4GUFA

1.5 angstrom crystal structure of the salmonella enterica 3-dehydroquinate dehydratase (arod) e86a mutant
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
260
structure length
252
Chain Sequence
ENLYFQSNAMKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKAGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVISVADLRTVLTILHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-dehydroquinate dehydratase
publication title Reassessing the type I dehydroquinate dehydratase catalytic triad: Kinetic and structural studies of Glu86 mutants.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase
total genus 93
structure length 252
sequence length 260
chains with identical sequence B
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4gufA00
3G1DA 1I4NA 3W23A 5DN1A 3NZ1A 2G5WA 3O16A 3STCA 2VXNA 1LM1A 5DELA 5G4WA 1F5ZA 2QCLA 3IGXA 5I3GA 1SO6A 3HMJG 5J5RA 3S5OA 3PVFA 3A24A 4UMAA 2X1SA 4MJMA 3DFNA 3BLFA 1T8XA 1O94A 3N14A 4RZ5A 1KTNA 4TIMA 4AVFA 1VC4A 1H5YA 3LRMA 4OBTA 5U7SA 3BW3A 4K7VA 5EMUA 3HG3A 7TIMA 1Q6QA 1W3NA 4M6PA 1M5WA 1YYAA 3NOEA 1H7WA 5LNVA 4OT7A 4O19A 2V81A 1RZMA 3W7CA 2QUTA 1OABA 2NUXA 4DO4A 3CT7A 3HG5A 3S1WA 1W5PA 2R8WA 1OFAA 2FPYA 3L0KA 2P1FA 1RQBA 1XBXA 2DORA 3UD6A 3BVJA 4UTWC 1TPWA 4Y96A 2C1HA 1ICQA 2ZQ0A 3FKKA 3P81A 1VCVA 3L66A 3B8DA 1JR1A 3MI3A 2J6XA 4K7YA 3RK8A 1OFQA 3WFAA 5DXYA 3MYPA 1LRNA 4HPJA 1A5CA 3MHUA 1W0MA 1G6CA 2BTMA 2BWGA 4PFMA 1K8YA 1G4PA 3HGRA 4C1LA 1QR7A 1SO5A 4WY0B 2VFIA 1XXXA 2WO5A 4WJEA 3G1HA 4RKAA 3HPSA 4S1FA 4NT0A 2EPHA 1Z42A 2FJKA 3MBDA 1MSSA 4Y6GA 3CC1A 3PG9A 3LI0A 1SZEA 3TU9A 3PBYA 3QRHA 4UTMA 4H4IA 2WSYA 3W1XA 3LB0A 1W1ZA 1HUVA 3MWAA 4FIRA 4JD4A 3MI2A 1E51A 5EA9A 3LDVA 3LXAA 3EX6A 4JIPA 3NL2A 4QM1A 3TW7A 4NNAA 4ML9A 4Y90A 1EWEA 1HL2A 5F1VA 3EX3A 5EYWA 3L67A 5L9FA 2E5BA 3N9RA 2TPSA 4UIOA 3SR7A 2JKEA 1DV7A 2RKXA 1OYCA 4EF9A 1AW2A 1GVQA 1I2QA 3QJAA 1WA3A 3G1SA 4JTTA 1W56A 4DPQA 1IXOA 3Q94A 4O0KA 3IGUA 4NNCA 2A5HA 4UMBA 1U5JA 5DY3A 1VLIA 4IX0A 4HSOA 3PB2A 1SZGA 3S42A 4UR8A 1TQXA 4PL2A 4O52A 3FEMA 2NX1A 1FCUA 3W75A 1AW5A 5FF3A 3A5FA 2FPTA 4S2CA 5IBXC 4GUFA 4CNOA 4U4MA 2VFDA 1ZALA 4ALDA 4XWUA 4JTSA 1EP3A 1WAUA 3JR2A 3MHGA 1W5MA 5T26A 5DBTA 3ELFA 2EGZA 4UC5A 1KTBA 4AEOA 1XI3A 4IGHA 5HUOA 2V9DA 2ZDRA 2H8XA 3VI2A 1KBJA 3KRZA 4FX8A 1LCOA 3G22A 3NYZA 1D3HA 4FNPA 5AHMA 5BNKA 3D0CA 3G0UA 1JVNA 3P67A 5CPMA 3L65A 3RLVA 1AG1O 2V0TA 5D2VA 3LM7A 2HMCA 1DHPA 1QNVA 2CLEA 2NZLA 4JTJA 1LOLA 1WV2A 1A5AA 3QEZA 3C61A 5G1TA 3FJ6A 5KITA 3I7SA 3QFEA 3K30A 4A2SA 3T44A 3BW4A 1TTIA 5AHNA 4JY9A 3N3MA 3KOFA 4ZQMA 4DELA 1LP6A 1OYBA 4LRSA 2YR1A 1J2WA 1UB3A 2OMAA 3MJYA 3UWYA 3LCWA 4FNSA 3F4WA 4O1BA 4MY9A 2VEMA 3W1LA 4FHAA 3OA3A 1WOBA 1ZJIA 5G2IA 1FY6A 3LBCA 3NQVA 1F2JA 4LW7A 4O17A 1KFBA 3W22A 1DJNA 3PBUA 4LOCA 1TPC1 3L5MA 1VS1A 2XFWA 1ZCOA 3QPYA 3VKJA 1Z41A 1DJQA 2V30A 3NQ7A 1A5SA 1GOXA 4U28A 1NFBA 4DXVA 1FWSA 1ZHAA 3ABSA 4LNYA 3NQ8A 4JTEA 3RFAA 5F2IA 2X1TA 4MY1A 2F84A 3G1FA 4LVGA 2C19A 4O53A 3HF3A 4JX6A 3LCGA 4WOZA 5D2XA 3FA5A 1Q6OA 3TSBA 1X1ZA 2V82A 3M6YA 3MMTA 1OX4B 1SSGA 3DH7A 3HPZA 1YTDA 1B4EA 3L5LA 1DKWA 3IIVA 2P10A 4YLWA 3DKJA 2QCCA 2CLKA 4HNVA 2OCZA 3NQAA 1SSDA 4MVAA 1M7OA 4KWWA 4N4QA 5CPNA 1PL9A 4N9EA 3ZWTA 2CLOA 2C16A 1ZNNA 3W7MA 2GQAA 1XC4A 1FUYA 3W83A 3T78A 3W3OA 4K8EA 3TA6A 1ZY9A 3NPWA 4CLMA 1GVRA 4YCOA 3LLFA 3GXNA 3LHZA 4PL1A 1JCLA 5BOOA 3HGJA 3W1AA 1WBJA 3E12A 5CPLA 3O07A 3LX9A 2ZZ6A 2R91A 3EEGA 3TSMA 3QSRA 3T40A 3GXTA 2ZZ3A 1LOSA 3UWWA 1KFKA 4N9CA 3NQ6A 4YCPA 3UWVA 2RHGA 1I45A 3USBA 3C2OA 3W1UA 2G95A 3C2EA 4NQ1A 1SZNA 5K4ZA 3P82A 1IIHA 1G4TA 4O16A 5HMSA 2WKJA 2XN2A 4UFMA 3M7WA 3PWAA 4OU1A 3TQKA 1PHQA 4ZL1A 3W1RA 4NXKA 4N4PA 4GJ1A 1QO2A 1LDCA 4RJEA 2C14A 1GTHA 1PCKA 3W7LA 4M7SA 3FYPA 2GOUA 4CQ9A 2A4AA 2VFEA 3VE9A 3FS2A 3CHVA 1UBSA 1TJRA 1QPOA 2O7SA 3I65A 3L2IA 3KFTA 1JCYA 4RX0A 5D03A 5AC8A 3B06A 4YL2A 1L6WA 3C6CA 1XKYA 1FXQA 3HJZA 2V2DA 3TMLA 3P60A 1AK5A 1PV8A 1QPNA 2Q3OA 4PH6A 2VOMA 1NAL1 5I3IA 3JS3A 3LLDA 1TREA 5CSSA 4NUWA 3FFSA 3ABRA 5G1YA 1HO1A 1EP2A 3LCFA 1W31A 3GDTA 4FX7A 3U2OA 1TPVA 4LVBA 5FF0A 2JBMA 3E9AA 2AQWA 1I2RA 1OHLA 3LI1A 3W84A 3NQGA 4TU1A 1OFOA 1YDVA 2PRLA 3BK0A 3SZ8A 3TX9A 1LLZA 2D73A 3NM1A 2AGKA 4MYAA 4TX9A 4S2BA 3QM3A 1V7YA 1W8SA 3CEPA 1CW2A 1QO5A 2R94A 2V2CA 3ATZA 5CZSA 2PRHA 1R2RA 3ZFHA 3NZRA 1F6PA 3UQNA 4NZJA 5J5DA 2NXHA 2DZWA 4B5NA 1N7KA 2CLHA 2QCHA 2C13A 3KRUA 3W7DA 3W6YA 1VCFA 3GK0A 2E6FA 3S5NA 4O12A 2EF9A 3L0NA 4LS0A 3NXFA 1JCJA 4Q33A 2Q8ZA 3HG4A 5D33A 3HG2A 3W7KA 4N6EA 3NGJA 3SGUA 3M5ZA 4ZZ9A 4N9DA 2Z6IA 2QJIA 3RLUA 4JTKA 1FDJA 2Y7EA 3M9YA 3IEBA 3EXTA 4O54A 4HN4A 3NDOA 3G0SA 4MZ8A 1YLVA 3W2LA 2DJXA 2BXVA 3HQ1A 3DZ1A 1LZOA 3WJXA 1H63A 4IX2A 3KVMA 2VFFA 3EXSA 3WJZA 4LU0A 5LGXA 1TB3A 1ICPA 2ZBTA 2W0UA 4LY8A 5AN7A 1S5VA 1NSJA 4WUIA 3S8HA 1TTQA 5CPOA 1RVGA 3WK3A 1VQTA 1VLWA 4UFJA 5DY2A 3DFQA 3PULA 4N2YA 3TJXA 1S5TA 3WK1A 4HIBA 1I2PA 5AHEA 1J4EA 4MLJA 4BFAA 4ADTA 5KZEA 3BW2A 4QIUA 3P8JA 4PCFA 4HNUA 3KXQA 3W7EA 3TC7A 1O5KA 1OFBA 2TMDA 2ZRYA 1H61A 1Y0EA 1A50A 2RDUA 3BPWA 1G7UA 4R53A 3MW7A 1NVMA 3LHTA 1UUOA 1KFLA 3NR0A 3R5EA 3VFLA 3L9CA 2FIQA 2A0NA 3GR8A 3LCHA 2Q8LA 2DZVA 3N34A 3TFXA 1SR9A 4AHOA 2WJZA 1GVOA 1X7FA 3DKLA 4WY0A 3CIWA 1GYLA 4IXXA 1JUEA 5HULA 4I9AA 1VYRA 4LWWA 1GZGA 3FKRA 2NUWA 2DZSA 3FIGA 3GDMA 3O63A 1FWWA 3MP4A 1K7XA 1KV5A 1H7OA 1GT8A 4O10A 5FEWA 3NG3A 3M1ZA 2CZDA 1ME9A 4JTIA 5CKSA 5D2YA 4IXHA 1KTCA 1OF6A 1O95A 2GJLA 1KM4A 2QCDB 1WBHA 3GVGA 3PBWA 1KFJA 3E02A 2IQTA 1H50A 4XUGA 1FBAA 2QCEA 2YW4A 1OFRA 3UWQA 4UXDA 3HOJA 1ICSA 3B04A 3B4UA 3GKAA 3V75A 3B0PA 3WK0A 4UMCA 1QCWA 3CTLA 3NPVA 4Z1DA 5I3HA 1V5XA 5BW6A 2E6DA 4AB4A 4CNNA 3TH6A 4NJGA 4D2JA 2NXIA 1WQ5A 4A2RA 5AHFA 1R2SA 1OK6A 3INPA 4YXGA 2FB2A 4QNEA 5D2WA 4IWWA 4HPXA 3R89A 4E2DA 1SW0A 1YTEA 1O5XA 2YCEA 1WX0A 5EY5A 2PCQA 2NX9A 5LNSA 1DL3A 3W2JA 1MXSA 2A7NA 4AWSA 5C5YA 3HGOA 3TAKA 4RXGA 4ADUA 3LRKA 3C52A 3I68A 3DFOA 5LNRA 3LGEA 3GXPA 2WSQA 2RDWA 5AYYA 2VEIA 4O18A 2XN1A 4I7WA 2V2HA 3NPXA 1QOPA 3MP3A 2VFHA 2FTPA 1X1OA 2C18A 3LBMA 4LTSA 2E09A 1XBZA 3EWUA 4PTNA 3R2GA 3G1YA 3ZWSA 1W54A 4JDYA 5I3FA 4HKPA 3LRLA 2B4GA 1BKSA 3MP5A 1SUXA 3S6DA 5G2HA 4M6QA 3GDRA 3SECA 3T55A 1YDOA 4DF2A 1UASA 3TKFA 3H53A 2VELA 1EA0A 4W9TA 5D37A 4AF0B 4MIMA 2Y62A 3TK7A 1F73A 4UFIA 2ZZ1A 5A5WA 3VE7A 2NUYA 1W3IA 2I14A 3IVSA 3W2MA 3GZ3A 4RCXA 4EOUA 1H51A 4KFOA 3BGGA 1TSIA 4TR9A 3T4CA 4GFSA 3O15A 1YXYA 1MEWA 4I7VA 4GUHA 4UTHA 5AYXA 3NQDA 4UR7A 2YW3A 4O1DA 2ALDA 1PCWA 4RK8A 4UTTA 1QFEA 2V5LA 4NX0A 1FCVA 4NU7A 1QPRA 5EL1A 1ZAIA 2C15A 6TIMA 3W71A 3M0ZA 1DBTA 2E6AA 5LGZA 1RR2A 4LS1A 3UNDA 3B03A 3PG8A 3E0IA 4JR5A 4JTGA 3VCRA 2H90A 4M7TA 1FXPA 1FDZA 3TNOA 1S5WA 4CQAA 5CSRA 2Y6ZA 5G2WA 4DO6A 1KM6A 4X9SA 1VHCA 3UXDA 5C54A 1K03A 4R7JA 2Z0IA 3DBPA 1NEYA 6ALDA 3EKZA 5LZLA 4BWLA 4IMEA 2J27A 2UV8G 2QF7A 3L0GA 2VC6A 3QZEA 4FB7A 4LRTA 4RLIA 1AW1A 1R2TA 1GVSA 3VNDA 3B0VC 2WV8A 2ZRWA 3W07A 4IMDA 3EWBX 4EVZA 2QR6A 3PF3A 2ZZ4A 2QDHA 4O50A 3NQ2A 2O7QA 2JKPA 4UFKA 2WOQA 4O4VA 3PUDA 1K02A 2NXGA 3LHVA 1IXQA 4WZHA 1OJXA 3W74A 5H91A 2ZFAA 5HR7A 3CM4A 4K6AA 1KBIA 2QJHA 4PC8A 4UFHA 5FEXA 1LLWA 3O6CA 4R34A 5F4SA 1W37A 4QITA 5HWJA 1SQ7A 4JICA 2TSYA 1OG0A 1TTPA 3PM6A 3FOKA 4BI5A 3P5YA 3NNTA 3G1VA 3UZJA 1G4EA 3P8IA 1QOQA 4TMCA 1H1YA 3BV4A 3H55A 3QMSA 3U8GA 3P80A 1YXDA 1H7PA 3LTSA 3N2MA 3M5XA 4MYXA 3FJLA 3UXAA 1Q6LA 3TUUA 4XKYB 4GUGA 5LHFA 3PSWA 1GG1A 1TCDA 3TV8A 1OF8A 3W88A 4FX6M 3V1PA 3S1XA 4X3ZA 3TMQA 3R13A 1PVNA 3NL3A 4UTJA 1BWLA 1OVDA 1YTKA 2OT1A 3THQA 4E2BA 1L9WA 3E49A 3PUOA 4J9JA 3DENA 2P0OA 3A9IA 3IGSA 4HNNA 1VYPX 3EWWA 3O05A 3W1MA 3UY8A 3S0CA 3Q58A 2PC4A 1PHWA 4M5PA 5HWNA 4UUIA 3C2FA 1NF0A 4O15A 2HSAA 2X1UA 5FESA 4QQ3A 3NPUA 2QDGA 2G97A 2CU0A 4XTIA 4JYFA 1H1ZA 2DZXA 2H3DA 3MI6A 3RNDA 1MO0A 4I7UA 1L6SA 2ATSA 3NQFA 1EB3A 4OHQA 1VR6A 2ISWA 1XBYA 2Y70A 1TV5A 1UCWA 5H2ZA 1M6JA 3A21A 5KZMA 3I6RA 1AL7A 2CLMA 5DBUA 2WPBA 1VYSX 3TW6A 2Y7FA 2I9EA 3R12A 3M5VA 1OX5A 3UY7A 2LLEA 2ZA3A 3P61A 4GC4A 5K4XA 1KM2A 1OFPA 5LSMA 4UNLA 4LC6A 3OVQA 1N8FA 2G96A 2YPIA 2CZFA 1YPFA 2Y89A 4WD0A 4QJ1A 3C2RA 4A21A 4K36A 5FEPA 2Y63A 2WNZA 1P1XA 3QC3A 2FDSA 4MUZA 3YPIA 1OFDA 5BMXA 2YX0A 1YXCA 1KM1A 1ZAJA 5KINA 3CU2A 4IMGA 4FXRA 1QWGA 4Z1BA 4L4LA 2J9YA 2FPVA 5K7JA 4ORMA 3C56A 1HFBA 4DF1A 2ZZ7A 5FI8A 3LHYA 3GKFA 1LYXA 3NVTA 3O8AA 4OWGA 2YFNA 1SFLA 4JN6A 4NJIA 1DQXA 4JX4A 5K9DA 4XBSA 2QUVA 3UPBA 1IXNA 3EX2A 3IRDA 3DGRA 3RMJA 3BGJA 3DI0A 4XZ9A 1OK4A 5SWUA 2C3ZA 1ZENA 3I7QA 1SU5A 1G7VA 3OIXA 4AMAA 1LBFA 1T0OA 1R30A 4X22A 1VCGA 1JRBA 1TO3A 1IXPA 3NL6A 4HNTA 4YMZA 4ZQOA 3W7OA 3QQ0A 5EPDA 3ZR4A 2A1YA 3B05A 3W7IA 2A85A 3WK2A 1L6YA 4QAIA 4JIQA 3GLCA 3IV3A 1W5OA 3HIJA 3SGZA 5C6MA 3PS7A 2HTMA 5D30A 1RQEA 1DQWA 3GX9A 4O13A 2QKFA 2QCDA 2H6RA 3G3DA 1FWTA 2KZHA 1I2NA 3DFSA 1GTEA 3C4UA 4LC8A 1BWKA 4ONVA 3RF9A 3W7QA 1LTDA 3W7RA 1ME8A 1D3GA 4FNUA 3O6DA 4NVTA 3W2KA 3SW6A 3W87A 5F1UA 4ZQCA 5EBUA 2CLIA 2WQPA 2OZ0A 3SJ3A 1MEIA 3EWXA 2A21A 5BMWA 4IJBA 3TAOA 8TIMA 3TQVA 5HWMA 1VPXA 3NA8A 4IMFA 1TRDA 3PBVA 3C3NA 1LRQA 5HJLA 3G0XA 4UFLA 2J24A 1TJPA 1U83A 1TMHA 3NM3A 4KFPA 4O28A 4UTWA 3BARA 3L5AA 1ZAHA 5I3KA 1JCXA 5AB3A 3IIPA 1FX6A 4OE7A 3W76A 4R33A 3G3MA 4IPJA 3N2XA 1TPEA 5FF4A 1EEPA 5DXXA 2J9XA 2TYSA 4LV9A 1QPQA 1ME7A 5AOUA 3DFPA 2YYTA 3E96A 5U4NA 3KVLA 2VKZG 4KWVA 4JTUA 2ZZ5A 1LROA 2Y7DA 4WY0F 4AAJA 1OYAA 4DPPA 3HPXA 4IOTA 1FCQA 4MKNA 5LHEA 3W1TA 1BTMA 3FYOA 1OX6A 4JDBA 1F76A 4DEFA 1DVJA 1HTIA 1DOSA 3OBKA 3QYQA 2ZZ2A 1VZWA 3TE9A 5HINA 5FF2A 1FDYA 3LERA 3IVTA 2GVGA 1CX9A 3NL5A 2E77A 2X2GA 1I2OA 2B7PA 2TRSA 4FNRA 3O6YX 1WYIA 1T96A 4X2RA 4XQ6A 3UWUA 3W7GA 1FCBA 2VEKA 4XBKA 2OT0A 3PY2A 4LUJA 4AF0A 3GAKA 2QAFA 3NQEA 3OVPA 1RV8A 2FFCA 4QNWA 4DBEA 3P74A 3PC0A 4GUIA 1JULA 4CCEA 3CWOX 1DORA 2AAMA 5K3VA 2NX3A 3NO5A 4CQ8A 4TO8A 1EUAA 2GQ9A 1K8ZA 2YDAA 3H54A 1XUZA 4XTDA 5KSWA 1C29A 2ZA1A 1G69A 1TRIA 4EIVA 3UZ5A 1EPXA 4FO4A 2V8ZA 5E1QA 4LVFA 1PE1A 4NZFA 4ADSA 4IUOA 1H7RA 4GNJA 3G1AA 1KM3A 1EUNA 3DU0A 1RQHA 1G67A 4E38A 3A22A 4NJHA 1F74A 3C8FA 1H7XA 3W86A 1KFEA 4BF9A 1ADOA 1XUUA 1MZHA 5CZJA 5IBXA 1WXJA 3FLUA 1K3UA 1SPQA 3W70A 4UTKA 1KV8A 3BG9A 3OG3A 2ZRXA 4AWTA 3W9ZA 3M41A 4MZYA 2QCGA 4FEZA 3HO8A 4Q32A 5E0KA 2E5DA 2YGYA 5L6UA 4DBDA 4UNKA 2BZNA 4MZ1A 3OEXA 2QUUA 5F2MA 1EWDA 4WX2A 4AH7A 5FEZA 2J9ZA 2YXGA 4M6VA 4P61A 4JYDA 1ZFJA 2OX1A 3TQ0A 3TIMA 3BLIA 1CI1A 4HSNA 3GAYA 3PB0A 3LTYA 3OVRA 5D2TA 4DF0A 5HUPA 3LHWA 1SO4A 2ZRVA 5G4EA 3ATYA 5AHIA 1Q45A 4E0CA 2B7QA 5D05A 2QJGA 3I7RA 3NEVA 1THFD 4NJKA 4H6KA 1H60A 5MHBA 1QAPA 3KHJA 1HG3A 1NF7A 4O4WA 1SO3A 4WXYA 2W6RA 4Z0SA 1KM5A 3GDLA 4K8HA 4FXSA 3STGA 2F7FA 3F4NA 2QCNA 1JQXA 1HO4A 2Y88A 1FWRA 4Z08A 4RZ4A 2Y7GA 4PODA 3THAA 3L21A 3PR2A 2PE4A 3EX4A 3TROA 4K39A 3BLEA 3A23A 4A3UA 3EXRA 2ATMA 3QW4B 1P5BA 1GG0A 1JJKA 1GEQA 5AC7A 2YSWA 4XKYA 3CEUA 2E68A 3W2UA 1YPIA 2ZCGA 2ZYFA 3OHIA 3GYEA 5D04C 4JX5A 4K38A 1LBLA 4YWIA 5K2ZA 3L68A 3LCLA 3DXIA 2A7RA 3SSJA 2X16A 4M19A 4L4MA 1Z44A 3N73A 1A53A 1W3TA 5FF7A 5D38A 1QMLA 1OX4A 3IVUA 3TR2A 3B0UX 5F2LA 4BI7A 1VJIA 1H7NA 1MEHA 4LS2A 4HHPA 1A5BA 4ZQPA 4LT9A 3DHDA 2H3BA 1T99A 3GNNA 2GJNA 3M44A 2OJPA 4OV9A 1X6UA 2VENA 3LTPA 4JTFA 1KFCA 4LUIA 2GUUA 4CNPA 4ZQNA 2EHHA 1F05A 1OFEA 3DI1A 4JGDA 3SFKA 3LOTA 2I1OA 2ISSA 3M16A 2Z1BA 4JTLA 1O60A 2WNQA 3PSVA 2RFGA 4O11A 3TXZA 5CZ0A 3MHFA 4P2VA 1TQJA 1GWJA 5DCBA 4JEQA 1R46A 4AXKA 2ZRUA 1JRCA 4Y8FA 2WSRA 2J88A 4MFDA 3JRKA 4OQVA 1SZFA 5CZTA 4G1KA 2Z6JA 3M5YA 3S9YA 1LBMA 3EKLA 4O0ZA 2JGQA 2ISVA 5AHLA 1WOAA 3W1PA 2A6NA 3SIZA 2JK2A 3UWZA 1VGAA 4IPIA 1C9DA 4UTUA 5HR6A 1TYGA 1VHNA 1W5QA 2RH9A 3W73A 3M47A 1VRDA 4MPQA 3MBFA 4LVDA 5TBOA 1SFJA 2CWNA 4WQ6A 2FB3A 2B0MA 4IQLA 4WXZA 1IF2A 4HT3A 1LOQA 5DCDA 1RPXA 3QSTA 3S5YA 3LV6A 1TPDA 4IMCA 4DO5A 3PAJA 2GQ8A 2W79A 5C55A 4UTIA 4EWND 2ABBA 3T7VA 4JXCA 3SY5A 3LV5A 4JYEA 4UTTC 3C2VA 3ZS4A 4MOZA 3LXBA 3TC6A 2GVJA 2JGYA 3QQ1A 1GYNA 2DU2A 5K9XA 5C2XA 2ZTKA 3KVKA 1J5TA 2PRMA 3KRSA 1QDSA 1UJPA 4JY8A 3IIZA 1UUMA 3ABQA 2DJLA 3HGSA 3QMRA 1FQ0A 2B7OA 3GIYA 1BEUA 1LRTA 2JKAA 4ZQRA 4PEKA 4FF7A 3LXCA 2Y85A 1TPFA 1F6KA 2VFGA 3G1XA 2NWRA 3KAOA 5CGQA 3U6WA 5D32A 4BWLC 1TV8A 2CLLA 3SI9A 3GNDA 2A7PA 4QISA 1KM0A 4NX5A 2EAWA 1GQNA 3N9SA 3WJWA 3R8RA 5K9CA 2NLIA 4AWUA 3W85A 1KW1A 4QSHA 4WOQA 5EKYA 2EKCA 3O06A 3CPRA 1TTJA 3LCXA 2VEPA 4OV4A 1ONRA 4POCA 5AYZA 3ANYA 4GRSA 1KLYA 4TMBA 1Q6RA 1L2UA 3QF0A 5E93A 2ZA2A 4NJJA 4LV4A 3CB8A 2V5BA 4ICNA 3CWNA 4JTHA 1XCFA 4N9BA 2YYUA 3GDKA 3S5ZA 3TFCA 4FNQA 3NQMA 3G24A 5F4XA 5DCEA 5TIMA 1KLZA 2Q3RA 1GPWA 4ZVJA 1TPH1 2A6LA 4C1KA 2B7NA 2QCMA 4MFEA 2Z2UA 2NV2A 1TPB1 3W7PA 2CLFA 1IGSA 4AHQA 1KA9F 3EWZA 3TXVA 3S1VA 2A2IA 4O1CA 2CZ5A 2GPTA 2QEZA 4K37A 1SW7A 3EB2A 4O8RA 4RXFA 3DAQA 3LCIA 4BR1A 2X30A 3W72A 2CW6A 1R47A 3CIXA 2WNNA 1C8VA 4O1AA 2FQIA 4GWEA 1EX5A 1XL9A 4CCCA 3EX1A 4MY8A 2X1RA 3A5VA 3M43A 4CCDA 4DQWA 5KZDA 3W1QA 3W7NA 3P84A 4BI6A 3MO7A 5LNWA 4UCGA 1XDLA 3W7JA 2R14A 4A29A 3P5ZA 3QMTA 1P0KA 3TSDA 5LKYA 1JUKA 2H8ZA 5LNUA 4FIQA 1JUBA 3QPZA 4GXMA 4N6FA 1H62A 4JS3A 1PS9A 3O1NA 5KTLA 1B57A 5TQLA 1XBVA 2QCFA 4Z1AA 1K7EA 4FNTA 3KX6A 4UTLA 1AL8A 1PIIA 1G4SA 3F03K 1EIXA 3TJLA 1JCNA 1VH7A 1ALDA 3Q37A 2Y61A 1TPUA 2CFFA 3DHFA 4NNBA 1XDMA 3N19B 1K8XA 1GVFA 5IM51 3WJSA 3STEA 1XFBA 1GJPA 1YADA 3BG5A 3NQCA 4O14A 1D9EA 4EF8A 3GR7A 4ORIA 5G5IA 3Q2DA 2FLIA 3GB6A 2DP3A 2E5CA 1S3HA 5AC6A 3S1UA 3G8EA 3BO9A 2BLEA 1B9BA 1FWNA 1F7BA 3W1NA 3ABOA 2YZRA 1B3OA 5F2GA 1JCMP 1EP1A 2DZUA 3C0JA 3TDFA 2DZTA 4Z1CA 3IIOA 3HBLA 2GVLA 3UPWA 2HS8A 3CQ0A 1W5NA 3IIXA 3P7YA 5D09A 3NAVA 1JQVA 4Q4KA 1P0NA 4N02A 3UYCA 4GUJA 2NV1A 3WJYA 3F1QA 5HQEA 3PUEA 1AMKA 2ZRZA 5GVJA 2C0AA 3HB9A 3CLMA 4O57A 4RZ6A 4KKXA 1TIMA 3EWYA 5I3JA 3QH2A 3KVJA 1P4CA 4ZMGA 3AO0A 3W7HA 4Y9AA 1B4KA 3DFTA 3QW3A 1TV7A 1ML1A 2C6QA 4Z0JA 3W2NA 3MUXA 5AFDA 4AHPA 3G8RA 1LORA 5D02A 2DZPA 4PA8A 3RU6A 3AJXA 2E1DA 2E6YA 1RD5A 2NWSA 4GBUA 1X8FA 2YFOA 5A8GA 4KFNA 4LVAA 2BX7A 3BG3A 1YDNA 4MLRA 4MJZA 1I8JA 4BK9A 4H3DA 2XN0A 4RR4A 2QAPA 5BRBA 2CZEA 4OGZA 1K7FA 5DLCA 5CG7A 3STFA 5F4WA 3LHUA 4RV8A 1SW3A 5HNRA 3G18A 3P62A 4JNMA 1WDWA 2ABAA 1IIGA 2RDTA 3TCEA 1Q3NA 1XM3A 1N55A 2HS6A 4A22A 5KMYA 4GE8A 2BSLA 5ABTA 1O4UA 2ZTJA 1Z48A 1M7PA 4NXSA 2PURA 3MYOA
chains in the Genus database with same CATH superfamily
1ELSA 2YBUA 3APGA 3STCA 5ECVA 1LM1A 5G4WA 4ROPA 1ESWA 2VX7A 4F0RA 3FV9A 1R6WA 1SO6A 3S5OA 3PVFA 3A24A 2DFAA 2X1SA 3NJ3A 3U5UA 3DFNA 4PBEA 3N14A 1KTNA 2XH7A 1K9FA 3AZRA 4ROQA 1H5YA 1I1XA 3CL8A 2XVLA 3BW3A 4K7VA 7XIMA 5C7HA 5B7ZA 1GOIA 4XD6A 4JL2A 1EQPA 3NOEA 2V5DA 3WDJA 1RZMA 4HVXA 3KTXA 3WLJA 2QUTA 3M0MA 1OABA 2NUXA 4KWSA 4XAGA 4DO4A 1F3WA 1A47A 3S1WA 2CNCA 2FPYA 2FH6A 4NY2A 4S39A 2P1FA 2AAAA 1RQBA 4H6QA 1XBXA 4PCPA 1TPWA 3QTGA 4JTDA 1QUMA 3EB4A 5C9ZA 1Q2RA 1B3XA 3I6EA 3P81A 3L66A 5CC6A 4M0XA 3MI3A 3GXMA 3RK8A 3SEPA 1OFQA 5DXYA 1LRNA 1TWDA 1W0MA 5HATA 2BTMA 2WZEA 1G4PA 4DWSB 3WG6A 2G37A 3BXWA 4NAEB 3HGRA 3NTYA 1QR7A 1SO5A 5GNZA 4RKAA 1JF5A 3HPSA 3ZSTA 2EPHA 2FJKA 3MBDA 2CCRA 3CC1A 4E2OA 1YNQA 4Q7BA 3GC5A 4H19A 4H4IA 3ARPA 3UEQA 3LB0A 2FZMA 1OT1A 1HUVA 1UWSA 1ONWA 2YXXA 4FIRA 3GG0A 3MI2A 2X7VA 5EA9A 4PN2A 3EX6A 3P14A 1AFSA 1M01A 4AD1A 4J3SA 3NL2A 4NNAA 1V7AA 3UR8A 4J27A 5EYWA 3L67A 4PTDA 4AZHA 3V5FA 1J12A 1XH0A 2Q01A 4MNJA 1OYCA 4EF9A 3AS3A 1GVQA 5BROA 4G5DA 1W56A 1CB7B 3LEPA 4DPQA 5LXEA 3Q94A 1U5JA 4MNKA 3B8IA 2CHOA 1X7IA 4IX0A 4OIFA 1Y5WA 4B4HA 1SJDA 3FEMA 4PTWA 1AW5A 5FF3A 4Z1YA 4S2CA 1IR2A 4QG8A 4GUFA 4CNOA 1Y65A 4DO7A 4U4MA 3ARRA 1ZALA 1EP3A 1WAUA 3CIVA 2GK1A 5DBTA 3ELFA 4GO9A 2ACQA 4AEOA 1WO2A 1PSCA 4S3AA 4ZOEA 5LIWX 2V9DA 4Q8OA 2WVVA 3VI2A 1KBJA 1EXBA 3KBSA 3NYZA 5EMYA 3QLLA 5BNKA 2GFTA 3D0CA 4KH2A 4P5UA 1JVNA 3P67A 3RLVA 1AG1O 4R7WA 2HEJA 1SJAA 3DG3A 4ZFCA 3NSMA 1UR0A 1ZP3A 2XDFA 1WV2A 3QEZA 1GHSA 3LM3A 5G1TA 3K30A 2W66A 3T44A 1TTIA 3QY6A 4D1IA 4X0VA 1TE1A 1CXLA 3TTOA 1ISVA 3MMUA 2YR1A 1E9ZB 3LLXA 4AYSA 4H8VA 3F4WA 3VIFA 1UPMB 3W1LA 1MW0A 2IPWA 3UA4A 1WOBA 2QMJA 5G2IA 1XH1A 1RAKA 4H41A 4O17A 1XRVA 4DYEA 3L5MA 3GR4A 3ZIZA 3QPYA 3WLSA 3CHFA 3Q45A 4V15A 3IACA 3CAWA 1JDCA 2PA6A 1A5SA 3KM8A 4U28A 1EL3A 1NFBA 1K70A 4DXVA 2GJXB 1FWSA 1ZHAA 3ABSA 2VUYA 3RFAA 5F2IA 1CWYA 2X1TA 2DT1A 4P8WA 2F84A 2O56A 3G1FA 1TWZA 4E4PA 2BVWA 3HF3A 1U1UA 4JX6A 5D2XA 4ZE5A 4JL1A 3M6YA 3CH0A 3MMTA 1WXZA 3BAJA 1DKWA 2P10A 1KBLA 2VZTA 3DKJA 3PTDA 2OCZA 4C1NA 2YCLB 2WHJA 1BG9A 3CUFA 2PWFA 1FUYA 3URBA 4R85A 3NPWA 3RRAA 2Y8VA 1LLOA 1Z6KA 1HKKA 3S5SA 5BOOA 3HGJA 1HJSA 1XLHA 6PTDA 1FFRA 5FL0A 3O07A 3H4GA 1NWUA 2E0PA 2R91A 3KBVA 1V02A 4LXFA 2PWHA 3T40A 3SCRA 3RR4A 1KFKA 2XWEA 2NQHA 4YS1A 1REQA 1R3TA 3USBA 6CGTA 2G95A 3C2EA 4NQ1A 3EMCA 1G4TA 4NRRA 4O16A 3WF1A 1K77A 4HA4A 4CUCA 1TUFA 1PHQA 1AQHA 4W4QA 1QO2A 4IISA 1LDCA 1UC4A 2C14A 3VE9A 1EHNA 3DDMA 3GG7A 3CHVA 1VFMA 3TTQA 4I9MA 1JCYA 1Q5MA 3B06A 4YL2A 3MC5A 4XD5A 4RPQA 3HJZA 2V2DA 4IP4A 4DBWA 4CU7A 2PDWA 3P60A 1KXQA 5TF0A 2E7FA 3FW6A 4XVDA 5AC5A 5I3IA 2OPJA 4NUWA 4U2ZA 2ZIDA 3ZO9A 4YWSA 2AQOA 3C0QA 3U2OA 3B0XA 3F2DA 1H3GA 3T07A 4Q4SA 2AQWA 2PWDA 1OHLA 1E0VA 3NQGA 4TU1A 5CPQA 1OFOA 3KP0A 1NFGA 4IG2B 3TX9A 4U2YA 4YVPA 2D73A 3LGGA 3NM1A 4B5XA 2YL5A 4K3ZA 2WZTA 3CEPA 7REQB 1ZBKA 5CZSA 2PRHA 1R2RA 1UWTA 3ZFHA 4U31A 3ZLGA 2NXHA 3WD0A 4JFWA 2ZUWA 1M9HA 4C5ZA 5FD0A 1VCFA 3L0NA 3NXFA 1JCJA 1VEPA 1RVKA 4XBJA 5BU9A 3SGUA 3ITTA 4IMAA 4ZZ9A 1GKRA 4JTKA 1UZ4A 4JFUA 1F3EA 4I8DA 1JDDA 3G0SA 4AZCB 3ONCA 2C1IA 1Z7AA 4AIOA 3HQ1A 2PLCA 2WMHA 2WC4A 4H9XA 1H63A 4IX2A 4C6IA 1NWTA 3EXSA 3WJZA 2ACUA 1XYBA 3ME3A 1PKNA 2W0UA 5AN7A 1V0NA 1NQKA 1RVGA 1VQTA 3IJQA 1S5TA 4LCSA 3A13A 4M81A 3SUUA 4BFAA 3VDCA 3P8JA 3KTCA 4PCFA 3WLKX 2J7DA 4RDYA 2RDUA 1G7UA 4AWEA 3PANA 3MW7A 1NVMA 2P8CA 3WUGA 3R5EA 4MB1A 3VFLA 3VDBA 1EYWA 3FN9A 3L9CA 3DYOA 1VFHA 2A0NA 3GR8A 2VYOA 4PUWA 2Y8KA 3IUHA 3SO7A 2YA2A 1SR9A 2MUCA 4AHOA 1PKLA 1GVOA 4MB5A 1X7FA 2JQXA 4WY0A 1UD4A 1NDVA 2AMXA 3BJSA 3MUY1 5HULA 2WMIB 1BAGA 4I9AA 5IOBA 1VYRA 1VENA 4QDMA 4GKTA 3FKRA 2DZBA 1FHVA 1FWWA 1BYCA 2EKGA 1CLVA 1K7XA 3CZ8A 2OWWA 3H7RA 4EAMA 1H7OA 2ZVRA 5FEWA 2PGEA 1XJBA 3M1ZA 3ZVHB 3CMJA 1XRFA 4IXHA 1KTCA 1OF6A 3PBWA 1KRBC 3E02A 2IQTA 3GUGA 2QIWA 1Q8AA 3ARWA 1FBAA 1XLLA 3GFXA 5CXPA 1V6UA 4XX6A 5E6ZA 4KIEA 3WK0A 4KT2A 1BKHA 4A05A 4WKAA 1F4AA 4CNNA 3B8SA 3TH6A 4ACZB 3UG8A 4D2JA 4DAIA 3N15A 2DV0A 3EZ4A 3INPA 2FB2A 1V3JA 4JN7A 3PPCA 4JPGA 5A95A 4HPXA 4E2DA 2ZUSA 4LSBA 1SW0A 4BHYA 2P88A 2YCEA 1RCQA 2VVNA 2J6VA 2PCQA 2V68A 5LNSA 3T2OA 1JZ6A 4QCEA 3HGOA 4UQBA 2WANA 4RXGA 4ADUA 3CO8A 3I68A 3DFOA 3GXPA 2WSQA 1OM0A 1EZ2A 2RDWA 2YDSA 4G7FA 5AYYA 4RV3A 4O18A 5DMNA 4OUIA 4JQ3A 3MP3A 3ZYZA 2VFHA 4PB3A 2C18A 2E09A 5BOEA 4M56A 3KUMA 1XCXA 3ZWSA 4JDYA 5TD4A 1R38A 5H6HA 3QR0A 2F2HA 1DHKA 3KOWA 4M6QA 4DF2A 2MANA 4ASTA 3TVAA 4GIEA 3TK7A 1PZ1A 4MTVA 2WMGA 1EO5A 4UQ9A 1W3IA 4EOUA 3GZ3A 4NZ3A 4J5NA 1Q13A 3TLLA 5BXRA 4W7WA 2J7EA 1TA3A 3T4CA 4GFSA 3GTHA 2VEFA 1VBUA 5HDRA 3GDBA 1XV8A 1EJ7L 2CERA 2NQLA 2YW3A 4DYJA 2ALDA 1C93A 1DP0A 4WDXA 1PCWA 1B1YA 1QFEA 1V08A 3WQ6A 4NX0A 1FCVA 1C7SA 3TOPA 1ZAIA 2C15A 3W71A 1QRQA 3GY1A 3ORWA 1BRLB 4JR5A 4KQNA 4ZFMA 3TNOA 1S5WA 5CSRA 5IFPA 2DY3A 5A2BA 1IWAA 5G2WA 1RBLA 5A6AA 4DJDD 1WDDA 1SZRA 2ZUMA 4R7JA 6ALDA 3WQCA 3EKZA 3OHMB 3ICJA 3WDQA 2J27A 1S2UA 3EA3A 4MWAA 4GI4A 2D2GA 1E6RA 2PWEA 2Z1KA 1AW1A 4RLIA 1GYMA 3C3UA 2QUNA 2HJPA 4AEEA 2QR6A 4EVZA 2HBVA 2QDHA 4UOZA 1MW1A 1VBRA 2O7QA 2JKPA 4Y7EA 4UFKA 1VFFA 1S2WA 2NXGA 1QNQA 1OJXA 3VNKA 2ZFAA 3CQKA 4I3GA 4K6AA 4C6EA 4UFHA 3IWPA 4QITA 3P0WA 2G41A 3H7UA 5T91A 1TTPA 3PM6A 1XIJA 3PZUA 4BI5A 3P5YA 3NNTA 1G4EA 3P8IA 1OEPA 4TMCA 1B9ZA 3H2NA 3LTSA 4MYXA 2JIWA 3FJLA 4XKYB 1MDRA 2REQA 3ITOA 1TCDA 1OF8A 3W88A 3V1PA 2C71A 1UP0A 5GNXA 2PTYA 1BWLA 1GQIA 3H22A 1V3IA 5LIXX 3I4KA 1L9WA 3TYEA 4GINA 4J9JA 3DENA 2P0OA 3WUBA 3IGSA 4C7DA 4MB4A 3ARQA 1S2AA 2EJAA 3FY1A 2BBFA 2ON3A 3RX4A 3DHPA 2OQYA 3AUOA 4O15A 2OX4A 4QQ3A 3WD4A 5A94A 1FKXA 2BY2A 2DZXA 2H3DA 3PZQA 1W9VA 4I7UA 1QNSA 3G6LA 3L23A 1W2VA 1XBYA 1UCWA 2PU0A 2J75A 5T9BG 5KZMA 1PO9A 3XIMA 3NDZA 4REQA 2Y7FA 3R12A 1BYAA 2ZA3A 3P61A 2GVEA 3VZZA 2YPIA 3THDA 4WD0A 4QJ1A 3OVGA 1OCQA 2CXEA 4A21A 1W1PA 3T8QA 2Y63A 4KBXA 1P1XA 4MUZA 1OFDA 3KRBA 2DH2A 3WQWA 2YX0A 3AU6A 1EBHA 1FWHC 1XGDA 2OB3A 1ZAJA 1HIZA 3ZOAA 1WZKA 4FXRA 4TUFA 1QWGA 3UVAA 4Z1BA 1CT5A 1Y7VA 1FOBA 3C56A 1T5AA 2ZZ7A 3IRSA 3LHYA 3GKFA 4GXPA 3NZGA 2IKGA 4AX7A 2QS8A 5E9AA 2YFNA 4QTGA 1DQXA 3KBWA 3RYSA 3WFLA 1DIDA 2C3ZA 4LCRA 4GIAA 1YE6A 3I7QA 1Z3NA 4E3VA 1BGGA 1US3A 3BWWA 1TO3A 2POZA 2R6OA 1M1BA 4KF1A 1S5NA 2BY3A 3NL6A 3MQTA 5EFDA 3W7OA 2D24A 5EPDA 1EC8A 3B05A 4R5EA 3W7IA 4QAIA 3PZGA 2GUBA 2Z28A 4JIQA 4HZ8A 4F3HA 1JZ5A 1NTHA 3HIJA 2VX5A 3PS7A 1DQWA 1EYEA 4O13A 2QKFA 2J79A 2QCDA 3G3DA 5LA0A 3VIIA 1I2NA 3U3HA 1JEZA 1ZP4A 3I3EA 3WEMA 4WJXA 5FJPA 1RBAA 3GVWA 1W32A 2GL5A 3W7RA 2D22A 4NVTA 3RN6A 1KCKA 3W2KA 3R79A 4H9UA 4CNUA 5DO8A 2CLIA 2FHCA 4FR1A 1ZLPA 4GHRA 3UF9A 2OZ0A 3K8LA 3MZNA 3T05A 5BMWA 5A8OA 4IJBA 4R3UA 1UWRA 3TQVA 4LYKA 2YLAA 3B9NA 3OQEA 4IMFA 1TRDA 3PBVA 3C3NA 4AD0A 1O68A 3MY9A 3H2EA 4L6OA 3R7MA 3GH7A 4GQQA 4EWJA 4US5A 4UZUA 1E55A 4DJEA 4MG4A 1TJPA 1F3XA 3E2QA 1OQFA 4M51A 4UTWA 1ZAHA 5AB3A 3NEHA 1EF2A 3E0LA 3W76A 3G3MA 3N2XA 5FF4A 2FZNA 4LV9A 3UCDA 3E96A 4AD5A 2BVDA 3KVLA 4KWVA 4JTUA 4IIBA 3MVTA 1LROA 3GBDA 3T2PA 4AAJA 4DPPA 1H0IA 1UYQA 5BRQA 4WKHA 1Q7ZA 4JHMA 3W1TA 1BTMA 1UP3A 3D3AA 1HTIA 1DOSA 2GQ3A 3TE9A 5HINA 1FDYA 2BOEX 2B81A 3IVTA 3NL5A 1QNOA 5A69A 1QT1A 2OQHA 4ES4A 1WYIA 1T96A 3S2CA 4OFCA 3W7GA 1FCBA 4XBKA 1JXKA 4LUJA 3GAKA 4BEQA 2PLJA 3UCCA 1UJQA 1RV8A 1P43A 1P0BA 3CWOX 1UWUA 2DSKA 2AAMA 4NIRA 1YRRA 4C6KA 3VIHA 2PTZA 2NX3A 2FGZA 4CQCA 2A3AA 3B9AA 4NILA 1E6XM 2XSXA 4KETA 1K8ZA 3WELA 4S3KA 3DN5A 2V3FA 2CPUA 1KD0A 1TRIA 1W2PA 4EIVA 1B5TA 3UZ5A 4PRWA 4FO4A 2V8ZA 1SFTA 3ANUA 4HHLA 1PE1A 3EKGA 4ADSA 1W3HA 4QQUA 4B2DA 4M80A 1KM3A 5CBBA 1JPMA 5GPRA 1VP5A 2JE8A 2PGFA 3W86A 4P7OA 5BU6A 2XFRA 2J25A 1BGAA 4MZYA 3HO8A 4Q32A 3P0XA 4DBDA 4UNKA 3SQMA 2P3EA 5E0FA 2J8GA 3AYSA 4FLOA 4P61A 1OY0A 4TXEA 3VUSA 2XGBA 4HSNA 1A80A 2C0HA 3GAYA 4HP5A 5C9RA 2O4MA 3L4UA 3QV7A 4QEHA 1GVEA 3WBXA 2VEGA 2ZRVA 4B3KA 4E0CA 4KRZA 4H2CA 1OGGA 2QJGA 2R82A 3KL5A 2VNCA 2XH0A 3BAXA 3CHEA 1R9YA 3KHJA 3VMPA 4WXYA 2WLZA 3TYUA 4Z0SA 4DVOA 2F7FA 5G1MA 1JQXA 4GMEA 1VKFA 3URAA 4E6MA 3PR2A 4LQ1A 2PE4A 5RUBA 3BLEA 3A23A 1RJRA 3PWGA 3CK5A 2WZIA 2AL2B 1CLKA 3BOFA 3N2BA 3T0AA 1YPIA 3VOCA 3GYEA 3NZPA 2NT0A 4ZR8A 4ZSTA 3CQIA 4JX5A 3DXIA 3SSJA 1HVXA 2X2YA 3BMXA 4OZOA 3SCPA 3VGEA 2ZC1A 2WWCA 5REQB 3C0SA 3E5BA 5F2LA 3FDGA 1JFXA 5FAGA 1VB9A 4BI7A 3NO1A 1R3YA 1R3RA 2Z27A 3HZ3A 1H1NA 4ZQPA 4B16A 3P93A 3BLKA 1OC6A 3PZMA 1LJYA 2H3BA 1IZKA 1T99A 2WK2A 3MPGA 3GNNA 2VCCA 1ZBVA 2VENA 4G56A 3LTPA 3KWXA 4BCEA 3CV6A 4CNPA 4HU3A 2WHLA 3WLIA 2Q09A 2CHNA 3AIVA 3ZR5A 3OZMA 4JGDA 4DRSA 2W63A 2O4QA 3LOTA 1EFZA 1LT7A 4NZ4A 3ZQ9A 2RFGA 4IJCA 3WY1A 1AD4A 5HMFA 5CZ0A 1B3YA 4U33A 1GWJA 1R7OA 3V3WA 4BY3A 4JEQA 2W91A 4AXKA 2ZRUA 1KB3A 1KQYA 3M0JA 3VNYA 4EAYA 2J88A 1KBKA 1SZFA 5BRPA 5BYWA 1RPKA 3EKLA 2ISVA 4JIRA 3WQEA 1CXKA 3W1PA 1KC7A 4C6QA 3SIZA 1QU4A 3UWZA 1C9DA 4UTUA 3E38A 3M0KA 1W5QA 3O7UA 2V67A 4WDUA 5H1WA 3BLDA 5TBOA 2CWNA 5BZAA 1GK8A 4WXZA 4HT3A 3K4WA 1DTUA 4C6OA 2P3ZA 3WMSA 3AAMA 2VZSA 3BAKA 4JXCA 3NXLA 3RXZA 4Q6XA 3AI0A 5DT7A 3K5XA 3BC9A 3GIPA 4YN5A 3MVIA 5C2XA 1IT7A 1DWGM 4WKFA 3KVKA 3QY8A 1UJPA 1V77A 1FH9A 1FWJC 2IKHA 1JPHA 3S9ZA 3ABQA 3SBFA 1QI3A 2EEXA 4PEKA 1CNVA 2Y85A 3LXCA 1TPFA 1LL7A 1PWLA 2BG5A 4V1YA 2A3LA 2WC7A 4P8XA 2PWVA 5D32A 4HYWA 1T40A 1TUXA 3R0KA 4U3AA 1TV8A 5A6BA 2XSAA 2VZOA 1RP9A 2A7PA 4MWAC 4QISA 3F5JA 1UD2A 3LN3A 1RY8A 3W02A 1TTJA 1TR1A 2VEPA 4ICCX 3GXIA 3PP7A 4U10A 5AYZA 1NU5A 1LL4A 4IH3A 3TYAA 3QF0A 3IV8A 3RM9A 5AZ0A 2NW0A 3CB8A 2V5BA 4DWDA 4A35A 4ICNA 1VFLA 2OO0A 3S2MA 3WENA 4QG9A 2WVSA 4N9BA 1NELA 3S5ZA 4PUEA 5I09A 1KWKA 3TFCA 3BQ6A 2H9AA 4Q8VA 3PPFA 1R3WA 1WCGA 3MANA 3BLPX 5TIMA 2Q3RA 3M64A 4ZVJA 1D2KA 4LUSB 5A2AA 1QNRA 2WAGA 4F66A 2B7NA 2QCMA 4JTQA 1TPB1 3W7PA 3R1ZA 2A79A 1W1TA 5C9WA 4AHQA 3EWZA 1NOFA 1SVDA 3H12A 4DX3A 2CZ5A 2GPTA 4LAZA 2QEZA 4K37A 1SW7A 3EB2A 3DAQA 3LCIA 4J4KA 1VBHA 2D3LA 1EJXC 4L6HA 1CECA 3EX1A 1QBAA 3W1QA 5LNWA 4L64A 3W7JA 2R14A 1SFSA 1W1IE 3P5ZA 4GC3A 4HMNA 1UIOA 3PZOA 3U4FA 4GXMA 1MUCA 5TQLA 1XBVA 4Z1AA 1K7EA 1XSIA 4L80A 3WD1A 5KZ6A 1WDQA 3PBMA 4M82A 3F03K 4OBSA 1QJWA 1ALDA 4B9YA 5M1TA 2VVSA 2Z1SA 3DHFA 4CQBA 4S38A 5IM51 2HCVA 1YADA 1UW9A 2XWDA 3GR7A 5G5IA 4HTBA 2FLIA 1LQ2A 3ZR6A 4QG6A 5AC6A 2BLEA 4RPPA 1B9BA 3ABOA 2WZMA 1B3OA 1B0IA 5F2GA 1I0BA 2PD5A 3K2GA 2DZTA 1MUWA 3IIOA 4Z1CA 2C8NA 3ZZ1A 3EA2A 5D09A 3NAVA 1PX4A 2F6UA 1WB0A 4DHGA 3CT2A 4GUJA 2NV1A 3WJYA 4CN1A 3TYDA 2HVNA 1AMKA 1XIEA 3CLMA 2FTYA 3QH2A 3W7HA 1UMLA 3UXLA 3DFTA 2W67A 4AZ6A 5FCZA 2C6QA 4AVOA 1SGJA 3W2NA 5AFDA 3G8RA 3LY0A 2DZPA 3RU6A 3UBPC 3ZVIA 3LS9A 4G8TA 3TOYA 3AHZA 2YFOA 1PZ3A 2FZ9A 3VMNA 2XN0A 2QAPA 1GQJA 5BRBA 5I78A 1NIUA 2VURA 3STFA 3ZT6A 3QKZA 5HNRA 1DPMA 1XIGA 4JNMA 4MB3A 1ZS2A 1WDWA 1IIGA 1KR1A 2Y2WA 3K4AA 3M0LA 1W1VA 3AXHA 2ZTJA 5BXTA 1CGTA 4NXSA 2Y0FA 3VU2A 4LAOA 4L1WA 3S46A 3MYOA 2EJ1A 3PUGA 1I4NA 3GZAA 3O16A 5DANA 3W38A 2QCLA 5I3GA 2XHYA 3BANA 5J5RA 3WBAA 4UMAA 3DYPA 3PTMA 3BLFA 1T8XA 4TIMA 4KPLA 2DDXA 2VUNA 5JVLA 4C6LA 1Q6QA 1JD7A 3AISA 3E2VA 4M6PA 1M5WA 3DHUA 4AEFA 1QI0A 3SAZA 3KE0A 2G8ZA 4O19A 3W7CA 2ACRA 4A8LA 4YTTA 2PDKA 5MKGA 4FAMA 3CT7A 4IIGA 3BAIA 1W17A 3S4TA 1E4MM 2R8WA 4DJEC 5CGMA 1OFAA 4UTWC 5I0DA 3TTYA 3UT0A 5AKQA 1J01A 3VYLA 3CV7A 2J6XA 3HA1A 5DRIA 2VX6A 1A5CA 1E0XA 3B40A 3MHUA 5IXEA 4JTRA 1PAMA 2BWGA 4PFMA 1K8YA 1PTDA 3WLNA 4FK9A 4PMXA 1GKPA 1WZAA 3MSYA 4NYUA 4RZBA 2WO5A 3G1HA 3EPNA 3KOXA 1LUCA 4NT0A 4S1FA 1XC6A 4HK6A 1V6YA 3A3WA 3PG9A 3VD7A 3QFWA 1IEXA 3TU9A 1ONXA 3PBYA 3QRHA 4UTMA 3AMGA 1XRTA 4ZTXA 3OO2A 4F0LA 1ITCA 2Z26A 1WUFA 2VRKA 1R85A 1AJ2A 2DH3A 1E51A 3W0KA 3M0VA 5HNNA 3T0DA 4QM1A 4ML9A 1FTXA 1EGMA 2OLSA 3HQOA 5F1VA 7CGTA 1LL6A 3GU1A 3N9RA 4R9XA 4UIOA 2QXWA 2YDRA 1NDWA 3QHMA 3IUIA 1AW2A 4J3XA 3QJAA 3H2AA 1WA3A 3G1SA 4JTTA 3ZSSA 1YIXA 1KXTA 2PLMA 3GNRA 4O0KA 4NNCA 4X63A 1VLIA 4HSOA 3PB2A 3S42A 4C6CA 4UR8A 1KGUA 2CEQA 4A8RA 4JAWA 1JD9A 1FCUA 4B91A 1OCJA 1KCXA 3A5FA 1IZCA 3SRFA 4ALDA 4XWUA 4ERAA 3AWNA 3JR2A 1W5MA 1TG7A 5T26A 4BQ4A 4AYGA 3VUPA 4GBDA 4C90A 3W27A 2AMGA 5HUOA 2ZDRA 3WX7A 3UVIA 4FX8A 1E70M 2GGJA 1LCOA 3U2EA 4FNPA 5A2CA 1H2JA 3RX3A 2B31A 2XVKA 1AH3A 3G0UA 1EBGA 1TFVA 3LM7A 1DHPA 4JTJA 1A5AA 3C61A 4L6DA 2FJUB 5KITA 3SCTA 1FHUA 4A2SA 4E5TA 3SUWA 4JY9A 3N3MA 6XIAA 4LALA 4ATWA 3A4XA 3UZYA 4Z17A 3ENLA 3BV7A 1MVYA 2OMAA 4L56A 4MPKA 2QPXA 4O1BA 4PMRA 2V6AA 3OA3A 2IUZA 4H7CA 3TN4A 3NQVA 1F2JA 5B7YA 2DSUA 4LOCA 4LYPA 1ZCOA 2VP8A 4XISA 1YQ2A 2HXTA 4GNVA 3VKJA 3SDOA 3V7PA 4ZCWA 1DJQA 3NQ7A 4WIWA 1ZUAX 1RCXB 2WXDM 2WCGA 3NQ8A 2FKPA 4WOZA 3K46A 3FA5A 1CLXA 3TSBA 2D2JA 2V82A 3TZFA 1SSGA 4IHCA 4EXQA 4EK7A 3QHOA 3ALFA 3V5OA 1W1B1 2QLYA 5LIUX 4I5UA 4HNVA 3NQAA 1SSDA 4MVAA 1M7OA 3AIEA 3GU2A 4IPPA 5CPNA 4LANA 3SRKA 1PL9A 4N9EA 3SCNA 3L4WA 2C16A 3I3DA 4IL0A 3VOIA 3T78A 1V6VA 4K8EA 3BOXA 3ITVA 3TA6A 1ZY9A 4RNIA 1RXOB 3VIGA 4C6BA 1KWGA 2I17A 2VD8A 3RCYA 1E3XA 1X6NA 1YPXA 4CKQA 2C1GA 4PL1A 2VGGA 2VRQA 4GX8A 4GYKA 4KRUA 3KTSA 2BS9A 5IDZA 3WDHA 3P6LA 4ZTYA 4OJYA 1PBGA 3HJEA 1LOSA 4W8AA 3UWWA 4JZ5A 4N9CA 1TIWA 3NQ6A 2DZAA 4NF7A 1QXLA 4CU8A 1VBGA 1I45A 4GISA 4HMEA 2GUYA 3W1UA 1SZNA 3UWEA 1IIHA 5A8MA 2XN2A 3M7WA 2I56A 3TQKA 3W1RA 3QR3A 4NXKA 3CV1A 3QXBA 3N12A 4GJ1A 1G01A 1GTHA 1UPPA 1X6LA 1U2YA 4M7SA 3FS2A 1BF6A 4A6GA 1UBSA 2CZVA 3I65A 4EKJA 3R4IA 4MJ4A 4RX0A 1PX3A 4XUYA 4YVVA 3JUGA 3LGDA 4DUVA 4PYSA 3SUSA 4ENLA 1NAL1 1NH6A 3JS3A 3CMFA 1JPDX 3B9OA 4HZ7A 2ZX8A 1EP2A 4XSLA 2RJHA 4FX7A 3SM0A 1TPVA 2WJEA 4NP7A 4CNSA 5FF0A 2G3MA 3N4AA 5DRCA 3POCA 1MMFA 2O9OA 3W84A 1FH8A 1JPIA 4KGJA 1Q8JA 3BK0A 3LYEA 1G1YA 4CNTA 3WF2A 3CL7A 5DX7A 3QM3A 4TX8A 3WEZA 3E0WA 2V2CA 1KR0A 1QO5A 2Y5EA 1H11A 3LD5A 4A3QA 2DZWA 3EDFA 4B5NA 5IRPA 3KCOA 4GACA 4RNJA 1QK2A 3W7DA 4AY8A 3K8MA 2E6FA 4O12A 1XLMA 3VNMA 4GD0A 4XAYA 5JBFA 4N6EA 2BY0A 1A4MA 2I57A 4Q8PA 2QJIA 3RLUA 4U5KA 1EJUC 3WQDA 3M9YA 4O54A 3IEBA 3VKCA 1CGWA 1YLVA 2DJXA 2BXVA 7A3HA 1GZJA 1LZOA 3KHDA 1E1CB 2P50A 4LU0A 3DIPA 3GTNA 1MNSA 1DJIA 5JH2A 1TB3A 1WKYA 4CQDA 4WUIA 3AMLA 3RPTA 3MZ2A 3WN6A 1O6IA 3DFQA 4N2YA 4H8UA 4GI8A 4HIBA 1X97A 3ARUA 1J4EA 2PTWA 4MLJA 2ACSA 4JKKA 1S46A 1XGZA 1OWQA 1W9DM 2ZRYA 1H61A 2WBKA 1O1ZA 1I0DA 3BPWA 3AIRA 1UUOA 1NP0A 3BCFA 3MSDA 3NR0A 2QHAA 3W4RA 4Q22A 3GE7A 2FIQA 2W92A 3R11A 2Q8LA 3GSMA 1KCZA 2OEMA 4I90A 3TFXA 4GG9A 3OQ8A 4C6JA 3CIWA 3MCMA 3N2CA 3SQLA 4IXXA 1RHCA 5I23A 3R94A 3S1GA 1HKJA 3UGVA 5BXSA 1GZGA 3UG5A 2NUWA 1PJ9A 3CZKA 3FIGA 2W5FA 3O63A 1XISA 4YJ5A 3MKKA 3KBMA 1WE5A 2WSKA 1B3VA 4O10A 1GPFA 4PUUA 3WL0A 2CZDA 5CPSA 1CXEA 3GVGA 2XFFA 2ZKMX 4D71A 1NOWA 2I7GA 3M46A 5M5DA 5A6JA 3TCSA 1OFRA 4LUTA 4ZO9A 4PB5A 3B0PA 4RE3A 3CBWA 1JDAA 9XIAA 4Z1DA 1B90A 1UD3A 2PS2A 4AQLA 4PTVA 3IJ9A 4NJGA 1CB2A 3AYVA 1XLFA 4EACA 2VGFA 4A2RA 2J7FA 4H6EA 3NVDA 4QNEA 2PFHA 4IWWA 4D6HA 2YB4A 1U1HA 3R89A 4HA0A 3EOLA 3S83A 5EY5A 5EMKA 2WC3A 1TX0A 3RLGA 2CYGA 3W2JA 1QI4A 1W1A1 2PGWA 5C5YA 1HJQA 1D7FA 1Q85A 4JHZA 3TAKA 4QLJA 1MRAA 2VMFA 5LNRA 3LGEA 1VIWA 3AZTA 1LT8A 3HURA 4F79A 4Z42C 5IFTA 2FGLA 3BCJA 2ALRA 1X1OA 4W89A 3LBMA 4LTSA 7ODCA 2VGIA 3FDKA 1W54A 2OKOA 4XAZA 4XVEA 1OCBA 4HKPA 1HVQA 3PZVA 2B4GA 1BKSA 1EXPA 3ERPA 1BHGA 5I24A 3SECA 3VNLA 3HMCA 4C6FA 1UASA 3TKFA 3CGTA 4W9TA 1EA0A 2XFYA 1BF2A 4AF0B 4MIMA 3FSTA 2ZWZA 1B2YA 4UFIA 3NIYA 1J5SA 3VE7A 4Q8UA 2QPSA 2NUYA 1HN1A 2E28A 3IVSA 4RCXA 2HVOA 4KFOA 3BGGA 1TSIA 2PDMA 3SN0A 4INFA 4YTSA 1XDJA 2WCSA 4I7VA 1MEWA 4YTRA 3WDRA 5A6SA 4UTHA 1U5HA 5AYXA 3NQDA 4UR7A 1V93A 7TAAA 2QULA 4QR6A 2V5LA 3WBYA 1S2TA 3Q65A 1JZ2A 1ZTVA 4PE8A 2OGYA 1AH4A 4ML4A 1RR2A 1GEHA 3N2OA 2DW6A 3B03A 1ISZA 2YIHA 3E0IA 3PG8A 3KOZA 2YZ5A 2QUMA 5DT5A 2CXGA 1FXPA 4M7TA 4CQAA 2V38A 1KM6A 1EJWC 3TN6A 2VDIA 1TZ9A 3DC8A 3QZAA 4X0NA 1XICA 4BWLA 3OODA 3L4XA 4W84A 2PF8A 3LG3A 3QZEA 3CUGA 1Z8AA 3STPA 1GVSA 3SCUA 2WKLA 1EPVA 2WV8A 3WLQA 3W07A 4IMDA 4YNGA 3TA9A 2ZZ4A 3W26A 4YHEA 3R8HA 3GHTA 4J2PA 4O4VA 1CBGA 3LHVA 2BOGX 3AOFA 1AQMA 2XIIA 1PZ2A 4KIRA 4AD4A 4HOXA 4H83A 2HNHA 5FEXA 3UJSA 1P6BA 4FOKA 1R87A 2WW5A 4R34A 2NQJA 1SQ7A 4I5RA 2PI6A 1A0CA 1XSKA 2XVPA 4MHBA 2WB5A 1DXFA 4LUSA 4RDZA 3KDNA 5HQMA 3EA1A 2OR2A 3G1VA 5CJ5A 5I79A 1VJZA 1QOQA 3IUDA 1H1YA 3H55A 3QMSA 3P80A 3B9DA 4QEEA 3BZJA 3N2MA 4ILSA 2PDHA 1V0KA 2Y4SA 1ZJAA 3TUUA 3PSWA 3XINA 1Y5VA 1Z32X 3KBNA 5I2UA 2YKKA 2IKIA 1DIOA 4AU0A 1PVNA 3APYA 1ONEA 2HV5A 2OT1A 4E2BA 5CAKA 3E49A 4G7EA 3FHQA 1UKQA 3A9IA 4CD4A 3C2YA 4KERA 3EWWA 4WEVX 3Q58A 2OELA 1UKSA 2OO6A 5HWNA 2X1UA 5FESA 2CKRA 2QDGA 2JEPA 4JYFA 3S3GA 3OG2A 2YBVA 3RNDA 3ITYA 4OHQA 2Y70A 1TV5A 5H2ZA 4HOZA 3A21A 3EB3A 4K1GA 3I6RA 3CUZA 2HBXA 2CLMA 1H49A 3PWIA 4B3ZA 1XQLA 2V3GA 3PJWA 3U48A 1ISXA 3M5VA 4M8UA 2LLEA 3BICA 3HV8A 4LC6A 1N8FA 3MMWA 5C71A 2CZFA 1BQGA 1YPFA 3SUTA 4B15A 3MS8A 3FXGA 2GLKA 5FEPA 1ISWA 2WNZA 1ENUA 2GJPA 4QXIA 2Y5JA 3CHDA 2KAUC 1YKWA 3BOLA 5BMXA 3R0DA 5H8UA 4AIUA 4AY1A 3GUWA 1YXCA 1GUVA 3BSMA 4HNCA 4UZSA 3CQJA 2E25A 4ORMA 4QRNA 3AIQA 1HFBA 4DUOA 1GQLA 4KEMA 2VC7A 2R1PA 3H4WA 2VD9A 1UMYA 4PULA 4JN6A 4JX4A 1ZJHA 1AJ0A 3UJFA 2PGRA 2J77A 3UPBA 5AYIA 1XIMA 1IXNA 4HA1A 2F9RA 1HXJA 4J3WA 2CITA 4PFHA 4XZ9A 1XCWA 2DT0A 3OGVA 4X2PA 3OIXA 1T0OA 1JYWA 1R30A 3NURA 1AZ1A 1IXPA 1JZ7A 3GO2A 3N13A 3QQ0A 2A1YA 2C79A 3GLCA 3IV3A 1W5OA 2QJJA 1Q65A 2HTMA 4R9OA 4DY1A 1RQEA 3IJIA 1FWTA 3DFSA 1QI5A 1P0EA 3KS5A 4PSRA 1BWKA 3GBEA 3RF9A 3NCOA 3W7QA 1XYCA 1LTDA 1D3GA 4FNUA 3O6DA 2VJXA 1QI2A 3W87A 3VC5A 2WQPA 4PCNA 2ONEA 3ITXA 2YLLA 2VT0A 3OLIA 4PMDA 1VPXA 3N04A 3NA8A 4UQCA 3RCMA 4GJIA 1KBBA 2INEA 4UFLA 1UOZA 2J24A 1UQYA 1HL8A 4KGLA 2OSWA 4DBSA 4J35A 4E3TA 3L5AA 1JCXA 2FHFA 1FX6A 1E1FA 4OE7A 2BB0A 4IPJA 1C8XA 2QJNA 1TPEA 1EEPA 2EPMX 5DXXA 3LMYA 3DFPA 5U4NA 3S47A 4NRSA 2Y7DA 1MXDA 4HU4A 1E73M 4W86A 3S2NA 3LPPA 1FCQA 4NAFA 5LHEA 4GVGA 5EMMA 1ITUA 1P7TA 3RJXA 3FX4A 1V0LA 3QYQA 1JCTA 3LERA 2OODA 2GVGA 1XLIA 4L65A 4PMVA 5FL1A 3WF3A 3ARZA 2X2GA 3VABA 3O6YX 4F4RA 4HNOA 2OT0A 2OVLA 4PRRA 3NQEA 2QAFA 4D8LA 3PTKA 2OOGA 1E6NA 5GJMA 3PC0A 4XD4A 5JU6A 4JFTA 4CCEA 3VK5A 3H21A 3QVQA 1DORA 4C6PA 1TJ0A 5JUVA 1V02E 5JIWA 1E15A 2GQ9A 1QW9A 2YJQA 1J2BA 1XUZA 3KDOA 4XTDA 1C29A 3H26A 5CG0A 5KSWA 1RLDA 1G69A 2XYLA 3H2CA 5HAOA 4WSHA 3GTXA 5ABFA 9CGTA 4IUOA 1H7RA 4GNJA 2D0FA 3G1AA 1E6QM 1EUNA 2YOCA 1G67A 3RPMA 3C8FA 3IS4A 1NM9A 4GZEA 3AICA 1K3UA 3NWRA 4UTKA 1QW7A 4US6A 3OG3A 4AWTA 3UXIA 3MV11 5E0KA 2E5DA 1L2QA 4S23A 5L6UA 3OGRA 3SQSA 3L12A 4Y9NA 3DBNA 2PP3A 2QUUA 2UY2A 5I03A 2Q02A 4WX2A 2PTDA 1QHOA 4HU8A 3U2ZA 4HN8A 4NHVA 1F61A 1S5MA 1Q6FA 2ZUVA 1TV2A 4HA3A 2GWNA 1KXHA 3TQ0A 4J40A 2WMKA 5JMUA 3TIMA 4FLRA 3SCWA 1WP6A 1DWJM 3PB0A 1E56A 3OVRA 4DF0A 4GGBA 3A4WA 5HUPA 4B2DD 3VOFA 5G4EA 4KESA 3ATYA 3MA8A 4Q8MA 1TCMA 2B7QA 4A8NA 4F9DA 3NEVA 4DJDA 1A3XA 1V51A 4LBRA 4H6KA 1C8QA 4V2XA 5MHBA 1QAPA 1QPKA 1NF7A 4KCUA 2O9RA 1KRAC 1KM5A 3GDLA 4K8HA 4Z2LA 3RM8A 3STGA 3F4NA 5JBEA 1HO4A 1FWRA 4Z08A 4RZ4A 4B5UA 3THAA 4PCTA 2VDGA 1SM9A 4TX6A 3WBWA 4A3UA 1E4LA 4HPGA 3B8VA 2ATMA 4IICA 1P5BA 1GEQA 1WDSA 3EBVA 1K9TA 2YSWA 4XKMA 1E6PA 2ZCGA 2ZYFA 4UNIA 4V28A 3TTEA 1YNPA 4DUWA 2VRJA 3H2MA 4ATDA 1LBLA 2J7HA 3LCLA 4D6CA 4M19A 4HSHA 1Z44A 1A53A 4Y9MA 1QMLA 5HJXA 3TLQA 1OSEA 2BOFX 3TR2A 1JGMA 1VJIA 1H7NA 1MEHA 4CD6A 4JIEA 1A5BA 1K1DA 3GRIA 3WLPA 3FA3A 4LT9A 5FJJA 1LG1A 3UU0A 5CEWA 4OV9A 3UCQA 1F05A 1OFEA 1K6AA 4CN4A 1ECEA 3SSZA 5IHRA 4JKLA 2ISSA 4JTLA 2P8BA 4GI9A 3PSVA 3TXZA 2PWGA 4P2VA 4D6EA 2YA0A 1JRCA 3VIJA 2XM2A 4MFDA 3JRKA 4A3RA 3RUBL 1WKDA 3UJEA 4LB3A 2JGQA 5AHLA 1Q63A 3AXKA 4IL2A 3W25A 3WNMA 1XIBA 2JK2A 4D72A 4H1ZA 2AL1A 4PUKA 4UOJA 4HBKA 3W73A 1G9HA 3M47A 3MBFA 4LVDA 1A4LA 1SFJA 4WQ6A 2B0MA 2V5JA 3ZT7A 4MNMA 2HVMA 3UR5A 1OT2A 3QSTA 4H7VA 3WIJA 3LV6A 3M0YA 2PDNA 4EWND 3LA4A 5M03A 2ABBA 3OTRA 1TMQA 3SY5A 4GOAA 3S2JA 3K8KA 3HU7A 3WLLA 3ZS4A 3AXIA 4MOZA 3LXBA 3QQ1A 5JBDA 5K9XA 1UKTA 4I8YA 1UKOA 3KRSA 1QDSA 1JZ3A 3IIZA 1UUMA 3VIMA 3PNUA 2DJLA 3BGAA 4L4PA 3N18A 3K4DA 3EDDA 3T6CA 3QGVA 1POJA 2GK1B 4S3EA 2JF6A 1GW9A 1ZZMA 2XM1A 4BWLC 2CLLA 3GNDA 2GDUA 1KM0A 4TOQA 1GQNA 3N9SA 2NLIA 3VA8A 4QSHA 5EKYA 1FVPA 4F40A 3CPRA 4UCFA 4ERIA 3LCXA 4POCA 4HJWA 4DI9A 4HJFA 3WZ0E 3T2QA 5E93A 2G3NA 4JFVA 2RGLA 4C91A 1AH0A 3MU7A 4BJHA 4ZXLA 2J13A 1V8EA 2BGQA 1FWCC 5DCEA 1KLZA 1Y8BA 2NSOA 4C1KA 4LAMA 1EA9C 2ISDA 3GHUA 2Z2UA 2NV2A 3BDKA 4Z2KA 1UBPC 4GQBA 1IGSA 1EJTC 4PUMA 1BPLB 2I5GA 2A2IA 1GOKA 5HMDA 4IGMA 2ZXBA 3QYSA 1R47A 2DEPA 1C8VA 4O1AA 2FQIA 3THUA 3TYZA 4IP5A 3CXOA 1TE6A 3C5QA 1FWGC 3BMVA 1A3HA 3W7NA 2ZOXA 3MO7A 1W9BM 4A29A 3M7SA 4MWAE 1P0KA 1OG6A 1FWFC 4L1GA 1JUKA 1DWHM 2H8ZA 3IJ8A 3WLRA 5LNUA 4W93A 1JUBA 4N6FA 1HQTA 1W9XA 3F2BA 1PS9A 3O1NA 2QCFA 4FNTA 4C1NB 2NQ5A 3KX6A 4UTLA 1RD6A 1F07A 2VR4A 1B30A 5I00A 1TVPA 1EIXA 2WSPA 1JCNA 1A5LC 1FWIC 1CENA 1TPUA 4NNBA 1XDMA 1K8XA 2A3HA 5H8MA 3WJSA 4AXNA 3PFMA 2YL8A 4UQDA 2R1NA 3PJXA 2V5KA 1D9EA 4GX9A 3CMGA 1FWBC 3GB6A 5HBFA 5CH9A 4BKNA 3BO9A 1FWNA 1F7BA 2NQ9A 4W85A 1REQB 4HZ6A 3MUAA 5D4YA 1K9DA 2GVLA 2PMQA 3CQ0A 2DQWA 2AKZA 3WMLA 2X0YA 3UYCA 4L4OA 3PJTA 1F3TA 5JH1A 3URNA 4L1XA 3BQ5A 4H01A 2ZRZA 1CGXA 1XYAA 2PODA 1OGBA 1GORA 3E1F1 5GVJA 3HB9A 1RALA 4BQ5A 5C9UA 4O57A 4GLEA 3EWYA 2EPNA 3M4HA 1P4CA 5CGTA 4IPNB 1TV7A 3M6DA 4MUPA 4LYQA 4TQTA 2VX4A 4IJRA 5HPOA 1V3MA 4X61A 1RD5A 1B3ZA 1PIGA 4GBUA 1OD0A 4DUXA 4KWUA 4I5XA 4LVAA 1E0UA 4J28A 4QDWA 4O8AA 1EGVA 4R88A 1OC5A 3ITLA 4GVFA 3K13A 3LHUA 4RV8A 2G4JA 3WNNA 1RY0A 2ABAA 2RDTA 3TCEA 1Q3NA 4A22A 1N55A 5KMYA 1M53A 3B97A 5CC3A 1V6WA 2BSLA 4F0SA 1O4UA 4WK9A 4DI8A 2WQDA 1J96A 5I3DA 5E09A 2ZXQA 2PURA 2GGEA 4ZO8A 3CTTA 5XINA 3G1DA 3W23A 5DN1A 3NZ1A 1UROA 2G5WA 1MI3A 2Y8UA 3U4AA 4NL1A 5DELA 5FACA 3V0SA 1UG6A 4HCLA 3HMJG 3DYMA 4PBFA 3VIKA 2L5HA 2E4TA 4GQGA 3DX5A 4GPNA 1IT8A 3N2TA 4IZGA 4AVFA 1VC4A 2VQTA 4MDPA 3LRMA 5BXPA 4OBTA 5EMUA 3FCPA 3HG3A 2Y1HA 1RJQA 1MW3A 1KXVA 1X8CA 4O1EA 2X40A 4Y8EA 1TKKA 5LNVA 3G1RA 5HANA 3U2CA 2PPGA 2V81A 1CXIA 2X7WA 4EX4A 4C7GA 3NQBA 3GVRA 4AG0A 2OZ8A 3AIUA 3TJ4A 3HG5A 5CBJA 1W5PA 3LPOA 3OPSA 2DORA 1B54A 1WZMA 4Y96A 2QMKA 3VD9A 2HE8A 1ICQA 1PIFA 2ZQ0A 3FKKA 3GHSA 1Q6DA 4XZIA 3CNYA 1KGWA 2WHMA 4HPJA 2TODA 1G6CA 3D46A 4H04A 4F0MA 4C1LA 4QROA 4WY0B 2VFIA 3L2MA 1VPQA 4D6DA 1LWJA 5EMJA 2ASHA 3OJGA 1MSSA 3LI0A 1SZEA 1UWAA 2NSXA 2E67A 3VXGA 2PD9A 2I5QA 1EOKA 2FVMA 4Q8QA 3SJNA 2EXOA 3RITA 3LDVA 1OIFA 4KEVA 3LXAA 2VR2A 1J11A 4EXBA 4JIPA 4IQDA 3CUHA 3TW7A 4Y90A 1BTCA 1HL2A 1E9LA 3GW0A 5FJRA 3EWDA 3EX3A 4HU0A 2E5BA 1V6TA 2TPSA 4DXKA 3SR7A 1CYGA 5LIKX 4S3FA 1B31A 1DV7A 3GVVA 1D3CA 2Z2BA 3B8UA 2RKXA 3LZ5A 1I2QA 1JL8A 1IXOA 3AMKA 3IGUA 4IGSA 5DY3A 1SZGA 1TQXA 2NX1A 2QJMA 4M6UA 3VIPA 1DIKA 3W75A 1JPKA 4GY1A 1XQKA 1GW1A 1XD0A 2VC5A 3PN8A 3POHA 2FPTA 1EC7A 3ZJKA 5EU9A 3VNZA 1TJ1A 4JTSA 3MHGA 4JCMA 3WUEA 3RILA 5E70A 1ZJBA 1XI3A 4IGHA 4AIEA 2QVHA 2X42A 3VGDA 5AHMA 1D3HA 2GWGA 5A8PA 3DFHA 2E9MA 3VZYA 3GYCA 2J78A 1AJZA 3WMBA 4ZE4A 2V0TA 2CLEA 2NZLA 1E0TA 1LOLA 3QC0A 4QFUA 3I7SA 1OC7A 2Q71A 3OZPA 3BW4A 4LY4A 1PWMA 2J4GA 3KLLA 2Z1VA 4ZQMA 4WGHA 3E74A 1LP6A 4JCLA 2DUZA 2OXNA 3DEQA 4HHMA 4W7VA 1EDGA 4P7LA 4MJ2A 4DJDC 1V6XA 1KRCC 4QJ3B 5I7GA 3UWYA 3LCWA 4FNSA 2ZX7A 1EGZA 4MY9A 3SGGA 2XH2A 1TA3B 4FHAA 5J04A 3II1A 4P7NA 3LBCA 4GKLA 2A3EA 3W22A 1VS1A 1XPYA 2IXUA 3RO8A 4JBRA 2XVNA 1YBQA 2V30A 4Y2WA 5LXXA 3C86A 3N25A 4H9MA 2QIIA 4LNYA 2NQZA 4JTEA 4N7QA 4W5UA 4MY1A 5CLWA 4LVGA 3VVGA 1I9CB 4O53A 1Q6OA 5I07A 1OX4B 3HPZA 1YTDA 1I75A 3CV2A 1RJPA 3L5LA 3IIVA 4LF1A 1S3TC 4NZCA 2QCCA 4CVUA 1R3VA 4KWWA 4EE9A 4X9YA 2GQAA 1XC4A 2BHZA 4Q8TA 3W3OA 3W53A 1X96A 5DFAA 4CLMA 2R1MA 4GVIA 3LLFA 2J47A 1PTGA 4YU1A 2BGNE 2DIEA 4LYRA 1BD0A 3SY8A 5BCAA 3MWCA 1A49A 2W62A 3CYVA 1ZBWA 1WBJA 4KRTA 3E12A 4KEZA 5CPLA 3BJTA 3OA5A 2ZZ6A 4RE2A 3EEGA 3TSMA 3QSRA 3TP4A 3GXTA 2DGAA 2ZZ3A 3IJLA 1J8VA 2YCJA 3SN4A 5HJYA 3UWVA 2FDMA 3P3BA 4BA0A 3AS0A 3MSGA 3VM7A 4ICMA 1U1JA 4RDVA 2E9BA 2GOKA 3PWAA 4ZL1A 3CUXA 4JQ4A 4FMVA 1J9YA 3QTPA 3TW9A 3N6QA 4RJEA 2UY4A 1PCKA 3W7LA 1J18A 4QHRA 1Q2SA 2GOUA 2A4AA 2VFEA 1EJVC 4AZIA 1DJZA 1TJRA 4KS0A 5M2FX 2O7SA 1XH2A 1E0WA 5FJTA 2UY5A 1IEWA 2UZ9A 5D03A 5AC8A 3AJ7A 3C6CA 2REQB 2VDHA 1XKYA 1DJYA 1CTNA 3I4EA 3FNDA 5DMLA 2Q3OA 4PH6A 4IIDA 4XO7A 2QGYA 4Q4PA 3PHAA 1LQ0A 2HE5A 4GNKB 3FFSA 3ABRA 1HO1A 3TJIA 2X0HA 1W31A 4M1RA 4Q4RA 4LVBA 2JBMA 3E9AA 3LI1A 1J0KA 1BWVA 4TTUA 2CIPA 4H7ZA 2FYMA 2VO5A 4LPCA 5LYRA 2PRLA 4D9PA 2QPUA 4U5IA 2AGKA 4MYAA 4S2BA 1MFVA 1O66A 2R94A 3VCNA 1F6PA 4NZJA 9XIMA 2CLHA 1NWSA 3KRUA 2D2HA 4IFKA 4REQB 4GY7A 3GK0A 4HMCA 4K68A 3S5NA 2EF9A 4LS0A 4QX4A 4Q33A 3HG4A 3W7KA 5D33A 3HG2A 5I06A 3DFYA 4F0HA 4N9DA 2Z6IA 1FDJA 3GS6A 3SB0A 1DQUA 4IIFA 2Y7EA 3EXTA 4H00A 5HQLA 1JYXA 3QGKC 3WUFA 3GXFA 3LK6A 3NDOA 3AXXA 1MRQA 4MZ8A 3W2LA 2QW5A 1SYTA 4GIYA 3WJXA 3MSRA 5AY7A 2OYMA 1ZGDA 3T9PA 5LGXA 4AZBA 1ICPA 2ZBTA 3N3TA 1EDQA 1VBJA 1NSJA 2AGTA 1TTQA 3S8HA 5CPOA 5DY2A 3PULA 3TJXA 3WK1A 2GSEA 1I2PA 3W28A 4GH1A 3IGHX 5KZEA 3TEVA 2D2OA 4WDTA 3SFWA 4HNUA 3R25A 3A64A 1ZBCA 1M7JA 3W7EA 1HW6A 1US0A 4R53A 4Q7IA 3LHTA 1XFCA 1KO0A 5CAHA 2PEVA 3OYZA 3LCHA 1F4HA 4DWSA 2DZVA 3N34A 4NAEA 1GYLA 4B5WA 4WHBA 4LWWA 3FK4A 5EMLA 2O9PA 2DZSA 4I6KA 4AZ5A 3KEHA 2ZX9A 3MP4A 3EWCA 1D8WA 1S1PA 1KV5A 3UA3A 4Z2HA 1ME9A 3OZYA 4JTIA 5CKSA 5D2YA 1KM4A 2QCDB 1KFJA 1HKVA 1HX0A 2FZ8A 2UWFA 4Q4OA 4XUGA 2YW4A 1U30A 1S39A 3UWQA 4UXDA 5GQBA 1ICSA 3GKAA 1MQQA 2PDJA 3T8LA 4NSBA 1QCWA 4DAFA 5I3HA 5BW6A 4EXAA 1WAWA 4K8GA 3L2LA 4CCZA 1NWRA 3UR7A 4RL3A 1E40A 1UD8A 1WQ5A 4XAFA 2UBPC 3LNMA 3ZXWA 5AHFA 1R2SA 3IJ7A 1OK6A 4YXGA 2OZTA 3CWHA 1L6GA 3VKDA 4GK8A 2WWDA 3GHRA 4MKSA 5CJNA 1YTEA 1O5XA 1N82A 1WX0A 2NX9A 3WQOA 4OOUA 2HXUA 1MXSA 2A7NA 4AWSA 4TTGA 3PZIA 3LRKA 3C52A 3BAWA 4P7QA 1FRBA 4XZHA 2OEKA 4PUDA 1MWOA 1XX1A 4I7WA 3NPXA 1QOPA 3VKAA 1UZ1A 5T9CE 3FAXA 4XZBA 3DERA 3EWUA 1GONA 1E1EA 3FSUA 1CEOA 3G1YA 8CGTA 2BP1A 2YCIX 1AZ2A 2FHBA 3LRLA 2DPEA 3MP5A 1SUXA 2ZXAA 3GDRA 3T55A 1YDOA 4DZIA 1JXJA 2VELA 3ID7A 1CGVA 4NASA 2Y62A 3W37A 2CBUA 2HWGA 4PCSA 4HCHA 4QS5A 2I14A 2PF0A 3W2MA 1H51A 4C6DA 4Y9PA 4FA3A 3N4FA 3QOKA 1DXEA 1PPIA 3TWAA 1ZCCA 3OLGA 2XG9A 1P0DA 2VCAA 3KCLA 3NO3A 3VIOA 1BSLA 4RK8A 4TV6A 4UTTA 4PEEA 3MUCA 5AYBA 2GSHA 4NU7A 2D0GA 2XINA 2Y24A 2PU1A 2E6AA 4H9ZA 3WQPA 5LGZA 2GJXA 2VWTA 4LS1A 4F2UA 1IR1A 2X09A 4H9VA 3VCRA 1ZSXA 2H90A 3ARXA 4OKDA 5A6MA 1PYFA 2WHKA 2Y6ZA 3CYJA 4DO6A 1IEVA 1B3WA 3UXDA 4NZ5A 3DBPA 1NOUA 4KWOA 1XHGA 4QP0A 3V4BA 2YCLA 2UV8G 4LRTA 1R2TA 2PDPA 3N1AA 3WDIA 5D9NA 1FFQA 2FGBA 3RHGA 2XPKA 3VNDA 2ZRWA 3EWBX 4DLMA 3PF3A 3NQ2A 4YYCA 3PUDA 3K1GA 1IXQA 4WZHA 3W74A 1POKA 4GQRA 5H91A 3VNJA 1KBIA 3VMOA 2JF7A 4LGXA 3OBAA 3O6CA 4MM1A 1MNZA 3BJFA 1OINA 4MKVA 5DQPA 1W37A 3BURA 4QE5A 4JICA 3PPHA 3IK2A 4LF2A 2ADAA 2TSYA 3HPAA 1KKOA 1OG0A 1G0CA 4XAPA 5AZ1A 2CESA 4DB7A 3UZJA 5AVHA 1XG3A 4AZ7A 1M65A 1YXDA 4GCXA 1H7PA 3PTQA