2FH6A

Crystal structure analysis of klebsiella pneumoniae pullulanase complexed with glucose
Total Genus 311
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
311
sequence length
1052
structure length
920
Chain Sequence
DVVVRLPAFGVALADAHWVDKTTLLWPGGENKPIVRLYYSHSSKVAADSNGEFSDKYVKLTPTTVNQQVSMRFPHLASYPAFKLPDDVNVDELLQGETVAIAAESDGILSSATQVQTAGVLDDTYAAAAEALSYGAQLTDSGVTFRVWAPTAQQVELVIYSADKKVIASHPMTRDSASGAWSWQGGSDLKGAFYRYAMTVYHPQSRKVEQYEVTDPYAHSLSTNSEYSQVVDLNDSALKPEGWDGLTMPHAQKTKADLAKMTIHESHIRDLSAWDQTVPAELRGKYLALTAQESNMVQHLKQLSASGVTHIELLPVFDLATVNEFSDKVADIQQPFSRLCEVNSAVKSSEFAGYCDSGSTVEEVLTQLKQNDSKDNPQVQALNTLVAQTDSYNWGYDPFHYTVPEGSYATDPEGTARIKEFRTMIQAIKQDLGMNVIMDVVYNHTNAAGPTDRTSVLDKIVPWYYQRLNETTGSVESATCCSDSAPEHRMFAKLIADSLAVWTTDYKIDGFRFDLMLYHPKAQILSAWERIKALNPDIYFFGEGWDSNQSDRFEIASQINLKGTGIGTFSDRLRDAVRGGGPFDSGDALRQNQGVGSGAGVLPNELTTLSDDQARHLADLTRLGMAGNLADFVLIDKDGAVKRGSEIDYNGAPGGYAADPTEVVNYVSKHDNQTLWDMISYKAAQEADLDTRVRMQAVSLATVMLGQGIAFDQQGSELLRSKSFTRDSYDSGDWFNRVDYSLQDNNYNVGMPRSSDDGSNYDIIARVKDAVATPGETELKQMTAFYQELTALRKSSPLFTLGDGATVMKRVDFRNTGADQQTGLLVMTIDDGMQAGASLDSRVDGIVVAINAAPESRTLQDFAGTSLQLSAIQQAAGDRSLASGVQVAADGSVTLPAWSVAVLELPQGESQGAGLPVSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of pullulanase: evidence for parallel binding of oligosaccharides in the active site
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords pullulanase
total genus 311
structure length 920
sequence length 1052
ec nomenclature ec 3.2.1.41: Pullulanase.
pdb deposition date 2005-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fh6A02
2.60.40.1130 Mainly Beta Sandwich Immunoglobulin-like Rab geranylgeranyltransferase alpha-subunit, insert domain 2fh6A01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2fh6A04
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2fh6A03
3H42H 1ZBVA 3D9AH 3UP1A 5HXMA 4BH7B 4MJ4A 5C8JB 4OLZL 5GQBA 4AG4H 4BZ2H 3KPRB 1BD2D 5HVGB 1S78C 5BVPH 4CU6A 4KK8D 1T7VA 1CDJA 1MFDH 1KYOK 3OX8A 2C1OB 3BPLC 5ICYA 2VDNL 2QPUA 3ARGA 3BH9A 4OFIA 2PYEA 2EJ1A 3B2UC 3S37L 4ENED 4C57C 4AMCA 3WYRA 3BOVA 5CZXD 4Z2LA 3LY6A 3CFKB 1FBIH 4CN4A 1W3JA 2D3NA 1E27A 2NYYD 2Z4QB 3P9LA 4JB9H 4WENB 1ZB5A 1ZVHA 4N8CL 1Y6KR 1BBJB 1SYSA 5D71H 1CDYA 4R0LB 3T8XB 3PWPE 1QNQA 2AV7A 2VLKE 3BT2H 3GSUA 1M53A 4ODVL 5I1EH 4JKMA 3MJ8A 1MJ7H 4QGYA 1DUYA 2D03L 2IBBA 3MLSH 4U1KA 3U2SB 5BQ7B 4HEME 2XZCL 2Z92A 4AENA 4GBXC 3DX8A 4P5MA 4JN2B 5E1HB 2QV4A 3FCTA 4ONGL 1TJGH 3S3JA 5JORA 1FVCB 2IQ9H 1FG2A 3QUKA 2DRUA 2J8UB 4OUEA 4HWEL 5CINH 3BWAA 4OGYH 5FF6A 1BYAA 3BQUD 3HZVB 1UR1A 5I77A 2GYSA 3L3DB 3MZTA 1NOWA 1FCGA 1HILA 3V6BR 4NZDA 3AREA 4PJCF 4TN9A 4XCYA 4QNPF 4TTDC 2LU7A 4ODSH 5SWZD 1ND0B 3FT4B 4KKBC 2WMIA 1JI1A 1C8PA 2VLJD 5I8KH 3UG5A 2D3LA 1X4ZA 4O2EB 2BERA 1P5VA 2W0KA 3ORJA 5D2NE 4FFWD 5IF0A 4YXHL 4OFPA 4JJ5A 1ZS8B 2GY7B 4RGOL 1LVEA 2IXVA 4MSWA 4PJFB 3CJJA 1DWIM 4D0DB 2P4AB 5IB2A 1GHFL 1MCKA 1W0VB 4XV0A 3MYZA 3LIZL 4YH6A 1LD9B 4Y5YB 4PP2A 5CZKA 2YK1H 5IB1A 3MUGA 3SKNA 3OF6D 1ONQA 2YSSA 2QMJA 1GPFA 3MJGX 4HWUA 1C7TA 2VQUA 2HJFA 1S7QA 1XCQB 2A74A 3CVHA 3GSXB 4JM2A 4UT7H 1CXHA 4HS3B 4OCRH 3P9MB 3OKEB 5CBAA 4HC1A 3VWJA 1U8NB 2C3XA 1FAKT 1A7PL 1XGUA 4S1SH 4OB5H 4TTUA 3ZHLA 5I9QB 4KRPC 3STLA 4KMTH 5JOPE 3CK0L 5JLZA 1SY6A 4KK6C 1S7RB 3KPRD 5A2AA 4JO3H 1RUPH 4JM2B 1KENH 4U3AA 5I78A 3IDIB 1AMYA 1GZJA 2XTKA 1OB1B 4AH2B 2HT2C 1BFVH 4FP8L 1LG1A 2B20A 1AFVL 5EG6C 2R23A 2Y2WA 4D6EA 5I2UA 1E6JH 1NGZA 3L3JB 5KTEL 3SDAD 2WZIA 5D7KD 3DX8B 4P5MB 2VXUH 5HSFA 4L29B 2DKMA 4E5XA 4GRWE 4JM2F 3EO1B 1MCBA 4FFZL 4IPNB 3RWHA 5KSVB 3KLKA 2DYPB 4P2QB 3KXFD 2VRQA 3INUH 5I0ZA 1DLFH 2DSKA 1T7YA 2RGMA 3B6SA 3D18B 1U9KA 5C07A 1NC2B 1TXKA 1U8JB 3NA9H 1GC1H 1NCDH 2XN2A 1Q6FA 5ADPH 1JUFB 3QUXA 4E5XB 1HWGB 4KRNA 4FLOA 4BQ9A 4FQLL 1GGBH 4NRSA 1BG9A 4LGRB 4JRXA 3FFCA 4YAQB 3QIWC 1FFNA 3BKJL 4XB7A 3UYRH 5I2IA 3UTPD 1DQDH 4MAYA 4RISL 3OGSA 1AGBA 3DVGB 4NC1E 5AUMA 1ZANH 1KV3A 4K3JL 5CJ8A 5ID0B 3IK2A 1UWSA 1EFXD 2DH2A 4RFEA 4YDKL 8FABB 4NHUA 2APTA 2B1HH 1KLUB 1C93A 1YPZB 4QXGH 5IESL 4LVOC 4U2YA 1TETH 4OF7A 1HT6A 3SJVB 4XP4H 4C55A 3AHTA 3L3OA 3N1FC 3NFSL 3MBEA 1FHDA 5BXRA 3VGAC 1RJCA 4QGTA 5C0FB 3PJSB 5HY9B 1IGCL 5ETUA 4DO4A 1A1NB 4WI4A 1NGWB 3HZVA 2VL5A 3QJFA 2VZSA 2YXMA 5JPNB 4KUCD 5I18H 4X8JA 5DVKA 2C8NA 3CMOH 2IPUG 3NSXA 2HISA 1CBVL 1YMMB 2AQ2A 1QO3A 5CGYD 5IVZA 4V2BA 3D5OF 1ZSDA 1U0QA 1WCBB 3EZJB 3DO3A 3KPRE 4PJXA 4YWGH 4HFWB 2PC8A 1R3JA 2EE6A 3HE6A 1PIFA 1FNHA 1YEDA 5JHLH 1W1PA 2DDQH 3FZUC 3P11L 3B8YA 1GVYA 2J47A 3MI6A 3UJTL 1NCWH 4HUVB 3CH8A 1MJ8L 1YN6A 2EH7L 1D6VH 4A4AA 5DJ8A 3SCRA 4ZXBC 5IDIA 4FQPA 3FQXA 2HFFA 1NLDH 3WEOA 4LSTH 1JGDB 1IC7L 3K2MC 4KV5F 4AIOA 2BVYA 2RHEA 1AD0B 4GAJL 3VW3L 5E2WL 1JGLL 1HHHA 3RPKA 1B0IA 2JB5H 3IGAA 1NMBL 3R1GL 1U58B 4JRYB 4C83A 1FPTL 3BI9X 5EOQL 1Z3GH 4XPHL 3V0AC 2GY5A 4X98B 2YHGA 5DK0A 2XFXB 1J86A 1JNNH 4HWNA 3W0WA 1LQSR 1W1YA 4JFFE 2GK2A 3MUHL 3STZA 4AEEA 2ARJB 4WHYG 3TZVB 1A2YB 5CCKH 3VD4A 1FFNB 1MPAH 5E4EB 1CFTB 5A69A 1KTDA 5DHYB 3DYMA 1W32A 3PP3H 1CI5A 3OR6A 1YEFL 4ATDA 4LVHB 4X98A 3UZEA 5I24A 3D2UA 4HZ6A 2FIKA 2GJZB 1MHPH 1CECA 1PQZB 2VC2L 4IRSD 3GFUA 4GIAA 1N2RB 3CFKA 4YE4H 1QFUH 2R1WB 2AMGA 3QPXL 4UINH 1Z2KA 1WEJH 3CFBA 4WJ5A 4EDWH 2O9OA 3HNSL 3KE0A 5IBUG 1Q0XL 3G6JF 1D7FA 1U41A 2JIWA 1JF6A 2C9AA 3O9WB 4POZC 1LEIA 4MVBD 5B8CA 1BM3L 4O4YH 2WNGA 4ZSOB 3TEUA 5EOQH 1QHOA 5JMOC 4CD7A 2LQRA 1VBUA 1NMBH 5EDXA 3TNMA 1U33A 2NXZC 4C7FA 1UENA 4JPVL 4D0BB 3WSUA 1IAOA 3VFWB 4APQD 3BDBA 2F9BT 4GT7A 1TMQA 5IHUL 1MFEH 1MSPA 3U9UA 4ZFOA 2NW2A 4N42A 2BNRE 4I1NB 5CG0A 1NGXA 3CU1A 1LL6A 4PP1C 4PRWA 3Q3GA 4RAHA 2AAAA 2H8PA 5C08A 1MCLA 4HKBB 5SWSE 3SKMA 5KSUB 1RU9L 1UCBH 1CVSC 4OBRA 3UAJC 2WBJD 3U83A 4HS8H 3VMPA 1ES0A 2YUWA 3CDGB 1T66C 3OAZK 5FKAA 1JGEA 4ZDHA 3VXOB 1J8HA 4TRPH 2GTWA 2DQTL 5F88B 3HZKA 2V3FA 4HMCA 4F2MA 1DCLA 3BRDA 4YWGL 4JPKH 4DTGH 1O5DT 2NY1B 5IIEB 3SDXE 4BUHA 1L7IL 1G6RH 1V6YA 3KPQB 5C86A 4WWKB 5JZ7D 1T1ZA 1NCCL 7FABH 3HG1B 1EFXA 4X5WB 4YXKH 3VFVA 2BFGA 1RZGB 3VXOA 5T5FL 5J13C 4ZEPA 1S9VB 3HNVL 4RGMB 1IGCH 3MRJA 4N0UB 2YS4A 5KVDL 3MBED 2Y6SD 1KTDB 1MCPH 3KPTA 3I85A 4WU5B 3AMKA 2JIEA 3G6LA 3UBXA 2VOTA 4XVJL 3SDCC 2OTUA 1EO8H 1DCEA 1QBLL 3QO0B 4XCEB 5FYKD 2BNUB 3LMJL 2BVQB 3S9DB 2FHFA 4YDKH 3ALFA 5DJ8B 4J3XA 4UZSA 3O3BB 1LK3L 3QUYB 2HLFD 1H8NA 3B3IB 3TNNB 2E7BA 3VKKA 5DEZA 2CJUL 2FR4B 3F5WB 3FHAA 1K6QL 5AAMA 1NP0A 5KAQF 3ULUD 5ANMB 2GJPA 1GGBL 3OKNA 3WMCA 2Y1VA 4NO0D 3H55A 2QEJA 4LLYB 3VFOA 3QHMA 5E94A 3FNDA 4KXZI 1A64A 2DWDA 5E8PA 1FGVL 1PX3A 2V5MA 3VGDA 4J1UA 2J7HA 2OBGA 3QISA 3MNZA 4DWHA 2X4NA 2W66A 1W9DM 1MHCA 4NSKB 3BP4A 4OZHE 5DK2A 4XTRC 3C5ZC 3MRGA 3EYFA 3MRFA 5BRZB 1E0XA 1A14L 2HT2D 2RIKA 5T1LA 4YHIA 4RE4A 4AZ7A 2R29L 2H2PD 1Q0YH 2JJSA 3AREB 1ZLSL 2VYRE 2OWXA 3MNZB 2E6QA 5ANME 1FP9A 4MXWL 2EPOA 2A73A 2ITDB 3NIYA 3DHUA 3H3BC 2FJFB 4PB0H 4HK0A 5I0DA 4WLCA 2I25N 3QDJB 5KVGH 3OV6A 3B9KC 2H3NB 5HGAB 4OB5L 3D51A 4LCUB 3WH6A 3JBG7 3U7YH 1UZ6E 1ISYA 3SE9L 4HKJB 1E5JA 3SQBA 5IW3A 3QNYB 3UG4A 4OCRL 5D8WA 1TLKA 2A9NH 2A73B 1SM3L 4YHOL 3TBWB 4OZFG 4ZUVA 1M4KA 1AQHA 5E5RB 4P9ML 3BKMH 2IGFL 1EZVY 3QRGH 4U05A 4XB3A 5JW4Q 3H54A 2YDQA 2E9IA 2PNDA 3JZ7A 4EUPA 5I1LB 3MACL 3V6FA 1C8QA 3LQAH 5DSCB 3U9UB 2OR9L 2UZYB 3T2NH 5J3HD 3DBXA 3L3HB 5IHLB 2IANB 6FABL 1PG7L 1TCMA 3OHXA 4U3HA 4BYHA 4KUZL 5D93B 3U7AA 5K9QI 4OCMC 1P4LA 1L0QA 3TIDB 1A6UL 2A6KB 4NZUL 4K2UL 2QPSA 4IM8A 3MRBB 4R4FL 4LSPL 2DICA 3U0TB 1U3HA 1B3VA 2WQ8A 4NC2B 3A6BL 4MA8H 4W81A 4PR5A 3ARUA 2PTTA 4E8CA 2XKSA 2WWMC 4KJWC 1VGKA 5IEKB 1YEKH 3FQXB 2OL3A 2JJWA 3IFNL 5DF0A 2J8GA 3TIDA 1MVYA 2VDKL 1BWMA 2EO7A 5JUEL 1UZ4A 4HQQL 3FB6B 4M8UA 4N1EA 3X13A 1LE5B 1FYTD 3VRJA 4EDXA 1QVBA 5ITBH 4N1CA 3CXHJ 3EDKA 3IAGC 3PE9A 1Q6CA 2EYTA 3H9SB 1EO7A 1EX0A 1B2YA 1L0PA 4A3YA 2XZCH 4ZXBD 2WVTA 4PRNB 2WMPA 5EBWA 4GPNA 4PG2C 4D6GA 3AC0A 4M6OH 1R5IB 1UWGH 1ZMYA 3N9GH 4NWTL 4BQBA 3A47A 3X13B 3PNWA 5DA4A 2YD8A 4N8CH 3K1DA 5TPWL 3QUYA 4UQ2A 4RA3A 4H7VA 2CUMA 4MCZA 5AY7A 4G9DA 1E4NA 2MANA 1WF5A 4ODHH 2HKFH 4BK4A 4Z2JA 3DMMB 3ECBB 4WEMB 2Y8VA 5E2UH 3N1AA 1T66D 3FO2A 4HA3A 2AJUH 5F9JB 4EUPG 4JM4H 5D1ZB 2LABA 1FSKB 1J1OH 4EN3B 3L2LA 3K46A 4UQ2B 4J1UB 2FDMA 2ZUSA 4KHXL 3NMEA 2Z31C 3DVFA 2UYLB 1PEWA 4JFUA 1SQ2N 1O7AA 1IM3A 1AXTH 5JIWA 4AQ1B 4HGKC 4RAVB 2XIDA 3D9AL 3HI1B 1TJIL 1U8QA 3QO1B 1DFBL 1SYVA 1RHHB 1XHGA 2XSBA 4QKXB 4Y19D 1A9BA 2UWFA 1AY1H 4Q6IA 1AGCA 4IOSD 5DVMA 1A6WL 1MCFA 4YDJA 2QF8A 1S7TA 1A7NH 3FQNA 3NH7L 4LPUA 5KSAA 1XIWA 1YECH 1YNTA 4WI6A 2E9LA 4PRHA 1TVDA 4L4PA 5E2TH 5IUSA 1U2CA 4MA3A 3GRWL 2WAGA 3LRGA 3V5DB 4AYFA 1TFVA 4JM2D 2VLLB 3CX5J 5LYRA 2B4CC 1OGBA 3CFIC 3GSRB 4AL8L 2R2CA 1JYXA 3VD3A 2WZHA 5D4YA 4QRTA 2WVUA 5ABFB 2JCCB 4PRPD 4PJ7A 1QNPA 1SJXA 2X4TB 3FKUS 2W9LA 5D2NC 2CDGA 4C54A 1BZ9B 2CIIA 3HB3D 4P2RE 2J74A 3BUQA 3MRMB 4QHNA 3HS0B 3VGGA 4ML4A 4PP1D 1I3VA 1U6AL 5F96H 1RULH 5M7QA 5C8JA 5CJXA 2XXMB 4XNQA 3O11B 5DFTA 1OD8A 1RZKH 1FO0A 4TSCH 4Y16B 4NRYA 1SBSL 1A7RH 1IKFH 3LB6D 5EC1B 1LO5A 4OZIB 4FFYL 5IFAH 4FXGB 1OGAD 1KN2L 4XXCC 2EE9A 4PYHA 2BFVL 2CBJA 3C09B 2MMXA 5D7IF 1PW3A 4KJPC 2ZPKH 4F7CB 2Z4QA 3P9LB 4E4PA 5L8LB 3DHMA 3QUZC 1HP4A 1V3KA 2BSED 1EQCA 4XAWH 1XF5A 1OP9A 4JRXD 3FN0L 1LQ0A 1BGXH 3M8OH 4DKEL 1IE5A 4IRSC 3TONA 4N0CD 3FO0H 4XP5H 1BVKA 1MQPA 1MREH 1HQ4A 3AU1A 1A2YA 4UU9A 3DWTA 5I6XC 3B5TA 1RZJC 3EJYD 1T03H 1T0PB 3VM7A 3K8LA 4XCFL 5ID1A 4RMQA 3EO0A 4PJIB 1D5MA 4NO0A 3VIPA 3HC0A 1RMFH 3EOBB 15C8H 5FF6B 2XN0A 2X9WA 4ORGA 3L7EA 5LG1A 4Y1AE 1KBBA 1KG0B 5C6TL 3PDGA 2YL5A 4UQ3A 4WFGD 4V27A 1A7BA 1L6XA 1XD1A 1I8LC 2P47B 5H37H 1Z0MA 5KVEH 2VAJA 3C5SA 4GXVL 3NAAL 3A4XA 1MAKA 3PNWB 4YHLH 1W72B 4I0PB 4XWOC 3TO2B 2W61A 1D5MB 4QXWA 1OAYH 2CRMA 5F7FA 3HZYA 3TC9A 4HPHA 3O4OB 3IFPA 3W29A 3FTGB 1XGQA 5BRZE 5E9AA 1CXEA 2GI7A 3AMDA 5JHDA 5JR1H 5L9DH 4LEOA 5I16A 3C5JA 3JVGA 5FHBL 4G3YL 3WXVL 4Y2DB 4XCCH 1RIHH 5D7KE 5KANG 3U9PH 1WDSA 2EYRB 1CEOA 1JRHL 1K4DA 1IZJA 1JTTA 3HFML 1R0AL 1WV7T 3FONA 1B88A 3HAEB 3BIKB 5JW4N 4ELKA 4W6XB 1FE8L 2WINA 1GGCH 3LXBA 4DKAA 4UT9L 1A1OA 3ZDXE 3QIUC 1D2KA 2A1WH 3R0NA 3AB0B 4L8SA 5DLMH 3T0EE 1ZHNB 3GSQA 2XWDA 2VZUA 5FO8A 2VABA 4YXLH 4HT1H 4QTHB 4GJTB 3UPAA 2ZUWA 1GC1C 3RVVD 2DQGH 3CDYA 1CG9B 3NFNB 5EC1A 2JJVA 4ZS6C 4PTVA 1MFCL 1AGEA 3C8KB 1RURH 4JDTL 3U7VA 1XSJA 2DQUH 2CLRA 3D3VE 4XNUH 4V28A 1G7QB 5DMYA 5GGRA 5IMMB 4M7LL 3DSNA 2C7UB 1E4JA 2EO1A 1T04B 4CW1A 4GSDL 5BZWA 2K1MA 5B3JE 1T1ZB 3VXRA 3LSOA 4DFIA 4N0UE 3C08L 4ZTPH 3DGGB 4M7LT 3HI5L 1UA3A 5L0QB 4YGVB 4HZ8A 3AVEA 3DETC 3WBEA 1I8KB 2UVFA 1YQVL 4RFOL 4JPIB 5IHZB 4ZXBA 4MNQD 2ORBH 2YD2A 3HG1E 5ID1B 4KZDL 2DT2A 1F2XK 2ZUNA 3V52L 2DMCA 3W39A 3WE6B 4CVWA 1W9XA 4HUUB 2G2RA 5BJTA 1EJ6A 2BNUA 1KXVA 3LZFH 4XC3L 3UTSD 3R4DA 4UMGA 1JPST 4K7PL 3U5UA 4HW6A 2CKBH 1JZ7A 3HE7B 3FOLA 1VGKB 2XPKA 4NRYB 5BCAA 1N0LA 3NDYA 4UIMA 4M7JL 4M81A 1H2JA 1NFDB 1FNSH 1AO7E 3RX5A 4LAJH 2I24N 4QYOA 1ISXA 2G3JA 1G7HA 1B0RB 1G01A 2X4SA 1LO2H 2X70B 4A6YL 2G8ZA 5ISZA 3VWKC 5IMKA 4LARH 3RWJA 3P0VH 2LU3A 5C7XL 3WF2A 1UFUA 3AHYA 3BXNB 3OA5A 43C9B 1CD8A 3NOIA 2F7RA 2EYRA 3F7YB 2VLKB 3OJDA 5IB4B 3HI6L 4M9PA 2H9GB 3BP5B 1HJVA 4HWBA 4IMKC 4X6EB 2QKIA 3MO1A 3G5ZB 1ORQA 3EFFB 4X7EC 3SJVA 3Q1SL 1KB9K 1S7XA 2P5WD 4H1LB 4LAQL 5IQ7L 4G9DB 3PWPD 2ZG3A 1GH7A 4QHUB 1QI0A 4TVSa 3CH9A 3CUJA 3WNMA 3WBDA 5H94B 5F3HB 1DZBA 1UZ8A 3D3VA 1E1EA 3FY1A 3G6DL 2UY3A 1OGTA 5INCB 3JV4A 4ONHB 3T0BA 2XM1A 2NZIA 2O5YL 4HDIB 3HMWL 3C8KA 2NT1A 4HXBH 3VXRE 3ARFC 3KYMA 3MO4A 3OGCB 3JUGA 4P2RB 4WFED 4PMZA 5I1AA 1RIUH 4PUEA 2H3NA 1T2JA 4Y4HC 4EUPB 4KKBD 3IRPX 2NY2C 1M7IB 4D9RD 3V4PH 1GZQB 3C60A 2GJXA 3LSOB 1XCQA 2A74B 2UUDK 3HG1A 4X5WA 2PO6A 4S0TD 4PJBB 3BW9B 3RDTC 3H9HA 1G9MH 2AGJL 4M7ZB 4GAYA 5TE4L 5ABDE 1H3TA 1PX8A 3MLUH 1Q9KA 3QXVA 4P57A 1Q6DA 3KZSA 2R0ZL 4C56A 3L7FB 3HPLA 2HWZH 1NCAL 4PS4L 1XF1A 2D7OA 2F54E 5IM7B 1WFNA 3OB0K 1TQTA 3MRLA 1A4JB 4K9EL 5EU6A 5GRJL 5KSBE 3WL1A 2GITB 4KQ4H 5E08L 4NUJB 4X9BA 2NNAA 3IDYC 1K5NA 1BEYL 4Z7VB 1OTUD 3U7WH 1BQLL 3ALWA 1JXJA 3CDCA 4GRLD 5DHVA 4Q9QL 2Y06H 4L4VA 4N0YH 2HN7A 2AV7B 3GSUB 5DJ2A 1IQDB 2IH3B 1A4JA 3Q5TA 4ODBD 3M45A 1RJYB 3E6HB 3D18A 1CLOL 3KHOA 4FQCL 3DDGA 4PRNA 1LO5B 2W5FA 5F3BB 1A21A 5GSVA 2EIZB 5H2BB 4MQ7A 5IWLA 4QHMB 4N5ED 3VU2A 3QP3A 1EVTC 5HI5C 5FDWA 1UD4A 2ZSWA 1N4XL 3PBGA 2XTJB 5EZJB 4MCZB 1G7JB 1MCIA 3L3KB 1KCKA 4NQSB 1N5YH 1NM9A 1IV8A 3WD5L 5GS0C 1BOGB 1ITCA 4XCYB 5F7WC 3MRPA 4HZLB 1JD7A 2G5BA 4FNLL 4HIIA 3TYFA 1SJVA 4HKZB 3QXWA 3EDFA 3HE6D 2UZIL 5JA8B 1EUTA 4TNVF 1LO4L 1VFFA 4LSRL 5BOZG 5GGTH 4PN2A 4IOFD 2ZP0T 3RVWD 4NSBA 3L3OB 4ACYA 5JNYA 3V6ZB 2R8SH 3VNYA 2VLKD 4EI6A 2WBJB 3WHE0 4CGTA 4NRXA 1QFWL 2WW8A 3SE4A 3VD7A 5AYUH 1RP8A 4D1IA 1T0MA 2OWWA 4RNRA 4L1HA 4YDJB 1LO3H 2EE2A 4NRZB 3BVUA 3J8F7 4PJHA 1UADC 4YK4B 2FBJH 7CGTA 5SWQB 1M01A 3OR7A 1TUXA 1HXMB 2IG2H 4EI5A 1SMAA 1F4YH 1SEBA 3VXME 2OWCA 4LKXB 1S7UB 2IANE 2YWYA 3OAUH 4PYGA 4DK6A 1E72M 4RE3A 1KXQA 5DD3H 4HAFA 2WVVA 3WUFA 4YHPA 2XOTA 1IM9A 3GMQA 3Q5YA 3QNZB 4W5ZA 4PJCA 2WK2A 2C3VB 5HGBB 2OP4H 1U8KA 2CIIB 4M5ZL 5EU5A 3D2UD 5IMOA 1HJXA 1MCSA 5EWIL 5TDOA 1JAEA 3MRBA 4F8QA 3QULB 3S5YA 2A3HA 1FP5A 2IH1B 3QG7H 4FQ1H 1F00I 2WC7A 5DHXB 4AZHA 4JQVC 4NZTH 1AIFB 2VN7A 4IRZL 2IXUA 4YNYB 1IM9B 1HEZA 3VXTA 4U1JB 2VSCA 3HRPA 1FC2D 3GH7A 3W0WD 1UT9A 2Q76A 3MJ9A 3CNKA 3U36B 2C3GA 3ZTNL 1KJMB 4KVCH 5JXAL 3PWLA 1K8DB 1OTSD 2HRLA 4KJPD 4QFUA 1JMXA 9CGTA 3L3GA 3NYDA 2WBKA 3VFPB 5IV2A 1HINH 3GEWB 3UZVB 1P7QB 5C07B 4J3WA 4H20L 5ELIA 5T3XH 4U1JA 3RAJL 3WLWD 1HJUA 4XBGB 2CPUA 2XGIA 4H8VA 3GMLA 4NJAH 4LPYA 1H1NA 3ALXA 1HIMH 5FA3B 4JO2L 2VXQL 4LL9A 1Q6GA 4PJBF 1DWGM 5EBMB 2CO7B 4XGZB 3UTTD 3LKNB 4GKOA 4LP4A 4OD1H 2DJSA 3V6ZA 1KB5B 1A47A 3HZ3A 2PR4L 8A3HA 4QP0A 1CCZA 1CDUA 5DHVB 1WAWA 4PLKD 4OD2B 4ZUSA 4DGVL 3NZ8A 3WFDH 1MHCB 2ZOLA 4NJ9H 5D1QC 1S3KL 4U6HB 5DR5L 2EE3A 4EK7A 1S3KH 2NLJB 3GSVB 4H88H 1AQKL 4GS7C 3PTKA 1A4KA 2BVTA 2WV3A 1A5FL 2W92A 3E8UH 3VINA 3RGVB 5T3ZD 25C8H 5B4MC 3OIHA 4NO5B 4U6YB 2X2YA 1YEJH 5IW6A 3PXHA 5SX5H 4YQXH 2ZSWB 3WY4A 3O6ML 3WUEA 4CJ1A 4JO2H 3DV6B 1WBZA 4GO6B 1T89A 1D9KB 4JFPB 1OWQA 2P1YA 1NDMB 3ZTJH 3U1SL 2EADA 3GMNA 5LQBL 1YMMA 1I8MB 3WXWL 1C91A 5KOMC 2ZCKL 3N1QC 2IADA 4POZD 4PRAA 1EGJH 1TVBA 4BKLA 4JQIH 3TBWA 2Q3ZA 4G80A 2BXYA 4GAGH 3ZT5A 2D7PA 2ESVA 2FGLA 2XA3A 3ZDYF 1CLXA 4K3DL 1TQBB 1CU4L 4W7UA 4PGZA 3IJHA 1WE5A 1PGRB 4U1IA 3VXMB 4JFYB 4QCIA 1RK1A 3MANA 1U8HB 2AOSA 3OPZL 2O5ZH 4M48L 4WU7B 1OOAA 5IOPA 1U42A 1ADQL 1G1CA 4TVPE 2ZKHL 5LXGH 5MERA 1PZ3A 4XX1E 1HHKA 2D24A 3DRTB 3OR7B 5E8DH 2L0DA 2DEPA 3I6LD 2V2XB 4I18C 5HYSG 4L4VD 4TOYL 4GKNB 1URLA 2W38A 5T1DL 4C7DA 4M56A 3SN6N 3MUIA 1KNOA 1HNFA 1W8OA 5JPMA 4YHPB 5C09E 4ZFOL 2IG2L 1CLZH 2APWA 1J0IA 3GKZA 3BDYL 3OZ9H 1CFTA 1FHGA 3VXQA 3TBVB 4UUJA 4X7DC 2NXYB 1L0XA 3QULA 3RNKB 3X14B 3B2VH 4AIXA 4HULB 2ADJB 4CVZA 4PGCB 3NCOA 5JTWA 5ABGA 4UT6H 3LPGA 1T6WA 5CGYC 4DQOH 1LG2A 1JGVH 2YD4A 4ZQKB 2DQIL 1A6VH 3UYOD 2CKNA 2WYSA 4L4VB 4Q97A 4PB9L 3AOFA 3QQNA 5MEQA 1X5LA 1DQLH 2BS9A 5C2BH 4HH9B 5F6HJ 4IOIB 3DV6A 1K8DA 3CZFB 3ZHKA 2UZIH 1ISZA 4HBCL 3T0EC 3UTQB 1ZGLM 1DQLL 3AS3A 4PLNC 3TNMB 4PFEA 4PB9H 2ZUTA 5I1HH 1C08A 1CD1A 4Z7QF 4ZS6D 4JPWH 5J3HC 3GH4A 3G08B 1AO7A 2DQIH 4GRLA 4OI8A 2ZE0A 1G7HB 4I0PA 2DYPD 3TO2A 2X4SB 4XBPA 1BBDH 3OKDA 4ZO6A 4WCYL 2OK0H 3OF6A 1CR9H 1KJ2B 2Z31D 5EIQA 5K9KA 1H09A 4NN5B 2XWTA 3DARA 1OB0A 3QXUA 2ZSVB 1XCTA 3EJZD 5IQ9A 3MRNA 5HHOA 1T83C 3BDYH 3OZ9L 1KWKA 3MFFB 5IT2H 4Z76A 3JTSB 5B21A 4WNQA 4JANB 3TIEA 1JFQL 4N0YL 1QACA 3DRQB 4Y4FD 3BLBA 4OAWA 2R2EB 3L5XH 3GGWA 3BZFB 2DSWA 4D2NA 2XWTB 4ATLA 5T1DH 2ZXBA 2V2XA 3TA9A 5D1XB 2DLFH 1F4AA 5GRJH 4V1DD 2WWCA 4MX7A 1KCSL 1OT2A 1F3DH 3BQUB 5LXGL 2G9HA 2PO6B 1PG7X 4JY6A 1N6UA 4E41E 4XP1H 1P6AB 5I19H 3F5KA 1NCAH 1UXWB 1J10A 5FYLL 4CMMB 4Z7OE 1JK8A 1KPRB 1JYWA 1XYFA 3GBNH 4PJ5B 3KPSE 3X3GL 1R24B 3W2DH 1FZKA 4NN7C 4P3CH 1UOKA 1CXFA 5ALCL 3GIZH 4PJGE 1SY6L 1S7UA 3X14A 1ZA6B 3SO3B 3MJ7A 1DBMH 5D96C 4BA0A 5E4IA 1NBZB 1I9RL 2MJWA 5CP3H 4JFTA 3QH3A 4WFGE 4MDJB 1AGDB 1PZ5A 2LU4A 4WY7H 4TUJB 5CGMA 2GTZB 1U8HA 3GTNA 2RB8A 3OKEA 3UX9B 5CSUA 3C8HA 2YKLL 4C56E 4BQ8A 5E7BA 1FYTA 3H53A 3MXVL 1UQSB 1IEAA 1P1ZB 3HR6A 4NX0A 1TVNA 1OD9A 4CRPA 4X4ZA 1CD9B 1IC4H 1C3FA 5A6JA 4ZD3H 1UR8A 5IP4A 1YY8A 3QJHB 4XZWA 3MRHB 1Y18B 1YEJL 1A6AB 5ILTH 1NEZA 4G6FB 2XWBB 2ZG2A 4WO4A 4Z0XA 2OCFD 2HMIC 3W5MA 4HIEB 1MFBH 2XRAL 2VR5A 1A5FH 5J11B 3NIDF 1R5VB 1I9JL 3D39D 2ALWA 1B0RA 3QUML 3W11C 1S5HB 3ZLQC 1V08A 1FGNH 2HVJA 2CNCA 3CH1A 3EO1A 4Q0XH 5JW3L 5DRZA 1WISA 2AQ3A 3L3KA 4M7KL 3TJEL 4F7EB 5E1QA 3IKCA 3LKQB 1MCQA 35C8H 4MD4A 3SCUA 3MPCA 3DTXA 3P0VL 1DJSA 3FO2B 1MHHA 3EOBA 1JWMA 4I4WA 4P2QE 1MWOA 3BWUC 1NMCC 1P69B 3F65A 4KKAD 5K9JH 1QSVA 5DJDA 1KOAA 4UIKL 2UYLA 4QOKB 4EKJA 3SY0A 1ZHBA 2X4UB 4ZAKB 2W63A 3BWAB 1MWAB 3O3DA 1HINL 3WEXA 5DQ9A 1JBJA 5GXBB 3TVMC 3VRIB 3F5JA 1N26A 2BY2A 4N90D 3LZFL 4RIRA 4UNIA 3NVQA 3NIGF 5E5MA 1RH9A 4QTIH 5JQ6L 2GDVA 4HDIA 2ZXDA 1OT1A 1TQCB 1R3IL 1R86A 3AXXA 2YBRB 1O7VA 1FZMB 2H6PA 3ULVC 4Y5VB 3ZE2F 1FJ1A 2YPLD 3V5DA 4QRRE 1JG9A 1V03A 1I1AA 1YY9D 1DQML 4NZTL 4HIHB 4M4RA 1EAPA 5DZLA 1QEWA 2OSWA 3OKLA 5HGGS 3P77A 4ZTPL 4QY8A 1OCWH 3FO1B 2NY4B 1IFHH 3DOSA 2YPKB 4LQFH 3CUGA 1OP5K 5CGTA 4M5ZH 5D2LA 4PV9A 1WQVT 3H7BB 4BSVB 3ZR5A 1A6ZB 3ES6B 5D9MA 4KKNA 4M7LH 4OM1H 3D25B 4LDLB 1PEZA 4YEFA 3FQUB 1JJUA 4PGEA 4ACZB 4WTWA 5B38A 4L8CA 4FK9A 4Y19E 1K8IA 2UWEB 1F4YL 1GPOL 1S9WB 5I71B 1C5CH 4PGBA 4K3EL 4P9HC 3NN8B 2C3VA 2DIJA 4DN4L 4R96B 4KJYB 3WL9B 1OP3K 2HT4C 1FORH 1J8KA 3PWUA 3G6JA 4HU8A 4W93A 1RZJH 1JRHH 4P4KD 5JLZB 5EMYA 1INEL 4G3YH 3WXVH 4DZ8A 5FGSA 1AJ7H 4G6FD 5JR1L 3EJTA 1BG4A 3MJ7B 3MX0A 3SDYH 2LAAA 3BPLB 1IAIL 4WI8A 1ETZB 2WIMA 3D39B 3GUTA 1CBGA 2J8UE 1RSFA 5DFAA 4P49A 2XFXA 1BAFH 4MB3A 4OLVL 5I17B 1EOKA 3DO7B 4MVBC 43CAA 1DN0B 4Y4FB 3WN5A 3BE1L 4CUCA 3PZUA 2ZZUT 5DDHB 1YJDC 4JRWA 3G5YA 1N5AB 5D9SB 1LLOA 3RM4A 1W3KA 1IGIH 1SMDA 1FLRH 2X10A 1OAZL 1NBYB 1VADB 4J8RB 5DVLA 2FD6L 3UYPA 1OD7A 1EHLL 4HCRL 1XYZA 1T03L 4L4TA 3O6AA 2CXKA 5I1GL 1ESWA 4Y4KA 4X4YB 3EGSA 3DO7A 4ZXLA 4Z0BL 4AD3A 1VFAA 2RGSA 1BQHB 2H32A 2J2ZA 2NLJA 3U6RB 3TA3B 3P2TA 3EJYC 1RK0A 5C0EA 2ZG1A 3QQ3A 2FATL 4X6CB 3MROA 3AHZA 1F58H 3SGEH 4OOUA 5INCA 2FB4L 1FFPB 3MLXL 3U7WL 5SWQA 3OXSA 1XT5A 4IOFC 2R2HA 1CQKA 1E28A 5EC2B 3NFPA 4S2SB 1FFOB 4G6AC 5EO0B 2Z31A 1ZXQA 1SFSA 3AZRA 3MSDA 5DJZB 1SMOA 5J6GB 3SY0B 1FZOB 4CBPA 1TVHA 4FQIH 1Q9OA 4PS4H 2NW2B 3WDJA 4YHML 2B39A 5HVFB 1W72L 1TPXB 3G6JE 1RULL 2BOCA 3IDNB 3MREA 2EPNA 4FNUA 4IHOA 3RY4A 4AXNA 3L5IA 2PF6A 5JXEA 1F3JA 5I8OH 1HHIB 3OG4B 2AJXL 2XN9E 3AS1A 3PV7A 3VMNA 1PY9A 2BCKB 2IF7A 5F1IB 4G6KL 5LJYH 1F42A 1F4XH 3I6GB 4AM0B 4WWID 5JO5A 2ITCB 3FZUD 4GRMB 1QKZL 2HRPH 5TD4A 2X6MA 1V3LA 1RIUL 2OJEA 1ETZA 3ARGC 5DUMH 3JUYA 2XIBA 5IROC 1PIGA 4HXBL 3HMWH 5BVJA 1BTCA 3HUJB 4X0KA 1LE9A 3KPOA 3KGRA 4YBLC 3VI4F 5I9QC 4KRPB 3RA7H 5T5NF 4N0RA 1PLGH 4TUOA 1HZHH 4GQ9H 4U0QB 3PIQA 4Y5XA 4OZHA 5GNZA 2YPLA 2A6DA 3CZSA 3BUYA 4QWWC 3DX7A 4NNPH 4XBGA 4PGCA 4JQVA 3AAZA 4B0MM 1QR1A 4LAQH 3HUJF 3LPFA 3QEHB 1GVIA 3ULUF 2HVKA 2NR6C 4Z7UF 5GGSA 3CZ8A 3O6KL 4U1NB 4OLUH 2X1XR 2BNQD 2MHAB 3GXMA 4Z7VF 4HIXH 4YBQC 1KACB 3G5VA 1QSZA 5F9OH 3PGDA 4JM4L 4X7CC 4PSRA 5BXSA 3CXDL 4BF7A 3NCFB 5CEXB 2YOCA 4UV4L 2D0HA 2Y07H 1JVKA 4NQCA 2VDPH 2G60H 4NO3A 4AT6B 1DBJH 1O7DC 1BZ7B 4RMUA 4G43B 1DBBH 3QZWB 5CWSA 2MHAA 2R69H 1VRXA 3SHSA 1SJEA 4KZEH 2G60L 4MGXA 5D7LA 2VDPL 5TPWH 4MA7H 3GJFB 5DC9B 1R7OA 3JV0A 1XSKA 4MDIA 4LCWA 3VCLB 5LGJB 4W4OC 1IKNA 3LEYH 4OGXL 5F9OL 3B9KA 3UTSE 3CHEA 3GK8L 1JP5A 4CNIB 1JNHB 2H1PL 1NQ6A 3WUWB 4B15A 3NCEB 2XN1A 4WO4D 1AC6A 5F9DC 1E73M 4LVOB 5C0IB 4BFIA 4ZUTA 4KI1A 2X4QA 3W9EB 4Q9BA 4G8EB 4OSUH 3UZQA 1E55A 1R3HA 5L88L 4ZTOH 5DJAB 5JUEH 5ECUA 3ZT6A 3VGAB 5FOBA 2J75A 1ZHBB 5HDBE 3IFNH 4X6DF 3KPNB 1QLEH 4Y8AA 2XYLA 1M71A 4JFFD 4NZRH 4TUFA 4OF8A 4EN3D 2ID5A 3SKJL 1P7KB 4OZHF 2NY3D 3TH3T 1MW2A 2X05A 1AGEB 4OFDA 4LSPH 5FUOH 1OWWA 1BWWA 5BVJB 2PTVA 3DIFA 4W5UA 1NKRA 2DM4A 2ZUVA 4LLDA 5INDB 2HYMA 1QKZH 2HRPL 4PRIE 4XNZC 4YPGA 3RX7A 2PB1A 4FTVE 2JTDA 5FM8A 4YXLL 5F7EL 1F4WH 4IBLT 3MYJA 5F9AC 1UWIA 5DLML 1XF2B 4O5LH 4R7NB 6FABH 4TOQA 4MDOA 3BPNB 3WY2A 3QDJE 1UXWA 2LE9A 2X4RB 4ZXBB 1R0AH 4X4MA 3VVGA 1WZKA 5EUOB 4LPVA 2UY6A 5HHPB 1A0QH 5ESAB 1FNEB 4MAZA 1GZPA 5L9DL 2BC4A 4PGEB 5J1AB 2F5BH 1QA9B 1S7SB 3W6MA 4S3KA 4IIQC 4O2FB 3T4AA 1K85A 5I1JH 2WIIA 4XCNA 4H0HB 5BS0D 4YFDB 3QO0A 3QSKB 4XCEA 3VD5A 4GXVH 1R47A 3TBTB 3WJLC 1L8NA 2CBUA 2J78A 4HD9A 2O9TA 3TZVC 3UPRB 4TTDD 1HI6A 4A6YA 2PUQT 5E4EC 3BP6A 2HVJB 4S1RH 1RMFL 3TJHC 2DL2A 1OARL 1ZLSH 5F1SA 1KELL 1LE5A 5FYLD 3BXNA 1IAIM 1EBAA 1Q0YL 4MWFA 3PP3K 2LAGB 3C8DA 3RWDA 5B8CC 1NC4D 3RL2B 5C0AB 3CFJB 1XIWD 5LA2A 1U8IA 1U8LA 5JQHC 1MREL 1E71M 1JI2A 1JWUB 1LEGA 1CS6A 2WC3A 4HXAH 5EBWB 3I75B 4QLJA 3QUXB 1D9KD 2E9JA 4MNHA 5IR1B 4Z8FL 2X4NB 3BE1H 3PQYA 4TNWK 2AK4B 4JRXB 2A3AA 4R2GB 3LKQA 1YEHL 2DQCL 1LK2B 3O9WC 2D7MA 2X09A 2D1ZA 1N3NB 2ERJC 4PRPA 1BAFL 3ZR6A 3ZKXB 1X5ZA 4QLLA 3CFCL 5CIPB 1LNUA 1ZS2A 8FABA 5I1IL 4WKHA 5E5MB 2NXZB 3JTTA 3VO0A 2APFA 3BN9D 5I1JL 3SCPA 4XH2A 4P2RA 4H04A 4U0RC 1IKFL 2PTUA 3O6FD 5I8CA 4GFTB 4DVRL 3QUMA 1DVFD 4IEFB 1MCWM 2EDNA 1RZKL 4TSCL 3W6LA 3RIAF 2DTML 3TN0C 2PBGA 1WDPA 1OCQA 3HG5A 3K81A 1T6VN 2BDNH 4UNUA 3TA3A 5L7XH 1VEOA 2OMNA 3D48R 3NPZB 1FORL 3WUWA 1U2YA 2XVPA 4MB4A 2NR6D 2YBRA 4RAUB 4M6AA 1T7WA 1Z5LB 5KVDH 4O5LL 3H7BA 4KK6D 4M1DH 4BSVA 2X4QB 4K3EH 3W9EA 3ARFA 3SKUD 2R4SH 3M6DA 1E4WH 4QT5A 3WFHA 5MERB 4QY8B 2NY1C 5M94B 4BELD 5HPOA 3VFSB 4AL8H 5FUOL 2VLJB 1EEYA 4U6XB 4WWKC 3RUGE 2RFXB 2DIAA 2BJML 4FMKA 4XPGL 5D2LE 3V5HA 1VJSA 1T1XA 3P3YA 5J13B 3GNPA 2J7EA 3A3HA 3CUPB 1WGOA 1EK3A 4GW1A 5MEPB 1LEKA 2VITA 1WP6A 4RGMC 3E6FB 3NH7H 3ARTA 5TQ2H 1IFHL 1QLEL 4LQFL 2OI9C 4W4NA 5ACZB 4Q58C 1KIPB 3D0VB 1UQSA 3FQWA 4U1LA 1ZLWH 3WUBA 4OSUL 4GRMA 1R46A 4L9LB 3C2SA 1D6EB 2X42A 1FVDA 1RU9H 1UCBL 3PGCB 3EOAA 5IKCA 1KXVC 2E3VA 5FYJD 3PQYE 3TWCL 3VE0A 2JF7A 1OAUL 5KJRL 1HNYA 4KHXH 4WGVB 1AI1L 1KPVA 1HSBA 3ZQ9A 5IXEA 3LKSA 2H1PH 2KUTA 5IHUH 2GJJA 4ZUWA 4UNVA 4KAQL 3HG3A 5GSRB 4G6JH 1CTNA 3L2MA 4HBQA 5HBFA 4HJ0C 5E2UL 5E8OA 3P0YH 1UM6L 1HH6A 2HKFL 3T4YA 5IVXA 4ODHL 1OTTD 43CAB 3DX7B 2ICWJ 4S1DC 1DBBL 3VWKA 3B9AA 1QLFA 1XGTA 4KRPD 3IJSA 4LCYA 2JB6A 3B83A 4XB8A 4B3LA 5K9JL 3SGJA 1Q0XH 5FUCC 3UR8A 1JHTB 1MNUH 1FNGB 4J6RH 4UINL 4EANA 1WTGT 4Y7MA 3T1FA 3BESR 1X5JA 1OSPH 3A6CL 4YGAB 4FG6C 3WUWG 1HH6B 4GO8A 2P7TB 1EIBA 3HC4L 4O00A 4OLUL 1DE4B 3O6KH 4G6ML 2HJKA 1NFIB 5DC0A 2ZUYA 1I9JH 3PABB 4PJDE 5J6HA 3UTPE 4HQQH 4D0DA 1BPVA 1NGWA 4EN3A 4W86A 5DJ0A 5ILTL 3QFJA 3SDDB 4B16A 4BFGA 5CCKL 4PTMA 2R2HB 3ZYZA 1VENA 4R9HA 5EZLB 1UH2A 1KB5L 4MA8L 4OLXH 5DYOA 4JFDD 2J8UF 3SCSA 3A6BH 5EOTB 1TR1A 3QIUA 1HWWA 3ZL4L 1EH9A 1Z3GL 3L3IB 3QQ3B 3C6SB 4AMKL 4U1GB 4LDEB 1MI5A 4XPTH 1MQKL 2YKLH 5DUML 1T83A 4LMQE 4RX4D 2Z93A 3KJ4C 4GOSA 1JGLH 4JIEA 4GAJH 4DN3L 3RGHA 3CLFH 4DKFL 2NX5E 4I77L 1HYSD 1F4XL 3K2UL 4JDZB 4P2OD 5I8CB 1DBML 3ABZA 2CRYA 4O2EA 4XVUC 4F9LC 3T2NL 2XFRA 4MHHG 4P3CL 2BOCB 2J3SA 2YRPA 5IKCB 1J7VR 3GBNL 4MNGE 2DLTA 2F58H 3QRGL 3HZMA 2FH8A 5JHLL 3OSKA 5BZDB 1H0IA 5IVXE 1U8OA 3QWQB 4FQIL 3LEVH 1C90A 4F9JA 3AROA 4JEGB 3F7RA 3MOBL 4IPLA 4HF5L 2H32H 3DX9A 2Y25A 1R34A 3SE9H 2XWEA 3VXQB 4PMNA 3APGA 5CKGA 1YDPA 2FB4H 1BF8A 5KVGL 1TZIA 1FO0B 2DH3A 4CKQA 5DFVC 1G0XA 1F02I 1FDLH 2R0WH 3FQRA 2X40A 5DRNB 5F9WB 3T65B 2IPKB 3V5HB 4LKCB 4RQQA 5E2VL 2VMFA 4AK1A 4MMZC 3N12A 2X0HA 5AYIA 1ZAGA 1XCXA 4Q2ZB 2E7HA 4Z0BH 4XP4L 5IK3B 1D5XB 3PWPA 3MLYL 4EE9A 2CK0L 1M7DB 4H8WH 4Y4FA 4X5LA 2FX9L 3VRLF 5EB8A 1GCYA 2B1HL 3R8BB 1IGIL 3RU8H 2AXGA 1AQMA 2Y5EA 2CDEB 5D6CA 2V3GA 1A4KB 3UC0L 4GQPH 4LKCA 3IDIA 4K3JH 4UB0L 5AZ2L 4WUUA 4V1DB 1J87A 4RISH 1US3A 1ZBCA 4DZBB 3ZT7A 2ZX9A 2AK1H 4PPTA 5KOVC 5I3DA 5ADPL 1J01A 2JJUA 5EOCL 4M03A 5E6ID 1GIGH 3HG1D 2B0SH 3WO3B 5IHRA 1NGYA 2P46B 2XYCA 1DLFL 2IADB 5BV7B 1TNNA 5D1ZC 3SDYL 1FSKC 5CS7A 2BVOB 1LK3H 4JFOA 1AJ7L 4LNRB 2DLEA 1J11A 4LCWB 1PBGA 1VBRA 2Z31B 5JDJA 4PJAA 2C4FU 3QZWG 1E6JL 3CFDB 3P4OB 1NC4B 3HLAA 2YA2A 1HKMA 2JF6A 1PKOA 4HK0B 3BH8B 1ZGLA 2DGAA 4FQ2H 4RRPA 5HDOA 3VFGL 3LQZB 1P7KA 4JJHA 2FCBA 5EO1A 1FQ9C 1PSKH 1GPOH 4NHUB 1WTLA 3AYSA 3PZVA 1A9EB 5F44A 4KKCD 1YYLH 1B3WA 3VFVB 3L4VA 5FAAA 3FONB 4AZCA 1E6OH 5C2UB 2J1KA 1NCCH 7FABL 4S1SL 2WC4A 1EOMA 3FB5B 1KCUL 3BEWB 1XEDA 5DYOB 1R5WB 2ZCHL 4PRHE 3PZQA 4Q7NA 4JPKL 1QPXA 1OAQL 1P2CA 4DTGL 2X7LA 1ZT7B 1K8IB 2UWEA 1JZ8A 3HPJB 2VIRA 4JZNB 2WP3O 5D2NB 3S3SA 1YYMH 5E09A 1UJ3A 4M48H 5BW7A 5D70H 4X8JB 4G8FA 1GGUA 2Z8RA 4NDMB 5GRUH 1RY7B 5DTFA 4JFEE 2XT1B 3LIZH 5IHBA 3DXAB 1J18A 4WUUE 4N0FB 2G5RA 4N90E 4GAGL 5D7JC 1C16A 4J3VA 5D72L 3VDCA 5JQ6H 4JQIL 4QTIL 1Q9WA 2ENSA 2DKUA 5DGRA 5J06A 4ZE5A 2YN3A 1CGTA 3WXWH 3TZVD 1U8OB 5GRZA 5FUZL 4M93C 1QA9A 1S7SA 3PWNA 1T5XA 3OJMB 2FSEA 4APQA 3MQIA 3QUZB 3GBEA 3RL1A 2IPTH 3MS8A 1JGUL 2WUCL 5GS1B 3VOCA 3RO8A 2E9BA 4PD4J 2X2JA 3DTXB 3MV11 1QFUL 1G6VK 3S2CA 1KPVB 2EXOA 4YE4L 4OGYL 2R23B 5CINL 4HWEH 4GINA 5I6XB 2P8LB 3MRRB 2VWEE 1KBKA 1I7RA 4BSWB 5JDSA 5D9PA 2VXSL 2A77H 3RIAK 1JRHI 3EDDA 3ZYJA 1XF3A 1KLFA 2A0LC 3QUMH 1YEFH 3ALPA 3OB8A 4HOZA 3RTQC 4HJJH 3VWKD 2Q6WA 3SE4C 2SEBB 1E6PA 4QOKE 2XVNA 4R26L 1MPAL 4OZFB 5BQ7A 3UMTA 4RIRB 4NQEA 4ZUTB 4AENB 1JHTA 5E99L 5KVMC 4WFFD 3JWNC 1UKTA 1BJ8A 5SWZB 3MRKA 4G8IA 2R2BB 1CE6B 4XPHH 3CC1A 2F1AA 4I0PC 5GIRB 1CFNA 2AJYH 4ZUVB 5I74C 2JB5L 3VXUD 4QRSA 4OF0A 4XXDA 3SPVB 4U33A 1T89C 4NHCL 5JORB 2D73A 4X5XA 1V8HA 3L5HA 3L95A 3T2OA 3ZDZF 5GS0H 4WW2B 3KS0H 1S7WA 3S6TA 4NQDD 4U3XA 1IC7H 1F45A 4OLZH 4UOW1 3SDDA 1CLVA 1LO0H 1QPKA 3MA7B 1SY6H 5C0CA 3DYOA 1HHIA 4P59H 1CQYA 4FXKB 4DEPB 1HKKA 3QIUB 1XGRB 4X9GA 3AB0C 5HYSB 2NYYC 1Q1JL 4Y7EA 3TV3L 3ZHDA 2QHRH 3C6SA 1Q9LB 4LFHG 5EWIH 1G94A 1ECEA 3V7AE 4Z7WF 4D9LH 5EN2B 3FQTA 4MCYA 3KL0A 2W4XA 2K7QA 2W60B 2AJZA 4FXKA 5IB2B 1YMMD 2EC8A 3PWUB 2EDHA 2OL3B 3OAUL 3VFSA 4S10A 3CHDA 1VESA 1YUHB 1CVRA 1R3JB 3DI2B 3LH2H 1XF4B 3O4LA 3ELAT 3PIQB 4Y5XB 3S4SB 3RUGA 3N0PB 2C1PA 5L0QC 2OXHA 5I1CH 1BD2E 1EDQA 5DFWH 1LO3L 1VJZA 1ZT4A 3QOKA 1J0JA 3U4EB 1DBAH 4AISA 3L4ZA 1J1XL 5E8NA 1DBKH 3IDUA 5K9QG 3C2AH 1UKSA 2WLZA 2YMXH 4OI7A 5LBSL 1XH3B 1KSRA 3KDMA 4JPWL 3HCVA 5BV7H 1YEEL 1JWMB 4I4WB 3WD3A 2F53B 3HMXL 1BP3B 2L7JA 4JE4B 1TZHA 3LVEA 2WHKA 4H5SB 4ONOA 3KPPB 3BEVA 4MD5A 5CP7A 1YPZA 4LBEA 5FA3A 1Y7VA 5I76A 4FTVD 1H41A 1SEQL 4ELMB 2E40A 1JZ6A 3QIBA 1BF2A 2XTJD 3T77A 5L2JB 3LKOA 5FGBC 3VWKB 3ILQC 4ZUSB 3QEQA 1NFIA 4Q74A 1VFMA 1QRNE 2IFFH 4G8GE 2FJGB 5F1NA 3O6FA 1QYGH 3V4UL 4NZCA 4U1SB 12E8H 5FM5O 3F6IA 5T3XD 1KCLA 1B30A 2RCSL 5L2KE 4ODXA 2PYEE 2HT3D 1G0YR 2M1KA 3HRZB 2AJ3A 4HUWB 1ZLWK 1QI5A 4AYSA 4FP8H 1EO5A 5E9DD 4W4OA 2VVNA 3MMEA 3T1WA 3UTTB 5DJZA 1I7UA 5C08E 4HWZB 1ED3B 3AIWA 1NGPL 4JO3L 4NQDB 5E8EB 4DW2H 3EMQA 1OLLA 1I8IA 3V0WH 1R3LB 4OZFA 2A3CA 1BQLH 2J79A 5HNNA 1J0HA 1QNZL 4OFYA 1W3HA 5C09A 3RDTA 1CLYL 3ARFB 3WF1A 3AM8A 3D25A 1JGIA 4D0BA 1QPPA 1WC7B 3OLIA 1NCNA 4RDQG 1KGUA 2J6EL 4Y4HB 4F37F 1BD2A 2A6KA 5E6IA 5IGXH 3BIKA 5HPCA 3RFZC 1GNXA 5DUPL 1I9IL 2F8OA 3THDA 1RD6A 4H41A 4U31A 1YA5A 5F89A 2D2OA 1HKJA 3GMMB 3IJHB 1AD9B 1JPTL 5C09B 3RDTB 3JVGC 3VXSE 3AIQA 1NCTA 2DD8H 4QTHA 1UXSB 1QO3B 5IVZB 4J27A 4M7ZC 2AV1A 3ME0A 4PTTB 5E5UB 2IFGA 4QRRD 2DIBA 3NFNA 5ACZA 3AIRA 4HA4A 1JGEB 1Q38A 3JV5A 1GHFH 3VFNB 1DHKA 4GI9A 1ZLUH 1WK0A 4YHNB 3V4PL 2J8HA 3NABH 2EEDA 3T3PE 4NQVB 5EZOH 1GOKA 3LPOA 1P2CB 2X9XA 1SJHB 4TUKL 3BUIA 3D4ZA 3RWFB 4U3CA 4YXHH 5DRWB 3HPJA 5H37G 2P43B 5LQBH 4LCIH 2KQMA 2O5YH 3DGGA 4WWKD 4L8BB 3OX8B 5CBAB 4ODSL 3G6DH 5EU6E 1L6ZA 2UY2A 3SCVA 1MWAL 2UY4A 3SDDD 4JQXA 3T09A 3STBA 1GOQA 1E40A 3EJJX 5L2JA 2X9YA 1T1YA 4MNQA 2NY4D 3BP6B 1IM9D 1A3LL 3E8UL 3H9SD 5CSZA 5E6YA 4L3EE 1JAKA 2NY2D 3NCCB 4H88L 3CFEB 1P5UA 1BGAA 5GS2D 3LV3A 4PJGF 4P5TB 1JN6A 1VKXA 3WFDL 3TYGH 1U8LB 4LHUD 1PAMA 2QTEA 1PZ2A 3ILQD 1UR2A 2AEQL 1HYSC 1CGWA 3QA3A 4A6YH 4OQTL 4OZOA 2BY1A 1KGCD 3WNNA 2P5EB 4F58H 2VXQH 4AIZA 5HTSA 3GXPA 1H8SA 1BX2A 4Y89A 4AY0A 1SR0A 1NGXB 3WH5A 1GQIA 5GJTH 4Q6IB 4AW7A 1MF2L 1TDQA 4QHLA 5DS8A 3S5LG 1RUML 1CK0H 2JJTC 2VDQL 3MA9H 4KVCL 1MHEB 4DVBA 2P5EA 1R33A 3G6AB 4EI5C 2MKLC 5HI5D 2CBVA 2A2QT 1C5BH 1AXSB 1LDSA 3WDPP 4CD4A 3TFKC 2PWHA 3P40A 2OTPA 2VLME 4L1DA 3H42L 5EO1B 2Y5TB 1WDRA 4K3HA 2YD3A 4PMDA 5IBLD 4YFLF 1K4CA 3QG7L 4FQ1L 2D4FA 4RAUA 5IVOA 3QG6B 2ZWYA 4OAWB 3MRMA 5FB8A 4RL3A 4P7RA 2OP4L 2CHNA 3OG2A 3SCMC 2W9EH 4ONFH 4R7NA 1WITA 3WDQA 1GCFA 3MJ6A 4U1IB 4XNUL 5F7NC 3SCWA 32C2A 2YKKA 4ETYA 1NUFA 2VDML 2JIXA 3QNXB 1UR9A 5C9JA 1VIWA 1QNOA 3IRZA 4HUXB 2XNAA 3V5KA 3MJ9L 4PY7A 3S36H 5AWNH 4PJCE 4OCWL 3RVTD 3WFLA 3U0WL 2A1WL 4L4JA 2GTWB 4JREB 5F88A 1KB3A 3G04A 4KPHH 2B31A 4P7NA 1V7NL 3RY5A 4OV5A 2BXZA 4L8DA 1R6VA 3QWOB 4I3GA 5DJ6A 5ACMA 3VFRB 4LLYA 5DD0H 5F21B 2X4TA 5AYUL 2QLYA 2F18A 2A6IB 2YFOA 4NUJA 4AWEA 2OQJB 4YHEA 4H26B 3HHRB 2WCSA 2CKRA 4P99A 3I02B 5HBBA 3QEGL 1MW1A 3KPRA 4PJXE 3I2CL 3O4LB 5L2KB 3NSMA 3DNKA 4FZ8L 4JY4B 4OFKA 4NO0B 1T80A 4WGWB 2BVDA 3I50H 1OB1A 5D1XD 2PI6A 1HHHB 4EEEA 2HJLB 3NCYP 5HYQA 3RI5K 2WZEA 4QCFA 2Z1SA 4KKAC 4D6IA 2A6IA 4LHUB 4CD8A 4NGHL 5HDBF 1YN7A 2Q8BH 4H26A 1FL5B 3P4MB 4JN1H 3TTYA 3EBVA 3L5WB 4R90H 3THMH 5BROA 1NLBH 5ACLA 4TVDA 3UROR 3SCOA 5JBDA 2FYVA 2CUHA 2A9MH 5IB3A 5SV3A 1L7TH 3K3QA 1G9NC 1V0KA 5FO7B 1IGTA 2XQYG 4MJ6A 3ZE1F 1UUQA 2DSZA 1IRAY 3IDMB 4LCCB 3SE8H 1C92A 2PKDA 1YMHB 3DHPA 1NAML 1BGXL 4XH2B 1UA6H 4JN1L 4ONHA 3W0WE 3GMRB 4NM8H 5FGCB 3LS5L 1QFHA 4C59B 5C09D 2QSTA 4K94H 3RDTD 2SEBA 3SDXF 4OOZA 1I1AC 4QOKA 3K0WA 4MJ6B 1D9KC 5C0RH 1BEYH 3I50L 4RCAA 1DANU 3UTOA 5KAQG 4JZ5A 1XGPA 4JDVB 1RZ8B 1JV5A 2VO5A 3I2CH 4JFQA 3O9WD 2Q7NA 5I15H 1BIHA 3ARVA 1JHKH 3V4VH 4G9FA 4HUNB 4PTUB 1GAFH 4MNMA 3BD5A 5E9DA 4KI5D 4P2QD 3S97C 4P3DB 5F7UA 5GISH 2A6JB 1R5WA 5JHDD 1U6AH 4H8WC 4HWZA 3EAKA 1QG3A 5HDRA 4KKLD 5B4MD 2EEBA 1G9ML 1IGYB 2AGJH 2HTKC 5TE4H 5HHXH 1RZ8A 1A3RL 4PLKC 5KS9F 1OWRM 1ACYL 3TO4D 4OD3L 4S1QL 1HJQA 2CEQA 1IGFH 2ESVE 2ICES 3BDXA 1E3XA 1MCHA 2YPKA 1PY4A 4EZMA 5KSBB 4AEIH 5IHZA 1K9TA 5I66B 4GKSA 1INQA 3ZMRA 1JIBA 2LVEA 4QNPE 5I1LA 5KS9B 3REVA 1QRKA 4PY8I 5JBFA 2XPGB 3B2UD 4LEXL 1ZGLP 4I3SL 3CO4A 3O45A 4ONFL 3MV8A 2I60H 5CJQH 2OYPA 1AIFA 3Q0HA 2IBZX 1IBGL 4GKZA 4EIZC 2RR3A 4CADB 1AGDA 1PZ5B 2AJZB 4Z95H 5HJ3B 3WH8A 1YJDL 3V2AR 1MLCA 4AMWA 3NN8A 1CFVL 2VSDA 3L3HA 4UIMB 2ILLA 3DVNB 4JHWH 4KH2A 5DQJA 5TQ0L 2J7CA 2EKSA 3O4LE 4TVPL 3U0TA 4NQVA 4MWFB 1C5BL 5ISZB 4W7WA 3HI6H 5DHVH 5DJCB 4CKVX 3RL2A 2X89A 1CDCA 3VXRB 1IC1A 3VGEA 2JB6B 3S4SG 5HD8D 1NEZB 2VDQH 3WJJA 2J88L 3UESA 1CK0L 1RUMH 4R3SA 3FCTB 4Y2OA 3KYAA 3PQYB 4E41D 3O2VH 2QKIB 3MO1B 1TZGH 3V9FA 3QEUA 4DFHA 2ZOKA 3IAPA 2EC9T 1XRVA 2R1WA 2EYTB 3AUVA 3H9SA 5I75C 3ZKNC 2CKBL 3LB6C 4HWBL 3A4WA 1UWGL 3N9GL 4OQTH 3ZJ8A 1F6AA 2VKWA 1NGYB 3VFOB 1KEMH 4HJ0D 2GFBB 1GJIA 3CX5K 1CGYA 1RPKA 3FT2A 3FQNB 5KSAB 5E9DB 3RGVD 3EYUL 5ISZD 1NBYA 1VADA 5J0BA 1I7TA 1T3FA 4PRBB 3I6KA 4P23A 1BQUA 4ZAKA 1IAOB 3VFWA 1RFDH 4Z7UE 1JF1B 3OGVA 2IPUK 1ED3A 2C4XA 1MLBB 1WBYA 5LGKA 5EBAA 3TCLA 4WEBL 5DRXA 1NFDE 2VQ1A 4ZSOA 4EBQH 3QXTA 2W67A 5JMRA 1W8NA 2H8PB 3T0DA 1EZVX 5E1AA 1C12B 4PG9B 2R0KL 4NKMA 4UQ3B 2WMHA 1U93A 3EJSA 2YUZA 1GOWA 3RVUC 5TF1L 4WV1B 3KXFE 2YRLA 5GGQL 4GQRA 4X6EA 4R4FH 4W89A 5D1XC 5B39A 1MFCH 4NZUH 3FTGA 4TUKH 3OKLB 1WWCA 2DBLL 1FZOA 3RVWC 1AXSA 3CBWA 4POYA 5TE7H 5E1AB 1V0MA 4F9PA 4U6VH 1ONQB 5A6KA 5FECA 2MCPH 2V5YA 3O0RL 4UILH 1RK1B 1A6ZA 3FRPG 1MCOH 4UT9H 4G5ZH 4NN7B 4YDLC 2EKSB 3OGCA 3S4SA 3MR9B 3MACH 1CFQB 4N1HB 4Q9RL 4M82A 5H35A 4NQCD 2TAAA 1EHAA 2VN4A 2VABB 4WTZA 2EYSA 3M07A 5FHBH 3T04D 3O8XC 3WNLA 1U58A 1UJ3C 4JRYA 4C83B 5IGXL 1SM3H 5DRNA 2J6EH 1IZKA 3MBXH 2OTUB 1GW1A 4AH2A 3AMGA 4FFWC 3FFDA 2BVQA 3A4AA 1V6WA 1OAYL 1G7QA 1L9NA 4RMSA 4UFIA 4LCWE 4YHLL 4LYRA 4ZYKA 4Z9KB 3IJ8A 5ESQA 4PB0L 1IGML 5CZVL 4I9WE 4DW2L 1FYTE 3S34L 1O6IA 5CSZB 2A6DB 1NGPH 3MNVB 2IAND 1FNGA 4DK3A 3RTQD 1DQQB 1CYGA 3BMWA 4GKZB 2CK2A 3TOPA 4JHOA 5MP6L 3GI9H 1TE1A 1J05A 5HHNA 1I1YB 2WNWA 1OINA 5GGSB 3BUDA 3DX0A 4ZO8A 2XFYA 4BS0A 4MLIA 3LRLA 1FL3A 3IETB 1QYGL 2DMBA 4X4XB 1DEEA 2N4IA 2PW2B 3FO0L 4XP5L 2ZCLH 2V7HB 2FIKB 5A3HA 2AQ1A 4XNXL 1NQBA 3TT1H 5JHDB 5J89A 1NMCB 5F7LB 5DJ0B 3VXSB 2AJ3B 4HUWA 5HYFA 3HB3C 2GUYA 2X4PA 4J28A 3BCFA 3IETA 2VVSA 2H26B 3C87A 4H0GA 4M5YL 1BVKB 1PKQB 4G9FD 2BFVH 2D7QA 2F8XC 2E4TA 1HKFA 1U3YA 3MRDB 1OW0C 2O9PA 3OKDB 4LIQL 1H3PL 1KN2H 4K3GA 3HMXH 4FFYH 1TJHH 2CJUH 5IFAL 5DMGC 3S5LA 2VWEC 3QDJA 5LWYL 2NY0D 1JHLH 2ZUMA 2EIDA 4PJ8B 1BVLB 5A6MA 4JGJA 4PJXF 4PJFA 3S35X 3GHBH 2FGWH 3ETBF 2VAAA 2CH8A 5KANI 3CGTA 2VDLL 5F96L 1ODZA 3G5XA 4WNQB 4AZIA 1QWNA 2IAMA 1EO8L 4HIJB 1NSNH 4Z7WA 3MRDA 5HHME 1DWFM 1P4IL 4EAMA 1I7TB 1T3FB 3S5LB 4LRNL 3IFLL 1RIVL 5T33L 2AXFB 1U8QB 3AGVA 2NY4C 2J8OA 3S7GA 3MC0A 4M3KB 2V2TA 3MV7A 3LH2L 4JFQB 2VQTA 1G7MB 3OJ2C 5DRXB 4MJ5B 4LSSH 5T5FH 4PCSA 1SZNA 1J8HB 2A3EA 3WFBH 1FFRA 3MV9D 3RRQA 3HAEA 1MCRA 4GG8B 4MADA 1JPSH 1G6RL 2XKNB 4PJGB 4KVNH 1L7IH 4FQQB 1UWUA 1AD0A 3PTMA 3KPSB 2Q87A 3ZYIA 4OZIF 5GRVL 3ARBC 3WFEL 2D4DA 2X1QA 2VNCA 4TRPL 4ZS7H 4WO4C 4CCDA 2CKBB 4Y19A 4GG8A 5KVFL 1NAMB 5FGCE 3W0WB 1DFBH 1MW3A 4PGJA 2G75B 3DETD 1TJIH 3ZJ6A 3BPCA 4W6YB 2ARJQ 3BD3A 4I0KA 4LRIA 5ESAA 4YN5A 5SV4A 4GKLA 2AJVH 4HU0A 3PGFL 5DEGB 2VZ3A 5GS0L 3CLEH 1J1OL 2YD6A 4P0DA 2ZX5A 3W25A 3LV3B 1T1WA 4XNQB 4YX2H 3OBAA 2K9UA 3V8CA 4Z7NF 1K2DB 1RHFA 3D69A 4NPYB 4LF3A 5GZNC 2IALB 3SGJC 4WUKL 1CGSH 5I6SA 1DUZB 2ATPA 3EMCA 4ETQB 1M1SA 1LP9E 1CD1B 2MOVA 4X6FA 3AXIA 5E99H 1MRCH 2YLLA 1LGVA 3RJDA 1MUJB 2J8UA 3LPPA 3FFCB 1MIML 3OKNB 4Y4FC 1EVUA 4R26H 3BHBB 5J4MA 3CLWA 2BX5A 2G2RB 4JFWA 2VLRD 1I8MA 1DUZA 1S8DB 1MHPL 3DSFL 3ULSA 4F7PB 4P8VA 3IDXH 4R8WL 3MCKB 2R2BA 4FOMA 1C1EH 3WLBB 1IT0A 5F7MC 3WF4A 2VDKH 1NEZG 1NANH 5DO2D 4YHIB 2OS7A 4CDGC 4PRID 3RVXD 3IVKA 3TA3C 4L4TE 2E6JA 3QAZB 2DLGA 5C0FA 2IPTL 43C9A 1ZA3A 2ATKA 4S11A 3R06B 1VFOA 4LCUA 1A7QL 4NQDA 1JPGB 2AAVA 1AGFB 2WHMA 5IMKB 2PYFA 2GFBA 3MCKA 3UJJL 4ENEC 4XVTL 5T3ZL 2DS4A 1W1TA 1FPTH 4Z18A 4K2UH 1KFAH 1EEUA 1KYOJ 5GS2H 3MKKA 4L3ED 1W1VA 1B3YA 1YEIH 1YEDB 3BGFC 1TPXC 3AMLA 1NLDL 1BIIB 4HS3A 2EH8L 2R56H 4UR9A 2OTWA 2OR9H 3QCTL 3RP1A 3CHCA 2DWEA 3S37X 3UJTH 1A3QA 5CPSA 4JFZL 4HG4J 3EJZC 4F7MB 3ARQA 3P11H 2WP3T 2DDQL 3EOTL 2DI8A 2V2WB 1QRND 2DQHH 2J4WH 1QOKA 2PCPA 3VJ6B 4M43L 4AZBA 4YHOH 5IFHL 1UD5A 2VURA 1IQWH 2ADJA 2F19H 1LP9A 1QVOA 1IEAB 4AD2A 3QDGE 4BQ3A 1KIRB 3ARGB 2DQDL 1NBVL 2JKXA 3U7YL 5LAXA 1S9WA 2CLZB 1WT5A 5LGHH 4EOWL 3QNZA 5BW7C 1E6OL 2Q1EA 4YBLB 3B3IA 3TNNA 5DK0B 2QJDA 2GFTA 1YYLL 3QHFL 1OTTC 4OCXL 1I1AD 1PSKL 1IC5H 4OLEA 4MXWH 3DI3B 4P57B 5A43C 3MV8E 3CZFA 4F3FA 4ZFFA 3BHBA 3NFSH 1MLCB 2PXYA 1ZVSB 4QXTA 3SDCA 1KULA 4UDTA 2Q76B 2VDRL 3UEZA 4CD6A 2GJZA 2ADIA 3FFCD 2W65B 1KTRL 3AHXA 1FLTX 3AU1B 5DJ2B 1GXEA 5DJDB 4M1RA 3N1GC 3OG6B 3UYRL 3ARDC 5BMFL 5HI4D 3CZKA 3RNKA 1FGVH 1GIGL 4TSAH 3O3DB 3L4TA 3W26A 5EOCH 2GCYB 4KU1A 5JOFB 4JVPA 4I0PD 5HHMD 5BO1H 1A7OH 2IALA 1UR4A 2Y7QB 4H1LG 1TENA 5J12C 3INUL 6CGTA 3C5SB 3D0LA 4OUOA 5D7JD 3DX6B 4X4XA 1VFBA 3W0KA 1A1NA 3C6LC 3QBTB 3IJ7A 1RHHA 2VDRH 3UO1L 4H8WL 4HOWA 3CPLB 1DLHB 1GQLA 4LEOB 5I16B 1AFVH 4NC0B 4P2OC 5GHWL 1ZWIA 2VRAA 1EEQA 5E2VH 2Z35A 1IC5L 3ARZA 5EC2A 3QG6A 4J4PD 4OCXH 4F9LA 2HJFB 3QHFH 3N04A 3MUAA 4NUGL 3DBXB 3GZKA 1NC2D 4OZGB 1ZA3B 2ATKB 4KFZC 1ZEAH 1DDHA 1IL1B 5LGHL 3BX7C 1XGUB 4P48A 1YNKH 2DQDH 1EERB 5BS0B 1GL4B 4HF5H 3KLHC 3VXPA 1WZ1H 1IQWL 2Z35B 1V0LA 4XNZB 2XFFA 1MXDA 1RJLA 1XH0A 3B5GA 4PY7B 2OZ4H 3IJYA 5I1AB 3BUBA 4GW5B 2VZ1A 3MR9A 5A8NA 1U8MA 4QRPE 4XI5C 3WQWA 1TTGA 3BPNC 3OQ3B 5DEFB 1G5AA 3PV6B 2XQBH 3TV8A 1YY8B 2PETA 3H3KA 1E6SM 3IF1B 1T1XB 2EPMX 2EAEA 1ULVA 5IOPB 1W0WA 4LLUB 4KTEL 1JK8B 4B5EA 3O3BA 4RGOH 3VXUB 5AG8A 4JPVH 4D9RE 4IIQB 3L7FA 2D20A 4NP4L 1MQKH 3FOMA 2KL6A 5IM7A 2WSPA 4R2GD 4UDUB 4FXLA 5FXCH 2OZ4A 1LP9B 1QVOB 4KMLB 5I8KL 3WLWC 3SUUA 4M1GL 3QHTC 1NBZA 2YC1A 3U46A 3VFMB 1FHLA 4JZJB 3AFBA 1NL0L 1P84K 5GSRA 4J3SA 3QPXH 3TBSA 4GG6A 3MCG1 4U49A 3OKYA 5A6BA 4UFJA 1E4KC 3WQ4A 1FH5H 5ID0A 4Y4KB 4DWSB 3JV6A 2QADB 1C1EL 1X5FA 4P8UA 3GXDA 3A21A 4G42A 4CVZB 2BY0A 4KGLA 5D1QA 1WBZB 4Z77A 5B8CB 5BXFA 2GK0B 3DUUB 3DSFH 3HC4H 1DLHA 4K23L 2ZJSL 2DM3A 1FCCA 1A22B 2ZX6A 1TVPA 4XRCB 3QUXC 5DMIL 1DVFB 2X4PB 2W91A 3BT2L 3K1KC 1YQ2A 4R2GC 2VZOA 3GBDA 1OY3B 3HI1A 2BHZA 4LSVH 1E3ZA 3BUPA 5LA1A 4LPXA 4MJ2A 4U6HA 1JNNL 3KNBB 2ERJB 4XPBH 3ZKXC 4JB9L 3U82B 3UTQA 2D22A 1BLNB 3I3DA 1FBIL 4J12A 5HGAA 5K9OB 3PWVA 2MPAH 4GXPA 2UY5A 3A5VA 4NP4H 4RDQF 8CGTA 4KV5E 4E41B 4U0RB 2N7BA 1PKQA 3SJVD 5B22A 4M1CD 3BPOC 4KTEH 2AJVL 1NP2A 3O81A 2MQ0A 3C9NB 3HUJE 2X1OA 3TN0B 4PJ7F 4BZ2L 4DAGH 3D0LB 1T4KB 4PMVA 1MIEH 3VIMA 4PJ8A 4UQ9A 4LYPA 4UTFA 4UQCA 1MI5B 3KL5A 2XQBL 3M17B 1INDL 2FBOJ 3ULUL 5KVFH 3ARWA 1NCWL 5CHNB 3CPLA 5DD6B 2GHWB 5J1TC 1ISWA 3WH7A 1E43A 1KLGB 3NTCL 1FH8A 1D5BB 4PJ7B 3KYMB 4S3JA 3WNPA 3O2DL 3VWJD 3BZFA 1WZ1L 1FN4B 3MLTB 2YD5A 4FNSA 4I48A 1TVBB 3K8KA 4HEPG 3PWJA 4PJ9D 2VERN 1CBVH 3W53A 3CZEA 1V3HA 5I18L 2VL5B 1WB0A 5DD6A 1U2HA 4PJBE 3RILA 4LSSL 5IG7A 4LGSB 1ZT7A 1DDHB 4JFED 4PR5B 1PX4A 2OR8A 1WAAF 2R4SL 3QRFM 4ZE4A 3O3AB 2OI9B 3QIUD 4Z7VA 1AHWA 2BZDA 2FGZA 3BO8B 1VCAA 4QRQA 1MI5D 2ZX7A 4NF7A 1AKJA 4JFFA 5SX4I 1XV8A 4L9LC 2LVCA 5HYEA 1HOCA 2JK5B 3TN0D 1TZIB 2HAZA 1U3JA 4HUVA 3GSOA 5HI3D 2DTMH 4NQEE 4KJQD 4MS8C 1OL0A 2C3HA 5F7HA 3EYQC 3FOLB 3TTQA 5DD1H 4NO3B 2ADGA 1DQDL 2CXGA 4UUJB 5A6SA 5CEZE 1FYTB 4R7DA 1K9EA 5IK3A 3FB7B 1A7OL 4KK5D 1G7LA 1KT2A 4HMEA 3WIFA 4AIZB 3GJFK 4UFMA 5IV2B 2O93L 3NA9L 3QJHA 2C4FT 3ROLA 4XWGH 1ZHLA 3TT1L 4MAUH 2VR9A 3MLZL 4D94A 3EDEA 4FQJH 1XR9B 4HXAL 3WCYA 4DZBA 5A2IH 3IS1X 5A8QA 4ALAL 4HZ7A 3CD4A 1N6QL 1S5HA 1NAKH 3GSWA 4H25B 1I7RB 1HHJB 4UZGA 2WWDA 3DX2A 5FCUH 2VXUL 2BP3A 2DM2A 5KTEH 4CVXB 3CAFA 3HMCA 4HKXA 4KK9C 3SDCD 1N3NA 3GI9L 1HCFX 1OARH 3FRUB 4MX7B 4S1RL 3QNYA 1K4DB 3SDDC 4R97B 1KENL 3KG5A 4U1MA 2CD0A 5D1ZD 4YJZL 3G5YB 3QQ4A 4NWUH 4OKVA 3ILPB 3GB7A 4PJDA 5CZVH 4Y2DA 4GH7B 3CK0H 3DIFB 3DMMD 4OIBA 4JY5L 1QFWM 5FA4B 3ULVL 4FQHB 4U1GC 3BSHA 1PD6A 4WWKA 3KNBA 3MV7B 4WHYH 1S9YB 3GXFA 3KJ4B 1J0ZA 3BFOA 6A3HA 4M43H 3GMNB 2ZSVA 2JE8A 3AM8C 1MVFA 2DQHL 3VWJC 3MROB 4JZOB 4EXKA 1A0QL 3DHJA 4HX1A 5HDQL 3LN5A 4ZUUB 4XNYL 1HXMA 2OL3H 3IYLW 2MQ3A 3CSGA 3PZGA 3G04B 4J3UA 1M6OA 6TAAA 1BGGA 5EFIB 2XZQL 1KJ2L 2GT9B 3HG2A 3MGAA 3MV8B 4HZAA 4F9PC 2VKXA 3KYNB 3T4AB 5KZCD 4UILL 1T04A 2E3ZA 2MCPL 5D2NA 4IRJA 5HDLA 4O58H 1EHXA 4Y16A 3WO4B 3POCA 3MRHA 3RZCD 3ZZ1A 3N9KA 1HWHB 5J7CC 3RWCA 4EIGB 4GW1B 3PZMA 2VCBA 1WZLA 5TDOB 4G7VH 3TA3D 2F74B 3G5VB 3BD4A 4JFXA 5DO2C 3UCQA 3MNWB 4F7CA 3B9KD 3LQAC 4GMTH 4YIQA 3ARBA 4XMKH 2R0KH 4LF3B 5IBLC 1ZVSA 5F9WC 3IF1A 1RZGA 3H9YA 3V6OE 1JPFA 1I3GH 2F7PA 1RUQL 2B1AH 4TVPD 5GSVB 1E15A 5E2JA 4ZUWB 1AR1D 3HE7A 3JWOH 3QIBC 1JNDA 3HJEA 2Z0BA 3EYFB 3PDDA 3VIKA 3QQ9D 4NKOA 3GDBA 2QBWA 5FO7A 1RJYA 5A8PA 3FOMB 4CVXA 1G6RA 3IDMA 3QDMD 4LCCA 1EMTH 4PJ9A 2G5BB 3TYFB 3MLSL 4HIEA 4IMLB 4PLOB 1G7IB 1JFHA 4LCWD 5D71L 3IFOA 1K3IA 3KPPA 5MEND 3VXNB 5F6HI 4HHAB 2FX7L 2GVYA 1MAMH 5D2LF 2A3BA 5H94A 4UQEA 1QSED 4UV4H 1JD9A 2Y24A 3WIFB 3LKOB 2KZ1B 4UFKA 5BV7C 3IFPB 3OMZA 4OGAD 5EORL 1ZTXH 5HHQB 2PYFB 4ZMAT 1MFDL 3LN4B 4P4RB 3PL6B 4UTAH 1PZUB 1BVLA 3IDGB 5AG9A 1KXTB 2GJ6A 4DGYH 3CHFA 3ULVD 3LRMA 4N8VB 4UBDD 3TO4C 1O0VA 1RZFH 5IW6B 3O2WH 2D31A 3AIEA 2X2HA 3RI5F 2WMFA 3SURA 4GAFB 4TVPH 3V6FB 5DO8A 1OM3H 3T0XA 1BQHA 2P5WA 4JHWL 1I7UB 4OIIH 3TFKD 4KRLB 1A1OB 2Y36H 1QNRA 3KYNA 2OTWB 3FFCE 1E4XL 4AD5A 3H0TB 1GZQA 3RNQB 2XZZA 3SCQA 1KTCA 2OYMA 3JTSA 4TX6A 4JVWA 1MJUL 2LTQC 4LEXH 5EZIL 2VZVA 4FABL 4G8EA 1LEKB 3B9VA 5AEAA 3ULVF 4PLJD 1KPUA 3SCMA 4GAYB 4PREA 5EU4B 1KIPA 3D0VA 3AIBA 2V6HA 3T0AA 4L3EA 4CAGA 2XSAA 1S9YA 1QBMH 3PGCA 1P4IH 2AJXH 4PEEA 5A94A 3HAEH 4O51A 2JCCF 2FX8H 4LSUH 4HX1B 3SIMA 5C3LD 5GISL 3DYPA 2AI0H 4PJ8D 1P4BL 4F3FB 3FMGL 5D7JB 3T0VA 1GAFL 4H8HA 5HHVH 1U91B 5LWYH 3V4VL 2FJHB 1T1WB 2Y8KA 1QLFB 1XGTB 4LIQH 4XX6A 4XPFL 4OTXL 2R9HC 1MRDH 4M93B 5HOSA 1EGJA 3BO8A 3DDFA 1AKJD 4CCCA 3MLVH 4DZ8B 1HDMB 1I3RA 4M80A 2FATH 4OD2A 1HP5A 4QHMA 3FO9B 3LS5H 4GLRI 4NM8L 5GS1C 4NQXB 1TITA 2F5AH 2OW6A 4BJLA 2FJHA 1UM4L 4JFDB 1FZJA 2KH2B 3T3PF 4MD0A 5D7LE 3QFDA 4ZQKA 1XGYL 5KBNC 1Y18A 2VB5A 4OLWL 2ADGB 3WKML 1MJJA 3MUJA 4GG6E 5CEYB 1GJUA 2FD6H 1EHLH 2JJTA 2APVA 1ZLUK 3AFLA 1CGUA 4R7DB 2D31B 1QQDB 3LS4H 3MLRL 2EDEA 3X3FL 3RTQB 1H5BB 3V8OA 5JXED 3GSNH 2E8ZA 1RUKH 3TPUA 3MGOB 1AE6L 5K59F 3RY6C 2OLHA 3QXAB 3IXTB 2QR0A 3IU4H 2K3TA 1DVFA 4PJIF 2AKRB 1OM0A 3I9GL 1N59B 2D7TL 5E70A 1OGAB 5I74B 1KIUA 5E00B 3MV8D 5SWZE 2HLFC 2YN5A 1BLNA 2Z9TA 2VLJE 3SQOH 2HG5B 1ZHNA 3HLAB 1WWAX 4WW2C 4F57L 5TGBB 2WVVB 1JNLH 3PHOA 3OLGA 1E1FA 3MRIB 2XWJA 3LRSB 5TDNB 3WHXB 1P6FA 2WM0A 2YFNA 1LNUB 1BQCA 1N64H 1UB5A 2V17L 1FFOA 1D5BA 4EQ2A 1R3HB 1CDBA 5ADOH 4MQXD 3HUJA 2FWOA 4X0KB 4DEPC 1MCOL 5SX4H 4DN4H 2HG5A 4YR6A 5IFJA 3CIVA 1U8KB 3O11A 3BVWA 3O41B 4AZ8A 1DL7H 5TE7L 4U6TA 1V0NA 1F8TL 1DANT 2CRIA 3BP7B 3CMGA 1G9EA 3WS6A 1EFXB 4LLUA 2PW1A 4MDJA 3VDHA 2GW5A 3SCTA 4GI8A 1OTSC 3WF0A 5C0BB 3VFNA 1Z6JT 1AQ0A 4ZYKB 2IC2A 1HVXA 3QDMB 5IBTH 2Q86B 3L3GB 4KRUA 4Y5XC 4QT5B 1WFTA 3HE7D 4KC3B 3AICA 2C7FA 4XBEL 5A2FA 2CR6A 5IG7B 2KZWA 2O9RA 3RVXC 4JRXE 3DV4B 2Q20A 3MV9E 4MS8D 1NMAH 2EKJA 1A6AA 5T1KB 4PG2A 4WUUB 4YO0A 3ZM8A 4Z78A 5IJKA 4P9HL 4M1CC 3QT2A 4YBHA 1VPOL 2CCRA 1WICA 2ZOLB 5E95B 1NCUA 1XR8A 3MA9L 4RE2A 1EDTA 1KEML 1QR1B 2VZTA 3SDAB 4Z7OF 3SCMD 5JIHA 4UZUA 1CFBA 1X6NA 3L7EB 5ERWB 3CVIH 4RA0C 5EU7E 3EOAB 4HIIB 5GJTL 1U92A 4DM2A 4GLRH 4M8VA 3KXFB 5CJOH 5IW1A 3E3QC 5C0NC 2BVOA 4JFOB 4F58L 1T21B 2IUZA 1FL5A 5GZND 5JNYB 1KGWA 2DPEA 5JOEA 4EI6B 4NQCB 1OF2A 3TYGL 35C8L 1WPCA 1DN0A 5DUBB 2WCAA 1UZ8B 3D3VB 2DQJL 4Q0XL 1FNFA 2VAAB 3G08A 2DBJA 2Z93B 1J5OH 3UTZB 1NMAL 3N17A 2B8OT 4JANA 1QSFD 3DURA 1F11A 4J2XA 1CDHA 3GSWB 1A3LH 4N9GA 3WY1A 1OSZB 3KPMB 3GSNB 5IB5B 2ED9A 5INDA 4XHJC 3DX1A 3W9DA 5DUBA 3O3EA 3QIWA 1X5KA 4Z95L 3A0OA 5IBTL 1MEXL 3RIFF 2I9LB 5CD5D 5FV1L 1IAKB 1QEWB 4B53A 3SE3C 5D7IE 3BP7A 2R39A 4F15C 5CEZD 3GM0A 1C8XA 3SUWA 3CDFA 1V5JA 5BS0A 5AYBA 1UVQA 3V7MA 2XZAH 4WY7L