4GUFA

1.5 angstrom crystal structure of the salmonella enterica 3-dehydroquinate dehydratase (arod) e86a mutant
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
260
structure length
252
Chain Sequence
ENLYFQSNAMKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKAGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVISVADLRTVLTILHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 3-dehydroquinate dehydratase
publication title Reassessing the type I dehydroquinate dehydratase catalytic triad: Kinetic and structural studies of Glu86 mutants.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 93
structure length 252
sequence length 260
chains with identical sequence B
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4gufA00
1HO4A 3LRLA 4IXXA 5D33A 2CLEA 3M47A 2NXGA 3EX2A 3HB9A 4Q4KA 2E5CA 3W1QA 3LTSA 4HPJA 2J88A 3TSDA 3UZ5A 1TYGA 4LT9A 4X3ZA 3KVMA 5D05A 1KM1A 2YCEA 1QPOA 1KV5A 3BVJA 4LVAA 1UUMA 2TSYA 4WOQA 2V2DA 3NL2A 3DU0A 4GUHA 3W85A 1W37A 5F2GA 1LCOA 1VRDA 1RQBA 1NAL1 3TKFA 4Z1BA 3W7QA 1WYIA 2X1RA 1S5VA 5I3JA 1GYNA 4UFJA 4O12A 3A22A 3TIMA 3LGEA 3Q37A 5AHIA 3USBA 1JQVA 3GK0A 5ABTA 5HWNA 4JY8A 2C6QA 3GR8A 1VHCA 2NUYA 6ALDA 5U4NA 3W71A 3P8IA 5U7SA 3M0ZA 1K8XA 4TO8A 3RMJA 4OGZA 4EF9A 4XTIA 2EKCA 4MY9A 2ZA1A 2QCNA 3F4NA 4AWTA 3INPA 4BI6A 1A50A 3DFNA 3QSRA 4TX9A 4BWLA 1SFJA 4IMFA 3W7NA 4UFIA 3NEVA 3LLFA 1XDMA 4NJIA 4UTKA 5DBUA 4JTIA 2Z0IA 3BGGA 4BI5A 1A5BA 1FUYA 3GKAA 3G18A 2QJIA 3EX4A 5LNSA 2ZA2A 2FPVA 4P2VA 4DF0A 4NU7A 4JN6A 5F1VA 1YXYA 2VXNA 3CTLA 3IIVA 5AHMA 4EWND 3N34A 4PCFA 4N6FA 1IXNA 3H55A 2W79A 4U28A 1O5XA 2E77A 2ATSA 4BR1A 5I3IA 5D03A 2Y7GA 3FA5A 1TCDA 2OMAA 1WX0A 1HO1A 3KVKA 1XUZA 3STEA 2ATMA 3HG2A 2WV8A 1RPXA 4UFHA 1IGSA 2Q8ZA 2ISSA 4AF0A 4HSNA 2H8ZA 1L2UA 3IIXA 2WNNA 3QMSA 3KAOA 5IBXA 4N4PA 3ANYA 1KM4A 3CEPA 4PEKA 2CZEA 4FNRA 1B4EA 4DBEA 1XBZA 2DZTA 2DJXA 4LRSA 3TSMA 4R7JA 3N9SA 2ZZ6A 4JX5A 6TIMA 1ZAJA 2Q3RA 3NZ1A 4ML9A 4ZQMA 1TPC1 3U8GA 4WOZA 4H4IA 1DVJA 3NQGA 1PHWA 4GUFA 1D3HA 4RXGA 5D2XA 5AB3A 3G3DA 1P0NA 5F2IA 2FDSA 3KVJA 3R12A 1W5PA 4WZHA 2OT1A 2CLOA 4LOCA 1TPEA 4DO6A 3AO0A 3M7WA 3N9RA 3NNTA 4L4LA 1EA0A 2B7NA 2VFDA 2A85A 5C5YA 3P5ZA 1WOAA 4Z1DA 3W2NA 3TFCA 2ZBTA 3BO9A 2ZZ5A 4X9SA 1S5TA 5AHFA 2CFFA 3DHDA 2QDGA 1ZHAA 4P61A 4QSHA 4AHOA 2HS8A 4FO4A 3LHUA 2R94A 3FOKA 1SZNA 3CLMA 3FKRA 1OF8A 4S2CA 3G3MA 4YWIA 4DXVA 3D0CA 3GDRA 3W7IA 5D02A 3CB8A 1OX6A 4UNLA 1LBMA 4OQVA 1WBJA 3TV8A 1YPIA 4TMCA 4LNYA 3KX6A 3PSVA 2QKFA 1XBYA 4DO4A 3LM7A 1GQNA 3SGUA 2JKAA 3C2OA 3F4WA 4KFNA 1WOBA 3EEGA 5C55A 3LCLA 3MUXA 2TYSA 4UIOA 4E2BA 5LKYA 4XTDA 3RK8A 3V75A 5LSMA 4UTWC 3WK2A 2JGYA 5AC7A 4IMEA 5KSWA 3UYCA 3STFA 4K38A 2ISVA 2NV2A 2HTMA 3W70A 5LZLA 4E0CA 4GRSA 1BWLA 1I2NA 4AVFA 1OF6A 3NVTA 4CQAA 1SQ7A 3MP3A 5CZ0A 1TIMA 4NJKA 3NQVA 2C14A 4PL2A 3TQVA 4WQ6A 1PS9A 2HSAA 2QCHA 1Y0EA 3W74A 4HT3A 1WQ5A 3I68A 5SWUA 3IVTA 2H8XA 1DBTA 2ZZ7A 3S6DA 3BG9A 4O14A 3G0XA 5G1TA 3S5YA 1RV8A 4A29A 1F76A 3DFTA 2Y61A 1Q3NA 3O63A 4X2RA 3EX3A 4MFEA 1XCFA 1QPQA 3CWOX 3NQ7A 2QCDA 3O07A 1VYPX 3RLVA 1GJPA 5DELA 3QZEA 1KM3A 5KTLA 1UASA 1F7BA 5EMUA 4N9DA 1FWRA 4M6QA 3CWNA 3EWZA 3IGUA 2WNQA 3GDMA 4QNEA 3AJXA 3NA8A 4MY1A 3HGOA 3FEMA 4O10A 2V82A 1JCNA 4KFPA 2E6YA 4WXYA 3PVFA 2ZDRA 1NVMA 5FEWA 2V5LA 5G2WA 3UZJA 5HWMA 4K8HA 2VKZG 4K36A 1UCWA 2AQWA 2V9DA 2FJKA 3W7OA 3NGJA 1FX6A 4HNTA 1H7NA 3M6YA 5FESA 3P60A 5K9CA 2JKPA 1PIIA 2BSLA 4WY0A 3UWQA 2IQTA 1F2JA 4RKAA 3GR7A 3SECA 1ZY9A 1H7XA 4A22A 4NUWA 2DP3A 4NVTA 4HN4A 2Y6ZA 4UFLA 1XC4A 3VE9A 3W72A 3SSJA 3G0SA 4S2BA 3UY8A 2VEMA 1JRBA 2A4AA 5CZJA 2G95A 1JCMP 4UXDA 3TROA 1B9BA 2ZYFA 3PULA 4MYXA 4NNAA 1L6SA 5AN7A 2JKEA 4LUIA 1E51A 2CWNA 4I9AA 5E1QA 4UTHA 1MEHA 2WSRA 4GBUA 3C8FA 4CLMA 4M7TA 2OT0A 4OWGA 1SU5A 5DCBA 3U6WA 5EYWA 3LXBA 2QJGA 3DH7A 1YXDA 1EUAA 2QCEA 4OU1A 3DKLA 4O0KA 3SFKA 1CI1A 3NAVA 2PC4A 4I7UA 1AW2A 4JR5A 1SR9A 4UTMA 2BTMA 2WQPA 2E68A 1YXCA 3R2GA 5DXXA 1NF7A 1LYXA 1I45A 3O16A 1KTNA 3L66A 4UTWA 3QFEA 1X8FA 1QNVA 1ZALA 2I9EA 4AB4A 2FQIA 3GNDA 4FNQA 4MYAA 3BPWA 4JIPA 1TMHA 4IUOA 4S1FA 3SR7A 2C15A 1J5TA 3RF9A 3FLUA 2C1HA 4X22A 1QAPA 4ZMGA 2VFGA 3BG3A 3L5MA 3E49A 4Y90A 3W1PA 4MJMA 1GEQA 2FFCA 3NYZA 2VEIA 1Q6QA 5HR6A 3R5EA 1M7PA 5J5DA 5G1YA 3HG3A 3ZFHA 3LTPA 3P74A 4JNMA 3QM3A 3GLCA 4JTTA 1KFJA 1GVQA 1QO2A 2GVLA 4EVZA 3TJXA 3W7CA 2WNZA 4A2SA 1SZEA 4DF1A 1SW3A 1RD5A 2YX0A 3THAA 4UNKA 4XWUA 3MWAA 2V30A 4TIMA 5J5RA 2VOMA 5DXYA 5C54A 1GT8A 3PBYA 2C13A 2WPBA 4NNCA 3W7KA 5F1UA 3SW6A 1I2OA 2GJNA 4N4QA 3M5YA 8TIMA 4I7WA 2NWRA 3G0UA 1I8JA 3MYOA 1H1YA 1W5MA 3L9CA 4O1DA 4JYDA 5KITA 1OFOA 3TJLA 1IXOA 1SZGA 3MI3A 1GPWA 3TX9A 3NL3A 3EWWA 5D2VA 1LOQA 3MO7A 4OE7A 1YTEA 4DEFA 3W88A 1WDWA 3WJSA 2CZ5A 2YZRA 4O17A 4JTLA 4LVGA 1G7VA 4O28A 1K7EA 3HGSA 2B7QA 5T26A 4K39A 3PBVA 5HJLA 3ABSA 2P1FA 1FCVA 4H3DA 3G1DA 1DHPA 1VLIA 1EB3A 1K8ZA 3NXFA 3LHWA 1EUNA 1KM5A 4UR8A 1VGAA 1JUBA 3NPWA 4NJHA 1VCFA 1TQJA 2CLLA 1ZCOA 5HR7A 1MSSA 3EKZA 5IBXC 4LVDA 3W1LA 4GUIA 2X30A 2TRSA 1WBHA 2NV1A 1BEUA 2YFNA 2AGKA 1B4KA 5L9FA 3S5OA 3ELFA 2JK2A 2QUVA 3OIXA 4FX7A 1FDYA 4FX6M 4O52A 4J9JA 5K7JA 4OT7A 5EL1A 3UPBA 4A2RA 5C6MA 3QYQA 2NXIA 4JXCA 1O60A 4UMBA 4LS2A 3GB6A 4IX0A 5F2LA 2B7OA 3W1TA 4HSOA 1SZFA 3C2FA 4N2YA 2R91A 1VR6A 1OYCA 3T7VA 2TPSA 2A7RA 3TH6A 3M44A 1EPXA 3P67A 3FKKA 3EWXA 4ADSA 3FYPA 3MHUA 2GVJA 1KFCA 1WV2A 1OX4B 1H7OA 3C2VA 3EWBX 1KV8A 5CPOA 1I4NA 2ZRVA 1D3GA 1OFAA 1DKWA 2C0AA 1A5AA 5AC6A 1P1XA 3W07A 3EX6A 3NPUA 1OK4A 1FXQA 3P62A 2Z6JA 5KZMA 4Z1CA 4UC5A 4ORMA 1TREA 3C4UA 4RCXA 4Y9AA 4LUJA 3A9IA 5HWJA 2CZDA 1OK6A 4RZ4A 3L5LA 4HHPA 1R30A 3RLUA 3CEUA 2VENA 1UB3A 3PBUA 5DN1A 3UWVA 1QOQA 4UTUA 2ZQ0A 2YGYA 1VQTA 4IWWA 1W31A 2PRLA 3QEZA 1XDLA 4RLIA 3QJAA 2DZXA 1M5WA 4JYEA 3DHFA 2J9XA 4A21A 3S1VA 2OCZA 3MBFA 5EA9A 3TR2A 3W2MA 1IXPA 2XN0A 1JR1A 3QSTA 1GZGA 2C18A 3I65A 1D9EA 1P5BA 1ALDA 4ZL1A 4JTKA 1FBAA 3JR2A 4PH6A 3KFTA 3ATYA 2VEKA 3C56A 3PR2A 3GXNA 2H6RA 1C9DA 4RV8A 1YPFA 4DPQA 1VC4A 5E93A 1OVDA 3M5ZA 3PBWA 4WXZA 2YSWA 4XZ9A 4MUZA 3IEBA 3LCWA 1P4CA 1ICPA 1J2WA 4YMZA 4QQ3A 4ZVJA 5FF4A 3W76A 3GDLA 4RK8A 4YL2A 1B3OA 1MO0A 2GQ8A 1EIXA 1G4SA 5K4ZA 2ZCGA 4PTNA 4JX6A 1W3IA 4FXRA 3L0GA 2ZA3A 1W8SA 4LY8A 5CG7A 3E12A 4HPXA 3GXPA 3PG8A 3IIPA 3HMJG 4RJEA 1W3TA 4JTJA 4O1CA 3ABQA 3W1MA 1TPFA 5EKYA 4ZQNA 1MXSA 3OA3A 3LCIA 5AYXA 1VCVA 3LXCA 3C2RA 3QRHA 4BF9A 1AK5A 2PCQA 1HFBA 1J4EA 5FI8A 3WJWA 4DPPA 1SW7A 3O1NA 1UBSA 1PL9A 4M5PA 1ZAHA 1FCUA 4GJ1A 1IF2A 3F1QA 1X1ZA 3TQ0A 1ZNNA 1GVOA 2Y7DA 5FF0A 1H61A 1ME9A 4O1AA 4NT0A 1YDNA 1KM0A 4JTFA 2G97A 1GVSA 1JCYA 4HKPA 3L0NA 4WUIA 5H91A 3G1FA 3UWZA 2QEZA 5DBTA 3W7HA 4M6VA 3L67A 3BV4A 3L21A 1XUUA 2A21A 3IIZA 3GYEA 2QR6A 3LV5A 3LX9A 3GNNA 2QCGA 3MMTA 3MHGA 4LU0A 3T40A 1QCWA 1SFLA 4FEZA 1TJRA 1TV8A 3A5FA 5LGXA 3S0CA 5FF7A 3W7PA 1G69A 3GDKA 3MHFA 2GUUA 1OFRA 1TTQA 1H7WA 3OVQA 3LHVA 1N7KA 3NDOA 4WY0F 4ZQRA 3TAOA 3UXAA 2EPHA 3L0KA 3W86A 3PAJA 3TSBA 1X1OA 1PCKA 4I7VA 4DF2A 2GJLA 5HMSA 1O94A 3JRKA 4OHQA 3WJXA 1FWNA 3N2XA 4C1KA 3GXTA 2DU2A 4N02A 3B4UA 1BWKA 3MP4A 3W83A 1DQXA 1DJNA 1FDZA 3EWYA 2E5BA 4IGHA 2EAWA 1UJPA 3LRMA 3G1HA 2D73A 3STCA 4O11A 1HL2A 3ABRA 4CCDA 1X6UA 3SGZA 2ZRUA 2H90A 4OV9A 5LNUA 5D37A 2P0OA 1LP6A 1VPXA 4POCA 3LCFA 3S1UA 1O4UA 4O1BA 5C2XA 2ZRYA 1Z48A 3NQMA 5I3HA 2ZTJA 2YW3A 1R2TA 2G96A 3DBPA 4XBKA 1CX9A 1DJQA 1TPWA 4O8RA 4CCEA 2CU0A 3NQCA 3C2EA 3HQ1A 4MPQA 1FWTA 2XN2A 4FX8A 4KWWA 2V5BA 1JCLA 1VYRA 1Z42A 2DORA 3ZR4A 4ZQOA 3CT7A 4AWSA 1TRDA 1FCBA 3QPYA 4CNPA 2BX7A 3EXSA 7TIMA 2ZFAA 2ZRXA 1G4PA 3EB2A 2CLKA 1HUVA 1O95A 3ZWTA 5A5WA 4N9EA 2ZZ4A 5AC8A 3S1WA 3DFQA 1JCJA 4IPIA 5K2ZA 5L6UA 4M19A 5FF2A 2RKXA 3PF3A 2WSQA 1OFPA 2PRMA 4N9CA 1EEPA 3MI2A 3B0VC 2FIQA 1Q6LA 1TRIA 1TPVA 3EKLA 3W7JA 4JIQA 3UWYA 3TW6A 1KFKA 4K37A 3B05A 3T55A 3P81A 1QDSA 4LTSA 2YDAA 1NEYA 2A7PA 3W3OA 1SO6A 1DQWA 3I7SA 3R8RA 2FPYA 1H5YA 5CPLA 3UXDA 1BKSA 4UTJA 4LWWA 3VE7A 1L6YA 3VI2A 5CKSA 1VZWA 3VFLA 5D09A 1F05A 4O16A 3OVPA 1X7FA 1G4TA 2WSYA 5BW6A 4AHPA 1H60A 5F4WA 5AFDA 1KBIA 1PVNA 3N2MA 2HS6A 3LHYA 4IJBA 4Y8FA 3GAKA 3PUEA 4JS3A 4DELA 1UUOA 3GDTA 2WJZA 4AWUA 5HUOA 3CM4A 1KLYA 4NX0A 4FNTA 2CLIA 5CPNA 1VLWA 1F73A 2E6AA 1M6JA 1FCQA 2PRHA 5D2YA 4JDYA 3K30A 3T44A 3THQA 1OYAA 4LC8A 1ZFJA 4QJ1A 1T8XA 3P80A 2I1OA 3SY5A 1JJKA 3HG5A 4EIVA 1DORA 1NFBA 2W0UA 1H51A 1K7FA 4LV9A 4JX4A 3EXTA 2FTPA 4QISA 4K6AA 3W1NA 1PHQA 4JTUA 1CW2A 2R14A 5LNWA 3TXVA 2J9ZA 2X1UA 2V0TA 1L6WA 1GTHA 4EOUA 4UTLA 2V8ZA 1AL8A 2A7NA 4ADTA 4LVBA 4R53A 3SI9A 1WA3A 2NLIA 4NXSA 3O6CA 1MZHA 3LDVA 5D32A 1OFDA 3W87A 1ZAIA 3W2UA 1Q6OA 3BLIA 4IX2A 1QR7A 4MVAA 2E6FA 1OX4A 1VYSX 2YR1A 4PL1A 3W84A 1TB3A 2BLEA 2A6NA 4GXMA 2HMCA 1TPB1 1GTEA 1PCWA 4ONVA 2VFHA 4K7YA 3KXQA 3NL6A 1F6PA 5D38A 4ALDA 2OJPA 1MEIA 5K9DA 1QPRA 3BW3A 1QO5A 1W5QA 1R46A 2Y7FA 4UMAA 1ICQA 3WFAA 1G6CA 1JRCA 3IGXA 1YDOA 3B8DA 2B7PA 4FNUA 1OHLA 3LLDA 2Y62A 1XFBA 2LLEA 3DI1A 5TQLA 3MJYA 2PE4A 4U4MA 1PE1A 2B0MA 3W2JA 4NX5A 3BLEA 3PSWA 3W7LA 1OFEA 4XKYB 3YPIA 3HIJA 3A21A 3CQ0A 4GC4A 4CNNA 5KINA 1ICSA 1I2PA 3TC6A 4JD4A 2JBMA 4HNVA 4WJEA 3TW7A 4L4MA 3B04A 3DENA 3TA6A 1FQ0A 3CPRA 2CLFA 1YYAA 1TQXA 4JGDA 3M41A 3I7RA 2QUUA 5BMWA 1K03A 1LRTA 2A6LA 3TUUA 4O4VA 3HG4A 1QMLA 2VFFA 2A1YA 1KFLA 4FHAA 3DKJA 3KRUA 2ZRZA 4NNBA 3TDFA 2QAFA 2E1DA 2NUWA 2A0NA 4IMGA 1KW1A 3BK0A 5DCEA 3W1AA 2GQAA 3FJ6A 1AG1O 1AW5A 5DLCA 3NR0A 4O18A 4DQWA 3NOEA 1TPDA 3W75A 1QFEA 5G2IA 5KZEA 5DY3A 4KKXA 3LCHA 4AHQA 3NQAA 2YFOA 3ATZA 1JULA 3FS2A 5BOOA 2ALDA 3TFXA 3NQ6A 1N55A 3TE9A 3S9YA 3BW4A 3UPWA 2EHHA 3ZS4A 3WK1A 1XKYA 2I14A 1FDJA 2OZ0A 5F2MA 1XM3A 4JTHA 2RDWA 5TBOA 4N9BA 5G2HA 4MZYA 3S5ZA 3BARA 4HNUA 1VH7A 2BWGA 3W7MA 1AL7A 2H3DA 2RFGA 5MHBA 2ZZ1A 4ZZ9A 1KA9F 1SSDA 3LB0A 3M43A 4GNJA 5DCDA 4OBTA 4JTSA 1WXJA 2WOQA 1EWDA 1TTIA 1RQHA 1ADOA 3EXRA 1KM6A 3S42A 1H7PA 1LM1A 1AW1A 1SW0A 3NPXA 1YADA 4NJGA 1HG3A 4CNOA 2A2IA 1H63A 2V2CA 3QQ0A 3W1UA 3W1XA 3GVGA 5I3FA 2Q8LA 3VCRA 2ABBA 4QNWA 2NZLA 4QIUA 4RXFA 3TU9A 2PURA 3TCEA 4CQ8A 3C0JA 1LLWA 3Q2DA 4QITA 2EGZA 4FXSA 2NX3A 1EP2A 2Z1BA 3STGA 3IIOA 1SPQA 1KFEA 4Q33A 1A5SA 4BI7A 4MZ1A 2Z6IA 3N73A 4E38A 1TTJA 3H53A 4NZJA 5CSSA 3NQDA 3M1ZA 3TXZA 4R33A 2B4GA 3PB2A 3NQ2A 1ZENA 3R89A 3OHIA 3QW4B 1W3NA 3NM1A 4IMDA 4RZ6A 2VELA 1LOLA 3P82A 1XI3A 4UR7A 1K02A 1GG0A 1FWSA 2Y7EA 1OYBA 2BXVA 5HUPA 3QMRA 5D30A 3WJZA 2QAPA 3NQFA 3PC0A 4IQLA 2GVGA 4O54A 3LHTA 2KZHA 4HNNA 3PUDA 3LRKA 1Z41A 4W9TA 1GWJA 1IIGA 3M16A 2X16A 3TMQA 4LS0A 1OABA 1BTMA 1WAUA 1G4EA 1OFBA 5G5IA 5BMXA 5IM51 1YTKA 4PA8A 3BGJA 2QCFA 2H3BA 3NM3A 4NZFA 3LI1A 3RU6A 4BFAA 3HJZA 1W1ZA 1LORA 1VS1A 1G67A 3LXAA 3R13A 3W73A 1KM2A 4OV4A 3C52A 4Z0JA 5A8GA 3PS7A 1F74A 3QMTA 1SO3A 3GX9A 1R2RA 1V5XA 1G7UA 1F6KA 4KWVA 3UQNA 3OBKA 3S5NA 3H54A 4EF8A 4O50A 4IPJA 4Y96A 1OFQA 3TAKA 4GUGA 1VCGA 4JYFA 3MYPA 2JGQA 3IGSA 4WX2A 5CZSA 5KZDA 2C16A 3I7QA 4GWEA 1ML1A 3DXIA 3FJLA 3UWWA 3NZRA 5LNRA 5AYZA 2QCLA 4HIBA 2FLIA 2ZRWA 3A23A 3PM6A 3E0IA 2X1TA 3N19B 3MI6A 3GZ3A 4E2DA 2Q3OA 3VNDA 2EF9A 3KRSA 1A53A 1LROA 1EX5A 1LTDA 5BRBA 4K8EA 2OX1A 2F84A 1V7YA 3RNDA 2W6RA 2C19A 5HINA 1I2RA 1TV7A 3NG3A 3FYOA 3S1XA 1KTBA 4Z0SA 1LRNA 1NSJA 4IOTA 1L9WA 5CPMA 4UTTC 1SO5A 2E6DA 5CSRA 4LV4A 1LZOA 4AEOA 3MP5A 1GVFA 1SUXA 1LLZA 3NPVA 3G22A 4IMCA 5F4XA 2F7FA 2NX9A 3E02A 2RHGA 4D2JA 1H7RA 1THFD 5D2WA 3DFSA 3FFSA 4RR4A 3UWUA 2QCCA 3MBDA 4UFMA 1C29A 1P0KA 1Q45A 1EP1A 2YW4A 2BZNA 2CW6A 3QC3A 1R2SA 3B0PA 3PB0A 3U2OA 4MOZA 1IIHA 3S8HA 2VFIA 1VHNA 3PWAA 1PV8A 1O5KA 1K3UA 4O4WA 3O6DA 2CLHA 4UMCA 1ZJIA 3CIXA 4FNPA 2AAMA 3HGJA 1LRQA 3CU2A 1JCXA 1TV5A 1LBFA 1I2QA 3QPZA 5G4EA 1DL3A 5EBUA 1FXPA 3CIWA 1JUKA 3W7EA 1JQXA 3W7GA 1LBLA 4QAIA 3B0UX 4LRTA 2TMDA 4C1LA 3T78A 5KMYA 3A5VA 3G8EA 4YXGA 4KFOA 4LS1A 4AMAA 1U5JA 3GIYA 3W9ZA 2DZPA 3W2KA 1XBVA 5AOUA 3G1YA 5G4WA 2QF7A 4H6KA 3G24A 3P61A 2J6XA 4NJJA 4FF7A 2NUXA 2Y70A 3LOTA 1DV7A 1XBXA 2Y63A 3PY2A 3WJYA 4DBDA 2DZVA 1LOSA 1TPH1 1K7XA 3N14A 3LHZA 1RR2A 3GKFA 3NQEA 2QDHA 4CQ9A 3KVLA 2DZWA 4TU1A 4R34A 2ISWA 4AF0B 3NO5A 2YYUA 3CHVA 1GG1A 4QM1A 3VKJA 2R8WA 3EX1A 3G1VA 3FIGA 3LI0A 1S3HA 1YLVA 4RX0A 1TSIA 3W6YA 2O7QA 4FIRA 3N3MA 1S5WA 5F4SA 4XKYA 3OEXA 4O57A 1N8FA 2FB3A 3PUOA 3ZWSA 5AHEA 3LCGA 3W2LA 5HNRA 1EP3A 5EY5A 1ME8A 5BNKA 5TIMA 1W54A 4ZQPA 4JEQA 2E5DA 3L5AA 4ZQCA 3UNDA 4B5NA 1YTDA 3P8JA 4Z08A 3UD6A 3L65A 3QW3A 4O13A 4M7SA 2GPTA 1H1ZA 2CZFA 2A5HA 3MW7A 3G1XA 1K8YA 2Y89A 1KBJA 4CCCA 3WK0A 1YDVA 5LHFA 3A24A 4JTGA 1VJIA 1QOPA 3C3NA 1AMKA 1KLZA 1GOXA 1C8VA 2UV8G 3G8RA 3Q58A 3DGRA 1JVNA 4UTTA 1TTPA 4Q32A 3W7DA 2NX1A 3SIZA 5CZTA 1R47A 3HF3A 4IXHA 2QUTA 3O15A 2V81A 3LBMA 2NXHA 2VEPA 3O6YX 1IXQA 2QCMA 3BG5A 4O53A 2J24A 3WK3A 5K4XA 3C6CA 4O19A 2DJLA 3DFOA 3DZ1A 5H2ZA 3EWUA 2QJHA 3LERA 3P7YA 4PODA 5LHEA 2J9YA 5DY2A 1TO3A 5FEPA 2GQ9A 1TJPA 3P84A 3W1RA 1OG0A 3DFPA 4PFMA 4DO5A 3QH2A 4JY9A 3T4CA 1A5CA 1Z44A 2YYTA 3W23A 1W5NA 3HO8A 2ZTKA 3OG3A 4FIQA 3M5VA 1T96A 4MJZA 4MLJA 4GE8A 2O7SA 5E0KA 3QQ1A 2X2GA 4LVFA 1FWWA 1NF0A 1T0OA 4XQ6A 4WD0A 4UTIA 4XBSA 3TMLA 5FEZA 1MEWA 4N6EA 1TPUA 3HGRA 4ORIA 2WO5A 3TK7A 3ABOA 1H62A 2ZZ3A 1QPNA 5I3KA 3M9YA 5LNVA 4O0ZA 4ICNA 5FEXA 4MIMA 1LDCA 4Z1AA 4YCOA 4ADUA 1HTIA 2VFEA 3IVSA 3NQ8A 3HOJA 3OVRA 4MLRA 3KRZA 3UY7A 3CC1A 2RDUA 4M6PA 3LTYA 1T99A 3HPSA 4A3UA 3RFAA 2DZUA 5K3VA 3HPZA 2YXGA 1JUEA 2QCDB 1W5OA 4YLWA 4TR9A 2C3ZA 4PC8A 2XN1A 1GVRA 2CLMA 1RZMA 1RQEA 3IV3A 5LGZA 4YCPA 4FNSA 3W7RA 1H50A 5AYYA 3DI0A 5K9XA 3PG9A 4MKNA 1F5ZA 2FPTA 4BWLC 2ABAA 3L68A 1W56A 4GFSA 1KFBA 2G5WA 4LC6A 3LV6A 4RZ5A 4FB7A 2VC6A 1B57A 3E9AA 2WKJA 1GYLA 4LW7A 3GAYA 2RDTA 3BW2A 1M7OA 2Z2UA 4MFDA 4TMBA 4JDBA 3NL5A 1DOSA 2RH9A 4MZ8A 3L2IA 1XL9A 1FY6A 3I6RA 4WY0B 4XUGA 2E09A 1W0MA 1QWGA 3M5XA 3F03K 4UUIA 5I3GA 2FB2A 3TQKA 1Q6RA 3BLFA 4Y6GA 2GOUA 5D04C 4NXKA 1U83A 4NQ1A 3DAQA 3TNOA 3KOFA 3G1SA 4O15A 5GVJA 1EWEA 5HQEA 2J27A 5D2TA 2DZSA 5CGQA 3C61A 5HULA 2V2HA 4BK9A 5AHLA 2YPIA 5AHNA 1OX5A 2Y85A 3O06A 3V1PA 4G1KA 3P5YA 3E96A 3JS3A 1OJXA 2P10A 5FF3A 1KTCA 1XXXA 3HBLA 3O05A 4UFKA 3IRDA 1SO4A 3SZ8A 3LBCA 3B03A 2XFWA 4GUJA 4UCGA 2ZZ2A 4K7VA 3B06A 4JTEA 5EPDA 4MY8A 3O8AA 3W22A 4AAJA 3QF0A 1ME7A 2Y88A 1RVGA 2X1SA 3KHJA 4AH7A 3G1AA 3HPXA 1SSGA 3LCXA 3SJ3A 2NWSA 3IVUA 4JICA 1ONRA 3TC7A 4AXKA 3Q94A
chains in the Genus database with same CATH superfamily
1XLGA 4LAKA 4A8LA 4IXXA 1RJRA 1UWAA 1X6LA 2NXGA 4MNLA 1J18A 1V3HA 5HNUA 4G1NA 4HNLA 3W1QA 2A3CA 4J3TA 1XJBA 5A8QA 5GJNA 3UZ5A 3L4TA 4X3ZA 2ZVIA 4LVAA 3FDGA 2CIPA 3NL2A 3DU0A 4GUHA 1XYCA 3FK4A 1YX1A 5F2GA 4IGMA 1RQBA 1OZMA 3WQGA 2FVMA 1WZLA 5AYIA 4Q8MA 1KRMA 3DEQA 4UFJA 4PUJA 1E72M 5AHIA 1B3YA 5I2UA 4GO8A 2AKMA 2OB3A 3R43A 5HANA 4YPJA 4GA8A 5U4NA 4GYPC 3P8IA 5U7SA 3M0ZA 4TO8A 1POKA 2IKGA 4OGZA 4K1GA 1XHGA 4J3XA 4EF9A 3GSMA 4H6RA 3INPA 3GU2A 4WGHA 1A50A 2XVNA 4AZ5A 4F8XA 4IMFA 3W7NA 4ZR8A 2RGLA 5CXPA 2G0WA 5A1AA 3LLFA 5CGTA 3VKKA 5DBUA 4JTIA 3BGGA 3GKAA 1PZ3A 3EX4A 2VC5A 3CMGA 1B2YA 5LNSA 5FJRA 1PX3A 1AH0A 3I3EA 5F1VA 3VCCA 2VXNA 2YL6A 5AHMA 1V6WA 3OBAA 1XFCA 1GJWA 2Y7GA 1WX0A 3AIUA 1XUZA 2GDVA 3STEA 4IIEA 4DJEC 1AQFA 4ZCWA 2WHMA 1RPXA 2NV9A 3W81A 1KXQA 2ISSA 4W88A 1JYXA 2PDBA 2DIKA 3R7MA 3QMSA 5IHRA 1KM4A 4PEKA 4PUEA 3WBXA 4IG2B 3WLTA 2OYMA 4WHBA 3TSMA 3WKZA 4JX5A 1ODZA 3B8UA 6TIMA 3UR5A 4GZEA 3UGVA 1UR8A 3HFTA 4WOZA 5M2FX 1V0LA 2VUYA 3MPGA 2AMGA 3N13A 3FAWA 4X0NA 1P0NA 2W27A 3S2CA 3R12A 4Q4SA 1UD2A 1TJ0A 3RLGA 3SQSA 1EA0A 2VFDA 5C5YA 4H9VA 3WLIA 3BLPX 4Z1DA 4F2BA 7ODCA 3FGCA 3W2NA 3N29A 2EG6A 2GJPA 2CFFA 3H2OA 3UJFA 5GPRA 3DHDA 2QDGA 1ZPTA 3WQEA 3MV11 4P61A 2OO0A 2PTZA 1EDQA 4AHOA 4FO4A 4HMDA 2WWDA 1DIEA 5CLTA 1ZBWA 3WMLA 2Z28A 3HU7A 4S2CA 4QP0A 4Z2IA 1ZU8A 3D0CA 1NFGA 2GL5A 4J35A 4HPNA 3GDRA 3HQPA 3EAUA 4WKFA 4DVOA 1OX6A 4UNLA 4PCTA 4B15A 3A13A 3TV8A 1YPIA 4LNYA 4KGLA 3P0WA 3PSVA 2QKFA 3PJUA 2J13A 4E8DA 4AISA 1GORA 3VGEA 2W4XA 4DXXA 4UOZA 2GVEA 3C2OA 1WOBA 3EEGA 5C55A 2VJXA 4XTDA 4UTWC 4URIA 1MUCA 3BCJA 4ZOAA 4DNHA 5AC7A 3K1DA 1UIOA 2HVMA 3AZTA 3RGTA 4Q4QA 3W70A 5LZLA 4KEMA 1BWLA 2FZ8A 4AVFA 3NVTA 3QV6A 3R11A 1SQ7A 2PWEA 4EPEC 4AMCA 3A9BA 1LG2A 2C14A 4IT1A 4UQ9A 4LEFA 1XR2A 2PLKA 1R8LA 2HSAA 1T6MA 5FL0A 3W74A 1WQ5A 4YVPA 1HQTA 3BQ6A 3VTRA 1Y8BA 2GJXB 2XVPA 3BG9A 4O14A 4XK2A 1RV8A 4Q4OA 4WDWA 3O63A 4H41A 3EX3A 4PUDA 3TWBA 3CWOX 3NQ7A 3TZNA 2QIWA 5DELA 3QZEA 3B8SA 1L6GA 2RJGA 4PB4A 1C8XA 4MF4A 3VMNA 1BAGA 3CHDA 4N9DA 2BHUA 3HGOA 3FEMA 2V82A 1JCNA 4GNKB 4FR1A 2W62A 3GH4A 1UCWA 3ARSA 1G5AA 1F8IA 2FJKA 2I9UA 2J77A 2X42A 3ECQA 1B0IA 1S38A 5DO8A 1RCXB 5FJIA 4HMNA 3M6YA 2P8CA 9XIMA 1RK5A 1ZLPA 2GUYA 3KCLA 4O1EA 2XM2A 4C5YA 4FALA 4JIHA 4HHMA 4UFLA 1XC4A 2BGNE 3SSJA 3G0SA 4W7WA 3N12A 2D24A 1M41A 3TROA 4TXEA 3J7HA 3W00A 4Q8NA 2HV5A 3VOJA 4H01A 3UBPC 4NNAA 2JKEA 2DUZA 1EJ7L 2WSRA 3WDRA 1X7IA 4IISA 4CLMA 3T8LA 4K8GA 3CWHA 1UROA 1TIWA 4DJDA 3U6WA 3VKCA 2O9RA 1XPGA 4O0KA 3SFKA 5JVLA 2PC4A 2PLJA 1EFZA 2VM8A 1SR9A 3MY9A 4DHGA 2E68A 1YXCA 2B81A 5DXXA 3FYYA 3TN6A 1SYTA 4UOQA 1KTNA 2O9TA 4NG3A 4IUOA 4S1FA 1QAPA 1QU4A 2WZMA 3L5MA 3E49A 3W1PA 5DEZA 5FD0A 3NYZA 4KESA 1Q6QA 5HR6A 1XD1A 3LTPA 3P74A 4JNMA 1VFHA 3QM3A 1JFHA 3M0JA 4EVZA 4GI6A 3TJXA 3WF4A 3CUZA 4HP5A 1SZEA 3UR7A 3VCNA 1F3TA 5IFTA 4XO7A 3LUTA 1JL8A 2IKIA 2DZAA 2V30A 1K6AA 4J1OA 3T08A 4TIMA 5DXYA 1BQGA 3ORWA 2C13A 3RPTA 2Z24A 3VZZA 1I60A 4PSRA 3M5YA 5DMMA 8TIMA 2NWRA 1I8JA 2OKTA 2J7GA 3L9CA 5DRCA 1JZ2A 2E9BA 4O1DA 1VB9A 3OA5A 5KITA 1SZGA 1NM9A 3TQPA 2R1LA 3AYTA 1WDWA 1DJXA 2CZ5A 2YZRA 2ZE0A 4H8VA 1DE6A 1FVPA 4K39A 3PBVA 3SFWA 4F9JA 1FCVA 3BURA 1K8ZA 3D46A 3LHWA 1EUNA 4UR8A 5HR7A 1ZCOA 1MSSA 5IBXC 2J7HA 4GUIA 4G5DA 4W5ZA 2TRSA 2CYGA 1CIUA 2YFNA 2PD5A 1XIEA 4FI4A 4PUKA 4GACA 4FX7A 3U9IA 1H11A 1EJSC 4FX6M 3NEHA 4O52A 3WFZA 5EL1A 3UPBA 2WLYA 2A3EA 4H9YA 3U57A 4JXCA 4IG2A 4ZA0A 1E55A 1UZ1A 2ZC8A 4LS2A 3GB6A 1E1CB 2UY3A 3VIOA 3W1TA 1R3WA 4F2TA 2WVUA 2R91A 3UYIA 3WQFA 1U2YA 1W1TA 2G3JA 6TAAA 3GVRA 3PZMA 2PTWA 3MHUA 5I78A 2XIJA 5ABEA 2X1IA 4EWJA 4AYGA 1WV2A 3ITGA 4Q8PA 3FEQA 3LYEA 1FHUA 4WKAA 5C0QA 5A8OA 4FPSA 1P1XA 3N17A 3BAIA 4DBSA 4BY3A 3TNBA 4Q7BA 3C4UA 4RCXA 1N82A 4HA3A 4DBWA 5IRPA 1H0IA 2YIHA 1R30A 3ITLA 3KL0A 3PBUA 1OCJA 1VQTA 1DWIM 3WDPP 1JZ7A 1K77A 3GFYA 3ZT5A 4DX3A 1M5WA 3H2CA 3MANA 3MBFA 4AUBA 2G8ZA 4ZOBA 4RE4A 4ACZB 1IXPA 1JR1A 2XH0A 3UJRA 1P5BA 3ABXA 4M1BA 3MUY1 3MUZ1 4RNHA 3ATYA 2VEKA 3OB8A 3QR1A 4Q7IA 3C56A 2H6RA 3BAJA 3WLMA 3O3RA 4H9XA 4IIBA 4DPQA 1VC4A 3MVTA 3UT0A 4EACA 3SCNA 2PGRA 2YSWA 4DI9A 4ZXOA 3LCWA 1P4CA 3E38A 3W76A 3GDLA 4RK8A 1B3OA 1EQCA 5K4ZA 3MCNA 3VOGA 4PTNA 4QR6A 1EHNA 2GJXA 2ZA3A 1OM0A 3RUBL 1W8SA 3MS8A 1E6QM 3CV1A 1UOKA 4G7EB 4Q8TA 4P8WA 2ZX8A 4AZHA 2DT3A 4MWAB 4RJEA 4DRSA 3BJFA 1W3TA 4JTJA 3W1MA 3RLHA 5EKYA 4ZQNA 1Y65A 3AS0A 5EMLA 5DQPA 4AZ6A 1MXSA 4RV3A 3LXCA 3C2RA 3OVGA 3PJTA 1ONWA 3I10A 4KEUA 1AK5A 2ZIDA 1HL8A 4R9XA 1C93A 2J7DA 4DPPA 6CGTA 1OIMA 2H9AB 4XZNX 3RM9A 5GNZA 3EB3A 1FCUA 4W8LA 4GJ1A 5KZ6A 3TQ0A 2Y7DA 2YL5A 1UKTA 1H61A 4O1AA 3EDEA 1DWGM 1GVSA 1NY1A 3COTA 2QEZA 1ZP4A 3BV4A 1BYBA 3L21A 3IIZA 3LV5A 3LX9A 3GNNA 1WKFA 1RALA 3MHGA 4GQQA 4DZHA 2PZ0A 1TJRA 3A5FA 4B91A 4ACYA 4CNSA 3WIJA 2PTXA 5GNXA 3MHFA 2GUUA 4AY7A 1JFXA 3NSXA 1JDEA 1XLFA 5BWFA 3UXAA 2EPHA 1EYWA 1UMLA 2YZ5A 3CQIA 1X1OA 1PCKA 4I7VA 4DF2A 2P0IA 3QLLA 4PBGA 5A6JA 5FOOA 1O94A 1UH4A 4XD3A 3UCCA 4H19A 4GFIA 2I56A 2HEJA 3WJXA 3GXTA 3UVAA 1FH7A 3FW6A 2ISFA 2W5FA 4E2VA 3W83A 2DSZA 1FDZA 3FXGA 3WQ8A 2E5BA 3F5LA 1A0CA 2EAWA 2VR2A 2MUCA 3TN5A 2DT1A 3V1HA 2D73A 2CC0A 3ABRA 4CCDA 4CUCA 1T8QA 3SGZA 4INFA 3LPPA 2GSHA 2XH2A 1XGDA 3DG6A 1QASA 5CBJA 1FHDA 1XIFA 2P76A 1LP6A 1VPXA 3DDMA 4S3JA 3UCQA 2PA6A 2R1KA 3S6OA 4KCUA 1VPQA 1EJVC 2GUBA 2Y1HA 3ITOA 3JW7A 2UY4A 1CX9A 1DJQA 4AD2A 2WSKA 4KWWA 2XN2A 4J40A 4YVXA 3W53A 2V5BA 3KBVA 1U1HA 3ZR4A 4ZQOA 1UD8A 5IFPA 4KCWA 1G4PA 4NIRA 3EB2A 4PSPA 3VILA 1HUVA 1O95A 5A5WA 2ZZ4A 2WVTA 4M19A 1K6WA 5ECVA 4GVIA 2WSQA 5A3HA 2FIQA 1A5LC 1TRIA 2PLMA 3WF0A 1KFKA 4K37A 3MDWA 3T55A 4CN1A 4HOWA 1QDSA 2R82A 4PUNA 4TVDA 1E0UA 3OYZA 1P0BA 2NSXA 2FPYA 3LZ3A 2HK1A 4UTJA 4NYUA 2QGHA 1VZWA 5D09A 4O16A 1X7FA 4LH8A 3C3UA 2OYLA 3UXKA 1DE5A 1OT1A 1PVNA 4JPGA 1WKDA 3V5OA 3LHYA 4GMEA 4E6MA 4JS3A 4DELA 3GDTA 2WJZA 5HUOA 1BGGA 4NX0A 4PMYA 4A05A 4EXAA 1BVWA 1PIFA 1M53A 2PRHA 4QE5A 4FMVA 1GOOA 4MJ4A 1M7XA 3OOQA 1H4PA 4UCFA 1ZFJA 4QJ1A 1T8XA 1YMYA 4Q4MA 3HG5A 1X39A 3AC0A 2DFAA 1Z69A 1UZDA 4LV9A 3WEOA 1DQUA 1XIGA 3TXVA 2J9ZA 3AAMA 3NVDA 1E1CA 4NI8A 4UTLA 3WUGA 3UGRA 2I17A 2RDXA 4IJCA 2NLIA 1HF6A 3B3DA 3CO4A 3CYVA 4M29A 1MZHA 1OFDA 4ZSTA 3B9DA 2BVTA 3DGBA 3W2UA 5GQBA 5BCAA 3FV9A 4NRSA 3OLDA 3VUPA 1JD9A 4GXMA 4IPLA 2VFHA 4HMCA 5A6TC 5D38A 3SCSA 1IWAA 1J6OA 3GC5A 1R46A 4IL2A 1R3QA 2QT3A 1G6CA 2OSXA 1JRCA 3DESA 5BYWA 3LS9A 3S1GA 2CETA 4FNUA 3LLDA 5J8LA 2Y62A 3MJYA 1PE1A 3FVDA 3W2JA 2WNWA 1AUSL 3W7LA 4PMJA 2E3ZA 2EO7A 2P88A 3YPIA 3A21A 4CNNA 1VP5A 1UR4A 4JD4A 4ACZA 4HNVA 4I9JA 3DENA 4MSSA 3T0BA 1YYAA 1TQXA 3M41A 3I7RA 2QUUA 1XCXA 1K03A 3OQEA 4GZIA 3A3WA 3HG4A 1F6YA 5BZAA 4X9YA 2X0HA 2BVWA 5HBFA 4ICCX 1D7KA 1E43A 4NNBA 2E1DA 5T9BG 1KW1A 3HV8A 5DCEA 2JF6A 4LCQA 3W1AA 4I5XA 1AG1O 1QXLA 3WQVA 1FWDC 3B8TA 3W75A 2Z7KA 1Q7ZA 1E5NA 5KZEA 2YXOA 3URQA 4KKXA 4QQUA 3N18A 3ATZA 3FS2A 3BE7A 2ALDA 3OGSA 3S9YA 1AVAA 4G7EA 1TWDA 1L8PA 2PWDA 1K1DA 1KXHA 3CTTA 2OZ0A 4MWAA 3IPWA 2RDWA 4M24A 4C60A 4WGXA 2I16A 4MZYA 2BWGA 3W7MA 1OG6A 2EPKX 3T09A 3WLSA 5AZ1A 1VRXA 4CU8A 3M43A 4GH3A 2F6XA 4JTSA 2NSOA 2H9AA 1DJWA 4QJ3B 1TTIA 1ECEA 1DXFA 1UP0A 3KEHA 4DWSB 1KM6A 2IPFA 1DHKA 2HPMA 5CJMA 1LM1A 3UJEA 3ZVHB 3VINA 1QVBA 4CNOA 2V2CA 4JTRA 3W1UA 4JCMA 4J27A 6A3HA 4QNWA 2NZLA 4QIUA 3ZQ9A 2XGZA 4TVCA 4Z2GA 2X40A 1CGTA 4FXSA 4F3HA 1EP2A 2Z1BA 4PB5A 1SPQA 3KCJA 5AZ0A 3H7RA 1UZHA 2Q09A 4NZJA 1OADA 2BY1A 3M1ZA 3PB2A 3DYPA 1H1NA 1MQQA 3A3HA 3NQ2A 3TW9A 3OHIA 1XLCA 3RU8X 1LOLA 1K02A 2Y7EA 1OYBA 2BXVA 4ZOCA 4HA4A 4P5UA 3WJZA 2QAPA 4IQLA 3UWEA 4O54A 3LRKA 1JPHA 4YWSA 2PTYA 1Z41A 2PS2A 5LIUX 1PB0A 3TMQA 1IQ8A 1OABA 4TOQA 1BTMA 1OFBA 5G5IA 3SRDA 1QOXA 2NT1A 1BLIA 1A5NC 1JYNA 3B8VA 3IS4A 3WQ4A 4F79A 4NY2A 1Q6FA 1DIKA 1G67A 1EGZA 3SUWA 1SMDA 3QVQA 4L4PA 1KM2A 3GRIA 3GNXA 3WMBA 3SCQA 2DEPA 4PEEA 2PDXA 2XUCA 3USZA 1HKVA 4ASTA 4DNMA 1R2RA 3KOYA 2NVAA 3QV8A 3LK6A 3OBKA 2AL1A 4EF8A 1EDTA 3TYCA 4FK9A 1YW1A 4QSFA 1OFQA 1V6YA 4Q6XA 1FWEC 3IGSA 4H8NA 4CD5A 2NLYA 4CVUA 2NQJA 1DP0A 1QATA 1GJUA 4DUWA 4MB3A 2CEQA 2V68A 2YDRA 3DXIA 3PK7A 3LEPA 5LNRA 5AYZA 3W28A 4HIBA 2FLIA 1I0BA 3WZ0E 2X1TA 3N19B 3MI6A 3UETA 4E2DA 5A69A 3PUGA 1LROA 1LTDA 2R24A 2W3ZA 2F84A 4JTDA 2OEKA 1EL3A 3FSTA 2C19A 5HINA 1TV7A 1EPVA 3ITXA 3N25A 2O4MA 1KTBA 1LRNA 3E2RA 1NSJA 4IOTA 4O8AA 2EQDA 4UTTC 4EKJA 5CSRA 2V67A 1CLXA 4AEOA 3MP5A 1A3XA 1LLZA 1XRVA 4X2PA 4IJRA 1O12A 3G1RA 4PUWA 3E02A 4B5TA 2A79A 5EMYA 3UWUA 4RR4A 3CUJA 4R3UA 3MBDA 4UFMA 1C29A 1K4HA 4AD4A 3HQNA 4U31A 1FWBC 4OBSA 1R2SA 3B0PA 1IIHA 2INEA 2Z4GA 4L4OA 4MAZA 4G9PA 4O4WA 4RNJA 2O0TA 2CLHA 3HGJA 1W1VA 3VC6A 1MWOA 1JCXA 1NWSA 1TV5A 1KCKA 3QPZA 4I3GA 3SDOA 4M1RA 2ZX6A 1TE6A 1DL3A 2VD8A 4H04A 4YN5A 2WW5A 1GOQA 3GXFA 3KOXA 2R9RA 2QXWA 4P7OA 3K46A 3W7EA 1C91A 4QAIA 4XD5A 3VXGA 1IEXA 4S38A 2TMDA 4C1LA 3T78A 3ZVIA 3RG6A 3GIYA 1MFUA 4L56A 3W2KA 1XBVA 1K9FA 4BHYA 2R1MA 2I5QA 1GVIA 2J6XA 1JEZA 2E1WA 1X98A 2WHJA 4NJJA 3ME3A 2B31A 2XGBA 2NUXA 1Q8JA 4GD0A 1DV7A 3E0FA 1CEOA 3E1F1 3E2SA 2DZVA 1TPH1 3BTNA 2FMNA 3LHZA 3RPDA 3UJ2A 1RR2A 4EPBC 1PXGA 4LQ1A 1Y5XA 4TU1A 4R34A 2EJAA 1GG1A 3OGRA 1XLJA 2R8WA 4JFVA 4OECA 1AH4A 4TVUA 4XUYA 1S3HA 4L1XA 5D9MA 2O7QA 4CNTA 1S5WA 3K5XA 4PCPA 3LCGA 5HNRA 1RA5A 1EP3A 3WNNA 5BNKA 2DT0A 2E5DA 3EOLA 3L5AA 5M1TA 4WF7A 1YTDA 3PP7A 3MMUA 2X2YA 1Q4WA 1H49A 2CZFA 3EZ4A 4C6CA 4G6CA 1KBJA 3WK0A 1P48A 1VJIA 5I79A 1AMKA 1KLZA 4WLCA 3ZZ1A 1FTXA 2EJ1A 3G8RA 4XAPA 4D1JA 4HYWA 4AXNA 3SN4A 4LYQA 5CZTA 2OPJA 2QUTA 2D69A 3RX4A 3LBMA 3O6YX 1IXQA 1CGYA 1W9XA 2J24A 1ADDA 3IGHX 5K4XA 3VIPA 5JH2A 3B9OA 5CPQA 2PMQA 3BH4A 1J11A 1TO3A 2GQ9A 3W1RA 4PFMA 3DFPA 1JPDX 3M0KA 2AL2B 2YYTA 3W23A 3M64A 4YU1A 1XDJA 4FIQA 1EHAA 1IHIA 2PDPA 1XLAA 3AS1A 3ENLA 2XIOA 2CZVA 1A47A 4DWSA 1W1B1 2J7CA 4IQDA 1NF0A 2V69A 3ZVHA 1E4IA 2VQTA 1IYXA 4U5IA 5B80A 1QW9A 4ORIA 3ABOA 4YS1A 4YTQA 1H62A 2ZZ3A 1QPNA 1UR3M 5CPSA 4EP8C 3VO0A 4C7FA 2ANUA 2QW5A 4O0ZA 4F0LA 5FEXA 4MIMA 1LDCA 2HNEA 3H4XA 1HTIA 3IVSA 1J0IA 2P3EA 1V02A 2DZUA 1CDGA 4J3WA 1V79A 2QCDB 4HZ7A 2WHKA 3ANVA 3TLQA 3OHMB 1ZB5A 4TR9A 2VD9A 2P50A 1U30A 2CLMA 3IV3A 2OEJA 1EZ2A 1Q85A 3M0LA 4L1GA 2IPJA 3ITVA 4MKNA 1HKJA 1CYGA 4GFSA 2J25A 3WBYA 3H23A 2G5WA 2D2HA 3LV6A 5I09A 4LW7A 1PSCA 2WVSA 3OG2A 4A8NA 3EKGA 4TMBA 4J3VA 3L2IA 1KXTA 2V5DA 3I6RA 5E09A 4WY0B 4XUGA 1R87A 5I3GA 3F03K 1Q6RA 4Y6GA 1WO2A 3CUFA 2GOUA 4Q3MA 3LM3A 1KQZA 4NQ1A 1EJTC 2IXUA 2VX7A 1H2JA 5D2TA 2DZSA 5CGQA 4KH2A 1ISWA 5HQLA 4FLSA 2V2HA 4BK9A 3V16A 4QCEA 5AHLA 2YPIA 3Q65A 1WXZA 5JBDA 1W3KA 4G1KA 1UKOA 3P5YA 2CWXA 2P10A 5FF3A 1MNZA 1XGEA 3QHNA 3GIPA 3QHOA 3NCOA 1NWTA 2OU4A 3EA2A 4UCGA 1ELSA 3WD1A 4QG8A 4U10A 3I3BA 4JTEA 4MY8A 1XWYA 1RVGA 2X1SA 3KHJA 1SSGA 4JNZA 1BGAA 1A3WA 3Q94A 2JIEA 1Z9AA 2CLEA 1D2KA 3HB9A 1R3SA 1UYQA 3G6MA 4GKTA 3ALGA 5EMMA 3QY7A 2FZ9A 4JZ5A 5JIPA 3OJGA 3KVMA 1ZBKA 3BVJA 1EGMA 4QLJA 4UNIA 4IIGA 4RDZA 4LBSA 1NAL1 3VMOA 1Z7AA 1RP9A 3IUIA 4J3ZA 1S5VA 1GYNA 5EFFA 3A22A 3O0KA 4LNCA 2WM1A 4QE1A 3T2QA 3Q37A 2I5GA 1R5YA 3GK0A 4N0RA 2C6QA 3GR8A 1BTCA 3EA3A 2NUYA 3UZWA 4ZO9A 3UG3A 2V5JA 6ALDA 2GSJA 4HYRA 2BY2A 4JIIX 4CQBA 4DXKA 1K8XA 2F6KA 1US3A 2EKCA 4MY9A 4IPNB 1OEPA 3QSRA 3DN5A 4C6OA 4BWLA 1E6XM 1SFJA 2WB5A 3NQBA 2PCEA 1K4GA 4YTSA 2UBPC 2EXOA 1RLDA 4LPCA 3E0VA 4WDUA 3LA4A 2E9LA 4C6IA 2Z0IA 4BI5A 1FUYA 3ZMRA 1EJWC 4E8GA 3UG4A 1IEVA 1QNPA 1XQKA 2G50A 4DF0A 4NU7A 1BYAA 3L23A 2J47A 3SCWA 3DG7A 4P8UA 3IIVA 2C7FA 4D6DA 2WMGA 1F4AA 3N34A 3H55A 4U28A 1VBJA 1GEHA 4FS9A 5I3IA 3NZPA 4GVGA 3FA5A 1TCDA 1HO1A 3EPMA 1OCBA 1JGMA 3KVKA 2D20A 1X96A 5C9WA 1R85A 2PDHA 4TUFA 2Q6ZA 2Q8ZA 4HSNA 3IIXA 2WNNA 3JZUA 1NP0A 2ZX5A 3KAOA 1EO5A 3RM4A 1ISZA 5A6SA 3GH5A 3ANYA 4L61A 1E3XA 3CEPA 2CZEA 4LF2A 3CK5A 2DJXA 4R7JA 2C0HA 1MW0A 2ZZ6A 1ZAJA 2F6UA 1Q66A 2EPMX 2Q3RA 3NZ1A 4ZQMA 4H4IA 3MUCA 1DVJA 4FZIA 4AVNA 3LD5A 1R3YA 1D3HA 5AB3A 2F8QA 3EDJA 2PDQA 3PPGA 4WZHA 2GK1B 3KZPA 3CL8A 2OLHA 1TPEA 3AO0A 1UWIA 3M7WA 2FGZA 4L4LA 3NNTA 3BXWA 4RW5A 2EPNA 3IJDA 4L65A 3WENA 1MVYA 3P93A 1CGVA 3TFCA 2ZBTA 1AJZA 3M0HA 4FOJA 3QPEA 1S5TA 3GG0A 1ZHAA 3R0DA 1WUEA 4Y9NA 2R94A 1ZJBA 3FOKA 1A5MC 3CLMA 5GNYA 5LA2A 1JGIA 4KQNA 3BICA 4Z2KA 3SN0A 3CB8A 1XW8A 4OQVA 3H24A 2JKAA 3MZ2A 3F4WA 2WCSA 4UIOA 5LKYA 2C79A 4HK5A 3ISIX 1CXFA 5A8MA 4GYPA 3CMJA 2W67A 4IMEA 3VKDA 2ISVA 3GTHA 2HTMA 1CZ1A 3REQB 4MB4A 4E0CA 1I2NA 1ONEA 3OZPA 4HNOA 5FJPA 2FGBA 5A6MA 3MP3A 5I06A 1VBRA 1UR2A 1WP6A 4R7OA 4UWMA 4OZOA 3S6TA 3OLGA 3KUMA 4WQ6A 1PS9A 2QCHA 2DH2A 3I68A 5HXMA 1QW7A 3VGDA 2ZZ7A 4AIOA 3G0XA 3S5YA 3HA1A 1F76A 3DFTA 4H7ZA 4XZBA 3FSUA 1PZ0A 2HXUA 8CGTA 2QCDA 3RLVA 1GJPA 2J4GA 3UFYA 1UASA 2V3FA 2VP8A 5FA5A 1F7BA 1RD6A 5BOFA 1V77A 1IZCA 3EWZA 3SADA 2WNQA 3GDMA 3W02A 1JIBA 4L9YA 4KFPA 4JQ1A 3PVFA 5HPOA 2ZDRA 5FEWA 2V5LA 3UZJA 4K8HA 4KERA 4K36A 3XISA 2AQWA 2V9DA 1MMFA 1J0JA 3W7OA 3NGJA 3GO2A 3K4DA 4ZENA 1ZJHA 3DFYA 3UU0A 2CNCA 4JN7A 1H7NA 3P60A 1V3LA 2WMKA 1Q13A 2TODA 1PIIA 2BSLA 4WY0A 1Z8AA 3WF1A 1F2JA 3SECA 1ZY9A 1H7XA 2F61A 1NOUA 1R9XA 2OODA 3W72A 1W9DM 2VEMA 1JRBA 4G56A 4UXDA 1LL4A 2O4QA 2VRQA 2CITA 4RL3A 4MYXA 1L6SA 4LUIA 3DHPA 1E51A 5D4YA 5E1QA 4UTHA 3QGAC 1KCLA 1DJZA 1B9ZA 3N2OA 3WYZA 2OT0A 3SCPA 1FWIC 3D6NA 5DCBA 1UH3A 1PX4A 4UB9A 1UR9A 4NZ1A 2ZXQA 5AYBA 4AX6A 3CL7A 4KEZA 1FWAC 4JR5A 1E6PA 4QAWA 4XG1A 3IJ9A 1SM9A 3R2GA 3RCYA 1NF7A 1LYXA 4UTWA 1X8FA 1CGUA 1ZALA 1EH9A 4FNQA 5I23A 3BPWA 3KTXA 4S3GA 3VD3A 1IGWA 4D8LA 2VFGA 5FL1A 3BG3A 4JKLA 4GVFA 2WMIB 3ALFA 2VEIA 2CXGA 5J5DA 5G1YA 3HG3A 3CYJA 4IUGA 3GLCA 4U3AA 1QO2A 2GVLA 4YJ5A 3QGVA 2F38A 5CJNA 4QS6A 4KWUA 4ML4A 4XZLX 4PE8A 1GOWA 1E73M 4IPPA 4J2PA 2VOMA 1EA9C 1UR0A 5AVNA 1F4HA 4HU8A 3NOYA 2VWSA 1TVLA 4B5XA 3G0UA 5EGRA 1H1YA 5BXPA 1VFFA 4UZSA 3LG3A 3MI3A 1EZWA 3EOUA 1CXIA 3SURA 2BFGA 4DEFA 3U7BA 4HCDA 4O17A 2BV9A 3CHEA 1K7EA 2WANA 2ISDA 3GW3A 1A4LA 3CUIA 3ABSA 4C6KA 4FOKA 3G1DA 1DHPA 1XH1A 2A3HA 1JUBA 3WFLA 3NPWA 3E5PA 4W5UA 3PANA 3TTOA 4LVDA 4FLQA 1WBHA 4QRNA 2NV1A 2DY3A 4Z2JA 1BEUA 2BOEX 2AGKA 5L9FA 2DUXA 2O9PA 3S5OA 3ITTA 2Y8KA 1JYWA 1FDYA 1GQIA 5K7JA 1UWUA 4OT7A 2NXIA 1QHOA 1J8VA 1O60A 3VZXA 3ZYZA 2B7OA 4HSOA 1VR6A 5LA1A 4X61A 3T7VA 1S5NA 1F9CA 3TH6A 1EPXA 4XSMA 3XIMA 3AROA 3FKKA 3CQJA 4ADSA 5LA0A 3ZOAA 1OSEA 3ARPA 2GK1A 4DZIA 1H7OA 5CPOA 2Y8UA 1GZJA 7REQB 3CB3A 1D3GA 1OFAA 1DKWA 1A5AA 1QW8A 3PFRA 4DO7A 4S3CA 3NPUA 1FXQA 3P62A 2Z6JA 4JL1A 4K68A 4LANA 4UC5A 2BGQA 3CHCA 4HHPA 3PZ9A 3IWPA 1TUFA 1T40A 3URAA 3RLUA 4HU4A 4BQ5A 2TAAA 1UB3A 5DN1A 3UWVA 2OEMA 2YGYA 3HPAA 2PRLA 3LU2A 1GGOA 2FVKA 5IXEA 4NAFB 3NO1A 4A21A 3W27A 2OCZA 1FH9A 3W2MA 4H6QA 2WKGA 4AY8A 1BF2A 1ALDA 4ZL1A 2POTA 1Q6CA 4PH6A 2DGAA 4DAIA 2CXEA 1W32A 3AXXA 5E70A 4RV8A 1YPFA 3REQA 4S3FA 3RAOA 3SEPA 3PZGA 2FHBA 4AD3A 1SR0A 4PMRA 4MUZA 4BEQA 3SN1A 1V8EA 1HXJA 1AH3A 1J0YA 1J2WA 4ZVJA 4PGLA 4C91A 1TZ9A 4JTAA 4YL2A 1P0DA 2GQ8A 4GCXA 5DF0A 1UZ4A 1G4SA 1M03A 1E70M 1WNOA 3PTQA 1IT0A 3L0GA 3R6IA 4EXQA 3AIEA 3IJ8A 1EX1A 1J2BA 4LY8A 5CG7A 2FTYA 1BSLA 4HPXA 3PG8A 4ZB2A 3IIPA 3HMJG 4XSLA 4UQCA 1UQZA 3ABQA 2EG8A 2ZUTA 4A4AA 1TPFA 4LY4A 3OA3A 4PMUA 5AYXA 1VCVA 1K70A 4GKLA 2QV4A 4DYKA 4BF9A 1S2TA 1BF6A 3S2MA 5IDZA 2PCQA 1HFBA 1J4EA 8XIAA 3HZ3A 5B7YA 3O1NA 1XISA 4L5ZA 5FF0A 4JBRA 5AECA 1ME9A 5BRQA 1KM0A 1S2UA 3ARWA 3A64A 4WUIA 3L12A 3FY1A 1R3TA 1MYRA 4AX7A 1XLDA 3KTCA 1QBAA 1NH6A 2J62A 1O66A 3V0UA 2J78A 4Q4RA 2FDMA 3R4IA 2XWEA 2QCGA 4BEUA 1E0TA 3GHUA 8RUCA 3T40A 1QCWA 2RJHA 3M0VA 3S0CA 2FH6A 4TQTA 3GDKA 2FHCA 3OVQA 3LHVA 3NDOA 3PHAA 4WY0F 2F2HA 5FJJA 3LQLA 1K9TA 2YA1A 2Z7GA 4LF1A 2VGFA 4D6GA 7XIMA 3M0IA 4HD5A 4J4KA 4HCLA 5HK4A 3T1GA 5E0CA 3W38A 1WDDA 3H4GA 4R85A 4ERGA 3VNYA 1P1MA 3JRKA 4OHQA 4C1KA 1CNVA 4N02A 1BXNA 3MT1A 4C6JA 2YCJA 2FMOA 1UJPA 3QHMA 3LRMA 3W01A 2WC3A 3NSMA 4O11A 3SCTA 2IUZA 2XM1A 2ZRUA 4OV9A 2PWGA 1BYDA 5D37A 2ACRA 4DJDD 2XPKA 1Z48A 3Q4DA 3FAXA 2WMIA 4CU7A 1JDAA 1A4MA 4XISA 3NWRA 1TPWA 1UQYA 4CCEA 2VRJA 4FXJA 5AY7A 1VYRA 2PDFA 2DORA 3CT7A 1FCBA 1UC5A 4C6PA 4XAFA 1W2PA 2BX7A 4GY0A 2ZRXA 2CLKA 1NOFA 3OZYA 5AC8A 3DFQA 4TV5A 3IUHA 4JFSA 5L6UA 3CV6A 3L4UA 5FF2A 4B2DD 1JDDA 2WJEA 3EOEA 1TPVA 3G6LA 3W7JA 3VIFA 3B4YA 1MZRA 1LQ0A 3P81A 2EEXA 2WSPA 1NEYA 3CXOA 1DWJM 2A7PA 3O2LA 2PDWA 4A8RA 2PDYA 1H5YA 1EF3A 5BXRA 1FA2A 3GS6A 1L6YA 3VFLA 1SJAA 1QNOA 1G4TA 1CXKA 4RE0A 4AHPA 1H60A 5TD4A 1KBIA 1HJSA 2D22A 4IJBA 1KFWA 3GAKA 3PUEA 3UJSA 3S2JA 1UUOA 4G7FA 1MDLA 3CM4A 1FRBA 3WF3A 3TR9A 4ZODA 1OGGA 3C0QA 1L0PA 3RCNA 5CJ5A 1FCQA 5D2YA 1W3LA 4P7QA 4JDYA 4UR9A 2BG5A 3K30A 2VR4A 3T44A 3THQA 1XYAA 4ZB5A 4H9ZA 1US0A 1JJKA 3ZLHA 1E0WA 4EIVA 1DORA 4DZ5A 3KOWA 4JX4A 2FTPA 4QISA 4JTUA 5BXTA 2D3NA 2V0TA 1OGBA 2R1PA 1PZ2A 1AL8A 4HZ6A 4ZO6A 1UHVA 4KF1A 3WD0A 1PX8A 1MDRA 1A5KC 1UWQA 1WA3A 1ZBVA 4ZOEA 1W3JA 1DJYA 1OC6A 4NXSA 2INFA 4W7VA 3LDVA 3SCRA 3BLIA 4IX2A 3VC5A 4MVAA 2YR1A 7REQA 1TB3A 2BLEA 2HMCA 1GTEA 3T6CA 4G8TA 2OLSA 3S9IA 4ALDA 1TWWA 1CTNA 1TVNA 4Z2HA 2ZX7A 1ICQA 1FKWA 3WFAA 1FWGC 4DN1A 3BAWA 3B8DA 2YL8A 1EXPA 2LLEA 5TQLA 4GIYA 3SY8A 4PTDA 3E74A 2NVDA 4U4MA 1QI5A 3CASA 3E2VA 4PUUA 4H83A 3UZZA 1OFEA 2Y5JA 3DUGA 4NAFA 1Q2SA 3T42A 3K4WA 3A3XA 3HIJA 1CGXA 4GC4A 1B3XA 1C3FA 3P3BA 2GGEA 1I2PA 1OZQA 3AALA 2ZUSA 2YB1A 3POCA 1LWIA 3TW7A 2YDQA 3OZOA 1HW6A 1JG9A 1FQ0A 2ZUUA 4AC7C 3CPRA 5DMLA 1IE7C 1GVEA 3LGDA 3TUUA 2CESA 3AXMA 3NZQA 1QMLA 2VFFA 3FNDA 2PGEA 3QGKC 5JUVA 4FHAA 2BXYA 4HHLA 3DKJA 4IMAA 1EJXC 3VK5A 2QAFA 2A0NA 3BK0A 2PWFA 3WNLA 4D71A 4WKHA 5CG0A 2J7BA 4O18A 4QJ4B 4DQWA 1IEQA 1CXHA 1BRLB 3K4AA 2FYMA 4LB4A 2YFOA 2XFFA 4D6FA 2YA2A 3AJ7A 3TE9A 1N55A 3OYXA 2OWWA 4B4HA 3IJQA 3BW4A 3N2CA 1WDSA 3UPWA 1PPIA 3BAYA 3STPA 4ERIA 4JTHA 1T41A 2OGYA 1Q6GA 3BARA 4WSKA 1QNRA 3MSRA 2F2KA 1UD6A 2H3DA 2NW0A 4J28A 2YBVA 2CBIA 2ZZ1A 4ZZ9A 1SSDA 4MKSA 1TMLA 4RPQA 4GNJA 4HPHA 3WLKX 2IPGA 3ARTA 1I1WA 3GVVA 1RQHA 4BF7A 2QS8A 4S23A 1R3RA 3D47A 1H7PA 4LBUA 1YADA 4RUBA 4AY1A 1H63A 3W1XA 3V7PA 4HTYA 3M46A 3VCRA 2J7EA 3L4XA 1XV8A 4L6HA 5KEZA 3C0JA 3BCDA 3BMXA 3STGA 3IIOA 4WJXA 4BI7A 2D0FA 4KIRA 4E38A 1U1JA 1WXYA 1TTJA 1BG4A 4MTVA 2HISA 2QUMA 4R33A 1OB0A 1MW3A 3KE0A 1ZENA 3R89A 3BCFA 4EANA 1W3NA 3RCMA 4JNYA 1CLVA 1XI3A 4PZVA 4UR7A 1GG0A 5CSYA 2Z1WA 3QMRA 3A4WA 2PDIA 3LPOA 4XD4A 4Y7EA 3LHTA 3ARQA 4ZFMA 1IIGA 1OQFA 1E6ZA 3M16A 3WLQA 1IR1A 5IM51 1HNYA 1XRTA 1GQJA 1WAWA 2H3BA 3NM3A 3CGTA 3LI1A 4NZFA 1RBLA 1OCNA 2VDHA 3HJZA 3GHTA 1LORA 3NIYA 2Y5SA 3LXAA 2PDNA 4JKMA 3MVIA 3C52A 4Z0JA 5A8GA 4GI9A 5EMKA 1F74A 3VIMA 1WPCA 3GX9A 1V5XA 4KWVA 4BCEA 2X7WA 3WH9A 4YYFA 5DX7A 3H54A 3TYEA 4O50A 3TAKA 4Y96A 3FA3A 1MW1A 1XIBA 2A3LA 2MNRA 1PWLA 3MDUA 4WX2A 3CPGA 3I7QA 3UCDA 4S3KA 2DW7A 1KGWA 1ZQ5A 2QCLA 3ARYA 2ZRWA 3AFBA 3PM6A 3T81A 4ZBCA 3BDKA 3TP4A 3P14A 3UG8A 3DERA 1CPUA 1A53A 4HU0A 5BRBA 4MAVA 1EDGA 2PFHA 4KMQA 2OX1A 1FWCC 2WBGA 2PDLA 1V7YA 4KCVA 1IWPA 3DHUA 3SY1A 2BY3A 3S1XA 3WNKA 1L9WA 4MB1A 1SO5A 4Y9OA 3UXLA 4D6HA 3L7RA 1N8WA 3WUBA 4LYKA 2RHGA 3NSNA 4WK9A 5D2WA 1UP2A 4HA0A 2CKSA 2QCCA 4QCFA 5I03A 1EP1A 2YW4A 4H9TA 3DCPA 4PRWA 1EXBA 3BC9A 5I6SA 1ZGDA 2EPLX 3GVQA 1XIHA 5A8NA 2VFIA 3NXLA 1AMYA 1O5KA 1XIMA 4JHMA 4UMCA 1ZJIA 2IW0A 4NHVA 3CU2A 4LAMA 1QRQA 3Q45A 1LBFA 3KS6A 2XTKA 4H7CA 1VD6A 3IJIA 2VZSA 1G9HA 5XIAA 4AEEA 2BOGX 1V0KA 2E28A 4XAZA 4GABA 3CIWA 1Z3NA 1FHVA 1O5RA 1JNDA 3W7GA 3QZ6A 4GXPA 4E4UA 4GX8A 5KMYA 3A5VA 3BSMA 4CD4A 1WDQA 4MHBA 4AMAA 1AODA 1UWRA 4YIWA 1BFNA 4IIHA 2DZPA 3ZO9A 2CBUA 1FH8A 5G4WA 3RXZA 2QF7A 4JL2A 4GZJA 3G24A 5KETA 4FF7A 4A35A 4NYYA 2Y70A 3LOTA 4DI8A 1XBXA 3WJYA 3PY2A 3BWWA 3N14A 4B5UA 2WZTA 2QDHA 3MA8A 2NT0A 5A6AA 2HPIA 2ISWA 4C6NA 4AF0B 3C8NA 2YYUA 3WLJA 3JU2A 4MPKA 1POJA 1TMQA 3WL0A 3G1VA 3EDFA 4MM1A 1E0VA 3GWQA 4RX0A 1MFVA 4U2ZA 1NU5A 4GIEA 3AU6A 4JIEA 1XLHA 1UJQA 5F4SA 1MI3A 4O57A 1N8FA 3PUOA 5AHEA 3B0YA 5HPCA 1W54A 2ASHA 2XH4A 4JEQA 3UNDA 4Y9PA 2QMKA 3P8JA 3UD6A 3WQWA 4J5NA 3OO2A 2XVKA 1H1ZA 3MW7A 3HURA 4YTUA 4GXWA 4WIWA 3GTXA 1H3GA 3IK2A 5HNNA 3QQWA 1TZ7A 1C8VA 2OZ3A 4ICMA 4UTTA 4H7VA 1S5MA 1DTUA 2QDDA 4Q32A 5HJYA 1FWJC 3W7DA 3DIPA 3SIZA 1R47A 1RVKA 1F8MA 1BRLA 3UZXA 4DJFD 4IXHA 1S46A 1ENUA 2VEPA 1X97A 4O53A 2E8YA 3OW1A 3WD2A 3C6CA 4O19A 2DJLA 3IJLA 1PYFA 3DZ1A 1C7SA 3WUEA 2QJHA 3LERA 1KCZA 2J9YA 1MUMA 3P6LA 2OQHA 2PB1A 3SRFA 1OG0A 4R5EA 4C6DA 3QH2A 3CAQA 2VO5A 4JY9A 2VZOA 2XSXA 3SM0A 3T4CA 1A5CA 1VFSA 2W91A 4MWAE 3PZUA 1KRCC 4X0VA 2PPGA 5E0KA 3RR1A 3QQ1A 4LXFA 2X2GA 2GVYA 2PTDA 4UOJA 1FWWA 4HJWA 1HIZA 3F2BA 4L9ZA 4MWAD 2PDUA 1T0OA 3RHGA 4WD0A 4XBSA 3OU8A 1VFLA 5FEZA 1TPUA 4HZ8A 1IT7A 5B7ZA 1PDZA 1UA7A 3D3AA 4FLOA 3WQPA 3E6EA 3QV7A 3BSHA 1J93A 4B2DA 3HV9A 4JN8A 4MMWA 3RO8A 2RDUA 3HPSA 3SUSA 3KHDA 5K3VA 1JUEA 1ESWA 4XX6A 4PC8A 1C90A 2XN1A 1RQEA 3VAVA 2XSAA 4YCPA 1H50A 5AYYA 5BRPA 1TWZA 1E1EA 3MSGA 1XKJA 1XG3A 3MKKA 2NQ9A 3L4WA 1F5ZA 2FPTA 5H6HA 1TR1A 4MNKA 4M56A 3VX1A 3DFHA 2Z1VA 1OD0A 3AIBA 2VC6A 5C9UA 2VI0A 4TX6A 4JDBA 2IXVA 1DOSA 1AQ0A 1FY6A 1KCXA 1NWUA 2E09A 3CJPA 1ZCCA 3IV8A 3M5XA 3TQKA 3A6OA 3DYOA 4ATDA 5D04C 3WEMA 2X41A 3PZVA 3G1SA 5E5CA 1LT7A 4O15A 5H1WA 1EWEA 5DMYA 1HKMA 3EEZA 4GQ0A 3C61A 3QV9A 5HAOA 3QKEA 2OQYA 2V38A 1UD5A 2HJPA 2VT0A 3H26A 3WH6A 4HYVA 2OZ8A 4HJFA 3II1A 3WNPA 5AHNA 3V5CA 3EPOA 2Y85A 3O06A 2EPOA 4UQBA 1OJXA 3HBLA 5I5RA 3IRDA 3VD4A 3CNYA 4BA0A 3SQLA 3SZ8A 1TR9A 2OSWA 3HFYA 1CWYA 3CAKA 3BLLA 1U5VA 1D8CA 1JPIA 4PMDA 2REQB 3B06A 3WG6A 2QV5A 3V0TA 1W3HA 3O8AA 3W22A 2E40A 3ZLFA 1ME7A 1XH2A 1EJUC 1XIJA 2P5NA 4AH7A 3HPXA 3SJ3A 1ZRQA 1KGXA 3IVUA 4JICA 3E0LA 2QHAA 3KLLA 1ONRA 1ISXA 2CLPA 1HO4A 2UZ9A 3LRLA 5D33A 2DIEA 2OWXA 3LZ5A 4CEXC 3AYRA 2E5CA 4H9MA 2GDQA 3OGVA 4HPJA 4HZMA 1TYGA 3SUTA 1NELA 2YCEA 2HDJA 3GHRA 1B1YA 1UWTA 1UUMA 2V2DA 3N6HA 1AJ0A 2HE5A 1XF0A 4XVEA 1VRDA 1QK2A 2WQDA 3TKFA 2V6AA 4Z1BA 3W7QA 2X1RA 1EBHA 5FIPA 3U3HA 4O12A 3LGEA 4PUMA 3USBA 1IT8A 1JQVA 5HWNA 4JY8A 4ZTYA 2VYOA 4OUEA 3FVMA 1QWKA 2PDMA 4RNFA 3R0UA 4WJ8A 3RMJA 1WB0A 2ZA1A 2PD9A 3F4NA 3EPNA 4V1YA 4XZIA 2WPGA 3DFNA 4ZGYA 3OIHA 5I07A 2C91A 1O68A 4YTTA 1KNWA 2ZA2A 4XAYA 4P2VA 1Q7MA 4JN6A 3RMEA 4ZXLA 4E8CA 1XYLA 4PCFA 3MUIA 4JCLA 3VD9A 3VGFA 2VRKA 2ATSA 2GZXA 3O7UA 5D03A 3IAPA 2OMAA 5FSEC 1TA3B 3PAOA 1XIDA 2WV8A 4UFHA 2GJRA 3KWSA 1Q65A 4AF0A 4DLFA 4EPKA 2H8ZA 1L2UA 3T05A 3HN3A 1VIWA 1F3WA 4FNRA 1B4EA 3GY1A 2DZTA 3B9EA 4XKMA 1M65A 1JZ5A 3EBVA 3PNZA 3U8GA 1S1PA 3NQGA 1EOMA 4R88A 2QULA 1PO9A 1QJWA 4W4QA 3PBMA 4PCNA 5FAJA 4JFUA 1UA3A 5D2XA 2W63A 3G3DA 2UY5A 2KX9A 3AZSA 1M7JA 3KVJA 1WZAA 4PTVA 1W5PA 4W87A 1J0ZA 3BZJA 2Z1SA 6REQB 1UPMB 1XCWA 5RUBA 4LOCA 2FZDA 2V3EA 4OOZA 1ECQA 3DOPA 2V3GA 3N9RA 3N9KA 4Z42C 3AUJA 2A85A 3P5ZA 1CCWB 4DBUA 2J79A 5AHFA 1NJJA 3W24A 3CH0A 4QSHA 2G4FA 2HS8A 3LHUA 3NO3A 4D9PA 2J75A 3WCZA 3AZRA 3FKRA 1OF8A 2PSNA 3G3MA 5M03A 3U4AA 4YWIA 1E56A 4DXVA 4KRZA 4IFRA 3VIJA 1LBMA 4M82A 4I8YA 1YHTA 1QI4A 2VGGA 1F3EA 4TMCA 1V3IA 4GI8A 4KRTA 1ZTVA 1F07A 4KIEA 4V27A 4B92A 3LM7A 1GQNA 3SGUA 4KFNA 3WQOA 4D6EA 3OZMA 3PNUA 1W1IE 3MUXA 1NQ6A 2TYSA 3F4CA 4E2BA 3H8AA 5LSMA 1NOWA 3JUGA 5KSWA 1PUDA 2HK0A 4K38A 2NV2A 4GRSA 1K9EA 2AGTA 3URNA 1XPYA 1J6PA 1OF6A 1R3VA 4CQAA 5CZ0A 3IACA 3AISA 3V35A 2UY2A 4PL2A 1P43A 5CCZA 5DT7A 3T07A 4OTKA 3TQVA 4H00A 4WR3A 4CEUC 3CLWA 3WH8A 4QG6A 1RPKA 3SAZA 3P0XA 1DJGA 3IVTA 2H8XA 1V93A 5G1TA 3NFUA 1G0CA 4X2RA 4AWEA 4DWSD 2DDXA 4MFEA 1QPQA 3FJNA 3HJEA 4LJ3A 1VYPX 5KTLA 1V02E 4WRHA 3K8LA 5EMUA 1BD0A 2I7GA 1FWRA 3MJMA 4M6QA 4BS0A 3CWNA 4QNEA 4PULA 2QJJA 4O10A 4HPGA 4WXYA 3TYAA 3LPGA 3NJ3A 3B8IA 5LIKX 1TWSA 4GO9A 1NVMA 5DRIA 5C8BB 5G2WA 4CN6A 4CN4A 5HWMA 4CU6A 2VKZG 2PP3A 1FP9A 4I5UA 2IKJA 4IIFA 2PDKA 1FX6A 1LF1A 2ALRA 2D23A 3VIKA 3U2EA 1ISYA 3W37A 1P6CA 2VCCA 2Z2AA 1HP4A 4JQ4A 2IKHA 2IQTA 3KM8A 4RKAA 3GR7A 3N6JA 4FF5A 4NUWA 4A22A 4HN4A 3GNPA 2VZUA 4GH1A 3D3FA 1ZZMA 4S2BA 4TTGA 1W1PA 2G95A 3I6EA 3AUOA 3WBAA 4C1NB 5C9XA 2ZYFA 3M7SA 5AN7A 2CWNA 4HGXA 1MEHA 2GGHA 4Z2LA 1RK6A 4KT2A 1SU5A 8XIMA 1JCTA 1D8WA 2VDIA 3GBEA 3LXBA 5EYWA 2QJGA 3DH7A 5LYRA 2QCEA 3PZIA 2CHNA 3MCOA 4C65A 1CI1A 3TYDA 3GTIA 2REQA 4I7UA 1AW2A 2QMJA 1QK0A 2BTMA 1BXBA 1I45A 3WD4A 2I9EA 3GNDA 3QY8A 3B9AA 4Q22A 1FWHC 3AWNA 4JIPA 1TMHA 3GW0A 3RF9A 4HSHA 2C1HA 2OOFA 4X22A 4ZMGA 1HGWA 4Y90A 4MJMA 2YJQA 5CEWA 4D1IA 3N4EA 3R5EA 1M7PA 4OKDA 1TWIA 1GVQA 1CGWA 1TV4A 2WCAA 3VNZA 2F9RA 3IUDA 3U4FA 3ZR6A 4KRUA 1ADSA 1RD5A 1A0EA 2YX0A 4V1XA 3UA3A 1C8QA 1W9BM 1ITCA 3THAA 4H6EA 4XWUA 5CC5A 2AQVA 5J5RA 1M01A 2XDFA 5JU6A 2DH3A 3PBYA 2WPBA 4NNCA 2GJNA 1V4YA 4N4QA 2VR5A 4S3AA 4I7WA 4B3ZA 3ZIZA 1W5MA 2FKPA 1XSKA 4FLRA 2C1GA 2INZA 4JYDA 4WDXA 1OFOA 3TJLA 1IXOA 2QGYA 4Y9MA 1LOQA 4OE7A 1CB2A 3W88A 1QI2A 2QPSA 2VMFA 4DJFA 4CNUA 3ARXA 4LVGA 5JQ9A 3L4YA 4O28A 2PDJA 3HGSA 4QDMA 2IS7A 2B7QA 3PPHA 2HVNA 5BU9A 3M07A 3AS3A 3U48A 1VLIA 1EB3A 2CHRA 1KM5A 3R8GA 1VGAA 1W91A 5D9OA 2BY0A 4XZWA 2DZBA 3EKZA 3VA8A 3W1LA 2X30A 4AU0A 1SJDA 1RJPA 2Q02A 2E4TA 4RW3A 1TA3A 5FACA 1UC4A 3ELFA 2JK2A 2FZBA 1CB7B 2QUVA 3EMQA 3OIXA 4HA1A 3B8WA 1F3XA 3I4EA 3QYQA 3EWDA 2OR2A 2OFJA 4EXBA 1ZL1A 4UMBA 4IX0A 5F2LA 5D8ZA 1SZFA 2J8GA 2BB0A 4Q7NA 4AD1A 5A2AA 2TPSA 2A7RA 3WDJA 5I3DA 2PDCA 3QOKA 3BLDA 3KL5A 4HN8A 4Q6JA 4EPDC 4M0XA 2AAAA 2XIMA 2ZUVA 6REQA 1KFCA 1OX4B 4QGCA 1KV8A 3HTWA 4W7UA 2Y8VA 3VKBA 2C0AA 2W66A 1P6WA 5AC6A 3PJXA 3W07A 3EX6A 1OK4A 4O0QA 5KZMA 3KBMA 3AXHA 4ORMA 3V5FA 1TREA 4Y9AA 3WDIA 4GZ7A 4LUJA 3N4FA 5HWJA 2XWDA 2CZDA 5HDRA 1OK6A 1E5JA 4JTQA 3ZT7A 2VENA 2ON3A 1J9YA 1QOQA 3UW6A 4L6OA 1U33A 4F0MA 1W31A 3QEZA 1XDLA 1VEMA 2SFPA 4ILSA 2DZXA 5C71A 5CGMA 3SO7A 2J9XA 4GYFA 3S1VA 3I6TA 2WHLA 5JIWA 3QSTA 1GZGA 2C18A 3I65A 3C5QA 2X0SA 5LIXX 4JTKA 3GHSA 3VOIA 4C6EA 3APTA 3EDKA 2OVLA 3GXNA 1C9DA 3SUUA 3ARVA 4IP4A 1US2A 4IQJA 1OVDA 5CAKA 1GKRA 1LJYA 1CXLA 3VVGA 1ICPA 5FF4A 1BG9A 2YB4A 1G01A 3CQKA 2ZCGA 3W0KA 1RH9A 4JX6A 1W3IA 4BF5A 2CPUA 4V2XA 1YE4A 2QVNA 4LYRA 1KO0A 1CT5A 3DYMA 4B3LA 4LB3A 5DFAA 3LSCA 3UNTA 3SQMA 2QLYA 3QRHA 2JIWA 3VU2A 1ZJAA 3RX3A 4ZE4A 5FI8A 4GOAA 3F2DA 1SW7A 3F5KA 1TUXA 1UBSA 2PF0A 4RDYA 1IF2A 4CD6A 1X1ZA 4NZCA 3S46A 1ZNNA 2BOFX 3A4JA 4DJED 4NT0A 1YDNA 2ZX9A 4JTFA 3V18A 1JCYA 4HKPA 3L0NA 5H91A 3UWZA 5DBTA 3WNMA 3W7HA 1AQHA 4M6VA 4LSBA 2BNJA 3KP0A 4IFOA 3AIVA 1XUUA 3GYEA 2Q71A 1QHZA 3MMTA 4LU0A 3ERPA 1SFLA 4FEZA 2ZICA 5LGXA 3H2FA 1OBAA 1A3HA 3E3HA 4JQ3A 1OFRA 3AIQA 1M9HA 1E4MM 3TAOA 3R0KA 1KXVA 4KW2A 4QS5A 3S9ZA 5GJPA 4D6CA 1X6NA 4GVHA 3TSBA 4C1NA 1C8YA 4D8AA 2GJLA 2GQ3A 4L1WA 1GW9A 2HXTA 3WQ5A 3AICA 1CBGA 1FWNA 1RY0A 4HTBA 1EKOA 4M51A 3VDGA 1W2VA 1WKEA 2Z1KA 3MP4A 1RJQA 1DJNA 3EMZA 4C7DA 1NDWA 4QTGA 2Y2WA 4LAZA 4J3UA 4FOUA 2DVXA 2VX4A 5LNUA 4MKVA 2P0OA 4POCA 2NQHA 3TTYA 3LCFA 4O1BA 1XLIA 3AIWA 4AZCB 4ECLA 3GD6A 3QR0A 2HZGA 2ZTJA 4AD0A 4US6A 4HCHA 3DBPA 3S5SA 4XBKA 1XIIA 2HQAA 3NQCA 3BV7A 3C2EA 2WC7A 1FWTA 3QBUA 1JCLA 5EB8A 1I0DA 1ONXA <