4IISA

Crystal structure of a glycosylated beta-1,3-glucanase (hev b 2), an allergen from hevea brasiliensis (space group p41)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
316
structure length
316
Chain Sequence
EVGVCYGMQGNNLPPVSEVIALYKKSNITRMRIYDPNQAVLEALRGSNIELILGVPNSDLQSLTNPSNAKSWVQKNVRGFWSSVRFRYIAVGNEISPVNRGTAWLAQFVLPAMRNIHDAIRSAGLQDQIKVSTAIDLTLVGNSYPPSAGAFRDDVRSYLNPIIRFLSSIRSPLLANIYPYFTYAGNPRDISLPYALFTSPSVVVWDGQRGYKNLFDATLDALYSALERASGGSLEVVVSESGWPSAGAFAATFDNGRTYLSNLIQHVKRGTPKRPKRAIETYLFAMFDENKKQPEVEKHFGLFFPNKWQKYNLNFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the endogenous glycoallergen Hev b 2 (endo-beta-1,3-glucanase) from Hevea brasiliensis and its recognition by human basophils.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Beta-1,3-glucanase form 'RRII Gln 2'
total genus 103
structure length 316
sequence length 316
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.39: Glucan endo-1,3-beta-D-glucosidase.
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00332 Glyco_hydro_17 Glycosyl hydrolases family 17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4iisA00
1OGBA 2D0GA 1TE1A 3THDA 1JNDA 3WDQA 1JAKA 4GZIA 3DYMA 4CN1A 2JF6A 4GXPA 2ZXDA 1E56A 3QHMA 4JIEA 2HVMA 3WDRA 3AFBA 1UWIA 1E73M 5CXPA 2VZTA 1PAMA 1B0IA 1V3HA 1BQCA 5C8BB 3A47A 4NI3A 5D8ZA 3WD1A 5GNXA 2W4XA 3MMUA 2OYLA 4JCMA 3N17A 3ZJKA 3NUKA 3WEZA 3SUTA 3QGVA 2ZUMA 1JF5A 4AZCA 4GPNA 3QHNA 1SMAA 2G4FA 3PBGA 4CD8A 1BPLB 3N9KA 1ESWA 2BV9A 2VJXA 3EDDA 1ISZA 3VTRA 7A3HA 3DECA 2XHYA 1EQCA 1C90A 1M04A 3NDZA 3BCFA 3ARUA 3CTTA 4BZYA 1QOXA 3UCQA 4EANA 5HPOA 1XSIA 3HMCA 5EB8A 4TVCA 1EO5A 1R8LA 1FA2A 1TVPA 1W9PA 3AJ7A 2C8NA 2UY4A 5M17A 1PX4A 2FH6A 2BXYA 2DSUA 3AQUA 3F5LA 1A47A 3GBEA 4UOJA 4OBSA 2RGMA 2NW0A 3W25A 4JHOA 2XVLA 3ZT7A 3GXDA 3AZRA 4OOUA 4PCSA 3UG4A 4X0VA 1M7XA 2G3MA 1KBKA 4M81A 1J0KA 4R27A 4MB5A 3CUJA 1CTNA 4RE4A 5ABEA 1BGGA 4PBGA 4FLSA 1VF8A 4A3HA 4C7DA 3VX1A 4D6CA 1E3XA 4D72A 5LA1A 1JYVA 2CETA 2EPOA 4PN2A 4BQ4A 5CQ1A 4H7VA 1MWOA 4HOZA 4LYPA 4MNMA 1BF2A 4AZIA 3IAQA 3VNZA 4CD5A 4WK9A 5BROA 3ZJ8A 4GQQA 1EOMA 1I75A 2J7HA 1UKPA 3GH5A 1K9EA 4YPJA 2XFYA 1QVBA 4GINA 4GO8A 2D23A 4LYRA 3UR8A 1XHGA 3BSHA 4DWSB 3KL5A 2ZXQA 1UKSA 2WNWA 4PCTA 3O9NA 2ZUNA 3IK2A 3WNKA 1E0VA 1L0PA 1BGAA 1UD3A 3TONA 4J7RA 1UD8A 3QHOA 1KGUA 4GO9A 4MPKA 1QI5A 2DH3A 4B15A 1KB3A 3VD7A 5LYRA 3BC9A 2DDXA 1UR4A 1JFHA 3W81A 7TAAA 5EMYA 3OLGA 3OLDA 1V02E 4LX4A 1CWYA 3WD4A 3NIYA 5I78A 2Y24A 3JUGA 1VRXA 4CN6A 5LA0A 2NSXA 1G01A 1NWTA 3THCA 1UHVA 4DWSA 4EK7A 3WH9A 2OYKA 4CU7A 1TA3A 1ZS2A 1BYDA 2EQDA 4QFUA 1PX3A 3FN9A 4PTXA 4PUEA 3MANA 1GZJA 1UH4A 2DQXA 1V0KA 1H3GA 2J62A 1J0YA 4MB1A 3W27A 1O7AA 1XV8A 3DHPA 4E8DA 5A6MA 3AMCA 1H1NA 1EA9C 2CPUA 2G8ZA 2O9PA 2WCGA 3AICA 1BYCA 4TTGA 3T0BA 2YA2A 5E9AA 1D7FA 1WDPA 6A3HA 1H09A 2WMIB 3BSGA 3ZJ6A 1IZJA 1LLOA 2YL5A 3WH5A 3ZJ7A 4F66A 3U5UA 1KBBA 3TP4A 3BH4A 3EDFA 1AQ0A 4D6IA 1GQIA 1FOBA 2EPMX 1EXPA 2W92A 4UTFA 2OWCA 1OGSA 5DF0A 1C8QA 4M1RA 4M8UA 1JD7A 2WW5A 2WYSA 1V0LA 4LXFA 1DWJM 1ISVA 1LJYA 1GORA 3TTYA 2VVNA 3GTNA 3U7VA 2CXGA 2WKGA 1HP5A 4JKMA 2WC4A 3GXFA 1MQQA 1GOWA 3AS1A 1HL9A 4U33A 1G94A 2YDRA 2B31A 4UFHA 3SEPA 3CO4A 1E71M 2V3FA 4P7RA 3L4WA 3ARWA 4PTVA 3POCA 1B3YA 3W6MA 1WZKA 5ECUA 2XPKA 1BYAA 3AS2A 1KR0A 1V03A 1X6NA 4BF7A 1VFMA 2VQUA 4HA3A 2ZUSA 2QLYA 4AD4A 3CZJA 2C7FA 3GDBA 1XH0A 3OIHA 2XVGA 3CPUA 5CGMA 2J78A 4X0NA 4MADA 1E43A 2VZOA 4H2CA 1F4HA 4AWEA 2GDVA 1QI0A 1VEPA 1FHLA 2D20A 1PJ9A 1I1WA 3BXWA 1W9VA 2EPNA 5CGTA 4WLCA 1IV8A 1CEOA 1UQZA 5DT5A 1C91A 1LQ0A 2VCAA 1U2YA 2V3DA 3VU2A 1CLVA 2JF7A 3SUWA 3WD2A 2X1IA 4QP0A 4BQ3A 5FL1A 4U3CA 3BAYA 4AZCB 4D1JA 5M03A 2WMJA 4PYSA 4WJXA 3GH7A 3KE0A 3VD5A 3VX0A 3CIVA 1DWFM 3W6LA 5JUVA 2YOCA 4W8BA 1OM0A 4D6DA 4MJ4A 2JIEA 5I5RA 1UKOA 4S3JA 3N04A 5CLTA 1B3ZA 1JNEA 2WVUA 1KFWA 3N13A 1B31A 3FHQA 1K9FA 3WFZA 2UWFA 4J27A 1GCYA 1B1YA 3CUIA 3VM5A 1HJUA 2E4TA 1EH9A 1UR8A 4TTUA 2JFEX 2OLHA 1E70M 3VNYA 4J3UA 2WZHA 5EFDA 2WLYA 1FP9A 2EO7A 3VIGA 4PMVA 3WD3A 5AY7A 3PTMA 3AS3A 3D3AA 3CUGA 2PWHA 5EFFA 4NRRA 1QNPA 1J10A 1ZJBA 3FNDA 1UZ1A 4UQEA 5A6BA 2CKSA 3WIJA 1KR1A 3ZIZA 4GI6A 3W0KA 1HKMA 5CPQA 1C8YA 1UKQA 4AZ6A 1V6WA 2X05A 3QOKA 3FHAA 3ALFA 1V3LA 2V3EA 4P7LA 2VT0A 1XH2A 2BY1A 4AZBA 3WUBA 4PSRA 5I24A 4B3LA 3W29A 4TX8A 1B3XA 3OA5A 3OLIA 3RM8A 2EJ1A 4AEFA 4ZEPA 1W3JA 2ZXAA 3EMCA 3ZSSA 2W62A 3FAWA 1JG9A 3NYDA 4PMDA 3AS0A 5A1AA 4PMYA 4F9DA 2AMGA 1E1EA 1UR9A 3PZNA 3DHUA 5I0DA 3VIIA 1YQ2A 1CGTA 2ZX5A 2RGLA 1HJXA 2YL9A 4MNLA 1QW9A 1FH8A 5E6YA 3WQ8A 1L8NA 2XM2A 2YA1A 5D9NA 1KXVA 3SCUA 5CPTA 3PZ9A 4AD1A 3M7SA 3MUZ1 2ZXBA 3TTQA 2AOSA 1HJSA 5FKYA 4PMRA 1HL8A 3F5KA 4IPNB 4WSKA 5JBDA 1I1XA 4R5EA 2VZUA 1JYXA 3CLWA 4ZENA 1CXHA 5HNNA 3OZOA 4AC1X 3IJ9A 3LPOA 4D6FA 3AIRA 3OBAA 2FHFA 1XD1A 3K8MA 2GUYA 1TZ7A 2G3IA 1SYTA 3QOMA 5IFTA 1J12A 1CGUA 1EDQA 3K8LA 3NSMA 3U5YA 2CBJA 2J7GA 3AI0A 3N12A 4U2YA 2CEQA 1OIFA 2WHMA 3VVGA 2GK1B 2VX7A 4CCCA 1W32A 2X2YA 3WN6A 2ZX6A 3NDYA 2ESCA 1Q6FA 4H8VA 4CD6A 2W63A 2YA0A 1EO7A 3AXXA 2WHLA 4MJ2A 2BVTA 1EOKA 1KQYA 4AW7A 3B9EA 4JHZA 2VX4A 3L4XA 3MS8A 1W3LA 2J4GA 5I77A 3VKKA 4AXNA 1OCQA 2WVTA 2YJQA 4QLLA 3ZT5A 2DEPA 4MDPA 2BY0A 3PZOA 3PZMA 2MANA 1OSEA 3EYPA 3OZPA 1LL6A 4AZHA 4B16A 2WM0A 1W9DM 1J18A 1V3MA 2W67A 3VD9A 1GJUA 2JEQA 1XH1A 5BXPA 2GJPA 1XSJA 3ALGA 3BGAA 4XZBA 5A3HA 4DM1A 1WB0A 2G3NA 2GK1A 4JFSA 1GHRA 2YBUA 5D9OA 1CGVA 2EXOA 4PMZA 1HJVA 2CKRA 1D3CA 2D3LA 2W66A 3PTKA 1QNOA 2A3EA 3M6DA 1V0NA 1AQHA 5DFAA 1GOMA 1KXTA 2WSKA 2BS9A 3GNOA 7CGTA 4ACZB 5A8OA 1PZ2A 1Q6EA 4MDOA 4BQ5A 8A3HA 4OIFA 5A2AA 1FHDA 1V3KA 2BHYA 1C3FA 4JL1A 1JZ8A 3WD0A 3LPGA 2VRKA 4GZEA 2EBNA 4CGTA 3ZMRA 5ABHA 1ZB5A 4JFVA 4J3SA 1QHOA 4CCEA 1R86A 2GSJA 1WE5A 4HMCA 2E9MA 3CUHA 1XSKA 2YBTA 4JAWA 1W1VA 2VQTA 1E55A 1JZ2A 1XYZA 1N82A 1KWKA 2UY2A 1XCWA 2VC9A 3WUEA 4W87A 4HA4A 3MUIA 2O9RA 1KWGA 1E6PA 5AC5A 1BTCA 1QW8A 1MYRA 3A6OA 3W28A 4Z2HA 2VURA 4FF5A 2J79A 1NH6A 3WF4A 3MV11 4FLQA 3VGBA 1RPKA 3QR3A 3WDIA 1SMDA 2CITA 4V27A 3VD4A 2VL4A 5BXRA 2CBIA 2D1ZA 3NSNA 2F2HA 3LMYA 4DWSD 3WY1A 1PZ3A 4AD3A 3ECQA 3RMEA 3PZUA 1BLIA 3M46A 5HPCA 1MQRA 6TAAA 3A3HA 1DEDA 3WEMA 3S6TA 4E2OA 1GW1A 5I79A 2JE8A 1E4NA 1GOIA 4OKDA 1KXQA 3IAPA 1OT2A 1ZJAA 4UFIA 5C70A 3OGSA 3HU7A 1MFVA 4M29A 3ARPA 1IZKA 1FFQA 3RPMA 5JIWA 5BYWA 4UR9A 1HKIA 2W91A 3NCOA 3WH7A 1E6RA 3SUSA 3O6AA 3WFLA 3WKZA 2BHUA 1HKKA 1JZ4A 4OBRA 3WDJA 2BVYA 5TD4A 1UQYA 3WBAA 2VR5A 1PBGA 3WQ5A 4LQ1A 3T2QA 1G5AA 5D9MA 3ZOAA 1QHZA 2GJRA 4AIEA 1TA3B 1E4IA 5BCAA 3UG3A 4HOWA 3NSXA 3WH6A 1DTUA 4L4PA 3SCRA 2J7CA 5FCZA 1W2VA 5IFPA 4J3XA 1WKYA 1HT6A 3L2LA 3A4WA 5BWFA 5I6SA 1QHPA 1UR2A 1BG4A 4ACYA 2VUYA 2X0HA 2DSWA 2X8RA 1G0CA 1H5VA 4W88A 1NQ6A 2WAGA 4Z2KA 1DHKA 3SCOA 5AC4A 1OIMA 3CBWA 4QDMA 2WWDA 1HXJA 1H2JA 3OLEA 2WMIA 1QNSA 3N11A 1KCKA 2Y2WA 3BLKA 2WWCA 1HN1A 1LL7A 2WSPA 3AZSA 5IDIA 4HPGA 2A3CA 5E6ZA 3ARXA 3FAXA 1VAHA 2VZSA 1US3A 4B9YA 3T2PA 2VCBA 4OJYA 2OSWA 2IXUA 4YHGA 1B90A 1J0ZA 2WZEA 1XCXA 4J3WA 3GNPA 2J7EA 3CH9A 4AD5A 1LG2A 4MNKA 1UH3A 2WXDM 3T2OA 1NOFA 5JIPA 3RJXA 4H8UA 4PTWA 2WKLA 4Y7EA 5E70A 4A3YA 5BRPA 2J7DA 2GVYA 2WCAA 4CUCA 3AROA 1GONA 4UFJA 1EIBA 4F8XA 3VIPA 1CGWA 2WCSA 3BAIA 4K68A 2D0FA 2FGLA 2D22A 3EMQA 2ZUWA 3K46A 5D9PA 1WP6A 1BHGA 3FW6A 3AIUA 4J28A 3S2CA 1BAGA 2CESA 2J74A 2OWXA 4FLOA 2QMJA 3BAJA 1OWQA 4KRTA 2E0PA 3J7HA 3CZGA 1SFSA 1VEMA 1Q6DA 2FHCA 1R85A 4Q22A 1FH7A 2WANA 3VDBA 1ZBCA 1V6YA 2UY3A 2A3HA 1GUVA 3VGHA 1K9DA 2WVSA 4XUYA 1C7TA 4WKAA 3AMLA 4P7QA 2Q8XA 3VIHA 1ITCA 1CXIA 1OINA 1DWIM 1OBAA 3AHZA 2CHOA 4BCEA 3K8KA 1V6XA 1VBRA 3MSGA 5BXSA 2D0HA 1E1FA 1W9XA 5M3WA 2ZWYA 1R7OA 3VMPA 3MV01 2PF0A 2WC3A 2J8FA 3WH8A 2YL6A 4AZ5A 1JYNA 2Y4SA 3AMGA 2CBVA 2XG9A 2BFGA 4D1IA 3GM8A 1EQPA 2BY3A 3UR7A 1UA3A 1JL8A 3VGEA 3WMCA 2VMFA 2O9OA 1UWRA 1JAEA 1HX0A 2ZX8A 2PI6A 4M24A 4JCLA 1KGXA 1JI2A 2W5FA 3OGRA 3WDPP 1V3IA 4DUWA 3GYCA 1B30A 2XM1A 1V08A 5A6BD 1NP0A 4P8XA 3K4AA 2CNCA 1V6VA 3RM4A 2WBGA 1U33A 8CGTA 4W7UA 4P7OA 1MW1A 4MAVA 2JIWA 3U57A 2ZUVA 1SR0A 3UEQA 2ZOXA 4W86A 3ZSTA 2BHZA 3B9DA 1H41A 3IJ7A 1OD8A 3TTSA 1WZAA 3EDEA 1ITXA 1E3ZA 2OWWA 3VGGA 2WMKA 3K4DA 1LF1A 2VR4A 3SCPA 4KWUA 4E8CA 2YKKA 3T09A 1W2PA 3VM7A 4DWSC 3K1DA 1TVNA 2J47A 2VOTA 2E8YA 2OYMA 4FK9A 1ECEA 1C7SA 1G9HA 3VDHA 3VIMA 3VIFA 4NSBA 4BS0A 1VBUA 3BAXA 2E9LA 4MTVA 1EHAA 2ZIDA 2FH8A 1CYGA 2FGZA 3N15A 4CVUA 4AIUA 1JDCA 1GVYA 1ISXA 5DEZA 2OSXA 1QNQA 1F4AA 3W37A 1UWSA 4KGJA 4TVUA 4PRWA 1US2A 1BFNA 2FHBA 4PMXA 4PUDA 4B3KA 3HJEA 4WIWA 2DSZA 4UQDA 4ZE4A 4EKJA 2PBGA 5A8MA 3PZQA 2E9BA 3WUFA 3UERA 2GJXA 3UETA 2WMFA 2XFFA 1H49A 3ARSA 3W82A 1MVYA 1NARA 3AOFA 1TCMA 3OB8A 4AZ7A 2XVNA 2YLLA 4JFTA 5A6JA 3MMDA 6CGTA 4UQ9A 1UR0A 3E1F1 1HVQA 1QPKA 1S46A 4PMQA 3ARVA 2IXVA 5HOSA 1Q6GA 2DSKA 3IJ8A 1NOWA 5I3DA 1WNOA 3T08A 2JALA 2PBOA 4PSPA 3CMJA 1WDQA 3AHXA 3WF3A 2WZIA 2YDSA 4HTYA 1FFRA 1GPFA 4TUFA 1J9YA 4XB3A 4ZE5A 1BVZA 1JFXA 5AYBA 2TAAA 3BAWA 2XVKA 2J25A 3F4VA 1JIBA 3WQWA 2DT1A 1M01A 1UYQA 3VGFA 4F9JA 1GJWA 3T0AA 5A8PA 3PN8A 4D71A 4W7VA 3ARRA 2GDUA 2WB5A 4WKFA 5CJ5A 3LPFA 1V02A 3CGTA 5CG0A 3VUPA 5E0FA 2JEPA 1JD9A 4F79A 4UZSA 1HNYA 3APGA 1R7AA 1UD6A 4RL3A 1CPUA 1WCGA 3II1A 4J3VA 1QI3A 1V6UA 2PWDA 4BA0A 1E6ZA 1JZ6A 3AXIA 1P6WA 3WNPA 3WQVA 2XUCA 4HZ7A 3VINA 1A3HA 1C8XA 3SCQA 1VIWA 5BXTA 2VX6A 1UD2A 3WSUA 1TG7A 3SURA 1TFVA 3KEHA 1W9BM 4URIA 1YHTA 3G6MA 2Y8VA 3AISA 3CZLA 5C71A 4LYQA 4C7FA 4DUVA 3PZTA 1DWGM 1RP8A 1J01A 2XIBA 3GXIA 4WSJA 2BXZA 4CU6A 4E4PA 3VPLA 5DO8A 1CGYA 3F5JA 4JFUA 4IUGA 2ZUUA 2DT0A 3BLPX 1KCLA 3AIQA 3WDHA 3T0DA 1ISYA 2E40A 4UOQA 2EPKX 1IT0A 1QBBA 2GFTA 3SCVA 1H11A 1WZMA 3KL0A 1CXEA 2WK2A 4UFMA 4N0RA 2C0HA 3IANA 4M82A 4U31A 5CPSA 3D5HA 1AMYA 3L4UA 3M07A 2PWEA 3VDCA 3BMVA 2ZWZA 2IUZA 4RE3A 4CN4A 3SCTA 3RDKA 2DT2A 4HMEA 5IHRA 3A4XA 3WL1A 4N42A 4D6GA 3PHAA 4UOZA 1E72M 1ZBWA 3GH4A 1ODZA 1DP0A 1E4MM 1KQZA 1VENA 1VFFA 4PMNA 5KZ6A 3MSDA 3MUY1 2DT3A 3L4VA 2PWFA 2WBKA 3KZSA 3POHA 1LG1A 3WNLA 3AIVA 2BNJA 4PTMA 3EMZA 4CD4A 3RIKA 3WELA 5ABGA 1ISWA 2VNCA 5I2UA 2XWDA 1ZL1A 1M03A 1JZ7A 1Q6CA 3KWXA 4U5IA 5HXMA 2A3BA 1E6NA 2V3GA 1ODUA 1MW0A 1X6LA 1JDAA 3WNOA 4W8LA 1HP4A 1AVAA 4W84A 2ZICA 2XSBA 5GNZA 3DYOA 2OSYA 5FOOA 4QCFA 1MFUA 3W26A 3ZO9A 5F7UA 5E09A 3ZR5A 5JBEA 3VMNA 4ACZA 5I23A 4HMDA 1CXLA 3O2LA 3EDKA 1MXGA 4P8UA 1TMQA 2EEXA 2Z1SA 3WNMA 3VO0A 2FDMA 2W61A 2WMHA 4ZXLA 4MNJA 1U30A 1W9UA 4W89A 5HBFA 5A94A 3W24A 5HDRA 2XGBA 1D2KA 3WENA 1XD0A 1K9TA 4QLKA 1W91A 2DH2A 3PZIA 1MXDA 4UCFA 4UQBA 4ZXOA 1JXKA 4W93A 4HZ6A 1OD0A 2VRQA 1CBGA 4GQRA 2XJ7A 4YN5A 4MB3A 1O6IA 2CCRA 2O9TA 2WPGA 1J0HA 1K6AA 4U5KA 4CKQA 3VILA 4CD7A 1WDSA 1JXJA 2E8ZA 1BVNP 4GZJA 4HU0A 3TOPA 2QV4A 1OGGA 1WDRA 3RM9A 3CHCA 2PC8A 3SUVA 1BYBA 4JKLA 4XZWA 2WVVB 3N18A 5A69A 4CU8A 1E40A 1HJQA 3AIBA 5A6LA 1XC6A 4Q7NA 4ZFMA 1ZBVA 2V5CA 2YDQA 1NWRA 1UUQA 4L4OA 3AMDA 4NRSA 1W1TA 4M80A 2YLAA 3GNRA 4WKHA 2D24A 4AZGA 2X09A 3WF2A 4W7WA 3RILA 1CGXA 1E15A 1MW2A 1X1NA 4UQCA 1TR1A 3U7BA 3WMBA 1CENA 3I3EA 1JDDA 1W3HA 4IISA 4EE9A 3BCDA 3MUAA 1UA7A 2NT0A 4V28A 2Y8KA 5A95A 1RD6A 1NP2A 1V0MA 1UR1A 1NM9A 1LWHA 3ZT6A 1OB0A 3HN3A 4M56A 1W1YA 1UZ4A 5EBAA 1QBAA 4KMQA 3VDAA 3BAKA 1H0GA 1C93A 1CIUA 3SUUA 4H41A 2J77A 1R87A 3VOCA 1E9LA 3SIMA 2HISA 2WC7A 5A8QA 1H4PA 4EAMA 2VO5A 4ML4A 2VTFA 3A4AA 1E5NA 1CECA 2CHNA 3WF0A 1XYFA 3TA9A 3SCWA 1GOQA 2QPSA 2A3AA 3UG5A 2V5DA 2XFRA 3WNNA 1VFUA 2V38A 3L4YA 4W5UA 4H8HA 4P8VA 1XRVA 1B2YA 3AHVA 2UY5A 2CYGA 3CZKA 3L4TA 1GQKA 4AD2A 1C92A 3AHTA 3VGDA 1J11A 3CHEA 1MQPA 2XIIA 1JF6A 5DT7A 5FD0A 3MKKA 1E0WA 3W38A 4HP5A 2J7FA 3BMWA 1UH2A 1G1YA 1AQMA 2CIPA 1KXHA 4CVWA 1EDGA 2XYLA 5LA2A 1EHNA 2J7BA 1HVXA 4OUEA 4TVDA 3SCSA 4PMUA 2D2OA 5CSUA 4DUXA 1VEOA 5GNYA 3FXYA 2D3NA 4UNIA 3WL0A 3ZR6A 5IXEA 4AMCA 1JZ5A 3NJ3A 1VJSA 3PZGA 1FP8A 1ZU8A 4JKKA 1EGZA 3SCNA 3WMSA 1UWUA 4H04A 4AYSA 1NWUA 4UFLA 1KGWA 1UG6A 4TX6A 2BY2A 4GIAA 5A2BA 4NF7A 3VD3A 2X0YA 3G6LA 5KEZA 5E0CA 1E4LA 4QAWA 4XX6A 1UKTA 3L2MA 4IPLA 2NT1A 1VB9A 3AYRA 5BRQA 1CZ1A 3WQ6A 2DGAA 5A6SA 1UOKA 4QCEA 1UD4A 2AAAA 2CERA 5CLWA 1PPIA 1PEZA 2XSAA 4HOXA 3WQ4A 2J75A 4KRUA 4HPHA 4JL2A 1DWAM 4BQ2A 2BVDA 3WUGA 4C7GA 4NZCA 4ATWA 4AY1A 4LGXA 2XWEA 4PMOA 3FY1A 2VRJA 1CDGA 2QF8A 1E5JA 1JYWA 2G3JA 3MO4A 4KH2A 2QHAA 4GI8A 1GQLA 4AEEA 3ARZA 1E0XA 1OT1A 4YHEA 4UQAA 3TTOA 3ARQA 1NOUA 1Q4NX 2XVPA 5ABFB 2E3ZA 3WEOA 5DMYA 1Z32X 3LPPA 3KL3A 1JI1A 1WAWA 2VZVA 3EBVA 3ZQ9A 4WF7A 4MB4A 3WF1A 1GOKA 2Z1KA 3I3DA 3AHYA 1CXFA 1FH9A 3CMGA 4LPCA 4HU8A 4Z2LA 2VX5A 5IHSA 1HF6A 1GVIA 5CZKA 3VIKA 1E6XM 1VJZA 3CZ8A 1QNRA 3N1AA 3DC0A 3ZM8A 5CSYA 1WO2A 1W3KA 1HIZA 2WHKA 5AYIA 1ZBKA 2J8GA 2VI0A 4XV0A 2PWGA 4A4AA 4GKLA 4Z2JA 1H0IA 4P8WA 1BSIA 1CXKA 4JZ5A 3GXMA 1VFOA 1PIGA 2DIEA 3B9AA 3AZTA 4D6EA 1HKJA 3RJYA 5A6KA 5D8WA 2YL8A 2PB1A 1GNXA 3DYPA 4FLRA 4MAZA 5A8NA 1UD5A 3MU7A 3ARTA 4J3TA 1XGZA 5ABFA 1RH9A 2DSVA 3ARYA 1J0JA 3GBDA 4FMVA 9CGTA 1MW3A 1GQJA 3AIWA 4V2XA 1QI4A 2VVSA 3AMKA 3CHFA 4IM4A 4CCDA 2VCCA 2ZX7A 4KGLA 1JZ3A 5A2CA 3CZEA 1WPCA 3VMOA 2CBUA 4UZUA 4Z2IA 2G41A 4HA1A 4B9ZA 4U3AA 1TUXA 3GZAA 3I3BA 2XGIA 3AXHA 3VIJA 4TOQA 4X9YA 5A6AA 1HJWA 4S3KA 5GQBA 4AD0A 5GPRA 4GI9A 4PEEA 4UFKA 1B3WA 3RO8A 1W1PA 3UESA 2F8QA 2XTKA 5M5DA 4AISA 2DPEA 4TXEA 4Z2GA 2DIJA 3OGVA 3W4RA 1UWTA 1M53A 1E6QM 1UWQA 2WMGA 5JBFA 4RE2A 3OG2A 5D4YA 4D6JA 3PTQA 2O92A 1PX8A 4D6HA 1LWJA 2YIHA 1V3JA 1B3VA 2GJXB 4AIOA 1QI2A 4P7NA 4W85A 1CNVA 1GHSA 4HZ8A 3MMWA 3RCNA 2WLZA 2ZX9A 3AIEA 4W5ZA 2ZUTA 2EPLX 1BG9A 1WZLA 4DM2A 1RP9A 4OZOA 4JFWA 3CHDA 4QLJA 1PIFA 3WBEA 1JGIA 1EDTA 3L4ZA 1DWHM 2F61A 2WHJA 5FL0A 3AYSA 3W53A 2WVVA 2QPUA 3EDJA 2Y5EA 1NWSA 2ZE0A 1B9ZA 4ATDA 1GOOA 3CUFA 1E6SM 4U2ZA 2QMKA 3B8SA 3VIOA 5FIPA 4ATLA 1LL4A 3PZVA 1CLXA 1J0IA 4OOZA 4W8AA 1Y7VA
chains in the Genus database with same CATH superfamily
1TE1A 3THDA 3WDQA 2C91A 2ZXDA 3H23A 1E56A 3QHMA 3PUEA 4Y90A 3HQPA 4NXSA 1BQCA 5D2VA 5C8BB 3A47A 4NI3A 5GNXA 1IXQA 3MMUA 2IKGA 4AY7A 1RA5A 3A3WA 2G4FA 1TPWA 4JTAA 1VPYA 2PD9A 3EDDA 3LV6A 3E96A 3SN1A 1VH7A 3ARUA 3GIPA 3CTTA 1TWSA 4IG2A 4ADTA 4BZYA 1QOXA 4JTCA 1H50A 1XSIA 1CT5A 5BOOA 1CB7B 3OPSA 3TROA 1W9PA 1OCNA 5M17A 4M6VA 1VZWA 3F5LA 1A47A 3GBEA 3TMQA 5FJOA 1X6UA 3W86A 3KX6A 2RGMA 2ABBA 3KP1A 2FMOA 2NX3A 2ONEA 4LAKA 3GXDA 1SZGA 3AZRA 1RJPA 4M81A 3LQLA 4EPDC 1KRAC 4MFEA 4R27A 4I5XA 3RLUA 4IGMA 4LUSA 4HSOA 4G1NA 1KTBA 2MUCA 1VF8A 3BZJA 4FLSA 4C7DA 5LSMA 4D6CA 1RY8A 4YWSA 2E77A 1GT8A 3PNZA 2EPOA 1DORA 2PDJA 3QXBA 5CQ1A 1MWOA 4AZIA 3ZVHA 4WK9A 3ZJ8A 3BO9A 3A12A 1HL2A 1I75A 3C2VA 4ZMGA 5HK4A 3AWOA 3LLXA 3H54A 1K9EA 2V2CA 3PG9A 4GINA 2QUUA 4CNSA 3I4KA 3UR8A 4UMCA 3KTSA 1ICQA 1P0DA 3KL5A 1UKSA 2WNWA 1F8MA 5I3FA 1FY6A 1OVDA 3WNKA 1RJQA 3GW0A 3H2MA 3F4NA 1RLCL 1ZP3A 3LCXA 4DBDA 4UIOA 1KGUA 1EP2A 3FA3A 1W31A 1IEWA 1NDWA 2UBPC 1I60A 1XIDA 4HYRA 2VFHA 1JFHA 1TZZA 4O57A 5C55A 3M0MA 1LT7A 3UBPC 4NYUA 3TN6A 3LGEA 7TAAA 1I6NA 1CWYA 4ZFCA 3PULA 5H8UA 4XD3A 1R3YA 3Q37A 4JY8A 4MSSA 1UHVA 1T99A 3WH9A 4X9SA 3T55A 1AQFA 2OLSA 1BTMA 4CU7A 4UMAA 3BLOA 4PUEA 3L5LA 4C65A 3VKAA 2PDLA 3MANA 2FKPA 2ZADA 2J62A 4MB1A 5MKGA 3LEPA 3SGGA 3PBMA 4X61A 4US5A 4I7VA 4C1NB 5KITA 1F3XA 3QYSA 1M7PA 1EGMA 3W6YA 3OVGA 1XG3A 5A6MA 3SJNA 3IS4A 3CASA 1L2UA 2WJDA 5XIMA 2O9PA 3AICA 1BYCA 4TTGA 2ZZ5A 2EG6A 3T0BA 4JNZA 1D7FA 3S5ZA 2ZRZA 3UZ5A 3ZJ6A 1ZQ5A 3M44A 1GKQA 1KBBA 2PRMA 1ZJIA 3BH4A 3S5NA 3GB6A 2J9YA 2NXGA 2EPMX 4YTSA 3WX7A 2Q8LA 2G97A 1C8QA 1V0LA 1DWJM 3ONCA 1DPMA 1LJYA 1GORA 1X38A 3QY8A 3W7OA 1B57A 3GTNA 1UUMA 1KKOA 1LT8A 3FJ4A 1GOWA 5FEZA 3DKLA 3I10A 3AS1A 3HJZA 4K38A 4UTUA 2P76A 3HURA 5L9FA 5I3GA 1GW9A 1E71M 1GTHA 4P7RA 3L4WA 3TOYA 2VP8A 4PTVA 4Z1YA 2BWGA 3POCA 3UJ2A 2WO5A 1B3YA 3CL7A 5EMKA 2ISDA 4XTDA 5REQB 2PSNA 2OOGA 1VFMA 2W9MA 2VQUA 4NNBA 2C7FA 1VR6A 3IIZA 3CT7A 3AYVA 4X0NA 4MADA 4JEQA 2VZOA 1FHLA 3VYLA 1J96A 2H3DA 5EPDA 5GJNA 4F0LA 4WLCA 3NG3A 3PJUA 4ZB5A 4DJDD 1XRFA 4NAFA 1XLAA 1CLVA 4HN4A 4QROA 3VKJA 3L5AA 2IQDA 1SJDA 3MZNA 4QP0A 2P3ZA 1GKPA 3BAYA 3QGAC 4AZCB 4D1JA 1NDZA 8RUCA 3BANA 5LIKX 4I9TA 5M03A 4JQ3A 4FP1A 4FI4A 3RYSA 3U48A 1A5KC 2GOKA 3VX0A 3O1NA 1PIIA 2DZWA 2E28A 4IP7A 2PTWA 4MJ4A 1OF8A 3UPWA 5G4HC 3PS7A 1JNEA 1W3NA 3B9OA 4G56A 1TCDA 2ALDA 5T9CE 3TAKA 1IEIA 3KBJA 4J27A 3P2VA 3QYQA 1GCYA 1CX9A 3QQ1A 3VM5A 1HJUA 4UTTC 3C3NA 3BV4A 1UR8A 4TTUA 3ABZA 2JKEA 1YLVA 4Q4RA 3R5EA 2V67A 2PD5A 4UTMA 5I3JA 1V8EA 3ZLHA 4J3UA 1QWKA 2ALRA 2D73A 1SZFA 2WLYA 2I57A 4PMVA 3WD3A 5AY7A 5C54A 3D3AA 3CUGA 2PWHA 2DW6A 1MEIA 3CYVA 5AC8A 2V5KA 4IGHA 4NRRA 4US5D 1UZ1A 3RR4A 5A6BA 1I9CB 1JCNA 2REQB 3SFKA 3WIJA 3G2GA 3W83A 4GI6A 4MY8A 3W0KA 4PB3A 1MNZA 1C8YA 2W79A 4AZ6A 3UYCA 1XLKA 3N6JA 4C6KA 4JOMA 1V4YA 4L1WA 2V3EA 3O15A 1R3WA 1XH2A 3M16A 2BY1A 3MCNA 4U4MA 3R2GA 3OYXA 1ZSXA 2EJ1A 3IIPA 4AEFA 4NT0A 4KBXA 3XINA 2DVUA 4NAEB 4PMDA 4GFSA 1D9EA 1GTEA 5A1AA 3QC0A 5TAOA 2JGYA 1I2PA 1YW1A 3GFYA 3TQPA 1I8JA 4QE5A 3CHVA 2ON3A 4MNLA 3BGGA 1QW9A 4JIIX 2YA1A 5D9NA 3CJPA 3GR7A 1CCWB 3G0XA 2AOSA 3TW9A 3IJLA 3A5FA 1HL8A 3RX3A 1I1XA 4R5EA 5TQLA 4WDXA 2VZUA 4FPSA 4EPBC 2NVAA 4K8EA 4WXZA 3S3GA 4AC1X 3IJ9A 1Q2SA 3K8MA 4A2SA 3BLEA 3VI2A 2GUYA 3KTCA 4CEXC 4DLMA 5IFTA 1J12A 3IUIA 1PE1A 1TTIA 1W3TA 1XF0A 4U2YA 2HVOA 3N12A 3VFLA 3T0TA 1IT7A 1X98A 1SJCA 4ZQOA 4RPPA 2V30A 4KESA 4H8VA 2W63A 2A21A 1WOBA 3AXXA 4JPGA 1EOKA 4EXAA 1GVFA 3LI0A 4LCQA 4JHZA 2VX4A 3L4XA 4DYJA 1ZAHA 2PURA 3VC6A 3FYOA 3VFCA 3VKKA 2DEPA 3KDOA 5FJPA 2MANA 1OSEA 4ZZ9A 1Q85A 4C6EA 4AZHA 3WLRA 2HZGA 1KV5A 1Q63A 1YNPA 5G4WA 1V3MA 2W67A 3KS6A 1GJUA 4H7ZA 1H62A 6PTDA 2JEQA 1IQ8A 5BMWA 3TQVA 1XSJA 4DJED 3BGAA 1QK0A 3UD6A 2AQOA 3O3RA 1LOQA 2GK1A 2YBUA 3ID7A 4ES4A 3CC1A 1R2RA 4B4HA 3KFTA 3PTKA 3M6DA 4LANA 1AQHA 3GU2A 1VFTA 3AC0A 1KXTA 4QDWA 2BS9A 3CIXA 7CGTA 4A35A 4LB3A 4BQ5A 3M4HA 1V3KA 4NZ3A 2WKJA 3FYPA 4JL1A 1JZ8A 3WD0A 3LPGA 2WSRA 2VRKA 3ZMRA 5ABHA 3VNJA 1VPXA 4CCEA 2XZ7A 2GSJA 3DI1A 1WE5A 4UTWC 2E9MA 3VE7A 4HSNA 1XSKA 3W71A 1FWEC 3RR1A 1K03A 2FMNA 3ANVA 3M0LA 2D2HA 3M5VA 1VBJA 2R94A 3DGRA 4TV6A 1A4LA 4N7QA 2PC4A 4W87A 5G1MA 3B0UX 2C71A 5HNRA 1BTCA 3LHTA 1KRMA 5DMNA 1MYRA 3A6OA 5T91A 3AALA 1Q7MA 1NH6A 1OFOA 4J2MA 2E68A 4F40A 5FEWA 3R7MA 3UYIA 3RUBL 1SMDA 5LIXX 1VHCA 4LF2A 2QDHA 2CBIA 5REQA 2F2HA 4NX5A 1ITUA 1R9YA 3ECQA 3PZUA 4LWWA 1ICPA 1BLIA 4QITA 3WEMA 2EG8A 1QOPA 4KERA 2CXEA 5I79A 1FDJA 1E4NA 4OKDA 3VOJA 3V0TA 3MSRA 1ZJAA 1XLBA 4PUKA 3B8TA 3ARPA 4HCLA 9XIMA 3C6CA 4EWJA 3RPMA 5JIWA 3A13A 3N9RA 2Z1WA 5BYWA 3W7GA 1HKIA 2W91A 2Z1XA 2I5GA 3WH7A 1E6RA 4O0ZA 1IIHA 3BSMA 3WFLA 2BHUA 1HKKA 1JZ4A 5AKQA 1EIXA 3MKCA 4OBRA 4PTDA 3OO2A 1K7EA 5DCEA 1HFBA 1AD1A 3KHDA 5TD4A 5C2XA 1PBGA 2Y1HA 4C6QA 1Y5XA 1TRIA 1L6SA 5G5IA 3W00A 3SCRA 1C9DA 2E5BA 2J7CA 4EACA 5IFPA 1F5ZA 2QW5A 2BBFA 3EB3A 3E49A 1HT6A 1UCWA 3A4WA 5BWFA 1QHPA 3B0VC 2I5QA 4JN6A 2VUYA 2Z29A 5LHFA 2DSWA 2X8RA 4JY9A 4W88A 2KX9A 2WAGA 2PCEA 3GC2A 3LHZA 4H9TA 3H12A 3SW6A 3SCOA 5AC4A 4S3AA 2XINA 4QNEA 4B2DD 3GQYA 3OLEA 1AFSA 3N6HA 4CQ9A 2A4AA 1HN1A 4DRSA 3AU6A 3NM3A 2WSPA 2A3CA 1KM0A 1TPDA 2VZSA 3IACA 1US3A 3UF9A 2VCBA 2OSWA 4ICMA 2IXUA 1HGYA 2WZEA 1XCXA 3GNPA 2J7EA 1LG2A 2WXDM 5JIPA 4KEMA 5C2GA 3GSMA 2QDGA 1PKMA 4ML9A 2WCAA 4XQ6A 2BOGX 1Y8BA 3HPXA 4F8XA 3VIPA 1FWBC 3BAIA 4NY2A 4K68A 5C7VA 2D22A 4A29A 2UZ9A 4D9PA 3THUA 5D9PA 3FW6A 3O0FA 1N2VA 1BAGA 7XIMA 4J4KA 4F48A 3B97A 1OWQA 3BAJA 4JTRA 4KRTA 1SFSA 3MCMA 1VEMA 1D8CA 1SU5A 2GGHA 5AZ1A 1FH7A 2UY3A 3EKLA 1GUVA 3VGHA 3P67A 2XN2A 4NZJA 2P88A 4JX5A 2LLEA 3PF3A 4EXQA 2JK2A 3MUXA 1ITCA 1XX1A 4K1WA 1OINA 3CNYA 2OJPA 1OQFA 2E6FA 5LXEA 2Q3RA 4C6JA 1JEZA 4WXYA 3QZ6A 4F2BA 3URQA 4JIQA 2J8FA 2YL6A 3IVTA 1JYNA 3H2FA 3CU2A 3T8LA 4DPQA 4KT2A 3E6EA 1MO0A 4QJ4B 1DHPA 1EGVA 5F2MA 3UR7A 5BU6A 1UA3A 3DEQA 4MZYA 4QQ3A 3VGEA 2VXNA 2VMFA 3P93A 2O9OA 1DOSA 2PI6A 3AUJA 4F2UA 4JCLA 4QNWA 1KGXA 3OGRA 1W56A 4AU0A 2FLIA 1B30A 4A21A 1K3UA 3STCA 4FX8A 4E2VA 3IJQA 2WBGA 2FYMA 3B40A 4HK7A 3U57A 3ZXWA 4JX4A 3UEQA 2BHZA 3PJTA 1H41A 1A5LC 2OWWA 1DQWA 1JUEA 4AC7C 3NEVA 3ZFHA 1LF1A 1OG6A 4KWUA 4JTHA 1K7XA 2YKKA 1XUUA 1H7WA 3EX2A 1Z3NA 2E8YA 1NJJA 1ECEA 3LK6A 3PBWA 4N9EA 1AL7A 3JRKA 4UNLA 1C7SA 3VDHA 3VIMA 3O07A 3DHFA 3P80A 3BAXA 2E9LA 3DERA 2ZIDA 3DX5A 3MVIA 4X60A 4CVUA 4QHRA 1XIEA 2CFFA 1WKEA 1ISXA 5CEWA 2OSXA 3W2NA 3O6DA 1RHCA 1BFNA 4RPQA 1NFPA 4EKJA 2PBGA 3PZQA 4L80A 2RHGA 3UERA 3ITOA 4JEJA 5B7ZA 1RBAA 1H49A 1TX0A 3ARSA 3B9NA 3TH6A 1TCMA 4AZ7A 2XVNA 2ZVRA 4JTDA 4GG9A 3I4EA 2V69A 4P2VA 3C52A 3KTXA 4UQ9A 1UR0A 3E1F1 4K8HA 4EPKA 1HVQA 1S46A 3R6IA 4MY9A 3GNDA 5HUOA 2IXVA 3GHRA 1L6FA 3OBKA 3GO2A 2OGYA 1ONEA 2JALA 2CZVA 2Z26A 3WMLA 3AHXA 2VGGA 3WF3A 5E0KA 4NJIA 1FFRA 3STPA 3TA6A 1TJ2A 1YKWA 1T5AA 1OFDA 3P3BA 1YMYA 1W37A 1GEHA 1EWDA 3V0UA 1IIGA 2TAAA 3BAWA 5D2TA 4FX6M 2FB3A 1JIBA 2OZTA 2GGEA 1M01A 1G4SA 2RUSA 4DO4A 1NSJA 5A8PA 2VGFA 4W7VA 4D71A 1SM9A 4O0QA 2A3LA 4IMFA 2GWGA 3GXPA 4IIDA 4WKFA 2PP1A 2FB2A 3CGTA 1UOZA 5CG0A 4DX3A 2C3ZA 2CZFA 1HNYA 4UTIA 1R7AA 1UD6A 1CPUA 1V6UA 4Z1CA 3EKZA 1E6ZA 1LCOA 4OV9A 4ALDA 3F4CA 1SVDA 1PHWA 1XYCA 5LIWX 3HTWA 2ZA1A 2E6AA 3EX1A 4Q32A 5C5YA 3IGUA 3C0JA 3SURA 3VA8A 4QSFA 1TFVA 1W9BM 4URIA 3ME3A 1YHTA 5K3VA 3AISA 2FTPA 2YPIA 2Q02A 1RP8A 3L23A 4UTKA 3UVIA 3V0SA 4NIRA 4E4PA 1S2VA 5DO8A 1I45A 4JFUA 4IUGA 1XBZA 2DT0A 4YCOA 1KCLA 3AIQA 3QMSA 4A3QA 1GVEA 3CMFA 3SCVA 1P0KA 2OELA 3SSJA 3CAWA 3DAQA 3W1PA 3G1AA 5BRBA 5IBXC 3N4AA 2WK2A 4N0RA 2Q3OA 4ZB2A 3BW3A 3G8EA 1TQXA 3KVLA 1Q3NA 3M07A 4YU1A 4GMEA 3NXFA 4O53A 3LGDA 4JIPA 3RDKA 2DT2A 1X7IA 4N42A 5FJRA 4MHBA 4N9BA 4QG9A 3EX6A 3EOSA 3B8WA 1KQZA 3KBNA 1FCBA 4PMNA 5I03A 4HHPA 2WBKA 3KZSA 4ZO9A 4QE4A 1TO3A 3WNLA 4ERIA 4CD4A 3RIKA 3A22A 5I3HA 2IQTA 4GCAA 1O66A 4AWSA 3NPWA 3WQGA 3UA4A 4FOJA 3TWBA 3KWXA 4FAMA 3W7RA 2V3GA 1ODUA 1X6LA 3VNIA 1HP4A 2VFGA 1AVAA 3IARA 2ZICA 3HB9A 1PYFA 3DYOA 2OSYA 4TMBA 4ICNA 3OQ8A 5JBEA 3C56A 1QRQA 3KAOA 3MUCA 1H51A 1CXLA 3O2LA 1F05A 4P8UA 3AO0A 1T0OA 2FDMA 4HK6A 2R6OA 4HK5A 3G0SA 5HBFA 5LNRA 4KCWA 1Y5VA 3PZIA 5FF0A 4OWGA 4UCFA 4ZXOA 4KIRA 4W93A 4V1YA 1OD0A 2VRQA 2XJ7A 4MB3A 1H7PA 4CKQA 2QJMA 1ME7A 1TMLA 3OBEA 1JXJA 2E7FA 3E5PA 4UB9A 3UXLA 4HU0A 3QKZA 2AQWA 3FGCB 1BYBA 2J9ZA 3S83A 4XZWA 1UPMB 4PGLA 1HJQA 1I2RA 2ZZ6A 1OYBA 3AIBA 1XBXA 1F6KA 3BLFA 1XC6A 4HHMA 3A3XA 1ZBVA 4ZBCA 3L12A 4D2JA 1NWRA 4NRSA 1KM1A 2PDMA 2AGKA 3SN0A 3GNRA 4WKHA 4O1AA 4V33A 4YVPA 2OEMA 4AZGA 3WF2A 4IUOA 3RILA 4LVGA 2C19A 3WQFA 3N9SA 2ZRYA 5AN7A 1CENA 2VWTA 1SUXA 3PVFA 4ERAA 1TPEA 5D30A 3ITXA 4EE9A 2HDJA 4V28A 4LUIA 3BQ5A 1RD6A 5A95A 1XFBA 1V0MA 2Q8ZA 3SECA 1UR1A 4RXGA 5C2CA 1KBIA 6XIAA 3FX4A 4LSBA 1UZ4A 2TRSA 4KMQA 4GHRA 4MOZA 1EZWA 2BXVA 2ZC1A 3EOLA 3SUUA 4IL2A 4IFKA 2J77A 4H41A 1YTDA 3GHUA 4E3TA 4JQ4A 1TRDA 2ICSA 3V4BA 4IXHA 3BLDA 4RUBA 3PWGA 2VO5A 3ITVA 2VFFA 2VTFA 3ABRA 2V6AA 3W7EA 4KFPA 3QPYA 2G95A 1E5NA 1VGAA 2CHNA 1LTDA 2Q01A 3JR2A 4DZHA 4A6GA 2WJEA 2PLKA 2QPSA 2QCCA 1TJ0A 1VFUA 5J04A 3VXGA 4EIVA 2Z00A 3SY8A 3AHTA 3CHEA 2V2HA 2J9XA 3NQVA 3T4WA 5FD0A 2Z25A 1FKWA 1E0WA 4HP5A 3V1HA 2GGJA 2RDUA 3LCGA 3EPOA 1UH2A 2C79A 1AJ2A 3M0HA 1B5TA 3I6TA 2EKCA 1OABA 1F9CA 5LA2A 1SW3A 4OUEA 4HBKA 3SCSA 4Z1DA 1FWGC 2TPSA 2D3NA 5HWJA 1XLGA 4AMCA 2RFGA 1VJSA 3PZGA 3PPCA 3SCNA 1EGZA 3WMSA 3W1XA 3FJLA 3JU2A 4H04A 4O52A 2HQAA 1UG6A 3L21A 2BY2A 4GIAA 1WOAA 2X0YA 3G6LA 1XGDA 1G6CA 3L2MA 1VB9A 4JNMA 1LBFA 5BRQA 4PE8A 1UJQA 4E8GA 4Q4OA 4QCEA 3O63A 1VFSA 1UD4A 2AAAA 4G7EB 4IOTA 4S1FA 3Q45A 4HOXA 4N02A 3NO1A 3GX9A 4KRUA 4WDWA 4JL2A 5AHEA 3WUGA 4PULA 5M2FX 1J2WA 1XWYA 3E0FA 1VLWA 4MWAE 1ITQA 3CUZA 4PMOA 3SZ8A 4BF9A 1Q5MA 3HMJG 1GVRA 3MO4A 4JIRA 4AEEA 2ZDRA 4XZLX 1OT1A 1TV4A 2QCDA 3TTOA 3ARQA 1NOUA 5MF5A 2XVPA 1PWMA 3E74A 3G22A 4IHCA 2VZVA 4K37A 5JH1A 3N2OA 2P0IA 1A49A 4WF7A 3P6LA 2JKAA 2Z1KA 1S38A 5KZEA 3CMGA 4Z2LA 5IHSA 1WYIA 2NZLA 1E6XM 1D3HA 3DC0A 5D38A 5DBUA 4EXBA 3OZYA 2WHKA 1BQGA 4XV0A 4GNVA 4A4AA 3GYEA 4NJGA 1H0IA 1BSIA 5CZSA 4JZ5A 4DBUA 1R5YA 1MDLA 1YPXA 4FNRA 4HJWA 4FLRA 5D2YA 3MU7A 3ARTA 2XIQA 1XGZA 3UY8A 5ABFA 2BTMA 3APYA 4GQBA 3URAA 1L8PA 1GQJA 4I3GA 1IXPA 3CHFA 3LLDA 8TIMA 4GQGA 4IM4A 4B5NA 1QDSA 1TPH1 3GTFA 5D02A 1WPCA 1NTHA 2CBUA 2QDEA 5H2ZA 1NFGA 4Q4MA 4B9ZA 4U3AA 3TN5A 1TUXA 3I3BA 2XGIA 2BODX 4PBEA 1HJWA 5LNSA 1UJPA 3USZA 2VENA 1LZOA 4PEEA 3TWAA 4DUOA 3MMTA 4UFKA 5AYZA 5LNUA 4WEVX 3RO8A 4DWDA 4IFOA 4LVBA 3UESA 2F8QA 3NA8A 4PUWA 4TXEA 3C61A 3OVQA 1A80A 1XINA 1ONRA 1E6QM 1UWQA 5JBFA 3IIVA 5IDZA 3UFYA 3OG2A 3S8HA 5D4YA 1V5XA 4D6JA 3W9ZA 1LWJA 2F9RA 1V3JA 1XICA 4O0KA 3WJXA 3G1XA 3R4IA 2GJLA 2BGQA 1I2OA 3MMWA 4S3FA 1UBPC 5DRCA 1Q8JA 4C5YA 2VR2A 5HAOA 3EKGA 1RK5A 4MF4A 5G2HA 4P5UA 4QLJA 2QJIA 3TKFA 4QEEA 2F61A 3FJNA 1N8FA 4H83A 3W53A 2WVVA 4MGGA 3GTIA 1NWSA 2YZRA 3WLSA 1E6SM 2F38A 2QMKA 5D33A 4H9UA 3H2CA 3VIOA 5FIPA 1HW6A 1UMLA 3PZVA 4OOZA 1L6YA 4WDTA 4HB7A 1E51A 1TMHA 2D0GA 1V51A 2G5WA 2DZAA 4GXPA 4DN1A 1ZAIA 4MZ1A 1SW0A 3H7RA 4I8YA 2AAMA 5CXPA 2VZTA 1BWKA 2PPGA 4MZ8A 3S9IA 2J6XA 5RUBA 1FHVA 3VNMA 1I4NA 2OYLA 4JCMA 1IWBA 3MP5A 3N17A 3NUKA 3WEZA 3SUTA 3TN4A 3TEVA 2ZUMA 1JF5A 4H6QA 4GPNA 3EZ4A 1LM1A 1WBHA 1VCGA 3M0KA 1KA9F 1K7FA 2BMBA 2HVNA 3SQMA 1BPLB 4K36A 2ATMA 1NEYA 4HPNA 3TV8A 4QE1A 4Y6GA 3GZ3A 3W7JA 4ONVA 3UCQA 4EANA 5HPOA 2VOMA 1R8LA 1JPIA 1FA2A 3UCCA 5E9XA 4DF1A 1O12A 1PX4A 3LTPA 1KM4A 3RRAA 1TZ9A 4DI8A 1PYMA 4CQDA 2NW0A 4C6MA 4WY0B 4DVOA 1R2SA 4DNMA 3R43A 2QCMA 1ZGDA 4YVVA 3HFTA 2P5NA 3CWOX 2X7VA 4N4PA 3UZWA 2X2GA 3PUDA 1M7XA 2G3MA 1FWAC 1S2UA 2NV1A 1KBKA 2ZFAA 4XZMX 2XIMA 4D8LA 4FNPA 2YCLB 1E0UA 1BGGA 4A3HA 4KWWA 3BUVA 2WPBA 4JTUA 3HG2A 1O5QA 3WQDA 4HU3A 1YXDA 4PN2A 4H7VA 2ZRVA 1BF2A 3IAQA 2PDWA 4R85A 5I7GA 5BROA 1LWIA 3N4EA 2OO6A 2J7HA 1FWNA 6ALDA 1SZRA 3T0CA 3H7VA 4JN7A 1PVNA 1QVBA 4LYRA 1XHGA 3EA2A 4DWSB 2ZXQA 1L6GA 3S6OA 4PCTA 3E0VA 1LUCA 3LZ5A 4Q6XA 3R8RA 1KTCA 1E0VA 1UD3A 1UC5A 3DBNA 5AFDA 3TONA 1HUVA 3IK4A 4J7RA 3KLLA 1QK2A 5H8PA 4MPKA 5E5CA 2EPHA 2I17A 1F7BA 3ANUA 2DH3A 1WKFA 4B15A 2WQDA 3CAQA 3NWRA 4AX6A 1E9ZB 3E0WA 4C6PA 4LB4A 5EMYA 3OLGA 3OLDA 3RLHA 4WJ8A 2YCEA 1HQTA 1EC9A 5AB3A 1VRXA 1EJVC 3E12A 4XBSA 3THQA 3ITTA 1SZEA 3THCA 2Y5JA 2JKPA 3MWCA 4JBRA 2CHRA 4MYAA 2KAUC 4G1KA 2CLOA 3P7YA 4Y2WA 4QFUA 3FN9A 4MG4A 4JX6A 3THAA 1DL3A 4RX0A 4UCGA 3AAMA 1GZJA 4GCXA 4LJ3A 3RN6A 2DQXA 1YADA 1V0KA 4PZVA 1A0DA 1YRRA 5PTDA 2CLMA 3SY5A 1QOQA 1MUWA 1W6TA 2PP0A 1O7AA 1IWAA 5CPLA 5BMXA 1RSCA 3K5XA 5L6UA 1H1NA 3MHFA 2CPUA 3SI9A 4E3VA 2E67A 2X1UA 3A24A 2WCGA 3MDWA 4F2TA 3IPWA 4ADSA 1ENUA 1F2JA 1YIXA 1UB3A 1LLZA 1R46A 4GJ1A 3HG5A 3W1UA 1X96A 4LUYA 5KINA 3TP4A 2C6QA 1TWDA 1YE4A 2VFDA 4OHQA 1DTNA 2Y62A 4B4FA 1GQIA 2XDFA 4O11A 3KOXA 2OWCA 4I6VA 4LC8A 1EZ2A 2HXTA 4M1RA 4M8UA 2WW5A 2WYSA 5D04C 5D05A 5FESA 3I7SA 3DHDA 3GE7A 2DZXA 1Z8AA 2WKGA 3PAJA 1HP5A 1NFBA 4JKMA 1K8XA 4INFA 3T4CA 1HL9A 2HK1A 1G94A 4EAYA 2B31A 3NQGA 4GIYA 3UU0A 3A9BA 4B5TA 4HKPA 4OQVA 1WZKA 5ECUA 2XPKA 1BYAA 2PA6A 4BF7A 3PFRA 4QG8A 2QLYA 4AD4A 2XVGA 3CPUA 3KBVA 5CGMA 2HSAA 3W7LA 1E43A 4WJEA 2GDVA 1PJ9A 3BXWA 2PTYA 5CGTA 2IKIA 1IV8A 3FOKA 2POTA 4X2RA 5DT5A 3P60A 3R11A 3EWWA 1RVKA 1U2YA 2V3DA 3VU2A 3KBWA 1EBHA 3LDVA 3EOOA 2JF7A 1AW5A 5C9RA 4N4QA 3N4FA 5FL1A 3LN3A 1OY0A 4QS6A 4DJFC 3KE0A 3V3WA 1DVJA 2QNEA 1OCBA 3IGHX 3BG9A 1OM0A 1J6OA 3NZRA 4D6DA 3EOEA 4GY0A 1XLHA 4S3JA 5CLTA 5B80A 4NZ4A 3PPFA 4RW5A 1OEPA 3Q58A 4KWOA 1HKWA 3N13A 3WFZA 1K9FA 2QEZA 2UWFA 3FVMA 3NL2A 3U2ZA 5C0QA 2FFIA 2E4TA 3CO8A 1EH9A 2FGBA 5J8LA 3DFTA 3F2DA 5CKSA 2JFEX 3WQOA 5CBBA 1E70M 2WZHA 4QDPA 3UR2A 2EO7A 2IQ0A 3FFSA 1T8XA 8XIAA 2H9AA 2DZTA 4GH3A 5EFFA 4WY0F 4A22A 2VYOA 1X8CA 1QNPA 1ZJBA 3FNDA 4D8ZA 1RALA 3GVVA 2ATSA 4QJ1A 4QJ3B 3ZIZA 1XPYA 4REQB 1PHQA 1UKQA 4PRRA 2DUZA 1V6WA 3LU2A 2X05A 1EJSC 2C13A 3FHAA 3MVTA 1EF2A 2VT0A 3EEZA 2YYUA 3W70A 4AVNA 3INPA 4DY1A 1B3XA 1GVOA 2O4QA 4WY0A 3SB0A 4XAPA 2H3BA 3EMCA 3QH2A 3FAWA 3NYDA 1ML1A 3QV7A 3GRIA 3I65A 4PMYA 4MYXA 2AMGA 5TIMA 2H6RA 1E1EA 2CWXA 2I16A 3Q65A 1YQ2A 1CGTA 2ZX5A 4G5DA 4DNHA 5E6YA 3WQ8A 1L8NA 1KXVA 4RNJA 1M7JA 3UZYA 3SCUA 4L9YA 1FXPA 4QGCA 3PZ9A 5FSEC 1HJSA 3EB2A 4L7ZA 3RXZA 1GVQA 4G2DA 1XJBA 3E9AA 3TLLA 3F5KA 4IPNB 4WSKA 1Y5WA 3CLWA 4ZENA 1KFJA 5HQEA 3OZOA 1PCWA 3A4JA 1J2BA 2A7PA 3S2NA 4RV3A 4MIMA 3STEA 4PTNA 2FHFA 1H1ZA 4KETA 4O1DA 3T81A 1KFEA 3QOMA 1SYTA 3HBLA 1EDQA 1R3VA 3NSMA 4F0RA 2CW6A 3MA8A 2J7GA 2XH7A 3VVGA 3EB4A 3ATYA 1P6CA 1BVWA 5H8MA 1B3OA 3MDUA 4JQ1A 3H2EA 3KVKA 1W32A 2X2YA 2ZX6A 2ESCA 5J5DA 4IPJA 1EO7A 5DANA 2WHLA 1QJWA 4MJ2A 1KQYA 4OU1A 3MS8A 4EOUA 1OFPA 1W3LA 2P1FA 4IFKB 1V7AA 3QKEA 2CWNA 4ZGYA 1U1HA 3PZOA 3PZMA 3OZPA 1RZMA 3TFCA 4B16A 2DQWA 1XUZA 1W9DM 1J18A 2CZDA 2X42A 1IT8A 4MWAC 2OG9A 1R3RA 2PF8A 3T42A 1EC7A 1ZY9A 3ALGA 4Y9PA 2OQLA 3GDLA 1WB0A 2G3NA 4DM1A 5MHBA 1GHRA 3QEZA 5G1YA 4WCJA 4PMZA 3BW2A 4N6EA 3GG8A 3S4TA 4B92A 2EG7A 1W5OA 3QGKC 4CNUA 1GOMA 4F0KA 3ABXA 5KZDA 4HNOA 2QDDA 5A8OA 2HNHA 4MDOA 8A3HA 5A2AA 1POKA 1I0BA 2BHYA 9XIAA 3CT2A 3WQEA 3QC3A 1J5SA 2EKGA 3PUGA 4XAFA 4CGTA 4NYYA 3PSWA 4FNQA 3FK4A 1R86A 2FQIA 5CGQA 4CNPA 1XC4A 3H8AA 4JAWA 1NDVA 2E5DA 1KWKA 2VC9A 4IJBA 3MUIA 4FO4A 1KWGA 1GZ1A 5H1WA 1NY1A 1EEPA 3L0NA 2FPYA 5F4XA 3LHUA 2QUVA 2X40A 1WDWA 5C9WA 5DELA 1DIOA 3QQ0A 3MV11 3WF4A 1AZ1A 3ZWSA 3WDIA 3C86A 3BWWA 3C2FA 3VD4A 5ABTA 5BXRA 2D1ZA 4KEVA 1D7KA 1FCUA 3C2RA 4DWSD 4UTJA 2GWNA 3WY1A 3LM7A 5HQMA 4FOKA 5HPCA 4ZTXA 3S1VA 1TWWA 3SAZA 2Y5SA 3DGBA 2A85A 3LCFA 2JE8A 4C6BA 3CS2A 1KXQA 4NJJA 1OT2A 3LHYA 4GUJA 5C70A 3HU7A 4QIUA 3QY7A 1D3GA 3BVJA 1DKWA 4GC3A 3GXNA 1K4GA 3NCOA 3CQ0A 1LUCB 1FWIC 3O6AA 1OX4A 3WKZA 2Q6ZA 3PY2A 4AF0A 2ZVIA 4R9XA 2BVYA 1GG0A 3BDKA 1KRBC 4XK2A 3KOYA 3U2EA 1UZHA 5CH9A 5DCDA 4LQ1A 2ZQ0A 1QHZA 1TA3B 3PK7A 5BCAA 2ISVA 3D46A 3GW3A 3NSXA 3QBUA 1DTUA 3RCYA 4IFRA 3T07A 5FCZA 1W2VA 1VD6A 3T78A 5FACA 1T41A 4H2HA 2HJPA 4J3XA 2BGSA 1EYWA 3QV6A 3FKRA 2ASHA 3VOFA 4K2SA 3TQ0A 4ACYA 3TW6A 3F4WA 4O4WA 1WQ5A 1Z41A 5F4WA 4R9OA 5FF7A 4C5ZA 4IP5A 1TYGA 3WLMA 3VK5A 3CBWA 2OO0A 2WWDA 1RVGA 2VC6A 1QNSA 3P62A 3BZGA 3SRFA 1U5HA 3OTRA 4E2BA 5DXXA 3BLKA 2WWCA 3DUGA 1IWPA 2ZRUA 1JGMA 1W8SA 3AZSA 2YCIX 4HPGA 3ITLA 3LZ3A 3IVUA 5I06A 1VAHA 3G1SA 2ZZ2A 2GOUA 4B9YA 3TQKA 4JD4A 4Q8PA 2QUTA 4YHGA 1J0ZA 2R82A 3RO6A 1UH3A 1LRQA 1NOFA 1Y65A 3R8GA 3RJXA 4PTWA 4Y7EA 5E70A 2GVYA 1ONXA 3WLIA 1GONA 4UBPC 4CNTA 3W88A 3G1VA 2I5IA 3RITA 3H21A 5BOEA 2J6VA 2WSQA 2PU0A 3SR7A 3K46A 1QPOA 4JTIA 4DIAA 3S2CA 1W5MA 3EXTA 1OFRA 3WZ0E 3TYAA 2QMJA 4BY3A 3MI2A 4HMNA 2E0PA 3J7HA 3CZGA 2FHCA 1Q6DA 2GQ9A 2X1TA 1R85A 4Q22A 2HPMA 4AUBA 2A3HA 4MWAA 1J4EA 1K9DA 2RDTA 4PL1A 3OP2A 2J88A 2Q8XA 3VIHA 1A5AA 3LGGA 4FX7A 4CQCA 3IJDA 4K1GA 1XKJA 3UZZA 3ENLA 2OLAA 4Z17A 1OBAA 3AHZA 4LAZA 3R10A 4YL2A 5BXSA 2D0HA 1E1FA 1W9XA 4IMDA 3VMPA 3MV01 3WH8A 2V5JA 4M7SA 2Y4SA 3AMGA 3C2EA 2XG9A 4D1IA 1VFLA 1XLFA 4J35A 2HBVA 5HNTA 5C9ZA 4DZAA 1I2NA 3FLUA 3TSBA 2YXXA 3WMCA 3KHJA 1IR2A 1YX1A 1NQKA 1UWRA 1JAEA 1WUEA 2ZTJA 2R1KA 1RQHA 5DMMA 3BTNA 3DG3A 1V3IA 4DUWA 3DIPA 2XM1A 1V08A 4P8XA 3DFQA 1P43A 1U33A 3ANYA 1WV2A 4P7OA 1MW1A 2JIWA 2ZUVA 1VBHA 4RZ5A 3DG6A 3LB0A 3B9DA 4R53A 1OD8A 3BK0A 3GY1A 1XKYA 2H9AB 3M6YA 1YBQB 3PWAA 2J66A 4GVFA 2PLCA 1W5NA 2FTWA 4GD0A 4E8CA 1K02A 2OYMA 4FK9A 1GWJA 1KM6A 3W1LA 2X1SA 1ONWA 2QAPA 2V82A 3WG6A 4ZOCA 1S2AA 5GJPA 2FH8A 3WK1A 2KZHA 3NPXA 1WUFA 3TZFA 4IL0A 2WV8A 3NOEA 4S38A 1F4AA 3KRZA 4UXDA 3W37A 4GVIA 4TVUA 3N2CA 2B81A 4PUDA 4UQDA 3MHGA 4NG3A 5EMUA 1EP1A 1GZGA 3AJXA 3UETA 2XFFA 4LTSA 3QJAA 4C6LA 1NARA 3AOFA 3CYJA 5HULA 5IOBA 4UNKA 2DUAA 1E9YB 2YLLA 2GUBA 4CCZA 4LY8A 2V9DA 1M3UA 3MMDA 6CGTA 3B4UA 1QPKA 4PMQA 3ARVA 4PB5A 2W6RA 3PBYA 4PODA 3QMRA 4DYEA 1XIJA 1EL3A 1MUCA 4PSPA 2PBOA 1H7XA 2Y89A 4XVDA 3DFPA 4YVXA 1J6PA 2YDSA 5EGRA 4DXKA 1P4CA 1JDEA 1J9YA 3NQBA 4XB3A 5EL1A 5CAKA 3MP4A 4TX9A 4NZFA 1ZENA 1JFXA 4PUJA 5AYBA 1KTNA 3HV9A 1TX2A 4EX4A 1A0CA 3VKBA 1EFZA 2DT1A 5AVNA 5LZLA 3CV1A 4NXKA 3ISIX 2P8BA 3T0AA 6XIMA 4O17A 1RPXA 4X3ZA 1EUAA 3KLKA 3O6YX 4LBRA 3UPMA 1UZDA 4FALA 3LY0A 3MB9A 2VC5A 1FX6A 4L1XA 1JD9A 4WGHA 4A2RA 2WM1A 4A05A 4AVOA 4HCHA 3IEBA 2NQLA 2XH0A 1WCGA 4J3VA 3W7CA 1F6PA 5C7HA 1QI3A 2PWDA 4BA0A 4KEUA 2PDPA 1JZ6A 3B04A 3CWHA 4DJEC 1BWVA 3WNPA 4B91A 2XUCA 3VINA 3DG7A 1A3HA 3B4YA 4HD5A 3C0LA 3GNXA 1C8XA 4FR6A 5BXTA 2VX6A 3LCLA 1HKVA 3C8NA 4HNCA 2PP3A 3U2OA 4J40A 1R0MA 1TSIA 2WNQA 3CZLA 1DQUA 3PZTA 1DWGM 2XH4A 3GG7A 3LX9A 4CU6A 4N9CA 4ZOAA 3RRXA 1XDLA 1B4EA 5FJTA 2GVLA 1RQBA 1WXYA 5CPOA 1ISYA 4Y9NA 2EPKX 1QBBA 1WZMA 3UY7A 4Q8VA 1CXEA 1U1UA 4GA8A 2C0HA 3ZLFA 3TU9A 4O50A 3WJSA 1W5PA 4IG2B 3M0YA 1JRBA 2PWEA 3V5FA 3G5EA 2IUZA 3LS9A 3V16A 4AB4A 3ZZ1A 3A4XA 3WL1A 3L68A 3HF3A 4D6GA 1NELA 4UOZA 2F84A 2QJHA 3F7JA 1DP0A 3UGVA 1ME9A 3C3UA 2CLPA 2VWSA 1E4MM 1PDYA 1KBLA 5KZ6A 3GKAA 3MSDA 2DT3A 1NVMA 3CV6A 3POHA 1OHLA 2R24A 3AIVA 4DELA 2VNCA 3DKJA 4KCUA 5I2UA 2XWDA 3O7UA 4NU7A 1N8WA 5CZJA 1MW0A 2OVLA 1JDAA 3E2SA 4Q6JA 1XIIA 1DE6A 3RU6A 4IIEA 3MT1A 4IT1A 3IIXA 2RJGA 3GUGA 4QCFA 3W26A 2YR1A 3KCLA 5F7UA 4QS5A 3ZR5A 2Z2AA 3VMNA 4ACZA 5I23A 3EDKA 1QR7A 4IIFA 5CCZA 1QO5A 2Z1SA 1Q4WA 3OU8A 5CAHA 4GACA 3VNLA 4Z1AA 1GVSA 1V79A 1U30A 4W89A 2E5CA 5A94A 3LXBA 1Q66A 2XGBA 4CLMA 4HHHA 1JXKA 1CBGA 1Q45A 1OJXA 1H63A 2O9TA 2WPGA 1Z9AA 3OHMB 2AGTA 1BVNP 4GZJA 3KCOA 3TOPA 1FWCC 3KCJA 3WJYA 4B5VA 4AIBA 4BF5A 2GGIA 3SUVA 3WJZA 3XIMA 2QR6A 4E0CA 3CPRA 3DZ1A 3DI0A 2YDQA 1UUQA 4C6IA 3AMDA 4C1LA 2ZYFA 2D24A 1FDYA 4W7WA 3S9YA 2PDGA 1GGOA 4UQCA 1TR1A 2OB3A 3IJIA 4KWVA 1X1OA 3U7BA 3TN3A 1UUOA 1JDDA 1W3HA 2Y7DA 1KM5A 3UVAA 1KO0A 2YDAA 4JIHA 3WLHA 2R14A 2F6KA 3OIXA 5LNWA 1LWHA 4XIMA 4M56A 4I7UA 5EBAA 1QBAA 3BAKA 4DJDA 1H0GA 3FSUA 3RPDA 1CIUA 4KWSA 4NNAA 3DESA 3LLFA 4GXMA 2PTZA 4HPXA 3SIMA 2HISA 2WC7A 1H4PA 2PRHA 1Z42A 2POZA 4OECA 4M19A 2F6UA 3N29A 3AWNA 4W9TA 4BWLC 1IE7C 3TFXA 5FJIA 1WXJA 4ROPA 5G2IA 1XYFA 3W07A 3SCWA 3L66A 2NWSA 3UG5A 2V5DA 4BEQA 2VGBA 1W17A 4P8VA 1VHNA 4QEHA 4RNFA 1OZMA 3AHVA 2UY5A 3CZKA 1W1ZA 2XFWA 1C92A 1MQPA 1JF6A 1FTXA 5DT7A 3DN5A 1GYNA 2J7FA 2ZZ1A 3MYOA 1THFD 4IX2A 2CIPA 1KXHA 2VFEA 2V8ZA 4H00A 1EDGA 1GK8A 1AG1O 2E1WA 1A5SA 4XO7A 5CSUA 3SN4A 1VEOA 3GTXA 5T8GA 4ASTA 3TK7A 3ZR6A 5IXEA 1F3WA 1Z6KA 1JZ5A 3NJ3A 1FP8A 4AMAA 4LY4A 4AYSA 4WGXA 4UFLA 4GOAA 1TIWA 4TX6A 5J5RA 5KEZA 4N6FA 5E0CA 4QAWA 3R94A 3OJGA 4IPLA 3AYRA 3WQ6A 3GVRA 1PO9A 4S23A 5CLWA 1PPIA 1PEZA 2XSAA 1XS2A 2OODA 4DBSA 3S42A 1F8IA 1UMYA 4BQ2A 2BVDA 2AL2A 4RDWA 3PAOA 4LEFA 3G77A 4LGXA 2XWEA 7PTDA 4M7TA 2VRJA 3SGZA 4LV4A 4ZQRA 1GQLA 1OK6A 4CQ8A 5SWUA 4GGHA 3BG5A 4IIBA 2E3ZA 1TTQA 5AZ0A 4R3UA 1WAWA 1Q65A 4TR9A 3WF1A 5M1TA 1CXFA 1TV8A 3GLCA 2VX5A 5AHFA 3KDNA 1GVIA 2OT0A 1KFLA 1DJHA 5H6HA 3VIKA 1VJZA 3CZ8A 3N1AA 1GOXA 3NQ7A 3ZM8A 5CC3A 1WO2A 3GDKA 1W3KA 2OOFA 3TJXA 4DZ5A 1HIZA 2CLHA 1KM2A 3IRDA 2W0UA 1CXKA 3C2YA 3GXMA 2C1HA 2DIEA 3B9AA 2XN1A 1HKJA 4GGBA 3RJYA 4GIEA 5D8WA 3NNTA 2YX0A 4IGNA 4J3TA 2O55A 1RH9A 2DSVA 4LBSA 3GBDA 1JPKA 1QI4A 2VVSA 4H9VA 2EJAA 3G8RA 3LOTA 1TIMA 4KGLA 4AF0B 4OVXA 3VMOA 3K4WA 8XIMA 2HE8A 1KD0A 2VD9A 1XYLA 2G41A 4RK8A 2V63A 4HA0A 3ZS4A 4RCXA 3VIJA 1OFBA 4TOQA 3W7DA 1U83A 5A6AA 3WLOA 3TNBA 1BXCA 4IWWA 3WLJA 1YNQA 4GISA 4IXXA 4LBUA 4OT7A 1DE5A 4JHMA 5HMSA 1B3WA 1FWHC 3M47A 2ANUA 2E6YA 2CLFA 1N8IA 2I1OA 3AXKA 3OGVA 2GSHA 3CUXA 3UXDA 3N2MA 1R30A 1KV8A 4BJHA 4D6HA 3SO7A 4AIOA 1QI2A 4P7NA 3M5XA 1M6JA 3SY1A 4YTRA 1XLIA 3MBFA 2OMAA 2YXGA 3RCNA 3GDRA 3TE9A 1O1ZA 2EPLX 4RZ6A 5G4EA 1RP9A 2FTYA 4O1CA 4JFWA 1WDDA 3T6CA 1Z48A 3NR0A 1EDTA 1DWHM 2QPUA 4LALA 4ATDA 3CUFA 2XH2A 4M6PA 4HZMA 2V2DA 1VCFA 4QBXA 4ATLA 3CAKA 1LL4A 1CLXA 3TVAA 5CSRA 3HFYA 3ITCA 1EB3A 3BGJA 3E2RA 4LNYA 2NX1A 3DYMA 5FEPA 4JTGA 4JTKA 1GPWA 2HVMA 3ZWTA 3WDRA 3AFBA 4UMBA 5FF2A 1E73M 4L6OA 2GL5A 1PAMA 1B0IA 3PG8A 4OGZA 3LYEA 4C6CA 4UTHA 3ZVIA 3T44A 1EX5A 3KXQA 5D8ZA 3TNOA 1NAL1 2I56A 1UROA 3P84A 2Y85A 3GNNA 3LNMA 4KS0A 3QZAA 1VYRA 3ZJKA 3WLPA 7ODCA 3QGVA 1XDJA 1SMAA 2DZPA 3PBGA 1S2TA 3M9YA 2VJXA 3VTRA 3L9CA 7A3HA 3AU2A 3DECA 3C0QA 1EQCA 1C90A 1BSLA 2HS8A 3W84A 4JQAA 3KZPA 3NQCA 1OG0A 3W1NA 3W2UA 4TVCA 4NHVA 1FCVA 4LVAA 3M0ZA 3E0IA 1W1IE 4O54A 2FH6A 2BXYA 2DSUA 1H7NA 4UOJA 1NDYA 4OBSA 1RV8A 1BXBA 4X63A 3R58A 4GUGA 5I3KA 2O7SA 2A2IA 1A0EA 3ZT7A 4LS2A 4H9XA 3DENA 1POJA 1R6WA 4L6DA 3H26A 4PCSA 4TIMA 2A6LA 2HS6A 1J0KA 3HOJA 3CUJA 2Q71A 1ZPTA 1CTNA 4RE4A 5ABEA 4BEUA 4O18A 4LAUA 1TV3A 5HR7A 5LA1A 3WQCA 1JYVA 4U28A 4YMZA 1BKSA 4BQ4A 3HM7A 4HOZA 4MNMA 5JVLA 3VNZA 1OFEA 4GQQA 1EOMA 2VEFA 1LQAA 5TBOA 1EUNA 4QSHA 3GH5A 4YPJA 4DXVA 1L9WA 4TU1A 3P81A 3BSHA 1JPDX 3CB8A 3CV2A 2Y8UA 2FJUB 2QF7A 1JQVA 2OXNA 4XIAA 1UD8A 3QHOA 4HHLA 1P1MA 1RCOB 1UW9A 2B4GA 1KB3A 1MDRA 4KF1A 4ZO7A 4Q8OA 3BC9A 1XIBA 1UR4A 2DDXA 2ISWA 2OPJA 1W54A 2Z28A 4NKCA 4LX4A 3NIYA 3BL3A 3CL8A 2V68A 2Y24A 3DBPA 3JUGA 4CN6A 3WLNA 1IGWA 2NSXA 1G01A 2BDQA 1ZTVA 1X8FA 1US0A 3MJMA 1ZS2A 1FWWA 5CSSA 1AH3A 1PX3A 3NEHA 5DCBA 2VUNA 5FSDC 3KVJA 5CJMA 5BU9A 4LFYA 3W27A 1PV8A 3OVRA 4I9JA 4LS0A 4IIGA 1JCTA 3PJWA 2Y63A 3B06A 2PUZA 1YXCA 3DHPA 4E8DA 1KFCA 3LMZA 3HPFA 3AMCA 2R1LA 1AD4A 3QQWA 1O5KA 3DFSA 5DY3A 3TCSA 1C29A 4H7CA 3BSGA 3G1FA 4O10A 1IZJA 1LLOA 3WH5A 2EGZA 3PANA 3U5UA 4F66A 4J5NA 3H22A 3EDFA 4D6IA 3EWUA 1FOBA 3GDMA 2W92A 1ME8A 1MZHA 3QLDA 3GAKA 5U7SA 3G3MA 4Q8WA 1YEYA 5DF0A 1JD7A 4LXFA 1RAKA 3Q4DA 4EVZA 1ISVA 1SO5A 3TTYA 3H70A 4BK9A 3HA1A 4KKXA 3U7VA 2CXGA 2ACSA 2WC4A 4XKMA 3SADA 1MQQA 1DV7A 3UNDA 4Q4PA 1H61A 4U33A 5D37A 3HG3A 2YDRA 4PL2A 2GDQA 3OYZA 4UFHA 5GJMA 3CO4A 5BW6A 2V3FA 1AW2A 3W6MA 2CC0A 3BW4A 3RHGA 2QVNA 2BB0A 3AS2A 1KR0A 2RJHA 3LHWA 4ZCWA 4HA3A 2ZUSA 4ZSTA 2Z2UA 3CV7A 3CZJA 1IYXA 1VQTA 4CNOA 4C60A 3HGSA 4H2CA 4KQNA 1VEPA 2D20A 1I1WA 3W72A 2EPNA 2NQHA 3KWSA 1CEOA 3BJSA 1UQZA 4NUWA 1S1PA 3W74A 1C91A 3M64A 1LQ0A 2YFNA 6REQA 2OU4A 3CB3A 3UWUA 3IJ6A 3CWNA 2EAWA 1XLJA 4BQ3A 1R3TA 3S5YA 4ZO6A 3LUTA 2PEVA 2OZ3A 4YLWA 2WMJA 4PYSA 2O56A 3VD5A 3TTEA 4I9AA 1P0NA 2NUXA 3GFXA 2YOCA 2FVMA 2D69A 2FPTA 5I5RA 1UKOA 1LQ2A 3N04A 1B3ZA 5HJXA 2WVUA 2AKMA 1KFWA 1B31A 2VEGA 2DORA 3FHQA 1IR1A 3DU0A 3N34A 2ZA2A 3H6OA 4ZSUA 3OOQA 1B1YA 1FUYA 1LP6A 4M51A 3CUIA 1XL9A 1XYMA 2F6XA 3NYZA 3TJ4A 3QTPA 3NPVA 4C6FA 1UIOA 1W0MA 5EFDA 3VIGA 4JTQA 3WBYA 4PFMA 1NF0A 3WLTA 4D8AA 3W1RA 4UQEA 2HMCA 2CKSA 1RBOB 1KR1A 3GU9A 1HKMA 1UPPA 2ADAA 2Z0IA 3CL6A 1F3EA 3QOKA 4Y9OA 3ALFA 3MQTA 1V3LA 4PBFA 2FFCA 3DFNA 3M0JA 4GBUA 4K6AA 2YW3A 5I09A 4GWEA 4PSRA 4X22A 4B3LA 3W29A 3RM8A 3OA5A 2W3ZA 3UWVA 5AECA 4S3GA 4ZEPA 1W3JA 1XBYA 4AH7A 4ADUA 2W62A 1JG9A 3P0XA 1LOLA 3AS0A 4Q4QA 4M1BA 3EWYA 1PSCA 1H1YA 1RJRA 3DHUA 4H19A 2RGLA 4XUGA 2YL9A 4K3ZA 3I7QA 3GIYA 4XAGA 2QZRA 3P8JA 2XIOA 2XM2A 4PCNA 3DCPA 2R91A 3B8UA 3REQB 2ZXBA 3TTQA 4MWAD 2YSWA 5FKYA 3MTWA 4PMRA 4JN8A 3VAVA 1RY0A 1XDMA 5CPNA 3NGJA 4XVEA 2BVWA 1CXHA 3F2CA 3LPOA 4D6FA 4JYFA 5LNVA 2TMDA 3OBAA 3K30A 4GABA 2HBXA 1XLMA 3D0CA 2ISSA 4EP8C 2G3IA 1PKNA 3OHIA 3R1ZA 4RZBA 2VELA 3S1UA 2GQ3A 5EMMA 3GG0A 2CBJA 3RK8A 3AI0A 2WHMA 1OIFA 3GKFA 1OF6A 1KCXA 1QASA 5FJJA 3HIJA 2GK1B 3RAOA 2VX7A 2FDSA 3M0IA 1XR2A 1JCYA 1R3QA 4OBTA 2HEJA 2YA0A 1BEUA 2BVTA 4MMWA 4MFDA 2NVCA 4AW7A 1GQNA 3KP0A 2J4GA 5I77A 4AXNA 1OCQA 5EY5A 4QLLA 3ZT5A 4MDPA 4MJZA 3EYPA 1LL6A 1A50A 1QPNA 2PODA 4H9YA 1K77A 2V5LA 4P61A 2PTDA 3VD9A 5HINA 1XH1A 4O4VA 2Z7GA 2GSEA 4ZQNA 5A3HA 4C1NA 5EMJA 5CZ0A 3COTA 2H8ZA 5K4ZA 1CGVA 3W7MA 2EXOA 1HJVA 2CKRA 1M9HA 1V77A 4JTEA 1QNOA 1VS1A 2A3EA 3PBVA 1VBGA 1V0NA 5DFAA 3DH7A 1V6TA 2WSKA 3GNOA 1UR3M 4ACZB 1PZ2A 1Q6EA 2Y0FA 3GHSA 4RLIA 4OIFA 2D2GA 1C3FA 1IXOA 4L9XA 4GZEA 2Z1BA 3L7RA 4RDVA 4XG1A 3JZEA 4Y8FA 1QHOA 1OYAA 3T9PA 1O94A 4HMCA 3CUHA 1O5RA 2YBTA 4M6QA 1FWDC 1ZAJA 3EA1A 1TJRA 1UC4A 4HNLA 5CG7A 2J8TA 4LUSB 3C8FA 1E55A 1JZ2A 5U4NA 1XYZA 1N82A 3W7IA 2HV5A 1EX1A 2I14A 2O9RA 3H2NA 3C0SA 4Z2HA 4FF5A 1SO4A 4NNCA 3ZVHB 2EF9A 1RPKA 3QR3A 4LRTA 3LA4A 2CITA 1S5TA 4AX7A 1NU5A 4XO6A 4NZ5A 4CEUC 3NSNA 2JQXA 3LMYA 1K6WA 2OT1A 1PZ3A 2FVKA 2G0WA 1GYMA 4ICCX 3RMEA 2OQHA 3BJFA 3M46A 2IS7A 3B8IA 1DEDA 1VYPX 1EPXA 3S6TA 3CQIA 1GW1A 2XZ9A 1GOIA 3IAPA 5AHIA 4NAFB 1MFVA 1WXZA 4GQ0A 2PDXA 1FXQA 1IZKA 6TIMA 2Q09A 3L5MA 2Z1VA 2DZBA 1QNVA 4M5PA 3SUSA 1R2TA 3LI1A 3P82A 2ZC8A 2QJGA 4WZHA 1JCLA 5JMUA 3N73A 3WDJA 4NJHA 1PZ0A 2VEPA 2VR5A 4Z1BA 3T2QA 1G5AA 1KBJA 3ZOAA 4V15A 1ZP4A 4AIEA 2OTDA 1E4IA 3UG3A 3ITYA 3NQDA 2OX4A 1L2QA 4HOWA 1QU4A 5H91A 4MKSA 3RF9A 3PWIA 4FNUA 3SRDA 4NL1A 3SRKA 5F4SA 3CEPA 1CB2A 3C5QA 3P5ZA 1XRSA 1XRTA 6ENLA 3ATZA 3L2LA 5I6SA 1UR2A 1KLYA 1G0CA 3KOFA 4G6CA 1H5VA 2AQVA 1NQ6A 4DI9A 4GX8A 3H4WA 1UWAA 1OIMA 4HN8A 1H2JA 1KCKA 2Y2WA 1P7TA 3LXAA 4MLRA 5E6ZA 3QPZA 4DBEA 4R7OA 2XU2A 5EU9A 1TB3A 2FZDA 4O12A 4DHGA 4O8AA 5KSWA 4LEQA 4AD5A 4MNKA 5AOUA 3T2OA 4WHBA 4DJEA 2WKLA 1IEXA 1K1DA 2J7DA 4CUCA 3AROA 2GVGA 2D0FA 3G1HA 5HUPA 4XZIA 4KW2A 5DQPA 2YYTA 1BHGA 3KOZA 2VM8A 4GVHA 3AIUA 4J28A 5LIYX 1SSDA 4MLJA 2OWXA 3QR0A 3B03A 4FLOA 5EMLA 4YXGA 1A4MA 4WX2A 3VABA 3TYBA 3N19B 2G3FA 3B0XA 3EWCA 3VDBA 2NXIA 3UJEA 2QULA 3NGFA 1JCMP 2NX9A 2IPJA 1C7TA 4GY7A 2QCHA 3Q94A 4PEKA 5D2XA 3SFWA 1YNYA 3LG3A 3QM3A 2IKHA 1DWIM 3RLVA 3EX4A 3WBXA 2CHOA 4BCEA 2NQZA 1V6XA 1VBRA 3MSGA 3BMXA 3W01A 2ZWYA 1R7OA 3BOLA 4PUNA 1BXNA 1M7OA 2QCEA 4FS9A 2CBVA 4IH3A 4E5TA 3CQHA 4IMAA 2V0TA 1GYLA 4GJIA 4WUIA 1J5TA 3GM8A 5FF4A 2BY3A 3CTLA 4HJFA 5DY2A 1JL8A 2FZMA 1JCJA 4S2BA 5ENLA 4R7WA 3UT0A 1HGWA 2BOFX 4M24A 4JDYA 3WDPP 2PWUA 4OUIA 2PDKA 3K4AA 1V6VA 1JPMA 1TKKA 4RR4A 4MAVA 3EOUA 2HROA 1YDNA 2ZOXA 3GK0A 3ZSTA 3SGUA 1JVNA 7REQB 2X41A 3IJ7A 1WZAA 2VFIA 3VGGA 1PS9A 3FIGA 3K4DA 5HMFA 3ORWA 3K1DA 1P0EA 1TVNA 5K9XA