1NDZA

Crystal structure of adenosine deaminase complexed with fr235999
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
349
structure length
349
Chain Sequence
TPAFDKPKVELHVHLDGAIKPETILYYGKRRGIALPADTPEELQNIIGMDKPLTLPDFLAKFDYYMPAIAGCRDAIKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVQAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDTTLYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenosine Deaminase
publication title A highly potent non-nucleoside adenosine deaminase inhibitor: efficient drug discovery by intentional lead hybridization
pubmed doi rcsb
molecule tags Hydrolase
total genus 144
structure length 349
sequence length 349
ec nomenclature ec 3.5.4.4: Adenosine deaminase.
pdb deposition date 2002-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1ndzA00
1RJQA 1V79A 2KAUC 3GRIA 2ICSA 4P5UA 1E9YB 4C6EA 1WXZA 4IFRA 3IPWA 4V1XA 2FVKA 4R7WA 3F2CA 3GG7A 4CQBA 3ISIX 4H9UA 1A5MC 1I0BA 4GOAA 3NURA 2GOKA 4G7EA 1UIPA 3RHGA 2HBXA 4H9VA 4H9TA 3MSRA 3PBMA 4PBFA 5HMDA 1PB0A 2RAGA 3E74A 4C6NA 1YNYA 3A3XA 3DCPA 4IQJA 2OQLA 4C6MA 1EJXC 1QW7A 3LGDA 2AQOA 1J6OA 2FFIA 3S2JA 1K1DA 4C6QA 1EJWC 1YIXA 2Z4GA 3MPGA 4HJWA 3NQBA 1RJRA 2D2HA 3NEHA 3S2MA 3T81A 3JZEA 1K6WA 3UPMA 4DYKA 4QS5A 3MVIA 3F2DA 1A5LC 2WJDA 2YZ5A 4C6KA 4WVXA 2ADAA 4NI8A 4UB9A 1EZ2A 4IFOA 4C6PA 3LY0A 2VC5A 4RDYA 1POJA 4F0LA 1R9YA 2IMRA 4LAKA 2QPXA 4CEUC 1KCXA 3AU6A 3TN4A 2GWGA 3GUWA 4EPDC 1XRTA 4XAYA 5A6TC 1JGMA 1FWGC 3IARA 3B0YA 1NDVA 4DIAA 4GY1A 2R1NA 1A4LA 4G7EB 4GY7A 2VC7A 3C86A 3K2GA 1FWHC 2AQVA 2HPIA 2I9UA 4B90A 2Z00A 1NFGA 2P50A 3RCMA 4F0RA 1RA0A 3K4WA 4EPEC 2GZXA 4HK5A 4DO7A 2A3LA 2ZC1A 4NP7A 1GKPA 3LSBA 3MKVA 1POKA 1UIOA 4PCPA 5FSDC 3GIPA 4JOMA 2F6KA 2OOFA 3K5XA 4J35A 3O0FA 1RK6A 3D6NA 4LEFA 3UR5A 4KESA 1KRCC 1EJRC 3G77A 2DVXA 3WMLA 4C5ZA 2Y1HA 3E3HA 3GTHA 4D8LA 2CZVA 4R88A 3LU2A 2UZ9A 4XD4A 1J6PA 3EGJA 4XD5A 1ONWA 5CH9A 4B3ZA 3OQEA 2VR2A 1FWDC 2D2GA 3WYZA 4J2MA 3E0LA 2Z27A 4IGMA 1O12A 4EPBC 3LS9A 4LAMA 4IFKA 2O4QA 4GYFA 4MUPA 1YMYA 4KERA 4WHBA 1M68A 2Q01A 2YB4A 4AC7C 4CQCA 4Z42C 3AUOA 5E5CA 1XGEA 2ANUA 2DVUA 4XAGA 2OGJA 2FTWA 1A5KC 3OU8A 4RZBA 4GZ7A 3F2BA 3PANA 3MTWA 1EF2A 3FDKA 3F4CA 4IH3A 4H9XA 4ERAA 3FEQA 3IV8A 4L6DA 2PLMA 4R85A 4WGXA 4CQDA 2EG7A 2OODA 3T1GA 3HM7A 4C6DA 4INFA 3UF9A 3IJ6A 2Z25A 4C6FA 4RDVA 3A3WA 1A5OC 4E3TA 4V1YA 1NDYA 4CEXC 3LNPA 4HK7A 4BJHA 4C6JA 1ADDA 2Z28A 3QY6A 1UBPC 4PE8A 4DZHA 2YB1A 2Z2BA 3GU9A 4PBEA 3UR2A 2Z26A 1FKWA 4C6OA 5LXXA 3TN6A 3E0FA 1ITQA 3CAKA 4XD3A 4PCNA 3OJGA 2R1KA 4CNTA 4L9XA 3TN3A 1NDZA 3TNBA 3EWDA 4DI9A 4IFKB 2W9MA 2QVNA 4YIWA 4ICMA 3R0DA 1O5RA 1FWEC 4XAZA 5FSEC 4LCSA 2OB3A 3IGHX 3N2CA 1P6CA 1P6BA 4DI8A 3UBPC 1PTAA 1J79A 1ZZMA 3OVGA 2P53A 3MDWA 4QS6A 1I0DA 3WZ0E 4HA0A 3MVTA 3GIQA 4IF2A 1P1MA 4QROA 3URNA 1EJUC 2BGNE 3CS2A 4GY0A 4H01A 1EJSC 3GU2A 4IG2A 5G4HC 1IE7C 4BKNA 4H9MA 1NDWA 4LANA 2Z7GA 2G3FA 1GKRA 2HBVA 4XAFA 4NG3A 4KEZA 2QT3A 3ORWA 2BB0A 2XIOA 1W1IE 2QS8A 4GX8A 4B91A 1KRMA 1ITUA 4KQNA 1XRFA 4LALA 2O4MA 4LCQA 4H00A 4AQLA 1PO9A 3RN6A 2UBPC 3HTWA 3V7PA 1V7AA 4C6IA 1A4MA 2AMXA 1YBQA 2PGFA 3B40A 2HNHA 4RE0A 4ERIA 3GTIA 2HPMA 2E25A 2R1LA 1R9ZA 1EJTC 3A4JA 1KRBC 2R1MA 1J5SA 1K70A 2VM8A 1V77A 1ONXA 3S2NA 3SFWA 5AKQA 1FWAC 2WM1A 1GKQA 3DUGA 4KEUA 4KF1A 1FWJC 3S4TA 2I5GA 4DLMA 4LH8A 4IG2B 3ID7A 5HMEA 1WXYA 4GK8A 4OFCA 1QXLA 3MDUA 4KETA 4LCRA 2PGRA 2FTYA 2Z29A 3ITCA 1PSCA 3ICJA 4KIRA 2Z24A 1FWIC 3MJMA 5HMFA 4H9YA 2EG6A 3BE7A 3PAOA 4QSFA 4QRNA 2R1PA 4KEVA 3TN5A 1M65A 3LSCA 3HPAA 1S3TC 1KRAC 4DNMA 3QGAC 2Q09A 1A5NC 3E38A 4IGNA 4ERGA 1YBQB 1E9ZB 2HQAA 4BY3A 4CNSA 1M7JA 4C5YA 3EWCA 4QTGA 4DLFA 3OODA 2D2JA 2E1WA 3E2VA 3LA4A 4B92A 1YRRA 4ZSTA 1RAKA 3GTXA 4CNUA 4DZIA 2VHLA 2GWNA 1RA5A 4I6VA 1EYWA 4C60A 1V4YA 3IRSA 4LAOA 2EG8A 4HK6A 3CJPA 2DVTA 3S2LA 1FWBC 1BF6A 3GU1A 4EP8C 1V51A 1VFLA 1FWCC 2FVMA 2PAJA 2PUZA 3FDGA 1FKXA 3OOQA 3QY7A 1HZYA 4UBPC 3T8LA 2WJFA 4XD6A 4EPKA 1R9XA 3GTFA 1UMLA 2WJEA 1XWYA 3PNUA 4H9ZA 4GBDA 4I6KA 1DPMA 4RDWA 3URBA 3SO7A 4G2DA 3URQA 1RJPA 4GX9A 3URAA 2GSEA 3KM8A 1FWFC 4C65A 4J5NA 4C6LA 3B0XA 4M51A 2Z2AA 3QY8A 4GXWA 2YXOA 4GC3A 3O7UA 4F0SA 2VUNA 4LFYA 3QGKC 3PNZA 3IACA 1RK5A 3AU2A 3RYSA 4TQTA 1EJVC 3F4DA 4RDZA 4ZSUA 3LGGA 4C6BA 4C6CA 3DC8A
chains in the Genus database with same CATH superfamily
3K46A 3ITOA 4UFLA 1UMYA 3AZTA 4IPJA 1AMYA 1REQB 2BS9A 1E9YB 1EO5A 3R7MA 1XYMA 4MMWA 2YYUA 1TA3B 5FAJA 1LRTA 2IPWA 2VNCA 2HBXA 2PLCA 2V82A 2NLYA 4ES4A 1UQZA 1ZTVA 3WLKX 2ABAA 2E9LA 2F38A 3W7JA 1OYCA 2QF8A 4JFUA 1FHUA 2QLYA 5LZLA 4D6IA 4UTHA 2NQJA 3KX6A 4JZ5A 4ATDA 3TSMA 1B30A 4UQCA 4GA8A 1ME8A 3W6LA 1K6WA 1ITXA 3UNDA 4DYKA 1QNRA 1E1CB 4I7VA 4AFYA 3UWUA 2YCIX 3V5OA 3W6MA 1JUBA 4JTDA 3RXZA 2DUXA 4AXKA 4US5A 2VP8A 2QYGA 3FAXA 2WZHA 3KUMA 1A5SA 1NDVA 2GJNA 4RCXA 3QSTA 5LHEA 3WQWA 2VC7A 2XVNA 3A4AA 3LRMA 1EPVA 2QUNA 4HB7A 1UD2A 2IKIA 4J3VA 4AZ5A 4XBJA 3GXPA 4GQBA 3LCGA 5CPLA 4PEEA 3IVUA 3N12A 1U2YA 2JK2A 2G50A 1LQ0A 1Q6RA 4IX2A 3W2JA 1ZBCA 4AY7A 2WWCA 3MT1A 2G96A 4NAEA 2R24A 5T9CE 4HJFA 5FIPA 3MMTA 1RVGA 4GVGA 2CKRA 1EF3A 5CZSA 2PGWA 4DJDD 2V5LA 2VFGA 2QCNA 3LU2A 2JEPA 4Q4QA 4MZYA 4XD5A 1QI0A 1L0PA 1C91A 3R8HA 3PTKA 4B3ZA 1PIIA 4RXGA 3KWXA 4KKXA 1Q85A 1M04A 3AIBA 3G2GA 3W76A 4PMNA 4PUJA 5C2GA 3WL1A 4ECLA 3TROA 3WDJA 4NNCA 4RZBA 4MADA 3PANA 3MTWA 3SCQA 1VRXA 1Y0EA 4IH3A 4H8NA 5K4XA 4WX2A 3CC1A 1TJ1A 1DOSA 4MG4A 2VD9A 2QCDB 4HU4A 2YBUA 1SO4A 1UR0A 1WZAA 3IJ6A 3L4WA 4HNVA 4P7OA 4NZ4A 4L5ZA 4IP4A 3WH8A 2Y8KA 3V4BA 1UD4A 3GNDA 3EEGA 2PCEA 3IVTA 4MYAA 4TX8A 3V0UA 2QIWA 5CZ0A 2XSBA 5A2BA 2HE5A 3UY8A 3WJSA 1ITQA 3H24A 4ZE5A 4CNNA 3NQ6A 3QPYA 3B9EA 3N29A 3O8AA 3WBXA 1HG3A 1UR1A 1ITCA 4OOZA 4O4VA 3WQFA 1DIDA 4LS2A 2Z7KA 4LBSA 2X0SA 2J27A 1WDSA 1R3QA 5J8LA 4MNKA 3VOIA 2DUAA 4QROA 3WIJA 3A5FA 3CS2A 5A6JA 3WQ4A 3ITLA 2JE8A 3A47A 3H2MA 2EXOA 3BAWA 3GK0A 3M16A 2AMGA 4LNCA 2R14A 1VLIA 3W23A 2FPTA 4HNTA 2PLJA 3EKGA 2V30A 2VDGA 4JYEA 1UP3A 3C0SA 4TUFA 3CB8A 3WBYA 3EAUA 2V5KA 1YTDA 1F7BA 1PAMA 4ZO8A 4GNVA 3WLQA 2E09A 2PDQA 1E0UA 2R91A 1U5JA 4V28A 2D73A 1WKDA 1A3HA 1XD1A 1UH3A 2HNHA 5AYBA 1X6LA 4HNCA 4N6EA 1P6WA 4XTDA 7XIMA 1IEVA 1S2UA 3NCOA 3AZSA 3PSWA 2H8XA 5G5IA 6CGTA 2WC3A 3WH7A 2WM1A 4WDWA 4XBKA 1SJAA 2GK1A 1LOQA 3PJUA 2BXYA 2SFPA 1MDLA 1X38A 3ALGA 3GXMA 2FPVA 1RQHA 1IWPA 1H2JA 3W7DA 5I7GA 2WSRA 1W5NA 1HT6A 4CCZA 1LJYA 3OO2A 1T7LA 3LSCA 3MANA 3PZTA 4OGZA 3C3NA 4DZ5A 3LTSA 1K77A 4WY0A 4DXVA 1MSSA 1SVDA 4GI9A 2YCJA 3VNZA 1LUCB 4I9AA 4GYPC 4HPHA 1VPYA 2GVGA 4QG6A 1BAGA 4PA8A 4PUNA 1MZHA 3TJ4A 1SSGA 4CNUA 5BOFA 2VWSA 2RH9A 3W73A 4F48A 1EGMA 3CQ0A 3KFTA 2W6RA 4RE3A 2GL5A 3WNKA 1NELA 4NHVA 4E2VA 3S3GA 1MW3A 4LAOA 1ALDA 1KTCA 1IT8A 5D04C 3CUIA 3PBYA 2VC6A 2Y6ZA 1UKQA 1FWCC 2PAJA 4TX9A 5ECUA 4PMJA 4QFUA 3BW4A 1YHTA 3SM0A 1ZP3A 2CEQA 3NDOA 3CAVA 2EHHA 2WVTA 1DORA 2PSNA 3UY7A 1J0JA 3BLIA 4QR6A 4YTRA 3AS3A 5HWJA 1XYAA 3GZ3A 4F40A 2YW3A 1GYMA 1HP5A 4IMEA 1QTWA 1LTDA 1KFCA 3PNZA 1L9WA 2QW5A 4O0QA 3F4DA 1CXIA 4XG1A 1QI5A 3UWQA 2WMIA 3KZSA 2DT1A 1LL4A 3SN0A 1PWMA 3IIXA 1R3TA 4R9OA 1H5YA 3R8RA 3L0GA 4DJED 4E6MA 1UUMA 2PDWA 4GO8A 4E4FA 3ISIX 5HA7A 1XYFA 2XH2A 1XKYA 3F4NA 3N11A 4FR6A 3W71A 2EGZA 4G7EA 3GNNA 3LMZA 1DEDA 4AF0A 4CU8A 1R30A 2AAAA 2VFHA 1MWOA 1VAHA 3GW3A 4IIHA 3AHTA 4C6NA 3FXYA 3F03K 4C6MA 2J77A 3LCXA 2YDQA 1DWFM 5U7SA 4MY1A 3PZ9A 2BY3A 1HO4A 1XIBA 2BG5A 4PB3A 3EWWA 1EZ2A 4Z1YA 1P7TB 3ZVIA 3EEZA 3WENA 5SWUA 3KTXA 1JYVA 3EOEA 4ZL1A 1XBVA 1Q65A 4JFVA 4H7VA 2PBGA 3H7VA 2WVVB 2XDFA 4HMEA 4S3KA 3V5CA 3WH6A 2W62A 4BWLA 5DBTA 3S6TA 3WNLA 4TVUA 2P50A 2PS2A 1MO0A 3RO8A 2PTYA 5I00A 3VNIA 1T0OA 1JYWA 4XZNX 2OSWA 5J5DA 2YLLA 3NSNA 1JZ6A 3CT2A 3WDRA 4Q4RA 1LBMA 1W2PA 3ONBA 4H6RA 2EEXA 4R88A 5DLCA 2J9YA 2P0OA 3P61A 3MUZ1 2GGJA 1SFJA 2XSXA 3BAXA 3ABQA 3KWSA 4WKFA 3RCNA 4IFKA 4AB4A 4A4AA 2HK0A 4OUIA 3HOJA 3WD4A 1JUEA 2NXIA 2J66A 2BOGX 5MKGB 3VKCA 1QRQA 2C19A 4LGXA 4U4MA 1XGEA 1CDGA 2F2KA 1A5KC 2HNEA 3UVAA 1B9ZA 3F4CA 3ZT5A 3C2FA 2OU4A 3O06A 1W9BM 2VZOA 3TYZA 3UF9A 3FEMA 3JZUA 4XSLA 3B0VC 4JN6A 3N73A 4GLEA 5LIUX 2PPGA 4E3TA 4RUBA 5M17A 3FX4A 4DZHA 6TAAA 3ES8A 3NQEA 4PBEA 4PBGA 1AJ2A 3TAKA 5TQLA 3ECQA 5ABTA 4GD0A 4RV8A 2R1KA 3TN3A 3GY1A 2PU0A 2PDKA 4CN6A 2ZXQA 3VD4A 5AYXA 2F7FA 2WMFA 4XK2A 4O4WA 1E15A 2O7SA 5HDRA 4FK9A 1IYXA 4Y8EA 1UH4A 3W7KA 3BLOA 2OLHA 3AWOA 1KBKA 1X1NA 1Y5XA 2YCEA 5A6BA 3NXLA 5F2GA 4JPGA 2V5CA 5D05A 2CU0A 4H9MA 4NJGA 4LANA 1E9IA 1UZ1A 2ZRXA 1X8FA 1CLVA 2WBKA 5M1TA 4EE9A 2WQDA 1GVFA 5H8UA 2PC4A 4KQNA 2REQB 2PU1A 2V38A 3HTWA 1V7AA 3A12A 3M43A 3VOGA 5FJUA 2OXNA 4WZHA 4U5KA 2YCLA 3T42A 1EEPA 5E6YA 4WOQA 3TYDA 1E73M 4KS0A 2E28A 4BI6A 3QMTA 1U5HA 3RX4A 1ONXA 4QEEA 1Q4WA 3P8IA 1JRBA 4IISA 1WKEA 2IKJA 5CSUA 1B5TA 2ZZ2A 1K8ZA 1ZJAA 4KMQA 1S2CA 3PJWA 3OLEA 3SUVA 4GUHA 4KWOA 4PCFA 1VFMA 3PTDA 4JFWA 5EBUA 5GJPA 2Z24A 2YFNA 4H9YA 2EG6A 3LM3A 4Q7BA 4FF5A 4AMCA 1VC4A 4HNUA 4CUCA 4CNOA 1VPQA 1TVLA 3HPAA 1F4HA 1SO6A 2ZQ0A 4A6GA 4UIOA 4E2BA 1NOWA 2WZMA 1PEZA 1BVZA 3H23A 2QNEA 1VIZA 5IFPA 3O0KA 1DWHM 4GIAA 1WBHA 3WD3A 2IKHA 3S8HA 5I3DA 5LIKX 4U33A 1P0BA 2NX3A 4AH7A 4DZIA 4H2HA 1B57A 1M6JA 3CL8A 4ADUA 1JL8A 1IEWA 3N17A 2GWNA 1S5WA 1BSLA 2ZRUA 1JYXA 4ZQMA 1NOFA 1TV5A 4NILA 1FWBC 4MY8A 1OIMA 1Q6LA 1BF6A 1W3TA 1W6TA 5AC4A 1HJUA 3VIHA 2QUVA 4MJ2A 4ZXLA 4GZJA 1FOBA 1G94A 3PZGA 2CYGA 4IIGA 1XWYA 4G6CA 2V8ZA 1KV8A 4UFMA 3LK6A 3FA4A 4NF7A 1YXCA 1W9PA 2PDCA 8TIMA 5I23A 2P3ZA 4UNIA 3KM8A 3EWZA 3T40A 5LYRA 4FNPA 3CZGA 3TAOA 2HEJA 3LZ3A 2DZVA 4GXWA 3U7VA 3CWNA 1OGSA 2G8ZA 3MI3A 4UTTA 2O9OA 4QNWA 4JIPA 5BYWA 4C90A 4UUIA 3F1QA 4S2BA 4FIQA 3FGCB 2C7FA 3S5OA 2XIMA 1SW0A 3VGBA 1MW1A 1RJQA 2VCAA 2H3DA 4J3SA 1TWDA 2FVKA 1JDCA 1MEWA 3F2CA 5E6ZA 2V2CA 2YBVA 2WO5A 3T0TA 2INZA 2YBTA 4C7FA 1T99A 4TX6A 5HMDA 1PB0A 3EWUA 2BY0A 2CLPA 2YYTA 3GH4A 3NSXA 1ZAHA 2PLKA 1JPDX 3DCPA 3WDQA 4E8CA 5BXPA 5GQBA 2AQOA 3VNDA 1ZB5A 3EX2A 2DW6A 2XZ9A 3EDEA 1E3ZA 1YIXA 2NXGA 4JHMA 4ATWA 1IZKA 2V3FA 2YDAA 1WOAA 1ENUA 2UV8G 5DXYA 2PFHA 2R6OA 4KW2A 1VJIA 1WDRA 3C0LA 4HPJA 1PTGA 4HNOA 1SZEA 1UROA 4ZOCA 1JRCA 2ALDA 4H3DA 2WZTA 4XISA 4NAFB 1B3YA 1XIHA 3NO1A 2WOQA 3R4IA 3V35A 3SQSA 4LT9A 2VWTA 3I6EA 3IJ8A 4XAYA 1KXTA 1NU5A 1FWHC 4S3DA 4B90A 1XYLA 2ISWA 3W01A 4R33A 1C9DA 5TD4A 4HK5A 2A3LA 2GQ3A 3L4TA 1ECEA 1C7TA 3S47A 2BY1A 1Q45A 3W7NA 4LBRA 4J35A 3VZYA 1P43A 3HQOA 3JVAA 2Z0IA 1MRAA 1TKKA 1PKYA 4WK9A 3O6AA 1O60A 1WDDA 5A6MA 1TWIA 1QWKA 3W7RA 3G77A 2QAPA 2W92A 3W37A 2QHAA 3TLLA 3UERA 3RCYA 4O16A 3PFRA 5C9RA 2ZZ1A 4HYWA 1G4EA 2ATMA 1EGZA 3OQEA 2HXTA 2BX7A 3ZWTA 2IQ0A 1R3SA 4UFKA 4PCSA 4N2YA 2WVSA 4R53A 4GYFA 2Q01A 4I7UA 5IHRA 4LVGA 3B9AA 5E5CA 5XIMA 5D38A 2ZDSA 1DJYA 3DESA 2FLIA 1VRDA 2XVGA 4ZENA 4L6DA 4AD4A 3RF9A 1GVSA 3KDNA 1RCXB 3UZYA 4KCUA 4K68A 2DW7A 3LD5A 1E6SM 1EC8A 4BEQA 3TX9A 2IW0A 3GG1A 4TXEA 1HIZA 1HP4A 1A5OC 2YKKA 5MF5A 1XJBA 4C6JA 3QY6A 4WDXA 1Q6GA 3GR7A 2J79A 1CLXA 1XR2A 4FPSA 4QM1A 3W1UA 2PDXA 1BWKA 2C3ZA 3A23A 2IPJA 4QG9A 3GX9A 3NL3A 2HJPA 4M7SA 4O53A 4YIWA 1FWEC 1XX1A 3KL0A 2OB3A 2YGYA 3UBPC 6REQB 1A3WA 3FKKA 4QS6A 3VI2A 2POTA 1Q8AA 1LBLA 2ZTKA 5EMJA 3ARUA 1RH9A 1VYSX 5DQPA 2A3AA 3S9ZA 3EX3A 1ZY9A 1GORA 1WZMA 2VX5A 3QFEA 3A3HA 3U57A 1TV4A 3IWPA 4ICCX 1GVQA 3TTSA 2Q3RA 4GWEA 4JEJA 1CCWB 3FA3A 5HPCA 3N2TA 3OVRA 2FJKA 3KVLA 3WF1A 1NWTA 1F6KA 5A1AA 3Q65A 2G3NA 1EDQA 4LCQA 3E2RA 4AQLA 1MEIA 4NJHA 2QGYA 1WDPA 5KINA 4ERIA 1TV2A 4E4PA 4EK7A 2VTFA 3LOTA 4P61A 2PWFA 1PZ2A 4H04A 4RZ4A 3M0MA 4O19A 1K70A 1RPXA 4YMZA 3LCIA 3DFQA 3KE0A 3S2NA 3AI0A 2OWCA 1QASA 3OLIA 2CBIA 1JCLA 2CC0A 5JXQA 4DLMA 3UU0A 4J4KA 2P1FA 2YPIA 3WN6A 4B16A 4CGTA 3USZA 2Z29A 1OWQA 3ITCA 2FDSA 1I1XA 3NM3A 4F2BA 2DH2A 2X1TA 3R12A 3IGUA 1D7FA 2NW0A 3LHTA 4BZYA 3BQ6A 1AUSL 1UPPA 4LSBA 3TQKA 4QBXA 3N2BA 3RRXA 4WLCA 4M82A 2ZX8A 3QGAC 4TV5A 5C9ZA 1XFBA 2EPMX 5CG0A 4ERGA 4JDBA 3LM7A 1R6WA 4DLFA 1PHQA 3TYUA 2ZDRA 2HV5A 1R7AA 2ZE3A 3GTXA 3PULA 1PHWA 2Q8LA 3P5ZA 1Q7QA 3PZNA 3VNJA 2QAFA 3KZPA 3QGVA 5DCBA 1CEOA 1B3XA 2ZWYA 1EYWA 4JY8A 4LS1A 1UP2A 3KEHA 2VFIA 5K4ZA 1RPKA 3C61A 4JX4A 3CQKA 4R9XA 1TPC1 3LZ5A 3EB3A 4UBPC 3H2AA 3MCMA 1JF5A 2I9EA 4RV3A 1F6PA 2J9XA 1JPIA 3VFLA 3GHRA 1LLOA 2PP3A 3O6YX 1KXVA 2I5QA 2ZUUA 5D2XA 2E8YA 3WLPA 1ZLPA 3V18A 2V3DA 1TELA 5CEWA 1UWSA 1XYBA 3B0XA 3MMWA 3NQDA 3E02A 2XFFA 5XINA 3CHEA 1HVXA 3T7VA 4W5UA 4XO7A 3CTTA 3HQNA 1KLYA 4W8LA 4C1NA 3DBNA 5HPOA 3D46A 1GGOA 4IJCA 4LVFA 3TA9A 4QLKA 4C6BA 3ERPA 1P0KA 3RM9A 2ZZ5A 4HA4A 2GFTA 4S23A 2NSXA 3LQLA 1SJCA 2NQLA 3GNRA 2HVOA 1H09A 3Q4DA 1FWRA 3CB3A 4EANA 1TVNA 1GZJA 1KM4A 2E6AA 2X0HA 1YADA 5DXXA 3B8TA 4F9JA 3T2QA 2PGEA 1VEPA 3OHIA 3BGGA 4QJ3B 4KGJA 4TOQA 4S3JA 2OZTA 1IXOA 3P8JA 3A9IA 2RJGA 4DF1A 2F9RA 1LORA 1Z44A 2Z1WA 1XGDA 1TTJA 1B4KA 4WXYA 2WAGA 3EDKA 1KM5A 1J6OA 2HCVA 4PRTA 3VINA 5I03A 4OBSA 1O4UA 1VYPX 1JFXA 3S2MA 1KWKA 4D9PA 3L2LA 5DT5A 4IM4A 5A8PA 4E8DA 3TONA 1RBOB 3Q37A 1BYBA 1R3WA 1J93A 4QGCA 4TIMA 3DBPA 5BMXA 2VEPA 1BXBA 2A3EA 1TE6A 1WP6A 5F2LA 3RK8A 5A6TC 3UFYA 1OFDA 2NWRA 4ENLA 1XLCA 4QAWA 3SBFA 4MFEA 2QZRA 2OLSA 1C3FA 3LN3A 5HK4A 1EDTA 4ZFMA 1PX4A 4F0RA 1RA0A 1E70M 3UW6A 4DO7A 4GO9A 3IJIA 1IWBA 1H61A 5TIMA 3OHMB 3W83A 3R94A 1OFOA 1S2AA 5I2UA 1G4TA 3H55A 4AZGA 3HURA 2WCGA 2DVXA 2ZRYA 3L5AA 3WX7A 1EQPA 1HNYA 1IEIA 9XIAA 3JU2A 2KZHA 5A6KA 1SGJA 5CH9A 1SZGA 4OT7A 1VBUA 3G8RA 3SR7A 3WQ6A 4LV9A 1W37A 4PSPA 3TR9A 2C14A 4KGLA 1E9LA 4LAMA 3LBOA 4MUPA 1NTHA 2P88A 3GXFA 1EWDA 3CWOX 3VIKA 4DJDC 4YLWA 2FTWA 3BW3A 1JUKA 1VBJA 1N82A 3VA8A 4UMBA 5CKSA 1E1EA 1EP2A 3ENLA 3IV8A 3WELA 3N2MA 3MSYA 4WGXA 4CQDA 2EG7A 1OF8A 2PDJA 4RW5A 4DNHA 4HU0A 3NZGA 4JTLA 2C13A 4ZOEA 3O63A 3HPXA 3TYCA 3UETA 4CEXC 3CQIA 4MDPA 5FF2A 1OD8A 1O1HA 3G1SA 1PUDA 3F5KA 3S42A 5LXXA 1JZ7A 1EXBA 3IV3A 2W9MA 3T0BA 3C0QA 3L65A 1BF2A 1VCFA 1Y8BA 1PCKA 4G1NA 4ALDA 3GAYA 1CWYA 4JYFA 1M1BA 2JQXA 5CGQA 1I0DA 4RLIA 3KCLA 3NZRA 1XISA 4JS3A 3NQAA 3QJAA 3WNPA 5CBIA 3M0YA 3ARTA 2WLYA 3LB0A 1DBTA 5FEZA 1IR2A 3VNLA 2Z7GA 3BOFA 1HKWA 1GKRA 2EAWA 3BGAA 5CAHA 3L68A 1MNZA 3W1AA 2ZBTA 1CGVA 1OK6A 2WLZA 4N4QA 3ABZA 1W1IE 2QS8A 4W7WA 1EKOA 2PP1A 2OG9A 3AXIA 4WY0B 1UPMB 2A3CA 3P82A 4S3BA 2DP3A 1G7UA 1FP8A 1THFD 2FHFA 3SECA 1M03A 3FSUA 1JGIA 1XLLA 3NQMA 2C71A 2XUCA 4W5ZA 5BXSA 3UG3A 4M6QA 1LOSA 5LNRA 3G0XA 2VI0A 5I3JA 1EJTC 1HKJA 1X96A 3AAMA 2BGSA 4P7QA 2Y85A 4FLSA 4IJBA 1TQJA 2IPFA 1H7NA 3SY1A 3BL3A 4LUSA 5HQMA 3S4TA 1SW3A 3PPHA 3K8MA 1RUSA 3MZNA 4EXBA 4Z2IA 1OGGA 3Q94A 1QO2A 1PDYA 3WLRA 1ONEA 4YTQA 4PZVA 3UEQA 2Z1VA 3AHZA 4AY1A 4NRSA 1XQLA 4HN4A 4O0ZA 3PPGA 3UQNA 3R11A 4JL1A 1M65A 4WOZA 3AYVA 2WKJA 3C0JA 1AQ0A 1E6NA 4NZ1A 1QFEA 3M5YA 2QF7A 3ITXA 4D6FA 1VGAA 3DYPA 5GPRA 3DFYA 2HQAA 1M7JA 4L4PA 5M3WA 4ZO9A 4O57A 3LA4A 1UKPA 5DCDA 3R43A 2NWSA 4GINA 3NFUA 2XFRA 2O9PA 3NPXA 3UWYA 1KA9F 4PUKA 3QPEA 3KP1A 4EAYA 2VHLA 4Y9OA 3FJLA 3LCLA 1IF2A 3I7RA 1DJGA 1QK0A 3CIWA 3GW0A 4HQVA 4UR9A 3SDOA 2HE8A 1RCQA 1AZ2A 1GTHA 1K9DA 2O7QA 1V3LA 5I79A 1REQA 4Q6XA 4CCDA 3LXBA 4NZFA 4FXRA 3P0WA 3FSTA 4OVXA 1W5MA 4S3EA 1E0WA 1TTQA 2OKTA 2YXXA 1I1WA 1SFLA 1TA3A 1ZRQA 4D1IA 2PD5A 3GVVA 4FHAA 2OQHA 4RDWA 3W7QA 2Y7DA 5CSYA 4DVOA 1R85A 2BHZA 4GUIA 3URAA 2GSEA 3QKZA 3NGFA 3V1HA 3FXGA 1QHOA 1UUQA 4MWAE 2YCKX 4P7RA 1XM3A 1SMDA 4UMCA 4BHYA 2DSZA 3AU2A 2V2DA 1FBAA 3OZPA 4O1BA 4N9BA 4DF0A 2YDRA 1L6FA 2OSYA 1CXKA 3W9ZA 1SUXA 1XD0A 3FNDA 5FJIA 2BOFX 1D2KA 3CV6A 1E1CA 1J0HA 1XFCA 1XLAA 4PB5A 1UCWA 2YL8A 1DHPA 3KS5A 4O11A 3GVQA 3QOMA 1AW1A 1WV2A 3ZOAA 1Q6QA 3SURA 3IJLA 3NURA 4DM2A 1VZWA 3LI1A 1G1YA 3MZ2A 3SCNA 7TIMA 3EYPA 1ICPA 2F6UA 4M8UA 4TU1A 3ZQ9A 3PUEA 5CPOA 4AZ7A 9CGTA 4NXKA 1EP1A 3VOFA 4DJEC 2OQLA 3DERA 3H2OA 3RX3A 3EDJA 5CJ5A 2PEVA 3NEHA 2WNNA 1PKMA 3GVWA 2WCAA 3K13A 4QS5A 3TCSA 5KITA 1HKMA 4UTKA 4H6KA 2D69A 4QJ5B 2OLAA 1GW1A 4MAVA 5D03A 1POJA 2YA1A 7REQB 3LENA 1NF0A 3TN4A 1AVAA 1FWGC 1TZZA 3VDAA 4UNKA 5PTDA 1WQ5A 3AOFA 2V9DA 3UYCA 5CZTA 1VFOA 3CV2A 4MPKA 4UWMA 1QPNA 3BARA 2OEJA 2X1RA 2QCDA 4A05A 3K5XA 4GJ1A 4DWSD 1CGYA 4HNNA 1WPCA 4ROQA 1T5AA 3H7RA 4LF1A 2E9MA 3UR5A 3UCDA 3GXTA 1KGUA 2Y1HA 3E3HA 3MJYA 5CLWA 5CGTA 1SR0A 2QGHA 2VEKA 4M0XA 1ONRA 2DSKA 1ZENA 3UG4A 1V8EA 5CSRA 2ZYFA 2GSJA 1OYBA 3GXNA 1KCLA 2VEFA 1O12A 5AHNA 3LS9A 1YQ2A 3ELFA 1M3UA 3N4EA 1E1FA 4JICA 1WKYA 2V5DA 3F2BA 1QOXA 3BV4A 1V0LA 3KCJA 4TO8A 4MWAD 1NM9A 3MSDA 2IPGA 1A5CA 2ISVA 2ACQA 2OYLA 3W53A 5LGXA 4LEQA 2QCGA 1OK4A 3DFPA 4Z1CA 1O5KA 3W87A 4JQ2A 3O15A 1W9VA 2WMGA 2PE4A 4IIBA 4HPXA 4MJ4A 1LT8A 1M9HA 3E9AA 4O1CA 3HMJG 2D2OA 6ENLA 1AMKA 4AC1X 2XINA 3UR7A 1TPH1 5D02A 1SPQA 2VC9A 2D1ZA 2CZ5A 1TPFA 3R1ZA 1QO5A 2E40A 4M24A 1WO2A 1GQLA 2CXGA 3BG3A 4L61A 1ZS2A 2C15A 1O1ZA 4E2OA 3UPBA 4MB4A 3QTGA 3SGUA 1K8YA 3W2KA 5K3VA 3MVTA 1UC4A 2GJPA 4GISA 1IE7C 5DMNA 2FGZA 3NVDA 4H4IA 5C6MA 1G4SA 3L66A 2RFGA 5I77A 1G5AA 1A5AA 1OFQA 3S6OA 1TIMA 3WQCA 2QT3A 3EB2A 3EMCA 3D3FA 3WBAA 2X42A 4Q8OA 3L4XA 1UZHA 2DZSA 4K6AA 3BCDA 4Y9PA 3LHVA 3NO3A 4J9JA 3EOSA 2HMCA 1FCUA 1TG7A 3H54A 6TIMA 7A3HA 1BQGA 1R9ZA 1H5VA 1AG1O 2X40A 3LV6A 1EIXA 2XPKA 2BV9A 1ICQA 2XJ7A 1ME7A 1SSDA 3T6CA 3DFHA 1Z42A 3ID7A 2P5NA 1HVQA 4DXKA 4NKCA 4MTVA 1W9XA 5MHBA 5CBJA 3ICJA 3DYOA 3REQB 1MDRA 4E38A 4YCOA 3PC0A 1DL3A 2GQ9A 4F0HA 1I45A 3G1RA 2V0TA 5E70A 1Z7AA 2WPBA 1B3ZA 4NU7A 2ZUTA 1LWJA 5AZ1A 1GW9A 3BLLA 3TMQA 4QQUA 3V16A 5BXTA 3BMXA 4I8DA 2PZ0A 1Q6EA 2PDYA 4J1OA 4UQEA 2WWDA 3CV7A 4FALA 2P8BA 1HF6A 4PMDA 4QTGA 3P67A 3W28A 1LG1A 4L80A 1A47A 2OWXA 1JNEA 1B9BA 4D6CA 2QCCA 4W9TA 4C60A 1V4YA 3IRSA 3L5LA 2PDBA 1XLIA 4AG0A 3K8LA 3WUBA 3NQCA 2J7HA 2QQ6A 1V51A 1VFLA 1QATA 2VQUA 4NNBA 1JAKA 5I3HA 1IXQA 1W3HA 2PTXA 3GS6A 3IK4A 3POHA 3SY5A 4LYRA 2WMJA 1DJIA 1BVWA 3S83A 4C91A 4JBRA 3C56A 1JEZA 4G2DA 3M7WA 5H2ZA 3EKZA 3EA2A 4J5NA 3T0CA 2PWHA 3S0CA 1XC4A 4O13A 4RX0A 3DXIA 3W38A 3BMVA 3F4WA 4CKQA 1BG4A 4DAFA 1DVJA 4KPLA 1PZ3A 5DN1A 4WUIA 3W75A 3WFLA 3VIPA 1V6TA 1XPYA 2NQ5A 3BAIA 1EOMA 1P7TA 2KAUC 1Q63A 3MKKA 3TXZA 1ZAJA 2YOCA 4R7WA 4GJJA 2GGGA 3O07A 1A5MC 2QR6A 4MLRA 1NWRA 4JIEA 5ABHA 4AZIA 1JXJA 3M0XA 1DTNA 4GNKB 2WSYA 3UJFA 4YCPA 4JTHA 1NH6A 2FQIA 3WBWA 1FXQA 1IGWA 3CUFA 2CXEA 4BF5A 2Y89A 1EJWC 3BLFA 1S39A 1Q3NA 1KCKA 3G22A 4MNJA 3CZEA 4HHPA 1PVNA 3UPMA 3ZVHA 3MVIA 2QJJA 2G3JA 1MFUA 2CITA 2FDMA 4ILSA 2IMRA 7PTDA 4A2RA 2J7CA 2DY3A 4JTSA 3AUJA 1GOMA 4XSMA 4EPDC 3EA3A 2X7VA 1JGMA 2CZDA 2V81A 1VYRA 4LW7A 4L6HA 3T9PA 1H3GA 1A4LA 2DH3A 1ZAIA 5MKGA 3NPWA 1EIBA 3WLIA 4LUYA 4HOWA 2A3BA 4S3CA 2Z1SA 1OIFA 2F61A 1G9HA 2VRJA 3ES7A 3TU9A 3TTEA 1R86A 2Y8VA 3VYLA 5D2YA 1WOBA 1WDQA 3MHFA 4DJFA 1OINA 4KCVA 5F2MA 2ZZ7A 1TIWA 4LBUA 1MQQA 1C90A 3G8EA 1RHCA 3HQ1A 4JX6A 3WMLA 2XU2A 5IDIA 1WDWA 4DBDA 2E3ZA 3SCVA 5A8QA 3BQ5A 1F76A 4MAZA 2WJZA 4BI5A 1MRQA 2WMHA 2NVAA 5TBOA 4W8AA 3CV1A 1VIWA 3KHJA 1NVMA 2OYKA 3PZIA 3S1VA 1A80A 1ZBWA 1VS1A 2C79A 1XLEA 3KW3A 4LJ3A 2P3EA 3VCNA 4HBKA 1Z48A 4H9XA 2QULA 3FW6A 5F4XA 1HGYA 5DEZA 3VFCA 4NI3A 3NGJA 1HL2A 5CBBA 1S46A 1V3IA 2ACRA 2OR2A 1EHNA 3QZ6A 2Q8ZA 1E6ZA 2YB1A 2Z2BA 4EXQA 5KEZA 1C8XA 3G1FA 1V08A 1PDZA 1JR1A 1VLWA 2REQA 4LVAA 4XD3A 4M29A 1VF8A 2X0YA 1M01A 2QJGA 3L4ZA 4L9XA 3TNBA 5HBFA 2G4JA 2XISA 5E0FA 3EWDA 4AY8A 5C2XA 3RMJA 1OB0A 3JUGA 3DIPA 2PRHA 3IGHX 2ZXDA 1VFTA 1ZSXA 2BHYA 1P6BA 2J7BA 3ZT7A 3M47A 4WIWA 4Z0SA 3TZNA 3QHMA 4IIEA 3MDWA 2GUYA 3P14A 1P0DA 2C0AA 4F66A 3LQGA 1JI2A 3AS0A 2NLIA 3QYQA 4AIBA 2YX0A 2G3IA 4KCTA 3WJXA 4OHQA 1Q4NX 3KXQA 2ISDA 3AMDA 2ZX7A 1SW7A 2POZA 3BSMA 4QLJA 5FI8A 3KOZA 4X0NA 3BC9A 1AL8A 1XRSA 1AZ1A 3UXDA 1XRFA 2O4MA 1OEPA 4M81A 3ONCA 1IT7A 4MB3A 2WVUA 2NV1A 1MMFA 3NG3A 3BK0A 2PWDA 4FX8A 1I9CB 3ME3A 2R1MA 5DRCA 2JKPA 2VM8A 1TRIA 4GG9A 1MXDA 4JFTA 1B90A 4FS9A 3GUGA 5JIWA 2PDHA 4LVBA 3T55A 4QHRA 3HGSA 4AVOA 1FWJC 1XL9A 3KTCA 3UJRA 5IXEA 3W1PA 4MFDA 1CGUA 1RD6A 1LLZA 1S38A 4DZAA 4IPIA 4OV4A 4AX7A 1FWIC 1R3YA 2MUCA 3MJMA 3NOEA 1F3WA 3EOLA 1XIIA 1F6YA 2A1YA 4QRNA 3VD9A 5DELA 3OLGA 1TX0A 2OEMA 2VKZG 1TX2A 2V68A 3L7RA 2DZTA 4YJ5A 3A21A 4QXIA 1RLDA 4MLJA 1UWTA 1KKOA 2A2IA 2HVMA 2GGHA 1OT2A 1KM0A 3VOCA 2BP1A 5HINA 3RPTA 4M1RA 1VB9A 4IMCA 4YXGA 5TNVA 1EBHA 3W88A 4Z1BA 1NP0A 3UJSA 4Q8VA 4IMGA 1CGWA 2B7QA 1QPQA 3R10A 1FFRA 1RA5A 3KBJA 1WCGA 1RY0A 1W1YA 1CPUA 1PZ1A 3FGCA 4DUOA 5A8NA 1F3EA 5EMMA 1QOQA 3GU1A 3NZPA 2ZKMX 3T0AA 2WBGA 4EP8C 1TB3A 2A5HA 2ZE0A 4JAWA 2PUZA 3PZQA 1TCDA 1GPFA 4J3WA 1V03A 2FH6A 1JJKA 1F5ZA 4LB3A 2FMNA 4GH3A 1J01A 1BWVA 4F8XA 2FZMA 3WNNA 2TODA 1JI1A 4HT3A 4Q8NA 3IVSA 3VGGA 3VX0A 3AS1A 4Q8MA 2CBVA 4IPNB 1R5YA 1KKRA 3MBFA 4ZXOA 5FF4A 4ZEPA 2NT1A 4LX4A 1ZHAA 2Z1KA 3UGRA 3B05A 5BZAA 5JBDA 3CT7A 3N3TA 2ZZ3A 4NAFA 3B3DA 4O17A 3GRIA 1K7FA 2O55A 3IAPA 1NEYA 3UPWA 1PYMA 4CD5A 1YE6A 2XG9A 2A7NA 1JZ5A 1RCOB 2YA0A 1UIPA 4HOXA 4TMCA 5E93A 4L4OA 3BANA 4FXFA 4H8UA 3EX1A 5AHMA 2V67A 4MGGA 1D3HA 3PF3A 4MJMA 2BWGA 4UTFA 2FZ9A 3A22A 4C6QA 4D6HA 3WQVA 1TREA 5DRIA 6ALDA 4IJRA 4HJWA 3WK3A 3BSGA 1RJRA 4EKJA 1TV8A 1XDMA 3LTPA 5FF7A 3AMGA 4UTLA 1EWEA 1FH7A 3F2DA 2PWVA 3LI0A 4BQ4A 1A5LC 4UNLA 2YZ5A 4NNAA 5BXRA 1AA1B 1VBRA 4IFOA 4RDYA 3SADA 1V6YA 3IJ9A 3AU6A 1KO0A 2PDGA 4Q8WA 3QQ1A 1BRLB 5C70A 4RZ5A 1BVNP 7ENLA 2GJXA 1K7EA 4RE4A 3BCFA 2HPIA 4GRSA 1S2WA 1EDGA 3HA1A 3GVGA 3UA4A 4N0RA 1FDYA 3VE9A 3P84A 5KSWA 1G67A 3DFNA 3AIEA 4JCLA 4PCPA 3SJ3A 3HG5A 1H0GA 2OOFA 4Y9NA 3RX2A 3AWNA 2DSWA 3ZR5A 5BOEA 2Y0FA 4US5D 1RLCL 3TV8A 3PWGA 1UD5A 1EJRC 1L6YA 2FJUB 1IQ8A 1JDEA 5LIXX 4PMZA 4XD4A 1HN1A 3TEVA 1ONWA 3MUY1 1UG6A 2XN1A 4PUUA 1J0ZA 1Z69A 2XIJA 4V33A 3CHVA 3RLGA 4C7DA 3WDHA 6REQA 4LUJA 1O7AA 1VPXA 2GDQA 2F8QA 4MF4A 4UQBA 1ELSA 2VEMA 2QCMA 1NQ6A 1YDOA 3T07A 4GMEA 4J28A 3RILA 3VDHA 1V93A 5JH2A 3QM3A 1OFPA 4UTMA 3UJEA 3ZMRA 1NDYA 1W91A 3AYSA 1RQEA 2DIKA 3OZMA 2XIIA 4JEQA 1QVBA 3GNOA 3UR2A 2F2HA 4GI8A 3WG6A 1LF1A 1ZJHA 2DU2A 2JALA 1XUZA 1TJ0A 4XAPA 2PTWA 3AC0A 1NDZA 3FKRA 2HZGA 1PTDA 2QVNA 2JKEA 4I90A 2I5IA 4X60A 1BXCA 3N2CA 4P7NA 5K9XA 3B03A 3E2QA 1G0CA 4K1WA 3ZT6A 5DT7A 3WLMA 3G1XA 3GZAA 4FMVA 3PBWA 4HMCA 1B31A 4GGBA 3L0KA 1EA9C 1Q8JA 3TJLA 1EJUC 3UG8A 2X1SA 1UC5A 5IBXA 3UZJA 1FHVA 2ODOA 2C8NA 3GSMA 2OO0A 2VUYA 4FA3A 1TMLA 3EOUA 3N25A 2G0WA 5CQ1A 4KEZA 5T8GA 2I17A 1OQFA 2BB0A 3HF3A 3N2XA 4RL3A 3LDVA 3U0HA 3W3OA 4AHPA 1ISVA 1YTEA 4H00A 3RR4A 3DG3A 2QVHA 3BO9A 4DWDA 4G8TA 4IP5A 1BQCA 3FK4A 3TQPA 1W5OA 3UP8A 3M6DA 3GTIA 4N6FA 4B15A 3HG2A 1KRBC 1J5SA 4FOUA 3GAKA 1P0EA 3TP4A 3E0IA 2O0TA 3SFWA 1T96A 4PTMA 4PN2A 3C6CA 4KEUA 1J5TA 3AZRA 5HMEA 4CCEA 2BLEA 2J6XA 3QSRA 4MB1A 5H8PA 2Y7EA 3OP2A 4JTTA 3EX6A 1OY0A 4KIRA 3UZ5A 3H2CA 1W1TA 3MS8A 1NWSA 4HZ6A 5A95A 3QHNA 3CIXA 4LV4A 4BR1A 4IICA 4D71A 4UOQA 1OVDA 1YDYA 1ZQ5A 1S3TC 3UJ2A 1BKHA 1HKVA 5FJRA 5AHEA 3HFTA 1B54A 3MYOA 1XIJA 4Q22A 2Y5SA 4X2RA 1MVYA 3WFAA 3EDFA 4YVXA 2H9AB 3CPUA 2J8FA 4M7TA 2YL5A 1G4PA 2J4GA 1B1YA 2DVTA 3N9RA 4B2DA 3A6OA 4J27A 4NXSA 3GDLA 4Z2GA 3VDBA 4S2CA 1TR1A 5KZDA 4EPKA 1IV8A 4LF2A 4H7CA 1Q6FA 3P6LA 1P0NA 3PSVA 4H9ZA 5EL1A 3H53A 5J5RA 1CIUA 2BSLA 3EWBX 4GX9A 2ASHA 5G4WA 3LEPA 2DT2A 3RGTA 2OPJA 1LLWA 2ABBA 2FFCA 4R7JA 4TVDA 2KX9A 4IXHA 2YXOA 1G01A 1GQNA 2V69A 3QVQA 3ZS4A 3LERA 2J78A 3VU2A 5K7JA 1PBGA 3P3BA 1RSCA 3BZJA 5FEXA 5K9DA 1C9WA 3F5JA 4PMYA 4QITA 3OBAA 2CLKA 3LPOA 4EF9A 2VGGA 4O1EA 3TLQA 4W85A 2RHGA 3LHYA 4AW7A 1W8SA 4V1XA 3W7PA 3W74A 3GG7A 3KBSA 3VGDA 4F0MA 1XI3A 3DFTA 3HGRA 3CWHA 5LA1A 1YPIA 4Z0JA 3E49A 3W7LA 1I4NA 4YVPA 3WDPP 1OG0A 2NZLA 4IX0A 1XLKA 5FL1A 2VFDA 1FDZA 3MSRA 2WNQA 4QCFA 1UR3M 5CGMA 2TSYA 2VZSA 2RAGA 3KAOA 1U1UA 4H19A 2C0HA 3DHUA 4UFIA 1UASA 1X6NA 3Q2DA 1EEXA 3APTA 1U22A 2D2HA 1ME9A 4L4MA 1SO5A 3TVAA 4I5UA 2NT0A 1SFSA 1BYAA 2INFA 1TJRA 4W86A 2BASA 4F0LA 4CNPA 1WUEA 3GTNA 1KCXA 3B8SA 3M0LA 3GFXA 2WSQA 4KEMA 3VIGA 3RIKA 2J25A 4GPNA 1VQTA 3FA5A 1UQYA 4JQAA 2ZFAA 5A6AA 1TWZA 4QDPA 2H90A 3OIXA 5F1UA 2F6XA 5CSSA 3LSBA 1CBGA 3AICA 3C8NA 4QQ3A 5AC5A 1S2VA 2Y8UA 2B7PA 1RK6A 3D6NA 4CQ9A 2XWEA 3VD7A 1EUNA 4NX5A 3B8UA 3NWRA 1J4EA 4AWEA 4JFSA 5HANA 1JFHA 2UZ9A 1LWIA 4IQLA 4X2PA 4XQ6A 1TTPA 4BQ5A 1Q5MA 4DWSC 1C8VA 3OPSA 3N6QA 3NQVA 3NL6A 2J7EA 2YL9A 4QJ4B 3QTPA 4HD5A 1D7KA 1HQTA 2QCFA 4KERA 7ODCA 3AUOA 4ZOAA 3IEBA 2CW6A 3L12A 4XAGA 2XGZA 4QISA 4M56A 4L6OA 1TPB1 1FHDA 5LA0A 4Y9AA 3DI0A 3UD6A 2VQTA 2PLMA 4R85A 1MW2A 2OODA 5BCAA 3B8VA 1E5JA 4C6DA 2D20A 4W93A 5JBFA 1EBGA 4RPPA 3H70A 4C6FA 4EOUA 3O1NA 2FB2A 4AWUA 3FHQA 1RQBA 4BQ2A 1UBSA 4MWAC 4UXDA 1XW8A 1BEUA 4QEHA 1XICA 1V3MA 4GVIA 4LY4A 5M5DA 3WL0A 3MHGA 2RDUA 1TMQA 4FR1A 4HSOA 3E0VA 5GVJA 3QQWA 1D3GA 3VOHA 2WC4A 5G4EA 1H7XA 5I3IA 4PUDA 3PK7A 3MA8A 4LCSA 5DCEA 3W00A 4UOZA 1DIOA 3PBVA 1GHSA 2B4GA 3WZ0E 1XPGA 3GIQA 4YTSA 3T2OA 2NQHA 2PDMA 3O9NA 2WC7A 4NZJA 3O6CA 4NG3A 1Q6DA 4YS1A 1KWGA 3NZQA 1BGAA 3M46A 4HSHA 1S5VA 1V3HA 4CVWA 4O8AA 3MP5A 2A85A 1T40A 4GYPA 4S39A 4DRSA 3KOWA 5JBEA 4H2CA 5A6BD 4DUXA 3GDRA 4I7WA 1DJZA 3I4KA 1ICSA 4QE1A 3CHFA 1PX3A 3TJXA 3P2VA 4Q8QA 2PZNA 4JHOA 1VR6A 4AZCB 2I5GA 4PFMA 5AN7A 3WK2A 1W1B1 1AK5A 1B0IA 4Z2KA 4FEZA 2E67A 5BRQA 4E5TA 2PDLA 2AL1A 2IS7A 4W88A 3IAQA 1SZRA 3PAOA 3TXVA 1K7XA 2DZPA 1OG6A 3V3WA 3SCRA 2R1PA 3WKZA 3VKJA 2QJMA 3CZJA 3GHUA 1W3LA 5EGRA 1KRAC 5DY2A 3MCNA 1EQCA 4OIFA 3WLLA 4RNHA 1IIGA 1Z32X 2ZTJA 2DJLA 3ARPA 3GD6A 4BY3A 5LNUA 2E5DA 4XUYA 2E7FA 1XH1A 1F9CA 4M6PA 4ICNA 3ITTA 4Y9MA 2W27A 1WNOA 2E68A 3AO0A 3IIPA 1DE6A 4L1GA 5I3GA 1HKKA 3R8GA 3NQ7A 5EPDA 2VDHA 2WZEA 4OJYA 4QE4A 4AAJA 3W7HA 1XGZA 3STEA 4QDMA 1BSIA 3W25A 5H1WA 3OIHA 1R47A 3H2EA 4Y7EA 3VVGA 2OZ0A 3CH9A 4DQWA 1HZYA 1QU4A 3M0IA 3S5YA 4Y6GA 1U83A 2CHOA 2RGMA 5HJYA 1MW0A 2PDNA 1JG9A 1SMAA 2CZEA 2X2YA 3I6RA 1J8VA 5HOSA 5GNZA 2AKZA 1FWFC 3WQGA 1X39A 1OX5A 3APYA 3TE9A 3RRAA 5KZMA 2ESCA 4UZSA 3SUWA 3NQ8A 2TPSA 4DB7A 3RUBL 3W1LA 3HJZA 3ZVHB 3AIRA 8A3HA 4D8ZA 2W4XA 3DG6A 1EJVC 3AXXA 1O66A 5EBAA 2PWUA 4C6CA 2JGYA 4A29A 3BH4A 1GVOA 1DP0A 3UESA 3S1XA 1HL9A 1ECQA 1R3RA 3NDYA 1AJZA 1W3JA 1VCVA 7REQA 4P5UA 1KR0A 3IPWA 3MY9A 1PE1A 3GDBA 4I3GA 3P81A 4DEFA 1M53A 1VKFA 4ORMA 3SCSA 4GCAA 4QCEA 3FVDA 1CXFA 1UA3A 5AZ0A 3LPFA 1QI2A 4GUGA 4H9VA 1BG9A 2NQZA 2VZVA 3G5EA 3T4CA 1WZLA 3CK5A 4I9JA 1YNYA 4DO5A 5LNSA 1GYLA 3TW9A 3SGGA 2DJXA 2WXDM 1JPMA 4IIDA 1K1DA 1MXGA 2QV4A 4Q8PA 3S5NA 1RBAA 3NZ1A 2OVLA 1JXKA 1QK2A 2ATSA 1EO7A 1V6VA 3H21A 3N34A 2Q02A 2RDXA 2DIJA 1XG3A 3VILA 3G3MA 1ADOA 1I2PA 2V3EA 2CESA 2CHNA 3GC2A 5I5RA 3BV7A 4D8AA 3WJZA 1EUAA 3FV9A 3QBUA 4R3UA 2JIWA 2DDXA 2QDEA 5C9XA 4URIA 2FZDA 2XM2A 4RXFA 3OVQA 5BRPA 3T44A 5M03A 3G1AA 4BI7A 3DENA 4D72A 5HNRA 1H0IA 4JTAA 4GIEA 4U5IA 5GNYA 3B9OA 3KP0A 1E71M 4O15A 3GKFA 4DM1A 5E9AA 2F84A 4Q4KA 4XIMA 1F73A 2BZNA 3CYVA 3CU2A 3ABXA 3K4AA 5LIYX 4PR4A 2DZBA 3EGJA 2XVKA 4YL2A 5FJPA 1J0YA 3ZJ8A 3LRKA 1KFWA 2CPUA 3COTA 3DHFA 8XIAA 1V02A 2WQPA 3PG8A 3OEXA 1M68A 3GR8A 3EXSA 4WEVX 2YB4A 2XGBA 3CBWA 4NIRA 3W2UA 5T26A 4FLOA 1QOPA 2YLAA 2CBUA 1XLHA 4ERAA 3ZJKA 1K8CA 1JCNA 4PB4A 1PIGA 4IQEA 1QNOA 2GSHA 5A69A 4XZHA 2XN2A 2INEA 3DYMA 3WH9A 3NJ3A 3NIYA 3TOYA 1FUYA 2UY3A 3V36A 2GQ8A 3GU9A 2EPOA 3VNKA 1WKFA 1W9UA 1GJPA 3UZZA 3KTSA 1GOOA 3NUKA 3DN5A 2EO7A 3HV8A 3VGHA 4ZZ9A 4PCNA 4GI4A 1VFSA 1PKNA 4ICMA 5K2ZA 2VVNA 4XAZA 2NV2A 1NAL1 3CTLA 3M0ZA 2AGKA 1BXNA 4RNFA 1J79A 1E0XA 3BW2A 4FXSA 2XFWA 4DF2A 4HYVA 2ZWZA 2XSAA 3GU2A 5G4HC 1XLBA 1OD0A 2E77A 1FCBA 1HGWA 3QC0A 4DXXA 4ZB0A 3HGJA 1XF0A 1JCTA 3REQA 3GWQA 3QZEA 1O94A 1GG1A 4GIRA 2CZFA 3GB6A 3AS2A 3ARYA 4NZCA 5FAGA 2WMKA 2QXWA 5BRBA 5A8GA 3V7PA 8RUCA 3VC5A 1A4MA 4GQGA 3N15A 2Y5EA 3RO6A 2VX6A 4OU1A 3H8AA 3TTQA 2BVWA 2XTKA 1W54A 4ZTYA 1OCJA 5JQ9A 3NO5A 1B4EA 1LP6A 3TSBA 3H12A 3S5SA 1UD8A 1S3HA 4IL2A 1IXPA 2VZUA 3HG4A 4LH8A 2VL4A 2C6QA 4KWUA 3O3RA 2WHMA 3MDUA 3E0WA 1SYTA 2XHYA 2V6AA 3VM7A 1GHRA 3UZXA 1J0IA 1OGBA 4QSFA 1J18A 2WYSA 1OT1A 4KRZA 4YTUA 1E4MM 1A50A 4A22A 4AEEA 1GOKA 2BY2A 4KRTA 4HPNA 1TPDA 4AZ6A 4ZSTA 4DAIA 2BXVA 1W1ZA 3ZO9A 4WSKA 4NSBA 4JTUA 3AYRA 3C2EA 1UZ4A 3RMEA 1U1JA 3W29A 3GBDA 4LS0A 1LRQA 3H4WA 3P74A 5ENLA 3F4VA 1Q7MA 1DJXA 1XBYA 4ZQNA 4LTSA 4HCLA 4HU3A 4QG8A 2VOTA 4OQVA 2VOMA 4WJEA 1CI1A 3GNXA 3N14A 3M1ZA 1E4LA 1QWGA 3DHPA 4X61A 3ATYA 1OABA 1DHKA 1T8QA 2DORA 3MSGA 3UCQA 1NF7A 3FJ4A 4P8WA 3MKCA 3WDIA 2G3MA 5A3HA 2Z2AA 4PUWA 3B0PA 1UJQA 3OZOA 1OZMA 4Q7NA 1LL6A 5I07A 5DY3A 1H7WA 1ADSA 2PB1A 3QV7A 4KFPA 5A8OA 3CQHA 1K3UA 2P10A 2I7GA 2B7OA 4FNQA 4IUOA 3T2PA 1WXZA 4XVDA 1OFRA 2GJXB 2PD9A 2J7DA 4UTJA 5KTLA 3EB4A 1H1NA 4CQBA 4H9UA 1SQ7A 5LIWX 1DXEA 2X30A 3NM1A 1LWHA 1L2UA 3PZUA 3RHGA 3KOYA 1QI4A 3F5LA 3FVMA 3M0JA 5G2HA 5LKYA 1S1PA 3KBVA 4UTWC 4WR3A 3LXAA 5H91A 3LGDA 3LLXA 5EYWA 1SJBA 3A13A 3FYPA 2PDFA 4AZHA 5GJNA 1XLFA 1DWIM 3FHAA 3KDOA 5CJMA 1NY1A 3U6WA 3LHUA 5G1YA 3APGA 4WQ6A 4ZGYA 3GM8A 4F79A 2EKGA 4UB9A 4YYCA 3VKKA 1LROA 3DH7A 5BROA 1UKOA 3L4UA 3XINA 4CEUC 4O1DA 1EP3A 1UJPA 3AYTA 3GUWA 5AHLA 3VNYA 4H1ZA 3NEVA 4CD4A 1OX6A 1ZJIA 3WUFA 4FOJA 1GQKA 3JS3A 2I16A 4MM1A 3ZLHA 3HB9A 4O8RA 3L2IA 1RP8A 3K4WA 2GZXA 1I60A 4K37A 2WV8A 1XCFA 4NP7A 5AVNA 3A24A 2WHKA 4PC8A 4E3VA 3GIYA 4R27A 3SB0A 1FTXA 3TFXA 3BOLA 5F4SA 2FVLA 3EMQA 3KVKA 1FWNA 4D6DA 3WMSA 5J04A 2EBNA 2YFOA 4D8LA 4WF7A 1F2JA 1XCXA 5D9MA 3AHXA 2NVCA 2VGIA 3E0LA 3MV01 3EXTA 4IGMA 3PS7A 3GDMA 4H6QA 1XIEA 3U2OA 1GZGA 1AL7A 4IP7A 4I9TA 1AQHA 1TVPA 4PFHA 3FN9A 5D2VA 5BU9A 1XQKA 4UC5A 2DT0A 2QEZA 1M41A 3FDKA 3W7OA 3T05A 2J6VA 2X7WA 2D24A 2ZZ6A 1Z3NA 1FCQA 1EC7A 3BPWA 4OV9A 3AHYA 2Z2UA 4AZBA 1FHLA 1FX6A 5C9WA 4L56A 5D9PA 3ZZ1A 3OA5A 4YN5A 1E3XA 1FY6A 4RDVA 4EIVA 3VABA 4JTIA 1V5XA 5I3KA 3CZKA 3EZ4A 4LYQA 3N1AA 4FNRA 1FKWA 1MUWA 4YWSA 3BOXA 1ZPTA 3CAKA 1HXJA 1OX4A 2VR5A 3FAWA 3EPMA 2Y4SA 5KMYA 4B4HA 5CXPA 1UZDA 4I9MA 4PULA 5H6HA 3CHDA 2NX9A 4Y96A 3VKDA 1KFLA 3O2LA 2WHLA 3R89A 1WXJA 3KBWA 1R8LA 1E6QM 2BFGA 1JCXA 4KWSA 1TUFA 4ZO6A 3S46A 5ABGA 1GVEA 4HMNA 1KR1A 3URNA 3RNDA 2A6NA 3H2NA 1EJSC 1SO3A 3G1YA 4U2YA 3ARZA 3C52A 3W1RA 4MZ1A 4MKSA 1GYNA 3TYAA 3FJNA 4XAFA 1OF6A 3RPMA 1TE1A 1P5BA 1ODZA 4MKVA 1CGTA 2EKCA 3VUPA 2ZA2A 1TJPA 3GLCA 3NVTA 1RV8A 3PFMA 2GVLA 9XIMA 3GR4A 1PO9A 3THAA 5LXEA 3H4XA 5FESA 4C6IA 4U31A 2WPGA 8XIMA 1UOZA 3CAQA 3PTMA 4OZOA 2E25A 3PUGA 4GH1A 1LQAA 1GQJA 1F8IA 2Y63A 3S6DA 3U2CA 4KIEA 2RKXA 5AKQA 2GDVA 4Y2WA 4GQQA 1GKQA 3K1GA 3DUGA 1JZ4A 5F7UA 2BODX 1FDJA 1C29A 2ZA1A 3WQ8A 4ADTA 2DSUA 1L2QA 4LCRA 3MU7A 1DTUA 4Q32A 1W31A 1WZKA 3M0KA 3OGSA 1X1OA 2QDGA 4S1FA 3ARSA 5F4WA 4I5XA 3UXLA 3VIIA 4A8IA 2E1DA 2RUSA 1DJQA 4AISA 4W87A 1C93A 1CNVA 1ZJBA 3VTRA 4O1FA 1YBQB 1AQMA 2PC8A 3AXKA 4AU0A 2D2JA 2E6FA 4K8EA 1RAKA 1XXXA 1GTEA 2Y7GA 3QN3A 4LUTB 2YW4A 1UWQA 3QXBA 3W24A 4LYPA 3UYIA 4UQDA 3NAVA 1US3A 4UCFA 3GG8A 3OGRA 3T0DA 1L6WA 3TJIA 2C1HA 4NYYA 1SR9A 2YL6A 5HATA 2O92A 1DJWA 3TA6A 4JNYA 5HUPA 3GC5A 1A0CA 3UR8A 1RALA 1NFPA 2FZBA 2D0FA 3UXIA 1S1RA 4JTJA 5FEWA 1R9XA 2WJEA 2J8TA 2V3GA 3DAQA 3DHDA 5EFFA 3A5VA 4AHOA 4CN1A 2DFAA 4IWWA 3QY8A 3CO4A 5KETA 5D2WA 2QPSA 2QCLA 3DKLA 3PBGA 5D9NA 4G56A 3C8FA 3W2NA 1WA3A 3G6LA 3VPLA 1R2RA 5ABFB 3MI6A 3MB9A 4RDZA 4LY8A 5A2AA 2OT0A 3LGGA 1VJSA 4XKYB 1Z41A 1QNPA 1KM3A 3W1NA 2JFEX 2A21A 2OCZA 4HSNA 2OTDA 2E8ZA 1TR9A 1KQYA 3MCOA 2E9BA 1W1VA 4C6EA 4IFRA 2VGFA 3LNMA 3P60A 5DMYA 1BRLA 1TCMA 4D6JA 3NA8A 3FOKA 5D37A 2Z6JA 1JYNA 2PCQA 2D23A 3BLEA 2CKSA 1LL7A 3I3DA 3PBMA 3VZZA 4EVZA 4QNEA 1CX9A 2DV0A 2WKLA 4J3UA 4IQJA 1EJXC 2W66A 3MWAA 5CPQA 3QPZA 3PUOA 1E56A 3L9CA 3N18A 2WM0A 3A9BA 2RJHA 1AW2A 3KL3A 4FX7A 4GQRA 1YKWA 2CERA 5I06A 1OZQA 1GPWA 3PPFA 2J7GA 3CL6A 2ADAA 1V0KA 2I1OA 3BAYA 1CXHA 4LRTA 3KS6A 3TNOA 2Y88A 1E6RA 1XLDA 2VC5A 2ZADA 3HQPA 1TWWA 4LAKA 5FF3A 3P80A 3ABSA 2ZRWA 3N3MA 4ML4A 6XIMA 1H60A 2Y61A 1KD0A 5FOOA 2YXGA 1K4HA 2GOUA 4GY1A 4DJDA 4K36A 1PX8A 2AQVA 3K2GA 5FCZA 3CUHA 2UY4A 3SZ8A 2VXNA 2FZNA 3IK2A 3CYJA 3B4UA 1XIGA 5CPMA 1H7OA 3LTYA 3SN4A 6XIAA 3C4UA 1QHPA 1POKA 2PWGA 1J96A 1OBAA 1O5XA 4NJIA 1LG2A 2ZUWA 4B3LA 3TK7A 3HV9A 3W0KA 2VRKA 3PJXA 3O0FA 4HA3A 4HZ8A 3OLDA 4MDOA 2EPNA 1KRCC 3W6YA 5FKYA 4C5ZA 4LPCA 2CWXA 2A79A 5AY7A 2QKFA 4D2JA 4DWSB 1J2WA 1FA2A 3UT0A 4OBTA 2QJNA 2VR2A 4IPLA 5FEPA 3PZMA 3WYZA 4H83A 4ZOBA 2XFYA 4H6EA 3MO4A 1S5MA 1W1PA 3QLDA 4Y8FA 2O4QA 1UYQA 1EYEA 3DI1A 3P62A 4AC7C 3IIZA 3M07A 3WQ5A 2OMAA 2W0UA 2A7RA 5DF0A 4NZ5A 1K4GA 4GZ7A 1Z6KA 2GYIA 3GHSA 4BWLC 4JYDA 1Z8AA 3IJDA 3EOOA 1J0KA 1IWAA 1M7PA 3FEQA 1R38A 1RR2A 1KXHA 1C8YA 3W70A 2OWWA 2DQWA 2FPYA 1AODA 3E5PA 5EY5A 2TYSA 1FCVA 2V63A 4MWAB 3K30A 4GKLA 3GH7A 1CW2A 1VHNA 3UCCA 3ARQA 1K03A 4C1KA 4R7OA 2OFJA 1TJ2A 3ZIZA 4AEOA 4CNTA 2CFFA 3A64A 4B5VA 1XHGA 3OVPA 3ATZA 1EH9A 1OC7A 1XCWA 1NP2A 3OVGA 3HGOA 4HA0A 1OCQA 1MEHA 3SY8A 4ZQCA 3TWAA 3W7GA 6PTDA 1X6UA 3CO8A 3T78A 3DDMA 4WDTA 4N02A 1XC6A 3NQ2A 2GQAA 3AIWA 1ZGDA 2D0GA 4QJ1A 4JKKA 1OC5A 1KCZA 3CMGA 1CB2A 3ORWA 1Q6CA 1IZJA 1GEQA 1KRMA 3TOPA 1ITUA 2E0PA 5B7ZA 1EFZA 3S9YA 1LCOA 4QP0A 5BOOA 1LQ2A 1XLJA 2OEKA 3TC6A 1KFKA 2DQXA 5AC7A 3DECA 4XZWA 3CAWA 2X16A 1V7YA 2HTMA 3T4WA 1EXPA 2JBMA 2OQYA 5C0QA 2H9AA 4XV0A 1VH7A 4B5UA 4LUIA 4OFCA 1QXLA 3M4HA 3IJ7A 3HG3A 2DZXA 2FTYA 2VZTA 3ANUA 5AC8A 1Y5VA 5HMFA 4PTNA 4QIUA 3HJEA 4DY1A 1XINA 4H8HA 3QR0A 3S1WA 4GGHA 1E0TA 1EA0A 4O1AA 2WNWA 3LBCA 4FOKA 4DNMA 2ZRZA 3NSMA 4PEKA 1NFBA 4RR4A 1HTIA 4Q33A 4X63A 4CQAA 1KBBA 4GQ0A 3CGTA 4C5YA 3BG9A 2C18A 4DX3A 4E4UA 2BTMA 5DANA 3NQGA 5C2CA 5C7HA 4K3ZA 2Z1BA 1QW8A 1HJWA 2XYLA 3THQA 3WBEA 4GE8A 1CYGA 3T08A 4W4QA 5LHFA 3U4FA 1BYDA 5JVLA 1A53A 1H1YA 1O5QA 4OE7A 2A6LA 2VD8A 4AWSA 4J2PA 5E09A 4WKAA 3BDKA 2EG8A 3QEZA 1I2OA 1RXOB 1AH3A 1VFHA 3TQVA 2EJAA 1U1HA 1WYIA 4RKAA 2FVMA 3OOQA 3TQ0A 3QY7A 2PRMA 4YNGA 4TTGA 5HUOA 2QMJA 2CBJA 3GHTA 3PNUA 3M5XA 5FF0A 4GBDA 3NTYA 1DPMA 4N9DA 1RJPA 1XS2A 1E6XM 4GABA 4DJEA 3VO0A 3I4EA 3I68A 5EFDA 4C65A 1MUCA 1RD5A 4YHGA 5G1TA 1ISWA 5AC6A 2QPUA 3D3AA 4F2TA 2CLLA 3I65A 3U2ZA 4Q7IA 3SRHA 1B3OA 3YPIA 4Q4PA 4HU8A 2LLEA 2EPKX 2OX1A 5A6LA 4UFJA 5C71A 1YPFA 3LBMA 3DC8A 1N7KA 1WB0A 3QV9A 5LSMA 3W72A 1LBFA 4PRWA 5AHFA 5BNKA 5I09A 5AFDA 4MVAA 3ZLGA 5C55A 4GOAA 4PL2A 3BUVA 2Y7FA 1VEOA 3BJTA 3RJXA 4H9TA 2ZZ4A 1W3NA 3KBNA 4RNJA 3W86A 3TZFA 5HNTA 1KGXA 1YTKA 3EXRA 3W07A 2FGBA 5HR7A 1JZ3A 3HZ3A 1QW7A 3QV6A 4NYUA 4EXAA 1Q7ZA 3TCEA 1W8GA 3QLLA 3G3DA 3FY1A 2Z4GA 1HJXA 2ZVRA 1H51A 3PBUA 4UTTC 3D0CA 1DJHA 1YNQA 3FJ6A 1HO1A 2FB3A 1UKTA 2WJDA 1W5PA 4DYJA 1G6CA 1GNXA 2H3BA 2QUUA 1K9TA 3MP3A 1X97A 3CHCA 3B8IA 1I2NA 3VM5A 1DXFA 5EB8A 1XIDA 3SRDA 2VURA 1G7VA 1TUXA 5A2CA 2FTPA 1UH2A 2O9TA 3K4DA 3N6JA 3O6DA 3MW7A 1F07A 2I9UA 2I56A 4AEFA 2HRWA 1OFAA 1ZBVA 3WNOA 2E4TA 4ZCWA 2UWFA 3SI9A 1W32A 2ZC1A 3BZGA 1U30A 4AHQA 5I24A 1EX5A 2ACUA 4ROPA 1VFUA 1UIOA 3LMYA 3WK1A 5G1MA 3BURA 3V75A 3DGRA 2FMOA 2VX4A 1A49A 4LEFA 4AX6A 5LA2A 1WAWA 3HBLA 2YZRA 2YIHA 4K38A 3N2OA 2VYOA 2OKOA 2VEIA 3GDTA 3OGVA 1ISXA 2CIPA 4JHZA 3N4AA 2FHBA 2CZVA 1JAEA 3OYXA 3KOXA 3SUUA 2XGIA 4IHCA 4HHHA 4ACZA 1FWDC 3C5QA 4DPPA 4MNLA 4LB4A 3DZ1A 3QF0A 4HTYA 4PMRA 3VD3A 3MP4A 5U4NA 3C2RA 4EACA 4DJFD 1NOUA 4GC4A 3P5YA 1BTCA 2DVUA 3BMWA 2OGJA 2J74A 3P0XA 1EF2A 2CWNA 2W61A 4NUWA 3WUGA 1YEYA 3LCHA 4P8UA 1T8XA 5HJLA 4FSAA 3CUZA 3T1GA 4K8HA 1QBBA 3FLUA 4ADSA 4BEUA 1QBAA 3NDZA 3JR2A 1YPXA 5EKYA 2J8GA 4D1JA 4LNYA 7CGTA 5E0KA 1JCYA 1S2TA 4J40A 2Z28A 1XSJA 1UBPC 1XRVA 4HZ7A 4B3KA 4B5SA 2R8WA 4HA1A 4J3XA 3V0SA 3V0TA 2AOSA 2W5FA 4QLLA 3BAJA 1MZRA 2V2HA 3H22A 1VCGA 3STPA 3W27A 5IM51 4XWUA 1I2QA 1P6CA 3M44A 1ZBKA 4TMBA 3MMDA 1XSKA 1ZZMA 2Y70A 3AMCA 4K7YA 4L7ZA 3WEMA 2NUXA 3N4FA 4MYXA 4P2VA 5REQB 2VENA 2X2GA 3CMJA 4AZCA 5HNNA 1DIEA 4JIQA 4Z2HA 4H01A 3VOJA 4G5DA 4BKNA 3GXDA 1DQWA 4L9YA 4CD6A 3XIMA 3K8KA 4GX8A 3VDCA 5CPTA 1C7SA 1O68A 3TTYA 1E55A 3EA1A 4EX4A 1N2VA 4W89A 3PM6A 3ANVA 4LALA 4M6VA 3ZR4A 2YR1A 1XDJA 5H8MA 2HK1A 3HU7A 5CC3A 4L1WA 4MIMA 5K9CA 2WHJA 4RE0A 3IIOA 2R1LA 3A4JA 1H63A 4XO6A 1C8QA 3AIVA 1ISZA 1UHVA 5FL0A 3UXAA 1P1XA 4W7VA 4FZIA 4UCGA 5I02A 3BAKA 1NSJA 3VNMA 3MYPA 4OUEA 3IIVA 1L8NA 2GVJA 3SCUA 4IG2B 2DIEA 1E4IA 3SRKA 2J88A 4KETA 5HAOA 3M7SA 3BTNA 3LYEA 2PDIA 1V3JA 4G1KA 1TZ7A 2HISA 2HS6A 4Q8TA 1AH4A 4MJZA 3IUDA 2OZ3A 2PODA 2H6RA 1ML1A 2XN0A 1XP3A 2BOEX 1E72M 5L6UA 4WD0A 4GI6A 1F8MA 4IGNA 1KC7A 1IHIA 1UWRA 1RP9A 1W0MA 1YYAA 3EWCA 5IHSA 4GUFA 2I57A 4O14A 2ZUNA 5E9XA 3OODA 2E1WA 3CNYA 1DXIA 3QC3A 1FH9A 3UXKA 3GDKA 2ZUSA 1WAUA 4ZTXA 3R25A 1AFSA 1NWUA 3THDA 4FO4A 2XWDA 2OO6A 2BHUA 2VCBA 3W2MA 3GKAA 2G5WA 3WEOA 1A0EA 3CJPA 1H62A 3CPRA 1YDVA 3M9YA 2PTDA 3R79A 3WEZA 2FH8A 1KM6A 4GZIA 2WJFA 1K02A 4GVFA 4FNUA 1KFJA 1EX1A 2PRLA 3DG7A 2Y2WA 4V2XA 2B31A 4UOJA 2HWGA 3OA3A 3W82A 1S5TA 3B9NA 3E1F1 4HYRA 3RLVA 3U9IA 3B0UX 5EA9A 4ZVJA 1LRNA 1HX0A 3NL2A 4Q4SA 1XIFA 3KRUA 4FIRA 2FZ8A 1R0MA 3TSDA 4XB3A 2QCHA 3V1PA 4V27A 1KFBA 1F3TA 1R7OA 2GGIA 4REQB 3PWIA 3P93A 1E5NA 2NX1A 3IACA 1KFEA 4JQ4A 2GGEA 3RYSA 4JXCA 4PMOA 3UA3A 4IPPA 1FXPA 3MV11 4HGXA 1TWSA 4AMAA 2PWEA 3TR2A 2ICSA 4HVXA 3MUIA 1UA7A 1BGGA 1PJ9A 4FAMA 1EZWA 3OBKA 1I0BA 3PPCA 4ZQRA 2A3HA 3LLDA 3WQDA 1FP9A 3WD1A 3GFYA 3ZSSA 3XISA 1Q2SA 3W26A 4AD3A 1JDAA 1PPIA 2ZXAA 4OOUA 1VFFA 1X7IA 4JGDA 3SEPA 3JRKA 2X1UA 3WSUA 3S2JA 1B2YA 1BLIA 3NL5A 1ZCCA 3STCA 3TIMA 4BCEA 3T81A 3MUAA 1DV7A 5FJOA 2YDSA 4F4RA 5D30A 3W7IA 2PA6A 4PTDA 4U28A 4CD7A 5BMWA 4LAUA 4C6PA 3LY0A 3BLPX 4S3GA 2J9ZA 5FA5A 2NUWA 4PH6A 1QPOA 1PCWA 1QPRA 3QW3A 4HCDA 4ZQOA 2HSAA 3G0UA 2WNZA 1KBLA 3IARA 4DIAA 3SFKA 3UG5A 3H7UA 3C86A 4ZB5A 1W5QA 4F2UA 1SFTA 4AD5A 1FFQA 1LT7A 2CHRA 1H11A 2Z00A 1VP5A 2RDWA 4EPEC 1E0VA 4ZB2A 3TW6A 3D47A 3Q45A 3PZOA 4MSSA 5D8WA 3WJWA 3GH5A 1GKPA 1BHGA 4E0CA 5G2WA 2F6KA 4LOCA 5HJXA 1UD3A 3UWZA 4BF7A 3ABRA 1JD9A 4U3AA 4KESA 4KT2A 3ITVA 1JCJA 1OX4B 2PBOA 1W9DM 5LGZA 4FNSA 3LPPA 5RUBA 1H50A 4NZ3A 4LVDA 2ZX6A 2XH7A 1SM9A 4XUGA 4L65A 3MI2A 5C54A 1DQXA 3R6IA 4A3UA 1BPLB 4MHBA 3KVJA 1QMLA 4S3FA 2G4FA 2ANUA 3VMOA 4HZMA 5IOBA 5I0DA 4AUBA 1X1ZA 2W91A 1DWJM 1TV7A 4FNTA 4B4FA 3KLKA 3LRLA 1AH0A 6A3HA 1TPUA 1DJNA 3HM7A 1ESWA 1X8CA 1CT5A 3QR1A 3W85A 4NAEB 4PTXA 1EC9A 5CPSA 4AIOA 4V1YA 2ZA3A 1CLKA 1H7RA 1UR9A 4DBEA 4PE8A 2DUZA 4IUGA 2BNJA 1VD6A 8CGTA 2AL2A 1R46A 3TN6A 5EMYA 5DMMA 5M2FX 3BICA 1IEXA 1MNSA 3PB2A 3WLJA 4HTBA 3B8DA 1LZOA 4YPJA 3KL5A 1XYCA 3S2CA 2AKMA 1A3XA 1XG4A 4OWGA 3KHDA 3E5BA 4WJ8A 1VEMA 3GYEA 1E40A 3PN8A 4WJXA 4DI8A 4JCMA 1S5NA 5T91A 3CL7A 3VIOA 2BMBA 4U2ZA 1P1MA 3BG5A 4MNMA 4NL1A 2WCSA 4E8GA 3MWCA 1A0DA 3OYZA 4MUZA 5C5YA 4XX6A 4O54A 2ACSA 1TO3A 3POCA 3QRHA 3AXHA 1V0NA 3BLKA 3LPGA 1HL8A 4H41A 4N9CA 2PF8A 3I7QA 4B91A 5AYZA 2JKAA 3LG3A 1YX1A 5CC6A 1H41A 1A5UA 2UBPC 3AIQA 2J62A 3W2LA 2MNRA 2ZVIA 1BFNA 4M6UA 3ITYA 2ISFA 3KRBA 3C3UA 1TRDA 3O05A 4AXNA 1KTNA 3AROA 3N04A 3SCWA 5HULA 2ALRA 3IUHA 3VIJA 3CM4A 2ON3A 2QIIA 5D9OA 1H49A 1ZCOA 1WXYA 3EWXA 3QMSA 3Q58A 4Z08A 2J75A 4AYGA 1T41A 2DGAA 2V5BA 2OZ8A 5D33A 4NQ1A 3HIJA 3VC6A 3UWVA 3AALA 4PMXA 4FB7A 3BE7A 3NYDA 2OSXA 2D0HA 4JIIX 3S1UA 3W1MA 1MI3A 3OBEA 4IIFA 2GVEA 4IMDA 1RBLA 1A5NC 4OECA 5A94A 3WK0A 4OBRA 1Z89A 5JU6A 1TPVA 1OCBA 4L1XA 1OCNA 1NARA 2CLIA 4CNSA 4JTQA 2NXHA 1X7FA 2OGYA 3S5ZA 3E2VA 1JF6A 3E2SA 3T8QA 3WLNA 1GT8A 2JGQA 4AVNA 1HUVA 1RVKA 1F61A 4HHLA 1FWWA 2GK1B 3KVMA 1DQUA 1PYFA 1M5WA 3OB8A 4ZODA 2QMKA 1U5VA 4N4PA 1KQZA 4JTRA 5BWFA 3EKLA 1JPKA 4GUJA 2ZIDA 2J7FA 1FKXA 3H6OA 3ZYZA 2XIBA 4TTUA 5HWNA 2C1IA 1MUMA 1UP0A 2IQDA 2BDQA 3GTFA 1KW1A 1JQXA 1L6GA 2VJXA 3CUXA 2RDTA 3DKJA 4XTIA 2R94A 1XYZA 1MFVA 1GVYA 4WY0F 5F2IA 2G41A 1P48A 5L9FA 4M51A 4WKHA 5D32A 2P0IA 1XIMA 3PHAA 3LUTA 3U48A 3CZ8A 4F0SA 4LXFA 1MYRA 1VHCA 4B2DD 2BVTA 4Q4MA 2H8ZA 1UR2A 3SCTA 4TQTA 4S3AA 4C7GA 1E6PA 1K9FA 3VKAA 3PR2A 3KBMA 3SIMA 1KM2A 1Y65A 4CD8A 3DX5A 3MO7A 5CAKA 1TZ9A 3NXFA 3OQ8A 1UWUA 4KH2A 4HOZA 3CIVA 4JR5A 1ZFJA 3ZLFA 3UGVA 3VDGA 3R13A 4A2SA 3VIFA 2ZC8A 4F9DA 3UWEA 2G95A 2XM1A 2PI6A 4NJKA 4ASTA 3IGSA 2VGBA 3K1DA 3E74A 3OW1A 4PGLA 1QNSA 3FYYA 1PV8A 3CUGA 3WCZA 2XVLA 4JNZA 3M41A 3MMUA 2YA2A 3QOKA 3R5EA 3MPGA 4W8BA 3NQBA 3HFYA 3WFZA 3VK5A 3TMLA 3RM8A 2WMIB 5HR6A 1F74A 3FIGA 3KOFA 1P4CA 1LM1A 3NOYA 2EF9A 1U33A 4NI8A 5CCZA 3RLUA 4IL0A 1AJ0A 3ARWA 1VENA 2IXVA 1LOLA 4IQDA 2AQWA 1V6UA 1XSIA 4QAIA 4B5TA 1JDDA 1GVIA 1XRTA 2P8CA 4O12A 3RDKA 3WQEA 2NUYA 3QYSA 4GXPA 4UTUA 2GDUA 4OKDA 5DO8A 2R1NA 5E1QA 4G7EB 4GY7A 4AF0B 3STFA 4NRRA 1GOIA 4X0VA 1NFGA 4JTCA 5T9BG 4QX4A 1BTMA 4WRHA 4V15A 5F1VA 3L0NA 3MKVA 1M7OA 2O9RA 3GIPA 3RAOA 3GG0A 1UB3A 4TV6A 3OTRA 1QW9A 3M0HA 2VT0A 1E4NA 5DX7A 4I5RA 1EL3A 5AB3A 4GBUA 3IJQA 1WX0A 3INPA 3TC3A 4O50A 4NVTA 2VX7A 3GTHA 3W02A 1AW5A 5E0CA 4Z17A 5AECA 2CLEA 4A8NA 2BXZA 2GUUA 4RE2A 4NY2A 1KTBA 1KBJA 1D8CA 4CU7A 1IXNA 2Z27A 1XUUA 3C2YA 1J2BA 1ZP4A 1ZNNA 3B97A 3BJSA 3I7SA 3DFSA 4LQ1A 4XZBA 2W67A 3FFSA 4LU0A 3WD0A 1E43A 4ORIA 1FWTA 2PTZA 3ANYA 3WMBA 4X3ZA 4ZFCA 1KLZA 1W56A 3W1QA 4DUWA 3CEUA 2XH0A 4X9SA 4B9ZA 1GJWA 3T09A 3M6YA 2OYMA 3E12A 1W3IA 2WKGA 3DU0A 4J3ZA 3QH2A 4KFNA 2Y5JA 2Z25A 2R82A 2E6YA 2GJLA 4TR9A 3A3WA 4NT0A 3ABOA 1HJQA 3ZSTA 3LNPA 3AMKA 4HK7A 1NIUA 1KNWA 3CUJA 3DGBA 3VXGA 2D22A 1Z9AA 4GYJA 5LNVA 3STGA 3BWWA 1FVPA 4GFSA 4IFKB 2XZ7A 2FHCA 5JIPA 3CLWA 4Q3MA 3QW4B 4L64A 3G0SA 5FSEC 5AYYA 3TUUA 5CPNA 3O16A 3U2EA 5HQLA 3G1HA 4XVEA 3LX9A 3TW7A 1O95A 2I14A 3DEQA 3CEPA 3SW6A 4IMFA 4IF2A 4A3YA 5BWAA 4GY0A 1YNPA 2VCCA 3HN3A 4A21A 2CETA 2OOGA 4B5NA 2FGLA 4US6A 4G9PA 1GK8A 3ZFHA 3USBA 2ZX9A 4GKTA 2Q3OA 2XIOA 1TQXA 4JIHA 1LDCA 4WCJA 3VX1A 2QUMA 3CZLA 3TDFA