1NDZA

Crystal structure of adenosine deaminase complexed with fr235999
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
349
structure length
349
Chain Sequence
TPAFDKPKVELHVHLDGAIKPETILYYGKRRGIALPADTPEELQNIIGMDKPLTLPDFLAKFDYYMPAIAGCRDAIKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVQAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDTTLYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A highly potent non-nucleoside adenosine deaminase inhibitor: efficient drug discovery by intentional lead hybridization
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Adenosine Deaminase
total genus 144
structure length 349
sequence length 349
ec nomenclature ec 3.5.4.4: Adenosine deaminase.
pdb deposition date 2002-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1ndzA00
1K70A 1EZ2A 3QY7A 4RDYA 4KESA 4ZSTA 2GWNA 2QPXA 2BB0A 3PAOA 4XD3A 4B91A 4C6LA 3GIQA 2Y1HA 4V1YA 1GKQA 2HQAA 3NURA 3K2GA 1NDZA 4KEUA 4KIRA 4GC3A 5FSEC 3LSCA 3URNA 4KETA 3D6NA 3ID7A 2UZ9A 2Q09A 3F4DA 4PE8A 1EJTC 1VFLA 4KERA 4PBFA 4R88A 1NDVA 2P50A 2Z4GA 3LSBA 1XRFA 3F4CA 4MUPA 2WJEA 2I9UA 4RDVA 1PO9A 3TN5A 4M51A 3GTFA 4J2MA 2YZ5A 3E0FA 4GX9A 2Z25A 4AC7C 3K4WA 4EPKA 4RDWA 4C6BA 1V7AA 1FWFC 3TN6A 4C6IA 3T81A 4H9MA 1UIPA 3AUOA 4LAKA 3MJMA 1E9YB 3RYSA 4XAFA 4CNSA 3UF9A 1ITQA 3E38A 4UBPC 2QT3A 4ICMA 2DVTA 4TQTA 4XD6A 2PLMA 4R85A 1QW7A 1YIXA 1FWEC 2Z26A 4H9XA 3PANA 1HZYA 3A3XA 3GG7A 4XAGA 4R7WA 3PNZA 1KRAC 2Z2AA 1RJRA 2R1NA 3NEHA 3S2NA 4ERIA 1W1IE 1P6BA 3A3WA 2BGNE 2OOFA 1ITUA 4GY7A 4JOMA 1ADDA 4KQNA 4GYFA 2I5GA 4C6OA 1YBQB 4D8LA 3IACA 2AQVA 4RZBA 4C6FA 2VR2A 4GBDA 4UB9A 4LCSA 4IF2A 4C6EA 4AQLA 4KEZA 1KRCC 4LAMA 2CZVA 1M7JA 4GK8A 3R0DA 2AQOA 3QY8A 4BJHA 3S2LA 4B90A 4LFYA 1EJRC 2HPMA 1WXYA 4C5ZA 4ERGA 2DVUA 4HK6A 3V7PA 4C6KA 4QTGA 3S4TA 1RAKA 4IFKA 3SFWA 3MSRA 4IGMA 2DVXA 3UPMA 1FKXA 2GWGA 4XD4A 1ZZMA 2FTWA 2PGRA 3LGDA 4DLFA 4C5YA 3T1GA 3QGKC 1J79A 1A5LC 1EYWA 3GU9A 3DC8A 2WJDA 1FWJC 2Z27A 1A5NC 1WXZA 4C6CA 1NFGA 1UBPC 4C6QA 4WGXA 2ZC1A 4H9VA 4NP7A 2D2JA 3OJGA 1YRRA 3B40A 3OQEA 3IRSA 4B3ZA 4NI8A 1GKPA 1V51A 2OGJA 3BE7A 2QVNA 2R1PA 3K5XA 2VUNA 1EJSC 2KAUC 3LU2A 1ONWA 3LY0A 3OOQA 3GTHA 4CQBA 4EPDC 2ICSA 2HNHA 3EGJA 2OODA 1V4YA 2FVMA 4QSFA 1FWDC 2HBVA 5CH9A 1RA5A 3B0XA 2GOKA 4IFKB 2O4QA 4ZSUA 3PNUA 3MPGA 3MTWA 3WZ0E 1A5MC 4XAYA 2VHLA 1KRBC 1EJWC 4IQJA 1POKA 4PCPA 2R1KA 4PCNA 4L9XA 4QROA 2RAGA 5HMFA 1E9ZB 4NG3A 1V77A 1XGEA 3FDKA 3O0FA 4LCRA 3URAA 3RN6A 1J5SA 3C86A 3N2CA 4DI8A 4GXWA 4H9ZA 5A6TC 4H01A 4IG2B 4CQCA 3ISIX 4V1XA 2Z28A 4DIAA 4DZHA 3IPWA 2Q01A 4H9UA 4C6JA 4GX8A 3OVGA 3QGAC 3TNBA 2ADAA 1EJVC 3FDGA 3T8LA 2Z29A 3HPAA 3CAKA 4KF1A 4H9TA 1YBQA 3LGGA 1RK6A 3KM8A 2FFIA 3CS2A 2O4MA 3TN3A 3NQBA 2OQLA 4ERAA 4H00A 4C60A 2EG6A 1M65A 5LXXA 1KRMA 2PUZA 3F2BA 1EJUC 1IE7C 1M68A 1DPMA 3DCPA 4L6DA 1NDWA 4G2DA 4IG2A 4WHBA 1R9XA 1RK5A 4LAOA 3A4JA 3E0LA 3URQA 1O5RA 1A4LA 1RA0A 2HPIA 2D2HA 1J6OA 4G7EB 4QS5A 3DUGA 3LA4A 4C6PA 1J6PA 4J35A 4HA0A 3URBA 1ONXA 2YB4A 2AMXA 3JZEA 3OU8A 3EWCA 3MDWA 1A5OC 4HJWA 3S2MA 4OFCA 3QY6A 1BF6A 4C6MA 4GOAA 1KCXA 2G3FA 1QXLA 4IH3A 4XD5A 5HMDA 3RHGA 4DI9A 2Z7GA 3AU6A 1S3TC 3ITCA 4IFRA 1YMYA 4C6NA 3E74A 3GIPA 3E2VA 1V79A 2VC5A 3UBPC 1FWGC 1P1MA 4F0LA 2R1LA 2Z00A 3EWDA 1EF2A 4BY3A 4QS6A 5E5CA 1A4MA 1R9YA 3MDUA 3IV8A 3IARA 1NDYA 4E3TA 4HK5A 3GRIA 4CQDA 1UMLA 3F2CA 4CNTA 2WJFA 2A3LA 3LS9A 3MKVA 3GTIA 3E3HA 4KEVA 5G4HC 2GZXA 4RE0A 4EPBC 1FWHC 4I6KA 5HMEA 4C65A 4PBEA 2FVKA 4EP8C 3IJ6A 3O7UA 3RCMA 4INFA 3ORWA 4F0RA 1RJQA 4LANA 2ANUA 1O12A 4DNMA 3MVIA 3HM7A 1PTAA 2YXOA 4WVXA 3B0YA 2Z2BA 4GZ7A 1XWYA 3S2JA 4LEFA 3GU1A 1I0DA 2GSEA 4GY1A 3PBMA 4CEUC 4LH8A 3GU2A 2P53A 1XRTA 3GTXA 2EG7A 3MVTA 4G7EA 2VM8A 4YIWA 4H9YA 4IGNA 2EG8A 3WMLA 3AU2A 3UR5A 4LALA 1K6WA 2Z24A 3LNPA 1PSCA 4LCQA 1FWBC 2HBXA 4DLMA 1I0BA 4DZIA 4P5UA 2E1WA 5FSDC 1JGMA 1K1DA 4I6VA 3WYZA 2PGFA 1YNYA 2XIOA 1R9ZA 1A5KC 4QRNA 2F6KA 2PAJA 2OB3A 5AKQA 4CNUA 1FKWA 4IFOA 3F2DA 2UBPC 4J5NA 1PB0A 3HTWA 3FEQA 3TN4A 3IGHX 1UIOA 4GY0A 4F0SA 3CJPA 1FWIC 4RDZA 4C6DA 4BKNA 3UR2A 4CEXC 3GUWA 1FWAC 2FTYA 1EJXC 4DYKA 1FWCC 3ICJA 2YB1A 2QS8A 4B92A 2WM1A 4DO7A 1POJA 2IMRA 4Z42C 4HK7A 1RJPA 2R1MA 3G77A 3SO7A 2W9MA 3OODA 4XAZA 1P6CA 4EPEC 2D2GA 1GKRA 2VC7A 2E25A
chains in the Genus database with same CATH superfamily
1WE5A 2NZLA 1F8MA 1JUBA 3P8IA 4B91A 1GJPA 4K38A 1GKQA 1QPNA 3CUXA 4KEUA 1KXVA 4KIRA 4UTWC 3VTRA 3PSVA 2A85A 5FF0A 3WMSA 1E4NA 1GQLA 3AHXA 1Z32X 1K8YA 2X8RA 1UR3M 1J0JA 4AHPA 3IEBA 2VFGA 3DH7A 3KZSA 3V1PA 1TTQA 1VFOA 4YTTA 1ZCCA 2VXNA 1ESWA 5FL1A 1V7AA 1WQ5A 2VC9A 3WDRA 1SR9A 4RK8A 2PDGA 4A21A 1JG9A 3SCNA 2I7GA 4TO8A 4ZTYA 2P1FA 3IIPA 2DVTA 3REQA 1FWEC 4W4QA 4GUJA 4JN8A 5M17A 3VZXA 4B2DA 4XSMA 1OB0A 1GHRA 4PTMA 4JTJA 2XISA 1JPDX 4S3FA 1R87A 3BZGA 3R0KA 1KV5A 2XIBA 3QGVA 3H2OA 2VR2A 1TMQA 1BTMA 4LCSA 4PTWA 3B9NA 3THAA 3O9NA 3CO4A 2PDKA 4KEZA 2CLPA 2QCGA 2AQOA 5DEZA 3E96A 1EJRC 3B0PA 2O9TA 1WXYA 4ZXLA 3A4WA 1MUWA 4IPNB 3JS3A 1YTKA 1P6WA 4GKTA 2WSRA 4KCWA 4WX2A 3WUEA 3EA2A 1QR7A 5LNUA 4O8AA 3FJ4A 4TX9A 2F8QA 2GWGA 5FEWA 1DHKA 5FEPA 1F73A 2OSWA 1N8WA 3LHTA 2IPGA 3QGKC 4PRTA 4IPJA 3LI1A 5CAHA 3ABQA 2R94A 3R0UA 3LBMA 3TTEA 3ZLGA 4HNUA 4JQ1A 3AHTA 3I4KA 3WDQA 1OG0A 4O1FA 4YCPA 3B8TA 3R8HA 5E93A 5FACA 2F9RA 5I3KA 5AC6A 3BE7A 4JR5A 1KLZA 1W9UA 2DV0A 4DUVA 3NJ3A 3LPOA 1XLAA 4JY8A 3GTHA 4FIQA 2ICSA 1SZFA 2I17A 2OODA 3MKCA 1W37A 1JZ5A 4JFUA 3UG4A 1NWUA 2VVNA 1KRBC 1XKJA 3CEUA 1PCWA 1E71M 3PBWA 1T99A 3W29A 4QROA 1T6MA 1E9ZB 2OG9A 3T2QA 2C16A 4NG3A 1S46A 3FDKA 3O0FA 4IXHA 4F9DA 4XVEA 5HNTA 2NXIA 4GXWA 1AJ0A 3P80A 2GSJA 1XYFA 3WBYA 3AROA 2QCDB 3BLKA 4C6JA 3W26A 3CTTA 4GCAA 4ZO8A 4IWWA 3WLHA 3W25A 4HVXA 2J7FA 2ADAA 1LWIA 3HG2A 3PTKA 1REQA 1X39A 5T9BG 1MNSA 4H83A 1R9XA 4FLRA 4ML4A 3OA3A 4JTLA 1C8QA 2HPIA 1RA0A 4WCJA 5DELA 4D6IA 2RKXA 2OOGA 2DZWA 4KFNA 1Q2RA 3GX9A 1TIMA 4OFCA 3A9IA 1RH9A 3TW7A 1QXLA 2VEMA 5HPOA 4AX7A 1RQHA 4DI9A 4HOZA 1S3TC 2VURA 1UD4A 2DUAA 1EFZA 4PL2A 2CCRA 4DYJA 1TVNA 1A4MA 2VRQA 4Y9OA 3FXGA 1FP8A 2YGYA 3LXAA 4PMDA 2CBIA 3I7QA 2A3LA 3GC2A 3WDPP 4DJED 1HJSA 3N18A 1KGUA 4AD3A 2CWXA 2ZTJA 3CPGA 2PDXA 3TWBA 3NSMA 2HTMA 1EIXA 4FNQA 5AYIA 2OLAA 4C65A 2EPOA 2D73A 1TKKA 3NSNA 1ECEA 3RCMA 2CERA 5H6HA 4L4MA 1SQ7A 3L4YA 1JCJA 9XIMA 4N02A 3VD3A 1LORA 2BHZA 1JD9A 4G7FA 2DEPA 4JNYA 3RR4A 3HPSA 2FDSA 2GFTA 2BX7A 4DPQA 2WVUA 2XWEA 1UUQA 3W83A 3FJ6A 4J4KA 5CC3A 2VT0A 5HA7A 4P7OA 1Z89A 1MUMA 4H9YA 4LUSB 3SUWA 4S38A 3AU2A 1YDVA 4GGBA 3BOLA 1R46A 1U5JA 2WPBA 1X1OA 3MO4A 1JAEA 3S0CA 3P6LA 2O9RA 3KVKA 2PDYA 3WQFA 1BVNP 2WSPA 4UNIA 3AHZA 4MNLA 1UZDA 2VYOA 3AISA 3TVAA 4F0HA 2VFDA 3DC0A 3TQ0A 1XGDA 3ME3A 4GJIA 1TWWA 3MUXA 2EO7A 4O4VA 2CLFA 2YL9A 3LXBA 3UXLA 3SCTA 3I3EA 3FGCB 1SJCA 3VMOA 1VBHA 3MC5A 4FF5A 4G8TA 5JBEA 1FWAC 3GC4A 4FB7A 2PC4A 1TJRA 5AC7A 1S5WA 1BGGA 3WDIA 1H1YA 4IISA 1MZHA 2WQDA 1RSCA 4Z42C 3WLNA 3CZJA 3TYBA 1K03A 4ZCWA 2VFFA 3PZIA 4K36A 3W7GA 3W24A 3VDAA 2P8BA 4XD3A 2TPSA 3H54A 3SDOA 4E4PA 2NQJA 4E6MA 1WPCA 5HOSA 3B8UA 4BF7A 2C18A 4Z1DA 3UPWA 1B3VA 3F4DA 5HUPA 1EJTC 4W8BA 4H04A 5HQMA 3WBEA 5HQEA 3UJSA 1NM9A 2XSBA 1ZHAA 4UTFA 2DH2A 4MAVA 3GTFA 5BU9A 3VIMA 2IUZA 3PP7A 2FZDA 2DFAA 3TH6A 3TW6A 4IUOA 4YS1A 4BR1A 1CXHA 3VD5A 1RQBA 3TN6A 4U3AA 3VYLA 3SCWA 1E4MM 1E9YB 4NNCA 1LROA 3A47A 4M80A 3WFZA 5D9OA 1KV8A 5CEWA 2ZZ5A 4R85A 4LY8A 2IKGA 3KRBA 4R53A 3KCOA 1JPKA 1RV8A 1KRAC 4KPLA 3K1GA 5C7HA 3VGDA 3GHSA 4L65A 3D0CA 4NVTA 2HE5A 1VB9A 4TX6A 1O68A 1H41A 4NJGA 5GQBA 3KBJA 4F40A 4TVDA 1FH8A 1V02A 4WKHA 3VM7A 4FEZA 2ZC8A 1MQQA 3SEPA 3WBXA 4C6FA 1UASA 4GBDA 1IZJA 4XZNX 4O4WA 1EXBA 3VX1A 2G97A 4J3UA 3R94A 3PBGA 3TFCA 3FA3A 3W37A 2GJLA 4KCUA 4BJHA 3HJZA 2HPMA 1R7OA 2DU2A 3CMFA 3FV9A 1K3UA 4MB4A 3KBMA 2MUCA 1DHPA 1H0IA 3CM4A 1WKYA 2ZOXA 1QNOA 1G69A 4MYXA 2FZ8A 2VEIA 2IQTA 1OYCA 1UC5A 2V3DA 1EL3A 2P3ZA 3WMCA 3WLPA 2CLMA 3V75A 2ZC1A 1HVXA 1QPKA 2OT0A 2I5IA 3PR2A 2Q3RA 4LC8A 4C7GA 1PIFA 1CXLA 1NQ6A 2DZAA 5BROA 3L4UA 2A79A 5REQA 1QWKA 3L5AA 4P8XA 2DZBA 4QSFA 1FWDC 3T6CA 2YCIX 1AK5A 4HZ8A 3UWZA 5F4XA 4JYFA 1X1NA 1GYNA 4C90A 1A5MC 1EJWC 3UVAA 1SW7A 1KD0A 3QPYA 4KGJA 3AFBA 3TQVA 3NPXA 3GBDA 2BVDA 3KLLA 4H8HA 4HYVA 1XG4A 1HIZA 1X6NA 2WHKA 3T2PA 1BF2A 4ECLA 2J66A 1GVQA 3M0LA 3T9PA 5FAGA 2Z7KA 1RP9A 2D22A 4DB7A 1FRBA 3ISIX 3T4WA 4DIAA 3CQJA 5EMJA 4XO7A 1SSGA 3S1UA 1Y7VA 3LCWA 5BW6A 1J93A 1Z3NA 4M19A 3CO8A 1Z7AA 3H2NA 1Q6LA 4H00A 2Y6ZA 1F4HA 3R2GA 1KRMA 3F2BA 4IGSA 2P10A 2V30A 4KCTA 4UMCA 4Z2HA 4N4PA 4L6DA 1W17A 4PEEA 4NAEA 1EX5A 2HNEA 5FJTA 1KLYA 5JU6A 2YB4A 1AUSL 1E56A 3N2MA 2QJIA 5HMDA 1E5JA 1JXKA 3EEGA 4AF0A 3ITCA 4WDUA 1LL6A 3ZJ7A 2J79A 4JFWA 3QFWA 3GC5A 1GOKA 1DIOA 4Z0JA 3MWAA 2QV5A 4ES4A 1OD0A 3ARTA 3F2CA 4FAMA 3DIPA 1SO6A 2ZZ2A 1M3UA 3FVMA 2WZHA 3GR8A 3KCJA 3GO2A 4UWMA 4OUIA 3NM1A 1AH3A 3B9OA 2GZXA 4EPBC 1XSIA 3IJIA 1UHVA 4MM1A 3UW6A 4EP8C 1OGSA 4PGLA 1JGIA 5TIMA 1A5UA 1UQYA 2KX9A 1KXTA 2VVSA 5ABTA 2ZVRA 2ABBA 3T78A 3USBA 1E55A 1CGYA 4O15A 1IR1A 2G4JA 4DRSA 4GZ7A 3N4EA 2Y8KA 1YXCA 2E9MA 1R3RA 2Y5JA 3SRDA 4B5VA 2ZTKA 4M81A 1KFJA 2NSXA 5A1AA 1AZ2A 1JCMP 1D3CA 4GQQA 5HAOA 4I6VA 2V5JA 4YTQA 1H61A 4I7VA 3ZYZA 3TAKA 2OEKA 4HU4A 3HU7A 4PODA 5DXXA 1PKYA 4M6UA 3S3GA 3CPRA 3WNOA 2ESCA 1UKPA 3M0YA 1XGZA 2NQZA 2QDDA 4ML9A 2WBGA 2E1DA 2FTYA 1EJXC 5A2AA 3ICJA 2QUNA 3MUZ1 1VEOA 3EMZA 1RBLA 4C1NA 1LYXA 1C8XA 4H2CA 1P0NA 3QPZA 5H91A 4WOZA 4WUIA 5F2IA 3M5VA 4JZ5A 3F5JA 4HT3A 3C0QA 1Q4NX 3UCQA 4UFJA 2Y1HA 4BFAA 4K8HA 1KM6A 3OO2A 3IIZA 4W8AA 4GC3A 1S5TA 4KETA 2J7BA 1UPMB 1PPIA 3PUDA 1L8NA 5FF2A 1OFPA 4R88A 3SUUA 1ZCOA 3CL8A 4AUBA 1H5YA 2D20A 4RPQA 1V6UA 5A6AA 1H7WA 3W1RA 4AIBA 3AS3A 1MW1A 1S38A 3E0FA 5CPMA 1HQTA 3FK4A 4NYYA 3E49A 3WQOA 4C6IA 4AWSA 1EHAA 5FD0A 1BHGA 3TROA 3W82A 2INEA 3UF9A 3UJFA 2WQPA 1YIXA 2A21A 4AZ7A 3NZGA 2QJJA 3DKJA 1PKNA 2EHHA 4P8VA 2A2IA 2FMOA 1KM4A 4CNOA 3B4YA 4MB5A 4J3TA 5J5DA 3O63A 1IXNA 1WO2A 5HANA 4QHRA 4FI4A 1P6BA 1J8VA 1EUNA 2OOFA 1ITUA 4E38A 3C2FA 4U2YA 3CTLA 1FFQA 5DF0A 3B06A 2X2YA 4ZQRA 4QE5A 2CLOA 4GGHA 4JTHA 4A3UA 4IF2A 2EPMX 4CCDA 5FESA 2VELA 2B7NA 3OIHA 5DRCA 1IWBA 2OZ8A 2CHOA 3WJXA 5F7UA 3CAQA 1AMKA 4AZIA 2C13A 1W5MA 5A8QA 3UETA 4WJXA 1UW9A 3V7PA 3SFWA 4LUIA 3DI0A 3CLWA 4U28A 2QF8A 3GZ3A 3VOFA 1DJXA 3KBSA 3H4GA 4AMAA 5KEZA 3N2BA 4IHCA 1EYWA 1W9PA 1OJXA 5AB3A 1XCFA 3H70A 1XQLA 3W38A 1UD3A 4LF2A 3USZA 3WLIA 4PTVA 3JZUA 5HJYA 4BI7A 3QLDA 3IRSA 2C19A 1GKPA 3IGXA 3W7DA 2OGJA 5K4XA 2PD5A 3JW7A 4K1WA 2E3ZA 5ABEA 1PX8A 5A6MA 3BAYA 2WV8A 1UR8A 1W1ZA 3M9YA 3WD3A 3K8KA 4XIAA 3MZNA 3ZJKA 1IXPA 3CWHA 2Y24A 1CLKA 2PP0A 1JCLA 3RPDA 1OQFA 1WUFA 1Q6GA 4JTAA 1JVNA 2VDGA 4KH2A 5B80A 4UTMA 1EOMA 1OINA 3UGRA 1Z8AA 5ABFB 3VIKA 1XBXA 4GFSA 4UQ9A 3IPWA 3ONBA 4L6HA 3RPTA 4PL1A 3SRFA 2PGWA 2X41A 4Z17A 1SM9A 3LDVA 2GYIA 1XR2A 2VOTA 4QITA 4GIEA 1BPLB 1PTGA 4A2RA 2OQLA 3MY9A 3TYAA 1RPKA 3LHWA 2ZE0A 2YBVA 3CH0A 1XLEA 5IBXC 2CW6A 2JKAA 2R6OA 3A4JA 1FH7A 1XLJA 3G18A 2AKMA 4L80A 2H9AB 4R34A 4X61A 3M0JA 2FZBA 2BOEX 4U2ZA 3L5LA 4HJWA 3S2MA 4Q6XA 2J8GA 4C6MA 3B8DA 1D8WA 4UTLA 1HX0A 3T09A 3TEVA 1YMYA 1PX3A 1FWGC 6TAAA 1EF2A 3O6YX 1S5VA 1R3TA 3B03A 3K4DA 2J75A 4AVOA 2PEVA 1EDTA 3PG9A 3BXWA 1BSLA 3TIMA 4GI6A 1IIGA 4NJIA 5G1TA 4YJ5A 4PZVA 1EO7A 3KRSA 3EPNA 1M7XA 2QPUA 4LBRA 2RJHA 2V63A 4Z08A 4DN1A 4UTIA 1EWEA 1TA3B 3LHZA 5BXPA 4RE0A 1A5BA 1H51A 2X0HA 3DGBA 1IZKA 1BVZA 3DDMA 3OZPA 4XZBA 4INFA 3GK0A 3NVTA 2OSYA 5D33A 3CK5A 4N0RA 2ANUA 3ARQA 4O57A 2ZUWA 1XRVA 2YXOA 1QAPA 3KS5A 3OB8A 5LGZA 4WR3A 4LV9A 3ZLHA 1JF5A 4Y96A 1KQZA 3GU2A 2PDCA 5IHSA 1TTPA 2Y70A 2EG7A 3EZ4A 3DYMA 1UA3A 2EG8A 1V0KA 2E09A 4MWAB 1Q7ZA 1I0BA 1VIZA 1U5VA 4TVUA 2PZNA 3BJFA 1BWVA 3WUGA 1ISZA 3EKGA 3PWIA 2XVNA 4O14A 2XIOA 4LUTB 1I2PA 4HSHA 3WJZA 3DX5A 2QJGA 4YU1A 4XZMX 3CMGA 1XYZA 2HXTA 1B2YA 4F9JA 3P61A 3NL2A 3QRHA 2ZXAA 2QS8A 1R86A 3AIUA 2FVLA 1UZ1A 1M41A 4ZO9A 3R43A 1K7XA 3UFYA 4B5TA 2OGYA 3REQB 2VRJA 4GYPA 3PM6A 2E6DA 3TU9A 2GOUA 1K70A 2ZUUA 3M43A 2GWNA 3AXHA 4M82A 2O55A 3GSMA 1Y5VA 3HG3A 4ZGYA 3PJTA 4AZ6A 2D23A 5A5WA 3LCGA 5DMYA 5D30A 1Q65A 1M1BA 3TTSA 1XFCA 4JTRA 3KP1A 2NVDA 4WDWA 2ZADA 4HU3A 3W7MA 4LYRA 4KIEA 3L5MA 1V08A 5KINA 3TC7A 4M51A 3WJYA 2DIEA 4HMCA 1T7LA 3MBDA 4NJJA 2ZYFA 3W1TA 5D9NA 3F5KA 4O1DA 1FWFC 3MI2A 4LAKA 3ZR4A 4CCCA 2F38A 3U2ZA 4YHEA 1KBKA 3NQFA 3SFKA 4UBPC 3N15A 1DWAM 4BHYA 1K77A 4UUIA 4DX3A 5AVHA 3A3XA 3GG7A 1MXSA 1CX9A 2HK1A 3L67A 1LRNA 3QZEA 5A6BD 2L5HA 2PRHA 1QI4A 4Q7NA 4PRWA 1DP0A 3S2NA 3OG2A 4DJFC 4X0NA 5JBDA 3VGEA 5FKYA 1UP0A 4PB4A 5DT5A 1RZMA 3IJ7A 2QCEA 5A6BA 4Q8OA 1J5TA 1E0WA 2XDFA 5A8NA 4YVVA 3THDA 3K4AA 4MNJA 3MWCA 2F61A 5C6MA 2NQ9A 4DUOA 1VCGA 2OWXA 2ZXQA 4ZQCA 3VINA 2P76A 4C5ZA 5HR6A 1F3EA 4H3DA 2BVTA 3QR0A 1MUCA 3MU7A 3LYEA 4ICNA 1OT1A 2DDXA 4UFIA 2UY5A 2ZXBA 3QEZA 4GI8A 2G3MA 1IEIA 3TCSA 2PGRA 4LVAA 1OABA 1GOOA 3BG5A 1YHTA 4G1KA 1JYXA 3TDFA 1BKHA 3VK5A 2P5NA 3SN0A 2HCVA 4LUTA 3RX2A 1XH0A 4G6CA 1QTWA 2OR2A 1Y5WA 4PMYA 4AIEA 5ENLA 3M6YA 1NP0A 5B7ZA 2BY3A 4GYPC 4YYCA 2G37A 4YTRA 2GJXB 3VIHA 3TCEA 5M5DA 5B7YA 4GH3A 2C0AA 1F5ZA 3GVRA 4ACYA 2WCAA 3S47A 1NH6A 3O6DA 2J4GA 4PMJA 3NZQA 4IFKB 1GOWA 3SQSA 3ZJ6A 2BVWA 3ALFA 3WLSA 4Q8VA 4N4QA 2GPTA 1H1ZA 1Q63A 4ROQA 2RAGA 3RRAA 3B8WA 1QPQA 4IT1A 3PPGA 1YKWA 2V2HA 3GFZA 3C86A 4DM1A 5G5IA 1YXYA 1QOPA 2IPJA 2FH8A 2O0TA 2IPWA 3H2CA 4YPJA 2QCHA 5LNWA 1NEYA 4UMAA 4XB3A 1ZBCA 1JZ4A 1DWJM 1UA7A 4R5EA 1M01A 3QHMA 1SO4A 3HQNA 4A29A 4H9TA 2HISA 3WH6A 4HPXA 1KXHA 2O4MA 3GG0A 3NXLA 1GQKA 5C9UA 1UJQA 1ZJIA 4TU1A 1D3GA 3WH5A 5CC5A 4PMRA 1BG9A 4AW7A 4D1IA 3WJWA 3BSHA 1CXEA 1J6OA 4PH6A 1GJWA 3SGZA 4XBJA 1I2NA 3WQ4A 3TNOA 3CQKA 3B0VC 4US5A 1T41A 3EWCA 3GHTA 2X1SA 1BKSA 5HNRA 1OCBA 2A7RA 4MLRA 4IH3A 1QRQA 3PUGA 4KRTA 2GSHA 3IUDA 4I9JA 5FF3A 1V79A 4M56A 2VX7A 4OTKA 3CASA 4F0LA 3C2EA 3PZQA 2TYSA 4WF7A 4W7WA 3G6LA 4QGCA 4E2VA 4LB4A 2IQDA 3E02A 4JN7A 4JXCA 2WBKA 4OHQA 3FX4A 4AXNA 4WJEA 1V93A 1QO5A 1TV3A 2B4GA 3QC0A 3E3HA 2PP3A 5G4HC 4CKQA 4I6KA 1I2OA 2B0MA 4LY4A 4YWSA 1E6PA 1DJGA 2FVKA 3P8JA 4TMCA 4MY1A 4S23A 4MADA 3B97A 1VCVA 3UWYA 3BSMA 2X2GA 5A8GA 3HM7A 2FHFA 1BYCA 3GFYA 3MMDA 4DF2A 3S2JA 4JPGA 2IKIA 1V0LA 5C7VA 2VC6A 4GY1A 3UY8A 1GZ1A 1JQXA 3NOYA 2DORA 3BW2A 3TYUA 5EFFA 3CV6A 2QCLA 4EXQA 1VPYA 2Z24A 1SZGA 3N25A 2Q8ZA 3BVJA 4J1OA 1TZ7A 2IQ0A 1TELA 1W1YA 4XTIA 3CUHA 3NPUA 4PBGA 4R7OA 1YQ2A 2ZA3A 5I3HA 3B8SA 2F6KA 3OYZA 3ZLFA 5LNRA 2VGIA 2O56A 1UG6A 2YL8A 4GHRA 2AAMA 1OX4A 3VIFA 2E5DA 1XL9A 4O12A 2XM1A 3W86A 2FGBA 3UXAA 2XH4A 3EX1A 2PURA 3LEPA 2HVMA 3FKKA 5DN1A 1G4SA 1RY8A 3CJPA 3TOPA 5C9ZA 2QUMA 2HK0A 3MO7A 1TREA 2VKZG 2CEQA 4CD8A 3BCFA 1E0UA 3CUZA 2OO6A 2D2OA 1GPFA 5FJUA 1DXFA 4PTNA 5DCDA 3W7LA 3DFQA 1YDNA 1FCUA 3WQGA 4GUFA 4IICA 3OZMA 5MF5A 4JIPA 3W2UA 1GORA 4AEOA 4Z2LA 1BVWA 3DG3A 2VEKA 3IGUA 3L23A 3ENLA 1PKLA 3XISA 3BURA 3HIJA 3LSCA 3VAVA 4JDBA 1XYAA 2VDIA 5K4ZA 3C0SA 1DWIM 1QHOA 4PBFA 1NDVA 3LLXA 2WB5A 4BQ2A 5BRPA 3LSBA 2OYLA 2J9ZA 3RXZA 1PO9A 3TN5A 1BEUA 3PZ9A 4RXFA 1ZJAA 2RH9A 2ZKMX 2OQHA 4WD0A 1MEWA 1KFWA 2J9YA 4CQ9A 3FYPA 4Y9NA 1ADOA 1H49A 4GVGA 3LV6A 4LV4A 3FFSA 4LW7A 2QT3A 4ICMA 2TODA 2F6XA 1TYGA 1XDJA 5G2IA 2AAAA 3LM3A 3MSGA 6XIMA 1K6AA 5M03A 3N13A 3QQ1A 2BP1A 4B3LA 3NQEA 1FH9A 1NWSA 4JNZA 4GJ1A 1SU5A 3L0KA 3TXZA 4D6EA 4YL2A 3UCCA 1EQCA 4RLIA 2EJAA 4HA3A 3GXTA 3ZT5A 1XBZA 3VCRA 1QNRA 4IOTA 4Q4RA 3GNOA 2WNNA 3KL3A 1S2WA 2NQLA 1UH4A 4C6EA 1I8JA 5J8LA 4NXSA 3UJRA 1L2UA 4CU6A 3T0TA 1U22A 1TWDA 1XI3A 1LLZA 4LFYA 3HV9A 4NX0A 4LRSA 1RD6A 4UCFA 3S4TA 4LAUA 4PB3A 3MUAA 1QO2A 4FP1A 5FJJA 4GLEA 1SJBA 5DQPA 2V81A 2FTWA 3LCHA 4DLFA 3I3BA 4C5YA 4R9XA 1J79A 3QJAA 4MB1A 3NYZA 5AC8A 4EF9A 4L6OA 4ZOEA 4C6CA 2HEJA 2NVCA 4XVDA 3VM5A 6XIAA 2CZFA 4MZ1A 4JHZA 2V5BA 3MHFA 1MNZA 5FJRA 5M1TA 3VGHA 4GD0A 4AHQA 4AVFA 2A6NA 3VI2A 4WJ8A 5FJOA 4LS1A 3TQKA 3EAUA 4HN4A 4LOCA 2UY3A 2DSWA 3W6YA 1TPH1 4GJJA 2YFNA 4NKCA 3NM3A 5EB8A 3NEVA 1DJWA 5AVNA 4O0KA 1MW0A 3BOXA 1V6WA 1XBVA 3W1QA 3FA4A 1KBBA 1US2A 1H7RA 2JK2A 1JNEA 4JQ4A 4ZTXA 3O6CA 2WOQA 1UOKA 1XQKA 3V18A 5BMWA 4LCRA 4PRRA 4DI8A 1CLXA 2WM0A 5A6TC 1VAHA 4H01A 1I4NA 3I10A 2XUCA 2G5WA 2Q01A 3SSZA 3V35A 1KM2A 2JKEA 1K8XA 1G7VA 3K46A 2Y0FA 3T8LA 2J7HA 1VJIA 2CLKA 1R3YA 3UG3A 2FFIA 2C8NA 1OK4A 1TQXA 4MNMA 3I6RA 2RDTA 3SN1A 5GJPA 3AYRA 2NWRA 2NW0A 1M68A 3DCPA 2OXNA 5T9CE 5CPTA 1XRSA 4V15A 4XZIA 4IG2A 2P0IA 2ABAA 4LAOA 4HCDA 1E43A 1E0TA 1XFBA 3CV7A 4RL3A 3RU8X 1M6JA 2DIKA 2PGEA 3HGSA 4G7EB 1L6FA 3BC9A 1YEYA 4BF9A 2JIWA 5FA5A 1LT7A 3FHQA 3CUJA 3TK7A 5FAJA 2PDJA 3EMQA 3NQGA 5LIWX 5GPRA 1KTCA 4GOAA 3RMEA 2HVNA 4UTHA 4AYGA 2A7NA 1G01A 2QPSA 4M1BA 3ZVHB 4Q32A 5FEZA 3K13A 1IXOA 4LQ1A 1SO5A 2OTDA 2C6QA 2YDAA 3ANUA 3IV8A 1CXKA 1RBOB 3R10A 1KR1A 1EEXA 2VFIA 1JEZA 4O53A 4YXGA 3QSTA 3SECA 3WQEA 4BQ3A 1QNPA 1LBFA 4CU7A 1UYQA 1TJ2A 3CZGA 3M0KA 1R2SA 3EKLA 3TMLA 2QDEA 3GW0A 3MP5A 2WMGA 3PJWA 2WCGA 3EXSA 5D4YA 3G6MA 4F66A 4LYPA 1HKKA 3NPVA 1XWYA 2VWTA 1SMDA 5HQLA 1US3A 3DZ1A 3VVGA 4AF0B 4CNPA 3H8AA 4JL1A 3VOHA 3DECA 3CH9A 3VD9A 4HN8A 3KTCA 1UKQA 3VCCA 4D71A 2Z1WA 1H62A 1OFEA 2OX1A 1OX6A 2W3ZA 4LU0A 1WKEA 4LYKA 4P8WA 3RG6A 5EKYA 1GGOA 1Y5XA 2V38A 3N11A 3BAIA 3W7QA 4NQ1A 3QZAA 1AQ0A 2FB3A 2FMNA 4FNTA 2CIPA 4J3ZA 5IBXA 1KFLA 4IQDA 5HNUA 3MMWA 3VUSA 4L1GA 2W79A 4R3UA 4MJMA 3FEQA 2ZZ4A 2YSWA 2BOFX 3RNDA 5GNYA 2PDWA 2DZVA 4NIRA 1UR2A 1SW0A 3LK6A 3AALA 1OC7A 1T8QA 1XM3A 1FX6A 1J2WA 3GUWA 3EWZA 4PMXA 2KZHA 3RR1A 3DBPA 3M6DA 1TPB1 4G56A 5C9XA 1QU4A 3L4XA 1BWLA 4HYRA 1YE6A 2YLAA 4A3HA 1PV8A 4L1WA 2VR4A 1RVGA 5D05A 3UWQA 2VC7A 2QW5A 5I0DA 4PCFA 4KWSA 3KHDA 3IIVA 2V8ZA 4QISA 3A22A 2I14A 5HWJA 7REQB 4GG9A 2IXVA 3MA8A 1A47A 1CBGA 3U8GA 3LM7A 4FA3A 5FSEC 3NG3A 3NWRA 3OLEA 5CJMA 3ID7A 1CNVA 1TV4A 2Q09A 1B0IA 3GXIA 2UY2A 4LUJA 2X40A 3LBCA 3LMYA 3RAOA 3ZWTA 4HSNA 2WW5A 3IK4A 2G95A 3W1LA 1BFNA 3ZFHA 3NQ7A 2YZ5A 1W1VA 1NVMA 3EX3A 4EPKA 2FZMA 4C6BA 3NA8A 3TA6A 3NNTA 3T81A 3C8FA 1O4UA 1UIPA 3ZSSA 3QC3A 4C7FA 1D2KA 2P8CA 2Y7DA 4ZQMA 1JZ7A 4XAFA 1N82A 4LB3A 1HVQA 7CGTA 4D8AA 4IX2A 4AD4A 1HZYA 3HURA 1OCJA 3L4VA 3TC3A 1Z6KA 3N2XA 5ECVA 2F2KA 4NJHA 4DVOA 1XLKA 3AIQA 3BAKA 3MV01 4KFOA 3W7KA 1IEWA 2ZX9A 4UTWA 4HP5A 2BGNE 3STFA 4JOMA 1XYCA 4KQNA 4DBWA 3W81A 4QDMA 4BQ4A 1JAKA 4C6OA 4GUIA 4DELA 3AYSA 3EOOA 2CU0A 3DI1A 4QX4A 2X1IA 5A8MA 4GACA 1AQHA 4LYQA 1KW1A 5XINA 3G1HA 4QLKA 2JKPA 2PWVA 2CZVA 4UR9A 2WCSA 3KDOA 4AZCA 4RKAA 3H22A 2CZ5A 5CPOA 3CPUA 1VEPA 1OX5A 4IFKA 3T55A 3WN6A 4HOXA 3GDMA 3QBUA 3H2MA 3NQ8A 5CC6A 2C91A 3HV8A 4X60A 4FXJA 3WH8A 1FWSA 1WCGA 4JIIX 1WDQA 4ENLA 1VQTA 4K3ZA 2ATSA 1A0EA 5CGTA 2WJDA 4IIGA 3T0DA 3UWEA 3BMWA 1A5NC 1QK0A 1FDYA 3GVWA 5CSUA 3O05A 4DYEA 1PZ3A 2NUWA 1MRAA 4IIDA 5C2GA 1TFVA 4ADTA 4UFKA 5LXEA 5D8ZA 2AQWA 4YWIA 2HRWA 3SY8A 1KNWA 5CBJA 1XIMA 3TV8A 3W71A 4ATWA 4LC6A 5ABFA 1VJSA 3WY1A 1HJQA 3L0GA 3MTWA 4MIMA 2VOMA 1NQKA 1POKA 3AAMA 3KTXA 4DJFD 1TJPA 2YCKX 4FF7A 2YBUA 2Y88A 2EGZA 3PFRA 1RVKA 3M16A 4PCSA 1UWUA 1QK2A 3TYZA 3PTMA 3P0WA 1GQNA 1HNYA 1TPVA 4ASTA 3AZRA 3PZTA 3T44A 4ZMGA 5CG7A 2H3DA 5DLCA 4FNUA 2H9AA 3ABSA 1DXIA 3HPAA 1BRLB 3KFTA 1XICA 5AOUA 3EWYA 1YBQA 2YPIA 4JX6A 3GHUA 4HKPA 3I3DA 4H6EA 1KGWA 4S3EA 1R3QA 2C79A 2D0GA 1TO3A 3ARUA 2IKHA 4M6QA 4XUYA 3V1HA 2GJPA 3W1AA 3URQA 4GYJA 4QNEA 4DXXA 1DJHA 4QJ3B 4QS5A 2A3AA 3I65A 1VYSX 1FTXA 1TJ0A 3MHUA 4IPPA 2ZZ6A 3H53A 3UZWA 3GYCA 4W89A 1NIUA 3ZSTA 2AMXA 3UU0A 1LRTA 2I57A 1B57A 3UG8A 4ORMA 2Q8XA 3ITXA 4E0CA 5E6YA 5I06A 4NSBA 4IFRA 4HPJA 1TSIA 1X8FA 4MFEA 1W5QA 1Z42A 2W61A 3ANVA 4E2DA 4FPSA 1L0PA 3VKKA 5CPLA 1OX4B 4IL0A 3SJ3A 1EBHA 4QM1A 3DHPA 3VFLA 4ZXOA 2PBGA 3GRIA 4CQDA 3U7BA 1Z9AA 2OZ0A 2X09A 4S1FA 1UWIA 5G4WA 4CNTA 5BU6A 1VF8A 3MB9A 5HPCA 2JF6A 3ZS4A 1AH0A 4BEUA 3PZGA 2VWSA 5L9FA 2FB2A 3R4IA 2EJ1A 4O1EA 1XIIA 3KRZA 3BL3A 2JEPA 1X8CA 4AZCB 1XHGA 1K7FA 1AZ1A 2NXGA 5BWFA 1ZB5A 5BYWA 1G7UA 6CGTA 1DE6A 1JDAA 1OF6A 1C8VA 1IGSA 3B0YA 3VOGA 1NP2A 3K30A 3I6EA 2YDQA 4ZA0A 4B5SA 4CN6A 4EANA 3UNDA 3TTYA 1OYBA 3SUTA 3WNKA 2XIQA 3AIBA 2ZDRA 3ZM8A 3L7RA 3S5YA 1I9CB 3MP4A 1TZZA 1T8XA 3LCFA 4K7YA 3RX3A 2PGFA 1V3JA 4X3ZA 3OVQA 5AECA 1M7PA 4NASA 4L4OA 3TJ4A 4FXRA 4HNTA 4GI4A 3GAKA 3UD6A 3QM3A 3F2DA 4PUJA 4OUEA 3D3AA 3HTWA 1UMYA 5D37A 5HWMA 4BCEA 1UIOA 6ENLA 4GY0A 4TMBA 4PC8A 1U1UA 4N9DA 4I9MA 1R3VA 4P7QA 3W7NA 4GE8A 3MUCA 2OEJA 4DYKA 4QBXA 4U4MA 3V16A 2GVJA 1FWCC 4DJEC 1XUUA 4MLJA 1WAWA 3VNLA 3BPWA 4IMCA 2X1TA 5ABHA 2QEZA 1XPYA 1QT1A 1UWTA 1GG1A 1VFMA 3WLOA 2HWGA 4EWND 1PYFA 4WKAA 3N2TA 1R3SA 2BB0A 3NZ1A 3GIQA 3W7IA 1ZAIA 5CPSA 3K2GA 3APYA 2H8ZA 3CQ0A 2XPKA 3PBUA 1E6NA 3KXQA 4JEQA 2WZIA 1SVDA 1M5WA 3ARSA 2PLCA 3KBVA 2P50A 4AAJA 2E6YA 3PVFA 3CQIA 2YCEA 2QR6A 4OV9A 4RDVA 2VX5A 1CGXA 2OPJA 2C3ZA 3DHFA 3SUSA 1GPWA 5E1QA 4GISA 3C2YA 3QN3A 3NFUA 3K4WA 3O6AA 5C55A 1A50A 1PXGA 3VA8A 1G6CA 3BAJA 3AUOA 4UOZA 3BJSA 3QKEA 1P7TA 4BQ5A 3RYSA 1YXDA 3VNZA 2W27A 1ITQA 3V3WA 4QAWA 3NOEA 1XS2A 2GK1B 4LUSA 2IXUA 1HG3A 1UKOA 3WL0A 3PANA 4XAGA 1LZOA 4L9YA 2GGEA 5HNNA 3ZT6A 3H7UA 1UUMA 1GTHA 5HUOA 2PWFA 3BARA 3B04A 2EAWA 1VCFA 4LWWA 3HPFA 1C90A 3MI6A 3BLDA 3HFTA 4QSHA 4O1AA 3B3DA 4Y6GA 2I5GA 3FGCA 1O5XA 4JCLA 3WH7A 2QLYA 1E15A 2CESA 2QMJA 4W7VA 1S2UA 1YBQB 1VBGA 2PS2A 3WENA 4XKYA 5D8WA 1HUVA 5I24A 3W00A 4P7NA 3AXMA 4DUXA 3W87A 2R24A 2YXXA 4GIRA 5E9XA 3QY8A 2ODOA 2VO5A 5KZDA 2UWFA 4H7VA 2R14A 3DESA 3C0JA 4ERGA 4HK6A 4DWSA 1C8YA 3FCPA 1W9DM 3AOFA 1KXQA 3S1VA 1PHQA 3LCLA 3DFNA 3ITLA 2V67A 4HQVA 3EDEA 1TPWA 5TF0A 1EXPA 4OOZA 1FWJC 2WSYA 3ABXA 4C91A 5CZJA 3HZ3A 5EBAA 2XVGA 3C8NA 3QYQA 4H9VA 4N9BA 1FXPA 3WLJA 1W1PA 1ZL1A 5IRPA 3ZT7A 2BFGA 5HJXA 4E4FA 1ZENA 4X63A 3BUVA 3VDHA 3EGJA 3WK3A 1UKSA 2MNRA 4L56A 2G3IA 2HBVA 4ZEPA 2C1HA 4IMFA 3B0XA 3BZJA 3MUY1 3MI3A 3KOFA 3MBFA 3C4UA 3DFPA 2J62A 1WZMA 5I3JA 4WY0A 2R1KA 4EAMA 2A0NA 1RALA 5CGQA 3C2RA 1EC9A 3WUBA 4I5RA 1J0HA 2PDPA 1XGEA 3D47A 3OA5A 2OLSA 4W85A 1L8PA 2OVLA 3GR4A 3UESA 1JZ3A 4V1XA 5D04C 2E40A 4AD5A 4HNOA 2WHLA 3H23A 3N6HA 1XYMA 1LCOA 3ZQ9A 1DJIA 3QGAC 3WG6A 1CCWB 3CAKA 3WQWA 3SURA 2NX1A 1PUDA 3CS2A 1W3TA 4GPNA 3TN3A 2VZUA 1B5TA 4RX0A 1EJUC 1IE7C 3RUBL 2ZBTA 3GXNA 5IHRA 1U1HA 4FNPA 3UZYA 4MKVA 1RP8A 2XHYA 2ZX5A 4UNLA 3TW9A 2QHAA 4Z2JA 1ODZA 3RX4A 5CBBA 2FHCA 4C7DA 2D24A 5KTLA 1CENA 3UXKA 4HA0A 2BBFA 4QQ3A 4LVDA 5F4WA 4GUGA 1W1TA 3CB8A 3AU6A 4BWLA 2PCQA 1EA0A 3KL0A 3RILA 1RCQA 1H5VA 4O28A 3AJXA 1LRQA 3IJQA 1IT8A 2P3EA 4AB4A 3MDUA 5TQLA 9RUBA 1E6RA 1F9CA 3K8MA 1F74A 3S5NA 4HK5A 3MYOA 4W93A 3DOPA 3NQDA 4CCEA 1VLWA 4DY1A 4F8XA 1JRBA 3GTIA 5H8PA 2VFEA 4KEVA 4QDWA 3EA1A 1XIGA 3PF3A 2VX6A 4FLQA 3IVSA 1UOZA 3TOYA 2QJMA 3IJ6A 3ORWA 3P5ZA 3GDKA 4PR4A 2BHUA 3DU0A 3N6QA 3BSGA 4JHOA 3G2GA 1FY6A 3SRHA 1ZP4A 4JIHA 4LEFA 2NV1A 1JRCA 1H2JA 1VYPX 2DSKA 1OIMA 3MMTA 5AFDA 1G4PA 1W2VA 4GVHA 1ZLPA 5EU9A 4YN5A 3QHNA 2Y2WA 1HJUA 4OECA 4NRRA 4IGNA 1QBAA 5GVJA 5XIAA 3W2LA 4MGGA 1UJPA 3PN8A 1TR9A 2FGLA 2ZZ3A 1CGWA 2PDBA 6PTDA 4ZB0A 1J01A 1B3YA 1XD1A 4XZWA 5EMLA 2NX9A 1DWHM 3E0IA 4QEEA 5AKQA 2C7FA 2XVKA 1S2CA 1EGVA 4DBUA 1KM1A 1PWMA 4OBRA 2QNEA 1LJYA 1ZFJA 3WEMA 1JD7A 2E0PA 3LRLA 1TZ9A 4F0SA 3S6DA 3W76A 4M8UA 2FZ9A 1B4EA 3FYYA 2CYGA 4UZUA 4PN2A 1YDOA 4DWSB 2R1MA 3GXPA 4ACZA 2WLZA 4XTDA 4YLWA 1H63A 2GDVA 1CECA 3P0XA 1W2PA 3U3HA 2VCBA 1TMHA 3D46A 4KESA 1OGBA 2OSXA 1E51A 3O2LA 4TX8A 3EXTA 1HKIA 4DBSA 1M7OA 3YPIA 4US5D 1Q3NA 3NURA 4ZE5A 4TTUA 1C3FA 1E70M 3VGGA 5A69A 2VQUA 5C71A 4OOUA 2GDQA 4NZJA 2QF7A 1JDFA 1IF2A 3JRKA 5DCEA 4XIMA 2Z4GA 2VTFA 4ZFCA 2WJEA 4KMQA 1UROA 3TKFA 2TSYA 4Z1YA 3TR2A 2DJLA 3S9YA 3T07A 3F4VA 3HA1A 3IAPA 3NTYA 1S1RA 3W7PA 2J27A 2QDGA 3BLIA 1JYVA 4NNAA 3W1NA 3CV2A 4H9MA 4HIBA 3QV9A 2REQB 1UBSA 4HJFA 5C0QA 3C3NA 4M1RA 4UCGA 1NSJA 3G1YA 3GW3A 4DBEA 1OC5A 2Z26A 4H9XA 4E3VA 1CI1A 5CXPA 3G0UA 3FAWA 1Q6QA 1TPC1 1F05A 3QMTA 2ZA1A 2Z2AA 1AA1B 3GG1A 1RJRA 1TX0A 2QUTA 1OHLA 2R1NA 3VIJA 2R91A 1UWQA 4UTUA 4B9ZA 4AHOA 5CG0A 1SZRA 3H7VA 5JH2A 4MVAA 3FJLA 4E4UA 3AC0A 1ML1A 4C1KA 3LV5A 3W1PA 4UTKA 2D0HA 1CB7B 3AXKA 4JTIA 5TBOA 2V69A 3U0HA 5CZ0A 3MS8A 1S2AA 2POZA 3CT7A 3EOLA 1QI2A 2OLHA 4K6AA 4AG0A 3GKAA 1DWFM 2V5DA 4QTGA 5BWAA 1RAKA 4L64A 3AHYA 3QKZA 1W1A1 1UUOA 1F3TA 2X1RA 2F84A 2Z1VA 3LQGA 3V5OA 4JX4A 1W8GA 2YJQA 3STGA 1J2BA 1HL9A 2ISFA 4RW3A 1XLHA 2WPGA 1VJZA 3GU9A 3AMCA 4JYDA 2XINA 4IP5A 5AYBA 3R8GA 1TE1A 2Z6JA 5AYXA 1B3ZA 3WEZA 2ZRVA 2V2CA 3APGA 2A5HA 1GVSA 1LWHA 3CNYA 5A94A 4B3ZA 3E5PA 2R8WA 1XW8A 5IDZA 4M6VA 1PVNA 2OMAA 2DH3A 2E6AA 3PUEA 4ZL1A 1RBAA 4EPDC 3V5CA 2RUSA 4TV5A 4TR9A 1AW2A 1V0MA 3EB3A 3ZR5A 3DFTA 1CWYA 5CSYA 8A3HA 4ZSUA 2RJGA 1JFXA 1W31A 3FOKA 3AS2A 3WJSA 2DGAA 4IQJA 3E2RA 4GXPA 3BLFA 2DT3A 4URIA 3H2FA 2VCCA 2PLJA 3L4ZA 5D2WA 1HO4A 2C15A 3KL5A 3WO8A 1IV8A 4Z1AA 4MJZA 3IS4A 4LS2A 4XX6A 4WY0F 2VD9A 4H9ZA 4IG2B 3PZOA 4OWGA 4DZHA 1GVEA 1GVRA 2DJXA 2PP1A 1WDSA 3SUVA 1AJ2A 3O8AA 3VKDA 1AW5A 4KF1A 3TTOA 4UFMA 4Y9AA 3TYCA 2J6VA 2YCLB 4KWOA 4ERAA 1ISWA 3RGTA 5IOBA 1W5PA 1SYTA 3ABRA 1KKRA 3OZOA 4MJ4A 5H8MA 2WHMA 1O5RA 1LLWA 1TV8A 4OE7A 3AHVA 4F2UA 1GYMA 1GONA 1J6PA 2DZUA 3TSMA 3B8VA 3L4WA 2OKTA 3EOEA 3M47A 3DERA 2ZX8A 3SQMA 5BXTA 4X22A 2Z6IA 3EDJA 1QI3A 1YYAA 2IKJA 3CXOA 3GNDA 5AHMA 4AZBA 3CQHA 4W9TA 5KZMA 4RNFA 2G3JA 4MAZA 3XINA 1OFQA 3B9EA 2J7EA 4QEHA 3LERA 4FHAA 3IV3A 1VEMA 1XLGA 6REQB 3E0VA 3OGRA 4UR8A 5CCZA 5LA1A 1G9HA 1JDEA 1C93A 3RJYA 4GNJA 1OIFA 4HHPA 1NELA 4JD4A 1CGVA 1PS9A 3UYCA 3GVGA 4QG9A 5F2LA 1A80A 2F2HA 3NO5A 1E1EA 1PHWA 4U5IA 4YHGA 1X1ZA 3WQVA 4DNMA 4UQDA 4PB5A 4U33A 2J77A 1WOAA 1GTEA 4XZ9A 1M04A 1DQUA 1GVYA 3GU1A 1K9DA 1OCQA 1ZP3A 2HMCA 3N04A 5U7SA 3WD2A 3W7RA 5I2UA 3POCA 3M7WA 5J04A 4DXVA 4P61A 1WYIA 2B7QA 5EL1A 3DENA 4G1NA 2C14A 4DZIA 3DN5A 3O06A 1SW3A 4BF5A 3RF9A 3BLEA 3PULA 5HJLA 4Q8UA 3XIMA 3HG4A 1GQJA 1GW1A 4C1LA 4W88A 1FKWA 3AYTA 4PUKA 3UCDA 1A0DA 4ROPA 3WLKX 4Q8TA 4PMNA 1C9DA 3LTYA 3QR1A 1QNSA 2HROA 1FWIC 1FFRA 3CEPA 4RE2A 4RDZA 1ICSA 2RDXA 2DSZA 4K39A 3T8QA 5CSRA 3UWUA 4Z2GA 4FNRA 4WDXA 3RO6A 1HGWA 1EWDA 4HK7A 4HMNA 4QG6A 1HJXA 2VP8A 3HQ1A 1NAL1 4J3WA 2YXGA 1W9BM 3L66A 3VNYA 1P6CA 3VD7A 2VJXA 1SFTA 2PTDA 5I3FA 2WK2A 3HGOA 2GK1A 3CUFA 1ZQ5A 4D6FA 5BNKA 4ZSTA 3M0XA 4AEFA 3NQVA 5I3IA 3IJ9A 1SSDA 1KCLA 2HQAA 2YKKA 4RNIA 3LI0A 4D6JA 1DIKA 3P93A 3PAJA 4O13A 1E6QM 4JTSA 1IWPA 2GLKA 1TRIA 1VC4A 2WWCA 3AQUA 1HXJA 1MRQA 1JF6A 1O60A 2OYKA 1CEOA 2WMIA 3W02A 4I7WA 1MDLA 3VO0A 3NL5A 1T40A 5F1VA 2Z25A 1G1YA 4RDWA 4NZFA 3A12A 1WDRA 2PRLA 5I03A 3E0WA 2ZCGA 3UJEA 1OC6A 2V68A 3E6EA 3LX9A 3GM8A 4QLLA 2BNJA 5CZTA 3PNZA 3A23A 1VD6A 2QV4A 4WXYA 3CBWA 4TTGA 1KO0A 1JCXA 3LGEA 4S39A 2WSQA 1FCBA 2PU0A 2XFRA 3VOIA 3HPXA 3OIXA 4NXKA 2XGBA 1W0MA 3DFOA 4GIAA 3WF4A 4HOWA 8TIMA 1SGJA 2PPGA 3A6OA 4A6GA 3N4AA 1QCWA 3FA5A 3HN3A 2XGIA 1K02A 4A3YA 2OU4A 2J7DA 3R0DA 4JFVA 3SIZA 4RV8A 1XX1A 3PWGA 1L9WA 4MWAD 4FLOA 4IMGA 3QF0A 3SCVA 4K1GA 1E72M 2XIMA 3M07A 1LG2A 1TR1A 3BAXA 2DVXA 1THFD 3UPMA 1FKXA 1F3WA 4XD4A 3OBAA 1XJBA 4RE4A 4IQEA 2QIWA 3SI9A 3T1GA 3IRDA 5GJMA 1LOQA 3APTA 1WXZA 1TVPA 5K3VA 1TUFA 4WGXA 1TUXA 3J7HA 2D2JA 4E2BA 4JTQA 1OZMA 1BLIA 5L6UA 4HMEA 3RU6A 5IFTA 1JQVA 4EF8A 2R1PA 3R89A 2E28A 4DJFA 1MFVA 3T42A 3CZEA 5A95A 1OZQA 3DEQA 1O94A 3OOQA 3N17A 1V4YA 1X7FA 2J88A 3GVQA 1OD8A 4AIUA 3PNUA 3WZ0E 3GR7A 4MUZA 2GVEA 4GZJA 2MANA 4AY8A 1W3LA 2CLIA 1OEPA 4AY1A 1OFRA 3HG5A 1NOUA 5C70A 2VQTA 3N2OA 3DG6A 3VU2A 2IPFA 3BGJA 1DYSA 1L6WA 2J74A 3O15A 3NQAA 2PB1A 2DPEA 2OZTA 4R33A 5HDRA 2B7OA 3MMUA 1RK6A 3AMLA 3KM8A 1H7PA 1FHVA 1D7KA 1GT8A 1KM3A 2GL5A 2C71A 1DPMA 1OBAA 1US0A 5K9CA 4WHBA 2HVOA 1RK5A 1XSJA 3E0LA 3N73A 3JUGA 1A4LA 2OWWA 2GJNA 1GZGA 3HB9A 1EIBA 4JTGA 1S2TA 1C7SA 5CC7A 1V3KA 3JZEA 3WUFA 2ZWZA 4Z1CA 3F5LA 4AZGA 3RHGA 4LBUA 3TSDA 2Q6ZA 3OHIA 1W8SA 1PEZA 2X1UA 3AYVA 3PUOA 3A4AA 2O92A 4BI6A 4BA0A 2EKGA 4C6NA 3MHGA 3E2VA 3ZR6A 3UBPC 2JIEA 1R8LA 4YYFA 1W54A 3CAVA 3OP2A 1P43A 3M0VA 1G4EA 2FIQA 4AZ5A 2VGFA 1V0NA 2ISVA 4M24A 5CZKA 1KB3A 3MCMA 1AL7A 2A3HA 3AIWA 1M53A 4K7VA 3WQPA 1LQ0A 2C1GA 3B8IA 4DJEA 8XIAA 3UA4A 4P8UA 2PCEA 3BW3A 1CGTA 3CWOX 1VR6A 1MW2A 2TMDA 3S9IA 1I45A 3S6OA 5AYYA 1DBTA 3MW7A 1ZBVA 2EPLX 1SFSA 4DJDA 4H8VA 4JICA 3VDBA 3AWOA 1Y65A 4AVNA 2QZRA 2VR5A 4MDPA 4YIWA 3MSYA 2I16A 2NV2A 4AU0A 3VNJA 3S1GA 1PSCA 3AWNA 3WF0A 3TJLA 3UQNA 1TVLA 2A4AA 2BXYA 1UD2A 5CKSA 5TD4A 1X7IA 4JDYA 5A6SA 1JNDA 1WB0A 3AS0A 1BXNA 2QCCA 5E0FA 3H55A 1ISVA 1XCXA 1ODUA 3EA3A 1O1HA 1PDYA 2XGZA 2PMQA 1E6SM 3GG8A 3C3UA 2Q8LA 3P81A 3C0LA 1DXEA 4GBUA 4AY7A 4WSKA 3W1MA 3RRXA 3TFXA 4TIMA 3VE9A 3GD6A 1MDRA 3C52A 4DNHA 3ZVHA 4B92A 4WZHA 1POJA 4A2SA 4EXAA 1B31A 2OCZA 4A3RA 2GUBA 1YDYA 2YR1A 4MPQA 4GINA 1XCWA 3DG7A 4MHBA 1O5QA 1C91A 3F4WA 3CU2A 4FO4A 4FNSA 2V9DA 4ZFMA 4IPLA 5CZSA 1H7XA 2PDMA 3R1ZA 2AL2A 5ABGA 1P7TB 3IK2A 3KZPA 3CGTA 5I09A 4N9CA 1VFLA 4IZGA 2OFJA 3KWSA 3DYPA 4EWJA 5I79A 2D69A 3M41A 2W63A 2I9UA 3B9AA 3TR9A 4H6KA 2OWCA 1VLIA 1HL8A 1ZPTA 1DKWA 1KBJA 3OZYA 4DAIA 4J40A 4JFTA 4O50A 3U48A 2VFHA 5IFPA 4NF7A 5XIMA 3T0AA 3Q67A 2WWDA 4LGXA 5JXQA 3ZMRA 4NILA 4UC5A 5BXSA 3O0KA 3A3WA 1HW6A 1XC6A 3SB0A 3WF3A 8XIMA 1V6YA 1AQFA 4QXIA 3S6TA 3GHRA 4A3QA 3QW3A 2PTWA 3NQMA 1IIHA 4G9PA 1JUEA 4MJ2A 4AQLA 3LNMA 3WEOA 4S3JA 1TPUA 2Y7EA 3FW6A 1KBLA 2QIIA 3KCLA 3TJIA 4L7ZA 1E3XA 2HE8A 1TJ1A 4O1CA 1QHZA 1JZ6A 3RJXA 2J25A 4RZ6A 4XKMA 3MSRA 4E8GA 2AGTA 4IIBA 1K8ZA 3BG9A 4P2VA 1W9XA 1OFOA 3LGDA 3VGBA 3VOJA 4OJYA 1E6ZA 2NT1A 3DKLA 4IP4A 1PYMA 2INZA 3QQ0A 1MEHA 3U2OA 3ITGA 4JNMA 1QPOA 3BQ5A 2QQ6A 3BCJA 2YW3A 4Q4MA 3OQEA 4HBKA 3WNNA 5KITA 4NUWA 1V51A 2YL6A 3EX4A 4R7JA 1E5NA 3KOYA 5CJ5A 5JMUA 5JH1A 1OT2A 3G8EA 4DBDA 3KVJA 2BZNA 2CZDA 1CW2A 3WLTA 4TUFA 4GKLA 1FCVA 4CQBA 3GDTA 4WOQA 4M5PA 2E6FA 2DW7A 1Q6RA 3ABZA 2FJKA 2PSNA 4NU7A 2GOKA 3HGJA 1Z41A 1NARA 4XAYA 1OVDA 4AFYA 3L12A 4H8UA 3RK8A 1GJUA 1P48A 3M4HA 1OYAA 5LA0A 1KA9F 2DZTA 5T8GA 2WVTA 1MVYA 4F2TA 4N6EA 3LHUA 4GX8A 4EE9A 3KOZA 2NSOA 2DUXA 3LB0A 4PUMA 1LTDA 1NY1A 3FDGA 4A4AA 4D9PA 3ITTA 3Q37A 3M64A 3OBEA 3OGVA 1BYDA 1QOQA 5AC5A 2FFCA 5E09A 1ICQA 3T05A 1S1PA 2FYMA 2WMHA 4J2PA 5C2CA 1WZLA 3PPCA 1C7TA 1ZSXA 2D2HA 4UQAA 3I68A 4JTKA 4W8LA 1QI0A 2PWUA 1TWZA 3LQLA 4H6RA 4XISA 3VNKA 5J5RA 4RZ4A 4DEFA 2ACQA 3QHOA 3OU8A 4REQB 2QCFA 3WLRA 2BG5A 1BF6A 2PLKA 1PZ0A 3U4AA 1VIWA 2WNWA 1VHNA 1QDSA 3BCDA 2HV5A 2NWSA 2QKFA 4J3VA 3W7HA 4NAFB 3CT2A 1D9EA 3VDGA 4XG1A 2PD9A 4TXEA 5I23A 4CN4A 1NDYA 4D6HA 4Y8EA 5EYWA 1UMLA 4Y7EA 1E73M 4H8NA 4IXXA 5FF7A 4AC1X 4ORIA 3RDKA 4F48A 1EA9C 3C61A 1TQJA 4PBEA 3W6MA 4HNNA 4UQEA 5LGXA 1KCKA 1OG6A 1GZJA 4RNJA 3W01A 2WKGA 1ZJBA 2BY0A 3QV7A 3LMZA 3GXDA 4LJ3A 3R79A 3UWVA 4CD7A 5A6JA 5AHFA 5AHNA 4GWEA 2EEXA 1WUEA 4I7UA 4S3KA 2ZWYA 3NL3A 1F7BA 5D2YA 5FJIA 3MT1A 1NF7A 4QJ4B 1YE4A 1E0XA 4KWWA 1JPHA 3GTXA 1UH3A 1FWWA 4NT0A 1Q13A 2QCMA 3A64A 5LIYX 1N55A 5D2TA 3UR5A 2WHJA 1K6WA 1QWGA 4LCQA 4S3BA 4DLMA 3O1NA 3ZWSA 4MG4A 1R3WA 1WX0A 4P5UA 1X98A 1K1DA 4MZYA 3SQLA 1EDQA 1VHCA 4HTBA 3MCOA 4AWTA 3OLDA 3TP4A 3W7OA 1A49A 2GUUA 4CD6A 1GOMA 1K4HA 1XG3A 4ACZB 4LEQA 1JCNA 4JKMA 3COTA 1AJZA 2YBTA 3W23A 5BRBA 4J7RA 2VMFA 1HTIA 1OSEA 2CKSA 1H7OA 1AD4A 1BG4A 4Q4SA 3UR7A 3M44A 3VXGA 3M5XA 1GNXA 2XN0A 4PULA 4Q6JA 5D2XA 4A05A 1ECQA 3M5ZA 2WM1A 3NXFA 4Z1BA 1VFFA 1XIEA 3NR0A 1UQZA 1ME8A 3CUGA 2AL1A 2XJ7A 5EMUA 4W5UA 4NZCA 1J10A 2JALA 3ATYA 4EPEC 1M9HA 4TOQA 2P0OA 1EZ2A 3BWWA 2DIJA 3BK0A 1HKJA 1EKOA 4L9ZA 1GOIA 2V3GA 4GRSA 1H11A 1IT7A 1ZBKA 1NDZA 4NZ5A 1CLVA 4W86A 1F6YA 2FGZA 3GH5A 3SR7A 1UZ4A 4NX5A 1I6NA 1LWJA 2VDHA 2E9BA 2YW4A 3N19B 1W6TA 3ITYA 3BV4A 4MZ8A 2BLEA 2VI0A 3NVDA 4LUYA 3S83A 4L1XA 3TLQA 4AC7C 3WMBA 3CAWA 4HTYA 3WCZA 1PBGA 3MJMA 1QHPA 4ZZ9A 2D3NA 3DYOA 4DF0A 4MB3A 3PZMA 2E8ZA 3RLHA 1YPFA 2VZVA 3M1ZA 1ITCA 1T5AA 3WFLA 5C9RA 2XFWA 3HQPA 1DJZA 3UR8A 2CITA 1KKOA 5M3WA 3AIVA 1P5BA 4AIOA 2DT0A 1UD5A 5FF4A 2WO5A 4R9OA 3H24A 4GYFA 2D0FA 5LZLA 2ISWA 5MKGA 1IEXA 4Q8WA 3V0TA 1E4LA 4HNCA 1H60A 1E9LA 4RZBA 1AG1O 3FSUA 3OPSA 1A3HA 1ZAHA 4XK2A 2WC7A 3QSRA 1W3KA 4NZ4A 3E5BA 4JN6A 1J4EA 2PWHA 5K2ZA 2YOCA 4HCHA 4U10A 3OBKA 3S2LA 3BH4A 2NXHA 3RM9A 3BMXA 3LZ3A 1VPXA 5A8OA 4PMOA 3TX9A 3HOJA 1E1CA 2E5BA 2OEMA 3ARVA 1CXIA 4I90A 4KRZA 3HBLA 3RO8A 1PAMA 3BLPX 4D72A 3A5VA 3OEXA 1HL2A 4Q8NA 3H6OA 3ABOA 3KS6A 2BDQA 1SFJA 2Z27A 1MWOA 1F4AA 2ON3A 3SN4A 3BLOA 3AUJA 5AHEA 3T4CA 4HPNA 2JFEX 2TRSA 2W66A 2G4FA 2PC8A 4QFUA 2DY3A 2VUNA 4FZIA 3WLQA 2YA0A 1GYLA 3GXMA 3IVUA 4B5NA 5CH9A 5FJPA 1XH1A 1SZEA 3ARYA 1MFUA 3PS7A 3A13A 2GGHA 4M7SA 5BOEA 1WZAA 2PZ0A 1VKFA 4FR6A 4B2DD 1DL3A 1SZNA 1X6UA 3MCNA 4S2BA 4MKNA 3URAA 3U2CA 5LIKX 2J47A 5CQ1A 3VD4A 2RHGA 2V5LA 3OW1A 1W9VA 4HCLA 1HJVA 3GE7A 2QDHA 2J24A 4QJ5B 4Y90A 3WBWA 4AWUA 4U31A 5G2WA 2JBMA 1PX4A 3LGGA 3VX0A 3H2AA 4PUNA 2EKCA 2X7WA 4W5ZA 1CDGA 2OYMA 3W7EA 4C60A 2ACRA 4L4PA 1Q2SA 3A21A 4YMZA 1KWKA 1CXFA 2VZOA 3PB2A 4S3GA 2CC0A 2PDNA 3CHEA 3UZ5A 1HGYA 4LX4A 3LA4A 4H19A 3CB3A 3FKRA 3VIOA 4O0ZA 3P2VA 3URBA 2LLEA 3N1AA 3MDWA 4W87A 3QY6A 2WYSA 5BOOA 4DO4A 1HT6A 1EEPA 4GZEA 2ISSA 4ZR8A 4ZVJA 2GJRA 3B0UX 1OK6A 1L2QA 1SR0A 5KZEA 2INFA 4MSSA 3W0KA 3G1RA 3UWWA 3UERA 1N7KA 4IPIA 5E70A 4V27A 2ONEA 3N12A 4P7RA 3T0BA 4OV4A 4I9TA 2A3CA 4MPKA 2YCLA 3VDCA 1D3HA 4JTFA 2X0SA 3V0UA 3OVPA 1XLBA 2VGBA 4ZO6A 3MUIA 1H09A 3SADA 4RZ5A 4B5WA 4CVUA 3U2EA 1RY0A 3ZOAA 4WY0B 5I07A 1TX2A 4LANA 1XDLA 2PF8A 4Y9MA 1MXDA 1RQEA 2HZGA 4FX7A 2O7QA 1OFBA 3P67A 3N14A 3O3RA 3L2MA 3UT0A 5LKYA 1A5CA 1LP6A 5CGMA 2CWNA 2P53A 1IT0A 1N8FA 1OFDA 3LOTA 2XSAA 4MDOA 3DGRA 3OTRA 2B81A 3I4EA 4Q7BA 3NZPA 4D6GA 4Q4OA 3FYOA 1IZCA 2WSKA 4GVIA 1BAGA 1BRLA 5FSDC 5CLTA 5LSMA 4NJKA 5C5YA 2OKOA 4NYUA 2CLLA 4KEMA 2WNQA 1JIBA 1Q7MA 4LNYA 4CNUA 3S1WA 2X0YA 4CU8A 4OQVA 3AZSA 1Z48A 1OFAA 3NZRA 4MWAC 3E2SA 3WD0A 1HKVA 3H7RA 3G24A 2YL5A 4IJRA 4QE4A 2CZEA 5JIWA 1QVBA 2WMIB 1R2RA 5G1YA 4EXBA 4LVFA 5K7JA 2J7GA 3VE7A 1AH4A 4OT7A 4DJDC 4M29A 3G1VA 3I7SA 4GA8A 3SCPA 3SRKA 2V3FA 1FWRA 4F0MA 4CUCA 3N4FA 2ASHA 5FI8A 1AD1A 1XLLA 3STCA 2ZVIA 4RDYA 3QY7A 4PUDA 3VOCA 1QNQA 1G94A 1RD5A 2QPXA 1IGWA 1EPXA 4GZIA 3VNIA 3GKFA 4POCA 1PJ9A 3KVMA 1OCNA 2XN2A 1UPPA 3NDYA 1PTDA 1RHCA 1KFKA 4PE8A 2XVPA 1V6XA 1XIJA 3QLLA 4JFSA 3PG8A 4GFIA 1GQIA 3F4CA 3VC5A 1DOSA 4MUPA 1VGAA 3AMDA 3NGFA 1W3NA 3QYSA 3THCA 5CLWA 4D6DA 1Q6EA 2V6AA 3OHMB 4OU1A 1XH2A 1EGMA 3BICA 3ITVA 1SJAA 4RXGA 3ZVIA 1V5XA 2CBVA 3G22A 3R58A 2PLMA 4A22A 4NZ1A 3FVDA 1F8IA 1WAUA 4XO6A 2DP3A 3CHCA 5LHFA 3WKZA 2PDQA 3W70A 4ERIA 4YCOA 4PTXA 1GVOA 4XZHA 1V02E 8CGTA 1X97A 2Z1SA 4H6QA 3QR3A 4N7QA 1WXJA 1UR4A 3FY1A 4ZO7A 3ZO9A 1VFSA 3II1A 1DEDA 1Y8BA 1M03A 4Z2KA 3FAXA 1NWRA 4UB9A 1VYRA 2PODA 3S5SA 2G0WA 4D8ZA 1AVAA 1DQWA 1NFBA 4W84A 3SAZA 3W22A 4U5KA 1KRCC 2Y5SA 4EAYA 3TE9A 2UV8G 3ARRA 4GK8A 1VPQA 3C56A 4B90A 4HGXA 1FUYA 5HK4A 2H6RA 2DVUA 1Q6OA 3UXIA 5EPDA 1EPVA 3ZIZA 3PY2A 4YVPA 4F0KA 3CHVA 4IGMA 1U1JA 3LTPA 3FJNA 3TWAA 3Q45A 3EDDA 4DHGA 4YNGA 3TUUA 3CIXA 1A5LC 1Q8AA 5JVLA 3DC8A 1W56A 1TV7A 4CQAA 3WLLA 1JI2A 3BW4A 2BOGX 1JZ2A 4I3GA 1NFGA 1A0CA 5LA2A 3GNXA 2GGIA 3ECQA 4WK9A 4F79A 4NP7A 1S5NA 2A3EA 4GC4A 4V33A 1HJWA 2HSAA 2XFFA 1BSIA 1YRRA 3W2KA 1SFLA 2GQ9A 3CIWA 2WVVA 4CLMA 1FWTA 3LZ5A 2YDSA 1UD8A 4LBSA 7TIMA 5C54A 5A2CA 1B54A 3QW4B 3ALGA 1EJSC 2V5CA 1A3XA 2DZSA 3LY0A 2J6XA 3QV6A 1BD0A 3NPWA 2HNHA 3RPMA 3S5ZA 1Q45A 3GH7A 2HDJA 3C5QA 3OGSA 1R7AA 3LD5A 3VZYA 2ZUVA 1EH9A 4CNNA 4JAWA 4PMVA 3SCRA 3ZXWA 3P62A 2ZICA 4ZENA 1TV5A 4PCPA 3W75A 2VX4A 3KBWA 1JFHA 1K8CA 3LLDA 4X9YA 5HMFA 2BY2A 3IIXA 2DW6A 1B1YA 4AYSA 3EOUA 4REQA 3L65A 3K8LA 3H2EA 2E68A 5BOFA 3WK1A 3C2OA 3U5YA 1EBGA 1HKMA 1TMLA 1J12A 3UP8A 1ME7A 1XLIA 1O6IA 1BTCA 1ONEA 2PWEA 2QXWA 3SIMA 4WGHA 2ZDSA 4M7TA 2ZUMA 4FLSA 1CTNA 5HULA 2PUZA 3LHYA 3ES8A 4LSBA 4WRHA 2XTKA 2ZRXA 2GQ8A 1KTBA 4JIQA 2OX4A 4EX4A 1XV8A 1F2JA 3DUGA 3WH9A 3U5UA 3NDZA 4ZOCA 1WDPA 3JU2A 3U7VA 3QMRA 3ES7A 3PTDA 3Q94A 3SCQA 3W1UA 2AKZA 2CETA 1LOSA 1WDDA 4F2BA 2VC5A 4P7LA 1O7AA 2GDUA 3Q2DA 1WKFA 2VGGA 4I8DA 3GNNA 1UWAA 3EBVA 4BEQA 3VABA 3S46A 3KDNA 4UIOA 2SFPA 3P84A 2DQWA 4EK7A 5I3DA 3EEZA 1AMYA 2NQHA 3M0MA 4BWLC 4ZODA 2CPUA 2W6RA 3A24A 2H90A 2QJHA 1N8IA 3W28A 1DQXA 4YTSA 2WAGA 1KBIA 4MFDA 4FIRA 4FX6M 4H1ZA 1R38A 4KWVA 1OY0A 1IEVA 4F0RA 3W85A 5CSSA 3LUTA 4Y8FA 3TLLA 2GGJA 4HSOA 4WVXA 3UNTA 1Q5MA 4HPGA 5K9XA 5KSWA 1JI1A 2J13A 3NAVA 3R13A 2ZZ1A 4AZHA 3W7JA 1HP4A 4J9JA 3PBMA 4UOQA 1UR1A 4N2YA 4U3CA 1KR0A 5A3HA 1GEHA 4PYSA 1FP9A 3MVTA 2VM8A 1VFTA 4GQGA 1FDZA 3DBNA 2I1OA 4LNCA 3LHVA 3WMLA 3AMGA 3G3DA 1QUMA 3LNPA 4D6CA 3W2NA 1TB3A 2PTYA 3V36A 1IQ8A 3F7JA 5KMYA 3VILA 1LUCA 1P0EA 1WA3A 5BMXA 5CPQA 1ONRA 1JGMA 5FL0A 3S9ZA 4RW5A 1IWAA 1ZNNA 3M0ZA 1WBHA 2QVHA 3M46A 1RCOB 2OB3A 4JX5A 1ICPA 1DWGM 3QQWA 2UBPC 1EDGA 4BI5A 5MKGB 4A8RA 2VUYA 1LQ2A 1G67A 5G1MA 2CBJA 1XSKA 4UTTA 2PTZA 4NHVA 4PSPA 4C6DA 1FBAA 3PJXA 4WEVX 3F4NA 2V0TA 5A8PA 3EYPA 2P88A 3GS6A 3VPLA 4HA4A 1YW1A 2OZ3A 3WNMA 3ARPA 2J8FA 4EOUA 3CHDA 3SO7A 3D5HA 4GCXA 1MO0A 1U83A 2G3NA 2QCNA 2O9PA 3LBOA 4DF1A 2CNCA 3TA9A 4JIRA 5ECUA 3OYXA 4C6LA 5HXMA 1ZTVA 3G1FA 3VZZA 3NSXA 3HJEA 2Q71A 3UPBA 1EOKA 3VFCA 3L4TA 3WNLA 5I78A 1TTJA 2UZ9A 3RMJA 3G8RA 1MI3A 3WELA 1TWIA 2H8XA 3MP3A 1TPDA 1RCXB 1E1CB 1MZRA 1K7EA 1XRFA 1XIFA 2W4XA 2RGMA 4E8DA 1DE5A 4IMDA 3AXXA 4XBKA 4PFMA 1TTIA 3FN9A 4D1JA 3BAWA 4ATDA 3TYDA 1FDJA 3E38A 3FHAA 1TG7A 4TQTA 2X30A 1QW7A 1LQAA 3BGAA 5BZAA 3NCOA 1BYAA 3N9RA 2WVSA 1DTNA 3HGRA 3N9SA 4R7WA 1OGGA 5HBFA 1DIEA 3POHA 1XINA 2WANA 4H41A 4CCZA 3IUHA 2GVGA 2VENA 1AL8A 2I5QA 1W3HA 2HS8A 3NEHA 3P74A 1W1IE 4MYAA 4B3KA 2OT1A 3ZZ1A 3H12A 3NO3A 3N29A 1S39A 3UZZA 1UD6A 1RXOB 2V5KA 2VCAA 4NL1A 4XZLX 1EC7A 5AHLA 3T0CA 3KEHA 1S3HA 4HMDA 3L2LA 7ODCA 2AQVA 3R7MA 4X2RA 3AI0A 4CD4A 3H21A 1YTDA 3NGJA 3GDRA 1NF0A 2VZTA 3BV7A 4GVFA 4LAMA 4LF1A 2WKJA 7XIMA 4IQLA 2C0HA 3QZ6A 2J78A 1R30A 3NDOA 4ZE4A 1VH7A 3VNMA 1XYLA 3NYDA 1TE6A 4QJ1A 2FPYA 2XZ7A 4Z2IA 4LAZA 3KTSA 1JCYA 1ZZMA 3HMCA 1MW3A 3W72A 4J28A 4JYEA 2ZX6A 3PB0A 3GTNA 1OF8A 3A3HA 4I8YA 2POTA 3W74A 1UBPC 3PZVA 1J18A 1S5MA 4C6QA 1GCYA 3E9AA 1KFCA 3OJGA 2QCDA 2FTPA 3B40A 2FH6A 5A2BA 1QFEA 1SMAA 4JCMA 3BANA 1I75A 3CZLA 2PWGA 3G1XA 3CL6A 1XP3A 3K5XA 4JTEA 2F6UA 3W2MA 2KAUC 2CBUA 1KM0A 5JQ9A 4F4RA 3AXIA 4XAPA 4ZB5A 4DWSD 4H7ZA 4TV6A 2XG9A 1HO1A 4QDPA 3W4RA 2O4QA 4AH7A 3MPGA 3MSDA 3U9IA 1GG0A 5F2MA 2ATMA 4CQ8A 1QW8A 3KUMA 5JIPA 2Z2UA 3EMCA 4D2JA 2DT2A 3GNPA 3RITA 1PIGA 1LL4A 3JVAA 1Q85A 2PE4A 2ZRZA 5MHBA 1E40A 3KWXA 4H9UA 1UR9A 3O07A 3S42A 2CKRA 4PTDA 5EFDA 3DFYA 1ME9A 3HMJG 3OVGA 3SCOA 3KX6A 1EJVC 1L6GA 2Z29A 3B4UA 1HN1A 1J0YA 1G4TA 4AD2A 1LBMA 3QMSA 4JKLA 3G1SA 3NQBA 3WD4A 3PTQA 4V2XA 1JR1A 4RNHA 1O1ZA 1I60A 1UCWA 1BXCA 1M65A 5FOOA 3DXIA 5I02A 4JQ2A 3MANA 5FIPA 1J0IA 3GLCA 1ZJHA 3CLMA 3W53A 3EWWA 3PZUA 1ZY9A 3P3BA 1XF0A 1XISA 4ONVA 2W67A 4O8RA 1FXQA 3KBNA 1W5OA 4L5ZA 4RV3A 4C6PA 5LNVA 2WZTA 4ILSA 1HFBA 4NRSA 3CL7A 3LXCA 1KCZA 1BGAA 1UP3A 2YA2A 4PA8A 3HO8A 5I5RA 4US6A 1CIUA 4MF4A 3WK0A 2V3EA 1JPMA 3V5FA 5TNVA 4OZOA 1R2TA 2R1LA 3EWDA 2I9EA 1GHSA 4TVCA 5E5CA 3O16A 2NT0A 2B31A 3AS1A 4HZMA 4E3TA 4KFPA 2PFHA 1EP1A 2JEQA 1UWRA 2YYUA 3CWNA 4WLCA 3SY1A 4O19A 2WJFA 1K9FA 3W3OA 3KVLA 3UYIA 1H3GA 4O10A 1W32A 2YYTA 1F61A 2XH2A 4QG8A 4GXMA 4QR6A 3BMVA 1PIIA 4DZAA 1VBRA 1XYBA 3VMPA 3PJUA 4S3AA 2DQXA 3O7UA 2Y89A 2ZQ0A 4H2HA 1QPRA 2HJPA 4DO5A 1YNPA 2EPKX 5DT7A 3MVIA 1B3OA 1PTAA 2ALRA 5K9DA 3R6IA 7ENLA 2VNCA 4RR4A 3BQ6A 4AD1A 1GOQA 3LCIA 4K68A 4HNVA 1XRTA 4ADUA 4PMQA 3PBYA 4O11A 4G7EA 2GVLA 1NJJA 5D2VA 4LALA 3GH4A 3DFHA 3M7SA 5BXRA 2AMGA 2B7PA 2E1WA 2PDIA 2R82A 3AZTA 3G0SA 1LG1A 3R11A 1WDWA 4NZ3A 4GQRA 4G5DA 1J9YA 4QRNA 2EBNA 3GWQA 3MZ2A 1PB0A 5FCZA 3TN4A 3MKKA 3IGHX 4WSHA 4AEEA 1VBJA 3G3MA 3OG3A 2EPHA 5F2GA 3N3TA 4YTUA 2O9OA 3IANA 1LLOA 3ELFA 4CEXC 4JTTA 3NQ6A 1ELSA 1ZU8A 5D9PA 3WQ5A 3NQ2A 2O7SA 4UQBA 1QASA 1E0VA 1SO3A 2VRKA 2E9LA 4FSAA 2ZUNA 5FEXA 3MQTA 3RFAA 4GNVA 1K4GA 4MOZA 4Y2WA 5EGRA 1MXGA 3OODA 4IMAA 3L21A 1B9ZA 1GKRA 4ZOBA 2ACSA 2CFFA 2FPVA 5CBIA 1VFUA 5GJNA 3T08A 3OLGA 2DUZA 3WQCA 3BGGA 5H8UA 4JQAA 3URNA 4XQ6A 4HU0A 1VZWA 3RCNA 3UG5A 1GWJA 3TC6A 4M3PA 4M6PA 1NWTA 4R27A 4HPHA 3AIEA 2DT1A 2XIJA 5REQB 4UTTC 9XIAA 2PRMA 4UQCA 4GQBA 2D3LA 3V4BA 4KT2A 2ZUSA 4NI3A 5HATA 5DXYA 4OBSA 3S1XA 1B90A 3GQYA 3UZJA 1V03A 4BS0A 4PMZA 4X2PA 1QOXA 1YLVA 3KE0A 4FR1A 5I77A 1T0OA 1WP6A 4IIFA 3AMKA 3Q65A 2Y8VA 2DZPA 1ZRQA 1XBYA 1V6VA 5G2HA 1E3ZA 4Z0SA 1UC4A 1ADDA 4MTVA 1QBBA 3KAOA 4Q4PA 4PEKA 2VEPA 3IJ8A 4PFHA 3IACA 2WKLA 5I3GA 4QE1A 4B5UA 1KFEA 2R9RA 5H2ZA 4QP0A 1MSSA 1JL8A 1J0ZA 3ARWA 5DRIA 1MEIA 3TONA 4Q4KA 5LYRA 1GVIA 3EOSA 4RPPA 5DMLA 1J11A 2ACUA 1W5NA 1WBJA 2XIIA 1LBLA 2I56A 5U4NA 5LNSA 4WDTA 4AD0A 3BJTA 1FWNA 4AMCA 1VRXA 5I6SA 1H4PA 2ZIDA 3HF3A 3EWBX 4S3CA 1CYGA 4B4FA 1PE1A 4FS9A 5E0KA 1S2VA 3SJNA 1EJ7L 1BQCA 1V7YA 2C1IA 1V3HA 3VKBA 5KZ6A 4FOJA 5C2XA 4UMBA 2XM2A 1G5AA 4QNWA 4IP7A 5DFAA 3RCYA 2FVMA 4OVXA 2YA1A 2YFOA 3C6CA 3CYJA 3KHJA 2VHLA 4MMWA 4O16A 5HMSA 2W92A 3DFSA 3ZJ8A 1VENA 1OADA 5G4EA 4DXKA 4Y9PA 4BK9A 3EWXA 3RN6A 5AN7A 4PMUA 1C29A 4HZ7A 3PSWA 3QXBA 1EX1A 2G8ZA 2JQXA 5CJNA 4EIVA 2Y85A 1B4KA 2NUXA 1FQ0A 5DANA 1R47A 4DO6A 1IEQA 4ZBCA 3BO9A 3F03K 5DX7A 1CT5A 2PF0A 1XLMA 3SBFA 2W91A 4PCTA 6ALDA 1Q7QA 1EYEA 1YADA 2EG6A 4GMEA 2G50A 4HHLA 2XZ9A 1NDWA 4G2DA 1EB3A 2NX3A 3WL1A 1XIDA 4XBSA 1B30A 3KW3A 3PHAA 2BODX