4B15A

Crystal structure of tamarind chitinase like lectin (tcll)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
266
structure length
265
Chain Sequence
GGNIVVYWGQGGSDNSEGSLKEACKSGHYNMIVLEELITYDNGRDPDLNLGAHCVNCTSLQQEIKYCQLKLIKILLQIGQVTPTKEDTKDTTKDLSQYLDSNFFSGKSGPLGEVYLDGIDIASVPEGLNLKFDELVQALNDSATSRRIYLSASPNCVYPDYYLDKAIQTQKLDFLFVQFFYALPCIYTQGLPEDLFQAMKTWTSNVPESIFMALPATPDLNGYIPPRVLNKEILPAVTQASNFAGVMIFDRYFDRFRKYSSKIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CHITINASE LIKE LECTIN
publication title Structural Investigation of a Novel N-Acetyl Glucosamine Binding Chi-Lectin which Reveals Evolutionary Relationship with Class III Chitinases.
pubmed doi rcsb
total genus 94
structure length 265
sequence length 266
ec nomenclature
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4b15A00
3POCA 2NW0A 1KCKA 1L8NA 1S46A 4PCSA 1E5NA 3OZPA 3WNLA 5HPOA 4PN2A 4UQBA 1UWTA 1W9XA 4W86A 1CXKA 3VGGA 4PMRA 5BROA 1KBBA 4CN4A 3W6LA 5A6JA 3AIQA 3OGRA 3MMWA 1NQ6A 2VI0A 2DGAA 1UD4A 3WH6A 2JF7A 1E40A 3GDBA 4TOQA 5GNZA 1CGXA 2DT2A 3AHVA 1TUXA 1NARA 2ZUTA 1UWRA 4Z2GA 1CDGA 2FDMA 5BXTA 1VAHA 1E6ZA 5EBAA 4W7UA 1ZS2A 4EK7A 5JIPA 1WAWA 3J7HA 4P7LA 4UOJA 2VX5A 3VMPA 3L4VA 3ECQA 4W8AA 1HF6A 1PPIA 3WF4A 4C7DA 1M03A 5A8OA 4L4OA 3K1DA 3AIVA 4UQ9A 2GDVA 4ATWA 2D0HA 1QPKA 3S2CA 2J7GA 3HJEA 2J78A 1UUQA 3AROA 3WNKA 3W53A 4XUYA 1GHRA 4MPKA 2BV9A 1CYGA 2CHOA 5M17A 5ECUA 1VBUA 3I3BA 3VIKA 2A3EA 1PIFA 2GSJA 4UR9A 4C7FA 5IXEA 2WAGA 3BCFA 1LWHA 1R85A 2VQUA 2VCAA 3ARSA 1E6RA 2VVNA 1KBKA 2OWXA 3WEMA 3CMJA 3CPUA 4U31A 5JUVA 4W85A 3WELA 1H0GA 3BMWA 4BZYA 1WE5A 1K9EA 5I77A 1HJQA 1OCQA 1PZ3A 4JCLA 1H09A 4LYQA 2WKLA 2XG9A 4TTUA 4EKJA 4PYSA 2DSUA 3A4XA 1HX0A 4AZ5A 4CKQA 3WDQA 3MUZ1 5LA0A 4C7GA 1MXDA 5AC5A 1V3HA 4A3YA 3AMGA 1GCYA 1BQCA 4HZ8A 1MW0A 2YL5A 3DYMA 1LJYA 4RE2A 4AW7A 1LL4A 1EOMA 1J11A 2VRJA 2DIJA 5IDIA 3GXFA 3BXWA 4AIUA 2WW5A 3WQ8A 1OGGA 2J75A 3ZJKA 3D3AA 2VZSA 1GOMA 4QCEA 3WL0A 5C8BB 3ZT6A 1R8LA 1XSIA 3GH4A 3KL0A 5BRPA 3RM4A 4QDMA 4W84A 3WBEA 2DDXA 3ZMRA 5CJ5A 3WSUA 4NRSA 2QLYA 3APGA 3FAWA 4AZHA 1EO7A 4QP0A 4FLSA 3SCVA 5CGMA 4HPHA 3AYSA 1KR0A 5DT5A 4WSKA 1YQ2A 3SCUA 4J3WA 4YHGA 2DSWA 2ZX6A 1VJZA 2PB1A 3DYPA 4WLCA 1W2VA 1KWGA 2X1IA 2XFYA 4X0NA 3MUIA 1EOKA 5FD0A 1JXJA 4OOZA 1SR0A 2QHAA 4JKMA 1I1XA 4J7RA 2Z1KA 5DO8A 4D6HA 4TVCA 5I0DA 3N1AA 2VO5A 5CSYA 1WDPA 3OGVA 4W89A 3SUWA 3L4ZA 3CZ8A 3AXIA 3WNMA 4AZCA 1HN1A 1YHTA 4BCEA 1M04A 2VRKA 1DWIM 1UD6A 1JZ8A 2TAAA 4RE3A 1US2A 4NRRA 1J12A 2WVVB 2YL9A 4HA3A 2WBGA 3AIWA 4AZCB 1FH9A 2VX4A 1I1WA 4PUDA 3AIEA 2YDQA 1GOIA 1HXJA 1K9TA 4MAVA 1KGXA 1CXHA 1TA3B 2ZX9A 2XFFA 5JBFA 1B2YA 3BAXA 3G6MA 1A3HA 5D9MA 4AD3A 1LQ0A 3LMYA 2PBGA 3GM8A 2UY2A 3ARPA 1CGYA 1WZKA 4M1RA 2ZIDA 2EBNA 2WXDM 4YN5A 2WVTA 1VBRA 1JI2A 1JNDA 5A95A 2VX6A 1G94A 4IPLA 2V3DA 1UR9A 3BGAA 3ARXA 1KXHA 4HP5A 3AIRA 1OM0A 3WL1A 1VF8A 1EHAA 3KEHA 1WO2A 2J79A 2BY2A 5A8MA 1E1FA 2PWEA 1JD7A 5JBDA 1VJSA 1XC6A 3QHOA 4J3UA 4UQCA 3AI0A 1E4NA 1U30A 2BVYA 2WANA 3SCQA 1JXKA 1VENA 1VRXA 1LL7A 3VDHA 2E4TA 1JL8A 2J62A 4WKFA 3WMBA 3A3HA 2WZIA 4MB3A 2AOSA 3LPGA 3W6MA 4P7OA 1R87A 5A8QA 1GQIA 2ZXDA 5ABHA 5CPSA 1KGWA 1V3LA 4CVUA 4CD5A 1ZBKA 1E71M 3O2LA 4P7RA 4JFUA 2EEXA 3T2QA 2WC7A 3VU2A 4PMYA 1OB0A 3VX0A 1JZ7A 1W2PA 1XH2A 2WMIA 3VDAA 2XGIA 3DECA 1CNVA 1E56A 1B0IA 2BVDA 5D9OA 3WEOA 1WDSA 1NP0A 2BNJA 3VDCA 3WNPA 1C8QA 3THCA 2O9OA 1DP0A 5I2UA 4M81A 2BHUA 4F9JA 3VGBA 4JAWA 2PF0A 1E70M 3VPLA 1DTUA 1QI0A 2D0GA 3GNRA 4A3HA 3WKZA 1ISXA 3WDPP 3MUY1 3OBAA 4MNMA 1GOQA 4WJXA 5IFPA 1GOWA 2XSAA 3BAYA 3VGHA 1WKYA 3BLPX 4AEFA 1HNYA 3T2OA 2E40A 3UG3A 3OB8A 3VNYA 1IZKA 5I6SA 4W7WA 4GI9A 1KWKA 4PMDA 4W87A 3AXHA 4LX4A 3PN8A 2OYLA 2DSVA 1OGBA 2ZICA 1QBBA 1QW9A 1EA9C 3LPFA 3U5UA 1OIFA 3WQWA 1V0LA 5E0FA 2YLAA 2J7DA 4PMNA 4JHZA 4TVUA 4AC1X 1CPUA 3II1A 2YA1A 5CPQA 2J77A 3F4VA 4AD5A 2CHNA 3BSHA 3EDFA 2X05A 2NSXA 3MKKA 4ZE5A 4CN6A 5FL0A 3VDBA 3OG2A 1RPKA 1H49A 4J27A 3SURA 3MU7A 3AMKA 4J28A 1W3HA 3GBDA 5A2BA 5E70A 4LPCA 1E6QM 5I5RA 3OIHA 2VRQA 1G0CA 1B31A 4UNIA 5A6AA 2WB5A 4H41A 4Q22A 3NSXA 5E6ZA 4D6DA 1UOKA 5A6SA 4OJYA 4BQ2A 3BCDA 2JIEA 3VIIA 3BAWA 3ALGA 4K68A 1JGIA 2D23A 3UETA 2W66A 3ZT7A 1V02A 3RPMA 1Q6EA 1KQZA 3BAKA 3PZIA 4HPGA 1H11A 4QFUA 3NCOA 2W4XA 3ZT5A 5A2CA 1G9HA 1E72M 1UR2A 2XPKA 2G3IA 3PZ9A 1HVXA 3WFZA 2WC3A 4JZ5A 2DPEA 1J0KA 4P8XA 3TA9A 3CUJA 3GZAA 3W81A 1DEDA 3CO4A 2A3HA 4WKAA 1ODZA 3CLWA 1TVNA 3B8SA 2ZX5A 3W82A 3VMNA 4WK9A 1W9PA 2DH3A 5BXRA 5DFAA 3MSDA 1B9ZA 1M7XA 3WH8A 2XFRA 1UR4A 3VIGA 3AICA 1XSJA 2XVLA 3AHYA 4PMVA 2WKGA 2FHCA 3GYCA 5KEZA 4U33A 1CBGA 3EDDA 3PZQA 4HU8A 2G4FA 3A4WA 3WY1A 3VMOA 1GUVA 4AIOA 4DWSC 1NWUA 5D8WA 2JEQA 5HXMA 1UG6A 1NH6A 6A3HA 1NP2A 4JFWA 3MV11 5GNYA 1WDQA 3A47A 2W67A 1CGVA 3EDEA 4GQRA 4IISA 3EMZA 1DHKA 5ABFA 3SCTA 1QVBA 5KZ6A 1BG9A 1TVPA 2JEPA 1J0ZA 3BSGA 2E9BA 4W7VA 5A8PA 5A6KA 5ABFB 1L0PA 1WZMA 1X1NA 2VMFA 1IV8A 5EMYA 4GZEA 2JALA 1QNSA 2CETA 1JZ5A 2GFTA 3VGFA 4ACYA 5A3HA 2CIPA 5BYWA 3GXMA 1XHGA 4V27A 1EHNA 4GZJA 2QMJA 3EMQA 3NIYA 4AD0A 5TD4A 3O9NA 3B9EA 1KXVA 3LPPA 4D6CA 3VIMA 4UZSA 3B9AA 5ABEA 1HJSA 2G3NA 5CXPA 3CHFA 1UHVA 1E3XA 1PBGA 5DF0A 4UFMA 5GQBA 4CCEA 3AHTA 4EANA 1MFVA 4AMCA 2PC8A 1NM9A 4PSRA 3QR3A 2UY5A 4U2YA 3SEPA 5FOOA 4AD1A 3WUEA 1GOOA 2WBKA 1ODUA 2WM0A 4D72A 4B3KA 1UYQA 1ZBCA 5LA1A 4CN1A 1HP4A 3OZOA 1XRVA 5A6BD 4XV0A 2CESA 3FN9A 5I24A 2OSWA 3UEQA 3F5LA 1FHLA 2O9TA 1W1TA 2EPOA 3OLIA 1W9UA 1JDCA 1XH0A 4GZIA 4AZ6A 3WDRA 1JDAA 5JBEA 2V38A 4HOWA 5CGTA 1PX8A 4LYRA 1QBAA 1CGUA 1VEOA 1EH9A 4HU0A 7A3HA 4FK9A 3VD4A 1UWQA 1CLVA 4E8CA 1XD1A 2WCGA 1J0YA 1EO5A 4QLLA 4CCDA 3CUIA 2CBUA 4PTMA 4AWEA 4CGTA 3WQ4A 2WHLA 1V02E 5BRQA 3N13A 2IUZA 3RM8A 1R7AA 2GJXA 2J25A 4FF5A 5HPCA 1AMYA 1O7AA 2WVUA 4LGXA 1KR1A 2WCSA 3VINA 1UKQA 1WPCA 1ZBVA 3CTTA 1W1PA 2XVPA 1JF5A 3ZR5A 3QHMA 1DWJM 2GJXB 4KMQA 4GI6A 3WF2A 4P8WA 1PX3A 2ZXBA 1WDRA 3CUHA 3OLGA 4OZOA 3WH5A 3AYRA 1HT6A 4MJ4A 4P8VA 4HTYA 2JF6A 1W91A 3F5KA 1ITXA 1ECEA 1E3ZA 1HJWA 1KCLA 4F9DA 1N82A 3VIOA 4OOUA 1TZ7A 5CZKA 1KXQA 3ARTA 3THDA 4QAWA 1C7SA 1GQLA 1CIUA 2CERA 2WMHA 2YBTA 1UR1A 4HA4A 2J7FA 3IJ9A 3KL5A 2E8YA 4J3XA 2X09A 5F7UA 1K9DA 3CGTA 3L4YA 1H1NA 1GQJA 2WCAA 1FH8A 2JIWA 4EE9A 1I75A 3VGDA 5DT7A 2CYGA 1C91A 5A1AA 3CZGA 3QOKA 4JCMA 4H7VA 1CXLA 1JI1A 2A3BA 2CXGA 4GO9A 4URIA 3SUVA 2WMFA 2F2HA 4WIWA 4FLRA 1AQ0A 2ZWZA 1UQYA 3VD5A 1V3KA 3DHPA 4FLQA 3AMCA 4NF7A 3OLDA 4Z2KA 1LLOA 2ZWYA 3MMDA 3ZM8A 4PMZA 3UESA 4IUGA 1NWTA 1MQRA 2VZOA 2V5DA 3FHAA 4M56A 1PAMA 2EXOA 1E4LA 9CGTA 2J4GA 2OWWA 4AD2A 2WMJA 2VR5A 1HVQA 3VM7A 4DWSB 4M24A 1CZ1A 2XJ7A 1QI3A 5JIWA 4CU6A 3VNZA 1MYRA 4A4AA 3AS1A 2ZUVA 3ARUA 1MQPA 3CMGA 1CENA 2XTKA 1GJWA 2XSBA 2CEQA 5D9PA 2FH8A 2XM1A 1XH1A 1QI2A 2W62A 2JE8A 3WF0A 4DUWA 4UFLA 3PTQA 1KGUA 4PRWA 3G6LA 1UD3A 2VR4A 5A6MA 3L2MA 5E09A 2GJPA 1V03A 1XCXA 2DSZA 2G3MA 2FGZA 2W92A 1CEOA 2YKKA 2W5FA 3VX1A 1V3IA 1XSKA 2D1ZA 3BH4A 1HKJA 3ZIZA 2VCBA 3RM9A 3W38A 2FHBA 1WZAA 3W25A 4WF7A 4DWSA 5A6BA 3PZNA 2OSYA 3WN6A 1PZ2A 1TG7A 3WF1A 4D6GA 1W3KA 1Q6FA 3OGSA 2DEPA 3RCNA 3W4RA 3ARWA 3K46A 1GVIA 4CVWA 1OSEA 4GQQA 4CD4A 1QI4A 3PZUA 1J0IA 1Z32X 1F4HA 2HVMA 3TTYA 2D3NA 5A2AA 3WD3A 4D6IA 1LWJA 1H5VA 5M3WA 3JUGA 4CD8A 1C8YA 1NOFA 3N17A 1NWRA 3WNOA 3NSMA 3UR7A 4F66A 3RO8A 2OWCA 3AIBA 4XX6A 1UH4A 2WPGA 1ISYA 4HOZA 1V6XA 3N11A 1E5JA 1JIBA 1BGAA 3AHZA 3I3DA 3PBGA 1E73M 3TOPA 4AISA 5CQ1A 5LA2A 2PWGA 3CUGA 1PJ9A 3QOMA 3WD1A 1FH7A 2DSKA 3VIPA 2E0PA 1OT1A 1JNEA 4YPJA 3MUAA 3CZEA 4AXNA 4GINA 3CH9A 4LYPA 3PZOA 4HZ7A 1BYCA 2WMIB 5BWFA 1J9YA 1BF2A 4CU8A 3WD4A 1B1YA 1JF6A 3L4UA 2J8FA 4IM4A 3EDKA 1SFSA 1JYXA 3MSGA 3T0BA 3B9DA 1FOBA 1US3A 4OKDA 3UR8A 3BLKA 1MW1A 1UKSA 3RJYA 2GJRA 2WLZA 3PZTA 2JFEX 2Y2WA 4RL3A 1JYNA 1FP9A 1DWGM 1ZL1A 3VTRA 3L4XA 2PI6A 1H4PA 3EBVA 4E4PA 3EMCA 1V6UA 4QLJA 1SMDA 4UQDA 1IT0A 1HKKA 3HU7A 4Z2LA 4GPNA 1UWIA 2WMKA 2QPUA 3EDJA 3AFBA 2PWDA 1JZ4A 2EO7A 4J3VA 2YL6A 3ZO9A 4H8VA 1CLXA 1BG4A 2YA2A 1OD8A 3WDJA 1OGSA 1TCMA 2E8ZA 2EPMX 3AMDA 3DC0A 4P8UA 4W8LA 2ZXQA 1SMAA 3DYOA 1Y7VA 2WZHA 5I79A 3LPOA 4PMXA 2WNWA 1VFFA 2CBJA 2YBUA 2V3EA 3EYPA 5EFFA 4H8UA 3SUUA 4MNJA 3ALFA 1B30A 1EDQA 3ZR6A 2BFGA 5EFDA 5IHSA 1RP9A 4JFSA 2Y8VA 6TAAA 3K8LA 3TP4A 4UQAA 3UG4A 3S6TA 2FH6A 1QNPA 1B3YA 4JFTA 2XIBA 3GBEA 1H2JA 1BYBA 2Y24A 4OBRA 2ZUMA 3F5JA 3K8MA 4PTVA 1W3LA 1W9DM 3FAXA 3M07A 2WHMA 1FP8A 1QW8A 3BMVA 2J8GA 2VX7A 4FMVA 1QNQA 2BXYA 1ZJAA 4ZXOA 3SCWA 3A6OA 4H2CA 4PCTA 1Q4NX 3SCNA 4E2OA 3WH7A 4OIFA 2XYLA 3WBAA 3ARZA 1B3XA 1ZBWA 2C0HA 3UG5A 3BAJA 2X8RA 3GTNA 5CLTA 1E6SM 5C70A 3GXIA 1CGWA 1EQCA 1BHGA 1V6VA 5EB8A 1GORA 1F4AA 4UTFA 2Z1SA 4JIEA 3L4WA 1D2KA 3CHCA 3PHAA 4HMDA 1DWAM 4PMOA 5E9AA 3DHUA 1QHOA 4X0VA 1WCGA 4UFKA 1KFWA 2ZUNA 2ZX7A 4V28A 2F61A 3SCOA 3AISA 1OWQA 1LF1A 3CUFA 1H0IA 3AIUA 3MO4A 4WKHA 5A8NA 5CSUA 4B3LA 3WDHA 3GH5A 1UKOA 3TONA 4D6EA 2GK1A 1VEPA 2WWCA 3VO0A 1V0KA 4JFVA 5HDRA 8A3HA 1C8XA 5AY7A 2CCRA 4D6JA 1Q6DA 3T08A 4R5EA 2VQTA 4TX8A 4CCCA 1J0JA 2XIIA 3AOFA 2UWFA 2ZUUA 3FXYA 1B90A 1BVNP 3NJ3A 4L4PA 4MADA 2F8QA 2Q8XA 1AQMA 3CHEA 4H8HA 3VUPA 2O92A 6CGTA 2VCCA 3WUGA 1B3WA 3GH7A 1X6LA 3AMLA 1E55A 5D4YA 4ATDA 2YLLA 4BQ3A 1QNOA 1E6NA 3QGVA 3ARVA 1JG9A 3K4AA 1E15A 2WC4A 3ZQ9A 4B9ZA 2J7HA 4LXFA 1GVYA 5A69A 4B15A 3SIMA 2VZTA 1TMQA 3AZTA 4OBSA 1GPFA 3T2PA 1UR0A 2BS9A 3FY1A 5GNXA 2ZXAA 1IZJA 1H3GA 2XWEA 1MWOA 4TX6A 1PX4A 5AYIA 2ZUSA 4QCFA 3CZLA 2XGBA 4H04A 4ZE4A 1OIMA 4JL1A 1JAKA 5GPRA 3RMEA 1MXGA 2WMGA 2D0FA 4D1IA 5DMYA 1UA3A 4V2XA 2BVTA 3GNOA 1E6PA 3SUTA 4AZGA 2J7EA 3W29A 4W93A 3I3EA 1CXIA 3FHQA 1RP8A 1BVZA 2WWDA 5IFTA 4YHEA 4B16A 3N04A 2X0HA 1WB0A 1E0XA 5FL1A 1K9FA 5A94A 1CWYA 3PZVA 2J47A 2NT1A 2D22A 3KL3A 1E4IA 2X0YA 3MMUA 3ZJ6A 2BY0A 4ACZA 2EPNA 4NI3A 1TFVA 4AEEA 3TTOA 2EJ1A 1VFOA 1VB9A 1R86A 3IAQA 1ISZA 3GXDA 2YDSA 3WQ5A 1W1VA 1WNOA 4Q7NA 2G41A 4CD7A 4Z2IA 3SCSA 4ACZB 1XYFA 3CIVA 2HISA 1UKTA 4D71A 3W28A 5E6YA 4M80A 4MNLA 3VIJA 3WFLA 4TTGA 1NOWA 1Q6CA 4EAMA 3N18A 4ML4A 4PTWA 2YDRA 5AC4A 1W32A 3L4TA 7TAAA 1BPLB 1GHSA 1TR1A 1UZ4A 3M46A 4N42A 4M29A 1HJUA 2FHFA 1ZJBA 3PZGA 1XCWA 4X9YA 1JYWA 2DH2A 4AY1A 3WEZA 1OD0A 2CNCA 2CITA 2E9LA 2VC9A 4PMUA 3K8KA 1G5AA 1NOUA 2PWFA 2GUYA 3ZSTA 3OLEA 1TE1A 4NZCA 1W9BM 1BAGA 1XD0A 4Z2HA 4NSBA 1HKMA 2D20A 2XVKA 4KRUA 5D9NA 2VVSA 2V3FA 2PWHA 4ATLA 1JZ2A 3UCQA 1RH9A 2CBVA 2UY3A 3VD7A 2WVSA 2VNCA 1VFUA 4PBGA 4UCFA 1PIGA 2ZOXA 2VTFA 4XZBA 2J7CA 2VJXA 1GJUA 4W8BA 2O9RA 2BXZA 1SYTA 1MW2A 1FFRA 2WK2A 2X2YA 5HOSA 4BA0A 1BTCA 3VD3A 4JHOA 3FW6A 2C7FA 1LG2A 3O6AA 4XB3A 5A6LA 1HIZA 2QV4A 4MAZA 3VVGA 3U7BA 1AQHA 4W5ZA 1C90A 2CKRA 4UFJA 1FHDA 4AD4A 1V0NA 4U2ZA 3SUSA 2DIEA 4CD6A 4LQ1A 2W91A 7CGTA 3BAIA 1E0WA 1V6WA 1MQQA 1QI5A 5E0CA 4OUEA 1JD9A 1UD8A 2UY4A 2V3GA 4MDOA 1HJVA 4GI8A 1GOKA 3AJ7A 4U5KA 1LL6A 2YOCA 1GW1A 3ZJ7A 3ARRA 2WVVA 2GDUA 1UH3A 2MANA 4J3SA 2W63A 3T0AA 3U5YA 3ZSSA 3T0DA 2A3AA 3PTKA 2DT3A 4XZWA 3NUKA 2J7BA 4DUXA 1E43A 1TA3A 1J0HA 1OINA 1ZU8A 3RDKA 1XYZA 1ZB5A 3MANA 4MB5A 3PTMA 3VILA 3CZKA 3MV01 2DT0A 1JDDA 4MJ2A 8CGTA 1HKIA 2IXVA 2YJQA 1V3JA 4PUEA 1ISWA 3HMCA 3W0KA 3ZOAA 2ESCA 2J74A 4GIAA 2FGLA 2OYMA 1GNXA 3VM5A 5AYBA 1O6IA 3POHA 4FLOA 4N0RA 1B3VA 1UH2A 3W24A 3ARQA 4DUVA 1XGZA 2OSXA 1U33A 1DWHM 5M5DA 3VIFA 1KQYA 5HNNA 2OYKA 1M53A 1MFUA 3GNPA 1W1YA 2XWDA 4RE4A 2OLHA 4M82A 3PZMA 3IANA 5BCAA 2DQXA 3WUFA 3SCRA 1BFNA 3E1F1 2WHKA 2G3JA 1QOXA 4DM1A 1UD2A 3NDYA 1EXPA 2D2OA 3W37A 1H41A 2QMKA 4U3AA 3WDIA 4Z2JA 2BHYA 2ZUWA 4ZXLA 3RIKA 3WIJA 3WD0A 2CPUA 2NT0A 3VGEA 2B31A 1GZJA 4HMEA 3RJXA 4D6FA 4KWUA 4W5UA 4PMQA 4TXEA 5CPTA 5FCZA 3WMSA 3WNNA 1X6NA 1JFXA 3NSNA 4ZEPA 2QPSA 3VOCA 4F79A 2VZUA 3D5HA 3T09A 1C92A 1BGGA 1MVYA 3KE0A 2G8ZA 2YL8A 2EPKX 1V0MA 2ZX8A 4BQ5A 3IJ7A 2VURA 2Y8KA 4DM2A 1UA7A 5D8ZA 1JYVA 4AZBA 4HA1A 3L2LA 2D3LA 3N15A 1UR8A 3M7SA 1FFQA 1K6AA 4TVDA 4W88A 4P7NA 4U5IA 2Y4SA 4PEEA 4AZIA 4PTXA 2ZE0A 4UOZA 2AMGA 4Y7EA 2WYSA 3WENA 2RGMA 5BXPA 1W9VA 1UWSA 1UD5A 3VKKA 1FA2A 2VZVA 5M03A 1ITCA 3AHXA 1HL8A 4J3TA 1BSIA 3WMCA 3FNDA 1E4MM 2A3CA 1ISVA 5I78A 4HOXA 2D24A 3AQUA 3AS0A 4KGLA 4TUFA 4UQEA 1WZLA 3ZJ8A 1CTNA 2XVGA 1XV8A 3WF3A 5CG0A 1RD6A 3RILA 3MS8A 1PEZA 2VT0A 4KRTA 1GQKA 4UFHA 3CHDA 4UZUA 4D1JA 2O9PA 2XVNA 3AS3A 3UERA 3WUBA 1ESWA 4ZFMA 1OT2A 1DWFM 3KZSA 4R27A 3IK2A 1NWSA 3N9KA 1E6XM 4AZ7A 2XUCA 1EIBA 2VL4A 1CECA 5I23A 2BHZA 2WZEA 1C7TA 1EDGA 1BYDA 1HL9A 1M01A 3WH9A 4U3CA 4JL2A 1QHZA 5BXSA 3IAPA 5FIPA 2YA0A 1GONA 3AS2A 1HP5A 5CLWA 1JAEA 4IPNB 4PSPA 1CXFA 2W61A 1E9LA 2PBOA 4MTVA 4BS0A 4UFIA 1U2YA 5FKYA 2V5CA 1W3JA 3W27A 1B3ZA 1UKPA 1OBAA 3AXXA 4JKLA 3WQ6A 3TTSA 3IJ8A 3OA5A 4BQ4A 2Y5EA 1J10A 1G01A 5DEZA 5I3DA 3VIHA 4KGJA 1V6YA 1JZ3A 1E0VA 4ZENA 1JZ6A 2AAAA 2QF8A 2E3ZA 3AZSA 3CBWA 5IHRA 3N12A 1JFHA 2WHJA 1KB3A 4KH2A 2EPLX 4GO8A 3W26A 3M6DA 3A4AA 2WSPA 4B9YA 4P7QA 4GXPA 3HN3A 3VD9A 1CXEA 3CZJA 5C71A 3U57A 2E9MA 4F8XA 1UZ1A 3BC9A 4JKKA 4MDPA 1QHPA 2XHYA 3NYDA 4HMCA 4BF7A 2CKSA 4AIEA 1LG1A 4AYSA 3TTQA 3WD2A 4E8DA 1BYAA 4S3KA 2GVYA 1CGTA 3ARYA 1Q6GA 4GKLA 1QNRA 1C3FA 2RGLA 4MB4A 1A47A 2DT1A 4S3JA 1J18A 2BY3A 1EGZA 3NDZA 4MNKA 1P6WA 2EQDA 1BLIA 4CUCA 4QLKA 3SCPA 1VEMA 1E1EA 2VUYA 2WLYA 4HZ6A 2GK1B 1V3MA 1C93A 1HJXA 1VFMA 4UOQA 1UWUA 1D3CA 2BY1A 1J01A 1AVAA 2CBIA 1MW3A 4MB1A 3AZRA 1UQZA 2IXUA 1KXTA 3QHNA 3K4DA 4M8UA 4DWSD 3U7VA 1EDTA 2WSKA 2VOTA 3KWXA 1VIWA 1D7FA 4WSJA 3WQVA 5ABGA 1EQPA 5LYRA 4CU7A 1G1YA 1R7OA 1V08A 2XM2A 2C8NA 1WP6A 2YIHA 5HBFA
chains in the Genus database with same CATH superfamily
4XVEA 1ZP3A 5K9CA 3E0IA 1XLCA 4LEQA 1GZGA 3MHGA 2V30A 4IQEA 3OG3A 1UWTA 3PBWA 1M3UA 4LT9A 2HQAA 3W1LA 2CWNA 3ZFHA 2PLJA 1VD6A 4EXAA 4ZZ9A 1WA3A 3WQFA 6ENLA 3AHVA 2ZUTA 1UWRA 3C2OA 2DP3A 2FZMA 3PB0A 2FDMA 3NQEA 3LQGA 1VAHA 1WUEA 5EBAA 1UC4A 4MZ1A 4YVVA 1OC7A 3M5ZA 4EF9A 4JD4A 3EPNA 4O11A 4MIMA 4UTLA 2VX5A 4DXKA 4Q4OA 1NF7A 3W6YA 1PPIA 5A8OA 3GC4A 4L4OA 2VWSA 3HBLA 1QPKA 3P7YA 1TTQA 3S2CA 4L1XA 3M0YA 3SN0A 1KW1A 2IQTA 4BEQA 1UUQA 3IV8A 1V77A 3M16A 3B06A 3MYPA 1TZ9A 2CHOA 3W7KA 2HE5A 2A3EA 5LHEA 4JYEA 3BCFA 1EL3A 2O4QA 1NU5A 2VQUA 3S5OA 3MYOA 3TXVA 2XH7A 1XYAA 4KPLA 2FTWA 2RDWA 3CMJA 3CPUA 3G5EA 3KCLA 5JUVA 1IEIA 1H7XA 5I77A 2Q71A 3K13A 2CZDA 3GYEA 4EKJA 4O53A 3A4XA 4AZ5A 3MUZ1 1HZYA 1R3YA 3DUGA 2QYGA 3RO6A 3UYIA 2GOKA 1GCYA 1MW0A 5I3HA 4KIRA 4BR1A 4RE2A 3VZZA 3B9OA 4MHBA 1DYSA 1P4CA 4N6FA 1Q6LA 1VYPX 4TV6A 3LB0A 3D3AA 2A2IA 2ZADA 1RCXB 4QDMA 1D3HA 4GVFA 4TIMA 4G56A 4US5A 4LS2A 3LZ5A 3LA4A 3APGA 3FAWA 3O6DA 4QP0A 5AZ1A 1TVLA 5CGMA 3NDOA 2OZ8A 3URQA 2CZVA 4J3WA 5CSSA 7REQA 1YXDA 2ZX6A 3NXFA 1CCWB 3AU2A 1OFRA 4XISA 4WLCA 3FVMA 3HIJA 2X1IA 4NJGA 3W2JA 3OA3A 1EZWA 4OOZA 4J7RA 5PTDA 3VCRA 5AKQA 1QTWA 4HT3A 3N1AA 2YYUA 1WDPA 4KS0A 3QTPA 3A9BA 3MKVA 2HXTA 5DXYA 1L2QA 1US2A 4OT7A 2YL9A 3G77A 4GHRA 1FH9A 2P76A 3SQLA 3UA4A 3MCMA 4MAVA 1SZFA 1TPEA 3MSYA 4R33A 4CQDA 1B2YA 2VEIA 4RPPA 1K3UA 5IOBA 3W2NA 3EZ4A 4O15A 3UP8A 3GM8A 4MUZA 5HNUA 4DAFA 1VFTA 1EA0A 1GKQA 1KRBC 3V18A 1VBRA 1FWFC 1JNDA 1O66A 5A95A 2VX6A 3WMLA 2NQJA 4C6IA 4QE5A 4HP5A 1VF8A 2I1OA 1EHAA 2C1IA 3N6HA 1IT8A 3M0KA 3IGHX 4ZODA 1AFSA 1ZSXA 3STEA 4EVZA 4IFKB 5DXXA 1VJSA 3BV4A 2AL2B 3AI0A 3OO2A 2BVYA 1C9WA 2ABBA 1VENA 1S2TA 4RXGA 2F9RA 2J62A 4AWTA 4JX6A 4BWLA 4HTBA 2GWNA 4RV3A 4FX8A 3RN6A 4A29A 4F0LA 4HVXA 1GEQA 4IGSA 3LPGA 1PKNA 3BO9A 4GFSA 5KSWA 1KGWA 3S1GA 3SGUA 1V3LA 1E71M 2EEXA 5RUBA 3CM4A 3R8GA 3S5SA 1YE4A 3N25A 2NUWA 1KFCA 1JZ7A 1LBLA 3QH2A 5AHEA 3WK0A 4ORIA 1S2UA 2ISWA 3O05A 3WNPA 3L0GA 4U28A 5F4SA 1AJ2A 3THCA 3L12A 5I2UA 3AC0A 4M81A 4F9JA 4GY0A 1LT7A 1MO0A 2PF0A 1E70M 1VZWA 1DTUA 1QI0A 2D0GA 3L5LA 3WKZA 3SFKA 3WDPP 2PEVA 3OBAA 4PA8A 2QDGA 1SJCA 5I6SA 4W7WA 4GC4A 1MEWA 4GI9A 4W87A 4LX4A 2Z7GA 1A5AA 3WO8A 5MF5A 2ZICA 1EA9C 1FWSA 1V0LA 3AWOA 3ELFA 1TQXA 3M5XA 5E0FA 2J7DA 3PVFA 2D69A 4ZVJA 1KRCC 3S83A 4N9BA 2HS6A 3FV9A 3F4VA 3S1WA 2BOEX 4MLJA 3CAKA 3JVAA 2X05A 3C2FA 1VH7A 4Q6JA 2NSXA 5SWUA 2PCEA 3WLLA 2F6XA 5FL0A 1DQUA 1RPKA 3GNNA 3GE7A 3SURA 4NT0A 4J28A 3P8JA 2FPVA 4TV5A 4LB3A 5H8MA 4O54A 4LPCA 4HNTA 3P81A 1E6QM 3GS6A 2VRQA 4RZ5A 1F3WA 2QJJA 3FOKA 4XIMA 1EEPA 1X8FA 3HGJA 3KCOA 4DI9A 4YIWA 4H41A 4D6DA 4BQ2A 3B3DA 3EGJA 1DXIA 3ALGA 3VDGA 1JGIA 4RUBA 1ZFJA 1P6BA 1KQZA 4CCZA 3BAKA 4NXKA 1SUXA 1XIDA 3ZT5A 5A2CA 1UIPA 1SSGA 1OYAA 5TAOA 3H7RA 2G3IA 3PZ9A 5FACA 1PCWA 4DJFC 1UBPC 4S1FA 1BSLA 4XO6A 4JZ5A 4H9YA 4P8XA 3W81A 3CO4A 1O1ZA 2A3HA 2R1NA 5REQA 1KCXA 3RX2A 1OK6A 2W6RA 4FI4A 4GISA 3TV8A 2MUCA 3UNDA 3VMNA 4AG0A 5F4XA 1B5TA 3W7DA 1B9ZA 3WQOA 2VEKA 2FHCA 3GYCA 1TKKA 2PU0A 4XTIA 4GNVA 3PZQA 4HU8A 2G95A 4JX4A 4LNCA 4DWSC 1NWUA 2JEQA 5HXMA 3M5YA 1S39A 4XAZA 2AGTA 1SFLA 1GKRA 3EMZA 3IIPA 1J6OA 2NXHA 1BG9A 2JEPA 1J0ZA 1E9IA 3P93A 2Q6ZA 4LUTA 4W7VA 1HW6A 3CEUA 4O57A 4WJEA 4LOCA 1Y0EA 4QGCA 1ZALA 5HUPA 3UWUA 1L0PA 1E1CA 1WZMA 5EMYA 4WUIA 4GZEA 2JALA 1R30A 4RX0A 1X7IA 2CETA 3SI9A 1YIXA 1JZ5A 1VBGA 4KF1A 1LLWA 3BZGA 4ZB5A 4ACYA 4F4RA 5A3HA 1XHGA 1QASA 1W5MA 3UXAA 3CUZA 4DF2A 9RUBA 5I3FA 5FJTA 4UMAA 2GGJA 3NIYA 4AD0A 3O9NA 3B9EA 3W1TA 3KX6A 4MGGA 5CAHA 4L6HA 5HMEA 2E09A 4JQ1A 5TQLA 5CXPA 3QPEA 3GIYA 3GU1A 5FF3A 1E3XA 1P0NA 3GDMA 1AK5A 5DF0A 2CZ5A 4EANA 3AHTA 3NQ2A 2PC8A 1NM9A 3QR3A 1LLZA 5FF7A 3P2VA 3VC5A 5AHFA 4IIFA 1US0A 2WBKA 2YCJA 1ODUA 2WM0A 3LD5A 1W31A 3GTHA 2HVNA 4E2DA 3MB9A 4JQ2A 4QS6A 5A5WA 4CN1A 3O1NA 3W2LA 3M4HA 1OYCA 2Y61A 2CESA 3FN9A 2TODA 2CLLA 3A3XA 5I24A 3PJUA 3ZVHB 5G2IA 3IJ6A 4XKYB 2O9TA 4A8RA 1XX1A 1VYRA 1ZJHA 2EPOA 1W9UA 1EZ2A 4QDWA 1JDCA 1XH0A 3H2NA 1JDAA 5JBEA 2P8BA 2V38A 4PH6A 4HOWA 1XBXA 1PX8A 1ZHAA 1VEOA 1EWEA 2RHGA 5IBXA 1TB3A 7A3HA 3QV9A 3QZEA 4BF9A 4HNNA 3VD4A 1NFPA 1RBOB 2QCLA 1EO5A 4CCDA 1S3TC 4PUMA 2VEFA 2WHLA 5M2FX 2ZZ3A 5BRQA 2F6KA 1A0CA 1VGAA 1F6YA 4CNPA 5HPCA 1P0EA 1XIJA 1NDZA 4YVPA 3IV3A 1WPCA 3HPSA 3CTTA 1WBHA 1W1PA 5I09A 1OABA 3TOYA 3MW7A 1CLKA 4KMQA 1XIBA 3C3NA 1S3HA 1EFZA 4GI6A 3IEBA 1YNYA 2EG8A 4O1AA 1EJWC 4YL2A 2VOMA 3W00A 3AYRA 3BV7A 3C5QA 2DZUA 1SGJA 1W91A 2XH4A 2FVLA 3F5KA 2B7OA 3BICA 1ITXA 1ECEA 3GFZA 3KTSA 3MZNA 1HJWA 1KCLA 2VGBA 1IQ8A 4GGHA 1ECQA 1RUSA 4KFPA 4QAWA 4CLMA 4RR4A 2QCNA 2CERA 3VXGA 3U2OA 2E8YA 2X09A 3IACA 3FGCA 1GQJA 4LRTA 4O19A 2P3EA 1FH8A 1VYSX 1F8MA 3PK7A 4EE9A 1I75A 4HGXA 5AHLA 3UWQA 5DT7A 1RBLA 1V7YA 1QR7A 3CIWA 4RLIA 1J4EA 4JCMA 3LXCA 4JDBA 2WQDA 3SUVA 4K36A 4HA0A 3DHPA 2Y85A 4X2PA 3AMCA 4Z1CA 3BANA 3F03K 3G1YA 5K2ZA 3HGRA 3FHAA 4M56A 2AL1A 2J4GA 2OWWA 2VR5A 1HVQA 3VM7A 1IXQA 4DWSB 3ABOA 3DERA 1XISA 3MBDA 5C6MA 4ZO9A 2ZUVA 4LBSA 3ARUA 4IP5A 3CMGA 4QEHA 1OCBA 3WJYA 1QI2A 3ZZ1A 4DUWA 3TCSA 5BMXA 3PTQA 3DENA 4DBUA 4UWMA 2VR4A 1SZRA 3N14A 1V03A 3QYSA 1UPPA 2YKKA 5C9XA 3FA3A 4K8HA 1XSKA 4CNSA 1W3NA 4S3DA 2D1ZA 4GIEA 2FHBA 4DJEC 3TA6A 1KM6A 3WLMA 1LQ2A 4IFRA 4IMAA 4E3VA 4IG2A 2YCLA 2IPWA 4GIYA 2QVHA 5ENLA 1GVIA 4CVWA 4GQQA 4ASTA 3PZUA 1Z32X 3UWWA 2MNRA 1RK6A 3PULA 4Q4KA 4PB4A 4UTTC 5A2AA 1LRTA 3S2JA 1YADA 3SECA 1J93A 1I2NA 3WNOA 3NSMA 3AIBA 3CPRA 1W0MA 3N2OA 1ISYA 1NTHA 3CV7A 2ZFAA 4AY7A 3N11A 1KTCA 3I3DA 4M3PA 4AISA 4GA8A 3QFWA 2PDHA 5CQ1A 3TZFA 2PWGA 1JUEA 4EIVA 4KESA 4MKVA 1PJ9A 4S23A 4G7EB 1FH7A 2DSKA 1QPQA 4I7UA 4GCAA 4LYPA 4GUHA 1BYCA 1NDYA 2O4MA 3H4XA 2VD9A 2VC5A 4IM4A 3UQNA 4ZO6A 2ACSA 3MSGA 4M51A 5FEZA 2NLYA 2VC7A 5LIUX 4FOJA 3SBFA 1US3A 3RJYA 3DG6A 3M0XA 4JQAA 7ENLA 2Y2WA 4RL3A 4MY8A 3ORWA 3QPZA 1DWGM 2XFWA 2YCIX 3T1GA 3L4XA 4LB4A 4IZGA 4GFIA 3M64A 1ONWA 1SMDA 4H1ZA 1J8VA 1IT0A 3GZ3A 1HKKA 5T26A 1O1HA 4Z1YA 4XAYA 1UWIA 8XIAA 3WLQA 3XIMA 2ZZ1A 1EUAA 4Q4RA 1R3VA 3E49A 1HO4A 2IKIA 2YA2A 3WDJA 1TCMA 2OVLA 3T4CA 3S1UA 3NZ1A 4DEFA 3DC0A 4GKTA 4P8UA 4RNFA 4HMNA 3S42A 1HGWA 3W1MA 1MI3A 4PMXA 2ACQA 2V3EA 2IMRA 1X1OA 5KETA 3FYYA 1SU5A 3W22A 1EDQA 4REQA 3ZR6A 2C91A 4C6JA 1JQVA 2Y8VA 1O5QA 3GVVA 3MHUA 4MFEA 3TP4A 2TMDA 2PPGA 1ONXA 3UG4A 1KV5A 4OUIA 5BRBA 1QNPA 1B3YA 3P0XA 2XIBA 4O0KA 3GBEA 1H2JA 4KEZA 1BYBA 4P61A 2ZUMA 3K8MA 4NZJA 1J96A 1W1ZA 1W3LA 3UG8A 4LC6A 2PGEA 1Y5XA 4ZOBA 1EX5A 1QNQA 3APYA 3R8RA 4YTUA 4E2OA 3VKBA 1VS1A 4MWAD 1LDCA 1L2UA 4ZMGA 5CLTA 2C18A 4H4IA 3EX3A 2PGFA 3TE9A 4XSMA 5EY5A 4X0VA 1KFKA 4I8YA 1XRTA 3FDKA 5HR6A 3SCOA 3LCIA 1OWQA 3G2GA 2OKTA 3AIUA 2DJLA 1OX4B 3PNUA 1O95A 2WNQA 4GWEA 3GH5A 1ME7A 3TONA 3URNA 5CBIA 3V75A 2PF8A 1EC9A 3W1QA 1M7OA 8A3HA 4HNCA 4R5EA 1C9DA 5LIKX 1KM3A 1J0JA 1I9CB 3V0TA 4WOQA 3BLEA 4AEOA 8RUCA 2UWFA 2ZUUA 5AHIA 1NELA 1FWJC 2Q8XA 2CXEA 4H8HA 3VUPA 1DORA 3GH7A 3P62A 5CH9A 1X6LA 3UW6A 1JUKA 3CQIA 2DW6A 4Q8PA 1E15A 4HK6A 3WQEA 1K7FA 2Q8ZA 3WLKX 2J7HA 3GVRA 5CPNA 1AMKA 1HL2A 2Z28A 5A69A 2YGYA 4C6QA 1GPFA 1K8CA 3T2PA 2BS9A 1XLJA 3L23A 4DZHA 3SSJA 4MZYA 1H3GA 3IVSA 2XGBA 3CO8A 1Q8AA 4JTDA 4V33A 3O6CA 5GPRA 4OTKA 3OHMB 1DQWA 3GNOA 2J7EA 3W29A 4W93A 2PTWA 1XBVA 2WJDA 4HSNA 1BVZA 2WWDA 3W74A 5IFTA 5CBBA 2QJMA 4GUFA 1YDVA 1ZCCA 4F0HA 3E5BA 3PBYA 5FL1A 1K9FA 2RFGA 3IGXA 3PZVA 1GW9A 3OU8A 3EOOA 4IWWA 3PAJA 3W7CA 3N4AA 3ZJ6A 4FX6M 2EPNA 4H00A 1WKEA 2EJ1A 1V5XA 2YDSA 3UBPC 1W1VA 1G4EA 1V93A 4FP1A 4Q7NA 4HIBA 1A0DA 2V68A 3SCSA 1UIOA 1XYFA 3PAOA 4XAPA 3FSUA 3MQTA 3XINA 4D71A 1POKA 4M80A 3V5FA 4HPNA 1Q6CA 3S4TA 1AJZA 3EXRA 3DBPA 1VQTA 4KIEA 1M41A 3WQPA 3CWNA 3M46A 4XBKA 1HJUA 4LTSA 1K77A 3YPIA 2A7RA 3ZLGA 2J8TA 3KHDA 4S2CA 2QNEA 1FY6A 4PMUA 3ABXA 3K8KA 2WJEA 2DZTA 2GUYA 2E77A 4NZCA 2L5HA 3NO1A 1W9BM 2D20A 2VGIA 5D9NA 2W79A 1V6TA 3KUMA 4JTSA 1T8QA 2PWHA 2CBVA 5D05A 3MDWA 1PIGA 2ZOXA 2VTFA 3BWWA 5DCDA 1GJUA 4W8BA 4IIEA 4DBEA 1SYTA 2E5CA 2WK2A 2C13A 2Y7DA 4JTTA 1V51A 4BA0A 4XZIA 3NO3A 3W23A 2VHLA 4XUGA 2C7FA 3O6AA 4MAZA 3T0TA 3ME3A 1LORA 4E8GA 1RCQA 1H50A 4A3QA 4B5SA 2CKRA 2QEZA 3LSBA 2NV9A 1FXQA 3OYZA 4U2ZA 5B80A 1E0WA 3WLPA 3UZYA 2R1LA 3R0UA 2V3GA 1HJVA 2IS7A 1Z7AA 2NVCA 1A5SA 4GI8A 2YOCA 1LOLA 2FKPA 3RYSA 4FF7A 4ADTA 5XIMA 3AYVA 2W63A 4J3SA 1UCWA 2JGQA 3ZSSA 1EX1A 2XINA 3R10A 2A3AA 2V2DA 3TYBA 3V5CA 3G0UA 2DT3A 4LV9A 3P5YA 1TPDA 5DCEA 3LLFA 1XYZA 1F7BA 4B3ZA 2I5QA 4EXQA 3SRKA 4UTKA 1OYBA 4A3RA 3GNXA 3MV01 4CNUA 1NF0A 2DT0A 5AYXA 3MDUA 3MWCA 3C2VA 3UWVA 3HMCA 2Z27A 1W3TA 1X8CA 2HK1A 3W7MA 1K8YA 4JIIX 3U4AA 1D9EA 3VAVA 4QHRA 4WCJA 3FEQA 4DBSA 3S2NA 3ES7A 3W24A 4KEVA 1XGZA 3V1PA 3RAOA 5M5DA 5FSEC 4YLWA 1KQYA 3KLLA 2VFFA 4IFKA 2HDJA 1XGEA 2OYKA 3A64A 1W1YA 2XWDA 2OCZA 3IANA 4JIQA 4N7QA 5BCAA 4LUSB 4IMGA 2YSWA 2G3JA 3DFQA 3LLDA 1EGVA 3SQSA 3HQOA 1QWKA 5BZAA 1BXCA 3HB9A 1RBAA 1RA5A 4I3GA 2CPUA 4DNHA 3VGEA 3TW9A 1GZJA 4GC3A 1XCFA 1WAUA 4Q3MA 1OY0A 5HWJA 1PKMA 2X7VA 3EWUA 4IQJA 3T42A 1TV3A 2FTYA 5CJMA 3E12A 3ZS4A 5GVJA 3LCWA 2ICSA 1R46A 3PFMA 3UR2A 1GZ1A 1RJRA 2Z29A 2ZQ0A 2EPKX 4BQ5A 5DBUA 3IJ7A 2VURA 2Y8KA 3PFRA 3EA1A 3MI2A 4DM2A 1JYVA 4O8AA 2OQHA 2D3LA 5HANA 5BOEA 3N15A 4B2DA 4X63A 3PTDA 5F2MA 3VNJA 1FFQA 1FXPA 2ZC1A 3HO8A 1L6GA 3LN3A 4P7NA 2X40A 4U5IA 4PEEA 3HFYA 4S3CA 2AMGA 4Y7EA 2W27A 4E4UA 3WENA 3D6NA 4K6AA 1W9VA 1RCOB 4LUJA 1N8FA 2PDBA 3AHXA 1V7AA 3EOUA 2A3CA 1IHIA 2XN2A 4Q8UA 2HE8A 4RZ4A 2BVWA 4HOXA 1HFBA 2RDUA 4UQEA 1WZLA 3UJEA 2HK0A 5CG0A 1RD6A 4ZOCA 4KRTA 2F84A 3DBNA 4FXJA 1GQKA 4UFHA 4AVFA 4UZUA 4D1JA 4R27A 1EIBA 4HCHA 1CECA 4XZLX 3EEGA 5C9WA 3Q58A 1BXBA 3ITOA 1KM2A 1JRCA 3L5MA 5BXSA 3RUBL 2YA0A 1RQEA 5G1YA 5BMWA 1H1YA 4I7WA 5CC3A 3GG1A 4L80A 1RQHA 1OFEA 2ALDA 3LM3A 3NEHA 1RA0A 3Q2DA 4ES4A 1SM9A 4IPNB 4CQBA 3CQJA 3TAOA 3DDMA 1CXFA 2PDPA 3HG2A 4HNLA 5HR7A 4Q7IA 4MTVA 3IUDA 4UFIA 3CL8A 1IGSA 4QJ5B 3KCJA 3PPGA 3IJ8A 4DPQA 4A05A 1J10A 1G01A 4UTHA 3L7RA 1T40A 4MSSA 2E6FA 3HG4A 1QOPA 1JZ6A 2Z1BA 3AZSA 5IHRA 3N12A 4TX9A 2P3ZA 3NQBA 4GO8A 4MKSA 5K3VA 1LRQA 1POJA 1FCBA 4GE8A 4B9YA 1OF6A 2I57A 5C71A 3U57A 2E9MA 4F8XA 3D46A 4YTSA 4JKKA 4MDPA 1QHPA 1T96A 4WXYA 4HMCA 3BZJA 3W7LA 4M19A 3KHJA 2CKSA 4QSHA 4O50A 3EX6A 2DZWA 4GKLA 1C3FA 2RGLA 6XIAA 4F2UA 2NV1A 2Y5SA 1JULA 1TCDA 3RLUA 3NDZA 2I17A 2VENA 1P6WA 4HPXA 1MRQA 4FOKA 3LBMA 4EP8C 4QXIA 5EMUA 2AQWA 2VUYA 1XW8A 2CZFA 4DJDC 1A5LC 3GUWA 3PJWA 4UOQA 1UWUA 1D3CA 1GKPA 2BY1A 1QW7A 1QO5A 3FJNA 2WSRA 1FDJA 2TSYA 4WQ6A 5XINA 3TN5A 3GG8A 4GMEA 4H9MA 2Z25A 1EDTA 2Z2BA 2WSKA 3NG3A 1QOQA 1XLFA 1D7FA 2BMBA 2DY3A 5ABGA 2PZ0A 3W2MA 1U83A 5LIYX 1G1YA 1R7OA 2C8NA 3EWZA 2NW0A 1KCKA 4C6LA 1IGWA 4PCSA 2OO0A 4JY8A 1E5NA 5TF0A 3OZPA 2FVMA 2BWGA 3WNLA 1BRLA 4PULA 5HPOA 2V2HA 4PN2A 4WD0A 1DJNA 1CXKA 3NQAA 2VXNA 2V63A 5A6JA 3OGRA 1NQ6A 1AD1A 2DGAA 2VI0A 3WH6A 2JF7A 1E40A 4TOQA 3PSWA 5GNZA 3RPDA 1CGXA 2V5LA 3FJ4A 1R3QA 3C0LA 4Z2GA 1CDGA 2GQ9A 1SO6A 3ZVHA 4BWLC 5I3KA 5BXTA 1E6ZA 2J9XA 2C79A 4FX7A 1WAWA 1YEYA 3ECQA 3HF3A 1VHNA 4XZHA 4DX3A 4UQ9A 3NQVA 2D0HA 5B7YA 1Q6RA 3QZ6A 3GAKA 4G1NA 1RY8A 3A24A 4JTCA 4RNJA 2Z1VA 3CT2A 3EB3A 4MLRA 1L6FA 1UPMB 4XUYA 1LOSA 4MPKA 3REQB 3ZVIA 5M17A 2DZVA 4IJRA 1AA1B 3SDOA 4NYUA 2B81A 5IXEA 2WAGA 1ZQ5A 1R85A 1TPWA 3M7WA 2VCAA 4L9XA 1A80A 3EA3A 3JRKA 1PS9A 3QY8A 2VVNA 1DJWA 1A5BA 4PL1A 4AFYA 2OWXA 4GYJA 4NU7A 1D3GA 1XIMA 4H9UA 1O5RA 4Y8EA 3WELA 2B7PA 1K9EA 4LYQA 4RW5A 4W9TA 3HGOA 4H9VA 4FSAA 4PYSA 1Z69A 2DSUA 2OZ0A 1HX0A 1RY0A 4I6KA 5BOFA 3KVJA 4C7GA 5FAJA 4A3YA 1BQCA 4HZ8A 2YL5A 3DYMA 1LJYA 5TNVA 4JDYA 2IKJA 3C8FA 1OG6A 4DXVA 4J2MA 2J27A 3MZ2A 1J11A 3KDNA 2DIJA 3PUEA 4UR8A 4CQ9A 3QTGA 3WQ8A 1OGGA 3ZJKA 4NHVA 4QCEA 1NVMA 5C8BB 1R8LA 1XSIA 5BRPA 3RM4A 3WBEA 2G96A 1FWIC 4JQ3A 4GNJA 3ZMRA 3H6OA 2ZDSA 3KOXA 1BWLA 2C15A 4NRSA 2QLYA 2I14A 3ITTA 3TROA 4EPKA 3TU9A 3WCZA 3CWHA 1KR0A 1JEZA 4I9JA 4ERGA 3CQHA 1TWWA 3T78A 3DFSA 4CQ8A 3PNZA 1KV8A 2DSWA 3A23A 1T99A 1PIIA 3QQWA 5FJUA 4R9OA 1M1BA 2PB1A 4HNUA 3SN1A 1UBSA 2CWXA 3GX9A 5FD0A 1JXJA 5FJRA 4DWSA 1PSCA 1I1XA 5BNKA 1QK2A 3BPWA 1OZQA 1QPRA 4QX4A 2P50A 2ABAA 2VO5A 2AMXA 3UWZA 3SUWA 3CZ8A 4AZCA 3SIZA 2GYIA 1HN1A 1H63A 4O13A 1DQXA 3HPFA 2VFDA 2TAAA 4RE3A 3SRHA 4NRRA 3F4CA 3G1AA 3NQGA 2IQ0A 4DELA 2WBGA 2C14A 1VLWA 3AIEA 3TYAA 1GOIA 5I3GA 1K9TA 4Q8OA 1MDRA 4QQ3A 2NLIA 1CXHA 2ZX9A 3QGKC 3M1ZA 2XFFA 3NO5A 1XF0A 4H7ZA 4DHGA 2UV8G 3NL6A 2PBGA 2FB3A 1Q65A 3OQ8A 4M1RA 3IIXA 4I8DA 2WXDM 4YN5A 4IP7A 3LV6A 1JI2A 5DRCA 1G94A 3W76A 1A5OC 3QR0A 2X1TA 1EWDA 2H9AB 3KEHA 2J79A 3DFYA 3VKDA 4O1EA 5A8MA 2PWEA 1YPFA 1JD7A 3NAVA 1OADA 1XC6A 3QN3A 3QHOA 3CH0A 4GNKB 1E4NA 1U30A 1X38A 3W02A 3LGEA 4MFDA 4LFYA 3GSMA 3R4IA 3RU6A 5CKSA 3VDHA 3KAOA 4M6QA 4AAJA 3WJSA 3WMBA 3A3HA 3W70A 4M5PA 4OV4A 2R1KA 1GGOA 2OPJA 4NAFB 2H3DA 4PTNA 1QO2A 3H2CA 2ZRYA 4P7OA 4PUWA 1GQIA 2NZLA 3W84A 1LTDA 5DCBA 3T2QA 2WC7A 1NFGA 4Y96A 1OB0A 3VDAA 1ADDA 4G9PA 3FIGA 1B0IA 1F9CA 5D9OA 3OQEA 3VDCA 1EUNA 4P5UA 2DVTA 1C8QA 1DIOA 4GJJA 1CI1A 2BHUA 4JAWA 2QCEA 3GNRA 2ZRZA 1XKJA 2FZBA 4MNMA 1GOQA 5IFPA 1GOWA 3GG7A 3LXAA 5XIAA 3BLPX 2E28A 3T2OA 1R2RA 3A3WA 5AECA 3MP3A 4PMDA 1ZCOA 1BKSA 2OYLA 1DIDA 3NNTA 4XQ6A 3LPFA 3WQWA 4XKMA 5IBXC 4PMNA 4AC1X 1OJXA 2J77A 4GABA 5C5YA 4FB7A 4PRTA 3ICJA 1D8WA 4L9ZA 4CN6A 4FR6A 4X22A 4KBXA 1H49A 3AMKA 1W3HA 3OJGA 4EX4A 1DIKA 1TPH1 4LNYA 2YCEA 4Q4SA 3DG7A 1B31A 3P82A 4MG4A 3P61A 3E2QA 1QUMA 3I65A 2IKGA 2Q3RA 5CAKA 3C3UA 4H6KA 5AC8A 4GXWA 3BCDA 5C55A 3URAA 2JIEA 3BAWA 3EOLA 3NYZA 2W66A 1Q6EA 1YPIA 4HPGA 2CLMA 3BGJA 2VELA 3T6CA 4AF0A 1E72M 5C54A 1JUBA 4CEXC 4KCVA 1Z3NA 1A4LA 1FWTA 4QISA 4ZBCA 1J0KA 3CUJA 1GQNA 4WKAA 4X3ZA 1YBQB 3KRBA 1TVNA 3B8SA 4L4LA 2QJNA 3BK0A 2ZX5A 3W82A 3B0XA 3EKGA 2DH3A 5DFAA 4ZQMA 2XFRA 1UR4A 5REQB 4PMVA 4L61A 2BASA 3MCOA 5D2VA 4JTUA 1FWNA 2G4FA 4EPBC 2VUNA 2TPSA 3C2YA 2OQLA 3VMOA 1Q6QA 4AIOA 2DIKA 1N8IA 2G0WA 1NP2A 5G2HA 4H83A 1CGVA 4OECA 2VEMA 1DHKA 3SCTA 3M0ZA 2A7PA 2R91A 3DI0A 3LHVA 1IWBA 5KZ6A 4RPQA 5BWAA 3GXTA 3BSGA 2E9BA 1EJ7L 3IRDA 3IVUA 4UIOA 5EYWA 3R0DA 1F3TA 4IPIA 1R2TA 5AVNA 4S3AA 2GFTA 3W2KA 5AC7A 4HZMA 1E1CB 3GXMA 1WKFA 2ZRXA 3S9YA 4ILSA 1JPDX 3IRSA 5TD4A 1SO3A 1KXVA 3VC6A 3QBUA 2V0TA 3VIMA 3CHFA 3MUCA 1UHVA 2Z24A 3V4BA 1XR2A 2GWGA 2J88A 3QYQA 1VFHA 2GQAA 4E2BA 2H3BA 4UFMA 4JN7A 4CCEA 4M6UA 2UY5A 4U2YA 1A5KC 3SEPA 5FOOA 4IMCA 1EKOA 1KRAC 4JXCA 3WUEA 4ORMA 4KQNA 1PDYA 1DL3A 2KAUC 5HMFA 2Y62A 2CC0A 3EKZA 3UJFA 1B9BA 1Z41A 3N2CA 4R53A 4MOZA 3T81A 2OSWA 2FYMA 2BX7A 2QQ6A 3TC7A 2JKPA 4PCFA 3KOFA 3B8WA 5GJMA 4HU4A 4LYRA 1KM5A 1XBYA 3QM3A 4TO8A 3TEVA 4FK9A 1UWQA 3OPSA 5AFDA 1CLVA 1Z42A 4E8CA 2PURA 3S9ZA 2WCGA 2POTA 5T8GA 5F2GA 3CUIA 4ZFCA 2CLOA 3A21A 4IHCA 3IUHA 1MSSA 1OVDA 4GK8A 1AUSL 3RM8A 5KZEA 2GJXA 3B05A 2J25A 4FF5A 1KFEA 3RLGA 4MJZA 1P43A 2WCSA 3I6RA 4LY4A 1UKQA 1TWIA 1ZBVA 5G2WA 2P53A 2WZTA 2XVPA 1JF5A 1NDVA 3ZR5A 4RK8A 1IR2A 2NX1A 1KM1A 3QHMA 1DWJM 1L6WA 4O4WA 4P8WA 1PX3A 2ZXBA 1WDRA 3RITA 4CNNA 3A22A 1HT6A 4MJ4A 2Y63A 2EKGA 5H91A 2VR2A 4F9DA 4Q6XA 3UWYA 4OOUA 1EBHA 2NX9A 3LQLA 4ICMA 1AODA 1WX0A 2Y5JA 1JPHA 3WLOA 4FNUA 4WDWA 4HA4A 3IJ9A 2KZHA 4AHPA 3L4YA 1DJQA 1XLKA 4G2DA 4LWWA 4AVNA 1GVQA 2CZEA 1AW5A 4GUGA 3LBOA 3TVAA 3E2RA 4R85A 1PTAA 4H7VA 4C65A 3KBJA 3TJLA 3VKAA 1XLGA 2CXGA 4GO9A 1BXNA 2WMFA 3UA3A 4WIWA 1PTDA 3T07A 2ZWZA 3VD5A 1V3KA 4FLQA 4NF7A 3OLDA 1FCVA 4Z2KA 3O07A 2NUYA 2BZNA 2VZOA 2V5DA 2EXOA 1F73A 2XJ7A 1XLIA 4GCXA 1GVOA 5JIWA 4A4AA 3S3GA 4AY8A 3AS1A 4L7ZA 1R3RA 4WDTA 2PRLA 3GU2A 2XTKA 2CEQA 5LSMA 2XM1A 1TV4A 1XH1A 4HB7A 2W62A 2JE8A 3UXLA 1THFD 4UFLA 5EA9A 1GVRA 4Z1BA 4PRWA 4BI6A 5A6MA 4QJ1A 1EYEA 5LKYA 4C1KA 3AWNA 1V3IA 3H4WA 1FWGC 3WFAA 4HNVA 1GEHA 3BH4A 3TYEA 2A6LA 1WZAA 4WF7A 5A6BA 3PZNA 3WN6A 3EWWA 3T9PA 1Q6FA 4X61A 3RNDA 4NX0A 2DEPA 3ITCA 3A5FA 3RCNA 1KRMA 3W4RA 1IEWA 4LUSA 3K46A 2HNEA 4ZL1A 3L68A 1G4TA 1QI4A 1CW2A 2QDHA 1Q6OA 4JS3A 3MO7A 1O60A 2OZTA 4IG2B 2YCLB 4AHQA 1YMYA 3WD3A 1LWJA 1H5VA 5M3WA 3U2ZA 3I6EA 4L6OA 1ZENA 1QCWA 1OK4A 1C8YA 5F1UA 4BKNA 3UR7A 3B8IA 4KCTA 1H51A 3KBWA 2EF9A 1XDMA 1SO5A 1TJPA 2I5GA 3UFYA 3MHFA 3G22A 1E5JA 1TX0A 1FWWA 5CEWA 3AHZA 4K38A 3M5VA 3FFSA 2XIMA 3CASA 4PFMA 2YYTA 1S5VA 3BG5A 4LCSA 2EPHA 1TWDA 3QOMA 3WD1A 5LNRA 4QTGA 3GVQA 3B04A 2E0PA 1TV2A 1JNEA 4DO7A 3CZEA 4AXNA 3CH9A 1I0BA 1A50A 1YXCA 3KM8A 3R13A 2WMIB 4RDYA 1BF2A 3GTIA 3WD4A 4CU8A 2PSNA 1LBMA 3EX1A 2VKZG 4E3TA 3VKJA 4QQUA 1DJIA 1WDWA 1SFSA 2Z1XA 3SY1A 2DU2A 3R25A 1JYXA 1FOBA 3GVGA 1R2SA 4OKDA 3L0NA 4A6GA 3BLKA 1MW1A 1UKSA 2XISA 4RZBA 6XIMA 4HD5A 3DCPA 1FP9A 4AUBA 5HMSA 1IR1A 2PI6A 1XLHA 2XN1A 3EMCA 3N6JA 4QLJA 3BDKA 4GLEA 2XIOA 4IP4A 2W0UA 5F4WA 2NQ9A 3TSBA 1KNWA 2QPUA 4K8GA 1UMYA 3G1HA 3M47A 3R43A 2YL6A 3ZO9A 4H8VA 4HSHA 4NY2A 2CLPA 3AMDA 5JQ9A 4Y9AA 3U2CA 1T8XA 2GGHA 3WYZA 3CK5A 2PA6A 2EG7A 5EMLA 2ZXQA 1SMAA 2PU1A 2WZHA 5I79A 2WNWA 4WR3A 2PDGA 5I7GA 1BF6A 4BHYA 1CB7B 3ALFA 1Z89A 4JNMA 4AX7A 1B30A 3WBYA 5EFDA 4GQBA 4J9JA 3LSCA 1RP9A 1ALDA 6TAAA 4QITA 5T9CE 4QAIA 4OBTA 4DY1A 3TWAA 1MDLA 3ABRA 4REQB 5FSDC 5I00A 3G8RA 3QMTA 2Y24A 4OBRA 4O4VA 4DLMA 4QM1A 3PR2A 1H61A 3UCCA 2W3ZA 1FP8A 3BMVA 4NNBA 3DAQA 5AHMA 2BXYA 1ZJAA 4UMBA 1J5TA 3W85A 4H2CA 2RDXA 2EJAA 3KTCA 4S3FA 2XYLA 4HCDA 3EX4A 2CU0A 3LHWA 5D2WA 2X8RA 3LG3A 3GXIA 1CGWA 2QCDB 1ZZMA 1V6VA 5HWNA 4UTFA 1XLDA 3E74A 3PHAA 4IX2A 4NVTA 1YNQA 4K2SA 3F1QA 6REQB 2X41A 4ZGYA 3BW4A 4V28A 1IIHA 2C1HA 3O0FA 1H0IA 2UBPC 5JXQA 5CSUA 1I2QA 5H1WA 4LALA 4D6EA 4R7WA 1Q7MA 3ES8A 2WWCA 4HYVA 3BMXA 4XZNX 1PKLA 1TTIA 1JCLA 3RRAA 4TX8A 4OU1A 4DNMA 2HBVA 3G1XA 3D3FA 2XIJA 3FXYA 4JPGA 4MADA 1B90A 1WKDA 3R8HA 3I10A 2VCCA 2FFCA 4A8NA 2PODA 3AMLA 3NQCA 1Q4WA 3Q65A 3RLVA 2PTZA 4HKPA 2YLLA 1L6SA 1EP1A 4E2VA 4Q7BA 2ZKMX 3ARVA 3H54A 3GNDA 5LXEA 2WC4A 3IIVA 3PUGA 4UCGA 3M43A 3LM7A 3ZQ9A 4FXRA 2F2KA 3OBEA 1GVYA 4JN8A 4I6VA 1UC5A 2ONEA 3CNYA 1TPFA 2G50A 3AZTA 3NFUA 2Q8LA 3B40A 3V0SA 3FY1A 4CEUC 4O1FA 1IZJA 4JTJA 3OZYA 4QCFA 1OIMA 4GQ0A 1QDSA 1MXGA 4MZ8A 1UA3A 5K9XA 1E6PA 3SUTA 1QATA 3I3EA 4H19A 3B4YA 3CL6A 1RAKA 1AL8A 1W37A 2X0HA 4JTLA 3MUXA 3T40A 2QF7A 2YFOA 3LCFA 4QE4A 1CX9A 1E4IA 2VGGA 3MMUA 5C9RA 4DAIA 3ISIX 2OLSA 1IF2A 3REQA 4NI3A 3CV2A 4WX2A 5CZ0A 4AEEA 1VFOA 1K1DA 3GXDA 3WQ5A 5CBJA 1Y8BA 1KFJA 1WNOA 1FRBA 4B5UA 5CZJA 1W1IE 4Z2IA 3Q45A 3CIVA 3W28A 3VIJA 1Q2SA 1XLEA 3N18A 2YDRA 2E6AA 3IIZA 1W32A 1GHSA 2FTPA 1UZ4A 3R12A 3UNTA 3KVMA 3D0CA 2QKFA 4MPQA 5HK4A 2FHFA 1ZJBA 1XCWA 5HNTA 1BWVA 2QVNA 4AY1A 4JEQA 3WEZA 2CNCA 3OEXA 3VCCA 4C6MA 5K4ZA 1WV2A 4KETA 2PWFA 4B5WA 4LANA 1YDOA 4PBEA 3IPWA 5FEPA 3RCMA 4K1WA 1BAGA 4HK5A 1P7TB 2XVKA 3PUDA 1VP5A 3L2IA 4KRUA 2VVSA 2V3FA 4ATLA 1JZ2A 3UCQA 1RH9A 1YDNA 1VBJA 2QJGA 3VD7A 2WVSA 2NQZA 4UCFA 2E6YA 4AWSA 3TC3A 2NQ5A 2YB4A 2VEPA 2O56A 4XZBA 4Y90A 2Q09A 2O9RA 1VCFA 2P8CA 1FFRA 5HOSA 1RLDA 3V7PA 4JHOA 2ISDA 3FW6A 2AKZA 1KO0A 3K2GA 4XB3A 2PDJA 2QV4A 2PAJA 3U7BA 1C90A 2ZA1A 1UP0A 1W54A 3MKCA 3NVDA 4AD4A 4GIRA 1V0NA 3SUSA 4LQ1A 2W91A 1GVFA 7CGTA 3BAIA 5GJPA 5E0CA 4QR6A 1E0UA 3CC1A 1UD8A 3BW2A 2UY4A 3NZQA 1GOKA 3FA5A 1GW1A 3ARRA 1T0OA 3P80A 3O06A 1UH3A 2MANA 2QT3A 2X2GA 3LCHA 3WLIA 3ERPA 3KFTA 4G6CA 4DIAA 3FSTA 3PTKA 3PJTA 3E2VA 1KLZA 3NUKA 3STFA 2PTXA 1YW1A 4HHLA 3QXBA 3WJXA 1A4MA 1IXPA 4QJ3B 4DJDA 3VILA 1U1HA 4WZHA 2WSYA 2IXVA 3UXKA 2FQIA 4GIAA 4DF1A 2FGLA 4GJIA 1F3XA 1I6NA 1O6IA 3EEZA 1ZPTA 4N0RA 1XFCA 1HKVA 3SGGA 3ARQA 2H9AA 5FJIA 3UZXA 2VDIA 3SFWA 3MI6A 4FNQA 3MTWA 3QFEA 1MFUA 3GNPA 1VPQA 2PUZA 4M82A 1F76A 1F8IA 3QRHA 5EMKA 2WHKA 1LQAA 1UD2A 4C5YA 3W37A 1DJXA 4I5XA 1H41A 1GG0A 2ZTKA 2HNHA 5AC6A 3HQNA 3KBNA 5J5RA 3RGTA 3R11A 4U3AA 1AH0A 4NAFA 2PP1A 3GW3A 4ZXLA 3RIKA 3WD0A 1UW9A 2NT0A 3ZR4A 2ON3A 1VPXA 4HHMA 4AXKA 4PMQA 3NL3A 5CPTA 5FCZA 4DPPA 1TJ2A 3U4FA 3VOCA 2VZUA 4WOZA 3D5HA 1XC4A 1ME8A 4H6QA 1PHWA 5LGZA 1Q13A 3KE0A 3I68A 3HM7A 3HGSA 4C6CA 3KBSA 3E0VA 3PUOA 1SW3A 3KRUA 2G4JA 2G97A 1KD0A 4KKXA 4XSLA 4AZBA 2Z4GA 3CJPA 3WQDA 1SW0A 3KW3A 1VJIA 4QG6A 3FK4A 2FLIA 4RDWA 3NVTA 3OTRA 3O8AA 2RGMA 5BW6A 5BXPA 4O8RA 1UWSA 3VKKA 3B9NA 4NJKA 4KFOA 1HL8A 3WMCA 1E4MM 5I78A 1UP3A 4GJ1A 2Y6ZA 4OVXA 4KGLA 4TUFA 1WQ5A 3ZJ8A 2XVGA 3WF3A 3ABZA 4NZFA 4D8LA 3QQ0A 4HBKA 5JU6A 4NAEB 1I4NA 5D2TA 2NVDA 2O9PA 3WUBA 1ESWA 2D2GA 1OT2A 1PO9A 2GGEA 1DWFM 5IM51 3KZSA 3LERA 4Q4QA 1NWSA 4AZ7A 2OEKA 2XUCA 1I0DA 4RZ6A 5I23A 4HCLA 3EWCA 3LBCA 5C9ZA 3S1XA 3SJNA 3GO2A 1M01A 4ADUA 1P5BA 5FIPA 3TQVA 4B4HA 3QJAA 3AS2A 3H12A 4HSOA 3UPBA 4MWAC 1TX2A 5TBOA 1SZGA 2DORA 2OTDA 1TJRA 3GTFA 3NL5A 3DFOA 1UMLA 3LMZA 4UTMA 4ZQPA 1XUUA 2W61A 1E9LA 4YU1A 3VOFA 4FALA 4B5VA 4C6PA 2PTDA 3GKAA 5FKYA 4DI8A 4AU0A 4ZB2A 3KLKA 1UKPA 5D2YA 1EB3A 1H7RA 1SJDA 3AXXA 3TK7A 3WQ6A 1YBQA 3OA5A 2P0OA 4BQ4A 1WYIA 5DEZA 3W1PA 1NEYA 3MA8A 4KGJA 3W1NA 4ZENA 4QG9A 2QF8A 2E3ZA 3CBWA 1JFHA 4IH3A 5AYYA 3RX4A 4ZSTA 3LLXA 1DTNA 3M6DA 4JTEA 4RE0A 3GTXA 4H9XA 1B4KA 4GXPA 4K8EA 1CXEA 5M1TA 3CZJA 3VD9A 2ZCGA 3NYDA 4AIEA 1LG1A 1HQTA 1XYCA 3TQPA 4S3KA 3C0SA 4GOAA 5CSRA 4N2YA 4DB7A 1QNRA 4US5D 4YWSA 4MB4A 2DT1A 4S3JA 3COTA 1J18A 1C8VA 3NEVA 1DJYA 3B03A 3P67A 4MNKA 4PB3A 2EQDA 1BLIA 1N2VA 4QLKA 3SCPA 1I45A 1VEMA 1RK5A 1E1EA 3HPAA 3W7EA 2PC4A 4IL0A 2GK1B 1BQGA 5CJNA 1XLBA 2BGNE 4HJFA 4TU1A 2CBIA 1LWIA 4LUYA 1LOQA 1MW3A 2IXUA 1EGMA 1O4UA 3U7VA 4R7OA 3GC5A 3RFAA 1LROA 2VOTA 1VIWA 3WK1A 3TJIA 1PTGA 4FNSA 4K7YA 4CU7A 4MY1A 2HSAA 3V35A 3POCA 1ZRQA 1H7PA 3QF0A 1QRQA 3OVGA 4R7JA 3RPTA 3KXQA 3PY2A 2HBXA 2DUXA 4UQBA 2FZDA 1JCTA 4IXXA 1KBBA 4CN4A 3W6LA 3AIQA 4LBUA 1BRLB 4LBRA 4WY0F 4RJEA 3GDBA 4XK2A 1G67A 2HV5A 4E5TA 3RLHA 4H9ZA 4QRNA 5CG7A 4LC8A 4OGZA 5EMMA 4W7UA 4B5NA 4EK7A 4L65A 6TIMA 3J7HA 4P7LA 3L65A 2V69A 4UOJA 3WX7A 2PDWA 2XH0A 4W8AA 3NQDA 4C7DA 1M03A 4ML9A 4AC7C 3K1DA 4ATWA 2GDVA 4YYFA 3JW7A 2Q01A 3AROA 2BB0A 4F48A 3TH6A 1GHRA 1W8GA 1VBUA 3VI2A 5JH2A 1PIFA 4UR9A 3W7QA 3L66A 1LWHA 3CUXA 3PB2A 2FZNA 1PDZA 1E6RA 4A8LA 1XLMA 5C7HA 3DHFA 4O14A 3VOHA 2PRMA 4LAZA 2YFNA 4W85A 2ASHA 3SQMA 1WE5A 3MP4A 3GY1A 1HJQA 1OCQA 1PZ3A 5AHNA 2XG9A 2OOFA 3E9AA 4MVAA 4CKQA 3WDQA 5LA0A 1H60A 3UT0A 1Y65A 1MXDA 5AC5A 1TPB1 1V3HA 1GWJA 2VWTA 3QKEA 4MWAB 4S2BA 2VRJA 1MEHA 3GXFA 2QAPA 2WW5A 2J75A 3VOIA 1R47A 1GOMA 3W1RA 5DY2A 3ZT6A 3GH4A 1Z48A 4W84A 2DDXA 5CJ5A 1PWMA 3WSUA 4GH3A 4LRSA 4AZHA 1XJBA 2VFEA 4HPHA 3AYSA 4NG3A 5DT5A 4WSKA 5ECVA 3GW0A 4ECLA 1N55A 5H6HA 4IMEA 3ABSA 4YHGA 3IVTA 3WK3A 2YXOA 1VJZA 3DYPA 1KWGA 4PTDA 3GKFA 1W56A 2QR6A 4NX5A 4RDVA 1SR0A 2QHAA 4JKMA 5DO8A 5FF0A 5LGXA 3NQFA 3GFYA 2Y1HA 5CSYA 3OGVA 1XIHA 2WJZA 4WY0B 5K4XA 3AXIA 1SVDA 1YHTA 4BCEA 2O0TA 1UD6A 2ZZ6A 4TQTA 4KCWA 3KWSA 3UWEA 3HJZA 1A53A 3W1XA 2GQ8A 4EF8A 2ZBTA 3AIWA 2CHRA 4AZCB 2DJXA 4PUDA 2YDQA 3KBMA 1HXJA 3FVDA 4H01A 2ZVIA 1TA3B 4LU0A 2PGRA 5JBFA 3BAXA 1A3HA 1XIFA 2A5HA 4FIRA 1LQ0A 3A9IA 5HAOA 3LMYA 3F4WA 3N3MA 2UY2A 3ARPA 2JGYA 2EBNA 4C6BA 4AX6A 3SSZA 2WVTA 3P5ZA 3NQ6A 1D8CA 3BGAA 1UR9A 1FWHC 3WL1A 1OM0A 1IEVA 2OT0A 3H2EA 1WO2A 4LY8A 4L1WA 3W7PA 2BY2A 5JBDA 2QCCA 1QPOA 4J3UA 1BWKA 4F0KA 5HULA 3ITVA 3QGAC 4ZO7A 3G1RA 1SJBA 2WANA 3VE9A 1JXKA 3V1HA 1VRXA 2E4TA 4N4QA 4IIHA 4WKFA 3LDVA 3HOJA 2NVAA 3B0YA 2WZIA 1JR1A 1IEXA 4Q8MA 2AOSA 1FHUA 3DG3A 1IXNA 1O94A 3MT1A 3W6MA 1R87A 5A8QA 4Y2WA 2Y88A 3WQCA 5KTLA 3B97A 2QCMA 1J6PA 1EJXC 1E9ZB 4JTHA 4LV4A 1G4PA 3IJQA 3C52A 4P7RA 4JFUA 2RKXA 3MI3A 5EKYA 4NJIA 3OOQA 3VX0A 1TQJA 2WMIA 3GUGA 3BARA 3DECA 2GJNA 1E56A 1U5JA 2BVDA 4US6A 2BNJA 1NP0A 9XIAA 3LCGA 2O9OA 4YYCA 1OX6A 3VGBA 3KBVA 1SO4A 3SADA 5A6TC 1M65A 3LUTA 3MUY1 3O6YX 4AQLA 3UYCA 3BAYA 3FJLA 1WKYA 3PBUA 2E40A 3VNYA 3H53A 1KWKA 2H8XA 3VZXA 3QC3A 1OGBA 1QBBA 4GY7A 3U5UA 1OIFA 2G3FA 1JPMA 2V5BA 3TNOA 2YLAA 4K3ZA 4JHZA 4TVUA 2PDCA 3WBWA 3N2BA 1TPC1 4Z0SA 1CPUA 3N9RA 2A1YA 4AD5A 4I9TA 1T6MA 1T7LA 4B5XA 1SPQA 2V67A 3WJWA 3VDBA 3OG2A 3MU7A 4JR5A 5A2BA 1S2CA 1RZMA 4H9TA 3U0HA 5I5RA 5BU6A 4JYFA 5E5CA 1EF2A 3UJ2A 1EBGA 4Q22A 5E6ZA 1ZUAX 9XIMA 1UOKA 5A6SA 2G5WA 2YB1A 1QU4A 3HZ3A 4OJYA 4IPPA 1MNSA 1ZAIA 3GVWA 3VIIA 4K1GA 4XD6A 4K68A 5HJXA 3WQGA 1VCVA 2D23A 2QDEA 4LS0A 3SR7A 3UETA 1V02A 3QY7A 5CC6A 3S2LA 4I9AA 3NCOA 3WLJA 4ONVA 1KC7A 3LGDA 1G9HA 3R58A 1R6WA 1FDZA 3N19B 4J4KA 5EPDA 4F40A 1XI3A 5H8UA 3WFZA 2WC3A 1PYMA 1XYMA 2DPEA 3V0UA 1DEDA 1YTEA 3EXSA 4AF0B 3HMJG 3NGJA 1W9PA 1S2WA 1PZ1A 1OHLA 2QCDA 5BXRA 2I56A 1Q8JA 3MSDA 2V5JA 3GIPA 1M7XA 3WH8A 5G5IA 3TCEA 3VIGA 3AHYA 3IJIA 2DQWA 3CLMA 4FIQA 1KA9F 5D2XA 5KEZA 1ZAHA 1CBGA 3KRSA 6REQA 1FBAA 1GTHA 5IRPA 5DY3A 4WEVX 4MKNA 3A4WA 3TLQA 4C1LA 3HA1A 4AMAA 1GUVA 4AHOA 3CMFA 4LVDA 5H8PA 6A3HA 4GYPA 1UOZA 3MV11 4JFWA 3A47A 4YS1A 4DBWA 3EDEA 1OF8A 3M0VA 5ABFA 3UPMA 1S5WA 1QVBA 3UF9A 5D37A 4L4MA 4XAFA 1TMHA 5DMLA 2PLMA 1S38A 1JJKA 1ENUA 1REQB 2QGHA 4O0QA 4YMZA 5A8PA 4QDPA 1X1NA 1IV8A 2FJKA 3SW6A 3VGFA 1I2OA 1KM4A 3EKLA 1XP3A 5LIXX 4WDUA 5AYZA 2R6OA 1EHNA 3DX5A 4BFAA 2QMJA 1K03A 3EMQA 4RCXA 4UR7A 3CAWA 4HYWA 1R9ZA 4D6CA 5A8GA 3IGSA 3B9AA 5ABEA 1HJSA 1QT1A 2OJPA 1XUZA 4PC8A 2RJHA 1PBGA 4XG1A 4JNYA 4MM1A 3UCDA 4AMCA 1YE6A 4PEKA 3SY5A 4YJ5A 2ZZ7A 3GDTA 4AD1A 3I4EA 3CB3A 4XD3A 3NZGA 2WNNA 4PCPA 3H21A 1AL7A 3BOFA 1TWZA 4B3KA 4JTKA 2BXVA 4C91A 1UYQA 1XRSA 3H22A 3UXDA 1HP4A 3QMSA 1NJJA 5MKGB 3PC0A 2DZSA 3M9YA 5DQPA 1G7VA 2ZA2A 4DYEA 3LHUA 5LZLA 1FHLA 1M6JA 5G4WA 1W1TA 1XBZA 2WQPA 4HNOA 2A6NA 5BU9A 2NXIA 3S5YA 1MUCA 3P8IA 3IK4A 4IX0A 2DZXA 4JBRA 1QBAA 1DXEA 1Q45A 1QJWA 4Q8NA 3W72A 4RV8A 4UNKA 2P0IA 5AOUA 1XD1A 2BTMA 4FS9A 4QLLA 5CPMA 4Q4PA 4AWEA 1OZMA 5E0KA 3GLCA 3PPFA 4A21A 2HPIA 1EJTC 3N13A 2IUZA 1TTPA 1O7AA 2WVUA 4M7SA 4LGXA 3VINA 2REQB 3LNMA 4FXFA 2OMAA 4PRRA 5FEWA 3KDOA 3FX4A 4LCQA 2GJXB 3BOXA 3EXTA 2WJFA 4Q8WA 3BQ5A 2NXGA 2OGYA 3TJXA 4OZOA 3WH5A 3M0MA 3ONCA 3RK8A 2JF6A 2XU2A 1GTEA 1P7TA 3SB0A 4FR1A 1N82A 1S1RA 3VIOA 4LS1A 2PDFA 5CZKA 1UROA 3UD6A 3S46A 3THDA 4IOTA 1ONRA 3T05A 1FTXA 2DW7A 2YBTA 5FA5A 5HQMA 2J7FA 4J3XA 5LNUA 3R1ZA 3UPWA 1KBLA 4C1NB 5F7UA 1K9DA 4LEFA 5JMUA 1H1NA 3OODA 3LCLA 2JIWA 2F38A 1AH4A 2VDHA 2CYGA 1AQFA 1C91A 5A1AA 4PB5A 3QOKA 2BGSA 2VFGA 1CXLA 1JI1A 5U4NA 5EGRA 2F2HA 1DKWA 4FLRA 2Z26A 4LAOA 1LLOA 5D30A 3ZM8A 3R5EA 3UESA 4LYKA 3W87A 1E4LA 9CGTA 1QI3A 3LTSA 3E6EA 1JDEA 6ALDA 4F3HA 4CU6A 4B90A 3VNZA 1MYRA 1ZGDA 4IFOA 3ITXA 4ZB0A 1CENA 3JU2A 5D9PA 2OO6A 3R0KA 3LEPA 2FH8A 3MPGA 3TMLA 3TTEA 3WF0A 1KGUA 1ICQA 3IJDA 1HGYA 1UD3A 5E1QA 3R89A 3TR2A 3L2MA 2GJPA 1XIEA 1XCXA 2DSZA 2G3MA 1OFDA 1CEOA 1B54A 3VX1A 3AO0A 3BJTA 2R24A 4NNCA 3IIOA 1LBFA 3W38A 3SM0A 2PDUA 5TIMA 3EB2A 2OSYA 1TG7A 1K02A 4QNEA 4ROQA 4NZ3A 1X39A 4D6GA 3AJXA 1W3KA 3OGSA 3L0KA 3EPOA 1FWBC 1OSEA 4CD4A 4RKAA 1J0IA 1F4HA 3IARA 3TTYA 1UJQA 3BLIA 3JUGA 4CD8A 1Z6KA 3JZUA 3ZWTA 1NOFA 3N17A 1NWRA 3QPYA 3LRLA 4LUIA 5HUOA 4F66A 1SZEA 2DZBA 2QW5A 1EYWA 4XX6A 3AU6A 1UH4A 4O1CA 4R88A 4HOZA 2GVJA 1V6XA 3INPA 2H6RA 4IT1A 3VKCA 1JIBA 1BGAA 5L6UA 3PWGA 2BOGX 3PBGA 4G7FA 1E73M 4NJHA 1KKRA 1VRDA 1QNVA 5LA2A 5JH1A 3S6OA 3CUGA 1U22A 4IMFA 3DN5A 4L64A 3VIPA 5LIWX 4FNTA 4YPJA 3MUAA 3STCA 3GR7A 2G37A 1A0EA 1AZ1A 3L21A 4D2JA 1DVJA 1J9YA 4WDXA 2HRWA 2Z1WA 1XLAA 3KOYA 3L4UA 2J8FA 3EDKA 1TRDA 5C0QA 2XN0A 1SFJA 4ROPA 3ZXWA 3UR8A 4GUIA 5HQEA 2INEA 2WLZA 5AB3A 4XZMX 3PZTA 2JFEX 1ZNNA 1UP2A 2J24A 3VTRA 4NAEA 4B91A 4JEJA 4E4PA 1TELA 4UQDA 3G1DA 4RNHA 3HU7A 4Z2LA 5C2GA 3E38A 3ATZA 3T7VA 4TMCA 3L5AA 3EDJA 4UTWA 2O7QA 3UGVA 2Y70A 2PWDA 1JZ4A 1IIGA 2EO7A 3CQ0A 3TWBA 1CLXA 5D09A 1N8WA 1OD8A 2E8ZA 2EPMX 4M6VA 2R82A 1OFOA 3O15A 1OFQA 3DYOA 1VR6A 2A7NA 5EU9A 3LPOA 2CBJA 3EYPA 2GZXA 2OEMA 3SUUA 1JRBA 1PUDA 2Z2AA 2BFGA 2IPGA 3HTWA 4ZTYA 3TXZA 4O17A 3SGZA 1SJAA 3GRIA 4JFSA 2RDTA 3UY7A 1YRRA 3BE7A 1K4GA 3WZ0E 4GVHA 3K8LA 1M9HA 1PB0A 3UVIA 4UQAA 3S6TA 2FH6A 4OWGA 1ICSA 3APTA 4YVXA 6PTDA 3VOGA 1U5VA 3F5JA 3DFPA 1JCXA 1W9DM 3FAXA 1EIXA 4X9SA