4IISA

Crystal structure of a glycosylated beta-1,3-glucanase (hev b 2), an allergen from hevea brasiliensis (space group p41)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
316
structure length
316
Chain Sequence
EVGVCYGMQGNNLPPVSEVIALYKKSNITRMRIYDPNQAVLEALRGSNIELILGVPNSDLQSLTNPSNAKSWVQKNVRGFWSSVRFRYIAVGNEISPVNRGTAWLAQFVLPAMRNIHDAIRSAGLQDQIKVSTAIDLTLVGNSYPPSAGAFRDDVRSYLNPIIRFLSSIRSPLLANIYPYFTYAGNPRDISLPYALFTSPSVVVWDGQRGYKNLFDATLDALYSALERASGGSLEVVVSESGWPSAGAFAATFDNGRTYLSNLIQHVKRGTPKRPKRAIETYLFAMFDENKKQPEVEKHFGLFFPNKWQKYNLNFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-1,3-glucanase form 'RRII Gln 2'
publication title Structural analysis of the endogenous glycoallergen Hev b 2 (endo-beta-1,3-glucanase) from Hevea brasiliensis and its recognition by human basophils.
pubmed doi rcsb
total genus 103
structure length 316
sequence length 316
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.39: Glucan endo-1,3-beta-D-glucosidase.
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00332 Glyco_hydro_17 Glycosyl hydrolases family 17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4iisA00
4GI8A 1JAKA 1JZ6A 2G4FA 3UG3A 5E0CA 4M29A 5HOSA 1VB9A 5GQBA 2XIBA 1GHSA 4EKJA 4MJ4A 4UQCA 1UR9A 2GJRA 3G6LA 1UYQA 3WUEA 1OD0A 1DWAM 1CXEA 3AJ7A 4FLRA 4S3JA 1E6RA 1E70M 1V6UA 2V5DA 2CYGA 3GZAA 4AD3A 2WVSA 4D1IA 4WKAA 1WE5A 3MUZ1 2XPKA 2JEQA 4AZ7A 5HXMA 2YOCA 2D3NA 3MV01 1JYXA 5D9MA 4W5UA 5JIPA 4AIEA 4R5EA 4GXPA 5A6LA 1BG9A 3VMPA 3ZSTA 4CN6A 1I75A 1ISWA 1UHVA 3RM8A 4AD4A 4HPGA 3AXHA 3WH7A 1NOWA 4WSJA 2ZUNA 2E9MA 1W3LA 1C92A 2EEXA 2WBKA 3L2MA 4PBGA 2EO7A 4QDMA 1WDQA 1TR1A 4AEEA 1H0IA 1F4HA 1JFXA 1BPLB 5IFPA 1GOQA 5CGTA 4H2CA 1J0KA 3AMKA 4D6EA 3M6DA 4M1RA 4M56A 4NRRA 4B16A 2WMJA 2PBOA 4LYRA 4TTGA 4J3SA 3VOCA 2F2HA 1JZ2A 4W87A 1OINA 1E0XA 2W66A 4CN4A 1B90A 3TTQA 3L4ZA 5DF0A 2YA0A 4KWUA 3PTMA 1CEOA 1FH7A 2CKSA 1MWOA 1BG4A 3W25A 1C3FA 4MPKA 2YDQA 1OCQA 4A4AA 1B31A 2WHKA 4ZXLA 3VGBA 1CXKA 2GJPA 5I2UA 2E3ZA 1AQMA 1PZ3A 3S2CA 3QOKA 1V3KA 3OGVA 2ZXDA 4W8LA 3QHOA 5AYBA 1VFOA 2W4XA 1CNVA 4W7VA 1NWSA 2VRJA 4GIAA 3W38A 5A8QA 4OJYA 5DFAA 4L4OA 2W91A 4M82A 2XFRA 4ACYA 1KQYA 4CCDA 4WF7A 1WZAA 1Q6GA 4F8XA 4X0NA 1B3VA 1QBAA 4HZ8A 1RH9A 1VIWA 5LA2A 2F8QA 3BCFA 2YJQA 5EFFA 2FGZA 1J12A 4X0VA 2VRQA 2ZOXA 1E5NA 1C7TA 1J0IA 4UFMA 2BXYA 2E8ZA 1DWIM 2G3JA 5CQ1A 1I1XA 3SUUA 3J7HA 3A47A 3ARTA 1J18A 3T2PA 3RM9A 1UKOA 1KBBA 4AIOA 3AFBA 4JL2A 1DWFM 2VCCA 4MB4A 1HJXA 1U2YA 4UFJA 1Q4NX 4HA4A 3CGTA 2WLZA 2A3BA 1R7AA 4P7QA 2YL8A 4X9YA 4J3WA 4PRWA 4W7WA 2DSKA 1B3ZA 3BMVA 3VNYA 3W24A 1KCKA 1EDTA 3AIWA 3WDPP 4Z2LA 3N11A 3BMWA 2WSPA 4CU7A 3BCDA 1PX8A 5I77A 1HKKA 1OT1A 1Q6CA 4LQ1A 4EE9A 1I1WA 1CXLA 1UD2A 2W63A 5D9OA 4P8WA 1JZ8A 1QHZA 3WKZA 1QHOA 1PIGA 4AWEA 1CGUA 4UOJA 3BAXA 4PMVA 3L4TA 1VJSA 1EGZA 3O6AA 2WZEA 1HP4A 1PJ9A 1ZBCA 3MSDA 3WIJA 4PSRA 2XYLA 2OYKA 4ZENA 2EXOA 4HTYA 2ZX8A 1FA2A 3LMYA 1PIFA 1JG9A 3WQ6A 2G3MA 4AISA 1JGIA 1UR4A 3II1A 1E73M 3I3DA 2X0HA 3T2QA 5EFDA 1SMAA 1G0CA 1PEZA 5AC4A 5CPQA 1R7OA 1V6YA 2JF7A 4AZCB 3CZ8A 4PCTA 2XJ7A 1EO5A 4N0RA 5CXPA 1OT2A 2O9OA 3O9NA 4XX6A 5CJ5A 3B9EA 4MB1A 1K9TA 1E72M 1V3HA 3AMCA 3GNPA 1M53A 3BAIA 2WB5A 2DSUA 2J7FA 2DEPA 1PBGA 1GVYA 1C90A 2GDUA 1BHGA 3CLWA 3AYSA 4AEFA 1HT6A 2DDXA 1OBAA 2DIEA 3MMDA 3WQWA 2DH3A 2UY4A 2Y8KA 3L4YA 3VIOA 2DT0A 4YPJA 1W9BM 1TMQA 5I79A 4MJ2A 2WNWA 3VKKA 3ARVA 3WSUA 5KEZA 5JBFA 1H1NA 5ABGA 1W9UA 1E0WA 1MW1A 2J74A 1XYFA 1LL7A 1EH9A 1KQZA 2DSZA 3E1F1 4M24A 3EMZA 3IJ9A 1NWTA 1XD1A 2A3AA 2WVTA 3VIJA 2W92A 1GQIA 3U5YA 2XVGA 4GQRA 4BQ5A 2J7HA 1QNQA 3AYRA 3ZJKA 2ZE0A 1XGZA 3CUHA 1VEMA 1V02E 1HJSA 5I0DA 4IPNB 4BS0A 1XC6A 2XVKA 1ESWA 3BH4A 1RD6A 5ABFA 2VQUA 3PTKA 1IV8A 2VNCA 2PC8A 4AD5A 3WY1A 3AMDA 3F4VA 2VX4A 4HZ7A 2VZVA 3ARUA 1GW1A 1VFUA 1D3CA 3SCRA 2BVTA 4LYPA 1G01A 2RGLA 2Z1SA 5GNXA 1WNOA 4FLOA 3UCQA 3K4AA 5AYIA 2XG9A 5A1AA 1JDAA 1SFSA 1WO2A 1NWRA 5EBAA 1FOBA 2UY3A 3EBVA 4OBRA 4Z2GA 5LYRA 1TA3A 4C7FA 3IAPA 3VUPA 1TE1A 3BAWA 4YHEA 5JIWA 1KFWA 3AHTA 3AOFA 4OOZA 2VT0A 3ARXA 5M3WA 2BFGA 4MTVA 5CPSA 4P7RA 3ZO9A 4CD6A 5DO8A 1NWUA 3CZGA 2XVPA 2GSJA 3WMCA 3HU7A 4H04A 2VVSA 5LA1A 3CMGA 1HJVA 4DWSD 4W7UA 1XV8A 4AYSA 3HN3A 1B3YA 5BWFA 1RPKA 4YN5A 3MO4A 5BXPA 1WB0A 4GPNA 4GKLA 1E6PA 4XZBA 3WF1A 2D0GA 3RMEA 1W1YA 2AOSA 2WKLA 3ARWA 3VD5A 3LPOA 4QAWA 3T0AA 1CPUA 2OYLA 4QFUA 3MMWA 1EO7A 2D0HA 3I3EA 4ZE5A 1KB3A 2J7DA 1UWSA 4MNLA 4GQQA 1GPFA 5TD4A 1XSIA 3T2OA 3DECA 1LL4A 3SCNA 3VIIA 1G1YA 3TTSA 3RJXA 3WBAA 2J78A 3PZ9A 1ITCA 3WNOA 4JAWA 4XV0A 5IFTA 1NOUA 4W93A 1GQLA 2WAGA 5C71A 1ZB5A 1SYTA 4CVUA 1DP0A 2D22A 3VVGA 3PTQA 4IUGA 3BSHA 5IDIA 4PSPA 2YDRA 1BQCA 3AHXA 3ALFA 4P7LA 1QNSA 1C93A 4MNKA 1E3ZA 2ZXQA 4IM4A 3NSXA 4PCSA 5I3DA 3FN9A 4PTXA 4C7GA 5A2CA 1JXKA 3BSGA 2VRKA 4AMCA 1WP6A 4H7VA 4GO8A 2V3GA 1J0ZA 3WH6A 1EIBA 1HKJA 1EHAA 1UH2A 1BGGA 3FHQA 3DHUA 1GJUA 4HMEA 3ZM8A 1BYCA 4UFLA 2CBIA 1EHNA 3KL5A 2DH2A 2WWDA 3QR3A 4CU8A 2WXDM 3K8MA 4DM2A 1DEDA 4AW7A 1LG2A 1V3IA 3BC9A 4B15A 3ARRA 1QW9A 3ZSSA 1HJWA 3DYOA 1HP5A 3N12A 2ZUSA 2D3LA 4TVCA 4JZ5A 2IXUA 1W3HA 4PMYA 5I6SA 4PTWA 1HVQA 2UY2A 2O9PA 2YKKA 1FP8A 3VIFA 4W84A 2F61A 2XVNA 1XH0A 4OIFA 4U31A 2GDVA 2CHOA 2YL9A 1G5AA 3BAKA 3SUWA 1UWTA 3NIYA 1W1TA 4D6CA 4ATLA 2ZWYA 1ISZA 2J7BA 4UFHA 1EOMA 2VCBA 5I23A 3WD0A 1H49A 4CUCA 3DHPA 5A6BD 5CG0A 1ODZA 2Y8VA 1W2VA 3OZPA 2VX6A 2WMIA 3MUIA 3WH8A 1GOWA 2B31A 3SCQA 1GNXA 2OWWA 2WBGA 4RE3A 3RJYA 5FKYA 2WYSA 3VINA 1E1FA 4CCEA 1PX4A 3F5JA 3EDKA 2BXZA 3GXDA 1CWYA 2DIJA 4RE4A 4Z2JA 3N13A 1LWJA 4W5ZA 5BRQA 4CD7A 2WCGA 1KWKA 3PZGA 2D0FA 2ZUWA 2XIIA 1VJZA 4JHOA 5A8NA 4HPHA 4NF7A 3W4RA 5I24A 1JI1A 1Q6FA 3IAQA 1WDSA 4UR9A 1C8XA 2CBJA 3VDHA 1M04A 2XWDA 5A3HA 5IHSA 4DWSA 1HL9A 2WC7A 4GZEA 4D1JA 3WFZA 1CGWA 4HA3A 1B30A 2O92A 2WK2A 1UR1A 2D2OA 1UA3A 1JZ7A 1QI4A 1CENA 3VMNA 5AC5A 4AC1X 1HF6A 3CO4A 5CPTA 3GXIA 2J62A 1V0NA 1LJYA 2FDMA 3FAWA 1X1NA 1PZ2A 3WD3A 3GBDA 2J79A 4U3AA 3SCTA 1CGTA 3OGRA 1HVXA 4F9JA 3VD3A 1KBKA 3K1DA 3THCA 3NDZA 1RP9A 1W91A 5D8WA 1WCGA 2DSVA 3AZTA 4QP0A 3RILA 2CKRA 4DUWA 4CGTA 1RP8A 3LPGA 1H5VA 3MV11 1ZBVA 3DYMA 1CDGA 1V0LA 2XFFA 3WD1A 2V38A 3FAXA 4W8AA 3POHA 2VJXA 4W89A 3UR7A 1OGSA 3T0DA 3HJEA 2DPEA 2PWDA 3CHFA 4BF7A 2W61A 1PPIA 1E55A 5M17A 4E4PA 3NSNA 1KWGA 1H11A 1UD8A 2W62A 2GUYA 3ZJ6A 4CCCA 1OIFA 1M01A 5ABFB 4PTVA 4V27A 2IXVA 3FHAA 3ZT5A 3ZT6A 1NM9A 3APGA 1O6IA 1JF6A 2WZHA 1MXDA 3CZKA 1W9DM 3DC0A 1JD9A 3TOPA 3QHNA 4H8VA 1IZKA 1UWQA 4Z2IA 4CU6A 5JBEA 2XGIA 4AZ5A 1C7SA 2PWFA 5FD0A 1CTNA 2QHAA 1XYZA 1QI3A 4J7RA 5IHRA 3WNKA 4JKKA 3WELA 1MXGA 3L2LA 4OKDA 3AIEA 3KEHA 4MNJA 3RIKA 1TA3B 5CLWA 3VU2A 5A94A 2X09A 1LF1A 1VENA 4URIA 3WQVA 1HNYA 3GBEA 3LPPA 2OSWA 3MUAA 3MANA 5D9PA 3RO8A 4TX8A 1UWIA 1EQCA 3GXFA 1E5JA 1C8QA 1CYGA 2DSWA 2XFYA 5F7UA 2WC4A 1XSKA 2Z1KA 1NQ6A 1OGGA 5AY7A 3LPFA 1BAGA 1TVPA 4MB5A 4EK7A 4AY1A 1E6SM 1QI2A 4F79A 1V08A 4ATWA 2VMFA 1X6NA 3PZUA 1JFHA 5A6BA 1GOMA 4QLJA 2WKGA 4MDOA 3TTOA 2FH8A 4K68A 5FL1A 3AIUA 3D5HA 1VAHA 1EQPA 2WHLA 3KWXA 4J28A 4U33A 4QLKA 4PTMA 4U3CA 4UZUA 3VNZA 4B3KA 1QI0A 2G3NA 1W3KA 1OGBA 1Q6EA 3QOMA 3AI0A 2CNCA 2ZX6A 1DWHM 5GNZA 1J0JA 4P7NA 3W27A 2ZICA 2EPLX 4NZCA 3OLDA 3OLIA 4B9YA 4H8HA 1FHLA 4UNIA 1GZJA 3GH4A 5HBFA 2J8GA 4EANA 2V5CA 1MW0A 1IZJA 3AIQA 3SEPA 4CD4A 2E40A 3VDAA 4UQAA 3VGHA 1P6WA 3AS2A 3MSGA 1A47A 5A6MA 1E4MM 1J0HA 5BYWA 3SUSA 3TA9A 1ZL1A 1E71M 2E0PA 4XB3A 2EPOA 3AMGA 3W81A 1BYBA 3JUGA 3SCUA 2C8NA 4UOQA 2XM2A 3ARQA 2X2YA 1XCXA 1GORA 1WDRA 3UG4A 1MW3A 4JCMA 4F66A 1V6WA 1NARA 3ECQA 3VIHA 1HIZA 1B9ZA 4D71A 2G3IA 3VGGA 4R27A 2XTKA 1XCWA 3WEZA 6CGTA 1HJUA 3SIMA 5LA0A 4TUFA 3SURA 3CPUA 2J7CA 3AHZA 7A3HA 4M80A 1LWHA 1J11A 2E8YA 4ZXOA 3W37A 2OSXA 4ZEPA 3AIRA 3K46A 1HKIA 5CSYA 1J9YA 4RE2A 5FCZA 1MVYA 1E40A 4MDPA 3WH5A 5C70A 2Y24A 2VI0A 4H8UA 1Z32X 3A4WA 2WANA 2PI6A 3AZSA 4D6IA 1CZ1A 1JYVA 4KGJA 2G41A 2O9TA 4JL1A 1GQKA 3ZJ7A 2W67A 3TP4A 2J47A 2C0HA 1PAMA 4JKMA 3PZVA 1UWRA 3IJ8A 5A8MA 3THDA 1UD4A 4B9ZA 2CERA 1ISYA 3BAJA 1BF2A 3WF3A 1UH3A 3AISA 4WKFA 3CTTA 1ITXA 2WMGA 3CUIA 1M03A 1UKPA 2WMIB 1D7FA 4AIUA 4FF5A 2V3EA 4C7DA 5ABEA 5I78A 4UQDA 3VM5A 4GINA 4J3VA 1CGVA 1K9EA 1XH2A 1KCLA 3WDRA 3O2LA 1B2YA 4E2OA 3RPMA 1PX3A 3CZLA 1BYDA 3WUGA 1FFRA 1ZU8A 3AXIA 1JF5A 2OLHA 3WEMA 1V02A 3WFLA 2J25A 5CSUA 5JBDA 3ZMRA 2DT3A 2DGAA 1W9XA 4LX4A 4P7OA 2PWGA 1UQYA 4YHGA 1X6LA 2FHFA 2DQXA 1QI5A 3UEQA 4FK9A 4UFKA 5HPOA 1EA9C 1XH1A 5ABHA 4Q22A 1W32A 1CXIA 2QMKA 2JALA 4DWSB 1OM0A 2IUZA 1MYRA 4QLLA 3WQ5A 3EMQA 4ZE4A 4E8DA 3WL0A 2UWFA 3CUFA 3SCOA 3WD2A 1ZJAA 2ZX7A 2VX5A 3VM7A 2Q8XA 4NRSA 1KXTA 1WKYA 1US2A 2GVYA 1JL8A 1BSIA 1HL8A 1TCMA 3GDBA 3VD9A 2ZUVA 2ZX5A 4KGLA 2XSBA 6A3HA 4ACZA 2EQDA 3IJ7A 3VIMA 4B3LA 2J7GA 5BXSA 1BVNP 2CHNA 5FOOA 3CZJA 4HOZA 1UG6A 2VR4A 1JZ5A 2WVUA 4AD1A 1R87A 2WMHA 3BGAA 3MU7A 2OWXA 3NJ3A 1GONA 3WDQA 3ZJ8A 4AD0A 3KL0A 5BXRA 1VBRA 1EXPA 3N18A 1DTUA 5CLTA 2PF0A 4N42A 1YHTA 4LXFA 4PUEA 4UFIA 5GNYA 3RM4A 4D6JA 3WMBA 1SMDA 2BY1A 1LL6A 3K4DA 4QCFA 5EB8A 2YIHA 5D4YA 1SR0A 1KGWA 1V0KA 3WBEA 1JD7A 2W5FA 1YQ2A 3M07A 3A3HA 4W88A 4UQBA 4PEEA 4AZCA 1IT0A 3N15A 5BRPA 3RDKA 4MAZA 1ZBWA 2VURA 3EMCA 1DWJM 3VGEA 4A3HA 1JI2A 4S3KA 3NUKA 1TFVA 3SCPA 1WPCA 5E0FA 4U5KA 5IXEA 3DYPA 3PZOA 4HZ6A 7TAAA 4Z2HA 3W28A 1VRXA 5E9AA 2WWCA 2CPUA 2E9LA 1JXJA 1K6AA 4JFTA 1QHPA 2WPGA 4EAMA 3U5UA 2NW0A 4PYSA 3VD7A 1C8YA 2Y5EA 1FH8A 2CIPA 3CUGA 1ECEA 1LLOA 1JIBA 3I3BA 4AZBA 3A4AA 4TVDA 3W6MA 1BYAA 2ZX9A 1K9FA 1ISVA 2VZUA 5A6JA 2WHJA 4U2ZA 4HOWA 2PWHA 2FHBA 1R8LA 3OGSA 3T08A 4DUVA 4JHZA 2VQTA 2WMFA 2WLYA 2ZUMA 2GJXA 2QLYA 4L4PA 1ZBKA 3WNLA 3ZIZA 4WLCA 1HN1A 1BLIA 7CGTA 2PBGA 4M81A 4Y7EA 2EPKX 1MQQA 4GZIA 4JIEA 4M8UA 1NH6A 2NSXA 4AD2A 1VBUA 2QPUA 5A6SA 4J3XA 1UZ1A 2A3HA 2CBVA 3KL3A 3WENA 2J75A 1V6XA 3CH9A 4DUXA 1US3A 3L4XA 4XZWA 1GHRA 2C7FA 5E09A 5C8BB 4JFWA 3VIKA 1CXHA 2VUYA 1OIMA 3GNRA 8CGTA 3OLEA 5HDRA 1UD3A 2WMKA 3OB8A 2YL5A 4FLSA 4UOZA 5E6ZA 2D20A 9CGTA 1AQ0A 3G6MA 1V6VA 1UOKA 3VILA 2J77A 1M7XA 4GI6A 1C91A 1XRVA 4PMRA 4HP5A 1K9DA 3F5LA 2MANA 5DEZA 2WZIA 3UR8A 3CMJA 2BVDA 4HU0A 3OG2A 3WEOA 3F5KA 3WQ4A 5CGMA 4JFUA 4Z2KA 2GK1A 3ARSA 3WQ8A 1UR8A 3CBWA 1OB0A 1HXJA 3PZTA 1GCYA 1UR2A 5ECUA 4LPCA 2OYMA 2JFEX 1O7AA 4IPLA 1L8NA 2WVVA 5M03A 3AROA 3L4VA 4OOUA 3B8SA 1J10A 1G9HA 1QPKA 1CBGA 2TAAA 1WDPA 1MQRA 4PMNA 1WAWA 5FIPA 1MW2A 3CIVA 2QMJA 4HA1A 1XHGA 5CZKA 4BQ4A 1W2PA 4UZSA 2CITA 1J0YA 4HMCA 1UA7A 2DT1A 1H3GA 3WD4A 1QVBA 4AZGA 1B1YA 4WK9A 3W26A 2BHZA 4FLQA 1KXVA 3FNDA 3D3AA 1QBBA 5BROA 4PMUA 2ESCA 2WCSA 2GFTA 3BAYA 5A8OA 3MS8A 4CD8A 2JEPA 2CESA 3MUY1 3BLPX 3ZR6A 4ATDA 3AZRA 4A3YA 1DHKA 8A3HA 4BA0A 4BQ2A 3ARPA 3N17A 3VPLA 1S46A 3PBGA 4PMZA 4UQ9A 1QW8A 4FMVA 1KXHA 2NT1A 2VC9A 4V28A 3WL1A 1BVZA 3VMOA 1LQ0A 1V3LA 5DMYA 4HMDA 2XVLA 2NT0A 2VR5A 3CUJA 3SCVA 3WMSA 1E43A 1NP0A 2YBTA 4GI9A 1EDQA 4HU8A 1FH9A 4UTFA 3NCOA 3QHMA 4V2XA 2EBNA 2JIWA 4AZHA 3MKKA 1V03A 4GZJA 2PB1A 1GQJA 2VVNA 1JNEA 2CBUA 2ZXBA 2J7EA 1OWQA 3ZQ9A 4P8UA 1KR0A 2FH6A 3WNNA 1GOOA 3HMCA 3AXXA 1W3JA 5D8ZA 1EOKA 3AS1A 2WC3A 3EYPA 1E3XA 1JNDA 1GJWA 2OSYA 3VTRA 2BY2A 1WZLA 1E56A 3W53A 2VZSA 1JYWA 1W9PA 1TUXA 4F9DA 2J4GA 3M46A 3AQUA 4PMDA 4E8CA 3L4WA 3UERA 3KE0A 2AAAA 3FXYA 3NSMA 4U5IA 1L0PA 1GVIA 1MQPA 4IISA 5A6AA 1JAEA 2WSKA 1NP2A 4ACZB 1CXFA 3EDEA 1VFFA 2WCAA 4RL3A 1FP9A 3SUVA 1JZ3A 1QNRA 3M7SA 3PHAA 3CHCA 3NYDA 3ALGA 2AMGA 2CETA 4H41A 3K8LA 4QCEA 1H4PA 2XGBA 3VIGA 4JKLA 1UKTA 3TONA 2BY0A 1QOXA 1HKMA 2XHYA 3SCSA 2A3CA 3GTNA 2ZIDA 2PWEA 2JF6A 5E70A 5E6YA 3WDJA 3L4UA 2EPMX 3U57A 2YBUA 3VD4A 1F4AA 1H2JA 5GPRA 1E6ZA 1UUQA 2JIEA 3POCA 1E4LA 1UH4A 3SUTA 2E4TA 2D24A 3EDFA 2CCRA 1BGAA 3UG5A 3ZOAA 2BHUA 5JUVA 1G94A 2YL6A 5HNNA 2VO5A 4CVWA 1D2KA 4UQEA 2EPNA 4DM1A 4W85A 3WDHA 3UESA 2JE8A 3N9KA 3RCNA 1BTCA 1VEPA 2BY3A 4ML4A 4BCEA 4U2YA 2YLAA 3VO0A 3AHVA 4OZOA 3SCWA 3PZMA 1HJQA 2VOTA 4KH2A 1WZKA 4AZIA 3NDYA 2EJ1A 1B3XA 3AMLA 1N82A 3PZNA 3W0KA 2WM0A 2Y2WA 4PMQA 4DWSC 3CHDA 5KZ6A 5A95A 1E15A 1CLXA 2BNJA 4KMQA 3U7BA 3T09A 2D1ZA 4KRUA 3CZEA 4NSBA 4PN2A 1GOIA 3GH5A 4BZYA 4MB3A 1E4IA 3WF0A 1UWUA 4BQ3A 1J01A 3CHEA 1VEOA 1UKSA 1JDCA 4P8XA 1B3WA 2X8RA 3VX1A 1QNOA 3AIBA 3TTYA 3WUFA 2UY5A 2GJXB 1JZ4A 4WJXA 4UCFA 1KXQA 2V3DA 4J3TA 3ZR5A 1KGXA 4LYQA 1W1VA 2FGLA 1DWGM 2BV9A 3B9DA 5DT5A 4HOXA 1ZJBA 5A2BA 4D6GA 3VDCA 1UQZA 3QGVA 1E0VA 2DT2A 4D6FA 1VFMA 2HISA 2WHMA 1Y7VA 3WF4A 4XUYA 1EDGA 2CEQA 1UR0A 2ZUTA 3N04A 3IANA 2VZTA 1UD5A 1LG1A 4KRTA 2BHYA 1CIUA 1FFQA 2O9RA 4TX6A 2VZOA 1CGYA 3OIHA 1R86A 1W1PA 3ARZA 2XM1A 4W8BA 3A6OA 4J3UA 5D9NA 4D72A 1GOKA 1V3MA 1OSEA 2X0YA 3VX0A 3AICA 2VX7A 4JCLA 4PMOA 1E1EA 1TG7A 4TVUA 1AVAA 1AMYA 3WN6A 3OLGA 1AQHA 1JYNA 1NOFA 2E9BA 3AIVA 1W9VA 2BVYA 1TZ7A 4OUEA 1ODUA 2GK1B 4MNMA 2WW5A 2X05A 2OWCA 3A4XA 5EMYA 4CKQA 5FL0A 4J27A 1MFVA 2VCAA 3AS3A 3GNOA 1FHDA 1B0IA 2QV4A 4WIWA 3W82A 1U33A 3VGFA 1OD8A 2WVVB 4NI3A 4OBSA 2J8FA 2VTFA 2ZWZA 1GUVA 3U7VA 4ZFMA 5A2AA 2G8ZA 1QNPA 1V3JA 3BLKA 1ZS2A 2ZXAA 3W29A 3WH9A 3MMUA 1HX0A 3AS0A 2BS9A 5HPCA 1CLVA 1XD0A 1Q6DA 5DT7A 1JDDA 2V3FA 1A3HA 2D23A 2YLLA 3T0BA 2YA2A 2FHCA 4D6HA 1KGUA 3PZIA 4LGXA 3FY1A 3K8KA 3ZT7A 1V0MA 1UKQA 1UZ4A 3WNPA 3EDDA 5A8PA 4P8VA 4PMXA 2VL4A 3EDJA 3AHYA 4AZ6A 4AXNA 2XUCA 4Q7NA 6TAAA 3WUBA 1H09A 5BXTA 1E9LA 1H41A 3FW6A 1U30A 4PUDA 1E6NA 3GXMA 4JFVA 4TOQA 2RGMA 2XWEA 4MAVA 1E6XM 3WDIA 2CXGA 4TXEA 3B9AA 3PN8A 3N1AA 3VDBA 4CN1A 2QF8A 1XSJA 3GYCA 4TTUA 1E6QM 5A69A 1WZMA 2XSAA 2YA1A 4D6DA 4JFSA 1UD6A 3GH7A 2Y4SA 2YDSA 2A3EA 1E4NA 3WNMA 3WF2A 1MFUA 4W86A 3UETA 4WSKA 3OBAA 3ARYA 4GO9A 2ZUUA 4MADA 3GM8A 5A6KA 5I5RA 2QPSA 3KZSA 3VGDA 5BCAA 1CGXA 1BFNA 1ISXA 3BXWA 2X1IA 1H0GA 3IK2A 1KR1A 1VF8A 4CD5A 1R85A 3VIPA 3S6TA 5M5DA 1CECA 1TVNA 4WKHA 2HVMA 3W6LA 3OA5A 3PZQA 3OZOA
chains in the Genus database with same CATH superfamily
4GI8A 1KA9F 4DBEA 2G4FA 4N9BA 2YZRA 5C9ZA 2D2HA 3S3GA 3SM0A 4RZBA 1GHSA 1DJHA 1VPQA 2ANUA 4EKJA 3FDKA 3GQYA 5EMKA 1TYGA 4S1FA 5D2YA 1XGEA 3PPHA 3PC0A 1OD0A 3ATYA 1XRFA 5AFDA 2VFIA 5U7SA 3MT1A 5GVJA 4CNPA 3AJ7A 3PFMA 4S3JA 3UPMA 3CHVA 1V6UA 3HPSA 4NZ3A 1OC7A 2V5DA 4DF1A 2P50A 4UTKA 3ONBA 4DO7A 1N55A 4D1IA 3RNDA 3TE9A 3MUZ1 2XPKA 4QE4A 5HXMA 2D3NA 3ZWSA 1B4EA 3BLDA 5D9MA 4W5UA 4R5EA 4GXPA 1K6WA 4AH7A 1BWLA 2PTWA 3EA1A 1GK8A 3OPSA 2ZA2A 3AALA 6ALDA 4CN6A 1ISWA 5DLCA 1UHVA 2POTA 1A3XA 1T6MA 1TMHA 1IR2A 1O95A 3DXIA 2Y63A 1F4HA 1QCWA 4JYEA 4JD4A 4FP1A 4ZMGA 2REQA 3W2NA 4F2BA 2QJMA 3LQGA 3M6DA 3FA4A 4JX5A 4B16A 2OG9A 3GXPA 1M7JA 1RCXB 3KCOA 2PDNA 3NPXA 4O4WA 1T8QA 1OINA 1E0XA 1TV3A 3TTQA 3L4ZA 2YA0A 2NLYA 1FWCC 2QEZA 1BG4A 5LIXX 3TVAA 4K3ZA 4JQ3A 4IP5A 1BEUA 3FCPA 1DJXA 1B31A 2WHKA 4ZXLA 3H21A 3VGBA 1KO0A 3NAVA 1CXKA 4Q4MA 1NIUA 2GJPA 3NQGA 2DVXA 5I2UA 2NSOA 2PTXA 4WR3A 5G2IA 4ORIA 2WPBA 5C55A 3R11A 3I7QA 3QHOA 1O94A 5AYBA 3JR2A 1S1PA 3UZJA 3W73A 3W38A 5A8QA 4OJYA 3GFXA 3GG1A 2XFRA 2QGYA 4ACYA 1WOBA 1BSLA 4Q8UA 2DZSA 1MZHA 2R9RA 3W87A 1VIWA 3HF3A 3TH6A 1QJWA 2VRQA 1E5NA 4MKNA 1EUNA 5FF7A 3A12A 3J7HA 3TCSA 2A85A 2YSWA 4DHGA 4L4MA 1VHCA 3AFBA 3C3NA 1HJXA 3CK5A 4HA4A 3CGTA 4GHRA 3TJXA 2WLZA 3BMXA 3IS4A 4DPQA 4P7QA 1ME7A 3W1UA 3LHUA 4X9YA 1B3ZA 3AIWA 3K4WA 4KWOA 1BXNA 4IMFA 3W2UA 4Q7BA 1ALDA 3BCDA 3D6NA 2VFEA 4BWLA 4MWAC 3VOJA 5HANA 1CXLA 2FZNA 4C1NA 3EPNA 2FVMA 3O7UA 3AAMA 4REQB 5D9OA 4S3GA 4P8WA 1QHZA 3QC0A 3L5AA 1PIGA 4AWEA 4L1WA 5IDZA 4PUJA 4UOJA 4ENLA 2Y62A 1NDYA 3R6IA 3EWYA 3PBUA 1EGZA 3MI2A 4KS0A 2WZEA 1HP4A 4I9AA 1Q6QA 5F1UA 4LV4A 3HZ3A 3MSDA 3CPGA 4PSRA 1A49A 3JW7A 4DLFA 2EXOA 3CV2A 4YS1A 3C0JA 4LALA 4GD0A 4M7SA 1NTHA 3IRDA 1W5NA 1JGIA 1UR4A 2PCEA 1PHQA 1QPNA 2IQ0A 4PMJA 5EFDA 4RXGA 1PEZA 5AC4A 2Y88A 1R7OA 4JNZA 5TBOA 2CLOA 5LXXA 3QPEA 5LSMA 3B0YA 3CZ8A 2VP8A 4PCTA 5BOEA 3O0FA 4N0RA 1DXEA 5CJ5A 4IHCA 5M2FX 2F2KA 3B9EA 2ZZ6A 1IEQA 1E72M 1XF0A 4NILA 2WB5A 1ONWA 3IPWA 3S9ZA 1GVYA 2GDUA 4IIBA 2QNEA 3EB3A 3L0GA 1O1ZA 4H83A 2HPMA 3WQWA 2UY4A 3L4YA 5KZDA 3QMTA 3VIOA 4QROA 1TMQA 4O11A 3VKKA 2HK0A 3ARVA 5B80A 2HEJA 5KEZA 5ABGA 5JBFA 1E0WA 4WHBA 1MW1A 1XYFA 1SO3A 1NQKA 4M24A 3UBPC 3TN5A 4J9JA 3IJ9A 4ILSA 3P82A 3VIJA 4U10A 3MVTA 1ZJHA 3U5YA 2XVGA 4BQ5A 3GUGA 2HWGA 1Q7QA 3ZJKA 4XD3A 4U28A 3CUHA 4XSMA 8XIAA 1B5TA 3EOSA 5BOOA 3S5NA 2RJGA 2XVKA 3IWPA 4HJFA 2NQJA 1UJPA 3MP4A 4GC3A 1W8SA 1RD6A 1XW8A 4QG8A 4AHQA 3SAZA 1F7BA 5ABFA 3QLLA 3PTKA 2OLSA 1IV8A 2PC8A 4HZ7A 3AJXA 2VZVA 1D3CA 5E9XA 2HTMA 1YBQA 1FVPA 5A1AA 1JDAA 4NAEB 1NWRA 4C6QA 4LY4A 2BX7A 4DXKA 1AW1A 3U6WA 3VZZA 1TE1A 4L80A 4MLJA 4K2SA 2DIKA 5JIWA 3P67A 1GKRA 3AHTA 3WBWA 2VT0A 3ARXA 2XIQA 3W7OA 1VH7A 4S2BA 3LRLA 1KFLA 1NU5A 4P7RA 2GSJA 2VENA 2VVSA 3UJFA 1HJVA 4DWSD 2Q8LA 4TV6A 2VGFA 5B7YA 4B2DA 4XZNX 2P5NA 4LUSA 5LNRA 1FX6A 5KSWA 1B3YA 1FWJC 3IRSA 3MB9A 2EG7A 3A5FA 4QNWA 2ON3A 4YN5A 4LS2A 1Q2RA 1FDJA 1WB0A 4F2UA 4XZBA 1Z69A 3U3HA 3WJZA 2X1UA 1FWAC 2CZDA 3ARWA 4QFUA 3I3EA 4ZE5A 3RITA 7REQB 4HK7A 3VXGA 3L12A 1UWSA 3LOTA 5LIUX 1R9ZA 3T2OA 3DECA 1LL4A 3HG4A 3SCNA 3VIIA 3LB0A 3RJXA 5H91A 1ITCA 4AB4A 3WNOA 2RDUA 3HG3A 6ENLA 2XN0A 2RJHA 1A4MA 2CWNA 5BNKA 2D22A 3M0HA 3PTQA 4XO6A 4KEUA 3AHXA 3ALFA 1ZPTA 5T9CE 3TYCA 2V68A 5I3DA 4BHYA 3E0FA 3LCLA 4PTXA 1F61A 4GKTA 4KBXA 3B3DA 2VRKA 5AN7A 3DBNA 1E51A 1WP6A 4H7VA 1PCWA 2V3GA 1J0ZA 3BOLA 2AKZA 1HKJA 1XLKA 3XINA 1FWTA 1EHAA 2OCZA 1F76A 3FHQA 3QMSA 5D2VA 1GJUA 1XDMA 3O0KA 2CBIA 4H00A 1DEDA 4IP7A 3ES8A 4B15A 3BC9A 2HQAA 2QIIA 4JYDA 4BK9A 4GBDA 5CAHA 3VC5A 3UXKA 1AMKA 4HD5A 2D3LA 3FK4A 4IH3A 2UY2A 2RDWA 5FESA 1FWWA 4A3UA 3FX4A 3N4EA 4H9TA 4AVNA 4V1YA 3N6QA 3NIYA 1W1TA 5DN1A 3NVDA 1V5XA 1IWAA 5G1MA 2GGIA 4WXYA 8RUCA 1H49A 5A6BD 3LHYA 5CG0A 4H01A 4H7ZA 3VNKA 3V1PA 1EUAA 1LLWA 5HUOA 2WMIA 4AFYA 4WXZA 2GQ8A 2OVLA 3TIMA 3WQFA 2B31A 1HKWA 5D32A 1T7LA 2R1PA 1J2BA 2F84A 1R3TA 4RE3A 1TWIA 5FKYA 5FJJA 4NY2A 4CCEA 4ZR8A 1TWSA 4E4FA 2BXZA 2WSQA 3N14A 2YBVA 4X63A 2ZDSA 4UMCA 4W5ZA 1F3EA 1OFOA 4XAZA 4RDVA 3TC3A 1JCXA 4IZGA 2G97A 2OLAA 1VJZA 4GQ0A 2CHRA 4DAFA 1I9CB 2ALDA 3W2KA 1QUMA 1JI1A 3LLXA 3ZVHA 2EAWA 5BRBA 1ZNNA 2CBJA 1E0UA 3IIVA 2OZ8A 2A3LA 2XWDA 1D3HA 2WC7A 4FF7A 1UIOA 3WFZA 3LHTA 1B30A 1B4KA 2WK2A 1UR1A 1JZ7A 1V93A 2OODA 1IXQA 4AG0A 1TV7A 5AC5A 4D2JA 4AC1X 5CPTA 3LCWA 4ZO6A 3ISIX 3NR0A 3VOHA 4NUWA 1V0NA 3OZYA 1PYFA 3S83A 2OGYA 2QUTA 3OGRA 4PR4A 4Q8NA 5HNRA 2PC4A 1LRTA 1KBKA 4A3RA 3AU2A 4GY1A 1J4EA 3S5ZA 1QT1A 1WCGA 4FXJA 2DSVA 1VFTA 2JK2A 1RP8A 2WOQA 4I6VA 4AMAA 5I06A 3MV11 3P5YA 3DYMA 1CDGA 2XFFA 1W31A 1VBHA 1R47A 1QPOA 4W89A 4W8AA 3UR7A 3G1YA 4LYKA 3T0DA 2QJHA 3MHFA 3E96A 1XYAA 2BWGA 4NAFA 4AF0A 5M17A 3B0PA 4E4PA 1KWGA 4R9OA 3JVAA 5K7JA 4BFAA 1UD8A 1HO1A 4XBSA 3ZJ6A 3V0UA 1OIFA 1REQB 5I00A 4UTIA 3ITXA 3ZT6A 4BR1A 3UQNA 4XZLX 4GH1A 1JF6A 1JRCA 2WZHA 1OF6A 3TYEA 4O50A 3DC0A 3H2AA 1IZKA 4S3DA 1P48A 2XGIA 3E0LA 1Q6LA 3NZRA 3VKCA 5BU9A 2WO5A 1IF2A 5IHRA 1IQ8A 3WNKA 1MXGA 4OKDA 4GG9A 2X09A 3FOKA 5CSRA 3APYA 3HFTA 1HNYA 3GBEA 4RV8A 3LMZA 2DZVA 2OSWA 3MUAA 2GWNA 3WBYA 1R3QA 3C4UA 5KZEA 2AGTA 1EQCA 1CLKA 3PAOA 2XFYA 3BANA 5F7UA 1WV2A 4UXDA 1DORA 5AY7A 2FZDA 2QCNA 1AG1O 1RK5A 1BAGA 1QPQA 2YCEA 4E5TA 3BVJA 3DFSA 1YADA 2QUMA 1E6SM 1SW0A 2VGGA 3P60A 4ATWA 2G4JA 1QW7A 1X6NA 3KP1A 4MDOA 1NDVA 4K68A 3NQ8A 2ZZ2A 4XWUA 3MPGA 4W4QA 2BG5A 3L0NA 2G0WA 2CZVA 1QI0A 3F2CA 4KCWA 5FJTA 1Q6EA 3QOMA 4DY1A 2A4AA 4EPBC 4Y90A 3E0IA 3W27A 3OLDA 1FHLA 2IKJA 4UNIA 3GH4A 5HBFA 3MKCA 4Q8VA 1TX0A 2ZZ5A 2V5CA 1A5AA 3BZJA 3SRFA 3C86A 3M1ZA 2WJFA 4UQAA 1TV2A 4AU0A 3UT0A 1OYCA 2E0PA 3PANA 2EPOA 4L64A 3DAQA 3W81A 4NNCA 3RF9A 3JUGA 3SCUA 2ZZ4A 2A1YA 4FIRA 2XM2A 3ARQA 2X2YA 3UG4A 2I7GA 4F66A 3ECQA 1QDSA 1B9ZA 4L7ZA 3VGGA 2A0NA 1YYAA 4ML9A 1A5OC 1E0TA 3U2OA 3SURA 3LTPA 3O6YX 4DLMA 3LV5A 4M80A 1LWHA 4R34A 2PD5A 2E8YA 3UXLA 1UPMB 1LQ2A 3AIRA 3K46A 4H8NA 4YL2A 5AKQA 4ZEPA 1HKIA 1E40A 3WH5A 2XH4A 3B8UA 1Z32X 2WANA 1IIHA 2VEKA 1JYVA 2OKOA 3HIJA 3BW3A 3RAOA 4XD5A 3G0UA 3Q94A 2DY3A 3PZVA 1OX5A 3MBDA 1TIMA 2FQIA 3KBSA 3W74A 4B5SA 2W9MA 3THDA 3GK0A 4X2PA 5XINA 4RCXA 4WKFA 5C0QA 3NZGA 3GVVA 1ITXA 1K8CA 3K2GA 4GYPA 1TPH1 1MDLA 2H6RA 4UQDA 4WJEA 4GINA 4J3VA 3DDMA 3RPMA 1OX4B 2YB1A 5HUPA 3LNMA 4RW3A 2KX9A 2BGNE 3WUGA 4HVXA 1MUMA 1YPXA 4JTGA 2OLHA 4LUTA 4ICMA 5JBDA 1X7IA 2HV5A 3TXZA 2DT3A 3SRHA 1IGWA 2BBFA 1LBFA 2HRWA 2FHFA 2DQXA 2TPSA 3UEQA 3RO6A 5HPOA 1H5YA 5ABHA 2GZXA 1W32A 1DXIA 1CXIA 3NZ1A 4DWSB 3R13A 1OM0A 3GIPA 1EWDA 1S2UA 3WQ5A 1QK0A 4IMAA 1YE6A 5J8LA 3CUFA 1QWKA 1ITUA 5GJMA 4IT1A 4LVDA 1ZJAA 3VM7A 3GXNA 4IICA 1KXTA 4ZQRA 1L6WA 4UR8A 1K77A 1UC5A 1JL8A 2ISDA 3SBFA 1PSCA 4LB3A 1WXZA 2C71A 2AMXA 3NQ7A 4OU1A 4LWWA 2VXNA 5T8GA 3IJ7A 2J7GA 5FOOA 1BVNP 1EB3A 3FYPA 2WVUA 4NYUA 4O10A 2WMHA 3ES7A 2OWXA 4K8HA 1XKYA 4AD0A 3KL0A 1YHTA 2Z6JA 2Q8ZA 4QTGA 5C9WA 1RUSA 1Q7ZA 1NFGA 2BY1A 3K4DA 2PGWA 3VFLA 3H54A 1B9BA 1S1RA 1SJBA 3QF0A 2YIHA 4L65A 4O1DA 3BG9A 4Q4PA 2QCHA 2QUVA 2Y5JA 3A3HA 4UQBA 1NF7A 1GEHA 1V51A 5E0KA 3G5EA 3W7QA 3N15A 5C9RA 3ITGA 5C2XA 3CB3A 2GGEA 1I4NA 4HQVA 3PJUA 4LF1A 1N8IA 2QAPA 1FWNA 4R9XA 3E12A 7TAAA 2QUNA 2ZRXA 1VRXA 1XLLA 4N4PA 4K36A 2WWCA 4Y6GA 3N4AA 5LGXA 1HFBA 2AQOA 3MYOA 2CLLA 3DX5A 2WPGA 4GGHA 3R8GA 1TQJA 2VFGA 1C8YA 2Y5EA 4M0XA 4I7VA 3R58A 3CUGA 4J1OA 1WBJA 2SFPA 4I3GA 1DIOA 5BW6A 1PDZA 1LLOA 1JIBA 2FGBA 3I3BA 3A4AA 4TVDA 3NOEA 3IJIA 1K9FA 1ISVA 5T9BG 1S5NA 2WHJA 1R3RA 3NPVA 2VQTA 3FIGA 2ZUMA 2GJXA 1ZBKA 3PJXA 1TPC1 2BSLA 3ZIZA 3RN6A 7CGTA 2W6RA 3AWOA 4L9YA 3Q45A 5GJPA 4CQBA 1VYRA 1NJJA 3RCMA 3U48A 3CC1A 2JKEA 2VM8A 7XIMA 3PS7A 1H61A 2A3HA 3T07A 3WENA 1US3A 5EA9A 5E09A 4M51A 2YFOA 1S2AA 2X30A 5HDRA 2WMKA 3CV6A 1YTEA 2D20A 4Q4RA 3M5XA 1EEPA 3PULA 1VR6A 1UOKA 3VILA 4IUOA 4GI6A 3EEZA 1DIEA 1PZ1A 4NNBA 1XRVA 4PMRA 3NQAA 2MANA 5DEZA 2PTYA 2CFFA 3URBA 4HNLA 3WQ4A 2GK1A 3ARSA 2QIWA 4YJ5A 1UR8A 3DG7A 4PRTA 1N8FA 5D2WA 1XIDA 2YGYA 1IE7C 1HXJA 3U8GA 1C8VA 5AHNA 4EPEC 3PZTA 1H50A 3NZQA 3TQVA 2QCCA 1NDZA 3PTDA 4LPCA 2OYMA 3TROA 2WVVA 5M03A 4O53A 3L4VA 4FZIA 1K02A 5D02A 2CLEA 3LNPA 3N4FA 4X9SA 4G7EA 2TAAA 3PJTA 4US6A 1WDPA 3OODA 5I3IA 3DU0A 3NO1A 5IBXA 2GUUA 3HMJG 2CWXA 1TTQA 4LNCA 2Z26A 4BQ4A 4UZSA 3F7JA 4XVDA 5CG7A 3WD4A 3EPOA 1M9HA 1B1YA 4WK9A 3RX2A 2B0MA 4IPJA 5I02A 3A9IA 3CASA 4MHBA 5A8OA 3MS8A 2YXGA 4CD8A 3GAKA 2JEPA 8A3HA 4BA0A 4UTTC 3N17A 2G37A 4ZQOA 4JIHA 4RPQA 1C29A 3AUOA 4FMVA 1KXHA 3NL5A 3DIPA 2QT3A 3WL1A 1BVZA 4GJJA 1R38A 1RA5A 2Z1XA 4L9ZA 2XVLA 3TN6A 1BWKA 4O28A 1CT5A 4GNJA 4JXCA 3V5FA 3H7UA 4AIBA 1P7TA 1RSCA 1FH9A 1R30A 3WLLA 3LXAA 3VUSA 1DOSA 4AZHA 3F4NA 1I45A 2VFFA 4AEOA 3NEHA 4LAUA 3O6CA 4LUSB 1V03A 2OQYA 1JNEA 4DJEC 1CB2A 2C3ZA 2J7EA 5C9XA 3DI1A 3WNNA 1GOOA 3FA5A 3LCFA 5HATA 1FDYA 3EYPA 2OSYA 1XPYA 3QH2A 1MUWA 2BY2A 2VZSA 1JYWA 1H60A 4RZ5A 4JTCA 4F9DA 3AQUA 3OHIA 2FFCA 3GS6A 4GISA 2C91A 4O17A 3UERA 3QLDA 3N2OA 4IISA 1JAEA 1RY8A 2YCLB 3B06A 1OFDA 2YX0A 3S5SA 3T9PA 2WNQA 3CV1A 2Q01A 4KFOA 4JTHA 4ACZB 4GBUA 1JZ3A 1QNRA 4LTSA 3PHAA 2I14A 3NYDA 2AMGA 3V0SA 2CETA 4H41A 1H4PA 4JKLA 1RQEA 4JTQA 1FCQA 4IGSA 3TONA 2Y89A 3KLLA 2VFHA 2DV0A 2D2GA 3SCSA 2ZIDA 4GYKA 2JF6A 2GGHA 5E70A 3LZ5A 4I90A 3L4UA 4YLWA 3AO0A 3I6RA 3TQ0A 4I8DA 4AUBA 1C9DA 1KTBA 1L6YA 3GR7A 4QGCA 2R1KA 1BGAA 3UG5A 1K1DA 4B4FA 1G94A 5LIYX 2VO5A 5HK4A 4E3TA 2OTDA 2EPNA 3G77A 4W85A 3WDHA 4N6EA 2JE8A 3RCNA 2Q3RA 1VEPA 5H2ZA 2FVLA 4ML4A 4XG1A 3K30A 3H2MA 3SCWA 4OZOA 3W84A 1WZKA 3HJZA 3S47A 1Y65A 3LXCA 2X2GA 3AMLA 2A21A 2WM0A 3T44A 4OWGA 3BPWA 4UTUA 4DWSC 1YXYA 3CHDA 3CL7A 1E15A 2BNJA 4KMQA 3WK2A 3T09A 5HWMA 3P6LA 4O0ZA 3CZEA 4MGGA 4XZIA 3KTSA 1F3TA 3L0KA 4BZYA 3GH5A 1P1XA 1SZGA 2ZA1A 1UKSA 3B9NA 4QEHA 3U9IA 3AIBA 4DJDA 2O7QA 3GYEA 5CCZA 3V7PA 2OB3A 3GVGA 3F4WA 4UCFA 1G67A 1I8JA 1KXQA 4WY0A 4J3TA 4YMZA 1X1ZA 4MF4A 4X22A 1DWGM 3B9DA 1H7OA 4YVVA 2BMBA 1E0VA 1VFMA 2HISA 4XUYA 3PR2A 1UR0A 3ITCA 5F4XA 3H12A 4NZ1A 1WKEA 2I56A 1LG1A 4GIEA 3KVJA 1CGYA 3CL6A 2ISFA 4JTIA 3N25A 5BWAA 3RLGA 2NXGA 1M3UA 1OSEA 1TTPA 3AICA 3SADA 2VX7A 4JCLA 4XKYB 2E5CA 2VEIA 3UP8A 3UW6A 4H4IA 1FWDC 3EKGA 1W9VA 1TZ7A 5K2ZA 1GVFA 4MNMA 4O4VA 1AD4A 5I07A 2HJPA 4CKQA 4YTUA 2Q71A 4UTHA 3NPWA 4QJ4B 2Y85A 1FHDA 1B0IA 2QJNA 4WIWA 4M6QA 1UP2A 3INPA 3W7DA 1O5RA 4OBSA 3BV4A 2J8FA 3V5CA 1GUVA 4ZFMA 3TYBA 4D8ZA 1JUEA 2ZXAA 3ITOA 3H7RA 4MY9A 2D23A 2YLLA 3SR7A 3T0BA 2H9AB 4Z0JA 1XICA 1UKQA 2QYGA 4ZZ9A 3WNPA 4P8VA 2A7PA 4EVZA 3IVSA 3O05A 3HPZA 2VL4A 4IPPA 5IRPA 4CNTA 3GC4A 3AU6A 3W23A 1H41A 3FW6A 1U30A 3S6OA 2XSXA 3GXMA 4TOQA 2PLJA 2E68A 4HPXA 4TXEA 3LCIA 4Y2WA 1DV7A 1LT7A 3GYCA 3LK6A 4EF9A 3C5QA 3KOZA 1RK6A 3W7PA 1WZMA 2EG6A 3E0WA 4NX5A 1DJQA 2ZKMX 2X1TA 1E4NA 3WF2A 1XL9A 3OBAA 3L5MA 1SM9A 1P6CA 4JBRA 3SY1A 3UY7A 3GW0A 3BLLA 1CGXA 1BFNA 3IK2A 1KR1A 1VF8A 4CD5A 3HBLA 1R85A 2PDYA 2PMQA 3VIPA 3HPFA 4Z1CA 3S6TA 1CECA 1TVNA 1ZQ5A 3FSTA 1JEZA 1JUKA 2EHHA 4Y9OA 1RXOB 2Y6ZA 3NZPA 3W88A 3PAJA 2NUWA 4PL1A 4M29A 5HOSA 3KTCA 1VB9A 3S9YA 5GQBA 2ZTKA 4KERA 1P5BA 4YVXA 3ITTA 1WKFA 3KRBA 4IMDA 2ZC8A 3WJYA 1JDEA 4TU1A 3W22A 1UR9A 3O3RA 1M5WA 3UR2A 5CGQA 3WUEA 3TKFA 3KM8A 1DWAM 3MI6A 2HE5A 1XPGA 3G1SA 1BF6A 1FWRA 4QE5A 5LNUA 4GCAA 1G4PA 2O7SA 2EGZA 1CCWB 3OVQA 1B3OA 2ONEA 1XBYA 1XGDA 3IUDA 3RHGA 2JEQA 3FVMA 3NO3A 1SPQA 2INEA 3F2BA 3U0HA 3EGJA 4FNTA 5JIPA 4C6JA 1SFTA 3DFQA 3SSJA 3ZSTA 5FF0A 3GIQA 1KW1A 3C61A 4NJHA 4DBUA 2E6AA 4HPGA 4WSJA 2ZUNA 2E9MA 1W3LA 2O56A 3IJLA 2EO7A 1XUZA 2WQDA 3QGKC 4QDMA 1WDQA 1TR1A 4D8LA 4AEEA 1JFXA 1BPLB 1GOQA 1PV8A 5CGTA 4GXMA 1CB7B 3OBEA 4ZVJA 4MSSA 4R33A 4NRRA 3RX3A 1XR2A 3LLFA 4J3SA 3GHRA 3VOCA 4POCA 5LNWA 5IOBA 3MYPA 1F74A 4CN4A 3GX9A 1FWFC 3PTMA 2CKSA 3CT7A 3VOGA 5FEXA 3W25A 4MPKA 3RUBL 1KM0A 2VDGA 1U5VA 1OCQA 2PAJA 7PTDA 1OK4A 1I2RA 5CKSA 1EYEA 3LBMA 1DIDA 3PPFA 2C6QA 3QOKA 1MDRA 4W8LA 1KRAC 4LVGA 1F8IA 3R0DA 1XYLA 2PDGA 1VFOA 4LRSA 2VRJA 5KETA 3P0XA 4M82A 4FIQA 1KQYA 5J04A 4CCDA 4WF7A 1Q6GA 3BQ5A 1GJPA 4X0NA 1B3VA 1Q8AA 1QBAA 4WDTA 3TSMA 2F8QA 3QFEA 2YJQA 4O1EA 1J12A 4X0VA 4LUTB 3UZXA 2V2CA 2DZWA 3DN5A 1XISA 2VD9A 4GNKB 1DWIM 4GA8A 3SUUA 4GJIA 3AXMA 3A47A 3ARTA 4ZTXA 2JKPA 3T2PA 3RM9A 1UKOA 3RPTA 3S8HA 3W75A 3K1GA 4MB4A 3KRUA 2YFNA 1SQ7A 1LWIA 2CU0A 1PL9A 2A3BA 3TZNA 2YL8A 3QV6A 4PRWA 4W7WA 2FJKA 3VNYA 4KWWA 1IXPA 2ICSA 2PWUA 1U1JA 3WDPP 4ZOEA 2OZ0A 4DWDA 4C6CA 4CU7A 1R5YA 2PRMA 1PX8A 5I77A 5HMEA 1PWMA 4OBTA 1HKKA 1Q6CA 4LQ1A 3QGAC 4B5NA 1EC7A 4P2VA 3CU2A 4QM1A 1A80A 3W1AA 2C0AA 4LANA 1UD2A 1WKDA 5HR7A 2EJAA 4G2DA 1JZ8A 3C8FA 1DL3A 3A24A 3WKZA 1ZHAA 3HPXA 4GJ1A 1S5MA 2PZNA 3BAXA 3L4TA 4HJWA 4O8RA 4XZ9A 3EB2A 4GUFA 3O6AA 2ZRZA 3MCMA 4LF2A 4MKVA 3THUA 4DUOA 1ZBCA 4G1KA 3WIJA 1IT7A 1PIIA 3L23A 4HNOA 3EZ4A 1TPEA 1EKOA 4FO4A 4LAOA 2X0HA 5D04C 1M6JA 2JGQA 5HJLA 2C1IA 4HKPA 1SMAA 1G0CA 2IKIA 5T91A 3IEBA 1Z44A 2V30A 2ZBTA 1HKVA 4S38A 5HA7A 3VA8A 3UJ2A 3BURA 3EXTA 4J5NA 3C2FA 4XX6A 2ZZ3A 4F2TA 5I3KA 4INFA 4MB1A 1V3HA 3AMCA 3MZNA 1M53A 1JDFA 3D46A 4OVXA 2J7FA 1K8ZA 3GU1A 3M5VA 4O15A 2DUZA 3NQEA 2B4GA 1ME9A 1SJCA 2NVAA 4AEFA 5HWJA 2VWTA 1HT6A 3DFOA 4MWAD 4ERAA 6XIAA 3SQLA 3T78A 2Y8KA 3G8RA 3G0SA 2OEJA 4YPJA 1YIXA 4MJ2A 4YWIA 3VDGA 1SVDA 1W9UA 1ONRA 2TODA 1KQZA 2DSZA 4JQ4A 3E1F1 1TWWA 1GVSA 5EY5A 4NP7A 3NPUA 3N3MA 2YCKX 1SFLA 3W72A 2W92A 1GQIA 3OP2A 2J7HA 2OU4A 4Y8FA 4Q6XA 2XH0A 4L6HA 1XGZA 1D3GA 4RDZA 2A6NA 1HJSA 1PKNA 4ALDA 3BH4A 1L2UA 4PBEA 4NNAA 4M6VA 3RRAA 5DRIA 3H6OA 3WY1A 3F4VA 2VX4A 3KHDA 1BKSA 4XZHA 1S5WA 4FOUA 1UPPA 2QPXA 3ARUA 2QCMA 1EZWA 1X98A 4LYPA 3W1MA 5GNXA 2PGFA 1XM3A 1UROA 3RU6A 3K4AA 4UTWA 1WO2A 2NUYA 2V0TA 2UY3A 2ZVRA 1VZWA 3HGSA 5LYRA 1TA3A 3VUPA 1KFWA 4OOZA 1BXCA 3CM4A 3T40A 2FPYA 4MTVA 1PTAA 4FX6M 4S39A 1GPWA 3CZGA 1GTHA 4S3AA 4W7UA 1GWJA 1XV8A 2Z25A 3XISA 3RMJA 2IPGA 3WK1A 2PGEA 5FJPA 1RV8A 4LB4A 3HN3A 4ZCWA 3TR9A 1AL8A 5FJRA 4LJ3A 4E38A 1G4TA 3P74A 3F4DA 4DX3A 2CZ5A 3PF3A 2X16A 4GPNA 1E6PA 4RKAA 4A8RA 3WF1A 3RMEA 1W1YA 3QQWA 1Q66A 2IPFA 3S46A 2OELA 2WSRA 3VD5A 3LPOA 4G7EB 4QAWA 2YW4A 1EO7A 3DUGA 4GH3A 1KB3A 4V15A 5K9CA 3P14A 4GQQA 4MUPA 1GPFA 1Q8JA 3EWWA 1WDWA 1OFBA 3A3WA 1TJRA 2J78A 5HR6A 1I60A 5IFTA 3EWDA 5D30A 4XAGA 4UBPC 1GQLA 1OY0A 3FEMA 1SYTA 2FB2A 1HW6A 1DP0A 3VVGA 4IUGA 3BSHA 3VZYA 5AECA 3KAOA 4PSPA 4A22A 1BQCA 4MWAE 2RAGA 4P7LA 1C93A 1E3ZA 4IMCA 4C7GA 4Z08A 5A2CA 3GKAA 4GO8A 4OE7A 3SJ3A 4A8NA 2PZ0A 1UH2A 4OGZA 2F9RA 3SI9A 2Q02A 4HMEA 2V8ZA 3ZM8A 4UFLA 2DH2A 1ZP4A 2WWDA 3QR3A 2WXDM 4DM2A 1LG2A 4PTDA 3UVIA 3ARRA 3ANUA 3ZSSA 3VC6A 4HNVA 1BKHA 2HMCA 1DJGA 1DTNA 2ZUSA 5G2WA 2FYMA 4CCZA 4DYEA 5I6SA 2O9PA 4IGNA 3F03K 1G7UA 2CC0A 1FP8A 3QM3A 4W84A 2F61A 2XVNA 3WG6A 3SRKA 1OC5A 1IHIA 2VFDA 2GDVA 4MZ1A 4WRHA 1QMLA 3MMTA 4O54A 3FSUA 2ZADA 1GKPA 1EOMA 3SDOA 4E2VA 3WD0A 3MDUA 1UBSA 2J9ZA 3DHPA 3RLVA 3TYUA 2W0UA 1ODZA 3OZPA 2PP3A 4TMCA 1H62A 4H9ZA 5C7VA 3TN4A 3N19B 3E3HA 2OWWA 2P3ZA 1KRMA 2WBGA 2X7VA 3RJYA 4QX4A 3U2ZA 2WYSA 4IIGA 3VINA 4KFPA 3M0VA 2P0IA 4Z2JA 2DIJA 3TOYA 2VC5A 5BRQA 3E2RA 2WCGA 1KWKA 2VOMA 2X1RA 2EKCA 4JN6A 2Q09A 3PVFA 4K7YA 3KP0A 4KEVA 1FHVA 1VBGA 4UR9A 1EWEA 1M04A 1RD5A 5A3HA 3NQBA 1HL9A 5FEPA 1CGWA 1JR1A 2D2OA 2PDQA 4KWVA 4JTUA 1FUYA 6REQA 4DO6A 3GXIA 1F6PA 5ECVA 3OW1A 1AL7A 1SSGA 1RLCL 3KXQA 1PWLA 2BVWA 5AYYA 1MUCA 1CGTA 4PEKA 2FJUB 1HVXA 4F9JA 3N2TA 4GGBA 3R10A 4B4HA 3WCZA 5D8WA 3EAUA 1Y5XA 1W1IE 3RILA 4FX7A 4CGTA 1VJIA 1M1BA 3LPGA 1F73A 1ZBVA 5EMUA 4C6BA 4G8TA 3WD1A 2OO6A 4Q4QA 2VJXA 1OGSA 3R2GA 3HJEA 3PPGA 2DPEA 4XKMA 3CHFA 2YYUA 4HMNA 4BF7A 1AW2A 1E55A 3LHZA 3A4JA 4QS5A 2I5GA 1RJRA 3OBKA 4CCCA 4PTVA 4V27A 2CZFA 1LOSA 2IXVA 3ZT5A 6XIMA 1NM9A 1O6IA 4NL1A 2GLKA 3UGVA 3SQMA 2F6KA 3WQPA 3F1QA 1VLWA 1JD9A 4JTTA 4HGXA 1LUCB 4H8VA 4WEVX 4CU6A 5JBEA 2JBMA 1K03A 4AZ5A 2PWFA 3PG8A 1CTNA 3A13A 1XYZA 1QI3A 4J7RA 4AQLA 5G1TA 5REQA 1SGJA 3WELA 1JRBA 4PUMA 5DMMA 3FVDA 2VEGA 4S3BA 5CLWA 3MW7A 5A94A 1VENA 1QR7A 4JTDA 3LPPA 2G3FA 3SO7A 4PCFA 3RO8A 1XBVA 1SSDA 1ZY9A 4TX8A 3EWCA 4DJFD 1SW7A 3H23A 1CYGA 2DSWA 4L4LA 2Z1KA 1Q63A 1QWGA 3LPFA 3ZXWA 5H8PA 4YVPA 4EK7A 1Y5WA 4AY1A 3TSDA 3E9AA 3DESA 3S2NA 3TFCA 1OEPA 3T0CA 4QLJA 2FMNA 1PO9A 2WKGA 4HIBA 4QDPA 4LOCA 5DANA 5FL1A 3NEVA 1VHNA 5HNTA 3G1RA 4DIAA 1XLGA 3PUEA 1DJWA 4N6FA 4U3CA 1ICSA 2YCIX 3UNDA 5BMXA 4UZUA 1TWDA 3VNZA 1F9CA 1IYXA 1Q7MA 3ZLFA 3W1PA 3AI0A 4NKCA 2CNCA 3S9IA 5GNZA 1J6OA 3G1HA 3OLIA 4B9YA 4H8HA 1GZJA 1LP6A 3PUOA 3W00A 4X3ZA 1EJRC 3N6JA 3SEPA 4CD4A 5AVHA 3QKZA 2E40A 2BOGX 3VDAA 1TPDA 4R53A 5A6MA 3TA9A 4WDWA 1ZL1A 4XB3A 4MZYA 1S2VA 3FYYA 4ZB2A 4HBKA 3M44A 2Z6IA 4HHLA 5CBJA 2C8NA 4F48A 1GORA 4KWSA 1V6WA 1NARA 4D71A 2G3IA 1XCWA 3O1NA 3GKFA 3CWNA 5MKGA 3HM7A 4BJHA 2J7CA 3AHZA 3BARA 3MQTA 3UWWA 3UXDA 7A3HA 4Q8PA 4ZXOA 1L2QA 4K1WA 4IXXA 1S5TA 1F8MA 2VC6A 5AZ1A 4MDPA 5BOFA 1GVQA 2VI0A 4H8UA 3TK7A 4K8GA 3A4WA 1W1B1 4D6IA 4GVHA 1T5AA 2O9TA 4JL1A 1GQKA 3ZJ7A 1O5XA 4OV4A 3W2LA 2W67A 4AWUA 5K9DA 2C0HA 2YB4A 2Y61A 1I0DA 5A8MA 2OXNA 1AJZA 2PODA 3FJ6A 2CERA 1ISYA 4Z1AA 3BAJA 3H2EA 4AX6A 3VK5A 1XC4A 3WF3A 4YXGA 1UH3A 2NVCA 5L9FA 4FSAA 4FXFA 4UIOA 4WJ8A 2OGJA 4ADTA 3KRSA 5FF4A 5IBXC 1D7FA 2QCFA 1DQUA 1IGSA 5PTDA 5BU6A 4JEQA 3JRKA 2GYIA 1ZTVA 4IQDA 4JPGA 2J25A 3LYEA 3WK0A 5CSUA 3UZWA 4GFSA 3ZMRA 2EKGA 4UB9A 2PWVA 3FJNA 4HYRA 1P6BA 2PDMA 4EOUA 3UCDA 4LX4A 3B03A 5A5WA 3TC6A 2VC7A 3W9ZA 1MYRA 3EMQA 4LUJA 4E8DA 1I2OA 1JPMA 3C56A 1XI3A 1I2PA 2UWFA 3TLQA 4H6RA 2AL2A 3SCOA 4N7QA 3WD2A 2ZX7A 2VX5A 3T1GA 2A7RA 4NRSA 1ZZMA 3TFXA 3QYQA 3UD6A 5LIKX 1WKYA 1US2A 2Z29A 5DCBA 4C6NA 4JIQA 3IIZA 1HL8A 1TCMA 3P2VA 4RNHA 3HOJA 4D8AA 2ZUVA 3RCYA 2ZX5A 4KGLA 3PBWA 4XISA 1RVGA 6A3HA 4C6DA 1H63A 2UV8G 5AC8A 3R5EA 3U4FA 2ZRYA 2ZYFA 3ZYZA 3EWBX 3R12A 1R87A 2XISA 3I4KA 3BGAA 2FZ8A 5AOUA 1GONA 3WDQA 3DG3A 1VBRA 1DE5A 1GEQA 2GQAA 1W6TA 2DZBA 4N42A 3EX6A 3TLLA 2C19A 4KW2A 4PUWA 1RY0A 1SMDA 1LL6A 2ISSA 1QTWA 5EB8A 4JTFA 5D4YA 3IVTA 2H8ZA 3R1ZA 4R7OA 3JS3A 3M07A 4W88A 4JTLA 3NOYA 4AZCA 3UY8A 5BRPA 3STFA 1XINA 2VURA 3QPZA 3EMCA 3TJ4A 1J79A 1JI2A 1GYNA 3GFZA 3NUKA 1TFVA 4C1LA 1WPCA 3W71A 4U5KA 5IXEA 4RZ6A 3PZOA 4Z2HA 4MUZA 5TAOA 4MYXA 1OC6A 2AQVA 4JYFA 2HDJA 1VQTA 1LRQA 2CPUA 5C5YA 2E9LA 3BE7A 3CQJA 3OVPA 1QHPA 4EAMA 2PRLA 2NW0A 4PYSA 3HURA 4AXKA 3VD7A 1FH8A 2QKFA 3KTXA 1ECEA 5FF3A 4QISA 2RH9A 4IGHA 3H4XA 1XLCA 2QCDA 3TEVA 1YDVA 3W6MA 2YCJA 4CLMA 4H9VA 1BRLB 4HOWA 2PWHA 2V69A 3OGSA 5XIMA 1MEHA 3URAA 3M5ZA 2WLYA 2F6XA 4E2DA 1W56A 5LHFA 2QLYA 1Q5MA 1TZ9A 4C91A 2V2DA 1BLIA 4M81A 2EPKX 4GIRA 1MQQA 1QO2A 3UVAA 1NH6A 2NSXA 4CEXC 3A3XA 3P5ZA 2H90A 3A9BA 5A6SA 1UZ1A 3KDOA 1V6XA 2E25A 4XZWA 1GHRA 1G4SA 1XLEA 3VIKA 2VUYA 4S3CA 4KETA 1PUDA 2HXUA 3OB8A 2UZ9A 2NQ9A 2CLMA 3MTWA 4KIEA 3NYZA 9CGTA 4QAIA 4QDWA 3V4BA 4WY0F 3CUXA 2ZFAA 1XDJA 4G7FA 3DHDA 3UR8A 3CMJA 2BVDA 2PD9A 4JFUA 4M1BA 3E02A 3PSVA 3PPCA 2I9UA 1O5KA 4C6FA 7ENLA 3CQ0A 1YTDA 2OOGA 2Y8UA 1OB0A 4IPIA 2GVGA 1WA3A 1GCYA 1UR2A 3UWYA 2Y7DA 1ZRQA 1O12A 1K7XA 3UWZA 1L8NA 2Z1VA 1WUFA 1P43A 3AROA 4OOUA 1FDZA 3NNTA 2EF9A 2E5DA 1QPKA 1CBGA 1DIKA 2A79A 1MQRA 5FIPA 3F2DA 1AK5A 1EA0A 1XHGA 2J66A 3QV9A 5CZKA 1IEXA 3FJLA 1TVLA 1J0YA 3KOYA 4WD0A 1UA7A 2DT1A 2AL1A 3EX4A 2O4MA 4AZGA 2YDAA 1UUOA 3W26A 4FLQA 2ABBA 1KXVA 3MP3A 1GYMA 5BROA 4PMUA 1JQXA 2WCSA 2GFTA 4J35A 4ATDA 4A3YA 2QUUA 1W1A1 1MEWA 4BQ2A 3N34A 2H8XA 3B8WA 4KCUA 3VPLA 3TZFA 1FQ0A 4UQ9A 1QW8A 3PY2A 5HJYA 2VC9A 4V28A 3W85A 3PK7A 1JCTA 3DH7A 3WMSA 3GTIA 3URQA 3D47A 1GG0A 1UR3M 4Q8TA 3NCOA 3VYLA 4I5RA 2B7NA 2EBNA 1TX2A 3RR1A 3MP5A 4GZJA 3VKAA 2VVNA 3N2XA 1LT8A 2DU2A 5G2HA 3LS9A 1HUVA 1KR0A 2PDXA 4FS9A 5FAGA 3HMCA 3AXXA 1ZSXA 2PURA 3EOEA 2VWSA 4CNUA 1OHLA 1Z41A 1JNDA 1GJWA 1H7XA 3VTRA 1E56A 2AKMA 3GHSA 4PMDA 1HGYA 4E8CA 2PPGA 1L0PA 3VOIA 1EP3A 1TPUA 4WGHA 4H9UA 1NP2A 3GVQA 1CXFA 1VFFA 2WCAA 1F5ZA 3K8LA 3TYZA 4EIVA 3BQ6A 4EF8A 1NFBA 4US5A 1R46A 1DQWA 5AVNA 1EIXA 2PWEA 5E6YA 2EPMX 2YBUA 1H2JA 4HK6A 1UUQA 1VFSA 1YMYA 1ML1A 3POCA 2R91A 2VEFA 4GFIA 2D24A 3RRXA 5D05A 2BHUA 4IG2A 3QSTA 1Q6OA 4ZO7A 3FGCB 4Y9NA 5HNNA 3W1RA 1RBLA 2J27A 4UQEA 4DJED 3FKRA 2PDWA 2DZPA 3S5OA 3UESA 1ZAIA 2F7FA 1BTCA 3O63A 4DEFA 2BY3A 3CTLA 2R94A 3B97A 3P93A 2J6VA 4I9MA 1TJ0A 1KFEA 1TREA 4XD4A 4KH2A 2ATSA 4YU1A 2CLFA 3LUTA 4F3HA 4MM1A 4IMGA 4PMQA 4X2RA 4AWSA 5KZ6A 5A95A 3TA6A 4DXXA 1K4GA 5CC5A 5DQPA 4Q32A 4A8LA 1YRRA 4QHRA 1GOIA 1E4IA 3WF0A 4BQ3A 1J01A 3CHEA 1JDCA 1MEIA 1OVDA 3NWRA 2X8RA 4FB7A 1R2SA 3NTYA 1W5MA 2PDJA 3CMFA 1IT8A 3T7VA 4YCPA 1RAKA 2F38A 1TKKA 2V3DA 2XIOA 3GNDA 3PBMA 3ZR5A 4TV5A 1W1VA 1J5TA 4HOXA 5HINA 2QS8A 5D09A 2PTZA 2YPIA 3W7MA 1A5MC 3Q4DA 1E1CB 2CEQA 5C9UA 2VZTA 2NVDA 4HK5A 1LROA 1HL2A 4JTAA 1P0NA 1TV8A 1DJZA 2O9RA 4TX6A 3TR2A 4S3EA 1W1PA 1ZALA 3VNMA 2XM1A 3KBNA 1EX5A 5D9NA 3GG0A 3VX0A 3MY9A 2P0OA 3Q37A 5AHIA 4DI8A 1KFBA 3OLGA 2QVHA 1AQHA 1W5QA 4FA3A 1NOFA 4C6OA 3RXZA 2BVYA 4JNYA 4OUEA 1ODUA 1Y8BA 1DQXA 2OWCA 4J27A 4GVGA 2VCAA 3AS3A 3FDGA 1KM4A 2NX1A 4AVOA 3M0IA 4FAMA 2QV4A 4B5UA 3W82A 1U33A 1JPDX 3NDOA 1OD8A 4REQA 3CH0A 3G3DA 1KV5A 2E1DA 3U7VA 2G8ZA 3GTXA 3CQIA 2FTYA 4G5DA 3S1UA 3TWAA 3WH9A 3MMUA 1HX0A 1XBXA 2BS9A 1OYBA 1CLVA 1Q6DA 5DT7A 1JDDA 2V3FA 3UNTA 2FHCA 1Z89A 3SSZA 4D6HA 3ZT7A 4LY8A 3EX3A 3P61A 3U2EA 3AHYA 2XUCA 4GX9A 4Q7NA 5BXTA 4PUDA 4JFVA 2RGMA 2XWEA 1HO4A 1QRQA 3B9AA 1TELA 3PN8A 1TZZA 3KOWA 3N1AA 3W2MA 3VDBA 1ZFJA 1XSJA 4GMEA 3T0TA 3MCOA 1EJVC 1E6QM 3NFUA 4ZB0A 2NV2A 4MMWA 2YDSA 2P53A 3WNMA 1QXLA 1SJAA 2C16A 1MFUA 5REQB 2V67A 3KFTA 1YTKA 3ARYA 1JJKA 3OIXA 2ZUUA 3NGFA 4MADA 4R88A 4GIYA 5A6KA 4GUGA 3E49A 5BCAA 4BF5A 3NA8A 4O1BA 3ZVIA 3BXWA 2X7WA 2X1IA 1H0GA 4YTTA 1F6KA 5I3GA 4C65A 2R6OA 3W01A 2FTPA 1Z8AA 1ZGDA 4WKHA 1TV4A 2HVMA 4AVFA 3LZ3A 3I4EA 1X97A 4ECLA 3RG6A 3HGOA 5LNSA 1WOAA 4WZHA 3PZQA 4IX2A 4QSHA 3ITVA 3UG3A 3BJFA 4Q3MA 4QIUA 2CLPA 3SGGA 3V16A 5HMSA 1YDNA 2XIBA 1J5SA 3GO2A 4U4MA 3LG3A 3V36A 5D37A 3M0LA 1F3WA 2LLEA 2A2IA 2VHLA 4XAPA 1VCGA 3G6LA 4NZ4A 4JDYA 3UYIA 2DZTA 1KNWA 3ERPA 3LBOA 1E6RA 1E70M 5TF0A 3SRDA 2CYGA 3TYDA 3GZAA 1HTIA 1O68A 2R1LA 1FHUA 4NAEA 5EL1A 4WKAA 1WE5A 5AYXA 3MV01 1JYXA 3IUHA 4KESA 4AIEA 3WX7A 5A6LA 2V82A 4LUIA 2DJXA 4E4UA 2IQDA 2FZMA 2HVNA 4XK2A 3RM8A 4UTWC 4C1KA 1VPXA 4DF0A 2E77A 3L2MA 4PBGA 4I9JA 3MKVA 5MKGB 4LVAA 3PG9A 2Y7EA 3MZ2A 4DNMA 2J13A 3S2LA 3HQPA 3HQ1A 4K8EA 4M56A 2WMJA 2PBOA 4LYRA 4TTGA 1PE1A 3CT2A 4M3PA 3KUMA 4ZOBA 1JZ2A 7REQA 5K3VA 1B90A 4PE8A 4ZBCA 1U22A 4DJFC 3UCCA 2R82A 4KWUA 1ENUA 1CEOA 4CNOA 5AC7A 1FH7A 4PUNA 1MWOA 1KM1A 1UMLA 2W3ZA 1C9WA 3CIWA 3O6DA 3T4CA 3GDKA 3ABOA 3UYCA 4OECA 2E7FA 1AQMA 4ZQPA 3TAKA 3OGVA 3W83A 1KM6A 2W4XA 3HQNA 1CNVA 2QCLA 4W7VA 1NWSA 2OJPA 4HZMA 3KLKA 2W91A 1A5SA 2DZUA 1WZAA 2BOFX 2ZC1A 4WQ6A 3W76A 4F8XA 5DXXA 2RDXA 1RH9A 2OMAA 1F2JA 3BCFA 5EFFA 3U2CA 2E09A 1J0IA 3LA4A 2BXYA 4RR4A 4UFMA 3DGBA 3BW4A 1LTDA 4WOZA 1I1XA 3QPYA 5KMYA 1SJDA 3TC7A 2E1WA 1BTMA 2ACUA 3WQCA 4BY3A 5E1QA 4JL2A 1OYAA 3GHTA 1FTXA 1DWFM 1JCMP 4UFJA 1Q4NX 3S1GA 4B2DD 4JN7A 1R7AA 1PS9A 3BMVA 3W24A 1UCWA 1EDTA 4Z2LA 3STGA 3N11A 1T0OA 3BMWA 4FOJA 1AH3A 5K4XA 1OT1A 4D9PA 1I1WA 4JY8A 4B3ZA 1H7WA 5G5IA 2W63A 4RPPA 1V77A 4PFHA 1A53A 3NO5A 4JIIX 3N2CA 4PMVA 2R8WA 3OVRA 1VJSA 4JQAA 3WLQA 4K38A 4MFDA 4V1XA 2P10A 4RNFA 3R0UA 4W9TA 3OEXA 4FR1A 3SZ8A 1MZRA 4E0CA 1KLYA 2XYLA 4Q4OA 4O52A 2NQ5A 4AX7A 1P0KA 2OYKA 4ZENA 4HTYA 1N2VA 1FA2A 1PIFA 3WQ6A 4OHQA 1CX9A 3EX1A 1X8FA 4L9XA 4RXFA 3T2QA 3TCEA 3SY8A 2DZAA 3QY8A 2Z0IA 4M6PA 1A3WA 4B5TA 5FSEC 5F2IA 5F1VA 3STCA 4AZCB 1VIZA 2XJ7A 1EO5A 1K7EA 2XN1A 2VGBA 5AHEA 1OT2A 4GUIA 3O9NA 1OX6A 4B5VA 3GNPA 4DAIA 3CWOX 1GOXA 2DSUA 2DEPA 3KHJA 2DP3A 4CQ8A 1BHGA 3CLWA 3AYSA 2NXHA 2DDXA 1MMFA 1V7YA 2PTDA 1OBAA 2DIEA 4CNNA 1R3VA 1V6TA 4JQ1A 3A22A 4XUGA 2DT0A 3CNYA 5I79A 2WNWA 3WSUA 1H1NA 4DF2A 2Z7KA 1NFPA 3DI0A 2J74A 1R6WA 1LL7A 2Z4GA 3P0WA 3UWUA 1KM3A 3TAOA 1XD1A 4DZIA 1XQKA 3KWSA 4LS0A 2FVKA 1LDCA 3PWIA 1U5HA 1QNQA 3COTA 1VKFA 3AYRA 3H8AA 4K1GA 1AH4A 3QEZA 4HTBA 2OEMA 1V02E 4FXRA 1YNQA 1XIFA 2OEKA 4IPNB 5EBUA 4BS0A 1XC6A 2BTMA 1ESWA 3TW9A 3PNUA 4NXSA 1GZ1A 4YNGA 2VQUA 4BEQA 5TIMA 4J3ZA 2VNCA 3R79A 1NEYA 3V0TA 3VAVA 4AWTA 3GHUA 1GW1A 2GGGA 3EWZA 1G01A 3DKLA 1WNOA 4LC6A 4EP8C 3KCLA 2XG9A 4GUJA 2GGJA 2IPJA 4ERGA 3IJ6A 5EBAA 3BLEA 1FOBA 4TX9A 8TIMA 3QJAA 3TUUA 1KFJA 1YNPA 3UGRA 1EBGA 3W7NA 3IAPA 4C7FA 2OQLA 1TQXA 3AOFA 3GVWA 1BQGA 4H9YA 5CPSA 2I57A 3ZO9A 5DO8A 1GVEA 2I9EA 1MI3A 4PC8A 2D73A 4AYSA 3QVQA 1RPKA 2GJLA 5BXPA 3BSMA 1DE6A 2REQB 3UZZA 3WJXA 1W37A 3T0AA 1JPIA 2OYLA 2PDPA 1P4CA 3MMWA 5HNUA 4AY7A 2PFHA 9XIMA 2J7DA 4FNQA 1WQ5A 4UTTA 3N9RA 4JN8A 5TD4A 1XSIA 3BGJA 3TTSA 3PZ9A 4JAWA 2A6LA 4W93A 4C6IA 2WAGA 2W27A 2ZRVA 2QAFA 2BDQA 3OQEA 4QR6A 3GDMA 4IF2A 1XKJA 2OX4A 3R43A 2PEVA 1QNSA 4MNKA 1KKRA 4IM4A 3NSXA 4PCSA 3FN9A 4IIHA 3THAA 3QRHA 4R85A 3M7WA 1ZUAX 4DXVA 3WH6A 1EIBA 1LQAA 1BGGA 3DHUA 1J93A 1VYSX 3N6HA 2OQHA 1BYCA 4LVFA 1EHNA 3KL5A 5H6HA 4AYGA 4AW7A 4I6KA 2IS7A 3C2EA 2ABAA 1V3IA 4P5UA 1QPRA 1PCKA 3G1AA 3DHFA 3UJSA 4JTJA 3GZ3A 3MJYA 3B8IA 1ICQA 2IXUA 4ROPA 2XZ9A 4PMYA 3NVTA 3ABQA 1HVQA 3Q67A 4NJIA 2YKKA 1GZGA 1XLMA 3H22A 1RR2A 1XRSA 4GNVA 4L61A 2CHOA 2YL9A 1G5AA 3BAKA 1UWTA 3KX6A 3QTPA 1SO5A 4D6CA 4ATLA 1W8GA 3GDTA 1YW1A 2ZWYA 1ISZA 2DJLA 1VGAA 1VRDA 4BI7A 2VCBA 1GYLA 3M0MA 5I23A 1X6UA 4C1NB 4ZB5A 4CUCA 3GU2A 4N9DA 5EMJA 2XINA 3TNBA 2ATMA 3QKEA 4LFYA 3OO2A 2PDCA 4B5XA 3MUIA 3WH8A 4PL2A 4O1FA 4JX6A 2VELA 1J96A 1GNXA 4XD6A 1TV5A 3MHGA 3BWWA 1OX4A 4GYJA 3LCGA 3W7EA 1E1FA 1F3XA 1PX4A 4KIRA 3EDKA 4L6DA 4QQ3A 4XBJA 3GXDA 4PFMA 3N13A 1LWJA 4ZL1A 4H6KA 4CD7A 4GACA 2E6DA 2ZUWA 2WJZA 3BTNA 1GW9A 4Q6JA 1PZ0A 3PM6A 3VZXA 4JHOA 5A8NA 4NF7A 1O60A 1H7PA 4FX8A 2C14A 4IJCA 1Q6FA 3KZPA 1LORA 4C6EA 4IG2B 3ONCA 3VDHA 3CLMA 1WAUA 1XYMA 2Z1WA 3L9CA 4IQJA 5KZMA 4DWSA 4D1JA 4GZEA 5LGZA 2RUSA 3WLIA 3FV9A 3WLOA 2O92A 2ZA3A 2QVNA 1OZMA 1UA3A 1QI4A 1P0EA 1CENA 2I5IA 1JVNA 1OCJA 1HF6A 1QAPA 3CO4A 4QQUA 3UZ5A 4MG4A 4Q7IA 1LJYA 2FDMA 3G3MA 1X1NA 1PZ2A 3WD3A 5KTLA 5DX7A 3GBDA 2J79A 3SCTA 4A21A 3VI2A 4IQEA 4HU4A 1IEVA 3GWQA 1OG0A 5LNVA 1M68A 3WK3A 3THCA 1DKWA 3FEQA 3G1DA 3NDZA 3VNDA 1W91A 1LOLA 4HB7A 3KRZA 2CKRA 3ITLA 4DUWA 3UFYA 3N29A 1BD0A 3QV7A 3W7IA 3VABA 1V0LA 4PCNA 5J5DA 5CC7A 2V38A 3FAXA 1O4UA 4JNMA 2P88A 4ZGYA 4BKNA 3SN4A 4RDWA 2IMRA 1R3SA 3CYVA 4LCQA 4AAJA 5D2TA 3XIMA 1PPIA 4P61A 1FWIC 2PUZA 2X40A 4F40A 3LRMA 3ZLHA 4KRZA 2WJEA 4HHMA 5HMDA 1ZAHA 4OT7A 5LIWX 2W62A 3GU9A 5CC3A 1UJQA 1RALA 2E6YA 1UMYA 1M01A 5ABFB 1NSJA 5AHMA 4IIEA 3IGUA 5I3HA 5H8MA 1MXDA 1L6GA 3CZKA 1W9DM 1J2WA 1UWQA 3LXBA 5CSSA 1JUBA 1DJNA 1K8YA 4HNUA 3C0SA 1YBQB 4NHVA 2OOFA 1D8CA 4JKKA 4IP4A 3U4AA 2NZLA 3AIEA 4MNJA 2GJNA 1ZP3A 3SJNA 3M0YA 4LU0A 3DZ1A 3WQVA 2R14A 2WZMA 5D9PA 4JHMA 4OFCA 2FZBA 5CPMA 1EJWC 1UWIA 3QY7A 4YYCA 1E5JA 1EPVA 1ADSA 2WC4A 3NL3A 1XSKA 1NQ6A 1QOPA 3RFAA 3V3WA 1TVPA 2CLHA 1S2WA 3GRIA 5GJNA 2HVOA 4PULA 2GVJA 4NZ5A 4F79A 1V08A 4NJGA 5D03A 4DO5A 3PZUA 1TWZA 3LV6A 1JFHA 4H9XA 4UMBA 3S6DA 1FXPA 2J6XA 4Q33A 1GOMA 5A6BA 3TTOA 2FH8A 1A0DA 3MVIA 3F4CA 3D5HA 1P0DA 5DBUA 1VAHA 3H2NA 4PZVA 3GTHA 2WHLA 3KWXA 3WYZA 4J28A 4U33A 5G4EA 4QLKA 3TXVA 2QJIA 4PTMA 4MYAA 3CS2A 4B3KA 4MY1A 4FPSA 3PB0A 2G3NA 1WUEA 3TJLA 2ZX6A 1K3UA 2PSNA 1J0JA 3O8AA 2ZICA 1A5KC 1O66A 1KM5A 2OKTA 4S2CA 2J8GA 3VOFA 1MW0A 1IZJA 3AIQA 2FIQA 4NQ1A 3IGSA 3M6YA 4QNEA 1P6WA 3KW3A 4I7UA 4HHHA 3MSGA 1A47A 5DMLA 1E4MM 1J0HA 5BYWA 3RGTA 3SUSA 4HSNA 1E71M 1AZ1A 1QO5A 3AMGA 4OUIA 3TTEA 2Q3OA 1BYBA 3QC3A 1H7RA 4XO7A 4UOQA 1POJA 1WDRA 4EPDC 1MW3A 4JCMA 8XIMA 1S39A 3VIHA 2DZXA 1HIZA 6PTDA 1VFLA 1LLZA 3R8HA 2XTKA 4KQNA 3WEZA 6CGTA 1KKOA 4DQWA 4Z42C 4TUFA 4IMEA 2O4QA 2BB0A 1W3IA 1S2TA 1WX0A 1PTDA 4NJJA 3Q65A 5SWUA 2QF7A 3W1TA 2OSXA 2WKJA 3W1LA 2V6AA