4B15A

Crystal structure of tamarind chitinase like lectin (tcll)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
266
structure length
265
Chain Sequence
GGNIVVYWGQGGSDNSEGSLKEACKSGHYNMIVLEELITYDNGRDPDLNLGAHCVNCTSLQQEIKYCQLKLIKILLQIGQVTPTKEDTKDTTKDLSQYLDSNFFSGKSGPLGEVYLDGIDIASVPEGLNLKFDELVQALNDSATSRRIYLSASPNCVYPDYYLDKAIQTQKLDFLFVQFFYALPCIYTQGLPEDLFQAMKTWTSNVPESIFMALPATPDLNGYIPPRVLNKEILPAVTQASNFAGVMIFDRYFDRFRKYSSKIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Investigation of a Novel N-Acetyl Glucosamine Binding Chi-Lectin which Reveals Evolutionary Relationship with Class III Chitinases.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords CHITINASE LIKE LECTIN
total genus 94
structure length 265
sequence length 266
ec nomenclature
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4b15A00
1EXPA 4ZEPA 1ESWA 1CGUA 3L4UA 1UWSA 3QHOA 2D0GA 3SURA 4CD6A 3RCNA 4W7UA 3WENA 4AXNA 4GI8A 1GJWA 2X2YA 3MANA 5GPRA 2XGBA 2XGIA 3AXIA 2BY0A 4C7FA 5A6MA 1ISYA 2VL4A 1HVQA 1YHTA 3VVGA 2EEXA 1ISVA 3WSUA 1PIFA 1VBRA 1R7OA 4PTMA 1C92A 3ZJ6A 2EBNA 1KGWA 3W6LA 1W9VA 1KQZA 1BF2A 3WMBA 2CBIA 2D20A 2WB5A 3VD5A 5M3WA 1XHGA 5JIPA 1V0KA 1PPIA 1CXEA 3SUSA 3AXHA 1G01A 3N04A 1E6XM 3PZUA 1FFQA 2D1ZA 4WIWA 2XWEA 1XH0A 1ZBVA 2BY3A 3A4XA 3VUPA 5ABEA 3QHNA 1HX0A 2D22A 8A3HA 2C8NA 1FFRA 1RP9A 2J74A 2YL5A 1VEOA 2Y8VA 3AI0A 4J7RA 1DHKA 2B31A 1BYAA 2J8GA 1W2PA 1V6WA 1NOUA 2WBKA 4P8VA 1WZLA 1V08A 5I77A 1LWJA 2WC7A 3MO4A 4AZGA 5A8OA 3PZOA 4MB5A 2VNCA 1QNPA 3GH7A 3NJ3A 1DP0A 3TTSA 1N82A 2XVKA 5FOOA 3SUWA 2VZVA 3VIHA 1UD5A 3GM8A 1GONA 2YA0A 1GUVA 1OINA 3WEZA 5BXTA 4GPNA 1LG2A 1NWSA 4LGXA 1AQ0A 1H4PA 5DO8A 1EDTA 1E4MM 2ZUNA 4ACYA 5D9MA 2O9RA 1JI1A 3VD9A 3WFLA 4W84A 3QOKA 4ZE5A 5CJ5A 3T09A 3ARRA 2ZXQA 3CZLA 1U2YA 1W9DM 1W1VA 1E71M 2JEQA 3PTKA 5E70A 2E8ZA 3MKKA 3W6MA 3PZTA 2W66A 1WB0A 2YDSA 1HXJA 4QFUA 3L4ZA 2XSBA 1JD7A 3WBEA 3PTMA 5A8NA 2C7FA 1CIUA 4AZ5A 2A3CA 1XYFA 1JDCA 4ZE4A 3RJYA 1JAKA 3SIMA 1EGZA 4CUCA 5ABGA 4LYRA 4F79A 1ITXA 4CD5A 1UQYA 2CHNA 1JDDA 1CXLA 1GORA 4GO9A 3KE0A 4BCEA 3AHTA 1K9FA 4J3SA 4P8WA 2RGLA 2VCBA 2J47A 2TAAA 4OJYA 4XV0A 3WF2A 3FNDA 3TTQA 1HF6A 4PN2A 3ZO9A 2XIIA 3G6LA 1DWHM 4J27A 1UG6A 4FLOA 5HOSA 5GNXA 3WUFA 1OWQA 1UHVA 5CSYA 1UA3A 4Y7EA 1B3ZA 1NOFA 2DSUA 2OYLA 2ZICA 3VU2A 4PTWA 3DHPA 5I3DA 4JCMA 1QHZA 3VD4A 2JEPA 3CHDA 1E0WA 1CBGA 4JFVA 5D8ZA 4HMDA 4DM2A 4P8UA 5CXPA 1E4NA 1PIGA 4R27A 1XCWA 1JI2A 3WD3A 3ARYA 1E5JA 1VRXA 1XH2A 3DYOA 1FH7A 1HJQA 3A3HA 1V0LA 3AMGA 1D2KA 3GXIA 5I0DA 4J3UA 3WDHA 3WEOA 5A6BA 1E6PA 1X1NA 4M81A 5FIPA 2JIEA 2VURA 3GXDA 4WF7A 3GZAA 2W5FA 4P7LA 1UR4A 1TA3B 4JHOA 2V38A 2WNWA 4AWEA 3VDBA 1WNOA 2CKRA 2PWGA 2OYMA 1HKMA 3CO4A 3VIKA 3ARZA 1UKSA 4P8XA 5KZ6A 2W91A 4HZ6A 1OCQA 5JBDA 4DWSB 3UEQA 1Q6CA 2BXYA 2O92A 2V5DA 2XTKA 2BVDA 4RE4A 4HU8A 1G9HA 1EQCA 3VM7A 1XCXA 4PMRA 1B9ZA 4KWUA 4UQEA 3BAKA 3OGSA 2EXOA 3WKZA 2QMKA 1TVPA 2XFYA 3CZKA 1MW1A 3AHVA 1UWTA 3ECQA 3DHUA 2F61A 3CGTA 1MW0A 3AMDA 2A3EA 2PF0A 1AQMA 3CTTA 3KL5A 1PZ2A 2G4FA 3ZMRA 3WBAA 1PX4A 3N12A 3GH5A 1KGXA 3ZJ7A 2VZSA 1R87A 5BRQA 2WANA 4OOZA 1QBBA 3GXFA 2YLAA 1W1TA 4JKKA 3ARTA 4MAVA 1ZU8A 5ECUA 1JNDA 4QP0A 2W61A 3WN6A 5A69A 2VO5A 1KFWA 2EPLX 2CPUA 4D72A 3W53A 1B3YA 1YQ2A 1XSIA 5HNNA 4W89A 4J3TA 1XD0A 3A6OA 1Q6EA 1UD2A 1CGTA 3GYCA 1BVNP 5A6JA 2Z1KA 2IXUA 2ZUVA 4OBSA 1QVBA 2XPKA 4N0RA 1XSKA 2ZXDA 2GVYA 3O9NA 4AZBA 1UD3A 2BHUA 2YLLA 1B3XA 2O9OA 4W87A 5D4YA 4PMYA 3ARXA 2WWDA 3AMCA 3BAIA 3VINA 1XH1A 6A3HA 3L4XA 5CPSA 4Z2KA 2PC8A 1I1WA 4MNJA 1UYQA 3WL0A 1G94A 5A8PA 3GBDA 2WVTA 3MUIA 1H2JA 2WMJA 3CUIA 2GFTA 1J18A 4JCLA 4MTVA 1B3VA 1W32A 4UFIA 3SUTA 3HMCA 5AYIA 2OWXA 1B1YA 3ALGA 2VC9A 4HA4A 4MPKA 3GDBA 2VT0A 4AZHA 3VTRA 3RM8A 1V03A 1UWQA 2A3AA 4MNLA 2DT3A 4NSBA 3K1DA 2D23A 4NRSA 4U33A 4WSKA 3OLGA 1Y7VA 2XJ7A 4CGTA 2XUCA 4ATDA 2XVLA 1LL4A 3AROA 3DYMA 1GQJA 3SCTA 1VF8A 1I1XA 3MV01 2O9PA 2X09A 4GKLA 1MW2A 1JYWA 1W9BM 1MQQA 4AW7A 3W29A 4WKHA 1TFVA 1W3KA 4KGLA 1VEMA 2X1IA 3MUAA 3EDKA 4S3KA 5LA1A 1BYDA 1LQ0A 1EQPA 2VRJA 4HZ7A 1VENA 3UG3A 1WZAA 2XYLA 1X6LA 2FGZA 3KWXA 2WVVA 3NUKA 1J10A 3UESA 2XWDA 2WC4A 2JF7A 4KRTA 2HISA 2WVSA 5A2AA 1NWUA 2VCCA 4NRRA 1J0YA 4AZIA 3B9EA 1B30A 1OBAA 3MMWA 4U5KA 3WNKA 2W62A 3A4WA 3VNYA 4GI6A 2XHYA 4JZ5A 3TP4A 5A8MA 4E8CA 4W8AA 1MWOA 4AZCB 3ARVA 3WNNA 3WUGA 1EHNA 2XVPA 5GQBA 3VD3A 1HNYA 1QBAA 1VB9A 2NT1A 1QI0A 4D1JA 1KCLA 5EB8A 5A95A 1CXFA 3T2OA 1CNVA 1MYRA 2YA1A 4ZFMA 3RM4A 4GQQA 3L2LA 3VDHA 1JXJA 1W3JA 1C7SA 1KXHA 3BAWA 3W4RA 4IPNB 4BA0A 5A2CA 2OSWA 4QAWA 3WF3A 1C8QA 3M07A 3ZT7A 3FAWA 2WK2A 1EHAA 2UWFA 4Z2HA 3AYRA 4QLJA 4AIEA 5EFFA 4JFWA 1I75A 1U33A 7CGTA 1UOKA 1SYTA 3IJ7A 1M7XA 3DYPA 3G6MA 1QI2A 5E6ZA 3M6DA 3WF1A 3AIRA 1ZBKA 3BLKA 4M56A 1JF5A 3VM5A 5D9OA 3OZOA 2WMIB 4HTYA 2WCSA 3RDKA 2GK1B 2WM0A 1Q6GA 4JIEA 3BMVA 2PWDA 4PMNA 5C71A 3VIJA 3VMOA 1W3LA 3AMLA 4PBGA 3AIQA 3F5JA 2VOTA 1MVYA 1SR0A 3S6TA 2FGLA 4W86A 4V2XA 1ISWA 4U3CA 1GOKA 1JYNA 2Y4SA 2X8RA 3ZIZA 4OOUA 2J7EA 2YBTA 3U57A 1B0IA 4P7QA 2E9BA 3HU7A 4GIAA 3WD4A 4D71A 4Z2IA 1DWJM 3MMUA 1C91A 5BXSA 3W25A 1EDGA 1Q6FA 4PMZA 1MXDA 3MUZ1 3TONA 4GZJA 1UH3A 4JL2A 4D6IA 1OSEA 3O2LA 1E0XA 3NIYA 2G3IA 1EH9A 4MJ4A 1E3XA 1VFFA 3PBGA 2XVNA 3EDEA 1JZ5A 4QCFA 3W0KA 5CQ1A 3WMSA 2IXVA 5C70A 1E1FA 4OZOA 4WSJA 1J01A 1H09A 1XSJA 1R8LA 4MB4A 3CMJA 3W24A 5LA2A 3W82A 2FHFA 1HVXA 1V3JA 2E0PA 4F9DA 4LQ1A 3W37A 2J75A 4UQBA 4LYPA 3LPPA 5A6LA 1TMQA 1BG4A 5FD0A 1CGWA 1JGIA 1UKOA 3L4VA 1TUXA 4L4OA 1BPLB 3VGBA 3M46A 5BXRA 1W2VA 4IUGA 5ABHA 1R7AA 1MFUA 1GVYA 5FL1A 1WE5A 2Q8XA 3UERA 4ZXLA 2ZX6A 4CU7A 5A2BA 1KXVA 2WWCA 3CMGA 3AHZA 4CVWA 2UY4A 4CVUA 3MU7A 3TTOA 1JZ7A 2WCGA 2PWEA 3GXMA 5A6BD 3S2CA 2ZX9A 4CD7A 1SMAA 4E8DA 2MANA 2WSKA 2DH2A 3LPGA 2EJ1A 1US3A 5KEZA 2CETA 1BTCA 3VDAA 3SCQA 1AMYA 4PYSA 4HU0A 1GOQA 4X0VA 3WQ6A 4M8UA 4UTFA 3AISA 4AMCA 1E55A 2ZX8A 3VIOA 1PBGA 1H41A 2QV4A 3POHA 5DMYA 2J78A 2X0YA 2VMFA 2YJQA 1WP6A 1TZ7A 2XFFA 2WHKA 3WH5A 3N15A 5AYBA 4R5EA 2NSXA 3A47A 4D6HA 2WCAA 5A6AA 1H11A 2PB1A 4MB1A 6CGTA 1V3LA 1MFVA 2VCAA 5E0FA 5BCAA 1JFHA 5I24A 2WHLA 3BLPX 1HJVA 2BY2A 3SCSA 4QCEA 2NT0A 1NWRA 2VZUA 3VIPA 2EPNA 3FXYA 1ZS2A 4HPGA 4TUFA 1US2A 1E6NA 3O6AA 2CIPA 3WNOA 3CZ8A 4J3WA 1E4LA 3BSGA 2C0HA 3BAXA 4HOWA 1LL7A 4HP5A 2RGMA 3WEMA 1HIZA 2FH6A 1UZ1A 3J7HA 3VILA 3W28A 5IXEA 1ZBWA 1UR9A 3BAJA 1J12A 3QHMA 1OD8A 3BXWA 3GTNA 2HVMA 3WY1A 3WQVA 3K46A 2OYKA 4A3HA 3OIHA 1OB0A 2GJRA 1BQCA 1CENA 3WUBA 4CN6A 1E72M 1M01A 2ESCA 4CU6A 3SCOA 3ZT6A 4Z2LA 2ZUWA 1E3ZA 2VZOA 3EMZA 2ZUTA 3IANA 2WVUA 2FH8A 1GVIA 3WD2A 3EMCA 4MNKA 2W63A 1JD9A 3T0DA 3MS8A 1NQ6A 4OKDA 4PCSA 2VX6A 3IJ9A 2VZTA 3N9KA 2FHCA 4H8UA 3IK2A 5E6YA 1OIMA 3TOPA 4CN1A 1FHLA 2CBVA 1MXGA 1E43A 1J9YA 4HOZA 1Z32X 1E73M 3WF0A 3CUFA 3K8KA 2ZWZA 1KBBA 3OA5A 1AVAA 1BG9A 1BLIA 4CD8A 4CU8A 3PHAA 2CEQA 4TTUA 1NOWA 3MV11 2D2OA 3L4WA 1HKKA 4OIFA 1CLVA 2J77A 2J7HA 1WAWA 4KGJA 3AXXA 1UD4A 4LXFA 4JKLA 2EQDA 5EBAA 2CBJA 2D3LA 1KWKA 3EBVA 4H2CA 1B31A 1M03A 3RPMA 5I23A 1A3HA 4AD4A 1GPFA 5CGTA 4U5IA 1NH6A 2X05A 3K4AA 4S3JA 3N13A 1M04A 3PZNA 4M1RA 2OWWA 2J7GA 1UZ4A 1E1EA 1OGBA 2YL9A 5A8QA 1WCGA 5CPQA 2WZHA 3VMPA 3WFZA 1HJUA 1JYVA 3SCVA 3THCA 4PMXA 1E4IA 1Q6DA 2WMHA 3I3EA 4QDMA 4RE3A 3GNRA 3WNMA 4AY1A 4A4AA 5HDRA 4MAZA 4U2ZA 4CCEA 3AS3A 4BF7A 2WHMA 3M7SA 4LX4A 5CGMA 1KQYA 4FF5A 3BH4A 3VO0A 2AOSA 1O6IA 5HBFA 1LG1A 1ZJBA 4D6DA 1AQHA 5JIWA 5JBEA 2WZIA 2BHYA 5ABFB 3EYPA 1GW1A 4TX6A 4HA3A 3WDJA 1L0PA 1NWTA 2ZOXA 1W9PA 4H41A 1CYGA 3ALFA 2YOCA 3ARPA 5BYWA 3AZTA 3UETA 1D3CA 3AS2A 1KWGA 1DWFM 5CLWA 3L2MA 4W5UA 2J7FA 3POCA 1BHGA 2JFEX 3QGVA 4F66A 1JF6A 2WKLA 1C8YA 4WKAA 4YPJA 1TR1A 2D24A 3CUGA 1KGUA 4W8BA 2J7DA 3MSGA 4GINA 4PTVA 2F2HA 1K9TA 3KEHA 1WDQA 3CZEA 3WELA 1ODUA 2GJPA 2JF6A 1FA2A 4MB3A 1BYBA 3FW6A 3MSDA 8CGTA 2W4XA 4GI9A 2Y2WA 1QNQA 1VJSA 4J28A 4PUDA 4C7GA 1W9XA 5D9PA 1WDPA 3ZM8A 5ABFA 1CECA 1ZBCA 3IAPA 3VOCA 3L4YA 3WF4A 1JZ4A 1MW3A 3SUUA 3ZQ9A 1CXKA 3EDJA 4UQAA 2V3GA 2ZWYA 1KB3A 3RILA 1DWAM 3WDPP 2UY2A 3N18A 4LYQA 4W85A 2DPEA 5F7UA 2PI6A 4AD1A 2QPUA 4U31A 4PUEA 1UR8A 3K8MA 4UR9A 1UQZA 1C90A 1E56A 3WDRA 1FP8A 4EANA 1GOOA 3AIVA 1UWRA 1A47A 3CUHA 4UFKA 4W93A 3VX0A 4W88A 1E6ZA 2D3NA 3AMKA 3NCOA 3UG4A 4H04A 4D6JA 3WQWA 4BQ2A 4TVUA 4J3VA 2XM1A 4IISA 2W67A 4UZSA 2CHOA 2FHBA 3ZSTA 4K68A 5I2UA 1BSIA 4F9JA 1JZ8A 1XC6A 3NSMA 5IHSA 2EPOA 4JKMA 4NF7A 1K9DA 1QHPA 3VGGA 5FCZA 5TD4A 2V3FA 4UFHA 4HMEA 3VNZA 1B2YA 1JYXA 3SCNA 5JBFA 1U30A 2WW5A 3SCRA 3NDYA 1WZKA 5JUVA 4JFUA 3TA9A 4W8LA 3ZR5A 6TAAA 1V0MA 1CXHA 5D8WA 3W27A 9CGTA 2OWCA 3OGRA 2DSKA 2Y5EA 1QW8A 2WXDM 2J25A 3CPUA 1HP5A 1KR0A 3LPFA 4P7NA 2DGAA 4DUWA 1VAHA 4L4PA 2WVVB 1MQPA 3FHAA 2V3EA 2VX7A 2J62A 4MADA 3T08A 2VX5A 5CLTA 1GOWA 2YKKA 4UOQA 3OBAA 2J7BA 3ZR6A 2J7CA 3WDIA 2WC3A 2UY5A 3D3AA 1NP0A 2BVTA 4GZIA 4AD0A 1LL6A 3VIFA 1E40A 1VJZA 3LMYA 3AYSA 3BMWA 4PMDA 1OT2A 3VGFA 4WK9A 3CHCA 2G3JA 4ACZB 1SMDA 4JHZA 5M03A 1ISXA 1W1PA 5E0CA 2BVYA 2WMKA 3ARWA 1GQLA 2AAAA 2OLHA 4H8VA 4UNIA 4XB3A 1J0ZA 1K6AA 3CLWA 2GJXB 1OM0A 4QLLA 1UH4A 3L4TA 1HJXA 2DT0A 2BY1A 4AD2A 4CD4A 3PZIA 3ARSA 1GQKA 3AZRA 3MUY1 3OGVA 3BAYA 4UFJA 1JXKA 1DEDA 3WNLA 1GOMA 5LYRA 5DT7A 1ECEA 2YDQA 3KL3A 2E8YA 3WH9A 4BQ3A 1PX8A 2J4GA 1CGYA 3RJXA 3W26A 4XZBA 2WZEA 4JFSA 4CCDA 5GNZA 4D6CA 1JZ3A 3EDDA 1UKQA 4FLQA 5AC5A 1ITCA 3WQ8A 1UKPA 3WQ5A 1XYZA 1PEZA 4WJXA 1QI5A 2G8ZA 3BGAA 3EMQA 4UQCA 3I3DA 3QR3A 1CWYA 3PZGA 2D0HA 4TVCA 1V02A 3RO8A 1E5NA 2VQTA 5CG0A 2DDXA 5BWFA 2BHZA 1UR0A 1V3HA 4FLRA 1UA7A 3F5LA 3CUJA 4KH2A 1R86A 3NDZA 1WKYA 5DFAA 4F8XA 2W92A 1DWGM 2YL6A 3AFBA 3F5KA 3ARUA 1HP4A 1EOKA 4AEFA 4M29A 1Q4NX 1LLOA 3AHYA 4Q7NA 1F4AA 2A3BA 4DUXA 1BFNA 3VD7A 1RPKA 4JFTA 1HJSA 1CEOA 1S46A 1FH8A 4D6FA 1BGAA 3EDFA 3WH6A 3I3BA 3U5YA 3BC9A 4AISA 2WYSA 4Z2GA 1VFMA 1TVNA 1H5VA 3UR8A 1NARA 2UY3A 3ZSSA 5A6KA 4AIUA 2X0HA 4X0NA 1V6UA 4GXPA 2WPGA 2GSJA 1J11A 5BXPA 1WDSA 1JG9A 3CHFA 2CCRA 1CTNA 1JFXA 2QHAA 2QLYA 4FK9A 1QNRA 5HPOA 1OGGA 2DT2A 3VIGA 1CGVA 4EKJA 1KR1A 3DECA 1GOIA 1KCKA 1PJ9A 2O9TA 3WMCA 2VR5A 2BNJA 1V0NA 5BRPA 3HJEA 1V3MA 1UD6A 1H0GA 4AYSA 3UR7A 4A3YA 2XVGA 3MMDA 3AJ7A 1XGZA 4UFMA 5IFTA 3ARQA 3HN3A 1E9LA 5EMYA 1IZKA 2CERA 4DM1A 3CH9A 4MJ2A 1LF1A 1E6SM 4XZWA 4XUYA 4UQ9A 3AOFA 3B9DA 2GUYA 4JAWA 1SFSA 1FP9A 1E0VA 4D6EA 3KZSA 3OLEA 4NI3A 4AIOA 1B3WA 1E70M 2EPKX 3AICA 3OG2A 2J8FA 4ML4A 3N1AA 5A1AA 4PEEA 1H1NA 3T0AA 4TOQA 2PWHA 1X6NA 5A3HA 3AZSA 2Y24A 3T2PA 4UOZA 4AZ7A 2BXZA 1JIBA 4J3XA 1GZJA 2DIJA 1FOBA 1NP2A 1PAMA 2WKGA 3RIKA 4X9YA 2IUZA 4W7WA 4AZ6A 4PMVA 1V3IA 2G3MA 3BSHA 3IJ8A 4DWSC 1VIWA 4V28A 1GHRA 4M82A 1K9EA 1UH2A 5FL0A 4EAMA 2D0FA 4BZYA 2J79A 1O7AA 3K8LA 1UWUA 4GQRA 3IAQA 4Q22A 1IT0A 1DTUA 2XG9A 3II1A 3AS0A 3AIUA 2YL8A 1PX3A 1BGGA 2NW0A 3VX1A 2WSPA 4LPCA 1JAEA 3VPLA 4E4PA 2VTFA 3N17A 1LWHA 2QF8A 4JL1A 1KXQA 2CITA 2YA2A 3F4VA 3PZMA 1WDRA 3CHEA 5I78A 5D9NA 5A6SA 5I6SA 2VVSA 7A3HA 1XD1A 1P6WA 2OSYA 2YDRA 1F4HA 2DT1A 5HPCA 3ZJ8A 3VGHA 3CIVA 4B16A 4BQ5A 4GO8A 2G41A 1QW9A 4OUEA 1GCYA 3N11A 2XM2A 3U5UA 1JZ6A 3WL1A 4N42A 1C7TA 3FY1A 3FN9A 2BFGA 2YBUA 4B9YA 1OIFA 1QPKA 4NZCA 3GH4A 1NM9A 2VRKA 4PMUA 4HA1A 2PWFA 4KRUA 4YHEA 1D7FA 2PBGA 4HOXA 1C93A 2PBOA 1IV8A 3U7BA 4WKFA 4DWSD 4ZENA 1KXTA 5CPTA 4DUVA 4M24A 4YN5A 1JZ2A 2E3ZA 1UR1A 3AIBA 4MDOA 1XV8A 2JALA 4UCFA 3T0BA 1GQIA 2CXGA 3GNPA 2ZUUA 3JUGA 4UOJA 3GBEA 1V02E 2ZE0A 4PMOA 1V6VA 1E15A 1H3GA 1CLXA 2VVNA 2ZX5A 5IHRA 3SCPA 3NYDA 1QNOA 2VUYA 2WLZA 1GJUA 2WBGA 1ZJAA 4M80A 5EFDA 4EK7A 5IDIA 4AD5A 2VQUA 2GDUA 1CPUA 1M53A 1QOXA 4CN4A 2WMIA 5DF0A 1UR2A 4PRWA 2DSVA 2JE8A 1C3FA 2DQXA 1UD8A 4AEEA 3SEPA 1BAGA 4TX8A 4RE2A 4CCCA 1CZ1A 1VEPA 2ZXBA 3A4AA 2WLYA 3W38A 1VBUA 1R85A 4H8HA 1UKTA 1UWIA 1VFOA 5CSUA 1W9UA 2DH3A 1QI3A 3PZVA 4PMQA 1WPCA 5FKYA 3ZOAA 4PSRA 1HL8A 1FH9A 4FLSA 1J0IA 3UCQA 5A94A 2FDMA 1UUQA 4BS0A 3PTQA 5AC4A 3WNPA 2CKSA 2QMJA 2XIBA 3CZGA 1RD6A 2E40A 1BVZA 2XFRA 5DT5A 2BV9A 5I79A 3E1F1 3BCDA 1HKIA 1TG7A 4RL3A 2GDVA 2E4TA 1H0IA 3TTYA 4IM4A 4U3AA 4TTGA 3RMEA 3WH7A 3SUVA 1HT6A 2Z1SA 1B90A 1BYCA 4C7DA 1HJWA 2F8QA 1L8NA 2V3DA 4B3LA 2G3NA 1CDGA 2VRQA 4PTXA 4KMQA 4PCTA 1G0CA 1MQRA 2EO7A 3WD0A 1CGXA 3APGA 5HXMA 5E9AA 3LPOA 3W81A 1ZB5A 1WO2A 3ZJKA 1E6RA 4YHGA 3WH8A 4P7OA 1QHOA 2VR4A 1EDQA 1OT1A 4H7VA 4E2OA 2V5CA 2BS9A 3WIJA 2CYGA 4HPHA 2DSZA 1C8XA 2WMGA 4U2YA 3GNOA 3VMNA 4AD3A 2ZUMA 1EO5A 3FHQA 3WUEA 4WLCA 4ACZA 4B9ZA 1W3HA 1JNEA 1JL8A 1RP8A 2DEPA 1FHDA 3NSNA 5M17A 3AHXA 4ATWA 1HL9A 1VFUA 3B9AA 3PN8A 1CXIA 5CZKA 3T2QA 2GJXA 3U7VA 2ZXAA 3K4DA 3CBWA 4TXEA 2QPSA 5C8BB 3AS1A 5M5DA 2DIEA 4XX6A 3VIMA 2YIHA 2CESA 7TAAA 1IZJA 2ZUSA 3VGEA 3RM9A 1W1YA 3UG5A 4MDPA 2Y8KA 3AIWA 3B8SA 4D6GA 3NSXA 3ZT5A 5DEZA 3PZQA 2XSAA 4MNMA 4W5ZA 4IPLA 1ODZA 1WZMA 4OBRA 4GZEA 3SCUA 1V6YA 3D5HA 1TCMA 1KBKA 1EOMA 4W7VA 3WD1A 1V3KA 4PSPA 3DC0A 1J0JA 1J0KA 1H49A 2CBUA 4AZCA 4V27A 3WQ4A 3CZJA 1EIBA 1V6XA 2EPMX 3OZPA 3FAXA 4UQDA 1ZL1A 3VDCA 3THDA 2AMGA 5LA0A 2ZIDA 4HMCA 1EA9C 2E9LA 1OGSA 4BQ4A 1QNSA 2WAGA 2OSXA 4B3KA 1JDAA 4AC1X 4HZ8A 4UFLA 4CKQA 5BROA 3KL0A 1XRVA 1EO7A 1W91A 2VJXA 4P7RA 3OLDA 4TVDA 1RH9A 3SCWA 4QLKA 2WHJA 3OB8A 4FMVA 4B15A 4EE9A 1E6QM 3PZ9A 4D1IA 1GHSA 1TA3A 1TE1A 3AQUA 5I5RA 2E9MA 2VI0A 1PZ3A 4Z2JA 4ZXOA 1ISZA 3BCFA 2DSWA 1QI4A 1HN1A 1DWIM 2A3HA 3VKKA 1GNXA 1LJYA 3VIIA 2VX4A 1G5AA 3AIEA 3VGDA 1HKJA 3OLIA 5GNYA 5AY7A 3QOMA 2CNCA 2ZX7A 1G1YA 4DWSA 2GK1A 5E09A 2JIWA 1OD0A 5IFPA 4ATLA 4URIA 1J0HA 4UZUA 2WMFA 3WDQA
chains in the Genus database with same CATH superfamily
3C56A 4GOAA 2Z29A 5FF3A 4DBUA 3RCNA 1W6TA 4GI8A 4UNKA 4GACA 5A6MA 1HVQA 3VVGA 3DZ1A 1VBRA 3ZJ6A 1DJIA 1KQZA 3ID7A 1BF2A 3WMBA 2BG5A 4PR4A 3SO7A 4PGLA 3H2EA 2H6RA 5JIPA 2GQ3A 4HNNA 1V0KA 1V77A 4WOQA 4REQB 1BWVA 4WIWA 2XWEA 1XH0A 4UBPC 4N6FA 3G77A 2OQHA 1OX6A 2YL5A 3UZJA 4E3TA 5HWNA 3CV1A 1EFZA 3E0FA 1BKSA 4HKPA 1V6WA 4H9UA 1NOUA 4PRRA 1WZLA 3FKKA 1KV5A 1QTWA 1TO3A 1V08A 3MO4A 4IP4A 2VWSA 2FIQA 4MB5A 2VNCA 3B03A 3TTSA 5I3JA 2XVKA 4GQ0A 2B7QA 2TODA 3PWGA 3CPGA 5FOOA 1IE7C 2W79A 1L9WA 3UBPC 1GUVA 3WEZA 4GPNA 4XAPA 4DLMA 2NUWA 3L0GA 1E4MM 4LFYA 4ACYA 4F2UA 3S6OA 1FWNA 4DAIA 4W84A 3QVQA 1LWIA 3QOKA 4ZE5A 3CQJA 1GVSA 1SVDA 3W70A 3ARRA 2ZXQA 1YTDA 1UIOA 1A3WA 1JRBA 5ECVA 1W9DM 4MKSA 1E71M 4YYCA 4NNBA 2BB0A 2Z1BA 2FZNA 4G1KA 2MNRA 3PZTA 3UJFA 1SFTA 5LHFA 3GR8A 3OYZA 1WB0A 2Q01A 3CMFA 1IEWA 2XSBA 2QJJA 3OBKA 3PTMA 2FVKA 2C7FA 5EMLA 1I60A 4AZ5A 1ZUAX 3RJYA 3W3OA 1YDVA 4F79A 1ITXA 4Q4SA 2CHNA 3UNDA 3WLTA 2B7NA 3CV7A 1CXLA 5IOBA 3KE0A 1GGOA 3URBA 4EXBA 1K9FA 4P8WA 3CXOA 4JYDA 3PJTA 3MSRA 5AVNA 3WF2A 3FNDA 3G6LA 1DWHM 4RDYA 3C0QA 4OBTA 4HD5A 1XI3A 2B7PA 1UA3A 4C6NA 1NOFA 2Y7GA 4PCFA 3MC5A 1YE4A 3TKFA 3DESA 3VD4A 3HQNA 3HGRA 3NXLA 3W7PA 4AYGA 4AWUA 2PLCA 3VDGA 4JFVA 4MLRA 4Z0JA 1QXLA 5AHIA 1XLIA 4EAYA 4HMDA 1RCOB 4A8LA 3PBWA 4E2DA 1E4NA 4PRTA 4UTUA 3BARA 2ZVRA 3WD3A 3WLIA 3W22A 1VRXA 1JQXA 3GB6A 2YCLA 3QTGA 3C61A 5F4XA 1A4MA 1T0OA 1IZCA 1REQA 3GXDA 4WF7A 3GZAA 2W5FA 4LY8A 3VDBA 4NYYA 4N2YA 1WNOA 2RJHA 1HKMA 4AX6A 4IMDA 4JQ3A 2PDPA 2BOGX 2VGIA 2YXGA 3RITA 5LNVA 2VDIA 3ARZA 2DP3A 1PVNA 1UKSA 3P81A 1KO0A 1FWRA 4LUTB 3F4DA 3UEQA 5CSSA 2V5DA 2BVDA 4RE4A 4Z1AA 2PEVA 4PMRA 4BR1A 4KCTA 4UQEA 5I07A 3OGSA 4IIEA 3S1WA 2EG7A 2QZRA 5HQLA 3CZKA 1MW1A 1MRQA 4JQAA 3DHUA 4IP5A 4IIGA 3OVGA 1JPMA 3FS2A 3AMDA 3KL5A 3LLDA 4JD4A 1PZ2A 3DIPA 3NPVA 4JYEA 4WZHA 4LUIA 1PX4A 1I2NA 3LBCA 1KGXA 1W17A 4WJ8A 4GLEA 1YPXA 3C8FA 1YXYA 4OOZA 3TROA 3PFRA 1W3IA 3CQHA 3C2YA 4MAVA 4R3UA 5ECUA 4RW3A 2V5BA 3LXCA 3WN6A 5A69A 2QJNA 5BRBA 1OG0A 4YWIA 2SFPA 3IGSA 1J79A 4C6EA 2A6NA 4ZB5A 4BEQA 4DO5A 3S47A 3C4UA 1FWGC 3S5OA 1CGTA 3YPIA 4ZOEA 3S5NA 2IXUA 2V5JA 3H4WA 1SJCA 1XSKA 1OF8A 4LCSA 4NAFB 2A7RA 4JYFA 1B3XA 2O9OA 1WDWA 3G1AA 3VNDA 2VD8A 1HZYA 3LS9A 4W87A 3KCLA 5D4YA 3LHYA 4DF1A 3BAIA 4O50A 4R7WA 3L4XA 5CPSA 2NLIA 2I14A 4OUIA 1ZRQA 2PC8A 3CEPA 1UYQA 1T99A 1G94A 1A4LA 3GNDA 2WVTA 1OX4B 3UU0A 4F0SA 3C5QA 4Q8UA 1XCFA 3BJTA 3C8NA 3SUTA 3HMCA 4HYRA 3ITTA 3QLLA 1B1YA 3W1PA 3CTLA 2VC9A 3GDBA 4MPKA 2BWGA 2D23A 3QEZA 4AEOA 2QT3A 3SR7A 5KSWA 1GW9A 4NRSA 2FB2A 3S9ZA 1XLKA 1Y7VA 2XJ7A 1YW1A 2R82A 2XVLA 3G1VA 1I1XA 2QEZA 2O9PA 4RR4A 1MW2A 3G1YA 3NOYA 1P7TA 4WKHA 2ZZ4A 1W3KA 2ZQ0A 4KGLA 3MUAA 3E96A 1VENA 5K9XA 2GJLA 2FGZA 3KWXA 1F3TA 3THUA 2WVSA 3E02A 4UTTA 1W1IE 1P48A 3MMWA 4NJIA 3LX9A 3WNKA 1V5XA 4ERGA 3TP4A 4W8AA 3DXIA 4AZCB 2BDQA 3NPXA 3VNIA 1EHNA 2PA6A 4Q8TA 1TWSA 4ZQOA 3TYUA 1W8GA 3O0KA 2NT1A 5D32A 1F3WA 4DN1A 4NHVA 2P3ZA 2CC0A 5A95A 4ZFMA 4UTTC 3VDHA 1JXJA 3KVMA 1C7SA 4P5UA 3DCPA 2Z6IA 4K3ZA 1DJNA 1D9EA 3VKJA 1L8PA 1F74A 4AC7C 1S2WA 4QLJA 4AIEA 4JFWA 1U33A 4H8NA 1SYTA 3L65A 3A13A 1AJ0A 3WF1A 4H1ZA 1SJAA 4O18A 3WLMA 4E6MA 1JGMA 3SQMA 1RALA 1XUZA 4BHYA 5H1WA 1BD0A 4H3DA 2WCSA 3W1LA 4LVAA 5CSRA 4JOMA 3OZMA 3BMVA 2PDGA 2PWDA 3QQ1A 1JCMP 4RPQA 3HPXA 2Q8LA 5DRCA 4X63A 2A85A 3ONBA 2PDHA 4L1GA 5D33A 5CBJA 5LGZA 3OVRA 2VOTA 1AH0A 1MVYA 3WQOA 2VEFA 4E2VA 1JJKA 3KCJA 4JNZA 4OVXA 1WA3A 4U3CA 4X61A 1I8JA 2X8RA 4LB4A 5AHMA 3ZIZA 2YBTA 1B0IA 3UR5A 2R9RA 1Y65A 3GHUA 2A21A 1RK6A 3WD4A 4D71A 2NLYA 1TMLA 1ZJIA 5AOUA 1XF0A 5SWUA 4ENLA 1GPWA 1PSCA 3MUZ1 3I68A 3TONA 1QUMA 2PDMA 3W88A 2G3IA 4YMZA 3PBGA 5F2GA 1A5SA 4JIRA 3W0KA 3Q94A 4GQBA 3TFXA 5HNRA 2IXVA 4PEKA 3NWRA 5C70A 3H22A 3DBNA 4MB4A 3W24A 3CMJA 5LA2A 1MRAA 1XIFA 1HVXA 1GJPA 1V3JA 2E0PA 3ANVA 5XIAA 5FI8A 3LBMA 3T0TA 4LYPA 2OT0A 1TMQA 2ZC1A 3HJZA 3K13A 1BG4A 3F03K 4NP7A 4GYPC 1SUXA 3MY9A 4GYPA 2QJGA 1BPLB 1U5HA 3DG6A 3MKVA 3P80A 3KTXA 1W2VA 4IUGA 2QUVA 1LLWA 4DWDA 2J24A 4B90A 3HG4A 4ORMA 4CU7A 5A2BA 3PUDA 3KRUA 2UY4A 4GX8A 1U5VA 4RDWA 4ORIA 1E9IA 3TTOA 4CVUA 5A6BD 4CD7A 4E8DA 4XO6A 4OU1A 4F3HA 2HEJA 2DH2A 2WSKA 3LPGA 4R7OA 1US3A 5HR6A 1XIBA 3DGBA 3VDAA 4GI4A 1AMYA 3OP2A 1GOQA 4K8HA 3STFA 3WQ6A 3T8LA 1UBSA 3AISA 1FXPA 3W7LA 1PBGA 2XIJA 1F8MA 2V6AA 4MUZA 4LTSA 1SZFA 4DBEA 2VMFA 1WP6A 2P88A 3WH5A 2PGWA 3CAWA 8TIMA 5A6AA 1H11A 2PB1A 4UR8A 1MFVA 5E0FA 1EZ2A 3G0SA 4F0KA 2FZ9A 2PGFA 1W5NA 3SJNA 3BLPX 4RLIA 3HB9A 3EWUA 3U2CA 3NNTA 1NWRA 2QJIA 1XC4A 3ES8A 1ZS2A 3IGXA 4HPGA 5BNKA 1US2A 1KRBC 1E6NA 4KCVA 3UWYA 2Y7DA 2C0HA 1G4SA 1RQHA 1R47A 2RGMA 4F2BA 4ICCX 2F6KA 3W28A 4GUHA 3M5YA 3E38A 1HKVA 3CS2A 3TQKA 2X40A 1W54A 2Y61A 3WUBA 3AWOA 3UXDA 5HANA 3SCOA 1PTDA 4Z2LA 3FSUA 1GVIA 3LQGA 4Q7IA 4MNKA 2W63A 2X1TA 1JD9A 1K4HA 3T0DA 3MS8A 4I8YA 3P3BA 4O54A 1QK2A 2BMBA 1TX0A 4DYKA 3BANA 5CCZA 2VZTA 3A3WA 3N9KA 2FHCA 4H8UA 4JTKA 3W75A 1P7TB 4CN1A 2RUSA 2CBVA 4HU4A 2DUZA 1MXGA 1J9YA 1DQUA 1I45A 2UV8G 1JDFA 3PJXA 2ZWZA 1LDCA 4HNVA 2YCLB 3OA5A 3LHZA 1AVAA 3KOXA 3GVGA 3PHAA 1QWKA 1ME7A 3RFAA 2R1KA 4IJCA 5F1VA 1K4GA 4JTGA 2D2OA 5D02A 1CLVA 1L6FA 4JTIA 3S5ZA 5CBBA 5EBAA 4JKLA 2EQDA 1LRTA 3B3DA 2NV9A 4JNYA 5EMKA 1KWKA 3MYPA 3GC2A 2HE5A 1M03A 5I23A 4JIQA 4N9EA 5G4EA 3R94A 3EKZA 4U5IA 1M04A 4QSFA 3VZZA 3AALA 3TJLA 1W31A 4OHQA 2HMCA 5CBIA 3H2MA 5HWMA 4OWGA 3Q67A 3VMPA 3FFSA 2BGNE 4JTLA 1XS2A 4L9ZA 4RE3A 2XH4A 4K2SA 1VLWA 2ZDRA 4CCEA 4CQAA 2WHMA 1W0MA 3UT0A 2IKHA 3LLFA 4JTTA 3BH4A 3RMJA 1ZJBA 5D03A 1NF0A 3W1UA 1W5MA 4D6DA 3CWNA 3I7RA 2WZIA 2QGYA 3ENLA 3EA1A 2ZOXA 4KFPA 2OO0A 4XK2A 2YOCA 4AAJA 1ONXA 1VBGA 3L2IA 1DHPA 4DZIA 4H2HA 1MNZA 1TWWA 2OPJA 1JF6A 4OECA 1C8YA 4WKAA 4NAEA 4YVPA 1OHLA 3MSGA 4PTVA 2F2HA 3V35A 3KEHA 5EMJA 1AFSA 3CZEA 3GDLA 1ODUA 1Z7AA 3WELA 3HM7A 2BBFA 2DW6A 4MB3A 1BYBA 3TQ0A 3FDGA 4C5YA 4FOKA 3MSDA 5G1MA 3TNOA 2Y2WA 1ICPA 4IMAA 1VJSA 2BP1A 5D9PA 1NVMA 3SDOA 3NGFA 2GZXA 1TQXA 3VOCA 1JZ4A 4ADSA 3TYBA 4UQAA 1PTAA 2V3GA 2ZWYA 2D2JA 1ZFJA 1B57A 2Z0IA 4Q4KA 3WDPP 1WKDA 1EJTC 4AD1A 1LUCB 1QJWA 4HHPA 4UR9A 1UQZA 1E56A 3MCNA 4EANA 2VD9A 3QPYA 4C90A 4W93A 1A0CA 5HA7A 5FF2A 3H53A 3PY2A 3RXZA 3PANA 5B7ZA 4C6BA 4FSAA 3ZLGA 1A0DA 3L5LA 1AL8A 4CQCA 4IISA 4UZSA 3TXZA 4LS1A 3VCRA 3G24A 4LJ3A 3SN1A 3GXNA 5IHSA 2CLIA 3QV6A 1QHPA 3UWUA 5FCZA 5TD4A 4US6A 1S5TA 4HMEA 5CKSA 1B2YA 1JYXA 3DI1A 3EKLA 4M51A 1RBLA 1WZKA 4PULA 3K4WA 1XRSA 2DORA 4PC8A 3W7OA 2WXDM 2J25A 4GVFA 3H12A 4NNAA 3NL2A 5AHEA 4DUWA 4L4PA 4DO6A 4BF9A 2QIIA 2VX7A 2IKIA 4GVGA 3LI0A 3GDKA 2AL2A 4UOQA 1Q13A 3ORWA 1YNQA 3U4FA 5LZLA 3VIFA 1VJZA 1O5KA 4PMDA 4WK9A 2C19A 4QQUA 2CW6A 2WKJA 3U9IA 4K8GA 1UZHA 2G3JA 3EB3A 4GZ7A 1MDLA 3JZUA 3DUGA 3NQ2A 4IGNA 4Q6XA 2BVYA 1WBHA 2WMKA 4QE5A 1LLZA 3N25A 1YIXA 3GWQA 1FWSA 5TBOA 3KZPA 4YU1A 3CLWA 2TSYA 4QLLA 1UH4A 2WQDA 3QMTA 4IWWA 4BI6A 4S3CA 3AZRA 4LYKA 4H9VA 1XISA 3PR2A 2R1PA 5DT7A 1BQGA 3KL3A 1ONRA 3EWXA 3SY8A 3QR0A 3W73A 3WH9A 1VP5A 4A29A 2P3EA 4GXMA 2WZEA 4L7ZA 1GG1A 4GBUA 2WM1A 3G0XA 3LCXA 3IARA 1UKQA 1A5NC 3WQ8A 1QI5A 3B8DA 2Z2BA 3T8QA 1CWYA 3PZGA 3QMSA 4NI8A 2FMNA 3BG3A 4JHMA 1OABA 3QXBA 3RK8A 2FZBA 1TPC1 2J6XA 1H1YA 3K1GA 2PDXA 3TOYA 1WKYA 2YL6A 1D8WA 3F5KA 3ARUA 1EOKA 4GK8A 1Q4NX 3TYZA 4K6AA 4A2SA 2RDWA 2OELA 3KX6A 1BFNA 1K02A 3B05A 4L61A 2DVUA 4UTMA 3R0DA 5HINA 1CEOA 1S46A 1FH8A 3I3BA 2WYSA 2C1HA 1H5VA 2Z1WA 1NARA 3PBMA 1KTCA 3I4EA 3UP8A 3ZSSA 4E0CA 4GXPA 1XIHA 2HROA 2OCZA 5KITA 2GSJA 3CK5A 2HPMA 4JN6A 3DI0A 5AB3A 2OVLA 1CTNA 1EXBA 4C6IA 5HPOA 1OGGA 3GAYA 3VIGA 1GQNA 4EKJA 3IS4A 1ZCOA 3DECA 5DXYA 2O9TA 4LBSA 1F07A 3EPMA 1V0NA 2CZDA 1UD6A 3UZ5A 3UR7A 3MMDA 4HB7A 2CHRA 4IICA 3BLDA 5IFTA 4Y90A 3V7PA 1MUWA 3CEUA 1FHVA 2CERA 1ECQA 5CC5A 3WLHA 3W1XA 1FDYA 4MJ2A 2P8CA 3K2GA 3LEPA 1NEYA 3GYEA 4EOUA 2F7FA 1FP9A 3TE9A 3BURA 3FSTA 4FIQA 4MWAC 3UPMA 4NI3A 4AIOA 1E70M 4FNTA 2J8FA 4O1BA 1RA5A 3QGAC 4M7SA 1YMYA 4LBUA 1OCBA 2AL1A 4RE0A 1A5LC 4C6FA 2Y24A 1XIJA 1TPH1 3V5CA 2YCEA 2D2HA 2TPSA 2W9MA 3NQEA 1JIBA 1GZJA 5HNTA 1FWJC 3W87A 2HBVA 3NM1A 4KWVA 4O10A 2IPJA 3XINA 1SQ7A 2G3MA 3H8AA 1VIWA 3QPEA 2OEKA 3R6IA 4PB4A 4AQLA 5FEPA 1UH2A 3APYA 4EAMA 1DBTA 3E0VA 2V2CA 4XBKA 4ZSUA 4NAFA 3BSMA 4Q22A 2DFAA 1DTUA 2XG9A 3LGDA 3AS0A 3LHTA 3GVVA 5J8LA 2GYIA 3H54A 2NW0A 1I2PA 2NWSA 3KVLA 4OGZA 3CPRA 4Q8PA 4XZNX 4E4PA 4KWWA 3N17A 1LWHA 4JIIX 2B4GA 2YA2A 3PZMA 1WDRA 5MF5A 1AZ2A 3P0WA 1UZDA 3ES7A 1ZY9A 1W1ZA 1EX5A 4GGBA 5A6SA 1P6WA 1F4HA 2DT1A 3IIPA 3CIVA 4B16A 1F6YA 1QW9A 3D6NA 4C1KA 4FIRA 1GCYA 4OUEA 3U5UA 3AXMA 3FY1A 3FN9A 4ZODA 1QPKA 2NV2A 1EBGA 3W1MA 4HA1A 1XIGA 1QWGA 2Z25A 3N73A 3S5YA 1YBQA 2XISA 3I4KA 1UPPA 1NDVA 3L23A 3PPGA 3OU8A 4IP7A 4AF0A 3KDOA 1JZ2A 1DL3A 2E3ZA 1D3HA 3AIBA 3T0BA 2OB3A 2Z24A 1GQIA 1UP3A 2CXGA 2ZUUA 4UOJA 2NQ9A 2ZE0A 2INZA 1E15A 1H3GA 2E25A 2GVEA 2ODOA 4MM1A 3R1ZA 1N8WA 2YCKX 4P2VA 2ISDA 1TPB1 2AQVA 3CNYA 3NYDA 1J4EA 4IL2A 3R25A 3LY0A 3RX4A 3G22A 4DBSA 2A1YA 1R3TA 5CPNA 4JX6A 1N8FA 4LAZA 2DSVA 1C3FA 4XD5A 2IQTA 4E5TA 3SEPA 3T9PA 1VR6A 3GG1A 2ZXBA 1VEPA 4Y9MA 3UQNA 2CZFA 3LCFA 3T40A 1NDZA 1W9UA 1WKFA 1X98A 3A5VA 5FKYA 3EA3A 4PSRA 3GQYA 1J0IA 2BSLA 1UUQA 3BQ5A 5AC4A 3WNPA 1RCXB 2QMJA 3WLKX 4XAYA 4WEVX 3EB2A 2XFRA 5DT5A 2BV9A 1U1JA 3E0WA 1IQ8A 4LUTA 3BCDA 1I9CB 4QE1A 3UZWA 3TTEA 2GDVA 2E4TA 3W76A 4YJ5A 3RMEA 3STCA 3RYSA 4NIRA 1QDSA 2OEMA 4GJIA 3EX1A 2F8QA 2J8TA 3HFYA 4GD0A 4KMQA 3H70A 2EO7A 2PP0A 4HBKA 2F6UA 2HZGA 4I5RA 4WX2A 5HXMA 5CPLA 3LPOA 4WDUA 3GD6A 4LNCA 4TQTA 1WO2A 4WCJA 1E6RA 3HGSA 3W1AA 3KRSA 3PPHA 3ABSA 4H7VA 1OYCA 2V5CA 2BS9A 2CYGA 2HJPA 1C8XA 2O7QA 1JEZA 3F2DA 3H2CA 5JXQA 3GFXA 5ABTA 4ACZA 1OJXA 2Z7GA 4GIYA 5IM51 4POCA 1W3HA 4QG6A 3ANUA 5M17A 3ABXA 4ATWA 1H63A 3UVAA 4DYEA 3B9AA 3C2VA 3V0UA 3T2QA 4C6KA 4PCPA 4ZO7A 3BLLA 4GNVA 4LAKA 3CBWA 4TXEA 5HUOA 5C8BB 3AS1A 5T9BG 2LLEA 2PUZA 4XX6A 2QYGA 3VIMA 1Z6KA 4FXJA 3TSMA 2ZUSA 4IQJA 1YNPA 4XUGA 4B5TA 2ACSA 3T81A 2V69A 3ABZA 3UG5A 2I7GA 3ZT5A 5HJXA 4ROPA 3S9YA 3ME3A 1IEVA 4F40A 3SCUA 1V6YA 3U2ZA 3D5HA 3KFTA 1AK5A 4W7VA 3DC0A 5D38A 4UTHA 4LV4A 2CBUA 2WSRA 4V27A 3KHJA 1NFBA 3CZJA 3CYJA 1FWFC 1A50A 5EKYA 1V6XA 4DJFA 4KCUA 3TH6A 3TW9A 3FAXA 1ZL1A 1X7IA 3STGA 4R9OA 2ZCGA 3B8VA 3RAOA 2E9LA 4HU3A 4EACA 3HZ3A 4B3KA 3OODA 4AC1X 3EPOA 3HA1A 1TJRA 3NQDA 1Q85A 3FVDA 1T96A 5H6HA 1QCWA 3VOJA 1J2BA 1OVDA 1ADDA 1RA0A 1W91A 2PDBA 4J9JA 5E5CA 1NY1A 4H7CA 5BZAA 1RH9A 4QLKA 2WHJA 4HTBA 2Z2AA 2V8ZA 2E9MA 1XYCA 2VI0A 4ZB0A 2IS7A 4ZXOA 1ISZA 1PB0A 4WDTA 2FPVA 3LM7A 1LJYA 3WBXA 2G95A 3OLIA 5AY7A 3QOMA 2BX7A 4NZ5A 4DWSA 2GK1A 5E09A 1J0HA 2VFIA 4JIPA 3NQBA 3WDQA 1EXPA 1TV4A 5FF7A 1CGUA 2PDUA 4IQEA 4NY2A 3E74A 5CC7A 1Z69A 2YGYA 2Z4GA 2X1UA 1GJWA 2X2YA 3MANA 2XGIA 1DTNA 2BY0A 1QATA 1KM6A 3KBVA 3NA8A 2O7SA 1R7OA 2C15A 4FOJA 4NQ1A 4N9BA 2EBNA 3QYQA 4H9TA 4TU1A 1SO4A 1LCOA 1EC8A 3PBVA 4XVDA 3W1TA 1PO9A 1P1MA 1PPIA 1CXEA 1SW7A 4RK8A 1XX1A 3N04A 4WXYA 2PD5A 4E8GA 3RHGA 1E6XM 1TPUA 4F48A 2R6OA 1FWEC 5DX7A 3ZZ1A 1RR2A 1VFTA 3VUPA 5ABEA 3QHNA 1EPVA 1ME9A 2ABAA 3IJQA 1VEOA 3MJYA 2FDSA 4MJMA 3EEZA 3CM4A 2QDDA 1BYAA 4LVDA 2WBKA 4YIWA 4L56A 5I77A 3LRLA 4ZBCA 2R1NA 3S3GA 2OLAA 3PZOA 3NJ3A 3BJSA 1DP0A 3LZ3A 2G50A 4B2DA 2I57A 3QR1A 3QY8A 1EP1A 4A6GA 2Q8ZA 4GKTA 2ACRA 1UD5A 3GM8A 1SW0A 4RCXA 1POJA 1XICA 4UUIA 2YA0A 4UCGA 5BXTA 1UPMB 1RLDA 2H8ZA 4O1DA 1NWSA 3M0YA 5DO8A 1EDTA 1XWYA 2ZUNA 5D9MA 3VD9A 4A2RA 3UY8A 3PB2A 2Z00A 3KLLA 2ZRXA 3FJNA 5CJ5A 4YLWA 1EA0A 4EWJA 4XKYA 1JDEA 4S3EA 3PTKA 4ZTXA 2E8ZA 3W6MA 3R58A 4DRSA 1HXJA 5C55A 3L4ZA 1JD7A 4JTJA 1YDYA 4ZE4A 3SIMA 2B81A 6ALDA 2R8WA 5ABGA 4LYRA 4ZQPA 1QK0A 1UQYA 5D2XA 5E93A 3WO8A 1LRNA 2VC7A 5LXXA 4H9ZA 5DANA 3LD5A 4S2CA 4O13A 1NELA 2CZVA 4J3SA 3ELFA 2J47A 2TAAA 1GYLA 5HUPA 2R24A 3IGHX 4HCLA 1TTJA 3TC7A 4XV0A 3T4WA 3NZRA 3CJPA 3DBPA 5DBUA 3PK7A 4J27A 3LCLA 5GNXA 4I9AA 1DJYA 3WUFA 1JCYA 1DKWA 1UMLA 1OFDA 4XO7A 3IGUA 3DFHA 4DXVA 1B3ZA 2ZICA 5MKGB 4NT0A 3DHPA 2E28A 3RNDA 4JCMA 1QHZA 3GC4A 1E1CB 2JEPA 3CHDA 5D8ZA 2J6VA 2OOFA 4RXFA 4P8UA 5CXPA 1S1PA 1PIGA 3BMXA 4HNOA 4R27A 4O8AA 1YPIA 1E5JA 1XH2A 3DYOA 3FJ4A 1HJQA 2AQOA 4XVEA 3GXIA 1D2KA 3UXAA 3ZLFA 1A5CA 3G3MA 1X1NA 3NL6A 3M0IA 3LERA 5FIPA 4MY9A 4P7LA 1M9HA 2H9AA 3P14A 4LC6A 3HPZA 1E1CA 3QTPA 5HJLA 3DH7A 2PWGA 1IT8A 1TPVA 1EJ7L 4MJZA 4P8XA 5KZ6A 1OCQA 5JBDA 3KBNA 4DWSB 2BXYA 2O92A 2NZLA 4HU8A 1EQCA 1MZHA 1XCXA 1B9ZA 1Q7ZA 3WKZA 3DFTA 4HK7A 5G2IA 3UWEA 1UWTA 3ECQA 3E0IA 3CYVA 3ITGA 2QCFA 2F61A 2A3EA 3CTTA 4GYFA 1Q65A 2CZEA 5LSMA 4ZA0A 4DYJA 3TN3A 1NTHA 4HGXA 5LIWX 4JKKA 3LRMA 3W6YA 1PV8A 2VO5A 1KFWA 3KS6A 3P82A 2C0AA 2CWNA 1G4EA 4JDYA 2BXVA 4D72A 4FNPA 1OFBA 1YQ2A 2ZA1A 2YB4A 4RZ4A 1TREA 1IIHA 3GYCA 3N34A 1XXXA 1JCJA 4LOCA 1BVNP 5DN1A 1PCWA 3NQCA 4N0RA 2ZXDA 3KOWA 4KEUA 4ADUA 4ES4A 2GVYA 3O9NA 5K4XA 4AZBA 3TU9A 1SFJA 2QVNA 3HMJG 2PDKA 4RJEA 1RSCA 1UJPA 4Q33A 4DPQA 3MI6A 4FZIA 4QX4A 1NDWA 5CZJA 4ZL1A 3HV9A 1XH1A 2NVCA 4G8TA 6A3HA 1VGAA 4K7VA 5FAGA 4AWTA 1KBJA 4UMAA 1XGDA 2E6YA 3SRFA 2RDXA 3COTA 5DBTA 1VD6A 4DBWA 3GBDA 1IEQA 3UJ2A 3HURA 3MSYA 2CLHA 1QT1A 2IPGA 4UFIA 3DFYA 5AYIA 3GTFA 3ALGA 4C6DA 4L4LA 1UWQA 1SW3A 4ZQRA 1QNVA 3SN4A 3S2NA 3BW3A 5G2WA 1UCWA 3KHDA 4DELA 2FZDA 2V5KA 9XIAA 3DG3A 1VF8A 3QC0A 1A5UA 4GKLA 4PL2A 4NILA 1MQQA 4AW7A 2V9DA 1TFVA 1Y5XA 4FNSA 2EAWA 2X1IA 3MTWA 1P0DA 2ANUA 5LA1A 1LQ0A 1VS1A 1ZTVA 2VXNA 3UG3A 1WZAA 3VC6A 4HSOA 1WBJA 1EC9A 3NUKA 2WVVA 8XIMA 1EJXC 1XLJA 4RNJA 3BE7A 1ZCCA 4DI9A 2JF7A 2DZTA 4LW7A 2VCCA 3R0KA 4NRRA 4AZIA 1OBAA 2QCGA 4U5KA 3VNYA 4GI6A 4K1GA 4KFOA 4NAEB 3ARVA 5DMNA 1X38A 1KTBA 2OKTA 2WJEA 2XVPA 5EMMA 3MQTA 1HNYA 4GUGA 3SSZA 1XDMA 4Z17A 1YPFA 1GVFA 4DHGA 1CXFA 1CNVA 1SZNA 3FKRA 2YA1A 3DEQA 1HG3A 4GQQA 1H62A 2OTDA 1AH4A 4N4PA 1F6PA 1H1ZA 1FCVA 3PVFA 3GLCA 3FV9A 4M1BA 5AYZA 3M07A 1IIGA 2WK2A 3GZ3A 1JUEA 1ME8A 2CLEA 3NO3A 4QXIA 3AYRA 5EFFA 1I75A 3VAVA 1DXIA 4JTSA 4AIBA 2DQWA 4K39A 3IJ7A 3DYPA 1EGVA 1QI2A 5E6ZA 3SM0A 1TV3A 3W2JA 4JTRA 5AC8A 3VNKA 1JPIA 4L6DA 1Z89A 1JF5A 1NSJA 5D9OA 1VBHA 4Q4PA 3MZ2A 5CZTA 3IV8A 1LT8A 2WM0A 3C6CA 1Q6GA 3N4FA 1LZOA 4PMNA 2VUNA 5T9CE 1NU5A 4QSHA 1BXNA 3VMOA 3WK3A 2Y63A 1S5NA 2X30A 1PKYA 1Y5VA 3BLOA 4C6LA 4DB7A 4IX2A 1Q63A 2QQ6A 3QF0A 4NJKA 2PDJA 2POZA 1SR0A 4JDBA 2FGLA 1BXCA 3S2LA 3E5BA 1LBFA 1CLKA 4X22A 1KRAC 3RRAA 4V2XA 5AVHA 1IHIA 1JYNA 2Y4SA 2J7EA 5F4SA 3QC3A 4B5XA 3QSRA 3TW7A 3CO8A 3HFTA 4RX0A 4BI7A 4GIAA 4J40A 3MMUA 1C91A 4GYKA 1N55A 5IRPA 2A7PA 2NXIA 4C1LA 1JUKA 3KP1A 2X1SA 3E2QA 4PMZA 4IQLA 1MXDA 4HPJA 3MYOA 2X41A 3E9AA 1UH3A 4D6IA 1Q6RA 1OSEA 3O2LA 3N4AA 4WRHA 4N4QA 5JVLA 1E3XA 3ZS4A 5CQ1A 2CLKA 2ZRVA 1E1FA 3E0LA 3TSDA 1XSJA 1R8LA 1SFLA 2FHFA 4O14A 4C6MA 4HPNA 2FPYA 3FJ6A 3IK4A 5CPMA 4UQBA 4QR6A 4YTSA 3LN3A 5FD0A 1ZAHA 1JGIA 1UKOA 1FBAA 3VGBA 4S38A 2QCEA 5FL1A 4IUOA 2Q8XA 1KXVA 2WWCA 1FUYA 1DXFA 2B0MA 1RHCA 2F38A 1P0BA 3GXMA 3NVDA 1GWJA 3T78A 1S3HA 1E0TA 3TDFA 4MF4A 5KEZA 2CETA 1BTCA 3Q2DA 4PYSA 4RZ5A 4FAMA 4X0VA 4I5XA 1R38A 1WUFA 4M8UA 3UWVA 1E55A 2PP1A 2PU0A 4GA8A 2DIKA 3TJ4A 4FNRA 1H41A 1OCNA 3POHA 5HJYA 2FMOA 2YJQA 2XFFA 2WHKA 4OE7A 2FB3A 2ZZ6A 4R5EA 2NSXA 4MFDA 4ZMGA 4Y8EA 2FTPA 1POKA 2FQIA 2VCAA 1VH7A 2CLOA 2A6LA 3VABA 4TMBA 4YTTA 4QCEA 2NT0A 5IBXC 2QPXA 4JN7A 2VZUA 3TN6A 3VIPA 2EPNA 3D46A 4GY1A 3KUMA 3O6AA 3R7MA 1XL9A 4FPSA 1EKOA 1R2SA 5D2YA 1XBZA 1ALDA 4HOWA 2WZMA 3WEMA 2HNHA 1KTNA 4JTHA 5AFDA 2P76A 4H7ZA 1UZ1A 4UTLA 3LYEA 5IXEA 3BAJA 4C6PA 4ERIA 2HVMA 4G6CA 1XG4A 2DZPA 4S1FA 4F0RA 3OIHA 1N2VA 2GJRA 3ABQA 1E72M 1YEYA 2J27A 1GG0A 4CU6A 4I7VA 2PDLA 1ELSA 2ZUWA 1SO3A 4HQVA 3GG8A 5TIMA 3EMZA 2ZUTA 3IANA 6XIMA 1S2AA 3S1VA 1VHNA 2R1LA 2VX6A 5C9ZA 1ZALA 5K3VA 1MXSA 1W1B1 1TMHA 4EPBC 1OIMA 4B5WA 4QS6A 1RPXA 4H6EA 1ONEA 2HNEA 3D0CA 2ISVA 3RN6A 1Z32X 1E73M 3WF0A 1KM2A 1V6TA 3SADA 4CQDA 4DLFA 3GTHA 1F5ZA 1RVKA 3A9IA 2RFGA 2C79A 4XZMX 4CU8A 3ICJA 2CEQA 2F9RA 3EX3A 1G7UA 1NOWA 4QBXA 3L4WA 3HIJA 1Q4WA 4OIFA 4OFCA 2J7HA 1WAWA 2ZRYA 3QV7A 1UD4A 4XSMA 4M6QA 1EYEA 3CUXA 5JH1A 1HQTA 4KW2A 2NXHA 4XWUA 3VK5A 4WVXA 1A3HA 3PWIA 3TZFA 1KFBA 4FXSA 3EXRA 4IFOA 5CGTA 2X05A 1FVPA 3K4AA 4HJFA 4S3JA 3N13A 3PZNA 2X42A 1N7KA 1FQ0A 3N9RA 2QCDB 2J7GA 1UZ4A 4Q8OA 1W1A1 4J3ZA 3K30A 4WGHA 4ZFCA 2X16A 3NURA 3MP5A 4G9PA 2WZHA 1HJUA 3F7JA 1JYVA 4ASTA 4PMXA 1Q6DA 5CZ0A 1PKMA 3O15A 4MWAA 4A4AA 2I56A 1RY8A 4KEVA 4LX4A 5CGMA 4MHBA 3VO0A 1O6IA 1W8SA 4MZYA 4WHBA 1AQHA 3W1RA 3W2UA 4LF2A 2VKZG 3VNMA 1M41A 4HA3A 3WDJA 3GHSA 3N19B 1TWIA 4BJHA 3ALFA 3ARPA 4QJ1A 2HVOA 4HNCA 3AZTA 3UETA 1WUEA 1KWGA 1DWFM 3L2MA 4W5UA 2J7FA 1WYIA 7TIMA 2WKLA 3CUGA 3SI9A 1KGUA 4UTWC 3TLLA 2BASA 2GQ8A 1K9TA 2XSXA 2JF6A 1VCVA 1JCTA 1WX0A 2PE4A 3N2CA 2W4XA 3W2LA 2C1GA 1OADA 1I2QA 3KM8A 4J28A 1TJ1A 3ZM8A 3CT2A 3BV7A 5J04A 3L4YA 1CXKA 3QZAA 5EBUA 3N14A 3RILA 2Y5JA 4PZVA 2Y88A 3MWCA 4IIBA 2ZZ1A 3N18A 1LTDA 4W85A 4O8RA 2DPEA 5F7UA 1UWAA 1TE6A 4HPXA 4KBXA 1MI3A 3K8MA 1TPDA 3WDRA 1C90A 3IACA 1I2RA 1RAKA 2ADAA 5CAHA 3WBYA 3ATZA 1OX4A 4UFKA 3VX0A 4H9XA 4YYFA 2Z26A 1IXQA 4W88A 2PDIA 1ONWA 3NCOA 4XTDA 4H04A 3VXGA 4I6KA 4BQ2A 4FR6A 2ZDSA 3TW6A 2ISSA 3WQEA 2W67A 5BMWA 3W7NA 4TR9A 2CHOA 1GVQA 3QSTA 1EUAA 1OC7A 3IPWA 4O15A 4K68A 1BSIA 3KRBA 3NSMA 3RR1A 1IXOA 1I0BA 4NF7A 1Q2SA 2C71A 4B92A 3VGGA 2D2GA 7ENLA 2INFA 2V3FA 5EL1A 1A5OC 3SCRA 3NDYA 4W8LA 2OZ0A 3AU6A 4HA0A 1CXHA 5D8WA 4L5ZA 3LSBA 2DSKA 4A22A 5C5YA 3CPUA 3LPFA 4P7NA 1K8XA 4NG3A 5TNVA 3KDNA 1XM3A 4KCWA 4IMFA 3F1QA 2XN2A 1WXZA 1OFQA 2VGBA 4MADA 4C1NA 1GOWA 5BMXA 3R13A 3ZR6A 3TVAA 1DJXA 2J7CA 3WDIA 3MHUA 3D3AA 3LGGA 1L6GA 5FF0A 4M19A 2BVTA 3PPCA 3BMWA 1OT2A 4FNUA 3JW7A 4ACZB 1S2TA 4Z0SA 4JHZA 5M03A 2UBPC 2GPTA 4O1FA 2P50A 2ZZ7A 3OQ8A 1A0EA 2OLHA 3EOEA 1L6WA 1UB3A 3MWAA 5TQLA 1OM0A 2G96A 3BGJA 5C9XA 4AD2A 4YNGA 3ARSA 3MUY1 5EA9A 3OGVA 2O4MA 2CXEA 1IEIA 1ECEA 4EVZA 4QDWA 5AC6A 1NQKA 3PNZA 1W3TA 3W1QA 2J4GA 1CGYA 3W26A 4XZBA 1YYAA 3U6WA 4CCDA 1KFEA 3GUWA 1Q8JA 4D6CA 3EDDA 3GU2A 3PG9A 5AC5A 1F05A 3LK6A 4I3GA 4LANA 2EPHA 1XYZA 4RUBA 3BGAA 3EZ4A 1QR7A 4I90A 5DMLA 4UQCA 4QS5A 4PMJA 1BVWA 3W7KA 2D0HA 4BY3A 1EX1A 1E5NA 1Q7QA 2VQTA 4PUUA 5CG0A 3WMLA 1F8IA 5BWFA 5D09A 2BHZA 2DJLA 3OPSA 1UA7A 2Q3OA 4L9YA 2NUXA 5DCEA 3CUJA 2NVDA 1IR2A 1R86A 2PDQA 2ZC8A 4KERA 4F8XA 1DWGM 5IDZA 4J5NA 1GEQA 3AFBA 1HP4A 3N2OA 3W7JA 4OV9A 1MZRA 3AHYA 1VHCA 2Z28A 4Q7NA 1F4AA 3GR4A 4YWSA 3W02A 2A3BA 3ATYA 4A3RA 3S83A 1KM3A 1VCGA 4M6PA 4PE8A 4AFYA 3O07A 3Q45A 4D6FA 3VOGA 3EDFA 3TR9A 2QJHA 1V4YA 3KS5A 3MP4A 1VFMA 1TVNA 5BU6A 3KOZA 3EXSA 4X0NA 1V6UA 3L9CA 3REQA 3N2BA 3LLXA 2EJAA 2AKMA 3CHFA 4JEJA 3UXLA 1QPQA 1FCBA 4FR1A 4FK9A 1WXJA 2ZA3A 1CGVA 1DJGA 1KR1A 3MVIA 2E67A 1PJ9A 4M6UA 1EWDA 9XIMA 4UIOA 3CV6A 4B3ZA 1HGWA 3AJ7A 1XGZA 3W72A 4UFMA 4ZO9A 5J5DA 3BLIA 4IJRA 2Y7EA 1IZKA 4QNEA 3E49A 4J35A 4DM1A 1K7EA 2JBMA 4XUYA 3S1GA 1H7XA 4UQ9A 4O52A 1H7RA 6PTDA 2YXOA 3B9DA 4GH1A 3WQDA 3QN3A 5G4WA 1E0VA 3M16A 4WXZA 2AKZA 3IVTA 5CC6A 1B3WA 3W1NA 2EPKX 1U22A 4Y6GA 5A1AA 4CNTA 7ODCA 4PEEA 3T0AA 2PWHA 3SFKA 5LIKX 1KM0A 4O0ZA 3DENA 1T41A 1S39A 4S3AA 1XLBA 3JS3A 3C52A 2DIJA 1FOBA 1Q6QA 1WXYA 4QG8A 2IUZA 4QM1A 3L0KA 5T26A 1AUSL 4NXKA 3SRHA 2Q3RA 4K36A 2TMDA 3M43A 1K9EA 3MMTA 3ZXWA 2D69A 1KC7A 3IIOA 3K8LA 2XH7A 3CT7A 3II1A 3P8JA 4UC5A 4NKCA 2GOUA 4Y8FA 4LPCA 1JAEA 3VPLA 2XGZA 2X7VA 1KXQA 3CHEA 1VLIA 4R88A 1LOQA 5D9NA 5BW6A 5I6SA 1Q5MA 4XAZA 2YDRA 1DYSA 2HDJA 3VGHA 4BQ5A 4GO8A 2G41A 4FHAA 2XM2A 3WL1A 2P8BA 3R10A 1R0MA 5FEZA 5REQB 4B9YA 3ITLA 2ISWA 4PMUA 4B5VA 2PWFA 4KRUA 3TNBA 4IPJA 4ZZ9A 3LENA 3O6YX 1C93A 1IV8A 1XLCA 3M64A 1SR9A 3A64A 1OFRA 2PU1A 1KXTA 3EOLA 3QBUA 2C13A 4DUVA 3EA2A 2FTWA 1XIDA 4H00A 1U83A 1XV8A 2JALA 1R5YA 4UCFA 1UW9A 1PZ0A 3QFEA 3P6LA 4UMBA 4WSHA 3V4BA 2OJPA 5EMUA 3DX5A 2VVNA 2HVNA 3SQSA 2OFJA 1QNOA 4J4KA 2WLZA 5EFDA 3QZEA 1W5PA 4EK7A 1PE1A 3EOSA 3LTSA 4CN4A 1HUVA 2WMIA 1SU5A 5DF0A 5BOEA 3PFMA 3EEGA 1NFGA 1R46A 1FRBA 1TRDA 3R43A 4L64A 4AEEA 1V8EA 3W07A 1BAGA 4FX7A 4CCCA 3OHMB 1CZ1A 3A4AA 3L7RA 4A3QA 1VBUA 3W74A 5LKYA 4Z08A 3CQKA 2DH3A 3PZVA 4E4UA 3NZPA 1HL8A 4FLSA 3RLUA 4U28A 2FDMA 1RUSA 3PTQA 2KX9A 2CKSA 3B06A 2OR2A 3UY7A 3UZYA 1RD6A 5H8UA 1BVZA 1F73A 3H7UA 4AWSA 2DW7A 4GYJA 4TV5A 1VZWA 3MO7A 2QW5A 1XRFA 5DMMA 3FYPA 1UBPC 4U3AA 1XGEA 2NSOA 3SUVA 2VC6A 1B90A 1BYCA 4C7DA 2OLSA 4UNLA 1UUOA 1CDGA 4DJDC 2VRQA 4PTXA 1BRLB 4PCTA 1MQRA 3SGUA 1VYRA 3DHDA 3P7YA 1XYAA 1ZQ5A 3WJXA 3GXTA 3IUIA 4R53A 4R34A 1MEIA 1ZB5A 5I00A 4JXCA 3WH8A 4ZO8A 1EDQA 2PF8A 4E2OA 4CEXC 5F2LA 3WIJA 3NO1A 2PDCA 2I1OA 4NJGA 4HPHA 3JVAA 3RR4A 4RKAA 4U2YA 5FJJA 4XQ6A 4HNTA 3N29A 5AECA 3PAJA 2INEA 2VYOA 1TQJA 2GWGA 3WUEA 3FA3A 4B9ZA 1YXDA 3EB4A 3R4IA 1RP8A 1H51A 3AXKA 2AGKA 2F2KA 2YCIX 1Q45A 3L12A 3EWCA 1P0KA 1VFUA 3PN8A 1A80A 3M0LA 4I8DA 2GJXA 3MPGA 1XBYA 3GFZA 5M5DA 2DIEA 1H7OA 3A23A 1Z42A 2YIHA 3VGEA 2RDTA 3RM9A 3WJYA 4MDPA 2Y8KA 1SSGA 3AIWA 4GC3A 5T8GA 4XD4A 1FWDC 2Y85A 1ODZA 3MW7A 3N3TA 4HN8A 1KBKA 3WD1A 4PSPA 4L1XA 1V3KA 3KLKA 3B04A 3EOOA 6REQB 1K3UA 1XLDA 1H49A 4MOZA 4AZCA 3VOIA 2ATSA 4QQ3A 1B9BA 3WQ4A 3BGGA 1OF6A 3ZR4A 2EPMX 3TQVA 2H3BA 3BDKA 5CAKA 3THDA 1MDRA 2AMGA 3BOXA 5D2VA 4GUJA 1G69A 3CC1A 2DUXA 1OGSA 4BQ4A 3LXBA 1KLYA 4IFKA 3U8GA 4XAGA 1GVOA 1W3NA 5I3HA 4UFLA 2WQPA 4CKQA 5BROA 3KL0A 2VJXA 4P7RA 4TVDA 4V33A 4B4FA 2DUAA 2YCJA 1ZP3A 3A22A 3SCWA 4CQ8A 1HO1A 4FMVA 3QW4B 4QJ3B 9RUBA 4D1IA 1TA3A 4FB7A 2BTMA 1M7OA 3SN0A 2AQWA 3THAA 1MMFA 3BCFA 1XQKA 1RV8A 3S2MA 1HN1A 2A3HA 4MY8A 1M5WA 3VIIA 1BEUA 2VX4A 1EC7A 3VGDA 1HKJA 2OU4A 3R8RA 5GNYA 2CNCA 3LUTA 5AC7A 4JEQA 1U1HA 4JPGA 1OD0A 4ATLA 4JN8A 2Z6JA 4UZUA 5B80A 2WMFA 4HIBA 1UP0A 4JQ4A 4B5SA 4EP8C 3WENA 4AXNA 3TAOA 1GKQA 1L2UA 2XGBA 3SGZA 3LCIA 4C7FA 5I06A 2XDFA 1YHTA 3ZVHA 1ISVA 4DJFC 1PIFA 1QPNA 3W83A 4PTMA 3W6LA 2CBIA 3AU2A 2D20A 4LVBA 3VD5A 5M3WA 1XHGA 3MHFA 1O66A 3SQLA 2YFOA 1Z44A 3SUSA 4IGMA 3AXHA 2QXWA 1RCQA 3PZUA 1FFQA 3XISA 3QKEA 4KETA 4O57A 1EUNA 1ZBVA 2BY3A 3A4XA 3T4CA 3UJRA 5HR7A 3KTCA 1SJBA 4WUIA 2PTZA 8A3HA 1FFRA 3SGGA 2NQZA 4PL1A 4EPKA 5H8PA 2Y8VA 3KXQA 4QEEA 5CZSA 2IQ0A 4YTUA 4H4IA 1W2PA 3PB0A 4H6QA 4P8VA 3NTYA 1P5BA 1LWJA 3N6QA 4AZGA 1XDJA 2E7FA 3GH7A 5DY2A 1KA9F 3SUWA 2VZVA 3LOTA 3KOYA 1GONA 1LG2A 4LGXA 4D9PA 3BVJA 1H4PA 2OO6A 4QHRA 4F0MA 2QIWA 3WFLA 2WJZA 2ZE3A 3G8EA 3B8UA 3T09A 4RZ6A 3CZLA 1U2YA 5FACA 2JEQA 5E70A 1JRCA 4H83A 3U0HA 1PYFA 2YDSA 1TVLA 4QFUA 1B5TA 1VFHA 1CIUA 1EP2A 2A3CA 1XYFA 1A5MC 2R14A 1R6WA 1JDCA 3QV9A 2PWUA 5KZDA 7XIMA 1JAKA 2XINA 2P0OA 4CUCA 3H7RA 4CD5A 2IW0A 2GGGA 3HOJA 1DJWA 4I9JA 1H7WA 3IIVA 3UWQA 1GORA 3VOHA 2Y8UA 4BCEA 3VE7A 4LWWA 3TYDA 5TF0A 1VPQA 4A8IA 4ICMA 5GJMA 3W7MA 3TTQA 3CAVA 5KZMA 3ZO9A 4YCPA 1K8CA 1UG6A 4FLOA 1OWQA 5LGXA 2RJGA 3PJWA 5AHLA 2DSUA 2X7WA 3XIMA 4PTWA 3VOFA 4KESA 1MSSA 1EL3A 3V3WA 3M0HA 1E0WA 3R12A 4E38A 4HN4A 4GH3A 1ZAJA 4DM2A 3M5ZA 3E6EA 1JUBA 1XCWA 3ARYA 1V0LA 4GGHA 3V36A 5I0DA 3JRKA 4J3UA 3WDHA 3WEOA 5A6BA 4M81A 2JIEA 3V5OA 3M44A 1UR4A 1TA3B 2PCQA 3HQOA 4DX3A 2WNWA 1Z41A 1M68A 2FJKA 2ONEA 2CKRA 2QUNA 2V0TA 2V68A 3LU2A 3CO4A 4XIAA 4Q8WA 3VIKA 2VR2A 2VGFA 3UGRA 2W91A 3TYCA 3AO0A 5CJMA 4AF0B 1Q6CA 1MO0A 3L5AA 3RG6A 2XTKA 3H2NA 4HHHA 1G9HA 2HK0A 3BG5A 3T44A 4L9XA 4KWUA 3BAKA 4HCDA 2EXOA 2QMKA 2XFYA 2WO5A 1Z8AA 2QS8A 3AHVA 1A3XA 4AY8A 3IEBA 1E9YB 3TLQA 1VRDA 3OG3A 3CGTA 4NL1A 1MW0A 1J6PA 3VKAA 4O11A 5CPOA 3ZMRA 3WBAA 1G6CA 1H60A 3CL7A 4UTKA 3ZJ7A 5BRQA 1WV2A 4Q6JA 2WANA 2PTXA 2WJFA 3GXFA 3QJAA 4UR7A 2JQXA 1W1TA 3LTYA 1FHUA 1JPKA 1ZU8A 3FOKA 1JNDA 4QP0A 2OQYA 4MZ8A 2EPLX 2QDEA 3FEMA 3GDTA 3W53A 1B3YA 3W85A 4AY7A 4N6EA 4QIUA 4W89A 4J3TA 5I3FA 1XD0A 3A6OA 1K8YA 3QZ6A 1UD2A 4X3ZA 3MI2A 5A6JA 2Z1KA 4KEMA 4EF8A 1QVBA 2XPKA 1IWBA 4OBSA 5CG7A 5HMDA 4ZSTA 1UD3A 1S5WA 2YX0A 4LEFA 5REQA 3BLEA 2G5WA 4G1NA 3P0XA 3OA3A 4X2RA 4QJ4B 2DZWA 1R9XA 4GQGA 1ZP4A 2VC5A 3ARXA 2WWDA 3AMCA 1EF2A 3G3DA 4PTDA 5GJNA 3KWSA 3N6JA 1XG3A 4WR3A 4NX5A 4Z2KA 1S38A 1I1WA 4MNJA 1PWMA 4IXXA 4NZFA 1QPOA 4GCXA 3A4JA 3GIYA 5A8PA 3MUIA 4LB3A 1H2JA 4QJ5B 7PTDA 1ICQA 3A3XA 4TX9A 1QPRA 4DJDD 5D2WA 4JCLA 3OW1A 4W9TA 4MTVA 1B3VA 3GRIA 5FF4A 2Q09A 4O4WA 4L80A 4IQDA 4GNJA 5K9DA 2MUCA 2HCVA 1E0UA 3AAMA 4DNMA 4MNLA 2DT3A 3BW4A 2PC4A 4NSBA 1P1XA 3CB3A 5FEXA 4NUWA 4NYUA 4U33A 4WSKA 3WJZA 2OT1A 4CGTA 2H90A 4F4RA 1F7BA 3V5FA 1LL4A 3DYMA 1MUMA 1GQJA 3M0ZA 1AJZA 5HULA 1GEHA 1HTIA 3MV01 2X09A 1JYWA 1W9BM 3PBUA 3A21A 3KVKA 2R1MA 3V75A 1AG1O 4S3KA 3EDKA 2IKGA 3HBLA 1BYDA 1EQPA 2QCNA 2VRJA 3Q58A 4Q32A 3MDWA 1FWWA 5LNSA 4IMEA 3SJ3A 2KZHA 1PHQA 2VENA 2W6RA 3VKCA 1EZWA 2XWDA 2X2GA 2POTA 2HISA 3I6TA 3B9EA 2VDHA 3A4WA 4HYWA 2EHHA 3T6CA 4JZ5A 5A8MA 1QOQA 4PUMA 1MWOA 2WV8A 3GG7A 3W84A 3WNNA 2PDNA 3WUGA 4US5A 2I9EA 5GQBA 3VD3A 1VPXA 2P5NA 4LEQA 7REQB 3IJ6A 1QBAA 1IT7A 1VB9A 3CQ0A 1AQFA 1QI0A 3AYTA 3P84A 5E0KA 5HQMA 5EB8A 4DVOA 3EX4A 2VWTA 3GTIA 3QV8A 1YBQB 4M6VA 1OZQA 4DJED 2J88A 3L2LA 3W7IA 2PTDA 1KRMA 2TYSA 3FGCB 1W3JA 1R30A 1KXHA 3BAWA 5JMUA 3W4RA 4DJDA 3W71A 3THQA 5A2CA 2OSWA 4QAWA 3WF3A 3ZT7A 4PODA 1EHAA 2UWFA 1TJ0A 3WLPA 3HO8A 3W9ZA 1SM9A 3FA4A 4RDVA 3PS7A 1M7XA 4HNLA 4Y9AA 4MFEA 3TN5A 1ZBKA 2PGRA 4LNYA 1WKEA 1S2VA 2NVAA 3FGCA 4NZ3A 5GVJA 1QO2A 3BLKA 1B54A 4JTQA 4LS0A 3VM5A 1KFLA 1F61A 1IXPA 2FLIA 1ADOA 3NEVA 1ZAIA 2YZ5A 2RKXA 2EF9A 3STEA 5D05A 4IHCA 5CEWA 3FCPA 4JIEA 2D73A 4OQVA 3VIJA 1BWLA 1W3LA 3C2RA 3ERPA 1HO4A 3AIQA 3DFPA 3F5JA 3S42A 4MPQA 3S6TA 4NZJA 3ZLHA 1ZSXA 1K1DA 1VBJA 2RAGA 3FX4A 4W86A 2P0IA 3GR7A 1L6YA 1ISWA 2RDUA 4OOUA 3H2AA 3V1PA 3U57A 3UD6A 1PDZA 1Y5WA 4LUSA 4P7QA 2E9BA 4FO4A 1D7KA 1CT5A 3HU7A 3QGKC 1SPQA 3IWPA 3H24A 4QITA 3IIXA 4YL2A 1KW1A 5BXSA 1KKRA 3W25A 4DQWA 1Q6FA 2E09A 1ENUA 5BU9A 4IPPA 4P61A 1KM1A 1E0XA 4MJ4A 1VFFA 5K4ZA 3G2GA 3WMSA 1XYMA 3B9NA 3U4AA 4WSJA 1J01A 3HQPA 1H09A 3B97A 4IF2A 1HW6A 3W37A 3ZVIA 2J75A 5A6LA 1IEXA 1KFCA 4ZB2A 3LDVA 3M46A 2PGEA 5BXRA 4FNQA 3E2VA 5ABHA 1GVYA 1WE5A 1JULA 2NQHA 2NX3A 3AHZA 4KIRA 4CVWA 1S1RA 4PH6A 4RPPA 3UYIA 2PWEA 3S2CA 2ZX9A 3BK0A 1X96A 1Z9AA 1BKHA 4GVHA 3PUOA 4F0HA 3SCQA 4KFNA 2Z1XA 3W2NA 3ZVHB 4UTFA 2Z7KA 2ATMA 2ZX8A 5G1TA 1LQ2A 3B0XA 3HG3A 2OKOA 3ZYZA 4LSBA 5DMYA 2J78A 1T7LA 4JX4A 2PLMA 3O3RA 4Q4RA 5AYBA 1DJZA 4MB1A 1NJJA 6CGTA 1V3LA 4GUIA 3UWZA 1E9ZB 2DVTA 6ENLA 3DKLA 4M5PA 1GK8A 3U2OA 2BY2A 2GLKA 3BL3A 5BOFA 2V81A 3FXYA 4BI5A 3GNXA 3V0SA 4HHLA 3TV8A 2CIPA 4LH8A 3WNOA 3P93A 2C91A 5KINA 3BSGA 1XBXA 3PSVA 3GXPA 3BAXA 4HP5A 5XIMA 1HIZA 2ISFA 2FH6A 3VILA 1ZBWA 1UR9A 3NM3A 1OD8A 3BXWA 4F0LA 3M5XA 2V82A 4AX7A 3SY1A 3K46A 2OYKA 4A3HA 1VFLA 2E6FA 1OB0A 1BQCA 1CENA 3H26A 1M01A 3URQA 2ESCA 4XAFA 3WLLA 2VELA 3ZT6A 1IGSA 1E3ZA 5F2IA 1OC5A 4V1XA 1AW5A 2WVUA 2FH8A 5DRIA 1I6NA 1C9DA 2BGQA 4OKDA 3IJ9A 2PMQA 2XN0A 3C0SA 2ALRA 3IK2A 5E6YA 1FHLA 1FDJA 4ZOAA 3NZ1A 2XH0A 3ITXA 2DZXA 3CUFA 3GVRA 3MCMA 4R7JA 3EAUA 2KAUC 1BG9A 1BLIA 2AAMA 3B0YA 2E5DA 3REQB 1HKKA 4NZ1A 2J77A 1TSIA 4XISA 4LXFA 3TCSA 2CLMA 4NASA 2D3LA 1TTQA 1XBVA 4H2CA 2YDAA 3EBVA 1S5MA 4ILSA 1LROA 1KD0A 3STPA 2JKPA 1B31A 3KTSA 2VOMA 3DKJA 1RBOB 3GTXA 4AD4A 1CI1A 1GPFA 3VKDA 2OZ8A 1E1EA 1OGBA 2YPIA 3TK7A 2ZA2A 1WCGA 3B8TA 3WFZA 1YKWA 3KAOA 5EU9A 3Q65A 4U10A 4MMWA 3THCA 1EEXA 1E4IA 5LIYX 3JZEA 2WMHA 4K8EA 3I3EA 4QDMA 3GNRA 4AY1A 3TCEA 3MDUA 1LBLA 1R3YA 4ML9A 4MAZA 4BF7A 4RNIA 4LU0A 4DJEA 2Y5SA 2AOSA 5HBFA 1LG1A 2WPBA 5JIWA 2BHYA 1UR3M 4HJWA 5ABFB 3N2TA 3EYPA 1GW1A 4MVAA 4TX6A 1L0PA 3NQ8A 1CYGA 3KBJA 3NQMA 1IR1A 4HZMA 2Y6ZA 1JCXA 3SFWA 1XKJA 4A8RA 5C2GA 3QGVA 4F66A 3EWZA 1Q66A 4O1CA 2ZVIA 4W8BA 2J7DA 1YLVA 1TIMA 4GINA 3EX6A 4X2PA 1FA2A 4ZOBA 2X1RA 1YTKA 3CWOX 3QFWA 1XPGA 4C7GA 5ABFA 1CECA 1M7JA 3WF4A 1ZGDA 3SUUA 3ZQ9A 3EDJA 1YADA 4AH7A 1UJQA 3RRXA 4AG0A 2GDQA 4AHQA 4LYQA 3MCOA 4Y96A 3HGJA 1QW7A 5FJIA 1O94A 2PI6A 2QPUA 2YR1A 4U31A 4PUEA 1UR8A 4FOUA