4IISA

Crystal structure of a glycosylated beta-1,3-glucanase (hev b 2), an allergen from hevea brasiliensis (space group p41)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
316
structure length
316
Chain Sequence
EVGVCYGMQGNNLPPVSEVIALYKKSNITRMRIYDPNQAVLEALRGSNIELILGVPNSDLQSLTNPSNAKSWVQKNVRGFWSSVRFRYIAVGNEISPVNRGTAWLAQFVLPAMRNIHDAIRSAGLQDQIKVSTAIDLTLVGNSYPPSAGAFRDDVRSYLNPIIRFLSSIRSPLLANIYPYFTYAGNPRDISLPYALFTSPSVVVWDGQRGYKNLFDATLDALYSALERASGGSLEVVVSESGWPSAGAFAATFDNGRTYLSNLIQHVKRGTPKRPKRAIETYLFAMFDENKKQPEVEKHFGLFFPNKWQKYNLNFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-1,3-glucanase form 'RRII Gln 2'
publication title Structural analysis of the endogenous glycoallergen Hev b 2 (endo-beta-1,3-glucanase) from Hevea brasiliensis and its recognition by human basophils.
pubmed doi rcsb
molecule tags Hydrolase
total genus 103
structure length 316
sequence length 316
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.39: Glucan endo-1,3-beta-D-glucosidase.
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00332 Glyco_hydro_17 Glycosyl hydrolases family 17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4iisA00
3UR8A 3VIOA 1ZBCA 1G9HA 3OGVA 4HOXA 3M6DA 3VM5A 4CVUA 1X1NA 3ARWA 1E0XA 3OZOA 1VB9A 2D3NA 5GNYA 5FD0A 1EGZA 4Z2IA 4MNKA 1WZMA 2WBGA 2YKKA 1DWHM 3AFBA 2D2OA 2CIPA 3AHYA 1GOQA 4KWUA 4LQ1A 1EOKA 2WBKA 4S3JA 5DEZA 4MAZA 3BLPX 1PX4A 1UR2A 4B9ZA 1J01A 1TA3A 1JZ2A 1WNOA 4KH2A 3A4XA 2Y2WA 1R85A 2BS9A 4D6GA 1UKTA 3AIWA 1M04A 3UETA 4W85A 5F7UA 4AMCA 1RP9A 3W38A 1ISXA 2VCAA 1E6NA 4BQ3A 2GUYA 2PWFA 2ZUUA 1W32A 2XVGA 2JF6A 2A3EA 4P8WA 1ZS2A 2F2HA 3ARZA 2W4XA 4PSRA 2WM0A 3MU7A 1SMAA 3ZM8A 1C3FA 1CGXA 3NSNA 5A2CA 5CGTA 4MJ2A 2VR4A 4W93A 4TX6A 1QNQA 3SUTA 2VI0A 3VIMA 3AYSA 4X0VA 1PX8A 3O2LA 2ZOXA 1H11A 2WLYA 4H2CA 1BPLB 3W0KA 1C91A 1HKJA 2OWXA 2G4FA 3EDFA 2QLYA 4LXFA 1JNDA 4QAWA 4F66A 4W84A 2VX6A 1ZBWA 4M24A 3CH9A 4UR9A 2WVTA 3AXIA 1CXHA 3T2OA 2DSVA 2XVPA 4R27A 2XM2A 1XRVA 4V28A 3BAWA 5FOOA 3VTRA 1NH6A 3GXFA 2ZX7A 3DHPA 1E0VA 3ARYA 1JI1A 2CBVA 1QI3A 2W62A 2OYLA 2WZEA 1UH2A 2IXVA 4CU6A 2AAAA 2BFGA 3WUBA 4QLLA 2WMFA 1TVPA 4W7VA 4OBSA 1JYXA 1WP6A 3RCNA 5C71A 1W3JA 1C93A 3QOMA 2Q8XA 1TCMA 2QPSA 1US2A 5KEZA 1DWGM 1DWJM 1Y7VA 2JIEA 3TTYA 5IHRA 5GQBA 2YJQA 4GZJA 1JF6A 4FK9A 3AISA 1NP2A 4W8LA 1J0KA 5ABFA 1JI2A 1QHOA 1IZJA 4LPCA 1B1YA 2XYLA 1LL6A 4TVCA 4L4PA 2YOCA 3BXWA 2OSXA 5M3WA 2BV9A 1TZ7A 3RM8A 4MB5A 2WKLA 3CZGA 4AZ7A 5JIWA 4S3KA 2VX7A 5D9OA 1KFWA 2XVLA 4BQ5A 1FH9A 2BY3A 3DYMA 4GZIA 2EEXA 2V5DA 4C7GA 1UH3A 2BXYA 5BROA 1JD7A 1FH7A 5E6ZA 4F8XA 2VJXA 2J25A 2WW5A 1HNYA 1H0GA 3NSMA 4CD8A 1KQYA 2BVTA 2OSYA 4ZE5A 1GQLA 4NRSA 3IAPA 3GZAA 3VOCA 3VKKA 3WF1A 3WD3A 2DH3A 4WKAA 3CZLA 1JF5A 1W1VA 1FHLA 2WSPA 3OA5A 3WF3A 1EQPA 1CZ1A 3PN8A 4AD2A 1XCWA 3KWXA 3PZIA 4AZGA 1R7AA 1M7XA 2Y24A 1GPFA 1VFUA 4E4PA 1CGVA 4BF7A 1NWUA 2ZUMA 4AZCB 2CESA 1VEMA 2VMFA 3GDBA 3CUIA 4AC1X 5AC5A 2YL5A 3SCQA 1E4MM 4PMDA 5E0CA 5EB8A 3ZT7A 5A95A 2XIIA 1JZ4A 1ISYA 3K46A 1LWHA 2BXZA 3ALGA 3CPUA 2XFRA 3VIGA 2EO7A 4NZCA 2BY1A 2CBIA 3AIBA 2CETA 2G3JA 5AC4A 5A69A 4CD7A 3MUAA 1UA7A 5A8QA 3VNYA 3BAIA 1KXQA 4D71A 4A3HA 1FOBA 4AIOA 2CBJA 2WC4A 4TVDA 4LYPA 2Y5EA 1E1EA 4W87A 3ZQ9A 3WF2A 3N11A 4A3YA 2O92A 1C90A 1DWFM 2A3AA 3I3BA 2CPUA 2HVMA 2WWDA 2ZXBA 3VM7A 2FHCA 1EDQA 2D0HA 4J3UA 2WB5A 1KXVA 4JFSA 2YL8A 4AZCA 2VZSA 3LPGA 1PBGA 1BTCA 3SCSA 1CDGA 1L0PA 1UD2A 3VNZA 3AIRA 1V0KA 4CCCA 3ZO9A 3W28A 4MADA 1OD0A 4U3CA 2YBUA 5FIPA 2WYSA 2PWDA 1EIBA 3WQ4A 3WD2A 4CVWA 4UQCA 3AHXA 1CIUA 1ZU8A 1M53A 6CGTA 3T0AA 3WF0A 3W82A 1VJZA 1L8NA 5JUVA 5D9NA 2Z1SA 2Y4SA 1E4NA 4J3TA 1VEOA 1GQIA 2Z1KA 1QW8A 4H41A 4M56A 1BHGA 5A3HA 4ZXOA 3RILA 3RJYA 3F5LA 4B16A 3AYRA 3N9KA 5D8ZA 1TG7A 1V08A 1Z32X 2BNJA 2VZVA 1OGGA 3SURA 1ZL1A 3POCA 4BQ2A 1ODZA 1VF8A 1WZAA 2DSUA 1VBRA 4A4AA 4HPHA 3VX1A 4FLOA 2VRQA 4J3SA 3CZ8A 3AS1A 1JG9A 3CZKA 2DQXA 1WCGA 4D6EA 5HBFA 1MFVA 2GJRA 2YA1A 4HMCA 1W2PA 1H3GA 5D4YA 3S2CA 3SUVA 2IUZA 3AZSA 3WH5A 5BCAA 3WY1A 3N04A 3EBVA 1VFOA 2GJXB 1V03A 4GQRA 2VRJA 4KGJA 1GNXA 4NSBA 1Q6DA 4C7FA 6TAAA 4J3WA 3MV01 4HTYA 1E40A 3GNOA 5A6BA 3T09A 3W6MA 4FMVA 2VRKA 1HKMA 1CXEA 1MW3A 4N0RA 4TVUA 1E5NA 3UG4A 2O9PA 4UQEA 1Q6GA 3WEMA 4MB4A 1UUQA 2VZUA 3ARRA 4K68A 5ECUA 3WEOA 1WPCA 1O6IA 4UCFA 4GI9A 3MO4A 2NW0A 1U30A 3OB8A 5EMYA 4BS0A 2EJ1A 1NQ6A 2VQUA 4OZOA 3RM4A 3SIMA 3AJ7A 5M03A 1ZBKA 2WCGA 4ZENA 4JCMA 1JDDA 2YLAA 4RE3A 3UG5A 3A47A 1V6XA 3AMLA 1XC6A 2D20A 2XIBA 4ZXLA 3A4WA 5I0DA 3VIKA 3VD3A 1VENA 4Z2LA 2F8QA 1U2YA 1CTNA 3MMWA 3VGHA 3AZTA 5C70A 1KB3A 1EA9C 4GQQA 5CPSA 4AZIA 4P8XA 2GJPA 4W5UA 2WC7A 1JZ7A 3M46A 3VIIA 5HPCA 1V3IA 1JAKA 4W88A 5JIPA 3U5YA 1Q4NX 3WL1A 4JZ5A 1KWGA 1J9YA 2YL9A 1KBKA 1OCQA 3BMWA 1GOKA 3OIHA 2CNCA 3WFZA 1P6WA 1X6LA 2VO5A 2OYMA 1W1YA 4CGTA 2E8ZA 2G3IA 2D0GA 3EDDA 5I3DA 2ZE0A 4ZFMA 3FHQA 4E2OA 1BF2A 5CZKA 1EQCA 4P7OA 3PZNA 3WH7A 3CBWA 1GW1A 1HJVA 1GVYA 1QNOA 5A8PA 1CGWA 4ZEPA 2X0HA 2GVYA 3KL5A 3MV11 5E09A 1CWYA 2CERA 2YL6A 2G41A 3MUZ1 5A2BA 3UG3A 4HZ7A 5LA2A 5A6LA 3KE0A 1EO7A 2D1ZA 5A2AA 1JXJA 4WKHA 3OGSA 4CU8A 3UCQA 4XV0A 1XH2A 4YPJA 1ITXA 3AXHA 3PZVA 3WDQA 3MMDA 4J27A 2WMGA 1TA3B 4AEEA 1JYVA 1H49A 1GONA 4U2ZA 4OUEA 5JBEA 2VUYA 1G01A 2V38A 5AYIA 2DT0A 2ZIDA 4HZ8A 1TUXA 3N13A 2QHAA 3WDIA 2PBOA 2VCCA 3WENA 1OB0A 3GBEA 1D2KA 1QW9A 3WFLA 3TONA 5A6JA 4UZUA 4PTXA 4J7RA 4R5EA 3S6TA 3L2MA 1YHTA 2JE8A 1PZ2A 3AICA 3ZJ6A 3WF4A 5I2UA 1OSEA 1PZ3A 1WZLA 4EANA 1JD9A 4JFUA 1EOMA 1MQPA 1H4PA 1EDTA 5CPTA 1QPKA 5E70A 4P7NA 3T0DA 3RPMA 1K9FA 4M1RA 2B31A 3CUGA 2GK1B 3VVGA 2D3LA 2E9LA 8A3HA 3M7SA 3A6OA 1W9XA 1CNVA 2TAAA 1V3MA 3O6AA 5CQ1A 3PZUA 4JKMA 4PYSA 1GQJA 1H5VA 1BYBA 1QOXA 1GOMA 2XGIA 3VINA 1OINA 2E40A 2PF0A 4D6DA 4MDPA 2VVSA 4QLJA 3AIQA 3AS0A 2XGBA 5BYWA 1VIWA 1JYWA 1C92A 1QHZA 4XX6A 3W37A 4IPNB 4W8BA 1OD8A 1Q6FA 2UY2A 1VJSA 1LWJA 4W86A 2V5CA 4MNMA 5A6KA 4H8VA 2C8NA 2CHOA 2W66A 1WKYA 2EPNA 5IDIA 3CUFA 4UOJA 2JFEX 3ZR5A 4WIWA 1AQHA 2J7HA 2GK1A 1UR8A 1HL8A 1PAMA 1NP0A 3VGGA 4U3AA 1E4LA 3LPFA 3RMEA 4CN1A 5ABFB 1H41A 3ZMRA 4ATWA 1R86A 2VL4A 1V0LA 1J0ZA 1GUVA 2J47A 2YLLA 3ZSSA 1ISVA 1BFNA 3MMUA 2WANA 3WN6A 4ZE4A 3E1F1 1O7AA 1E56A 1VBUA 5AY7A 4HZ6A 1NOFA 1ISZA 2A3CA 3WD4A 1WE5A 2AMGA 1C7TA 1UD4A 5A6SA 2J7FA 1WB0A 1TMQA 3T08A 2NSXA 1PIGA 1LL7A 3M07A 4F9JA 1HVXA 4UZSA 1UWRA 1WAWA 3L4WA 4IPLA 3F5KA 1HIZA 4J28A 4GKLA 1JAEA 2PWHA 4NI3A 3OLGA 1LF1A 4U5KA 7TAAA 4B3LA 3WUFA 5DT5A 2PC8A 1B3WA 3ARTA 2J77A 2CYGA 2X8RA 3A3HA 1CENA 1DHKA 1UWSA 1H09A 4L4OA 4MB3A 1E72M 1E6RA 2V3FA 1TR1A 5A6BD 2NT0A 1LL4A 3NDYA 1JXKA 4JHOA 3QOKA 5BXPA 2ZXQA 1OWQA 2CCRA 3J7HA 2DEPA 5CXPA 1JL8A 4GO9A 5BXTA 1UD8A 1J0HA 4IUGA 1UR1A 5LA0A 3W24A 1JYNA 1CLXA 9CGTA 2DSZA 3T0BA 3SCUA 2EPLX 3ARQA 3F4VA 1YQ2A 3VILA 4TXEA 1R8LA 4UFMA 4H04A 3AIUA 1HKIA 3UESA 1TE1A 3VGEA 3IK2A 2NT1A 2G3NA 4OBRA 3OBAA 4AXNA 4LYRA 4OOZA 4KMQA 3ALFA 4PCSA 4WSKA 4LYQA 5CLTA 4WK9A 2QMKA 4CD4A 4V27A 1E6ZA 4PMZA 4UFIA 2E3ZA 1ZJBA 1CEOA 1UG6A 1UWIA 1XV8A 1E70M 1NOWA 1NWSA 1HJUA 3K4AA 1MFUA 4M29A 4CN4A 3GH4A 1W3LA 4B15A 1I1XA 1BYCA 1OGBA 3KL3A 1MW0A 2YDRA 4UQDA 3II1A 4ML4A 2FHBA 2FGZA 5IFPA 1KGUA 4PTMA 4E8DA 5HDRA 1WDRA 2VX4A 1BLIA 3VD9A 2HISA 5A6AA 3W81A 4P7QA 4AZHA 1H0IA 1MXGA 3HMCA 1AQ0A 3AIVA 1AMYA 1NOUA 1PJ9A 3NYDA 4QP0A 4HOWA 2XVKA 2ZUVA 3TP4A 4AISA 1D3CA 1KR1A 5I6SA 1BAGA 1ZBVA 3ZJ8A 2J8FA 4D6IA 2J78A 2BHZA 1JZ8A 3GM8A 3ZIZA 1MVYA 3B9DA 1CPUA 4J3VA 3WNOA 2XWDA 3BLKA 3WBAA 1JFHA 4F79A 2JEQA 2A3HA 1BQCA 2GDUA 2VCBA 1E6XM 4GINA 4DWSA 3VPLA 4M81A 3VMNA 3WEZA 5FKYA 2VC9A 2DPEA 3WQ5A 2ZXDA 2XHYA 3CZEA 4XZBA 3OG2A 1WO2A 5IHSA 3CZJA 1F4HA 3WIJA 1KCLA 5DFAA 3EDEA 1V6WA 3GTNA 4JL1A 4MNLA 1E6QM 3AS3A 5I77A 1W1TA 4JKLA 4PMRA 3W29A 1C8XA 4JKKA 3GBDA 1UA3A 3WQ8A 1LJYA 5D9MA 1HVQA 2J7GA 3RM9A 3WNLA 3FXYA 3WH6A 3VD7A 3ARSA 3W26A 1W9DM 7A3HA 4N42A 2OWWA 3WDRA 2QPUA 3WBEA 1BVZA 5I23A 2X2YA 2ZX5A 1NM9A 4PTVA 2VTFA 3SCTA 3VIFA 2OYKA 4PMOA 2BY0A 4MTVA 4AZBA 1DTUA 4EAMA 1G5AA 4AD5A 1RP8A 3MUIA 3EYPA 1HJSA 3QGVA 1OT1A 1FFQA 1XD0A 1SMDA 2QMJA 1EH9A 4PEEA 2EBNA 3T2PA 4CN6A 4HPGA 1E73M 3L2LA 4LGXA 3EMQA 2WMIB 4PMVA 5ABGA 1KGWA 1AQMA 1B31A 2Y8VA 2DT1A 4TTUA 3G6LA 2XFYA 4HMEA 3SCRA 3K1DA 3W4RA 5C8BB 1QBAA 1CGYA 2WK2A 3WNKA 4CCEA 3GXMA 3PTQA 3W27A 2WMKA 5JBFA 2D22A 4Q7NA 2WVVB 2FDMA 3N12A 3AHTA 5M5DA 2FGLA 2W91A 3NCOA 5E0FA 2DGAA 1FP8A 2XPKA 4P7LA 5ABEA 4QCEA 3WSUA 1ZB5A 1B3YA 2DIJA 3ZOAA 3VU2A 4HP5A 1C8YA 1UR9A 5HNNA 1E0WA 4GIAA 4PUEA 3CGTA 4WLCA 1HJQA 3WQVA 4DWSC 4Q22A 2ESCA 1E5JA 3OLIA 1R7OA 1DWIM 4CUCA 2CITA 3CUJA 1E71M 3AROA 3WNNA 2WMIA 4RE2A 2XSBA 4AIUA 3MUY1 1QI2A 2EXOA 1W1PA 3BCDA 1GHSA 3U5UA 2WVUA 5LYRA 3PZGA 4TOQA 3B8SA 3EDKA 3K4DA 2OSWA 4WF7A 1Q6CA 3PZ9A 1JDCA 4BQ4A 4HA4A 1PPIA 1S46A 2WXDM 3PBGA 2WVVA 3ZT6A 1CYGA 2JF7A 3OLEA 3WQWA 3ZT5A 2DSWA 3B9EA 3W53A 1VEPA 3FAXA 1VFFA 2WPGA 4MAVA 1DWAM 4HU8A 3TTQA 4FLQA 1J10A 3DYPA 1B3VA 2PI6A 4HA3A 3ECQA 4GXPA 3CMJA 1J0IA 1FA2A 1PEZA 2G8ZA 2Y8KA 2WNWA 4D1JA 2UY3A 1U33A 3ZJ7A 2ZICA 3VO0A 3NUKA 4TUFA 3G6MA 1ITCA 3MKKA 4B9YA 4XZWA 2BY2A 3BCFA 1ZJAA 3WMSA 3L4ZA 4U33A 2AOSA 1HJXA 2G3MA 1E43A 3SCOA 1MW2A 3T2QA 1AVAA 1BYAA 3RDKA 3BAKA 1E6PA 1KQZA 5GPRA 2X09A 2WCAA 3AMCA 2VT0A 1V3LA 4EKJA 3DC0A 1UKQA 1B3ZA 1CGTA 1XSJA 3PTKA 2RGLA 1HX0A 2WZIA 1JNEA 1V0MA 3JUGA 2J74A 5A8OA 3VDAA 1LG1A 4AWEA 3CHEA 1VAHA 4JHZA 1BYDA 5LA1A 2V3GA 5BRQA 2J7DA 5BRPA 1E15A 1SFSA 3WMCA 1E3ZA 1W2VA 3AS2A 5M17A 1OBAA 2WWCA 5I24A 5BWFA 4M80A 4DUXA 5I78A 1FH8A 1BGGA 3NDZA 4AD3A 2ZX9A 4FLRA 1J0JA 3DHUA 3WMBA 3L4UA 1MQRA 4KGLA 1WDPA 2JALA 1GORA 3MSDA 4W8AA 1FHDA 4UQBA 1CXIA 2WC3A 4IISA 2X1IA 1K9EA 4H8HA 4AZ6A 1EXPA 3FNDA 4FLSA 2YIHA 1FFRA 1C8QA 1OIMA 4Y7EA 3NIYA 3ARVA 1A47A 3RO8A 3VIHA 3QR3A 5D9PA 1E3XA 1VRXA 1JZ5A 4UFJA 1W9UA 3VUPA 2D0FA 4PCTA 1HXJA 1MWOA 3OZPA 3QHMA 5DT7A 3SUSA 2WHKA 4P7RA 3FN9A 3CIVA 1RPKA 2CXGA 2GSJA 1JDAA 4P8VA 1R87A 3F5JA 4KRUA 1M03A 4AD0A 2UY5A 5CPQA 3BH4A 4MDOA 1IT0A 4XUYA 1I75A 3AIEA 4RE4A 1RD6A 2JEPA 1J11A 3VDHA 1UQZA 4DWSD 1PX3A 4D6CA 1UKSA 5CG0A 2O9TA 2VR5A 3GXIA 4UQ9A 5EBAA 4PMNA 4Z2HA 4AZ5A 4JIEA 1E9LA 5A8MA 5GNXA 2W67A 3APGA 4U2YA 4JFWA 3ARPA 2ZX6A 1ESWA 3TOPA 1V6UA 4NRRA 4MJ4A 3KEHA 1PIFA 2E4TA 4D6FA 3VD4A 3HJEA 5IFTA 3LPPA 1HF6A 1QI5A 1N82A 4XB3A 2XG9A 1XH0A 4QFUA 5ABHA 1EHAA 1XYZA 2WHMA 3CHDA 1QHPA 3K8KA 1V3HA 1B90A 4HMDA 2X0YA 1GJUA 2XWEA 2BHYA 5FL1A 1CXKA 4PUDA 5DF0A 4JFVA 3AQUA 3N17A 1GHRA 4P8UA 5FL0A 1V02A 4CU7A 3AOFA 3VMPA 4LX4A 3PZTA 2VX5A 4ATLA 3PTMA 3VDCA 3KZSA 4PMUA 2ZUWA 3VMOA 1UQYA 3AXXA 4M82A 3FY1A 4J3XA 3TTOA 4UOZA 3I3EA 3VIJA 1HT6A 3L4TA 1ISWA 1BGAA 1XGZA 2J75A 1JFXA 1V3KA 3WDPP 1W9BM 1B3XA 1I1WA 2XM1A 4DUWA 2F61A 1JZ3A 4UFKA 5CLWA 1G94A 3WNPA 2WLZA 2ZUSA 1X6NA 4H8UA 4AYSA 5CGMA 1B9ZA 2WCSA 2XTKA 1CXFA 4EE9A 4HU0A 4BA0A 1UD6A 2EPMX 2RGMA 3SUWA 5HOSA 1UD3A 4JFTA 2E8YA 2XJ7A 1J0YA 4Z2KA 4GI6A 5CSYA 3CMGA 1UR4A 1LLOA 2J4GA 2WHLA 2O9RA 2DT2A 1B2YA 2J79A 1OT2A 1E55A 2J8GA 2J7CA 4OKDA 1KCKA 2MANA 1C7SA 1EO5A 1G1YA 4W5ZA 4UNIA 4CD5A 1UZ4A 2VNCA 4D6JA 5DMYA 3U7VA 1IZKA 2OWCA 1J12A 1UH4A 1B0IA 3WDHA 3K8LA 2QF8A 2YDQA 4H7VA 5A8NA 2YA2A 2CKSA 1V6YA 1FP9A 4AW7A 2UWFA 1LG2A 2DIEA 4YN5A 4UFLA 4PBGA 2WHJA 1UYQA 3D5HA 3LMYA 1BVNP 3EMCA 5CSUA 4DWSB 4UQAA 4X0NA 1NARA 2WKGA 5GNZA 4PMQA 2J7BA 1WZKA 4AY1A 3TTSA 3RJXA 1H2JA 1UOKA 4WSJA 3BGAA 1KBBA 1G0CA 3IAQA 1RH9A 2DSKA 3BAYA 5TD4A 8CGTA 1NWRA 3SUUA 5HPOA 3ZSTA 2ZXAA 4JCLA 1MW1A 1KGXA 1HP5A 1OGSA 4QDMA 2BHUA 3N18A 1F4AA 3AHZA 3PHAA 4CKQA 4WJXA 3TA9A 3CLWA 5IXEA 4PTWA 3WNMA 3THCA 1K9DA 2ZX8A 4GZEA 3VX0A 1XYFA 2WZHA 1W9PA 2FH6A 4IM4A 4ACZB 3WELA 1QVBA 1HJWA 3WDJA 4D72A 2VVNA 3ARXA 3HU7A 4QLKA 5E6YA 3IANA 3POHA 4V2XA 1UWUA 5I5RA 4GO8A 4MPKA 3WH8A 3O9NA 4F9DA 2OLHA 3ZR6A 2ZWYA 2DDXA 1XHGA 1SR0A 2J62A 4KRTA 3B9AA 3GXDA 4GI8A 3CUHA 4OOUA 2GFTA 1LQ0A 3ZJKA 4PRWA 1SYTA 1QNRA 1E6SM 5A94A 2C0HA 3FW6A 2WMHA 4URIA 2DT3A 2V3EA 1EDGA 4Z2GA 3UEQA 1B30A 4FF5A 3AHVA 2FH8A 3W25A 4U31A 1W3KA 2XSAA 4WKFA 5A1AA 5AYBA 1K6AA 3AI0A 2PWEA 2GDVA 3L4YA 1XSIA 5BXRA 2EQDA 3KL0A 1CBGA 1TVNA 1OIFA 1K9TA 4YHEA 3VGBA 4ACZA 3WD1A 1UZ1A 2CEQA 3I3DA 3HN3A 2X05A 2A3BA 3SCPA 4B3KA 4C7DA 3UR7A 1ODUA 3AMDA 3WQ6A 2VZOA 1MXDA 4DM2A 3DYOA 3WUEA 3L4VA 2O9OA 2DH2A 3PZMA 1QNPA 3PZQA 7CGTA 1UKPA 5KZ6A 4UOQA 1XSKA 3EMZA 2YA0A 1UWTA 3CO4A 1IV8A 5EFFA 3GH7A 1V3JA 2YDSA 5DO8A 1D7FA 1GJWA 3VGFA 2VZTA 4DUVA 4PN2A 3SCVA 3GYCA 1M01A 5D8WA 1US3A 3CHFA 3WUGA 3AZRA 1XCXA 1WDSA 3WL0A 4TTGA 1KXHA 1E1FA 2EPKX 1QI0A 3OLDA 2E0PA 3IJ9A 3LPOA 1JIBA 3FAWA 2W63A 1V6VA 1GVIA 5BXSA 2CKRA 3IJ7A 1H1NA 3VDBA 1A3HA 1QI4A 2QV4A 2YBTA 1NWTA 1GQKA 3NSXA 5I79A 4GPNA 3MANA 3VD5A 3OGRA 5FCZA 2PB1A 1HL9A 2WSKA 2FHFA 2ZUNA 4OIFA 3SEPA 4AIEA 1HN1A 4HA1A 4BZYA 1GOIA 4Z2JA 4MB1A 2PBGA 5E9AA 5JBDA 1ECEA 4X9YA 2D23A 4AD1A 4OJYA 2W92A 2BVYA 2VURA 1DP0A 2W61A 2J7EA 3N15A 4PMYA 4RL3A 1GZJA 3PZOA 2E9MA 1KR0A 3AMGA 2VQTA 5HXMA 5EFDA 2GJXA 3EDJA 3FHAA 1KWKA 1W3HA 2IXUA 1MYRA 1TFVA 3CHCA 1MQQA 3BAXA 1UWQA 1GOOA 2E9BA 4EK7A 1W9VA 4E8CA 1VFMA 3IJ8A 4W89A 3U57A 1WDQA 3BSHA 3W6LA 2C7FA 3WKZA 3CTTA 4BCEA 2WAGA 2CBUA 3N1AA 4CD6A 3DECA 1EHNA 1OM0A 4AD4A 4AEFA 1W91A 1HP4A 1J18A 2BVDA 2JIWA 1KXTA 3VGDA 1CECA 2PWGA 4PMXA 2WVSA 3GNPA 3UERA 1BG9A 4CCDA 3GH5A 1CLVA 4NF7A 1CGUA 1V0NA 3NJ3A 5CJ5A 1JZ6A 4QCFA 3SCNA 1Q6EA 2WMJA 4DM1A 3ARUA 3QHOA 2VOTA 1UR0A 3D3AA 4YHGA 1CXLA 4MNJA 3VIPA 4UFHA 4D1IA 1UHVA 1DEDA 4M8UA 3WH9A 3SCWA 1QNSA 1JGIA 4W7UA 2D24A 1BG4A 3BSGA 2V3DA 3THDA 1QBBA 4W7WA 3RIKA 2ZWZA 3WD0A 4ACYA 2XFFA 1UD5A 3BAJA 1E4IA 3A4AA 3U7BA 4UTFA 4JAWA 3BC9A 3MSGA 2W5FA 1UKOA 6A3HA 1GCYA 1XH1A 4PSPA 1V02E 5A6MA 2EPOA 3AMKA 3K8MA 4D6HA 3GNRA 3L4XA 4JL2A 1GOWA 2XVNA 2XUCA 3MS8A 4U5IA 4HOZA 1BSIA 2UY4A 3BMVA 2ZUTA 1XD1A 3QHNA 4ATDA 1HKKA 4TX8A 2CHNA
chains in the Genus database with same CATH superfamily
3UR8A 4LRSA 3VIOA 1D9EA 2OT0A 3LV6A 3R6IA 2VD8A 1E0XA 1YKWA 2EKGA 5HMFA 3GHTA 4DBEA 2BBFA 4Z2IA 4MNKA 4EWND 2YKKA 4RLIA 4JYEA 3AHYA 4KWUA 1IYXA 3KLLA 4S3JA 3NL6A 2VELA 3H21A 1JEZA 5I06A 4KCVA 4Q4KA 2C16A 4KH2A 4RXFA 3IJIA 3ID7A 4H7ZA 1T5AA 4D6GA 1LBMA 4J2PA 3LBOA 3UZJA 1M04A 3UETA 5F7UA 1W6TA 4JIRA 4BQ3A 4JYFA 1TJPA 1W32A 3QTPA 2RDTA 4PSRA 4V1XA 2FFIA 1SMAA 2NQ9A 3ZM8A 2BZNA 2Q09A 5FJRA 4MHBA 4OQVA 2FB3A 4INFA 3W1UA 2EGZA 3L0GA 3H2NA 3AYSA 4KETA 1YX1A 4X0VA 4UTIA 1NTHA 4H2CA 4IJRA 1YTDA 3EOOA 1NY1A 5CZSA 1Q7QA 2G4FA 3EDFA 1JNDA 4F66A 4W84A 4UR9A 4Q8QA 3AXIA 3XINA 3AYTA 4ERIA 2V82A 3TLQA 2DSVA 3NO5A 3TYDA 1GZ1A 2G0WA 2QCHA 4AQLA 1NH6A 3DHPA 4F2UA 4S3CA 3W7RA 3LZ3A 2V2DA 3ARYA 1JI1A 1QI3A 5AB3A 2QCFA 3H4WA 3VKAA 2AAAA 3W75A 2BFGA 4A21A 4IQEA 1TVPA 2R1MA 4OBSA 4C6PA 4WY0B 3QPEA 1L6GA 3RCNA 1C93A 1NVMA 3URBA 3HA1A 1US2A 5KEZA 1Y7VA 3U2EA 4EXQA 3P2VA 1TVLA 4GZJA 1XIFA 1JF6A 1ME7A 3AISA 1VRDA 1J0KA 1TPVA 4LPCA 3KUMA 2XYLA 4RPQA 3C3UA 3RLVA 2YOCA 4J40A 5M3WA 4CQCA 2BV9A 3URQA 5AHEA 3RM8A 4WGXA 3GDLA 5CSRA 1A50A 4S3KA 3WQEA 3GVRA 5J04A 2X1UA 3PBMA 2YFOA 1KFWA 2XVLA 2AAMA 3OVPA 4H6RA 2EEXA 2V5DA 1BTMA 2J66A 1UH3A 4OV9A 3GTHA 4GH1A 1P7TB 1HL2A 3N2BA 2OODA 4GACA 4F8XA 4I3GA 2VJXA 4K2SA 2WW5A 4K8EA 2TPSA 3O0KA 2V6AA 3OIXA 4R7OA 4ZE5A 5FJPA 2MUCA 1HGYA 1NIUA 4JQ1A 2DH3A 3CZLA 1W1VA 2I57A 3NQDA 1XFBA 4IG2A 1QWKA 3OA5A 1EQPA 3HFTA 3S6OA 4S3AA 3PZIA 3GDTA 4Y90A 4AZGA 1M7XA 1OC7A 2E28A 3SY1A 4E4PA 1CGVA 4RDVA 4Z08A 4AC1X 1ICQA 7ODCA 3CJPA 4B5NA 2BXZA 3CPUA 2ZKMX 3VIGA 2BY1A 2CBIA 3AIBA 2CETA 2FZDA 2G3JA 5AC4A 3SQLA 2H6RA 1JDFA 4CD7A 5A8QA 3WLPA 1KXQA 1TV2A 4D71A 2WSQA 1FOBA 1H50A 3UXDA 3N6JA 3AUOA 1OCNA 4W87A 2QCLA 1AZ1A 1OEPA 3W7MA 1DWFM 3I3BA 3PJTA 1L6WA 2CLMA 5AC7A 5EMKA 3VM7A 2FHCA 3BL3A 5FJIA 2PUZA 2PDIA 4C6FA 5C2GA 1EPXA 4HZMA 1CDGA 7PTDA 3BLFA 4CCCA 4GZ7A 1IEWA 2V5KA 2VENA 1XBVA 2QF7A 1OD0A 4JOMA 3M0JA 2OXNA 2WSYA 2C3ZA 1GT8A 4JN8A 4UQCA 1HO1A 1CIUA 1A5OC 3A21A 1L8NA 2Y4SA 4J3TA 1QW8A 4PUMA 4M56A 1BHGA 5A3HA 4ZXOA 2V81A 3ANUA 3NPXA 1O5XA 5G2WA 4DJEC 2AQWA 1DHPA 1R9YA 1EC9A 1TG7A 1V08A 2BNJA 2VZVA 1OGGA 2EG8A 3OQEA 2INZA 2YBVA 2HPMA 1VBRA 3VX1A 4ZQPA 4FLOA 3AS1A 1S5VA 1WCGA 1XUUA 4QXIA 2KX9A 5HBFA 4PH6A 4I9AA 2LLEA 4QE5A 5LIKX 3O6DA 2IUZA 3CL8A 1J2WA 5J5RA 4A22A 1VFOA 2WNZA 3E2SA 1NDWA 1TTIA 2KAUC 3SRKA 4NSBA 1R30A 3GYEA 4K39A 3GDMA 4J3WA 4O8AA 1ZAJA 2VRKA 3TV8A 2Q3OA 3W9ZA 4LS1A 2O9PA 1S2WA 1FUYA 3OEXA 1IWBA 1UUQA 2VZUA 3ARRA 1K8ZA 4RR4A 2ZDSA 3C8NA 1XCFA 2ZRYA 3FLUA 2O55A 3FA5A 3H53A 2EJ1A 4BS0A 4D2JA 3N2XA 3AXMA 1NQ6A 4IIEA 2VQUA 4DZAA 4NXKA 4MOZA 4JXCA 1ZBKA 2I17A 3G0UA 4GXMA 3WLJA 4M7SA 4JCMA 1SZFA 2IW0A 2YLAA 4FX7A 1J2BA 1V6XA 3E0WA 4O53A 1XC6A 2FJKA 4Z1DA 3UCDA 1D3GA 5FF7A 1V4YA 3UG8A 3HPZA 1CTNA 4DQWA 3KDOA 4PFMA 4MKNA 2TRSA 3VXGA 5C70A 1KB3A 2ZYFA 1CW2A 3QYQA 4NKCA 3I7QA 4H6QA 4GQQA 4AZIA 4RNHA 3VKCA 2GJPA 3S9ZA 2YCIX 3SSZA 3H4XA 1JGMA 2WC7A 4NIRA 1V3IA 1JAKA 4W88A 3U5YA 1AODA 3QYSA 3OZYA 2A7NA 4GOAA 4IMAA 1KBKA 1OCQA 3TVAA 2G50A 4L61A 4PB5A 2Q6ZA 1TPFA 4UTKA 3DG3A 2RH9A 3H2EA 2VO5A 2OYMA 2EPHA 4YNGA 2GLKA 4LCRA 4O52A 3FHQA 4E2OA 1EQCA 1MNSA 4E8GA 3WH7A 3CBWA 1PHWA 2WJDA 4A3RA 1UMLA 2BX7A 3AYVA 1CGWA 3U6WA 3E6EA 4N9BA 5E09A 3LTSA 1S2VA 3MUZ1 5A2BA 4MJMA 3KE0A 2D1ZA 2ASHA 3OGSA 4ADUA 4Y2WA 3UCQA 5E5CA 4BF5A 2O4MA 1XH2A 5KITA 5BU9A 1H7NA 2DUAA 3D6NA 1R2TA 3C2YA 3AXHA 3MMDA 4PUUA 4NZ1A 3P5ZA 2WMGA 1TA3B 3PF3A 1H49A 1SGJA 5D2XA 5JBEA 1ME9A 5U4NA 3C8FA 4IOTA 5AYIA 1FTXA 3KXQA 1X8FA 4RXGA 2P0IA 3FJ4A 1JPMA 2XN2A 1QW9A 4DZ5A 2O7QA 1TV3A 3UGVA 3U4AA 2YPIA 1YHTA 2O7SA 3EX1A 3F4CA 3PUOA 4WZHA 3C0JA 4XAZA 3ZJ6A 4Q4OA 1UC5A 3H7VA 1UW9A 1Q66A 5BNKA 2XH4A 1TJRA 4GKTA 3W87A 1EOMA 1B9BA 4R33A 2P10A 3VOIA 4FZIA 4ADTA 5A8GA 5CPTA 4UC5A 1VIZA 3V0SA 3CUGA 2GK1B 2D3LA 1Q6RA 1VKFA 3M7SA 3A6OA 3THAA 4PBEA 1V3MA 1BQGA 1MDRA 4ZOEA 4JKMA 1H5VA 1GTHA 1QOXA 2Y7DA 2OZ0A 3VINA 3DFOA 2E40A 2PF0A 4UTWA 4XKYA 2VVSA 3GU2A 4QLJA 3AIQA 4QE1A 4B2DA 1VIWA 1NFBA 1U22A 1ZNNA 3W37A 4C6EA 4W8BA 2UY2A 1VJSA 1Q6QA 4YVPA 1IWAA 5A6KA 3NO1A 1WKYA 2EPNA 3W76A 3BSMA 4AWTA 4UOJA 1AQHA 1G4SA 4I7VA 1EFZA 1TWIA 1ITUA 1NP0A 2YCLA 5E1QA 1E4LA 1EX5A 1LUCA 3RMEA 4E5TA 4ATWA 1R86A 3IJ6A 3E3HA 4ZGYA 1WUFA 2WPBA 4LOCA 1GUVA 3PANA 3L5MA 4NILA 1BFNA 1YYAA 2WANA 4RNJA 3GQYA 4B5UA 3TAKA 4DZIA 1YDYA 4OFCA 3B9NA 1E56A 3VAVA 3SECA 1ISZA 2A3CA 4JD4A 5DLCA 1TR9A 4MZ8A 2AMGA 1M5WA 1OG6A 2WZMA 2J6XA 1S38A 2PD9A 3DH7A 3U2CA 1WB0A 1TMQA 3T08A 1PIGA 5GJPA 1BXNA 4HJFA 1UWRA 2POZA 3MZNA 4CQBA 4IPLA 3F5KA 5A6TC 4J28A 4WEVX 4NI3A 1IT8A 1N8IA 1HQTA 1W17A 4XG1A 3TYZA 3FSTA 1OVDA 2R94A 2VM8A 7TAAA 1XX1A 3BDKA 1B3WA 1X7FA 2J77A 3GUWA 3L66A 3O06A 2X8RA 4O0QA 2MNRA 1CENA 1PL9A 4YTRA 4GQ0A 3V5CA 2V3FA 3DFTA 3KVKA 1TV8A 3QMRA 1LL4A 1KCXA 5BXPA 3V4BA 1OWQA 3J7HA 2HPIA 1YIXA 4C6IA 1VBJA 4QEHA 1NF7A 4IX2A 4GO9A 3WK1A 1EF3A 4HHMA 2E5BA 4GMEA 1J0HA 2GOUA 4IUGA 2B7NA 3NZQA 5LNUA 1JYNA 1CLXA 1MSSA 4ZOAA 3F4VA 4K8GA 3P14A 3F2DA 1H62A 3NVTA 1R8LA 4DJFC 1ONRA 2PE4A 4JEJA 2GOKA 4HSNA 2OGYA 3VCNA 5XIAA 2G3NA 4PCPA 4GQGA 4LYRA 3PBWA 4GFIA 4KMQA 3M0ZA 2UBPC 3O0FA 4WSKA 4GI4A 3SRFA 1Q7ZA 4UFIA 1GPWA 3A12A 2QUUA 5FSEC 4QS6A 4XZLX 1R38A 3NQ7A 1MFUA 3KOYA 2ZTJA 1I1XA 3SJ3A 4ALDA 1GJPA 1W5QA 1KGUA 5REQB 1XLDA 1EX1A 2VGFA 5D05A 4QHRA 5C9XA 4JTUA 2HISA 3HJZA 1QATA 2OX4A 4HOWA 1OFQA 2XVKA 2NX9A 3APYA 1OFPA 2G3FA 3KRUA 1NFPA 1D3CA 1SQ7A 4M3PA 3ZJ8A 2PWVA 1JZ8A 2GGIA 2REQA 3LGGA 4E38A 4NZ5A 3NTYA 4CNSA 1MVYA 4ORIA 3EX3A 1TV5A 3B9DA 4UNLA 4RW3A 2GJNA 4F79A 1BQCA 1KM0A 3IUDA 3MYPA 2VC9A 2DPEA 4JEQA 3UP8A 1REQA 2ZXDA 4EIVA 3H2OA 3QTGA 3CZJA 5IHSA 1XBYA 4NYYA 4MNLA 2PU1A 1E6QM 4JNYA 1RBLA 3RAOA 2Z1VA 3UWUA 5I77A 4WDTA 3EWBX 4PMRA 4IIBA 1UA3A 1KW1A 1LJYA 1HVQA 1RLDA 3FGCA 4O4VA 2GGHA 3W26A 5IOBA 5DRCA 7A3HA 2X7WA 2QULA 2OWWA 2BDQA 2V5JA 3BUVA 3PAOA 1BVZA 3N9RA 1ICPA 1RA0A 5CC7A 4PTVA 3WFAA 2GVLA 1XYBA 4IUOA 3SCTA 3VIFA 2ZZ3A 1H7WA 1OX4B 4MVAA 4RK8A 2BY0A 2I16A 2DVUA 2YYUA 3RLUA 1VFSA 4AD5A 1RP8A 3MUIA 1MNZA 3VK5A 3S5ZA 2Q02A 1ALDA 1Z89A 3BV7A 3CYJA 1KTNA 1XD0A 2R14A 4A6GA 2OT1A 5J8LA 3OBKA 2EBNA 3HF3A 4IGNA 4LGXA 4ZODA 4PMVA 4WCJA 2HV5A 3K1DA 3GKFA 1SUXA 2WK2A 4FX6M 3GC4A 1RPXA 4Z0SA 3GXMA 3W27A 1GEQA 4IP7A 5I03A 3LEPA 2FGLA 2FDSA 4BEUA 3R13A 4P7LA 3B8WA 1ZQ5A 3UY8A 1B3YA 4EP8C 5HWNA 3WBXA 1AW2A 1M7OA 4HP5A 1KC7A 5CPLA 1QPNA 1WDWA 3WQDA 3CUJA 3WNNA 3SAZA 2XSBA 4O14A 3SADA 2B0MA 3WJZA 3U5UA 4IMFA 5D02A 4TOQA 1CB2A 2OX1A 4GQBA 2R91A 3EEZA 2A2IA 3ABZA 3P3BA 3PZ9A 4BQ4A 1YNPA 1PPIA 1S46A 3ZT6A 1CYGA 1R9XA 1EUNA 3WQWA 2ZZ4A 1OABA 2DSWA 3B9EA 3W53A 3W7PA 3AAMA 1S1PA 1J10A 3OYZA 1F6KA 1B3VA 1K4HA 3TFCA 4GXPA 3CMJA 1VBGA 2GQ9A 1PEZA 1WXZA 2UY3A 3ZJ7A 4XZ9A 3EGJA 3VO0A 3NUKA 3G6MA 1ITCA 3NQFA 2AMXA 4U33A 5K9DA 3KP0A 4K3ZA 2R24A 1E6PA 3TZNA 1SZNA 2X09A 4KCWA 2WCAA 3AMCA 4F4RA 3SI9A 2NXGA 3EX4A 2Z2UA 1XFCA 1XC4A 5C6MA 4V1YA 1OZMA 1HX0A 4J35A 1MXSA 3TFXA 3WJXA 4ECLA 3B4YA 5G1YA 3QZ6A 3W7GA 3H23A 3IUHA 3LBMA 3IWPA 4ZQOA 3NXFA 3BURA 1AD4A 4AWEA 4GGHA 1VAHA 4HVXA 2P3ZA 5BRQA 2J7DA 2QUTA 1E3ZA 3AS2A 5M17A 2GWGA 3T55A 3GVGA 1J0JA 3DHUA 4DPQA 1K6WA 4DJDC 2OG9A 3OODA 4KGLA 1XLIA 1WDPA 2JALA 6ENLA 3MSDA 1S2AA 3C86A 1FHDA 4UQBA 4HHLA 2WC3A 4IISA 2IS7A 3F2BA 1K3UA 4H8HA 5BOEA 1YPXA 4FLSA 4ML9A 3TNBA 2YZ5A 4GXWA 3OTRA 4O10A 1TSIA 3ARVA 4O17A 3T6CA 2PDWA 1QO2A 1JZ5A 3B0PA 2NVAA 4GK8A 4A8LA 3GLCA 3LTPA 3QJAA 1C9DA 1EL3A 3TQ0A 3OPSA 4JTFA 3SUSA 1PYMA 1Z48A 3BG9A 3UZ5A 2GSJA 1JDAA 4L4MA 4IGHA 3F5JA 4AD0A 3LCFA 1DOSA 1IT0A 3CASA 3G1DA 1FWFC 1RD6A 2JEPA 4RE4A 1J11A 5B7YA 1UQZA 4DWSD 4LANA 1UKSA 4FXJA 1FHUA 4O4WA 4RE0A 2O9TA 2VR5A 4PBFA 3GU9A 4JIEA 3QGKC 2Z28A 1YNQA 4JTDA 4M6QA 5A8MA 3R2GA 1J96A 4JFWA 5FESA 5K3VA 1AW5A 3IIOA 3SN4A 3TOPA 4NRRA 4MJ4A 1DQXA 2ZRXA 1VHCA 2OGJA 3CXOA 3M0IA 3TH6A 1N82A 4XB3A 4HNLA 3HPFA 1XLEA 4HN4A 2DORA 2WHMA 3JVAA 4MFDA 3OHIA 4HMDA 2BHYA 3PWAA 3AQUA 1KBLA 2NZLA 1V02A 4O50A 4B90A 2ANUA 4MZ1A 4S3GA 5FACA 1RAKA 2CLEA 3VDCA 5DANA 4Y9NA 4PMUA 3VMOA 3AXXA 2NVCA 4F48A 4M82A 4KCUA 3TTOA 4UOZA 1WKEA 4X60A 1HT6A 1LROA 1ISWA 3L4TA 1BGAA 4C60A 1XGZA 4L6HA 5AZ1A 3WDPP 1YXCA 1W9BM 1C8VA 4MWAA 3N6HA 3CQIA 1O1HA 1FWEC 1JZ3A 2PP3A 3WNPA 2BOFX 1B9ZA 3DOPA 3INPA 4GUGA 1A49A 3O7UA 5C55A 3PTDA 1UD6A 2EPMX 3SUWA 1POJA 3LHZA 5HOSA 1PSCA 2IPJA 2ZA2A 3S9YA 5CSYA 3CMGA 5L6UA 3QV7A 1NFGA 2ZZ1A 1P0EA 3CPRA 2O9RA 2DT2A 3UNTA 4HPXA 1B2YA 1W8SA 3S1GA 2J8GA 4CNPA 2J7CA 3NR0A 4OKDA 3HQOA 1QOQA 2J24A 3ICJA 1EO5A 5AZ0A 4K37A 1OCBA 1RXOB 1B4EA 1UZ4A 2VNCA 4D6JA 5EPDA 5DMYA 4LB3A 1GOXA 1J12A 1M41A 3W1PA 3TA6A 4GY0A 4MLJA 3T1GA 2CKSA 1FP9A 1ZSXA 3BLOA 3M0HA 4JX5A 1LG2A 3JW7A 1A5KC 4O18A 3P8IA 3VUSA 1BVNP 1M3UA 5CSUA 4UQAA 4M6PA 3MPGA 2QNEA 4FIRA 3DI1A 4NAFA 1RJPA 4ZO6A 3RJXA 3URNA 4JTLA 3MDUA 3BGAA 1KBBA 1I2NA 5ENLA 3FIGA 2DSKA 3BAYA 3LCXA 3W23A 5HPOA 4OE7A 4A2SA 1XYMA 3EWZA 2W27A 4JCLA 1IXPA 2ACSA 1KGXA 3N18A 3O1NA 4CKQA 4LJ3A 4WXZA 4ZO7A 4PTWA 2ZRUA 3WNMA 1CI1A 3GW0A 5H1WA 2FH6A 4AX7A 4NASA 2OVLA 3FEQA 3LX9A 1HJWA 4L65A 3CT2A 4D72A 3E02A 1TZ9A 1VCGA 2PDMA 3HU7A 4QLKA 4HCHA 5K9CA 3POHA 1DJHA 3M0VA 1UWUA 3WH8A 4MPKA 2IMRA 3O9NA 3M47A 4RZ4A 3GO2A 2OLHA 3ZR6A 2ZWYA 2JGQA 3EWUA 1LDCA 1EB3A 2GFTA 1BRLB 1E1CA 1LQ0A 1SYTA 1QNRA 4L9YA 4R85A 3GNXA 3U0HA 2V3EA 3CEPA 1SW7A 2AQOA 1AH4A 2DQWA 4FF5A 3DEQA 3NQGA 3QQ0A 4U31A 4RDWA 4WKFA 1TYGA 3ZVIA 2IQTA 1U1JA 2FPYA 4HHHA 4HIBA 2ABBA 4JY9A 3KTXA 4QNEA 1UZ1A 2VEKA 3TQPA 5C9UA 4C7DA 3AMDA 2VWSA 4DM2A 3DCPA 3DYOA 2O9OA 3PZMA 3PJUA 4JQAA 5A5WA 1UWTA 2W79A 5JU6A 3GH7A 4DUVA 2VZTA 3DFSA 4PN2A 3M1ZA 3G1AA 4HNUA 3BJSA 4QDWA 1FWJC 5T9BG 2C1HA 3GYCA 1P0KA 3HV8A 4QAIA 1XCXA 2Z1WA 4XK2A 3S46A 4H4IA 5AYYA 1E1FA 3OLDA 1M7PA 3TN3A 3MP3A 3LPOA 1JIBA 4NJIA 2Z2BA 3W7HA 1GVIA 2Y88A 5D37A 4AWUA 2NLIA 5JH1A 5G2IA 1UR3M 3NQMA 3E5PA 4GISA 1DYSA 1GQKA 4LUTB 3MANA 4PEKA 3LLXA 2QJGA 1UIPA 3TYUA 1LRNA 2ZUNA 5LIUX 4AHOA 1PV8A 2PBGA 5E9AA 1ECEA 4AD1A 2W92A 3NM1A 2F84A 2DJXA 1MDLA 1K1DA 4RL3A 2E9MA 1IR1A 5ABTA 5HXMA 5EFDA 3LNPA 4G1KA 1OFAA 2GJXA 2IQDA 2IXUA 2DW7A 4QNWA 3ME3A 3WYZA 3L9CA 1MI3A 2Z6IA 2NQ5A 1TWDA 4IJBA 4FXRA 2PDFA 1Z41A 3TTEA 4H6KA 4EK7A 3G3MA 4U10A 4W89A 1EUAA 4Q6XA 5CGQA 3H7RA 5HUPA 3WKZA 3CTTA 4L56A 1UBSA 2CU0A 4CD6A 2XZ7A 1GKRA 1OM0A 4AEFA 1HP4A 1J18A 3V1PA 4C1LA 2JIWA 4TQTA 3CT7A 1BG9A 4CCDA 3GH5A 4NF7A 1CLVA 1H5YA 3NJ3A 4A8RA 1FHVA 5KSWA 1JZ6A 1RHCA 4KWWA 3SCNA 4B3ZA 5CG7A 2AGKA 1XLHA 4IFOA 1OADA 3VZZA 3ARUA 3IJLA 3PG9A 1F7BA 4P2VA 3QHOA 2JKPA 1K8YA 2OCZA 5KETA 1K8CA 4PULA 2NWSA 1UR0A 4MLRA 3UXKA 3VIPA 1TTJA 4AC7C 5DXXA 3MHUA 4PODA 4Q8VA 4M8UA 4HJWA 4FF7A 2V67A 3SCWA 1MUMA 1IXNA 2D24A 4KQNA 3PFRA 3GVQA 2XFFA 1FWBC 2P53A 2H9AA 2QCDA 4LUSB 5A6MA 2EPOA 3AMKA 4XAGA 4D6HA 3KFTA 1GOWA 3W7LA 2GGJA 1O1ZA 5HMSA 3UZWA 4U5IA 4I9TA 1BSIA 2RKXA 3BMVA 4ZL1A 5D38A 2QVHA 5M1TA 3A3XA 3DX5A 4ATDA 4TX8A 1ZBCA 4XBKA 1G9HA 3RPTA 4GBDA 1X38A 5KMYA 1X1NA 3WLOA 3OZOA 1Q3NA 2E67A 1ADDA 3BARA 3HPAA 4YTQA 5GNYA 4WUIA 2E6YA 2RJHA 4A3QA 3I10A 4WD0A 2WBKA 3NOEA 3NZRA 1VHNA 1J6PA 3O16A 1PX4A 3IV3A 5BOOA 4B9ZA 4B92A 1IXQA 2Y2WA 1LLZA 4IIDA 2PD5A 2RJGA 3RG6A 3W38A 1F07A 2VCAA 1E6NA 3UXLA 2PWFA 3UVIA 1P0BA 3SJNA 1W56A 2JF6A 2A3EA 1LT7A 4O12A 3ARZA 4JTAA 5F4WA 4RZ5A 4UTTA 2FPTA 1BXBA 1MZRA 3PJXA 4UMCA 3UWYA 3N3TA 2VR4A 4W93A 3H55A 1EXBA 1FDJA 4Q4QA 3YPIA 2PTDA 3DGBA 4FNTA 3SUTA 4WR3A 1TPUA 3VIMA 1NDVA 4NI8A 3W1MA 2OZ3A 3O2LA 1H11A 5EGRA 3W0KA 1C91A 1HKJA 5C5YA 2E6DA 3MI6A 1EA0A 1UIOA 3AU2A 4QAWA 1PTAA 2VKZG 1ZBWA 4M24A 6XIMA 3LM7A 1CXHA 3GE7A 1EWDA 3ES8A 4R27A 3H54A 1AL7A 3P67A 4RKAA 3BAWA 5KINA 4E2BA 2RDWA 2Z27A 2ZX7A 3I6EA 3F2CA 5HINA 2CBVA 1RJRA 2W62A 4L64A 4WY0F 1PTGA 2OYLA 3B0UX 3TC3A 2WZEA 4O16A 5HUOA 1Z9AA 2IXVA 4CU6A 2TODA 3FOKA 2NSOA 1RUSA 4MGGA 4ES4A 2FIQA 2Y89A 1KM2A 3N2MA 4BWLA 2Q8XA 4DY1A 4AB4A 4ZR8A 4GCAA 3I6RA 1DWJM 3TTYA 1SR9A 5F4XA 3T40A 5LIXX 5GQBA 1T0OA 2YJQA 4H6EA 3SB0A 2GYIA 5ABFA 2OKOA 1JI2A 1QHOA 1MUCA 1ZALA 1B1YA 1AH3A 5I02A 4TVCA 2Y0FA 1RA5A 3L68A 5LKYA 3L21A 1K03A 1GZGA 2OSXA 1TZ7A 3N2TA 4C1KA 3CZGA 2Y85A 2VX7A 4KERA 1FH9A 5H8UA 3Q45A 3OBEA 2BXVA 5I3IA 1HUVA 2BMBA 1VJIA 4GZIA 4K7VA 4C7GA 3GAKA 4UTWC 3BO9A 1SO5A 4RV8A 3VNJA 2BXYA 1GKQA 3TSBA 3FA4A 4GNKB 2V9DA 4HK6A 5E6ZA 2YZRA 2PWUA 4LBRA 2J25A 4Y9MA 3W71A 4UTMA 5LZLA 1JCYA 4EPBC 3FVMA 3TROA 2OSYA 3IAPA 1KD0A 1YEYA 5CZ0A 4HB7A 1W3TA 4LBSA 3UU0A 4GIEA 1EEPA 4JICA 4NNBA 3WF3A 1CZ1A 4AD2A 3IRSA 2PURA 1Y65A 1KA9F 1YDOA 3CB3A 4I7UA 1R7AA 5HMEA 4GVGA 4BF7A 1A4LA 4M19A 3FCPA 2ZUMA 3E38A 3KBMA 1OYCA 4AZCB 1VEMA 2X0SA 3GDBA 2WV8A 3R11A 1P1XA 2QVNA 5E0CA 4C5ZA 3N29A 1ISYA 1LWHA 1IWPA 4YVVA 3MZ2A 1P0NA 2EO7A 2VR2A 3GG8A 1P7TA 1FBAA 1UA7A 3M64A 4PMJA 2ZCGA 4Z1YA 2PRMA 1Q8AA 1POKA 3VOFA 1PUDA 3NZGA 2XIQA 4TVDA 2Y5EA 2QIWA 3G77A 3WF2A 3N11A 2HWGA 3H2FA 3MHGA 4QISA 3PAJA 2CPUA 2ZXBA 2VP8A 4HPJA 2IPGA 4DNMA 2WB5A 1WBHA 1RQBA 2CWXA 3CM4A 2VZSA 4LVGA 3QY8A 5MHBA 2AL1A 1DQUA 4FAMA 3BPWA 3KVMA 3LMZA 3ZO9A 4LNCA 1RCOB 3CEUA 3EB2A 5CKSA 4U3CA 1O94A 2VFGA 2HTMA 3WLHA 1Q63A 1A0EA 1Q7MA 4AU0A 4LUIA 3R1ZA 4EF9A 1JVNA 4G2DA 3MCOA 1EIBA 3WQ4A 3WD2A 3SFKA 4MF4A 1ZU8A 1A5LC 1R0MA 3GD6A 3WQGA 1M53A 1WX0A 2GUUA 3KHDA 5TIMA 3WF0A 4N2YA 1I0BA 1VJZA 5D9NA 5LNWA 1E4NA 3Q2DA 1R3QA 4C6DA 3RJYA 2GSHA 1ZJHA 4I9JA 3F5LA 1L8PA 4B16A 4LNYA 4QTGA 1ZPTA 4GY1A 4X63A 2Y7EA 8XIMA 2DZVA 4LAZA 1ZL1A 1WZAA 2XIMA 5I3GA 3AJXA 4WRHA 1JG9A 3AWNA 1JULA 3O6CA 4JDYA 3P81A 2YA1A 4IICA 7REQB 1G4TA 1XLCA 1XQKA 3S2CA 3AZSA 4H9UA 4IXHA 3WH5A 5BCAA 1GVFA 4A3UA 3N04A 3EBVA 4IJCA 2EAWA 4YYCA 1V03A 3LCIA 4GQRA 4ICNA 4RZBA 2B7PA 2Y61A 1B4KA 5FF4A 3A23A 6TAAA 3GFXA 4HTYA 1E40A 3GNOA 5CEWA 5C7VA 1XINA 2ZTKA 1TTQA 4Y9PA 3T09A 3MKVA 1MW3A 4N0RA 2XIJA 1XLKA 4TVUA 3VKDA 2QAFA 4O8RA 1Q6GA 3WEMA 2I9UA 3D3FA 4MB4A 4GG9A 5ECUA 3MBDA 4GI9A 1CLKA 4AAJA 4DBWA 4CQDA 3OB8A 1XM3A 1YLVA 1VGAA 5K4XA 2F7FA 3SY5A 3RM4A 2B7OA 4HYRA 3H8AA 3W1AA 4ZENA 1VQTA 3JR2A 1V6TA 4XO7A 3BV4A 4RE3A 3L67A 2ZC1A 2GPTA 4ZXLA 3A4WA 3W1LA 3VIKA 4IFKB 4R9XA 3VD3A 1VENA 4Z2LA 1QJWA 1LZOA 2F8QA 3MMWA 4QSHA 1WV2A 9XIMA 3VGHA 4NJKA 4QJ5B 5EA9A 4R3UA 3GRIA 2RHGA 1G4PA 4DF1A 5CPSA 4LF1A 1UP0A 2VWTA 4REQB 1RCQA 3M46A 1F3XA 4LS2A 2PDYA 1LT8A 1XDJA 1GVQA 1J9YA 2YL9A 3F4NA 1W3NA 3OIHA 2ATMA 4CGTA 3WK0A 4O19A 4KFPA 2E8ZA 2HNHA 1V5XA 3V35A 2YX0A 1D3HA 4ZFMA 4M51A 1BF2A 1W1B1 4P7OA 3B40A 4JQ4A 5JVLA 1HJVA 1GVYA 3S2NA 5A8PA 3UWZA 1W1A1 2ZZ7A 3OVQA 2Y63A 3CWHA 3G0SA 1S5TA 2YL6A 2G41A 5A6LA 1EO7A 2ALRA 3QPZA 4OHQA 5A2AA 4WKHA 2OMAA 1HFBA 3UWWA 1LRTA 3NOYA 4XV0A 4OT7A 1ITXA 3KVLA 1LQ2A 1P4CA 1RK5A 4XD3A 4J27A 1TPB1 2P50A 4AEEA 4R9OA 4U2ZA 4NZ3A 1JCMP 4KCTA 2QV5A 2ZIDA 4HZ8A 4S3BA 1TUXA 3WDIA 4TIMA 2PBOA 1XYCA 3WFLA 4UZUA 4R5EA 4XQ6A 3KS5A 3S6TA 4XAYA 1A5BA 1ITQA 1PZ2A 4JS3A 3LTYA 4GVHA 3AICA 3BG5A 3LSCA 3WF4A 4UCGA 3CAWA 1PDYA 2E7FA 4US5A 1P0DA 1WZLA 3W3OA 4O57A 1UZHA 2VGGA 3MSYA 1FWNA 1EDTA 4QITA 1F5ZA 2E68A 5E70A 2Z25A 3T0DA 3RPMA 3NXLA 4JTHA 2HK1A 4M1RA 3TLLA 3EWDA 5BMXA 2E9LA 8A3HA 1TX2A 3DESA 4QX4A 4TMBA 1T40A 2ATSA 3LB0A 4Q7IA 1R3YA 2XZ9A 4PYSA 1GQJA 4EPKA 1BYBA 2XGIA 4QEEA 1QWGA 4OV4A 3KZPA 3QPYA 4XIAA 3AS0A 2XGBA 5BYWA 4ZA0A 2PGRA 2ABAA 1DXEA 5K2ZA 1C92A 4IPNB 3UZYA 1OD8A 1LWJA 1WXJA 4H8VA 3BQ6A 4BI5A 1DIKA 1ELSA 1AQFA 3IV8A 3UXIA 4JTGA 3KBVA 3ZR5A 4LVAA 2GK1A 1IGSA 4J5NA 5PTDA 1K70A 3B8IA 3ZMRA 3Q37A 1S3HA 4H9TA 1EP1A 2VL4A 3WBWA 2PDKA 2NXHA 1J0ZA 4FNRA 3QQ1A 2YLLA 3WCZA 4P5UA 3WN6A 2QAPA 1FWIC 3E1F1 4H9ZA 3B0VC 3L2IA 1K8XA 4QQUA 3MJMA 3ZWSA 1TUFA 1OCJA 1NOFA 2EF9A 3L23A 8XIAA 2CZDA 3HOJA 3QN3A 3TSMA 1VYSX 3OZMA 2QCMA 3C2FA 4QIUA 5CBBA 2C13A 5CZTA 1HIZA 5CC5A 1JAEA 2PWHA 3DXIA 3FDGA 2BODX 3OJGA 3ENLA 4B3LA 3B97A 2PC8A 2BLEA 2FVKA 3NFUA 3IJDA 4YXGA 1UWSA 1H09A 3G18A 4L4OA 3B8TA 1E6RA 4JTTA 1JR1A 1YTEA 3PK7A 5A6BD 2OQLA 3QOKA 2INEA 5T26A 4H9YA 2ZXQA 2CCRA 3EWWA 1FXPA 1I9CB 1JL8A 4JIQA 1JDEA 3JU2A 2PDHA 3K2GA 3L12A 3PUEA 4FO4A 2HEJA 5LA0A 3W24A 3V18A 1IGWA 2A0NA 2NQLA 1YQ2A 3IJQA 2ZADA 4UFMA 1Z7AA 1SFTA 1EPVA 3UESA 4EPEC 1TE1A 1RBAA 2NT1A 4PA8A 4OBRA 4AXNA 1Q6LA 3U3HA 4M0XA 3ALFA 4PCSA 1PZ1A 1OK4A 3NA8A 5CLTA 4WK9A 2QMKA 4CD4A 5M2FX 5HJLA 3HM7A 3EOSA 1DXFA 1SFLA 1TJ2A 2G4JA 4IP4A 1HJUA 3GFZA 4FNUA 4A8NA 2NV1A 3PSVA 1RR2A 1BYCA 1GGOA 1MW0A 3V75A 3TN5A 4E3TA 1A0DA 4QSFA 1W54A 5IBXA 3H2AA 3NDOA 3QVQA 2V63A 3HO8A 4E8DA 3ZR4A 1WA3A 3LNMA 5I3JA 3VD9A 3WK3A 5A6AA 3UCCA 3W81A 5CAKA 2VFFA 4RCXA 4DAIA 3ZLHA 1MXGA 3HMCA 5GVJA 1PJ9A 3TP4A 2DFAA 3UWQA 5I6SA 1BAGA 1OFOA 1HZYA 2J8FA 2J78A 2BHZA 3ZIZA 1FWCC 4NZJA 4YLWA 1A53A 4GJIA 1NU5A 4MWAC 3WBAA 2JEQA 2YCKX 3LYEA 2VCBA 4GINA 3VPLA 4M81A 3TXZA 3HGJA 1QFEA 4S23A 2XHYA 3CZEA 4XZBA 3WIJA 1V6WA 4XD5A 1FX6A 3GTNA 3SQMA 2HS6A 2PDBA 4C6OA 3AS3A 4JKLA 4GUJA 1A5CA 1G4EA 4AVNA 3CWNA 1D7KA 2DIKA 3CPGA 3WH6A 3SO7A 3K1GA 1W9DM 4O28A 5CCZA 1KFEA 1V8EA 4FNSA 4N02A 2XISA 3WDRA 1X98A 1H1ZA 3WBEA 4JTQA 1F76A 2IKIA 3LBCA 1XKJA 2A1YA 3RHGA 1SFJA 1XW8A 3NGJA 3QKZA 1S5WA 4PMOA 4Q7BA 3FJ6A 1IF2A 4KIRA 4OTKA 4BF9A 1DTUA 2RDUA 1A5SA 1KRMA 2XH0A 5D2TA 3UGRA 3BTNA 3UA4A 3MVTA 3NZ1A 2CZ5A 2QMJA 3MYOA 4PEEA 6XIAA 3KOWA 3VYLA 4HPGA 3TX9A 1ZENA 3L2LA 1BD0A 3DG7A 1AQMA 1B31A 1Y5WA 2A7RA 4HMEA 4TTUA 3S1XA 3W4RA 5C8BB 1QBAA 1CGYA 1KBIA 2NQJA 1GK8A 3CIWA 1SJCA 3ITGA 3CAKA 2GVJA 1DE5A 5E0KA 3SFWA 5C9RA 2WVVB 2FDMA 2YW3A 1I2RA 2FVLA 3G22A 3NCOA 1KV5A 5E0FA 1FP8A 2XPKA 1E9ZB 2O0TA 1ZB5A 1KFJA 3AWOA 4JTJA 1UR9A 2C79A 3MMTA 4GIAA 4QBXA 4WLCA 4TU1A 4DWSC 4GA8A 3ITVA 1GWJA 1R7OA 2OEKA 1E71M 4F0LA 4NJHA 2HBXA 3U48A 3E0IA 4RE2A 1SJDA 1NELA 1QI2A 3DFNA 1KM3A 3VI2A 1GG0A 1FKXA 2WVUA 4O1DA 4F3HA 3EDKA 3RX2A 4WF7A 7TIMA 2HSAA 1U5VA 1VPYA 3PBGA 4HPNA 3R89A 1FKWA 2VEIA 1VFFA 5LHFA 3RXZA 4J3ZA 2ZA1A 3DFQA 4Z0JA 3O3RA 4MAVA 1E9IA 1DWAM 1I2QA 3BICA 3TTQA 1KCZA 3LDVA 3RITA 3UYIA 2PI6A 2Z1BA 1A4MA 4HA3A 5C9ZA 4MKSA 4D9PA 3KW3A 1FA2A 2G8ZA 3I68A 3PY2A 4D1JA 4PUWA 3IK4A 1TX0A 1U33A 1PKMA 4AY7A 2AL2B 2PTZA 3MKKA 4B9YA 1ZJAA 3L4ZA 2AGTA 1TMLA 1HJXA 2Z24A 4NXSA 1MW2A 1AVAA 5CBJA 4CCZA 5GPRA 1FWGC 3WLQA 2VT0A 4CLMA 4EKJA 3DC0A 5HULA 1UKQA 3O05A 4MFEA 1CGTA 2QIIA 3PG8A 2RGLA 2X16A 2WZIA 1P43A 2QXWA 4B91A 1DIDA 3N2CA 3TZFA 3B0YA 1JJKA 2OJPA 3GR7A 1XIMA 3M41A 4X2RA 1QNVA 1DL3A 4HA0A 2V3GA 3VFLA 5BRPA 3ITOA 1SFSA 1XRFA 3WMCA 4DF0A 2NUXA 1OBAA 5I24A 1VS1A 1EJTC 1FH8A 1BGGA 1KRAC 3NDZA 2ZX9A 1YXYA 4BFAA 1V79A 3L4UA 1ZFJA 4MKVA 3FJNA 1SSGA 1GORA 5D30A 1K7XA 2V5BA 3CUXA 4IQJA 3HQNA 2X1IA 2NLYA 1K9EA 3EWXA 5H91A 4ZZ9A 1EXPA 4I8DA 1FFRA 1C8QA 4C90A 2P8CA 3TYCA 3S2MA 2J27A 3NIYA 3RO8A 3VIHA 5D9PA 1E3XA 3QW4B 4WQ6A 4UFJA 1W9UA 2D0FA 3NNTA 3EWCA 3GU1A 1GKPA 5DT7A 1OFBA 4WVXA 4P7RA 3RYSA 3FN9A 2HS8A 1H63A 2I5IA 4P8VA 5CZJA 1M03A 2F6XA 3BH4A 1I75A 1PVNA 4D6CA 1V77A 2XU2A 4EF8A 1JCTA 4PMNA 3VA8A 1XL9A 1MZHA 1TPDA 4AZ5A 4FXSA 5C2XA 2BWGA 1YMYA 1U83A 1SO4A 2W67A 5AKQA 2XH2A 5FF2A 1ESWA 3U4FA 1V6UA 1JUKA 3ZZ1A 4PE8A 3R4IA 3UXAA 4D6FA 4JN7A 1C29A 3GUGA 1RY0A 5K4ZA 1HF6A 2C1IA 1XIGA 4AUBA 3DBNA 3KBNA 1OFDA 1ZTVA 1XH0A 2H3BA 1XYZA 3HQ1A 1XDMA 3CHDA 1V3HA 1XYLA 1B90A 3HURA 5FL1A 3CV6A 3T4WA 5I09A 1GHRA 1PKYA 5FSDC 3EA3A 4QJ3B 2X40A 4CU7A 3G24A 1UB3A 3NAVA 4GVFA 3N25A 3AOFA 4N6EA 1G69A 3VZXA 3GAYA 4RUBA 3FYOA 3EPNA 1G67A 5LIYX 5T9CE 1VLIA 3FY1A 4J3XA 1EP3A 4JTKA 2FB2A 1JCNA 4LW7A 1JFXA 3M0MA 2BVWA 5LGXA 2XM1A 3C52A 3EWYA 5CLWA 4PRTA 4HNCA 1TPH1 1X6NA 3M5VA 5CGMA 4E6MA 4Q4PA 1KNWA 1RLCL 2VXNA 4K6AA 2WCSA 2XTKA 4UB9A 2RGMA 4KKXA 4RNFA 2HRWA 3KDNA 1M65A 1YW1A 1UR4A 1LLOA 2WHLA 1U5JA 2ZZ2A 1OT2A 1SSDA 2TYSA 4CNTA 4YVXA 2MANA 1TMHA 4UTTC 4UNIA 1Y0EA 3UPWA 4E2DA 3KM8A 4EPDC 1IZKA 2OWCA 2ZVIA 3BMXA 1EBGA 1B0IA 3CWOX 2I5GA 4H7VA 4MUZA 3LK6A 2REQB 3A9BA 4WDXA 2YCJA 2UWFA 3S2JA 1C9WA 2DIEA 3HPXA 2DVXA 5EKYA 2PLKA 4JN6A 3D5HA 3LMYA 3EMCA 1AJ2A 4DO5A 1R3WA 3QC3A 4IIFA 4ZB2A 1UOKA 4MY1A 5CH9A 3W00A 3C6CA 3IAQA 3B8UA 4Y9OA 5TD4A 1WXYA 2OKTA 8CGTA 1Z3NA 1XIIA 3SUUA 3ZSTA 5DY3A 4LAOA 1I4NA 4QDMA 1HP5A 2YGYA 1F4AA 1PE1A 4WJXA 3TA9A 3CLWA 3LI1A 3DI0A 3JS3A 1K9DA 2PDJA 2ZX8A 4GZEA 3VX0A 4BWLC 1KM4A 4IM4A 3WELA 1QVBA 1H7RA 3GXPA 1VLWA 4WX2A 4JX6A 2VVNA 1O5RA 5E6YA 4DYKA 5I5RA 4GO8A 3COTA 2P1FA 3C2EA 1DPMA 3ITYA 4BR1A 4UWMA 4N9CA 1SR0A 4KRTA 2X7VA 4I7WA 2ZC8A 4ZO8A 4GI8A 4PRWA 3S42A 3S4TA 3P0XA 1E6SM 3DFHA 3AXKA 4ORMA 2WMHA 4FR6A 4URIA 2DT3A 1EDGA 2PAJA 1UP2A 3UEQA 1B30A 1IHIA 1DJWA 3AHVA 3W25A 2J8TA 1QASA 1W3KA 2DP3A 1JPIA 2HVNA 4NX5A 5A1AA 1OG0A 3UQNA 2NV9A 2EQDA 1CBGA 1SZGA 3GFYA 4GJ1A 1Y5VA 2CEQA 3V0UA 3VC6A 1TTPA 3VKJA 2X05A 4M7TA 1P1MA 2HVOA 3UR7A 1QTWA 3HG5A 1R47A 1TPC1 1GYLA 2POTA 3L4VA 2DH2A 1QNPA 4JX4A 3PZQA 3W2UA 1BRLA 1TWZA 1EBHA 4UOQA 2QUNA 4GNVA 4ERGA 3EMZA 2YA0A 1XGEA 3NQAA 4XUGA 4XD6A 5AHMA 1VBHA 1V3JA 4LS0A 4Q3MA 4QDPA 3VGFA 1YDNA 1J4EA 2NUYA 4GFSA 3SCVA 1QUMA 1US3A 4E4UA 4GD0A 1OYAA 2C14A 3AZRA 4N9EA 4TTGA 4FP1A 1GQNA 5B80A 3EXTA 4DJFD 3IJ9A 3CV2A 4DBUA 1TRDA 1A5AA 3LCHA 3L65A 5AHFA 1KRCC 3KOXA 5BXSA 2CKRA 3IJ7A 1Q2SA 3MKCA 1J93A 4DO7A 5KTLA 5JH2A 4F2TA 3IRDA 1F74A 2Q8LA 2C18A 1XRSA 4DO6A 3OGRA 1LOSA 5FCZA 4OIFA 3SEPA 1N55A 1RK6A 3RUBL 1RZMA 5I07A 2QJHA 2X1SA 4ZTYA 4HK5A 1A3XA 4CQ8A 1KRBC 2IKGA 2W61A 1CT5A 2J7EA 3N15A 1GZJA 3CH0A 3PZOA 3S2LA 5FJTA 3IVTA 3MW7A 1U5HA 3ERPA 1XWYA 6REQB 1TFVA 1MQQA 2GQ3A 1GOOA 2QPXA 1B57A 3HTWA 5I7GA 3U57A 5HQLA 4PB3A 3FXGA 1UROA 3P7YA 4M1BA 3W6LA 2C7FA 4KW2A 1F8MA 3NYZA 4BCEA 4MZYA 2CBUA 2PDCA 4RPPA 3E96A 1EHNA 4AD4A 1XLAA 1JRBA 2JK2A 2BVDA 1IIGA 3ES7A 1BKHA 4O11A 2PWGA 4DYEA 4H9VA 3GNPA 1EP2A 1A0CA 3B8VA 3LQGA 1V0NA 1EGMA 2P88A 5CJ5A 5ECVA 4HCLA 2J88A 4XZNX 5HR6A 2WMJA 4WOZA 4Z1AA 5FJJA 4NNAA 4DB7A 4YTUA 2VOTA 2L5HA 4D8ZA 2ZBTA 3S1WA 4LUYA 4O54A 4MM1A 3RX3A 4JIHA 5C0QA 4YHGA 1CXLA 4MNJA 3MTWA 4UFHA 1UHVA 1DEDA 1RV8A 3WH9A 3ZS4A 1QNSA 5G4WA 3TMLA 1BG4A 2GZXA 2TMDA 3THDA 4W7WA 3WD0A 3P60A 3RO6A 4AWSA 3E0FA 3BAJA 3WQCA 1E4IA 4UTFA 4JAWA 1EJXC 3ZLGA 3E2VA 1XRTA 3BC9A 6A3HA 1XH1A 4PSPA 2CWNA 1Q13A 3G2GA 3GNRA 5AVHA 4C6MA 4L7ZA 2ZUTA 4XO6A 5DBTA 2YW4A 1PYFA 2CHNA 4G7FA 4PL2A 1UPPA 3BJFA 4HOXA 4H9XA 4FXFA 5D09A 3VM5A 2ACQA 3EA1A 4F0HA 3DAQA 3CAVA 5FD0A 3RF9A 2CW6A 4S38A 2GWNA 3AFBA 1DWHM 4FS9A 4NY2A 3RRAA 2PCQA 1GOQA 4LQ1A 1EOKA 3FDKA 5DEZA 5DY2A 4MAZA 1KM1A 1VCVA 4LUSA 1BF6A 1UR2A 3GG0A 3THUA 2OQHA 4CEUC 1TB3A 3RR4A 1JUEA 4PCNA 2R8WA 1R85A 4MPQA 3AIWA 2PDPA 4W85A 1ISXA 4E2VA 2GUYA 3T78A 2IQ0A 4HKPA 2XVGA 4P8WA 1ZS2A 2F2HA 3H2MA 3TK7A 2ZZ5A 3KS6A 3MU7A 1CGXA 3Q94A 3M5ZA 3NSNA 3I65A 2GUBA 4MJ2A 4TX6A 4RDYA 3CV1A 2ZRZA 2X42A 4JIIX 1GVOA 4AFYA 3H6OA 2ZOXA 2WLYA 1BSLA 3CQHA 1YBQA 4LXFA 1DE6A 1TREA 1DJQA 3CH9A 3PR2A 3FJLA 2FZMA 1R2RA 1XRVA 4KFNA 3PBUA 1KBJA 1VFTA 3QXBA 1E0VA 1XISA 1UH2A 4HD5A 2OO6A 3I7SA 3WUBA 4QLLA 2NX3A 3W6YA 3NPWA 1JYXA 3ATZA 2XINA 4E4FA 3MBFA 4HYWA 1TCMA 3HBLA 1LOQA 3QH2A 3TEVA 2JIEA 1H60A 5IHRA 3N34A 3PBVA 4FK9A 4F0SA 4W8LA 4XVEA 1E0UA 4IMCA 4BKNA 1KLZA 3PBYA 4L4PA 3TJIA 2CLFA 4UMAA 4ZB5A 4UR7A 3BXWA 4MB5A 5I3FA 2WKLA 5JIWA 4HNOA 3NL5A 3LZ5A 3N73A 5D9OA 3OQ8A 1A5MC 3TU9A 2BY3A 3GDRA 1SZRA 1GEHA 2OLAA 4BY3A 2Y62A 3RCYA 1OC6A 4Y8EA 4HBKA 5BROA 1NF0A 4IZGA 5F2MA 4S2CA 2R82A 1KQYA 1IEQA 3Q4DA 3CYVA 1GQLA 4NRSA 3OVRA 3GZAA 3VOCA 3WD3A 4WKAA 2WM1A 1UCWA 1FHLA 1KM5A 2F6UA 3PN8A 2PP0A 3KWXA 4YL2A 2Y24A 1VFUA 1W5OA 1FRBA 2V2HA 1L6FA 1NWUA 2YB1A 2YSWA 3PPCA 2VMFA 4O1FA 2B81A 2YL5A 1MMFA 1E4MM 4PMDA 1ONEA 2XIIA 1E1CB 1JZ4A 3XIMA 1HKVA 2W6RA 3K46A 3ALGA 4AG0A 3PS7A 4NZCA 3ABQA 2E09A 5LGZA 5F2GA 4PZVA 3LI0A 3FFSA 4I9MA 4RW5A 3WJSA 2PTWA 4C6KA 4AIOA 2CBJA 4BHYA 4ILSA 4R7JA 2XFWA 2R6OA 1ZP3A 1E1EA 3ZQ9A 3W1RA 2QCNA 4A3YA 2O92A 1C90A 2HVMA 2WWDA 1THFD 3M43A 3WQOA 4LBUA 3MP5A 4J3UA 1KXVA 4AZCA 3A9IA 4HNVA 2AQVA 3GB6A 2QCGA 4ROPA 3LPGA 1VFLA 3R8RA 1BTCA 1UD2A 3GHRA 1V0KA 3DFYA 3W28A 4AHQA 5CC3A 3BCJA 3UZZA 3OO2A 2YB4A 1D8WA 2WYSA 1XICA 4K7YA 5LHEA 3T7VA 2F6KA 3KAOA 2QQ6A 3T0AA 3BJTA 1TIWA 3S9IA 4GY7A 5D04C 5JUVA 1VEOA 4H83A 4H41A 2QYGA 2PTYA 1QPRA 5G4EA 5D2WA 4XAFA 3RILA 3LENA 1BKSA 5G1MA 1JPHA 3AYRA 3LG3A 5D8ZA 2HE5A 3AC0A 3P8JA 5TBOA 3GZ3A 4GYPA 2HMCA 4X3ZA 1VF8A 2EG6A 1R5YA 2NX1A 4A4AA 5BOFA 4JR5A 3LHVA 5AN7A 1KTCA 3LCLA 2FMOA 3CZKA 1LRQA 2DQXA 2PCEA 3P61A 3A64A 2GJRA 4HMCA 3BW2A 1H3GA 4TO8A 5JQ9A 4GC4A 1XYAA 5IBXC 3ABSA 3PC0A 4ASTA 3W73A 3WY1A 4C1NB 1XI3A 5D2YA 2GJXB 2DZUA 3L0NA 3UF9A 1GNXA 1Q6DA 4FX8A 4YS1A 4PC8A 4FMVA 1F3WA 1HKMA 2AKMA 3GG7A 1CXEA 5BRBA 3UG4A 4UQEA 4V33A 1DVJA 2H8XA 3DENA 4XD4A 1QDSA 4E0CA 4ZQCA 7XIMA 1EC8A 1TE6A 1XF0A 3D46A 3WEOA 5BW6A 1WPCA 4DBDA 4UCFA 4NP7A 4EAYA 2NW0A 3G1HA 5EMYA 4DEFA 3VNIA 7REQA 3A4JA 3ATYA 4C5YA 3SIMA 4F0MA 3AJ7A 5M03A 3HQPA 1X7IA 3TIMA 3A47A 4F40A 2C0AA 2E1DA 3AMLA 1NEYA 1XLJA 1R3VA 4FB7A 2XIBA 3KLKA 3REQB 4UTUA 2ACRA 3OG3A 1DJNA 2E1WA 1UBPC 1E9YB 1U2YA 3T05A 3MY9A 3FS2A 3KVJA 3CNYA 4P8XA 4BJHA 3RFAA 4W5UA 4HQVA 4GHRA 4L1GA 5HPCA 1KFBA 5FEXA 2C71A 1Q4NX 3WL1A 4ZVJA 2QCDB 3NQ8A 4JZ5A 4LVBA 1GOKA 2CNCA 3S47A 2G3IA 2QUMA 3B0XA 3EDDA 3WQFA 2FTYA 5I3DA 4S2BA 1S5NA 3UD6A 3SN0A 3PZNA 3LHWA 1KFLA 1UUOA 3W2JA 1DJZA 1QNOA 3BGGA 1BVWA 3A24A 2X0HA 3MV11 5MKGB 3ABOA 2A5HA 1CWYA 1LCOA 5EMJA 2WKJA 4GCXA 4HZ7A 3UFYA 1JXJA 3URAA 1YNYA 2OQYA 4CU8A 1OFRA 3BLLA 1YPFA 3N3MA 4PB4A 4YPJA 4REQA 3APTA 4EWJA 3TWAA 3WDQA 1LBFA 5F4SA 5EYWA 2YCEA 5HNUA 4KT2A 3H4GA 2V38A 4LF2A 3FV9A 2DT0A 3IGSA 3N13A 2QHAA 2V2CA 4W9TA 3UPBA 3LCGA 3WENA 3GBEA 4KEUA 3R5EA 1D2KA 4HGXA 1PWMA 3TONA 4PTXA 4J7RA 5CPNA 4IWWA 1XP3A 3K13A 3L2MA 6TIMA 2JE8A 4XZHA 3LUTA 2GQAA 5C2CA 3HPSA 1WDDA 4B5XA 3GVWA 3GWQA 3ITCA 1DTNA 1EC7A 4X61A 5BMWA 3NO3A 3CIXA 1N7KA 1HG3A 1JD9A 4JFUA 1DIOA 1OY0A 1MQPA 3LV5A 1CCWB 1RY8A 1YE6A 2B31A 1X39A 4YTTA 2XDFA 1IQ8A 5AHIA 4QG9A 1FWDC 1W9XA 1CNVA 1VPXA 2Z7GA 3B4UA 4CNUA 5LXEA 3R12A 3PZUA 2YDAA 1G7VA 1K77A 1GOMA 1PCWA 4S3EA 1OINA 5CSSA 4MDPA 2Q8ZA 1W1IE 3H2CA 3QZAA 3B3DA 3RCMA 3MI2A 4Y9AA 3KBJA 1QHZA 3L5AA 3OVGA 1VYPX 4ZSTA 4W86A 4MNMA 3TSDA 1AW1A 2DZXA 4WIWA 2J7HA 4UMBA 3DFPA 4U3AA 3NM3A 2WSRA 3LPFA 4CN1A 5ABFB 1H41A 5H8MA 4RNIA 4Q8OA 5HQMA 3OP2A 5K7JA 1ICSA 2HBVA 1V0LA 1HTIA 5FF3A 4PUJA 1LM1A 1ZHAA 2J47A 4CEXC 5HMDA 2OU4A 4WXYA 1DJYA 4JY8A 3QLDA 1K02A 1O7AA 3WO8A 3TXVA 1VBUA 4DPPA 4LC8A 4HT3A 4WJ8A 1IEXA 2J13A 3TUUA 3M7WA 1WE5A 1RQEA 4M6UA 4DZHA 2VUNA 4GLEA 1G7UA 4FALA 1R3TA 2J7FA 2NSXA 1LL7A 3DKLA 3M07A 4F9JA 1YADA 4UZSA 3B03A 2C91A 4GKLA 5H6HA 5EMUA 1NDZA 3OLGA 1LF1A 4NYUA 2QJMA 3S5SA 4U5KA 2ZDRA 3H26A 3WUFA 2INFA 2CYGA 2BOEX 2NQHA 3C56A 1DHKA 4DO4A 1S5MA 4MB3A 2D69A 2QGYA 2ISSA 1W5NA 4Z42C 2NT0A 3NDYA 2JKEA 1JXKA 1OF6A 1IZCA 1XLLA 3SY8A 1VZWA 2DEPA 4HYVA 1XIEA 2DUXA 5BXTA 5CJMA 2FFCA 3W7NA 1W31A 3N4AA 3MB9A 1EEXA 5FAJA 1UR1A 9CGTA 3T0BA 3SCUA 2EPLX 5FJUA 2A21A 3DERA 4K8HA 3VILA 4B4FA 4TXEA 4K38A 4ZQMA 3AIUA 2YXOA 5HA7A 3VGEA 4WSHA 5C9WA 1BEUA 3QFWA 2CLOA 4XBJA 4IXXA 2WO5A 1E6ZA 1PTDA 5DRIA 1XQLA 1CEOA 2JQXA 1UWIA 1O68A 1NWSA 1ZY9A 1XXXA 3K4AA 4PUNA 4M29A 1YE4A 4CN4A 1W3LA 1LQAA 4B15A 3QR1A 4WJEA 3KL3A 5E93A 3O15A 3QMTA 4UQDA 3ZYZA 1Z69A 3II1A 1PIIA 4ML4A 2FHBA 2FGZA 1X8CA 2E6FA 3KCOA 1YPIA 3QFEA 1TV7A 3P82A 5HDRA 1W5MA 2Z2AA 3G0XA 1YRRA 3QZEA 5CJNA 8RUCA 3GVVA 2VX4A 5KZEA 4LCSA 2VYOA 4P7QA 4AZHA 4JQ2A 3V7PA 4KEMA 4L9ZA 4X2PA 1AQ0A 4WOQA 3RRXA 3AIVA 1AMYA 1NOUA 3TJLA 2FMNA 4LAUA 2NWRA 1KR1A 1ZBVA 1Q4WA 4YWIA 3PNUA 1RALA 2ZZ6A 2ISWA 2V68A 1ZLPA 4C6JA 3BLKA 1JFHA 2GDUA 3WLKX 1TJ1A 4PCFA 4DWSA 3WJYA 2EG7A 2WQPA 5FKYA 4O1BA 3W7KA 3WQ5A 2DU2A 1UJPA 3OG2A 1WO2A 2OFJA 1F4HA 4IMEA 1X1OA 5DFAA 1F6PA 1Y8BA 3Q58A 4ZB0A 4JL1A 2QS8A 4UNKA 4NZ4A 3IARA 5L9FA 4NX0A 1C8XA 5DCEA 3V36A 3WQ8A 2FTPA 4NT0A 3M0YA 2OLSA 3WNLA 3FXYA 1F3TA 1UOZA 3RNDA 2PDUA 1XLMA 3VD7A 1R2SA 3SQSA 3S0CA 4N42A 3QY7A