4IISA

Crystal structure of a glycosylated beta-1,3-glucanase (hev b 2), an allergen from hevea brasiliensis (space group p41)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
316
structure length
316
Chain Sequence
EVGVCYGMQGNNLPPVSEVIALYKKSNITRMRIYDPNQAVLEALRGSNIELILGVPNSDLQSLTNPSNAKSWVQKNVRGFWSSVRFRYIAVGNEISPVNRGTAWLAQFVLPAMRNIHDAIRSAGLQDQIKVSTAIDLTLVGNSYPPSAGAFRDDVRSYLNPIIRFLSSIRSPLLANIYPYFTYAGNPRDISLPYALFTSPSVVVWDGQRGYKNLFDATLDALYSALERASGGSLEVVVSESGWPSAGAFAATFDNGRTYLSNLIQHVKRGTPKRPKRAIETYLFAMFDENKKQPEVEKHFGLFFPNKWQKYNLNFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the endogenous glycoallergen Hev b 2 (endo-beta-1,3-glucanase) from Hevea brasiliensis and its recognition by human basophils.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Beta-1,3-glucanase form 'RRII Gln 2'
total genus 103
structure length 316
sequence length 316
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.39: Glucan endo-1,3-beta-D-glucosidase.
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00332 Glyco_hydro_17 Glycosyl hydrolases family 17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4iisA00
4P7QA 1EO7A 1W2PA 1H0GA 4UR9A 1ISVA 1IZKA 1J0JA 1EQCA 3SURA 5TD4A 1E15A 5AYBA 4Z2HA 3T2OA 4CD6A 1UHVA 2VL4A 3UEQA 1CWYA 5JUVA 4PBGA 2XVKA 4XX6A 5AYIA 4W7WA 3PN8A 2BXYA 5I3DA 3OZPA 1E6ZA 3CUHA 1V3LA 4W5UA 1PX3A 5GPRA 2ZXBA 3W37A 4ZENA 2E9BA 3L4YA 2WB5A 3LPGA 3MKKA 2WC7A 4XB3A 2WMHA 4HA4A 1UR4A 2YOCA 3WQ5A 1BHGA 4GXPA 3VX1A 4CCCA 2ZX5A 4F79A 3SEPA 4HPGA 3CZ8A 3VNYA 4BQ3A 1CBGA 1GORA 4JAWA 1VENA 1QHZA 3RO8A 3WN6A 3SUSA 4WJXA 3PTMA 1P6WA 2VCBA 3PZ9A 2CHNA 3VUPA 3QGVA 5I6SA 1V6UA 4HMCA 1TVPA 4U3AA 1E1FA 1BFNA 3GXMA 1TUXA 1KQZA 1G1YA 4PSPA 2QV4A 1W3KA 3GH7A 1CXFA 4QLKA 3K8LA 2BVDA 1JFXA 4D72A 4J7RA 1KCLA 1GVYA 2J7FA 4HPHA 1OSEA 3BLKA 1V02E 2XJ7A 3WQWA 3AROA 3FN9A 1UR2A 4P7LA 2OSXA 5E6ZA 2NSXA 1WZKA 1VJZA 2JEPA 2WLYA 2F2HA 1V3IA 5M5DA 3D3AA 1W1TA 4V28A 2Y2WA 5ABHA 2CERA 1LWHA 3A3HA 1UR9A 3GXDA 4DM2A 5C70A 5A6AA 4QLJA 1KCKA 1QOXA 3PZQA 3T08A 1XYZA 5IHRA 4TVCA 3VD5A 5A2AA 1SMAA 2WAGA 1JAEA 3U5YA 3NCOA 2YJQA 2DGAA 5A6BD 3A4WA 3WELA 3VIKA 1HKIA 4H41A 5C71A 2JIWA 4Q22A 1DWGM 3A6OA 3OBAA 3CUJA 1IT0A 2PI6A 3T2QA 3WEOA 4ATLA 1BVNP 1WKYA 2ZIDA 2UWFA 4MNLA 1EHNA 4MNMA 5A6JA 4M81A 3ARYA 1UR1A 5EBAA 4A3YA 1B2YA 3AMGA 2O9OA 4JHZA 3WNOA 3L4ZA 3T2PA 1GW1A 3T0AA 3EDJA 2DSZA 3DC0A 2DH3A 3ARQA 2VR5A 3WDRA 3B9DA 5CPSA 1DWFM 7CGTA 1W3LA 5JIPA 1BYAA 1B31A 1LL4A 1LQ0A 2V3GA 4TOQA 3F5KA 3CZLA 1NWSA 5BROA 2CCRA 3WF0A 2J47A 1UZ1A 1C91A 3GXIA 1HL9A 2PBOA 5CLTA 1XRVA 3AHTA 3L4TA 4OIFA 7A3HA 4LGXA 2QPSA 1AVAA 4UZUA 1JZ7A 1J0YA 8CGTA 1WDRA 3PZNA 1C3FA 1M03A 1BLIA 1JD9A 5CXPA 1KXVA 3WMBA 1Q6FA 4XZBA 3W6LA 2DPEA 2YKKA 4BF7A 3ZT5A 4GI8A 1BF2A 4U31A 1HVXA 4CU7A 5JBDA 2WHLA 4NI3A 1US3A 3KL3A 5LA0A 3PTQA 3AS3A 1V08A 4D6GA 5BXRA 1FA2A 4J3SA 3VMNA 4CKQA 1V3HA 1L8NA 1GNXA 2ZXAA 3WF4A 2X1IA 2CBJA 2Z1SA 2ZUTA 2BHYA 2WMGA 1OT2A 1BSIA 1NWUA 4Y7EA 3WD3A 2E3ZA 2E9LA 3WEZA 3PZIA 2W67A 3RM9A 5A2BA 1HKKA 4XUYA 2IUZA 1FFRA 2DDXA 2VZOA 4M80A 4X9YA 3FY1A 4KRTA 2BY1A 4CD5A 2WBGA 1AMYA 2G41A 4ZFMA 4OZOA 4Z2JA 3WH8A 1XSJA 3IAQA 4U2YA 5A2CA 1X6LA 1J10A 1XH0A 2WWDA 3TOPA 1JDCA 1GQLA 5I77A 3RMEA 1DWJM 1GQKA 3W29A 1OCQA 2D3NA 4P7OA 3T0DA 3CHEA 1JF5A 3AIEA 1HN1A 3CHCA 3DYMA 2VZUA 4AZCB 2GDVA 1G9HA 2CBUA 3W25A 3TA9A 5ABFB 2WM0A 3BAYA 4F8XA 3K4DA 3BH4A 2E4TA 3W24A 4OKDA 4UCFA 1MW3A 1GHSA 3BLPX 5DT5A 2A3HA 3WD2A 1B3WA 1EQPA 1I1WA 4W5ZA 3VKKA 1OD8A 3OB8A 1QNRA 1XH1A 4GQQA 4B9ZA 3WBAA 3OZOA 1K9DA 4PMXA 4UFHA 1ITXA 4QCEA 1PJ9A 1WDSA 1MW2A 4IISA 3IJ8A 4F9DA 1HVQA 1SMDA 2GDUA 4MPKA 4CN1A 2OWWA 5M3WA 3OGRA 3ZMRA 1JZ5A 3TP4A 1FH9A 2QF8A 5FL1A 4UQBA 1ISZA 1MXGA 3CMGA 1VF8A 2OWXA 2DT2A 1PX8A 2WW5A 3L4UA 4WF7A 3NSMA 3GXFA 2BS9A 3RILA 5HDRA 4J3XA 4RE3A 3TTSA 1JNDA 1VEOA 2VMFA 1CGTA 1BYBA 1QI0A 1FHLA 2VRQA 1SR0A 2WSPA 4W89A 1MVYA 3ALFA 4FF5A 2GFTA 1F4HA 2PWHA 5DFAA 2AMGA 1PZ2A 4E8DA 1XD1A 5A95A 4MADA 1VFOA 3IJ7A 4PSRA 3CZGA 1MFVA 3W6MA 2EO7A 3WDIA 1GJWA 3EDDA 3ALGA 3OLIA 2OLHA 1V02A 4W86A 2VZVA 4WSKA 3VMPA 2XSBA 4AD0A 1E6SM 1IZJA 2VCCA 2JF6A 3IJ9A 3BAJA 1OINA 3M6DA 1WZLA 4UFMA 4KGLA 2VNCA 3GNPA 3AIVA 3I3DA 5CSUA 3VDAA 1NWRA 1Q4NX 1W9BM 2OYLA 1N82A 4DUWA 4D6FA 3VIHA 2YBUA 1OBAA 4URIA 4W8BA 3NJ3A 4DWSD 4OUEA 1K9EA 1W1VA 1LG1A 1WZAA 3D5HA 2RGMA 1QBAA 3AOFA 1KBKA 3SCPA 1BAGA 3VD4A 1FOBA 1XSIA 2V3EA 3A4AA 2DSKA 3OLGA 3PHAA 2YIHA 5I2UA 4LYQA 4HTYA 2XIIA 1V3MA 1OIMA 2O9TA 2J78A 3AIRA 4JFSA 4RL3A 4NSBA 1ZL1A 4LXFA 1UR8A 3VDHA 2XWEA 3ARSA 2X2YA 1RP8A 4YHEA 2BY2A 3WL0A 4UZSA 4A4AA 3GNRA 1CECA 2WSKA 4YPJA 4B15A 1RPKA 1WB0A 5D9MA 1CXHA 3I3BA 3ZQ9A 1JDAA 1QW8A 4WKFA 3AXIA 4QCFA 3LPOA 1C7SA 1Q6EA 2ZXQA 3ARUA 4CCEA 3A4XA 2WHKA 1SFSA 3WUGA 3FAWA 4WKHA 1OT1A 1UWUA 8A3HA 3II1A 3N18A 1E70M 4L4PA 5HNNA 2WMJA 3F4VA 3JUGA 3AHXA 1E6XM 3AXHA 2NT1A 2UY4A 1O7AA 3G6MA 5D8ZA 2MANA 4AZ7A 4FLSA 4AWEA 5GNXA 3AJ7A 1V03A 3AYRA 4DWSA 1ZBKA 3U5UA 1F4AA 1EA9C 2BVYA 1EOMA 1HJVA 3VIGA 3EYPA 3SUWA 5A6BA 4JKMA 5D9OA 5A94A 3EMZA 4JIEA 2WZEA 5JBFA 4W84A 4W87A 4PMUA 3VM5A 4UNIA 4AEFA 3HMCA 3PZOA 1E4MM 4C7GA 1EXPA 3PZVA 1CTNA 2YBTA 3BXWA 3VGGA 2XVPA 1E9LA 2GUYA 1QI4A 2CIPA 3IK2A 4PYSA 2X8RA 4M82A 3BAXA 5FOOA 3BAKA 3ECQA 2J77A 3N15A 3POHA 2ZUSA 1GQIA 3VGBA 1AQHA 4WK9A 2CKSA 2FDMA 1H49A 4BA0A 3WF1A 1LLOA 1E0WA 4DUXA 5BCAA 5IFTA 4HMEA 3LMYA 2PWDA 3KL0A 5A8NA 1Z32X 2ZWYA 5I79A 1WP6A 2CITA 1W3HA 2Y8KA 1PBGA 2VJXA 1ITCA 3CUIA 4OOZA 2VI0A 3WSUA 3QHMA 4H04A 1RH9A 2WKGA 3SCTA 2CESA 4GZEA 2J75A 2Y24A 4AYSA 1UH2A 1UWQA 1ODZA 3N04A 2W63A 4W7VA 1V0NA 1H2JA 2D3LA 3L2LA 4U33A 3GH5A 4CD8A 4MB1A 4E2OA 4GI6A 4XZWA 3KWXA 4HU8A 2G3JA 1JDDA 4U5IA 2J79A 3M46A 2BHUA 2EQDA 4AIUA 1UOKA 5HXMA 3WMCA 3RPMA 1NOFA 1I1XA 3OIHA 3N11A 3WDQA 2W66A 2BVTA 2G4FA 3ZSTA 2V5CA 4B3LA 3OGSA 5FCZA 2JFEX 3SCNA 3AIWA 3W4RA 3RJYA 3SIMA 3LPPA 4DUVA 2WMFA 3MUAA 4JCLA 1R85A 3MUIA 3WH7A 3DYOA 4Z2LA 2D22A 1B3YA 1CGYA 4E4PA 4ACYA 1RP9A 3GNOA 4GZIA 4MNKA 5BWFA 4GINA 1V0MA 4H8UA 1Y7VA 2BHZA 4K68A 3POCA 3L4XA 4CU8A 1B9ZA 4MTVA 1BVZA 1WNOA 2W91A 3AZRA 2A3BA 5KEZA 3I3EA 2TAAA 2CBIA 3FAXA 1D3CA 1VFUA 1PIGA 3VX0A 1QI2A 3BC9A 1VAHA 4ZE5A 4PMVA 2GJXA 3OLDA 3AHYA 5CPTA 3KEHA 1KGWA 2AOSA 5CPQA 1C7TA 2E8YA 5DMYA 2X05A 3ZJKA 1KXQA 4R27A 2VX6A 1PAMA 4YN5A 3CLWA 4P8UA 2ZICA 1CLVA 4RE2A 3AI0A 3T09A 3UERA 1JXKA 5A1AA 4BCEA 4Z2KA 2DSUA 2NW0A 3WEMA 2WCAA 3AHZA 3WUBA 1US2A 3UESA 5DF0A 1E6PA 2X0YA 3WNLA 1OB0A 3VO0A 1E0VA 3FNDA 5IHSA 3HU7A 3VGDA 1JIBA 3WY1A 4CU6A 1GOWA 2WANA 2WLZA 2O92A 4UFJA 2UY3A 1JYVA 1E71M 1QBBA 1JAKA 2VZTA 2WMKA 2DSVA 3WDPP 1EHAA 1BYCA 4UQEA 2OWCA 1BYDA 3THCA 4Q7NA 1NARA 1UA3A 1UD4A 3VD9A 5EFFA 4HU0A 3RIKA 1C90A 4MDOA 1J18A 2UY2A 3MSGA 2X0HA 2FGZA 3PZUA 1GOQA 2VR4A 3ARRA 1M53A 2JE8A 1E3ZA 1UWIA 4N0RA 1C8YA 4TTGA 1UG6A 1JNEA 1UH4A 3CZKA 4IM4A 1DEDA 5ABFA 5HBFA 1XCWA 3MMWA 4J3TA 1NP0A 3W82A 4UTFA 1CDGA 2ZX6A 4JKKA 3K4AA 2WVVA 3WD0A 3SUVA 2ZWZA 1B3XA 3NSXA 2G3IA 1DHKA 5IDIA 4EK7A 4JFVA 1QVBA 2WBKA 1HJQA 2FH6A 2J7GA 3SCSA 1E72M 4ZXOA 1J0ZA 4IPNB 4HZ6A 1FHDA 4AEEA 1V3JA 1DWHM 1KXHA 2WC3A 5LYRA 3W28A 3ARTA 1EDQA 4X0NA 1LWJA 4UOQA 4ATDA 4AZCA 2WVTA 3O2LA 2J74A 4M24A 3CPUA 4FLOA 4W93A 2GJXB 3NUKA 1TZ7A 3WH6A 2EPNA 4MAVA 2CYGA 4M29A 1GONA 4EANA 5AY7A 1AQMA 3VGHA 3ARXA 3ZO9A 1OGBA 4P8VA 1H0IA 4HOZA 1EIBA 4H8VA 2J25A 3AS0A 5LA2A 3KL5A 1KWGA 2ZX9A 1KGUA 4D6DA 4PMNA 4C7FA 3SCWA 2CEQA 3AYSA 2YDRA 1PZ3A 1UWTA 4C7DA 1I75A 3ZT7A 1CXKA 4PCSA 1WCGA 5CGMA 3S6TA 4AZIA 2JALA 1R8LA 1HL8A 1BTCA 2HVMA 3K8MA 3HJEA 3FW6A 1HIZA 4ACZA 2VURA 2D20A 1E6RA 3DYPA 1MW1A 1QI5A 4A3HA 1UD6A 5CZKA 4CN4A 2CXGA 3RJXA 5ABGA 3WL1A 4MDPA 5D8WA 2PBGA 5A6KA 2VQTA 1J12A 4MB4A 5M03A 4CN6A 1BG4A 5AC4A 3B9EA 3WQVA 1MW0A 3BAIA 1Q6GA 4AY1A 1JZ3A 3AHVA 4WKAA 1NOWA 4FMVA 2XVGA 4F66A 4KMQA 1VRXA 6CGTA 4LYPA 2FHCA 1ZJBA 2C8NA 3VGEA 4PEEA 4LPCA 4PTWA 3WF2A 2YL5A 1VFMA 1TA3A 4FLQA 1VBUA 4AZHA 1R7AA 5E9AA 1HT6A 3SCVA 3VIPA 3VDCA 4J3UA 3K46A 3EMQA 2ZUUA 4JHOA 1E55A 4V27A 2PWGA 1H1NA 2J8GA 4BS0A 1JZ2A 3WMSA 2GJPA 1UUQA 4HZ8A 2XFRA 3GBEA 2VX7A 1CNVA 3AIUA 1E56A 3APGA 1BPLB 1TG7A 4ATWA 1JYXA 2YA2A 2YLAA 1PX4A 4J28A 4PMZA 4J27A 1GOMA 2XTKA 4UQDA 1OWQA 1TCMA 5IXEA 1CXLA 1UYQA 4JFUA 3HN3A 1G5AA 4CD4A 2BNJA 4QFUA 1KQYA 3T0BA 3UR7A 2YA0A 1ZJAA 3QHNA 2XWDA 4AD1A 4NZCA 5D9PA 4L4OA 4FLRA 5CQ1A 3WDJA 1NWTA 2Y4SA 3NDYA 3BMWA 4X0VA 5A6MA 1C92A 1XC6A 4UFKA 4D6CA 1OD0A 3AMKA 1JZ8A 2XFFA 2GK1B 3OLEA 5AC5A 1UQZA 2W5FA 3VOCA 2F8QA 1TVNA 3OG2A 2ZOXA 1ZBVA 2DT1A 4YHGA 3F5JA 5BRPA 5BXPA 3NSNA 4JZ5A 4BQ5A 1CIUA 1V3KA 3BGAA 3RCNA 1TR1A 1LF1A 1YHTA 3FXYA 3E1F1 1CPUA 2PWEA 4AZBA 3ZJ6A 4D1IA 1JI2A 3W26A 4TTUA 1E5NA 1C8XA 4M8UA 2OYKA 4LX4A 3U57A 4CUCA 1XYFA 3EDFA 3WENA 4OJYA 1OGSA 3KZSA 3ZT6A 2IXUA 4H2CA 1QHPA 4GO8A 3AIQA 1ZBCA 2VX4A 1VIWA 1CXIA 1LL7A 1H11A 2B31A 2J7CA 3PZGA 1U33A 3VIJA 5D9NA 3VIFA 5GNYA 1V0LA 2XPKA 1ZU8A 4H8HA 4PMOA 3MS8A 3MV11 1E5JA 1KFWA 1LL6A 1L0PA 3ZR5A 1G94A 4NRRA 4PMDA 4OBSA 1NP2A 4PMYA 1W32A 5BRQA 4AZGA 1BGGA 5I24A 3FHQA 1VB9A 3RM4A 1KGXA 5EFDA 1XSKA 1HXJA 2VT0A 1NOUA 4JL1A 1C8QA 1W2VA 1H09A 2VVNA 1JZ4A 4UOZA 5ABEA 1WO2A 3SCOA 2BV9A 2WC4A 4KGJA 1R87A 4CD7A 2PC8A 3DHPA 4BQ4A 2WVVB 3J7HA 4D6EA 4MJ4A 3ARPA 1BQCA 1KR0A 2Q8XA 4HA1A 5GNZA 2WYSA 2VCAA 1XV8A 4QLLA 1WDPA 4RE4A 5EMYA 4JCMA 3WFLA 2VRJA 1C93A 1W9DM 5I23A 1ZS2A 3AMLA 1QHOA 1GHRA 4Z2IA 4D6IA 2YL9A 4D71A 2GVYA 1E43A 1MXDA 1Q6DA 1KWKA 1GPFA 4AMCA 3NDZA 1E73M 1W3JA 3WUEA 1GVIA 4LQ1A 2G3NA 1K9FA 3M07A 1U30A 1HJSA 4GO9A 2E0PA 1VEPA 2VO5A 1ZB5A 2WZIA 3U7VA 3TONA 1CXEA 1J0HA 1VJSA 4ZXLA 2X09A 4B16A 2G3MA 3MMUA 4B9YA 1UKPA 3AS1A 4UOJA 1WPCA 1HKMA 3W27A 2WMIA 1W9XA 2BY0A 3VIIA 4PUDA 3PBGA 3AMCA 1A3HA 3RDKA 4UQAA 5CGTA 3CHDA 1B1YA 3NIYA 2DIJA 2CETA 2PB1A 1QNSA 4QDMA 4AC1X 3TTOA 1HP4A 1NH6A 4U2ZA 2ZX8A 2D0HA 3WF3A 5DT7A 1E40A 3GTNA 4AISA 4D1JA 1B30A 1HP5A 3N12A 1X1NA 2IXVA 1H5VA 3WH5A 1CGWA 3SUUA 4PRWA 5C8BB 3VTRA 4QP0A 3N17A 2E8ZA 1W1PA 4UFIA 3VILA 1E6NA 1K9TA 3AXXA 1QW9A 3L4WA 4AD3A 1HKJA 4WSJA 1MYRA 3EDEA 4S3KA 1D2KA 1XH2A 1FP9A 1ZBWA 5E0CA 1V0KA 3AFBA 4EKJA 1W91A 4KRUA 2PF0A 2YA1A 4PTVA 4GQRA 1EDGA 3DECA 2WHMA 5FD0A 4JFWA 1CEOA 5KZ6A 3VVGA 3LPFA 1EDTA 4W7UA 1KBBA 2QHAA 3SUTA 2XHYA 1B0IA 2GK1A 2W62A 3U7BA 3EDKA 2DSWA 1JG9A 2J7BA 2J4GA 2YDQA 1UD3A 2VC9A 4CGTA 3IAPA 2ZUMA 1DWIM 5M17A 3WNNA 1H3GA 2XSAA 3WQ4A 3ZSSA 4PMRA 1DP0A 1KXTA 3MANA 1XD0A 3DHUA 1Q6CA 5I0DA 2WZHA 5CG0A 1E1EA 3WUFA 1UWSA 2ZX7A 2E9MA 4W85A 1W1YA 3UCQA 3TTQA 5HPCA 1FH7A 1IV8A 9CGTA 1UQYA 2CNCA 2UY5A 5A8OA 1LJYA 3CGTA 4W88A 3GDBA 1JF6A 1ESWA 1UD8A 1KB3A 3WNPA 1XCXA 1JL8A 1VBRA 4MNJA 1V6VA 3AZSA 3CZEA 3IANA 4ACZB 5DEZA 4M1RA 4CVWA 4EE9A 2D0FA 4N42A 1H41A 4AZ5A 2VZSA 1WDQA 3WQ6A 1PEZA 1SYTA 3CBWA 2DQXA 2FH8A 4LYRA 3GM8A 2CHOA 2CPUA 3EBVA 2VOTA 3L4VA 3MU7A 2D2OA 2ZXDA 2EPKX 3VGFA 2NT0A 2XYLA 1M04A 3AISA 2W92A 4PUEA 1JXJA 5I78A 2OYMA 1W9VA 1JD7A 2YLLA 2VVSA 1XHGA 5E70A 1OGGA 4P7RA 3WD4A 1HX0A 2E40A 1A47A 2QMJA 4HMDA 4CVUA 1D7FA 1QI3A 1WE5A 4AW7A 1UR0A 1WAWA 4IPLA 4JKLA 4UQCA 4EAMA 3VINA 4FK9A 4M56A 3CUGA 3AMDA 1TMQA 1J11A 3ARWA 3CTTA 2QPUA 3O9NA 3VPLA 1QNQA 4GPNA 3PTKA 3MSDA 3SCRA 1YQ2A 3QOKA 3AIBA 3CZJA 5ECUA 3M7SA 3WD1A 3N13A 2WCGA 1HNYA 3B9AA 3K1DA 4KH2A 5JBEA 1ISYA 4PN2A 3AZTA 1HJWA 3F5LA 1V6XA 4AD2A 4NRSA 2F61A 1XGZA 1UKQA 2W61A 2W4XA 2V3DA 2V5DA 4AD5A 1TFVA 3FHAA 4AZ6A 3BAWA 4TVUA 3WH9A 2JF7A 3GH4A 4S3JA 5LA1A 4AIOA 2ZE0A 1U2YA 4B3KA 2EBNA 2CKRA 4AIEA 5I5RA 4MB5A 1S46A 3VNZA 3A47A 1MQQA 4DWSC 3WNKA 3VDBA 4HA3A 2XG9A 2XVLA 3MO4A 1EO5A 2Y5EA 1TA3B 3W81A 3QHOA 1FH8A 2ZUVA 3WBEA 2ZUWA 3WQ8A 3PZTA 1PPIA 1GJUA 2XM2A 4GI9A 4PMQA 2DH2A 2VRKA 1OIFA 1ISXA 4ZEPA 2XM1A 2BXZA 3EMCA 3W53A 4JL2A 4XV0A 4IUGA 4D6HA 3ARVA 7TAAA 4TUFA 5F7UA 5HOSA 3BCFA 4F9JA 3OGVA 4HZ7A 3TTYA 5E09A 1ISWA 1O6IA 4OOUA 2DIEA 5CSYA 2EPOA 4ZE4A 1UD5A 3RM8A 3ZM8A 4HOWA 4Z2GA 3CUFA 2V3FA 2BFGA 2EEXA 1HJXA 2D24A 1CGXA 1GZJA 3VD7A 3CIVA 2WXDM 1W9PA 4PTXA 1RD6A 5EB8A 1G01A 3AICA 1CENA 2CBVA 3WIJA 3N1AA 1TE1A 4P7NA 1HJUA 2GSJA 1QNPA 1UKSA 1DTUA 4W8LA 4TVDA 1X6NA 1JYNA 4TXEA 5A6SA 1GOOA 3G6LA 2DEPA 2WCSA 4D6JA 4ML4A 2J62A 4TX8A 2WVSA 2EPMX 4J3WA 3GZAA 1R7OA 4U5KA 3AS2A 3UG5A 4BQ2A 3QR3A 1EH9A 4CCDA 2FHFA 1G0CA 3L2MA 3W38A 3WKZA 2QMKA 1J0KA 2ZUNA 2J7HA 1QPKA 1JI1A 2BY3A 1B3ZA 4TX6A 5IFPA 1MQRA 2DT0A 5DO8A 5A8QA 4V2XA 2A3AA 4MB3A 3N9KA 3THDA 4MJ2A 1H4PA 2WNWA 5HPOA 3GBDA 2J7EA 3ZR6A 5JIWA 2HISA 1V6YA 2XUCA 4QAWA 3SCUA 1E3XA 1GUVA 2WVUA 2XGBA 5A8MA 1PIFA 2OSYA 4GIAA 1BG9A 2AAAA 4GKLA 5CJ5A 2VUYA 2O9RA 4H7VA 4R5EA 4PCTA 4WLCA 5E0FA 5GQBA 1CGVA 1CGUA 2A3EA 3ZJ8A 1GOKA 3UG3A 4HP5A 2C0HA 1W9UA 2O9PA 5BYWA 2QLYA 2WK2A 4AXNA 4UQ9A 1JZ6A 2EPLX 3QOMA 1ECEA 1J0IA 1QNOA 2WHJA 5D4YA 1J01A 5FKYA 2D0GA 1E0XA 1E6QM 3CH9A 1E4IA 2XFYA 4U3CA 4HOXA 2EJ1A 4J3VA 2WMIB 1ODUA 3MUY1 3VIOA 1GQJA 3ZJ7A 3UR8A 4UFLA 3OA5A 1B3VA 3KE0A 6TAAA 1WZMA 1KR1A 2V38A 3UG4A 1E4LA 5BXTA 5E6YA 1E4NA 3VM7A 1J9YA 3BCDA 3S2CA 4BZYA 2J7DA 3VIMA 5A6LA 3GYCA 6A3HA 3CO4A 5A8PA 1JYWA 1UWRA 3K8KA 3PZMA 1B90A 3MV01 2DT3A 1FFQA 1M7XA 1EOKA 2Z1KA 3O6AA 1MFUA 1V6WA 3MMDA 4DM1A 4P8WA 4DWSB 4OBRA 4P8XA 1MQPA 4GZJA 5CLWA 5FL0A 2XIBA 1AQ0A 5BXSA 1MWOA 1UD2A 3NYDA 1BGAA 1DWAM 2YL8A 4KWUA 3VMOA 3CHFA 3SCQA 2VX5A 3MUZ1 1JGIA 2EXOA 2VTFA 5FIPA 2ESCA 1K6AA 2A3CA 2D1ZA 4AD4A 1VFFA 1M01A 1UKTA 1HF6A 2D23A 2WKLA 3ZIZA 3ARZA 5A3HA 2J8FA 1EGZA 1FP8A 1OM0A 1UA7A 2JIEA 3BSGA 1R86A 2Y8VA 3UETA 2GJRA 3VD3A 3WFZA 4E8CA 1UH3A 1GCYA 3WDHA 4WIWA 4PTMA 1NM9A 2FHBA 4MAZA 4W8AA 3AQUA 3BSHA 2YL6A 2G8ZA 2XVNA 2C7FA 1CZ1A 3B8SA 1UZ4A 3WNMA 1LG2A 1GOIA 1NQ6A 1CYGA 2RGLA 2WWCA 3BMVA 2VQUA 3VU2A 1VEMA 1CLXA 2JEQA 2FGLA 1UKOA 3W0KA 3ZOAA 2YDSA 5A69A 2XGIA 2PWFA 4NF7A 1JFHA 2WPGA 4JFTA 2OSWA 3CMJA
chains in the Genus database with same CATH superfamily
3CM4A 4XAZA 4UR9A 4CD6A 2NLYA 5AYIA 3H23A 4DY1A 4C5ZA 2BXYA 2R14A 3MO7A 4YNGA 4C90A 4W5UA 4A8IA 1XL9A 1PX3A 5GPRA 1IHIA 2E9BA 7TIMA 2WB5A 4L1XA 3KBNA 5F1VA 3OVQA 2HPMA 1KFEA 2BASA 4MPQA 4GXPA 4KPLA 5DY2A 3BE7A 1Q6LA 4HKPA 4WJXA 2VCBA 2F2KA 4GRSA 2CHNA 3CV7A 3HGSA 1BWKA 5FJTA 1TJPA 2V30A 3GXMA 1TUXA 1W3TA 2J9ZA 4NJGA 1VC4A 4S3DA 3TKFA 3K8LA 1EYEA 2BVDA 1GVYA 1S5TA 4UB9A 1OSEA 1YPFA 2CLLA 3WQWA 1J96A 3AO0A 2ZA1A 3PS7A 2OSXA 5E6ZA 3ZVHB 1VJZA 1PXGA 2JEPA 3NR0A 1FQ0A 4FX8A 1Q85A 4AWTA 1EBHA 3QQ0A 3KX6A 1JJKA 3WLIA 1KM0A 4YLWA 3NQCA 1P1MA 1AW2A 1M6JA 4TVCA 5IBXC 1R47A 1DOSA 1UMLA 3NCOA 4I7UA 2DGAA 1DV7A 3A4WA 1PKYA 1WBJA 1OVDA 2JIWA 1EX1A 4QITA 1ONEA 4HQVA 4Q22A 5TIMA 3F2CA 5D33A 4KFOA 3OBAA 4DJDC 3E12A 3FYYA 3GSMA 4K1WA 1R2SA 3GK0A 3DFOA 1J79A 3L0NA 3CUJA 1UIOA 3LHZA 4LBSA 4LH8A 3UYCA 1XDJA 2X41A 3F4CA 4R33A 5K4ZA 2PI6A 3T2QA 3R13A 3WEOA 4U10A 1BVNP 4GBUA 3KLLA 3JS3A 3EGJA 2UWFA 2RAGA 3H12A 1HGYA 1I9CB 5T9CE 5EBAA 5J04A 4J2PA 2O9OA 3T0AA 1XIEA 5KSWA 2I5GA 3DC0A 3ARQA 4K37A 3WDRA 4YWSA 3IRDA 3HJZA 5LIKX 5G2IA 4L9YA 3TDFA 4TOQA 3CZLA 2J24A 3I4KA 4I9TA 1UZ1A 1LZOA 5DRIA 1RBOB 4OIFA 2FZ9A 4DBEA 4FX7A 1DJHA 4BI5A 4LGXA 2QPSA 3KRUA 3SN1A 1TV8A 3M9YA 3STEA 1EJVC 1Y5XA 2AGTA 1WKFA 4V15A 8CGTA 2GSHA 2NV2A 4FNQA 4O13A 3T8QA 1M03A 1XLHA 3WK1A 3CU2A 1JD9A 3CV6A 5CXPA 3WX7A 2JBMA 2DPEA 4BF7A 1XIBA 3BQ6A 4U31A 2DJXA 1HVXA 2RHGA 3EOUA 3KL3A 3S5ZA 1RALA 5LA0A 4O16A 3PTQA 2PLCA 4UTMA 1BXNA 1KRMA 4J3SA 1PDYA 3VMNA 1V3HA 1L8NA 4XIMA 3SAZA 3WF4A 4RXGA 4IXXA 1P0NA 2PTZA 1ZTVA 1IYXA 2BHYA 2WMGA 3PWAA 4JQ4A 4DLFA 3WD3A 2EHHA 3KOFA 3WEZA 3PZIA 3WO8A 5A2BA 4HGXA 2E6AA 4CNSA 3IPWA 4XUYA 5CAHA 1TE6A 3UQNA 3FA5A 1YXYA 1FFRA 3UVIA 2HS8A 1TTJA 4KRZA 2FZNA 1EC9A 3MQTA 4CNUA 4X9YA 2ZZ7A 4CD5A 1VFHA 1AMYA 1JQXA 3SI9A 3WH8A 1FWBC 3SW6A 4UXDA 1CT5A 4CQAA 3WLHA 3M0LA 3TOPA 3OQEA 1XLAA 2EKGA 3W29A 1JF5A 3AIEA 4N2YA 4UC5A 3N25A 4DF1A 2VZUA 4AZCB 2GDQA 1G9HA 2CBUA 4K3ZA 5ABFB 3GVGA 2ISSA 3NL6A 1S2CA 4JTTA 1FWTA 2Q8LA 4JTLA 4ZQOA 3AJXA 3V1HA 4A8NA 4B5UA 1EQPA 1VBJA 4JDBA 3LZ5A 1HW6A 4C5YA 1QNRA 4B9ZA 3GVQA 4NQ1A 5DCDA 2YPIA 2XN2A 4PMXA 1PJ9A 1XM3A 2B7QA 2FZBA 1SMDA 4QR6A 2GDUA 1VP5A 3ICJA 3OVPA 2BGSA 4FOKA 4ZQPA 4I7VA 3D47A 2V8ZA 2QF8A 1JPIA 4XISA 2OWXA 3E0VA 1PX8A 3RLHA 4WF7A 1JCMP 3RILA 5EMUA 3ME3A 3TTSA 3O3RA 3LNMA 1QI0A 2D69A 4Y9NA 2Y62A 2VRQA 3P0XA 2E5BA 1UBSA 3IWPA 2PWHA 4GD0A 3CIWA 2NUWA 1GKRA 5C9RA 3FKKA 4FOJA 2Q09A 4JTCA 2JKPA 1QDSA 3FGCA 3B0YA 1W1ZA 2AQOA 3BG5A 2OLHA 1V02A 1EXBA 5HATA 1E6SM 1IZJA 2VEMA 3GWQA 3SB0A 1TV2A 3BAJA 4ZO7A 1E0UA 3OOQA 4UFMA 3NM1A 3EX3A 3WLMA 3SY8A 4KGLA 2VNCA 3AIVA 1Q4NX 3LHVA 4D6FA 3VIHA 3NQ8A 2FZ8A 1OBAA 3WJSA 1S5VA 2RGMA 1QBAA 3QZ6A 3AOFA 1KBKA 5DELA 1XIIA 1XLFA 1XSIA 4NX5A 3A4AA 3OLGA 3AXKA 4LYQA 1OFAA 5D09A 9RUBA 4JFSA 3OODA 1YNPA 4OQVA 2FTPA 2VFFA 3ARSA 7REQB 3WL0A 4UZSA 3GNRA 3H55A 1CECA 2PU1A 3DESA 4H19A 2WSKA 4YPJA 4M6QA 1QW8A 3PJUA 4QCFA 3FV9A 5FJPA 1Q6EA 3SADA 5AHFA 3BURA 1X38A 2PGWA 3II1A 3N18A 4L4PA 2WMJA 3F4VA 3NL3A 4GYFA 1E6XM 3V5CA 3H26A 3EKGA 4WXYA 1G4PA 3T7VA 3AXHA 3ENLA 4B5WA 1O7AA 2MANA 4GCXA 4AWEA 5CPMA 3U5UA 3V5FA 1EOMA 3SUWA 1ONXA 4ZGYA 3EMZA 3BLFA 4UNIA 3TX9A 5HMEA 3THUA 3L2IA 3GIYA 1ONRA 1JUKA 5FA5A 2C91A 3TW6A 3BXWA 1OYAA 2YXOA 4ZSTA 1TTPA 4GUGA 1E9LA 2GUYA 1QI4A 1REQA 2X8RA 2XZ9A 3BAXA 2A2IA 2J77A 3N15A 2PDYA 4BI7A 1GQIA 2ZRWA 2OKOA 5AZ1A 1N8IA 2PDJA 3WF1A 4DUXA 1HL2A 4HMEA 3OVRA 2PWDA 3NZPA 3KL0A 4PCFA 4MLRA 3MKVA 5I79A 2CITA 2Y8KA 2BMBA 4Z1YA 4D2JA 1PBGA 2XH2A 3CUIA 3HB9A 3W1LA 4Q4KA 6PTDA 1EWDA 3ITCA 1RH9A 3W2NA 2CESA 3KCOA 4GZEA 2A6NA 3BZGA 3W9ZA 1UH2A 1YEYA 3OHIA 2W63A 3V75A 1H2JA 1XLDA 2B7PA 2VFEA 3CXOA 3UZJA 4JYDA 4CD8A 4MB1A 4GI6A 2WOQA 4U5IA 3M46A 2BHUA 5HXMA 3EKLA 1NOFA 3OIHA 2G4FA 1S3HA 2PC4A 4JIQA 3XINA 4M1BA 2D2HA 6XIAA 1DKWA 2WMFA 4H7CA 4IG2A 4KF1A 3MUAA 3OEXA 4JCLA 2V5JA 4MY1A 1R85A 3ABZA 1KFJA 1QW7A 1B3YA 3TV8A 4MNKA 4QGCA 1TWWA 2PDCA 2BHZA 2YCJA 3S6DA 2ATMA 3POCA 4K68A 3CHVA 4CU8A 1S2AA 2QCNA 3G1HA 4MTVA 1BVZA 3UBPC 1WNOA 3PBUA 3C8NA 2A3BA 3U4FA 1PIGA 3VK5A 3W7KA 3NQ2A 3BV4A 3HFYA 1ADOA 1RUSA 2CLHA 2R6OA 1VD6A 4JTGA 3AHYA 4S2BA 4MYAA 5CPTA 1V8EA 1SZNA 2C0AA 5E1QA 1L6FA 2E8YA 2YBVA 5DMYA 2TPSA 3ZJKA 4QQ3A 1OZQA 2VX6A 2AAMA 1MUWA 5LIUX 4G9PA 1KTCA 3DC8A 4G7EB 1SO6A 5A1AA 1ZQ5A 2NW0A 1JCNA 1T8QA 3MP4A 3P5ZA 3WUBA 1MMFA 1E6PA 5C5YA 1OB0A 4AB4A 1F07A 3UZWA 2W79A 3QFEA 1ZUAX 3H7VA 3UW6A 2Y7EA 4LF1A 2EJAA 3GS6A 1O68A 2OZ8A 2OWCA 3P84A 1O95A 4XKMA 3VOHA 3NAVA 4HYWA 5MHBA 2QCDA 3GDRA 4HU0A 3GLCA 3BW3A 1AA1B 4IMCA 3H4GA 4KEVA 2FGZA 2DIKA 1IEVA 3V3WA 3PZUA 5AHEA 2VR4A 3ARRA 1M53A 2JE8A 1R2TA 1A49A 1UWIA 4TTGA 4K8EA 3UWZA 5ABFA 1XCWA 2BSLA 2IKHA 3W82A 4UTFA 3T81A 4FXRA 3WD0A 5B7ZA 3UVAA 1W31A 3SUVA 8XIMA 1B3XA 3M5ZA 2OGYA 1DHKA 1X8CA 4EK7A 4DELA 3WBXA 2FH6A 4YTTA 3LGEA 1E72M 1J0ZA 3LLDA 1FHDA 1DJQA 1RCOB 1S2VA 3GDLA 4XZ9A 4UOQA 1Q6OA 4AZCA 1K8CA 3O2LA 2J74A 4BEQA 1Q65A 4NAEB 2EPNA 2CYGA 3LCWA 3P5YA 1GONA 4MGGA 3N14A 1GEQA 3ARXA 4JTQA 2I9EA 1GVEA 2P8CA 3JZUA 1KM5A 1EIBA 3L12A 4H8VA 3FVMA 1KWGA 2HPIA 4D6DA 4Y6GA 2O7QA 1EUNA 4ZFCA 4F0KA 5AECA 4HNLA 3AWNA 1PZ3A 5G4WA 3HG5A 3MT1A 2FMOA 1I75A 4C7DA 7ENLA 3APYA 2ICSA 1CXKA 4OUIA 1WCGA 2Z1VA 1ZFJA 3NPVA 4IFKB 3LB0A 3K8MA 1QFEA 3CYVA 3M0ZA 3TFCA 4DZHA 4O1EA 1UD6A 3TC6A 1L6SA 2CXGA 3RJXA 3WK2A 3HGRA 3DDMA 1J12A 2IPWA 5M03A 4CN6A 2NUXA 1BWLA 1H51A 3C5QA 3PUDA 2A21A 3UJRA 3WQVA 3BAIA 1QK2A 3W7DA 4FMVA 1IEIA 6CGTA 4FNTA 1DBTA 4X22A 3UZYA 2FTYA 4RV8A 2YL5A 3F4DA 4FLQA 2B0MA 1VBUA 3EWCA 3VDCA 2QUNA 4J3UA 4ERIA 3K46A 4TR9A 4JHOA 4C6NA 1H1NA 2C15A 2J8GA 1JZ2A 2XFRA 4FX6M 3KTXA 4HNOA 3MCMA 3TMQA 1TVLA 3KRBA 1ZCCA 1JYXA 4PMZA 2FDSA 2Z24A 4MKSA 3UP8A 3QXBA 1EUAA 1TCMA 4I9MA 4YVVA 3ABRA 4LFYA 3BLLA 4DB7A 3G0UA 1UUOA 1G5AA 1DXIA 1W5OA 3T0BA 5L6UA 2NWSA 2A6LA 2A5HA 3W72A 3LCIA 5D9PA 5AHNA 2PP0A 1ML1A 3NDYA 1C92A 4UFKA 1OD0A 4C6BA 3BQ5A 2GK1B 4LBUA 4IIHA 3QGAC 3G1XA 3M4HA 1UQZA 2W5FA 3VOCA 2F8QA 1AZ2A 1IT8A 1KV5A 3NSNA 4BQ5A 1R9YA 4GX8A 1UWAA 1J2BA 1FWSA 3RCNA 1YHTA 1LF1A 2ODOA 1BXBA 1CPUA 4AZBA 3MWAA 1JI2A 3W26A 3WLOA 3V0UA 2PGRA 4M8UA 4DXVA 4H1ZA 1AUSL 1WXZA 4LX4A 2IPJA 2HROA 1JR1A 2OPJA 1OGSA 1VCGA 4K39A 4ZOEA 4Z0JA 3ZT6A 2E6DA 3UCCA 1SUXA 1DQXA 2DQWA 3M5VA 4JQ3A 2QCGA 3LEPA 1K1DA 5K3VA 4MZ1A 3AWOA 1O1ZA 3CQ0A 1R3QA 3F03K 2QJGA 2FB2A 4PMOA 3MV11 2B81A 4HMNA 1G94A 4MSSA 1OEPA 2YX0A 3FJ4A 4PMDA 3KAOA 1W32A 3W7RA 2CZFA 2Z1WA 3UXLA 1VB9A 3RM4A 3KTSA 1SU5A 3DN5A 3QY6A 3S2JA 1XSKA 4US5A 1NOUA 4J40A 3BGJA 4KEUA 1S2UA 1MZHA 2YXXA 4QXIA 2GOKA 2E68A 4WUIA 3GNNA 2BV9A 2PEVA 5C2XA 2YYTA 3QV7A 4IOTA 2PE4A 1TMHA 1T41A 4A8LA 3J7HA 3M47A 1EP2A 5EYWA 1BQCA 4KEZA 4WY0F 3EPMA 3OQ8A 1KM2A 5I3IA 2WYSA 4PH6A 4ZBCA 1TX2A 3C4UA 4JR5A 2VRJA 3ORWA 4WJ8A 4ZQMA 1HGWA 1ZS2A 3AMLA 4XVDA 3W7GA 3G1VA 1E43A 1WUFA 5F2GA 3S9IA 1W3JA 3WUEA 4HZMA 2R1LA 4LQ1A 1WV2A 2DZPA 3M07A 5G4EA 3GR8A 2PDMA 3W3OA 1LWIA 1QR7A 1WOAA 3LTPA 4J35A 1VJSA 2OCZA 5F4WA 2Y0FA 3MMUA 4B9YA 3QZAA 4OT7A 4R9XA 3TAKA 4LS1A 4UOJA 5C9WA 5DCBA 5DMNA 4BR1A 2HBXA 3W27A 1S2TA 2BY0A 1CCWB 4PUDA 3RN6A 3W87A 2PURA 5DMLA 2PP1A 1A3HA 2GL5A 2P5NA 1B1YA 2DIJA 2FJUB 3I6EA 1QNSA 5K9CA 2CZVA 4RJEA 3VZZA 4MUPA 4L4MA 2ZX8A 4F2BA 2D0HA 3WF3A 1TWIA 4W4QA 4XAPA 1F3WA 1HP5A 4AX6A 1WDWA 3G0XA 2IKGA 3M1ZA 3W1AA 3G2GA 3E9AA 3SUUA 3VTRA 3N17A 1XF0A 3M0MA 1XLIA 1PZ1A 4JTUA 4AMAA 4AD3A 1HKJA 1D2KA 2PTWA 3UY8A 5E0CA 1W91A 2PF0A 4NZFA 2E28A 3NNTA 1EDGA 5HINA 3DECA 3R0DA 2WHMA 4NUWA 4EAYA 1ZJHA 2PLMA 5DMMA 1YXDA 2X1RA 1DJXA 3BDKA 3DFHA 4GVIA 1OX6A 3VVGA 3LPFA 1EIXA 1EDTA 3A9IA 3EWDA 3SUTA 1B0IA 2D2GA 2W62A 3H24A 3S5NA 4UTJA 1OF8A 4AX7A 1SO5A 2J7BA 4G8TA 4K36A 2ZTKA 2IQTA 3E49A 3WNNA 4PMRA 4S3EA 5HWNA 3MANA 1U5VA 3DI1A 3DHUA 5A8GA 1FWFC 5C2GA 1Q6CA 5CG0A 4JTKA 2OKTA 1AODA 1E1EA 2ZX7A 3UR2A 4FA3A 2PUZA 4RDWA 1W1YA 2P3EA 3TTQA 1IF2A 4AVOA 4QG6A 1OCBA 3O8AA 2CNCA 2UY5A 5A8OA 3WLPA 3GDBA 1ESWA 3GG7A 2FFIA 1KB3A 3E0LA 1BKSA 1LRQA 2OEKA 1W17A 1VBRA 3ANYA 2C14A 1TELA 3ONCA 3N9SA 1XKYA 4N42A 1H41A 4GYPC 5AC8A 3NURA 1WDQA 4Y2WA 3WQ6A 1PEZA 4RNIA 2TODA 1YTEA 3PUEA 4QJ1A 5F4XA 4NHVA 4TX9A 2FH8A 2YZ5A 4EX4A 2CHOA 3LD5A 3E02A 2CPUA 3I7RA 5G2HA 2REQB 2HVNA 3EBVA 4TQTA 5T91A 1UP2A 4IIFA 4QS6A 2ZXDA 2EPKX 1XIHA 2Q8ZA 4UR7A 1ZGDA 3ATZA 5HJLA 4FF7A 1JRBA 4PUEA 2OYMA 1W9VA 4AVFA 2YLLA 5U4NA 2GUBA 2VVSA 3N2BA 5E70A 3TLQA 1Z3NA 3BUVA 1M7JA 3E6EA 2QMJA 4B3ZA 4HMDA 1EA0A 1P7TB 2H8ZA 1WE5A 4AW7A 1WAWA 4O4WA 3QQWA 1HQTA 3LMZA 1JCLA 2OFJA 1HUVA 3AMDA 1TMQA 1J11A 2VKZG 4S2CA 3VPLA 1EJTC 3PTKA 3B0UX 3N13A 3WLJA 1HNYA 3NZRA 3K1DA 2DZBA 5H91A 3CPRA 4E2BA 3HOJA 1HJWA 2INEA 1DQWA 1JEZA 3PBVA 4YCOA 2HDJA 1DTNA 2ALDA 4AD5A 3IUHA 4HIBA 1TFVA 3BAWA 3QTGA 2JF7A 1ALDA 2OX1A 1H62A 5LA1A 3LXBA 1U2YA 4HSNA 4B3KA 4AIEA 3UA4A 2ZQ0A 4MB5A 1Z69A 1DJYA 1UR3M 1S46A 1MQQA 2PODA 2XG9A 3VFCA 2Y5EA 1TA3B 1FH8A 4GY7A 3WBEA 3P8JA 3PZTA 2I56A 3ES8A 2E67A 2VRKA 1OIFA 3RRAA 4O15A 4JL2A 1YADA 3OA3A 2CWNA 3ARVA 7TAAA 3BCFA 3B8VA 1E9ZB 4PFHA 3PBMA 3IIZA 3KHDA 4XTDA 2V67A 4FHAA 3TSBA 4UTWC 2OQYA 2QCLA 1PO9A 4GISA 5D05A 4H9ZA 3ZM8A 2YZRA 4Z2GA 2V3FA 1KTNA 3GTFA 4QE4A 1N8WA 4RNJA 3W1MA 3VNJA 1CGXA 3DKLA 1GZJA 1VYRA 3MUXA 1RD6A 4JN8A 1NDYA 3AAMA 5EB8A 4IMDA 4F3HA 3INPA 2OO6A 1CENA 3WIJA 3HPSA 1A5CA 4E4FA 3UJEA 1R3VA 1HJUA 2GSJA 2RH9A 4W8LA 4TVDA 1F3XA 4B2DA 4S23A 5A6SA 3HTWA 3NVDA 4MWAB 4NVTA 4Q8VA 3QY7A 3TR2A 2WVSA 3PPGA 9XIAA 1RSCA 2G50A 2EPMX 4J3WA 4U5KA 3IIPA 1H7WA 3HQ1A 3UG5A 4BQ2A 3QR3A 1EH9A 1S38A 1G0CA 3WKZA 2TMDA 3OZYA 2J7HA 4NL1A 4AY8A 1JI1A 4J1OA 3TVAA 1B3ZA 5DO8A 3BOLA 5A8QA 3FSUA 2EGZA 4OV4A 3S42A 2HK1A 3NEHA 4WXZA 1VKFA 4FEZA 4YYFA 3NZ1A 1ZAHA 4L64A 1ZLPA 1ME8A 3V36A 1QPOA 3GU9A 3ZR6A 1V6YA 2XUCA 3BOXA 3LQLA 3DFPA 3RR1A 2VEFA 3VNMA 3OW1A 2WVUA 2XGBA 4GX9A 3SY5A 5CJ5A 2OOGA 4R5EA 4PCTA 5GQBA 2RDXA 3C8FA 3LERA 4AHQA 2EG8A 2CZDA 3VOFA 5BYWA 3TYBA 4KQNA 4UQ9A 3LCGA 1JZ6A 4JY8A 2O7SA 1K4HA 3C0JA 1EC7A 1J01A 3P14A 3BARA 3P2VA 3MSRA 3JU2A 1AQFA 3IIVA 3DX5A 1UIPA 4FS9A 2WMIB 3N2MA 1ODUA 3HQNA 2DV0A 2IKJA 3LRLA 3UR8A 4OVXA 4N9BA 1POJA 4RKAA 3Q45A 1KR1A 3RX2A 2V38A 3PFMA 1R38A 3BWWA 3C2RA 5E6YA 3BCDA 4PE8A 3SJNA 4L9XA 3CL8A 4ML9A 2YB1A 1UBPC 3GYCA 6A3HA 3CO4A 1JYWA 4YYCA 3K8KA 3B9NA 3SDOA 3VXGA 2I5QA 3AUOA 1MFUA 3MMDA 4P8WA 4AIBA 4RPPA 4S3AA 4GZJA 2OVLA 5CLWA 4GI4A 2XIBA 2FLIA 1AQ0A 1OC6A 3R11A 1AZ1A 2Z0IA 1M5WA 1OFDA 4EWJA 3FKRA 1TPUA 1H7XA 3SCQA 2ESCA 3GG1A 1EJSC 1M01A 5T8GA 4DYKA 3ARZA 1UZHA 1EGZA 1M9HA 4V1XA 3GXTA 3UETA 4CQBA 2VGIA 3WFZA 1OFOA 3NYZA 4G6CA 3NGJA 4WIWA 4PTMA 3G0SA 2FHBA 2PP3A 4W8AA 1J5TA 1PWMA 2G8ZA 2XVNA 1CZ1A 1DIEA 4H9MA 3B8SA 2JGYA 1UZ4A 1ZCOA 3CAKA 2HRWA 1NQ6A 1CYGA 2Z6IA 3MBFA 2WWCA 3GX9A 3CH0A 4RDZA 2JEQA 3ANUA 4Q8TA 2Z6JA 3NG3A 1RQHA 4G7FA 5A69A 2W0UA 2WPGA 3A12A 4JFTA 2J27A 4MHBA 3N2OA 1YNYA 3KFTA 4P7QA 1EO7A 1QASA 1H0GA 3LI1A 1IXQA 3SURA 1SJBA 2HVOA 2P0OA 3UEQA 1P4CA 1PKMA 5JUVA 4TO8A 1MSSA 2VFIA 5E5CA 4EP8C 4W9TA 4ERGA 4XZMX 4AHPA 4LC6A 3I6RA 4LV4A 3OZPA 2QZRA 1E6ZA 3CUHA 1V3LA 4ZO6A 4WY0B 4ZENA 3CTLA 2WC7A 4EWND 1V51A 4L5ZA 5G5IA 2WMHA 4GYJA 4YCPA 1UR4A 3WQ5A 4CCCA 3GD6A 4NI8A 4F79A 3SEPA 1IGWA 5REQA 3VNYA 4TV5A 1CBGA 4UCGA 4EXQA 4GC4A 1T99A 1J5SA 3I4EA 3LHWA 4QQUA 3QGVA 5FAJA 5I6SA 4LVAA 1E1FA 4GNVA 1BFNA 4PSPA 1W3KA 3LN3A 3GH7A 5I3FA 1QU4A 5CG7A 4QLKA 2GVEA 4I5XA 3QMSA 1TREA 4OECA 3SECA 1BF6A 3QPYA 3ABXA 2VFGA 4P7LA 3W73A 4NYYA 3TWAA 2DW6A 3TNBA 2WLYA 1KNWA 1I8JA 2Z1XA 1ZALA 4H6QA 5ABHA 3QJAA 2ZRUA 3A3HA 1UR9A 5A6AA 4MIMA 5XINA 3RXZA 3NO3A 1QOXA 1XYZA 2P53A 4X2PA 3VD5A 2ISDA 5A2AA 2WAGA 3U5YA 1A3WA 5A6BD 4HK7A 3UJFA 3DERA 2PD9A 4ZR8A 4XAGA 4H41A 4YJ5A 4AY7A 5IRPA 2OG9A 1OYBA 2R1PA 1FHVA 5BU6A 5CKSA 1ADDA 3LBMA 2C13A 5AB3A 3WQCA 2JKAA 2A7RA 4IPIA 1FCUA 1XLBA 4MNLA 4EACA 1EHNA 4MNMA 4QG9A 4M81A 3QZEA 3MVIA 4JGDA 4O50A 4A3YA 2VOMA 4JHZA 5D04C 3WNOA 4L1GA 1FXPA 2W9MA 3QGKC 1H60A 2PGFA 4DZIA 2DSZA 2VR5A 1FWRA 1G6CA 5JIPA 1BYAA 1B31A 2V3GA 2V2CA 1XYBA 5BROA 3RCYA 2CCRA 1HL9A 1VPXA 1B4EA 2PBOA 2X2GA 3NPUA 3PNUA 3TFXA 3L4TA 3T8LA 7A3HA 1NFGA 3A3WA 5CBBA 5K9DA 4IIGA 1JRCA 2HNEA 4LCRA 1ZJIA 1WDRA 3PZNA 1C3FA 3GDKA 3TYAA 2F6KA 3ZXWA 3IGXA 1KXVA 3C0LA 4L7ZA 4TMCA 3BICA 3PUGA 4O1DA 1BF2A 1LOLA 1C9DA 4CU7A 4K8HA 5JBDA 2WHLA 3K4WA 3TQ0A 3QPEA 1RY8A 3AS3A 2HBVA 2ZZ6A 1V08A 3EWBX 4CKQA 1DIKA 2ZXAA 1BXCA 1G7VA 4IH3A 5EL1A 3GU1A 1IEQA 1BSIA 2QIWA 2OXNA 4MY9A 4YL2A 1IXNA 3MHGA 3T9PA 1DORA 3BCJA 2UV8G 1KM3A 1LQ2A 4LAZA 4G1NA 2IUZA 4KETA 2VZOA 4KRTA 3RK8A 2A85A 2OLAA 4H4IA 2WBGA 2G41A 2Y61A 5I3GA 2P88A 3GVVA 2PD5A 4AUBA 1XSJA 3IAQA 4U2YA 3WQEA 2ISFA 1QPRA 3M0YA 5BOFA 4E38A 1X6LA 2HXTA 1J10A 1XH0A 3TOYA 1JDCA 4XBSA 5I77A 3RMEA 1DWJM 2WQDA 1L6WA 4P7OA 3CHEA 3GQYA 3NGFA 5HNRA 3CHCA 2QQ6A 2GDVA 3LSBA 1FVPA 1EJXC 4GE8A 3W25A 2YCLA 4F8XA 1FWGC 2E4TA 5H8MA 4LRSA 3W24A 4ZQRA 3RF9A 1GHSA 3BLPX 4XD6A 1A5LC 1G4SA 1I1WA 4GUHA 3H6OA 3K2GA 3FJ6A 1TYGA 4O1AA 1ITXA 1WDSA 3IJ8A 5CC3A 3BG9A 4F9DA 4Q6XA 3Q67A 2RDWA 1OF6A 4FNPA 2OWWA 2XN1A 3TP4A 1FH9A 1RQEA 4UQBA 2WW5A 4C6MA 3N4EA 4I6VA 1AMKA 5HDRA 2G0WA 2VEKA 1JNDA 3CWHA 4Q7IA 2VMFA 1S5MA 2QCMA 1AL8A 2OELA 1RJQA 4I90A 3WLLA 4R88A 4W89A 4FF5A 4DO4A 4DF0A 4DO5A 2AMGA 3VZYA 1XD1A 3IJ7A 3CZGA 3W6MA 4C60A 3WDIA 3B0VC 3OLIA 1FDYA 3QTPA 5T9BG 2VZVA 3EOLA 4AD0A 2VCCA 3PG8A 1OFQA 1OINA 1OC7A 3M6DA 3GG8A 4E5TA 4PL1A 5JMUA 5CPOA 3I7QA 4HNNA 3NJ3A 1K9EA 3M7WA 3OIXA 4MFEA 1WZAA 3D5HA 3R1ZA 1X7FA 1TKKA 1A0EA 1PTDA 5HANA 1FOBA 2DSKA 3LYEA 3P67A 5I2UA 3G8EA 5FJIA 4HTYA 3ZS4A 5F2LA 3CT2A 1VLWA 5CZJA 2Q6ZA 2XIIA 3BW4A 4DEFA 2O9TA 4JNZA 2QUTA 1UR8A 1JVNA 4HT3A 3KLKA 1YDYA 3RPDA 4A4AA 4ES4A 2C19A 3R4IA 3GTHA 1R2RA 2ZADA 3HIJA 5D9MA 4ZVJA 3ZQ9A 4BF9A 1JDAA 1H63A 2YYUA 3EWZA 4WKFA 1Y5VA 1NFBA 2Z00A 3ARUA 4H6RA 5IBXA 4CCEA 3A4XA 2WHKA 5H8PA 4WKHA 8A3HA 3JUGA 4A8RA 2NT1A 2I14A 3LS9A 2X30A 4FLSA 4LOCA 1F4AA 5D9OA 4GKTA 2QCHA 5A94A 2INFA 4W87A 1BTMA 2PRMA 3GYEA 3VM5A 3JW7A 2H6RA 3LLFA 1QPQA 3PZVA 4UTTC 3NO5A 3PG9A 1V79A 4QG8A 4JBRA 3GVWA 4PYSA 2G37A 4JX6A 1W8GA 1IQ8A 1XLJA 5C0QA 5E9XA 3POHA 4Z08A 4KFPA 1AQHA 2PGEA 4NAFA 2ZYFA 2CKSA 1ICPA 5M1TA 3LLXA 2IW0A 1E0WA 5BCAA 1O5RA 3E0WA 2WNZA 2E77A 2GYIA 1Z32X 1WP6A 3LHUA 4QDWA 4G1KA 4O11A 4Y9OA 2VI0A 3QHMA 4H04A 3SCTA 3LNPA 4QDPA 3QR0A 5FF4A 4L1WA 2Y24A 1W1IE 1ODZA 3N04A 3QVQA 1MI3A 3C3UA 1DXFA 2V5LA 3VUSA 4LUTB 3S4TA 4U33A 3R43A 2FVLA 2IPFA 3HZ3A 2B7NA 4E2OA 4OWGA 4XZWA 1JDDA 2J79A 1UOKA 3WDQA 2HTMA 3GR4A 3ZSTA 1WYIA 1IEXA 4ZB2A 3SCNA 4MG4A 2PRLA 4JIPA 2QCCA 4DUVA 5J5DA 4X61A 1IE7C 1RJRA 3LCHA 5IOBA 3WH7A 2D22A 1DJIA 1CGYA 1GG0A 1U22A 3UXDA 1RP9A 3GNOA 4GZIA 5BWFA 4GINA 4DZAA 1V0MA 2INZA 2Z2AA 1QAPA 3L4XA 1B9ZA 3HF3A 3DBPA 1NDWA 4RDVA 3SO7A 2TAAA 3FAXA 1GT8A 4BK9A 2VD8A 1GKQA 3LV5A 1VFUA 4ZQCA 1QI2A 3LDVA 3KVLA 4ZE5A 2UBPC 4RNFA 3RUBL 3W1NA 4PZVA 3N2XA 3OLDA 3NQ6A 3KEHA 3T6CA 4DBSA 2AOSA 1C7TA 3P80A 2ZRXA 4JTAA 1KXQA 1F05A 1XWYA 2OU4A 5D38A 3PPCA 1OABA 2OX4A 4ORMA 3UFYA 3GC2A 4Y9AA 3E38A 3PM6A 5G1TA 4RE2A 2O4QA 1PV8A 2DVTA 4Z2KA 4CLMA 5G4HC 3N34A 2WCAA 5DY3A 1GKPA 1TIMA 1US2A 3UESA 3CB8A 2HE8A 5DF0A 2X0YA 3FK4A 3VDGA 1E0VA 3HU7A 2PTDA 1FWEC 1GOWA 2O92A 3B8IA 1KRCC 4UFJA 1T8XA 1E71M 1QBBA 1UC4A 2QCFA 4AH7A 2A79A 3IUDA 2DSVA 4GXWA 1JCTA 1KFKA 5XIMA 5CBJA 3WQPA 3TQVA 2YW4A 4GNKB 1UD4A 3RMJA 3W83A 4C91A 1HG3A 3W2KA 4MDOA 4J3ZA 3GUWA 4HTBA 1H50A 1TPH1 1UG6A 3CJPA 1XDMA 1F3EA 2H3DA 3LU2A 1BKHA 1NP0A 4Y8EA 1CDGA 2ZX6A 4A2RA 1OK6A 1D7KA 4MWAE 4YXGA 3HPAA 3R58A 4C65A 2ZWZA 3G1FA 1OG6A 2DVXA 4JFVA 1XYAA 4Q8PA 3LK6A 2WBKA 3UZ5A 4IPNB 4AEEA 1V3JA 3LX9A 1B4KA 1DWHM 1GVQA 1KXHA 4FXFA 1NSJA 2WVTA 1OQFA 1GVFA 3TNOA 4M24A 3L67A 4W93A 3H7UA 2GJXB 4M29A 1J6PA 5AY7A 3T4CA 1AQMA 3VGHA 1KLYA 1L2QA 3EWYA 4P8VA 1AJ0A 3I6TA 3QC3A 4JTJA 1REQB 1UCWA 4HOZA 1I2QA 3M16A 1I2NA 1QWKA 5LA2A 3KL5A 2A1YA 3GAKA 1OHLA 3OBEA 4GIRA 3WLRA 3TYZA 1J93A 3NXLA 3B0PA 3SCWA 4DBDA 4KKXA 4YTQA 4KERA 1U5JA 4DJFC 2Y88A 5CGMA 3S6TA 4AZIA 5KTLA 1R8LA 4I9JA 3BG3A 3NQEA 1LQAA 2HVMA 1IR1A 1KFBA 1E0TA 2VURA 2DZXA 2D20A 1UUMA 4ZO9A 2BBFA 5CZKA 1TWDA 4CN4A 4BI6A 3R89A 2ZZ4A 2VQTA 3G1AA 1BG4A 1Z8AA 1D8CA 1WKDA 4TV6A 2XVGA 3MC5A 4KMQA 4PBEA 4XKYB 4HB7A 3VGEA 4PEEA 4LPCA 1VFMA 4LANA 1TA3A 1AFSA 5E9AA 4NG3A 1AJ2A 2E5DA 2Y1HA 3LZ3A 2FFCA 2FVKA 2ZUUA 1E55A 4V27A 3WMSA 3OTRA 3YPIA 3LCXA 4ZSUA 2VX7A 2W3ZA 4EF8A 4GOAA 3AIUA 3AC0A 1BPLB 1J4EA 4RPQA 2F84A 2VUNA 1LROA 4AWUA 2YXGA 1XDLA 4J28A 4PUMA 1Q6QA 2QVNA 2PFHA 4J27A 1X8FA 4PRTA 1NF0A 4O10A 2XTKA 3EEZA 5DBTA 4HYVA 4Q8OA 1OWQA 4GUJA 1N2VA 5IXEA 2QJNA 3UGVA 1EF2A 3M6YA 3KM8A 3W7NA 3BW2A 1XW8A 4HHMA 2EG6A 1LDCA 3U2ZA 4CD4A 4NZJA 1RLDA 1RA5A 1XC4A 3QHNA 2QUMA 2XWDA 1W1A1 4NZCA 3U3HA 4FLRA 5CQ1A 4Y8FA 5A6MA 2H8XA 4CNPA 4NNBA 3LV6A 4UMBA 5B7YA 3CUZA 1ZBVA 4YHGA 4ADTA 4KWOA 8XIAA 5BRPA 3FIGA 5A6TC 1ZP3A 4DZ5A 5BXPA 2ACRA 5EBUA 3BGAA 3L0GA 4NJJA 1TRIA 3CYJA 2PRHA 3FXYA 5C54A 4GGHA 3ZJ6A 3QKEA 1WUEA 1E5NA 1C8XA 5AOUA 4CUCA 1XYFA 1EF3A 3W1XA 4OJYA 1JQVA 4B5VA 1YDVA 3HPFA 2ABAA 4JY9A 1ZAIA 4HCDA 1QHPA 2GWGA 4DJED 1Q5MA 5AHLA 4LF2A 5GJNA 1P0EA 1L6YA 1CXIA 4S38A 4L6OA 1H11A 1G4TA 2J7CA 3PZGA 1U33A 2NX9A 3VIJA 1XQLA 1UASA 5GNYA 1V0LA 1QUMA 3MS8A 1LOSA 1L0PA 2Z29A 4YS1A 4NRRA 4IHCA 1PIIA 5BRQA 1BGGA 3MBDA 1P7TA 4XK2A 4XKYA 1NU5A 4QAIA 4LRTA 3NPWA 4JL1A 2PWVA 1C8QA 4C6QA 4UTWA 2VVNA 2AKMA 4Q8NA 4RZBA 4AG0A 3FA3A 5ABEA 1H5YA 1WO2A 4LB4A 3SCOA 4C6OA 5KETA 3IJDA 2WC4A 1GTEA 1UPMB 3RCMA 2ALRA 3S5YA 3U2EA 4D6EA 1KM4A 1BRLB 1KR0A 2Q8XA 2QIIA 3VC6A 1PKLA 5GNZA 3N4FA 4C6PA 4S3BA 1WDPA 5I3KA 4WCJA 1SGJA 1C93A 1W9DM 2Z25A 1GGOA 1HKWA 4D6IA 2YL9A 4D71A 1Q6DA 4R7JA 3NDZA 1EEPA 5CJNA 1KM6A 1E73M 1XBXA 4UMCA 1UJPA 3DH7A 4GO9A 2PMQA 1VEPA 4GGBA 1ZB5A 2VO5A 1DJNA 3VKBA 4JIHA 4B5XA 3KP1A 1Q66A 4O4VA 1CXEA 1J0HA 4G5DA 3EX2A 8TIMA 1ME9A 4DJEC 3DXIA 3E5BA 1U83A 1WPCA 1KA9F 1IWBA 1KO0A 4B90A 3USZA 1XR2A 3DENA 4CNOA 1SSDA 2PDGA 5CGTA 4PGLA 3ITOA 3CHDA 2PB1A 2GVLA 4AC1X 2WZTA 1HP4A 4DXKA 1NH6A 1C9WA 1AW5A 4LY4A 4PFMA 3GHUA 2Q3OA 1B30A 3UWQA 2IXVA 3VNKA 3WH5A 1CGWA 4UTIA 3DFSA 3CQJA 5DCEA 3S0CA 4Y9MA 2E8ZA 3EB3A 3KBWA 1B5TA 1W1PA 4UFIA 3VILA 1E6NA 3IVSA 5MKGB 1K9TA 3H2EA 3L4WA 4NZ5A 4X9SA 2FPVA 5LHEA 4WSJA 5I09A 4RXFA 3EDEA 2QJIA 3WLQA 1XH2A 1V0KA 5B80A 5C55A 1EPXA 1LRTA 2GSEA 4JFWA 2H90A 1CEOA 2R8WA 3M0XA 4V1YA 2OR2A 2E1WA 4RDYA 2GQ8A 1RV8A 4W7UA 1KBBA 4IJCA 2YW3A 4DAFA 3V1PA 3U7BA 5EMLA 3EDKA 4JICA 4QNWA 5LXEA 4JD4A 1ITUA 2HSAA 3EX4A 4PB5A 2FIQA 1S3TC 4UWMA 1XICA 1K3UA 4Z42C 1OADA 2VC9A 4CGTA 2AL2A 3WQ4A 1KKOA 2BWGA 1DP0A 3HPXA 1EWEA 1XD0A 5D2YA 2FMNA 4JHMA 2Z27A 3C2OA 2WZHA 3H2FA 4GHRA 1KM1A 3DAQA 3WUFA 3TZNA 3K1GA 3W1TA 4W85A 1QK0A 3O16A 3NEVA 9CGTA 1QCWA 4RZ6A 3NVTA 3CGTA 4JQAA 5C9XA 1XCXA 3C52A 1GVSA 3P60A 2VC5A 3CZEA 3IANA 3BMXA 3GU2A 1IT7A 5DEZA 4AYGA 2D0FA 2HK0A 2GVGA 2VZSA 1Q2SA 3HG2A 4IICA 1ZP4A 2ATSA 2WQPA 3CBWA 4WDWA 2DQXA 3G1YA 2PS2A 4LYRA 3GM8A 3N2CA 3ABSA 4NXKA 4JQ1A 4LB3A 3L4VA 2D2OA 4TIMA 3AALA 4XIAA 1M04A 2DZUA 3N6HA 5EMJA 4KIEA 1JXJA 1KD0A 3CASA 1K7EA 4FP1A 4CNNA 1OGGA 4S3GA 2E7FA 3CK5A 4H6KA 1A47A 1ZSXA 2P3ZA 3EXTA 2CLFA 3V35A 1D7FA 3KS5A 1OYCA 3VINA 4JTFA 1EP3A 3O9NA 3VAVA 4CQDA 5ECUA 2J9XA 3WD1A 2EKCA 3VNLA 3UJ2A 2CWXA 3B9AA 4FZIA 3OPSA 1F6KA 1QRQA 1V6XA 4O19A 4AD2A 3NQGA 1XGZA 1DJWA 1UKQA 3BLIA 2IQDA 2V5DA 2PDBA 4AZ6A 3WH9A 1JDFA 1UB3A 4S3JA 5GVJA 4A2SA 4AIOA 3PSWA 4F0SA 1KRBC 1VH7A 5BZAA 4LAUA 4DNMA 1GYNA 5I5RA 4FPSA 1OK4A 2QUUA 5HQEA 4JTSA 4YTSA 5DRCA 1TPB1 2CLMA 4QEEA 1O66A 4GI9A 3COTA 4PMQA 4QROA 1ISXA 2BXZA 3EMCA 3W53A 2E6FA 4XV0A 3TJXA 4D6HA 4TUFA 3W7PA 2V5KA 1VRDA 4XWUA 5FF0A 3IK4A 1Q7ZA 2VEGA 1B3OA 1XRSA 3OGVA 3TTYA 2ON3A 1VLIA 1TX0A 1XP3A 1O6IA 1SM9A 1NF7A 1JDEA 2F6XA 4MWAA 4RLIA 1UD5A 3T1GA 2X1SA 1XBVA 1A5NC 4F2TA 3MY9A 2GJNA 1A50A 3W7EA 3Q4DA 3QV6A 4ECLA 5CZSA 1VCFA 1VGAA 3RR4A 3VD7A 3CIVA 2WXDM 4PTXA 4HJWA 2PZNA 3L5LA 2AQVA 1G01A 1YE6A 3HM7A 3MJMA 4P7NA 1QNPA 1POKA 1DTUA 3V5OA 1IXOA 1JYNA 3NFUA 4C6IA 5LNUA 4ZL1A 1W5MA 2Y7DA 2GUUA 3G6LA 3THQA 3O15A 5CZTA 5FSEC 3HURA 3E96A 2OTDA 3ITXA 3IJQA 2J62A 4US5D 2FB3A 4R9OA 2NUYA 4CQ8A 5D03A 4DF2A 3NQDA 2Q71A 4H00A 4R3UA 1TJ2A 4CCDA 3W38A 3L2MA 5FAGA 1A5MC 3B4UA 2QMKA 1J0KA 4GYPA 1CLKA 1HO4A 2NQ9A 1QPKA 1I2OA 1VBGA 2BY3A 3W70A 4TX6A 1UROA 3OBKA 3R12A 4A6GA 2A3AA 1KCZA 4S1FA 1E1CA 1A4LA 5ECVA 2WNWA 1N55A 1O60A 3GBDA 4J4KA 1YDNA 1ADSA 4QAWA 1VPQA 2PPGA 3SCUA 1E3XA 2VGFA 2I1OA 1PIFA 1F8IA 4CNTA 1TJ0A 2DZVA 1UP0A 4IJBA 4MFDA 4V33A 2O9RA 4DJEA 3SN4A 3OYZA 3WYZA 1GOKA 3UG3A 4HP5A 3CO8A 4H3DA 3QLDA 3N3MA 1VFLA 2EPLX 5FJUA 3WJXA 2A0NA 4RW5A 3QOMA 1ECEA 1J0IA 5D4YA 4HYRA 2XU2A 1V5XA 5FKYA 2D0GA 2P0IA 4OFCA 3QY8A 2NQJA 4NX0A 3W1PA 3CH9A 1TIWA 4N6FA 2V5BA 5BU9A 3N9RA 3MYPA 2I17A 3A13A 4NZ1A 3GFYA 4JX4A 1AH0A 3TLLA 1SFTA 1KLZA 1A53A 3G5EA 1SFLA 3WK0A 1VYPX 1XLLA 1E4LA 2VM8A 3W01A 1TO3A 1ENUA 3S2CA 4O12A 4QSHA 4GVGA 5A6LA 4O17A 2BX7A 5A8PA 1QATA 3PZMA 1B90A 1N8FA 1ONWA 1XFBA 4F48A 1MXSA 5JVLA 1DIDA 4FXJA 2J66A 4HPNA 1MWOA 1EEXA 2PAJA 2DJLA 4JOMA 1TV7A 3VMOA 3H22A 3CHFA 3VKCA 5D2WA 2VX5A 5FEWA 3DG3A 3EA2A 1JGIA 4PUUA 2EXOA 2VTFA 1DVJA 3B9OA 2ACUA 5FIPA 1UOZA 1K6AA 3WZ0E 2D1ZA 3I7SA 3ONBA 4QRNA 1UKTA 2D23A 3B0XA 3ZIZA 5A3HA 2R24A 3QMTA 3BK0A 5TF0A 2JIEA 1R86A 2GJRA 3G77A 4E8CA 3RG6A 1JCXA 3RAOA 1GCYA 2OZTA 1O5XA 3U48A 3M0JA 2CW6A 3W1UA 2GQAA 5F2IA 1Y5WA 2V63A 3W02A 1VIZA 3WNMA 2V0TA 2AL2B 3VU2A 1CLXA 1VJIA 3W0KA 4DJFD 1VFTA 5GJMA 2YDSA 4H9VA 5HJYA 4NF7A 3UZXA 5A5WA 3M0KA 3CMJA 1S1RA 1RK6A 1QO5A 4OU1A 1ISVA 1VBHA 1EQCA 5AYBA 3T2OA 2VL4A 2XZ7A 3W75A 3MA8A 4W7WA 2J13A 3PN8A 4REQB 4LJ3A 5HUOA 2QS8A 4IL2A 1XIJA 4R34A 3N19B 3W37A 4WSHA 3P62A 3TTEA 3KCLA 4JS3A 3URNA 4HA4A 3ITTA 4Q8WA 2YOCA 4EF9A 3VX1A 1SVDA 2ZX5A 2RUSA 4KFNA 4BQ3A 1GORA 4WDXA 1QHZA 2NVDA 3RO8A 3SUSA 3WN6A 3PTMA 3PZ9A 5HQMA 5LIXX 4WR3A 3LSCA 4Z1AA 1THFD 4HMCA 4E2DA 1TVPA 3UXKA 3R8HA 5FESA 1MEHA 4O28A 3O0KA 4IF2A 3W2LA 4F0RA 2DZSA 1QTWA 5KZDA 1CXFA 1AH4A 3PC0A 4IGSA 2JGQA 1JFXA 4FOUA 4D72A 1KCLA 2J7FA 4CQCA 4HPHA 1GVRA 1XPYA 3M43A 4NNCA 3GO2A 1SQ7A 3P93A 2SFPA 2BP1A 3NOEA 3FN9A 1UR2A 2VELA 5KZMA 2NSXA 1WZKA 4HHHA 4GLEA 1EZWA 3B05A 4A3RA 1BSLA 1V7AA 2Y2WA 1WKEA 4HSHA 1VHCA 2ABBA 4GG9A 1LBFA 3GXDA 3W86A 4DM2A 4QLJA 1KCKA 3O6DA 2DFAA 3PZQA 2KX9A 5IHRA 4DNHA 1JAEA 2P8BA 2YJQA 4H01A 2DY3A 3WELA 1MNSA 1NTHA 1HKIA 3VIKA 3NDOA 1MNZA 4YTUA 1DWGM 3A6OA 4GA8A 4O57A 4KIRA 1Z7AA 1TWSA 2GQ3A 4ATLA 3KOXA 3FXGA 4IUOA 1XLMA 5A6JA 3ARYA 1TSIA 4IT1A 1F74A 3AMGA 1IIHA 4LEFA 1BWVA 3T2PA 3SGGA 1JUBA 4WD0A 4O54A 2DH3A 4L6HA 3FA4A 3DHFA 1W3LA 1LL4A 4UUIA 2UZ9A 2WO5A 3TYUA 2VR2A 1NWSA 2NQZA 2FPTA 1C91A 3PULA 3GXIA 2O56A 5D2XA 3AHTA 4GQBA 4I7WA 1J0YA 3UJSA 4RE0A 1PS9A 2C1GA 1BLIA 1GZGA 2AMXA 3WMBA 1I6NA 1Q6FA 3W6LA 2YKKA 5DXYA 4GI8A 3H53A 4LTSA 4A29A 3PB0A 4NI3A 5FJRA 4EPDC 1US3A 3NZQA 4LUSB 2Y6ZA 3LTSA 1BQGA 3A21A 4GBDA 3L0KA 1GNXA 3CB3A 3C2VA 3M5XA 2X1IA 4G2DA 3GXPA 2BGQA 3MB9A 3BVJA 1RVKA 4O0ZA 1LUCA 4JIIX 3MI2A 3PPFA 2HQAA 1NWUA 3IGUA 4Y7EA 3H2OA 1JULA 2E9LA 3EOEA 2W67A 1AH3A 5E93A 4DAIA 5BOOA 4OV9A 1SJDA 2HMCA 5FF2A 2VDGA 3ABQA 1PTAA 3PPHA 4IQEA 1Q7MA 5LNWA 1TB3A 4M80A 2BY1A 4LEQA 3DCPA 4ZFMA 4OZOA 4HA0A 3AUJA 3LBCA 3TJ4A 3UWEA 2Y5JA 4LCQA 2WPBA 4FSAA 3S2LA 1FBAA 3T0DA 5CCZA 3GXNA 2VYOA 2Y8UA 2X40A 2PDIA 1A5OC 3TA9A 4GFSA 1B9BA 3K4DA 4NT0A 4OKDA 1NQKA 3SQLA 3UWWA 4YVPA 4JIRA 1MW3A 3IUIA 3B40A 1W37A 5DT5A 2A3HA 3VZXA 3VKKA 1OD8A 2OZ0A 1OFEA 4LUSA 4H8NA 2CLOA 3WBAA 1TV5A 4JPGA 1R9XA 4UFHA 2QPXA 5G1MA 4QCEA 5D37A 1A80A 4S39A 1MW2A 4N02A 1HVQA 1VCVA 1D9EA 4MPKA 2GGGA 1JZ5A 5FL1A 1MXGA 3N29A 2BZNA 4IJRA 2DT2A 5JXQA 4Y9PA 3L4UA 3SFWA 4BHYA 3NSMA 3GXFA 4HNTA 4J3XA 3F7JA 5AKQA 3TMLA 4RE3A 3OYXA 1VEOA 2YCKX 4MWAD 3H4WA 4WQ6A 1FHLA 2REQA 2GFTA 3JR2A 4GFIA 5DFAA 1PZ2A 4E8DA 3S47A 4FNRA 4C1NB 4IFKA 3HV8A 1VFOA 4MADA 4PSRA 3GC5A 2PTYA 3WFAA 1MFVA 4E2VA 2VWSA 1Y65A 2EO7A 3LM3A 1GJWA 1VQTA 4W86A 4WSKA 3VMPA 2XSBA 4LUTA 1WOBA 2JF6A 4PB4A 5HAOA 3IJ9A 1WZLA 3GNPA 3HGJA 3I3DA 3VDAA 1W9BM 3EPOA 1N82A 5BMXA 2YBUA 4URIA 1UPPA 4W8BA 4JTIA 4DWSD 4XO7A 1LG1A 1P0BA 4GABA 3V4BA 4XZIA 2X42A 4KT2A 2OQHA 3S1WA 2D2JA 2G4JA 1IWAA 2V3EA 1G7UA 2W6RA 2YIHA 5EY5A 1R5YA 4QE1A 1V3MA 1DL3A 1OIMA 1DQUA 2J78A 3AIRA 1T5AA 1XRTA 4NSBA 1NEYA 1ZL1A 4LXFA 3LY0A 3CWOX 2GVJA 4BWLC 1Z89A 2QNEA 4LNYA 3VDHA 4C6DA 2XWEA 2X2YA 1RP8A 1FWWA 1XYMA 2QULA 3GTIA 1OFRA 4DWDA 3TSMA 4B15A 1WB0A 1GJPA 3I3BA 2Y89A 4PC8A 4DBWA 3AXIA 3LPOA 1SFSA 3LGDA 3T55A 3TN4A 5JH1A 3Q65A 3FAWA 3PANA 5K9XA 2NVAA 5FF3A 3AHXA 1A5KC 3PP7A 2UY4A 3CL7A 1MO0A 5AZ0A 5D8ZA 4AZ7A 4GZ7A 3VOJA 3AJ7A 1V03A 1VYSX 4Q7BA 4DWSA 3E74A 4E4UA 4POCA 1K7FA 5I02A 3VIGA 4IL0A 5A6BA 4JKMA 2RJGA 2OZ3A 3O7UA 1TZ9A 4W84A 1YXCA 3WLTA 3MTWA 4PMUA 4AEFA 3HMCA 3PZOA 5D02A 1E4MM 3ZLGA 3W85A 1EXPA 2YBTA 2CLIA 5HQLA 2XVPA 3SM0A 2CIPA 3IK2A 3IGHX 1F9CA 4M82A 4MM1A 3ECQA 3EXSA 3OP2A 2ZUSA 4Q4MA 4HNCA 2FDMA 1H49A 4KCWA 4BA0A 3LI0A 1VZWA 3GE7A 2B7OA 3LMYA 3G1RA 4MZ8A 4JTRA 2PCEA 1F2JA 2ZWYA 3AYVA 1QJWA 1QPNA 1W5NA 5H6HA 3G22A 4XQ6A 4RX0A 1PL9A 1XGDA 2HV5A 3LHYA 3VE9A 4AYSA 1UZDA 4W7VA 1V0NA 1YKWA 3P81A 2D3LA 2XH7A 3L2LA 1A5UA 5DN1A 4AFYA 3GFZA 1JCJA 2Q02A 3KWXA 3WMCA 4HU4A 2VWTA 3N11A 4XD5A 2W66A 4UTKA 4B3LA 2NWRA 2OEJA 3OGSA 2E25A 3QYQA 3GC4A 4ZO8A 3AIWA 3W4RA 5L9FA 4O0QA 3RJYA 3T07A 3SIMA 3LPPA 4FR6A 1EPVA 2NV1A 4ILSA 4JN6A 3MSYA 3MUIA 3SRKA 3PR2A 4AEOA 2V9DA 5H8UA 3CIXA 2I5IA 1Z44A 4PL2A 5I3JA 3EB2A 4ACYA 3TIMA 1YMYA 3H2NA 3QW4B 4DN1A 1Y7VA 4NIRA 3G1DA 4LUYA 1IWPA 2ZDSA 1JUEA 4RUBA 3I3EA 2CBIA 3TN5A 3VX0A 4O52A 3NO1A 3O6YX 3BC9A 4DXXA 4AWSA 4LUIA 3MP3A 4ASTA 1FWNA 1KGWA 4I6KA 5JU6A 5CPQA 3EX6A 3KCJA 3L21A 4R27A 3AU2A 1SJCA 4EPEC 4AU0A 4YN5A 1L9WA 4K38A 4NNAA 2Z1BA 4UTTA 2VD9A 2ZICA 1CLVA 3AI0A 4GK8A 4MJZA 1JXKA 3UGRA 3UERA 3QKZA 1LUCB 1XINA 2QDGA 1XI3A 1M1BA 3A5VA 2DSUA 4QIUA 1O94A 4IX0A 3WNLA 4DJDD 2WM1A 3FNDA 3RNDA 3VGDA 2OODA 1H7OA 4CU6A 4DYJA 3V7PA 4C6EA 1JYVA 1JAKA 3B3DA 2VZTA 1XG4A 3SQMA 4BFAA 1EHAA 1BYCA 3THCA 3PBYA 4Q7NA 3VKJA 1UA3A 1FWDC 3W00A 6ENLA 1TRDA 3RIKA 5FEZA 1RVGA 1J18A 2UY2A 3MSGA 2X0HA 1U1JA 1KW1A 1VPYA 2ISVA 2PCQA 1GOQA 1E3ZA 5BOEA 4ADSA 3GIPA 4ZTYA 1JNEA 3CZKA 4IM4A 4YVXA 2Y63A 2E5CA 2XIOA 4J3TA 2MNRA 4FB7A 3GZ3A 3HFTA 3K4AA 2ZC8A 2WVVA 4FNSA 4M5PA 3CLMA 1RAKA 2IQ0A 3NSXA 2C1IA 2PLKA 2G3IA 2NSOA 1JPDX 1Q2RA 1HJQA 2J7GA 3SCSA 4ZXOA 2WSYA 4MMWA 4HZ6A 4RR4A 2WC3A 5LYRA 4XTIA 3CUXA 1FY6A 4X0NA 1LWJA 1SO3A 4ATDA 3L9CA 1EJ7L 5AHIA 3NTYA 3CPUA 4FLOA 1CW2A 3NUKA 3WH6A 3FGCB 1OFPA 2OT1A 4EANA 1SJAA 1UJQA 1OGBA 1E1CB 1X1ZA 1H0IA 1K8XA 5E0KA 1QXLA 1SZEA 4OBTA 3AS0A 4ERAA 4N9EA 4GY0A 3KOWA 1MDLA 3OZMA 1UWTA 2CFFA 4PCSA 1G4EA 1I2PA 1BTCA 3D46A 1RBLA 4BY3A 3M0VA 4ACZA 4XZLX 3NM3A 2G95A 2VHLA 1MW1A 1QI5A 2WJZA 4A3HA 4JTDA 2XIMA 3SRDA 5ABGA 3WL1A 2OJPA 1OCNA 4MDPA 1MDRA 1TMLA 2PBGA 4S3FA 5D8WA 1NIUA 3TCEA 1GWJA 5EGRA 1PYFA 1Q8JA 2NLIA 4HCLA 1T96A 3Q94A 5HR7A 2V81A 1MW0A 4AY1A 1JZ3A 3AHVA 1TPEA 1NOWA 3Q2DA 3V0TA 4PCNA 4F66A 1FWCC 4K6AA 4LYPA 2FHCA 2C8NA 4H2HA 2ZKMX 6REQB 3UPMA 1XGEA 4AZHA 1SFJA 4QEHA 5AFDA 1WDDA 1YNQA 3EMQA 1PTGA 4LU0A 4ROQA 1Y8BA 2GJPA 1UUQA 4C6LA 3UWYA 4DHGA 1OZMA 1AJZA 3GBEA 4GQ0A 4Q8UA 2J6XA 4NZ3A 2ZC1A 4JYFA 4GMEA 4RK8A 4IMEA 3QPZA 2VP8A 5IDZA 2BLEA 3CQKA 1KFCA 3W2UA 4UQDA 1IIGA 5H2ZA 2PDHA 4KWSA 2ZZ5A 1R3YA 1CXLA 1UYQA 1WA3A 3RGTA 1W54A 1EGMA 5GJPA 1MRQA 3C3NA 1TV3A 2OT0A 2PSNA 1FWHC 5I03A 4M3PA 1KQYA 1W6TA 4UTLA 3TC7A 4GJIA 4B4FA 2XSXA 1EZ2A 3S1GA 4AD1A 3NWRA 4M6VA 3W7HA 1FHUA 4L4OA 3PNZA 2ZVIA 3RO6A 4X0VA 5CC7A 5H1WA 3WQFA 3DUGA 5AC5A 5TNVA 3OG2A 1XXXA 2PZ0A 2ZOXA 4WJEA 4NY2A 3DHDA 3H2MA 4LVFA 3F5JA 1HZYA 2WZMA 3O1NA 3C6CA 4JZ5A 3PB2A 3N6JA 3VNDA