2FH8A

Crystal structure analysis of klebsiella pneumoniae pullulanase complexed with isomaltose
Total Genus 310
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
310
sequence length
1052
structure length
922
Chain Sequence
DVVVRLPDAAFGVALADAHWVDKTTLLWPGGENKPIVRLYYSHSSKVAADSNGEFSDKYVKLTPTTVNQQVSMRFPHLASYPAFKLPDDVNVDELLQGETVAIAAESDGILSSATQVQTAGVLDDTYAAAAEALSYGAQLTDSGVTFRVWAPTAQQVELVIYSADKKVIASHPMTRDSASGAWSWQGGSDLKGAFYRYAMTVYHPQSRKVEQYEVTDPYAHSLSTNSEYSQVVDLNDSALKPEGWDGLTMPHAQKTKADLAKMTIHESHIRDLSAWDQTVPAELRGKYLALTAQESNMVQHLKQLSASGVTHIELLPVFDLATVNEFSDKVADIQQPFSRLCEVNSAVKSSEFAGYCDSGSTVEEVLTQLKQNDSKDNPQVQALNTLVAQTDSYNWGYDPFHYTVPEGSYATDPEGTARIKEFRTMIQAIKQDLGMNVIMDVVYNHTNAAGPTDRTSVLDKIVPWYYQRLNETTGSVESATCCSDSAPEHRMFAKLIADSLAVWTTDYKIDGFRFDLMLYHPKAQILSAWERIKALNPDIYFFGEGWDSNQSDRFEIASQINLKGTGIGTFSDRLRDAVRGGGPFDSGDALRQNQGVGSGAGVLPNELTTLSDDQARHLADLTRLGMAGNLADFVLIDKDGAVKRGSEIDYNGAPGGYAADPTEVVNYVSKHDNQTLWDMISYKAAQEADLDTRVRMQAVSLATVMLGQGIAFDQQGSELLRSKSFTRDSYDSGDWFNRVDYSLQDNNYNVGMPRSSDDGSNYDIIARVKDAVATPGETELKQMTAFYQELTALRKSSPLFTLGDGATVMKRVDFRNTGADQQTGLLVMTIDDGMQAGASLDSRVDGIVVAINAAPESRTLQDFAGTSLQLSAIQQAAGDRSLASGVQVAADGSVTLPAWSVAVLELPQGESQGAGLPVSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords pullulanase
publication title Crystal structure of pullulanase: evidence for parallel binding of oligosaccharides in the active site
pubmed doi rcsb
total genus 310
structure length 922
sequence length 1052
ec nomenclature ec 3.2.1.41: Pullulanase.
pdb deposition date 2005-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02922 CBM_48 Carbohydrate-binding module 48 (Isoamylase N-terminal domain)
A PF03714 PUD Bacterial pullanase-associated domain
A PF11852 DUF3372 Domain of unknown function (DUF3372)
A PF17967 Pullulanase_N2 Pullulanase N2 domain
A PF18494 Pullulanase_Ins Pullulanase Ins domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fh8A02
2.60.40.1130 Mainly Beta Sandwich Immunoglobulin-like Rab geranylgeranyltransferase alpha-subunit, insert domain 2fh8A01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2fh8A04
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2fh8A03
2P1YA 4K8RL 3DLQR 3LN5B 2C9AA 5EUKA 1QBMH 1NAMA 3GNMH 4OCRH 4APQC 5LA2A 1BGXH 4JN1H 4P2QD 3MRCB 2IF7A 3Q5OA 4L8DB 3EIFA 2MWCA 2E7BA 5IB5B 2G60H 4BZ2L 1UA7A 3DSFH 4XMKH 1ZGLP 1E4XI 2Z0BA 4Z7VA 2P8MB 3G6DL 4POZC 5E5MB 3W53A 3S36X 1QR1B 4E8CA 4DWHA 1KPVB 5E2WH 4NQTA 1FO0L 2FH8A 5DD0H 5DMGC 2NYYD 1KV3A 4KVNH 4MA1B 4YDJB 4NRRA 4YBHA 4F7TB 4X7TB 4P7NA 1T22A 4FFVD 2YD9A 3PDDA 1F4XH 3VXUD 2ZOKB 5HGAA 3MLTA 3HKFA 2J8FA 3OZOA 3UPCA 3QI9D 2X2IA 2K7PA 2ADFL 2P5EE 4OCWL 4HUNB 4QXUL 4P8VA 5A69A 4GG8B 4DKFH 5CD5D 1K4CA 4HGWB 4LSSH 3T0AA 3AS3A 1OD8A 2EPLX 2YHGA 3FZUC 4JKPH 3O6ML 1NAKH 2DQCL 3DIFA 3RBSA 1F58L 3I2CH 2J47A 5A6KA 3ZKQD 4P99A 3UDWC 1REIA 4HPHA 3FQUA 1BG9A 5HPMB 1NWRA 1O7VA 3VI4E 1Z2KA 3QWQB 1U3HD 4FOMA 4IOIA 2ED8A 1UWEH 3ARGA 2V7HB 4PJGE 4U1KA 3CPLA 3ZKSD 4DKEL 1JNDA 3ZE0E 2M8XA 4U1IA 4V2CB 1A6UH 3HAEB 3MMDA 3S37X 3I6GA 3D3VE 4F37F 4RIRA 4U05A 3VO0A 4G7VL 3IXTB 1NCUA 2EADA 1I8LC 2R15A 2V5SA 4P4RB 4PMZA 5D9SA 1A02N 3WIHA 4H88L 4PRDB 4C83A 1H4PA 4UMGA 3CZGA 4Z7NF 4N90E 1NC4A 1QW9A 1I8KA 3QIUA 3SN6N 5BXPA 3GI8H 4AYFA 3B9KA 3QG7L 4JFDE 3P2TA 1ZHLA 5DSCA 4U1LB 5GGSY 4K68A 1AQKH 3GBML 3L3IA 4H20L 4OOZA 4OF5A 4P9MH 3BXWA 1HHJA 2CUIA 5EU5A 1KEMH 4ELKA 4PG9A 3UX9B 12E8L 2XG9A 4LLAA 1TZGH 1ZT1A 3L3HB 4LLWB 2W60A 2FL5B 4AMWA 3FCTA 1MFAL 3HZVA 4OD2A 5EB8A 4FQQA 1X4YA 4Y19D 4JLRB 4X6DF 2FDBP 1ZLVK 2XI9A 4MA1C 2VXVL 4NJAL 3IDNB 1V0MA 1PKQA 3E6HB 3LZFL 5DDHB 4DM1A 3QXTA 4XCCH 1GHRA 4PB9H 1TJIL 3ARQA 1G9NC 1MNUL 2GAZB 5E08L 4ZENA 5A2JH 1NBQA 1BFOA 2HP4A 1MH5A 3TTOA 2JJVA 4S1DC 2J5LC 4GQRA 4U6XB 1GJWA 5IB2A 2QSCL 1KC5L 3VG0H 3DVIA 4PJIA 1D6EA 4XH2A 4UZSA 2W4XA 4LAJH 5I24A 2MKLC 2XTKA 1X5GA 2VZOA 2GEEA 2BVOA 3TLRA 3ZKMC 5EBLA 4YNYB 1JNLH 4P7OA 3MYJB 3SDCD 4Y16D 1GXEA 1MFEH 3TJEH 5IV2A 2P8PA 2ZCLH 3MMEB 3LKRA 5F7EL 3WQWA 4LPUA 4HPOH 1H3PH 4XB8A 2OLHA 2WBGA 3LD8B 4UUJA 1HKJA 2F1BA 3ZJ7A 4B3KA 4YZFE 1RIVH 3HC0B 4JJHA 4PTUA 5IB1B 4PJ9B 2WZPD 4PLKD 5C9JA 4HCRH 3P0VL 5E0CA 3OF6A 4RGND 4KZEL 3I6KA 3WUWA 2VXSL 2VRKA 5CD3B 3FRUB 4UFHA 4F66A 1JGUH 1R24B 4M1DH 5CP7A 3V95A 4D0CA 5D1QA 2P49B 4TTDC 3W9EB 3EDJA 4GRLB 3BLPX 2R4SH 2BCKB 5F6HJ 3T04D 4AYGA 4ACPA 1ND0A 4L9DA 1HZHL 1OAZL 1WDSA 3MUZ1 4V1DD 2GJXB 5HD8C 1A3RL 1MCOL 2HTKD 4R4FL 1QHPA 4LK4A 3BCFA 4G42B 3PGCB 4RAHA 2SEBA 1HH6B 1JAEA 1B3YA 5JA8B 4FHBD 1SM3L 4P3CL 5L2KE 1GZJA 3NCJL 1A14L 5TE7L 3CZFA 4YHKH 3SDXA 5D6CA 5FO7A 2V38A 4UTBH 5E9DA 2WLZA 1NAMB 2YD7A 1W1VA 2VQTA 1F4WL 3LKSB 1FVDA 3FJTA 5I5RA 5IVXF 1UA6H 4IMKC 5JDJA 5IP4A 2FYYA 4AH2A 3EYPA 1GVYA 1W72A 1K4DA 3MXVH 3S6TA 2AJYH 4Z7VB 4PSRA 3I02B 1BGGA 3B2UC 4RMTA 2PTTA 3U9UA 1SEBA 4KK8C 5GJSL 2YUZA 4KV5F 4YXLL 2ID5A 3UO1L 2VRJA 3GZAA 3C6SA 1T22B 1EEQA 4GI8A 3HUJF 4AD5A 3MLTB 4LCCA 3PTKA 2J6EL 1JTPA 4LEOA 4HOXA 1O7AA 4DEPB 1JGDA 2G3IA 3BIAX 2CKBA 2APWA 1G9MC 1QNOA 1QPPA 2OBGA 3AMGA 5HYJE 1NEZG 1WEJH 4FRWA 4R96A 1MQKL 1GC1H 2ZXBA 5CIPH 1UD2A 4QLKA 5CGYC 4AZ6A 4PJ9C 2BOBA 3Q1SL 4KJWC 3DIFB 3OKNA 2PWFA 1HP5A 1UWSA 2DQEL 4WJ5A 4LFHD 4NRXA 4Q74A 4XPGL 4HWUA 3DMMB 3NIFE 5EWIL 3LHPL 2R69L 1F4HA 4IOIB 1ZLVH 3CZLA 1KFAH 4YHMH 4OIIH 3CPLB 4U1KB 5CSGA 1XSJA 5BVPH 3SJVB 1T0NA 4MZ3A 3A0OA 2QMKA 2R1XB 3CVHH 3I6GB 3SDDD 1UH4A 3HMXL 5LXGL 1KCUH 2O9PA 3VRJA 1G84A 3BD3A 3RVTD 3VDBA 2F5AL 2VL5A 3BT2H 4HLZG 4WEBL 1EMTH 5D9SB 4DGIL 1B2WH 1GORA 2NY4D 1YEDA 4HK0A 4QNPF 2CIPA 4NQDD 3G6MA 5I78A 1H8SA 2GJPA 3VDHA 3VCLA 1MQQA 1NC4B 4FQXA 1I8KB 3QIUB 4Y1AE 3I84A 5MI0C 3B9KB 4LDEB 3UTTB 1ZHLB 3QPXH 1EXUA 5DT7A 1U0QA 4KXZI 1GONA 3MUAA 3RVVC 3MODH 1U93A 4MNHA 1EVTC 4RFOL 5C07A 2UY7A 5EU5B 3Q5YA 1JFHA 4ELKB 1E15A 4PG9B 4JPKH 3TEUA 2FATH 4ZUVB 1OARH 4OUUA 4K3EL 3SE9L 5D7SL 2V3FA 5HHXL 2PI6A 4HS3A 3HZVB 4OD2B 3LVEA 1J05A 2DGAA 3O3DB 3BP7A 2YBUA 1PKQB 2FZ3A 5BRZD 5EBAA 4JDVA 1HJQA 3BIKB 1LK3L 2H9GA 3PL6C 2E6JA 2R2EA 4PJ5E 4OZGE 3O6LL 4DEPC 1EFQA 1B88A 3B3IB 4PJGA 5FO9B 2IGTA 4FTVD 4Z95L 1R3KA 4HV8A 1IC5H 2XTJB 1BFOB 4PJCE 1MH5B 1I1WA 4OUEA 1IM9A 3UTPE 1NCWL 1NGPL 3NZHL 3RGVA 1P4LA 1G9NL 4PV9A 5IB2B 3GXPA 4APQD 4NJ9H 4F8QA 4PJIB 1D6EB 2K3TA 1OGAD 4M24A 4B16A 1VFAB 4MLIA 1ESWA 3VD5A 5TE4H 1MI5A 3DMMC 3W27A 4MHHG 2B0SL 4X4XA 4X99A 2YPVH 5EBLB 4N0UE 4GKNA 4DM2A 4JFDA 3WFCH 3PWPE 1L7TH 2P8PB 5DMGD 1FPTL 1F4YL 2A9ML 2YA1A 3KG5A 2XSAA 3HTLX 1NANI 4GBXA 4UUJB 1KWGA 4PJDE 4LVNB 4LLUA 2ICEA 1A3HA 3EFFA 4GW5A 2XZZA 3ZOAA 1E27B 5C9JB 3GSVA 3QFJD 1PEZA 5E1AB 1I9JH 1ZWIA 1FFOA 3I6KB 3WUWB 5E8OA 3QIUC 4WTZA 3DO3A 3V4UH 1X9QA 3L5WA 4Z7OE 4D0CB 2VH5H 5EOTA 5D1QB 4HJGA 4DGVH 3B5GA 3SGJC 4OM1L 2PYEE 3APGA 5D8JL 3CC1A 2D3NA 1ND0B 4W6YB 5GGVL 5ABDE 1P7HL 1FP5A 4RA0C 1JPST 3HMWL 3TZVC 2NPLX 3UJIH 3DV4B 2AGJL 5SWZD 3WUFA 5AAWA 5B8CB 1IQDA 4NGHL 3FW6A 1M05A 1HE7A 1S7WA 4PMVA 1YJDC 1ZT7A 1OCWH 4HMEA 4EIGB 1JPFA 1DEDA 1EHNA 5D6CB 1IAIM 2AQ1A 5FO7B 3MACH 5DA4A 3VXPB 3CV5A 4BSVA 5FYJD 2VVSA 3WH5A 4YXHH 3MRMA 1DBML 1CU4H 3MV9A 1FDLL 1KQYA 4CCCA 5BXRA 2FYYB 4AH2B 3A4WA 2Q86A 2UZIL 1W72B 1K4DB 1FNAA 2YDQA 3DROA 4G3YL 2VURA 2WHKA 1KB5B 1GPOL 4OQ1A 2IPTH 4CN1A 4ZXLA 3WNKA 2PB1A 4NQUA 3IYLW 4PBXA 2PTTB 3DRTA 4UQ3A 1SEBB 3U9UB 5HXMA 2E4TA 3O0RH 5DJXA 4YBLB 2VRQA 4JE4B 1A6AA 4KK9C 2PWGA 2YPLA 4Z7VF 1ZLSH 2QHRL 3C6SB 5DK0A 5DTFA 1S5IH 3KDMB 4RAUA 1OGGA 4LCCB 4LEOB 5HHME 1EJ6A 4GT7A 4WWKA 5IBUG 1JGDB 1XR8A 2Q8AL 2YK1H 2CKBB 1SY6L 3BCDA 4U1HA 3BVVA 1QVOA 4KKLC 4G9DA 3V4VL 1AQDA 4LVNC 4AW7A 3VWKA 3ARDC 5E2JA 3RVXC 3OKNB 2XJ7A 3DUHA 3W5NA 1G9ML 1OAXL 3U4EA 3MUGA 2ARWA 4WJ5B 1IKFL 2EDWA 4RL3A 1ULVA 4NRXB 2Y72A 5L2KA 2YUVA 5EFFA 4M4RA 2WQRA 3SOBH 4N1HB 2X1XR 4O02L 4TOYL 5FL0A 2WMHA 5DZNA 4IOFD 2ED9A 3T4AA 1T0NB 3V5KA 3WD5L 2UZYB 2YA2A 1TJHL 2DLFH 3RKDC 2A3CA 4JB9L 2BRRL 4AISA 2BC4A 2FBJH 3L95B 5B8CC 5C08E 2D7TH 2VL5B 2R1WB 3FQNA 1H3UA 5IFPA 3KYOA 4HK0B 1YEDB 2UY6A 3RRQA 3KJ6H 1CN4A 4JPIA 4KXZH 5BMFH 4FQXB 3TBTA 4XBGA 3QDHA 1EDGA 4AD4A 5CINH 3O4LA 2ORBH 1YMHA 2M26A 1KTBA 5HHNA 4P46A 3VXTA 2UZXB 1MCDA 2AXHA 5JORA 2J7DA 5C0GB 3LMJL 4M81A 2WVSA 5C07B 1OWRM 1I1YB 4OF6A 4XT1C 3WFHA 4X9GA 5KW9H 1MREL 1UM6H 1GJIA 4JFWA 1XZ0A 4OUUB 5HNNA 4H1LH 3K4DA 4OM0L 4TSAH 4TTDD 2Y36L 4YH6A 2FGWL 1J05B 3DX9A 4CW1A 4YBLC 3W29A 3CCHA 3TP4A 5I30L 2HKFL 1MCRA 1FGNH 1ZGLA 2FZ3B 3QHOA 4FQJL 1DBKL 4JDVB 3SUSA 2H9GB 1RZ7L 1J8HE 4RZCA 2R2EB 5HD8D 4LCCC 4HUUA 3UBXA 4ELMA 5J06A 1R3KB 3CFEA 4TOQA 4HV8B 2WBKA 2PWHA 2W59A 1GQJA 1IM9B 2MQCA 3MU7A 5D9OA 3TT1H 3RGVB 4GJTB 4D3CL 1PY4A 3QISA 2CEQA 1LL7A 1MRFH 1R85A 4ETYA 2GUYA 1OT1A 4DKDC 4D8PA 2R23B 2X4RA 2A3EA 1MI5B 1IAKA 3HMCA 2OJZL 4U6VH 1PX4A 4OZFH 4K94C 2EDFA 4X4XB 2DM7A 4M9PA 1RP8A 4PJIF 5A6MA 3U7BA 1Q0YL 5LJYH 3MNZB 1NANH 1RULH 4JFDB 2V2XB 3B2UD 2OLDA 3GGWA 3RIFK 3TH4T 1TFHA 4GBXB 1MRCL 3MRNA 4NKDB 1GGBH 3PWLB 4MAYD 1B6DA 2ICEB 1KCRH 3EFFB 3MRIA 1OSEA 2GSJA 4WJXA 5M7QA 3GMMB 2O5ZL 2FBOJ 5C0CE 4H8UA 3STLA 1X5ZA 1I4FA 4RISH 2R0WH 1FFOB 1ZS8B 3ULVD 3IETB 4FQXC 5E8OB 1OIFA 2I9LA 1E4IA 3L5WB 3DHJA 1VRXA 2DS4A 5EOTB 4HJGB 5CGYD 3E1F1 5K9JH 4KJWD 1XCQA 2PWEA 2R56H 5JW3H 1NQBA 1IZKA 4LCWE 1G5AA 3OGSA 1VJSA 1W32A 2OSLA 2BERA 5LYRA 1RUML 3O6KH 1KN4L 3ULUE 1ZVYA 2BFVH 3MRHA 4PJCA 1IQDB 4J8RB 1M05B 3PF2A 4HAGA 1S7WB 4GRLD 4EANA 4JQXC 1JPFB 2GT9A 3VGGA 3VIIA 1QSZA 5FA3A 2COQA 2D03H 4A6YB 4BSVB 4NN6B 5HJ3A 5KVGL 1G7MB 3MV9B 4N0UA 1B30A 5CKGA 1UEMA 1CGVA 4OLYL 4TPRL 3DROB 3F6LA 4M5YL 3SDYL 1UR2A 1EJOH 3GI9H 1VEMA 3RGVC 2BVDA 4PYSA 2AP2A 2GY5A 4FF5A 3N9GL 4YPJA 4PJBE 5FOJA 2EIZA 5F6IB 4IM4A 4P5MA 4PJDA 5D1XC 3DRTB 4UQ3B 5DJXB 5A2LH 5F89A 4LP4A 4LHJB 5FUOH 4J7RA 1BVNP 1WTGT 1A6AB 4PG2A 5C0RH 2YPLB 4FQ2H 1CDGA 5DTFB 4RAUB 2JJSA 5T3ZL 3C8KB 1MAML 5F9AC 3GSWA 1VACB 4WWKB 2O9OA 1NC2A 1KENH 3QXDB 5GRJH 4LCIH 1T2JA 2J62A 4HTYA 3M1BA 4U1HB 3NCCB 4GBXC 3RWJA 2EH8L 1QVOB 1BPVA 4G9DB 5EU4A 1BOGA 1OIMA 3QXAB 1AQDB 5BW7C 1T0PB 2ERJC 3VWKB 2VIRA 3N13A 1MF2L 2CPUA 4WDIA 3MYZA 2DAVA 4NKMB 5EOCH 4BA8A 3MUGB 5BZDA 2J88L 3RM9A 5BYWA 4L8CA 3X3FL 4HAFA 4UU9A 5L2KB 2B4CH 5F7YC 1JWMA 2VQUA 4QCEA 3P4NA 25C8H 2A83A 2ADGA 4W86A 1MFDH 3T4AB 2CK0L 3KS0J 4WUKL 4A3HA 1DEEA 1GOWA 1HKFA 4GI6A 2BC4B 3N1MC 4PGBA 1WP6A 2OR8A 4AZHA 2P4AB 3LB6C 1CDCA 3ARGD 3MJ9A 3FQNB 1DZBA 5I79A 5B38G 3KWWA 3KYOB 3BP5A 3RUGE 4PUBH 2YRPA 4JPIB 3ZYIA 3A3HA 2QL1A 4R9HA 1N8ZA 3PHOA 4XBGB 3UYOD 1SZNA 2XXCB 5ENWA 1FH9A 3O4LB 2V3EA 1YMHB 1UVQA 4NN6C 5M03A 5HHNB 2UWEE 4P46B 3VXTB 1QNPA 3SE8L 5JORB 4ZO7A 3AC0A 3W24A 4U2ZA 4HFUH 2W9DH 1W0VB 4GKZA 3WFHB 1NC4D 3QIUD 4BK4A 3PXHA 2LAAA 3RMEA 3B9KD 3UTTD 1U9KA 1XZ0B 4POYA 4MX7A 1OB1A 3SCSA 2X89A 2F7QA 4AIEA 2FGLA 5F6IC 3IFNL 4KY1H 1W0YT 4CW1B 1T7ZA 1IGJA 1MHPL 1MUJA 3HNVL 1KB5L 3RHWK 1ZGLB 3IRPX 3F58L 1Z9OA 3ZT7A 3KPNA 2CR6A 2X4OA 4MLSA 3QOKA 4RZCB 4DN3H 1E6NA 4HUUB 5DS8A 3SGKA 1YNLH 2DQUH 4WWKC 4ELMB 1MIEL 1MY5A 1C1EL 3CFEB 2XWBA 3W39A 4JREB 4WHYG 5DQJA 2IMMA 3RCNA 3ZDYF 2DT0A 3C9NA 3VSUA 2H2PD 5AZEL 4L3AA 5HPOA 2KUTA 1OF2A 1S9WA 4JZOA 5C08A 5CGTA 4N8VG 4D8PB 5GNXA 2UY3A 2XTJD 4TNVK 2X4RB 1IAKB 3GHBH 4NDMB 5IESH 1UXWA 2HFFA 3CFCL 4ALAH 4CRPA 1KR0A 1PGRB 3QDGA 4O4YL 4LYQA 5AYQA 2FX7L 3CXHK 1MIMH 5F93C 4GZEA 3SURA 3C6LA 1TMCB 5T5NF 3GGWB 1U30A 4WLCA 1P6AB 5DMKA 3MRNB 5BOPA 5BO1H 2XVLA 1ZEAL 3MRIB 3JZ7A 5IOPB 2FX8L 2E6QA 3STLB 4EUPA 1SFSA 4XCYA 1GGUA 5DI8A 1I4FB 1QFHA 2G5BA 2JLLA 3IVKA 4JDZA 4UILH 2F53E 3N85H 1T2XA 2I9LB 4FQPA 3JV0A 4KKLD 2HMIC 3O81A 4XNMA 4P46C 3PP4L 1A3LL 1OAYL 2XY2A 4K07A 1ZVSA 3RVXD 4S2SA 3IDYB 1XCQB 4ZOAA 3OF6D 3WFBH 4YBQC 4YFEA 3NUKA 2OSLB 1ZE3C 1YNTB 3MRHB 1AXTH 2XWTA 2IPUK 4MD0A 4PJCB 2EH7L 5D1QD 2ADJA 3UG3A 1TE1A 4YHEA 2X2YA 3MTRA 1DFBH 4GW1A 2GT9B 4P2RA 5FA3B 1CR9L 1RQ5A 4XNZB 4M1GH 3SCTA 2YWYA 3P77A 4ZODA 2WCSA 4P8WA 3GKZA 3BAWA 5HJ3B 1JG9A 3BSHA 1B90A 2YN3A 5B3JE 4JREC 1YN7A 4PGZA 1WITA 4MA7L 1TVPA 5AG8A 3EO9L 4JRWA 5E9DD 1U8JA 2VSCA 1HINL 2ICWI 3WSUA 1LO0H 4M29A 4NM4H 1PYWA 4G43A 4WU5A 3BJLA 2EIZB 2C1OA 4KI5E 4P5MB 4PJDB 2AJUH 3HZYA 5AAMA 4TSBH 5F89B 1F13A 1T66C 2QF8A 1MHCA 1KT2A 1NH6A 3LPFA 4I18C 4JN1L 4QXTA 4WEMB 4JVWA 3OQ3B 5M94B 1X5HA 3GB7A 3C09B 1X6LA 3PZTA 1C5CH 2G60L 4DUVA 5D4QA 4OGAC 1CS6A 1NC2B 3DSFL 2DH2A 1UM4H 1LE9B 3EZ8A 4NN5C 3U57A 3M1BB 3UR7A 3VH8A 1KQZA 1INEH 1YY9C 4ZS7H 3AMDA 5EU4B 1BOGB 3AY4C 1GSMA 4M1CD 5JLZA 5E2WL 3N1QC 2I24N 2VIRB 5DD0L 4DZ8B 4LYPA 2YEZA 4QF1B 5BZDB 3WN6A 5A6BA 1DQLH 2IANA 2R8SH 1TLKA 4L8CB 4UU9B 4RFEA 5I6XC 1OB0A 4PRBA 3DC0A 2YMXL 3OAUH 3P4NB 2A83B 2OMBA 2ADGB 4M43L 3NA9L 2ZUSA 4X80H 4RNRA 3IDYC 3N50A 2FSEB 4QYOA 1OTUC 4BQ9A 2BNQE 1UH3A 1DEEB 4LSSL 1HILA 2BJMH 2N1KA 4PGBB 3KR3L 3TN0A 1JMXA 3I2CL 5JXAH 3SUVA 4OCXH 1TJGH 4IISA 1RVFL 3WIJA 4BFEA 4ODBD 5TQ0L 2EXYD 3MPCA 1D6VH 3KWWB 3ZE1F 3BP5B 4LSQH 5FYLH 4GFTB 5D96B 1GYAA 4PJBA 3KL0A 1UWEL 4N0FA 1N8ZB 4XNZC 1ISYA 3PHOB 2WBJA 1WLHA 5ENWB 3BUTA 1A6UL 1UVQB 2OZ4H 4ISVA 1U6AH 5E1HB 4KK6C 1XF4B 3VRIB 4FP8H 4GKZB 4FQXD 4LFHG 4OJFH 1IRAY 1W8OA 2E27H 4MX7B 1OB1B 1ITXA 4U6YA 4QCFA 4JVUA 5D2NE 5I1CL 4AY1A 2R0LH 3GI8L 3MNWB 5C07D 1IGJB 1MUJB 5EZJA 2YD1A 4PG2C 3BDBA 3KPNB 2X4OB 4D6GA 4P9ML 3C09C 4XMLH 5DS8B 2JF1A 4NHUB 1KEML 1S9YA 3IJYB 3W39B 2MMXA 4S0SD 4DGYH 1T5XA 1UM5H 4MA8H 1IAII 3QHFH 3R0NA 4ELMF 5I17A 5I8OL 3SCQA 4LPXA 5C08B 1S9WB 4JZOB 1KR1A 2GY7B 1XGZA 2E8YA 3O2WH 4XCCL 1IM9D 1KJ3H 2Q7NA 1UXWB 2OWWA 2DBJA 2HFFB 5F7UA 3RGVD 4ACZB 4JFQA 3QDGB 5BZWA 5ILTH 1CLZH 4U3HA 1OLLA 5CQ1A 1GPFA 3KYKH 4GLRI 3C6LB 1ACYH 3VMPA 5F9OH 1ZHKA 1QQDA 4L8SA 1MI5D 2HT2D 5JZ7C 3VG0L 3KE0A 4LQFH 2OL3A 3U5YA 3SCMC 5C0AE 1FVEA 4LNRB 3R8QA 4LHUA 4JFDD 4EUPB 4XCYB 5DI8B 2G5BB 1ED3B 3T1WA 3IVKB 4JDZB 1JNLL 4GBXD 2J8OA 3MLPA 2CBUA 1VPOH 5ECUA 2ZCLL 4XNMB 3DNKA 4ODVH 3CK0L 3SPVA 4Y7EA 4HPOL 1EA9C 4S2SB 2AS5M 2JJUA 1Z9LA 4M02A 5F7HA 3GXNA 3OG4B 2A1WL 1RIVL 3ABZA 3QUZC 2EZ0C 1KIPA 5HDLA 5A6AA 4AEIH 5EN2B 4UB0H 1UQZA 4HCRL 1J1XH 1RZKC 2XWTB 4MD0B 1U8HB 4HEME 4HZAA 1LD9A 4DWSA 5IB4A 3BRDA 1IT9H 1MWAB 4GW1B 5AYBA 1JGUL 4M1DL 4P2RB 5MHSD 3RKPA 4X7EC 1QA9B 1OGTA 2KBGA 1WO2A 1TETH 3P77B 3RX5A 3TPKA 3C60B 3LSOA 4LIQL 4EI5A 3GMQA 5E0QA 2D0FA 2VLMD 1QSEE 3S3PA 3VU2A 2NT1A 5T1DH 2HT3C 3NBNA 4PR5A 2ZUTA 2R4RH 2Y4SA 4PP1C 1Q9OA 3D39B 1KWKA 4ZTPL 4BH7A 1U8JB 3S35H 1A7NH 2FO1A 4I9WD 1PYWB 4FQHB 2W62A 4WU5B 1GIGH 4YHKL 1IV8A 3RWDA 3PN8A 3HZYB 3MV9D 1IAMA 4PY8I 4M3JA 3BH8A 5KS9B 4HZ6A 1KT2B 3WDJA 3HNTH 4QXTB 2F53A 1WAAE 4LPCA 3QWOA 3INUH 1ZJBA 4ATWA 2E7HA 1J1OL 4WHCA 4X8XA 2VKXA 1KOAA 2AJYL 4RWYH 2C26A 1KGUA 2ADIA 2X44D 3VH8B 5DXWA 3D51A 1PZ5B 2YPLD 1DBBH 1UZ4A 5A8MA 5I19H 2AJVL 1TQUA 2YEZB 1LTXA 2YPKA 1OP3H 3Q6GH 4KVCH 5C0IA 4WWKD 5KSUA 2IANB 4TNWK 5EORL 2EEAA 3B9EA 4RFEB 5BVJA 4PRBB 2ZXDA 2Z8RA 3H3PL 3GMOB 3RJDA 3VWKD 2W1NA 1S7SA 3JWDC 1FNGA 4QYOB 1C12A 2B8OT 1WV7T 2CRYA 1HILB 1WFUA 4JO2L 5L2KD 2JJWA 3CD4A 4PP2B 3TN0B 5DQDH 2DT1A 4MNQE 2PXYC 1JPTH 1JZ6A 3TBSA 2E5EA 1CXFA 2J7EA 3VRLE 4PJBB 1KNOA 2IQAA 3WQVA 4N0FB 1BFTA 1KFAL 4K7PH 4YHML 1V0NA 1HKLH 2WBJB 5BVPL 3C60C 3SHSA 2GSGA 4ISVB 4Z0BH 4PMYA 3P9MA 1DBJH 1CBVH 1D5XB 3DXAB 1WGOA 4Q97A 4LSUH 4L4VE 2WWMC 3SDAC 3C8HA 1X44A 4LCUA 2HMID 5IK3A 2XPKA 3O4LD 4U6YB 4DAGH 4P46D 1FLRL 3CMOH 2VAAB 1QRNE 3N04A 2ZE0A 2HRPH 3NN8A 5EZJB 4UAOB 3CLFH 3QPXL 1BJMA 5H2BB 4TVPH 1QWUA 1Z0MA 4Z8FH 4OBRA 3LRHA 3MODL 3MMWA 3BDXA 1QFOA 1QNZH 4QY8B 3ZTNH 1ACZA 3ZSSA 1S9YB 4JPKL 4S3KA 1MLCA 5IJVB 2J7BA 3HAEG 1OARL 5ABEA 3LMYA 4OAWA 1W9XA 3P9WB 3STZB 4HWZA 4K7FA 2AK4E 1XSIA 4EVNB 4MXWL 5I17B 1A6ZA 1BMGA 4J3WA 3KLHD 2WB5A 2BVPA 4KPHH 2L4OA 4Q2ZB 3PNWB 1A6TB 4GLRH 3R4DA 3REVB 5JMRA 4JFQB 4Z5RA 4JZ5A 5BZWB 5C0EA 1PSKH 1IC5L 4OLUL 4ZFZB 4M6AA 3B2VH 1TVDA 4L29A 2DLGA 1ZHKB 2HJLA 1QQDB 4ZUUA 4UQEA 4L8SB 1YMMB 4BCEA 4NJ9L 3TN0C 2OL3B 5CHNA 4NFBA 5BQ7A 3P4OA 5EU6E 1FVEB 4PV8A 4G6ML 2MQ0A 4BELD 1R3JB 4LHUB 2NY6C 5TE4L 5LQBH 4MDIA 1NCCH 1P5UA 2QQKH 3BRFA 4GG6E 3LRSA 1CGUA 5AYUH 2QR0A 1WZ1H 2WBJC 1YY9D 4N1EA 5D71H 5MERB 3PGDA 3WFCL 3DI2B 1L7TL 1FG9C 3TYGH 3DX4A 2E9LA 4S0TD 1A6WH 5IHUH 3SPVB 1KUMA 5DT5A 2XA8H 3U48A 3U30B 1DWGM 4CMMA 3AHVA 1CNVA 1NFDA 3AZRA 5AD0A 1KIPB 3K81A 1KF9B 3UG4A 5ADPH 1I9JL 2EJ1A 5E24E 5ITBH 4HZ8A 1L8NA 4DWSB 5IB4B 4P9HH 3V4UL 5ETUB 1OTUD 5DD3H 2EC9T 3C2AH 4UAOC 2VH5L 1OGTB 1QZ1A 1RZKL 2ZCHL 4DGVL 4ONOA 4XP9H 2IFFH 3MFFB 1FBIH 4EI5B 1EOKA 5MENA 2A6JA 5BCAA 5GS2D 4PR5B 3UJIL 3JV4A 1Q9OB 1EO5A 2OM5A 1QUNA 5FL1A 2GDVA 4NCC1 4BH7B 4QDMA 3SCPA 1WFNA 4FG6C 4I3GA 4HLZH 5E6ZA 3FB5A 3RWDB 5KVEH 4KK6D 2BOCA 4YDLB 3NDYA 5CJ5A 3MACL 3BH8B 3T4YA 2EIDA 4ZSOB 3ARYA 5E8PB 4FQ1H 3IKCA 3FHAA 1QI3A 5K9QG 5C86A 5FDWB 3QWOB 2EEXA 3N0PB 2XYLA 1N6QL 4HK3J 1KGXA 5KOVC 5KS9F 3IB4A 2VB5A 4F7EB 3SCUA 4L8SC 4JRXE 2ADIB 5DRXA 2DLHA 3O0RL 2JEQA 1T2QH 4UT7H 3UYRL 3W6LA 2BX5A 3AI0A 1NC2D 5KSUB 4HD9A 1ZLSL 3I75A 1UWTA 1S5IL 3TCXA 2KKQA 3TBYA 1MVUB 5BVJB 2DM4A 4JM2A 2MCG1 2YK1L 5DJ0A 1S7SB 1FNGB 4K3GA 1EDQA 1U2YA 5A94A 5IROC 1C12B 4FLSA 2ZSVA 3D85A 1QSEA 4ZFGH 4HU0A 3R1GL 5CEYA 2CJUL 3GXDA 2A3AA 4XB3A 3CFDA 2DQGH 1W1YA 4U5IA 1X5KA 3UETA 1MRDH 2AW2A 5LA1A 3AREB 1B3WA 4WY7L 2XVKA 2OR9H 5CZVL 1EBPA 3UYPA 1KNOB 1DUYA 2IQAB 4PRHE 4NPYA 1PVHA 1J9CT 4EDWH 1CLOH 3CUHA 1NGYA 3IANA 5JZ7D 4R4NC 1UUQA 4HIJA 1WZAA 4EI5C 2B1HL 5I2IA 1F8TL 2JELL 1MWAL 2ENYA 3P9MB 2DLFL 5J8OA 1IZJA 4Y5XA 5ITFA 2FBJL 4NUJA 1W8NA 4NO0A 3UC0L 3BZFB 4LCUB 4ODHH 1WWWX 2X1PA 3DV6A 3KJ6L 4FXLA 5A1AA 3QEUA 4BQBA 1CVRA 1W3LA 4U3AA 3LN4B 5KAQF 3NN8B 2ZCKH 2F1AA 1P69B 4PRWA 2ORBL 4LOUC 3WLBA 2WSKA 1LE5A 3SUUA 3KEHA 3ME0A 1FC1A 3L1OH 3B5HA 5DFAA 1J1PL 1MPAL 5EFIA 4FNSA 2X89D 1H5VA 4C56E 1XGTA 3WH7A 1RAMA 4JFHE 5D2LA 4NO3A 1U3JA 1UM6L 2CD0A 1MLCB 1AVAA 3GDBA 4HC1L 3OX8A 5L7XL 2P47B 1M01A 4OAWB 5FUZL 1MQRA 4HWZB 5DO2C 1U8OA 3WS6C 4K7FB 4IHOA 1R0AH 4PUEA 3VSVA 3W38A 1A6ZB 1IARB 5DJAA 4QWWD 2OI9B 2VT0A 2X1OA 4MNQA 2QQNH 3W0WE 2L7JA 4OFKA 5KSAA 2BVPB 2HT3D 2JF6A 4W68A 3K7UA 2VRAA 1PX8A 1BFSA 2G41A 4EJ1C 1J0IA 3ARWA 1FORL 2X1IA 5F72S 4Z5RB 3BXNA 5C0EB 4Z7QE 3V79C 1EAPA 5C08D 2FWOA 4XC1L 2VLKB 3BISA 4L29B 2W63A 5CILH 5I1GH 2HJLB 4ZUUB 1QFWH 3TT1L 1BQLH 2NNAA 3GSNH 4WW1A 4CVZA 2M1KA 5J1SC 1CQKA 4FFWC 5CHNB 2Z8WC 4RMSA 4UINL 4YLQT 1S7XB 3P4OB 3U79A 2O5YL 3QUMH 5F7NC 3QDGD 3SQOL 3AREC 1I85A 4U6VL 3C6LD 3LRSB 5FYJU 4WI4A 1QBBA 2QR0B 1HX0A 3IJSA 3SKUD 1RULL 2EDHA 3PGDB 32C2A 4NZJA 3U0TA 4RCAA 2CBIA 2G75A 3HS0B 4M7KH 3F4VA 1VCAA 1RPQA 2X2JA 5I1EH 4CMMB 1GGBL 3THML 1SBBA 1NFDB 5AD0B 1KCRL 5J6GB 1H41A 4AIUA 5I2UA 1E28A 1JF6A 4RISL 5IJKA 1OAUL 4TTUA 3V5DA 2NLJA 2AK4A 5CZKA 2P24B 2APVA 3LKQA 2J7GA 1WSST 1AC6A 2Z4QA 1MVFA 3ZO0A 3G04A 2W9EH 5K9JL 5AWNH 3NDZA 2GQHA 2WUCH 1QEWA 2R56L 3NZ8A 5JW3L 5MENB 2A6JB 2JJTC 1NCAH 2VC2L 3EJPA 5CSZB 4M6OH 3EAKA 4N9GA 3JV4B 3QIBA 4P2RD 5DJ2A 4GUPA 2WXDM 2PKDA 5F88A 3FB5B 4JO1L 2DD8H 2OI9C 5EU6A 4XVJL 2BOCB 2VZ1A 3JWOH 3W28A 4UOQA 2OWCA 2WHJA 3OKKA 4MXVE 2D03L 1DL7L 3STBA 4UDUA 2BRQA 3WUWG 3IKCB 1C16B 3QUXA 1K6AA 4OF0A 4TX6A 1UC6A 5GSRA 4GRWB 4FA8A 1EJOL 3GI9L 5D1ZA 5C09E 3T2OA 5JW4M 1EAJA 5KTEH 1JP5A 5DRXB 2Z92A 4ZXBB 1ERNA 1KTCA 3X13A 3A24A 2CPCA 2DOCA 4J4PA 1DANT 1KJMB 3ARPA 5FUOL 4WCYH 1K8IA 4FQ2L 3I75B 3KHQA 1SMOA 1W91A 2PYFA 1R3LA 5I1LA 4XCFH 5SV3A 1AHWC 2I07A 3M46A 2WW8A 4JM2B 4CJ1A 1OINA 5DJ0B 2ZG1A 3ULUD 2ZUMA 4X9IA 1DSFH 5A6BD 3ULSA 3EJYC 3OXRA 2IAND 2ZSVB 3D85B 4YE4H 2WZEA 8A3HA 3WFEH 1CZ8H 5CEYB 2NX5A 3CFDB 3UESA 4XPBH 3SCVA 5DC0A 2EICA 5FEBA 3TM6A 3X11B 2O61B 2B4CL 1DUYB 2HKHH 4NPYB 1K9EA 3NCYS 3RPMA 1NGYB 4BUGA 5AC4A 1S46A 4HIJB 4NZRL 1QG3A 1MFDL 3TN0D 4JPVH 2DKMA 2IH1A 5I2IB 5D6DA 1E4MM 1UD5A 3OXSA 5I0ZA 3UTSA 4Y5XB 3VMNA 3VG9C 5GZOD 3AIBA 5IGXH 4NO0B 4H7VA 5JHLH 3L7FA 4QRPE 1HDMA 4NQXA 4C4KO 1KIUA 2WBJD 5DMIL 3WBDA 4QRTA 2XPGA 4PGCA 4JRXA 1WZKA 3DV6B 3RM8A 3QEUB 4NOBA 4WEUD 5ICZA 1H2JA 1WWCA 1OTSD 3MO1A 2HWZH 1KXQE 4HA4A 1V3JA 1AMYA 3WLBB 1LE5B 5ECJE 3OAYK 2CBVA 2YZ1A 1UT9A 5EFIB 4MSWA 2VWEE 1XGTB 1P5VA 2W9DL 2G8ZA 3RL2B 5GGQH 1CPUA 5D2LB 4NO3B 5HSFA 5BXSA 1R87A 3OX8B 2MPAL 1BWWA 4XP6H 1U8OB 4ZXBC 1H8OA 4KY1L 1ZKAA 1JYVA 4M62H 1QD0A 3IAQA 3BPLC 1F2QA 5C0BB 3L9RA 1JK8B 3VD7A 4DFIA 3V7AE 5DJAB 5DQ9A 4D72A 4MNQB 5KSAB 3FB6A 4PTVA 4W81A 4KRUA 4JVPA 1G7IA 1A5FH 4UFIA 2DQUL 1CF8L 3EW3B 4JM2C 1JHLL 1IEHA 3CHFA 3U83A 3BXNB 2VQ1A 4MDJA 4FLOA 3VIFA 1Y6NR 2C3WA 4W6XB 1UKOA 5IQ7H 2FWOB 1EGJA 1ITBB 1WIOA 4WUUE 3S3SA 4PRAA 2C4FT 4XPHH 2NNAB 4WI9A 4WW1B 4Z7WF 4CVZB 4QCIA 3M6DA 3U1SH 4MNKA 2VC9A 1FYTE 4Q6IA 3L2LA 1FZOA 3B43A 2HISA 2ENSA 4YHIA 3FMGL 4FXKB 3VWJC 3EDEA 1JRHL 3F12A 3D25A 1I1AA 4NQVA 4M48H 4B41A 4HG4J 4ALAL 4XZBA 3PDOA 3IJSB 4E41A 3U0TB 5TGBA 2G75B 1X3DA 3ZL4H 4Y2DA 2ZNWA 2AJXH 2GJ6E 4LHUD 4Y5XC 1E71M 4Q7DA 5BO1L 4QHUA 4FABH 3CLWA 3NACL 3ZHDA 4JHZA 3TA9A 3U7YH 2D3VA 1NQ6A 3VPLA 1E28B 5ELIA 3CVHA 3V5DB 4UILL 3N85L 2KZWA 3D0LA 4I4WA 3LKQB 3T0EE 1NFDF 2JALA 4HWNA 5DFVC 2HJFB 2Z4QB 5F70A 3FN0H 3W0WA 5FK9A 3WD3A 3G04B 1K9FA 4PN2A 2DKUA 2PF6A 1CD1A 3VGEA 3NAAH 3TTQA 4G8FB 3WFBL 1QEWB 2EDDA 4HH8A 1YEHH 4EOWL 3N06B 4DWSD 5IFHH 5D7LB 4N9GB 5DJ2B 3QIBB 5EG6C 1AXTL 2EE2A 9CGTA 3D48R 3C5JB 4R4ND 2VYRE 1WC7A 4OZ4A 5F88B 1N0LA 4EI5D 5EU7C 3FFCE 1VFUA 2BDNH 3CPUA 5C6PB 5J57B 5EU6B 1NUGA 1Z0NA 4M1GL 3S5YA 3OKKB 3Q6FA 2Y8KA 2YS4A 3S3JA 4WTZG 4BJLA 1Q9LB 3QUXB 1HVQA 3MJ8B 1UQSA 3MV8B 4JY5H 2XFYA 3FAWA 3QA3A 5GSRB 4WI6A 4MNMA 2WINB 4X0KA 5E6YA 5FKAA 5D1ZB 4KH2A 4NQEE 5KSVA 3ALXA 1LO0L 2IALA 2V7NB 1URLA 4LOUD 4WFFE 2VR9A 3GRWL 3UEZA 2AJUL 2F53D 1SYTA 3X13B 4DVBA 1KIQA 4YEEA 4GRWF 4TSBL 2DQJH 2WM0A 1FV1A 1I9RH 1K8IB 3Q48A 5F7WC 4ZE4A 2PYFB 1R3LB 5I1LB 1S7VA 2RQ8A 2WIIA 4Y5VA 1C5CL 4G8IA 5INCA 4ODTL 2JE8A 3E8UH 2X70B 4CUCA 4AYSA 3OAYH 3RNKA 3QG6A 1INEL 4F2MB 1E0OB 1F00I 3ULSB 3OXRB 3WNNA 3GH7A 1MCIA 5BJTB 4Z7UA 4XWGH 3ROOA 3E6FA 1MHEA 2NX5B 4G6JH 5DFTA 2WMJA 4JM2F 3VXMB 2Z8VC 1DQLL 5IJKC 2R8SL 3V7MA 4MJ4A 1DBAH 4XHJD 5DJ8A 3MGAA 3QO0A 1FCCA 3OAUL 4IMLA 4F80A 4P0DA 5IG7A 3MRRA 3OLDA 7CGTA 4X80L 3SBWC 4FFWD 1CYGA 3VE0A 3DX3A 3OXSB 2VSDA 5L8KB 1Z3GH 5GGTL 3UTSB 2XN0A 4PCTA 3AIEA 4LVEA 3V0VA 3W26A 3T3PF 4OCXL 1TJGL 3DX6A 1KXHA 5E8DH 4I5BB 4NQXB 2FECL 2K1MA 2QTEA 4YUEL 1D6VL 4QRTB 2XPGB 4PGCB 3RQ3A 2CIKA 4M3KB 3C5SB 5ICZB 4AMKH 1YYLL 3ZT6A 1RP9A 2XZCH 3DGGA 3ARTA 4F37K 1NEZB 1UA3A 5HI3C 4D6CA 1UQYA 1JN6A 2DI9A 1U6AL 2EPNA 1D2KA 3W4RA 3QUXC 4QXWA 3EYVA 1M7DA 4MSWB 4AIXA 4FQIH 2F61A 4JR9H 5E09A 1T6WA 1F90H 2XIBA 4OJFL 3G6DH 2E27L 4P3WA 2BY1A 4U1SA 3TA3A 1PZ3A 2X8RA 3QEQA 2XZQL 5BWFA 4PJHF 1H0DA 4ONFH 4J4PC 1LWHA 5ABHA 5D2LF 1F11A 1XGPA 5DQ9B 3FB6B 1RY7B 3PGFH 3GEWB 3K2MC 3SE3C 4HIEB 4KQ4L 3VIOA 1G7IB 1U42A 2UY4A 4HWEH 2ADFH 2KQMA 4D6JA 2VQ1B 4MDJB 4XI5C 2AK1L 2J7HA 1MEXL 4DGYL 4UV7H 1UM5L 5IR1A 3O6MH 1LNUA 4PRAB 3QHFL 1QLFA 1FH5L 4QCIB 1DCLA 5HGGS 3NIDF 4Q6IB 4KTEH 1EHLH 4XVSH 4YHIB 3O2WL 5TDNA 1GAFL 4WV1C 1KXVA 2KH2B 1ZV5A 3F12B 4XVTL 3D25B 1I1AB 2VLKD 1KJ3L 4HUWA 4NQVB 4OGYL 4DKEH 1C7TA 3WYRA 2MTPA 4MJIE 3PDOB 1CLZL 4E41B 2EKSB 3P11H 1KXQA 1HNGA 5D6DC 5TGBB 4Y2DB 5F9OL 1X5IA 1H5BA 4JFEE 3HR6A 1I3RA 1WCBA 3I50H 1NGZA 4QHKI 5CSUA 2B5IB 4H88H 2NXYC 3ALWA 1BM3H 4HUKB 1WT5C 3V8OA 3O41B 1JMZA 1J0HA 3CVHB 2E40A 2FJGA 2DQHL 3B6SA 2UUDK 1V0KA 1GQIA 3BUQA 1JZ2A 5ESVA 3GBMH 1VPOL 4JFFA 4M82A 4LSTH 4XUYA 4ODVL 5FK9B 3KAAA 1DTUA 2CIIA 3AIVA 2JB5H 1U8KA 1A0QH 2XVGA 5I77A 3KL3A 4XPFL 4AEIL 3EKCA 1FQ9C 1J1XL 1FL5A 1MFAH 4Q0XH 2NY2B 3CZNA 4WUUA 3BD4A 1QSVA 1J11A 1RUKH 2ESVA 2EO7A 1WC7B 2VXVH 4OZ4B 1XGYH 2CDGA 4ORZC 3SEPA 5MEND 1MXGA 3EOTH 4UFJA 4MGXA 1TETL 3WDPP 1AQ0A 3RZCC 4KRPB 4ONHA 2NY0B 3ARBA 2WKLA 1QHOA 1RJZA 3HRZA 4HZLA 5ERWA 1R7OA 3WFLA 1X5YA 4UT6H 1BYBA 4KMLB 4Y8AA 1UQSB 4AQOA 2R4RL 4HKBA 1P4IL 4JFTA 3QA3B 3ALFA 4OIFA 1HXJA 3QWRA 1KC5H 1IC4H 4LHQB 4X6FA 3S35L 1LLOA 1A7NL 3RO8A 2IALB 2F74A 1EGZA 1GIGL 3EOAA 5E1QA 1J12A 1AI1L 1EEYA 4DVBB 2NMSA 3C8DA 4BQ6A 1FV1B 4Y7MA 1I1AC 1JGIA 3BW9A 3HG1A 4BUHA 3CFKA 3T0EA 2WIIB 4NQSA 3INUL 2GTWA 4Y5VB 3UTZB 5INCB 5DMYA 1HL8A 2HN7A 3LN9A 3WEXB 5A8NA 4Y2DC 5CBEA 3WXVH 3QG6B 5F9JA 5FV2A 3V52H 4OZFA 1DBBL 1XF2A 2Q8XA 4OLVL 1MAJA 4Z7UB 5I19L 3ROOB 4P4KA 1MHEB 3Q6GL 4KVCL 4C4KT 1VA9A 3VD3A 4J1UA 2XGIA 3PZNA 2YUWA 1P53A 3VXSA 4JM2D 1G6RH 2DMCA 1KB9J 5C1MB 3D3AA 2DQFA 5JXEC 1F3DH 4N0YH 3FFCA 1SEQH 3D85D 1P9MA 3QO0B 1QSED 3AU1A 1S7UA 1Y6MR 4IMLB 3DX1A 3EBVA 5IG7B 3MRRB 4G8GE 1E5NA 1IVLA 1V08A 1HZHH 1OAZH 4KKBD 3VE0B 3O9WA 5GRYA 2VDLH 1QPXA 1FFPB 1A3RH 1FHGA 1MCOH 4FXGA 1BIIA 4K23H 4R4FH 1AY1H 1I9IH 1KLGA 1MCEA 3ECBA 2P46B 3V0VB 3WKNA 3DX6B 5FGBA 1NOUA 6TAAA 1JPTL 1SM3H 3O2DH 2PN5A 4NQEA 1NCDH 3PE9A 4IM8A 1H0GA 2CIKB 3LH2H 4GO9A 4CGTA 3IJ8A 5IBUB 5E99H 2HLAB 2VXQH 1HKLL 4TX8A 3ORJA 4WFHD 1KN2L 4KRPC 2NY0C 1JN6B 4NO0D 1V3MA 4Z0BL 4DK3A 4Q9CA 4UQBA 4G6KH 5JPNA 1CCZA 3ZM8A 1CBVL 3BMVA 3EYVB 1M7DB 1UENA 4P5KA 3ZKNC 1BQHA 4LSUL 3RWHB 4N8CH 4PJEE 1BTCA 3SY0A 4FMVA 3NOIA 2GHWB 4H0HB 4OCNC 2J4WH 3HI6H 5DFVD 2X7LA 4U1SB 3OR7B 1SYSA 2JCCF 3TA3B 2DWDA 3QEQB 4WHTA 6CGTA 4W8AA 4NQCA 4DAGL 4YDVA 2YUXA 4YXLH 5E4IA 3EO1A 3UO1H 5I75B 2DJ4A 2HRPL 2EEDA 3TESA 1OM0A 1XGPB 2EO9A 3ZDXF 5FV1L 1GZPA 4Z8FL 2BY3A 3PZMA 3F5WA 2OXGA 2UUDH 5FYLE 4Y5VC 4EQ2A 3ZTNL 4YFLF 4GW4A 3LV3B 4K55A 1P4BL 3GHEL 1PD6A 1M4KA 4IJ3B 2BHZA 1Y0LA 4MNQD 5KSAD 5DHYB 5IEHA 5JDSB 4NX0A 4MWFB 2G3JA 4JAWA 5IR1B 3Q1SH 1LNUB 1OY3B 1MW1A 1QLFB 3RL1A 5ACZA 4NC1C 4H26A 4ZNEA 1LEIA 2VDNH 1ROWA 2Y25A 4U1NA 4XPGH 3H53A 3TV3H 5TDNB 5DJ6A 2OS7A 3LHPH 2R69H 2DJUA 3SKMA 1E4KA 4HUWB 1CLXA 4YQXL 1C8XA 4NC0B 4UT9H 1PSKL 1U36A 3F5KA 3WMSA 3B2VL 3UPAA 1D3CA 1G0XA 2VITB 4DUXA 3QIWC 2W38A 3LXAA 5K9QI 2LABA 1YEIH 1I3RB 4LSRL 1XGQA 1NGZB 3WJLC 3OBAA 4GPNA 4WI3A 5CSYA 5LQBL 1NKRA 1NCCL 2QQKL 2VVNA 3V5HA 4JFOB 4M56A 2DYPB 4PJAB 4CN4A 1UJ3B 4J3OC 3B6SB 1WZ1L 5D9PA 4UFKA 1DUZA 1JF1A 3D4YA 2DF3A 1C08A 5ESVB 3KPSB 3ARSA 4JFFB 5IHUL 4RFOH 3WDQA 2CIIB 2XA8L 3MRBB 4TYUA 3GXIA 5DT1L 1TTGA 2AK4D 4L3EE 2DPEA 3BGMA 3DETC 4K3EH 3SE9H 1T89A 5D7SH 2C8NA 1BJ1H 1FL5B 5FOOA 5ADPL 1JCKA 2WV3A 4WUUB 2I5YL 2BNJA 5ITBL 3GKWH 3BAYA 3UXFA 3F5JA 4UQCA 2ESVB 5CS7A 1JE6A 5I75C 4P9HL 5ID1A 2IWGA 5DD3L 1C8YA 5JTWA 2CDGB 1LGVA 1VB9A 4JHOA 1LK3H 2QHAA 3KS0H 4XP9L 4EUPG 1MFCH 5CPSA 3QIBD 2E6PA 4ONHB 3ARBB 1WDQA 4HBCH 4JDTH 4RX4A 1RJZB 3HRZB 3RJQB 5KSBA 5BV7B 5ERWB 5JW4R 3BRGC 3TTSA 2XN9A 4PYGA 1TITA 4HKBB 3WY1A 1RZGA 5AZ2H 1FC2D 1LO4H 4IJ3C 5CFHA 5EU6D 1G9NH 2LV4A 3VFMB 3BKML 3QBTB 4JFVA 4X6FB 4Z2KA 4MA3B 1G1CA 4CBPA 2F74B 3ARRA 5HI3D 1RJLA 6FABL 3EOAB 1Y18A 4PBVC 1EEYB 3VXOA 5KVEL 4JHWL 3QUXD 1RU9H 2DQIL 5CJOH 5I1IH 3KPLA 2FLRT 3MV01 1KXVC 3D69A 3F7QA 3JTTA 4FQ1L 4M5ZL 5D1ZD 3BW9B 3HG1B 1A7BA 1A9EA 1Q8MA 3CFKB 4PYHA 3L4ZA 2D7MA 4NQSB 4TXEA 2GTWB 3S2CA 4CNIA 2HN7B 5HPCA 4L4TE 5JIIA 5CBEB 4WFED 4J4PD 3AUVA 2VLRA 5F9JB 3KWXA 1WBZB 3U7AA 5D8ZA 3HAEH 3VFPB 1XF2B 5HDQH 1E6XM 1IGTA 3W25A 2BNRE 4P4KB 1SBSH 3OKOA 1TZ7A 5LAXA 1O6IA 2X4UA 4J1UB 4LPWA 3VXSB 1INQA 5I3DA 1UJ3C 1B0RA 1NCBH 2XRAL 4AEFA 3HG4A 4PRPA 4XI5D 5A2FA 1GGIL 2DQFB 5HYSA 4Z7UF 2CNCA 4R6UA 4AC1X 3AU1B 1S7UB 3FT2A 3GXTA 4JZNB 4WW2B 2NX5D 5GGVH 3KPPB 3O9WB 3BOVA 4YHOH 3TONA 4GZIA 1NGXA 3OV6A 4QOKE 4FXGB 1BIIB 3P4MA 3V6OA 1KLGB 5C0ND 3ECBB 4OQTH 4KGLA 1MRDL 3O45A 3B83A 2EDJA 2DTSA 4G9FE 3VH8G 1KEGH 2VR5A 4NQEB 5H37G 3X3GL 4AY0A 1TQTA 4H8VA 1YYMH 5CWSA 2OR9L 4OLXH 5L0QB 4OD3H 3GTNA 4D0DA 1FFNA 4GKOA 3UTSD 4WK9A 1T4KA 4EDWL 4D6FA 3QFDB 3L5JA 3ARBC 1DBMH 2ZWZA 3S5LA 2OYKA 5BV7C 5JPNB 1K3IA 3GBLA 3CUPB 5KG9B 1AIFA 4P5KB 4G3YH 4DZBA 2NY3B 1BQHB 4AXNA 3CO4A 1GRWA 3SY0B 3AGVA 1MCNA 1BD2B 5JOPE 1SYSB 4WHTB 4NQCB 4YDVB 4I77H 3QSKB 1BZ7A 5A8OA 4UQAA 5KEZA 1PG7H 1A47A 4YHZH 2DSWA 2QLVB 3FKUS 4CN6A 3O2VH 5I73B 4EI6B 5C7XH 1ES0A 3ZDZE 1OGSA 1GZPB 4HKZA 4P8XA 3F5WB 4OF3A 5A6LA 5BOZG 4RGMB 4H25B 4KKCD 4TUOB 4BFBD 1X6NA 3VXNA 1V6UA 1JD7A 4GW4B 5TH2A 4URIA 1LL4A 2FHBA 4HWBH 3V4VH 2FE0A 1Y0LB 5EPMA 1ZTXH 2AKRA 2D3LA 1R0AL 3GJEA 1JAKA 4P4KC 1G9MH 1OAXH 3RL1B 4HUXA 3K74B 5KAQG 4H26B 5DUBA 5M95B 2CO6B 1LEIB 2QQNL 3IJ7A 4U1NB 5AY7A 3FQWB 3SCNA 3IFPA 1YPZA 1TZIA 4GQ9H 2A3HA 3SKMB 4MXQC 4UFMA 3KJ4C 4MQXC 1P9MC 4O02H 3RAJH 3AFLA 4TOYH 2YJQA 4WSKA 3FN3A 4WW2C 2P48B 4PMUA 1TJHH 1K85A 4TVPE 1G1YA 2BRRH 5CILL 1QFWL 2RCSH 3GSNL 4U31A 1EZVY 4X9FA 1I1AD 3MLUH 1D9KC 5GJTH 5CEZD 3I9GH 4IRZL 5CSBA 3QUML 5JW4N 1J0ZA 4PY7A 1HJWA 2LAGB 4E41D 2R0KH 4U1MA 3V5HB 3TVMA 5L0QC 2R1YA 1R8LA 3QNYA 4Y2DD 1DUZB 1H3VA 1I7RA 1JF1B 1NEUA 2VLJE 4AK1A 3HC4H 1OQOA 4M7KL 4PJAF 1LP9E 4U3XA 4ZFOL 1NAMH 5I1EL 2NY3C 2DM2A 1MREH 3MBEA 3BGMB 5FHBH 3DI3B 4WIQA 4Q22A 2JIEA 2OZ4A 2Y36H 3W0WD 2DM3A 5BS0E 2KDGA 1LO3H 4P8UA 1AXIB 5GISL 5ID1B 3MGTA 3I3BA 4Z18A 5D5ME 4ZFFA 5I73C 2AXFB 2ZKHL 2DLIA 4LHUG 2FLBT 1MSPA 3O3BA 3PTQA 2QKIA 3BPOB 4Y19B 3QGVA 5AWNL 4RGMC 2F54A 4TVCA 2HTLC 1YUHA 4D1JA 3N17A 2NY2D 2WUCL 4URTB 5KSBB 2J77A 2XN9B 5GNZA 1NCAL 1U92B 4M6OL 5HVHB 1Q4NX 1FGVL 1RZGB 5DVOA 1EX0A 4D3CH 3QI9C 4H04A 3QPQD 4KRPD 4H41A 3G6JE 5FM5M 4FZ8H 5CD5C 1Y18B 3JWOL 3BN9C 2LVCA 5B39A 3JUGA 5DA0B 3ZKND 3D69B 5FA4A 5CGMA 1N82A 1OAKH 3LDBC 4ZDHA 3CUJA 5IHRA 3P4LA 2DB8A 2NW3A 1A9EB 5D9MA 2YBTA 4M1RA 5GZNC 1I7UA 3FO2A 4CNIB 2MFNA 4PREA 3B8YA 3KLLA 3MLYH 2VLRB 4Y16B 5HDBE 5IFTA 2JK5A 1Z6JT 2X5PA 3AYRA 2D7OA 3ARXA 4G8EA 5E2VL 2P5WA 1UD4A 3OKOB 2XWEA 5LAXB 4MS8C 1CVSC 3QULA 2DSUA 4WCYL 5KOMC 2GJJA 1INQB 2ZSWA 1B0RB 5IHBA 2DKSA 5EFDA 1F6AA 3OHXB 2Z9TA 4PMRA 2VCAA 1PEWA 4N9OB 4PRPB 1SMDA 4UIKH 3WIHH 5HYSB 4XCFL 4NNYA 3IDGA 4N5UA 2DL2A 3FT2B 4I2XE 4WKFA 5ANMA 3QAZB 3ZR5A 1DSFL 1INDH 4K2UH 4MB3A 4YE4L 4OFYA 2OQJB 5D4YA 2YRZA 3RPIA 3OKDB 3Q5TA 1CZ8L 4L5FL 5E56A 4XTRC 5FYKH 1T89C 3KPQA 2ESCA 1VESA 2R2BB 2UY2A 4XPBL 4WW2F 5FD0A 3O45B 3AS2A 1JZ7A 2WNGA 1JGEA 3DBXA 3THDA 5K9OA 3BWAA 4NZUH 5CWSB 4M93B 4D0DB 4ZPTA 3ZMRA 3BVWA 1YJDH 4X5XA 3CX5K 5EC1A 1RK1A 1A6VL 4JPVL 4E42A 3S5LB 3OZ9H 2C5DC 4OSUL 2OTWB 1AO7E 2A6IA 4OLYH 4TPRH 3SCOA 1AIFB 4M5YH 2X10A 4DZBB 3U2SA 1K9DA 4F8XA 1J8KA 5I1AA 2OTUA 5TD4A 5FGCE 5JHLL 5JO5A 3OL2A 1JI2A 4F9LA 3HPLA 1NKOA 8FABA 4PJ8A 3L6FA 1BZ7B 1OLZA 3LKPA 1CGTA 1ZA6A 2XKSA 1N3NA 2BNRA 2ICWA 1NLDL 2ZX7A 2HWZL 1ES0B 4W5UA 5T3ZH 4GXVH 4HKZB 4L4JA 4EKJA 1MAMH 3A6CL 3TA3D 4Q7NA 3QEQD 5J12B 2J8UA 3CSYA 3T3MF 3RBGA 3CUGA 5TH2B 4U0RB 4MVBC 3SDCC 1ZSDA 1CLVA 3EJSA 4Y16C 2XG5A 1KPUA 4DOHB 3W0KA 1YEEH 2VZVA 1B3VA 5EPMB 2AKRB 4M62L 1QP1A 3SUWA 4CD7A 1Q6FA 4HUXB 3JTSA 3CH8A 1TDQA 3QDME 2FX9H 1F97A 1XCTA 2RR3A 3MR9A 4XMPH 3IFPB 1YPZB 4G9FA 4PLKC 1JDAA 3MV11 3AZSA 2VDMH 1CDIA 3WO4B 3EO0A 5DF0A 5IQ7L 4CMHB 4ZQKB 1NDMA 2I9TA 1GOMA 1H11A 2FIRT 1RUAL 4M9OA 3V6OC 2OW6A 4X0NA 2DLTA 2YXFA 3FB8A 2PR4L 3SO3B 4BKLA 3ZYOA 4PY7B 2OYLA 2R2CA 3M07A 3PABA 3OB8A 3G5ZA 3CMJA 2LU4A 2HTKC 4U1MB 1OWQA 4PTXA 4M93C 1Q9KA 2R1YB 2FCBA 2RIKA 2DIEA 3QNYB 3RY4A 3II1A 1C92A 2P8LA 1KJ2B 1I7RB 4EBQL 1ORQA 4NYLA 5I8EA 3SE8H 4K9EC 4LQ1A 3A23A 4M7JL 2AJXL 2EYRA 1D5BA 2IXUA 4X83A 4FABL 4JCMA 1QLRA 2DICA 3QDAA 2ZUNA 4RMWA 3MBEB 4CDHA 4OGXL 1DP0A 3MRKA 3U7YL 4F58H 2OW7A 1T1YA 1UWGH 2E9MA 3IFNH 1KSRA 4GOSA 2HVJB 3RFZC 4JFFD 3H54A 1W72H 4RQQA 4ZAKA 3MGTB 3HNVH 1KB5H 3KYAA 4ZFFB 3FN0L 4XP1H 4MB5A 5D93B 2C7FA 2IMNA 4H8HA 4QGTA 3O3BB 5F1KC 2QKIB 3VA6A 2F54B 3NAAL 5EH1A 5J12C 3WNPA 1YUHB 3T1FA 1IMHC 4WUUD 3PHAA 5BRZB 4U0RC 3FQRA 2ESVD 5IFHL 4WI8A 2EYSA 1KYOK 3CSPA 1PG7W 3U7VA 3WH8A 3RY6A 3VIJA 1NWUA 1OQXA 2CKBH 5KSBF 3ARBD 3E3QE 2GI7A 3TCLA 4PSPA 3AZTA 3PJSA 4MAVA 2DQXA 4NSKA 1UD3A 3OLIA 1V6YA 2XXMB 1LEGA 1P84K 5FA4B 5D7IF 4Z9KB 4ZDHB 2KQNA 3QWRD 4XAKE 4GAJH 2NW3B 4OCSL 2FX7H 2OP4H 4Q9RH 4BZ1L 4JY5L 3WO4C 5FKPA 5IBLD 1R7AA 4PRIE 1A6PA 3FO2B 1BG4A 4PJXA 4K94H 4PREB 1JXKA 1UWQA 2DN7A 4NUGL 4NO5A 5JIKA 2CHOA 2A74A 2V5YA 4G8EB 2P5WB 1KG0A 3CGTA 3HG1D 3SO3C 2G3NA 3T0ED 5FHAH 4QRRA 1VENA 4Y8DC 1WB0A 2DQJL 1U95B 1I9RL 2ZSWB 1F6AB 5GS3A 2XM2A 2NY4C 2DTML 1BGAA 3AAZA 4NNYB 2J8HA 3IDGB 3MRGA 2R29L 3W5MA 3E8UL 4P4KD 5ANMB 1PW3A 2O26U 3VJ6A 3IAPA 4G80A 4Y4HA 3VXSD 4R90H 1NUDA 5KANI 3OPZH 3DX0A 3RPIB 3MBEC 4JHBA 4J3UA 4XWGL 2X4NA 3ZZ1A 5DJYA 4MXQD 4XWOD 3ZE2F 2OYPA 3G9AB 1TENA 3FFCD 4MQXD 4WHDA 3AXHA 3PQYE 1VGKA 4MZ2A 4NWUL 1C5DA 3LEYH 5GIRA 3DBXB 1A9BA 1H15A 5K9OB 1YZZA 1DBAL 3O9WD 1IAOA 4GXPA 4B7IA 1IGIH 5I8CB 2X4PA 4YHYB 1ORSA 4X5XB 3ETBF 5EC1B 1RK1B 1RUQH 2ZUVA 4E42B 15C8L 4FNTA 3GXMA 2A6IB 4NQED 4MTVA 4MA7H 2CKSA 1LK2A 4CD5A 4P7QA 5I1AB 2OTUB 3GMRA 5IW1A 1SJHB 1E40A 5E8DL 5JO5B 3ZQ9A 1J0JA 1W9DM 3HPLB 4OCLC 4CL7A 3EJJX 4NM8H 4JFYA 8FABB 3BAIA 4OLWH 4PJ8B 3L6FB 3SGDH 1HWWA 4AMKL 4F33A 1ZA6B 2XT1B 1N3NB 4JAMA 2XZCL 1CFQA 2ICWB 3QQ4A 2D23A 1X5AA 2NY3D 5HHPA 1H3GA 1BVLA 2BHUA 1JDCA 4J3XA 3FHQA 3RIKA 1BD2D 4OZHF 2J3SA 5DVLA 4JFZH 4FQIL 4NQCD 2J8UB 4LGSB 4QHNB 4JR9L 1F90L 1JUFA 1L9MA 4J2XA 4GXUM 1B3XA 1FAIH 1ZSDB 2WCAA 1KPUB 5FO8B 4XNQA 3S37L 2EDTA 3MRDA 2XFXA 1HI6A 1TQSA 4ONFL 5SWQA 2HTLD 3JTSB 4IBLT 1XHGA 3MANA 1T7XA 1ZHBA 2Q6WA 1XCTB 3MR9B 3TOPA 1RD6A 3PGFL 2YMXH 3GSOA 1I8IA 4WWID 1XYFA 4HWEL 1U8QA 3NA9H 4M43H 4OFPA 4M00A 4W8LA 5IT2H 2X1WL 5DWUH 3EO0B 5IDIA 3U4BH 5BROA 3RGHA 1YPZF 4GAYA 1J5OL 2APBA 4UV7L 3BN9D 2I9TB 1XD0A 4P7RA 4B15A 1AO7A 1E4LA 3KR3H 3AYSA 4ZOBA 1RVFH 3QT2A 3L7EA 5TQ0H 4DW2L 1BVZA 4KTEL 3FB8B 4BKLB 1EHLL 4XVSL 5GZND 4HDIA 3MLVL 1WNOA 3PABB 3D0VA 2VAJA 3AJ7A 3DOSA 3BJ91 3QZWA 2P8LB 3P30L 4YHYC 5DC9B 1FIEA 1ORQB 4NYLB 2WWDA 2ZNXA 3P11L 3EDFA 1FJ1B 4IUGA 5DYOA 2EYRB 1D5BB 4MS8D 2VTFA 3KXFE 4A6YH 2MCPL 3I50L 1IFHL 1XGUB 1A64A 2DIJA 4OZIA 3MRKB 1BM3L 1JNHA 3G5YA 1T1YB 3QDJA 4AIZB 5I1CH 3BZDA 4F9DA 3WL9A 2W92A 4ZAKB 2EE9A 2V5CA 3EYQD 1U8NA 1XH1A 4V27A 2XN1A 3VFWA 4GRMB 3DO7B 5D9NA 2OSWA 4LSTL 2J79A 5J7CC 4QHLA 4JIEA 3H9HA 4XTRD 4X6CE 2JB5L 1RFDL 1BX2B 2C0HA 3EHBD 2NTFA 5F1NA 1AD0A 3T1FB 4NZDA 2X0YA 1A0QL 3QNXB 3FQRB 3FB7A 1RIHH 4ZYKA 3C08H 1MQ8A 4Q0XL 2V17H 2O5XH 1V5JA 5FUCE 5CJ8A 1L0YA 1KCKA 4KMQA 1RUKL 5I8OH 2EE6A 3TCLB 1XGYL 4RX4D 1Z9SA 3PJSB 1CIDA 2VR4A 4XP4L 5EZOL 2XN9D 1FVCA 4GKSA 3FO0L 5JBEA 3EOTL 3CHDA 1T7VA 4TULL 1LEGB 3QQ9C 1DJSA 3AMCA 1S9VB 1IE5A 3ALGA 4P5TA 2FEDC 4P2QE 3FT3B 4UT6L 3MFGB 3J8F7 1L0QA 2J8GA 5IVZA 5CP3H 3N1FC 1M1SA 5IB3B 4PJXB 5CCKH 1N59B 5CJQH 1IC4L 4IOFC 4NO5B 3W9DA 2ICCA 2DIBA 4PLOB 5TF0A 4FK9A 2XG4A 2A74B 4M8QA 3JVGA 1CDBA 3CHCA 4QRRB 1KFWA 3LY6A 4MAYB 1NP0A 2EDEA 2GCYA 1PBYA 2YXMA 4MVBD 1HCFX 2J7CA 2VLRD 4F9PA 3CZJA 3L3KA 3H2WA 3VXUE 5H94B 2J7LA 3CK0H 3AAZB 1WWAX 3R8BB 3MRGB 3QUMA 3WXVL 3VJ6B 2H26A 1UZ1A 2A1WH 4G80B 4Y4HB 4JQVA 3NIGE 3V52L 3UEQA 1E4JA 3K8KA 2F5BH 4PRPD 2AXJA 1L6XA 2X4NB 3HB3C 5DJYB 2VDQH 2OSYA 4JY4A 1BIHA 3W2DH 1VGKB 4QKXB 3CC5A 1A4JA 1OWWA 1G6RL 5GIRB 4O5LH 4ZAKC 4W87A 1A9BB 4PD4K 5IHLB 1NUNB 3NH7L 2BVEA 4ZFOA 2WWKO 4N0YL 1IAOB 1SEQL 1UACH 2DH3A 4M8VA 4YO0A 2ZG2A 2X4PB 4LIQH 4BFIA 5GRWA 1ORSB 5KZCD 2OK0H 1FA2A 3VGAB 3MUIA 2VDLL 2CRZA 4UOJA 4E0RB 3EJRA 3MSDA 3F7RA 1WBYB 4WTXA 2EXOA 4K23L 1LK2B 1AY1L 1I9IL 1QR4A 4PRIA 4U0QB 4ZTPH 3WDIA 1ODUA 3GMRB 5IW1B 4QTHB 1DQQA 5IXEA 1WF5A 3O2DL 4AJ0A 1NCDL 4F7CA 4JFYB 3BVXA 3LH2L 1WKYA 2GFTA 1BVKA 5EUKB 5E99L 4BZYA 3TGXA 4F33B 3CZ8A 4RFNB 5GRVK 2VXQL 4JAMB 1CFQB 1BHGA 1DLFH 3QQ4B 7A3HA 2PW1A 4NRYA 5HHPB 1GCYA 3PZOA 1BVLB 3RWGA 1D5ZA 2YL8A 1HHGA 3LQAC 4G6KL 2J75A 2CMRH 3H0TA 3MNVA 1J1OH 5HYIA 4N8CL 1JUFB 4NZCA 4D6EA 4UCFA 2J4WL 2W66A 3HI6L 4LAQH 3V6FA 5B4MC 4BQ3A 4Z6AT 5IM7A 4XNQB 2CRIA 1UYWH 2AJVH 3MRDB 3O6FA 4UTFA 1HI6B 2J8UF 2H41A 4P49A 3VINA 4XZUA 5SWQB 4WF7A 3WY2A 2IUZA 4LXFA 4MAYC 4JPWL 5EORH 2Q6WB 3WFDH 1CFBA 3WN5A 2XUCA 5HGAB 3BUIA 4DQOH 1Q6CA 3GSOB 3H3PH 1I8IB 4PJ7E 1CXEA 1U8QB 3ULVC 3LD8C 4PJFE 4ZPVA 3G9VA 2NTSP 3WIFA 2FHCA 1A4KA 2ARJQ 3GH5A 4Y2OA 1K4CB 4GAYB 4JKWA 1B4RA 5HGBA 1OP9A 4JO2H 1HN1A 3KPRA 4PB0H 4HG4K 1LQSR 3HNSH 1CICA 1AQHA 3CMGA 4NBZB 3L7EB 3FQUB 2YC1A 1FP8A 5FGCB 2VDNL 2AABL 3TV3L 5J6HA 1L4IA 5MP6H 3FTGA 3VI3E 1OOAA 4PFEA 3NFPA 3GZKA 3ARGB 3OAZK 4ODWA 3KPMA 3QZWB 1TTFA 4GRLC 1NFKA 4U1IB 1UXSA 4UT9L 4X5LA 5GS2H 1FLTX 2XSBA 1JNJA 4LASH 1JGVH 3VGAC 4RIRB 4JHAH 5DYOB 4S1SL 3T09A 1NM9A 3WKZA 3TPUA 1LQ0A 1DVFA 3TVMD 1YEIL 5DRNA 2N56A 3NPZB 5SWSE 4OZIB 5J1TC 4CU6A 4C83B 1JNHB 3G5YB 1AD9A 3QDJB 1FLRH 4HS8L 1ETZA 5FYJL 4RGNE 3WL9B 1T7YA 4RFNC 1GJUA 1V02E 5FYLD 5EUOE 3AMLA 5HHVH 5EOCJ 3VFWB 4D9RE 5DSCB 2GIYA 3PV6A 4P3DA 3WY4A 3L3IB 5E6IA 2E9JA 3AROA 3MBED 2BVYA 3GYCA 4QHLB 2G4FA 1HHJB 3RIAF 4GO6B 5F1NB 2NTFB 2QLYA 1AD0B 3OMZA 4TRPH 3FB7B 2P5EA 3RY5A 1ZT1B 4EZMA 1LL6A 1CFTA 2XYCA 2W60B 4V1DE 1NSNH 3FCTB 4L1DA 4X5WA 3MS8A 4FQQB 2YL6A 4MXWH 3GKWL 5CUSH 2F54D 3PZIA 4I8DA 5LA0A 3F7YA 1ITCA 2J2ZA 1FVCB 2DRUA 4GKSB 4KDVA 1MFCL 1H0IA 2C3VA 5IFAH 2W07A 1W9UA 4HBCL 4JDTL 1QBAA 2X9YA 4P5TB 1E43A 2ARJA 4HT1L 4OLUH 4Z2LA 1QO3A 1ZLWK 1A7QH 5IVZB 4OB5L 1RK0A 5AZ2L 1LO4L 2ITCA 2WPGA 1DDHA 3D3VA 3MLSH 1U8LA 3ZYJA 3OGCA 1ZOXA 3CTTA 3W9DB 4XH2B 3KXFA 4MPKA 4G6MH 4D9LH 2FH6A 4M8QB 1AKJA 1RU9L 5CJOL 4PJXF 5I1IL 5M17A 5I16A 2YKKA 2AEQH 5A2IH 3HFMH 4RMUA 4EIZC 4R0LA 3LPWA 1KCVH 2BVOB 3ARGC 2GCYB 4D9QE 3MJ9H 4ML4A 5CJXA 5IV2B 2JIWA 3VMOA 3S35X 3LKRB 3IJ9A 3LRKA 4ESKA 2P5WD 4HUMB 4E4PA 2RAMA 2H26B 4X6CA 1NWSA 4PTUB 3UTOA 3EOBA 5C9KA 5HDQL 1UR4A 1SBSL 3ULVF 4JY4B 3NYDA 4PTMA 2XNAA 5DLMH 1JF5A 5KBNC 1UWRA 3ZTJG 2PBOA 3CC5B 1A4JB 1NCBL 2QV2A 2E7LA 5IQ9A 3B9KC 3BEWA 1ADQA 4PLJC 5DEGA 5CP7B 1ZVHA 4LRIA 3L4VA 4MB1A 2ZCHH 1RZKH 4OFYD 3NSMA 5E94A 4WENB 4YO0B 2PW2A 4BFIB 3QO1A 3ALPA 5JIHA 3GNOA 4R7DA 2NZ9D 4YHOL 1UB6A 3MUY1 2EIBA 4O58H 1QFUH 1O0VA 5MEQA 4B5EA 3ISWA 1WZLA 7FABL 4OQTL 4OD1H 4PMXA 2VO5A 2QPUA 2SEBB 2WQ8A 1VSCA 1MCWW 1DQQB 5K59F 2V2TA 1SR0A 1WDRA 5FDYA 1KEGL 3CZFB 2MANA 3SDXB 4F7CB 1YYML 5IHSA 4OLXL 4OD3L 1BVKB 4NQDE 2AI0H 3WQ8A 5E9DB 3BQUA 1CFNA 3DARA 2CDEA 3WD4A 4Z7NE 1TQBB 1FVDB 2ATPA 2H2PC 1WZMA 4NRYB 1U33A 3KLAA 4M7LH 5FF6A 4HA1A 4ZEPA 3RWGB 4A3YA 1D5ZB 1JBJA 1HHGB 3OAZH 3NFSL 1N6QH 3U4AA 2XTJC 4M61A 3TTYA 2DQTH 4LP5A 4K3JH 4PJ8D 5L8LB 3KNBA 2WMGA 3GFUA 2ZUUA 1V7NL 1E4NA 1JPSH 2BNRD 3EJZD 4K7PX 3V6FB 3LQAL 5IFJA 4OJYA 2PUQT 2V9QA 4I77L 3O6FB 1MJ8H 3UYRH 3JVGC 1PG7L 4U1GB 4XZUB 4YHZL 3ZJKA 2NY5C 3O2VL 5C7XL 1DN2A 1CXLA 3WN5B 4X6DE 4Y4FA 4KUCD 1MFNA 3BSGA 5GGSA 1DE4A 1ZJAA 3V8CA 4ZPVB 4HWBL 3WIFB 4J23A 1S7TA 4FTVE 3UROR 4R96B 5KVMC 4F9JA 3R1GH 1ZL1A 2N7AA 2CJUH 2H6PA 1KXTA 1ZTXL 2BOBB 4G9FD 3KPRB 3QQ9D 1CICB 3JWDH 1I8MA 1CGXA 1OCQA 2Q8BH 1CTOA 2FEDD 4WY7H 3X14A 4GQ9L 1HJUA 5J6HB 2WC4A 5CZVH 3FTGB 5DVMA 3NFPB 5ISZE 5D1QC 3ES6A 3RAJL 5CPTA 4ODWB 3KPMB 2K9UA 3ZSTA 4ERSH 1MQPA 2CGRH 3HU7A 1UXSB 3CHEA 1GGYA 2B1HH 1F8TH 1BYCA 2JELH 1MWAH 2I27N 1RZFL 3VRJB 1NL0H 2FJHA 2RCSL 3TPUB 2YFNA 3R06A 1DVFB 1HNFA 1ZLWH 4CVUA 3UC0H 2M2DA 2UVEA 3MLUL 4UFLA 4MCYA 2CERA 3WD0A 4R2GD 3EJUA 5GJTL 3I9GL 2PF0A 3TH2T 1NOFA 5HI5C 4G7YH 1AD9B 3VFNA 2VDKH 2R0KL 3VCLB 5D70L 3GUTA 3AHTA 1ETZB 5DD5H 1UEYA 4OZIF 1TQBC 3PV6B 1EXUB 1EUUA 4P3DB 2VI0A 5KJRL 5E6IB 3HC4L 3EJQA 1J1PH 3HB3D 1U93B 3IU4H 1MPAH 3PWJA 4MNHB 4W7VA 5DK2A 4P23A 4BA0A 4L4PA 4E2OA 3KPOA 4KAQL 2MHAA 1NAML 4XVUC 3DVGA 3QUYA 4OLEA 3O3AA 1RZJC 4ZAKD 2P5EB 4RGOH 4HC1H 5M3WA 5HYJA 1CFTB 5L7XH 3U0WH 5FUZH 5FHBL 2Y6SC 4HS3B 4X5WB 2WMKA 5I1JH 3O6FC 2NXZB 1LO3L 1RIUH 3BP7B 4HFWA 3IF1A 4M1CC 3F7YB 4GMSL 2QJDA 2X0HA 4W6WB 3WN5C 2XA3A 1UCTA 3MO4A 2C3VB 2CLRA 1FORH 1IC1A 2BVTA 4IIQA 1FO0A 4PJGB 3BAEH 4TVPD 2D7NA 2ARJB 2QSVA 4J3TA 4XC1H 5IVXE 1D5IH 2ITCB 1DDHB 3LAFA 3D3VB 2R39A 1P4LB 4PV9B 1HT6A 1U8LB 3OGCB 4N0CD 4MJ6A 1CICC 1SJEA 4UINH 4W8BA 3KXFB 3CXHJ 4I3SH 4FZ8L 2O5YH 1TTUA 3CDFA 4O9HL 3SQOH 2D1ZA 5SWSA 1AKJB 3GBDA 4P7LA 5GS0C 3S98A 5I16B 2LTQB 1S9KC 4X99B 4R0LB 1OAKL 1CBGA 3GJFA 4GKNB 2EXYC 4KV5E 4Y1AA 2WWKT 5B4MD 5SX4H 1JRHI 3A4XA 2BS9A 4LL9A 1I1FA 1VEPA 3HUJE 2XOTA 3MLYL 2X09A 4QRRD 3THMH 4KGJA 2CITA 3QCUL 1DVFC 1UD6A 2YLAA 4LLUB 4U7MA 3WKMH 4GW5B 3EOBB 3GSVB 3H9SE 1TMQA 3VFSA 2CLZA 1ZWIB 1IEAA 2Y06H 3ZO9A 1OAUH 5DHVA 5IQ9B 3BEWB 5DEGB 5HYQA 1MCKA 4NP4H 4UIKL 4Y4HD 3WIHL 5CAYB 3WDRA 5EB9A 5C6WH 1OPGH 2PW2B 4HU8A 1T1ZA 4UR9A 2EYTA 4PJ5A 4KKAD 4P2CG 1S78D 3CZSA 4OZGA 1INDL 1OW0A 4K2UL 4R7DB 2VC2H 1UB6B 1P7KA 4YDIH 5MEQB 1CGSH 3PG2A 5K93A 5FYKL 3IFLH 3BH4A 5EO9A 4GSDH 3CDGA 1ZT7B 5F9WB 4JO1H 2AV7A 4NZUL 4ATLA 1BF8A 1V3HA 5EULV 4XVJH 1TVHA 2XICA 3PZVA 3BQUB 2CDEB 1DL7H 4QNPE 3VIKA 3WMCA 1YJDL 3PIQA 4YHNA 3MRMB 2XHYA 3KLAB 2G5RA 3RILA 4RDQG 5TQ2L 3BVNA 3OZ9L 2CLVA 3SDXF 3ILQC 4JFSA 2FJFA 1KIRA 2Q86B 3PWPA 3FO1A 4UI2A 1A22B 4NBXB 4J6RL 1LDSA 2F18A 1RMFH 2WVVA 3WDHA 5FGRA 4JN2A 3IDXL 1SQ2N 1IKNA 5F3BA 4TVDA 3BUBA 1FNEA 2A73A 3WELA 2HT2C 1QFWM 3GSXA 2V2WA 4X8JA 4FLRA 1JPGA 5DK0B 2OL3H 3N11A 4GXVL 4Y4FB 5J0BA 2EQDA 1JL8A 4GKLA 3WBAA 4N0RA 2WK2A 1UKSA 2FD6H 3WCYA 4WNQA 5GGSB 1DE4B 1XR8B 5CJBA 2PYEA 2F7OA 1BYAA 1HL9A 3MLZH 1S7TB 1V03A 5GNYA 1YEEL 5L88L 3KLKA 3LOWA 5AUMA 4KUZH 1R3IH 1KXTB 2ICWJ 4FQLL 2BFGA 5DD1L 1BQHG 5C2BH 3U4EB 1I8MB 1QX1A 2AV1A 5T5FL 1JD9A 2ILLA 2VABA 4LCYA 2FX9L 4JFPA 5E2TH 2H32H 5JOFA 4XMPL 3WH9A 2E7LC 3G6LA 1EH9A 4TUKH 3EMCA 1UH2A 3NABL 3ES6B 4HGMA 1FAKT 2VDML 4Y4KA 1AO7D 2OJEA 4NZRH 3V5KB 3IT8D 2K7QA 4XV0A 4KRTA 2TAAA 1AQMA 2FJHB 4GQQA 2IFGA 3PTMA 5DURB 5E9AA 2EABA 5DMIH 3HPJA 5D7JA 3VFNB 3QR3A 2FECI 3TBTB 3BQUC 3BAKA 3OJVC 1NFIA 1C8PA 5A3IC 4KJQC 1ZU8A 4PPTA 3UAJC 4TQEH 3PWJB 3O2DA 5DK2B 3TO4A 4BQ5A 4P23B 3QDJD 1ISXA 3KPOB 4JQIH 2MHAB 4JM4L 1MLBA 5JBDA 1E6OL 1VFBA 1G7LA 3O3AB 3QUYB 4QRSA 4PLJD 4FNLL 2EDYA 5HYJB 5HOSA 5ESAA 2MPAH 4F58L 3LRLA 4NXKA 1UWGL 1WDPA 3MLWL 3U36A 1G9EA 1W72L 3DX9B 1FYHB 3WF3A 1NMAH 1RURL 3LS4H 3CCHB 1RZJL 3T08A 3IU3A 1MJUL 2A9NL 4HFWB 5F7LB 4XP1L 4WKAA 4C55A 4TVUA 4Y4FC 3UBXB 4ZUWA 2CLRB 1NPUA 1CF8H 3MRLA 4IIQB 1FO0B 5ISZA 1JHLH 3W81A 1UCBH 2OMNA 1JXJA 1QFPA 3SKJH 2Y2WA 4HUVA 1YA5A 1N6VA 3VI4F 3VWKC 3D5HA 3QHNA 2J6EA 4MJ6B 4PJGF 1KBGL 2CKBL 1SJEB 3QEGH 4NT6A 3ZE0F 3BUPA 1T6VN 3FMGH 4P5TD 1MCSA 1JRHH 1Q72L 2UY5A 1KELL 4XPAH 4KK5D 4R7NA 3GJFB 4HKXA 1US3A 3LPGA 4Y1AB 1UZ8A 5DRZA 4GAJL 2IQ9H 3M45A 2OP4L 5AC5A 4Q9RL 1NCTA 4Z7VE 1QNSA 4UV4H 1I1FB 2MNUA 4XX1G 3S4SA 2YFOA 4K94L 4ZG1A 5EDXA 1JTOA 1TUXA 3VA2C 5DJDA 1E5JA 3NACH 4GXUN 4LLQA 3SO5A 3UDWA 4RBPK 1Q1JL 3BO8A 5FHAL 3T65A 3VFSB 2CLZB 2OR7A 1IEAB 4DTGL 5DHVB 1ZK9A 3HMXA 4W70A 1QOXA 4QHMA 5HYQB 1W2PA 1UHVA 3VFUA 5F1IA 1V3IA 3THCA 1J8HA 2EYTB 4PJ5B 4K8RC 4P23C 4OZGB 2W61A 3F8UB 4R90L 4EOWH 2WIMA 3OPZL 3QUYC 1I8LA 1VGEL 4P48A 1EO8H 4KFZC 5EO9B 5IVXA 1BBDH 3CDGB 3EOYG 1UOKA 3LEYL 4M6MH 2VE6A 3SJVE 1TVHB 4YDKL 1IGIL 2QEJA 1HSBA 3PIQB 4YHNB 4B53A 1RUQL 4L8DA 3KLHC