4IISA

Crystal structure of a glycosylated beta-1,3-glucanase (hev b 2), an allergen from hevea brasiliensis (space group p41)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
316
structure length
316
Chain Sequence
b'EVGVCYGMQGNNLPPVSEVIALYKKSNITRMRIYDPNQAVLEALRGSNIELILGVPNSDLQSLTNPSNAKSWVQKNVRGFWSSVRFRYIAVGNEISPVNRGTAWLAQFVLPAMRNIHDAIRSAGLQDQIKVSTAIDLTLVGNSYPPSAGAFRDDVRSYLNPIIRFLSSIRSPLLANIYPYFTYAGNPRDISLPYALFTSPSVVVWDGQRGYKNLFDATLDALYSALERASGGSLEVVVSESGWPSAGAFAATFDNGRTYLSNLIQHVKRGTPKRPKRAIETYLFAMFDENKKQPEVEKHFGLFFPNKWQKYNLNFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-1,3-glucanase form 'RRII Gln 2'
publication title Structural analysis of the endogenous glycoallergen Hev b 2 (endo-beta-1,3-glucanase) from Hevea brasiliensis and its recognition by human basophils.
pubmed doi rcsb
molecule tags Hydrolase
total genus 103
structure length 316
sequence length 316
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.39: Glucan endo-1,3-beta-D-glucosidase.
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00332 Glyco_hydro_17 Glycosyl hydrolases family 17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4iisA00
1KBKA 3SCOA 1TZ7A 5HDRA 3CUJA 4QLLA 3ARWA 2J25A 5D8ZA 1X1NA 1CBGA 1O7AA 1XCWA 2CHNA 3IJ8A 3GNPA 5D9PA 4ZFMA 3AMKA 2CEQA 1VRXA 1NARA 1JI1A 1GPFA 4DUWA 1QNRA 1JNDA 1J0KA 1SMDA 5BXPA 4HZ8A 3WD1A 3AIQA 2V38A 1E6NA 3AXXA 1QI2A 4BQ5A 1OT2A 2D3LA 1QNPA 1ITXA 4DM2A 2VOTA 3KL5A 5KEZA 1Q6GA 1CENA 5M03A 1VB9A 1XD1A 3U5YA 1V02E 1UKPA 1PBGA 1KR1A 3RJXA 1CXIA 5A6AA 3RPMA 3SUUA 3UETA 1JG9A 3PZMA 3ALFA 2BXZA 3VDAA 1ZB5A 1EOKA 3B9DA 2WZEA 3PZVA 3VINA 3CMGA 3WQ5A 4AIOA 3ARVA 2D23A 3U7VA 3AQUA 4GI6A 5M17A 2VT0A 3CUHA 3LPFA 5E6YA 3CLWA 4LX4A 3MO4A 2TAAA 3MSGA 3CHDA 3FY1A 1H2JA 3AHXA 1RPKA 2B31A 4HZ7A 1C3FA 1GOQA 4HMEA 1MXGA 3BH4A 1JZ3A 2VX4A 2V3FA 2JEPA 4MNKA 1KR0A 1UR2A 3WH8A 1CYGA 4MNLA 1E0VA 1Q4NX 2WZHA 3ARUA 4UFJA 1K9EA 2J7DA 1F4HA 4CU6A 1OD8A 1C8QA 1BYCA 2DPEA 3SCQA 5BROA 5I77A 5ABFA 5A6BA 1XH2A 2VQUA 1UG6A 3RJYA 4XZBA 2EXOA 1E55A 1W2PA 1UYQA 3K8MA 2ZX7A 3N9KA 4ACZB 4WF7A 5I0DA 2J4GA 2MANA 1XYZA 4UNIA 1FOBA 3WUBA 2D0FA 4QLJA 2EPNA 4DWSD 1GNXA 4XB3A 1F4AA 2O9RA 2O9TA 4OKDA 1GCYA 2OWWA 1V3MA 3UESA 1CPUA 3SCPA 3OGVA 4WJXA 2AOSA 3VMOA 4DUXA 1ZL1A 1DWAM 4JHOA 3K8LA 5M5DA 4NZCA 5CPTA 3T2PA 4UOQA 2G8ZA 3MUAA 2YA2A 2BVTA 1AQ0A 2A3CA 1H1NA 3BC9A 1AVAA 1BHGA 3L4VA 3UR7A 1YHTA 1NWRA 5AY7A 4JL1A 1LL4A 1CGYA 5A8QA 4JAWA 1FHDA 5BCAA 2OSWA 5F7UA 3QGVA 2Y8KA 2J7CA 1EH9A 4CCEA 3BLKA 4ZEPA 2X09A 4B15A 3MS8A 1C8XA 4C7DA 2GDVA 4YN5A 5AYIA 4W88A 4W8AA 1C91A 2XIIA 3B9EA 1V6UA 5M3WA 5A69A 3FHQA 5JBEA 2XVGA 1BF2A 1A3HA 1E6ZA 1WDQA 1H09A 4ZENA 2CCRA 5FL1A 1HVQA 1DWFM 2ZUMA 1JZ4A 4HPGA 5BXRA 5C70A 2OSYA 3N1AA 3B9AA 3GZAA 4AWEA 4J3WA 5FD0A 2JF6A 3NUKA 3J7HA 4RE4A 1LF1A 3WEMA 3WMCA 1VENA 3K8KA 5FOOA 4AZHA 4Z2LA 5IHRA 1OB0A 4N0RA 3TA9A 2V5CA 5D9MA 2J47A 4HU8A 3O2LA 2EO7A 5ABHA 1MYRA 1WZMA 4JKKA 2WC7A 5JBDA 3PZIA 2WVSA 2UY4A 4Z2HA 5BXSA 2E8YA 4FLRA 1KB3A 2X0HA 1WZAA 2BY1A 1XCXA 3TOPA 4W8LA 4S3JA 2A3EA 2WXDM 5CJ5A 1B9ZA 3MKKA 3GDBA 3A47A 3GNRA 3WIJA 1DTUA 6A3HA 2YDQA 1NOUA 4H8HA 4DWSA 1ECEA 3AXIA 3OG2A 1W3LA 2XFYA 2X8RA 1SMAA 1NH6A 2DDXA 6TAAA 1HNYA 2J7FA 3WEZA 1QW8A 2OLHA 4OZOA 1GQKA 2UY2A 4W7VA 1JZ2A 2WVUA 2QMKA 3AICA 1W9VA 4MJ2A 3VD9A 1HJWA 2XVNA 3KE0A 2BVYA 1UQYA 5CXPA 4TXEA 1TVNA 5I78A 1EOMA 4QFUA 2JEQA 1JDAA 2WMKA 4WKFA 4ZE4A 4GQQA 1BGAA 4P7RA 2VCAA 3L2MA 1V0NA 4EANA 5ABEA 2D22A 3WF3A 4AZIA 1QHPA 1VFFA 3SUWA 1EHNA 5A2BA 3QHMA 3W28A 2FH6A 1JIBA 2XSBA 1XSIA 1BYAA 1KGXA 4D1IA 4TVUA 2YJQA 3SCWA 3ZOAA 3IAQA 3DECA 2G4FA 2BV9A 3GXMA 5BWFA 2ZX6A 2QV4A 1E6QM 1ZJBA 2WZIA 4LQ1A 3WQ4A 5EBAA 3WF4A 3WFZA 3WENA 4TTGA 2DEPA 3D5HA 3VVGA 4BQ3A 4YHEA 1QNOA 1NWSA 1RP8A 1KXHA 2BS9A 1K6AA 4PRWA 5DO8A 1CTNA 3WDIA 3GXIA 4H2CA 4ATDA 1QVBA 3L4UA 4CU8A 3OB8A 1QW9A 2NT1A 2BY2A 5I79A 2DSUA 4XUYA 1V3KA 4H04A 4B16A 4MADA 3BAYA 3OZPA 4V27A 2PF0A 2V3GA 4JFTA 4JHZA 4J28A 2WM0A 3II1A 5I24A 1QHOA 3VGBA 1H41A 1BYDA 2DT1A 1C93A 3ARRA 3VDCA 3AJ7A 3AHZA 3GBDA 3WNOA 1MW2A 3KEHA 1B3ZA 1HN1A 4JCLA 3AS1A 2PWGA 4PTMA 4J3UA 1D3CA 2WHLA 1W9DM 1MW0A 1C7SA 1UD3A 2DGAA 4AD0A 2C8NA 2XSAA 4Z2GA 1B30A 5ABGA 4W89A 4AZCB 1U33A 1MQPA 4MJ4A 3DYPA 4PUEA 4KRUA 4CN6A 1DHKA 1CGUA 2WLZA 1UD4A 4M1RA 4D6FA 1CIUA 2ZX8A 1ISYA 3F4VA 3DC0A 1TG7A 3CZEA 1LWJA 3HJEA 3OLIA 4J7RA 4W93A 1PZ3A 4GZIA 3WNNA 4AZGA 4QDMA 3GBEA 3AHTA 4DUVA 4AY1A 3SCRA 2BHUA 1GQLA 1QI4A 1UR0A 3CMJA 4PYSA 4UQAA 7CGTA 5I5RA 4LYQA 3B8SA 3ZT5A 1W3JA 3WQVA 1NM9A 1W1VA 1TR1A 1VF8A 1FHLA 2W61A 3BXWA 3W81A 3IANA 3VILA 2IUZA 1WDSA 2W63A 4PSRA 1OD0A 3ARPA 3MV01 1J0HA 1QHZA 2CPUA 4HA4A 3ZIZA 2VI0A 5A95A 2BHZA 1WDRA 4UFKA 1QI3A 1J01A 4B3LA 2QPSA 3L4WA 3OZOA 4W5ZA 3SEPA 1Q6EA 2WWDA 2ZXBA 1Q6DA 1UR4A 5CZKA 2ZX5A 2VZOA 4AXNA 3G6LA 1E6XM 3AIWA 1UR8A 2ZXDA 2UWFA 3VGGA 4KMQA 3THCA 1TFVA 3BCFA 4PMQA 4BS0A 1E5NA 1CXKA 3SUSA 3WDRA 5IXEA 2GSJA 4WSJA 3RM4A 4H8UA 3EMQA 3A3HA 3N17A 2O9PA 2A3BA 1NP2A 4CD7A 1D2KA 2GK1A 2C0HA 4NRRA 2X05A 1EXPA 4XZWA 5E9AA 2JIWA 1R87A 1VEMA 1JZ7A 2E9MA 1A47A 3WF1A 2WMJA 2XM1A 1HKJA 1PX4A 3NIYA 1BTCA 1W3HA 4WIWA 4IM4A 1UR9A 1E1FA 4BF7A 3BAKA 3AYSA 3VX0A 4PTWA 2WK2A 1AQMA 3ZT6A 4EE9A 3MANA 5LA1A 1VFMA 4IPLA 3UR8A 4CVWA 1JZ8A 1J18A 3ZSTA 3DHUA 1V3LA 1W9UA 1QBBA 2BY0A 2WHJA 3OLEA 2WKLA 1B3YA 1JYXA 2WWCA 3ZR5A 3QR3A 1C92A 1ODZA 2ZWYA 1XSKA 4NF7A 4UTFA 2BFGA 1GOWA 1UQZA 4D6GA 1PIGA 1W1TA 3N15A 3W0KA 2EPLX 3TTYA 1UKOA 3FNDA 3WBEA 4W84A 3M7SA 3GTNA 1E43A 3PHAA 3ZQ9A 3AIBA 3WF2A 2F8QA 1QI0A 4B3KA 3KZSA 1H4PA 2YL9A 3OA5A 2VO5A 1HT6A 3PTMA 3VM5A 2X0YA 5A6MA 4GO8A 3W37A 2UY5A 3LPGA 1PEZA 3UEQA 4AD5A 5CPSA 5HBFA 1E6SM 4KGLA 3GXDA 1W3KA 2PB1A 5CGMA 2YA1A 3WKZA 3SCSA 1BVNP 5D9NA 3WMBA 4M80A 4MB5A 2YL8A 5FCZA 4FF5A 3E1F1 2WMFA 2XFRA 2D0HA 2YLLA 5A1AA 1OGGA 1UHVA 1E4LA 1JXJA 3NSXA 3AMGA 2CERA 3KL3A 1M7XA 1BYBA 2WC3A 5EB8A 3NCOA 4M81A 3VNYA 3VGEA 4A3HA 3RILA 5I2UA 1MQQA 3W53A 3EDJA 1UUQA 3WDQA 2WANA 3FAXA 4PN2A 3QHOA 2GVYA 3ZSSA 1UWUA 4AD3A 3N13A 2JE8A 4FMVA 3ZT7A 1BGGA 2OYMA 1FH7A 5I3DA 1SYTA 4AMCA 2G3MA 3RMEA 4KGJA 3WEOA 3WELA 1UKQA 1P6WA 5D4YA 1TVPA 1J10A 3W29A 2JFEX 2YLAA 3F5LA 2YBUA 1LG1A 4PMNA 3PZNA 3N11A 3NDYA 4DWSB 4XV0A 1V6XA 4TVDA 4OBSA 2VRJA 4R5EA 3WNKA 1B90A 4HP5A 4MNJA 2PWDA 3WD4A 1JYNA 1X6LA 3VGFA 1HXJA 4F9JA 1DEDA 1M53A 4HA1A 2XGIA 1C90A 1MWOA 4LPCA 1TA3A 1JD9A 3FXYA 1U2YA 2BNJA 4P7NA 4WSKA 1JF5A 1GOMA 1NOWA 1UH3A 3WD2A 3AIVA 2EQDA 2E8ZA 4BCEA 2DSKA 5CPQA 5A2AA 3MV11 1PPIA 1H49A 4JCMA 1ZBWA 2FGZA 2PWFA 3CZ8A 5FL0A 4UOZA 4CKQA 4F79A 3WUFA 2CBJA 3MSDA 1UD5A 1KQZA 4LYPA 1XC6A 1B3WA 3WNPA 1HJSA 2OWXA 4P8UA 4L4OA 3IJ7A 2CKRA 4RE3A 4B9ZA 3EDDA 3GH5A 1GW1A 1CEOA 3OIHA 1CGXA 1G5AA 1GJWA 1HKKA 4OUEA 4ZXOA 1W9BM 4D6JA 3SUVA 3CGTA 2E9BA 5HPOA 1EDGA 5AYBA 1W1PA 1LG2A 2GJXA 5D9OA 5IFTA 5E0FA 1MFVA 1V6VA 1KFWA 1KWGA 1G94A 5DT5A 1BVZA 1N82A 1CXHA 1UKTA 2WMIA 3U7BA 5DF0A 4U3CA 1PJ9A 9CGTA 1ZBKA 1CGWA 2WW5A 3VO0A 1R8LA 3TONA 2DSZA 3AS0A 1UWSA 1GONA 2XVLA 2WMHA 1RH9A 5CG0A 4HMDA 1JI2A 2XIBA 4E8CA 1IZJA 1B0IA 1IZKA 5E0CA 3SCTA 2DH2A 1ZS2A 3VD7A 3WSUA 4AEFA 3ARZA 1UH4A 2WNWA 4BZYA 1H0IA 1JXKA 1HJUA 2O92A 1GQIA 4M82A 2V5DA 2WPGA 3W25A 1UZ1A 4D71A 3CPUA 4MPKA 4Q22A 1E73M 4HU0A 2G41A 3S2CA 3VU2A 1X6NA 1G01A 3F5JA 3CH9A 4AZ6A 4H7VA 4E2OA 3LMYA 2QLYA 5A6KA 1S46A 3VIHA 4HOXA 2QHAA 3N04A 5CSYA 1WPCA 2Y5EA 2GFTA 2WCGA 1QOXA 4CUCA 3A6OA 3L4YA 2G3NA 1H11A 3LPPA 5EFDA 2XUCA 1JF6A 3QHNA 2BY3A 1ODUA 4D6IA 2W92A 1E3ZA 3WNMA 3AS3A 1CECA 6CGTA 2CBVA 2YIHA 4WKHA 3PTQA 4TVCA 1VFOA 2VZVA 4C7GA 3VD4A 3AHVA 4RL3A 3CZKA 1GVYA 3AS2A 4MB1A 1H5VA 2DT3A 1US3A 1WO2A 2WLYA 1LWHA 3MU7A 3N18A 1LQ0A 3MUY1 3SCNA 5CLTA 3AROA 5JUVA 4ZE5A 4KH2A 4YPJA 1VEOA 3FN9A 1GOIA 4E8DA 2QMJA 3WDHA 1SFSA 4MAVA 3VIGA 1R7AA 2Z1SA 2DSVA 2HISA 1B31A 2VJXA 3PTKA 3CUIA 1FP8A 4AEEA 3UG5A 2F61A 1XD0A 1J0IA 3U57A 4U31A 1XV8A 3K4DA 1WAWA 2VZSA 3BCDA 3WY1A 2FHCA 3PZ9A 4OOZA 2WCSA 1NQ6A 3AOFA 3PZTA 4PTXA 3VPLA 1VEPA 4E4PA 4TX8A 2XM2A 2CESA 4W86A 3U5UA 1OT1A 1HVXA 4AIEA 1B1YA 1IV8A 8CGTA 1WB0A 4JFVA 4PUDA 2XWDA 1QPKA 4P7LA 2G3JA 1PIFA 1JD7A 1K9DA 5IDIA 5JBFA 1CLVA 1PX3A 2XFFA 4FLQA 1CZ1A 2CHOA 2XGBA 1E4NA 4PCSA 2E3ZA 3GH4A 3M07A 1AMYA 1VJZA 3VMPA 1C8YA 4UFIA 4DWSC 4EKJA 1XHGA 3EDFA 4QCFA 1KXTA 1PZ2A 3AMDA 1QNQA 2CYGA 4F8XA 1V03A 2YA0A 4HPHA 1WP6A 3APGA 2VURA 1GHSA 4MB3A 1WNOA 3CZGA 1HKMA 1E6RA 1FP9A 1E9LA 2VZTA 4UCFA 1W91A 4UQ9A 3HN3A 4TUFA 2D2OA 3AZRA 4RE2A 5FKYA 1I1XA 4KRTA 3GM8A 2DQXA 2DT2A 4CCDA 1OCQA 1M04A 3WFLA 3ZJ7A 3EMCA 2DT0A 3W4RA 4D6CA 1NOFA 1QNSA 4J27A 4UQEA 3WL1A 3EDKA 2YDSA 3WL0A 1E3XA 3TP4A 1WKYA 1OGSA 5LA2A 4LXFA 1ISWA 1VBRA 1HL8A 2G3IA 3W24A 2XWEA 5EMYA 4U5KA 4Q7NA 1KCKA 3WN6A 5I6SA 1XH1A 2RGLA 1K9TA 3RIKA 2CIPA 3KWXA 4AC1X 2YL6A 3DHPA 3WD0A 1CWYA 2WAGA 3BAWA 1EA9C 4CN1A 2J7HA 4AW7A 1XGZA 5CLWA 2E4TA 1CLXA 4MDPA 3ALGA 7A3HA 1JFHA 5TD4A 3I3DA 2D3NA 3I3BA 5DFAA 2J8GA 3VD3A 1W1YA 1UD2A 3WBAA 1G1YA 1OIMA 3CHCA 2NT0A 4ATWA 1E5JA 1JGIA 1TCMA 3BSHA 4B9YA 2A3AA 3NSNA 3F5KA 1E0WA 4GO9A 4CN4A 2VVNA 3WDPP 3L4TA 2PBOA 4AD1A 4LYRA 2D24A 3ZM8A 4AD4A 1O6IA 1CXLA 4PMDA 2ZX9A 3VOCA 1BAGA 2OYKA 5ABFB 1V3IA 1BG9A 1FA2A 1JAKA 1UWQA 3NSMA 3T2OA 2VNCA 3VMNA 5GPRA 2Y2WA 4GXPA 3WMSA 4A3YA 3WH5A 2E9LA 3WH9A 2VX5A 2XYLA 1E0XA 1UOKA 1CGVA 7TAAA 3SIMA 3GXFA 5HPCA 4X0VA 2J79A 4QCEA 1TA3B 2D20A 4CU7A 4UFHA 4OBRA 3VIFA 1VFUA 3G6MA 5ECUA 5HXMA 2E40A 4P8WA 2NSXA 1CDGA 1PAMA 1C7TA 4UQDA 4WKAA 2ZICA 3M6DA 4H41A 1EHAA 3VKKA 1R85A 3S6TA 1ISVA 2VCCA 4W5UA 2EJ1A 3W6MA 2CXGA 2WHKA 1V02A 4M8UA 5DEZA 1OINA 4AZ5A 5IFPA 4CD6A 3DYMA 2WKGA 3CUGA 4PMUA 1XH0A 2WHMA 2CITA 1ZU8A 4HTYA 2ZUTA 2VRQA 4ZXLA 5DT7A 1E71M 2V3DA 4HMCA 3WUGA 1V08A 5A3HA 2GJXB 2XHYA 2BXYA 3FW6A 3AMLA 4W85A 1B3XA 1K9FA 3ECQA 3VIPA 2WMIB 3OGRA 1UWIA 5BRQA 1QI5A 3WDJA 1TE1A 1CXFA 1EDQA 4GPNA 4GKLA 1GJUA 4TOQA 3CO4A 1GORA 2HVMA 4P8VA 1UA7A 4OOUA 1JFXA 4UOJA 1HJVA 1CNVA 2VL4A 4PCTA 3A4WA 1OGBA 2W91A 2FH8A 3ZJ8A 1HIZA 3K4AA 5HNNA 1KXQA 3THDA 2WBKA 1JDCA 1YQ2A 2F2HA 2GJRA 5C71A 4Y7EA 1UH2A 4P7OA 2PI6A 2OWCA 5A8MA 1ITCA 2J7GA 5AC5A 1BLIA 2Y8VA 3OBAA 3NYDA 5E09A 2VRKA 4UQCA 2IXUA 1L0PA 1H0GA 1DWJM 3MUIA 3EBVA 1V6YA 3ARQA 1V3JA 4U33A 2YBTA 3W27A 4Z2KA 2W66A 4OIFA 4ML4A 2EPKX 4UQBA 4JFUA 2X1IA 3UCQA 3VIIA 4EK7A 1EGZA 4EAMA 1SR0A 2AMGA 1E56A 1DWGM 3WNLA 4S3KA 5FIPA 4D1JA 4JIEA 3RDKA 2WSPA 2VUYA 3FHAA 2W62A 2JALA 4CD5A 2XG9A 1RD6A 4PMZA 1G0CA 2VZUA 1E40A 4NI3A 2ZXAA 1US2A 4JFWA 5D8WA 3VNZA 2W4XA 3VIKA 4MAZA 4D6HA 1XYFA 1BQCA 5GQBA 2NW0A 3A4AA 2DIEA 2J7EA 3VDBA 3SCUA 2DIJA 3SURA 2WVVA 3GYCA 1E70M 4GI8A 4ACYA 4AZ7A 3HMCA 1D7FA 3VIMA 2A3HA 2ESCA 2XPKA 3BAXA 1VJSA 4KWUA 2GUYA 4U3AA 2QF8A 4M56A 3PBGA 4UZUA 4GZJA 1JYWA 4UFLA 4D6EA 1BFNA 4K68A 1E15A 1OSEA 1ISZA 1UZ4A 4D6DA 3VIOA 4IPNB 1EDTA 1EQCA 3CZJA 1W32A 3N12A 4W87A 3VUPA 4ATLA 2D0GA 1HJXA 4A4AA 2BVDA 2WYSA 3I3EA 1GOOA 1VAHA 1J12A 1E4MM 3PN8A 1KXVA 1FFQA 1JDDA 3UG4A 2WB5A 2XVKA 1M01A 3VIJA 3OGSA 3PZGA 4JKLA 4PMOA 2Z1KA 4J3VA 3WH6A 2J74A 3AIEA 1B2YA 1I75A 3ZO9A 4U2YA 3CIVA 1V0MA 3CBWA 3W82A 1TMQA 4BA0A 3BMWA 2Y24A 3SUTA 2VX6A 5BYWA 3AHYA 2J8FA 3WF0A 2YL5A 4WK9A 3IJ9A 1XSJA 3VM7A 3AYRA 3VD5A 3VTRA 4V28A 4IUGA 4F66A 3D3AA 1MVYA 2VC9A 2J77A 1OBAA 1Z32X 3RM9A 3ARYA 2BHYA 1Q6FA 3T0AA 3T09A 3VGDA 1E1EA 2PWEA 3BMVA 4Z2IA 2VVSA 1MXDA 2FDMA 2X2YA 4UFMA 2W5FA 3MMDA 2RGMA 3RO8A 3UG3A 4JL2A 1XRVA 3K46A 3ZJKA 4CVUA 2OSXA 1GHRA 2WBGA 3CHEA 2CETA 2ZE0A 1MFUA 2VCBA 5A6SA 2EPMX 2OYLA 2ZUVA 2QPUA 4U5IA 3NJ3A 1WE5A 3EYPA 3MUZ1 3PZUA 3AISA 2JIEA 3ZR6A 4ACZA 1KBBA 2XJ7A 1HKIA 2IXVA 3BGAA 2AAAA 1J0JA 2VX7A 1ISXA 5JIPA 1VBUA 1Q6CA 2PC8A 3PZQA 2CNCA 3CTTA 3AIUA 4M24A 1W9XA 5A2CA 4FK9A 2EEXA 4V2XA 5GNYA 1IT0A 1R7OA 1UKSA 2Y4SA 1GUVA 4HOZA 1JZ5A 2DSWA 4PTVA 1KQYA 1BSIA 1DWIM 2E0PA 2WMGA 1PX8A 5GNXA 3RCNA 4AYSA 2GK1B 1V0KA 1W9PA 3DYOA 3T0BA 3ZJ6A 2ZWZA 1OM0A 4HZ6A 4CD4A 3BAIA 3AMCA 3IK2A 5E6ZA 3CHFA 5EFFA 3VX1A 3WQ8A 4PMVA 5KZ6A 3BLPX 1V3HA 2WC4A 5A94A 3LPOA 3WQ6A 3TTSA 1EIBA 4F9DA 4Z2JA 1MW3A 1JAEA 3HU7A 2ZOXA 4WLCA 3OLDA 1CXEA 5BXTA 2EBNA 2CBIA 1Y7VA 2JF7A 4C7FA 1UWRA 4R27A 2PBGA 2J75A 1HP4A 3O9NA 1MQRA 2WSKA 1TUXA 2J62A 1U30A 4TX6A 2UY3A 3M46A 2ZUNA 4UR9A 3L4ZA 2ZUUA 3RM8A 4N42A 1V0LA 2ZUWA 5A8NA 5BRPA 3EMZA 4URIA 3AXHA 2GJPA 4NRSA 4GIAA 2CKSA 1FH9A 4OJYA 1B3VA 1DP0A 1MW1A 2ZXQA 4TTUA 1J11A 4GI9A 4CCCA 3CZLA 2W67A 1LL7A 3BSGA 2YKKA 4X9YA 4MNMA 4FLSA 3AI0A 1WZKA 2FHFA 3L2LA 1DWHM 1JL8A 4AZBA 1FFRA 2FGLA 3WH7A 2EPOA 5IHSA 2XTKA 1UWTA 3OLGA 4W7UA 3ARXA 4PBGA 4PEEA 3W6LA 1KWKA 1ZBCA 3AZTA 3JUGA 2V3EA 1LLOA 2VQTA 1GZJA 3ARSA 5CSUA 4JFSA 1J0YA 1RP9A 4JKMA 4W7WA 2WCAA 3EDEA 3K1DA 3ARTA 3NDZA 4MB4A 3PZOA 4QLKA 4PSPA 4DM1A 2VR5A 2ZUSA 1E4IA 8A3HA 4PMYA 1HL9A 1KGUA 3O6AA 1BG4A 1EQPA 5DMYA 1ZBVA 1L8NA 5LA0A 4CGTA 1WZLA 4W8BA 3TTQA 4HA3A 3SCVA 5C8BB 5A6LA 5LYRA 2FHBA 4L4PA 1HX0A 4H8VA 4IISA 4X0NA 4GQRA 1UD6A 5CQ1A 4HOWA 1HP5A 1E72M 2DH3A 2J78A 1GVIA 1FH8A 1J0ZA 1M03A 1R86A 1H3GA 2VR4A 4J3SA 3GH7A 3WQWA 4P7QA 3GNOA 2GDUA 1LJYA 4BQ4A 1G9HA 1HF6A 4LGXA 4M29A 4D72A 4AIUA 4J3XA 3T08A 1OWQA 4GZEA 3W26A 3T0DA 2D1ZA 4GINA 4QP0A 4CD8A 5I23A 4FLOA 1HJQA 2XVPA 4JZ5A 1I1WA 1WDPA 3AZSA 1JZ6A 1ZJAA 3MMWA 3CUFA 1LL6A 4XX6A 1KGWA 3VGHA 2O9OA 4MTVA 4AISA 4YHGA 3AFBA 2Q8XA 3VDHA 1JNEA 1VIWA 1E6PA 1QBAA 2ZIDA 3L4XA 2J7BA 3WD3A 1KCLA 2C7FA 1UA3A 4BQ2A 5A6JA 1GQJA 1JYVA 1NWUA 5JIWA 5GNZA 2VTFA 4P8XA 2PWHA 3ZMRA 2VMFA 4PMRA 3BAJA 4NSBA 3FAWA 3POHA 1W2VA 1UR1A 1EO7A 2WVTA 1V6WA 3AIRA 1CGTA 3A4XA 3QOKA 1WCGA 1EO5A 3KL0A 1NP0A 4QAWA 2CBUA 5A6BD 4J3TA 5A8OA 4U2ZA 2WVVB 3UERA 3IAPA 4UZSA 3MMUA 3TTOA 5A8PA 1NWTA 4PMXA 5HOSA 3QOMA 1BPLB 3POCA 4MDOA 4AZCA 3W38A 1GOKA 3T2QA 2YDRA 1J9YA 3WUEA 4AD2A 1ESWA 1AQHA 1UD8A 2YOCA 5E70A 1OIFA 5AC4A 5CGTA
chains in the Genus database with same CATH superfamily
1H7OA 2P76A 2P88A 4HK6A 1X1NA 3V1PA 4US6A 1CBGA 1O7AA 1XCWA 2YSWA 3RUBL 3AMKA 1QWKA 4LV4A 4F0SA 1NARA 3CB3A 3Q45A 4NJKA 1JNDA 4L1XA 1V93A 3SY5A 3LDVA 4HZ8A 2V38A 2C6QA 3W87A 4BQ5A 2VOTA 2DJLA 1Q6GA 1XD1A 3P8JA 3THQA 1KR1A 1CXIA 1G4PA 1YDVA 3H2FA 4PTDA 3UETA 2QJHA 1JG9A 2PLJA 5MKGB 4LVFA 3B9DA 3LXAA 3VINA 3PM6A 4DPPA 1BWKA 4UUIA 3MCNA 4BK9A 3JZUA 3ARVA 4NG3A 4GI6A 5M17A 3CUHA 4H2HA 1FHUA 2NQJA 5D2YA 1IT8A 1PIIA 3FY1A 3LZ5A 3E6EA 3IGUA 1AD4A 2B31A 3FA3A 3S9ZA 3BH4A 1JZ3A 2WNNA 4MNKA 1A0DA 1UR2A 1CT5A 5LIWX 4O1EA 1CYGA 4MNLA 2WZHA 5IRPA 4BEUA 2J88A 4GY1A 1F4HA 1FWFC 3BDKA 4N4QA 5BU9A 4H9UA 1C8QA 4ZODA 5BROA 5I77A 5ABFA 5A6BA 3LBMA 4A8NA 3NZQA 1UUOA 3KWSA 1E55A 1W1ZA 1W2PA 2OB3A 3GC2A 2BTMA 3WQGA 4ACZB 3R6IA 3WLNA 2O4QA 5TNVA 1GNXA 1F4AA 1DIDA 1GCYA 2OWWA 1LUCA 1V3MA 1T7LA 2QCLA 1WKEA 1H7NA 3ABSA 3VMOA 3L67A 1DWAM 2CLFA 3K8LA 3D6NA 5CPTA 4ZMGA 4IFOA 4YU1A 2BVTA 4FIQA 1L9WA 2OJPA 2QDDA 3BC9A 3FVMA 2X42A 1YHTA 1Q7QA 4ADSA 3RMJA 1DJGA 1CGYA 1VBJA 4L4LA 4JAWA 3L65A 2OSWA 5F7UA 3MZ2A 2PD9A 3W72A 4ZEPA 4HNOA 1Z8AA 4YN5A 1WOAA 3W7CA 2VWTA 3W7RA 3K30A 5DMNA 4X9SA 3B9EA 3CEPA 1SW7A 3FHQA 3IJIA 4H6RA 1E6ZA 2HEJA 2QT3A 2DJXA 2P3ZA 1JZ4A 4HPGA 2R1KA 4AWEA 4CQAA 3W07A 3IRDA 3J7HA 3L12A 3G77A 3VCCA 3KM8A 3WEMA 3K8KA 3BE7A 4G5DA 1OB0A 3O63A 5D9MA 4F0MA 5BRBA 2J47A 1K02A 2WKJA 4XVDA 2VFDA 1MYRA 1OFPA 3QW4B 4DJFC 2UY4A 2E8YA 2W0UA 4JY8A 1KBIA 4FLRA 2POTA 1E9YB 1E9IA 2BY1A 3W23A 3D46A 4DO5A 2A3EA 1C29A 2D2HA 4AWTA 1B9ZA 1OFAA 3MKKA 4HQVA 4MUZA 2QPXA 3NXFA 1H7WA 3A47A 1TTPA 3RFAA 2I9EA 3GNRA 3AUJA 1VLIA 1M1BA 5KSWA 2FGBA 4BFAA 1S2UA 3LLXA 1W3LA 2BWGA 2XFYA 3NZPA 2DDXA 2OMAA 3ELFA 4BF9A 2GJNA 4FPSA 1Q85A 4W7VA 4KKXA 4LB3A 3AICA 1JJKA 4EACA 4MJ2A 5D38A 3B8UA 2NX3A 1XJBA 2Z7GA 4H9XA 1UQYA 3W73A 2E68A 1GG1A 4FAMA 3L5MA 1EOMA 3L21A 3M43A 4LUSB 4ZE4A 3MP3A 1RZMA 2VCAA 5EY5A 1WXJA 5ABEA 2D22A 1EEXA 4LAKA 3UY7A 1QHPA 3S42A 1D3GA 1SU5A 3FEMA 1E9ZB 2XSBA 4XTIA 4TVUA 3DG7A 3HQNA 2CHRA 3VE7A 4PH6A 1R47A 2GWGA 3E02A 4GY7A 5IM51 5BWFA 2BX7A 4ZO8A 2DZVA 4QS5A 3WQ4A 5AECA 3WFZA 2WNQA 1TMHA 3VVGA 2HQAA 1RP8A 1KXHA 2BS9A 5H8MA 3GHUA 3MI6A 1TUFA 4QE5A 4DY1A 3KS5A 4RPPA 4NYYA 5H8UA 1KKRA 4G56A 1MRAA 1V3KA 4B16A 2A7NA 3S1VA 5AHEA 3IVTA 1QHOA 3B3DA 2BODX 1C93A 2DT1A 3ARRA 3M47A 4XIAA 3GBDA 4ICCX 4AAJA 5JQ9A 3KEHA 2VFFA 2PTWA 4NJJA 4RCXA 1DPMA 1C7SA 1ZJHA 3MA8A 1YPFA 3EKGA 4XAZA 3M7WA 4X60A 4O53A 4HHHA 4KT2A 3FCPA 4GIYA 4Q6JA 4LT9A 1MQPA 3TE9A 3DYPA 3QZAA 4CN6A 2NX9A 3PVFA 4M1RA 4JTDA 1N8FA 2KZHA 1TYGA 5AZ1A 1L6FA 1FWBC 4NXSA 4FNSA 5REQB 3GDRA 3CV6A 3EWCA 1FHVA 5AHFA 1R38A 4K1GA 2HK0A 3RHGA 4UTLA 3KRZA 3SCRA 1UR0A 4POCA 4LSBA 4XG1A 4L1WA 3RU6A 3ZT5A 3KRUA 1J2WA 4GH1A 3UXKA 1RPXA 3W81A 3IANA 3CL6A 3VILA 3G1SA 4DBUA 1I2PA 4A8IA 4PSRA 3ARPA 2CPUA 4JTGA 2VI0A 3DESA 3UCCA 4DQWA 2V5JA 3EX2A 3M0MA 3OZOA 2ZXBA 5I03A 1UR4A 1OF6A 3QSRA 5CZKA 1Q6LA 3RAOA 3G6LA 1NSJA 1Q45A 1UR8A 2ZXDA 1O60A 2EG6A 2V2DA 1TPVA 4B2DD 1JULA 4B5VA 2PLKA 3LK6A 3QH2A 3GTXA 5IXEA 3W7PA 4H8UA 1XDMA 1V5XA 3BMXA 1QR7A 3S1GA 4IWWA 1NP2A 1OVDA 2PMQA 1D2KA 2C0HA 2DQWA 2OGYA 1JZ7A 2E9MA 2PGFA 1SZGA 2XM1A 1W3TA 3U2OA 1S5TA 1J6OA 1UR9A 3PBUA 4YWSA 2FZMA 3GDTA 3VX0A 4C1NB 1GWJA 1IR1A 1VS1A 4H4IA 3ZT6A 8RUCA 4EE9A 4D8ZA 4S3FA 3M5YA 4U28A 5HR7A 1KM1A 4E4FA 4S3GA 2DVUA 5TBOA 3DHUA 1W9UA 3UXAA 1B3YA 1VYPX 4M19A 4UTUA 3TWBA 1DJZA 3QR3A 3N2TA 4C6NA 1I45A 4L61A 4NILA 1MXSA 4UTFA 3KX6A 3BURA 3UZYA 1PIGA 2G4JA 3KUMA 3TKFA 4OVXA 3TTYA 1JGMA 2I17A 5HMEA 4BI7A 3WF2A 5PTDA 4B3KA 3BOXA 3MT1A 2D73A 1EEPA 1TIWA 1RK6A 4PRRA 1HT6A 3T8QA 3VM5A 2INEA 3C6CA 1B57A 2LLEA 1RD5A 3QPYA 4M6UA 3OVRA 1TV5A 5HINA 1E6SM 1ONRA 5FAJA 3YPIA 2VD9A 1NF7A 3GXDA 3EKLA 1W3KA 1YIXA 1ZHAA 3GUGA 5D03A 4JX5A 2NQ9A 5D9NA 4M80A 3LZ3A 2WMFA 2XFRA 3UJRA 5CZJA 2YLLA 1UHVA 1JXJA 4FNRA 3G2GA 1M7XA 1TV4A 4JIQA 1TV8A 5EB8A 1OX5A 1X7FA 3DN5A 3I7RA 5BMXA 1UUQA 5BU6A 1SJCA 3T8LA 2GVYA 2PDFA 4J5NA 2O0TA 4AD3A 1VR6A 3R11A 3ZT7A 2OYMA 1FH7A 3GXTA 4IICA 2PEVA 3NQBA 3WBWA 2WPBA 1VPQA 3N29A 2JFEX 2YLAA 1PB0A 4CQCA 1WDDA 5LHFA 3WQFA 3Q2DA 1R30A 1J8VA 3N11A 2ICSA 3FA4A 3HMJG 2A21A 3LSCA 2HNEA 3GHSA 2R1MA 2PWDA 4YWIA 3WD4A 2GDQA 2F6UA 1DORA 1NQKA 1X6LA 6REQB 3TWAA 1EF2A 1MNSA 3OEXA 2XGIA 2BOEX 1TA3A 1U2YA 4QXIA 3NM3A 2OLAA 1DTNA 4P7NA 4QRNA 4RDZA 1NOWA 4G8TA 3WD2A 4BCEA 3FJ4A 3DFPA 1XISA 4HA0A 3TYAA 4QAIA 1GYNA 1H49A 2VHLA 1ZBWA 1EGMA 2FGZA 4WEVX 4QITA 4HHMA 4CKQA 3QEZA 4LYPA 1DE6A 2ZZ2A 3E5PA 4KS0A 1YDNA 1HJSA 2V5BA 2Z2UA 4P8UA 4L4OA 3IJ7A 2CKRA 3EDDA 3GH5A 4DJDA 1GYLA 2WOQA 1I2NA 3BZJA 1GVRA 4ZXOA 1HKKA 2DZXA 1DBTA 5AC6A 5D2WA 4O54A 5HPOA 2XH0A 5CKSA 1Z7AA 2QCMA 4O17A 5AYBA 4N9CA 5D9OA 4Z0JA 3LHUA 1KFWA 1KWGA 1G94A 3BK0A 1N82A 1UKTA 2WMIA 1ZBKA 1RY0A 4A3UA 2YB1A 4LH8A 1BWVA 3OIXA 5FF7A 2EPHA 5DXYA 1UWSA 3DG3A 1RH9A 4HMDA 1TREA 3MSYA 3MY9A 1IZJA 2D69A 1IZKA 5HMFA 1YLVA 3LTSA 4MLRA 1LLWA 2OCZA 1I0DA 4CQBA 1B4KA 1W8SA 4M6VA 4BI6A 3EKZA 3P0XA 3SR7A 2VC5A 1US0A 2F84A 4BZYA 1AK5A 2XDFA 1KC7A 4M82A 2WPGA 4D71A 3LX9A 4XAYA 2P53A 3W1QA 1XGEA 2YX0A 4R7WA 2FFCA 4H7VA 1M7PA 4OV9A 4CNUA 2EG7A 3EXRA 1GVOA 1P1MA 4UWMA 3R79A 4HOXA 2QHAA 4AWUA 5CSYA 1WPCA 4MOZA 4F0LA 2WCGA 4L6OA 2Z29A 1UBSA 3K5XA 5EFDA 5U7SA 3SGGA 3W02A 4J2MA 3CM4A 2BY3A 4H8NA 2ZC1A 4ZQOA 1ODUA 1ME7A 4D6IA 3RLVA 3VNMA 1E3ZA 3DZ1A 4YLWA 3AS3A 1CECA 3L9CA 2DU2A 1K7FA 3BGGA 2PGEA 3BPWA 4RL3A 3NOYA 3CZKA 4YTSA 4O0KA 1US3A 1YADA 3F4CA 1LWHA 1K1DA 3KCOA 4G9PA 4E0CA 2E1DA 2E67A 2HMCA 3SCNA 5CLTA 3AROA 5JUVA 1DKWA 3TK7A 2W6RA 3BW4A 3TMQA 3QV6A 3H24A 5EMJA 1IEXA 3WDHA 1E1CB 5A6TC 1XRTA 4OT7A 3CUIA 1TJ0A 2NLYA 3VDGA 3TXZA 4MF4A 2NX1A 1J0IA 2PD5A 3K4DA 2DUXA 1V4YA 6XIMA 1JCXA 2B81A 3PZ9A 1NQ6A 4S23A 3S6DA 4L4MA 1W37A 1O5XA 4LUYA 1Q6RA 2CESA 2AGKA 1HTIA 1CX9A 4AIEA 2C71A 8CGTA 1TWIA 2GQAA 3OJGA 5L9FA 4P7LA 1YDOA 4MG4A 4LRSA 4W9TA 3S2LA 5IDIA 1CLVA 3KOXA 3H23A 4LFYA 4FLQA 1PKYA 1XGDA 2XGBA 1A5CA 4WY0A 3DKJA 4C6CA 4NY2A 1P7TA 2DVTA 3UY8A 1XXXA 1AMYA 2YYTA 3DENA 1VJZA 1C8YA 4UFIA 3C56A 4EKJA 4QSFA 3AMDA 1QNQA 4JTJA 4Y9NA 4F8XA 4HPHA 2VURA 1TQXA 3LCIA 4MB3A 4A3QA 1AH0A 4QG9A 3RO6A 4PMJA 4XD5A 4GVFA 3URBA 2P8BA 1W91A 3WLQA 4UQ9A 4TUFA 3AZRA 1KRMA 2TODA 2PDPA 1A5AA 3P67A 4O4VA 1A5NC 4KRTA 2DQXA 5K9CA 1GEHA 3WFLA 4I3GA 4ZO6A 4XD3A 1P48A 3EMCA 1R3VA 3XIMA 3OVQA 4V1YA 2HBVA 1V6TA 2JKEA 3S5ZA 1EX5A 1XM3A 1QNSA 4J27A 4DPQA 3XISA 3EDKA 1E3XA 1L6SA 1ISWA 5C2XA 2GUBA 4B5UA 2P3EA 2XWEA 4U5KA 2QF7A 1V77A 1KCKA 1BTMA 1Q3NA 2FVKA 3B04A 1A49A 3VC5A 1OY0A 4GGBA 3L5AA 3DHPA 1L6GA 3GDLA 3EPOA 4XBSA 3BAWA 1EA9C 1BRLB 4CN1A 4AW7A 1XGZA 5CLWA 2E4TA 4MDPA 1J93A 1O1ZA 1JFHA 3DU0A 5TD4A 2RJHA 2D3NA 3I3DA 5DFAA 1R2SA 2FZ9A 3VD3A 1UD2A 4HPJA 3WYZA 4RV8A 1G1YA 2NT0A 2R6OA 2QR6A 3QC3A 3BSHA 4B9YA 3NSNA 1QK2A 4CN4A 3N6JA 1KLZA 3WDPP 3GFYA 3HGJA 2D24A 1A5MC 4XZHA 1CXLA 3W71A 4PMDA 1M3UA 3HBLA 1BAGA 4RDVA 3GVVA 1FA2A 4GYPA 3IPWA 3VYLA 5GPRA 2Y2WA 1F74A 3GU9A 4PCPA 3QN3A 3GXFA 4BWLC 4IJRA 4CU7A 2Y5SA 3PPCA 2YB4A 4C6FA 2A7PA 1ZCCA 3C3NA 1IWAA 4KETA 5DY3A 1CDGA 1PAMA 3GUWA 2P50A 3UZXA 3NG3A 2E5BA 2PDJA 3CQKA 4J4KA 1KFEA 2ZICA 1R3QA 5AOUA 3M6DA 5JMUA 4O4WA 4F40A 5JU6A 2XN2A 2VCCA 1FWAC 2EJ1A 1EB3A 2WHKA 2ZE3A 2QJNA 4LC6A 4MYAA 4CNNA 4CD6A 5IFPA 5IOBA 4O15A 1XH0A 3CQJA 5AVHA 2CITA 1ZU8A 3W7JA 3I6RA 4NZ1A 4NAFB 3SRFA 4FP1A 3V5CA 1ZFJA 3EOOA 1GYMA 3BVJA 4IP5A 5A3HA 2GJXB 2XHYA 2BXYA 3FW6A 3AMLA 1K9FA 2YCKX 3VIPA 3OGRA 5BRQA 1QI5A 1UB3A 3F4NA 3G1HA 3MHFA 1EDQA 3GR7A 1Z41A 2ACSA 4GKLA 4XWUA 1PCKA 1VQTA 4XZIA 1JPMA 4OOUA 3CASA 4ZOAA 1IXPA 2YCIX 1NFGA 1CNVA 2Z1XA 1OGBA 4ADUA 3NO3A 1JCTA 4FZIA 2V8ZA 3EX1A 3M0LA 3PK7A 4LUTA 1KXQA 3VFLA 2WBKA 3V35A 2AAMA 2GJRA 4P7OA 2PI6A 1ITCA 2J7GA 2PU1A 3H53A 1GVFA 1G4SA 1ONXA 2NXIA 3WBYA 1LLZA 3UXDA 4MWAE 1KLYA 3T07A 4IOTA 3G24A 1L0PA 3EBVA 1ZNNA 3ARQA 4ZSTA 2ISFA 5F4XA 2YBTA 3H4XA 3W27A 4Z2KA 1HFBA 2W66A 4GUGA 4ML4A 4A6GA 3DFTA 4UQBA 4M1BA 4MKSA 3TN4A 3G1VA 2FVMA 4NIRA 3H21A 4QM1A 1QASA 1EGZA 5AC7A 3NNTA 1SR0A 1RUSA 4BEQA 5FIPA 1U5JA 3BOLA 3EA3A 4JIEA 3RDKA 3UPBA 2WSPA 3N4EA 1XUZA 3VKJA 2OPJA 4P5UA 2JALA 2EF9A 4HNNA 1KRBC 1TJ1A 3UNTA 3ZVHB 2Y6ZA 2ZKMX 3I7QA 2ZXAA 5CGQA 2HE8A 4Y6GA 4JTUA 1KBJA 2PU0A 1Q5MA 1N7KA 2NW0A 4TV5A 2QDGA 1K70A 2DIJA 4HSNA 4UBPC 5HATA 3LCFA 4GI8A 4GG9A 3VIMA 2O7SA 2GUYA 4U3AA 3T4WA 2QF8A 4M56A 3IV8A 4GZJA 4IGNA 1NIUA 1TR9A 3NDOA 3FYYA 4DNHA 1ISZA 1UZ4A 4MSSA 5H8PA 3VIOA 1A0EA 3DKLA 5D09A 2VGBA 3N12A 3UWUA 5CEWA 3BG5A 4O11A 3E2SA 3VUPA 2QAPA 3B9NA 1UJPA 2PDXA 4PULA 3N2XA 5EMMA 1GOOA 2OZTA 1KXVA 2PTXA 3UG4A 3GE7A 4PB3A 2XVKA 1M01A 4QHRA 3EWBX 3OGSA 1TSIA 4J3VA 2PDGA 4PODA 3DXIA 1DJXA 5G2WA 5BW6A 4N02A 4U2YA 2E5CA 3H4GA 4DZ5A 3QQ0A 3WK0A 2Y24A 2VX6A 4Q32A 3IGSA 5BYWA 1Q7ZA 1KA9F 5SWUA 2IKIA 4FX7A 1P0NA 4B5XA 1K8CA 2QEZA 3AYRA 4HCHA 2NUXA 5AFDA 4PUMA 3V7PA 4LCRA 4DZHA 1MVYA 2VC9A 4PBEA 3ARYA 3IV3A 3FGCA 3T0AA 1HO4A 1B3OA 1I4NA 1E1EA 2HDJA 3DX5A 3VGDA 1SZFA 5HJLA 2X2YA 1A4LA 4K39A 2Y1HA 3K46A 5BOOA 6XIAA 2HS6A 4GH3A 3TC3A 3KBNA 3CAWA 1PYFA 3CHEA 3GO2A 3BW2A 3FFSA 1KCXA 2VCBA 1XL9A 4QJ4B 2JBMA 3E9AA 3FDKA 2XJ7A 3BGAA 3LU2A 4K8HA 2VX7A 4DBWA 1VBUA 3SGZA 4P2VA 3PZQA 1AL7A 4QTGA 3AIUA 3LXBA 4M24A 1W9XA 4A8RA 4I7UA 4C90A 3HJZA 1VYRA 2W79A 1JZ5A 4GNJA 1DQUA 2DIKA 2I57A 5CSSA 2IPFA 4AYSA 1V0KA 4C5YA 4O18A 4JNMA 5E5CA 3BAIA 4E3VA 5E6ZA 4JQAA 4H3DA 3I10A 3VNLA 4LC8A 4RKAA 3TTSA 1EIBA 4Z2JA 2FVLA 2ZADA 4G7FA 2FJUB 2V69A 3UWWA 3S5YA 2Z6IA 5BXTA 4YIWA 1OX4A 3WJSA 1A3XA 2QUUA 4QR6A 1X97A 2J75A 2YCEA 2INFA 2PLCA 3HG2A 4RZBA 2C0AA 2J62A 2IQDA 3M46A 3W22A 4UR9A 5LNSA 3RM8A 1V0LA 2ZUWA 3P60A 5BRPA 2HVNA 3KP1A 1VHCA 3R12A 1L6WA 1FH9A 1DP0A 3M5XA 4TTUA 1Z6KA 3CJPA 3GIPA 3O16A 4FNUA 3PNUA 2W67A 1QK0A 4IF2A 4X9YA 3MP5A 4FLSA 1WZKA 2FHFA 4YVPA 2PP0A 5ECVA 3RLGA 1FWHC 3WH7A 2IPWA 2XTKA 3EPMA 1UWTA 3MWCA 4ZQNA 4JN8A 3ARXA 4PBGA 4NL1A 1VRDA 3JS3A 3KOZA 3JVAA 3SO7A 3JUGA 4KEMA 1KM0A 3PPHA 2V3EA 4AHPA 4JFSA 4JKMA 1FCUA 4W7WA 3GNDA 2WCAA 5FEXA 4X2PA 1GTEA 4PSPA 2VR5A 3NQ2A 3U4AA 8A3HA 5DELA 4JQ4A 1Q8AA 1Z3NA 5EMKA 2VEKA 3SCVA 5C8BB 5A6LA 5LYRA 2FPYA 4XQ6A 1W31A 3PFMA 5CZ0A 4H00A 4H8VA 4GQRA 4PFMA 4GXMA 1UD6A 2R1PA 3GSMA 1VP5A 1E72M 3STEA 3W1RA 1J0ZA 1LM1A 4B5SA 1M03A 2DZUA 5D30A 3R10A 1ADOA 3GH7A 2Q02A 3FK4A 3LQGA 3WQWA 3AALA 4P7QA 2GDUA 4D8AA 4LGXA 4AU0A 4L9ZA 1M68A 4QEHA 4D72A 4AIUA 1GKPA 1OWQA 4YXGA 3T0DA 4GINA 4JXCA 1A4MA 3CL8A 5I23A 3REQA 1AODA 4IQEA 3AZSA 5LNUA 5FF0A 2C14A 3GYEA 3CUFA 1LL6A 2QW5A 4NVTA 3IIZA 3GTFA 1LT7A 3VZXA 3FKRA 5CG7A 1JNEA 4LNYA 2KX9A 1QBAA 4UTWC 4HIBA 2YCLA 4JX4A 4IXHA 1N8IA 1KCLA 2CLEA 3VC6A 5JIWA 6ENLA 5D37A 4O8RA 4P8XA 1P0KA 2QGYA 1TPUA 3CH0A 4M51A 3BAJA 4NSBA 2VWSA 2ALRA 3POHA 1DOSA 1EO7A 3BLDA 3AIRA 3STCA 1CGTA 4D2JA 1WCGA 4L64A 1PKNA 3AJXA 5LXXA 1EO5A 2R14A 3UD6A 2OLSA 4QAWA 3LUTA 2CBUA 5A6BD 1NDYA 4U2ZA 2CZFA 4ZBCA 2WVVB 3UERA 3PUOA 3RX4A 3MUCA 3MMUA 3TTOA 5A8PA 3EZ4A 1DYSA 4QJ3B 1BPLB 3BO9A 2MNRA 4F3HA 1GOKA 3T2QA 1J9YA 3P2VA 3FYPA 1ESWA 2AGTA 2NXHA 1AQHA 2YOCA 2ZC8A 4PC8A 5HDRA 5F4SA 9XIAA 5EPDA 4A2SA 4Y8EA 3TYBA 4JTEA 5D9PA 1LRNA 1OZQA 1XKJA 3T81A 3APYA 8XIMA 3EOLA 2HPIA 3WLRA 3MB9A 3R25A 3OPSA 1A5KC 4PR4A 4AVNA 5BXPA 3WD1A 4QQUA 2PTZA 3TW6A 4J3ZA 2D3LA 3T7VA 1QNPA 1ITXA 2F6XA 5M2FX 2I5GA 1V02E 5I00A 2EAWA 2PUZA 3QFWA 4WSHA 1OEPA 3N9RA 3PP7A 5DMLA 3ALFA 2BXZA 4FI4A 2VGIA 3SFWA 4JQ2A 1EOKA 1RALA 3WQ5A 5LIKX 4GJIA 1AG1O 4G7EB 5E6YA 1K7EA 2QCGA 4O10A 4QS6A 1F9CA 1IYXA 4KW2A 5C9WA 4Z1YA 4QEEA 1X38A 4HMEA 3S3GA 5K9DA 3UU0A 1MXGA 3ABQA 3WH8A 1Q66A 1E0VA 1Q4NX 3ARUA 4CU6A 1XYAA 1OK6A 2PA6A 1YKWA 4G2DA 1ITQA 1BYCA 2RDUA 3ICJA 2DPEA 5BWAA 2A85A 3EEGA 2OX1A 3VZZA 2VQUA 4LUIA 4MIMA 1AQFA 1ZTVA 4XZBA 4ZFCA 2EXOA 1D3HA 3NPWA 4WF7A 5I0DA 1XYZA 4UNIA 5FJJA 2FIQA 1GZGA 3WLIA 2O9RA 4OKDA 3ITCA 1JUKA 3T6CA 1OYAA 3PG8A 4J40A 1S5NA 1Z44A 3WJZA 3N3TA 4DUXA 1XKYA 2X1UA 2NSOA 1EFZA 3T2PA 3KHJA 4HU3A 4ERIA 2G8ZA 3PUGA 2ABBA 2YA2A 4UTIA 2OO0A 4L6DA 2A3CA 3GDMA 3C0LA 1BHGA 4ZB5A 4GJJA 1ZAIA 3UZJA 3BQ5A 1FHDA 4ZO7A 3QGVA 4ZL1A 4O57A 3HOJA 2J7CA 2E09A 1QRQA 5F1VA 4OTKA 3RR4A 1VIZA 3M6YA 3LCXA 3MS8A 2CZDA 2GDVA 5AYIA 4GIRA 2RUSA 1T8QA 3UYIA 4W8AA 5AYYA 3PJTA 2YZ5A 2GL5A 2OGJA 1LZOA 4KF1A 1A5LC 3SN4A 1A3HA 4WDWA 1VZWA 1TV2A 2G37A 2OSYA 1PTAA 3EX4A 3HG5A 4J3WA 1RA0A 4AXKA 3NUKA 1W5QA 1LF1A 3W84A 3QSTA 4AZHA 4PZVA 5IHRA 4C6LA 3WK3A 4KWVA 4Z1CA 3W2JA 2L5HA 3O2LA 2EO7A 5ABHA 3ZR4A 3N9SA 1XRSA 2WC7A 1IHIA 2WVSA 1FWTA 5BXSA 3QVQA 5F4WA 1FXQA 1VH7A 4JY9A 1WZAA 3TOPA 5CC6A 4W8LA 2BGQA 1LRQA 3GTIA 4S3JA 1R3TA 2WXDM 4GLEA 3ABXA 1RQEA 4KFPA 3GDBA 2PDMA 2I1OA 4PUKA 3L0KA 2YDQA 4DWSA 4UTMA 1PTDA 4UTTA 3AXIA 4DO7A 1VKFA 3S2NA 1SMAA 1NH6A 2XH2A 1V51A 6TAAA 3QR0A 1HNYA 1ZUAX 2VC6A 1MEHA 3WEZA 4OZOA 1GQKA 2UY2A 4DNMA 2WVUA 3HPZA 5AYZA 5FA5A 1H60A 2DZBA 2JK2A 2XVNA 3KE0A 3F4DA 3UT0A 3HPAA 1O5RA 2YGYA 4C6BA 4QFUA 3IJLA 2JEQA 1JDAA 2WMKA 5DCDA 4JNYA 2X1TA 1V0NA 1W6TA 4PBFA 4FR1A 3MJMA 4IL0A 4AZIA 3N2MA 1DXEA 1FWRA 5A2BA 4R7OA 2EGZA 1KGXA 1QPNA 3AYVA 4Q4PA 1I2OA 3SCWA 1U5VA 3SJNA 1FRBA 3HM7A 3NGFA 1WUFA 2G4FA 4MUPA 3GC5A 3N2CA 4C6KA 3QR1A 1E6QM 4ZCWA 2NXGA 3IACA 3PSWA 4LS2A 1XICA 2DEPA 1UZDA 3D5HA 4YHEA 2G97A 3CU2A 1K6AA 4PRWA 1CTNA 3WDIA 3R0UA 5MF5A 4H2CA 3E0FA 2BY2A 3WLSA 1QCWA 1VCVA 3BAYA 4V27A 4PUJA 2V3GA 2J24A 1XYBA 3ME3A 3GG8A 1BYDA 3N6QA 1DE5A 3TUUA 3AJ7A 1XFCA 3AHZA 3WNOA 1MW2A 3AS1A 4PTMA 5HQLA 5G1YA 1D3CA 1IGWA 3A9IA 1W9DM 3M0HA 1UD3A 2DGAA 2DZPA 1J4EA 4JTRA 2F6KA 2XSAA 1B30A 1CCWB 4W89A 3NM1A 1FQ0A 1U33A 1TE6A 2CU0A 1S5MA 2JKAA 3SAZA 4DBDA 5CCZA 2WLZA 1W8GA 5TQLA 3PPGA 2ZX8A 2Q6ZA 3W86A 1UP3A 2XINA 4FOUA 1LWJA 4J7RA 1JCNA 4W93A 4D8LA 4QDMA 3GBEA 3N25A 1O4UA 3KVKA 1XWYA 4AY1A 1GQLA 1QI4A 4PYSA 4GX8A 5I5RA 3C2OA 3W76A 4B92A 3AU6A 1TR1A 2FZNA 1RAKA 1FHLA 2W61A 3BXWA 3D0CA 4DI9A 3VK5A 4IPPA 1XLEA 4AH7A 1FKWA 2IUZA 4DXXA 4F4RA 3RXZA 4LAUA 4GOAA 3TR9A 2YXGA 3WLOA 2P1FA 1J01A 1ZP4A 1W3NA 1R2TA 2TYSA 4V33A 5BOFA 1Q6DA 2OR2A 3WQPA 4AXNA 4HZMA 3VGGA 4KMQA 3THCA 5K3VA 4NU7A 3QGAC 1JQXA 1RK5A 3BCFA 4BS0A 1S3HA 3EB2A 3Q67A 4G6CA 4WSJA 4DJEA 1MI3A 3EMQA 4JTHA 3N17A 3S2MA 5C6MA 4JN6A 3C3UA 4I5RA 3JU2A 4NRRA 2X05A 3A5VA 4XZWA 4X22A 1VEMA 1OF8A 1XFBA 4ML9A 2FMOA 1HKJA 2OXNA 2DV0A 1PX4A 2ZTJA 3NIYA 1BTCA 1W3HA 4WIWA 3C8NA 2GSEA 4Y9OA 3BAKA 4IZGA 4ONVA 4PTWA 2WK2A 3G5EA 5HNRA 1MRQA 4O0QA 3MANA 3S9IA 2OEKA 3NURA 4CVWA 1V3LA 3WX7A 2WKLA 4NUWA 3CQ0A 2DUZA 4RNIA 4QDPA 1ODZA 3TQPA 1F3WA 5IDZA 1XSKA 3O05A 4XKYB 1GOWA 4A22A 2FTPA 3NQ6A 4A35A 1QJWA 1RBAA 3FNDA 3WBEA 1FCVA 4DUOA 5HJYA 2ZQ0A 3SZ8A 3GTNA 1E43A 3MSRA 2V30A 3ZQ9A 1MSSA 3LN3A 1WKFA 1J2BA 1XBYA 4DIAA 2QUNA 1SW3A 2Z1VA 5I3FA 3OA5A 4NXKA 3BWWA 7XIMA 3E2QA 1B4EA 2X30A 2VO5A 1R46A 1M7OA 4EVZA 3H2OA 3PTMA 4PCNA 2X0YA 2I56A 2XGZA 4GK8A 3W37A 4MWAA 1PEZA 3UEQA 3W1NA 5CPSA 4KGLA 3SBFA 1QAPA 3SFKA 4XZMX 4DJDD 2TRSA 3QKEA 3V5OA 4EP8C 3WKZA 3SCSA 2YL8A 4E5TA 4FF5A 1YXYA 1IEWA 3E1F1 1EC9A 5A1AA 1CW2A 1ICSA 1OGGA 1E4LA 3GLCA 1MEWA 2CERA 1KFLA 4Y9AA 1E51A 3CAQA 4JN7A 1BYBA 3ZFHA 3ITVA 2PLMA 2WNZA 3R2GA 2WC3A 3JR2A 1H61A 3OQEA 1DQXA 1I6NA 3NCOA 3VGEA 4AF0A 1MQQA 3W53A 3VNKA 4NJHA 4CNOA 2WANA 3GFXA 5LNWA 1DVJA 2IPGA 2OT0A 4QE1A 4UMCA 3ZSSA 5DANA 2JE8A 4RDYA 1REQA 4OE7A 4LBRA 3R8GA 5EGRA 3OYZA 4AMCA 3W75A 3WEOA 3WELA 1OCBA 1UKQA 3M0YA 4MVAA 5D4YA 4JIHA 2PP1A 3P62A 3G22A 4O8AA 2FZ8A 4IX2A 1W1A1 4PMNA 2FB3A 3BGJA 4ZA0A 1Y5XA 1Z48A 1GVEA 3WLHA 4R5EA 3WNKA 4HJFA 1IXQA 4Q4KA 3EPNA 1JR1A 2HZGA 1JYNA 4JTKA 1HXJA 3SADA 1M53A 1SFLA 4OWGA 3MYPA 3LBCA 4I5UA 3PUDA 4LVBA 4LPCA 1JD9A 1K4GA 2BNJA 3B0PA 3L2IA 4WHBA 4WSKA 1JF5A 1GOMA 3AIVA 2EQDA 5CPQA 5FJPA 4FNTA 1RCOB 1ICQA 3WK1A 2VYOA 2PWFA 1F3TA 3A23A 4GCXA 4QJ1A 1OFQA 3T0TA 4F79A 3WUFA 4GHRA 1KQZA 1XYCA 4E8GA 1B3WA 1TWWA 4HCLA 4AX7A 4B90A 1NU5A 2E6YA 3PAJA 2IQ0A 3NTYA 1G5AA 1GJWA 4OUEA 5E0KA 3N19B 1R6WA 1TB3A 1XW8A 1S5WA 3N73A 4FHAA 2E9BA 3CPGA 2A3LA 1EDGA 3W7QA 3MPGA 5IFTA 1H63A 1UZHA 3TV8A 1BVZA 3U7BA 5DF0A 3PAOA 4U3CA 3HQ1A 1CGWA 2WW5A 3DC8A 1KO0A 1U1UA 2DSZA 3TN5A 3RLUA 3AS0A 1I0BA 1GONA 5LXEA 1UP0A 2BB0A 2WMHA 4O13A 1NFPA 1Q2RA 2X7WA 2REQA 4E8CA 1JPKA 4PTNA 2A5HA 4JICA 3SCTA 2EKGA 1X7IA 3G1XA 3WSUA 4IT1A 3ARZA 2A1YA 3ATZA 1UH4A 5C5YA 2O92A 1DV7A 3S5NA 3CPUA 4YS1A 2WSQA 3FJ6A 3LB0A 4ZQRA 1DJHA 3V16A 1A5OC 2GGIA 2IQTA 3WCZA 3LMYA 2BXVA 4MJMA 4XUGA 3VIHA 4FR6A 1AW1A 3SN0A 4Q8WA 4CUCA 1QOXA 3RPTA 2PS2A 1K8XA 1M5WA 4XAFA 4O14A 3K4WA 4NAEA 3KOWA 3WNMA 2X16A 3QXBA 5GJNA 3ITGA 3LCWA 1XIJA 3VD4A 1LQAA 3AHVA 1GVYA 3A13A 3QC0A 2H9AA 1EIXA 1RSCA 5F1UA 1CB2A 3VNJA 2OZ3A 3QMTA 5F2LA 2VEFA 3MU7A 1EP3A 4JTSA 1EGVA 1JPDX 3E3HA 1FWGC 2C3ZA 2CC0A 1IWPA 5JVLA 3FN9A 4ZTXA 2BBFA 3M0XA 2ADAA 2QMJA 1SFSA 3CWOX 2ISSA 2DW6A 2Y5JA 2Z1SA 3SY8A 3UA3A 1FP8A 2P10A 1XD0A 3U57A 4U31A 3SY1A 3BCDA 3WY1A 4Q6XA 1B9BA 5HNTA 3PZTA 1F8IA 3C4UA 3VKAA 4JTCA 1VEPA 4IIDA 1K8ZA 1XQKA 4W86A 2X2GA 3TH6A 4I6KA 4C6EA 1SSDA 3HGSA 2V63A 1QPKA 2G3JA 1PIFA 1JD7A 1FUYA 2IS7A 5AHMA 1G7UA 4FXJA 2CHOA 2QVHA 3ES7A 4RW3A 4FO4A 4E3TA 2YCJA 3KFTA 4L9YA 5C54A 3TJXA 3GH4A 4J2PA 3LM7A 3NQDA 5I3HA 1XLKA 4AHQA 1XHGA 3EDFA 3PANA 3H4WA 4I7VA 4QCFA 1KW1A 1KXTA 2PURA 3NWRA 4QE4A 4EXAA 2YA0A 1R9YA 3GNXA 2ZVIA 3CTLA 1WNOA 1TPWA 3CZGA 4N9DA 2RDTA 2GOKA 1D7KA 1KFCA 4PCFA 2CLIA 2DY3A 5I3IA 5FKYA 1X8FA 3CYVA 4GFIA 5FAGA 4KWSA 1YPXA 3SN1A 5AYXA 3H12A 2WM1A 3OVPA 3NPUA 2QKFA 2Z26A 4EPDC 1ONEA 1EWDA 4LYKA 3TC7A 5CC5A 1SUXA 4OECA 4JYEA 3WL1A 2YDSA 1XIMA 3TP4A 1WKYA 4J1OA 3A5FA 3W1UA 3W24A 4LWWA 5EMYA 1HG3A 4Q7NA 3FLUA 3WN6A 5G1TA 3GXPA 2RGLA 1K9TA 3K1GA 3PPFA 5C0QA 4K2SA 1CWYA 2WAGA 2QCCA 3O0KA 4H6QA 4Q4RA 3CPRA 2JGQA 5IBXA 7A3HA 4Q33A 4CQ9A 3TW7A 2OEJA 3DBNA 4EOUA 2GGEA 2J8GA 3FKKA 2QQ6A 1W1YA 1G7VA 1OIMA 2C15A 2QXWA 4S2BA 3QV7A 2B7QA 3APTA 3LLDA 1JGIA 5BZAA 2A3AA 5HWNA 1E0WA 5G1MA 3NQVA 1U1JA 4GO9A 3EX3A 1BXCA 5C55A 4AD1A 1DJNA 3N6HA 1E0UA 2VDIA 5CPOA 1TIMA 1BXBA 1O6IA 4JNZA 3BUVA 2OYKA 1BG9A 5HWMA 3NSMA 3VMNA 4GYJA 4MPQA 4GXPA 3WMSA 1XLGA 4A3YA 2XISA 4HYWA 4XO6A 1RXOB 1UOKA 3S4TA 3SIMA 4EWND 3E5BA 5HPCA 1LBFA 2J79A 1M6JA 1TA3B 3LEPA 1VFUA 4P8WA 3D47A 1WV2A 1C7TA 1XIGA 4UQDA 4RV3A 3P3BA 3R4IA 2V9DA 3EEZA 4JPGA 4WZHA 3VKKA 3B9OA 1AJZA 3S6TA 2XIOA 2O4MA 4IPIA 4KIRA 1EA0A 1JPHA 3S8HA 2DORA 5LKYA 2CXGA 4JQ3A 4H9ZA 4XSLA 2HWGA 1BEUA 1S1PA 1V02A 3ID7A 4M8UA 4XBJA 4AZ5A 1QO5A 5AHLA 2A6LA 3CB8A 1DL3A 2AL2B 2ZRYA 3QF0A 2WKGA 3LGGA 5KETA 1IXNA 3MP4A 3VZYA 3GU1A 1E71M 1O5KA 2V3DA 4KWOA 3UJFA 2WSYA 3CK5A 3F2CA 1QWGA 4LY4A 3M44A 1B3XA 3TJIA 2GLKA 3ECQA 2CLKA 2BOGX 2WMIB 3UW6A 5C2CA 1GG0A 1CXFA 4HU4A 3W2MA 3THUA 4F2UA 2INZA 3CO4A 1GORA 4P8VA 4UOJA 4DZIA 3P14A 4O16A 1LP6A 2C91A 2DP3A 4Q4QA 2FH8A 1J5TA 3LCHA 4Y9PA 5AB3A 4HT3A 3THDA 1JDCA 1YQ2A 4Y7EA 3UVAA 3P84A 1BLIA 1ZLPA 3ISIX 2ZZ7A 4R33A 2Y88A 1KM5A 3TYZA 3NYDA 2B7NA 2GJLA 2TMDA 1GZ1A 2TSYA 2IXUA 1K8YA 3KCLA 1DWJM 3MUIA 2VOMA 1EBGA 3QZ6A 4K1WA 4NZFA 1DJIA 5J5RA 1UOZA 2VC7A 1TTJA 2EPKX 1O94A 2YXXA 3ITOA 4FNQA 4PL2A 3NPXA 4M3PA 4EK7A 5CPNA 1SJAA 3AAMA 3M0IA 1E56A 3G8RA 1DWGM 1W1IE 1FDZA 2ZZ3A 1PZ1A 5FF3A 2VUYA 2W62A 1VPYA 3AWNA 1EP1A 3VNIA 1G0CA 4NNCA 3UFYA 1YW1A 1E40A 3GFZA 3W2LA 5D8WA 3TSMA 2OODA 3L66A 2FTYA 1Y5WA 4MAZA 9RUBA 1EX1A 3QMRA 3EOEA 2ZZ6A 3A4AA 1GKRA 4TX9A 3EGJA 1TWZA 3SURA 3RRXA 1MO0A 4XKYA 5AKQA 3OBKA 3GYCA 5FI8A 1E70M 3CUXA 3WLPA 2A3HA 3HIJA 1GT8A 2ZCGA 1TPC1 4GYFA 4HNVA 5F2MA 3BAXA 3TMLA 3MCMA 3PBGA 1JYWA 3TVAA 4YCPA 4ADTA 5CC7A 1BFNA 4AX6A 3FX4A 3ZZ1A 4UB9A 1BQGA 4IPNB 3HQOA 1EQCA 3CZJA 3MHGA 4IJBA 3VA8A 4W87A 1FWDC 1W54A 4ATLA 2D0GA 1HJXA 1DXFA 2WYSA 3GS6A 4S3CA 5EA9A 1J12A 4CEUC 1E4MM 4LAMA 2VELA 1FFQA 3SIZA 2VEGA 2WB5A 5D32A 3CO8A 3WH6A 2ZZ1A 4NKCA 3AIEA 1B2YA 2C18A 2B7OA 1XPGA 1OG0A 1WX0A 3W82A 1TMQA 2QGHA 1YBQA 2R8WA 4WY0B 2BG5A 3W85A 4BA0A 1P7TB 3I68A 1EXBA 3SUTA 1HO1A 3Q94A 3T0CA 3AHYA 4AMAA 1GJPA 3N14A 5DX7A 4AFYA 2NWRA 2GGGA 3NFUA 4F66A 3D3AA 4L56A 1OBAA 3RM9A 2BHYA 2A6NA 1GPWA 4GZ7A 4WCJA 3PULA 4C1LA 3BMVA 1H7RA 1OFRA 4Z2IA 1JDEA 2Y7FA 2Q8ZA 4UFMA 1EWEA 3MMDA 4XVEA 3RO8A 3UG3A 4JL2A 4O50A 4UMAA 3UBPC 3GY1A 2QJMA 4CVUA 3BLIA 2OSXA 1GHRA 3V18A 1AZ1A 5KITA 3OVGA 2PRLA 3W6YA 4IGSA 5I09A 3NQAA 3EYPA 3MUZ1 5DCBA 3AISA 3O3RA 1XLFA 4LBUA 1KBBA 1H5YA 2C13A 1HKIA 2HJPA 2IXVA 2AAAA 1J0JA 4DJDC 4R3UA 3M64A 1PHQA 5JIPA 1EJRC 5I3GA 2PC8A 3H7VA 3QTPA 4FK9A 3M4HA 4V2XA 2PDKA 5GNYA 1PKLA 1UKSA 2DSWA 3QPZA 3F4WA 4PTVA 4QSHA 1KQYA 1BSIA 2YZRA 1XLCA 1DWIM 3RLHA 3UWZA 2WMGA 3ITYA 3RK8A 2GK1B 1EJTC 1R9ZA 3KP0A 4UCGA 2PDNA 3ZJ6A 2EHHA 4HZ6A 3SRHA 2ATMA 3AMCA 1OFDA 2WJDA 5G4WA 1IT7A 3WQ8A 4PMVA 2ZYFA 4OGZA 2C19A 1XBXA 2WC4A 3LPOA 3Q65A 3WQ6A 2Z24A 4EPEC 4GY0A 3ZWSA 2OX4A 1QNVA 1JAEA 3CNYA 3HU7A 2ZOXA 3UYCA 5M1TA 4WLCA 3PWGA 3OLDA 2EBNA 2NV2A 4L1GA 1UROA 4RK8A 1Y7VA 4ZGYA 4C7FA 1TQJA 4LS1A 2PBGA 3O9NA 1MQRA 1L6YA 3MBFA 4BF5A 2VEPA 1HGWA 2GZXA 2HSAA 3IK4A 4TX6A 2UY3A 3V4BA 3C8FA 4ZTYA 4GKTA 3S9YA 3QBUA 5EU9A 3SI9A 3PR2A 4RZ6A 4URIA 2GJPA 3C5QA 3EXTA 3A12A 4B3ZA 4GXWA 1B3VA 3DCPA 2ZXQA 3HG4A 3H26A 1Q63A 2H8ZA 2ZRVA 3MTWA 4GI9A 3CZLA 1Z89A 2W9MA 4MNMA 1XC4A 3S47A 1DWHM 1ZP3A 4HMNA 4S1FA 4EF9A 2HK1A 4JYFA 2EPOA 5IHSA 1ZZMA 4ERAA 5DY2A 4W7UA 4PEEA 3W6LA 3W83A 3MC5A 1ZBCA 3IVUA 4LBSA 1LLOA 1U1HA 3ARSA 3WK2A 3G8EA 4HJWA 3K1DA 4MB4A 4QLKA 1PWMA 3UGVA 1KGUA 3B8DA 1OFOA 1ZBVA 1L8NA 3DDMA 4HKPA 1XUUA 5LA0A 4W8BA 3TTQA 4ZZ9A 4KPLA 2FHBA 2B0MA 3MVIA 4HBKA 3W70A 5FESA 4L4PA 4I8YA 4Z17A 1VPXA 4LUTB 4H01A 3LSBA 4A2RA 5CQ1A 4HOWA 4RXGA 4LTSA 3DH7A 1LDCA 3TQVA 1SFJA 1YPIA 1R86A 2ON3A 1H3GA 2VR4A 2QCDA 3UWVA 6PTDA 2Z00A 3GNOA 2WJFA 4BQ4A 3VCRA 3QY6A 4FNPA 4I9JA 4ILSA 4M29A 4FALA 1EUNA 2VEMA 3W26A 5C7VA 5I07A 3PWIA 5HUOA 4C5ZA 4ZQPA 1WDPA 4QG6A 4Q4OA 1ZJAA 2PTDA 2V67A 4XX6A 3SQMA 3FJLA 4ORIA 3SB0A 1KGWA 4Q7BA 4YHGA 3C2RA 1YEYA 4MKNA 1AJ0A 3L4XA 5FEPA 2J7BA 3WD3A 1XIDA 3VAVA 1MUWA 2KAUC 2I9UA 1JYVA 1UA3A 5A6JA 5GNZA 1RLDA 2PWHA 3ZMRA 1W2VA 5HWJA 2X41A 4ZVJA 3A4XA 3QOKA 4HK7A 1NP0A 1ZPTA 4GRSA 1SR9A 1Q6QA 4IMEA 4D9PA 4UZSA 2QIWA 1NWTA 3LRKA 2POZA 4AZCA 5FJOA 1VCGA 2HE5A 4AD2A 5D02A 3MQTA 1OIFA 3SSZA 5AC4A 2MUCA 2ALDA 3ANVA 5CGTA 3SCOA 4LOCA 3U2CA 3HFTA 3CUJA 3ZVIA 2J25A 2FDSA 3CS2A 4WDUA 3IJ8A 5A8GA 1RCXB 3GNPA 4ZFMA 2ISVA 3TX9A 1J6PA 1PXGA 2CEQA 1ME8A 4DUWA 3UJSA 1QNRA 3FYOA 5DQPA 4FX6M 1J0KA 4Z1BA 4HNLA 2HXUA 2PDUA 2GYIA 2IKHA 1TV3A 7TIMA 3AXXA 2XN1A 1AA1B 4NZ4A 1OT2A 4DM2A 2PODA 3BV7A 5KZEA 3TN6A 5ABTA 5KEZA 1HUVA 2FJKA 3W00A 1CENA 3U5YA 1UKPA 1PBGA 3RJXA 5A6AA 1QOPA 4PFHA 3LHVA 3RPMA 1O1HA 2PCEA 3PZMA 1RJPA 4N9EA 3VDAA 5DRIA 3R89A 4L5ZA 2WZEA 3P0WA 1JUEA 5C9ZA 4GYPC 3PS7A 3U7VA 3AQUA 3LPFA 3LG3A 1S1RA 3MO4A 3NQCA 2OKOA 3MSGA 4B5WA 3CV7A 1H2JA 3M5VA 3FGCB 3AHXA 3NO1A 1RPKA 4HZ7A 1GOQA 1OC7A 3CLMA 4I8DA 2VX4A 3KBSA 3B4YA 5D05A 1Z9AA 4YTRA 1F8MA 2QJIA 4I9TA 5C9RA 4UFJA 1OD8A 3G0XA 3QRHA 2CLLA 3QM3A 1SJBA 1OCNA 3SCQA 5E9XA 4HK5A 1XG4A 3RJYA 2CZEA 4TV6A 1Q4WA 1LOSA 1UYQA 3K8MA 3QZEA 5GJPA 2J4GA 2MANA 1FOBA 3LA4A 1GEQA 4QLJA 2EPNA 4DWSD 1JQVA 4RUBA 2O9TA 3TTEA 3QQWA 5CH9A 3UESA 1CPUA 1PUDA 1ZENA 3OGVA 4WJXA 1WXYA 3IGXA 3CIXA 4NHVA 4GIEA 3P8IA 2B4GA 3CV2A 1WAUA 1LT8A 1AQ0A 1EL3A 3UJ2A 1H1NA 2E6DA 2Q8LA 1AVAA 3L4VA 3VABA 2GVLA 3KBJA 3P80A 3TSDA 3M0KA 3GIQA 2V82A 4DWDA 3STGA 3VKCA 2CWXA 2AL2A 3W3OA 4AY7A 4YCOA 3BLKA 3NQ7A 2PGWA 2X09A 4B15A 4WRHA 1C8XA 3TXVA 1UIPA 4U10A 1O12A 4W88A 1RVKA 3O6DA 1NEYA 3PBYA 1V6UA 7ODCA 4CLMA 3R1ZA 5JBEA 4H9VA 2XVGA 1OX4B 5DBUA 4DRSA 1WDQA 3LNMA 2XH7A 1H62A 4ZENA 4NX5A 1HVQA 1DWFM 5BXRA 4TR9A 3N1AA 4E38A 4K7VA 2HPMA 3GZAA 5FD0A 2JF6A 3GG7A 3KDOA 1KBLA 4CNSA 1BSLA 3W2UA 3WMCA 1VENA 1VFTA 5LHEA 5FOOA 4Z2LA 1LORA 4N0RA 5CZTA 3TA9A 2V5CA 3A4JA 2RHGA 5H91A 4HU8A 2R91A 2PGRA 4HD5A 2QUVA 5JBDA 2R9RA 3PZIA 3UXLA 4Z2HA 4DHGA 4C6MA 3LTPA 1XPYA 1UJQA 3O0FA 3G1RA 1QMLA 5C7HA 2J66A 1XCXA 1WBJA 2Y8UA 4NI8A 2HRWA 3FA5A 4IXXA 3L5LA 5CJ5A 1F6YA 3B0YA 1U83A 3WLKX 3WIJA 1DTUA 4C91A 1ECEA 5DRCA 3URAA 2H90A 3OG2A 5T8GA 4CQDA 2X8RA 3KTSA 3OHMB 2J7FA 3MKCA 2P0OA 1R3WA 3IVSA 2ZFAA 4JBRA 1JZ2A 4GQGA 2QMKA 1W9VA 4Z42C 1XDLA 2A0NA 1HJWA 3W7EA 2CLMA 5CXPA 3RYSA 3L0NA 4AVFA 3BLEA 4TXEA 1TVNA 5I78A 4HSOA 4WKFA 4L9XA 1ZCOA 4P7RA 1EC7A 3TAKA 2FTWA 1OCJA 2WJEA 1VFFA 3GR4A 3SUWA 1EHNA 1RBLA 1NJJA 2FH6A 2PCQA 1F7BA 1JIBA 2XZ9A 3P7YA 1BYAA 5C9XA 5K7JA 4D1IA 2OZ0A 3U48A 3B06A 1TZZA 4PEKA 3ZOAA 3IAQA 5AC8A 3CYJA 3GXNA 1QUMA 3REQB 3GXMA 1D9EA 2DZSA 1TO3A 2YW3A 5EBUA 3WF4A 3TNBA 3WENA 1QNOA 5C9UA 3GDKA 1XLBA 4JOMA 4DJED 4H7CA 4ATDA 2YCLB 4S3DA 3L4UA 3OG3A 3V5FA 3CC1A 2NT1A 5I79A 2DSUA 3R0KA 5FF2A 4XUYA 3ANUA 4MADA 2HROA 2PF0A 4JFTA 4JHZA 5B80A 3NR0A 4Q8OA 3QY8A 4OFCA 2OOGA 3II1A 3VGBA 5HULA 3VDCA 2HNHA 2QCNA 2YXOA 4JCLA 1LQ2A 4F2TA 1F2JA 4HNTA 4J3UA 2CLOA 1MW0A 4UNKA 2FB2A 3O15A 4AD0A 2C8NA 4L65A 3UZZA 5LSMA 1G69A 1QPOA 2E7FA 5CAKA 1R2RA 4H7ZA 1UR3M 1DHKA 1UD4A 1Q13A 1CIUA 4DYKA 1ISYA 4GD0A 1S3TC 3H22A 4F0RA 5HNUA 3HJEA 1PZ3A 4AZGA 2ZRXA 3AHTA 2BHUA 3CMJA 1S2AA 3GHRA 1S2TA 4TQTA 3NZRA 4LYQA 1IXOA 4AEOA 4EXQA 3B8SA 1UC5A 3WQVA 1NM9A 1W1VA 3BSMA 1W5OA 1VF8A 4CNPA 2P8CA 3A21A 4R85A 1WDSA 3E12A 5HK4A 2W63A 2ZRUA 3PF3A 5EYWA 4ECLA 1J0HA 4HA4A 1T40A 4NZ5A 5A95A 2BHZA 3TFCA 4MWAD 4UFKA 4UNLA 4XSMA 1QI3A 3KLKA 4XK2A 1Q6EA 4AQLA 4MFDA 2F9RA 3U2ZA 4HTBA 2CLHA 3ENLA 3UNDA 3WQOA 2VZOA 2Z25A 4TMBA 2DZTA 1E6XM 2PDCA 1KV8A 2E1WA 3KBMA 4WGXA 2YW4A 1TFVA 4MYXA 4PMQA 1UCWA 3ABRA 4XD6A 4M6QA 1E5NA 2QVNA 1GVSA 1ZAHA 1S5VA 3SUSA 3WDRA 3RM4A 2A3BA 3E0WA 1W5MA 5HJXA 1RR2A 2GK1A 2Z28A 4CD7A 4LB4A 2GUUA 5KINA 3MKVA 3UPMA 1A5SA 3O6YX 4NNAA 1F6KA 5HMSA 4IM4A 2IKGA 1E1FA 4NNBA 3DEQA 4OV4A 3AYSA 4REQA 1AQMA 1VGAA 1T8XA 1VFMA 1JZ8A 3ZSTA 3VKBA 3SJ3A 1QBBA 2BY0A 1JYXA 2WWCA 3V75A 3G18A 3ZR5A 2FZBA 1FXPA 2CZ5A 3W74A 4I7WA 5H1WA 1C92A 2G3FA 4HYRA 4NF7A 1PDZA 2BFGA 1UQZA 1W1TA 3N15A 2VEIA 4UR7A 2NQLA 2OZ8A 1FKXA 3UCDA 4W84A 3M7SA 4N2YA 1BKSA 1UWAA 3AIBA 2F8QA 2R24A 1QI0A 2RDXA 1AW2A 3KZSA 1FWCC 4GQBA 1DJWA 1H4PA 2NVCA 1M7JA 4PB4A 3BLOA 4IGHA 3GIYA 2HS8A 2QJGA 5JH2A 5A6MA 4GO8A 1TPDA 4K36A 3IIXA 4RNHA 4E4UA 1LOQA 4LEQA 3EX6A 4I9AA 3QPEA 5HBFA 2Y7EA 5HQMA 1PTGA 2YA1A 1DJYA 3WMBA 4KEZA 1P4CA 5FCZA 1OJXA 4LUJA 3CWHA 1UIOA 3BICA 2GVEA 5FJRA 3H2MA 4HNUA 5G4HC 4Y2WA 3KL3A 4IIBA 4LAOA 4C60A 3E74A 2GQ9A 3LM3A 3GK0A 3VNYA 4PA8A 4RNJA 3RILA 4B91A 5I2UA 3BARA 3EDJA 3WDQA 2E77A 4CEXC 4PN2A 1AW5A 4IG2A 1ME9A 4O28A 1UWUA 3N13A 4JIIX 4WX2A 1BGGA 1OFEA 3GRIA 4DAIA 1SYTA 4MM1A 4MY1A 2G3MA 3RMEA 4R7JA 1TVPA 1J10A 1Y5VA 2BSLA 3H55A 5CBJA 3ZLGA 1MUCA 4RZ4A 4DWSB 4XV0A 4M6PA 4OBSA 4UC5A 4Q8UA 3QW3A 1B90A 4HP5A 5D04C 1EZWA 2J6VA 3R43A 4DO6A 4HA1A 3OO2A 2EKCA 3VOGA 4DBSA 1C90A 4IJCA 2PAJA 3TAOA 4K3ZA 3C0JA 3P81A 1UH3A 2PWUA 2E8ZA 2OKTA 4HN4A 7ENLA 3MV11 1PPIA 4PUUA 3CZ8A 4FIRA 5FL0A 4UOZA 1NVMA 2CBJA 1UD5A 1I2RA 1SZRA 5CPLA 3EB4A 3ABOA 4RE3A 4UTHA 1QW7A 3MCOA 1CEOA 3OIHA 1OG6A 3PJUA 1CGXA 1Y65A 5FACA 4XTDA 4JTAA 4D6JA 3UPWA 4F48A 1TJPA 1J79A 3I4EA 3GAYA 3SUVA 3O07A 4CNTA 1W1PA 3GAKA 4YTUA 4X2RA 5E0FA 1MFVA 2W3ZA 2X1SA 3NEHA 1SM9A 4UXDA 5DT5A 5CBBA 3O06A 3GWQA 1PJ9A 9CGTA 4IIFA 1R8LA 2BGNE 3DIPA 3TONA 1C9DA 4Z1DA 3H70A 2XVLA 1QDSA 3NXLA 1B0IA 1XLAA 2DH2A 4PRTA 2A79A 5FEZA 4AEFA 1ZQ5A 3FXGA 2WNWA 1JXKA 3STPA 1PDYA 2V5DA 1OQFA 4Q22A 4YVVA 4M0XA 1TWDA 1E73M 4HU0A 1MZRA 5JXQA 1YNQA 3S2CA 1G01A 3F5JA 3CH9A 4AZ6A 3TOYA 5G2HA 3RX2A 1PV8A 4E2OA 2DVXA 1S46A 3N04A 1XBVA 1KTCA 4Q8PA 2GFTA 1BKHA 3A6OA 3L4YA 1H11A 3LPPA 2XUCA 3ITTA 1KTNA 3KXQA 1IIGA 2TPSA 1S2VA 1ICPA 1P6CA 4ZR8A 3P5ZA 3B8TA 3GQYA 4TMCA 1YRRA 3CMFA 2PTYA 2CBVA 4NZ3A 4DF1A 1RJRA 4WKHA 2Z1WA 1XLHA 2ZRZA 2VZVA 3AS2A 2C1GA 2HTMA 1TRDA 2GSHA 1MUMA 1PCWA 3DI1A 1M65A 5E93A 1XR2A 3N18A 1WKDA 1OADA 1LROA 3WQDA 3TSBA 2CXEA 1R7AA