2FH6A

Crystal structure analysis of klebsiella pneumoniae pullulanase complexed with glucose
Total Genus 311
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
311
sequence length
1052
structure length
920
Chain Sequence
DVVVRLPAFGVALADAHWVDKTTLLWPGGENKPIVRLYYSHSSKVAADSNGEFSDKYVKLTPTTVNQQVSMRFPHLASYPAFKLPDDVNVDELLQGETVAIAAESDGILSSATQVQTAGVLDDTYAAAAEALSYGAQLTDSGVTFRVWAPTAQQVELVIYSADKKVIASHPMTRDSASGAWSWQGGSDLKGAFYRYAMTVYHPQSRKVEQYEVTDPYAHSLSTNSEYSQVVDLNDSALKPEGWDGLTMPHAQKTKADLAKMTIHESHIRDLSAWDQTVPAELRGKYLALTAQESNMVQHLKQLSASGVTHIELLPVFDLATVNEFSDKVADIQQPFSRLCEVNSAVKSSEFAGYCDSGSTVEEVLTQLKQNDSKDNPQVQALNTLVAQTDSYNWGYDPFHYTVPEGSYATDPEGTARIKEFRTMIQAIKQDLGMNVIMDVVYNHTNAAGPTDRTSVLDKIVPWYYQRLNETTGSVESATCCSDSAPEHRMFAKLIADSLAVWTTDYKIDGFRFDLMLYHPKAQILSAWERIKALNPDIYFFGEGWDSNQSDRFEIASQINLKGTGIGTFSDRLRDAVRGGGPFDSGDALRQNQGVGSGAGVLPNELTTLSDDQARHLADLTRLGMAGNLADFVLIDKDGAVKRGSEIDYNGAPGGYAADPTEVVNYVSKHDNQTLWDMISYKAAQEADLDTRVRMQAVSLATVMLGQGIAFDQQGSELLRSKSFTRDSYDSGDWFNRVDYSLQDNNYNVGMPRSSDDGSNYDIIARVKDAVATPGETELKQMTAFYQELTALRKSSPLFTLGDGATVMKRVDFRNTGADQQTGLLVMTIDDGMQAGASLDSRVDGIVVAINAAPESRTLQDFAGTSLQLSAIQQAAGDRSLASGVQVAADGSVTLPAWSVAVLELPQGESQGAGLPVSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords pullulanase
publication title Crystal structure of pullulanase: evidence for parallel binding of oligosaccharides in the active site
pubmed doi rcsb
total genus 311
structure length 920
sequence length 1052
ec nomenclature ec 3.2.1.41: Pullulanase.
pdb deposition date 2005-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fh6A02
2.60.40.1130 Mainly Beta Sandwich Immunoglobulin-like Rab geranylgeranyltransferase alpha-subunit, insert domain 2fh6A01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2fh6A04
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2fh6A03
5GSVA 5JHLL 3O6FA 4OLXL 2EDOA 2FZ3B 5I1AA 3UTOA 1N6UA 1XD0A 3LMJL 4ZPTB 5IMOB 1F2QA 3N50A 4F15B 4ELME 3FRPA 4IIQA 3QUYB 4P7OA 5F7FA 1OGAE 1CLYH 1W3HA 3MLUL 4S1RL 1FCGA 2C1OB 2J8UB 4Z0BH 4J3XA 4PRHD 3S96A 5HVFB 4AZCA 1OCWH 3IETA 4HIXL 2OP4H 5CGYD 2AXGA 1SY6L 3TVMA 3KWXA 1DVFC 1CFQA 1QBMH 3FONB 1CZ8L 5DVNA 4I1NB 2EZ0C 5ILTL 2P5ED 1OM0A 2OR9H 1U8PB 3BWUC 1H5BC 3E0GA 5IB1A 4G9FD 1G7LA 1CCZA 3KL0A 2D31B 3DXAE 4AIEA 5IJVB 3S6TA 3LEXA 5C8JA 2FHFA 1J18A 1T66D 3U7AA 5C0IA 3KYAA 4W4OC 4U1NB 4TX8A 4UOW1 4WFFE 1ES0B 3OG4B 4OAWB 5D1QC 2Y4SA 5C9JA 3EDDA 4FXGA 4RGMB 4HFWA 4DQOH 1TVHB 4Z0BL 3DX0A 1HVXA 3OLDA 1AGFA 1OCWL 3K1KC 2IALA 3BPLC 3D3VD 3RGVC 1QBML 4NN5C 4MA7H 4PJ9B 4XBPA 4Z0XA 4NSBA 5KOMC 2NY0B 5HI3D 3ILQD 3HTLX 2XNAA 3SE4A 1P9MA 3HG3A 2HTKD 2XWTB 4W7VA 1FSKC 3GO1H 2Z35A 3POHA 4AQOA 1CU4H 3C87A 5EZJB 3EKCA 2OR9L 1MCCA 2PXYC 3GK8L 1TQTA 3QXUA 5DRNB 3M17A 4WSJA 4PJCE 5SX4I 2ZIDA 2PC8A 3CUFA 4PG9A 5C6WH 1PW3A 5INDB 5E0QA 5T1MB 2R8SH 3VFRA 2WKGA 1N4XH 3AB0C 1NLDH 3NZ8A 3FO2B 1H3WM 1F3DJ 4ETQB 4UOW0 4AMWA 3EGSA 4NQEB 5J7CC 3DVNA 1T3FA 3GSNB 2FWOA 3LKRA 4OLUH 3L9RB 1UR8A 4LLMA 3U0WH 1W9VA 1G0XA 2XFXA 3L95B 1QSFB 1O6IA 1A1MB 4OCSH 5C08A 2Z8SA 4DQOL 4D6CA 3ZR5A 2WCAA 2K7QA 4EANA 3TF7C 1P84J 1W72B 1GW1A 1BBJA 3DX6A 4PJEE 2GSGA 1TQSA 5B38G 3HKFA 4JQXC 1OOAA 1TNMA 4YFLF 4CDGC 4MZ3A 3VFVA 1FNEB 2JTDA 3GO1L 3SJVD 1E40A 1CU4L 3KVQA 2XG9A 2UYLA 3EYPA 3ROOA 4OZIF 2Z9TA 3KLAB 2XN1A 3KPTA 3ARED 3KPPB 4LDEB 3ZJKA 5EUOA 2R8SL 3GJFB 1N4XL 4HH9B 1NLDL 4Z7VA 3C5ZB 5GRYA 3TH4T 2IBGA 1KN4H 4OLUL 2YBRA 1FORL 1FVCB 2D4FA 4DKAA 4PB0H 1CIUA 5CSBA 2LVEA 3U0WL 3A47A 5GRXG 4ZFZB 4OCSL 3OF6D 5A2FA 1NQBA 2PTUA 3QDGA 4ODUB 4X6FA 2CKBA 3I6LE 2JIEA 1T0MB 3AS1A 4X99B 1PYWA 1UOKA 1E27B 4P46B 1NL0L 4OCXH 5EO0B 1IGFH 4GAGH 1OAYH 1Q6GA 1UZ4A 1F4WH 2YEZB 2PO6B 4BQ8A 2FX8H 2DQCH 4LLUA 4YBHA 2G5RA 4DWSD 4U6YA 5J1TC 5A6JA 1NOFA 4K94C 3TJHD 2WPGA 3VWJB 2G3JA 3G6AA 5AYUH 3WFHA 1WBZA 5J13B 1HN1A 4XX1G 4EQ2A 3QWRD 3RX5A 3QB7C 1MNUH 2ADJA 1H09A 3KJ6L 1WTLA 5K9OA 3QNXA 1DUZA 1KN4L 1WCGA 4LPTA 3PUCA 1XGTB 2EDQA 4HLZG 2YDRA 1AO7D 4P59H 2P8LA 4UNVA 3L4WA 3P11H 4ZAKD 1Q94B 1A7PH 3CX2A 3V5HB 4OCXL 1IGFL 4GAGL 4HH8A 4LKXA 1R5IA 1OAYL 1TNNA 2ZSWB 3M1BB 1F4WL 4P5TC 4PRDB 3TYFA 4YDVB 2FX8L 1S9KC 3OGCA 3HR6A 5F1KC 2R0LL 5TGBB 1EK3A 4HWUA 4ZODA 2EYTA 5A8QA 2DQCL 2J75A 3HNVH 1ZAGA 3V6FA 4TPRH 3BP6B 5IFPA 1E4LA 3IFPA 4POZC 5DHVH 5DEFA 5AYUL 4MMZC 4JRXE 1PPIA 4HPYH 4PJCF 2OTWB 3D85D 3UBXI 5DJAA 1R3KA 2FJHB 4N1CA 3RTQC 2VUYA 3GMQB 4LAQL 4M7LT 5I8CB 5C0RH 4MDJA 1MNUL 1ZT4B 4BH8B 3VX1A 1QHOA 2ICWA 1RPKA 5ERWA 1C8YA 5DSCA 1JD9A 1YMHB 4LHUA 2FR4B 2Z4QA 4NWUH 1UC6A 4P59L 4H26B 5C0JA 3WF4A 3NTCH 3P11L 4XPFH 1A7PL 3OIHA 1NBYB 1BGXH 3BUYB 1J9YA 1CDJA 3RO8A 1T89A 2AGJL 1Y7VA 2HKFL 4PJEF 2CD0A 3TA9A 3UTSA 5KSBA 5EOTB 2AMGA 4QRQA 1KBKA 3HNVL 2A74B 3ZJ7A 5IMKB 3QIBA 4TPRL 4MTVA 4QF1A 4GRWF 3T4YA 2GFBB 5LXGH 4HT1H 1UWIA 1OQOA 4PMZA 1I1FB 3QUKA 5DT5A 4HPYL 2NSXA 3TT3H 1IAKB 1CD1A 4AY1A 3DHJA 2H2PC 2BP3A 2ZWYA 2AJ3B 2CDEA 5C0RL 4JZ5A 3LRMA 4FP8L 4JFQA 4H8UA 3L5HA 4D6FA 4U2YA 4H1LG 3I6GA 2F53D 1FLTX 2WBWB 5CILH 4P9HC 4MAVA 2R4RH 5BRQA 2BHYA 1YQVL 5AD0B 3SDDA 4NWUL 1E6PA 1T4KB 3GH7A 2WWMC 4LCWA 2VC2L 2Q8BH 2PYED 3D39D 4HXAH 3NTCL 1HCFX 3HE7A 2F8OA 3VXRA 1BGXL 1YC8A 2PCPB 2EPOA 3L3DA 4XCYA 2IQ9H 4NKQB 4ZOCA 5MHSD 4JRYD 4U1SB 5C3LD 3T77A 3CXHJ 5GGUA 1ZLVH 3UPRA 1ZA6A 1GYAA 2EJ1A 1X5JA 2D73A 1U3HC 3G6JA 1JNHB 3B8SA 1JRHI 5EMYA 5LXGL 4HT1L 3F4VA 4PMDA 2DKSA 3HRZB 1N26A 4PREA 3TZVB 2EC9T 4OOUA 2LU3A 3TT3L 2WIIA 1T0NB 3E3QE 3OJMB 2DQFB 3I02A 3A4WA 5AG8A 5JPMA 3JTTA 1JDCA 2J7HA 2IQAA 4M1GH 5CEXB 5KN5B 2F1BA 2F1AA 5FYJH 5CILL 1RIVH 3BKJH 1MAKA 2R4RL 5CJ8A 3FT2B 2Q8BL 1UKOA 1MH5A 1BOGA 1NM9A 1TJHH 1QBLH 2O92A 4HXAL 4R0LC 3SCTA 2AJYH 5F7YC 2BC4A 1VF8A 3QAZB 1GGIH 2GJRA 5IKCB 2IQ9L 1FA2A 1TA3A 2YFOA 1UJ3C 3TA3B 4DZ8A 2VX4A 3D3AA 2FE0A 4LEOA 3DO7A 4LLWA 5DVLA 1H2JA 2DBLH 1BVKB 5EC1B 3N18A 3PZIA 4IS6A 3F6IA 5I1EH 5EU3B 1TVDA 1A6ZB 1C7TA 4G9FB 3U6RB 5CEZD 4TVCA 4ZO9A 4MNQA 4LSRH 4Z78B 5DZLA 1LEKB 1P1ZA 4NZRH 1XHGA 3DIFB 5DJCB 3TBSB 4GSDH 3B5HA 4Y5XC 5FYJL 1RIVL 2YL9A 3BKJL 2ZZUT 2Z8RA 1QI4A 1JGLH 2C1PB 3KZSA 4P7LA 5FM5M 4XMKH 1P2CB 1KENH 1QBLL 1TJHL 3RBSA 1Q9KA 1S7SA 1FZKB 3VFSB 3D3VB 1WITA 4LCIH 2AJYL 4XRCB 4HDIA 4HJ0C 4AZGA 1GGIL 1ZHNB 2ZUMA 1B6UA 1V05A 4HMCA 3KL3A 1LNUB 4Z7OE 2FEEI 5GSRA 5DFVD 2DBLL 4CD5A 5SWSE 1RZ8B 1AP2A 4WSKA 2WZEA 3IDMA 4HZLA 2HH0L 4KK6D 2X4PB 3PXJA 5CSYA 2NY4C 4LSRL 5D6CA 4NJ9L 4OLVH 4XCCL 3LOWA 4FZ8H 4NZRL 2W5FA 3JV4B 4Z2GA 2VL5A 1XD1A 4GSDL 1KJ2H 1LD9A 2F7OA 1WJ3A 5GGQH 1YPZE 3OGOE 4QRRD 1CDCA 4ENED 1JGLL 2AQ2A 4BQ6A 4XMKL 1ISWA 1KENL 2EDDA 4G8GA 5DJ8A 3VH8B 1H3GA 1SYTA 2OW6A 1V8HA 2NNAA 3N1AA 4LCIL 5JBDA 5GNXA 5GS2D 5B4MD 5LGKA 3K7UA 1YZZA 3V0AC 5L8LB 4P23C 3CFEA 3K2UH 2X4SA 1J8HD 1JNNH 2EQDA 1JV5B 1W0WA 4XNZC 5I1CH 1XCQB 4MD0A 2NYYD 4PLJD 4AYFA 4POYA 2X09A 5E00B 4NRXB 1PQZB 5ENWB 3MRMA 4OLVL 3OBAA 1EVUA 4CDHA 3BPCA 2YFNA 2A83A 2PNDA 4FZ8L 3W11D 3TV3H 5L2JA 4XCNB 4HBQA 3X12A 5HHOE 2WP3T 3RWJB 1KJ2L 1ZS8B 2A0LD 5GGQL 2CRMA 3RPMA 3K46A 3TH3T 2EEXA 2PUQT 1D7FA 2H41A 1PY4A 2XWEA 4K07A 1P7KB 2ERJB 1C5BH 4W68A 3VRLF 3OKOA 4KXZH 25C8H 2CXKA 1G7HA 1YEDA 4RE3A 4RMRA 1UYWL 4EN3C 5HD8D 3O11B 1NFIA 4K3GA 3VMNA 1Z9LA 2BRQA 4MS8D 2BERA 1I8MA 3K2UL 3S5LA 1R7AA 3AIUA 4X6CA 3AXHA 4DWSB 1A6AA 1JNNL 4J7RA 1IKFH 5DFTA 3STLA 3RM9A 1ORQA 5ALBH 1INDH 3EYVB 3UBXG 1I1CA 3F7RA 3RWDA 1HHHA 3TESA 3TV3L 5T1LB 3BLKA 4B9ZA 4MDIA 4GRMA 2B2XH 5F7MC 3VFPB 5J3HD 4M9OA 5EU6A 4GZIA 1FH9A 5LYRA 5GQBA 3PIQB 3ARDD 1AO7B 2YD1A 3PZGA 3WD4A 2EBNA 1XIWA 4ZAKB 5FKAA 5IHZA 3M8OL 1C5BL 5D7JD 1IC7H 1G1CA 3L7EA 5I8OH 25C8L 4U5IA 4NC1E 1I9RH 5ITFB 3EMQA 1E4IA 3V4VH 1GGCH 4EDWH 1M1SA 5IROA 4NC0B 1OY3B 5FA4A 1ZBWA 3FN0L 1I3UA 1IKFL 1KTCA 4Z7OF 2X1WL 5A95A 3SDCA 5ALBL 5EUKA 1INDL 4WKFA 1RHFA 1FJ1B 3B9KC 5DFWH 2FJFA 1H15A 1KIQB 3D85B 2FH6A 4UDTA 3LHPH 4V1DA 3EW3B 1I8KB 3IDIA 4JJHA 5IHUH 1URLA 2V6HA 4PGBB 5HHVH 2B2XL 2WCGA 2M8XA 3MJ9H 2DIJA 1E4WH 1UH4A 1R24A 5MI0B 4NOFA 1AMYA 4N0CC 4PTXA 3P77A 4XB7A 4ZUSA 1GVYA 5GS2H 4RFOH 4JQIH 1U8QB 2HJFB 2O5XH 4YFDB 1VFAB 4DCQB 4LCYA 4LVNC 2GIYA 4OGAD 5I8OL 1ONQB 1G94A 2JEPA 3V4VL 1GGCL 1FL3A 4UB0H 5GGTA 4EDWL 1BZQK 4HG4J 1WBYA 2Q76A 4DN4H 2FX7H 4JFDD 3B8YA 2G2RA 3O6FC 2XT1B 1NMCC 4MQXC 4KGJA 4FS0A 1JPFB 1RZFH 4DVRH 5EFIA 3QPQC 3ZR6A 5H2BB 5CHNB 1BQLH 3MYJA 4WW2C 3LHPL 1I7RB 5HY9A 2IAND 3MGOB 4KPHH 1BREA 3PQYA 4UBDC 1DLFH 5E8NB 3S98A 5IHUL 4W88A 2APWA 4FFWC 4P4RB 5F71A 3HFMH 2ENYA 5F3BB 2F53B 2A6JB 3F5JA 3SKOB 1E4WL 4JFWA 4ZXOA 1KJ2B 2YA0A 4KK9C 1CE1L 4Z7VE 2F9BT 2PYEB 1HCVA 1J1PH 3D39B 3HI6L 4X5WA 4K23H 1DJSA 2XZQH 4RFOL 4JQIL 2O5XL 2YL6A 4ETYA 3EMCA 3S97C 4HK3J 4EDXB 1K8DA 5BQ7B 5FK9A 3KE0A 4G9DB 4JRYB 4UB0L 4WW2F 3BUIA 1I1YB 2QSTA 3SN6N 1WDSA 1JPGA 2DWEA 2FX7L 5D2NB 4DN4L 2DSZA 4HJGA 2B7DT 1EEQA 2CYGA 2EEDA 3MBED 4QT5B 1RZFL 2XA8L 4DVRL 2A9NL 1H3XA 2DT1A 3ALPA 2ZUXA 2W62A 4UTFA 3CFIC 1BQLL 1RZKC 5T3XD 1NWTA 2D3VA 3WN5C 5T5NF 1JJUA 5BS0D 5LCVH 3S4SG 2O5ZH 2Y1VA 4I4WA 3HFML 2X4NA 4HK3N 4XVJH 3VIKA 3MZTA 3QIWD 4QLRA 4FG6D 5T1KA 5L8KB 5A8PA 1WCQA 5E9DD 1D2KA 3SE4C 1P9MC 1GNXA 4KTDL 1J1PL 2YS4A 2OTPA 4K23L 1L0XA 3KJ4C 1DQJB 2XZQL 3WNPA 1K6QL 4PP2A 2NR6C 1F6FB 4WDIA 3KHQA 1JGVH 1VFUA 1XSKA 4YHMH 2AV1A 5T3ZE 3WL0A 3RBGA 3I75A 4XH2A 1MJ7H 4GAYA 3O4OC 1KLGB 2E9IA 4PRBA 4P49A 1SVZA 1ITCA 3REWA 3CDYA 2YD8A 2AV7B 3L4YA 1HHJA 1F02I 2XA3A 1SMAA 4HIJA 3RAJH 1PIGA 3MLZH 1K9TA 4PJAB 4PGCB 5LA1A 1T7VA 5LCVL 5IR1A 2O5ZL 2VX5A 4JHWH 4BSJA 5ALCH 1CTOA 5A3IC 3GGWA 2A6KB 4AM0B 4JFHE 3CC1A 5EC2A 2ZKHH 1XF1A 4GXPA 2AVGA 4QP0A 3RWGB 2WMFA 5F1IA 4UT9H 1Q9LB 5GZND 1I3VA 1A1NB 1KB9K 3AMCA 3ZDYE 4KMTH 1PIFA 4MA1B 4ALAL 3VFNA 1EGZA 2F5BH 1H3PH 4YHML 1G0CA 1C16B 1QVOA 3TN0A 4S1DD 1UACH 3NPSC 2DS4A 5C8BB 4PLKD 1MJ7L 3QXWA 5DQJA 1AHWB 2HMID 3QQ4A 2DM4A 3H8NA 5BWFA 1G9MC 1RUMH 3AS2A 2OYLA 5E8EA 1J88A 3UTSE 5KSBE 5FAAA 2N7BA 2R2HB 1V0MA 3TBWB 3N0PB 3SCOA 3MLZL 1I9IH 1M6OB 1INQA 2P42B 3EO1B 3KYOB 4HKZB 4PY7B 1GPFA 1I85C 3NIFE 4JHWL 3TBYB 2ED7A 3QUMH 5MERA 1DHKA 2UWEB 1EGJH 1U8JA 3GHBH 4PR5A 2ZKHL 3DV6B 2GJ6B 4WHCA 4YIQA 4JM2D 4UT9L 5EUOF 2FGWH 5EBLB 4KJQD 3CMGA 4U31A 4KK8D 4WJ5A 4Z7VF 3CXDL 5KVDH 1AGBA 3GSVA 4KMTL 4OFYA 2HRPH 4QGYA 2ICWI 2F5BL 3PGFH 2E5EA 2EXYC 4XI5D 3PJSB 1UACL 4HIIA 4M8QB 3FB6B 1HNFA 1J8HB 4AT6A 4R96A 4M61B 3S3SA 1RUML 3TO4A 3W4RA 5F7DB 1TTFA 5T3XH 5JPNB 1PKQE 2DB8A 2F8XC 2ZWLT 3DC0A 3G6JE 3MRLA 4F9PA 1I9IL 1KNOA 1SEBA 3F8UB 3RIAF 1G7MB 4Y5VA 1WF5A 4Y4HD 1E43A 1AKJB 3BAYA 3VFWA 1R33A 3HCVB 3QUML 1FNAA 4RAUB 2Z31A 1EGJL 1G9EA 3GHBL 1LO2H 2HLFC 4QXTA 4XMPH 3QUZC 1WLHA 2FGWL 1KLFA 1RHHA 1G7JA 2E40A 5E0FA 3MRKA 3HI1B 3O6LH 2HRPL 1S5HB 3PGFL 1NBVH 1N8ZA 4OI7A 3OJDA 3FRPG 2Y6SD 4GINA 1XGUA 1MY5A 3BQUC 1XH1A 4P57A 4RFNC 2YD9A 1CICD 1VJZA 5K93A 4MAYC 3DYMA 3HMXA 3QR2A 2ZCLH 6A3HA 5JW5B 3BUQA 2MFNA 4I0PD 4JE4B 4J3UA 4KKAD 4OF3A 3GXTA 1HL8A 5CGTA 5T5NG 4Y16D 5EN2B 3S34H 4M62H 5JW4R 2A6DB 4AH2B 4UOZA 3RKDC 4MNQE 3FN3A 4MJ6A 2VCAA 3ARDB 1E0VA 4OOZA 3B2UC 4XMPL 3DVIA 3ZKMC 1OHQA 5DDHB 3T0ED 5FKYA 3DX4A 1ZWIB 5D7JB 3QIBC 4OGXH 3O6LL 1VADB 3LVEA 2DT2A 5HPMA 5DHYA 2R2EA 1E4MM 3ZDYF 2X4RB 3D9AH 3VIGA 2P7TB 1MW3A 3FQTB 4JANA 5HYSA 5EIIA 3BZFA 4UFLA 4KROC 4WENB 1ZMYA 2Y25A 4DO5A 2HTLD 3UTQA 3HB3D 2ZCLL 4M1CD 3RWIB 1M7DA 4KI5D 1NOUA 5GS0H 5HYJD 5IGXL 5KSBF 1XF2B 1I7TB 3W0WE 3S34L 4M62L 3U1SH 4WF7A 4WGVB 3C08H 3HE7C 2J8GA 2D7TH 3H53A 2FIRT 3L1OH 4K7FB 2VE6B 4HUUA 1HZHH 5TF0A 1AXSB 4TNVF 3AI0A 3QWOA 3OLGA 5ETUA 1MI5D 4R97B 4ZYKB 5DUMH 4HV8A 4OGXL 4NRSA 4Z2IA 2NZIA 3Q0HA 1MYRA 4TUFA 4HUMB 2CXGA 2QKIA 4G8GE 1RUKH 3ECBB 4JAMA 1NUFA 3RL1B 5C70A 2WZHA 2K9UA 3D9AL 3GSQB 2DGAA 2I07B 4JG1H 2FZ3A 4QYOA 3WL9B 4ZPTA 1W9XA 5IMOA 1GRWA 5JNYB 3BCFA 4G80B 4ZPVA 1GXEA 4OGYH 4UQAA 1BGAA 2ZCHH 4Z5RB 3QUYA 3LN4B 1ZEAH 1OTSC 3U46A 5GS0L 3PP4H 2IANB 1XGRA 2J8UA 2ADGB 1XSJA 3U1SL 1A14H 3G6JF 5CD5C 3C08L 1I9EA 2D7TL 3FONA 3LCYA 4K71B 4BFBD 3L1OL 1FHDA 2ZNWA 1HZHL 2VZ1A 2ICES 3L7FB 1U8PA 2NY5H 1OGTB 1BVNP 1U8KB 2ESCA 3VGDA 3VG9C 5DUML 3EO0B 2QHRH 3UG5A 1T2JA 1FNGB 2D31A 1RUKL 5JA8B 5IJVA 4OQTH 4JG1L 2X2YA 1NCCH 2P46B 1Z5LB 4UINH 3G5XB 2VXSH 2OJZH 4NN6B 3ARBC 4U1NA 3MBEB 1ES0A 4WFGD 4OGYL 4PY8J 2ZCHL 4OAWA 1KC5H 4G8FB 4XAKE 4LP5A 1ZEAL 1AGDB 4X6CE 3VMOA 3VXPA 3PP4L 5BS0B 2YOCA 3N9GH 1BD2D 3IKCB 3VG0H 4JFPB 2VLJD 3G04B 4WUUA 4X5LA 1A14L 3UAJD 3ZYJA 3F7QA 2OSXA 3CFBB 3QDJB 1QR1A 3QIWB 4PJ9A 3QHFH 4ODHH 2A77L 5E9DB 3RVTD 2H9GB 2DJUA 1FDLL 2C3WA 4R3SB 5EZJA 1KCLA 2NY5L 2W0FA 5DRNA 2CO7B 2MQ3A 4GKNB 4LCCC 2QHRL 1NCDL 3K8LA 1XYFA 3PZ9A 1KCVH 3TFKC 5HSFA 5INDA 1WIPA 4OQTL 3VD5A 4PJ8D 4UINL 3FO2A 2OJZL 3RJYA 4ETQA 1MCWW 2OTUA 4NQEA 4PV8A 5J0BA 2HT3C 3GSNA 4L3ED 3L9RA 1KC5L 3L3JB 4M02A 3PDOB 3D1MC 2X1IA 3AS3A 1QSFA 3L95A 1A1MA 5F9OH 4E2OA 5IFAH 4F57L 3N9GL 5D7KD 1PZ3A 2DQGH 1W72A 1L0YA 3UDWA 3W27A 2V3DA 4X80H 4HJJH 4ODHL 4V1DE 5EZLB 3FN9A 5BOPA 2G3IA 1FNEA 3E2HC 2G41A 1NC2D 2NZ9D 2V38A 4JKLA 2I9LB 1GOOA 3WNLA 2UZXB 3IU4L 4N68A 2XZCH 1XCTB 1HHIB 5L6YH 3B83A 3KLAA 1XEDA 1KCVL 1JPST 4BM7A 3KPPA 4LHUG 1NGQL 5TJWK 3O41A 3P40A 4P5KB 3GJFA 2AQ1A 1A64A 1IAMA 4HH9A 1G84A 4XB3A 5TQ2L 3KPMB 4ZFOA 3C5ZA 2EABA 3APGA 4GBXC 1QFOA 3QHZH 3WFCH 4XXCA 3QBTB 1YN7B 4KC3B 3FB8B 3FO1B 2XVNA 5F9OL 5IFAL 5T5FH 4ODUA 2DQGL 1T0MA 4CAGA 2VYRE 5BZWB 1AI1H 4P46A 5EO0A 2EZ0D 4X80L 2YEZA 2PO6A 4HJJL 5E1AB 3PQYE 5CEYB 4W8LA 4JM2B 2HJLB 2XZCL 4XTRC 3HA0A 4HA1A 5L6YL 3B3IA 1IVLA 3OAUH 3EJJX 4NQVB 4Y1AB 3VWJA 5IW6B 1UR9A 3WF1A 3QUXD 4RGNC 3BGAA 2WBGA 4IISA 3NN8A 4MADA 2Y07H 3AJ7A 2XRAH 2QLYA 3MRCB 3CFJB 1A4KB 5D1QD 5CPQA 4M7LH 2QSCH 3QHZL 4RL3A 4B3LA 3WFCL 1XGTA 2D1ZA 1J10A 1JD7A 3W9EB 3V5DB 3MA9H 3RPIA 1Q94A 1MVYA 1QHPA 1NCBL 1XIWC 4Y4HB 5ESVA 3RGVD 3DGGB 3SCMC 1AI1L 4JPKH 5DMIH 2ZSWA 1Z0NA 4PRDA 3HZVB 4YDVA 2KH2B 1WGOA 4KV5E 2PXYD 5TGBA 1ZE3C 1JZ6A 1CR9H 5IDIA 4ZXBC 1P69B 4UNIA 1BQHA 5JDSA 2DD8L 3OAUL 4AEHH 2V17H 4JB9L 3KDMB 4AMXA 4MYWB 3F6LA 1HJQA 3NFSH 2OTWA 1LMKA 1YEJH 3GZKA 2FJHA 1A8JH 3D0LB 2WWKO 5A40E 4EI5B 3GMQA 1KCKA 1H1NA 4YR6B 5I8CA 3BJLA 4KK5C 1ZT4A 2XRAL 4BH8A 1CICB 5CBAB 1JNJA 2AEWA 4AYGA 1YMHA 5KAQG 2ADIB 3GYCA 1U93B 5F6HI 1GHRA 2FR4A 2QSCL 1TVBB 3O2DH 3FCTA 3MV9B 3PL6B 4L29B 5GISH 4PTTB 1OWQA 2VLLB 5HXMA 3ALFA 4Q2ZA 4QO1A 1WT5C 5FUCE 3MA9L 5FYLD 2WQ8A 1XGQB 4QNPF 4HLZH 1UD8A 1NBYA 4LX4A 5JR1H 4MSWB 3BUYA 5DMIL 4PBVC 4D2NA 4GJTB 4F7CB 1RIUH 5ID0B 4L4JA 5EOTA 1NH6A 1ZTXH 1EDTA 1CR9L 3T0EB 1OGAD 15C8H 2A74A 2JALA 5IMKA 3VUPA 5HNNA 3OB0K 4JEGB 4BK4A 3SQBA 1FH5H 2V17L 4AEHL 2J62A 4GXVH 1I1FA 3EUUA 1IAKA 1YEJL 4ORZC 4AZHA 3RQ3A 5D1XC 2AJ3A 3OGRA 6FABH 4FQCH 1SEQH 3VTRA 3FO0H 4M6NH 3O2DL 1X5IA 5CJQH 4GOSA 5GISL 5AD0A 4OD1H 1T4KA 2AERT 5HYJB 5EIVA 4D1IA 3D6GA 3MA7B 5KVFH 4P3WA 4EKJA 1D9KB 1WWAX 2FHBA 5JR1L 1LO0H 2PCPA 2BV9A 2ZE0A 4OT1H 3TO2A 2ID5A 4U1SA 1RIUL 3WY1A 2V2XB 1ZTXL 3N06B 2FBJH 15C8L 3EO9H 2AEPL 1JNHA 4K3EH 2B5IB 5K59E 1HI6B 3HRZA 4AK1A 4GXVL 1A9EB 3TZVA 4HOZA 4OQ1A 1T7WA 2J5LB 5TDNB 5A6AA 3VNYA 1T0NA 1CWVA 1NC4D 5I19H 2DQFA 4BZYA 5JIHA 6FABL 1QTYT 2YR3A 3CMJA 4DK6A 1S3KH 1SEQL 3LKPB 3S5YA 2ADFH 5CEXA 5KN5A 1F00I 3FO0L 1L6XA 1SBSH 3IGAB 3ARZA 1QNZH 1G7QB 3FT2A 4OD1L 1EOMA 2NTFB 2X1OA 1WICA 2CR6A 5KVFL 4TOQA 3MRNB 1FYHB 4P5TD 2PTVA 1LO0L 3ARYA 4CKQA 4GMTH 4OT1L 1TTUA 4DUVA 1UJTA 4ZD3L 3H9YA 4GIAA 4WUKH 1LK3L 3TA3A 1TUXA 3AIVA 4HXBH 1U91B 1ZVSB 2FBJL 3EO9L 3LD8C 1BVKA 5EC1A 4NGHH 3BP7B 4KV5F 4POZD 3RNQB 4K3EL 4BZ1H 5EU3A 1MCEA 1A6ZA 3OKKB 3GNML 1GL4B 3RTQD 3MV01 3MLSH 3UCQA 1NARA 4Z78A 4QHKJ 3HG1D 3F7YB 5I19L 3UEQA 1LEKA 2ZUSA 1RJLA 4EKXA 4ERSH 4E0RB 3DIFA 2OR8A 2D7NA 5DJCA 1S3KL 4D9RE 3TBSA 2ADFL 4RIRB 1SBSL 3HC3H 2VLME 5C0NC 4TNVK 4HOXA 2V5CA 2GAZB 4UFKA 2VR9A 4FZEH 1NJ9B 2C1PA 4FQXB 4WFEE 3P0VL 1BD2B 1P2CA 2UY2A 2VLJB 1JYWA 5CJBA 4PJHE 3D3VA 3VFSA 3DHUA 3VIJA 4XRCA 4GMTL 3B2VH 1ZHNA 3U7YH 5GNZA 4U2ZA 2RFXB 2GFTA 1CT8B 1Z6JT 5BCAA 3BW9B 3K0WA 1LNUA 4HXBL 1TLKA 4A4AA 1KQYA 1XF4B 4HKBB 3HMWH 3QEQD 4NGHL 5H35A 4DGIH 1RZ8A 4X5XA 4BZ1L 2YWYA 5DC4B 2D0GA 2VLRD 3BT2H 3NFNB 2X4PA 3X14B 1X5AA 5DK3A 2H2PD 3NCMA 3NCFB 4MLIA 4PG2C 3A67H 4PGDB 4PJ8B 4CADB 4JFEB 4ERSL 4UV7L 5DD0H 3BKMH 4U0RC 4L3EB 3L3IB 3HC3L 4XPTH 3ZT5A 2DN7A 1WAAA 2WWMD 5IIEB 3IAQA 2R69L 5IQ7H 3EFFB 4FZEL 4NUGH 2BXZA 1DWGM 2DBJA 1I8LA 3HPJA 5JXEC 1NWSA 5DD6B 4OLEA 3BLBA 3VH8A 1BWWA 4OBRA 4WKAA 3BAJA 5FUOH 3B2VL 1Q6DA 3U7YL 1FO0A 4NFBA 4D0DB 2X4UA 1DQLL 4PMYA 1U3HD 3HMWL 4XP5H 3T0AA 1YEKL 4DGIL 1GCYA 1JV5A 1XCQA 1BEYH 4JY5L 1S9VB 1N3NB 5K59F 5E00A 2X4QB 4NRXA 1PQZA 1E3XA 3MRHB 5ENWA 4OUUB 5GGSB 3A67L 1H49A 5C2BH 2GSJA 3TEUA 4KAQH 4F9PC 3OKNA 5DD0L 3BKML 5DEGB 2EDJA 5EU7E 4Y5VC 5IBLC 2HLAB 2IJ0C 2ZP0T 4Z8FH 2NY3C 3MGTB 4XPTL 1BYBA 5I0DA 3RKPA 5IQ7L 4NUGL 5IG7B 3OF6A 3F12B 1CDBA 1GOIA 1P7KA 1DVFB 3U4EB 5IWLC 2OL3H 3ULUE 3BAIA 3AU1B 5HGGS 1TXKA 3K2MC 5DD5H 3WE6B 5JOEA 1RI8A 2WC3A 3QH3B 5FUOL 4ATWA 4D71A 2GK2A 2J8UE 3O11A 4JL2A 1IEAB 4JRWA 3EJRA 4DWSA 2DYPB 1GZQB 2HISA 5IVZA 4XP5L 1ZJAA 1EOKA 1W91A 4R27A 4X7EC 2VRQA 1UQYA 1BEYL 3EYVA 3PWVB 4FHBD 5C92A 3T09A 4J23A 4K8RC 4CU6A 4FN0A 4GRWH 4M24A 2BSTA 3QWRA 5C2BL 4GZJA 4FQ1H 5M17A 4KAQL 5T1LA 5D1QB 3VFPA 1XRVA 4DKEH 4Z8FL 3TTYA 5AC5A 1B2WH 4ONOA 1UB6A 1H4PA 1OB1B 3HC0B 3PIQA 4KRPC 2ZXDA 3A0OA 1AO7A 4AD4A 3BPLB 3WS3B 3DSNA 2OI9C 1PZ5B 2OL3L 3RGVB 3Q5OA 5D7IF 4NN5B 4HJ0D 4C56D 5I76B 4NNPH 1I1RA 4FQPA 4F9DA 2P48B 3RHWF 4HUXB 3AFLA 3LKSB 5ITFA 2NW2A 1FSKB 2CBUA 2OSYA 4L3CB 2PXYB 2VN7A 2OYKA 4YX2H 1SYVA 4OZFG 3T1WA 3CHEA 1N64H 2NY4D 4R4NC 1FJ1A 4TX6A 1JI1A 4J12A 4Y19D 1KIQA 3D85A 1FGVL 1V0NA 3AB0B 2A9MH 2QHLA 3RWFB 4C83B 3K4AA 1I8KA 4P9HH 4BH7B 4OZIB 5KZCB 3IAGC 1Q72H 4PGBA 1KJMA 3MODH 5BXTA 4DKEL 1U58B 4QOKD 1EJ6A 1B2WL 1ZK9A 4N0FB 4XNYH 3FOLB 4J3WA 1MHHB 1IQDB 2I27N 1DWFM 3DSFH 1QFWM 1BBDH 1E28B 4NQEE 1U8QA 2FEDC 2HJFA 3VU2A 1VFAA 4DCQA 1HDMB 4NNPL 4NNXB 5IOPB 1VIWA 1E4KC 2YXFA 2L7JA 1ONQA 4HUWB 1QSFE 4P23D 3X3FH 1YYML 4ZQKB 4YX2L 2APFA 1VERA 1H3VA 2EDBA 3C6SB 3BAWA 1N64L 2FRGP 4XP1H 3WD2A 1A7OH 2H6PB 3LQAH 3ULUC 5H2BA 5CHNA 2VX7A 1CWYA 2A9ML 1BG9A 1J0YA 1I7RA 2DQJH 1UR0A 3B43A 4P9HL 5TDOB 3MGOA 1HH6B 5E8NA 1GOKA 1MFNA 1Q72L 3MODL 4P4RA 5F3BA 2F53A 2A6JA 2NXZC 2VABB 4WKHA 3MJ8B 2XVPA 3T0DA 3SKOA 3H9SB 4XNYL 4U3AA 3UJJH 3MLVH 2FO4B 2PYEA 2MCPH 4NBXB 3DSFL 4XP6L 1CDYA 1BBDL 3MU7A 2OJEB 5FGCB 3GMLB 3OXRA 3TBTB 2VRKA 4NN7C 2F7QA 2CLVB 4JDTH 4AY0A 5ACZB 5J89A 5JOFA 4EN3D 2E7HA 3D69B 4NPYB 5BQ7A 3ULUF 4JRYA 4F7TB 4X7SH 4TSBH 1L6ZA 3X3FL 1ODUA 4PJDF 5D2NA 2J8UF 1QRKA 5D72L 2GJPA 3SURA 2A73A 4FNTA 5F3HB 1ND0B 4XP1L 1JRHH 1A7OL 3LQAL 4X6BB 1UCBH 4OIIH 5D7LD 2WNGA 2DQJL 5HPCA 3D0VA 5A43C 3LV3A 3PTQA 2YD7A 3O6KH 5DC9B 3D51A 4ZG1A 4CBPA 5CFHA 4MB4A 32C2A 1UWGL 3UJJL 3LN9A 3MLVL 4PJIF 2MCPL 1ZA3A 3EYQC 3JV6B 3NACL 1T5WB 1DQJA 1LL4A 3SUSA 3CU1A 4LRIA 4P5TB 5F7KC 3VFGH 4JDTL 4M7KH 5M95B 3PABB 1ISXA 2OL3B 4PMQA 3QRFM 1PX3A 4X7SL 4TSBL 4B5EA 5EBAA 4UMGA 5E2UH 5FB8B 3X17A 3QEGH 4MA8H 4PTMA 2Q87A 1KLGA 3B9KD 5I1DB 4LPXA 3RWEA 3GEWB 1JRHL 3RTQB 4NCC1 2AV7A 4OIIL 3HG1B 3E8UH 3IJSB 1ZHKA 1TZ7A 2MTPA 2XM1A 5BZDB 4NRZB 4PJAA 4PGCA 4GRWB 3O6KL 1JDAA 3VSVA 3BAEH 3QJFA 4HWBH 2W67A 3BH9B 1GQKA 1GCFA 2KZWA 3MLXH 4N0CD 5FO8B 2A6KA 4AM0A 3UZVB 3CLEH 3WUGA 3HAEG 3RWGA 3C8KB 2X0HA 3EOYG 5DJZA 2D7MA 2J7BA 1A1NA 5DF0A 2WWCA 3W0KA 3VFGL 3GKWH 2C3GA 3CVHH 2VZTA 5EORH 4Z77B 2X8RA 5E2UL 3O6FD 3PNWB 4MA8L 4MQXD 1U8OA 3QEQB 1I1AA 1AHWA 1JCKA 4YHPB 4HGWB 4XMLH 1IAIH 3QPQD 3C5ZC 2VLRB 5FGSA 3W9DB 3UJTL 2WINA 3NCJH 4X6DF 1LO4H 3GXNA 1QSEB 3L4XA 2R2HA 4OF6A 3E8UL 3TBWA 2XN0A 4UBDD 4KY1H 3KYOA 3EO1A 4PY7A 4FFWD 3GSRA 3G6DL 4HKZA 1VA9A 1HJVA 3ELAT 1U2YA 3SKMA 4HWBL 3TBYA 3MLXL 4JFVA 2DTSA 4QHNB 4I48B 3WS6A 2PWHA 3CLEL 4OF8A 1K9EA 2PO6C 3MJ9A 2GJ6A 4KHTH 4CD4A 4H25B 1R3JB 5EBLA 2JF6A 5T1DH 5GGRA 2BNQA 1G9HA 3ZQ9A 3H0TB 4OCYH 3GKWL 4RZCB 1EO5A 3CVHL 3C09C 1T03H 5EORL 3PBGA 2APBA 5DR5H 3SUTA 1U3HB 3FB6A 5A69A 4HQQL 4IRZH 1F42A 4MCYB 1RMFH 4X0VA 1J8HA 2FEEL 2VWEE 1KB5H 5LWYH 4XMLL 5A2LH 3NCJL 5IFTA 1LO4L 4M56A 3ARGC 2AJSH 5JPNA 5ECUA 3NIGF 4KY1L 4RWHA 1OAQH 4O51B 1HX0A 2GT9B 1G7MA 4BUHA 1AKJA 1DR9A 3W6LA 3HCVA 2F74A 2IBZY 4RAUA 3GXFA 1NDMB 5MEOB 2BY2A 1AR2A 5DUBB 5BV7C 4KHTL 4R0LB 5T1DL 3MX0A 5GGVH 3W2DH 1CLCA 2NR6D 4OCYL 4F7MA 1T03L 3HI1A 4BFEA 1UJ3B 4LPCA 1EQCA 1S5HA 5DR5L 2YIHA 3L5WB 1AC0A 4LFHG 4IRZL 1RMFL 5D1ZB 1EV2E 1OTTC 2DLEA 5FUZH 1KB5L 5LWYL 4NO5B 2QR0B 2W9DH 4IMLB 3M07A 2CUHA 2ZX9A 3VILA 1JGUH 1Q9WB 2AJSL 3MV8D 1LG1A 3DO3A 2WVUA 4JFTA 2EDFA 1M53A 3O3AB 5C08D 4J4PC 4BQ3A 1OAQL 4G9FE 5EN2A 4Y5XB 2A6DA 5CKGA 5A3ID 3LB6C 1MCFA 3ARDA 2EKSA 3AM8A 5DDHA 3OG6B 5GGVL 2PW2B 4JHBA 3W2DL 1PY9A 4C56B 5D7JA 3WFBH 4FNSA 1VADA 1T1XB 3U9UB 3N1MC 4PRPA 5HPOA 2G9HB 4JL1A 4IRJC 2X4RA 5D9NA 1IV8A 2P7TA 3D3VE 3T3PE 2XACC 2ALWA 5JQHC 3FQTA 2X2HA 5FUZL 2NY4B 2W9DL 4Z7UB 3WHE0 4B50A 2A2QT 4KRLB 4QXUH 1JGUL 3NH7H 1PD6A 4NDMB 4Y19B 2WSKA 3RWIA 3CIVA 2CRIA 1Y6NR 3MSDA 3QDGD 4H7VA 1U6AH 1XF2A 3WHXA 4AIZB 4NM8L 2WM0A 3WEOA 3DLQR 4QOKB 1E5JA 4K7FA 3T2OA 2VE6A 4X0NA 1KTDB 4MVBC 5AYBA 1UWSA 1JN6A 5EIQA 4NHCH 1A21A 1AXSA 3RNKB 1ISZA 1EHXA 4LRNH 4KKCD 3U7VA 4W7UA 4ZYKA 5FIEA 4WJXA 1WAAE 4HSQA 3WFBL 2ARWA 3EYUH 4IDLA 2EXYD 4YUEH 4G5ZH 1ZBKA 4DTGH 1DBBH 3RL1A 3GSQA 4JR9H 1SZNA 3WL9A 4AZBA 3D2UD 1RZKH 5JNYA 4G80A 5FEBA 1GH7A 1NBZB 4QXUL 4D6HA 3NH7L 3KAAA 4Z5RA 4BKLB 2AXJA 2VDQH 3HZYB 5I71C 3L6FB 1C92A 2AABH 1U36A 2IANA 1U6AL 2XI9A 3PWNB 5HDLA 3RHWK 3MLPA 3DURB 3QYCA 3EHBC 5BXPA 3WYRA 2J47A 3TCLB 2HLFD 3QUZD 5HI4C 3BP4B 5IK3A 2KDGA 2SEBB 4NHCL 3ARUA 3TA3C 3L7FA 2IADA 4K7PH 1OGTA 2YWZA 3GXDA 3AHVA 1ZT7B 3PE9A 3UC0L 1U8KA 4G6AC 3T1FA 3DETC 3SEPA 5D9OA 3EYUL 3EO0A 3VXUD 4EN3B 3N1GC 2GK0B 4G5ZL 4YUEL 3QZWB 1FNGA 1NKOA 4XC1H 4N1HB 3BQUD 4JFHD 2QLVB 4DTGL 4PRNB 4JR9L 1Z5LA 4W6WB 4MXWL 3G5XA 4MAYD 4U1MA 3MBEA 1IGYB 3OL2A 1NBQA 4H2CA 1GJUA 3ETBF 1W0VB 4O9HH 1A47A 4G8FA 5D7LB 2ZUTA 4BUGA 1XGYH 2VDQL 1AGDA 4OLZH 3HG4A 2AABL 2YXMA 4R8WH 4C4KT 4WU5B 3BPOC 2CIIB 4NQSB 5BS0A 1B3VA 3IKCA 3M7SA 3W28A 5CG0A 2B0SH 2X10A 3RKDD 2J2ZA 5I16B 5L2KA 5SWQB 1GZPB 3CFBA 3QDJA 3IDJB 3QIWA 1NWRA 2XGIA 3B2UD 3CFDB 1EAJA 2D2OA 1KB9J 3K8KA 3OKDB 5E9DA 3UTSD 1GONA 2H9GA 4JKWA 5IFJB 1AIFB 1V02A 4K7PL 1UD3A 1H5VA 3QIBD 4GKNA 3QNYB 4U1HB 3KLLA 1WWBX 5BRZA 1AO7E 1JFQH 4C7GA 4XC1L 1G9MH 2JJSA 1HYSC 5FYKD 1BX2B 1VENA 2F61A 4KROD 1BLIA 4FQJH 4UIMA 3RL2B 3B9KB 1U8MA 3RY5A 5JIKA 1HKJA 4O9HL 2CKBH 3L3JA 5TFSL 3PDOA 4AIXA 4LCWD 4OLZL 1LF1A 4Y89A 2I26N 3OB0H 2B0SL 3WBEA 3HE7D 1OCQA 1N5AB 3VXRD 4NNYB 2XPKA 5F7HA 1UENA 4MWFB 5DYOB 5EZLA 4IOFC 2RQ8A 2XZAH 2O93L 3A24A 5HBBA 4LVNB 1WTGT 3QT2A 1ISYA 2FATH 3O81A 4QCFA 1XCTA 3PHOB 1QO3B 3BX7C 1U3ZA 3RA7H 1JFQL 2WAHA 3IFNH 1NSNH 3DECA 1WK0A 1NMCB 4P5KA 2O9RA 4PLOB 1QD0A 2FGZA 3KPMA 4FQJL 1FZJB 2UVFA 4J3OC 4WW2B 4ZTOH 5T3ZH 1CLVA 1RP9A 1OTSD 2CKBL 3Q48A 1YN7A 3U4AA 3FB8A 2BK8A 3FO1A 3ARTA 3S96B 2OX5A 3F5WB 2AOSA 2CNCA 5CD5D 4P3DB 2AXGB 2HT4C 3PV6B 4ESKA 5BZWA 3V0WH 2BHUA 1NAMB 4JVWA 1B3XA 1VFOA 3SCPA 3ARVA 5K9QI 2XZAL 5E1AA 5CEYA 2DQHH 3HU7A 4JM2A 5DMGC 5I18H 2F53E 2FATL 2HJLA 2V9TA 3LX9A 5C9KA 2GTZA 2R1WB 4Y1AA 4U7KA 2V7HB 1BZ7B 3SGKA 1PX8A 3RA7L 2G75B 2PYEE 1XF5A 3D39E 3IFNL 1NSNL 5FV2A 1KSRA 1IC5H 4OI8A 1MWOA 3ARBD 5DJ0B 2NQCA 4LNVA 4FLOA 5IB3B 4OI9A 2ZCKH 3MRCA 3CFJA 1A4KA 1X5FA 5MHSE 4JRYE 4U1LB 1KFWA 1KT2B 5T3ZL 4ZTOL 5DJYB 3WN5B 5D2NE 5C0CA 3S6CA 3HG5A 2XYLA 4M1DL 1GUVA 4OUOA 3W9EA 3LQMA 1HNGA 1UEYA 3VIIA 3N1PC 3V5DA 3AZRA 2P8PB 4K9EC 2W59A 1ZSDB 4Y4HA 3DGGA 5GRJH 4LYQA 3V0WL 4M1RA 4WCYL 3MZGB 1AGEB 2EADA 3LXCA 3HZVA 3IRZA 2Z35B 2IPUK 3KJ4B 2DQHL 1VSCA 1ZOXA 5I18L 3BAXA 3VXTB 2OMNA 3NBNA 1KPRB 2UZYB 2CSPA 3KXFD 1NUGA 3TFKD 3KS0H 4TVSa 3KDMA 1C3FA 5FYKH 3ZE1E 1IC5L 2FNBA 1MCQA 3H7BB 3O4OB 4NWTH 4EI5A 3MO1B 1DBAH 1WV7T 4M6AA 4ODWB 5CBAA 1CICA 2ZCKL 3JWDC 2HT3D 3EGSB 4R7NB 3DVNB 4F58H 1DANT 2ADIA 3WFDL 1U93A 3AY4A 2V5MA 1TVBA 3MV8B 2FYVA 3OGVA 5FL0A 3C5SB 4LQFH 4LLMB 3GJFK 3MV9A 3PL6A 4ONFL 3WJJA 3GIVB 3QO1B 4PTTA 3I84A 5C08B 2VLLA 3K81A 3S35H 3CPUA 1BBJB 5CEZE 1XGQA 4XBGB 4DJMA 3O2LA 1KR1A 4MSWA 5GRJL 4YXLH 4KJPD 4XWOC 4FMVA 2BSSB 5FFLA 2YD4A 4PP1C 3WFEH 3F58H 1C8XA 2V3FA 4F7CA 3WD1A 4PJAE 5ID0A 3T0EA 1KXQA 4BQCA 1WZ1H 1V3JA 1RUQH 1CK0H 3FT4A 1VFMA 2I60H 3KEHA 4UNUA 3U2SB 2AEQH 3WXVL 5FYKL 3OB8A 5I73B 3KR3H 1L7TL 5B39B 2QSVA 5EUOB 1ZGLM 2WVVB 1AD9B 3ZSSA 1DBAL 3TV8A 3GKZA 4I3GA 2ENSA 5F1NB 1TZIB 4GBXD 4F58L 1GPOH 1U30A 3VGBA 1A4JB 4MPKA 1MELA 4LQFL 4N0YH 3KPRD 1RZJC 3SCRA 3QDGB 4N0RA 5HYJA 4XVUC 3ECQA 2XFFA 4KXZI 1D9KA 4W93A 5EBMB 2X5PA 1HQRB 5E6YA 4YXLL 2CBVA 4YLQT 1WZKA 1T22B 2BS9A 2R56H 3WFEL 3F58L 2CR3A 4LQ1A 4G8EB 4W6YB 1FRGH 2V2XA 2AJZB 1NFKA 5KEZA 1HXKA 4XTRD 1WZ1L 3VGGA 2R2CA 1RUQL 2I60L 2UWEE 5GGVY 4RGND 3VRIB 1MREH 5F7WC 2GJ6E 3LDBC 5A6KA 3KR3L 4JO2H 5TDNA 2YK1H 4K68A 4NQXB 5DZOA 3ZHDA 1WUNT 2FDMA 3NAAH 1WIUA 4L4TD 5DD3H 3D2UB 1JZ8A 4G6KH 3LKPA 1GPOL 1T21B 4HUVB 4I3SH 5EU6D 4HD9A 3IGAA 5CUSH 4V2CB 4N0YL 4G6FB 1C8QA 3SE3A 3OKLB 2NTFA 1J8HE 1SJXA 3QQ3B 5ADOH 1XIWD 1EO8H 3SCMD 4YH6A 4KDTA 3MRNA 1KWKA 1IM3A 1PKOA 1BAGA 2CCRA 2IBZX 4PY8I 2R56L 3LIZH 3QUZB 4O5LH 4X4ZA 4U1KB 1MRCH 4ZXBD 1FRGL 1VBUA 2JEQA 1U91A 1ZVSA 4GAJH 4KH2A 4LLDA 5FDWB 3RNQA 3BP7A 1E4JA 4P3CH 1R34A 3VXUB 3OKKA 1MREL 4JO2L 3BQUB 2YK1L 2E27H 4V1DD 4RFNB 4KK5D 2VXTH 3NAAL 3S3JA 3ZE1F 4MAYB 4E0RA 5DSCB 3BFOA 1E0OB 2QBWA 4G6KL 3MMUA 4MGXA 5DO8A 3KPLB 2QMJA 1E6OH 5JW3H 3SBWA 2X70B 5CUSL 1E6NA 1M4KA 1U33A 4HPGA 5ABHA 1KN2H 3BYYA 1NJ9A 1IEBB 4QKXB 2AJVH 4FQXA 5ADOL 3ROLB 1BD2A 1EO8L 1JUFB 2VLJA 3HNSH 4LVEA 4N5UA 3LS5H 3HUJA 3LIZL 4LBEA 4MA1C 4O5LL 1RV6X 2RFXA 5H94B 1CT8A 4R4BB 3RZWA 1ZS2A 3BW9A 3BIKA 2W07A 3HHRB 4GAJL 1XF4A 4HKBA 1XSIA 2KQMA 1I1AC 4F9LA 1AHWC 4HTYA 4FLSA 3NFNA 3CK0H 4XXDA 3X14A 43C9B 4PTWA 3PP3K 1TZHA 3V7AE 5D1XD 4KUZH 5HHMB 2EH8H 4PGDA 2E27L 5E2JA 1SR0A 3OZPA 4PJ8A 4CADA 3PQYD 1UKQA 4JFEA 2VXTL 4JFQB 3ZKNC 4KROB 2ZOKB 2ICCA 3QR3A 1E6OL 4OFKA 4LSTH 5JW3L 4WTXA 1NANI 2YD5A 4NP4H 5IIEA 4LCWB 1KN2L 3P9LB 5JORB 1JF1B 2AJVL 2J74A 2X89D 1KTKE 5DD6A 1A5FH 3CSPA 3HE7B 5AZEH 4CNIB 1ED3B 2LE9A 3VXRB 2J7DA 2X1XR 3HNSL 1HIMH 3L3DB 5KS9B 1ORSB 3BUDA 4B7LA 2L7UA 5K9QG 1S7XB 4D0DA 1X4ZA 3UPRB 4LK4A 1S7RB 1BIIB 2QF8A 5JW4M 5ACLA 3CBWA 3OJ2C 3F62A 4K7PY 3N85H 2Y7QB 3NPZB 3CK0L 4MX7B 1ZGLA 3KNBB 4MQTB 1N3NA 3CAFA 2X4QA 5DJ2A 4KUZL 3MRHA 3CFCH 4OUUA 2EH8L 5GGSA 3VFUB 1INEH 3BHBB 1DWJM 5FHAL 3ZT6A 3FQNB 3QO0B 5FGBC 3VI3E 5CJXC 5DEGA 5LG1A 2HLAA 3MJGX 1K85A 5LGHH 3MGTA 3T2PA 5C3TA 1GC1C 2E9BA 4NP4L 1YJDC 5IG7A 1MH5B 5TE6H 3F12A 1DVFA 1A5FL 2DI8A 1J0JA 4LLVB 5AZEL 3U4EA 2XTLA 3PWUB 3AU1A 1HIML 3BJ91 3WE6A 3QH3A 4R9HA 2IANE 4Z2LA 1I3GH 3L4ZA 3AIRA 1IEAA 2EE2A 3IJHB 1KXVC 3VG9B 1EBAA 2DYPA 1GZQA 3QJHA 8FABB 1PAMA 4KVNH 5F8RC 3HZ3A 3QXVA 5L88H 4M80A 3PWVA 5E4EC 3AHYA 4UAOB 3EOAB 4Y4FC 3RIFF 2GW5A 3TPUB 3MJ6A 1YY8B 3CFCL 1NCNA 1INEL 4YDIH 4W4OA 3ARBB 1IJ9A 4C54A 4IEFB 5EOQH 4U6VH 5D1QA 5C0ND 2DLIA 1KQZA 2IBBA 5LGHL 4LAJH 1OB1A 1PJ9A 1Q9OB 3DRTB 3HC0A 4TVPD 1K3IA 2EIDA 4YZFF 4HMEA 1RIHH 4R5EA 4UR9A 5TE6L 4D8PB 4OB5H 4Y5YC 2XQYG 3WS3A 3AM8C 3Q3GB 1PZ5A 3RGVA 5DI8B 5GGTH 2XYCA 4HUXA 4S0TD 3LKSA 4FFYH 2WVTA 5T3XE 4Z7NE 3ZYIA 2BOBB 5BS0E 1I3GL 2PXYA 4L3CA 3VXNB 1TFVA 4LCCB 3QDJE 4KVNL 2K1MA 3KXFB 2VLKD 4D1JA 5L88L 2MOVA 4MMXC 3G5ZB 5E9DE 2ATPB 3IS0X 4G42B 3SE8L 4M3JA 3DPBA 1FFQA 4CMHC 4APQC 4YDIL 1F45A 3HRPA 2WZPD 4BH7A 4C83A 4ACPA 3WMCA 4GKLA 4U6VL 4UQ2B 2BX5A 2BNUB 1LE9B 2I5YH 5HGDB 3VM5A 1U58A 3M6DA 3MNVB 3S5ZA 3FOLA 5DVMA 1MHHA 1XCWA 4AMKH 5JXED 1IQDA 1RIHL 1G6VK 4AIUA 3P0GB 4OB5L 1V6WA 2F2HA 4N9OB 3FMGH 4JY4B 4PJBF 4JHOA 1OQXA 1HDMA 4NNXA 5GGTL 3IF1B 5IOPA 4QGTA 1JHTB 3ESUF 4FFYL 4HUWA 1A7BA 2AXHA 3E2HB 3CVIH 5IMLB 5KBNC 1LLOA 3RM8A 2WBJC 3BO8B 4UU9B 3CFEB 4PPTA 3NCYS 2CJUH 4UQCA 2X4SB 4ZQKA 4AG4H 1TIUA 2X7LB 3ZE2E 4MD0B 3BGMB 3C6SA 2WQRA 4J8RA 2H6PA 4S2SB 4P4KA 5JW4Q 3KLDA 3VIPA 1QI5A 1N7MH 5TDOA 1A22B 1MQRA 2A3BA 5IBLD 4GBXB 5IEKB 2I5YL 2NY3D 1J86A 2RGMA 2ICWJ 2VABA 3MJ8A 4RGOH 1KGCD 3H9SA 5IV2B 3GMNB 3KPRB 5KG9B 3IS1X 1MUJB 1ZHLB 2WW5A 4JCMA 3FMGL 2HP4A 1QSZA 2EIZB 2OJEA 3NCOA 3AYRA 3OKOB 1X9QA 1YC7A 4XPBH 3TBTA 3BEVA 2CLVA 1YEDB 2XOTA 5ACZA 3RJXA 3FQUB 5SX5K 3D69A 3CVIL 4NPYA 3BMWA 4F7TA 3OKYA 2M1KA 2X1QA 3VMPA 1I8MB 2BVPB 2CJUL 2WBKA 4R7DB 3BWAB 1A7RH 5B21A 1QLFB 4WFED 3KLHC 4H88H 2X0YA 3OXSB 1OAKH 4RGNB 2AI0H 5F3HA 3WXWH 4K8RD 4TQEH 2AQ3A 2LAGB 4X6BA 3WNKA 1N0XH 3EYSH 4XT1C 3VDCA 1KPUB 3Q5YA 4NCC2 5IW1A 4C58B 4RRPA 2VAAB 1R7OA 4L4TB 3KS0J 1BFOA 1JHLH 1MCHA 4Y1AE 3EJQA 5EU6B 3OLIA 3DX9B 1IAOB 4RGOL 3FB7B 4KRPD 5TF1H 1X6LA 3MUJA 2VH5L 1XIWB 1NGXB 1XR9B 1T5WA 3JV6A 3SKUD 3SCMB 3WJLC 2GTWB 4XPBL 1F6LL 2EO1A 4P5TA 3H3BC 1UCTA 3MBXH 3PABA 5BJTB 5I0ZA 2XICA 4ZXBB 5FB8A 3DX1A 1T1WB 2OLDA 1A7RL 5EU4B 2HFTA 4H88L 3NIDE 3IT8D 1IGMH 4R4ND 4S1SH 1BWMA 2NX5D 5I1DA 2AI0L 4LVHC 3WXWL 3RTQA 2ITCB 4TQEL 1UUQA 1N0XL 3EYSL 3HG1A 3IJSA 2V2WA 1FNLA 3GMPB 4GW5B 1JNLH 1VEPA 1QACA 5BZDA 4NRZA 4BA8A 3IDXH 1IQWH 1JHLL 1Z3GL 4M81A 2EPLX 1W3KA 3QDMB 3BH9A 3RX8A 5FO8A 5TF1L 2BCKA 2PYFB 3OZ9H 5IXEA 2FEDD 4ZUVA 2HFEB 3C8KA 4Y0GA 1J0IA 1QNQA 1MW1A 4P99A 5DRWB 1T1ZB 5J06A 3QISA 3MV9E 2E7MA 3MBXL 3UZQA 1F3DH 4W87A 4Y2OA 4O4YH 1JF6A 3V8CA 4Z77A 4WI3A 3WKZA 4S10A 1TZGH 3PNWA 5DD1H 3WH5A 1UA7A 3QEQA 2X2JA 4YHPA 4HGWA 1IGML 2BMKB 4S1SL 2R0KH 1QFUH 2VLRA 3W9DA 3ULUD 4CN6A 3ZOAA 1QSEA 1DEDA 4YGAB 3TYGH 3MRFB 5D1XB 3T0EE 1KXQE 5IVOA 5HY9B 1E0XA 1JNLL 5HYEA 1CGTA 1QA9B 1D5BA 5C2UB 1PEZA 3L3KB 2XJ7A 1UM6H 4WHTB 3IDXL 1IQWL 4W6XB 4UFMA 1DN2A 2NXZD 4GZEA 1U8HB 4I48A 2D23A 5JZ7D 3UX9B 4X5WB 1H3UA 3OZ9L 2DKUA 1GQLA 3EAKA 4LXFA 1HP5A 3BXWA 4H25A 1R3JA 3OMZA 1TDQA 2YHGA 3W24A 2V2TB 3H0TA 5SV4A 2WLYA 2VRJA 2J12B 4RZCA 5DK2A 4V27A 2B4CH 4KI5E 3BXNB 3OTTA 5HYJE 4O4YL 5E9AA 2XUCA 1KELH 1JPGB 2VDKH 4U5KA 3GNPA 3R4DA 1U3HA 4ZFMA 5DD1L 1SFSA 3HI5H 3HMXH 4ODSH 3JVGA 4K8RH 4RAHA 3RMEA 4Y2DB 2R0KL 1QFUL 3L3GB 4I0CC 5F9WB 2YUVA 4FTVA 3BCDA 3OR6B 3TYGL 2V5RA 5BVJB 4PMRA 3MCLH 1AE6H 4AL8L 3VW3H 1UM6L 4O51A 3VWKA 2EH7H 1BFVH 4WUUD 2GT9A 3EJUA 3EOBB 1EVTC 1T7XA 3WBAA 5CZXC 1NDMA 4FNLH 2A3EA 3EYQD 3ZJ8A 3CDCA 3TIEB 4P2OA 4R0LA 2YUZA 4GKSB 2NMSA 4YNYA 3MV7B 1KPVB 2B4CL 4WDIB 3WY4A 4QLKA 1BVLB 1Y0LB 1UJ3A 3AS0A 1H11A 1L0PA 1KEGL 3ARRA 3CUIA 3FY1A 2ICEB 3L5WA 1KELL 1A6UL 2VDKL 4CRPA 1JPTH 2ZSVB 3AIWA 1QG3A 5SWZB 4GAYB 3VXQB 3HI5L 3HMXL 5D1ZA 5HDQH 5ABFB 4ODSL 5E2VH 1JGEA 4K8RL 4E4PA 2QR0A 3T4AA 3EZJB 4S1QH 4IMLA 2DIEA 1Q9WA 2ATKB 5E2TH 1QSFD 3O3AA 3PL6C 3MCLL 1AE6L 5E08H 3VW3L 3BAKA 2EH7L 1BFVL 2BVEA 5CS7A 3WY3A 1K6AA 4GAFB 1V08A 5I24A 4HIHA 5J11C 3MCG1 1V0LA 2RGSA 6CGTA 4FNLL 4F7PB 5IB5B 1I7UA 5D9MA 1MCJA 2ORBH 4WFGE 3RVXC 1C90A 2PW2A 4PJGA 2F8VA 4C56A 2FX9H 3AAZA 3VFNB 1E71M 5JHDD 1T1XA 3RRQA 3U9UA 4WGWB 1NGPH 2XY1A 3MFGB 1BD2E 1IGIH 1M71B 2G9HA 1G9NL 5AAMA 1RFDH 4JN1L 2VDMH 2VLJE 4BQ9A 5HDQL 3ULUH 3CDFA 3C5ZD 5E2VL 3OPZL 4F3FB 2VLKB 1NEUA 4Z7UA 2VQTA 4S1QL 1CGXA 5TE7H 1J0KA 4JHZA 5LQBH 2ITDA 4M93B 4NDMA 4Y19A 5E2TL 1Z32X 3ILPB 3GM0A 1DWIM 5E08L 4AIZA 3PWPB 4U0RB 2J7FA 2E3ZA 2XTJC 4QTHB 4F7EB 1Q6EA 3GXIA 4P5MB 3WY2A 1AH1A 2PO6D 3DX7B 1KTDA 1W0YT 3CH1B 5D5MB 4JFEE 4F33B 3RNKA 1A3QA 5DK0B 2CUMA 3MUAA 2ORBL 1NEZA 4L3EE 5I1JH 2NXYC 3RIFK 2AP2A 2FX9L 4WU7B 5I2IB 3PTMA 3TPKA 3L4UA 1IM9B 5H8DA 1NGPL 1EEYB 1IGIL 5D7KE 3V5KB 1RFDL 2DLTA 5KVGH 1HWHB 5IT2H 3ULUL 4K7PX 1OLZA 2BHZA 2AW2A 3U7BA 5TE7L 1NBZA 1VJSA 5LQBL 1HKKA 4AMCA 4BKLA 3HZYA 1SHMA 3L6FA 5B3JF 3JXAA 1FYTD 1KNOB 3AFBA 2H1PH 3PWNA 1WFNA 1GVIA 4Q6IA 3DURA 5AYIA 2PW1B 5DFAA 4BYHA 2NY2C 2NY3B 5J56B 4KDTC 4GXUN 3W26A 2MPAL 4YN5A 3TCLA 3VCLB 4DFHA 4MJ4A 3BP4A 4U7MA 2SEBA 3NFPB 2DKMA 4YEEA 1SYSB 4NXKA 2W0KA 5I1JL 5L0QC 4BSWB 5FHBH 2ZPKH 2HWZH 4M43H 5JQ6L 2F5AH 2YL8A 5FO9B 4PRNA 4KQ3H 1OTTD 5D7IB 1UKSA 3GSNH 5GXBB 5IT2L 3OKMB 1RK0B 1WEJH 5JBEA 5F9AC 5HVHC 2G3NA 4HUNB 4WW1B 1W0VA 2EDHA 1EERB 1T20B 4J4PD 3SBWC 5D7LA 1W72H 1CS6A 2XPGB 2DM3A 5GJTL 4FXLA 2H1PL 4WU5A 3CZEA 2CIIA 4FQXC 3LB6D 5E5UB 3C2AH 5I16A 5FDYA 4QHMB 1I3RB 5SWQA 1GZPA 4UIKH 2DQIH 3IDJA 2PWEA 4KRPB 2WC4A 4XZBA 3CFDA 3OKDA 1BECA 5IFJA 2OI9B 1P7QA 3BDBA 1AIFA 4WNQB 1TPXC 1A02N 1BYCA 3EZ8A 5F6HJ 5E6IC 5FHBL 4F9LC 2ZPKL 5HPMB 3GJFH 1I4FB 3QNYA 1NFDF 1OSPH 2HWZL 2VITB 3QSKB 4IRJD 4M43L 5HVWA 2EPKX 2F5AL 2ED8A 4QCIB 3Q6GH 1F4XH 4KQ3L 4EOWH 3GNOA 4IRSB 1A6VH 3GSNL 1BX2A 1MW0A 1JAEA 3RL2A 5EZOH 4ZNCD 4HLJA 2NX5B 1WEJL 4MHHI 1M7DB 4KRTA 3HUJF 1W72L 4L9DA 3V6OC 1NUNB 4CUCA 3RDTB 1H3TA 3C2AL 1N5AA 3W5NA 2UY3A 5E8OB 1LDPH 4XBEH 1Q38A 4NNYA 1MFVA 4MVBD 4UIKL 2DQIL 1A9BB 2AJUL 4MWFA 4D94A 2WCSA 4OZIE 4M82A 4NQDA 3BVTA 1E6JL 5D8ZA 3CSBA 4S11A 4KRNA 1L4IA 1RH9A 5GRWA 4OCLC 3PHOA 1WKYA 1QO3A 2IAMC 1XYZA 1U8IB 2X6MA 5DURD 1LEIB 2QKIB 1KTBA 2WMIA 4JAMB 4MJ2A 4ZFOL 5FYLE 3QXDB 3Q6GL 4QYOB 1F4XL 1T0PB 4PJ5A 3AIBA 2CQVA 4PRID 1MEXH 5EZOL 4ZPVB 2EXWC 5KW9H 1B0IA 3NUKA 1FZJA 2VR4A 4WW2A 3QCTH 3U46B 4PJDB 3MLRH 1C91A 3CZ8A 3WN6A 4V2XA 1XGRB 2Z0BA 2C9AA 3F5WA 3B5TA 1F4AA 4P3DA 2NXZB 2B8OT 3UTTA 1UEMA 3PV6A 4OD3L 5BV7H 2YN3A 3J8F7 4X9YA 4KJWC 1NAMA 5HI4D 1T04B 4YFLI 3TA3D 3BSGA 3T65B 2HAZA 4G6AD 3DETD 4NN7B 3MC0A 2R1WA 3H9SE 2J8HA 3D5HA 2V7HA 1BZ7A 1MFEH 2G75A 4PJIB 1R75A 1DL7H 4OF5A 5FGCE 5E95B 5DJ0A 4Z7WB 5IB3A 2JLLA 1BG4A 1MEXL 2FIKB 4UILH 1IKNC 4NQUA 4U1LA 1B88A 1KT2A 3QCTL 3QEUA 2CMRH 5DJYA 5GRVK 3WN5A 4MDPA 2E8ZA 1CLYL 3MLRL 3VXPB 3OQ3B 1RQ5A 4JPVH 3SDAC 4FQIH 2OP4L 4WUUB 2P8PA 1E0WA 4O02H 1ZSDA 5F70A 5C0BB 1QLEH 4CKVX 5BV7L 1QR1B 2H26B 1X5GA 2W0PA 3EBAA 5DTFB 1AGEA 1UWUA 4Y4KC 1F13A 4WFHD 4WWKC 1YQ2A 3FNDA 1E1EA 4GQRA 1OIFA 3ARPA 2CBIA 2W0FB 4Q6YA 3S35X 3LXAA 3VXTA 5B3NA 1CQKA 1KPRA 1FIEA 1ROWA 1BF2A 1MFBH 1MFEL 3C2SA 1HYSD 5F97E 4XHQA 1V7NH 1DL7L 3VA6A 1FVDB 3H7BA 4HULB 4RE2A 3MO1A 1LP9F 4ODWA 1NMAH 2OTUB 2NLJA 3R06B 4KRMB 4R7NA 4PV8B 4UILL 3JWOH 2YL5A 4G6MH 3MV8A 4JKPH 3C5SA 2CMRL 3MUY1 1CLZH 3GIVA 3QO1A 1R85A 4JPVL 1DE4B 3KPNB 4ZSOB 4RA3A 2EACA 5HHXH 4O02L 4XBGA 4X6DB 4AZ8A 1QLEL 1UQZA 1AC6A 3DGCR 3PP3H 4LHJB 4MA7L 3HG1E 3ULSB 4IOFD 2BSSA 3VM7A 3AICA 4LOUC 2WP3O 4X9GA 2PB1A 1LWHA 5IHRA 4GRWE 1ZU8A 1LGVA 4UTAH 5E1QA 2Q7YB 3DROB 3U2SA 1OP5K 1KIPB 1C08A 2AKRB 5JHDB 3W6MA 1MFBL 1RJYB 3WKMH 2OZ4A 1XFPA 2OSLB 1EXUB 3O41B 1U0QA 4NZTH 5B39A 2WVVA 2Y24A 4P4KC 4AD1A 1V7NL 3EIFA 4RDQG 1AD9A 1WZAA 3LPOA 3NMEA 4ZFOB 1GQIA 5F1NA 1TZIA 3LKNB 3JWOL 5FCZA 3RI5F 1A4JA 4G6ML 1E4NA 3CUPB 4JKPL 4CU8A 2FO1A 1CLZL 4CD8A 3QEQE 4PCTA 5BVPH 1T6VN 2HT4D 1I85A 2VLRE 5HHXL 5EBMA 3CTTA 1QSEE 1HQRA 2WV3A 4G6JH 4LASH 5I15H 1MIMH 1T22A 3T2QA 3C60A 3QFJD 5DMGD 4G8EA 2NCMA 4AW7A 2AJZA 2J25A 3GJEA 5E7BA 1VPOH 2P8MB 2XKSA 4UTAL 3A23A 1JP5A 2XY2A 3BZDA 1CI5A 3B3IB 3C09B 4GO8A 3VRIA 3BRDA 2P24A 3SO3C 3WKML 3UYPA 1HYRC 4NZTL 3NN8B 1ZXQA 4NQXA 1A7QH 3QWQB 3R8QA 1UWRA 1Y18B 3D2UA 4AD5A 4AEIH 5T1LD 3ARGB 1T21A 2BVOB 2P5WD 4HUVA 3LPFA 1XGPB 4PB0L 1MW2A 3WF0A 1HTYA 3OKLA 1EZVY 1OINA 2JJWA 3FQRB 1FYTB 1A1OB 4QAWA 1W9DM 3QQ3A 5BVPL 4PUEA 3RPIB 5ESVB 3CHDA 2DIBA 2C3XA 4G6JL 4LASL 5DO2C 5I15L 5D6DC 1YEGH 4PCSA 1MIML 5INCB 5BV7B 2F7PA 3QUZA 4U1KA 5I79A 4C7FA 1VPOL 2AS5M 1BQHB 5JDSB 4XNUH 4WTWA 5FDWA 2ED9A 3CLFH 2ZX7A 3VXUA 1VEMA 3MRDB 3BQUA 4HX1B 4JFZH 1D6EB 3TGXA 1TCRB 1WDQA 4NRYB 3BN3B 4MAYA 4RWYH 4AEIL 1H0GA 4FQQB 5AWNH 3KPLA 4MHHG 1C5CH 2X70A 3FCTB 3VOCA 3TIDA 4MB3A 3PHSA 2F19H 2D0FA 1IEBA 2OM5A 4Q2ZB 4ISVA 4FK9A 3ROLA 2GEEA 4GFTB 1JUFA 1FO0H 4XWOD 4PP1D 1YEGL 5J12C 4DFIA 2WUCH 4WK9A 5H94A 4R4BA 3WH6A 1B90A 2R2BB 4XNUL 3TH2T 3ZSTA 4JREC 3CLFL 1LL7A 5C07D 3DX3A 4I18C 4ZUUB 2CGRH 2PF6A 3AYSA 1B3ZA 43C9A 4YPGA 4IRJB 4X9BA 2D4DA 4JFZL 5HI5C 2OLHA 4C56E 4PEEA 3LSOB 1KIRB 2ZOKA 3O3BB 1LHZA 3ZLQC 5AYQA 5AWNL 3BN9C 3AQUA 1C5CL 2BNRD 3MLWH 3OA5A 1T7YA 2W9LA 3U30C 2PTTB 4XVUD 5JORA 3P9LA 1JF1A 1LILA 1IFHH 2H3NB 4XPFL 4Z7UE 4CNIA 4L8CA 5M7QA 1ED3A 3ALXA 1FO0L 3JWNC 3WBDA 4PUDA 4Y19E 4HW6A 5KS9A 3PZQA 3WF2A 3TO2B 1ORSA 1S7XA 1MCOH 2WUCL 5D71H 1RVFH 4X4YB 2DLHA 1S7RA 3S7GA 1HWGB 1BIIA 2ZUUA 3SCWA 4TUJB 3W25A 4GI6A 1UXSA 4QOKE 3JVGC 1CFBA 5I9QB 3O9WC 2CGRL 4I2XB 2Y7QA 4MX7A 5ANMA 4L8SC 2WHMA 5DURB 3KNBA 2X05A 1PZ2A 2R39A 2VL4A 2L0DA 1KEMH 1UR2A 3LKQB 4QHUB 3VFUA 2C4FT 3BHBA 4WVRA 3O3UN 3FQNA 3QO0A 4PRIB 3VWKC 5I6XC 2YUWA 3DRQA 2FSEA 5SX5H 4ZFFA 4OF7A 5FV1L 5I71B 1GJIA 3MLWL 4K9EH 5EU5B 3VRLE 2DJSA 1BM3H 2OW7A 3V6ZB 1N6QH 1IFHL 4I8DA 4LLVA 4P2OC 3VI4E 3PWUA 3HZKA 4WI7A 5KSAC 2E7BA 3RWHA 2XN9D 1ADQA 2YD2A 5D71L 1OGSA 3VXMD 1RVFL 2QQKH 2BRRH 2XXMB 1KJ3H 3IJHA 5DGRA 8FABA 5D1ZC 4TYUA 3LRHA 4L4PA 3WUBA 5IB2B 5A6BD 3EOAA 3JWDH 2EECA 3TPUA 1KEML 1CXIA 1OF2A 1YY8A 1BFNA 3IFOB 1RJLB 1YDPB 1VEOA 2VUOA 3ARBA 1LJYA 1P53A 5FF6B 4M1GL 3QNZB 5MEND 3PZOA 4K2UH 4DWHA 2H45A 4K9EL 3LRGA 1Q9OA 3DRTA 1PFCA 3BPOB 1Q4NX 5CCKH 3CUGA 4WTZA 4D8PA 1UD5A 2XFRA 3ZE0F 1BM3L 1T2QH 3O0RH 1N6QL 3Q3GA 1B0GB 5DI8A 4C59B 4AZ7A 3BESR 4NHUA 5D7LE 1ZBCA 5EULV 3CHCA 2JCCA 3MSGA 2BOBA 5FXCH 3TCXA 5C09D 3N04A 1MSPA 4JDVB 2QQKL 2Y5EA 4OZHB 1KJ3L 1IAII 3PV7A 1I1AD 5H35B 3VXNA 3ZDXE 4X5XB 3HPLB 4LCCA 5ICXB 5I1EL 3KXFA 1RK1B 4PTVA 4ORGB 3G5ZA 2KQNA 3EYOB 4FQLH 2ATPA 3HE6C 4G42A 4LIQE 3JWDL 3K80A 4BK5A 5A6MA 2OXGA 4NO0B 4DM2A 3ZKND 3WQVA 4UQ2A 1HXMB 2BNUA 2ZWZA 4PJGF 1LE9A 5HGDA 4QRTB 1EJOH 4K2UL 4HZ7A 4W4NA 5HTSA 1KIUA 3MNVA 5K9KB 5CCKL 2GJ6D 3HPJB 1T2QL 1FGNH 2CKNA 3O0RL 4JY4A 4FMKA 2BNQD 3TONA 5IHBA 1CD9B 2CPUA 3IF1A 2BFGA 1CECA 1Q0XH 1JHTA 4TN9A 2G5BA 4Z7UF 4GPNA 1FO0B 1E9LA 5IMLA 2KBGA 2X4UB 3BO8A 4UU9A 2L4OA 1CIDA 5IM7B 3MOQA 2UY6A 2X7LA 1EX0A 2JB5H 5J6HB 1ECEA 1NDGB 3BGMA 3GXPA 2W60B 1OT2A 3QXTA 4FQLL 4P7QA 4S2SA 1IL1B 5JDJA 2DI7A 4JQVC 2YRLA 1B9ZA 4N8VG 4Q0XH 3OKNB 4Y8AA 2Z91A 4GBXA 5IEKA 1AKJD 4Q6IC 2OSWA 1EJOL 1WDRA 2DIAA 1QP1A 5IV2A 2EDEA 3GMNA 3LEYH 1KF9B 3KPRA 5KG9A 1MUJA 1ZHLA 3P30H 1FGNL 2EIZA 1HJSA 4XB8A 2R1XB 1Q0XL 4JGJA 3F5KA 3FQUA 1HT6A 4B41A 3VI4F 3QFJB 2CKRA 1JNEA 3FO9B 3OR7B 3ALGA 2BVPA 4R7DA 5CEZH 3BWAA 5IVZB 2JB5L 1QLFA 3CZSA 2YPKB 5I1CL 1ITXA 1N59A 3OXSA 4Y4FD 1XAUA 1ACYH 4L8DB 2X2IA 4J1UB 2BSTB 3IKKA 1KCSH 5D9SB 4ZXLA 1KPUA 4Q0XL 2VAAA 4L4TA 3X11B 2P5WB 3DUUB 1QSVA 3DX9A 1IAOA 3FB7A 3WFZA 1UB6B 1F6AA 2RIKA 3LEYL 3U83A 5B4MC 2ZG3A 3CDGB 3P30L 3BH8B 1NGXA 1XR9A 2P47B 3RVUC 4XGZB 3SCMA 5F6IC 2GTWA 5D93C 1IC4H 3SUUA 5BJTA 2NW2B 1NGYB 4PRPD 1QBAA 5I74C 2DWDB 4ZXBA 4PLJC 3TNMB 1MAMH 1T1WA 1X5HA 5CEZL 1SYVB 5EU4A 2J77A 2W66A 2AXFB 5E5RB 3D4ZA 4XX6A 5A2AA 1QHZA 3GBLA 3ZDXF 1ACYL 5MEPB 3DTXA 3IJ8A 2ITCA 1OBAA 1KCSL 3GMPA 4GW5A 2ZICA 1ITBB 4G3YH 5HBFA 4KMLB 1KJMB 2Z1KA 3QDMA 3LKOB 2EKJA 2PYFA 1JYNA 2XN2A 1QLRB 1WT5A 3DHPA 1U41A 2HFEA 3VGEA 3EJZC 4G7VH 3VGHA 5DRWA 1T1ZA 1FL6A 1IC7L 1U2CA 1MCLA 1IC4L 3MV8E 4M6OH 4MA3B 1D5MB 2WW8A 4W5UA 1I9RL 1DQMH 2WBJD 2RCSH 1T5XB 5C08E 2CDFB 1MAML 1DWHM 1WIOA 3P0YH 2QHAA 2OR7A 5D4YA 4U6TA 5LA0A 5C07B 2BMKA 4PJ7F 2XKNA 1NGWB 1U9KA 4AIOA 2Y36H 5DVKA 4LCUB 1A3LH 3V9FA 3MRFA 5D1XA 3UP1A 2VKXA 2IG2H 5ELIA 1QA9A 3N15A 3L3KA 4G3YL 3DI3B 4K3DH 4WHTA 3VFMB 2VDOH 1GC1H 5HHVL 1ODZA 4H1LA 3QG6B 1YJDH 5E5MB 5IB4B 1UR1A 3BD4A 2IXUA 3MJ9L 1U8HA 4JZOB 5EUOE 2BNRB 5LKNA 4M8UA 3ARFC 2C4FU 1NANH 5CIPA 2M2DA 5DJ6B 2VNCA 3MANA 2X89A 4UTBH 4G7VL 4LEXH 3WLBB 2V2TA 3OXRB 2J7LA 5F89B 4M6OL 5JOFB 3DARA 1CDHA 2GY5A 1LWJA 1DQML 2DAVA 2RCSL 2YA2A 3BXNA 5I77A 3QDGE 1OWWA 1XH3B 2YPLD 2B31A 1CXFA 3KLHD 1NWUA 1MFAH 2VDRH 2DMKA 2A73B 5C6PB 4Y2DA 3AXXA 5F88B 1YY9C 3LDBB 3L3GA 2BVTA 2Y36L 1HWWA 1AXIB 3OR6A 4D0CA 2IG2L 5BVJA 2VXVH 1ISVA 5I8EB 1MCPH 1D5IH 3D0VB 4X6EB 3LV3B 5I75C 4KPHL 4ZE5A 1DLFL 4K3DL 2VDOL 2XIBA 3EOBA 1YJDL 5L2KD 2IGFH 4N8PA 4TOYH 32C2B 3QDJD 4H0GA 1GIGH 1W2KT 5DA4A 5FM4A 1GSMA 1EZVX 2Z1SA 1ZA3B 3H9HB 4UTBL 3TIEA 4GKSA 4QY8B 4H0IA 4LEXL 5HHQA 1S8DB 1HHKB 3MV7A 1KPVA 1BVLA 1Y0LA 2XN9B 5BRZD 1OSEA 1UZ1A 4F8QA 3VXMB 2ICEA 2X1PA 1V3IA 3MUIA 2ZSVA 1V6UA 5FOBB 3U7WH 5SWZA 1JWUB 5ABFA 4U1JB 3VXQA 1MFAL 2FL5B 2XWBA 2VDRL 2JJUA 3GI9H 2FHCA 5TQ0H 2HVJB 3B9DA 4GG6B 4UQDA 3RWEB 3JTSB 3RZCA 2ATKA 2P1YA 1WBXB 2COQA 3G6LA 1ZHKB 2VXVL 3CHFA 1MCPL 1D5IL 5C0AD 1ZB5A 4HA4A 4HHAB 4MXVF 5CD3B 3VXUE 1VB9A 2APTA 3QJFB 4IBLT 2IGFL 1HEZB 2J3SA 5MENB 1R47A 1NCAH 1LDSA 4XVJL 1HJWA 3MRIB 2EDWA 1GIGL 3O8XC 1LTXA 1W1YA 4F7PA 3QZWG 5IB5A 5DJZB 4PN2A 1QNPA 4PGZA 1W2VA 5IUSA 1S46A 2DT3A 1WC7B 1JGVL 1QBBA 2EDXA 5C09B 1M71A 4W8AA 1FH8A 5I73C 2DOCA 3SGDI 3VFTB 1BZ9A 1JIBA 1AFVH 1U8OB 4WWID 1I1AB 4YO0A 1MXGA 5JIPA 4MCZB 3GI9L 4F3FA 5TQ0L 2F54B 2R23B 2VLKA 2WINB 5CSZB 1YEFH 4I5BA 4PG2A 2D3NA 5I1HH 4GW1B 4J6RH 4BZ2H 2UWFA 2XGBA 1QPPA 3ILPA 3IU3A 3RAJL 1OARH 3MQIA 3BDYH 4UV4H 3GSRB 4WO4C 5KANI 3PWPA 3SKMB 4LDLB 5C71A 5DEZA 4QTHA 4F7EA 1NCAL 5ALCL 3KHOA 2QMKA 5HHME 4P5MA 5DT1H 1EFQA 3DX7A 5FYKE 4P2CG 5LGJB 3CH1A 5D5MA 3C60C 5JXEA 4F33A 4EIGB 3P9WB 3J7HA 5DK0A 1A2YB 3GHEH 2YA1A 5GGRB 2BNQB 3F65A 1NCTA 3O3EB 4Y1AD 2C26A 4WU7A 5I2IA 4LCWE 2XWJB 1H3PL 3SOBH 2X42A 1IM9A 1C93A 5D96C 1EEYA 2IC2A 5ITBH 3V5KA 2DH3A 2CUIA 3AIQA 1AFVL 5K33A 3VXOB 3VXRE 2D22A 2VKWA 1G6RB 1U95B 1W9BM 5KS9E 1FVEA 4PD4K 1YEFL 4UZGA 2PETA 5I1HL 5LVEA 4J6RL 4XVTH 5E99H 4BZ2L 3MI6A 4I9WE 5C0CD 1WPCA 1MLBB 4XAWH 3U48A 1L0QA 3QRGH 1JAKA 1OARL 1TFHA 3BDYL 4UV4L 2XM2A 4G43B 5IVXB 2PW1A 4ZEPA 1YECH 5CZXD 3HG2A 2IFFH 2F74B 1G7PB 5DT1L 3VCLA 1FNHA 4JVPA 4EXKA 1C8PA 1HSAB 1DZBA 3NFPA 4WI2A 3TNNB 5IWLA 1K5NB 1SYSA 3GHEL 3P4OB 4S1DC 3B9VA 1RZ7H 4PTUB 1TMCB 4X98B 5KVDL 2XIIA 3FQWA 4F7MB 4BSWA 3GFUA 1QOXA 3SOBL 4ZTPH 2V3GA 3T04D 5ITBL 3AZTA 1OD8A 5FO9A 3TM6A 3A6OA 4L3AA 4EI5D 3HS0B 4PSPA 3GM8A 5D7IA 3HMCA 4OZOA 3OKMA 1BLNB 3ARXA 2GCYB 5E4EB 1UVQB 1RK0A 1OD9A 1IRAY 4Y4FB 3UBXA 5T3XL 3BUPA 4WW1A 5GS0C 1MJJB 1T20A 3BSZH 3MV9D 3PL6D 4XVTL 5E99L 3VDHA 4XAWL 1NOWA 2XPGA 2VC9A 4YC2C 1BF8A 2K7PA 2XHYA 1F90H 3PWLB 4QHMA 1I3RA 2IFFL 2VISB 4HS8H 4JPWH 1LO2L 1IGTA 2EKSB 4LYPA 4Y5YB 3RVXD 3BP5B 4WNQA 4BQ2A 2D7OA 2VQUA 1RZ7L 3QG7H 4Z18A 4JFOB 5DZNA 1BIHA 5GRVL 1I4FA 1NBVL 4PRPB 2VITA 5BMFH 1RURH 3CMOH 4QCIA 4PJBB 5JBFA 3QDAA 4IRSA 3AZSA 4OZFB 2NY7H 3S36H 4PYGA 5M3WA 3GBDA 2NX5A 1KJVB 1BGGA 3IJYB 4CMHB 5F44A 4APQB 3BSZL 3ULVC 4OKVA 3WHXB 5FYJU 2XTJD 1F90L 3KXFE 1D9KD 1N2RB 4LPUA 3RDTA 3OAYK 1OP5H 3CZGA 1IT9H 3HNTH