4B15A

Crystal structure of tamarind chitinase like lectin (tcll)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
266
structure length
265
Chain Sequence
GGNIVVYWGQGGSDNSEGSLKEACKSGHYNMIVLEELITYDNGRDPDLNLGAHCVNCTSLQQEIKYCQLKLIKILLQIGQVTPTKEDTKDTTKDLSQYLDSNFFSGKSGPLGEVYLDGIDIASVPEGLNLKFDELVQALNDSATSRRIYLSASPNCVYPDYYLDKAIQTQKLDFLFVQFFYALPCIYTQGLPEDLFQAMKTWTSNVPESIFMALPATPDLNGYIPPRVLNKEILPAVTQASNFAGVMIFDRYFDRFRKYSSKIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHITINASE LIKE LECTIN
publication title Structural Investigation of a Novel N-Acetyl Glucosamine Binding Chi-Lectin which Reveals Evolutionary Relationship with Class III Chitinases.
pubmed doi rcsb
molecule tags Hydrolase
total genus 94
structure length 265
sequence length 266
ec nomenclature
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4b15A00
4MAZA 1D7FA 3B9AA 3KL3A 4H2CA 3AROA 2JALA 2VX7A 4CD4A 4JCMA 1UA7A 1ITCA 3GM8A 3AISA 1DHKA 3MUIA 1OINA 4WK9A 4MNMA 1Q6CA 1OGBA 1OM0A 3CUFA 1C90A 4QLLA 3CZLA 4W7VA 4DUWA 3BAYA 2XYLA 5E70A 1QHZA 5LA0A 1UOKA 4AISA 4ZE4A 2XWDA 3WQVA 1M7XA 4JFSA 3ZT5A 1GJWA 2E8ZA 2ZX8A 5CXPA 1ZBCA 1X6LA 1HJUA 1AQHA 4CU8A 2BXYA 1R8LA 1K6AA 1NOFA 3VIJA 1TR1A 3DHUA 1UYQA 4HZ8A 2D0FA 3TTOA 1G5AA 2XVGA 2YA2A 3RIKA 4BQ2A 2OYLA 4HP5A 3VUPA 1J10A 4Z2JA 2WKLA 4CN4A 2YL6A 4B16A 3F5LA 1O6IA 3AIBA 3VGGA 3I3DA 1U33A 3B9EA 2A3BA 1HKJA 2Y5EA 2VR4A 3PTKA 3LPOA 1US2A 2WVSA 4QLKA 1PEZA 3M6DA 3PZ9A 4J3WA 3QHNA 1CXIA 3AHTA 4U31A 4F66A 1J0ZA 2V3GA 2VQTA 1NOUA 3TOPA 1XHGA 2YIHA 3WDHA 1MQQA 4MADA 4DWSC 1TG7A 3L2LA 3BMWA 5I24A 1P6WA 1UWIA 3T0BA 4JL1A 4HA4A 4H8HA 5GNYA 3GTNA 3CH9A 3KE0A 2GDUA 1OT2A 2VX6A 5CPSA 1UQYA 1W1TA 2O92A 4AD1A 4PTVA 3ZO9A 4PN2A 3G6MA 4UZUA 1CGXA 1IZKA 1HJVA 1XCXA 1HX0A 2A3AA 2WCSA 3OA5A 3RJYA 3SUSA 3VMOA 2YLAA 3ZMRA 4L4PA 3L4YA 3WMCA 3VKKA 3N04A 1IZJA 3QR3A 3RCNA 3W38A 3WUFA 2VQUA 2ZUUA 2X0HA 4AZHA 5JBDA 2YDRA 1OGGA 3PZVA 3CUJA 1E55A 3WH5A 1C7TA 4Z2HA 3KWXA 4HOXA 3AXIA 4PUEA 4HTYA 1EGZA 1GQJA 3SUTA 1OCQA 2V5CA 5I3DA 5GNZA 4XV0A 4JAWA 4ACYA 2WMJA 2VI0A 3AYRA 1UWUA 4ATDA 4PSPA 3CBWA 5D4YA 3AHZA 1PX4A 1J0IA 1BGAA 1E72M 2VO5A 3I3EA 3AZRA 3BMVA 3MKKA 2O9RA 3ZT6A 3FXYA 3BSHA 3WQ4A 4CUCA 2ZUNA 3IANA 4DUXA 1W1VA 1HJSA 4MJ4A 1BFNA 2FH6A 3NYDA 4CD6A 3KZSA 3NSMA 4UNIA 4M1RA 4F9JA 3SCOA 2XPKA 2DSUA 1UH4A 1V6UA 2X0YA 3WQ6A 1CGTA 3E1F1 2WLZA 3PZTA 2EPMX 1XSIA 5HXMA 2RGMA 3AS0A 4UQEA 1DP0A 1C3FA 4PEEA 1FH8A 1QOXA 1LWJA 3WH7A 3OBAA 2WKGA 2CXGA 1JXKA 2DEPA 4KGLA 2D3LA 5AC5A 3U5YA 3CZ8A 1JZ3A 2D20A 3ARQA 3VMNA 2C7FA 2J79A 3A3HA 1EA9C 1V3IA 4MAVA 1V3KA 4UQDA 3WF2A 5E6ZA 2VCBA 2NT0A 4UFIA 2BY0A 1UKQA 4CD8A 1GQKA 3CUGA 2VZVA 4NRSA 2YBTA 4LYRA 4M81A 3NCOA 1E0XA 3WNKA 4CD7A 5AC4A 1FP8A 3T2OA 2XGIA 1NOWA 2D24A 1DWFM 3N1AA 3VILA 2BNJA 2A3HA 5DEZA 5EFDA 3IJ7A 3VU2A 2GSJA 4AD5A 3N17A 3EMQA 3VO0A 4PMZA 1ISZA 4WJXA 2WZHA 4PRWA 3VNYA 2NT1A 2OWWA 1KQZA 3T2QA 5A95A 2PI6A 2YBUA 4TOQA 3UESA 2ZWZA 4E2OA 1J01A 1XH0A 5FL0A 2ZX9A 4NF7A 5A6SA 1HJXA 5A1AA 2QMKA 4BZYA 5C71A 2YA0A 1HIZA 3HJEA 1ITXA 1VBUA 1UR2A 1KXVA 1SFSA 2GJRA 3DECA 4U2ZA 1G94A 1M01A 1WPCA 3KEHA 1NWTA 4P7RA 3WH8A 4LX4A 3WUEA 1V0KA 1CNVA 3ARYA 3RPMA 1JZ8A 3SIMA 4GZEA 4HPGA 2DPEA 3PZUA 1WO2A 3T09A 4R27A 4HOZA 1GHRA 1CZ1A 1KXQA 1Q6FA 4TVCA 1VEMA 2Z1SA 4AMCA 4AD0A 1JNDA 2BY2A 1C8XA 1E1FA 1GCYA 5ABFB 3WQ8A 3OLGA 1JZ6A 2JF7A 3DYOA 5ABHA 3AMKA 2G3JA 1E6QM 3TP4A 1C7SA 1CGUA 2CIPA 4UOQA 1KGWA 3UEQA 4ZXOA 2ZICA 2E8YA 1KR0A 5FL1A 3K8KA 4AD2A 3CHFA 3BSGA 3FNDA 1HKIA 1G01A 3WSUA 4BQ5A 3O6AA 2JFEX 3ARWA 5HNNA 4B9ZA 2D1ZA 4GQQA 5BXTA 5HPOA 1KCLA 1MQPA 3IJ9A 1WZKA 2FGZA 2WMFA 1X1NA 4HMEA 2YL5A 3PZQA 1G9HA 4AWEA 1QBAA 2XM1A 3GH5A 1KQYA 4W8BA 4D6HA 1HL8A 3VX0A 5LA1A 2ZX5A 1EQPA 5BXRA 4QCFA 3GXIA 3N12A 1UR4A 4CCDA 3GNPA 5JIWA 3BAXA 3W4RA 3MO4A 1XYFA 1ISXA 2BVTA 4AZGA 3N9KA 5I5RA 1UHVA 1E5NA 3WN6A 2VZOA 4M29A 5I79A 1MVYA 2VNCA 1BQCA 3UERA 1V6YA 3N15A 4AZ5A 1ODZA 1SMAA 4S3KA 1EDQA 3CZJA 4CN6A 1EO7A 4P8XA 1SYTA 3AIEA 1UD2A 3SCRA 1ZJBA 5E0CA 2DH2A 3WL1A 1WNOA 2XTKA 4V28A 4PBGA 2E9LA 4D6CA 3T0DA 3NJ3A 4RE3A 5D8ZA 1M03A 4U3AA 4P7QA 1K9EA 1VENA 3K1DA 4PYSA 1AVAA 4D6IA 1BPLB 1A3HA 4W86A 3GNRA 1QBBA 2PWFA 3VIGA 1XH1A 1JNEA 1FFRA 3RILA 2UWFA 1GPFA 3TTSA 5A3HA 5CGMA 2XJ7A 2G4FA 4M56A 5EB8A 1Q6DA 1UG6A 3SCSA 2FHFA 3WNPA 1B2YA 2E3ZA 4J3VA 4HOWA 5I6SA 3POHA 1CECA 1VJSA 4PSRA 3CHEA 1MQRA 1H41A 1UKSA 2J7GA 4AEEA 2WHMA 3ECQA 1VBRA 3U57A 2WC4A 1M53A 2E40A 2UY2A 1GW1A 1KGUA 4F79A 1OB0A 2BS9A 2X05A 1J9YA 1WDSA 3F5JA 3WUGA 1H5VA 4JKLA 1QVBA 2XUCA 3EMZA 4HZ7A 4E8DA 5JUVA 1DWIM 1XSJA 3FHAA 1VF8A 5IFPA 5A6BA 1D3CA 1XCWA 1NQ6A 2WB5A 2ZXAA 4QFUA 2BXZA 4HMCA 1GOOA 1SR0A 4LYPA 1SMDA 3WFZA 2VVSA 2WHLA 2W63A 4YHGA 3CUIA 4UOJA 4RE2A 3RJXA 3MUZ1 2ZUVA 3BAKA 4DWSA 5DMYA 2OYMA 1FH7A 1ZL1A 3IAQA 4NRRA 1HXJA 1G0CA 4TVDA 1FP9A 3NDZA 1V02E 2PBGA 3A47A 2VRKA 4NSBA 4DUVA 1CXLA 2VOTA 3VD7A 1K9DA 1CDGA 5CJ5A 1WZAA 1TA3B 4ML4A 4AD3A 1TZ7A 3CHDA 4D71A 1KBBA 3VIKA 4BF7A 1W91A 2FGLA 4UQ9A 4H8VA 1E3XA 3GH7A 4U5KA 1E4MM 3PTMA 4M24A 5D9NA 4TVUA 4JFUA 1QI3A 3WENA 2OWCA 3W0KA 3AMCA 4OUEA 3PN8A 2J8FA 2ZE0A 2VL4A 1JI1A 1V6VA 1XRVA 1BYBA 2Y24A 1C8QA 1LG2A 1BSIA 3EDDA 2QHAA 3GXDA 4AYSA 4KRUA 1A47A 3GXFA 2CNCA 5DT5A 4J3XA 4JIEA 2D3NA 5I2UA 4DM1A 2AOSA 4W93A 1JD7A 2HVMA 3POCA 1JZ4A 4WSKA 1Q6GA 3JUGA 1JFHA 1GQLA 3W29A 1V3MA 1TFVA 1QHPA 2WBKA 5CSUA 5CSYA 3EBVA 2OSWA 2J7FA 3ARXA 4CCCA 4W8AA 1WZMA 5KZ6A 2G41A 2MANA 4DWSB 1RP9A 5JBFA 3FHQA 3W53A 4UTFA 4MNKA 4RE4A 1UUQA 2XHYA 4LXFA 1VAHA 1R7OA 2WHKA 3O2LA 1VRXA 1DWGM 1KR1A 3VOCA 4F9DA 5D9PA 3CUHA 1MW3A 3PZGA 3UR8A 2JIWA 4P8WA 1B3WA 3HU7A 3UETA 2D0HA 2G8ZA 3VM5A 1GNXA 3OGRA 1PAMA 2VR5A 5DFAA 2YDSA 1X6NA 4GQRA 4AC1X 2CITA 2VX4A 4TTUA 2YJQA 1CXKA 1FHDA 2GK1B 3U7VA 4CVUA 1I75A 5BYWA 2QPSA 4W84A 1UKOA 1J11A 4UQAA 1XV8A 3AIQA 1GVIA 1V6XA 2XFYA 1W3HA 4Z2IA 3GBEA 4JKKA 1JAKA 2E9MA 2BVYA 2OLHA 1MWOA 2DT3A 1HT6A 1E1EA 3WF3A 1QW9A 1PIFA 4CU7A 2RGLA 4HU8A 3GZAA 3TA9A 1JG9A 4ACZA 2F61A 3CMGA 2VT0A 1WKYA 2BY3A 2PWEA 4HZ6A 3LPPA 5M17A 1V3HA 4ATLA 2EEXA 1V3LA 1H4PA 2VCCA 2YKKA 3MMDA 1E15A 3BLPX 1U2YA 5A94A 1JDAA 3AIVA 3MU7A 3GXMA 2VTFA 4XUYA 3TTYA 5HDRA 1LL4A 4MJ2A 1ZBKA 3AS2A 4HA3A 1H49A 1KB3A 3G6LA 3ZJ6A 2CERA 4V27A 3W27A 4AXNA 3VIPA 2CETA 2WK2A 1FA2A 1TUXA 2BVDA 3VIOA 4BCEA 6A3HA 2W62A 1QPKA 3MS8A 4J27A 3K8LA 1B1YA 4QLJA 3VX1A 3GYCA 4LPCA 5LA2A 4A3YA 5E09A 4JHOA 5A8QA 3WD4A 2GJXA 3FAWA 3LPFA 1QNQA 2YL9A 5E6YA 2J7EA 1Q6EA 2CHNA 4TTGA 2VZTA 4H7VA 2ZUTA 4OOZA 5A2AA 3WDQA 2XVKA 1E70M 3AIUA 1BVZA 2E9BA 3MMWA 4H04A 4PMVA 3RDKA 1HNYA 5BXPA 3LPGA 3ALFA 4RL3A 1HP4A 2J77A 4FLRA 2WYSA 3AMGA 2XSBA 2BHZA 3THDA 1J0JA 2WBGA 4B3LA 1GUVA 4JCLA 5A6LA 2AAAA 2O9PA 2DSKA 1PX3A 3AHXA 1XSKA 3IJ8A 5CLWA 1H1NA 1OIFA 3AS1A 2CKSA 3EDKA 2V3DA 3BXWA 1GJUA 3KL5A 1NWRA 3ZSTA 5FCZA 3ALGA 8A3HA 4N42A 1UH2A 3PHAA 1AQ0A 1TE1A 3SCTA 5A6BD 2WMGA 3WMBA 2HISA 1QI0A 2WMHA 1GOMA 4IM4A 3AS3A 4PMNA 1UD3A 1F4HA 2PBOA 1V03A 1K9TA 1LL6A 4UFKA 5IHSA 4AIOA 2VX5A 2J7HA 4WSJA 1MFVA 1ZJAA 1C92A 3VVGA 4P7LA 4DWSD 3ZIZA 1ODUA 2GJXB 3MSDA 3NSXA 5JIPA 1LLOA 2CEQA 4WLCA 4HU0A 3WQ5A 1QHOA 4QP0A 1BVNP 4KH2A 1CLXA 3AMLA 3WNLA 3B9DA 2WNWA 2E4TA 3VD4A 5JBEA 4GI6A 4P8VA 2YOCA 3ZOAA 1QNRA 4W7WA 3ZJKA 3GBDA 1FHLA 1UZ1A 2ESCA 4C7FA 1XGZA 3AXXA 3WEMA 1K9FA 2BFGA 5KEZA 4Z2KA 4LYQA 2WAGA 2J78A 4JFWA 3PZIA 3RM9A 3OG2A 4PMUA 2ZX7A 3VDHA 2FHCA 2WZEA 1HP5A 4AZBA 1W1PA 3EDJA 3OZPA 4GPNA 3L4ZA 1EH9A 3WF1A 5I0DA 1UR0A 3ARPA 2Z1KA 4LQ1A 1MFUA 3CZKA 4FLQA 3VGEA 4GO8A 1PBGA 1PZ2A 3AQUA 3F4VA 5FKYA 1CIUA 3N18A 2ZXQA 1E3ZA 4HMDA 5CZKA 1E6XM 3NUKA 3TTQA 2O9TA 3BH4A 5IDIA 1V0LA 3PZNA 3VGHA 2EPKX 2QF8A 1GHSA 3AIRA 3L4WA 1UH3A 1LWHA 5EMYA 1DWAM 1BAGA 1CYGA 2VURA 5CPTA 5BCAA 1XD1A 2J4GA 3NDYA 2W91A 3W26A 1TVPA 2DT0A 2UY3A 1J18A 3CIVA 1UR9A 3IK2A 5E0FA 2BY1A 3AIWA 4UOZA 5M3WA 3CO4A 2VJXA 3UG4A 2DDXA 2WMIA 1CENA 1B90A 3O9NA 4TXEA 4U33A 3WF4A 3ARZA 1CXFA 1MW0A 4UQBA 5A2BA 4D6JA 4U2YA 2W66A 4TX6A 2VZSA 1OD0A 3VM7A 3ARTA 2DSZA 4GZJA 4J7RA 1W3KA 1EOKA 5A2CA 4ZEPA 4UFHA 1EDTA 1TMQA 3WEZA 3SCNA 4BS0A 2VUYA 1Y7VA 4Q22A 1NH6A 1UKPA 2F2HA 1HKKA 3SCPA 3WNNA 1RH9A 3BCFA 5GQBA 2VCAA 2WPGA 3UCQA 2D2OA 2J75A 3OLEA 3W37A 2J7DA 1JYVA 1KXTA 1W9PA 1KWGA 2WSKA 4MNLA 1MYRA 1W3LA 2ZIDA 3W24A 2EPNA 2A3CA 2VMFA 5M03A 2OWXA 4D6EA 3TONA 1HJQA 1MXGA 1GORA 4E8CA 5CLTA 4AZCA 2DGAA 1JGIA 2JEPA 1NWSA 3PZOA 3WELA 1BYCA 3ZQ9A 4R5EA 5DT7A 3VD5A 2JF6A 4PMXA 3CPUA 3S2CA 2XG9A 2CESA 3WBAA 1GOQA 5IHRA 2G3IA 1BG9A 5M5DA 1B31A 1CGWA 3SCUA 2DSWA 3WD1A 1R85A 1V0MA 3K46A 1Z32X 3GNOA 1VIWA 1IV8A 3VTRA 1UD4A 3W25A 1UWTA 2G3NA 3BAIA 2IXVA 1JF5A 5D9MA 1VB9A 1H11A 4D6FA 3M07A 2XVLA 2ZXBA 1ECEA 3BAJA 2DIEA 3S6TA 4PUDA 5HOSA 4TX8A 4CD5A 4KMQA 1RD6A 1EOMA 3VPLA 4OJYA 4KGJA 1E6PA 1NM9A 5I77A 4EKJA 1B3ZA 1UQZA 4WKHA 4BQ3A 3WF0A 1CTNA 1CBGA 4K68A 5ABGA 3AJ7A 3T0AA 2YLLA 1E9LA 4D72A 4N0RA 3QHOA 3K8MA 3WH9A 3EDFA 2WZIA 4M8UA 1DTUA 2ZUWA 3WIJA 2V5DA 1UWSA 1BTCA 4W88A 4Z2GA 4AZCB 4NZCA 7CGTA 2W5FA 4CGTA 4FMVA 3RMEA 1WDQA 3OZOA 2VZUA 3EYPA 2OSYA 1GZJA 4X9YA 3K4DA 1NP0A 1NWUA 2Y4SA 3SUVA 4ZXLA 4EANA 2GUYA 4OBRA 4PMRA 3F5KA 2J74A 5TD4A 3VD9A 3I3BA 4W5UA 2WC7A 2WWCA 4OKDA 3M7SA 1GOWA 4YHEA 4QDMA 1LF1A 3BC9A 4F8XA 4GIAA 3VIFA 2BHYA 4XZBA 1PX8A 3A4XA 3FW6A 3VGBA 1V02A 3NIYA 1V6WA 3SCVA 1BF2A 1WE5A 2GFTA 5BROA 5FIPA 4X0VA 4JZ5A 5I23A 1UD6A 3HMCA 4GXPA 7TAAA 2CPUA 1WZLA 3ZR5A 3L2MA 4X0NA 1ISYA 3FY1A 2VRQA 3QHMA 2OYKA 2WSPA 1JDCA 1GVYA 6TAAA 1ESWA 1R87A 4B9YA 4QCEA 3ARUA 3QGVA 2J62A 2XGBA 1LG1A 2WVUA 1HVQA 1BG4A 2DIJA 2PC8A 4CCEA 1WDPA 4V2XA 2J8GA 1VFOA 2J7CA 2D22A 2WCAA 1QI2A 3NSNA 3VGDA 4CU6A 1JAEA 3AHVA 4P8UA 1CWYA 1LQ0A 4AZIA 2IXUA 1PIGA 1JZ2A 1ZBVA 3N13A 2BV9A 3L4TA 4A3HA 1BYDA 1L8NA 3ZJ8A 4AZ7A 2XFRA 2CBUA 5A6KA 2WXDM 3T2PA 1EQCA 2NSXA 4UFMA 5CPQA 2X2YA 1W2VA 1E0WA 3PBGA 5DO8A 3II1A 3WQWA 1B3XA 1H3GA 5D8WA 3AOFA 2YA1A 4NI3A 3MANA 3WD3A 3SEPA 1CGVA 2WCGA 2Y8VA 3RM4A 1F4AA 4JFVA 1GOIA 1KWKA 1OT1A 4FLSA 1QI5A 4C7DA 3VDAA 3WMSA 1V0NA 3U5UA 2UY5A 4GI8A 2Y2WA 3ARRA 4BA0A 4FK9A 2QLYA 4PMQA 4PMOA 3DC0A 1HN1A 1QNPA 5ABEA 1L0PA 1E6NA 3ZSSA 4JKMA 3WFLA 4M80A 1JF6A 3WDIA 1N82A 3VIHA 1VJZA 1E73M 5CQ1A 4AD4A 1JDDA 1W9XA 1OIMA 4MB5A 2CBIA 1JI2A 1B0IA 1OSEA 1KXHA 3W28A 5GPRA 2GJPA 4MTVA 3A6OA 4W87A 4OIFA 1CXEA 1C91A 3KL0A 1PJ9A 2E0PA 4Z2LA 3AYSA 2DSVA 5AY7A 1AQMA 3AFBA 1UD5A 4UR9A 1FH9A 3OGVA 4P7OA 5A8OA 5A6JA 1UWQA 3WDPP 1CXHA 1W1YA 3BAWA 1ZS2A 3A4AA 1XC6A 1B30A 3ZJ7A 3ARVA 5BWFA 3VDCA 3CHCA 2DH3A 1E0VA 3SCQA 1ZU8A 3L4VA 1G1YA 1O7AA 8CGTA 2WMKA 3WH6A 1J12A 3QOKA 1W9BM 1WDRA 1JIBA 4UCFA 4H8UA 1M04A 4W7UA 2JIEA 5F7UA 4GI9A 4AW7A 2CBVA 3D3AA 1GQIA 3BLKA 5A6AA 5BXSA 4L4OA 4EK7A 1BGGA 1HKMA 4ACZB 3W81A 1JZ5A 1FOBA 1YQ2A 3UG3A 4AEFA 2XWEA 2BHUA 1H0GA 2J25A 5D9OA 4P7NA 1E6ZA 2XFFA 3CTTA 1EO5A 2ZOXA 4UFJA 2UY4A 1MW1A 1WP6A 2QV4A 1ZB5A 1XD0A 1EHAA 4WKAA 2FH8A 4PMYA 1BLIA 2C0HA 4CVWA 3A4WA 4W5ZA 4KRTA 1DWJM 2ZUMA 3IAPA 6CGTA 4IISA 4QAWA 4C7GA 2YL8A 5IFTA 2PF0A 1HF6A 1CPUA 3OLDA 1EDGA 3CLWA 2CBJA 4LGXA 5IXEA 1WAWA 1US3A 1QW8A 1E56A 1C8YA 1QNOA 4M82A 3VINA 2W67A 4JFTA 1W9UA 3T08A 2EBNA 2W4XA 1ISVA 4PCSA 3WKZA 3SURA 2DT2A 3AI0A 4MDOA 5ABFA 2EPOA 3M46A 2JEQA 3DHPA 2PB1A 2WANA 1S46A 2CKRA 2PWHA 4W85A 5HBFA 2TAAA 3L4UA 4IPNB 4J3TA 4FF5A 4WF7A 1NP2A 1OGSA 3PZMA 2EO7A 4IUGA 5ECUA 2D0GA 2DT1A 2JE8A 1JD9A 3DYPA 3L4XA 4EAMA 4PTMA 1W9DM 4YN5A 1KCKA 1DWHM 3MUAA 4UZSA 1CGYA 1HVXA 3AICA 1QNSA 4MNJA 1YHTA 4U3CA 1UA3A 4MDPA 1AMYA 4PCTA 4KWUA 5E9AA 2DQXA 1H0IA 3CMJA 1W9VA 2WVTA 1CEOA 1H2JA 3W6MA 2XIIA 4D6GA 2YDQA 1GOKA 4WKFA 3AXHA 2WC3A 2CHOA 2EPLX 4AZ6A 1VFFA 3W82A 1JYNA 4D1JA 2W92A 1BYAA 2V3EA 4PTXA 4J28A 1IT0A 2VRJA 1PPIA 1E43A 5AYBA 4ZENA 3CZEA 1WB0A 1JFXA 1E6RA 1PZ3A 4J3SA 1JXJA 3SCWA 4BQ4A 4B3KA 3HN3A 2PWDA 3THCA 3RM8A 2XIBA 3W6LA 3VMPA 1VFMA 2W61A 2XSAA 3VD3A 5BRPA 5BRQA 4D1IA 1W3JA 5EFFA 4IPLA 3EMCA 3ZR6A 3WDJA 2FDMA 5AYIA 2EJ1A 4GZIA 3VDBA 3OLIA 2V38A 5GNXA 2ZUSA 2B31A 1V08A 2Q8XA 4DM2A 1EIBA 4MPKA 3VIMA 3SUWA 1OBAA 1QI4A 1DEDA 1R86A 5C70A 2NW0A 4XX6A 2D23A 5A8PA 3D5HA 2XVNA 1RPKA 5CG0A 4E4PA 3FAXA 2X09A 1H09A 1JL8A 5FD0A 3AZSA 2ZX6A 3VIIA 3BGAA 4WIWA 3MSGA 4H41A 2WWDA 3AZTA 2VVNA 2J7BA 1E71M 4CN1A 2CYGA 4OZOA 1E4IA 3N11A 3OGSA 2J47A 3K4AA 1UR8A 3J7HA 4S3JA 1U30A 1OWQA 3CZGA 2GVYA 3WUBA 1R7AA 4J3UA 5A8MA 3ZM8A 3WD0A 1E5JA 2Y8KA 1LL7A 2GDVA 4ZE5A 2O9OA 4TUFA 5A6MA 2WHJA 4GINA 2ZWYA 3MMUA 1B3YA 4FLOA 1V3JA 3VNZA 3AMDA 1FFQA 5LYRA 2OSXA 1RP8A 1UKTA 3MUY1 4U5IA 2X1IA 2WMIB 4GO9A 3WD2A 4AY1A 4JHZA 3U7BA 1TA3A 4UQCA 1J0HA 3CGTA 2IUZA 4GKLA 2VC9A 4HA1A 2EQDA 4OOUA 1LJYA 1E40A 3WNMA 2G3MA 1C93A 4UFLA 4JL2A 2EXOA 9CGTA 4CKQA 1EHNA 1OD8A 1TCMA 3APGA 2QMJA 5CGTA 3VGFA 3MV11 1JZ7A 4EE9A 2FHBA 3AHYA 4D6DA 3WEOA 5DF0A 1NARA 1I1XA 2WVVA 4MB4A 1BHGA 2CCRA 2XVPA 1ZBWA 5C8BB 3BCDA 1I1WA 3EDEA 1TVNA 1W2PA 2A3EA 3GH4A 1WCGA 1D2KA 2C8NA 2QPUA 1Q4NX 4XZWA 3PTQA 1XH2A 1MXDA 3UR7A 4URIA 1KGXA 2AMGA 4ZFMA 3WNOA 3ZT7A 3OIHA 3FN9A 2WLYA 2F8QA 1E4LA 4Q7NA 4B15A 1JYWA 3WDRA 4AIUA 5A8NA 1HL9A 1UD8A 5EBAA 4W8LA 3DYMA 4OBSA 1CLVA 4PMDA 4A4AA 4Y7EA 1VEOA 1UZ4A 3MV01 4MB3A 1GONA 1J0KA 5I78A 2ZXDA 3WL0A 4ATWA 1VFUA 5A69A 4MB1A 3UG5A 3WBEA 2XM2A 4HPHA 1ISWA 1E6SM 2WW5A 3SUUA 1KFWA 1VEPA 1J0YA 4YPJA 4AIEA 3ARSA 5HPCA 1B9ZA 2X8RA 3QOMA 1JYXA 2WVVB 2V3FA 5FOOA 2GK1A 1B3VA 4PTWA 3B8SA 1HJWA 2PWGA 1MW2A 1XYZA 1W32A 3RO8A 4XB3A 7A3HA 1E4NA 1EXPA 2WM0A 4W89A 3GDBA 3LMYA 3OB8A 3WY1A 1UWRA 1UR1A 1KBKA
chains in the Genus database with same CATH superfamily
2FKPA 4MAZA 4MWAA 1D7FA 3KL3A 3I7RA 4Q32A 1XIDA 1JPDX 2JKAA 2VX7A 4JCMA 1UA7A 3GM8A 3AISA 1S5MA 1YRRA 2GZXA 1OGBA 4IJRA 1OM0A 4QLLA 3CZLA 4W7VA 4DUWA 2OU4A 1SJAA 5E70A 3LM7A 1UOKA 1IWBA 3CB8A 4ZE4A 3WQVA 5IBXA 1M7XA 4JFSA 5KZDA 2VGBA 3OVGA 1GJWA 1ALDA 2O4QA 1X6LA 4Q3MA 1EKOA 3CH0A 1MRQA 2I56A 1Q7QA 1NOFA 4H6EA 4KCVA 4Z0JA 3VIJA 3ITGA 2QW5A 1QCWA 2WV8A 1FWIC 1TREA 2XVGA 4FR1A 3MSRA 4FOJA 3L23A 1XIIA 3EX1A 5T91A 3RCYA 3NO5A 3GG0A 3BV4A 3G1AA 4RXFA 3VGGA 3GG8A 5C2CA 2OO6A 2YZRA 4HT3A 2Q8LA 3EX3A 3C2EA 2ZA1A 1HKJA 2Y5EA 5C5YA 3TC6A 3SSZA 3PTKA 2WVSA 3WQFA 3PM6A 3P80A 1ZTVA 4J3WA 4UB9A 1IEXA 5T9BG 1MI3A 3F2BA 4JGDA 5HUOA 2PLJA 1GG0A 1EB3A 3WDHA 1EJWC 1MQQA 4MADA 4GVIA 1IYXA 5FJUA 1QU4A 4Q4SA 4KEUA 3CU2A 1EFZA 1Z69A 2GGJA 4HA4A 4EF8A 3LN3A 2ISWA 1TJPA 3GTNA 3CH9A 1OT2A 2VX6A 5CPSA 2Y62A 4CNTA 4EOUA 4AD1A 2VWTA 3KHJA 1XBYA 1IZKA 5TF0A 1HX0A 2A3AA 1EA0A 2GGIA 4L7ZA 2WCSA 3OA5A 3H6OA 1K77A 2Z7KA 4LVFA 3B9OA 4HHHA 2F6UA 4Q4RA 3W38A 2HV5A 3OQEA 2X0HA 4AZHA 3PC0A 4FIQA 3WH5A 2F2KA 2C19A 3LHYA 4CQAA 3P2VA 3KWXA 3AXIA 1EGZA 1OCQA 4LCSA 2V5CA 4XV0A 4JAWA 2WMJA 1FWDC 2W6RA 2P5NA 4PSPA 3GR8A 5D4YA 1J0IA 3MKKA 3FJNA 3NYDA 3KZSA 2FFCA 4XZMX 4KIEA 2DSUA 3GE7A 3TXZA 1OF8A 3T05A 3VOGA 2X0YA 3UWZA 3PZTA 5EY5A 1FX6A 4JTFA 4Z0SA 5FACA 1C3FA 3G22A 3M0JA 4JTTA 1UJQA 3OBAA 2VGIA 1JXKA 4KGLA 3URBA 5IBXC 2E6FA 5AC5A 3CZ8A 2G96A 4O13A 1TSIA 1IXOA 4LB4A 3A3HA 4QM1A 1V3IA 4MAVA 3WF2A 2X41A 4UFIA 1ITUA 1UKQA 4CD8A 2VDGA 3VKDA 2D69A 2DUXA 3B03A 3NCOA 1E0XA 3WNKA 2XGIA 1NOWA 2Q6ZA 5I09A 4X63A 3IJ7A 3VU2A 2GSJA 4UTTA 2QJIA 4PMZA 1ISZA 4DI9A 4KFOA 3QN3A 4US5D 4C6FA 2OWWA 5CZ0A 1M3UA 5CBIA 5A95A 2YBUA 4TOQA 3REQA 3LCWA 4JTJA 2A3LA 1WBJA 3WMLA 4JEJA 1R38A 2UV8G 4BZYA 4RDYA 3COTA 1VBUA 3H2AA 3GU2A 2Q02A 3DECA 2ATMA 1M01A 1WPCA 1NWTA 3UXKA 1Q4WA 1RR2A 2PLMA 3SIMA 3NM1A 4UBPC 4GZEA 2PZ0A 4KEZA 4HPGA 5HJYA 2DPEA 2VHLA 2TRSA 4RPPA 3PZUA 1FWGC 2KZHA 3T09A 3TSMA 3IJQA 4ZOEA 4HOZA 4EPEC 1GHRA 4S3FA 1Q6FA 1VEMA 3IJ6A 1JNDA 1XLBA 1XYMA 1TV3A 1GCYA 3HQPA 3OLGA 1G4PA 2FMNA 1F7BA 2JF7A 3T9PA 4CQDA 2OFJA 3UWVA 3AMKA 1E6QM 2HZGA 3URQA 3MI3A 1C7SA 1OFOA 1CGUA 4PC8A 1AZ2A 1S2CA 4MWAD 5AB3A 4ZXOA 5FL1A 4QG9A 5EU9A 4PB5A 1OYBA 3HGRA 3WSUA 4BQ5A 2ZA3A 4S3BA 1M5WA 2YL5A 4RJEA 1FWHC 3T4WA 3SY8A 3WJYA 3TMLA 3W7MA 1QBAA 3GH5A 1KQYA 4WDWA 2Z7GA 4GC4A 4D6HA 2YX0A 2GGGA 4QDWA 1M9HA 3S8HA 1I2PA 4RZ4A 1Q8JA 3R25A 4F2UA 3CV1A 3TEVA 1VLIA 2J6XA 1VYSX 3W4RA 4AZGA 2BVTA 3HO8A 3PAJA 1IR2A 1K7EA 5HANA 3STGA 3GS6A 5I5RA 4MSSA 1MUWA 3DU0A 2ACUA 4M29A 1MVYA 1BQCA 4JIQA 4AZ5A 2PD9A 1EO7A 3UVAA 4AC7C 1V8EA 1SYTA 2NV9A 4JTIA 3WL1A 4RR4A 2WSYA 1EUNA 1KNWA 1PKNA 1KBLA 4PBGA 4WSHA 3NQ6A 3QR1A 2E9LA 4RE3A 5D8ZA 2PMQA 3CL6A 4P7QA 4GXWA 3NZ1A 1A3HA 3GNRA 5GJPA 1JNEA 1FWCC 3RILA 3TTSA 4LANA 3RLHA 1LCOA 1UMLA 1TKKA 3SCSA 2BODX 1B2YA 2DV0A 1W6TA 4HOWA 3P60A 1Z7AA 2BOEX 4JNMA 3WK2A 3WQGA 1MQRA 2B7NA 1OFPA 1H41A 5AHIA 2GJLA 2J7GA 1VBRA 3U57A 5J5DA 1U5JA 1M53A 1JEZA 2Y7GA 1KGUA 1OB0A 1AK5A 4XD3A 4CCZA 4M7TA 3WUGA 4PR4A 3LTYA 3KOYA 3RU6A 4HZ7A 3EMZA 4YTQA 1DWIM 1CCWB 2R1MA 3NZQA 2QCLA 1D3CA 4NG3A 1NQ6A 3QY6A 1XKYA 4L6HA 4QFUA 3OP2A 1SR0A 3R58A 3AYVA 3HV9A 4XTDA 4K8EA 1XLEA 3SN1A 3OYZA 3CUIA 3PUEA 1L2QA 2XFWA 3RJXA 4GUHA 3MUZ1 3N34A 2XINA 1K4HA 3PSWA 1G4EA 1LT7A 1ZL1A 4NRRA 4X60A 4TVDA 3NDZA 2VOTA 3HPAA 2O0TA 5CJ5A 4IF2A 1WZAA 4XKYB 4QEEA 2NXIA 1OYCA 4BF5A 3OVQA 1DIKA 3RGTA 3CHDA 4D71A 5XIMA 3VIKA 2NQJA 1W91A 1E3XA 1WOAA 3QKZA 3GH7A 5D04C 3M0LA 3BDKA 4N7QA 5CKSA 4JFUA 1QI3A 3BARA 3EWCA 3LHTA 3ITTA 1DVJA 4LUTB 4LV9A 2ZE0A 3APYA 2G97A 2VL4A 5IRPA 2FZ9A 4PGLA 2B7QA 3N14A 3NZRA 4XSMA 1H7NA 3GXDA 4AYSA 5CPLA 1A47A 2CNCA 3FIGA 3SY1A 1DJQA 2AOSA 3IS4A 4W93A 2POZA 4E4UA 3POCA 1JZ4A 1XICA 5F4XA 4IFRA 1W54A 3W29A 1J2WA 2WBKA 3WJZA 5CSUA 2BWGA 3EBVA 2C79A 1HG3A 1TTIA 2OG9A 4W8AA 1WZMA 3WQEA 2G41A 4DWSB 4I5UA 3CC1A 3QM3A 4ERGA 4UTFA 3CAVA 3EWYA 2PZNA 3W22A 3S9YA 3G0SA 3MVIA 1S2WA 3KDNA 1LZOA 3UR5A 3LZ3A 3O2LA 3ZWTA 4O18A 2QR6A 1MMFA 1DWGM 3VOCA 4O11A 4L4MA 1JGMA 4E38A 3EWXA 3IV8A 3OHMB 2OXNA 2BG5A 2G8ZA 2RDTA 1XM3A 2AQWA 3DN5A 2C15A 4LTSA 4DBWA 2QJNA 3ZYZA 1PAMA 1EF3A 1RCXB 4H8NA 1ZSXA 1X6NA 2PGRA 4IMGA 2CITA 4O8AA 1XLHA 1A3WA 3MHUA 4JDBA 4JQAA 3MP5A 4CVUA 1I75A 5BYWA 1J11A 5H6HA 4UQAA 1KM1A 1VBGA 4H9YA 3M7WA 2WJEA 4Q7BA 2JK2A 2OLHA 1K8YA 2Y7FA 4GVHA 4HU8A 1PIFA 4CU7A 5KTLA 3CQJA 3TA9A 4WJ8A 2HXTA 1E0UA 4S3DA 3S9ZA 4XBKA 1I6NA 3M6YA 4HZ6A 3GVWA 3LPPA 1V3HA 1V5XA 2VCCA 4LBRA 4MKVA 3N73A 1YTDA 3AIVA 3PBVA 3B97A 3MU7A 3RO6A 1Y0EA 2VTFA 3TTYA 2INZA 4C6OA 3UXIA 4HA3A 1H49A 1KB3A 3G6LA 3KP0A 1BVWA 3ZJ6A 2CERA 3W27A 3VIPA 2CETA 2MUCA 3L5AA 4IWWA 4IP4A 1J8VA 4X2PA 1QPKA 4NXKA 3W7GA 1VC4A 4NJIA 3VX1A 3GNDA 2QJGA 3ZZ1A 4CEUC 4F0SA 2QVHA 3TQ0A 5E09A 1XJBA 4A21A 3VFCA 3WD4A 3ITYA 2YL9A 2J7EA 2C16A 2VZTA 3PS7A 1EX1A 1XR2A 4YVPA 1PXGA 1RSCA 3PY2A 1KA9F 4XZIA 2I57A 1E70M 1OK4A 2PC4A 3D47A 1WXZA 2A6LA 1GKPA 4HSNA 4N02A 1T8XA 3RDKA 2FPYA 2G3FA 1MDRA 1CW2A 3U9IA 4YTUA 3G77A 3W7OA 3AMGA 2XSBA 3O05A 3THDA 1J0JA 3MYOA 1ZRQA 3CQIA 2OZTA 1PX3A 2R6OA 4QR6A 1H1NA 4QJ3B 1DJWA 3ZSTA 4NZ5A 5FCZA 4MIMA 3ALGA 1UH2A 1IR1A 3PHAA 5FAJA 3NQ8A 4F3HA 3SCTA 1EP1A 1QI0A 3MUCA 2NLIA 4Q7IA 1L8PA 4Q8OA 5IHSA 4AIOA 4ZSUA 2VX5A 2Z1XA 3VVGA 3ZIZA 3MSDA 3NSXA 1EWDA 2QF7A 4HU0A 3WQ5A 1QHOA 4UIOA 3N29A 1RHCA 3W1RA 3C8NA 4Q6JA 1CLXA 1V4YA 2ZRUA 1GYLA 2YOCA 4FX7A 3UZXA 2C1GA 3AXXA 3TCEA 4J2PA 5KEZA 3TYAA 3LXBA 4LYQA 3R89A 2WAGA 3GTIA 4F40A 1QATA 4S38A 3ITXA 3IUDA 5U4NA 4WXYA 5EL1A 5HA7A 3EDJA 3OZPA 3EWZA 3XISA 1EH9A 5I0DA 3ARPA 4E6MA 3UNTA 2P88A 3VGEA 2FYMA 1PBGA 4JYEA 4B3ZA 1PO9A 2OZ3A 3N18A 4NQ1A 6REQA 3KTSA 3FYPA 1TV7A 5CC3A 3WFAA 3VGHA 4E2VA 1GHSA 1UH3A 5I06A 1LWHA 2PTDA 1DWAM 1CYGA 2VURA 2A7PA 3EWDA 5AHMA 1DBTA 1JCYA 3VI2A 5HWJA 1TVPA 2DT0A 3CIVA 4ZTXA 1OYAA 1IXNA 4DIAA 3CT2A 1TUFA 2VJXA 1TB3A 3MKCA 1SSDA 1B54A 2CLLA 3MWCA 2DU2A 1H50A 1TX2A 2FTWA 3UG4A 2DDXA 2WMIA 3O9NA 3I10A 1EF2A 4OUIA 2ZVIA 1IGSA 2Z0IA 4FNRA 3G2GA 2VZSA 1OD0A 3MT1A 1TPVA 3VM7A 4C1KA 1TZZA 3R1ZA 2DSZA 1W3KA 5A2CA 1SO5A 4GNVA 4UFHA 1EDTA 3WEZA 4MF4A 3S2NA 2VUYA 1YXDA 4I6KA 5I07A 4NU7A 1SW0A 1ZALA 2QAPA 3BCFA 4L9ZA 2VCAA 2WPGA 3NGFA 2YBVA 3HMJG 1IEWA 5PTDA 3C3NA 2E28A 4ORIA 2J7DA 4N9BA 4HNUA 3T55A 1W9PA 2ODOA 4A05A 1S5VA 4MNLA 1ZUAX 5M03A 1YE4A 3H2NA 9RUBA 1HJQA 1VIZA 1MXGA 1W8SA 5CC5A 1M68A 1NTHA 1NWSA 3PZOA 1BYCA 3ZQ9A 1FDJA 4R5EA 5B7ZA 3VD5A 2ZC8A 2O4MA 4HK6A 5M2FX 2XG9A 3ONBA 3W73A 3UZYA 3G1DA 5FJTA 3G8RA 5LIKX 4RDWA 1V0MA 3LNMA 1VCVA 3GO2A 1TPDA 3GNOA 2C14A 2IPJA 1L6SA 3E9AA 1UWTA 4IH3A 3V0UA 1RK5A 2IXVA 4A22A 1LUCA 3S0CA 3HF3A 4GJJA 2QUTA 3FJ6A 4KMQA 5EYWA 3OBEA 4AHPA 3W87A 2PD5A 1REQB 4KGJA 3L0GA 4EKJA 1LYXA 5FF0A 1ADSA 4JTDA 4AVNA 4WKHA 1GVEA 2BGNE 5ABGA 3AJ7A 2FTYA 3THQA 2WJDA 2YLLA 3T0AA 1ICPA 4N0RA 5CPNA 1FWNA 5LGXA 3EDFA 3R11A 1RY0A 4M8UA 1DTUA 3E2QA 2V5DA 3MCNA 1ZQ5A 1JUEA 2PTZA 4C6NA 3W7DA 1CX9A 3STPA 5DMMA 4DJFA 1W56A 4BI5A 3EZ4A 4X9YA 3K4DA 3KS6A 3SUVA 3ERPA 4JTRA 4X61A 5HK4A 4TX9A 4MWAE 2PDQA 4O19A 3B8TA 3WQPA 1OFRA 3M7SA 3L67A 1GOWA 4YHEA 5EMJA 3GUWA 2MNRA 3VIFA 4C6IA 3A12A 5FF3A 3UW6A 4QJ1A 4UMBA 1WOBA 3SADA 3SCVA 3BZGA 4CNNA 4I7WA 5TAOA 2Q3OA 4UR8A 3G1HA 3W70A 3M5VA 4BEQA 1WZLA 2CZDA 2Q09A 3L2MA 4X0NA 1ISYA 3FY1A 1OCNA 2OYKA 3FS2A 2WSPA 4A35A 4HCLA 3OTRA 1I9CB 4Q8PA 3TYBA 1YPIA 3QGVA 4L1GA 3PVFA 2J62A 2WVUA 1HVQA 3TIMA 1BG4A 3CQHA 4R53A 1WDPA 4V2XA 2YB4A 2D22A 4J40A 2WCAA 5D03A 3WLPA 2PP1A 3A4JA 4ROQA 3AHVA 1CWYA 1XLMA 4AZIA 1TYGA 3OIXA 5BW6A 1DJGA 1PIGA 2IS7A 2BV9A 3ZXWA 4LT9A 4A3HA 1BYDA 2VGGA 3RF9A 4ONVA 3VNMA 5A6KA 2VEKA 2NSXA 5DQPA 1BWKA 3UD6A 1W2VA 3Q67A 3II1A 1VYPX 5D8WA 1ENUA 3WD3A 1EJRC 4JDYA 4MZYA 1GOIA 3L65A 1OT1A 2WNQA 3OQ8A 2F7FA 3U5UA 1RALA 3UYCA 1A0EA 1M7PA 4DF2A 2Y2WA 4IZGA 4I8DA 2BLEA 4PMQA 1WKEA 2WM1A 1HN1A 5ABEA 4JN8A 5IDZA 1IE7C 1A5MC 1NVMA 1P0DA 1E6NA 3PK7A 1X8CA 2QEZA 2JBMA 3TOYA 3DKJA 4M80A 4TU1A 3WDIA 1N82A 2VENA 3VIHA 1XLJA 3QVQA 3IIPA 1E73M 4GACA 2CWXA 1KM3A 5AHLA 1W9XA 1OIMA 4MB5A 3WLQA 2GDQA 1KXHA 1VJIA 4QIUA 4W87A 4R34A 4XIMA 4NX5A 4DJFC 3HB9A 3GRIA 1EJ7L 3GW3A 4C1NB 3KW3A 4A2RA 1FH9A 4F0MA 1F61A 3V16A 3RITA 3A4AA 2GQ8A 3IIOA 1RBAA 1XDMA 1B30A 3ARVA 4WCJA 1F76A 3L4VA 3QBUA 3CQKA 3U8GA 4JTHA 1Q6RA 4I9AA 1KC7A 5CSRA 3WH6A 1TJ2A 1K4GA 4W7UA 2KAUC 2JIEA 1XUZA 1J96A 1XBXA 4LSBA 5BXSA 1BGGA 5AHEA 1EGMA 3W81A 1JZ5A 1FOBA 4G9PA 5AHNA 3UG3A 2IKHA 1TTQA 2PCEA 4P7NA 1E6ZA 1ADDA 1MEWA 4DF0A 2XFFA 1N2VA 3SGUA 4J35A 1JDEA 2GWGA 2PTXA 1XD0A 5FEZA 2ZVRA 4KS0A 1EHAA 5LGZA 5DCBA 1R3YA 4PMYA 2CLIA 2C0HA 3A4WA 4B5SA 2VXNA 4JX4A 2X7VA 1KFEA 4G5DA 4KRTA 1DWJM 3IAPA 1K02A 2Q3RA 4IISA 2I17A 3OYXA 2PF0A 1QPQA 4TIMA 1CPUA 1YDNA 4LS0A 4RX0A 1XKJA 4H9UA 3H7UA 2J13A 4NP7A 2I9UA 4JIHA 3S83A 1JCXA 4JIPA 3M46A 3UPBA 2JEQA 2PB1A 2WANA 3QYSA 4W85A 3L4UA 4IPNB 1VD6A 3RLUA 4A8NA 1TPC1 3NTYA 4HYWA 2NX3A 1EP3A 2EO7A 1I2QA 2D0GA 1QRQA 4DJFD 3NPWA 1F73A 3L4XA 3WO8A 1XC4A 3EX6A 1QPOA 1HVXA 4MY8A 4PE8A 2OGJA 1YHTA 3GUGA 3W7JA 2FDSA 5E9AA 2P3ZA 4L56A 3JR2A 3PJUA 3T0TA 3LA4A 1Y5XA 2BB0A 2XIIA 3TJXA 3H4WA 4D6GA 3WZ0E 6ENLA 3FDKA 1UUOA 4D8ZA 4O52A 2A6NA 4NX0A 3DBNA 1JYNA 3S5YA 1PYFA 3BOFA 4PTXA 5REQA 1DJNA 1I2RA 1YDOA 3DX5A 1TPWA 3DGRA 4IQDA 4PEKA 1PZ3A 3A23A 2HE5A 3H7RA 4QROA 4B3KA 2XIBA 3ZFHA 1YBQA 2NWSA 3BG9A 2NVCA 1VFMA 4GISA 3CAKA 4D1IA 3QPYA 2PDPA 1VHCA 2FDMA 4WVXA 3LG3A 3VDBA 3GHSA 4AVFA 3EB4A 4I90A 1JQVA 3SUWA 3QLLA 1OBAA 1QI4A 1DEDA 1A80A 4U4MA 1EC7A 5AECA 2XVNA 1GEQA 5CG0A 1XW8A 3FAXA 1H09A 3F1QA 4MY1A 5C2GA 2ZX6A 1RLDA 2WO5A 3IK4A 3BGAA 4WIWA 4FR6A 4X3ZA 2J7BA 5H8UA 1BXBA 1FCUA 2ISFA 3TAOA 1A5CA 2W79A 4OZOA 1E4IA 4MJZA 3K4AA 1EEPA 2X1TA 3PPCA 4B92A 4S3JA 4L64A 3WUBA 2GVYA 4J3UA 3SGZA 5HWNA 2OCZA 3ZM8A 3WD0A 1E5JA 1T99A 3OBKA 3E0WA 2O9OA 3HG5A 4TUFA 4Y8EA 4CNPA 4GINA 1JVNA 2QV5A 8RUCA 3MMUA 1B3YA 1J93A 4FLOA 4NZFA 5LYRA 2CLMA 2OSXA 1RP8A 4JQ4A 5CBBA 2ZA2A 1U5HA 1WXYA 3GTFA 2HK1A 3LI0A 1R2SA 4NI8A 5F4WA 4AMAA 3ABXA 4GCAA 1C29A 4GKLA 2Y5JA 4HA1A 4XAZA 2YYTA 1SFLA 2VEIA 3N3MA 3T8LA 4CKQA 3APGA 2QMJA 5CGTA 3VGFA 3JZEA 3BOXA 4LUTA 3GK0A 3FYYA 2X0SA 2ZRVA 4FF7A 1KBIA 1AH4A 2YCLA 4RPQA 2XVPA 4WY0B 3BCDA 7TIMA 1I1WA 3EDEA 1D2KA 2QPUA 1Q4NX 4XZWA 3PTQA 3AO0A 1QK2A 1MXDA 3UR7A 3DHFA 3DZ1A 2VP8A 3VXGA 1PVNA 4I5RA 3TJIA 3ZT7A 3FN9A 4H3DA 5HATA 1GT8A 3PUGA 4KKXA 1JYWA 2Y70A 2PDNA 2V30A 4C6QA 1CLVA 1PV8A 4IMCA 1VEOA 1UZ4A 2VEMA 3B40A 5I78A 4BFAA 1VFUA 3N2OA 5A69A 1BSLA 3WBEA 1J4EA 1M7JA 2NVAA 2NX1A 4I9TA 1VEPA 2A5HA 2XDFA 3T6CA 3QOMA 3TR2A 1ZAIA 1N8WA 1TPH1 4GWEA 2V3FA 3V5OA 2EJAA 1XYAA 1B3VA 3GZ3A 1F8MA 1WQ5A 1J6OA 3HFTA 1IQ8A 4JS3A 1EXPA 4AUBA 4IHCA 5LNUA 5JXQA 1O4UA 3GDBA 3T42A 5RUBA 4FP1A 3PG9A 3WLHA 3VE7A 4MYXA 5TQLA 4G7FA 2PU0A 3R0KA 3UYIA 4BI6A 4H2CA 1ZLPA 5J8LA 1A0DA 4NHVA 2PWVA 5DBUA 1PTAA 3LSCA 2CHRA 3KHDA 3LLXA 4AEOA 3MUIA 1EPVA 1OINA 1UASA 3GDRA 3QC3A 1Q6CA 4M6QA 1B9BA 3TW6A 1PYMA 2GSHA 3CUFA 2P0OA 1PDYA 1C90A 3RR1A 4XD5A 2PDBA 2E8ZA 3S9IA 2YFNA 4E5TA 1ZBCA 3PG8A 4A8RA 3HJZA 1AQHA 1ZPTA 1LQAA 4WGXA 1A0CA 1Q6OA 2BXYA 3CEPA 1R8LA 4Q8NA 4GBUA 1TR1A 4E2BA 3TTOA 1G5AA 3PWGA 4GX9A 3RIKA 1IT8A 3P81A 4OGZA 3G3DA 3SR7A 1AG1O 3TQKA 3NQMA 3VA8A 4Z2JA 4WOZA 3VE9A 2WKLA 3QMSA 4C5YA 2QDEA 3F5LA 3FXGA 3AIBA 4PCNA 4PL2A 1A49A 3R4IA 4L80A 3CPGA 4FB7A 3KBMA 3I3DA 1U33A 3V36A 3B9EA 4MLRA 2NXGA 1UC4A 3LPOA 3QSTA 4HBKA 4S3CA 4QLKA 3WLNA 3M64A 3S6OA 1HTIA 3VKAA 3DGBA 4MWAB 4U31A 1D3GA 1XBZA 3VC6A 4GX8A 3TOPA 3ABZA 1GZGA 4TV6A 3OZYA 4DWSC 1YX1A 5AKQA 1OJXA 4PRTA 5I24A 1I2OA 3QZEA 3QPZA 1D9EA 3DI0A 2GDUA 4GIRA 4NT0A 4N6FA 1W1TA 4PUKA 4PN2A 1DV7A 1IEQA 2PWUA 4UZUA 3BANA 2CZEA 1CGXA 1U1HA 4XSLA 4HN8A 1HJVA 1DQWA 1XCXA 3KVMA 3RJYA 2YLAA 5CC7A 1QMLA 3L4YA 2Y8UA 1GPWA 3B4UA 1IZJA 1XIJA 3QR3A 3WUFA 4ZL1A 3BQ5A 5JBDA 3VKCA 4LRTA 1C7TA 4PUEA 1W5NA 3BSMA 3UWWA 4ORMA 3UBPC 1W37A 1TX0A 1LP6A 3R2GA 1PX4A 2O9RA 2EG7A 3FXYA 4CUCA 2XIJA 4ZQNA 3VZZA 2ZUNA 3KXQA 1SZRA 4CD6A 1YE6A 4DYJA 2WQDA 2XPKA 3MDWA 3LZ5A 3H2OA 4DBUA 3WJXA 4GJ1A 1P6BA 3E1F1 1TE6A 2EPMX 5JH1A 4XZLX 4UQEA 3W1TA 1FH8A 1LM1A 1QOXA 3B8UA 3WH7A 2WKGA 3P93A 4IIFA 4FS9A 4RLIA 1AA1B 5BWAA 4BI7A 1KKRA 2CW6A 3ARQA 2C7FA 2BY0A 5CPOA 3CV2A 1GQKA 4IPJA 4NRSA 4DPQA 3HM7A 2XH2A 4WXZA 3V1HA 5AC4A 1K03A 4OWGA 3W7IA 3MA8A 2ISDA 3N1AA 2BNJA 4AD5A 1KFJA 3EMQA 4KERA 1G4TA 1LLZA 3R12A 4UTKA 4JTCA 3LD5A 3TQVA 3NURA 4OV4A 3UJEA 2PI6A 1J01A 1XH0A 2ZX9A 4NF7A 5A1AA 4YU1A 1HIZA 1ITXA 2D2GA 1KXVA 3GNXA 1SW3A 1G94A 1Q13A 1QUMA 3RPMA 3MO7A 1HO1A 5CZTA 3BLIA 1OFAA 3CMFA 5AC7A 4R27A 3UFYA 3S46A 4L1XA 1KXQA 4TVCA 4AMCA 1AL8A 3EXRA 3NQDA 1J6PA 1C8XA 2PDKA 2B7PA 3TW7A 4KFNA 1DXIA 1FBAA 2NUYA 3DFNA 3RLGA 4EIVA 3S5OA 3TP4A 1DORA 1KGWA 1HFBA 4FSAA 3IIVA 1Z8AA 1KR0A 1TJ1A 1XFBA 3FNDA 1HKIA 1ICSA 4GABA 5M1TA 4O10A 2JFEX 5HPOA 3P7YA 5HNNA 2D1ZA 4ZGYA 1NFBA 2BGQA 3E5PA 1WZKA 4HMEA 1X1NA 3ABSA 3PZQA 1ZY9A 3NL3A 1NDYA 2J9YA 3RX3A 2XM1A 3GG1A 3FEQA 5JVLA 1O5RA 1LQ2A 4AXKA 1WAUA 1HL8A 3RAOA 5LA1A 3C2VA 1EQPA 4QCFA 3N12A 1FHUA 3W00A 2E5BA 3BAXA 2NV1A 2QCHA 3JRKA 1ISXA 3OEXA 4AWSA 5G1MA 1ZAJA 2DJLA 2J9XA 2QCEA 1DJXA 2VNCA 2REQB 3W83A 2P3EA 1KLYA 3USZA 3DESA 1ODZA 1REQA 2Y63A 3G8EA 5E0KA 4PUUA 3CHVA 1ZJBA 3LY0A 1YADA 3C5QA 2DH2A 3D6NA 1WNOA 3NVTA 1RPXA 5DMLA 4D6CA 3NJ3A 2A4AA 4PYSA 4QNEA 2XISA 1Y5WA 3VCNA 1VFHA 3GDLA 1XH1A 1SO4A 2PTYA 4JQ2A 3W72A 5CH9A 4E3VA 2XJ7A 2G4FA 4M56A 1IZCA 1LBMA 2FHFA 3LRKA 3WNPA 3M16A 2HTMA 1CECA 2GVGA 3QTGA 2WHMA 3INPA 1VZWA 3TN5A 1O5KA 3VNIA 2DZAA 4QTGA 1Q85A 1LORA 4R9XA 4F79A 3IACA 2BS9A 1DTNA 2YCJA 2NUXA 2X05A 3BJSA 1WDSA 2GGHA 1H5VA 3KRBA 4PUWA 3MPGA 1QVBA 4E8DA 4RDZA 5IOBA 1NEYA 2DW6A 1EPXA 1A5BA 5JMUA 1XCWA 4S3GA 4HMCA 4LYPA 4ZQMA 3L66A 3D46A 4MFDA 4YHGA 4UOJA 1BQGA 4RE2A 3PULA 4FNPA 3BAKA 3EX4A 2OYMA 3N4AA 3IUIA 3IAQA 1HXJA 2QJHA 4MMWA 3IWPA 3A47A 1UIPA 3VD7A 1K9DA 3GIQA 3W2KA 2Y7DA 4FNTA 4ML4A 1YNPA 4AWUA 2O7QA 3WQDA 1XXXA 8XIAA 4PFHA 2FGLA 3P3BA 3IJIA 1XRSA 1E4MM 5G2HA 4L9XA 5KZEA 4AX7A 1DE5A 2OWCA 3W0KA 3GXTA 5K9DA 2DZSA 1VFLA 4XK2A 3H2CA 3PPGA 1NIUA 1BYBA 1MNZA 2DY3A 2EG6A 2QUVA 4GC3A 3EDDA 4N9EA 2RFGA 3E96A 2EPHA 4KRUA 3UQNA 3TYUA 1JPHA 3GXFA 2A85A 3PTDA 4ZR8A 2Y89A 4JIEA 4MM1A 2D3NA 3HQOA 5I2UA 3BE7A 4IP7A 4WSKA 4HJWA 2CLKA 1Q6GA 3JUGA 1JFHA 1NDZA 1TFVA 1DXEA 1NJJA 3SFWA 3F4NA 5CSYA 3GD6A 3ITCA 1U83A 4CCCA 5HMSA 4OU1A 1B3OA 3O3RA 1RP9A 4KIRA 3FHQA 2WKJA 4RE4A 2ON3A 2EGZA 3EOSA 1UUQA 3NO3A 1ZCOA 2B4GA 4CNSA 2WHKA 1KR1A 2CLEA 3CUHA 3VOJA 3FFSA 3TTEA 1SJCA 3UR8A 3MZNA 2D0HA 3VM5A 1XG3A 1DIEA 3MUXA 3EWBX 2VR5A 5DFAA 2YDSA 3W23A 1GOXA 4GQRA 3QZ6A 3MCMA 4M51A 4ZQPA 3EKZA 2X2GA 2YJQA 3KLKA 2DUZA 2QPSA 2I16A 3AIQA 3KVKA 3TQPA 3CXOA 3TYDA 1V6XA 3QY7A 2XFYA 1W3HA 4Z2IA 4JKKA 2E9MA 4DO4A 4UR7A 1W5QA 1HT6A 2JKPA 1E1EA 1QW9A 3G1VA 2RGLA 4O16A 3QXBA 1LOSA 3GZAA 1EXBA 4AIBA 2F61A 3CMGA 1WKYA 2PWEA 4LVBA 3W1XA 3DERA 1GZ1A 1CI1A 3R0DA 2EEXA 5HMFA 2YKKA 3U2CA 1GVOA 3BLPX 3IRSA 3GIPA 3UJFA 3PBUA 3WJWA 4XUYA 5H1WA 1LL4A 1QWKA 1ZBKA 5CCZA 3A9IA 5D30A 3BCJA 4IG2A 5TNVA 3DENA 2WK2A 1VKFA 2BVDA 6A3HA 1K70A 3NXLA 2W62A 3MS8A 5C7VA 1B1YA 3BW3A 5C55A 5AC8A 4LPCA 4A3YA 4ZQRA 1QASA 4LCRA 1JRBA 2A1YA 2HXUA 2GJXA 4H6RA 4AB4A 1ONWA 3LRMA 2CHNA 3UG8A 4H7VA 3TFXA 3GC2A 2E9BA 4GD0A 4JEQA 3LPGA 3C61A 1XGDA 2WYSA 2BHZA 4A3QA 3E6EA 4JCLA 2OT1A 4GQBA 4FNUA 3W1PA 1AL7A 1QNVA 3AHXA 2XH4A 4FXJA 1OIFA 4HK5A 3AS1A 2CKSA 4RNHA 1ML1A 3R5EA 1MNSA 3TSDA 5K4ZA 3K1GA 8A3HA 4HCHA 2Z4GA 5AVNA 2WMGA 3MMTA 2C3ZA 3WMBA 6ALDA 4ZSTA 3ES7A 2GLKA 5DCEA 3HPFA 1VHNA 4DI8A 1LL6A 4PCFA 1KD0A 3V75A 1ZJAA 4ROPA 1GYNA 3DG7A 3PPFA 1ODUA 5JIPA 3K5XA 5G1YA 4LUJA 3M5ZA 4RE0A 1BVNP 2DVUA 2WNWA 2VOMA 3CM4A 5HJXA 1B5TA 5GVJA 4HTBA 1X1OA 1QNRA 4W7WA 3ZJKA 5CAHA 2HS6A 3GBDA 3CWOX 1UZ1A 4C7FA 1XGZA 3GYEA 1K9FA 4IICA 2X1RA 1Q7ZA 3BOLA 2J78A 3PZIA 3RM9A 3VDHA 2XIOA 3GU9A 2V5BA 2ZZ6A 1HP5A 4GCXA 5FEPA 4AZBA 3A22A 5H8MA 3KOFA 3BK0A 1UR0A 5T9CE 4OT7A 3WQCA 4IPPA 2KX9A 1WBHA 3HZ3A 3RNDA 4FLQA 4GO8A 4XO6A 3F4VA 4JIRA 3AUJA 2E25A 4H7ZA 3NUKA 1W1A1 3C0SA 3LSBA 4ERIA 2O9TA 3BH4A 4YLWA 2EPKX 1BAGA 5BCAA 5CPTA 2J4GA 2OR2A 5K9XA 2FZDA 2W91A 2DW7A 2UY3A 3IK2A 5E0FA 4WHBA 1XYBA 3R13A 4AHOA 4UOZA 3CO4A 1P4CA 1HL2A 4XAYA 2OKTA 1QT1A 4M1BA 1Q65A 2PLKA 5D05A 1WV2A 3EKGA 4M6VA 4JQ1A 3TNBA 2DZUA 3R0UA 1CXFA 1MW0A 5A2BA 4CQBA 2JGYA 4EAYA 2NQHA 3T7VA 2VFDA 4U2YA 3BLDA 2OZ0A 1GTHA 3TFCA 1OG6A 3QW3A 2VFHA 4GZJA 4J7RA 4XTIA 3LCFA 2VWSA 1VBJA 1XINA 1RBOB 1XS2A 4Q22A 1UKPA 1HKKA 3WNNA 4QQUA 4WY0A 3STEA 3EOUA 3TE9A 3O1NA 3WK3A 5LHFA 3B0VC 1KTCA 2J75A 2G5WA 2R1NA 4IMFA 1JYVA 1IGWA 3TN6A 1KXTA 1T40A 5AHFA 1JCNA 3WBWA 3W24A 5D02A 1V51A 2A3CA 3T40A 3KCJA 1JPMA 1Q2SA 3S5SA 4QHRA 3S5ZA 2GSEA 4AZCA 2DGAA 1JGIA 2V68A 4H01A 3S5NA 3VFLA 2P8CA 1IXPA 5DT7A 1XIHA 1RQBA 3LV6A 2JF6A 2CESA 3WBAA 1GOQA 1S3TC 4MJMA 2G3IA 4JD4A 4QS5A 1WYIA 5G4WA 1B31A 1CGWA 5CSSA 3SCUA 1R85A 1Z32X 2VC5A 4V1XA 1VIWA 3VTRA 3P14A 4FI4A 4D6FA 3KAOA 1ECEA 3BAJA 1DHPA 4PUDA 5HOSA 3NQCA 4LVGA 4CD5A 1BKSA 3EPMA 4AY7A 2FQIA 1E6PA 5I77A 4ZB0A 3EXSA 4LF1A 3H22A 1B3ZA 4N6EA 2Y5SA 3GR7A 4BQ3A 3ABOA 3CEUA 3N2CA 3NXFA 3M0KA 4LAKA 3LB0A 3U48A 4DYEA 6XIMA 2CLOA 5IM51 3C0JA 2HVOA 2GL5A 5D37A 4Q4QA 1W5OA 1F8IA 4W88A 3CYVA 7CGTA 1T7LA 4XBJA 3QQ0A 4O1CA 1WDQA 3H12A 2VZUA 3BGJA 2TMDA 1NP0A 2Z26A 1NWUA 5HNRA 4ZXLA 3GHTA 1XLIA 4EANA 1D8WA 2OOGA 5TD4A 4IQEA 1OZQA 2ISVA 2WC7A 5AYZA 5KZMA 4QDMA 4CQCA 3DFPA 3M0MA 3BQ6A 4XZBA 1PX8A 4TQTA 4DHGA 3L5MA 1V02A 3LTSA 3PFRA 4DRSA 4C6PA 3GTHA 4JOMA 5J5RA 2GFTA 2C18A 4N4QA 2BTMA 2BVWA 5FIPA 4JZ5A 2QXWA 5I23A 4DB7A 4GXPA 7TAAA 3ZR5A 2E5DA 3LXCA 2VRQA 3APTA 1IF2A 1GVYA 1Z6KA 2PDWA 4XAFA 2HBVA 4PBEA 4QCEA 4XIAA 4LU0A 3ARUA 1AD1A 3VNJA 1LG1A 5U7SA 1ZFJA 1XLFA 1ICQA 1OHLA 4W4QA 2H3BA 1SVDA 2F38A 2I9EA 3NZPA 4CNOA 3NSNA 4FAMA 1JAEA 3WK0A 3P8IA 5FJRA 5HNUA 4P8UA 3W9ZA 3QMTA 3KX6A 4K2SA 1JZ2A 5FEXA 4HPNA 3N13A 2F6XA 3NO1A 3HOJA 1I2NA 2XFRA 2WXDM 1EQCA 1VGAA 2OEMA 1R30A 5L9FA 2E09A 3DC8A 2VEFA 1E0WA 3W74A 1H3GA 2ASHA 4GUGA 3BTNA 3AOFA 3MANA 4LAOA 4A2SA 3SBFA 3RM4A 3C8FA 4G1NA 3LYEA 4IOTA 2GGEA 2R1KA 1MEHA 3PUOA 3W6YA 4HNLA 4H4IA 4JBRA 2UY5A 3H21A 3NAVA 1KCZA 2OPJA 3H53A 1JUBA 1BRLA 3DC0A 1E0TA 2R1LA 3WQOA 3ZSSA 3ABQA 3O15A 1BKHA 2ZKMX 2WPBA 1H7OA 1JF6A 3S1XA 1PSCA 1S2TA 4NYUA 4IJBA 3TC7A 3EEZA 1L2UA 4ZB2A 5C2XA 3LNPA 1JI2A 1KKOA 1OSEA 4AX6A 4OIFA 4RXGA 5C0QA 1CXEA 3KL0A 5XIAA 1U5VA 1PJ9A 5D2TA 3KTCA 1AQMA 2FMOA 4UR9A 3LBCA 3CASA 3OGVA 5A6JA 1UWQA 4Q4KA 1CXHA 4GIEA 5HQEA 1XC6A 1ME9A 3M0ZA 1YPFA 2BZNA 3UWEA 3ZJ7A 5BRBA 3CUXA 1ZU8A 2QCDB 4PA8A 4I9MA 4QDPA 1J12A 1UCWA 1WDRA 3KVJA 1OX5A 2V69A 5F7UA 3WLMA 1GKQA 3D3AA 3BLKA 4K36A 5A6AA 3GFXA 3W1LA 1PKMA 2BMBA 4R85A 4M19A 4AEFA 3MP4A 2BHUA 4HJFA 3UJRA 5D9OA 3E2RA 3CWNA 1EO5A 1KM2A 4NUWA 2ZOXA 2RAGA 3QY8A 1KV8A 2UY4A 2QV4A 1WP6A 3ATYA 2UZ9A 1FCVA 1A4LA 1FWBC 4MWAC 1RJPA 1BLIA 3MBFA 1S2AA 3VYLA 2ZUMA 6CGTA 1AD4A 2YL8A 2VUNA 1JUKA 2RDXA 5D09A 2X30A 1A50A 2NX9A 4UUIA 3L0KA 4LGXA 3SRHA 1WAWA 4Z1CA 2VELA 2B0MA 2OMAA 4RNFA 2XU2A 3QEZA 3S2LA 2EBNA 2W4XA 1ISVA 3SURA 3AI0A 4KRZA 4MDOA 2EPOA 1L9WA 4ADUA 4LBUA 3OODA 4XQ6A 2CKRA 1K8ZA 3QMRA 4J4KA 1H7XA 1VPQA 4FF5A 4XG1A 3VDGA 1DJYA 1LOLA 2Z1VA 2XZ7A 3PZMA 2V9DA 5FI8A 3RPDA 3BW2A 3DOPA 4LAUA 3I4KA 2DT1A 1JD9A 4F0RA 2GPTA 4EAMA 4PTMA 2D2JA 3E74A 3MUAA 1CGYA 3AICA 2IQ0A 4AYGA 4F0KA 4NNAA 3KRZA 1XYLA 3W2JA 4PCTA 3ISIX 2DQXA 4JYDA 5DCDA 1W9VA 1J79A 4C6MA 5B7YA 2VDIA 1CEOA 3UGRA 4ZO7A 2IKGA 4Q8QA 4LEQA 3T0CA 4C5ZA 1B4EA 1GOKA 1O95A 3R79A 2A7NA 3EB2A 4EACA 2REQA 1BYAA 1QDSA 1IT0A 2I5GA 2VRJA 5AYBA 4QE1A 1OCBA 2YB1A 2ZRZA 4EF9A 5D38A 2AQVA 1VR6A 1AW2A 1JXJA 3N4FA 2ACRA 4BQ4A 3HV8A 2VKZG 3RM8A 3USBA 3VNLA 4DO7A 1KFLA 3VD3A 1R3WA 2R94A 2Z6IA 2QYGA 5AYIA 2PRHA 3IGUA 4LUSB 5GNXA 2ZUSA 2A0NA 4DYKA 2B31A 3MY9A 2Z27A 1V7YA 4B2DA 1EJSC 2BOGX 1T8QA 1YMYA 3M41A 2NW0A 4XX6A 2D23A 3E12A 4E4PA 1PE1A 2UBPC 3D0CA 5FJPA 1GVFA 1KBJA 2HDJA 2V82A 4H41A 3W7CA 4WX2A 2CYGA 4XZNX 3OGSA 2J47A 3J7HA 3QRHA 5REQB 2AGKA 5DRCA 1ONRA 1OY0A 2P53A 2Y8KA 5F2IA 4GNKB 1QFEA 2XN1A 4ZQCA 4LW7A 3W7QA 3MJYA 3W7EA 1YBQB 2XN2A 2XGZA 1SGJA 1W17A 4NJJA 3QPEA 3TSBA 4U5IA 2O55A 2X1IA 4GO9A 4AY1A 3UWUA 1T5AA 4NZ1A 3W7PA 1W0MA 3MI6A 2VC9A 2EQDA 4OOUA 4UTTC 1UPMB 2OOFA 3VOFA 1C93A 4UFLA 2DZTA 1NFGA 1WXJA 4DJDA 3PJWA 5FSEC 5I03A 1DQUA 1TCMA 1RUSA 1EIXA 5CC6A 4DN1A 4IMDA 4D6DA 5DF0A 4F0HA 1VBHA 1NARA 2DIKA 2ZZ5A 2XIQA 2DZXA 3RMJA 3ZS4A 4I8YA 4MB4A 1R9ZA 1ZBWA 5C8BB 4NZ3A 1M65A 2OQYA 4H7CA 4V33A 4M0XA 5LXEA 3GH4A 3QJAA 2R91A 4TV5A 4PH6A 1KGXA 3M43A 8XIMA 2AMGA 2WLYA 4OVXA 3AUOA 2P8BA 3WDRA 1BWLA 4M3PA 4IIDA 4PMDA 4A4AA 4Y7EA 4UCGA 3K13A 3NGJA 2W0UA 2CU0A 3PFMA 2R1PA 2CZFA 3Q58A 4JTAA 4ATWA 4HSOA 3L9CA 3UG5A 1O94A 3VCRA 3HG4A 2WW5A 4XVDA 3SUUA 1PKYA 3MC5A 4GOAA 2EF9A 3GVQA 4OQVA 4Y9MA 3VZYA 4FIRA 2E6YA 4N2YA 4AIEA 2YXOA 2H9AA 3IEBA 3GDKA 4C6CA 1B9ZA 2X8RA 1HUVA 1LROA 3UCDA 1O5XA 3T8QA 2YCLB 2FPTA 1YDYA 2I7GA 4W9TA 2CLHA 2PGEA 3R7MA 1HJWA 3DUGA 1MW2A 3T78A 4PBFA 3RO8A 1SO6A 3QKEA 2DZVA 3IV3A 3HTWA 4RZ5A 3NQEA 3S1WA 2WM0A 1TRDA 2AAMA 3WY1A 3ID7A 4AU0A 1HKWA 1VFSA 3W1UA 1HW6A 2C13A 3GXNA 3DG3A 2G0WA 3AROA 2JALA 2FVKA 4OECA 1ITCA 1G67A 1DHKA 1TVLA 4NJHA 2QDGA 4KBXA 5EMKA 1XCFA 5EA9A 3O0FA 3CLMA 3GLCA 4R7OA 3RX4A 4Q8TA 1BXNA 3S6DA 4YTTA 2XWDA 4KEVA 3GTXA 4HNCA 2ZX8A 5CXPA 4E2DA 2WJZA 3FK4A 3C4UA 1K6AA 3MSYA 4DJDC 2A79A 2ZZ1A 2D0FA 3FDGA 2DFAA 4DAFA 2YA2A 4BQ2A 4BF9A 3VUPA 1J10A 4REQA 2EHHA 1XRTA 4CN4A 4WR3A 2YL6A 4HK7A 4B16A 1O6IA 1DPMA 3W2MA 4EP8C 3WJSA 3WLSA 5DX7A 2YPIA 1R3VA 3O6YX 3Q2DA 1PEZA 3M6DA 1A3XA 4Q8WA 1CXIA 2R8WA 3AHTA 4WDXA 3PJXA 4DNMA 1TWIA 1R3SA 5F1UA 1P6CA 4LBSA 3KOWA 1K8XA 3O07A 1TG7A 5C9ZA 1GGOA 3BMWA 4B2DD 3OVRA 1PZ1A 2VC7A 3H26A 3UVIA 1FKWA 1UWIA 3T0BA 4G56A 4H9XA 4JL1A 2GVEA 3B0YA 3M0VA 1GG1A 3RU8X 1UQYA 3UJ2A 3RCMA 1S1PA 4KESA 2O92A 3R10A 1OX4A 4PTVA 3G6MA 3HIJA 4IP5A 2PDYA 2NLYA 3SUSA 3VMOA 3GFYA 2QUNA 3ZMRA 1M7OA 4L4PA 3WMCA 4ML9A 3N04A 4G8TA 2FIQA 1IT7A 3RCNA 2Z2BA 2VQUA 1D8CA 2ZUUA 3VOHA 1OGGA 1QO5A 3CUJA 1E55A 3PZVA 3W88A 3SQLA 1W3TA 4HOXA 4Z2HA 4HTYA 1FTXA 3NL2A 1GYMA 1GQJA 4PL1A 4BY3A 3CL8A 3LU2A 5I3DA 1YXCA 5GNZA 4LAMA 4LCQA 1G7VA 1H61A 4ATDA 3HURA 5HR6A 3O16A 3S2JA 1RQHA 3CBWA 1FCBA 2HS8A 1BGAA 1XWYA 3G1RA 2O56A 4Q6XA 3NR0A 3BSHA 3N4EA 3WQ4A 1Y8BA 4S3EA 2FTPA 3ZLGA 1L6YA 4KWOA 1HJSA 1R3RA 1KTNA 4Q4MA 3GDMA 1JPIA 3NSMA 4UNIA 4DJDD 3FA4A 3SCOA 2PF8A 4XBSA 1UH4A 3ELFA 3WQ6A 2WLZA 4B91A 1RCQA 2PURA 1YDVA 2RGMA 5DXXA 5HXMA 3NNTA 1DP0A 4XZ9A 4JR5A 3TAKA 4OHQA 4Q8UA 1LWJA 4IUOA 2CXGA 2DEPA 4V1YA 5C9XA 4HVXA 3EOOA 1UB3A 3A13A 3N2BA 2GQ3A 3U5YA 4NYYA 2J79A 2TSYA 3FLUA 5L6UA 3UPMA 1EA9C 4KEMA 3ITVA 4NNBA 5E6ZA 3SO7A 2GQAA 4FXSA 4Y8FA 3CUGA 3ANUA 2ZZ4A 2VZVA 3SZ8A 4LYRA 1SQ7A 4M81A 5G2WA 3S1VA 3T2OA 3BLLA 4O4VA 4QJ4B 3CAQA 2D24A 1DWFM 3CJPA 3LS9A 1GK8A 1VQTA 3ITLA 4OE7A 2ADAA 4MZ1A 4WJXA 1SZNA 1P0KA 4PRWA 3HQ1A 1KQZA 3T2QA 3F2CA 1XG4A 4E2OA 1QW7A 5A6SA 5FL0A 2HROA 4AHQA 5C71A 3HJEA 4O1EA 3VCCA 1SFSA 4U2ZA 3DCPA 3KEHA 3WH8A 3WUEA 4R7WA 1V0KA 3EKLA 1CNVA 3PB2A 1JULA 4NJGA 1XX1A 1E1CB 1RA5A 4LY8A 2D2HA 2E68A 4O0KA 2C6QA 4J3ZA 4IX2A 3FSUA 4L65A 4C65A 2C1IA 3E3HA 4GK8A 3W85A 1SU5A 1E1FA 1X7IA 3TR9A 2X42A 3GR4A 3IUHA 3WQ8A 4DY1A 1KRCC 1SPQA 4P5UA 3U3HA 5ABHA 2G3JA 1UUMA 3O8AA 1W3NA 2CIPA 3V7PA 5C7HA 4PB4A 1T0OA 4UOQA 2J27A 2BXVA 5JQ9A 1I8JA 3EA3A 2ZICA 3B0UX 4H1ZA 3BSGA 1G01A 3O6AA 5BXTA 3TX9A 1KCLA 3IJ9A 2FGZA 2IPGA 2WMFA 3H70A 3L5LA 1EBGA 3UT0A 4S23A 1G9HA 4F4RA 3I65A 4AWEA 3B3DA 4GGBA 2PPGA 4PULA 3E0FA 5BXRA 4YVXA 3UZZA 1XLGA 4CCDA 4YMZA 5JIWA 1TIWA 3NPXA 3WBYA 2GUBA 4LV4A 1XYFA 1O5QA 3A5FA 5LSMA 1UHVA 1E5NA 2VZOA 5I79A 3A21A 3UERA 1JRCA 4MUZA 4PRRA 4CEXC 5BOEA 4ZBCA 4WUIA 4YS1A 4O14A 2TYSA 1Y5VA 3CZJA 3M0XA 3QQ1A 4P8XA 1WUEA 4NKCA 3CTLA 1YKWA 3AIEA 1UD2A 2ALRA 3SCRA 4GQGA 1OZMA 5E0CA 2XTKA 5FJIA 4V28A 1NDWA 2YW4A 1M03A 1MDLA 4U3AA 1K9EA 3WLKX 3GB6A 4GGHA 1AVAA 1BEUA 5T8GA 3NQBA 3TCSA 3B8IA 1BPLB 4W86A 2Z2AA 4D6IA 4IQLA 1QBBA 2PWFA 3VIGA 1FFRA 2UWFA 3JW7A 3DIPA 1EYEA 5CGMA 1TPB1 3PBMA 4P61A 4JN6A 3MTWA 1UG6A 3EOLA 3FJ4A 1HGWA 1SZFA 2E3ZA 3IVSA 5SWUA 1M1BA 3POHA 4LRSA 4PSRA 3CHEA 3ZWSA 3IGSA 4QNWA 4QITA 4YYCA 1Q6QA 4AEEA 3N6JA 4MY9A 3ECQA 2P76A 3CIXA 1KM0A 2QCGA 4A3RA 2RJGA 4DLMA 1YW1A 2E40A 2UY2A 4H00A 1FDZA 3FGCB 3L7RA 4A8IA 3RFAA 3SM0A 4DWDA 4LUIA 5ECVA 4JKLA 2VFFA 3SDOA 2XUCA 3CK5A 2YXGA 5EBUA 3NL6A 3LI1A 1R9XA 4GJIA 2WB5A 3KM8A 1A5AA 2ZXAA 2BXZA 1GOOA 3DI1A 4IXHA 1F05A 3BJFA 1SMDA 3WFZA 3TYEA 1EL3A 4ERAA 2WHLA 3LV5A 4IFKB 2YGYA 1NELA 3GIYA 3U2ZA 4RNJA 4Z1DA 5DMYA 3LK6A 1FH7A 2Z28A 2Y88A 4DO5A 1G0CA 4RDVA 1FP9A 1V02E 2PBGA 3URNA 4BHYA 1CDGA 2AL1A 4P2VA 5D33A 1TA3B 1TJRA 3MCOA 4XD6A 4LS2A 1KBBA 4PTDA 1XLCA 4U5KA 4M24A 5D9NA 4JQ3A 2E6AA 1FVPA 3SN0A 4HPXA 3NA8A 3WENA 3GFZA 3AMCA 4Z1AA 2AMXA 3PN8A 2J8FA 4YTRA 3RYSA 1OABA 1JI1A 1V6VA 5BMWA 2YW3A 4AY8A 2Y24A 3FCPA 3H4GA 5MKGB 4AF0B 4I7VA 4Y96A 2WJFA 4H83A 5DY2A 4J3XA 2V81A 3F2DA 3AYTA 2C1HA 3TDFA 4CLMA 4DM1A 2HVMA 5I02A 3QV6A 3GQYA 1A5OC 1TJ0A 3WLOA 1GQLA 1QHPA 4JPGA 1TTJA 4HKPA 3VNDA 2Y1HA 3CUZA 2J7FA 2BOFX 3ARXA 3QFEA 3CB3A 3DEQA 3QGAC 7PTDA 3C0QA 2ZQ0A 3OPSA 1PUDA 1TO3A 3KCLA 5CZSA 5K7JA 3AJXA 1FWWA 2P0IA 1VAHA 3GC5A 1R7OA 1AJZA 1UIOA 3HPXA 1VRXA 2R9RA 3HPZA 3PZGA 5DY3A 2PDCA 3MVTA 2JIWA 3K4WA 4P8WA 1B3WA 3UETA 1AODA 2X16A 4LC8A 1R9YA 4Z08A 4AC1X 1WKFA 3ORWA 3TVAA 5AVHA 4IPIA 1FHDA 2GK1B 3TN3A 4ZMGA 2BBFA 1EEXA 4JTSA 2X7WA 4C6LA 1I0BA 3CV6A 1XV8A 3H2FA 5I7GA 2CFFA 2QCDA 2V6AA 3HGSA 3GBEA 2WNNA 2ZE3A 1JAKA 5A5WA 4JX6A 3GSMA 3R8HA 2YYUA 4O1FA 4XVEA 1K7FA 4BK9A 1SJDA 1IWPA 1JG9A 4JY9A 1NY1A 3KBVA 2VT0A 2BY3A 3HG2A 4L4LA 3B8WA 3WYZA 4INFA 1CB2A 2INEA 4ATLA 3HBLA 4X2RA 1H4PA 5FJJA 2RDWA 1U2YA 1X1ZA 5A94A 3GXMA 1E9IA 1ZNNA 4PTNA 3ATZA 5HDRA 1IEIA 1XRFA 5A6TC 1YLVA 1XPYA 2RDUA 1ZAHA 4DX3A 1EJUC 1TUXA 3VIOA 3HA1A 4BCEA 4AWTA 4JTEA 3K8LA 4WOQA 3W1QA 3HGJA 4QLJA 1X39A 5C6MA 4WY0F 5LA2A 1AW1A 3R43A 4JHOA 5A8QA 4UTLA 3FAWA 1QNQA 4RCXA 5E6YA 4TTGA 3RRAA 4IIGA 2ZUTA 3PWAA 3FOKA 2XVKA 3AIUA 5CG7A 1B57A 3DAQA 1KO0A 1EWEA 1EZWA 3SSJA 6TIMA 1HNYA 5BXPA 1Q5MA 1OFDA 3PAOA 4Y9PA 1EP2A 3ALFA 4HU3A 1M6JA 2J77A 1TV5A 3LXAA 4LF2A 5DRIA 4H9TA 2WBGA 1GVSA 1N55A 3LRLA 1GUVA 2PAJA 2AAAA 2O9PA 3T4CA 4HNTA 3LHZA 5MF5A 1XSKA 3IRDA 4QRNA 3BXWA 3EDKA 3NPUA 1ONEA 1V93A 3KL5A 4MZ8A 1HKVA 2ZTKA 4IG2B 3T1GA 4N42A 3EPOA 4O50A 3JVAA 1TE1A 3PNZA 1H51A 2HISA 2WMHA 1GOMA 4IM4A 3AS3A 2OJPA 4PMNA 3V0SA 3W71A 3KBJA 2FFIA 1PHWA 3B05A 1AMKA 1QR7A 4UFKA 3H23A 3RK8A 1MFVA 2HSAA 5BOOA 3VAVA 2QGYA 2GJXB 4ZOAA 5K4XA 4NASA 1PTGA 1T41A 4ILSA 3GU1A 3AMLA 3WNLA 3B9DA 3I7SA 3VD4A 5JBEA 1S1RA 1Z3NA 2D73A 3JS3A 2YFOA 2ESCA 3UF9A 1XIGA 2XN0A 5DMNA 4LUSA 5FA5A 4Z2KA 4QISA 3PR2A 2P50A 5CGQA 1YXYA 3NZGA 4IIBA 3OG2A 2FHCA 3NQVA 1FKXA 1RY8A 1ZENA 4GPNA 3THAA 6PTDA 2HCVA 3MB9A 3RX2A 1PZ2A 1TZ9A 4GY1A 4FA3A 2OGYA 2ZXQA 1E3ZA 4PCPA 2Z25A 5GJNA 4JNYA 3S1UA 3UJSA 4HMDA 4ECLA 1E6XM 3IGHX 3TTQA 1XBVA 4N4PA 1SM9A 4S2CA 5IDIA 3P5YA 2QF8A 3AIRA 3L4WA 5E1QA 5EMYA 2PDUA 4UTIA 3KDOA 3W26A 1THFD 1J18A 3L68A 4LS1A 4ZTYA 1UR9A 2BY1A 1P7TB 3AIWA 3W2UA 3EB3A 4HHMA 1AQFA 3AWOA 4YYFA 3GVVA 2BDQA 4H19A 1CENA 1B90A 4NY2A 4U33A 4L1WA 5F1VA 3WF4A 3ARZA 3C52A 1G6CA 2HVNA 4K1WA 4D6JA 5I3KA 3BO9A 2W66A 4GVFA 4TX6A 3WLRA 5LIYX 3ARTA 4D9PA 3V4BA 1EOKA 4FEZA 3SGGA 4NAEA 1W1ZA 2WQPA 3LQLA 1NH6A 2F2HA 4O12A 3SCPA 3SY5A 3EEGA 1RH9A 4IFOA 5EPDA 1XLLA 4ZZ9A 3KZPA 5GQBA 2AQOA 1G4SA 3LGGA 1OADA 2H8XA 4Z42C 3PB0A 3W37A 4ZO6A 5DN1A 4B5TA 4QE5A 2V2HA 2OO0A 1MYRA 2ZIDA 4L9YA 2EPNA 3MDUA 3CIWA 3UA4A 3ZVHB 2VMFA 2OWXA 3T07A 1ZCCA 3FYOA 4FHAA 5XINA 4E8CA 2JEPA 4IGNA 3WELA 4K6AA 3RUBL 3L0NA 1U22A 3ENLA 5F2MA