4B15A

Crystal structure of tamarind chitinase like lectin (tcll)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
266
structure length
265
Chain Sequence
GGNIVVYWGQGGSDNSEGSLKEACKSGHYNMIVLEELITYDNGRDPDLNLGAHCVNCTSLQQEIKYCQLKLIKILLQIGQVTPTKEDTKDTTKDLSQYLDSNFFSGKSGPLGEVYLDGIDIASVPEGLNLKFDELVQALNDSATSRRIYLSASPNCVYPDYYLDKAIQTQKLDFLFVQFFYALPCIYTQGLPEDLFQAMKTWTSNVPESIFMALPATPDLNGYIPPRVLNKEILPAVTQASNFAGVMIFDRYFDRFRKYSSKIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Investigation of a Novel N-Acetyl Glucosamine Binding Chi-Lectin which Reveals Evolutionary Relationship with Class III Chitinases.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords CHITINASE LIKE LECTIN
total genus 94
structure length 265
sequence length 266
ec nomenclature
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4b15A00
4HZ7A 1J0JA 4Z2JA 5BRQA 2BY0A 5DT7A 2CITA 2VL4A 4NRRA 5EB8A 4C7GA 1U33A 3A4XA 4PMDA 4ATDA 3VD5A 5M3WA 4AZBA 4JHOA 1AQ0A 1ZBWA 1E0VA 2VX5A 4B3KA 3AOFA 3LPGA 5D9PA 2F61A 4ZEPA 3ARVA 2G8ZA 3ARSA 1GQKA 1ZBCA 3BAJA 5CSUA 3WELA 3NSMA 1UR8A 4RE3A 2YJQA 3SCNA 2OSXA 5ABFB 1H2JA 1GOOA 8A3HA 2WKGA 3POCA 4UFIA 2CBJA 1G1YA 2YBTA 3CZKA 5JIPA 4EANA 1PIGA 1JFXA 4JFSA 3MMUA 4MJ2A 1ZS2A 3W6LA 4PTWA 1PJ9A 1BHGA 3WMBA 2OYKA 2W5FA 2J7FA 4H8UA 4AYSA 4BZYA 2AAAA 1E5NA 4UFMA 5I3DA 4PCSA 2J7DA 5HPOA 2PBOA 2BXYA 2Z1KA 2CIPA 2DT1A 4CVWA 3T0DA 1W9UA 2VRQA 2GDUA 3AHVA 1XRVA 2Y24A 3KZSA 3VGEA 2E4TA 2WMJA 2W62A 1ZBKA 4GZIA 1C8XA 3K1DA 3VVGA 3AS0A 1SMDA 3BAYA 5HPCA 1NWSA 2VCBA 2UY4A 2A3CA 8CGTA 3W53A 1WP6A 1AQHA 1F4HA 3AS1A 3BH4A 1PX3A 3WD2A 3U5UA 1JF6A 2VCAA 3K8MA 2YIHA 1C93A 1JYWA 3AS3A 1VENA 4QP0A 3RDKA 1V3HA 2GK1A 4DWSB 5BXSA 3KL0A 1TFVA 3BCFA 1HF6A 2V3FA 4AIOA 4A4AA 1V0KA 3EDKA 3OB8A 1Q6FA 1TZ7A 2WWCA 1E6SM 1TVPA 2DH3A 1OT2A 3RM9A 1KBKA 1SR0A 5E9AA 2OYLA 3ZSSA 5GPRA 1UH4A 1Y7VA 4JFWA 4UNIA 2JE8A 3MSDA 3VIIA 3WIJA 1OD0A 1OIFA 4WIWA 5E0CA 2D24A 1KWGA 1ZBVA 4HU8A 4MJ4A 2XHYA 2GDVA 1US2A 4BA0A 3GNRA 2WZEA 3AMGA 2QV4A 4DUWA 3ZOAA 3EDFA 3OLGA 1VB9A 5GQBA 1JZ3A 4B9ZA 5LA1A 2A3HA 2J7EA 1VEPA 2EPNA 4DM1A 2OWXA 3WUFA 4AWEA 4GXPA 3PZQA 1J0YA 1BSIA 1JDDA 3WNPA 1DWGM 1GNXA 3UR8A 2FH8A 2WNWA 3VGGA 3BSHA 1RD6A 3LMYA 3N11A 4HMDA 5A6SA 4PMOA 4D6GA 2F2HA 4E8CA 1B3YA 2JF7A 2BHUA 1CGVA 3O2LA 3ARPA 3IJ7A 3GDBA 4V27A 4DM2A 3WQ5A 4LYQA 1K9DA 5A6BA 3VIKA 2WLZA 2QF8A 1MXDA 3RPMA 2NT1A 4GI6A 3BSGA 1FH9A 1DTUA 2V3DA 1DWAM 1R85A 4TOQA 5FCZA 1W3LA 1BYDA 3AQUA 2XIIA 4FF5A 1ISZA 3MUAA 3QHNA 1MWOA 5HDRA 3VGHA 1H5VA 3POHA 3W4RA 1EH9A 5A8MA 1JFHA 2WMKA 1TCMA 1KB3A 1PBGA 1JDCA 3WEOA 5A69A 1V6VA 1CXHA 3SCVA 3NDZA 2AMGA 4E8DA 1V02E 2VX6A 1H3GA 2VTFA 3CMGA 4HP5A 1CDGA 1UHVA 4J3UA 4WSJA 1V3KA 2QLYA 3WH9A 1OIMA 5I24A 4P8XA 9CGTA 1NP0A 4B16A 3ZJ6A 2VVNA 2CBIA 7TAAA 2EBNA 3GXMA 3N9KA 4YHEA 2IXVA 4Z2IA 3VDCA 1FFRA 5AY7A 2G4FA 3ZT5A 4UCFA 5A1AA 3MS8A 2GSJA 1NM9A 1QI3A 3QHMA 3VDBA 3CO4A 1WO2A 3AIEA 5GNZA 1UKQA 1E4LA 2CCRA 1H41A 1GCYA 1UZ4A 1MVYA 1V0NA 1WE5A 2UY5A 3IJ8A 3SIMA 1LG1A 1J0IA 1Z32X 2WKLA 4JKLA 3IAQA 4GO9A 4H41A 3ZIZA 4W86A 4PBGA 3W27A 2D2OA 4J7RA 1E1FA 2C7FA 1NP2A 2VR5A 1CPUA 2VVSA 2XFRA 4F8XA 4HZ6A 4MDPA 3CUGA 1KXHA 1U2YA 4BF7A 4JKMA 4NRSA 3PZNA 3EMQA 5JIWA 5LYRA 2Q8XA 4JFUA 3T0AA 4P7OA 2YDSA 5KZ6A 2XVPA 1UR9A 4WLCA 3PTMA 1TE1A 1BYAA 4BQ4A 2ZUUA 3BGAA 5I77A 3PZ9A 3AMCA 1UA7A 1V3MA 1ISYA 5ECUA 4AMCA 1E5JA 3VX0A 1QNOA 2D3LA 2WSPA 5EFDA 4TX8A 1FH7A 1HJUA 1EHAA 3AIQA 4AISA 1QOXA 4AD5A 2PC8A 1Q6DA 3D5HA 1EDQA 5I6SA 1XGZA 2XTKA 1WDQA 3WN6A 2BVYA 3VGDA 2ZXDA 3AIRA 5A6LA 1CTNA 2ZX6A 1UD3A 1ITCA 2CKSA 3NSXA 5M03A 3VM7A 1KQZA 2VZTA 4AC1X 5A6AA 4HTYA 2BY3A 2J78A 2FGZA 2C0HA 1JIBA 1NWUA 3K8LA 3U5YA 4OBRA 3PBGA 4J27A 1JGIA 1QNSA 1OB0A 2W66A 4W8LA 4B9YA 3WQWA 1UKPA 4P7LA 1XCXA 3DYOA 4S3JA 1UR4A 4CD4A 3W28A 1TVNA 1NOWA 2D0HA 3ARQA 4PN2A 2ZWYA 4WKHA 1W9DM 4HU0A 2CEQA 4UOZA 1JNDA 4PMXA 2YBUA 1BFNA 1HKKA 1UR1A 1CGWA 1E73M 1ZU8A 4KGJA 2CBVA 3RMEA 3F5JA 4XV0A 5D9MA 3VKKA 4TX6A 1W9XA 1JNEA 3SUTA 5IHSA 3EDDA 3GTNA 3WQ4A 3VGFA 4M80A 2D0GA 3AXXA 2ZUMA 1PIFA 1ZB5A 2ZUWA 1LL6A 2WMFA 5A8QA 1QI5A 4D6CA 2E0PA 4QCEA 1D2KA 3L2MA 3B8SA 4PMUA 2DH2A 1UQYA 2J47A 1E4MM 1E43A 1QI2A 2G3MA 4M1RA 2NSXA 5DO8A 4DWSA 2ZXQA 3AI0A 2WWDA 4AD1A 4BQ2A 4CVUA 4IISA 3T2QA 1HVQA 1BYCA 2EEXA 2CKRA 3PZVA 2PWFA 2J75A 1JZ6A 3VIGA 4R5EA 4UFLA 4LGXA 4ATLA 1LWHA 3PZTA 4UQDA 2DIJA 3GH5A 2UY2A 1CIUA 4CU8A 3WL0A 2DSZA 4PMQA 4AZGA 3SCOA 1CGXA 4DUXA 4AZ6A 1UKOA 1LWJA 2J4GA 2XVKA 3PZUA 1WCGA 4PMVA 3A47A 2G3IA 3OLIA 3VMOA 2V5CA 3ZQ9A 4JIEA 4M81A 3L4WA 3AJ7A 1DEDA 5A6BD 3WNOA 1MXGA 4DUVA 1FH8A 1ODZA 4EKJA 3CUIA 1GZJA 3CZGA 3S6TA 4HZ8A 3WH5A 2J62A 1JL8A 3RILA 3OLDA 3SUSA 4CKQA 2E9LA 3VIMA 2WC3A 3BLPX 2BNJA 1XH0A 3AMDA 1JDAA 3CHCA 1KGXA 4UQCA 4OJYA 3WUGA 4CN6A 3AZTA 4RE2A 3ZO9A 2UY3A 3OBAA 2VX4A 4GKLA 4V2XA 5CG0A 1KR0A 1GHSA 4J3SA 3KL5A 1DHKA 3B9DA 2XM2A 5I0DA 4LYRA 1AVAA 2EPLX 2D1ZA 5LA2A 1EHNA 3QR3A 3KE0A 2ESCA 2DEPA 1QW8A 1HP5A 3VO0A 4W8BA 1J11A 3VMPA 1V0MA 1KGWA 2WK2A 4P8VA 3GXFA 4FLSA 1E1EA 2VC9A 3EBVA 1V3JA 5HXMA 1OWQA 3WDHA 4MADA 2E9BA 4GINA 1CNVA 3AIWA 1YHTA 1L8NA 3ARYA 4H7VA 4J3XA 2HVMA 4CD6A 1J0KA 3M6DA 2D20A 3MMWA 1NQ6A 2IXUA 1CECA 1B3WA 1UYQA 3RCNA 1WZLA 3VUPA 1CEOA 2O9RA 4UR9A 2YL9A 1W1VA 4TUFA 2IUZA 2GJXA 4XUYA 3ZJ8A 1ISVA 4CCEA 4HMEA 1E0XA 5D8WA 5E09A 3AYSA 1UOKA 3WENA 4PSRA 5A6JA 2WSKA 2FGLA 4CCDA 1LLOA 3U57A 2BV9A 4H8HA 3BXWA 4TVUA 1E3XA 5E0FA 2DSKA 3T2OA 1UWIA 1KBBA 1CXEA 1XD0A 2ZE0A 3ARXA 1E6ZA 5AYBA 3MANA 4CN4A 1MW1A 3AIBA 3N13A 1VIWA 1CLXA 5I78A 1V6WA 4UOJA 3L4UA 2YL6A 4AEFA 3VILA 4CD8A 2CERA 3HU7A 4ML4A 3L4ZA 2XFYA 1XSKA 2D0FA 3ECQA 4XZBA 3SUVA 1QPKA 3WL1A 3WQ6A 5IFTA 2X2YA 3ZT7A 4J3WA 1E56A 1GQIA 4MB4A 4UQEA 4EK7A 3QHOA 4QLLA 2FH6A 2PBGA 3FXYA 1VFMA 3W0KA 2V3GA 1DWFM 2ZX7A 3JUGA 4J3VA 2CNCA 2DQXA 1HX0A 2Y8VA 3VOCA 1WDPA 1IV8A 4PYSA 4KH2A 2Y2WA 1C90A 2VZOA 4D6JA 1RP8A 1J10A 3UETA 4WJXA 1TA3A 1H11A 3OA5A 1SMAA 4CN1A 2YLAA 2W63A 3OGRA 2OWCA 2DT3A 1XC6A 2O9PA 4PMNA 2EQDA 5FOOA 5CLWA 2WC4A 3MUIA 2V3EA 3WD1A 2VZSA 4TTGA 1WZAA 4H04A 2DDXA 3ARZA 1W3KA 3WH6A 3G6LA 4PCTA 3N12A 1UG6A 2VRKA 1JXKA 2BHZA 1HJQA 4TVDA 1DWIM 6A3HA 1HL9A 3ZR6A 5BYWA 2W92A 1QI4A 1PZ2A 3AYRA 1GHRA 1UD8A 4W87A 2WMHA 4JKKA 1R87A 4PTVA 4JCLA 3WF1A 4ZE5A 4D1JA 4CGTA 4MB5A 4MB1A 4OOUA 1O7AA 2YDRA 1WDSA 4JFVA 1QBBA 1EXPA 2X1IA 5E6ZA 3BLKA 2XFFA 2OLHA 2E3ZA 5A3HA 5DF0A 3N1AA 2EJ1A 3VINA 3QGVA 5FD0A 2J77A 5FL0A 3ARTA 4GZEA 3NDYA 2XIBA 2Y4SA 4CD7A 3AHZA 1MW3A 3WD4A 2QMKA 3GYCA 3F4VA 1HL8A 3AMLA 4U33A 2DT0A 4CUCA 4HA3A 4CU7A 2VX7A 2E8ZA 1ECEA 1KXTA 3WDJA 1BAGA 2VMFA 3WDRA 2GJRA 2VZVA 3AXIA 3GNPA 4HPGA 2X09A 1PEZA 3WDQA 2WVUA 1E6PA 1X1NA 1JI1A 3WF4A 2VURA 1QBAA 1BLIA 3WEZA 2VNCA 2OSYA 2WW5A 2QHAA 3NUKA 3WEMA 2W67A 3LPFA 3PTQA 1DP0A 1ITXA 1GONA 1KXVA 4UOQA 4BCEA 3CHDA 4ACZB 1UA3A 3W37A 3AFBA 2WMIA 2PB1A 2YA2A 3CHEA 4D71A 1TUXA 5A6MA 3ZM8A 1WZKA 4M29A 3VIFA 1W1PA 5C8BB 4XX6A 1DWJM 1J12A 4OOZA 4PMZA 4KGLA 2D23A 3RIKA 4PTMA 1B1YA 3CZLA 3PZGA 3EYPA 2WMIB 2BVTA 1VEMA 1ISWA 4IPLA 1UH2A 3WSUA 1VFOA 4MNJA 1OM0A 4MNMA 3CGTA 1CXLA 3AMKA 4W7VA 2E9MA 4RE4A 1Q6EA 1BPLB 2XVGA 2B31A 3TTYA 1ZJBA 2PWEA 4URIA 4D6EA 4AD4A 4HMCA 4U31A 3CUJA 2OWWA 1GOKA 1GOWA 3L4TA 2RGLA 1HNYA 3WY1A 1UR2A 1JZ2A 3ALGA 4QCFA 4Z2LA 2GK1B 3SCTA 1VBRA 4WKFA 1UD4A 1QHOA 1JZ7A 4UZSA 3ALFA 2BXZA 4X0VA 1UKTA 1C91A 3SUUA 1ZL1A 3OIHA 2XGIA 3AZRA 1PPIA 1RPKA 4D6IA 4AZIA 2DSUA 4JCMA 1JYVA 4QLJA 2J7HA 3IANA 1W91A 2J79A 1XSJA 3OGVA 1BG4A 3CUFA 2EPKX 1MFVA 4S3KA 3UG3A 3TOPA 3BMWA 5EMYA 1FHLA 2YLLA 4F79A 1RP9A 5CLTA 3FHQA 3TA9A 1UD6A 3WNNA 2WBGA 2XUCA 3NSNA 4JHZA 1BYBA 4BQ3A 3PZIA 1VF8A 3IJ9A 3U7BA 2VO5A 2QPUA 1CLVA 4IUGA 1HN1A 1ODUA 3WD3A 3HMCA 4P7NA 3FAXA 3CZEA 1BTCA 5I23A 3EDJA 4XB3A 3OGSA 4UQBA 1XYFA 3BAXA 3VNZA 3VPLA 3KEHA 3FY1A 4GI9A 2Z1SA 1JD9A 2WYSA 2ZXBA 4X0NA 1X6NA 4PUDA 3N04A 4LQ1A 1EQCA 1VJZA 1E70M 1OGSA 4CD5A 1V08A 2WZIA 1AMYA 2XSAA 4HOZA 1LQ0A 1J0ZA 1SYTA 1EDGA 1W3JA 2J7GA 4UFJA 1NWRA 3B9AA 3MU7A 1HP4A 3IK2A 1KWKA 1FP9A 1WB0A 1ZJAA 2WPGA 1TMQA 3A3HA 1N82A 5HBFA 1JAEA 2XWEA 1LG2A 3VGBA 5I5RA 3T2PA 3WF0A 2X8RA 4GPNA 4Z2HA 1VJSA 3AHTA 1D7FA 5FIPA 2O9OA 1BVZA 2ZX9A 3THDA 1VEOA 3OG2A 4X9YA 3ZT6A 2ZUSA 1CGYA 1IT0A 3BAKA 3MKKA 1ESWA 3UR7A 5I2UA 2DIEA 5IHRA 2WC7A 2Y8KA 1PZ3A 1QI0A 4A3YA 2E8YA 1R86A 1KXQA 2BY1A 2ZX5A 4V28A 5M5DA 1I75A 1W2VA 1KQYA 1R7AA 2FHFA 1V03A 3SCWA 3VDHA 3KL3A 3PN8A 3DHPA 1IZJA 2CXGA 1B3XA 1EIBA 4YN5A 4D72A 5A8OA 3AROA 2PWHA 1JZ8A 1GVIA 4KRTA 5CQ1A 1M01A 2WCSA 2WAGA 3A4WA 2V5DA 3VD9A 2WMGA 1E9LA 4KWUA 3TTOA 4AEEA 2PI6A 2W91A 4W89A 5A2CA 4HPHA 1E4NA 1E72M 1KCKA 1JAKA 2G3JA 1W1TA 2CHNA 1V0LA 4MAZA 3VIPA 2Y5EA 2BHYA 1EDTA 3GBDA 4AD0A 1M04A 3APGA 4AXNA 1HJVA 1B0IA 3GZAA 3ARRA 1UR0A 2TAAA 2J7BA 1XCWA 3A6OA 1EA9C 1PX4A 3SEPA 4CCCA 4BS0A 2XJ7A 3PZMA 1E3ZA 1NWTA 3VDAA 4PEEA 4RL3A 2G3NA 5F7UA 3TONA 3L4YA 1UWSA 5C71A 3WQ8A 4JFTA 4JZ5A 1XD1A 2CHOA 2X0HA 4D1IA 2WM0A 1E6NA 3CHFA 3MSGA 4DWSC 3CZJA 1G9HA 3TTQA 3W29A 4U3CA 4W93A 2CYGA 3NIYA 1WDRA 2QPSA 2X05A 3FAWA 4PUEA 4D6HA 1KFWA 4MDOA 5BRPA 3TP4A 1VFFA 4GQQA 4UFKA 1UQZA 4LXFA 3E1F1 4MTVA 1B31A 1GUVA 4B3LA 4HA4A 1J9YA 1OGGA 1BVNP 1V02A 4F9JA 1W32A 4P8WA 4LYPA 4A3HA 1GOQA 3GH4A 1W9BM 1CWYA 3CBWA 1E55A 1US3A 5C70A 1CGUA 1H1NA 1OSEA 5I79A 2GJXB 2JIWA 2WVVB 1UWTA 5BXPA 1HKIA 2O92A 1Q4NX 5KEZA 4IPNB 4N0RA 1D3CA 5FKYA 4Q22A 1MW2A 3K4DA 4W8AA 3DC0A 2AOSA 5A8NA 5BXRA 3W82A 1HVXA 4AZ5A 3T0BA 1C8YA 4L4PA 1WZMA 2VT0A 3T08A 1VFUA 4TTUA 1F4AA 1WPCA 2VRJA 4M82A 4J28A 4KRUA 3O9NA 3IAPA 1UWUA 4WF7A 1TG7A 2X0YA 2WCAA 3AICA 4OKDA 2XGBA 4CU6A 4J3TA 1GOIA 2A3AA 1C3FA 3LPPA 4QAWA 2EXOA 1XHGA 3WBEA 1GJWA 1XV8A 1OD8A 4PMRA 3UG5A 2WLYA 5ABHA 3M46A 1DWHM 3AS2A 1QNQA 2XM1A 1CGTA 3K4AA 3TTSA 3WD0A 1M03A 3WFLA 1C92A 5GNYA 1A47A 1GQJA 3NCOA 1E4IA 1K9FA 3UERA 5A95A 4P8UA 3FNDA 2JEPA 2YA1A 1TR1A 4IM4A 1GVYA 1E0WA 3CH9A 4QLKA 1HKJA 1K6AA 3T09A 3G6MA 1HJWA 2VOTA 3M07A 4ATWA 5ABEA 2FHCA 1K9TA 4NZCA 4WK9A 3L2LA 1VAHA 3HJEA 1W1YA 3O6AA 3MUY1 3U7VA 3AHXA 1MFUA 3I3DA 3RJXA 4Y7EA 1YQ2A 1TA3B 3AZSA 2WZHA 2ZXAA 3RM4A 2XVNA 1HXJA 3VNYA 4JL2A 3RM8A 3F5LA 4HOXA 1UUQA 5E70A 4W85A 3KWXA 5A6KA 3GBEA 1O6IA 3I3BA 1NARA 1W9VA 1P6WA 1GJUA 4OZOA 4P7QA 5IDIA 3VTRA 5JBEA 1FA2A 2WHLA 4C7FA 6TAAA 4UQAA 3SCQA 3WBAA 1W2PA 4D6DA 4K68A 3SCUA 2ZUNA 3ZJ7A 4F66A 3SCPA 2CBUA 4U5IA 3WMSA 2J8GA 1H4PA 1W3HA 2GJPA 1QVBA 4MNKA 2PF0A 2DSWA 2A3BA 4GQRA 4LX4A 1L0PA 1E6RA 2D22A 2JEQA 1HJSA 4MPKA 3VIHA 7A3HA 1HKMA 5DMYA 5JBFA 2VZUA 3W81A 3NYDA 3J7HA 4F9DA 3MV11 3QOMA 1G94A 2W4XA 1XSIA 4W7UA 2FHBA 5E6YA 3GM8A 4H2CA 2YA0A 4AZ7A 2VI0A 2YOCA 4U5KA 1UH3A 5FL1A 1J0HA 3LPOA 4M8UA 3UESA 1Q6CA 4ACYA 1KR1A 4MAVA 2VR4A 4OBSA 2DT2A 1M7XA 1V3IA 4PTXA 4L4OA 3DYPA 2DPEA 1WAWA 1XH1A 3UEQA 1UD5A 2ZIDA 3N15A 3AISA 1E15A 4NSBA 5D9OA 5DFAA 1XH2A 5IFPA 3B9EA 4HOWA 3ZR5A 3DHUA 1EO7A 1J18A 2BFGA 1FHDA 3L4VA 5DT5A 1Q6GA 2WBKA 1B90A 4W5UA 2JIEA 1CXIA 5LA0A 1G5AA 2V38A 1E6XM 2JALA 1H49A 5D8ZA 2NW0A 2WCGA 5AYIA 1A3HA 5D4YA 3VIOA 3W25A 3I3EA 3PHAA 2HISA 5CSYA 1MW0A 2A3EA 3NJ3A 4QDMA 1QNRA 1K9EA 2WVSA 2NT0A 2G41A 3W24A 2C8NA 2GVYA 2PWDA 4FMVA 5M17A 2E40A 3VIJA 1MQPA 4KMQA 5TD4A 3N18A 1EOMA 1UKSA 5CPSA 1JF5A 4OIFA 3WDPP 5ABFA 4B15A 2VJXA 1EOKA 3BAWA 1VBUA 5DEZA 3BMVA 1FFQA 2GUYA 4OUEA 4QFUA 1MQQA 3CIVA 3WMCA 1JXJA 1IZKA 1X6LA 1E40A 2D3NA 2J25A 4W88A 1GORA 4U2ZA 4LPCA 3CMJA 1G01A 1QHZA 3WH8A 5JUVA 1JYXA 4UFHA 4WKAA 3BC9A 3W38A 1GOMA 3UCQA 2PWGA 2VQTA 1QHPA 4AZCB 3EDEA 1CXKA 3VD7A 3AXHA 2O9TA 2J8FA 2ZWZA 1CYGA 1C8QA 1BGGA 2XWDA 1JZ5A 4E4PA 3CUHA 3OZPA 3OLEA 2EO7A 1ISXA 4FLQA 2ZUVA 5CXPA 3VX1A 2DSVA 2YL8A 2EPMX 2J74A 1BQCA 4ZENA 2WB5A 1E6QM 4ZE4A 2XYLA 3AIUA 1C7SA 3WF3A 5CPQA 3GXDA 3SURA 3II1A 1PX8A 5ABGA 3WUEA 3CZ8A 1G0CA 4FK9A 1B3VA 4GO8A 4WSKA 3M7SA 2OSWA 5JBDA 1KGUA 3D3AA 4P7RA 4W84A 4XZWA 1CXFA 3CLWA 5BCAA 3GNOA 5GNXA 4ACZA 1B9ZA 3FHAA 4NI3A 2BS9A 2CETA 2J7CA 3FW6A 1H09A 2FDMA 1MQRA 1OT1A 1J01A 3ARWA 1GQLA 2XG9A 1CZ1A 1FOBA 3MO4A 4AD2A 1R7OA 1V6UA 1I1XA 2JF6A 1OBAA 4YHGA 2CESA 3DYMA 3THCA 2VQUA 2WVVA 3VMNA 4DWSD 1H0IA 3QOKA 4PMYA 1S46A 2UWFA 3FN9A 3K46A 5EBAA 5A2AA 1EO5A 4ZFMA 1MYRA 2DGAA 3MMDA 5A2BA 2XPKA 3K8KA 1SFSA 5AC4A 1M53A 3ZJKA 4U3AA 3VU2A 1BG9A 3WQVA 3PTKA 3OZOA 7CGTA 1B3ZA 1WNOA 2MANA 1KCLA 4C7DA 1AQMA 1NH6A 3ARUA 1UWRA 1HIZA 2WHMA 2ZOXA 3BAIA 4M24A 3CTTA 1E71M 3A4AA 3GXIA 3EMZA 3WNLA 1UWQA 1UD2A 4U2YA 1FP8A 5HNNA 3PZOA 1PAMA 3CPUA 4AZHA 4AZCA 4M56A 3VD3A 1OINA 4JAWA 2CPUA 4W5ZA 1U30A 1V3LA 1QNPA 4ZXOA 3VM5A 4UTFA 1JG9A 6CGTA 1BF2A 4AY1A 3WF2A 3MUZ1 4MNLA 2WHJA 4GIAA 1B30A 1EGZA 1JYNA 1LL4A 4W7WA 3ZMRA 2YL5A 5CJ5A 4ZXLA 3AHYA 1LF1A 1JI2A 2F8QA 3WUBA 4Q7NA 4BQ5A 5IXEA 1JD7A 1V6YA 5CZKA 2WHKA 1RH9A 1JZ4A 3WNMA 4FLOA 2WANA 2VUYA 2ZUTA 1NOUA 1XYZA 5BXTA 3RJYA 4E2OA 2EPOA 2YDQA 4H8VA 2ZX8A 3F5KA 1WKYA 3ZSTA 3W6MA 5A94A 3DECA 5AC5A 2WXDM 3SUWA 3UG4A 1GPFA 3WH7A 2WVTA 4FLRA 4GZJA 4AW7A 3VD4A 1HJXA 4HA1A 4EE9A 1LJYA 4AIEA 4UQ9A 1W9PA 2QMJA 5CGMA 3N17A 1UZ1A 1BGAA 5HOSA 4PRWA 4EAMA 1GW1A 4Z2KA 1H0GA 1VRXA 2XVLA 5BWFA 1OCQA 3BCDA 5D9NA 4YPJA 1I1WA 3L4XA 4AD3A 5CPTA 1CENA 4TXEA 3EMCA 3WNKA 1HT6A 5BROA 4JL1A 3WFZA 1OGBA 1EQPA 3W26A 2OYMA 2W61A 3MV01 1QW9A 1V6XA 5CGTA 4TVCA 2RGMA 2JFEX 2YKKA 3AIVA 1C7TA 4NF7A 2BVDA 4AIUA 4R27A 2VCCA 2ZICA 4UZUA 3WDIA 3GH7A 4Z2GA 1B2YA 4N42A 4PSPA 4D6FA 2BY2A 1R8LA 3SCRA 3SCSA 5A8PA 3RO8A 2XSBA 5EFFA 1LL7A 3S2CA 4GI8A 3HN3A 3WKZA 1NOFA 4MB3A 1CBGA 2GFTA
chains in the Genus database with same CATH superfamily
4F0RA 4GY0A 5EB8A 2Z1XA 5KITA 3UNTA 3FLUA 1JUEA 4FNQA 1BWKA 3ABXA 2QVNA 4AVFA 4QJ4B 1O4UA 4B3KA 2OPJA 3QGAC 4C1NB 4HPNA 5D9PA 4H6RA 2Z0IA 2FQIA 4JPGA 1OJXA 4K7YA 1GQKA 1W0MA 3BAJA 5FEPA 2NUYA 3NSMA 3SCNA 2OSXA 2NWRA 4K1WA 3NXFA 4OTKA 4P5UA 3WMLA 1A5AA 4S3AA 1PWMA 1GTHA 1JFXA 4JFSA 4MJ2A 2IMRA 1W3IA 4C5YA 4H8UA 1GVSA 1U22A 1E5NA 3KWSA 1JEZA 2FTPA 1AODA 4LUTA 4X63A 1EYWA 5HMEA 2PBOA 2PE4A 2DT1A 4CVWA 2VRQA 5KZMA 3TWBA 4DBDA 3GB6A 2PWUA 3CC1A 3TMQA 3M0IA 3WLJA 4GZIA 4I5RA 1RQHA 3K1DA 1ADSA 3UWYA 1H50A 2VCBA 1RD5A 4EPKA 3W53A 1WP6A 3PB0A 4E6MA 3JW7A 4QQ3A 3AS1A 3BH4A 1QPNA 2VCAA 4EVZA 3K8MA 3AS3A 2PLCA 4IIDA 1FCUA 1B54A 2GLKA 5BMXA 1UR3M 3WK0A 1N8FA 2Y62A 1EP1A 4NKCA 4PFHA 1RBLA 2HWGA 2FFIA 4AIOA 1Q6FA 5HUPA 2A85A 2WWCA 1TVPA 3I4KA 3H4GA 3G1RA 3LCLA 2YXXA 3G24A 3S83A 4FXJA 1KBKA 3ZSSA 1SR9A 1SW3A 4PFMA 1W1ZA 1GEQA 2FZ9A 5FF0A 4UNIA 1FKXA 2PU0A 2JE8A 3BCJA 5CJNA 3CT7A 1OD0A 4DO4A 3Q94A 5E0CA 4HU8A 1FWCC 3G1HA 1US2A 3JZUA 3ENLA 4B5UA 4BA0A 1K6WA 2WZEA 3AMGA 1UMLA 3OLGA 2OKOA 4ZCWA 4E4UA 5IOBA 4R9XA 4DM1A 3N2XA 1D8WA 3PZQA 1J0YA 3WNPA 2FH8A 3BSHA 3LMYA 4HMDA 5A6SA 3UT0A 1OFPA 2QCDB 1YLVA 1FWHC 1PCWA 1B3YA 1TV3A 3UZZA 2BHUA 4N9CA 1CGVA 3O2LA 5K4ZA 3GDBA 2PGEA 4Y9OA 2Z28A 4LYQA 1LORA 3H2OA 5A6BA 3VIKA 5FF2A 1EWEA 3LI0A 1FH9A 1R3YA 1XDLA 4DIAA 3DUGA 3DCPA 3OU8A 1W3LA 1BYDA 2XIIA 4FF5A 3M1ZA 3VGHA 3KRZA 4KEVA 1M1BA 2PZNA 4C6KA 3W4RA 2GJLA 2PF8A 1ZALA 1DE5A 1KB3A 2VWSA 5DY2A 1PBGA 3LD5A 3WEOA 3GG1A 3GIYA 2AQWA 2G4JA 1JJKA 3NDZA 1H3GA 2PS2A 3I6RA 4HP5A 3GDKA 1GYMA 2E6FA 1UHVA 3M47A 4WSJA 2QLYA 2VYOA 3T55A 1OIMA 1TPDA 1S1PA 2UBPC 4B16A 3D6NA 3C2VA 2VVNA 1PS9A 2EBNA 4O53A 1UPPA 3H22A 1FFRA 5G2IA 4PRRA 1H7WA 4O11A 3IVSA 4YWIA 4P2VA 1NM9A 1REQA 1NQKA 3VDBA 3CO4A 3SGZA 3NPVA 4PL2A 1GCYA 4E5TA 2PP1A 4C6OA 2UY5A 4IICA 1LG1A 3PP7A 1PYFA 1RY0A 3MHUA 4JKLA 2HSAA 3IAQA 2DZVA 4H41A 1QOPA 3QV8A 3ZIZA 1H51A 4LT9A 2D2OA 4NZFA 4Q8MA 1UW9A 5XIAA 2P0OA 5FJTA 4GNVA 1HL2A 3KP0A 2VVSA 2E7FA 1FDYA 4IQJA 4BF7A 1J2WA 1TPEA 3OHMB 1HW6A 1EEPA 3EMQA 3OODA 5JIWA 2YDSA 5KZ6A 4KETA 3GW3A 2QDHA 3HPSA 2ISSA 3B4UA 4BQ4A 1I4NA 3PJXA 3R13A 4DO5A 5D02A 3QC0A 5HMSA 3BGAA 4S2CA 2IKJA 5K4XA 3LA4A 1FDJA 3AMCA 3EKZA 4AMCA 3WJYA 3DU0A 3QKZA 4NG3A 3IJ6A 3B8IA 4HTBA 4PH6A 1PV8A 2Z27A 5AC6A 1EZ2A 3PUEA 3HO8A 1XS2A 1XGZA 2BMBA 2XTKA 1K8YA 4UTLA 1WDQA 3VGDA 4JIPA 1DXEA 1VYSX 2ZXDA 2OJPA 5FEZA 3OIXA 2F6XA 1UD3A 3DX5A 2E1WA 2RDUA 2X1SA 1BKSA 4R53A 1ZAJA 4MVAA 2GL5A 3AC0A 3KDOA 5DBTA 4J27A 1RBAA 2W66A 5CZSA 2VUNA 1UKPA 5C9RA 3IPWA 1XCXA 4P7LA 3OTRA 4LUTB 4S3JA 4CD4A 4HD5A 1NOWA 2D0HA 3NR0A 2PDMA 1P0DA 3TEVA 4HU0A 1UROA 4LF1A 2YBUA 5IDZA 1BFNA 1TV5A 3P14A 3M5ZA 5CBJA 4KGJA 3NPUA 3B0XA 1DIEA 1PWLA 4Y9AA 3F5JA 4FI4A 4TX6A 5IHSA 1VBJA 3L0NA 3LCHA 1FVPA 4JBRA 2ZUMA 3CAKA 3CIXA 2ZUWA 3UPWA 4N4QA 5A8QA 1QI5A 3ZYZA 4GJJA 2E0PA 4QCEA 2P8BA 3EOLA 3L2MA 4PMUA 3S1VA 1UQYA 1E4MM 4MWAE 2G3MA 1LRTA 5DO8A 1FXQA 4K6AA 2WWDA 3GWQA 4AD1A 4CVUA 3T2QA 1R3VA 3TC6A 4GYFA 2QGYA 3PZTA 3ABZA 4J35A 4UQDA 4XSLA 3U48A 4ORIA 1FCBA 3GH5A 5KTLA 2PSNA 3LS9A 1GVFA 2VFGA 1UCWA 3SCOA 4RV3A 4DUXA 1S2WA 3H4XA 2J4GA 1XDJA 4LSBA 1H60A 4PMVA 3A47A 2G3IA 4FNRA 1DEDA 4NNAA 3STPA 1RK6A 2J66A 4HZ8A 3WH5A 3BE7A 3DFQA 4LU0A 3E0WA 1PL9A 2CW6A 4QBXA 2GYIA 6XIAA 3AMDA 1TVLA 5CAKA 1MMFA 4CN6A 3AZTA 4ALDA 4KWSA 4GKLA 4V2XA 2CLKA 3LGEA 1XLJA 3WJXA 3OYXA 5JXQA 2XM2A 3LYEA 4A3UA 3CAWA 3T9PA 3UGRA 2ESCA 2DEPA 1HP5A 4I7VA 3VO0A 4W8BA 3THUA 3DFPA 3LV6A 1MUWA 4ZSUA 2CLIA 3GDMA 4MADA 4D8LA 4DXKA 4EOUA 4DAFA 3AIWA 3ARYA 4H7VA 4J3XA 4NVTA 4X3ZA 4CD6A 3SDOA 1J0KA 3TROA 4KWWA 4QISA 4NZ1A 3MMWA 1NQ6A 2IXUA 2NQ5A 1CECA 4NI8A 3VUPA 1R0MA 1XIGA 2YL9A 4ASTA 4TUFA 2IUZA 2R6OA 1EX1A 2IKHA 1B9BA 3LDVA 1XISA 5BW6A 5E09A 3MUCA 3WENA 1M65A 5A6JA 4CCDA 4GX9A 4H8HA 3BXWA 4LBUA 3UWVA 1CXEA 1XD0A 1E6ZA 4CN4A 3OHIA 3W7PA 1Z3NA 1TMHA 1LTDA 4AEFA 4GIEA 2OO0A 2RH9A 4HBKA 3UJRA 3AYTA 2VEFA 4R3UA 2CERA 3SQSA 3HGOA 3L4ZA 1B5TA 1NELA 1TWSA 3VOIA 2GSHA 3KCJA 4XZBA 3SUVA 3WL1A 4QITA 4EK7A 1SZFA 4L80A 4QLLA 2PBGA 5LNUA 2ACRA 1VFMA 1XWYA 1RZMA 3WK2A 3KLKA 4WX2A 2CHRA 3SY8A 5CPOA 3LV5A 2PDXA 3RPTA 5IM51 1H7XA 4I8DA 5B7YA 2VZOA 3M6YA 3MMTA 1JPIA 1RP8A 1J10A 3OA5A 4C6PA 1S2TA 4DNMA 1I2NA 1H1ZA 3B05A 2FPTA 2VELA 3PG8A 4NJKA 4GACA 1K4GA 1VPXA 3M0KA 4WXYA 1UWAA 3WD1A 4BK9A 3LGDA 2XSXA 3B04A 2EAWA 5T26A 2OGYA 3KBWA 3QZAA 5HJLA 1L2UA 3W07A 1XPGA 3TCEA 1Q2SA 1UD8A 1R87A 3GFXA 1XM3A 4JCLA 3ANYA 3WF1A 3SN1A 2DZTA 4H9VA 4W9TA 3VXGA 4JFVA 4ZFCA 4B5XA 2OLHA 2E3ZA 5A3HA 1OFBA 2RUSA 1KLZA 2J77A 4JN7A 5FL0A 4MOZA 2AQOA 2Y4SA 1MW3A 1Y5XA 2CZEA 1HL8A 1OZQA 5BNKA 4CUCA 1ECEA 1XIHA 1KXTA 3NAVA 1GT8A 3N14A 2CZDA 4HPGA 3S6OA 1TPC1 1R30A 2X41A 4NJJA 3AXKA 1X1NA 5H6HA 3WLHA 2VURA 3XINA 1VQTA 4L56A 3S1XA 2HCVA 4H9MA 3WEMA 1A4MA 4LEFA 3PTQA 3P93A 1DP0A 4U4MA 1ITXA 2F6KA 4LVGA 4BCEA 1XRTA 3FA5A 4ACZB 3NFUA 3W71A 1A3WA 4S23A 5HJYA 3C2OA 5E1QA 4AWTA 4NZ4A 4D71A 4L9YA 1EBGA 1QDSA 3UXIA 1GVOA 4XX6A 4Z1BA 1SO4A 4JHMA 3PZGA 1JVNA 2YYUA 2WMIB 1O66A 1UH2A 3UQNA 3WSUA 3QV9A 2ZFAA 4DJEA 5CH9A 3G5EA 3QSRA 3PR2A 2E9MA 2VEIA 4RE4A 3URNA 2E5CA 2J24A 2R1KA 1BPLB 3DEQA 4IP4A 2MNRA 4F4RA 4URIA 1W3TA 4XKMA 3MI3A 3NPXA 2P50A 1GOKA 4B3ZA 3L4TA 3WY1A 4NJGA 1SW0A 2GK1B 3QVQA 4Y9NA 2CWNA 4Q3MA 4GUFA 3S2MA 3SUUA 1C91A 3EWYA 4YCPA 1F8MA 1ZL1A 4GXMA 1WXYA 2QJNA 4L9ZA 1RPKA 2BP1A 2H9AB 2DSUA 1JYVA 2IW0A 1F5ZA 3A3WA 2J79A 3TYDA 3WJZA 3W7JA 4S3KA 3VCRA 4HK6A 1JCTA 1FHLA 1M41A 1XF0A 2YLLA 4ONVA 3R7MA 4F79A 3GY1A 3GRIA 3VCCA 1MO0A 1F61A 1AZ1A 2V9DA 2VEKA 1ZCCA 1VF8A 1UIOA 2QJHA 3IJ9A 2QPUA 1CLVA 5DXYA 4IUGA 2PGFA 4O4VA 1O95A 2B7PA 4HHLA 3NQDA 1BTCA 2GVGA 1XYFA 4HK7A 3M0MA 3VNZA 1V7AA 1JPKA 3FY1A 4Q8WA 1WBHA 3GLCA 5AVHA 4OBTA 3TQVA 1G4EA 2V2HA 3VZXA 1JD9A 4X0NA 3CH0A 3HFTA 4K8EA 3SIZA 4XIAA 1VJZA 4Q7BA 4O1DA 1XRSA 3AJXA 1JGMA 3HOJA 1G6CA 4QR6A 3AALA 3UA3A 1FP9A 5FAJA 4DJDD 1ZJAA 2AKMA 1EC9A 3A3HA 1N82A 5HBFA 4H19A 2DVTA 3LHVA 3T2PA 1FCQA 1Z7AA 5FF4A 3EXTA 3S2JA 2X1RA 1ZPTA 4O10A 2DZAA 1UMYA 3P5YA 1M7PA 1VEOA 4WCJA 1VFHA 3N2MA 3FJLA 3GX9A 1CGYA 3LQLA 3S5ZA 5I2UA 2DIEA 2IPFA 1PZ3A 1QI0A 3TQ0A 2I9UA 2AGTA 1R86A 1KXQA 2BY1A 3TR9A 2HBXA 1X8CA 4V28A 1O5KA 1I75A 1KQYA 1R7AA 4MMWA 3UYCA 2PC4A 1V03A 1MEWA 7PTDA 2BGSA 3UJFA 4F48A 3NYZA 1B3XA 2A7RA 4D72A 3DENA 5C9ZA 2PGRA 4H6QA 1MUCA 5D2XA 1JZ8A 1GVIA 3BK0A 5C7VA 2V5DA 3VD9A 1E9LA 4CQCA 4KWUA 2H8ZA 3A9IA 4W89A 2BOEX 1R3SA 4NIRA 1OABA 2G3JA 1TELA 4QG6A 1TWDA 3VIPA 3S5YA 3ICJA 3GBDA 1LBLA 2ZRVA 3WYZA 3NQ8A 3W7EA 4AXNA 1HJVA 2VGGA 4IOTA 4JTIA 2YFOA 1WAUA 2QUMA 2Z00A 5IBXA 3IIXA 3LQGA 1IEVA 1XCWA 3Q37A 1IEWA 1PX4A 5EMMA 1EBHA 1XGDA 5KMYA 4LNYA 2XJ7A 3IV3A 2GGJA 3TA6A 3D3FA 2WZMA 3TONA 3W1TA 1JDEA 4UBPC 2B81A 4UC5A 2WM0A 4RK8A 2C91A 3CZJA 1HKWA 2VEMA 2CXEA 3W2MA 2IPWA 2CYGA 3W7QA 3NIYA 1K8ZA 2X05A 1QU4A 1DIOA 2OMAA 3KDNA 4DRSA 5BRPA 3TP4A 1VFFA 5HNUA 5CBIA 3E12A 4B5TA 5G1MA 1YNYA 1OGGA 1V02A 3NDOA 3NZGA 3LMZA 3SJNA 3C0QA 5AHFA 4WZHA 2PDIA 1MEIA 1PKLA 4ICNA 3EB2A 1VCVA 2E6YA 4KWOA 1CWYA 4L7ZA 1US3A 1YIXA 3I7RA 6REQA 2BVWA 3CXOA 3DFOA 5I79A 3GXNA 1RALA 2WVVB 1UWTA 2GWGA 3BZGA 4XZLX 3QV7A 4IPNB 1E1CB 1UP2A 2DV0A 1X6UA 3DC0A 3UCDA 2B7NA 5A8NA 5AC8A 2O56A 3C6CA 4AZ5A 3T0BA 4L4PA 3T08A 1O5XA 1KCXA 1IXPA 3GTIA 1S2CA 3LXBA 1OY0A 5T9BG 2HNHA 1ZENA 4RE0A 2VRJA 4FXFA 3GTXA 2FPYA 2HROA 1SW7A 1UWUA 3N25A 3ONBA 1SJCA 3ISIX 1FWGC 2WCAA 3QPYA 3OZYA 4ENLA 5CCZA 3TLQA 4IMDA 1TKKA 3C52A 3TQPA 1GOIA 2A3AA 4QTGA 1JCNA 1XHGA 4RW3A 3D0CA 4IIGA 4LUYA 5IBXC 1KTNA 1RY8A 3QRHA 2WLYA 3UG5A 2NQHA 4HK5A 1DWHM 2PD9A 2XM1A 1CGTA 1F76A 3A12A 3WD0A 5LGZA 5GJMA 5HWMA 1C92A 3ANVA 4XAFA 1V51A 2ASHA 4DUOA 4BI7A 3O8AA 1E4IA 1TIWA 4XAGA 1K9FA 3DZ1A 5AECA 1X1ZA 3G8EA 3STCA 2YZ5A 4HSHA 1E0WA 3CH9A 4HNUA 1K6AA 3TJIA 2VOTA 3L2LA 3PNZA 4EAYA 1MFUA 1FHVA 3I3DA 1OYAA 1K3UA 1TA3B 1KTBA 1XR2A 5H1WA 1U5HA 3IUIA 4DYJA 3F4NA 2IQTA 4UMBA 4YIWA 3GBEA 1K03A 2Z24A 4BJHA 1P6WA 4P7QA 4NASA 2NXIA 2ZKMX 3W7RA 2I1OA 4IPJA 4W4QA 2O55A 3WJWA 4DJFD 4QNEA 4UQAA 3SCQA 4XD4A 1W31A 2WPBA 2BDQA 4OWGA 5J8LA 1EA0A 2OQYA 4UR7A 3ZJ7A 2L5HA 2F6UA 3SCPA 3WMSA 2GJPA 1QVBA 2R94A 4GK8A 2XIOA 3NGFA 4GE8A 3CQHA 3BANA 2A3BA 3E74A 1GEHA 1L0PA 1E6RA 6ENLA 2D22A 2OT1A 4WDTA 4MPKA 7A3HA 2RJGA 3W81A 1EEXA 4XO6A 4QGCA 1H5YA 3RLUA 3C5QA 4NX0A 4H2CA 2VI0A 5EL1A 5FL1A 1J0HA 4V15A 3ZR4A 3UESA 1D8CA 1Q6CA 1EUAA 4IIBA 4ORMA 4JQ3A 1O60A 3MJYA 2XIMA 1V3IA 4PTXA 3G18A 4DJDC 1WAWA 1BTMA 3QJAA 3UEQA 4WDXA 1UD5A 3ONCA 4NSBA 5IFPA 4EF8A 3B9EA 3GK0A 3DHUA 1FHDA 1UC4A 1X7IA 1Q6GA 2WBKA 5G4WA 1B90A 3ZWTA 2JIEA 5LA0A 2OOGA 2V38A 4UNKA 2JALA 3V4BA 2PTWA 1J2BA 4MKNA 2NW0A 4KKXA 4IWWA 2HPIA 1QW7A 5AYXA 2DZSA 3F03K 1MW0A 2A3EA 4AQLA 3M0YA 2GVYA 4KPLA 1S3HA 2PWDA 3LN3A 5TD4A 1MQPA 4KMQA 3BMXA 1EOMA 3E96A 1UKSA 3DI1A 4PMJA 4PUUA 4B15A 1PTAA 4TMBA 4LAKA 1CW2A 4QROA 4I9MA 1N8WA 5HULA 3KOWA 3LCGA 1GG0A 3AXMA 1YBQA 4YJ5A 1X6LA 3M0LA 4U2ZA 2J9XA 1DL3A 5G5IA 2VXNA 5CKSA 3WLPA 3NQAA 5JUVA 2XN0A 4UFHA 4UTMA 3BC9A 3I6TA 2REQA 4XZNX 3P60A 3ZZ1A 1XYCA 4S3GA 3OA3A 1JULA 3VD7A 4O28A 3TSDA 2ZWZA 4V33A 2Z2UA 3XISA 3B8VA 1DQUA 1BGGA 3VE9A 4DF0A 3CWOX 3VZYA 1JZ5A 2H6RA 4MG4A 1XLCA 3OLEA 3CQJA 2EO7A 3U0HA 4FLQA 5CXPA 4HCHA 2EPMX 4M0XA 1BQCA 3FJNA 1E6QM 4ZE4A 2ZTKA 2QS8A 4N9BA 1R9ZA 3WUEA 2G3FA 5G1TA 1RA5A 3HV8A 2DVXA 2YBVA 1DQXA 1YDYA 4WSKA 4AWUA 5JBDA 1AJ2A 1DXFA 1KGUA 2ZZ4A 2O4MA 1KA9F 2PD5A 1CXFA 3LOTA 3NQFA 4ACZA 3FHAA 4NI3A 4Q8UA 5FESA 1H09A 2IPJA 4B2DD 4XBSA 2DIKA 3V3WA 5AHNA 1I1XA 3QQWA 4B92A 3M0VA 2QCNA 3DYMA 2ZTJA 4PEKA 4PMYA 3PUOA 3HF3A 4IGHA 5EBAA 5A2AA 4ZFMA 2RAGA 2XPKA 3P8JA 1A4LA 5LHEA 1DQWA 3PBUA 1LLWA 2WSYA 3VU2A 2C79A 3EEZA 3GHUA 2A2IA 2V30A 2MANA 2HS6A 4C7DA 3HZ3A 1XIMA 1EGVA 2BODX 4JQAA 3CTTA 1GVQA 1KBIA 3GXIA 5I7GA 3WNLA 4P61A 1V79A 4LF2A 4U2YA 3MC5A 1FP8A 5HNNA 3EA3A 3CPUA 1DJWA 3S2LA 4JAWA 4XSMA 1YKWA 3AWNA 2QUTA 1A0CA 3PFMA 3MUZ1 1H7NA 4KCTA 1P1MA 3ZMRA 4ZXLA 5CC7A 3WUBA 1FUYA 1F74A 3WX7A 1JD7A 2PODA 5CZKA 1VPYA 2WANA 3U2EA 1NOUA 1XYZA 3I68A 5K9XA 1B4EA 3ZS4A 1QPQA 3RLGA 4E2OA 3KOZA 3N2CA 3NQ2A 1G7UA 3N6JA 2QYGA 2WVTA 3PTDA 4H4IA 4AW7A 4X2RA 5HANA 2GZXA 4HA1A 4EE9A 1LJYA 1KFCA 1TJ1A 1HZYA 1W9PA 2QMJA 5K9DA 3C61A 2UV8G 2XVLA 3W84A 4PE8A 3VNMA 3DFHA 3OG3A 3C0JA 4JTDA 3S1UA 2RDXA 4JTRA 3HM7A 3W2JA 1A0EA 1QW9A 4TVCA 1LOQA 1Q85A 1TPWA 2YCJA 3AIVA 3WK3A 4NF7A 4AIUA 4R27A 4UZUA 3VUSA 1UBPC 1YPIA 3H2NA 1GZ1A 1PSCA 4N42A 3PJUA 2BY2A 4PTNA 3HGJA 3ERPA 5EFFA 1XG3A 3S2CA 4GI8A 3HN3A 3TW6A 7REQB 2NVCA 1IEXA 1IHIA 1TX0A 2GFTA 4AEOA 3INPA 4HZ7A 1XKJA 5BRQA 2ICSA 3L7RA 3R10A 2Z1BA 4C7GA 4ERIA 3JZEA 4PMDA 1OX4A 3KVLA 1L6WA 2DUZA 3Q4DA 4JHOA 1ZBWA 3KTSA 1E0VA 1TV4A 3I7QA 1JR1A 1RQBA 3R5EA 4HVXA 2F61A 4ZEPA 3ARVA 2G95A 3BOXA 4G1NA 5F2LA 4N6EA 5CSUA 3WELA 5ABFB 3U2ZA 3E2QA 3MWAA 2VFEA 3OZMA 3P7YA 4UMAA 3F2DA 4EANA 5BOOA 3N6QA 3UD6A 4GC3A 4PB3A 4PTWA 2QPXA 3WFAA 1KFLA 3AO0A 3WMBA 4UFMA 3N29A 2INFA 5FJIA 1TUFA 4PCSA 2J7DA 3W2KA 1F6PA 1KM6A 2A0NA 2BXYA 2XH7A 3NO3A 1ME8A 4I8YA 5EA9A 2HBVA 2FGBA 2P10A 3T0DA 1ZRQA 1LP6A 3AHVA 3ITCA 4GGBA 1XRVA 4TMCA 3LLDA 3KZSA 4ZOAA 3UG8A 5DLCA 4FXRA 5I3KA 6REQB 1G4TA 4O16A 3IGSA 3A22A 5LGXA 2BB0A 4IX2A 3SR7A 1MDRA 1QATA 4MJZA 3B03A 2UY4A 4IGSA 1NF7A 2H3BA 3LU2A 1AQHA 3F4CA 3UJSA 1PX3A 1SFLA 3U5UA 3MCNA 2PDLA 5J04A 3HFYA 2O4QA 1V3HA 3REQA 2GK1A 4KQNA 5LIUX 3T1GA 5AZ1A 5CPMA 4A4AA 2NX9A 1RJRA 3LHUA 1E6SM 3GFYA 3VZZA 2DH3A 1B57A 3M5YA 1OT2A 3UZ5A 4NNBA 1SR0A 4FOJA 2ONEA 5E9AA 5AVNA 2OYLA 5F4SA 1T6MA 2GQ8A 7REQA 4YL2A 2KX9A 4TU1A 4Z42C 3CV1A 3NQVA 3MSDA 1AUSL 4C6LA 4A3RA 3TNOA 3HIJA 2D24A 1KWGA 3SADA 1CB2A 2QV4A 3IIOA 3HG5A 4IFOA 1VB9A 1XFCA 4B9ZA 2ALRA 4FNTA 2J7EA 1VEPA 3H53A 4AWEA 3IUHA 1RHCA 2Q09A 1JDDA 3GDRA 4CQ8A 1DWGM 1GNXA 3UR8A 5CSSA 3N11A 2ANUA 1ZSXA 1O1ZA 3H2AA 1RLDA 4Q7IA 4GJIA 3ARPA 4IMFA 3KBVA 3W83A 3S9YA 2X42A 2CC0A 3KM8A 1FWJC 1MXDA 3TXZA 2ZDRA 5F2GA 2NT1A 4GI6A 3TN3A 3BSGA 4IFRA 2QR6A 1R85A 4TOQA 5FCZA 1WKDA 3AQUA 3QQ0A 2ZVIA 4HN4A 5HDRA 2ZA2A 3QMSA 1BKHA 1H5VA 3CIWA 1W5MA 5LSMA 4JTSA 1TCMA 2Y7FA 3ZVIA 5A69A 2D69A 1WOAA 2WO5A 3SCVA 3N9RA 1F2JA 1V02E 1RSCA 2YCLB 2NV1A 4DJDA 2XU2A 3MY9A 5TQLA 1NIUA 1FWRA 2QAPA 7TAAA 2BX7A 3GXMA 4FR1A 1TTPA 3VDCA 5I00A 3U4FA 5A1AA 2FPVA 3NNTA 3AIEA 5GNZA 3R8GA 3PNUA 4GCAA 1UKQA 1E4LA 3B3DA 1T41A 1UZ4A 1V0NA 1WE5A 3IJ8A 1J0IA 1JPDX 2WKLA 2GVEA 1TJ0A 1GG1A 4LCRA 3NXLA 2A21A 4IX0A 3BG9A 4W86A 3VAVA 1A0DA 4PBGA 4J7RA 1E1FA 1ICQA 1PXGA 1NP2A 3W7NA 1XIBA 3CUGA 4ICMA 2PDKA 4A8NA 4MY9A 2PDCA 2Q8XA 4JFUA 1BSLA 4P7OA 3IEBA 2C0AA 1UR9A 3S4TA 4XD5A 2G96A 2GGIA 4O15A 5JU6A 2PDWA 5REQB 1A5LC 3WJSA 2POTA 1FCVA 3PJWA 5T9CE 1V3MA 1ISYA 5ECUA 5GVJA 1E5JA 1QNOA 1YBQB 4A21A 5LIXX 3A24A 4TQTA 2XN1A 2WSPA 3NL5A 3O06A 3TH6A 2VFFA 1FH7A 1HJUA 3AIQA 3KFTA 4AISA 2PDHA 2PC8A 5CC3A 3W7OA 3PWAA 3TK7A 4IMCA 1W37A 3EX4A 2PTDA 3VDGA 4LCSA 1O1HA 3WN6A 2BVYA 5CJMA 3G8RA 2Q8ZA 3AIRA 5A6LA 2ZX6A 2G50A 1ITCA 1D3GA 2CKSA 3NSXA 3VM7A 2VZTA 3RR4A 4HSOA 2J78A 2FGZA 2WNNA 4K3ZA 3FV9A 4UXDA 1JIBA 3K8LA 4E2BA 3BQ5A 3PBGA 1MZRA 1QNSA 1RVGA 1OB0A 3Q67A 4B9YA 1J96A 5FACA 3WQWA 4ADSA 1X8FA 2OQHA 3NM3A 2OOFA 5JVLA 1IR1A 5CPNA 2VKZG 2ZWYA 1RVKA 4WKHA 3V1HA 4QDPA 1P5BA 4JIQA 1VHCA 2CEQA 4UOZA 1JNDA 4F0KA 3H8AA 3O0KA 4Q4KA 1CGWA 1E73M 1TZ9A 1ADDA 4ZB2A 1W9XA 3IIPA 1JNEA 3EDDA 3GTNA 5TIMA 3W73A 3BJTA 4M80A 3K1GA 2C15A 3TVAA 1WA3A 1ZB5A 3IJLA 2WMFA 3LRKA 2HVNA 4D6CA 3H4WA 1PHWA 2QUVA 3MBFA 1VCGA 3BTNA 4IUOA 2B0MA 2J47A 3VKCA 5I02A 1QI2A 2NSXA 4CQ9A 1EPXA 4CNSA 3TYEA 2ZXQA 3AI0A 1R38A 3TFXA 4BQ2A 1LROA 2Z25A 4FA3A 4IZGA 2J75A 1JZ6A 3VIGA 3LI1A 4J9JA 4ATLA 4LGXA 1LWHA 2UY2A 1CIUA 2HK0A 1G4PA 3WL0A 3IACA 2DSZA 4PMQA 4PUJA 1UKOA 1YE6A 2XVKA 4QXIA 4NAEA 1KM5A 3O05A 3OLIA 3VMOA 3ZQ9A 4QIUA 4H7CA 1TE6A 1OC5A 4G9PA 3SM0A 3WNOA 4DUVA 1ODZA 4DF2A 4EKJA 1PDYA 3CZGA 4WQ6A 3W1MA 4FR6A 3S6TA 1UB3A 2OCZA 3W74A 2V2CA 2J62A 3M5XA 1JL8A 3VE7A 4GYPA 3E9AA 1RAKA 3M5VA 3VIMA 2Z2BA 3H24A 3H2MA 4AB4A 5LXEA 4XZMX 3RR1A 3SRDA 2BNJA 4AVNA 2TYSA 5C0QA 3L23A 1JDAA 3CHCA 4OJYA 3ZO9A 1HO4A 3QGKC 1NDVA 4H2HA 2VX4A 4NJIA 3FVDA 2B4GA 3GDTA 2O7QA 3MCOA 3STFA 4QDWA 3T78A 4LH8A 1S5MA 2FZMA 3B9DA 1W1B1 1EJRC 4XVEA 1DJQA 2A7NA 3WLQA 4PC8A 1KGWA 1E1EA 2VC9A 2GJNA 4Z1CA 1OWQA 4XISA 4WEVX 1C8VA 2XINA 5I3GA 2E9BA 3G1FA 2Y5JA 2R24A 2ZDSA 3GXTA 1L8NA 2VOMA 3GSMA 3NZRA 3GD6A 3M6DA 4OV9A 2D20A 2FDSA 3CYVA 3U4AA 1ZJIA 1OFOA 4KEMA 1WZLA 3TXVA 3V0UA 1CEOA 3PF3A 3G1VA 1AD1A 4UR9A 1W1VA 1M3UA 4XUYA 3WQDA 3MP4A 1AQFA 4HMEA 1EJ7L 4CCEA 1NU5A 5EPDA 3L5AA 5D8WA 1D9EA 2C18A 4H00A 3EOSA 3PY2A 4QSFA 2WSKA 2BV9A 4XAYA 3PBWA 5FF7A 3PANA 3TZNA 1IT7A 4TVUA 3M64A 1V6TA 1KBBA 4JTAA 3CL7A 1MW1A 3AIBA 1VIWA 4RCXA 1AH0A 2QCGA 3BOFA 1LQAA 3L4UA 2YL6A 4ZO9A 1ML1A 2Y89A 1FWTA 4CD8A 2XZ7A 2QDEA 2W27A 3F2CA 4ML4A 2XFYA 3GG0A 3ECQA 4FSAA 1QPKA 1OX5A 1K8XA 3GW0A 3WQ6A 2X2YA 4J3WA 4ZQMA 3W70A 1PKYA 1E56A 4MB4A 1XC4A 3QHOA 4G2DA 2E28A 3N2OA 2TPSA 1XINA 2CNCA 3VOCA 2GPTA 4PYSA 4H9YA 1VBHA 4G5DA 2DQWA 1TPVA 3MYOA 2OEMA 3R0UA 1W1IE 2YLAA 3LZ5A 2W63A 2DT3A 1XC6A 3EPMA 5FOOA 2WC4A 4EACA 2V5KA 3MUIA 3A9BA 1R2SA 2V3EA 4AY8A 4TTGA 1WZAA 4H04A 2DDXA 3ARZA 2PA6A 1XX1A 4M51A 4GFSA 1MI3A 5AFDA 3R94A 2VRKA 1JXKA 4LVAA 2BSLA 2R8WA 2BHZA 4TVDA 2EF9A 3E5PA 3UPBA 4WDWA 1SO6A 3KVJA 5AHEA 2F2KA 1DHPA 4IT1A 4ZE5A 4CGTA 4MB1A 1NAL1 1O7AA 3L21A 4I9JA 2AQVA 1SZNA 1QBBA 1BEUA 1EC8A 1EXPA 1F6YA 3BLKA 3MVIA 3G0XA 3LK6A 3UJ2A 4YVXA 3QGVA 3T0CA 3FXGA 3JRKA 4A05A 2RJHA 4CD7A 3AHZA 4CNUA 4C6IA 4OQVA 3HG2A 3NG3A 3F4VA 1TWWA 4JNMA 3OBEA 4U33A 2FYMA 1F07A 4UTJA 4HA3A 4CU7A 3RGTA 3M0ZA 1BAGA 4H1ZA 3AXIA 2QNEA 3GNPA 1NDYA 2X09A 2OODA 4H7ZA 3WDQA 1ONWA 1VC4A 2Y6ZA 1QPRA 5FEXA 3WF4A 1TX2A 4LNCA 4KS0A 5HNRA 2WW5A 2QHAA 2HQAA 2NVDA 4LRTA 1KXVA 2QCHA 3CHDA 4B5VA 4MPQA 3GVVA 4A29A 3W3OA 4OHQA 1E9YB 2NV9A 1W1A1 1J6PA 1LT7A 2WMIA 2Z4GA 2YA2A 1QRQA 3HQOA 1WZKA 1XLMA 5C8BB 3DBNA 4IFKA 2JQXA 1J12A 3E2RA 4OOZA 4KGLA 4PMZA 3RIKA 4RXGA 2X0SA 3HPAA 2BVTA 4TIMA 1ISWA 1VEMA 4NHVA 4IPLA 4JTGA 5G4EA 1EX5A 4KFOA 1CB7B 4MNJA 4REQB 4LB3A 3BLEA 1Z44A 3UGVA 1CXLA 4W7VA 3TUUA 4BI6A 1DIKA 1BXCA 1OFAA 1F9CA 4D6EA 4AD4A 4HMCA 4GLEA 3CUJA 2OWWA 3M16A 1GOWA 4DO6A 3DG3A 1UR2A 3ALGA 4PUWA 3BLLA 4WKFA 1TTQA 1JZ7A 4XZHA 4DNHA 3ALFA 1YTDA 3MT1A 5I03A 1UKTA 5FEWA 4LV4A 1XLFA 3OIHA 3MTWA 3G1SA 1M7JA 3LBMA 3C8NA 2YB1A 2CLOA 1XSJA 2BASA 3EKGA 3THAA 5FJUA 3U2CA 4WY0A 4O0QA 4M6VA 1MFVA 1W5PA 5EMYA 3B9OA 3V16A 5BWAA 1SU5A 2VDIA 3AUJA 1Q7MA 4D2JA 1VH7A 1SPQA 4GISA 2D2HA 2GQ3A 3APYA 2LLEA 1TRDA 3ITXA 4Q8PA 2FVMA 2CWXA 3G77A 2OTDA 3WD3A 3P81A 3BURA 2Q3OA 4P7NA 1BVWA 3B8TA 3EDJA 3OGSA 4UQBA 3TJ4A 2X1TA 4IF2A 3THQA 3GG7A 2ADAA 1PYMA 3DI0A 4GI9A 1IWAA 1QOQA 1DJHA 1LBMA 2WYSA 2CZ5A 1IT8A 3N04A 4S1FA 4LQ1A 1EQCA 4DJFA 1E70M 2NQZA 1AMYA 1LQ0A 2V6AA 1SYTA 1W3JA 1OYCA 4LS2A 2J7GA 1XLHA 1MRAA 4UFJA 1NWRA 1KWKA 4TV6A 1FWWA 4UWMA 4MZYA 1ECQA 1TMQA 2WPGA 2VDHA 4LVBA 4JN6A 2XWEA 2YDAA 3WF0A 3M9YA 3DAQA 1UZDA 3F4WA 1VJSA 1QAPA 1M6JA 3R79A 4Y8FA 4DPQA 1D7FA 1VBGA 5FIPA 3KVMA 4O54A 2Z7GA 4DX3A 3K30A 1ITUA 3MB9A 4POCA 3VC6A 5J5RA 3JU2A 2ZX9A 3MZ2A 1R6WA 4GVIA 3OG2A 4AC7C 4DHGA 2WNQA 4QE4A 2ZUSA 3BAKA 4FIRA 4YTUA 4FS9A 3UR7A 2ODOA 1DJYA 4C91A 2Y8KA 4C6MA 1Z48A 1FX6A 3G0SA 2RDTA 5M5DA 4DJFC 4GFIA 1K7XA 1OCBA 1BD0A 3KL3A 3OBKA 2UZ9A 2XISA 3S46A 1IZJA 4DVOA 2CXGA 1EIBA 3T6CA 4YN5A 4BEUA 3MSYA 4MZ8A 4CQAA 4MLJA 4QEEA 2PWHA 1SSGA 3DFNA 1F3EA 1OCNA 1KM4A 2W3ZA 4KRTA 5CQ1A 2WCSA 1QPOA 1OF6A 4O18A 4AEEA 1AMKA 1EYEA 1E72M 1YRRA 1KCKA 3TZFA 1JAKA 4NILA 2DY3A 2NVAA 3UNDA 2YSWA 2Y5EA 4LWWA 3P5ZA 2X2GA 1M04A 3APGA 3M0XA 3MI2A 2CLFA 4Q4PA 4F0SA 1F3WA 5CGQA 3WLSA 3RX3A 1XJBA 4RNIA 5ABTA 2TAAA 1QWKA 2J7BA 3A6OA 5U7SA 2YR1A 3SEPA 4B90A 4CCCA 2QCDA 2YCKX 3BGGA 3RO6A 2I57A 5C2XA 1E3ZA 4QHRA 3SW6A 3L4YA 1UWSA 4ECLA 3A4JA 3T7VA 4JZ5A 2H3DA 2NXGA 4JEQA 1V8EA 2RHGA 1E6NA 2ZQ0A 3CHFA 5CG7A 2GSEA 3WLIA 4XKYB 2F38A 5D04C 3TTQA 3UR5A 4U3CA 3RU8X 2QUNA 4GOAA 2QPSA 1AG1O 4PUEA 4Q33A 4D6HA 1KFWA 1GZGA 4US5D 4MDOA 3PBYA 3MP5A 4DLFA 4XBKA 1Q45A 4MTVA 4ZR8A 1B31A 4HQVA 5E9XA 1GUVA 4B3LA 3UVAA 1J9YA 2SFPA 1BVNP 1XQKA 3N2TA 4L5ZA 4P8WA 4LYPA 4A3HA 3VKBA 2V2DA 3PFRA 1YDNA 1W9BM 5GJPA 5C70A 1H1NA 2O92A 4W8AA 1O5QA 2AOSA 1FBAA 5FSDC 4REQA 1WYIA 3O16A 1WBJA 4TTUA 1OHLA 1PVNA 1F4AA 3V7PA 3IAPA 1DKWA 4WF7A 3DGRA 4FF7A 4XQ6A 3R58A 4J5NA 3PS7A 2X0YA 4PUMA 2VFHA 4CU6A 4CCZA 4QAWA 3W7KA 4H01A 3WBEA 4PCPA 1OD8A 4HPXA 3PC0A 3AS2A 4QQUA 2JKPA 4R88A 3TE9A 3TTSA 5HQEA 2ON3A 4JX4A 3WFLA 3N19B 5GNYA 1A47A 1GQJA 2GOKA 4MZ1A 1JPMA 3N34A 5A95A 1IF2A 1Z6KA 1TR1A 4IM4A 2OLSA 5I3IA 4G7EB 4QLKA 2VGBA 1GGOA 1J4EA 5U4NA 3T09A 1LCOA 3G6MA 5DMLA 4WK9A 4NZCA 1N2VA 1W1YA 5C9XA 1D3HA 3AHXA 2ISWA 4N9EA 2PEVA 4WXZA 3C2EA 4ZB5A 2XVNA 3PPGA 3VNYA 4JL2A 1NDWA 1C9DA 5E70A 4IQEA 1AFSA 1W8SA 5A6KA 2ALDA 2VGFA 4DBSA 3IGXA 5IDIA 1XXXA 4JEJA 5JBEA 1FA2A 5REQA 2WHLA 2OLAA 1MSSA 3PUDA 3LNMA 4S3DA 3B8DA 2H8XA 8XIAA 4IMAA 1TJRA 3NURA 5TF0A 3CJPA 1SZEA 1PKMA 1I2QA 3TN6A 1YTEA 4U5IA 1W3HA 1FXPA 3OW1A 4LX4A 3GHTA 1HKMA 2CLLA 9XIMA 1OFDA 3QOMA 3H21A 3KHJA 5D03A 1RK5A 4AZ7A 2YOCA 4U5KA 3GO2A 5M1TA 1R2TA 1UC5A 3W1AA 4M8UA 5BMWA 4GI4A 5T91A 1M7XA 3TKFA 3UY7A 3R12A 3H7UA 1PHQA 4HJFA 3U3HA 1PDZA 2ZIDA 3N15A 3AISA 1E15A 2E5DA 1XH2A 2FTYA 2NV2A 3ZR5A 3W1QA 3FDGA 2BFGA 4I3GA 1UIPA 3L4VA 1Z89A 3HURA 4E2DA 2OZTA 3QF0A 2E09A 2VEPA 2WCGA 5AYIA 1A3HA 1FWIC 3VIOA 1Q4WA 4UTIA 3T4WA 3SGUA 1NFPA 3I3EA 2YFNA 2PDYA 4D8ZA 2C71A 1XYMA 4IJBA 2BLEA 3EZ4A 3TDFA 2C8NA 1ZLPA 5GJNA 1KFBA 3FYYA 2YYTA 5M17A 4RZ4A 1KFKA 3W7GA 1KW1A 5CPSA 4OIFA 1V93A 4K37A 1IZCA 2VD9A 1VBUA 3P82A 1J79A 3S9IA 3T81A 2PDNA 2Z29A 1BWVA 1FFQA 2GUYA 4X61A 2OX1A 4R7JA 4KEUA 4DXVA 4EP8C 3FIGA 1MQQA 1XYAA 3WMCA 1JXJA 4JY9A 1E40A 3H54A 3W1RA 5TBOA 2NQJA 4NY2A 1GORA 2NQ9A 1JCLA 3CMJA 1G01A 2X7WA 3BZJA 3WH8A 1IXOA 1DJNA 2PTZA 3CQIA 5DELA 1GOMA 2PWGA 2HJPA 1VD6A 4H6EA 4YYCA 1QHPA 4AZCB 4I9AA 3P0WA 1B3OA 1ONEA 4GNJA 3O0FA 2O9TA 1Q7QA 3COTA 4CNTA 1OK6A 1FKWA 3GYEA 1T5AA 5DRIA 4K39A 2HXUA 3FA3A 4E4PA 3MA8A 5T8GA 1XW8A 3OZPA 4RKAA 2GQAA 5ENLA 1ISXA 1Y0EA 2CLPA 3H2EA 3GC5A 3GR8A 3AYVA 3C8FA 3KX6A 3MO7A 1LRNA 2BZNA 1ME9A 2XYLA 3WF3A 1C7SA 1ZHAA 2E6DA 2ZCGA 4R7OA 4K36A 3CZ8A 1G0CA 4FK9A 2EKGA 4M5PA 6ALDA 5I3HA 3M7SA 1OG6A 4X22A 4GXWA 4QE5A 2YW4A 5LXXA 4MWAC 4P7RA 4W84A 4XZWA 3CLWA 3BPWA 3R4IA 3GQYA 1W6TA 1A5MC 1AZ2A 4O1FA 3SB0A 4GYPC 1NEYA 2WKJA 2DORA 4GNKB 3FW6A 1DE6A 1OT1A 3O6CA 4FX7A 3NQEA 2XG9A 1OADA 3S1GA 1R7OA 1NDZA 2OR2A 5H2ZA 4YHGA 4YTTA 2WVVA 4DWSD 1H63A 1GTEA 1W5QA 3QFEA 3K46A 1EO5A 3P80A 4G1KA 5EBUA 1MYRA 4ADTA 2DP3A 1SFSA 1BG9A 2QGHA 2YXOA 2YGYA 1SO3A 3PTKA 3P84A 1WNOA 2FZDA 1BRLA 5L9FA 1KCLA 3M41A 4GYJA 1UWRA 4R7WA 1W5OA 1PIIA 3A4AA 3ITOA 3EMZA 3NQCA 3GIQA 4YVVA 3KRBA 4FOUA 3N73A 3PZOA 5CC6A 1PAMA 2R91A 1VHNA 3NGJA 5FJPA 1P0BA 1DYSA 4DY1A 1XP3A 3ORWA 1R3RA 3UA4A 1RXOB 3RF9A 4AY1A 3WF2A 2WHJA 4GIAA 1B30A 3OQ8A 1EGZA 2REQB 1LL4A 1AW2A 4W7WA 1OC7A 5H8PA 1JI2A 4ICCX 4ZQOA 1JZ4A 3O3RA 2GDQA 2VUYA 3HJZA 4K38A 3U9IA 3H26A 1XCFA 4IPPA 4JTLA 3IRDA 3ZSTA 3W6MA 1P4CA 3URQA 1WUEA 4HNOA 3UG4A 3U6WA 1F3TA 1GPFA 3LXAA 3TYCA 3STGA 3HPFA 3QXBA 4FLRA 4JN8A 1HGWA 2VDGA 1FWSA 3QBUA 1VFLA 4AIEA 4UQ9A 4EAMA 2JGQA 5LNRA 1TTIA 1VRXA 4DQWA 4WSHA 4PZVA 1OCQA 3BCDA 3EX2A 2VGIA 1I6NA 5CPTA 4AHOA 1CENA 3KHDA 1TTJA 4ZBCA 2Z2AA 4JL1A 2IS7A 2W61A 1RCXB 3TWAA 3IJDA 5CGTA 1V6XA 3WQEA 2QDDA 2H90A 1T7LA 3S47A 3E0LA 4DZ5A 5EGRA 1B2YA 1JCJA 4E38A 4PSPA 4B5WA 3S5NA 3SCRA 1R8LA 1E9IA 3RUBL 4UMCA 2XSBA 5I09A 3SFWA 5D2VA 3IARA 1YEYA 3PG9A 1J0JA 4RW5A 4DELA 2BY0A 1K70A 5DT7A 4EXAA 2CITA 4NRRA 5CZJA 3T40A 3A4XA 4ATDA 5M3WA 1K8CA 2PCEA 4RZ5A 4AZBA 1ICSA 1GK8A 4XKYA 4Z08A 3VYLA 1EJVC 4QRNA 5MKGB 3NQBA 4FNSA 5G4HC 3GIPA 2VX5A 4AX6A 3R89A 4HJWA 3AOFA 3LPGA 1QUMA 1IEIA 1GYLA 2G8ZA 3ARSA 1ZBCA 3VKAA 1UR8A 2YJQA 1A5OC 1H2JA 1GOOA 4J3ZA 5CZTA 2WKGA 1WOBA 1OQFA 2CBJA 2OG9A 3SN4A 3GNDA 5JIPA 1H7OA 1PIGA 1EB3A 3V1PA 3LSCA 3W7CA 1SFJA 1ZCOA 1ZS2A 3W6LA 4KCWA 4L1XA 2OYKA 2W5FA 4C65A 3WQCA 2FVLA 1XYBA 3LZ3A 3EAUA 2MUCA 4S38A 5I3DA 5AOUA 5HPOA 3AU6A 4JXCA 3QQ1A 2CIPA 1UBSA 3NPWA 4OU1A 2GDUA 3QC3A 1IIGA 2Y24A 1EPVA 3VGEA 2E4TA 3G2GA 1ZBKA 3FJ6A 3AS0A 2P0IA 3BAYA 1NWSA 3S8HA 1OX4B 3DKLA 2F7FA 8CGTA 3CB3A 2AL2A 3LERA 1F4HA 2QT3A 2VP8A 4EF9A 3W1XA 1EKOA 3QLDA 3WD2A 1JF6A 2YIHA 1JDFA 3KW3A 3N6HA 3CTLA 1JYWA 1VENA 3RDKA 4US5A 3QYSA 3T8QA 5BXSA 1TFVA 2OQLA 4LOCA 1HF6A 2V3FA 3SQLA 1DXIA 3ZWSA 3UXDA 3KZPA 4LCQA 4E3TA 5EMLA 1TZ7A 3BJFA 1KM0A 2QKFA 2Z1VA 2P3ZA 5LIKX 3B4YA 5XINA 4K7VA 3BVJA 4HNLA 5GPRA 2EG6A 1JCXA 4JFWA 4FNUA 3SBFA 5G2HA 3MVTA 4L65A 3WLOA 3H7RA 1YNPA 1GW9A 1OIFA 1Q66A 3VC5A 4WIWA 4UCGA 2Y7EA 4MJ4A 1EJTC 1Q6QA 2XHYA 1RLCL 5H8MA 1PUDA 3GNRA 1KRBC 4NYUA 2FIQA 2WJDA 3SECA 3EDFA 5GQBA 1JZ3A 4JNZA 3TYBA 2J13A 1K4HA 2PTYA 1KCZA 1DVJA 4KCUA 3V5CA 4H9UA 3W7DA 3LNPA 3FJ4A 3EB4A 3XIMA 4L61A 3VGGA 1RD6A 4JTEA 4PMOA 1KRMA 3NTYA 4KF1A 1CX9A 4ZO7A 3LHWA 3BJSA 4E8CA 3IJ7A 4V27A 1K9DA 3V75A 3NEVA 2NSOA 3V5OA 2ZZ3A 2PRHA 3R1ZA 2CLMA 1L6GA 1OK4A 2V3DA 3USZA 5AN7A 3H12A 1OZMA 5BZAA 3ATZA 2PP3A 3MUAA 2NQLA 1Z9AA 3E0FA 3D46A 3L0KA 2FZNA 3POHA 5TAOA 2KAUC 4AWSA 5A8MA 4LALA 1JFHA 4KW2A 1MXSA 1VLWA 1JDCA 3MWCA 3C0SA 4MJMA 5EY5A 3EX6A 2D2JA 1V6VA 4DZIA 4NAFA 4XG1A 3SRKA 4E8DA 4LY4A 2XIJA 2PDQA 4BR1A 2VTFA 3HBLA 1CDGA 4J3UA 1V3KA 3WH9A 3C3NA 2BTMA 5I24A 1NP0A 2FB2A 4UTWC 2CBIA 1KBLA 1ZGDA 3R25A 3N9KA 4Q4MA 4YHEA 4Z2IA 2Y70A 4JY8A 3TC7A 1NFGA 3B0VC 4NXSA 3WQGA 2GSJA 3QHMA 2R1PA 2CCRA 3HTWA 2Q02A 5M2FX 1A3XA 3SIMA 4ERGA 4MM1A 3SY5A 4GO9A 2Y85A 4GIYA 2D2GA 3W27A 4E4FA 1KKRA 3O15A 3G3MA 2VR5A 4FALA 4A2SA 1CPUA 4B5NA 4LAOA 3CYJA 1A5KC 1KXHA 1W56A 1MZHA 3LGGA 4JKMA 1Q6LA 3BARA 1FWEC 4DO7A 4NRSA 5BU9A 3BG3A 3PZNA 4NU7A 4GA8A 5LYRA 3T0AA 2WJFA 4F0LA 2XVPA 2Y0FA 1TE1A 2ABAA 1K77A 2PGWA 2XH2A 4R85A 5HR7A 3S0CA 3S3GA 2W79A 1RCOB 2JGYA 1P0KA 1ZAIA 3DFYA 1MUMA 4IHCA 2V5LA 3PZ9A 1DBTA 2C13A 3P3BA 4PUNA 3VX0A 6XIMA 7ODCA 3MHGA 5K3VA 2D3LA 4MLRA 1BWLA 5EFDA 3UWUA 3MSRA 4KFNA 1EHAA 4ROQA 4RJEA 3Q58A 1Q6DA 1WX0A 1KD0A 3QYQA 3DN5A 3W01A 1D7KA 3NZ1A 3FGCB 3LCXA 4DBWA 4Q32A 3BLDA 3ZVHA 1THFD 1CTNA 4QX4A 3TW7A 3NOYA 3LUTA 1XFBA 5A6AA 2BY3A 2XN2A 5JH2A 4DZHA 5D32A 3TU9A 3U5YA 3WBYA 4OBRA 3KP1A 1W8GA 1ELSA 3TYZA 5HMFA 4FX6M 1KLYA 3GS6A 5DCBA 4ZOEA 3DYOA 5EMUA 1UR4A 3W28A 3P67A 4C1KA 4O50A 1YADA 4CEXC 4HSNA 4XTIA 2G97A 1ZU8A 4ZL1A 2IQ0A 2CBVA 1S39A 4XV0A 5D9MA 3LENA 1IQ8A 4WGXA 2NUXA 3NEHA 3WQ4A 2Q3RA 2D0GA 4LRSA 4IPIA 3E2VA 4HN8A 3HQ1A 2C6QA 3AXXA 3P61A 2Y7DA 5AHIA 5A5WA 1LL6A 1XQLA 4JDYA 1ALDA 3GAKA 3ABQA 5E5CA 3LM7A 1D2KA 3B8SA 1KM3A 1AJ0A 3I6EA 1E43A 1SM9A 4M1RA 1R3WA 2A6LA 4DWSA 2RFGA 3CK5A 1XLGA 2I5IA 5EMKA 3LRMA 4IISA 1BYCA 2EEXA 3ITVA 3PZVA 2PWFA 4UFLA 4J4KA 1EF3A 3TN4A 2A6NA 1WV2A 4AZGA 4AZ6A 1IEQA 3MPGA 1Q7ZA 1LWJA 5D30A 2GVJA 4PGLA 1WCGA 1G69A 1YTKA 4RDVA 4XAPA 2V5CA 4AVOA 3L4WA 5HWJA 3AJ7A 5A6BD 3CUIA 1GZJA 4H8NA 1MNSA 4GYKA 3I65A 4PODA 3KVKA 4IL2A 3OLDA 4CKQA 1UOZA 3FGCA 2E9LA 2WC3A 3BLOA 3BW4A 1XH0A 2ZZ6A 3S5SA 5C9WA 1HTIA 4LAUA 3WUGA 4O8RA 3FEQA 1KR0A 4X60A 1NFBA 1GHSA 2NZLA 1DHKA 3BW3A 1L8PA 4I90A 1AVAA 4Q8QA 1R46A 4MYAA 2D1ZA 5LA2A 1EHNA 3QR3A 4NP7A 3KE0A 3RFAA 2BOFX 3OOQA 1J11A 2PMQA 1V0MA 4P8VA 3GXFA 4FLSA 5F1VA 3EBVA 5HXMA 3NL6A 3WDHA 3UXLA 1J5TA 5HUOA 9XIAA 1F8IA 2VC5A 3UZXA 1YHTA 1HG3A 4B4FA 2JKEA 3ITTA 4ZO6A 3CASA 5D33A 1B3WA 1UYQA 3TC3A 4S39A 4R34A 4BHYA 3O1NA 5CEWA 7ENLA 3ZJ8A 3IUDA 1ISVA 2JKAA 5C54A 3TV8A 4PSRA 4DI9A 5HWNA 2FGLA 3U57A 4Z1YA 4DB7A 1BRLB 1T96A 1Z42A 2C1HA 2P76A 2YCIX 5DN1A 1E3XA 1OF8A 4L6OA 3GKFA 5AYBA 1EXBA 2ZE0A 1M7OA 3VNLA 3EXRA 2Q8LA 1KC7A 2QCMA 8XIMA 5I78A 1Q65A 3EPNA 1V6WA 4KIRA 1U5VA 1X38A 1JRCA 1IGSA 1XSKA 4OT7A 1YXYA 2D0FA 1P48A 2OT0A 4HA0A 4I5XA 4EWJA 2WSQA 1GQIA 5KZDA 1X97A 4JX5A 3SZ8A 4YU1A 4M7SA 2FH6A 3LCWA 3V5FA 5AC7A 3REQB 3W0KA 4M6QA 4Q4QA 2OGJA 3GR4A 1XBVA 1X7FA 2ZX7A 3JUGA 3LBOA 3KS6A 5CAHA 5DMMA 1HX0A 1WDPA 2DU2A 1QT1A 4KH2A 5C5YA 1A49A 2Y2WA 3QY7A 4ILSA 4WJXA 1TA3A 1H11A 4CN1A 4Z0JA 1YDOA 3OGRA 2OWCA 4M7TA 2O9PA 1PZ0A 4PULA 3ZLHA 4PMNA 5HA7A 4JTTA 3NO1A 5CLWA 1JUBA 1JUKA 2QCCA 3EPOA 4US6A 2IKIA 3HGRA 3WH6A 3N12A 1UG6A 1NF0A 3GDLA 2HEJA 1DWIM 6A3HA 4PRTA 1HL9A 4PTDA 3ZR6A 4EPDC 2YCLA 5BYWA 2W92A 1QI4A 1PZ2A 4JYEA 4WHBA 4DJED 4GQBA 4W87A 4JKKA 2YX0A 2INZA 2OZ0A 4WRHA 4JTKA 3SY1A 1AA1B 4OOUA 3SO7A 2YDRA 4ZGYA 2X1IA 3GFZA 3L0GA 3QZ6A 5E6ZA 1IXNA 1VJIA 1OFEA 2XFFA 4GBUA 4N4PA 2NLIA 3U2OA 5DF0A 4KERA 3VINA 5FD0A 1MDLA 4WVXA 3W22A 2PWVA 4LVDA 2PLJA 1ZUAX 3NDYA 2XIBA 4S2BA 3WD4A 1KM1A 3L66A 3UFYA 2DT0A 1LYXA 3L68A 2VX7A 2E8ZA 3Q65A 2BXVA 3BW2A 5IRPA 3WDJA 2VMFA 3WDRA 2VZVA 2QXWA 1KO0A 1RCQA 4H9ZA 1PEZA 2WVUA 3AAMA 2DFAA 3NWRA 1TJPA 3RRXA 1QBAA 4FNPA 2E1DA 1BLIA 1TQXA 1R3TA 2VNCA 3LPFA 3A5VA 2PP0A 3W87A 1GONA 1QO5A 3W6YA 1P1XA 4NYYA 3RX2A 4OGZA 3W37A 3AFBA 1DJIA 1L9WA 4FAMA 2PB1A 1FDZA 2XFWA 3B9NA 3VIFA 1YX1A 1TR9A 1DWJM 1GYNA 4PTMA 4PCNA 4PR4A 2VFIA 2C14A 2DUXA 1W17A 3LCIA 4J2MA 3V0SA 1AD4A 4NXKA 1TZZA 1VFOA 4AU0A 4MNMA 1VLIA 4GVHA 3AMKA 1AH4A 3QY8A 4GUHA 1Q6EA 4XWUA 3HMJG 4UR8A 1VPQA 1QK0A 3HG3A 2B31A 4A22A 3TTYA 1ZJBA 3LRLA 4X2PA 5AKQA 3DFSA 3DG6A 3F2BA 4ZO8A 3EEGA 1HNYA 2XH0A 5CPLA 4QCFA 4Z2LA 3QKEA 3SCTA 3H23A 1QHOA 2BXZA 2Q6ZA 4X0VA 3VNKA 3AZRA 1PPIA 2W9MA 4AZIA 3NZPA 1EZWA 3CUZA 4QLJA 1L2QA 2J7HA 4QAIA 3IANA 2NUWA 2CZFA 4JTHA 4HIBA 3B0UX 1BG4A 1GWJA 3LB0A 2EPKX 3BMWA 3FX4A 3UWWA 4XVDA 3M43A 3STEA 1UD6A 3WNNA 2WBGA 2XUCA 4JHZA 1BYBA 4D8AA 3RLVA 4TR9A 3GUGA 4Z0SA 4S3EA 3CMFA 3U7BA 2VO5A 1DTNA 2FJUB 2G0WA 2R1NA 4AXKA 4HYVA 3LEPA 1AL8A 2ZADA 1HN1A 3HMCA 4Q8TA 1PKNA 1I0BA 1WXZA 4RPQA 4C6EA 3UJEA 3FVMA 5I23A 4XB3A 4BI5A 5HK4A 3WG6A 3BAXA