB3A 1TRDA 2ZTJA 4MJMA 3W83A 1UCWA 4Z1CA 3NL2A 1Q3NA 4M19A 2ZRYA 2QAFA 3BARA 4HT3A 4IJBA 3I7SA 1H5YA 3NGJA 2O7QA 5DN1A 4O57A 5FF3A 1U5JA 1DBTA 3WJWA 4CCCA 3S42A 2C16A 5KZEA 2ZZ5A 5F4XA 3PBWA 2C3ZA 4ZQMA 5HNRA 2A85A 1TPDA 4WUIA 2CLKA 5KSWA 3H54A 4NXKA 4QSHA 2DORA 3KXQA 4IUOA 4IXXA 2J9ZA 1TPVA 4NNAA 1V5XA 3N2MA 2ZA3A 4L4LA 5D33A 5EPDA 1Z48A 2OCZA 4JY9A 1GVSA 1A5CA 3L5AA 2ZRZA 3CT7A 3O6YX 1QPNA 1SZEA 4UFMA 5BMWA 3SZ8A 5FF0A 4H4IA 1G4PA 3TC6A 2HSAA 3W07A 5IBXC 2YZRA 2GQAA 4PEKA 4O1CA 4NNBA 4FIRA 1LOQA 2ISWA 3GB6A 1SW0A 3G0UA 3PBUA 1TJPA 1TV5A 4KFNA 5D2TA 2FFCA 3CLMA 5AYYA 1KTNA 3P8JA 1W1ZA 1D3HA 3F4WA 4NNCA 3FJLA 3UPWA 1HTIA 1JUBA 4O4VA 4A21A 4HHPA 4ICNA 3TW7A 3W7EA 4BI6A 4WY0F 4JTIA 3C56A 4FX8A 1A5BA 2ABAA 2YYUA 4TU1A 5DELA 1FX6A 2PURA 4ADTA 3M5ZA 1W5OA 4X9SA 5CGQA 3QFEA 3W7NA 3BW4A 3NA8A 2G95A 4HNVA 1KBJA 1D9EA 1CW2A 3B06A 3O06A 1MZHA 4AMAA 3M41A 1SZFA 1K3UA 2B7NA 4PCFA 3R13A 2V5BA 4O10A 4CNOA 5D38A 1QPRA 2OMAA 3QSTA 5HWJA 4UTTC 3C2OA 4RV8A 1ONRA 1QOPA 2ZZ7A 1RQHA 1EEPA 3C2RA 5E0KA 2Y61A 1OFBA 3STCA 1P0NA 7TIMA 3EKZA 3N19B 1VRDA 3DXIA 3QMTA 2X16A 2E5CA 1ME9A 1XCFA 4NU7A 1UJPA 2OT0A 2Z6JA 4O1BA 3SR7A 3F1QA 4OT7A 4JTHA 1AW5A 4MJZA 3G1FA 4M5PA 3TKFA 1HO4A 4UR8A 1LCOA 2FLIA 3A24A 1JVNA 3HGJA 3SECA 3W76A 2WO5A 1SU5A 3HO8A 5CZTA 4Y9AA 4E2BA 4IPIA 1THFD 5G1TA 3L0KA 1N55A 3PG9A 4FIQA 1TTJA 3CWNA 5EMUA 4LS1A 3O07A 4DO6A 3O16A 5L6UA 5MHBA 2QCFA 3C61A 3NQMA 3NQ7A 1H7RA 1T0OA 4CNNA 3HPSA 3AJXA 3GDMA 1OFAA 4QJ1A 1M6JA 4FEZA 2VFFA 4JTKA 3JRKA 1LRTA 3W7QA 1ICSA 4N2YA 2Y7GA 3T78A 3FKKA 1A5SA 1X8FA 3G0XA 5I3FA 3S5YA 3TJXA 3TU9A 3MI3A 1FQ0A 2H3BA 4UTLA 2A5HA 1VHNA 1KLZA 2C18A 2CU0A 3VI2A 2BWGA 4JDYA 3L65A 3LTYA 2ALDA 1KFCA 1CX9A 3M6YA 4S2BA 4BF9A 4Y90A 3TAKA 3A21A 1E51A 3SW6A 3KOFA 3CB8A 3LRLA 5DBTA 4K39A 1FBAA 3PAJA 2VFEA 4W9TA 1AL8A 3NQEA 2QCMA 3KVLA 5HUOA 1JCXA 4AEOA 4GBUA 4YMZA 3CC1A 1I2NA 3GX9A 3TFXA 4U28A 4ZVJA 2J88A 2NXGA 2W6RA 3SI9A 2DP3A 5D30A 2IQTA 1A53A 3V1PA 4I7WA 1TSIA 2C6QA 5AHFA 3L2IA 4KWWA 4LV9A 3LLFA 1WYIA 2CLHA 2OX1A 1LBLA 1F73A 3LHUA 2Y6ZA 1IXOA 1GG1A 4Y8FA 4WJEA 3M5XA 5D02A 2G97A 2YGYA 5F1VA 3N2XA 1H60A 1OJXA 3UZ5A 2E5BA 3DI0A 1P0KA 2YW4A 3LV5A 1SZNA 3TROA 4N9BA 4O15A 1FWNA 1NFBA 2ZZ6A 2V81A 4Z1DA 1KFJA 2HMCA 2NXIA 1GVOA 2WNQA 1H7NA 3EWBX 1HG3A 1K02A 3MI6A 1DJQA 4O50A 5G2IA 2A0NA 2NUYA 3N34A 1W5NA 2GVJA 4UFHA 1KTBA 4BWLC 1LZOA 1R30A 3O6CA 4GFSA 4LS2A 4M7SA 1UUOA 1MSSA 3GXTA 3QMSA 1XI3A 4JDBA 4ZQRA 4UMBA 5C55A 1VGAA 2R91A 2Y7EA 1OF8A 1F74A 2ZA2A 3EWZA 4YCOA 2X1UA 1PV8A 1R46A 3ZR4A 2Y7FA 1ZY9A 3M43A 3TW6A 4NJKA 3P67A 2C13A 2CFFA 1W37A 1XXXA 2ZZ2A 4JTTA 1I45A 3MP3A 2QJIA 2UV8G 1W54A 3OVQA 2E1DA 3G24A 3NZRA 2GQ9A 3G1AA 3PSVA 1VLIA 1K7XA 4OU1A 4LU0A 1Z44A 3TAOA 4DBDA 3MBDA 1BKSA 2H3DA 1FCVA 4DF1A 5BMXA 4O12A 2GUUA 2Y62A 3G18A 4GUGA 3TQ0A 1B57A 3W70A 3M44A 4GRSA 4O54A 4O28A 4M6VA 2VELA 4O17A 1C29A 4EF8A 1FDZA 3T44A 3UYCA 3NEVA 5H2ZA 4XKYB 4ORIA 1AW1A 1MEHA 3ZWSA 3BV4A 3UWUA 2BSLA 2A1YA 4DO4A 5EKYA 2RFGA 3I6RA 4ZQNA 1PHWA 4LC8A 4TR9A 3L0GA 4HPXA 1YDNA 4WXYA 1DVJA 1G7UA 1W3NA 3W1NA 3W2NA 3MBFA 4OHQA 2Y70A 3W1QA 5A8GA 3GDLA 1NF7A 4NQ1A 2RH9A 4OGZA 5DCBA 4RR4A 3W2MA 4O13A 3STFA 3NQVA 1I2PA 3QPZA 2ZQ0A 3HG3A 3TE9A 2GPTA 2CLFA 3FFSA 1VCGA 4IX0A 3W87A 3R5EA 4LVFA 2Q3RA 1TJRA 5C2XA 5HMSA 1ZAHA 1ZENA 2WKJA 3LHZA 3NQAA 3GR8A 1QO2A 1IIHA 1DQWA 3W86A 3FEMA 1BWLA 4JY8A 3LTSA 1YTKA 1XKYA 3BGGA 2JGYA 5IM51 3LV6A 5AYZA 3RK8A 2R8WA 2J9YA 2DZXA 1VYPX 4HKPA 3Q37A 3W71A 2A7NA 3GZ3A 1L6SA 4BWLA 5K7JA 2B4GA 3C2FA 3P62A 3HG2A 2F84A 5AHLA 4AWUA 3G8RA 2GQ8A 4PTNA 3A9IA 1OFDA 3OBKA 4JIPA 3UWZA 1FWRA 1N8FA 1WDWA 3PF3A 4AHQA 1AL7A 1TPB1 5TQLA 3HGOA 4LVDA 5K9DA 4R34A 1OX4A 2RHGA 3O6DA 4JX4A 1KFLA 4JD4A 4RJEA 4A2RA 3EWXA 3H53A 4UTUA 2H90A 1IXPA 5BRBA 1KV8A 1NEYA 3S5ZA 1VS1A 4UNLA 4UXDA 3U2OA 3QYQA 1MXSA 3QPYA 5CSRA 3LDVA 1Q6RA 3M9YA 1LORA 1L2UA 1N7KA 1QPQA 3KAOA 3L67A 3NG3A 1T96A 3MUXA 2FPVA 3LCFA 3L5MA 5D2XA 3LHTA 5FI8A 4C1LA 5HR6A 3WJXA 3U6WA 3CM4A 3NNTA 1AMKA 5AHIA 1LRQA 4Y6GA 3VCRA 5KINA 1I2QA 3FYPA 4JTSA 3FOKA 3LB0A 3NDOA 1LP6A 1PHQA 3W7IA 4M6QA 3BG5A 3EXSA 3TNOA 1GPWA 2ATSA 1ML1A 4GJ1A 1KM1A 3HIJA 4DXVA 3MJYA 3BLFA 1PL9A 1H61A 4P2VA 3R89A 3A23A 4CCEA 3EWUA 2YCEA 1SO3A 3GIYA 1KM3A 2A6LA 1KFKA 1GVQA 2FB2A 3DFOA 1UBSA 4MFEA 1HO1A 2X1RA 5C54A 4B5NA 3NQFA 1G4SA 1GWJA 3LCGA 3WK0A 2ZZ3A 3UD6A 1GTEA 4O18A 4QM1A 3VE7A 1GG0A 5KZDA 4EF9A 3EKLA 4MFDA 4JTJA 2NV2A 4NUWA 4HN4A 2CW6A 1I4NA 3Q94A 1FUYA 2TPSA 3K30A 5G1YA 2JGQA 2QJGA 1JCMP 1DJNA 4POCA 3EX6A 3GXPA 1G69A 2FDSA 1K8XA 4K8HA 3P60A 1YADA 4IMEA 1P1XA 1H62A 1VQTA 2V8ZA 4Z1BA 1A5AA 1M7OA 1P4CA 3W6YA 4XBKA 3IVTA 1WBHA 1TYGA 1KFBA 4DEFA 5D37A 4N6EA 4XBSA 4N4QA 3THQA 4S1FA 3G1XA 5ABTA 3GYEA 1KM5A 1EIXA 1XBVA 2BXVA 5I3JA 4UTJA 3NQGA 1I8JA 4XKYA 3E0IA 1EX5A 3DFSA 3S1VA 5LHFA 2E68A 4LVGA 1ZAIA 1YTEA 4NXSA 1RR2A 1B4EA 4LV4A 1S3HA 2V82A 3TFCA 3MHGA 1JCLA 1TV7A 2HS8A 3ANYA 5AC7A 2GJLA 3S8HA 1Q6OA 3OG3A 2CZEA 3UQNA 3ATZA 5AFDA 1B9BA 5LNVA 5T26A 3LERA 1KM6A 1L6WA 3IIOA 3MYPA 1O4UA 2QAPA 1FCBA 2P1FA 4QQ3A 3O8AA 4O53A 2P10A 1TV8A 2B7QA 2QCGA 3NM1A 1WAUA 3MO7A 3BGJA 4FX6M 2W79A 3USBA 1IIGA 3EB2A 3TSBA 4FNSA 3W2UA 5CZSA 3KRUA 4FNTA 2I14A 3B04A 2GVLA 3NQ2A 3EX1A 2P0OA 4OQVA 1VLWA 3VFLA 4LUJA 4C1KA 5H91A 3C8FA 1XL9A 2VFGA 2WNNA 4KKXA 4A3UA 1JUEA 1XBYA 3SY5A 1JCJA 3OIXA 5U4NA 4LS0A 3GNNA 3I7QA 3W85A 1Z41A 1K8YA 1SQ7A 1JCNA 1EP2A 1TPC1 3HQ1A 3MHUA 2NWSA 4GNJA 1SO5A 2Q8ZA 4WZHA 4HNUA 1LDCA 3PC0A 4PFMA 3IRDA 1KW1A 3WJSA 1H63A 3QQ0A 5D03A 4E38A 3ABSA 2WJZA 4ZZ9A 1MO0A 2FPTA 4UFLA 3SIZA 1TCDA 3KX6A 3QC3A 1UUMA 1J4EA 3B03A 5E93A 5LNWA 3EEGA 4JNMA 3M7WA 1OFPA 3C6CA 3MP4A 2B0MA 4AXKA 1KV5A 1TTIA 3CPRA 3DFNA 2VC6A 3G0SA 2NX1A 1L9WA 3TCEA 4CQ9A 1TRIA 1M5WA 4H3DA 4K36A 4JYFA 1G4EA 1KM2A 1OFRA 3IIZA 3PS7A 1K7FA 4JR5A 2NZLA 3DGRA 5AN7A 2ISVA 3IIXA 2H8XA 5FEZA 4FO4A 4JXCA 3TJLA 1YXYA 2CZDA 5LNSA 4LC6A 4GUJA 3JS3A 2YFNA 1XC4A 3T7VA 1ZAJA 1Q6LA 4LY8A 5EY5A 3L21A 1UASA 1JCYA 3NOEA 1SR9A 4Z0SA 1QNVA 1I2OA 2E6DA 1OFQA 2E6AA 2QCHA 4UUIA 2BTMA 3W9ZA 1H7OA 3TV8A 2J9XA 3SGZA 4MPQA 2ZDRA 2YX0A 4R7JA 5BW6A 1RZMA 3WK1A 4ZQPA 3N73A 4UIOA 2C14A 4IXHA 4ONVA 2WV8A 3LLDA 4O14A 4O0KA 2ZTKA 3PSWA 2J24A 1Q6QA 3RU6A 3O63A 3E9AA 4CNPA 2FJKA 2B7PA 3DENA 3C52A 4DBEA 3YPIA 4K8EA 3RLUA 3WJYA 3DZ1A 3KVJA 1IXQA 3BW2A 3HJZA 4O1DA 5L9FA 3BLIA 5KTLA 3SJ3A 3BG3A 3B0VC 3QQ1A 3U8GA 1EA0A 5HR7A 4JGDA 3W1PA 2ATMA 4UTKA 3NPWA 1J2WA 4CQ8A 2I9EA 5FEXA 1PE1A 5AOUA 4O4WA 1DL3A 4K38A 3B8DA 4PH6A 1XM3A 2F7FA 3TX9A 2ZFAA 2JKPA 5D05A 1MEIA 2C15A 2Z0IA 4LVAA 3UZJA 3DKJA 3SFKA 4N6FA 1FWWA 4Z0JA 3G3DA 5CPNA 4QIUA 1OYAA 1MEWA 2GVGA 1IGSA 1JRCA 1RQEA 2ZZ1A 5AHMA 2CLMA 4E0CA 5J5RA 3S9YA 3W7PA 3BK0A 2VEKA 1FWSA 3B0UX 3SSJA 3QM3A 1YXDA 1S5TA 1EWEA 2BLEA 2RDTA 3S5OA 3UXDA 2QCDB 5KITA 2ZRVA 4N4PA 1W5MA 3IGXA 5J5DA 2NX9A 2QCEA 4E2DA 2R14A 2ZCGA 3TQKA 1OK6A 2YSWA 1QMLA 3DFPA 2QDGA 5KZMA 3CIWA 1NSJA 4R33A 4EOUA 4D2JA 2ZBTA 4RZ4A 4EWND 2V30A 1KM0A 2DZVA 1QR7A 2KZHA 3EWWA 4O1AA 1SFLA 2RDUA 1QWGA 4MIMA 3BG9A 4MOZA 1HUVA 5LZLA 4QITA 2H6RA 1DV7A 8TIMA 3TSMA 3HOJA 1YPIA 5LHEA 4UTMA 1YXCA 2J27A 3UPBA 4UFIA 4KWVA 2DZTA 3W22A 3PUEA 1OX4B 1WOAA 1LTDA 2Y85A 3M5YA 2AAMA 3CQ0A 3DU0A 3IVSA 1W31A 1H50A 3UNDA 4G1KA 2FPYA 2YXGA 3MI2A 2NXHA 4Z1AA 1GZGA 3FLUA 3PM6A 1TO3A 3RMJA 3E12A 3NQ8A 4UNKA 3OVPA 4JN6A 4YXGA 2JBMA 2QCNA 2WQPA 3RNDA 1TQJA 3NPXA 3HBLA 3PVFA 1R2TA 3LBMA 3NVTA 3LOTA 2PCQA 4UCGA 1K8ZA 2DZSA 4QAIA 4UTIA 3ELFA 4JEQA 4UMCA 3Q58A 4OBTA 2Y89A 1C8VA 1H7WA 1DKWA 3EXTA 3MP5A 1VH7A 2VFHA 1T8XA 3P82A 1F6PA 5HJLA 2GOUA 2JK2A 4NX5A 5D2WA 2Q8LA 5I3GA 1GVRA 1QOQA 4N9CA 4GC4A 3S0CA 2V2CA 3QRHA 3ABRA 1X6UA 1B4KA 3ZS4A 1YLVA 3EXRA 4UTTA 2JKAA 4LWWA 4UTWC 3PY2A 4HNNA 2H8ZA 5DBUA 2QKFA 3UWVA 5AYXA 3IVUA 1OFEA 3MMTA 3D0CA 4TX9A 4BK9A 2OJPA 2VEIA 4MZYA 2Y7DA 3BLEA 1WV2A 1ZHAA 3S5NA 4AWSA 5F2IA 2CWNA 3TMLA 4Q4KA 4NZFA 4K7YA 2DU2A 2ZRUA 5I3KA 3W7MA 3INPA 3TSDA 4HPJA 4GXMA 4IOTA 2Z6IA 4O52A 4WY0B 3W7JA 1IF2A 3O15A 3W1MA 5CKSA 4GWEA 3KRSA 2Q3OA 4UFKA 3ABQA 1W56A 4A22A 3OVRA 1OYCA 4MVAA 3F03K 4FX7A 1ZFJA 5C6MA 4UMAA 4JTUA 1SO4A 2CZ5A 1GT8A 3NL6A 4JX5A 2NV1A 3LCLA 4H6KA 1X1OA 3W1RA 1X7FA 5E1QA 2PRHA 2Z2UA 3OHIA 1FXPA 3FKRA 5EL1A 1LBMA 2QUVA 3IGUA 5G4WA 3W88A 4LTSA 3NAVA 4N9EA 3GK0A 1VJIA 5FEPA 5D09A 2OZ0A 1YYAA 2V2DA 5F4SA 1KM4A 1WOBA 2A21A 4MLRA 3LI0A 4HSNA 3MHFA 4BR1A 1Z42A 5G2HA 1JJKA 1TPEA 5FF7A 3EX3A 3GDTA 3KFTA 5DY2A 2GJNA 1YDOA 3R8RA 1TPUA 3QJAA 3FIGA 3W2LA 2VEMA 3GAKA 3LCHA 4R53A 3IEBA 4A2SA 2E09A 2BX7A 1BEUA 3W2KA 3TH6A 3G1HA 2FTPA 4ADSA 4KFOA 5K9CA 4U4MA 1GJPA 3PG8A 1DOSA 3M1ZA 3HB9A 4K6AA 4FNRA 3DAQA 4ADUA 1VHCA 2AQWA 2V2HA 1KBIA 4DF2A 3BW3A 5HINA 3I68A 2LLEA 4UC5A 3KHJA 3LRMA 2YPIA 1XDMA 3LBCA 4N9DA 3UY7A 1O95A 4RLIA 3AO0A 3CEPA 3FA5A 3W7GA 2DJLA 1W0MA 1DORA 2QCCA 3WK3A 1H7XA 4IGHA 3M47A 4X3ZA 3CWOX 3GDRA 4S2CA 2NLIA 3TC7A 5AB3A 4I9AA 3GR7A 4MZ8A 1YPFA 3W84A 3C3NA 4GUFA 4QISA 1FCQA 4JX6A 2EHHA 4BI7A 4LW7A 3EX4A 4PL2A 4DQWA 4RXGA 5EBUA 1G67A 2NWRA 3OA3A 1TMHA 2WNZA 5AC6A 5FESA 3G1DA 4HNTA 1SSDA 4A29A 4I7VA 2VOMA 4NX0A 5F2LA 3M5VA 4WY0A 4AF0B 4XWUA 1W5PA 3TMQA 1H1YA 4WOQA 3GNDA 2VFIA 4AVFA 4WQ6A 4XTIA 1TQXA 4M6PA 1YTDA 2V5LA 1ICQA 4IMFA 2NUWA 4UR7A 3A22A 3GLCA 2V9DA 3G22A 5SWUA 4TMBA 4MYAA 1F7BA 3E49A 4NJGA 4ALDA 5D2VA 3L66A 3NO5A 3T4CA 1F6KA 4NZJA 4DPPA 4AF0A 1I2RA 1ZNNA 3DFQA 1QO5A 4AAJA 4JYEA 3NXFA 3QZEA 4RK8A 1TTPA 1DQXA 1XBXA 1QCWA 3NR0A 4LUIA 5D2YA 3G8EA 4WX2A 4O16A 4GE8A 5EYWA 3QW4B 2E6FA 2A4AA 3LRKA 3EX2A 5F2GA 2X1SA 4YCPA 3FYOA 5G4EA 3LCIA 3UWYA 1FCUA 2BZNA 3M0ZA 1OHLA 2YFOA 3QSRA 3W1TA 3L5LA 1KFEA 2QF7A 1AW2A 1ZALA 2E5DA 3W7LA 4QNEA 3H55A 4FNPA 1OFOA 4LRSA 2OT1A 4XUGA 3ZFHA 3PR2A 3S6DA 4MYXA 3IGSA 1FDYA 1O5KA 1T99A 3B0PA 1QPOA 4NVTA 1JQVA 1S5VA 2J6XA 3KRZA 1WA3A 3LM7A 4LRTA 4LNYA 2A7PA 1O60A 1HL2A 2O7SA 3TIMA 1LM1A 5F1UA 1ME8A 2A7RA 3RF9A 2XFWA 3JR2A 5CPOA 3LI1A 2W0UA 5LGXA 1NAL1 1A50A 4NJIA 5CZ0A 4IPJA 4JTEA 1ME7A 4L4MA 4FXRA 5GVJA 5K9XA 2B7OA 1SSGA 2ZA1A 4XTDA 4AHOA 1LOSA 4JIQA 3W7CA 4ZMGA
chains in the Genus database with same CATH superfamily
4H6QA 1SGJA 2ZKMX 2RKXA 1QNOA 1TX0A 3B4YA 2D73A 1NOFA 5H8UA 1JR1A 4JOMA 1R3WA 2YCKX 1MW1A 4DY1A 1W3HA 5FSEC 2GOKA 1K03A 4HPNA 2CKSA 2ZWZA 3NPUA 1EUNA 5A1AA 3BANA 1BLIA 3I10A 2PWHA 3KTSA 4JIIX 1KKOA 5CSSA 3WLJA 1SFTA 5FAJA 2IKGA 1WBJA 2CLOA 3A5VA 3AU2A 1OSEA 1D3GA 2G96A 4CLMA 4WJ8A 4K3ZA 6PTDA 1XDLA 1B30A 2EPMX 3Q2DA 3N6HA 1RQBA 4Z2GA 4ERIA 1XLFA 3KBWA 2PWGA 4WJXA 2HWGA 2JQXA 3FS2A 1XIBA 4AZ6A 1VF8A 3A6OA 1PS9A 3LXAA 2WVSA 3W7DA 1LL7A 2WMIB 3HG5A 3UESA 2OGJA 3A4JA 3GKFA 2P5NA 1EDGA 1FY6A 1H7PA 1UD6A 3FSTA 3AHZA 1XIMA 4IGSA 4XSMA 3B97A 2Z26A 1ZTVA 2WMKA 1BWKA 4YWIA 2DZPA 4XD3A 1KB3A 5BXRA 1GGOA 2WSRA 3BLKA 5IOBA 3IIVA 3DFYA 2ZUUA 3FXYA 2G5WA 4NAFA 5RUBA 1NFPA 1ICPA 4PL1A 4BFAA 4DB7A 2WMGA 4NZ5A 1QPKA 3HFTA 1GVFA 5K4XA 3GD6A 1S5WA 1O1ZA 1SUXA 5AZ1A 4KFPA 4H7ZA 2RUSA 5HQMA 2OEJA 1G7VA 1NDYA 4BZYA 3EA2A 4JTFA 1YQ2A 2OWXA 4XZ9A 5FCZA 2J25A 3TA9A 3IJ7A 1PZ3A 3TXZA 3PZGA 4P8UA 2YW3A 4Q8NA 5BCAA 1ZCOA 3FK4A 2OODA 4D6GA 4XBJA 1E3XA 5HUPA 3DHFA 3ZJ6A 3B4UA 4O0ZA 1Z89A 4AQLA 2PD9A 5K4ZA 2NV9A 2W91A 3SO7A 2A3EA 2ZYFA 3SEPA 1F61A 4GKLA 1LLWA 3E96A 3SGUA 3LD5A 2EQDA 4LVBA 3ZSTA 3KZPA 3V75A 4IIGA 1OF6A 3DESA 4I5RA 5FEWA 4I8YA 3CK5A 3GH7A 1V7YA 1ZB5A 5KMYA 5DXXA 5C9XA 4DJDD 4EPDC 3RX3A 1F3EA 3CQKA 4WLCA 1EWDA 3MUIA 1E4MM 2VEGA 1HNYA 3TYUA 1EOMA 1X39A 1LRNA 1OX5A 2TMDA 3P81A 3UW6A 1ADOA 3VGHA 5IFPA 3W1XA 2PTZA 2CITA 4UFJA 1DIOA 4U2YA 3P74A 3DI1A 3ONCA 2QCDA 4LUYA 2J6VA 2HXTA 3HF3A 1GTHA 4ZB2A 1GYNA 2Z1BA 3RX4A 5AZ0A 1CIUA 2G3MA 1WZKA 2XIQA 4EKJA 4UTHA 3VABA 4JFUA 1XUZA 3I7RA 4IQLA 3VNZA 2FZDA 1YNPA 1HGYA 1GHRA 2G4FA 1OCNA 4AHPA 4YWSA 1B3OA 1AQHA 1QAPA 3A3XA 5CPLA 1PKYA 2YOCA 3T8QA 4MDPA 4MWAA 4XAPA 3VU2A 2QUMA 1LUCB 2PZ0A 3KP0A 4TO8A 3E5PA 3VX0A 1QDSA 1WNOA 2YYTA 2GJRA 4C6NA 3DG6A 2BBFA 1QJWA 1LYXA 4GQ0A 1IR2A 3RLVA 4X22A 3W72A 3QTPA 1VR6A 3FSUA 3UJ2A 4QX4A 5DANA 1J2BA 3IJLA 4QNWA 1PZ2A 5E5CA 2WJFA 3RCMA 4DYEA 1YMYA 2V0TA 3RITA 4ZL1A 1J8VA 4FR6A 5CPQA 5I02A 4P61A 2DUXA 2FVKA 4TTUA 4DYJA 4QG8A 1QHOA 4AVOA 3VNIA 4FNUA 3WLRA 3FJ6A 4H00A 1JQXA 1GHSA 1E6XM 3VOIA 1EIBA 3VD9A 3IAPA 4V15A 4D1IA 4AVNA 4G7EA 4YL2A 1L8NA 2QDHA 3TC3A 1SMDA 4PUWA 4FF7A 2XFRA 2XM1A 1HJVA 4OV4A 3NL5A 3QKEA 4L1GA 1KRMA 5DCEA 2PDWA 1SJBA 1UBPC 3A5FA 1ONWA 2TSYA 3B8IA 2R1LA 1EO5A 2VR5A 3WF1A 2QGHA 1XISA 3P0XA 2R1KA 1XIHA 3IIPA 2PDGA 3IK4A 1XH2A 1NQKA 3DHDA 4GNKB 1J0JA 5D32A 1WX0A 4I7UA 3WH6A 1X8CA 4LUTB 3DIPA 1P7TA 1TPH1 1XRTA 5H8MA 2QEZA 1VPXA 3FXGA 3WLPA 6TIMA 3T40A 2YCLB 1JULA 2ACUA 4JQ2A 1JL8A 4EIVA 5FL0A 3QR3A 3B8VA 3RILA 1C9DA 3SUVA 2V5KA 3H26A 2ZTJA 5FJUA 3W83A 2ONEA 2X09A 4JPGA 1NU5A 5DN1A 2NVCA 2IPFA 1UJQA 3S42A 4CCCA 2C16A 2ZZ5A 3E0WA 1S2AA 3TYDA 1BYBA 3MZ2A 1E6QM 3TYEA 3LPOA 2J9ZA 1TPVA 3GXFA 1RUSA 3WLHA 2ZA3A 4H1ZA 1Z48A 4PMYA 4RNIA 1A5CA 4IT1A 2ZRZA 4UQ9A 4H8NA 1QPNA 2DH3A 3TC6A 2GQAA 4HGXA 1KGWA 4FIRA 1LOQA 2ISWA 3FV9A 3GTXA 1A0DA 3GB6A 2PI6A 3ZIZA 1TV5A 1R9ZA 1D7KA 4PUUA 3P8JA 3F4WA 2WM0A 5JQ9A 3FJLA 3UPWA 3MSDA 1MXGA 3VGFA 4L9YA 2F2KA 3W7EA 4XV0A 4FX8A 4YYCA 2ABAA 1FX6A 5CC7A 2WVUA 1WZLA 1E9IA 2BOFX 1AMYA 5EFDA 3BW4A 3NA8A 2G95A 1KBJA 1CW2A 1W3KA 3LMZA 4AX6A 1B31A 3MKVA 5I03A 2QHAA 4DWSA 2EPKX 4CNOA 2X41A 1EGZA 1XINA 3QSTA 4QGCA 4UTTC 3R11A 1H49A 4S38A 4QS5A 4J27A 1GEHA 4RV8A 1TE1A 1ONRA 1RQHA 1S2UA 5CCZA 4MMWA 5E0KA 3R6IA 1WO2A 1OFBA 1EXPA 1WKFA 7TIMA 4ERAA 1Q6DA 1VRDA 4RDYA 1NIUA 3PZUA 1B2YA 3NURA 1LLOA 2O9PA 4B5WA 2REQA 1ME9A 4NU7A 1UJPA 2OT0A 1IYXA 4O1BA 3SR7A 4JTHA 4I6VA 1J0ZA 3WDJA 4ZOCA 4MJZA 5C9ZA 3FGCA 4I5UA 1HO4A 4UR8A 1LCOA 4PMJA 2VR4A 4CD8A 3HGJA 3PPGA 3SECA 3W76A 3C2YA 1NDVA 3PJUA 4Y9AA 4E2BA 4IUGA 4AEEA 3K1DA 3L0KA 4Q4RA 4GI8A 3PJXA 3CWNA 4LS1A 3LN3A 4DO6A 2XU2A 2VX5A 3AMLA 4QROA 1Q4WA 2YDRA 2Z27A 1TZZA 3C61A 2XINA 4LANA 3AJXA 3STPA 1CXEA 2XVPA 2CNCA 2VFFA 3JRKA 4C60A 1LRTA 3OQEA 4HZ7A 1X6LA 2Z1KA 1A5SA 1HJQA 3S5YA 4MAVA 4PGLA 1FQ0A 2H3BA 1XYBA 3QHOA 4LBSA 4DI8A 2C18A 2E3ZA 3WQDA 2PWDA 1V02E 2BWGA 2PTYA 5AECA 1BG9A 1CXHA 3LTYA 2ALDA 5DT5A 4S2BA 1W6TA 4NZCA 2XZ7A 3A21A 4F0LA 4KWUA 3CB8A 1ITXA 4JL2A 2VFEA 3ARUA 1MDLA 4C6MA 1M65A 4E3VA 1J96A 4HSHA 4GZJA 3EMQA 3WH5A 4JTQA 4HNLA 1IWAA 1AZ2A 2PDFA 4AZCA 3T1GA 2NXGA 2W6RA 4J3WA 3EGJA 1FA2A 3V1PA 3UG8A 3UJEA 3L2IA 4LV9A 2WKLA 3LLFA 1LBLA 4J3ZA 1NDZA 1IXOA 5FA5A 1GG1A 3I3BA 3DERA 2FMOA 1SMAA 1OJXA 1EF2A 3VFCA 3TROA 4GZIA 4HCLA 1FWNA 1KFJA 4E4PA 2GDUA 4AYSA 2WNQA 2AMXA 3UFYA 1JFHA 3MI6A 1NWRA 3SRFA 1VBRA 5CJMA 1V0LA 4EX4A 2AQVA 3N34A 1CLXA 1W5NA 2HDJA 5CQ1A 4V2XA 1KTBA 3FVMA 4BWLC 3O6CA 4M7SA 3NJ3A 1MSSA 3L4TA 1JI2A 4JDBA 2UY3A 4UMBA 5C55A 1J6OA 1OBAA 2R91A 1OF8A 4YTSA 3S6OA 4YNGA 4J5NA 3IWPA 4H9VA 5HPOA 1ZY9A 3PJTA 3UZXA 4AISA 1IZJA 1TWZA 4DNHA 2ZZ2A 3SCSA 3SUWA 3OA5A 2V3FA 5IDIA 1VLIA 4LUSA 3ME3A 1K7XA 4OU1A 4LU0A 3QY7A 7CGTA 4LF1A 4PTWA 2HRWA 4IPPA 4O12A 4LCQA 2GJXB 2HE5A 2Y62A 4GUGA 3VTRA 2OLSA 2OX4A 4A8IA 3CAVA 1UWTA 3EOOA 1H4PA 3WD1A 5TAOA 4O17A 4XAGA 1FDZA 1UROA 2NVDA 3TVAA 1XLLA 2VDHA 4ORIA 1E6PA 3C3UA 2HROA 4GPNA 2PDCA 1XQKA 4DO4A 1J9YA 4TR9A 1YDNA 3L0GA 3FY1A 1W3NA 4FMVA 3XISA 2Y70A 4LY4A 3GDLA 2BGQA 4RPPA 2RH9A 4OGZA 4RR4A 3TLLA 4XX6A 4C6CA 3STFA 4IL2A 4KEZA 3TE9A 1XIDA 2GPTA 3T6CA 3VNKA 4JQ1A 3BJSA 3FYYA 3W87A 3R5EA 4DIAA 2Z00A 2Q3RA 2Z1WA 2ACQA 5HMSA 3HQOA 4AU0A 3QV6A 5DMYA 1OC5A 3LHZA 3S2LA 1QO2A 1IIHA 3W86A 1DYSA 1PUDA 2D69A 2P0IA 3H23A 1Z6KA 2JGYA 1MYRA 1TZ7A 3W01A 4ASTA 5JH1A 3RK8A 1TFVA 2C7FA 4D6FA 1E1FA 1UWAA 2I17A 1XF0A 1FHLA 2J9YA 3A47A 3E0LA 4M80A 2D2JA 2YA0A 3CS2A 1L6FA 3Q37A 5I5RA 1P0BA 1O12A 3GZ3A 4WKHA 1L6SA 4BWLA 1RBAA 4ZFMA 3C2FA 3P62A 3VUPA 3GYCA 3GTNA 4P7LA 2GQ8A 4PTNA 1OFDA 1N8FA 1WDWA 3U57A 5TQLA 1GK8A 1TPB1 4LVDA 1FHDA 3GFXA 4C6QA 3WQEA 4FF5A 1H11A 3BLPX 4RJEA 2WBGA 3L4XA 3EWXA 6XIMA 1A5LC 5BRBA 1KV8A 2VRJA 1NEYA 3N13A 3GFZA 4UNLA 1MXSA 3QPYA 4NRRA 4ZCWA 5CSRA 3D6NA 1Q6RA 1KRBC 1TA3A 3MPGA 1L2UA 3L67A 1QPQA 1XG4A 4PUMA 1NOWA 4HQVA 4C1LA 1KQZA 4HCHA 3NGFA 2C79A 3WJXA 1T5AA 4B3KA 3KBMA 1TG7A 5AHIA 3DYPA 4Y6GA 4Q22A 3FYPA 4JTSA 5ECVA 1PHQA 2WC7A 4HU4A 3T07A 4M6QA 4KGJA 3WDQA 2ATSA 1ML1A 1R85A 1BSLA 4H8VA 2PWFA 2WC3A 3HIJA 4HJWA 3THCA 1B90A 3BLFA 1V03A 2VRKA 4P2VA 2ACSA 4GK8A 2JALA 1P6BA 3EWUA 3FX4A 4HYVA 1C7SA 3OZMA 2YCEA 1EJUC 3GIYA 1UPMB 1KM3A 5FAGA 4GXPA 4UNIA 4LX4A 4D6JA 2X1RA 5C54A 2Q8XA 1GWJA 1UMLA 1REQB 2GDVA 4C90A 4UOZA 3WK0A 2BXYA 4BEQA 1SJCA 3KL3A 2Q09A 2CPUA 1XD0A 4E6MA 1GG0A 4EF9A 3ISIX 3SCRA 4MFDA 3S9IA 2CW6A 1I4NA 1QTWA 3EBVA 1DWIM 2AQOA 5G4HC 3EX6A 4CGTA 4K8HA 4KRZA 1MWOA 1YADA 4IMEA 2R24A 2YB1A 4GY1A 1P1XA 1ECEA 1M7OA 3LENA 1Z7AA 1ITQA 4DEFA 3IJDA 4CKQA 3OW1A 1ZRQA 4CN4A 4XBSA 3THQA 3F4DA 5ABTA 4HN8A 2A3HA 2FH6A 4UTJA 4XKYA 3GSMA 1Z8AA 1EX5A 3DFSA 4DWSD 2E68A 4NXSA 1UW9A 1S3HA 3ZVHA 5GPRA 1JCLA 2WSPA 2XIJA 1A3WA 5AC7A 4A3YA 1UR9A 4AZHA 2ZE0A 3UPMA 4H04A 2CZEA 3MSGA 3UQNA 3XIMA 3GW0A 1B9BA 4UOJA 5LNVA 3MYPA 1RD6A 1FCBA 3QY6A 3GDBA 3VUSA 3O8AA 4O53A 4I3GA 4IQDA 2R9RA 1H1NA 4PFHA 1UKSA 3BGJA 4OUIA 4FNSA 1XYCA 5CZSA 1XIFA 3B04A 3QN3A 3EX1A 3VFLA 1U30A 4C1KA 3SGGA 3UCDA 4S3AA 2VFGA 3U5UA 4QCEA 1UWQA 1XWYA 4A3UA 1AFSA 4P7QA 5JUVA 3SY5A 1UWRA 3DCPA 1JCJA 3ARPA 1XLCA 1TCMA 4K1WA 4E2VA 1P0EA 4LS0A 4NZ3A 4X0VA 3NVDA 1OCQA 1UH4A 4GQRA 4S3CA 3WBXA 1SQ7A 1W17A 2NWSA 2E9LA 1HKKA 3CUJA 4GNJA 2GWGA 3MV01 3VDCA 7REQB 4HNOA 4JIRA 2WJZA 1W1B1 3PZ9A 4A3RA 2PCEA 1J4EA 4V33A 1IT0A 4H7VA 4B4HA 1FH7A 3MP4A 2Y5EA 1KV5A 3D46A 1LL4A 2NX1A 1L9WA 1E9YB 1TRIA 3R8GA 3SQLA 5ECUA 4K36A 5AKQA 4JYFA 1G4EA 1KM2A 3IIZA 1HKIA 2O0TA 3PS7A 3TW9A 5AN7A 3OGVA 4QXIA 2H8XA 4QLKA 1XIGA 4FO4A 4JXCA 4GISA 1W9VA 2CZDA 2CBIA 3LLXA 1HP4A 1QBAA 2F38A 2PC8A 3UEQA 3RPMA 1UR2A 1V3IA 1UASA 1JCYA 4L80A 1QNVA 2I7GA 1OFQA 4ZE4A 5MF5A 2BHYA 3VDGA 5LIUX 1JZ3A 2E7FA 3TV8A 2J9XA 2GUYA 2VR2A 2E1WA 4LGXA 1AODA 2ZXBA 2ZDRA 2YX0A 4R7JA 5BW6A 3OJGA 1YIXA 1K6AA 4UIOA 1F07A 4S3KA 2QUNA 3PNUA 4TUFA 3RDKA 3GUGA 4ACYA 4O0KA 2OWCA 1QI4A 1Q6QA 4CNPA 3E9AA 5BRQA 2DUZA 3GVRA 3HU7A 3C52A 1PAMA 5ABGA 3RLUA 1R87A 1IXQA 2PBGA 1XH1A 5AYBA 4J35A 3BLIA 5DQPA 2H9AA 3U8GA 2X7VA 3VKDA 4Y9PA 1XLDA 4S3EA 2ATMA 4V1YA 5FEXA 1PE1A 2E8YA 2OYKA 3AS0A 1Y8BA 3APTA 3TWAA 3UZJA 1XJBA 3KBVA 3DKJA 1DIDA 4JKMA 3S5SA 4GCAA 3RXZA 1DWGM 2XIMA 3E2QA 4C6BA 4AC7C 1H2JA 3AIQA 3SN1A 4E0CA 2OPJA 3BK0A 4BHYA 2FHFA 2VEKA 3B0UX 1YXDA 1S5TA 1D3CA 1T41A 2BLEA 3S5OA 2PB1A 2ZRVA 4L65A 2ZCGA 1OK6A 1WKEA 4YTTA 2OWWA 2J78A 4D2JA 3K13A 1FWHC 1XICA 3JU2A 2GGEA 1L0PA 4QLJA 1ONEA 1SFLA 1QWGA 2Y8VA 2UY2A 5GJMA 5LZLA 1PTDA 4QITA 4JZ5A 3BCFA 4IQEA 4DZHA 4WEVX 3V5FA 1YXCA 2J27A 2DZTA 3W22A 3PUEA 1OX4B 1PIGA 3RM9A 4W7VA 2AAMA 1W31A 3ZJ8A 3E3HA 3UNDA 2FPYA 2YXGA 1HGWA 1FVPA 3FLUA 3UG4A 2IXVA 1BGGA 2Y8KA 3PM6A 5I3DA 4UNKA 3OG2A 4YXGA 3TTEA 4W5ZA 3DN5A 5GJNA 4D6HA 2IKJA 3AS2A 3RR1A 2WYSA 3U2EA 1R2TA 1FWDC 4Z2LA 1FP9A 3ZZ1A 2PCQA 2VL4A 3T05A 3QV9A 3ELFA 4JEQA 4F2TA 3ZR5A 4X60A 3VKAA 4IHCA 1DP0A 1H7WA 1Q66A 1FP8A 1MZRA 1XH0A 2XUCA 4DNMA 3WQVA 3MP5A 2XIOA 3BC9A 1T8XA 5HJLA 5D2WA 3WLIA 3T0AA 1DXIA 4CQDA 2WWDA 4XUYA 1RY8A 2QV5A 3QRHA 1A5OC 2CC0A 3PFMA 4H9MA 3ZS4A 3EXRA 2F6UA 4UTTA 1AA1B 4UTWC 3O9NA 3PY2A 4CN1A 1AZ1A 1XSIA 2H8ZA 2QKFA 3UWVA 4C91A 1TV2A 3MMTA 1P7TB 1A4LA 2E8ZA 4H01A 2QLYA 2Y7DA 3BLEA 1WV2A 5A2AA 3T9PA 2INFA 5H8PA 3BAKA 3N6JA 4GNVA 4XIAA 4Q4KA 4K7YA 3S2MA 3UJSA 2ZRUA 5I3KA 1U5VA 3INPA 3TSDA 4HPJA 4GXMA 1KNWA 2YCJA 3H7VA 4O52A 1BF2A 5HOSA 5JXQA 2WLZA 1AVAA 4M82A 2SFPA 3KRSA 4UFKA 1W56A 3BAIA 5A6MA 4C7FA 3H6OA 2GQ3A 9RUBA 1OYCA 4MVAA 5J8LA 4FX7A 3SURA 1GOIA 4JTUA 1SO4A 2CZ5A 4DJFD 1DWJM 4H6KA 3W1RA 3ARVA 4KS0A 3A4AA 2DIEA 2QPSA 5EL1A 3WD0A 1KC7A 3W88A 4M3PA 6TAAA 1B3XA 5JVLA 4P5UA 1YYAA 2V2DA 1WOBA 2EO7A 3LI0A 1K6WA 2PWVA 3MHFA 1Z42A 3IS4A 4CD4A 5JIPA 4BEUA 3OPSA 1LWIA 3TYZA 3KFTA 2YB4A 5DY2A 5A2CA 1UKQA 1Q7ZA 1UR0A 3EB4A 1Q6CA 3QJAA 5I79A 5HDRA 2VT0A 3GAKA 3O7UA 3WF3A 4RDWA 4HHHA 2FTPA 4ADSA 4ZGYA 4KFOA 5K9CA 4OOZA 1GJPA 1J0HA 4N7QA 5I6SA 2GZXA 1EBHA 5A6BD 3UP8A 1L6GA 2V2HA 5HINA 2LLEA 3U48A 2ADAA 4KRUA 3KHJA 3LRMA 2YPIA 3B9NA 3LBCA 4N9DA 4RLIA 3CEPA 1UZ1A 1V3KA 2XH7A 5JIWA 4R3UA 4M8UA 3KLKA 4RDVA 1XLHA 2HNEA 1TUXA 3W84A 4GO8A 4GUFA 1CPUA 1DJZA 2EHHA 2BG5A 4LW7A 4DQWA 4AZ5A 3SRHA 3NWRA 2NWRA 4ATDA 1BFNA 2XPKA 3G1DA 4XAFA 4B15A 1SSDA 3SCUA 2VOMA 2H9AB 3QGAC 1FKWA 4LQ1A 4NX0A 2Y4SA 4XWUA 3GXDA 5GNZA 1VIZA 1K70A 1RPKA 2V5DA 1FTXA 1TQXA 4M6PA 1ICQA 3PPFA 4ZXLA 3O0KA 3GFYA 2NUWA 2NQHA 3OZOA 4UR7A 3A22A 2V9DA 3G22A 5SWUA 3UCQA 4NJGA 4MNKA 3L66A 1BRLA 2DGAA 3T4CA 3O6AA 4NZJA 4DPPA 1GVIA 3E1F1 2YXXA 3DFQA 5LYRA 3DHUA 2PTXA 1XBXA 1W9BM 3G8EA 4IISA 2E6FA 1K9FA 4MB3A 3GIPA 3W26A 4YCPA 4J40A 3OYXA 3W1TA 1V6WA 3L5LA 3A13A 1ZALA 2E5DA 3W7LA 1EXBA 2PWEA 3LPPA 3B0PA 3MDUA 2ZC1A 3WF4A 3KRZA 1WA3A 1UZDA 4LRTA 1HL2A 4JFVA 3ZLGA 1LM1A 2BXZA 5F1UA 4GVGA 3SM0A 2W0UA 1A49A 5LGXA 2ZICA 4GX8A 1A50A 5CZ0A 4L4MA 4HMNA 4QDMA 4F40A 4XTDA 4AHOA 4JIQA 2O56A 1FOBA 1UD4A 1TB3A 2QUUA 4B5TA 4KIRA 4IMAA 2XH2A 4ZTYA 3V5OA 4DO5A 1V3MA 1XRSA 1LBFA 3CZLA 3WNNA 2G3JA 4KCUA 3BCDA 1TZ9A 3SSZA 4EPBC 1FWBC 1KCKA 3W75A 1XLGA 3G1YA 3TXVA 2GWNA 4DUWA 3PBYA 2OQLA 4HK5A 3KRBA 3H24A 4RCXA 2D3NA 2E4TA 4W5UA 4BQ2A 4J3SA 3JW7A 1TKKA 5FIPA 5I24A 4ZE5A 3EDJA 4JFWA 5EU9A 1EF3A 2UZ9A 1PIIA 4M29A 3V0TA 5HMEA 5MKGB 3BO9A 3OBAA 3RO6A 2C19A 5I3HA 5CBIA 2YR1A 1BYDA 1AQ0A 2NQ9A 3GH4A 1SM9A 1KR0A 1XYFA 5JH2A 4HIBA 4XAYA 3VIMA 1RLDA 1XX1A 1RVGA 3IV3A 2QR6A 1EP1A 3L9CA 2PD5A 4EPKA 4M7TA 3EZ4A 3LHVA 1YRRA 3C2EA 3TZNA 3NQDA 2D0GA 2XN2A 1O7AA 1I9CB 1FWAC 1G94A 5HULA 3THAA 4OECA 2AAAA 4R7OA 1SW3A 4E8GA 2QCLA 2PE4A 2WOQA 3CHVA 1KCLA 2A2IA 4JAWA 1EP3A 1YEYA 1JDCA 3VYLA 2IPWA 4Q8VA 2OSXA 3OB8A 2ZX8A 3GNRA 4IX2A 3P5YA 2WHLA 4AD1A 4Q33A 1EB3A 1ZJAA 4EWJA 2I1OA 3UZYA 4UCFA 3ZLHA 1UZ4A 3LYEA 3G1SA 5A6BA 3VNDA 4R27A 3AS3A 1JPKA 1F3XA 4LPCA 1A4MA 2CIPA 2IKIA 4DZ5A 3GAYA 3R0UA 3W73A 5FSDC 1XC6A 2C1HA 3MW7A 4HHMA 5BOFA 4H9ZA 2EKCA 3GW3A 1RJPA 4MLJA 1I6NA 2EAWA 2AGTA 1MRQA 4EANA 2QJHA 3M16A 3V5CA 4OV9A 3B8SA 2X42A 4D6CA 2OSWA 1P5BA 4LEFA 1BTMA 1DJIA 1PJ9A 2GJPA 1TJ2A 4LAMA 2G3NA 1KKRA 1NARA 2V68A 4PA8A 3TN3A 3N3MA 4YLWA 5KETA 3JVAA 3HMJG 2ESCA 2WAGA 1NH6A 1Q7QA 3W74A 3TTYA 1G6CA 1AG1O 2W67A 4DELA 1GYLA 1VC4A 1SPQA 2IXUA 3PTMA 4ZOEA 2HVMA 2BDQA 4AZCB 2TYSA 4DUVA 1V6TA 4Y9MA 3DHPA 4WOZA 3E0FA 3EWYA 3CEUA 3U3HA 3L4UA 3WF0A 4NSBA 4GMEA 3O05A 3WK2A 5TBOA 2VOTA 3W2JA 5K3VA 3P8IA 1KXVA 4IGMA 1CGWA 2O9RA 2XH0A 2X0SA 1GOXA 4BY3A 1JEZA 1XR2A 1F3WA 2JKEA 2YDSA 2DZUA 5F2MA 4EAYA 3ABOA 3MWAA 1EGVA 1CGYA 3KHDA 3FN9A 4W7WA 4MWAB 4YIWA 5M3WA 4ZXOA 4HYRA 2GL5A 1AQFA 3U7VA 1DE5A 3W7OA 2E6YA 4P8WA 2W9MA 3A3WA 2ZUTA 1BF6A 2VZVA 2HEJA 3I6EA 1TPWA 4IMCA 3DKLA 4HMEA 3LXBA 3UWWA 3N29A 1VCFA 3B8UA 3BPWA 1O1HA 2FGBA 5TIMA 1ELSA 1UKTA 4C6EA 1PCWA 4KEUA 4OIFA 2FYMA 1W3IA 3F2DA 3TN6A 3P6LA 4AH7A 5AC8A 5BROA 3UXAA 5DY3A 4J9JA 4QDPA 3CB3A 2A6NA 1UP3A 4NJJA 2I9UA 4A3QA 2DZWA 2WLYA 4B91A 2X2GA 1GQIA 1IZKA 4FLOA 2ISSA 3L68A 1YDYA 3HG4A 1DHPA 2AGKA 3P61A 4MY8A 2VENA 4R9OA 3WBAA 2QXWA 4AY7A 3PB2A 1G4TA 2P50A 3MYOA 2X05A 3T2QA 5CXPA 3UY8A 5C2CA 4MY9A 2PDBA 1TIWA 4K1GA 5BOOA 1CXFA 4A8LA 3NZ1A 3AUJA 4F9JA 1BD0A 3DH7A 2X30A 1ZU8A 2J77A 2VX4A 2E28A 1SW7A 1CLKA 3TK7A 2FMNA 1EPXA 4ZO9A 1NF0A 1QWKA 4XZMX 3GC5A 4LAZA 4OZOA 3ZXWA 3WZ0E 1I0DA 2BGNE 2I16A 2Y88A 3W7KA 1GEQA 4AIBA 1SZGA 3AROA 2G4JA 5PTDA 3W6MA 5H6HA 1XYAA 3WQ6A 1RPXA 1A47A 1XUUA 1IWBA 5LNUA 2WHJA 3T42A 3DOPA 1TWWA 2VUYA 1PKMA 1EUAA 1O5XA 2WC4A 7XIMA 3W3OA 3TQPA 2WPGA 4W86A 1R8LA 5LA0A 5F4WA 2TRSA 4F66A 2VGGA 1F3TA 3W23A 4TQTA 4Y8EA 4HMDA 4XZIA 4DYKA 3UXIA 1UHVA 4B3ZA 4H9UA 4AB4A 3U0HA 4NT0A 1CXLA 2VJXA 2HZGA 3B9AA 1F2JA 3HPZA 2XISA 5EMYA 4K37A 4PC8A 4A4AA 1W91A 1ZP3A 1O94A 3QMRA 4Q8MA 4S23A 4HVXA 2WSQA 5BU9A 1C8QA 4MJMA 5XINA 1Q3NA 4M19A 4GYPC 1CEOA 2WKGA 3GR4A 4HT3A 3NGJA 1H5YA 4O57A 5FF3A 1OADA 4EK7A 1DBTA 3AC0A 4S3DA 1HQTA 3FJNA 3PBWA 2C3ZA 5HNRA 1TPDA 4WUIA 4B2DD 3KE0A 4NXKA 4QSHA 3RM8A 3UT0A 4GFIA 3NDZA 3WDIA 3E2VA 2DORA 3KXQA 2B31A 4IUOA 3SCQA 1V5XA 4HOZA 2BP1A 4L4LA 1CXKA 1X6NA 4XVDA 5D33A 4JY9A 4UQAA 3CT7A 3UR7A 4R7WA 1WPCA 5IDZA 5BMWA 4WK9A 1G4PA 1XIEA 2HSAA 5IBXC 1N82A 4O1CA 4GGBA 1PEZA 4YS1A 4TX8A 1SW0A 3G0UA 3K1GA 3ZLFA 2ZOXA 4RW3A 1QHPA 1TJPA 4KFNA 3B9EA 4N42A 4UTFA 4XZHA 1W1ZA 2NT0A 1D3HA 3OGSA 4NNCA 1HTIA 3C0SA 3G77A 1EA9C 1JUBA 4O4VA 3SCNA 4A21A 4L64A 2WWCA 4B5VA 1XLEA 4JTIA 1VPYA 1A5BA 5FJJA 2YL5A 4LAOA 1W5OA 2YCIX 3ARTA 4KEMA 3QFEA 3H2EA 3S4TA 3W7NA 3L4VA 1REQA 1Z3NA 4MADA 1D9EA 3M4HA 4DBUA 1Q8AA 1MZHA 1EFZA 3WFZA 3POHA 1B3ZA 3R13A 2DH2A 1CWYA 4O10A 2OZTA 1QPRA 3F4CA 5FOOA 3SCOA 5HWJA 2P8CA 4PMZA 3C2OA 3QZ6A 1KRAC 4CU7A 2R1PA 1M68A 1HKMA 1MMFA 1QHZA 5A3HA 2Y61A 3STCA 1P0NA 1WKDA 3ANUA 3N19B 1FKXA 1KGXA 2PGEA 4NAEA 4PRTA 2X16A 1OINA 1FWFC 3AYTA 2E5CA 1XCFA 1AW5A 4BA0A 3A3HA 3VNYA 3GQYA 4M5PA 2PDJA 8A3HA 3F5JA 4ENLA 3K8MA 1JVNA 1IEVA 1F8MA 3IUDA 4H41A 4AD4A 3CUHA 3UR8A 1YKWA 2GJXA 5CZKA 1N55A 4Y9OA 1R38A 1OGSA 4TVCA 5MKGA 2OYMA 1TJ0A 2QCFA 3NQ7A 1H7RA 1E6ZA 1T0OA 4CNNA 4NZ1A 4JHZA 2WZMA 2FTYA 1M6JA 4FEZA 2DFAA 2QYGA 3POCA 3W7QA 2NQJA 5I3FA 5BZAA 2DIKA 3TJXA 4YVXA 1J79A 4UTLA 4HD5A 3RPDA 3W29A 3GVWA 1VHNA 2WCGA 3L2MA 3E2RA 3NYDA 1E0VA 2FKPA 1JZ2A 2HVOA 4LH8A 3TAKA 1E51A 3SW6A 4Q4PA 3LRLA 4US6A 3DYOA 1RBOB 1Q85A 1JAKA 1FBAA 3KP1A 3PAJA 4W9TA 1AL8A 3NQEA 5HUOA 4H19A 2CERA 3HM7A 4YU1A 1ONXA 1TA3B 3PWIA 4WDTA 3WX7A 4PMDA 5HJYA 4XKMA 2FVLA 4PUJA 5CPTA 2VUNA 4EE9A 1PO9A 4ZVJA 4NASA 4JHOA 1JF5A 2DP3A 3MS8A 5D30A 2NT1A 1JYVA 4PB4A 1YPXA 4I7WA 2C6QA 5AHFA 2EPNA 3P14A 4KWWA 1WYIA 2CZVA 1Q8JA 3GU1A 1AH4A 4UB9A 1XYLA 4M1RA 4H9XA 2G97A 2YGYA 2Q01A 1H60A 3UZ5A 1RBLA 3AISA 2E5BA 3DI0A 1UA7A 1E9LA 1UMYA 4GI4A 4O15A 1NFBA 3KDOA 4Z1DA 2BHUA 2NXIA 1H7NA 3EWBX 1K02A 2TAAA 1P6WA 1DJQA 3UJRA 2A0NA 2NUYA 5C70A 1NOUA 2CHNA 4ATWA 4UFHA 3CAKA 4GFSA 3D3AA 1XI3A 3ZM8A 3WQGA 1ADSA 3VDAA 1VGAA 2ZA2A 3PZMA 3T0TA 1PV8A 3OBEA 2Y7FA 4DUOA 3P67A 4GKTA 4LUTA 2PU0A 4JTTA 2CBJA 3VC6A 1I45A 3MP3A 2UV8G 5D9PA 2E1DA 4JFTA 5XIAA 3G24A 3OTRA 4DX3A 2IMRA 3G1AA 2NW0A 3BQ6A 2VGBA 4F2BA 3TAOA 4DBDA 1BKSA 4HHLA 4U5KA 3IJ6A 4IQJA 1B57A 1YBQB 3W70A 3O2LA 2O4QA 3LNMA 4O54A 1V0KA 3G6MA 2VELA 3THUA 1C29A 5GNYA 3JZUA 3UYCA 5H2ZA 4CCZA 4IFKA 4AC1X 4EXBA 2XIBA 4XKYB 4AD5A 1AW1A 3AJ7A 1MEHA 1AJ2A 2BSLA 1CGUA 1KXTA 2RFGA 4HA0A 4ZQNA 4GYKA 4LC8A 3R94A 4HPXA 4WXYA 1DVJA 1MUCA 1G7UA 3MBFA 4OHQA 3QTGA 4ZFCA 1RALA 4QSFA 5A8GA 4NQ1A 3NQVA 3QPZA 2ZQ0A 2AKZA 4UR9A 5CC5A 3FFSA 1OIFA 4IX0A 3PBMA 4LVFA 1ODZA 1FWGC 1BQGA 3E6EA 2AKMA 3NSMA 3LPFA 4GD0A 3W25A 3NQAA 3WBYA 3MQTA 1DQWA 3FEMA 1BWLA 3VDBA 5BXPA 3LTSA 3EMCA 4F0RA 1OC6A 5E70A 2PTDA 2R8WA 4C1NB 2DZXA 4US5A 4X61A 4ERGA 3KBNA 1OZMA 3CL6A 4WDWA 3OLDA 5HJXA 3CT2A 3OBKA 4JIPA 3UWZA 1W1YA 3ZT6A 3FNDA 3PF3A 2OSYA 1UR3M 1AL7A 5K9DA 1NTHA 3WH8A 3O6DA 3CPGA 1P0DA 4LYKA 4A2RA 2Y5SA 3WY1A 4QHRA 3GHUA 3BL3A 3U2OA 5XIMA 1Q4NX 5F7UA 4KCVA 1C7TA 4MPKA 1N7KA 2P3ZA 3KAOA 3ITTA 4QQUA 4OBRA 1T96A 1OT2A 2FPVA 3L5MA 2PDKA 3GZAA 3THDA 5FI8A 1U1HA 2O92A 3PFRA 3CZEA 3W37A 3E38A 1KXQA 3ARXA 3CM4A 3NNTA 5BRPA 2ZWYA 3WEOA 4CQBA 2XGIA 1OWQA 2NLYA 3LB0A 1LP6A 2QJJA 3MMWA 3SUUA 3EXSA 1NFGA 1WCGA 3TNOA 1GPWA 9CGTA 1CXIA 1KM1A 5GNXA 4NP7A 3MJYA 4DM1A 2V63A 3A23A 1TWSA 1SO3A 2XHYA 2Z4GA 3VVGA 4AD0A 1CNVA 1UP2A 5C71A 2PDYA 2FB2A 3SCWA 1IEIA 4M0XA 5IFTA 1E0WA 1HO1A 1RA5A 2GFTA 2PLKA 1G1YA 2CXEA 1V3LA 2DQXA 2ZZ3A 4QM1A 4PMNA 2DVTA 4NUWA 1CECA 3Q94A 3TYAA 1JZ4A 1MFUA 2JGQA 4MNMA 4POCA 4JFSA 1QW9A 4R85A 3APYA 1HKWA 4Z1BA 1P4CA 4G6CA 4XBKA 1TYGA 1KFBA 4YTQA 3GHSA 3BWWA 1QBBA 1XBVA 2BXVA 4FP1A 2BASA 4A05A 3E0IA 1US0A 5LHFA 1ZAIA 1YTEA 4GCXA 1RR2A 1B4EA 3WEMA 2V82A 2HS8A 3UZWA 5I77A 3S8HA 2GYIA 1QRQA 4UQDA 5C8BB 3LERA 3QOMA 3M0JA 3GVVA 3N9KA 5E0CA 1TV8A 2V67A 3KL0A 3NM1A 4Q8TA 1WAUA 3ZYZA 1N8IA 2W79A 1VJSA 2DT3A 3LQLA 2P53A 1QASA 2I14A 3ARYA 1WE5A 2P0OA 3BURA 1VLWA 4OQVA 4J3XA 1GQLA 3C8FA 1YE6A 5IRPA 3RCYA 1ZP4A 1FWCC 2E40A 5HMFA 5ABFB 1S39A 1WXZA 2GSJA 3JUGA 3BTNA 3VOGA 5HNTA 3AWOA 1EP2A 1TPC1 3HQ1A 3OODA 3MHUA 3BLOA 3XINA 1SO5A 3COTA 2WANA 4IP5A 1ISXA 1BXBA 1PTGA 1LDCA 3PC0A 1KW1A 3WJSA 4IIFA 1H63A 3QQ0A 3ABSA 2JIEA 3KCJA 2INEA 1WDSA 2IW0A 3SIZA 1TCDA 1XGDA 1UUMA 4S39A 3B03A 5LNWA 3EEGA 4AFYA 4AZ7A 2OOGA 5FACA 3M7WA 3ZT5A 3C6CA 3RX2A 4AXKA 1LT7A 3CZGA 5I0DA 4CNTA 1E4IA 5A8QA 3RG6A 1PZ1A 1M5WA 3WNKA 3VCNA 5IXEA 4JR5A 2ISVA 3IIXA 3GTFA 4Y2WA 3BOLA 1XHGA 1XS2A 2E67A 5LNSA 3ORWA 1OY0A 1UPPA 4QJ5B 1M01A 1XC4A 2YFNA 2VP8A 2WVVB 4LFYA 3VCCA 1BHGA 4DRSA 3BXWA 5DRIA 4L7ZA 3BLLA 3NOEA 3CV6A 1I2OA 4XISA 4PUEA 2E6AA 2QCHA 3EDEA 5G1MA 1EPVA 3EKGA 3SGZA 4GX9A 3M0IA 2B81A 3AZTA 4LXFA 4IXHA 1GQJA 3VOHA 4O1EA 2WMHA 3BV7A 1IEWA 3O63A 2FJKA 1Y5WA 3USZA 3YPIA 1HW6A 4K8EA 3WJYA 3DZ1A 3KVJA 4O1DA 2PPGA 1LQ0A 1VBHA 5EMMA 1TR9A 1JXKA 3ITYA 1EA0A 3SN0A 2BVDA 2I9EA 1E0UA 1DL3A 4PH6A 1TWIA 4MJ4A 3EDFA 4GLEA 3CWHA 2DZAA 2IKHA 2C15A 3KM8A 3AHVA 2WSKA 2Z0IA 1YX1A 3B0XA 4LVAA 3WUGA 1V0MA 1XDJA 1RSCA 1FWWA 1ITCA 5CPNA 3A4XA 3LUTA 3ITGA 1VFFA 1XYZA 2Z2AA 2CLMA 5A6AA 2C91A 1UC5A 3CV7A 2FDMA 3AI0A 1EWEA 8XIAA 5KITA 4N4PA 1W5MA 3IGXA 3KBSA 4DJEA 4G7FA 1QMLA 1XPYA 2QDGA 5KZMA 1JNDA 4MDOA 2OELA 1YNYA 3H2MA 1UKOA 2F61A 1BGAA 7A3HA 2YLAA 3KTCA 4NL1A 4LJ3A 3M6DA 4PB5A 3DECA 5AC4A 1PDZA 2RDUA 2V38A 2YA1A 4MIMA 4IFRA 2H6RA 1T6MA 3VO0A 5LHEA 4FALA 1LL6A 4KWVA 3GVQA 3CYVA 1LTDA 1WXYA 2Y85A 3CQ0A 3IVSA 3MI2A 2NXHA 1GZGA 1EKOA 4JCLA 3TZFA 2HK1A 1Q7MA 1TO3A 3RMJA 3ES8A 3OVPA 1CTNA 1QATA 4GQQA 2CHRA 3UJFA 3LM3A 1PPIA 3G2GA 3TJIA 2W92A 1V0NA 3NPXA 2OYLA 3HBLA 5EB8A 2Z1VA 4KESA 3LBMA 3NVTA 4UCGA 1OD0A 1K8ZA 2XZ9A 1VIWA 3VGDA 4FLQA 4QAIA 4LCSA 4UTIA 1UWSA 3R0KA 1V8EA 2Y89A 1D2KA 4Z42C 2RAGA 3VGEA 3WCZA 4M6UA 3EXTA 5HNUA 2VFHA 1J12A 4NKCA 5CLTA 3SADA 4NX5A 2Q8LA 2WCAA 1I75A 2XSXA 4DWSB 2VWSA 1QOQA 4N9CA 3E2SA 2HVNA 4IP4A 1S46A 4AY8A 2X2YA 1ISYA 4MKSA 1T8QA 2OEMA 4HNNA 5CBJA 5CG0A 5CSUA 3EOSA 5HBFA 1IT7A 1JCTA 2OJPA 2VEIA 4MZYA 2PMQA 3WMCA 4U33A 1ZHAA 3ZQ9A 5A6SA 3U9IA 3TMLA 3N4AA 3M07A 3W7MA 1ZJHA 4CNUA 3REQB 3L4ZA 4GIRA 4OOUA 3BSHA 4GXWA 1IF2A 1BVZA 3O15A 2F8QA 2ON3A 2ALRA 4GWEA 4DM2A 1A5UA 3ABQA 3UETA 2BY0A 4IZGA 1C92A 3WD3A 4MB5A 1JPHA 4MNLA 3CNYA 1QI2A 7ENLA 5E1QA 3OHIA 2Z2UA 5CLWA 1LBMA 4ATLA 5G4WA 5JBDA 2PDPA 4XVEA 1PX8A 5FEPA 3FA4A 3NDYA 2OZ0A 3V1HA 4I9MA 5F4SA 1KM4A 2A21A 1KGUA 4HSNA 1JGIA 4BR1A 4ACZB 2OKTA 4S3FA 5CJNA 1JJKA 1TPEA 2JEQA 1M53A 4DAFA 2GJNA 4C5YA 1YDOA 5A94A 1O68A 5A6JA 1KBBA 3R8RA 3GC2A 1LJYA 2VEMA 3WD2A 4BQ5A 2BX7A 3H7RA 3TH6A 2CBVA 3VAVA 1K77A 3T08A 4F2UA 1VBJA 5BYWA 3PG8A 3B0YA 5HANA 2QJMA 4E3TA 4FNRA 4V1XA 4U3CA 1VHCA 2FZBA 2QW5A 1KBIA 3BW3A 3I68A 3CAQA 4MWAE 1MUMA 1R9YA 4UC5A 1XDMA 2PSNA 1G9HA 2VEFA 3FW6A 1DORA 5LIYX 4GABA 3WK3A 4IGHA 3MA8A 5D9MA 3TC7A 5AB3A 2MANA 4I9AA 1QVBA 1Q13A 4JQ3A 4QISA 1FCQA 3W00A 1OG6A 3FA3A 2PDLA 4MB1A 3S47A 3AIEA 2HNHA 4KCTA 3H2AA 3OA3A 1XW8A 2CCRA 5AC6A 3F2CA 5F2LA 3M5VA 3BH4A 2ANUA 3IK2A 1W5PA 4GIEA 2AL2B 1H1YA 1HVQA 3C8NA 3GG1A 1JYXA 3WLOA 4AVFA 4EAMA 4XTIA 2YBTA 3Q4DA 2J8FA 2V5LA 2EEXA 3WBWA 3GLCA 4TMBA 4MYAA 3TNBA 4QRNA 3PZOA 5D2VA 4DI9A 2DW7A 1QW8A 3NO5A 2V5JA 3KLLA 1F6KA 3BOFA 4BCEA 1I2RA 5E0FA 1ZNNA 3ITLA 3QZEA 4RK8A 5D2YA 1QCWA 3NR0A 4LUIA 1ISZA 3VIGA 4FPSA 4WX2A 3QW4B 3BLDA 4WDXA 5EBAA 2WMIA 5G4EA 2J75A 2QIIA 4B9ZA 5BWFA 4PMXA 2BZNA 3Q65A 1EBGA 1KFEA 4QNEA 4PTXA 4FK9A 4FNPA 1OFOA 4LRSA 2OT1A 4XUGA 1AJ0A 4B5UA 3LS9A 1ODUA 1FDYA 1T99A 1E0TA 1DXEA 1O5KA 3IJ9A 4H6EA 2QULA 1S5VA 1VEPA 3GWQA 5C9RA 3ZMRA 4RPQA 1PX4A 3MMDA 1BKHA 1XSJA 3TIMA 5DT7A 2A7RA 4ES4A 1FFQA 3NZPA 3PN8A 3CMGA 3JR2A 2DT2A 4GO9A 5CPOA 2YZ5A 1NAL1 3T2OA 3MUCA 4NJIA 4YVPA 3FCPA 4IPJA 4JTEA 1ME7A 3OZPA 1SZRA 2VGIA 5K9XA 3E5BA 1M03A 4XD4A 1F6YA 1CI1A 4JICA 3WQOA 5HWNA 3C4UA 3CZKA 3WN6A 3R2GA 2HV5A 1RXOB 4GQGA 3ZWTA 4GI6A 1DJGA 3LK6A 1OK4A 2EJAA 4TIMA 2J79A 3W24A 2JEPA 2QPXA 4E4UA 3VE9A 1J0KA 1F76A 3P7YA 1HP5A 2C8NA 3TCSA 3CUIA 3NYZA 4JIHA 4PE8A 5EMKA 3OGRA 1WQ5A 1R6WA 3RRAA 4XIMA 1UD8A 3EEZA 5GJPA 5LGZA 2HK0A 1Q5MA 5AC5A 3GVGA 1ZJIA 2R94A 4O19A 3RPTA 3GXIA 4ZO7A 3B05A 5C5YA 4HSOA 4JN8A 4O8AA 3PUOA 3FDKA 2D2GA 1S5MA 1UOZA 6XIAA 3QW3A 5ENLA 2VCBA 4LYRA 5EA9A 4NI8A 3VGBA 1L6YA 1KXHA 1JUKA 1OX6A 3MZNA 3F4NA 3WQWA 1W32A 1D7FA 2BMBA 3SAZA 2PWUA 3IAQA 2NX3A 3J7HA 1FWEC 4Q4OA 4PRRA 3LXCA 1XQLA 4MKNA 2OU4A 1M7PA 2VVNA 3TQVA 1XCWA 5D8ZA 1RA0A 4GI9A 3EOLA 4BKNA 2ZXAA 3C0JA 3K4AA 1J5TA 3VNLA 2W3ZA 3EPMA 4HOXA 3SN4A 2YDAA 2HTMA 2PF0A 4AWTA 2WB5A 3LCXA 4GC3A 2ZZ4A 1YE4A 1VYRA 2HS6A 4O8RA 2PTWA 4K7VA 5AVHA 4EVZA 3W1AA 4HA4A 1TTQA 2XVGA 1F05A 1KA9F 4UOQA 2OO6A 2EGZA 4WD0A 1RY0A 3LX9A 4RW5A 1K7EA 1W1TA 1MW2A 1R47A 2XN1A 3ARZA 2XWDA 2HXUA 3EMZA 2CLIA 1KBKA 1E3ZA 5CJ5A 4ZQCA 5IBXA 2A3BA 4O11A 3QH2A 7TAAA 5CC6A 3BOXA 1WXJA 4AWEA 1TPFA 2ABBA 4LT9A 5A8MA 4QJ4B 4I9TA 4Q32A 3E74A 2YDQA 3NQCA 4K68A 1WZMA 3NZGA 4D6DA 1FDJA 1X1ZA 5C9UA 1XLKA 2VC9A 1RD5A 2EG8A 3HPXA 2WPBA 4IWWA 2Y24A 3PWAA 4CUCA 2YLLA 4O1FA 1MI3A 3N9SA 2X8RA 4FZIA 5AY7A 2ZRWA 2FB3A 5CH9A 4TV6A 3MWCA 4ROPA 2J7BA 5LSMA 1SR0A 1ZBVA 4PZVA 4W93A 1LLZA 1WUFA 1U83A 3WYZA 4MAZA 1XBZA 3U4FA 4N02A 3CH0A 3DBPA 1HJUA 2ZUSA 1LOLA 4E8DA 2D0FA 3GNXA 4INFA 3S2JA 2OTDA 2PC4A 4JTLA 2OOFA 3UERA 4X0NA 3MKKA 4PYSA 2DIJA 2XN0A 4P7OA 3NZQA 2ZRXA 3RU8X 4KT2A 3QV7A 2ZX5A 1MRAA 3CUFA 3ABXA 2PLMA 2A3LA 4IMDA 3ITXA 3HGSA 4GIAA 3RHGA 4J2PA 2CETA 2Y5JA 2GGHA 3A4WA 3HA1A 4DF0A 3ZJKA 2XFYA 3R4IA 3LQGA 4N0RA 3QF0A 2ACRA 4AIUA 3H4XA 1TX2A 3PBVA 4DXXA 1M1BA 2PGFA 4Y7EA 3TA6A 2FHCA 2W27A 1PCKA 4LBRA 3LNPA 5DLCA 3WH9A 1E56A 1VYSX 1V6VA 4GH3A 5E9XA 1AJZA 4J3VA 1KQYA 5AYIA 1NVMA 4JNZA 3A12A 3O1NA 3AMDA 2VFDA 4GUHA 2ZUWA 1GJUA 4DPQA 3GTHA 2OQHA 2DSKA 1GQNA 5I07A 1TIMA 5CZJA 4DLMA 3WQ5A 3T0BA 3VNMA 4HU3A 3OEXA 5E6YA 3C2VA 2Z7KA 5AHNA 5G5IA 1L2QA 4YHGA 3PP7A 1IZCA 2YL8A 3N14A 4KMQA 5H1WA 3N15A 1HT6A 1ZL1A 3LCWA 1AK5A 1YDVA 4HBKA 3NPVA 4EXAA 4RNFA 2J8TA 3WFAA 2YA2A 2ZUVA 2P88A 3IJ8A 4FB7A 1IEXA 2PDHA 3R10A 4NHVA 4L6HA 3L7RA 3CU2A 3NEHA 5CPMA 1H0IA 4ICMA 4JTGA 3WQCA 3WDPP 4PUNA 3TR2A 3LPGA 1EYWA 1CBGA 3NL3A 4HZ6A 3ECQA 3G1VA 3I65A 3IJIA 1OG0A 3N12A 1DJXA 2ZXQA 4ZO8A 5HQEA 1FRBA 1V4YA 2G41A 3EPNA 4W89A 4D8LA 4JS3A 1PWLA 4DJEC 1F5ZA 1HL8A 1V02A 4CCDA 4WDUA 2L5HA 4IH3A 3AIWA 1F4AA 3ABZA 2X1TA 5DRCA 4XD6A 2CESA 4KIEA 3L23A 3WDHA 4FXSA 3MB9A 2NUXA 4AZGA 1P1MA 3AIVA 1PYFA 5U7SA 1JRBA 3ITCA 2VC7A 2QUTA 3GXNA 2PRMA 1HL9A 1TRDA 5DMMA 1HJWA 1BXNA 3PTDA 3NL2A 5CBBA 1GZJA 1MUWA 1BAGA 1QNQA 3K4WA 4ZB5A 3LEPA 3BARA 2F9RA 1JD7A 3WJWA 4C6LA 3DG7A 5KZEA 5F4XA 3IRSA 4ZQMA 2A85A 2CLKA 5KSWA 3GY1A 2NVAA 3RR4A 1E43A 3HQPA 1E70M 1M41A 4IXXA 4NNAA 4WKFA 3N2MA 1FFRA 3D47A 3FEQA 4IPNB 4RV3A 2OCZA 3IANA 3HPFA 3G1RA 3Q67A 1QNPA 2Q71A 3O6YX 4JBRA 1SZEA 4MHBA 4H4IA 4PBFA 2YZRA 4NNBA 2BOEX 3PBUA 2EPLX 3RRXA 4QE4A 3CYJA 5AYYA 4P7NA 1KTNA 1J01A 2POTA 3WG6A 3L12A 1BWVA 1X97A 1GKPA 4X2PA 3MCMA 4E8CA 1K8CA 3N11A 2J7FA 1W1IE 3VIHA 3QBUA 4CEUC 1EQCA 3AOFA 4WY0F 3C56A 3VZZA 4US5D 4FLRA 4TU1A 2PURA 1U5HA 3M5ZA 4GZ7A 4NYYA 4ZR8A 4X9SA 5CGQA 2GK1B 2RJHA 3QLDA 3VOCA 2ISFA 3PTQA 4FAMA 3O06A 1OM0A 5ABFA 1EQPA 4AMAA 2Z2BA 3M41A 2UY5A 2V6AA 1A0CA 1SZFA 1K3UA 2FZNA 1KWGA 2V5BA 2OMAA 3M0XA 2VZOA 4R88A 4PCNA 2PDXA 3RIKA 6REQA 3OYZA 1ECQA 1S3TC 4YTRA 2D22A 1QOPA 2VZUA 1EEPA 2DQWA 3C2RA 3W27A 4MWAD 1OC7A 4B16A 4JN7A 3R1ZA 1GW9A 1E6SM 3QMTA 3KUMA 1E5NA 3MCOA 3KS6A 3IARA 2VRQA 1GJWA 3F1QA 4OT7A 4ZOAA 4QE5A 1ZBKA 5EMLA 3TKFA 1JXJA 3TEVA 1O5QA 5A6KA 2FLIA 3AXXA 1HKJA 4BF7A 3PPHA 1SU5A 1ZPTA 3HO8A 5CZTA 5CAHA 3BMVA 1THFD 1XIJA 4TX6A 2ODOA 3PG9A 4FIQA 1TTJA 3GG0A 2DSWA 4Z2JA 3O16A 5L6UA 5MHBA 3CQHA 3NQMA 3SQMA 1SYTA 2QMJA 3SB0A 4IFKB 3GDMA 4QJ1A 3K8KA 4GYFA 4N2YA 1ICSA 4DBWA 3T78A 3FKKA 1X8FA 3G0XA 2MUCA 3AHXA 2VZSA 3UR5A 4AZIA 2Y1HA 3ANVA 1X7IA 5D9NA 2CU0A 4JDYA 3PAOA 4NILA 1Q6EA 2DT1A 1RCOB 1KFCA 4HK7A 1CX9A 3M6YA 5DMNA 4Y90A 3AAMA 4AUBA 4YYFA 3QGKC 4K39A 4IPLA 3WQFA 5BXTA 8RUCA 3PZQA 2QCMA 3KVLA 4IIHA 3UR2A 4AEOA 1XRFA 4HK6A 1JPDX 1I2NA 1P43A 4JTDA 3GX9A 2VC5A 3CV1A 2DUAA 3CUZA 3WQ4A 3UF9A 3TFXA 4DVOA 1CT5A 4U28A 3PJWA 1OD8A 4L61A 2BNJA 1HN1A 3WELA 3OU8A 3PZNA 4J3UA 3SI9A 3GRIA 3OQ8A 3ZR6A 1A53A 3H4GA 3QR0A 1G01A 2CLHA 5T9BG 2TODA 1ESWA 4TOQA 1EH9A 2R6OA 2FJUB 1F73A 3LHUA 2Y6ZA 4WJEA 3M5XA 1TUFA 3WLLA 4PN2A 5F1VA 4W7UA 3WNMA 3FVDA 4CNSA 3MDWA 1UIOA 1K1DA 2YW4A 1SZNA 4N9BA 3LMYA 1IGWA 2HPMA 4JKLA 2J66A 4H2CA 2V81A 2HMCA 4XZWA 1X98A 2BV9A 1HG3A 4LAKA 4O50A 4EPEC 5G2IA 3KTXA 1WDPA 4QG6A 3PHAA 3GHRA 3HURA 2VTFA 1LZOA 1NM9A 1R3TA 1GQKA 3GXTA 2QVHA 3B3DA 3RN6A 4D6EA 2BY2A 1VKFA 2Y7EA 1BQCA 1F74A 1TVNA 3EWZA 4YCOA 1AQMA 2X1UA 1R46A 4F0KA 3M43A 4DAIA 3I6TA 4NAEB 2C13A 3QPEA 1XXXA 1O5RA 2QJIA 3VMNA 3TTSA 3HMCA 2WMJA 2GQ9A 3PSVA 4L5ZA 4Q8OA 2KX9A 1UP0A 3MBDA 1FCVA 4MSSA 4KERA 2GUUA 3TN5A 3TQ0A 1R86A 3CL7A 4IGNA 3W02A