3PBMA

The crystal structure of adenosine deaminase in complex with chloropurine from pseudomonas aeruginosa
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
313
structure length
313
Chain Sequence
YEWLNALPKAELHLHLEGTLEPELLFALAERNRIALPWNDVETLRKAYAFNNLQEFLDLYYAGADVLRTEQDFYDLTWAYLQKCKAQNVVHVEPFFDPQTHTDRGIPFEVVLAGIRAALRDGEKLLGIRHGLILSFLRHLSEEQAQKTLDQALPFRDAFIAVGLDSSEVGHPPSKFQRVFDRARSEGFLTVAHAGEEGPPEYIWEALDLLKVERIDHGVRAFEDERLMRRLIDEQIPLTVCPLSNTKLCVFDDMSQHTILDMLERGVKVTVNSDDPAYFGGYVTENFHALQQSLGMTEEQARRLAQNSLDARL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenosine deaminase
publication title The crystal structure of adenosine deaminase in complex with chloropurine from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 121
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.5.4.2: Adenine deaminase.
pdb deposition date 2010-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3pbmA00
3DUGA 1POKA 3TN6A 3LSCA 2UZ9A 1IE7C 4C6FA 4CEUC 1FWFC 3CJPA 5A6TC 4KESA 4ZSTA 1V4YA 3IACA 4MUPA 3E2VA 3GU1A 5FSDC 4ZSUA 1KRBC 3E3HA 2FFIA 4IQJA 4AC7C 1NFGA 3QY7A 3TN5A 3LU2A 4DLMA 3F2CA 3T8LA 4GYFA 4RDYA 2HNHA 4XAYA 4D8LA 3OQEA 1RJRA 1FWIC 1QXLA 3HPAA 2WJDA 3T1GA 4C6OA 1EJTC 4KF1A 2FVMA 2YB1A 3QGAC 2EG6A 4R88A 4J2MA 4C65A 4HK5A 1EZ2A 4QROA 2R1LA 4I6VA 4C6JA 1M7JA 3LSBA 2HPMA 2AQVA 3B40A 4UB9A 3MVTA 2Q01A 4DO7A 1KRAC 1VFLA 4ICMA 2FVKA 4INFA 3LS9A 2AMXA 2W9MA 1EJSC 4GK8A 2P50A 2ANUA 3AU6A 4I6KA 5LXXA 3HM7A 4AQLA 1EJWC 3O0FA 4P5UA 2FTYA 3G77A 1J6OA 3GTHA 4RZBA 2EG8A 4ERAA 1EYWA 1K1DA 1FKWA 4H9YA 2PAJA 4LAKA 1R9ZA 2Z28A 3IV8A 2EG7A 1FWEC 1W1IE 1UMLA 2Z4GA 2BGNE 2ZC1A 4IFOA 2VM8A 3UF9A 3MPGA 2QS8A 2XIOA 3E0LA 1ONXA 4DZIA 2CZVA 4KQNA 1DPMA 4CNUA 3IARA 3F2BA 4C6IA 4C60A 1EJXC 4IF2A 1XGEA 3MKVA 4C6QA 3E0FA 3S2LA 4PE8A 4GY7A 2R1KA 4C5YA 4NP7A 4R7WA 4B3ZA 1ITUA 3FDKA 1KRMA 4JOMA 4WHBA 3QGKC 4LCSA 4H9UA 4LH8A 1UIPA 4B90A 4LCRA 3QY6A 3GRIA 3MDWA 4XD3A 2IMRA 4KETA 3NURA 4Z42C 2GSEA 1A5NC 4DI9A 1NDYA 3ID7A 5E5CA 4QS5A 3O7UA 1RJQA 4EPBC 4YIWA 1A5MC 4PBFA 1EF2A 4KEUA 2O4QA 3LY0A 4EPDC 4C6MA 1A5KC 4H9TA 1BF6A 4IG2B 1P6CA 2YZ5A 4XAZA 4LAMA 4DLFA 2Q09A 4H01A 3TN3A 1POJA 3S2MA 1YIXA 3F2DA 3PNZA 4BY3A 1K70A 2OGJA 3GTIA 3WYZA 2R1NA 2Z25A 4GY0A 2R1PA 4L9XA 1RJPA 2VR2A 2DVUA 5HMEA 4DYKA 1EJUC 3S2NA 2YB4A 4PBEA 1PTAA 2PLMA 3GTFA 1K6WA 2WJFA 1R9YA 4DIAA 2GWGA 1J5SA 4V1XA 3FEQA 2OOFA 4C6BA 2A3LA 1J6PA 1M65A 3TN4A 3C86A 3PANA 1RK5A 3IJ6A 4WVXA 1E9YB 3PAOA 1NDZA 4LAOA 3EWDA 3KM8A 4IFKB 1GKRA 4KEVA 1I0DA 1YNYA 3RCMA 2VC5A 2D2GA 2Z27A 2UBPC 3SO7A 2AQOA 3GU2A 3LGGA 4XD4A 3PBMA 3JZEA 1S3TC 5HMDA 1A4MA 4HK7A 3IPWA 1KRCC 4RDZA 4HA0A 4C5ZA 2FTWA 1I0BA 3RHGA 4F0RA 3B0YA 3A4JA 1V51A 4BJHA 4G7EB 4L6DA 3NQBA 3CAKA 1V79A 4LFYA 3CS2A 3T81A 3URQA 4LCQA 4IGNA 4CEXC 1V77A 4H9XA 3OJGA 1XRTA 1NDWA 4LANA 2F6KA 4NI8A 2HQAA 3EWCA 4CQDA 3DC8A 4PCNA 2Z2BA 4HJWA 1R9XA 3GIQA 1KCXA 4XAGA 3UPMA 2OB3A 4F0SA 2HBVA 3GIPA 1WXZA 1YBQB 3D6NA 3OVGA 2HBXA 4DNMA 5CH9A 3UR2A 3B0XA 4RDWA 2I5GA 3URBA 5FSEC 1A5OC 4C6EA 2Z7GA 2HPIA 2ICSA 2DVTA 1RA5A 2E1WA 4GBDA 5G4HC 1A5LC 4KERA 4H9ZA 3F4CA 4V1YA 4IFRA 1PO9A 2Z29A 4C6CA 4IG2A 3A3WA 3IGHX 3SFWA 4J35A 2PUZA 3MSRA 1A4LA 3AUOA 1UIOA 2Z2AA 4GZ7A 2I9UA 1FWJC 2ADAA 3S4TA 4WGXA 3WMLA 3F4DA 2PGRA 2YXOA 1YMYA 1FWHC 4ERIA 2DVXA 4F0LA 3K2GA 4QTGA 1ONWA 3UR5A 3K5XA 3E38A 3URAA 4GY1A 3IRSA 4GOAA 1FWAC 2GWNA 3K4WA 4C6PA 3TNBA 3LGDA 3WZ0E 4CNTA 4XD6A 4C6KA 4QSFA 3AU2A 3NEHA 3S2JA 4IFKA 4KIRA 1J79A 3EGJA 1WXYA 2Y1HA 2Z00A 1RK6A 3OU8A 1QW7A 3HTWA 3DCPA 2KAUC 4EPEC 2WJEA 2R1MA 4E3TA 1JGMA 2VC7A 3GG7A 3MJMA 1ADDA 3GUWA 1EJVC 4HK6A 1ZZMA 3RYSA 4IGMA 1HZYA 4EP8C 1GKQA 2G3FA 4G2DA 4B91A 4DZHA 3E74A 3GU9A 1FWCC 2P53A 2WM1A 4RDVA 4EPKA 2BB0A 1XRFA 4G7EA 3URNA 4TQTA 4J5NA 3MTWA 2OODA 2Z24A 2GOKA 2PGFA 2E25A 4C6DA 1O12A 4IH3A 2VHLA 4ERGA 1V7AA 4GX9A 4PCPA 4H9MA 2D2JA 4B92A 3ISIX 1RA0A 1GKPA 3OODA 3RN6A 1FKXA 3FDGA 4M51A 1E9ZB 2OQLA 3N2CA 4H00A 4BKNA 1FWDC 2GZXA 4KEZA 3MVIA 1EJRC 4RE0A 4QRNA 3BE7A 4CNSA 1UBPC 2VUNA 3ICJA 4UBPC 2O4MA 3LA4A 4QS6A 3R0DA 1YBQA 1FWGC 2QT3A 1RAKA 4LEFA 3V7PA 4R85A 1FWBC 1XWYA 5AKQA 4DI8A 4OFCA 3MDUA 1PSCA 3OOQA 4CQBA 1M68A 4GXWA 4XAFA 1O5RA 4LALA 4C6NA 3PNUA 1PB0A 1YRRA 3GTXA 4GX8A 3LNPA 3ITCA 4NG3A 4XD5A 4C6LA 5HMFA 4H9VA 2RAGA 3QY8A 1ITQA 2QVNA 1NDVA 3ORWA 3UBPC 4CQCA 1P1MA 2D2HA 2QPXA 3A3XA 4GC3A 1P6BA 2Z26A
chains in the Genus database with same CATH superfamily
3T7VA 4AAJA 1IZJA 5G1TA 1QW8A 1J9YA 3CJPA 1DQUA 1V4YA 2DZSA 3IACA 1G6CA 1GORA 1TELA 2E3ZA 1G0CA 3FOKA 5A6AA 1WKFA 4O1CA 3ZJ7A 2G3NA 2VZVA 2NX3A 5JH1A 4XKMA 2OYMA 4A8NA 3WQCA 4IIGA 3FJ6A 6ENLA 3N13A 1XBZA 2AGTA 1KW1A 4KRTA 1ESWA 5ECUA 1ZY9A 3W38A 3W7OA 3LCFA 1VEOA 1AJZA 4IUGA 5BZAA 4JTGA 3WKZA 4UIOA 3ZR5A 4ZQPA 3MVTA 3WEZA 4AIBA 2DV0A 3QVQA 3WMCA 2XISA 1VFLA 3PPGA 1WDPA 4INFA 3QC0A 4AEOA 3DHFA 3IIXA 3NG3A 1X7FA 4URIA 3SADA 4LT9A 5LXXA 2YXXA 4ZL1A 2CXGA 3QXBA 3O0FA 2VEPA 3B0VC 2R8WA 4D1JA 1PKYA 1K1DA 4ZCWA 5AHMA 3H53A 3RX3A 4X0VA 1Z6KA 2XFRA 3BAYA 1SUXA 4IFOA 4MZ8A 4QP0A 1V03A 4IMAA 1HUVA 1QPNA 4DJFC 4KIEA 3KWXA 1QPOA 1LL4A 3OG2A 1XGEA 2L5HA 2W62A 1DWIM 2DY3A 3COTA 4W89A 1K8ZA 4K68A 2A85A 4Q8OA 2OFJA 4K2SA 2V5DA 2ATMA 4GNJA 2P0OA 3MC5A 4Q4OA 1BFNA 3QGKC 3IGSA 1H09A 1UIPA 5HJXA 1M41A 4U33A 4FAMA 1M7OA 3CMFA 3GZAA 1XLCA 4QIUA 2CZEA 3WLLA 1O94A 3O7UA 4YIWA 5HAOA 2J4GA 4BQ5A 4PMOA 5DMLA 2CW6A 1GVEA 1LLZA 4DLFA 3D47A 4O54A 4K7VA 3ZSSA 1DJNA 1Z9AA 3G0UA 1OHLA 3SB0A 4QE5A 1YNPA 1HT6A 1PIIA 5CGMA 5GPRA 1MQPA 4K8EA 5REQB 2FJUB 2YJQA 1V6TA 2QJJA 2X40A 2V38A 3IJLA 5TIMA 2BOEX 1FWWA 1H0GA 3QRHA 1D7KA 2UY4A 4AIEA 2I16A 5KTLA 1W5QA 1J01A 2NT1A 4DPQA 4JAWA 1RY8A 2NV2A 1KXHA 1MMFA 2ODOA 3QLLA 4BR1A 3B0UX 5CPTA 2ZWYA 1QUMA 4Q8MA 5FOOA 2VO5A 1S3TC 4ZR8A 2PTDA 4HCLA 3O3RA 1H0IA 3E2QA 4HA0A 3P3BA 1XV8A 5ABTA 2GUYA 3RLVA 2RDUA 4HYRA 3B0YA 1PXGA 4L61A 2FQIA 1X96A 2NVCA 1GG1A 1VFOA 2GPTA 4IGNA 3CHDA 1M04A 3TMLA 3CLWA 4UOQA 4M6QA 3NQMA 1JCYA 3OLGA 2V2DA 1X6NA 3M0HA 1G4SA 3U2OA 4NAFB 4WXZA 2ZUVA 3QHNA 1W5NA 2W4XA 3E0VA 4CQDA 1DP0A 3T0CA 1TX0A 1RVGA 1WAWA 3MANA 3UY7A 4F0SA 1DJXA 4B5UA 3O6CA 3WQFA 4WSJA 1GVFA 1A5OC 2EPHA 1V3LA 2Y6ZA 2ABBA 3IAPA 3EPOA 4IG2A 1HKJA 2WKGA 3UJFA 1BG9A 2TAAA 3WQGA 3C4UA 4H7CA 2V5LA 3TFXA 1FP8A 2ADAA 2XIJA 4GH3A 4ORIA 4Q6XA 2ZZ3A 4DWSB 1LT7A 4KRUA 2PDJA 3N29A 2FDMA 4AD4A 3M47A 5I78A 1JCJA 4FLRA 3RU8X 3LTYA 4RV3A 4GKLA 3GVRA 1ZBWA 3SSJA 3UWVA 3B8UA 3GDMA 2ZKMX 3CEUA 4KIRA 2CESA 1PYMA 4NVTA 1YYAA 2BXVA 4TVCA 3DCPA 4I5UA 3KL3A 4TXEA 4PC8A 3RPDA 4CD6A 3O8AA 4FZIA 4HHPA 4BS0A 3U8GA 3OA5A 3RFAA 2WVTA 1C7SA 4O10A 4DX3A 5D33A 1TMQA 4S3EA 2XWEA 3WLMA 4PTXA 1U5JA 4XUYA 2Q8LA 3VAVA 4IP7A 3O9NA 4AIOA 2PDUA 5A6JA 3C3UA 4O4VA 2CWNA 1ZL1A 1A50A 1EYEA 3RN6A 1ISZA 1GUVA 2W92A 1E9ZB 1JGIA 3H70A 1UD3A 4QRNA 4W9TA 5EMUA 4QNEA 1KR1A 1K8XA 1K02A 4O0KA 2J62A 1FWGC 1IXOA 2BHZA 1OINA 1JYNA 5K7JA 4ZA0A 1JAEA 5AC6A 4B5NA 2ALRA 1XFBA 2OPJA 3R8HA 2NWSA 4MDOA 1N82A 3RITA 4GIYA 4JNYA 3OHIA 1JI1A 1WBJA 1JQVA 5KINA 3S46A 1ZGDA 5BRQA 4LF2A 2OYKA 4IJBA 4JX5A 5AYZA 1Y65A 4NAEA 4O15A 2PEVA 1HKMA 3TJXA 3M41A 4D8AA 4E6MA 3ZOAA 2D2HA 3UWZA 3A3XA 3B03A 4C6FA 3EXTA 4CEUC 1BVNP 3UVIA 4E38A 4ZXLA 4A3YA 4AMCA 2PDNA 3FV9A 4DLMA 1RCQA 4YYCA 1WDRA 4PL1A 3NPWA 2XFFA 1FY6A 3BSGA 3G6LA 4BFAA 4FS9A 2WC3A 3QGAC 4HNLA 2NVAA 3C0QA 4P7QA 4W7UA 1KWKA 5I7GA 1J18A 2PF8A 3R5EA 1TJ1A 3DYPA 4GI6A 2GQ9A 3JVAA 2F61A 3WO8A 2XIBA 1A5AA 2CLFA 2GGJA 5B7ZA 3NM3A 1VKFA 3W2LA 1N7KA 3WBWA 2P0IA 1LBFA 4JYDA 1WDQA 2DORA 4AVFA 1J6OA 3AFBA 1TSIA 4ERAA 2WZIA 4ZVJA 4B9YA 4FI4A 3WUEA 4UTUA 1FKWA 5A8NA 1SYTA 4ALDA 3FW6A 1R9ZA 2EG7A 3CZ8A 3SUUA 1W1IE 3LCLA 4CN4A 2PFHA 3E0LA 4GZEA 1DPMA 2Z1SA 1H1ZA 2ZX9A 3BOFA 4ICNA 2ZA1A 3LPPA 2Z6JA 1EWDA 4H04A 4MNMA 3ZYZA 1B4KA 3WJYA 3HZ3A 2FB2A 1UP3A 4HHLA 1PX4A 1FOBA 4G1NA 5DT5A 2DU2A 2G3IA 5M3WA 3L65A 3MUZ1 4W8BA 4DO5A 3AICA 1X1NA 4B90A 4LCRA 3QY6A 4QJ1A 1X39A 1YXCA 4CCZA 2VEGA 4DO6A 3VGDA 2WW5A 3QPEA 4OV9A 4EXAA 1DTUA 4BWLC 4C6MA 2ZX8A 2TSYA 2ZRZA 3WJZA 1SZRA 3LTPA 1P6WA 4WDWA 4FLOA 2OGYA 1HJVA 3NGFA 2OGJA 3HGRA 3HIJA 3GDRA 5G1MA 3ARSA 5FEPA 2JALA 2P1FA 3CT2A 4L80A 4E2BA 4C6BA 1M65A 1XCXA 3GC5A 4S3FA 3P5YA 3RMJA 3POHA 4MLJA 3CUZA 4QAWA 3BOXA 2WWDA 3M0KA 3G1SA 4BI6A 2ZVIA 4TX8A 3GXMA 4XD4A 1QNRA 2PSNA 4LS0A 5GVJA 1XF0A 2ZYFA 4XKYA 2A79A 3L4ZA 4R3UA 3P2VA 4QQ3A 4ZQRA 4RDZA 1A3WA 2FFCA 3W00A 1NOWA 1RSCA 3CXOA 3AIVA 1H1YA 3NQAA 3VKCA 4CNNA 1J0KA 5AC5A 1US3A 2Y8VA 3PJTA 3THAA 1XDJA 3MV01 1CGTA 3BLFA 4RLIA 1SR0A 1F76A 2UY2A 1HJUA 1W9BM 2FZDA 2XDFA 5D2VA 4LANA 3STCA 1XBYA 5BROA 3CEPA 2P8BA 2HS6A 4QBXA 4QR6A 3WH6A 4Q8VA 2BP1A 1E71M 7ENLA 2PP1A 2XIIA 4GXPA 4P7OA 4E4UA 2DFAA 2YCEA 2YSWA 4KKXA 3POCA 3DEQA 3WK2A 4P2VA 3USBA 1E1CB 2V69A 4X2RA 2QDHA 3WF2A 1RUSA 4J35A 1B9ZA 3B8DA 4Y9MA 2D23A 4GZ7A 1SO4A 1MQQA 1IZKA 3BL3A 2E67A 2QCMA 2FIQA 5CJNA 3GR7A 4AX7A 3K2GA 5CKSA 1RD5A 5BMXA 1O1HA 4NRRA 3U2CA 3L0KA 2XN2A 1VCGA 4FNSA 3P14A 3GH4A 2GQ3A 4IPIA 4GVIA 3WZ0E 3M64A 3WQOA 4HN8A 1BSIA 4O17A 3UYIA 1J79A 1TMHA 2FVLA 3W1XA 1QW7A 2ZRWA 2R1MA 1DJHA 2BY1A 5DXYA 4XZHA 1L6YA 1VCVA 3LGEA 2J7CA 4O1DA 2G3FA 1Q5MA 3CLMA 2VKZG 4CD7A 2NZLA 3GFYA 4B91A 1XC6A 3VNZA 4D71A 2WM1A 1TPFA 1ADSA 3XINA 3A9BA 4Q3MA 3QC3A 4AFYA 1US2A 2G95A 1O5QA 4AF0B 3THUA 5EB8A 3BGGA 4LUSB 1V7AA 2PURA 3DGRA 1MQRA 4PCTA 4PFMA 3VYLA 2YDRA 2YLLA 1KFWA 3APGA 1CWYA 3OZYA 4CNSA 4M19A 1Q66A 2VOMA 4S3JA 4PMVA 3R0DA 3WENA 1UP2A 4JXCA 1L0PA 1FCUA 1KTNA 1K6AA 3BAJA 4GKTA 2ZXBA 2J8TA 1MXGA 5GNYA 4BZYA 2CZDA 5CAHA 1JI2A 1KTBA 3AIBA 3PNUA 2WHLA 1K7EA 4HPNA 2OLAA 3IUDA 4PUNA 5TD4A 1TTPA 4PBGA 3THQA 4GQRA 4EK7A 1C8VA 3AIWA 2FDSA 2E6DA 1M5WA 3P81A 3VOHA 4MB1A 2PPGA 4D9PA 2FH6A 1F3XA 4HNTA 4X60A 4D6FA 3GFZA 3EX6A 2QGYA 5C6MA 3ARZA 3G3MA 2OX4A 2OEJA 4NZ5A 5DX7A 3NL6A 4KESA 2QYGA 2HRWA 1KRBC 1JEZA 3FGCB 1JCNA 4TIMA 4TV6A 3VMOA 3C6CA 2V82A 2YFOA 3ONCA 2GK1A 3T8LA 1NU5A 5JIPA 5H1WA 5CPMA 2FH8A 1VCFA 3C61A 2AAAA 2WVSA 4KF1A 1RP9A 3OBKA 2EKCA 3M44A 3OO2A 1H5YA 2IXUA 1XICA 2J6VA 1PEZA 1P7TA 5L9FA 1E4MM 2B7PA 4UQCA 3VD3A 1YLVA 1Q6QA 6PTDA 3INPA 2ANUA 2JQXA 3SW6A 4OOUA 1I75A 3AWOA 4ZZ9A 3E2RA 1E4LA 2EJAA 3E5PA 4IICA 3H2MA 3P93A 1W5PA 4NIRA 3LCXA 4BQ2A 2XVLA 2YL5A 4BEQA 4DUXA 3ZS4A 3QBUA 4H41A 2G96A 3V16A 3ANUA 3DFNA 2PWDA 2QAPA 3VGFA 1XQKA 3I4EA 5HNTA 3VIOA 2PMQA 5F2IA 2CCRA 4HZ6A 2EKGA 4F8XA 2IKGA 4HYWA 1ML1A 3AZRA 1R3RA 2A3BA 1KXQA 3LLFA 1EP2A 3LG3A 4Y96A 4PZVA 5E6ZA 3S5ZA 4F2BA 2VZUA 1BYAA 1NIUA 4B2DD 3QJAA 4XIMA 1SFSA 3UJRA 2A3EA 2H6RA 1GQJA 4QE4A 4HBKA 3TTSA 2J8GA 4JY9A 2O4QA 1MXSA 4EPDC 2VQTA 3VM7A 1B31A 3VIHA 1T8XA 5AFDA 4IPPA 1QI3A 3WELA 1UW9A 2ZA2A 3PNZA 3BH4A 1E70M 4DJDD 2HVMA 2OX1A 2Z25A 4BHYA 3H21A 5M1TA 2C19A 3LZ5A 1H61A 3BLKA 3NZ1A 1AH0A 3S6DA 1KR0A 2FHBA 1BKHA 2WHKA 4GPNA 4S1FA 1PKMA 5CZJA 3WJSA 4YPJA 2GSHA 4GZJA 4AWEA 4R7JA 5A6LA 2ZX6A 1ITXA 1QBBA 4ZE4A 4ES4A 1VRDA 3RCMA 4QCFA 2X1SA 1V3MA 2OQHA 3PBMA 2WBKA 4Q4PA 1CX9A 3AYTA 3M7SA 4ICCX 3UQNA 1EA9C 1IQ8A 3H2AA 2QIWA 1BVWA 5FEXA 1OADA 2NV9A 3VXGA 3NVTA 4PMYA 6REQA 1H7XA 2FZ8A 2X7WA 5DN1A 3GVQA 4G7EB 4UTWA 4L6DA 4GE8A 3KEHA 5EMMA 7REQB 1UD8A 4CEXC 1ZBVA 4JTRA 1SJAA 4AB4A 4B9ZA 4UMAA 4MOZA 2ZRYA 3RG6A 3NOYA 2HDJA 4J4KA 4NNBA 3B97A 3AS1A 4FXRA 1F3WA 1ZLPA 3H7VA 2ZUTA 3SURA 2OB3A 3GKAA 3WEOA 2BFGA 5IDIA 2ONEA 3OVGA 1XLLA 1OZMA 3UR2A 5GJNA 5A94A 4HJFA 1HVQA 2HPIA 5AECA 1FWTA 1EEPA 3S1UA 2Y5SA 3VNMA 3BXWA 4UWMA 1AJ0A 4WRHA 1R0MA 1YQ2A 1X98A 2QCDB 1KM3A 3S4TA 2O7SA 2QCLA 1FWHC 3S5NA 4UNKA 1LWIA 3HG4A 1TRIA 5HPCA 1F7BA 3URAA 4PSPA 4ZQMA 3IVUA 3K4WA 5XINA 3WLPA 2B7QA 3L4YA 3R1ZA 3QMTA 2XZ7A 8XIMA 3EGJA 4XB3A 2R6OA 4L1GA 5KZEA 2FPTA 3VDBA 2BHUA 4LB3A 2X1RA 4JIHA 3BO9A 4NUWA 2D0FA 5CJMA 3A4AA 2W63A 3MJMA 3W3OA 2O9OA 4IQLA 3C8FA 1UH3A 1XKYA 2KX9A 3NOEA 5E0CA 4PMDA 5LIXX 1GOIA 3VOIA 1JDEA 1RCXB 4UTTA 6XIAA 2C8NA 3ZVHA 3T08A 1T8QA 3GU9A 1FWCC 3L0NA 2QDGA 3GNOA 5CPOA 5FJTA 2C6QA 5G2HA 1R3TA 2OODA 4KWWA 1O12A 4WSKA 3R0KA 2FTPA 1ZJBA 2V3DA 4W5ZA 4MYAA 1XYBA 1T96A 4IGHA 2OQLA 4PULA 4WQ6A 1TCDA 2NSXA 1C8QA 3PTKA 3WEMA 1KQYA 3TA6A 4PFHA 4Z2GA 4QDWA 5AB3A 3ZMRA 1KGWA 3SY1A 1TA3A 2VUNA 2VUYA 1XCFA 4Z0SA 4LEFA 4AZBA 4O57A 3AOFA 4K38A 1VFSA 2X2YA 1RR2A 1O66A 2Z1BA 4MIMA 5D9OA 1BKSA 2WXDM 3M7WA 3N4FA 1V6UA 3CQKA 1HKVA 1C93A 1VBJA 2C14A 2PDBA 1P0KA 3FNDA 5D2TA 1CXFA 4EOUA 3ARWA 3CQ0A 3PBYA 4CQCA 4LUTA 4H3DA 1P6BA 3DUGA 3EA3A 4PMQA 1VH7A 3MSYA 2R9RA 1L9WA 1MNSA 4G1KA 3SCQA 3KHJA 4HTBA 2G5WA 4FP1A 1K9DA 5TF0A 2VP8A 4HKPA 1KKOA 3DFSA 5DY2A 1TVPA 5DBTA 3S1VA 4N2YA 4LGXA 1KFEA 1X1OA 1TZZA 2QJMA 4WDXA 2EG6A 3SCUA 3LHYA 2P3EA 4X63A 2HE8A 2QUTA 4ROQA 3N9SA 1KRAC 1YTDA 1EBHA 4Y9PA 2Y61A 1E15A 3BPWA 5CXPA 5EKYA 5M2FX 1EX5A 1TPH1 3TX9A 1VPYA 2FTYA 4JIIX 4PUKA 2CBUA 5G2WA 3AHZA 3VINA 2QDEA 4FNQA 3LLDA 4RW3A 2PAJA 1DWHM 3IV8A 4HSHA 5HUPA 3TZNA 3S3GA 5D03A 2X2GA 2GVYA 3WG6A 2GGGA 4EF9A 5J5RA 1FWSA 2QUNA 3WQDA 1V3KA 3MPGA 3C2YA 2I1OA 1CPUA 2QJIA 3IIOA 3P82A 3RLUA 1XIMA 1E0UA 2GQAA 2ZIDA 2A7NA 4GIAA 4LUYA 2PCQA 3A12A 2D0HA 3VK5A 1I1XA 2JGQA 1DIOA 6TIMA 4HB7A 6ALDA 4ZENA 1ME7A 5E0FA 1WOAA 4HD5A 2CKSA 4R7WA 4US6A 4B3ZA 4AHPA 4Y9NA 3VD7A 5AHNA 5LNVA 2CHRA 3T0TA 4Y9OA 3CAVA 4AY1A 3THDA 3WQEA 1JCTA 4DWSC 1OZQA 1E6ZA 4MADA 4J3TA 3E9AA 3KS6A 3LCHA 1QNVA 5EU9A 4JICA 1QI2A 1OIFA 4NL1A 4ATDA 5MKGB 3DHUA 3OYZA 2CYGA 3S2MA 2H3DA 1W37A 2W79A 1NJJA 5HMEA 4DYKA 1VLWA 5E09A 2PLMA 1NH6A 2XG9A 1IIHA 3UZ5A 1YW1A 4CQ8A 4WY0F 3M46A 1J5SA 3FS2A 1FHDA 1MEWA 1GGOA 1MDRA 2DQXA 4WVXA 5KMYA 1FBAA 1RBAA 4FNPA 1WKYA 3DFQA 1PJ9A 4J1OA 3ONBA 2QPUA 1TPDA 4IL2A 4AHQA 3N17A 3DECA 1P0EA 1RLCL 3UD6A 2IKIA 1VJSA 3BLIA 1E0TA 2PCEA 1BD0A 2W6RA 1FVPA 1W3IA 5JU6A 4TX6A 4BJHA 4GVGA 3VPLA 3CAKA 3F5JA 1HGWA 3E6EA 1Z48A 1ZENA 5LA2A 2ZRUA 3NQCA 2VGFA 1Q6DA 3VTRA 4L6OA 3SFKA 3UZXA 5T26A 4EXBA 3DG3A 3TXVA 3B8IA 3HPXA 5IBXC 4R5EA 3CZJA 3QQ0A 4PCNA 1V6YA 3WDIA 1OC5A 3QYSA 1QK0A 4M6VA 4O1BA 1V02E 1LCOA 3DESA 2DZAA 3EOLA 4MPQA 2WJZA 1W1B1 1QNOA 3BCJA 1QRQA 2I5GA 3TCSA 4O16A 4DB7A 5CAKA 2BVTA 4JNMA 2J79A 3N2TA 1UWTA 2EGZA 3AXXA 1VFUA 2WMHA 4NHVA 3G1AA 2PTWA 1E6SM 3F4NA 3U0HA 2GJXB 3L2MA 3WLSA 4RPQA 3CMGA 4WGXA 1SW0A 2YXOA 4GYPC 4JTUA 2J9XA 2J25A 2FPYA 1EDQA 3TJIA 3E38A 5E9XA 4S39A 1GYLA 7XIMA 1FWAC 3MMDA 3W37A 2YPIA 3W0KA 2G0WA 4MSSA 4R9XA 4A22A 4QSFA 1C8XA 4WJXA 2EAWA 5CJ5A 3SGGA 4IX2A 1F73A 2WWCA 3VGBA 3DX5A 3EA1A 1TPEA 1TE1A 3V1HA 5U4NA 2VX7A 1ZZMA 2EO7A 3FXGA 1PWLA 3RNDA 1P48A 4WX2A 3N2BA 1VP5A 4S2CA 3W2KA 1QPRA 3TEVA 2P3ZA 4UR7A 4TQTA 2JF6A 3SM0A 3GNDA 3HU7A 5EMLA 1QW9A 2PWUA 1OFPA 4XIAA 3R8RA 4Q8NA 3QN3A 7CGTA 5LNWA 1TTIA 1FCVA 3SUWA 2CZ5A 3FA4A 4JTAA 1FKXA 1KM4A 1OJXA 4F48A 5LHEA 5I3IA 1LRTA 1EOKA 2OT0A 4OE7A 4PUEA 4FMVA 5CBBA 3KVJA 3MCMA 4L64A 4PTVA 5GNZA 2ZC8A 2VFEA 3IUIA 4PMZA 4C6NA 3IGXA 4FR1A 2ZQ0A 2ZZ1A 2VDGA 4GX8A 3LNPA 4XD5A 3L2IA 5L6UA 4AWSA 4TX9A 5ABFB 2W91A 4JQ3A 3BJSA 3UBPC 2QPXA 1YDYA 2WVVB 4LUJA 4IJRA 4ASTA 3LSCA 4GXMA 4U3AA 4LUTB 1HL8A 1JNEA 4PUDA 4MUPA 5DELA 3C52A 4TOQA 3E3HA 2FFIA 3TJLA 3QY7A 1B9BA 3P74A 1K7FA 1A5BA 1TPC1 3G1VA 3QR0A 3SAZA 1YE4A 5HWJA 3AHTA 1MWOA 4JPGA 3HPAA 2WJDA 2QR6A 3CTTA 3KVLA 4G5DA 5HANA 1BXCA 2GUUA 3IJQA 8RUCA 2I9EA 1TFVA 1D3CA 1S5TA 5GJMA 4R27A 1UKPA 3KX6A 2V3EA 1AA1B 4KS0A 3QTPA 4GIRA 3CO8A 3A64A 3SN1A 3AZTA 3AMCA 2Y7GA 5FI8A 3ZVIA 5AYXA 1D7FA 3GXPA 4P5UA 3UP8A 1FHUA 1EHNA 2PS2A 4RZBA 5DEZA 3P84A 3VCRA 1W6TA 1CCWB 1GVRA 3N73A 4QJ4B 3T44A 3ZXWA 4ZTXA 3G24A 2R94A 4LXFA 3GXIA 2DUXA 3WH9A 3ENLA 2O9TA 4DZIA 1AD4A 3A4WA 1GCYA 1K3UA 1O60A 2Y7DA 4P8WA 4JX6A 3CQHA 2A3CA 3GBDA 5AZ0A 2OMAA 4ZMGA 1AL7A 2JK2A 1Q6OA 5DFAA 1DXFA 3B9OA 1A49A 3W9ZA 1FDZA 1ITUA 4PMUA 3ZT5A 1KRMA 4JOMA 3BG3A 2NX9A 3TR9A 1R3VA 3PAJA 3WNOA 2QF7A 1XM3A 3MDWA 1LLWA 4LBUA 2GSEA 1AODA 1Q4NX 2RUSA 4FX8A 3DN5A 1V5XA 3ZQ9A 3PBWA 4WUIA 4PODA 1GJPA 3S47A 5JH2A 3ECQA 4TVDA 1FDYA 2GQ8A 1P5BA 1P6CA 3LI1A 5AC7A 2VD8A 1GVQA 3VKKA 5I07A 4B5TA 3VDGA 1NARA 1B3WA 3QV8A 1RQBA 1QCWA 2E6AA 5F2MA 1BQCA 3H8AA 2XZ9A 4IQDA 3V36A 4JIPA 2H8ZA 1FWNA 1OGSA 1BRLA 4LTSA 1GQLA 3SIMA 4LAUA 3ZT7A 2J7GA 4TV5A 4V1XA 4YTRA 3AMGA 2OOFA 5C9UA 2DT3A 3CNYA 2PDHA 3PAOA 3FX4A 1CIUA 3CIVA 1HP5A 4CGTA 2HS8A 2EEXA 3ZR6A 2Z27A 2IPWA 5BYWA 3BLLA 2V30A 1KM1A 4BCEA 2WK2A 3JZEA 3VVGA 2YFNA 3G1HA 1VFHA 3GS6A 5HMDA 1PBGA 1X8FA 3MCNA 2Y62A 3UZZA 1KRCC 1UR0A 1GG0A 2ASHA 3KBJA 2DPEA 1L8NA 3VD9A 1JQXA 3BANA 5DQPA 1TMLA 4MF4A 3K4AA 3CS2A 3GE7A 2ZZ6A 3TU9A 3KOYA 1R85A 1WBHA 3KDNA 1UZ1A 3KBVA 2HISA 1OD8A 3V5OA 1RPXA 4GISA 3EWCA 1H63A 1IXNA 1R9XA 1KCXA 1ZP4A 3KVMA 2WC7A 5LIWX 1OX6A 1GT8A 1YBQB 5CLWA 3S1WA 2I14A 2QCFA 3Q67A 4MKSA 1R7OA 4GNKB 1FCBA 5G4HC 4GBDA 2DIEA 2E8YA 1RVKA 2A21A 3L4UA 3TYAA 3QV6A 2POTA 4IFRA 3A3WA 4OWGA 1PAMA 5IM51 3SZ8A 3MSRA 2GVEA 3EX4A 2NUXA 3RO6A 4B2DA 4NZ3A 1G1YA 3EOSA 3MUXA 2QPSA 2XM1A 1B4EA 4GUIA 2XVGA 1VEMA 2AMGA 4TVUA 2WZMA 3WH5A 1R8LA 4ATWA 7ODCA 1G4PA 3K8MA 3IK4A 3Q4DA 1TR9A 1V6XA 1ZHAA 5E0KA 1K03A 1FA2A 3AU2A 1OGGA 1JRCA 1R3WA 1TV3A 3PJUA 3WN6A 2YX0A 1JD9A 2B4GA 3ZJKA 4DJDA 3OYXA 4ZBCA 3VUSA 4IPJA 1I45A 2ACSA 4O12A 2XSBA 4O0ZA 1E4NA 1REQB 1JF5A 2XVPA 1EL3A 3E74A 1UYQA 3CASA 3CBWA 3WUFA 3PFRA 3LERA 4AZIA 2BODX 1V0NA 3HB9A 3W01A 2HE5A 1D8WA 3AC0A 3WNNA 4AG0A 3PSVA 5CPQA 3WBYA 4WIWA 1LYXA 1H7NA 5SWUA 3N2OA 3L66A 3GAKA 2RDWA 3MVIA 2E9BA 3WLNA 4B5VA 3N6HA 3N4AA 5CC7A 1EC8A 3VDCA 4Z1AA 4OUEA 2J75A 1KV8A 2HMCA 3LD5A 3FJLA 4FIQA 2Y88A 4A4AA 2VGBA 3W7NA 1F9CA 5KZDA 3V7PA 1XIIA 1GQKA 3M5ZA 2ZWZA 1XWYA 3J7HA 4XG1A 3AXKA 4JFTA 1B3YA 4CQBA 1YE6A 3MUAA 2I17A 3EMCA 1VPXA 1PDYA 3UXIA 1QTWA 3LTSA 1KLZA 1AH4A 4NASA 3ITCA 2X1IA 4HU3A 4TMCA 3FLUA 2RAGA 4M29A 1JZ2A 3KCJA 1IEIA 3W6MA 4Y6GA 3LPGA 2RDTA 2OZTA 3M0XA 3HF3A 4OGZA 4A35A 3P8JA 1D3GA 3G5EA 3JU2A 1IE7C 3I7QA 5FAGA 3GHUA 1R30A 2ZUSA 2HROA 4AC7C 4L4MA 4Q22A 3KW3A 3LU2A 2GL5A 4A8LA 2FLIA 2V63A 1CTNA 4HA3A 3FAXA 2HVNA 5FEZA 4ACZA 2PDCA 3BARA 2DSZA 1SO3A 1EJTC 4PB5A 5XIMA 3WJWA 2YA0A 3MCOA 5BXTA 4J2MA 5JQ9A 1VHCA 2E5DA 2BY0A 3GG8A 2D0GA 4EAMA 2WMKA 1TZ9A 3PZTA 2OCZA 3W7PA 3P0XA 4LV4A 5HQMA 4RXGA 4WDUA 3SQLA 3NXFA 4R53A 3LRKA 4XZLX 3CL8A 3N11A 2X42A 2QUVA 4DJEC 3OG3A 2F84A 3H2FA 3GNRA 3TOPA 3VX1A 4KCVA 1KBBA 4GUHA 3W2UA 3QV7A 1OABA 3UZJA 3SQSA 5CCZA 1JVNA 4HPGA 3ANYA 4JS3A 2Z4GA 2ZC1A 1RALA 4PMJA 3DFPA 2GJLA 3KTXA 3QMSA 4K37A 3IANA 4OJYA 5D32A 4WDTA 4MB3A 1F6KA 3DFHA 4XQ6A 3W73A 4A3QA 1NF0A 2E9LA 4IF2A 2BY2A 1VYRA 3V3WA 1LG2A 2GJPA 4YN5A 1PHWA 4BI7A 4PRWA 2R1KA 2HEJA 1PPIA 4GNVA 2FZBA 4JY8A 2VGIA 4N7QA 2QQ6A 2FZMA 2VQUA 1KB3A 3K1DA 1FP9A 1VFMA 3ERPA 1JDFA 2IMRA 4B5SA 3ITVA 4J27A 3HBLA 2A7RA 1EIBA 1XRVA 3EYPA 4OBTA 3AS3A 5BWFA 4PBFA 5J04A 4B5WA 2PC8A 3LY0A 3T2OA 3UG5A 1ZU8A 1RPKA 1QBAA 2GFTA 4QLJA 3O1NA 1BGAA 3TN3A 3MS8A 4WF7A 1OYBA 3QH2A 1DV7A 3P61A 3H2EA 1HL2A 1E0WA 4H6QA 5CZTA 5LSMA 2O0TA 5I77A 2ZE3A 1W1PA 4LU0A 2Y2WA 4RPPA 2ON3A 2ISWA 3DBPA 4YVVA 3CV1A 3EX3A 2QCNA 1SZEA 3LN3A 1TV2A 4G56A 1E9YB 2E40A 1VLIA 2Z1VA 3MHFA 3EWDA 3KM8A 3WK0A 1UWAA 4IFKB 1XGDA 3WLIA 1V02A 4OVXA 1F3TA 4IMGA 5LNSA 2J13A 4LRTA 4L9YA 3WD4A 1LWJA 2AQOA 2Z6IA 3GU2A 3VNKA 1X6UA 3W7EA 3TDFA 4NXSA 2OKTA 4PA8A 5KEZA 3D5HA 4H8HA 3SGUA 4XVDA 4H6RA 1I2RA 4HK7A 3LHVA 4L1WA 1OVDA 3ARYA 4H8NA 4KWOA 4PYSA 3MP5A 1E6PA 1C9DA 3A4JA 3W85A 1AMKA 3U5YA 1HX0A 4YNGA 4B4HA 4RZ4A 1PUDA 3H26A 3HPZA 3G18A 4I5RA 3NPVA 3G1DA 3SCWA 3O6DA 1NDWA 2F6KA 4NI8A 1EC7A 2XGIA 3GR4A 3C2EA 3AI0A 4WGHA 2C3ZA 3QKZA 3SCNA 1GZGA 3IGUA 4AX6A 1GNXA 3WF3A 4GFIA 4OV4A 1ISWA 3L4XA 2PRLA 3H4GA 1E6XM 2HBVA 3M0YA 4AWTA 2C15A 3TK7A 1PZ0A 3ALGA 2HBXA 4LUIA 4RW5A 4U10A 1AW2A 1CGUA 5G1YA 1TJ2A 5CG7A 2H3BA 1BYCA 1XYCA 1A5LC 4XZNX 2TMDA 3S2CA 5JBFA 3MP3A 3W72A 3LEPA 4M24A 1QNPA 1GTHA 1G69A 3AUOA 2Z2AA 1NWTA 1XYFA 2I9UA 3ALFA 2YCIX 3AXMA 4IISA 1OYAA 3CPRA 4J3WA 4K1WA 1HFBA 4S3BA 4F0LA 1ZP3A 4HNCA 2GYIA 4RX0A 3LGDA 3N15A 5FF7A 2NUYA 1OFQA 5AHEA 4LF1A 1WDDA 2ZOXA 3W7MA 5FD0A 1WXYA 2Y1HA 2RH9A 1MUCA 2VC6A 1HIZA 4S3CA 1S5WA 4IWWA 1CB7B 2D20A 2PB1A 3SIZA 4QLKA 4H4IA 3N19B 5LGZA 2XJ7A 4Q4MA 3D46A 5D2XA 4ZEPA 2X16A 5C9XA 1VYPX 3BUVA 1E3ZA 4M7TA 1XRFA 4AZ6A 3QZ6A 1I8JA 1UKOA 3N3TA 4J9JA 3WLHA 2ZDRA 4D6IA 4D8ZA 1IT0A 1KM2A 4PRRA 1J11A 3T07A 1GKPA 2X1UA 4FX6M 1M03A 4O13A 1VIZA 4WJ8A 5AVNA 2JEQA 2OQYA 3PWGA 1BAGA 3PB2A 4AH7A 2OR2A 3MZ2A 5CLTA 4DVOA 3Q37A 1Y8BA 4I5XA 4AHOA 5IFPA 3UCCA 1RAKA 2VYOA 3FIGA 4DJFA 2NLIA 4JYEA 4PN2A 1CECA 2WCAA 2XH2A 1GZ1A 4ENLA 4MUZA 2V5JA 1J5TA 1HTIA 1JCXA 2O55A 1VEPA 2BXZA 4L5ZA 4BA0A 4CU7A 5EBUA 5C7VA 4ZB0A 3PZIA 1EGVA 4R34A 1QDSA 4LS1A 5A8QA 5J8LA 1HF6A 5HR7A 4NSBA 4AEFA 1UMYA 1DWFM 1AFSA 3LCWA 4FXSA 2VDIA 3H2NA 3K8LA 3PZVA 4MWAA 2Z26A 9XIAA 3HGSA 2GVLA 1XUUA 2YZRA 3EX1A 1S2VA 1V8EA 4JDBA 3KWSA 1YXDA 3FVMA 3TN5A 3WQ5A 2V67A 1J96A 3PF3A 1KFBA 1GOQA 4DWDA 5M5DA 4LYKA 4RNJA 3LMZA 4AD2A 3OQEA 3U4FA 3UG8A 1HL9A 3G0SA 3ABOA 3W7HA 2DSUA 3LI0A 3R0UA 3CQIA 3NSMA 1MW2A 1ZB5A 1S39A 3B8TA 4Y90A 1V93A 3NEVA 4IXXA 4YHEA 2WSRA 3WLOA 3KLKA 1NFPA 1NF7A 2E4TA 1DE6A 1W1YA 4IMEA 3GVGA 3U4AA 4W8AA 1WX0A 1EJSC 5EMYA 4UTWC 2Y63A 5KITA 1ONRA 4B16A 3NQFA 3LZ3A 2VNCA 2FHFA 2CLHA 4PUWA 2DJLA 4LAKA 1JUBA 3LYEA 2ALDA 3TKFA 2A6LA 2WO5A 4X2PA 3I3BA 5DCBA 2RHGA 4NZFA 1QAPA 3GNPA 4NZJA 1IWBA 4US5D 2CZVA 1KCLA 3MMUA 4JL1A 3RJXA 1WKDA 4CNUA 3F7JA 4K8HA 4CCCA 4J3VA 1S38A 3BQ6A 1S1PA 3MKVA 2VEFA 1JXJA 1EPXA 3N6QA 3S2LA 1FDJA 1K9EA 3HO8A 2Z1WA 4FNRA 3PJWA 3OZOA 2X09A 4WHBA 1SJBA 3DIPA 2INEA 4MNLA 1THFD 2DZUA 4ORMA 1NDYA 3PB0A 4S23A 2BVDA 3M0LA 4EPBC 2INZA 1DWJM 3G8EA 2C16A 2ESCA 4ZXOA 2YBVA 1A5KC 4UTMA 3WD3A 3ZSTA 4UCFA 4GI4A 3PHAA 3QLDA 1YIXA 4ZB2A 5HPOA 1WCGA 4UQ9A 4HPHA 4DHGA 5CZ0A 1EJUC 5E93A 3W1QA 2E77A 1MFUA 2EPMX 4DF0A 1R7AA 3CZLA 3PR2A 1JG9A 1ZBKA 3TN4A 1KBJA 3EMZA 1Q6EA 2WQPA 1SZFA 4ATLA 1YNYA 4E2VA 3TVAA 1E9IA 5BXPA 1UBSA 3W84A 3M0ZA 3OW1A 2QGHA 2BY3A 2VT0A 1JPKA 2F6UA 3HMJG 1UUMA 4Q7NA 4Z1CA 1Q85A 3VOFA 4HZMA 3AXIA 1XLFA 2R91A 3H12A 2YCJA 2CZFA 5A2CA 4F0RA 5A3HA 3AMDA 2W61A 1V51A 3LXBA 4HSOA 3TLLA 3PTMA 2XGBA 1SO5A 2YBTA 3R13A 1VYSX 2CLLA 2VGGA 4F9JA 4H9XA 3QTGA 1UR2A 3CHVA 1K4GA 3TP4A 1Q6LA 3L12A 2WMIB 3HJEA 4XSMA 4H2CA 1LLOA 3KS5A 3UPMA 1W9DM 4AZCA 2WNWA 4DNMA 3BAWA 4DWSD 5FF2A 3URBA 5CC6A 3DBNA 3D3FA 1OC6A 1RA5A 2Z29A 3NQ7A 2CBVA 2DZPA 5EPDA 5AC4A 1XLIA 1LM1A 3TZFA 1ME8A 1CGVA 3S83A 1QOXA 5I3FA 4RNIA 1UOZA 3MSGA 2A5HA 4FALA 3WFZA 2BVWA 3H24A 3S0CA 2OSXA 3RX2A 4L4OA 3WNLA 4F0HA 1CGXA 1G9HA 1XFCA 4WJEA 5G4EA 1E51A 2PLJA 3BDKA 2I57A 3CV2A 4AZHA 2XH0A 1KNWA 4Z0JA 1AH3A 2OO6A 2Q3OA 3VA8A 1RY0A 3H4XA 3TE9A 1HW6A 1NWSA 4Q6JA 4MZYA 4F0MA 2RFGA 3NL2A 1KV5A 4FOUA 2O92A 2YDAA 4HK6A 3QSRA 8TIMA 4IGMA 4EP8C 3W1TA 3W25A 3ITXA 1MZHA 1TQJA 4LS2A 1TO3A 1Q6FA 3THCA 3WDRA 3W27A 5G5IA 2WKJA 1JL8A 4IPLA 4EAYA 2RGLA 2PGFA 2LLEA 4PTDA 4WY0A 5HMSA 1V0LA 3T9PA 3WK1A 1O68A 3MJYA 2JIWA 3EEGA 4NZ1A 1RA0A 2XTKA 3OODA 4M51A 2BS9A 1KM6A 3OPSA 2VI0A 4BK9A 1B2YA 1A80A 1C3FA 3PZ9A 3PSWA 3TYDA 2O4MA 3LA4A 4IM4A 4PL2A 3G1RA 1WO2A 5F4SA 2QT3A 3FYOA 5C9WA 4JIEA 5HBFA 4CD8A 4HZ8A 5D09A 4OFCA 2HVOA 1PSCA 3T4WA 3T55A 1CGWA 1NP0A 3TSMA 5AHLA 3E02A 2AL2B 1LG1A 1W9UA 3S9YA 2WVUA 3WF0A 2VX6A 4ZO6A 5HMFA 1OG6A 1TIMA 1R3SA 3WD0A 4F40A 3NCOA 4TO8A 3WQPA 1VBRA 3KRZA 4WZHA 5BCAA 3UYCA 3NYDA 4O1FA 3MKKA 3EDKA 4MWAB 1F07A 4BWLA 2IKJA 3HQNA 1IEXA 3OGSA 4DPPA 5LNRA 4NI3A 1S2UA 2WSPA 4D8LA 1PZ1A 3GC2A 2NQ9A 4C6OA 2ZRVA 5K3VA 1TQXA 1TYGA 1DJZA 5A8PA 5DXXA 4HK5A 4AD1A 3KBNA 3BVJA 1GK8A 4YL2A 2F2HA 2J7HA 3LCIA 4O4WA 3AZSA 2PE4A 3UWWA 4ZTYA 3LSBA 4ZFMA 1XIJA 2A4AA 4UB9A 3RX4A 3RXZA 4ICMA 3VCCA 2FVKA 3AJXA 1R2RA 3CV6A 3TW9A 3AALA 2AMXA 3AIQA 8XIAA 1J2WA 1ELSA 1TVNA 2QV5A 3KFTA 4I6KA 3VOCA 1EWEA 1BLIA 3L21A 1EJWC 4MTVA 2EG8A 1EC9A 3W7KA 1E72M 3SSZA 2AOSA 6XIMA 1OCNA 2CLPA 3PM6A 3RM9A 2C79A 1H49A 5FKYA 1GYMA 3KCLA 2GVGA 4L7ZA 1H62A 3PUOA 2TODA 3TMQA 3RAOA 4DXVA 1BQGA 2VR5A 5F1UA 5E1QA 2QS8A 4LVBA 4IPNB 3NTYA 3G1YA 4YMZA 3ZR4A 5HJYA 3G1XA 4IX0A 1AZ2A 4YVPA 1PZ3A 2J9ZA 1V3IA 2CITA 3WDHA 4UR9A 3VIJA 3VNJA 4DYEA 2W67A 1UR3M 3ARXA 4HCDA 3ZWSA 1ZRQA 1PKNA 2OT1A 1BHGA 4H9UA 5EL1A 2CNCA 2CEQA 5HNUA 4KETA 1LBLA 3REQA 4QEHA 1GPWA 4D6CA 1TCMA 3FY1A 2YYTA 4FR6A 4REQA 3W74A 2G50A 4M7SA 2G37A 4W4QA 1GW9A 3TQPA 4HMEA 2PBGA 3FSTA 3G3DA 1P0BA 2J7FA 3LK6A 3W87A 3I7SA 4XAZA 1HQTA 2X7VA 5D04C 3UWQA 1Z42A 1UWSA 2YL6A 5I79A 4U2YA 3PULA 2E0PA 2VR2A 4L9XA 3W26A 3WBEA 2H9AB 2J7EA 4DZ5A 1K6WA 3GFXA 5F7UA 1GEHA 1VBGA 3SR7A 2GWGA 1XLAA 3UZYA 2ZX7A 2VFFA 1J6PA 2JKPA 3U3HA 3KOZA 1CENA 1P0NA 2I5IA 2QF8A 4JIQA 3RPTA 4EE9A 3F4WA 3R8GA 4I8DA 2NW0A 3IJIA 4UCGA 3LGGA 3N9RA 1H7PA 1GVIA 5AHIA 4JTFA 1XUZA 3TONA 2VX4A 5HNNA 4W87A 4FLSA 1W17A 4S3DA 3R6IA 1W5OA 1EGZA 1TX2A 3W4RA 4MY9A 1JUKA 4RE3A 1OFDA 4XBSA 4UMCA 2V3FA 2XIMA 4E0CA 5I5RA 1NELA 2OEMA 1ALDA 3SQMA 3VIGA 3OJGA 1Q65A 3RGTA 3E0WA 5C55A 2W66A 3PTQA 3C2VA 1XGZA 3GK0A 2O9RA 1XLBA 3VGHA 2CLIA 1SFLA 1HN1A 2WSKA 2Z0IA 4YU1A 1QWKA 3PPHA 2WYSA 1R3YA 3T4CA 2WZTA 4ZQCA 1WXZA 3PWIA 1SVDA 3WD1A 1WDWA 3PUDA 1ZCOA 1PX8A 2PLCA 4QDPA 3L7RA 2Z7GA 4AD5A 2P76A 2ACUA 4Q8WA 4ADUA 1W9VA 4W93A 2XIQA 3EB2A 4Z2IA 3V0TA 2PUZA 3CHFA 1W1ZA 1Q45A 1UUOA 1A3XA 2HK0A 4KEMA 4A6GA 1FWJC 3JUGA 3CPGA 2A6NA 1UC5A 4RUBA 4HNNA 1ISVA 4GRSA 1TPVA 3EOEA 5LYRA 2ISDA 4QTGA 3ITLA 1OC7A 3K5XA 1DKWA 4GOAA 4ADSA 1JYWA 2O56A 1IHIA 4FOJA 1OFAA 3WQ4A 2QCCA 3OGRA 2XH7A 1GW1A 3A24A 3GVWA 3W1MA 1JPDX 2VRJA 2KAUC 4NYUA 3FYPA 1CGYA 4DBDA 3A23A 4JIRA 3ZWTA 3W7IA 4BF9A 3H4WA 3OLIA 1OX4A 3KRUA 3EPNA 2YCLA 1LTDA 1TVLA 3CIXA 1GKQA 3W6YA 2D24A 4NU7A 4O1EA 1DJIA 2IPJA 3QQ1A 1ODUA 1R2TA 4R7OA 1T5AA 1E5JA 5HR6A 3TR2A 3STPA 3SRKA 4FEZA 2V9DA 3NZGA 4WR3A 2PLKA 1W2PA 3FHAA 2XN1A 4C6DA 4AUBA 2VHLA 2D3NA 4I8YA 1H3GA 2D2JA 4B92A 5H8MA 1PIFA 3FA5A 2WQDA 1F2JA 2GZXA 3HV9A 4S3GA 3K30A 4POCA 2VCCA 2Y5EA 4O11A 3HG5A 3AAMA 2C1IA 3W7LA 4GINA 1M3UA 1EXPA 4UZUA 3W7GA 3MI2A 3ABXA 1QASA 2ZTKA 2Y8UA 2I5QA 1H11A 2BGQA 4UFIA 4KH2A 3LMYA 3MB9A 3OOQA 4DN1A 3DDMA 1FFRA 1XSJA 4OIFA 3IUHA 3S6TA 5A95A 2FGLA 1AQHA 3AXHA 1SR9A 4YTTA 5D02A 5LZLA 3MBDA 1ZCCA 2QVNA 4DRSA 1UZHA 4UMBA 1JDDA 4JKKA 5D8ZA 1L2UA 1ZPTA 3BW2A 5CBIA 2UZ9A 3APYA 2NV1A 3LRMA 1FWFC 2PZ0A 2ZXDA 1GJUA 3T8QA 4Q8QA 5FSDC 1BG4A 1Q7QA 3GH5A 3SN0A 4UTJA 3QPZA 2YDSA 4Z1DA 4G7FA 1HVXA 5C8BB 4N42A 4WSHA 3IWPA 1IEQA 2PU1A 1ZJIA 3M4HA 4D1IA 3GR8A 1EF3A 5I03A 1DQWA 2E6YA 3N4EA 3T6CA 3DI0A 1XIEA 2PWVA 3VZZA 3CHCA 3W7QA 1H41A 2X0SA 1Q7ZA 3SN4A 3VI2A 1O5KA 3AMKA 4GYJA 5DMNA 4UTFA 1TUFA 2OLSA 4YHGA 1EDGA 5FJOA 5T91A 3KOXA 3B4UA 3AISA 1XIFA 3SUTA 1FRBA 3ZT6A 1WUEA 4I9MA 1I9CB 3BJTA 2JE8A 3ES7A 1Z69A 4QHRA 3VD5A 1NOUA 3TTEA 2QHAA 2EF9A 1FWEC 4NNCA 2HXTA 4HU0A 4N4QA 5FEWA 1DTNA 1JCLA 2WANA 3H22A 4LAZA 1UR9A 3GH7A 4M6PA 1LUCA 1I6NA 3A13A 3R89A 3M0JA 4V27A 2DJXA 4DAFA 3BG9A 4O50A 4LV9A 3GG0A 2DIKA 1UWQA 1O4UA 4UQAA 3CAQA 3BCDA 3GHTA 3SGZA 4AD3A 3E0FA 3ATYA 3LV6A 2NQHA 4DBUA 3TC6A 2BOFX 3MWAA 4RKAA 1XSIA 4C5YA 4CCDA 1OBAA 2ZADA 3NGJA 2J88A 5A6BD 3MU7A 3QGVA 3C2OA 1J0JA 4AY7A 5TNVA 1ISYA 1DYSA 4DELA 1XS2A 3AYSA 1FQ0A 4NX0A 2ZZ7A 4DI9A 3NQEA 1ECQA 1V08A 4RL3A 1J8VA 3OZPA 1EF2A 2PGWA 4N9EA 3ES8A 1G01A 4MJZA 3E5BA 4HP5A 4IG2B 5DO8A 3B9AA 5EMJA 4MFDA 1P1XA 3O6AA 1XPYA 2PDMA 2DZTA 2HWGA 4JBRA 1SW7A 4MAZA 2Y5JA 3S6OA 1DIEA 5I6SA 1C9WA 2E5BA 1R9YA 3P5ZA 4ADTA 1R38A 1S46A 4QFUA 1RK5A 4LAOA 4CD4A 4A29A 1LBMA 3WL0A 3F4VA 1UPPA 3LBCA 2VC5A 5CQ1A 2D2GA 4DXXA 4DJED 1KA9F 2CBJA 4JKMA 2XUCA 3ZIZA 3R25A 4KFOA 2NLYA 2VURA 3OVRA 3SY8A 3L68A 4I7VA 1XHGA 4GIEA 2VEKA 3ABZA 1XD1A 3IPWA 4O18A 3EOUA 4M3PA 1NAL1 5EA9A 3CWNA 2J27A 3GG1A 4I3GA 3CH9A 4GI8A 1BPLB 5A8MA 4FOKA 3S9ZA 1UASA 4E3VA 4GUGA 1DJYA 1F4HA 3CWOX 4IIFA 1KBKA 1U22A 3ME3A 3S42A 3TV8A 1W31A 3BMWA 4QNWA 1HG3A 2Y4SA 3K8KA 1GYNA 4US5A 3GIPA 5FIPA 1V6VA 1ZJHA 3RPMA 5BRPA 4JGDA 1KFLA 1GQNA 4C6EA 4O1AA 1JXKA 4GQGA 2DDXA 4JTLA 4M1BA 2VFIA 5DF0A 4QJ3B 3LQGA 4CNPA 4C6CA 1PO9A 3P8IA 3Q2DA 4I7UA 4J3UA 5H6HA 5AHFA 3NQVA 3SY5A 3EPMA 3STGA 1A4LA 2IQDA 3OHMB 3GUGA 1Y0EA 4GJIA 4Z08A 1TWDA 3HG2A 4NAEB 4PTMA 4W86A 5IFTA 3CT7A 3HJZA 3IIZA 4JHOA 1DE5A 5REQA 1VR6A 5A6MA 4HA4A 4A3RA 2GVJA 3GTNA 2CHNA 3IRSA 4J3ZA 5AN7A 3TNBA 1YEYA 4GACA 5EBAA 3MKCA 1ME9A 1AW5A 1B54A 3TAOA 4JQAA 5C70A 3GDLA 1LZOA 1UR1A 4UUIA 4EX4A 1QVBA 3BGAA 1PKLA 4IIDA 1PCWA 3Q94A 2P10A 4MFEA 1EIXA 3ITGA 5D2WA 3M6DA 4GG9A 3L67A 1T0OA 4RDVA 2XSAA 3URNA 3APTA 4A3UA 1OM0A 4I90A 2ZUUA 1PTDA 4NY2A 4RNFA 1CXLA 1Z44A 4P8UA 1RHCA 3H23A 4XZMX 2DZXA 4GX9A 1AW1A 4FXFA 2DUAA 3R58A 4H00A 4NAFA 3VUPA 4XAPA 4W84A 1K9TA 3U57A 5E6YA 1QO5A 5AYYA 3DERA 1PE1A 1YPIA 4L6HA 2VENA 3K13A 1WZLA 2PRMA 1LJYA 3RU6A 2DSVA 2F9RA 4DEFA 3PY2A 2NQ5A 4OBRA 1M7PA 3EWXA 1VQTA 1FWBC 4UQBA 3E1F1 4Q8TA 2DT0A 5D38A 5LKYA 1KWGA 1M68A 1ICSA 3EWWA 3W28A 4OZOA 3CWHA 1EHAA 3W7DA 1JZ4A 4PUMA 4FIRA 2PDWA 5H8UA 3LHZA 2GDQA 4B4FA 5TQLA 3IAQA 1Q6RA 4Q7IA 4FNUA 3RCYA 1BWVA 1NFBA 1KCKA 4DWSA 9XIMA 1GOWA 3N12A 4IZGA 3DKJA 3VIFA 3SCTA 3A9IA 1PHQA 4IMDA 3PS7A 3WD2A 2JKEA 1ZJAA 2OO0A 1XX1A 1JR1A 1WA3A 4G8TA 3OIXA 2HXUA 1AMYA 4H8VA 4RDYA 4YWIA 1WP6A 1RJRA 1FWIC 4HU8A 1Z8AA 3KL0A 1B57A 2QCHA 1SJCA 3ABRA 1AUSL 4IIBA 1ADOA 4GI9A 4LVFA 2AAMA 4B5XA 3NVDA 2XYLA 1G4TA 2RGMA 4C6JA 5I0DA 2WCSA 1KFCA 2ZUNA 4KWUA 4PR4A 3NDYA 1QOQA 2HK1A 2Q01A 1CXIA 5FF0A 2GOUA 2W9MA 4C1LA 2O9PA 5C2XA 4AZ5A 1NQ6A 1Q4WA 3QQWA 1TIWA 3JR2A 3M1ZA 3K46A 1B90A 1DHKA 3B9NA 1EYWA 1LORA 3IIPA 4XKYB 4KWVA 4BI5A 4AIUA 3FKRA 1H7RA 2BGNE 5D37A 2JEPA 4EVZA 3Q45A 1OIMA 3VD4A 4Q8UA 4FO4A 5M17A 3ZLHA 3F2BA 3HURA 4DBEA 2FPVA 3N34A 3QHOA 1OF8A 3UJ2A 1XLJA 1MFVA 4GCAA 3PZMA 2YDQA 5IBXA 1XLEA 1GOMA 3DHDA 2DZVA 1W5MA 3NSNA 4H7ZA 4NP7A 3NDOA 4UOJA 3NO5A 2TPSA 2E28A 4JFSA 3GDTA 4E8DA 3EKZA 4HMDA 4KCUA 4K7YA 2J74A 2X41A 4CQ9A 1CB2A 3N2XA 2C13A 4M80A 2GLKA 4K36A 1MRAA 4H9TA 2Q09A 1AG1O 3F2DA 4IMFA 2EPOA 4GYPA 5BMWA 3WYZA 2GJNA 2VZTA 2HNEA 4FB7A 1IT8A 1AD1A 1S1RA 4GY0A 5F4WA 3I68A 3O63A 1EPVA 4TR9A 3VIKA 2GGHA 1JULA 5HNRA 3MHUA 4HSNA 4I9AA 4MKVA 3MV11 4XK2A 2Z1XA 5D05A 2UY3A 1C90A 3CTLA 4YXGA 3BAKA 3TAKA 1I2OA 1UD4A 3PANA 4AZ7A 3NO1A 3CB3A 3FSUA 4KEVA 2HJPA 3TSBA 1R86A 4P7RA 1O1ZA 1TRDA 4LBRA 3VABA 4LX4A 1TJPA 3UPBA 4HA1A 1CXEA 1K8YA 5JBEA 5HQLA 3FJ4A 1CBGA 4IP4A 4BF5A 1ECEA 1QU4A 3AWNA 3ABSA 4QCEA 1H2JA 1EA0A 1Y7VA 3VNYA 1R87A 4XX6A 1R46A 3IK2A 3M07A 4C5ZA 2JF7A 1W1TA 1D3HA 2PD9A 3HPSA 3EWZA 4ZFCA 2WC4A 1E6RA 4LFYA 2WAGA 3URQA 1OT2A 3MI6A 1S5MA 1E43A 3GSMA 1ZAHA 4X0NA 1CI1A 3GO2A 2G3MA 4HPXA 3S5OA 3VGEA 3W6LA 3NIYA 2BOGX 2OXNA 1PIGA 2KZHA 1KBLA 3HQ1A 3L4TA 3HGJA 3E12A 1RD6A 1QPQA 3UG3A 3ZM8A 5FSEC 4JEQA 5DMMA 4MAVA 3T78A 4F2UA 1XH2A 3V5CA 4GVFA 3LHWA 3O15A 4MWAC 1H5VA 2POZA 5PTDA 2DT2A 1IGWA 3HQPA 4A2RA 3W83A 1FXQA 3QPYA 5GNXA 1MDLA 4JZ5A 4XTIA 3VKJA 1UIOA 1KXTA 4M82A 2CLOA 4GO8A 3FXYA 1XYAA 5ENLA 4O28A 4DBSA 3W81A 2WPBA 2WLZA 1YMYA 5IXEA 2RKXA 3LV5A 1F74A 4PCFA 4GCXA 4QM1A 1M1BA 2OJPA 3PZQA 4FF7A 5HA7A 1B1YA 4YTUA 1TPWA 2E1DA 4HMCA 5BXRA 3PFMA 4WLCA 2DH3A 4QQUA 3CL7A 1TR1A 1A53A 3S2JA 2ZICA 3BWWA 1CLVA 5IHRA 1OFBA 4XZIA 2GK1B 4RCXA 3W7CA 1RK6A 3OU8A 2CPUA 4AZGA 3MQTA 4EPEC 2H90A 1RP8A 4HOXA 3WLRA 2A2IA 4DAIA 1OEPA 3RJYA 3SCSA 4W8LA 4AVOA 4S38A 4OUIA 4JCMA 1AQ0A 1I4NA 5G2IA 4G2DA 1IEWA 3CO4A 4NJKA 3VX0A 4JYFA 4QE1A 1F8MA 1SZGA 1P7TB 2B7OA 3ARQA 1N55A 1E6NA 4LVDA 3UCDA 1H7WA 3P60A 4H2HA 3P0WA 3KP1A 1LQ0A 3W1PA 4KWSA 3QM3A 2NX1A 4ZOAA 2QZRA 3FN9A 1F61A 5C7HA 1W1VA 4DUWA 2Z2UA 1W3KA 4O52A 1PTGA 3PBGA 3VCNA 4BKNA 3DH7A 1J0HA 3KZSA 1UBPC 4PSRA 2VZSA 2ZTJA 1XIDA 3RDKA 2WCGA 4A8RA 2DP3A 4FXJA 4NJGA 3QHMA 2AQWA 4R85A 4JTQA 3TFCA 1UA7A 3TTQA 1E1CA 2VEMA 3MDUA 4P7LA 3S5YA 4HT3A 1UHVA 2SFPA 2PWEA 1B3OA 1IWPA 4MMWA 1PB0A 2HSAA 1EP1A 1FWRA 1GZJA 1BYBA 2Y8KA 4R33A 2VXNA 4XSLA 3QY8A 4XZWA 3GYEA 5CEWA 1NDVA 2VD9A 3K1GA 5BRBA 1P1MA 3PJXA 2QUUA 9RUBA 2DQWA 1IR2A 5BOEA 3QFEA 3RCNA 3EOOA 1WKEA 3HQOA 1EEXA 5A6SA 1XCWA 3I10A 4KGJA 1EO7A 3UEQA 4RNHA 1T99A 3TYCA 2EPLX 7TAAA 1KM0A 1OYCA 3NYZA 1HKIA 2BBFA 3KCOA 1J0YA 2HNHA 4F66A 3IIVA 2YR1A 4CQAA 3GXDA 3WUBA 3WSUA 3WDJA 2NXGA 4GZIA 4F79A 3NQ2A 3WMBA 3R7MA 3LQLA 3QR1A 3W70A 2J78A 3V0UA 1Q8JA 2OZ8A 4QROA 1EP3A 1US0A 3ATZA 3WCZA 2HPMA 3LBOA 2AQVA 2MNRA 3B40A 3CUJA 4EACA 4DBWA 4WK9A 1JF6A 1TUXA 3MBFA 3OGVA 4O0QA 4AF0A 1DWGM 3EB3A 4X9YA 4ECLA 4CN6A 4LUSA 4GK8A 2QDDA 3N25A 3C3NA 3KBMA 4GJ1A 2ZZ2A 1LF1A 5DBUA 3NM1A 3G77A 3NL5A 3KOWA 4PUJA 2W27A 1EBGA 1UD6A 2ZUMA 2Z28A 2VWTA 5LA0A 1OSEA 3S5SA 4GQBA 4UTLA 2FZNA 1TTQA 3B9EA 3TYZA 1H60A 1ONXA 4IOTA 1BXNA 6REQB 1I1WA 3C2FA 5LIKX 2YW3A 4DXKA 3PUGA 2J7BA 5C0QA 2CU0A 4UNIA 3EWYA 1M01A 2BDQA 2WZHA 4XUGA 4QDMA 1UKTA 2ZZ4A 4H83A 3VE9A 1JFXA 4C7GA 3VFCA 4F2TA 2Q8XA 3A47A 2BXYA 1MW0A 3I6TA 4M1RA 3LOTA 4XD3A 1A5NC 1MW1A 4J40A 1YDOA 4DM1A 3FGCA 5ABHA 1AQMA 2CKRA 5JUVA 1WZMA 2NXIA 3ZO9A 3JW7A 1IR1A 2NQZA 1F6YA 1XI3A 4P8VA 4CVWA 4S3AA 5XIAA 4WKAA 4BY3A 1LQ2A 1Q63A 3L4VA 4Q4QA 3W1UA 1PTAA 3EA2A 2O7QA 1JPMA 3QV9A 4QAIA 2Y89A 3T2PA 4JQ1A 2VR4A 3II1A 5LIUX 5I3GA 4HMNA 4GUFA 1GPFA 2OOGA 1E40A 4AXNA 2P8CA 1FTXA 1V0KA 1UR8A 3N2MA 3BCFA 4N4PA 1D8CA 3RLGA 2QIIA 4EKJA 4GFSA 1PX3A 3T05A 4MNKA 1SFJA 1EQCA 1UZ4A 4Q4KA 4Q33A 3VMNA 5JBDA 1XPGA 3S1XA 2ZXAA 3QOKA 4ZOEA 2FKPA 1UA3A 5E70A 3ZVHB 4HHMA 1CXHA 2CWXA 4U5KA 4B3LA 1QI5A 1LROA 1KM5A 1M7XA 3R2GA 7A3HA 3TTYA 4GGHA 4U5IA 3OA3A 4YCPA 3C8NA 1F4AA 3UVAA 1FH9A 3H54A 2X8RA 2PDGA 1LOSA 3KTSA 1OG0A 4O19A 4BF7A 4HJWA 1KGUA 4J7RA 1TA3B 1EDTA 5IRPA 2OSYA 5DRIA 1JZ3A 3DI1A 1HNYA 2J24A 1QNQA 2G8ZA 1UJPA 3ITTA 3W1RA 3F5KA 5HXMA 1A0DA 1P0DA 3S9IA 3TQVA 4HPJA 4H9ZA 3V35A 1QOPA 1CEOA 1FX6A 2J6XA 3SFWA 1MUWA 5U7SA 5FJJA 5BXSA 5A6BA 1XC4A 5D4YA 4K39A 2WHMA 3GNXA 4JCLA 4EXQA 3WMLA 2DW6A 2JBMA 3W1LA 1VF8A 4X22A 4G6CA 3OBEA 4E2OA 3AMLA 4M5PA 3UETA 1ONWA 1SSGA 3SRHA 1BYDA 1IV8A 1A0EA 4C6PA 2CIPA 4CNTA 3B0PA 5I23A 1EX1A 1U1UA 5T9BG 3VZXA 1XH1A 3W02A 1DJWA 4UFJA 2EHHA 1U1HA 2OELA 2Z00A 5BW6A 1QATA 4WCJA 4E3TA 3BW3A 3DC0A 1JGMA 3FKKA 4AC1X 4XBKA 1HZYA 3CL6A 3BICA 1S2AA 1GEQA 2DUZA 3R94A 2X05A 1DEDA 1QNSA 4G7EA 1HXJA 1BTCA 3KVKA 4PCSA 3STEA 7REQA 1Q7MA 2E25A 2RJHA 3BSMA 1TPUA 1RCOB 6TAAA 3TH6A 4DJEA 2IXVA 3LNMA 3M0MA 3UXDA 2Y7FA 3G22A 4Y8EA 1FWDC 4UQEA 3SCRA 2A7PA 2QJGA 4KEZA 4OOZA 4V15A 3A22A 3MHGA 5FESA 1T41A 1CLXA 2XFYA 4UBPC 5FA5A 3EBVA 3FK4A 1XYMA 4TMBA 4WOQA 3I3EA 3NO3A 1E73M 3W1AA 2Q8ZA 2PDPA 1MW3A 4DI8A 1DORA 1E6QM 1OY0A 3NAVA 4GXWA 5TBOA 1H51A 1X7IA 1HGYA 3CH0A 1T6MA 3WLQA 2QCDA 3GTXA 3GXFA 3U7BA 4X61A 3LPFA 2FJKA 2DSWA 3P6LA 2QKFA 3XISA 3U2EA 3TJ4A 4Q8PA 3PZNA 3WJXA 1TJ0A 1ZUAX 3PTDA 4YCOA 1Z32X 5MF5A 2Q02A 1HKWA 1ICPA 1PVNA 5A6TC 1VBUA 4ZSTA 2CLMA 4Z1BA 3U2ZA 1JZ7A 4L4PA 4LNCA 1UB3A 2GDVA 2XFWA 1IXQA 3MT1A 1MYRA 4LOCA 3IV3A 5CGTA 4ML9A 2C91A 4LY8A 3EMQA 3BOLA 2OZ3A 4U31A 1ZFJA 4C65A 4K1GA 5HATA 4RJEA 2EBNA 1L6WA 1QHOA 1EO5A 1QI0A 2NWRA 3B8WA 2QJHA 4MHBA 3WLJA 4C91A 2WLYA 2Y24A 3UNDA 5JMUA 2ZX5A 4JTJA 1LP6A 3T0AA 4KT2A 4XTDA 4DNHA 2CXEA 4BQ3A 2PBOA 3NPXA 4LYPA 4FSAA 1WYIA 1DQXA 5CPLA 3CZGA 2DH2A 1KQZA 4AQLA 3W53A 3GYCA 4JTIA 4HQVA 1WQ5A 5CC5A 4NJHA 5CBJA 4S3KA 3VOGA 4EIVA 1F3EA 3WQVA 4H9YA 4LPCA 5MHBA 3ITOA 5DMYA 2BV9A 1DL3A 2VVNA 1ODZA 4N9BA 3UGVA 3UF9A 3RIKA 4MM1A 2XIOA 4QG9A 4WXYA 4C60A 5A69A 1EJXC 3IS4A 3K4DA 1GONA 4PMRA 3TQ0A 1EZWA 4C6QA 4IUOA 4ZQNA 1L6GA 3P67A 4QJ5B 4Z17A 1XYLA 2ZBTA 1JZ5A 5CZKA 1S2WA 1Y5VA 3TYEA 5I09A 1UD2A 3FDKA 1I60A 5CGQA 3EDDA 2J47A 4Z2HA 2R24A 2FGZA 2DW7A 3VDAA 1UUQA 1LRNA 1EB3A 3CV7A 1SZNA 2Z7KA 2YW4A 3IJ8A 5D2YA 3QW3A 2X1TA 3H7RA 4YYFA 2PU0A 2VRQA 4JN6A 3VIPA 1IWAA 4MLRA 3TCEA 3GQYA 3HFTA 1JD7A 1GHSA 1D9EA 1O5XA 3GTIA 1L2QA 2R1NA 2R1PA 1RJPA 2DVUA 2ISFA 3L4WA 2NUWA 3BJFA 4FA3A 2OEKA 3SCPA 3R10A 1WAUA 4CNOA 4D2JA 5A8GA 4NRSA 3IEBA 4XZBA 2XSXA 1MUMA 3IJ6A 4QITA 1NDZA 4DQWA 2WOQA 1XW8A 2ZFAA 1GKRA 3B8VA 1I0DA 2QLYA 3AYVA 4CVUA 1JRBA 1JJKA 2ZRXA 2V68A 1Q13A 2VFGA 3SECA 1KC7A 2VRKA 1XLDA 5T8GA 2RDXA 2V6AA 2YIHA 1GTEA 2G4JA 3L5MA 2W3ZA 4QISA 4UNLA 1MXDA 4M0XA 4QG8A 1W9XA 4Z2LA 3NQBA 4HTYA 1V79A 1XDLA 4TU1A 5JIWA 4ZO9A 1SW3A 1W3HA 4CU6A 2QUMA 1NM9A 5HOSA 2R82A 4FX7A 3NJ3A 2WNZA 2HZGA 4QSHA 3PBVA 3KXQA 4MPKA 4MG4A 2AL1A 1CYGA 1MSSA 1JFHA 1HO1A 1BWKA 3B3DA 2A3HA 3D6NA 1J12A 2J8FA 4JKLA 1WOBA 5C5YA 4MB5A 1JAKA 1QMLA 3VKAA 3IJ9A 4PEEA 5LGXA 3CHEA 2ICSA 1DXEA 5FF3A 2XH4A 4V1YA 3U7VA 3ZZ1A 3EKGA 4N02A 2Q3RA 2PDKA 5MKGA 4PEKA 4KBXA 1Z7AA 4FHAA 1W91A 4UFKA 3B05A 3VO0A 1U1JA 3MYOA 4CD5A 3R43A 4D6GA 2MANA 3BURA 1LRQA 3PZGA 1BF2A 4LYRA 2VELA 4AVNA 2ZDSA 5FJPA 3TQKA 3BG5A 4ROPA 2DVXA 4JFVA 3LHTA 1TG7A 4H6EA 1KO0A 3O6YX 4GY1A 4JN8A 1DOSA 2GWNA 2VWSA 3N6JA 4IGSA 1X8CA 3WLTA 1YDVA 3W7JA 4LJ3A 1JDCA 4QXIA 4NYYA 3ITYA 2VC7A 4HVXA 2ZVRA 3ELFA 4MY1A 3H55A 1G67A 1VJZA 1Z41A 1TV8A 3LB0A 3M43A 4Y9AA 1TKKA 1OCJA 4NJIA 3LXAA 1MEIA 3OIHA 4J5NA 3WY1A 1XSKA 4IH3A 3G2GA 1UWIA 4D72A 4ERGA 3WNPA 1YNQA 4IJCA 2WMGA 4KRZA 3EDFA 3GVVA 2WBGA 5H8PA 5F2LA 5I3HA 2D69A 4M8UA 3FDGA 3RRXA 3H6OA 4HIBA 1GVSA 4JTSA 1CZ1A 4CN1A 1EJRC 2UY5A 3ICJA 2IQ0A 4GGBA 6CGTA 3TNOA 3H2CA 5C9ZA 1OCBA 1KCZA 3NQGA 3VIIA 3NQ8A 5A8OA 4ZE5A 3BW4A 2DSKA 3WDPP 1O5RA 4LALA 3W07A 3TXZA 1EH9A 5K9XA 3CQJA 2GJXA 1PWMA 3KRBA 3T42A 3BLPX 3M0IA 1X6LA 5K2ZA 1CXKA 2D1ZA 3UT0A 1ITQA 1NQKA 4UR8A 3ORWA 5CPSA 1KBIA 5HULA 1DIKA 4JHZA 4L1XA 1XD0A 2XPKA 2FMOA 4LY4A 4HZ7A 3GU1A 4J28A 5DCDA 2X30A 2IW0A 2XWDA 3WX7A 3LXCA 4O14A 5FACA 1LOQA 3KRSA 1TE6A 5F4XA 3UCQA 2G4FA 3MZNA 3T1GA 4YLWA 1QWGA 2YCKX 5LIYX 3PUEA 3WQ8A 5FL0A 3FVDA 4MJ2A 1EQPA 3EX2A 4AMAA 1BRLB 1SO6A 2UWFA 3MMTA 5I3KA 3VC5A 2C71A 3KBWA 1XLKA 3SUVA 4NX5A 1W3JA 3KE0A 2E09A 4UFHA 3PC0A 5LHFA 3VFLA 4Z2JA 3OLEA 4IQEA 2PTYA 3E2SA 5C71A 4JTKA 3UNTA 4C1KA 3LCGA 5LNUA 3WK3A 1W9PA 2X0HA 4IIEA 2W5FA 5I2UA 3QFWA 3UERA 3B04A 8A3HA 3SCOA 3OB8A 1UKSA 1ISXA 4K8GA 2NQJA 2PP3A 1UP0A 3WF4A 4GWEA 1SMAA 9CGTA 1WXJA 1UKQA 4N9DA 3VM5A 3DYOA 4D6DA 3IARA 4C6IA 5AOUA 1XINA 1U33A 1UWUA 1ITCA 4C1NA 3XIMA 4PE8A 4UTKA 4C7FA 2ACRA 3PZUA 1VAHA 3M9YA 5ABFA 2GSJA 3UR8A 5EFFA 3MI3A 2F6XA 2CLKA 2V81A 1DJGA 2WVVA 4WKHA 4W88A 4DUOA 3BZGA 3HGOA 4UTIA 3NURA 5DY3A 2OVLA 2VFDA 4Z42C 3DZ1A 3WQ6A 2YA2A 3QF0A 2C7FA 3M16A 3CGTA 5CSUA 4OT7A 1J93A 3CC1A 1U5HA 3DG6A 1A47A 1XXXA 1GWJA 2YZ5A 4G9PA 1HJXA 3S1GA 1LQAA 2GUBA 3LPOA 3IVTA 3IRDA 4GH1A 1MRQA 3VGGA 4GJJA 3UJSA 3OLDA 3GW0A 3F03K 3BLDA 3N9KA 3A4XA 4DO4A 2PDIA 1P43A 3HFYA 2A3LA 3B4YA 2V3GA 4MDPA 3CB8A 2DGAA 4ZODA 3TSDA 2E6FA 3UR7A 3VILA 4R9OA 1WZKA 2PTXA 2NVDA 3H2OA 4DM2A 2ZUWA 4A8IA 3GIYA 2PC4A 1A4MA 4YS1A 3RR4A 3C0JA 1Y5XA 2WMJA 4JFUA 5C2CA 2F7FA 3KDOA 1ONEA 1WE5A 4DYJA 2FTWA 4V2XA 4MVAA 5F1VA 3UWUA 3MWCA 3WFLA 1L6FA 1S5NA 4IHCA 5TAOA 1GQIA 1T7LA 2CERA 1FH8A 3V18A 3P62A 3M5VA 2PP0A 3L0GA 3UESA 3KHDA 1XP3A 3ARVA 3DXIA 4A3HA 3BTNA 3OTRA 2QNEA 3DC8A 3BQ5A 4M81A 4EWND 4GQQA 4M6UA 3O16A 1RQHA 3V5FA 1OFEA 2VX5A 2OG9A 3RO8A 4V28A 3B0XA 4GQ0A 3MY9A 1KFJA 1TV4A 1RZMA 2PF0A 3HG3A 1IIGA 2J77A 1L8PA 5I00A 4PB3A 3IGHX 4MJMA 1U30A 3OP2A 2WB5A 1VRXA 1W0MA 3FJNA 1G4EA 3T0DA 1G7UA 4JTCA 4P61A 2UV8G 1HO4A 4U3CA 2VC9A 4JN7A 4E4FA 3EDJA 3GNNA 3IJDA 3I3DA 6A3HA 2DZBA 3WFAA 1QPKA 5FJIA 3HPFA 2GGEA 2INFA 4H19A 2YBUA 4QGCA 2CBIA 4JDYA 4KFPA 1VENA 3EAUA 1OQFA 1UC4A 4Y2WA 1E0XA 2EXOA 4S2BA 2IKHA 1XG3A 4MYXA 1HJQA 4OHQA 1EJ7L 1WUFA 3Q58A 3GG7A 1UQZA 2PDYA 4P7NA 3DAQA 3KAOA 1EJVC 4ACZB 1S3HA 3BMVA 2BSLA 1QR7A 4YTQA 1VFTA 7TIMA 3W75A 1I2PA 1RV8A 3USZA 1W8GA 4DZHA 3MA8A 3RK8A 4AWUA 3B06A 3TIMA 4J2PA 2F8QA 3WBXA 4F0KA 3HN3A 2GOKA 2XN0A 4JTEA 1DWAM 4GD0A 1A5CA 5DANA 5C9RA 2VEIA 5I06A 4PCPA 1Q2RA 3T0BA 4DJFD 1JUEA 1Y5WA 1QO2A 3VNDA 2OWXA 2FMNA 1KD0A 2YXGA 4GMEA 3QZAA 5F2GA 5K4ZA 4LC8A 3VNIA 1FHLA 1AK5A 3GC4A 1J4EA 3WDQA 1E3XA 1E56A 4LW7A 3GM8A 1YBQA 5I24A 3FEMA 1U83A 3CUXA 1HP4A 3NA8A 2XHYA 4RV8A 4Z1YA 4J3XA 1K8CA 4JTTA 4N9CA 5AKQA 1NWRA 3GB6A 2XVNA 1SU5A 4MWAD 4W7WA 2VFHA 1W3NA 5GQBA 2PGEA 3SEPA 1UJQA 1UCWA 2DZWA 2DIJA 4JL2A 3L5AA 4H1ZA 3CUFA 1M9HA 3AIUA 1POKA 3TWAA 1ZALA 3KTCA 2A0NA 1GHRA 3TC7A 4ZSUA 4AYSA 2C1HA 3BLOA 4UZSA 1NFGA 2BHYA 3IVSA 2PWGA 3W24A 4GYFA 1UH2A 1IXPA 4XAYA 2JKAA 1QXLA 4JTHA 3N3MA 3OBAA 5I02A 5AYIA 1RXOB 1REQA 3AS2A 5HJLA 2PWHA 3CUHA 3SJ3A 3V1PA 3QW4B 5G4WA 4ZO7A 2R1LA 1LL6A 4I6VA 4UTTC 3DENA 4PUUA 4HYVA 2YOCA 4E8CA 4EF8A 4U4MA 3PG8A 1UOKA 1XG4A 5DCEA 3BSHA 4DF2A 3CK5A 3AU6A 1VD6A 2FYMA 4AISA 4KCTA 5AY7A 3T40A 2XVKA 3BAIA 1ENUA 4I9JA 5I3JA 1NSJA 1UMLA 4NZCA 3E49A 3NR0A 5D30A 4WEVX 4FPSA 1YX1A 3TROA 5B7YA 1TTJA 2QXWA 5H91A 1H1NA 2QW5A 2ATSA 2TRSA 3QOMA 4E4PA 3D3AA 3O2LA 7PTDA 3RLHA 3EXSA 2V5CA 4JR5A 1VC4A 2ZXQA 4GY7A 3HV8A 4IMCA 3N18A 1O6IA 1C91A 3FA3A 4C1NB 5FJUA 1FHVA 1W56A 1PV8A 3GRIA 1YHTA 4KGLA 3ARUA 5CC3A 3IJ7A 4QS5A 1R47A 1RJQA 3NDZA 1J0ZA 1A5MC 3GXTA 4PMNA 1SPQA 4KEUA 3MMWA 4N6FA 1N8FA 1OGBA 4W7VA 4AD0A 4LAMA 4UFLA 3NZQA 3S8HA 1MNZA 2XM2A 1R6WA 3W2NA 2YKKA 1K70A 1UD5A 1ZTVA 3VU2A 3UXKA 3W1NA 4D6HA 2YB4A 4JTDA 4GVHA 4NJJA 3UJEA 1MEHA 3G6MA 2BNJA 2WJFA 1XJBA 5EMKA 4D6EA 3E96A 3UXLA 3M5YA 3SDOA 3EB4A 1OFRA 3A5FA 3GKFA 4ILSA 1QI4A 3KLLA 3CIWA 4HOZA 3FFSA 4ZB5A 1XKJA 3AO0A 4GLEA 4PH6A 2WNNA 3MSDA 5EFDA 4ZGYA 4MWAE 5A2AA 5FF4A 3OVPA 1SGJA 3WBAA 3NNTA 2B7NA 4QX4A 1V3JA 2OLHA 4OECA 2YL9A 3A5VA 2WNQA 3UA4A 4XISA 4W5UA 3BV4A 3OEXA 4RE2A 1PCKA 1V0MA 1M53A 3GLCA 5DLCA 3LHUA 1EOMA 4BQ4A 1G94A 2ACQA 3A21A 4HGXA 2FGBA 3OZMA 1AQFA 2HQAA 1JZ6A 1PZ2A 4ML4A 1I2QA 3TOYA 2Z2BA 1BTMA 5E9AA 3DFYA 3PPFA 1XYZA