4B15A

Crystal structure of tamarind chitinase like lectin (tcll)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
266
structure length
265
Chain Sequence
b'GGNIVVYWGQGGSDNSEGSLKEACKSGHYNMIVLEELITYDNGRDPDLNLGAHCVNCTSLQQEIKYCQLKLIKILLQIGQVTPTKEDTKDTTKDLSQYLDSNFFSGKSGPLGEVYLDGIDIASVPEGLNLKFDELVQALNDSATSRRIYLSASPNCVYPDYYLDKAIQTQKLDFLFVQFFYALPCIYTQGLPEDLFQAMKTWTSNVPESIFMALPATPDLNGYIPPRVLNKEILPAVTQASNFAGVMIFDRYFDRFRKYSSKIKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHITINASE LIKE LECTIN
molecule tags Hydrolase
publication title Structural Investigation of a Novel N-Acetyl Glucosamine Binding Chi-Lectin which Reveals Evolutionary Relationship with Class III Chitinases.
pubmed doi rcsb
total genus 94
structure length 265
sequence length 266
ec nomenclature
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4b15A00
5D9OA 4C7DA 4UOZA 1W32A 2C8NA 4IPLA 4CD7A 2WC3A 2W62A 1J0YA 2PWHA 4QLLA 3AIEA 1PIGA 4AD3A 1H2JA 5JBDA 1JDCA 1UR1A 4AZ6A 4E4PA 1UQZA 4CN4A 1RH9A 1V6WA 3KL3A 1Q4NX 2WZEA 1OGBA 2W63A 3AYSA 1E6RA 1NWSA 1UKSA 3I3BA 3PTKA 3T2QA 4V27A 1FH8A 3FN9A 2EO7A 2XVKA 4JFSA 3WSUA 4ZFMA 2QMKA 3VIJA 1DWIM 1QBAA 1QW9A 2O9TA 3VDBA 2J8FA 1JXKA 2WB5A 1CXFA 1JIBA 2CERA 3MU7A 1N82A 5D8ZA 1JD7A 4KMQA 3F5LA 1E1FA 2NSXA 3L4YA 4GI6A 2ZX9A 3BSHA 1OSEA 1K9DA 1UWSA 2OSXA 4AEEA 3AOFA 3EDKA 4MPKA 3WL0A 3TA9A 1E9LA 1OINA 1GHSA 1JGIA 1U30A 1E6XM 4AY1A 3ARTA 3DHUA 1CPUA 2XUCA 1XCXA 5D9PA 1QI0A 1O7AA 1XYFA 3FHQA 3AZTA 2WMIB 4V2XA 3UESA 2G41A 3QHOA 4GO9A 5IFPA 4WIWA 1NWRA 1UD3A 3CHDA 3N1AA 2WHJA 2XHYA 4PMYA 1B3VA 3VIKA 3U5YA 1F4AA 3KEHA 9CGTA 5EB8A 1IZJA 4PSRA 5AC5A 1XD1A 4HP5A 1C93A 1EQPA 1TA3B 2J7BA 2VX7A 1V02E 2D3NA 4BQ4A 1X1NA 1HL9A 2A3HA 1LLOA 1HKMA 1C90A 1Q6EA 4HMCA 1W9PA 2A3AA 3CBWA 4HU8A 4MB5A 1BLIA 2BHYA 5JIWA 1FP9A 2QF8A 4URIA 5DO8A 3WQVA 4RE3A 4S3KA 1ZBWA 1GNXA 1W9XA 3WUFA 1YQ2A 1C7SA 1XC6A 1HJXA 3AXXA 4LYPA 4EAMA 5CLWA 1CWYA 3KWXA 3UR8A 4YN5A 2VRJA 1VFFA 1KXVA 1PX8A 4W93A 3RCNA 4QCEA 3PN8A 4H8HA 2GJRA 1J18A 2X0HA 5CG0A 1W1PA 2UY3A 1JF6A 3M46A 1PEZA 1ISZA 1KCLA 2UWFA 2WHKA 1CXEA 3QHMA 2V5CA 1B9ZA 4WLCA 1WNOA 2WC4A 4F8XA 1V02A 1V3MA 2DQXA 1NOWA 2YOCA 5CGTA 2GUYA 4Z2LA 3OG2A 3WIJA 3K46A 2GFTA 2WKGA 4P8WA 4WF7A 1BG4A 3B8SA 2GVYA 3WY1A 3AHYA 3BCDA 1JAKA 3PHAA 2WMGA 4CVWA 3ZMRA 3K4AA 4UFLA 1H5VA 3NSNA 3HJEA 2X8RA 2OWWA 2J79A 4OIFA 1V3LA 1NWUA 3GXFA 2YJQA 3ZO9A 3WUEA 1BAGA 3CMJA 3NDZA 3WUGA 3CO4A 3L2MA 1Q6GA 3WQ5A 1UR4A 5DEZA 3OZOA 2DEPA 5BWFA 1FH9A 4V28A 3AS1A 3BH4A 2E9BA 1D7FA 5ABFB 4KGLA 4UFIA 5LA1A 1ODUA 4OOUA 1QHPA 4D71A 1BSIA 4MJ4A 3BXWA 1CENA 3VIMA 2BFGA 3WENA 4CU7A 1FH7A 2ZWZA 5BXSA 2ZXBA 4A4AA 1VFMA 2YA0A 2ZXDA 2XIIA 1BHGA 2CBJA 1E70M 1GW1A 1B2YA 3DYMA 4MJ2A 2WVUA 1DWHM 3ARQA 5KEZA 1EDTA 1UWTA 3KL5A 3T0DA 4PCSA 4TUFA 1E40A 2WNWA 3BMWA 1E3ZA 1UWIA 4AC1X 5CPTA 2E8YA 3VIIA 1ZB5A 1NARA 4AIEA 2E9MA 4OBSA 1DWFM 1H49A 1CXLA 1TVPA 2QPSA 2W4XA 2WVSA 1E55A 4W87A 3F5JA 1WCGA 2VX4A 3E1F1 3EYPA 1SR0A 2WYSA 4FLQA 1OM0A 2PI6A 4Z2JA 5FIPA 2XPKA 1KCKA 1FA2A 1PJ9A 2VJXA 2DDXA 3AHVA 3W37A 1NP0A 4E8CA 2XVPA 1G94A 4DM2A 2VVSA 1K9TA 1LL4A 1DEDA 1AMYA 3I3EA 3N17A 2WVTA 3AROA 1W1YA 7CGTA 1GCYA 3AS3A 1ZJBA 2WHMA 3CHEA 4GPNA 4QAWA 1RP8A 3SUTA 4B9ZA 5ABGA 3AXHA 3WMCA 5C8BB 5BXTA 4FF5A 2WZIA 4GO8A 4F9JA 5A8NA 4GI9A 5CPSA 2XSBA 1X6LA 4UQBA 2WZHA 4AIOA 2WXDM 2YDRA 3OA5A 1IT0A 2ZXQA 1DWAM 3OLGA 1VENA 1GONA 1EA9C 1WDPA 3VD3A 4M81A 3A3HA 5I5RA 2J77A 4Q7NA 1GOMA 3VDHA 4WKHA 3AHZA 6CGTA 2A3BA 3WELA 3GH4A 2VC9A 1HX0A 3WD2A 2CBUA 1QPKA 4QLJA 1MFUA 5I6SA 2XSAA 4OOZA 1JDDA 1W9VA 3WFZA 3FXYA 3TTQA 5JBFA 1QI4A 1UR9A 1ITCA 1G0CA 4JCLA 1G01A 4P8UA 2OWCA 4PTMA 2VVNA 1BQCA 4U2ZA 3SURA 2V3EA 3U7BA 1UKTA 2YA2A 3VGEA 3OZPA 2QPUA 5LA0A 3A4XA 1UZ4A 2CXGA 4KRTA 3FHAA 3MO4A 3WF2A 4HOXA 2Z1SA 5D9MA 1HIZA 1R7OA 1XHGA 3WF4A 3POCA 1H1NA 2VX5A 4UNIA 3GNRA 1XH0A 1CEOA 4W85A 1XGZA 2E40A 1E71M 3DYOA 1L0PA 2ZUNA 1P6WA 4ZEPA 1MW1A 1BGGA 2VCCA 4Z2GA 4PMUA 5FL1A 3BCFA 1EOMA 4M80A 3W26A 1ODZA 2XGBA 5IHSA 4IM4A 4Z2KA 2C0HA 1V0KA 1NM9A 2CKSA 1JYNA 1JF5A 1ZS2A 3GYCA 3VIOA 3ZJ6A 3F5KA 1QVBA 2CPUA 5ECUA 4CN1A 3D3AA 1SMAA 3GXMA 1NQ6A 4H8VA 3MMWA 2DT2A 3CUHA 3DC0A 1JFHA 2OSWA 4HZ6A 4H04A 4U3AA 3SCOA 2EPOA 4MNJA 3RILA 4BQ3A 2J7HA 1PX3A 2V3GA 4ZXOA 4D6FA 4U3CA 1HN1A 2BHZA 3BMVA 3PTQA 1A47A 3SCRA 2W5FA 1BYAA 3HMCA 3AIWA 4ATWA 1NWTA 4TXEA 3VUPA 4WKFA 1GQKA 1GOQA 2CITA 4NRRA 4EKJA 2ZUVA 2WW5A 1B3ZA 2DT1A 1JXJA 1E1EA 1FHDA 1J0ZA 4UCFA 5E09A 3PBGA 4JZ5A 4XV0A 2WMHA 2WHLA 1TUXA 4EK7A 2D23A 3UG3A 4YHEA 3UERA 4PMDA 3TOPA 3ALFA 5A94A 4LX4A 3EMQA 3PZTA 4B3KA 4D72A 4U5KA 2VURA 2W67A 4MNMA 3VGDA 1BG9A 3VILA 1H4PA 4FLRA 3D5HA 5JIPA 3WQ8A 3RO8A 5A69A 1HXJA 2J25A 4Z2HA 1B3WA 2FGLA 5DT5A 4JKMA 2BXYA 1EXPA 1J01A 3WMSA 4FMVA 1BFNA 2VRKA 3U7VA 3VINA 1XCWA 2W66A 3ZT5A 1J9YA 1ZBVA 2FHFA 4TOQA 3VGBA 3WD1A 4PMNA 1XH2A 3IAPA 2DPEA 5A8MA 1Q6DA 3VGFA 1J0IA 4UFMA 5HPOA 3SUSA 1FFRA 4KH2A 2GDVA 3ARRA 5A6KA 2F2HA 3KL0A 4D6EA 4UQCA 1E6QM 1VFUA 3WH5A 2HVMA 4A3HA 1AQHA 4HTYA 3ZR5A 4D6HA 4NF7A 1ITXA 2WSKA 1NP2A 1PBGA 3WDJA 2XM2A 1BYDA 1WDSA 3GBDA 2NW0A 4AZ7A 3EBVA 3ZSTA 4XB3A 2PBGA 3WDIA 1OD0A 4GIAA 1CGUA 2JEQA 1CYGA 4CD6A 4DUVA 4MNLA 2JALA 2ZIDA 1WP6A 2QV4A 3W28A 1VJZA 1HJWA 1BTCA 3VMOA 5FOOA 3EDDA 2D0GA 1B30A 3WD3A 3VGHA 4TVUA 1GJUA 1AQ0A 2AAAA 5I2UA 3W0KA 1K6AA 1VIWA 3CH9A 3VU2A 3W27A 4H41A 3ARZA 3T0BA 3SCSA 3WD4A 1W91A 1Z32X 2E4TA 3ARSA 3B9EA 2O9PA 5A6LA 3SUVA 4BZYA 1HL8A 3AJ7A 4RL3A 4NI3A 4KWUA 4JFVA 1DTUA 5IXEA 4PSPA 3ZSSA 3MSGA 1MFVA 3TTSA 2FGZA 1UA7A 4N0RA 2YL6A 3ZIZA 5BXPA 4QCFA 3W81A 1CGXA 1VAHA 3W25A 1CLXA 5GNYA 3KE0A 3LPGA 3RDKA 2PWGA 4XX6A 4LPCA 1EQCA 2D3LA 2GJPA 2CBVA 5HXMA 2CNCA 4DM1A 3VIHA 1R86A 3BC9A 2ZE0A 2WMIA 2XVGA 4CD5A 4TTUA 2OLHA 3CZJA 4OUEA 3L4VA 5LYRA 1KGUA 5C71A 4F79A 1TMQA 4PCTA 3CTTA 2ZX6A 2V3DA 4A3YA 5D9NA 3FAXA 1ZBKA 3ALGA 2WVVB 2CETA 4U31A 2YDQA 4ZXLA 2ZICA 3THDA 3WD0A 1HJUA 1H3GA 2YBUA 3RMEA 4X0VA 1E6PA 2D20A 3OLEA 2CKRA 2ZUWA 4HA4A 2Y5EA 4S3JA 2J75A 3W6LA 1E4MM 3WNKA 2V5DA 1WDQA 2FH6A 2YLLA 2A3CA 3G6MA 4AZCA 2WM0A 4DUWA 2G3MA 3OGRA 4TVDA 1HKJA 1E5NA 3ZR6A 2ZX7A 2X05A 3U57A 1XV8A 3FW6A 4JL1A 3EMZA 3CZ8A 4P7RA 1QW8A 2XWDA 3O9NA 4CCCA 1TE1A 1KB3A 2PWFA 4ACZA 2VX6A 8CGTA 3WEMA 3WNMA 1BYCA 1CGVA 1WZKA 2YDSA 4UQAA 5A8QA 4J27A 4OKDA 1B0IA 4MDPA 4PRWA 1TZ7A 2VZTA 4XZWA 1GOIA 3DECA 1KR0A 1ZBCA 4MAVA 3POHA 4ML4A 3IJ8A 2D22A 4UQDA 1KGWA 1MW0A 8A3HA 2DH2A 2G3JA 3RM4A 3WEZA 1UD5A 2YLAA 5A6BA 5EFDA 3WNNA 3WDHA 1JZ5A 2WK2A 4OZOA 3THCA 5AYIA 2FH8A 3WNOA 3VPLA 3CZGA 4UFHA 5CSYA 4CD8A 2O92A 5C70A 3MUZ1 3SCVA 5LA2A 4C7GA 4Q22A 5IDIA 2GK1A 1V3HA 5FKYA 1XSKA 3GZAA 1JNEA 3MV01 5A1AA 3AMCA 5KZ6A 2WMJA 3NUKA 1OT2A 2JIEA 4J7RA 5GNXA 1ISVA 3RM8A 1E4IA 1GPFA 3JUGA 3VGGA 5A8OA 3ARXA 4IPNB 2V38A 1OWQA 2G4FA 4M82A 2G3IA 3WN6A 3PZNA 3I3DA 4GZJA 3AXIA 1ECEA 3MUAA 2WCGA 2ZXAA 3WQ4A 5JBEA 2WAGA 2XVNA 5M5DA 1DWGM 4GXPA 3WH8A 3PZVA 2PBOA 1RP9A 4D6CA 1GOWA 5I24A 2E8ZA 1CECA 3CZLA 1UH4A 1UHVA 1UZ1A 2AMGA 4Y7EA 4WSKA 3PZIA 2W61A 2WLZA 4J3VA 3WQ6A 4ZENA 3SEPA 5D8WA 2CHNA 1HJVA 1OCQA 2ZX5A 1KGXA 3ARWA 3RPMA 1U33A 2DSUA 1E73M 4E2OA 1UD2A 5E9AA 4UOQA 2F8QA 5A6MA 1MWOA 3AS0A 4WK9A 3WKZA 1HT6A 4PUEA 4BA0A 1PZ2A 1ZJAA 1J10A 3AMDA 3FNDA 4AD1A 1H41A 5CQ1A 1LWJA 2C7FA 4HMDA 1WZAA 4P8VA 3ARUA 4JFUA 3MMUA 3EDEA 2DGAA 4AD5A 3VDCA 4QLKA 2IUZA 4LYRA 3W38A 4M29A 1W1TA 4MB3A 3IAQA 2J4GA 1E3XA 1M7XA 3PZOA 3SCUA 1IZKA 1CXIA 3RM9A 1B31A 2VCBA 3CHCA 4AZHA 4EANA 2J7CA 1WPCA 3L4TA 4PTVA 1JI2A 3L4XA 4HOZA 1JAEA 4H7VA 1UQYA 2DIJA 2OYMA 1W9UA 2VZOA 1OB0A 3VX1A 1DHKA 1OD8A 1EHNA 4F66A 1JG9A 3AIQA 1MW2A 1KWKA 3A47A 3QR3A 2ZWYA 2Y24A 3W6MA 4MB1A 1CIUA 1R87A 4CD4A 1CXHA 4X0NA 2VNCA 4HPHA 1IV8A 5GQBA 6TAAA 4D6IA 1DWJM 4W89A 1TG7A 3SIMA 1E43A 1CZ1A 1W2VA 3MANA 1V3JA 3PZUA 3VX0A 2WANA 4LYQA 2VQUA 1EIBA 1EO7A 4JIEA 2CBIA 2DH3A 1PZ3A 4AIUA 4AZCB 4UZSA 3WFLA 1GQIA 4EE9A 1B1YA 1EGZA 3RJXA 1XSJA 1V3KA 3B9DA 3SCWA 1MQPA 1JZ6A 1KXQA 2W92A 3WF3A 3AI0A 3ZJ7A 1J0HA 1JD9A 3BAWA 3TTYA 3WF0A 4DWSC 2VRQA 3AIVA 3TTOA 4D1IA 1RPKA 1QOXA 1GQJA 4AZIA 1FP8A 5IFTA 4ACZB 2WMKA 2D2OA 3HU7A 3WEOA 5AC4A 1SYTA 1OT1A 1GOKA 2XIBA 1KWGA 4MADA 2VL4A 3U5UA 1VFOA 3GH5A 4ZE5A 4W7WA 3OGSA 3K8MA 1KQYA 4HU0A 5DT7A 1NH6A 4AYSA 3IJ9A 4AXNA 1GOOA 2WKLA 1LL6A 1QHZA 1ISYA 1JZ8A 1WB0A 5CXPA 5FCZA 2WMFA 3SCPA 1XYZA 4TTGA 3UG5A 2DSKA 3AQUA 4PBGA 3OIHA 1JZ2A 4HZ8A 4NRSA 4DWSD 3ZM8A 3MSDA 4AZ5A 2W91A 3O2LA 1UKPA 1PX4A 4U5IA 1CGYA 2DSWA 5JUVA 3GBEA 1E6NA 4BF7A 3GTNA 1GVIA 4UFJA 3WNPA 1WO2A 5CPQA 1XH1A 1CTNA 4Z2IA 1KQZA 2J47A 1W3KA 2XWEA 3WUBA 3N04A 1E72M 5DMYA 1UR8A 2EJ1A 3T08A 7A3HA 2YL8A 4U2YA 2DSZA 1EOKA 2V3FA 1V03A 1OGSA 3M07A 2X2YA 4J3UA 3WNLA 2RGLA 1MXGA 5D4YA 2GK1B 1W2PA 3AICA 4BS0A 4LXFA 1UYQA 4JKLA 1RD6A 1WZMA 2UY2A 1CGWA 4TVCA 4KGJA 5HBFA 4UQ9A 5IHRA 2B31A 2O9RA 1C8QA 3CUJA 4D6DA 2NT0A 2J8GA 3GH7A 2J74A 1QI3A 5BYWA 1VF8A 1CXKA 4K68A 4UZUA 4J28A 3VTRA 1XD0A 2WVVA 1KR1A 3CZEA 1E6SM 1HF6A 3UETA 4JFWA 4UTFA 1I1WA 2HISA 1U2YA 3AHXA 1QNQA 1QNOA 1UA3A 2BXZA 2F61A 2D0FA 4M1RA 3VKKA 4ZE4A 1TCMA 2E9LA 4DWSA 1EHAA 3VD9A 4AMCA 1HNYA 4PMVA 1VEOA 1GUVA 1WAWA 1AQMA 2J78A 1R8LA 2XVLA 4D1JA 5HDRA 2TAAA 2XFYA 1E6ZA 2BY3A 4R27A 2JIWA 1PAMA 2PC8A 1LQ0A 1Q6CA 4B3LA 4CU8A 1BYBA 2XM1A 1C8YA 3NYDA 5FL0A 5HNNA 2VMFA 3TP4A 4AISA 4JAWA 1V0MA 1V3IA 1KFWA 3HN3A 2EEXA 3OLDA 3II1A 3MMDA 3APGA 2J7DA 1CBGA 3A4WA 4CCEA 4QFUA 1W9DM 2ZX8A 4WSJA 4CCDA 3VIGA 3L4UA 2VT0A 1WE5A 4U33A 5A95A 3PZ9A 5HOSA 3WF1A 1KXTA 3BAIA 1AVAA 1Y7VA 1ZU8A 4PTWA 3W82A 5I79A 2A3EA 2JEPA 1UH3A 4FLOA 2OWXA 4LQ1A 2VOTA 2OYLA 1UWRA 1GHRA 1BF2A 5CGMA 1VRXA 4L4PA 3OGVA 4HMEA 1W9BM 2GJXA 3ARVA 4PTXA 1W3JA 3VM7A 2FHCA 1A3HA 2JE8A 3SUWA 1ESWA 4MDOA 2CEQA 1VB9A 4UQEA 4WJXA 4DWSB 1GJWA 3UR7A 2X0YA 5A6BD 3ZOAA 5GNZA 4GKLA 3T0AA 3ARYA 3OLIA 4P7QA 3G6LA 1VEMA 5EMYA 2YKKA 1XRVA 4AD2A 1I1XA 4F9DA 4HZ7A 1E4LA 1US3A 1LF1A 5A3HA 4AEFA 2WWCA 4HA1A 2UY4A 3VD5A 4UOJA 2VR5A 4GZIA 1B90A 3CLWA 3S2CA 4B9YA 1EO5A 1PPIA 1G1YA 1KBBA 1VJSA 3GDBA 5AY7A 3AZSA 2FHBA 1E15A 2WBGA 3ZQ9A 3WDQA 3KZSA 3VIPA 4ACYA 2YBTA 3A4AA 2G8ZA 5A2CA 1UWQA 5CZKA 3BAJA 3CUFA 1MQRA 1ISXA 2WSPA 4JHOA 2XTKA 3EDFA 4H8UA 1BVZA 2IXVA 1MVYA 4C7FA 3WDPP 3W53A 2VR4A 1VEPA 5HPCA 4P7OA 3F4VA 1TR1A 3IANA 4YPJA 4UR9A 4PEEA 3RIKA 1E0XA 1OIMA 3VM5A 4XUYA 3QGVA 4NZCA 2GSJA 2ESCA 4L4OA 1M53A 3CIVA 2AOSA 1ZL1A 1HP5A 5A2AA 3BAYA 3LPFA 1FHLA 1LWHA 4KRUA 4GQQA 1YHTA 3VDAA 5CSUA 1UWUA 2ZUUA 4MTVA 2VCAA 2Q8XA 3DHPA 4BCEA 1C7TA 2MANA 3SCNA 3AMKA 2ZUTA 1FOBA 5GPRA 3EDJA 4W8LA 1LJYA 1G9HA 1FFQA 3EMCA 4M8UA 1UD6A 3LPPA 3SUUA 3VMPA 3ZJ8A 4BQ2A 5A6SA 4OBRA 2CIPA 3IK2A 1JYWA 4B16A 3L2LA 4PMQA 3VNYA 2VZVA 3VNZA 3N15A 5AYBA 4H2CA 5TD4A 2QHAA 3AHTA 3WDRA 3WBEA 1WKYA 2DSVA 1V6YA 4OJYA 2VZSA 3VMNA 3UG4A 2OSYA 3VVGA 5I78A 4JHZA 1QHOA 2Y8VA 4PMOA 1KXHA 3N18A 2ZOXA 3K8KA 3PZMA 3CZKA 4M56A 1JNDA 1C8XA 1UR2A 1JYVA 5DFAA 5A8PA 4MNKA 2D0HA 3AIBA 5ABFA 3TONA 1PIFA 5A2BA 5BROA 3NCOA 2ZUMA 3AISA 2VI0A 2WCSA 1JZ7A 3GM8A 4TX8A 4ATLA 4DUXA 1QI2A 4J3SA 2O9OA 1L8NA 1E5JA 1K9FA 1B3XA 1QBBA 2VZUA 5I3DA 4PMRA 2Y2WA 1GQLA 1BVNP 3NSXA 4AZBA 1C3FA 1UR0A 2J7FA 5E6ZA 5EFFA 1QNSA 3BLPX 3MKKA 1OGGA 4GQRA 5E6YA 3NIYA 2XG9A 3L4WA 3AZRA 4CU6A 3N11A 2D24A 2DT3A 2NT1A 4W5UA 1K9EA 3CHFA 4LGXA 3MUIA 3NDYA 3CUIA 1JDAA 2Y4SA 3LMYA 1JL8A 4W7UA 2BNJA 1CDGA 2EPMX 2QMJA 3K4DA 1J12A 1C91A 3IJ7A 1J0JA 3N9KA 3BSGA 3ECQA 3B9AA 1JZ3A 1B3YA 2PWDA 1X6NA 4N42A 3S6TA 1TVNA 3AFBA 2CCRA 1R85A 3OB8A 2OYKA 3WH7A 5A6AA 3VO0A 3CGTA 1MYRA 1QNPA 2J7GA 1LL7A 4JKKA 3A6OA 3AS2A 2VUYA 4XZBA 1H11A 2YA1A 1VBRA 1M04A 1BGAA 1E4NA 3AIUA 3PZGA 1HKKA 1H09A 2ZUSA 5CJ5A 3BAKA 1EDGA 1JFXA 1E56A 2VTFA 3T09A 1E0WA 1H0IA 4GINA 2BS9A 4M24A 1BPLB 3RJYA 4AWEA 4BQ5A 4W8BA 1CGTA 1S46A 4AD4A 1HVQA 1J0KA 2BY0A 1D3CA 1O6IA 2EXOA 5EBAA 3VD4A 5F7UA 2E0PA 1MXDA 2XYLA 3W24A 1W3LA 3DYPA 3UEQA 4UFKA 4JL2A 2G3NA 3M7SA 3ARPA 4AD0A 4W5ZA 4E8DA 3CUGA 1H0GA 3QOKA 3OBAA 1V6XA 3SCTA 1MW3A 3BGAA 5I0DA 3VD7A 1V0LA 2XFFA 1EH9A 2XJ7A 3GNOA 3WQWA 5M3WA 3CMGA 3VIFA 2X1IA 3LPOA 4AW7A 5E0FA 2PB1A 4CVUA 4J3XA 1D2KA 4AZGA 2BY2A 4CN6A 2UY5A 1US2A 4D6JA 1C92A 3QHNA 4J3WA 2EPNA 2JF7A 1E0VA 2JFEX 3WMBA 1CLVA 5A6JA 1UG6A 5CLTA 1XSIA 4PN2A 4JFTA 3WL1A 3M6DA 3T2OA 1JZ4A 3J7HA 3NSMA 2J7EA 4ATDA 4PUDA 7TAAA 3WH6A 1F4HA 3MS8A 4W8AA 1V08A 3ZJKA 3BLKA 2WCAA 4CKQA 1LG1A 2CESA 1V0NA 3SCQA 4HOWA 1KBKA 4WKAA 1DP0A 5E0CA 2WBKA 2BHUA 6A3HA 2EQDA 4HPGA 2PWEA 1JYXA 1TA3A 1NOUA 1V6UA 4IUGA 3NJ3A 5M17A 3ZT7A 2GDUA 3BAXA 2PF0A 3MV11 2X09A 4GZEA 3PZQA 4YHGA 4CUCA 1HP4A 3AMGA 3T2PA 5BCAA 5I77A 4FK9A 1ISWA 2YL5A 4HA3A 2FDMA 3GXIA 2BVTA 3FY1A 3W29A 1HJSA 4CGTA 2EBNA 3O6AA 4NSBA 3MUY1 1I75A 3AIRA 1CNVA 2VQTA 1GVYA 1UUQA 2EPLX 2XGIA 1V6VA 3AMLA 3K8LA 2JF6A 1SFSA 1W3HA 2IXUA 3GXDA 1M01A 3L4ZA 1HJQA 4FLSA 3WH9A 2BY1A 2Z1KA 4P7LA 4MAZA 1OBAA 2CYGA 3GNPA 3AYRA 2BVDA 2WPGA 3UCQA 1M03A 1TFVA 2E3ZA 5FD0A 2WLYA 4TX6A 1GORA 1Q6FA 1GZJA 4PMZA 1WZLA 3K1DA 4GI8A 4PYSA 3PTMA 2VO5A 4R5EA 1VBUA 3FAWA 3QOMA 4W7VA 1EDQA 2Y8KA 1UD8A 5BRPA 1HKIA 3ZT6A 1QNRA 1J11A 4IISA 3WBAA 1UH2A 4RE4A 2D1ZA 1WDRA 1NOFA 1UKQA 5DF0A 4J3TA 4X9YA 2WWDA 2GJXB 3N13A 2EPKX 1W1VA 4QP0A 2RGMA 1MQQA 2DIEA 3W4RA 1R7AA 5BXRA 1UD4A 4MB4A 1UKOA 5ABHA 1LG2A 1JI1A 3CPUA 4P8XA 4PMXA 4RE2A 5ABEA 2QLYA 4JCMA 1HVXA 4W84A 1QI5A 1G5AA 2DT0A 4W86A 2J62A 5BRQA 1SMDA 4P7NA 3VOCA 3N12A 4B15A 4W88A 5E70A 2BV9A 5M03A 2YIHA 4D6GA 2CHOA 5I23A 1UOKA 2XFRA 4QDMA 1OIFA 2WC7A 2BVYA 2YL9A
chains in the Genus database with same CATH superfamily
4GISA 4QIUA 4NIRA 5FJJA 2QYGA 2WC3A 4E2BA 3IPWA 4LF1A 2A2IA 3NPUA 5LIKX 1PIGA 4F0MA 4Q4QA 3R8HA 4JTKA 1GKRA 2PLCA 2WZEA 4DXKA 5IOBA 3F2CA 1UKSA 4PUMA 3PTKA 5FF3A 3T2QA 4QNEA 1FH8A 3PUEA 2QMKA 2HS6A 1DWIM 4NJGA 1QW9A 3VDBA 2J8FA 3WBWA 1JXKA 2WB5A 4EOUA 3T07A 1JIBA 3KZPA 4LVDA 2ZDRA 1N82A 4I7WA 5LSMA 2NSXA 3PJWA 1RY8A 3WLJA 3CAVA 1YKWA 1E51A 7REQB 3LG3A 1OINA 1U30A 1AMKA 1QDSA 3ARTA 3VOFA 3OU8A 2Q71A 4FNSA 2G97A 4ZTXA 1XIFA 2B7NA 4WOZA 5J5RA 1XYFA 4JBRA 4J35A 3M7WA 3MCNA 2PDXA 3S5OA 4Z1AA 2G41A 4Q8UA 4GO9A 5IFPA 2OEJA 1NWRA 3C3NA 2HXTA 1DJXA 2ANUA 4XO7A 2XHYA 4PMYA 1B3VA 3FGCB 1F4AA 1IZJA 4PSRA 5AC5A 5HJLA 3MI6A 4HP5A 3GUGA 1L2QA 2XIQA 2E09A 2D3NA 4ML9A 3BOXA 4QEHA 2E25A 1X1NA 1J8VA 1Q6EA 4I9MA 4UTIA 2O7SA 3G1FA 1Y5VA 3O06A 2A3AA 2BHYA 1EEXA 1PTGA 5DO8A 2G3FA 4ZQPA 3WQVA 2IKHA 4KBXA 4IGSA 3QN3A 4BKNA 3NAVA 4S3BA 3GC5A 1XC6A 1HJXA 1P7TA 4J5NA 1X38A 2PDLA 3PY2A 1S2UA 1PVNA 3W1UA 4G1KA 3MCOA 3B8TA 4EXAA 1H62A 1JF6A 2A6NA 3PM6A 2XU2A 4E8GA 2PLKA 1CXEA 3KRBA 1L6SA 1WNOA 4JDBA 4QS6A 2DQXA 1NOWA 2YOCA 1VRDA 3KOXA 1DQUA 4G1NA 4AFYA 3GVVA 1GK8A 2WKGA 4NYYA 3N3TA 4QSFA 3VCRA 2GWGA 1VFLA 1OF6A 1LDCA 3I6TA 3PHAA 4MFDA 4ZOCA 1TTPA 2ISWA 3ZMRA 1UPMB 3HTWA 4FPSA 3HJEA 2PDGA 4Y9MA 2OKOA 4OIFA 4JICA 1S5VA 2VXNA 4H83A 4BF5A 1W1B1 1WX0A 3WUGA 3CO4A 4JQ2A 3E5BA 3L2MA 3WQ5A 5AHIA 3KP1A 3L5LA 2FPVA 4XK2A 3P81A 2E9BA 3W1NA 3WFAA 3W1PA 5ABFB 3ONBA 1JCJA 4KGLA 4UFIA 3VOHA 5LA1A 3M16A 4H9VA 1BSIA 1G7VA 1M6JA 2BFGA 1FH7A 1QCWA 2Y62A 3RG6A 4I6VA 3LNPA 4IG2B 3LD5A 2ONEA 4HBKA 2WVUA 3TDFA 4NVTA 5K4ZA 1R2RA 3U8GA 3ARQA 1XBVA 1SZGA 1XQLA 3T0DA 1AG1O 2GVJA 4HJFA 3WZ0E 3T55A 3MHGA 2E9MA 1EGMA 1DWFM 1H49A 3GIYA 3WLHA 4S3EA 1CXLA 2QPSA 2W4XA 3F5JA 2WYSA 1OM0A 4FLQA 4Z2JA 4QNWA 4S38A 4GYKA 4MUPA 1W31A 3GIPA 2PZNA 3RRXA 3UWVA 1GZGA 2VOMA 3B0PA 4E8CA 4H9XA 2XVPA 1A53A 1BTMA 3KBWA 3F4DA 3JW7A 4XWUA 1DEDA 4WDWA 3W74A 3N17A 3AROA 3AS3A 2WHMA 4HYRA 3CV6A 2DVUA 4S1FA 4GX9A 3GTIA 3SUTA 5ABGA 5C8BB 4K8HA 3GXTA 2WZIA 4GO8A 4NX5A 2NQ5A 1FDJA 5CPSA 3C4UA 2WXDM 2YDRA 4KIRA 1KBJA 1PDYA 2X7WA 1TSIA 2YB1A 4GMEA 2ZXQA 3R89A 2R14A 1GONA 5EGRA 4Q7NA 1QT1A 1GQNA 4WKHA 4DB7A 4JIIX 4OECA 4N2YA 1EJUC 3VOGA 3CS2A 3RHGA 3BGGA 1MFUA 3AC0A 1B4EA 2RDWA 3IUHA 3W7CA 3TR2A 3RR4A 3M0LA 1LTDA 1GG0A 3DU0A 5JBFA 3TR9A 2PDUA 1UR9A 2ZZ7A 1G01A 2CWXA 2R1PA 1G4SA 5DN1A 2QPUA 3OYZA 4C6EA 4KRTA 4G2DA 1F61A 1L6WA 3WF2A 3TXZA 1TTQA 5D9MA 2XINA 3KS5A 3POCA 1YNQA 3GNRA 1XH0A 1CEOA 1XGZA 2GDQA 1E71M 2QGHA 5GJMA 7ODCA 2BVWA 2BOFX 2B4GA 4WRHA 3B0XA 1BGGA 2YSWA 4JIPA 1ZZMA 3RX3A 1UP2A 3GR4A 1XYMA 4NUWA 1KA9F 4YCOA 2XGBA 3PTDA 4IM4A 4Z2KA 3S1UA 2BBFA 2ZC8A 3SM0A 3MZ2A 4QQUA 4GNVA 4Q8NA 1IGWA 1ZS2A 3VOIA 3MKVA 2CPUA 4CN1A 2FTWA 2F9RA 5D05A 1XRTA 4AG0A 3XINA 4NJKA 3SCOA 5LKYA 1EFZA 2EPOA 4MNJA 2A5HA 4BJHA 1YADA 2FJUB 3S2LA 1A47A 3T78A 3LM7A 4PFMA 4AVNA 4JTRA 1BYAA 3DHFA 2ZTJA 2QVNA 1NWTA 3WQDA 1ZP4A 4XZIA 1TJRA 1OFQA 1B3ZA 3CAQA 2J27A 1XYAA 5REQB 3SN0A 3PBGA 4XV0A 4S2BA 1EX5A 1TUXA 1DIEA 5ABTA 1NVMA 3ALFA 5A94A 4LX4A 3PZTA 3TFCA 4ZODA 1UUOA 3AAMA 1S1PA 3SQSA 4C60A 3VGDA 1BG9A 4HNOA 3LI1A 4IHCA 1GOXA 1XLFA 4V33A 4LB3A 3D5HA 1FUYA 3WQ8A 3RO8A 2J25A 1PO9A 4Z2HA 1B3WA 1OX6A 2FGLA 1J01A 4A2SA 1BFNA 1FKXA 4GE8A 3U7VA 1AW5A 5FSDC 3ZT5A 4TOQA 3UWZA 1U1HA 3N2CA 5C54A 1Q6DA 1DOSA 1Q85A 3A24A 4UFMA 3H6OA 3HGRA 2KAUC 1TV8A 4A35A 2GDVA 1WYIA 3ARRA 2QGYA 3KL0A 1ZP3A 1VFUA 3OEXA 4KF1A 2OZ3A 3RU8X 5PTDA 4HTYA 4NT0A 3ZR5A 4OBTA 4QG6A 1NAL1 1PBGA 3BJFA 1UP0A 2UV8G 3E49A 2XM2A 5AC6A 3GBDA 3BURA 3P74A 3BK0A 3GKAA 1F2JA 4XB3A 4L7ZA 2XH2A 3WDIA 2OQYA 2I17A 4OV9A 2QV4A 1UMYA 1Q7MA 3KVKA 1VJZA 1REQB 2I14A 4UTUA 3EDDA 1QU4A 2D0GA 3WD3A 3QQWA 3H23A 3MZNA 3DFOA 4TVUA 1AQ0A 3A22A 4J3ZA 1H7OA 3CH9A 3F03K 1TUFA 3SCSA 3WK1A 5IDZA 2NQ9A 2PGEA 2O9PA 1ZALA 2KX9A 1A3XA 4BEUA 1VPXA 4HT3A 3W86A 4BZYA 5DRCA 2LLEA 2FB2A 4PSPA 3MSGA 2Z27A 1MFVA 2FGZA 2XGZA 4DJFC 1XLJA 3ZIZA 4WX2A 3GR7A 1XR2A 4NAFB 1MI3A 3NQFA 4TQTA 2PWGA 4C6QA 4LPCA 2OVLA 2GJPA 4DF2A 3HO8A 4BWLA 4UTWA 2WMIA 3I6RA 4Y9PA 3AUOA 2GGIA 4TTUA 2OLHA 4MWAC 1VCGA 2ADAA 2D2HA 2D73A 3WLIA 3TC7A 1PB0A 4PCTA 4S3AA 1SJCA 2A79A 4NHVA 1OJXA 1XLDA 4A3YA 5D9NA 3FAXA 3CT7A 2CETA 4U31A 2V2DA 3TYZA 1IEIA 1REQA 2ZICA 1HJUA 2YBUA 3S8HA 1I2NA 4MY1A 3GQYA 3RMEA 3ZLHA 2D20A 4WJEA 5K3VA 2ZUWA 4O18A 3W6LA 1E4MM 4O13A 3WNKA 3WLSA 3H4XA 2Z6JA 3G6MA 4N6FA 2WM0A 5T9BG 1LQAA 3UZZA 1XV8A 2I5IA 4UTKA 4GBUA 3FW6A 4JL1A 3EMZA 1DE6A 4P7RA 1QW8A 1KRMA 3UR5A 3G24A 3FX4A 1NY1A 1BEUA 2PWFA 1ONXA 3P0WA 3TZNA 2I57A 3WNMA 1EYEA 3BO9A 4PUUA 4UQAA 3W70A 4OKDA 4MDPA 5BMWA 2VZTA 4XZWA 3SQMA 4F2TA 1NFGA 1OFAA 2PDMA 3UXDA 1YPXA 4HU3A 2VELA 3WEZA 1UD5A 3QEZA 3S2MA 3V36A 4DJDD 3HG4A 5A6BA 5EFDA 1YBQB 3F4CA 1JZ5A 2FH8A 2ZRVA 3CZGA 4N9BA 3GS6A 4CD8A 2O92A 3MUZ1 1MO0A 4NJJA 1RZMA 2PLMA 5LA2A 5IDIA 2XIMA 1V3HA 4O0QA 3GZAA 3ITLA 2EJAA 3MV01 4Z1BA 3QTPA 5KZ6A 3NUKA 1OT2A 3W7LA 2VYOA 5GNXA 1QK0A 3RM8A 4HNTA 2AQVA 5C55A 7ENLA 4IPNB 1Y5WA 3NTYA 1OK4A 2HEJA 4G56A 2G4FA 4JX5A 3LDVA 4M82A 3T7VA 3E0LA 5HQMA 3LCHA 5H91A 3WQCA 3AXIA 3P14A 1Q7ZA 1IF2A 1VLWA 4H7CA 2ZXAA 4DO6A 1VHNA 4C5ZA 1QWKA 2OLAA 3B0YA 1GOWA 1F3TA 2YR1A 2E8ZA 1CECA 1UH4A 4XZHA 2W61A 1KRBC 2WLZA 2CHNA 3BCJA 3A5FA 4WHBA 4UOQA 3PNUA 2F8QA 1EC7A 5A6MA 1E9ZB 3WKZA 1HT6A 4PUEA 3AMDA 1TPEA 3R8RA 4O0KA 2C7FA 2H6RA 5LIXX 1WZAA 4PUKA 1EJRC 5FEXA 1UCWA 3EDEA 4K7YA 1Z9AA 1KM1A 2IKJA 4QR6A 3NL3A 2AGTA 3W38A 1Q8AA 1VCFA 3IAQA 4RE0A 3QV8A 2J4GA 3SCUA 2VEFA 5FA5A 1B31A 4AZHA 1W37A 4EANA 3QH2A 4C6OA 1J79A 4IQLA 3QQ0A 2W9MA 4AVFA 5AB3A 4H7VA 3SO7A 4RNFA 2POZA 2DIJA 5LIYX 2OYMA 1RY0A 3LOTA 2Q8LA 1OB0A 4FNRA 1EHNA 4F66A 2PTDA 1C9DA 4BWLC 3AIQA 3TYBA 2F84A 3S6OA 3C0SA 2Y24A 3W76A 4DJFD 3W6MA 4MB1A 1JVNA 4G5DA 2IW0A 4X0NA 2IPGA 2IPFA 3SDOA 5GQBA 1KRCC 4JIHA 1DWJM 4LV9A 2VUNA 1CZ1A 1W2VA 4LFYA 3PUGA 2DZXA 2VQUA 1EIBA 4JIEA 5HMSA 2DH3A 1I9CB 3NXFA 3WFLA 4EXBA 1TV3A 4GUJA 2VFDA 4JY9A 2NUYA 1B1YA 2F6XA 1I0DA 4QDWA 3E74A 1ZFJA 3B9DA 3RJXA 1JZ6A 1KXQA 2A7RA 3AI0A 1FKWA 3BAWA 2QCDA 1FWDC 4KPLA 3EA3A 4Q7BA 1QNVA 4DWSC 2BGNE 2VRQA 3S9IA 1F05A 1RPKA 3L12A 4AZIA 5IFTA 3TCEA 2XIOA 3PUDA 4ACZB 1OX5A 5KINA 3C2YA 4L56A 1TTJA 1KFCA 2HQAA 4BI7A 1OT1A 4ZE5A 3WQOA 4W7WA 1X96A 4LAZA 1L9WA 4Y96A 3W7PA 1JPDX 4HU0A 1TQXA 1UWAA 1LL6A 2X1SA 3SGZA 1QHZA 3KRZA 2DZVA 5FCZA 4P5UA 3DKJA 3HQ1A 3SCPA 1G4EA 4O52A 3AQUA 4XTIA 1US0A 5XIMA 1JZ2A 3R1ZA 4NRSA 2ON3A 4ZO9A 1QPNA 3BLEA 4U5IA 2Z28A 3KTXA 3UY8A 4BF7A 5KTLA 2BGQA 3KCOA 4MJZA 5CPQA 1EXBA 2FZNA 4Z2IA 4I5UA 1KQZA 4GFIA 3N04A 1E72M 4HU4A 4HYWA 7A3HA 2DZPA 2E1WA 1DJHA 5CZSA 3G1XA 1FWBC 1S1RA 3AICA 1W2PA 3SGUA 4JNMA 2YXOA 1X6UA 3VCNA 4JKLA 1RD6A 2PDHA 1WZMA 3C8FA 1TJPA 2NUXA 2OX1A 1DTNA 5HBFA 1IIHA 2O9RA 4D6DA 3KM8A 2NT0A 4DJDC 4DO7A 3VYLA 2J8GA 3LXBA 3M0KA 1QI3A 3VTRA 3HG5A 2WVVA 2OQLA 1E6SM 4IQDA 1EJVC 1XICA 4JFWA 4BY3A 1RK5A 5C0QA 1I1WA 4GWEA 5AECA 5C5YA 3TSMA 2F61A 4ZE4A 9XIMA 2J6XA 3NQ6A 3OQ8A 4AMCA 1VEOA 3TMQA 1AQMA 1XINA 2TAAA 3REQB 1A5BA 3P3BA 3I4KA 2BY3A 3ANUA 1PAMA 4B3LA 2XM1A 5GJNA 1NJJA 2QULA 1Q65A 2VMFA 3ABQA 1GVRA 1V0MA 3URNA 1V3IA 1KFWA 2Y5SA 2EEXA 3TN5A 4LVFA 2ZVIA 5GVJA 4HHMA 2VFIA 4CCEA 3A4WA 4ZB0A 2ZX8A 3FJ6A 4CCDA 3FA4A 2ZQ0A 1WE5A 3CNYA 3PZ9A 3EA1A 1KXTA 1YPFA 1OF8A 1AVAA 3ZWTA 4YLWA 4PTWA 1O1ZA 1UH3A 4NZFA 1O4UA 2A3LA 2L5HA 3GFZA 4HMEA 2JKAA 1T8QA 1O5XA 1UOZA 3H8AA 2FHCA 1A3HA 3GSMA 1FXPA 1ESWA 3UNDA 4IMAA 4JR5A 4R33A 4MDOA 4UQEA 3CL6A 1B4KA 3QFEA 1R3TA 4XBJA 2X0YA 3CV2A 1QXLA 5CPMA 3W1RA 1V5XA 3ZOAA 4X60A 4XBSA 2BLEA 4P7QA 3BMXA 3TZFA 4YVPA 3NVTA 4BI5A 1DIKA 2VEKA 3H7UA 3RLVA 2P76A 1VLIA 3B9NA 4PBFA 3L5AA 1G1YA 2QT3A 4GQBA 5D2YA 3KDNA 5AY7A 1X1OA 2FHBA 4BFAA 5F2GA 4ZSTA 1I2PA 3ZQ9A 3GHUA 4KERA 3T8LA 2Y70A 3LM3A 5CBIA 3DERA 3KOYA 3QBUA 2A21A 2G8ZA 2ISDA 1YRRA 5A2CA 4IFKA 1OCBA 2PDFA 4QROA 4JHOA 3G1SA 2J88A 2IXVA 4C7FA 5I02A 1VEPA 4P7OA 4ERGA 3F4VA 1ONWA 2BODX 4I6KA 4PEEA 3RIKA 2PZ0A 1NF0A 3N34A 3QGVA 4L4OA 2REQB 3CQKA 5A2AA 2NQLA 5E0KA 2PMQA 1AUSL 4KRUA 3EKLA 2ZUUA 4MTVA 2ZVRA 4LRSA 1C7TA 1VBGA 4QQ3A 1PV8A 1G9HA 1FFQA 4RDZA 5D33A 3PSVA 3VMPA 1KFBA 4BQ2A 2QAFA 4YWIA 4OBRA 4C1LA 2B7OA 3IK2A 1N55A 1BKHA 4IMFA 3N15A 2BTMA 1JEZA 5TD4A 3TYDA 1XFBA 5AYYA 2VZSA 2Y0FA 3P7YA 3UG4A 3S1WA 3TLQA 4GX8A 1VP5A 3PFRA 1QHOA 4PMOA 4DPQA 1XIMA 1RV8A 3K8KA 3PZMA 3LXAA 4AXKA 4O19A 1JNDA 1JYVA 1R2SA 4E38A 3EAUA 2GSHA 3G8RA 4U4MA 4Q4SA 4IIFA 5A2BA 2XH7A 3LTSA 2WPBA 3VKCA 2QUMA 3AISA 1K7FA 4GYFA 3HF3A 3DESA 3QLDA 5DBUA 1JZ7A 4ATLA 4PCPA 4DUXA 1QI2A 1U83A 1L8NA 4LALA 5HANA 2E5BA 1E5JA 3U4AA 1K9FA 1HKVA 2VZUA 1MEWA 3GZ3A 4PMRA 2Y2WA 5G1MA 4Q4RA 2BG5A 1C3FA 1GKPA 1KTCA 5EFFA 3GB6A 4F0RA 1RQHA 2V2HA 2XG9A 3L4WA 4OU1A 3BV7A 2I1OA 2NT1A 4W5UA 4DPPA 4KCUA 5D2WA 5CC5A 3GX9A 4K37A 3RMJA 1X39A 4RJEA 2PDJA 3TLLA 4AU0A 1EB3A 3TK7A 4W7UA 3R6IA 2EPMX 3S5NA 3K4DA 1MUMA 1J12A 4Y2WA 1BRLA 1PKNA 3LUTA 5C6MA 3B9AA 1B3YA 3E02A 2HSAA 4N42A 1A3WA 4DJFA 1AL7A 1G4TA 3WH7A 4JKKA 4X61A 3A6OA 4BK9A 2NZLA 3K4WA 1WV2A 1M04A 2VDGA 2TPSA 4L64A 4A2RA 3D47A 1HKKA 4XBKA 2ZUSA 5HR7A 3HV8A 4L9XA 2JKEA 2VTFA 4MWAA 4HCHA 1E0UA 4Q32A 4Q4MA 3VD4A 1D3CA 3MKCA 1W6TA 1TZZA 5F7UA 4ECLA 1RCXB 4B5WA 2FVMA 1Z41A 4UFKA 3U4FA 4D8LA 2PP1A 4GHRA 1EWEA 1W54A 3ARPA 4L6DA 1R46A 4W5ZA 2ZRUA 3N2MA 1H7RA 4JD4A 3CUGA 3BANA 3QOKA 2D69A 1EP1A 2R24A 3EX6A 4MKNA 1OFEA 3VNLA 1DV7A 3BGAA 4NY2A 5J5DA 3R4IA 2XFFA 1HUVA 3GNOA 2NLIA 4ALDA 2X1IA 5HUOA 3FIGA 3UYCA 4CVUA 4L61A 4N9CA 3E2SA 4LV4A 3PC0A 1L6YA 4H6QA 3F2BA 2WJZA 4D6JA 3H7RA 1F8IA 1TRDA 4J3WA 2EPNA 3EOEA 4HIBA 2WQDA 5T91A 2NQJA 1BXBA 4XIAA 3ZXWA 2YFNA 3MP3A 1CT5A 4XD6A 3USZA 3T2OA 5BU6A 3GAKA 3NSMA 4CNTA 7TAAA 1F4HA 3EX2A 3DFTA 3INPA 3O0FA 1JDFA 1V08A 3HFYA 1ZJHA 3W3OA 1KBKA 4KCWA 4WY0A 4KKXA 1UC4A 3B3DA 4HPGA 1X7FA 2PWEA 4KEMA 4QX4A 1F5ZA 1V6UA 1DXFA 1HO4A 2J66A 4N9DA 5M17A 3CK5A 4YHGA 4H6KA 1HP4A 2GVLA 1GEQA 2WZMA 2WSYA 3V4BA 5I77A 4FO4A 1ISWA 2YL5A 3HGOA 2QCMA 3GNXA 2NUWA 3AIRA 3AU2A 2Y8UA 3LB0A 2YPIA 2C79A 4FNUA 4EWND 2NVDA 2XZ9A 2JF6A 1PWLA 1SFSA 3CC1A 4WXYA 4MVAA 1HJQA 3PWAA 4FLSA 3PNZA 4L65A 2Z1KA 2E6YA 2O55A 1IGSA 2V82A 5K9DA 2WPGA 1XDLA 2E3ZA 3W7KA 1UJPA 1XLGA 1P1XA 3GG0A 2WLYA 4O57A 1H51A 2FPTA 3O0KA 4GI8A 6PTDA 2PA6A 1CW2A 3TU9A 4H9TA 4CEXC 4IFOA 3ANYA 3UNTA 3OBKA 4CQDA 3CUZA 4C6FA 1UPPA 3QOMA 4HK7A 3PPGA 1ONEA 4HSHA 2Y8KA 2EG8A 4MYAA 4B92A 4IISA 3SJNA 4FX6M 3WBAA 1UH2A 1WDRA 2PCQA 1MEHA 3QSTA 5DF0A 4X9YA 3IUDA 2FFCA 2VGGA 3TQPA 1BSLA 1W1VA 5H2ZA 2PGWA 1MQQA 4P61A 3LU2A 1NDWA 3IGHX 5FJRA 3W4RA 3LZ3A 3FSUA 3W7MA 1LG2A 1JI1A 5CCZA 2R1LA 3STCA 4A8NA 3U2ZA 4RE2A 4JTJA 2QLYA 1XYBA 4JCMA 2OQHA 1YIXA 3D46A 1QI5A 1G5AA 2OO6A 4GQGA 3LENA 1KFLA 3C2FA 1SMDA 3VOCA 4W88A 2BV9A 4D6GA 1XGDA 1Q5MA 1UOKA 1OQFA 2P3ZA 5KZDA 4QDMA 1DXEA 3CIWA 5D9OA 4C7DA 4NQ1A 4NYUA 2QDGA 3NGJA 2GLKA 2PAJA 1HGYA 3MYPA 2XN1A 3O16A 4LF2A 4DEFA 3IACA 2V0TA 1TO3A 1UR1A 1DYSA 1UQZA 1GYLA 3KL3A 1P0DA 1Q4NX 2CZFA 2W63A 4J2MA 1UASA 3SAZA 4NU7A 3D6NA 2UZ9A 3A9BA 3N9SA 1WAUA 4V27A 1ZCCA 3FN9A 3EWZA 4Q33A 1TRIA 3TNBA 1AZ2A 4H01A 3WSUA 3MA8A 4GXWA 3LK6A 3G8EA 4XO6A 1T5AA 5D8ZA 1R5YA 1F3XA 3M0XA 4KMQA 3F5LA 4GI6A 3W1LA 4Q8MA 5GJPA 1TJ0A 4X22A 4Y9AA 3HPSA 1UWSA 2QXWA 4AEEA 3GRIA 4MPKA 3WL0A 2FZBA 3RAOA 5C2XA 1GHSA 1JGIA 1E6XM 1QOPA 1TPDA 5C9XA 5D9PA 4G7EA 4DHGA 4HKPA 1J5TA 3AZTA 2WMIB 2E7FA 4V2XA 2WM1A 1IT8A 1V6TA 4ERAA 4O17A 1E0TA 4WIWA 4FOJA 1MEIA 4UTHA 1VHCA 3EWYA 2WHJA 3N1AA 4EPDC 3U5YA 3SBFA 3BLIA 1QJWA 3KEHA 5EB8A 4A3RA 5G2WA 1XD1A 5KMYA 3URAA 2HBVA 1VJIA 1VKFA 4B5VA 2J7BA 2VX7A 1V02E 2YYUA 3S42A 3PANA 1RALA 1HL9A 2A3HA 4UTJA 4HMCA 4ERIA 4DY1A 4MB5A 4V1YA 3CT2A 1KV5A 2QF8A 4URIA 4RE3A 3FLUA 3P60A 3E6EA 3V0SA 1C7SA 2Q3RA 2VRJA 4BEQA 1KXVA 2PFHA 3UQNA 1VPYA 2DU2A 1K8ZA 2WNQA 4QCEA 2GJRA 2X0HA 1F3EA 3W9ZA 3MHUA 1I8JA 5CG0A 1D7KA 1W1PA 3M46A 2RDTA 2UWFA 1SZFA 1W3TA 5E5CA 5DQPA 3QHMA 3TYCA 4PULA 4E3TA 4LAKA 4ROPA 1B9ZA 1TCDA 4XKYB 1V02A 2PDIA 2W0UA 3UJEA 3CEUA 5CGTA 4JYEA 4Z2LA 3WIJA 3K46A 3TN3A 4PB4A 3LLDA 3FXGA 1AJZA 3NL5A 1ZJIA 4XTDA 3WLKX 1EEPA 2OZ0A 2TRSA 3WJSA 3WY1A 3AHYA 3BCDA 4F0SA 4FAMA 1JAKA 1IEVA 2YCJA 4EIVA 4DBSA 3E0WA 5CSSA 4MZ1A 1OC5A 1YBQA 2FJKA 1P6CA 4JTQA 2X8RA 2E68A 1YW1A 2OWWA 1NQKA 3ANVA 1J5SA 1LOLA 4C6NA 2YJQA 4UUIA 3N2XA 3ZO9A 4FR1A 2H8XA 4GABA 1W1IE 1UR4A 4YMZA 3T40A 2DEPA 1RQBA 2QKFA 4V28A 3AS1A 1CB2A 1XIDA 2OEMA 1ADOA 2XIJA 1EP3A 4OOUA 1QHPA 4GLEA 4RNJA 3W87A 3LY0A 4JTFA 4POCA 2E77A 3BXWA 1CENA 1J6OA 3VIMA 4TR9A 3WENA 4CU7A 5BXSA 2EG6A 4I9JA 2ZXBA 2QUUA 2DZAA 2PTWA 1JDEA 3PPCA 4A4AA 2ZXDA 1BHGA 2CBJA 1E70M 1GW1A 1RSCA 3DYMA 4HNVA 1TWWA 1TQJA 1TREA 4JTEA 3DI0A 5KEZA 1RBLA 3Q58A 1QWGA 4AC1X 4FNTA 5CPTA 5EMMA 2E67A 3GFYA 3S1VA 1F6KA 3VIIA 3M43A 1ZB5A 2G37A 5AC7A 4OBSA 3SGGA 3TEVA 1TVPA 2WVSA 4AWTA 3SADA 3C2RA 4W87A 1OC6A 3EYPA 5AFDA 1ZAHA 1LLWA 1D3HA 1JR1A 5FIPA 3ZVHA 3OVGA 3SY1A 1KCKA 1RA0A 2QUTA 2PUZA 3PFMA 3IJQA 2X40A 3C0QA 3W37A 3SRKA 4XQ6A 1G94A 2HXUA 3U0HA 4IGMA 4ENLA 3TNOA 2DUXA 2HRWA 3LZ5A 1AFSA 2QDEA 7REQA 4V15A 1LT7A 4QAWA 2BOGX 1FXQA 3VKAA 2Q6ZA 6TIMA 2PP3A 5BXTA 4UIOA 4PMJA 3VKBA 2VP8A 4F9JA 3TKFA 7TIMA 3B9OA 3M5VA 4AIOA 2VKZG 1KTBA 1YE6A 3V3WA 1ZHAA 1XP3A 1EJXC 3WQFA 4I5RA 4LUJA 4Q8VA 3STPA 3T6CA 1EA9C 3PB0A 3A3HA 1OVDA 3QPEA 2PDBA 3E12A 3WELA 1RVKA 2E6AA 1FHVA 3HIJA 3RPTA 1HX0A 2RHGA 3WD2A 4AF0B 1T41A 2JK2A 1QPKA 4QLJA 4LBRA 4LS1A 4MMWA 3PP7A 3N6JA 1W9VA 4IPJA 1SPQA 3FJLA 3MYOA 4A05A 4RXFA 1G6CA 1QI4A 1ITCA 1G0CA 4HJWA 4GIEA 1BQCA 2QCFA 2V3EA 1SW7A 2OPJA 3U7BA 3NWRA 1UKTA 3OZPA 1AL8A 5H1WA 3HFTA 1HIZA 1XPYA 5T8GA 3CU2A 3JZUA 4XVDA 1RK6A 3G0XA 1OEPA 1UZDA 2CLPA 3FEMA 2VEIA 2E40A 3DYOA 4PB5A 2ZUNA 1R3WA 4ZEPA 3MC5A 4AAJA 5U7SA 4PMUA 2O4QA 4UNKA 2MNRA 3LMZA 2NWSA 1KRAC 4ILSA 3BCFA 3RU6A 3W26A 1ODZA 3C2EA 4FXSA 4C6IA 4DI9A 1BD0A 1QRQA 3M0JA 1UIPA 2C0HA 1V0KA 4GKTA 5CZ0A 1JF5A 1LBFA 4RXGA 2PTXA 3S9ZA 5ECUA 3OYXA 3GXMA 3EWXA 3MMWA 2Q01A 2QAPA 2DT2A 2R91A 4LEQA 4G9PA 3V0UA 2R1KA 4A6GA 3RILA 2R1NA 4RZ4A 3MY9A 4R9OA 1HN1A 2P3EA 3PTQA 2ACUA 3KTCA 4UXDA 3P62A 5I3HA 4O1FA 4IPPA 3G1YA 3ME3A 1XIHA 3M6YA 3QMRA 1GOQA 1GQKA 2CITA 4EKJA 2GUBA 1JXJA 1KNWA 2V69A 4GNKB 4WVXA 1BRLB 1FHDA 5E09A 1Z3NA 4JZ5A 4YTUA 1KKOA 2DP3A 4M5PA 2D23A 3NQGA 3UG3A 4YHEA 3NQMA 2FMOA 3UERA 2J6VA 4LVBA 3EMQA 3LHWA 1YE4A 4D72A 4M6QA 1GTEA 4MNMA 3VILA 1JCTA 3RXZA 1H4PA 2OELA 4IG2A 3M0ZA 2CZDA 1R9ZA 4ZR8A 3S6DA 2QS8A 3UCDA 3W00A 4JNZA 4C5YA 4NZ5A 5CG7A 2VRKA 1DJYA 4RZ6A 3M0YA 1OABA 4E4UA 3VINA 2W66A 4GJ1A 4PGLA 1J9YA 4CQAA 3CB3A 1RUSA 4UTLA 2G0WA 1XH2A 4EX4A 3IAPA 2DPEA 1YXDA 2IS7A 1FFRA 4KH2A 3W1TA 3CIXA 5A6KA 1P48A 2C1GA 1IXOA 4N6EA 4EF8A 2HVMA 4LUSA 2H8ZA 4TMCA 2Z0IA 1ITXA 2WSKA 1B57A 1MSSA 3EB2A 5HA7A 3U9IA 4FXJA 3C0JA 3CYVA 1WXJA 2R9RA 1Y8BA 2V81A 3HA1A 4GIAA 4FOKA 1CYGA 3C2OA 2ZIDA 4KIEA 5U4NA 5LHFA 3W28A 3LGEA 1OFBA 3V35A 1PKMA 4ZO7A 4Z1DA 3K1GA 3VGHA 3PG8A 1H7WA 1KM3A 3RCMA 1PL9A 3GDMA 4YJ5A 3T0BA 3U2CA 1BKSA 3WD4A 2PD5A 4PCNA 1R47A 1Z32X 1F7BA 3W71A 5AHFA 8TIMA 3PK7A 3B04A 3UA4A 4JFVA 1BF6A 5IXEA 3UY7A 3YPIA 3BW4A 3NO5A 2YL6A 5I03A 4QCFA 1AQFA 2GSEA 4UB9A 4E2DA 1CLXA 3PPFA 4R85A 5AHEA 4Z42C 3RDKA 1U1JA 4XX6A 3UG8A 3KOZA 2ZRWA 5HXMA 3VIHA 3BC9A 5FEPA 1A5LC 2FB3A 1EYWA 3O6CA 5LYRA 4GOAA 2P1FA 2DUAA 2HDJA 3CL7A 3M44A 3ZVIA 3NPXA 1J2BA 1PWMA 3CTTA 3NZQA 4DJDA 3USBA 3LLFA 3ES8A 3ALGA 4JQ3A 4R53A 3VOJA 4ONVA 2YDQA 3THDA 1H3GA 3R0DA 3W84A 3ABZA 4JQ4A 5MHBA 2QCDB 4B90A 2CKRA 3NO1A 3NXLA 4S3JA 2Y5EA 3EKGA 2J75A 3BPWA 1M68A 4I5XA 2P53A 1QPQA 1LZOA 3NZ1A 2QVHA 4K36A 1JRBA 1WDQA 2FH6A 4LEFA 2YLLA 2A3CA 4IMDA 4AZCA 5FACA 4NZ1A 1I2OA 1YTDA 3RN6A 4QHRA 3L0NA 1HKJA 1E5NA 3FKRA 2X05A 1EP2A 3U57A 4EVZA 3FSTA 1K8YA 3CZ8A 2YZ5A 3T0TA 4C6DA 1TE1A 1KB3A 1E9YB 4AHPA 5E1QA 3W6YA 4B5XA 1FTXA 4QITA 2HJPA 4ZQOA 1TZ7A 1CCWB 1GOIA 1KR0A 1ZBCA 4MAVA 2OOFA 3POHA 5M1TA 4ML4A 2NQHA 1MW0A 3UWYA 3H53A 1KKRA 3LX9A 3GFXA 4Q3MA 2YLAA 4XSMA 1FWCC 3WNNA 2AKMA 2BOEX 4AH7A 3THCA 5AYIA 4GCAA 1GVEA 1FDZA 3VPLA 4LCRA 4UFHA 2P8CA 1F6YA 3SCVA 3KW3A 2DY3A 2IPWA 2GQ8A 1JNEA 1QR7A 3AMCA 4KFNA 3MDUA 2WMJA 1ME7A 1O12A 1K03A 1NTHA 4GH3A 2OODA 3JUGA 3WX7A 3P8IA 3VGGA 3QW4B 4DAFA 1RLCL 3OVPA 4M51A 5D02A 1TMLA 3PWIA 3C5QA 3IVTA 5AHNA 1LLZA 3LCXA 5CBJA 1VC4A 4FA3A 3MUAA 5M5DA 4LC8A 3TA6A 5K7JA 4GXPA 2PBOA 2HE5A 1RP9A 1W5QA 3FCPA 4LOCA 5I24A 1KFJA 4FI4A 2RH9A 3CZLA 1UZ1A 1AH3A 3MPGA 4N9EA 2HWGA 4WSKA 2OU4A 4ZENA 3TJ4A 1PKLA 1OCQA 4M6UA 4D8ZA 2XN2A 2QDDA 1KGXA 3ARWA 1YTEA 1E73M 2BP1A 5E9AA 3R94A 3W01A 3AS0A 1J10A 4GYJA 1EC8A 4AD1A 4DJEC 1D8CA 1YXYA 2CFFA 3URQA 1XC4A 4Q8WA 1D8WA 3O7UA 5E9XA 1ECQA 4HYVA 4W9TA 1WBHA 3GNNA 2INZA 3ARUA 3QJAA 2FYMA 3LBCA 4JFUA 3O1NA 1SJAA 2WJFA 2RDUA 3IIPA 4AY7A 3R79A 3VDCA 4LYRA 1ZQ5A 5LNWA 1ZAJA 2AQWA 1P6BA 1M7XA 4E2VA 1J96A 3CHCA 4PTVA 3NO3A 3HG2A 1JI2A 1O1HA 1JAEA 3UD6A 1UQYA 2HTMA 3OHIA 3VX1A 1DHKA 1OD8A 4PA8A 1TZ9A 4MYXA 3E2VA 5FJOA 1B9BA 3TIMA 3HPZA 1MW2A 1LBMA 3QY7A 4HVXA 2CHRA 4DRSA 1CIUA 1A5CA 4LUTB 1UJQA 3A3XA 1FWGC 1C8VA 1XISA 6TAAA 1F76A 1O94A 4W89A 2WNNA 4GYPC 2GJLA 1V3JA 3VNJA 2VDHA 1YPIA 3PZUA 4OTKA 5CC6A 3KRUA 3NOEA 3TYAA 1EPVA 1PZ3A 4AIUA 1ME9A 3DCPA 4R7OA 3UCCA 2VEPA 1XSJA 3R13A 1V3KA 1MUCA 3ZJ7A 3NQDA 3AO0A 3WF0A 4QISA 1WKFA 1VPQA 3M0HA 1GYNA 3UXLA 1XLMA 3WEOA 2Z25A 5AC4A 1SYTA 2QPXA 1GOKA 1OYBA 2VL4A 3U5UA 1VFOA 2DORA 3W83A 3RYSA 3K8MA 2X7VA 3C56A 1KQYA 1KC7A 3MCMA 4AXNA 3LCFA 1XDJA 4CNSA 1Z89A 1TYGA 3U2EA 3BW2A 1WUFA 1TB3A 3CJPA 3OIHA 4HZ8A 3ZM8A 4AZ5A 3BARA 1PX4A 4DNHA 3V18A 2H3DA 2DSWA 5JUVA 1GVIA 1MRQA 3QYSA 1DE5A 2W27A 5FF4A 2J47A 1W3KA 4LU0A 4AX7A 3GK0A 5DMYA 4DI8A 3T08A 3SW6A 2OGJA 1S2VA 1V03A 3M07A 2X2YA 3UGRA 2XFWA 2RGLA 1XUZA 1MXGA 5D4YA 2GK1B 4BS0A 4LXFA 2ICSA 2YBVA 3QF0A 3BWWA 3E38A 5FJTA 3MP5A 3ITXA 2UY2A 1JJKA 2EPHA 5AZ0A 5F1UA 4AYGA 4XG1A 5IHRA 2F2KA 2B31A 3BG9A 2WV8A 3CUJA 1QOQA 5F2IA 2J74A 1A4MA 1TE6A 1C29A 2H3BA 4GJJA 3I7RA 4TU1A 1AH0A 2NXGA 3UETA 2CWNA 3G1AA 5CC3A 3C8NA 1MRAA 3AHXA 2FFIA 2BXZA 4D9PA 1T6MA 2OT0A 3P67A 3JS3A 1GW9A 4UNLA 3BJTA 3G0SA 1HNYA 4IJBA 4PMVA 1GUVA 1WAWA 4HHHA 4DZHA 3S9YA 3CV1A 4G6CA 5KETA 1D3GA 1C8YA 5HNNA 3TP4A 1JCXA 1S3TC 3BG5A 1Q6LA 4JAWA 3ABSA 1SFLA 3CASA 1V51A 3HN3A 1W5OA 3HGSA 3RUBL 1VD6A 4Q8OA 1CBGA 3UR2A 4QFUA 4GIRA 1W9DM 3GUWA 3VIGA 1IWAA 3L4UA 4IP4A 5D37A 4KESA 3U6WA 1WBJA 3WF1A 2BWGA 2Y61A 4GVIA 3BAIA 1Y7VA 3NQCA 4TO8A 2FVLA 2VOTA 1LYXA 4Q7IA 4B2DA 5KSWA 1VRXA 4L4PA 3EWUA 1Z8AA 4Z08A 1IZCA 3VM7A 2ZRZA 2JE8A 3SUWA 4MLRA 1J6PA 4C6LA 4DWSB 1Q6QA 2IKIA 3L68A 4YTTA 4FSAA 3H2AA 1S39A 4LANA 2DZUA 1VZWA 2XSXA 4GUFA 3RF9A 2OEKA 4ADUA 3EPNA 3BOLA 3M0VA 1I1XA 1RHCA 4XSLA 4YVVA 1US3A 3WLTA 3DAQA 4AEFA 4OVXA 4M7TA 3U3HA 3VD5A 3F7JA 3H55A 2DZBA 2NX3A 3CLWA 3T81A 3S2CA 4B9YA 1XLLA 3WJXA 1FWFC 3A4JA 3AZSA 2WBGA 3EWCA 4R3UA 3STFA 3WDQA 3KTSA 3L7RA 1XLCA 4RZBA 3GY1A 2NLYA 4AHOA 1H7PA 2YBTA 2POTA 2AL1A 3KDOA 3URBA 3JU2A 3L66A 1QASA 3EDFA 4KWVA 1IXQA 4H8UA 1BVZA 4O8AA 2GUUA 4U10A 4IIGA 3WDPP 5D2TA 1BXCA 1GTHA 4O15A 2X2GA 3BUVA 3IANA 3M47A 4UR9A 4XUYA 5F4SA 3RPDA 2GSJA 2ESCA 2XH0A 4HSOA 5CAKA 3CIVA 1HFBA 1OHLA 4FEZA 1ZL1A 1HP5A 4QBXA 1I6NA 1F07A 3LHTA 3TAOA 1M3UA 1VH7A 2BMBA 4M6VA 8XIMA 1YHTA 5HJYA 3VDAA 4R7JA 1UWUA 2VCAA 3CAWA 3Q94A 1V7YA 3NNTA 2ZUTA 3L0GA 1QATA 3W22A 1F8MA 1QPRA 1LJYA 3E2RA 4M8UA 5LGZA 1M9HA 1UD6A 3LPPA 5HMFA 5A6SA 2JGYA 2CIPA 1OY0A 3W7JA 4LY4A 3GTHA 4B16A 5DMLA 3L2LA 2VZVA 3S47A 2Q3OA 2VC6A 4FS9A 4H2CA 2QHAA 3AHTA 4EPBC 1V6YA 3F4NA 3R43A 1YNYA 1ZUAX 3AU6A 5DXYA 3VVGA 3KX6A 3B06A 1QAPA 2Y8VA 3HPFA 4RK8A 1K8XA 4EPEC 1W8SA 4NP7A 4M7SA 5DFAA 4MNKA 1CB7B 3N2OA 3CLMA 1PIFA 5BROA 2ZUMA 3WJYA 1IWBA 4WZHA 1A49A 3HGJA 4G7FA 3AXKA 4H9YA 1SGJA 1W5MA 1RAKA 4J3SA 1DIOA 5I07A 3QLLA 4QJ1A 4YXGA 5I3DA 2A0NA 1GQLA 3AALA 4AZBA 4B4FA 1UR0A 1YX1A 4N02A 5E6ZA 1QNSA 1IEQA 1OGGA 3G0UA 4N4PA 1TPFA 3AZRA 3KFTA 4WGHA 2PU0A 1DIDA 3FK4A 4AMAA 1F6PA 2WKJA 4Z0SA 2INFA 1WXYA 3C3UA 4INFA 3S83A 3CUIA 4X3ZA 1XBYA 2REQA 1E1CB 3LMYA 1PXGA 1LUCB 4UCGA 3BQ6A 2BNJA 3DFQA 4LRTA 4O16A 3HZ3A 3N9KA 4YTRA 1LOQA 3IJLA 2P8BA 3DBPA 3A3WA 3H2OA 2CCRA 4NL1A 2GVGA 1R85A 3ABRA 3VO0A 4K39A 1QNPA 3AS2A 5DMNA 2VUYA 3CB8A 2ZA3A 1FWRA 3GTFA 3HJZA 1BGAA 3E3HA 5AHLA 1OG0A 3PZGA 3OQEA 1KFEA 3BAKA 1RQEA 1EDGA 1E56A 1P0EA 1WUEA 1OK6A 3NYZA 5JH2A 3T09A 1E0WA 2TMDA 1RA5A 4UTMA 1BPLB 1K8CA 3DG7A 1W5PA 3PJXA 4W8BA 3AWOA 2Z24A 4GVFA 2P50A 1HVQA 2EKGA 3HPAA 1O6IA 3M5XA 5EBAA 4GJIA 3DYPA 4K38A 4JL2A 1JULA 4KEVA 2G3NA 1NELA 3QMTA 3M7SA 1QO2A 3NQEA 3TOYA 4AD0A 4XZMX 2KZHA 3GDRA 3MJYA 5F4XA 3TQKA 1H1ZA 2A85A 1H0GA 1SO6A 3VA8A 4IMCA 1V6XA 1LRTA 4I8YA 5I0DA 1V0LA 1EH9A 4G7EB 5AN7A 1ITQA 5M3WA 2ABBA 4GGHA 5KZMA 5E0FA 1A0CA 1H1YA 3TWAA 1G7UA 4J3XA 3W1XA 1D2KA 2BY2A 4TX9A 4IP7A 1ME8A 2JF7A 3FJ4A 3B0VC 3H24A 1UG6A 1Q45A 3HB9A 3SFKA 2R94A 1OC7A 4R9XA 1QK2A 1Z44A 5CC7A 4Y9OA 3BZGA 2BASA 4JFTA 4NJHA 2ACSA 3M6DA 1JZ4A 1JRCA 3J7HA 3UPWA 4DF0A 4DWDA 2J7EA 3MS8A 1W1ZA 4W8AA 3B8IA 3L67A 4L9YA 4S3CA 3EB4A 3EZ4A 1V0NA 1SFJA 4YL2A 3F2DA 4CQCA 2DW7A 4H4IA 5LNSA 5SWUA 5G4EA 1ZRQA 1JYXA 1TA3A 3B40A 1Q2SA 3PAOA 3QZAA 3MV11 1GG1A 2OFJA 4FIQA 1XRSA 3T2PA 1N8FA 3CH0A 2P88A 4HA3A 5DMMA 4H3DA 3FDKA 1HJSA 1TV7A 1M7PA 5DLCA 1IYXA 3MUY1 3W7EA 1M1BA 3VK5A 1UUQA 3WYZA 1IXPA 4QJ3B 3AMLA 4RDVA 3RR1A 3MO7A 3QRHA 2ZA2A 1M01A 2QUNA 2XN0A 1VYPX 1K70A 1XL9A 5JU6A 3P5YA 3CQJA 3GNPA 4B5SA 3AYRA 3A13A 3MP4A 1SUXA 3ZWSA 2NV1A 1OG6A 1SO5A 3UWUA 3HM7A 3UGVA 1OFOA 3DG3A 4PYSA 1WZLA 3K1DA 5EMLA 3PTMA 1ENUA 4Z1CA 4WCJA 1HGWA 1EC9A 4IZGA 4YTQA 3TN6A 4W7VA 3L65A 1SFTA 2VWTA 4DZAA 1OADA 3PJUA 4NASA 3ZT6A 1LCOA 1MMFA 2WOQA 2DZSA 1Q7QA 4RW5A 2D1ZA 1KM4A 1NOFA 1GVSA 1UKQA 1SJDA 2PU1A 2GJXB 1BWLA 3N13A 3QKEA 2EPKX 2GYIA 2ZFAA 4A3QA 2DIEA 4MKSA 5ABHA 4JTAA 1XKYA 4EXQA 4PODA 4QAIA 1XYLA 6REQA 4P8XA 1XLAA 1SVDA 3H12A 4MJMA 5I3GA 4LUSB 4ZSUA 2OX4A 3IRDA 2ODOA 1OZMA 3PBVA 1VBJA 3DIPA 3TX9A 4B15A 1XLKA 4YS1A 3DI1A 4JEQA 1EBGA 3IWPA 2WC7A 2BVYA 3VNDA 1YXCA 4AQLA 4UOZA 2C8NA 4IPLA 3RLHA 1JCLA 3LQGA 2W62A 1J0YA 2PWHA 4UMBA 2O0TA 5JBDA 5JMUA 4GUGA 4AZ6A 4E4PA 2HROA 2GGEA 4HK6A 3LERA 1OGBA 1E6RA 4LUTA 1NDZA 2VC5A 3NPVA 4QE1A 4IMEA 5K9XA 2BZNA 4LWWA 1AW2A 4ZFMA 1PCWA 1QBAA 5H8MA 2O9TA 4IPIA 3QZEA 1JD7A 3M41A 1E1FA 3L4YA 3WJZA 3FDGA 1K9DA 1MDRA 5AYZA 4GFSA 2OSXA 1HG3A 3LHZA 3AOFA 3EDKA 6REQB 1E9LA 2PEVA 4N7QA 3OVQA 4HNLA 3AXMA 1XCXA 3KVJA 3FHQA 2QJMA 2ZZ3A 3BSMA 1IT7A 3S4TA 3VE9A 3QHOA 1UD3A 4Q6JA 2XISA 3V1PA 3VIKA 9CGTA 1TX2A 3QVQA 1PUDA 2E5CA 5E93A 2G50A 3JR2A 1C93A 2QIIA 3QZ6A 4DZIA 3FYYA 4BQ4A 3NA8A 1HKMA 1C90A 1W9PA 1R6WA 4DF1A 4RNHA 4DIAA 4HU8A 1BLIA 5CSRA 5JIWA 1FP9A 1XBZA 1KD0A 4S3KA 4OT7A 1GNXA 1W9XA 1WDWA 2X30A 3VNKA 2ZZ2A 2GGGA 3KWXA 3UR8A 4YN5A 4WXZA 1PX8A 4X2PA 3RCNA 3E5PA 1J18A 2UY3A 2Y6ZA 4HN8A 3ES7A 1ISZA 1KCLA 3DFNA 4IQJA 3W85A 3IJDA 4WLCA 4WR3A 2H9AB 3W2UA 4GNJA 4L5ZA 2WC4A 3JVAA 1V3MA 4JIRA 2GUYA 3OG2A 4P8WA 1FWHC 4WF7A 3ID7A 3W73A 3D3FA 4Q4PA 5AYXA 2GVYA 1DHPA 3T42A 2VEMA 3E2QA 2CW6A 4IP5A 2WMGA 4CVWA 5FAGA 2PWUA 3K4AA 4S3DA 4M1BA 5L6UA 1J2WA 3EWDA 3PBUA 4JN6A 1V3LA 3ZFHA 4PCFA 1NWUA 3GXFA 3WUEA 3K30A 1BAGA 3NDZA 1Q6GA 3VNMA 3NPWA 1FWAC 2NX1A 2QCEA 2IQTA 3OZOA 1VGAA 5I3IA 3UYIA 4H6EA 1JGMA 4F3HA 1ODUA 4WUIA 4D71A 1OFPA 1E9IA 1DJIA 2ZWZA 2WO5A 4XZNX 1TPVA 3G1DA 4WY0B 4DYEA 1YTKA 3ATYA 2XIIA 3OJGA 1B2YA 4PC8A 1DWHM 1CI1A 8XIAA 2JGQA 4OFCA 3IARA 4DNMA 3KHDA 3KL5A 4P2VA 4TUFA 1E40A 3MDWA 4LNCA 4RR4A 2WNWA 5REQA 3BMWA 2Y89A 1EF3A 4HNNA 5MKGB 4C6PA 4JNYA 2E8YA 4LUYA 4B2DD 9XIAA 1BXNA 4KCVA 1NARA 2C15A 4AIEA 1ZLPA 4MLJA 4FX8A 1E55A 1H50A 2XPKA 1ELSA 1FA2A 2HBXA 4ZL1A 5HR6A 3AHVA 1GJPA 2GJNA 2VVSA 5TBOA 1K9TA 1LL4A 3I3EA 2OR2A 3EGJA 1W1YA 2C16A 4LH8A 3NEHA 3CHEA 4GPNA 1G69A 2ZRXA 2AQOA 3RO6A 3R7MA 1MNZA 5IM51 4ROQA 1RP8A 1A5OC 5HULA 3OO2A 5BOEA 3LA4A 3LBOA 4KWWA 1X6LA 4UQBA 1QTWA 2FIQA 3OA5A 4QTGA 3LCIA 3LHYA 1P0KA 4MZ8A 1VENA 3VD3A 1ICPA 5I5RA 4PE8A 3PF3A 3G3MA 3ONCA 1GOMA 3VDHA 4UMCA 1FHUA 6CGTA 5FAJA 3FJNA 3F4WA 4QM1A 3RX2A 1PYFA 2E28A 3H54A 1ZENA 4IWWA 4QDPA 3STEA 1SM9A 4FXRA 3SI9A 1JDDA 2PSNA 3WFZA 3FXYA 3S3GA 5FEZA 4AY8A 2E5DA 4QSHA 4CQ8A 3UW6A 3I4EA 4ZFCA 3SURA 4U2ZA 2YYTA 4HCDA 3NM1A 2YZRA 3IIXA 1DJWA 5AZ1A 1XGEA 5LA0A 3A4XA 3W88A 1UZ4A 2CXGA 2GOUA 5HNRA 3FHAA 3P5ZA 4HNCA 4IX2A 1R7OA 5DRIA 1XHGA 1XJBA 4GYPA 1H1NA 4W85A 4D8AA 4CCZA 3TQ0A 3H26A 1L0PA 3CAKA 3IJIA 1P6WA 5G4HC 1MW1A 3VABA 3OOQA 1YLVA 4C6KA 4Z2GA 3Q2DA 3LCWA 4M80A 4HN4A 1GYMA 1AD4A 2NX9A 1FQ0A 2XDFA 2CKSA 3G1RA 3RRAA 2V5KA 3VIOA 3ZJ6A 4AB4A 3R8GA 1K77A 4MWAE 1QVBA 3ZR4A 4C1NA 3KLKA 3BJSA 1TIMA 3HMJG 2PGRA 1NQ6A 4NAEB 3CUHA 3DC0A 1FVPA 3VE7A 1JFHA 5TAOA 2OSWA 4RZ5A 1JCNA 5A5WA 3I68A 4H04A 4U3AA 4QRNA 4BQ3A 2DUZA 3C52A 2BHZA 1SZEA 5JXQA 4B4HA 1K4HA 3HMCA 3M9YA 4L80A 5CBBA 4TXEA 1NDYA 4NILA 3VUPA 4WKFA 1FY6A 2FMNA 3N2BA 2C13A 4RX0A 2YCLA 4ZGYA 4NRRA 2ZUVA 5AVNA 2WW5A 4IOTA 1XCFA 2DT1A 4UCFA 2QCNA 2WHLA 1K6WA 4EK7A 1UMLA 4U28A 3W2NA 4PMDA 3UPBA 3TOPA 2PF8A 3S5ZA 4XZ9A 2ZE3A 3APTA 4IXHA 3P84A 4U5KA 2W67A 4S2CA 4C90A 3MJMA 3RLUA 2P5NA 1L8PA 5JIPA 4DO4A 5DT5A 2BXYA 3WMSA 4O4VA 1TJ1A 1R3YA 3MB9A 1XCWA 3EWBX 1ZBVA 3WD1A 4NZ3A 2HMCA 1F3WA 5A8MA 2CZ5A 3NGFA 3FVMA 4UQCA 1E6QM 3GVGA 3QMSA 3WH5A 3IVSA 4A3HA 5FF7A 3IUIA 2HCVA 1AQHA 1QMLA 3LV6A 5DX7A 4D6HA 2PODA 4NF7A 4M3PA 1NP2A 3WLNA 3E0VA 4JOMA 3WDJA 2OG9A 1UBSA 2DZWA 4C6MA 1PDZA 2NW0A 1EZWA 1WOAA 1A5MC 1FCQA 1OD0A 2VFGA 4DZ5A 2JEQA 4DUVA 4MNLA 3LRMA 2JALA 2P0IA 2RJHA 4TMBA 3QY6A 4E6MA 3SIZA 2XH4A 4DAIA 2RKXA 1HJWA 3LBMA 1EJWC 3MI3A 1B30A 1DQWA 3CL8A 1TPH1 4OHQA 2V8ZA 5I2UA 3W0KA 1VIWA 3B8VA 3VU2A 3W27A 4H41A 3ARZA 3MVTA 4PL1A 1W91A 4J40A 4LBUA 2E4TA 3ARSA 2C14A 3SUVA 3LI0A 1ZCOA 4TIMA 1HL8A 3AJ7A 4NI3A 4KWUA 3QGKC 2VR2A 2OB3A 3BL3A 2ZZ5A 2ZADA 2Z2BA 1FCBA 5BXPA 3SRDA 4XD4A 1CGXA 3M0MA 1VAHA 4X9SA 3KE0A 1A5KC 2VC7A 1EQCA 2D3LA 2CBVA 3G2GA 4YIWA 1O68A 4C91A 2CNCA 1K4GA 3GTXA 5CPOA 4DM1A 1R86A 2ZE0A 2XVGA 1KCXA 4LBSA 3CZJA 3GE7A 4PTNA 4OUEA 4L1GA 4RNIA 1NFBA 3KCJA 5C71A 3N9RA 4HB7A 2GQ3A 2V5JA 4JX4A 5C2GA 3CV7A 1GGOA 3UWQA 2V3DA 3OG3A 4CNNA 1ICSA 2B81A 3AJXA 2PP0A 3NEVA 2ZDSA 3DKLA 4NZ4A 3WD0A 2OT1A 3CHVA 4DXVA 1A50A 4X0VA 1E6PA 4GCXA 1N7KA 4EPKA 3OLEA 1A5UA 2CC0A 3EOOA 4BI6A 4YCPA 2P0OA 5DY3A 4FF7A 1MNSA 4LW7A 2FLIA 2V2CA 4L1WA 5HWJA 3WQPA 3OGRA 1UP3A 3TCSA 4PH6A 4CNPA 1SO4A 1X98A 2XWDA 2I5GA 4O8RA 3W7RA 2QQ6A 3B8DA 4XAZA 5BOFA 3L9CA 4LVGA 2O7QA 2ZZ1A 8CGTA 1GT8A 3WEMA 1BYCA 2YDSA 3MHFA 3OVRA 3TJXA 2X1RA 5A8QA 3VFCA 1KBIA 1B0IA 2ASHA 4PRWA 2I9UA 3DECA 1T99A 1YDNA 4E3VA 1MZHA 4EP8C 5M2FX 3IJ8A 3LHVA 4XISA 1KGWA 8A3HA 1XYCA 2CZEA 2G3JA 3MBFA 4DBEA 3CYJA 1S5MA 3WDHA 2WK2A 3EX1A 1RCQA 1XW8A 3OZMA 3OTRA 3OPSA 2EKCA 5CSYA 5C70A 2EGZA 4QG9A 4FNPA 5A1AA 5D03A 2JIEA 4WOQA 1ISVA 1WA3A 4DO5A 2C0AA 4R7WA 3KBVA 4AEOA 5A8OA 2YW4A 3ARXA 4LUIA 1OWQA 3B4UA 4C6BA 4BR1A 2AAMA 4EWJA 3I3DA 3W7HA 1POJA 5C7VA 2ZZ4A 4IT1A 2E6DA 2WCGA 3LHUA 4CNUA 2WAGA 2XVNA 4XUGA 3I7SA 4MWAB 1CLKA 1DWGM 3WH8A 3PZVA 1FRBA 1TV2A 4CEUC 3CQIA 4GRSA 4ZMGA 4C6CA 1UHVA 9RUBA 2X0SA 3BE7A 4B91A 5B80A 4XAYA 1X1ZA 3PZIA 1H7XA 2VD9A 4J3VA 2GOKA 2BB0A 1HJVA 2ZX5A 3PAJA 3RPMA 3C61A 1UD2A 1PZ2A 1ZJAA 4JTSA 2QW5A 4JDYA 3MT1A 1O5RA 1DKWA 3NOYA 3D0CA 3Q67A 4HMDA 3M0IA 8RUCA 3A12A 3K2GA 4HA0A 1PCKA 2DGAA 4DQWA 1I2QA 4QS5A 4QLKA 5CZTA 2IUZA 4M29A 1JPKA 4MB3A 3H70A 2HK0A 1E3XA 3PZOA 1IZKA 5F4WA 2VCBA 5FJIA 1WPCA 3L0KA 3GIQA 4I3GA 2J8TA 4JYDA 3L4XA 1LROA 4HOZA 1JUKA 3UFYA 3VDGA 1FCUA 3SN4A 1QO5A 2VZOA 1EUAA 1KLYA 4LNYA 3GG8A 3IEBA 1KWKA 3QR3A 1PTAA 3H4WA 4GIYA 1PZ1A 2DZTA 4B3ZA 2VWSA 1CXHA 1RJPA 3NQAA 2VNCA 1IV8A 4LS2A 3UZXA 1SU5A 3OIXA 1TG7A 4C6JA 4DX3A 3VX0A 4LYQA 1EO7A 2CBIA 4AZCB 3L21A 4UZSA 2A7NA 4QXIA 1GQIA 2HK1A 1X97A 4US6A 1MQPA 2B0MA 4DJEA 2C1IA