3PBMA

The crystal structure of adenosine deaminase in complex with chloropurine from pseudomonas aeruginosa
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
313
structure length
313
Chain Sequence
YEWLNALPKAELHLHLEGTLEPELLFALAERNRIALPWNDVETLRKAYAFNNLQEFLDLYYAGADVLRTEQDFYDLTWAYLQKCKAQNVVHVEPFFDPQTHTDRGIPFEVVLAGIRAALRDGEKLLGIRHGLILSFLRHLSEEQAQKTLDQALPFRDAFIAVGLDSSEVGHPPSKFQRVFDRARSEGFLTVAHAGEEGPPEYIWEALDLLKVERIDHGVRAFEDERLMRRLIDEQIPLTVCPLSNTKLCVFDDMSQHTILDMLERGVKVTVNSDDPAYFGGYVTENFHALQQSLGMTEEQARRLAQNSLDARL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Adenosine deaminase
publication title The crystal structure of adenosine deaminase in complex with chloropurine from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
total genus 121
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.5.4.2: Adenine deaminase.
pdb deposition date 2010-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3pbmA00
3UBPC 1GKRA 1UIOA 1A5OC 1NFGA 2ANUA 4LANA 4D8LA 1FWDC 3PANA 4HK6A 4DLFA 4ERGA 3F2BA 2D2JA 2QS8A 4LCQA 2OQLA 3HM7A 3DUGA 4H01A 4XAGA 2HBXA 3GTXA 2W9MA 3E38A 1EJSC 5AKQA 4H9XA 1S3TC 2QT3A 4CNUA 3NEHA 3LGDA 2UZ9A 4GX9A 1PTAA 1E9YB 4QSFA 4IFOA 2F6KA 4RDVA 4L9XA 1QW7A 3GU2A 4Z42C 3O0FA 1EJXC 3SFWA 1POKA 5CH9A 4F0SA 1A5KC 2YB4A 4RE0A 2Z27A 4V1XA 4UB9A 3MVTA 1KRCC 3B0XA 3LS9A 4KEUA 3RHGA 1XGEA 4H9UA 3S4TA 4H9YA 4IFKB 2HQAA 3DCPA 2A3LA 3CAKA 4E3TA 4WGXA 4GY0A 1FWIC 2GOKA 3TN6A 4GX8A 3MJMA 1RJRA 2Q01A 3OU8A 2E1WA 4H9MA 4UBPC 1RA0A 2EG8A 1PB0A 3K5XA 2Z28A 4ERAA 1PO9A 2Z26A 4CEXC 4C5YA 2DVUA 4WVXA 4DZIA 4DZHA 4TQTA 3LNPA 2YB1A 2WJEA 4B91A 4PCNA 1EYWA 3LGGA 3IRSA 4QROA 4DO7A 1IE7C 1YNYA 1XRTA 4B3ZA 4HA0A 4IQJA 2R1LA 1ITUA 3E0FA 3IGHX 1EJWC 2PUZA 4GK8A 4IH3A 2DVXA 1V51A 2PAJA 3TN4A 1ZZMA 1ONWA 4LEFA 4LFYA 1UIPA 3HPAA 3E3HA 2BGNE 1J6PA 1M68A 3QY7A 4JOMA 3TN3A 2UBPC 2YXOA 4LAOA 4EPDC 2P50A 1FWHC 4J35A 3S2NA 3T8LA 4HJWA 3PBMA 3GTIA 4BY3A 1K1DA 2QPXA 4LH8A 2O4MA 1KRAC 1NDVA 4C60A 2Z2AA 4PBEA 3EWCA 1BF6A 3F2DA 1V4YA 2R1NA 4M51A 2P53A 4DYKA 3MSRA 1YBQA 4G7EB 2BB0A 4KQNA 2QVNA 1FWEC 3LU2A 3A4JA 1FWCC 1RK5A 3E74A 2IMRA 4C6JA 5FSEC 2VC5A 2Z24A 2WM1A 1UBPC 2ICSA 4BKNA 1O5RA 2HPMA 1RK6A 3S2JA 3EWDA 3BE7A 4C6CA 1I0DA 4KEVA 5FSDC 1A4LA 2D2HA 3IV8A 4NG3A 4C65A 2GWNA 3K2GA 4LAKA 4IGNA 4RDZA 2GWGA 2OGJA 4HK7A 3RCMA 3LY0A 3RN6A 4L6DA 4DLMA 3ISIX 1WXYA 3QY8A 4EPKA 5HMFA 4CNTA 3GIPA 3WZ0E 1NDYA 3FEQA 3AU6A 4YIWA 3OODA 5HMEA 4R88A 3T1GA 3ID7A 1EZ2A 1V79A 2VC7A 3ICJA 2VR2A 2ZC1A 4C6DA 1A5LC 1A5MC 3A3WA 1O12A 2ADAA 1FWBC 4IG2A 2FVMA 1PSCA 4INFA 2FTYA 3CS2A 3URNA 1NDWA 3EGJA 4PBFA 4ZSUA 3F2CA 3OVGA 3AU2A 1UMLA 3S2LA 3ITCA 4XAZA 3PNUA 1YIXA 3NQBA 1DPMA 4C6OA 2GSEA 3DC8A 3URBA 4GC3A 3QY6A 5HMDA 3UR2A 3ORWA 4C6QA 1K70A 2R1MA 4HK5A 4QTGA 2GZXA 3PAOA 1HZYA 4XD3A 2Z25A 3WYZA 2OOFA 4DIAA 4GY7A 4DI8A 1R9ZA 1RJPA 2CZVA 3WMLA 1RAKA 3D6NA 2WJFA 4C6PA 3IARA 1WXZA 4H9VA 2EG6A 2HBVA 4LALA 1FWAC 4EPEC 2XIOA 1J5SA 1FWGC 2DVTA 1KCXA 1FWJC 1P6BA 4ERIA 3KM8A 1FKWA 4I6KA 2AMXA 2OB3A 4CEUC 1R9XA 3UF9A 4XD4A 3B0YA 3GU1A 1R9YA 4XD6A 1ADDA 4F0RA 3URAA 3UR5A 3GU9A 1XWYA 2Q09A 3OOQA 4G2DA 4LCSA 4AC7C 1EJRC 1GKQA 3HTWA 4ZSTA 2I9UA 3FDGA 4F0LA 3CJPA 3GIQA 3MDWA 3G77A 4I6VA 3AUOA 1M65A 4IFKA 3MTWA 1P1MA 2VM8A 4PCPA 4XAYA 2AQVA 4BJHA 4NP7A 3TNBA 1J79A 1W1IE 2KAUC 4C6NA 3MDUA 4C6MA 4IFRA 4H9ZA 1ONXA 3V7PA 4EPBC 4NI8A 3UPMA 4C6LA 2FFIA 3TN5A 4H9TA 4IGMA 4RDWA 1VFLA 1V77A 3GTFA 2EG7A 4KF1A 4QS6A 4XAFA 4GY1A 2RAGA 3URQA 1V7AA 4GZ7A 2HNHA 3MVIA 1QXLA 4IF2A 1YMYA 4WHBA 1M7JA 3E0LA 4B90A 4GYFA 1A4MA 1J6OA 4PE8A 4XD5A 4RDYA 4GXWA 2E25A 2VHLA 1YBQB 1JGMA 3N2CA 4V1YA 4CQDA 2R1KA 2Y1HA 3NURA 3QGAC 3S2MA 4QRNA 4KEZA 3LSCA 3IPWA 4R85A 3LSBA 2Z29A 1XRFA 3R0DA 4QS5A 4CQBA 4ICMA 4RZBA 2Z2BA 2Z4GA 3OJGA 3OQEA 1KRMA 1RJQA 4AQLA 1EF2A 4KESA 4C6KA 1FKXA 1P6CA 3C86A 3RYSA 4C6FA 4CQCA 1RA5A 2PGRA 3GUWA 3FDKA 4C5ZA 2I5GA 4EP8C 4MUPA 1POJA 1NDZA 3PNZA 3GG7A 5A6TC 5G4HC 2AQOA 2PLMA 1I0BA 2FTWA 3MPGA 2WJDA 1E9ZB 4G7EA 1K6WA 2Z00A 2O4QA 4KETA 1ITQA 4OFCA 1KRBC 4LCRA 4C6EA 4CNSA 4R7WA 3IJ6A 4J2MA 4KIRA 3JZEA 4H00A 3F4DA 4DNMA 4C6BA 2OODA 4IG2B 4C6IA 4P5UA 2Z7GA 3GRIA 4J5NA 3F4CA 3A3XA 4GOAA 1A5NC 2VUNA 4GBDA 4DI9A 1EJVC 2FVKA 2YZ5A 3K4WA 4LAMA 3O7UA 2G3FA 3QGKC 4B92A 1YRRA 3B40A 1FWFC 3SO7A 1EJTC 2PGFA 1GKPA 3LA4A 1EJUC 3IACA 2R1PA 4KERA 3T81A 3GTHA 2D2GA 3E2VA 5E5CA 3MKVA 2HPIA 5LXXA
chains in the Genus database with same CATH superfamily
1GKRA 5DLCA 4WKFA 4Z1DA 3BLEA 3BTNA 4WDTA 2QS8A 4YN5A 1XPYA 2BGSA 3N73A 1BYBA 2WMIA 1H5VA 4LVDA 1OX5A 3VGEA 1F73A 2TPSA 2X0YA 3O6DA 4PMRA 1SVDA 3IVUA 1KRCC 5FJRA 1RVKA 3WNOA 1E6XM 2YR1A 1LF1A 5LIYX 4UCFA 5IDZA 2ZZ1A 4N9BA 4H7CA 3MO7A 4ZE5A 3B8VA 1MUCA 2EJAA 4FP1A 2GGJA 3RK8A 1O5KA 4M81A 4D6DA 1IV8A 2IW0A 3GHSA 3W74A 3WX7A 4HT3A 4Z1AA 3KL0A 4NXKA 4WF7A 3HO8A 3CK5A 5AZ0A 1F5ZA 5AVHA 3NOYA 4LNCA 4DWSA 3TQ0A 1L9WA 3MP3A 4RLIA 3ZVIA 4EE9A 3CLMA 3VNIA 3NZPA 1IGWA 4ZO9A 1CECA 1OHLA 2C1GA 2RJHA 1Z69A 3G0XA 5LXEA 3WD0A 5AHEA 1ME9A 4NSBA 1OK4A 1CEOA 1SYTA 1CWYA 1OYAA 1ZZMA 1JUEA 3HPAA 1XYMA 4PEEA 2OO6A 3AS3A 2ZDSA 3WMSA 2ZBTA 3PUEA 3VGDA 1EP1A 2VEKA 2BOGX 1J5TA 3NQEA 3VYLA 3LI1A 1QVBA 3O07A 2DT1A 3B04A 5H8UA 4AZCA 1XBZA 1FCQA 4DBDA 4IPPA 5XIMA 3R8RA 1E0UA 3QMTA 2QVNA 5D9NA 3VKKA 3DFTA 4NIRA 3GXMA 4C6JA 2P8CA 5RUBA 2HRWA 4CQ8A 1EA9C 1HJUA 4MAZA 3DYOA 1CGYA 5LNVA 1M7OA 4B2DD 3EDDA 3W6YA 1A5BA 4W89A 4DHGA 1OFRA 4NG3A 1VBUA 3C6CA 2G96A 4DBEA 4NF7A 3EXRA 3RCMA 1R7AA 3CYVA 4RPPA 1Q5MA 4AZBA 1TX0A 1F4HA 1Q6FA 2PP3A 4YIWA 1ICQA 1Q7ZA 1KQZA 3VIKA 1V7YA 5HWJA 1FCBA 2ZVIA 2NQJA 3S2LA 2OGYA 4QSHA 2WMIB 3RCYA 1SPQA 4UWMA 3GZ3A 3NQBA 4PSRA 2WHKA 3EX6A 2ZZ4A 1KTBA 1AODA 2VKZG 1QFEA 5DMYA 5CZ0A 3NL5A 3B9AA 1GZGA 3AYSA 3NZGA 4MUZA 1P0DA 3UR7A 3MKKA 3IJDA 1JYNA 1HJQA 4OBRA 5HR7A 3OO2A 3VD5A 2TAAA 4V33A 4H04A 1QU4A 3KX6A 1EHAA 1U5HA 1XYAA 1Z32X 1XWYA 4KRTA 4NXSA 1BVWA 3QBUA 2WYSA 3W1QA 2V8ZA 2FZNA 5GJMA 4LB4A 5DBTA 3CLWA 3B0VC 5LNSA 4UMBA 4DWSB 2Y7FA 2AQVA 4CN6A 1VHCA 2W61A 3C52A 1TWIA 1TPDA 3IK2A 1KCKA 5FL0A 4TX9A 5T8GA 2V81A 3OW1A 3K4DA 3MMUA 2HTMA 3G1RA 2QCNA 3DFPA 1E6QM 4K7YA 4PTWA 2YGYA 1A50A 3POCA 4XB3A 1V7AA 1UJQA 3DXIA 3C0SA 4BCEA 3O05A 2J7HA 4TX6A 7TAAA 1A4MA 2VNCA 4BS0A 1D7FA 5K2ZA 4AZCB 2V68A 4ZR8A 4L6OA 5ENLA 3WNKA 5IDIA 2J74A 3LCIA 1G7UA 3UZZA 1UWQA 3L4YA 3V0SA 1KKOA 3WK3A 1WBJA 4L1WA 1VQTA 2PC8A 3WLQA 2WZIA 1WB0A 3KFTA 2WLYA 1JR1A 4MLRA 1FKXA 1RQBA 2I5GA 4EP8C 4MTVA 4B16A 3F4WA 4W84A 4BQ4A 3H54A 2FFCA 2VZVA 2WHMA 1S5VA 3GNDA 2FTWA 3C56A 4HNVA 4DUVA 4GH1A 2Z00A 2EBNA 5C2GA 5LYRA 4QDPA 4L7ZA 5BRPA 3E12A 2PB1A 3ARWA 1HL9A 3G8RA 4C6BA 3DEQA 3K13A 5EMYA 3F03K 3LMYA 4P5UA 3W85A 3PPCA 3VOFA 2PD9A 5HNUA 1GOXA 4YHEA 3T44A 2IPFA 4HPHA 2JBMA 4O19A 3OLGA 4FHAA 3SO7A 5A6SA 2BHZA 3FJNA 2XGBA 2VYOA 1SJDA 2FZDA 3SEPA 5CPSA 2WSRA 2BVDA 3QEZA 2DT3A 1BSIA 5G1TA 1E56A 2OKTA 4LANA 5TNVA 5AYZA 4Q8MA 5C2CA 2H3BA 3TFCA 1LROA 4NYUA 4ZOAA 5CZKA 3HM7A 1H7PA 1BRLA 1AZ1A 4LAZA 4I3GA 4XAGA 5D03A 4YLWA 4JTEA 3R2GA 3W0KA 2UZ9A 2J75A 1GQIA 4HNTA 1SFJA 3HB9A 5AB3A 2XN2A 1TMLA 1HKWA 3SFWA 3QVQA 1KM4A 4PMYA 1QPOA 3SBFA 4AVNA 4U31A 3VCNA 5U7SA 3V75A 1EPVA 3V18A 2I56A 4ECLA 5A1AA 4GO9A 4WRHA 2VDGA 2HNEA 3RHGA 3T08A 3W7IA 1Y5WA 1QW8A 4UZSA 1EGMA 1HTIA 3IGUA 1UKSA 3P5YA 3M47A 2V6AA 1XCXA 2CKRA 4ZQCA 2ZUTA 3WNPA 3TMLA 3I3EA 4MDPA 1HGWA 2JALA 2E6FA 4A35A 1CX9A 2FPVA 2Z28A 5HBFA 4ERAA 3GDTA 2Z26A 3NM1A 1LWJA 3PUOA 5CXPA 4P8XA 4W9TA 1UASA 1YX1A 4HMCA 5CPOA 3MP5A 1CB2A 3W7DA 4B91A 3N25A 3WQPA 5TBOA 3H4GA 2VENA 1MDLA 3I7RA 5C55A 2V2DA 1BVNP 3POHA 1BQGA 4HA0A 3RLVA 4US5A 4LRSA 5JMUA 3ES7A 5E9AA 4EVZA 4UTIA 4AFYA 1ISYA 3UP8A 3VKDA 2WLZA 1RHCA 3BJFA 1V51A 3NSMA 1RQHA 2HV5A 4F0MA 2HDJA 4KFPA 2QPUA 3QY7A 3G3MA 1XH1A 4A8NA 3QJAA 2UBPC 1AUSL 3NZRA 4EPDC 1UP3A 5KSWA 1EF3A 3TKFA 1LORA 3MSDA 3PC0A 1XYCA 3M46A 4Q32A 1NFBA 4HD5A 1CZ1A 1R3SA 2BB0A 4LT9A 1JXKA 1FWEC 3WJXA 3WLLA 4KGJA 4GYPC 3PJTA 4R9OA 5HMSA 4O14A 3S1XA 1WDDA 3L4UA 5DELA 4M56A 5PTDA 1DIEA 4KBXA 3MANA 4QE4A 4PB4A 2ZKMX 3GW0A 3LTPA 2QULA 1DOSA 1TWZA 3IV8A 1OF6A 1VPYA 5CSRA 1PUDA 4A22A 3LY0A 1TTJA 3W01A 5D37A 2EEXA 1O66A 2CC0A 5DFAA 3KRZA 4MY9A 5IOBA 4H7VA 2CLLA 5GQBA 5HMEA 1EQPA 1LL6A 4AYGA 1DL3A 3KBWA 3TNOA 3GW3A 4AVFA 1Z48A 1O12A 3R79A 4PH6A 3L21A 5XINA 1S39A 1BRLB 1OGBA 4AD4A 3AS2A 1W17A 1K02A 3KBMA 3D5HA 5C9ZA 5D30A 2QQ6A 4RNFA 4Y6GA 4XD3A 1TREA 3SQLA 3VIFA 3D3AA 1ZENA 3E9AA 3P0WA 4WGHA 4AZGA 1H7OA 3U2EA 3PHAA 5K4XA 1QT1A 5C9UA 3F5LA 4TR9A 4F9JA 1FX6A 3ALGA 1KD0A 3VNLA 1FWAC 1Q8AA 3U5UA 2NT1A 3WBAA 1DORA 2A21A 2E4TA 4HMDA 1H7NA 1J0IA 3QH2A 3TTSA 2DZXA 4WUIA 4OE7A 3EXTA 1R9YA 3EWXA 3CQ0A 4KWWA 1G5AA 4GINA 2QJIA 3T05A 3ZVHA 5FAGA 3FXYA 2YOCA 4UFHA 3EDKA 3O2LA 2I9UA 4IGHA 3TC6A 1JZ3A 1A5CA 3DKLA 1U1HA 2NUXA 1PZ1A 2OWCA 1VHNA 4A8LA 3WLIA 3GHUA 3W73A 1NEYA 3AICA 3TFXA 2R91A 2Y0FA 1W1IE 4ORIA 1Q2RA 2NXHA 2BVTA 1RZMA 4GI8A 4NYYA 3K8LA 3GX9A 3SCNA 3WBXA 1FBAA 1XRSA 3G1SA 4IIDA 4BQ5A 4PUWA 4LWWA 3W1UA 3BMXA 2ATSA 3N4AA 2J7BA 2VCCA 4NVTA 3UY8A 5SWUA 3VD3A 1O6IA 3LLDA 1KCLA 3KBVA 4JICA 1A3WA 1YMYA 1E1FA 1TKKA 2HS8A 2G4JA 1OINA 3PAJA 2BXZA 1FHLA 4RW5A 1SFTA 5BMXA 3CWNA 4CQ9A 3N12A 4WXYA 2D0GA 6REQA 2YBTA 4YMZA 2ZX9A 1WNOA 3OQEA 1XQLA 3C0JA 4UTKA 4ML9A 1VFMA 3H2EA 3KOYA 1MXGA 1XBXA 3AYVA 4ORMA 1VFHA 1EPXA 4FA3A 4PL1A 3L5AA 1UPPA 3VMNA 2J7CA 2IXUA 3TSMA 1EEXA 3EMCA 5CSYA 1GQLA 1PIGA 3MI2A 3FJ4A 3SIZA 4C6EA 1SO4A 4S2BA 3GH5A 3TA6A 5I09A 3HGOA 4DJDC 2NWRA 4JKMA 2OJPA 1R2TA 1A5NC 3CMJA 3BVJA 3K4WA 1BD0A 1BVZA 3BL3A 3NQ7A 4IQEA 2PD5A 1A0EA 3LA4A 3V1PA 3IRDA 1XQKA 1JCJA 3TWAA 3SDOA 1NQ6A 4BK9A 2AKMA 3P2VA 4MADA 2R8WA 3FS2A 2EPKX 4WLCA 4MZ1A 4AZ6A 3B06A 2X1SA 1TA3A 1KFKA 1TCDA 5F1VA 3KWSA 2JE8A 4JTQA 1NVMA 3RU6A 1B57A 4GQ0A 3E38A 3AAMA 1EJSC 5I06A 3NEHA 5EB8A 4ADSA 3TJ4A 3KVJA 1PTAA 1DKWA 4IFOA 3UGVA 3F4NA 3VKCA 1R47A 2HMCA 3ZVHB 1WQ5A 3SM0A 3TYDA 2PC4A 1A5UA 2DSWA 4L9YA 1R2SA 3B0XA 3O1NA 4UNKA 4HVXA 1EKOA 2CLHA 2OLHA 4JTCA 4LUTA 4BEUA 4UTHA 2CPUA 3WNNA 4QG6A 5G5IA 1UD4A 1T40A 2E40A 1PWLA 3TW7A 3BO9A 2O9RA 4G8TA 2E5BA 4L1XA 3UWWA 3E0WA 1W3JA 2OSYA 5GNZA 4O4WA 5I79A 2G37A 3FX4A 2C18A 1R46A 3USZA 3WH8A 2ZWYA 3KVMA 3ME3A 4DXKA 4UQCA 4AXNA 2OTDA 3THQA 3PBVA 1XLFA 1JULA 1GW1A 5K4ZA 1Q2SA 3LGGA 4IX2A 3CT7A 1MRAA 4D9PA 5T26A 2YL5A 4B4FA 1DXIA 4I9AA 2Y7EA 4X2RA 2RJGA 1RD5A 2PUZA 3EDEA 3CH0A 3FCPA 2X05A 6REQB 2DVXA 2DW6A 3M0HA 4E2VA 3MO4A 1GOWA 1AD1A 3SQSA 2YXOA 2P0IA 3GFXA 3S1GA 1MUWA 3GTIA 2Y8VA 2O4MA 6PTDA 1O94A 1TE6A 5I07A 3KLKA 1XI3A 3FY1A 1ZU8A 2NZLA 1B3ZA 3N17A 2Y2WA 5I02A 1RK5A 3HMCA 3PY2A 5A95A 2QCDB 1F7BA 2A79A 2V30A 4NJHA 3LXAA 3OYXA 4BFAA 3DYMA 5HATA 3S2JA 3S83A 3RMJA 1OVDA 1EXBA 1GOIA 3PWGA 4N4PA 3GXNA 1R87A 4JGDA 3TCEA 2ZYFA 1UZHA 1FXPA 4DJEC 3W2UA 3STGA 4P7NA 2CU0A 4O13A 3WNMA 1EC7A 4B9ZA 1YYAA 1C7SA 1C8QA 2PRMA 4UR9A 3NL6A 4YTTA 7ENLA 1EZ2A 1KO0A 2ZUSA 1HL2A 1V6TA 3MHUA 3EDFA 2NQLA 4GFSA 4ZTXA 1IT7A 1TA3B 1ECQA 3WG6A 3FSUA 2GDUA 1AD4A 4HJFA 3NA8A 4ZZ9A 2BMBA 5AHNA 2AOSA 4GC3A 4PGLA 4ZOBA 1PX4A 4O57A 4CN1A 2ZTJA 4ICNA 4DJDD 3VZXA 3M1ZA 3WYZA 1PZ3A 2OOFA 3W27A 3KAOA 1TIMA 3CZGA 1T96A 2XPKA 1WOBA 7CGTA 2DIJA 1WXZA 2PDIA 3E96A 3NQGA 3H8AA 2PEVA 1H41A 2ISFA 1OSEA 4C7DA 4LUTB 1KCXA 1FWJC 3KHDA 1P6BA 5I00A 3H7UA 1UZ1A 1I2NA 5LHFA 2UWFA 3R4IA 2XIIA 2J25A 4F0RA 2P10A 3UR5A 1Y8BA 3S5NA 3VDCA 1G7VA 4AHOA 3UESA 3N34A 1S3HA 1XLLA 3W07A 2ZVRA 4DELA 5I6SA 1ZJHA 3O9NA 5HQMA 4WQ6A 3OLDA 3WQ5A 4GUGA 2A3HA 3W1MA 1OYCA 1Q6LA 2NX1A 2QIWA 3MDUA 4ZA0A 2OMAA 3WQVA 1OWQA 4X60A 3MMTA 4PC8A 2VMFA 4AW7A 4PCFA 3ZJ8A 1XICA 1B3VA 5EMKA 1GVSA 1C29A 1TWDA 4Q7BA 2WVTA 1VFLA 5KITA 4I7UA 5M17A 3TWBA 3CASA 2YCKX 5D33A 3RNDA 1SMDA 3UXLA 3ONBA 4TU1A 3M7WA 4ZO7A 3DFYA 2D22A 2HNHA 4C1NA 4LBRA 1M7JA 1Y7VA 1AQHA 3VTRA 2GQAA 1OC6A 4LQ1A 4RCXA 1BPLB 3VNMA 3I7SA 3UWYA 3Q45A 4ML4A 4W93A 3FLUA 4X22A 1W3KA 1GTEA 3WF4A 3ARRA 2Y1HA 1QOXA 1XKYA 2CLEA 3STCA 3R0DA 2HZGA 3LGEA 3ZYZA 4P7LA 5A6BD 2GJLA 5B7YA 1ZP3A 2CFFA 2PDHA 5EMJA 1EF2A 1VC4A 4O8AA 3PUDA 5BRBA 4M6PA 3APTA 4ATDA 2A6NA 5H6HA 1W3IA 1MEHA 3ANYA 3PULA 3OGRA 2PLMA 5IHSA 4NZFA 3CU2A 4JQ4A 4G7EA 3GR7A 3J7HA 1HJVA 3DX5A 2VQTA 3CQIA 2BODX 4QEHA 3TQKA 1W1TA 3ZZ1A 1GYNA 4QGCA 4J2MA 1JI1A 5LHEA 4Q8NA 1R3RA 1RBLA 2Z1XA 3VE9A 3A3XA 3AHXA 5T9CE 5D2VA 2FVKA 5GNYA 1DWFM 4GNKB 3R94A 3NQDA 1UKPA 3P74A 3VXGA 4CCDA 1EJUC 3CUGA 3PTDA 1B4EA 6A3HA 3E2VA 3E6EA 3MKVA 1MDRA 4OJYA 4HZ6A 1A5OC 4FS9A 5EKYA 4WSKA 3PUGA 5I24A 4DJED 1H1ZA 3QW3A 2CKSA 4F2BA 1I8JA 4PRWA 2W9MA 3CB8A 4IJCA 5C5YA 4R53A 4FNPA 1VBJA 1EP3A 4QCFA 3M07A 2WQPA 4OBTA 4K1GA 7PTDA 1UPMB 4GJIA 4Z42C 3CM4A 4YTQA 2HSAA 5A69A 1AH0A 1XV8A 3U3HA 1B30A 4PULA 1VZWA 4GLEA 1C93A 5CC6A 3BPWA 2XSXA 1DJHA 3S4TA 3EOEA 3DCPA 5A2CA 3OGSA 1PZ0A 3QHOA 1LYXA 1TE1A 1A47A 1VPXA 2E1WA 4UBPC 4BI5A 5DRCA 1D3GA 3KRUA 3S2CA 3CL8A 4EK7A 2CHOA 2H6RA 2OO0A 1Q66A 5KMYA 4ROPA 4YU1A 1ELSA 3MUCA 4RW3A 2NLIA 2AL1A 4C1NB 1F05A 3GC4A 1OX4A 1E6ZA 4DO7A 2OEMA 3GNXA 1UB3A 1W37A 2CLOA 4LYRA 3GE7A 1SSGA 3BLFA 3DENA 1Y5VA 4XAPA 4HNLA 3EWBX 3PR2A 1BQCA 3P60A 4HA4A 4F8XA 3G1XA 4QHRA 2BTMA 2W91A 3UGRA 4L5ZA 1L6SA 4N6EA 1MEIA 3JRKA 2VFFA 1ISWA 1PL9A 3LRMA 4F48A 2MNRA 3GB6A 4ATLA 4J35A 3N18A 1AQMA 2ISDA 4PN2A 1X6LA 3QPZA 1XC4A 3UZWA 2BX7A 3N3TA 3GDBA 5H91A 2NX3A 2EJ1A 2EO7A 1BF2A 3LK6A 1YBQA 3G24A 1Q4WA 4G7EB 1DWGM 2G3JA 2GPTA 1T8XA 3TYUA 3DGBA 3BH4A 4A3UA 1HKIA 1UR3M 1W9DM 3G22A 3EMQA 2ZRZA 1M5WA 2VD9A 3W7RA 1MW1A 3L7RA 3CGTA 3M43A 4TMCA 3KP1A 1J96A 4HZMA 2WCAA 3H7VA 5HNTA 1HJXA 2P1FA 4GQQA 5C7HA 2GUUA 4PMUA 5HOSA 3TA9A 3SUSA 3S47A 3AJXA 3WZ0E 3PF3A 4CU6A 3GBDA 1L6FA 2QJHA 2D24A 4KCVA 3GVGA 2YZRA 1A5MC 4IG2A 2POTA 4UTWA 5IM51 1J9YA 1NY1A 4UQ9A 4F40A 1K8ZA 1B31A 4XVDA 4W8BA 3IUHA 1J11A 2O55A 4IICA 1P0BA 4UOQA 1OY0A 1VB9A 1ZBKA 2ZRYA 4C6QA 3L5MA 3L4TA 2E68A 2JGQA 5CAHA 4K8HA 1VFUA 3S6TA 2PRLA 3GD6A 1PE1A 3WQ8A 4S3DA 2OZ3A 4QJ1A 1RJPA 2WMFA 4Y9NA 1GVOA 1HUVA 3WMLA 3WCZA 1HO1A 1ZALA 4Q7NA 1W9XA 2EHHA 1S5WA 2ZX8A 1SW7A 4XIAA 2D3LA 2FTPA 4ZB0A 4DWSC 4O11A 4FIRA 4BWLC 1W91A 5CG7A 3JVAA 4MYXA 2IQ0A 4J27A 2QUMA 1QR7A 1KLYA 2Q09A 2WB5A 3OOQA 4AC7C 4JIQA 1GKQA 3PBGA 4WDXA 1OCQA 3T0CA 5I3HA 3FDGA 3TR9A 1MVYA 1TR9A 3QR3A 4QEEA 1FH9A 3DYPA 3VM7A 1OX4B 3G77A 1KR0A 3MTWA 4E8CA 3S0CA 3TNBA 2QEZA 2UY4A 5CZSA 4C6NA 1NFPA 4MG4A 4D6HA 4H9ZA 4L4MA 4XKYA 2PF0A 1UQZA 4GH3A 3BMWA 1M3UA 1OM0A 1PWMA 1V77A 1GQKA 5KZEA 3SADA 3EDJA 3VZYA 1E9LA 4Z1BA 3ERPA 4GZ7A 3SCUA 3W38A 1E51A 2NXGA 5D09A 3S9YA 1QBAA 1ZQ5A 1WCGA 2VOMA 1XIIA 4LW7A 1W3LA 2DZAA 5D2YA 3UA3A 2BHYA 4U3CA 2VQUA 2OVLA 4K68A 2HXUA 1G0CA 4Z0SA 1YBQB 5TF0A 3OVPA 3L2IA 4CQDA 5JH1A 1PKNA 3UG4A 3N4EA 8A3HA 5CLWA 5CSSA 1UHVA 2OPJA 1F74A 2BNJA 4Y8EA 3MKCA 3JU2A 3HIJA 4Q4OA 2AAMA 4C1KA 1JCMP 3IANA 4PUNA 3ZS4A 3AJ7A 1NOUA 1PCWA 3GHTA 4PEKA 2WC4A 4F3HA 2Z1KA 1CGUA 4ICCX 1FWRA 2V69A 2ZQ0A 1DJXA 4CQCA 1R3YA 3JR2A 3K30A 1NDZA 1ISZA 1A49A 3PNZA 4LYQA 5JBDA 4EXQA 5D8WA 3W7MA 5BROA 2PSNA 1CXKA 4Q4MA 3NNTA 4JQ3A 3VAVA 4OFCA 1LQ0A 3VO0A 4HSHA 4FIQA 2GLKA 2AMGA 3IAQA 1TPWA 4CNPA 4IG2B 4HNOA 3RGTA 3WQCA 1N2VA 2MUCA 4CVUA 4WK9A 3GXFA 5D9OA 2YZ5A 8XIAA 1ONEA 2CLFA 4LAMA 4TMBA 2H9AA 3N04A 3ATYA 1NSJA 1RH9A 1ZS2A 2FVLA 4FR6A 1XD0A 1TPFA 2BY2A 1OB0A 3NXLA 3TAKA 1TPB1 4GZIA 1IXNA 2G3MA 4Q4SA 3VFLA 1AQFA 3NM3A 3A21A 2DGAA 4UOJA 4DLFA 1WDWA 3WDJA 3WEMA 3NVDA 3H2MA 5JU6A 2OQLA 2C1IA 5AKQA 3CXOA 4IZGA 2X1UA 4Y9PA 2QGHA 2E6DA 4GI4A 2QCMA 3T2PA 3VD4A 3MA8A 5FOOA 5HK4A 4Z08A 4H2CA 1NJJA 3EXSA 4LAUA 3W29A 7ODCA 5BRQA 1RVGA 1XBYA 1TWSA 3UEQA 3NSXA 3GNRA 4I7WA 4D6FA 3QLLA 4K2SA 1W9PA 1GOMA 2DT0A 3MHGA 4XZNX 1XSIA 1EC9A 2EPMX 3UXDA 1KM3A 1H09A 4WGXA 2XZ7A 4H4IA 3TN6A 2PTYA 2CBIA 3F1QA 2WBKA 2E6YA 4XKYB 3LHWA 3HGJA 4L9ZA 2PODA 4Y7EA 3H2OA 3OTRA 3SURA 1FCVA 2DVUA 3U0HA 1VCGA 1Z3NA 4DWSD 1OC7A 1SMAA 2QUVA 2ZFAA 4GGHA 5JUVA 3PVFA 4MZYA 1FH7A 1OZMA 2IKGA 4Z2GA 2XIMA 3PJUA 1B3OA 1GONA 4AIEA 4IQJA 4FNTA 4M0XA 1SJBA 4WOZA 1I2PA 3ZLGA 1VPQA 2V2HA 3T7VA 3NYDA 3E3HA 1J6PA 1M68A 4CLMA 3EX4A 4A8RA 2QMKA 1CIUA 3WBWA 1E0XA 2PTZA 2Z2AA 4A3RA 3MUIA 4GUHA 1XRVA 4EAMA 4JTFA 4LUSA 4M51A 1IT0A 3ARYA 3M64A 4KQNA 3WLTA 5U4NA 5M2FX 1IZCA 1GJPA 3B03A 2F2KA 5HJLA 1UR4A 2YCEA 1DJIA 1G9HA 1WDRA 4OGZA 3WF2A 1I0DA 4QG9A 3TROA 3NFUA 1O1ZA 2VVSA 3K2GA 4IGNA 3MCMA 4OT7A 2GWGA 2H9AB 2LLEA 1B54A 3CHCA 3LHUA 4HK7A 4P7QA 3TJLA 4IISA 1G4TA 1US3A 1WXYA 4YHGA 1JZ2A 3QY8A 1WV2A 4JCMA 4ATWA 2FZMA 1PBGA 3EEGA 3HF3A 3PZQA 3VCRA 3A4AA 1LT7A 1BYDA 1FDZA 1A5LC 2VI0A 3DFSA 5AC8A 5H8MA 3PG8A 4ZEPA 2A1YA 5HAOA 1E6SM 2RFGA 1G4SA 4KFOA 3ZT6A 2YLAA 4GC4A 4M8UA 3DFQA 1FWNA 1HVXA 1J4EA 1UR2A 3LENA 1MFUA 2R1MA 2VC9A 2DEPA 2J6VA 3Q65A 4JKKA 1Q4NX 3GQYA 4ONVA 1EQCA 1JCYA 4JCLA 1FOBA 3D6NA 2INZA 2ZXDA 5IBXA 2ZUNA 4IIEA 1CGTA 4ACZA 4ZODA 1XXXA 5G4WA 3N2XA 2YJQA 2XVNA 2VX6A 3FV9A 4JYDA 1EXPA 1DQUA 4QE5A 2J66A 5EMLA 1QATA 1K6AA 3WJZA 1R9XA 2XWDA 4LC8A 5A6LA 3UQNA 3GU1A 3WLHA 4N6FA 3LN3A 3EA3A 1GEHA 2QDHA 3HTWA 2YSWA 3ITOA 4CGTA 1BSLA 3V5OA 4I9JA 2J47A 3P93A 1JZ5A 3GKAA 3FYOA 1WKEA 4O54A 2PPGA 4HN8A 1P1MA 1TUFA 2VM8A 4JEJA 3SN1A 3BZGA 4KFNA 6XIMA 1JEZA 1X98A 3KWXA 5FF2A 2QDGA 4O52A 3OIXA 3V7PA 4CKQA 1FWWA 4OBSA 4TTUA 2C14A 2WZTA 4PFHA 1KNWA 5E0CA 1TV4A 4QS6A 1KM1A 1OK6A 3LZ5A 2E8ZA 3LYEA 4DAIA 4AMAA 3N6JA 3MVIA 1OT2A 1SZEA 4D6JA 4XV0A 1UWAA 1K7FA 2V67A 1YPFA 4ZTYA 3G2GA 4LUSB 1ZSXA 1J0KA 5AYXA 4LYPA 2Y5SA 2J9ZA 3V4BA 4BQ3A 5CGQA 3HJEA 4RE4A 3M0ZA 4WJXA 3H2AA 3STFA 1XRFA 1E4NA 3SY1A 3AXKA 1EWEA 3W9ZA 3AMDA 1RJQA 2TRSA 4ASTA 1P6CA 1MW0A 1OC5A 2PDWA 3U2OA 1HJSA 1EYEA 1QI0A 1YTEA 2PP1A 4E4FA 1QK2A 1UR9A 1AFSA 1K6WA 4RNJA 4KETA 1B9ZA 1KRBC 2G5WA 3ZT5A 2DPEA 2JF6A 4CD7A 5FF7A 3UJ2A 1GPFA 3W7CA 2J77A 5ECVA 2JEPA 2P0OA 2G3FA 4DF0A 3ARSA 1SJAA 3UWZA 3SJNA 1KBJA 3QPYA 5TQLA 4KERA 2A3CA 3GTHA 2D2GA 4OHQA 2DUXA 1TV2A 3PTKA 5LXXA 4PMNA 1SSDA 3W1LA 1UIOA 2ANUA 5D04C 1FWDC 3MS8A 1XISA 4KKXA 2QJMA 4XO6A 2D2JA 2GQ8A 4ACZB 1IIHA 3ARXA 5KTLA 4Y9MA 4DXXA 4LS0A 4ALDA 2H3DA 3QC3A 4I9TA 1V0NA 4ZB5A 4I5UA 1I2RA 3MUY1 3W6LA 1QW7A 2EAWA 3TC7A 3O0FA 1K3UA 3B8WA 4F0SA 3R7MA 3TAOA 1T99A 1AH4A 1OABA 1Q8JA 2YB4A 5LNRA 3GS6A 5JIPA 3LS9A 5CPMA 5A5WA 4JAWA 2P88A 3UZ5A 2YA2A 1DJQA 1Q6DA 3GYEA 2RKXA 4GX8A 4U33A 2A85A 2YPIA 3MHFA 3R13A 3QKZA 1AVAA 5A6JA 4V2XA 2PGEA 3HPZA 1ZY9A 1JG9A 2FPYA 1W32A 2PDBA 6ENLA 4MJZA 4ADTA 3GK0A 5F4XA 1EYWA 4US5D 2WSPA 3VGFA 5MF5A 1ZJIA 3NPXA 3VVGA 3EKZA 4L80A 3T8QA 4XBJA 3IGHX 3IVTA 4FI4A 5FEXA 1FWSA 4IOTA 4GUIA 4GVFA 4F9DA 1W8SA 1UW9A 4MAVA 3WLJA 1S1PA 3AXIA 3GXTA 5C8BB 4XZWA 1YTKA 4U4MA 3DH7A 1FWHC 2IKHA 4HJWA 3PBMA 1K1DA 4WCJA 3C2YA 1BG9A 3MYOA 4AX7A 1AZ2A 2NT0A 3EOSA 3FKRA 3VFCA 2PTDA 3C8FA 3OLIA 2QR6A 2ZRVA 2ZRXA 3C61A 4DYJA 1OFPA 4AVOA 1UA7A 1UWRA 2Z24A 3MZ2A 4RNHA 1EEPA 2IKIA 3TXZA 1Q13A 4WR3A 3LPOA 2P76A 5BXPA 4MKVA 5KZDA 4U3AA 3A3HA 1EGVA 1CTNA 4FSAA 1UUMA 5AC6A 2POZA 4TX8A 4PMXA 1B4KA 4BZYA 1AL8A 3I6TA 3L66A 1UG6A 5LNUA 3CUJA 1NDYA 1TPVA 4WXZA 1T0OA 4P7OA 2VC7A 1VIWA 2VR2A 5DXXA 2ZC1A 4UNIA 1WDPA 1OD0A 4OWGA 1HN1A 1PSCA 2XH4A 3FYPA 4PBFA 3KBJA 1EOKA 4E4UA 3OVGA 3QFEA 3FA4A 3VNYA 4XTDA 1LDCA 1ZPTA 1H60A 4FB7A 3ABXA 1HIZA 1MNSA 4N9EA 1C90A 4R34A 1J0JA 1P1XA 2V5LA 4YTSA 2ZWZA 3UT0A 5CCZA 1EZWA 4AC1X 3RCNA 2PDLA 4O0KA 1SU5A 3AC0A 3CEUA 3ZJ7A 2W27A 3LERA 1VR6A 3W02A 2CZVA 3BLOA 2CLPA 4WEVX 3BLIA 3IJQA 1XGDA 4DYEA 4QP0A 3NYZA 4LYKA 2WZEA 2IPGA 2I17A 4HSNA 5D4YA 4GZEA 3TJXA 2EPNA 3BQ5A 3BLPX 2PU0A 3N6QA 4Y90A 1KWKA 3A64A 3TU9A 3S9ZA 4CEUC 2HVNA 3UF9A 2XISA 5LIKX 1EGZA 5DO8A 5A3HA 4HYRA 2ZE3A 3PWAA 2GGEA 1PPIA 1ZBVA 1OCBA 1UKOA 1EA0A 4O10A 1XSKA 1KTCA 1GVRA 4OTKA 2DDXA 3L0KA 2OKOA 3L65A 4CNNA 1AG1O 3TYAA 2ACRA 2KAUC 1LBLA 4CVWA 2OYKA 4AWTA 1QI2A 1X38A 3CIWA 3ABSA 2OXNA 3NOEA 4FNSA 1C8YA 3ITLA 3QW4B 3M41A 1JCTA 1P0EA 4LNYA 3IAPA 1WZAA 1ZAIA 1D7KA 2QNEA 3DERA 3IVSA 4ZQNA 1E0WA 3TC3A 2GJNA 1VRXA 4PMQA 4AWEA 1O1HA 2PLKA 3LTSA 4QJ3B 2ZRUA 1JF6A 3RUBL 1C91A 2FH6A 2XJ7A 3W7JA 1KRMA 4A8IA 2UV8G 2V3GA 3GFYA 2XH7A 5LIXX 3VNZA 3AQUA 5B7ZA 3VOHA 1JQVA 3LHZA 3H4WA 5C2XA 3DECA 4MB1A 4CCCA 2RHGA 3S5OA 5CJMA 5FCZA 3M0LA 5IXEA 3LPGA 1VYPX 2VGGA 3W86A 1KM2A 1HGYA 1QWGA 5AECA 1RCQA 4D8ZA 1T8QA 4HA3A 3E2RA 3RJXA 4FALA 3G6LA 5H8PA 3IJ6A 3JZEA 4LUIA 3W4RA 3AYRA 3IGSA 1DQXA 3VOJA 2QPSA 2Z7GA 2NX9A 1VJSA 3SB0A 1RBAA 3NQVA 2VRQA 1FWFC 1O5XA 1Z89A 4M19A 4PFMA 4A3QA 1TYGA 4NRRA 5C9XA 3SECA 4H19A 5G1YA 2PCQA 3WQEA 3DG7A 3CHFA 1NIUA 4AIUA 4Z2KA 1BWKA 3SQMA 3DDMA 3TW9A 1F6PA 1AH3A 4YYCA 1TJ0A 4E6MA 1KGUA 1V3LA 4JTHA 3EMZA 8CGTA 3KLLA 3SSZA 4IP7A 3VC6A 1GVYA 4HCHA 3GUGA 2PE4A 3KL3A 4XO7A 1CYGA 4ES4A 3QHNA 4GX9A 4S3FA 2XIQA 3B8UA 4L9XA 1W5PA 4ZCWA 1V8EA 4J3TA 4AY7A 2R6OA 3MCNA 5H1WA 3EB3A 1WKFA 2GSJA 3P14A 3WD1A 1SZRA 1GNXA 4UC5A 1W3NA 1ZRQA 2E28A 4GY0A 2J88A 3MJMA 1EO5A 1RJRA 1QCWA 5FJTA 5FJIA 3NUKA 1BXBA 1YDYA 4K8GA 1H3GA 1MXDA 4H9MA 1PHQA 1I45A 1XPGA 2Q8LA 1BKSA 4XWUA 4JBRA 3H12A 2FB3A 2V5CA 1XIMA 2WPGA 2VEPA 2PP0A 4QBXA 3AIEA 2CERA 3T0AA 3HOJA 1C7TA 3FVMA 3E0FA 2XINA 1EJWC 2ONEA 3A5FA 4WJ8A 4H83A 3PJXA 2CXEA 1VENA 4FEZA 4S3JA 1XIBA 2BGNE 3IIZA 3GG1A 4MZ8A 1OF8A 1I1WA 1NWUA 3S2NA 2E7FA 4Q8OA 3KVKA 3W3OA 1DYSA 1EDTA 5TIMA 4PBEA 1BF6A 3QXBA 4IL0A 1H5YA 4B5WA 3G8EA 1LL7A 1K7EA 2C71A 2PURA 3NPUA 3A4JA 1KXQA 2IMRA 4EX4A 4B5VA 3MWAA 3A24A 3WFAA 5EY5A 3ZXWA 3FIGA 3ZLHA 5AHIA 3W6MA 1EX1A 2ZZ3A 2G8ZA 1C8XA 1U5VA 2E9LA 4IIBA 2P3EA 3WEZA 2O9OA 1FWTA 1US0A 4J3ZA 3TTEA 4C65A 4D6CA 5AC4A 3G6MA 3MJYA 3OG2A 3BK0A 1DIOA 1DBTA 3WUGA 3RX4A 1YNPA 4ZQPA 3HBLA 4S39A 1UWTA 4GNJA 4E0CA 2Y62A 2ADAA 1MNZA 4MMWA 1U1JA 1OFDA 4X61A 4YJ5A 5AOUA 1V6WA 1BHGA 3N9SA 2BFGA 1ADOA 1XLAA 2DORA 3DC8A 3URBA 2XHYA 1OFEA 3U4AA 1L6WA 4GFIA 2J7GA 1HZYA 2D3NA 1Q85A 3BV4A 1XYLA 4AH7A 2OT1A 1YPIA 2DSVA 4JN6A 1JYVA 1CBGA 2CXGA 1EH9A 3IJIA 2VEGA 2X09A 2B7PA 3WJYA 4JTJA 5JBEA 1VLWA 2VRKA 1JZ6A 1QNVA 4S23A 2YFOA 1O60A 5G1MA 4C90A 1KA9F 3B0YA 1EUAA 4FR1A 3VZZA 4D72A 4PB5A 4LS2A 5G2WA 2WMGA 3W1AA 3AMLA 3ZLFA 1R3QA 1Q6OA 4PZVA 3QQ1A 3GBEA 3GO2A 1V3IA 3QQ0A 3LPPA 1MW3A 1W8GA 2R14A 3H6OA 4PTNA 3GDLA 4J4KA 4IFRA 3HURA 3KZSA 2DQXA 3PZOA 3GY1A 3W2MA 1WKDA 4Q4QA 3VX1A 4H8UA 2PTWA 3VNKA 1BYAA 2OEKA 4IGMA 2PGWA 2ZZ7A 4A21A 2OEJA 4LVGA 4BI6A 3GTFA 3A5VA 4MY1A 4AZIA 1E4MM 3KW3A 2A7PA 3URQA 1PXGA 1BGAA 3I3BA 1AL7A 3AFBA 3N2MA 4IF2A 2XDFA 1EC8A 3MSGA 2VVNA 4JTAA 4AEEA 4QG8A 2Y24A 2AL2A 3UPBA 4AD5A 1JGMA 3L12A 5CZTA 1JVNA 2E5CA 3S2MA 2JGYA 2J9YA 2VZOA 5DMNA 2XGZA 4MOZA 1I60A 4JEQA 4EF8A 2XM1A 2Y63A 5E6ZA 3B9DA 4FXFA 2ASHA 3UJFA 4Q3MA 4HZ7A 1XFBA 3Q67A 1LRTA 1OADA 1KXTA 1WXJA 4UTWC 2VFEA 1SQ7A 3I4KA 4RV3A 1RA5A 4DEFA 1XW8A 2XFRA 3HQNA 3SGUA 4YXGA 3BSHA 3DOPA 3QMRA 1UUQA 3GG7A 2RDXA 3ALFA 1E9IA 2Q71A 2PWUA 5A8GA 1Z7AA 3DHPA 2FMOA 1FFRA 1ODUA 3V35A 2DZVA 4NZJA 2VEIA 4J3UA 1C9WA 4MPQA 4Q8VA 4R7WA 1LG2A 1CI1A 3EA2A 3V3WA 3CHDA 1MQRA 3L67A 3CUXA 3SUWA 4Q4PA 4NZ1A 4EXAA 1X8CA 1BLIA 1VIZA 4J5NA 1J01A 1LWIA 1W1A1 2CYGA 5I3DA 4HOXA 3LHYA 1KFWA 2E5DA 5HDRA 2VX7A 1JCLA 1SFSA 2TODA 1F3TA 2ZUVA 4DUXA 1XM3A 4S3BA 3VNDA 3A47A 5DXYA 3BAWA 1I6NA 1H0IA 2ZX6A 5E5CA 2BY3A 1FTXA 1OQFA 2B31A 3RRAA 3NQ8A 4HK6A 1JYWA 2OSXA 2ACUA 4TOQA 3T6CA 4GKLA 1KW1A 1E6PA 4UNLA 4QQUA 1S3TC 3MC5A 5K9XA 3A4XA 5CBJA 1AJ2A 3E0VA 3CMGA 1QW9A 5CC7A 2V3EA 1IR1A 1XKJA 4IT1A 3W37A 2AGTA 3LMZA 2WNQA 5REQA 1SO5A 4YTUA 4X9YA 2PWHA 5DMLA 1BGGA 4PTXA 1R30A 5B80A 4Y96A 3WBEA 4UIOA 4B5NA 2XYLA 3SGZA 4YCPA 3B8TA 4XZHA 2Y8UA 1IHIA 1P6WA 3G1HA 1MXSA 3N15A 1X96A 1M41A 1LJYA 4AHQA 4JIIX 1R3VA 1F3EA 3LV6A 1MO0A 4H6QA 1CXLA 2EG8A 3CTLA 3I7QA 3K5XA 4HN4A 1FUYA 2OCZA 3M0YA 4LS1A 4IPNB 3QTPA 4IGSA 2C0HA 1S5NA 3M4HA 1Q6QA 3G1AA 1BYCA 3JS3A 4NJIA 2QJJA 4AD0A 3G1FA 1T7LA 3AZTA 2BWGA 1IT8A 2AL2B 2X42A 3TK7A 4PMDA 5TAOA 3H53A 4O16A 4HMEA 1Q6GA 1XD1A 3PPFA 3S6DA 5A8QA 5CPQA 1ONWA 1UIPA 2WW5A 4JOMA 4HU0A 4LBUA 1B2YA 3ZMRA 1HNYA 4HNNA 4DF2A 4XZMX 4Y9OA 4E2OA 3UJRA 3WH9A 4JFSA 4NKCA 3LXCA 3PWIA 1GG1A 2G3IA 3NPVA 3VUPA 2C3ZA 3OYZA 4JTDA 4Z2LA 3QOMA 3L4VA 3UD6A 2HISA 5IFTA 5FSEC 1NELA 2ZE0A 3H21A 3WQDA 2INEA 3TW6A 5BOOA 4BKNA 2XSBA 4IMFA 3NO1A 3DFNA 3FHQA 3BE7A 1GGOA 1CXFA 1AA1B 2X0HA 3GHRA 4LAKA 3TOYA 3DG3A 3N9RA 3WY1A 4CNTA 3GIPA 3DKJA 3SZ8A 3G0UA 2PDCA 3SRKA 1A0CA 1BEUA 1QI4A 1XH0A 3SCRA 5I3KA 1V6UA 5LGZA 3A3WA 1HF6A 4LXFA 2FTYA 3KE0A 2EF9A 4DPPA 4DF1A 3THDA 4DRSA 3AIBA 2GSEA 3QY6A 2VDIA 3CZJA 1JFHA 3ZSTA 1WAUA 4HK5A 2C1HA 1UCWA 5REQB 4ZL1A 2VFGA 3P61A 4S38A 4UTTA 3W1RA 3V0TA 3DU0A 3SW6A 3BW4A 1CCWB 2YBUA 4H8HA 3VDAA 3N11A 4C6PA 2J6XA 5FEZA 2EG6A 4HHMA 3A22A 3ZJ6A 4A6GA 1J5SA 1WDSA 2DVTA 2V9DA 1UD3A 2BV9A 4DN1A 3W2KA 2GQ9A 4JTGA 1JUKA 3RLGA 5LA2A 5CPTA 1HKKA 4L61A 4PCTA 3LCLA 3T0TA 5CG0A 1E1EA 1DWHM 1W3TA 2G3NA 3DI1A 1TZ7A 3GH7A 2YXXA 4X0VA 3THCA 4GIEA 4AEOA 3FAXA 3T4WA 2EKCA 1H61A 4JN8A 3VUSA 4LVAA 1T6MA 5FJJA 2X1TA 5D2WA 4GMEA 5DEZA 4DJFA 5GPRA 3L2LA 2ZA3A 2V63A 4XAYA 4H8NA 4NP7A 1P4CA 2BXVA 3SIMA 3WQOA 1KFBA 4C6MA 2FKPA 4EF9A 1SO3A 3KOZA 2FHBA 1NP2A 2YL6A 3TTOA 1TPUA 1QPKA 1Z8AA 1CLVA 4I8YA 5A6KA 4RDWA 3ZSSA 1WYIA 1G4PA 4XBKA 1BWLA 1RY0A 4XAFA 4B3LA 1V0LA 1GHRA 4BHYA 2ZADA 4QJ4B 2Z1BA 4PR4A 2XN0A 4IXXA 3E0LA 4G1NA 3C2FA 4W86A 2ALRA 3WF0A 3E0IA 4LRTA 3TR2A 2MANA 1JDFA 2NXIA 3FGCA 2YYTA 1QHZA 4HYVA 1XLJA 2J8FA 3TTQA 1G6CA 1DIDA 1S2WA 3GR4A 4JFTA 2YA1A 3LTYA 3BCFA 4CUCA 2PLCA 3WIJA 3UXIA 3UVAA 2ZXQA 2QIIA 2UY2A 4C6FA 4C5ZA 4KWOA 2PDQA 4MUPA 1VS1A 3S46A 3M9YA 3T9PA 2Y5EA 1WDQA 3QZAA 1PDZA 2IS7A 3CL6A 3P84A 4Q8WA 1RV8A 4IP5A 3WDRA 4FF7A 4MIMA 4LCRA 3SRDA 2NQHA 4U28A 2Z0IA 3A23A 4AWSA 3Q37A 5JBFA 2DSKA 1E73M 1OCJA 2VD8A 4IUOA 5IBXC 4CD8A 3WK2A 2TYSA 3AIQA 2DU2A 3KVLA 3P6LA 3QGKC 3EEZA 1S2AA 1EJTC 1EWDA 2EXOA 4U2YA 1K9EA 1MFVA 3WL1A 1GKPA 4A05A 9XIAA 3WEOA 3T81A 5FF0A 1ZCCA 4QLKA 5I03A 4GI9A 2B7QA 3B97A 4YWSA 2ABAA 3NQCA 4W8AA 1PTGA 1S5TA 2ZRWA 1UH2A 4TVUA 1PEZA 4JS3A 2YCJA 3RX3A 1AMKA 4FXJA 1J0ZA 1NWRA 4QDMA 1UC4A 4H01A 3U7BA 1JPMA 2ZDRA 4WSHA 4NQ1A 1V0MA 4D6GA 4AXKA 2CEQA 2GK1A 3O63A 1QO2A 2F6UA 3QV7A 5DCEA 1X97A 4PSPA 4AEFA 5LIUX 5CH9A 4GGBA 1SR9A 1RD6A 5BNKA 3UU0A 3BZJA 1A5KC 2W66A 3VKBA 3E2SA 4NZ4A 4V1XA 3K1DA 2CBJA 3CUHA 2FJUB 2NUYA 2ZZ2A 6CGTA 3UNTA 3CPRA 1RY8A 4DM2A 1XLCA 2ABBA 1L0PA 4QNEA 1GVEA 4JPGA 4IWWA 3WSUA 3D0CA 2ZX7A 1RA0A 3T0DA 4N2YA 5BW6A 2GDQA 1UMYA 1UC5A 3ANVA 2DW7A 3QV9A 1ME8A 2FZ8A 3ZR6A 3AHZA 3BG3A 3P8JA 3CV2A 1QJWA 2YB1A 2A0NA 1IWBA 1O95A 3ZOAA 1W9UA 2RDWA 2WJEA 4W8LA 3QZEA 2CZDA 3PZGA 5AHFA 2PZ0A 4RKAA 3S6OA 1HVQA 3AXHA 2WK2A 4YL2A 2I5IA 4QAWA 1W9BM 3FGCB 2ESCA 3OVQA 4I90A 3T40A 4EXBA 2WCGA 1U30A 3SCVA 3IGXA 3W24A 1MWOA 5ABHA 4N0RA 4LEFA 3TJIA 3KOWA 3WLOA 5JVLA 4LPCA 4JNYA 4UCGA 3ZR5A 1AW5A 4ACYA 3EX2A 4RPQA 3VABA 4BEQA 1JJKA 3B9OA 3ZO9A 2XGIA 1DWIM 4D1IA 5AYIA 1U5JA 3PSVA 4GCXA 2P53A 1W54A 3HGRA 1GHSA 4ZO6A 3KHJA 4PMZA 2PBGA 1FWCC 3MMDA 3G0SA 1K9FA 1E71M 2O7QA 2WM1A 4AHPA 2Y7DA 1TG7A 3P7YA 4AWUA 4H1ZA 4KW2A 2F2HA 2GUBA 4I7VA 1TQJA 1YLVA 1P43A 1KCZA 2A4AA 1EX5A 4F2UA 1XG3A 1J18A 3R58A 5C71A 4MJ4A 3SFKA 1EBHA 5DY3A 2QZRA 5L9FA 2X7WA 3NEVA 3NGJA 4EPKA 2XFYA 3L2MA 3GNNA 1HG3A 4JTSA 3TYEA 2DP3A 2GGGA 3IJLA 4JYFA 4F2TA 2HWGA 3LM7A 1MMFA 1H7RA 2F61A 2V5JA 3M5YA 3BGAA 1TV8A 3ABZA 2FVMA 2YKKA 3V16A 3F2CA 2XFWA 4Q8UA 1J93A 2CLKA 5G4EA 3PNUA 2DZBA 1DPMA 1IWPA 3PG9A 2GK1B 1XCFA 1K70A 3GVVA 1YDOA 3KP0A 4QE1A 3W7LA 2ZZ5A 3FSTA 4HHHA 1V3KA 4B3KA 1T41A 2EPOA 5A94A 4NILA 1GZJA 1R9ZA 3HV9A 2G97A 3BOFA 3IARA 3PFRA 2PI6A 1XYBA 3WLNA 3EWUA 3WF3A 2EGZA 4DBWA 3NL3A 4P2VA 2NQZA 7XIMA 2JK2A 2W67A 4PL2A 1LOSA 2WNWA 2WKLA 4FK9A 1Y5XA 3O6CA 1X1NA 5HPOA 4S3CA 3JUGA 3GC2A 1JNEA 3UZJA 3M5VA 5EL1A 1I4NA 1M03A 4MYAA 2RGLA 1XDJA 3ONCA 4W87A 3MZNA 2HEJA 4JQAA 3BWWA 3PPGA 3N19B 3ECQA 2AGKA 4EPBC 2DUZA 2Z1WA 4RV8A 1L2UA 3ZFHA 3JW7A 1QHOA 4G1KA 4JIRA 3VU2A 3VGGA 4XUGA 4YYFA 4ZE4A 3WJSA 4LBSA 1K9DA 2WVSA 3RM8A 4LTSA 4XD5A 4RDYA 4JDBA 3LCFA 3BW3A 5FL1A 3WMCA 4G6CA 3GLCA 1JZ7A 1JAKA 3E1F1 4TV5A 1CGVA 2PWEA 3PZNA 2H8ZA 4RE3A 2F38A 2WHJA 2A7NA 4QS5A 4RK8A 2ON3A 2I16A 4H41A 4WOQA 1LOLA 4BQ2A 3L23A 2GL5A 4ZMGA 4MM1A 2IPWA 1WUFA 5BU6A 2I7GA 1UWIA 3USBA 4NAFA 1R38A 1J2WA 4H2HA 5LIWX 3CEPA 1W1VA 3MI6A 3DFOA 1X7IA 1VCFA 2W6RA 3W1XA 4UXDA 3FXGA 3GXPA 5EMMA 5FI8A 4YVXA 4KIRA 4MSSA 2OODA 2WC3A 3AMKA 3AIRA 1EJVC 3ZR4A 1CB7B 1W3HA 4B92A 2PRHA 4OV9A 3B40A 2QCFA 4IJBA 1KR1A 3TVAA 3QR0A 2YDSA 4O8RA 2O92A 1Z42A 2D69A 2Z1SA 4BF9A 1VFSA 2QCGA 3XISA 3QKEA 3NAVA 3UCCA 4NNAA 3ITYA 3WQGA 4AUBA 1BXNA 4ZO8A 1DTNA 3DGRA 1JRCA 1E5NA 4JFWA 1GVFA 2JFEX 4V15A 3B0UX 5I3IA 1EDQA 1EOMA 4H6RA 4NHVA 5DF0A 3OVRA 3VMOA 3AALA 3IJ7A 1Y65A 1Z6KA 1VEOA 3CB3A 4CNUA 3O0KA 3LGDA 3PBWA 3WBYA 6TAAA 1E9YB 4CD4A 2Y70A 4RDVA 2YW4A 3NTYA 2QCHA 1F2JA 1S2VA 3B4UA 1UR8A 1POKA 1OX6A 1TJPA 4LSBA 4B5TA 4MDOA 1ALDA 2G4FA 4RE0A 4X9SA 2BXYA 3CMFA 4Q33A 3V5FA 5I5RA 3CAKA 1S2CA 2PU1A 4I5XA 2JEQA 1UYQA 4M7TA 1H51A 4WY0F 5LSMA 3VKAA 2BS9A 4IQLA 2DZWA 2VO5A 1CDGA 1BXCA 1PO9A 1ZCOA 2J78A 4RE2A 3GDRA 3WKZA 4DZIA 4HA1A 4K38A 3R11A 4CD5A 2PWFA 3LBOA 3DIPA 1XLDA 2R9RA 2Y7GA 1NF7A 4U5IA 3EWYA 1XRTA 1WBHA 1GORA 2R1LA 2QV5A 1R2RA 1KFEA 1L6YA 2EPHA 1N8WA 2GVLA 4LFYA 3VI2A 3VIGA 4BF7A 3H7RA 3CAVA 4GJJA 4MFEA 4HTBA 4NY2A 3T0BA 1CGXA 4AX6A 1UH3A 3CHEA 2CBVA 3FKKA 1NDVA 4NAFB 4IIFA 1TO3A 5KINA 1R6WA 3FEMA 4JTRA 3GFZA 3DN5A 2D1ZA 4OKDA 4WD0A 1E6RA 3HFYA 1GQJA 4GISA 1XBVA 1ZFJA 3W00A 1HQTA 1LL4A 4CU8A 3T09A 3SRFA 3E74A 3IUDA 1DJGA 1UKQA 1OCNA 3QN3A 4U2ZA 3LD5A 1VFFA 3GAKA 4P8WA 4UFLA 3KTCA 4NUWA 4NJJA 1W1ZA 2QCLA 5ABFA 1QWKA 4J1OA 1R86A 4RDZA 4GQRA 1GYLA 3TUUA 1M1BA 4LX4A 3ABOA 4GRSA 3WDIA 1B90A 4CD6A 2JKEA 1K4GA 2AAAA 2WOQA 3I6EA 3ES8A 2DH2A 3ID7A 1OFQA 1GK8A 1LBMA 3N6HA 3PZTA 1W31A 2Z1VA 1MI3A 3P8IA 3UFYA 5M5DA 3TIMA 4J3SA 1WZLA 3QQWA 1NDWA 1RALA 2V3FA 4N4QA 3UY7A 4Q7IA 1YDNA 4MVAA 3A4WA 2D23A 3LBMA 1C8VA 1A0DA 3QZ6A 3KDNA 1QTWA 2ZA1A 4NASA 3QV6A 3SCQA 3RPDA 1TUXA 3H23A 5JQ9A 1VGAA 2EKGA 5FD0A 4R7JA 4BWLA 1KBIA 3AMGA 4DI8A 2O9PA 1NU5A 4G9PA 5C9RA 4W5UA 1RAKA 3KBSA 1JGIA 2WVUA 3MV11 4LALA 3I3DA 4X2PA 3FK4A 3U2CA 2XFFA 4L56A 4MNKA 1AW1A 1FKWA 5I7GA 1E70M 4I6KA 4NJKA 3QOKA 2YA0A 4Z0JA 2AQWA 1MEWA 2CZ5A 1DJYA 4ZQOA 3W1TA 2ZC8A 2VGFA 4YCOA 3TEVA 1RP8A 4FLSA 4GQBA 2E9BA 4JTUA 2VGIA 3BAJA 3RO6A 2UY3A 3H24A 1ZJBA 1OIFA 3AUOA 3BW2A 1MYRA 5JH2A 1J79A 4M29A 5EFDA 3QF0A 3PFMA 2AKZA 1UOZA 7A3HA 3CV7A 5DN1A 3UPMA 3RR1A 4C6LA 3TN5A 2WBGA 2WM0A 4ZFMA 4UZUA 3KBNA 2E8YA 3BAKA 3GTNA 8XIMA 3N3MA 1UZ4A 4RX0A 1GWJA 5CQ1A 4KF1A 3UJSA 5E6YA 1PHWA 4AG0A 1QBBA 3H4XA 3BV7A 2V5DA 3BGGA 3L9CA 2DIKA 5GNXA 3SI9A 3MUZ1 5ABGA 3T2QA 1PKLA 4CNOA 1TFVA 2VT0A 3GG8A 2VHLA 1KB3A 3QGAC 1Q7QA 1XJBA 2BSLA 1OFBA 3Q94A 2R82A 3QPEA 3LSBA 3MB9A 1W2VA 3RILA 2IQDA 1W2PA 2A5HA 3PB2A 4GHRA 4DAFA 3OJGA 1HKJA 1CENA 5AHMA 2D0FA 3R0UA 1CW2A 2INFA 1SM9A 3C86A 5ABFB 1SW0A 3OA5A 3PPHA 4V27A 2RGMA 4M24A 2Z6IA 2DUAA 4IPLA 4KWUA 4QJ5B 3W7NA 4IMGA 4X0NA 3OG3A 3B0PA 1EJ7L 3CQHA 3JZUA 4CNSA 3CPGA 1CPUA 1SO6A 1G94A 3FA3A 2W63A 9XIMA 2J4GA 3ATZA 4GYKA 3WLRA 3NZQA 1VEPA 3F4CA 2SFPA 5AY7A 3RR4A 3BAYA 4FOKA 9RUBA 4JHOA 4ZB2A 2PS2A 1GYMA 1YRRA 2QUTA 1W9VA 3I65A 3W70A 2W3ZA 4W88A 3GNOA 1GUVA 4F4RA 1LCOA 3WLMA 2Z7KA 2DV0A 3WENA 3N2BA 4GA8A 4K6AA 4EIVA 2X16A 3F2BA 2DT2A 1PZ2A 1PS9A 4K3ZA 5DX7A 3RXZA 4JKLA 4B4HA 4W7UA 3BG9A 4H9XA 5FF4A 3RLHA 4H6KA 3PN8A 3BSMA 1EFZA 1UD2A 1YXYA 2YIHA 1ZB5A 1PAMA 4GUFA 4OIFA 3QM3A 3S9IA 4CCEA 3QHMA 2I14A 4O12A 2GVGA 3RFAA 3MVTA 2VOTA 1XGEA 1NOFA 1DEDA 5F7UA 2HQAA 3KTSA 4M6VA 4FLRA 3SJ3A 3ITGA 1FWIC 1GW9A 1IEIA 2WQDA 4IMEA 3OU8A 3PZ9A 3DHFA 4KRZA 3T2OA 4AY1A 1GVIA 3T78A 3UWVA 5CJNA 3BLLA 3RO8A 1KFJA 1LRNA 3K4AA 4C5YA 4DUOA 4DZ5A 4JNZA 3XIMA 4GJ1A 5HANA 1KBKA 3HG2A 4W85A 4QROA 4JQ2A 2XN1A 1K77A 1WX0A 1ZAHA 2YX0A 3R1ZA 5DY2A 1Z41A 2QAFA 1R0MA 4IH3A 3EB4A 1X1OA 1B3WA 3S1VA 2C15A 3W7KA 2VGBA 3GVRA 4AB4A 3RPMA 2F6XA 5I3JA 3GC5A 4G5DA 2W4XA 3MP4A 4K36A 1VFTA 4HHLA 1M7PA 1MUMA 3BSGA 4PUUA 5HINA 3F2DA 1M04A 4MKNA 3TQPA 4E38A 3MSRA 3SCTA 4ZQMA 4GIYA 3AWNA 2Z2UA 1UZDA 4FOJA 2GGIA 3P80A 5DRIA 1KWGA 2PWDA 1AJZA 1MQQA 1DVJA 3WMBA 2WPBA 3CZ8A 1UBPC 4I5RA 3HQPA 3M5XA 1XC6A 1NQKA 4ZFCA 1RK6A 2OFJA 4JXCA 2FGLA 2GSHA 4GWEA 4HPXA 4IMCA 1EIBA 1B3YA 2NVAA 1T5AA 2V2CA 1R3TA 2YYUA 1HP4A 3C2VA 3FFSA 1E15A 1JIBA 2OGJA 3T42A 3OQ8A 1SJCA 4WJEA 4XISA 1IXOA 1E1CA 1UD8A 5BWAA 3S1UA 3BLKA 1B0IA 1XG4A 2X1RA 1E0TA 1GOKA 5BXRA 2GJXA 4JFUA 1K8CA 5EU9A 3WNLA 4XX6A 4C7FA 4IIGA 5I3GA 3EGJA 3QR1A 4OVXA 3ENLA 5CEWA 3IEBA 1J8VA 1OJXA 4UFKA 4ZQRA 1VLIA 1XLBA 1GOOA 3PAOA 1L6GA 4FX7A 3LEPA 4DIAA 3TH6A 4GY7A 2J7EA 3NCOA 4XVEA 4WDUA 3EPNA 3WELA 3V1HA 1J12A 4IXHA 2DJLA 3NXFA 4G7FA 3QRHA 1SZNA 4MKSA 1X6UA 1YE4A 3NDZA 3HGSA 1VJIA 3WD3A 3HQ1A 3LLXA 3LOTA 2X8RA 4MWAA 1YADA 3RU8X 1GJUA 4O28A 2AMXA 1OGSA 5G2HA 3W23A 1R5YA 1LP6A 1H62A 4L6HA 3H55A 3R12A 2NV9A 2QDEA 3W7HA 2GQ3A 1THFD 4J3WA 3Q4DA 4X3ZA 5FF3A 4F0LA 1YXDA 1U83A 4R3UA 8RUCA 3W26A 3SCWA 4I6VA 1M65A 1S1RA 4LOCA 3LPFA 3WUEA 3O16A 2XM2A 5BOFA 4GVHA 2XIJA 1E6NA 4S3GA 2CCRA 2CITA 4H9TA 2A3AA 2VXNA 4DXVA 3CWOX 2GJPA 4FLQA 1YE6A 5DMMA 3SGGA 4DZAA 3M0IA 4LEQA 2OLAA 3E5BA 4BR1A 4PE8A 4CN4A 4GXWA 1OG0A 3UWEA 1KQYA 4RZ4A 4UTUA 4QNWA 4FF5A 4O1AA 3DBPA 5I3FA 4R85A 1GQNA 3ZT7A 1NF0A 5KZ6A 3MUXA 3MSYA 4X63A 4O0QA 2HK1A 1XLEA 4KESA 2E1DA 4U5KA 1IEQA 2WXDM 4PMOA 2OR2A 1V0KA 4U10A 4KCWA 4PB3A 5FACA 3ARZA 1E1CB 4IQDA 3AO0A 3W22A 3M7SA 4D6IA 3DZ1A 3MPGA 2DSZA 4XZBA 2GJXB 4UTFA 5EFFA 2ZXAA 4P7RA 1NWTA 4H00A 4UTTC 4ROQA 3CTTA 4XSLA 1IQ8A 1YXCA 1QK0A 3LRKA 1UR1A 3GRIA 2XH2A 4DI9A 5K7JA 1U33A 4FPSA 4WIWA 3CYJA 2H90A 4LVBA 1I2QA 1PYFA 5F2MA 4I9MA 1XX1A 4ZENA 3LQLA 3AIUA 4WSJA 5F4SA 3CAQA 1GZ1A 1LZOA 1DJZA 6XIAA 3PZIA 1OBAA 3BGJA 1IWAA 5AYBA 3VIOA 2HPIA 1JAEA 2YCLA 4UQAA 2V38A 4XK2A 1JDAA 5GVJA 1CGWA 3M0KA 4NAEA 4FMVA 1TTPA 3PANA 3AS1A 1KGWA 2P3ZA 4O50A 1B5TA 4YS1A 1JZ4A 4DJFC 3S42A 1QNQA 3R5EA 3DUGA 1O5QA 2PDMA 4MWAB 3ZJKA 1TV7A 4RZ6A 1CXIA 4KWSA 4HTYA 1TJ2A 5FIPA 3WQFA 4PYSA 3CL7A 2Q8XA 1FDJA 5FEPA 2VX4A 2ATMA 5F2LA 3U48A 4Q4KA 1D2KA 3UWUA 4KEUA 4H9UA 3WUFA 3YPIA 3IWPA 3RF9A 2VDHA 4OZOA 1JCNA 4MNMA 2V82A 2Q01A 1ZBCA 1IGSA 1ADSA 4GVIA 3QSTA 4PA8A 1FP8A 5CSUA 1Q65A 2QV4A 4O4VA 2IPJA 1ZBWA 4LV4A 3ARQA 5FESA 1UA3A 2ZUWA 1PX8A 3QTGA 4D6EA 4B5SA 3IRSA 2XVPA 2OWXA 2QCDA 4DX3A 4QR6A 3IV3A 1XYFA 1TPEA 2J7FA 3N13A 2VZTA 5AFDA 2XU2A 1N55A 2ISWA 1V3HA 4KMQA 2QGYA 3TN4A 1V02E 5A8PA 1QRQA 1U22A 1OEPA 5HQEA 4MNLA 3EB2A 5A8MA 5TD4A 2P50A 1QMLA 3T8LA 5A6MA 2QPXA 2PDPA 3ZIZA 1LQAA 2PFHA 1FXQA 4GYJA 7REQA 1YEYA 2Y4SA 4HCDA 4DYKA 4IP4A 4XQ6A 1S2TA 1OFAA 4P8UA 3ARVA 1XLGA 4QAIA 1RP9A 2WKGA 2HCVA 4IPIA 1PJ9A 1J0YA 3GXDA 4S3EA 3EWDA 4UOZA 1O68A 3NQFA 1JUBA 3HV8A 4QFUA 1UD5A 2FIQA 1XIGA 3VD7A 3RN6A 4L6DA 3PBYA 5HMFA 4M80A 2HVOA 4AD2A 3LRLA 1M01A 3GH4A 3AU6A 1QOQA 4OUEA 3HN3A 2D2OA 1V3MA 3T1GA 4UQEA 2YCLB 1BWVA 3DFHA 4NAEB 4GCAA 1XIHA 2E9MA 2UY5A 3TDFA 1TRDA 3HG5A 2JIWA 4AF0A 1TVPA 4KIEA 4INFA 3U4FA 5CJ5A 5D9MA 2VZSA 1K7XA 3URNA 4Z17A 4POCA 3LZ3A 3SR7A 2C16A 1YIXA 3GR8A 4OV4A 1CXEA 4FNRA 3RDKA 3UR2A 4J40A 1TJ1A 3A12A 4M1RA 3FYYA 1FRBA 1IEVA 2J27A 2CIPA 5HNRA 2RH9A 1P0NA 1M6JA 1R8LA 3VIPA 4LY8A 5HWNA 2XVLA 3DAQA 1JPHA 1HX0A 3VOGA 1IXQA 2HXTA 3FA5A 4O53A 3W81A 3N2OA 3R10A 1XIDA 2XH0A 4G56A 1VBRA 4FZIA 4PTMA 1C9DA 4ZBCA 4AD3A 1UR0A 1XDMA 1ML1A 4YVPA 4DB7A 4PMVA 1O4UA 3HA1A 3UXAA 3TQVA 2VTFA 4XD4A 4KT2A 3HU7A 4RUBA 1LUCA 1ADDA 3S1WA 1NM9A 1KM5A 2ODOA 4IPJA 3H2FA 4M3PA 3BANA 1G69A 3R0KA 4R7OA 5D8ZA 4DJFD 1FP9A 3EA1A 3KEHA 2GVJA 3CWHA 1S2UA 3PZMA 4YWIA 3GXIA 2E77A 2YDQA 5BZAA 1V93A 2J62A 4IFKA 3OP2A 4PCPA 4BJHA 4WZHA 4XUYA 2CWXA 2WHLA 2I1OA 2A7RA 4O17A 2PDYA 3LLFA 4NI8A 2WJZA 1KTNA 4JZ5A 4HCLA 1XH2A 2DH3A 3AYTA 2ZOXA 4GY1A 5T91A 4O1BA 4XSMA 1QXLA 1XF0A 3S3GA 3AHYA 3LM3A 7REQB 1J6OA 4QLJA 2V0TA 2QUNA 4UUIA 2OELA 4UR8A 1S5MA 4KPLA 3M0MA 4GXPA 4J28A 1IEXA 2DSUA 1GG0A 4W4QA 4Z1CA 3NG3A 2ZA2A 3NDOA 3H22A 2FZBA 5EYWA 1B1YA 2VEFA 4Y2WA 2F8QA 2VWTA 4JY8A 4KS0A 1Q6RA 1GCYA 3W75A 4GACA 4OUIA 3REQA 2WAGA 4FLOA 4HPJA 3G1YA 3N2TA 6TIMA 3B9EA 1EB3A 3BAXA 3AS0A 3LB0A 3RYSA 2GVYA 2DQWA 4GO8A 3GUWA 1TV5A 3W84A 2Y8KA 3UWQA 5G4HC 2AQOA 4WKHA 3LHTA 2BOEX 1F76A 2O4QA 2RUSA 1NH6A 2BZNA 3B8SA 3EWWA 1SW3A 1FDYA 4AF0B 1RSCA 3VDHA 2QF8A 1PKMA 1VYRA 1PDYA 4LB3A 2NV2A 1GVQA 4GOAA 5I0DA 2ZCGA 2PA6A 3SCSA 4MB5A 1JPDX 4O0ZA 4AZ5A 5BWFA 4PUDA 5J5RA 1U2YA 5H2ZA 5J04A 2GGHA 2C7FA 1ICPA 5AN7A 2PDXA 3AHTA 5M03A 2ZZ6A 1TQXA 3IIXA 2VR5A 3UBPC 1TSIA 1IEWA 2DZTA 4HU3A 1NFGA 1ISXA 1VF8A 1QPNA 3EX1A 4ERGA 2J13A 1Q3NA 4LCQA 4NX5A 3WH5A 3DI0A 2PDNA 2VJXA 1LOQA 3KZPA 2GUYA 4LY4A 4HB7A 2O7SA 3GTXA 4DBSA 3ITTA 4TVDA 1TVNA 3HJZA 4FXRA 1FFQA 3O15A 4QSFA 1LUCB 2W5FA 1F4AA 2E09A 3STPA 3N9KA 2VZUA 3GU2A 3VOIA 3AIWA 3BOXA 3UG5A 6ALDA 3O3RA 3EKGA 1XGZA 4QX4A 1W6TA 1QI5A 1QAPA 4GIAA 2Z27A 4E3VA 2CW6A 4UB9A 3MQTA 2XWEA 3WDHA 2W62A 2VUYA 8TIMA 1MQPA 2KX9A 4IFKB 1F8MA 3MBFA 1HP5A 3CT2A 2HK0A 1W1PA 2FLIA 2FGBA 4A2SA 2X7VA 1PIIA 1TPH1 2XVKA 3KXQA 4C7GA 2ZICA 1TX2A 3ARPA 4KH2A 1ZHAA 2WC7A 4UFJA 2REQA 1CLXA 4CEXC 3C2EA 3KCOA 1QDSA 4XTIA 3S5ZA 3HFTA 4W5ZA 5BYWA 3LBCA 3LNPA 3ZWTA 4EACA 3D46A 1HKMA 4HNCA 3M6DA 3OHMB 1FHVA 4PMJA 1OFOA 3HMJG 2PWVA 2BDQA 4GKTA 1Q6EA 3RITA 1JDDA 1K9TA 1X6NA 3KDOA 3VNJA 2PTXA 2R94A 3PZUA 3IK4A 3MV01 2J8GA 3REQB 3TTYA 3C5QA 3QFWA 4HIBA 5ABTA 4PRTA 3FJ6A 1KC7A 3KS6A 3BJTA 4LH8A 2Q6ZA 1GOQA 3W7EA 4S3AA 1H63A 5E9XA 1MZHA 3MWCA 3VC5A 1UD6A 1ZAJA 4M82A 3L5LA 3CUFA 7TIMA 1PKYA 1TRIA 3LU2A 2TMDA 2VC5A 1CLKA 2JQXA 4JX5A 3SUTA 3WO8A 1A5SA 4D8AA 3QV8A 4OECA 3W76A 2HPMA 3TYCA 3TSBA 3EX3A 2HJPA 2O0TA 2FPTA 2OU4A 2WV8A 2VX5A 4RJEA 1A4LA 3W7OA 2D2HA 4HQVA 3R6IA 3VIJA 1UOKA 4B2DA 1LLZA 1XP3A 2FDSA 3LQGA 1E4LA 3ISIX 4ILSA 4N9CA 4O1EA 1JDCA 3FEQA 2NWSA 3EPOA 3S8HA 2B81A 5FJPA 1TCMA 1FWBC 4CCZA 2E67A 3E5PA 2PDUA 3W82A 2R24A 1GTHA 3P3BA 1D8WA 4E2BA 1TMQA 4MLJA 3Q58A 3H70A 2OQYA 4LJ3A 3ORWA 2PDJA 2VCBA 4O1CA 4QTGA 5HQLA 1ME7A 1E4IA 1TZZA 4HSOA 4DQWA 1E43A 1FQ0A 2Z25A 2OQHA 3UG8A 3EBVA 4N02A 3P81A 4NX0A 1QPQA 1KKRA 3RRXA 4IIHA 1UP0A 1KM6A 1OT1A 2HBVA 2GJRA 1JD9A 3U2ZA 2ZIDA 2H8XA 3NQAA 5L6UA 4AD1A 1QNSA 2HS6A 2PCEA 1NWSA 2B7OA 4MJ2A 2J7DA 2YW3A 4PCSA 5C9WA 3B8DA 2REQB 1EJRC 4ZSTA 3QC0A 4HZ8A 1TZ9A 2I57A 1BFNA 4BI7A 3FAWA 3P62A 4PUKA 3O6AA 3L4ZA 4LV9A 1YNQA 2WMJA 4RXFA 3PZVA 3SUVA 1V6XA 3XINA 4HHPA 3NJ3A 3CZLA 1AK5A 1JXJA 2CHNA 4HU4A 3GG0A 1H49A 3PBUA 2HROA 5HUPA 3THAA 1DTUA 1E72M 4UTLA 3NIYA 3VDGA 3FVDA 4L65A 2JKPA 3AXMA 3R43A 4YTRA 2EG7A 1ONRA 4KCTA 1DP0A 2PMQA 3IIVA 3M0VA 2B0MA 3MCOA 2Q8ZA 1RLDA 1D8CA 2BBFA 2EQDA 2C91A 5E1QA 4J7RA 5HXMA 3D47A 1JPKA 2A6LA 2E25A 3HQOA 4DWDA 2IQTA 3C3UA 1EO7A 3NURA 3N14A 3UPWA 3AROA 5JXQA 4KEZA 3IPWA 3QMSA 2Z29A 2V3DA 2QDDA 4PUMA 4RNIA 3W2LA 1A3HA 5FJOA 2QLYA 5E93A 5C54A 2CETA 2GVEA 4AQLA 2QYGA 4FNUA 4TIMA 3VMPA 1CNVA 3CZKA 1GJWA 1G1YA 4E2DA 2PGRA 5DBUA 3PB0A 1QO5A 4J2PA 3UZYA 2OYLA 1KV5A 3LI0A 4M6QA 1FVPA 5CGMA 2O9TA 2WJDA 3CHVA 1RBOB 3MYPA 2G50A 3K8KA 5HA7A 3GSMA 1VBHA 4S3KA 4IHCA 1VEMA 5CPLA 2OT0A 5HPCA 1BTMA 2ZXBA 3H26A 3CBWA 4DNMA 4W7VA 4C6IA 1VYSX 4GZJA 1UBSA 4JIEA 2PF8A 1X7FA 4GBDA 4LF2A 5LZLA 4M5PA 2CWNA 3VE7A 1XLKA 1ZL1A 3IUIA 3WQ6A 3SAZA 2PGFA 1WAWA 5BXTA 3U57A 4B5XA 1WPCA 5EPDA 3WD4A 3TXVA 1G4EA 3MT1A 2OSWA 2W0UA 3BICA 3BQ6A 4MFDA 3AUJA 3VINA 4F79A 4JX4A 4KEMA 2ACSA 3BDKA 4NI3A 4GQGA 4WY0A 5CAKA 1V3JA 2NSOA 4PBGA 4R5EA 1DWAM 4YVVA 3WFLA 2VFIA 5AZ1A 3T4CA 1E40A 4LUYA 1EIXA 3RM9A 1JF5A 3WF1A 4D2JA 1C3FA 3CIVA 2QAPA 2QT3A 3EWZA 2YL8A 4H7ZA 2Q3RA 1F3WA 1R7OA 4AIBA 3SCOA 2F6KA 3W72A 1H7WA 1WE5A 1U1UA 2PZNA 4Q22A 1LM1A 5A6AA 4J3XA 4GI6A 2Y61A 3LDVA 3SN0A 3TYBA 2OYMA 4H9YA 3S5YA 3TONA 4ZXLA 2A3LA 1RCXB 5D2TA 2GOKA 4N7QA 4A3HA 3R89A 4EANA 5LA1A 5KZMA 2DZUA 1DWJM 1JFXA 3QGVA 2HE8A 4ADUA 2WWDA 3N4FA 4C1LA 3DHDA 3EAUA 3W25A 2FZ9A 4HMNA 5GJNA 1TWWA 2WNNA 5CC5A 2X1IA 3R8GA 3PSWA 1LRQA 3UA4A 1NP0A 3ITVA 4GD0A 1UWUA 1V6YA 2CZEA 4B3ZA 3QSRA 3VA8A 1IR2A 5D05A 3LCWA 4UMCA 5C0QA 1WZMA 2QJGA 3E2QA 1XLIA 1W1YA 2WO5A 4GK8A 4A4AA 1N7KA 2PAJA 4WDWA 2Q02A 1RPXA 3W53A 2I9EA 4FXSA 1XDLA 3C2OA 4OOUA 4LAOA 3VDBA 1Q6CA 3VIHA 2VELA 1VRDA 3WD2A 3SY5A 4C60A 2C79A 1ZNNA 2OWWA 1GPWA 3DG6A 5FKYA 1H50A 3VM5A 1G01A 4JQ1A 3W7QA 3FW6A 5AVNA 5EBUA 1XSJA 1V4YA 1P5BA 1M7XA 3N29A 2X2YA 3GNPA 1RXOB 3VIIA 4C91A 5JIWA 4DO4A 2WSYA 1IZJA 3CPUA 2VP8A 5IHRA 5LKYA 4QITA 4M6UA 3VK5A 3VPLA 5BXSA 3W71A 3BC9A 1H2JA 1I75A 2XZ9A 3BMVA 3C2RA 5FSDC 1PV8A 2DZPA 3STEA 1SGJA 4JN7A 3DC0A 1Q63A 4XZLX 4GNVA 3WDQA 2G0WA 3LUTA 4CQAA 3ICJA 3BUVA 4J9JA 2XSAA 3TV8A 4WY0B 3U7VA 4K39A 3LCXA 3W1NA 1P7TA 1MZRA 3W7PA 1LQ2A 3AU2A 4K1WA 4XAZA 1WKYA 5C7VA 2OOGA 2J24A 2P8BA 4Z2IA 4NU7A 4JTLA 3M0JA 2D73A 4E8GA 2JF7A 1H7XA 1BAGA 4LUJA 4JNMA 1EUNA 3HZ3A 3ZQ9A 1ITXA 3EPMA 2NQ5A 4MJMA 3WFZA 4I8DA 1DV7A 4K37A 2VR4A 3G18A 3BAIA 4NZCA 1SUXA 3KOXA 5A2AA 1N8FA 3KOFA 1FWGC 2CLMA 1PTDA 3ARUA 4GG9A 3OHIA 1ESWA 1I1XA 3HG3A 3ARTA 1HW6A 5F4WA 3APYA 5I2UA 5CZJA 2OB3A 1TELA 3E49A 3O8AA 2BOFX 1SZFA 3W7GA 3I68A 4LCSA 4PTDA 3OIHA 3G3DA 4A29A 1QOPA 1VD6A 4KGLA 2FDMA 2GYIA 2Y5JA 3MDWA 2BY1A 3VILA 3E02A 4E5TA 1BKHA 2XTKA 2QUUA 5CPNA 5LNWA 3PJWA 4HKPA 3AWOA 4DNHA 1W0MA 1YTDA 3I4EA 5F2IA 1DXEA 4N9DA 4QIUA 1VP5A 4DVOA 1LBFA 4NL1A 3C8NA 3CZEA 3GVWA 3IJ9A 2QJNA 3FHAA 2V5BA 1TVLA 2QMJA 2B4GA 3I6RA 5AC5A 1DE6A 4E8DA 1JZ8A 3AOFA 4MY8A 1OD8A 2DJXA 3L0NA 2VFDA 1A53A 3AI0A 3DHUA