3PBMA

The crystal structure of adenosine deaminase in complex with chloropurine from pseudomonas aeruginosa
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
313
structure length
313
Chain Sequence
YEWLNALPKAELHLHLEGTLEPELLFALAERNRIALPWNDVETLRKAYAFNNLQEFLDLYYAGADVLRTEQDFYDLTWAYLQKCKAQNVVHVEPFFDPQTHTDRGIPFEVVLAGIRAALRDGEKLLGIRHGLILSFLRHLSEEQAQKTLDQALPFRDAFIAVGLDSSEVGHPPSKFQRVFDRARSEGFLTVAHAGEEGPPEYIWEALDLLKVERIDHGVRAFEDERLMRRLIDEQIPLTVCPLSNTKLCVFDDMSQHTILDMLERGVKVTVNSDDPAYFGGYVTENFHALQQSLGMTEEQARRLAQNSLDARL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenosine deaminase
publication title The crystal structure of adenosine deaminase in complex with chloropurine from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 121
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.5.4.2: Adenine deaminase.
pdb deposition date 2010-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3pbmA00
3PNUA 1YBQB 2BGNE 3K5XA 1A4LA 1YRRA 2YZ5A 2RAGA 1QXLA 3GG7A 1FWBC 4IFRA 1EYWA 1POKA 1EJWC 3S2LA 1KRAC 2YB1A 3T81A 2R1MA 1FKXA 3FDKA 2R1LA 1FWJC 1M65A 4MUPA 2GZXA 4IFOA 2EG8A 5CH9A 4HK6A 4QROA 4C5YA 3GTHA 2A3LA 2R1NA 3AU6A 2PLMA 4KERA 3S2NA 1EJSC 1YMYA 4C6DA 4WGXA 2VC7A 2FTYA 2DVXA 1P6CA 3LSCA 4RZBA 3FEQA 1FWFC 3MVTA 3K2GA 4LEFA 3SFWA 3PAOA 2HQAA 3IV8A 4AC7C 1FWDC 3QY7A 4IFKA 4BKNA 3DUGA 4RE0A 2WJEA 3MDWA 1UIPA 4DLFA 2OQLA 3QY6A 4B92A 1EJXC 1FWIC 1QW7A 3WYZA 2R1KA 3IRSA 4EPDC 1J79A 3DC8A 1HZYA 3TN4A 1J5SA 2OOFA 3RYSA 1EJTC 3GU1A 1NDYA 4CQBA 4NG3A 3RN6A 1K1DA 4QS6A 2YXOA 3MKVA 2Z25A 4GC3A 4PE8A 3TN3A 4CNTA 2R1PA 4C6NA 2Z4GA 4H9YA 4IG2A 4HJWA 1UBPC 3URBA 2Z7GA 4EPBC 4PCNA 1FWEC 3ICJA 2QPXA 4C6KA 2Z27A 1EJUC 2QVNA 1EZ2A 1V4YA 2QS8A 4C5ZA 2E1WA 4GZ7A 4EPKA 4CQCA 1E9ZB 2ZC1A 4C65A 1EJRC 4HK7A 4G7EA 2OGJA 4XD4A 4E3TA 3ORWA 3BE7A 4I6KA 4DNMA 4KEZA 5HMFA 1GKQA 4LCRA 3S2JA 1YIXA 2P53A 2Z24A 1KCXA 4L6DA 3LGDA 4DLMA 3G77A 3HPAA 2ADAA 1PTAA 4NI8A 3O0FA 3E38A 4V1YA 2KAUC 1RK5A 2D2JA 3ITCA 4H9VA 4EP8C 3S2MA 2O4MA 4PBEA 4DI8A 4QRNA 3URAA 4ERGA 4XAYA 4R7WA 3D6NA 3PNZA 4IGMA 1ZZMA 2Z26A 3EGJA 3OODA 1I0BA 3F4CA 1YNYA 3MVIA 1NDVA 1KRBC 1PSCA 1I0DA 4CNSA 2FTWA 4LALA 4ERAA 1W1IE 1EJVC 4UBPC 4Z42C 3GTIA 2IMRA 4BJHA 4J35A 1KRCC 1V77A 1EF2A 4GK8A 2Z29A 1S3TC 4R88A 3FDGA 4GY0A 2ICSA 2O4QA 3MDUA 1ITUA 1IE7C 3MSRA 4GX8A 4C60A 3URNA 4C6JA 1J6PA 4LCSA 3UR2A 3NEHA 4RDZA 3UBPC 1E9YB 4LAMA 2VC5A 2GWNA 3IARA 4XD6A 4C6IA 4IG2B 4TQTA 4DO7A 2OODA 3DCPA 4NP7A 4DZHA 3CAKA 4AQLA 1XRTA 3GTFA 3UPMA 2F6KA 3QY8A 3RHGA 1XGEA 4PBFA 4PCPA 3V7PA 3F2BA 4QSFA 4H9TA 2XIOA 4C6QA 1ADDA 1V7AA 2HPMA 1A5MC 4XD3A 4DZIA 1RJQA 1ONWA 1A5NC 4F0SA 4INFA 2BB0A 4G7EB 4I6VA 2HPIA 3ISIX 4C6MA 3F4DA 4H9UA 4IQJA 2PAJA 4XAGA 4KQNA 4YIWA 2UBPC 4WVXA 3F2DA 4KEVA 4F0LA 3UR5A 4GX9A 3A3XA 4QS5A 4KF1A 2PGRA 1V79A 4RDYA 2Q09A 4C6CA 2Z28A 4OFCA 4GYFA 4EPEC 3OU8A 3TN6A 1ITQA 1XRFA 2VR2A 1BF6A 1FWGC 3LNPA 4C6FA 2HBVA 3IGHX 4IGNA 4J5NA 4CEUC 1A5KC 3WMLA 1A4MA 2GSEA 3NQBA 1J6OA 2HNHA 4LAOA 3LS9A 4CQDA 2HBXA 2PGFA 4HK5A 3IPWA 3E0FA 4ICMA 1O5RA 3K4WA 1RAKA 4LAKA 3EWDA 1NFGA 3NURA 4RDWA 4CEXC 2YB4A 1UIOA 1FWHC 4KIRA 1V51A 3E3HA 1A5LC 3AU2A 3ID7A 1XWYA 2Y1HA 2WJDA 4DYKA 4B91A 2DVUA 4H9MA 2Z2AA 5A6TC 1FWCC 3GUWA 1GKPA 4C6OA 3E74A 4BY3A 4IFKB 1DPMA 2FVMA 2GWGA 4B3ZA 3GIPA 3B0YA 4C6LA 2E25A 4C6EA 3PANA 4KEUA 1R9YA 3LGGA 3HM7A 2VM8A 3LU2A 3GU2A 4G2DA 3GTXA 4LH8A 3OVGA 4F0RA 3EWCA 2VUNA 4QTGA 1YBQA 3A4JA 4CNUA 3GIQA 5HMEA 2UZ9A 2FVKA 4LANA 2CZVA 2D2GA 3IACA 4GOAA 3E0LA 4H9XA 3B40A 4IF2A 3CS2A 3IJ6A 3JZEA 2G3FA 2Q01A 2D2HA 3QGKC 2AMXA 3LY0A 1R9ZA 2AQVA 3TN5A 4B90A 3RCMA 4KESA 3WZ0E 1KRMA 3HTWA 2P50A 3S4TA 2WM1A 3MPGA 2AQOA 2DVTA 4DI9A 3QGAC 4D8LA 1JGMA 1NDZA 3CJPA 2WJFA 3F2CA 1NDWA 4XAZA 4GY1A 3MJMA 1M7JA 4UB9A 4L9XA 4XD5A 2EG6A 4HA0A 4J2MA 3OJGA 4XAFA 3TNBA 1RA0A 1RJPA 1PB0A 3UF9A 2I9UA 3KM8A 4LFYA 4ZSUA 3OQEA 4KETA 3T8LA 4RDVA 2Z00A 4ZSTA 5AKQA 3E2VA 3LSBA 3O7UA 3B0XA 4R85A 5HMDA 1RJRA 2FFIA 3MTWA 2W9MA 1R9XA 1K70A 3T1GA 2VHLA 2OB3A 1RK6A 4GBDA 3SO7A 3GRIA 1GKRA 2ANUA 3LA4A 4P5UA 1UMLA 3OOQA 5FSEC 1PO9A 4JOMA 4H01A 4GY7A 4LCQA 3A3WA 1M68A 1WXZA 5G4HC 4C6BA 1P1MA 5E5CA 4H9ZA 5LXXA 1WXYA 4DIAA 4V1XA 2I5GA 2Z2BA 4WHBA 2PUZA 2QT3A 4GXWA 3R0DA 1ONXA 1RA5A 3AUOA 3PBMA 1O12A 1FWAC 3URQA 3GU9A 4M51A 4C6PA 1FKWA 1VFLA 3N2CA 2EG7A 3C86A 2GOKA 4ERIA 1P6BA 1K6WA 1A5OC 1POJA 4H00A 5FSDC 4IH3A
chains in the Genus database with same CATH superfamily
3XISA 1TWSA 1U33A 1UP0A 3DFHA 3LUTA 1TJRA 1DJYA 3KFTA 3WCZA 4YYFA 3QYSA 2YB1A 3MJYA 1FKXA 1FWJC 1XSKA 4O54A 3EOLA 3VKJA 2BHYA 4RKAA 1JXKA 1A49A 2QAPA 3VDAA 4AYSA 2INZA 3C52A 4AEEA 1W3HA 3UD6A 4MJ2A 2D0HA 1M7PA 3GNNA 4LB3A 4NF7A 1HJQA 1R0MA 2E4TA 2Y5JA 3DUGA 4KFNA 4UUIA 3GNRA 4GWEA 1FWIC 4DJDC 4GQGA 1O68A 3LBMA 4E8GA 1CT5A 1LORA 2GQ8A 3P2VA 4TVDA 1DE5A 1TO3A 7ODCA 2X30A 3MKVA 4GXMA 1XIDA 4PE8A 1VF8A 4RNHA 1W1YA 4GNVA 4IJRA 1NIUA 2OPJA 2DZUA 5CG7A 3HG3A 1EJUC 4CCEA 3BGGA 1LWJA 2LLEA 1EYEA 3HBLA 3AS1A 2RDXA 3KEHA 1KV8A 3I7SA 3DOPA 4LVBA 2JKAA 1H7RA 5KEZA 1TCMA 2E3ZA 3INPA 3TOYA 3SCPA 2Z0IA 1TPDA 4O12A 5FF3A 3TAOA 3EWYA 3QQ1A 2J9ZA 4MJZA 1RHCA 4GVGA 4MPKA 3GVRA 2O4MA 3TW7A 1IWBA 3DERA 4O1EA 2D0FA 4EWND 4QITA 1A0CA 1EZWA 3DHFA 4B5NA 4MWAD 5FF2A 2QUNA 2PGEA 3W22A 2VEMA 3PVFA 2NQJA 2VEGA 3VX0A 1BSLA 2FTWA 3LTSA 2C8NA 2CWNA 3WQEA 3EKZA 1SYTA 4J35A 4KS0A 3ALGA 4NZ3A 3MC5A 3W7GA 2CKRA 3GYCA 1ZBKA 3SIZA 3FN9A 4DWDA 3MY9A 1C90A 3FX4A 3S5SA 2CW6A 2O4QA 3KW3A 5A6SA 3P6LA 2DUZA 2DZWA 3MI3A 3GKFA 2Z6JA 5SWUA 1T41A 4U3CA 2C3ZA 1W3TA 2Y70A 2ZRWA 3UGVA 4UFJA 2PU1A 1EWDA 1LRQA 4FF7A 1JNEA 2F6KA 2A3AA 2OSXA 1H7OA 3J7HA 3V5OA 5BOFA 4YCOA 5FESA 2NX9A 4O8AA 1VCGA 2QCHA 1KXVA 5AHEA 5CLTA 2J77A 1RSCA 3W7NA 3CHEA 1QBAA 4LSBA 1SZGA 5AVHA 2PPGA 2DZBA 4KRTA 2O9RA 2WAGA 3VOGA 2WWCA 1HKKA 1A5SA 7TAAA 2DH3A 3HJEA 4AAJA 3Q2DA 1V0NA 4C6CA 2VR2A 2CZ5A 1Q4NX 5G4WA 4IGNA 2DQWA 2X0YA 3A64A 3PP7A 1B90A 2GUBA 1XKYA 1VHNA 2HNHA 3L5MA 4MDPA 4N9EA 4OHQA 2JEQA 3W6LA 4QIUA 4GHRA 2WC4A 3STEA 1OX4A 1W6TA 1R7AA 5AC4A 1I1XA 2BXVA 4KIRA 3HQPA 2DP3A 4FAMA 1BKSA 1XI3A 1SR0A 4XUYA 1J10A 2VFDA 3KOWA 3GUWA 1B3VA 1D7KA 1W9VA 1QNRA 1TPEA 1XQLA 3IJQA 4C6LA 1BTCA 4JFUA 3WQVA 3DG6A 3GXDA 2J7EA 4LH8A 3W7LA 3T0DA 2X0SA 4MYXA 4QGCA 4GVFA 2GSHA 3AISA 5FEZA 1YXYA 1MNSA 3I3EA 5FJRA 4IMEA 2VEFA 3VU2A 3IVSA 3W2MA 1B3WA 2WPBA 3ZVIA 1DBTA 3PPGA 3TW6A 1XLHA 3KBWA 3PZGA 1XDMA 5AYXA 1R9ZA 1B57A 2BNJA 2IPFA 2OTDA 4O1CA 3O05A 5CPMA 1YTKA 3RILA 3WJZA 1S2AA 2WZHA 4PTDA 3T4CA 4JTTA 4KMQA 5G1MA 4PH6A 1RA0A 2NZLA 1PB0A 1QJWA 4K6AA 3UF9A 3E2QA 1E40A 1CLVA 4KETA 3C2YA 2QJHA 4FR6A 4NNAA 3MTWA 3HFYA 3G8EA 3HGRA 3MQTA 1KFLA 3LHZA 1UP3A 2FMNA 3DESA 2XGBA 1F4AA 1F05A 4NYUA 4HPGA 3WJWA 1W5OA 3KL0A 4L5ZA 2RFGA 4DZAA 4JKKA 2VFGA 4LCQA 2GJNA 3AHTA 2E40A 1U1JA 1TWDA 2ZA1A 1FWRA 1VLIA 4XZWA 3LCIA 1JR1A 3COTA 1WZKA 1V0KA 3EMCA 1E4NA 1I8JA 5JH1A 3ZFHA 1WDQA 5C54A 2XHYA 2VURA 2GLKA 3C86A 1WBHA 4ERIA 1P6BA 2XSXA 4Q6XA 2OQYA 1AW2A 3EDDA 1A4LA 1YRRA 3UJEA 4JTEA 1ZJAA 3PZ9A 2DZSA 4OWGA 3NO5A 4LEQA 2Y5SA 2F6UA 4X63A 3M07A 2WLYA 3ABXA 5CBJA 4JX6A 1D8CA 1DJIA 4X61A 1US3A 3AU6A 1XC6A 4NRRA 1ZPTA 2VC7A 3WLJA 3MMUA 5BROA 1U22A 3OVQA 3PSVA 3O9NA 3A4WA 1HXJA 1W3LA 1UPPA 1W91A 3B06A 3SFWA 2R9RA 3D47A 4TVCA 4YNGA 1PIFA 4AISA 4N02A 2O7SA 4KWSA 2CFFA 1Q6CA 2OLAA 4F0HA 3E2SA 1GJPA 5EMMA 1XG3A 3V4BA 5F2LA 2R1KA 4CNOA 1LDCA 1S5NA 3AYSA 3QRHA 3EOUA 2VRQA 4JTFA 2V0TA 1EJTC 4UOZA 1G5AA 1MFUA 4HNTA 3H70A 4XSMA 4NG3A 3LCGA 4AD2A 7REQB 3S47A 2PFHA 3DFQA 3WMSA 4ATDA 4XBSA 2J75A 4DWSB 2ZUVA 3WEZA 1PZ1A 3L21A 4FXRA 1UZ1A 4C5ZA 3S0CA 1TV8A 4PTXA 3GXMA 1V02A 2WMFA 3UZXA 4A2SA 5TF0A 2ZC1A 3BWWA 3PBGA 1L2UA 4WEVX 3AJXA 2V82A 2VI0A 2X2YA 5GVJA 1E6QM 4A35A 4I6KA 2Y85A 1IZKA 2Z24A 3LG3A 4WKAA 3FJNA 4NAFA 5FJJA 1TV7A 3H2MA 3DHDA 4HTBA 3C4UA 4EF9A 2GYIA 4F40A 3C0QA 3G3MA 3B4UA 4DI8A 3W07A 5I06A 2C1IA 3URAA 5JIPA 4IPIA 3MP4A 1GG1A 5M17A 1XUZA 3TYBA 3EGJA 4L61A 2ZUUA 5EPDA 1NDVA 1Q2SA 2VP8A 3ARSA 5HAOA 1HKWA 5LGZA 1B3YA 4YJ5A 1F5ZA 4CCCA 2HZGA 3V16A 4LC8A 3KOFA 4ONVA 4W85A 3K1GA 1J12A 4DBEA 1UMYA 3KVJA 5I77A 3S1VA 1R2SA 4FLOA 1A5UA 5CBIA 3NWRA 1PDZA 3DI0A 3L7RA 3MMTA 5HQEA 3T09A 3QPZA 4GX8A 3R10A 2ZWZA 3T78A 1LLWA 5AC7A 1TV2A 2GUUA 1JPHA 2J25A 3EDJA 4GYPC 1G7VA 4DUXA 1XG4A 1PDYA 1JCTA 4NYYA 4TQTA 4JNYA 3RO6A 4S3JA 2QPSA 1TE6A 4CD7A 2A79A 3ZQ9A 1I2PA 4OZOA 2E9BA 2XWDA 2PCEA 1ODUA 2XM1A 3WJXA 1W3JA 5T26A 2EO7A 1OY0A 1WKFA 2G0WA 4GJIA 1A5NC 4IJCA 1A50A 3GX9A 3LI1A 5CLWA 1PCWA 1Y0EA 2XVNA 3RITA 3GSMA 4ML9A 3W38A 1K7FA 4PMJA 4ZTXA 2EPHA 2WVUA 2ZZ1A 1GT8A 1IEWA 2CZDA 4GGBA 2Y7DA 1CBGA 2GK1A 4DHGA 3CO8A 3TFCA 2YDAA 4KEVA 3LTPA 4AXNA 3C61A 1RVKA 1TPWA 1RQEA 1K9DA 1UR9A 3THDA 5GNYA 4GYFA 5J5RA 3R89A 1H4PA 4N4PA 1BF6A 2E6FA 2Q6ZA 1XBYA 3UA4A 1VPQA 4BI7A 2E9LA 2NXIA 3RAOA 3TQ0A 2BHZA 1VFUA 1V3MA 3CV1A 3BG9A 4W7WA 3R0KA 2XG9A 3CHDA 3OZYA 2OYMA 2WKLA 1FWHC 2GFTA 1X39A 3TONA 3E3HA 2MUCA 2ZDSA 4LX4A 1T5AA 1HJWA 1UD3A 4KWOA 1VBRA 2J8FA 1R3WA 1J8VA 3H2CA 3JS3A 4O0KA 3TJXA 4XZ9A 4P8WA 3VKBA 4PRTA 1NQKA 3Q94A 1Z7AA 2GWGA 4M3PA 3MCOA 1HL9A 4K8GA 4O0QA 3ZT6A 3BLDA 3GY1A 5C2CA 3LV6A 4KEUA 1JDCA 3LGGA 5FAGA 1YX1A 4NAEA 2OKOA 3OVGA 2VUNA 3A4JA 2PDWA 5DELA 1MMFA 2FVKA 1XYBA 1W2VA 2ZZ7A 1Q6GA 2VGBA 4GOAA 3O0KA 3EWWA 1RCQA 2BGSA 3RRAA 4ICNA 1DWGM 4HU8A 3JZEA 1Z9AA 1SGJA 4NY2A 3BSHA 1S38A 3HU7A 1DWIM 5IRPA 1BPLB 5IBXA 1F8IA 4R7JA 4UC5A 4ZQOA 3GBDA 3NL3A 3L0NA 4OJYA 4B4HA 5A2AA 1PKNA 1ZLPA 1RY0A 4CCZA 3GXFA 4P2VA 5FI8A 2DQXA 3VNLA 1P0KA 2H3BA 3RR4A 4B3LA 4I5UA 4WJ8A 5I0DA 3IS4A 1S5MA 2P0OA 3ITYA 2VGFA 1LOQA 4Y6GA 2OLSA 4W7VA 2VVSA 2BOEX 3UXKA 3NGFA 4A3RA 5LGXA 3VKAA 1GQIA 3S5OA 3IANA 1LROA 1GOMA 3QM3A 3QTPA 2F2HA 4RE3A 4JFWA 3WLIA 2BSLA 5EKYA 4YTTA 2FZDA 4G8TA 1VGAA 1TPB1 4CNPA 2ZRYA 1KGWA 5D2YA 1OZMA 2I5GA 4YS1A 1X98A 2GSJA 2PUZA 3NTYA 2YIHA 4A8NA 2DU2A 4B2DD 6TAAA 9CGTA 2DSZA 3GW0A 2WB5A 5ECUA 2J24A 4PRRA 2WNNA 5IFTA 2W4XA 5CPLA 4AZHA 4LYQA 1DXEA 1IXQA 2ON3A 3TYUA 3CTLA 1XLLA 4WCJA 3FA3A 3QSTA 1JF6A 1DQWA 2WPGA 3R25A 2OZ3A 4Z2KA 3U48A 3M9YA 3LLDA 4CN4A 2C13A 9RUBA 1V0MA 3W1MA 1MFVA 3A4AA 2YDRA 5HNTA 4O19A 3ARPA 4C6DA 3UYCA 1LRTA 1SSGA 4M5PA 4ROPA 3CMJA 5EYWA 4IOTA 3EX6A 1RCXB 1Q8JA 2XGZA 4BFAA 4PA8A 2PU0A 3E5BA 3LMZA 5CC5A 3VDCA 5DCEA 1MUCA 3NQMA 1PBGA 1GOWA 4LS0A 3GHRA 1U5HA 3TKFA 4E38A 3TJ4A 1OB0A 3DIPA 2R94A 1LBFA 3VD4A 1QPOA 2I9EA 3CYJA 1W8SA 2PDIA 5ENLA 4JHOA 4AIUA 3G1YA 2Z27A 1JCMP 1TKKA 4MZYA 3LXCA 1GVQA 4GBUA 1JZ3A 4JICA 4F0MA 1A80A 1HJVA 4XD4A 3K8MA 3H24A 2XIJA 4HMNA 1IYXA 3LTYA 3LGDA 4O1FA 2WZIA 1XCFA 1OFBA 1XLEA 1QBBA 5IFPA 4XKMA 4YHGA 1ZP4A 1T40A 2PWUA 3TYEA 4F79A 4GQBA 4WKFA 3ECQA 3KCJA 2W92A 2FDSA 4L80A 1G0CA 4LOCA 3WFAA 1CX9A 2SFPA 3G6MA 4M19A 1EDTA 1JJKA 3LHVA 2GJXA 3W71A 4L4OA 2Q8ZA 4TX6A 1H7XA 2Z26A 1MSSA 2PWHA 1QWKA 3W1XA 1FHUA 2D22A 3IGSA 3L9CA 1EC9A 4KCWA 3FJ4A 5BZAA 1HKVA 2AAMA 1BYAA 4D8ZA 1AQFA 3L4YA 1K7XA 3TH6A 1DJXA 2DUAA 1H1ZA 3F7JA 1ITXA 2ISSA 3GHUA 2ABBA 1Q6EA 1AFSA 1XJBA 3TC7A 4DUVA 4QJ4B 5A2BA 2DSUA 3NEHA 4M0XA 4X3ZA 2VDGA 4XD6A 2ZFAA 3AIQA 3SUWA 3C2EA 4DELA 3D46A 3SY5A 4D6CA 3UPMA 3VZZA 5DBUA 3KDNA 4IL0A 1OT1A 4TR9A 5E9XA 3V7PA 2RH9A 4A29A 3HFTA 3T40A 4WJXA 1L6SA 3U2ZA 3PBUA 1A5BA 3WENA 4AZBA 3QKZA 3M0IA 2ZQ0A 3U2OA 3HG4A 5T9BG 5D03A 5FJIA 3W3OA 1SR9A 4B15A 3RF9A 1OFPA 4C6MA 1VBGA 3W29A 1GVYA 4H7CA 2R91A 4LY4A 4NAFB 4AFYA 2YFNA 4RZ4A 3A3XA 4MB1A 2G41A 1F3WA 4W5UA 3L4UA 3PB2A 3T42A 4H41A 3LX9A 4RZ5A 5DEZA 2J8GA 3B97A 1LBMA 3RIKA 1NSJA 1UASA 3GDMA 4I7UA 3KRBA 3U4AA 3IJ8A 3MWCA 1E3ZA 4LAOA 3LPGA 2PDXA 1EHAA 2QAFA 3GZ3A 3SJNA 1W0MA 3LYEA 3OHMB 3S6OA 2A85A 1OQFA 3W7JA 4Q3MA 3W6YA 5BWAA 4J4KA 1HL8A 2NX1A 3THQA 3W73A 1CNVA 3BLIA 3TMLA 2XFFA 1IGSA 4UQCA 4H9MA 3CUIA 1XBZA 2PWFA 4QJ1A 5CC6A 2OX4A 4J40A 3CBWA 7XIMA 2J13A 1UKTA 2PDYA 4IIEA 1E9LA 5FJPA 3PN8A 5FCZA 4IISA 4Y7EA 2Q8XA 3Q67A 4UNLA 3IACA 5HR7A 1UD4A 3VNJA 5AZ1A 3O6AA 4IF2A 4UCFA 1OF6A 2H90A 3V1PA 4OV4A 1HG3A 2DSWA 5L9FA 2YYUA 3CUHA 3PWGA 1OC5A 2YL5A 4JCMA 3CUFA 3QV8A 1MZRA 2PTZA 3NQ6A 4ZO6A 2GK1B 5A8MA 4XK2A 2VCAA 1KM6A 4FK9A 1HF6A 1RQBA 3FGCB 4FLQA 5BXTA 4LF1A 3VFLA 2FZ8A 5E6YA 3WQGA 3M0HA 1JPMA 4A8LA 3HGOA 3O7UA 1LQAA 3VIKA 1ZGDA 4B5UA 2B0MA 2NSOA 2DT0A 1QWGA 3TOPA 2OT0A 1MVYA 2ZVIA 3SM0A 1ICSA 1DKWA 1SMAA 1PZ0A 2YL8A 1J0ZA 3B8DA 4HPHA 3NDYA 3R0UA 3B03A 4HHHA 1XLKA 1LL6A 1K9TA 3KRSA 3CAWA 3T0BA 3VNDA 3H4WA 5HNUA 1P1MA 4QNEA 2OZTA 3NO3A 3RX3A 4FNQA 3WJSA 3KX6A 4WHBA 2BWGA 4ZR8A 3NM1A 4N9DA 1V7YA 1F9CA 2ZBTA 3MP3A 5AYBA 3CHVA 3XINA 2BHUA 4DJDA 5KZDA 4NAEB 1UQYA 5FSDC 2TAAA 3C8FA 3ZSSA 1GVRA 1XCWA 1ELSA 1QXLA 2QYGA 1FWBC 1POKA 2Y8VA 4QBXA 5BYWA 4C7GA 3FXYA 1J9YA 3QW4B 4QE4A 2EAWA 2VZVA 1WB0A 3D0CA 3N4EA 4ZQRA 3SADA 1KBKA 3CT7A 4RE2A 3CUZA 4RX0A 1A3XA 5I3GA 2DVXA 4IIFA 1XC4A 3OG3A 1XIIA 3HG2A 4QDPA 4B9ZA 4M8UA 3MVTA 4IX0A 2E6AA 2WBGA 4WIWA 3BL3A 3QY7A 3PTDA 4RR4A 3FAXA 4TUFA 2P3EA 4Z1YA 5I3DA 2FJUB 4MTVA 3DHUA 4TXEA 1FH9A 2D0GA 3KBMA 3MHGA 1W9BM 3N3TA 5LIKX 1ESWA 4JTDA 2F38A 1OX5A 3CZGA 1LL4A 4NVTA 5BCAA 1E6PA 4JEQA 1KXHA 1DHKA 2FMOA 3A5VA 2E6YA 1H5YA 3UG5A 4MLRA 1JI1A 4LRSA 2A0NA 3OG2A 3TX9A 4LW7A 2VRJA 5CCZA 2E09A 2VGIA 3OIXA 3Q65A 1FRBA 2PDQA 3WLHA 4JYFA 3IGUA 4LQ1A 3GXNA 4ZO7A 3HPZA 4IIBA 1C93A 1UZDA 4QX4A 3WH6A 3VUSA 3H55A 3WBXA 4C7FA 5M3WA 3A23A 5FL0A 3RUBL 4FI4A 2V3EA 1TJPA 1PEZA 2D2JA 5CSSA 1C7SA 1NFBA 3UERA 1BVWA 4H9VA 3L23A 3S2MA 4XBKA 1S3HA 2VENA 1H5VA 1ZY9A 1DJNA 3AICA 4GJ1A 3M0ZA 2WSKA 1QAPA 1NF0A 4MWAA 4L1XA 5I2UA 3QEZA 4UTTA 3AALA 3W1AA 4R9XA 4YTRA 4IM4A 3WBWA 1MW3A 5LIXX 3I6EA 3L68A 3NXFA 1X1NA 3BZJA 1NY1A 4LTSA 2FH6A 2PDPA 2BVWA 1Y8BA 5JBDA 3ZR4A 3KTSA 3VDHA 1XF0A 4QAIA 4GY0A 4GPNA 4O0ZA 2DZTA 3MDUA 1QI3A 3A6OA 4H2HA 4H8VA 3VGDA 4C60A 5AC6A 3HQOA 2X05A 4AMCA 1V3LA 3QKEA 3LNMA 4WJEA 2QEZA 2CHNA 1XX1A 2VDIA 3OZOA 1UD8A 4KKXA 4O52A 2GJLA 1VZWA 5D8WA 3QV6A 1AUSL 2Q71A 4BEUA 1C8XA 3RHGA 1VEOA 4TU1A 4UXDA 5D30A 4QJ5B 3PTKA 3PAJA 3PBYA 2VX4A 4HN8A 3NZRA 1NOFA 2BB0A 1NWRA 1RR2A 4HYVA 2ZX9A 1F7BA 1F3EA 4O53A 4ZQNA 4NZ5A 4I9MA 2VOTA 1ISZA 1DP0A 3BARA 4KQNA 1EP3A 1EPXA 3FFSA 2UBPC 4F8XA 1G4PA 4AG0A 4LBRA 3RRXA 4G6CA 3QHOA 1B4EA 3G22A 3W1PA 1S2CA 4AEFA 1TZZA 4I7WA 3VD9A 1FTXA 2UY2A 3WN6A 4GI6A 4K68A 1T99A 3RM8A 2DUXA 4DWSD 4K1GA 2BODX 5ABEA 3ANVA 1N55A 3LS9A 5JUVA 2HBXA 4ICMA 1PWMA 5FJOA 2BASA 3GIYA 1NP0A 1TV5A 1OZQA 3P5YA 3NYDA 4OECA 1R2TA 1XRSA 1BGAA 4MY8A 5U7SA 5PTDA 4H6QA 4NZ4A 2DSKA 5I3FA 4NZJA 5LNUA 1H7PA 3F5LA 3WKZA 2DT3A 3UZWA 2E25A 3IJ7A 4EWJA 4UZSA 3MUIA 3VPLA 2W62A 2AMGA 4W86A 5HMSA 3FLUA 1OFDA 3V3WA 3GU2A 4F0RA 1GGOA 3G1XA 2VX6A 3HMJG 3PJUA 1PKYA 5FJUA 1UA7A 5CXPA 4QLLA 3HURA 4AZ5A 1W5QA 4DXXA 1BWVA 1E0TA 1W1PA 3E6EA 2J47A 3NXLA 2AQVA 1WXJA 2G4JA 4B16A 3EPNA 2WM1A 5AZ0A 2Y7FA 1QW8A 4PUDA 4GABA 1O95A 2J7CA 3AWOA 5CPTA 4G7FA 1EUAA 1QU4A 5D33A 2WJFA 1UWRA 1PZ2A 4PMQA 3VMOA 4C1NB 3SN1A 3WF1A 4MKNA 1JDFA 5C8BB 2DT2A 3OQEA 2OWXA 2WMJA 4YU1A 1KQYA 1MQPA 3NCOA 3MS8A 5REQA 4HSOA 3WLKX 1EGMA 2E1DA 4AZGA 1QK2A 1JFXA 3WDRA 4JR5A 5FIPA 2WMIA 5CSYA 2W67A 4EF8A 3TTEA 1XXXA 3DAQA 1P43A 1CB7B 1OK4A 4UZUA 5M2FX 4Q4SA 2NVAA 3EX1A 3L2MA 1CXEA 3PPHA 1JL8A 3L4WA 1K4GA 5M03A 2FGZA 3CLWA 1KR0A 5H8UA 4NIRA 5LHFA 1SFLA 4JKLA 1THFD 2YSWA 3TA9A 3BJFA 2E6DA 5MF5A 3R11A 3DI1A 1RPXA 2JGQA 4IFRA 4C91A 1KGUA 3A12A 2VJXA 2ATSA 3EX2A 4M29A 2BMBA 1TSIA 3BK0A 5LXEA 3CAQA 3PZNA 1HKIA 1Q6OA 2VTFA 5DF0A 1X96A 1B54A 4LS2A 2AL2B 1XLMA 3G1SA 1KGXA 1B30A 2HE8A 4EVZA 3ARTA 1E73M 4P8UA 4MAVA 3KS6A 3S83A 4A2RA 4NRSA 3VIIA 1G4TA 4WK9A 2NSXA 3LSCA 4U31A 5TIMA 4H8NA 1WZLA 1EP2A 5H91A 3AZSA 2QUMA 2Z2UA 1YTEA 1PHQA 3N6QA 2OZ0A 2J7BA 3MBFA 1QI4A 4LUYA 3QY6A 4MKSA 1UP2A 3HA1A 5I5RA 3LK6A 3E02A 2Z1KA 3GU1A 3G3DA 4IPNB 1VIZA 3FAWA 3ATZA 1VENA 4Z1BA 4B9YA 1Q45A 4QLKA 4NZCA 1F76A 3BQ5A 4B3KA 3FHQA 4OKDA 4XBJA 3SGUA 5HJXA 3TSDA 4IQDA 1XL9A 4PUUA 2QCGA 5HPOA 2OYLA 4S3DA 3ZR6A 1GVOA 4HK7A 3NQGA 3LM3A 1LUCA 1TR9A 3UZ5A 4DNMA 2J78A 3FJLA 3MZ2A 4ZZ9A 1SM9A 1KBBA 3V5CA 1PZ3A 4WXYA 4XO6A 3P80A 2CNCA 1RK5A 3TDFA 4GYPA 5EY5A 1L6YA 2QNEA 4RL3A 1PAMA 4WY0F 2YGYA 1H0IA 2YBUA 4K38A 1WKEA 3BG5A 1BVNP 4GH3A 1XLBA 4R7WA 3OODA 3S8HA 1YNYA 3QC0A 4XIAA 1HW6A 1ME7A 1XDLA 4XZIA 2VQUA 4PB4A 1W1IE 4K7YA 1V6VA 1OGGA 2ZWYA 1SO5A 1XIFA 3HJZA 2OYKA 2E9MA 1EX1A 6PTDA 4AY8A 1JNDA 2NQ5A 2P88A 3FDGA 3W74A 3LN3A 1MQRA 4XO7A 1JQXA 5I00A 1JQVA 3AXKA 1T8XA 3WF4A 3GS6A 4UOJA 3NL2A 4TTGA 1I2RA 5A8PA 1X6UA 4FEZA 3UG8A 4HPJA 1TIWA 1I4NA 4XV0A 1FWSA 1TV4A 2POTA 3BPWA 4AQLA 2ZADA 3GTFA 2PWGA 5KETA 1YNPA 3QY8A 1B4KA 3ZJ8A 1Q7QA 4FZIA 5DT7A 3LGEA 5J04A 1LZOA 2XIOA 4MVAA 3MKKA 4DZIA 2PDMA 4WDWA 4FNTA 3BJSA 5LA1A 5E6ZA 2IPWA 3QPEA 2O55A 1ME8A 3CM4A 7A3HA 2C79A 3W0KA 3JW7A 2PI6A 2WHJA 1EKOA 2NV1A 5FF0A 3LCHA 3EEGA 2J74A 5BRBA 4XVEA 3BANA 4NJHA 3ZYZA 3BV7A 1VIWA 4LUTA 1H7NA 3R43A 2DV0A 2CETA 4KEMA 3LNPA 4I7VA 1AMYA 3RG6A 3WQ4A 2X7WA 4LBUA 4KIEA 3NGJA 4CGTA 1ZBWA 4NUWA 3SECA 3IGXA 3UJRA 3TR2A 1IGWA 1BWLA 1U30A 4O10A 4XTDA 3EYPA 1XFBA 3SFKA 1NFGA 4U28A 3M5YA 3BV4A 4LB4A 5T8GA 3LXAA 1IV8A 3MMDA 1PYMA 2REQA 4X0VA 3VM7A 4J3ZA 4HSHA 1O5XA 1XLJA 3VO0A 2A6LA 3DDMA 4REQA 4C6OA 3VTRA 3WJYA 4BY3A 4HVXA 2MANA 3WF3A 1TMQA 2VC9A 1XUUA 4UWMA 3LQLA 3H6OA 3FS2A 4NI3A 4HD5A 1RLDA 2UV8G 1JZ4A 3QHMA 3L5LA 2V5CA 5I3HA 4E2DA 3G5EA 1E72M 2AL1A 1I75A 1X8CA 5AYZA 1UUMA 1E5NA 1W2PA 4O17A 1HJSA 4PTWA 3VYLA 2QF8A 1WPCA 3PY2A 3N9RA 4QG8A 5D9OA 1B5TA 1UOKA 1QCWA 2AMXA 2Q8LA 2GJPA 2JEPA 3C0JA 1OCNA 3H26A 2E28A 1W3KA 1M03A 2J7GA 4JIQA 4XSLA 2QCLA 2WVVA 3AXIA 1F07A 4D8LA 3M44A 1RCOB 3CMFA 3VIPA 5AHFA 1VHCA 3ELFA 1MEHA 1QASA 4ZOBA 4U5KA 3D5HA 3ENLA 4S3EA 2I9UA 1XBXA 2J6VA 2YL6A 1I2QA 4ACYA 4GQ0A 2ZUTA 2DIJA 5CZJA 1WKDA 4A05A 3AIWA 1WZMA 3HO8A 3B8TA 1W37A 1R9XA 1K70A 2VHLA 2FPTA 1OINA 1FFQA 2ZZ4A 2FZ9A 1QNVA 2X0HA 5AECA 3GRIA 5FEXA 2C18A 1UMLA 3P67A 5CEWA 1LP6A 3SI9A 4W93A 3EMZA 5G4HC 3TYZA 1ZL1A 2P10A 3KRZA 1WXYA 2Z2BA 1KCLA 1UWTA 4BK9A 4AZIA 3AXMA 3VIJA 4C6PA 2CKSA 4B2DA 3ARQA 1G67A 3JR2A 1K6WA 1UWQA 1AH4A 4OE7A 4FLRA 1JIBA 3LRLA 5BMXA 3K46A 1DTNA 2QV5A 5EB8A 1EYWA 4Y8FA 1ISXA 3VNZA 1GW9A 4AB4A 1XLAA 4GGHA 2V5LA 4L1GA 4YCPA 2ABAA 3N2MA 3G1RA 1UG6A 1MW2A 1F3XA 4HZ6A 3CWOX 1KFBA 3QFEA 4H04A 5EMUA 1RUSA 1I45A 3V35A 1L8NA 3LOTA 3VI2A 1IWAA 1M7XA 3GDKA 3B0UX 1K4HA 1S1PA 3MUZ1 2I56A 5EMJA 2PP1A 1J0YA 2A21A 3MYOA 2XSAA 5HDRA 1BQCA 2XISA 4OBSA 1NWSA 1I9CB 1M9HA 3I68A 3IRDA 3YPIA 1V3JA 1LG2A 3UT0A 4R5EA 4MHBA 2J66A 2DW7A 1J5SA 4CCDA 4GINA 4ICCX 3SUSA 5REQB 3N34A 4E4UA 4LRTA 4BWLC 3UWZA 3UFYA 1SFJA 1DL3A 1KO0A 2J7FA 4LAUA 4JS3A 5I24A 2XFWA 3TCEA 2QS8A 3PZQA 4X2RA 3KDOA 1VYSX 4US5A 3N2OA 3WMCA 1JXJA 4ZEPA 2VFFA 1OEPA 4GXPA 3VXGA 1EA9C 4HCLA 1BKHA 1O7AA 2YX0A 1QPKA 2YCLA 3H7UA 2QCCA 1KTNA 2G8ZA 3IIOA 3E38A 4N6EA 2J79A 1ZBCA 3WH9A 4Q4QA 1SQ7A 5F4WA 1V6WA 5A5WA 3I7QA 4V33A 2QV4A 3KOXA 3GB6A 3OIHA 1HJXA 4XAYA 1A5AA 3N15A 4UQBA 3PNZA 4MAZA 3S1UA 2ZXAA 5G4EA 3H23A 4PRWA 4JL1A 2YKKA 5HJLA 1JZ5A 1F8MA 3CLMA 2VCBA 5U4NA 3IEBA 4CD5A 2DW6A 2WZTA 3EMQA 1YE6A 3DBNA 3H2AA 1CGXA 3APGA 5IDZA 3II1A 1BF2A 4RE4A 7ENLA 2HDJA 4D6GA 5A69A 2FLIA 4JHZA 4PUEA 3R58A 1ISYA 3GVWA 1HP5A 1NWUA 3VM5A 4RNJA 4XG1A 3T9PA 3W70A 1DIKA 3W87A 4XZMX 5HWJA 1GEQA 4TIMA 3W85A 4NNCA 5D38A 3M5VA 1CI1A 1SSDA 1TX2A 1TMHA 4ZE4A 3SJ3A 1HGYA 1R86A 2WO5A 2FZNA 2BOGX 1XRVA 3TMQA 6REQA 2YDSA 1QW9A 1JDEA 5FAJA 3UG4A 2PEVA 1U5JA 2PTWA 4H8HA 1M5WA 1UR8A 1PCKA 1CTNA 4RZ6A 1LUCB 1SW7A 1XLDA 7TIMA 4Y9PA 4FLSA 2YLLA 2EKGA 3ABOA 3KUMA 1EXBA 6XIAA 4E5TA 4AC1X 3W7IA 3PJXA 2PGRA 3GG8A 4Z2IA 4EPEC 3OU8A 1B3XA 1EDQA 2IUZA 1UD5A 1UR0A 1OGBA 1HUVA 2OKTA 5CPQA 4GO8A 1N8WA 2PZNA 3M4HA 4W84A 4J5NA 3GLCA 4CEUC 4AIBA 3M0MA 4JIEA 4MDOA 3TV8A 3A22A 1W8GA 4RUBA 1AZ1A 3KHJA 3EWDA 3NURA 3B9EA 4PMDA 1XIMA 1DE6A 1QNQA 1TR1A 1CWYA 3FHAA 4ZCWA 1W56A 1RQHA 4O1AA 2WJDA 3MP5A 2EBNA 5KINA 3H2EA 2BY1A 1OIFA 4JTRA 2F61A 5CPOA 3GC5A 3W81A 4M81A 4E8CA 2RDWA 4I9TA 3ZO9A 4PEKA 4AWTA 1E6NA 1YHTA 3FYPA 2VNCA 5C7VA 2PC4A 3HOJA 3OLGA 4MUZA 4ZXOA 1V6XA 3UWQA 3SQSA 3VIHA 3N11A 4H6EA 5G5IA 5HUPA 2ZCGA 3PG8A 4PN2A 2CLMA 3K8LA 3RU6A 4OVXA 3PZIA 4I3GA 4PUKA 3QFWA 1LTDA 3WIJA 2AGKA 3GC2A 4ZFCA 3TA6A 5C71A 4LVDA 1W9PA 2X1SA 3IIXA 3RCMA 3LERA 5A8OA 1UA3A 3PR2A 3KTXA 4MPQA 1VJSA 4S39A 3VGHA 4A4AA 4PSPA 4PMZA 1WCGA 3OLDA 4XAZA 3MJMA 4Q8WA 3HF3A 2WKGA 4P61A 1UD6A 1XH1A 1XH0A 3CPRA 2GDQA 4LUTB 2ACRA 2ZUSA 4KCVA 2D3LA 4PBGA 2Z00A 5HPCA 1X7FA 3SCUA 2ZKMX 4Q8PA 1Y65A 4QQUA 4K2SA 8RUCA 4P7OA 3KCLA 1JG9A 4H4IA 1NJJA 3NZ1A 3WFLA 1BXBA 2VR5A 2Y4SA 1YKWA 3R5EA 3SO7A 2XN0A 3THAA 4PCFA 5JMUA 4UTKA 5H8PA 3OOQA 3ANYA 4UFKA 2REQB 2HEJA 4Q4PA 3TJIA 1XW8A 1TTIA 3SCTA 1XD1A 4OUEA 5E5CA 2WSQA 4H9ZA 5LXXA 2W79A 1UJQA 4AX6A 3CL7A 1DIOA 1UD2A 4GFSA 3EWUA 4F2TA 1V0LA 3TTSA 3W2UA 2ONEA 3SAZA 4GIRA 2V2CA 2H8ZA 3PNUA 3REQA 1PPIA 1YPIA 2E8YA 2XUCA 1S46A 1KM1A 1CGYA 2WVSA 3S6TA 5LHEA 1J01A 3DHPA 4MUPA 5I6SA 4Q8VA 2R1NA 2PD9A 4KH2A 3QOMA 2A3CA 5FEPA 3AXHA 2WVVB 3H12A 4YN5A 5M1TA 4GUFA 4H1ZA 5HATA 1JAKA 2Y2WA 2DZVA 4GC4A 3GG1A 3ARVA 1UIPA 3DKJA 4PMVA 3P60A 2V68A 1KM5A 4IP7A 2NUWA 3OO2A 2TMDA 3OTRA 4DBDA 1G4SA 3WLTA 4PFHA 2G37A 1O4UA 4NU7A 2ZE0A 2JFEX 1J2WA 3EOEA 3P62A 3MB9A 4URIA 3KVKA 1UJPA 3UCDA 3ITVA 4H6KA 2Z25A 1KKRA 2QGYA 3GXIA 4C6NA 2CLLA 4YYCA 3KWXA 3GHSA 4IPPA 2XH2A 1FDZA 4FX6M 4IGHA 3ANUA 1GOIA 2PDUA 4DY1A 4L4PA 3LBCA 1E9ZB 1EX5A 2RGLA 4C65A 2PURA 2X16A 3W4RA 3M0KA 4J3SA 2VRKA 2P8CA 3BE7A 3GQYA 3UY7A 2VUYA 3HPFA 1YIXA 2PBOA 5L6UA 5CGQA 3DBPA 5A8QA 3P8IA 2DJXA 2ADAA 1PTAA 4NI8A 4F66A 4U33A 3FV9A 3WD4A 1KFEA 1BEUA 1X6NA 4O15A 1X7IA 4EP8C 3QQ0A 1A0DA 3S46A 5HR6A 1J0HA 1MNZA 3VABA 1XIBA 4JN7A 4DJFC 1VAHA 2FB3A 2PTYA 3MV11 1LYXA 2BXYA 2HVOA 3RU8X 2QZRA 3MVIA 1O6IA 1PSCA 4JTQA 5K7JA 1K8YA 1UROA 4D6HA 3CIWA 4R34A 1EJVC 3GTIA 1E4IA 4R3UA 4P7QA 3DH7A 2YW4A 1TRIA 1OABA 5FACA 4BI6A 1TPC1 1WE5A 1GHSA 3NDOA 3N18A 1D2KA 4W9TA 1PTDA 3T0AA 3WUGA 1J6PA 4X22A 1IT8A 3ZT7A 5DN1A 2XVPA 1NVMA 3RPDA 2E67A 2AQWA 3WLOA 5CQ1A 4NP7A 3MU7A 5G2WA 1UUOA 3OBKA 2A3BA 3W02A 1XGEA 3KZSA 5EA9A 2Q3OA 4UQAA 1Q7MA 2O0TA 2A4AA 2YOCA 2Y5EA 3W7MA 2WANA 4F0SA 4X2PA 2FZBA 2HPIA 1E6RA 4JDBA 4GI8A 1XYMA 2YCLB 4PB5A 2G95A 4P7LA 3PC0A 5CG0A 1VH7A 4ES4A 4FB7A 1BYDA 4N6FA 3C3UA 4QP0A 3EB3A 1WUFA 4WSHA 1HVQA 1TVNA 2Z28A 1GONA 3JRKA 1FH8A 1KTBA 2YFOA 2CLEA 2VZTA 7REQA 4HNOA 3W84A 4C6FA 2PWDA 1OJXA 4PMUA 1CXHA 1BYBA 1WOAA 1O5QA 1US2A 1XHGA 4L65A 4IMGA 4M24A 4JQAA 4PGLA 1W5MA 4JYEA 2ZIDA 1E70M 3S1GA 2ODOA 1EDGA 4PTNA 1MEIA 3L4ZA 3QZAA 3FKRA 4GG9A 3NQCA 3M46A 3ITOA 4DO4A 4DJDD 1OGSA 1EOKA 1DWJM 4GI9A 1IXPA 4EXAA 1CENA 3E74A 3U5YA 2PGWA 2TSYA 2FVMA 3B0YA 1UQZA 4DF0A 3SN4A 5K2ZA 4UR7A 1JDAA 3LPOA 4V28A 3M0JA 4GIAA 2B4GA 4LYRA 1AK5A 3EWCA 2DY3A 4NL1A 4WLCA 3FK4A 1ONEA 3GH4A 1AQ0A 2O56A 1ZUAX 1HJUA 4Q8QA 4GD0A 3AHZA 3NUKA 3UJ2A 3G1FA 3B40A 6REQB 3K13A 3R4IA 3VGGA 1H63A 5DRIA 4GUIA 3SY8A 3WBYA 2D69A 1WNOA 3DFOA 4PCTA 1IEXA 2DZPA 1MDRA 4N9CA 4DI9A 3SDOA 1NDZA 2W5FA 4NZFA 3WBAA 4H7VA 4AD5A 3TUUA 2ZYFA 1M7JA 2ZA3A 3I3DA 1OBAA 1RJPA 3ZJ6A 3LD5A 2NX3A 1NOWA 1H60A 1RJRA 2FFIA 3HN3A 3SW6A 1MYRA 1W5NA 4UMCA 4JY9A 2Y8UA 1ME9A 1RY8A 1VC4A 3VCRA 2XINA 4AX7A 1CEOA 2X42A 4MFDA 1GKRA 3NNTA 4O14A 3GR8A 2IQDA 2XTKA 1DWAM 3JU2A 2V9DA 2ZRVA 2WCGA 4C6BA 4H2CA 2TODA 3TROA 4HTYA 3PJWA 4PYSA 2CXEA 3CH0A 3I4EA 3OA3A 3TC3A 2CHOA 1KV5A 1CGTA 4DJEC 4Q4RA 4Q4MA 3KP1A 3WLQA 1PWLA 5CZKA 3MYPA 1P7TA 3TW9A 3GFZA 3ZWTA 1EQCA 2GOKA 3TLQA 1P48A 4H00A 4QCFA 4V27A 1EC7A 1RP8A 1JCLA 4GH1A 2GPTA 5ABGA 4MLJA 3H8AA 4QAWA 3M5ZA 3WLRA 2PDLA 4S3KA 1KCZA 3DYOA 4JX5A 1YE4A 4UR9A 2VMFA 4JZ5A 5A6MA 4Y2WA 3LDVA 3S9YA 1A3WA 1LF1A 3W27A 1UR1A 2FPVA 2JBMA 4UIOA 1M3UA 4W8AA 4RXFA 3L5AA 3HQNA 4ORMA 5K9CA 1MXGA 2RHGA 4B5SA 5HNNA 4XQ6A 1VJZA 4J9JA 1P6WA 1R3VA 3F1QA 2ALDA 3PUGA 3ATYA 2QDDA 3M16A 2OQLA 1ALDA 1EJXC 1WV2A 3N6HA 3ABZA 4IXHA 4LT9A 3WLMA 2OQHA 1KM3A 2YBVA 1EIBA 3R1ZA 1UB3A 4CQBA 3IAQA 4JTKA 2NXHA 3SZ8A 5LKYA 1C3FA 1HT6A 4CNTA 4H9YA 1DEDA 2BG5A 2I17A 4EPBC 1ZQ5A 4OV9A 4Y9OA 1PV8A 1TJ2A 3T0CA 4MJMA 1EZ2A 3TAKA 2AKMA 1TRDA 3UETA 2QIIA 4RCXA 4JTAA 5HWMA 5F4SA 3WF2A 2HROA 4CU6A 4AWEA 4HSNA 3DU0A 4W88A 5EFDA 1S5TA 4MNKA 5C5YA 3WK0A 1R87A 3OBAA 3QOKA 3PWIA 1PS9A 3QMTA 1KM0A 1X38A 3ZVHB 4Z2JA 1FP9A 1KCXA 1TTPA 1HVXA 2DH2A 1W9UA 3VUPA 3CQ0A 3CT2A 3G6LA 1HX0A 3BAJA 5I02A 3LB0A 3REQB 2A6NA 4JTJA 1UH3A 4V1YA 3GO2A 5I3IA 2CC0A 2BY3A 3GWQA 5E70A 5D2TA 1KM4A 7PTDA 4FNRA 3NO1A 4PBEA 4UQ9A 5F2GA 5GNXA 2D1ZA 4AUBA 1V02E 4AD4A 3O6DA 2A1YA 4BF9A 2YZRA 4HMDA 1DXIA 2ZOXA 3SGZA 1YDYA 5AOUA 1GQKA 5CAKA 3DGRA 3MHUA 3CZEA 1A0EA 4TTUA 4QE5A 1LRNA 2O9OA 2GVEA 4YL2A 3FVMA 3K30A 1ZHAA 3WX7A 5A3HA 4ZQMA 1NOUA 4M80A 2BVYA 1DVJA 1OSEA 1HGWA 3VOHA 1F74A 1TB3A 1OIMA 3ZMRA 1CGUA 4C6IA 3P61A 3VNYA 2EPNA 2OODA 2RDTA 1WOBA 2Y61A 5IOBA 4F2BA 2DT1A 5LIYX 4IJBA 4MG4A 1XBVA 3B9NA 4PMYA 1JPIA 4WGHA 1CLKA 1J4EA 4C6QA 4JTGA 2OJPA 3WELA 1I2OA 3W2LA 4KRUA 1BG9A 4F4RA 2WMKA 3UJSA 5BRPA 4WVXA 5A6JA 5AB3A 1NARA 3O63A 4Q8NA 1V79A 2XGIA 5FEWA 3MUXA 3QLLA 4OFCA 5G1YA 3TN6A 3TQPA 4POCA 4MIMA 3QYQA 1ITQA 3OLEA 1OYAA 3FY1A 4Z2HA 3M7WA 5D9MA 1IEQA 4IT1A 3MO7A 5EFFA 4WKHA 3NOYA 4DUOA 4JIPA 3U7VA 4FNPA 4HK5A 4J3VA 4DM2A 4JL2A 1DYSA 4DNHA 3TXVA 3ZLFA 2Z6IA 2YCJA 2VX5A 1WDRA 1KC7A 1GVSA 1XWYA 1MW0A 2R8WA 3TXZA 1IT0A 4PMXA 4FOKA 2Y0FA 2DVUA 2Z2AA 4S3AA 4DZ5A 1IR2A 2PF8A 4NX0A 1WKYA 1ISWA 5D04C 1W1A1 1XP3A 4IFKB 4S3CA 5BRQA 2IKHA 2BS9A 1MUMA 1F6PA 3LU2A 1T0OA 1IQ8A 4A8IA 1GVFA 2WHMA 2DIKA 3U7BA 4Y9NA 1JZ6A 4JFTA 2OELA 5F4XA 3UZJA 1DJQA 3P81A 3EBVA 1J0KA 4CQ8A 2OG9A 1LLOA 1WO2A 3OLIA 1V3IA 2PRHA 5F1UA 3QGKC 4B90A 3WNOA 1TWWA 1BG4A 1Z44A 3V5FA 4N0RA 1DIDA 1UOZA 4HB7A 1EPVA 1ZAHA 1PX8A 4FNUA 2E5DA 1MO0A 5C9UA 3TE9A 5K4XA 4RNFA 4ZSUA 3UA3A 3SUVA 4R85A 4BEQA 3RMEA 5J8LA 4S3GA 3FW6A 3FYYA 4CVUA 1XLGA 4U2YA 1XIEA 4DYJA 1KR1A 3EXSA 1TMLA 1RK6A 2J9YA 5GJPA 2XFYA 1JF5A 2QDEA 5DX7A 2PBGA 4JTLA 3BW4A 5JVLA 3TP4A 3WUFA 1FCQA 1W1TA 2EF9A 1E15A 5CZSA 1GZGA 1KD0A 2OX1A 5IM51 4HHMA 4IL2A 4OBTA 3NQ7A 2E0PA 4MY9A 3RPMA 3VDBA 3LCWA 2QT3A 4GXWA 4Q8TA 3KBNA 3HG5A 2PTDA 4UTUA 1CXKA 3QTGA 1Z41A 2EG7A 1VQTA 3W88A 3BTNA 4BWLA 3MCNA 1EUNA 4NHVA 4JPGA 3T81A 2INFA 5HA7A 1M65A 2HVMA 4J3TA 2Y6ZA 3DYPA 1VFOA 2ACSA 2GVJA 3S2CA 2XM2A 4KERA 3HZ3A 4EE9A 2XH0A 4WQ6A 1P6CA 3B05A 3W00A 4JKMA 1FWFC 3GR7A 2BXZA 3K2GA 4JTCA 1BYCA 5A8GA 1D3HA 2BY2A 4BQ5A 2XFRA 1K03A 4OQVA 4ROQA 3L4VA 4AVOA 1Y5XA 1DOSA 1DWFM 2Z1BA 1Q8AA 1J79A 1W9XA 1HZYA 3RCYA 3T4WA 2OOFA 4LXFA 2BDQA 1GQLA 3U2EA 1K1DA 3AUJA 1SJDA 3TN3A 4X9SA 2BP1A 4KWWA 1ITCA 3URBA 1W31A 2GQ3A 2XZ9A 4M6QA 2V2DA 3W2KA 1V6TA 2G3MA 2OFJA 3HV9A 1ZSXA 4PUNA 4XZLX 3U57A 3BDKA 2XDFA 4D6FA 4ZBCA 3AIRA 1X6LA 2A2IA 1VS1A 4ZOAA 3CWNA 1GZ1A 4ACZA 1C9DA 1LG1A 2ZRXA 1HKJA 3UXAA 2E8ZA 4DM1A 3FCPA 3MANA 1QUMA 3FGCA 4J3UA 4E3TA 1K8ZA 3MSGA 2PDGA 1P7TB 4O1BA 4L9YA 3B8VA 4HZMA 4YXGA 3T08A 1V5XA 4JQ1A 3VILA 2IW0A 2Z1SA 2VVNA 4IZGA 2V67A 4M6PA 5DMMA 5RUBA 1XIJA 3CQKA 4QRNA 1TQJA 2XIMA 4K7VA 1X97A 1JI2A 4WOZA 4LGXA 4ENLA 2HXTA 3MI2A 1I0DA 4EAYA 2Z1WA 4QM1A 3AHVA 4OT7A 4Z42C 1XGDA 1JYXA 5EMYA 4HCDA 3BAIA 2O9TA 2Z29A 1S3TC 4DBSA 3C6CA 1SO4A 3AAMA 2BLEA 3S5ZA 2G97A 1EP1A 4S3BA 3GAYA 1RH9A 1Q2RA 3NL6A 4C6JA 3L2IA 3PZOA 3W7CA 3EDFA 3VKCA 4NXKA 3V36A 2FDMA 2YCEA 2J8TA 4DAIA 2VC5A 1C91A 4WUIA 5DCBA 3SQLA 5F7UA 4R7OA 4DZHA 2CBJA 3HV8A 2VDHA 4IMDA 1R7OA 4PSRA 2PODA 2CXGA 3WD3A 4JIHA 3VC6A 2W0UA 2OWCA 3KHDA 5AYIA 4YWSA 2FTPA 5I03A 4JTHA 3VNIA 4XD3A 1R30A 5A6BD 2QCNA 1O5KA 3N17A 1IZJA 3NQDA 2F2KA 5HXMA 1YADA 2JIWA 1UKOA 4UFMA 3P14A 1W3IA 3CIXA 4ATWA 1RD5A 3F2DA 2CLOA 1EBHA 3NAVA 3SUTA 1WBJA 4J3WA 2B7QA 2Q09A 1TG7A 3IUHA 3UU0A 3F5JA 1LBLA 4Q8MA 4MNLA 4QJ3B 2OEKA 3GNDA 2OOGA 1A4MA 4CLMA 3NQBA 3N19B 4IX2A 2QULA 4HGXA 2VQTA 3G1HA 4LUJA 3CO4A 1U2YA 4LAKA 2H8XA 4RDWA 2FYMA 3N9SA 2ZUNA 4CKQA 5HBFA 1TVLA 5C55A 2UY3A 3GM8A 3WO8A 3BAXA 3GVGA 3OPSA 3TYAA 3S1XA 3GDBA 3N4AA 3BSGA 1V6UA 3KBSA 1V3HA 5IXEA 3U2CA 2WWDA 3UWVA 1TPUA 1H41A 1HTIA 3WK1A 2GL5A 3VOCA 3CXOA 3R13A 4DBUA 4JQ3A 3NFUA 4L6OA 4NJIA 3JZUA 1AA1B 3HGJA 4MY1A 4ZO9A 3WQ8A 1XIHA 2QR6A 3Q37A 4HT3A 4JBRA 6TIMA 3P82A 3CS2A 1X8FA 1OF8A 4C7DA 2V81A 1BWKA 3C0SA 4MMWA 4U5IA 5LA0A 3H4GA 3LY0A 3TN5A 1K8XA 1LQ0A 1GQNA 1N8FA 4W7UA 1Q66A 3ES8A 5HQLA 2WNQA 3B3DA 3CL6A 2FPYA 3NSMA 3LLXA 1SZEA 2DORA 5GJMA 3F4NA 1E71M 2EG6A 5TD4A 4YTUA 3LRKA 5DXYA 1O1ZA 4ZMGA 2HS6A 3RDKA 4J7RA 2OWWA 1HNYA 4JEJA 1BLIA 5BNKA 3RCNA 4GMEA 4TV6A 2I7GA 3AIUA 3OVRA 5CC7A 3GVQA 1XLCA 5D8ZA 3TSMA 4US5D 1AJ0A 3LPFA 4PMOA 3H54A 2WJZA 2J62A 4I5RA 4JN6A 4W89A 4I5XA 4I9JA 3N25A 1WXZA 2J7HA 3GH7A 2D2OA 5CJNA 2IQ0A 3LXBA 4DIAA 2VT0A 4WSKA 1YDNA 2ZA2A 3AUOA 2WC7A 2JKEA 3TK7A 2X41A 2CCRA 3SGGA 3PPFA 4YTQA 3DYMA 4LBSA 1PKMA 4JY8A 3PUEA 1YW1A 2I14A 3QVQA 5HOSA 3PS7A 2BGNE 4LF2A 5CC3A 3B9AA 1WDWA 3LCLA 5C0QA 4D2JA 4HHPA 3ONCA 5AHIA 1SJBA 4IFOA 3P84A 3GTHA 4JFSA 1HFBA 1QI0A 4S2CA 1XH2A 3WUEA 1Q6RA 3OGRA 1GK8A 2FTYA 1DJHA 3ARZA 1U1HA 5KZ6A 1FWDC 3N3MA 3ITTA 3DENA 2CBVA 2YJQA 4KWVA 3MSDA 3VCCA 1PIGA 4DXKA 1Z42A 3VC5A 4K3ZA 3G1AA 1GVIA 3M6DA 3NQ2A 2J88A 3WDHA 4GJJA 1EL3A 4F48A 3G0XA 4JTSA 3SB0A 2R6OA 5G2HA 3CQIA 4H8UA 3WNLA 1NDYA 4QS6A 2YXOA 2XSBA 3VZXA 2X7VA 1TJ0A 5KMYA 4HMCA 4PCNA 4ZXLA 3NIYA 3K4AA 5DMYA 3SCQA 2DZAA 2YA1A 2ATMA 4GZ7A 4EPKA 3ARYA 5E09A 2YA0A 4QQ3A 1SO6A 1ZCCA 1NFPA 4LVFA 1TTQA 1CGVA 3KRUA 1EJRC 2QIWA 4G7EA 1AMKA 3LHWA 3LM7A 4C1NA 1LQ2A 3I6TA 1FHVA 1EF3A 4L6DA 3IIZA 2X8RA 1KW1A 4DLMA 1JYWA 2X1IA 1QRQA 1YPXA 3WQFA 1TVPA 3LCXA 2KAUC 1GYNA 1EB3A 1H2JA 3UXIA 3AQUA 2FGBA 1XS2A 5BXSA 1D3CA 3TQKA 4FXSA 4AVNA 4GVIA 1TPH1 4CNSA 3HPSA 4LALA 2OMAA 4XX6A 3IJIA 1EXPA 1UYQA 5E0FA 2QUVA 2QGHA 1UHVA 4Z0JA 3SURA 5AFDA 4H7ZA 2KX9A 1OFRA 5KTLA 4CU8A 1QOPA 1OC7A 3CC1A 1IE7C 1SW3A 4OUIA 3GAKA 3QR1A 2RDUA 4MWAE 5HK4A 5D02A 3C2VA 3WNKA 3P5ZA 3C8NA 2AL2A 3LZ3A 2ZXBA 3U6WA 1GOQA 1XYZA 2Y63A 3N4FA 3EOOA 4LYPA 4A8RA 5XIAA 3PTMA 4PBFA 1PVNA 5C6MA 1NF7A 3TIMA 3VE7A 1P1XA 1W1VA 2NWRA 4ACZB 4B4FA 2HK0A 1A5MC 1GWJA 4EXBA 1A5CA 4UOQA 4P7NA 8A3HA 1PHWA 2FZMA 3VOIA 1C8QA 3ISIX 1KWGA 4XAGA 3WY1A 3WG6A 2A7RA 1OFEA 4U3AA 1UKQA 4AY7A 1KFWA 1JEZA 1G1YA 1BHGA 2ISFA 3FSUA 5EBAA 2FVLA 4BCEA 2HSAA 4UCGA 3GVVA 3TFXA 4FX7A 3WFZA 4IPLA 3IGHX 3TTQA 4Q8OA 5I79A 2Y7EA 3ABSA 3EA1A 3V0SA 3BJTA 3LHYA 1D8WA 4CQDA 2DPEA 1JPKA 2ZX8A 5A6KA 3UNDA 4BR1A 1XPYA 3RO8A 5A2CA 3W76A 1J93A 2CHRA 2HK1A 3BH4A 2DFAA 4XTIA 5LNSA 1FCVA 3P0WA 5XINA 1TWIA 1QATA 1YXDA 3SCOA 3S6DA 1KM2A 3AWNA 3IIVA 5HNRA 2EQDA 3R7MA 5DFAA 1XYLA 3K8KA 8XIMA 3ALFA 3MUCA 3AZTA 2WLZA 3L4XA 5LA2A 1T7LA 3UQNA 2EKCA 1R9YA 1VYRA 3DFPA 4I9AA 1UBSA 1XIGA 4NASA 1YBQA 4CNUA 3VD5A 4HA4A 3VAVA 3SCSA 2CZVA 2D2GA 4AIOA 3EAUA 4U4MA 4H9XA 2YL9A 3GDRA 1JZ8A 5DBTA 1JFHA 5H1WA 3B9DA 2ZUWA 2YXXA 2PP3A 2TRSA 5FL1A 2G3FA 4MWAC 3AROA 2WM0A 1H50A 4IGSA 1OYBA 1TPVA 4UTTC 1SJCA 2D20A 4EAMA 3W24A 1T96A 3LEPA 3CU2A 1QDSA 4Z2LA 1DWHM 1JGMA 4DJEA 3CJPA 3IJLA 1JZ2A 4GY1A 3VX1A 4DX3A 4PTVA 2E77A 4JYDA 1NELA 5KZMA 3BGJA 3M7SA 3ITGA 3UWWA 3T05A 3E2VA 3LSBA 4RV3A 1FH7A 4MOZA 4B5XA 5D37A 5ECVA 3UXLA 4E2BA 5DRCA 3S5YA 1VFMA 1FHLA 9XIMA 2OB3A 3PM6A 1M53A 2ANUA 4PZVA 3LA4A 4AY1A 3W1LA 5LIUX 1VP5A 1PO9A 4JOMA 3W01A 3IIPA 2NW0A 3G1DA 3CAVA 2R24A 3OP2A 1OK6A 3T2OA 2I5IA 4GQRA 1MQQA 5AHMA 3RLVA 1FWAC 3GYEA 3GU9A 2IXVA 5C7HA 1Q6QA 1NTHA 1GPFA 3W2JA 3PUDA 3MMWA 3VDGA 2FFCA 3NL5A 2CBUA 5TQLA 5AC5A 3NSNA 3GG7A 1DIEA 1G6CA 1UUQA 2DEPA 4C1KA 3KXQA 1EJWC 4MB3A 1OCJA 1KRAC 3R8HA 2PP0A 4YHEA 2YW3A 5CJMA 2VZOA 3WEOA 4DQWA 2R1MA 1K7EA 3L66A 1PX4A 4GUHA 4LNCA 2GZXA 1VKFA 3EKGA 4QROA 3W37A 3UY8A 3USZA 2PLMA 2I57A 1KFCA 1XFCA 5CPNA 3ZLGA 3APYA 4CUCA 2GQAA 3L67A 5A6AA 3B0PA 3A5FA 3UWUA 2HQAA 1GPWA 1J11A 3I3BA 4DBWA 4K36A 3TCSA 3BW3A 1L0PA 4BKNA 3EZ4A 3H7VA 3G18A 3MDWA 5AYYA 1V8EA 3KE0A 4BZYA 1JUBA 3WYZA 2F7FA 3IRSA 4HPNA 2ZZ2A 3PJTA 3KAOA 4KCTA 3BLEA 4FA3A 2UWFA 3RX2A 3WLNA 3AYRA 5K4ZA 3T6CA 4GNKB 4WDUA 1Z32X 3AI0A 5I23A 1J96A 3EA3A 4GACA 3VIGA 3UCCA 4CN1A 4NJGA 2Z7GA 2WVTA 2QPXA 1SZFA 2PRLA 3LRMA 3T55A 1Q5MA 5G1TA 3E49A 2L5HA 5MKGA 2YCIX 3FYOA 5A1AA 1XSIA 2WC3A 5H2ZA 4AWUA 4I8DA 4UTWC 4XUGA 5AC8A 3C5QA 4WDTA 4EIVA 5I09A 1OFQA 2Y7GA 1EGVA 1A3HA 5HMFA 4MZ1A 1F2JA 4Z17A 1F3TA 4GYJA 3VVGA 1BXCA 1LM1A 2CLPA 3AMLA 3B0VC 1G4EA 3HPAA 1Y5VA 3PSWA 4LS1A 5AVNA 3VIFA 2G3NA 2XPKA 4GE8A 4HPXA 5I3JA 3UZZA 3STPA 1Q65A 3ZLHA 1PL9A 1UKPA 3WDQA 4Z0SA 3QZEA 3ERPA 4DRSA 3B8WA 1M1BA 2TPSA 3ONBA 5HINA 3D6NA 1I2NA 4O28A 1LL7A 1OG0A 2PB1A 3F03K 3LV5A 3QQWA 2V5KA 2O7QA 3W7OA 1UKSA 3H53A 4IXXA 1E43A 1VJIA 4JNZA 4JQ4A 1KRCC 3SRFA 4GCAA 1GORA 4WF7A 1EF2A 1MWOA 2VZSA 1I1WA 1VRXA 1AD4A 4R88A 4OIFA 4TVUA 2BGQA 3W86A 3LBOA 3KS5A 3VKKA 3OA5A 4Q22A 1BTMA 3AYVA 3B4YA 2BZNA 4LC6A 3FEMA 5MHBA 4HOWA 3ABQA 6ENLA 1E9YB 3ZJKA 3PZUA 3IARA 1OFAA 2AKZA 3V0UA 2ASHA 4DO7A 4AWSA 2OT1A 1WYIA 1CECA 1YDOA 3WQ6A 1IIHA 3CAKA 3VD3A 3PWAA 1QK0A 1V93A 2G3JA 4O16A 4BA0A 5K3VA 4PCPA 1VBJA 4JIRA 3VMNA 4PEEA 1S2WA 2VXNA 3DFNA 3NOEA 1IEVA 4G7EB 1UR4A 6ALDA 4FX8A 5EGRA 3CHFA 4NJKA 4KPLA 4IQJA 1GZJA 2WSYA 1AL7A 3EDEA 4F0LA 1GJWA 3A3HA 4EKJA 3TEVA 3R6IA 4QNWA 3CV6A 4QSHA 2JGYA 3MA8A 4CQAA 2NXGA 1AW5A 1OCQA 3PBWA 1A53A 2EPLX 3N6JA 4Q6JA 4GCXA 1A5KC 3Q4DA 3WMLA 4HHLA 1H62A 2QQ6A 2DJLA 3USBA 1TYGA 1SZRA 3R12A 5DY2A 2PGFA 2PC8A 3BOFA 4UMAA 1QPQA 2I5QA 3PZVA 3W53A 2CESA 2TYSA 1V51A 2WHKA 4H6RA 1MW1A 1A5LC 3QLDA 1OADA 1K9EA 4J27A 3F4WA 4YLWA 4B91A 1KB3A 5FKYA 3QW3A 3BLOA 1FWCC 2H9AA 5LSMA 3GH5A 4HMEA 2W3ZA 2JF7A 1FWNA 1E51A 4HA3A 1VFFA 4FIRA 1TUXA 4RPQA 3BAWA 2VR4A 2VM8A 4ASTA 2HWGA 4XAPA 4CVWA 1DV7A 3GKAA 4WSJA 2NQLA 3DX5A 2QVHA 4FXFA 4QXIA 3VMPA 1ECEA 2V2HA 2QMKA 4JDYA 3OW1A 1UR3M 3ZT5A 3N1AA 2IXUA 3AS2A 3U5UA 1H49A 3I7RA 1P0BA 3P8JA 2IKJA 1O1HA 2BVDA 3P3BA 3MPGA 3WQPA 2Q3RA 2V63A 2VWSA 1ZJIA 3CB3A 1Q4WA 5EU9A 2QCMA 1XGZA 1KWKA 5AHLA 3BLLA 4XAFA 1R8LA 3UVIA 4E4PA 4LWWA 1VPYA 3B0XA 2HISA 5HMDA 2WZEA 1DQXA 1P4CA 1E55A 3SUUA 3DG7A 1R46A 2NQ9A 4GI4A 3S5NA 4Y90A 4FPSA 4GVHA 4JTUA 1B9BA 3AJ7A 3EDKA 4WZHA 1VEMA 2FKPA 3SCRA 4P5UA 5FSEC 4JX4A 3DKLA 1FFRA 1ZALA 3A3WA 1FX6A 3CNYA 1CLXA 1ADSA 2UY4A 3TNOA 1JCJA 4LAZA 8CGTA 2O9PA 2RJGA 3R0DA 2HE5A 2PLKA 2QUTA 5GPRA 4LUIA 3MT1A 4IUOA 4Q32A 3QN3A 2WSPA 2XN2A 3EKLA 1DJWA 1QO2A 3STFA 2HV5A 2BOFX 1YBQB 1AH3A 3K5XA 5TBOA 3TQVA 4IP5A 5D2XA 3CB8A 3FA4A 5JU6A 1EOMA 1DORA 5BOOA 3NZQA 5T9CE 1VBUA 1WUEA 3FJ6A 1O94A 2G3IA 4XIMA 2JIEA 3PFRA 4Q7BA 1P0DA 1RBOB 2ESCA 4YTSA 3RR1A 3BG3A 1JZ7A 5I78A 3AS0A 4ZTYA 2Y8KA 3VINA 1PX3A 3I10A 1FY6A 2PDFA 4EANA 1Z8AA 4UQDA 2XVGA 1M6JA 4H3DA 3WUBA 1OD8A 3SEPA 4AC7C 1TV3A 1O66A 2ZX7A 4DB7A 5J5DA 1E4MM 4RXGA 1QR7A 4AW7A 3ABRA 3CZLA 3TN4A 1P5BA 3BC9A 4TX8A 3CZ8A 3RYSA 1M04A 1G69A 2ZVRA 2VKZG 3BMWA 4OBRA 5DY3A 2R1PA 4WXZA 4PB3A 1DXFA 5E93A 4F3HA 3B8SA 3FXGA 3IVTA 4DF1A 3MCMA 5HWNA 1V4YA 3DXIA 3EEZA 2WHLA 1NQ6A 4MB4A 1E4LA 1I60A 1OX4B 4WD0A 4ZVJA 1TZ9A 4MNJA 3QHNA 3WLLA 5FF7A 1GTEA 5F2MA 3A47A 2GVGA 3CEPA 3PB0A 3MHFA 2IKIA 2V5DA 2ZTKA 3Q58A 1HKMA 2G50A 3S42A 2YBTA 3ZWSA 1B0IA 3VGFA 4N7QA 2AAAA 4PR4A 2IS7A 4ZA0A 2Y24A 1E0VA 4ERGA 5C9ZA 2NWSA 2P0IA 1R3QA 2PSNA 3AS3A 1ZZMA 1SW0A 5C2GA 3I6RA 4GUJA 4TMBA 4GUGA 1YDVA 4ERAA 4ZB0A 2PDHA 3HIJA 1GTHA 1TJ1A 4J1OA 1FDJA 2E5CA 4AZ7A 5DMLA 5HULA 3F5KA 1AODA 1QPNA 3ARWA 2PDBA 1HL2A 5LNWA 1ITUA 1Q7ZA 1BRLA 3M43A 1FHDA 1OG6A 1PXGA 3IUIA 1KA9F 3CPUA 5CSRA 4G5DA 3UR2A 4ZQPA 3U8GA 4QEEA 1EA0A 1XRTA 1EO5A 1GEHA 5HJYA 3K4DA 3OEXA 5D2VA 5MKGB 1VFSA 3KOZA 2J9XA 2ZZ5A 1H1NA 3EWBX 1AQMA 4M1BA 1ADDA 1S2TA 1ONWA 1RJQA 4A3HA 5A6BA 3POCA 3GXTA 3BCFA 1LOSA 4I6VA 1G01A 2GUYA 4LNYA 4AHOA 3F4DA 4XB3A 2X1RA 4M1RA 3T2PA 5GNZA 1E0WA 2QDGA 2GVLA 4GX9A 2IPJA 4CQ9A 1GJUA 4JHMA 2XWEA 3NJ3A 4FOUA 4RDYA 4ILSA 2OR2A 4H83A 1SFSA 3PK7A 4BQ4A 1E1EA 1FWGC 2POZA 2W63A 1W32A 2V30A 3WK3A 3WNMA 3RM9A 1IF2A 1R2RA 3BCJA 4FP1A 3OHIA 3N14A 3UWYA 1JGIA 3BMVA 1E1CA 3IPWA 3E0FA 1RAKA 4U10A 3GK0A 4G1KA 3BVJA 6A3HA 4CEXC 3SRHA 3KP0A 3NZGA 4RNIA 2B7NA 2PZ0A 2FJKA 9XIAA 1ZNNA 3OGVA 3FKKA 3GFXA 1UH4A 1EWEA 3I65A 3M64A 3QMSA 4MFEA 4D71A 1E5JA 1UPMB 5BU9A 1DPMA 1TTJA 2BV9A 4JCLA 1NU5A 4WDXA 3KL5A 3DG3A 3GTXA 5DO8A 2ISVA 4EACA 3MWAA 2CU0A 4F2UA 5HMEA 4JXCA 3A21A 4UNIA 1C92A 4UTMA 3RLHA 3W7EA 1K9FA 4ORIA 1S5WA 3W2NA 1TELA 5D2WA 3UJFA 4KFPA 4L4MA 3CK5A 1C8VA 3PTQA 2NT0A 4OOZA 3WF0A 1EC8A 2D2HA 5HUOA 2VCCA 3KCOA 2XYLA 3HTWA 3W72A 1E3XA 5AY7A 4CD6A 2CLFA 2A5HA 4GZIA 3VIOA 1Q3NA 1EH9A 3G0UA 4XZHA 2AOSA 4K39A 5HQMA 1B3OA 3DN5A 1JYNA 4Q7NA 4V15A 1R3SA 1V3KA 4RLIA 3OJGA 4TX9A 4HYWA 2Y89A 3W82A 4Y9AA 4RV8A 2GGIA 1W17A 4ZSTA 1LWIA 1IR1A 2O92A 4MZ8A 4S38A 4CNNA 3ZJ7A 3TZNA 4Y9MA 2QUUA 3WQ5A 1JRCA 2NQZA 4TO8A 1JCNA 2W61A 1AQHA 3BW2A 3R94A 3UZYA 3Q45A 3PZMA 4W8LA 3W6MA 2FHFA 3MBDA 3ZS4A 1RV8A 4IUGA 3EX3A 4J28A 2NUYA 1Z3NA 1GW1A 1K77A 3WMBA 4OOUA 3VOFA 1AZ2A 2DIEA 2H9AB 4Y8EA 4V1XA 3FOKA 3W23A 3O15A 5FJTA 3PBMA 3CMGA 1O12A 1TA3A 1Q13A 4GZEA 1JUKA 4EXQA 1ICPA 4M51A 1KLYA 1DJZA 1KBIA 4QISA 2YLAA 2XH4A 3HMCA 2XIIA 1QI5A 1Z48A 4DVOA 1QHZA 2VEPA 4O11A 1NWTA 3G24A 4AIEA 4KBXA 3T0TA 3NPXA 5I7GA 2C6QA 1B3ZA 4IIDA 3EX4A 2EG8A 3M0VA 2C15A 4C5YA 4FALA 2A3LA 3W25A 2ISDA 2W27A 1YMYA 1PUDA 4WGXA 4A3QA 2X1TA 3QJAA 3OBEA 3IUDA 3RLUA 2MNRA 3M5XA 3IVUA 3TU9A 5B80A 1ZJHA 3ZSTA 1Z69A 2ACUA 1QPRA 1W9DM 3GZAA 3EWZA 4MNMA 2J6XA 1LCOA 1QW7A 1BVZA 2EPMX 1AW1A 4NT0A 4MADA 4XKYA 1UZHA 2A7PA 1BQGA 1J18A 5LZLA 4ADSA 4AD0A 2BTMA 3B9OA 4IG2A 3SIMA 4HJWA 4L1WA 1R6WA 3BSMA 4C6KA 1L8PA 2ACQA 3N04A 3RLGA 3LZ5A 3GNXA 4LJ3A 2FQIA 2OZ8A 1IIGA 3AIVA 3NG3A 3RK8A 3PPCA 2D73A 4QR6A 4MYAA 4S3FA 1OM0A 4UNKA 1Z89A 4PL1A 3EOSA 3ORWA 3QSRA 1P0NA 3A9IA 1ZCOA 1H51A 1WDPA 1QOQA 1KFJA 4PL2A 3G77A 3DC0A 2QCDA 3CUXA 3O0FA 1HO1A 1A47A 4Z2GA 1C8YA 5E0KA 4HNNA 3M0LA 1JD9A 2EGZA 3TYDA 1PE1A 2ZTJA 3APTA 1AJ2A 4IGMA 4WX2A 2P8BA 3F4CA 2NV2A 4G1NA 2VYOA 3W7DA 2HNEA 1E9IA 1E56A 1KKOA 3NSXA 3OB8A 3QGVA 4N42A 2HRWA 3P0XA 4IMCA 2ZRZA 2A3EA 4IPJA 4YPJA 1Y7VA 1EJ7L 3FNDA 4XZNX 2YXGA 4RW3A 4GA8A 3VZYA 1AH0A 4IIGA 1MDLA 4IP4A 1JUEA 3W75A 1ZJBA 4ZQCA 4E2OA 4R53A 4ZB5A 4QDMA 2FHBA 3WLPA 2ZX5A 4GIYA 1E6SM 4LCSA 3PG9A 1X1OA 3O6YX 4LAMA 1QOXA 4S2BA 5CKSA 1KBLA 3KOYA 4HCHA 3DCPA 2OO6A 1CXFA 4UTHA 3AC0A 1SMDA 3PFMA 4LVAA 2ZXQA 4K8HA 2CERA 4LY8A 2PDCA 3UVAA 2CLKA 4HJFA 2PCQA 2GGHA 4JN8A 1R85A 2Y88A 3QZ6A 1BGGA 3ARUA 3E5PA 4FOJA 4YIWA 2VEKA 2C71A 3U4FA 3N73A 3UR5A 4A22A 4D6IA 1S2UA 5BWFA 3RGTA 1GG0A 1IXNA 1V08A 1QNSA 4TOQA 1CW2A 2X09A 3E2RA 3AZRA 1CYGA 4JTIA 5D09A 1HQTA 3VIMA 4PUWA 2X40A 4MM1A 4N2YA 2P3ZA 2OSYA 5IHRA 3SY1A 4BF7A 5D9PA 2C91A 1JPDX 3K4WA 1LOLA 3TZFA 4ZENA 2NQHA 1UIOA 3UESA 1EIXA 4J2PA 3N29A 3GBEA 4L6HA 3DFYA 3ZVHA 1T6MA 3WQCA 2PWVA 1NH6A 1BRLB 2QJNA 1RVGA 2NUXA 1NEYA 3SRDA 2F9RA 1GKPA 4UFHA 4AMAA 4JAWA 3BAKA 3GIPA 1QNPA 3QR0A 1RXOB 4PC8A 4P7RA 4R27A 3C0LA 4PUJA 1FWTA 2VEIA 2CEQA 2C1GA 1JVNA 3HPXA 2OVLA 4ADUA 3GIQA 1SVDA 3P74A 3WEMA 1L6GA 3W7HA 1PYFA 1YXCA 5B7YA 4F9DA 1R47A 1XM3A 4NZ1A 1FBAA 3GHTA 2WBKA 1EO7A 3S4TA 4P8VA 2GDVA 3MKCA 3UPWA 3CV7A 1Z6KA 1MXSA 1TREA 1FOBA 3WQDA 5CGMA 2AQOA 1FWWA 3G1VA 2ZXDA 4AVFA 2W66A 1XPGA 5CZ0A 4DPQA 4C1LA 3LENA 4UB9A 4HA0A 1C29A 2YPIA 3TNBA 4NJJA 3E12A 4LFYA 4HP5A 1S39A 3ITLA 1KLZA 3AMDA 4DJFD 1JD7A 3EPOA 3SN0A 3JVAA 4HYRA 1N7KA 1XICA 3P7YA 5EL1A 2B31A 3AIEA 3H4XA 1E1CB 1MUWA 3IAPA 4DN1A 1GUVA 1CPUA 5FOOA 2GJXB 1CB2A 1SU5A 3KZPA 4P8XA 3U0HA 5I07A 5DLCA 2C1HA 3WD1A 4PMRA 1XINA 4ZODA 2CITA 3QMRA 2JK2A 1YTDA 1MXDA 1ONXA 3L12A 1TCDA 5LIWX 1H7WA 2PA6A 4HNCA 3CEUA 1SO3A 4JD4A 3N2CA 1PTGA 1GOKA 4B5TA 3ES7A 1VCFA 2YZ5A 4IMAA 4MGGA 2PE4A 4DO5A 1OC6A 2XVKA 4GFIA 4KGLA 3NQFA 2CLHA 2R1LA 1VPXA 3G8RA 1OX6A 3TVAA 3BXWA 1J0JA 4D9PA 3TTOA 1XLFA 4K1WA 3NYZA 1S2VA 4DWSC 1EJSC 2CYGA 4ML4A 4L7ZA 3E96A 3AMCA 4HU4A 2D23A 5EBUA 4UTWA 3FEQA 5H8MA 2VWTA 2P5NA 2VO5A 5TAOA 4DPPA 5CJ5A 3PAOA 2XU2A 3T7VA 1EEXA 1GQJA 2QJIA 4PODA 3CQJA 4IFKA 4RE0A 4DLFA 3WQOA 1LWHA 5CAHA 1UWAA 1L9WA 5ABFA 4B92A 4MKVA 4W87A 3NEVA 3VFCA 1R3RA 1X1ZA 1D9EA 3ZZ1A 1GOXA 3E9AA 2CIPA 2OLHA 3OQ8A 4Q4OA 3GDTA 1CXLA 4GC3A 2XJ7A 4IICA 1UBPC 5KITA 1LJYA 1QNOA 3GXPA 3G2GA 6XIMA 4D6DA 5H6HA 4GRSA 1ZU8A 2V3GA 3NQAA 4YMZA 5F2IA 2E1WA 1BSIA 3BQ6A 4WRHA 4X9YA 2J4GA 3POHA 4BQ2A 1ODZA 3GR4A 3W7KA 1QTWA 1REQA 3NPUA 1TA3B 2QKFA 1QVBA 2XIBA 4FS9A 4KEZA 3S2JA 1VYPX 3AO0A 1QHOA 1LT7A 1MZHA 4AF0A 4AXKA 1ZBVA 3H2OA 1NAL1 3MV01 3WD0A 1DJGA 4IQEA 3A13A 3NQEA 2QLYA 3WK2A 1FXQA 3UYIA 1KRBC 1WDSA 1VFHA 4K8EA 4EOUA 1YNQA 1WDDA 2IMRA 1TUFA 1M01A 3SSJA 4EK7A 1G7UA 4KWUA 1VR6A 2HS8A 1VCVA 4GK8A 4W5ZA 3BMXA 4DO6A 3UG3A 1BD0A 3AHYA 2DSVA 3GNPA 3QF0A 4XKYB 3DZ1A 1Q6DA 1SFTA 3STGA 3C3NA 4RPPA 1J5TA 2QXWA 4IG2B 4US6A 1EBGA 1UW9A 2C0HA 4KW2A 1H1YA 4BI5A 5BXRA 3M1ZA 2CBIA 4JIIX 1EGZA 1H3GA 1VBHA 1UC4A 4QG6A 2P1FA 3F2BA 3ZXWA 1XD0A 2YDQA 3STCA 4H9TA 1SPQA 4GZJA 3W83A 2YR1A 1V7AA 3V18A 1IZCA 3GW3A 4NX5A 3H7RA 4INFA 3XIMA 4DJED 2WXDM 1T8QA 4UFLA 3R8RA 2OEJA 3IV3A 3EB2A 1KFKA 3WSUA 3LPPA 4UTJA 2ZX6A 1JAEA 2QCDB 3GE7A 4DYEA 1HP4A 4LYKA 2VFIA 4AD1A 4RJEA 4PULA 3JUGA 2KZHA 3AHXA 4MF4A 4CD8A 1ZAJA 2GGEA 4Q8UA 1RBAA 4GKLA 5BXPA 3KBVA 1K8CA 1WAUA 1WA3A 4AZCA 2HBVA 2VFHA 1P0EA 1OWQA 2Q02A 3O1NA 3TWAA 1GHRA 4NKCA 4IQLA 2IQTA 5M5DA 2RUSA 2V5BA 2VELA 1XYAA 1J6OA 5E9AA 1IXOA 3T07A 3AMKA 2C0AA 3CASA 1G9HA 2HCVA 3FIGA 5C9XA 1VFTA 2F6XA 3A4XA 1VD6A 3CZJA 3ID7A 4DYKA