4IISA

Crystal structure of a glycosylated beta-1,3-glucanase (hev b 2), an allergen from hevea brasiliensis (space group p41)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
316
structure length
316
Chain Sequence
EVGVCYGMQGNNLPPVSEVIALYKKSNITRMRIYDPNQAVLEALRGSNIELILGVPNSDLQSLTNPSNAKSWVQKNVRGFWSSVRFRYIAVGNEISPVNRGTAWLAQFVLPAMRNIHDAIRSAGLQDQIKVSTAIDLTLVGNSYPPSAGAFRDDVRSYLNPIIRFLSSIRSPLLANIYPYFTYAGNPRDISLPYALFTSPSVVVWDGQRGYKNLFDATLDALYSALERASGGSLEVVVSESGWPSAGAFAATFDNGRTYLSNLIQHVKRGTPKRPKRAIETYLFAMFDENKKQPEVEKHFGLFFPNKWQKYNLNFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-1,3-glucanase form 'RRII Gln 2'
publication title Structural analysis of the endogenous glycoallergen Hev b 2 (endo-beta-1,3-glucanase) from Hevea brasiliensis and its recognition by human basophils.
pubmed doi rcsb
molecule tags Hydrolase
total genus 103
structure length 316
sequence length 316
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.39: Glucan endo-1,3-beta-D-glucosidase.
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00332 Glyco_hydro_17 Glycosyl hydrolases family 17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4iisA00
1NH6A 2IXVA 2VX7A 1MQPA 4WSKA 1VFFA 1QPKA 4UOZA 1X1NA 1J9YA 2WLYA 1W9VA 4BA0A 4TOQA 4CCEA 1C3FA 1CXEA 3K4DA 4KGJA 2DSVA 1C7TA 1ZBWA 5A69A 1GONA 3CUFA 7TAAA 1EHAA 1H11A 2FH6A 2FHBA 1V03A 4OKDA 1VEPA 4V27A 2UY3A 4AZHA 4TVUA 5DT7A 3WF4A 1HP5A 1TE1A 4EE9A 2YDRA 1B30A 1GOWA 2F8QA 1DTUA 3W26A 1BHGA 3VINA 1QBAA 4GI8A 5CPQA 5A8MA 1CEOA 1ZBKA 4YHEA 3NIYA 4J28A 2DT2A 2JFEX 2ZXAA 2X0YA 2WBGA 5JBEA 3PZNA 4U33A 2VRKA 4JL1A 3AS2A 1GOIA 4H8UA 5BXRA 3WDRA 1EDQA 1JZ7A 4BQ3A 3RM4A 4XX6A 2Q8XA 3U57A 3L4WA 2GDUA 3GXMA 2UWFA 4M24A 1E5NA 1UA7A 5HNNA 1TZ7A 4AWEA 2J7BA 3WQ4A 1JI2A 3ARSA 1E73M 3MUY1 3FY1A 3QHOA 1W9UA 4UR9A 3L4UA 1U30A 1E0VA 3WN6A 1E43A 4LGXA 1H49A 1IT0A 1JNEA 1GOOA 3BH4A 3CGTA 1FA2A 2CIPA 2ZUWA 2VRQA 4BZYA 4W93A 3W53A 4DWSD 1EIBA 5A2CA 1GPFA 2DQXA 4IUGA 1V0MA 1XCWA 1C91A 1WZAA 2OYKA 1GW1A 3PZOA 2EQDA 1NOFA 1E55A 1JZ3A 4IPNB 4CKQA 4AEFA 1KGUA 1LWHA 4AMCA 1J0IA 1C8QA 3BAWA 2VUYA 1G1YA 1EH9A 3SCOA 1Y7VA 3BLPX 1J01A 3WDJA 2VURA 1US2A 2CITA 3KL3A 1CGVA 2D0FA 4UTFA 3AIVA 2F2HA 4LYQA 1IV8A 1UWQA 1BSIA 4PMQA 2C8NA 1K9TA 2DDXA 3AIRA 4M29A 2XWEA 2GVYA 4L4PA 5A2BA 4LPCA 1EQCA 1HF6A 3SUTA 3G6LA 3FXYA 4DUWA 5FIPA 4MNJA 1E4NA 8A3HA 1FFRA 3MMDA 3LPFA 4P7RA 5ABGA 4W87A 3L4YA 1B3WA 4W8LA 3A4WA 1CWYA 3ZJKA 2VCAA 3VDAA 1ZB5A 2BHUA 2DH3A 1HJQA 3WNOA 4WJXA 1V6WA 2A3AA 3MV01 3RJXA 4W5UA 2VT0A 2EPOA 4ZXLA 2J7GA 3AQUA 2V3GA 1JZ8A 1KWKA 3GBDA 3KEHA 1CDGA 2OWWA 4F9DA 4HU8A 4UFMA 1BQCA 1W1PA 2V5DA 2WBKA 3EBVA 3BCDA 3MV11 3AJ7A 1HT6A 5EMYA 2BY3A 1HKKA 4Q7NA 1HL8A 1XRVA 1A3HA 3W6LA 4J3SA 2WCGA 2D3LA 3VIJA 3EMCA 2ZUMA 2X09A 3UCQA 1E3XA 2EO7A 4J27A 1W1YA 3WEOA 4W8AA 2XFFA 4PTWA 3K1DA 1E5JA 4CD7A 2CBVA 1WDPA 1C92A 1OWQA 1ZU8A 3WQ5A 1FP9A 2BY0A 5A6SA 2O9TA 3VM5A 1Q6CA 2E8YA 4CD5A 4W85A 4CD6A 4ZENA 3ZJ6A 3CMJA 3CZGA 5DO8A 1BYCA 3MUIA 1B3XA 4JIEA 5EB8A 1UWSA 3CHDA 1EO5A 4UQBA 3CUJA 1CENA 3RCNA 4GI6A 1CGWA 2Y5EA 2VL4A 2UY4A 4UQAA 1BYAA 2A3BA 4L4OA 3VKKA 2J79A 4W5ZA 1QHZA 3AROA 3W29A 4CU6A 4Z2IA 3VDCA 3AHXA 4JKLA 3HJEA 4FLSA 4JFTA 2GK1A 1P6WA 1WB0A 1CGTA 4AZCB 3MSDA 4ACYA 2BFGA 2CBJA 1J0ZA 2EJ1A 2YBTA 1FHDA 5BYWA 2XTKA 1E4IA 3BAKA 1JI1A 4PRWA 1JZ4A 1CXHA 2CEQA 5A6JA 3IJ7A 2D0HA 1VBRA 1OM0A 3WMBA 3WD3A 4MNMA 2FHFA 3T0BA 5HBFA 4UFLA 5KZ6A 1DWAM 2WW5A 2WVVA 6A3HA 1PZ2A 5BWFA 4UQCA 5HDRA 1EHNA 3AIQA 3VD7A 1L0PA 3AS1A 3AIEA 4A4AA 2D22A 4MJ4A 3CLWA 3ZJ7A 2WMFA 2G3IA 3WH7A 3B9DA 3POCA 5JIWA 1RD6A 4OOZA 4E4PA 3LMYA 1V3KA 4C7DA 3WL0A 4XV0A 2E40A 2DIEA 3GH4A 1UA3A 3SCSA 3VX1A 3A4XA 3VOCA 1MWOA 4A3YA 1GNXA 5BXTA 2Y2WA 4U5KA 1KFWA 1QW8A 4D6HA 1HVQA 4IISA 4AD3A 3W81A 3T08A 3MU7A 4ZEPA 5CLTA 2O92A 2ZX9A 2D23A 2NSXA 4ATDA 1UR1A 4F8XA 3A4AA 1KBBA 3CZKA 1JDCA 1OGBA 2YOCA 3G6MA 3RPMA 1BG9A 3T2QA 3WQ6A 4CVWA 2WK2A 4EAMA 4B3KA 3PZUA 2VOTA 4EANA 2EEXA 5BRPA 1JDAA 3VIOA 1VJSA 1MXGA 1A47A 1TR1A 3UETA 2AMGA 3VD4A 1QNSA 2Z1SA 4TX8A 3WH6A 2DSKA 2V38A 1DEDA 1LQ0A 3GNPA 4IM4A 1GQIA 3BCFA 2CKSA 3VNZA 3ZOAA 2VZTA 3N18A 1WDSA 2ZUNA 1KCLA 2VMFA 2ZUSA 1HKJA 4HZ8A 4V28A 1W1VA 2WC4A 3ARPA 4RE4A 5C71A 5DEZA 1VEOA 4MAZA 4TUFA 4C7FA 1UWIA 3S2CA 2ZE0A 1NOWA 1R7OA 1WDRA 1UWUA 1QI0A 1XD1A 1MW2A 4AZIA 1WAWA 5CSUA 3CBWA 3MS8A 1EA9C 1B3ZA 4AD2A 4CCCA 5EBAA 2W66A 1J0JA 2CBUA 4ZXOA 1EOKA 2NT0A 4M80A 2QPUA 1JFXA 3MO4A 4M81A 4H7VA 2WANA 4PEEA 1B31A 1Q4NX 3VD3A 2GFTA 2YDSA 3KL0A 3VMNA 3E1F1 3MSGA 3ZQ9A 2JF6A 1V0NA 4HA1A 4PSRA 1E72M 1FH7A 1CLXA 2O9OA 1Q6EA 1UR4A 3WFLA 3OGRA 1E0WA 3I3BA 4PSPA 3CUIA 1XH0A 1F4AA 1LG1A 1NOUA 1CBGA 3MKKA 3W4RA 5I78A 2WC3A 2QMKA 3OGSA 4ACZB 2DH2A 1E6ZA 2J4GA 3ZR6A 3NSXA 4RE3A 2WAGA 3ARVA 5E6ZA 3TTQA 3HU7A 1K9DA 1WNOA 1AQ0A 2WZIA 4K68A 2ZX8A 2X1IA 4NF7A 1BGGA 1NP2A 3QOKA 1KXQA 1BTCA 1KQZA 1EO7A 3WUEA 4TVCA 1TVPA 3SCUA 3IJ8A 1PEZA 2PB1A 3L2LA 4XB3A 2DSZA 1FFQA 4UFKA 4KRTA 1AVAA 3K8MA 2VO5A 2O9RA 2VZOA 4WKFA 5HPOA 3ZT7A 1X6NA 4HPHA 4WLCA 1V3IA 5E6YA 1LWJA 1MW1A 3NUKA 4M8UA 3WBEA 4LX4A 4W7VA 4B9YA 4E8CA 3LPPA 3PTQA 3GDBA 1OSEA 3BAJA 5BXPA 4OBSA 2Y8VA 2BV9A 1MFVA 1DWFM 5E9AA 1V08A 1EOMA 4NRSA 5BCAA 3W25A 5A94A 1LL4A 1MVYA 1US3A 3M6DA 2J7FA 1W2PA 2BHZA 1PBGA 2AAAA 6CGTA 1AMYA 2GJXB 2VR4A 3T2OA 3SUVA 3GNOA 2BY1A 2WWDA 3CUHA 1JF6A 3APGA 3K4AA 3WF0A 1EDGA 4XZWA 1JYWA 1HJSA 4WSJA 4J3VA 2X2YA 2UY2A 1E6RA 1UH4A 2GDVA 2XFRA 4GO9A 3NCOA 3AIWA 4F66A 5IFPA 4OIFA 1M03A 4HU0A 5M3WA 1UR0A 3W37A 1E6NA 2G8ZA 4AIUA 2BXZA 4PTVA 3N13A 2NW0A 5LA1A 3PZMA 1RP8A 1BFNA 2XVPA 4D6CA 1QHPA 1CNVA 1WZKA 5D8ZA 3MANA 4P7LA 5CSYA 1H0IA 5LYRA 3DC0A 1CXKA 4Q22A 2XFYA 2YLLA 1WDQA 5LA2A 3EDDA 1OD0A 1E70M 1WE5A 1W9DM 2WHKA 4P8WA 1J0HA 3WNLA 3N15A 1ODUA 3TONA 2W91A 2VZSA 1CIUA 2ZX7A 3LPOA 1CGUA 5M03A 1UD3A 1LLOA 4KH2A 5IDIA 3BXWA 4QCFA 3WD1A 1KGWA 4X9YA 3WUFA 3VIPA 1HP4A 1H4PA 1XSKA 3ARQA 2VZVA 2J75A 2J47A 3GH5A 1SMAA 2W61A 1BVZA 2XIIA 4TTUA 2Y8KA 1V3JA 1E6QM 2V3DA 3W6MA 3M7SA 1CXFA 4AXNA 1ZJAA 3BC9A 4YN5A 2TAAA 1W3HA 3DYMA 2VX5A 4HMDA 3VD5A 3AIUA 3N17A 4ATWA 1UR8A 6TAAA 4Z2LA 3U7VA 2VZUA 2AOSA 1H09A 3OLIA 2XM1A 5BXSA 2W4XA 4ZE5A 3I3EA 1PX8A 1WO2A 5D4YA 4TVDA 5IHRA 5TD4A 3D3AA 1JAKA 1J10A 4DWSC 1KGXA 1C93A 2ZXQA 2WMJA 5AC4A 1ZL1A 3W27A 7A3HA 4UOJA 2YIHA 4AD5A 3B8SA 1MW0A 2PC8A 1WZMA 3VNYA 3PN8A 4AZCA 1BVNP 3VU2A 5D8WA 1H1NA 5KEZA 1CECA 1LF1A 1V3LA 3AZTA 4KGLA 2J8FA 3AIBA 3WF3A 4TX6A 1TVNA 3T09A 1UZ1A 1B2YA 3UEQA 5A8OA 1OBAA 2VTFA 5I5RA 3CHCA 1B9ZA 1GCYA 4D6DA 2XVNA 1R87A 3BMWA 2D24A 2JIEA 5F7UA 4AZBA 5C8BB 1Q6FA 1QI4A 3EMQA 3AHZA 5ABFA 1M01A 2WMGA 3VUPA 3WH8A 2WVUA 2CPUA 1EQPA 1HIZA 4OZOA 3RO8A 3T0AA 4PBGA 4U2ZA 5A95A 2D2OA 3PZ9A 1UKOA 3BAIA 1VENA 1WZLA 3OLGA 1IZJA 1BYDA 1DWJM 1XH2A 3QR3A 5FD0A 1W9XA 1FP8A 5CLWA 4PMYA 1FHLA 1QI2A 3EDKA 4C7GA 3WDHA 1H3GA 2QPSA 1CLVA 2J7CA 1ISVA 3AOFA 2ZX6A 3ZR5A 3NJ3A 1XC6A 2XSBA 3KL5A 2J77A 1U2YA 2WMHA 3VGDA 3GXFA 2QLYA 2WMIB 5A6KA 4D6JA 3QGVA 3WUGA 4QAWA 2MANA 3WNNA 1G5AA 1C8XA 3W28A 3PZVA 2XPKA 4JCMA 4AZ7A 4W7WA 5HOSA 4Z2HA 5A1AA 2WCAA 1KXVA 2OSXA 3BSGA 3SURA 1GZJA 4YPJA 1V0KA 5IXEA 1UKTA 1TA3A 4ATLA 1CYGA 4CD8A 4PUEA 3ZT5A 4HOZA 1KXTA 2VR5A 1JFHA 3NYDA 3S6TA 2ZOXA 3WY1A 1J12A 1VAHA 2ZWZA 1JIBA 4UZSA 3M46A 3CO4A 5EFDA 5A6AA 4JFWA 4CUCA 1NM9A 2ZICA 1D3CA 2C7FA 1GJWA 2E9MA 4UFHA 2W92A 3A3HA 4LXFA 1V0LA 1DWGM 3WNMA 1D2KA 2BY2A 1CZ1A 5CPTA 3UR8A 3ZO9A 3PTMA 1DWIM 4GIAA 1V3HA 5A6MA 1V02E 5FL0A 1HL9A 1CTNA 1G0CA 1V6XA 3CH9A 2CYGA 4UFJA 4MDPA 3SCWA 1GORA 4GI9A 4B9ZA 1V3MA 2BVDA 4NZCA 4S3JA 5E0CA 2XVLA 3ZM8A 1XGZA 2XUCA 4PMOA 3VIMA 1NWUA 4CGTA 4UCFA 1BYBA 1BAGA 5I2UA 5DFAA 2XJ7A 3GBEA 1UQYA 1HJVA 3CMGA 2CHOA 1V6UA 1OIMA 1W3KA 4HA3A 7CGTA 3BAXA 4DM2A 1JZ2A 1R85A 3FHAA 1ODZA 2VCBA 4J3XA 3KZSA 2Y24A 3VPLA 1CGXA 3UG5A 3PZTA 2DPEA 2XVKA 4H2CA 3AI0A 3MUZ1 4QCEA 4MPKA 1NWTA 5CZKA 1E6PA 1HJUA 4U5IA 1MQQA 3IAQA 4OBRA 1WP6A 1FOBA 3WQ8A 4BQ4A 4W89A 1JXJA 4MB1A 1CGYA 3AICA 4N0RA 3CUGA 4CN1A 4D6EA 2CNCA 3AHYA 2VVSA 1V6VA 1QBBA 3AYRA 2OYLA 4RL3A 3AMCA 2ZIDA 5M17A 2BHYA 5LA0A 2Y4SA 3WFZA 5CGMA 1B1YA 3WUBA 4CU8A 4A3HA 4HP5A 2WSPA 5DT5A 1PIGA 4MTVA 3EDEA 4X0VA 3N12A 1R86A 1MYRA 4MADA 4U3CA 1EXPA 2UY5A 3TTYA 4BCEA 4DWSB 1HXJA 2FDMA 3WDQA 2V5CA 4KRUA 3RILA 4PN2A 4QLKA 1E6XM 1W2VA 3L4TA 3WDPP 2X05A 5BROA 3B9AA 1BGAA 3F5LA 1KWGA 1W32A 1UOKA 3POHA 1MFUA 3ARRA 4U2YA 2VQUA 2GJXA 4JHOA 5A3HA 3GYCA 1E40A 4KWUA 3WBAA 4HMCA 4B3LA 2E4TA 2PWEA 3W82A 3WH9A 4P7NA 1E4LA 2BXYA 1ISWA 3VIFA 1XYFA 1E1FA 1J11A 3VDBA 1G94A 3PZGA 1JYVA 3O6AA 4NI3A 3WEMA 2GJRA 3NDZA 4J3UA 2PWHA 4MAVA 3GXDA 1RH9A 2WC7A 1BLIA 1UD8A 5I23A 3WEZA 3ALFA 2W62A 4D6FA 5C70A 1OCQA 2DGAA 1TCMA 4Z2JA 2CXGA 1Q6DA 5M5DA 1FH9A 2WWCA 2XGBA 1E9LA 3AHTA 1XV8A 1DWHM 4GZEA 4UOQA 1QNRA 3VVGA 3WELA 3HMCA 2YL6A 1OINA 5GPRA 2J8GA 4W88A 1M04A 1R8LA 2JEPA 1E3ZA 3VD9A 1PX3A 1JD7A 4URIA 4FLOA 2FGZA 1ITXA 3F4VA 2JEQA 3ARWA 5D9OA 1HKIA 3WH5A 2WZHA 3NDYA 1Z32X 2ZWYA 3N9KA 3B9EA 1E71M 2V3EA 3AZSA 4TXEA 3WIJA 2VQTA 2RGLA 3GZAA 4JZ5A 4P8XA 4PMUA 1SFSA 4JCLA 1VFUA 1VB9A 3MUAA 1IZKA 2OWCA 1BPLB 1MXDA 1KQYA 2J7DA 2BVYA 3VIKA 2V3FA 4HTYA 2WVTA 3FW6A 4PUDA 1GOMA 2EPLX 1KR1A 3L2MA 4AD0A 4QP0A 3T2PA 3WQWA 5GNZA 2VRJA 3AYSA 3MMUA 1UH3A 4U31A 1WPCA 3DECA 4H04A 2ZUUA 4GZJA 4J3WA 1GOKA 4LYRA 3K8LA 1KBKA 3OZPA 2ZXDA 2F61A 5GNXA 5I77A 1CPUA 4CN4A 4X0NA 5I3DA 1OGGA 1NWSA 1QHOA 3F5KA 2VCCA 1UD5A 3ZIZA 3I3DA 1E15A 1XH1A 1HVXA 1ESWA 3CIVA 2GJPA 3WMCA 5ECUA 2YA1A 3FN9A 3A6OA 1OB0A 2XG9A 3O2LA 4WK9A 4W7UA 1GQKA 4HZ6A 4NRRA 3OLEA 3CHFA 3UG4A 3UR7A 1HKMA 3DHUA 1JF5A 4LYPA 3WD2A 4UZUA 3KWXA 1V6YA 4GZIA 1C7SA 3L4ZA 4QFUA 2YL8A 1FH8A 1GHSA 1PZ3A 2A3CA 2WLZA 1ITCA 2WM0A 3F5JA 5CPSA 2PWGA 3OG2A 1CXIA 3VMOA 1QI5A 4AISA 4JKMA 3AMLA 2VX6A 2WHJA 3EMZA 3L4VA 5IHSA 2YDQA 4MNLA 1O7AA 4MJ2A 2A3HA 2YKKA 4E8DA 3ECQA 1W91A 3IK2A 3GH7A 1UR2A 2E9BA 3W0KA 4EKJA 1C8YA 3RM9A 2PF0A 5JBDA 5A6BA 4H41A 4PTXA 1BG4A 3J7HA 4HOWA 1M53A 4PMRA 3TA9A 5FL1A 5ABEA 1JGIA 3FAXA 2EPKX 1RPKA 2DT3A 3SCPA 4OUEA 3VX0A 3WNKA 1JG9A 2IUZA 1JDDA 1MW3A 3ZJ8A 2QV4A 2JF7A 4PYSA 1Q6GA 2WKLA 3OLDA 4AIEA 1J0YA 1HJXA 4FK9A 4GQQA 2WMIA 1U33A 3ZSSA 1QOXA 5AYBA 4D6GA 2E8ZA 3U5YA 4QDMA 1UD2A 1UG6A 1GHRA 4J3TA 3EDFA 4JKKA 4HPGA 2WYSA 4D6IA 1ZBVA 2E0PA 4AD4A 2J78A 2XVGA 3U7BA 2CETA 4JFUA 4AD1A 2FH8A 3ZSTA 4WKAA 1UQZA 4W84A 3VMPA 2D0GA 4WKHA 1JNDA 4TTGA 5AC5A 4CU7A 3WSUA 5ABHA 4MB5A 4ZE4A 4UQEA 1K9EA 2WXDM 4AY1A 1MQRA 5DF0A 1GOQA 1HJWA 3AZRA 2OWXA 4P7OA 3PBGA 1KXHA 3CZ8A 4BQ2A 1TMQA 5CXPA 4JFVA 2E3ZA 4AW7A 1XSJA 1TUXA 1UR9A 4DUXA 3A47A 4F9JA 5HXMA 4MB4A 2W63A 3ARUA 3SCNA 1K9FA 4BS0A 4AYSA 3VTRA 4W86A 4D1IA 2YA0A 3LPGA 4WF7A 3VGHA 1UZ4A 4JFSA 2IXUA 4LQ1A 3WD4A 4GINA 5CJ5A 2WVSA 1KB3A 1WCGA 5A8QA 2J7EA 1R7AA 3KE0A 3MMWA 2RGMA 2VX4A 4MB3A 4P8VA 3SCRA 3AMDA 3CZJA 4P7QA 3DYPA 4M56A 1UD6A 2CCRA 1VRXA 1JXKA 3N1AA 4UQDA 2Z1KA 4OOUA 4CVUA 4PMXA 1I1XA 2WCSA 4CN6A 2WKGA 2VVNA 2OLHA 2PBGA 2YL9A 3AISA 3FAWA 5A2AA 2EBNA 3WF1A 2CKRA 1C90A 1E56A 5AYIA 3RMEA 2J74A 2ZX5A 1GQJA 2DEPA 1GQLA 2EPMX 5IFTA 3QOMA 1E0XA 2X0HA 2DT1A 4HA4A 4BQ5A 1ISZA 1DP0A 1DHKA 4JL2A 3WL1A 1ISYA 2VNCA 5E0FA 2CHNA 5A8NA 2CBIA 3CTTA 3SCVA 4AZ6A 1QNQA 4GO8A 4MDOA 1NP0A 1K6AA 4NSBA 1YHTA 3VGGA 2QMJA 3CZLA 1E1EA 1AQMA 1UKPA 2XWDA 3EDJA 1E6SM 1I75A 1XYZA 5FCZA 3WDIA 2WSKA 4OJYA 4GKLA 3WKZA 3TOPA 4PCSA 5HPCA 1PJ9A 4F79A 1EDTA 4Y7EA 3SUSA 1JZ5A 4CCDA 3BSHA 3K8KA 5GQBA 4R5EA 3WD0A 4DWSA 1QNPA 2PWDA 2CERA 2VI0A 2FGLA 5AY7A 2XM2A 1SR0A 3VGEA 3RIKA 1OD8A 2WZEA 2G41A 2YJQA 2J7HA 3HN3A 3VIHA 1GUVA 3THCA 4RE2A 4D1JA 1OT1A 1XD0A 1HX0A 1LL6A 1W9PA 3DHPA 1VBUA 1ECEA 2ZUVA 5I6SA 3ZMRA 2B31A 1J0KA 3QHNA 3EYPA 4DUVA 1B3VA 1QVBA 2VC9A 1H2JA 2J62A 2FHCA 3AXHA 4PMVA 5CQ1A 1VJZA 1VFOA 2EPNA 4UQ9A 3WNPA 1ZS2A 1QW9A 4GXPA 2WB5A 5E09A 2J25A 1JYXA 2D20A 3II1A 2DT0A 4B16A 1SMDA 2BVTA 4BF7A 4R27A 1V02A 4S3KA 2OYMA 3OGVA 2O9PA 4PTMA 3SUUA 3NSNA 5I24A 1NARA 4D71A 3ARXA 1ZJBA 4UFIA 1W3LA 2E9LA 4FLQA 5I0DA 2YA2A 1RP9A 5ABFB 4QLJA 1NQ6A 2DSWA 2EXOA 1UUQA 2G3NA 1LJYA 1ZBCA 5D9MA 1HNYA 1KCKA 2YBUA 3AHVA 3THDA 1ISXA 3ARYA 3JUGA 1UYQA 3RJYA 4Z2GA 3OIHA 4HMEA 4P8UA 1W9BM 3IAPA 1HN1A 4IPLA 4ACZA 1OT2A 1GJUA 1PPIA 3CHEA 2X8RA 3CZEA 1UHVA 1E4MM 2W5FA 4PCTA 1EGZA 2HISA 2D3NA 1X6LA 3BMVA 4B15A 3AMGA 2WHLA 4AZGA 4W8BA 1VFMA 2G3JA 3RM8A 1GVIA 3UG3A 2OSWA 5FOOA 4XZBA 1UWTA 3CPUA 3GM8A 3SEPA 4KMQA 2ZXBA 1PIFA 5D9NA 1SYTA 4HOXA 4M82A 3N11A 3N04A 3OB8A 3NSMA 4HZ7A 1M7XA 1XHGA 4U3AA 4XUYA 3OZOA 4AC1X 1TA3B 3WMSA 2C0HA 5JIPA 1S46A 3VM7A 1W3JA 4AIOA 4ZFMA 1UKSA 1NWRA 4FLRA 1TFVA 4D72A 3VIIA 3VO0A 1UD4A 4WIWA 2OSYA 1QI3A 4GQRA 2XHYA 1H0GA 3ZT6A 5EFFA 1BF2A 4CD4A 4YHGA 2XGIA 5A8PA 3AMKA 1H41A 4GPNA 4QLLA 1PX4A 2GK1B 4MNKA 5BRQA 3QHMA 5A6LA 3IJ9A 3ARTA 3OBAA 3TP4A 3RDKA 1XCXA 3VILA 3OA5A 4AEEA 1UH2A 5JUVA 1VF8A 4N42A 5JBFA 8CGTA 3K46A 1G01A 3SCTA 2DIJA 5I79A 3GNRA 3AS3A 4UNIA 4JHZA 2QF8A 4AZ5A 3BAYA 3PZIA 1UWRA 2DSUA 5E70A 2WPGA 3SIMA 3VIGA 2WVVB 2XSAA 2A3EA 3AFBA 4E2OA 1OIFA 2HVMA 2QHAA 3UERA 3O9NA 5D9PA 4J7RA 9CGTA 1F4HA 3AXIA 2PBOA 2GUYA 3VGFA 2VJXA 1CXLA 5A6BD 4PMDA 1JL8A 4V2XA 4PMZA 3VDHA 1W1TA 4FMVA 4JAWA 3SCQA 1J18A 3DYOA 3UESA 1WKYA 3WF2A 1JZ6A 3PZQA 1AQHA 2G3MA 1LG2A 1QNOA 3GTNA 4H8HA 4M1RA 1B90A 5GNYA 2JALA 1GVYA 1OGSA 3FNDA 3L4XA 1G9HA 2XIBA 3IANA 3M07A 1UKQA 5CG0A 5DMYA 1VEMA 1B3YA 1LL7A 3PTKA 5FKYA 3WQVA 2PWFA 2W67A 3FHQA 2ESCA 3D5HA 2PI6A 3ARZA 2CESA 3AXXA 1PAMA 2WMKA 1JYNA 3WENA 2YL5A 4DM1A 1D7FA 3TTSA 3GXIA 2XYLA 1JAEA 3PHAA 1TG7A 2GSJA 1KR0A 2BNJA 2WNWA 2NT1A 1O6IA 3SUWA 5CGTA 3W38A 2ZUTA 2JE8A 1H5VA 2WHMA 1N82A 3W24A 4EK7A 1I1WA 3AS0A 2D1ZA 1XSIA 3ALGA 3BLKA 4H8VA 2BS9A 4ML4A 3U5UA 1VIWA 2YLAA 4FF5A 1JD9A 3TTOA 2G4FA 1L8NA 1YQ2A 1B0IA 3T0DA 2JIWA 4Z2KA 3BGAA 4PMNA 3VGBA
chains in the Genus database with same CATH superfamily
3UWQA 2VX7A 1LOQA 1VFFA 2X0SA 1X1NA 1W9VA 4BA0A 5AHEA 4TOQA 4RX0A 2YYUA 1CXEA 2DSVA 1XDMA 2IW0A 3CUFA 1PDZA 4C6PA 1GVSA 3O0KA 1HUVA 3CLMA 1P5BA 4J2MA 5DT7A 3EX1A 3LN3A 1S5VA 1EKOA 1GOWA 2E7FA 4HHLA 1DTUA 1RQEA 3CAVA 4ILSA 1MNZA 2NUWA 3EOLA 3BZGA 3U4FA 4O53A 1ZBKA 3TWBA 2WOQA 5JBEA 4GYPA 2F9RA 2R9RA 3IGHX 3M0YA 4OUIA 2HK1A 3FK4A 3PAJA 2QPXA 5BU9A 2DZTA 4FSAA 1JI2A 2GGJA 1E73M 1OZMA 5EMKA 4OECA 3AAMA 1HW6A 3QHOA 1W9UA 1F74A 4C6FA 1FWGC 4ZQPA 4DY1A 1W1B1 1E43A 4M7TA 5DRCA 1H49A 1JNEA 5CBJA 4E3VA 1FA2A 4E6MA 4BZYA 4W93A 5A5WA 1EIBA 1GPFA 2DQXA 1DIEA 3GHUA 3PJXA 1VP5A 1WZAA 3PZOA 3KOXA 3U0HA 4FNUA 2QCDA 3BJFA 4CKQA 4WGXA 2J24A 2VUYA 1G1YA 1WKEA 3SCOA 1H50A 2D2GA 4EIVA 1EEPA 5DCBA 1KM6A 4XIMA 3WJYA 1TPFA 2F2HA 2FFIA 4MOZA 3OVQA 4PMQA 3BLEA 1GQNA 5TNVA 4L4PA 3SUTA 4MKNA 1DIDA 3P80A 3G6LA 4IF2A 4DUWA 1E4NA 2HPIA 3LPFA 3MMDA 5ABGA 4W87A 2J6XA 3L4YA 4O18A 2BOGX 4XG1A 1BKSA 1IT8A 1W5QA 2VC7A 5TQLA 4WR3A 2OB3A 3ZJKA 3C2EA 2DH3A 2G3FA 4GQBA 3KLLA 1S2UA 5LGXA 4QRNA 2GVLA 1JRCA 2A3AA 3RJXA 4JTLA 4RLIA 1GYNA 3V75A 2OT0A 3LMZA 1JZ8A 1KWKA 3U2EA 1X39A 5CSRA 3NO3A 1DE5A 3BCDA 2NUXA 3MV11 3KTXA 1TPEA 2IQTA 1HKKA 2ZRVA 4Q7NA 3T8LA 4NXSA 3VIJA 3TLLA 4HHHA 2ZUMA 4IPJA 4DPPA 3UCQA 4DZIA 1E3XA 2EO7A 4J27A 3WEOA 3E12A 2F6UA 2XFFA 4UIOA 3CQ0A 4IT1A 4DAFA 2CBVA 1WDPA 1OWQA 2QAPA 4WDUA 1OYCA 1FP9A 2BLEA 2QR6A 5A6SA 3UZWA 1EJTC 4IMGA 3MPGA 3ZJ6A 3GG8A 3CZGA 1X8FA 4HA0A 3MUIA 1BTMA 3CHDA 1EO5A 3E74A 1JR1A 1YW1A 1CT5A 1VKFA 3UXIA 2A3BA 4L4OA 3GDLA 1OFRA 1WBJA 3LV5A 3VKKA 4W5ZA 4LUIA 3DN5A 3CAKA 3T9PA 3MSDA 5B80A 1W37A 2BFGA 1POKA 2P8BA 5I3FA 3LX9A 1E4IA 1AK5A 4PRWA 1IWBA 1E9IA 3W7DA 2FHFA 1VPXA 2WVVA 4LNCA 1PKNA 2I7GA 1PZ2A 1US0A 2Y7GA 1JGMA 4UQCA 5HDRA 2ZDSA 3H4GA 4C6NA 4A4AA 2J9YA 4ML9A 3B9OA 3IJ6A 5RUBA 4FA3A 1I2RA 3EEGA 4PUUA 5KZMA 1GEHA 3UJFA 1RD6A 3VK5A 1THFD 1AJ0A 1AMKA 1ZAHA 1YNQA 2DUAA 3I10A 4HJFA 2QAFA 1HKWA 2X2GA 1PKMA 2ZVIA 3VX1A 1T8QA 3VKCA 4NKCA 2Y2WA 2PODA 4GOAA 4P5UA 5HJXA 4IJRA 4IISA 2AQOA 1POJA 1A5BA 1RAKA 1TVLA 2EHHA 3C0QA 4ZEPA 3DESA 2V5BA 3ITOA 2HBVA 4ATDA 1FKWA 4F8XA 2VFIA 4S3GA 1JDCA 3UXKA 1UROA 1EP1A 4EAMA 1WXJA 2QT3A 1SZGA 1VJSA 1Q7QA 1TR1A 3HZ3A 1QNSA 2Z1SA 4TX8A 4C1NA 2DSKA 2V38A 3WLHA 3W71A 4IM4A 4GFIA 2MUCA 2CKSA 3ZOAA 4HNCA 3STPA 3W7PA 3SO7A 2ZUNA 3ANYA 3C2FA 3QYQA 1PTGA 3SZ8A 1DJHA 2V67A 3EWWA 4J5NA 2FMNA 2BVWA 2WC4A 3ARPA 3I65A 4MAZA 1UWIA 3DUGA 2ZE0A 3CT7A 2V6AA 4XD3A 3M7WA 1DXEA 4DBUA 2XISA 4AZIA 3VABA 3H24A 5CSUA 3CBWA 2OZ3A 1EA9C 2YZRA 2PUZA 1J0JA 2ACQA 1DHPA 1EOKA 3ENLA 4Q7IA 2QPUA 2CHRA 4H7VA 1ZSXA 4PEEA 1B31A 1PO9A 2YDSA 3KL0A 3E1F1 1XPGA 3V0SA 2ANUA 1OFEA 1ML1A 3IARA 4QDWA 1IF2A 1RALA 4E2DA 4PUWA 4E2BA 1LYXA 2HNEA 2O9OA 1T8XA 2P76A 3OG3A 4NI8A 1E0WA 2RDXA 2I14A 1BSLA 1F7BA 4A6GA 1XH0A 3KBJA 4LAUA 4AF0A 1NOUA 3W4RA 2QDEA 3OGSA 2VGBA 2IKGA 3P2VA 3OU8A 2J4GA 2WAGA 4IGNA 4ZQRA 3TTQA 1OABA 2OO0A 3UA4A 1QR7A 2X1IA 1M7OA 1M5WA 1R0MA 1O5KA 1KQZA 3EB3A 4CNOA 3S2LA 2Z7KA 2PB1A 2IPWA 3L2LA 1HTIA 2YPIA 3UJ2A 3LCFA 3M0ZA 4HQVA 4NHVA 3VOFA 3CM4A 1W1IE 3N73A 4HPHA 1V3IA 5E6YA 3MY9A 4F48A 1LWJA 4BFAA 3QSRA 4A8NA 3B0YA 3O8AA 4HGXA 1JPKA 4LX4A 4E8CA 4QJ4B 1UIOA 2PAJA 3WQEA 5BXPA 1V08A 1EOMA 3W25A 3BJSA 5DCEA 4UTTC 2HCVA 1AMYA 3O63A 1KKRA 2VR4A 3D47A 3T2OA 1BXCA 1WV2A 2RHGA 3APGA 3O6DA 1FXPA 1N8FA 4TR9A 1TCDA 4J3VA 1I6NA 1E6RA 1Z69A 1UH4A 1YXDA 3QKEA 4JTJA 1ZPTA 3NQ2A 3W7KA 4LUYA 3K2GA 1R9XA 4O57A 4GO9A 3GD6A 1UR0A 3W37A 2BSLA 2EAWA 3KOZA 2G8ZA 4AIUA 3FJ6A 4PTVA 4NASA 3THQA 4F2UA 3PZMA 1RP8A 1BFNA 4M6QA 2GYIA 2XGZA 1CNVA 1WZKA 4GRSA 1IXPA 4UTJA 3DC0A 3WLSA 1JPHA 1WDQA 5LA2A 3SN1A 4PUJA 1VCFA 3EDDA 3PUEA 1E70M 1WE5A 1W9DM 2WHKA 4P8WA 4GUIA 3S9YA 2REQA 3UW6A 1ODUA 1SSGA 3TONA 2XIQA 1PWLA 2VZSA 4QGCA 3V0UA 3SB0A 2PTXA 4RNFA 5M03A 3LA4A 1QO2A 3W75A 1KGWA 4GVGA 3WUFA 1V5XA 3P82A 3TQKA 3ARQA 4Y96A 5C9WA 4YCOA 2J47A 3TYDA 3MW7A 4TTUA 2Y8KA 1V3JA 3GVQA 3Q58A 3M7SA 3UPBA 3G22A 1ZJAA 3HV9A 2TAAA 3RF9A 4M7SA 2OODA 1YXYA 3SGZA 3DYMA 3N17A 1GKPA 4LEFA 1GKRA 3QZAA 1YXCA 1EJWC 1H09A 1E51A 2JQXA 2XM1A 1KCXA 3CV7A 3S8HA 2W4XA 2GVEA 3WQPA 3MP3A 1Q2RA 1L6YA 1WUFA 3ABZA 3D3AA 5CH9A 2VDIA 4J3ZA 4DWSC 2FB3A 1KGXA 1C93A 4H6EA 2ZXQA 2WMJA 1ZL1A 2VDHA 4JTFA 7A3HA 3E6EA 1Q66A 4H3DA 4UTKA 1XP3A 1LBMA 7ENLA 2QCHA 2PC8A 2PURA 3IGUA 5BOOA 4UTMA 3PJTA 1X6UA 1CECA 1LF1A 4FNSA 1ITUA 2QJIA 4ONVA 3AIBA 2X1UA 1TE6A 3CIWA 4HSHA 4K36A 1DORA 1B9ZA 1M3UA 3OQEA 2I5IA 3MSYA 1TREA 4LWWA 2QF7A 3PUOA 3IJLA 4GX9A 3NWRA 5C8BB 3SRKA 3EMQA 1M01A 4GMEA 2ISSA 3NZQA 2WMGA 3PBWA 2PU0A 2WVUA 3NL2A 3EWZA 3CXOA 5C54A 1SW3A 1XIFA 5A95A 4I7WA 3BAIA 3DOPA 3SN4A 2YB4A 1FP8A 5CLWA 4A8LA 3EPNA 3L67A 1H3GA 2QPSA 1CLVA 1OZQA 2V2CA 1P1MA 1TPB1 4JICA 4WUIA 4XKYB 1TPWA 3O7UA 3TMQA 3TU9A 4LFYA 3COTA 1BQGA 3PFRA 4QEEA 3WUGA 4LCRA 3R5EA 3VZYA 1TV8A 4L4LA 4NG3A 5A1AA 1EYEA 2WCAA 3MI6A 4WSHA 3BSGA 3N3MA 5IXEA 3F03K 1U5VA 4ATLA 4O12A 1RZMA 1CYGA 4CD8A 4E4FA 4KERA 1LQAA 3ATYA 1KXTA 9RUBA 2VR5A 4FXSA 2FTYA 3QY6A 4IIFA 5AYZA 1BXNA 1OFQA 1M1BA 3M46A 3CO4A 4CUCA 4CNTA 3ANVA 5KZDA 3MZNA 3NPUA 4RZ5A 2NWRA 3A12A 3IUIA 2E9MA 1Y5WA 4BWLC 1BRLB 1XIDA 3H22A 4H9YA 4EPKA 3WNMA 3IVTA 1SJDA 1PHQA 5FSEC 1DWIM 1NDYA 1V3HA 5A6MA 3FOKA 1HL9A 5FL0A 3OJGA 1CTNA 1NFGA 1EP3A 1V6XA 1JDEA 3LENA 3QV6A 3EWXA 4E0CA 3IIPA 2V5KA 4RE0A 2FZNA 1BYBA 5DFAA 3Q2DA 1VCGA 3MA8A 3BOXA 9XIMA 4XK2A 3L66A 3C3NA 1W3KA 4HA3A 1XDLA 3BAXA 3FHAA 4XO7A 1ODZA 3NZPA 2DVTA 3VPLA 3LNMA 1SJBA 2PGEA 2DPEA 5FI8A 3AI0A 3MUZ1 2ON3A 4PE8A 4IFRA 1NWTA 1XYLA 2QKFA 3WQ8A 4L6OA 1NY1A 4Y9OA 3AICA 3IUDA 1UWAA 3TV8A 4C1KA 3LM7A 4S39A 2EGZA 3AHYA 2VVSA 4Z0JA 2GJLA 1M6JA 4OGZA 1PIIA 2PZNA 5M17A 1U5HA 5CGMA 4S3AA 1B1YA 4HCHA 3WUBA 2CLKA 1PIGA 3RRXA 4XZLX 1AUSL 3NTYA 4CCZA 4MADA 4U3CA 1HXJA 2FDMA 4OFCA 2VFHA 3RILA 3USBA 4Q8WA 3ZLHA 3L4TA 1HQTA 1V4YA 3WDPP 5DRIA 1F6YA 3W83A 3E2VA 1KWGA 2FZDA 1W32A 2A3LA 3PBUA 3FS2A 4NL1A 3UR2A 1F3WA 4GABA 5A3HA 1ZQ5A 4KWUA 4B3LA 3ATZA 3W7JA 1PHWA 2DZXA 4R53A 2BXYA 1ISWA 2IMRA 1E1FA 5J5RA 1J11A 4NI3A 4O52A 3GG7A 3NZGA 2Z29A 5I23A 1EGMA 4D6FA 1RVKA 1H7RA 3FEQA 2RDTA 2DGAA 2WV8A 2CXGA 1UUMA 5M5DA 3H4WA 5H8MA 1E9LA 1EUNA 3AHTA 3T0TA 4N9DA 3T78A 5LNUA 3K4WA 4Y6GA 4YCPA 3QBUA 3QY8A 1QNRA 1PYMA 3UA3A 1U1UA 1FWRA 2YL6A 2PU1A 1Q5MA 1H63A 2JEPA 1AH0A 4I9TA 3TN3A 4FLOA 3R1ZA 2FGZA 1ITXA 4GWEA 3M4HA 6ALDA 4ZO9A 4CNPA 4O50A 3RMJA 3WH5A 5PTDA 2V3EA 3WIJA 1TWSA 4MWAD 1L2UA 4P8XA 2YCEA 1OFAA 1VFUA 1DJYA 2Y0FA 3VIKA 4HTYA 4JTQA 3SQLA 1GOMA 2EPLX 4R7OA 3GUWA 2FTWA 3M0LA 4AD0A 2R24A 4NNCA 2VRJA 2CFFA 1RJPA 3MMUA 1UH3A 4U31A 4NVTA 4WVXA 3DECA 4J3WA 2D2HA 5DLCA 4LYRA 4MUPA 1KBKA 3OZPA 3V3WA 2ZXDA 2Y7FA 1FWHC 2HS6A 4X0NA 4UXDA 3H55A 1QHOA 1J5SA 2QIWA 3SY8A 3F5KA 1ZGDA 3CAWA 3E5BA 3ZIZA 4QS6A 1E15A 1FQ0A 4Q8NA 4AQLA 1HVXA 1S5MA 1ESWA 3CIVA 2Z24A 2F6KA 4JQAA 3P5ZA 4FR6A 4WK9A 4W7UA 3RG6A 1Q65A 4PGLA 3A21A 4IIEA 3OLEA 3CHFA 4XAYA 3UG4A 3DHUA 1JF5A 1WQ5A 8RUCA 3MI2A 3RUBL 5D2VA 2CLMA 3TZNA 1X97A 4GZIA 5K9DA 3L4ZA 1EJUC 1FH8A 1GHSA 5AECA 4NAFB 1AG1O 1CXIA 1QI5A 3TN6A 2JKEA 1TZ9A 2P0IA 3AMLA 2VX6A 1XW8A 3W23A 4X2RA 4QAIA 4MNLA 4MJ2A 2A3HA 1BVWA 4R85A 4WDXA 4LBUA 1MI3A 4I7VA 4JN8A 1IXNA 4JTEA 4A22A 1C8YA 1FDJA 1YNYA 1QCWA 3C8NA 3LGEA 5A6BA 4GY0A 1BG4A 1Q6QA 1XL9A 1GTEA 1M41A 4PMRA 2PCEA 4HIBA 3FAXA 7ODCA 2DT3A 3DAQA 3S83A 2IUZA 1PL9A 1RXOB 1JDDA 3W73A 3DI0A 1TZZA 3ZJ8A 4XKYA 3R0KA 2WKLA 4AIEA 3IGSA 3GC4A 1HJXA 4FK9A 4EOUA 2GOKA 2Y88A 1H61A 3ZSSA 2NXIA 3PB0A 3QKZA 3R8RA 1G6CA 1KFCA 3U5YA 4QDMA 3TNBA 3OA3A 4JKKA 5T9CE 2WYSA 2HXUA 3FGCB 2WPBA 2DUZA 2E0PA 3PR2A 4ASTA 4BF5A 2BDQA 2CETA 5AVHA 1D8CA 2FH8A 3TSDA 4WKAA 1UQZA 4W84A 1VYRA 2D0GA 4TTGA 2A5HA 3W22A 4CU7A 5CZJA 3WSUA 2AKMA 5ABHA 4QDPA 4I6VA 5HA7A 1UW9A 3IRDA 1GOQA 1S5TA 3T42A 1HJWA 1E1CB 3AZRA 2X40A 3O6YX 1KXHA 4KWVA 4XISA 3HGSA 2NVAA 1XWYA 4K7VA 1XLAA 4JFVA 4AW7A 1XSJA 2QUNA 1GGOA 4B5WA 4HZMA 3PNZA 4HNNA 1ECQA 5HWJA 3ARUA 3P84A 2C71A 3VTRA 4HPNA 1BRLA 4GX8A 5EU9A 3BV4A 1X7IA 4JFSA 1H51A 4B2DD 1KBJA 3WD4A 5CJ5A 1ICSA 1DJXA 1PB0A 5DQPA 5AHMA 3MP5A 5FF7A 2J7EA 1AD4A 2ZRUA 5LXEA 2VX4A 4MB3A 1PZ1A 4M56A 1UD6A 3N9RA 4IP4A 2PP1A 3GRIA 3H21A 3S46A 3L5MA 2QCGA 2Z4GA 3H7UA 3G3MA 4IQJA 5KSWA 3MP4A 3R58A 2ZZ4A 2WKGA 3N2BA 3AISA 5G5IA 4JNZA 3WF1A 4LUSB 1RR2A 1C90A 1E56A 3IV8A 5AYIA 2J74A 2ZX5A 1GQJA 2DEPA 1GQLA 2V8ZA 2CZFA 1OG6A 3BLOA 2DT1A 3RLVA 2IKHA 3EZ4A 3LRKA 3UXDA 1ISYA 4IH3A 3UP8A 3DZ1A 2FTPA 1SZRA 3EA3A 2CBIA 3SJNA 3PF3A 4MDOA 1NP0A 3I6EA 1BWLA 2VP8A 3VNLA 1P6CA 1E1EA 1YLVA 1E6SM 2BP1A 4LS2A 4B91A 2WSKA 2Q02A 3WKZA 3TOPA 3DCPA 1ICQA 3B8TA 3N4EA 1NJJA 4Y7EA 3ISIX 4ICCX 2V2HA 3WD0A 4AHQA 4YTRA 1QNPA 3NM1A 2CERA 5F4SA 4C6EA 4QROA 3R8GA 1SR0A 4ERAA 4JIRA 3QW4B 3VGEA 4EACA 3SW6A 2PDLA 2INFA 3LS9A 3HN3A 2BOFX 3THCA 4RE2A 4UMCA 1OT1A 1XD0A 1HX0A 4JTHA 3KVLA 4FHAA 4Z42C 5D04C 3VUSA 1P4CA 3TCEA 4DUVA 1QVBA 3N2OA 1H2JA 4QE5A 2FHCA 1KTNA 4LW7A 1P0KA 4L4MA 4GYKA 3R11A 2C16A 2D2JA 3OW1A 2J25A 4ZOEA 4GNJA 3JU2A 1JYXA 4GA8A 3II1A 3QR1A 2ACSA 2DT0A 3QFWA 4B16A 3BO9A 3OPSA 5FJUA 1JVNA 1NDWA 5I24A 1KV8A 1NARA 3ARXA 2A7RA 4MFDA 4UMAA 4FLQA 3GDRA 3VNKA 1RP9A 4OE7A 3LHUA 4QLJA 3SGGA 1NQ6A 2DSWA 2P10A 1UUQA 1XG3A 3SY1A 1HNYA 1ISXA 3T8QA 4P61A 1TMHA 3JUGA 3PAOA 3WQFA 5LIXX 4F0LA 4HMEA 4XKMA 1JULA 3QTPA 1W9BM 3IAPA 3VNIA 1O4UA 4O16A 4XWUA 2X8RA 3CZEA 1ZFJA 1E4MM 4PCTA 4F0RA 3CUXA 4EPDC 3TYBA 4B4FA 5LHFA 1BEUA 1KRCC 3T7VA 3HURA 1DVJA 2PDYA 4NZ4A 1SFJA 3JW7A 3CPUA 3AUJA 4A3QA 2PFHA 2VEMA 2ATMA 4AX7A 4PTDA 2QUUA 5D9NA 3W1NA 1SYTA 3G1RA 4H9XA 4Z1YA 4UR7A 4XUYA 4PB3A 4AC1X 1L6GA 1TA3B 3WMSA 4AIOA 1UKSA 3S5OA 1REQB 4FLRA 4D72A 4HKPA 3VO0A 4K38A 3G5EA 1QI3A 2G5WA 3ZT6A 1KNWA 1A49A 5A8PA 3QV8A 1KO0A 1SQ7A 4GISA 4UC5A 4DJFC 3GTFA 3MYOA 5IBXA 3MO7A 4KCUA 2QV5A 4MNKA 1Z7AA 5A6LA 3IJ9A 2W79A 1UP2A 3RDKA 1XCXA 1F3XA 3OA5A 4AEEA 1UH2A 4UTWA 4IHCA 1FWDC 4N42A 5JBFA 8CGTA 3D0CA 3K46A 3A9IA 4NAFA 4PUNA 4Q8OA 3NURA 3S9IA 1MRQA 3ORWA 2I9UA 3EOEA 4JHZA 4K8HA 5FF0A 4AZ5A 3PZIA 4J2PA 1IHIA 5E70A 3W7GA 5FAJA 2XSAA 2A3EA 3AFBA 3D46A 4INFA 4E2OA 3ZWSA 1TV3A 1LM1A 1XQKA 2G37A 5D9PA 1F4HA 3AXIA 2PBOA 4TIMA 3WCZA 1IT7A 3VGFA 4AIBA 2PZ0A 1A0EA 5K4XA 1CXLA 4PMDA 3LZ3A 3VDHA 4JAWA 2QJNA 4GC3A 2ZE3A 4N02A 4BEQA 2ZVRA 1JZ6A 3TN5A 4TO8A 4LVBA 3AALA 3DC8A 3WK1A 1LG2A 4LF2A 4M1RA 1B90A 3WLTA 1J96A 4OBTA 2XIBA 2PDBA 3IANA 1KM3A 1UKQA 2PLCA 1OCBA 1OFOA 4DN1A 3PTKA 1ENUA 3RR4A 5FKYA 3FGCA 4MLRA 3TTEA 3FHQA 2Z28A 4KWOA 3C3UA 4JTUA 6PTDA 4X63A 3DHDA 1A5UA 4QNEA 2PLJA 1A5LC 3SR7A 2QUVA 4MVAA 3FYOA 4DRSA 4DF2A 5AC7A 2WNWA 1A5NC 5CGTA 3W38A 2ZUTA 1OF6A 1E1CA 2OZ8A 3AS0A 1NTHA 1UASA 4XVDA 2D1ZA 1P7TA 3BLKA 4M51A 5FJIA 4O8RA 2ZRXA 4KT2A 3U5UA 1VIWA 2YLAA 4FF5A 3N9SA 2GGIA 3WQGA 3LGDA 1YQ2A 2V5LA 2JIWA 3G1AA 4ZGYA 2VGGA 4KFOA 3T07A 3PWAA 4WX2A 2JK2A 3KDOA 3U8GA 3KM8A 4CCEA 3KVKA 4ZO7A 5A69A 4FNTA 4D8ZA 2WQPA 1EHAA 2FH6A 4NJJA 2DVUA 2O55A 2FHBA 1R6WA 5CAKA 1GKQA 3NFUA 5GJPA 4V27A 4PULA 3WF4A 1M9HA 4IJCA 2P3EA 5TF0A 4IL0A 3DFQA 1T0OA 2F8QA 3EKLA 4AUBA 1VJIA 1BHGA 5D05A 4PBFA 3B03A 4YHEA 3NIYA 2JFEX 1EJSC 3PZNA 3ID7A 3W07A 1OX6A 3KHDA 1GOIA 3BUVA 4I5XA 1FWEC 1A3XA 1EDQA 1Y5VA 4XX6A 2C79A 1DJGA 4M24A 3VKJA 2J7BA 3WQ4A 4FEZA 5FSDC 3DFYA 1YPIA 4FR1A 2PDMA 3FY1A 1V79A 1VS1A 5HANA 1AW5A 4DXXA 1FRBA 3B0XA 2E1WA 3URBA 4MY8A 3BH4A 3CGTA 4NZ3A 3W1UA 2P53A 3EXTA 2F2KA 1EC9A 3CYJA 3WQCA 1M65A 3VOGA 2VRQA 4DWSD 5DMNA 3OZMA 1T40A 1C91A 2OGJA 5CBIA 1GW1A 3EXRA 1JZ3A 3EPOA 4FXJA 4IPNB 1C8QA 2AGTA 3VAVA 1EH9A 2FVLA 4PFMA 4A3UA 3GHSA 2YR1A 1J01A 3KL3A 2YDAA 3TXVA 4NNBA 4UTFA 3AIVA 4AMAA 2CC0A 1UWQA 3H2AA 1OX4B 2RJGA 3G77A 2P3ZA 3AIRA 4KF1A 4ZB2A 2CLIA 2GVYA 2XWEA 4LPCA 1WA3A 3FXYA 3G1YA 5FIPA 3PPFA 3L9CA 3WX7A 4Q8PA 4US5D 4JQ3A 4GFSA 4C6OA 4HNTA 4BK9A 1TPH1 1JQVA 3BARA 3OTRA 5JH1A 4GNKB 6XIAA 3C52A 3KRBA 4JIQA 2NVDA 3WNOA 1V6WA 4FX7A 4FIQA 1YPFA 4W5UA 4Y8EA 1A4MA 4KEUA 2EPOA 4ZXLA 1ONRA 3QQWA 3AQUA 2V3GA 3TR2A 3GBDA 3UGRA 3WBYA 2ZBTA 3GX9A 1CDGA 4HU8A 3CIXA 3A3WA 3WQDA 2WBKA 3MBDA 4XZHA 3EBVA 2BXVA 4HHPA 1FWIC 5L6UA 4O4VA 4Y2WA 1RLDA 3VKDA 1HT6A 2GVJA 1HL8A 2E77A 3EPMA 4Y9PA 1TQJA 1WDDA 4J3SA 2WCGA 2ZZ2A 2VD8A 1B57A 2QDHA 1E0TA 1XIEA 4ROQA 3RFAA 2X09A 2C18A 2IPJA 1W1YA 1TIWA 5KITA 4PTWA 1E5JA 1GZGA 1RA0A 4CD7A 2E5BA 3M1ZA 4MF4A 2BY0A 1Q6CA 2E8YA 4F4RA 4CD5A 4W85A 5G1MA 2I1OA 1DQUA 1KM2A 1IIGA 4ZENA 1OCJA 3SAZA 3R6IA 5DO8A 4XUGA 2VEGA 1B3XA 1UWSA 4UQBA 3CUJA 1TPUA 4UMBA 4LB3A 3RCNA 2BOEX 2X1SA 1REQA 2Y5EA 2VL4A 2UY4A 3WLIA 1MRAA 2H6RA 1FDYA 3KZPA 2J79A 4JTAA 1I2PA 3AROA 3W29A 2AL2B 3VDCA 3HJEA 4JFTA 1ITQA 3CJPA 1S5WA 1C8VA 2FMOA 4LAMA 2YZ5A 1YRRA 4UR8A 2J27A 4TV5A 2EJ1A 2YBTA 1PTDA 1A5MC 3GHRA 3G2GA 3SRHA 1QXLA 1AA1B 4HD5A 4J40A 2QS8A 1JZ4A 3P8JA 4EAYA 5EL1A 3WLMA 2CEQA 5A6JA 4QJ3B 1VBRA 1OM0A 3ONCA 3T0BA 3UCDA 2HZGA 1DWAM 2WW5A 3IIOA 3QTGA 6A3HA 1XIJA 4IQDA 1OHLA 1ZTVA 3L0NA 3U2OA 2XH4A 3S2MA 3CLWA 4LV9A 1EX1A 1YDVA 1DJQA 2OEKA 3WH7A 3FJ4A 5XIAA 3POCA 5AHLA 4MYXA 4E4PA 3MWCA 3SFKA 3W70A 3LM3A 3SCSA 5IRPA 1MWOA 1GNXA 5BXTA 4U5KA 4FXRA 4DF0A 3K5XA 1QW8A 2C14A 2ZRYA 4O10A 1XLBA 3MU7A 1SSDA 1R3QA 1Y5XA 2E1DA 3TROA 3TMLA 2D23A 4QG9A 3FJLA 4KFPA 3MJMA 3A4AA 2YFOA 2B7NA 2VFGA 4LB4A 1YDYA 3T2QA 1MZHA 4CVWA 1V77A 2WK2A 3T44A 1OG0A 4A05A 3PZUA 3OOQA 4RDWA 3VE7A 2V69A 2A1YA 1XRSA 4KIEA 2AMGA 3WH6A 5I3JA 3RCMA 3GNPA 1U1HA 2A85A 3BCFA 1UBPC 5L9FA 3OBEA 1WDSA 2VMFA 1HKJA 1W1VA 4DQWA 3KLKA 1VBJA 3LK6A 3NO5A 5DEZA 1VEOA 4C7FA 4AC7C 3IWPA 3S2CA 1NOWA 3AXKA 3KBVA 3N2XA 1R7OA 4QSHA 2NXHA 1UWUA 1XD1A 4JGDA 1MW2A 3VNDA 2VFEA 1W0MA 3C0JA 1RBAA 3N19B 4FIRA 4S23A 4JYFA 4CCCA 4HNVA 5IDZA 1XGDA 4K1GA 2IKJA 2NT0A 3NQMA 3JRKA 2WANA 4MMWA 2PLKA 3CS2A 2CLOA 4L7ZA 2GFTA 3UPMA 3UJRA 2CWNA 2NUYA 3MSGA 4KEVA 4C6DA 3SIZA 4TU1A 2GWGA 3EKGA 1V0NA 3LERA 4HA1A 4MYAA 5G1TA 3E3HA 2PDCA 3LB0A 1QFEA 3CL8A 3OGRA 4IQEA 2H9AB 1OFBA 3P0WA 3BWWA 3M5VA 3CUIA 1GG0A 3H23A 3CWNA 4G7EB 1NEYA 1VFLA 1F4AA 1V93A 1K03A 4O14A 2WJZA 2NQZA 1VQTA 1X38A 3OEXA 4XD6A 1TPC1 3NA8A 3QV7A 1IEQA 2DH2A 1E6ZA 1H7NA 4WD0A 5E6ZA 4ZA0A 1WNOA 3L5LA 4K68A 1BGGA 3LV6A 1NP2A 2VELA 1BTCA 1EO7A 4TVCA 1B3OA 1YTKA 3TZFA 5H2ZA 1PEZA 4B5NA 1XKJA 2Y89A 4XB3A 1LT7A 2DSZA 4UFKA 1K8YA 2WSQA 1AVAA 3URAA 4GH1A 5CGQA 1LOLA 2WKJA 3GU9A 4ZODA 4DLMA 2DV0A 4M8UA 2INZA 1R3WA 4RJEA 1T7LA 3K1GA 4B9YA 3PTQA 3N2MA 1UP0A 3WK2A 4EX4A 1OSEA 4ZB0A 3BAJA 1MFVA 3WBXA 1XLMA 5E9AA 5BCAA 3HGRA 1US3A 3M6DA 1W2PA 1XCFA 6CGTA 2AQVA 1ELSA 3RX4A 4LS0A 4V15A 1HKVA 1FUYA 3PB2A 1TWIA 2BY1A 4E3TA 2D69A 2WWDA 3K4AA 1G4PA 3WF0A 1JYWA 1HJSA 2X2YA 2NQHA 3CAQA 3CB8A 2GDVA 4NY2A 1VHNA 3AIWA 3ONBA 3F2CA 1M03A 1LROA 1E6NA 1Q6LA 3VXGA 2BXZA 1P1XA 3N13A 2A6LA 4DELA 5LA1A 4AY8A 5LZLA 3NDOA 4P7LA 5CSYA 3GTIA 4Q22A 2XFYA 2MNRA 2YLLA 3DG3A 1RBLA 4S2CA 3WLLA 4DBEA 5BOEA 1GVOA 5I00A 3N15A 1PDYA 1P0EA 4YXGA 1MEHA 4XZIA 1CIUA 2ZX7A 3LPOA 3PY2A 4DWDA 1UD3A 3MHFA 4DZHA 4C5ZA 5D30A 3BXWA 4QCFA 1VBHA 4G8TA 2ZZ1A 1H4PA 2ZZ5A 1OFPA 3QM3A 4MG4A 2J75A 4DZAA 1N55A 1U83A 2ZRWA 4XD5A 2TYSA 4DEFA 4DXKA 2W61A 4G5DA 1BVZA 2XIIA 2V3DA 1UBSA 3CUZA 5JQ9A 2DVXA 1MZRA 1OYAA 3APYA 4LANA 3KOWA 1FWAC 5C2CA 2I5QA 5AC8A 5LKYA 4JX6A 2PDWA 4ATWA 3C4UA 2I56A 4Z1AA 4NJGA 5BXSA 2YW4A 2CU0A 2LLEA 3IUHA 1YBQB 3RNDA 2AGKA 3EEZA 3MMTA 2HQAA 1JAKA 3P67A 1XF0A 5BU6A 1R9ZA 1V8EA 1DV7A 3QFEA 1O5XA 2HVNA 4MZ1A 1P0BA 4J35A 2V5JA 2YIHA 1MW0A 4LF1A 3VNYA 3PN8A 5C7HA 4X2PA 5LIKX 3LYEA 1H1NA 5JH2A 5KEZA 3L65A 3B4YA 1MUMA 1V3LA 3AZTA 4NYUA 1R46A 4NZFA 4TX6A 1NF0A 2ZA1A 3AO0A 1B2YA 4UWMA 2C6QA 1HO4A 1NDZA 4PFHA 3HPAA 4GVHA 2NVCA 3BMWA 5EMJA 1XLCA 3F4WA 4PRTA 4AZBA 1Q6FA 2XH2A 4ERGA 5HR7A 3WH8A 3BLFA 4ZO8A 1HIZA 4OZOA 3RO8A 3BANA 3TH6A 4H4IA 4DZ5A 3PZ9A 2CXEA 1WZLA 3UZYA 1IZJA 3WYZA 1F5ZA 2E6AA 1RSCA 3S47A 1PTAA 1AW2A 3STFA 3EA1A 1OX5A 4RXGA 3EDKA 3WDHA 3VI2A 4IMEA 2ZX6A 1GTHA 4LAOA 2XSBA 4ZOBA 1B9BA 4QS5A 3R79A 6REQB 3M9YA 4S3CA 3QGVA 2MANA 3WNNA 3DH7A 3PBYA 3W28A 1WXYA 2XPKA 1U5JA 3IEBA 4Z2HA 1YPXA 5KTLA 5FF2A 4YPJA 1L8PA 1V0KA 1UKTA 4K8GA 5KZEA 4O4WA 3V1PA 1Z6KA 4I5UA 4PUEA 4L61A 4Q4OA 1XLDA 1VAHA 3KRZA 1TRIA 2ZWZA 1JIBA 5EFDA 3VKBA 1EWEA 3TDFA 3LHVA 4JFWA 4FNPA 2R1NA 4GC4A 1EBGA 3STCA 2QCNA 2ZICA 1YNPA 2PDUA 4DJDC 3WLRA 2YGYA 2W92A 4LXFA 1F8IA 1R2TA 1MO0A 3DKLA 1CZ1A 4X9SA 4DO4A 1I2QA 3GSMA 3UR8A 5D2TA 3ZO9A 3CB3A 3GXTA 4GIAA 1FDZA 4I9AA 5MHBA 4W4QA 1G0CA 3LLFA 3W1LA 3CH9A 4MDPA 1QOQA 1V3MA 2BVDA 4HYRA 3ZM8A 5DY3A 4LY8A 2XUCA 1GYLA 4CGTA 4UCFA 3TYEA 4K6AA 2Q71A 2XIMA 1OIMA 5AZ1A 2NXGA 2H9AA 4I8YA 4GUHA 4A29A 1XRFA 4DM2A 1R85A 4J3XA 1X1ZA 1XLKA 3KZSA 3NVDA 4G7EA 3DFSA 4MPQA 3UG5A 3PZTA 4H2CA 1I2NA 4QCEA 3QJAA 1PZ0A 3IAQA 3P8IA 3GWQA 3M0XA 4BQ4A 4W89A 1PUDA 1W8SA 1CGYA 5LIWX 3H54A 4XVEA 2CWXA 5D09A 1TWWA 5F2IA 1RUSA 1V6VA 4DBSA 5D38A 1D3HA 3R2GA 3HO8A 3L2IA 1RVGA 2Y4SA 4AWSA 3W1XA 1KFEA 3AU2A 3HBLA 2R1KA 3QC0A 3IV3A 1NSJA 4HP5A 3S5ZA 1WXZA 4QG8A 4MJZA 1TTJA 2Y85A 4PR4A 1EPVA 3TTYA 3WDQA 3A23A 1DXFA 2Z27A 4IGSA 5CPMA 4EWND 2C1HA 4QLKA 1E6XM 3LBOA 2X05A 1SZEA 4GIRA 1IEIA 4DJFD 5BROA 1W5NA 4L56A 3F5LA 4N9BA 1UOKA 3HFTA 4U2YA 1UP3A 3W85A 2Z1XA 1O1HA 4GXMA 1UIPA 2OR2A 3IRSA 4HMCA 1MSSA 2D73A 3JS3A 5I7GA 4P7NA 1E4LA 3VIFA 1XYFA 3VDBA 1EC8A 1G94A 3PZGA 4HHMA 4MUZA 2GJRA 2ABBA 1EX5A 2C15A 3LCWA 4L6DA 2Q01A 5EMLA 3LHTA 4MAVA 1RH9A 3FA3A 1BLIA 1UD8A 3ALFA 2W62A 5C70A 1XPYA 3U3HA 1SVDA 3LBCA 3UFYA 4Z2JA 1Q6DA 1R3VA 5LGZA 4RV3A 4WZHA 1DWHM 2Q8LA 5A6TC 2WM1A 4KEMA 3LLXA 4PODA 1FBAA 4W88A 1M04A 1R8LA 1PX3A 1X1OA 4O1BA 2E28A 4O54A 2JEQA 4F0KA 4S38A 4N9CA 3LHYA 5BZAA 4G1KA 1KBLA 1DTNA 2VD9A 2JKPA 4NU7A 5REQB 4IFKB 3V0TA 3B9EA 1E71M 3AZSA 3QEZA 2F38A 3UR5A 4KIRA 4JZ5A 4K8EA 4ZO6A 3UG8A 1VB9A 3W6YA 3MUAA 4GYPC 3U4AA 3QZEA 3CYVA 1YYAA 2HXTA 2V3FA 2WVTA 3FW6A 4PUDA 4B5VA 3HG5A 5AYYA 2UV8G 1KR1A 2E68A 2ZYFA 1PWMA 2WNZA 4S3DA 4QP0A 3UVIA 1DPMA 1UZHA 3W7MA 3WQWA 4FOKA 2BODX 4ZFCA 4GZJA 3K8LA 4Z1CA 1O68A 3F4CA 2F61A 5CPOA 1Z48A 1VR6A 4LUTB 5I3DA 3TQVA 1XI3A 3QR0A 4C1NB 3FX4A 4DJFA 5AZ0A 3M16A 1S5NA 2H8XA 3NO1A 2Z00A 3TK7A 1XH1A 2CW6A 5ECUA 2YA1A 1OB0A 2XG9A 3O2LA 1TYGA 3O06A 2OELA 3W7NA 1GT8A 3ES7A 3F2DA 5FEPA 1IE7C 2HRWA 4UZUA 1C7SA 3N14A 2YL8A 2G0WA 4IMCA 2BG5A 3SJ3A 3VMOA 4AISA 3XISA 3AXMA 7PTDA 1CLKA 1H7WA 5F2MA 3H2MA 3PUGA 2YDQA 2ALDA 4E8DA 3WLKX 2H3DA 3E96A 1YDNA 4IPPA 3GH7A 2YCIX 3W0KA 3RYSA 4RXFA 2PF0A 3HM7A 3CQIA 4H41A 4V1XA 5DN1A 1ZJHA 4R3UA 4HJWA 5T91A 1EIXA 2B7OA 2A0NA 4GVFA 2EPKX 1VFHA 3EX2A 3WMLA 4OUEA 1A5CA 3VX0A 3WNKA 2WO5A 2GUBA 1MW3A 4AF0B 1EB3A 3OLDA 4IG2B 1FKXA 6REQA 2IPFA 4DUOA 3W7OA 1U33A 4D6GA 2E8ZA 2R82A 4MJMA 4PBEA 4D6IA 4DJEA 4GCXA 4AU0A 2J78A 3U7BA 3UQNA 3CV1A 3UXAA 4JFUA 4XAFA 3ZSTA 4YTQA 3R25A 4WKHA 1ME8A 2FIQA 1RK5A 3CQHA 2WXDM 2Z25A 2Z6IA 1MQRA 2YCLB 3MSRA 1A5AA 4GACA 1CCWB 2OWXA 3NPVA 4MGGA 4ZCWA 4BQ2A 4QISA 4O11A 2DZSA 1OJXA 2E3ZA 1TUXA 1UR9A 4DUXA 5HQMA 1GEQA 3HQPA 4F9JA 5HXMA 4Q6JA 2J8TA 1K9FA 4Q4KA 3P0XA 2YA0A 2ZQ0A 4WF7A 2X30A 4LQ1A 1K3UA 2NX1A 4I9JA 3KE0A 2PRHA 4IPIA 1F6KA 3AMDA 1VRXA 1JXKA 1J2WA 3NPXA 1JCMP 4UQDA 4H9UA 3LTSA 2WQDA 2Y63A 3UY8A 4CVUA 3FEMA 4LH8A 1QK0A 3L7RA 3R0DA 4E2VA 3G8RA 4CN6A 3SGUA 4CEUC 3FAWA 2YL9A 1FWSA 3ABOA 1FHUA 5I07A 1R38A 4Q8VA 4KEZA 1WX0A 4JN7A 4NAEB 3RMEA 3HFYA 5IFTA 3QOMA 2X0HA 1TTIA 4Q7BA 2REQB 4BHYA 1DHKA 3WL1A 1AH4A 2VNCA 1XUZA 2GVGA 1FWCC 2BWGA 5AFDA 1TTQA 1QNQA 4L1XA 4GO8A 4GE8A 1K6AA 4NSBA 4FX8A 1YHTA 2Q3OA 2QMJA 1AQMA 3EDJA 1XYZA 3FKKA 4OJYA 4I8DA 1HL2A 4JNMA 2DZAA 4PCSA 2PMQA 2JGYA 1ZLPA 5AOUA 5HPCA 4ALDA 4YS1A 1PJ9A 3M0KA 1Q85A 3SUSA 4US6A 1JZ5A 3BSHA 1D7KA 2YBVA 2VI0A 3FV9A 2X41A 4Z0SA 3TLQA 3A24A 1YE6A 3RIKA 2DW6A 2YJQA 2J7HA 3VIHA 1GUVA 5DY2A 4CNNA 4C6MA 3STGA 2XU2A 4K37A 3W76A 1J5TA 1KCZA 3FCPA 3F2BA 2Y62A 4F3HA 1J2BA 1VFOA 2EPNA 2AKZA 4FS9A 4KWWA 3SQMA 3PTDA 4GIEA 4D8AA 1K4GA 3ABQA 2BVTA 4BF7A 1Z44A 2ICSA 1V02A 4S3KA 1V6TA 4XO6A 2OYMA 4PTMA 1EC7A 3EWUA 4EWJA 1W3LA 3K30A 4POCA 4AG0A 1TPDA 3C2YA 1GG1A 3NG3A 3MHGA 1EF3A 3KP0A 1TJPA 3CT2A 3OIHA 3EB2A 4IPLA 4GKTA 4ACZA 4L80A 1OT2A 1PPIA 3CHEA 3PPGA 2EG7A 4YL2A 5REQA 4AWTA 3IVSA 4IFKA 1EEXA 3IIVA 3C56A 3L0KA 3L23A 1X6LA 3BMVA 3S0CA 5AKQA 5G4WA 3N4FA 2WHLA 5KETA 1GVIA 2OSWA 2ADAA 2ZCGA 3SDOA 1UWTA 3QMTA 1DOSA 2ZFAA 1WAUA 1XIBA 1QDSA 2NWSA 1HGYA 4GG9A 1YMYA 1XXXA 2ZXBA 1FWJC 1JPDX 3LQLA 1SR9A 1PIFA 4NP7A 4M6UA 2ZZ7A 1XIHA 4RZ4A 3PM6A 2V82A 3NSMA 1MMFA 1L6WA 1M7XA 1XHGA 4U3AA 4M6PA 4C6CA 3R4IA 1SFLA 2PA6A 4LUTA 4O28A 3BLDA 5I3KA 4ZFMA 2PD5A 3VNMA 3I4EA 3LTYA 4LYKA 4GY1A 1JCXA 5AVNA 4HCDA 4WOQA 4GQRA 9XIAA 1F2JA 1H0GA 4U4MA 3DERA 1BF2A 1QU4A 4GPNA 1H41A 5CPLA 1PX4A 3G1FA 3ZLGA 4QQ3A 2GK1B 3BV7A 4BI6A 3FYYA 1DYSA 1W31A 3ARTA 4L5ZA 5HJYA 3LLDA 2FDSA 2GUUA 2CLLA 3HPZA 3W1PA 1VF8A 1G01A 3P62A 1WUEA 5I79A 2DZVA 3AS3A 3GR7A 2X1RA 2QF8A 3LCLA 3ZVIA 3L12A 3KCOA 1UWRA 3RITA 1XIMA 3SIMA 3VIGA 2PTZA 5EBUA 1F3EA 3OP2A 2HVMA 1J6OA 2QULA 3T05A 3NQ8A 3TEVA 4UB9A 5TAOA 3W7HA 4AX6A 3NEVA 4IIBA 2GUYA 2VJXA 2E6YA 4PL2A 1SM9A 4IWWA 1JL8A 3U9IA 4V2XA 2DIKA 4PMZA 4EXAA 4C5YA 5B7ZA 4HYWA 1IZCA 4E5TA 1QNOA 4A21A 3AWNA 3GTNA 4DX3A 5EGRA 3R0UA 1BD0A 3W1MA 1QPQA 2JALA 3A4JA 4HN4A 4IG2A 1OGSA 3FNDA 3S9ZA 3M07A 1K6WA 5DMYA 1LBLA 1LL7A 2YXXA 2Q8ZA 3G0SA 1JCTA 4L6HA 1B4EA 2O4QA 3ZVHB 1KD0A 4LBRA 4AHPA 1ZY9A 4DBDA 3QY7A 2PI6A 2OU4A 3WENA 1B5TA 4DM1A 3H53A 1JAEA 1MEWA 4GJIA 3OYXA 2H8ZA 4HB7A 2YCLA 2OG9A 3KFTA 1H5VA 1O12A 3W24A 3A5VA 3ERPA 2QDGA 3ABXA 1RHCA 4AVFA 4BJHA 1EXBA 3D3FA 3GNDA 4XSLA 2J13A 4RV8A 3DXIA 1JD9A 3PK7A 2G4FA 3L68A 3RXZA 1L8NA 1G67A 3EWYA 4PMNA 1ZJIA 1E9YB 1NH6A 3PJUA 2HDJA 2IXVA 1MQPA 4WSKA 4MZYA 4ZOAA 1J9YA 1KW1A 1XG4A 2FYMA 4JQ2A 3UVAA 4WXYA 2C1GA 3P74A 1C7TA 3B8DA 4C91A 1ZBWA 5C6MA 4L9YA 4GGBA 1GONA 1WBHA 7TAAA 3VZZA 1H11A 3WK0A 5K9XA 1EF2A 3DBNA 4AFYA 1V03A 1VEPA 3LHZA 4TVUA 4IUOA 1B4KA 1B30A 3F7JA 3REQB 1XYMA 4NAEA 3ITLA 3W2LA 3H7RA 1KM5A 1RLCL 3W26A 4GYFA 3KRSA 3T40A 2XDFA 1EGVA 3E0IA 4GI8A 3V5OA 3VFCA 3AUOA 5A8MA 4NZ5A 1DXIA 3HV8A 5D37A 3QVQA 1CEOA 4PEKA 4J28A 2ZXAA 4DI8A 2X0YA 2FB2A 3GAKA 2XN1A 1FWNA 1K8CA 3O6CA 2NX9A 2VRKA 4JL1A 2WSYA 2YCJA 4YU1A 3G1SA 4H8UA 3WDRA 1JZ7A 2L5HA 4BQ3A 3RM4A 3BK0A 3U57A 3L4WA 1UA7A 1TZ7A 4AWEA 3ARSA 2OEJA 5ECVA 4H9TA 3W7IA 3QF0A 3G1VA 4G56A 3WN6A 2VC6A 1KKOA 4GI4A 2OFJA 4LGXA 4JTDA 1GOOA 4HCLA 4BR1A 2ZUWA 1FCUA 5A2CA 3LHWA 4IUGA 5JU6A 1V0MA 1XCWA 2OYKA 4H6RA 2EQDA 3V5FA 1NOFA 1E55A 4JTTA 5AYXA 1TB3A 4AEFA 1QUMA 1XBXA 3M43A 4W9TA 1Y7VA 4H1ZA 1SZNA 1US2A 4HN8A 5CPNA 1A4LA 3W88A 2W9MA 2D0FA 2BX7A 5M1TA 1BSIA 2NQJA 3TAOA 2POZA 2QEZA 1K9TA 2DDXA 1CX9A 4M29A 5A2BA 1EQCA 1HF6A 1JCNA 3L5AA 3TCSA 4YTUA 8A3HA 2OKOA 1N7KA 3A4WA 1CWYA 2C3ZA 4H8NA 2IPGA 5LNSA 3VDAA 1ZB5A 2BHUA 1HJQA 3LRLA 3H26A 4WJXA 1KM0A 4D9PA 2GDQA 2J7GA 4E38A 2OWWA 4F9DA 4HK7A 4UFMA 1SGJA 3M47A 1BQCA 1W1PA 3RHGA 4GIYA 5M2FX 3AJ7A 3DU0A 3S42A 5EMYA 1IEXA 1LBFA 1W5PA 3TA6A 5K4ZA 1H60A 3QSTA 5EMMA 3UWVA 1XYCA 2D3LA 4J9JA 4MWAB 3TYAA 4MSSA 4JYEA 3EMCA 5JXQA 1OF8A 3LDVA 4KS0A 3QV9A 4W8AA 3BURA 3CC1A 4XAZA 3WQ5A 3C6CA 5LHEA 1RBOB 4FOJA 3RLUA 3CASA 1YEYA 4JIEA 5ABTA 1CENA 1QASA 4QITA 2NZLA 3CWOX 4GI6A 2VHLA 4PC8A 3N3TA 1K8ZA 1BYAA 4L9XA 2FKPA 4ROPA 2G4JA 1GVEA 3LY0A 2E5DA 1K70A 1QHZA 3CEPA 4DJDD 4Z2IA 6TIMA 3S1WA 5CC5A 4JKLA 2GK1A 3R43A 4UBPC 1WB0A 1OVDA 3VOHA 1CGTA 5BRBA 1FVPA 3G1HA 4XD4A 3TJXA 1I8JA 2PRMA 2CBJA 4L65A 2ZC1A 3BAKA 3P61A 1JI1A 3SFWA 1ME7A 1XYAA 1CXHA 3IJ7A 3WMBA 4MNMA 4UFLA 2QUMA 4ADTA 5KZ6A 2PC4A 4GBUA 2SFPA 5G2IA 5BWFA 4JTSA 3AS1A 4ICNA 3SN0A 2C0AA 2D22A 1U1JA 4AWUA 1Q63A 4YTTA 4Q8MA 3MCOA 4MJ4A 5CEWA 3TUUA 2WMFA 2G3IA 2VDGA 4U28A 4Q8QA 3TSMA 3UNTA 4OOZA 3LMYA 2I5GA 1PSCA 2PTDA 4XV0A 4AXKA 2E40A 3C5QA 1O5QA 3ITYA 1IXOA 3GH4A 4HU4A 3E2RA 1UA3A 3VOCA 3ZYZA 5FF4A 3M64A 1HVQA 3LI1A 3HPXA 4AD3A 1BWKA 3EWBX 1FWWA 2XH0A 2DQWA 3LUTA 2O92A 4ZZ9A 2GQ9A 2VFDA 3ZVHA 1UR1A 4C6BA 1YKWA 3RPMA 1T96A 2PDJA 1MXSA 1VD6A 3W2UA 1R3YA 4B3KA 1T99A 2XSXA 3ZZ1A 2VOTA 4EANA 2EEXA 1JDAA 1ZALA 3VIOA 4AYGA 5HULA 1A47A 3MDUA 2QNEA 3VD4A 3M0VA 1R30A 4Z1DA 1GQIA 3SSZA 3WJSA 4N6EA 1QRQA 3QYSA 1AW1A 2VZTA 4WDWA 3N18A 4QQUA 1Q2SA 3N2CA 2ZUSA 1PCKA 4AVOA 3S5SA 4HZ8A 1LDCA 1K8XA 2HE8A 1R3TA 2R8WA 5HNRA 1LT8A 1VZWA 2ZZ6A 3MC5A 5FEXA 4Y9NA 2BZNA 4GJJA 4PH6A 2RDUA 1QI0A 1TWZA 3V7PA 2VENA 3W7CA 1WAWA 3FDGA 4HVXA 3XINA 3MS8A 1TV7A 2HPMA 3IJDA 4AD2A 5EBAA 2W66A 4JTGA 2CBUA 4ZXOA 4LRTA 2X7VA 3NGJA 3W7EA 1G4EA 3MO4A 3NL3A 3E38A 3VD3A 2OJPA 5DXXA 2OPJA 3MUCA 2ALRA 1UCWA 4PSRA 1E72M 4Q4QA 2Z2UA 1CLXA 3REQA 3T1GA 4WRHA 2IKIA 5H1WA 3TC6A 4Z17A 4Y8FA 4LUJA 3GR4A 4KW2A 3OVRA 1HG3A 1CBGA 3MKKA 2QMKA 3TQ0A 1T6MA 3M41A 3ZR6A 3NSXA 3B8IA 3B8UA 1K9DA 1G4TA 1AQ0A 2WZIA 1H62A 2ZX8A 3MYPA 4NF7A 4HNOA 3YPIA 2VKZG 1F8MA 1KXQA 5D33A 1RCOB 3WUEA 3SCUA 3IJ8A 3TJ4A 1EA0A 3M0MA 1RPXA 3VE9A 3K8MA 2VO5A 1NELA 4R9OA 4YYCA 3FSUA 1I4NA 3VYLA 3THUA 1KRMA 1X7FA 1IGWA 1LRNA 2ZDRA 3DEQA 2AAMA 3A9BA 5CC7A 3GDBA 3W86A 4HPXA 2BV9A 3E0LA 4WEVX 1QTWA 4NRSA 1LL4A 2OQLA 4PCPA 2J7FA 4RDVA 2BHZA 4GQ0A 1G4SA 2AAAA 2OGYA 3GC2A 5D2WA 3PC0A 2GJXB 4I5RA 3PS7A 2PDIA 3B0UX 3QRHA 3P5YA 4JDYA 4V1YA 4WQ6A 3GNOA 2CZDA 1ICPA 3CUHA 1JF6A 1XFBA 4JN6A 3QQ1A 5CBBA 4R9XA 1EDGA 4XZWA 4WSJA 1QPRA 1ADOA 3ITGA 2GLKA 4LY4A 2Q3RA 3PJWA 2XFRA 4JIPA 3MT1A 1OK6A 2NV2A 4F66A 5IFPA 5M3WA 3RX2A 4OQVA 5HWMA 2XVPA 4D6CA 4ECLA 1QHPA 2JKAA 5D8ZA 2Z1WA 1EZWA 3B05A 4PCNA 1CXKA 1ZZMA 1GVQA 3VA8A 1OD0A 1ZAJA 1J0HA 2WNNA 4CEXC 2AQWA 5I03A 5FEWA 1P48A 1CGUA 1QOPA 4FALA 4ZQNA 6XIMA 1TJ1A 3WD1A 3VIPA 3PNUA 1UMLA 4MWAA 1PS9A 3GH5A 2I9EA 1SMAA 2WSRA 4AXNA 2YXOA 4YN5A 3E0FA 5I3GA 3G1DA 2Y5JA 1TJ2A 3NOEA 5C9ZA 4EP8C 1K7FA 6TAAA 4Z2LA 3U7VA 4WOZA 1FHVA 3U2ZA 3MVTA 3OLIA 3JR2A 5I02A 3M0HA 3I3EA 4MHBA 4CQ8A 1VYSX 1WO2A 1XJBA 4TVDA 4GYJA 5IHRA 2O7SA 3SQSA 1SFTA 1J10A 3RCYA 3N4AA 1WOBA 2C13A 4JX4A 5AC4A 4L64A 2AL1A 1P7TB 2TMDA 3W27A 4BKNA 1QWGA 4AD5A 3HGJA 4HSOA 1WZMA 4EF9A 2O4MA 3G0UA 4B4HA 4IGHA 4ZTYA 4LCQA 3UXLA 4KGLA 2E25A 5ENLA 3FLUA 4KFNA 2A7NA 3WF3A 3TAKA 4B5SA 3LQGA 4JNYA 1UZ1A 2J9XA 3UEQA 2VTFA 3CHCA 4HTBA 4GZ7A 4WY0B 3R12A 4D6DA 3RAOA 3R8HA 1EP2A 2JIEA 3LU2A 5F7UA 1D8WA 1QI4A 4JXCA 5ABFA 4J4KA 2PEVA 2CPUA 1SJAA 2YX0A 1TWDA 4Q3MA 3T0AA 2KAUC 4U2ZA 5C5YA 1UJPA 5E0KA 2HROA 3W3OA 3UWUA 1J4EA 1A80A 4C65A 4LJ3A 3OLGA 1RK6A 1DWJM 5G2WA 1XH2A 1W9XA 3KHJA 5C9UA 1FHLA 4LVAA 4UTIA 1XUUA 3OODA 2PDGA 4QJ1A 1Q8JA 1IR2A 4ZB5A 4S3BA 5EMUA 5C2GA 3GDKA 1XC6A 1Q45A 3SM0A 5DMLA 4A35A 3KL5A 2J77A 4E8GA 1U2YA 5FESA 4G2DA 4LTSA 3VGDA 1S2WA 2Y1HA 4C6QA 4JY8A 1OCNA 2WMIB 3EWCA 4O0ZA 2H3BA 3W1QA 3CPGA 4QAWA 3PP7A 1K7XA 2PP3A 5K9CA 3DBPA 3TR9A 5I09A 2OZTA 3GVRA 3LCXA 1DL3A 3PZVA 4JCMA 1UPMB 4UCGA 4H9VA 4AZ7A 1CI1A 5HOSA 1KXVA 4O1EA 3VDGA 4IX0A 3SURA 1VGAA 3NQGA 3WJWA 2PTYA 3ABSA 4DO5A 3ZT5A 2DU2A 4FB7A 3NYDA 3S6TA 2ZOXA 1ONEA 2E67A 1J12A 2FQIA 3B97A 4LAZA 2Z7GA 5A6AA 2RJHA 1H1ZA 4AEOA 1XLGA 4F0HA 5JMUA 4JTRA 5TIMA 1D3CA 2JGQA 1JPMA 3DG7A 2C7FA 1VPYA 4CQBA 4UFHA 4KBXA 1V0LA 4JEQA 1UB3A 4B2DA 5IBXC 4YVVA 3ELFA 4N2YA 1Q4WA 2PDKA 4DO6A 5BMXA 3PTMA 2IS7A 2AMXA 3BSMA 4B3ZA 1V02E 1SO4A 3D6NA 3PG8A 3LCHA 1HFBA 4UTWC 4FP1A 3SCWA 1GORA 3B04A 4QM1A 1GYMA 1XLIA 1YIXA 2V30A 1DJNA 1QMLA 4CQDA 2DP3A 1A53A 1GW9A 1RA5A 2Q09A 5E0CA 3NL5A 3S5YA 3QGKC 3VIMA 1NWUA 3IGXA 4DO7A 5I2UA 1XQLA 2XJ7A 1HJVA 4EVZA 3HA1A 3CMGA 3H2CA 2CHOA 3O07A 1V6UA 4LAKA 3WJZA 4E4UA 3S5NA 2HEJA 4C6KA 1K77A 2VCBA 2OVLA 2Y24A 2XVKA 3KTSA 4CQ9A 1L9WA 3Q37A 2EG8A 3KVMA 4QG6A 3RO6A 1HJUA 5HMSA 1MQQA 4OBRA 1FOBA 3KP1A 1LCOA 4XIAA 4AH7A 1SPQA 4MB1A 2HWGA 3DIPA 4CN1A 2CNCA 4OWGA 5HNTA 3GB6A 3AMCA 3QW3A 1O1ZA 5HUPA 3WFZA 2DFAA 2VUNA 2NLIA 1Z9AA 4A3HA 4WHBA 3BQ5A 4MTVA 3T55A 3EDEA 4X0VA 4Q4SA 3Q94A 4F0SA 5MF5A 3JZEA 3IJQA 1EXPA 4DWSB 4B92A