3PBMA

The crystal structure of adenosine deaminase in complex with chloropurine from pseudomonas aeruginosa
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
313
structure length
313
Chain Sequence
YEWLNALPKAELHLHLEGTLEPELLFALAERNRIALPWNDVETLRKAYAFNNLQEFLDLYYAGADVLRTEQDFYDLTWAYLQKCKAQNVVHVEPFFDPQTHTDRGIPFEVVLAGIRAALRDGEKLLGIRHGLILSFLRHLSEEQAQKTLDQALPFRDAFIAVGLDSSEVGHPPSKFQRVFDRARSEGFLTVAHAGEEGPPEYIWEALDLLKVERIDHGVRAFEDERLMRRLIDEQIPLTVCPLSNTKLCVFDDMSQHTILDMLERGVKVTVNSDDPAYFGGYVTENFHALQQSLGMTEEQARRLAQNSLDARL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of adenosine deaminase in complex with chloropurine from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords Adenosine deaminase
total genus 121
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.5.4.2: Adenine deaminase.
pdb deposition date 2010-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3pbmA00
2GSEA 3IGHX 2KAUC 2EG8A 1RJRA 4TQTA 1FWBC 3B40A 4H9VA 4IQJA 1HZYA 3GIQA 1NFGA 4LANA 1YMYA 1O5RA 2R1KA 3GRIA 5CH9A 1V4YA 3MKVA 4LEFA 1FWFC 2OODA 4DZIA 3LSBA 2YXOA 1BF6A 3NEHA 3V7PA 1EJTC 1RA5A 3B0XA 4HK5A 3EGJA 3SO7A 4YIWA 3T81A 3OQEA 4WHBA 3FDKA 3MVTA 2D2GA 2Z25A 3TN4A 3FEQA 1YBQA 4OFCA 1YNYA 2P50A 4KESA 3MPGA 3E0LA 1FWHC 4QTGA 1J6OA 3QGAC 4B3ZA 3ITCA 1RJPA 2ICSA 2VR2A 4KEVA 1ONXA 4IFKA 1IE7C 1NDVA 3GG7A 2HBXA 2D2JA 3K4WA 1A5MC 3QY6A 2QT3A 3CJPA 4PBFA 3LSCA 1R9ZA 1O12A 3F2BA 3OODA 2Z29A 4LALA 2HNHA 1RAKA 1R9XA 5HMDA 3F4DA 4B90A 3CAKA 4KF1A 3UBPC 3URAA 3CS2A 1M7JA 4ZSTA 1FWEC 4C65A 3SFWA 3E74A 4NI8A 1NDWA 1P6CA 1QW7A 4PCPA 3IARA 4RDVA 3IPWA 2R1NA 4DLFA 4DO7A 3RHGA 1J6PA 2WJEA 3GU2A 4RDWA 1GKPA 4DLMA 1JGMA 4INFA 3GTIA 4C6NA 1GKQA 3TN5A 1R9YA 1V79A 2WM1A 1ITUA 3DCPA 4Z42C 2PGFA 4CNUA 3A3WA 4ERAA 3AU2A 4C6MA 4LAMA 3F2CA 1I0DA 4RDZA 3WYZA 4C6CA 2CZVA 2GWGA 1YBQB 1EJXC 2YB1A 3LGGA 5FSEC 1RK6A 3URQA 4H9MA 1KRAC 2DVTA 3MSRA 4GX8A 2Z7GA 3QY8A 3NURA 4CQDA 1KCXA 1EYWA 1EJWC 2OB3A 2OQLA 2Z28A 2DVUA 1YRRA 3IV8A 1A5NC 1UMLA 3R0DA 2AQOA 3QGKC 4MUPA 1A5LC 3UR5A 4NP7A 4GBDA 2FVKA 2Z27A 1S3TC 2VUNA 3OJGA 2P53A 4DYKA 1W1IE 4PE8A 4XD5A 1POJA 4ERIA 3JZEA 3EWDA 4KETA 3GTHA 1FWDC 4LCQA 4DNMA 2GWNA 4CQCA 2F6KA 4G2DA 1NDZA 4C5YA 4H9TA 3F2DA 4H00A 4BY3A 1EJVC 4R7WA 3ISIX 2PAJA 3S2JA 2OOFA 1V7AA 4LFYA 4QS5A 2FFIA 4XAYA 1V51A 5A6TC 1FWIC 3GU9A 4IGNA 4C6KA 2HPMA 1FWCC 4UBPC 4LAOA 2WJDA 4J5NA 5FSDC 2VHLA 2Q01A 4EPKA 2R1PA 3LY0A 2Z2BA 1RJQA 4J35A 4XD4A 1XWYA 3WZ0E 1KRBC 4PCNA 4NG3A 1A4LA 4XD3A 1FKWA 3LA4A 3S2MA 1EF2A 1NDYA 4DI8A 4EPEC 2PLMA 3URBA 4H01A 1M68A 2I9UA 4I6VA 4L9XA 1UBPC 4GY0A 3QY7A 4CNSA 4DIAA 1P6BA 3OU8A 4R85A 3URNA 4ICMA 3AUOA 3MTWA 3UR2A 4KQNA 2ADAA 2QPXA 4F0LA 3O0FA 1FWAC 3T1GA 3E3HA 3TNBA 3T8LA 3B0YA 3DC8A 3LGDA 3E2VA 1VFLA 3RCMA 4XAFA 2AMXA 2HPIA 5E5CA 4GYFA 2FVMA 2A3LA 3NQBA 3PBMA 2E1WA 2YB4A 3N2CA 3F4CA 4IFOA 4LH8A 4KIRA 4QSFA 4F0RA 2UZ9A 4JOMA 4C6IA 4M51A 3D6NA 4G7EA 4LCRA 3TN6A 3ORWA 3RN6A 2ZC1A 3PAOA 4IFRA 4CEXC 4HK6A 1UIPA 4C6OA 3S2LA 3PNUA 4C6BA 4XAZA 4AQLA 3S2NA 2PUZA 1ONWA 2ANUA 3HPAA 4WVXA 3GIPA 2AQVA 2W9MA 4E3TA 3IRSA 4GK8A 1XRFA 1K1DA 2GOKA 3GU1A 1RK5A 4HK7A 4C60A 2PGRA 4V1XA 4GY1A 2YZ5A 1PSCA 1WXYA 4WGXA 1FKXA 3GUWA 1EJRC 1RA0A 1K70A 2VM8A 2R1MA 3KM8A 3C86A 4KEUA 3MJMA 2BGNE 1UIOA 1K6WA 3MDUA 1POKA 3K2GA 4IG2A 4PBEA 3HTWA 4IH3A 4KEZA 1FWGC 3GTXA 1EZ2A 1KRCC 2Z24A 3OVGA 2Z2AA 3WMLA 1A5KC 4XAGA 2O4MA 3E38A 4GX9A 3PANA 4HJWA 2UBPC 5G4HC 2RAGA 4BJHA 1ADDA 2E25A 3MVIA 1E9ZB 4IFKB 3DUGA 4G7EB 2QS8A 3BE7A 3IACA 4H9YA 1ZZMA 4C6DA 4R88A 4RDYA 1GKRA 3UPMA 1PB0A 4C5ZA 4GOAA 2XIOA 1J79A 3A3XA 1A4MA 2DVXA 1A5OC 4GXWA 4C6QA 4DZHA 4L6DA 4IF2A 2BB0A 2Z26A 2Z4GA 3TN3A 3AU6A 4C6LA 1YIXA 4C6JA 1ITQA 4QROA 3ID7A 4C6FA 2O4QA 4LAKA 4C6EA 2Y1HA 2R1LA 1DPMA 4P5UA 2OGJA 3HM7A 4ERGA 1EJSC 4J2MA 5AKQA 4DI9A 1I0BA 4RZBA 4I6KA 4EPBC 4CQBA 4H9UA 4CNTA 3G77A 5HMEA 2I5GA 3FDGA 3A4JA 4AC7C 2Q09A 4IG2B 1J5SA 2HBVA 4H9ZA 1XGEA 5HMFA 2EG7A 4H9XA 4HA0A 4QS6A 4UB9A 3RYSA 1M65A 1QXLA 3PNZA 3MDWA 5LXXA 2IMRA 3LNPA 4GZ7A 4IGMA 2G3FA 3S4TA 4C6PA 4GC3A 4XD6A 4ZSUA 3GTFA 2HQAA 2GZXA 2VC5A 4KERA 4B91A 3ICJA 4GY7A 1XRTA 4B92A 3IJ6A 1KRMA 1EJUC 4V1YA 3E0FA 2QVNA 1E9YB 1PTAA 1FWJC 1P1MA 4EP8C 4RE0A 2VC7A 2EG6A 4LCSA 2D2HA 3UF9A 3OOQA 3LU2A 4D8LA 4BKNA 4QRNA 3LS9A 1V77A 1PO9A 1WXZA 2WJFA 2Z00A 4F0SA 4CEUC 4EPDC 3K5XA 3O7UA 2FTYA 2FTWA 3EWCA
chains in the Genus database with same CATH superfamily
3WDHA 4GUFA 2XM2A 2E6YA 3NO1A 5A8PA 3KBWA 1HZYA 1NFGA 2NT0A 1A50A 2QV4A 1TJRA 4O19A 3RDKA 4DPPA 3NEHA 3EDKA 1G1YA 1E5JA 3B0XA 5MKGA 3EGJA 1XH0A 2WK2A 4HNNA 2QJIA 1QRQA 4D6GA 1SMDA 4MY9A 3T42A 1X8FA 2BX7A 1FWHC 4Y9MA 1J6OA 1XCXA 3QSRA 4AZHA 3QGAC 2FGZA 2D20A 5D2YA 4YWSA 2JEPA 4ZOBA 2ABAA 4N42A 1ONXA 1DQWA 2PZ0A 3LENA 1MWOA 3ZO9A 3LCFA 4JTIA 1QO2A 2GGJA 3TIMA 7ENLA 4XO7A 3F5LA 2NVCA 4ICNA 4JTCA 5D30A 2VELA 1M6JA 5E1QA 3VGEA 3CAKA 3ABQA 3VVGA 3PPFA 4IZGA 4D6DA 2BASA 3FA4A 3NNTA 2Z7KA 1HN1A 4JIHA 1GW9A 4GNJA 2ZE3A 2ZUWA 2ZRVA 3VIHA 3IPWA 3OLIA 3WX7A 4IJCA 3PAJA 3GG0A 4ICCX 6REQB 1GKPA 4MWAE 2G0WA 3VOGA 2VD9A 4JHOA 2CEQA 3VGBA 3H2FA 3B06A 2XIQA 3PZNA 2FDSA 1H63A 6A3HA 2VX4A 3RO8A 4LW7A 3AS1A 1PXGA 1LTDA 2PDIA 1KLZA 3R5EA 3QY8A 4HD5A 3UQNA 4XZWA 1J0JA 2QMKA 2YXXA 1EYWA 1UZ4A 1S38A 4YVVA 4GYJA 1S2VA 3VO0A 5XIAA 3HOJA 4MUPA 3FGCB 3LBOA 4X9SA 1K4GA 2X7WA 3CZEA 1H5YA 2QVHA 2FZNA 2YDAA 3PZUA 2G8ZA 4AYGA 4PA8A 3SCOA 2ZWZA 3B9OA 1W1ZA 5FJJA 1WZAA 4P8UA 1RQHA 1G6CA 2J24A 4NU7A 3GH4A 3F2DA 1QWKA 3MBFA 5H1WA 5BWFA 4XAYA 5L6UA 2QCGA 5LA0A 4D1IA 4UQBA 4MOZA 3GU9A 3NVTA 3P8JA 1UH4A 1BLIA 3FLUA 1Q6LA 3FY1A 4XD4A 5A8MA 3AMLA 1KRBC 2WNNA 3EOOA 3AWOA 2P88A 2DDXA 4Z1BA 3VE9A 4PB5A 2PLJA 4DI8A 3OZPA 3W07A 2XGZA 1G5AA 1XINA 3OLEA 2I9UA 2RKXA 4HU3A 1XIBA 4DJFC 4GIEA 1E0UA 2CYGA 2GJLA 4MB1A 3THUA 1KTBA 3T8QA 3E0VA 4QFUA 1B3OA 1O68A 3UWWA 2WW5A 3N4FA 3AIUA 4WLCA 3H7UA 3WD3A 3FIGA 3DDMA 1EJ7L 4Q3MA 3NQMA 5I24A 5CZSA 1SO3A 2Y7DA 5DCEA 2OLAA 1SFLA 1MYRA 1JG9A 4LH8A 4Q6JA 4F0RA 1SO6A 4JOMA 3BW4A 3NPUA 1LT8A 1UUMA 1EQPA 3TOPA 1UIPA 4C6OA 3AC0A 2J47A 1B0IA 4DYJA 3AIRA 5D09A 3ABZA 3HV8A 2FH6A 4M56A 2ANUA 3BAXA 4GYPC 2CLPA 4S39A 2D0HA 2PGEA 1TPB1 4O15A 3TV8A 3DHDA 3NJ3A 5HUPA 3ARPA 4FNTA 3TLQA 4L4OA 4LJ3A 1X8CA 3LCXA 2WV8A 3CUHA 3W2NA 4Z2LA 4I9AA 4I9MA 4ROPA 3SRFA 3AISA 3GUWA 4NXSA 4ZODA 3A9BA 4ZGYA 2EAWA 1EWDA 1TMHA 2GQ3A 2YSWA 3VD4A 3KTCA 3B8VA 1PX3A 4HJFA 4A2RA 2YA0A 3NQ7A 1J0IA 4I7WA 1HJWA 1SMAA 1SYTA 4KW2A 4GX9A 1ISZA 1H61A 3IUIA 5FD0A 3SUWA 4U2YA 2EEXA 4O1DA 2ZX9A 5AECA 2E25A 4V2XA 2E40A 1V08A 5I02A 2FLIA 1XH1A 4NSBA 2X1RA 1GQJA 4CLMA 1P0BA 1KM3A 3W29A 4E4UA 2BTMA 3Q2DA 4NX0A 4X0NA 1QNPA 1OGGA 3G1RA 4R7OA 3S1WA 2CZFA 4MUZA 1JZ8A 3TN3A 5EMLA 7REQA 3LHZA 4ES4A 5I06A 4GO9A 4YWIA 3TTYA 4JYFA 3I6TA 4RK8A 3NIYA 2E6AA 5EPDA 4DF1A 1VH7A 3OBEA 3MP5A 1W5QA 3G5EA 3UU0A 4UTHA 4HTYA 1DQUA 3N04A 1PV8A 3GDMA 2D1ZA 3IEBA 1J5SA 3W82A 3VIKA 1FWWA 2H3BA 3S1VA 4CNOA 2OWXA 4RKAA 3WH8A 2DIJA 1M65A 2ZKMX 4AFYA 1DE6A 3GG8A 5GNZA 5AC7A 1XS2A 1X7FA 3N15A 3P74A 1V02E 3S5ZA 3U48A 2HQAA 1AH4A 3VU2A 3NZQA 3AXKA 4B92A 1Y7VA 1UCWA 3M0LA 2A3CA 5GNYA 2QYGA 2WZIA 1WYIA 2VWSA 1N8IA 2CLKA 2EG6A 4R9XA 3AYVA 3T09A 1XSKA 3IIOA 3W74A 3ZFHA 1UD8A 4M1BA 3AMKA 2OT0A 4EPDC 3AIEA 3EKZA 3IIPA 1JDDA 3VXGA 5LNSA 3MYPA 1XLEA 4JFTA 4U10A 3RJYA 3AHVA 2WLZA 3GIQA 3H2CA 1JQXA 4A35A 1EQCA 1N8WA 1RV8A 2YX0A 1YTDA 2BVYA 4GQBA 2V69A 3SDOA 3W24A 3OYZA 1TVPA 4UQEA 4KWUA 3GXNA 2J4GA 1U5HA 1I1XA 3FDKA 3UXLA 3MPGA 2WANA 4NJIA 2XVNA 3W02A 2NWSA 2WBGA 4H8UA 3B8WA 3EWXA 1DWHM 1MFUA 2WMJA 3EOEA 1VFSA 1YX1A 4A8RA 4MG4A 1IE7C 1NDVA 3BOFA 3DEQA 1XUUA 3G3DA 4IMCA 5CPOA 8A3HA 1ME9A 4LYKA 3IJ8A 4RL3A 3VM7A 4CD6A 1FXPA 3QXBA 3CLWA 3WLQA 4B90A 4WGHA 2I14A 3ARXA 2PRMA 3EEZA 3TQ0A 5JUVA 4GUGA 1F4AA 1QW7A 4MM1A 4DLFA 1OT1A 3RHGA 5TIMA 3D3FA 3BLDA 4WDTA 4E4PA 1OX4B 4BQ3A 4LPCA 1XIHA 2FYMA 1GVEA 3FHAA 4ZOCA 2D0FA 4FNRA 2RJGA 3G18A 5D02A 2WVVA 4UQAA 4OGZA 2XG9A 1L8PA 1WQ5A 1ZALA 4F48A 1Q6CA 3LTSA 3SCNA 2Y6ZA 2CITA 1F4HA 1IGWA 1DKWA 4MDOA 4H9MA 3S8HA 1TPC1 4GUHA 2BV9A 2C18A 5EFFA 4LY4A 1EWEA 5TBOA 3N73A 2NQJA 3SCUA 1M7OA 2CWXA 4JX5A 4B3KA 4AMAA 1EJWC 3GY1A 3SECA 5AC5A 5CSSA 2A7PA 2GQ8A 2BVWA 4N0RA 3V5FA 5JU6A 1GT8A 3MI2A 2Y5JA 4X2RA 1Y0EA 3PPGA 4CN1A 3WJWA 2NX9A 2XGBA 1HJXA 5C71A 1RH9A 1XDMA 2XH4A 4CQCA 1LM1A 2VNCA 1JCTA 3QPZA 2FHBA 1FOBA 1QUMA 4R7WA 2G41A 5FA5A 1NVMA 1Z7AA 3TMQA 3W72A 1YE4A 5A69A 2WMGA 2ZUSA 4EPKA 4M80A 3EB4A 1ZHAA 1B2YA 2FPYA 3SSJA 1PWLA 1G9HA 1JVNA 1TVLA 4W8LA 2IPWA 1GCYA 2CU0A 3HGRA 4C7FA 4I6VA 4EOUA 4PN2A 1EPXA 3WFAA 2OVLA 1XD0A 1XR2A 2Z1VA 3I3DA 4UTUA 1M03A 1JYNA 4IHCA 3BWWA 3FKRA 3EDJA 5HQEA 1XLGA 3MKCA 3CQHA 2OWWA 4FZIA 4P8XA 1MW3A 2PDCA 1C9DA 4N9BA 3C2EA 3TNBA 3BG9A 3DC8A 4IP5A 1NOWA 1XLHA 3B9DA 3LGDA 5I3HA 2AMXA 2AKMA 4DJEC 3LNMA 3L4VA 5DX7A 2YYUA 1I1WA 2R91A 4KGLA 2TPSA 1GOWA 4X60A 2GSJA 4CCEA 2ZDRA 1ECEA 4CEXC 1U1HA 3G8RA 3ZT5A 4F0KA 3WENA 2V2CA 1EZWA 3ARUA 2W67A 3WLIA 1R5YA 2HVNA 1MQRA 3U9IA 4K36A 5CSUA 4WVXA 1R3SA 1I75A 3TTOA 4HZ8A 3LBCA 1LL4A 5GVJA 3QHMA 2WHLA 4HSHA 5DCBA 2FHCA 2DH3A 3R89A 4A8IA 4W7WA 2WWCA 5G4EA 4PUWA 2VEGA 5H91A 5T9BG 3VUSA 1JL8A 1DIDA 1K70A 3SCTA 3LV6A 4WZHA 3O05A 5E70A 4O4WA 3S2CA 2C0AA 2DIEA 2ZZ7A 1POKA 4LUJA 4PTXA 4FNSA 1R3TA 3EPOA 1IYXA 2X0HA 1J96A 5DRCA 5ABFA 4JNYA 3OVGA 1V0NA 3T08A 2EPNA 1UD5A 4JFVA 3O6YX 3GO2A 2XM1A 5AVHA 3C0JA 3NCOA 1OFDA 3A23A 4HYVA 3IJ9A 2Z1KA 3D46A 1FH7A 2CLEA 1OF8A 4BF5A 1QDSA 3SN4A 1TKKA 3CIWA 2QUMA 3GNXA 4ZO6A 1AQFA 3O6CA 1F2JA 3ARSA 2HDJA 2BG5A 1H2JA 3TXZA 2PS2A 4C6LA 2YLLA 1K7FA 3LYEA 4HMNA 1UR8A 2HXTA 3TQPA 1XQKA 4US5D 3GDTA 1QMLA 2PDWA 3W84A 4M8UA 1I0BA 2W62A 3CHFA 3GC4A 4GQGA 3NPXA 3G77A 4PFHA 3FDGA 4BS0A 4KPLA 3ZM8A 1W56A 4H9XA 2AL1A 3OBAA 3FXGA 4HA0A 4GG9A 5FAJA 1O1ZA 1TWIA 2FPVA 3P14A 1T0OA 3QVQA 1TJPA 1YPXA 4S3DA 3AI0A 3CUXA 1UH2A 3GHUA 4QCEA 4L64A 4NASA 3VOJA 2C0HA 4O18A 1O5QA 5D33A 2AL2A 4PTWA 2C7FA 1P1MA 4EP8C 1GUVA 3ZR4A 5IFTA 2Y8VA 4MAVA 4B5VA 3DU0A 4JICA 3ITYA 3OOQA 1Q6DA 1BTMA 4FALA 3AYRA 2UWFA 2H9AB 1WXZA 1SFSA 2WPBA 3AMGA 4TTUA 1UKPA 4PMOA 4DO4A 2HTMA 3EWCA 2RDUA 4O1EA 4D1JA 4OECA 3KS5A 4A6GA 2UY4A 3WMBA 1LT7A 3EB3A 1XLDA 1V03A 5LNVA 1ITXA 2E67A 5DELA 3LTPA 3V7PA 4ZO9A 2ZRZA 3RR1A 3SGZA 1OSEA 4HK5A 4ZB0A 3WLNA 3GXDA 4PMUA 3MVTA 1F6PA 1XLLA 1YNYA 2G3JA 4TX8A 2NSXA 3L4ZA 1QVBA 4AZCB 3ITCA 4AXNA 3VYLA 3W28A 5A6BA 4JTJA 1YTEA 2D2JA 5C7VA 3LSCA 1R9ZA 5FCZA 1FWNA 4QG6A 1TPVA 1RAKA 3I68A 4H2HA 3F4VA 3L23A 5HMDA 4YXGA 4PEKA 3W1TA 4PRWA 1M7JA 4J4KA 4RE4A 1E3XA 4Y9AA 3NPVA 3RU8X 3E74A 4ZOEA 4OTKA 4Q8QA 5I79A 2PWVA 3BQ5A 3VIGA 4FOUA 3SGGA 2TAAA 3KLLA 1KGUA 1RSCA 3WQDA 4MKSA 5LSMA 1E6SM 1V0MA 1XP3A 3E02A 1V79A 1TIMA 2PWUA 3DECA 1X1ZA 3DCPA 4Z42C 2HVOA 4C6MA 4LEQA 3IJDA 4DBWA 5L9FA 3G24A 4ZQRA 4DXXA 3O0KA 2NQ5A 3VNJA 2X1SA 3UYCA 5D4YA 1DXIA 1R87A 1W6TA 4ZENA 3WQ5A 2V0TA 1F8MA 4YTTA 3IGUA 4WX2A 3M0ZA 1EGMA 3W4RA 1CLVA 1GYMA 2FVKA 4LVDA 4L6HA 3KLKA 4L1XA 4CVWA 3OJGA 1GOXA 2NSOA 2X05A 2XPKA 1MNZA 5G4WA 3VGDA 4IIDA 4JN6A 3L2MA 2A3EA 3CEUA 1J93A 4L9ZA 3M0YA 5I03A 3THDA 1T96A 3WH6A 4ADUA 1H7NA 1QNSA 2PLCA 1FHLA 4CNPA 2E1DA 1P0KA 1DJNA 2EXOA 3N4AA 2GDQA 3ME3A 3BTNA 2EPOA 4EANA 5ABFB 5G1TA 3BLLA 4LYPA 4GIRA 1VPQA 4HZ7A 3PZTA 4O52A 4QXIA 1AL8A 1GZ1A 1G4EA 1ZBVA 3L5MA 2OOGA 3T0TA 5G2HA 3CXOA 4NG3A 4DWSA 1XLCA 1NDYA 4B4FA 4NX5A 3U4AA 2PLMA 3S5YA 2OX4A 1KB3A 4W93A 1PYFA 1IWPA 3M5VA 4QDPA 3GZAA 5CGQA 5BZAA 4CU8A 2VFFA 3M46A 3FYOA 1W5OA 2F61A 2WZTA 4JS3A 4DB7A 5BOFA 2ZXQA 3LHVA 5FOOA 2HE5A 3W1PA 1TRIA 4HPHA 1J10A 4ROQA 1MMFA 1QHPA 4D72A 2OSWA 3BURA 1ZCOA 1SJCA 2UZ9A 3B8UA 4JIEA 4F9JA 1B3YA 3BJSA 2Y4SA 1H1ZA 2G5WA 2OFJA 4Q4RA 1RP8A 4C6BA 1HJSA 2E5CA 3SY5A 3S2NA 2VKZG 2GDVA 3G6MA 2YOCA 4JTHA 5M3WA 4A29A 1TCDA 4EE9A 1FHVA 3BW2A 2JF7A 2DW7A 1XPYA 1EXBA 5BRBA 5BU6A 4TIMA 4EACA 4J3ZA 4LBRA 3KM8A 3C86A 2CFFA 3BUVA 3CUGA 2OO6A 3KUMA 1S46A 3MDUA 8XIMA 2IKIA 4IG2A 3J7HA 3K30A 3ONBA 3NO5A 7A3HA 2WXDM 1XHGA 1XICA 3PZIA 3O9NA 5C5YA 2G50A 3VMPA 3FVMA 5AHNA 3WNMA 1VENA 2QCDA 3PANA 1O5KA 3QQWA 1DL3A 5LA2A 1JZ6A 5BMXA 1E9ZB 2NVAA 4IIGA 1GVYA 1W31A 5HJLA 3N9SA 1W9DM 2XWEA 2YR1A 4H9YA 1ZZMA 4K39A 1TR1A 2PDXA 1OC6A 3AYTA 3EX4A 3LRMA 1UW9A 1IIHA 4E8GA 4AD4A 8TIMA 1IZCA 3KTSA 5LKYA 3SCVA 3N2OA 1ITQA 3V36A 3PG9A 3WQEA 2QAPA 3N13A 3VX0A 3HM7A 4J2MA 1F61A 2Y24A 2I5QA 3UD6A 4JQ2A 5HMEA 1XLKA 2XZ9A 2O7QA 1VBRA 4Q7NA 1BVWA 6CGTA 3RMEA 2OEKA 2EG7A 1LG2A 2FJUB 1PKMA 2IMRA 5EBAA 2FGLA 1GVQA 1K3UA 4CQ9A 5IXEA 3R8RA 4S2BA 2ISWA 4U33A 3FV9A 2WSKA 2NQHA 3E0FA 1D3GA 1Z3NA 5C9RA 5C7HA 3ZT6A 3NR0A 3TSBA 3QV6A 4MB4A 5CZ0A 2WWDA 4O4VA 1V77A 1Q8AA 3EOSA 2WSQA 4F0SA 4JTRA 4UXDA 1BYCA 3WFZA 4BCEA 2DIKA 4HSNA 1EP2A 3ZLHA 2P5NA 3S6TA 2QPSA 2OZ8A 1TVNA 3AS2A 3BXWA 3MHGA 5H6HA 4HT3A 4DUOA 5HINA 2OODA 4DZIA 3LSBA 1SZNA 3W7LA 3DHUA 1BF6A 3CPRA 3AIQA 5DANA 1OF6A 2P0IA 4Y9NA 1Q4WA 1E6NA 1W1B1 4ZE5A 3QYQA 3SURA 1U22A 3I7SA 3HGOA 1OC7A 4B3ZA 1RP9A 3GZ3A 4PCFA 4MPKA 1GVFA 4JAWA 2F38A 2BHYA 4LXFA 3QW4B 1UUQA 3WDJA 3TW6A 2DZBA 4GQ0A 1JULA 4Z2IA 3M0KA 2B7PA 3W85A 5EBUA 1W54A 1O60A 3NL5A 2PDMA 3S1XA 3WDQA 3MMDA 3GXIA 4GI8A 4BHYA 1KCKA 1JDEA 2I9EA 1EHNA 5DXXA 2NUYA 3SFWA 4EXAA 3OB8A 5KTLA 4UOQA 4PB4A 3PPCA 1E3ZA 3T4WA 2VZSA 3PY2A 3WJZA 2VGBA 3QQ1A 2V5JA 4CD7A 3TSDA 2DPEA 1BXNA 1JGMA 1G69A 4INFA 1C29A 5C2CA 4JBRA 1R8LA 2FZMA 2BP1A 3M4HA 5F4WA 5JMUA 1X96A 1VBJA 3W2JA 3CMGA 3V0SA 2SFPA 2OYMA 1QNQA 3THAA 2BY0A 2WVSA 1UD3A 3FSUA 4ZQCA 4NRRA 2OCZA 3TX9A 2Y5EA 3B9EA 4MYXA 3VNLA 3OLDA 3KHDA 3UXDA 3QKZA 2PODA 1JGIA 2ZXAA 4NILA 1CECA 3COTA 2ZQ0A 3W25A 1CI1A 2P53A 3W7RA 5GJNA 4ERIA 2PURA 3W7KA 1AH3A 3UR8A 3QN3A 4JQ4A 3GFXA 4G2DA 1YEYA 3NDOA 3KRZA 1HO1A 1GOMA 1Q2RA 3BGGA 5C0QA 3MWCA 1V7AA 1GG0A 4QAIA 1WDDA 3BAKA 2ZA1A 4C6KA 4L9YA 3CZ8A 5A5WA 1J8VA 3G1DA 4XZIA 4ZXOA 3V4BA 4W84A 4CCZA 1OFEA 2CHRA 3DG6A 4L1WA 3KBMA 3L5AA 2GLKA 2PDPA 1FY6A 3C0QA 1R2SA 2VEKA 4GUIA 4KCVA 2MUCA 3DZ1A 2BY2A 3KBJA 1RCQA 4NZ1A 5A6LA 3WQGA 3OVQA 4H01A 3QZAA 3AALA 4ZOAA 1GVRA 1UBPC 4GY0A 4DIAA 1BGGA 2H90A 1LL7A 3LLXA 1TTPA 2UV8G 3H21A 2E9BA 1XX1A 4UFHA 3SQLA 3JVAA 3W22A 5HDRA 1WDRA 3N2BA 3LCLA 1BSLA 3MHUA 3ZJKA 4O57A 1FP9A 5AC8A 3H54A 1T40A 1VFLA 5H8UA 4WCJA 5K4XA 3CZGA 3N14A 3ZT7A 3T7VA 1E56A 3S46A 3A5VA 5ABGA 1WZMA 3D6NA 1Z9AA 1KFBA 1NTHA 3O16A 1VBUA 3G1HA 3TOYA 3RILA 4AD2A 5J04A 1B4KA 3ARVA 4H1ZA 5AYXA 4TOQA 1W3LA 2QJNA 3AXHA 1W1PA 3GR8A 2FH8A 2W9MA 3NQGA 4PC8A 2J27A 3LZ5A 4C60A 1PBGA 4WJXA 3OVPA 1XLFA 5EMMA 1E4NA 3F7JA 1BKSA 1HFBA 1EJRC 2C91A 5F1UA 3LQGA 1NARA 2WC7A 3CUIA 2PP1A 5E9XA 5EMKA 2ZRXA 1ISYA 1UIOA 4IMFA 4URIA 5I3GA 4U2ZA 1FXQA 1X1OA 1BF2A 4R53A 4E3VA 4J3WA 1XCFA 3GM8A 3VKCA 3QLDA 2GVEA 4UNLA 3PWIA 1S1PA 1PZ3A 4H19A 1LLZA 3CASA 4PMXA 1TELA 3GVGA 4HCLA 2QDGA 4IQEA 4FMVA 2F2HA 4AHOA 3BSGA 1A49A 4ZTXA 2PI6A 3WLTA 5DN1A 3QOMA 1AW1A 4A4AA 4K7VA 4J40A 2BNJA 1GG1A 4NY2A 1VLIA 2G97A 5EA9A 2GJXB 2BB0A 4OIFA 3AU6A 4QROA 3RLGA 3B3DA 3L66A 4WDUA 5F2MA 3CZJA 1UZHA 2O7SA 4P5UA 3EDDA 4QEEA 1NWUA 5C9ZA 1GHSA 3QC0A 3CC1A 2V5BA 4UTMA 1DXFA 3IIVA 3C56A 4NJGA 4IXXA 4PCSA 4MB3A 4UB9A 2JALA 2VDGA 2NWRA 1ZBWA 2D22A 4C6PA 3W81A 4QLJA 5HWMA 1SZRA 2WBKA 2F6UA 4B9YA 2PCEA 2NQ9A 4HA4A 9XIAA 3EB2A 2WVVB 1UOKA 2FZBA 5I2UA 1EP3A 3AHTA 5AB3A 3PF3A 1OYCA 1XCWA 4PR4A 4AVNA 4WSJA 4DJDA 1MNSA 3TP4A 3TJIA 1JXJA 5EL1A 3LHYA 2YIHA 4XG1A 3LS9A 3R12A 4E5TA 3C5QA 1GEQA 1DJIA 4NAFA 2FTYA 3IANA 3GLCA 4HVXA 1PJ9A 4HN4A 3MI3A 5BXRA 2VRQA 3VMOA 2PF0A 4ZFMA 4DX3A 1L6YA 4FXFA 4H9VA 1CT5A 5M03A 5CH9A 2VRJA 3I3EA 2E09A 2WMIA 2BHZA 1TZ9A 5AHIA 5DCDA 3CMJA 2BXYA 1ZUAX 4AY7A 1MEIA 3SO7A 4KMQA 4AXKA 1DBTA 2RH9A 4QTGA 3IJLA 1UWQA 1GYNA 4A3HA 2VR2A 3PM6A 4PYSA 2CLIA 3UXKA 1XL9A 2CBJA 4W85A 3L0KA 4HCDA 4L4MA 1BQCA 4N2YA 3RAOA 2V63A 1TZZA 5I7GA 4AZGA 4Q8MA 2A7RA 3V5OA 3URAA 3W86A 1PZ1A 1M3UA 3LHTA 3LRLA 5BOOA 3NGFA 1LRQA 2EF9A 1QI0A 3S6OA 1DEDA 1P6CA 3GVVA 3IARA 1R3RA 4UTJA 4YLWA 3WUGA 2DJLA 4AWSA 4RDWA 1XFCA 1EL3A 4DLMA 1PIGA 5FKYA 3HBLA 1US2A 1VFMA 4JIPA 4MJMA 3TYUA 2E28A 3GDKA 3KRUA 4GVIA 4J7RA 2J8TA 4PMYA 3MC5A 1JJKA 2CKSA 2IQDA 3WYZA 4Q8PA 1XIIA 4M7SA 1CGWA 4FR6A 2PDKA 1DOSA 1KRAC 2VZUA 2GOUA 1CZ1A 1DHPA 1JYVA 1FQ0A 5HK4A 3WD1A 3SZ8A 1KCXA 5CLWA 4DUVA 1PKNA 3K4DA 1V3LA 4KCUA 2AQOA 2Y5SA 3C6CA 4MY1A 3UR5A 3ZJ6A 1QTWA 3FS2A 4MNLA 1A0EA 1JF5A 1ZAHA 4AC1X 1NP0A 3CWHA 4KETA 5JQ9A 3H4XA 4BQ2A 3WJSA 1U5JA 4ZXLA 3QHOA 4BY3A 4DJFA 1NQ6A 1SJDA 1VCVA 2OOFA 1FDZA 2ZWYA 4L80A 5CAKA 1FWIC 2HXUA 4RCXA 1DIKA 2PF8A 4PFMA 3VFLA 1MXGA 2ACQA 4Z0SA 3B8IA 2ZZ3A 6REQA 1EO5A 1PCWA 4OZOA 3WZ0E 3M0MA 4XZNX 4H7VA 4LS1A 3LPGA 5K7JA 1ADSA 3URBA 3R11A 1L6FA 1S2CA 4FX7A 3RLHA 3S42A 1EF3A 1LF1A 1P6BA 1WKYA 3LCHA 4LAZA 1TV8A 2PDYA 1VBHA 3NZRA 4AISA 4AHPA 5XINA 3EOUA 3WLKX 2WVTA 1W3IA 3CV1A 4JX4A 4D8ZA 2FJKA 2WHKA 4ATDA 1BRLA 4MGGA 4ZR8A 1EGVA 2VP8A 2AGKA 1M9HA 3LRKA 5J8LA 5KINA 2Z1XA 5E0KA 1K7EA 4DXKA 5F4XA 3RN6A 1C90A 1RPXA 1OEPA 1YHTA 1EO7A 1MW2A 3R25A 1FWSA 1I2RA 1QHZA 3AWNA 1GTEA 3ARQA 2IKGA 4GJ1A 4E3TA 1PKLA 3HQPA 1OCNA 4E4FA 4GCXA 1AA1B 5M2FX 1EEPA 3UJ2A 3A4AA 4F40A 3N19B 4DBDA 4H4IA 1PZ2A 1QNOA 3OZYA 2KZHA 2R1MA 4K8GA 1ZL1A 3CTTA 4JDBA 3BDKA 2TRSA 2WJZA 4UR7A 4QE1A 1D3CA 3WD2A 4KWVA 4IMEA 1JYXA 3WMLA 2G4FA 1V0LA 4GHRA 5A6AA 4NAEA 1PEZA 4CUCA 4QM1A 1AQ0A 1VGAA 2UBPC 3POHA 3AROA 1SJBA 3G6LA 3CAQA 4G5DA 1WXJA 1QPKA 5B80A 3U2CA 4XQ6A 3IK4A 4YCOA 1J0YA 5A94A 4AW7A 2ZVIA 3WD0A 3UPMA 5HOSA 3W7OA 1ITCA 3DFNA 2PP3A 1LZOA 2QGYA 3EXTA 3THCA 5FJIA 1U1UA 2VURA 2V8ZA 2B31A 4JKMA 4YTRA 4WXZA 5KZDA 4IIBA 4C6FA 3U5UA 4IUOA 4V28A 4IX0A 1MZHA 1OCQA 1RQEA 1HJVA 1UQYA 6ALDA 1R38A 4DI9A 1OFQA 5BRPA 3GKAA 1CB7B 4MNKA 4WF7A 4TX6A 1ZSXA 1SFTA 4J1OA 3H23A 2OZ3A 2INEA 4H9ZA 3EMQA 1VJZA 3H6OA 2PC8A 1AQHA 4RW5A 4E6MA 3NG3A 3BO9A 2ZUUA 4FK9A 1UWTA 1IWAA 1UP0A 3CO8A 4LUTB 1RBAA 1SW3A 1N82A 4WJ8A 2WMHA 2ZX7A 1TQXA 1GTHA 5A2AA 1TX0A 5DXYA 2Y7FA 4CD5A 2VZOA 3O07A 3ABRA 3MCNA 3ANYA 1UG6A 3CPGA 3LU2A 2GSHA 3AIWA 1PO9A 3QTGA 1V3KA 4AD5A 1RJRA 3N17A 4B5WA 5M17A 3WK1A 1ML1A 3GUGA 1O5RA 3R8HA 2V3FA 2VL4A 1A5CA 1X7IA 4UNKA 4GISA 2R8WA 2BHUA 3B97A 2G3IA 5G5IA 2GJNA 1OIFA 1RA5A 3IIXA 3USZA 4ASTA 2IUZA 1ZRQA 4MF4A 4N02A 3R7MA 1H0IA 5GQBA 5REQB 3VKAA 2J7HA 5I0DA 1JPHA 4KESA 5DMLA 1VHNA 3CUZA 1JPKA 3ELFA 3SB0A 3GXMA 3TYDA 1J0HA 5K9CA 3MA8A 4D6EA 3GBEA 1JNDA 3P0WA 4HIBA 5C6MA 3I65A 1DJGA 4GQQA 2PA6A 2PWHA 4B5UA 1R9XA 3BAIA 3F5JA 5DQPA 3TWAA 3MO7A 4DUXA 1TO3A 4NZ3A 4DJED 4ZSTA 4C65A 1EHAA 3HMCA 1BVNP 1B5TA 4JKKA 3U7VA 5FF7A 1EIXA 1F73A 4KEMA 2OEMA 3GXFA 4DUWA 3EZ4A 3VMNA 1JPMA 3GH7A 2R1NA 3WQFA 1V5XA 1VYPX 1VP5A 2INZA 3WLOA 1JYWA 1RUSA 2QCLA 3WNOA 4C6NA 3GTIA 1UWSA 3KL5A 3B0PA 3QSTA 2HWGA 4DZAA 1TSIA 4NZJA 1W8GA 4KFNA 1QW8A 3GXTA 4KT2A 2CLFA 2BOEX 4C6CA 3GNNA 2DORA 2OYLA 4MFDA 3NM3A 1N2VA 1XLMA 4X0VA 2YCEA 3DKLA 1S5WA 4CQDA 1HIZA 1V6TA 1T5AA 1Q6EA 2Y88A 3QGKC 3HPZA 3ZLFA 4S3EA 1JCNA 4D6IA 1UMYA 1Q13A 4MLJA 4KIEA 4JEJA 5D9NA 3W7IA 3LMYA 5KZMA 2YCJA 1KV8A 3PJXA 1UWAA 3CWOX 2D23A 3E1F1 3JU2A 3WELA 2GQAA 5AC4A 1POJA 5D2TA 3V5CA 2X16A 4YHEA 4UTWC 3W1UA 2AMGA 3V75A 2EKGA 4XIMA 1OM0A 3CIXA 1H09A 1SW0A 1YPFA 1XC4A 4FXSA 2EQDA 3UNTA 4CD4A 1V51A 3UNDA 1KBLA 3WNPA 3TZFA 3FJ4A 3W53A 3AFBA 2Q01A 3M64A 4IJRA 1BYDA 2Z2BA 1H50A 4GVGA 7TAAA 1A4LA 4TR9A 4KKXA 4OVXA 1RHCA 1FKWA 2JBMA 3UZWA 3BW3A 3FN9A 4K2SA 3IVUA 4YCPA 1OCJA 1Q7ZA 3W7QA 4PODA 4Z1AA 4L9XA 1G4PA 4S1FA 2XFYA 3RO6A 3R43A 3H2NA 3OU8A 1R6WA 4GRSA 3UR2A 3TUUA 3NL6A 2ZRWA 1E0WA 1ZU8A 4CKQA 3ABSA 3LOTA 4HNUA 3L21A 3NM1A 1LCOA 2VRKA 2J13A 5H2ZA 1XD1A 2FVMA 1GOQA 1FH9A 2E1WA 3LI1A 3W83A 4FS9A 5BXPA 3IUHA 4A05A 5CPSA 1R2TA 2FKPA 2XN0A 1JRBA 3LXAA 2Q8ZA 3I3BA 4WR3A 4UC5A 1E73M 3RJXA 1ONWA 3WQ4A 3STGA 3SRHA 3G0SA 5B7ZA 4NAFB 3DENA 1KM2A 4JL2A 4HOZA 1OABA 4GY1A 5MKGB 2JKPA 1H0GA 1KFCA 3FNDA 4LNCA 3OP2A 3SRKA 3KVJA 3F4NA 4M29A 2CZ5A 5KZ6A 2V38A 4Y8FA 5HWJA 1Z89A 3VABA 1XYZA 1A5KC 2L5HA 1ICSA 1ZCCA 4ZMGA 2NZLA 1A5BA 1KW1A 4YU1A 4GJIA 4XSMA 3TEVA 3AO0A 2RAGA 2J66A 2ZZ2A 3TE9A 2IPGA 3BE7A 1IR1A 3E0WA 1TA3B 5H8PA 2OZTA 2EJ1A 4H7ZA 5A1AA 2AAMA 1OWQA 2DVXA 1V02A 9RUBA 4K38A 2D3LA 1YIXA 3K1DA 5LNUA 3V0UA 2YGYA 4A3UA 4QDMA 1KGXA 4YYCA 1Z48A 1BWKA 1ADOA 4QE5A 3DAQA 2ACSA 2YCLB 1KFKA 2HSAA 4TUFA 2V5DA 1QOQA 2I5GA 3IWPA 2IXVA 1KXHA 1JR1A 4R33A 2DEPA 1AZ1A 1XBVA 1TUXA 1HKKA 3M7WA 1OG0A 3OHIA 3RYSA 5HMSA 2Z1WA 1SW7A 2NVDA 4EKJA 3WF1A 2XFFA 3PBYA 4PZVA 3CUFA 5ABHA 1OJXA 4X2PA 1M5WA 1IT7A 1QT1A 4R34A 1O66A 3SGUA 3IJ6A 3UZYA 1NU5A 4MY8A 1KXQA 4W4QA 1R7OA 3NO3A 4X3ZA 2ODOA 1SSGA 1SGJA 4GUJA 1CB2A 1XYBA 2HISA 3W6MA 4NJHA 4N6FA 1G4SA 4XBJA 4H8HA 3P84A 3K4AA 2A85A 4IPLA 4OQVA 4V33A 3WG6A 4IL0A 2GSEA 3KL0A 2WC3A 1GQIA 2EG8A 1YW1A 4TQTA 3WF2A 2CNCA 5LIKX 4LUYA 2J77A 3GRIA 1QW9A 3MKVA 2PZNA 1M53A 4IQDA 1UA7A 2OXNA 4E2BA 1W17A 5BWAA 3M41A 1UJQA 3FJ6A 3ZXWA 1AJ2A 2OT1A 4MWAA 2C16A 3LM7A 4IISA 4YMZA 3TDFA 4WD0A 4O1AA 3ZIZA 4W5UA 1I2OA 3AOFA 2IKHA 1VPYA 1HGWA 3LGEA 2YW4A 3D0CA 2I56A 2HNHA 4UUIA 4Q4QA 4S3GA 1L6WA 1C7SA 4LB3A 5D8WA 1YDYA 4W86A 3WQCA 5D9PA 4LT9A 4H3DA 1ZJBA 5D9OA 1VB9A 1EYEA 2O0TA 2O9PA 4UMCA 4HTBA 2A4AA 5A8NA 1D9EA 2W3ZA 3PSVA 4CGTA 1JAEA 6ENLA 1W1VA 4UCFA 4R9OA 2ZUMA 4BEQA 3F03K 1H60A 1WX0A 4S23A 5M5DA 2W0UA 1MDLA 2CLHA 1A3XA 3ZWSA 3SQMA 2OYKA 1PTDA 3UJSA 2CBUA 2NT1A 3N3MA 1YXCA 3BSMA 3GAYA 1UR3M 4DY1A 1MSSA 3MI6A 3T0AA 1HF6A 2XVPA 3STPA 3ZVIA 4XTIA 1B3ZA 4AD1A 3CAWA 3QTPA 5JIPA 4AZ7A 2PDHA 3T2OA 5I6SA 5AVNA 2AQWA 3HG4A 4NKCA 3W23A 3CMFA 1YNQA 3P60A 4C5YA 3B03A 1O1HA 4HHHA 1HNYA 5IFPA 3G1XA 4WOQA 2C6QA 1GWJA 4QG9A 5KSWA 5LHEA 3UCQA 4TU1A 4UTFA 3ITTA 2XU2A 4W7UA 1GHRA 5DMNA 3GDRA 2H3DA 4PTNA 5FIPA 4MWAD 1SVDA 4J35A 1UWIA 2FZ8A 4PRRA 1X38A 4PULA 3W0KA 1KWGA 5M1TA 3RU6A 3TWBA 2RUSA 3P62A 3NQCA 3I4KA 3GHSA 2HE8A 4Y8EA 2ON3A 4Z2JA 1M68A 4JPGA 1E0VA 3PB2A 4F0HA 3M6DA 4DN1A 5I07A 1LQAA 2GYIA 3AUOA 3C4UA 2QPUA 2QUUA 1NF7A 5DO8A 2QPXA 1TWSA 4KFOA 2YKKA 4PUMA 1CW2A 1IEIA 3VM5A 3HPXA 3L4WA 3O6DA 4QJ1A 3T8LA 3IGSA 3Q67A 2NXGA 2WQDA 1W1TA 3E2QA 3VPLA 5E5CA 1GJWA 3PG8A 3RX2A 1JPIA 1F8IA 2VFEA 3G1VA 2BODX 2V68A 4F4RA 3OPSA 2XISA 4GGHA 1SR0A 3PAOA 1MEWA 3HZ3A 3W87A 1OK6A 1J5TA 3WUFA 1ZGDA 2QZRA 1NWTA 5LZLA 1R30A 2WMIB 2QCEA 3UG4A 4HA3A 4RNIA 4IICA 5A95A 1V3MA 3B05A 1OX5A 3W27A 2NX3A 1XRFA 3C8NA 2GOKA 4FAMA 3DOPA 5E6ZA 1TV5A 1IZJA 1F3XA 2I5IA 4O10A 3VA8A 4E2DA 3RG6A 1H62A 4WDXA 4S3KA 4DWSC 4XK2A 1QAPA 5D2WA 1AH0A 5MF5A 4PBEA 1FA2A 2R6OA 1FWRA 3NSMA 3LI0A 1KRCC 3TXVA 1B4EA 2PTDA 1UQZA 3NSNA 1TE6A 4RNJA 5AYIA 3NDZA 4EIVA 3GYCA 5G4HC 2VVSA 2PP0A 4BJHA 3UVIA 3A4WA 3DUGA 3ZQ9A 3VCNA 5D32A 2BWGA 3U3HA 3VC5A 4JTEA 3PFMA 2VCAA 5CBJA 1TWWA 4FF5A 2VZVA 3PTDA 4LS0A 1AMYA 2Z26A 1LP6A 4ZB5A 3PZVA 3ARTA 4XX6A 1BFNA 3NQDA 2Z1BA 4IOTA 1FH8A 2CCRA 3AS0A 3GXPA 5AKQA 1XQLA 1EPVA 4I6KA 2J88A 3V0TA 4JGDA 1UC5A 3Q45A 1US0A 5FEXA 1GVSA 2HBVA 1TMLA 3D47A 3N4EA 1LWJA 5CXPA 1JUBA 4DF0A 1QXLA 1EDQA 3OEXA 4IGMA 5F7UA 4UFIA 1VPXA 3LZ3A 3A9IA 1F6YA 1Q66A 4GC3A 4YYFA 4ZSUA 1MW0A 3AIVA 1ZTVA 3VGGA 3ARRA 3CYVA 1XKJA 3UR7A 4ACYA 5A8GA 3M0JA 1KRMA 1E71M 3W1LA 4V1YA 4OUEA 1E9YB 3PBUA 3H2OA 3SRDA 3P81A 3AXXA 3HG5A 3G1AA 4V15A 3GR7A 4KFPA 4UQDA 1K4HA 2D2HA 4YTQA 3UF9A 4UR9A 5A8QA 3S9YA 3LB0A 3NVDA 1V6VA 2NV2A 3O06A 1BGAA 2VFGA 3M47A 4L6OA 4DYEA 1H1YA 2JFEX 3UFYA 3UG3A 3B40A 1TJ1A 3W75A 3LXCA 5LHFA 4L7ZA 3R94A 1WB0A 2ESCA 3LV5A 1KM0A 3A21A 2BDQA 1QK2A 4FIRA 3UWYA 1S2WA 3GFYA 4WHBA 2D2GA 4QITA 4NAEB 3PZ9A 4EK7A 5RUBA 3TR9A 2FQIA 1S2TA 1DTNA 1A0CA 3ANVA 3B8SA 4IPPA 3R1ZA 3WFLA 2OKTA 5T26A 4C1NA 3AJXA 1Q6QA 5DT7A 3ITXA 3O8AA 4G1NA 3PC0A 2OMAA 1ZFJA 2DT3A 1V7YA 3U57A 2DUZA 2X0SA 1QOPA 2WNZA 2PBOA 1VFUA 3FX4A 1NIUA 3BPWA 2ZRYA 1KC7A 3TFCA 2J7BA 2QR6A 1CGYA 2VOTA 4JTAA 4CNNA 1VFTA 2Y7EA 1KCLA 2Y8KA 4DO7A 1OT2A 4DWSD 2VCCA 1CLXA 4L1GA 1W1YA 5IDIA 3BCFA 1K8ZA 4XWUA 1NELA 3HMJG 4H8NA 4UTLA 1DIOA 3ZS4A 2PWDA 1GEHA 4RDZA 2HZGA 3TJ4A 2EGZA 4I7VA 4HHPA 4OBSA 2AOSA 4BR1A 3M5XA 1TV3A 3KW3A 4LYQA 1W3KA 5LA1A 4QP0A 1L0PA 3SADA 3LHWA 3EX6A 3KBSA 1ICQA 1Q6RA 3C2VA 4IXHA 1PX4A 1LWHA 3KVLA 2YDQA 1KTCA 4O53A 5BROA 4D6CA 3U4FA 1P43A 1F3TA 3BH4A 3H8AA 1F76A 4K6AA 3S5NA 3HV9A 1B57A 3EX1A 2DY3A 2VOMA 5TD4A 1SO5A 2F6KA 3MMTA 5CBBA 5HNRA 3SQSA 2PDNA 5HJYA 3HPFA 2QUNA 4CQAA 1PKYA 3H55A 3VD9A 1VC4A 2OZ0A 3VOIA 3WF0A 3FEMA 2VUYA 2HPMA 4Z17A 2CHNA 5KZEA 1EIBA 1FUYA 4LX4A 3H12A 3WLLA 3E6EA 1Y5WA 1XPGA 1LRNA 1KCZA 3WH9A 1EFZA 4PCNA 5G1MA 1NJJA 2ZZ1A 4EWND 3NZGA 4JL1A 4LV4A 2GDUA 1UHVA 5FI8A 1M04A 1DHKA 2PCQA 4Q4KA 3HGJA 2DSZA 2BXVA 3C52A 2C1HA 3A64A 4PUUA 3NOYA 2KX9A 3O0FA 1YXDA 1WBJA 2Z2UA 2W92A 4O1CA 1T7LA 1C9WA 3VDAA 4Z1YA 1W91A 1ZB5A 1L2UA 4I9TA 1YTKA 1O7AA 3HF3A 3CU2A 1Y5VA 1ZY9A 3GVQA 2PU1A 1OD8A 4IFOA 3FAWA 3BK0A 4CN4A 3BAYA 3PB0A 2VO5A 3W1NA 5BU9A 5BXTA 3IUDA 4G7EA 4LCRA 1UA3A 2HS8A 1IXPA 3ORWA 2CW6A 4HK6A 5T8GA 3VINA 1K8CA 3KWSA 4E8CA 3VNKA 1OFOA 4X22A 4XBSA 4PMRA 3GVRA 4JTSA 1D8CA 4M0XA 4Q8TA 4AQLA 3KS6A 4EXBA 2PUZA 4NI3A 4AYSA 3EX3A 3QC3A 5I3KA 4LUTA 3ATZA 1RK5A 2R9RA 2BMBA 1XIEA 4V1XA 4GVHA 1PSCA 3LEPA 1MXSA 3BGJA 4EAYA 1FKXA 1KKOA 4CVUA 3DYPA 4QE4A 4C1LA 3O63A 3WF3A 1VFFA 1NEYA 3MZNA 3ZR5A 4KEZA 2ISFA 2FZDA 1FWGC 1X1NA 2XJ7A 3WDIA 5K3VA 4MWAC 2ACUA 3BLIA 5C54A 2NQZA 5IHRA 2PTYA 3ITGA 1MQQA 1TE1A 4HJWA 1YNPA 2JGYA 5HXMA 3WNLA 1UR2A 2ALDA 2DZXA 3CL7A 4AEOA 4DQWA 3W7MA 3DI0A 4R27A 1FCUA 2VJXA 5E9AA 3H70A 2QF8A 3ZSSA 3MW7A 3SY8A 1CX9A 4LS2A 1PTGA 3UVAA 2DSKA 1GQLA 3BG5A 2JKEA 3SBFA 1UYQA 2PTZA 2DGAA 3RNDA 2V2DA 4JTUA 3UA3A 3T9PA 3PR2A 3NAVA 4Q32A 3EBVA 3ID7A 1IEWA 2J74A 2ZZ5A 1JD9A 3H26A 2I17A 3EXSA 2Q02A 3E12A 4I8YA 4QHRA 3L2IA 2CBVA 2DZSA 4AB4A 2IQ0A 2VGFA 4M5PA 2Y0FA 4IPIA 5JXQA 3LQLA 1WP6A 5KMYA 2JEQA 2WVUA 2JGQA 4LUSA 3TJLA 1R0MA 2QJHA 5CBIA 4ACZB 1UD2A 1AODA 4GYKA 3G2GA 3NXFA 4UTKA 4UZUA 4RR4A 5AC6A 1H7WA 1UP3A 1JQVA 1TPH1 3DFSA 3T05A 3UWUA 3BOXA 4D8LA 4PCTA 4GH3A 4FSAA 1HL2A 2HV5A 3ZVHA 4K37A 3K5XA 2BGQA 2QCCA 2FTWA 3MUCA 3ITLA 5FACA 2GFTA 2YJQA 2AAAA 3TVAA 5IBXA 3TTQA 1FWBC 2GGEA 2E4TA 1E4MM 2ZZ6A 4LANA 1R3VA 3WDRA 2XIIA 2UY5A 4NRSA 1QPRA 4UFJA 3ITVA 3VAVA 3NQEA 2YXOA 5LGZA 3RX4A 3DBNA 4I8DA 2HK0A 1D8WA 2PFHA 2Z25A 3TN4A 2G95A 3SJ3A 3REQB 3E0LA 4Q8WA 4W88A 5BW6A 3A4XA 3BAJA 1W9VA 4WKFA 3N34A 3DC0A 3N11A 1HP5A 3AMDA 4KEVA 3UXIA 3VZXA 4XZMX 5D04C 5REQA 2J9ZA 2HBXA 4RXFA 3QW3A 2VXNA 1OCBA 3L5LA 4LUSB 1UWUA 2DZWA 4PBFA 3H2MA 3RFAA 2PU0A 5E0FA 5J5DA 3EDEA 3N9KA 3QMTA 4HQVA 2X41A 3TSMA 2VMFA 3IS4A 4KF1A 3U2OA 1E0XA 4P7RA 1VIWA 4B5TA 4XZLX 4B2DA 1KQYA 2XHYA 3VC6A 4GA8A 3WO8A 2ATMA 2QDDA 2VGGA 2NV1A 3G1FA 4RPQA 4XAPA 4D6FA 5CG7A 3TC6A 5T91A 3NQ8A 4QJ4B 5HUOA 2OU4A 1CXLA 4HNCA 3AICA 2OQYA 4LVAA 4OJYA 1NY1A 1J4EA 4UTTA 1ELSA 1EBGA 4U31A 1ITUA 2BOFX 3HO8A 4CNUA 1KFJA 3A3WA 2QUTA 6XIMA 4NZFA 3Q4DA 4WRHA 4GIAA 4LAMA 2E6FA 3Q65A 1AW5A 3EYPA 2RDXA 2CXGA 1U83A 1EA9C 2XIMA 1TRDA 4NZCA 4S3AA 3VIOA 4RPPA 4O0ZA 3L65A 4UOZA 3QGVA 5CKSA 1WO2A 4FB7A 1P7TB 3O3RA 3W26A 2HNEA 4Y90A 4DYKA 1W1IE 4B3LA 2A2IA 2HMCA 4JXCA 4DNMA 3SUSA 5H8MA 2PRHA 3VGFA 3VK5A 3NPWA 1DQXA 4H00A 4EAMA 4LFYA 2YA1A 1WUFA 2GVYA 1HG3A 2ZZ4A 4DBUA 3NDYA 4JNZA 5EGRA 1CXIA 1RD6A 4LAOA 3S47A 3N2MA 2J25A 2YCLA 1G0CA 4JFWA 5CG0A 3P93A 1WOBA 3T0DA 3LY0A 4W87A 3SM0A 3GD6A 2QULA 4PTVA 2DW6A 3WEMA 4L65A 3LLFA 4PUNA 4JIQA 3C2YA 3KZPA 1VF8A 3LA4A 1EF2A 1RY8A 4MADA 1E9LA 4TVCA 1OFPA 1MFVA 1S2UA 4QEHA 1R3YA 3TAKA 1OHLA 1H7PA 4ICMA 3FHQA 1F7BA 2X8RA 3GWQA 1CGTA 4BWLA 2J78A 1W9UA 4PBGA 4AY8A 1WDQA 1B9BA 1UROA 4US6A 5DT5A 4LGXA 2YCIX 3UJEA 3MUXA 1CGXA 1QK0A 1HJQA 2XDFA 1HTIA 2HPIA 1KQZA 2V30A 4RUBA 3BC9A 2GGIA 4H8VA 4MZ8A 3MUZ1 4AAJA 3B0VC 2FFCA 4BI6A 4KCTA 1ONRA 3IVTA 3EWYA 1FHUA 2BLEA 2A6LA 4M81A 5LYRA 3PUEA 3W6LA 5I77A 2P3ZA 3MQTA 2ISSA 4GC4A 4LRTA 3S2LA 4LB4A 5DBTA 1Y8BA 2PC4A 2W6RA 4GYPA 3UJFA 2OKOA 3CZKA 4OBRA 5HANA 4MWAB 3DBPA 1AMKA 2NUWA 3PJUA 1QHOA 3B9AA 4HMDA 3UZ5A 2J7GA 1C3FA 3HQOA 2PWFA 4PEEA 2O9TA 3VIIA 4RW3A 3N25A 6PTDA 3LERA 4I5UA 1ECQA 1JRCA 4F2TA 4CU7A 4B2DD 4Q8VA 3DFTA 4N6EA 1JI1A 4TV5A 3AUJA 4GLEA 4POCA 1WDSA 3B4UA 1A80A 1BEUA 1SSDA 3ES8A 5BCAA 3TTEA 3FJLA 1UJPA 4QLLA 3CM4A 2JQXA 3M07A 2PEVA 1YDVA 2VCBA 1LDCA 4J3UA 1TX2A 2P0OA 1DWIM 5PTDA 4YHGA 4AZ5A 4AWTA 1ADDA 1A3HA 1X6UA 3GYEA 3ALGA 3FYPA 4MYAA 2B4GA 4DNHA 2P8CA 1GKRA 3CH9A 3VNZA 1BAGA 1C93A 3AYSA 3ZYZA 4GXWA 2V5LA 3WBWA 4Q4SA 2FVLA 1RCXB 4D6HA 3VCCA 4Q22A 3JR2A 2TSYA 2O92A 1NFBA 1Y5XA 1XF0A 1UPPA 4H41A 1DPMA 3DFYA 3KCLA 4G7FA 1DJXA 1XUZA 4DBEA 1TG7A 4CNTA 3WIJA 4ZBCA 4IG2B 1E51A 7CGTA 2A3AA 3UGVA 4C91A 2Q3RA 1LORA 4JTKA 2QLYA 4PRTA 2FMNA 4HHMA 1K8YA 3DGRA 1Z42A 3DFQA 3SUVA 3SW6A 2DUAA 4BK9A 1XRTA 3FOKA 1QR7A 3NQ6A 1TV2A 2F6XA 3CL6A 3BL3A 5FF3A 4ADSA 1AFSA 3FFSA 4YL2A 5FL0A 1LBFA 4QGCA 2WZHA 3LXBA 1A47A 4AUBA 4MVAA 4FLQA 2YDSA 2G96A 4LVGA 4O11A 3RPDA 5SWUA 5HNNA 1R2RA 3JUGA 3N2XA 5JIWA 2CKRA 4MAZA 3AZTA 1MEHA 4FF7A 3VGHA 1YMYA 3QR3A 1C7TA 2G3MA 1XIMA 4RNFA 4N9DA 2XVGA 2PGWA 2DT0A 3BMVA 3BAWA 4FLRA 4FXJA 2FIQA 5CC7A 3PWAA 1BWLA 1J12A 1VFOA 1VCFA 3SI9A 2GVLA 2Y7GA 3IAPA 5GNXA 3N6HA 3NGJA 2DV0A 2ZX5A 3S1GA 3P5YA 4WKAA 1WA3A 3DH7A 4GPNA 3K4WA 1NOUA 1LLWA 2A79A 1C8YA 1TV7A 2GGHA 2A3HA 1AVAA 3GDBA 3G0XA 4PMJA 2ZXDA 4KWOA 2RGLA 4P8VA 4FOKA 5CC6A 3WLMA 1JPDX 5I3IA 4U5IA 1R7AA 3PULA 2TMDA 3KHJA 1NDWA 5AZ0A 3QKEA 2UY2A 1PWMA 2PSNA 3GR4A 4U28A 3RM8A 3DG7A 1OK4A 1J6PA 5HA7A 3IGXA 3CQ0A 3B8DA 2VEMA 3K8MA 5FJOA 4QLKA 9CGTA 4NJJA 4MB5A 5AHLA 3DYOA 3TYEA 2XUCA 3V1PA 2J7CA 2VEPA 3MYOA 2E0PA 1EGZA 2GUUA 4HPGA 2ZUTA 1EBHA 5CC5A 4RZ4A 4JCMA 3LGGA 2POZA 3AJ7A 4PUDA 2DH2A 3VD5A 3CK5A 5C2GA 4MNJA 3NZPA 1F74A 3EPMA 4EF9A 4D8AA 2YPIA 3LHUA 1FBAA 4A8NA 1W1A1 2OB3A 1E6RA 1VYSX 1N55A 1S3HA 4GCAA 1A5NC 1UMLA 4KBXA 4LTSA 4HZMA 5I78A 2YCKX 1Q85A 4ATLA 3G0UA 2Z27A 3FVDA 3OA3A 4P2VA 2GUBA 1QWGA 3ANUA 4HU8A 2HVMA 4NZ4A 4B4HA 4LCQA 3GTNA 3KCOA 3VOCA 2DT2A 3BLEA 3MU7A 2GPTA 3LPFA 2WC4A 4HBKA 3M16A 4AH7A 1JCLA 1CDGA 1DP0A 2ZICA 2FFIA 4XSLA 1PVNA 5C9UA 4F2BA 1TTQA 4DJEA 3ARWA 4IGNA 3I7QA 3TA9A 3RRXA 1XLJA 3VDHA 2A1YA 3OZOA 3TKFA 1O94A 3CV2A 4DEFA 1XWYA 3MT1A 4LYRA 4CCDA 3GNOA 2WYSA 3GBDA 1PDZA 2XSXA 5FJPA 4EPEC 3LCIA 4IPJA 2OELA 5HULA 2VR4A 4LU0A 1UR9A 1ZP3A 1AW2A 1EKOA 4REQA 5CCZA 3MTWA 2WCGA 5EMJA 1DJQA 1E6PA 4ZA0A 2ADAA 3MP4A 4DAFA 3NA8A 1ZP4A 2X1TA 4MPQA 2JIWA 2PDLA 3PHAA 2IXUA 3B0YA 2WMKA 4FEZA 1O6IA 4AIUA 3SN0A 3GNDA 5HNTA 1IHIA 1ZJAA 3VFCA 4QNEA 2X7VA 3BV7A 1ZAIA 3HQ1A 1V0KA 1F3EA 1EX1A 2PLKA 3VKBA 2CZEA 3W2KA 4P7NA 3L2LA 2B81A 1I2PA 5E93A 5CSYA 3TLLA 2DJXA 2W27A 1HW6A 5FJUA 4J28A 2XZ7A 4O17A 4IMAA 1VAHA 2PD5A 4LUIA 4R3UA 4DVOA 2PGRA 4QJ3B 3BMWA 1FP8A 3FA5A 4FNUA 4E8DA 1K8XA 1LJYA 4WK9A 2C13A 3STEA 3QMRA 2W66A 1OVDA 2XN2A 3SSZA 5ABEA 1T8XA 3WY1A 2OEJA 3THQA 3K2GA 3PZGA 5TQLA 2X2YA 1XG3A 3GVWA 5BRQA 1EP1A 1FHDA 4J9JA 4P8WA 1FX6A 4JFUA 3E38A 1IF2A 3E5BA 3SJNA 3EDFA 1WDPA 3BGAA 2REQA 1LLOA 3ALFA 5MHBA 1XXXA 3CQKA 3GHRA 3C3UA 1NQKA 2ZRUA 4N9CA 3RK8A 1DWGM 4G7EB 4AIEA 4LAUA 4ENLA 5GPRA 2QF7A 1JZ3A 3R58A 4B9ZA 1VBGA 4OKDA 1CIUA 2XIOA 1J79A 3A3XA 3M0XA 4GKTA 4QAWA 3GW0A 2NUXA 4WJEA 1Q7MA 3P0XA 3O6AA 5DRIA 1NF0A 3W1QA 2YLAA 3SCPA 3ZWTA 1XGZA 2P8BA 4LSBA 1TPWA 3MB9A 3S5SA 2EHHA 3PZMA 3ZSTA 2E9LA 3UCCA 4P7QA 1SQ7A 4O1BA 3FJNA 5U7SA 2ZX6A 3W70A 1QO5A 5I23A 3FKKA 2WZMA 2CIPA 1B90A 2CERA 1F6KA 3M43A 3LPOA 1IEQA 2OJPA 5K2ZA 3S5OA 2J6XA 2C1IA 3O1NA 1XC6A 2AKZA 2VX6A 3BVJA 2X2GA 3E96A 1M01A 1V3HA 1K9FA 1AJZA 4QNWA 3NEVA 1JF6A 2F84A 3H22A 3DHPA 3H4WA 1W2PA 4FXRA 1J2WA 2X1UA 1MZRA 3CHDA 5E6YA 4F79A 1CNVA 4XV0A 1K02A 2WJFA 5B7YA 1X39A 3IIZA 2GJXA 4JTTA 3W1XA 2E8YA 4ZQMA 2B7NA 3L7RA 4MMWA 2W79A 5CC3A 3TW9A 3LX9A 2AGTA 5A6SA 4NXKA 5HBFA 4LEFA 1IEVA 1FWFC 2E9MA 1NOFA 7TIMA 1XV8A 4DXVA 1KXVA 3C2OA 4OHQA 4OOUA 1OYBA 4A8LA 1RLDA 5CPLA 3JS3A 3S9IA 1YBQA 2R14A 5LNRA 3T2PA 4L4PA 3FW6A 1DYSA 2EPLX 1G7VA 5D2VA 2ATSA 3A13A 4O1FA 4UZSA 3BLPX 5I3JA 2BVDA 3QY6A 2Y63A 3CJPA 2CXEA 3P6LA 4HSOA 4UTWA 5EB8A 1E1EA 1S5MA 3F4DA 1FVPA 3RPMA 3WLPA 3UBPC 1TTJA 1VFHA 3WNNA 4IWWA 3CS2A 4Y9OA 2EPMX 4AEFA 1GQNA 3JRKA 2HRWA 4DELA 3VIJA 3K1GA 3MV01 4W8BA 3UWQA 4G6CA 4L5ZA 2FTPA 5A6JA 1XGDA 1RVKA 1A3WA 4XZBA 3EXRA 1NSJA 1VS1A 1S5NA 1KBBA 2J9XA 1OINA 4JTFA 2G4JA 5C8BB 2G3NA 3QR0A 1MRAA 1KNWA 3XISA 2B7OA 1I0DA 4G1KA 4WEVX 4YNGA 3REQA 3MJYA 1RK6A 1TWZA 4BFAA 1PHWA 3DN5A 2BS9A 3GFZA 2DVTA 3MSRA 4TVUA 4ONVA 3FCPA 4I9JA 4IIEA 3GIYA 1OC5A 4JYDA 3W1AA 3CGTA 4PMDA 1EUNA 4S38A 4E0CA 3QMSA 3AXIA 5C9XA 3N29A 4XZ9A 4J3VA 1CGUA 3P2VA 4NP7A 4DJDC 4U4MA 3MANA 3WBYA 1TPEA 4FLSA 3QR1A 4WY0B 1ZLPA 4IMDA 3KOXA 3EWDA 3TFXA 3CV6A 4ZQOA 4M6UA 1CGVA 3KBVA 4NQ1A 5AFDA 4WXYA 4M6PA 1VD6A 4J5NA 4HMEA 3NL2A 3A47A 1F5ZA 1JZ7A 4LBUA 1Z6KA 4ZQPA 2C19A 1XYAA 3LCGA 4KH2A 1G94A 1XBZA 3KWXA 3RLVA 3KOYA 3K8LA 1R47A 4PGLA 3TTSA 3BLKA 2WKGA 1C8XA 1MXDA 4AZCA 2X1IA 3BICA 3WF4A 1QFEA 4HU0A 4O14A 2ALRA 2ZUVA 1EDTA 3URNA 5A8OA 2ASHA 2BSLA 4KQNA 4HNVA 1OZMA 3M0IA 2HEJA 3INPA 4F0LA 1VZWA 5IBXC 2O9OA 4S3CA 4ZE4A 1R3WA 1AL7A 4YVPA 4Q4PA 7PTDA 5G2WA 3RCMA 4XAFA 3HURA 1E6ZA 2Q71A 1GPFA 1J18A 1QI2A 3NQBA 1ISXA 4LBSA 3G8EA 3SUUA 3BJTA 3MUIA 5AYBA 3TN6A 4WQ6A 2I57A 5IRPA 3WK0A 4HHLA 2OO0A 2Q8LA 1J11A 5CJ5A 4IL2A 1VEOA 3UT0A 4AX7A 1EEXA 3F1QA 4AZBA 5LIWX 5LIXX 4RXGA 1CEOA 3HPAA 3WK2A 3Q58A 3GIPA 1US3A 2AQVA 1P0EA 3IRSA 4GK8A 4ILSA 1K1DA 2A21A 3MMUA 4O0QA 4US5A 3MHFA 3LCWA 1RA0A 1UD6A 4AD3A 4KEUA 5AOUA 1ZNNA 1GORA 4XTDA 4EF8A 1VEPA 1RALA 2BGNE 5C55A 2XH7A 1XBYA 1KXTA 3SCWA 3QPEA 3T4CA 4IH3A 6TIMA 2ZOXA 1RBLA 4WY0A 1A0DA 3RUBL 3NXLA 3XIMA 3U5YA 1WKDA 1GYLA 2CC0A 1XLAA 1VKFA 2ISVA 3T55A 8RUCA 1RCOB 1H7OA 5AHMA 2X42A 2PMQA 4CU6A 4JTDA 1DTUA 3QOKA 1H7XA 1I60A 3OGRA 2YL5A 1MDRA 2A7NA 2GK1B 3L12A 3N6QA 4AG0A 4LC6A 2PDBA 3HJEA 1TCMA 1QI4A 3OA5A 4L6DA 4M82A 2Z4GA 1RQBA 3RCYA 4C6JA 2PTWA 2IW0A 3KVMA 1LYXA 1T41A 4QBXA 2OTDA 3O15A 1JFHA 2YFNA 4F66A 4JEQA 1FDYA 1NAL1 1VQTA 4WY0F 4DJDD 2XH0A 2VENA 3KDNA 1EJSC 1Q6GA 3UZXA 3D5HA 1GZGA 3QLLA 3QPYA 1NFPA 4J27A 3B8TA 1GJPA 1GOIA 3BCJA 4MJZA 4RZ5A 5CSRA 1E15A 1X98A 3AIBA 1IEXA 3PNZA 3MDWA 4ZCWA 3V16A 5A6KA 2FHFA 2D24A 2VDHA 3R6IA 1W8SA 2C71A 3W88A 1E4IA 3DX5A 1TYGA 2IPFA 4Q6XA 1PTAA 3KDOA 3HFYA 3MUAA 1AD4A 3NYDA 4JHZA 4GZJA 4JN7A 4QSHA 4GMEA 5C9WA 3T44A 3WN6A 5LIYX 1QJWA 2FPTA 3EWZA 1PX8A 1PHQA 4FA3A 2J8GA 4X61A 3R13A 3HQNA 1W3JA 3R2GA 1SR9A 4D71A 2XSAA 3M9YA 4MFEA 2E77A 2V5KA 4GFIA 4HPJA 5CGTA 3MKKA 2CZDA 2C15A 3MV11 1EJTC 2NXIA 3DERA 1FRBA 3RRAA 1XYCA 3OQEA 5DBUA 1BYBA 1PIIA 4B5NA 3P67A 1Q2SA 2OLHA 3YPIA 4I3GA 4QIUA 3M5ZA 3VD3A 5HR6A 1BRLB 1F9CA 2YL9A 4O54A 4AHQA 4UIOA 2DSVA 1H5VA 3KZSA 2QT3A 3A12A 3F2BA 1OADA 3PFRA 4JTQA 1HO4A 1XG4A 3OODA 3MUY1 1EA0A 3FK4A 4DO5A 4KGJA 1IIGA 1OIMA 3EEGA 4UFKA 1MQPA 4GABA 2WAGA 5CGMA 4JQ3A 5FF2A 5BMWA 2Y8UA 3H7RA 1JZ4A 4E38A 3CWNA 1V6UA 3QZEA 3RLUA 4NI8A 1QATA 1ENUA 3U2EA 1CCWB 4BI7A 4RDVA 4FX8A 3HA1A 5BXSA 2VI0A 2WJEA 4GNVA 4MJ4A 2PBGA 3S3GA 2YBUA 4H6EA 3TN5A 4P7LA 1BSIA 2ZYFA 3CBWA 1VCGA 2WM1A 2F2KA 5KEZA 4MIMA 3DGBA 3KBNA 1ZENA 3GNPA 1E5NA 5K4ZA 5IOBA 1VJIA 5HWNA 3F2CA 4MJ2A 4IGHA 3L9CA 3T40A 4EVZA 5TNVA 3RMJA 3UG5A 3BCDA 4GX8A 2Z7GA 1CLKA 4PTMA 4FHAA 2Z28A 3CQJA 4XVEA 1HXJA 5DMMA 3I7RA 3KE0A 4GI6A 1BXCA 4GBDA 3U2ZA 1CXKA 2VUNA 1UKTA 1PYMA 4DJFD 3W37A 2QKFA 2V5CA 2PTXA 4N4PA 1V3IA 3GTHA 1FWDC 4K68A 4H9TA 4GI4A 4AIBA 3T0BA 2PAJA 3OVRA 2ZVRA 1UP2A 1W3TA 1SPQA 3VCRA 1WDWA 3EA2A 3UA4A 4UBPC 1GW1A 3GS6A 3LDVA 4BI5A 3TMLA 4OWGA 2R1PA 4RE2A 3H2EA 2YW3A 1H11A 3GKFA 3WLRA 4NNAA 1E40A 2H8XA 1B30A 3QQ0A 4YS1A 3UW6A 1ZBCA 3UGRA 2O56A 4U3CA 1J0ZA 2Y62A 1HKWA 3QY7A 3CZLA 4ML9A 1MI3A 2MANA 4HMCA 1OGSA 4HYRA 3DI1A 2FB2A 1ISWA 1QBBA 1W3NA 3TC3A 3T1GA 3V18A 3UCDA 2YL6A 1PUDA 3WQOA 4Q8OA 1HP4A 4GYFA 3IJIA 2YB4A 1DWAM 2CBIA 1RD5A 3VUPA 3RITA 2A5HA 4JQ1A 3UETA 2A3BA 4PSPA 1HL9A 1XSJA 4KRZA 4H6QA 3GB6A 3I6RA 4IFRA 4G56A 2ACRA 4RX0A 3RXZA 3WBAA 3SR7A 1QBAA 4BQ5A 2YBTA 3GH5A 1ZJHA 2EPKX 2VGIA 4Q7IA 4DHGA 2P76A 4XUYA 3APGA 1UH3A 3CAVA 1Z8AA 1SZEA 2WOQA 1JD7A 3QZ6A 3RPTA 2GVGA 4HPNA 1KTNA 4HK7A 4Q4OA 3TNOA 4BF7A 1C8VA 1K6AA 2X30A 5AYYA 2OWCA 1WXYA 1EDGA 4DWDA 2VM8A 4RV3A 2V3GA 3G22A 1EOKA 3U7BA 3UESA 4XKYB 3NSXA 4NHVA 1LUCB 3WMSA 3BV4A 2V3EA 2WKJA 3W7DA 3R10A 1NWRA 2Z6JA 3EWUA 4HNOA 3KRSA 3RIKA 1NWSA 3WL1A 3KEHA 4Z2HA 1V3JA 5A3HA 4J3XA 1THFD 5DY2A 4YPJA 1UC4A 1IWBA 4G9PA 5CQ1A 3BARA 2D73A 5E09A 4YTSA 3MSYA 3EPNA 1YE6A 4R88A 4M6VA 1OFAA 4C5ZA 1SFJA 2R24A 2QCNA 2CLOA 4XB3A 4DO6A 2HCVA 2PB1A 3W7JA 4GD0A 3H4GA 1IT0A 1RR2A 3NYZA 1A5OC 1KFWA 4DZHA 1C8QA 1ZJIA 1YLVA 2NLYA 4DM2A 4XKMA 3N18A 2VFDA 2VC9A 4Z2GA 4AD0A 3UPBA 1XW8A 2ZA3A 1JAKA 3H2AA 1BWVA 2F7FA 2YZRA 4ERGA 4X63A 3P61A 1U30A 3WSUA 4EPBC 5F2LA 3LK6A 1W5MA 2WQPA 3LN3A 5EY5A 4GACA 4AC7C 2Q09A 3WLJA 1SJAA 3ZR6A 4F0MA 3W00A 4HOXA 3W01A 2LLEA 3KOWA 4JYEA 1AQMA 4TMCA 2IPJA 1GZJA 1XKYA 2G3FA 3S4TA 1V93A 5I00A 5DLCA 4W5ZA 1BHGA 3TQKA 2GZXA 5JVLA 4B91A 3GSMA 1EJUC 2QVNA 4UMBA 1IXNA 2OR2A 4TX9A 3TROA 4PMNA 1PAMA 4AZIA 3WQVA 2E7FA 1Q45A 3GDLA 1HKMA 4QRNA 3SIZA 3VTRA 3TCSA 4ZZ9A 4H6RA 3S1UA 4NYUA 3ZZ1A 3M1ZA 1QI3A 4LRSA 1QI5A 5F2IA 2ZE0A 3WUBA 4WDWA 3P7YA 1YXYA 4PMZA 3MCMA 1L6SA 2F9RA 1EOMA 3WBEA 1YDOA 4DWSB 3WQ6A 4DPQA 1XRVA 3GK0A 3W7EA 3ERPA 3BJFA 3MP3A 3KP0A 3EKGA 4MZYA 4W9TA 5AZ1A 1QNVA 2PD9A 1REQB 2I1OA 1O5XA 3R0UA 2ICSA 2QNEA 1GQKA 1TPUA 4ALDA 3LM3A 4LVBA 4Q7BA 3I4EA 3RCNA 4NIRA 1EXPA 1HQTA 3GG1A 3VDGA 4L61A 1E1CA 2Z29A 4TVDA 1I4NA 1VR6A 4OU1A 3JZUA 3PBWA 3VI2A 1CENA 1H49A 3CQIA 3CL8A 2Z6IA 1QPQA 3LMZA 3TW7A 5DF0A 3B9NA 1W0MA 2V82A 2NX1A 3ZVHB 4HCHA 1M1BA 3G3MA 1GKQA 5KITA 4YTUA 1PZ0A 1R9YA 4NJKA 1DE5A 4TTGA 2PGFA 1WNOA 5G2IA 1XYFA 4WOZA 1VIZA 3CB3A 1IGSA 4Y96A 1HKIA 1SZFA 1YBQB 2C3ZA 2YB1A 4B5XA 3BANA 3UZZA 1JXKA 5GJMA 3W9ZA 1ZBKA 2WCSA 3NURA 3WDPP 3E2SA 1YRRA 3R0DA 3M7SA 1CWYA 3OHMB 3RX3A 4OBTA 1O95A 2QDEA 4RZ6A 3VD7A 3SUTA 5D03A 1TA3A 2BY1A 4E2OA 2QIIA 1TB3A 2FMOA 4ORIA 3V1HA 1JDFA 1W9BM 2YXGA 4WKHA 2WSPA 2VDIA 3WQPA 1KFLA 4GZIA 1EJVC 3WK3A 1WOAA 5XIMA 3ISIX 2TYSA 3A24A 1QPNA 2FB3A 3E0IA 3UWVA 2VQUA 3P82A 1BG4A 1EC9A 1KA9F 2VFHA 5FSDC 3LPPA 2VHLA 2FZ9A 1U33A 3WMCA 4O8RA 1B3XA 2EJAA 5A6MA 1RJQA 4JY8A 2PWGA 3WLHA 5F1VA 4ZQNA 1TJ0A 3O2LA 2DU2A 4JQAA 1WKFA 3OZMA 2V2HA 3TAOA 3F4WA 3OQ8A 1EB3A 4NL1A 3SEPA 3EMZA 1K03A 1GVIA 3OGVA 4CNSA 1P0DA 3AXMA 1LBLA 1YADA 4UOJA 1KM4A 3AHYA 2QHAA 2C14A 4MKVA 4UTIA 2CLMA 1OX4A 4CCCA 2RJHA 4QQUA 4ATWA 3WJYA 4O16A 3GW3A 1MUCA 1UKSA 2XH2A 2E5DA 3DFOA 3E2VA 2V81A 3OLGA 1WV2A 3PBMA 1HKVA 4HNLA 3DXIA 5D2XA 1F05A 3GAKA 1P0NA 1HL8A 4AIOA 1UKQA 4K8EA 5LXEA 4KCWA 1LRTA 3TH6A 3MWAA 4UQ9A 3V35A 3N1AA 5IM51 3R79A 2ZXBA 1XI3A 1DIEA 2QEZA 4MNMA 5DFAA 5FESA 3L4UA 4CN6A 1I8JA 3KCJA 3RGTA 4OE7A 1JCMP 2I7GA 5I09A 3OYXA 4D9PA 3USBA 1EX5A 1IV8A 3UEQA 1KBJA 4Q8NA 4HOWA 4WSKA 4FLOA 4L4LA 2Q8XA 1XDJA 4JIRA 4LF2A 3PN8A 1VYRA 3K13A 3MO4A 4FP1A 1B3WA 4AF0A 5C2XA 1AD1A 3FGCA 2Q3OA 4GVFA 1TUFA 2DFAA 1E6XM 3II1A 2Z24A 2Z2AA 3LUTA 1BD0A 3OGSA 4XAGA 4PMQA 5HJXA 3DKJA 2D69A 2Y61A 1R3QA 1V6XA 1MRQA 1TPDA 1FWTA 2XFWA 3MZ2A 3RM4A 2DZUA 3L4YA 4K1GA 3H53A 2JKAA 4ZEPA 2QS8A 1FDJA 3AMCA 4RDYA 4J3SA 4NT0A 4B16A 4MLRA 2J6VA 4GOAA 1E70M 1UOZA 2NQLA 1FCVA 4AX6A 4IF2A 2POTA 2JK2A 3SN1A 5JH2A 4KWSA 3DFPA 4ORMA 2NLIA 4NNBA 3KX6A 2O4QA 3P8IA 2Y1HA 3OIHA 3UJRA 3VIMA 4ZO7A 3BZGA 1TREA 3IAQA 2DZPA 4RZBA 5G1YA 1UR0A 3BMXA 1DXEA 3L68A 2VT0A 5IHSA 3BG3A 4B5SA 5AN7A 1XGEA 2WHJA 2ISDA 2PDUA 1D2KA 4XZHA 1JCYA 2DP3A 4IGSA 5LXXA 1Q3NA 2XVKA 2E3ZA 4MDPA 4AVOA 4EWJA 3IJQA 5TAOA 4WSHA 3APYA 3EA1A 3QRHA 4J3TA 1S1RA 1W5PA 4I7UA 5CEWA 1TMQA 3PTKA 1DJHA 1LOLA 4RE0A 3WCZA 5AHEA 2DQXA 2OGYA 2VC6A 1XJBA 2ZA2A 1AG1O 3G1YA 1TZ7A 5AY7A 2BBFA 3CHVA 3GC5A 4TMBA 5HR7A 3IGHX 1J9YA 3EKLA 4GGBA 1C91A 3E2RA 1Z41A 2ZFAA 3CIVA 3W7CA 4QG8A 4AY1A 3ZMRA 3CO4A 2QCHA 1J01A 4PSRA 1XSIA 2XIBA 3BLOA 1KWKA 2VEFA 1Y65A 3T81A 5CPNA 3FEQA 4OFCA 1TV4A 1PS9A 4A22A 1L9WA 3QBUA 3ITOA 3SY1A 4MKNA 3TC7A 1RJPA 2JIEA 3ARZA 5HQMA 4C7DA 4IFKA 4PH6A 4YVXA 3Q94A 1A5MC 3TONA 1E6QM 1RVGA 3MSDA 2I16A 3VKDA 3PZOA 1IQ8A 3L0GA 3CH0A 3CT7A 3VDCA 5FJRA 1U1JA 3WEZA 1Q65A 2WPGA 3A5FA 5EFDA 1XLBA 5T9CE 4PCPA 1GOKA 3Q37A 1Z32X 2OX1A 7REQB 4NUWA 1M7PA 3PBGA 2XYLA 2Z1SA 4JKLA 4UWMA 2VZTA 2J8FA 3OW1A 5GJPA 3UP8A 3C8FA 1YPIA 4N7QA 2E68A 1OGBA 5LIUX 1L6GA 2GWGA 4Y7EA 1ALDA 4H83A 5FSEC 5D37A 1KV5A 1J0KA 2QGHA 4C1KA 1WCGA 2EKCA 4Z08A 4ZO8A 3EWBX 1GPWA 1G01A 2OPJA 4HU4A 2Y2WA 3UPWA 1SUXA 5TF0A 1KM1A 3KL3A 2NV9A 3VKKA 3CV7A 2NW0A 4I90A 2TODA 2ZC8A 1UBSA 1XM3A 1S5VA 3GQYA 1W9PA 1A5LC 4H2CA 2BY3A 3MSGA 4WUIA 4O0KA 1LUCA 1OY0A 1SZGA 3W7HA 4Y6GA 1W5NA 4JN8A 5CZKA 2GWNA 3QV8A 4IJBA 2NXHA 2ZADA 2REQB 4FX6M 3FA3A 4UMAA 4LNYA 2G37A 3QJAA 4QS5A 3HGSA 1TJ2A 3HG3A 3UY8A 4GXPA 2V3DA 3C0LA 3M5YA 1CTNA 4TV6A 1JDCA 4HGXA 3VOHA 6TAAA 3CTLA 1KKRA 1AUSL 4GBUA 3KRBA 4DM1A 4JX6A 4GXMA 3APTA 5F2GA 1O4UA 2BVTA 2VQTA 3S2MA 4EXQA 1FTXA 1C92A 1EUAA 1KFEA 1RPKA 5DY3A 4U5KA 4FR1A 1HX0A 1GJUA 2XFRA 2QV5A 3QEZA 4BWLC 1DJZA 2D0GA 4GINA 3W7GA 3E3HA 1W3HA 1UUOA 1HKJA 2A3LA 3PS7A 1GOOA 3N2CA 4EX4A 1B3VA 2INFA 4A2SA 3KXQA 4KIRA 4XO6A 1CBGA 1DJYA 3AHZA 4M6QA 4FPSA 1UD4A 2GL5A 1Q7QA 3WKZA 3PJWA 1L2QA 3L4TA 3H7VA 3PNUA 4FNQA 3VE7A 4V27A 4XAZA 5A6BD 4O8AA 4QCFA 3HU7A 1MUMA 4YJ5A 4PL2A 1LL6A 3L4XA 3ABOA 2VFIA 1UZDA 2HROA 1R46A 5CJNA 2DQWA 4PMVA 3EMCA 1Q4NX 3VIFA 2ONEA 3HFTA 3W2LA 2XWDA 1JEZA