2FH8A

Crystal structure analysis of klebsiella pneumoniae pullulanase complexed with isomaltose
Total Genus 310
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
310
sequence length
1052
structure length
922
Chain Sequence
DVVVRLPDAAFGVALADAHWVDKTTLLWPGGENKPIVRLYYSHSSKVAADSNGEFSDKYVKLTPTTVNQQVSMRFPHLASYPAFKLPDDVNVDELLQGETVAIAAESDGILSSATQVQTAGVLDDTYAAAAEALSYGAQLTDSGVTFRVWAPTAQQVELVIYSADKKVIASHPMTRDSASGAWSWQGGSDLKGAFYRYAMTVYHPQSRKVEQYEVTDPYAHSLSTNSEYSQVVDLNDSALKPEGWDGLTMPHAQKTKADLAKMTIHESHIRDLSAWDQTVPAELRGKYLALTAQESNMVQHLKQLSASGVTHIELLPVFDLATVNEFSDKVADIQQPFSRLCEVNSAVKSSEFAGYCDSGSTVEEVLTQLKQNDSKDNPQVQALNTLVAQTDSYNWGYDPFHYTVPEGSYATDPEGTARIKEFRTMIQAIKQDLGMNVIMDVVYNHTNAAGPTDRTSVLDKIVPWYYQRLNETTGSVESATCCSDSAPEHRMFAKLIADSLAVWTTDYKIDGFRFDLMLYHPKAQILSAWERIKALNPDIYFFGEGWDSNQSDRFEIASQINLKGTGIGTFSDRLRDAVRGGGPFDSGDALRQNQGVGSGAGVLPNELTTLSDDQARHLADLTRLGMAGNLADFVLIDKDGAVKRGSEIDYNGAPGGYAADPTEVVNYVSKHDNQTLWDMISYKAAQEADLDTRVRMQAVSLATVMLGQGIAFDQQGSELLRSKSFTRDSYDSGDWFNRVDYSLQDNNYNVGMPRSSDDGSNYDIIARVKDAVATPGETELKQMTAFYQELTALRKSSPLFTLGDGATVMKRVDFRNTGADQQTGLLVMTIDDGMQAGASLDSRVDGIVVAINAAPESRTLQDFAGTSLQLSAIQQAAGDRSLASGVQVAADGSVTLPAWSVAVLELPQGESQGAGLPVSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords pullulanase
publication title Crystal structure of pullulanase: evidence for parallel binding of oligosaccharides in the active site
pubmed doi rcsb
molecule tags Hydrolase
total genus 310
structure length 922
sequence length 1052
ec nomenclature ec 3.2.1.41: Pullulanase.
pdb deposition date 2005-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02922 CBM_48 Carbohydrate-binding module 48 (Isoamylase N-terminal domain)
A PF03714 PUD Bacterial pullanase-associated domain
A PF11852 DUF3372 Domain of unknown function (DUF3372)
A PF17967 Pullulanase_N2 Pullulanase N2 domain
A PF18494 Pullulanase_Ins Pullulanase Ins domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fh8A02
2.60.40.1130 Mainly Beta Sandwich Immunoglobulin-like Rab geranylgeranyltransferase alpha-subunit, insert domain 2fh8A01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2fh8A04
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2fh8A03
5JPMB 1HJXA 4Z9KB 5DRZA 1OAYL 1NGWA 4ZFGL 2AGJH 5CP3A 4FNPA 4NKQB 1F11A 2AXFB 2NX5E 1T1YA 3FQXB 3MRDA 3J8F7 5MI0B 1JF1A 3BDBA 5KANG 3UTTA 4LQFH 1A7NL 3ZKXB 5A3HA 4L9LB 5AYUH 1KYOJ 1CDYA 4J4PA 4YHOH 2X2YA 1G9NH 3ALWA 1S5IL 2QHAA 2PBGA 1GHRA 3LZFH 5MEOA 1A7OH 5I66A 1XSKA 1YJDH 1MCCA 2Z93B 2FWOB 5DMKB 1KTBA 5KVEH 1ZT7B 5I1HH 1CN4A 4X6FA 1RUAL 3QQ4A 4XMPL 3IDNA 5EBLA 3AZTA 1PG7W 2BX5A 2ED8A 5D1QB 1A6TB 3ZDYE 1NCWL 2X5PA 4GAGL 2Q76A 4OT1H 4C56D 4M82A 3AOFA 1X7QB 2YPVH 3VFMA 2XWBA 4PJFF 3TIDB 3KYMB 2VSCA 1H5VA 1A6VH 4M3JA 4Y4HA 3WY2A 4GXPA 2HN7A 2IAMA 3QNZA 1JPSL 2FH8A 1PIFA 5DJZA 1J18A 3SIMA 4HFUL 5TQ2H 4PB9L 5J89A 4BKLA 3BUDA 4XPAH 2Y1VA 5GGSB 3NH7H 3MGTB 1TCMA 4QOKE 3ALFA 4OD1L 4C58B 1INDH 1G0XA 3MRKA 4GW4B 4ZD3L 2NW3B 3BP6B 3AXXA 2VDRL 2YSSA 4YUEH 2AV1B 3QUYD 2CJUH 1OAKH 3RVXC 5T1KB 4LEOA 5BS0E 2GSGA 3BZEA 5LXGH 3TNMB 3QOKA 4WKAA 4FS0A 2I5YH 2D1ZA 2XFFA 1J0JA 2VXSH 5C70A 3B4NA 5C07B 4B5EA 5IDIA 3PWPE 3PP4H 3QUML 3STZA 2XN1A 1RAMA 2OTUB 3GSUA 5CEZD 1FNEA 1LE9B 2WVTA 5C0JA 4WV1A 2JJUA 2LTQB 4P57B 32C2A 4ATDA 5CJOH 4XPHL 3RGVD 4QLJA 3O0RL 3U9PL 4XB8A 3BWAA 2Y8KA 1HYRC 2L4OA 4HH9A 3CU7A 2XZAH 1JHKH 3QDHA 4LFHD 2GJPA 2VERN 3NAAH 3HTLX 3SDCC 1KF9B 1ISYA 4EIGB 3WUWB 2DBLL 4MQTB 2HWZH 1D5BA 3QR3A 1MOEA 1Q94A 1GJWA 1OWQA 3TA9A 4G9DB 4WTZA 2PW2B 1I1YA 3O6AA 4X6CA 2IBZX 5KSBB 1U93A 3GMPB 4NSBA 1FIGL 5FYKD 3GNPA 2A2QT 3N1MC 1T2QL 1BG4A 4K3JL 5E5MA 5IMOB 5DR5H 4M7ZB 2CHNA 1EAPB 5TE4H 5SX4I 2A9ML 4CBPA 1GIGL 3VSTA 2BK8A 4FXGA 4Y5VC 4LLQA 1XCWA 3ARBC 3IDYB 5FUOH 4PJIE 1IGYB 1SYTA 2W0PA 2Y23A 1OARL 2BJMH 1UQSB 4YEFA 3S5LG 5F8QC 2BVQA 1OTTC 2HLAB 5KVGL 2Y36H 1OGAB 5CSGA 1A1OA 2P5WB 2V9QA 1K3ZA 3HMXL 4KKNA 2QSTA 4N9GB 3WKZA 5IM7A 2ZCKH 3WSQH 4NZUL 2WMIA 2L0DA 1XIWC 4CADA 5ENWA 4NN7B 3MRIB 4G42B 5DUBA 3QDMD 1U41A 1BPLB 4HSQA 4ZFFA 1BBDH 3JWOC 5JW3L 1UR0A 2ATPB 2CITA 3THDA 1G7HB 2VRQA 1I3RB 4PJ7F 4U6VL 1A8JH 1C16B 4X7FC 3QXAB 4F7PA 3MRMB 4F3FA 3DHJA 4NO0B 3F62A 4U1MA 4PY8J 4Z7VF 2ZUQB 3G6JB 3SE4A 3OPZH 2F5BH 4F8TA 3GJFH 3SKOA 4JPIB 1T6VN 5GISL 5T5NG 4G8IB 3REVB 1LF1A 1IT9L 4KFZC 1ZU8A 1KXVC 2VQ1B 4BS0A 4FZ8L 1W32A 1CLOH 2YDSA 15C8L 3CDGB 4OFYA 1DSFL 2JCCF 4X5WA 4MAUH 1H5BC 5GXBB 2ZWLT 7FABL 4J3SA 3PZQA 1XAUA 3OKMB 4RFEA 1LL6A 1A6ZB 4PRHE 1CE6B 4GKZB 2VX6A 2Z31A 1ZAGA 4U5KA 4L8SC 4LPCA 4HJ0C 2BNQE 2WSPA 3T0DA 4OIIL 1CBGA 3X17A 1X5LA 5EPMB 4FQXB 4OCWL 4JDVB 1NANI 5EZIL 2HISA 4I3GA 1EFXA 4QXTB 4WSKA 1PZ5A 5GRUH 2X8RA 2WV3A 3WH6A 3GRWH 2YZ8A 3ARWA 2CLRA 1OCQA 3RTQA 4G6JL 2FIRT 3QUZB 1INQB 3O3AB 2GFTA 3WV0A 1UZ4A 2JF6A 1FPTL 4OUUB 4WI4A 3LKQB 3LQMA 3VFOA 4PRPA 1FDLH 3KLAA 5ABEA 2EC9U 5F71A 3TT3H 4OFDA 3JSSA 5F1NA 3B9DA 2VLJD 1E6QM 3GJFA 1CNVA 2FSEA 2DT2A 3T2NL 5DURD 5IW6B 1WWBX 4WW2F 4WFGD 4B7IA 1T03H 1HKLL 3M45A 5HSFA 1FFOB 2WSKA 2CLZA 2F74B 3BYTA 2VABB 4DAGH 2XFRA 3VWKD 1A0QH 5IW1B 1BFNA 3AUVA 4NHUB 4G8EA 4BK5A 2V38A 4AD0A 3T3PE 1J87A 5IF0B 5DJCB 4PMRA 2Q20A 4RZCB 3E2HB 4FRWA 4HXAL 5ECJE 3CVHH 5ILTL 3T08A 2R1XA 1EHAA 5IFAL 3TBWB 4QY8B 1DBML 3GRWA 4LKCA 4YK4C 4P3DA 3MYZA 4MNJA 4IIQA 4OGYH 4R4BB 3DVNB 4BH8B 3QEHA 1UR8A 1UWXH 3B9AA 1OT2A 3EJZD 1E3XA 1HYSD 3OAUL 4WVRA 3NZ8B 4OJYA 1N6QL 3NFSH 5IBUG 4LCIL 1JDDA 3Q48A 5J3HD 1QHZA 2A3EA 1A4JA 1JXJA 2IH1A 2IMNA 5I6XB 1R5IB 3OJ2C 4FQCL 3UAJC 5GGUA 2AQ2A 3O3BA 2PO6D 2V2TB 1FO0H 1ZSDB 5EU7E 4JHBA 1X5YA 5ELIA 4DKEL 3PXHA 5JR1H 3EO1B 3QQNA 3ALPA 4JHOA 3IKKA 4LCCB 3GI9H 4HK0A 5E8NB 4LP5A 4X4XB 4X0KB 5DSCB 5C0FA 1CU4H 4BSWB 3TPUA 4CCDA 1JK8B 1TJIL 1T0MB 3RPMA 1YEIH 3UX9B 1L8NA 3EMQA 1NBZB 3P9MB 2KH2B 3FHQA 5FO7B 2H1PL 2ZOLA 4HX1B 4QHNA 3U4BL 2E6PA 3OGVA 4P5KA 2CH8A 3I3BA 3BAIA 1HQRB 3L3IA 1LWRA 5L2KB 3S5ZA 1WUNT 3GBNH 4JO1H 3O9WC 5E00A 2YMXH 2HH0L 4Z0BH 2NR6C 2QHLA 4U6TA 5FDWA 2NY2D 1C5BH 3HZYA 2WNWA 2EICA 4GAYA 5MP6H 3D85A 5A6BA 2F7PA 1IL1B 4MXQC 1VGEH 1E4LA 1I7RB 4YDVB 3GJFK 2XJ7A 3RO8A 1UR1A 2BSSB 5HHNA 3NIGF 3ZTNL 3AVEA 2O9RA 5D2NB 1ZA6A 5EU6E 5KZ6A 3ZKNC 2X1OA 4NJ9H 3GM8A 3TVMD 5CXPA 1FFPA 3ZT7A 4XP6H 2OW7A 2FX9L 1JD9A 4W68A 3VKKA 4G8GB 5FKPA 2A6JA 1O7SA 3U46B 3DROA 5FF6B 4GFTB 3BQUB 3BKCL 2PETA 1KJ3H 4LAQH 3VFPA 3ROOA 3TCLA 4OZHE 3KPLB 4D0BA 1UWGH 3MRHB 4AIEA 2XG9A 2ED9A 3GSWA 1B0RB 3U2SB 1HOCB 4M3KB 4RBPH 2P5EE 3WCYA 3BAKA 4LSDA 4MZ2A 1DQML 2IQ9L 4TVPE 3N18A 1C8YA 3RNQA 1UXWB 3MCG1 1B4JH 3HPLB 4ZUVA 4YHGA 2W63A 4POYA 4Y7MA 3BD3A 4UINL 3C60B 3SO3B 2VDNH 4JY6A 4C55A 4J7RA 1AO7B 1OCWH 4J1UA 4XX1E 2FE0A 4UQ3A 2JIXD 1CDBA 4Y2DB 3T09A 4S1QL 1ZGLB 3IJYB 4HOWA 2XQBL 5KEZA 3FFDB 3T0WA 5MI0C 4DEPB 3ZKXC 2YPKB 4L9LC 4QRRE 5HYFA 3DUSB 1XGUA 3FFCE 5E2TH 2PXYD 4JN2B 4ZOEA 4OZGF 2X89A 3QISA 3WFHB 2BZDA 1W9VA 4HS8H 2FJGB 5GGVH 4HUMB 1CDUA 3DI2B 3C9NB 3KLHC 1IBGL 4QXGL 1ZA3B 4Q2ZA 3CFEB 4V1DA 4WI5A 1QFPA 1I9EA 3BSZL 4YFDB 4HUVB 4PGCA 1OAZL 3HMWH 3S98A 5JQHC 1BFOA 4NO2B 4KJWC 2CRIA 3CZFA 5D1QC 5C6PB 1ZEAH 1L6ZA 1LGVA 1U2YA 4FQJH 4LKXA 4RDQG 1KIPB 1KGCD 3B8SA 1L7TH 1UWXK 4WF7A 3HNVL 4X8XA 3BH4A 5I24A 5TH2B 4PTTB 3VG9B 4O51A 1H3VA 5B38A 4D6IA 3N1AA 2NYYD 4NKOA 2WP3T 4P4KC 3HI6L 1P4BH 2R4SL 4LK4A 4LHQB 2J8OA 3BZFB 1RPKA 4YWGL 1LE5A 3GBEA 2WC4A 1IKNA 3FT2B 4LLMB 3WH8A 4BJLA 5DWUH 4UBDC 1INEH 5KBNC 4JM2A 4WHYG 4PJXA 3ZE2E 3WIHA 1GC1H 1B0GB 2R8SL 1SEQH 4KZDH 5C0BD 5SWSD 1MJJB 4XT1C 1VADA 4JZNA 3VXSB 3CX5K 3GGWA 2HT4D 1HI6B 2AK4E 3PWPA 4XNUH 1W3HA 5C0AB 3BMWA 3CFDA 1RZFL 3LSOB 4LPTA 3VFGL 1CFNB 3GH7A 2R15A 3CFIC 4JR9L 3SJVE 3VXQB 5IB2B 5I30H 5HYJB 4KJPD 1RI8A 3UTOA 1JP5A 1HKKA 3ARXA 2ZUNA 3HAEG 3AQUA 2AV7B 4MADA 1A9BA 4FZEL 3D69A 5C0DB 4OZIF 3PZ9A 3FO0L 4OUOA 4LSSL 1AXIB 5MERA 1DLFL 4P5MB 4J6RH 3TTQA 5I77A 2B0SH 3KWXA 5HHXL 5ALCH 3T4YA 4KUCF 1KB5H 4R4FL 4HWUA 1I85A 1OB1A 1H0GA 4LMQE 1ITXA 5GS3A 3UBXG 1TZIB 1YA5A 3HE6D 1KCSL 3TT1H 1W1VA 1X5IA 2FATL 2YLAA 4W7VA 2DRUA 4Y4FA 4HPOL 4XXDA 1FOBA 5I76A 3I6KA 2HFFB 4M43H 3WF3A 4TRPL 1UB6A 3DC0A 1S9WA 4M7ZC 4RMRA 1TJGL 4YR6A 4NBZB 2FR4A 1UGNA 1HIML 1F6AA 1JNEA 1YEEL 1SBSH 3CH1B 5J12B 4PJIA 1MVYA 4R5EA 1JI1A 2BRQA 1NCUA 2B5IB 1U8IA 2E9IA 5I1KH 5ESQB 5C09B 3RBGA 3IDYC 4N5ED 3IDMA 5DD5L 3PG2A 4PJDF 2YWYA 4QRPD 4AMXA 1JNNL 2DQHH 3NCJH 3WH7A 3LD8B 4P59L 4Q7NA 5CILH 1WDSA 4XNMA 1MCQA 1NUGA 4JY4B 2QADB 1JNJA 3ZDZF 4Z6AT 3QXVA 4RBPK 1G6RB 4LCYA 3FO9B 3CUJA 2VDQH 2R9HD 3H3PH 3RAJH 3SBWA 5ID0A 3GH4A 1I8IA 4ODSL 4AIUA 1E4JA 1TJHH 5HHOA 4PB0L 4U1KA 4JFYB 4NN7C 4ENEC 3UO1H 4KUZH 5A2LH 3I50H 3S3SA 1KB5A 2PC8A 1WBXB 2IMMA 3FCTB 3S7GA 1NCBH 1DANU 1F3RB 4OIFA 3JV5A 5BZWB 3VX1A 2X4OB 4P23C 1BM3H 1W0VB 2ZUQC 4UI2A 3UJIL 3AIVA 4DUWA 4HLJA 5JXEA 3S36L 5FKAB 2I07B 4U6HB 3ZT6A 3T0EE 4FNSA 3EOTH 4P46D 3BIKA 1RQ5A 5J57B 1IGMH 3KJ6H 4PRHA 5CHNB 5KSAB 3HUJA 4MNLA 3D25A 1R3KB 4W88A 4HMDA 3A3HA 2BNQA 2A38A 1CFSB 4GW5A 5F1KC 1E27B 4HWEL 2NT0A 2UYLA 3VIFA 1NGXA 1A7RL 4Z7WE 3SDXB 1RK0A 3W26A 3WF0A 1NGQL 3CSGA 3RWHA 4XB3A 2AJVL 3VXNA 5K9JL 1E4XH 1W9PA 4ORZC 1W8OA 1RFDH 1V08A 1WIUA 2A6IB 2XG5A 4PGBB 5IQ9B 3QUZC 3BPLB 4KKAD 4RAVB 1IZKA 5E0CA 1R3LB 4Y5XB 4W5ZA 1KNOB 3B5TA 3A6CH 3O6LH 2OM5A 4BSJA 3DX6A 1NGPL 4MB5A 3AGVA 1T89C 1YY8B 3SQOH 1SM3H 2OX5A 2A74A 1S9VA 1JFXA 4AG4H 4MHHG 1NGYB 4U1SA 5C7XH 2BHZA 1UVQA 2J7LA 4FFWC 3IGUA 1C92A 5KVFH 2FEDC 1M6OA 3LRHA 4TSBL 4HCRH 2KKQA 1NDMB 4G7YL 4NOBA 1E4KC 5CGYD 3U7BA 2IC2A 5AAMA 5CLWA 4H88L 2DI8A 1NBYA 2BP3A 5JHDB 1NLBH 5M7QA 3MRCB 5D9OA 4QAWA 4PGZA 1ZHLB 3ES6B 2YR3A 4XNYL 4HWBH 4C54A 1A22B 1KEMH 4U49A 1S78D 2VQTA 4X5XA 3WNKA 1OVZA 1H3GA 1Q38A 2NNAB 1QFOA 4Q0XL 3ZSSA 2BMKB 4JB9H 4M48H 2R2BA 3E2HC 5DO2D 1BEYH 2P24B 2DMCA 1F42A 3MC0A 4X7DC 1C08A 1FSKB 2W9DL 2G5RA 5I1JH 1YPZE 4AZCB 1CFTA 4HBCL 3LN5B 4DFIA 3GNMH 4E0RB 5E70A 4LOUD 5KOVC 4A6YH 4WIWA 1T5WA 4G43B 4IOFC 2AP2A 4PG2C 4MD5B 2X4UA 1KIRA 2W07A 4MAYA 4HUWB 3MUGA 2XA8L 4OLEA 1CGVA 5I6XC 4YGVA 3GBMH 4LHUB 4YJZL 1HXMA 4UB0L 5EA0L 2O5YH 1YMHA 3U9UA 5GRXG 2E7CA 4HCRA 5HGDA 2ATKB 5CSYA 1BPVA 1RURH 2AI0L 2EH7L 3HNTH 4LCCC 1F4XL 1I7UB 4MA7L 3ZR6A 3IJ8A 4JFWA 2DIAA 2V9TA 4ACPA 3C6SB 1V6YA 3Q1SL 3FAXA 4WGVB 1CLVA 1I3GH 4A4AA 4KZEL 2G5BB 1BX2B 5LBSH 4FNTA 4MVBD 4PUBH 1RUMH 4N1EA 2Z91A 1CF8L 4ETQB 4TVPH 1U8MB 2ENYA 2UVFA 3NFPA 5BVJB 4UV7H 3B9KB 2ADFH 1NCTA 2AKRB 4BFBD 1MCSA 5DQ9B 4MDOA 5F9OL 4ZFOB 4X7TB 1KCRH 4NM4L 3VXTA 4IRZH 3KHOA 1R86A 3RU8L 1R5WA 3EFDH 3CLWA 4A6YA 5DD6A 3UEQA 4TX6A 2DGAA 4LCWD 1IFHL 1G7LB 3S5LA 4JFVA 1FC1A 4WO4A 4UIKL 3QPXL 4R8WL 3L3OA 3P9LB 2VLKB 1NOWA 1RZGA 4G5ZH 3AB0C 4DTGH 3KPRE 5EU6A 5FEBA 3UZEA 1GGBL 4I48A 1P9MA 2WANA 4LCUB 3HCVB 3Q6FA 5D2NC 5BZDB 3FRUA 5CINL 2G3MA 4F7MA 5BJTA 2XXCB 3QEUA 3SUSA 4HHAA 5FHBL 3X11A 2XTLA 3O2WL 3UTSE 2PWEA 4ZNEE 2ZXBA 3O45B 3WLBB 5JBEA 2HFEB 4ZUWB 3BQUC 1KPUB 5E0QA 4K3GA 4JVUA 4NYLA 4FMKA 4CVXA 3BH8B 1UZ8A 3QSKB 2R1WA 4I3RL 4MA1B 4XVJL 1NOUA 3V0VA 5E9DA 4QLRA 4JDZB 5I1CH 4ZXOA 2QKIB 3LQZB 5D7JB 3SCUA 2ZE0A 4PY7B 3FRPG 2F19H 1MCJA 5GNXA 2R23B 4BZYA 5T1LD 1B3VA 3VCLA 5E99L 4I18B 4L3CA 3QG6B 5F6IB 5E7BA 3MCKB 4ZFZA 2IGFH 3SO3C 3LS5H 3CD4A 4C57C 4QRQB 1LO4L 2J5LB 1NPUA 1PPIA 5IJKC 4D9QE 4Y2DC 4PJHF 1HINL 5FB8B 3FB7B 5F89A 3ARDB 4JRXB 4P2RE 2D2OA 3UESA 2P7TB 4W81A 4DEPC 4DKAA 4AT6B 1BFVL 4KI5E 1A3HA 1K85A 2YPLA 1JPGA 1EMTL 4A3YA 4F33B 1J8HD 4HIEB 3BZ4A 3RIFF 4NRRA 5I8EA 3FMGL 5IBTH 2HFGL 4FQHB 3CV5A 1BLNB 3ARGA 2BCKA 4KGJA 1Z32X 2VZ3A 1E71M 1SJVA 1QKZH 1ZT1A 2ARJQ 3MRQB 3VH8G 1UH2A 3EJTA 2V6HA 3P4OB 1S7XB 1WKYA 4D8PA 5TPWL 3KR3L 2VUYA 4PR5B 4P8VA 3MODL 1F3DH 2UZIL 1JGLH 2CKBH 3NIDE 3OJDB 1HP5A 4HIHB 3MLXH 2GAZA 1CGUA 4UOW1 3NTCL 2PF6A 5HHQA 2FO4B 3DX8A 2V7HB 1CLZH 2GTWB 3VG9C 5IMLB 1E6NA 4LSQL 5TE7L 3NIFE 3BDYL 2W60A 1CLYH 5GNYA 5IG7B 1NC4D 4ORGB 3BE1H 5E8EB 3MJGX 3DXAA 1UXSA 3EFFB 1DQDL 4JO3L 3V6BR 1HH9A 1BJMA 1HXYB 3F7YB 3RUGF 5KG9B 3D2UB 1FP5A 5KSUA 2DL2A 1V0KA 3FHAA 4OLVH 2NY6D 3EYVB 2W9LA 1FZKB 3MRGB 4P0DA 3I6GB 1LD9B 3E8UH 2OL3B 3GDBA 1HHGA 43C9B 1DL7L 2FLRT 4JZOB 1OAYH 4YX2H 5HYQB 3F5WA 1TTFA 1R3JB 4NJAL 3D18A 5FECA 3D39E 3BVNA 3HRZB 1J7VR 1YMMD 2X09A 4L1DA 3W28A 1A7NH 5K59F 2PTVA 3OL2A 3WL1A 1OWRM 4V2CB 3P2TA 3IK2A 4YHPA 4NC0B 4GRLA 2CKBA 4UILL 4D1JA 4M9PA 3QZWG 1H1NA 4FLOA 1S5IH 3F12A 4DOHE 2ZUYA 2W4XA 5BXTA 3BI9X 4XAKD 3CFKA 3N06B 2NXYD 4CD7A 3C6LB 2PYED 1KJVB 3TO2A 3VMOA 4PJCA 2VN7A 5DK0A 1GOMA 4WDIB 3HG2A 4P8WA 5J11B 2L7JA 1AC0A 1P7QD 5DEFB 1XRVA 1O7AA 1KB9K 1ISXA 2H2PD 4OD3L 1NCWH 5B3JF 4K94C 4KMQA 3JV4A 3IVKB 2EADA 2ZPKL 1GW1A 1ODUA 2VCAA 4IRSC 4I0PD 4R26L 4OGXL 2XVPA 1MRFH 3QCTL 1JPSH 3SDDA 5K93A 2DSVA 5T3XD 4ONGH 5J12C 3NDZA 4HFUH 4WTXA 4K8RD 1QG3A 4PB9H 5BRZE 3CVIL 2H26B 5FUZL 5IWLA 3EJRA 3WF2A 2C4FT 3FXYA 4FQIL 4L8DB 1ZS8B 2XN2A 4OD1H 2GY7B 3B3IA 3LD8C 2GJZB 3W37A 4L4VB 1Q6DA 1E72M 1PBGA 3BN3B 3HG4A 2QADC 3NABL 4ZD3H 2D0HA 5GQBA 2VDRH 4HH8A 4UIMA 5D7LE 1W8NA 5I0DA 1BOGA 12E8L 1MW1A 3WDJA 3TIEA 3VFSB 4N0RA 1KUMA 4I4WA 1IEAB 4LNRA 1W0WB 2RGLA 1XGRA 4ZOBA 3U6RB 4XNXL 2NY4D 2XTJB 1VPOH 4Y0GA 1AGDA 1F4HA 1WTGT 1UD3A 4CVWA 4AEIL 5F97E 4IDLA 4EQ2A 1M05B 5F88A 4DM1A 1VFAA 4K71B 3SKNB 4AEHH 2DT3A 4XPHH 1NMCB 1OF2A 3O0RH 3U9PH 4UNIA 2W91A 1JWMA 3IFPA 2J7DA 4Z2LA 5L6YL 3DDGA 3T0EA 3VXUB 2BNRE 3QUXC 4NNXB 2DBLH 4U1HB 2D7QA 3AY4C 3SGJA 2F54B 2GT9B 4ACZA 2VE6A 4AL8L 1VFBA 2PUQT 5D7IE 3TYFA 4DUVA 5KSAC 5JUEL 1TQTA 1EVUA 5KANI 1FIGH 4PBVC 5CMAA 3TH3T 1ZVSB 2C3GA 1R24A 4XXCA 1T2QH 3QWQB 3L4TA 3O8XB 4K3JH 4Z7WA 4NQED 1BWWA 5K9KA 2F53D 3DGCR 1MHHB 5DC0A 4WHYH 4R96A 1GIGH 3FQRB 1S9YA 2VNCA 1KJ2L 3WFBL 1SVCP 1QNPA 1VBUA 5EO0A 3RIAK 2XVNA 3V6FA 1JDAA 4PJFE 2DICA 3QUMA 2LVCA 4PD4K 1WIPA 5C0CB 4JFOB 1V05A 1MFVA 1K6QL 4EANA 4L4TB 3VNYA 3BPLC 5KVGH 3HMXH 4Y5XC 2AMGA 1MQRA 1NCDL 5EZLB 4AWEA 4JGUA 4MJIE 4Z0XB 2CEQA 4ZUTB 4NZUH 4LRIA 4EDWL 1JPFA 3FB8A 3HAEH 4CMMB 2W9EL 3IT8D 2PCPA 2VRJA 3LRKA 5CEZL 2APFA 2WBJB 4OZFB 5DK2A 3FQTA 5JW3H 4M29A 2A6DB 1MIML 4LLVA 3CSYB 3OGRA 4NGHH 5HHME 2EBNA 4ZSOA 4D0DB 1MWAB 4AZIA 1MHEA 1E4XI 3K80A 3NCYS 2VDPL 3W6MA 3HZVA 3LY6A 5GISH 5HVHC 4U1GB 2VZ1A 1OSPL 2R2HA 1IT9H 1KB3A 3IDGA 5HOSA 1P5VA 2RCSH 5GJSL 5JA8B 2OYLA 1E56A 4FZ8H 2WIMA 15C8H 2IG2L 1DSFH 3AS3A 1FCCA 5FYKL 7FABH 5I79A 1FSKC 2LABA 3ULVD 1C93A 3DX1A 3PUCA 4XVTH 2Y07L 4JRYA 3GNOA 3HMXA 3AISA 2BY1A 4HIIB 4IRJA 2ESVB 4OIIH 5DXWA 4UQCA 4OCWH 3ZDXE 4TTDC 4CN4A 5EZIH 1V6WA 2IF7A 3HAEA 2P8MB 3FOMB 4UU9A 5DVMA 1WICA 3RX5A 1CPUA 3DWTA 3QOMA 4WWKD 3G5XA 3ILPB 1XF3A 4NRZB 1T1ZB 2CUIA 4G6JH 4QCIB 3HC0A 2CKSA 3MLZL 3HLAA 1FPTH 1QLRA 4YHNA 1Q9WB 5ALBL 3TBSB 5JORA 4YZFE 2QQKL 1CGSL 1SYSA 1Z3GL 2JK5A 2CIPA 5C8JA 2J3SA 3H7LA 3UBXA 3BYYA 3MUJA 3UTQB 2AJUL 3AZSA 3T2NH 1QBBA 5D71H 1K4CB 4F7CA 1HKLH 1LP9A 4H8WH 4Q58C 4GRWE 4NQSA 1ZOXA 2EDOA 3QNXB 3QI9B 4LLYA 3GMMA 3BAJA 2Z4QA 4ZUSA 3S4SB 1FFNA 3B9KC 3GMRA 1UG9A 5ISZB 4PJ5A 3ESVF 3RTQD 4M8UA 1IAIM 4PJ7E 1RZKC 2F9BT 1HEZB 1U8PB 4PRPD 1KTDA 4FTVE 2VKXA 3KPRA 4HXAH 5ILTH 4Y19A 3ZYJA 4NRSA 5IFAH 1GQIA 1DBMH 4EN3A 4YHYB 1U3ZA 5D6CA 5DRZB 1LILA 4W6WB 4TNWK 1IRAY 2G60L 3CGTA 3SCNA 1F11B 1PSKL 3OAUH 1T1YB 3G6DL 3UTSA 4APQA 1EQPA 1N6QH 4QCEA 4NN5B 2VZUA 4OTXL 1JF1B 4LCIH 4O2FB 5KS9E 4O2CA 3BP7A 5F9JA 4AMCA 4FQCH 4MX7B 5CJQH 1TQCB 4TX8A 1RJLB 5IOPB 3ZJ6A 1WFOA 4LNVA 4MA1C 5MEOB 1US2A 4OCMC 1TA3B 2JEQA 2CSPA 4R90L 4F9JA 4POZD 5HY9A 3ALXA 3VDAA 2EPMX 2NT1A 1TJIH 5DFVC 3QQ4B 4MAVA 1JAEA 5J06A 4JZJA 5EBLB 2OTPA 5F6IC 1CICB 2R9HC 3K7UA 4X9IA 2Q76B 2H1PH 2J5LC 5ETUA 3VFMB 3PNWB 4S3JA 1U36A 2XWBB 4P2RA 5DRWA 3E6HA 4XC3L 4O58L 3MMEA 3ULUC 3ISWA 5EMYA 1E6PA 3MTRA 3QNZB 1KCKA 2IAMB 2FEEL 1SJHA 2IALA 3RWFA 3THML 5DZNA 3NCBB 3L5WA 4BKLB 3CMOL 1YN7A 1XGTA 4AYSA 3VFTA 5H35A 1J0ZA 4PCTA 5D2LF 5E1QA 3PABA 1KR0A 4RIRA 1ZT4A 1TXKA 3NVQA 4P2OA 1D9KA 3VIJA 2CUMA 3P40A 4G8GD 2CIIA 4PLJC 2YSSB 4U6YA 5D8WA 5FV1L 3P77B 3V4VL 4KAQL 3ZTNH 4LPVA 2WP3O 1OAUL 4RNRA 4LEOB 2GSGB 5A94A 3TTYA 2BC4B 2OXGA 5L8KB 1QTYT 1EEYA 5HD8D 4LF3B 1EOKA 4I9WE 4JPVL 2A83A 2FX9H 1Y18A 1ZHBA 3MYJB 5HPOA 2IFFL 5C0JB 3R0NA 1I1AB 4WEMB 4PS4H 1MHCA 3BKCH 1D6VL 4IMLB 4DWSD 4Y7EA 3KXFB 3L7EA 4QF1A 4U3XA 2GDUA 4HH9B 3C60D 3D52A 4AXNA 4AEEA 3AIQA 3RZCA 3MBEB 1DQMH 4JQXA 2IQ9H 1Q94B 4P2QD 4L9DA 4H0IA 2HRPL 1P7HL 3IXAB 1HTYA 2APBA 4X6CB 1IVLA 3W2DH 2PWGA 4UINH 5L9DL 4F9DA 2NY5L 2WYSA 5DMGC 4S1QH 3AZRA 4KKCD 3QEQB 4WUUB 3TO4B 2XQBH 2V5TA 4TUKL 2HLFD 5DMJB 4FXGB 4OOUA 5ACMA 1TZGL 4AIZA 2FRGP 3IXTB 2C1OA 4LMQI 4LSVL 1T22A 2BVQB 1XGZA 1TTGA 1A1OB 3CUHA 1KPVA 5DLML 1K5NA 3C6LC 2UY5A 1IBGH 1RZIA 4KDWA 3V5HA 5IM7B 4L4JA 3BSZH 2WMIB 3DNKA 5CFHA 4CADB 5J11C 1YY9D 4ODHL 4RE3A 2DQFA 1RJCA 4NUJB 1AFVL 1MFNA 2GJ6E 2J78A 1KIQA 4LOUC 2B1HH 5GZND 3MJ7A 2J4GA 3BSGA 3R06A 1WVZA 5DVLA 4WSJA 1U8OB 3HNVH 1YHTA 1QBLL 1WWWX 4HPHA 1HN1A 2AABL 2O26U 4CVZB 1P2CA 5BRZA 1GZQB 1N7ML 5F9AC 3W27A 2HJKA 2X89D 2YD3A 1OPGH 2PWHA 4AYGA 4JRWA 4YWGH 4M93C 5DT1L 4HIXL 2D3LA 3GSOA 1XYZA 2JFEX 5C0AD 4HA1A 1RMFH 4HTYA 4V1DD 3AC0A 1BQHG 2R8SH 4X5WB 4YFLI 3RM4A 5HGGS 1CS6A 1OQOA 3F7PC 5L0QB 1QSFE 2Z31B 4W6XB 2NMSA 5GGRB 5IB5A 3OG4B 2C3HA 1RZFH 1T04A 2K3TA 3VFGH 1G7JA 4YQXL 2PTTB 2DKUA 5J1AB 1KTLA 2XTJC 4JR9H 1CXHA 4Z7UF 1LO5A 2GFBB 3RVUD 1EFXB 1PZ5B 1FL5A 5JW4M 5C1MB 5FYJU 2J7HA 1NGZA 4K71C 3I6LD 4F15B 4WHDA 4FZEH 1T7WA 3D6GA 3FO0H 3L3JB 2FGWL 4JFFD 4LSSH 5JNYA 3GXNA 4L3EA 4W4OA 1U8JA 3FRPA 5HHXH 2EE3A 1MCBA 4OZGE 4R4FH 5F1NB 3BVUA 1AY1L 4BQBA 2XACC 3GJFB 1PBYA 2BDNL 4LFHG 3H9YA 1KCSH 4UQEA 3WELA 1CIDA 1RP9A 2FATH 2FIKB 4HPOH 3CXHJ 2P44B 2EO7A 1E28A 4TRPH 5H8DA 4NSKB 1KLGB 1TNMA 1TJGH 4CNIB 4BA0A 3L5XL 2XN0A 1HIMH 3RI5F 2X1WL 1YEEH 2HKFH 4PJFA 1BGXL 5F7KC 1A3RH 2XSBA 1B3JA 4G6AD 1UD8A 5DD5H 4OZ4B 1JNNH 4MYWB 2Q7YA 1RUQL 4P59H 4XCCL 2BSTA 1G9MC 4U1IB 1CT8B 3VH8A 4MJIA 1WCGA 1P1ZA 4LKCB 3FB6B 4CU8A 1EXPA 1WT5A 3BAEL 4W70A 3BEVA 1ZHNA 3QEHB 4ODSH 1DWHM 5C2BL 4PB0H 3EAKA 2XVKA 1NEZG 3IAQA 4NWTL 4ZO9A 1VEOA 2WBJC 2FECL 3D3VB 1R85A 2IH1B 2E8YA 2NY7L 3K8LA 2X40A 1FN4B 2YBRA 3HFML 3AYSA 1QRKA 2OLDA 1MAJA 1BP3B 3AFLA 1D2KA 1CD1A 3WLWC 3UJIH 3JV0A 4HD9A 3D0VA 2UWEB 5JW4N 1E70M 4U1GC 1MFAL 4GRWH 4NOFA 5DJ0A 5C0FB 2J79A 3S36H 1I9IL 2WB5A 1NMAH 1YYLL 2HJFB 4OV6F 1ZL1A 1FVEB 3M1BB 1W9DM 1AQDB 2VLRD 3SCMA 3GMQB 4X4YA 3LEYL 2Y06L 1UB5A 1KWGA 4QHNB 3BGMA 3CVHB 3U36A 2O61A 43CAB 2X4QA 4P5KB 3UC0L 5D72L 4HWEH 1ODZA 4UOW0 3L3IB 4URIA 1A7RH 3SDAA 2DJ4A 5E00B 1NGQH 1XSIA 4OBSA 5K9JH 4Y16A 1FRGL 2XN9A 5FDWB 3W29A 4Z95L 5JIWA 3HZYB 3QZWA 1MJ7L 4H41A 4GAYB 2E7HA 4BSVA 1M7DA 1QACA 5A1AA 3D85B 4PRAA 1B3YA 3GSRB 4LDOB 3UBXI 3WD5L 5HYSB 1BLIA 3KWWA 4W8LA 5D1ZA 4YHIA 2H45A 4E9LA 3BFOA 3CSBA 1FO0B 3M8OL 4PJDE 1ZA6B 4LPYA 4AYFA 3MV9D 4UFMA 4DO6A 4CL7A 5IMKA 1RZJC 4CD5A 1KN4L 1MQKL 5CD3A 3LOWA 1CTNA 1ISWA 2ZSWA 5FKPB 3EIFA 2A6JB 3DROB 2MKLC 3GSNA 1W1TA 4PLKC 4L4OA 4LU5H 1P53A 4PJGE 3KS0J 3QI9C 4G7YH 3VFPB 3V9FA 2OQJA 1DN0A 1WV7T 4R0LA 3OKNA 4HS3A 4PJ7A 4YO0A 2GTZA 2L7UA 1W2PA 5J9PA 3L2LA 4PYHA 1RIUL 4LBEA 4XNYH 4C56E 4F57L 1WB0A 3ARYA 4Z7VA 1B1YA 2DYPA 4Q0XH 3O3DA 3EYOA 5J1SC 1T7ZA 1LL4A 3UPRA 4KMTL 4I2XE 4ZUVB 3OJVC 4HBCH 4MB1A 2NX5B 2Q87A 4JQVA 2JCCA 4J1UB 2XT1B 4MXVF 4UQ3B 2D31A 5CZVL 3G6JF 2VAAB 4WEUD 4NN5C 3W11C 2QBWA 2DM2A 1H3UA 3W82A 5HDBF 5CBEA 3MLWL 1V0LA 4JHAL 2XA8H 4WJ5A 2CDEA 4OI9A 4J4PC 2GITA 3WUFA 1TQCC 3MLTA 1SJEA 1CL7L 4J12A 4UB0H 5EA0H 3O4LD 3RL1A 3CPUA 2EEDA 5CEZE 1D3CA 2AI0H 2EH7H 4Q2ZB 4L29B 1F4XH 4MA7H 3S37L 4OFKA 5KZCB 1NP0A 2WQ8A 3MRPA 3OBAA 3GKWL 4OQTL 1MFDH 1GGUA 3Q1SH 4ZXBD 1Y6NR 1BFOB 1WISA 5E9AA 4OV5A 4KZEH 1CICC 2X4NA 3TM6A 4MAYD 3D9AL 3B43A 1CF8H 1KLFA 4JN1H 4GZIA 4WW2A 4Y4HC 4O51B 1DUYB 2IAMC 5B38B 1IEBA 2NY4C 4XP1L 2Q6WA 3OKLA 4NKOB 3TH4T 5C2UB 2X4TA 4QOKB 5F9OH 2GUYA 4NM4H 1LE5B 3I75B 4MPKA 3RU8H 35C8L 1HHHA 4JANA 1JNHA 3ZTJG 4JHWL 1IFHH 3SGEH 2J12B 4UIKH 4QRUB 3QPXH 4AENA 4GKNA 2IADA 4R8WH 2GSIB 3QQ9C 5BS0B 5J56B 1ORSA 2WWKT 3KPSA 3POHA 2XPGB 4ZTOL 4KY1L 4PRNA 2BVDA 1FNGB 1F6LL 3PWPB 5E7FA 1CDJA 1JGVL 3CFDB 5CINH 1YJDC 4CVUA 3AU1B 5FHBH 3O2WH 1TVPA 5D7JD 5SWQA 1KTRL 1RIHL 4GBXA 4NQVA 3CFCL 4N0FA 4WV1C 2W5FA 3LIZL 5F1OB 4WRLA 5A95A 3HHRB 4I3RH 4XVJH 3RY6A 1IARB 2QSCL 2HT3D 3T4AA 3KYOB 3T4YB 1XD1A 5E2VL 1UR9A 1DVFA 3ARDD 3N9GL 5E99H 1EVTC 3PWLB 3HG1D 1KJMA 4MMXC 3ZLQC 4Y4FB 4XXDB 4DVRL 4LRNL 3I6KB 1P84J 1YNTB 1LO4H 4HPGA 2APXA 2JLLA 4ERSL 3EW3B 3D4YA 2FR4B 5A2KH 4ZAKA 1HINH 1F6AB 2VISA 5HBFA 1KXQE 4PJIB 5E1HB 1K6AA 1D5ZB 2VR5A 1DQQA 3MXVL 1BFVH 3O2VL 2EYSA 2EIEA 1FNSL 2CPCA 4WUKL 3IDMB 1H3XA 5IHZA 5F93C 1XF2A 1JJUA 3FMGH 5GIRA 2HFGH 1V02E 1MSPA 1BVKB 4XNMB 3ZKMD 2QEJA 1MFBL 5FM5O 1FAKT 2RIKA 3CBWA 2VZSA 4WHCA 1D5IL 5ICYB 5FYLE 2IJ0C 3RM9A 4I1NB 5ID0B 1CLCA 3CK0L 4E5XA 3C8KB 1B2WH 1I8IB 4LLWA 5DFWH 6FABL 3EJYD 2YKKA 4M00A 5TPWH 3KR3H 5E8OB 2GJ6A 4U1KB 1MCPL 4U3HA 1QQDA 1WIOA 3MODH 4TSAL 1KB5B 2E5EA 2VX4A 1QD0A 1JGEB 3TA3A 1YEHL 3EGSA 3NTCH 4UFHA 3W81A 3AXLA 2YPLD 1EEZB 4M1DH 2VLJE 3OKOA 4ATWA 1VBRA 3LH2L 2HJLA 4PRDA 3FB5B 3V5DA 2D22A 1TVDA 1GVIA 5TE7H 2Q8AL 3SE4C 3IFOA 3BDYH 4WFGE 4E41A 4OB5L 4JFED 2VURA 5IGXL 3O41B 5CJ5A 1DQDH 1PZ2A 1OGGA 1XF1A 3H8NA 5H2BB 3VIOA 3BIKB 3ZE0F 3RWDA 1QSFA 4PRHB 2G2RB 2FZ3A 3D25B 1RVFL 5L0QC 3OG2A 3F58L 2BNQB 3VOCA 4QT5A 2Z31C 4NJAH 1BGGA 5AYQA 2XYLA 5GSVA 4GI6A 4MCZB 3OKKB 1NGXB 1N4XL 4ZO6A 1RK0B 2XY2A 1FZMB 3RWHB 3VXNB 3IF1B 1G84A 1OTSC 4LLDB 3DXAD 3WHE0 4RMWA 4PJHE 4UFKA 4QRSA 4YDKH 1A7PL 3H9SA 4G6KH 4F15C 1NH6A 3E3QC 4OZGA 5K9OA 1DQTA 3DX6B 5F7DA 4FNRA 2G4FA 3PE9A 3FY1A 5EOCL 3BLPX 4C7GA 3A5VA 2A74B 3VWJA 3QHZL 5IHLB 1S9VB 5LGJB 1WC7B 4U1SB 1AE6H 2VI0A 5FGCE 2GEEA 4JKMA 4MMZC 3BW9A 4X4ZA 5HHVH 3CU1A 3WH9A 3LQAL 2ICWJ 4OD3H 2XIBA 4M24A 2YL6A 1LEKA 3RIKA 3E6FA 2F58L 2H3NB 1T66D 2ZPKH 4HT1L 4RMTA 4R26H 4OGXH 3QCTH 4NM8L 5JIKA 3H3BC 3NCEB 4OM0L 4G9FE 3CVIH 2FHBA 3QFDA 5FUZH 1F90H 3OLDA 3PQYA 4FQIH 4MB3A 2R2BB 5EDXA 3HJEA 4FQ2L 4G80A 1U91A 3CC5B 3QWOA 2V5CA 5CPTA 1IC1A 4MNGA 4QHLA 3V52H 4FNLL 4OAWA 1C08B 4XBPB 2BXYA 4RISL 1CFTB 4AZ5A 3SN6N 3VIGA 1JNDA 1KIUA 12E8H 4ZQKB 4Z5RA 1GGIL 4HKXA 1RP8A 3MUHL 4B9ZA 1U8NB 3VD4A 4UOZA 4EI5B 2ZUMA 2X4UB 1KIRB 4K3EL 4XNXH 3OA5A 3UTZA 4AEIH 5ABFB 4YGVB 3DVGB 1HXMB 1OT1A 1EEQA 2A0LC 1KT2B 3C8HA 1YMHB 3U9UB 2XNAB 3VW3L 3WKML 3WNPA 1ITBB 5HGDB 4PN2A 3V2AR 4IPLA 2IEPA 5L8JB 2H9GA 5IB4B 4PMOA 1M01A 3VRIA 4OZIA 2WINA 2GUOB 5EOTA 3PL6A 3VRLF 2IH3A 3VI4E 3TF7C 1UFUA 2G8ZA 4AL8H 3ZOAA 3QXTA 2NXZB 4HS6A 5JUEH 2ZUUA 3OWEA 1UM4L 4F7TA 3FO2A 3LAFA 2CYGA 4RRPA 4RMVA 4HBQA 4Y4KD 5C0CD 1IAMA 1GQJA 4MA3A 2FJHA 3NFPB 5HD8C 3T3MF 3MSDA 4X80L 4DN3L 5T3XL 2WIIA 5DZLA 3J7HA 4WI8A 4N1HB 1KC5H 3GHEL 4K8RL 1KJ2H 2X7LB 5ADPL 1R5WB 3AM8A 1YEGH 4A6YB 1VGKA 1C1EL 3B9EA 4RWYL 3FN0L 2XRAL 4WO4B 2H6PA 3QHTC 1IM9D 3RDKA 1K6QH 2EYTB 5DDHA 4PJDA 5EBMA 5FIEA 5EU6B 3C09C 1R5VA 1NCDH 4I48B 2O5ZL 3TEUA 3ELAT 3Q6FB 4D0CA 4JKLA 3CZNA 1IM3B 3CFJA 4JAMA 4PFEA 3RKDC 4EDWH 4F7MB 2K9UA 3QEUB 4G6ML 5GS2D 3O6FD 4HHAB 2W9EH 5D1XA 3WEXA 4M62L 2IGTA 3H9HB 2Q86B 3DX4A 5CEZH 3UJTH 3S96B 4OZHB 1MIMH 1AMYA 3QG7L 1S3KL 2V2XA 4NYLB 3EDKA 3WMSA 5JW4Q 2YXFA 1FYTE 5JOPD 1L4IA 1UZ8B 5IVXE 2X44D 1UKOA 2P5EB 1JPTL 4NRYA 3DMMD 1SMOA 3SCPA 2VDPH 1KGCE 2EEXA 5JZ7D 1OSPH 3OHXA 4OIAA 4U7MA 5GJSH 1EUTA 2ESVD 4I2XA 1BQHA 3SCTA 4AEFA 3L7FB 3VCLB 4XRCB 1ETZB 2IG2H 5H94B 2EIBA 2XWTB 3MFFA 5EB8A 4FG6D 1CECA 3WDHA 4Y5YA 4YE4L 1HHJA 4X9BA 1MUJB 2Y07H 3W5MA 5C3LD 5D5ME 1LQ0A 2WWMC 4QRRB 5F89B 4DCQA 4WK9A 2AJ3A 3FFCB 5C0BE 2PNDA 1RHFA 2ZCLL 5ICXB 4J3WA 5SWSE 3SQBA 1VF8A 4H8HA 3ARTA 5CWSB 2OI9B 3BZ4B 4L8BA 4FFZL 1LWHA 4PJ9B 5L2JB 2EXYD 1N0LA 1B6UA 1E4IA 1N26A 1UA6L 3ARGB 1J05A 2Y9RT 1ZT1B 5E8PA 4GUPB 1UCTA 2XWEA 2YUVA 2D7OA 2EO9A 1MJ8L 1ZJAA 3ZJ8A 3RGVA 2AS5M 2QQKH 1CGSH 4D8PB 1Z3GH 2DLTA 5ESVA 1K4DB 1JGIA 4JRYD 4K7FB 4JM4L 3BLBA 1E0VA 4IRJD 2AJUH 4MS8C 2ZUXA 2BNUB 2P45B 3X3GL 1ZMYA 1ZLSL 5I5RA 3DX8B 4U7SA 5BWFA 4ZYKA 2GJJA 1RUPL 1NCAL 2EPNA 1NUFA 1WE5A 4PGDA 1Y0LA 2W60B 4I0KA 3FT3B 1VDGA 1OTUC 4H0GA 1OP5K 1HH9B 4ALAL 4JM2C 4LSPL 2VXUL 3ILQD 3PZNA 3BXNA 4Z7QE 1S8DB 3KLLA 2QHRL 5GZOC 3LRLA 3ULVL 2AK4B 3CCHA 2VR9A 5C0ND 1HHGB 4X0VA 2UZYB 1UWRA 3GIVB 3C5JA 3ZT5A 4QRPE 5AC4A 2N4IA 2WHLA 2G60H 3SJVB 1PSKH 4QXUL 1NEZA 4NZTL 5IBUB 2ZNWA 3G6DH 2EDEA 3T65A 4OTXH 3TLRA 5DD3L 4PJ8B 1ZLVH 1KYOK 2XIDA 4DGIL 2NTSP 4PJ5D 5FYLH 2XVGA 4PTXA 3QDMA 4GRLB 2CKBB 1E1FA 3ZMRA 1IAOA 4ZE5A 4R2GB 3LKRA 3F12B 1S5HB 2ZX6A 1KXTA 3CFKB 1N6UA 4UZSA 4O4YL 3OR7A 4WIQA 1ES0A 3B6SB 1ECEA 1QNZL 3TO2B 4R90H 1H3PL 3B8YA 5DK0B 4OKDA 4EN3D 5C08D 2DBJA 3SGEI 3QR2A 2AQ3A 4RA0C 5GS0D 1I85C 1W0YT 1XEDA 4V27A 2X9XA 2VR4A 3WNNA 1U3HB 1SQ2N 1A6AA 4I5BA 5I15L 1BGAA 4Y4FC 4Z78B 4GKSA 1NARA 4FFVC 1JRHL 3QUKA 1GC1C 2J8HA 5JDSA 1GGCL 3DPBA 2HT2C 3GSXA 3JV4B 4XC3H 3HMCA 4O58H 4R7DB 4RFOL 3WQVA 2WXDM 4GI9A 3HZKB 4JKKA 3SDDB 3OXRA 4NQDA 3THMH 3L1OL 1H0DA 3L4VA 5HI5C 4TNVK 3CMOH 3Q5YA 5I73B 5J7CC 4D72A 2XM2A 4NDMA 5A2FA 3S36X 2H32H 2EE9A 4MXWL 1PKQE 3B3IB 4PP2A 2QSQA 4MSWA 3X3FL 3JWDC 3G04A 3DV4A 4PMVA 5I8KL 1CGYA 1BOGB 1I1AD 4KAQH 2QMJA 3SBWC 2UY4A 2XUCA 1OAUH 1ZVHA 3QIBB 1CXFA 3KPMA 5IKCA 3D51A 1XGRB 3L2MA 1ZJBA 4FXKA 4JPVH 5INCA 1GSMA 1AGDB 2D7MA 2EDHA 4GO6B 3U83A 1J8KA 4MJ4A 2IFFH 3MBED 1E43A 3L3DB 2JEPA 1M7XA 4JG1L 3QWRD 5M3WA 1D6VH 1UEYA 5KSVA 4F7EA 4ZUUB 4WW1A 1NKRA 2A6KA 1F4YL 1OF2B 2RHEA 2J75A 3CUPA 1XGPB 3HZMA 4EXPX 3IFPB 1D9KD 4J2XA 5IVZB 3T0EB 3VWKA 5JXEC 1HJSA 2AK1L 2HRPH 3H2WA 3TO4D 4ACZB 1VFBB 2AEQL 1NFDE 4GXVL 4UT6L 4WNQA 3WL0A 5EBWA 4DZBA 2VTFA 5JMRA 5CMAB 4JDTH 2XYCA 1R24B 4Z7WB 2G9HA 3TN0A 2A1WL 5L9DH 1O6IA 2NY5H 4GS7C 4KK5C 1JUFA 4M61A 4QGYA 4TUKH 3Q5OA 1S9YB 4G8FA 1C12A 1OW0A 5EO0B 4PJHA 4RGND 4P99A 4YIQA 3HE7B 4OLYL 5EBGA 1JZ5A 2WW8A 1KGWA 1DWAM 1M4KA 5DJ2A 4NZFA 1UCBL 4X7SL 5E6IA 3N1PC 5IFHL 1NWUA 1CZ1A 3TZVA 5DLMH 5ICZA 2ADJA 1IQWL 4ODWA 3ULUF 4G7VL 3QIWD 1JPFB 4LVNB 1T83A 4ODHH 4HW6A 1W1PA 3WY1A 1JNLL 1N5AB 5CZXD 5EO1A 4AH2A 5B4MC 1AFVH 3FQTB 5HJ3B 4ZPTA 2DQTL 4LLVB 5HYIA 2R2EB 2IBZY 3UR7A 1ESWA 1AVAA 2F1AA 1QBLH 2AABH 2YA1A 1N7MH 3UP1A 4XP4H 4ISVB 1ZLVK 5AY7A 4KJYA 4D6FA 3HZVB 2C1PB 4HIXH 4U33A 2R2HB 3VA2C 1UA3A 2BS9A 3P30L 3S97C 2AEPL 1SYVA 4GMSL 1YPZB 3U1SL 1OD9A 1I7TB 4D6HA 2CXGA 2HTLC 3TBYA 2F8VA 3RUGA 4MQ7A 4GQQA 3REWB 4R7NA 1V5JA 1Q9KA 4LCWE 1RK1A 4S10A 1C7TA 2GK2A 1A6PA 4M9OA 4KQ3L 3RWCA 4YQXH 3UTPD 2DTML 5T1MA 1RU9H 3VFVA 3TVMA 5I1DA 5IB1A 3BMVA 4QHKI 3HAEB 4P3WA 5I74C 4LGSB 5EU7C 4HK3N 4F9PA 3QB7C 2X42A 4X8JA 4XP9L 3HC0B 2ZOKA 3WUWG 2FGWH 3W39A 5JO5B 1ACYL 5JORB 5EN2B 1SYSB 3TYGL 3WDRA 1T1XA 3UPCA 3VXRA 2ITCA 5C8JB 3UBXB 4OSUL 2WWDA 2FDBP 5MHSD 1BYDA 4LASH 2BDNH 4NT6A 2W59A 2QR0A 4K7PY 3U5UA 1MLCA 2VMFA 4O2EA 2V3EA 1I75A 1TQSA 4F7CB 5MENE 3RX7A 4NQSB 3ARFA 3CDYA 3PTKA 4LLYB 3GMMB 3AMKA 2VJXA 3GMRB 3LS4L 1WP6A 1ZE3C 5E4EC 3CLFH 4JY5L 1Z0NA 2JIXA 5D93B 1DFBL 3MA9L 1BGXH 4G6FD 2EC8A 4BFGA 8A3HA 1U8QA 1AI1L 2R69L 4GINA 1GOFA 3RVTC 1KEGL 3AAZA 2VWEE 2AJZA 3HB3C 1KTDB 4WO4C 1RUQH 3KPRB 4BQ9A 2V5YA 4P5TD 4XCCH 3W0WA 3ZL4L 3ZO0A 5MEQA 3WY3A 3WXWL 4CD8A 2PXYA 2VSDA 3IDXL 1HHIA 5D6CB 3TTSA 1NC2D 3PZTA 3QDJD 4KKLC 1P9MC 2BOCA 1I1XA 3BAEH 1J8HE 4PP1C 5AYIA 5LAXA 5ANME 2FL5A 1EEUA 4EVNA 3UTSB 3MRRA 4APQB 5C2BH 4BQ2A 2MSPA 4NWTH 1IAIL 4L8CB 1NWSA 1M7IA 4O2CB 4LLUA 2FDMA 2NY7H 3CFBA 3HFMH 5A6MA 3DECA 4OJFL 6CGTA 2OK0L 3BEWA 1QNRA 4P2CG 1CE1H 4WENB 5A69A 3C2SA 3O3EA 1BVLB 3BAYA 1JZ7A 2GK0A 4QO1A 3THCA 4TN9A 4OKVB 5HY9B 2E0PA 1MFAH 5GJTL 3D0LA 3ZZ1A 1I9IH 3WE6B 1AR2A 1RZ8A 1YYLH 5FD0A 4QFUA 4NQCD 4JZJB 3MCLL 1R8LA 1V3KA 1M71A 5D5MA 3LEYH 2Y06H 3GJEA 4P2RB 3E6HB 1KLUA 3MMEB 1I8LC 5D72H 5SWSA 1OGTA 5E08H 4MNKA 1SJHB 1UJ3A 2IALB 5IBLC 3RWFB 1S46A 1YN7B 2HTKD 3C5ZD 1FRGH 1T21B 4MNQA 2P8PB 2OI9C 4Z95H 1MCEA 3UG4A 2GKIA 3PABB 4XZUB 1MJ7H 1IKFL 1MNUL 4PJ9C 3ZE1F 1YMME 1FYHB 3ARGC 3BJLA 2XM1A 2CIIB 3WD5H 4QYOA 4U6YB 5DI8A 3SCMD 2ZG2A 1CLXA 3M8OH 1M04A 3OGOE 2YXMA 4WFHE 3IRZA 1QW8A 2WBWB 2E6JA 3BPNB 2XKSA 1LNUB 3MJ8B 1KN4H 1MQKH 2P4AB 2PYFA 4XAKE 2CO6B 2A83B 4U6XB 3H0TA 5LJYH 2PYEE 1ZHBB 1KFAH 1JPST 3KPOB 5EB9A 3TJHD 3ARZA 3HE6A 4AY1A 3FN3A 2IAND 4JZ5A 2XN9D 2WWKO 1D5XA 4L1HA 3TNNB 4YPGA 1JYVA 1OY3B 3RWGA 3L7EB 3JWDL 5JPNA 2WVVA 1S7RB 2EIZB 2NX5D 3UTTE 4CKQA 1RIUH 2O9OA 4PRBA 4D6CA 3RZCB 1IGFL 5EUOE 2RGSA 3DIFB 3SKMB 2ZWYA 4HLZH 4PRIA 2IPTH 4KMTH 1F4AA 3D39B 4UTBL 4BA8A 2O9PA 1DUZB 2A77L 5KAQG 1HK6A 4K3DL 4F9LC 4LL9A 1JHTA 2VB5A 4KTEL 2VXQL 1C5DA 3MNZA 1CR9L 5FOBA 3B5GA 3LMJH 4PJ8C 3A24A 2OR9L 4AIZB 3MLWH 4RQQB 4JHAH 1K2DA 4DOHB 3KJ4B 1HE7A 3OR6A 4GRLC 2X2IA 3CHEA 5BYWA 4LPXA 3KYNA 2X1XR 5IW3A 3SDCA 5IIEA 1I7ZA 2DYPD 1CL7H 3G6AB 1K5NB 3DUUA 4TTGA 4LSUL 5B8CB 2VRAA 3QRFM 5D9PA 3O3UN 3S37H 1IC5H 2JB5L 3S3JA 4BCEA 2YD4A 3S2CA 3V8OA 3GKWH 3MJ6A 4OQTH 4PG9A 2DQFB 5F96H 3AJ7A 1LO0L 3CPLA 4U2YA 1O0VA 3JTTA 3OZPA 4P46A 5HDRA 4JFHD 3D4ZA 3VFWA 3D9AH 5I19L 3FTGA 3R06B 3AIWA 4DKFL 3BC9A 4Z7OE 1HJUA 3GMNA 4HC1L 1UWSA 4HWZA 4PY8I 1RSFA 1QFUL 5BRZB 4XVUC 3SDDC 4XP1H 4D3CL 1QHPA 2DSZA 5KTEL 1PKQA 5FAAA 5EG6C 5I73C 3KE0A 35C8H 5IWLC 5JHLL 3TV3L 2WVSA 1T0NA 2F53E 1JN6A 1WCBB 2W0FA 4JHWH 3RVVD 1FQ9C 2BVOB 4ZS6D 1UQYA 3GZAA 3WFLA 5D7LB 2DJSA 1XIWA 1S7TA 1Q9LA 4ML4A 5EIVA 4N9OB 3BCFA 4XCNA 3ZHDA 4ZTOH 2O5XL 4KY1H 2UY3A 3T0AA 3U7WH 5IB5B 2OR7A 1EO5A 4NO5B 1JGVH 4S1DD 5BW7A 2BVPA 4MGXA 2I9TA 3LPOA 1G7JB 1XGQA 1Q72H 3EHBC 4CU7A 1KTLB 1EUUA 1EJ6A 1VACA 2DF3A 3PWNA 5TD4A 1HKMA 5I17A 3A23A 4Z8FL 1QI5A 4CAGA 1GOGA 1RIHH 3ECBA 1OD7A 2V7NA 4I77L 3F5JA 1NGZB 2FEEI 3MA7A 3A4WA 3LIZH 3T0BA 4FQQA 3V6OA 2BNRB 2YUXA 4YFEA 1BHGA 2QSCH 3T0EC 1KR1A 3WL9B 1OIMA 3FQUA 1A5FL 5E2VH 1NFDA 5SWZD 1D5MB 5D7IB 3QFJD 3VG0L 1S7VA 3N9GH 2CCRA 3T2QA 4R9HA 4Q9QL 1KG0B 1MFEL 5F7YC 2EPKX 2MANA 4DVRH 4LRNH 1HWGB 5IR1A 4XXCC 4Y88A 1SZNA 2FYYB 2W61A 2WCAA 1AD0A 3MO1B 2Y7QB 2C7FA 3V0AC 3DO3A 3GTNA 4ERSH 5EFDA 3S6TA 2VL4A 1A4KA 2XIIA 1ZVYA 4JFDA 4PJFB 3ULVE 3UG3A 5E6YA 4PTWA 3O2VH 1B3XA 3CIQA 1FNSH 4WUKH 3KL0A 3FO1A 1BJ1H 2JB6B 2EJ1A 3HPJA 2FHFA 5DFTA 3HE7C 5HI3D 2M1KA 3KPTA 4L3AA 2BSTB 4K7PL 3QGVA 1MFBH 3VH8B 4MJIB 5D2LA 3VDBA 1X5HA 1JTPA 4D6EA 4NO3A 4H7VA 3K1DA 3MKKA 4JG0L 3BEVB 3CK0H 5DJ8A 3K1KC 3WS6A 1GUVA 2FBJL 2G75A 4LRIC 1Z5LB 1MCPH 3VI3F 4W89A 3UYPA 1J11A 1J0HA 4TSAH 4KK8D 5HHMB 3DRQA 2X4SA 1XYFA 5IV2A 1YEHH 4P8UA 4L8SB 2YBRB 3O6KL 3ZR5A 2LVEA 1FH5L 2CIKA 4XPBL 1XD0A 3LH2H 1A02N 5IEKB 1NFIA 2Q8AH 4ODUA 1JE6A 3U57A 4LPWA 1G7MA 2OJEA 2OMBA 2YUZA 3D0VB 1V7ML 2ADIA 5K9QG 4PREA 2ORBL 2DD8L 2Q8BL 3HR5B 3MACL 5D6DA 5DJ0B 2UY2A 1XF4B 2NY1D 2NTFA 4WWID 4C7DA 3N0PB 3BN9D 4BFIA 1MCWM 2E9LA 4M8VA 4LCWA 1RVFH 4X4YB 1UR2A 2HKHL 3E3QE 1UB5B 3LEVL 5I3DA 4AM0A 3F58H 1AGFA 3U36B 5AEAA 3BRGC 6A3HA 4PRPE 1EJOL 3G9VA 3T0VA 1I4FA 2X4QB 3TA3D 3TESA 1QR1A 4PBWD 5EWIH 5TF1L 4N0YL 2J47A 1NCNA 4HOZA 1N4XH 3OKEB 4N0CD 3SDAB 2ZX5A 2OYMA 4X83A 2YD7A 4Y16B 1PG7L 1J1PL 3VA6A 1QEWA 2J8GA 2G3NA 3QZWB 3QXDB 4BSVB 5FO9B 4I13B 4S1RL 3MV01 1M7DB 1OD0A 4X6CF 1ISVA 5DJXB 1A7PH 3WQ4A 1MCNA 5FXCH 2H2SC 3WNMA 1JWSA 4RCAA 4F58L 3KWWB 1E5JA 3AFBA 5EOCH 1O7DC 2XICA 1C5CL 3QHOA 4ACYA 3DUHA 4OI7A 4KHTL 3QHZH 5IMKB 5C0NC 5CD3B 2Q3ZA 4GRWB 3U7AA 2PBOA 4F66A 2ZSWB 4D2NA 5EU5A 3LQAH 5HHPA 5T1LA 1V7NL 3JBG7 3K4AA 5BXRA 4V2XA 4KGLA 2F58H 4C7FA 2OQJB 4GRMA 1DN0B 4HT1H 2P8LA 3VD9A 4YXHL 4ONHB 2BVEA 2PKDA 4HS3B 4PJ7B 4NM8H 2OSLA 3S88L 3H9SD 4DGVL 1NAML 1RY7B 5D93C 2HP4A 4LBEB 4FTVB 1OINA 5IEHA 5I8CA 1FJ1A 1AQKL 2EYRB 3O3DB 3I02A 1L7IL 4FQ2H 5EIQA 4W8AA 3VWJD 3TFKC 1RZJH 4YBLB 4RISH 3PWJA 2C7UA 2HG5A 5FK9A 1LJYA 3V0WH 4GG8B 1E6OL 1T4KA 2R4RH 3OLIA 2D31B 5GRZA 3O6ML 4JFPA 4Z76A 5KS9B 3ZE0E 4APQC 3DX9A 2MJWA 5F3BB 3MSGA 5TE6L 4NFDA 4GZJA 5GRYA 3GSQB 3ECQA 5CBEB 4PSPA 2J8FA 3B83A 2CDEB 2GITB 1PD6A 4QXWA 2VDKL 1W9XA 4K68A 1KTCA 1SJEB 4UMGA 3MV8D 2NXZD 3VW3H 3FZUD 4DW2L 4K2UL 3SPVA 5A16A 5F8RC 3VE0B 4XCEB 5FCSH 3NCMA 3IFNL 2F8QA 5JPMA 1LG1A 25C8L 1J86A 1M1SA 2IUZA 1N5YL 1QW9A 5CP3H 4JZJC 3SKUD 4OV5B 1PQZA 1BIHA 1V8HA 2X4NB 1MY5A 1UM4H 3H9ZA 1QHOA 2C4FU 3PV6A 2EZ0C 3EOYG 3BOVA 5AZ2L 4WU7A 4P2QE 1FG9C 4L9LA 1MAML 1IEBB 2Q6WB 4PTUA 2XPKA 3OKLB 4KI5C 4X80H 4DN3H 1UJTA 5T3XH 4EK7A 3SE9L 2X4TB 1WWAX 2FECI 3GHEH 4K8RH 3VPLA 3LRGA 1MCRA 1EAJA 3DETD 5ADPH 3QIUD 4JANB 1WGOA 1YMMA 4LAJH 5AAWA 5IJVA 1C1EH 4RWYH 3FN0H 3ARED 5FDYA 1WTLA 1BIIA 2Z93A 2FWOA 4P2OC 2NZ9C 5DMKA 4AENB 1T1WB 2IADB 3AS2A 1ZT7A 1T7XA 5LA1A 5FGBC 3MOBL 1S9XA 1UZ1A 4PRNB 1FGVL 1XFPA 2YKLL 3QDGD 1P7KA 3PIQA 5D1QA 5GGTL 1A6TA 3CNKA 5HGAB 3BPNC 4GAJH 3BVXA 5F6HJ 4G6MH 5A6AA 5I1EL 5TDPB 4TVPD 1ULVA 4M62H 3AROA 3ORJA 2CDFB 4GBXB 1P7QA 3QG7H 4NQVB 4MWFA 1FZJB 1OLLA 2FD6L 5BOZG 1ZBVA 3T2PA 2GCYB 5FOOA 4E4PA 4I0PA 4PMYA 3RILA 3T4AB 5EUOA 3VFNB 1FHDA 3DVFA 2NW3A 3RZCC 2NY0D 3BP6A 4YBQD 4JQXC 3F8UB 1SJXA 4QRRD 3FFCD 1WDRA 4XPTL 4DGYL 4E42B 3U82B 5C0IB 1F4WL 1SY6L 1EBAA 4OGAD 5D1XD 3ZJKA 1W9BM 4YE4H 2HVJA 4MB4A 2MCPL 4V1DE 5L7XL 3IJ7A 4ZAKB 3UG5A 1GOWA 2D24A 1DZBA 4GXUM 3A6BL 3MQIA 2AXHA 2ZCLH 3UJJL 2X2HA 1DQQB 2UWEF 2EYSB 4LHUG 4XVSL 3WMCA 5F7EL 3KJ4C 2DQJH 4FFZH 1XF2B 1Q8MA 1DWGM 4M6ML 1DHKA 3RVWD 4K9EL 4P4KB 1UA6H 3WUWA 3F7VA 3GXTA 4G9DA 2PW2A 5B8CC 1A2YB 1MJ8H 5BQ7A 1MVFA 5GGRY 5AWNL 3DYMA 3GMPA 3I6LE 1QSED 5I1AA 2GJ6B 1ZKAA 2J77A 4PJXE 4JM4H 4JFFE 1EAPA 3L4ZA 1BZ9A 1F3DJ 3EGSB 1EK3A 2ZSVA 1QRND 3X3GH 3RDTB 5L88L 1G0CA 1H8OA 1F8TL 3OKOB 2HJLB 3SHSA 1EGJA 1NCAH 1RUPH 1WF5A 5D8JL 3V5DB 2AK4D 3DSNA 4E41B 4NQEA 2F53A 4HZAA 1AGBA 1Y7VA 2P5WA 3IDJB 3MU7A 4ALAH 4LSPH 2VXUH 3FONA 1CL7I 4N9GA 1F6FB 3RWDB 2B1AL 1QSFB 2QHRH 1MEXL 4JO2L 2W62A 3NFNA 5I2IA 3ULVH 4HKJB 2BSED 2IPUG 2J8UE 4NUGL 3TONA 2MWCA 3MRIA 4G42A 4HEPG 4UNVA 2YD9A 1K8DA 4NFBA 2E7LC 4JGMA 3TBVA 1JD7A 1G7HA 2C5DC 2DLEA 2G3JA 2X6MA 4QXUH 4NZTH 4DN4L 1I3RA 1C16A 4HAGA 3QXAA 3BCDA 5A8NA 4L5FL 2ZNXA 5DD3H 4DGIH 1B3ZA 4NO0A 4KK6D 3G6JA 1U30A 2ITDA 4JPIA 3REVA 4PGEB 4GXUN 1WAWA 2VQ1A 2QLYA 5BMFH 4RFNB 4JFUA 1E1EA 3V79C 4OZGB 1X5AA 4W4OC 1QNZH 3MLPA 1H3PH 3AMGA 1V6UA 3HR6A 4D6JA 3OKMA 2Y24A 4I0CC 4GKZA 4RE4A 1UA7A 4R97B 4U0QB 2AJSL 2M8XA 5I15H 3BKML 1AKJD 2DS4A 4PGJA 4GW1B 2J6EA 5LA0A 1X5XA 1ND0A 5EPMA 3WO3B 4FQXA 1PZ3A 3E6FB 1GGCH 5FYJD 4JDVA 2OR8A 3G6LA 1ONQA 4RFOH 3CUGA 2ZJSL 4QXTA 5GGQL 5GHWL 1EHLH 4HZ7A 2AXGB 4DWHA 5HHOE 2VLRE 3B2UC 3BUYB 4N90E 3L1OH 4ELMF 4PV9A 2EDTA 4KV5E 5CEYB 3SUTA 3QFDB 4TSCL 3P0GB 1INQA 3O3AA 2WKLA 4KRPD 2BSRA 3VFRB 4MXWH 4KROD 4P23B 4G80B 3ZDYF 4YAQA 3QWOB 1MQPA 3PZMA 2NY3D 3DV6A 4BZ1L 4OAWB 3BD4A 1BAGA 1JVKA 1CVRA 5I8KH 2B2XL 4WWKA 2A3BA 3AIBA 1WT5C 3UCRA 9CGTA 5BO1L 3WXVH 3F6IA 5E95B 3F65A 2CUHA 4GG6E 2N1KA 2VQUA 3MLYL 1HP4A 2VABA 4PMDA 5C6TL 1FVDB 3HUJE 3MRLA 4NQDD 1KQYA 2QTEA 2ZG1A 3MV9E 5DGQA 5CKAA 4NHUA 5EH1A 2Z8RA 4JG1H 1MCLA 1J9YA 4HGKC 4Y89A 5IF0A 1F4YH 4ONFL 3QP3A 3LPFA 4RZCA 4MJ6A 1Q0YH 4Z7NE 2H9GB 1MXGA 1CXIA 4QY8A 1N2RB 5GS0L 2WINB 5EOTB 3PL6B 5CCKL 1NP2A 2AK1H 5CD5D 3JUYA 2AGJL 2AEQH 3DVNA 4UT6H 4EIZC 1TVBA 3C87A 3SCMC 4F7TB 4PG2A 3R4DA 2W67A 3TH2T 2EH8L 4MA3B 2FJHB 2A1WH 3PJSA 4U0RC 3VGHA 1R5IA 2JELL 3SDAC 4H04A 1G9NL 3A4XA 3TJHC 2I27N 5E5UB 4Y16C 5DMIL 2K1MA 1HKIA 1VGKB 1A7OL 3ULSB 2EXWD 4OLYH 2RJMA 2H6PB 2CDGA 4PSRA 1HH6A 5DSCA 1UCBH 4X7SH 5IFHH 5DDHB 1JWUB 4PJDB 1T0MA 5EBMB 3BVVA 4D1IA 2DSUA 1R5VB 1F00I 3NOIA 3QJFB 5D1ZC 4QLLA 1NBZA 5EBAA 1IQWH 4D0CB 5B39B 3CFJB 4JAMB 5EC1A 2VKWA 1UYWL 2FCBA 2EO1A 1T7VA 3L4WA 4IM4A 4MLSA 3O4LE 5F72S 3TN0D 3PTQA 1JNLH 3WEXB 3KYAA 4PJGB 1A3QA 1E0WA 4OM1L 3KEHA 3QHMA 1HQRA 2DQTH 5L2KA 4XI5C 2V2XB 1MFCL 1LK2A 1FAIL 3L5HA 4XPAL 4BQCA 3KL5A 1HDMB 1BD2D 5CQ1A 2DQIL 4FOMA 3P4NA 4R0LC 4C56B 2WHJA 4NRYB 1DLHB 5E6ID 1IEHA 5ERWB 2OCFD 1QZ1A 3TZVD 5F7UA 1I1WA 1FE8L 4YDVA 3S37X 4D94A 2BSSA 4YUEL 3P30H 4I2XB 3HI1A 1BQHB 2CJUL 2AEPH 1KJ2B 4GMSH 3U1SH 5D2NA 5DYOA 3MSPA 5AG9A 4FFYH 3SUUA 3MFFB 3W9EB 4X9YA 3APGA 3PWUB 4YBLC 1E15A 5DMYA 2EQDA 2FYVA 4HKBB 1HHJB 4JFTA 5INDB 4G8GA 1TG7A 3U46A 4QWWC 1U8LB 5FF6A 3BAWA 4KQ3H 3QUYB 4ZNCD 5H37G 3LX9A 3LN4B 4X6DE 1HF6A 2YK1L 2DTMH 2PR4H 4UT7L 2MOVA 3PBGA 3U7VA 3KPLA 3MX0A 3MRHA 1DE4B 2Y6SD 4L8BB 5F3HB 5ACZA 4XHJD 1PEWA 3CZJA 5DHXB 3U2SA 1HOCA 3VGDA 4ZO8A 4TQEL 4M1CC 1WDQA 4XP9H 3NIYA 4AD5A 3NGBB 3PF2A 1UXWA 3BIAX 3GMOB 3RWEB 3SCSA 4LARL 3L3KB 4X7EC 4DWSA 3HPLA 1OIFA 3GH5A 3TYGH 3VD5A 4GQ9L 3C60A 1O5DT 4OSUH 3Q3GB 3P9WB 5FUCE 3SDYL 3AB0B 4XWOD 1P6AB 3IANA 1JMZA 4GH7B 2HMIC 1US3A 5TE4L 1ZGLA 3IJYA 4P2QA 1BBJA 1WZ1L 5BXFB 4IOIA 1B88A 1QPXA 3OXSB 3UZQA 4WW2C 3DUSA 5FUOL 3DLQR 4UV4L 3LS4H 4KK9C 4PGDB 1Y0LB 3EO0A 3HG1E 1XGYL 4JN2A 4HP5A 4JY5H 1LTXA 1NBQA 4XTRC 1DFBH 3MA9H 1DEEB 4RAHA 4HV8B 2CGRL 2R69H 2UY6A 4KKBC 1KEGH 1L6XA 2LAGB 2Z35B 3C9NA 3CLEL 3H42L 3BXNB 5CGMA 5I9QC 4ATLA 1ZA3A 3CFEA 3ZL4H 2IBGA 3GSVA 3VXRD 2ZCKL 4HU8A 2X4RA 1DWIM 3WXWH 2J7EA 2XZQH 1E4MM 3KNBB 3FN9A 3IDXH 4JFXB 4JFQA 5E9DE 1NQBA 4NO2A 3O4OB 3IS0X 3H54A 2WMHA 3EYPA 4OLUL 3ARFD 2DQGH 1NEZB 1KIPA 3ABZA 3MOQA 3T3PF 3T65B 5HVFB 1IAIH 5TH2A 4PTTA 2WKGA 2XG4A 2QF8A 5I8OL 2AJYL 3OZ9L 4GBXC 4UAOB 3WD2A 1BYAA 4KJQD 4CJ1A 3BZFA 1I3UA 1X4XA 4M6OL 4OJFH 3IDUA 2OK0H 1CD9B 1WK0A 2XKUA 1KXTB 5F1IA 4LLMA 3JWNC 2ZIDA 3WIHH 3W0WD 1CK0L 3RY6C 2RFXB 2VRKA 3ZJ7A 1WFUA 1B0GA 1VA9A 1GHSA 5HI3C 1DVFC 2MTPA 3QJHB 2YPLE 1MJJA 2EECA 5GRVL 2QL1A 3VXSA 3WJLA 4P9MH 3TC9A 1A6AB 4I5BB 5C0AA 4JFEE 5C0GA 4OD2A 4GKSB 4AD4A 3N1FC 3QUKB 3VXQA 3DGGA 1A3LL 5IROC 4ZAKC 4PEEA 1WLHA 3OXRB 5JBDA 3DX0A 2EDLA 3OKDB 4M7LL 4MQXD 4WEBL 3BKYL 1W2KT 5C0DA 4Z2KA 2EDDA 4ZS7L 3NACH 3WY4A 4C4KO 1MNUH 4PP2B 4P5MA 4MSWB 4HUUA 3G04B 1FZOB 1JV5B 1ADQL 1U58A 2OBGA 3TT3L 1H49A 8FABB 1LDPL 2R0WL 5EFIA 4HAFA 3G6MA 4GIAA 1FIEA 3PWVB 1N0XL 3I84A 3QULB 3BN9C 3DXAE 3KPMB 4JFFA 4NKDA 3EBAA 3MLSL 1A6WL 2YN3A 4FXKB 3BGFB 2KPNA 4DAGL 3F7RA 1AXSB 2VLJB 3S35L 3QXWA 3CH1A 2BVTA 3S4SG 3RDTC 2FX8L 2VCCA 5DURB 3L95B 4MNQD 3SE8L 3PZIA 5ESQA 5C09A 5KSVB 2NPLX 4WW1B 1AJ7L 3CTTA 1J01A 1HILB 3JWDH 5EIIB 3HZMB 3D39D 3FNDA 2V2WB 3AMLA 4HFWB 3VWKB 4JY4A 4UT9L 2C4XA 4WY7H 1G6RA 5TF0A 1IGFH 3UPAA 3FO9A 2AAVA 2J8UA 4XNQB 4WNQB 2APTA 2H32B 5T1DL 3A22A 4DZBB 3VX0A 4PJAE 4JFYA 4OZHF 4UTBH 1NCCL 1OWWA 1KV3A 3H3KA 2A77H 4YDJA 4K3DH 3MRBA 4PJCE 2E9BA 4OF8A 1KN2L 3SCQA 4TOQA 1I9RL 4KTEH 4M61B 2VXQH 5T5NF 1CR9H 1V3JA 1Q6CA 3CZ8A 1GQKA 5LA2A 3VILA 2OR9H 1C12B 5DUPL 4NF7A 2X4OA 2VDLL 4PJHB 1J1OL 2QJDA 3C8DA 4IRSB 1C7SA 3LKNA 5FKAA 3PHAA 5ABDE 4U6HA 1YEIL 4RFNC 2DB8A 3RVXD 1HJWA 4LSUH 2PO6B 4PRID 5E2WH 5D9MA 2ADJB 4ODWB 4EZMA 5JIHA 1XZ0B 5FGCB 4B15A 1OP9A 4TVUA 1V3LA 1R3KA 5FM8A 2BV9A 4YHML 4J27A 3VO0A 4R97C 5EO1B 4S2SA 1U2CA 1LO0H 4NP4L 4ZPTB 4XC1L 5I19H 4DKFH 1BOYA 2VLRA 4I3SL 4HC1H 4H2CA 2UZXB 3N50A 5D7LD 2VL5B 4G9FB 1QLFB 4D3CH 2EDJA 3SDCD 1YDPB 3WQ5A 3VJ6B 4KJYB 4M4RA 4N5UA 2X9YA 5IQ9A 1VGEL 5JHLH 4RAVA 1R3LA 4Y5XA 3TV3H 1A14L 1KNOA 1JBJA 1AR1D 1MQ8A 1MIEL 1TQBC 2NY2B 4AZHA 4NJ9L 5JBFA 3KLSA 4ZTPL 2LQRA 1NGYA 3X13B 3QUXB 4F8QA 4R7NB 4YC2B 1PIGA 3GSNL 2O5XH 3KS0H 1XCQA 4N68A 1GH7A 4GG6A 1QNOA 1RK1B 4BQ4A 5FO8A 5BROA 5CUSH 4H5SB 3G5VA 1KJ3L 3ARBD 4MJ5A 1MF2H 1RJYB 1UWGL 3MV9A 3VFVB 3ZE2F 5IB1B 4Z8FH 2I24N 5FGRA 3MRCA 2DH2A 1OTTD 4I77H 1ZHLA 3MO4A 2MKWA 1K8IB 4X8JB 5J6HA 1KULA 4ONOA 4XUYA 4XGZA 4UQ2B 4NZRL 3IDIB 3VXPB 4HC1A 1QNQA 1KCVH 2P24A 1XIWD 1A5FH 3T0XA 4HF5L 3AHXA 5E09A 1J1XL 3H55A 2Y72A 3DX7B 3PL6C 5JOPE 3LN5A 3VG0H 5JOFB 1LEGB 3KLKA 4NT6B 2QR0B 4M8QA 3LPGA 4EE9A 1MLCB 1ROWA 3BX7C 4KRMB 5J1TC 3MJ9L 4Q9QH 5A6SA 2DM3A 1MCKA 4G43A 5BOPA 2CD0A 4ZENA 1T2JA 3MPCA 2HFTA 4HUWA 2D7TL 4QDMA 3RIAF 2FH6A 5DA4A 3FQNB 1NSNL 1R3IH 4LHUA 1OAQL 2F18A 2DKSA 3AM8C 1PAMA 2Y5EA 4HS8L 2J7CA 1U8QB 3MNWB 3DHUA 1PVHA 1UZ6E 1XMWA 2ATKA 2AJZB 1VFUA 1XHGA 1UENA 4ZOCA 1VCAA 4ZSOE 1P4IL 4K7PH 5C0EB 2F8XC 5DJ6B 1YECH 1YNLL 4KRNA 2J1KA 2PXYB 5HVHB 1MYRA 3C6SA 4YHEA 1MI5D 4HGMA 2C3VB 2BOCB 3GI8L 5LAXB 3MMUA 4JG0H 1ED3B 3O4LA 4HJ0D 5I75B 2Z1SA 3HNSL 4HU0A 2G5BA 3MOAL 1T3FB 2FBJH 3I2CH 3MRRB 4UUJA 4UFLA 4OGAC 4YLQT 2PI6A 2UWFA 5BVJA 1WZKA 4TPRL 5F1SA 1JGUL 3CFBB 1FYTB 4JFDD 4ZXBA 1P4BL 4ZFOA 5IVXB 3O6KH 3LKSB 2LU3A 1FH5H 1LO3L 5E24E 4JRYE 1EDTA 5A43C 3NUKA 4EDXA 1WDPA 1V7MH 3VRJA 3GHBL 4Z2JA 2ORBH 2DD8H 3D0LB 3P9LA 4XBGA 2BOBB 2Q8BH 4PJBF 4Z77A 4YFLF 1QYGL 4OOZA 2R1YB 3HCVA 4XNUL 5EZOL 5BZDA 3QHNA 1M71B 2HKHH 5D5MB 4OI8A 3LEVH 1FNLA 1CVSC 3GJEB 4PV8B 1EJOH 5C0BB 5DHVH 5SWSB 4X6DA 5CSUA 1LK3L 4N0YH 3QUYC 1BZQK 2CXKA 1UJ3B 5KJRL 3BUPA 4U1NB 1FL6A 3ARPA 5DJDA 3BH8A 5BV7L 5I16A 1PG7H 1J1PH 4XWGL 1LP9E 4K23L 4OCSL 3RNKA 3VIHA 4S1RH 3W38A 5D7JA 1Q9OA 1DQJA 3PHQA 5EO9B 2V3FA 3F7QA 2DN7A 1HNYA 1FLRL 3NGBC 4QYOB 1OSZB 4PBXA 4NCC1 4PJ5E 4F58H 2R23A 2DM4A 4PLNC 4QTHA 2ARJB 4I18A 2DAVA 2ZP0T 3RGVC 4JHZA 3QG6A 3MCKA 1H41A 3QRGL 1C5CH 4MTVA 4KHTH 4QRQA 2PYFB 2G3IA 1WJ3A 4JKPL 1XCTB 3WD3A 4Y19E 2DEPA 3UAJD 3D3AA 3ARDA 4JRXA 5CSBA 5C08E 3AXHA 1V7NH 3HE6B 3SUVA 4WU5A 2YFNA 3HG1A 2BY3A 3H7BA 1IC7L 3TP4A 4YXHH 3RWGB 4QHMB 4HIEA 1FP9A 3L3HB 2VITB 4DVBA 2WVVB 5JPNB 3NCOA 4KK6C 3S34L 3S88H 4DGVH 5DHVA 1NAMH 4FQHA 1BLNA 3BISA 4PRBB 3VMPA 1UOKA 3VIIA 4JGJA 1AQKH 3WFEL 5E0FA 1L7IH 3TPKA 5IESL 3CZGA 2QMKA 2JIEA 4Y1AD 2EE2A 1S7XA 4CD6A 4QRPB 2QLVB 4RDQF 4PR5A 1GZJA 4KUZL 3K4ZA 3I50L 3O4OC 1E6OH 2YRPA 3OJDA 3O6MH 1IQDB 4LHJB 1JHTB 4NRXB 3O9WD 2X70B 1C5DB 2FO4A 5FOBB 5TJWK 2NR6D 4YNYB 4EUPG 1P69B 3GXPA 3EYQD 1K2DB 4RAUB 1N59A 1Q6FA 4UAOC 1B90A 2YWZA 3OR6B 5IG7A 4ORGA 4GSDH 4JL1A 2VDKH 1YPZF 3KYNB 3VXMD 1FC2D 3EFFA 5IIEB 2AAAA 2DMKA 1HXYA 1CGXA 3F7YA 3RY4A 2FX7L 4K2UH 4DW2H 4FABL 5KG9A 3EJPA 1IILE 3ZKND 4CD4A 4KROC 3HA0A 2IPUK 3EYVA 1FZKA 3MRGA 3IFNH 3S8WA 1HX0A 4ZEPA 3D1MC 4JVWA 3I6GA 2OL3A 3BKJL 3EOBA 4QNPE 25C8H 4JFEA 1N3NA 1NAMA 5HYQA 1N5YH 3DURB 1R3JA 2WMGA 4ZOAA 5K33A 4HA4A 5BCAA 3CPLB 3W53A 1B31A 3HRZA 3MV7D 1GQLA 4M7KL 2OTWB 4P46B 4URTB 5T3ZD 3GMNB 4HWZB 1E4XL 3WUBA 1MAMH 2N7BA 1IAII 5I2UA 1S7QA 3FQWA 3SE9H 2GJXB 4U3CA 2RAMA 3WENA 1XC6A 2LE9A 3OX8A 1PKQB 4N1CA 4OCRH 4AD2A 3RA7L 4YPJA 1T0NB 3O6LL 1JN6B 2W0FB 1TQVA 5HYSG 1KJVA 2W92A 2GYSA 2DLFL 2IPKB 3L3GB 5CS7A 3DYOA 1Q9LB 3EMCA 3MOBH 4RGNE 2CHOA 1GOQA 1FGVH 2YKLH 5GGTH 3D48R 2BVPB 2MHAB 1C91A 3KHQA 1UD4A 1P4LA 2I9TB 3K2MC 1XGQB 1O7VA 3OG6B 5B22A 5I1EH 3BGFC 3IVKA 4NBXB 3PWNB 3U79A 5I17B 3RHWF 4ZFGH 1A1NB 2DJUA 2V7NB 4Z2GA 4ELKA 2DWDB 4NZJA 1PY9A 1XF5B 3KLHD 4M48L 1ZS8A 4B3LA 1N8ZA 3VWKC 3W9DA 2DWEB 2GIYA 2HRLA 1NFDB 4K55A 1JYWA 3AIRA 4KJWD 4PJAA 4EI6A 5D1QD 1X5JA 3ZQ9A 4DGYH 3RWJA 1CFVL 3DX2A 2M2DA 3WNOA 1F4WH 1SY6H 1W0WA 5IR1B 5JQ6L 1D6EA 2K7QA 1PS3A 2NW2B