2FH6A

Crystal structure analysis of klebsiella pneumoniae pullulanase complexed with glucose
Total Genus 311
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
311
sequence length
1052
structure length
920
Chain Sequence
DVVVRLPAFGVALADAHWVDKTTLLWPGGENKPIVRLYYSHSSKVAADSNGEFSDKYVKLTPTTVNQQVSMRFPHLASYPAFKLPDDVNVDELLQGETVAIAAESDGILSSATQVQTAGVLDDTYAAAAEALSYGAQLTDSGVTFRVWAPTAQQVELVIYSADKKVIASHPMTRDSASGAWSWQGGSDLKGAFYRYAMTVYHPQSRKVEQYEVTDPYAHSLSTNSEYSQVVDLNDSALKPEGWDGLTMPHAQKTKADLAKMTIHESHIRDLSAWDQTVPAELRGKYLALTAQESNMVQHLKQLSASGVTHIELLPVFDLATVNEFSDKVADIQQPFSRLCEVNSAVKSSEFAGYCDSGSTVEEVLTQLKQNDSKDNPQVQALNTLVAQTDSYNWGYDPFHYTVPEGSYATDPEGTARIKEFRTMIQAIKQDLGMNVIMDVVYNHTNAAGPTDRTSVLDKIVPWYYQRLNETTGSVESATCCSDSAPEHRMFAKLIADSLAVWTTDYKIDGFRFDLMLYHPKAQILSAWERIKALNPDIYFFGEGWDSNQSDRFEIASQINLKGTGIGTFSDRLRDAVRGGGPFDSGDALRQNQGVGSGAGVLPNELTTLSDDQARHLADLTRLGMAGNLADFVLIDKDGAVKRGSEIDYNGAPGGYAADPTEVVNYVSKHDNQTLWDMISYKAAQEADLDTRVRMQAVSLATVMLGQGIAFDQQGSELLRSKSFTRDSYDSGDWFNRVDYSLQDNNYNVGMPRSSDDGSNYDIIARVKDAVATPGETELKQMTAFYQELTALRKSSPLFTLGDGATVMKRVDFRNTGADQQTGLLVMTIDDGMQAGASLDSRVDGIVVAINAAPESRTLQDFAGTSLQLSAIQQAAGDRSLASGVQVAADGSVTLPAWSVAVLELPQGESQGAGLPVSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords pullulanase
publication title Crystal structure of pullulanase: evidence for parallel binding of oligosaccharides in the active site
pubmed doi rcsb
molecule tags Hydrolase
total genus 311
structure length 920
sequence length 1052
ec nomenclature ec 3.2.1.41: Pullulanase.
pdb deposition date 2005-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fh6A02
2.60.40.1130 Mainly Beta Sandwich Immunoglobulin-like Rab geranylgeranyltransferase alpha-subunit, insert domain 2fh6A01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2fh6A04
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2fh6A03
1YN7B 1MPAL 2MQ3A 2A83B 4B41A 1BJ8A 1UWXH 1ZVYA 5FK9B 2XWEA 5MEPA 3VW3L 4W7UA 1W0WA 5GGRA 3A6BL 1CBVL 1B0RA 1FSKC 1E6SM 4PRWA 2VNCA 5DT1L 1K8IB 4BQ2A 2GHWB 3MSPA 5AUMA 1LD9B 1EHLL 1R24B 5JW5B 5CUSH 1ZA3B 3RI5K 5E9DA 4IDLA 3WJJC 5EWIH 3VFSB 3MV7A 5KS9E 1JZ5A 1ZGLA 2WXDM 1CGSH 3S3JA 1VKXB 5DJCA 3BQUB 2E40A 1A4KA 4HT1L 1KR0A 3VNZA 1W0YT 5KS9F 4PMQA 1G6RH 3PP4L 4ONHA 1BG9A 1GGCH 3LD8B 5FL1A 4QGTA 1FOBA 1NCAH 2F74A 2O61B 1U8KA 3JWDC 2CDGB 2GITA 3CFEB 4XPBL 2NX5E 2X10A 1R7AA 3TYGL 4AD5A 1FDLL 2G3MA 5HHXH 2E3VA 2BNRB 3LRHA 4TVSa 1HOCB 4U0QB 3EZJB 1IGML 3STLA 4PJCE 3SDDA 5DURB 1C7TA 3VWJD 3VXUB 5ACMA 4D9RE 3CFJA 3IXTB 4NFBA 3V7AG 4GQRA 1EMTL 5FUCC 4AG4H 3QXTA 4PJCF 1WE5A 4LPCA 3LRSB 1BFVH 3ARDD 5TPWH 5CJ5A 3ARFA 5E2WL 3A23A 3WXWL 1KLGB 3Q6GH 3FJTA 4RDQF 4OGAD 4EI5D 1ZHBA 1EHXA 2EDYA 3PF2A 4JO4H 3SCOA 1IAIL 2BSRB 1JPTH 4JG1H 2VIRA 3FMGL 5E1AA 4PJXA 1LF1A 4NQUA 1T04A 3INUL 1TCMA 4Y2OA 1US3A 1UWIA 5C0RL 3ZHKA 1DUYB 1FHDA 4WF7A 3UPRB 1CL7L 1XF5A 3U36B 2DDQH 4HXAL 4FG6C 3BW9B 1RZKH 4PJ8A 3RCNA 4X7FC 3M7SA 1KWKA 5SWSB 4DN4H 2R1WA 1WVZA 4HJGA 1JDCA 2OLDA 1CXIA 4OCWH 3RX5A 3HPLB 4KHTL 1HH6A 2DKUA 4YDLB 4RWYH 5J6GA 5CLTA 4KKLC 4AYFA 4Z77B 5HD8C 1GYAA 1HILA 2GFTA 2ZOLA 1E28A 3O6AA 4JFZH 3HAEG 4Z2IA 4PGDA 3FNDA 3BSGA 5ITBH 3VE0B 4L4TD 5DVNA 2EIZA 5F7DB 4LDOB 2WIIB 1QFPA 4OM1L 5FV2A 3VXMD 4IIQA 4F7EA 2W9LA 1TR1A 3VINA 3NFPA 1NUDA 1OBAA 1BOYA 2HVJB 4HF5H 1UWGL 4NYLB 1N4XH 5IGXL 2QMKA 1LP9A 2CMRL 3T0DA 3F5WB 1CFVL 2I24N 4PJGA 3HCVB 1SVZA 1RFDL 3ZIZA 4NOFA 1RU9L 4MGXA 1KN4L 2WMHA 1B31A 4HKXB 2E7BA 3FT4B 4B53A 4UNUA 5DEGB 1BZQK 4EE9A 3NIDE 3KS0H 5D4QA 1QI2A 4NO2A 5FCUH 2GI7A 3ARED 1O0VA 1FV1A 3GXIA 1WWCA 1MQPA 1MAMH 4R4FL 1HX0A 1MFAL 4G6JH 1LL7A 1REIA 4UQCA 3CMOH 4TOYL 4WFHE 3WFHA 4FP8L 3FO0L 3DXAE 1AR1D 1ZJBA 3VSTA 2WP3O 3S98A 3IANA 5ICXA 1BVNP 5HDQH 5FM5O 1MYRA 1MVYA 4LVHC 1FGVH 3I3BA 1KTKE 5A8NA 4U31A 4TUFA 4MXWH 4J27A 1H9VA 4U3CA 4UAOC 5TDNB 3WDIA 4HUNB 4YAQA 1U33A 1IM3A 4QRPE 3R0NA 4GKZA 4W4NA 6TAAA 5T1DL 1OM0A 4J3OC 3FB8B 2FATH 1VBRA 1ORSB 3JTSB 1PBYA 3N15A 3VXNB 1LG1A 1I9JL 4RQQA 3VXPB 3UJJL 3LMJL 1RZIB 5IW1A 1ZVHA 4PMUA 5FGBC 1IM9A 5DVLA 1GPOH 1DQJA 3QNZA 2F5AH 4YQXH 3TZVC 4OZIA 3AJ7A 5M17A 5CD5D 4Y5XA 4RX4D 1S8DB 4TRPL 3S3PA 3I6GA 4WJ5B 5F93C 3BVNA 1U8PA 4EN3D 1P7QB 4O02H 4MYWB 4LU5L 1BF2A 3MFGB 2LU3A 2OL3L 4PJHB 3VX1A 1JP5A 4GKSB 5L7XL 1E73M 1NGWB 3SEPA 4M8UA 1NOWA 4K7FB 5AZ2L 5JUEL 4UV4H 4WCYL 3HA0A 4ODWB 1YEDB 2MPAH 3O6KL 2IG2H 5LXGH 1ZMYA 3P9LA 4J6RL 2ZUQC 3LPWA 1Y0LA 2CK2A 2BSTA 5CG0A 1JGEA 4FFWD 2BMKA 1D6VL 1MCFA 3BZEA 4O58L 2VH5H 1OD8A 3TBYA 4IOSD 4P23B 4PRAB 1ZHNA 3MSDA 1G7LA 1A3RH 2FECI 5J06A 3SIMA 3V4UL 3DGGB 4XVSL 2FEEI 5DI8B 1K6AA 1F4XH 4ZTPL 2IGFL 2VE6A 1BHGA 1RJZA 5JQHC 3W28A 4XAKE 5CGYD 1WZKA 1CIDA 2GSGA 3DGCR 1ACZA 1XGUB 6FABH 4MLIA 4XUYA 4XRCB 3VD4A 1S7SA 3DV4A 1CU4H 4L29B 3QXDA 1A1NB 1D5IH 1M4KA 1P4LB 1R6VA 3TP4A 4TVCA 4XT1C 2VISB 3O2VL 4ETYA 5DGRA 3UETA 5E24E 5F6HJ 3BC9A 1F4WH 2DBJA 4NIKB 4UQ2A 3A3HA 1LILA 4QCEA 2C9AA 4TNWK 4BFIB 4C56A 4AMWA 2IH3A 3I75B 1V3JA 4ZQKA 2HTKC 4AIZB 3M46A 2HVKB 1HI6B 1GCFA 4GMTL 2WWKO 2R2CA 1MLCA 2C3XA 2YJQA 1G7PB 4Y0GA 5L2KD 4GXUM 4FTVD 4KTYA 3PBGA 5IKCA 2KL6A 1CFQA 3KS0J 4HPYH 4U3XA 5C0AB 1OWRM 5J1AB 2EDKA 3H53A 3CXDL 4NHUA 4P5TD 1GPFA 1F97A 1QFUL 1DDHB 3KNBB 5ID1B 4XAWH 1AI1H 3CUPB 4X5XB 5HDOA 1IEBB 3HG1B 1MRFL 5KW9L 4TVUA 3W0KA 3HS0A 4U6XA 3MGOA 4G80A 4HWZA 2D3LA 2CIPA 2ATPA 2WMKA 1YECL 3QEGH 4MB1A 1KC5H 3ZE0E 2NY3D 3KLAA 4XP6L 5B21A 3KLSA 3ZKMC 5HYJA 5C07E 4QRRB 1WT5C 3HRZA 5C0ND 1P5VA 3MYZA 4YHYC 2P5WB 4KU1A 5DS8B 2FJGA 3ZE0F 1A9EA 5B4MC 4KJWD 3MRBA 4EDXA 5CEZH 5MERA 2XVNA 4UDUA 3PTQA 2V5RA 4GO8A 1MCWW 4Z18A 3TCXA 1RIUL 3S35X 4ORGA 5ITFA 1A5FL 4QF1B 4HIJB 5C9JB 3KPRD 3LZFH 5D9PA 1AXSB 2O5XH 2Z92A 2ILLA 1NDGA 1ZTXL 3HE7A 1UKTA 5MHSE 2R23B 3GMRB 3D3AA 5HGAA 1A6VH 1U8MB 2EJ1A 2V17H 1BVZA 1Q0YL 4UI2A 4NNXB 1V0MA 5GGTL 1YNLH 4Y4KC 3F58H 5ESQA 5IMLA 2ZZUT 1Q94A 3F7VB 5GRUL 1QFOA 2YK1H 5T3XL 5EU4B 4XXCC 4I5BB 4F3FB 3BGAA 4WY7L 2NNAA 2XVKA 3VIKA 4TVPD 4GAYA 4W93A 2CQVA 2Q8AH 5GGSB 1FLRL 4ELKB 2F58H 1S7UA 3GMOA 3QH3B 3ILPB 3TESA 3IS1X 4JY6B 4ALAH 4ODVH 4OIAA 4QLKA 3LQMA 1S78D 2P5EA 3C5JA 1DBML 5K9KB 4NC1C 4V2BA 4DWSB 4PBVC 5B22A 4BZ2L 5JR1L 2IPTH 3BKCH 5A6AA 1UB6A 3TLRA 4D0CB 3N9GH 5BMFL 5KSBE 3B5TA 2F8VA 3OKEA 4D9LL 4HK3N 5HJ3A 4OCNC 3BSHA 2XFRA 4FXGB 2BXZA 3QP3A 3GXFA 1BIHA 4RGOL 1TVNA 5D6DC 3WEOA 1CG9A 4HOWA 1SY6L 4ZUVB 1MOEA 3BDBA 1QHZA 1ZANH 1ZE3C 4MDIA 3RWJA 3BUQA 3W38A 5IB3A 4L3CA 1QFWH 4MJID 1C8YA 2Q3AA 4HC1L 4YFLF 1KTDA 4X6FB 2HFGL 1HH9B 4OF3A 3KPOB 2ENSA 4HGKC 4LLMB 2FJHB 1TG7A 5E5MA 1GGUA 1WCBB 4TUJB 5I8CA 3JTTB 2DD8L 3BJ91 3U1SL 2YUVA 1INQB 4F9DA 4CMHB 2I26N 5T3XE 3FRUB 2X2JA 3GBLA 2PN5A 3PWJA 2AQ3A 3B83A 4IISA 2V6HA 4UT6H 5C09D 4AK1A 2FHBA 4R90L 5FIPA 3HC4H 1A21A 5FYJU 3CUFA 3WNLA 2ICEA 3MRHB 1AQHA 2BNUA 3S35H 3TBSA 1M7IB 1OPGL 2IPKA 3BVTA 3QXVA 1KJ3L 4JFHE 4KK9C 4AH2A 1MREL 1LGVA 3L5XH 5F3HA 4TTDD 2ZUYA 2ORBH 3OWEA 1FG2A 1ZS8B 4PB0L 4WHDA 1I9RH 2E6QA 2XZQH 4JFFD 3VMNA 5LKNA 1Q9LA 4L9DA 5ERWB 5E8NB 1J01A 2JB5H 4NI3A 3BP4B 3BPOC 3L3HA 4Y4FB 1EDGA 4UT9H 1FH5L 4NC1E 5EU7C 4P7QA 5CSBA 3UERA 3ECBB 5DJYB 3OGCB 4WHCA 4PB9L 3LB6C 3SPVB 3V5DA 3AISA 2W63A 5EC2A 1EDTA 1YEHH 4GBXA 3NVQA 4YHOH 1FFNB 1I9EA 2X5PA 1YN7A 1XGQB 3JBG7 2A83A 3K80A 3QNYA 4JM2C 4RAHA 1GGBL 1KCSL 3PJSB 3AHYA 5FK9A 3EHBD 3RIFF 3MLSL 3GTNA 1GQJA 3EOTH 1T0PB 2BXYA 4NZUL 3WIIH 1ZEAH 1NDMB 3HZYA 1YN6B 3E6HB 2WAHA 2NW0A 3IDJB 4M5ZL 1HCFX 1LD9A 2DMCA 3WIFB 1R24A 5JW5A 2JEQA 1S7WB 1N0XH 1ZA3A 3DECA 1S5IL 1H2JA 1EJOH 3KPSB 2H32B 4K23H 2NY6D 5TF1L 1VKXA 3BQUA 4LSPH 1KENH 5HGGS 1LO2H 4D8PB 3RL1A 4W85A 1X5LA 5I17A 4P4RB 4M29A 5IP4A 3CXHJ 2O61A 1KGWA 4OTXL 2VCAA 4NRYB 1A0QH 3QXUA 2CDGA 3CFEA 3EYQC 4K68A 5CILL 5LCVH 3W9DB 2BNRA 3MRGB 1HOCA 3P0YH 2XGBA 2YIHA 1C8XA 4MAUH 3EJYD 3L6FB 4KPHH 2ZOKB 3HTLX 4UB0L 2YBTA 4FNSA 4YXKH 4GO9A 4N68A 3VXUA 4ZDHB 2AJXH 3NH7L 3FL7A 3IXTA 4I9WE 2IUZA 4G3YL 5HGBA 1AIFB 2VXQH 4LKXB 3O2WL 1SFSA 1FRGL 2CUIA 5BO1H 1SM3L 2BRRL 1KLGA 4WV1B 1T21A 2BHYA 3W6LA 5EU7E 3FOMB 1RVFH 2BSRA 3B2UD 3ES6A 1ZLVH 3VFPB 1DANT 3ARGB 3PGFL 3UAJD 1SJHB 3MV9A 1T1ZB 4WEBL 3EDEA 3CZLA 4U2ZA 1KB5H 2CLZB 3CJJA 1NGQL 2VDOH 1IEHA 3B9DA 2VC2H 4CD4A 2FO1A 4I77H 1NWTA 1DUYA 3B9AA 1VB9A 2J2ZA 5D1XC 3ZT6A 3MXWL 3KXFD 3U36A 4PRHB 5EU6D 5LJYH 4OZHB 4JM2F 3BW9A 3GHEH 5I30L 2G60L 4QXWA 3RO8A 4HMEA 5D7SL 5SWSA 2QJDA 1NLDL 2J6EA 2YEZB 4MA3A 2WIMA 4FFYH 4YFDB 2FEDC 3UTTE 3HPLA 4AEIL 1JF1A 1NBZA 4OCYL 4M4PA 4U7SA 1OL0A 5E9AA 4WFGE 1R3IH 1P7KA 5K93A 4LRNH 4KXZI 4JO1L 1M01A 3VE0A 2ARJQ 1U8QB 1XF4B 3H9SD 4DVBB 3S96B 5D1ZB 5LWYH 3CFCL 5F7DA 4FMKA 1LHZA 1XD1A 4P2CG 4HFUL 3V7AE 4PPTA 4UINH 4X5LA 3UTZA 5I8OL 2R9HC 1CZ8H 3O0RL 3WMSA 1N7ML 2VLLB 4Z76B 1UB5B 2NPLX 4NRXB 3AMLA 2HMIC 3S4SB 1PX8A 3F5WA 5I19H 4ZO6A 1MCBA 2EDWA 3SKMB 3HCVA 3TA3C 2D9CA 3NJ3A 3GM8A 5F9JB 4IM4A 4HKXA 5D8ZA 5IFPA 5IEHB 2EPMX 4WW2C 5DEGA 5L0QC 4TULH 4P2RA 1KB9K 1MF2H 1SBBA 3QI9B 3MODL 2YDSA 5IF0B 2Z91A 2X1WL 1F3DH 1MQ8A 3UROR 1A47A 5DT5A 2NY2C 3LSOB 3RZWA 2FDMA 3MOQA 4AW7A 3ARDB 1J1OL 4P2QE 3TC9A 1G7HA 3SBWC 1EEZB 3S97C 4PGBB 5H35B 3O6FD 1BWWA 1W0VB 4JHBA 4EI5B 4HLJA 1FAIH 2SEBB 1OB0A 4M3KB 4PG9B 5CZXC 3W27A 4JHAL 1MNUL 2WZHA 3W0WD 3TBWA 1HIML 3MRQB 3V9FA 4E41D 1L0QA 4OFDA 3FXYA 2JJSA 3OB0H 3GXPA 3NFSL 5TDNA 4QDMA 1XYFA 4XWOD 3O2DL 1B4JL 3BUIA 1TENA 3BKML 5EU3B 1KACB 2BVYA 5BRZE 3FB8A 2Z1SA 2GK0B 4X4XB 1ORSA 5HI5C 3UCQA 4Y2DB 2E8ZA 3VXNA 5GZOD 3II1A 2RHEA 4RMUA 2IAND 1MRDL 3NCMA 4ZSOB 1EVTC 4JFQA 1I3UA 4TTGA 2Z1KA 2FIKB 5I24A 5I6SA 1DEDA 4WHYG 2CH8A 4XPTL 1XT5A 4LCYB 1A4JA 1T66C 2PYEB 1QVOB 1GOWA 1B2WH 3MREB 4ELMB 1S8DA 3R0MA 5HHOD 4W87A 4MVBD 3O9WB 1LK3H 5FM5M 1UCTA 2UZYB 1QR1A 3L1OL 1P7QA 3NGBB 4YC2B 4HIHB 5HYSB 3O4LE 2WBWB 3V8OA 4PJHA 5A2LH 3OR7B 4M1GL 2A77L 1IRAY 1NGWA 4L4TB 4ZUWB 1F58H 4K7FA 3C5ZD 2YD4A 4XP1H 4HA3A 4NQCE 4ODWA 4JKKA 1YEDA 3BN9D 3QHFL 3TTSA 2ZX8A 1X5IA 3DUUB 4JPWL 1B3VA 2XA3A 1U2YA 4WI7A 3DOSA 4NQSB 1LLOA 4DW2H 4WW2F 3LEYH 4RBPH 4M02A 4X6EA 3SDXB 5L9DH 4CD6A 3W29A 2ZCLH 1NOUA 3U0PA 2G41A 5D5MF 1L7TL 2BV9A 3QCVH 4JFED 4PRAA 5B38B 2QSTA 4NWUH 1I7ZA 3M17B 4I3SH 4HKBB 3SE4A 4TSCH 5FV1L 3CSYA 3AREB 2ZJSH 1OHQA 1JI1A 3VXSD 3P9WB 3O11B 4X4MA 3NIGF 1NMBL 2J3SA 3EFDL 3U30C 4ZFOL 3CFKB 4PBWD 4C4KT 1XGUA 3C8DA 2D03L 4XRCA 1HVQA 1ZGLM 1M04A 5IUSA 1P4LA 2PKDA 4CVZA 4S0SD 3FQRA 1JZ8A 3PZNA 1JRHI 4D9QE 4MAYD 5FHBL 2QHLA 1FL3B 5T5FH 3VFUB 1DSFL 4KK6D 3H55A 1FGNH 1NCUA 1OD7A 2VXVL 3VRIA 4BFIA 4NO0B 1H3UA 4Q9RH 4AIZA 1TZ7A 1RK1B 4XMKH 2HVKA 1RZFL 1OGGA 2HLFD 1HI6A 1BVKB 3MBED 1U91B 1G7PA 3BH9B 5J56B 4Z7UB 1WZLA 5SX5H 1X6LA 3DNKA 3IJ9A 1PDKA 2FZ3B 5C0AA 5J1AA 1TJHL 4JJ5A 4CJ1A 3KJ6L 5E8OB 1EO8L 3AYSA 3L7FA 2MSPA 5E1HB 4APQB 3CX2A 4QO1A 5C9KA 2XHYA 4L5FH 3KNBA 1F3DJ 5F97E 3CUPA 4X5XA 4N8CL 5F88B 1ODAA 1IEBA 2IBBA 4OGYL 5IMMA 1QEWB 1U30A 4ZG1A 5TDOB 4EN3B 1DFBL 5CXPA 5FA4B 4AC1X 3QDGB 2UWEB 1K8DB 2Z0BA 2WM0A 4K8RH 1XCQB 4QRRA 2IBGA 3TWCL 2MWCA 4G9FE 4TUOB 2DQCH 2P5WA 5DS8A 4KRNA 2RJMA 3RPKA 4YHLL 3RDTC 5JBFA 1MCDA 5KANI 1SMAA 5EUOE 1MCPH 4TTUA 1ADQA 3WSUA 4IRJD 5CBAB 4MA7L 4HPOH 2VLJB 4Y19E 2J8FA 5FECB 2NX5D 5C9JA 1GONA 4IEFB 1AXSA 2PWDA 3Q1SL 1KG0A 1NCBH 2ZCHH 3R1GH 5EUOF 1WDPA 1JK8B 2R0KH 3EFFB 3M45A 1YY8B 2VDMH 2CIIB 2R23A 1HKMA 3GMRA 1OAKH 3HMXH 3MJ8B 4KRPB 3HN3A 1U8MA 4RGNC 1DCLA 3KYNB 4PJ9C 1R5WB 5HI4D 4D9RD 3BE1H 4OGXL 4NNXA 3NDZA 3I6LE 4POZD 4OT1L 4KVNL 5DMIH 3F7VA 3DHJA 1QSVA 5DLML 5EU4A 5A16B 1GGTA 4NXSA 3AZSA 3W4RA 1OTUD 5E94B 1CQYA 1WTGT 4G9DB 5GGSA 3QH3A 3FO9B 3ILPA 3GO1L 1MQKL 1X9QA 2RIKA 2MCPH 1A6ZA 5K9KA 3IU4L 4P99A 3A4WA 3R06A 3B8SA 3V79C 4U3HA 3CV5A 1PEZA 5E4EC 2DF3A 5TFSH 1IC4H 3KLKA 2DGAA 4LNVA 2VRAA 5KSAB 5C2BH 5L2KB 4J3TA 3VUPA 2YPVL 5IIEB 1TZGL 4RFEB 4D3CL 5KOVC 4XC1H 4MNKA 1JD7A 4ZUVA 3FN0H 4NKMB 2WUBH 1FH7A 4OCRH 4U7KA 4P2OB 1X5FA 1HH9A 4OD3H 1RZ7H 3KPOA 4PTUB 4LLMA 4HK0B 5D9OA 3B9EA 1FNGA 4H41A 2NY3B 3PZGA 1FAKT 5BWFA 1INQA 5E08L 4RGMC 3UTSE 3ZYJA 1QYGL 4PREB 2DWDA 3RWIB 2IFGA 1FNHA 2BCKB 3A0OA 3NZHL 4W6XB 3GBDA 3GMLB 3V0WH 4NKIL 4G5ZH 5HOSA 4RGNE 2FLBT 3SDDC 4LGXA 4XC3H 4UTAH 2OSXA 1M7IA 4ISVB 3MZGB 2ARJB 4AIXA 2PWFA 1GOIA 1X5XA 5KG9B 3ARFC 1OGAE 3P30H 1UR0A 1RUML 3IAQA 4JFTA 5ERWA 2ZUUA 2ESVA 3PQYD 1U3HD 4LLWA 2IC2A 1FO0H 3GKZA 3MGAA 4H04A 4WFHD 3ECBA 1ZXQA 4PV8B 3OGCA 3DXAD 4ZO8A 3NPSC 3SPVA 3MGTB 4WTZA 2E9JA 1BPVA 1FFNA 3T4AB 3X11B 1V7ML 1XGQA 1BYCA 2R56H 3UZQA 1H0IA 4F66A 3PJSA 2AGJH 4PJ8C 2EICA 2IBZX 3BHBB 3DLQR 3MFFB 3MUY1 1AE6L 5IFHH 5T1KD 2W1NA 3KPQB 2WC3A 1NDMA 1QZ1A 1YN6A 2P8LB 3RJXA 5E9DE 2BVOB 2W62A 4PUDA 3MV7E 3WIFA 5HD8D 3AQUA 4OLZH 1TFVA 5A6MA 3KPSA 2H32A 5A6JA 1S9WB 3DVNB 4KDTA 3KPLA 1NAKL 1G5AA 4CVXB 3A47A 1IEAB 2GFBB 1WCGA 1BQCA 1P84J 4X80H 4D8PA 4XP5L 2MOVA 4P4RA 4I1NB 2FJFB 4H1LB 1G94A 1E5JA 2GDVA 2K3TA 3QAZB 4IIQC 3SN6N 3DV6B 4NRYA 1QNPA 4AYSA 3QPXH 1UQSB 3WUWB 1OAQH 3W9DA 3MRGA 2FX9H 3EBAA 5GISL 2M2DA 5EZIH 3GIZL 1OSEA 1Q0XL 2ZOKA 2PYFA 3T0WA 4ZDHA 4RIRB 1MHCB 5D70L 2J4WH 3J8F7 5C09B 1AIFA 1UYWL 2X4UB 4LKXA 3SCPA 3LS5H 1QPKA 4GRMB 3V5KB 5KVGH 1CFNB 3FOMA 3JZ7A 3L5WB 5F1OB 1HKKA 5DUMH 2WNGA 2HT3C 3ARGA 5JMOC 1SJHA 4NQXB 4PJXF 2CXGA 2CLZA 4XVTH 4KY1H 4HJJL 4LPXA 4XNMB 2JF1A 1DE4B 2APWA 1R3KB 1PZ2A 3H3PH 3BKYL 5JHDA 4PRHA 3MRKB 5IV2B 4OZHA 5ETUB 2HYMA 2XWJB 3B5GA 4DWHA 4XP4L 2R8SL 3ALFA 1DQLH 4OLVH 5E0QA 1JNEA 2YEZA 3H42H 1MXGA 2AMGA 2FRGP 5FUOL 2D3VA 1E6NA 4EUPB 2ZCKL 1FVDA 2X70B 4BH8B 3QHMA 5CHNB 3WF0A 3MJ7B 4PV9B 1TE1A 4S1QH 1U8QA 1XF4A 2EECA 4DVBA 3S96A 1ISYA 3GIVA 4Y5XC 4AENB 4XHJC 2PBGA 2G75B 4YDKH 3L2LA 1LP9E 4F2MA 1FLTX 1MW3A 5HPMB 2NY6B 1UB5A 4NRXA 3S4SA 3X3FH 1I7UA 5FXCH 1B3WA 3VSVA 1LP9F 3T65A 5DC9B 1LO4H 4FQ2H 3ALWA 1LE5A 4PJGF 4PJEB 4FOMA 3QULB 3ALXA 3HI1B 4F58H 5F9JA 2A6IB 5FA3B 4HCRH 4C55A 3PZMA 5DD5H 2F7QA 4S3JA 4JDTL 3BZDA 2FE0A 2GJXB 1JYVA 3QI9A 4U6HB 2W0FA 5IF0A 4D6IA 1SEQH 1GAFH 4KUCF 4YEEA 2NXZC 3WY1A 4YLQT 2DI9A 3RNQB 3LSOA 4KAQL 3VXRD 1I3VA 1TFHA 2WINB 3ARDA 5FEBA 1PX3A 3TT3L 4PGBA 4AMXA 5H35A 3VFTB 1T3FB 1W0VA 2AXFB 2NLJA 4EI5A 5ABFB 2SEBA 1XH3B 4MQTB 4CN1A 4PG9A 3WKZA 1L0YA 4WDIB 2YN3A 5D72L 2YKLL 1BECA 3P73B 1RUQH 1PG7L 3MRQA 4C58B 3IJSB 4P46D 4KGJA 3AXXA 4O2FA 1IKFL 2DQJL 5FDWB 4PP1D 1BAGA 3BUPA 3MJGX 3Q0HA 4ODXB 5EU3A 3ARYA 1TJGL 2GK0A 4K7PY 4X4XA 1R86A 3WO4C 3JWDH 3KXFB 2HTKD 4LLYB 5EU6B 1JFXA 5T33H 4OJFL 4UV7H 3PZIA 3GSUB 4ZSOA 5IVZB 3VGEA 1YEEL 2VLKE 1FFOB 3RI5F 4OZIE 4ZUTA 3AICA 5D7IE 3LIZH 5C0DB 1AVAA 5HVHC 1F90H 4NO5B 5FFLA 3KWXA 3X3GH 4ELMA 5IFJB 1OIFA 2IWGA 4OZIF 1ZAGA 4WU7B 3QUML 2X4SB 4HZ8A 1YQVH 4CN6A 3RP1A 2WPGA 1FZJB 5IBTH 4HIHA 4MHHI 4U49A 1JNJA 1W1YA 5HYSA 4LMQE 5EULV 1T22B 3H9SB 1JWMA 3OR7A 1FNLA 2PR4H 4KQ4H 4L4TA 4ZUWA 3T04D 4ZD3H 1ZGLP 2V2WA 1IQDB 4DGIL 1UA6H 3VXMA 3MKKA 1CICB 2NR6D 4OD2B 1FYTD 4RE4A 3DUUA 5CEZD 1GNXA 3ZKMD 4JQVA 5F6IC 3MJ6A 2V3FA 4NQSA 4FABH 2WVTA 5FM8A 4MJ6B 3SDXA 1I85A 2YA2A 5D8JH 1QD0A 5DQ9A 5JW4Q 4M7KH 3F5JA 1WGOA 5B38A 2D31A 3M17A 2ADJB 2R2EA 4HKBA 2AXGB 3U7YH 3BUDA 4LSQH 3BIBX 4UDTB 2MFNA 3BP6B 3WDPP 3HKFA 3AREA 1R3LB 1QLRB 3QEQB 1A7OL 5T3XD 3W82A 4OI9A 3D4YA 3LXAA 4LDLB 3O11A 3MOAL 1MXDA 2QBWA 4ETQB 4FQ1H 4FK9A 5D7KD 2CXKA 3CFKA 3HE7C 1WBZB 4GOSA 2Z4QB 2CDEA 4KK5D 3N85H 1E56A 4N9GB 1OCWH 2EC9U 5CSGA 1CEOA 1GZQB 3O6FB 4Y4KD 3BX7C 4NF7A 3VFUA 4C56E 5LGHH 3AMGA 4NO0A 1KPVB 25C8L 4YX2H 2A3BA 1J1PH 1FG9C 1RK1A 3RVTC 3SKOB 3MUIA 4D0DB 5E8PB 5ESAA 4BSVB 3CDFA 1U91A 1OP3K 5DD0H 3BH9A 1RQ5A 3L3JB 2CD0A 4Z7UA 4YE4L 4PMXA 3VGFA 1ZT4A 2Y23A 4TOYH 4AD0A 2I9LB 4OLWH 4EOWH 2V7HB 3MLRL 3NMEA 1MFUA 2F53D 4E5XB 4R2GC 5T1LD 4APQA 1MIEH 3V6ZB 2AI0H 2A38A 1MVUA 3V4VH 4XMPL 5F88A 5FYKL 4RX4A 5HHOB 2AJZB 2W9EL 4XNZB 5C0BB 1QEWA 1T0MB 2OK0H 3MMUA 4UR9A 5TDOA 4EN3A 1MCQA 2GJZB 2PO6D 4PRNB 1TITA 3QDGA 1CFSA 5TQ2H 2UWEA 5CKGA 1K8DA 1YC8A 1TLKA 4NGHH 3MV11 1E55A 3C5ZB 1XCQA 1HTYA 3WEZA 1T7WA 2WAGA 4E4PA 4TUOA 5DRXB 2X7LB 4QHMB 4FRWA 2MMXA 1S9XB 1X5JA 1OP5H 2F54B 5CP7A 1TJIH 3TVMD 2BSSA 1CF8H 4N5ED 3X14B 1HHKB 3EAKA 5ENWB 4HWEH 4JFSA 2CKSA 4JZ5A 2ZNXA 5CBAA 3TT1H 4Z95L 3NA9H 4ONOA 4R27A 2FX7H 1AMYA 3GJFK 5L88L 4JFEB 4ATWA 4AMKL 2BJML 1JK8A 4K94H 3EFFA 5C0IB 5E2TH 1XZ0A 2VR5A 5I0ZA 1H3PH 3MJ8A 3GXMA 1Z2KA 2XXMB 3KYNA 3N1FC 4ERSL 2RBLA 1R5WA 4OF7A 1FYHB 4U5KA 3VXSB 2WNWA 5A8QA 4GXVL 3HI5H 1IGIH 3SGDI 5J57B 5EBWB 3DARA 3IDIB 2EEDA 5FYKE 5M7QA 4G9DA 5T3ZL 2P5EE 4LCWB 4DOHB 1XRVA 1ZV5A 5INCB 1AJ7H 3AXIA 2L7JA 3APGA 2DPEA 5IBUB 2Z8VC 3PUCA 2OP4L 2X42A 4GBXC 1H8OA 3CHDA 3WKNA 1ZOXA 4AZ6A 3QBTB 5K59E 5I1KH 3NABH 3G5VB 2IQAA 3RBGA 1T80A 1M6OB 1HDMA 1EGJH 2GY5A 5DJ8B 3W39A 5L2KA 1UWSA 1JUFB 3DUSB 3DMMD 2C1PB 1J18A 1OD0A 5IIEA 5K59F 4HHAB 4KTDL 4QWWD 1JGVH 5DMKB 3EO1A 3DYPA 1EIBA 4FQCL 1JE6A 4CU8A 1UZ1A 5EFIB 4NKMA 1R33A 3F6LA 2YD6A 4L4VD 1C7SA 3D39B 4OZFH 3M6DA 2W92A 2IMNA 1KULA 2X4RB 4P2OA 3C2AH 3VSUA 3BQUC 2FEEL 1JIBA 1BFTA 3O4OC 5DVMA 1JGLH 4PTUA 2VXSL 1PKOA 4HK0A 1YEKL 2N1KA 5F9OL 3LD8C 1U2HA 4AD2A 3OAZH 2DM3A 3B43A 3MMWA 3L4XA 2VB5A 2K9UA 4DN3L 4PREA 4G6KH 3RWIA 3GZAA 3RZCD 2BCKA 4LOUD 2R0ZH 1SQ2N 3L3KA 3U9PL 4LGSB 1BYDA 5T3ZE 4CCDA 1ZK9A 3QUKB 3ULVL 1KGXA 2YFNA 3UYRL 4YBHA 4XCFH 3HNSL 2CLVB 1JVKA 4ISVA 1V3IA 2WBJD 3NCEB 3OA5A 2ARJA 2F15A 4LEXH 2XFFA 1T03H 1UA3A 4DUVA 1T2QL 3OKMB 5KG9A 4H0IA 4XZUB 2P1YA 5CMAB 1JG9A 2DN7A 4Y7EA 4D0BB 3LPPA 3GMMB 1XR8B 1RZ8B 1QBAA 1RK0A 4MNGB 5MI0B 1C08B 2LTQB 1ZLWH 1GOKA 5IHRA 2HTLC 3VWKD 3B6SB 2AJUL 1XH0A 3LV3A 2LAAA 3BLPX 2WKGA 1WITA 2A1WL 2WWCA 1IBGL 4MNLA 2ITCB 2QEJA 3WF1A 4PV8A 3AMKA 1OSPL 4I2XB 4MA1B 5CIPB 4YHEA 3MGTA 2V5YA 1PZ5B 3T4AA 3X11A 2GKIA 3UPCA 2LV4A 3OJVC 1UZ4A 4WI2A 5IDIA 2EE2A 3TV8A 3HG3A 4F33B 1UWRA 3HMCA 1JTPA 3BHBA 2W65B 3MFFA 3EYOA 1BBDH 3KPQA 3LMYA 2XFXB 1X3DA 3HC0B 2P8LA 1KCVL 3P77B 5GS0C 5BRZD 2IFFL 2GK1B 5TGBB 3FZUD 4YHKH 4JJHA 4JFYB 1Z3GL 1FP9A 2Q7NA 3SCVA 3DVNA 2NTFA 2VXTL 3QUYD 3ARWA 3ULVE 5FO9B 5T5NG 1IEAA 2GFBA 4OCSL 3WN5A 1BOGA 5CGMA 4X7DC 1G6RB 2J6EL 3GDBA 4S2SB 1F6LL 2FJFA 4HDIB 5D7LB 2R9HD 4H1LA 4HZLB 5FOJA 5JOFB 3RDKA 3DV6A 2BNRE 3AFLA 3KG5A 1QBLL 4ODHH 4MJIA 3CFDB 3U7WH 5CBEB 4G42B 3AYRA 1FN4B 2X4NA 3BH8A 3AMCA 2NMSA 1HNFA 3RA7H 2H26B 3VXUE 5DJZB 3BPNB 3WFCL 1NANI 2C1OB 4X0NA 1NWUA 3RUGB 3GZKA 3S4SG 3T08A 5C09A 4DO5A 1NBVL 2X4UA 4HBCL 3H7BA 1CGTA 4L3ED 1WF5A 4B3LA 1HCVA 2O5YL 1KTRL 4GRMA 4N0UB 3V5KA 1A7NH 1CR9L 2H1PH 1E4XI 3VRJB 4YBQC 1KEGL 1FORH 3L5WA 4JY5H 4HOZA 3A22A 2IQ9L 3PWPB 4WTXA 3VFGH 2Y06L 3MNZB 5HVWA 2E8YA 4NQXA 4PIRF 4JFFA 43CAB 4AYGA 1TVDA 2C3HA 3PQYB 5CKAA 4XNMA 4FLSA 1DE4A 1R3KA 3V4PL 3BEWB 3UEZA 1KFWA 1IFHL 3K46A 1QSFD 5GSRB 3MRKA 2VDNL 4HWBH 3VM5A 2JJSC 5SWSE 2XWJA 4LSSL 4XNQB 5EDXA 4MD5B 3THML 5E2UL 3VXTB 2EACA 1GOOA 5HI5D 3LHPL 4KZEH 3IGUA 5MEND 5GRYA 1NUNB 3WQVA 3QA3B 4M6MH 4EUPA 12E8H 3LKOB 2DTML 2X70A 5HDRA 1PGRB 3WFBH 6CGTA 2XV6B 4OIBA 3G5XB 1FJ1B 3MJ7A 1T66D 3OQ3B 4PV9A 2HLAB 1FCCA 1JAKA 2D7PA 3IKKA 1E6PA 1DTUA 1RJLA 3N50A 4AENA 3KL3A 1JNLH 3I6KB 4YHML 4K2UL 3PV6B 2QLVB 2F9BT 3RJYA 1KN2H 2NYYD 2C3GA 3DX9A 3GNOA 1ZBWA 3GH7A 1RJCA 4U0RB 3H9ZA 1T7XA 1GQKA 3EYPA 1MFNA 4N0YH 4PJEA 2ADGB 2CPCA 3QULA 1FZOA 3IXAB 2A6IA 5FA3A 4Y8AA 5HYSG 4DJMA 3Q6FB 4GQPH 3ZTJG 4P2RE 3CVIL 5IQ7H 3GMNB 4JCMA 1R0AL 4BZ1L 4BM7A 4LARH 3BDYH 3FB6B 2GJXA 5IBLD 2RFXB 4G9FD 2YD1A 1VFOA 4U6HA 4AD1A 3V2AR 5ECUA 3BLBA 2QLYA 2Z35B 4OM0H 1OD9A 2I9TA 1G9NC 4WGWB 4LCUB 3D50A 3SE4C 1A7RL 4JRYB 2WINA 3WENA 4TQEH 2F19L 4I13B 2P8MB 1NFKA 3VFTA 1T3FA 2AXFA 3KPMB 1BQSA 4WTWA 1PW3A 5B38G 1G9EA 5I77A 4LAJH 4WDIA 3MLWH 1JHTB 4TSAL 2LAGB 2IMMA 3U5UA 2EDQA 1KBGH 3P73A 1G9NL 3WH6A 1K4DA 4W84A 1DBKL 3ZM8A 1UH3A 3IJSA 4BFEA 5EFDA 1KBBA 2D7MA 3HI6H 2EDEA 5FDWA 3ETBF 3N1AA 3SQOL 3ZKND 3NCYS 3MRCB 4ODXA 2J7DA 4F79A 3C6LB 5IFAH 4W68A 2XIDA 5EOTA 4NQDD 2DT0A 3KXFA 2X4TA 1HJVA 2HWZH 5EU6A 3WUZA 1TPXB 2LVCA 2AJVL 4G3YH 4JKWA 3SCQA 2YXMA 3NZ8B 3GSUA 5IVZA 2FNBA 1A1MA 5F44A 1IC5L 2EXYD 1BVLA 3OKDB 1XSIA 2EYTB 4NO5A 3SOBL 4DCQA 2D24A 2IADA 5IFJA 4WU7A 4UIKH 4PJHE 4UBDC 1F4HA 3RY4A 3N0PB 4DEPB 1TETL 2ATKB 2ID5A 5KVMC 2HKHL 1MCOL 5I18L 1F02I 5DMGC 3H9SA 3VIOA 4RA3A 2YMXH 1DLFH 4CDHA 4PJHF 3EW3B 4JZOB 3BP5B 4G6MH 1IQDA 3MJ9L 1TVBB 2DQIH 3IDUA 4KQ3L 3D5HA 4OD2A 1U93B 1MJ7L 2Y6SD 4P8XA 4GINA 3OZPA 2C4FU 1IC7L 1AR2A 3DVIA 3JWNC 1A6WH 4MJ6A 3PN8A 1B6UA 4QLLA 4AMCA 3T2NH 5HYFA 5KTEL 4QT5B 2ADJA 4RMQA 1RZJC 2AXGA 3GRWH 3QDMB 35C8L 4UDTA 3BP6A 1R3LA 4X4ME 3WHXB 2WUCH 2XRAH 1QLRA 3QEQA 3RGVD 2Y36H 4FQPA 4IM8A 1VACB 5GGVL 4PTTA 5L8JB 1P53A 4PRDB 2FBJH 4ETQA 3MYJA 5IB2B 2B2XH 1WBZA 4AEHL 2RR3A 5J3HC 2ALWA 4WWKB 4X8JB 1RZJL 2F61A 1ADQL 4M61B 4X6CB 3O6FA 1XCWA 2LQRA 2P49B 2NY4B 4F37K 3VIIA 5ICYB 4M8VA 2P45B 2PTVA 4ZAKB 1CYGA 3W0WA 2OW6A 4UNTA 1KPVA 3HRPA 3BPLC 4J3VA 4P46B 1BGGA 1CGWA 1YEFH 3NCOA 1CI5A 3OHXB 4WO4D 1ZA6B 3SKOA 3C60B 3VCLB 2XN0A 2O5ZH 5E6ID 4D0DA 2XY2A 2WB5A 2I60H 1B6DA 4JE4B 5C0AE 3AZRA 2OZ4H 4FZEH 3L3JA 5CJOL 2GSIA 7FABL 3O41B 4DWSC 3C2SA 1AGCB 1KEML 2I9LA 2DQTH 2V7HA 3GSOB 2ICCA 4WUKH 4IHOB 4F7TB 4E5XA 3HG1E 4DAGH 3ZTNL 2OYPA 3OAYH 4CD5A 5HGHA 2YL8A 5J12B 1R3JB 4YJZL 3IDXH 1IAII 1HSBA 4GSDL 5HHOA 2AJZA 5AYUL 4FZ8H 2CUHA 3QDHA 1T0MA 2EDBA 3QQ4A 2XTJB 1NL0L 2GJZA 2Q3ZA 1F3JB 4PRNA 3NFSH 5E9DD 3QRFM 2GW5A 4M8QB 3BEVB 4QRRE 3ZYIA 3QSKB 3TFKD 1YY9C 1QUNA 5GS2D 2X1IA 5KVDL 2P5WE 2VLRB 5DUPL 3C5ZA 4HS3B 1CL7I 1INDL 2X7LA 4QHMA 1BGXL 1S9XA 2QQLL 1IGCL 4M93C 1FYTB 4K3HA 1Q4NX 4X0VA 2NXYB 4JG0L 2UVFA 1L0PA 2ZUXA 3IJYA 5EA0H 1CGVA 4PYGA 1HHKA 5ENWA 3X14A 3NSXA 2C4XA 5HGDA 4D6EA 1WEJL 5HI3D 4CMHC 3B2VH 1OQXA 4FNQA 2BVEA 3VGDA 2W60B 4JFEA 5A2FA 1HXMB 3RWGB 1AKJD 1LNUB 2D4FA 4K9EH 2XTKA 5C0IA 4UQEA 2VERN 5A40E 2YXFA 4NQVB 2DQHH 4KI5C 1RD6A 2GTWB 2DSVA 5I78A 3GK8H 5INDA 3VXSA 4UZUA 5IVXB 4I3GA 1BAFL 1MFVA 1HQRB 1CENA 7A3HA 5EBWA 5TQ0L 3UO1H 1UKSA 4HU8A 3GI9H 2VQTA 3EOBB 3IDIA 2ZUVA 5F6HI 3D69A 4I48B 4MAYA 1VFUA 3T3PF 3KWWB 1ZHLB 1KIUA 1FZMB 1BYBA 5F9WB 2XKUA 1Q38A 1OLLA 1JBJA 3PG2A 1JNNH 2X9WA 3L5HA 3SGJA 1MY5A 4LVOC 3G5VA 1E6OL 3MBEA 1M6OA 4XV0A 8FABB 5DJ8A 1JUFA 3DUSA 1WC7A 2C1PA 4NHCH 4HHAA 4JPIB 4M56A 3BMWA 5ADOL 3WCYA 1UKOA 2RCSH 5ALCL 5LVEA 2QPUA 3CZSA 2F53B 5EFIA 1SYVA 5GRJH 1N2RB 4HQQH 3D39A 3TO2B 4KDTC 2X4RA 3A4AA 1K6QH 1I8KB 1MAJA 3DX7A 1C5BH 1UCBH 4XCCL 5F7LB 3OF6D 4FN0A 1QLEH 4QHLB 3DX2A 3QDAA 2HH0L 2ZSWA 5HYQA 1E72M 3BRGC 1UWEL 3BT2L 4NBXB 5I8KL 2PNDA 4FXLA 4KI5E 4P9HH 3UCRA 4H1LG 3WLBB 3I50L 4KK8C 2AEPL 1VBUA 4IRJA 2EPNA 3WUWG 2CLVA 4KI5F 3ROLB 1MIMH 2XA8H 1I7TB 4XPAL 3OL2A 4JM4L 4NJ9H 5MP6L 3OKMA 3QOMA 4XZUA 3O81A 4D0BA 4WV1C 1DL7H 4BJLA 3WFDH 3GMMA 1HZHL 1RZ8A 4MNGA 4PLJC 3GBNH 1J9YA 1UYQA 2HT3D 1QNZL 1C08A 3VD9A 4LHJB 3B6SA 1ZJAA 5H37H 5IR1B 5LGJA 1KCRH 3ARXA 3ARGC 2ITCA 3QIBB 4KV5E 3UJIL 5DRNB 1A3LH 4I2XA 1A6AB 2J5LB 5CIPA 3OLDA 1R7OA 2ICWB 4X0KA 3ZSTA 4L1HA 3SDCB 1R3HB 2Q8BL 3MRLA 3EO9H 3QPQC 3WDJA 3LS4L 2Q6WB 4GLRH 3KGRA 3OJDB 4GKNB 2W65A 1NAMH 3TJHD 1I75A 1IQWH 2XFXA 3H9YA 5FO8A 5DD1L 3KPSE 3S37H 5A6BD 2VZ3A 2F5BL 2N7AA 2GK1A 5TGBA 2BVDA 4J12A 4KRUA 3WQWA 4JFYA 3DMMB 1IGJB 1N5YH 4P9MH 1PKQB 1JNDA 3W11D 5FO9A 2VLKD 1A9BB 4XHJD 1G6RA 1FNFA 5DRWA 4EUPG 2E5EA 4S2SA 2XIBA 4HDIA 5GJSL 5D7LA 4HZLA 1IVLA 4B0MM 4L4VB 5JOFA 1G84A 3HG2A 3CPUA 4PS4L 1NP2A 4PRIB 1HKLL 1MQKH 1P5UA 4FNTA 1CZ1A 5CBEA 2OWXA 3G6JA 5I1DB 2YL9A 1FN4A 4NN6B 1TQTA 5ABGA 3AHTA 3CHEA 2EIBA 2HRPL 3FO1B 5DQDH 1WB0A 3BWAB 3P9MB 2H26A 1HHJB 4A2LA 5DJZA 3VXOB 3WHE1 4L8BB 4H8VA 3U4AA 1MJ8H 5C7XH 2C1OA 2D0HA 1JGIA 4HS6A 3WNKA 3RUGA 5IB4A 1NC2D 4NQED 3RZCB 4DZBA 4C7FA 4RFNB 5CD3B 3QGVA 1SEBA 3U7AA 5EB9A 2A3EA 2EEBA 5J4MA 4N0UA 3BPCA 3QI9C 2NXZD 3VRJA 3IFOB 2WBJB 2QHRL 3AS2A 3IETB 4RA0C 3TN0B 3FCTB 3WQ6A 4YHNB 1UJ3A 2Y25A 3ARDC 3P11H 5CPTA 1CT8B 3MROB 4S1DC 3P0VH 1KB5B 4EI5C 4OGAC 43CAA 4AISA 4BUGA 1WDQA 3I9GH 3MACH 5DYOB 3CLFH 3PQYA 1E1EA 1UWQA 1U3HA 2DH2A 3AS0A 4PRHE 4ODBD 2ZIDA 4OZHE 3VWKB 5C6WH 3BEWA 3H2WA 4JN2B 2BK8A 3KYMA 4GJTB 4XCNB 5D7JD 4AWEA 5GSRA 5KEZA 1E0OB 1RHHB 1TQSA 5JTWA 3NDYA 3PTKA 3TEUA 4UT7L 4B50A 5HY9B 3ARUA 3JWOC 1CIUA 1IT9L 3IFNH 4MD5A 3VXTA 1VEOA 4OZHF 1V0LA 3BGMB 5I1EH 1HK6A 4RE3A 4P49A 2XZZA 3HMWL 1E4MM 1EQCA 4YFLI 4NM8L 4YXHL 1ZLSH 4C56D 5JORB 4V28A 3QA3A 2OWCA 2Y5TA 3BDXA 5AD0B 4LRIC 3LKOA 4JREB 3SJVD 4PR5B 2CO6B 2JELL 5DMYA 5KVFL 1XGYH 3G5XA 5T1KA 3JWOL 2HLAA 2YRLA 1CFTB 2EH8H 2JKXA 3FAWA 4FFZH 5DHYB 3PV6A 4FNPA 3O9WC 4PJAB 4U6VL 5HDLA 3UZVB 3QUYB 4O2CB 4WVRA 4YC2C 5FYLL 4NZRH 2VRKA 3OGSA 1X4XA 1P1ZB 4NZTH 4PLNC 3OXRB 2V9QA 4NN5C 1NCDL 2ADGA 2G5RA 2FD6H 1BIIB 1IKNA 2IF7A 1E4NA 4PTMA 1CK0H 4JQVC 4ZFFA 3TJEH 2RGLA 4DTGL 4PY8J 1J9CT 1EFXB 4OQTH 4S0TD 1NGPL 1L9MA 1I85C 3FB6A 4Q9QH 4OFIA 2R1XA 2RFXA 2R15A 3RTQB 2NQCA 3A6CL 4J3XA 3MA9L 4WFED 3VGBA 5EH1A 1NCWL 1WO2A 1N3NB 1UXWB 4KZDH 2G9HB 4CADB 1A1OB 5D9MA 3CU7A 4LCUA 2F8QA 1ZT1B 2Y72A 4QGYA 1UD8A 4L3EB 3AREC 5I2UA 1WWBX 4Y5YB 5DFWH 1EVUA 3HE7D 3MR9A 2XYLA 2CRYA 1JHTA 5BXRA 4JPKL 2AV7B 3W2DH 1RURH 3WF2A 4PMYA 2WMGA 5EOQH 3F7QA 2OXGA 3MRCA 5B3JE 2XN9B 2V3EA 4ZSOE 5FYLE 4S10A 5JIWA 1QSFB 3RVTD 5LBSH 2F1BA 3NZ8A 5B3JF 3DRTB 2YA0A 4NPYB 2PYEE 5FYKD 4UOW0 2B1AL 1UD6A 5EO9A 4ELME 2P5ED 1KGUA 3OKDA 1O7SA 4F7MA 5GGQL 3KL0A 3NACH 1INEL 1Z0MA 4ELMF 4MX7B 4R2GD 4MLSA 4JZNB 4L4TE 2ATKA 1E6ZA 1UVQA 1HJWA 4APQC 1MFDH 3TA9A 1U6AH 5F1NA 5IESL 1JTTA 4ODSL 5LAXB 1YJDH 3KLLA 5CD5C 1I1CA 4AL8L 3N9KA 2WZIA 1JV5A 2XZAL 1RP9A 1TVBA 2GJRA 9CGTA 4EN3C 4IPNB 1YNKH 1W72H 1U93A 5H94B 5J9PB 3SDXE 1W9DM 3OBAA 5C0CD 2V9RA 3CUHA 1QACA 2ZCKH 5KZCD 3DRQB 4WJXA 3SDXF 4EBQL 2YR3A 3IS0X 1UR1A 2YBRB 4QT5A 3OX8A 3U7VA 1D7FA 1VSCA 4TUKL 3TCLA 4HA4A 1FIGH 3QDMA 4NNPL 5EORL 4FFWC 4PTXA 4Y1AB 3WHXA 4HIXH 2OTWB 4D6JA 1KIQB 2G2RA 1VACA 3PE9A 1OAZH 4I3RL 2VSCA 5ANMB 3ROOB 5IFTA 4PRDA 5F7EH 1GGIH 3VXRA 5IB2A 2D2OA 4WWKA 5H2BB 3D51A 1QX1A 5I1GH 4KDVA 4X6CA 3HC3H 1LMKA 5HHVH 1LQ0A 5CGYC 3VDBA 3VIGA 4N8PA 5ICYA 1FBIH 2LABA 5EO0A 1KLUB 1OQOA 3PL6D 3SE9L 2OYKA 3LH2H 1HKFA 4H2CA 4P46A 4BK5A 5I1AA 1J0HA 1NFDB 1ZA6A 4NRZB 3C60A 3VCLA 4Z7UE 3JUZA 2R0LH 3LY6A 4YGAB 2QQNL 3OXSB 1GOHA 2A2QT 3B5HA 4Y5VB 1FPTL 3WL9B 2WKLA 3DIFB 3BESR 4GBXD 5GNZA 5C92A 3V6FA 2D7TL 3O41A 1BP3B 1K5NB 4Z7UF 1AGCA 5M95B 4KVCH 4N0FB 4IHOA 3ZSSA 1HSAB 4F7TA 5GSVA 1IC1A 5IBUG 3CLEL 1R3JA 4UFKA 2ZX6A 3BYTA 2QF8A 2ED9A 5FYJH 2CR6A 4LASH 3UTPD 3EYUH 3QDGE 4MA8H 2UWEE 1GL4B 1HKIA 3X17A 4XZBA 4RMTA 4M8QA 4GQQA 4XVUD 3BP7A 2VLRA 2W07A 1FNSL 3BQUD 4MSWB 2UWEF 5KSBA 1E4KA 1X4YA 3WFEH 3OJMB 4HS3A 1S5HB 2WW5A 4P2OC 5K9OA 1KSRA 3ZL4L 3UJTH 3ULVD 3WH5A 1XIWB 2VDRL 3PIQB 1FYTA 4I0CC 4JO2L 2ZXBA 2VLJE 4ZXBB 1J10A 2FLRT 3WDHA 3NAAL 4H26A 1Q9KB 1ZHKB 2NY3C 3WV0A 4Q0XL 1A7QH 4MZ3A 3RWCA 5F96H 2BNRD 1FH8A 3IKCB 3VG9B 5C0NC 5F71A 3Q2CA 3VU2A 5HYIA 1H0GA 2W60A 4NJAL 3AROA 1HXMA 3MLYH 1LNUA 3RWGA 4UTFA 5FDYA 3KDMB 5I73B 1F4AA 1P4BL 4OLEA 1DQDL 4NQVA 2HISA 4XBPB 5I71B 5F9DC 1W2KT 3D0LB 2GTWA 4QXGL 1CDCA 3RGVB 3STZB 3EO0A 1R8LA 4GAJL 5D9SB 1KGCE 2QQKL 4DGIH 4DKEL 3VI3F 3DDGA 2CKBH 4OLYH 4LIQL 4CU6A 1C3FA 1HQRA 1SBSH 1TVPA 2CK0L 2JLLA 5FOOA 2YWYA 2VX4A 4MS8D 3STBA 4XP9L 3QEUA 4Y4KA 5A1AA 5JQ6H 4I48A 2DLIA 3KWWA 1SVCP 1ZHLA 3CNKA 4HXBL 1FZMA 3MLZH 5JXAH 3NCBB 8CGTA 4JY4B 2VUYA 4CVWA 2VKWA 1I9IL 1C92A 1NGYA 3BZFB 4PP2A 5C1MB 2FR4A 5ISZB 4YIQB 5L2KE 2XYCA 3CZEA 5E6IB 3N1QC 3NYDA 2C7UA 4R7DB 4GPNA 3Q3GB 4X7EC 8FABA 4UFLA 1S78C 2OTUB 1YEJH 5SWSD 4XVJL 3OZ9H 1UM5H 4IMKA 4TVPL 1R85A 2UY7A 2F53A 2OSWA 5T1LA 2FGWH 4N8VB 4MADA 3F5KA 2VAAB 2CBUA 3KYKH 1N2RA 3UXFA 3TO2A 1EOKA 4B3KA 3L3GA 1I8KA 2A74B 2PO6A 5E2JA 4FQLL 2HFEA 4HPGA 5BXFB 3KPPB 1KR1A 5ABHA 4DQOH 4KMTL 3HPJB 1NEZG 4QHLA 3QAZC 3GSNH 4LIQE 3MLUL 3DX6B 3N06B 4I0PB 2HN7B 5ECJE 1XSKA 1J0KA 4LBEB 3CZNA 3D9AH 2EEXA 3IU3B 3TVMA 3OPZH 4XNXL 4M7JL 4ML4A 4V27A 3O3BB 4X5WB 3ROLA 2HAZA 5DZNA 2AK1H 2BOCB 2VDQH 5I1HL 2J62A 1JPSL 1ORQA 1AKJB 5GNYA 3MLXL 4R5EA 1WJ3A 5BRPA 4OAWB 1MFEL 3VGAB 3MSGA 2HT2C 5SX4I 1F4YL 1FO0B 4NSBA 1T7ZA 1XGPB 1YDPB 4P3DB 5BVJB 5IR1A 1P4IH 5AZEL 4QRUB 1DBAL 1LO0L 4TTDC 3QIBA 4TVPE 5DRNA 1V8HA 1KXVA 1KQYA 1A6AA 2YUWA 5C71A 1NCCH 2CHOA 3GHBH 3VFMB 4CMMB 1C5DB 1DQML 2WSPA 3SDCA 1MEXL 5FGCB 1R3HA 3FONB 1XCTA 4WI6A 1UADC 2Q6WA 3KYOA 3OJDA 1RIHH 1C5CH 4ZS7L 4GKNA 2UZIH 3BH4A 1FFPB 1ETZB 4M3JA 5CJQH 3MTRA 3RU8L 4W5UA 4HX1B 4UOJA 4MD4A 3EHBC 3DMMA 4C59B 1AFVH 2A3HA 2EIEA 1DN0B 3S5LB 1L7IL 1A02N 2OS7A 3OV6A 4NSKB 1ESWA 4W4OA 4YHZH 3WMCA 5T3ZH 4MJIE 2V7NB 2R69H 4L4VA 3S88H 4J1UB 3WXVH 5DJAA 1NBYB 4P7RA 2NY6C 2QADB 1RULL 1UM6H 3RWDB 5I1DA 3MRJB 4JFUA 1A3HA 3U4BH 1KJ2H 2OP4H 3CCHB 1B90A 4J7RA 1MQRA 3BWAA 2XGIA 3P9MA 1HHJA 1BZ7B 4KKAD 4AZ5A 3VXOA 3LN4A 3WSQL 4L8BA 2XWTB 5JIIA 4BCEA 1DR9A 1F42A 4OIIL 5C09E 1NPUA 1UH2A 3GSWB 3RZCA 2PXYB 4F57L 4V1DD 1CN4A 1KPRA 3GGWB 3EJYC 5IW3A 1D6EB 1TZHB 4JR9L 1Q72L 4AEEA 3GBML 1H3VA 4P23D 3HUJB 1TDQA 4OKVB 1QP1A 3IFOA 2WBJA 3IETA 3TN0A 3FCTA 2VXUH 3CVHH 4QHUB 3E8UL 3MROA 1CD1B 2VXSH 2OCFD 4QEGA 1YEGL 4CNIB 3K2UH 1HKJA 3MV01 1KB5A 3GNMH 2N56A 5DYOA 3MUGA 1Z0NA 3QG7L 3TPUB 3B2UC 4LSUL 3VWKA 1O7DC 2CR3A 2E7HA 4JN2A 4FQQB 4LYPA 3HZ3A 1UC6A 2AV1A 2EDNA 4UTBH 5K9JL 1G01A 1UEMA 4JEGB 4XXDB 3UAJC 2ICES 3BMVA 3FRPA 3L9RB 1ITBB 4EIGB 3BGMA 4YDVA 1WZ1L 2XQBL 1GZPB 4FQIH 4R26L 5FGRA 4IJ3B 5JORA 2VZVA 4NM4H 4H25B 3AC0A 2W5FA 5FHAH 1WLHA 4PR5A 3DX8B 2PWGA 1KELL 3SCNA 4R8WL 5GXBB 3CC5B 3DETD 4B7LA 5I79A 5BRZA 3K8LA 1CFTA 2F18A 3RRQA 5DO8A 4UBDD 5DHYA 3TPKA 2CHNA 2BHUA 4PJAA 4PJIB 5DMGD 3QUYA 4O2CA 5E99H 2VDKL 1NC4B 3BKJL 1GHFH 1KCUH 1VGEL 3HG1D 3OLGA 4JCLA 4H20H 1P1ZA 4PJEE 3OXRA 1WWAX 1E9LA 3E2HB 1TVHB 3WD5L 3HG5A 2EDJA 2YRZA 3C9NB 1BIIA 3V95A 1QI3A 1KB3A 1WFTA 4PJEF 1BEYH 4HG4K 2VRJA 3Q5TA 4PLKC 3HNTL 2VAJA 3G08A 4QRRD 4CUCA 2VZOA 2NW2A 2OTPA 1EFXA 1X5KA 3DJ9A 4KDWA 2P5WD 3DYMA 5AC4A 2AABL 1I4FA 5KVEH 2DSZA 2GJ6D 3RTQA 1NC2B 4TPRL 4NQEB 1N3NA 2G9HA 4CADA 1SR0A 1ZT1A 3QIUD 4C7DA 4JQXA 4L3EA 1LEGA 4JL2A 2A9MH 3PWNB 5GS0H 3HFML 4UNVA 1YUHA 4Y5YA 4XHQA 1R47A 2DBLH 1J0IA 1UZ6E 1NSNH 5KBNC 3SBWA 2W4XA 3QCUL 4KHXH 1P84K 3UC0H 1B3JA 2FSEB 1ZL1A 3BAEL 3O6FC 1HJQA 1I8IA 5BW7A 1ZB5A 1UZ6F 4LCIH 3KXFE 2CGRL 4NBZB 5EU6E 2QSVA 1S7XB 2PUQT 2XN9A 3T2QA 5D7JB 3U57A 1QSFA 1AGEA 3EJQA 3IDNB 3BUBA 3DRTA 4JO3L 4XWOC 3I2CH 2H41A 4NPYA 3OR6B 3MS8A 5MENA 3L4WA 1GOMA 4DWSD 4O5LH 5GZOC 3SJVB 3SO3C 3ZKSD 1U8OB 3H9SE 3CFBA 4MX7A 1E6JH 4JZNA 3VFNB 2XSAA 1OAYH 3U9UA 3GSRB 3MXVL 4XPFL 1D5BB 2EBNA 3S5ZA 3HG4A 2DIBA 4P57B 5LAXA 3MCKA 4XNZC 4ZUUB 4MVBC 4QCIB 2DQEL 3GKWL 4OZGA 3Q5OA 1YYLL 1OTTD 4WI9A 4Z8FH 5H94A 1J1XL 3BI9X 4K3JL 4RISL 1JZ6A 3OJ2C 5A95A 4G8FB 4GIAA 2VZSA 3C5ZC 3O6LH 3VI4E 4ONGH 2Y07L 3RAJL 3DRQA 3BN9C 2TAAA 2CCRA 3ORJA 3SCTA 3V0VB 2YBRA 1JMZA 2AEQH 3VI4F 3QEQE 4PFEA 4Y7MA 4O4YL 2X9YA 4JFWA 4PBXA 3UYOD 1MH5B 4D6CA 2OTWA 4HTYA 5JMRA 3QJFB 1KIQA 3SKNA 2ZWZA 4MD0A 2IJ0C 5ANMA 3ROOA 1UG6A 1AXIB 2G3JA 4YPGA 4KI5D 1KXHA 2VSDA 4F8XA 3L3IB 4PJFB 5I0DA 3QWRD 5H2BA 1XH2A 5ALBH 4DGYH 4ATDA 4GW4A 3UG4A 2VURA 2FHFA 3PXJA 4AJ0A 4JKPH 3PHQB 1PVHA 2C8NA 4H88H 1CDBA 3CK0L 5DDHB 1AGBA 1G0YR 1KLUA 3NCFB 1RH9A 1CLYL 4Y4FD 2AJYH 1EDQA 4NP4H 1NFDA 3OKNB 1C1EL 4TSBL 2NSXA 4MAYC 4DVRL 4IDJL 4CKQA 1JZ3A 3V52L 3OXSA 4KKBC 5FAAA 3WL9A 3DIFA 4NQDA 5EZOL 3DSNA 3FHAA 3G6AB 1K5NA 2FH6A 4NUGH 5TE4L 2LU7A 4JRXB 1UR2A 1KXQE 4N0FA 1ERNA 5A2BA 3VDHA 2HLFC 3SGJC 1XFPA 5HHOE 1VPOL 3MBEC 3GNPA 3BO8B 4L8DB 2WCAA 3F5LA 5A8PA 1G9MC 3C08L 3LQZA 4HIEA 1RI8A 1IAIM 3DSFL 1RMFH 2PW2B 1MQQA 2X0HA 4DM2A 1FFRA 3KPSD 3RVUD 5EN2B 5FL0A 3VO0A 1G9ML 4ACPA 1NWSA 2F54E 3VD7A 2VVSA 3AAZB 3E1F1 1KFAL 5MEOA 4OI8A 2VCCA 4R97C 5IXEA 1XIWA 3WH9A 3PIQA 1J5OH 2R2BB 1Q1JL 4ZXBA 5M03A 1Q9KA 1ZHKA 5DQJB 5C0CB 4DGVL 4F9PA 4JFEE 3IKCA 1OARH 4EI6B 1P69B 3IDMB 1VFFA 1FE8H 1WAAA 1ACYH 1F8TL 2YN5A 5DR5H 3HMXA 4IRJC 3D0LA 1AY1L 1CGYA 1PSKH 3VXSE 4PYSA 3RGVA 5JPMB 2JIXB 1J0JA 2GCYA 3RVXC 1ZBKA 4J3UA 2GUOB 2NT0A 5DEZA 2ZWYA 3QT2A 3L5IA 4UILL 4E8CA 1ES0B 4PLJD 5B39B 1EEYB 4LCWE 4DOHE 5GHWH 1EK3A 5MI0C 3BZ4A 1FHGA 3A67L 3U0WH 5HI4C 2DIEA 3QCTL 4GMSH 2LTQC 2CLRB 3ARGD 4POZC 4RNRA 2EZ0D 1R5IB 1A6UL 1HP5A 2APBA 4ONFL 1PIFA 4EDWL 3TBVA 3PL6B 4JY4A 5M5DA 3PV7A 4WIQA 3I85A 3AUVA 4OLXH 5AAWA 3C5SB 3BZFA 1OTUC 3G6DL 4WO4A 1FL5B 5ISZA 1JXKA 4YIQA 3WKMH 2JK5A 5E6IA 4R7DA 2I5YL 2IXUA 2A9NH 3K4ZA 3Q3GA 3ELAT 4LXFA 2V38A 2OTUA 3RPMA 1H4PA 1A14L 5JIKA 1E71M 1DANU 3ABZA 4QOKB 1QLFA 2NY7L 3MRDB 3D39E 3J7HA 2DLFH 4XPHH 4N8VA 2XPKA 1GQIA 2VAAA 3CX5K 2XKSA 2YPKB 4U1GB 5IMKB 4IBLT 4K3DH 1A6TB 1CLZH 5D1ZD 4U1LA 4M48H 4XZWA 2DOCA 4K7PH 1HQ4B 4ODUB 1EXUB 2IEPA 2OJEA 5I66B 3KPPA 5DZLA 5JPNB 3DPBA 5CUSL 2MKWA 1FVCB 5EWIL 4YEFA 3DX6A 2BVQB 1CNVA 3AXHA 1CGSL 4LBEA 1J7VR 1H3TA 1YQ2A 3MUHL 3LRGA 5BQ7B 1EZVY 3IU3A 5CZVH 2EADA 4HWNA 1G6RL 1P6AB 2XWBA 3BPNC 1GGCL 5D6CB 2F8XC 3P0GB 1TTFA 1OAUH 2V5MA 1UR9A 1NCAL 3O3BA 3C6SB 4M43H 4X5WA 5F7FA 1MVFA 2Z93B 1LK2B 2EQDA 2GEEA 2BOCA 5HHXL 5D4YA 2XVGA 2EDRA 1W3HA 1AKJA 5EBMB 5GZNC 2VL5A 3T77A 1UKPA 4YWGH 4MNGE 5A3ID 3QI9D 3WUFA 3DX3A 4F37F 1CDGA 1KV3A 1VDGA 4YHIB 1VFMA 4QKXB 5J0BA 2BP3A 1EUTA 1FO0A 1QBMH 1QNSA 4P3DA 4S1DD 4I2XE 4M7LT 1UJ3C 4AG4L 3W9EA 4QRUA 1BFVL 5IB1A 5TPWL 4MCZB 3BCDA 1MCSA 3MPCA 4JG0H 3WIHH 3Q6GL 3VFMA 1C5DA 1U3HC 4XBEH 4HIIA 1K3ZA 3FONA 4JO4L 2EDOA 2MNUA 3SCSA 1V3HA 1JPTL 3ZR6A 4XMLH 4JG1L 1T1WB 3CUGA 5ICZB 1RZKC 4WUUD 2AK4D 4JN1H 3FN9A 3IRPX 1FFPA 5CP3H 5D93B 4Y2DD 4DK6A 1ETZA 1ED3B 1WSST 3PGDB 4JHWH 5IK3B 3FB7A 2YZ8A 4OUOA 3EMZA 4HX1A 3VA2C 5FYLD 3REWB 1JGUH 2NY1D 3QISA 2DDQL 3FRPG 4LX4A 1RZKL 1DN0A 2PYED 5D7LE 4NSKA 4P7NA 2AEWA 4DN4L 3BISA 3O9WD 4OCWL 4C83B 1PAMA 2V7NA 3ILQD 3G6JE 4RWYL 4ZFGH 1NBYA 2YD9A 4G43B 3P4NB 2IGTA 4Z7VB 3RWFB 4JFZL 3RWDA 3RVVD 3CCHA 4U0RC 5ITBL 3G6JF 3IFPB 3OF6A 2JIEA 1CLOH 1BZ7A 4NWTH 3RUGE 2VTFA 2YD8A 5A43C 3ZJ6A 1EBAA 4I18B 1IKNC 3GSWA 3MZTA 3CLWA 2B4CH 4FS0A 1XF1A 2PXYA 3RUGF 4HF5L 1NGZB 1N4XL 4N0UE 2X1OA 4J28A 1N82A 1P6WA 3GGWA 1D6EA 1TZHA 4OLUH 3W5NA 3MMEA 3HUJA 1KB9J 2GT9A 5KAQF 5CSYA 4OKVA 4RAVA 2WLYA 4GI8A 3WY4A 4QHUA 5JW3H 2DT3A 5E6ZA 1CD1A 3PQYE 2Q76B 4UOZA 1UD5A 1T0OA 5FCUL 3MUAA 4OD1H 3NIDF 4P2YA 1W9BM 1MAML 4G6JL 3TPUA 1JPFB 4D94A 5I1CH 5IT2H 1HXKA 4K3EH 1DWAM 1NCTA 1I3RB 3CMOL 3NSMA 4XXDA 1QWUA 2UZXB 3SHSA 1JRHH 4NKOB 1CE1H 3NTCH 3WYRA 3W37A 3L9RA 2ZKHH 1KIRB 4PCTA 4XCEB 1GZPA 3O2LA 4YXLH 4NO0D 5JZ7C 4GXPA 5HDQL 4H25A 1G7QB 3DX4A 1AXTH 1TPXC 1YMMD 4X98B 1LEIA 4O2EA 1FGVL 4MB3A 5FKAB 1U8HA 3DX8A 3MC0A 4H7VA 2GQHA 4MXWL 2JJVA 3CC5A 3BLKA 2CSPA 2KKQA 4ODTH 5E0FA 1URLA 5E2VH 5A6BA 2W0LA 3QQ3B 4M7LH 5HHQB 1UD4A 4PJIA 4APQD 4DEPC 5CSUA 1VEMA 5GRXG 2VLKA 1NC4A 1GPOL 5D7IA 4N90E 1W32A 2D7NA 4Z0BH 1WKYA 5DK0B 4GG8B 2F5AL 1N5AB 4Y16B 4E8DA 4YQXL 1VF8A 5C0FB 3C9NA 5SV4A 1CXHA 3QDGD 2AJSH 4PGEB 2IH1B 4JAMB 4IOIB 4HCRA 4O02L 4QRTB 2D1ZA 4AZIA 5J7CC 1K9TA 4IRZH 4UV4L 1OP5K 1ZVSB 4RMSA 4JM2B 4JRYE 2E27H 2MPAL 4JB9H 1NC2A 2IG2L 4NQEA 5IW6A 5DJDB 5LXGL 5I16B 4V1DB 3SE8H 2VLJD 2OYMA 1VFAB 4P4KB 5ILTH 2DQGH 3LKNA 1FH9A 4RMVA 1SJEB 3PWNA 2CITA 4W8BA 2EE6A 5CJ8A 4LP5A 5LA1A 2VH5L 5JW4R 1EUUA 4J23A 4KRPD 3GYCA 1T1YB 1A3RL 4WWKC 4XNUH 2KDGA 4WSKA 2R1YA 2FSEA 3F7RA 3SDAD 3PZVA 1F4XL 4KGLA 1KGCD 2NY4C 2PF6A 4IOFD 3FQTB 1S7XA 5KJRH 2DLGA 1CLVA 5D7JA 3RHWK 5IHUH 6FABL 3IYLW 3UZEA 3IDNA 1YYMH 4AZ8A 4P46C 1CU4L 5BROA 1D5IL 4PP1C 3C60C 3OR6A 3F65A 3IJHB 4HV8B 3IJ7A 2A0LD 3QUMA 2F2HA 4LSTH 5D96C 3P4LA 4Q74A 1DUZB 1F4WL 1KYOK 1T7VA 3TO4D 3SJVA 4PUBH 3TM6A 3QWOB 2V5TA 5BZDB 3VFNA 5KSAD 5E8EB 4OCXH 3GSRA 4M82A 2VQUA 1D5BA 2HKFH 4KUZH 2DQUH 5SV3A 4P57A 2KBGA 1D5XB 2PETA 5I9QB 2OMBA 2X41A 1G7MA 3RWHA 4ZUUA 4MQXD 1FC1A 4QCIA 4HGMA 1U36A 4HPYL 2XTJC 3FOLB 3QDJD 2AJ3A 3MLVH 4OFYD 4B9YA 4UQBA 3TONA 4P2OD 5IROC 4G8FA 4XAWL 1AI1L 1E4KC 4R4BB 4TN9A 2VITB 3QEHB 3VX0A 1Z9LA 3GI8H 1YHTA 2NR6C 3V0VA 1N64H 3QDME 2EYSB 3OAZK 3BSZH 3ULUH 5GGRY 2DLTA 2FH8A 3QEGL 1A2YB 3AMDA 1KC5L 1MJUH 4HZAA 4CVUA 1OB1B 4AZGA 1MH5A 2H45A 4DKAA 1GIGH 4ZUSB 2GJ6B 3VXRE 3QJFA 1UD2A 1BM3H 3PGCB 1N8ZA 3MU7A 3WLWD 4X6CE 4PJFA 5CEZL 1QBBA 5AWNH 1T0NA 3QIUB 4PCSA 4JGUA 2UWFA 1QNQA 1OCQA 1K9EA 2Q86B 4X6CF 3PHQA 3DVFA 3LZFL 2O5XL 4L1DA 1OGBA 2I25N 3RNKB 3U79A 5DDHA 5DFVD 4G7VH 4KK5C 5F7HA 5DGQA 2UYLA 2FB4H 1A6VL 3OKNA 4P3CH 5TF0A 2V17L 15C8H 4GUPA 1U9KA 1YNLL 3TA3B 3F58L 4OV5B 3NFNB 5F9WC 4M5YH 2YK1L 3G6AA 2H3NB 1RPQA 5I1LB 3THCA 4JRXA 2JTDA 3TNMA 3DHUA 1GC1H 2Q8AL 2F58L 5D5MB 3BO8A 1S3KH 3G9AB 4LLAA 5JHLH 2FO4B 4FNLH 4ODVL 4ALAL 2DT2A 2XTJE 4P5KB 5CPSA 1FL6B 2PW2A 4QHNB 3VMPA 4PMOA 3C09B 2R4SH 4CRPA 5DD3H 2NY2B 1ISVA 4IMKC 5HNNA 2IPTL 4CGTA 4GXUN 2BRQA 2VLRE 3BKCL 3A24A 3IF1B 5ESVA 1IGTB 5A6KA 5E1QA 5EN2A 5JOPE 3N9GL 1FYTE 3AAZA 3WJLA 4PRPB 3QR3A 5CEZE 2G5BB 5KSBF 2P43B 2PO6C 2XSBA 2QSCH 3O3EB 2R2BA 2VN7A 4N8VG 2YDQA 5DQJA 5C0CA 4YUEH 1TQCB 2XI9A 1QRND 1ZANL 1OSZA 2BY0A 1VENA 1QFWL 2E6JA 4Q97A 2A73B 2H2SD 4EI6A 5JXEA 1NEUA 3IDMA 3TVMC 1AD0B 1BQLH 4TXEA 4AIOA 2V5DA 2QKIB 4XB3A 4N5EC 5F1IB 3X13B 1DWHM 1VEPA 4JDZB 5IVXE 5JPMA 3K1DA 5D7KE 1V08A 2GUOA 1QG3A 4UT6L 4XCYB 1OTSD 3PWVB 2EE9A 3WE6B 2ADFH 2HT2D 3HC4L 2J47A 3MUJA 3JV0A 1YEIH 1D5ZA 4YDIH 3S35L 3KEHA 3O6MH 3BRDA 2CLRA 4P0DA 5GS1A 3ZZ1A 4IRSB 4OF0A 2DTSA 4H0GA 4XPGH 1BX2A 3L5XL 3PL6A 3QIBC 3SCMD 1KXVC 1GORA 2J5LC 4U1KB 3S36X 2ORBL 4LQFH 1I9RL 2XZQL 3C5SA 4I4WB 1MW1A 4GZJA 1UM4L 3SDCC 5EPMA 2JALA 2JB5L 1RP8A 5JA9A 4UT9L 3CSPA 1EGJA 3CTTA 2DB8A 3ARTA 4L8SB 1KTCA 5BXSA 2EEAA 5BV7H 2F53E 5I15H 4PJ5D 3BAIA 3VIPA 3CMGA 3LAFA 1YEHL 4QOKA 5EU5B 4YHOL 1U42A 3MRDA 3KYAA 3BXNB 3VDAA 3HNVH 4ZOBA 3JV5A 2YPKA 4M6NH 1MFCH 3DMMC 4XB8A 5IMKA 1Y6KR 1K8IA 1A6TA 3P4MB 4QWWC 3ARBD 3HE6D 3EOTL 4W4OC 1S7TB 3WIIL 1HQ4A 1ZEAL 1ISZA 4LEOB 1EXUA 5I66A 3VFSA 3WD2A 3AHZA 2EH7H 3H6JA 4LLQB 4AZ7A 3T8XB 1EJOL 1FVCA 3S5LG 3RBSA 2BVQA 1JFQH 4K23L 2VR4A 4NN6C 5AEAA 4LSPL 1KENL 1LO2L 5BQ7A 4XX6A 1HEZB 1R34A 4IS6B 3D18B 5D6CA 5I2IB 2R2HB 3EJPA 5BXPA 3C6SA 3CLEH 2Z93A 1A0QL 4GH7B 1LK2A 5C6TH 3RZCC 3MA7B 4LOUC 3TH4T 1N59B 5LCVL 3P0YL 43C9B 5EBMA 4WKFA 2C4FT 1UWTA 4CW1B 3F7YB 1PPIA 4MAUL 1JHLH 4KPHL 5L6YH 2QHAA 4WHTB 1YNTB 4YXKL 3LRSA 2WBJC 2EABA 2AJXL 4JQIH 3TN0C 2QV2A 5AAMA 1IGFH 3Q5YA 2D73A 2VXQL 5BO1L 4RWHA 1QHOA 3U7BA 3GJEB 3CZ8A 3BUYB 1MHPH 4J4PA 4JGMA 1DZBA 4Z5RB 3VWKC 1RVFL 1LWJA 2C7FA 5J11B 5EMYA 1T1WA 1U3YA 4NCC2 1XC6A 5ICZA 1NAMB 1BYAA 3S36H 1M03A 2VZTA 3UPRA 5BYWA 1KB5L 3SGEI 2VDOL 1ED3A 5IK3A 1RUPH 2FL5B 2VC2L 5FGSA 4I77L 2OR9H 1FC2D 4PLOB 1PKQE 4JREC 5FYKU 1MI5D 4MZ2A 4M6OH 2CPUA 2CRIA 3GHEL 4K07A 4X7CC 1KNOB 1XGZA 1D5MB 5DHXB 4L4VE 3TV3H 2F7RA 3FFDB 4FFYL 4Z77A 1Y6MR 3CZJA 1AGDB 2DRUA 3FZUC 4RGNB 4C83A 5J1TC 1LDPH 3IVKB 1MCCA 1LWRA 4AY0A 4G43A 4ZFZB 4LSVH 3P4NA 1H15B 1R3IL 3QUYC 3RWFA 4Z7VA 4FLOA 1NLBH 2YSSB 4M1DH 1BMGA 4LRNL 2Z31B 2WIIA 4Z2KA 3VVGA 4PBGA 1CICD 2ZG2A 5T1MB 5LWYL 3M8OL 5DVOA 4O9HH 3U46B 2HVJA 4QTIH 5TE6H 4NYLA 2QPSA 4I18A 4UINL 3B3IB 4PLKD 1X4ZA 1CZ8L 2VN4A 1ECEA 2FX8H 1BGAA 4XVJH 1OP3H 1NGZA 1UACH 1N6QH 5LYRA 4W7WA 5I19L 5HXMA 3QWQB 1A3QA 4OUUB 3FT4A 3RTQC 4FQXD 1ZLUK 1BQHB 2ICWJ 2WZPD 4ZS6D 4MNHB 4HUWB 1TMCB 5A94A 4BQ6A 2VR9A 5MEPB 5I6XC 2OSYA 1W0WB 4G8IB 4LDEB 3LQAC 1IMHC 1B0RB 3QEQD 4QXUH 2CJUH 1JZ7A 4JQXC 1Y6NR 2Q76A 4TULL 2O9PA 2YUZA 5AUMB 4Z2LA 1PLGH 4Y5YC 3CZGA 3AOFA 4GRWH 1MF2L 3HZKB 5A2JH 2N4IA 2EPOA 1V03A 3EIFA 4YDJB 1DVFD 3K3QA 1KCKA 2B20A 5DJCB 4HWBA 1I3RA 3LQAL 3BCFA 4NKOA 4U1SB 1T5XB 1ITCA 4ZTOH 3L3DB 1T20B 2UUDK 5BW7C 2YL5A 4ONHB 1KIRA 1HWWA 3PWLB 1FAIL 4BQ8A 1W9XA 3B9KD 1LL4A 1U8KB 2EDTA 1G7QA 4X98A 5FKAA 4WUUB 4XI5D 2AK4B 5DJ0B 5IHZB 3GJFH 3JTSA 3BVXA 2VLME 1CCZA 3VXPA 3CC1A 4IUGA 4PJAE 2QL1A 1AHWB 1RZIA 3QQ3A 3G6LA 4LNRB 5LQBH 3CFJB 2NY1B 5HHQA 1BLIA 2XWDA 1SJXA 2WMPA 5I76B 4HGWB 5L8KB 2ERJB 2WQRA 4PJAF 4HH8A 4UOW1 4F80A 2OI9B 1N0LA 4YZFE 2EE3A 5DK0A 4GG8A 4NO3B 1DBBH 1ZHBB 1N5AA 3BGFB 4WJ5A 5C0BD 2O9RA 5C0FA 1LK3L 3D6GA 4GKSA 2VIRB 3BIAX 3EJZD 4YZFF 2NYYC 4PJXB 1JHKH 1SZNA 4NT6B 4HULB 4AZBA 2IH1A 4IOIA 4QRTA 4HJ0D 4LVEA 5BVPH 4NC2B 1A7PH 1H8NA 3D87B 1QSED 1YA5A 1F58L 3ULSB 4QXTB 3PZTA 2B39A 1G0XA 1V3KA 2F54D 4XP1L 1G0DA 4MNQB 3GSQB 4X7SH 1XF5B 2VDPH 4OQ1A 4CN4A 2VZUA 4YPJA 5DJDA 2VDLH 4L3EE 5I16A 4PJ8B 4V1DA 2LU4A 1ODUA 1U92B 2XN2A 1VFAA 2W9DH 1TZIB 4P4KA 3MQIA 4DW2L 4HJGB 2WQ8A 3LEYL 3D5OF 4P23A 5L9DL 5IBLC 2ZCLL 4D6HA 1HH6B 5IWLA 5C0EB 3QCVL 3DGGA 2X4QB 1UZ8B 5CCKH 5DI8A 1F45A 4A6YH 4NWUL 3EDJA 1T1YA 3NCYP 4I3SL 2I07B 4PGDB 2R0WL 2YD5A 4MXVE 4TSCL 3JXAA 1OWQA 2XN9E 5I1JH 2EIZB 2ZJSL 2ZX5A 1W3JA 3DDFA 1QSFE 4ATLA 3FQTA 1RUKH 3SGDH 3ME0A 4L29A 1A1NA 3WFZA 3KLDA 2VISA 2ADIB 2RAMA 4LCWD 5MENE 1EV2E 4NZFA 1Z5LB 4KKBD 4PJGB 1CS6A 3ZKNC 4HV8A 5T5FL 4Y5VC 4R0LB 1FGNL 1NMAH 4NN7B 2VRQA 3WY3A 1DUZA 3I75A 1Q8MA 4PGCB 3VG0H 1YMMB 3QWOA 1E4WL 5BZDA 3T0EB 3FQNB 4Q9RL 5JNYB 2EXYC 4XMKL 3MJ9A 4NO2B 4DO4A 4OZGE 1H8SA 4NCC1 2ENYA 3WUBA 3L2MA 3FOLA 1DDHA 4OZGF 5ID1A 1W72B 4LSDA 3D39D 4GAGH 2KQMA 3HG1A 1JCKA 4AM0B 4L5FL 4NZJA 3SUSA 2XZCH 4K8RC 4OZ4B 3WS6A 2VX7A 2VITA 1F5WA 3DBXB 3THDA 1B3ZA 1XIWC 2B0SH 3RX7A 1QW9A 2EYSA 3WNOA 3N1PC 2Y6SC 4Y1AE 2YDRA 4ZXBC 1IM3B 1A2YA 5FUZH 3V6BR 4F9PC 5ANME 4K8RL 3D3VB 3VG9C 1KBKA 2ESCA 2WC7A 3QO0B 4ZUSA 2GJ6A 4XNYH 3OG2A 2DQCL 2P44B 1UENA 4NOBA 2AQ1A 2JF7A 3BYYA 3ARZA 2R29H 4ENEC 1WTLA 4QF1A 3QIUA 5I71C 5KN5B 3U2SB 4HIJA 2B5IB 3RVXD 3RGVC 2Q7YB 1RUAH 1LO3H 2XJ7A 4LSRH 2Q86A 4OCLC 5CQ1A 4OGZA 2L4OA 2AAAA 1NCBL 2ZCHL 3R1GL 1PEWA 3RNKA 3G6MA 1NFDE 1U8PB 2R0KL 1QKZH 5I8EB 4RCAA 3AS3A 2EDLA 3SDAB 1OAKL 3HMXL 4NQDE 1NFDF 4JFXB 4LKCB 5CPQA 1LEKB 2WHKA 3BE1L 1RIVH 4I5BA 2OZ4A 4F3FA 4OV5A 5DMIL 5B39G 3NFNA 4G7YH 4L4JA 1MW2A 2H3NA 2KZ1B 4ELKA 1PS3A 2B1HH 3A21A 2FYYB 1VFBB 4WO4C 4RFOH 4JY6A 3KLHD 3WDRA 3PZ9A 2BSTB 5E6IC 5K9QG 1EOMA 3BZEB 1GHRA 3VIJA 2FO4A 4CDGC 2HVMA 4TYUA 2BHZA 4DWSA 4P5KA 3TO4B 4QHNA 2MCPL 1ZHNB 2BERA 2APXA 4D0CA 2QQQA 4QRQB 3EZ8A 2X44D 4KMQA 2DQDH 2H6PB 3BAEH 2BY3A 1MHHB 1IGTA 2VE6B 3RKPA 5TFSL 1IC4L 1OM3H 4HS8H 4FXGA 4JPVH 5C2BL 4LAQH 2BDNH 4PRPA 5E03A 2X6MA 3K1KC 1CD9B 1E15A 5B3NA 3QDJB 5D7LD 2NCMA 3IFLH 3QQ9D 3DV4B 4XC1L 5E8DH 4JZJB 2QMJA 3TFKC 2GY7B 2NT1A 3FN0L 1V7NH 4OZFG 2WUBL 4X6FA 3MCLH 5TE7H 4KKCD 4OCRL 2X0YA 2FJHA 1WK0A 3FT2B 3SKJH 1WAAE 1WCBA 4GFTB 4TUJA 2W0PA 3M1BB 2A73A 4S1SH 3WO4B 1JYWA 3JTTA 4OD3L 1RZ7L 3PP3K 2J78A 3CZFB