4GUFA

1.5 angstrom crystal structure of the salmonella enterica 3-dehydroquinate dehydratase (arod) e86a mutant
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
260
structure length
252
Chain Sequence
ENLYFQSNAMKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKAGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVISVADLRTVLTILHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-dehydroquinate dehydratase
publication title Reassessing the type I dehydroquinate dehydratase catalytic triad: Kinetic and structural studies of Glu86 mutants.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase
total genus 93
structure length 252
sequence length 260
chains with identical sequence B
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4gufA00
2E6DA 2CZ5A 4L4MA 4O0KA 2NX1A 5TBOA 2ZZ1A 3R5EA 3TCEA 2P10A 4JTHA 3EXSA 4JNMA 3NO5A 4EWND 2ATMA 3RF9A 3P5YA 3FLUA 3MJYA 2J9XA 4NJJA 1FCBA 5LNUA 2ZA1A 2OZ0A 4JX4A 2WKJA 4Z1DA 3TK7A 1A5BA 3GVGA 4AEOA 4FNSA 3PBYA 4RZ4A 1FWRA 2YR1A 4QAIA 3S1UA 1G69A 5K9CA 3C2VA 5KMYA 3N3MA 3F4WA 3HG5A 3P62A 4FX8A 2V30A 3BG5A 1OG0A 5DCBA 1KLYA 1IIHA 4FIRA 3QM3A 3UY8A 4FEZA 2NZLA 3IIZA 2CLHA 3MP5A 4DEFA 2Y89A 2NXHA 4QJ1A 3QW3A 4O0ZA 2YX0A 5F2MA 2X30A 5DELA 2C13A 5E0KA 2Y61A 3M7WA 3G8EA 3M5XA 1K03A 3C56A 3WK1A 2ZCGA 1QO5A 3O07A 3L5LA 3G0XA 1EUNA 1MSSA 1VQTA 2DJLA 2DZXA 3LCHA 4X9SA 4DF2A 3P80A 3NEVA 2YYUA 4JYEA 2A4AA 1ONRA 3O63A 3W87A 1RV8A 3NYZA 1XBVA 2YSWA 2QUTA 5D37A 1QR7A 4O19A 1WV2A 3GXNA 1TRDA 4N4QA 5DLCA 2NX3A 1VYSX 1ZFJA 5AHNA 3IGSA 5FF3A 4FXRA 5BMWA 3B0UX 3MW7A 4LTSA 1GZGA 3GDTA 3ELFA 3G22A 2Y6ZA 3QSTA 3MHFA 1K7XA 3B04A 3L9CA 5ABTA 4FNQA 4Y8FA 1D3HA 2HTMA 2BLEA 3O8AA 3PG8A 4NJKA 4WOZA 1CX9A 3G1FA 1FUYA 3WJXA 1DQXA 3TQKA 4N9BA 4O16A 1R30A 2J24A 5FF4A 1OK6A 2WJZA 2EGZA 1VCVA 2OX1A 2V2CA 3M5YA 2VXNA 2ZTJA 1UASA 3PSWA 2R14A 3N73A 3LCXA 2VENA 1B4KA 3VKJA 1TPB1 1N7KA 5BMXA 2F7FA 3H54A 1F74A 3CPRA 2H3DA 2GJLA 3DFOA 1SFJA 4M19A 1YTEA 1BTMA 4N9EA 4WY0A 3FOKA 2VFFA 4LS0A 4JN6A 4JX6A 1R2SA 3C2RA 1YPIA 5CPNA 5DCDA 3IV3A 3MUXA 5D03A 1GYNA 2RHGA 5I3GA 5BNKA 5DBUA 2B7PA 4JYDA 1H5YA 1LLZA 2A5HA 3L5MA 1W31A 2QCLA 2ZQ0A 4UC5A 4CLMA 2V5BA 3ZWSA 3HOJA 3OVRA 3UYCA 1X8FA 1LCOA 3NQEA 4JTGA 1QDSA 2X1SA 3P82A 1DBTA 4LY8A 4RK8A 4IMEA 3TH6A 2VOMA 3DKJA 3W7IA 5G1TA 4LOCA 5MHBA 4ZQMA 3QPYA 1EWEA 1A5SA 1EUAA 3PUOA 4Q33A 4NNBA 1KTCA 3LI1A 3HF3A 1GVSA 2Y63A 3W76A 1NVMA 1OHLA 1IXNA 3TXZA 3MP4A 4UFJA 3NQAA 3Q58A 3DENA 1XL9A 5CZJA 2ZZ5A 2VFIA 4CCEA 1JUKA 1WDWA 1OFAA 1MEIA 4ZQCA 4Z0SA 4IMGA 5D2VA 3IGUA 5LNVA 3S5ZA 3T40A 2A7PA 4Y6GA 3W71A 2WSYA 5K4XA 3K30A 2H8ZA 2DZUA 2TPSA 3PF3A 1P1XA 1FXPA 3VE7A 1WA3A 1PHQA 3NG3A 3FEMA 3M47A 4N6EA 4UTHA 3LBMA 4K7YA 3TMQA 2E5CA 1M6JA 3G24A 3P7YA 3W22A 4GWEA 3HGJA 4DPQA 5K7JA 1TV8A 4CNNA 1TMHA 1RQHA 3WK3A 4AH7A 4UTWC 3QQ1A 1JCMP 1H50A 3G1SA 1SU5A 1G4SA 3M5ZA 3LCFA 5FI8A 1S5VA 1FCQA 5BRBA 2LLEA 1MEHA 3L5AA 3GKFA 2PRLA 3NDOA 2JGQA 4LWWA 4O53A 4N2YA 5CPOA 1H7OA 2W6RA 1OFOA 3FJ6A 3VNDA 1K3UA 4YL2A 5CZTA 3W7JA 4O18A 3LXCA 1MEWA 4MY9A 3W1LA 3PSVA 3U8GA 2YW4A 4NT0A 3TMLA 4LS1A 3GDLA 3TIMA 1ME7A 1XDLA 2C3ZA 5L6UA 2E09A 1GWJA 5FEWA 3SSJA 5D32A 2EAWA 1THFD 5KITA 3GXTA 4FIQA 4RXFA 5F1UA 3W2NA 3PWAA 2PE4A 1YXCA 1OFPA 2C14A 4CQ9A 4LV4A 3NL6A 3JR2A 1XM3A 2VFEA 2E77A 3S1WA 2YZRA 3PUEA 2H8XA 3WK0A 4LVAA 1W3TA 4HSOA 3NQMA 2QF7A 1FCUA 3DFNA 3W2MA 1GTEA 4JY9A 1Q6OA 1GVOA 5AC8A 3A22A 5EBUA 4O50A 1XCFA 4CCDA 3NL5A 4JX5A 3BG3A 2FB3A 4HPJA 1EB3A 1KA9F 3L21A 5FF2A 4Z08A 3SECA 5HULA 3QMSA 1TV5A 3GAYA 3QH2A 5HWJA 3NM3A 1TIMA 1VH7A 1H1YA 3VE9A 4KWWA 1QCWA 3C2EA 4DF0A 3DH7A 4WUIA 3EWUA 2F84A 4EF9A 2CWNA 1BWLA 4NJIA 4OU1A 4LVGA 2E68A 2FJKA 4ORIA 1T96A 1TTJA 1XUZA 4JY8A 2AGKA 3CEPA 2EPHA 3N34A 4JEQA 4PL1A 2E6YA 1YXDA 1VYPX 1RVGA 4UCGA 1CW2A 3MMTA 5HUPA 1K02A 4GXMA 2ZDRA 1U5JA 4JD4A 1FCVA 3OVPA 5U7SA 4BI6A 3ABSA 3IIOA 1W54A 1M7PA 3THAA 3JS3A 3O16A 4O57A 4MFDA 2X1TA 1J2WA 1DQWA 3MBFA 3TR2A 1FXQA 1YLVA 2WNQA 2I9EA 3OVQA 3LRKA 1DHPA 1JCXA 4OQVA 1LBMA 4PTNA 3OA3A 3UPWA 3TAKA 1JRBA 4PFMA 2NXIA 5C5YA 2Y7EA 3Q94A 3NR0A 3SFKA 4H6KA 4WY0B 3PC0A 1GEQA 2VEKA 3A5FA 1QWGA 2QJIA 2ISVA 3G0SA 1DJNA 3R13A 4U28A 1FQ0A 3BLFA 3G3DA 4MUZA 2IQTA 4GFSA 4YCOA 1AW5A 3AO0A 2ZRVA 3UQNA 4BR1A 1Z48A 3IIXA 1AG1O 1B57A 2BXVA 1WQ5A 2YW3A 4IPIA 3M44A 5KZEA 1IF2A 1YDNA 1BWKA 4JIQA 3HG3A 3LLDA 3W70A 5DCEA 3NQ7A 2TSYA 1F7BA 1GJPA 1UBSA 4I7VA 1RPXA 3DFSA 3O1NA 1VCGA 4NVTA 2CZDA 3GKAA 3NQGA 2ZZ6A 1QFEA 3W73A 3QFEA 2ZZ4A 3G1YA 5F2LA 1EP1A 1GYLA 3BV4A 5AYXA 3NPXA 1W5QA 1UJPA 3GR8A 5F4WA 3WJSA 1DVJA 4ZMGA 1WX0A 3KX6A 1KTBA 2X2GA 1YTDA 3SW6A 3CM4A 5F1VA 1SFLA 4O4WA 5HMSA 8TIMA 2RKXA 1KM2A 4B5NA 3USBA 3DBPA 4QNEA 1K7FA 3LB0A 3W7CA 3TAOA 5HQEA 2X16A 2ZRXA 1DJQA 3G3MA 4AWUA 1JUEA 2C0AA 3E0IA 1TTPA 1H7NA 3PBVA 4UIOA 5EYWA 1AL8A 3D0CA 2W79A 1DV7A 4QNWA 3CIXA 4X3ZA 3VI2A 4O4VA 2GJNA 5KSWA 4JTUA 2FFCA 3ABQA 1FDJA 3C3NA 3M6YA 2J88A 2DZPA 4S2CA 3IVUA 3KVLA 3C52A 1LZOA 2V2HA 3EXTA 1FWNA 4GUJA 1X1OA 4Z0JA 3PBUA 4L4LA 4NX5A 4RCXA 5L9FA 1VLIA 4IQLA 4O1DA 4UTTA 4Z1AA 3SIZA 4MZ8A 1EPXA 3N19B 2QJGA 1HL2A 3O06A 4BWLA 1NFBA 3UXDA 5DY2A 4NNAA 4I9AA 1Q45A 1XXXA 3KXQA 1R2RA 1GPWA 3KVKA 4WOQA 3NVTA 4NJGA 3O6YX 3TSMA 2ZYFA 3FJLA 3L68A 5H91A 3FS2A 3NM1A 3LLFA 4OWGA 3WJZA 3CEUA 3KFTA 3TNOA 1W37A 4A22A 2CLKA 4WXZA 5IM51 5KTLA 1JCYA 4AHQA 1ICPA 4EIVA 1OYCA 3TV8A 3H53A 2FLIA 3LBCA 2CFFA 3UWVA 3LRLA 2QCGA 4AB4A 4KKXA 3BGGA 1ALDA 2C19A 1OJXA 2QDGA 2V81A 3HPSA 4JTEA 4LVBA 5KZDA 3LCWA 3TXVA 4ADUA 4BI7A 4WXYA 5CZ0A 1LDCA 2XN0A 4MJZA 2YYTA 4MYXA 3BG9A 2E6FA 3EKZA 4E38A 3SI9A 3B4UA 5BOOA 3IEBA 3ZWTA 2O7QA 2QJHA 3EWZA 1PS9A 2R8WA 4Z1BA 3W74A 1VJIA 1H7PA 1W0MA 2I14A 4O10A 4OBTA 4UTKA 2B7OA 2PRMA 2QCNA 3N2MA 3W07A 1PCKA 4BF9A 1AL7A 1VYRA 2A7RA 4CNOA 4RLIA 3FIGA 3KRZA 3EWWA 3LHUA 2TRSA 4TR9A 3G1HA 3Q2DA 1I8JA 2ZRZA 4AWSA 2Q3RA 1OX4B 5EL1A 5I3KA 3M43A 1G4EA 2JKEA 2OJPA 3LERA 1IXQA 4JYFA 4YMZA 4KFNA 4R34A 1OVDA 2CLEA 1JULA 3R89A 4N02A 3W1PA 1LLWA 4LV9A 4O1AA 4LU0A 4NX0A 5C55A 1LRQA 2A7NA 4I7UA 3QZEA 3F03K 1DOSA 3LTSA 1JRCA 1TYGA 1YDOA 4NQ1A 3E9AA 2E6AA 4LW7A 1ADOA 2YFOA 3W72A 3DHFA 1Q3NA 3W1UA 1FWWA 4RZ6A 1T8XA 4ORMA 3LCGA 3YPIA 3CWNA 3BGJA 1Z42A 3LI0A 2Y7DA 3M1ZA 4RZ5A 2QUVA 4IMCA 4I7WA 4AF0B 1HTIA 5D2YA 4OT7A 3DFPA 5U4NA 4IGHA 1TPVA 3QEZA 4O1CA 1C29A 2EKCA 1W1ZA 5F4SA 3UZJA 2CLLA 4UFIA 1R46A 1K8YA 1OK4A 3UPBA 3EX1A 4GE8A 3N14A 3LRMA 4JGDA 4MIMA 4JDYA 3BO9A 1W5MA 2A6LA 1QOPA 1VGAA 4Z1CA 3DI0A 1I45A 3DGRA 3W7OA 4AWTA 5LNWA 3W86A 1OF8A 2WQPA 3PY2A 1H60A 1TTQA 3GXPA 1H51A 4DBDA 3AJXA 2OT0A 2DU2A 2V82A 2PCQA 1S5WA 1V5XA 5FESA 5HR6A 4Q4KA 2QCFA 3T7VA 6TIMA 2B7NA 1B9BA 4IMFA 4HKPA 5CPLA 5KINA 4IJBA 4PH6A 1ZY9A 1Q6LA 5CGQA 5A8GA 3STGA 1HFBA 2WOQA 3LHVA 4CQ8A 4MFEA 3CT7A 2NUWA 4UUIA 2Q8LA 2O7SA 1RQEA 2FQIA 2W0UA 3I7SA 4R53A 3ATZA 1BEUA 1FWSA 3TFCA 3W7MA 1ZAIA 4X2RA 4KFOA 1SO5A 2EF9A 1SQ7A 3NNTA 1PHWA 1FY6A 2YPIA 1H7RA 1EIXA 2XN1A 3W75A 2HS8A 5F2GA 1LRNA 3V75A 4O28A 4A2RA 3W7RA 5A5WA 1Z41A 1ZHAA 4EOUA 2VFHA 3NQCA 4E2DA 5DY3A 1AK5A 2H6RA 3DFTA 5CKSA 5HWMA 4YCPA 1LOQA 3HPZA 3TW7A 1B3OA 1FDYA 2QCHA 1TJRA 3QMTA 4JS3A 5AHFA 2Y88A 1JVNA 1TRIA 5DBTA 1QNVA 2ABAA 5LGXA 2FB2A 4YWIA 1EP2A 1LP6A 4HHPA 3GNNA 2Y70A 4ZQNA 3TQVA 5G2HA 1W3IA 4DPPA 4C1KA 2X1RA 4E2BA 5HNRA 4TO8A 3QQ0A 3L2IA 5C54A 4UMAA 5J5DA 2FPYA 1K8XA 1UUOA 3HG4A 3O05A 1YADA 5AYZA 4MVAA 3L0KA 7TIMA 1IXOA 3PG9A 4CQAA 5LNRA 5HUOA 4XZ9A 2ZA3A 3MHGA 1C8VA 2YXGA 1QPNA 1W5PA 3BK0A 2C1HA 4K6AA 1JJKA 2PC4A 3H55A 4K38A 2A85A 2G96A 2P0OA 3E12A 1I2RA 2QAFA 1EP3A 1E51A 3GR7A 2NUYA 3LV5A 4UXDA 5D2WA 1QAPA 4FXSA 5FEXA 5DXXA 4UTJA 4EVZA 1K7EA 4FNRA 4FB7A 2G95A 2NWSA 1YYAA 3FKKA 1FX6A 2CZEA 3EX3A 1SZNA 3B06A 4Y90A 1M5WA 5I3HA 3EX2A 3LGEA 1H61A 3G0UA 4RXGA 4M6QA 3OBKA 2WSQA 3GDMA 3CTLA 2ZRYA 1OFEA 1QPOA 1FWTA 5TIMA 1LYXA 4P2VA 1Q6RA 3UY7A 2BWGA 4NZFA 4DO4A 1X7FA 3W7NA 3LXAA 3QJAA 1O60A 3W7GA 2QCCA 5AHIA 2VELA 5AYYA 1L9WA 4LUJA 1W5OA 5DXYA 4JICA 3W88A 3W1TA 4O11A 5K9DA 2YFNA 3TKFA 3W7QA 3BVJA 1GVRA 3C8FA 3RMJA 4GUIA 1G4TA 1EEPA 4R33A 2OT1A 4BFAA 2ZZ3A 1QPQA 4JTLA 2VC6A 4AHOA 1Q6QA 3W1QA 2C6QA 4GJ1A 2J9YA 3UZ5A 3SY5A 1OX4A 1D9EA 1I2OA 5D38A 1ZJIA 3LV6A 5FF7A 4MKNA 4O14A 1XBZA 2DZVA 1P0KA 3V1PA 5I3IA 3MI6A 1JCLA 5EMUA 4G1KA 5F4XA 1L6WA 2ZRUA 3SGUA 1OX5A 1O5KA 1OABA 3FFSA 2ISWA 3P60A 5CPMA 1R47A 2E5BA 1JQXA 3NA8A 1KFCA 3FYOA 3LHYA 1NAL1 5D04C 2GVGA 1GQNA 4AF0A 1LORA 3INPA 4WZHA 1ZNNA 3G1VA 4ADSA 2AQWA 3F1QA 3BARA 3P61A 3TU9A 1HO4A 1VRDA 2JGYA 4UNLA 1T99A 1SO3A 5FEPA 1TPFA 3CHVA 1RR2A 1WOBA 4WX2A 4AVFA 3E02A 2E5DA 2A6NA 4LS2A 1G4PA 3KVMA 3TJXA 1SSDA 3KRSA 4A3UA 5CSRA 3BW2A 3OIXA 3P67A 2VKZG 2DP3A 2GUUA 2FPVA 2Z1BA 3LDVA 4JDBA 3GYEA 3SR7A 4JTSA 1I4NA 3W2KA 3BPWA 3S42A 2GQAA 4POCA 1JCJA 2J27A 4RV8A 3TDFA 3C4UA 2A21A 4ZQRA 1TB3A 4OHQA 2G97A 1A50A 1AW2A 4PA8A 4CCCA 1UB3A 5HWNA 2CZFA 3I6RA 5G4EA 3I65A 4HN4A 4IXXA 1M7OA 2RDUA 3W85A 1IGSA 1W5NA 3LCIA 3STFA 4HPXA 4FX6M 1ME8A 5AN7A 3W1AA 4O1BA 3A21A 4XBKA 1O95A 3ZR4A 3GNDA 1TQXA 2NV2A 2C16A 1HG3A 3P5ZA 2QAPA 2PURA 5K9XA 4TX9A 5D2TA 1G6CA 2RDTA 4W9TA 3PR2A 3QC3A 4MZYA 4K37A 3G1XA 1VR6A 2JKAA 4DBEA 2VEIA 5I3FA 3IIVA 3W23A 4MZ1A 1TPH1 2WSRA 4LC6A 2WNZA 3PBWA 4BI5A 4KWVA 1LROA 5G1YA 4S1FA 5HINA 3NQVA 1S5TA 5IBXA 4O13A 4K39A 4S2BA 1MO0A 2CLOA 1ICQA 1H62A 4IPJA 1W8SA 3S0CA 3T55A 2C15A 2WNNA 2I1OA 5I3JA 3W7LA 1VHNA 1H63A 3TROA 2V0TA 3NZ1A 1I2NA 3RLVA 1X1ZA 2TMDA 5G2WA 5LGZA 4EF8A 3HGSA 4UTTC 1FBAA 3HIJA 1SW3A 3C0JA 4O12A 3NAVA 3N2XA 4BWLC 4N9DA 3WJYA 1QPRA 3MP3A 1KW1A 3NPWA 4PL2A 2ZZ7A 4KFPA 4ML9A 2H3BA 2Q8ZA 2YGYA 1TPWA 4DO5A 2QCDB 4HSNA 5TQLA 1TCDA 5LNSA 1H1ZA 2WO5A 3CC1A 4Y9AA 2YDAA 2NX9A 2VFGA 2QDHA 4ADTA 3CIWA 1SO6A 3C2FA 1I2PA 3MHUA 1VLWA 3W6YA 2HSAA 2VEMA 1OYAA 3R12A 1N55A 3UWQA 3A23A 2J9ZA 1F05A 2HMCA 1XBXA 2E1DA 1MZHA 1NSJA 4M6PA 2A2IA 3TA6A 1IXPA 4R7JA 4XTDA 4GC4A 2R94A 3M0ZA 4QSHA 4GUHA 5FEZA 5AC6A 1KBJA 3EXRA 4UFMA 2QKFA 4ZZ9A 3ABRA 5CZSA 1PE1A 3VFLA 4GUFA 1JR1A 4NJHA 3HPXA 4NXSA 2CLMA 3NPVA 1KM0A 3TSBA 4IX2A 3W83A 2ZBTA 1LOLA 1NEYA 1WOAA 1JCNA 3S1VA 4UFHA 3FYPA 3TC6A 4IOTA 4UTIA 3W9ZA 1IIGA 2H90A 4LC8A 2QR6A 3TQ0A 1VHCA 1OF6A 2R91A 2VEPA 1G7VA 2YCEA 3I68A 3M5VA 4JIPA 4ZVJA 4XBSA 3CWOX 5D30A 4LT9A 4RKAA 4NZJA 3W7KA 5KZMA 1PVNA 4MOZA 1LTDA 4M7SA 1L6YA 3Q37A 3VCRA 4TU1A 3MWAA 4D2JA 3SGZA 1ZAJA 3SZ8A 5F2IA 3DKLA 2BX7A 5AHLA 1Z44A 3HG2A 3W3OA 2ISSA 3QF0A 3QPZA 4O52A 3TW6A 1I2QA 1KV5A 3B8DA 5LSMA 2OCZA 1SUXA 3PULA 5SWUA 1KM4A 1P0NA 3MI2A 3WK2A 1TSIA 4FHAA 3HO8A 3W7PA 1LOSA 4JTJA 3KOFA 1ML1A 1U83A 4GUGA 4IUOA 2G5WA 3IRDA 4ICNA 5G5IA 3EX4A 2BSLA 3F4NA 4Q32A 4UR8A 4WJEA 1SZEA 3MBDA 5EA9A 3C6CA 3LCLA 2A1YA 4TMBA 3NL3A 2ZZ2A 3HMJG 1WBJA 2WV8A 1GG1A 4RX0A 1SPQA 4HNVA 1A5CA 1KTNA 3RLUA 3UWZA 3FKRA 2Z2UA 2RDWA 3A24A 1ME9A 3A9IA 1DKWA 4N9CA 4AMAA 1GOXA 1TQJA 3MO7A 2KZHA 1XBYA 4JTFA 5BW6A 1UUMA 4O8RA 3QSRA 4XKYA 1K8ZA 4JR5A 4CNPA 4GBUA 1KM5A 3CLMA 3DU0A 3GZ3A 4C1LA 3EX6A 1TO3A 1ZCOA 2J6XA 4O17A 1EX5A 4RJEA 1T0OA 3G1DA 5D09A 4WD0A 3NGJA 3IIPA 3N9RA 3PM6A 2ZRWA 4NU7A 4PODA 1RD5A 4WY0F 5CSSA 1VCFA 3GK0A 4FNTA 5C2XA 4IXHA 4HNUA 3LX9A 3TFXA 1WBHA 3NQ8A 3KVJA 3UXAA 3W7DA 5LHFA 3G8RA 1FDZA 1KFBA 3G18A 1JUBA 3TJLA 4ZQPA 3W7HA 1PIIA 4O54A 4OV4A 4MLRA 3NQ2A 4FF7A 4FO4A 1O4UA 1QMLA 3PAJA 3SJ3A 1XDMA 2P1FA 1OFQA 1F2JA 4MJMA 2QCMA 2GQ8A 1KFKA 1XC4A 3NQDA 4QITA 2V5LA 4E0CA 3R2GA 3STCA 4YXGA 3GB6A 1A53A 2JBMA 3GIYA 3OHIA 3W2LA 1YTKA 3LM7A 5E93A 3W1NA 4UTWA 4MPQA 5AFDA 2OMAA 2NXGA 1QOQA 3S8HA 2DZTA 2BZNA 1KFJA 4K7VA 4P61A 2RFGA 4OGZA 3NQFA 4TMCA 3DFQA 4UTMA 1X6UA 4GNJA 4UTLA 3O15A 3S9YA 1JQVA 4A29A 3I7RA 3HBLA 3LHWA 3RNDA 1QO2A 2JK2A 3DXIA 3PUDA 1HO1A 3EWYA 1G67A 4BK9A 6ALDA 3BW3A 3DAQA 5DN1A 3I7QA 1R2TA 2CW6A 1NF7A 1A5AA 2FIQA 5AHEA 1RQBA 3GX9A 4IMDA 2GVJA 3KAOA 3B0VC 4N6FA 2ZA2A 3C2OA 4PCFA 2Y85A 5C6MA 2GOUA 3M41A 2CLIA 3M16A 3NXFA 4A21A 2GQ9A 1SW7A 3EWXA 3DZ1A 3IGXA 1GVQA 4OE7A 3EEGA 4MYAA 4DXVA 4LUIA 3QW4B 4TIMA 1PL9A 1ZAHA 1SZFA 2ZFAA 4IWWA 3UWUA 1D3GA 5AB3A 1GVFA 3O6DA 2EHHA 2GPTA 2QCDA 2A0NA 1UCWA 4LVFA 5D33A 3L66A 3LHZA 5H2ZA 1F73A 3GLCA 4GRSA 3UNDA 5D02A 1B4EA 3TX9A 1KM6A 3ABOA 4HT3A 2NUXA 3T44A 1OX6A 3OEXA 3MI3A 2ZTKA 4LVDA 4UTUA 1ZALA 3TUUA 3EWBX 5EPDA 1OYBA 1WAUA 2Y7GA 1SW0A 1GT8A 3BW4A 4LNYA 1SO4A 1F76A 4XUGA 4UFLA 3BLEA 4MLJA 4XWUA 3P84A 3LHTA 1OFBA 1AMKA 3N9SA 1TJPA 4K36A 4PC8A 3E96A 4XTIA 4YLWA 3B0PA 3U6WA 2FDSA 2D73A 4ALDA 2C18A 2DORA 3CB8A 5G2IA 5E1QA 3CU2A 2FPTA 2AAMA 3NZRA 1SR9A 3W1RA 1SZGA 4HNNA 5G4WA 4J9JA 4DF1A 1KM3A 3DHDA 1PCWA 2Q3OA 2Z0IA 1EA0A 3HGOA 1L6SA 1VS1A 1XFBA 3LTPA 3MYOA 4MY1A 4NXKA 3HJZA 3UWYA 2ABBA 1XUUA 1V7YA 5EY5A 1KFEA 3PB2A 5K2ZA 1KFLA 5K4ZA 1OFRA 3A5VA 2CLFA 3PVFA 3MYPA 3HGRA 5AC7A 3GDRA 3P8IA 5LZLA 4UMCA 2UV8G 3L67A 2QUUA 1LRTA 4QQ3A 3B03A 3NQ6A 1G7UA 3UD6A 3OG3A 1P4CA 4UR7A 3NOEA 4UMBA 3STEA 1H7WA 3HQ1A 3TE9A 4H4IA 2GVLA 3RK8A 4JTKA 2Y62A 3S5NA 5GVJA 4DELA 3T4CA 5K3VA 4MY8A 3HB9A 3LTYA 2CU0A 4DO6A 4JXCA 1ZENA 1GTHA 1J4EA 2ATSA 4HIBA 4XKYB 3S6DA 1XI3A 2B0MA 4AAJA 5AHMA 3M9YA 3NPUA 3RFAA 1N8FA 2BTMA 3ANYA 3LOTA 1YDVA 1ICSA 2FTPA 3QMRA 2NV1A 5D2XA 2V2DA 1TPC1 4AHPA 1TPEA 1Y0EA 2DZSA 2B4GA 3GAKA 3W1MA 4WQ6A 3THQA 2WPBA 1XKYA 1F5ZA 2B7QA 3JRKA 1TPDA 4AXKA 4PEKA 1TREA 3LXBA 2JKPA 3O6CA 4FX7A 1F6PA 4LRSA 4NNCA 1KV8A 3W2UA 4DQWA 1TPUA 1KM1A 3L0GA 3QRHA 4Y96A 2NLIA 3P74A 3QYQA 3W7EA 4A2SA 1VZWA 2ALDA 1CI1A 5HJLA 1H7XA 5LKYA 3RU6A 4ZL1A 3T78A 4ONVA 4O15A 1AW1A 1PV8A 3S5OA 2QCEA 1RZMA 4N4PA 5T26A 3L0NA 3TC7A 4QIUA 3WJWA 1HUVA 3E49A 4OV9A 1O94A 2PRHA 1O5XA 1VPXA 4JTTA 4ZQOA 1P5BA 3NL2A 1WXJA 4K8HA 1J5TA 5CG7A 3IVSA 2Z6IA 3GDKA 1TTIA 3KRUA 3KHJA 4X22A 2X1UA 3DI1A 3W1XA 1C9DA 4XQ6A 4RR4A 5LHEA 3R8RA 4UFKA 5EKYA 3P81A 2HS6A 3L65A 5FF0A 1BKSA 1W3NA 3ZFHA 2RH9A 1LBLA 1F6KA 1KBIA 3WFAA 1MXSA 1DL3A 5D05A 3EB2A 1W56A 5AOUA 4IX0A 3BLIA 1KLZA 3UWWA 3PS7A 1NF0A 3CQ0A 3IVTA 3S1XA 2V9DA 2XN2A 1WYIA 1YPFA 3G1AA 2VFDA 3EKLA 3TSDA 3C61A 1GG0A 3ATYA 3S5YA 2DJXA 3FA5A 4H3DA 2TYSA 1S3HA 4UNKA 1L2UA 1SSGA 2V8ZA 4NUWA 3U2OA 3ZS4A 2Y7FA 1LM1A 1EWDA 3P8JA 2Z6JA 5HR7A 4K8EA 4U4MA 5IBXC 1YXYA 4M5PA 4QM1A 2NWRA 4M7TA 1OFDA 3B05A 4QISA 2XFWA 4M6VA 1LBFA 4FNPA 1DORA 3PB0A 3W2JA 4JTIA 3W84A 4HNTA 1TV7A 2QEZA 2DZWA 4LRTA 1VC4A 4FNUA 5J5RA
chains in the Genus database with same CATH superfamily
2CZ5A 2NX1A 4Q8PA 3R5EA 1RJPA 3V5OA 5C7HA 3NO5A 3OU8A 1OIMA 3RF9A 1UWAA 1VD6A 3FLUA 4EK7A 2BODX 2W63A 3MJYA 4NJJA 5I6SA 5LNUA 3GVGA 4FXJA 1V93A 3EOSA 3PBYA 4TV6A 2VR5A 3C2VA 2P88A 1OEPA 2XZ9A 4A6GA 1IIHA 1J9YA 5ENLA 4WJXA 2WMGA 3UY8A 3A64A 2WC3A 4CN6A 4OECA 4S3BA 2CLHA 4ZENA 3MP5A 1BVZA 1UIPA 1PDYA 2Y89A 1IZJA 3BUVA 4QTGA 4QGCA 1J93A 3BCJA 3ZT5A 3U3HA 3W37A 5CBBA 4UQCA 3SUVA 2BNJA 4EXAA 1QO5A 3L5LA 1EUNA 2DJLA 4X9SA 4W8BA 3P80A 1A47A 3NEVA 3WDRA 4B5UA 1ONRA 3VOJA 4WCJA 4IT1A 1REQA 3W87A 1RV8A 1QR7A 3GXNA 4N4QA 4DZHA 5FF3A 4FXRA 1GZGA 3GDTA 4L6HA 2Y6ZA 1MWOA 2AQVA 3CTTA 3MHFA 1K7XA 1D3HA 5GNXA 2BLEA 2XTKA 1VB9A 5CPQA 3G1FA 3ZMRA 3R7MA 2HQAA 1FFRA 2J24A 3EPOA 1AJ0A 1E9YB 3V35A 4KQNA 2HROA 2VXNA 2ZTJA 2AQOA 1WDQA 3UCDA 3N73A 1B4KA 1V6TA 3VKJA 1TPB1 3KHDA 4YHEA 5BMXA 4AYSA 4PMUA 4YJ5A 4AD5A 4DO7A 2H3DA 2TAAA 4M19A 4N9EA 1PTDA 4CVUA 1R2SA 5CPNA 3GTXA 3IV3A 4LNCA 5D03A 2RHGA 8CGTA 5JU6A 3CT2A 3AYTA 1W31A 4HBKA 4F0KA 4IIBA 3KW3A 2QZRA 1WNOA 4JTDA 1VBRA 2ZADA 1JYNA 2NT1A 2NQHA 2MNRA 1XKJA 1K8CA 3ZLGA 5A6LA 3O7UA 4QROA 4C6FA 3TA9A 5MHBA 1S46A 4HNCA 2V5DA 5IOBA 1EWEA 5CSUA 4H8VA 1GVSA 2FVKA 3W76A 4AEEA 4QQUA 2W62A 4XSLA 4R5EA 1XL9A 5CZJA 4C7GA 2AL1A 3H2AA 3HFTA 1JUKA 1WDWA 1OFAA 4L9XA 2WCAA 3OG2A 2PDFA 1CGVA 3IGUA 1AFSA 4EXBA 1RP8A 1B9ZA 2A7PA 4QCFA 2WSYA 2QV4A 2WK2A 2DZUA 3R1ZA 1B90A 3VE7A 1J0HA 1QNSA 3NG3A 3FEMA 2NSOA 3RG6A 4QP0A 2DDXA 2JIWA 4AG0A 4K7YA 3TMQA 3T1GA 2OZTA 1TE6A 4YTTA 6A3HA 3G24A 2XVLA 3JVAA 4JNZA 3W22A 4GWEA 4XZNX 5HANA 5K7JA 1TV8A 1MUCA 1R3VA 5HXMA 2J8FA 1EC7A 3M5ZA 3LCFA 4Q3MA 2LLEA 1K6AA 4MDPA 3L5AA 3SCNA 3C3UA 4HYRA 5BROA 4O53A 1R87A 1YIXA 3FJ6A 1A0DA 1SMAA 5CZTA 1PPIA 4HJFA 4EACA 2OQLA 3TZFA 4O18A 3N29A 4MY9A 2Q02A 3PSVA 3U8GA 2YW4A 4NT0A 3F5LA 3TMLA 2Y8KA 4UB9A 3GHSA 4WIWA 3TIMA 2PDPA 2C3ZA 2E9LA 2OYLA 1GWJA 5D32A 4M3PA 2EAWA 5KITA 1PZ0A 1XX1A 2V3DA 2DFAA 4EPBC 4L5ZA 1KCZA 1TMQA 3PWAA 1YXCA 4RDZA 5KZ6A 4CQ9A 2C14A 1DQUA 4CU6A 2NT0A 1UR2A 4LBSA 3VKCA 1XLMA 4LYPA 2VR2A 3SAZA 2D0GA 1BF6A 2QF7A 3IRSA 1GTEA 5AC8A 4O50A 2SFPA 3Q4DA 1DWGM 2A3LA 3BG3A 5IFPA 4D6EA 5FF2A 4Z08A 3SECA 5FJTA 4Q8OA 1TV5A 3QH2A 1WCGA 3VE9A 1VJZA 4FLRA 1HNYA 2Y4SA 4S23A 3UU0A 5CCZA 3DH7A 2E1WA 3CZ8A 3T0AA 3DDMA 4EF9A 5BOEA 1GPFA 1O66A 4LVGA 4UCFA 2FJKA 3S2MA 1T96A 3M07A 2QHAA 4XZWA 1XUZA 2ACRA 4J27A 3CAWA 2OZ8A 4WGHA 4UOJA 4HK5A 4GZ7A 1E6PA 4DZAA 4LB4A 3W6MA 5HUPA 1BYBA 3TN5A 3VGBA 4GXMA 1IV8A 1FP8A 4BQ3A 5D9PA 5J04A 4LANA 3ABSA 5TD4A 1W54A 4PRTA 2J66A 1F3EA 3JS3A 2X1TA 3R58A 1C8YA 2WHJA 1YLVA 4G9PA 1JI2A 5H8PA 1UMLA 5H8UA 1CXFA 1GHSA 2POZA 4ZCWA 4EANA 1P43A 3OA3A 1JRBA 4KBXA 4PFMA 4S3DA 5HA7A 1PKYA 3ANUA 3I4KA 3Q94A 4H6KA 4WY0B 4WVXA 2VEKA 3A5FA 1YQ2A 2MUCA 1Y5XA 2ISVA 3F4CA 2V3FA 1WP6A 3M0LA 1UROA 1FQ0A 2C7FA 5CEWA 3G3DA 2W66A 2IQTA 3NSNA 1AW5A 2ZRVA 5CC5A 3UQNA 4BR1A 4WHBA 1WO2A 4AD4A 4PCTA 2BXVA 1WQ5A 5AVNA 2XGZA 4NI3A 2AMGA 2OXNA 4F2TA 1R38A 1YDNA 2NVCA 2CBIA 4P7NA 1MRQA 3UETA 5BRPA 3O0KA 3D6NA 1GJPA 4I7VA 3BSHA 1XH2A 1HL8A 1TKKA 1WDPA 3DFSA 3O1NA 1S2TA 1QNPA 4PUUA 4AQLA 4YN5A 4LUSB 2CZDA 1XRFA 2ZZ6A 2BS9A 4GINA 1WPCA 3VD9A 4GFIA 3H4GA 3G1YA 3TN4A 2J8TA 1C9WA 4X0VA 4MB3A 5AYXA 3NPXA 1U5HA 2ZIDA 2X2GA 4IP4A 1YTDA 3ZIZA 4NZ5A 1YHTA 4K1WA 5JXQA 5A8PA 2E25A 5A8MA 1BWVA 3OBAA 3NDZA 5DMLA 1K7FA 3LB0A 3QR3A 4RE4A 2X16A 2BB0A 1TTPA 1V3IA 1NWRA 3K5XA 4QE4A 2W91A 1B30A 1HJSA 6TAAA 4ZFCA 3LD5A 3D0CA 4KEUA 5J8LA 3VI2A 5KSWA 1XG4A 2EG7A 4S2CA 1TX2A 3KVLA 3QKZA 2WKLA 3F5KA 3NWRA 1X1OA 2PLMA 5H8MA 5L9FA 5PTDA 1W1TA 2BVWA 4IQLA 4UTTA 1K1DA 4IL2A 1HL2A 2Y8VA 5D9NA 3QZAA 3O06A 1E9LA 4I9TA 3FSUA 1NFBA 1XXXA 5IDZA 1BLIA 1GPWA 3RU8X 3NVTA 3TSMA 3WMLA 3IJ8A 2ZYFA 5H91A 3BZJA 2RDXA 2NQ9A 5A6JA 1XH0A 3CEUA 3TNOA 1XLIA 1W37A 4YYFA 3UBPC 4M8UA 3VD7A 2CLKA 1GW9A 2QPXA 3AMCA 1GK8A 3LRLA 5D8WA 2QCGA 4GXWA 5FAGA 2PTWA 1JGIA 3ME3A 5CZKA 3T8LA 4WXYA 1ZUAX 1LDCA 4MYXA 2YYTA 3TTYA 3BG9A 4GC3A 3IEBA 1KKRA 2OOGA 4Y8EA 2QJHA 3EWZA 1PS9A 2R8WA 2NW0A 3WNMA 1JDFA 3IAQA 4QDPA 2GJPA 4PTWA 4OBTA 2ZOXA 1PIFA 3N2MA 4BF9A 4AZIA 4HB7A 4A3HA 4CNOA 3PZUA 4RLIA 3FIGA 1K77A 3KBMA 1WZKA 2AMXA 4AWSA 1O5RA 5EFFA 3CL8A 5EL1A 2JKEA 2F2KA 5DANA 3SCVA 1XRVA 3VNIA 4YMZA 4KFNA 4R34A 3BLKA 4KERA 4IFRA 1NWUA 4OKDA 3R89A 4ENLA 1P6WA 5HNUA 1LLWA 4LV9A 4O1AA 2HVNA 1YW1A 4ZB5A 1UKSA 1LRQA 3K1GA 3F03K 1EDQA 4DI8A 4NQ1A 2E6AA 1ADOA 3AZSA 3HA1A 1Q3NA 3TJIA 4LSBA 1W3LA 4RZ6A 4XSMA 3VD3A 4ORMA 2R24A 4RZ5A 3MUCA 4QSFA 3WQVA 2FH6A 3WUFA 3DFPA 5U4NA 4IGHA 4GA8A 1TPVA 5I06A 1RP9A 4KT2A 1C29A 4ZB0A 3VUPA 3RM8A 3UPBA 5ECUA 2GGJA 3H23A 1KRBC 3L2LA 3OW1A 4MIMA 2CBVA 1W5MA 1HZYA 2PD9A 4RNJA 2A3EA 1I45A 2I16A 1DWIM 2FTWA 3WD4A 5LNWA 2WQPA 1H60A 1TTQA 4I8DA 1H51A 2OVLA 3KTSA 3ITTA 2DU2A 4A8NA 1S5WA 4HJWA 3GBDA 5HR6A 4Q4KA 3T7VA 1LQ0A 4IMFA 1XLFA 4HKPA 3FVDA 3S9ZA 4DWDA 3QHMA 3CV1A 2NQZA 1HFBA 3AC0A 3QBUA 1UWUA 3UJRA 3ONBA 3KWXA 3CT7A 1ZU8A 2Q8LA 4Z42C 2O7SA 1VFMA 1RQEA 3ATZA 3EDDA 3G1RA 1ZAIA 4X2RA 4KFOA 1SO5A 1N8IA 3P14A 2VHLA 1Z89A 1SQ7A 2X1IA 3NNTA 1PHWA 1FY6A 2YPIA 1H7RA 5F2GA 1KXTA 1GJWA 4PCPA 2WYSA 2DIKA 3K46A 1NQ6A 4CD4A 4Q7BA 1NP2A 4B4HA 2ZX5A 1VEMA 1QI0A 5HWMA 4S3JA 2FZ8A 3WQCA 1WKDA 1MMFA 4O1FA 4WSKA 3U2EA 1VFOA 1TG7A 2G37A 4JS3A 4Z2KA 2Y88A 4NF7A 1P48A 5DBTA 4XB3A 3QPEA 1N8WA 2ABAA 5LGXA 1QNQA 2FGLA 5M2FX 1JYXA 3UZWA 3WNLA 4HHPA 2WZHA 4D9PA 3GNNA 1XFCA 4LYRA 2Y70A 4JQAA 4ZQNA 4JHOA 3RYSA 3WDHA 4CQBA 3HURA 3VFCA 4E2BA 2I5IA 1JZ2A 4TO8A 3U5YA 3VDGA 5J5DA 4W87A 1JL8A 1ZJHA 4GYPC 3TOPA 2FPYA 4XV0A 1UUOA 3HG4A 3O05A 1YADA 1E4MM 5AYZA 5LA0A 3EOUA 4MNMA 4JEJA 5HUOA 1OINA 4AY8A 1EIBA 1JJKA 3AXXA 4AVNA 2WVVA 2G96A 1ONWA 3EAUA 1CDGA 1I2RA 3CWHA 1E51A 2NUYA 4XK2A 4UXDA 4FXSA 1CGUA 4M29A 3WQOA 2CXGA 3QGKC 4FB7A 4QFUA 3EX3A 1SZNA 1FWFC 4Y90A 1M5WA 3EX2A 3LGEA 1H61A 3QV8A 3IS4A 2Q09A 1IR1A 3G0UA 3TEVA 4OUIA 2INZA 2ZRYA 1QPOA 1FWTA 4MG4A 1DJWA 1DJZA 4P2VA 3U57A 3PFRA 4DO4A 4KRZA 5I2UA 3B0YA 1ESWA 4IL0A 3ALGA 2Q71A 5AHIA 2VELA 3P0XA 3VZYA 1L9WA 1MVYA 5CBJA 1M03A 4GIAA 5HMEA 5K9DA 3VABA 4PMRA 1H41A 3BVJA 2PEVA 1GW1A 2D23A 4PULA 2D3LA 1ZPTA 1YE4A 2P5NA 2ZZ3A 4JTLA 2A3HA 4AHOA 3MMUA 3W53A 1U5VA 4JIRA 2VJXA 2D69A 2BHZA 3W26A 2OSXA 2XH4A 3IK4A 1R3QA 2PDGA 3GU9A 3P3BA 3LV6A 5FAJA 4MKNA 1XBZA 3BURA 3MZ2A 4GQRA 1YKWA 3DC8A 4A3RA 2HPIA 3ARZA 3SGUA 1O5KA 2C8NA 3WQDA 3MQTA 5H6HA 1CT5A 4AW7A 4WEVX 1UD2A 1KFCA 4AY7A 3WQFA 4AD0A 3LMYA 3RPTA 1RLDA 3TVAA 4AF0A 2CHRA 4QR6A 2TODA 3OVGA 1D7KA 1ZNNA 3G1VA 4ADSA 1XGEA 1QW7A 4PUMA 1J8VA 3F1QA 4J35A 3QOKA 4H01A 2JGYA 2CITA 4ILSA 1FH7A 2O9OA 3CHVA 1XIDA 4AVFA 3H4XA 5AVHA 1G4PA 4ACZB 1SVDA 2REQB 3RO8A 3N12A 3DHPA 5G1MA 3FSTA 3CMFA 1YE6A 4XAZA 1R3SA 4JDBA 1UC5A 1UPPA 3VKDA 1EZWA 3PTKA 2WSPA 3WF2A 1JCJA 1OCBA 4S3KA 4YTQA 4OHQA 4PA8A 5ABGA 2BMBA 4JTQA 1GQLA 3LSCA 3I65A 3CNYA 2RDUA 2PGEA 3LCIA 3DYMA 2G3JA 3STFA 3PPFA 3LZ5A 3WY1A 1KRCC 4XBKA 3ZXWA 1O95A 3ZSSA 3LNMA 2C16A 3P5ZA 4H6QA 2OYKA 4FK9A 2P8BA 1P0EA 4MB5A 5D2TA 3TTOA 1P6CA 2RDTA 1MUMA 3PR2A 7REQB 1RHCA 1VR6A 1NDWA 1TA3B 5AECA 4JAWA 5I3FA 1R3TA 3N4EA 2XIIA 3M0XA 3W23A 4H19A 5IFTA 3WG6A 5RUBA 4BI5A 4KWVA 5HINA 2ISDA 4H8UA 4JL2A 2NVDA 3RO6A 4O0QA 5FIPA 3ITVA 3CZEA 1ICQA 5JIWA 2DGAA 3UJ2A 3KL0A 1JNEA 2WNNA 2I1OA 3N2CA 1QHOA 3TROA 1I2NA 5LGZA 4LUTA 4MWAD 3ZJ7A 2CESA 4EF8A 3M0MA 1O12A 1C7SA 2DSWA 2HBVA 3NAVA 1WZLA 4BWLC 2PBOA 2E9MA 2WB5A 3BAKA 3MP3A 3NPWA 4ML9A 5DEZA 2YGYA 4DO5A 5TQLA 1TCDA 2ODOA 3B9EA 1M41A 3WBAA 1CXLA 2VFGA 3IJQA 1ZSXA 1SO6A 1MRAA 1EL3A 3W6YA 2JF6A 2VEMA 3R12A 3UWQA 1B3XA 3A23A 5HQMA 2J9ZA 1F05A 3A3HA 1TV2A 1J79A 2WMJA 1I0DA 2A2IA 3OOQA 3M0ZA 1D8WA 3CHEA 2Y2WA 4GUHA 3W4RA 3CBWA 4ZZ9A 2WC4A 1W9XA 3TZNA 3HPXA 3KOWA 4KMQA 2ACQA 7A3HA 4IX2A 1WOAA 2W9MA 3OODA 3ALFA 3TC6A 2ZWYA 4LF2A 3AWOA 4H2HA 1QNOA 4JIPA 2R91A 1G7VA 2I9UA 2VEPA 3I68A 1J6OA 4LT9A 4XAGA 3EGJA 2J8GA 3PZMA 1GVIA 4DLMA 4M7SA 3Q37A 1C8QA 3VCRA 1NDVA 4KETA 2PB1A 2PC8A 3SGZA 3NEHA 2OODA 2Y5JA 2GLKA 3DKLA 4FOJA 4GVFA 1VFTA 1M65A 1V6UA 2E7FA 3HG2A 4B3KA 3QF0A 1JPHA 1L6FA 4E8GA 3TW6A 3B8DA 1RCQA 3CUGA 3GVRA 5MF5A 1KM4A 4JFUA 2GFTA 3HO8A 3KOFA 4J40A 2V5CA 4GUGA 4IUOA 2G5WA 3EX4A 4Q32A 9CGTA 3MBDA 5FL0A 2R1MA 3N2TA 1BVWA 5CC3A 3QFWA 1DPMA 3NL3A 4TMBA 3S4TA 1GG1A 4RX0A 1W32A 4HNVA 1A5CA 3UWZA 1XD1A 3VPLA 3E2RA 3VGEA 2O9RA 1MYRA 2RDWA 3A9IA 2O0TA 5E0CA 3TN3A 3MO7A 2KZHA 3DGBA 5M5DA 1XBYA 4MNKA 1WKEA 4V27A 3NIYA 3QSRA 3EDJA 2ZE3A 4CNPA 3ARWA 3DU0A 1BYDA 1JIBA 3AHZA 1Z32X 5D8ZA 1T0OA 3ZSTA 3G1DA 1WDRA 1V3JA 4R9XA 3PM6A 4NU7A 1DP0A 1UPMB 1RD5A 1VCFA 2EQDA 2INEA 3L23A 3VCCA 5HPCA 1RLCL 4IXHA 4YNGA 4L6OA 3NXLA 4HNUA 1XYLA 1WBHA 3KVJA 3H24A 3TJLA 2R1LA 1TWSA 4OV4A 1H0GA 3EYPA 3NQ2A 4FO4A 1O4UA 4FA3A 2FVLA 1DWJM 4L4PA 3H2OA 2P1FA 1OFQA 3WLPA 4J3TA 1V02E 1F2JA 1VFFA 2GQ8A 4V33A 1MQPA 1XC4A 3NQDA 1EYEA 4E0CA 3UXIA 3GIYA 1JDAA 1YTKA 1UWRA 3WLHA 4MPQA 2PTZA 4XZMX 2OMAA 5A6KA 1NP0A 3S8HA 1ZTVA 2DT1A 2FVMA 2BZNA 1KFJA 4C6DA 4OGZA 3NQFA 4UTMA 1X6UA 4NP7A 4UTLA 3S1GA 1JGMA 5AYIA 4D6DA 4AXNA 4A29A 3AWNA 2VQUA 2ALRA 3RNDA 1BG9A 3PUDA 1QNRA 3WF1A 6ALDA 4BKNA 1J6PA 4MNLA 1R2TA 1VP5A 1XIJA 3CMGA 3MMDA 4J7RA 1J0YA 4M1RA 2FIQA 2PWUA 2XSXA 4IMDA 3USZA 2PDNA 4AC7C 3DFHA 3KAOA 4N6FA 3FJNA 3CQIA 1F6YA 4M1BA 4J3WA 2GOUA 4C1NA 2E0PA 2C0HA 3GW3A 4YIWA 1R0MA 4A21A 2V69A 4WDXA 3MKCA 3EWXA 5B7YA 4NHVA 4ZTYA 1B3YA 4AC1X 3OJGA 2CERA 3ABZA 2WQDA 3EEGA 3L2MA 1OQFA 4DXVA 1PL9A 3SN4A 3UWUA 4UNIA 4HNLA 1XLKA 1UCWA 4KCWA 5D33A 2XFYA 3R0DA 1I9CB 1C7TA 3F2BA 3PJWA 3R79A 3M46A 1XIBA 3HV9A 3MI3A 2ZTKA 3B9OA 1Q4NX 3TUUA 1IT0A 1XC6A 3EWBX 2OB3A 5EPDA 4G7FA 1OYBA 4UBPC 3AZTA 1NY1A 1NARA 3NJ3A 3QY6A 3AXHA 4GABA 1Q7ZA 2D2GA 3T4WA 1W91A 2WVSA 1MFVA 1VF8A 2GDUA 1XIGA 5BWFA 2XGIA 3BLEA 4MLJA 3LHTA 1AMKA 2V6AA 3TQPA 4K36A 4XTIA 4H9UA 4YLWA 1TVLA 4ALDA 1QUMA 2C18A 4L61A 3THDA 1XSIA 3VMNA 5G2IA 5E1QA 3CU2A 4YU1A 1HP5A 1C91A 1B0IA 3W1RA 3S3GA 2RGLA 4C7FA 1KM3A 4QE5A 5CQ1A 2Q3OA 3AS3A 4DVOA 1L6SA 1VS1A 3MYOA 3PFMA 1RBAA 1T7LA 1OSEA 1KFEA 5K2ZA 2YL6A 4CD6A 3B8WA 4HQVA 3MCOA 3A5VA 2Z2BA 3VNJA 1X38A 2VZSA 1E6SM 2P8CA 3BLLA 3HGRA 3GDRA 1C3FA 1MNSA 4EWJA 1A80A 3ID7A 4H1ZA 2OLAA 3FJ4A 3IJIA 3R4IA 2WHLA 4PUNA 3OG3A 4PCNA 4UR7A 4J3UA 4H4IA 4A8LA 1E0UA 4Q7IA 4HHLA 5GVJA 1KCXA 4F0MA 3T4CA 3W00A 1GOMA 1HN1A 2CU0A 1DIDA 3WLOA 1EPVA 4LCQA 2ATSA 4HIBA 1JPIA 1XI3A 5A6SA 4AAJA 3M9YA 3NCOA 1N2VA 3NPUA 1N8FA 2ZX6A 2BTMA 1K9EA 3LOTA 1TWIA 1YDVA 4K68A 4AZGA 1TPC1 4U3AA 4AHPA 3VTRA 1A5NC 4X9YA 2DZSA 4HZ8A 2B4GA 5B7ZA 1ZZMA 3THQA 3MVTA 3SEPA 1MW2A 4ICMA 4CNTA 4DWSB 2YOCA 2JKPA 3O6CA 2A3BA 4FX7A 1YBQB 1EBHA 4YVVA 2AL2B 1DXFA 3SM0A 4A2SA 2HCVA 2DUZA 3RU6A 4O15A 3MZNA 5CGMA 3WKZA 5AYBA 1E3XA 3WD1A 1RZMA 5T26A 2X0SA 3AJ7A 3L0NA 4QIUA 3WJWA 2H9AB 4HA0A 1JCTA 1UIOA 3A4WA 2PBGA 4PUJA 1O5XA 1VPXA 2WWCA 4M56A 1UQZA 4ZQOA 5XIMA 4HOXA 1WXJA 4MB4A 1UMYA 2Z25A 1R9XA 3GDKA 4LF1A 3A3WA 5FSDC 4UWMA 1UW9A 3RITA 3W1XA 5BXRA 3R8RA 2ZX8A 1OC6A 3F5JA 5EKYA 3FVMA 1W3NA 1A0EA 3VIMA 1KQYA 1KBIA 3WFAA 1V3HA 1MXSA 3BWWA 5D05A 4IX0A 3IJ6A 3K1DA 1KLZA 4V15A 4RPQA 2G4JA 2OLHA 3GR4A 2V9DA 3HV8A 2XN2A 1YPFA 1BQCA 2VFDA 3BGAA 3EKLA 3TSDA 3FXYA 1D2KA 1VIWA 3UVIA 2DJXA 2TYSA 1S3HA 3CPGA 2V8ZA 4NUWA 4P8XA 3ZS4A 2Y7FA 2GL5A 4JFWA 5DMMA 4K8EA 4M5PA 1AMYA 3B05A 4E4FA 2XFWA 1EF3A 1PTAA 3PB0A 4JTIA 2ZXAA 4FNUA 4ZO6A 2E6DA 4O0KA 4UOQA 4NL1A 2VX7A 4MUPA 1OGBA 2P10A 4JNMA 3QV6A 4EWND 4IPLA 2J9XA 1OC7A 5HJXA 1LL6A 3TK7A 1A5BA 2VOTA 4RNIA 1XQLA 4FNSA 4GVHA 3H12A 1KGWA 3S1UA 1G69A 2FMNA 3R10A 3HG5A 1CGYA 3P62A 4FX8A 1V3LA 4I9MA 1OG0A 1KLYA 3U5UA 4FIRA 2J25A 3QM3A 3GNRA 4QRNA 1UZDA 3IIZA 5A8OA 4F0RA 2WMKA 4TVCA 3ZJ6A 3MSDA 2I7GA 3QW3A 2KAUC 3QN3A 5I00A 3KP0A 5DELA 3M7WA 4PMNA 4ZODA 3SADA 4IHCA 4QLLA 3GZAA 3WK1A 4W4QA 4LY4A 2GSJA 3OQ8A 2J62A 3OO2A 4DBUA 4DF2A 3LCHA 1F3TA 3JZUA 4BQ4A 2A4AA 5LA2A 3T08A 3NZPA 1DXEA 2VGBA 3NYZA 1XBVA 2YSWA 1A3WA 4MWAA 5D37A 1WV2A 3PBGA 1BHGA 3BJSA 5C9WA 1EJTC 1VYSX 3RM9A 1DXIA 3IGSA 1CZ1A 3E0VA 5BMWA 3B0UX 3CZLA 3FX4A 4B5SA 4ZB2A 3CO4A 4KPLA 2VWTA 2J6VA 3B04A 3L9CA 5ABFB 1DWHM 4Y8FA 4TXEA 2ZUTA 4PTVA 3GS6A 4F9JA 4WOZA 4RW3A 1CX9A 1MDLA 1FUYA 1LWHA 5I79A 2PDCA 4N9BA 2EG6A 3SRKA 3VOHA 1CNVA 1OK6A 2WJZA 3DFYA 1VCVA 4RE2A 4H9YA 4ROQA 3M4HA 2WSKA 3UF9A 2R14A 3KDOA 2VENA 4KCVA 1N7KA 4RE3A 2F7FA 3H54A 1F74A 1T40A 4S3CA 1AUSL 1A5MC 2J75A 4HYVA 1HKIA 1QK0A 1EOKA 1X1NA 2VFFA 1ZGDA 1PAMA 3C2RA 2VYOA 3MUXA 2ZX9A 3BAWA 1OADA 1LLZA 1S39A 2QCLA 3TYAA 1U22A 2ZQ0A 2ON3A 3GXDA 4GY7A 3HOJA 4LYQA 3OVRA 1LCOA 3RJXA 4JTGA 3WLTA 2G3FA 1QDSA 3P82A 4TQTA 3LM3A 4IMEA 1W1VA 4S3EA 1A5SA 1GOKA 3PUOA 5JUVA 4Q33A 1W9PA 1KTCA 3M0IA 3HF3A 2YBUA 2Y63A 2O92A 1FWEC 3TXZA 3MP4A 4HA3A 4LAUA 3NQAA 1NJJA 3AU6A 4AIEA 1CB2A 1JFHA 2VURA 2VFIA 4FLOA 4CCEA 4DWSC 4ZQCA 1S5NA 1XSKA 4Z0SA 1W1YA 1EGZA 1E6ZA 2VQTA 2DV0A 2C91A 2FHFA 5I0DA 7CGTA 5AY7A 2YA2A 3B8VA 3K30A 2QJNA 1V6YA 3PF3A 1P1XA 1FXPA 3KRBA 4J2PA 3M47A 4BF7A 2GJXB 1M6JA 3P7YA 4CU7A 4LALA 4H8HA 4GQBA 3A9BA 3BLDA 1UR9A 1TMHA 3WK3A 4AH7A 4UTWC 3QQ1A 1R7OA 1JCMP 3RR1A 1F3XA 2BVTA 3G1SA 5I7GA 2DQWA 1FCQA 5CAKA 5IRPA 1EKOA 4N2YA 3RLGA 2YJQA 2W6RA 1OFOA 4L80A 3U2CA 3VNDA 3W7JA 3UNTA 4E2OA 3C0QA 3WL0A 4RW5A 2JFEX 3WBYA 6REQA 1TFVA 3RUBL 3FAXA 3B9NA 4FAMA 3IGHX 3CQJA 5FEWA 3V0UA 4CEUC 4KW2A 1THFD 3AISA 3SN0A 4RXFA 3XINA 2Z28A 2Q01A 5GJPA 3SY8A 4QS6A 3JR2A 4Q8WA 2J7BA 5BU9A 2G3IA 2YZRA 3PUEA 4J2MA 2H8XA 1ZCCA 5D9OA 3UERA 4LVAA 3TYUA 4HSOA 2DT2A 3MB9A 2C1IA 3DFNA 1BF2A 3DG6A 1BRLB 3CAQA 3CYVA 4JX5A 1WE5A 4HPJA 4Q4SA 3TCSA 5HULA 3AHVA 3VDHA 4NAFA 3NM3A 3BQ5A 1H1YA 3QOMA 5G4HC 1XRSA 1T41A 3S2NA 2YDQA 3W01A 2X2YA 3C2EA 4DF0A 1REQB 1J0IA 3EWUA 3BL3A 2DT3A 1XICA 4OU1A 3VC6A 3WLKX 2E68A 3OB8A 3M0VA 1AD4A 3N34A 2YL8A 1T5AA 4PL1A 3FCPA 1H4PA 3CK5A 1XLDA 1UHVA 1RAKA 1BYCA 3MMTA 2YL5A 5KETA 1U5JA 3OVPA 4GKLA 4ZOCA 1TX0A 3IIOA 4E2VA 2WZMA 2PMQA 3CHFA 4DUXA 2PF0A 3WUBA 4CNUA 1J2WA 1DQWA 4CUCA 1FXQA 2WNQA 5AZ1A 4NG3A 3OVQA 1Q6EA 1PJ9A 5FJUA 4DJFA 2OYMA 1LBMA 3UPWA 2WJFA 1CXKA 3UJSA 4HP5A 2UY2A 2PPGA 4Z2IA 2GYIA 3KUMA 2RGMA 1CYGA 1OCJA 4HMEA 4DNMA 2QJIA 2Q6ZA 4L9ZA 3SCRA 4U28A 3VM5A 2HISA 1W6TA 4B5VA 1YDYA 4YCOA 2WVTA 5C9XA 1AG1O 4GHRA 2IPWA 1I60A 5KZEA 3H2CA 4GIEA 3GFZA 3GSMA 1A5OC 1RVKA 1RD6A 2D22A 3BJTA 3EBVA 2FGZA 3LLDA 4DUOA 2HK1A 3NQ7A 2TSYA 1F7BA 4AZBA 4GI8A 2X0HA 3VAVA 2X0YA 2F38A 2FZBA 3FDKA 1NFGA 1VCGA 3NQGA 1QFEA 3W73A 3RX3A 2GGGA 3Q65A 2PWGA 3BV4A 3GR8A 1UJPA 5F4WA 4DJEC 3WJSA 1QI5A 4ZMGA 4FOUA 4HPNA 3SW6A 3GDBA 3CM4A 2XH2A 2WVUA 2QXWA 2F6UA 2FHCA 3C0SA 8TIMA 1KM2A 4KESA 3DBPA 1BKHA 1E71M 3W7CA 2WPGA 3TAOA 2VDIA 4AWUA 1MW1A 4R7WA 4W7VA 1V0MA 4RV3A 1V03A 2QGHA 3PBVA 4UIOA 4BHYA 1UWIA 2QF8A 3KLKA 2JEQA 2W92A 1AL8A 1JAEA 5HNTA 1SJCA 2W79A 4QNWA 2CHNA 2GJNA 3ABQA 1FDJA 4ACYA 2R1PA 4ZXOA 1OZMA 2V2HA 4GUJA 2OWXA 4M6UA 5F7UA 2OTDA 4O1DA 4H9MA 3EB4A 1EPXA 3VIIA 3LS9A 4F79A 2OWWA 6ENLA 3T8QA 2VZTA 3UXDA 3PPHA 1X98A 4NNAA 4I9AA 2YKKA 4QDWA 3PZGA 3TYDA 3O6YX 3O2LA 3FJLA 1SJBA 2VUYA 2DVXA 3FS2A 2BOFX 3WSUA 4OWGA 4ROPA 4WXZA 2WMIA 5IM51 5IHRA 1AVAA 4IIHA 4AHQA 2X41A 4DJDC 9RUBA 1OYCA 4TV5A 4TTGA 5C9ZA 1JYWA 3BGGA 3H2NA 1OJXA 2V81A 3LCWA 1CXHA 4BI7A 6XIAA 2E6FA 1FWJC 4HU8A 4CN4A 4RNFA 3EDFA 3PZOA 3W74A 3UYIA 1VJIA 1Q5MA 1U1UA 1WZMA 2IKGA 1PO9A 3C2YA 3MU7A 2PRMA 3OLGA 3OPSA 4DUVA 1OBAA 3VVGA 3EWWA 3LHUA 2ZICA 3T0CA 3VD5A 3Q2DA 3NO3A 2ZRZA 3TNBA 2Q3RA 3S6TA 3WD3A 1GCYA 3LERA 1IXQA 3QY7A 4MDOA 1FHLA 1GNXA 1OVDA 2CLEA 3APGA 4EPEC 3HZ3A 2J47A 3W1PA 4H7ZA 4LU0A 2PFHA 4MB1A 4I7UA 3QZEA 3LTSA 1TYGA 4UZUA 3E9AA 4LW7A 2AKZA 3W72A 3DHFA 1WB0A 4K1GA 4DIAA 3W1UA 2V3EA 3YPIA 4XZHA 3BGJA 1Z42A 3LI0A 2Y7DA 2QUVA 4IMCA 3QTPA 5FKYA 5D2YA 2VGIA 4KWSA 1EJ7L 3CZJA 4MKSA 1DJGA 5A6BA 2EKCA 4P5UA 2CLLA 4UFIA 2F6XA 1K8YA 1OK4A 3ISIX 3EX1A 4GI6A 3N14A 4UTFA 4YTRA 3LRMA 1DJIA 3T0TA 3VILA 2EPNA 4PTDA 2PF8A 1C90A 3S47A 3PY2A 4CU8A 2WCSA 4XAFA 3OTRA 1E3ZA 4ZO8A 1V5XA 4B3LA 4DM1A 1CGXA 2QCFA 1HP4A 1W1A1 4MGGA 2DW6A 2J4GA 4U5IA 2QJMA 4PH6A 2ICSA 3ZJKA 1TR1A 1U1HA 5A8GA 3STGA 4QG6A 2GOKA 1PDZA 2WOQA 1KB3A 3RX2A 4L6DA 1AJ2A 3WDPP 2FQIA 2W0UA 2PDQA 1BEUA 3TFCA 4P7RA 5EMKA 4JKMA 1KNWA 2A3AA 1EIXA 4OUEA 1A49A 1AH3A 4JPGA 3V75A 4O28A 4ZA0A 4LUSA 1UUQA 3AALA 4P7OA 1KXVA 2VFHA 3NQCA 4HTYA 4E2DA 3GRIA 2YCLA 2QIIA 2H6RA 3T81A 3DFTA 5CKSA 1KC7A 1LOQA 3N3TA 3TW7A 4NASA 1PUDA 3SURA 3W25A 2QCHA 1TJRA 2WC7A 3VGHA 1GQIA 4XO7A 3WBWA 1IGWA 2FB2A 1EP2A 1TVNA 3WF4A 1W3IA 4LAOA 1O7AA 2ESCA 3BSGA 2VX4A 2ADAA 5C54A 2DT0A 3VOIA 2EO7A 3FN9A 4A8IA 3IJ7A 3WQ4A 3JW7A 5A2BA 4GLEA 4MVAA 4D6GA 5A6MA 3L0KA 3APTA 7TIMA 3PG9A 4CQAA 4D8AA 4MADA 4GCXA 1QPNA 1W5PA 3BK0A 5EFDA 2BY1A 2PC4A 3STPA 3H55A 2A85A 3E12A 3GR7A 2VVSA 3WQ6A 5D2WA 4DZ5A 1QU4A 2I5QA 5FEXA 3CV2A 4GZJA 4UTJA 1K7EA 1UZ1A 1ITCA 5DFAA 2G95A 3FKKA 1YYAA 1JXJA 5FJPA 3B06A 5I3HA 2VNCA 4RXGA 3CTLA 1OFEA 2ZUWA 3ZT7A 1Z69A 1JZ4A 1JFXA 2DEPA 1E1CA 2PDJA 2HNHA 1S5MA 2P3ZA 3QJAA 3W7GA 1PXGA 2WBGA 3GNPA 1A4LA 2ZVRA 4OOZA 2ZXBA 1C8XA 4LUJA 1W5OA 3VKAA 4JICA 3PWIA 4O11A 3O6AA 4Y9MA 2YFNA 4AD3A 4E3VA 4D8LA 1L0PA 1TJ1A 3SCOA 4GUIA 3BJFA 1G4TA 1AODA 2PODA 2DW7A 3WYZA 4C5ZA 2OT1A 3TTSA 1QPQA 4C6BA 1TMLA 2VC6A 3VINA 3WMCA 4PMOA 3AYRA 4GJ1A 4OVXA 5CPTA 1D9EA 1NIUA 3OGRA 1I2OA 5D38A 4FI4A 4MM1A 1S1RA 1UOKA 4OOUA 1XIMA 3WNKA 2PAJA 3MI6A 1JCLA 3N1AA 1L6WA 2ZRUA 1OX5A 1GOIA 1OABA 3OZMA 3FFSA 4OBRA 1W1B1 4D6FA 1ZBWA 4D6HA 4V28A 3GHRA 1R47A 2E5BA 2E4TA 1JQXA 1XCWA 3NA8A 3WH8A 1CPUA 4PN2A 1NAL1 4B5TA 4GYJA 2GVGA 5I24A 1QBBA 3VOFA 4PCSA 1LORA 2X40A 1UA7A 4W8LA 4ZSTA 3GXMA 2EKGA 2VDGA 1BTCA 3LPGA 1HO4A 1KCKA 4UNLA 3VNLA 2CIPA 1LT8A 5JQ9A 1ZS2A 1TPFA 4AD2A 1FA2A 4WX2A 1JZ5A 2E5DA 1BPLB 5A8NA 1LUCA 1RBOB 2VRJA 3Q45A 2XHYA 2VKZG 2DP3A 3J7HA 1GZJA 2FPVA 3LDVA 3I6TA 4H41A 3AIRA 4JTSA 3VIFA 3W2KA 3HMCA 3BPWA 4MAVA 1QOXA 3GM8A 2ASHA 2J27A 3C4UA 4N0RA 4ZQRA 1TB3A 3WL1A 1PZ3A 1O68A 1UB3A 5HWNA 5G4EA 2X09A 3RIKA 1L8PA 4IXXA 4X61A 1E15A 1M7OA 1PX8A 2I17A 3RRXA 4AZ5A 2PTYA 1IGSA 4TUFA 2G8ZA 3SY1A 4FX6M 1ME8A 2DSUA 2QJJA 4HA1A 3MVIA 4RDVA 3T07A 3A21A 2CPUA 1IEXA 4IM4A 3GNDA 1TQXA 2NV2A 3EDEA 5REQB 3L4ZA 4Q6XA 3ARTA 2J7FA 1B54A 5DRCA 1E43A 2XVPA 5K9XA 2DSKA 4TX9A 3WDIA 1NOFA 5A1AA 3WNNA 4W9TA 3NSXA 1H0IA 4MHBA 3G1XA 1CIUA 1M9HA 3PZ9A 3OP2A 1DE6A 1PWMA 4MZ1A 3LGGA 1JPDX 2VCBA 3CYJA 3PBWA 4G5DA 4NZ1A 5G1YA 4S1FA 5IBXA 1GORA 4O13A 4Y7EA 3K4DA 1ODZA 2WVVB 1H62A 1W8SA 3WLLA 2QYGA 3ARVA 4GQ0A 4Q8VA 5I3JA 3W7LA 1VHNA 2V0TA 3ECQA 1X1ZA 2TMDA 2WANA 3HGSA 4UTTC 3HPAA 1SW3A 3WQEA 1BQGA 1RXOB 5A8QA 1QPRA 3AXMA 1TPWA 1VBHA 3NVDA 2HVOA 4G1NA 1H1ZA 1UKOA 3MDUA 5E6YA 4H2CA 3CC1A 1KBBA 3KOXA 4D71A 4WSHA 1F4AA 3VIGA 3MHUA 4QE1A 2PU1A 4EP8C 2EJAA 4E4UA 3H8AA 1ZBVA 2HMCA 4AZHA 2VZVA 1XINA 1MZHA 1NSJA 1IXPA 2QKFA 1S2UA 4Q4OA 5E09A 3G5EA 1AQFA 1IWBA 1PZ1A 3WLMA 1JR1A 4NKCA 5T91A 4J28A 3UR2A 3D5HA 3NPVA 1KM0A 4R7OA 3GE7A 8XIMA 2ZBTA 1NEYA 3DERA 3QTGA 1QPKA 3VO0A 4FR1A 3G6LA 3W9ZA 1IIGA 2QR6A 3CUIA 1OF6A 3S6OA 1UR1A 3CWOX 3IWPA 2QT3A 4RKAA 4NZJA 1JEZA 4WR3A 4MOZA 4CVWA 2V38A 2PP3A 2J7CA 4TU1A 4DWSD 4CEXC 2J79A 4E3TA 2AGTA 3ARUA 3VA8A 5AHLA 4HU0A 2ISSA 2PDMA 3QPZA 2P0IA 1VEOA 4O52A 1VBUA 1I2QA 1KD0A 2QPSA 2OCZA 5LIXX 3PULA 2GVEA 3MI2A 1TSIA 4FHAA 1TZZA 2IKHA 3HN3A 1JI1A 2Z2AA 1ML1A 1NELA 3IRDA 2E28A 2BSLA 3F4NA 4UR8A 5EA9A 2WW5A 1NTHA 4Z2GA 2A1YA 2ZZ2A 4F8XA 1XDJA 1UD3A 1WBJA 3UZXA 1KTNA 3NSMA 1YNQA 2VD8A 1DKWA 1I6NA 3DOPA 3T0BA 3IUDA 4B4FA 2QVHA 1UUMA 1UOZA 4XKYA 1W2PA 2OSYA 4PBEA 1K8ZA 3AS2A 3WH6A 1BAGA 2FFIA 2IUZA 2XINA 1EX5A 4XKMA 2VD9A 2WLYA 1P7TA 3GTIA 3S5SA 3N9RA 2XM2A 1KRAC 3AIVA 4WY0F 1BXNA 4RL3A 1TIWA 1XCXA 5C2XA 1X39A 3C0LA 2V67A 3MKVA 1BXCA 1KFBA 2C79A 3G18A 6PTDA 4YWSA 3W7HA 1ISZA 3BZGA 4O54A 2D0FA 2DSZA 4NRRA 3RCYA 3AI0A 4AX7A 4BQ5A 3SJ3A 4QHRA 4MJMA 3M7SA 2QUMA 4LB3A 3R2GA 3STCA 4JTCA 5JBFA 4YXGA 1KCLA 2JBMA 3FA3A 3OHIA 3LM7A 1EXPA 3FGCA 3SB0A 1DIOA 2HEJA 4N7QA 5AFDA 2NXGA 1CLKA 2DZTA 4IPPA 3WD2A 5C70A 4JIIX 2J7GA 4S3AA 1QI4A 4P61A 2FKPA 3DFQA 1TA3A 3KS5A 2W5FA 3O15A 4TVDA 3I7RA 3LHWA 2UY5A 3GW0A 2VCAA 1QO2A 1PSCA 2JK2A 3DXIA 1NDZA 3H4WA 1Q6CA 3LMZA 2BY0A 1ZJBA 3EDKA 1G67A 1H2JA 1K9FA 2CW6A 1UKPA 3PP7A 4HVXA 1RQBA 3EMZA 2GVJA 4AZ6A 3C2OA 4PCFA 2Y85A 3E2QA 3ITCA 1ITUA 8A3HA 4KCUA 2GQ9A 3N4AA 2BGSA 3DZ1A 4BCEA 1GVQA 4U31A 4XD5A 3V4BA 2P3EA 4FOKA 2ZFAA 3WLJA 3O6DA 2EHHA 2EXOA 5JH2A 4LVFA 2PS2A 4HK6A 1R6WA 3E5PA 5H2ZA 1F73A 2E40A 4AIUA 4GRSA 3URBA 5D02A 1AQHA 3OYXA 4AD1A 3ABOA 4HT3A 2NUXA 4A8RA 2P76A 1US0A 3CUJA 2DSVA 4M80A 3PN8A 3LUTA 2XM1A 2Y7GA 3NO1A 1QHPA 1GT8A 4LNYA 1M7JA 2AAAA 4UFLA 3ZLHA 4XWUA 1OFBA 3N9SA 1CXIA 2VDHA 2XIQA 4B15A 1ZP4A 4PC8A 4S3FA 2PGWA 2JEPA 3B0PA 3H22A 2FDSA 2D73A 4EAYA 1BVNP 5BOFA 3TOYA 1ECQA 3CB8A 1XRTA 3AXKA 4TVUA 4Z1YA 3GXFA 1SR9A 4LAMA 3A4AA 4Z2HA 5G4WA 1KXHA 4DF1A 5LYRA 1PCWA 2RAGA 1X6NA 3UXKA 1EA0A 2DY3A 2VC7A 1GVEA 1XFBA 1YEYA 5DT5A 3HJZA 3UWYA 2Z1WA 1FWDC 2W67A 1AJZA 1Q8AA 1KFLA 1S2WA 5K4ZA 1OFRA 2PZ0A 1TCMA 2XUCA 5AC7A 3PZVA 3P8IA 3OLIA 5LZLA 1Z8AA 1J2BA 4GO8A 4LYKA 3B03A 1G5AA 1G7UA 2Z4GA 2PDLA 2R1KA 3MANA 4UMBA 3AXIA 2XVKA 3HQ1A 3TE9A 3RK8A 2Y62A 4K2SA 3S5NA 3SQLA 3WLRA 4UZSA 3ZQ9A 4H6RA 1UWSA 3LPOA 1ZENA 3WLQA 1GTHA 1ONXA 1V6VA 4JN7A 4J1OA 2VZOA 2B0MA 3B8IA 3QZ6A 3VOCA 4Q6JA 4UQAA 1KQZA 2FTPA 3DECA 4F66A 5D2XA 1LF1A 5I07A 4JCLA 3K13A 2V2DA 4I5UA 2Z1SA 2X42A 1E56A 1TPEA 4RDWA 3IAPA 1Y0EA 3GAKA 4J3ZA 3EWDA 3PNUA 1LJYA 2B7QA 3JRKA 2VP8A 4C6QA 3UVAA 4DJDD 1MZRA 3AYVA 3EOOA 3LXBA 3N9KA 4LRSA 3QGAC 1KM1A 3QRHA 4Y96A 2ZE0A 5BU6A 3GIQA 3T6CA 3WNOA 1RA0A 4ONVA 3CB3A 1PV8A 2O55A 1WAWA 4JNYA 3TC7A 1HUVA 3PHAA 1FHVA 3E49A 4OV9A 1EGVA 6CGTA 4AYGA 4EX4A 4K8HA 5CG7A 2Z6IA 1E0WA 4J3XA 1C9DA 4XQ6A 4RR4A 5LHEA 2CZVA 4XX6A 1IEVA 3P81A 2RH9A 1LBLA 1F6KA 4M82A 3BSMA 1DL3A 4PMDA 2CHOA 2VRQA 3PS7A 3CQ0A 4FALA 2ISFA 3E0WA 4Q4PA 3TYCA 3C61A 1GG0A 4G56A 2VR4A 3FA5A 4H3DA 1J5SA 2HV5A 3IUHA 1ZRQA 1L2UA 1SSGA 3U2OA 4ZOAA 1R3RA 3CJPA 2Z6JA 1HKWA 1H3GA 2OPJA 5A6AA 1LBFA 1SFSA 4FNPA 3WENA 1YNYA 1W3HA 3W2JA 3W84A 4NSBA 4HNTA 2DZWA 1VC4A 1XLBA 5J5RA 2GK1B 2OELA 4L4MA 2ZZ1A 1DJXA 3QHNA 3W24A 2W27A 5FOOA 3EXSA 2EPKX 2ATMA 1O1ZA 1IT7A 1IHIA 3P5YA 4IQEA 1GEHA 2OZ0A 3IPWA 4GY1A 4AX6A 4AEOA 2PGFA 1NWSA 3R0KA 4QAIA 2DPEA 5K9CA 1ECEA 3N3MA 3F4WA 2GZXA 4RZBA 3D3AA 1TUXA 3BG5A 3AIWA 3FHQA 5DCBA 5A2AA 3ZM8A 2B81A 4KGJA 4FEZA 4M51A 1IEWA 1XYMA 3N6QA 2NXHA 4QJ1A 3I6EA 3TTEA 1VFLA 4E8CA 1EJUC 2X30A 2C13A 2Y61A 5T9CE 3G8EA 1K03A 1PYMA 1Q2RA 3CHCA 3O07A 1MSSA 2DZXA 4Y9NA 4F2BA 2YYUA 4JYEA 2AOSA 4CD5A 3URQA 3PTQA 3O63A 1GJUA 3SCSA 1XLCA 4O19A 1AZ2A 3ARRA 2NX3A 3E5BA 3HTWA 1U33A 1DIEA 2J74A 3MW7A 3SJNA 5C0QA 3ELFA 3GXIA 3QSTA 3I10A 3NOYA 4FNQA 1TR9A 2PUZA 2HTMA 2VX5A 3PG8A 1KRMA 5M03A 2PWFA 1EH9A 1E70M 3WJXA 2PTDA 1EA9C 3TQKA 4TX6A 3W02A 3VKBA 5HJYA 4O16A 3BLOA 2EGZA 3RGTA 2V2CA 3ZT6A 3M5YA 3OHMB 4XIMA 2OR2A 1UASA 4IIDA 2BBFA 2QMKA 2ZUMA 3LCXA 2FDMA 2PDWA 1W1PA 4WDTA 2HRWA 4U3CA 1L6GA 5M3WA 1OG6A 3LN3A 3L4VA 2NVAA 1UH2A 4GH3A 1SFJA 1FP9A 4GMEA 3FOKA 4LS0A 4JN6A 1FWCC 4AUBA 4JX6A 1W1IE 4JQ4A 1FWBC 3RPDA 1R85A 2YXXA 3S46A 5DBUA 2XIJA 3PBMA 2B7PA 4JYDA 4IQDA 2A5HA 3L5MA 4GZIA 4REQB 4HPGA 3IJDA 2V5BA 3ZWSA 1RA5A 2VM8A 2Q8XA 3NQEA 3CPUA 2X1SA 3MSYA 2PWHA 3PZIA 4LY8A 4RK8A 3VDBA 3PJUA 3AS1A 3TH6A 3DKJA 3W7IA 5G1TA 4KCTA 3FA4A 2PTXA 1KGXA 3V18A 2YDSA 3LG3A 4NNBA 3LI1A 3GVQA 1EHAA 1YBQA 1TV3A 1NVMA 9XIAA 2E67A 3QR0A 1A5LC 4UFJA 5DF0A 3WUEA 4IP5A 4PFHA 1EC8A 1Q7QA 3MT1A 2ZZ5A 2WZTA 3UP8A 1YPXA 1PWLA 2WNWA 2HZGA 1MEIA 1Z7AA 2OKTA 2VC9A 5HDRA 5E5CA 4IMGA 4HMNA 2BGNE 3S5ZA 4NRSA 2CKRA 3W71A 3BLPX 7XIMA 2H8ZA 3ZLFA 4ZOBA 5CJMA 2ZUVA 4UTHA 4B92A 2E5CA 2XSAA 3A4JA 3UG4A 3ES8A 2O4QA 4ZO9A 4BF5A 2Z24A 3D3FA 5KEZA 3UCCA 3GNXA 3E1F1 1KR1A 4ZR8A 2DZBA 1SU5A 1G4SA 1EZ2A 5FI8A 1CWYA 1QW8A 5BRBA 1MEHA 2EEXA 2WHKA 3GKFA 2PRLA 3NDOA 2JGQA 4LWWA 4AIOA 1CGWA 2I57A 4MMWA 1K3UA 2QPUA 2HE5A 4YL2A 3LYEA 1RJRA 2PDBA 3LXCA 1MEWA 3RM4A 3W1LA 4LS1A 3GDLA 1ME7A 1XDLA 4IG2B 4DNHA 2YB4A 3G6MA 3GNOA 1M04A 4RPPA 3GXTA 1C93A 3CUHA 5F1UA 2PE4A 3LY0A 5FSEC 1OFPA 1CECA 3NFUA 4LV4A 1PYFA 3NL6A 2W61A 3VNYA 3PPCA 4AISA 5GQBA 2E77A 5EMYA 1JPKA 3N15A 3CXOA 3K4WA 1HJXA 2VMFA 3POHA 3WK0A 3GBEA 3KL3A 1W3TA 1W2VA 3NQMA 4IJRA 3W2MA 3KDNA 3A22A 5EBUA 3L4TA 1XCFA 3ERPA 3VC5A 4CCDA 1HKMA 3QMSA 1JPMA 5HWJA 1TIMA 1VH7A 4WSJA 4KWWA 1HJWA 1TWWA 4XBJA 4DYKA 1RY0A 4FLQA 4IFKA 2Z27A 4GZEA 2GWNA 4WUIA 2CWNA 1BWLA 4NJIA 2FGBA 3H7VA 4JY8A 5BXPA 1GVYA 4JEQA 4AFYA 3JUGA 1OGSA 1YXDA 1XSJA 2PWVA 1VYPX 1RVGA 1Z3NA 4UCGA 1V6WA 1K02A 2IQ0A 5U7SA 4GJIA 2XVGA 1MXGA 1M7PA 3RJYA 3THAA 3XISA 4CN1A 3O16A 4O57A 2YLAA 2CKSA 1JG9A 1OCNA 3V0SA 2YCIX 2I9EA 1DE5A 1HX0A 1DHPA 3GG0A 2ANUA 1JAKA 4PTNA 4KWUA 2PWDA 2QIWA 2NXIA 3ZVHA 3N6JA 5C5YA 4IIGA 2Y7EA 1HT6A 1IT8A 1R5YA 3PC0A 1GEQA 3U7BA 1E4IA 1HJQA 1X6LA 1AD1A 2IQDA 2QW5A 4IH3A 4F0LA 1DJNA 4GNKB 3AYSA 4MUZA 1K9TA 1WUEA 3V5FA 3GHTA 4WK9A 4R88A 2YW3A 7ODCA 2VTFA 3M44A 2G50A 3VCNA 4JIQA 3HG3A 5TAOA 3CV7A 1UBSA 1J0KA 5DRIA 4GPNA 4HA4A 4U10A 4G7EA 1FOBA 4NVTA 3GKAA 3CUZA 1RBLA 1UR0A 3OGSA 5F2LA 1F3WA 4HHMA 3GYCA 1W5QA 1V08A 1V51A 1WX0A 3KX6A 1SFLA 3WQ5A 4O4WA 1HQTA 3VIHA 4B5NA 4PTMA 3LENA 4GD0A 1K4HA 3FDGA 5C71A 2ZRXA 1DJQA 3G3MA 1JUEA 1G1YA 2C0AA 4WKAA 3C5QA 1Q85A 5GJMA 3UG8A 3GVVA 4H7CA 3EMCA 4KEMA 1DV7A 3ZOAA 3CIXA 4C6NA 3HPFA 2FFCA 1BGAA 2WWDA 3C3NA 2D2JA 3M6YA 2GJXA 2J88A 3IVUA 4J4KA 5I77A 3EXTA 1LLOA 4Z0JA 4L4LA 1E4LA 3U48A 1OB0A 1VLIA 1XLAA 2ZX7A 4MZ8A 5FJIA 4RNHA 3WFZA 5CC6A 5DY2A 4XIAA 3KXQA 3A13A 5EMLA 4GG9A 3W6LA 3SCUA 1QJWA 3NURA 1EYWA 3KZPA 3TLLA 1TELA 4CNSA 4Z17A 3MMWA 4C65A 3VX0A 4H83A 4A22A 4S3GA 1LWIA 1VEPA 3H53A 2FLIA 4P8VA 1KBKA 2CFFA 4AB4A 2PDYA 4KKXA 4PUKA 2PCEA 1ALDA 3NQBA 4X60A 2QDGA 2QQ6A 2JE8A 3KBNA 4W84A 1W3JA 1UA3A 5CZ0A 4W89A 2XN0A 3EKZA 4E38A 3SI9A 4NAFB 3ZWTA 5CG0A 3ITXA 1GUVA 4Z1BA 1W3KA 2I14A 1Q4WA 2B7OA 4WJ8A 4F0HA 1PCKA 1GOOA 1AL7A 1VYRA 2A7RA 2WJEA 1BRLA 4JZ5A 5IDIA 5E0FA 2GDQA 3KRZA 4HMDA 4AWEA 2Y24A 1J01A 4TR9A 4Y9PA 1OX4B 1U1JA 3WDJA 4C6OA 1QTWA 1MDRA 4JYFA 3N11A 4NAEA 1J11A 4QJ5B 1D7FA 2WBKA 4N02A 5GPRA 2J7DA 2PLKA 4NX0A 2VRKA 5C55A 4LFYA 1MXDA 1ZLPA 2A7NA 1YDOA 2HK0A 3MSGA 3RAOA 2YFOA 4MAZA 1SZRA 1I0BA 1T8XA 2V5KA 4WF7A 4MWAC 3M1ZA 5EMJA 2VWSA 4I7WA 3KCLA 2XSBA 1KWKA 3N13A 2WXDM 1A5KC 4U2YA 3QEZA 4O1CA 3R25A 1GOWA 1W1ZA 4D8ZA 4IPNB 4HZMA 3REQB 3OZPA 1P1MA 3WF0A 4GVIA 1LT7A 1RPKA 1S1PA 1US3A 3U9IA 3UG5A 7PTDA 3ZVIA 4JTRA 4JDYA 3BO9A 3BCFA 3LLXA 1VGAA 4Z1CA 3CAVA 3DI0A 3ARSA 3B4YA 4QS5A 5BWAA 4Q22A 1A3HA 5E9AA 1DEDA 4DBDA 2R6OA 3M64A 2BFGA 2PCQA 3AIBA 3UESA 6TIMA 3TYZA 3WFLA 4B5XA 5KINA 2RUSA 3WN6A 1ZY9A 3B8SA 1Q6LA 5CGQA 3S83A 1E40A 3D46A 4IZGA 4MFEA 1FH8A 5HMDA 2YCKX 4UUIA 4FSAA 3WQPA 2Y0FA 4R53A 3F4DA 1UH4A 4UOZA 1FWAC 1FWSA 3W7MA 1VKFA 2EF9A 3MA8A 2PDUA 5ECVA 3WEOA 3W75A 2HS8A 4FP1A