1NDZA

Crystal structure of adenosine deaminase complexed with fr235999
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
349
structure length
349
Chain Sequence
b'TPAFDKPKVELHVHLDGAIKPETILYYGKRRGIALPADTPEELQNIIGMDKPLTLPDFLAKFDYYMPAIAGCRDAIKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVQAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDTTLYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenosine Deaminase
publication title A highly potent non-nucleoside adenosine deaminase inhibitor: efficient drug discovery by intentional lead hybridization
pubmed doi rcsb
molecule tags Hydrolase
total genus 144
structure length 349
sequence length 349
ec nomenclature ec 3.5.4.4: Adenosine deaminase.
pdb deposition date 2002-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1ndzA00
3QGAC 1J6PA 4H9MA 4QS6A 2P50A 3GIQA 3PNZA 3F4DA 3KM8A 4RDVA 3LGDA 4H9ZA 2Z00A 1GKPA 1I0DA 2AQVA 4PCNA 4QSFA 4CNUA 1FWCC 3G77A 3T1GA 1RA0A 4HK5A 1GKRA 1EJWC 3LSCA 1POJA 4GY7A 3T8LA 1YRRA 4G2DA 4QS5A 4E3TA 3OJGA 1NDZA 3UPMA 4XD5A 4WHBA 1EJTC 1YMYA 1A5OC 4TQTA 3GG7A 2DVXA 2Q01A 3E0FA 1J5SA 4C6IA 3F2BA 5FSDC 2Y1HA 3MDUA 2D2HA 2ANUA 2FTYA 1A5LC 2GSEA 1NDVA 3ID7A 4RDWA 4B91A 3O0FA 3GU1A 2IMRA 2VUNA 4XAZA 2R1KA 4CQDA 4C6OA 2PLMA 2P53A 5HMEA 4XAYA 1FWFC 4LAMA 2ZC1A 3QGKC 1QW7A 3D6NA 2FVMA 4G7EA 4IQJA 3QY8A 4KETA 2Z26A 4D8LA 4HA0A 4XD3A 2YXOA 2BB0A 4LH8A 4C6MA 4ZSTA 4DI9A 2XIOA 2Z24A 4OFCA 4I6VA 4C6NA 3UR2A 3N2CA 1WXZA 1P6BA 3SO7A 3EWCA 1FKWA 1I0BA 4B90A 2WJDA 3B40A 3RCMA 4RDYA 2D2JA 2YZ5A 4J5NA 4CNSA 1A4LA 5FSEC 2PAJA 4C6PA 1O5RA 2EG6A 4C6KA 4RZBA 2Z27A 5G4HC 3F4CA 2BGNE 3CAKA 3QY6A 4CQBA 3RHGA 4DYKA 1XWYA 4C6JA 4J2MA 3HPAA 4ERIA 3UF9A 1E9ZB 1V51A 4XD6A 1E9YB 3LY0A 1V4YA 2Q09A 4IFKB 4C6DA 1RA5A 1PO9A 1V77A 2Z2BA 4AQLA 1RJPA 4INFA 3TNBA 3E2VA 2R1NA 2R1LA 3S2MA 4BJHA 4Z42C 1WXYA 2DVUA 4KQNA 1UMLA 3LS9A 2Z2AA 4C6CA 4LAKA 2HBXA 5CH9A 2VHLA 2OODA 4C6EA 3UBPC 1KRCC 1NDWA 1ITQA 3GTXA 4EPKA 3RN6A 1RAKA 3RYSA 2DVTA 1R9YA 4NG3A 4C6LA 4NP7A 1A5KC 4AC7C 3PNUA 1XRTA 4QTGA 3BE7A 4LANA 3PAOA 2OGJA 4IGNA 3URNA 2FVKA 2OB3A 4LFYA 3F2DA 1ZZMA 3MTWA 3OOQA 1A5MC 1FWHC 3WZ0E 4L9XA 1FWEC 3IARA 1YNYA 1EJUC 1ITUA 3E38A 1PSCA 4WVXA 5LXXA 4DZIA 2O4MA 3MVIA 4GXWA 4C60A 1UBPC 3T81A 2QPXA 2GZXA 1YIXA 4QRNA 3AU6A 2W9MA 2UBPC 4F0RA 2QT3A 4GZ7A 3PBMA 3OODA 4LALA 1UIPA 4IFRA 4IG2B 1W1IE 2VC5A 1J6OA 4ERAA 1P6CA 2FTWA 3B0XA 3JZEA 4LCQA 4V1XA 1A5NC 3IRSA 4C6FA 2PGRA 1M65A 1YBQB 4DIAA 1XGEA 3DUGA 4EPEC 4C6QA 1K1DA 3FEQA 2HPIA 1XRFA 4IFKA 1HZYA 4H01A 3CS2A 3TN5A 1FWJC 1S3TC 4C5ZA 2F6KA 3DCPA 3URBA 3GU2A 4PE8A 3LGGA 2GWNA 1EJSC 4GBDA 4KERA 3A3XA 2QVNA 1RK5A 4LAOA 3URQA 4CNTA 2WM1A 4CEXC 3GU9A 1POKA 4P5UA 3HTWA 4IF2A 4MUPA 3IJ6A 3MPGA 3AUOA 5A6TC 3LSBA 3ISIX 2R1MA 3S4TA 2OOFA 1JGMA 2GWGA 2O4QA 2VR2A 2RAGA 3UR5A 4HJWA 1FWDC 3FDGA 4YIWA 4CEUC 4IGMA 4EPBC 4GX8A 4R85A 3URAA 3GUWA 1GKQA 3LU2A 1EJVC 3NEHA 3LNPA 2HPMA 1EJRC 4B92A 5HMDA 1NFGA 4LEFA 4M51A 2I9UA 3LA4A 4HK6A 4DO7A 4ERGA 3OQEA 3R0DA 3MSRA 4GOAA 1BF6A 3OU8A 4XAGA 1ONWA 1RK6A 3TN3A 2E1WA 4KIRA 3MJMA 2CZVA 3S2NA 3WYZA 1FKXA 4EPDC 1FWBC 4LCRA 3EGJA 3PANA 3DC8A 4GC3A 1K70A 4GK8A 3F2CA 4RE0A 4KESA 4DLFA 4F0SA 1RJRA 1NDYA 1ADDA 1KRBC 3GTIA 4J35A 4IG2A 4IFOA 4H9TA 3K4WA 1DPMA 2PGFA 3K5XA 4L6DA 1R9XA 2AMXA 4R7WA 4XAFA 1EZ2A 1FWIC 4PBEA 2G3FA 2I5GA 1EF2A 1YBQA 4DZHA 4GYFA 1A4MA 2E25A 3CJPA 2EG7A 1P1MA 2HNHA 1KCXA 3MKVA 1RJQA 3IACA 2GOKA 3S2JA 4C5YA 5AKQA 1KRAC 4H9XA 2WJEA 4R88A 3GIPA 2FFIA 4C6BA 1PTAA 4ICMA 1V7AA 4I6KA 1R9ZA 2PUZA 4RDZA 4KEUA 3IV8A 4PCPA 2Z28A 3QY7A 4EP8C 1UIOA 4CQCA 1QXLA 5E5CA 3FDKA 3OVGA 2YB1A 4H00A 3ITCA 3TN6A 3C86A 4ZSUA 3NURA 2KAUC 4H9UA 4F0LA 3GRIA 2HBVA 3B0YA 4GX9A 1IE7C 1FWGC 4GY0A 3E3HA 1J79A 3ORWA 3MVTA 4UBPC 3S2LA 2Z25A 4BY3A 4WGXA 3WMLA 3IGHX 3A4JA 5HMFA 2Z29A 4KEVA 4LCSA 3TN4A 2Z4GA 3AU2A 3E74A 4JOMA 1V79A 2R1PA 2QS8A 4GY1A 3IPWA 2ICSA 1EYWA 2EG8A 1EJXC 4H9VA 3HM7A 2YB4A 3ICJA 1K6WA 3GTFA 1O12A 2OQLA 4IH3A 3EWDA 1ONXA 1FWAC 2UZ9A 1M7JA 4QROA 2D2GA 3E0LA 4DLMA 2HQAA 3NQBA 4H9YA 4PBFA 4DNMA 4XD4A 3A3WA 4HK7A 2ADAA 4V1YA 1VFLA 3V7PA 1M68A 4G7EB 4BKNA 2Z7GA 2AQOA 1KRMA 4C65A 3GTHA 4KF1A 3SFWA 4B3ZA 3K2GA 1PB0A 3MDWA 2WJFA 2A3LA 4KEZA 2VM8A 4UB9A 2VC7A 3O7UA 4DI8A 4NI8A
chains in the Genus database with same CATH superfamily
4RPQA 4GNKB 4ZTXA 4QS6A 3VIIA 2QDGA 3KM8A 5I77A 2J7GA 3PBVA 4NRRA 4EX4A 4PCNA 3DBNA 1JNDA 4FX8A 2H3DA 2GDUA 4MMWA 3BLLA 4NZ3A 2DSUA 1EEXA 4I5RA 4M6UA 4UR9A 1MFVA 2G3JA 3LTSA 1SO5A 1V5XA 2R24A 3CHEA 3DEQA 1V6TA 1A3WA 4FR1A 3WLHA 1HJQA 2ZADA 3CUJA 3WF4A 1Z8AA 4U5KA 2ZRUA 2H9AA 3NJ3A 6XIAA 2Q01A 1DTNA 1UD6A 1DJNA 4JHZA 2Q6ZA 4NJHA 2E5BA 2A7PA 4MNLA 4QSHA 2D2HA 4HIBA 3GXIA 4BQ2A 3PJUA 1AK5A 1A5SA 4Z1BA 1XR2A 3RLVA 1T5AA 3GS6A 4L5ZA 1NM9A 5LIWX 2JBMA 4UTLA 5HWMA 4PB3A 1FWFC 2VR5A 2O9OA 1OC7A 4MNKA 3G1HA 1B54A 3BC9A 4CN6A 1NOUA 1VYPX 3MMUA 3EXRA 3QR1A 5I78A 3O2LA 3WBYA 1VYRA 4GUHA 3THDA 3RJYA 1XXXA 2W66A 4NX5A 3HZ3A 3SUVA 3H2EA 5FSEC 3GHUA 5DCDA 4JXCA 1SJDA 1A5BA 3I3DA 2V63A 3RO6A 1VHCA 3AIWA 3HPAA 2VENA 2DZSA 1GZGA 1V4YA 2BY3A 2OYKA 3V0UA 3VGHA 1VC4A 3A24A 4LY8A 4L1GA 4LRTA 3R1ZA 3RM9A 4IT1A 5U4NA 3FXYA 3M47A 4Z0JA 1ZRQA 1QO2A 3W7HA 2OSWA 2DUZA 2VHLA 1MRAA 4WOQA 5C8BB 1HVXA 1TYGA 3WQGA 3UZZA 3OLGA 4AY8A 1H1ZA 1DWFM 1XG3A 3LRMA 4W87A 3UJFA 4WF7A 3R25A 2QZRA 3LCIA 1CXHA 4UNKA 2QLYA 4MZ8A 3W2NA 4UFLA 3MTWA 1MO0A 2CWXA 2YYUA 4I9TA 4B4FA 3HPSA 3DHPA 1V93A 2D0FA 4CLMA 1AQ0A 3MSYA 1RQHA 2F61A 5D32A 3RPMA 5DRCA 3WX7A 3WFZA 3NDYA 2O4MA 1IYXA 4HVXA 1VHNA 5FA5A 3AZSA 3UZWA 3F7JA 1A5AA 1DE6A 1MEIA 1SR0A 2E6DA 1MDRA 1KFEA 3G1DA 1J18A 2VC5A 3GKAA 1UZ4A 5DLCA 3RMJA 1SFSA 1WV2A 3VX0A 7CGTA 1E4NA 4ZQPA 1E73M 3HQOA 3VFLA 4L4LA 3L66A 1ZP4A 4K3ZA 4H01A 3CS2A 3TN5A 4Z1DA 2ONEA 2CLOA 2XUCA 1LRQA 1W1YA 1DIDA 1MZHA 5H6HA 4NT0A 3RRXA 3UERA 4P7LA 3OZOA 1KFBA 3FYPA 5EBUA 3SCQA 2VNCA 2EJ1A 3MPGA 5K3VA 2EGZA 1UH2A 2ZZ2A 3ZT6A 1BQCA 4RUBA 1XSIA 1TR1A 2BGSA 4HHMA 2NWRA 1AQMA 1HL9A 5E6YA 3FDGA 4OU1A 4XVEA 1F07A 2VP8A 1KBKA 1TG7A 1RPXA 3N4EA 1B3ZA 4L1XA 2FJUB 3LU2A 2HPMA 3LNPA 1EJRC 4XIMA 4M51A 4HU8A 1A49A 1W3TA 3PJTA 3M4HA 3V36A 2QHAA 4ZTYA 1VRDA 3W70A 4BQ5A 4YTTA 5HWNA 2CW6A 3BG9A 1TPB1 3GNOA 1FCVA 3DESA 4R9XA 2XH2A 3QN3A 3F2CA 3PK7A 4GISA 1Q2RA 4E38A 3LCGA 4TOQA 1J96A 3BWWA 2OLAA 1JYWA 3LQLA 2CBIA 3L4TA 3BL3A 5DCBA 5C2XA 4YLWA 3L68A 4H6EA 3VKJA 5A6MA 2FGBA 4CD5A 4C7FA 1CGXA 1LOQA 3CJPA 4V27A 5AYXA 2PTDA 1NF7A 2CFFA 5I03A 4OOUA 3B8TA 5AYYA 4DBWA 4IZGA 1QK2A 2XH0A 3D47A 4NNBA 9CGTA 4JIIX 4CD6A 2DIJA 2GDQA 3APTA 1TMHA 3SGUA 1L8NA 1XG4A 1WDPA 1TPVA 2F7FA 4OT7A 1LRNA 2V2CA 4FPSA 4Q7NA 2VFDA 2BTMA 3NXLA 2ZA2A 1TA3A 1XDMA 3NURA 3GRIA 3IJDA 1E4LA 1PXGA 2VEMA 1IE7C 1PCWA 1VCVA 1RLCL 4ZENA 1B2YA 3JU2A 5D37A 4AMAA 5HMFA 4GWEA 3TN4A 3OGRA 1H63A 1SMDA 4O4VA 5T9BG 1TB3A 1VYSX 5ABHA 4RV8A 1FOBA 4D6IA 2JK2A 1AFSA 4Q22A 2CITA 1SW3A 4AYGA 3BQ6A 4NAEA 3O1NA 1OWQA 2PDYA 4MHBA 3UCQA 1NELA 1WX0A 2EEXA 2VXNA 4UTWA 3WUGA 3IUIA 4QROA 4H9YA 3N2MA 3REQB 1FWTA 1H1NA 3T08A 3U4FA 3TXZA 1PB0A 3G0SA 3TZNA 4ZR8A 4GFIA 3MDWA 1UUOA 1MEHA 3ZJ7A 4FX6M 3UXKA 1BFNA 3TTSA 1J6PA 3AMLA 3FGCB 3GIQA 1ZNNA 2DDXA 2DQWA 1GJPA 2Y62A 4Q6XA 1OX6A 3VPLA 2AQVA 2L5HA 2ZUSA 2WCSA 2WZMA 1H7RA 2YOCA 4JTHA 2BLEA 4BZYA 5A6BA 3RMEA 4DNHA 2QJJA 3W86A 1TX0A 4BQ3A 2TYSA 1GKRA 1W1ZA 1TJPA 4K2SA 3ZMRA 3AZRA 1UC4A 2BWGA 4CCEA 2YA1A 4C1NB 1XC4A 5BCAA 1WP6A 1NDZA 1YXYA 1EL3A 4I7UA 1SJBA 1GHRA 3EPNA 4JTUA 3WNNA 4FF5A 5H8PA 5BMXA 1AA1B 3TW7A 1S2UA 4QJ5B 1BG4A 5ABTA 3E2RA 3PTQA 3CEUA 3WY1A 2YKKA 3EDDA 2UY5A 1QPRA 5F2GA 2WC3A 2VOTA 1PDYA 3S83A 2TMDA 3CU2A 2O55A 3WNPA 2E8YA 3CYVA 3V75A 2ACQA 4PMYA 2VMFA 1H7OA 3O63A 2ZC1A 1CXLA 1XS2A 2ZRZA 1WPCA 1N8IA 2MNRA 3F1QA 2C3ZA 4JAWA 3VIGA 2J8TA 4YVXA 3T40A 3KBWA 2ZZ6A 3ITXA 1P0DA 5LA0A 3QLLA 2G4FA 2OELA 4N6EA 1UJQA 1UD3A 5FL1A 3N2TA 5AYBA 3R58A 3L4VA 3NUKA 4ILSA 1XYAA 1ZCCA 3H22A 3FOKA 1EOMA 1QPNA 3VNMA 5JMUA 3CAKA 3W28A 3RHGA 2BFGA 2HJPA 4TMBA 1CGTA 1KXTA 3LDVA 1IWPA 4C6DA 1A5UA 4V33A 3RCNA 3KRZA 4IGSA 4CN1A 1ME7A 3P62A 1KM6A 1V3LA 4UNIA 3S2MA 5IOBA 4ADTA 1WXYA 1R38A 4DJDD 4K8HA 1SJCA 3EWZA 1F3WA 4I7VA 3V3WA 2YXXA 1JGIA 5D2XA 3UBPC 3U57A 5JQ9A 4MLRA 3EPMA 1ECQA 1H0GA 2XYLA 3CQHA 2YX0A 2E09A 4AC7C 3BE7A 2IQ0A 3BV7A 4IOTA 1ZJHA 3GAKA 3URNA 3WJWA 2JQXA 2J24A 3PPCA 4XZNX 4HQVA 3TFCA 2ALDA 2PDJA 2XZ7A 1UA7A 3OBEA 4Q4RA 4KMQA 4S3FA 1G4PA 2Z6IA 2P5NA 2O9RA 4J3XA 4AZ5A 2BODX 2DV0A 1GORA 3TYUA 1EP2A 1X1OA 5DY2A 4UTHA 3PZQA 4OV4A 1M3UA 1QO5A 4HA1A 3O16A 1EA9C 4Y96A 1IT0A 1Q2SA 3KWSA 4JY8A 2D3LA 4MDOA 4C6FA 3QJAA 4BWLC 2CCRA 3AYSA 1YQ2A 3FVDA 4M6VA 1RP8A 1IT7A 4IIHA 1EUNA 1M04A 3ARYA 1LBMA 2INFA 2RFGA 2OZTA 2WNQA 2V0TA 3CMGA 1QJWA 4WRHA 2IQTA 1HJUA 3ERPA 3LHYA 4H8HA 4A2RA 4EK7A 3VVGA 1D3HA 1TV8A 2ZRVA 3D46A 3QQWA 4QLLA 3GDTA 3ZLGA 2QYGA 4YIWA 1I60A 1MXDA 4M80A 4EPBC 1OIFA 4H19A 2VO5A 3DHUA 3NEHA 1CEOA 3ZFHA 5J5RA 1CGYA 1NFGA 3MZ2A 3HB9A 3TXVA 3S47A 4AWUA 1DHKA 2ON3A 3HBLA 2Z7KA 3OQEA 1EJ7L 2YCEA 1JPIA 4PTWA 4X22A 5A6KA 2IQDA 2QCMA 1KO0A 2CXEA 2NQ5A 3EGJA 2GFTA 5LNWA 1CGUA 4H6QA 1Y5VA 2GSJA 6ALDA 3I6RA 3W38A 3BAJA 4AVFA 2PDBA 1VFOA 2PGFA 3CASA 1K8CA 4CNNA 1X96A 5C7VA 1VRXA 1DWGM 1SZFA 1MI3A 1AUSL 2QIIA 4GPNA 1DXFA 1VIWA 4HB7A 4LU0A 2CYGA 2W62A 3UY8A 1AMKA 4I9JA 3WFAA 2XINA 3FKRA 1XL9A 4C6BA 3BOLA 1T8QA 4KEUA 1I2RA 4UTKA 4ML9A 3W73A 2DZAA 4GJ1A 4A8RA 2B0MA 2AL2B 3G1AA 4LY4A 2ISDA 3CZLA 4O4WA 2I1OA 3OVGA 3EX6A 4V28A 2QJNA 3PHAA 3RLHA 1YYAA 5CC5A 1MRQA 5G5IA 2KAUC 3VCCA 4FNUA 3LPGA 4GX9A 4S3BA 4ZCWA 2UWFA 4BK9A 5DMYA 4BY3A 1DV7A 2Y5EA 1SW0A 3FSTA 1E4MM 2A5HA 2WXDM 3BQ5A 4JOMA 3EWXA 1JYNA 1E71M 2PWUA 3T0CA 3TTEA 3WNLA 3CL8A 4HYVA 4LAZA 4XV0A 4TU1A 3U3HA 3QEZA 5G1TA 4MUZA 1BYDA 1UKPA 2W5FA 3OZMA 1E55A 1BWVA 1O12A 3C0LA 1PWMA 4YTQA 4NJGA 1ZPTA 2UZ9A 2FDMA 4Z2HA 3NQBA 5I3HA 1GYLA 1V3KA 3P80A 1VEPA 4US5D 3BAKA 3G22A 1QWGA 4HCDA 2YYTA 3P2VA 4KEZA 1OG6A 3QZEA 4BA0A 2P3EA 2FZDA 4NI8A 4YTSA 3WLIA 1G94A 3S5NA 4PTNA 4LJ3A 1ZU8A 2G3IA 2NUWA 3S6OA 2QEZA 3ITOA 1RD5A 5AC4A 3TLQA 4H4IA 1H50A 3AHTA 3L4YA 1B4KA 3JRKA 3MI6A 5LNRA 1JDFA 3KE0A 1WA3A 2FZ8A 3TJXA 3SUUA 3GKFA 4B4HA 5I3FA 1O1ZA 3PZVA 4AZHA 4M24A 5AC5A 4AMCA 2PI6A 4NI3A 1PV8A 3QYSA 3LLXA 1B9BA 3S6TA 1A5OC 4TIMA 3LUTA 3RLGA 1QBBA 3NQEA 3GUGA 4IIDA 5BWAA 1VKFA 4RK8A 2ZYFA 3EZ4A 1G69A 1PHQA 4DO5A 1P6WA 1EWEA 2XSAA 3AHXA 4KFPA 2R1KA 3KZPA 2WKLA 2HCVA 1MSSA 2VZTA 1XISA 3QV6A 1IR1A 4PZVA 4XAYA 3POCA 2XVKA 4O0QA 2DORA 3WUFA 3RUBL 2WPGA 3VYLA 3REQA 1WDWA 3GXFA 3C3NA 4EVZA 3HPXA 1XBXA 4OBRA 4YJ5A 2YZRA 1I8JA 1E6QM 1F73A 2ZUMA 2XIOA 5LHEA 4G7FA 3M43A 3S9YA 4N9CA 2E77A 3WK2A 4K36A 3GYEA 1HJSA 3FGCA 3ES7A 3CHFA 5AC6A 1Q8JA 1Z3NA 4C6PA 2B81A 3C2RA 1MZRA 2PCQA 4RE4A 5A94A 1DXIA 3B9DA 4X0NA 3W1AA 3AJXA 2PDPA 5C6MA 3T0AA 3LLDA 4IFKB 3W7DA 1E0TA 1KM1A 1PO9A 3WDHA 4DWDA 1DJIA 4C1NA 1GOQA 4M56A 4EANA 4AXNA 2CLHA 4JIHA 4U2ZA 2DVUA 3M1ZA 4HN8A 4C6CA 3C5QA 1D8WA 3ZJ6A 2H3BA 1KWKA 3WLKX 3RCYA 2V6AA 5CH9A 1B57A 1HIZA 2BS9A 4YTUA 5JIPA 2POZA 4WQ6A 1EUAA 1WB0A 2IXVA 3LRKA 4Q6JA 4LANA 1SZRA 3PAOA 2OGJA 1E1EA 4HPHA 2X0HA 3BURA 1QPKA 4I8YA 5C9RA 3QTGA 2WW5A 4I5XA 1G4EA 2QW5A 2VURA 1JCYA 2Z1KA 2WBGA 5I00A 4IX2A 1VEOA 3WO8A 1QBAA 2XGBA 3PUEA 5DBUA 5PTDA 1KBLA 3OG2A 4PFMA 3BXWA 1FRBA 1R5YA 3KAOA 1UR4A 1OZMA 1JDCA 1VBUA 4A05A 1UIPA 2GQ8A 1XIBA 3SQLA 4HCHA 4M82A 4PN2A 1JAEA 1W3LA 2VL4A 4TX6A 3S9IA 3ITYA 2E67A 5FAJA 1YBQB 2QGYA 5EMYA 4NJKA 3FEQA 5TIMA 4BCEA 1KTCA 2C14A 1LCOA 2TRSA 2C8NA 1YXCA 1GOOA 3DH7A 5FESA 4BWLA 3GU9A 4MUPA 4YVVA 4LNCA 4OHQA 4R33A 4PUMA 5A6TC 3N1AA 1LL7A 4YYCA 3BJTA 3N2BA 4Y9MA 3WK1A 4JL2A 4KWOA 5DXYA 1GTHA 3UZ5A 3WQOA 1D8CA 3RXZA 3GUWA 1S1RA 2OWXA 1QWKA 4ZXLA 3KWXA 3AYTA 2J4GA 4O10A 4XUYA 2QJGA 3EA3A 1YPIA 1H51A 3CPRA 2ZZ4A 2E1WA 2YDAA 3R8HA 3EX4A 4UTJA 2YA2A 1AW1A 3NTYA 4D6HA 3RO8A 4PC8A 3DC8A 1TWWA 3RM8A 1F3EA 3LENA 2WWDA 1P0NA 4HA3A 3GFYA 1D3CA 3R8RA 1GG0A 3I3BA 4Z1AA 1KA9F 2RHGA 3A4AA 4JTGA 1DPMA 1GVSA 3PG9A 2WHJA 1KFLA 1VFHA 3W2KA 1EF2A 2W0UA 4ZO6A 3VM7A 5BW6A 4QNWA 4GIAA 1O4UA 4D9PA 4Q32A 1CXKA 5G4WA 3OW1A 3USZA 1J10A 3SDOA 2PP3A 1DWIM 4DEFA 5I02A 1M7PA 3M0HA 1J0KA 2ISWA 3A4XA 3MHGA 1IEIA 1ISVA 1KBBA 2NVAA 3W9ZA 5A3HA 1AQFA 4AF0B 5LNUA 1LP6A 1TPH1 4ZSUA 1FHVA 2XG9A 1EX1A 3W74A 3FHAA 3W84A 4ZZ9A 4B3KA 2IPWA 3RU8X 2FGZA 2UV8G 1O6IA 3JZUA 2REQB 3LGEA 4AD5A 1BXNA 4A3UA 3T8QA 4N6FA 2ZZ3A 1TPFA 1SM9A 3GG0A 1OADA 3TU9A 1IEVA 1EC7A 1SO3A 3RAOA 4Q8TA 3ICJA 4B5SA 2GLKA 2XGIA 1ONXA 3QKZA 4AY7A 4U2YA 4FIRA 3W27A 3XISA 3PG8A 5LIYX 4D71A 3L2IA 2AQOA 2EF9A 2G37A 4JBRA 4J40A 1WDSA 1XSJA 5EB8A 1GW1A 2VC7A 3W1XA 3M0JA 2J9YA 1RCQA 1TIWA 3KVKA 2ABAA 4D6EA 1VB9A 3B8SA 4OV9A 2JFEX 3L5AA 1AJ0A 4LS1A 1XHGA 2GQ9A 4H3DA 2O9TA 3EX2A 3SSZA 1V7YA 1JZ7A 4RNHA 5IXEA 4LGXA 3C56A 1EJWC 2AL2A 2XN2A 1HP5A 2VD8A 2DZPA 3BAIA 3P81A 4QS5A 4HA4A 5CZ0A 2BX7A 2XHYA 4XAPA 4I9MA 4WHBA 5DFAA 3WMSA 1W32A 3FJNA 5ECUA 3GNRA 3VIKA 5FIPA 5HJXA 1OC5A 3PBYA 1LDCA 3SGGA 5F4XA 1QW8A 4KBXA 4MY8A 1AZ2A 1JDDA 4K7YA 3U8GA 3OA5A 2Z2UA 2VGFA 2VUNA 2VVNA 4A22A 1JYVA 1MNSA 1QHZA 5A1AA 3H2CA 1KC7A 3MWAA 4FA3A 4YWSA 3CH0A 1PHWA 3CM4A 5HNNA 2AQWA 3SY5A 4MKSA 5LIKX 4W7WA 5LHFA 1JCXA 3EX3A 5HPCA 1QTWA 3CMJA 2FVMA 2ZZ7A 1GOXA 2ZTKA 3VD9A 4ZQOA 1B31A 4O1CA 1UKQA 4F0HA 3IK2A 3MBFA 3QW3A 4IXXA 3DI0A 3UNTA 3N2CA 1Z7AA 2GK1B 1B3OA 5CZSA 8A3HA 3BJFA 3VMNA 1WQ5A 4GGBA 2G95A 2Q3RA 3KS5A 2PAJA 4GXMA 4C6KA 1S39A 1JXKA 1DP0A 3PZUA 4O18A 3TZFA 4OJYA 4QDWA 1SMAA 3GE7A 3GVRA 3THAA 1MQPA 4M0XA 4XKYB 4NF7A 4AIUA 4PMJA 1TPWA 2GGJA 3TNBA 2C79A 1QNRA 1J2BA 3PWGA 4DJEC 4HZ8A 3GBDA 1XBYA 3CQ0A 1OJXA 3MUAA 2VEGA 1MFUA 3TAOA 1EO7A 4ADSA 2PWDA 2DVTA 3NQ6A 1I2QA 3SRDA 4GE8A 2Y0FA 4JTSA 4LVBA 4O1AA 5IM51 5GPRA 1QNPA 3O6YX 3P0WA 3GIYA 4UTUA 1HO1A 5CGQA 4W8AA 3IARA 1QRQA 4H8UA 1EJUC 3EX1A 3LHZA 2WANA 4Z17A 4W85A 1UD8A 4FXJA 5DRIA 4GXWA 4O54A 4YPJA 3VXGA 3D3AA 2PD5A 4E0CA 1XUUA 2J77A 4U31A 1OGGA 3DN5A 4GIRA 1JD7A 1W1IE 2BGQA 5DO8A 2QIWA 4NXKA 2D0GA 2FTWA 3B0XA 3MYOA 1XLDA 1LQ2A 4LOCA 1AH0A 3A5FA 2J8FA 1X6LA 5BXTA 1M65A 4DIAA 2XVPA 4BEQA 3Q58A 3ARTA 2OLHA 4PULA 4IFKA 4YTRA 3P67A 3VCNA 1FWJC 1US3A 1OCQA 4DN1A 3GU2A 1TMQA 4EACA 3VOHA 4IMEA 3UWQA 5ENLA 3NZGA 2VDHA 3CAVA 3BOFA 3ZLFA 2XZ9A 1E72M 4KCWA 2GOUA 3OHMB 1HW6A 5LNVA 1JNEA 2ZX8A 2ZX9A 2YPIA 3WD1A 2IPFA 4JN6A 1FP9A 1ZL1A 1JCTA 3H70A 1QT1A 3KOYA 2RH9A 1GTEA 1CWYA 5KTLA 3F5LA 3VOGA 3URAA 4W5ZA 3VIJA 3GNXA 4OE7A 4HHPA 3MJYA 1VENA 3VKBA 4NXSA 4O0KA 3R43A 3W82A 2GSHA 3STEA 2VJXA 1YDNA 1JZ6A 1UWRA 2DJXA 2DSZA 5AVNA 2X1SA 2CZVA 2Y7EA 1H41A 4QITA 1L2QA 1YTEA 2XVNA 1HKVA 3ATZA 1GQLA 2VT0A 3N3TA 2FGLA 4S3JA 1ISYA 2DSKA 2V81A 4ZOAA 2GUBA 3DI1A 1Q13A 1GQJA 3GB6A 3DBPA 4DWSB 4EAMA 1Y65A 4U10A 2JF6A 1R9XA 1W5NA 3JR2A 4GQQA 2G3FA 2I5GA 4A4AA 3O6DA 1YBQA 4I90A 5D2WA 4DAIA 2NQJA 2E0PA 1VFUA 2A2IA 1W1B1 2EPOA 3ABOA 4F9JA 4R88A 2BOGX 2FFIA 2Y4SA 3CV2A 3NQGA 4OBTA 3W37A 3QY7A 4D1JA 1BAGA 4CQCA 3N2XA 1K6AA 4TMCA 3IGXA 1C29A 4MOZA 4H9UA 1CGVA 2HBVA 5K4ZA 4W88A 2AMGA 4QXIA 3G2GA 6TAAA 4FK9A 3UJRA 3CPUA 3TONA 3CL7A 2CLMA 4LSBA 2PTWA 4AIEA 1EYWA 4IJBA 1F5ZA 3DFPA 1CXIA 1TJRA 4P7OA 1W9XA 3AYVA 4MNMA 4YCPA 5CPMA 3EPOA 4YWIA 5KETA 3SW6A 4JIPA 1F3XA 3B0UX 1XLJA 3KDNA 3S5YA 1SJAA 3L5MA 1KB3A 3TSBA 2O0TA 1PX8A 4ZO8A 3MP3A 5CJMA 3S1GA 3N4FA 2BHUA 3CMFA 4G9PA 1S2TA 2QGHA 4GA8A 3EXSA 3U5UA 1V8EA 2Q8ZA 3LX9A 1XJBA 3M5ZA 4UMCA 5F2IA 4UTTC 4H9ZA 3DYPA 2GVYA 4F0KA 3SCRA 1GG1A 1ZAJA 2P8BA 4X3ZA 2J7CA 3II1A 3PSWA 2XH7A 4PUDA 3FIGA 1W1PA 4KFNA 1ZALA 3TQPA 4AF0A 1E40A 2VUYA 3JVAA 4PH6A 1H49A 1LRTA 3VIOA 3ZIZA 3CHCA 1OG0A 2J9XA 3C4UA 4KWSA 1XQLA 1YMYA 4TQTA 3L12A 3FEMA 3QV9A 4DY1A 1BYCA 4GUGA 3W7OA 1MXSA 3CTLA 5FSDC 1GHSA 4BF5A 5A2CA 1H3GA 2Q8LA 3FV9A 4MJZA 4CQ9A 1C8VA 1V6YA 3G1VA 4O16A 1EDQA 3RIKA 1W3NA 3TTYA 4DJDC 3UWVA 3CV1A 5TD4A 3DU0A 1UR2A 4HNUA 1F8IA 4JPGA 3PP7A 3GDBA 1P7TB 1K9DA 1HKWA 3O6CA 3PPHA 3PAJA 4ML4A 3FKKA 4QFUA 3GVWA 1GQNA 4WD0A 1W31A 2EHHA 3SY8A 1V02A 2FZNA 1H4PA 4HMEA 3ATYA 3N15A 3NQDA 2QPUA 4PTXA 2J75A 3ZR6A 5IHRA 1ISWA 4FHAA 5A6JA 3WNKA 4H6KA 4RDYA 4O13A 2GJXB 2VWTA 1F7BA 3OBKA 2Z27A 5G4HC 1HGWA 3F4CA 3VGEA 3WQPA 4LUSB 4NZFA 3OLEA 3LPOA 4UNLA 4Q8QA 3THQA 2OZ8A 4AD0A 3N3MA 5A8OA 1QUMA 1ZENA 2F8QA 3R10A 2WVVB 3WLPA 4WY0B 3GFXA 4AQLA 1W9UA 1AVAA 4QE1A 4UUIA 4IMDA 2Y88A 3WIJA 1B3YA 3TR2A 1VF8A 3LNMA 4QAIA 1OF6A 1D3GA 1TX2A 4OZOA 3BJSA 3M0IA 3SECA 1NDWA 4UOQA 4B5VA 2VFHA 2NW0A 4DJEA 1TV3A 3Q45A 2YR1A 4IGNA 2I5QA 1OCNA 4JTRA 2OB3A 3RITA 1B0IA 4M1BA 4IICA 5JU6A 5E9XA 4O8RA 2XIMA 4W7UA 2D23A 1EFZA 3VGGA 4K68A 3E38A 4CCZA 5LXXA 1ZTVA 4HPNA 3WBXA 4GYKA 4E8GA 3N11A 3TA9A 1UBPC 3KP1A 3HQ1A 4AIBA 3HFYA 3I4KA 4K7VA 3DFQA 5J8LA 4ROPA 3SB0A 5JVLA 4MY9A 2GK1A 3ABZA 1XINA 2Y8KA 4TR9A 3SCTA 3R0UA 2WHLA 5I5RA 1W2VA 1PIGA 1TTQA 1OINA 5HQLA 2ACUA 3T07A 3WLNA 1L9WA 2PDQA 1AW5A 5TNVA 2HS8A 1U1HA 4YYFA 4D6JA 3VDBA 1KGUA 3RK8A 1JPMA 4Z2LA 1G4SA 3I65A 4E4FA 2VFGA 1EF3A 2OCZA 4L9ZA 1R8LA 4FR6A 1G9HA 4GI9A 4ZQNA 1Y5WA 3PTMA 3APGA 4D2JA 1RBOB 3SCWA 1Q6EA 3IJ6A 3JUGA 2DW6A 1TUXA 3CZKA 3W02A 3ZLHA 2FZBA 4JHOA 1NWUA 3QVQA 3TC6A 1JGMA 4WX2A 4O17A 2OKOA 1HJVA 4IGMA 1BTMA 2G8ZA 1MVYA 4HD5A 4QE5A 3VDCA 5E93A 4LEFA 3KXQA 1FCQA 3L4WA 2YCLB 2DZBA 3T0DA 4GZJA 3R0DA 3MSRA 2WVUA 2YA0A 3FA5A 1UKSA 1RK6A 4AG0A 3AMGA 1XFCA 1C8YA 3PS7A 2OXNA 3G1YA 3A9IA 4GK8A 3W6YA 3A5VA 3C0SA 2V68A 2YGYA 1UD5A 2FH8A 2Z1BA 3AS3A 3CLWA 4FLRA 1U1JA 3N12A 4CCCA 2WV8A 3O06A 4TXEA 4BI5A 2J78A 2C6QA 1R3TA 4W9TA 4Y7EA 4WDXA 3L4XA 1OT2A 2HE8A 1P1MA 3NM3A 4JS3A 3UVAA 4EE9A 2DEPA 3UZJA 4MWAB 3NFUA 4Q4KA 3TQKA 1H7PA 1OCBA 2D24A 5AHLA 2E68A 5T26A 1S2WA 1PTAA 2PA6A 4LXFA 3EB4A 2QDDA 4W84A 4ZQMA 2Z28A 3ITTA 1NH6A 5E5CA 3WJZA 3T0BA 1CLKA 3VTRA 3MCMA 1XLBA 3ZZ1A 4B15A 2P8CA 3PZ9A 4QE4A 3ORWA 3GC2A 2E6YA 4DB7A 3IK4A 4PB5A 1XCWA 4KEVA 3BLOA 3BOXA 1V79A 4Z08A 3PC0A 4ZB5A 1TCDA 4F4RA 3B06A 4RE2A 3YPIA 3GC5A 1R46A 3HA1A 3M7SA 4C7DA 4HZ7A 3VNIA 4JFSA 2P76A 2D73A 2ZX7A 1JZ5A 2F2KA 2POTA 3GTFA 3CIWA 3W26A 1YEYA 3OPSA 3WEOA 4L7ZA 3N9KA 4GO8A 2AKMA 1X6UA 4EKJA 2ZE0A 4DNMA 2W63A 3A3WA 4D8ZA 4E6MA 2PP0A 4MG4A 4Z1YA 1S2VA 3MCOA 5HUOA 6A3HA 4KF1A 4DWSA 4O50A 1KXHA 2GJPA 3DFNA 1QATA 5E0KA 4UB9A 1W3JA 1HKIA 3Q94A 1O68A 2F6UA 5D02A 4RDVA 4PMNA 3VDHA 1HVQA 1EKOA 3W24A 3UWWA 4JNYA 4P8UA 2IXUA 1GVQA 3KVJA 3B9EA 4NYYA 3GVGA 1V6VA 3SJ3A 3LBCA 3JS3A 2NV9A 4F3HA 1EPXA 3H6OA 1PYMA 2YDRA 1IWBA 5D9OA 4JICA 1LQ0A 4QLKA 3OJGA 2V5BA 1C7TA 1OD0A 4XD5A 4LWWA 1QI4A 1Z44A 4QAWA 3WNOA 3UG8A 1BSIA 3ZJKA 1J0HA 3WN6A 3TX9A 1TTPA 1PL9A 3ZT7A 3DXIA 1HT6A 4CGTA 3B9NA 1CDGA 4XAZA 5AOUA 2J7EA 8XIMA 3WMBA 2W6RA 3K1DA 3LN3A 1DIEA 3P61A 3R5EA 3CNYA 3ARRA 1TREA 1YPXA 4HU4A 3LD5A 1N82A 3QKEA 4I8DA 2LLEA 2X1IA 1UOZA 4DJDA 2CKRA 2NQZA 2WSQA 1TVNA 1UWUA 4LW7A 1K7FA 2E6FA 3PZNA 5AHFA 1FVPA 1J2WA 3NPUA 1T8XA 1WXZA 2CHRA 3ABRA 2EXOA 1P0BA 1N55A 3M0ZA 1E4IA 2D0HA 3MQTA 4WCJA 4U3AA 2OT1A 3VIMA 3W85A 2BGNE 3CUFA 4L65A 1JZ8A 4CQBA 4DYKA 3H4WA 2ALRA 2OT0A 3MY9A 4ZEPA 3WK3A 5TAOA 2BNJA 2PWVA 1N2VA 1DJZA 4FALA 2CU0A 4L6HA 1XRSA 3SR7A 3NZRA 4N2YA 3W6MA 1RJPA 3WQCA 3EA1A 3EOUA 4PR4A 5A6SA 1XLFA 2WMIB 1EOKA 2GGHA 2R1LA 2WSPA 4YHEA 4JNMA 1P1XA 4HMCA 1DJHA 4CU6A 3ARZA 4JQ4A 3WQ4A 4IIBA 3H2NA 1RQBA 3AFBA 4JQ1A 1UH4A 3RN6A 1DORA 4DJFD 5I3GA 2AGKA 2C1IA 5JH2A 4QNEA 1HF6A 4GUFA 4QTGA 3VNYA 3I7RA 4B5UA 5CGTA 4AY1A 2NXGA 4AZBA 4LFYA 4IWWA 1ZZMA 5IBXC 1QMLA 3H8AA 3WZ0E 2VZVA 5EMJA 1OX5A 1P7TA 3QPEA 2I16A 3S46A 3MV01 4FAMA 3NAVA 2ZA1A 2OEMA 4AEOA 1V03A 4XTIA 2EO7A 1QHPA 4JD4A 3EBVA 4AD2A 2FB2A 1OB0A 1P6CA 4GQ0A 4GZEA 3SRFA 2GJXA 4MM1A 4PTVA 1WYIA 4LUSA 1UJPA 2PGWA 3V5OA 5EMLA 4L61A 3GX9A 4PMDA 4PUJA 1F8MA 3N6QA 4MLJA 4W89A 5LGXA 4PA8A 1W1A1 2WVVA 1ENUA 5ABFB 3UYIA 3DFYA 3E49A 3PJXA 4Z2KA 3WLQA 2QCDA 1OT1A 1S3HA 1RCOB 2YL8A 3NGJA 3BZJA 3SN1A 3VAVA 2ESCA 1R3SA 3UCCA 3ISIX 1DBTA 3W88A 2GWGA 2O4QA 3WD3A 3BAWA 3IS4A 4IMGA 4XZHA 5HNUA 4AC1X 2QF8A 3W29A 3N34A 3NZQA 5LXEA 1JRBA 2HISA 1LYXA 4YCOA 2VZOA 1GPFA 4EWJA 1FX6A 1E5JA 1FP8A 2HDJA 3LPFA 3TN3A 2C13A 1VP5A 2IW0A 4LX4A 4WSJA 1L6FA 3AIQA 2HS6A 4W93A 5AYZA 3V5FA 1TMLA 3LHTA 4H7VA 3VC6A 1E6RA 4P7RA 4OQVA 1XSKA 4I7WA 4XBSA 2AAAA 1U33A 3M41A 2VCCA 4ALDA 1YTDA 4FNQA 5BZAA 4IFOA 1TRIA 2PLCA 3DFSA 4PMOA 4PRTA 2WQDA 4M3PA 3ZWTA 4AZCA 3VU2A 3FX4A 4AVNA 1HJXA 3C6CA 3CUGA 4CN4A 5CAHA 1HO4A 3BW3A 2E5CA 1KCXA 2YBUA 1E9IA 1EHNA 2HMCA 4MZ1A 4XO6A 3RX2A 1JIBA 4FS9A 3GIPA 4Y90A 3TJ4A 5CXPA 2I5IA 4I6KA 3QW4B 4O52A 3U48A 2YBVA 1T99A 3OHIA 4A3HA 4QG6A 3MZNA 4EP8C 2QKFA 4X61A 1BXBA 3FDKA 3I4EA 4H00A 3VDAA 3ITCA 3CXOA 1DXEA 2DT3A 4US5A 5C71A 2Y85A 2A3AA 4GY0A 2V5KA 4PSPA 3WF1A 2C0HA 3IJQA 5F1VA 3GK0A 3UR8A 5EL1A 1KKOA 2OX4A 2QDHA 4KRUA 3VKKA 2YCLA 3P3BA 2ICSA 1X1NA 4HU3A 5A8MA 2CZEA 2DIKA 4PRRA 1OM0A 1YKWA 2NX1A 3OVPA 3RPTA 3GW0A 3KFTA 4QBXA 4AB4A 3V1HA 2VEFA 3F5JA 2C18A 1QNSA 1BVWA 4FOUA 4MVAA 3UWYA 4RXGA 2O7QA 1C9DA 2C0AA 4MF4A 4DI8A 1OQFA 1VFSA 1D2KA 1W91A 3QGAC 3I7SA 3SBFA 2FMOA 2OQHA 3QTPA 4HBKA 1LORA 3KTSA 1UD4A 4GD0A 1UOKA 3GDKA 1RA0A 2PP1A 3KCJA 3BAYA 3LSCA 1LWJA 2YDQA 4IUOA 4HNLA 4RZ4A 2X2YA 4GUIA 5XINA 3KP0A 3UPMA 2OO6A 3G0UA 2VVSA 3W87A 4QX4A 5I06A 3KBMA 4Z1CA 4UCFA 1J5SA 3MCNA 4A29A 4IQLA 4NY2A 2JGQA 2PDKA 2C19A 1AW2A 2QUNA 1JJKA 4J9JA 1B3VA 5D2VA 3UT0A 4B91A 3OIXA 3M0KA 3MMWA 1ODZA 2PEVA 2I57A 4QCFA 1KCKA 2WLYA 2ZC8A 4MNJA 3C2OA 5BXRA 3P5ZA 1HGYA 1R7AA 4MPKA 4GACA 1XLKA 1EC8A 3O15A 4Q8WA 4U33A 5IHSA 2CKSA 3NQ2A 2PURA 1TZ9A 1X7IA 3LM7A 3I10A 3SFKA 1PZ3A 2RGLA 3H7VA 4ZO9A 3SIZA 1P6BA 1VBHA 1Y0EA 2WJDA 3B40A 1K7XA 3RCMA 5I2UA 2YZ5A 1XP3A 1RP9A 1E56A 1B90A 2JKPA 4GINA 4ZGYA 1TFVA 5FJOA 3QZAA 1OFDA 3KBNA 2BOEX 4C6JA 5D2TA 3ARXA 1S5WA 3DAQA 3LCXA 1JUKA 2ZICA 1VGAA 1XPYA 4AFYA 1H7NA 4S2BA 5AVHA 4INFA 1X7FA 3DFTA 5CBIA 2DH3A 4PTMA 2DUAA 3LS9A 3CPGA 1REQB 3SQMA 5HMSA 3WDRA 1OFOA 2GUYA 1Q4NX 4RKAA 1I6NA 3AXHA 1KRCC 1I9CB 4V2XA 1F76A 4DUWA 3LCFA 5A6AA 3W53A 5D38A 4C1KA 3EOEA 4F79A 3MUXA 5HAOA 5H91A 3MI3A 3OOQA 3MV11 5CGMA 4XG1A 1XIMA 3FJ6A 3HF3A 4HZMA 4RNFA 4NKCA 3ZR4A 1KR1A 4QM1A 4IISA 5IBXA 4CKQA 1P43A 3W01A 3OODA 1SYTA 5A6BD 3MT1A 1MW3A 2HVMA 3WLSA 3T4CA 1J6OA 4QLJA 5HA7A 5LSMA 1WDRA 4R53A 1GYMA 3IEBA 1QOPA 4RZ6A 1V0LA 2DT0A 3MBDA 2WMHA 2J8GA 2VFIA 1IGWA 1QNQA 1PVNA 3LYEA 3QR3A 4D8AA 5EPDA 3CAWA 3UPBA 2PU1A 4XO7A 4PE8A 2XM1A 2WMIA 1QI2A 5AECA 3VNKA 4AEFA 4XTDA 1E3XA 4QP0A 5HANA 1P48A 3TMLA 1JZ3A 3ONBA 4XVDA 2P88A 5BROA 1NWSA 3MC5A 1T96A 3WQVA 3K30A 3KUMA 3W00A 2DT1A 8RUCA 4GX8A 4R85A 3HGOA 1GKQA 1IEWA 1XLEA 3N13A 3E0VA 5EMKA 1GPWA 2WQPA 4XAGA 4QIUA 5KSWA 1LQAA 3GSMA 4CQ8A 3IV3A 4V15A 3KL0A 3DG3A 1EH9A 4KCTA 3W7MA 4JR5A 4QHRA 4GYPC 4RE0A 4GC4A 3IWPA 3TYAA 4L80A 1MUMA 3IIOA 1PAMA 2A7NA 3OYXA 3B04A 1R2SA 1TZ7A 1IIGA 4PTDA 3WKZA 1W0MA 5AZ1A 2X30A 4PUKA 4NILA 3QFEA 4QEHA 1TV4A 1QNVA 1W9VA 2P1FA 1LOLA 3DZ1A 2HNHA 2XFYA 2ABBA 4K8GA 3WJYA 8XIAA 4H9XA 2WJEA 1FHDA 5ABFA 4JN8A 4ZXOA 1E6NA 3FVMA 2VZUA 5XIMA 2B7PA 3BK0A 1Z42A 2XJ7A 4FMVA 3K8LA 3TSDA 4P8WA 1HTIA 3NCOA 4E4PA 3FXGA 5FF4A 5E6ZA 1JPHA 1DKWA 4J3WA 1WAUA 4P2VA 2QCLA 1R30A 2EAWA 1S5VA 1JPDX 2ISVA 4TTUA 4BI6A 3HMJG 4DPQA 4XZBA 3R4IA 3HJEA 3RFAA 4FLOA 1Z89A 1E0XA 1JR1A 2DSWA 3QSRA 1W9PA 1XRVA 3ZT5A 1M7JA 2PDWA 4AZ6A 3HQNA 4OWGA 4IPNB 4M7SA 5I79A 3O07A 1M68A 5CG7A 4AZ7A 3SFWA 1ISXA 3KVMA 2QJIA 3MSGA 3NA8A 3AQUA 2VM8A 2G3MA 3TFXA 4LF2A 2E7FA 5RUBA 1GK8A 5LNSA 3CC1A 3SN4A 4MB5A 1S2AA 2HXUA 1S5MA 2X8RA 3F4DA 1J4EA 1SFJA 3AOFA 2V3GA 4MADA 1ZBKA 1Z48A 3AAMA 4RNIA 1JVNA 1TWDA 4UC5A 1W5OA 3UY7A 2VTFA 2HSAA 3U7BA 1POJA 4DELA 5DMLA 3RGTA 4GNJA 1XI3A 2OMAA 1QI0A 3UG3A 3EOLA 2J27A 3BLFA 1ZJBA 2W79A 3TJIA 2PMQA 4Q8VA 1VBRA 1IEXA 2PSNA 1XC6A 4GLEA 4JTEA 1TCMA 1A5LC 3ID7A 3CWOX 1CCWB 3M0YA 4JQ2A 1GVYA 1SPQA 4WIWA 1GUVA 3G8EA 2G4JA 1TELA 4HSOA 5C55A 4YHGA 3ZYZA 2O7SA 1PKMA 1JCLA 4FZIA 3H55A 4NQ1A 4Q33A 1KCLA 1K9FA 1QW7A 1UZHA 3C0QA 2VDGA 2GVEA 4HA0A 1GCYA 3A22A 3B05A 1LLWA 3BICA 4BF7A 4O8AA 2FTPA 2HROA 1B30A 2Z24A 1CB2A 3HV8A 3SEPA 1OABA 2DZUA 1NWTA 4C6NA 1NOFA 2P0IA 1A50A 1FKWA 1ESWA 2NXIA 2B7OA 3U2OA 3WH8A 4PEKA 1O5XA 1D7FA 3PBWA 3NPXA 1C7SA 3UU0A 3QY6A 2E28A 1E51A 4WY0F 4B5XA 3W7NA 4J2MA 5AYIA 2WJZA 1HG3A 1UUQA 4AUBA 2E40A 3OGSA 1RA5A 3SN0A 1RY8A 2W92A 4QG8A 2VFEA 3DG6A 3EEZA 4WUIA 3TMQA 3N9SA 2ISFA 4JCMA 2Q71A 2CLEA 4TX8A 2HBXA 1O1HA 1FTXA 5TQLA 4B5TA 2OODA 4B2DA 1V3JA 3BAXA 4IGHA 3P14A 2PRMA 3O0KA 3M46A 3VX1A 1RSCA 4HN4A 4JYDA 2GYIA 4ICNA 5BYWA 1Q3NA 5H8UA 1KKRA 1AQHA 2PZ0A 3NO3A 1XUZA 1E6XM 1X97A 3B0PA 4NRSA 2ZZ1A 4A8IA 1JI1A 3GG1A 1FWEC 3L4UA 1W1VA 3LRLA 1EGZA 3TR9A 1VFFA 3VO0A 2QPXA 3WDQA 1X8CA 3L21A 4FO4A 3IJLA 1I2OA 3LQGA 5I3IA 2J66A 4AHQA 4JEJA 3VZXA 1UA3A 1CLXA 1JRCA 2I9EA 4CNOA 1TJ1A 1JDAA 1R3QA 3GWQA 3VD7A 5HINA 3A9BA 4V1XA 3CEPA 3UEQA 2A0NA 3W7QA 3M16A 4LYRA 4EPEC 5HULA 3C8NA 4NNAA 2OSYA 3KTXA 3G3MA 1ZBCA 2X7VA 1S3TC 4C5ZA 5DXXA 1FBAA 4XISA 3AHYA 3O05A 3BSMA 3RU6A 4LBRA 3HG4A 3N18A 3L67A 3FYYA 2PWGA 4UQAA 4CEXC 1POKA 1REQA 3S5SA 5H1WA 1XCXA 2C71A 2FMNA 4KT2A 5H8MA 1EXBA 2OOFA 2NLIA 1VLWA 4GFSA 2ZOXA 4HJWA 3QSTA 1XH0A 1F4AA 3NM1A 1R3YA 5IDZA 4N4QA 2NQHA 4N9BA 3NGFA 3I3EA 1WBHA 1Q4WA 4HK6A 4N4PA 4N9EA 4F40A 2A6LA 2G97A 5K7JA 5M1TA 2PDNA 1ONWA 3DKJA 3AISA 1UKOA 5MF5A 3E0IA 3MO7A 4O14A 2E1DA 1E6PA 1KD0A 2RDXA 3NR0A 4F0SA 1VIZA 4HZ6A 3T78A 4Y9OA 1SSGA 4N42A 2JEQA 2CESA 2A3EA 2X1TA 5HR7A 1QCWA 2G0WA 4GYPA 4DZHA 1TE6A 2E25A 2JIEA 1KR0A 2INEA 4NYUA 4AHOA 3LEPA 4ZOBA 3WQ6A 2GOKA 1EZWA 3A21A 2H90A 3TEVA 1WBJA 3PUDA 1WOAA 4J3ZA 1H5VA 5CZKA 3GD6A 2ATSA 5KZEA 1TPC1 4RV3A 1AL7A 1DL3A 1TWZA 3NSXA 3GY1A 4HSNA 1NEYA 5EFDA 1Q65A 6REQB 3IJ9A 3VNZA 2OSXA 1C3FA 5C9ZA 4ATDA 3M6YA 3D5HA 4S39A 2D1ZA 2D3NA 4PCTA 3N4AA 4K38A 3W25A 1UZDA 1IXOA 3WNMA 3ZVHB 2R1PA 1J5TA 3KX6A 4S3DA 1LUCB 2IPJA 2QS8A 4GY1A 1DOSA 1DWHM 2ZUNA 1Q6FA 4M8UA 4KIEA 5BOFA 2V8ZA 2A4AA 4H9VA 2ZQ0A 4UFHA 3OIHA 3QV8A 1IGSA 2PTZA 3UD6A 2UY2A 4PODA 4LUIA 1FWNA 1AD4A 2G5WA 2W91A 2D2GA 2PWHA 3UJEA 2AAMA 3BARA 1V3MA 2ADAA 2WVSA 5GJNA 1KGXA 1TWSA 1DWAM 3MP5A 1EP1A 1BGGA 5TF0A 4O53A 2QMJA 4TTGA 5C54A 1N7KA 5M03A 3FJ4A 1VJIA 4NUWA 1O5KA 3DGRA 1GWJA 1A5CA 5DELA 3LGDA 4J1OA 2WNWA 3HU7A 3O6AA 2Z1SA 3F5KA 3V0SA 3KL3A 2V2DA 3NEVA 4OIFA 2CZDA 1WZMA 3S5OA 1SZGA 3UETA 3XINA 1B1YA 1F2JA 3BLEA 4JNZA 1J12A 3N9RA 3AHVA 3DGBA 4UOZA 2A3HA 4HK5A 4ZVJA 1OFPA 1W5MA 2ZDSA 3GXPA 4GY7A 3W72A 3ECQA 3OZPA 4X9YA 3NQVA 2FHCA 1KW1A 4G2DA 3K8MA 1K8ZA 3LXAA 5A2AA 1V6WA 4ROQA 3SUSA 3R8GA 4BI7A 3WH6A 2H8ZA 3ZSSA 1KTNA 1V6XA 1ZB5A 3CB8A 3MUIA 1Q5MA 2IKGA 1ADSA 4P8VA 2XDFA 4J27A 2WSRA 3VI2A 1KQZA 3CWHA 2QCHA 4AISA 2NVCA 3GU1A 2FVLA 2BHZA 2V30A 1DJYA 3GBEA 4CQDA 3NWRA 3RM4A 3ZSTA 4C6OA 4JTKA 4JTDA 1EIBA 3OVQA 3PFMA 5CSSA 1RUSA 1FH7A 4DJFC 4IP7A 2DUXA 2DZWA 2A3CA 2JALA 2NZLA 4D8LA 2HNEA 2BHYA 3WJXA 1BKHA 4CUCA 1PDZA 1JDEA 1V08A 3BMWA 3WDPP 1S2CA 3P6LA 5CJNA 4K37A 3LHVA 4C6MA 3GVQA 4D6GA 7XIMA 4JQ3A 3SO7A 3EWCA 1I0BA 1AG1O 2D2JA 5C2CA 2C91A 1IHIA 3H23A 2JKEA 3BANA 3NL5A 4MB4A 3W3OA 4CCDA 3HV9A 2J9ZA 3E2SA 3RNDA 5FAGA 3DKLA 8CGTA 5CPSA 1TQXA 4IMFA 3UWUA 2Z2BA 3PWAA 1XIDA 2ZRWA 3IVUA 5KEZA 7A3HA 4BJHA 2EQDA 3GW3A 5FKYA 4GBUA 3OA3A 2Z2AA 3M5YA 4RJEA 1E9LA 3E12A 3N04A 1OYBA 5FF7A 4A21A 3W7JA 1HUVA 1XF0A 1YDYA 3CLMA 4C6EA 3T09A 1W8GA 4JDYA 1VLIA 4MAVA 3RILA 4JTCA 1TWIA 1VBJA 1EWDA 1H1YA 3ARQA 4NG3A 2HVOA 2VI0A 5I3DA 1G6CA 2QUMA 2PF0A 1TJ0A 2ZUWA 3PPFA 3SY1A 2R94A 1JF6A 1MNZA 5ECVA 1A5MC 2WHMA 5L6UA 3EOOA 3E1F1 4C60A 1XLCA 2GZXA 4MB3A 3UWEA 5J04A 3VE9A 4WLCA 1TPUA 3AIUA 3RLUA 3M7WA 2BVYA 1X1ZA 3NDOA 1FH9A 3G8RA 3UA4A 5CLTA 5D9NA 1M9HA 2PWFA 3WBWA 4ERAA 3L0KA 2WZIA 4WEVX 3JZEA 2C15A 5A8GA 4QJ4B 3RF9A 5CSRA 3QC3A 3IRSA 1LBFA 4HPGA 2PGRA 4E8CA 1XCFA 5FF2A 2INZA 3TSMA 4C6QA 4RZ5A 3VCRA 8TIMA 2HPIA 1ICSA 3E02A 5G4EA 4M6PA 3WQ8A 2GVGA 3FHQA 3URBA 1ZFJA 1R87A 3IIPA 4GBDA 3G1XA 5D03A 2ZVRA 4LAOA 4NZ5A 4IF2A 4EWND 1XIGA 3TWBA 4S38A 5HWJA 1GVRA 3V0TA 3CV6A 5CEWA 3S9ZA 3UNDA 4HOZA 4OBSA 3ME3A 3UR5A 1UCWA 3AI0A 1FWDC 4MB1A 1DWJM 1F74A 1GVFA 4MJMA 3TAKA 3SCVA 2W67A 3GNNA 4B92A 4DO7A 1CPUA 4AZIA 5FD0A 1QDSA 2XFRA 3STCA 3QMTA 1LF1A 4UFKA 1WKYA 1BWKA 3POHA 5HATA 3P7YA 4G56A 1T0OA 3CO8A 4DM1A 1OFBA 5D09A 3WLJA 6XIMA 3Q2DA 3KW3A 1U5JA 1XPGA 2A21A 1NDYA 4LYQA 1MWOA 4UTFA 1Q6GA 2CLLA 2EPHA 4GI4A 3K4WA 3HFTA 1FUYA 1PIFA 1NAL1 3NQMA 4GUJA 5GQBA 1G1YA 3UQNA 4H83A 3N17A 4XZWA 2EPLX 4MYAA 5AZ0A 1KM3A 5C9XA 3H54A 4J7RA 2D22A 4Q8OA 1DQXA 3VGBA 1UMYA 4YN5A 1AJZA 1R9ZA 3ZM8A 1L8PA 1HP4A 4HCLA 1HJWA 1W3IA 1S38A 3ES8A 4S3GA 3C2EA 1UIOA 3VMOA 5BXPA 3SUWA 2SFPA 3K1GA 1SO4A 1RPKA 1WNOA 2PWEA 4F2TA 4KPLA 4X9SA 3CL6A 1L2UA 2E6AA 4C90A 2Z4GA 3HG2A 1W1TA 3AIRA 4E2VA 2XTKA 4IMAA 2VRJA 3ALGA 5CPTA 1BGAA 1MQQA 1ZJIA 2WLZA 4HNOA 3RJXA 1YNQA 3RX4A 4OOZA 1IEQA 3BG3A 2RDTA 2HQAA 2X2GA 1F9CA 3DENA 4KS0A 4V1YA 4BKNA 1ZUAX 1K7EA 1DVJA 1NOWA 1WDQA 5CPLA 2UY3A 4A6GA 1BYAA 4YVPA 4ES4A 2ZA3A 3BLKA 2E4TA 3PUGA 1I75A 5BXSA 2P50A 3ZQ9A 3PNZA 4LNYA 1Q63A 3H4XA 1C8XA 4JCLA 1K8YA 1GKPA 1VR6A 2WSKA 1W5PA 5FJUA 1XLGA 3XIMA 4R5EA 1BPLB 4U28A 2FPYA 2BV9A 3LXCA 1ODUA 4O1BA 2OEKA 1OK4A 6REQA 2PDXA 4WDWA 1PWLA 1ZLPA 3KHDA 2V5DA 4X63A 4EXBA 3WQDA 4GVFA 1ICPA 3MWCA 4ZODA 1SW7A 1BKSA 2I14A 5FF3A 1JF5A 1R47A 2JE8A 3GC4A 3ZVHA 1LUCA 5I3JA 3KTCA 3Q65A 3IGUA 2V5JA 1XICA 3C0JA 3QOMA 5L9FA 3EDFA 3OO2A 2Z0IA 3LB0A 2VEKA 2VGGA 4D6CA 5KZ6A 3H26A 3KOZA 3UXLA 2PLMA 2HK1A 1QPOA 1FY6A 4UTWC 1F61A 4N9DA 1V0MA 3R7MA 1UPMB 5I24A 5I6SA 2J88A 4POCA 1ZP3A 2YBTA 3B8WA 3F4VA 2J62A 4O1DA 4PRWA 3N6HA 1MEWA 4LBUA 3PZTA 1PZ0A 1RZMA 2NUYA 3UXDA 1JUBA 3EYPA 5T91A 3ZJ8A 1T41A 1E3ZA 1KXVA 4DJFA 4KKXA 4B16A 1FDYA 3PB0A 3LZ5A 1XD1A 2X05A 1TPEA 1K9EA 1UUMA 1ZAHA 3L65A 2OWCA 4FEZA 3EWBX 5C2GA 1JQXA 3OP2A 4KGLA 3GM8A 5D05A 4HPJA 2VCAA 2YSWA 2PRHA 2ZWYA 3TQ0A 3ZS4A 3F4NA 3N19B 3E2VA 4FOJA 1U5HA 4Z42C 1UMLA 3TC7A 4PCSA 4JFTA 1FXQA 3GTNA 4S3KA 3B97A 1YLVA 2Z1XA 3EWUA 4H2CA 1WKFA 2GGGA 3GFZA 1SFLA 3ZO9A 4UXDA 4UTIA 3AALA 2A3BA 4IL0A 3RYSA 1GNXA 4LVFA 4XUGA 2FLIA 3CTTA 3PNUA 4QCEA 5B80A 3BW4A 3QF0A 1TQJA 3T05A 3BO9A 1ITXA 2FPVA 2FVKA 3V16A 4EXQA 3DYOA 1FWHC 1RR2A 5LIUX 1RBAA 1W17A 2GJLA 4HYWA 5A8QA 1YNYA 4FLSA 4FNRA 3K8KA 3ITVA 4L4OA 4MJ4A 1H7XA 3ITGA 3LV6A 4XKMA 3L23A 2W9MA 3NG3A 7ODCA 1DJQA 3AIEA 2EKGA 4QQ3A 1BSLA 2A1YA 5HQEA 3HMCA 3EKLA 3TP4A 1TO3A 2CHOA 3U5YA 4HMDA 1Y8BA 1CLVA 2PDLA 4UR7A 3AMKA 3E0WA 3VD3A 4L9YA 2IKHA 3LZ3A 4QISA 3VOJA 4LCQA 2FHFA 1XIEA 4DUXA 4WJXA 5BOEA 3QRHA 3PZMA 3S1WA 1QI3A 5FOOA 4M1RA 2ZIDA 2DH2A 1IZKA 1XIJA 5EMMA 4KERA 1LM1A 3MANA 1G67A 1WZKA 4WDTA 3DOPA 3Q4DA 1WDDA 4IPPA 3VM5A 5AHMA 3WF3A 4LC6A 3KHJA 3HTWA 2FPTA 4PCFA 2VZSA 1AJ2A 1O7AA 2WK2A 1WKDA 3LSBA 2J7BA 1KCZA 2R1MA 3B4YA 5K9DA 2B7QA 1IWAA 1RXOB 3CV7A 4RXFA 2R82A 2GQ3A 3BG5A 5TBOA 1EYEA 1HKJA 1GEHA 6ENLA 3RX3A 4E2BA 5C0QA 9XIMA 2X1UA 1OX4A 2I9UA 3LA4A 3QXBA 4E8DA 4RE3A 1R3RA 2Y89A 3NOYA 5KINA 3R11A 3R6IA 4YNGA 3S2NA 4ZOCA 3AMDA 1PPIA 1FWBC 3KCOA 4LUTB 1E0WA 3A64A 1M1BA 3IUHA 4P7QA 3M44A 3PBUA 4PYSA 3P60A 1A53A 2FKPA 2QCCA 4ZO7A 4HT3A 3KOXA 1NP0A 5FEPA 4AEEA 5D2YA 1VPYA 1EQPA 3UYCA 4JQAA 2YL9A 3W7LA 1ECEA 1SZNA 2RUSA 1CNVA 2EG7A 1ZY9A 3AWNA 1E0UA 3HQPA 4BQ4A 3IACA 5JBDA 1DHPA 1RH9A 5BRBA 2QULA 4MPQA 2PTYA 3W07A 2VD9A 4CU8A 3ZOAA 4CD8A 4CVWA 4X60A 3CZGA 1XDJA 4PCPA 5LA2A 1HNYA 2E9LA 1OZQA 4DJED 4FXFA 3SUTA 2ZDRA 1PS9A 4A3YA 1ZBVA 3S2LA 4F0MA 3DHDA 1LROA 3SRHA 1U2YA 1Q8AA 3E74A 3MO4A 1W6TA 2QDEA 5CBJA 1XM3A 3TK7A 3W2JA 3MA8A 2JF7A 3BSHA 3GXMA 4Q7IA 1EJXC 1IR2A 1TVPA 1NFPA 2Q02A 3GQYA 4C7GA 3CBWA 3B9AA 4MDPA 4IH3A 4Y9NA 4IMCA 4UTMA 3ONCA 2Z6JA 3E0LA 4FB7A 2WYSA 4S3EA 2E9BA 2ZE3A 4ECLA 5FI8A 3NSNA 4G7EB 2Z7GA 3KEHA 1M6JA 1U83A 1ITCA 2DY3A 3BMXA 2VEIA 2WJFA 1QNOA 1AL8A 3EDJA 2CLIA 3S1VA 3S42A 1K03A 2X40A 4OUEA 2QR6A 4MKVA 3MSDA 1IXQA 3ZWSA 1L6SA 2Z00A 5BU9A 4MZYA 2PLJA 1TTJA 1YE4A 4NJJA 1A47A 2WNZA 1XIIA 9RUBA 1E15A 1P0EA 3TYEA 4RLIA 1NFBA 5GJPA 3KRUA 3B0VC 5REQB 1M5WA 2VRQA 2PD9A 3EKZA 3UVIA 2FH6A 1J0ZA 5JBFA 3QQ0A 1OGSA 3U2EA 1V6UA 3GNPA 2Z1WA 4IHCA 3NYDA 3N14A 2YW4A 4QDMA 3F2BA 2YCKX 1AH4A 3W7EA 2PDIA 3STPA 3C8FA 3VNJA 2D2OA 4D6FA 3O0FA 3BUVA 3H2MA 5MHBA 2Y2WA 2WZEA 2J79A 4PBGA 4WJEA 2R91A 4EXAA 3N25A 3TW6A 4NVTA 2YCJA 2NSOA 5EY5A 3G24A 3KCLA 1HL2A 2V5CA 3T6CA 3TLLA 3D6NA 1IQ8A 4KETA 1MDLA 5DT5A 4CU7A 2QXWA 4JIQA 4ZFCA 3TIMA 4I6VA 3PY2A 4QGCA 3V1PA 5M3WA 1EA0A 2BZNA 1FFRA 3ARUA 3C2FA 2PTXA 2X0SA 2QUTA 4M81A 3NVDA 1JZ4A 1W9BM 2HTMA 4JTJA 4XB3A 3VFCA 1TTIA 3GXNA 1HQTA 3M5XA 1CXFA 1BYBA 4RZBA 1TV2A 1SUXA 2AGTA 3FN9A 4J3UA 1XWYA 4ZQRA 1ME9A 1PUDA 3QMSA 1SZEA 1LZOA 2G41A 4MSSA 3V18A 1V77A 1V3HA 1BQGA 1ICQA 4OTKA 1F6PA 4RR4A 5HK4A 1R7OA 2TAAA 3VUPA 3W81A 4LAKA 4S3AA 2DU2A 4D72A 2I7GA 1ZCOA 4DYJA 3VKCA 3NOEA 3L5LA 4DBDA 4J3VA 4MFEA 1PTGA 4EPKA 1GT8A 2ACSA 4EAYA 3PBGA 2CBUA 2PDFA 3AS2A 3DX5A 4R7JA 4GGHA 3ALFA 4PL2A 5CC3A 4DWSD 3HOJA 4AAJA 4IIFA 2RJHA 2XN1A 2CERA 3C3UA 2RJGA 4E4UA 3NIYA 2BDQA 1JCMP 2J6VA 3PM6A 2TODA 3H24A 2UBPC 2QQ6A 3QV7A 3Q37A 3LTPA 4GZ7A 2WBKA 3A47A 2BOFX 5DANA 2EJAA 5FL0A 4ZOEA 1JAKA 4IFRA 4IG2B 3VIPA 1J01A 1FFQA 2OJPA 4LT9A 1EB3A 2R9RA 1AD1A 4MGGA 3CZ8A 3BGJA 4PUWA 3BZGA 4E5TA 5LIXX 1EP3A 2QV4A 2OZ3A 4CQAA 4GKTA 3DUGA 2RKXA 4IIGA 3BTNA 3W7IA 3OLDA 4FNPA 4GZIA 3G1SA 7TAAA 3C2YA 1X6NA 3JW7A 1K9TA 4IJRA 2PODA 1EJSC 4FXRA 1C90A 2V5LA 2VQTA 2WKJA 4R27A 3D0CA 1SSDA 3PJWA 4Y6GA 4PEEA 1ZHAA 4PUNA 3VD5A 4HHLA 4A3RA 5HUPA 4CD4A 2VC9A 3CIVA 2XISA 5DY3A 4HOXA 4GI6A 2VR2A 2RAGA 2WHKA 3GH7A 4TVUA 4URIA 5HPOA 5BNKA 1O60A 1EJVC 1OBAA 3PB2A 1QI5A 2OZ0A 5HMDA 2VRKA 3HN3A 4HTBA 4HJFA 3W1QA 1NVMA 4QEEA 4GOAA 3I7QA 4RNJA 4U5IA 1G5AA 1OEPA 5C5YA 3BGAA 4EPDC 3L4ZA 1HKKA 1XV8A 2XN0A 1EHAA 1OHLA 3KRBA 3GR7A 3RPDA 1NTHA 3IVSA 4IUGA 3KBSA 3TOYA 5E09A 3CYJA 4XAFA 4GYJA 4WR3A 2OPJA 1PKNA 1BXCA 1H60A 4MFDA 4GYFA 3IIXA 3EMZA 2NV2A 4F9DA 1IZCA 4ASTA 1XYFA 3S2JA 3GO2A 4F8XA 3C52A 3F4WA 3W7RA 4ICMA 2RGMA 4O19A 5JH1A 4RDZA 3FA4A 2PGEA 4WKFA 3GXTA 4KCUA 3T42A 1U30A 1UWSA 3VINA 3PFRA 1WO2A 4X2PA 3EOSA 3LCLA 1H7WA 4J3TA 5AHIA 3CUZA 4UZUA 1JFXA 4JIRA 3A4JA 4LCSA 2Y8UA 1TJ2A 4N0RA 2PS2A 4UFIA 4XZLX 4KEMA 2OKTA 4XK2A 5GNZA 3HPFA 3W1LA 2CLFA 2OGYA 2D20A 5KMYA 5I23A 4BFAA 2PZNA 4DXKA 1GOWA 1H61A 1K02A 4XBJA 1FCUA 3UFYA 4W8BA 2VEPA 1K6WA 2YLAA 1YNPA 1TV5A 4H2HA 4LUTA 3MHFA 3WUBA 4A3QA 2VCBA 3W1MA 2EBNA 4DLMA 2PC8A 3MS8A 1XX1A 4DZAA 3MKCA 5HQMA 2E8ZA 4C65A 3NL6A 3GH5A 4LUYA 4B3ZA 5D9PA 3TKFA 2W27A 2ZBTA 3SQSA 3LPPA 4TV5A 3U2CA 1IXNA 3QYQA 3GAYA 1PEZA 3QPYA 4PFHA 1LL6A 2QCDB 5KITA 2CLKA 2RDUA 1FWCC 4DX3A 3R13A 1GJWA 2JEPA 3VZYA 1GOMA 1M01A 4H7CA 3O9NA 1GQKA 2FJKA 3QH2A 1HX0A 5MKGB 2BXVA 4E3TA 3W6LA 2ZWZA 4RCXA 1QHOA 3GG7A 1H2JA 4H7ZA 3B3DA 3LV5A 4LS2A 2PF8A 3VOCA 3WL1A 4MY1A 3HGSA 3W4RA 3EMCA 3IAQA 1FDZA 5T8GA 3KOWA 5D4YA 3U4AA 2IMRA 2A7RA 4GG9A 3QFWA 1LL4A 1ZAIA 2VX6A 3MW7A 3A13A 1ZJAA 3OB8A 1QASA 5EFFA 1LWHA 4AZCB 4W7VA 2V3DA 4OGZA 4G7EA 3I6TA 3IAPA 1UQYA 1EGVA 5HNTA 3PZOA 3A4WA 3EDKA 3AS0A 2WKGA 4NNCA 5J5DA 4B90A 3WQWA 4MYXA 2V69A 4YS1A 4CNSA 1Y5XA 3TCEA 3STFA 1MUWA 1RY0A 1X8FA 3MMTA 4L1WA 2YXGA 1V02E 5A8PA 4ERIA 3UF9A 1US2A 1E9ZB 1V51A 4XD6A 2HRWA 3S3GA 3GDLA 5REQA 1RQEA 4KW2A 1XH2A 2R1NA 4J4KA 5DT7A 2ISSA 1G7UA 4O12A 1KM4A 1QOXA 3ENLA 3VDGA 2FB3A 2ZTJA 5D8ZA 2X41A 5AC8A 4PUUA 3GZ3A 3PR2A 2VFFA 1W5QA 2FYMA 3LI1A 2R6OA 3DERA 5A6LA 2ZUVA 3A6OA 3GTXA 4LYPA 4LV9A 4C6LA 4XSLA 1XLLA 1XRTA 5FJRA 3KBVA 1XBZA 2P3ZA 5IFTA 2J25A 3LOTA 1LG2A 4Q4PA 3IIVA 5E0CA 2Y70A 5A2BA 3H7UA 1QU4A 1TR9A 5D30A 1ITUA 2NLYA 1PSCA 4PMQA 4WVXA 2XSBA 1UD2A 3TDFA 1XDLA 1MQRA 5C9WA 3S8HA 2YJQA 4MWAD 3OEXA 3UG4A 2XFWA 3KLLA 4JFVA 3QHNA 3AXMA 3R0KA 2Z1VA 2XVLA 1MW1A 1OD8A 3NL3A 1VCGA 1BRLB 2NT1A 3SI9A 5BU6A 1PX4A 4LBSA 4R3UA 2GGEA 4R7OA 4WK9A 3IJ7A 3TTOA 2DFAA 5AFDA 1A5NC 5U7SA 1L6GA 3M0MA 4KFOA 1UB3A 3GZAA 3LMZA 4UMAA 3BSGA 5G1YA 2CIPA 2CC0A 3WEMA 4LRSA 4LB3A 3VGDA 2DPEA 3LM3A 2QVNA 4AVOA 1UW9A 4JTQA 2RDWA 2H6RA 1K8XA 1NWRA 1OSEA 1KM0A 3CIXA 4L4MA 3WG6A 5C9UA 1M7XA 4IP5A 2Y6ZA 2FIQA 3HG5A 5CBBA 1NQ6A 2O9PA 2J7FA 2FZ9A 2PDCA 2XIJA 5HXMA 3E2QA 3K46A 4MTVA 3WUEA 3GVVA 4B5NA 2BXYA 4KRZA 3RG6A 4Z2JA 4GHRA 1AMYA 4A35A 3APYA 1ELSA 2QCFA 1C9WA 5A95A 1JD9A 1I45A 4H04A 4XX6A 4FLQA 1BEUA 2DQXA 1UR8A 3VD4A 2A79A 3WDJA 3BCDA 4KH2A 1I2NA 1O95A 2QUUA 4Q8NA 3L0NA 2QNEA 5JBEA 4GC3A 4DLFA 1KFJA 3UXIA 1CB7B 2GL5A 2V38A 1XIFA 1ADDA 2XIIA 3K13A 4IG2A 3VZZA 5CPQA 4G1KA 3N6JA 3T44A 4L6DA 1YHTA 1JI2A 5GJMA 1FWIC 3ZVIA 1RLDA 2IS7A 4UTTA 2JKAA 1ONEA 3OLIA 3AHZA 1FHLA 3QMRA 4EF8A 4NHVA 1B4EA 1VCFA 1ZS2A 2GQAA 3VK5A 3LMYA 3ANYA 1RJQA 3CUIA 3MU7A 5CCZA 3V4BA 4AX6A 1F4HA 4C5YA 4NU7A 1DQUA 1MW0A 1CI1A 4ICCX 2QJHA 3IV8A 3ABSA 5LYRA 5F4WA 5C7HA 5F2LA 3AZTA 3C86A 3M64A 2VDIA 3CB3A 1J0JA 4UOJA 4GIEA 1KXQA 4XIAA 1BLIA 1QFEA 3L0GA 3TYDA 3DFHA 3SSJA 4GIYA 5HJYA 1AH3A 4M7TA 2WNNA 3TW9A 4IQEA 4JYFA 2HWGA 1UWTA 1NP2A 3FK4A 3T55A 2OQYA 4AHPA 1D9EA 4GVHA 4GABA 4WSHA 3P74A 4W86A 3HM7A 2YB4A 2YL5A 1GEQA 3W0KA 4WXZA 2VKZG 3S5ZA 4HSHA 4S2CA 3W1RA 3VABA 4L64A 2WC4A 4JX6A 6PTDA 4JTTA 4B9YA 4HNCA 4HK7A 1VFLA 5DQPA 4WDUA 4B5WA 2B7NA 1RALA 1KRMA 2Y24A 3NQCA 1OYAA 5G2IA 3GYCA 2YW3A 3K2GA 3M9YA 3WSUA 4WZHA 1EQCA 4R9OA 3UGRA 3QOKA 3CAQA 1CGWA 1N8WA 2NVDA 2HE5A 4IPLA 7REQB 3WH9A 1LTDA 3FSUA 2HV5A 1I2PA 4OVXA 4AD1A 1ML1A 3EDEA 1GZ1A 5CSYA 2O92A 4TX9A 3PUOA 3AC0A 1XYMA 1W3HA 5LGZA 2YDSA 2J47A 3T1GA 4DO4A 3TWAA 1XIHA 3ZXWA 4E2OA 4AD4A 3TNOA 1YPFA 1JULA 1YX1A 2VC6A 1EDGA 4JY9A 3SCSA 2FDSA 4XBKA 3VC5A 3V35A 4JIEA 5BRPA 5FEWA 4C6IA 4NZJA 1VBGA 2PDGA 4LV4A 4JL1A 3VA8A 5IRPA 2ANUA 1GONA 1NDVA 5E70A 3W2UA 3DDMA 2E3ZA 1FHUA 3DYMA 1KGWA 1YADA 3ANVA 2QF7A 1PJ9A 3SRKA 3QGKC 3NPWA 3ELFA 1CT5A 5K9CA 4Q4SA 3QY8A 2Z26A 3AS1A 2F6XA 3ITLA 4LH8A 4DI9A 3VE7A 1C91A 3MP4A 2W3ZA 2FHBA 5AHEA 4I3GA 2QPSA 4X2RA 3MUCA 3G0XA 5GNYA 1A4LA 3GDRA 3KBJA 3O8AA 2EG6A 4AYSA 4JGDA 3WD4A 2X1RA 1Q6CA 3PN8A 4LQ1A 1XLIA 1E9YB 3LY0A 4DBEA 2V2HA 3CO4A 4KWVA 2CBJA 3LERA 4JX4A 5MKGA 2DT2A 3AMCA 4UQBA 4WXYA 1KM2A 2CXGA 2QCEA 2J13A 3FYOA 3LCHA 4PSRA 2WO5A 3D3FA 2HZGA 1LT7A 5JIWA 1ITQA 2P10A 3GNDA 3WF2A 2GVLA 4S3CA 1VPQA 1E1FA 2HEJA 2X09A 1G4TA 3B8VA 4RPPA 1UP0A 3OQ8A 3E96A 3LTYA 4CVUA 4GH1A 1C92A 4DHGA 4UQEA 3CUXA 2ZRYA 2I56A 6CGTA 3OTRA 1IV8A 4QJ3B 3AU6A 1H11A 3KOFA 2QT3A 1TE1A 1F3TA 3PBMA 3MMDA 4WOZA 3VUSA 2WCAA 5B7YA 3VOFA 2PE4A 1OIMA 1EO5A 2OWWA 4XZ9A 1E6ZA 1EC9A 3G1RA 4TVDA 1P4CA 1XGEA 2B31A 2DW7A 1WKEA 1K1DA 1R0MA 3N29A 1XRFA 3TC3A 1JPKA 1GGOA 3RR4A 3CZEA 3DC0A 3LGGA 3WD0A 3GG8A 2QAFA 3G3DA 3AIVA 1UP3A 4QG9A 4L56A 1KBIA 4O0ZA 1CX9A 2WMKA 3AO0A 3T4WA 5D9MA 3M5VA 4Y8FA 3L2MA 1RHCA 2CZ5A 3S4TA 1PKYA 3UESA 3IJ8A 1X39A 1Q7ZA 3R12A 4NAFB 5AHNA 1MUCA 3KLKA 3EXTA 2VELA 4P61A 3QQ1A 2E5DA 3UWZA 1SU5A 4JTFA 1RVKA 3U0HA 1KLZA 3BH4A 3VOIA 1SQ7A 3COTA 3PZGA 1QW9A 2BASA 1KBJA 4MKNA 5HJLA 3WYZA 3Q67A 4EF9A 1JCNA 1TIMA 3BDKA 3ABQA 3CGTA 3PANA 4HYRA 4JFUA 1WUFA 4UQCA 4GQBA 4GXPA 2QCNA 1MMFA 4AXKA 4KESA 3QR0A 4ZA0A 2GDVA 1RJRA 2NT0A 3S0CA 4OECA 1THFD 2ZUTA 1J93A 1BRLA 4QR6A 4ACZB 3HGRA 1E6SM 1S5TA 5I07A 1EGMA 3CT2A 2AMXA 5HDRA 3IRDA 2GJRA 5DF0A 3NSMA 2VWSA 4WKHA 2AKZA 4R34A 5CZJA 4LYKA 5DX7A 1FCBA 1DJWA 1VJSA 1KRAC 5CC6A 3QHOA 3NVTA 3EWWA 5FJTA 3N73A 4B2DD 5K9XA 3GHSA 5M17A 3TCSA 2O56A 1UP2A 5HNRA 1QXLA 3W1TA 1B3XA 5FACA 2XGZA 4F0LA 1TKKA 2MUCA 2V3FA 4UCGA 4US6A 3B0YA 1XBVA 1J79A 1JUEA 3ZR5A 3EWYA 4ZFMA 3R79A 1W56A 3GR4A 3NL2A 1W37A 4U3CA 4DXXA 2ZUUA 3TVAA 5DCEA 4IPIA 3HPZA 1KFKA 3OVRA 3HG3A 1UC5A 3SCOA 4JKKA 3U6WA 2EG8A 1DJXA 1LJYA 1ZGDA 4UQDA 3QC0A 3QZ6A 1B5TA 3NDZA 4NZCA 3AICA 1FWAC 4DUVA 2PB1A 4PBFA 3L9CA 2V9DA 1OVDA 3U2ZA 3GTHA 4O11A 4JEQA 5LA1A 4XWUA 4NIRA 3WLOA 3IVTA 3VKDA 1YXDA 4UIOA 4E2DA 1LOSA 2R14A 3WJSA 2WZTA 3USBA 5XIAA 1PKLA 2PBOA 4LVGA 1A3HA 2VX4A 4Q8UA 1Y7VA 2VQUA 4DRSA 4CD7A 1I0DA 4QSFA 2F84A 3WEZA 4DO6A 3WK0A 3CK5A 1QR7A 2C1HA 2V3EA 1SO6A 3QHMA 4UZSA 1VH7A 2ASHA 3INPA 3W83A 3MYPA 2WVTA 3CZJA 2DJLA 4MWAE 2ZRXA 3U7VA 1R3VA 1GYNA 4ZB2A 4JX5A 1A3XA 3H2FA 2FFCA 5FCZA 3H4GA 4ACYA 2PBGA 3AXIA 4W8LA 5D04C 4IL2A 1W3KA 4RDWA 4AZGA 2ATMA 2YCIX 2PRLA 2YFNA 4GVIA 4Z2GA 2BVDA 4GVGA 4B3LA 3NQ8A 1ZQ5A 4RL3A 2D69A 1YE6A 2BVWA 4LVDA 1JFHA 2P53A 2E9MA 3A23A 1GOIA 3THCA 3BLIA 3SCNA 4FX7A 4LTSA 1LG1A 1KLYA 2Y7DA 3CQJA 2GJNA 1UKTA 4GJIA 4E3VA 1QOQA 4OUIA 3EB2A 2PLKA 3L7RA 4ONVA 4DWSC 5EKYA 1OC6A 1TV7A 7REQA 1LWIA 4FXSA 4J2PA 4LPCA 2CPUA 3WELA 3BGGA 4S23A 2OX1A 4HNVA 2ZZ5A 5I7GA 3F03K 3T2OA 1BF2A 1E43A 1F6KA 4ZMGA 3V5CA 5CZTA 3W71A 4D6DA 2Y7GA 1I1XA 3OG3A 3BV4A 4U4MA 2YLLA 1BHGA 2BSLA 1QK0A 2Q09A 2Q3OA 4H1ZA 5LKYA 1IF2A 3S1UA 1UWIA 3UP8A 3AXKA 4BS0A 2YIHA 2XSXA 3P8IA 2J7DA 3UJ2A 4ENLA 3EMQA 4IXHA 1H0IA 3TYZA 3UZXA 1EEPA 1UR9A 2BY2A 1Z6KA 1R2TA 4DPPA 1R9YA 1JEZA 5CG0A 4NSBA 4NP7A 1A5KC 1QVBA 1PIIA 3FS2A 3GR8A 1UROA 4LB4A 4GO9A 1E70M 3OBAA 3F2DA 3WLRA 4L4PA 3NQFA 4Q4OA 3SIMA 1Q6OA 2REQA 2PFHA 3PPGA 2Y7FA 3LBOA 3E5PA 4N02A 2ZVIA 3E6EA 2HXTA 3MVIA 2VX5A 1YIXA 4YXGA 3LBMA 4JDBA 1UQZA 3NPVA 4TUFA 1KV5A 1O66A 5FJIA 2BXZA 4UMBA 2XWDA 1ISZA 2C16A 4JKLA 3SCPA 5G1MA 5CJ5A 4AX7A 3GHTA 1Q6QA 4IPJA 4HNTA 1KNWA 3I6EA 3WQ5A 2ZXBA 2IKIA 3WLMA 3T2PA 1BD0A 4HOWA 1EBGA 4REQB 1US0A 4FP1A 1R2RA 3DCPA 4JHMA 4ZE4A 2WPBA 3BCFA 2WCGA 1T6MA 4YMZA 4NASA 3KRSA 1RK5A