2FH6A

Crystal structure analysis of klebsiella pneumoniae pullulanase complexed with glucose
Total Genus 311
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
311
sequence length
1052
structure length
920
Chain Sequence
b'DVVVRLPAFGVALADAHWVDKTTLLWPGGENKPIVRLYYSHSSKVAADSNGEFSDKYVKLTPTTVNQQVSMRFPHLASYPAFKLPDDVNVDELLQGETVAIAAESDGILSSATQVQTAGVLDDTYAAAAEALSYGAQLTDSGVTFRVWAPTAQQVELVIYSADKKVIASHPMTRDSASGAWSWQGGSDLKGAFYRYAMTVYHPQSRKVEQYEVTDPYAHSLSTNSEYSQVVDLNDSALKPEGWDGLTMPHAQKTKADLAKMTIHESHIRDLSAWDQTVPAELRGKYLALTAQESNMVQHLKQLSASGVTHIELLPVFDLATVNEFSDKVADIQQPFSRLCEVNSAVKSSEFAGYCDSGSTVEEVLTQLKQNDSKDNPQVQALNTLVAQTDSYNWGYDPFHYTVPEGSYATDPEGTARIKEFRTMIQAIKQDLGMNVIMDVVYNHTNAAGPTDRTSVLDKIVPWYYQRLNETTGSVESATCCSDSAPEHRMFAKLIADSLAVWTTDYKIDGFRFDLMLYHPKAQILSAWERIKALNPDIYFFGEGWDSNQSDRFEIASQINLKGTGIGTFSDRLRDAVRGGGPFDSGDALRQNQGVGSGAGVLPNELTTLSDDQARHLADLTRLGMAGNLADFVLIDKDGAVKRGSEIDYNGAPGGYAADPTEVVNYVSKHDNQTLWDMISYKAAQEADLDTRVRMQAVSLATVMLGQGIAFDQQGSELLRSKSFTRDSYDSGDWFNRVDYSLQDNNYNVGMPRSSDDGSNYDIIARVKDAVATPGETELKQMTAFYQELTALRKSSPLFTLGDGATVMKRVDFRNTGADQQTGLLVMTIDDGMQAGASLDSRVDGIVVAINAAPESRTLQDFAGTSLQLSAIQQAAGDRSLASGVQVAADGSVTLPAWSVAVLELPQGESQGAGLPVSSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords pullulanase
molecule tags Hydrolase
publication title Crystal structure of pullulanase: evidence for parallel binding of oligosaccharides in the active site
pubmed doi rcsb
total genus 311
structure length 920
sequence length 1052
ec nomenclature ec 3.2.1.41: Pullulanase.
pdb deposition date 2005-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fh6A02
2.60.40.1130 Mainly Beta Sandwich Immunoglobulin-like Rab geranylgeranyltransferase alpha-subunit, insert domain 2fh6A01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2fh6A04
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2fh6A03
1RZGB 5EBAA 5F8QC 4KY1L 3PP4H 4PP1D 2ZP0T 4PJHE 3WKML 1YECL 1QSFB 5JUEH 5DWUH 2WBJB 2Y36L 5FKAA 1KYOK 5FD0A 4DM1A 2VQTA 4G5ZH 2Y24A 3SCVA 4UDUB 3GMNB 4PG9B 3V52H 1C92A 5JR1H 1QBAA 1FYTA 4PJGE 1LO0L 5IBLD 3HE7B 1VGEH 4X4XA 2EKSA 3W0WD 1YN6B 5BV7C 3I84A 5K9JL 2LFGA 1UC6A 3J7HA 1U95B 1BD2A 5IVZA 4GKNA 3W2DH 5ADOH 2OXHA 1IGCH 5LQBL 3U46A 5A8OA 3FFCD 1JMZA 3C08H 5FOBA 3BJLA 2WBJD 1I9RH 2IQAA 2PYEA 1UZ6F 3MCLL 5DEGB 3T4YA 3TO2A 4TOYH 4GMTH 3UZQA 3ZE1E 2UWEA 5D7KD 4RQQB 3IFNH 2DT2A 3LRKA 2W63A 4ETQB 5INCB 1L7IH 1MI5D 3QFJA 4ELKA 1DQDL 1KCRL 2AJ3A 1AP2B 1XGQA 3RGVC 1LD9A 1L4IA 2XICA 3D39E 1CICB 3WSUA 3QSKB 5DMYA 3UG5A 4X5WA 5LVEA 4XMPH 5I5RA 1ZE3C 5D2NA 5A43C 5IMLA 1JIBA 4FZEH 3QZWA 4FFZH 1TVNA 1WCBA 2VDQH 4RNRB 4QNPE 1TQSA 5EB9A 4Q7NA 4MB4A 1OCWL 5LAXA 3QR3A 2JEPA 2UVEA 3IDMA 5F3BA 4UOJA 2IAMB 5FK9A 2OSXA 3PDDA 5CBAB 4HIJA 3OKNB 4I3RH 3HR5A 4P9HH 4PJGB 3GNOA 3RL1B 2IQ9L 2K7PA 4OCXL 1P5VA 2CO7B 1W0VA 4LKCB 1SFSA 4OCSH 1WKYA 4KAQH 3ULUD 3LKSB 4M6AA 3BN9C 4PBWD 1V7ML 2HFGL 1CFTB 4ODWA 4F7CA 3WNKA 1JV5B 1XT5A 2Q8BL 4JFQB 3F7VB 5L8KB 5E2VH 4D8PB 5AC4A 2DQIH 4NOBA 4G6JL 3ZKND 1XYFA 2Y06L 2OXGA 3HFMH 4WEMB 1KJ2H 2CLZB 3O6FB 1VFAA 4XNUL 4ZO9A 3WFCL 3OSKA 2AMGA 1ADQL 3T77A 5IB1B 5AD0A 2X4OA 1K2DB 2DD8H 2QTEA 4U1JB 2XJ7A 5HBBA 5T3XD 3W25A 1X44A 5FOBB 4HPOH 5T1MB 4D1IA 1GSMA 1BFVL 3F5WB 5M3WA 2IQAB 1H8OA 5JZ7C 2FRGP 1LF1A 2JK5B 3G5XB 1F8TL 4JFDE 3WD5H 3WY2A 3FZUD 1HH6B 3WEXB 1U8HA 2HVMA 1U8KB 4YFLI 4JRYD 4AIEA 5GGQL 4DVBB 5KN5B 1JF6A 4XCYB 5IB3B 4NRRA 3CFIC 3RI5F 5E6YA 5EC1A 1D3CA 1KV3A 2V2XA 4NZTL 1WCBB 5KZCD 2OW7A 1X5ZA 3MRPB 4PRBA 1UR2A 5DK0B 5MERA 1AO7D 5HHVH 4NQSA 3K4ZA 2VRJA 2J7EA 4P2OD 2ESVE 4P4KB 1ESWA 1SYSB 3L3JA 3GI9H 5FO9A 5MEPA 2XN9B 2ZJSL 4X9HA 4YBQD 3JUYA 5D8JL 2AJZA 1RMFL 2GT9A 5C08E 4F58H 4NKOB 5E6ZA 3MV8A 2A83A 5J89A 3RFZC 2HJKB 1YMMB 5SWSA 1TJGH 3RNKA 2YZ1A 3EMCA 3P4NA 3QI9D 4GW5A 4HKXA 5JXEC 3A3HA 2VKXA 1FYHB 1UVQB 2B7DT 5EFIB 3GMPA 5JIPA 1JZ4A 4FLQA 3RX7A 1ZTXH 3IU4H 4GAJL 1S9VB 3UTOA 2WB5A 5LGHL 2Z31A 4XCCH 4Z2IA 4YHPA 3IAQA 2OM5A 4L4TE 1CL7I 3BDXA 3R0NA 4PJ5A 4K68A 2FYYA 3P9LA 1BQHB 3L3OB 2VDPL 3PWLA 4OUOA 2CDEA 2BY0A 3S37L 3N1FC 5GS0H 5C08B 1OCWH 4MS8D 4Y5VB 3OKDA 1LO4H 5BS0B 2DL2A 3CFBA 1ZAGA 4M6NL 2DJUA 3QULB 4Z9KB 1QW8A 5F7WC 2ZUQC 5D5MF 1Y0LA 2YKKA 1Q9KA 2CIKB 3TVMB 1R5VB 3GNMH 3MV7A 5IF0A 4ZDHB 5E94A 1K8DA 4JB9L 4OAWA 1E6SM 3RZCD 2X89D 2BNRD 4I0PC 3R8BB 5L2KA 5I8KH 1F3DJ 5EZIH 3CZKA 4Y4HD 4BQ3A 3VXRD 4JAWA 1AD0A 5EG6C 3IDXL 4LQ1A 3RQ3A 1O6IA 1MREL 1U6AH 3O3AB 3U0WL 4MNLA 4XPAH 4ALAL 4YHLL 1T5WB 4XC3L 2DTML 3TJHC 4OGZA 4WIQA 1IKNA 3KNBB 3HG2A 3CZFA 1BOYA 3BP4B 4HUMB 1NL0L 3WDPP 5BRZE 5I78A 3LQZA 2ATPB 4PJFB 4JRXE 1QSFA 3HN3A 4D9QE 2JFEX 2O5YL 2HP4A 1JP5A 4HFWB 4EN3C 5F9DC 1FVCB 2ICWB 1DBKL 2FIRT 1OAXL 2B0SL 2IPKA 1OD7A 1MI5A 2CKBL 3CU1A 3MUAA 5C0CA 3OKNA 3ZHDA 4Y4FC 3MO1A 5HDRA 2XVNA 1HWHB 4OGXL 4HIXH 3C6LC 1NUFA 2IADA 3ZM8A 2EO1A 3RJQB 4KKNA 3DX8A 2F18A 3ZYIA 4QHMB 3NH7H 4DN3L 1FH8A 3TJEH 1IQWL 4W86A 4E9LA 2OYKA 4L5FH 5BO1H 3A4XA 3DX7B 1QBMH 2ZKHL 4JFEB 5I15H 3IJSB 2KQMA 4YNYA 3F7YB 3WMSA 2VIRA 4EN3D 1R0AH 4X6FA 3K0WA 5IMMB 5EN2B 1R3IH 4RWYL 1FBIH 1NKRA 2ZUXA 1DQML 3VFRB 1ZSDA 1AY1H 1XF1A 3CFKA 3O6KH 3MCKA 1IC7L 3BEWB 4ONGH 5IJVA 1DBJL 4U1JA 2PYEE 3VFOB 5F88A 2VSCA 2D0FA 5GRZA 3UTPD 5HGBB 3GXPA 4M61B 1WEJL 3N11A 4URIA 3SDXE 1BVLA 1MJ7L 4L8BA 2J77A 2XWTA 4R97C 4DCQA 2C3VA 1IILE 3B6SB 4AQOA 1MFDL 1BEYL 5DD3L 5C0FA 4TSBH 2F53E 2YXMA 3GH7A 5IFHL 3H55A 2G4FA 4XP6H 3B8YA 4OLZL 2EQDA 2QJDA 3L3KA 1N6QL 2QQKH 4BFBD 5I3DA 3WF0A 5HGAA 4D94A 4G6ML 3KJ4B 2WVSA 3RJXA 3WIIH 5ERWB 3D5OF 2AXFA 4LAQL 12E8H 5EORL 4FQ2H 1V6UA 5FGCB 1OP3H 5CEXA 5CJOH 2DQCL 4TQEH 1TZGH 2BSSA 2PF6A 5HYEA 1WNOA 4R4FH 1KULA 2ADIB 5JW5A 3WUBA 43CAB 4KRPD 4W8BA 3O6FA 3BYYA 4FFWD 2O5ZH 4N9GA 4M62H 5E0CA 1FV1B 1KENL 2VDMH 4P46B 4LGSB 4TX6A 1V5JA 5EUKA 1KB5B 1V0LA 4EAMA 2P45B 1UYWL 2J8HA 1VGKA 1VADA 5C6TH 3LEYL 4I0PB 1MCJA 4IMLB 4Y4HB 2IH1B 2MQ0A 1Q6GA 1URLA 2UYLB 5D1ZC 1OOAA 3V7AG 1XZ0B 4K8RL 1A6AA 3BVTA 4LCUA 5F9WC 4V1DB 3QUML 5A6LA 2D1ZA 2ID5A 5F71A 4JG1H 3NCFB 2IG2H 5IGXH 4MD0A 4PJFF 5K33A 1CLYL 1JGUH 2JTDA 4H26A 4GRLB 1K85A 3MBED 2IAMD 2BXZA 5DD5H 4GBXA 3JWDL 2Y5TA 3D3VE 4BYHA 2CRZA 3V7AE 1XCQA 3E6FB 3OKOA 1HHIA 4M9OA 3QFJB 4HC1H 2HMIC 1IKFL 1YPZB 5EBWA 5KANG 3X14B 3ZDXF 3FCTB 1FPTH 3NA9H 1MCPL 1E9LA 4PGDA 5DQJA 3MS8A 4JZNA 2AKRA 4EI5D 4I9WD 3MRNA 2I9TB 4ZFFA 3BD5A 5FHAL 3VU2A 1U93A 1KT2B 2CLVB 1CDYA 5I1IL 5D1QC 2J88H 2QKIB 5JW3H 4QT5B 3KYAA 4QP0A 3AVEA 2I9LB 2HFFA 3KPMA 5IESH 1RD6A 3AROA 1Z0MA 2EC9T 3AMDA 5L7XL 3WL0A 4MAUH 1MCIA 1TQCB 4X9IA 2X9YA 4DEPC 3W37A 3GI8L 3UEZA 3NACL 4WO4D 4AZHA 4W8LA 4ATDA 4YHPB 4PJCB 5K9KB 4YHGA 5E8DL 5E7BA 1W9XA 3QOMA 4JFOA 5DQ9B 4MHHG 3H3PH 4OZGB 1FNEB 5F3HA 1T4KA 1CK0H 3HU7A 5T3ZL 2CGRL 5FYKE 3C09C 1N0XL 2Y4SA 2IPKB 1MNUH 4AENB 2B20A 5FIEA 5C0GB 3Q1SH 4OBSA 5MEOB 4KZDH 5GHWH 2M26A 1A02N 1CWVA 4JRYB 2BOBA 2VLJE 4YDJA 5HPCA 4AY0A 2X7LB 1OP5H 1IL1B 1LWJA 2GY7B 4D6GA 3L5HA 4XNMB 4JFXA 1WEJH 1NUDA 4YNYB 2DICA 5TJWK 1FNGA 3O8XA 3QXAA 1SJEB 1T5XB 2J74A 2XNAB 3QIBA 1D6EA 1WVZA 4XCNB 3PJSA 1MRCL 3TV3H 3D3VB 1RULH 3GUTA 5DJYB 1T22B 2Q86B 1WWCA 4YHYC 4ZFFB 1INEH 2YD1A 2YFNA 3VD5A 2Q6WB 3LKQA 2WK2A 2J78A 1WGOA 1K6QL 1M03A 1F90H 5K59E 2JE8A 3ELAT 1LHZA 3GSVA 1PZUB 3ORJA 2P47B 1QA9A 3APGA 3P2TA 1GOIA 1N6VA 4JY4B 3QG7L 2YL8A 4QRUA 1FAIL 1VFMA 5DUML 2R1WB 2R69L 3AGVA 4JFYA 4BM7A 3JUGA 2E0PA 3MACH 4LP4A 5DI8B 3HC3L 5DQ9A 2E3ZA 3EJZD 2O61A 4X80H 3QDMD 3PG2A 2YRZA 3BPNB 3BH9A 3CIQA 2Z93B 1JZ5A 4U1MA 1OHQA 3AHYA 4KK5C 8CGTA 2BMKA 1MAKA 5SWZB 1RUMH 4WSKA 3EOAB 5GZND 5ABDE 3QDGE 2GFTA 4PMQA 3RVTC 3ZJ8A 5GJTH 1HYRC 4OKVB 4HH9B 5FUOH 2OQJB 1CLXA 2R0WL 3U0WH 3RDTA 4F79A 1RUQH 4XNMA 5B22A 1XH0A 3O9NA 1FFRA 5D1QA 3OKMB 1HINH 2ADGB 1DBBH 3DJ9A 1D5IL 1EAJA 3VTRA 4GI9A 3TO4B 2JF7A 5GPRA 1BAGA 3T0EE 1A7NH 3BPNC 1WV7T 3ZHKA 2HFTA 3PWPB 1LE5B 5BZWB 2A1WH 3RNQA 3U9UB 4YX2H 1HN1A 4LNRA 4NGHH 1Q6CA 5M7QA 1SZNA 1WDRA 2JIWA 4UQCA 4R5EA 3D2UB 5E99L 1DLFL 1RUAL 2E27L 2FZ3B 3HS0A 5FF6B 2ZCLH 4K2UH 2Z8VC 3DARA 4WTXA 1ZXQA 2W1NA 3RCNA 3MGOA 2FJHA 1HOCA 5FM5O 1UG6A 1LG2A 5B38B 3HG1A 1WICA 2F53A 2OR7A 1O0VA 4NQVB 3SGJC 1MXDA 5HOSA 2FO4A 2GKIA 3VH8G 3BCFA 3O9WB 3ARDA 5ISZA 5TQ2L 3NPSC 1NOWA 2OTUA 4HPYH 4LSQH 4R0LC 1EJ6A 1BVKB 4JKLA 4OD2A 3ZSSA 1ISYA 4Y7EA 5IHUH 3IT8D 1R7OA 1U8PA 1FNSH 1XF4B 5BJTB 4Z8FL 2R8SL 1E4MM 2J6EA 3RPIB 1CD1B 3QAZC 3QO1B 1JMXA 4G8IA 4ACZB 3U9PH 4G3YL 3CPUA 3O6FC 1E4WH 5D9OA 4U1HA 3T0DA 4K55A 2N7AA 2D9CA 3QDGB 5EOQL 3SDCA 2X70A 3Q5OA 3U4BL 4APQB 5I76A 4QHNA 3F5JA 2MKLC 4R8WL 4DKEL 1E72M 3ZDYF 3M6DA 3WYRA 5DVLA 1XC6A 3ZKMD 1F97A 4PRAA 5F89B 1A6WL 3EYUL 1LL7A 3MUIA 2AEPL 5F7MC 1XD0A 1YQ2A 1TMCB 4GIAA 3A6OA 3OR6B 1V02A 1RZ8A 3WUFA 2VH5L 4XXCA 1NAMB 2Y6SC 5EOQH 1D6VL 4EUPB 3SCPA 5CKGA 4OFPA 2R0KH 5EDXA 1E6QM 2XM2A 1MLCB 1OP5K 2BOCB 5FM4A 4LLUA 3GBNL 1FGVL 4EI5C 3I75B 4M6OH 3MRPA 4PRBB 4M29A 1XF3B 5EU4B 4UUJA 3TH3T 1I9IH 3S97C 4F9LA 2FR4A 5GRJH 4OFYD 1GPOH 5KZ6A 4PS4H 4HUVB 3IANA 2X4SA 1A3RH 3QQ3B 4WFED 4QFUA 3QEGH 5FKYA 4NM4H 4FXKB 2XZZA 4OFYA 1W2PA 5KS9B 3IRZA 3WY3A 1T7YA 4AZ7A 4D72A 2H2SC 2VXTH 1DANT 3EJQA 1RP9A 2Y8KA 4UV7L 4W4OA 3OZPA 4LRIC 4UFIA 1G0CA 2J1KA 2Y23A 5A6BD 3FW6A 5L2KE 3W39B 4YGVB 3GMLA 1EXPA 4LCWE 3NIFE 4KROB 5C2BH 5DUMH 1HKJA 3MV7E 4HKBA 5EO1B 4I3RL 2J47A 4WIWA 2A1WL 1MCWM 2W91A 4KJQD 4XGZB 3W82A 1PG7W 4JJ5B 1JHKL 3PIQA 3TC9A 5FYKU 3D69A 3G6JA 3KYMA 1JGLL 1LE9A 3NAAH 5DJ0B 4LCWA 3C8DA 2BHYA 3QDJE 5FYJU 4PMUA 1LEIB 1HINL 4AG4L 3AHTA 2X09A 5C6PB 4WV1B 4RCAA 1P7KA 3WY4A 3P77A 5E09A 1CR9H 2NNAA 5BROA 3QBTB 1CFVL 4ZUVA 2QF8A 1DQDH 1KCRH 3C5ZD 1ZBCA 3WQVA 4AZCA 1WZKA 2M1KA 3MROB 3QIBB 5T33H 5D71L 5E03A 4NM8H 2OQJA 3FHAA 4MAYD 1B2WL 3FAWA 3HMWH 4PJ8D 1ITXA 4JCMA 3PV6A 4GAGH 2GAZA 1J5OH 4RGNC 1CEOA 4O9HL 1ZL1A 4JL2A 2GCYB 2QBWA 3FTGB 3O3AA 1BWWA 4MD0B 1U58A 3QUXD 1EHAA 4A6YA 3N1AA 2HTLC 1DWIM 1C7TA 2R39A 5JBFA 2V7NB 4OZHF 1EH9A 1WDSA 5KVDH 3IF1B 4XB7A 1X5HA 1T20B 4NO0D 3EHBD 5I71C 2Y7QA 1E5NA 4CVZA 4QXGH 1Y7VA 3D0VB 1JN6B 3O4OB 1GGYA 3QQNA 4OF7A 3RZCB 4ZXBA 2XM1A 1HXMB 5EU6D 4JFHE 3MSDA 3TPUA 5A2CA 4PMRA 1IGML 3H6JA 3W39A 4LU5H 4PJAA 4ZAKC 4FXGB 1T03H 4UTFA 3NSXA 3JSSA 4WI8A 3IXTA 2OSLA 5T5FL 4ELMB 4Z7NE 2Q7YA 1AJ7L 3AREC 1PPIA 4D8PA 5ID0A 4CVXB 5F1NB 3E8UH 3ILQD 4BKLA 4X83A 2PW2A 2VLRB 3T0EB 2UY2A 4U1NA 1C1EL 1IARB 1XIWD 4I0PD 1FP5A 1LQ0A 1GIGL 5GGSA 3KLAB 3DX8B 5AC5A 3CDGA 4P5TC 4YFDB 5JTWA 1H0DA 4Y8AA 3VGGA 3MUZ1 3L5XL 1T2XA 3BJ91 2MOVA 4LDEB 5I74B 4JZJB 4G8EB 4P9ML 3RKPA 4B7LA 2HG5B 3TJHD 2WMHA 2F53D 4PJ7F 4JN1H 1BVNP 5I76B 4IRSB 1G5AA 1F4YL 3V0AC 4P2OA 5HHNB 4LLYA 1S78C 2WW8A 2Z92B 3GO1L 2HFEB 2NYYC 4KDTA 3L3HA 4UZGA 2FLBT 2A38A 4HIEB 1YNTB 3O2WH 4D6IA 2EDQA 2C3VB 2MCG1 2NTFA 3OGSA 2W0PA 1QKZH 3NDYA 1KPVB 3EGSB 3UO1L 2VUOA 2CRIA 3DBXB 4K8RH 5E9AA 1CGSH 1DVFD 4N0UA 1P1ZB 4BFIA 3KLHC 2WWKT 4PGEA 1QVBA 4QLKA 4XCNA 5GZOC 2QHLA 2YKLL 1EMTH 4Q9BA 1CPUA 1N64L 5DTFB 1N26A 2JJSC 1NP2A 1F4WH 5D2NE 3UC0L 2EE2A 4E2OA 2GUOB 3RO8A 1V6WA 4PJBE 3DO7B 3MRIB 5DD6A 1VESA 3ROLB 2JB6A 3GJFA 5TE6H 3PZQA 4DW2L 3RPIA 3IETA 4V28A 5DFVC 4MNJA 1I85C 3OPZH 5KOVC 1QI3A 2JELL 1FZOB 1QLFB 4L8CB 1U3ZA 4NDMB 3UJIH 2CR3A 2VLME 4R2GD 4ML4A 4D6FA 1MW0A 3MYZA 3QZWG 1GHFL 3WKZA 1S7RA 2MQCA 4FFZL 2DQDH 3LPWA 3BD3A 4M93C 1W0YT 3ME0A 3LAFA 2DQUL 2R4SL 2BNRA 3UP1A 1K3IA 1JE6A 3VFTA 2OCFD 5TDOB 4YWGH 3MUGB 2CH8A 5IFHH 2PWHA 4NN7C 4MD5B 1L9MA 1KJVB 3J8F7 1RZ8B 2PO6C 3O4LE 4H5SA 4OZ4B 4XVJH 3RTQA 5C7XH 2LVEA 2IXVA 4YWGL 5CGYC 3IU3B 4ZAKA 4F2MB 4JFFD 1LO5B 1VHPA 4TUKL 3N9KA 2IWGA 3WBDA 2X1OA 5F1SA 1S9XA 5BVPL 4JFFE 1IQDA 3MRKB 3F5WA 2D3NA 1A7QL 1JPSH 5E2TL 2E8ZA 3IJYA 4OZGE 4O2FA 4XI5C 4JVUA 4CCDA 4GT7A 1PDKA 4PTTB 1VB9A 4N0YL 5CSBA 1NLBH 3UJTH 2X4PA 5EU6A 3JVGC 4UMGA 1QEWB 1F3RB 1YC7A 3OKOB 3LKPB 1T21B 2V5DA 5I1EL 2VAAA 4FFWC 5IQ9A 3KPRD 4G42A 3TT3H 4M24A 1UWTA 3RGHA 4JFZL 4H88L 3FQXB 2YRLA 2ZG3A 1HH9A 1DN0A 1T1WA 3L3GB 3MLUH 3QB7C 2VR9A 4CD6A 3KYNB 4W85A 2WMJA 4QRTA 2A6KA 5MP6L 5E8EB 4L9LB 5J9PB 1G7QB 2EIZB 3QJFA 3CXHJ 3F7QA 2YD2A 5ABFB 1X5XA 4E8CA 2D7TL 3HPJB 3M8OL 1EEUA 5GGRA 2UV3A 3W11C 2LTQB 5C0BB 3PV7A 4PJ8A 1JN6A 4NC0B 4ZXBB 4GKSB 1I1AC 1W72A 2AJYL 4PRPE 4B50A 5FCSH 2OP4H 4OLEA 2Y07L 2EDRA 5DF0A 3RIAF 5AUMB 2AP2A 3JWOH 3U36B 3MA7A 3GJFK 1CICC 2NNAB 4JN1L 2D4DA 5DMIL 3KWXA 1PX3A 5EMYA 2HVKB 4NUGH 5BV7L 4YHLH 1AQ0A 5DHVA 2Q76A 3DUHA 3KR3L 1LO5A 3QCUL 4PJ5D 4XHJC 4HJJL 2YD3A 3GHEL 4FQCL 1DZBA 2R56H 1F3DH 4GMSL 4JRWA 3SDAB 5I15L 5HDLA 1C16B 5F93C 4L4VB 5GRYA 1KLGA 2DM2A 3GNML 4IMKC 1I1YB 3LD8B 1BX2A 3O8XC 1CICD 2YD9A 4NQDA 4A6YH 3WH5A 3MREA 1JWSA 3BVUA 4M80A 2EDNA 3WE6B 1JUFA 2P46B 2NLJA 1CICA 5K9QG 4ZDHA 2NR6D 4NNYA 1N3NB 2DQFA 2PTTB 3G5VA 1BFTA 4GXUN 4Z76B 4X4MA 4TVPE 2JEQA 4B16A 1FSKC 1IGJB 4FQIL 1GHRA 2F7PA 4LSPH 3O2WL 3T0WA 5E5MB 2YL9A 3LPPA 2C5DC 4GG6B 4OCMC 3GHEH 3KG5A 5ESVA 1KCKA 43CAA 1GAFL 4F7TA 4LIQE 2XQYG 3X11A 4QDMA 2CRMA 1H3GA 3MX0A 4ODUB 1BLNB 1U6AL 1U93B 2Z93A 1Q1JH 3FQWB 4PN2A 1J0ZA 3F5LA 4PR5A 1RJZA 5I75B 2I9LA 3KPMB 1UD8A 1XCTA 2BVPA 2H26B 5C7XL 4UQDA 2YDRA 1YHTA 1ZV5A 4JR9L 5GXBB 1DQJA 2X1PA 1R3LA 5IVXA 2JCCA 5KAQG 2VRQA 4EZMA 1RSFA 4PJEF 3E8UL 2V9QA 1NC2B 3M8OH 2XIIA 3NCJL 4M3KB 1JD9A 1ZT1A 1NH6A 2G9HB 4G6AD 3D0LB 3SJVA 3EO0B 4HC1A 3HRZA 5JQ6H 2ADGA 3DSFL 1SMOA 3OKKA 4JY6A 5GS0L 5C0DA 3PHOB 1JHKH 2BNJA 3BFOA 3KL0A 1ETZB 2BFVH 5E6IB 3C6SB 5AWNH 5TDPA 3GSNL 3ZMRA 3H9SB 1VFBB 4U6YA 5HPOA 4G6KH 5GRUH 3LV3B 4RFNB 5GRVL 2ED7A 3V5DB 4A2LA 3UR8A 1EFXA 2ERJC 4QRSB 3CHDA 3HUJA 1DWGM 3DI3B 1G9ML 4M1GL 1V3LA 5FGCE 1W91A 1BHGA 5EB8A 4NSBA 4UV7H 3KAAA 3ARQA 4LCCC 2APVA 4PYGA 5JOFB 1TUXA 4PJ7B 3B6SA 1B9ZA 3WFCH 5BVJA 4OLVH 5JNYA 2W67A 3HFML 4IRJB 1PKQA 3WJLC 1UJTA 3HMWL 1NFDE 3I6GA 4AL8L 3FQXA 3MLXH 4JPVL 5DD0H 4OZHB 1I9IL 1V7MH 1PX8A 2J8UE 3D0VA 4UOW1 2OR9L 2H8PA 3HRPA 4MVBD 1HHKA 1B3YA 3BDBA 1CFQB 1OP3K 2ZWZA 4TUFA 3MOAH 2ZSVB 1S7SB 2WMPA 1DQQA 3N1PC 4MZ3A 4QTHA 3BPOC 1XIWA 4ENED 1D6VH 5DC4B 3ZKNC 4NQDD 4XPTH 5ICXA 1R3LB 1KJVA 4NUJA 5IVXB 1JPFA 3BZ4B 4J6RH 4X5XA 1HJXA 3NVQA 3LB6C 4M1DH 4Y4FD 2W4XA 5GISH 3C60A 1X9QA 3VKKA 5CEZL 1KJ2B 4E5XA 2AEQH 3FOLA 2PO6A 1CQYA 5H94B 5C2BL 3BLPX 5I24A 4P5TD 1XR9A 4R8WH 1BVZA 4OFKA 3PWPE 1VERA 4F7PA 1RZ7H 4MJ2A 4RDQF 3GNRA 5GNZA 3IJ9A 4UQ3A 3LZFH 5E08L 4RISL 1N64H 3B2VH 2A6JA 3BPLB 4OAWB 3ZL4L 4ETQA 5ITBH 4FZ8H 3MLTA 1T21A 4D3CL 1AP2A 2CKRA 4WDIA 5AG8A 1TENA 5T3ZE 1S78D 4K71B 1AQKL 1BSIA 3BMWA 3LN4B 4ORGA 1BG4A 3DVNA 2PYED 2C3WA 5LQBH 1IGCL 4PRPB 3U57A 1HSBB 3QDJB 1MH5A 1AR2A 3N9GH 2GI7A 3LN9A 4NYLB 4Z2HA 4J3SA 2IQ9H 3QUZA 1E55A 5JR1L 4MNHB 5IB5A 2I25N 2OI9C 5D70L 4MB5A 2R1YB 3DUSA 5IJKC 3VVGA 2I5YL 2EO9A 2RQ8A 1P5UA 1DLFH 4NQED 2HT2C 1X5IA 3DXAE 3QQ4B 4U05A 3VFGH 3AM8A 2NXZB 3AAZB 3DUUA 4U1SB 1RH9A 2JB5L 1CZ1A 2J8UB 1IGJA 5KSBE 1UKTA 1NBYA 5DRZA 1FVCA 2H32H 1E73M 1SYVA 1EHLH 3LRLA 2EEAA 3SGEH 1X6LA 2QKIA 5HDOA 2EXWC 2IAMC 4HCRH 4B5EA 3UPAA 3NCEB 1FVEB 3E6HB 3MTRA 1BM3L 5D6DA 3U7WL 1A9EA 3IFNL 4CMHB 4F3FA 2MMXA 2QQLH 4X9GA 3PZTA 4Q22A 4MSWA 5FOOA 1FNSL 3EYQC 4U1GC 5CZXD 3RVUD 4WO4B 2EDKA 4OD3H 2ZOKA 3BIAX 2BVPB 1U2CA 4Z7WA 3P11H 1RQ5A 4N5ED 3KYKL 5C0AA 2R2EB 5BWFA 1IM9D 1YNLL 1KGWA 2XWJA 4JEGB 5HHMB 2I07A 2WQRA 4OZFH 2P8LA 3ARBA 4I3SH 5L2JA 5DJCA 2R15A 3IDUA 4XVUC 3VXMA 2DIEA 1EDGA 3MI6A 2DDXA 2J75A 4XP4L 3IDNA 3TCLB 5C0NC 3ULVE 1JWMA 3MODH 4YHNB 3KPSD 1X5LA 4LVNC 3OXSB 1OQOA 5ANME 3MRCA 3WDIA 5CBEB 1H11A 3DV4A 2OJEA 4CGTA 2WYSA 6A3HA 1T2QL 5BV7B 3VE0A 4X7TB 4H1LB 4G6FD 4JO2H 4RRPG 2OMBA 4G8FB 3AIQA 2VAAB 2IH3A 3DYOA 1WAAA 4Y89A 1MCDA 3W9DA 3UTSB 1HQRB 2ZX5A 2WMKA 4WJ5B 1V6VA 1XF3A 3X12B 3MSGA 5GJSL 1CDUA 1FGVH 3MRLA 1BTCA 5LCVH 3LKQB 4M8QB 5BVJB 1JGEA 5JLZA 3CD4A 3MRFB 3UJTL 1T0NB 1RZKC 4HJJH 3OHXA 1XGTB 3AREA 2FE0A 2E7LA 2C3GA 4YBQC 2D24A 1ZT4A 3MMEB 1J8KA 1I3VA 3BXNA 3OF6A 1W72H 3D18A 2XZCL 2X44D 3QA3A 4TUKH 1I9EA 3V0WL 3H53A 5JHDD 3EO0A 2WCAA 3BAIA 3GSUA 1MJUL 5I1CH 1DJSA 2YN5A 3OKKB 4CU6A 3GXIA 1HZHL 2HG5A 4YO0A 2ZCKL 1ACYL 4LSDA 1F5WA 2G75A 1GC1H 5SWSD 2GJZB 3RM4A 5F6HI 5CJ8A 1TZHB 2GQHA 1LE9B 5F7DA 4ZUSA 5T3ZH 2AW2A 3K8LA 2ADJB 1JHLL 4HFUH 3MFFB 3P9MB 3ZDZE 3IJSA 5E0QA 1NMBH 4YDIH 3B2UD 1M7XA 3HNVL 3NYDA 1MJ8L 5ALCH 4W88A 2IFFH 4O4YL 1G7IB 4NO3B 5A16B 3EMQA 5HSFA 4YE4H 3BKJL 4FRWA 3GSWA 1A1OB 1VFUA 4H8WC 1NDGA 1LILA 4WDIB 4WWKB 3FN3A 3GSQA 2BCKB 4ODXA 4PP1C 1AFVH 3LN4A 3HE6C 2AXJA 4RAUB 3VFVA 5FGBC 1EQPA 2EZ0C 4LNRB 4LSUL 2WKGA 3ZKXB 5D7SL 1OAQH 5BVPH 1BBJA 5DS8B 4UQBA 3FNDA 1V03A 1HDMB 1VSCA 1TPXC 2Y5EA 1A7PL 1B4JL 4YBLC 3H9YA 2A6DB 4LCIH 4PRPD 4POYA 5JPMB 1Z3GL 3GH5A 3WENA 3DX9B 4X0NA 2HWZL 3ULUH 3CXHK 2VLLA 4QO1A 32C2A 4KI5D 1SY6A 3VXMD 5ERWA 5HYSG 1HJQA 2VERN 2OSYA 3FOLB 1TETL 3BAKA 3L9RA 2HWZH 3ULUL 2NZ9D 3E0GA 2DLIA 3AXIA 3CMOH 2ZXAA 4F8TA 1HNYA 2LV4A 4Y4KA 3HE6B 4JQIH 2G8ZA 4XP5L 4NO5A 1S7QB 4LCIL 2F8VA 1FG2A 3AIEA 2A0LD 1QW9A 1GCFA 4GW1B 4AWEA 3QPXL 4M9PA 2FJFA 2XKNB 4KMQA 1E6OH 5C3TA 2BOBB 5TF1L 2X1IA 1KB9J 1AE6L 4F80A 4F9LC 3V6FA 5CGTA 4S3JA 5B39B 1VAHA 2PYEB 4X9FA 2GVYA 1S9YA 1CG9A 2UY7A 3SQBA 1MHHA 1BZ9B 1N2RA 2B8OT 3QNYA 3MRBB 1U8MA 1TJIL 4RQQA 5I18L 3RKDC 1MLBA 4WCYH 3T8XB 5FDYA 3G04A 4IRSA 3AB0C 1SEBB 5DEFB 3GH4A 4OZIB 5IK3B 1OIMA 4XVSH 5IB4A 4LU5L 4DTGL 4U6YB 4WGWB 4YPGB 3E2HC 5E24E 4AK1A 3OB8A 4J27A 1W0WA 2BJMH 2RR3A 4P5MB 5HY9B 3ULUC 1QKZL 3IS0X 3BSHA 4JM2D 2MPAH 3LRSA 4Z7WF 2EH8H 4QEGA 4D9RD 1UGNA 3QJFB 1SEQL 3CZLA 1H5BA 3H3BC 3IDIB 3TV3L 4WI3A 4ZUUA 3HLAA 3LEXB 3N50A 5J6HB 2WVVA 4U1IA 4UIMA 3UDWA 5H8DA 3FB7A 1C8QA 3X14A 4YZFE 4P9MH 4PRNB 1HQRA 4JO3H 1X6NA 5DQJB 3V0WH 1A9EB 4OIAA 4LPXA 1P7QA 3X12A 4PY8I 2QL1A 2AERT 4U7KA 3WSQH 3LQZB 4O5LH 4NHUB 3STLB 1YUHA 2IF7A 4L3ED 1BQHG 4BSVA 1ES0B 1YN7B 2Y2WA 3JV4A 3MNZA 4FTVA 3GJFB 1XGRB 4M48L 4TVSa 1NWUA 3N1GC 5HJ3B 5FAAA 1YZZA 3MUJA 3CSPA 5IEKB 1R85A 2MTPA 2A2QT 1R5WB 1U8OB 2MPAL 4LSRH 4P3CL 4I4WA 2ICEA 1H9VA 2P5EA 2UZIL 3QOKA 1MRDL 4WV1A 1OTTC 4UT9L 2FIKA 2NY4B 4LAQH 1Q9WA 4D0DB 1UWRA 1MCLA 2CIIA 4X4XB 1CXFA 4UT6H 3WEMA 4UFJA 3MRHB 1NP0A 4KJQC 2GJZA 4G9FD 4RAVA 1RULL 5EUOE 4NCC1 3TA3D 1QR4A 4BH8A 3C6LB 4NNYB 3LS4H 2FHFA 1RJLB 2P49B 4RA3A 2AK4E 1CZ8H 3PDGA 5KEZA 2UY3A 4NI3A 3QDAA 3RIKA 4RBPK 3PL6C 3T65A 1GGBH 2LQRA 3NCBB 1DWJM 5GS1A 1JWUB 3ROLA 4JFUA 1OLZA 4HZ8A 4DN4L 1T89A 1FFOB 1A5FL 1EV2E 5KSAD 1N4XH 1TCRB 5IMKA 4NM8L 2W0FA 4JPWL 4Y5XA 5HHXH 3BRGC 3UTZB 5BW7A 4WFEE 4C56B 4M5YH 1YMME 4OT1H 4Y5YB 2WIIA 2OBGA 1T7WA 4PBXA 4YDLC 1SYTA 3MV8B 1HXJA 4XPBL 1MWAA 3W5NA 4ZSOA 5F7UA 3UZVB 1P53A 3VGFA 3KGRA 1ES0A 3FRUB 5I8KL 1J88A 4RNRA 4JG1L 5ELIA 4AJ0A 5FFLA 1MFCL 1OWWA 2EDWA 1T0OA 2R2BA 5D1QD 3IXTB 1INQB 1NC2D 3RP1A 2BVDA 4NIKB 4ELMF 5LKNA 1MQQA 2D3VA 4Z7WE 1MHPH 5MEOA 3HC4H 1NC2A 1FFNA 2CMRL 3WDHA 1WPCA 2YL5A 2ZSWA 1JNEA 3AIWA 5FYKH 1PLGL 4CMMA 2J88L 4P46A 4ZTPL 3SCRA 4KWUA 2VDPH 6CGTA 3KL3A 3E2HB 2NW3B 4G43B 4LGRB 4YC2C 3SDDA 3DYPA 1NC4D 3FB5A 4Q6YA 3TO2B 2V3GA 4ZD3L 1OGTA 1OM3H 1EGJA 3P73A 1FPTL 1G7IA 2BXYA 4NO3A 5A16A 1F02I 4R4FL 3SOBH 1KC5H 4BZ2H 4N0YH 1XZ0A 3NIDE 2FSEA 3C87A 4KH2A 4LSQL 2YS4A 3PTQA 1TJGL 3A22A 3MV9B 2YA2A 1DBML 2GJ6E 1JYXA 1JPSL 2B31A 1CG9B 1X5YA 5IB2B 2AK4B 4HIHA 4M6OL 1KGUA 4KI1A 3CH1B 3ZHLA 3VGAB 3EGSA 5IFAL 3GI9L 1N59A 3RU8L 5K9QI 1FLTX 1LE5A 2A6DA 3NTCH 4M6MH 2D03H 3RNQB 2VH5H 4UDTA 5CSUA 5FOJA 5EBWB 3CZGA 5D7JB 2YPLA 3OLIA 3WLBA 3P9WB 3BH8B 5EC1B 1X5KA 2H8PB 3FRUA 2FGLA 1DVFA 2HJLB 3PZUA 4KKBD 2P5ED 2VN4A 1QFOA 4GJTB 5J1SC 2CERA 4BA8A 4QLJA 4WJXA 3LPFA 5GGQH 1PZ3A 2NY3B 3QO0B 5FA4B 4NKMB 4KV5F 2O5ZL 1M7IA 4LARH 1MCOH 4WGVB 4HZ7A 4IBLT 3TH2T 2AQ1A 3M07A 1Z6JT 1R47A 2ZUMA 3E3QE 5GJSH 1MHCA 4JFFB 3WH7A 2NY2B 1SJVA 1MYRA 5D7IE 1RPKA 1GVIA 3WDQA 2XTJD 2YXFA 2O5XH 5BRZA 1F4WL 5TH2B 3UC0H 4G43A 2F5BH 4YZFF 5D1QB 4OCNC 5EORH 1XH2A 2XFXA 4NRZB 2FX9L 3JTSA 3K3QA 5GZNC 5HYJE 4G9DB 1FLRL 2FYYB 4UQ9A 2DPEA 1TNMA 1CGSL 4YEFA 1TG7A 3WH9A 1W3HA 2VL5A 2IPTH 5E08H 4X80L 4LCYB 3SKNA 1R24B 3K4DA 1G7HB 2A73A 5TDNB 5ICZB 1MW3A 4PRHB 4NQCD 4OCSL 4C56D 3BSZL 1HKKA 4EXKA 4LSTH 4JO4H 2FZ3A 3HS0B 4TVPL 3WO4C 5FF6A 1K6AA 1OT1A 3GJEB 1ONQB 5AWNL 3V9FA 1CECA 1MJJA 3BX7C 1HEZB 5IB5B 4MD4B 1SJHB 4MNMA 5D7JA 1J1PL 3C8KA 4NQXB 1INEL 3SO3B 1WE5A 3SDXB 1DVFB 2HJLA 4MXVF 1ZVYA 3JZ7A 1MFEH 3T65B 4WU5B 3I85A 2GIYA 5IVNA 1XF5A 5HYQA 4Q74A 1ZOXA 1LQSR 4QHLB 5GS1B 4M4PA 5JW4Q 4ACYA 4ELMA 4JRXA 4OZGF 3HNSL 4S1SL 1BBJB 2YD8A 3CFJA 4XCFL 1NC4A 3LKRB 3SCMB 4U6HB 4Z78A 3FT3B 2DD8L 1J05A 3SGDI 2Y8VA 1OD9A 4OV5B 1CBVL 5CP3A 3CLEL 3LMJH 1RHHB 2Y06H 4K7PY 4GKSA 5H35B 2VCCA 4F7MA 2F74B 3BUDA 4YGVA 1DE4B 4KK8C 3I50L 4S1RL 2XQBH 3DRQB 1EUUA 4MHHI 3ABZA 3SGDH 2CK0L 4QRQA 5F89A 3ILPA 1LO3L 1JDDA 2UYLA 1UA3A 2WC4A 4QHUA 1Y6MR 3MJ9A 1B3VA 4MLIA 3IXAA 4R7NA 2XYLA 3C9NB 1A9BA 1IAOA 1RIHL 1RUKL 2KKQA 3FB8B 4EIGB 1F4XL 2I07B 3C6SA 2DEPA 1LO3H 3TVMA 1UYQA 2BFVL 3DROB 4Y88A 5IB1A 3T77B 4AC1X 3L3HB 5EO9B 3PQYE 2ZSWB 1QI4A 1CF8H 3BGAA 4MQ7B 3WHE0 1FL6B 4NZFA 1EHXA 1E0XA 5I6SA 1ZKAA 5GSVA 5EU7E 1HP5A 4W7VA 2YDSA 1F58L 1S9YB 2JLLA 4R96B 4GW4A 4QOKE 3WS6C 2V7HB 1NGXA 3LKNA 4L4TA 4PJ5E 1Q4NX 1UOKA 5M03A 5BOPA 4KRTA 4G7YL 3C8KB 4I3GA 1BP3B 1UXWA 3BP4A 4Y5YA 2PB1A 15C8L 2QHRH 1D9KA 4XCYA 5CJBA 4X4ME 1VFFA 5C0EA 4PJXA 4IOFC 3V6ZB 3EYQD 4TOYL 2R56L 3OKEA 5CZXC 3MRDB 4FQCH 2FATL 3RVUC 2UWFA 3HAEH 3BAWA 1S8DA 6FABH 3WY1A 2CSPA 5E95B 4ODSL 3B9EA 1G1CA 2VISA 4BJLA 5KVFL 1UWQA 2YA1A 1DQQB 4PY8J 5M94B 4W5ZA 3TTYA 4AT6B 4H20H 3NCYP 4JANA 3PTKA 3W11D 1U3YA 5A2JH 2ESVA 5IGXL 5ESVB 2HT4D 4XVUD 3HZYB 1XGUB 4PJ7E 2EH8L 2C7UA 4PTMA 1LJYA 1IC1A 4M1CC 2FEEI 4Y5VC 1E56A 4EDXB 3V52L 3QQ9C 2OL3B 3QJHA 1SYVB 4NF7A 1B3WA 3N18A 1ZWIA 5JORA 4QHUB 5ESAB 5DWUL 1HKIA 3KLSA 3QI9A 3PP4L 2CPCA 4OLVL 5DJ6A 3VIKA 3HMXL 1QX1A 5E1HB 1R8LA 2E8YA 3TZVD 3CZNA 1F6LL 1HK6A 3WFHA 3VGHA 4JFEE 3SKUD 1E0WA 5KANI 5DO2D 5IOPB 1IZKA 2CETA 1VGKB 1EHNA 2ZNWA 5GSRA 3GSNH 3DVIA 1VEOA 4PUBL 4DGYH 1WIUA 4QRRA 1EZVY 3LKPA 3EYFA 2NX5D 3RGVD 1UQZA 3ZDYE 5TDNA 3PP3K 4KMTH 5ICZA 4HIEA 1EOMA 5IMLB 4ZPVA 4YBHA 5KJRL 1DWAM 4K07A 4WFGD 3SCSA 4MJIB 2OJEB 4CRPA 3WIHH 1CBVH 3E1F1 3MYJB 2O26U 3RRQA 5FGBA 3FQTB 1FNAA 5FK9B 4N68A 1HEZA 3MLWH 1SVZA 2P24A 4RIRA 4U6XA 3WIHL 2XPGB 3HR5B 4PJGA 4J28A 4MMZC 3CX5K 3ROOA 4KVNH 4XNUH 3VSTA 1OBAA 1KJ2L 1Q1JL 4GAYB 3WFLA 3VXRE 4TPRH 1Z9OA 2CPUA 3B8SA 1MIEH 3OAZH 4JFFA 3UAJD 5H37G 5MEQB 1DBMH 2DYPA 1JGEB 4WUKL 3GM0A 4BQCA 5JLZB 1PSKH 3HE6A 4MNGB 1E4KA 3WQWA 1MUJA 1YEKH 4HH8A 1YDPA 1E3XA 2VXUH 1UCBH 2X4QB 3RBSA 2BVOB 2ZXDA 4J12A 2QADD 1YMMD 2Q76B 3EO1B 3ARGC 1Z32X 2CJUH 5C0CB 2XYCA 2XWDA 1UZ8B 2F19L 3BPCB 4Z7VA 1UCBL 3IYLW 3FRPG 1H8NA 2VMFA 3NFSL 1T0PB 3WJLA 4JM2F 3SCMD 3VFMB 3UAJC 4MXQC 1YECH 3IDNB 3TCLA 1JG9A 3N85H 4LVHC 1KR0A 2AJVH 4XWGH 4G80A 3TO4A 3I6KA 4V27A 3SGJA 3BGMB 1LK3L 5ENWB 5IVOA 4U7SA 3KYOA 1CT8A 2EH7L 1AGBA 3MRRB 35C8H 4FG6C 2AJSH 2QQNL 3AMCA 3IFLH 4DZ8B 4JZJC 1HJWA 4MNQB 2PKDA 4U6VL 3DX6B 3KS0J 4NQEB 4R90L 4ZPVB 5E2JA 4HKZB 1A6ZB 3MRGA 2NZ9C 2YSSA 3BP7A 4LLDB 1SJEA 1T5XA 1E1EA 3NIGE 5INDB 1ULVA 5HGHB 3T0BA 4FLSA 2MNUA 2JJTA 4RA0C 5JDSB 1UKQA 3LKRA 3WNMA 2NY3D 4ONGL 5D9SB 4MWFA 4OFVA 2Y72A 5HD8D 3CNKA 4NKIH 2PXYC 4DN4H 4PMZA 3GRWL 2FECL 4CVZB 4NNXB 1XH3A 5J6GA 4LSPL 4IRJC 2YPKB 4K8RD 4Y7MA 1LO0H 3VA2C 2WUCL 4Y1AB 3RDTC 4YK4C 1MUJB 2I27N 3OGCB 5HYFA 4ZTPH 3O4OC 3B5TA 5FYKL 1ZEAH 3RWIB 3VD7A 4L4TD 5GGRB 2GK1B 1II4E 4QRRD 5SWQA 3OXRB 4M6NH 1EMTL 1TTGA 2R29H 3K2UH 4MADA 3G5YB 3VFPB 4UT6L 5F1NA 3WIFA 3C9NA 3POHA 4UFLA 1ZEAL 4QRRE 1XYZA 4LOUC 5CUSL 4L1HA 1ADQA 3FO2A 1ODUA 4QCIB 3ARFC 3OB0H 3QG6A 1IAIM 3EJPA 1WP6A 1NEZG 1EVTC 3QEQA 1CLOL 4UAOB 2XFXB 3SBWC 3KXFB 1VFAB 4P4RA 4AY1A 2ARWA 4RMRA 5I8CA 2V2WB 4WEBL 2LAGB 3H42L 1KR1A 3HG4A 2ESVD 4XC3H 3VI4E 4ELKB 3AUVA 4JPWH 2V5RA 1QBLH 2P8LB 3WNPA 5CPQA 4YXKH 2VXSH 4OD3L 4IOFD 3CCHA 4GO9A 5DURB 3BP7B 1ZVSA 2QQLL 5CGMA 3EYVA 4R90H 1AGEA 3PF2A 1U3HC 1Q38A 3JV5A 1E40A 3WD3A 4MMXC 3H3KA 2AS5M 3L4XA 4Z7UF 4FNSA 3REVB 2XN1A 4UOQA 3HPJA 4LVHB 1UWEH 1KACB 5DSCB 3IDJB 1W9VA 1SHMA 2DQUH 2R4SH 3HZVB 1OGAE 1IGFH 5I73B 4UT9H 3UJIL 3WUGA 5BW7C 3MKKA 1KXVC 4PIRF 4HK3N 4WV1C 2DS4A 2WNWA 4JFHD 3KPRA 4PJXE 3HE7D 1WTGT 3HHRB 4WRLA 4QWWC 2XWBA 4HDIB 5DJ8B 5ESAA 3I3BA 4U1IB 4UIMB 4QXGL 1QNZH 3SCMA 4GAFB 3A47A 2GJRA 5IR1B 4N8CL 4ETYA 4P48A 3VDBA 3AC0A 4OTXH 3REWA 2HVJA 4LEOA 4FN0A 4NN6B 2CK0H 5FHAH 1PSKL 5DO2C 1DUYB 2BNRE 5TF0A 2EYRA 5HHOD 2HLAA 5A3HA 3DRQA 2R1XA 2RCSH 2DH3A 2XTKA 3QCTL 4ZXBD 3DNKA 1CFSA 4NNPL 1BMGA 1QLRA 1UJ3C 4HS6A 1MLBB 2YD6A 5DZOA 4PMXA 1WB0A 5MENB 4P59L 4YN5A 2I60L 4XBPA 5FYJE 1MVFA 1E0OB 1HIZA 1IQDB 3MRKA 2DSWA 1KB9K 3L5IA 3BGMA 3MXVL 4H20L 4UIKL 1BOGA 4U0RC 2VC2H 1OLLA 4YH6A 3MMDA 3AU1B 1UR8A 3AYSA 5A40E 5EUOB 1UXSA 3VIIA 1D9KD 1SY6H 4MXWH 3V5HA 4K7PX 1E6ZA 4K3GA 3PBGA 2FATH 3CZEA 3PN8A 3QR2A 4X7FC 2GFBB 4LX4A 4JDTL 4CAGA 3VCLB 3CLWA 3RILA 1W32A 3AAZA 3DUUB 1NBQA 3GMQB 4JO4L 1VEMA 4RAUA 4TVPH 5CWSB 3VFVB 4ELME 5CZVH 5ISZB 2YEZB 3H7BB 3KYNA 1OGAB 3UDWC 4M6ML 1D5BB 1J9CT 2PNDA 4P57B 1V3JA 4BSJA 3Q0HA 3EDDA 4ZS6C 1KCVH 3CU7A 4I2XE 4GMTL 5E1AB 1AXSA 1G0YR 4GOSA 3BW9B 4H8HA 4PTXA 4TQEL 5FB8B 5CJOL 3KHQA 4MSWB 1KB5A 3EDEA 4MQTB 5J11C 1XSJA 25C8H 2G9HA 2GJ6D 4Y4KC 5I1AA 1S7SA 4IRSC 2ICWA 3NIDF 4ODWB 4F7CB 5K9JH 1U33A 1PBGA 1FDLL 5GRUL 3RPKA 5C0DB 5DVOA 2CIIB 3QYCA 1K4DB 1T7XA 1UWGL 2R0KL 2BZDA 3O3DA 2F7OA 1U2HA 1HZHH 3ARBB 5L2JB 1QO3B 2W65A 1FZJA 1QQDA 3BUYA 3V5DA 3VDAA 2PO6B 2LVCA 3GBML 4Y19B 1UD3A 5HHOB 4JM2C 1A14L 3PWVA 5J06A 1UENA 3A67H 3DBXA 4Y1AE 3DPBA 4P2QA 4X6FB 4PSPA 2OX5A 2R2CA 1UXSB 2Q3AA 1HH6A 3HG1E 3M46A 4MA3B 2DIBA 3SY0A 1ZHKB 1E4JA 3HNSH 3FKUS 1CE6B 1MFCH 2NW2A 1OQXA 3T8XA 4HP5A 2XFRA 4UNIA 3RU8H 2IH3B 1E4WL 1JDCA 2YUWA 2EPMX 1CLCA 1MCNA 4R2GC 4YE4L 4OZOA 5ABGA 5I2IA 2ZKHH 4Y5XC 4BQBA 4P46C 2ENYA 4POUB 3GKZA 5IB2A 4C57C 5IP4A 4HHAA 3DO7A 4Y19E 1JGLH 5JO5B 3DRTB 4GG6F 5DK0A 5MERB 4XI5D 1FNLA 4TVPD 3RWJB 5CJXC 5M95B 3RM8A 4UQ2B 5T1LA 3H9HA 1AHWC 3U7YL 4DFHA 1R3HA 3GSOB 4XRCA 4DK3A 3IDJA 1F42A 3GXFA 1H5BC 2HA1A 3C60B 3A5VA 2O5YH 2NCMA 2EYSA 1AO7E 2XACC 4MVBC 1YMMA 4M00A 2Q20A 4W8AA 3QUMA 3GBDA 4EN3B 3BVNA 4YHIB 1QSEE 1CWYA 3UPRA 3MFGB 2WNGA 3OZ9L 1KJMB 3O2DA 4OCWL 1A3RL 1E6JH 2OK0L 2V5CA 4RL3A 2W9LA 3SGKA 4M7KL 4Q97A 4ZE4A 1E4LA 1C12A 4QLRA 1A7NL 3MJGX 1A47A 4DFIA 2HT3C 2WHLA 2XWEA 4HJGA 5C8JA 3SBWA 4QOKD 1MAMH 1ACZA 1H0DB 1TQTA 3P0VL 4KK8D 4LARL 4HIHB 1WWWX 1Z5LA 2UWEB 4W6WB 5A95A 5F6IC 4UTBL 3UYOD 3UZEA 4ZFMA 4HS6B 1BGXH 2R2EA 4PJ9C 3BEVA 3LY6A 3G9VA 1R6VA 4WKHA 4WWKA 4OCWH 1FO0A 1K8DB 2V9TA 5F1OB 1K9FA 4S10A 1LO2H 1PKOA 1EEYB 4PTWA 1D5MA 3S3PA 1WK0A 2D7OA 2XVPA 3S37H 2VN7A 4CW1B 2ZX6A 1SR0A 1PY4A 5GGTH 4RGMC 2HN7B 3P4LA 4XCCL 4RSVA 1SEQH 3W5MA 4Z8FH 1WBZA 3WF4A 2V5MA 2LAAA 4S0SD 2NPLX 4PGDB 4AYGA 1I8KA 3DI2B 3QUYC 5IMOB 1OW0A 1QR1A 2WPGA 4GLRH 4F3FB 2GUOA 3NIYA 3IAPA 1PYWA 1S7UA 4QKXB 3GSRB 4JFED 3SE4C 4CDGC 1AQKH 1CFNB 3T3MF 3I6LE 5BRZB 1R86A 4P3CH 4V1DD 4HUXA 5I1EH 5EH1A 4QGTA 2CRYA 1Z2KA 4ACPA 4OQTH 4GFTB 5D9MA 3BIKA 3B9VA 3HA0A 4DEPB 1W1TA 1KYOJ 3T09A 5T1MA 1F3JB 2WCGA 4GXUM 3CUIA 4TSCH 1A7QH 1OAKL 3TN0B 4UU9B 3C8HA 1UKSA 4NN5C 5DJ2B 4LCWD 2DSKA 4O58L 4NC1C 2CKBA 4ZO8A 1FE8L 1ZA3B 3WEXA 3BZEB 3DMMD 1FFQA 4H1LH 5I79A 2FO1A 4LHUG 3DVFA 3QRGL 2J8FA 2APTA 4D6CA 3HPLA 4F9JA 4IHOB 4WW1A 1K3ZA 3QNXA 4R97B 5KN5A 2DRUA 2V5SA 3W81A 1TETH 1PAMA 4BH7A 3VFOA 3PP3H 1JZ6A 1OB0A 1UR0A 4Z76A 1TXKA 1NBZA 1PD6A 4CW1A 3AXHA 1UACL 5JXEA 4Z7OF 1HVQA 4JREC 1US2A 4BQ6A 1S9WA 3N1MC 1QPPA 4DTGH 2DI9A 2FH8A 1UA6L 1AKJB 1U8LA 3P30L 1CDJA 3KPSA 2FO4B 2DQIL 5EZJB 4F7TB 1OP9A 1OM3L 3WS3B 4YDVA 3EYSH 3L5WA 3B2VL 4FABL 1GOMA 2QV4A 5HGAB 1IEBA 3GSRA 2G2RB 1YUHB 4FTVB 4KXZI 4P2QD 3VXPB 1KIRA 4X98B 5CZVL 5LAXB 3FL7A 4JY5H 1ZHBA 1IFHH 2ZG1A 3BHBA 2G3IA 3QHTC 5FUCE 3QHNA 4DAGL 4ONHB 1E6OL 1CDBA 2XY2A 5IFPA 3NZ8B 4LHUA 2O9PA 1BQCA 3EZ8A 1FC2D 4EOWH 1I9JH 3E6HA 4P2RB 3JWDH 1N5AA 3P4MA 4PRHE 2WKLA 4OKDA 1A7OL 1KFAL 4NFDA 4N0CD 3OJDB 3KZSA 1Y6NR 3BZEA 2E7HA 4WU7B 2BNQE 4PGZA 4BQ4A 4R26H 1DL7L 3RVWD 1IAMA 1FO0L 1IAIL 2B5IB 1CT8B 1V6YA 4JHWH 1I8LC 5E6IA 1R3KA 4XVTL 3CC1A 4R3SB 3MLXL 4JPVH 4MJID 1BEYH 1Z9LA 5DD3H 5HVHC 1N4XL 3O11A 4PV9A 3HNTH 2OWCA 2FEDD 2XZCH 3FY1A 5E70A 4P2OB 2BERA 3NABH 4MJIE 4K94L 1ZU8A 5C07A 3QUYA 4HOZA 1HYSC 4L29B 1BZ9A 1MHHB 3RVVD 2WLZA 5JO5A 1U3HD 4Z2LA 4K7FA 4OFDA 4XPFH 4YLQT 2ZUQB 5D9SA 1QNOA 3OX8B 2QPUA 2NXZD 3RHWF 4PGJA 2WZHA 1CLOH 3I3DA 3HZKA 4YDVB 3FONB 3G5ZB 1N3NA 3OBAA 4JANB 3BDYH 4PJ8B 4QRPB 5C0IB 1VENA 5CHNA 4GRMA 5B4MC 3TJEL 5ILTH 1EEYA 5I17B 1CBGA 1GGIH 3CXDL 1G9EA 3SDXA 1NMBL 2C7UB 5CUSH 4AM0B 2A3BA 4NWTL 4P23D 3N13A 5IBUG 3OLGA 1NJ9A 4KUCD 4PJXF 2BNUB 4GG6A 1KBBA 1JPFB 3BZ4A 4PJ9A 2HTKC 4A2MA 2B0SH 2HFFB 3JV6A 2MCPH 3L3DA 5I0DA 3S5LA 1SQ2N 4FG6D 3SCTA 5HYSA 1FFNB 4HBCH 2ZCKH 1G84A 3W27A 1JGVH 1HL8A 4AZBA 4UILH 2A83B 5D72L 4H8WL 4RWHA 1HJVA 4TVCA 3F8UB 1WAAE 3JV4B 2RIKA 2X10A 4M7JL 4Y4KD 1PZ5B 4KROD 5F7HA 2B2XL 5IWLC 3CH9A 2H26A 2CD0A 3CLFL 3CMJA 1P84J 4PV8B 5C0CE 4XP5H 4RFEA 1Z0NA 4NKDB 4PJDE 5IHBA 4KPHH 3H54A 5F88B 4WI2A 5HYJB 3L6FA 3VNZA 1JK8B 3TBWB 3WHE1 4OJFH 4BA0A 1W0WB 3PL6D 1WFUA 3QUMH 4W4NA 5GGRY 2C8NA 4WNQB 2CXKA 3HAEB 1Q9WB 1F4AA 4KROC 4D0DA 1I1XA 5ENWA 5L2KD 4ZTOH 1Y0LB 5IVXF 1F6FB 5HDBE 2L4OA 1R5VA 4UQEA 2BHZA 4WHTB 2XPGA 5IJKA 1OGAD 5C0IA 4LSUH 1OAYH 3SDDD 1UD4A 3TPUB 1ISZA 2UUDH 5EU4A 4KUCF 3FQRB 1YY9C 1Q9LB 3NFSH 3ZT6A 1LP9B 4XP4H 3OLEA 2WUCH 1JNNH 3BVVA 3ZQ9A 3MNZB 4HWBH 1AE6H 1YYLL 1GZPB 3BQUD 3HNVH 4X4ZA 4HC1L 4TX8A 5TE7H 3D50A 4L4JA 3TZVC 5IEKA 5FYJH 3KLAA 4HEPG 4NUGL 5DO8A 5JIWA 4Y19D 4JHZA 1JFXA 3DGGA 5E6ID 5B3JF 2C9AA 4NFBA 4RMTA 4Z77A 2O92A 5IBLC 1HWGB 2QQNH 4P8UA 1Z9MA 2X2HA 5HHVL 5KAQF 1DQLL 2WP3O 5J3HD 5SWSE 4ZO7A 3IRPX 2A3AA 3LEYH 3GXMA 4O51A 4XWGL 1KIUA 2AJVL 3PGCB 3SN6N 4YEEA 1CVRA 5IHSA 4TSCL 4E8DA 1KEMH 4H26B 3FO1A 3RHWK 5I8EA 3S3JA 2FR4B 3MLUL 2XIBA 3QCVH 4Q9RH 3RWDB 5EBGA 1CQKA 1WZLA 4HS8H 1S7TA 2OJZL 3DHMA 4UV4L 3FOMB 4JVWA 3F12A 3IU4L 3MV01 2IFFL 4GAJH 4O4YH 5IK3A 4XC1L 2ZUUA 4OOUA 1ZS8A 4NPYB 1E0VA 5J6GB 3F6IA 5ANMB 3VFUB 1G6RL 5D4QA 1AGEB 1LEKB 4HKJB 4AYFA 1MH5B 1D5BA 2XTJE 4W68A 2JJWA 2NY5H 3T3ME 3A6CH 3BO8B 3MRMA 4Z78B 4D3CH 3MYJA 1VJZA 1BLIA 1KSRA 4OZHE 4CD4A 1MI5B 5CLWA 1W2KT 1SYSA 3L3JB 4R27A 4KDWA 1EXUA 1C08A 3WLBB 3LVEA 1AQDB 2HFGH 5JHDE 3ZYZA 2IPUK 4TSAH 3VRLE 1C3FA 5D4YA 3D85B 2J8UA 2BDNL 1G7JB 4OCYL 1PX4A 3ULVF 2BSSB 3ZR5A 4AENA 2UUDK 1CTNA 3LD8C 2EIBA 2YBUA 4R7NB 1M05A 4DO5A 4TNWF 3QDMB 3GMPB 2CHNA 2G5BB 1KIPB 3K7UA 4WW2A 4PMNA 4ALAH 1OSEA 1U3HB 4P8XA 3WEOA 3IDXH 3ULSA 5AYQA 2P5WE 4KJWC 5I1LA 2APXA 3I6LD 5HBFA 2C26A 3VFWA 2G3JA 5DMGC 1GGTA 1WDPA 5ID1B 1CVSC 1RZIB 5IHRA 1BFVH 3W6MA 2P4AB 3CFBB 5CXPA 3BAYA 1EO7A 4OLYH 1QEWA 1X3DA 2A0LC 2V3DA 1FHDA 2QLVB 4FNQA 1KXVA 5T5FH 3BMVA 1KGXA 5I2IB 3MBEA 5J8OA 1QFWI 1UEYA 2QSTA 5DGQA 1DANU 2Q8BH 5SV3A 2P8PA 4U3AA 4XBGB 3KPQA 2AJUL 1X7QB 3KWWB 1A6TA 3QFJE 1MJJB 1J0KA 4N8CH 5GS0C 2VZUA 2Q7YB 2IFGA 2WANA 4HIJB 5FGSA 1TJHL 2ZOLA 4OI7A 1FQ9C 1M7IB 1PY9A 4WO4C 2QLYA 3BUPA 2BVEA 1ODAA 2DTMH 3U4EB 3UTZA 3OB0K 3VCLA 3HZMB 3TNNB 2Z91A 2HAZA 3VXQB 3IFOB 3RPMA 5KVGL 2F1AA 3H7LA 2HLFD 2J6EH 2J8OA 4LP5A 4XPHL 3SE4A 2FWOA 4M8QA 3OLDA 4XP1H 3MRJB 3RY6C 3PGFH 1E5JA 1T0NA 3NCJH 3TNMB 2X2IA 1MAJA 1FNHA 2ARJB 3SO3C 1ZHBB 4NRZA 3ALFA 2NXYD 4G9FB 4RE2A 1RZ7L 1X5FA 2RFXB 2X40A 3GMRB 4S1SH 4XCFH 1FZOA 3WUWB 5KSUB 1U8IA 1KBGL 3ARTA 4FNRA 4Z2GA 1GXEA 2YN3A 5J4MA 2AQ3A 5J1AA 1VKXA 1MCEA 3T2NL 5IHZB 1OAZL 3KPRE 1B90A 5CINL 2XA8L 3ESVF 3MV8E 1RZIA 1JWMB 4YHNA 4UBDC 5E0FA 1U8QB 5BV7H 1IGMH 3II1A 3DV4B 2XY1A 1J10A 1YEEL 4AIZA 1JRHH 1UR4A 3QWOA 2HKFL 3WD5L 4Z5RB 5M5DA 2XG5A 1E4XL 1S5IH 3UPCA 4FLRA 2BDNH 4OCYH 4IIQC 4CD8A 4KQ4H 2VDRL 3V7MA 4Y4HC 3O45B 4ZE5A 4Y2DA 1FCGA 4ORGB 3GMQA 5CWSA 4P2YA 4NZDA 3CVHB 2G3NA 4PP2B 3ETBF 4HX1B 1YJDL 4LLQA 1TTFA 3NCMA 4CMHC 4EANA 3BCDA 4K7FB 3CFJB 5INCA 1GNXA 3OWEA 4X6CA 3LMJL 1JVKA 2D4FA 4EDWL 3TYFA 2P42B 4RISH 4QXUL 4BUGA 4F66A 3G6AB 1KELL 1CXKA 1MHEA 1QOXA 3OAZK 4MYWB 4JFZH 1KBKA 1AXIB 3RTQC 3MRJA 4B3LA 3SCOA 1MFEL 5CEZH 5SX4I 3C5ZA 3S4SB 4WSJA 5DT5A 1NPUA 5I1GL 2J7GA 2ZXQA 4QHKJ 2W59A 1XEDA 5IFJB 4RMVA 3LXCA 4M7ZC 5CSYA 2OR8A 5ID0B 3MPCA 1OSPH 1YEFH 3M45A 4JN2A 3UROR 4QHNB 4P9HC 32C2B 5FGRA 4FZEL 3VUPA 2A3EA 3H9ZA 4FQXD 4JPKH 4B7IA 3TOPA 1H3VA 3S6CA 2X7LA 1FZMB 3OKDB 3U83A 3KDMA 3QJHB 2YBRB 3I6KB 2F58H 4RFOH 4MAYB 4PJHB 4ZAKD 4JR9H 4LMQI 3DX3A 2VDKH 3PWUA 2ZE0A 2A3HA 2V17L 3MRHA 4MNQD 2HRPL 4G6FB 4AL8H 4NBZB 3JTSB 4JAMA 1XAUA 5KSBF 1FL5A 1HVXA 2E6JA 3EHBC 4Y16C 3BWAB 5ABEA 3HE6D 4C83B 5IHUL 2BCKA 4Q9QL 2ZUNA 5MP6H 5B39A 1V6XA 1JK8A 1T7ZA 1YEHL 3GNPA 1F6AB 5JA9A 5E8OB 4QRTB 1HCFX 4KAQL 4QRPD 3UETA 1UM6H 3BUBA 3RDKA 2DM7A 1ZLWH 4C56E 1CDGA 1W9BM 4B3KA 5D7LA 1JGIA 5KTEL 4CU7A 1JNNL 1TFVA 4BFIB 1TA3B 3SURA 3CFDB 5B8CC 3U9UA 1W8NA 4PUDA 3EOYG 3RZCC 4I48B 3VNYA 1PLGH 3UTSA 1KEML 3MNVB 2XZQH 3VXTA 7FABH 1H3UA 3QHZL 3FQRA 4PBGA 1GOHA 4G6MH 3TBVA 1H5BB 3U5UA 3MC0A 1KG0B 1OSZA 3U36A 4EN3A 4H0GA 1S7QA 1CI5A 3NGBC 1OL0A 4P5TA 3IFPB 4ZNCD 1IAKA 4D2NA 4PJBA 3TZVB 1AGFB 1JRHI 3GSXB 4CL7A 4XZWA 3VG9B 2OTUB 2J4WL 4ODUA 3DOSA 3WFHB 1KFWA 4Z7UE 4OZGA 5F3HB 3BRFA 4E42B 3OKYA 1IGYA 1HXYA 1Y18A 1BF8A 3T0XA 2BNRB 5F70A 1D7FA 1YA5A 5HHXL 1AD9A 5GRVK 4HXBL 1UM5L 5D1XA 3KPNB 3W2DL 4HWZA 4Q6IA 1RUML 3MV11 4TN9A 5CD3A 1MCCA 3O4LA 2WBKA 4WKAA 2Z1KA 3TWCL 5HVWA 1J8HA 3O9WC 3WHXB 2BHUA 4ZG1A 2BNQA 3EFFB 3R4DA 4G5ZL 3THDA 2F61A 1FL6A 2GSIA 2IBGA 2X5PA 1HKFA 1UB5B 3SDXF 1H4PA 2DBLL 4IJ3C 3IJYB 3RM9A 4JHAL 3TFKC 4OGXH 2YKLH 1F00I 5KVMC 4Z7NF 3G9AB 3HTLX 3LHPL 4PD4K 1DQTA 4KRPC 4ZPTA 3L4YA 4WTZA 1EFXB 3U4EA 2E6PA 1N5YH 2C3HA 2Q86A 2VAJA 3TBYB 3O3UN 5L88L 2DWDA 2DT1A 5EU3B 1I8MA 3LH2H 3ZTNL 2A6KB 4PR5B 2ADFL 2DI7A 1MRCH 4XCEA 4Y5XB 1CXIA 4M5YL 4OT1L 1H15B 5A6MA 3QXTA 4UQ2A 5T1LB 4KK9D 3ARBD 2IALB 3RA7L 3WUWA 2J7LA 5HHQA 1O5DT 5FA3B 3UYRH 3M1BA 1MREH 1RI8A 4S1QH 5EUKB 3GIZH 5I1KH 8A3HA 4MJ5A 3MSPA 4YXHH 4H8VA 4RAHA 4XVJL 1TQVA 4JZOB 3KLKA 1E4NA 2AJSL 4BS0A 5AY7A 4ZQKA 1FG2B 4R26L 4GRWB 5EPMA 4AIZB 2DYPD 1OPGH 3OR7A 3R1GL 3K74B 2D7TH 3F7PC 3NZHL 3SKJH 1AJ7H 2DMCA 4Z5RA 5K59F 1ISVA 4HULB 1A7OH 1AHWA 3IDYC 1QOKA 1T03L 4QRSA 2NTFB 5I9QB 3SKMA 3SGKC 3EJSA 1C16A 3EMZA 5GIRB 2JK5A 3G5XA 4U31A 3VE0B 1F2XK 5DRWA 5DQDL 4NXKA 3W6LA 3VIPA 3VXOA 3GSNA 1OPGL 3BP6B 1TJIH 3MLTB 5IW6A 4UTAH 1Q9OB 5JMOC 1OB1A 1V3MA 1JYVA 4QXTB 5E5UB 3VXUA 5MHSE 1YY8A 2XQBL 5C07B 2VQ1B 1RPQA 1MWAB 4XXDB 1NAKH 3FO9A 1D5MB 4P4KC 4QTIH 4WW2C 4XZUA 4AH2A 3VPLA 4JRXB 1MCPH 2D20A 4HQQH 1G94A 4O5LL 3VXPA 3WSQL 1H0GA 1TVPA 4BK5A 3HNTL 4JO3L 5IFJA 3UO1H 2WVVB 1VACA 2JIXA 3PWNA 4JQIL 2R1YA 4AEIL 3MLSL 3S36L 1XIWC 4JHWL 4IS6A 4Z0XA 4WVRA 4ZOAA 5SWZD 4AM0A 5I73C 2FCBA 3GO1H 3CFCH 2GHWB 1EGJL 4M7ZB 3TLRA 2FBJH 2WV3A 3VW3H 4QRQB 3GGWA 1CFNA 2X0YA 3WD2A 2NW3A 4ZQKB 1RIVH 2VLRE 2IBBA 1MWAH 5TD4A 1GZQA 4EOWL 3M7SA 4PYHA 2AEPH 2XKUA 5KBNC 4OI8A 1T89C 3C5SB 3GDBA 4DW2H 5TE6L 1U8IB 4M8UA 2PI6A 1F8TH 2GDUA 1I75A 4I4WB 3NDZA 1LK2B 2FYVA 1EEQA 4U3CA 1EIBA 4UBDD 2IUZA 3O3BB 3KPNA 1U8QA 3BKJH 2IC2A 1ZJBA 1ZHKA 4KU1A 4NRXB 1D6EB 2O9TA 2D31A 3W0WB 3ZE2F 2OMNA 3WQ6A 2BVTA 2VRKA 3TA3C 1UM5H 3QEGL 4RFNC 1KTKE 3ZKSD 1HT6A 4HPGA 2F5BL 3CHEA 4P3DB 1VBRA 2NX5E 1B3ZA 2YPLB 2QPSA 2CBJA 3MV8D 3QH3B 5F96H 5C70A 3BP5B 1EFQA 3THMH 1KIQB 1PIGA 2NY2D 4KFZC 5INDA 4X7TA 3MANA 3VXNB 4G8FA 2ZCLL 4K2UL 3V4PH 1KTLB 1EXUB 1INDH 3O4LD 3NA4A 3IJ7A 1T83A 3L95A 2AK4D 1WJ3A 1XGUA 3SUSA 1JPGA 1ZA6B 5D7IF 1FV1A 1T80A 4YX2L 1H8SA 4R7DA 1IEBB 1RZJH 3DX4A 1OGSA 1B2WH 1EERB 1V3KA 3CDGB 5D7IA 1K5NA 2X89A 5I75C 1WITA 2VZOA 4GQRA 3HI1A 2R1XB 2PW1B 4XB3A 1AD9B 3RWFA 3WFBL 2LU4A 3PABB 4PLKC 4XAWH 2FX7L 2Q7NA 2IPUG 4M7LH 5SV4A 3ZDXE 1R0AL 3A23A 1H09A 1ZB5A 3O2VH 3KLDA 4CN4A 2BSTA 5DDHA 1QHZA 1KN2H 5BO1L 3BLKA 1NCCL 4XNYL 4M5ZH 5KVEH 2VCBA 2FL5B 4P2QE 4DVRH 1MVUA 4C55A 1CF8L 2A6IB 3AXLA 4L3AA 4HPYL 4Q9QH 2R0LH 4ZO6A 2XXCB 2YPLE 4JO2L 4S3KA 4F7PB 2A9MH 3WEZA 4LRNL 3AU1A 4BELD 3N04A 4JKWA 1I7ZA 4ZD3H 1IT0A 3LQMA 1HCVA 4MD4A 4LYPA 1IGIL 3WL1A 1EBAA 2F54B 4TSBL 5F21B 5ISZD 5D9NA 4DZBB 5GGSY 3DXAB 3ZDZF 4P2QB 3QIBC 3P4OA 1MCBA 4PRIB 3EDKA 3WXVH 1MJ7H 3NFNB 1W72L 5ISZE 1U91A 5I16A 5LGJB 1WBXB 1NFDA 2DB8A 3MRFA 4YR6B 5ACLA 9CGTA 1U8NA 1A1OA 2ICES 1OWQA 2W0LA 3HI5L 4PS4L 3WBAA 4CVWA 3L95B 2EDFA 5I1HH 3X11B 2PUQT 2FEDC 4FQQA 2FHCA 3OKLA 1C5BH 5I17A 3IDGA 1CL7H 1HILA 4NZUL 4OLWH 1NANH 2FB4H 4XPGL 1UASA 4PJAB 4MJ5B 4NZJA 3EOTH 1HTYA 3NH7L 2X4QA 4DN3H 2DQXA 4QXUH 4QRUB 1E1FA 4G9FA 1OSZB 4M7KH 1KF9B 2BY1A 1QUNA 3LQAL 5JW5B 1BIIA 2XVKA 1QFHA 5A8MA 1A9BB 1IAOB 3UCRA 2PW2B 2VLRA 1W0VB 4LKCA 2EEDA 4GKNB 1E4XI 3LKSA 1AHWB 1E71M 2I5YH 3U4BH 3HMCA 1CZ8L 2VWEE 4U1MB 4DJMA 1H0IA 3FO1B 2JCCE 1I3GL 2B4CC 1BBDH 3QDMA 3S5LG 3X3GH 4GZJA 4I3SL 1CFSB 1QLEL 3QNXB 4FQLH 3QFJD 3MR9B 3WL9A 2D3LA 3BPLC 3K1DA 4LRNH 4CVUA 5I66B 2Z1SA 5IWLA 4AD0A 1NGWB 4G42B 3FQUB 4LCYA 4TUJB 3BXWA 2EDDA 5E8DH 1IGTB 3PTMA 5B3NA 3UTSE 2XA3A 5JZ7D 4XXDA 1NOFA 3FO0L 5BMFH 4JFTA 4TUOB 3GEWB 5FYJD 4XBEH 3GBNH 1TVDA 4X99A 4X6CB 1TITA 2Z4QB 2VISB 4X6DB 1BM3H 3U7WH 4B41A 3LS5L 5I1IH 1WC7A 1YC8A 2JIXB 3PWNB 5IQ7H 3FFCE 2X6MA 4I77H 5CS7A 5DURD 4GSDH 2VZVA 3GBMH 1Y6KR 1OGAA 5A3IC 1FL3B 1XIWB 1HF6A 1IMHC 3PHAA 3OXRA 3S98A 2ITCA 1DFBH 4YBLB 5GGVH 2VC2L 1DBBL 3AZSA 1GZQB 3HG5A 3ARGA 5CD5D 3MLZH 4KK9C 1QSEB 3CUJA 5HI5C 1AXTL 2P48B 1N0XH 1QPXA 1FZMA 5H35A 1US3A 4XWOD 4HPOL 4GG8A 3S35X 4RGNE 2ITDA 2W61A 5BRPA 2ILLA 4NZRH 2UZYB 5JW4N 1T0MB 1ZVHA 3HCVA 4AZGA 1UVQA 2W9DL 3F7RA 3VX1A 1CTOA 4XMLL 1KC5L 4P4RB 4BZ2L 3GMRA 1UZ6E 2DMBA 2JCCB 2RCSL 4QRRB 5I66A 1GOWA 1IT9H 1G9NL 4OLYL 2XHYA 3GYCA 1F3JA 1KPRB 4OJYA 5EUOF 4WWID 1HE7A 3B3IA 3HC3H 4OTXL 4LSSH 3K2MC 4PRAB 3PDOB 4LNVA 3DX2A 3AISA 2ARJQ 2AEQL 4P9HL 1F13A 1FZKA 3ARED 4NQSB 3QXAB 1AGBB 2GITA 1MFBH 1X7QA 3KWWA 4NO2B 3KLHD 3RWDA 1BFNA 3UR7A 3L1OH 4FNUA 3VXNA 1MLCA 4XPTL 3RI5K 3ET9F 5F6HJ 1ZLVK 3EKCA 1XGQB 3VJ6B 3A6BH 2B1HH 1NMAH 4JG0L 4UIKH 5CLTA 3SQOH 1CLYH 1JGUL 5J12C 4HKZA 3V0VB 3MOAL 3VXQA 4WWKD 3TYGH 4M4RA 1MPAL 5DHVH 3MBXL 3O41B 4P99A 4PMDA 3SCNA 3DRTA 3O6ML 4OLZH 1FNFA 5DEZA 3WMBA 1ZHLB 3AMKA 5E8EA 5J9PA 2VVNA 2ZXBA 2FBOJ 4PJ9B 1I7UB 4JRYE 4MWFB 4U2YA 2ICCA 2QADC 3G6MA 4LL9A 3TCXA 1MFDH 3EJRA 3VD9A 1WIOA 2NT0A 3TBTA 1B0IA 2MKWA 4IISA 1R5WA 1I9RL 2EYTA 4UOW0 4NQCA 5DUBB 4OM0H 1NMCC 2ICEB 4RMQA 4Y4FA 3JXAA 1T3FA 5BS0D 5DUPL 2EBNA 2CKSA 5B8CA 4ISVB 5CSZB 4UOZA 3U82B 3F7VA 2PO6D 2HKHL 4JQXA 4X5XB 3MO1B 3F65A 1L6ZA 3D5HA 4KDTC 5DQDH 2FJFB 3QCVL 4N8VB 4Q9RL 3QXDB 4X7EC 3QISA 2EZ0D 1YNTA 2BOCA 2UZIH 2PTUA 4EE9A 3DC0A 2VCAA 1HYSD 2WC3A 3OAYK 2ZX7A 3QEQB 5FL0A 1S7WB 1UH4A 3DIFA 3TV8A 3D3AA 4W5UA 3UTTE 4OIIH 3T1WA 2WVTA 2EXYD 1U91B 5I16B 1GC1L 4BQ2A 2Z31C 3MR9A 5JW3L 1UWSA 4Z7VE 2W92A 3BEWA 3CVHL 4HWNA 2SEBA 4OD1L 1JNDA 2W0FB 3WIJA 2D31B 4X0KA 5DXWA 2NT1A 5DTFA 1L7IL 4FQJH 4YPGA 5EIVA 4P5KB 1MHEB 1MOEA 3NA9L 4L8BB 1NL0H 4P5MA 1P2CA 4JFPB 3R06A 3RWEA 2QMKA 3ZKMC 3V4UL 2VXSL 2YD5A 3RAJL 1DWHM 1NWSA 1KCSH 3HI6L 3UBXG 3MMUA 1DTUA 1DVFC 3BHBB 3ARFB 3CSYB 4I18A 5C3LD 4FFYH 3P0GB 5HHQB 3PIQB 1GW1A 2RJMA 5IBTL 1XHGA 2OL3L 4OGYH 2W66A 3G6JB 5DUBA 4ZS7H 2UVFA 4XX1E 4QCIA 1ZLVH 4KC3B 4TULL 3R0MA 4LAJH 4OF6A 2BJML 4Y16B 5IKCB 4PLJD 4JGMA 2NQCA 2NY1C 5D7IB 5BQ7B 3IVKB 4DQOL 3P4NB 1S3KL 1N82A 4YJZL 1KB5H 3HI1B 2DN7A 3WMCA 1S7XA 3B5GA 1ROWA 3OR7B 2DH2A 2HJFA 4U5IA 2UWEF 1T2QH 3BZFB 3KJ6L 5I18H 3BIKB 2DLGA 4HLJA 3ZT7A 4WW2F 1C5DB 1UD6A 4MA1B 3TT1L 3QIWD 1U36A 1V05A 4KJPD 4PJAF 4J2XA 3DX1A 3VM5A 3TTOA 4L9DA 2G60L 2IBZY 4W4OC 4WO4A 5T5NF 1QRNE 1NARA 1Q0YH 1BYCA 4JDVA 4MXQD 1I1CA 4NJ9H 4U7MA 2X1QA 4I0PA 5DVKA 3RY6A 2V7HA 1ORQA 4PTTA 4PV8A 1ZA3A 1FVDA 4WI6A 4FFYL 5C0FB 4GRLC 3GRWH 1TZGL 3INUH 4XB8A 5FM8A 5HHMD 3O4LB 4BUHA 3WQ5A 2AVGA 2X1XR 2ORBL 1I8IA 4NN7B 3SE9H 3B3IB 3B9KC 3ZO9A 5ANMA 3VFUA 1IBGH 4F58L 3BKCL 4IM4A 5HGDA 4KVNL 1Q6EA 4U1SA 4KJYA 1CE1H 1W9PA 4MAZA 2J4WH 1FH5H 3QIBD 5CEXB 5E7FA 4PJ7A 2D7PA 5F3BB 5GS3A 4HBCL 4CCEA 4N0UB 1OGBA 4AT6A 3GSOA 35C8L 4XRCB 3TTSA 1TQCC 1Q0XH 4PY7B 4PMYA 1GC1C 4LXFA 2EH7H 4PRDB 1XFPA 2GFBA 3W9DB 1A1MB 5KW9L 3F5KA 3LOWA 2BY3A 2CKNA 3DLQR 1OAQL 3MJ8A 3QHZH 2VLJD 3U0TA 4PG2C 4KTDL 2CLVA 1X5AA 2VDML 1AY1L 1NC4B 3EO9L 1QZ1A 4DGYL 4K94C 2Q8XA 2DI8A 3FT3A 3LKOB 3TT3L 1CLVA 4LPCA 1UWUA 2XKNA 2AABL 4FFVD 2Y25A 1RZGA 4HWZB 1NANI 4Q6IB 2XWJB 2V3FA 1NCAH 1RJCA 3CPLB 2FHBA 1RZKH 2YWYA 1VRXA 4KKAC 1DE4A 4PJBF 1G7MB 5MHSD 5E00B 1DWFM 4J4PA 7A3HA 1FORL 5H94A 3I02B 3VDHA 5GSRB 5FECA 2Q1EA 3HE7C 4QHKI 3PHSA 4GRWE 2C4XA 2Z8WC 4K23L 4ZOEA 5ITBL 3O3DB 3W0WA 1NCBH 1B3JA 4XMKH 4PB0L 5I8CB 3ILQC 5HI3D 1FL5B 1HHIB 2X9XA 3D9AL 5D6CB 3S37X 3TN0C 4POZD 1CXLA 3EBVA 3VRIA 1C8PA 4OCXH 1HNGA 3QQ9D 5HVHB 1Q9LA 2DDQH 2X8RA 1ZK9A 2DQDL 4ZUUB 1OD0A 4KI5F 4ZODA 2JB6B 4S2SB 5HDQH 1EA9C 5F9OH 3BT2H 5F1KC 2JELH 2F5AH 3IETB 2GSGB 1NCTA 2O93L 1DUZB 1FBIL 3ARRA 3C6LD 4ODXB 3EAKA 4HAFA 3RUGF 1Q94B 2MWCA 3T3PF 2OYLA 4DWSD 3TBTB 2DJSA 3SDDC 1QBML 3D2UD 4JFPA 2IEPA 1S8DB 4NRSA 4MNGA 1C1EH 4W89A 3RX5A 5AZ2H 4MX7A 5F7NC 2E3VA 3I9GL 4J8RB 3F6LA 3ZE0E 1CIDA 3FHQA 4XTRC 4UDUA 4DO6A 2XIDA 4UAOC 1CDCA 4MCYB 1REIA 4EDWH 4IRZH 2RFXA 1ADQH 1VACB 1ZGLB 2KBGA 2HH0H 4G6JH 3TO4D 1X5JA 1ZLSL 4FQXA 3BUQA 2VVSA 1ZT1B 1UACH 1A8JH 2W62A 2TAAA 4DGVL 4L3EB 1ISXA 2IGFH 4NQUA 5DC0A 1NCDH 5KVDL 3QHOA 1HP4A 3JBG7 4JGJA 5M17A 3BD4A 3BZFA 4FP8H 2PCPA 1YEEH 2FDBP 4HH9A 4EBQH 3LPOA 3VM7A 1RVFL 1MCRA 4KGJA 4Z7OE 4OF3A 3SE3A 4LCUB 3VWJC 3O45A 5J3HC 5DJZB 1W1VA 3GUTB 4ODSH 3SE3C 5IOPA 2VDQL 1RMFH 3CLEH 1OTSD 4I77L 4NSKA 3EOBA 3T2NH 3QUXC 1UB5A 3HUJE 1GONA 5ACZB 3OZOA 5T33L 4L9LA 1TCRA 2L7UA 5LXGH 1XD1A 1L7TH 5E8NA 3HC0B 3TYFB 4HCRL 3AS0A 4JFYB 1B4RA 1YEIL 4OZIF 3FO0H 5BMFL 1A0QH 2VX6A 4XP1L 1ZJAA 2XTJC 5H2BA 5HYIA 3MLRH 4MJIA 4WU5A 4GZEA 3OGOE 1G7JA 2W07A 2NSXA 1CNVA 1WSST 3D3VD 4LBEB 1EGZA 5D70H 4CKQA 4IMKA 2OYPA 1JI1A 2F53B 4DKDC 3X3GL 3S6TA 4L9LC 2HJFB 4GAYA 5GGTL 4LVOB 3GB7A 4PREB 4HOWA 3QIWC 1FFPB 1WZAA 2LU7A 3WN5B 3DETC 4F37K 5CCKH 5FUZL 4YDKH 4ODTH 2VRAA 2FLRT 2R9HC 1GRWA 4L4VA 3PZVA 4HV8A 1M6OB 2GJ6A 4WUUE 1MELA 2VZ1A 3UTQA 1BG9A 1OW0C 2V2WA 3WIHA 5HD8C 1DEEB 2L0DA 1UADC 1HQ4B 4JQVA 4IOSD 1QFWL 5FYLD 3MJ7B 2J7FA 2NW0A 4W84A 4N8VA 3LXAA 4U1KB 4NRYA 3VFMA