3PBMA

The crystal structure of adenosine deaminase in complex with chloropurine from pseudomonas aeruginosa
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
313
structure length
313
Chain Sequence
YEWLNALPKAELHLHLEGTLEPELLFALAERNRIALPWNDVETLRKAYAFNNLQEFLDLYYAGADVLRTEQDFYDLTWAYLQKCKAQNVVHVEPFFDPQTHTDRGIPFEVVLAGIRAALRDGEKLLGIRHGLILSFLRHLSEEQAQKTLDQALPFRDAFIAVGLDSSEVGHPPSKFQRVFDRARSEGFLTVAHAGEEGPPEYIWEALDLLKVERIDHGVRAFEDERLMRRLIDEQIPLTVCPLSNTKLCVFDDMSQHTILDMLERGVKVTVNSDDPAYFGGYVTENFHALQQSLGMTEEQARRLAQNSLDARL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of adenosine deaminase in complex with chloropurine from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords Adenosine deaminase
total genus 121
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.5.4.2: Adenine deaminase.
pdb deposition date 2010-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3pbmA00
4GXWA 3UR2A 3PBMA 2PUZA 4IFKB 4DNMA 3HTWA 4C60A 3EWDA 1O12A 3TN3A 3E0LA 1HZYA 3A3XA 2QS8A 4J35A 2FFIA 3UF9A 2E1WA 2R1PA 1WXYA 1YBQA 4PE8A 3AU6A 3LS9A 4ERAA 4H9VA 1RK5A 3E0FA 1NDWA 2I5GA 3O7UA 2FVMA 4C6CA 4GY0A 2VHLA 3WMLA 2Z25A 1FWEC 5G4HC 3OQEA 4GY1A 3FDGA 3WZ0E 1QW7A 2FTWA 3T81A 1EF2A 4J5NA 2KAUC 2WJFA 4KF1A 3LSBA 3RCMA 4XD6A 1A5LC 1EJXC 2W9MA 5CH9A 4BY3A 1J79A 4ERGA 1UIOA 4H01A 2UBPC 3E38A 3S2MA 4C6KA 2FVKA 2R1NA 1NFGA 4XAGA 2DVXA 3GTIA 3EWCA 4PCNA 4UBPC 1V51A 3OVGA 3PNZA 2GSEA 2ZC1A 2YZ5A 3OODA 4NP7A 3CAKA 4NI8A 2Y1HA 4RDYA 2Z28A 4F0RA 1ONXA 4C6IA 3MKVA 4UB9A 1K6WA 1FWBC 1POKA 2XIOA 1R9ZA 1EJTC 4HK5A 3TN4A 4LCRA 4LFYA 3B0XA 3GUWA 1EJSC 3N2CA 2OB3A 1A5MC 4OFCA 1FWIC 2PLMA 1R9YA 3K5XA 2VC7A 3IV8A 1E9YB 3LSCA 3ORWA 2GOKA 3ITCA 3GU9A 4G7EA 3GTFA 4C6NA 4L6DA 1UMLA 4P5UA 2Z26A 3E2VA 1YBQB 3WYZA 3LY0A 2DVUA 4QROA 3AUOA 2OGJA 4RDWA 3MSRA 4CNTA 1ITQA 2PGFA 4KERA 4DLMA 1EJUC 3CJPA 4CQBA 4TQTA 3SFWA 1RA5A 4QRNA 3E3HA 1ZZMA 2AQVA 4QS5A 1NDVA 4JOMA 3IJ6A 4C6MA 4LCQA 4H9UA 1FWCC 1YIXA 4ERIA 3T8LA 4HA0A 2CZVA 3ICJA 2OOFA 2Z29A 2Z4GA 4KEVA 4XD4A 3TN5A 4LEFA 2Z2AA 3DUGA 1E9ZB 2Z2BA 1NDZA 4KIRA 1RJPA 3MJMA 4H9MA 2GWGA 4IGMA 1S3TC 4EPEC 3A4JA 1ITUA 1EZ2A 1YNYA 4HK6A 4XAYA 5HMEA 1EJRC 2GWNA 3UBPC 4G2DA 1XRFA 1FWAC 3G77A 2Z24A 3NQBA 3F2DA 1V79A 4LAKA 2VUNA 4R7WA 1POJA 1FWJC 4DO7A 2UZ9A 2YB1A 1R9XA 1PB0A 3MDWA 1FWFC 3B0YA 4C5ZA 2WM1A 3MDUA 4C6EA 4GK8A 4H9XA 1FWDC 1EYWA 4AC7C 1M68A 4C6OA 4HK7A 4XD5A 1J5SA 2ICSA 4LCSA 1W1IE 4CNUA 1KRMA 3GTHA 4H00A 1K1DA 2R1LA 3GIQA 1RJQA 4Z42C 4CQDA 1GKPA 3JZEA 4I6KA 3O0FA 1I0BA 1UIPA 5A6TC 1FKWA 4I6VA 1KRBC 2R1KA 2F6KA 2VM8A 1EJWC 1ONWA 3IRSA 2ANUA 1A5KC 4KESA 3F4CA 4CNSA 5HMDA 4G7EB 1K70A 1GKQA 4IQJA 4V1XA 2DVTA 4IFRA 3OOQA 3ISIX 1P6BA 1WXZA 3QGAC 4ZSTA 2AMXA 4RDZA 5AKQA 1FWGC 3GRIA 3UPMA 1EJVC 4QTGA 3TN6A 2O4QA 4C6BA 5FSDC 3V7PA 1RA0A 1QXLA 2I9UA 3IARA 3GTXA 1RJRA 3RYSA 2OODA 1A5NC 4NG3A 1JGMA 1PO9A 4BJHA 2D2GA 4IG2B 4C65A 3NURA 1A5OC 4GZ7A 3S2JA 4YIWA 1XGEA 4WVXA 2Q09A 2YXOA 4DYKA 2BB0A 3LNPA 3A3WA 1IE7C 4C6PA 4B3ZA 4C6FA 3DCPA 1P6CA 2EG6A 4GBDA 1KRAC 4IF2A 4DI8A 3EGJA 4H9TA 4KEUA 4L9XA 3FDKA 4B92A 4BKNA 4E3TA 3SO7A 2VR2A 3HPAA 1XWYA 4DLFA 3URNA 4LANA 2G3FA 3D6NA 3QGKC 4F0SA 3F4DA 2E25A 3TNBA 1XRTA 4B90A 2GZXA 2P50A 3PANA 3MVTA 4IH3A 3BE7A 3URBA 4DZIA 2AQOA 4LAMA 3ID7A 2VC5A 4HJWA 4INFA 4C6JA 2HQAA 4XAZA 4D8LA 4C6LA 4H9ZA 4R85A 1J6PA 4EPDC 2Q01A 4XD3A 4LAOA 1PTAA 1BF6A 3IPWA 2Z7GA 2O4MA 3PAOA 3QY6A 3QY8A 4RE0A 2D2HA 4DI9A 3LA4A 4EP8C 4WHBA 3C86A 4DIAA 4CQCA 1PSCA 2Z27A 1P1MA 1GKRA 4KEZA 4V1YA 5E5CA 4GYFA 3MPGA 4IG2A 4B91A 2PGRA 3S4TA 1O5RA 2ADAA 3KM8A 4GY7A 4PBFA 1V77A 2BGNE 1DPMA 2HPMA 3IACA 1I0DA 1YRRA 3QY7A 1VFLA 4ICMA 3F2BA 3K2GA 3FEQA 2WJEA 2IMRA 4EPKA 4IFKA 4J2MA 4AQLA 2HNHA 3LGGA 1J6OA 4MUPA 3T1GA 2EG7A 3LGDA 4CEXC 3OU8A 3DC8A 4XAFA 4PBEA 3IGHX 2Z00A 1KCXA 3S2LA 3URAA 4KQNA 4R88A 4C5YA 4KETA 4GX8A 4M51A 5LXXA 4GOAA 4QS6A 3GIPA 1M7JA 2A3LA 3OJGA 3HM7A 4EPBC 1M65A 4QSFA 3RN6A 1V7AA 3NEHA 5HMFA 1V4YA 1A4MA 2QVNA 4RDVA 4CEUC 2PAJA 4C6QA 1ADDA 2YB4A 4ZSUA 2R1MA 4C6DA 1NDYA 3UR5A 3MTWA 4GX9A 4WGXA 4PCPA 2FTYA 4H9YA 4F0LA 4LH8A 3F2CA 2RAGA 4RZBA 2P53A 2HBVA 4IFOA 2QT3A 1FWHC 1RAKA 3RHGA 2OQLA 3GU1A 3LU2A 5FSEC 2EG8A 3B40A 3GG7A 4IGNA 3K4WA 3CS2A 3URQA 3R0DA 2WJDA 2D2JA 3S2NA 3AU2A 2QPXA 1A4LA 2HPIA 1UBPC 3GU2A 3PNUA 1FKXA 1RK6A 3MVIA 4DZHA 4GC3A 4LALA 1KRCC 1YMYA 2HBXA 3E74A
chains in the Genus database with same CATH superfamily
1DIDA 5LNSA 3VGBA 4JTCA 5ABEA 3P0XA 3ZLHA 1SU5A 1KBIA 1LG1A 5HQMA 1VIZA 3WF1A 3EBVA 2PFHA 4ZOEA 5DLCA 3B8IA 2XDFA 3W38A 5G1YA 5E6YA 3CZLA 1J18A 2XG9A 1FP8A 3HURA 4ZL1A 5DQPA 1V6XA 2V69A 1EDGA 1XIHA 1DV7A 3WLRA 1AUSL 1P0BA 5HNTA 5JH1A 3B0UX 2C3ZA 3TK7A 3RM4A 1F76A 3ANUA 3O3RA 5LIKX 1H62A 4Z2IA 1LF1A 4NI8A 1AH0A 3LUTA 3NO5A 4UQCA 4X22A 1S1RA 4C6IA 4JQ4A 1KFWA 1EA9C 3SFKA 2EKCA 1QFEA 1R9ZA 4M7SA 3WH8A 3WQ5A 4HK5A 4CVUA 4O57A 5AHFA 1H0GA 2D3LA 1DE6A 2H3DA 3V0SA 2OWWA 3ME3A 4QAIA 4RZ5A 4KS0A 1XM3A 3R8RA 2NQHA 3GU9A 3EEZA 1M7OA 3RDKA 1YXCA 1NARA 3V35A 3VNZA 3E96A 2GQ9A 5D2VA 4MJ4A 1YBQB 1Y0EA 1W2PA 1HFBA 3VIPA 3CT7A 1TJRA 3MSRA 4GVGA 1THFD 5D02A 1D2KA 4GH1A 1OWQA 3VGEA 2VGGA 2ODOA 3DFOA 4GFSA 3E3HA 3G22A 2AQVA 2ZQ0A 4AY7A 1NDVA 1UKSA 4LRTA 1MEWA 3KUMA 1K7FA 2PLKA 4H9UA 1JI2A 2NUYA 1Q7ZA 1RBLA 1VH7A 3UY7A 3UCCA 4TMBA 1FOBA 3DC0A 4UQ9A 2CWXA 1R6WA 1XI3A 4M1BA 3R94A 1Z69A 1W3LA 3T2OA 3OVQA 3MO7A 2PDMA 3PS7A 1P0DA 2XH0A 4DXKA 1WA3A 2H9AB 1V79A 5I5RA 2R14A 4A3UA 4JTUA 2PDQA 3QZ6A 2WOQA 2OT0A 1GQNA 3H2MA 3VKKA 2WMFA 4A05A 2I57A 4H9XA 4P7OA 1UKTA 1XH2A 4DN1A 1WBJA 4GXPA 2Y8VA 1W1IE 2FYMA 1CCWB 3W1TA 4P8VA 3GIQA 1XLBA 1MSSA 5EMKA 5I06A 2PC4A 3NFUA 4Q8NA 1AVAA 1J01A 3MUAA 4I3GA 3AS3A 5HUOA 1XC6A 1QDSA 1IZJA 1V6YA 4C7GA 1V0MA 2I5IA 3EXSA 1FXQA 3DGRA 3CZEA 4MY9A 1Z9AA 5D9PA 3CIXA 4IQJA 2X42A 1O4UA 3G24A 5CSRA 1A50A 2Z1BA 4S3AA 2BHYA 1XLEA 1JDAA 1BSIA 2F7FA 3O05A 3AHVA 4BFAA 1P0KA 4B15A 3V1HA 4L5ZA 5FJJA 4IMFA 3T40A 2V5DA 3QHOA 4P7RA 2WCSA 3IWPA 3FJLA 3BW2A 2ZADA 3UA4A 4DRSA 4ZQPA 1VBHA 4M81A 4ZTYA 5BZAA 3H70A 1A5OC 1UH3A 3AI0A 3KZSA 4ENLA 5DANA 2NT1A 4ZZ9A 3NA8A 3IJQA 1LBFA 4W7VA 1M7XA 1W1YA 1B4KA 3T9PA 4B3ZA 1OB0A 2OYMA 3GFZA 4NRRA 1Q6CA 3RITA 2CLLA 5A6BA 3WBYA 3AIBA 1XD0A 3FW6A 2GVEA 1VR6A 4UTWA 4I9AA 1X6UA 1H50A 2AL2A 1E0WA 5LNVA 1XCFA 2GZXA 4HOWA 2R24A 3PF3A 4HOZA 4RJEA 4LAMA 3BAIA 5LIXX 1ZSXA 1CGVA 3EEGA 1NWUA 3BSMA 4M1RA 2GUUA 2OLSA 4EPDC 2E1DA 2Z6IA 1IZCA 1LQAA 1ZBKA 1EPVA 1W1ZA 1BKHA 4DI9A 3RRXA 1AW2A 1MXSA 3C86A 3KX6A 2VZTA 3BMXA 4AZ6A 3KWSA 2J7CA 3EAUA 3BVJA 3I6RA 5M17A 3OHMB 4N7QA 3PZTA 3VDAA 1CXIA 1PKNA 1RZMA 2I1OA 5ABTA 4MKSA 4I8DA 2HPMA 1KM1A 1TV8A 3ARSA 4UZSA 3F2BA 5C71A 5ECUA 2WJEA 3MV01 5H8PA 2HNHA 4UQEA 2Z2UA 3NDYA 2AGTA 1JCMP 5A8NA 3WFAA 1OT1A 6XIAA 3HQOA 3GNNA 4MNJA 3CU2A 4B9YA 1X96A 1EO7A 4M51A 5D9MA 5LXXA 4FX6M 1JPIA 4AZGA 4F0KA 3O2LA 4D6IA 2OEMA 1GYLA 2VCCA 3XINA 3MB9A 4LS2A 4AVFA 2OWXA 3ZJ7A 1V4YA 5F2IA 1A4MA 3ZXWA 1SR0A 3DI0A 2INZA 4JICA 4IUGA 5IBXC 5BRBA 1W54A 2FPYA 3LCHA 2YB4A 3DI1A 4GQGA 3ZWSA 5A1AA 1H2JA 3UJFA 1F73A 3WUGA 1UUOA 3TU9A 5E1QA 5H8MA 4JQAA 3LXBA 1LWIA 2B7OA 2GUBA 3CL7A 4L4PA 2PWVA 4CCZA 2D0FA 1J11A 3AFBA 5DBUA 2CBIA 3OO2A 4F66A 1F6PA 4GNKB 3VABA 1MW0A 1Q6FA 1E51A 3CUFA 1LM1A 1A47A 4IIDA 2J6VA 2O7SA 4JKKA 3SUUA 4AISA 3WUEA 1TV3A 2PDCA 4NX0A 4FMVA 2FFIA 5BU6A 4K6AA 3ZLFA 4GNVA 1W3TA 1TIWA 4H8UA 4GQRA 1FWSA 3STGA 3KVKA 1D3HA 2BY3A 4GE8A 2JEPA 4Z1CA 2FTWA 3IGXA 3ZOAA 1KCZA 5A2CA 1EF2A 2YCLA 1UD8A 1CPUA 1XIFA 3PR2A 2JKPA 3O6CA 1S2AA 4PMUA 3EPOA 3P0WA 2WVSA 4DF1A 1RALA 3WQOA 2ISVA 4JXCA 4L7ZA 1GW9A 2WMJA 4PYSA 3WL1A 1CZ1A 5AVHA 1AA1B 2WLYA 3V3WA 3REQA 3EOUA 4PMZA 3OODA 2WSQA 3VNJA 3INPA 2DZBA 3O15A 4HNVA 4QEEA 1TTIA 1QI0A 3R11A 3T2PA 1EHNA 3GHUA 3I3EA 4HPGA 3IEBA 1Q6GA 1GJWA 1ME8A 4H04A 4GVHA 2EO7A 2C71A 3TC3A 2QEZA 1WAUA 4HP5A 4N4QA 2EAWA 5CZSA 1TPC1 2VFGA 3K5XA 4H4IA 4NUWA 4F3HA 3HO8A 5F4WA 5I24A 1Z3NA 3UWQA 3LSCA 2ACRA 5EKYA 1B2YA 3ITCA 1US3A 5K9DA 2HS6A 2NWSA 2PWFA 3R0UA 1DORA 4JCLA 4X3ZA 2B7QA 1G5AA 4DYEA 1QOPA 4HYWA 2ZE3A 3CGTA 4MPKA 1JF6A 1M03A 2OGYA 5DT5A 3B0VC 1JPKA 1F3TA 2ZRZA 3W22A 1ZALA 3SN1A 3W1AA 3LQLA 4KIEA 2E6AA 2A1YA 3DG7A 2E68A 1QW8A 3S1GA 4UCFA 3CUHA 5EBAA 2VVNA 1NOFA 3EXTA 1XJBA 1JCYA 4AX7A 1BWKA 3SCVA 3UETA 2HE5A 3TTOA 3N2BA 4PFHA 1ITXA 1IT7A 4YL2A 3QFEA 3WF3A 4IT1A 3S42A 1UQYA 3WD2A 5AYYA 3EXRA 3RAOA 3WEOA 1E0XA 2NVAA 2NX3A 1OHLA 4YTQA 3QMTA 5I3KA 1POJA 1HIZA 3GNOA 3BOXA 4TXEA 1T7LA 3CPGA 2OFJA 3N04A 4LCSA 4OUIA 1BRLB 3GH4A 5FA5A 4LJ3A 1VHCA 2ON3A 2O7QA 1U1UA 1PEZA 2JF7A 5FAGA 5KSWA 4I6KA 4R9OA 1J8VA 4GO9A 4HD5A 2VX7A 2A3CA 1BSLA 3DBNA 4AFYA 4BQ3A 2SFPA 5AB3A 4G7EB 2W62A 2WXDM 2ZWYA 3CB8A 1J10A 3WL0A 5CC5A 3ISIX 1B3VA 1KM2A 2WMIA 1QUMA 3KOYA 1TPH1 1EYEA 1HVQA 3GRIA 3B8WA 4FNSA 2HV5A 4D6DA 3V7PA 4JFSA 1F5ZA 3QJAA 2NV9A 3YPIA 3RLVA 1FH8A 1J2WA 1S5WA 2V9DA 3W87A 1DIOA 1IWAA 4ZXLA 3D5HA 4B5VA 4D6FA 2O56A 4O1AA 4IPNB 3DCPA 3QV9A 3QEZA 5BWFA 2WB5A 4DI8A 4L1WA 3PTDA 1OC6A 3W1LA 1XBZA 4B90A 3CUZA 4J27A 5AZ0A 1NOWA 4MDPA 4O13A 4DZIA 2AQOA 3BLPX 3R10A 1XLGA 4WF7A 1KKOA 1D9EA 2UY4A 1P43A 2A6LA 4XD3A 4Q8WA 5EMYA 3SZ8A 1XIGA 3IPWA 2DY3A 5BMWA 4J3TA 1W8GA 3VIGA 2OSWA 1Q45A 1U5HA 1FWTA 2ZZ5A 3SUVA 3O07A 2QKFA 3GZAA 4ZCWA 1XIIA 1JGIA 2PRHA 3VYLA 3S4TA 3LI0A 2BXYA 3KM8A 1VYSX 2J7GA 5HWMA 1R3VA 3A4XA 1H7WA 1XLMA 2V81A 1J4EA 3WNMA 1WB0A 3M5XA 3L5LA 4OHQA 4DZAA 3G5EA 1R7AA 1CWYA 4GD0A 3AWNA 2OWCA 3IGHX 1A49A 2XSAA 3MT1A 4ECLA 4FSAA 4HBKA 3OVPA 4S1FA 1WKFA 4XO6A 2DJLA 2ZOXA 1EGZA 1TZ9A 5BW6A 2X09A 4EE9A 1XSKA 5I7GA 2OTDA 2VD8A 4UNKA 3VOCA 3N3MA 1VJZA 2XM2A 4MG4A 2ZA1A 9RUBA 2CKSA 3OB8A 2WWDA 4YJ5A 3UCQA 2F2HA 1XXXA 3H7RA 4GNJA 5AZ1A 3IUDA 3WF4A 1H51A 4O52A 1GZGA 3TWBA 3QHMA 4RX0A 3G8RA 1GTEA 1QNRA 3UESA 2IPGA 1UKOA 3PG9A 4H9YA 2PU1A 2RAGA 4O19A 4JR5A 4ZE4A 4GISA 3G1AA 4JHZA 2QPXA 4XG1A 1F8IA 3BMWA 5GQBA 3NR0A 4Q4MA 3EWZA 4LRSA 1ISWA 1TV4A 4YWIA 3VUPA 3HTWA 3EKGA 1XGDA 4UOJA 2MUCA 3RGTA 4ADTA 3A3XA 1JL8A 4UOZA 1JPMA 2CBUA 1ICSA 3I3DA 1OIFA 3W7LA 3AU6A 3HN3A 4MMWA 4MJ2A 1JD7A 3CTLA 3UZ5A 1AH4A 2BY1A 1DJWA 2C18A 3EYPA 2W27A 4O12A 5G2IA 3VIFA 3VXGA 1W9PA 1FDZA 4RV3A 2YX0A 4KF1A 3N25A 4Q4PA 1ITCA 4WLCA 4S3KA 2V3FA 1HN1A 3GTIA 3BLEA 1LZOA 2OKTA 2NVDA 1XCXA 3TVAA 5CPSA 5E93A 4Q32A 1CGUA 1W1A1 1AQHA 4DWDA 2PDWA 4DWSD 5EL1A 4OKDA 2J75A 2PP3A 5F2GA 2JGQA 4CU6A 1FWBC 1POKA 3EDEA 4ATWA 3DFSA 4DPQA 4LFYA 4TVUA 3C3UA 4JTJA 3N2CA 4V27A 3SSJA 1KTNA 5CQ1A 2D73A 1ZAIA 1L8PA 1XLAA 3GTFA 3DECA 4QBXA 2GJXB 3W7DA 3DX5A 3S1XA 3TLLA 2Z26A 4WDUA 1FCQA 1BQGA 2NT0A 4RDWA 3BAYA 4MKVA 1SJDA 1W9XA 3S5SA 3SFWA 3RPDA 4HCDA 1ZZMA 3PHAA 1RQEA 4ICCX 4J2PA 3TQVA 4TTGA 4EACA 3O9NA 2FTPA 2ZVIA 5BXRA 3NPUA 3JW7A 2VZVA 2PLCA 4UTWC 2DU2A 2XYLA 1VBGA 1J0ZA 1VD6A 5I3HA 3W2MA 4IGMA 1DHPA 5BNKA 3QR0A 4X9YA 1O1ZA 4ZENA 1Q8JA 3FGCB 4NU7A 5EU9A 4HK6A 3WK1A 2CBVA 4G2DA 3E6EA 3L5MA 2CKRA 4LAKA 3MQTA 3LPFA 1B57A 2Y61A 5HANA 3NYZA 1FHLA 2WM1A 3C3NA 3A21A 3UZWA 3I65A 4ILSA 4O28A 2ICSA 5A6KA 2VX5A 3OZPA 3CQ0A 4JY9A 2ISSA 2GOUA 2R94A 3VD4A 2PDHA 3WNNA 3VMNA 1RJQA 1ZJBA 5J04A 4M24A 1ZB5A 1CECA 2PSNA 3E0WA 6ALDA 4LWWA 1K8CA 3I68A 4E38A 1E6ZA 1WXJA 1A5KC 4ADSA 1SJCA 5H91A 3TW7A 4JPGA 5JBFA 3W86A 2VRJA 4JIRA 2H8ZA 3L4VA 1E43A 2WLZA 4AY1A 5HUPA 1W5OA 1QWGA 1OD8A 5EMLA 2REQA 4O15A 3TN6A 5A2BA 1CYGA 4DF0A 1CW2A 2GK1B 3KHJA 1VPXA 3UZZA 4NG3A 3FXGA 4BJHA 3ZJ8A 4ZR8A 4LUTB 4AWSA 3S9YA 3PTMA 3EOOA 3CUGA 3M7SA 4QG6A 1XGEA 3U2OA 2YXOA 3ITVA 1B54A 1VCGA 3LMYA 3GXDA 2H6RA 3CQJA 1OFDA 3MP5A 4REQA 3NVTA 5CPOA 2XM1A 3G1DA 4IF2A 4UIOA 1TELA 3RO6A 2YCKX 2NVCA 2VR2A 5LYRA 3GKAA 1JXKA 4LT9A 3BCFA 3NIYA 1XLHA 1VCFA 3A23A 3K4AA 3W2NA 3RLGA 2WCGA 2INEA 1HL9A 1H3GA 3WQFA 4Q7BA 3DGBA 4KFPA 3PP7A 2A79A 2V5BA 3AYVA 2C79A 4H19A 2Z7GA 2J27A 1JF5A 2ZUNA 2YOCA 3KBMA 5SWUA 2I5QA 2NUXA 3LA4A 4GJJA 2FHFA 3GVGA 4YYFA 5I79A 1XS2A 1VYPX 4XTIA 3TQ0A 4H3DA 1JZ8A 1MW2A 3KTCA 2PGRA 1W1TA 4NXSA 3TYEA 1TRIA 2BP1A 4RPPA 1V77A 2BZNA 5KTLA 3SEPA 4MOZA 3L68A 4QLKA 4FLOA 3WEZA 1VQTA 2C0HA 3PZIA 4DO4A 1H0IA 3MHGA 1RH9A 3A5FA 3CH9A 1PIFA 4OECA 1WKDA 1C8XA 3W2JA 2QW5A 4A29A 4Z08A 3CUXA 3ITLA 3VCCA 1JFHA 4QS6A 3TA6A 5M5DA 1VAHA 2CITA 4GINA 3NPVA 5FAJA 4O54A 3SCNA 1BYAA 2NWRA 4ZE5A 1GPWA 1EZWA 2DORA 3BXWA 3MI2A 1QK2A 3SCRA 3ERPA 3DKLA 4DX3A 1ISVA 3QOKA 2CHNA 2WYSA 3QPEA 3OIXA 1CB7B 4DJDC 2G0WA 2EPLX 1I2NA 4IGNA 5A8PA 2W63A 3VIJA 1RD5A 4MNMA 1OX4B 2D2JA 1JZ7A 4JEQA 5DCBA 1PXGA 3FKRA 1K6AA 2P8CA 3MVIA 3ARQA 3MSDA 3QZAA 2FIQA 1EPXA 1XQLA 1V6UA 4QJ1A 3H55A 3KDOA 2OVLA 1AMYA 3FVMA 4RXFA 3EWUA 2AAMA 4D72A 5CPLA 3QC3A 2XVNA 1TWSA 4ES4A 2FVMA 4UCGA 3HF3A 3KBJA 2GYIA 2VEFA 4IPLA 3T4WA 1BAGA 2BVDA 4DJEA 4MWAD 4ZQRA 3Q45A 2J8TA 3APTA 3HFTA 4E2BA 1W3IA 4NIRA 1XQKA 1GW1A 5CPTA 1IXOA 3V5OA 5CJ5A 5A3HA 2YR1A 3T55A 3DXIA 3PNZA 3PJUA 4UTUA 5FKYA 4AIOA 4C1NB 3S0CA 1K6WA 1VYRA 2AMGA 3CO4A 3FGCA 4MZ8A 1QNOA 1C9WA 4RNFA 3IAQA 2G3NA 2HSAA 1X1NA 3ELFA 1F74A 1H7OA 1HG3A 1EX1A 4QG8A 3NOYA 1KXHA 3AMGA 3P2VA 4QQ3A 3TAOA 3M6DA 3B8VA 4JN8A 2P8BA 3E5BA 2IKGA 4MYXA 5FF2A 5GJNA 1Q66A 2PS2A 5CKSA 1CIUA 1PE1A 1JZ3A 2Q8ZA 1VEOA 1S46A 4JTGA 4W4QA 2ZRWA 1S39A 2J78A 1QPOA 1OD0A 2XUCA 3LXCA 2Y5JA 1EWDA 1PIIA 5J8LA 5I3GA 4WOQA 2GDUA 3CQIA 2Q71A 3RFAA 3SN0A 5DMYA 5D33A 3AALA 2OOFA 4M80A 3TN5A 4G5DA 1Z42A 4OE7A 4P8XA 5CC6A 1RJPA 1R3QA 4QJ3B 3M43A 4ZO7A 1J93A 2V5KA 2QDEA 5HMEA 4AH7A 2GWNA 4XBJA 1OZQA 2GGIA 4M3PA 4EAMA 3F2DA 4QFUA 3PY2A 4Q22A 1Z41A 4FNPA 4UXDA 1PUDA 1FWJC 1C7TA 2ZUUA 1V02A 3LM3A 4FI4A 2FGLA 2QJMA 2FPVA 3WQ6A 1KO0A 2VMFA 4NNBA 2BFGA 1Z6KA 1WDPA 3GM8A 4EANA 1IQ8A 9CGTA 1FWRA 1XLCA 1HP4A 1LLOA 4HN4A 3TJXA 1Y7VA 2WVVA 1E9LA 4S3FA 1DP0A 3WLIA 1UWTA 4Z42C 1SJAA 1RLCL 4LV9A 1MQRA 3ARXA 4NZ5A 1GWJA 4M5PA 3HU7A 4S3CA 3VK5A 3ZSSA 5PTDA 3PWIA 4J40A 1UD4A 1QOQA 1SZRA 1QI4A 3UWYA 4MJZA 3WLLA 3RJYA 1R5YA 3RF9A 3CV7A 4IFRA 3U7VA 3H21A 2A3HA 3NGJA 4ZO9A 5HINA 1RBOB 3II1A 1X8CA 4NJJA 4OU1A 4U10A 3PSVA 1UR2A 2OYLA 1X6NA 3OQ8A 1HX0A 3DENA 3SUTA 3BQ5A 3MMUA 4E2OA 3WLSA 4US5D 1TX0A 4B5SA 1KFJA 1NP0A 2HXTA 3EPMA 2ZZ2A 3JU2A 2EPMX 4C65A 4FOUA 4KEMA 4H41A 5M3WA 4WVXA 1AG1O 4IMGA 5TNVA 3SUWA 3TOPA 4W87A 5C2GA 4H6KA 3GYEA 1Z32X 4HN8A 4JDYA 5G5IA 4L9YA 1OABA 3JVAA 2RHGA 1B9ZA 2DEPA 5J5DA 4BKNA 4K1GA 1MEIA 3BK0A 2XIIA 5C6MA 1UZDA 2DDXA 2OX1A 5HPCA 3TSBA 2E25A 2VEKA 3H6OA 3QTPA 3FJ6A 1VCVA 2X7VA 3T05A 4MNLA 4LVBA 3CMGA 3E9AA 2J7DA 4R85A 1J6PA 4CD5A 1I60A 4JQ3A 4PN2A 2CESA 4CCDA 2ZTJA 5D03A 3DOPA 1Q6LA 4OIFA 2QULA 3P8JA 1B31A 1GKRA 2VFDA 4IG2A 1IHIA 1H5YA 1M7PA 3VIHA 3R6IA 4JCMA 1DPMA 2YL5A 3O63A 3GB6A 1VFLA 2OLHA 2RDUA 5A94A 3T09A 2NX1A 2ZVRA 3UXIA 2JE8A 4UOQA 3LGGA 5HULA 4QE4A 3NTYA 3CPUA 3VO0A 1WOAA 1XCWA 1D8WA 1J0HA 4UUIA 1Y8BA 3DC8A 3DFYA 4HOXA 1MEHA 2FLIA 3BLOA 4KBXA 4MB4A 4HSNA 3AUJA 4KETA 4L4LA 4JTLA 4AZHA 5FEWA 3C56A 4QX4A 1M7JA 1PCWA 4OBRA 3W1QA 2PDBA 4PMNA 1B30A 5FJUA 1E73M 3OZMA 2FZ8A 4A2SA 4FAMA 1P0EA 3QQ0A 1KBJA 3PZMA 4I7VA 4RDVA 4L65A 4PH6A 1OFOA 1U83A 4HSOA 3IVTA 3RX3A 3KBWA 3CEUA 4E6MA 3DHPA 5F1VA 1UOZA 4GUHA 2EGZA 3P14A 4GZEA 3LXAA 1XR2A 2YA1A 3ALFA 3NPXA 1TR1A 4LU0A 1U1HA 4NNCA 4PZVA 2QV5A 3VPLA 4FR1A 1KNWA 2LLEA 1IT0A 4HPHA 3AMCA 3GAKA 4UFKA 2GUYA 5I02A 2NQ5A 1WAWA 4UFJA 2XN2A 1VPYA 3B0PA 1XG3A 4DNMA 2L5HA 3AMLA 5LNRA 2UY2A 4PUDA 2C91A 1A3XA 1IF2A 2CETA 4J35A 1NH6A 5IRPA 4JHMA 2ZRVA 2VX6A 3KXQA 5K7JA 1N8WA 1VENA 1KCKA 3I4EA 4FXRA 2Z25A 1CI1A 4NAFA 1BYCA 1ZNNA 3LLXA 1KXTA 3WZ0E 4F0MA 5T8GA 5D32A 3VNLA 2F61A 2DZSA 2WJFA 3LV6A 4YVXA 2JK2A 3EX3A 2XWEA 1A5LC 3GXFA 4H01A 2QUVA 2XZ9A 3CAQA 3M7WA 3QPZA 3LOTA 2I9EA 4RUBA 2FHCA 4FHAA 5AY7A 5BOFA 3CAKA 3FFSA 4L4OA 1SYTA 1XV8A 4GYJA 2BWGA 6CGTA 3R79A 3MKVA 2PF8A 3B04A 4A8LA 1Q7MA 3ZR6A 1DJGA 2GJPA 2H9AA 5CZKA 4KW2A 5F4SA 4RV8A 3BICA 1R9YA 3KOFA 2VC7A 4I9JA 5MHBA 3AIVA 3AIWA 4IHCA 2WNWA 3W1PA 2QVHA 3STPA 3WK3A 4CD6A 5HXMA 2XIQA 2HROA 4GZJA 4HHPA 3GDBA 2XJ7A 1TWDA 2FZNA 3GNRA 3CB3A 2PGEA 1DWGM 2EKGA 1ITQA 3WD1A 3VIIA 3SY5A 4P7LA 4AD0A 4QNEA 4HJFA 1O1HA 2E5DA 5LIYX 1V93A 1AQ0A 3PG8A 4PB4A 3VKDA 2W4XA 3CEPA 1MUWA 1YIXA 3TCSA 3HG2A 2X8RA 2V0TA 4TV6A 2VO5A 2V2CA 1E9ZB 4QLJA 3W2UA 2WC3A 4ACZA 4ORMA 5KZMA 1FWWA 4KGJA 3WD0A 1HO1A 3EMCA 4KWVA 2E9MA 2BXZA 5IHSA 4HZ6A 4GABA 4Z2JA 1YNYA 1VF8A 4D9PA 4DJFC 1B9BA 1XRFA 2W66A 1FWAC 1Q3NA 2I17A 2VGBA 1QAPA 2XN1A 4I5RA 1E4LA 5RUBA 4TOQA 2V67A 3MDUA 2PI6A 4MLJA 1FA2A 1RSCA 1E3XA 4I7WA 3SCOA 3FVDA 3FEMA 2VENA 5I03A 1KBLA 1EC7A 1Z7AA 1I1WA 5DCDA 5ABGA 5HNRA 2IW0A 1UP2A 1VRXA 5BXSA 1E6RA 2PDPA 1JUEA 5HMDA 3CZKA 4D8ZA 3KDNA 1PKYA 4D6HA 2DVTA 2OOGA 3OOQA 1Z8AA 1P6BA 1EUNA 2CU0A 3LG3A 2DIKA 4PEEA 2Y7EA 3VD3A 1GQLA 4F79A 4GKTA 1G94A 3LDVA 5T26A 1G1YA 1W91A 4C6BA 1TPFA 1QXLA 3K8KA 3E2SA 1DXFA 2GJLA 3AHYA 1EP3A 2DT1A 3ITYA 1HF6A 1DE5A 1TMLA 2Y24A 3UJRA 4DWSC 2BVTA 3OBAA 4PMDA 2NXIA 2X1SA 3SJ3A 4DYKA 2VEIA 3LNPA 4K68A 1IE7C 3KVMA 3G3DA 3P81A 4KEUA 1FY6A 2ABAA 4E3TA 3KLKA 1VHNA 1WQ5A 1U5JA 3GG0A 2FJUB 3LBOA 3ABQA 1AL7A 4ORIA 2CHOA 3MVTA 5BRPA 3PZQA 2BGSA 1O6IA 5BXTA 3KBSA 3E12A 3OHIA 1OCQA 3PZGA 2YDRA 2ZXDA 1WO2A 4MWAA 4XAZA 2V63A 3WDQA 4PUEA 3WBWA 4QE1A 2O4MA 4JIIX 4A8IA 2NV2A 4IL2A 3ZSTA 5MKGB 1JRCA 3LHTA 2NSXA 3CHFA 4KRTA 4ADUA 2HVNA 1W9DM 4HHLA 2WNNA 3W82A 5BU9A 1O5RA 4ZOBA 4J3UA 3TYDA 1EBGA 3C2FA 5A8OA 4DHGA 5AC8A 4GHRA 4ICMA 3OLEA 4K8HA 4EPKA 4HCHA 1HGWA 1H49A 1UWAA 4RPQA 1PTDA 2J7FA 1IZKA 1W2VA 3SDOA 4ZVJA 4GI6A 2GK1A 2ZE0A 4ROQA 1EEPA 3K8LA 4V28A 2IQTA 3UNTA 5C2CA 1JYWA 1EXPA 5XIMA 1DQUA 1K9DA 2YDAA 5E0KA 1R38A 4PA8A 2IPWA 2QVNA 3AXHA 4UWMA 4JKMA 3RU6A 1K7XA 1JQVA 5HR7A 2PAJA 2VWTA 1ADDA 3MI6A 4IXHA 2XFYA 3UR5A 3KEHA 4X2RA 1LTDA 3CHEA 2G96A 1GGOA 1DXIA 3W3OA 3WH5A 4J3ZA 5LNUA 1XIBA 3AS0A 3MU7A 5LA0A 3KE0A 1J0IA 3AU2A 3ARRA 1U33A 4I8YA 1UBPC 1MMFA 3PNUA 4LALA 1TR9A 1EWEA 2QYGA 3GAYA 3M0ZA 1LT8A 4B5UA 4FR6A 5CBBA 3SW6A 1MZRA 3RU8X 4PRTA 5EFDA 2IXVA 3EWBX 1CXLA 2QS8A 3RX2A 4L6OA 2XGZA 4HA3A 4HB7A 2X1TA 1HGYA 3MC5A 4LS0A 3G1SA 3WNPA 3WQCA 3W29A 2G97A 1QI3A 3WBXA 2HISA 4PULA 1S5MA 3BLIA 2WPBA 4HMDA 1FHVA 2WMIB 3BQ6A 1G67A 3W07A 1KM6A 1K8ZA 3SRFA 2ZXBA 3LSBA 1IR1A 1DJHA 1GVOA 2PDIA 1GVFA 1Q2RA 1LYXA 3CQKA 3SR7A 1RBAA 2J8FA 4CCCA 1TKKA 1ICQA 1BGAA 4RZ4A 4EK7A 3RX4A 2ZC1A 1CXHA 2QUNA 4UTFA 1T6MA 3S9ZA 4RDYA 2Z28A 1ONXA 2WWCA 4AC1X 4BQ2A 5CZJA 3TTEA 3W81A 2JEQA 1AW5A 2DSZA 2XTKA 3KS5A 3IV8A 4EF8A 2F84A 5EMJA 4FALA 4GLEA 4U2YA 4Z1YA 4C6NA 3WLNA 1S2WA 4P5UA 4OJYA 3CIWA 4M82A 2EPKX 3AIRA 1DOSA 4ALDA 1XDLA 2ZRYA 4Q3MA 1C7SA 1GOWA 5TF0A 3IUHA 4FLSA 4I9TA 1UH2A 2PBOA 2PRMA 1M1BA 2PGFA 4N6EA 1EJUC 1CBGA 1XL9A 4J28A 2ZWZA 1A5BA 3GH5A 1ZJAA 2WO5A 1BPLB 2C16A 5H2ZA 1TCDA 1HQTA 2W5FA 6ENLA 3UXLA 3MMWA 1IGWA 3ICJA 1L8NA 4O1DA 3RILA 3S83A 4LEFA 5HOSA 3DEQA 1QI5A 3EKZA 3WLTA 4XVEA 5TIMA 3UCDA 2X05A 2PTZA 1O5QA 4NL1A 1UPPA 3GK0A 3CK5A 4LX4A 4LNCA 4PBGA 1X6LA 3DIPA 3N4AA 3PWAA 3IK2A 3LCIA 3BZJA 2R8WA 2PRLA 2FMNA 4OGZA 3DDMA 4LW7A 3UFYA 1WZKA 4QSHA 3JRKA 3C2YA 1EYWA 3OP2A 4AC7C 4C6OA 1J5SA 1TMQA 1VB9A 3ES7A 3FHAA 1TQJA 1NIUA 4MADA 3GR4A 4CUCA 4AWTA 2DIJA 4NJGA 5AHIA 3JZEA 3NCOA 2Q8XA 1I0BA 4BR1A 3CYJA 2Y62A 3MCOA 2EXOA 2ZZ6A 1UR8A 4WEVX 1J0JA 4GUJA 1L2QA 4DUWA 3WLPA 1IEXA 3SQSA 3ARTA 1QNQA 3EMQA 4N9BA 4WJ8A 2WZHA 2HWGA 1OIMA 3CV2A 1UWIA 2AOSA 1Q65A 1NELA 3P62A 4LY8A 1PBGA 3NNTA 2DT3A 1A5NC 1JGMA 4MWAE 3B4YA 2D2GA 2PMQA 4GZ7A 2OZ3A 1PPIA 2EJ1A 1I9CB 4B3KA 4WCJA 4KRZA 1ODUA 3A3WA 1UMYA 3BGAA 3OGRA 2WANA 4JQ2A 1VBRA 1DWAM 4BCEA 1NEYA 3W74A 3HGJA 2YXGA 3HOJA 3K4DA 3P7YA 4E2VA 1F3EA 1XIMA 2G3FA 4E4PA 1KQYA 2J6XA 1YTDA 5D2YA 2BDQA 4BI7A 3UY8A 3BE7A 1SW7A 2V5LA 4CVWA 1BLIA 3PB2A 3NQDA 3ZVHB 4D8LA 3U4AA 1MFVA 1SUXA 3BLDA 1BWVA 2QCMA 1IEVA 3HPZA 4JTEA 4CD4A 1SW3A 3OZOA 4RE0A 1IV8A 2IKIA 2Z7KA 4HNCA 1X8FA 4I90A 1A80A 4PMJA 2GQAA 3C8FA 4V1YA 5E5CA 5AHEA 3QH2A 2P0OA 1W3JA 4V33A 3H7UA 4KWSA 2V8ZA 3H2AA 3IIVA 1PX4A 3A47A 5F2LA 3W84A 2BTMA 1E0TA 2Y85A 3BOLA 3G6LA 2QCGA 3BCDA 4J2MA 1J2BA 1VEMA 2VNCA 1OSEA 1P1XA 4X61A 3LRKA 3M44A 3AAMA 4ACYA 3GXPA 3URAA 1OFPA 4FOJA 1KM5A 1OGGA 2GL5A 3B8DA 4F40A 3G3MA 3SRKA 3E1F1 3HM7A 4EPBC 3UXKA 5CG7A 4X63A 4GI9A 4US6A 3NQCA 3RN6A 4IL0A 2DSWA 4IQDA 5HMFA 2PDNA 4UR7A 5A69A 2A3BA 3MHFA 3M46A 2XGBA 1GOQA 3MANA 2QJGA 4C6QA 3W00A 4BF5A 3H4GA 2NLYA 3SURA 1UWUA 3MTWA 3CT2A 4ASTA 3EWXA 3MUZ1 2XIJA 4WK9A 4BF7A 3OVRA 3AO0A 2BVWA 3TUUA 1CDGA 1F4AA 3EZ4A 3W83A 4Q8OA 3KOXA 3QKEA 3FCPA 4LOCA 3VCRA 5HJYA 1IXQA 4H8HA 2Z1SA 3AQUA 5IFPA 3CBWA 2V3EA 2PU0A 1OCBA 2BHUA 4Z2GA 2GDVA 3BGGA 2VI0A 1FFQA 1TG7A 3MSGA 3N9KA 4DY1A 3WQGA 1XLJA 3NAVA 1HZYA 3H2EA 4PC8A 5IDIA 2TSYA 3VI2A 3UF9A 3L23A 1EFZA 4DJFA 3ALGA 2JKEA 2HMCA 4H9VA 3VIKA 1PKMA 2VP8A 3T0TA 5K2ZA 4IPPA 5EY5A 5E9AA 4Z1BA 1JI1A 4J5NA 4DAFA 4NVTA 3RCMA 4P7QA 3M0IA 4YTRA 4HSHA 3GDTA 4GQBA 5DCEA 1XYMA 1DEDA 1KV5A 2VYOA 2R1NA 4MJMA 4PCNA 3VMOA 4GO8A 4OZOA 2RJHA 4PSPA 2R9RA 2Y1HA 3G1FA 1LBMA 4LV4A 3APGA 3H22A 4ZFCA 1X38A 5FEPA 4JYEA 1TQXA 4UB9A 4PTWA 4ZO8A 3NL5A 1OZMA 4REQB 1EDTA 4YVVA 5T91A 3A13A 5FEXA 4AUBA 1TVLA 3GX9A 3B8TA 2WQDA 3DAQA 2F2KA 1ZBWA 2J62A 5CLTA 2TPSA 3N4FA 2A4AA 1NJJA 1UW9A 4KCTA 1HO4A 1XH0A 2OQYA 2GGJA 4KKXA 4G7FA 2DVUA 3GR8A 2OO0A 1DYSA 1IGSA 1W6TA 2DUXA 3F4WA 5CSYA 1LWJA 1TZ7A 2QUUA 4IIHA 1L6FA 4OBTA 3MP3A 1MW1A 4GYPC 2XZ7A 5CC7A 4AVNA 4LF1A 4JOMA 4AHOA 3N2XA 3LHVA 3CXOA 4HA4A 5KMYA 3H12A 1MUMA 1QBAA 3QR1A 4JIPA 4GGHA 2W3ZA 3TTQA 5LXEA 1P4CA 3BLKA 4MB3A 3PSWA 1GOIA 3TWAA 1H7PA 3GBDA 5HWJA 3VINA 3XISA 3WUBA 4WSKA 3G77A 3HPSA 3BTNA 8RUCA 5E09A 1UASA 4RE4A 2R6OA 2GVYA 1GT8A 1H1YA 1WCGA 2ZZ3A 4JYFA 4C5ZA 2A2IA 4C6EA 3PPGA 1Q2SA 4XD5A 4B4FA 3EDDA 3WQPA 3DERA 1W8SA 4AZCB 4GI8A 3DZ1A 3M0KA 1ZENA 2NQJA 3NZGA 3G1RA 3PZ9A 3KVLA 3VAVA 3GLCA 3IJ7A 1KRBC 2R1KA 1NWTA 3V36A 2HZGA 1OX5A 4KESA 4PUNA 1HNYA 1UR0A 3EMZA 4R53A 1XFBA 3C0SA 3ZR4A 1OF6A 1JCTA 3R8HA 4K7VA 2B31A 3DFQA 2V30A 2CLFA 3AROA 4ZSTA 4JIEA 3AXKA 4N9DA 3VOIA 4NILA 3SCSA 3EDKA 3U2CA 1XISA 2O4QA 5I6SA 4YXGA 5JIWA 4LYKA 4N42A 3W7IA 3G0SA 2DZWA 4GZIA 3GTXA 5G4WA 3WFLA 4R34A 1SO6A 3M07A 1F05A 3WH7A 4X9SA 3A5VA 1VFUA 3FA3A 1VEPA 3ONCA 1ZTVA 1ELSA 5M03A 2DW6A 4KPLA 1P5BA 1R2RA 1X7IA 4YIWA 5FF0A 2WMHA 3N6HA 1GQJA 3KS6A 4XKYA 3W7QA 3W73A 3R8GA 3DFTA 1PX3A 2BODX 4FF7A 3QBUA 4ZBCA 3K1DA 2UWFA 4HMEA 3JS3A 2GLKA 4ZQNA 5GJMA 4JD4A 2CYGA 3CO8A 5ABFB 3F4DA 2VELA 2GJXA 3IANA 1PIGA 2P50A 4MFDA 1F61A 2FZMA 1TVPA 1U1JA 1E1FA 5A95A 2DP3A 2VC5A 4B5TA 1Q6OA 4OBSA 4UTMA 2CXGA 5JQ9A 2Q3OA 4RNJA 4LB3A 4MNKA 1BWLA 1L6GA 3PVFA 4ML4A 5CAHA 2ACQA 1FTXA 3GHSA 1JJKA 3TFCA 3Q37A 4IXXA 3DHUA 1PSCA 1REQA 4DB7A 3TTSA 2WSRA 4IOTA 3WK2A 3AMKA 2X1RA 3QLDA 2DQXA 4ZTXA 2OZ0A 3RRAA 4Q4RA 1KFKA 4XZWA 1KTCA 2UV8G 1TSIA 4LSBA 4O0ZA 2ZZ7A 2ZX8A 3TNOA 4BZYA 1I0DA 4JN6A 4XKMA 3FEQA 1JUBA 2IMRA 1H7XA 3NQGA 3VU2A 3LTPA 4UR9A 2VWSA 3EDJA 4EAYA 2EG7A 5GNYA 4XAFA 3N15A 3WN6A 5KZ6A 1OFAA 5ABFA 3S2LA 1JDDA 2WNQA 2YDSA 3NPWA 1XFCA 2W61A 2XFWA 2E6YA 3DFNA 5DX7A 4L80A 1DVJA 2X40A 3FSTA 1DKWA 2B81A 1A5CA 5A8QA 3VIOA 4DYJA 2F6XA 4HU0A 4CEUC 2J74A 3QMSA 1LOLA 1NDYA 3ONBA 1QOXA 3W1UA 4UTIA 2WPGA 4WIWA 3CPRA 1D7KA 3URQA 2QF7A 3U3HA 4RLIA 4GACA 1A0CA 1JIBA 2QLYA 4Z1AA 5DT7A 1VRDA 1A5MC 4AD1A 2Y0FA 3N6JA 1KGWA 3BAWA 1X7FA 3SSZA 3EWDA 2QF8A 3PBVA 2ISFA 2PWDA 4RE2A 1EC8A 3V5CA 4ZEPA 4QHRA 1Q6RA 1PV8A 2FZBA 4LBSA 1AJ2A 5CJMA 1Q8AA 3WMLA 3WSUA 2YSWA 4G1KA 3N17A 1H1NA 3T7VA 2VGFA 2A7NA 4WD0A 3UEQA 1NWSA 2CNCA 4ONVA 4D6CA 1UZ1A 3PJWA 3GXIA 2WZIA 4P8WA 2H8XA 1DIKA 2DVXA 5AVNA 3LMZA 2NXHA 1V51A 3G0UA 4IJRA 4NZ4A 1B5TA 3SJNA 5GNXA 1KKRA 2WV8A 4URIA 1EJTC 4QR6A 3TLQA 5FESA 3S5NA 4B5XA 5AC5A 2AL1A 3B0XA 1EJSC 1G69A 1UKQA 1C93A 1PZ3A 2I56A 4XZ9A 1Q85A 3LCLA 1N7KA 3CYVA 3PPFA 1HJVA 5BCAA 1IIGA 1XH1A 1QPKA 1GVYA 2IUZA 2BOFX 1R86A 1WDSA 3AUOA 1R2SA 1QBBA 2YL9A 1V6VA 4DLMA 3UT0A 3A64A 1UG6A 1LROA 2GGHA 1AJZA 3WUFA 3G0XA 2HK1A 1GJUA 3DFHA 4QCEA 5D37A 1RV8A 2D3NA 2PP1A 3WBEA 4ZA0A 2IKHA 2CZVA 1V3LA 4BHYA 3CZ8A 2Z29A 2Z4GA 3P5ZA 1FDYA 1EKOA 4O18A 4O1BA 4AY8A 5FD0A 6REQA 4NY2A 4JY8A 3MJMA 3ITTA 1ONEA 1NFBA 3W7JA 3TW6A 4GMEA 2X0HA 5AN7A 1VBJA 2CPUA 4A22A 1VFTA 1T40A 4HNUA 4LEQA 3PTQA 2YXXA 2V5CA 1K8YA 4X2PA 4F0HA 1W1B1 4M7TA 1XRVA 4A3RA 5K4ZA 3Q94A 1R9XA 1XLDA 4MB5A 3W88A 4O1FA 4WOZA 4MAVA 1ZPTA 4CQ9A 4FIQA 1GEQA 3QTGA 4QISA 5CBJA 2EBNA 1OBAA 3IIXA 3WQDA 5C5YA 4H2HA 4U2ZA 4DJDA 4BI6A 4ATDA 4W86A 3F03K 3GIYA 4NNAA 1ONWA 3THDA 1OFBA 3G1HA 1KFCA 3A22A 1W9BM 3AYSA 4CNSA 6TIMA 3HG3A 4V1XA 3W7PA 1Q6DA 4WKHA 1QASA 1KM0A 1R3YA 1XIJA 5CPQA 1JNEA 2AMXA 1WDWA 1S38A 3CASA 4LVDA 3XIMA 3MUIA 3UPMA 5FEZA 2GQ8A 3BV4A 3KP0A 2I9UA 4CNOA 1A53A 1B1YA 3RYSA 3BO9A 1H63A 1KA9F 3S1WA 3M0LA 1ZLPA 3M0JA 1KW1A 4TMCA 3TAKA 4AZ5A 1TRDA 4F2BA 1AK5A 2YCEA 1R3RA 3M5ZA 3EPNA 3C0LA 3IVUA 3PUGA 1ZUAX 3ZZ1A 3NQEA 2FVLA 2VEGA 3S5YA 3WDPP 2NXGA 3TJLA 3WFZA 2D24A 3G1XA 4ICNA 4B92A 1G7VA 3FAWA 3T2QA 2YFNA 3LBCA 1QT1A 1GQKA 1ZCCA 1JAEA 3ZR5A 1EX5A 3IRDA 3UZXA 3BV7A 1DJYA 3GXNA 1KFBA 1RQHA 3CWNA 3FNDA 1HP5A 2PWHA 3TYZA 1HJSA 1Q4NX 4HCLA 3ITOA 3ZQ9A 1EC9A 2E4TA 3ZYZA 4H9ZA 2EF9A 2DV0A 1KR1A 4XKYB 2PLJA 4IWWA 3TR9A 4Q8VA 1VIWA 4C7DA 3BSHA 3W24A 3HJZA 1VJSA 3ZO9A 1H4PA 2D69A 3UZJA 4EP8C 1F9CA 4DIAA 2HS8A 3SGGA 4KFNA 4Y8EA 3NG3A 3RG6A 4FNRA 1V03A 2NZLA 3COTA 1PZ1A 1W3NA 2BG5A 1PJ9A 1EQCA 3L9CA 4DM1A 3I7RA 3GFXA 3AYTA 1H5VA 3QHNA 4CEXC 2RJGA 4BS0A 3CQHA 1MUCA 3PFRA 4EXQA 1T0OA 1QO5A 2WSYA 1F07A 5CSSA 5EFFA 2A3AA 1LG2A 2V2HA 2D23A 3CH0A 1CGYA 3QMRA 3U2ZA 1GOXA 3N18A 2BOEX 3KWXA 2QUMA 1O5XA 2G50A 3CM4A 1UD2A 3N2OA 4QDWA 1CXKA 1KCLA 3QGVA 4JAWA 1LRQA 4MUZA 2Z1WA 4LF2A 1LBLA 1KD0A 3WMCA 3LCGA 5I3JA 5BRQA 5C9XA 5C8BB 3SY1A 3WX7A 1RCOB 5DY3A 2Q3RA 1WUEA 5D9NA 1RAKA 3VZXA 1BG4A 4PCTA 4WX2A 2ZYFA 4PUKA 1XSJA 2E8ZA 4JQ1A 5HAOA 5D8WA 1E6SM 1W5NA 1FX6A 2HPIA 4XBKA 2OLAA 3VKAA 4BQ4A 2VDGA 1MQPA 1LOSA 2BVYA 2KZHA 1LL7A 1TE1A 1XYFA 4IFKB 3EA3A 2NQLA 3K8MA 2ZZ4A 3OGSA 5A6MA 1ZAHA 4R7OA 3GXMA 2WC4A 4H7VA 1O60A 3UR8A 3HA1A 1B0IA 2VT0A 1MNZA 1EB3A 1DWIM 4CU8A 2W6RA 2YJQA 4TU1A 3F4VA 2KAUC 4PMYA 4G8TA 2VQUA 3BG9A 1XLLA 1TPEA 4EOUA 2UBPC 5C2XA 5D38A 1NFGA 3EOLA 1TPVA 2QHAA 1F6KA 3BG3A 2P10A 2RGLA 4FNQA 3F5KA 2CCRA 2CWNA 3T42A 3Q67A 5D2WA 2P3ZA 2PDGA 4WKAA 4FP1A 3GUWA 4OFCA 1FWIC 2PLMA 3H4XA 4NAEB 3GXTA 1YQ2A 3CMJA 4JTSA 2I16A 3K46A 2WHLA 3KP1A 3VMPA 1OF8A 2JGYA 2RDTA 2AGKA 2YL6A 5BXPA 5KINA 4Q8TA 3SRHA 4PMQA 3JR2A 3N1AA 2ZDSA 1ALDA 4XIAA 2YLAA 2P88A 3O0KA 1C90A 1L2UA 2C7FA 3H2NA 4MZYA 2FB3A 4HGXA 4CNTA 3EB2A 1GONA 2OZ8A 4WDXA 4JTFA 4KERA 3R7MA 2NSOA 4WKFA 1E4NA 3O6AA 3AYRA 5A5WA 1OK4A 3HMCA 2D20A 3UJSA 3IIOA 3H2CA 3IGSA 3UP8A 4L9ZA 1TFVA 5HMSA 3R4IA 4O0KA 2MNRA 2DSUA 5LIWX 4BWLA 4J4KA 4B2DD 1N8IA 1KLZA 3FLUA 4S2BA 2D22A 2GWGA 1SMDA 2QMKA 3LHUA 4PODA 3T0CA 3E2QA 2J25A 1PL9A 1EZ2A 4L64A 1EJRC 1LP6A 4LS1A 4LUJA 4TX8A 3M1ZA 2RGMA 1QI2A 1JQXA 1XC4A 2YGYA 3NVDA 4F9JA 3NO3A 3R5EA 1QO2A 4QQUA 1F6YA 1FWDC 4PL2A 4UTKA 4OQVA 1KRMA 3KRSA 1VKFA 3GVQA 1Y5XA 6REQB 4Y9OA 3FA5A 4CQDA 2QIIA 3WLJA 3V4BA 3VDGA 3MW7A 4I6VA 2QJIA 4R7JA 2HTMA 3W2LA 1PX8A 3ATYA 4LAUA 1K03A 2BBFA 1KWGA 2C6QA 3UR7A 2IPFA 2PZ0A 2YDQA 4JIHA 5I2UA 4QG9A 3W1MA 2Y7GA 1Q4WA 4KCVA 4ZB0A 3SCWA 3KCOA 2PDFA 1NSJA 3WF0A 2OEKA 3U9IA 1RVGA 4JDBA 5DELA 3M0MA 4CN4A 2OSYA 2ZCGA 3IARA 1SGJA 1ZGDA 1RJRA 4A8NA 4DXVA 2ACSA 1I2QA 2E8YA 2QDGA 1TREA 1LRNA 4AHQA 3CLMA 4QDPA 2Q09A 1UJQA 3SI9A 1XLIA 1UH4A 1TPUA 4WQ6A 5JUVA 2BASA 1V8EA 3G1VA 3W6YA 2J7BA 4IMAA 4N0RA 1M5WA 3QVQA 3GTNA 4GJ1A 2QGYA 3L4YA 4DAIA 1KLYA 1YE4A 4HPNA 3HPFA 4XISA 5CPMA 3VD7A 4XUGA 4YPJA 3U7BA 5TAOA 3M0XA 2YYUA 4KGLA 1JPHA 5H1WA 4WXZA 5HA7A 4C6JA 3FYPA 3BURA 5AC7A 4W85A 3R12A 2G3IA 1DJXA 3CLWA 5CCZA 3PAOA 4F2TA 2VX4A 4YN5A 2I14A 2DJXA 3TYBA 3NJ3A 1BXBA 2Z27A 4MAZA 2VR5A 1MDRA 3OEXA 1XYBA 3ANYA 1SJBA 1PVNA 1JZ6A 1BXCA 4PBFA 2GSJA 3KBNA 3PZVA 3WH9A 5CGQA 5FJRA 3BANA 1OY0A 1H1ZA 3UJEA 1BYDA 3C4UA 2PGWA 4Z0SA 3I4KA 3MS8A 2PTDA 3NQ7A 3GR7A 3HV9A 4E5TA 3IUIA 2J8GA 2VVSA 3DG3A 1QWKA 3R13A 3ABOA 1IWPA 3LPGA 1NQ6A 3BDKA 1O94A 4MFEA 1UR4A 3UU0A 2E7FA 3ARZA 5D2TA 3VFCA 1RQBA 2OG9A 1UZ4A 3U5UA 2X16A 1V7AA 2CLPA 4HVXA 3L7RA 3BZGA 3B05A 4V2XA 3LRMA 1OG0A 5LSMA 1GVIA 1OK6A 4HPJA 3TV8A 1Q7QA 3GC5A 3VNDA 1YADA 2DZPA 4HNTA 4JGDA 3VKCA 5LA1A 1W56A 4ZQOA 4PCPA 4JNZA 2FTYA 2ZTKA 4BF9A 1J0KA 3S5ZA 1X1ZA 3RHGA 2PTYA 4I5UA 4DBDA 2OQLA 2EG8A 3I6TA 5CPNA 1YTEA 3K4WA 4GA8A 1ZY9A 3ZVHA 3N11A 1DHKA 4S39A 3LNMA 5CBIA 4MTVA 3ABZA 1RK6A 1UA3A 1XPGA 4PTDA 2RUSA 4GXWA 2WKGA 1TTJA 3LCXA 5EMMA 4M8UA 5HJLA 3W23A 2PUZA 1Z48A 3F5JA 4DBWA 4PB5A 1O12A 1GCYA 1XLFA 4JTTA 2ALDA 5D30A 3NZPA 2TYSA 1BFNA 3BAKA 1XKJA 3LS9A 3E0FA 1NDWA 1V02E 3OYXA 4C6CA 4AEOA 3WF2A 3VKBA 4M6QA 2WSKA 1FWEC 2V82A 5DMMA 3SGUA 1XSIA 2BS9A 4GIEA 1U30A 4HHHA 3ZS4A 4MYAA 1V3IA 4O4VA 2D2OA 1IEIA 5ABHA 5CG0A 2YCJA 4RNHA 1J79A 3E38A 3N9SA 2PDLA 2V6AA 3K13A 3CL6A 3O06A 1D3GA 1OM0A 3V16A 1NQKA 3QW4B 4DJEC 2YYTA 4MWAB 1LUCB 2XVPA 4IJBA 3UWWA 3E5PA 1GPFA 4A21A 4AD3A 1UR1A 1YNQA 4L1XA 3GNDA 4JFTA 1EOKA 3P6LA 2XVLA 5KEZA 2X0YA 3B06A 4PMOA 4CN1A 1EF3A 4JS3A 2POZA 1TE6A 1WUFA 3TE9A 4Q8PA 3OG3A 1QMLA 3PZOA 3WJYA 3NGFA 4WJEA 4KWWA 4WSHA 3T44A 4M29A 1I45A 2OGJA 1SZGA 3ATZA 4MKNA 3THCA 3HFYA 5GVJA 3M41A 3N6QA 3DBPA 3MUXA 3V5FA 4CQBA 1RA5A 1KB3A 2GJNA 4HQVA 2E5CA 1HJWA 3IJ6A 1UROA 4LCQA 4DVOA 2IQDA 1FH9A 4TO8A 5FIPA 5LZLA 2CLKA 5KZDA 3TOYA 1ICPA 2Z2BA 3WKZA 1NDZA 4GWEA 1YLVA 3TEVA 2ZX5A 1R0MA 1JXJA 3AIUA 2JFEX 4H9MA 1DJIA 1UP3A 3NQ6A 3SADA 1MYRA 5IOBA 3P60A 1KM4A 3UGVA 2ZXQA 4DM2A 3N4EA 2WK2A 5L6UA 1MO0A 2AKZA 3WJWA 1WZAA 3RK8A 3NXFA 1TVNA 1GVEA 3VX0A 3SUSA 1C29A 1AH3A 3H2FA 3DG6A 1AQMA 3EX4A 1KXVA 3PZUA 3WLQA 3THQA 4F2UA 4V15A 4DXXA 4UTTA 2FZ9A 1ZHAA 1KM3A 3W7GA 7ODCA 4CNUA 1HKIA 2WZTA 2TRSA 1K1DA 3TW9A 4AZBA 1JYNA 3N2MA 1SO3A 1Y65A 1UA7A 5REQA 1W31A 1QPNA 3ZJ6A 1UIPA 4ZGYA 3HZ3A 8A3HA 2XISA 1RHCA 1E40A 2E0PA 1UKPA 3N2TA 4A3HA 3UXAA 5F7UA 5FACA 3EB3A 4JTKA 4DZ5A 2QQ6A 1FCBA 2P1FA 2QCDA 3WJXA 1H09A 2YA2A 3ZIZA 4GUIA 4RDZA 2PF0A 4NT0A 1GVSA 4O8RA 1E0VA 2VEMA 1F2JA 4AF0A 1LQ0A 3WQVA 1ISXA 5TQLA 2OODA 1KGXA 4C90A 2CLIA 3U4FA 1Y5WA 1SW0A 4O53A 2C13A 3LHWA 1QVBA 3R0KA 3W26A 2FH6A 2HVMA 4JL2A 4JX5A 4O0QA 4S3GA 3W71A 1OX4A 2P3EA 3Q2DA 3RPMA 2F9RA 4FS9A 1I8JA 2Z1KA 1M01A 3VFLA 4H9TA 4XTDA 4D71A 3CHCA 3URNA 2G3JA 3LYEA 4UFHA 5E0CA 1E71M 3QGKC 1AFSA 2VD9A 4H83A 3OZYA 3TNBA 2PURA 4IH3A 4U28A 3UJ2A 3ITGA 3MMTA 5F1UA 2ZUVA 1XIDA 4DBUA 1DWFM 2C1IA 2CBJA 3NQAA 4UQAA 1JCNA 1BF6A 2YBVA 3CL8A 3GW3A 3MI3A 3CWHA 1K3UA 4WHBA 4MY1A 2FPTA 1UD6A 4KEZA 5JH2A 4B91A 2E3ZA 5GJPA 2VOTA 2EPOA 1EHAA 2XIBA 2YA0A 4OT7A 3FYOA 4N6FA 1TPB1 4JX4A 2BGNE 3IACA 3PBGA 4QCFA 3WLOA 1YRRA 3UZYA 3QY7A 3M5YA 3K2GA 4AD4A 2ZXAA 4YNGA 7TAAA 2IPJA 4IPIA 1OYCA 4C1NA 2TMDA 2FDSA 4MUPA 3LGDA 4B16A 3EOSA 3OU8A 4AYSA 3MYPA 3CC1A 1HXJA 2Z00A 3TH6A 3PPCA 3P8IA 1XG4A 1NAL1 3TZFA 4KWUA 3C6CA 4K39A 2A3LA 1OEPA 1NY1A 4PSRA 1JUKA 2Z1XA 1PHWA 1FBAA 1ESWA 2ZICA 3DH7A 3BAXA 1DTNA 2ZA3A 3CZJA 1ZCOA 2DZUA 2VC6A 1FP9A 4RZ6A 3NSMA 3SB0A 3W7EA 1TB3A 1W5QA 4C6DA 3U0HA 4DBEA 7REQB 2ZX6A 4O1CA 1ZRQA 3FYYA 3L0GA 4D6EA 1YW1A 3PB0A 4HTYA 2E09A 1ME9A 1O95A 3VGDA 1G01A 1SR9A 3DKJA 4AEEA 4UQDA 4IUOA 3IJ9A 1R46A 2Z6JA 3KOWA 2PZNA 2YLLA 1R7OA 4D1IA 1VFMA 3QXBA 5LNWA 4HNOA 3MBFA 5T9BG 2WVUA 3QV7A 3NXLA 1QHPA 4C60A 4UTHA 4HNNA 1QR7A 3R1ZA 1SM9A 1RR2A 4QNWA 1Q5MA 2XFRA 5BOEA 2R1PA 1WXYA 5G2WA 3VTRA 3AXMA 3AS1A 1W1VA 1YTKA 1SFJA 2O9OA 3STFA 2GDQA 2XHYA 4QAWA 2FB2A 3VOHA 5G4HC 4Z1DA 3DHFA 1L0PA 4AZ7A 3T81A 2JQXA 3FS2A 3T0BA 3GNPA 1I2RA 1SZEA 2E67A 1MXGA 1Q6EA 5DMNA 2BSLA 3LHZA 1UIOA 2B4GA 2WC7A 4XAGA 1KFLA 1QNVA 1K7EA 1M04A 3MO4A 2GSEA 2YZ5A 1KBBA 4M6PA 3LD5A 4F0RA 2Q6ZA 1L9WA 5D9OA 2CZ5A 3BMVA 2ISWA 3W75A 3ZT6A 4N02A 3TN4A 3L2LA 1XYAA 2E28A 3BLLA 3TYCA 4EXAA 3H4WA 4MZ1A 1G0CA 3C8NA 4ZOCA 4NJIA 3OBEA 1E9YB 4GQQA 3RPTA 3NQVA 3VNMA 1DBTA 4UNIA 1QNSA 4GYPA 3ECQA 4K38A 4L56A 2R82A 2PC8A 3O6YX 2PDYA 4W7UA 2XH7A 2W67A 4HPXA 4GFIA 1VLIA 3UVAA 1RXOB 4AU0A 3QC0A 1OYBA 3S5OA 4M6UA 2HEJA 1RLDA 3E2RA 2ZRUA 1YYAA 1ZL1A 3VDCA 1OFRA 2PPGA 4PTMA 2A21A 3MYOA 4U5IA 4C1KA 4AWUA 1REQB 4IP5A 4MY8A 4HA0A 2VFHA 3BW4A 1OG6A 4DJDD 1OGSA 2E5BA 1PYMA 3UERA 2ZFAA 1US2A 3I7QA 1EA0A 3EX2A 3GBEA 1TV2A 4KWOA 3KCLA 4JTDA 4EPEC 5HJXA 1WBHA 2POTA 3GNXA 1O66A 1G9HA 1GVRA 5A6BD 1FRBA 3QV8A 1F4HA 2DUAA 1HKKA 3OYZA 2BX7A 2QJHA 3OG2A 5A8GA 5B80A 3A12A 4XIMA 1FWFC 3CUJA 1UQZA 3WBAA 4BA0A 2G37A 3EB4A 3GQYA 5K4XA 1JZ2A 3LERA 1JNDA 1L6WA 2DSVA 2D0HA 3ZVIA 3SGZA 3GO2A 4IX0A 5JMUA 2J77A 2D1ZA 1UUQA 3VA8A 1FKWA 5IBXA 3B9DA 2VM8A 1EJWC 1TWIA 4RL3A 2XVKA 3SY8A 2EJAA 4CNNA 3ITXA 1HL2A 3DYOA 5F4XA 3VOFA 2J24A 1WDQA 2Y5SA 2J7HA 4F4RA 4O11A 4CU7A 4CD8A 3GG8A 1WXZA 3UG5A 3F1QA 3WQ4A 2QMJA 2QAPA 5I77A 1SMAA 1Q6QA 1FWGC 1MNSA 4EF9A 5U4NA 4PMVA 3SCUA 3V18A 1AW1A 1E6PA 3PTKA 2JIWA 4W84A 4TVCA 4Z2LA 1LDCA 3BCJA 4XQ6A 1BKSA 4KRUA 3QF0A 3W53A 4FO4A 1I6NA 4U31A 4W7WA 5HNUA 3TROA 2PE4A 3B8SA 3LX9A 5DMLA 1YDNA 2PTWA 1V0LA 4TUFA 4W8AA 4QJ5B 3W1RA 3T8QA 3B4UA 1R2TA 1PS9A 4GBDA 2VRQA 2X2GA 1HKJA 4GIRA 1EL3A 3FDKA 4XK2A 2EQDA 2QCFA 1JYVA 4CD7A 3HPAA 1BYBA 1FXPA 2PD9A 1QPQA 5CLWA 1LORA 2A3EA 4F0SA 3FA4A 3N73A 2NLIA 5HWNA 4YHGA 5I3IA 3PANA 3A24A 3W6MA 3M0YA 3URBA 2VDHA 3WLMA 4AIEA 3ID7A 3HIJA 4LUSB 4CKQA 1JDCA 4AWEA 1T96A 4X0NA 3W1NA 5BYWA 4DELA 3RNDA 1MDLA 3GS6A 2IQ0A 1S2CA 4NX5A 2YZRA 3SECA 4CQCA 2GGGA 5B7YA 3LEPA 3PULA 4D1JA 1C8YA 4YHEA 3ARVA 4B5NA 4TIMA 1J5TA 4PFMA 3A9IA 5IM51 3WD4A 2IXUA 4C1LA 1HKWA 1KXQA 4GKLA 2X1IA 1AL8A 4JFWA 2B0MA 2DUZA 3UGRA 2YFOA 4AD2A 3S1VA 1OFQA 1DL3A 3F4NA 4ML9A 1I1XA 5TD4A 3MBDA 1GUVA 2BOGX 4GOAA 7CGTA 3K30A 4Q6XA 3SM0A 3BSGA 4QSFA 1UC5A 4Y6GA 3PK7A 5JXQA 4NJHA 3W4RA 2XPKA 2VZOA 3P3BA 1M53A 4PMXA 1R47A 5D2XA 3W72A 4ZQCA 3FIGA 2ATSA 4WY0A 4IMDA 5CEWA 1UR3M 5LIUX 4Y9MA 1DXEA 4O16A 2XGIA 1YDOA 3F2CA 4GI4A 1B3ZA 3VVGA 2PDXA 2HE8A 3GG7A 1BF2A 3B03A 1IXNA 4NAFB 1R8LA 2WBKA 1W3KA 2X2YA 1HTIA 4NI3A 5HK4A 4NSBA 1V3KA 1WZMA 3AISA 3UWZA 2IS7A 1AODA 3RLHA 3BC9A 3BGJA 1CLVA 2CEQA 3KZPA 4CQ8A 4D6JA 2PTXA 1FCUA 5JBEA 4FNTA 3G2GA 4ERAA 4GPNA 4R5EA 3O7UA 3UPWA 4GY0A 1CNVA 3M64A 1C3FA 4J3SA 3OQEA 4KCWA 5AHLA 3QQWA 1RVKA 1R30A 3QLLA 3OA3A 4XD6A 1ZJIA 3ZMRA 5CH9A 4XO7A 3S2MA 1ML1A 3LHYA 4NF7A 2FDMA 1UZHA 3CV6A 2PDJA 4UQBA 3L2IA 3EKLA 3L0NA 1TIMA 2J9ZA 4M6VA 5AC6A 4O50A 4GIYA 3H2OA 1JR1A 2YPIA 1GOKA 1T8XA 3P5YA 2PODA 1FFRA 4P2VA 1AD1A 3AHTA 2FGZA 2FH8A 3RJXA 3NQFA 4A6GA 1E72M 2Q8LA 1P6WA 2ZKMX 1EEXA 3ORWA 2GOKA 5IXEA 2WHMA 1TJPA 3NQ8A 2A5HA 4S3EA 1BTCA 3PUOA 1UMLA 2CERA 4H8VA 2VL4A 1GG0A 4JHOA 3UG4A 1MWOA 2NUWA 3UA3A 2QDDA 3TSDA 3IJ8A 1VFFA 1TA3B 4TQTA 3S6DA 3BOFA 1RCXB 2CLEA 3QYQA 3LN3A 4NYYA 4B5WA 3C52A 4QS5A 1YEYA 3LI1A 5HR6A 2DH2A 5DRCA 3RO8A 5BWAA 3T8LA 4J3XA 5A6SA 5D05A 3IV3A 3TXZA 4XD4A 2VURA 2PBGA 3GVWA 3DUGA 4JYDA 3SCQA 1WPCA 2VZSA 8XIAA 4IIGA 1V0KA 4GC4A 1WP6A 1S2VA 2JBMA 4K37A 4Y90A 3C2VA 3A4JA 3JZUA 4XAYA 3UBPC 1EQPA 2QNEA 1CLKA 1TZZA 3D47A 1JG9A 4FLQA 2VUNA 1GEHA 1QRQA 2WW5A 4HZ8A 4NZ3A 3RM8A 3BJSA 1SZNA 2YBUA 6TAAA 4G1NA 3EA2A 2DSKA 4PRRA 5KITA 2G4JA 2P5NA 1CLXA 1LUCA 4HZ7A 3WLHA 4YS1A 3MUCA 2DQWA 4QJ4B 3VDBA 1ZS2A 2Y70A 3QOMA 5CGMA 2EPNA 3I10A 4LPCA 1KR0A 3P67A 1PHQA 2WZEA 5IFTA 4B3LA 4OWGA 2HNEA 1K77A 3N3TA 1UB3A 1JZ5A 3F4CA 5DRIA 4YCOA 3WDHA 1Y5VA 2E77A 1GKQA 4DEFA 3CUIA 1IEQA 5I00A 3N9RA 4B9ZA 3W2KA 2X0SA 5C0QA 2X41A 4JTRA 4W88A 5JBDA 4IQEA 2EPHA 1YE6A 2C1HA 5EMUA 3CAVA 4IG2B 3R2GA 4FEZA 4D8AA 1QHOA 1F3WA 4IIBA 5C9WA 5T9CE 1E70M 1S2UA 1LL6A 3S6TA 3BPWA 3FY1A 4K3ZA 1H61A 2C19A 4C6FA 4W9TA 3UVIA 3VKJA 2YBTA 1XINA 3BUVA 2AQWA 2B7PA 3GE7A 3SCTA 4DLFA 5G2HA 4E4UA 2PDUA 4E8CA 1GOMA 1XBYA 1GZJA 1ISYA 4W89A 4HU3A 3VGFA 2XFFA 2OEJA 1VFOA 3NZ1A 3TJ4A 3LRLA 4PCSA 5F2MA 1V0NA 1K8XA 1S5NA 2WM0A 3LZ5A 4Y7EA 6A3HA 3KFTA 3QY6A 1K9EA 5CJNA 1BG9A 3WNOA 1ZBVA 4DJFD 4GYFA 3UPBA 4Q6JA 4EX4A 3LB0A 4GY7A 1EP2A 2HXUA 1W37A 4DQWA 1G6CA 1KWKA 1GVQA 1JPDX 4GUFA 4LUSA 4IFKA 4W8BA 4WZHA 4AQLA 1ZQ5A 2CZDA 3MWCA 5AYBA 5BROA 4RXGA 4U3AA 4UMCA 4EWJA 1B3WA 2TAAA 2FHBA 3MY9A 4AF0B 2BHZA 3AICA 2YL8A 4D2JA 2AKMA 3A6OA 3FOKA 2E40A 1FDJA 4AB4A 3I3BA 1H7RA 4LC8A 7PTDA 4HA1A 3Q65A 3NDOA 2PA6A 3F5LA 1UP0A 4Q8QA 4HZMA 4TX9A 4LUYA 2QJNA 3W37A 4FZIA 3D46A 4XZLX 1DWJM 1UJPA 1YNPA 1J96A 4YMZA 1EBHA 2GGEA 3WQ8A 2J66A 2E6DA 4MSSA 7ENLA 4WGHA 4ZSUA 1XUUA 3GVVA 1GTHA 2AAAA 3GDMA 1EOMA 4PGLA 2ONEA 4HU4A 3KL0A 1CGWA 2XSBA 4YWSA 4IFOA 2CZFA 2XN0A 4H2CA 2GVGA 4UNLA 3I6EA 3GD6A 4QDMA 3TR2A 1T99A 2XH2A 4X0VA 4L6HA 5H6HA 4O14A 2D0GA 1B3YA 5GNZA 2V5JA 2HBXA 2NX9A 3UR2A 1F7BA 3DYMA 2Y63A 3CTTA 1E4MM 1PKLA 9XIAA 4XZIA 1DWHM 3CV1A 3POHA 5FJTA 4RNIA 3TN3A 4PTNA 3VCNA 5EB8A 2QCHA 3E0LA 4YTSA 1RP8A 1XICA 4MVAA 1GK8A 1YBQA 3RLUA 4PE8A 4PB3A 2VHLA 1K9TA 4MGGA 3NL6A 3PAJA 3GC4A 3P61A 3ARPA 3KTXA 4GY1A 4JFUA 2J4GA 1XYLA 1TYGA 4W93A 1QW9A 3FXYA 3QPYA 3W7RA 4EXBA 1TWZA 3WJZA 2DZTA 4BY3A 1MI3A 4ERGA 1UOKA 3EWCA 1V3HA 4AHPA 3TONA 4AW7A 3GZ3A 3OVGA 2CFFA 4MLRA 3WDJA 4RCXA 2TODA 4AAJA 3P82A 3KRZA 2Y5EA 3BWWA 3QYSA 4ACZB 2OQHA 5TBOA 1VP5A 2QCEA 1UHVA 5C70A 2VRKA 4JFVA 1DJNA 4BEUA 4L1GA 3PBYA 1M41A 1E5NA 1A5AA 4MB1A 4NASA 4AD5A 4WJXA 3SQLA 4LBRA 1BQCA 1QHZA 3M4HA 3V1PA 5M1TA 5D04C 1XPYA 4A3YA 2ZDRA 4IGHA 5I0DA 3MZNA 3LZ3A 3WYZA 1A0EA 3RCYA 2OZTA 2WMGA 4QROA 2XIMA 1YDVA 4XZHA 4FXSA 1ADOA 4IIFA 3OW1A 4POCA 2WKLA 4HYVA 1XDJA 3PBUA 3T0DA 3C2EA 3KVJA 3HGOA 3KRUA 3VNIA 4UMBA 4AXNA 5I23A 3SIZA 4XZBA 2VJXA 3LV5A 2X7WA 4KH2A 4Z2HA 2Z2AA 1ZP3A 2J79A 3GW0A 2HCVA 3RR4A 3T6CA 3V0UA 4KIRA 2NQZA 3T4CA 5I07A 1OX6A 1JRBA 4F48A 2E6FA 3VC6A 1LLZA 1U5VA 3R89A 3ARUA 3QN3A 4MPQA 3NQBA 3W6LA 1G4EA 3NOEA 1A0DA 3QV6A 4XVDA 3UG8A 3PJXA 1RPKA 2VC9A 1QPRA 3VZZA 4N9EA 1JCXA 4XBSA 5JVLA 3BAJA 1B3XA 3P80A 5IHRA 1UUMA 1N8FA 3APYA 1H7NA 4E3VA 4H00A 1NF0A 3GYCA 3BJFA 3KCJA 1GHRA 1T8QA 3OBKA 3LK6A 3RCNA 1E6QM 1VBUA 4UR8A 2VKZG 4P61A 1EO5A 5A6TC 2DZAA 3S2CA 4JBRA 3SRDA 2QJJA 1JDEA 1AZ1A 4PMRA 4E0CA 3B9AA 2GFTA 1XX1A 1ADSA 3PUEA 3HQPA 1D3CA 4WY0F 3W7HA 1CXEA 1OQFA 3KTSA 3LTSA 5K9CA 1TTPA 1V3JA 2KX9A 2O9TA 7TIMA 1A5UA 3AHZA 3WMSA 1HKVA 3WENA 1WNOA 3GDKA 3MKKA 1S5VA 2ZUSA 5HNNA 1RA0A 3QKZA 3BG5A 4ZB5A 3KAOA 3QQ1A 2PEVA 1WKEA 1A3WA 5C7HA 1X39A 4HMCA 5A6AA 1PDZA 1VFSA 1FHUA 3ZT7A 1JULA 3S6OA 4RW5A 4NRSA 1W1PA 3CNYA 3EDFA 4JL1A 1BTMA 2CC0A 4XSMA 1MRAA 3UQNA 4L9XA 5EGRA 3WDIA 4NAEA 3OPSA 5FF7A 1K4GA 3PPHA 3HG5A 3D6NA 3USBA 1GNXA 4MHBA 3FAXA 1JAKA 1XRTA 1HJUA 4PUUA 2F6UA 2PD5A 2A6NA 1MVYA 4JKLA 4WRHA 1K9FA 4W8LA 3OA5A 2O9PA 3WMBA 4INFA 2HQAA 3GC2A 1GHSA 3P93A 4C6LA 2HDJA 3KLLA 1EGVA 4O17A 2ZUMA 3H26A 2H3BA 3J7HA 3NL3A 3EA1A 2VUYA 2D2HA 1FCVA 2V3GA 2ZA2A 3TFXA 1J9YA 5FJIA 1LQ2A 2DPEA 1VZWA 4R33A 3ARWA 3MPGA 4WR3A 5U7SA 2WCAA 1VJIA 2WNZA 3R58A 4U33A 1P7TA 3AC0A 4ATLA 3LCFA 2CIPA 3AJ7A 5LA2A 3F7JA 1V3MA 5AECA 3HV8A 2G3MA 2XVGA 1OCJA 3NZRA 2A7PA 1AZ2A 1O7AA 1CEOA 5IDZA 4YVPA 1J6OA 3VUSA 4CNPA 2XU2A 1H41A 1GORA 3TYUA 4LVAA 3WEMA 1B4EA 1KC7A 2G95A 1E0UA 1H60A 3L12A 3MZ2A 4R88A 3UG3A 2X30A 4YU1A 3OJGA 6PTDA 3ZJKA 2AL2B 1M65A 3E02A 2YCLB 5G1TA 5EBUA 2EHHA 2DT0A 1JYXA 2QUTA 4S3JA 3B9NA 4QGCA 3E0VA 5MKGA 1PTGA 4LB4A 3D3AA 4N2YA 5KETA 3ZM8A 3STCA 1NP2A 4OOZA 1D8CA 4NZFA 5DXXA 2QPSA 1DQWA 1P7TB 2DT2A 2OXNA 4R3UA 2ACUA 4JX6A 4IIEA 3W70A 2RFGA 5AHNA 3CS2A 4WSJA 3VX1A 3KL3A 2WJDA 5I09A 7A3HA 5AHMA 1PZ0A 4B4HA 3LM7A 4F9DA 1WKYA 3NYDA 1M6JA 1MRQA 4L61A 4RKAA 1ISZA 3USZA 2P0IA 3CIVA 1UYQA 2QPUA 4AZIA 1K02A 1QTWA 5JIPA 1IT8A 1DJZA 4CGTA 4A35A 3M0HA 1MQQA 5EPDA 3H7VA 3ZLGA 3FN9A 2XH4A 3OLDA 1RK5A 4OV9A 2RH9A 5A6LA 2WMKA 5HQLA 4AIUA 4AXKA 3NL2A 1E4IA 2Y88A 4KFOA 5DEZA 2YCIX 2O92A 4IMCA 4U4MA 4Y9AA 1C91A 4Q4KA 4FXFA 3ZT5A 3OTRA 5AC4A 2FVKA 4IQLA 4QE5A 1UBSA 3VZYA 1CT5A 4W5ZA 3U8GA 3H53A 2DZVA 3M47A 4K8GA 4Z2KA 4XZMX 3A4AA 3KOZA 2W91A 2W92A 3BL3A 4WDTA 3VILA 3H24A 3UWEA 3PN8A 1LT7A 3DHDA 2YKKA 5A6JA 4XSLA 1JFXA 2XIOA 2VXNA 4QXIA 4ZOAA 4PUMA 1CENA 5D8ZA 4FF5A 1SSGA 2JALA 3S46A 3VE9A 1Z44A 5E0FA 2QCLA 1VPQA 1C9DA 3VM7A 2OELA 4W5UA 4DJED 1RUSA 5L9FA 1M3UA 1J0YA 2WBGA 4FX7A 3N34A 3B9EA 3W28A 4A8RA 3E2VA 3LY0A 3JUGA 4RW3A 3VM5A 3W27A 3U6WA 1L6YA 3WNLA 5REQB 3K1GA 2PWUA 1VLWA 1VGAA 4FX8A 4GH3A 4H6RA 1EP1A 3GUGA 3NEVA 2ISDA 3GDLA 4J3WA 4LY4A 3D3FA 3TX9A 4OTKA 2R91A 3NSXA 5E70A 4ERIA 5CAKA 3RM9A 1XRSA 3UWUA 9XIMA 1SSDA 1WE5A 4O1EA 5CC3A 1SVDA 1OFEA 1Z89A 5DO8A 4AZCA 4GBUA 4GXMA 1QNPA 3WY1A 3HJEA 1D7FA 4UMAA 1S3TC 1U22A 1QATA 1OVDA 3SAZA 4Q7IA 2NQ9A 2BV9A 4FXJA 1PCKA 3VGHA 3WQWA 3FK4A 1RPXA 4QLLA 1QCWA 4CQAA 5J5RA 1EH9A 1GYNA 5A2AA 3E0IA 4OUEA 5I78A 1TJ2A 2C14A 2PB1A 5FF4A 2ZUTA 2V68A 2VFIA 2A7RA 1FH7A 1SO5A 2A85A 5JU6A 3EX6A 3AHXA 4GK8A 3FX4A 2WVTA 1OC7A 2VGIA 3SQMA 3TCEA 1JEZA 5D4YA 2QIWA 1YXDA 3HPXA 2A0NA 2R1LA 4XAPA 1TPDA 3WD3A 3AZSA 3AWOA 1VS1A 1GKPA 4O10A 1WV2A 2V2DA 3MKCA 4JTQA 3ANVA 4JEJA 3H54A 2MANA 5LKYA 1W5MA 3IRSA 1XIEA 2V3DA 3EWWA 4OOUA 1FWNA 1CGTA 1S2TA 1E5JA 1A3HA 3WO8A 3W25A 4FB7A 2PDKA 3ENLA 4Q4SA 3TMLA 3G6MA 5H8UA 1LRTA 2Z0IA 2VFFA 5FF3A 3SCPA 1V6TA 2PP0A 3QFWA 1PWMA 3FV9A 2VCBA 3R43A 4DUVA 4QEHA 4HU8A 2DFAA 3UD6A 1J12A 3EX1A 4N9CA 4Y9NA 2FZDA 4GYKA 1PO9A 1EXBA 1ZU8A 1CTNA 4RE3A 4ZFMA 1G7UA 2RKXA 3NURA 3GHTA 1PAMA 4YTTA 1ONRA 5G4EA 1TX2A 2ZIDA 1JZ4A 1AMKA 4C6PA 4XV0A 3W01A 1KRAC 1O68A 2ZX9A 1N2VA 4E2DA 4XUYA 1W0MA 1SFTA 3W1XA 3BW3A 3Q4DA 2HK0A 3W02A 4P7NA 5CZTA 4CLMA 4LANA 4MF4A