3PBMA

The crystal structure of adenosine deaminase in complex with chloropurine from pseudomonas aeruginosa
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
313
structure length
313
Chain Sequence
b'YEWLNALPKAELHLHLEGTLEPELLFALAERNRIALPWNDVETLRKAYAFNNLQEFLDLYYAGADVLRTEQDFYDLTWAYLQKCKAQNVVHVEPFFDPQTHTDRGIPFEVVLAGIRAALRDGEKLLGIRHGLILSFLRHLSEEQAQKTLDQALPFRDAFIAVGLDSSEVGHPPSKFQRVFDRARSEGFLTVAHAGEEGPPEYIWEALDLLKVERIDHGVRAFEDERLMRRLIDEQIPLTVCPLSNTKLCVFDDMSQHTILDMLERGVKVTVNSDDPAYFGGYVTENFHALQQSLGMTEEQARRLAQNSLDARL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenosine deaminase
publication title The crystal structure of adenosine deaminase in complex with chloropurine from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 121
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.5.4.2: Adenine deaminase.
pdb deposition date 2010-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3pbmA00
3MJMA 3LNPA 1A5LC 4J35A 3AU2A 2WJDA 2FVKA 1R9XA 2R1PA 2I5GA 4IFKA 4C65A 3B0YA 2Z28A 4PCNA 2EG7A 1FWDC 1FWAC 4H9VA 4XAZA 4CEUC 1K6WA 3FDKA 1JGMA 1RA5A 2Z26A 4WGXA 2VM8A 2ICSA 2QT3A 3S4TA 2ADAA 3C86A 3A4JA 4XD5A 1EJXC 4C6NA 3E2VA 1QW7A 1KRAC 5AKQA 4KEZA 3S2LA 1RAKA 4INFA 1FWJC 4TQTA 4I6VA 4IG2A 3ORWA 4KEVA 3T1GA 3JZEA 4ERIA 3OOQA 1FKWA 3ICJA 2Z24A 2OGJA 4LAKA 2FTYA 3IJ6A 3NURA 1KRBC 2R1MA 2F6KA 4L9XA 3MSRA 4I6KA 2GWNA 4PBFA 4F0SA 1RK5A 1W1IE 2GSEA 1P1MA 3EWCA 3QY8A 3S2MA 4C6IA 4DYKA 1EJTC 4CNTA 3EWDA 3WYZA 1UIOA 1EJSC 2FVMA 4H9MA 1PB0A 3F4CA 1ONXA 3OJGA 3SFWA 3PANA 4LALA 4C6BA 3CS2A 1I0DA 1A5OC 3CAKA 2EG6A 3GU1A 3E0FA 3TNBA 3IGHX 4C6CA 2Z27A 4NP7A 3PBMA 1FWIC 4IGNA 1O5RA 4PE8A 1V51A 2A3LA 4H9YA 2UZ9A 4XAYA 1A4MA 4H9ZA 4IGMA 1A5MC 4HA0A 3AU6A 4RDWA 2PLMA 4XD4A 4LANA 1M7JA 1M68A 4EPDC 1WXYA 1V77A 1FWGC 4GBDA 3AUOA 4GC3A 1ITQA 4KESA 2AQOA 4UBPC 3QY6A 3IPWA 3OVGA 5E5CA 4P5UA 2QS8A 4IG2B 3K4WA 1RJRA 2Z00A 3GTHA 5HMFA 4CNUA 3TN5A 3GG7A 1KRCC 4LFYA 1RK6A 1XGEA 3K5XA 3IACA 2Q09A 3HM7A 4G2DA 1UIPA 4DZHA 2R1KA 3QGKC 2OOFA 4H01A 1GKQA 4L6DA 2P50A 4GY7A 3S2NA 4RDVA 3A3WA 3UR5A 1PSCA 3RCMA 4QTGA 1EJWC 1YNYA 4F0RA 2Y1HA 1HZYA 3E74A 3MVTA 1EJVC 4HJWA 2Z2AA 4C6DA 2O4QA 4DO7A 4EPKA 4IH3A 4R85A 2OODA 3EGJA 2VC5A 2VUNA 3ISIX 4J5NA 5FSDC 1GKPA 3MDWA 2HBXA 1FWBC 3URNA 1RJPA 1RJQA 2DVUA 4NI8A 2QPXA 3LU2A 3K2GA 1QXLA 1J79A 4KERA 1J5SA 3GIPA 4LCSA 2KAUC 3RN6A 4DLFA 1I0BA 4KEUA 2GWGA 1DPMA 2IMRA 1ADDA 4DNMA 3PNZA 3KM8A 3ITCA 3LA4A 4KIRA 3UBPC 3GRIA 1A5NC 2Z29A 2Z4GA 1V7AA 4V1YA 4XAFA 4C6OA 2DVTA 3MTWA 2Z25A 3O7UA 1VFLA 2PGRA 3B40A 4RDYA 4CQCA 1S3TC 1EF2A 4RE0A 4PBEA 4F0LA 4ERGA 3PAOA 4ICMA 4HK5A 2D2HA 4H9UA 1YBQA 2P53A 4CNSA 3IARA 3MPGA 3E3HA 4IFRA 4MUPA 4DI9A 4G7EA 5FSEC 2PAJA 3HTWA 3QY7A 2HPMA 3NQBA 3A3XA 4GXWA 1POKA 3O0FA 4ERAA 1NDWA 3F4DA 2AMXA 1E9ZB 4H9XA 4WHBA 4AC7C 5HMDA 4GZ7A 4CEXC 2WM1A 3IRSA 4E3TA 3LSCA 3TN4A 4UB9A 3QGAC 4C6EA 2HBVA 1POJA 2QVNA 3GTXA 3URAA 4OFCA 4CQBA 5G4HC 3E38A 3T8LA 3UF9A 1RA0A 4QS6A 4H00A 3DUGA 1GKRA 2UBPC 4GY1A 1R9ZA 3G77A 4GX8A 1A5KC 1UBPC 4LCRA 1FWFC 2ZC1A 4RDZA 3IV8A 3LGDA 3B0XA 4XAGA 4KQNA 2YB1A 2E1WA 1IE7C 3F2DA 2D2JA 1P6CA 3TN6A 4GYFA 1NFGA 4QSFA 1ZZMA 4C60A 4EPBC 3MDUA 1FWCC 1V79A 4BJHA 3MKVA 1PO9A 2VR2A 4QRNA 4EP8C 4C6JA 4XD6A 1J6OA 4BY3A 1YBQB 2RAGA 4HK6A 2HPIA 4R7WA 1A4LA 2DVXA 3SO7A 4IQJA 4GX9A 4C6KA 1R9YA 2OQLA 2WJEA 2Z7GA 2R1LA 3R0DA 4CQDA 3GTFA 2GZXA 1NDVA 4G7EB 2BB0A 2PUZA 3LGGA 4C5ZA 3RYSA 5LXXA 3E0LA 4C6MA 2E25A 1PTAA 5A6TC 3PNUA 4ZSTA 3UR2A 3UPMA 3GIQA 3N2CA 5HMEA 1EJUC 4C5YA 2VHLA 3GUWA 4WVXA 4QS5A 3TN3A 1YRRA 2HNHA 2YXOA 1KRMA 4IFOA 1YIXA 1O12A 4QROA 2R1NA 3F2BA 4J2MA 2FFIA 3LSBA 4NG3A 3LS9A 1NDZA 2YZ5A 4M51A 3D6NA 4C6QA 4C6PA 5CH9A 3URBA 1FKXA 1KCXA 1K70A 1UMLA 3BE7A 4PCPA 4B91A 2EG8A 1BF6A 1V4YA 3FEQA 4LH8A 2YB4A 3HPAA 4KETA 3S2JA 4IF2A 4BKNA 1P6BA 2FTWA 2I9UA 4YIWA 4C6FA 4DIAA 4C6LA 3T81A 1EYWA 3F2CA 1K1DA 4HK7A 2GOKA 3OU8A 1WXZA 4DZIA 3LY0A 1FWHC 3URQA 4KF1A 4EPEC 4JOMA 3NEHA 3GU2A 1EZ2A 2WJFA 4B3ZA 4IFKB 4B90A 4XD3A 2Q01A 1NDYA 1XRTA 3ID7A 4LEFA 4V1XA 4Z42C 2O4MA 4LAOA 1EJRC 1E9YB 1XRFA 2Z2BA 2G3FA 1J6PA 2ANUA 1FWEC 2W9MA 3OODA 4ZSUA 2OB3A 2HQAA 4DI8A 2PGFA 1M65A 2VC7A 4GK8A 1XWYA 4R88A 4DLMA 3V7PA 2XIOA 3GTIA 3DC8A 3OQEA 4H9TA 1ONWA 4AQLA 4LAMA 3MVIA 3DCPA 3WZ0E 2D2GA 4RZBA 3RHGA 1ITUA 3FDGA 3WMLA 1YMYA 2CZVA 3GU9A 4D8LA 2AQVA 4B92A 4LCQA 3CJPA 4GOAA 2BGNE 4GY0A
chains in the Genus database with same CATH superfamily
2NVDA 2WJDA 4HU8A 1AODA 3B0YA 3TQVA 2WMHA 3H26A 3EWZA 1VFHA 4NILA 3LBCA 3NTYA 3S4TA 1LWHA 4DBSA 5BXTA 3RPMA 3PZQA 1IR2A 3W1PA 2GUYA 3ZR5A 4KEZA 2OPJA 4GI8A 5CKSA 3E2SA 4ZO9A 4N7QA 3SW6A 2DT1A 3A21A 2QUNA 2RJHA 4TV5A 3NGJA 2V5CA 1RSCA 2PRMA 1IZJA 3M46A 3B97A 2PS2A 1TVNA 5DRIA 2QCLA 3L5LA 6ALDA 5E6ZA 1ZPTA 3H2AA 3NUKA 4OQVA 3ARRA 2UV8G 4DXKA 3P3BA 4JQ3A 5CC5A 1W1IE 3ZSSA 2YIHA 4OT7A 1VIWA 2BBFA 2Y5JA 2FB2A 4DM2A 2QUTA 5I23A 1O5QA 3WYZA 5LA2A 1I2OA 4S38A 3TCEA 1WBJA 5HPOA 1ONXA 1UWQA 3ABSA 3KRBA 1CGVA 3CXOA 3QYQA 2E67A 3GFXA 1JZ6A 1PE1A 5L9FA 1JF5A 3V35A 4WY0F 5HULA 5HJXA 4IGMA 1FWRA 4K6AA 4F2BA 4PODA 2QEZA 3ARWA 1TJ1A 4ZOBA 2BOGX 1FFRA 4ZQCA 1U22A 3DHFA 1ADOA 2I5QA 4QEEA 1CTNA 3L65A 1E1EA 4IMGA 4MDPA 2PDGA 4AIBA 4S2BA 2WHJA 5BRBA 1OZMA 4S3DA 1R38A 3FIGA 2CHOA 3MHGA 2WMJA 1KRCC 1HGWA 5C9ZA 2R1KA 3BCJA 4Q8MA 3H6OA 1UPMB 4RDVA 5AN7A 1YDNA 5IXEA 4L5ZA 4QTGA 4S1FA 5CZ0A 3POHA 1S2WA 5MKGA 2VZOA 2BVTA 4EWND 1NELA 4RL3A 3LHVA 3M5ZA 4C1NA 3W28A 1ODZA 2IW0A 3W7OA 1XUZA 3ISIX 1G7UA 2OSXA 3CEPA 4FF5A 2ZUNA 3PZMA 1F3EA 3EKLA 4KGJA 1SZGA 3K46A 3EWWA 1PTDA 2VOTA 3MI6A 1Z7AA 4AISA 3EEGA 1W9UA 5H8MA 3H2MA 1KCZA 2D2OA 4Q7BA 2V63A 4V1YA 4W8BA 1V7YA 1XIDA 1VFLA 5BRPA 1ALDA 1ZBCA 4JFUA 5DCBA 3KS5A 5JXQA 3WFZA 5AYIA 4HTYA 4ICMA 1TMHA 2HTMA 1KB3A 4NU7A 2RGMA 1O6IA 3UWZA 3BW2A 3VNYA 2FH8A 1H1NA 3V5OA 1I9CB 1EGMA 4GJIA 5FSEC 4WSHA 2YJQA 4RW5A 1WDPA 3GS6A 3UZJA 3PBYA 4JICA 4I9TA 2MNRA 3TXZA 1E9ZB 1KKRA 4H9XA 1EP3A 4YTUA 2PTXA 4IGHA 3K8LA 2XM1A 5MKGB 1P4CA 2QMJA 1AW1A 4J28A 3NJ3A 3D3FA 1H41A 4DWDA 4X2PA 4IPLA 4YTQA 1PZ1A 5HNNA 4JQAA 1RHCA 3VC6A 3S5NA 4FIQA 3CL8A 1U5JA 3UZXA 4Q4MA 1JIBA 3GTNA 4A35A 3WMCA 5DBUA 1CXEA 4X9YA 2UWFA 3GDRA 1P6CA 3QRHA 3OPSA 1V79A 4BF9A 2XN1A 5IBXC 4EP8C 1KM3A 5D09A 4E2DA 3FXYA 1TE1A 3CV6A 2R82A 4YTTA 3GAYA 3WLSA 3WUFA 4CLMA 4RNHA 2G5WA 3R0DA 1G0CA 3NVTA 4ZZ9A 1A53A 3TW6A 4HYWA 4HA3A 1BWVA 4GE8A 4K1GA 2E40A 4GUJA 5D2YA 5CLWA 5A6TC 1GOQA 4JN6A 2VQTA 1W31A 2X40A 5FJTA 4IGSA 2Q3RA 5EBUA 4DEFA 4AZBA 4NX5A 3WD1A 2YXOA 4F8XA 4F66A 2CBVA 1M53A 1VEOA 3M0KA 4UCFA 1EX5A 3TC7A 2HXUA 2GDQA 5JIPA 1XR2A 5HANA 2NLYA 1IEIA 4C6PA 4CQ8A 2X0HA 4CCCA 3BAWA 3PUOA 1K70A 1QPNA 1JZ8A 5DY2A 3EPMA 4NZ4A 3GZAA 5GJMA 3W72A 1EHAA 3RDKA 3RM8A 3GR7A 1XIEA 1OGBA 3BOLA 2ZFAA 1DJZA 4UZSA 4DXVA 1E72M 3TDFA 3EOLA 1F6PA 3GXNA 3F2CA 3OU8A 1MW1A 3S1GA 1YPFA 4X2RA 1XLAA 3PG8A 4S3JA 1K4HA 5M5DA 3W26A 1TR1A 1N7KA 3GVRA 1QO5A 3NVDA 5AYZA 1MDRA 2BXVA 2ZA1A 2DZXA 3QQ1A 1S38A 4GVHA 4A8IA 1MMFA 2W4XA 4IOTA 2A3HA 4HZ6A 2PGFA 1RBOB 3N04A 1EXBA 4DLMA 3W74A 3FNDA 2XPKA 4JTAA 5EPDA 1LLZA 5D38A 3W6MA 1XISA 2IKJA 1ZU8A 2WYSA 1J0IA 2FPYA 3M16A 3NDOA 3VMNA 3ENLA 4M7TA 3NO1A 2WKGA 5D9NA 3MYOA 2PDPA 1RA5A 2ZZ4A 2VEGA 2R8WA 3PVFA 2UY2A 3O63A 1WZKA 2J7EA 3W29A 4ZOCA 3O9NA 3WG6A 5CZKA 5K4ZA 3CQIA 2QIIA 3ZXWA 1KXTA 1TUXA 2PDXA 4FK9A 1W1B1 4BF7A 4O18A 1DEDA 3VNJA 4CQAA 1SJCA 5ABTA 1J96A 3LLXA 3LHYA 2PRHA 3UA4A 7PTDA 1XIIA 1PZ0A 4KKXA 4B9YA 5D9OA 4NSBA 5CXPA 3N1AA 3VU2A 3AISA 4Q8NA 1XGZA 1FQ0A 1WUFA 4HBKA 2YCIX 1LL4A 1UIOA 2P8BA 4G5DA 4FNUA 1NOUA 1V5XA 3AZRA 3GG0A 2P0IA 1I0DA 2EG6A 4NZJA 3T2OA 5LYRA 1XYZA 3HQ1A 2OT0A 3JZUA 4U28A 3EX1A 1J0KA 2G95A 3KDOA 5JH2A 1LBFA 1PWLA 1US2A 3CUJA 5FF0A 1AUSL 5JBEA 5DXXA 1QTWA 5DCEA 3AXXA 4FNSA 3GW3A 1QPKA 2OZ0A 5I0DA 1MQQA 4A2RA 3Q67A 2XWEA 2PP3A 1U5VA 1QNVA 4AHOA 2NVCA 4IL2A 3TFXA 3VOHA 3BJTA 3N12A 4F4RA 5JU6A 1K7XA 3PF3A 1FY6A 2Y85A 1XD0A 2EQDA 3GQYA 3ARUA 4M81A 2XFYA 1OY0A 4FNQA 4K2SA 4BZYA 3S6TA 1MFVA 4E8DA 2W92A 3W00A 4L6DA 3W7CA 3S2NA 3A3HA 1SW3A 3NL6A 3GY1A 4UUIA 4L4LA 1QFEA 1PSCA 3CUXA 4J4KA 3XISA 3DESA 1JYXA 1B9BA 1GJPA 4PMNA 1UROA 3FEMA 3EGJA 2VC5A 3D46A 4QHRA 3G1VA 2ABBA 5F2IA 1HGYA 4IICA 1OT2A 3TK7A 2ISDA 4MLJA 3UU0A 3SQSA 3QHOA 3NQ6A 2GGJA 2YKKA 2YBVA 5I3GA 4ASTA 3TSMA 2DIJA 2ZA2A 1KR0A 1L0PA 4DLFA 5AYYA 3TU9A 3PNZA 2QMKA 3UY7A 3GE7A 4JDBA 4MTVA 5E9XA 4RE3A 3DH7A 1AQFA 1W9BM 4C6OA 1X1NA 5F4SA 1EFZA 5TF0A 1FBAA 4LB3A 1H51A 2F8QA 3CHCA 1OC5A 4ML4A 5DMYA 4BEUA 3M64A 3WENA 4OIFA 1TVLA 4QQUA 1CWYA 1KXHA 3KVKA 2QDDA 3SY8A 2DP3A 1QMLA 4MWAE 3T2PA 1U1JA 5A6SA 2BGSA 2WZMA 3HTWA 4A22A 3O8AA 2I9EA 3PC0A 3GG8A 1GYLA 3RGTA 3B8DA 2WM1A 4HPXA 1ZJBA 1XYMA 4IMAA 3ANYA 2R24A 4L56A 5T91A 2BXYA 3GTXA 3URAA 2B7OA 4AD5A 1OYCA 3WQOA 4ZMGA 3UF9A 2AAAA 3SGZA 4BI5A 2JK2A 1SYTA 4PTVA 1OVDA 3SBFA 7TIMA 2FVLA 3UWQA 3RLUA 2FJUB 3DUGA 2D24A 3KHJA 1PUDA 2C19A 3G1YA 3AIRA 2PC4A 4PTXA 3GB6A 4U2ZA 3SR7A 1PXGA 1UR1A 4P2VA 3F5LA 3TVAA 1E3ZA 1JRCA 2V82A 5FJOA 3PR2A 3LMZA 1HO4A 3O05A 3KBNA 5CZSA 3GYCA 2DJXA 3WY1A 3V0TA 8CGTA 3VIIA 2BDQA 4UTJA 5I07A 3P80A 4QE1A 2DVXA 3SO7A 1K8ZA 3OB8A 4C6KA 1XG3A 3AS0A 1GTEA 3OZPA 6REQA 3PSWA 5EBAA 4XB3A 3GW0A 4C5ZA 2WB5A 5K2ZA 1ZBKA 1VLIA 2X1IA 4C6MA 1E51A 4PMOA 1JCTA 1KBLA 2OO0A 1C7TA 2D22A 3P84A 4JTSA 1AD4A 3LEPA 2FZ8A 2HNHA 3LENA 1AMYA 4GCAA 4O1EA 1I75A 2PWEA 1CEOA 3GFZA 5FEZA 1LL6A 2CETA 2X16A 3W1RA 5G4WA 3PB2A 1NIUA 2ZX7A 1G4EA 1SW0A 3T0TA 2V5LA 2E6FA 3KOWA 1QO2A 4ZB2A 1NOFA 2OWXA 4GUHA 1JPHA 2CEQA 1SJDA 4JBRA 3TTYA 1HKKA 3T7VA 3M0VA 1XX1A 2H6RA 3LYEA 3T81A 3CYVA 3P62A 5HOSA 3I7RA 1H7OA 1QNSA 4MPQA 1BRLB 1WB0A 1H2JA 1X98A 1CIUA 1VR6A 3AALA 1QWGA 3N34A 3R8HA 4AH7A 4Z42C 4HHMA 1P7TB 2DDXA 2Y5EA 5LA0A 4QDMA 4TVUA 3NQFA 2G3FA 4QE4A 4FO4A 2VR5A 2XM2A 3TYUA 6REQB 3W7JA 3DKJA 1Y65A 2PU0A 4EAMA 1HFBA 1ZJHA 4ATDA 1OJXA 2XSXA 4DF1A 1J9YA 3AIQA 1TPDA 1R3RA 1ODUA 4LAMA 3MVIA 4ZENA 2D2GA 2Y61A 1JQXA 1ZL1A 4L6OA 5FEPA 1GVSA 2DU2A 4B92A 1FHUA 2E9LA 2EF9A 1WZLA 1R9XA 5EYWA 4C65A 1LL7A 1OC6A 2YCEA 4QG9A 5CZJA 4Z1CA 4MM1A 3FOKA 2VC9A 5F2GA 4Y9NA 5H6HA 3BSMA 3QEZA 2PTZA 1F8MA 1ISYA 2QF8A 2YYTA 4Q6XA 2HNEA 4KWSA 3ZSTA 1EIXA 1T8XA 3CWNA 1D2KA 2ZYFA 3FJLA 5C9UA 2POTA 2YL5A 1JPDX 2NQ5A 1Q3NA 1QOPA 5AFDA 3ORWA 1QI5A 1LYXA 3DFYA 2J47A 2HVMA 3TUUA 2REQA 3GH7A 5TAOA 2A0NA 4O0KA 4O1BA 2F6KA 2UY4A 1PL9A 1JEZA 4LV4A 1DXEA 2E09A 4HNLA 2UY3A 2YDAA 1G5AA 1I2PA 2IUZA 4AXNA 3EWCA 4YYCA 3G0UA 3H24A 2QDGA 3W38A 1ENUA 2VEFA 1EJSC 3ARYA 3N2BA 2QR6A 4MPKA 4LALA 3W73A 4NYYA 2ZIDA 3DIPA 3R8GA 1A47A 2VCCA 1G4TA 1QPRA 4TO8A 3NL2A 5IFTA 3CHEA 2G3JA 2VEPA 2O9RA 4JN7A 3S83A 4DB7A 2PLMA 4XD4A 2XFRA 2W3ZA 4WDTA 3T07A 3CZKA 1F7BA 1OGSA 3G1DA 4H8HA 1CXLA 1W9PA 4I3GA 2WMFA 4BWLA 1KLZA 3FLUA 2H8XA 3O15A 2YLLA 3S46A 1E73M 2VGFA 5AB3A 1V3HA 4ZFMA 1D7FA 3QTGA 3SUVA 2E6YA 1RJRA 1VZWA 2REQB 3KX6A 7REQA 3C8NA 1IWPA 3PTQA 5JVLA 2IPWA 1PIGA 3V3WA 3RAOA 3ABQA 5HATA 3L2LA 3ITLA 4J3ZA 2CLIA 1ZJIA 1DOSA 1O5KA 3G0SA 3U0HA 3P5ZA 3WK3A 4LY8A 3NQAA 2E68A 3SCOA 3E2RA 5HQLA 4F0RA 3AYVA 1BXCA 3SCWA 5I79A 4GUIA 4U3AA 5EU9A 3BPWA 4R85A 4MNKA 3H4XA 4XSMA 4MOZA 1WPCA 4FOKA 3FHAA 1Q66A 3BW3A 3H12A 5A6LA 2E7FA 1DXIA 4UQAA 1EOKA 1QI4A 3AS1A 3LU2A 2H3DA 2VDGA 4MADA 4KW2A 2DZWA 5T9BG 3CAQA 2P8CA 1RH9A 2TYSA 3N17A 3WQPA 3ZS4A 2C6QA 1EP2A 1ZSXA 3KM8A 3OG2A 4KIRA 5DEZA 4AZ5A 1UKPA 1A5NC 4HCLA 2Y5SA 1L2QA 4JQ1A 2DVTA 2BVYA 3MTWA 4Q7NA 2J27A 1EF2A 4HK5A 4IXXA 3VFLA 3IVUA 3LTSA 3GHTA 7REQB 2J7GA 3AMDA 4W8LA 3ZWSA 4DJFC 1GPWA 3ABXA 3R0KA 3KRSA 2Z0IA 2XGBA 1OB0A 3QPEA 4TTUA 2C13A 4GXWA 1JZ3A 2Y88A 3F4DA 1VRXA 4NJJA 3CUHA 5G4EA 1KTBA 3C61A 5DFAA 4CNOA 2GUBA 1MW0A 2GOUA 2E0PA 3H55A 1IXQA 1VRDA 4QLLA 1IEWA 5LGZA 1C3FA 4JHMA 4Z1AA 1QWKA 5BXPA 3W7IA 2FHFA 5CC7A 1RPXA 2I16A 4QG8A 5C70A 1VP5A 4HPJA 3AS3A 3CZ8A 4TV6A 1K02A 3CIVA 2VI0A 3VD4A 2Y7DA 3WDHA 1FRBA 3MV11 5FEXA 5MF5A 2WVUA 3CUGA 3UQNA 3F2DA 1VD6A 1F2JA 1JVNA 3KLKA 2NUYA 4NZ5A 4MJMA 1LRTA 3BLDA 3GH4A 4IMDA 3BG9A 4HK6A 2HPIA 4DUVA 3LNMA 3C2EA 4IQJA 3M7WA 3DENA 5B7ZA 1VLWA 2X1UA 3PWGA 4CQDA 1OT1A 3QHMA 3QF0A 4MB5A 4W9TA 4H3DA 2A3AA 2P76A 3P2VA 1MEWA 3Q58A 2E25A 1LCOA 3PNUA 3N2OA 4ZSTA 2CERA 2C0AA 2VHLA 3EKZA 3USZA 4QS5A 2VZVA 1E6SM 2PU1A 4JQ4A 4IFOA 5D04C 4QCEA 1MYRA 3VIHA 3M47A 2V2HA 2G8ZA 3CQJA 3TNOA 4F0KA 2BASA 3D6NA 5LIWX 4LBUA 1F4AA 4D8AA 1TZZA 2ATSA 1BF6A 1PIFA 3I6TA 4D71A 1AFSA 3PBGA 3MU7A 2WPGA 1H49A 1M7XA 1C8YA 1RP8A 4CU6A 4UNLA 1VHNA 4DIAA 3SIMA 4LF2A 4JY8A 3C3UA 1P0NA 3PPCA 1TX2A 2DSZA 1DV7A 5C7VA 5E09A 4FXRA 4JTLA 4B5SA 3WJWA 4TU1A 3NWRA 2PDHA 5D8ZA 3ID7A 3CASA 4JS3A 3BK0A 5DANA 3OODA 4ZE4A 2VR4A 3VXGA 1Q6CA 4TVCA 4BQ3A 4AD2A 4RZ5A 4LS1A 1XH0A 1UB3A 1F73A 3UG4A 4HNTA 3T0BA 1BQGA 1U5HA 5FJPA 3N4FA 1UOKA 4XISA 2I7GA 4FP1A 4RNIA 3UCCA 1EDTA 2ZRWA 2D20A 4L61A 1CB2A 1YMYA 3GU9A 1E9IA 4GOAA 4TOQA 2FVKA 1UWUA 4IUOA 3AXHA 1UW9A 4L4OA 1LRNA 4O15A 3KUMA 1LT7A 4JHOA 1JGMA 1YE4A 4GKTA 3IV3A 3ZM8A 4WGXA 2NQLA 1OHLA 4A6GA 2V3FA 1A80A 4XD5A 1EJXC 1TA3B 2GGEA 2VFHA 3WIJA 2W5FA 2VKZG 4RUBA 2X42A 5AKQA 4S3BA 3QJAA 5C54A 3JVAA 2YBTA 5HAOA 3LERA 1DTNA 4NNAA 1XQLA 4J1OA 1G1YA 4BA0A 2AAMA 4PULA 3CPRA 4WZHA 4DQWA 2G37A 2V3EA 2OWCA 3CBWA 4ILSA 4ADTA 3T44A 2FLIA 3W85A 4AUBA 3O6YX 1DJNA 2GSEA 4AMAA 4XKMA 2Z1KA 1W3LA 1VBHA 2ISFA 2ESCA 8RUCA 4WJXA 4DJDD 3NCOA 3ZJ7A 3B8IA 4Q7IA 4GLEA 3L4UA 3E0FA 3U2EA 4MLRA 5AC8A 2XZ7A 2VRKA 3M6DA 2WVSA 1XXXA 1Q7ZA 3KBSA 2QPSA 1TPC1 4LUTB 3MBDA 4ENLA 1BTCA 3NL5A 1YHTA 3LXCA 3O1NA 4LVBA 4EPDC 1WXYA 3IVTA 1EA9C 2VJXA 1F6KA 4HP5A 2BVDA 1A0DA 2Y7FA 1H1ZA 4AZHA 4K8GA 4LUSA 1CB7B 4AHPA 3B9OA 3BLKA 3OG3A 2QJGA 1G6CA 4CNNA 4H8VA 3RM4A 4DZHA 3DX5A 3L9CA 1P0KA 2ZXDA 1Q8AA 3BG3A 2XDFA 2VT0A 2QAFA 3WNLA 2RJGA 3BDKA 2FTPA 3O2LA 2VX5A 1J5TA 1S5TA 4ATWA 1EWEA 4A29A 1XRSA 3UCDA 1D8WA 4N6EA 1SPQA 1UKTA 4B5UA 4C90A 4PZVA 1TJ2A 1PKLA 4CCEA 1JL8A 1W2VA 1KFKA 4W5UA 4EAYA 3DFSA 3OZYA 4QBXA 4S2CA 4GQRA 2LLEA 3ITVA 1EO7A 4UCGA 1A0CA 4N6FA 4H19A 4L9ZA 2QIWA 2B7QA 1F6YA 3I68A 4RXFA 4QAIA 5SWUA 1JZ4A 2VFEA 5FF2A 3S3GA 2QPUA 1V7AA 3B0UX 5XINA 3PB0A 3W23A 4UTUA 3NA8A 4CQCA 2PWFA 4LUSB 4PB4A 3U2CA 3G22A 3L4WA 4NJKA 3IARA 3IUIA 3ZQ9A 1X6NA 1JNDA 1W1PA 4GQ0A 4Q4QA 3MSDA 1UP3A 2NSOA 2X7VA 2NT1A 4Y9OA 2EO7A 3LRLA 1WKDA 1H11A 3QMRA 5HMDA 4CGTA 2Y8KA 2ZXQA 1EIBA 4DN1A 1CBGA 2XIMA 3C3NA 3BOFA 4X63A 5GNYA 1RR2A 1HO1A 3D5HA 1DKWA 1R46A 3OIXA 4Y9MA 1RVGA 5CQ1A 1OFEA 2CESA 1LROA 1GKRA 2HDJA 3H2NA 1QK2A 1DJIA 3LN3A 2ZXBA 4LRTA 5D02A 1CGXA 1SQ7A 3RO8A 2YBUA 3SN0A 3G6LA 3IV8A 4YYFA 3ZOAA 3VO0A 2YB1A 4DJDC 3UY8A 1O66A 3W1QA 3WQFA 4MAVA 5H8UA 2DFAA 2VR2A 2ISWA 1B1YA 3B9DA 1NF0A 1V6VA 4GX9A 1B57A 4M24A 4JX4A 2OQLA 1UR0A 1LUCA 4LUYA 3G3DA 4AG0A 3TZNA 1HP5A 1NH6A 5AC7A 5I7GA 4DBDA 1LQAA 4AD0A 3W22A 1OX5A 4RKAA 4XZLX 1TREA 3DBPA 1IGWA 4C7FA 4TXEA 3P67A 3IJLA 2B7NA 3LOTA 4JNYA 3T09A 2ACRA 3VUPA 2VNCA 4YU1A 1V0MA 1NDZA 2BY2A 1XH1A 1TWDA 1B2YA 4HTBA 3R7MA 1FKXA 1KCXA 1FWNA 3PJXA 1ZAIA 4O52A 3S2JA 2WBKA 1CGTA 4AZIA 4JGDA 4HB7A 1JRBA 3WDPP 2O9TA 4MFDA 5CJNA 3W25A 3V4BA 4E0CA 1CENA 1UA3A 2Y70A 4FLQA 4DZIA 1GQNA 2V8ZA 1EYEA 4AAJA 1C93A 1Q5MA 2IS7A 4Z2GA 4JOMA 3LHUA 2WJFA 4QIUA 1DTUA 2OVLA 2DT3A 2QZRA 4RV8A 5LGXA 3BLIA 2ZQ0A 1QI0A 4YS1A 2BODX 4OWGA 3U4FA 3TJ4A 3EWXA 3PBUA 3UJFA 4GYPA 4AX6A 3VCNA 4EVZA 1LUCB 4X9SA 3EX6A 3TP4A 2WNWA 2DJLA 4DNHA 2HRWA 4XIMA 3OQEA 1GVRA 2HMCA 2QV5A 4GIRA 1T40A 3NYDA 3PY2A 4AD3A 1XYLA 4Z0SA 2MANA 3MJMA 3KOYA 3KTXA 3HQOA 3ZZ1A 3QR1A 1ISZA 4IFKA 1FWDC 3OEXA 3NQGA 4DO6A 2WSQA 1EHNA 1FHVA 3ELFA 1J12A 4JFTA 5GPRA 2NQZA 3TLQA 3Q4DA 3OQ8A 3UXDA 5K7JA 1GOMA 2F61A 3COTA 5DF0A 5FOOA 2EJ1A 1IT8A 1UC4A 1FWSA 1RAKA 2CLHA 4JTDA 2PLKA 2OFJA 1XL9A 1XPGA 3FV9A 5CGTA 5BXSA 1WCGA 4F79A 1NEYA 1BKHA 1T41A 1ZQ5A 4GH1A 4LX4A 2AMGA 4LAKA 4GIEA 3UESA 4ML9A 4GRSA 4AWUA 6XIMA 5E93A 3TCSA 4W88A 2AKZA 2OKOA 4GVIA 3WLJA 4PBFA 1A5SA 1RK5A 3AWOA 3ITXA 4OBRA 2D3NA 2QCCA 3PHAA 4QP0A 3P5YA 2OX4A 1LLWA 1BFNA 5EGRA 1DHKA 9XIMA 3DGRA 2ZICA 4JTUA 2PZ0A 3M5VA 4RR4A 1BGGA 1G4PA 3MT1A 1SU5A 5CAHA 1B9ZA 3BICA 4H9ZA 6TIMA 4UQBA 4WK9A 1LZOA 3CZLA 1ZLPA 1YQ2A 1EX1A 1C8XA 4ZFCA 3RX2A 3VDHA 2WC7A 2QCDA 2RHGA 4FXSA 1TPUA 3W83A 1AJZA 4LT9A 1TV8A 3CNYA 1OM0A 2ZC8A 3N2TA 1TWZA 2WPBA 2WKJA 3EDKA 2DZTA 2QS8A 4NZ1A 3HJEA 4GQQA 3QMSA 3GTHA 3ANUA 1TIMA 4MNJA 4FB7A 1J2BA 3PUGA 3PZGA 3KAOA 2QJHA 3QGKC 2BHZA 4D6FA 1GKQA 4RX0A 4Z08A 2OYLA 3O0KA 1OFOA 3V18A 4AYGA 3TE9A 4LVFA 2YOCA 2BY0A 4FLSA 3SY5A 5AHNA 1TSIA 3U7BA 2INEA 1SUXA 3G1FA 3W37A 3MSGA 5T8GA 4ZO7A 3DFHA 1OYBA 1SZRA 1N8IA 2E5CA 4BWLC 3LGEA 3MDWA 1XW8A 2XISA 3EDDA 4J3XA 4C91A 2ZX5A 4TTGA 1KM4A 3K2GA 3LXAA 3ITOA 3SADA 3T6CA 2KAUC 3FX4A 1GNXA 3UBPC 4OECA 3APTA 2Q6ZA 3ALGA 4IIDA 4BI7A 1W3KA 1TCDA 3CPUA 4YVVA 1F07A 4LVAA 4NJHA 4QSHA 3AYTA 3I7QA 1O1ZA 4JTGA 4EF9A 2EPHA 3P82A 1MEHA 3VIOA 1W1VA 3TFCA 4S3CA 2JGYA 1DJXA 1PBGA 1E4MM 3ARSA 4AU0A 3CH0A 4QDWA 5E1QA 1PKYA 5HK4A 5KEZA 4RPPA 1MO0A 1H62A 1DORA 1ZENA 3W7QA 2ASHA 1NDWA 3VD7A 4ZODA 2B81A 4IJCA 1E1CA 3CGTA 3W75A 3G8RA 3QGAC 2GUUA 4C1LA 1JPIA 3T8LA 4DF0A 4IZGA 4OGZA 2PP0A 1F3WA 1NFPA 1QUMA 4F48A 1KW1A 1BAGA 1CNVA 4U10A 2CWXA 2ZA3A 1LF1A 1KBBA 1SGJA 2V81A 1UJQA 3G1AA 1W56A 3CO4A 3CV7A 1V0LA 1BD0A 4O8RA 2VZTA 2VX7A 3PPFA 4MWAD 3VILA 4XUGA 1W9DM 2C7FA 1IEVA 1RXOB 5M03A 3P8JA 4J3VA 1YDOA 5IHSA 3TROA 1VEMA 1IXPA 4JDYA 5CC6A 3I4EA 2AGTA 2QGHA 2BX7A 4F9JA 2PF0A 5U4NA 3Q94A 1OFDA 2CBIA 2EJAA 2CW6A 1K9TA 1MXGA 4NHVA 3E0LA 4WOZA 1H7NA 4HOWA 3I10A 1JXKA 3M0YA 2DV0A 3SCVA 3UR2A 2ATMA 1MRAA 2ONEA 1XLCA 3CMFA 1E1CB 3UJRA 5EMYA 1UR3M 4O4VA 1S3HA 3ES7A 5H1WA 4FALA 1XDMA 1KO0A 2ZRZA 2QNEA 1Q2SA 4JY9A 3QLLA 4ATLA 1NTHA 1HJUA 3ARVA 3USBA 1A3HA 2WWDA 5D4YA 3BCDA 2VENA 3FEQA 4KETA 1QNQA 1SM9A 4NYUA 5EA9A 4C6FA 5LKYA 1IEQA 5I3FA 3WD4A 1XG4A 3ZLHA 1EYWA 1XP3A 5BXRA 3FGCA 3M1ZA 3UT0A 1EZ2A 5LNVA 1VFFA 4B90A 1TR9A 3UVIA 3TIMA 1CXIA 3W7KA 4LVGA 3HMCA 4LAOA 1XRFA 2Z2BA 4IP5A 1J6PA 3KTCA 4WJ8A 2OMAA 4S3KA 2CWNA 1Y0EA 1TV3A 1WV2A 3VOFA 1KBKA 3BJSA 5LNRA 2VZSA 2BTMA 4MZYA 4UNKA 1UC5A 1BXNA 5PTDA 1C29A 1W3HA 1JXJA 2VWSA 3CUZA 1PIIA 4A05A 3ATYA 4BQ5A 4D1JA 3CJPA 4GY0A 3TOPA 1A5LC 4M1RA 1M3UA 1QBAA 3WH6A 1GCYA 2EG7A 3QOMA 4CEUC 1K6WA 1KFJA 4ZL1A 2Y7GA 2XH0A 2ICSA 4Q33A 1XC6A 3W07A 3VE7A 3F03K 2CZEA 4PTWA 2WHMA 3PBWA 1XLMA 2O9PA 1E4IA 4HYRA 1BYCA 1VS1A 1PPIA 2XIBA 5FIPA 4KEVA 3MUAA 5K9XA 3FGCB 3WNOA 3TW9A 3SQMA 1TPB1 4Y96A 3M0LA 2ODOA 3VABA 4U31A 4QX4A 4WDWA 3ZIZA 3OYXA 4N2YA 3AXKA 3EWUA 3VIMA 2GSHA 3UWYA 5C9WA 1OX4B 1EJTC 2OLHA 3T0CA 5AZ1A 2EHHA 3PANA 3IIZA 3CS2A 4NL1A 2FDMA 4MWAC 4X3ZA 3MP4A 5AHFA 1TZ7A 3U57A 2DEPA 1Q6GA 4CD4A 2C71A 1W3NA 1RQHA 2ZXAA 2A7PA 4YJ5A 3H2CA 2PC8A 3S6OA 4ROQA 3NM1A 1WE5A 4HD5A 4O53A 4UC5A 2NXHA 1K6AA 3QLDA 3MMTA 3CUIA 1K9DA 4E2BA 3IIPA 1K9FA 3EOEA 2DORA 4K1WA 1YXCA 1KFEA 3WJSA 5F7UA 3T0AA 3DG6A 2Z7KA 1XBZA 3E1F1 8A3HA 3AMKA 3ZT7A 3IIVA 5LNSA 1LWIA 1BSIA 4XZ9A 2CKRA 1SJBA 3WQEA 2IPGA 3SRHA 3FXGA 3EX3A 3SJNA 1R2TA 3IACA 3F5JA 5CPMA 2G41A 3TC3A 1UIPA 4GY7A 2R6OA 1EUAA 4BQ4A 5C9RA 1T5AA 2ZVRA 3POCA 3TA6A 1YNYA 3SEPA 3VKJA 1XCFA 1HZYA 2FKPA 1IXNA 1VF8A 3R25A 3MUXA 4DO7A 3AJ7A 5FD0A 3NPUA 2OT1A 2PFHA 3RRXA 2ISVA 4IP7A 2A1YA 5FAGA 1FCQA 1CGYA 2QLYA 4O0QA 1UMYA 2QHAA 3NOEA 4IPIA 3PFRA 1O68A 1OD0A 1Z42A 3P93A 1MQRA 1XD1A 1QXLA 1J79A 9CGTA 4UMAA 2QAPA 3ARXA 5C9XA 3BUVA 3MUY1 3JUGA 1UPPA 4GHRA 1XLIA 2RDTA 4CD5A 4EOUA 3VC5A 5LIXX 4R34A 2XZ9A 3LCLA 4PL1A 4RE0A 1GZJA 3PAOA 4PN2A 3WQCA 3OGSA 3C0QA 4WDUA 3L4TA 4Z2JA 1EQPA 4O1AA 3WO8A 4EXBA 1HXJA 3QVQA 1EBGA 1DWJM 3C6CA 3GHRA 4Q8TA 4N9EA 5D03A 5LIYX 3VM7A 4ZQMA 4K3ZA 3WLTA 5DRCA 4XBKA 2AMXA 2J4GA 3M7SA 4CEXC 2VCBA 4ROPA 3AZSA 2A4AA 3TMQA 4WX2A 4HMNA 2AGKA 1GG0A 4N9BA 1PKMA 1W3IA 1KBIA 1WDDA 4MG4A 2YW3A 3OIHA 3WDJA 4ECLA 3L0GA 3W1TA 3PZVA 4MKVA 2GVLA 3NSNA 2QJIA 3M4HA 1PCKA 3UXIA 4CD8A 3UXKA 4XQ6A 4MIMA 1GVYA 1JZ7A 3VE9A 1W37A 3B05A 1IE7C 3DYOA 3BLOA 3VK5A 4HU3A 4MZ1A 4QSFA 1OEPA 5HWMA 2XIJA 2W63A 3M0XA 3N14A 4BJHA 3MKVA 3A47A 4XD6A 1SSGA 3WJZA 3GZ3A 3ANVA 4XZNX 2QF7A 3GD6A 4XSLA 2A21A 2NQ9A 5D2TA 4A3UA 3AMCA 4H83A 4P8VA 1NM9A 1V8EA 1AQ0A 4O11A 1VPXA 1F3XA 3BURA 4MGGA 4PCTA 1XLHA 3HGJA 4WQ6A 3N2CA 1EJUC 1XYFA 3LQGA 5B7YA 2NX3A 3ABRA 2PDFA 3YPIA 4GYKA 3B8VA 1YIXA 1IXOA 2HK1A 3LSBA 1GZGA 2QDEA 3C2VA 1I2NA 1ZJAA 3V75A 4I9MA 4G9PA 1VKFA 4M56A 3VGDA 4AC1X 1A5CA 1WOBA 3FKKA 1TTPA 4CVWA 4PCPA 3VKCA 5J5DA 5T9CE 3PUDA 2YCLB 4Z2KA 5L6UA 1Z3NA 4BI6A 2ZRUA 1DXFA 3FS2A 4FLOA 4LOCA 4R53A 3AIVA 4AXKA 2I56A 3MQTA 1JUKA 5TBOA 2ZWYA 1E56A 3WQ6A 4Q8QA 2C1IA 4Q4RA 4P8UA 5F1UA 3URQA 3W2UA 2PMQA 2YPIA 2Z1VA 4IIFA 4B5NA 1W1TA 3NEHA 2GVJA 2IXUA 4REQB 3L12A 4IUGA 4TR9A 1S46A 4GI4A 4LEFA 3U9IA 1HKJA 2F38A 2VFDA 1JYWA 3MKKA 2OB3A 1Z32X 2VOMA 1HX0A 4ZTYA 4CNPA 3HGOA 5EY5A 3FKRA 3B9EA 3V5CA 1J2WA 2PBGA 4PMJA 4Q3MA 1SZFA 2HE8A 2GQ8A 3RFAA 3W7PA 1L9WA 5CSUA 4QJ5B 3HN3A 3GDBA 2CZVA 3I3DA 5JBDA 3OYZA 4UR7A 4XKYB 3E6EA 1Y5VA 3W70A 2D69A 4Z1DA 4TVDA 1EO5A 4RW3A 3U5UA 2WVVA 4WIWA 4G56A 1MXDA 1AMKA 3TYCA 2F2KA 4EF8A 1Q6LA 4GYPC 2ISSA 1R86A 1GW1A 1LG2A 4N42A 5AC6A 2OSYA 5K3VA 4UTFA 3KRUA 3T42A 4GACA 1OINA 1XIHA 3PUEA 2WCGA 2Z24A 4KRZA 4DO5A 4JKKA 2PDBA 1KRBC 4DF2A 1HUVA 8XIAA 3BMVA 2P10A 2VFFA 2F6UA 3C2FA 4NX0A 5GVJA 4BCEA 1YDYA 1TX0A 1JDAA 4FIRA 3HG2A 1B3ZA 5E0FA 2ZUUA 4ORMA 1KWKA 1N8WA 1X7FA 4JIQA 1V3KA 2HVNA 4MZ8A 5BNKA 4D6DA 4C6CA 4IGNA 1MZHA 2WMIA 4HPGA 4QGCA 5CSSA 2WSYA 3I3BA 2X05A 3ITTA 3SCSA 5G2WA 1A4MA 1JAKA 3DGBA 3NDYA 1FHDA 3A5FA 2FH6A 3S1WA 4MJ4A 2WVVB 1Z69A 4MUZA 2RH9A 4GC3A 2VD9A 3IPWA 2IKGA 4LYRA 2W62A 2FHCA 4HU4A 1RZMA 4N9DA 3S1VA 2GFTA 1YTDA 3BW4A 3V0UA 5M1TA 1GHSA 5HPCA 4UTMA 3GLCA 5HMFA 4D6CA 3TN5A 3MWAA 4NKCA 1A3XA 1V3IA 3HM7A 3TTOA 2EPLX 1KXQA 3RITA 1TZ9A 4KRTA 3A3WA 1E55A 5DT7A 4ZQPA 2YL9A 5JQ9A 5AC5A 3IJIA 4G6CA 3SQLA 3AC0A 2QJNA 1ELSA 4TX8A 4J3TA 2ZADA 3EAUA 4H8NA 4ZQOA 3P8IA 3MHUA 3URNA 4NRSA 1P6WA 2IXVA 3O3RA 4WLCA 5BOFA 2WSKA 3VIPA 3GXTA 4TIMA 2QPXA 4FX8A 1OYAA 4X61A 1DIEA 4RXGA 4G1NA 4KWOA 4ZA0A 3RN6A 4LUIA 4N4QA 1ZY9A 4QEHA 5KZ6A 3W76A 1VFOA 4FZIA 4XAFA 1D3HA 1R6WA 3W2MA 4IQDA 4NRRA 5CGMA 4C1KA 1I1XA 1C7SA 2OKTA 2D2HA 3XINA 5TIMA 3NPVA 4JPGA 2ZTKA 4IL0A 1LP6A 3CV1A 3W2NA 2BY3A 3KBWA 1ZCCA 4D2JA 5LHFA 4KEMA 3GVGA 5DT5A 1UH3A 5IM51 2BWGA 1JDDA 4O57A 3TN4A 1PYFA 2VWTA 4DELA 3WEOA 1L6FA 3A5VA 5ECUA 1JQVA 4GH3A 4A4AA 1DBTA 4PC8A 4W5ZA 2OSWA 3W7DA 1B3XA 4GY1A 3WFLA 1XSJA 3WF2A 1TPVA 1E4NA 4UTTC 1OQFA 1Q4NX 4DAIA 1HQTA 5DELA 4R3UA 2WM0A 1VEPA 4W7VA 3U7VA 1A5KC 2Z1WA 3WKZA 3CQHA 1QNPA 5BZAA 2XUCA 1W5NA 1XLKA 3BARA 3VDAA 1W3JA 4D9PA 1XKJA 3DC0A 1B5TA 3SN4A 4YHEA 2WC4A 3GG1A 1E6PA 5ABEA 2G3MA 1TTJA 4IPPA 1JPMA 2BG5A 4YHGA 4H6EA 3VGFA 3KBMA 4HVXA 3LGGA 1WAUA 4AY7A 3SCNA 3O07A 4WCJA 3EOUA 3DN5A 3T9PA 1XS2A 3HB9A 3UPMA 4FXFA 3GUWA 1XLFA 2GPTA 3K8MA 1KFLA 1BG4A 3AAMA 2WZEA 3JRKA 1BYAA 3OA5A 1OWQA 3QFWA 4IX2A 4CD7A 2XINA 1G4SA 3WLHA 3DECA 1S39A 3HPZA 1VYSX 3GKAA 4CUCA 4YCPA 2X0YA 3EBVA 3VM5A 1XCWA 4GNVA 3DBNA 1RCOB 2BLEA 2YB4A 4BFAA 2R91A 2WV8A 2W6RA 5AC4A 2BZNA 4AD1A 3TKFA 2G0WA 1KKOA 3T40A 1VPQA 5XIMA 4DO4A 1BYDA 2D3LA 1WXZA 4HNOA 5M2FX 2GJPA 3WUBA 1J11A 4H7VA 3L68A 2KZHA 4OBTA 2UY5A 2PGEA 2WJZA 4HCDA 3T2QA 1E9YB 2X09A 1CW2A 5HINA 5GJNA 1YEYA 4HJFA 4L9YA 5HQEA 5IRPA 1BVZA 2IQDA 2TODA 1TV7A 3TWBA 1C90A 4RPQA 4NQ1A 3V7PA 4QAWA 1QJWA 3BL3A 2BV9A 4E5TA 3RHGA 1E0TA 1SMAA 3R6IA 1ZRQA 1UR2A 1CLVA 3KTSA 4GFSA 4KRUA 2CLKA 1FWAC 3VDCA 2NUXA 2OR2A 5BU6A 2CC0A 2IQTA 3LZ3A 1UD4A 3TJIA 2Z26A 4M8UA 1IIGA 5AZ0A 1LBLA 2GGHA 1O1HA 3HPSA 2VFGA 1QHPA 5HDRA 1GEQA 2A7RA 4MJ2A 3AS2A 3BAXA 4INFA 1NQ6A 4DJFA 1PS9A 5F1VA 2CLOA 1FVPA 3FYOA 3APGA 2P3ZA 1JCYA 2J7HA 2VRQA 3EEZA 2OGJA 3MP3A 4I5RA 1AH4A 3NIYA 3LB0A 1IIHA 1E0UA 4M7SA 4P8XA 2F7FA 3NM3A 4C6IA 1EPVA 2GQ3A 5IDIA 2GGIA 1E3XA 6XIAA 4ZQRA 1EGZA 3G1HA 2P88A 4OKDA 1HT6A 4A3RA 2J75A 3EPOA 2VO5A 4NP7A 1EXPA 1GHRA 3VGGA 3A64A 3VGEA 4PMRA 3FFSA 5DMLA 4H9YA 3DKLA 5F4WA 4HSOA 1H63A 1W5OA 1XLLA 2Y6ZA 2ZZ7A 1M7JA 1PVNA 3TYZA 5C0QA 4JTHA 1R30A 4JTKA 3WD2A 1V77A 4IWWA 2V3DA 1SFSA 4X0NA 2V67A 4GPNA 1IR1A 3QY6A 1UR4A 2QUMA 1LOLA 1HNYA 4IMEA 3DI0A 4C1NB 1N55A 2C1GA 1N82A 3CLWA 3W7RA 4CKQA 1SVDA 3S9ZA 3PZ9A 1E40A 3K5XA 2JFEX 3GXMA 2OOFA 4EE9A 2C15A 3U3HA 2J24A 3PK7A 4AW7A 3LHTA 1HW6A 4EIVA 2CZDA 1SSDA 2A79A 3R13A 3RILA 3S9YA 2WSRA 1OGGA 3NQCA 3NOYA 3ONBA 3N4AA 2VTFA 3T78A 1B4EA 3E96A 2RGLA 1GKPA 5HR6A 1C9WA 3FY1A 1PDZA 4JFWA 3PG9A 1UH4A 4HHPA 5I3JA 3TW7A 3NO3A 3RJYA 1UUOA 1HJSA 4KERA 2FPTA 2YZRA 3M5YA 3GC5A 1DPMA 1JF6A 1ADDA 2YGYA 2AL2A 3R2GA 3W9ZA 2Z29A 3NZPA 4G1KA 5DN1A 1VQTA 4HA4A 3UWUA 2Z25A 3XIMA 4OU1A 1YX1A 2CLLA 1IHIA 2OQHA 5EKYA 4AVOA 4Q4SA 2FZNA 3S0CA 3MMDA 3BTNA 1X6UA 4BR1A 5E0KA 1BLIA 3E3HA 3CHFA 3FK4A 2PTYA 3VIFA 3K30A 4M5PA 4W86A 3VMOA 3QY7A 4E4PA 3NQBA 4FPSA 1AVAA 1EEXA 2YYUA 1Z8AA 2X2GA 1GVFA 2QJMA 3WQ5A 1JNEA 1XDJA 2B7PA 3DYPA 1CDGA 3LZ5A 4C6EA 3GVVA 3CB8A 3EKGA 1YTKA 3KOZA 4QLJA 4R7OA 1KFBA 3MS8A 2P3EA 2OWWA 1HKWA 3SAZA 2DQWA 2GDUA 1L6SA 2CLEA 2Q02A 1UZ1A 4JD4A 2GQ9A 2JIEA 1DIKA 3BV7A 2PURA 3L2MA 2NX1A 1A3WA 3HGSA 3CHVA 3LM3A 5A8PA 2AL2B 5H91A 5GNXA 2J9XA 2WZIA 3K4DA 2JF6A 1FWCC 2FIQA 3K8KA 4H04A 1M01A 1PX4A 3N13A 3WJXA 3WEZA 5AECA 4UNIA 4XZBA 1QBBA 1JULA 2G3NA 3BZJA 2BB0A 1FA2A 5LXXA 1B3VA 1TMQA 2DH2A 1TV2A 3GIQA 4ORIA 4QLKA 2XFWA 3CWOX 5HMEA 1HL8A 3RMEA 4ADUA 3OVRA 3RO6A 4HA1A 1K8YA 1FH7A 3THDA 3BJFA 3KWXA 4S23A 5HJLA 4UTKA 1KBJA 2TPSA 2NV9A 2QJJA 4LXFA 3W2LA 5KSWA 4R27A 5I03A 3WNMA 3LTPA 4B2DA 3DFTA 4IF2A 4BKNA 3HGRA 2XGIA 2YA2A 1P6BA 1KNWA 3VIGA 2ZKMX 4YTRA 3ZFHA 5C2GA 3GSMA 4C6LA 1B0IA 1VCGA 5CEWA 3LHWA 3ONCA 2E8ZA 1EDGA 4PA8A 4Z2IA 3CM4A 4RLIA 3C5QA 3RLGA 4HNCA 3IGXA 3Q2DA 1GQKA 2BS9A 4K68A 3WBWA 3VOIA 3LRMA 4W7WA 6A3HA 3QQWA 1MQPA 4GZJA 2IKIA 1DWAM 3H7VA 5J04A 9XIAA 1P48A 1VH7A 1I1WA 4J3WA 4RE4A 4UTIA 2ZVIA 2WANA 2XU2A 3W86A 2XTKA 1SO3A 3EX4A 1ZCOA 1SMDA 3GYEA 5C2XA 3AHVA 4W89A 5HXMA 4GK8A 2I1OA 1W32A 2OZTA 1CXKA 4LBRA 3ZO9A 1YDVA 1R47A 3DHPA 5EMKA 1YTEA 3OA3A 1RQEA 1X8FA 1DE6A 2CLFA 4LU0A 2YXGA 2J25A 1ZBVA 4NF7A 3LXBA 5FKYA 3HF3A 2BGNE 3AO0A 2I5GA 3WDQA 1CZ1A 4XAZA 1G94A 1MZRA 3UR7A 3FDKA 1V6TA 1YE6A 4H6RA 1ISXA 3UJSA 4C7GA 4WDXA 1WDSA 3C86A 2QCEA 1J18A 4Y2WA 3E2VA 4UFJA 3PPGA 2CIPA 4GKLA 3VIJA 4EKJA 3CMJA 4L4PA 1SZEA 4CCZA 1TTIA 2OOGA 3CO8A 4EXAA 1DE5A 4F0HA 4PTNA 4ERIA 3OOQA 3W27A 2YXXA 3TAKA 4FF7A 1XH2A 5KZDA 3CPGA 3WD3A 2QCFA 4HPNA 3DAQA 1IZKA 2P5NA 4AHQA 3SCRA 3MSRA 3VOJA 3M5XA 1OG0A 3DG3A 3N3MA 2FZ9A 2AL1A 3TJXA 2OJPA 5G2HA 3S2MA 1VBJA 5GNZA 3M9YA 3A23A 2WO5A 2BHYA 1IT0A 3W7EA 3QFEA 3SFWA 1GGOA 1S5WA 3R79A 2C79A 4WKAA 3R10A 3P0WA 2Z27A 4FAMA 1FP8A 3WDRA 1LQ2A 1O5RA 2VVSA 2G50A 3RU8X 4AD4A 3DG7A 1Z9AA 4DJDA 1R3TA 1ONRA 2PCQA 4B16A 5D9MA 2C0HA 4V28A 3QQ0A 1M68A 1FXQA 4X60A 4AWTA 2WXDM 3GR4A 1QT1A 3IIXA 3GVQA 5LZLA 1UKSA 3FJ4A 2E4TA 4GWEA 1KV5A 2H3BA 4K36A 4V27A 2A7NA 4JFSA 1FCBA 2OTDA 3B0PA 2JE8A 1OIFA 1WDWA 3L4ZA 3VNZA 4KPLA 2V2DA 3ECQA 1U1UA 3C52A 1RK6A 2J8FA 1XGEA 1TJRA 1DP0A 5LNUA 2P50A 2FYMA 2G4JA 3QBUA 1MWOA 1KM0A 2PDKA 4IQLA 4L1GA 4B4FA 1QK0A 4MYXA 1GOXA 4KFOA 3L2IA 3MVTA 4B4HA 1WUEA 2X0SA 4P7OA 3ARZA 2YFOA 3VKBA 1PV8A 3DOPA 3RPTA 1ICPA 1NARA 1HJWA 2VUNA 3BH4A 4A2SA 3GDMA 1RJPA 5I77A 5A5WA 5BWAA 1US0A 1GJWA 4I7VA 4V33A 3LPFA 1H61A 3LI0A 4NZCA 1YPIA 5D2XA 4KH2A 4XVDA 3TTSA 3WF4A 4L64A 2NXIA 2RDWA 3FVDA 1MFUA 1UCWA 4W7UA 1EL3A 2E28A 3VNIA 4P7NA 3AHXA 4KT2A 1C92A 4QR6A 4YWSA 3B40A 3B8UA 3KVJA 3W24A 3R58A 2XG9A 3WH7A 2NWRA 1NQKA 4W8AA 2DIKA 1ISVA 1ADSA 1Q8JA 3UEQA 4B3KA 3CAWA 4AZ7A 1TMLA 2WOQA 4RZ6A 2I5IA 4FSAA 4IFRA 4IQEA 4UR9A 1BWLA 1GWJA 1KM1A 1ZBWA 2MUCA 1W6TA 3WMBA 3S5OA 4UIOA 4YMZA 3A3XA 1N2VA 1POKA 1ZAHA 3WLNA 4OOZA 4HOZA 3H4WA 1JDCA 4MDOA 3W81A 4LV9A 5KZEA 2QCNA 4O16A 2PRLA 1GORA 4H1ZA 3R0UA 2HBVA 3V36A 2PWDA 2PDWA 4DJEA 2JQXA 3IJQA 4V15A 3PJUA 3E5BA 3CWHA 4O28A 4LSBA 2HROA 4XBSA 3EXRA 5I2UA 1TTQA 3G2GA 1R9ZA 1HJXA 4PUDA 4JIPA 2H9AA 1GUVA 5A8MA 1W5MA 1BKSA 4XAGA 3A13A 3WL1A 4A3YA 4JIRA 1NFGA 1ZZMA 3MDUA 4O4WA 3MW7A 1EJ7L 1BWKA 2HS8A 3BXWA 3B8SA 1UWIA 2FGLA 4ES4A 1WO2A 4DJFD 4OOUA 4E4UA 4R7WA 4AFYA 4YNGA 1CT5A 1NP2A 7CGTA 3PJWA 4YL2A 2W79A 3PTKA 1Q65A 1EF3A 1PTAA 3NL3A 1G69A 3S5YA 4GBUA 3NYZA 3NAVA 2GJXA 4MY8A 5A8QA 4AWSA 4DZ5A 2QDHA 4OE7A 5M17A 1RLCL 3GXPA 5A6KA 1O12A 2OCZA 2C14A 3LS9A 5I00A 1LORA 3UCQA 3FJ6A 3J7HA 5I3IA 2DT2A 4GQBA 2Y0FA 2WNNA 2V69A 2WLYA 2DZPA 4AEEA 1Z6KA 1V4YA 3KS6A 4HCHA 1Z89A 5TNVA 3C2RA 4GXPA 5LXEA 1UKQA 3FAXA 5LHEA 4YIWA 1SJAA 3GBDA 2H9AB 3EOSA 4FA3A 4UTLA 3HQNA 1XLBA 4QISA 5KINA 4B9ZA 5FF3A 1FDJA 2GLKA 3TQPA 1RBLA 3GU2A 3T8QA 1JG9A 2R14A 3DFNA 1CX9A 1NDYA 3CTTA 1BYBA 3N11A 2O4MA 1EOMA 1PJ9A 3TQ0A 5XIAA 3U6WA 2TSYA 2VGIA 3KCJA 2HQAA 2ZRXA 1D3GA 4DHGA 1S2AA 3AHZA 1LRQA 1WA3A 2G97A 2PWGA 3IJ8A 4XTIA 1HG3A 4GA8A 2GJXB 4Z2LA 1UA7A 2W61A 4O1CA 2ABAA 4H9TA 1V3MA 3IAPA 4KIEA 2WMKA 3C4UA 1K77A 1HTIA 3WMLA 1X39A 3SECA 5HMSA 4UQEA 2VDIA 1S2UA 4J35A 3UYIA 5AVHA 4OV4A 4NJIA 1B3YA 2Z28A 1F61A 3LK6A 1XI3A 3UJEA 3VVGA 1DQUA 3C0JA 2QT3A 4C6NA 4H2HA 1I60A 4A21A 4PFMA 2J8TA 4AYSA 1W9XA 3GH5A 4NJGA 2YCJA 3VZYA 3WEMA 3KOFA 1VFSA 1M7PA 4UTHA 3MO7A 1YPXA 1KR1A 4JKLA 5I3DA 4GIAA 2JF7A 1UBSA 5ENLA 4CN1A 4M6UA 1JYVA 3PWIA 2POZA 3BAJA 3F7JA 3HQPA 1V6UA 4IIBA 2GWNA 1ZNNA 4AX7A 6ENLA 5A2CA 1XM3A 3L66A 1XIGA 3IUHA 3S5SA 3L21A 5LA1A 1FWWA 2PD9A 4POCA 3U2OA 4CNTA 4OJYA 1UUMA 4RZ4A 4H9MA 1PB0A 1E6RA 1WOAA 1VBGA 2YDQA 3UPBA 1H50A 3CAKA 4DYEA 3IGHX 2CZ5A 3PSVA 3K4AA 1OABA 1D3CA 1F9CA 1IZCA 3LQLA 1QDSA 4JFVA 2UZ9A 3B3DA 3WQ4A 1H7PA 1IGSA 3SB0A 1AL8A 4QCFA 4YN5A 3AYSA 3AUOA 4PB3A 2ZX6A 3HOJA 3VINA 1QPOA 4ZGYA 3TA9A 4P5UA 3IK4A 3NNTA 3K4WA 3ZMRA 1HJQA 1M04A 5C55A 1IV8A 4K8EA 5A8OA 1MUMA 3ITGA 3GM8A 3VGHA 4WXZA 3T05A 5CPQA 1UD2A 2CCRA 3HG4A 3UR5A 2W66A 1P0EA 3CT7A 3T4CA 3BANA 1V08A 1TRIA 7XIMA 1BEUA 3UFYA 4AIEA 3UR8A 4O1FA 1AQHA 3V5FA 2O7QA 2AKMA 3CH9A 1RVKA 2ZZ2A 3BG5A 1FH8A 4NZFA 3SRDA 3TQKA 4P61A 3TOYA 5BW6A 1Q13A 1PZ2A 3UW6A 5AHLA 4ICNA 1AQMA 1M03A 5AOUA 4AZ6A 2W27A 2J6VA 2YL6A 1FHLA 4M19A 4HPHA 5K9DA 3LCXA 4B2DD 5JH1A 1VYRA 4CCDA 3PP7A 1EC7A 2WSPA 4OUEA 4ZE5A 1XLJA 3M0HA 1OX6A 3NFUA 4GO9A 1UQZA 5HWJA 1JFHA 3MPGA 4O14A 3M6YA 4R9OA 2EBNA 2PAJA 2PDLA 5AVNA 1WP6A 1TV5A 1K03A 1E0VA 2BHUA 4GZ7A 3A4AA 4HIBA 2CHRA 4EK7A 3MWCA 3LSCA 1DVJA 3KXQA 5CG7A 3UZYA 4PUKA 5I24A 1A5UA 2E1DA 3EMZA 4A8LA 1SO6A 4PRWA 2OU4A 4HT3A 3WLRA 1G01A 3QMTA 3BGGA 3N9RA 3G77A 2GQAA 4B15A 6CGTA 3LM7A 1UBPC 4PGLA 2DQXA 2EPNA 3QOKA 3LGDA 3NQVA 3RJXA 4DM1A 4I8DA 2W0UA 3CYJA 1US3A 2BNJA 3SGGA 3OLGA 3AHYA 4C60A 4WR3A 4LYQA 3GBEA 3SSZA 3CQKA 3JW7A 4QRNA 1FUYA 4UMCA 1L6WA 4KWUA 1J10A 4OBSA 3ZLFA 1JCLA 3TYEA 4MWAA 2DUZA 4LC8A 4HMDA 2VDHA 3GFYA 3AOFA 3NQ7A 7ODCA 3EB4A 3W1LA 3L23A 3IS4A 1YRRA 3O6DA 2XYLA 3RLVA 1OFBA 5IDZA 2FFIA 5CSRA 4ZOEA 3F1QA 4Y8EA 2YZ5A 1JCJA 2ZZ1A 2EKGA 3W71A 2DZUA 2VYOA 4IP4A 3LCFA 4IHCA 2D0FA 4JAWA 4ZO8A 2VP8A 4G7FA 2EG8A 3AWNA 5A6MA 5A6BA 1EWDA 4Z2HA 3C2OA 3BLFA 3U5YA 3I4KA 1J93A 3DHDA 2QQ6A 3BAYA 4XX6A 1K7FA 3TTQA 3RCYA 1O5XA 2DZVA 1DIOA 1JCMP 5FL1A 4ONVA 1I2RA 3ZWTA 4AB4A 1TPWA 3CC1A 4E2VA 2Q01A 3SGUA 3U8GA 4V1XA 4J3UA 5F4XA 4LB4A 3WF0A 3O6AA 1EJRC 5MHBA 4UZUA 1FWEC 4MWAB 1EA0A 4FI4A 1U83A 4JXCA 3AIUA 3DC8A 1ONWA 4AQLA 3MBFA 1IT7A 3ATZA 4E8GA 1SR9A 1OFPA 2DW7A 1JDEA 3DCPA 3VKKA 5DMMA 2NVAA 4JTRA 2ZE3A 1TE6A 6PTDA 1L6YA 3BMWA 4LNYA 3MP5A 3GHUA 4F2TA 4H9VA 4BQ2A 3NQEA 2CZFA 1NVMA 1GVOA 3S47A 3H53A 2E5DA 3SRFA 1AH0A 3QV6A 1KCLA 1UH2A 5CBIA 1FWJC 1GOIA 3ES8A 3ME3A 3M07A 3T1GA 1FCUA 3LCWA 1FKWA 1DYSA 3WBXA 2EPKX 3A9IA 4Z0JA 4RCXA 1Z48A 4GNKB 2ZDRA 3TX9A 1O60A 4LBSA 4U33A 2ZE0A 2XSBA 4F0SA 3DDMA 4IX0A 3OVQA 3QY8A 1Y5WA 2OEJA 1JZ2A 1VBUA 3WH8A 4JYFA 3LV6A 4UMBA 4Z1YA 1R3YA 1QU4A 3TC6A 2XGZA 3HURA 3P7YA 3PZNA 1MNZA 3GNXA 2ALRA 3VDGA 5A94A 2INFA 2XFFA 4YCOA 1GOOA 1H4PA 2VURA 4DJED 4DPQA 4GXMA 3TSDA 2Y8UA 3I6RA 4K39A 5U7SA 2WQDA 4U3CA 3B9NA 1AD1A 2JIWA 4QG6A 5BOEA 2AQOA 3GDLA 2WBGA 5G5IA 3HBLA 3ARPA 2EGZA 3TYBA 1QHOA 3OW1A 3II1A 1XCXA 4HNUA 4FR1A 4AVFA 5KMYA 2A6LA 5F2MA 5CPNA 1J0HA 4Z17A 1A0EA 2YA0A 4E38A 3UWVA 2NT0A 1E71M 2FMOA 3EPNA 5AY7A 3SIZA 2F6XA 3C0LA 3SCQA 2WHKA 3CHDA 4MF4A 4HSNA 4EXQA 3E5PA 3AIWA 1MUWA 1KGUA 3W2KA 3KZSA 2X1SA 3RXZA 1ME8A 3E74A 1R7AA 4MAZA 2J78A 3K1DA 4O19A 2Z2AA 4C7DA 4XVEA 3VYLA 2O4QA 3WL0A 2SFPA 1IYXA 7ENLA 1E5JA 3KL5A 1CXFA 2HE5A 3EDEA 2J8GA 3G6MA 1GPFA 3MV01 1KCKA 1RJQA 4PEKA 2DVUA 3CEUA 1UD6A 2PDIA 1R5YA 4LPCA 3IEBA 4B5XA 1UR8A 2A3EA 3P60A 1FXPA 3GIPA 1PDYA 2GWGA 3AXIA 1QHZA 2VQUA 3TJLA 3GK0A 1FH9A 1QI3A 5D33A 1XPYA 2Z4GA 3LUTA 1TVPA 1EC9A 2ZTJA 3ZVIA 5EMUA 4GQGA 3WLLA 3LPOA 1ONEA 1QATA 5HUPA 4PBEA 4E6MA 4XBJA 2VEIA 3H2FA 2GJRA 1AJ2A 5EMJA 4BHYA 3MZ2A 5D2WA 3TYDA 3AUJA 1GJUA 3FAWA 4FOJA 4PCFA 4GIYA 2OX1A 2XIIA 1QW9A 3QYSA 3VD3A 3A12A 3W01A 1Y8BA 4M1BA 3KLLA 2DT0A 4AIOA 3SN1A 3IRSA 3M41A 2FHBA 4H8UA 4NNBA 4L80A 4UB9A 4XUYA 1POJA 3G1SA 2VXNA 4OFCA 2XHYA 4AY1A 4LS2A 2GVYA 4JQ2A 3F4NA 1W3TA 1UWSA 3C8FA 4PMQA 5A6JA 3CB3A 1XFBA 4FX7A 4WGHA 5FAJA 1E15A 4Y7EA 2OEMA 2JBMA 5FA5A 3GHSA 1UR9A 3ABOA 2DIEA 4LS0A 4GX8A 1MEIA 3IK2A 4K38A 4RNJA 2HJPA 3L7RA 5CC3A 4M29A 1ICQA 2XVKA 2HWGA 4YWIA 3VD5A 3VKDA 2Y62A 4QNEA 3RX4A 1OBAA 1XYAA 3F4VA 4LUJA 3D0CA 3VNLA 3VCRA 5G1TA 2ZX8A 4LVDA 1A4LA 3QKZA 5EB8A 4NXSA 3PJTA 3B04A 4MKSA 2ZRYA 4DJEC 3T4WA 4AY8A 3BLPX 3RCNA 2PUZA 4DUOA 2IPJA 3PBVA 2HZGA 5D37A 4XO7A 3KVMA 3IJ9A 1YW1A 1W1YA 4PUNA 4WVXA 3GO2A 4GFIA 3DXIA 2GGGA 1UD3A 3KW3A 1XDLA 3E02A 3HO8A 1W1ZA 3KHDA 4J2MA 3QGVA 3ERPA 1XLDA 3B06A 3QW3A 1TUFA 4DAFA 1AZ1A 1V03A 4I9JA 4UOJA 4O8AA 4ZQNA 5I5RA 4B91A 3S42A 3DFQA 4LH8A 2VEKA 3Q45A 4E3VA 2P1FA 4HSHA 2J66A 2J9YA 1PWMA 4R9XA 3I65A 4NVTA 3S5ZA 1E70M 5LNWA 3ZLGA 1JPKA 4LNCA 1RALA 3LY0A 2Q8ZA 2G96A 3SJ3A 4IFKB 2J7FA 1V6XA 2X8RA 3UVAA 4M80A 3REQA 3WNKA 4PMVA 2X1RA 1OCJA 1Z44A 5CPLA 1M65A 1WAWA 4XAPA 4IXHA 2WZHA 2XIOA 3GTIA 2QUUA 1UD8A 3AJXA 1NWUA 1Q45A 1SFJA 1CLKA 1EBHA 1PX3A 3MI2A 1V93A 1BRLA 3AU2A 4O12A 2B4GA 4D6GA 4GUGA 3H21A 3MA8A 3LV5A 3BSGA 4ZB5A 5I6SA 1P7TA 1VHCA 1GVEA 1W5QA 4UXDA 4A8NA 1S2TA 1S5VA 3SUUA 4JNMA 2QULA 4PMZA 3MUZ1 2BY1A 3S2LA 4WXYA 4O54A 3W53A 1RD6A 5BMWA 3KBVA 2V3GA 1UD5A 1V0NA 1P43A 4FHAA 2KX9A 2BFGA 1MVYA 3M43A 1HN1A 2ZZ5A 4J40A 2VD8A 2FFCA 2VEMA 5JIWA 1U30A 1U2YA 3QR3A 3ZJ6A 4JTJA 3KWSA 3REQB 2QCDB 2FZMA 1GG1A 4J2PA 3OGRA 4K8HA 1S1RA 1K3UA 3A9BA 4MY1A 5I78A 4WRHA 5BMXA 1I8JA 1XHGA 1L8PA 4LF1A 3OJGA 1H60A 4C6BA 2I14A 1A5OC 4UTTA 4FX6M 4TMCA 3MO4A 1JJKA 2J13A 3W7HA 3PBMA 1KA9F 4B5TA 4DRSA 1NAL1 2A3LA 4OVXA 3VNDA 1RD5A 1OD8A 3GDKA 4GJ1A 3L4VA 4PH6A 4F40A 3LBOA 1ZTVA 1ITQA 1VIZA 3G3MA 4U5IA 3TXVA 1CLXA 3UNDA 5CJ5A 1P5BA 4JHZA 5HBFA 2JEQA 4YVPA 3HFTA 3GC4A 1X1OA 2DSVA 1SFTA 4TMBA 3UXLA 4QJ3B 2Z00A 1KGWA 1JFXA 1LWJA 2I17A 1WXJA 3GG7A 3B0VC 5KITA 3UWEA 4LFYA 2GL5A 4MB3A 3S1XA 1TB3A 1ZP4A 5C6MA 2Q09A 2VMFA 4G2DA 4H01A 3L67A 4O50A 2VCAA 4PSPA 5JBFA 4PRTA 2Z1BA 4GC4A 3C2YA 1OF6A 3SFKA 1IF2A 1REQA 3ZT5A 1M1BA 2PDUA 1QAPA 3MSYA 4PUWA 1EC8A 2HCVA 3TSBA 7A3HA 4K7VA 1RPKA 1E6ZA 5HWNA 2O56A 4NAFA 2HBXA 1OADA 8TIMA 3NSXA 3W3OA 3HV9A 4NI8A 1TG7A 1XBXA 2WCAA 2DZBA 5I3HA 1Q6QA 1E0XA 2OLAA 2WWCA 1PAMA 3R1ZA 4RE2A 3WFAA 5ECVA 3VAVA 4MB1A 2ZZ3A 4CU7A 5DXYA 3ZJKA 1ECQA 3WQGA 2PDNA 1R3QA 3GRIA 5A8NA 1RY0A 5A6BD 4HZ8A 4IPJA 3EMQA 3OTRA 1TWWA 4RDYA 4Q32A 2X41A 2FMNA 2FDSA 2GK1A 4HZ7A 4LRSA 1PX8A 4L65A 5FF4A 4R33A 3VNKA 3IAQA 3H7UA 4XZMX 3QC0A 3GDTA 1HL2A 2INZA 3L0KA 4DI9A 1H7XA 4H7CA 4JTIA 3B4YA 3HJZA 1CYGA 2ON3A 3SURA 1R2RA 5D05A 1K8XA 1G9HA 4GVFA 1REQB 2TRSA 3UPWA 3STPA 4I90A 2O7SA 3STCA 1YXYA 3IJDA 4IJRA 3VIKA 3VOCA 2ZRVA 3BV4A 2Y8VA 4P7LA 3SI9A 3W2JA 1VENA 4NAFB 1S2VA 1QNOA 1ISWA 2A3BA 3T0DA 3GIYA 5CCZA 5A3HA 1RA0A 3WELA 4DUXA 4LYKA 3DYMA 2ZCGA 3WNPA 4QJ4B 4UOZA 3G24A 2VX6A 4PUJA 3LLDA 1PTGA 4M6QA 3UA3A 2PDMA 3W7MA 1W91A 5FF7A 5CBBA 3B0XA 1F74A 4N02A 2OG9A 1W1A1 1B54A 3WK1A 1FX6A 3WMSA 1N8FA 3CZJA 4NT0A 1QOQA 2RKXA 2PEVA 1EQCA 2GK1B 5C8BB 2B31A 1EEPA 3VA8A 1CGWA 3IVSA 2NV1A 4UWMA 1OCQA 3NQ8A 2YDSA 4Q4OA 2WW5A 2WJEA 2R1LA 3G0XA 3GTFA 3E0WA 3W7NA 1R0MA 5B80A 2JKEA 4BF5A 1O94A 3P61A 3N6HA 4GNJA 1UASA 1XSIA 2ZUSA 1VBRA 1V3LA 3H2OA 4UFLA 4PEEA 1L2UA 1J0JA 2OYMA 4JL2A 2PDQA 3SRKA 4GUFA 4KGLA 3FYPA 1V02E 3BC9A 3W6LA 2D0HA 3UGRA 3IRDA 1KTCA 2HISA 2C91A 3L5MA 4D6JA 3EWBX 3GNRA 1UHVA 1JCXA 1TQJA 3W4RA 3VGBA 2FTWA 2I9UA 4JNZA 3BLLA 1U33A 1DJWA 1P1XA 3LDVA 2EAWA 3CAVA 4AIUA 4JTEA 2NQHA 3IUDA 4HK7A 4LAZA 3VDBA 2XSAA 4NUWA 2VFIA 4O17A 3CQ0A 4KF1A 4S3AA 1F3TA 3KE0A 4IM4A 4Y8FA 5TQLA 3M0MA 3BAKA 3R4IA 3L4XA 2J7DA 3MI3A 4K37A 4WOQA 2ANUA 1BTMA 3ARQA 4GISA 1OCBA 3N3TA 3MUIA 4WKFA 1W0MA 3M44A 2L5HA 2WK2A 3W1UA 5JUVA 5DO8A 4Q6JA 4URIA 3MUCA 3W02A 2PDYA 1IEXA 3CIXA 3RU6A 1ITUA 4JEQA 1WDRA 4I8YA 1EGVA 4C6DA 3WBYA 4WF7A 4CN4A 1Q4WA 2HK0A 4PCNA 3EA2A 3NXLA 1LTDA 3CMGA 3FA3A 3CV2A 1GVQA 3VUSA 1XBYA 2ZDSA 1M41A 3BQ6A 4A3QA 4IISA 1SW7A 3TAOA 2ZZ6A 3H7RA 5GJPA 1AH3A 1NY1A 1JCNA 2E8YA 1E5NA 2WMGA 3TV8A 1BSLA 1Q7QA 4I6VA 3GC2A 4IG2A 4W4QA 5E9AA 1MW2A 1NF7A 3EMCA 3HZ3A 3QZEA 3W1NA 3BZGA 1XGDA 3GAKA 4XK2A 1TQXA 2FTYA 3IJ6A 3F5KA 2Z6JA 2OZ3A 1XLEA 2O0TA 5KETA 2EPMX 3D3AA 3TMLA 2EKCA 1ZB5A 4WKHA 4DPPA 1P1MA 4MVAA 2A2IA 2FQIA 2TAAA 3EWDA 2B0MA 1TA3A 2PCEA 3N29A 1LBMA 3DHUA 3VI2A 4GZEA 1GK8A 3DI1A 2DZSA 3MKCA 3WF3A 1W5PA 1QW8A 3KDNA 1DQWA 4OHQA 1A5MC 2PTDA 4HA0A 1J0ZA 3FSTA 3MMWA 4JEJA 2PSNA 1WYIA 1XYCA 3LPPA 4X22A 3UNTA 1RP9A 1ICSA 1KWGA 4WD0A 2XVNA 1GT8A 3BCFA 1S1PA 4O1DA 3QR0A 3LCHA 4HNNA 1YADA 3OBKA 5E5CA 5I06A 3QH2A 4IG2B 2JKPA 3RF9A 3STEA 1BGAA 1E1FA 4CNUA 1JAEA 2NWSA 2Q3OA 4JTQA 1B3OA 5EMMA 4ZTXA 4N9CA 4UTWA 1ME9A 3P81A 1ZHAA 1CXHA 4LUTA 3CU2A 3U2ZA 1WBHA 3QSRA 2V30A 4AEOA 4ADSA 3RCMA 1BHGA 1EJWC 8XIMA 3B03A 1TPH1 4DZAA 1H0GA 3A6OA 4HJWA 4Y9PA 1JDFA 3OLEA 3PWAA 3BVJA 1DWHM 4DBWA 4S3GA 1NSJA 5FSDC 3TWAA 3HFYA 2XWDA 3QV7A 5CJMA 4XZWA 5A2AA 1PCWA 3W84A 3MCNA 2DH3A 4ZXOA 4XZHA 1UKOA 1A49A 2QKFA 5AHEA 2QV4A 4HMCA 1KLYA 3UZZA 1I0BA 1WZMA 3JR2A 5REQA 5TD4A 5BROA 1NWTA 3VKAA 3W7LA 4JCMA 3N18A 3GWQA 1WKFA 4OV9A 3KP0A 1S3TC 1JR1A 3KOXA 3NXFA 4QQ3A 1OFRA 4PMDA 3VMPA 1XIMA 1E4LA 2C1HA 4MUPA 3STGA 3W82A 3GXFA 3UETA 4HYVA 3ZT6A 2WLZA 2QCMA 2HPMA 1NP0A 9RUBA 5D9PA 2PWHA 3NZGA 2IKHA 3LD5A 3O0FA 3K13A 2O55A 5D8WA 1EZWA 3VZZA 1SFLA 1VAHA 4S3FA 4MKNA 4ACYA 2YDRA 5FJRA 3TZFA 1UP2A 5G4HC 4J27A 4Y90A 2AQWA 1IQ8A 1S5NA 1I2QA 2ACUA 4QS6A 4H00A 1PEZA 3AICA 4MFEA 1J8VA 1TJ0A 3S6DA 4PRRA 2OEKA 5DMNA 2Q71A 4Y6GA 4ZCWA 3GR8A 4Y9AA 5REQB 4HNVA 1HIZA 1QVBA 3HPFA 1YNQA 2V5BA 1YXDA 1SZNA 3L5AA 1B3WA 4L1XA 1KFCA 4H2CA 5CG0A 3GX9A 1LDCA 4PL2A 4JIIX 2GVEA 1A5BA 4NZ3A 2VL4A 3AI0A 5CBJA 3KL0A 2RAGA 3N25A 4ZOAA 3UG5A 4QITA 1MXSA 1X7IA 3B4UA 1DJQA 1H5YA 2XVPA 1DWGM 4F9DA 1KXVA 3VZXA 2QW5A 1JUEA 3THUA 1AW2A 1OK6A 2J88A 1PZ3A 1DL3A 4C5YA 3FHQA 1KM2A 3DERA 3NGFA 2E6DA 3BO9A 2E9MA 4R5EA 4LEQA 4IMFA 1OG6A 1TV4A 2FGBA 1X6LA 3FJNA 4M51A 4Q8WA 3NZQA 4C6QA 3AHTA 3URBA 5C7HA 2E6AA 1NU5A 1UMLA 1I6NA 3LBMA 1D7KA 1HP4A 3B9AA 4KCUA 3EDFA 5BCAA 1VFUA 4HZMA 3HPAA 3A22A 5DBTA 3QV8A 2XH4A 4ZXLA 4AZGA 2Z1XA 4IPNB 5HNUA 3QV9A 1B31A 1MRQA 3ZVHA 2JEPA 2WAGA 3QN3A 5H2ZA 1Y5XA 4CU8A 5HA7A 2XVGA 1Q2RA 4NXKA 5EL1A 4XO6A 1T0OA 3HMJG 4PSRA 3PZOA 4ZR8A 4JIEA 4LYPA 1GQLA 3DU0A 1ML1A 4GMEA 1Q63A 4LQ1A 3VNMA 1OFAA 4E4FA 3KFTA 4WY0A 4O10A 1AL7A 3H4GA 3RUBL 1GZ1A 1C8QA 3HIJA 4P7RA 3I6EA 2DW6A 1TKKA 1T8QA 4JIHA 1LQ0A 1H7WA 1QPQA 3VCCA 3UD6A 3UXAA 3WZ0E 1R87A 1UZDA 3FDGA 4KBXA 5CAKA 1JD9A 4D8LA 4FNPA 4YPJA 2CLMA 2J74A 3R43A 1T96A 4QNWA 1ZFJA 2R1PA 2NUWA 1KTNA 1B4KA 1BG9A 1EB3A 2WC3A 2XH7A 4O13A 1XJBA 2ADAA 3N15A 2W67A 4DWSA 4YTSA 3WBEA 2GYIA 2O9OA 1KM5A 3ZVHB 3OHMB 4F0MA 4P7QA 4TQTA 5CGQA 3UZ5A 3MZNA 2WMIB 2OQYA 2J77A 3ICJA 2XIQA 4B5VA 1GOKA 2G4FA 3NURA 4KWVA 4UQCA 1F05A 2FPVA 1X8CA 2R1MA 3WD0A 3UG3A 4MJZA 4WY0B 5JMUA 2D0GA 1O95A 2RUSA 1D9EA 3NEVA 4WUIA 4I7WA 4ALDA 2CPUA 1FDZA 2F9RA 3EX2A 3GU1A 5DLCA 1UP0A 2PDJA 4UFMA 3WSUA 2DSKA 4H4IA 1XC4A 3W1AA 1V51A 5AHMA 3TEVA 3AIEA 1H1YA 4DBEA 4PMXA 1LM1A 2F84A 4FNRA 3TLLA 1B90A 3QZ6A 5M3WA 4KFPA 1YKWA 5D32A 1JGIA 4U2YA 1WKEA 1XSKA 4LGXA 3T55A 3R94A 3U4AA 1OCNA 4U4MA 4DWSB 5A95A 2JGQA 4MNLA 2NLIA 2VELA 1ITCA 1E0WA 3NQ2A 2QYGA 4A8RA 5CPTA 1NFBA 1UJPA 1V6WA 4FEZA 4HHHA 3EB3A 1YLVA 3MCMA 3WCZA 1KC7A 1XINA 4KMQA 1EPXA 1V02A 2PWUA 5IFPA 3SCTA 1DHPA 1C9DA 3BLEA 3GNNA 2HVOA 4GO8A 4JCLA 4GI9A 4F2UA 4CQ9A 2Q8LA 3RX3A 3BGAA 2DUAA 2WQPA 2OELA 3G1RA 4DY1A 2OGYA 2FZDA 3NQDA 1FDYA 3UERA 3QSTA 2GJLA 2VC6A 3LCGA 5I02A 3TTEA 5BOOA 4J5NA 2J7BA 1UZ4A 1FWBC 5K4XA 3TR2A 3MCOA 2IQ0A 2Z6IA 5D2VA 4LWWA 2J6XA 2PPGA 2DSWA 3TR9A 3UWWA 3GUGA 1J5SA 3WLPA 3E49A 3SZ8A 3HV8A 3G1XA 3LA4A 2FGZA 1DIDA 4KS0A 2JKAA 1F8IA 4GVGA 3OZMA 3GNPA 4MY9A 3O7UA 2OO6A 3N2XA 4RV3A 3N73A 3LPGA 1YNPA 2BVWA 1FP9A 3H23A 4JYDA 3G5EA 1DQXA 2R9RA 1YBQA 3CK5A 3KCLA 4HHLA 2P53A 3P0XA 1UZHA 4WJEA 1UOZA 4G7EA 2D1ZA 2WHLA 4Q4KA 1HF6A 4FXJA 2Z1SA 5G1YA 3EA3A 2WCSA 1Y7VA 1ZP3A 2CU0A 4AC7C 3I3EA 4AZCA 2VRJA 1TJPA 1K7EA 3B8WA 3EDJA 2BXZA 4CQBA 1O7AA 3AFBA 4HOXA 3IANA 3SM0A 4M3PA 3LTYA 2UBPC 4HQVA 1FWTA 4GGHA 1UQYA 3UYCA 3WQVA 3ZJ8A 4ZB0A 2EXOA 3VOGA 3FW6A 3N6QA 5T26A 3SUTA 4LCRA 2ZC1A 4FR6A 4D8ZA 4KQNA 4D72A 4JTFA 1WQ5A 1XV8A 3AMGA 3R8RA 4CVUA 1L8NA 2OXNA 2P0OA 2NXGA 2PGWA 1PO9A 2XJ7A 2YLAA 1H09A 1M7OA <