1NDZA

Crystal structure of adenosine deaminase complexed with fr235999
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
349
structure length
349
Chain Sequence
TPAFDKPKVELHVHLDGAIKPETILYYGKRRGIALPADTPEELQNIIGMDKPLTLPDFLAKFDYYMPAIAGCRDAIKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVQAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDTTLYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Adenosine Deaminase
publication title A highly potent non-nucleoside adenosine deaminase inhibitor: efficient drug discovery by intentional lead hybridization
pubmed doi rcsb
total genus 144
structure length 349
sequence length 349
ec nomenclature ec 3.5.4.4: Adenosine deaminase.
pdb deposition date 2002-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1ndzA00
4C6PA 3RCMA 3EGJA 4G2DA 4F0LA 4IGNA 1FWBC 1O12A 2HBVA 3GIQA 2Z4GA 3S2JA 2VM8A 1FWCC 3RYSA 2VHLA 3E74A 1K70A 1YBQB 4IFOA 1ITQA 4XAFA 4LAMA 2ADAA 4R7WA 4GY7A 1FWHC 3N2CA 2UZ9A 4C6NA 2I5GA 1W1IE 3D6NA 3TN6A 1S3TC 3PNZA 4OFCA 3SFWA 2QT3A 1ITUA 1RK5A 2PGFA 2Z7GA 1FWJC 2FTWA 2O4QA 1M65A 4DLMA 2R1MA 5A6TC 1A5LC 3B40A 4B91A 4RDVA 4B3ZA 1JGMA 3URBA 3IRSA 2D2HA 2DVUA 1R9ZA 4LALA 4BY3A 4GXWA 4CNUA 1K6WA 1EJSC 4LFYA 4F0RA 4C65A 4WGXA 4C6EA 1R9XA 4RE0A 1BF6A 1E9ZB 4J35A 2QPXA 3GU1A 3E0LA 1O5RA 1P6CA 3K2GA 4KERA 2Z26A 2IMRA 3LY0A 4LH8A 4NP7A 1P6BA 2Z25A 3ITCA 4I6VA 2ZC1A 1A5KC 3GUWA 2R1PA 4GC3A 4HK7A 3PAOA 2BGNE 2GSEA 4G7EB 4LAKA 3S2NA 4KQNA 4AC7C 3S4TA 3IPWA 1POKA 4IFKA 4H9ZA 4DI8A 2BB0A 1FWDC 4KEUA 4QS6A 2Z24A 1RA0A 4ERGA 4LANA 3CJPA 4HK5A 4LEFA 1FWEC 3E2VA 3LU2A 3MDUA 1A5OC 1M68A 3O0FA 2GWGA 4GZ7A 4YIWA 4V1YA 5HMEA 2GWNA 1A5MC 4L9XA 1DPMA 1PSCA 1YBQA 4R85A 1NFGA 4INFA 4IF2A 3CS2A 4BKNA 2QS8A 1EJWC 4Z42C 1XRFA 4J2MA 3T1GA 1K1DA 4C6MA 2WJEA 4KETA 1VFLA 4PCNA 3UR5A 2Y1HA 2Z00A 3MJMA 1EJTC 4HJWA 3IARA 1RJQA 4IFRA 4C6OA 2QVNA 3CAKA 4ERIA 3MVIA 3URNA 1RA5A 4KIRA 3GRIA 1ONXA 2WM1A 2Z28A 4PBFA 4C6DA 1GKQA 2YB1A 4QS5A 3PANA 4M51A 1UIOA 3JZEA 3UF9A 4RZBA 1J79A 4KEZA 1EYWA 1NDWA 4R88A 2D2GA 3AUOA 1A4LA 4UB9A 2ANUA 1FWFC 3IV8A 4GX9A 4CEXC 3F4CA 3GTIA 3ISIX 1XWYA 2PLMA 3R0DA 4V1XA 2YB4A 1EJXC 3UR2A 4GOAA 3O7UA 5FSDC 2EG8A 4ERAA 4EPKA 3F2DA 3MTWA 1A4MA 2GZXA 4GK8A 1NDYA 2GOKA 1IE7C 3DUGA 4H00A 3F2CA 3LSBA 4IQJA 2OODA 2ICSA 4G7EA 3TN4A 1PO9A 4QROA 4LCRA 4BJHA 5AKQA 4CQBA 3EWDA 1UIPA 2E25A 4NG3A 1EJVC 1EJRC 3OJGA 4H01A 3HTWA 4CNTA 3MKVA 3QGKC 3A4JA 3UPMA 1FWIC 2HPIA 2HQAA 4H9XA 2Z2BA 1XRTA 2Q09A 3DC8A 4RDWA 3ID7A 2EG7A 3LA4A 3B0YA 4H9VA 4PBEA 4DIAA 4C6IA 5HMDA 4D8LA 1V51A 3B0XA 3TN3A 3WMLA 4XD4A 4CQCA 3LGDA 1RJPA 4GY0A 1FWGC 4WHBA 2PUZA 4LCSA 2HNHA 3SO7A 4C6KA 4QRNA 3FEQA 4DLFA 2I9UA 2F6KA 4E3TA 3IACA 3S2LA 1UMLA 4QSFA 4RDZA 3OODA 1POJA 3GTXA 4JOMA 4EP8C 3PBMA 2AQOA 4C6FA 1NDVA 1KRMA 4CEUC 3GG7A 1P1MA 4EPEC 4I6KA 3LS9A 2EG6A 4DZHA 2FVKA 4GX8A 3K5XA 1NDZA 4B92A 3URQA 3IJ6A 2A3LA 3MDWA 4PE8A 3UBPC 4C6BA 3G77A 3T81A 4KF1A 3NURA 4KESA 3F2BA 4C6QA 5HMFA 3HM7A 1EF2A 3NEHA 4WVXA 3E3HA 1YIXA 4ZSUA 3TN5A 3DCPA 4IG2B 2OQLA 1V77A 3C86A 4B90A 4ZSTA 4C6JA 4GBDA 4EPBC 4H9TA 2AMXA 4HK6A 2P53A 2W9MA 3ICJA 3WYZA 1RJRA 2AQVA 4GYFA 1R9YA 1PTAA 3LNPA 1WXYA 1ONWA 3WZ0E 4UBPC 2P50A 3ORWA 1KCXA 3QGAC 3QY8A 1YRRA 1M7JA 2G3FA 3QY7A 4KEVA 4XD5A 2DVXA 4C6LA 3AU6A 2DVTA 2VUNA 4TQTA 4PCPA 1QW7A 5CH9A 2HPMA 2Z27A 3S2MA 4LAOA 4XAYA 2YZ5A 4AQLA 1QXLA 4XD6A 3TNBA 1V79A 1V7AA 2OB3A 3E0FA 4RDYA 4CQDA 3K4WA 1ADDA 2R1NA 2XIOA 4F0SA 4ICMA 3OVGA 2Z2AA 4QTGA 2VC7A 2D2JA 3A3WA 3OU8A 2VC5A 3A3XA 1GKRA 4IH3A 3OQEA 1KRCC 4IGMA 3NQBA 4NI8A 4C60A 1GKPA 5LXXA 1UBPC 2O4MA 4XD3A 4H9YA 2PAJA 3RHGA 3GU9A 2WJFA 2YXOA 3IGHX 1FKWA 3T8LA 1KRAC 4IG2A 1YNYA 4L6DA 1XGEA 3V7PA 3PNUA 2OOFA 1WXZA 4C5YA 2RAGA 2WJDA 2Q01A 4DI9A 5E5CA 1PB0A 2Z29A 3E38A 5G4HC 5FSEC 3MSRA 3HPAA 3F4DA 3GIPA 1EJUC 3BE7A 3RN6A 4DNMA 2KAUC 4GY1A 3GTFA 4XAZA 3LGGA 1J6OA 1RAKA 1J6PA 4MUPA 1I0BA 4P5UA 2UBPC 3EWCA 2R1LA 1A5NC 4CNSA 2FVMA 2PGRA 3LSCA 3MPGA 1YMYA 1RK6A 2HBXA 2FTYA 4H9MA 2R1KA 3MVTA 3KM8A 2FFIA 3FDKA 1FWAC 1HZYA 2VR2A 4H9UA 1V4YA 2OGJA 2CZVA 3GTHA 4C5ZA 3FDGA 4DYKA 1J5SA 3QY6A 4LCQA 1ZZMA 3URAA 4DO7A 2E1WA 1I0DA 1FKXA 4IFKB 3AU2A 4J5NA 4C6CA 4XAGA 4EPDC 4HA0A 3OOQA 4DZIA 1EZ2A 3GU2A 1KRBC 1E9YB
chains in the Genus database with same CATH superfamily
2ZA3A 4P7NA 3WBEA 1GK8A 3P3BA 2A7PA 3GIQA 2PZNA 2BXVA 4AD4A 2IKIA 1JF5A 3MY9A 4J40A 3EDJA 4XAFA 4ZVJA 1FWWA 4PSPA 1GHSA 4IPPA 5BROA 3NXLA 4C6NA 2YCKX 1R7AA 2BOEX 2W63A 4NSBA 3CYVA 3WF1A 2O4QA 4IQLA 4QDMA 1KBBA 1JRCA 1G94A 4QEEA 4DJFC 2X30A 1XBZA 4A2RA 2PF8A 4AWUA 1QWKA 4JS3A 3GXTA 4ZFMA 1EJSC 2VFGA 2YXXA 4WGXA 1Q3NA 4JTDA 3VGFA 3R6IA 4WCJA 2IPWA 2OWXA 2QPXA 3UCCA 3PY2A 3C0JA 2PTDA 1NOWA 1KBKA 2ZVIA 5D32A 3M64A 2Z25A 3ALFA 4GO9A 1X1ZA 2WSYA 4Q8VA 3GNPA 3W37A 4MAVA 3A9BA 3TROA 2VEGA 2HV5A 5ABFA 4W7UA 2PWVA 2C16A 3N3MA 4DYJA 3WMSA 3S2NA 1ZQ5A 2CKSA 1A3WA 2Y8KA 2ACUA 5EMUA 4IFKA 2WHJA 5D8ZA 1IZJA 1D8WA 3BG5A 4LEFA 1W3NA 4Z0SA 5AC8A 2GWGA 4A35A 2HSAA 4L9XA 4Q8NA 3TA6A 3VNKA 1ONEA 1G1YA 1GQKA 4ORIA 3WUBA 4NT0A 3CS2A 1K9DA 3PK7A 1MMFA 3AICA 3TAKA 1K1DA 1HJUA 3MUIA 4JFTA 1WZLA 1PEZA 3K30A 4Q8UA 3KWXA 2E3ZA 3UR5A 2BOFX 4FB7A 4LBSA 1RJQA 4ZQNA 4C6OA 1O5XA 2DH3A 3GRIA 1BD0A 2GJRA 1CX9A 1EBHA 3S6DA 4PRWA 3G1HA 2BY1A 3W86A 2UY4A 1E56A 3KBWA 4Y8EA 4PL1A 3IUIA 4O1EA 4PRTA 4UB9A 1Z3NA 3BCFA 1ZBWA 1A5CA 5AYXA 1N7KA 4B5UA 3NSNA 3QMTA 4ERAA 3DBPA 2XM2A 3FYOA 1IE7C 3GHTA 1LBMA 3XINA 1Y7VA 1X97A 6PTDA 1C9WA 1F6PA 3VUSA 4NNCA 2V69A 3G1SA 1I9CB 3KOYA 3T0BA 3GWQA 5I5RA 5AKQA 1N8WA 2WJZA 2ZUWA 4Q6XA 3O15A 1A50A 2GQ3A 3SUUA 4JIPA 5EBAA 4DRSA 3CT7A 3ARYA 3MKKA 2HPIA 1F3XA 3H70A 4H7CA 4ZO6A 4MWAC 3WY1A 4HPXA 3B0YA 2OXNA 2WZIA 3B8UA 1DTNA 2Z6JA 3T55A 3CBWA 2HK1A 3ZT7A 2EQDA 4AWSA 2XIQA 2VELA 2VWTA 3N12A 1H3GA 2OELA 5A8MA 3FIGA 4KKXA 4I9AA 2C13A 1GYMA 2XGBA 3E0IA 3QW3A 4U4MA 2V5LA 2J7FA 3V16A 2WZMA 4JOMA 5G2WA 3ARTA 3UERA 4LVBA 3O07A 4H2CA 3PPCA 4O17A 3D47A 4B92A 2DUAA 5A5WA 2E6AA 4P2VA 2QIIA 1BXCA 2BVDA 1RY0A 4JTCA 3VIIA 4AWEA 2J6XA 2PC4A 2VDGA 5XIAA 1ZS2A 3NURA 4NF7A 5K7JA 4W8AA 1XJBA 5DQPA 1JZ2A 2QLYA 3QR0A 3UJSA 5C9XA 1J0JA 3KBNA 4LWWA 3K4DA 4EXQA 4HMCA 2TMDA 4GYFA 2CXGA 5DO8A 3E2QA 2P50A 2CLFA 1KCXA 3R13A 3GNNA 4GZEA 4IMGA 3WQ6A 3SUVA 1MNSA 3JR2A 2QQ6A 2Y5JA 2EXOA 3EOUA 4EWND 3ZO9A 1EA9C 3M41A 4YL2A 1BVWA 2VL4A 4LRTA 2YDSA 3E0VA 1CLXA 2YZ5A 3DGBA 5CPQA 1E6PA 3BARA 2ZIDA 1IV8A 4OBTA 3MSGA 3OLIA 1QHPA 3UZ5A 2YCEA 2PSNA 2WYSA 4L1WA 3GXPA 1WKEA 4RE2A 3A3XA 3VKBA 1PE1A 3CU2A 3EX1A 5CKSA 4U10A 1AW2A 4PB3A 1IZKA 1FHUA 2O4MA 4A2SA 4BK9A 1OYBA 2NVDA 5CZTA 2E40A 4MJ4A 1XC4A 2FPVA 4RKAA 1KRAC 1XUUA 3USBA 2VGBA 2WZHA 2OOFA 5F4WA 5CSRA 4GUGA 1GVOA 5E5CA 1NP2A 3MSRA 2V8ZA 1BG4A 1GOIA 4P7OA 4K36A 3F4DA 3I6EA 5D30A 1ZUAX 1JZ6A 4HZ7A 1SO5A 3NZGA 1DKWA 4PGLA 3H22A 1XPYA 2YR1A 3DI1A 4FK9A 1CCWB 2FTYA 2R1KA 4ZTYA 1F8MA 2ZQ0A 3M0YA 3EPMA 1DYSA 4UTIA 1ISVA 4XX6A 4PA8A 3HZ3A 3L4TA 2BP1A 2E1DA 4XZHA 3AI0A 5AHEA 2ZXQA 2W66A 3WCZA 1YDVA 5AZ0A 4GQRA 3M0HA 3GX9A 3W7GA 1O4UA 4MB4A 1EZ2A 2Z4GA 4HNTA 3QKEA 3W07A 4HU0A 4OVXA 1QNSA 4NZ4A 3TYCA 3S83A 3WLOA 3ZIZA 3VCRA 4D1JA 4QR6A 2ADAA 2V5CA 3ANUA 1DJXA 4XTDA 4JXCA 1BKHA 3WQGA 1YPXA 3D6NA 1XH2A 5EA9A 3UG8A 3SJNA 3UWZA 1GZJA 4AZHA 4LYPA 2PGFA 2Q3OA 4DLMA 5KSWA 2J27A 4JR5A 3W7IA 3C0LA 4KW2A 1K6WA 5G5IA 3DFHA 4E5TA 4LXFA 2VOMA 3AXHA 4DWSD 1BWKA 3K2GA 5D04C 3SCUA 3EOLA 1K4GA 3M6DA 4PUJA 3DDMA 1RY8A 1JCNA 4AZ7A 1JZ5A 1ZBKA 5I3HA 4HU4A 2WMGA 2Y0FA 3AXKA 3V18A 1J11A 4L1GA 3PAOA 4RK8A 1EKOA 5AC6A 2FZDA 3Q37A 3STCA 3AMLA 3VGBA 1GOQA 3S9YA 2FDMA 4MZ1A 3N4FA 4R9XA 1B0IA 4X60A 2DIJA 3O3RA 2Z1WA 2FB3A 3FGCB 3PPFA 3H2NA 3U48A 2PC8A 3G1AA 1PTGA 4B4HA 3O0FA 4OBSA 4XIAA 5BMXA 3GXFA 1OFBA 4JAWA 1XYZA 4LQ1A 4QDWA 4K7VA 1AH0A 5AYBA 1EC9A 1H60A 3CL8A 3LZ5A 3WFLA 1XIDA 4E8GA 2EF9A 3UG5A 1XYBA 3NEVA 2PP0A 5AECA 4HJWA 2CZFA 3IARA 1HX0A 4IFRA 3CASA 1DXEA 4KIRA 4CD6A 2Q8LA 3UFYA 5HUOA 3DG3A 3DECA 4M1RA 3UEQA 2JGQA 4J1OA 4WDWA 4O28A 3R58A 5F7UA 4AHQA 4F2TA 3CEPA 4GX9A 1B31A 5EYWA 5GJPA 1W5QA 3HQPA 4KWSA 4M3PA 3M1ZA 3LHYA 4M6PA 3L5AA 1NELA 2BWGA 4OHQA 2JE8A 3DUGA 1W1A1 3PUEA 2Y70A 2PRLA 2OODA 5AC5A 5AHNA 2HDJA 4MNMA 1WDQA 1E5JA 2CC0A 3A4WA 5DFAA 1NQKA 3L0NA 1XICA 1SFJA 2WPGA 4I9JA 4AXKA 1HL2A 4KCVA 3C2OA 3UNDA 5GPRA 3EOOA 5CG7A 5AFDA 4PBEA 2X7VA 3ALGA 1V51A 4TV5A 4AEOA 3CAVA 1L6WA 5JIWA 5E6ZA 1KXTA 1PVNA 6REQB 4QQUA 2OFJA 1BKSA 2FHCA 4L7ZA 3S1XA 1GJUA 3T09A 5FAJA 1UD6A 4GFSA 3ABRA 4CU7A 1T7LA 4BZYA 1W9BM 1XQKA 1ADSA 4JN8A 4MYAA 3IIOA 3W6LA 2VMFA 1N82A 1P1MA 1F6KA 1NDZA 4J9JA 1XGDA 4IX0A 3ZWSA 2HVOA 3HOJA 4O19A 1HKVA 3ARSA 2TODA 4IUGA 2I14A 1XL9A 4WLCA 1AVAA 2O56A 1PHQA 2VRJA 3T81A 2GGGA 3NA8A 3RJYA 3LM7A 4CD4A 1FTXA 1EF2A 3NPXA 2DT0A 1ZFJA 4FX6M 4RLIA 4JHOA 2J66A 4B5XA 4DQWA 3DU0A 4WY0F 4U2YA 3R10A 3VE9A 1JDDA 4QM1A 2YFOA 5KINA 1QTWA 4QAWA 5HDRA 1AD4A 2PDYA 1HVQA 4HK6A 1FXPA 1UKQA 4O0QA 3ANYA 1XX1A 4NX5A 2AQVA 3H7VA 1ZP4A 3WELA 4QG9A 2OJPA 4PCFA 3T78A 3TK7A 3IIXA 3PZTA 6REQA 2DVXA 5TD4A 3AU6A 3RU8X 4AH7A 3QV6A 3G2GA 2C15A 3AIQA 3OP2A 4MB5A 2OZ0A 3UXDA 3S2MA 5G2HA 4HNLA 3RU6A 3WQPA 1LL6A 1TTPA 3MP4A 4YHGA 3OVGA 5I3KA 4Q22A 3FN9A 4DBDA 1SPQA 4IMCA 2I1OA 5IBXC 5LIXX 3F03K 4C7DA 4GUJA 2VFDA 1O66A 2A3BA 3RHGA 2CETA 2ISFA 3WLPA 4HMDA 4QNWA 3SW6A 1TTIA 1DXFA 1NJJA 2YCJA 4FA3A 5B7ZA 4B3KA 1KGUA 2JFEX 3A23A 2WMIB 5JBFA 4RUBA 4HGXA 4A3QA 1HL9A 3T0DA 4IMDA 2FH6A 3F4WA 4PL2A 4DNMA 1GPWA 4Y2WA 1F2JA 2O9OA 3QMSA 3OVPA 1AQHA 3PUGA 1XIIA 1C7SA 3N2BA 2VX5A 1OM0A 1MI3A 3ZJ6A 4LVDA 1DV7A 3QW4B 2IQDA 4C5ZA 3LEPA 1F05A 3TMLA 4Q4QA 4KS0A 1W3HA 1NAL1 4LEQA 4PMOA 4HA0A 3WMBA 3GG1A 1G4TA 3N4AA 3TLQA 4R9OA 1GOOA 1VBHA 1O12A 4D6GA 4DO4A 1MW2A 2R94A 1R38A 2QCEA 4NVTA 1MRQA 4EE9A 3A3HA 4JD4A 1VS1A 4QP0A 3M44A 1OWQA 1N55A 3L21A 2ZX9A 5G1TA 2AL1A 5IFTA 4F0MA 3DC0A 4LAZA 4AVFA 2QT3A 2XIBA 2PWUA 3EA1A 1JL8A 1V3IA 1PX3A 2OLHA 2WMIA 3MUY1 5AYIA 3URBA 2X7WA 4S3BA 4GG9A 1JCYA 2QAFA 3EEGA 3IK2A 3M9YA 3GR4A 1R9XA 4N9BA 4KRTA 3PBVA 4J35A 2NVAA 3NZ1A 1Q2SA 3B8VA 1X8FA 3RLUA 4G5DA 4NP7A 1IR1A 1HG3A 4ZODA 3L4ZA 4PMQA 3ITCA 1J18A 4I6VA 4TTGA 2X1SA 1A49A 3M5XA 3KBVA 1XIFA 3GG0A 4DJDC 3FY1A 3SFKA 3T8QA 2PS2A 4CVWA 4H9ZA 3WF0A 3PWGA 3HU7A 3N6HA 3BV7A 3PF3A 3DG7A 2PDQA 2VD8A 3VOGA 4AU0A 3RF9A 1B3ZA 3UWQA 4B5VA 1IEIA 5LNSA 4V1YA 5HANA 4LYRA 3ANVA 1H7WA 3VGDA 4OBRA 3NO5A 2DZVA 4HHMA 4EF9A 1R3SA 3GVWA 4IF2A 4JGDA 3PJWA 5C7VA 4Z42C 4OV9A 2A7NA 4LY8A 3MMTA 2J8TA 4BQ2A 1C90A 3HN3A 3KTCA 1HKMA 2R91A 1V3JA 1JUEA 1TE6A 3QLLA 3TTOA 2VRQA 1OYCA 3M0IA 3VKKA 4ZBCA 4DHGA 2D2GA 3ARUA 3G3MA 1XISA 3VIMA 4MNLA 2C6QA 3TV8A 3HQNA 3RITA 3GFZA 2V5BA 2BS9A 3L9CA 4WXZA 2FPYA 3DX5A 2HS6A 3H7RA 3AO0A 1H50A 3TCEA 1WBHA 3IGUA 1UIPA 2E25A 3WBAA 3PJTA 4H01A 5D9NA 1VEPA 1FWNA 3N29A 4FNUA 4WF7A 2P3EA 5SWUA 1FH7A 5HATA 3RCYA 2Z2BA 3QH2A 4LNYA 5CC7A 2D73A 1UKPA 3CB3A 1EWEA 3QVQA 5CPOA 1HL8A 1JCTA 4N7QA 4N42A 3MUZ1 3CMJA 2G96A 2PUZA 5LZLA 4IIDA 4Y96A 4Y90A 4QRNA 3APGA 1TPEA 2UY5A 3IACA 1Z32X 1UMLA 3EDDA 2VX7A 2QJJA 3L4UA 4BR1A 3H2OA 1KCKA 1QPRA 3QZEA 4I6KA 1C8YA 2VKZG 2XH2A 3G1DA 3TFCA 4GMEA 4Q7NA 3BAKA 5KZMA 1I1WA 4BWLC 3NGJA 1FWSA 3QM3A 3SCNA 4DF0A 3LCXA 3OLGA 4DJEC 1FVPA 1JRBA 3O06A 1W5OA 2HMCA 3I6TA 1DVJA 1A3XA 4L5ZA 1BXBA 2YFNA 1SSGA 1UD3A 3GLCA 1OB0A 5BCAA 3M5ZA 3WYZA 3ITOA 3S46A 1DEDA 1IWAA 2ISVA 1JXJA 3TW9A 1ONWA 3LHUA 4MDPA 1R7OA 1NQ6A 3HQ1A 1TMLA 4X9SA 2G3NA 3VIKA 2D0GA 1P0EA 4LAOA 4MNJA 3RLGA 3ZXWA 1GTHA 1Q7ZA 3G22A 4D6JA 3OZOA 4QHRA 3W1AA 4HCLA 1PZ2A 3PTQA 1JZ4A 5LGXA 3GVQA 2E8ZA 2ZDSA 3OQEA 1K6AA 1FXQA 4HPJA 3IVTA 2VGGA 5A2AA 4FF7A 3N11A 1EHAA 2YCLB 4OZOA 4WY0B 2ZADA 1IR2A 1GG0A 3WQOA 4UQBA 2NWSA 2INZA 4UQAA 3DG6A 5C6MA 3MUCA 1W31A 1AW1A 1KNWA 4FOJA 2CBUA 3S42A 1US0A 4AD1A 1OCQA 5G4HC 2XDFA 3PG8A 1M53A 3GDRA 3UWYA 2JQXA 3BE7A 1OBAA 4NHVA 4LYKA 3LGGA 5IM51 4S1FA 3BAYA 1KWGA 3MMWA 1A5UA 1LBLA 2HBXA 3L2IA 4O50A 4KRZA 2FFIA 2J13A 1OD0A 2A0NA 4POCA 3WNPA 4YJ5A 1KM4A 3FDGA 4EK7A 3G8RA 4Q8OA 3NG3A 4DUWA 1PWLA 5E6YA 3PB2A 3PULA 3AXMA 2NT1A 4M5PA 3DN5A 3E49A 3P60A 4UXDA 3SEPA 3W1QA 3HPXA 1WDPA 3MV11 4OECA 3TXVA 2NX3A 1EWDA 5PTDA 3RM9A 3FA4A 1V6TA 4PUUA 4ZOCA 1WPCA 4L4MA 4H6KA 3CO4A 1FRBA 2D22A 4LC6A 3THAA 2BY3A 7TIMA 2P1FA 1SO3A 3GNXA 2YCLA 2V3DA 1TV5A 4FXFA 4JDYA 4WY0A 3WUFA 4O15A 5I09A 1PDZA 5CC3A 3PFRA 1O1ZA 4PUNA 4MPQA 4LB4A 1QRQA 2DVUA 5D2YA 1UP0A 4MY8A 1BRLB 1TFVA 4C65A 1I6NA 2RDWA 4Q7IA 2V67A 3W1MA 1EEPA 1GT8A 4AD5A 4F2BA 3GG8A 4EAMA 4MFEA 1WE5A 3WD1A 4LH8A 2NV2A 1Y65A 3AHZA 1P6BA 1JIBA 3BANA 3OBAA 4QX4A 4Y9OA 1T41A 4AZBA 4XIMA 4CQAA 5I06A 2F6XA 2PDBA 4JIQA 1LYXA 1JCMP 1IEXA 4GCXA 2F38A 3S2CA 5AC4A 1UUOA 4MM1A 3CMGA 4IWWA 1G5AA 1VFTA 1OZMA 5M3WA 3U3HA 4GIEA 3RNDA 4JZ5A 1SZGA 1OFEA 4I90A 4PN2A 5IDZA 3KTSA 3AWNA 3I68A 1RPXA 1Z89A 1B4KA 2PU1A 2GWNA 2V3FA 1Q6FA 3F4NA 3ITXA 1PSCA 1IXOA 1W2PA 3TYDA 1W3JA 3STFA 3G1XA 2H8ZA 4GIYA 5FF2A 1XRFA 1ZALA 1XLBA 3CV7A 2J79A 1PX4A 1VZWA 5CQ1A 2Y1HA 1UD5A 4AFYA 5HQMA 3CAKA 3PZVA 3GD6A 3NPUA 1WZMA 1ONXA 4XB3A 1WAUA 1H5VA 4LJ3A 2P8BA 1BRLA 4HN8A 1M3UA 1BSLA 1NTHA 2PD5A 3MI2A 2XN1A 7ODCA 1NOFA 2YDAA 5DRCA 3HGRA 1W54A 1OCNA 3CNYA 3KZSA 5FSDC 2DZSA 2PTZA 5D9PA 3MTWA 5HUPA 1DXIA 1NDYA 3AMGA 1X98A 4DJFA 4ES4A 2NQZA 4E8DA 3BMVA 3JS3A 3LPOA 5A8GA 5G1YA 3NOEA 4DO5A 1EX5A 4RW5A 1UD2A 4B16A 4ECLA 3KFTA 2R6OA 3NVTA 3PTKA 1UR3M 2PDHA 4ALDA 4FNRA 1XRTA 1HJQA 4U31A 4MZYA 4UOZA 5H6HA 5XIMA 5T26A 2OX1A 2W91A 5H1WA 3HV9A 3VKDA 3GTNA 4Q8MA 1T99A 1SR9A 2CIPA 3B05A 1MNZA 5A6LA 1CIUA 2O9PA 1JPDX 2WSPA 2YX0A 5I2UA 3FEQA 2I9UA 3GDTA 3KE0A 3VKJA 3GTXA 5K9DA 2A1YA 4M80A 3ZWTA 1D3HA 2AQOA 2VGFA 4MWAB 2ZZ2A 3W7KA 2DSZA 5D38A 3AYTA 4RL3A 4R7JA 5HJLA 2QNEA 3AXIA 4WSJA 1VLWA 4UQDA 3N6JA 3C3UA 5KZDA 1Z41A 2Y7FA 3CHDA 1LLZA 3GXNA 1E70M 3D0CA 2WQDA 4YPJA 3U5UA 4IG2B 5EL1A 2PCEA 2UV8G 3H2MA 3IJQA 3RILA 1AJZA 4ZSTA 1HKJA 4JTAA 1W37A 4FR1A 4UOJA 1QK2A 2YZRA 1W5PA 3BLKA 5BZAA 4O8AA 5JH1A 1O6IA 3NL6A 4FZIA 3ICJA 1BHGA 2FDSA 3EWXA 1WZKA 1CXEA 4MGGA 3WZ0E 4UBPC 2YLLA 3QY8A 3U7VA 2GSHA 2WMKA 1W91A 2YA2A 5HWJA 2KX9A 4Q6JA 1K77A 4C6LA 3ITLA 1KFEA 4PCPA 4ZO7A 2HVNA 4JTUA 4P7RA 1UR8A 3N2MA 1C93A 3LBOA 3TSMA 3RK8A 1A5BA 4ICCX 3E0FA 2XH4A 4DO6A 2VZUA 4GXPA 4IMEA 4MWAA 2Y85A 4HIBA 1TV8A 3BAXA 3WLHA 2EAWA 3MYPA 2HZGA 3P62A 3SQLA 4FLQA 2E5BA 4PBGA 2WV8A 3GVRA 4QEHA 1FCQA 3W27A 3AS1A 1NFBA 4OGZA 2EPHA 3WDHA 3SECA 1W9UA 1WP6A 4IG2A 1EUNA 2IS7A 2X1TA 3WQ4A 3QF0A 3TC7A 4R5EA 3S5OA 1HJSA 1QFEA 4I7WA 1GNXA 4GQBA 1YE6A 5BYWA 3P80A 3VVGA 2WJDA 2H8XA 1BWLA 1ODUA 1ZHAA 2GJXB 2INFA 3BCJA 4H8VA 3L23A 3KVLA 4ACYA 2ISWA 3ES8A 3ABQA 2ZTJA 1IT7A 1JCLA 3EWCA 2ACSA 4CNSA 3VD7A 3CM4A 1H61A 4O16A 1F3EA 2OX4A 2WCGA 5DMLA 4AG0A 2XVNA 1TV4A 1WQ5A 2RH9A 4AWTA 2PA6A 4GWEA 4RV8A 1SO6A 4TO8A 1TCDA 3ZSSA 1IGWA 3EWYA 4S3KA 2Y24A 1CECA 2G95A 3EX4A 1E73M 5F2MA 2A85A 4B9ZA 2VR5A 3VKAA 1SSDA 4LFYA 2Z1VA 4JICA 3QHOA 4ZOBA 2ZUMA 3MP5A 4GQQA 3RPMA 5E9AA 1PX8A 1XHGA 4BQ3A 3SN0A 3SN1A 2J7BA 2E7FA 3W1PA 3RPDA 1AUSL 2TRSA 3N2CA 1OEPA 3BJFA 3KCLA 3OGSA 1W0MA 1WUFA 2P88A 3U9IA 4FLOA 2Z7GA 4B2DA 1FWJC 1RH9A 2IPJA 1J0KA 3UT0A 1NF7A 3CZEA 1A5LC 4W93A 2A4AA 3EYPA 2GJXA 3LLFA 3AOFA 3AC0A 3QHMA 3NSXA 4RR4A 4C6EA 2QPSA 4I7VA 3KDNA 5G2IA 4ZZ9A 2X2GA 1AW5A 1BTCA 3PM6A 3BOFA 3WQCA 5KMYA 1ZBVA 4I9MA 4U33A 4CQ9A 3DEQA 4HK7A 1XSJA 4Z1DA 4PUMA 2V0TA 3L65A 4FOUA 4LAKA 1TV2A 4YCOA 2Y7DA 1QBAA 1UJQA 2YOCA 3B8TA 1E6SM 4IM4A 2BNJA 4GXMA 5AC7A 1XD1A 4QFUA 3LI0A 4ERGA 5LIWX 4EWJA 2G5WA 4NXSA 4PULA 3MDUA 2CXEA 3W1UA 4YIWA 1ZTVA 3TMQA 2HXUA 3ECQA 3P74A 4WJ8A 4W88A 1OD8A 1XSKA 4PMDA 5DANA 3T7VA 4IIEA 4DN1A 4HA3A 4HU3A 1Q13A 2AL2B 5A6KA 4OV4A 2FGBA 1W5NA 5DY2A 3MKCA 3LGEA 2EO7A 4NY2A 2X0HA 1UWUA 4PBFA 4B5TA 2PZ0A 1NWUA 4QS5A 5K4XA 4CCCA 4P7QA 1OK4A 3B9NA 1J79A 3DXIA 4EACA 1NDWA 5CBJA 4IT1A 5F2IA 2Q8ZA 3O7UA 5A8PA 2HNEA 1TV3A 3UYCA 3GKFA 3DI0A 3WUEA 1GCYA 1U5VA 2QULA 4HSOA 3WNKA 3OG2A 3FA5A 2BHYA 3ZR4A 1IGSA 2A3AA 2E67A 4DYEA 2J9ZA 3VMNA 3MO7A 3ZS4A 4O52A 2DPEA 3ENLA 4I5XA 3R2GA 3IRDA 3TIMA 1NVMA 3GIYA 4N2YA 1FH8A 3CV2A 3SQMA 1AZ1A 3A4JA 5FEZA 1J8VA 1IEQA 2VCBA 3CTTA 3MO4A 4GI8A 5FF4A 1M7XA 3OZYA 4LUSB 1BGGA 3FSTA 1VR6A 2I57A 1HW6A 4JYDA 4OJYA 4GUHA 1REQB 2AL2A 2F6UA 1EGVA 4UR9A 3CV6A 4PMUA 4FF5A 2PD9A 4H41A 1KWKA 2DUXA 2FHFA 2G0WA 4J27A 1POJA 2XFYA 3C2RA 3HJEA 1WOBA 4JKLA 2YGYA 3WDJA 4EP8C 3V1HA 4UR7A 1SJCA 1KRMA 3PBYA 4CEUC 2C0HA 1E6QM 4GX8A 1QOXA 1IZCA 4U2ZA 1JR1A 2MNRA 4Q4SA 2CKRA 2A3LA 5K9XA 4X2RA 4V15A 1F4HA 3TQPA 2G4JA 3NDZA 2EGZA 3A5VA 4RZ6A 4WVXA 1TB3A 3H21A 4H6QA 4L1XA 3REQB 3BAWA 3C86A 1ZJAA 2BSLA 4PTWA 2HISA 4MJMA 3UR8A 4D6HA 4DELA 3WL0A 3MYOA 2F84A 2BASA 2ZUTA 4CKQA 4I5UA 1JNEA 2PRHA 3UZZA 3BG3A 3TOYA 5A6BA 1YXDA 2VDIA 1EQCA 2OZ3A 1EP2A 3BMXA 2G3FA 4W84A 4LUSA 1CGWA 1QU4A 2Z0IA 3BTNA 3LM3A 3N9SA 4JIRA 2OMAA 2OSYA 4O4WA 1REQA 1U5JA 1K8ZA 5CH9A 3UXAA 4IL0A 1YX1A 3PZUA 1NOUA 1GW9A 2BG5A 4ADUA 1C8XA 3KOZA 1XBVA 1VEMA 2E9LA 4YVPA 1RD6A 1E6ZA 1S2TA 4A3UA 1E4IA 1WZAA 4O0ZA 4IPJA 3VOHA 2VZOA 4F0SA 2ATSA 3OYXA 3QQWA 3SDOA 4MFDA 3E12A 2DU2A 1UWIA 4RW3A 2WAGA 2CESA 4AD0A 3EOEA 1A3HA 4H3DA 4LUJA 4C60A 4KWVA 1CGUA 2V63A 1OG6A 1BSIA 2V5DA 5C70A 2CBIA 3WIJA 5FJUA 4GZIA 1FKWA 3HF3A 1FCBA 3REQA 2PDKA 2ZVRA 4S3AA 1UWRA 1QPKA 1UKTA 1DJHA 5HA7A 3T42A 1X6UA 3SQSA 1VJZA 4GY1A 1QK0A 2WHMA 3AZTA 2DT3A 3GTFA 5H8MA 3MBDA 1TWIA 3R0KA 4MUPA 1W56A 1IT0A 2R1LA 4RPQA 3U4AA 3UJFA 1F5ZA 1AA1B 2QVHA 4Z2JA 1CDGA 5EFFA 1XLLA 2HJPA 2VP8A 3PPHA 2PRMA 4JKKA 1P1XA 4IXHA 2Y7EA 3WDRA 1IWBA 4IMAA 2D0FA 3QQ1A 2W5FA 3G1RA 3N9KA 2FZNA 3Q94A 4WR3A 4Y9AA 4H1ZA 4HNVA 2Y89A 3EMQA 1S2VA 4LCQA 4IMFA 5BXRA 1UP2A 2RGMA 3SGUA 4PB4A 3B0PA 5FJRA 4S3DA 3L5MA 2GVYA 4XAGA 3WUGA 3XISA 2WK2A 2AAMA 3ARVA 3KRUA 5ABHA 4ZL1A 4B4FA 1XYAA 3GDBA 2Y8VA 4JY8A 4AW7A 1X39A 3KBJA 1B54A 4F8XA 3WDPP 1XLEA 1QWGA 1Y5XA 1IF2A 3G3DA 3IAPA 4U28A 3FAXA 1WA3A 2DGAA 2OYLA 4NZCA 4GQ0A 3WG6A 4JTQA 4Y7EA 5FAGA 3W00A 4GH3A 1EHNA 1GQLA 4P8UA 1JFXA 4IZGA 1QHOA 1V02A 4Q33A 3AZRA 2Y61A 5D05A 3FV9A 2NQ5A 4JNZA 1BG9A 2AMGA 3OIHA 1JZ8A 4KWOA 1JZ7A 3SGZA 3PG9A 3MCOA 2FH8A 6XIMA 3S9ZA 3D5HA 1DQUA 1V6YA 4I9TA 5IBXA 3MU7A 3O2LA 1YEYA 1B3XA 1JPIA 1R3TA 1O5RA 1TWWA 3IS4A 4GD0A 3CQ0A 3ARXA 5F1VA 1IWPA 4O10A 4GC3A 3MBFA 3TJIA 4Q4MA 3THQA 1TWDA 1OZQA 2VC9A 5MKGB 4H2HA 5JMUA 1G0CA 3EAUA 1LRQA 4WJXA 4XAPA 3VZZA 3N73A 5CG0A 1POKA 1VF8A 5E93A 4N6EA 1EF3A 4UC5A 4AZCB 4KFNA 3TR9A 2EPMX 2OSWA 1A5OC 4BI5A 1MFVA 3IV3A 2V38A 4BFAA 1OHLA 4WXYA 3AHYA 3FXGA 2YBVA 3QMRA 1EO5A 1TX2A 1OC5A 2VD9A 1NFGA 2HTMA 3NZRA 3UETA 1J01A 4N0RA 3R8RA 2YW3A 4PMJA 2OO0A 3GNRA 4UQEA 5LNUA 1GVQA 2WM0A 2VEPA 3I7SA 4US6A 3V0TA 4UTTA 2NWRA 4DXVA 4TUFA 1HJWA 4JCMA 2J8GA 4A8RA 4Y8FA 1VYRA 3B97A 1VJSA 3ITGA 4J3TA 2YL5A 3AUJA 1DBTA 2ANUA 5HNTA 1EP1A 1XWYA 2PLMA 4PRRA 1OT1A 2FFCA 1MUWA 1TX0A 2XIIA 3UGRA 2PDGA 4FXRA 2WVUA 1A4MA 5LXEA 3GAKA 2HWGA 3CT2A 3CUGA 3G0UA 4FS9A 5MKGA 4MF4A 1CB2A 2J25A 2NLYA 2V3EA 3H7UA 4GCAA 3TN4A 1TCMA 3NFUA 2GQ8A 3TWBA 1XDMA 1U2YA 4AZCA 2J8FA 3WLSA 3M0MA 3CL6A 3PB0A 2D24A 3QGKC 3UPMA 4V27A 1S2CA 3P0WA 4UFHA 1K03A 2J47A 2DSVA 4DNHA 3DC8A 4ML4A 4WQ6A 2RDUA 4V28A 1HKKA 4JL1A 2A3CA 2NXHA 3VNDA 3B0VC 1WAWA 3H12A 5CBIA 4GRSA 2HNHA 3OIXA 3SO7A 2YDRA 5CGTA 1V6VA 2CYGA 2WSRA 1ZCCA 1VKFA 2X0SA 4Z08A 3VKCA 1UROA 5BU9A 4UR8A 4REQB 3Q65A 1VENA 4C6FA 3CH0A 3F7JA 3W23A 4ZOAA 2FVKA 1OGSA 2OEMA 2I16A 1R85A 3KL5A 3IJ6A 4KT2A 2MUCA 4IIFA 1E0WA 4MLJA 4AIOA 4PE8A 1R86A 5AYZA 4C6BA 2JEPA 1PKNA 1H09A 3A6OA 1XINA 3NCOA 4ZSUA 2JKEA 4FALA 1GVSA 1ZP3A 4IJBA 3QHNA 4JNMA 1VPQA 1UUQA 3P8IA 8A3HA 3S5YA 5CCZA 3NZQA 2P53A 3TR2A 3RRAA 5TAOA 3LN3A 4NNAA 5C9RA 2B7NA 3OEXA 4BA0A 1LQAA 3JUGA 1E0XA 3TYZA 2GGIA 2J7HA 4GNKB 4XZLX 2J78A 3B04A 1FHDA 2E4TA 1UHVA 4UMAA 2ZE3A 4XD5A 4XSLA 2DVTA 3BLFA 3VGGA 2WLYA 5H8PA 3SCWA 4DM1A 2OLAA 2C18A 1QXLA 3W74A 1XLDA 1NH6A 2OB3A 4REQA 3W73A 1L2QA 5C2CA 3OBKA 1KM2A 3H55A 5HINA 2CITA 1RZMA 1M01A 4QJ5B 3BL3A 4JQ2A 5FF3A 1M03A 1XRSA 1L9WA 4IGMA 3RGTA 3CQIA 3WQWA 1GVRA 2V2DA 5K4ZA 2LLEA 1JNDA 1JZ3A 5FJJA 1UWTA 1E1CB 1DIEA 4H83A 4UFIA 4C1LA 1E9LA 4DJFD 4M7TA 1W3LA 2PWEA 1OG0A 5GNZA 1UH2A 3VABA 3NDYA 4CN1A 2DSWA 2FMOA 2R9RA 1WB0A 1V0LA 3MCNA 2ZYFA 3S3GA 3L66A 2NQHA 2DEPA 2VFFA 4Q8WA 5DXYA 3WLIA 3AIEA 4MYXA 2W0UA 4DJEA 1FH9A 2ZZ7A 1SMAA 2EJ1A 3WQVA 4CNOA 5E0CA 3CO8A 3N2OA 1MQRA 3RX3A 2DW6A 3T2OA 4K3ZA 2CZVA 3MP3A 1PYMA 3TSDA 2I7GA 3GW3A 4PB5A 4H04A 2E1WA 4O1BA 2EJAA 1V0KA 1SJDA 3GU2A 1KRBC 4XKYB 1LT7A 3M16A 1Q7QA 3EKGA 2YL6A 2X42A 4F0LA 3GH5A 4IGNA 2XTKA 4NAFB 2VM8A 2Q71A 1B90A 4XKMA 3EDKA 2VCCA 3E74A 2CLHA 1S46A 3I6RA 4IFOA 1ITQA 3H23A 3RM4A 3LOTA 5L9FA 5BOOA 5LA0A 3E9AA 3R1ZA 1S3TC 2FGZA 3PNZA 1E1CA 1OT2A 5I0DA 2ZRWA 3O1NA 2ODOA 1EGMA 1JGMA 1QNVA 3BOLA 1HP5A 1ZNNA 4KMQA 1VC4A 1E6XM 5DN1A 3H4WA 1E9ZB 3GU1A 1G67A 4IPLA 1KBIA 1HO4A 2XVGA 1WBJA 1UUMA 2VQUA 1TIMA 5EMKA 3A64A 3U4FA 3OZPA 4UTUA 3F5JA 2VNCA 3NTYA 4MG4A 1TUXA 2VVNA 1VB9A 5E09A 3BW4A 4K1GA 1XYCA 5F1UA 2CHRA 3SBFA 3UA3A 4EXAA 1LM1A 3G1YA 2BXZA 1RA0A 4XKYA 4L6HA 2BGSA 1XUZA 4HK5A 3VC5A 1MXSA 2YA0A 1U1HA 4MWAD 3FAWA 4NAFA 1VCFA 4Q8PA 2OYMA 3W7PA 2JALA 1V3KA 3LCGA 3FA3A 2XN0A 1H62A 2OEKA 3BLLA 4JFUA 2JF6A 3T1GA 5F4XA 4ZXOA 4QBXA 3ZM8A 6CGTA 3WENA 4JHZA 1FP9A 1Q7MA 2FJUB 3QXBA 1SZRA 1R2SA 2CZDA 2QJGA 1VHCA 4KEZA 2NVCA 4F2UA 3C4UA 4NXKA 4A3RA 4XVDA 3AUOA 3CLMA 3ZJ8A 3IV8A 3GTIA 4ZEPA 3R0DA 5JBDA 1IIGA 2ZZ5A 2F2KA 4DF1A 1MUCA 3F2DA 1J4EA 3C56A 3MI6A 1BPLB 1EIBA 2BTMA 1FBAA 4AZIA 3H53A 1W3IA 5A94A 3R5EA 5GVJA 2XM1A 1RBLA 3OA5A 1EJVC 3GC2A 3OJGA 3NM1A 1GVFA 3K13A 1DJNA 2B0MA 4DY1A 1ISXA 1UZDA 5I24A 1B4EA 3WX7A 2PU0A 4GIRA 1B2YA 3FSUA 3C0SA 3CIXA 2PDIA 3QPZA 4DIAA 4HZ8A 3WKZA 3H2CA 4PTVA 3PZNA 4C90A 3NM3A 3TN3A 2QF8A 4Y9MA 1EB3A 4X0VA 1GEQA 3NQ7A 1SR0A 4LB3A 3WH6A 4F9JA 4B2DD 1BFNA 3LBMA 1B30A 1Q6DA 4MOZA 1TPUA 1TWZA 2WMJA 4UWMA 5T8GA 3DYMA 1DJGA 2V5JA 3MDWA 3UBPC 3L0KA 2BZNA 3P82A 1WDSA 4Z1CA 3BJTA 4P8XA 5AHMA 3KXQA 5HMFA 3E3HA 2A6NA 3I7RA 4Z1AA 4LC8A 1OADA 3ZJ7A 2PURA 4B90A 4LAUA 2DT1A 3ITVA 3ME3A 2QDDA 1XIHA 2EEXA 5JUVA 4KCTA 5EB8A 5DT5A 4B5SA 3W75A 4M56A 3UY8A 3RIKA 2VVSA 2Y6ZA 1PTAA 1US3A 1UR1A 3UPBA 4ZOEA 1KKOA 2VZTA 4IIBA 3AWOA 4NRRA 4X61A 4A21A 1R8LA 3W1NA 1KXVA 2BXYA 3O6AA 1UD8A 2VUNA 2FJKA 1RCOB 2DZPA 2DJXA 3NQFA 3SGGA 2WKLA 2QDEA 3STGA 1GZGA 2ZZ4A 3NUKA 2PBGA 5IOBA 3HV8A 4KGJA 1GQJA 2PDJA 1GW1A 3TTEA 3UZJA 3ZR5A 3WD3A 1OINA 3O9NA 1AG1O 1M5WA 1V3HA 1XR2A 1GKRA 5D2WA 1A80A 1OX4B 4IIGA 6TIMA 1HF6A 4Q8TA 1DOSA 4DB7A 2Y5SA 5ABGA 1B5TA 3H54A 3U8GA 4HCHA 3THCA 1EC7A 1RBOB 3V7PA 1ZY9A 4WX2A 5AN7A 4C5YA 2E09A 3VDGA 3CUZA 4CVUA 1JI2A 2HS8A 1CGVA 1RR2A 5TF0A 4GFIA 1FA2A 1TJPA 2KAUC 1BYDA 1QT1A 3CWNA 2P8CA 3BQ5A 2CU0A 2ZXBA 1V3LA 1A0DA 1S38A 1I0BA 3H2AA 4ZE4A 3CB8A 3SIMA 5GNXA 3IJIA 1XFCA 3GZ3A 4MZ8A 2ZXDA 1V93A 2F9RA 4N9EA 3G6MA 5CJNA 4W5UA 4K7YA 1AJ0A 3T0CA 5JIPA 1IEWA 3NYDA 2DZAA 1TG7A 1TZ7A 3NQMA 4BEQA 4BF5A 4HNUA 4HSNA 1JULA 4QCEA 1TVPA 4GYPC 4AIBA 2Q6ZA 4G2DA 1DWJM 3FS2A 2Z1BA 4FI4A 1VAHA 4Q4OA 4GI6A 5HWNA 2J9XA 3WH8A 5J8LA 1OX4A 3DKJA 3QKZA 1W9PA 2RGLA 3W2NA 4PMXA 1LLWA 4GY7A 3SCVA 3N15A 2I5GA 2KZHA 2WLZA 5A95A 1UMYA 3DHPA 2VQTA 1ISZA 1XIEA 4Q4KA 3D3AA 4ATWA 4US5D 3RFAA 4W89A 1JYNA 9XIAA 3SCTA 1CLKA 3RLHA 5DRIA 2UY3A 2WVSA 4FNQA 2R1MA 3BZJA 4I8DA 1V0MA 3B40A 3PSVA 3PZ9A 4RNJA 5HR7A 3STPA 1TVNA 5HNRA 1C8VA 2J74A 3SSZA 1ISYA 4X0NA 4EF8A 4AY1A 3OLDA 1K02A 1QI0A 1S2WA 4S3EA 3GDKA 4OUEA 3E0LA 3NQVA 2QKFA 1AD1A 3QJAA 2XFRA 2ZRZA 4AZGA 4AIUA 1EYEA 1V0NA 4H6EA 3K46A 1C92A 3F1QA 3CPGA 3NIYA 3QRHA 3N6QA 1I60A 4YN5A 3UZWA 2PTYA 1CZ1A 1UH4A 3S4TA 1UWAA 1OABA 3OGRA 3G6LA 1E71M 3AXXA 3C2EA 4KEUA 1Z44A 4N4PA 2BX7A 4HN4A 1K9TA 4JIEA 1J0HA 3KLLA 1X1OA 2VZSA 4GZJA 3VUPA 1J2BA 4GZ7A 1ZENA 2G3IA 3LUTA 1LBFA 1SFLA 2V3GA 3O8AA 5GJNA 1EEXA 3IVSA 2WJEA 1AL8A 2BY2A 1W9VA 4KWWA 5IXEA 3URNA 3LX9A 3BW3A 4H7ZA 2WM1A 3VDCA 2P5NA 5LIUX 3DBNA 3NOYA 5EY5A 3UF9A 1ITXA 3WK1A 3II1A 4O53A 1EYWA 4DM2A 4ZQMA 3F4CA 3ISIX 1UA7A 4QG8A 4ZE5A 5E9XA 4MUZA 1H51A 4GOAA 3LQGA 1TR9A 1E9IA 2EG8A 4EPKA 5DLCA 3FW6A 4KIEA 5T9BG 3F2CA 4RE4A 1YQ2A 1H1NA 3DFPA 2AKMA 3LENA 2POTA 5FA5A 2JGYA 3M46A 4MJ2A 3DOPA 1QNPA 2FKPA 3QQ0A 5CJ5A 5C8BB 1XCWA 3KS5A 1HO1A 1K9FA 1SVDA 1KXHA 3RO8A 4CNTA 1JYXA 4Z2HA 3E96A 4JX5A 7REQB 2WNQA 5U7SA 1S5WA 4QLKA 5HJYA 8RUCA 3ID7A 3UJ2A 4D8ZA 1Q6CA 1W6TA 3DHUA 3TTSA 5A8QA 3P93A 2D2OA 5EBUA 1P0NA 3NQGA 3U2CA 4JX4A 4CQCA 4JQAA 5CZ0A 1FWGC 2ZUVA 3AIVA 3ABOA 3W3OA 4LCSA 3TZNA 2DQXA 3RLVA 3FKKA 3GM8A 3OZMA 4S3GA 3NQ6A 1ZGDA 4E3TA 6ALDA 4NJGA 1VHNA 4RDZA 3BQ6A 3RDKA 4DPPA 1AQFA 1TWSA 1UP3A 1KR1A 3ARQA 1GVEA 4AMCA 4RE3A 2IPFA 3SZ8A 5BW6A 2EG6A 3LXBA 4B5WA 5A3HA 2WVTA 1N2VA 1R46A 4NZ5A 4QE1A 4HTBA 3L2MA 3URQA 3TW6A 4CQ8A 3VD4A 4CCEA 1R30A 4CLMA 1EPXA 1FUYA 3BW2A 1AK5A 3IGSA 1E0VA 4GNVA 7ENLA 1XLMA 4KESA 4C6QA 4JNYA 2PDCA 1P48A 2ESCA 4J2PA 3TZFA 3NQDA 1S3HA 5M5DA 3GBDA 4HMEA 3P67A 3SIZA 3GYCA 2VUYA 2G3JA 5FJTA 5ECVA 1AMYA 1XG4A 4BQ4A 3HMCA 2QCGA 3PUOA 3UR7A 4CCZA 2X8RA 3INPA 7REQA 3GYEA 4DF2A 1VGAA 3E02A 1MQPA 2HVMA 1EIXA 1ICQA 3NZPA 4FX8A 3OTRA 4NASA 4HZMA 2DT2A 1TO3A 2Z27A 3CIWA 2Z1XA 3BCDA 1IXPA 3OA3A 2Z2UA 1PIIA 1EO7A 1V79A 1L6YA 4GE8A 3FJ6A 1UH3A 2F7FA 1ADDA 1GG1A 1E5NA 3NSMA 2F8QA 2GVGA 5BOFA 2VC7A 4EIVA 2VC5A 4W7VA 2B4GA 5CC5A 3AFBA 2PTWA 3AHXA 5DXXA 1C91A 2NXIA 4NI8A 1WV2A 4GJIA 2D0HA 4XBSA 3W4RA 3LCHA 4FIQA 2XN2A 1I2RA 4QISA 3T44A 3P0XA 3SR7A 1VQTA 2D3LA 3SCRA 4IIHA 2PLCA 4LVGA 1B57A 2X09A 1OGGA 3GXDA 4XZNX 4ZGYA 2RKXA 3RXZA 7A3HA 1K8CA 3RCNA 2ABAA 8TIMA 2P76A 2UBPC 3UG4A 3AIRA 1A5NC 4YVVA 4F0KA 2RDXA 4WKFA 1SJBA 3MPGA 1BLIA 1UG6A 4L61A 2XVLA 1GONA 3APTA 5G4WA 1M9HA 3W83A 4D8AA 4DJDD 1WUEA 4ATDA 1TZ9A 4E2OA 4A05A 1KBJA 3N13A 2FMNA 3QY6A 1DIKA 2VDHA 2WKGA 3TTQA 2FZBA 1GOKA 1SM9A 4J5NA 1GUVA 6ENLA 1NP0A 3QOMA 4WEVX 1E9YB 3KL0A 4C6PA 4FNSA 1SYTA 1EFZA 1UWQA 3LV6A 2X40A 5A69A 1E4LA 3RRXA 3HG5A 1NF0A 1TA3B 3IWPA 2UZ9A 4FHAA 1W1IE 1DWGM 3FEMA 3LG3A 1ME9A 4K38A 2YBTA 3W6YA 2V2HA 3UJEA 4Z2IA 3DKLA 5LIKX 3DFOA 1XYMA 3VIGA 5A6TC 3W85A 1BEUA 3GR8A 1G4PA 4BY3A 4CNUA 4GKTA 5CXPA 3EX6A 4HNCA 2OPJA 5FCZA 3FGCA 3MMDA 8XIMA 1JUBA 3RO6A 3WNNA 4UTFA 3B9OA 3R11A 3AQUA 3MHGA 5BMWA 3W84A 4MY1A 2Z26A 2A5HA 1PBGA 3T6CA 3ELFA 4LW7A 1VFMA 1H49A 2YW4A 3B8DA 1P0KA 3O6CA 3U57A 3WDQA 1LT8A 3W88A 1V6XA 3KOWA 4MPKA 1A0CA 5ENLA 3GHUA 3L0GA 2ZRXA 3TJLA 3IPWA 2NQJA 2CBVA 2PDWA 3RX4A 1PZ1A 1R3WA 2DSUA 3LU2A 1KGXA 2Z1SA 1GOWA 2NXGA 2DFAA 1H1ZA 3W0KA 5HMEA 2ATMA 3ZYZA 4K6AA 4QG6A 5D4YA 4IL2A 1CT5A 1TA3A 4C7FA 5LA1A 3TOPA 3P81A 4N4QA 1NM9A 1NWTA 3EXRA 4DBEA 4CD5A 2X16A 4NRSA 3TH6A 3MVIA 2OWCA 1GKQA 3VTRA 2Y5EA 5HBFA 4M51A 4MWAE 4WGHA 5DBUA 3WH9A 5BRQA 2GQ9A 1TTJA 4JKMA 5D2TA 1T5AA 4ZA0A 4O1AA 3BH4A 4HVXA 3GR7A 2FVLA 5BXPA 4BEUA 1OIFA 5J04A 4W7WA 5M1TA 3NQ8A 3GB6A 3UCDA 1YE4A 1FDJA 1CGYA 3W7HA 4YNGA 4PTNA 2GZXA 4GK8A 4RNFA 4FO4A 1G7UA 1OY0A 4M6UA 4Y6GA 1FDZA 1P43A 3KHJA 4QGCA 1KTCA 4O1DA 4DBWA 3KHDA 1X96A 4YS1A 2JIEA 1QATA 1SFSA 2ZCGA 2EPOA 4FX7A 4S3CA 5C2XA 1FWIC 4H9XA 3W22A 3DIPA 4RDWA 3GBEA 3LPPA 3CLWA 1QDSA 5CJMA 2R8WA 1KKRA 4C6IA 3C2FA 4G6CA 1UOZA 1MVYA 3P7YA 3PZQA 1EXBA 4ML9A 3VDHA 1A47A 2IQ0A 4W87A 1E0TA 4RNHA 4L65A 1X7FA 2OT0A 2ZUNA 2GJNA 2QR6A 1VEOA 2GDVA 4Y9NA 4MTVA 4AUBA 3N04A 4XBJA 2POZA 3AROA 2CEQA 2WSQA 3UCQA 3WJXA 1W8GA 2XINA 2BBFA 5HAOA 4C7GA 4CNNA 1V7YA 2BFGA 3VIPA 3AJXA 4U5IA 4QXIA 1OYAA 4HPNA 1Q2RA 3G77A 4AYSA 1KFKA 1R3RA 4QJ3B 4U3AA 1VBUA 2VO5A 2DW7A 3CHVA 3HO8A 3P14A 3LHVA 3DYOA 4KRUA 3SSJA 3GDLA 5C55A 1W1VA 2QGYA 2ZKMX 3FYYA 1CB7B 1I75A 4A3HA 1K3UA 5AHFA 4D71A 2OSXA 4UTTC 4GKLA 4HYWA 4LF2A 4JTTA 3CUHA 2Z7KA 3OQ8A 1QNOA 2BV9A 1XCFA 5CGQA 2CLMA 1PCKA 3BWWA 4UCFA 4GISA 4XQ6A 4WD0A 3WFZA 3EDFA 3TCSA 3V35A 1R3QA 4WIWA 4H8NA 3VXGA 4NZFA 4P7LA 1KXQA 3TNBA 4QCFA 3AYSA 1YKWA 2Z1KA 1UASA 3C6CA 3UXLA 3CUIA 3I3BA 1J0IA 1LWJA 3TQVA 2WXDM 3C8FA 5HOSA 5CBBA 1HTIA 3QSTA 3R4IA 2GVJA 4AAJA 3R25A 2IQTA 1F8IA 3W7CA 1QR7A 1HJVA 5LXXA 4WKAA 1OCBA 4PFMA 1T8XA 2NX1A 5AHIA 3VK5A 5EMYA 4GVIA 4NL1A 3VAVA 3LB0A 4LS2A 3QEZA 3CIVA 4Q32A 3VO0A 4TX8A 1PCWA 2VFIA 2CHOA 3BMWA 1RLDA 4JN7A 4LSBA 5BXSA 3R7MA 4Z1YA 2A6LA 3GZAA 4XAZA 3ZQ9A 3QPYA 3P8JA 1RAKA 1J6PA 2ZOXA 4P5UA 1TJRA 4LX4A 3M0KA 4OOZA 4F79A 4H9MA 1PL9A 1MUMA 4L4LA 3KM8A 1JVNA 1Z48A 1FWAC 2VR2A 3EKLA 1LRNA 4D72A 1W1ZA 2IW0A 4ZO9A 1TV7A 3CHFA 3AIWA 3W25A 5GNYA 4D1IA 1QI3A 5TBOA 1UJPA 1UR2A 4GGHA 1LZOA 1R3YA 2C1IA 4E3VA 3CWOX 4TMCA 2PE4A 2H9AB 1E1FA 1F76A 2VEFA 1QOQA 5C2GA 2VCAA 1PTDA 1TKKA 1RCQA 2PCQA 3LI1A 2HBVA 1PXGA 1U1UA 1M7OA 4QNEA 3GVVA 4JQ3A 4L4PA 3KCJA 3N18A 5D33A 1YBQB 1W3KA 2WBKA 1US2A 4ACZB 3HG3A 3K1DA 1CXFA 1V5XA 2E68A 2QIWA 4AF0B 2QPUA 2IXVA 5B7YA 4WSHA 1FCUA 1Q4WA 1ITUA 3AALA 3WD2A 2WWDA 4JBRA 5LNWA 2OVLA 3A13A 1LORA 5D8WA 3I10A 1F3TA 5DF0A 3KCOA 1MYRA 1GJPA 1M04A 4JTHA 4EANA 3TUUA 4D2JA 2HRWA 4HB7A 4GXWA 2WCAA 2ACQA 4AEFA 3JU2A 5LNRA 4E4PA 3AS0A 3ZFHA 4RE0A 1BF6A 4W85A 3BXWA 2MANA 3LPGA 4HOWA 1P6CA 3WLRA 4KERA 1CXLA 1LCOA 3UZYA 1HGYA 3T4CA 4D6EA 2VTFA 4R3UA 4AX7A 4LGXA 2ZC1A 1ZBCA 4N02A 5DELA 1R2TA 3OHIA 1B3WA 2DY3A 4M1BA 4PSRA 3WD4A 2G4FA 2XFWA 5JU6A 4DAIA 2H90A 2P3ZA 2ALDA 4HQVA 2GFTA 9XIMA 4AC7C 1Q6EA 4NILA 2H9AA 2WNZA 3M7WA 1H63A 1Q63A 3HPZA 3W1TA 4LANA 4IGSA 3SB0A 4JDBA 5C9UA 3DFQA 3BDKA 5CSUA 4YYFA 4PZVA 2BODX 1WOAA 1A5MC 5C5YA 1DPMA 1YBQA 4ACZA 1UR0A 4JEJA 4S3JA 5G1MA 1E40A 1MSSA 3ZVHB 2SFPA 3WEZA 1TJ1A 3H4GA 3OHMB 4C6MA 3VIHA 1JG9A 4ZTXA 1XBXA 1KM0A 4PUDA 3KBMA 1Z42A 3IANA 2ZA1A 1TR1A 2FTPA 4CNPA 1VFHA 3N9RA 2QW5A 3EA3A 2FB2A 2YB1A 2QZRA 5CLWA 3TWAA 4JL2A 1KTBA 3EDEA 4HCDA 1D3GA 4IOTA 3S5NA 3ZT5A 4LRSA 1E15A 1EH9A 5U4NA 3OVRA 4OTKA 5I78A 5CZKA 3U2OA 1Z69A 2WC7A 3MCMA 3LRMA 4PMRA 1XSIA 2BDQA 6A3HA 4DZAA 2IKGA 4K39A 5CAKA 4W4QA 2OTDA 2OLSA 1UPPA 1XLCA 1CWYA 1BYBA 2X1RA 3AIBA 4B5NA 3NQ2A 4X63A 1J10A 3LA4A 3GDMA 2ZWYA 3VCCA 5DCDA 1E0UA 4G8TA 3B0XA 4ZR8A 3ZVHA 2CFFA 1H11A 1RJPA 3DFNA 4PODA 2JF7A 1J9YA 2O55A 2AQWA 2OQYA 4LV9A 5CLTA 4O1FA 1O94A 1XG3A 1XW8A 3N2TA 1KM6A 2F6KA 3QGVA 4DX3A 3Q2DA 4QIUA 2O9TA 1W1TA 3NDOA 3W7JA 1W8SA 2B81A 3WLKX 3HB9A 5EMJA 4JIHA 2AOSA 3W7LA 2OU4A 1AJ2A 3NJ3A 4RZ4A 1TPH1 2QMJA 3LHWA 4BHYA 3EX3A 3A4XA 2QF7A 3PTDA 5IHRA 5C71A 5KEZA 4FOKA 2XZ7A 1YIXA 2ISSA 2B31A 4JTSA 1TRIA 3UU0A 1BVZA 3DCPA 5ABTA 3VI2A 3C0QA 1V02E 1U22A 4K8EA 2CLEA 4ILSA 2QMKA 3BO9A 1YADA 2YKKA 4EPBC 4LPCA 4ZB2A 1ZL1A 2FLIA 4RXGA 1DQXA 3UP8A 2H6RA 1RSCA 4W86A 3SCSA 4AHPA 3S6TA 4Q7BA 2YPIA 5FEXA 4I3GA 4RNIA 4C1NB 1DJYA 1EOKA 1YRRA 3KWSA 5H2ZA 1YNPA 3PS7A 5HQEA 3UY7A 3NO3A 1Q6QA 1WKDA 4HA1A 4M82A 3GXIA 3LXCA 3V75A 4NYYA 2QCMA 3UW6A 2E0PA 3W76A 4IISA 1JJKA 5M17A 3VIJA 3S1UA 3WJYA 3H4XA 4XD6A 4XVEA 1SFTA 1I2OA 1B9ZA 1GZ1A 2E5CA 4EX4A 2ACRA 7XIMA 1ZAJA 3K4WA 1QCWA 3PWIA 2Z2AA 3GSMA 4IPNB 4TIMA 4JQ1A 1EOMA 2CLLA 4IH3A 1XF0A 1MW1A 5LA2A 3ATZA 3EX2A 4LBUA 4KCWA 3WNMA 3TYAA 4H9YA 2YSWA 1CGTA 3IGHX 2PWHA 1H41A 1H5YA 3CZJA 1XGEA 3D46A 1JD9A 3CWHA 1I45A 2V2CA 2RAGA 4F40A 3H2FA 1YNQA 3WBYA 2EPKX 3GO2A 1YDNA 3PSWA 5FJOA 1OJXA 3SCQA 1D3CA 2NUYA 1JPMA 3M0VA 3WLTA 3T05A 4C1NA 2FVMA 3PZIA 2QCDB 3WD0A 2YXGA 4CU8A 4ZO8A 3BSHA 4JHMA 4O14A 3FDKA 1HZYA 2ZX6A 5AOUA 1U30A 5I23A 4YXGA 3GTHA 2W61A 3TE9A 1ECQA 1PYFA 3EXTA 1EPVA 5M03A 3RJXA 1JDFA 1VFFA 1JFHA 2G97A 1XIGA 2CNCA 3O6DA 5ECUA 1YLVA 4DZIA 1GOMA 5CZSA 4UMBA 2I5QA 1AZ2A 4LT9A 4M0XA 1OFOA 2WANA 3W53A 4PEEA 1EJ7L 4DXKA 3FFSA 2VX6A 3EA2A 4RPPA 4YMZA 3QV8A 4A8IA 4JPGA 5B80A 3HMJG 1KD0A 2W27A 4PCSA 3A9IA 1BAGA 1RQBA 2DP3A 2PDPA 1GEHA 4G7FA 2BVTA 4GO8A 2GQAA 1XP3A 3GVGA 2FTWA 1QASA 4AEEA 1RP8A 3QLDA 1J93A 4RDVA 1LWHA 3E5BA 1CW2A 3WNLA 4F0RA 3LDVA 1DE5A 4QSHA 2WBGA 5EU9A 3CC1A 1R47A 1X8CA 4B3LA 2XVPA 1VCGA 2QCDA 3THUA 3VD5A 2Q3RA 3PWAA 1GHRA 2ZZ3A 6XIAA 3UWVA 3YPIA 1ME7A 1F7BA 3LCWA 4LUIA 5A6JA 4UFJA 3NL3A 4PC8A 3LLDA 4OUIA 3SY8A 1HQTA 5KITA 3EOSA 2CZ5A 2JBMA 1OVDA 1GTEA 1QUMA 4LTSA 5C9WA 4S3FA 1FWEC 5REQB 2J7DA 1TMQA 2OCZA 4HTYA 4ZB5A 3W7OA 3ERPA 5CPLA 1UQZA 1NIUA 3NGFA 3A21A 4E0CA 5GQBA 4LU0A 3WLQA 4INFA 1TELA 2YL8A 3AYVA 4UZUA 4ADSA 3TXZA 3R43A 4O0KA 3IJ9A 4PCNA 3U7BA 1CTNA 3K8MA 4F3HA 4GYPA 4ORMA 3TQKA 2QVNA 3S0CA 4Q4PA 4ERIA 1G4EA 1RA5A 2XU2A 3H24A 3QPEA 4J7RA 3FLUA 4AD3A 3WFAA 3JZEA 4S39A 5F2GA 3DFSA 4FMVA 1WYIA 1PV8A 1K7FA 2C0AA 1KFWA 1M7PA 3LTSA 4A22A 1MEWA 5FF7A 3T40A 1E1EA 1S5TA 1H0IA 1X6LA 5JQ9A 2PF0A 2YB4A 3BGAA 3ARZA 4J3UA 3KVJA 1F9CA 2J7CA 2ZE0A 3E6EA 4FAMA 2OR2A 2ICSA 4JYEA 3IUDA 4GQGA 4K1WA 1KFBA 4PMVA 4BJHA 3TAOA 3PR2A 3A24A 3VPLA 3NO1A 5REQA 4BF7A 2HQAA 2RJHA 4GC4A 2PPGA 3XIMA 1PDYA 3TA9A 2J62A 1YHTA 1EA0A 1GPFA 5HMDA 3QR3A 5BOEA 3E5PA 3WMLA 4GLEA 4XD4A 3LNMA 1N8IA 2BY0A 2C14A 4FIRA 3M0XA 4P8VA 1JDEA 3MSDA 1TZZA 3BOXA 3IGXA 4DLFA 1CPUA 1MQQA 1EUAA 4YVXA 1YDOA 4GVHA 3CQKA 3E2RA 3T0AA 2J24A 1GJWA 4IPIA 4G9PA 4DZHA 3K5XA 5KETA 4MAZA 3R8GA 4MB1A 1Y5VA 4FNPA 4XZIA 1FHLA 4LOCA 3LXAA 3VDAA 2G3MA 3WO8A 3ZJKA 2V68A 2C8NA 3WK2A 3A47A 1WX0A 1QI2A 4GVGA 4CUCA 4UFMA 3OGVA 3PP7A 1SW3A 1HUVA 5CPMA 3VNYA 2QV4A 1E6NA 1TQJA 2ZZ1A 1I2NA 4H8UA 3BLPX 1RJRA 1DJQA 2ZA2A 3S5ZA 1DWAM 3DAQA 3SY5A 2PEVA 5BWFA 5CAHA 1VH7A 4HP5A 1RCXB 1D9EA 2XSAA 4QLJA 4DWDA 4E38A 1ZJIA 4KEVA 3WQ8A 3ZMRA 4AHOA 3WSUA 2JKAA 2XH0A 2X2YA 1NU5A 3MQTA 2XVKA 3FVDA 4XAYA 2Y62A 4AQLA 1P0DA 1LL4A 3QTGA 4L6OA 3PFMA 2XIOA 1VIZA 4X3ZA 4XTIA 2FYMA 3ZT6A 4QTGA 1XI3A 3ES7A 4TXEA 1P4CA 5G4EA 1KV5A 3PUDA 3R79A 3I3EA 4JIIX 4A8LA 3M0LA 3UZXA 1XDLA 1XIMA 4JEQA 1JI1A 4XD3A 3GU9A 3T8LA 1LG2A 1T96A 1IHIA 3Q58A 4L9YA 3B9DA 1LROA 3BSMA 3PZMA 1R5YA 4OKDA 3CL7A 1RUSA 4XUYA 3BC9A 3COTA 3O0KA 4MKNA 1XH0A 4GH1A 3H2EA 4O57A 1PKYA 1LQ0A 2C7FA 1OQFA 1C29A 1VCVA 2GYIA 3IVUA 4NQ1A 3OB8A 3P61A 3KVMA 5EPDA 1QW9A 3HIJA 4H9UA 2OGJA 2XYLA 3AHVA 2AAAA 2PWGA 1PWMA 3T08A 1VFSA 4LF1A 4ATLA 1XYFA 4DO7A 1VD6A 1Q5MA 3SI9A 3W1XA 3W7EA 4NZ1A 1FKXA 1K8YA 4MB3A 3OOQA 5K9CA 4ROPA 3EGJA 1UW9A 1CEOA 3PTMA 4UTJA 3R8HA 2A7RA 3FXYA 3ABSA 4HT3A 3VIOA 1K70A 1LOQA 1KQYA 2YYUA 4R7WA 1E72M 1E51A 3PC0A 1FWHC 4W8BA 4MLRA 3AZSA 1GQIA 4HHPA 1DJZA 1WDDA 3E1F1 4Q8QA 3C3NA 3VX1A 4E2DA 4M8UA 2DORA 4NJIA 4YLWA 4XV0A 2VX4A 1J0ZA 2ABBA 3IRSA 4TTUA 3ZOAA 1G4SA 4JTKA 4IUOA 4N6FA 4K68A 5MHBA 3QN3A 1J0YA 2QCHA 2EPNA 1MW0A 5AVHA 3SCOA 4EAYA 1S2UA 1QI4A 4M6VA 2JK2A 4OWGA 3WK0A 3QC3A 1C9DA 2R1PA 3F5LA 4UTLA 2DSKA 4O4VA 2XZ9A 5E0FA 1RLCL 2H3DA 1L2UA 3VNLA 3J7HA 1HIZA 2O92A 2DUZA 3W1LA 2WNWA 1FWDC 5EMLA 1CI1A 2FZ9A 1YTEA 3AIUA 1V8EA 1TPVA 5I6SA 3O16A 1J2WA 3GHSA 1M68A 1T40A 2W4XA 5I3IA 2ZFAA 4M7SA 3OYZA 5KZEA 1GQNA 4WZHA 3TC3A 2GUYA 4OU1A 1S2AA 3CH9A 1EJWC 4J2MA 1UC5A 3DERA 2Y7GA 1W9DM 4KETA 1VFLA 2VT0A 4MHBA 1UA3A 5D03A 4XZBA 2Z28A 3CHEA 1XYLA 3POHA 1JYWA 4S23A 2QV5A 3MANA 2QUVA 3M4HA 3GS6A 3W28A 4B15A 4KPLA 4R88A 5LIYX 4J28A 3SRDA 3W2LA 4DWSC 3QV7A 5I02A 2QUTA 3VZYA 1MEIA 3L12A 2P10A 1R3VA 3CAQA 1ITCA 4NZ3A 4UTWC 4PCTA 3G18A 1IYXA 1QAPA 5FL0A 1JCXA 1JUKA 2P0IA 4GYJA 4C91A 3IJDA 3MHUA 4QQ3A 3EEZA 1SZFA 1UZ1A 4IJCA 1E43A 3LCIA 5LHFA 4A6GA 4GABA 4KEMA 1PS9A 2UY2A 4UOQA 4MY9A 3GNDA 1QNRA 3WQ5A 4CN4A 2P0OA 2O9RA 1W2VA 2EG7A 1EXPA 1XH1A 2GL5A 4FR6A 3VNZA 1V6UA 3V5OA 4P8WA 3VNIA 1UWSA 4Z2LA 1G01A 3P84A 3LMZA 2OKOA 4C6KA 1WXJA 5IRPA 2REQB 3BAIA 4CU6A 2VEKA 3LTYA 3TNOA 2QJMA 3IIPA 1Q45A 3N25A 1G9HA 3H8AA 1TMHA 4EKJA 3OW1A 2EKGA 3L5LA 2PP1A 4PH6A 1X38A 2CWXA 3PN8A 4DUXA 3KOXA 2NV1A 1DORA 3VOIA 3GC5A 3UYIA 2BHZA 4O1CA 3EPOA 3HG4A 1RHCA 4EXBA 1OFRA 3E2SA 3LZ3A 2OQLA 3ARRA 1CXIA 4HYRA 1NEYA 1H7OA 4X2PA 1S5MA 1YDYA 4IP5A 2A3HA 1RVGA 2CLOA 3SM0A 3N19B 4NUWA 3BURA 4UTMA 5A6SA 1MO0A 3PZGA 1P7TB 9CGTA 1LOSA 1R9YA 3ARPA 1DJWA 4WSKA 4GVFA 3KEHA 3SY1A 2HE8A 4KFOA 1JEZA 4JTJA 3GE7A 5GJMA 3PVFA 3CZGA 2YDQA 1EBGA 1RPKA 2PDMA 1O5QA 3JZUA 5I07A 1XDJA 3MMUA 3ZLHA 2HE5A 3VFLA 4WRHA 4YWIA 4MADA 4MKVA 2REQA 4LUYA 1ZRQA 1QJWA 4NJKA 2F2HA 4ZB0A 4O54A 1XS2A 3G0XA 1V7AA 4MIMA 1R2RA 4PMNA 3WBWA 4M6QA 4QLLA 4IJRA 2FZMA 5I3DA 3A12A 1R87A 4ICMA 2CHNA 4X9YA 3OU8A 1LDCA 4LNCA 1OSEA 5E0KA 3U2ZA 5A1AA 2W3ZA 2V82A 2PAJA 2WJFA 1J12A 3ITYA 3AMCA 1UYQA 3G8EA 4P61A 4ZQCA 2QJNA 1BVNP 1KBLA 1ESWA 1OGBA 4BQ5A 4K2SA 4XZMX 4E4UA 1ELSA 3HFYA 2E8YA 1MWOA 4JTRA 1XGZA 3M0JA 1AH4A 1I2PA 1P7TA 4DUVA 3APYA 1J6OA 1U33A 2PI6A 4ZQOA 4H4IA 3V0UA 1J96A 3OVQA 1P0BA 1UR4A 3SJ3A 1TRDA 3M5VA 3HPFA 5JH2A 2I56A 1UPMB 4K8GA 1V03A 2VJXA 1V4YA 3SURA 2NSOA 1Q8AA 3WF3A 1ZZMA 2DDXA 4XK2A 1IIHA 2I17A 2ZICA 3WDIA 2J4GA 4C6CA 4EPDC 1JAEA 3KTXA 3WEOA 3L4YA 1ZAIA 3GFXA 4WDUA 5A8OA 1UR9A 1XLAA 3JVAA 1B3OA 4HNOA 2VHLA 2TYSA 3GKAA 1MDLA 4LY4A 4Y9PA 3I65A 3LPFA 3BLEA 2E77A 5C0QA 4OFCA 1CLVA 3D3FA 2BMBA 4XO6A 1Q66A 4YYCA 3LYEA 4Z2KA 3B8IA 1B9BA 2VURA 1FDYA 3KX6A 2J9YA 2GGEA 2WPBA 3AAMA 4B91A 2GLKA 4B3ZA 7TAAA 1MRAA 4JTFA 4GHRA 4U5KA 3RR1A 1L6SA 2BGQA 2OOGA 3EWWA 3VE7A 4JTEA 1Q65A 1BGAA 3MZ2A 4W9TA 3PPGA 2PP3A 4L9ZA 3QR1A 3MA8A 1XQLA 2GVLA 3GXMA 1EX1A 2ZC8A 3VINA 2EKCA 1VP5A 3QFEA 3GW0A 4YU1A 5HMSA 3AS3A 3V1PA 3FJLA 3V36A 2HCVA 5EGRA 5DCBA 1XM3A 2Z24A 4NNBA 1L6GA 3KW3A 2XIJA 5HNNA 3RMEA 1T0OA 3E2VA 2QEZA 3S6OA 1TJ0A 3KRBA 5LGZA 1N8FA 1DWHM 2DZBA 1P6WA 1AH3A 5I03A 1UCWA 3O63A 1KM1A 4WOQA 3ITTA 3KP1A 4KCUA 1S5VA 1ISWA 4YHEA 2GGHA 2VYOA 3VGHA 2XWEA 1W3TA 1LF1A 4Z2GA 2VR4A 4F4RA 2W6RA 4ZQRA 3TEVA 2GK1B 1XLIA 3MS8A 1UQYA 3BSGA 4M81A 3WNOA 2QCLA 3UG3A 2B7QA 4U3CA 3BGGA 1U83A 1ZB5A 1RQEA 2QDGA 1SO4A 2NV9A 3KBSA 3WH5A 3TC6A 1FWFC 3B9EA 3L2LA 5FJPA 3IIVA 3QV9A 3PAJA 4PEKA 2D3NA 4OIFA 2X05A 2Y2WA 4YWSA 3VCNA 4H00A 4LS1A 1I1XA 4QE4A 3GY1A 3TYUA 1U5HA 4DEFA 1PJ9A 5HXMA 4XZWA 2VRKA 4BI7A 2WB5A 4YCPA 2Q8XA 4QROA 4CD8A 1O95A 3MWAA 3TDFA 4DZ5A 3MJYA 3QYQA 1AQMA 4TMBA 4BI6A 2XGIA 3BK0A 3VMOA 2ZBTA 5LNVA 2E6DA 2YJQA 1HKIA 1UKOA 2F61A 2GPTA 1JF6A 4URIA 2D69A 1ML1A 3BJSA 2XISA 3M47A 1TQXA 3SADA 7CGTA 3WF4A 3FX4A 3LGDA 1UB3A 3NR0A 3T2PA 4PMZA 1L8NA 4G1KA 5HR6A 2TAAA 3OG3A 2GK1A 5FIPA 1XLKA 3AISA 2JKPA 4QSFA 1O5KA 3UWWA 4R27A 5I77A 2Q02A 3W7MA 1M6JA 3WLNA 1FP8A 4QJ1A 1RQHA 1F4AA 2WKJA 2O0TA 2PMQA 5JVLA 1W1YA 4J3SA 2OZTA 5A8NA 1FOBA 4LVAA 1R6WA 3NEHA 4H6RA 1SW7A 1PKMA 2VEIA 1OF8A 3A4AA 5DMMA 3TN5A 3VDBA 4HNNA 2PFHA 1V77A 1XD0A 3PBWA 3FK4A 4DUOA 1XKJA 2ZRVA 1KQZA 4GBDA 5FOOA 3FVMA 4H7VA 1CGXA 1H7XA 1VYSX 4PMYA 4FPSA 1W5MA 3R94A 3S5SA 2AMXA 4WDTA 1E55A 3FCPA 1TSIA 1D7KA 3N34A 1ZJHA 3AYRA 4D9PA 5D09A 5LYRA 1PUDA 2VOTA 3QGAC 2OQHA 3JRKA 1Y0EA 3IUHA 2RFGA 3BVJA 4WOZA 1EC8A 2OGYA 2HPMA 1XFBA 1SGJA 3VA8A 4MDOA 1SW0A 1WDRA 4M29A 1H7PA 5C9ZA 3AHTA 1K4HA 4I5RA 3LLXA 2CZEA 1YPIA 3USZA 3W02A 1HXJA 1TIWA 3CZLA 3W7QA 1G6CA 4CQDA 1UD4A 4AXNA 4F66A 3W6MA 5KZ6A 3V4BA 5KTLA 1TE1A 5DX7A 2PLKA 3MW7A 4LYQA 3NL5A 5LHEA 4GINA 2QJIA 3K4AA 4NJHA 5AB3A 4L56A 2IPGA 4UNKA 3WQEA 3NWRA 1IQ8A 3EPNA 1JQVA 5D2XA 2NUWA 3W70A 1BYCA 2J77A 2WQPA 3O05A 2RHGA 3LRLA 2CBJA 3Q45A 3W2KA 2VXNA 5EMMA 3PNUA 1RALA 3K8LA 1I2QA 3WL1A 1PB0A 3W82A 4D6IA 4DVOA 1KC7A 5FESA 3CUXA 1Q4NX 2PDFA 2VI0A 5D2VA 8XIAA 1Z9AA 1BF2A 5J5RA 1J5TA 3AMKA 3UESA 3W29A 3R89A 1X7IA 2CLPA 3G24A 3NNTA 5BRBA 2QUNA 1E3XA 1XXXA 3HGJA 4IHCA 1R0MA 5FD0A 1KM5A 3HGSA 2AKZA 3W87A 1NY1A 1SMDA 2L5HA 3NXFA 1MDRA 4JFVA 1TPC1 3L7RA 1FWTA 3VIFA 4I8YA 1QVBA 2RJGA 3DFTA 1CYGA 3HURA 2VFHA 1AFSA 2PGEA 1E4NA 1LP6A 1IT8A 1LRTA 1EL3A 4D6FA 2VGIA 1GVYA 1ONRA 1PZ3A 2ZZ6A 3RCMA 3WH7A 2XFFA 4PTXA 3ABZA 2J6VA 4QJ4B 1KLYA 2CERA 2OWWA 3RYSA 1XIJA 1GWJA 3IK4A 4GUIA 3WLJA 2XPKA 4LAMA 3MSYA 3VFCA 4ZXLA 1Q6RA 4BF9A 1FCVA 3LQLA 3R0UA 4E4FA 3TN6A 3FKRA 4NI3A 4OE7A 3SFWA 4GA8A 2NQ9A 1L0PA 3TTYA 1HGWA 1F3WA 1XIBA 2PLJA 1DE6A 3GUGA 4M19A 5DY3A 5FI8A 5HPOA 4EVZA 3EKZA 1JD7A 5IFPA 1ME8A 3VZXA 4PUWA 2D2HA 1RD5A 2ZWZA 4O13A 1DWFM 1V3MA 2GDQA 3TLLA 4YTRA 2RUSA 4Z1BA 5HJXA 1ZAHA 2BVWA 1Q6LA 2IMRA 3W71A 4Q3MA 4XUGA 3GHRA 1XPGA 3P2VA 1LLOA 2BGNE 2GSEA 3W01A 2BVYA 4JYFA 5FACA 4KH2A 4IQEA 3SUSA 4G56A 4AVNA 3PJUA 4R7OA 3UJRA 4D6DA 1GYNA 2PDUA 4NU7A 4AVOA 1K8XA 5BXTA 1JPKA 2BHUA 2R82A 1O60A 2Y88A 1LOLA 4AY8A 2IXUA 3K1GA 1EDGA 2WZTA 2GUBA 1VFOA 4AISA 4NAEB 3ZR6A 5CPNA 3CPUA 1VBGA 4MJZA 2Y8UA 3P5YA 2QS8A 3B03A 3RG6A 3DENA 1BYAA 1JPHA 2V81A 1ZSXA 2E6FA 1ZPTA 4XISA 4GACA 3AMDA 4UUIA 4IXXA 4QE5A 3RMJA 1UC4A 3MZNA 3PANA 4YTTA 2FGLA 2JIWA 3CXOA 1UIOA 3UNTA 2RDTA 4J3XA 5FL1A 1V08A 2QGHA 2J88A 3N4EA 3EZ4A 3SN4A 4V1XA 3N3TA 2OZ8A 1SJAA 4BCEA 3L4XA 4AYGA 2WWCA 3EB2A 3ONBA 2GOKA 5A2BA 1BQCA 1T8QA 4TU1A 2X0YA 1YYAA 2W67A 3S1WA 3OLEA 1GORA 3VYLA 4N9CA 2DQWA 5DBTA 4YTSA 3NQEA 1TPB1 3MC5A 1VYPX 3F5KA 2W62A 4S2BA 5CEWA 3GQYA 2TPSA 3NPWA 1CNVA 2WMHA 5JXQA 3A22A 3W72A 3B9AA 1GYLA 3UVAA 3MKVA 5I3JA 2BOGX 2XSBA 4UIOA 2Q09A 3FJNA 2HK0A 4A4AA 4GI9A 3F4VA 4NAEA 5F2LA 3SCPA 1WCGA 4D8LA 2NZLA 1KV8A 1BWVA 1YXCA 2C91A 2ZXAA 3B4UA 2DZXA 2PBOA 3EBVA 1LUCB 1QI5A 4ASTA 1QBBA 2HEJA 2FPTA 4FXSA 1WDWA 4R33A 4ICNA 4WJEA 2NLIA 3PBGA 2ZDRA 3NVDA 3KRSA 3TP4A 4TVDA 1NDVA 1QPQA 4EPEC 3GH4A 4HPGA 1RP9A 4H19A 4XBKA 2X1IA 3ZLFA 1LWIA 4IICA 1HFBA 2CCRA 3G5EA 4GBUA 2INEA 3HM7A 5T9CE 3UWEA 1VBRA 5DCEA 2I9EA 1W1PA 2DJLA 3N17A 1QPOA 4K8HA 3MV01 1W1B1 1YTDA 3EB4A 2G50A 5DMYA 1QO5A 3CMFA 5CGMA 1B3YA 3M6YA 2V9DA 2C1HA 2OEJA 1KR0A 1U1JA 4FXJA 3S47A 4PUEA 3SAZA 3LNPA 5FEWA 3ZZ1A 2I5IA 3VD9A 1WXYA 1L8PA 3P5ZA 5HULA 3M43A 1ZJBA 3C2YA 4GYKA 3B06A 3NPVA 5DT7A 2O7SA 4TQTA 4GJJA