3SUTA

Crystal structure of beta-hexosaminidase from paenibacillus sp. ts12 in complex with pugnac
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
519
structure length
504
Chain Sequence
HHHHSSGLVPRGSHMSQPSILPKPVSYTVGSGQFVLTKNASIFVAGNNVGETDELFNIGQALAKKLNASTGYTISVVKSNQPTAGSIYLTTVGGNAALGNEGYDLITTSNQVTLTANKPEGVFRGNQTLLQLLPAGIEKNTVVSGVQWVIPHSNISDKPEYEYRGLMLDVARHFFTVDEVKRQIDLASQYKINKFHMHLSDDQGWRIEIKSWPDLIEIGSKGQVGGGPGGYYTQEQFKDIVSYAAERYIEVIPEIDMPGHTNAALASYGELNPDGKRKAMRTDTAVGYSTLMPRAEITYQFVEDVISELAAISPSPYIHLGGDESNATSAADYDYFFGRVTAIANSYGKKVVGWDPSDTSSGATSDSVLQNWTCSASTGTAAKAKGMKVIVSPANAYLDMKYYSDSPIGLQWRGFVNTNRAYNWDPTDCIKGANIYGVESTLWTETFVTQDHLDYMLYPKLLSNAEVGWTARGDRNWDDFKERLIEHTPRLQNKGIKFFADPIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Beta-hexosaminidase
publication title Gaining insight into the inhibition of glycoside hydrolase family 20 exo-beta-N-acetylhexosaminidases using a structural approach
pubmed doi rcsb
source organism Paenibacillus
total genus 192
structure length 504
sequence length 519
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF02838 Glyco_hydro_20b Glycosyl hydrolase family 20, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3sutA01
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3sutA02
2WMHA 4MNKA 1GZJA 4AZ6A 4D6FA 3RO8A 1RD6A 4A4AA 1LWJA 1HF6A 3MV01 4UZUA 2DT2A 4UOJA 5TD4A 4FK9A 2D0FA 2W62A 2DSKA 1KBKA 3AFBA 4UOQA 1JL8A 3ARUA 3VIOA 5A6AA 4AD5A 1E6ZA 4KMQA 3VGHA 3K8MA 4JHZA 1NWSA 1GOOA 1H0GA 2Z1KA 2BVDA 2VTFA 3MO4A 1TR1A 4B9ZA 4UFJA 1CENA 3WN6A 1KXHA 1TA3A 5C8BB 1JZ6A 1JD7A 3VINA 3B8SA 3AMLA 2A3BA 2D23A 1ZBCA 1GQIA 2X8RA 1XYZA 4TVUA 5A95A 1HXJA 1FHDA 2WK2A 2J74A 1JDDA 3NSMA 3CZEA 5M3WA 1U30A 3AS3A 3PBGA 1JAEA 2DH3A 1FH9A 2J47A 3ARTA 3N1AA 2J7GA 5D9PA 2DSWA 4OBRA 4NRSA 2VMFA 1B3WA 1C7TA 2FHBA 3WD1A 4TXEA 1HKJA 4C7GA 3KZSA 4WIWA 3SUSA 5CJ5A 2WHKA 5BROA 3O9NA 3UG3A 1W9PA 3U57A 3SCTA 1K9TA 3N13A 3TP4A 3VPLA 3WH8A 1NOUA 1HJUA 3PZOA 3T2QA 1ZBWA 3GNPA 2DIJA 2XFYA 3BC9A 3AIQA 5I0DA 1XSIA 4CD4A 4FLOA 4V28A 3AXXA 2G3JA 4CCEA 2WB5A 4UFLA 5JIWA 1H09A 1UA7A 3RM8A 4U3CA 3CLWA 1PZ3A 2WC4A 1V08A 4E8CA 1CEOA 1JZ7A 1LL7A 1MVYA 4Y7EA 3VIGA 1JZ3A 3VKKA 2TAAA 1HJSA 3SURA 3VU2A 4WJXA 3GYCA 2J75A 1DWAM 4JHOA 1JNEA 3AROA 3W28A 4ZE5A 1K9DA 4ATLA 2W63A 1HKKA 1I75A 3AZSA 1EH9A 4YHEA 2E9LA 4V27A 1G94A 3W37A 4PCSA 2MANA 2JF6A 1OBAA 3MS8A 5EFDA 1MXDA 2OYMA 3AHXA 5DO8A 1J0KA 1W2VA 1W9BM 1EO5A 5HPCA 1E55A 3WEZA 1KBBA 3CGTA 2D20A 3UG5A 2YA2A 4KRTA 4LYPA 3MMDA 3L4YA 1GW1A 4ZXOA 1PJ9A 1W3HA 1HJQA 4DWSB 3ZSTA 1US2A 1OCQA 2BXYA 2GDUA 1J0HA 2CNCA 2G4FA 3O2LA 1UZ1A 5JUVA 4JFUA 4HA3A 2C7FA 2EEXA 3WF1A 4J3WA 2YJQA 1JD9A 2ZXDA 2O9PA 3VD5A 2OSYA 2WWCA 2VI0A 3CUFA 2PF0A 3AS0A 1BVZA 1LL6A 5JBDA 4PMNA 4UFMA 2OYKA 2XG9A 2JE8A 4HU8A 4H41A 2VR4A 1E72M 1OT2A 3GM8A 4AD4A 2WKGA 1CYGA 1VB9A 2X09A 2JFEX 1NQ6A 1Q6GA 2VZOA 2ZUVA 1PX4A 1EQPA 4J3SA 1W91A 3QHMA 1JF5A 2ZE0A 4Z2HA 1GCYA 5EBAA 4JKLA 4QCFA 4XB3A 1O7AA 2CCRA 1V6YA 1TZ7A 2A3CA 5A6BA 4UFHA 4CN6A 1K9FA 1TFVA 2WBGA 1UUQA 1E73M 1PZ2A 3EDKA 5CQ1A 4EAMA 2WMIB 3FY1A 1MW3A 1CPUA 4IPNB 1ZBKA 3GXMA 1KQZA 4DM2A 1IV8A 1O6IA 1V6UA 1XH1A 4UZSA 3UESA 1B3XA 3WD0A 3CBWA 3T08A 2BV9A 2ZUUA 4GZJA 2WC3A 1R7AA 3WEOA 5DFAA 1KGXA 2WMJA 3SCSA 1GPFA 4D6HA 4LXFA 1DWHM 4D6GA 5KZ6A 3EDDA 4CVWA 4P8UA 5A6MA 1CTNA 1EHAA 1CBGA 4X0VA 3AHVA 3AIBA 3MUY1 3A3HA 1LG1A 3G6LA 1Q6EA 4DWSC 3GXIA 4TX8A 4P7RA 1OGSA 3OA5A 1HIZA 1WP6A 4HPHA 3VIKA 2XSAA 1ISVA 1GOIA 5I78A 3ZT6A 3WNMA 4PTMA 1JYXA 3AHZA 1ZJAA 4DUXA 3K46A 2PWDA 2FGZA 1JDAA 5JBFA 5AC5A 2QPUA 4JKMA 5ABHA 3AJ7A 3VDAA 3CHCA 2YDSA 2V3GA 1KXQA 3T09A 3ZOAA 1R7OA 1UWIA 1VEMA 4Z2JA 1XCWA 1PPIA 2XVPA 3WNOA 2E8YA 1BSIA 3BMVA 1UH2A 3E1F1 4W8AA 1ISYA 4IUGA 4WKAA 3CUGA 4BZYA 4PN2A 1QBBA 3AS1A 4C7FA 1UD6A 4MNJA 3DC0A 2YKKA 3QOMA 3RILA 1ISZA 1W9DM 5A6KA 1NWUA 2WVTA 2ZWYA 2BY3A 4DWSA 1M03A 4KH2A 3BSGA 5HXMA 1OSEA 3ARYA 4CVUA 2WMFA 1CGUA 2YL9A 3MMUA 1R8LA 2C8NA 1E0VA 4W7UA 1VRXA 1MWOA 4D6EA 2PBGA 3N9KA 1OGBA 5A2BA 1QHOA 4R5EA 5M03A 4F8XA 2XTKA 3OGRA 5CLTA 1ITCA 3WDQA 4DM1A 3UERA 3BXWA 3EDFA 3OB8A 2QLYA 8A3HA 1KQYA 7A3HA 3EDJA 3I3BA 3QGVA 5I2UA 4UOZA 4AZGA 1H1NA 4IISA 3AYSA 1EGZA 2PWEA 2UY3A 1WCGA 3VVGA 2GJPA 4N0RA 1AQ0A 1JFHA 3WMCA 1EDQA 1OGGA 3K4AA 3DHPA 4GO8A 5CGMA 2BVTA 3D3AA 1E4MM 3OLDA 1F4HA 1JYNA 4GINA 4JAWA 2O9RA 2W92A 1G9HA 2WVSA 1GOMA 1IZKA 1NOFA 5DT5A 3ZM8A 1J12A 1W1VA 1H5VA 3BMWA 4L4OA 1FFRA 4UQBA 1V03A 1PIGA 4PMUA 4PMQA 2WMIA 5FKYA 4GPNA 4W85A 1B31A 4QLLA 2D1ZA 3VMPA 1MFVA 1QHPA 3VGBA 3WD4A 2Z1SA 2FHCA 4X9YA 3SEPA 4B3KA 5I79A 3T2OA 2XUCA 4NZCA 2VCBA 5E0CA 5GNYA 2YBUA 4W88A 1JZ4A 3UR7A 4JCMA 1UR0A 3L4UA 1CXKA 1SR0A 1UKOA 1EDTA 3WNLA 4Q7NA 2DT0A 1E70M 4JL2A 4YPJA 2J77A 1GOKA 1C90A 3QR3A 1UOKA 1G0CA 4W86A 1CXHA 4PUDA 3U5YA 1RP9A 1E40A 2YLAA 2G3IA 1XD0A 3MSDA 3FHQA 1E6RA 1WZKA 3LPFA 1NP0A 3WDHA 5E70A 2WSKA 1VEOA 5DEZA 1BPLB 4YN5A 4WLCA 2JEQA 3SUWA 3VM5A 2VRQA 1HX0A 4AEFA 6A3HA 5AYBA 2E0PA 5CXPA 3I3DA 4AZIA 1K9EA 3WF2A 3NJ3A 4H7VA 2NSXA 1UQZA 4D72A 4TX6A 3BSHA 2ZUTA 3AS2A 1KCLA 1OIFA 1QW9A 3WKZA 3VD9A 3JUGA 2OWXA 1RPKA 3SIMA 1IZJA 2ZX6A 1NWRA 3G6MA 4MJ4A 5CPSA 3BGAA 3WF4A 1KWKA 3ARWA 1PX8A 1UQYA 5GQBA 1E43A 3S6TA 5JBEA 2CXGA 1EOKA 4MTVA 2F61A 3RPMA 3CZKA 4W84A 2IXVA 4HA4A 1N82A 1NP2A 4J28A 4QLKA 3RJYA 5A6BD 1JI2A 1HJXA 5HPOA 2W61A 3ARPA 3WD2A 2WKLA 4BF7A 3K8LA 3BAIA 5GNZA 2WBKA 2E40A 3GZAA 5FCZA 4LQ1A 2WLYA 2PWFA 2CESA 4EKJA 1CNVA 2J8FA 3O6AA 1BTCA 3WMSA 4U33A 3PZNA 3IANA 3EMCA 4KWUA 3PZ9A 2XGIA 1TG7A 2WHMA 5A8QA 5HOSA 3CO4A 2DT1A 1V6XA 1JDCA 5A2AA 2PI6A 2XYLA 3UR8A 4A3HA 3OG2A 2BY2A 4BCEA 5M5DA 4AC1X 1C92A 2EJ1A 4NF7A 4H8VA 1B2YA 5I23A 2ESCA 4U2YA 1JNDA 1WZLA 3FNDA 3WDPP 2CETA 4BQ2A 1RH9A 2BFGA 1KXTA 2CKSA 1H2JA 2J7FA 3ZJ6A 1J10A 5BRPA 1W1TA 1EQCA 3DYMA 4ATDA 1CIUA 1TVNA 3ZT7A 2DT3A 1E0XA 1GHRA 3KL3A 5GPRA 1J0JA 4D1JA 2ZXAA 3ZJ8A 1TVPA 5D9OA 5FIPA 2EQDA 1H49A 1JXKA 1V3HA 3WBAA 5FD0A 3AMDA 3NCOA 3WUFA 3WF0A 1Q6DA 1FA2A 3WL1A 3CUJA 3HN3A 5KEZA 3B9AA 3PTKA 2D2OA 4L4PA 4M81A 2WNWA 4MDOA 3RMEA 1FOBA 1XGZA 3CHDA 5CPTA 1W9XA 3OGVA 3SCQA 1JGIA 3VDBA 4DWSD 2PBOA 1WAWA 8CGTA 5IFTA 4C90A 2JALA 3N12A 4J27A 5AC4A 5D8ZA 5E6ZA 1UWUA 4PMXA 1EA9C 3VNYA 4M82A 1ZBVA 1GQJA 2VZSA 4PEEA 4W87A 2F2HA 2CBIA 2EBNA 2GUYA 1BQCA 1B30A 4S3KA 1UH4A 2J4GA 4E4PA 2YDRA 3N17A 3ZO9A 2DDXA 5D8WA 4HOWA 1QI2A 4OBSA 4MB3A 2NT1A 1VFFA 1MQPA 3ZR6A 5CPQA 2DEPA 5D9NA 1QI0A 3MMWA 3VGFA 3W6LA 3SUUA 1W3LA 3ZT5A 2RGMA 3BAJA 1A3HA 3MSGA 3CZ8A 5HDRA 2UY4A 5FOOA 1WNOA 1JXJA 3IK2A 1UD8A 4XZBA 4AZCB 3RM9A 5A3HA 2PB1A 3AIWA 1AQMA 1R86A 3WQWA 6TAAA 1GVYA 1W2PA 2E4TA 1AQHA 2XVGA 3ALFA 2FDMA 4W89A 4D6DA 3TA9A 2BHUA 2A3EA 5EB8A 3FAWA 1HN1A 3WH6A 3OZOA 1C91A 2X0HA 4NI3A 1CGWA 4AEEA 1UR1A 1V3JA 2VVSA 4CCCA 3D5HA 1DWIM 3PZQA 3UETA 3QHNA 4ZFMA 2OSWA 4N42A 5BXSA 2YLLA 4P7OA 3F5JA 2EXOA 4J3TA 2OSXA 2VX4A 3W0KA 3GBEA 2G3NA 4MNMA 1U2YA 1X6NA 3DYOA 1B0IA 1HVXA 4KGLA 4W5UA 1WB0A 4FLSA 2C0HA 1E4IA 2WCAA 2YIHA 5EMYA 3HMCA 3W29A 4ACYA 4PCTA 4PMRA 3I3EA 2OWWA 2ZIDA 3CZLA 3A6OA 1UKQA 3DECA 3PN8A 3VOCA 4AYSA 2V3EA 9CGTA 4P8VA 1ODZA 4HMEA 3W25A 2CPUA 2VOTA 1L8NA 4HP5A 1C8YA 1WZAA 1QNOA 2GJRA 1EIBA 4IM4A 5A8PA 3WNPA 3CH9A 4PYSA 3QHOA 4AY1A 4HZ6A 5A6SA 3TTQA 2D0HA 2VO5A 1MW1A 1LJYA 3WNKA 1SMAA 4JFTA 4M1RA 1XC6A 1QVBA 3WQ4A 4KRUA 3PTQA 4J3XA 2WMKA 3A4WA 1ECEA 4GKLA 3W26A 4B15A 5A1AA 4K68A 1E5JA 1EO7A 2WWDA 5I5RA 2DPEA 2D3NA 1WKYA 1E1FA 1WE5A 1E3ZA 2V3DA 2VT0A 1E15A 3OBAA 5BXTA 3ARRA 4BA0A 2X1IA 4H2CA 4MPKA 4CUCA 3IAPA 4AIEA 1CDGA 4HZ8A 4PUEA 1H4PA 2CKRA 1UKTA 4JFSA 3W27A 4AMCA 2WM0A 4D71A 5A8NA 2BHZA 2RGLA 1BGGA 3BAXA 3PZGA 2XIIA 1W32A 4PSPA 2VQUA 3PZMA 2JIEA 2VCCA 4M80A 1C3FA 2A3HA 1FP9A 5BCAA 4B16A 4PTVA 4YHGA 1OD8A 5I6SA 4B3LA 1WPCA 1CGYA 3QOKA 3KL5A 3GXFA 4AD3A 3AOFA 1BHGA 2ZX7A 4PSRA 5ABFB 2XIBA 1I1XA 3AIRA 3A4XA 1UWRA 3II1A 2YL5A 4MAZA 1CXEA 1TE1A 2E8ZA 5E0FA 1KB3A 2VRKA 3BCFA 1XRVA 4LGXA 2NT0A 1GOQA 2WC7A 4AZCA 5E6YA 5D4YA 1QPKA 2ZXBA 5A94A 5HBFA 1ZU8A 2J25A 1JI1A 2VRJA 4UR9A 4EE9A 4HA1A 1J0ZA 1FH8A 1QI5A 3CUHA 3OZPA 3VIHA 3ZJ7A 1XH0A 3PZVA 3GBDA 1J11A 4WF7A 3F5LA 3UG4A 4BQ3A 1KCKA 4ZENA 5GNXA 6CGTA 1UKSA 4P8WA 3AXHA 2CBUA 5A8OA 1OM0A 3CMJA 1GVIA 4OZOA 3EBVA 2CITA 4Z2KA 3VIIA 3N18A 2W67A 1ZB5A 5BRQA 4U2ZA 4HPGA 3GXDA 4P7NA 1IT0A 2FHFA 4AIOA 1G5AA 4OOZA 3M07A 4UFIA 1W3KA 4TOQA 4UQEA 5CZKA 5BXPA 4P7LA 1KGUA 3FHAA 5IHSA 1VBRA 4GZEA 2VCAA 4HMCA 4H04A 4CCDA 1JAKA 1WZMA 1UWTA 3WUBA 2VQTA 1R87A 4CGTA 3NYDA 2XPKA 2XFFA 3ARZA 1BGAA 4M56A 1V0MA 1KWGA 2WZEA 4AIUA 1J0IA 5I24A 1BVNP 1UG6A 4U31A 4HOZA 3ARSA 3KEHA 4EANA 5AYIA 2YDQA 1JZ2A 1U33A 1CZ1A 1E6SM 1B3ZA 1DWGM 1AMYA 1ESWA 2EPMX 3MU7A 3T0DA 3WELA 3ZSSA 1WO2A 1BAGA 4FLQA 1SFSA 3T0AA 3A4AA 1EOMA 5ABGA 2J79A 2J7BA 3SCVA 1QW8A 4W7VA 4X0NA 3ZMRA 3NDZA 2J8GA 2VUYA 4OIFA 2CBJA 3W53A 2DGAA 1XH2A 4CD8A 1V3IA 1G1YA 4AD1A 3WH9A 3GH7A 2ZX9A 1XCXA 1V3MA 2Y8VA 2V5CA 2XJ7A 4WKFA 2G8ZA 5DF0A 4TUFA 1E6NA 3VO0A 2VX5A 3WQ5A 2EO7A 2X0YA 3U7BA 1H11A 1MFUA 1HNYA 1L0PA 1NM9A 4D6CA 3AYRA 5M17A 3FAXA 3SUTA 3THCA 2UY5A 1FFQA 1UD5A 3APGA 2DSZA 3OLIA 3AI0A 1D3CA 2BVYA 1UKPA 1E56A 4OOUA 2YA0A 3IJ7A 2EPLX 2V3FA 3WEMA 1ODUA 2HISA 2WLZA 3NSNA 3SUVA 2O92A 3WL0A 1JIBA 2XWDA 3VILA 4W93A 5ABFA 5JIPA 1CLXA 1GQKA 2D3LA 2GVYA 4HZ7A 4URIA 4DUWA 1OINA 1D7FA 1F4AA 2ZUNA 3L2MA 3M7SA 1M01A 2VC9A 2ZX8A 2FH8A 1PIFA 4M8UA 3RM4A 4H8UA 4U5IA 1W3JA 2XVLA 2J7HA 2J7EA 4C7DA 4HU0A 2WAGA 3AISA 3L4VA 4JL1A 1J0YA 2VR5A 2WCSA 4H8HA 4OUEA 1JFXA 3GNRA 3PZTA 2VX6A 3ZIZA 1CWYA 4QAWA 4JIEA 1KGWA 4Z2GA 2WVUA 3ZQ9A 1HKMA 2OYLA 3T0BA 3WDRA 3AMKA 4E8DA 4PTXA 5CSYA 1E6QM 1XYFA 1OT1A 2B31A 1AVAA 5C71A 1BYCA 2QHAA 2X05A 1UR4A 2VZUA 2F8QA 1PAMA 2ZUWA 1OB0A 1CGTA 1GHSA 1D2KA 2WSPA 1VJSA 4GO9A 1DWJM 2PC8A 2DH2A 1UR2A 4PMYA 3VIMA 4GQRA 2DQXA 3VDCA 2ZX5A 7CGTA 2XGBA 4M24A 1Q6CA 4CN4A 5DT7A 1B9ZA 2UY2A 3CPUA 2E9BA 2CIPA 3WQ8A 2BHYA 3SCWA 2Y8KA 5ECUA 2Y4SA 4QP0A 1QNQA 4CKQA 4B9YA 4OKDA 1JYVA 4WSJA 1UWQA 2XHYA 2V5DA 4GI9A 4J3UA 1NH6A 3WY1A 1LG2A 2ZWZA 4ML4A 3SCRA 4QFUA 4F79A 3POHA 1NARA 1C7SA 1BG9A 2BY0A 4U3AA 3K8KA 5A2CA 4D1IA 3BH4A 4EK7A 4W5ZA 4MDPA 1Y7VA 3SCUA 3AQUA 1OD0A 3BLKA 4F66A 3F5KA 3VD4A 1E4LA 4XX6A 2DSVA 4RE4A 3VGDA 4J3VA 3A47A 1V02A 4W8LA 4HOXA 1KR1A 1UZ4A 1SYTA 3WUEA 3PHAA 3S2CA 1HP4A 3VX1A 3AHTA 4LX4A 1EDGA 3CZJA 1LLOA 1QNSA 2XM2A 2J7DA 2EPKX 4JFWA 2XM1A 5BYWA 1BYDA 3VDHA 4AISA 1E6PA 4W8BA 1CGXA 4UCFA 2VURA 5A6LA 3AMGA 1VFUA 4MJ2A 1PBGA 1DHKA 1GONA 1UWSA 3MV11 1HT6A 4UQ9A 4CD6A 1B3VA 4C91A 1QBAA 1UD3A 1ITXA 2GFTA 2XVNA 3MUIA 2J62A 1V0LA 1H3GA 1BF2A 3WF3A 5A6JA 3J7HA 2BXZA 4QCEA 5IDIA 4RL3A 3KE0A 1JZ8A 2E3ZA 3FXYA 4AZHA 4ZE4A 1UYQA 3EDEA 1FP8A 4XV0A 4HMDA 1VF8A 3FN9A 1X1NA 3WBEA 2Y2WA 4UQAA 1ZJBA 4UQDA 4D6JA 4TVCA 2GK1B 1W9VA 2WW5A 2YL8A 1KR0A 1BYAA 5LYRA 1UR9A 3CZGA 1M04A 2ZUSA 2ZOXA 4UNIA 2CEQA 2IUZA 3WQ6A 4MB1A 2VL4A 3LMYA 4Z2LA 2QV4A 4Z2IA 2AAAA 4WSKA 3BCDA 5E9AA 3VTRA 3VGEA 3GNOA 2CERA 2W66A 2WPGA 1GQLA 4WK9A 3AHYA 4AZ7A 4PMOA 4ATWA 1UR8A 2VZVA 4XZWA 2QMKA 1QI3A 4UQCA 1C8XA 2BS9A 3W4RA 3DYPA 2XWEA 1HKIA 4UFKA 1UA3A 2WYSA 3UEQA 3B9EA 2EPOA 2NW0A 1QOXA 5IFPA 2G3MA 1DP0A 3VMNA 1OIMA 1TUXA 1XSKA 1MQRA 1JZ5A 1X6LA 4FF5A 5CGTA 2BY1A 5EFFA 4F9JA 2WMGA 4PRWA 3T2PA 2JF7A 1ZS2A 1YQ2A 3L4TA 3VIPA 1VEPA 2YOCA 3WH7A 3MANA 3K4DA 3M6DA 2VVNA 4JCLA 1MXGA 4GI8A 5I77A 1MW2A 1G01A 3SCPA 3VD3A 2CHNA 1J18A 3VMOA 1W1PA 3VD7A 3OLEA 5CLWA 3B9DA 4CU8A 4AW7A 3DHUA 4AD0A 1FHLA 3LPGA 3LPOA 4PMVA 5FL0A 1E71M 1XHGA 2VJXA 5A69A 1J01A 2BNJA 1GORA 2CHOA 3VNZA 1M7XA 2WZIA 3N04A 1W9UA 3PZUA 3MUAA 2WANA 3AZTA 3WFZA 3CTTA 4RE3A 2Y5EA 3WMBA 1SMDA 1HJWA 3AIVA 3RCNA 4R27A 4ZXLA 4MB4A 1LL4A 3CHEA 3ARQA 1DEDA 4NSBA 3WFLA 3BLPX 4ACZB 4ZEPA 1MQQA 3AXIA 3NUKA 1V6WA 4QLJA 3TOPA 3AICA 4LYQA 2ZICA 5BXRA 3GDBA 4F9DA 2OWCA 3WDIA 1PX3A 3N15A 4FMVA 3RIKA 2O9OA 3WD3A 5D9MA 2Y24A 1EHNA 2D24A 3PZIA 3POCA 2VX7A 3WENA 3VIFA 1WDRA 3ECQA 4PTWA 2GJXB 1VFMA 1GUVA 3AMCA 1E4NA 1VFOA 2JEPA 1HP5A 1Z32X 2VZTA 2W91A 2PWHA 2YL6A 1JF6A 3AIEA 2V38A 4TTGA 1B90A 3UCQA 1BYBA 5DMYA 1CXIA 1S46A 3W6MA 3VGGA 4J7RA 2ZXQA 4BQ4A 1E3XA 2GK1A 3EMZA 3L4WA 4XUYA 5F7UA 5LA1A 1E0WA 1JG9A 1KXVA 2XVKA 4JKKA 4V2XA 1C93A 3WH5A 4PMZA 4AZ5A 3W38A 1CXLA 4AXNA 2E9MA 1GOWA 1PEZA 1ZL1A 2A3AA 1XD1A 1GJUA 3NDYA 1J9YA 4KGJA 3THDA 5IXEA 3OLGA 4HTYA 1VAHA 2WXDM 5I3DA 2CBVA 4S3JA 2QPSA 3PTMA 3N11A 3TTOA 1DWFM 4GQQA 1LWHA 4E2OA 3W24A 4GZIA 3U5UA 1FH7A 3GH4A 1R85A 4UTFA 4W7WA 2FGLA 1MYRA 3CUIA 7TAAA 2YA1A 3HJEA 3EYPA 2Q8XA 2AMGA 2X2YA 2WVVB 1DTUA 1Q6FA 3W81A 2CYGA 3AZRA 3ZJKA 1UD4A 1HJVA 4P7QA 1H0IA 1I1WA 2J78A 3W82A 1H41A 2JIWA 1EXPA 1E9LA 2IXUA 4A3YA 3RDKA 2XFRA 3LPPA 3L4ZA 4CU6A 4M29A 1ISWA 2XSBA 3TTSA 4AZBA 2D0GA 3L4XA 1QI4A 4MAVA 4AWEA 4BQ5A 1TCMA 4IPLA 1V0KA 3VIJA 5AY7A 1QHZA 3NSXA 2D22A 3K1DA 3WUGA 5LA2A 2EPNA 4LYRA 4U5KA 3WNNA 1JYWA 2GSJA 3IJ9A 5ABEA 1UD2A 5HNNA 1V0NA 1UH3A 3GH5A 2WCGA 4PMDA 4JFVA 4P8XA 1LF1A 4MNLA 4ACZA 2DSUA 3CMGA 4MB5A 1TA3B 1NOWA 5BWFA 1BLIA 1E1EA 2GDVA 2W4XA 1OWQA 4TVDA 5E09A 1TMQA 4D6IA 1RP8A 1E6XM 4RE2A 3VUPA 1VIWA 1UHVA 4MADA 1CXFA 5CG0A 3VM7A 4WKHA 4Q22A 1NWTA 1BG4A 4AD2A 5C70A 4LPCA 1B1YA 3BAYA 1XV8A 3MKKA 1HL8A 3BAWA 3KWXA 4CD5A 2GJXA 4TTUA 1VBUA 2QMJA 2WHJA 3U7VA 1QNRA 3GTNA 5FL1A 4CD7A 5LA0A 1GJWA 3NIYA 1WDPA 1BFNA 1P6WA 3M46A 1KFWA 3TTYA 1K6AA 1US3A 1W1YA 3IAQA 3SCOA 2HVMA 3IJ8A 2VNCA 1M53A 5A8MA 3FW6A 1CECA 3WIJA 2J7CA 4DUVA 2DIEA 4JZ5A 2G41A 3KL0A 2W5FA 1MW0A 1B3YA 4OJYA 1Q4NX 3ALGA 3ARVA 1WDQA 3HU7A 3WQVA 3SCNA 4FLRA 1A47A 3EMQA 1E5NA 2ZUMA 2WZHA 5CSUA 1QNPA 4CU7A 2UWFA 2O9TA 1LQ0A 1WDSA 4GIAA 3RJXA 4NRRA 1HVQA 1VENA 3AIUA 1C8QA 1ISXA 3CHFA 4BS0A 1V6VA 1V3KA 1V3LA 4GI6A 5IHRA 3MUZ1 3WDJA 2AOSA 4PBGA 3CIVA 2OLHA 3L2LA 1XSJA 2QF8A 3ARXA 2YBTA 2WVVA 3F4VA 1CLVA 1HL9A 3TONA 1GNXA 1YHTA 3OIHA 1VJZA 4QDMA 2FH6A 3ZR5A 3VX0A 2PWGA 2WHLA 4CN1A 4GXPA 1CGVA 3WSUA 3OGSA 3BAKA 1V02E
chains in the Genus database with same CATH superfamily
1XS2A 7ENLA 2OCZA 4HNTA 2WMHA 3BGGA 3MUXA 4B5UA 3RK8A 1DPMA 4LY4A 4MNKA 3BANA 3W87A 3RO8A 1RD6A 2YXOA 1HF6A 3MV01 4GRSA 5TD4A 4FK9A 4J35A 2QCGA 2W9MA 3SDOA 5A6AA 3G22A 4CLMA 2HV5A 1S5VA 4JHZA 1NWSA 1LT8A 2CU0A 1H7OA 2BVDA 2VTFA 3GUWA 3MO4A 4H6KA 1KNWA 3PWGA 4B9ZA 4UFJA 4WY0B 1YNYA 4E5TA 3WN6A 1G6CA 2ZDRA 1TA3A 1YXCA 3WBXA 1US0A 1ZBCA 1XG4A 3ISIX 4TVUA 4KEZA 3UPBA 5A95A 5TBOA 1S2CA 1JDDA 2GOKA 3NSMA 4E2VA 4NYYA 4R9OA 2O7SA 4MKSA 1E9YB 1KM5A 3N25A 4E2BA 2VMFA 1B3WA 4HNOA 3WD1A 5I3KA 4MSSA 1HKJA 5DQPA 1AFSA 4DJDD 1I6NA 1WKDA 1WYIA 5BROA 3O9NA 1Z6KA 4RNHA 4C6OA 4HN4A 5AKQA 3R8HA 4ADUA 1K9TA 1W5NA 3N13A 3WH8A 3QPZA 7PTDA 3BC9A 1XSIA 3PUDA 2QJJA 1Q45A 4H9VA 1E9ZB 3SQMA 1E1CA 3AXXA 4CCEA 5JIWA 5REQA 3OQ8A 1TPVA 2Y5JA 4U3CA 3CLWA 5EL1A 4N02A 3P7YA 4PL1A 1LL7A 3VU2A 2J75A 1OFPA 3E49A 4M7SA 4ATLA 3L12A 1KM2A 4ADTA 4X2PA 1XBXA 1UC4A 2E9LA 1LOQA 1HKWA 1MZHA 5EFDA 4PEKA 5DO8A 1FWFC 4PMJA 2QJGA 1SFTA 1KRAC 3WEZA 1KBBA 2YA2A 4LYPA 4LALA 3L4YA 4NI8A 5CJMA 1HJQA 2FZDA 4DWSB 4G8TA 3LHZA 2ZADA 4Q8WA 3BTNA 1OCQA 2BXYA 2GDUA 2AKZA 5D02A 4HCLA 4JQ3A 4ZOCA 3PB2A 3UWUA 3M43A 2C16A 2CLMA 2VEIA 2YJQA 3NPWA 1TIMA 2O9PA 1Q65A 2OSYA 1D8CA 2WWCA 3CUFA 3PNUA 4HYWA 3UXAA 3L68A 3CMFA 3LB0A 1UCWA 4FOUA 3HQPA 1QT1A 3BICA 1BVZA 4IH3A 4NY2A 4L9ZA 1K7EA 2XG9A 5FI8A 8RUCA 4H41A 2VR4A 3GM8A 1EJRC 4AD4A 2XU2A 4XZMX 1XM3A 1KCZA 1Y5WA 2YFNA 2JFEX 2VZOA 1EQPA 2HVNA 2V6AA 1JF5A 1A0DA 2POZA 2YW3A 2VUNA 3SN0A 3MHUA 3S9ZA 6XIMA 3H26A 4QCFA 4WY0A 2CCRA 3CQIA 4ZQCA 4UFHA 3E9AA 1UUQA 1O95A 3EDKA 4C6MA 3IVTA 1W3TA 4IPNB 4EIVA 3GXMA 1KQZA 4DM2A 1TB3A 3ATZA 3GAKA 1V6UA 3VNKA 1XH1A 3T81A 4HSHA 4ZQOA 1B3XA 2BV9A 4DIAA 1F2JA 3GHUA 2GLKA 1WUFA 3SCSA 4D6HA 4D6GA 1K3UA 1CTNA 1EHAA 4O8AA 3H54A 1CBGA 1XW8A 3AHVA 3AIBA 5HNUA 4YIWA 3HPFA 3VK5A 4LH8A 3G6LA 3PBWA 1XP3A 3CIXA 1ZSXA 4TX8A 4P7RA 3W86A 3OA5A 1DQUA 8TIMA 2VC5A 3W9ZA 4CQAA 4PTMA 1GVEA 3ZXWA 1TR9A 3A13A 1JYXA 2O55A 1Q6OA 1EC8A 5F1UA 3HBLA 2QPUA 3LNMA 3AJ7A 4OBTA 5HK4A 2V3GA 3UA3A 1KXQA 4MYXA 1P0EA 2QR6A 1PPIA 1AW5A 1QO5A 3WNOA 3SJ3A 3BMVA 3QLDA 1K8XA 4LJ3A 4PODA 5XINA 1ISYA 4IUGA 2ZYFA 4BZYA 3GVWA 2ZVIA 4C65A 5EY5A 4PN2A 1QBBA 3STGA 3KBNA 4C7FA 1UD6A 3DKLA 4H7ZA 1PE1A 2WVTA 3PANA 3K30A 4DWSA 2XSXA 4MUZA 3BSGA 1R9XA 5HXMA 2VFIA 3TSDA 5K2ZA 2JK2A 2V5LA 3OOQA 1XYAA 2YL9A 1TV5A 2QJMA 4XD5A 1WOBA 1R8LA 1KD0A 3NXFA 3GY1A 2PBGA 3UW6A 1I8JA 3SZ8A 3PPGA 3OGRA 5K3VA 3WDQA 3EDFA 4HYVA 3RX4A 8A3HA 1V7AA 4GKTA 4IIBA 3RLUA 5I2UA 4UOZA 4GXMA 4AZGA 4IISA 2PWEA 4LAUA 3CLMA 4KWOA 4JX5A 2O0TA 3U8GA 1EDQA 1VFTA 3C2OA 1OGGA 3K4AA 5D2WA 2WSQA 4NZJA 3SQLA 3D3AA 3F03K 1GOMA 3BOFA 3BMWA 4L4OA 1FUYA 4ZCWA 4PMUA 1GGOA 2H8XA 5FKYA 4W85A 1B31A 1RV8A 4M6VA 2D1ZA 1W56A 2Z1SA 4NAEB 4X9YA 3UQNA 3MP3A 3T2OA 4DBEA 2ZC8A 5MF5A 2QVNA 4A8IA 4HCHA 3UR7A 4NQ1A 1CXKA 2YZ5A 1EDTA 3EZ4A 2Z2AA 2PTDA 3M0VA 3EWWA 3WNLA 4Q7NA 5F2GA 6ENLA 1S3HA 5G5IA 3BK0A 4L65A 1C90A 2VFGA 3WBYA 2GQ3A 4X9SA 1UOKA 2NQJA 1G0CA 4UCGA 4QQ3A 3OBEA 1RP9A 2GGHA 2YLAA 4X22A 5HNTA 3GZ3A 1Z69A 3EXSA 1WZKA 5CC5A 5E70A 1VYRA 2HS6A 1VEOA 4JQ1A 1FWIC 3SSZA 4TMBA 5DEZA 2YCIX 1F9CA 4YN5A 3UYIA 1EL3A 1W3NA 3GC2A 1RBOB 4AZIA 3DFOA 1K9EA 4IJBA 1OFRA 5CPOA 3V5CA 4JDYA 1JCJA 4TX6A 3WLNA 4NP7A 3M0KA 4C6JA 4ORMA 4PGLA 4H9MA 3WKZA 3VD9A 2OWXA 1RPKA 3SGGA 5CPSA 2QUVA 3CO8A 4GCXA 3TJ4A 3ARWA 1UQYA 3BZGA 2GQ9A 4WGHA 3S6TA 2CXGA 1Z3NA 1EOKA 2CWXA 4GH1A 4W84A 4FZIA 2IXVA 4HA4A 3S4TA 2XIMA 1MUWA 2D2JA 4UMCA 4HBKA 3RJYA 1Y65A 1JI2A 2PDLA 4G2DA 6ALDA 2GSHA 1EBHA 4Y9OA 4WXYA 2PF8A 2PWFA 2I17A 2Z1VA 4EKJA 1CNVA 3C52A 2J8FA 4AB4A 3O6AA 4ZFCA 3N4AA 3NOYA 4U33A 2XH0A 3V0UA 4Q8MA 5A8QA 3E3HA 3WLKX 1I2NA 4DY1A 3TX9A 4IXHA 5A2AA 3E5BA 4A3HA 2PC4A 4AC1X 3TSMA 4H8VA 1B2YA 1SGJA 3G1XA 3R6IA 1WZLA 3TWBA 3WDPP 1J4EA 1SJBA 1SW0A 2CETA 1T0OA 2BFGA 5AYYA 2A1YA 1H2JA 3ZJ6A 4EF8A 3CQHA 1J10A 5BMWA 4C1NB 2VFHA 4DYKA 1W1TA 2CLLA 2FLIA 1TVNA 1E0XA 4D1JA 5LGZA 2ZXAA 3GVRA 3ABQA 3C0QA 4I6KA 4XBJA 2BWGA 3WBAA 3NCOA 1H61A 3WUFA 3WF0A 3WL1A 3G0XA 3NPUA 3C5QA 1VCVA 4MIMA 2VWSA 5EIYB 3PTKA 3KFTA 4L4PA 1SZEA 3RMEA 1FOBA 1DIEA 3UWVA 3SCQA 1PHQA 3ZVHB 4DWSD 4QJ1A 3OU8A 1VYSX 8CGTA 1JPMA 5C9XA 3N2XA 4KFOA 4DBUA 1Z7AA 4EVZA 3CL8A 1AUSL 1ME9A 4J27A 4ZB5A 1BVWA 4H1ZA 5D8ZA 1XLGA 1UWUA 4PMXA 4IP5A 1DJXA 4M82A 2QT3A 1GQJA 4IL0A 3ANVA 3LS9A 3QW4B 4W87A 1BQCA 1B30A 5FJTA 4M5PA 3KWSA 3W22A 3N17A 1YADA 2JGYA 3EWUA 3HIJA 4JTRA 1VFFA 4JXCA 3VCNA 3G24A 5D9NA 2ZRZA 1UMLA 4WEVX 3TC3A 3LM7A 5HDRA 3O06A 2BGNE 1JXJA 1UD8A 4U10A 2PB1A 1R86A 3MO7A 3TV8A 6TAAA 3GO2A 3SRKA 3UJ2A 2BHUA 2A3EA 3GKFA 5DBUA 2TODA 3WH6A 3DIPA 3W07A 2X0HA 3M5YA 4NI3A 1CGWA 1SJCA 3OHIA 1UR1A 4AEEA 3TN5A 3F2BA 3CB3A 3Q94A 3O07A 3PZQA 2PWUA 2VGGA 5C2XA 3AWNA 1Q8JA 3UETA 2OSWA 1S5NA 4J5NA 1ONXA 2J6VA 4I3GA 2OSXA 1QW7A 3DFNA 1X6NA 4KFPA 4KGLA 4W5UA 4KERA 5CCZA 1L6WA 3W29A 1SQ7A 2OWWA 3LHTA 2PU1A 1UKQA 3BLDA 4C1NA 1RUSA 1NFGA 5K4ZA 3MMTA 4HMEA 3W25A 2CPUA 2C91A 1L8NA 3DEQA 1M7OA 3B8TA 1QNOA 2GJRA 1EIBA 5GVJA 1TX0A 4PYSA 2NXHA 3U4AA 5H8MA 2GVLA 3LA4A 3EPNA 2BP1A 1F3EA 2Z26A 1A5MC 1MW1A 1XC6A 3WQ4A 2R24A 2YXGA 1R30A 2WMKA 3GFZA 4B15A 4GKLA 3W26A 5A1AA 4K68A 1OY0A 3W7RA 1EO7A 1EFZA 3TLQA 4XAYA 4Z08A 1UZHA 4H6QA 3G8RA 2FFCA 3RX3A 2X1IA 1TV7A 3THAA 4MPKA 2JBMA 4RPPA 4PUEA 3V0TA 1NU5A 3NL3A 3BW3A 2BHZA 1NFBA 4O53A 1SO6A 4PSPA 3EOEA 1TUFA 3OG3A 5TIMA 3PZMA 4GJJA 2JIEA 1AW1A 3TOYA 3HQOA 3NGJA 4FX6M 2HBXA 3VKCA 1FP9A 4H9YA 3KBWA 4K36A 4B16A 4XAPA 3QV9A 5I6SA 3A5VA 4F3HA 4OE7A 3O05A 3A3XA 3F7JA 1KFBA 3KL5A 1VC4A 3VA8A 3G1AA 2PP0A 3AOFA 2ZX7A 4FSAA 2CC0A 4PSRA 3TC7A 1P6CA 3OJGA 1ECQA 4BJHA 1UWRA 3TAOA 3H4WA 4AVOA 1KB3A 1AH4A 3CYJA 2OEMA 2ZZ3A 3UYCA 3W83A 1TKKA 3H6OA 3G1VA 2ZXBA 4I9AA 5HBFA 3MVTA 4L4MA 2DU2A 1XINA 2BLEA 1A4MA 3OZPA 4K37A 1YYAA 3UG4A 4BQ3A 1WXYA 3OHMB 1UKSA 3AXHA 2FTPA 1IZCA 3CMJA 4F2BA 3EBVA 2CITA 3VIIA 2GSEA 2RHGA 2W67A 2XIQA 1ZB5A 5BRQA 2OOGA 2ZRVA 4P7LA 3FCPA 3P62A 3BQ6A 3WK1A 5LSMA 3W1PA 4E0CA 4JR5A 4HMCA 3AJXA 4YVPA 4BF9A 1JAKA 1UWTA 3WUBA 2VQTA 1RA0A 3UJRA 1BGAA 1FRBA 4M56A 5BWAA 4DPPA 1I2PA 2NV9A 4AIUA 1VBGA 2W0UA 3KEHA 9XIAA 1KM4A 5AYIA 4OVXA 4JQ2A 1B3ZA 3IIOA 1WBJA 1DWGM 3T9PA 5FJRA 1AMYA 1ESWA 3M1ZA 3LD5A 3C3NA 3MU7A 1I4NA 4GG9A 4LAOA 3TW9A 3ZSSA 1XX1A 5B7YA 1SFSA 2BGSA 4NAFA 2OXNA 3DN5A 2J7BA 5A5WA 3MB9A 3ZMRA 1EX5A 3D3FA 2QF7A 2ZA1A 2CBJA 5D38A 2IKIA 3STEA 4JTFA 1FDJA 2I9EA 1KM1A 1V3IA 3GH7A 4LUJA 1R3RA 3F2DA 2Y8VA 4K8EA 4NKCA 2REQA 4WKFA 2G8ZA 2Z2BA 3FJLA 1W1A1 3RU8X 4YWIA 1ZHAA 3GC4A 1VQTA 2X0YA 3S1UA 5M17A 3CXOA 4FNTA 3THCA 3M47A 3WLPA 1FFQA 5LGXA 2DSZA 3OLIA 2Y7FA 1FWWA 3MP5A 2YA0A 3VDGA 3IJ7A 3B05A 1XFCA 5DX7A 2EPLX 3W7CA 3KOFA 2INZA 2Y5SA 1JUEA 3TJXA 1U22A 1EGMA 3SUVA 3VNIA 5LIUX 3VILA 5GJPA 5JIPA 3CQ0A 2PTXA 1DE6A 3TYAA 1GQKA 3B9OA 3ZWTA 4FNSA 1W37A 1D7FA 3ICJA 4HGXA 2ONEA 4A21A 5HMDA 2E68A 1Q66A 2FH8A 3OTRA 4FIQA 2OQYA 1VH7A 2I5GA 3AISA 4JL1A 1J0YA 5BZAA 4H8HA 2CZVA 4JTGA 4I8DA 3AU2A 1A5UA 1PKYA 2VX6A 3VKDA 4MUPA 4B5VA 3W71A 5CZ0A 1TWWA 4QAWA 5FJUA 1F74A 3RO6A 3NZPA 1HKMA 2PGRA 3AMKA 2PRLA 1W1IE 3I68A 5CSYA 3STFA 2PDIA 1AVAA 5I3JA 3S0CA 2QHAA 2X05A 1UR4A 2F8QA 4DUOA 2ZUWA 4Z1YA 2C13A 4JTJA 1D2KA 4FAMA 1VJSA 2JGQA 1DXFA 4PMYA 4L5ZA 2PDGA 2JKAA 7CGTA 4WUIA 1Q6CA 1B9ZA 2OT0A 3BLOA 3E2RA 3L65A 3G1YA 4PULA 5AHEA 4I6VA 2QDEA 3A23A 2CIPA 4IX2A 4EXQA 1NELA 3SCWA 3EWCA 4XAFA 2Y4SA 4CKQA 4QAIA 1ONWA 2Z24A 1UWQA 1L8PA 2OX1A 2VGIA 4ZODA 1LG2A 3POHA 4KT2A 1C7SA 1GTHA 2BY0A 1F6PA 5A2CA 2RFGA 1RA5A 4F66A 5J5DA 1A5NC 1KFEA 3GG0A 3SQSA 3TR2A 3QGAC 2DVXA 4RE4A 3PUOA 4LUTB 4HOXA 1F8MA 1YDVA 4J2MA 3HF3A 3VZXA 4LX4A 1EDGA 3TQ0A 1QNSA 1PZ0A 3BG9A 2XM1A 2Z00A 3LTSA 2PA6A 3T42A 5HWJA 1ZAHA 2FIQA 4DO6A 4Z1CA 4UCFA 4GACA 3TFXA 1PBGA 5C9WA 1HT6A 4CD6A 1YPIA 4Y9NA 2V8ZA 1H3GA 3QV6A 1BF2A 1KM6A 3FYOA 2D69A 1IEQA 2ACQA 3KE0A 2E3ZA 4NX5A 1RK6A 1UYQA 3EDEA 4HJWA 3SFWA 3FN9A 3PM6A 2J88A 3WBEA 1AQFA 3W3OA 3WJWA 4D6JA 2GK1B 1KR0A 1WAUA 1K7FA 2C14A 4A2SA 2Y7DA 3R94A 3CZGA 5JXQA 2V2CA 2OT1A 4UNIA 1OEPA 2IUZA 3N4FA 2VL4A 1F5ZA 4WSKA 3V7PA 3I4KA 3VGEA 3CQJA 2QJIA 2W66A 4B91A 1MEIA 2ZBTA 4YMZA 4WK9A 2IQTA 4PMOA 3NQ8A 2NX3A 4XZWA 1PDZA 4Q32A 3IUHA 3W4RA 3UFYA 2XN2A 3W7IA 4FNPA 4IPJA 1XGEA 1X96A 4S3BA 3S2MA 3STPA 3VMNA 1QK0A 4F9JA 4PRWA 3C3UA 3WK2A 3T2PA 3PNZA 1YQ2A 4C6BA 2YOCA 1JCTA 4AHPA 3MANA 5DMLA 4A6GA 2VVNA 4JCLA 1ZZMA 3D0CA 5AHIA 4XAZA 5I77A 4GUFA 1Q85A 3WLTA 3G8EA 3ES8A 1S5WA 1Q4WA 1JCMP 1PTAA 4GC3A 2DJXA 4AD0A 4Q8NA 3PJUA 3XINA 3L9CA 1J01A 1GORA 1M7XA 1BF6A 2WZIA 3KCJA 3PZUA 4LUTA 3LZ3A 2ZZ7A 1VPQA 3KOXA 3TYUA 3LSBA 2CLHA 2DZUA 3RCNA 1B9BA 4TV6A 1SUXA 4ZXLA 4MB4A 2QVHA 1MQQA 2IW0A 3NUKA 1V6WA 3TOPA 4LYQA 2ZICA 4WDTA 5KSWA 5BXRA 2AL2B 3GDBA 3A3WA 3WDIA 3HPXA 4FMVA 3RIKA 2O9OA 2Y24A 4LVDA 9RUBA 3ECQA 3Q67A 5KZDA 2QJHA 4S3GA 4ZSTA 5TAOA 4LCQA 1E4NA 3KRUA 4NNBA 3D47A 2YL6A 1OZMA 2R1NA 2P3ZA 3AIEA 3EA1A 2FTYA 4G56A 3H70A 4QSHA 1CXIA 3KDNA 1S46A 4EPDC 4J7RA 2PDFA 2GK1A 4XUYA 2DZSA 1E0WA 1RQEA 1JG9A 4JKKA 2Z2UA 3WH5A 2OEJA 4PRRA 5T91A 4AZ5A 5LNRA 1R2RA 1ZL1A 2Q8LA 1PTGA 2EG7A 3MUCA 4YYCA 1AA1B 4HTYA 1UZDA 3APYA 4S3JA 1LDCA 1XKYA 1QRQA 2PWVA 3N11A 3TTOA 1DWFM 4GQQA 4GYKA 1W17A 4G7EB 4FX7A 4GZIA 2BG5A 2Z1WA 2QIWA 1IXNA 3ME3A 3W2NA 1QASA 1JR1A 2Q02A 3U2ZA 1HUVA 1QO2A 2CYGA 3AZRA 3MCMA 3FOKA 1I1WA 2V69A 2RDWA 5FAGA 1DXIA 4GOAA 2EG6A 3WJZA 4N7QA 1QATA 1EXPA 3GSMA 3OVGA 1TELA 4B5XA 4HSNA 2V30A 3LPPA 1HG3A 3GXTA 2BTMA 3WMLA 2D0GA 3APTA 4UTIA 3NXLA 1O12A 3F4NA 2WO5A 4OU1A 1L6GA 1A4LA 2Y89A 4AWEA 4UMAA 1TCMA 4O54A 2HVOA 2A2IA 1QHZA 2PODA 3T78A 4LS2A 3UGVA 3WUGA 5LA2A 5EPDA 4LYRA 4U5KA 3NQVA 2GSJA 3IJ9A 1UW9A 5HNNA 3LTYA 4JTEA 5HR7A 3W23A 1RVKA 3KX6A 2BX7A 1NOWA 1BLIA 2GDVA 2W4XA 3HGOA 4TVDA 2PMQA 3P61A 1TMQA 2V81A 4DJEA 1E6XM 1VIWA 3LLXA 1UHVA 2AL2A 3LV6A 1W54A 2ATSA 1WDWA 1LRQA 4LPCA 4LC6A 3BG5A 4IIGA 1P43A 2HE5A 4JTAA 1HL8A 3C2YA 1GKQA 1TZZA 4CD5A 2I5IA 4NL1A 5FESA 5FSDC 1QNRA 1Z48A 3FYPA 3GTNA 3MDUA 5FL1A 2UZ9A 2GVJA 4JEJA 5F2LA 1WDPA 4ADSA 2RDUA 1IR2A 1P6WA 1YE4A 4OV4A 1K1DA 3TTYA 1US3A 1W1YA 3IAQA 1XF0A 3IVUA 3UR5A 4IICA 4DO7A 1M53A 4C6IA 1KV5A 1CECA 4F2TA 4OHQA 4JZ5A 5H8UA 1XUZA 3CUZA 5JQ9A 4GBUA 1LQ2A 3OBKA 1B3YA 3ALGA 3SCNA 4RLIA 3QKEA 3W6YA 3S2JA 2QW5A 2WZHA 2VYOA 3BO9A 4S3DA 1WDSA 3DU0A 3P8JA 4HK7A 3MCNA 2JQXA 4HB7A 1UP3A 4BS0A 3GX9A 5HMEA 3GUGA 3FLUA 4G7EA 1V3LA 4GI6A 3ELFA 3W85A 5D09A 3HG5A 3O16A 2ZRWA 2AOSA 5F2IA 1XSJA 2R6OA 2ODOA 3THQA 7REQB 3M0IA 3KLKA 3RR4A 2SFPA 1N8IA 2X42A 3NL6A 3KP1A 4IGMA 2DW7A 3WQCA 1HL9A 4QX4A 3KCLA 1GNXA 1OX6A 3N73A 3OIHA 5HAOA 1F3WA 4QDMA 1SSGA 2FH6A 2PGEA 5HNRA 2PWGA 2O56A 5DY3A 2WHLA 4CN1A 1CGVA 3FGCB 3GC5A 4BWLA 4AH7A 1OYBA 3GQYA 3W00A 1R2TA 4LAKA 5EA9A 3W76A 4RZ4A 4AZ6A 4A4AA 6PTDA 3N2BA 3OEXA 3S47A 1LCOA 5AC6A 4JTTA 1EJSC 2DSKA 4PC8A 4O16A 1G4SA 2WSRA 3ARUA 3VGHA 3S1WA 3PPCA 4PUKA 1NF0A 2GWGA 3N2OA 4LB3A 4WOZA 1XIIA 1BD0A 4AHQA 2VWTA 3UY8A 5EYWA 5C8BB 1JD7A 3FEMA 1W0MA 2PTYA 2A7RA 5F1VA 2P8CA 2A6LA 2E5DA 3AMLA 2A3BA 2CLFA 1GQIA 1XYZA 3MSRA 3VKBA 1W1B1 3FKRA 2XGZA 2J74A 3ORWA 1H1YA 5M3WA 1EP2A 3AS3A 4DNMA 1JAEA 3N9RA 5T8GA 2A21A 3EA2A 2J47A 2J7GA 4NRSA 3QEZA 1C7TA 4JYEA 4C7GA 4EWJA 5LNUA 4Q4QA 1VD6A 2J27A 3SB0A 4FA3A 3R8RA 4XKYB 1XBVA 5IBXC 3SCTA 1NDYA 3TP4A 3TSBA 4NZ3A 2PP3A 1NOUA 4L6DA 4ZB2A 2XFYA 1BQGA 2X7VA 1G4PA 4MY1A 1H50A 4V28A 4GUIA 1LORA 5BNKA 1ICQA 3H2OA 5B80A 2G3JA 2WB5A 4UFLA 1LOSA 5ABTA 1PZ3A 2WC4A 1NVMA 4Y7EA 3VKKA 1ITQA 3SURA 4WJXA 4WVXA 1DWAM 5AFDA 3W28A 1O68A 1HKKA 3G0SA 2CLOA 4PCSA 2JF6A 1MXDA 2OYMA 3AHXA 3QY7A 1W2VA 4WDWA 1W9BM 4ZTYA 1EO5A 3L5AA 3XIMA 7REQA 2CLIA 5HPCA 4B4FA 4DJED 3OODA 2D20A 3UG5A 4KRTA 4C6DA 1YBQB 1K8ZA 1GW1A 3ITLA 3KS6A 5M2FX 2YB4A 3ZSTA 1OX4A 2ZQ0A 4FPSA 1DBTA 3EWYA 2F6XA 4HA3A 3GR4A 3FGCA 2ZDSA 3W7KA 3R11A 2OZ8A 4XD3A 3NURA 2VI0A 5L9FA 2J66A 4LTSA 4S3AA 2NUXA 2Y61A 4BI5A 3AS0A 5JBDA 2A5HA 3OW1A 4HU8A 4P02B 2WKGA 1OFQA 1VB9A 4A3QA 1Q6RA 3LU2A 4IIFA 3BCJA 4KEMA 2X16A 2ZE0A 4Z2HA 2HNEA 3ZR4A 4IGSA 4JKLA 2F9RA 1KFJA 1RJPA 4OTKA 3T1GA 4XB3A 4K1GA 1XLMA 1EJ7L 4JPGA 2ZCGA 2Q01A 3B0PA 2ISWA 3IJIA 1CPUA 4NU7A 3LI0A 5HJLA 2HJPA 3T08A 2ZUUA 1L6FA 2WC3A 4KESA 1U5VA 3L66A 1QFEA 2YYUA 4CVWA 4L56A 1OYCA 1Z9AA 4DELA 2P0OA 2ZRXA 5AZ1A 5C2GA 3TXZA 3MUY1 1LLZA 4XKYA 4XTIA 2NZLA 1ZFJA 2QUUA 2J8TA 1H7NA 3DENA 3TC6A 1J93A 2HMCA 1PYMA 1GOIA 3HB9A 3P80A 5CKSA 4HYRA 3OIXA 2PRHA 4CNTA 1JDAA 2ABBA 3ERPA 1X6UA 3E6EA 5AC5A 1T96A 5ABHA 3VDAA 3CHCA 2YDSA 4KWWA 1W1ZA 1SZGA 3ZOAA 3UZYA 1UWIA 4Z2JA 4O28A 1V8EA 3DESA 2E8YA 1MNZA 3E1F1 1OFOA 4W8AA 1QOPA 3FJNA 1ZJHA 1E51A 4D2JA 3LGDA 1JULA 1P0DA 2B7QA 3G3MA 4IIEA 2XZ9A 3BDKA 4FXFA 5ENLA 2QDGA 1LP6A 3HGJA 3N29A 3DXIA 1YBQA 2PLCA 1ISZA 1NWUA 2ZWYA 4XO6A 4KH2A 3LUTA 4H2HA 1JUBA 1XLDA 1EC9A 1RBAA 4CVUA 1O60A 4O11A 1CGUA 3MMUA 5DLCA 2C8NA 4W7UA 1VRXA 4HN8A 4A29A 4MWAC 4MZ8A 5A2BA 4MG4A 4R5EA 4F8XA 2P1FA 5CLTA 3GDKA 3UERA 3BXWA 1YLVA 5B7ZA 4KCWA 1D3GA 4M19A 2QLYA 3UD6A 3RLGA 4NYUA 1KQYA 1UROA 3IVSA 3QGVA 3QH2A 1PXGA 3DHFA 1LZOA 3AYSA 1EF3A 1H60A 4Q3MA 4DRSA 4BY3A 4GISA 2HZGA 3RMJA 4O4VA 1TV4A 3KXQA 1KBLA 4N0RA 1AQ0A 1IYXA 2F84A 3DHPA 4LW7A 3A24A 5CGMA 4PBEA 3EGJA 3NQFA 1EPVA 2O9RA 2GQ8A 1G9HA 2WVSA 2X7WA 3FVDA 4Q4SA 1IZKA 2X0SA 5DT5A 3ZM8A 1W1VA 3WJSA 4GCAA 4JIHA 4C1LA 4UQBA 3UVIA 2VEKA 5HANA 4PMQA 2PGFA 3NOEA 3VGBA 1QHPA 2PDJA 2ALDA 3NQGA 4LV9A 3TEVA 4NZCA 3IGXA 5E0CA 3EX2A 3B4UA 1S38A 4J4KA 1JZ4A 1UR0A 1J2WA 3URAA 4EP8C 5FJOA 1UKOA 1Q2RA 2J24A 3NM1A 3LRKA 4YPJA 1QWKA 4O0QA 3E96A 4Z1DA 2C79A 3QR3A 3QVQA 2P53A 3SN4A 3B40A 4HZMA 4PUDA 3RFAA 5C9RA 3LCLA 4C5ZA 1QPRA 3NYZA 3MSDA 1E6RA 2EKCA 1NP0A 2A4AA 4O1BA 1LLWA 2DP3A 5D2VA 3GFYA 2JEQA 3B0VC 3VM5A 2VRQA 4CQCA 3SADA 3C0LA 2E0PA 1H7XA 3BE7A 4K7YA 1OIFA 5KITA 3EB4A 2E7FA 3R79A 3SIMA 1NJJA 4MJ4A 3INPA 1KWKA 2QCDA 5GQBA 2PS2A 3RPMA 4XZIA 4XD4A 3TK7A 4MJZA 4N2YA 4QLKA 1NF7A 3CT2A 1BRLB 3JZUA 4ORIA 3ARPA 4IXXA 4N9CA 4WSHA 4B5TA 4IHCA 2WLYA 3NVTA 4GVIA 2CESA 4Z1AA 1YMYA 1CCWB 3B0XA 2RKXA 3TA6A 3LCIA 4LVAA 2QAFA 3Q58A 3E2QA 4KWUA 2BB0A 3PZ9A 3SSJA 1TG7A 1R0MA 7ODCA 5HOSA 2DT1A 3M0LA 1JDCA 3UR8A 1GEHA 2BY2A 4BCEA 2PD9A 2P0IA 4XBSA 3ITOA 2EJ1A 4NF7A 5I23A 3QFEA 4LRTA 3ZFHA 4LF1A 4RV3A 3FNDA 2ZE3A 1KXTA 4N9BA 3T7VA 3UXIA 4OT7A 1O4UA 2PDWA 2VFFA 5BRPA 4NILA 1EQCA 4I5UA 4IFKB 4ATDA 1CIUA 3ZT7A 3NQ6A 3KL3A 4QJ4B 5GPRA 5D9OA 2BOEX 1VPXA 3HTWA 3GG8A 2XH4A 3QN3A 1AG1O 4DBSA 1FA2A 1SR9A 3IWPA 3BOXA 2Y88A 4HQVA 3WQDA 2WNWA 4MDOA 2C1IA 2BASA 1GZ1A 3LOTA 1G7UA 2P10A 3CHDA 3OGVA 3GWQA 1JGIA 5BRBA 3MP4A 3W1MA 3WO8A 3TKFA 2P8BA 1X98A 3QLLA 3N12A 4KCUA 1YDOA 3MSYA 4QXIA 2CZ5A 2J13A 5E6ZA 4Q6JA 5BOFA 1EA9C 2I1OA 1ZBVA 4KIRA 2VZSA 4PEEA 4R34A 2PLMA 3W72A 2J4GA 3EB2A 4UTLA 3G3DA 2YDRA 5U4NA 1OZQA 3A21A 3UF9A 1EEXA 2DDXA 1T8QA 5D8WA 2A0NA 7TIMA 4OBSA 4PA8A 5CPQA 4LVBA 3VGFA 3W6LA 3EPMA 2GGEA 1VFHA 1F3XA 1P7TA 1A3HA 3MSGA 3CZ8A 1FWGC 3IK2A 3RM9A 4DWDA 1BRLA 2YCEA 2HPIA 4EOUA 3WQWA 1Z89A 1GVYA 3DDMA 4IMEA 3BPWA 1D9EA 1W2PA 2E4TA 3GVVA 1AQHA 2XVGA 1WKEA 3G0UA 4QRNA 4W89A 2QKFA 3TA9A 1ONRA 1HN1A 2RAGA 2YBVA 1C91A 5G1TA 1FCBA 4O12A 1JPDX 3WLIA 4EXAA 5FACA 1DWIM 3EX3A 3QHNA 4ZFMA 4HK5A 1EZ2A 1OVDA 3W7QA 1XFBA 3O0KA 3W75A 1OF6A 2VX4A 3W0KA 4O18A 4MNMA 3CHVA 3LGGA 1U2YA 4K38A 1XDMA 3TYEA 5KETA 3KM8A 4FLSA 2C0HA 3PSVA 2YIHA 5EMYA 2Z1BA 1EKOA 4PCTA 3GYEA 3A6OA 2NSOA 3PN8A 1V93A 1PDYA 3QC0A 4IFKA 5C5YA 3FEQA 1RHCA 1GYLA 3NZGA 3OYXA 1DQWA 2P88A 5A8PA 3WNPA 3CH9A 4CNSA 2Z1XA 2VO5A 3HJZA 3T8LA 3SY1A 1VLIA 1LJYA 4G9PA 1F6YA 4JTSA 3WNKA 4FEZA 2KX9A 4KRUA 3UR2A 3BV4A 3PTQA 1DXEA 4J3XA 1TRIA 4G1KA 2FGBA 4H19A 1A0EA 1ECEA 2PRMA 3IGHX 4IG2B 5IDZA 2RDXA 5I5RA 2DPEA 3PBYA 2VKZG 1E1FA 1WE5A 1YPFA 1E3ZA 4LU0A 2VDIA 4QE1A 4O1AA 4GK8A 1E15A 3OBAA 4AWTA 1ADSA 5BXTA 3GR7A 4H2CA 4CUCA 1CDGA 5CEWA 3DGBA 4WGXA 3C8FA 3DH7A 4AMCA 4D71A 4O1CA 1GWJA 2RGLA 4Z0SA 2CWNA 3RR1A 3FYYA 1XLLA 1W32A 3AYTA 3N6QA 4YTSA 2ISDA 3PC0A 3LZ5A 1GYMA 3LN3A 3M7WA 3MKCA 3MI6A 5CSRA 3IARA 2VCCA 5CPLA 1C3FA 5CC3A 2ANUA 4IWWA 4JN6A 4B3LA 5D2TA 4YVVA 3QOKA 4GBDA 4CQBA 2R1PA 2OO0A 3DFQA 4U4MA 3AUJA 3IJLA 5HATA 5E9XA 2PDHA 2XIBA 1I1XA 3A4XA 3S1VA 2YL5A 3VABA 1CXEA 1ZCOA 4RUBA 2VRKA 1AL8A 1XRVA 3WLSA 2WC7A 5D4YA 1QPKA 3TN4A 4JTIA 3UPWA 3H7UA 1JI1A 3FKKA 1Q7MA 3V36A 2IMRA 2UBPC 1YXDA 1R3SA 3VIHA 2QIIA 1I60A 3DI0A 3ZJ7A 2Q3RA 2RDTA 2E1DA 3DX5A 1B54A 5GNXA 4ALDA 3CNYA 4OZOA 4Q7IA 1FDYA 3I6TA 4Z2KA 3C56A 3KS5A 3NQEA 4JIQA 4ZOAA 2HCVA 3PG8A 3P93A 3DFHA 4P7NA 1IT0A 4GGBA 3TR9A 3SJNA 1G5AA 1XIJA 5CZKA 4OFCA 4UQEA 4NHVA 5BXPA 3QMSA 3HPAA 3KOWA 3EWBX 4M6UA 2X2GA 1A5SA 4GZEA 4Z0JA 4WQ6A 1EA0A 4Y9MA 4CCDA 1WZMA 3V16A 2INEA 1PHWA 2XIOA 4CGTA 3NYDA 1HZYA 2XPKA 1S2AA 1V0MA 1KWGA 3GU9A 1J0IA 3MBDA 1BVNP 1UG6A 4HOZA 5CH9A 1IXPA 4WHBA 4GVFA 2YDQA 5LHEA 1JZ2A 5BU9A 3UU0A 1EUAA 4F2UA 1K7XA 1RQBA 1QNVA 3RYSA 2Q71A 2NXIA 4FLQA 3BJSA 4NJHA 5F2MA 3A4AA 1EOMA 2Z27A 5ECVA 2MUCA 3NDZA 3CWOX 4IG2A 1I9CB 2VUYA 3KBVA 4QBXA 3W7LA 3VNJA 3WH9A 4AD1A 1DJNA 3UXDA 1V3MA 4F0MA 2V5CA 2XJ7A 2V0TA 3EKGA 1FDZA 1N2VA 2VX5A 2EO7A 4G1NA 4RNJA 1GQNA 2OB3A 2Z29A 4ASTA 4D6CA 1T7LA 4NIRA 3AYRA 1A5OC 3SUTA 1NQKA 2BMBA 5EJ1B 3AI0A 1D3CA 3MY9A 2WNQA 2BVYA 1BWVA 4XD6A 3GU1A 1TJ0A 3A9BA 5C55A 1ODUA 2HISA 1RPXA 2WLZA 3NSNA 4WX2A 3WL0A 1FX6A 4REQB 3H2EA 2HNHA 4TX9A 4F0SA 4YTUA 3TFCA 4O1FA 1FWNA 4HZ7A 4DYJA 4PB5A 1RCXB 2ZUNA 1M01A 2DZXA 2VC9A 4IUOA 4D8AA 2ZX8A 1XIBA 3RM4A 1KTNA 2DZBA 4JQ4A 4ICMA 4FOJA 2J7HA 2J7EA 3HOJA 3PSWA 5I3IA 3M16A 1TIWA 4QS6A 2QGHA 4AUBA 2VR5A 4TR9A 3ZIZA 1CWYA 4K1WA 5CBBA 3BURA 3U0HA 2VR2A 2WVUA 2NUYA 3ZQ9A 2OYLA 3QTGA 2WZMA 3ITYA 4PFMA 3LYEA 3L7RA 4Q33A 2QQ6A 2TYSA 1HKVA 3C0SA 3G1SA 2QZRA 1V6TA 3O8AA 5FJJA 1PAMA 1Q63A 4AY7A 4ZZ9A 2DH2A 1UR2A 3VIMA 4GQRA 2DQXA 3RRXA 2ZX5A 4M24A 5DT7A 1IQ8A 2UY2A 1TQJA 3CPUA 3M5XA 3CS2A 4UWMA 4A8NA 1AW2A 2YR1A 1UBPC 3TH6A 4QP0A 1ME8A 2CLPA 4OKDA 1JYVA 4WSJA 1ALDA 1JPKA 2XHYA 4GYPC 1E0TA 1BXCA 4J3UA 3PAJA 3SECA 2ZWZA 4A3UA 3M0MA 1K8CA 5TQLA 4A22A 4GFSA 1DHPA 4P61A 4XAGA 4UTMA 3NGFA 1L6YA 1XR2A 4O19A 1S39A 4QTGA 1JUKA 4W5ZA 1Y7VA 3B4YA 3SCUA 3BLKA 3F5KA 2H9AB 3V75A 4XX6A 3RUBL 2PGWA 1XLCA 4J3VA 4TIMA 4XZHA 3PHAA 4DJFC 3T55A 3HFYA 2PCQA 1FVPA 2DUAA 1QK2A 2B0MA 2YW4A 3CZJA 4RW3A 1H7WA 4HNUA 4E3TA 3U2CA 1AD1A 2QAPA 2J7DA 4JFWA 5BYWA 5AVNA 4AISA 4FR6A 4W8BA 1CGXA 3LCHA 4MYAA 1VRDA 3AMGA 1VFUA 4PUUA 1UWSA 5E5CA 3C2FA 5LXEA 1KLZA 1EP3A 1RLDA 4REQA 3S9IA 3W2LA 4ERIA 2BXZA 3MKVA 4FXSA 1MRQA 1KO0A 5AC7A 3FXYA 3UZJA 2QCFA 4JTDA 5DRCA 2GOUA 2F6UA 4ZMGA 4ZQPA 4UQAA 1XLEA 4TVCA 1W9VA 2YL8A 1F76A 3FDKA 1LBMA 5LYRA 1UR9A 3K5XA 4IJCA 4L7ZA 4V1YA 4B3ZA 2FTWA 4IGHA 4E4UA 2WNNA 4JN7A 2GL5A 4GI4A 4QG9A 1YEYA 2AAAA 4XZLX 5LHFA 5E9AA 3IS4A 3VTRA 3QQ0A 1TWIA 3NQ7A 2WPGA 4AZ7A 3DUGA 2Y0FA 3LLFA 1KKOA 5LIYX 1N8WA 1OABA 4YTRA 1HKIA 2NX1A 3CB8A 2DZPA 3MZNA 3NO3A 3BLEA 2WYSA 4GWEA 3IGSA 4QGCA 4MKVA 4CCZA 3NWRA 3T4CA 4O10A 5CZJA 3WZ0E 2G3MA 1MQRA 1X6LA 4C1KA 3LCXA 5CGQA 2BY1A 3R58A 1EJUC 4G5DA 5G2HA 1LRTA 1FY6A 3L4TA 3LRMA 1FWSA 3M6DA 4PCNA 1LBLA 4GI8A 4QG8A 4B92A 2CLKA 4C6FA 1FWTA 1MW2A 4DXVA 3H8AA 3FA3A 4JTCA 5EMUA 3VD3A 1AZ1A 2GGIA 2P5NA 1GKRA 3EXTA 5FL0A 2VJXA 5IM51 5KINA 2BNJA 2OELA 1XXXA 4Q4PA 2H9AA 4UR7A 4Q4MA 3F4CA 3WFZA 2IPGA 4RE3A 2OKTA 3A9IA 1XIMA 2PZ0A 2Y5EA 4UTTC 1YTKA 3WMBA 1HJWA 3OO2A 5LNSA 3SY5A 3P8IA 3EOUA 3CHEA 4NJGA 1I2OA 1BSLA 4O4WA 4GGHA 4ZEPA 5I06A 1PIIA 5HQEA 3MVIA 1M7PA 4QLJA 5FJIA 2VM8A 3AICA 3VC5A 3LLDA 1FWJC 1KM3A 3FA5A 1PX3A 4DB7A 2Z0IA 3WD3A 4ZO9A 2D24A 5HJXA 1GVRA 3ES7A 3POCA 3PZIA 2VX7A 3HV9A 3F1QA 3VIFA 4L61A 4YS1A 4PTWA 4HNLA 4NZ4A 4KS0A 2GJXB 1GUVA 1W6TA 1P6BA 3AMCA 1TPWA 2Y8UA 2V5BA 4NXSA 3L0NA 2ZRYA 3W01A 4AWUA 4H9ZA 5LNVA 3HPSA 2W91A 4KKXA 1QR7A 1JF6A 3VYLA 2V38A 3HO8A 4IL2A 4ZOBA 4DJDC 1BYBA 1IWAA 3W6MA 3C2EA 4S3CA 4IPIA 3L4WA 3EMZA 5LA1A 4C6NA 4IF2A 3PJTA 2F2KA 4PMZA 3W38A 3TYBA 1CXLA 3FX4A 3M5VA 2YYTA 4AXNA 3GNDA 3N14A 1GOWA 4Z1BA 4GNVA 4FNUA 3W7PA 3E0LA 1O5QA 1J9YA 3THDA 1RVGA 1VAHA 3STCA 5I3DA 2CBVA 3NFUA 1T8XA 1GVFA 4IMFA 5HUOA 1LWHA 4F4RA 3TU9A 3EWXA 3PFRA 4W7WA 1MEWA 3DBNA 4NZ5A 3EYPA 4ZO6A 2Q8XA 1YDNA 4DO4A 1XKJA 2WVVB 4E2DA 3DG6A 1UD4A 1HJVA 3R1ZA 4P7QA 5GJNA 4LUSB 4WDUA 3LQGA 2IXUA 1AD4A 4A3YA 2FZMA 3RHGA 3L4ZA 4MZ1A 4Y90A 2Z28A 5KMYA 1KBJA 1J2BA 5FA5A 1QI4A 4MAVA 3O63A 1CT5A 4BQ5A 2FB3A 1GEQA 1V0KA 3HG4A 3IGUA 1RZMA 1JRBA 3LG3A 5AY7A 3NSXA 2QS8A 2D22A 2VFEA 2BSLA 4FXJA 4M7TA 1XI3A 1VJIA 1TZ9A 4GHRA 5ABEA 2C0AA 4GX8A 5T9BG 3GH5A 4P8XA 3FIGA 1XCFA 2DSUA 3CMGA 4MB5A 5BWFA 2HS8A 1OWQA 2FJUB 3G1HA 1GOXA 3VUPA 2Q8ZA 3T07A 1W8GA 1NWTA 4Q8TA 1BG4A 3GXPA 4PL2A 3N6HA 1X1OA 4AD2A 3UY7A 2A85A 2NVAA 2V5JA 4HNCA 3BJTA 4HT3A 3EWDA 2GJXA 4XISA 3U7VA 5I02A 4CD7A 3DGRA 2INFA 4IQLA 4CQ8A 2Y63A 3M46A 1VHNA 1KFWA 4HPNA 3VOIA 1QUMA 3ITGA 1K6AA 2V82A 5J8LA 1POKA 1R6WA 2HRWA 5A8MA 1JQXA 1T5AA 3FW6A 3SGZA 2G41A 3GDMA 4ZQNA 2RJHA 3A22A 4XO7A 4OJYA 1Q4NX 1WDQA 4A3RA 3EMQA 1E5NA 5CSUA 4CU7A 2HSAA 4X3ZA 3KVJA 3Q4DA 1VENA 4R53A 3RITA 3ZYZA 1ISXA 4GMEA 3CHFA 4BK9A 4CQ9A 4ICCX 2GGJA 1OK4A 3MUZ1 4BI6A 3WDJA 1A5LC 3L0KA 1BWKA 3WLMA 4DXKA 1W5MA 4R7JA 3K4WA 3L2LA 1KV8A 1F05A 1WOAA 2IS7A 2Y62A 1JCXA 1V4YA 2WVVA 4BHYA 3I7QA 3F4VA 3QYQA 3DBPA 4H4IA 1VJZA 3CAWA 2X1UA 2PDNA 1RLCL 3HGSA 4HMNA 4LUSA 3UWWA 5CZTA 3P60A 1BKSA 1AODA 2VOMA 3C6CA 3L0GA 3GTIA 1OC7A 3EX4A 3QRHA 4O0ZA 3FVMA 4FIRA 3CV6A 3RX2A 1GZJA 1QXLA 4UZUA 2DT2A 4ZQMA 2D0FA 2W62A 1VCFA 3QSRA 1KBKA 2E67A 3AFBA 1K70A 5HMSA 3ID7A 4AD5A 5I3GA 4Q8VA 4TU1A 3DERA 5HR6A 1GOOA 2Z1KA 3GTFA 4I8YA 4PUWA 6REQA 4NNAA 3VINA 3B8SA 1JQVA 3HG2A 3YPIA 5KZEA 1FHDA 4EXBA 1IE7C 3S5NA 3B8IA 4BEQA 1X7IA 1MUMA 1U30A 4HSOA 2DH3A 3N1AA 4PFHA 1UOZA 1XIFA 3GD6A 2DSWA 4OBRA 1KRCC 2PDCA 3QFWA 3R89A 4HIBA 4TXEA 3KZSA 3OYZA 4L9YA 3LCWA 4WIWA 5CJ5A 2MNRA 2O7QA 2WHKA 3S5OA 3B8UA 2DZVA 3TMLA 2FDSA 3R0UA 3VPLA 2C1HA 3T2QA 3GNPA 4MM1A 4IIHA 1E9IA 4OGZA 5I0DA 1D3HA 5I09A 4ENLA 4FNRA 3EAUA 2OTDA 4LEFA 3THUA 4C6PA 3UJEA 4O13A 1DL3A 5D32A 5D2XA 1H09A 1UA7A 4FO4A 3WLHA 1V08A 2IPJA 1M41A 4E8CA 1J96A 3MJYA 3VIGA 1JZ3A 1X97A 1HJSA 2TAAA 5K9CA 4N4PA 5EMMA 1K4GA 5HQMA 4V33A 4JHOA 1JNEA 2IPWA 3N9SA 3AROA 1C9WA 4HHMA 2Y70A 4ZE5A 4AX7A 3AZSA 1I75A 1HL2A 1XYLA 3M6YA 1EH9A 4YHEA 4QHRA 1G94A 4V27A 5H2ZA 3MS8A 4RZBA 1VHCA 2GZXA 3H23A 2OZ0A 2VFDA 1J0KA 1DE5A 4JIRA 3UPMA 4LUYA 4QITA 4EACA 1XLIA 3MMDA 4W9TA 4ZXOA 1PJ9A 1W3HA 4RK8A 1IXOA 1U1JA 2PDKA 1JVNA 1W3IA 4FALA 1US2A 3W1LA 1J0HA 2G4FA 5JUVA 1UZ1A 1G7VA 4JFUA 6XIAA 2C7FA 3PR2A 3VNDA 3WF1A 3EB3A 2ZXDA 1M3UA 2VP8A 3VD5A 4DZHA 4ZA0A 3NZQA 1IGWA 1POJA 2PF0A 2VDHA 4YCOA 3U4FA 4PMNA 4D9PA 1Q7QA 1E72M 3PK7A 1CYGA 1OC6A 3ABZA 4RV8A 2X09A 3Q2DA 2ZUVA 1PX4A 4J3SA 1W91A 3QHMA 4UBPC 1OG6A 1TPB1 3ITCA 3NA8A 2PCEA 1TPH1 1RJRA 1OFDA 5I3HA 3PVFA 2DZAA 1O7AA 5DRIA 3V3WA 4PTNA 3LEPA 7XIMA 5U7SA 1K9FA 1TFVA 1E73M 4NAFB 1A5KC 3LHVA 3R0KA 4EAMA 2WMIB 1MW3A 4AWSA 4N9EA 4AAJA 3DC8A 1IV8A 1TREA 4L1GA 4UZSA 3RPTA 3WD0A 1Q13A 4GZJA 2YPIA 3T6CA 4UTUA 3WEOA 3Q37A 1KGXA 3H4GA 2WMJA 1GPFA 3M44A 2REQB 4LXFA 3MPGA 5KZ6A 1REQB 3EDDA 3N2CA 3DZ1A 3E0IA 3E0WA 4B5NA 5J5RA 3OP2A 1EWEA 1M65A 1IR1A 4JBRA 1GTEA 3A3HA 3M41A 4GNJA 1LG1A 2Y85A 3SY8A 1IWBA 3P6LA 4HTBA 1H63A 1YKWA 1Q6EA 3S8HA 3H22A 3MZ2A 4DWSC 3B03A 3GXIA 4K6AA 2V63A 3QR1A 1HIZA 2Z4GA 4HNNA 4HPHA 4UTTA 2OZ3A 4BF5A 5I78A 3ZT6A 4XVDA 2QULA 1YX1A 1ZJAA 3K46A 4KPLA 1EBGA 2PWDA 2NQZA 2AKMA 2FGZA 2V5KA 3LV5A 4XIAA 2QDDA 2VEMA 2QV5A 4B5WA 3T09A 3EXRA 3W7OA 1XCWA 2NV2A 2Z6JA 1DORA 3GU2A 2PDMA 4PUMA 2XVPA 3S1XA 5KTLA 4M3PA 1UH2A 4XBKA 2GUUA 2W27A 4JY9A 4AIBA 3SR7A 3GIPA 2J9XA 3AS1A 1MEHA 5AYZA 3RAOA 1PS9A 3QOMA 2XH7A 1M03A 3B8WA 2B7PA 1OSEA 1H7PA 4OQVA 2WMFA 4NNCA 2FZ9A 1XUUA 4RX0A 1UC5A 1XLKA 1XG3A 4D6EA 1UIOA 3W1AA 2NVCA 1JPIA 1OGBA 1HGYA 3MW7A 4GUHA 3BWWA 4J40A 4L6HA 5M03A 2XTKA 1H5YA 1ITCA 3EOLA 5F4WA 4K8GA 3EDJA 2FPYA 2XFWA 3EX6A 2P3EA 2X41A 3S3GA 2G97A 3MWAA 2FVMA 1WCGA 1XQLA 4BFAA 1JFHA 3KAOA 2P50A 1A53A 1PWLA 1M9HA 1E4MM 2QNEA 1DJQA 4RDYA 4XSMA 3GAYA 1OCBA 2W92A 3QZEA 3F4WA 3P81A 1O5KA 1NOFA 1TYGA 3R8GA 1J12A 1H5VA 3ABXA 2ACUA 1FFRA 4LF2A 1V03A 1XPYA 1PIGA 2B7OA 5DCDA 2PDPA 2WMIA 3QMRA 4MY9A 1TV2A 2E25A 2ISFA 1ZUAX 5GJMA 2FHCA 1GZGA 1PVNA 1G4TA 3SEPA 2HXTA 2XUCA 1Z42A 3VKJA 2YBUA 4F0KA 2FVLA 3M64A 2ZA2A 1PKMA 4JCMA 3L4UA 2CFFA 1SR0A 3AAMA 1REQA 2R82A 2DT0A 4JL2A 4GUJA 3KRBA 2J77A 3ABRA 3AO0A 3WJXA 4I7UA 1GOKA 3TN6A 1WXJA 1B5TA 3W7MA 3RU6A 1BWLA 3M0XA 2E6AA 5CSSA 3U5YA 2G3IA 1XD0A 1VZWA 3NQ2A 3FHQA 1KA9F 1O5RA 2ATMA 4KF1A 3SUWA 1VFSA 3GHRA 3TWAA 2ASHA 2DUZA 1HX0A 2C15A 5CXPA 3WF2A 3ONBA 4H7VA 3XISA 3BSHA 2ZUTA 1KCLA 1QW9A 3N2TA 3W73A 1XRTA 3W1QA 2DVUA 5CC6A 3I6RA 3I6EA 3ATYA 5HUPA 1IZJA 2ZX6A 4FXRA 3G6MA 3ZWSA 1PX8A 3A12A 3SRDA 2OGJA 1R38A 1R3WA 3W7HA 3UNTA 2HPMA 3TMQA 5AN7A 5DBTA 1F61A 4AF0A 5HA7A 4Q4RA 1HJXA 2W61A 5BOEA 4IX0A 2VEFA 2WKLA 3K8LA 2E40A 3GZAA 5FCZA 3QMTA 1X38A 1OYAA 3DAQA 3O15A 1ZRQA 2WOQA 5FF2A 3QR0A 3WMSA 3PZNA 3GXNA 1MO0A 3DG7A 3CO4A 2BZNA 4ZGYA 2XYLA 4RR4A 2TMDA 2EHHA 1H62A 3F2CA 4RE0A 5G4HC 1M1BA 2ESCA 4U2YA 2H3DA 1JNDA 4HU3A 1RH9A 2CKSA 1NAL1 2J7FA 4LT9A 1ZAIA 3M4HA 4Q8OA 3DYMA 2E5BA 1GHRA 4NXKA 2R8WA 1J0JA 1JCNA 2NQ5A 3ZJ8A 5FIPA 4Z17A 2EQDA 2AMXA 1JXKA 4ILSA 3IUIA 5FD0A 3AMDA 2ISVA 5LNWA 3MI3A 4AX6A 3PWIA 2QGYA 3W1UA 2GWNA 4HA0A 4M81A 3P3BA 4TV5A 2CW6A 5T26A 3K1GA 1THFD 3B04A 3CJPA 1XGZA 3NQMA 4C6CA 3VDBA 3BLFA 1UB3A 2PBOA 4FF7A 2NWRA 5IFTA 5EMLA 1ZAJA 4GE8A 4C90A 4H00A 1ZLPA 1IIHA 1AJZA 1R9YA 3FFSA 4I7WA 4YVXA 1ML1A 4JTHA 1XIGA 1U5JA 3E02A 3L21A 2F2HA 3FJ4A 2CBIA 2GUYA 4O57A 1U83A 1F6KA 3DFSA 4E4PA 1PKLA 4K2SA 4OV9A 4HOWA 1QI2A 1MQPA 2FJKA 3IJ6A 3ZR6A 3O7UA 1PSCA 2ACRA 4UNKA 3SUUA 3ZT5A 3BAJA 5FOOA 1WNOA 1FCVA 3WG6A 4AZCB 5FF4A 4DYEA 4FOKA 4Q4KA 3AIWA 1AQMA 4GQBA 1TE6A 2X1RA 4CNPA 1WA3A 3L23A 4I7VA 2PTWA 2FDMA 2IQDA 1XDLA 4D6DA 2ZTJA 5EB8A 3OZOA 4DI8A 3KW3A 2OJPA 1LYXA 1UBSA 3NQDA 4ERGA 1FHVA 2VVSA 3D5HA 4L1XA 2Z7KA 2L5HA 3H21A 1UP0A 1XYMA 4P7OA 3KBSA 4MLRA 3F5JA 3GRIA 3UA4A 4ERAA 4QQUA 5EJZB 2GDQA 4IMDA 3GBEA 1J79A 1V77A 1IIGA 2WJDA 3LERA 4QNWA 4PRTA 2WCAA 3PB0A 3I3EA 2VD8A 3MC5A 3DECA 2FYMA 4AYSA 9CGTA 2OG9A 5C2CA 3DFPA 1KC7A 4AMAA 4CEUC 1F7BA 3MWCA 4QDPA 4HP5A 1C8YA 3QZ6A 4IM4A 3O1NA 1SO3A 1VIZA 3VNMA 2OGYA 4M0XA 2TRSA 5A6SA 4M6QA 4C5YA 3TTQA 2IKGA 2D0HA 1QMLA 1FWCC 3UBPC 4JFTA 4PH6A 2B81A 3VZZA 1E5JA 3VOFA 1EP1A 2FPVA 1L2UA 3GE7A 4Q4OA 1U1UA 3BLLA 1CI1A 4GC4A 2VT0A 3V5FA 3ARRA 5D04C 3W74A 5JH1A 1DIKA 3ZVIA 1A5AA 1MNSA 4BI7A 3EEZA 1DJWA 4IQDA 3QY6A 1XWYA 1H4PA 3LBCA 4LOCA 2PAJA 4PCFA 2CKRA 1UKTA 4JFSA 3W27A 3M9YA 4AHOA 4WXZA 3D46A 2XIIA 4RDVA 2QCEA 5A8GA 5D05A 2NQ9A 1IEVA 3UT0A 2PLKA 2HQAA 4M80A 4QJ3B 1LRNA 1ITUA 3UZ5A 5F4XA 1NTHA 3NEVA 2OPJA 4YHGA 4UTWC 1WPCA 4IPPA 4HU4A 1TMLA 3GXFA 4HG6B 4QROA 4S3FA 3LDVA 5ABFB 5BOOA 4LANA 3AIRA 3TXVA 3T05A 3II1A 2WJEA 4MAZA 4RJEA 2E8ZA 2EKGA 5E0FA 4G7FA 3BCFA 1KFLA 4LGXA 3IIZA 4NUWA 2NT0A 1GOQA 3B06A 4AZCA 1B4EA 2J25A 3GW3A 3R13A 4EE9A 2QCHA 4HA1A 1FH8A 3CUHA 4WDXA 1HO4A 2HK1A 4BEUA 4AC7C 1XH0A 3HZ3A 3GBDA 1J11A 4WF7A 3FJ6A 1UUMA 4ZENA 2C6QA 6CGTA 4P8WA 5A8OA 4LY8A 1O94A 3MYOA 4ZTXA 2NX9A 5CBIA 4U2ZA 3GXDA 4AIOA 4OOZA 4XG1A 1ZQ5A 4UFIA 1R3QA 4TOQA 1NDVA 1I2RA 3FHAA 4K8HA 5IHSA 1WKFA 3NVDA 5RUBA 1VBRA 1NY1A 2VCAA 1PL9A 3ITTA 3HQ1A 2CXEA 2V67A 2ALRA 4AY8A 3DHDA 2XN0A 1QTWA 1R87A 2HTMA 2R1LA 3ARZA 5G2IA 2WJZA 4O17A 4LVGA 3TN3A 2WZEA 4DNHA 1XC4A 5I24A 3VOHA 3U2EA 1XJBA 3R4IA 1U33A 2PUZA 4A8RA 1WBHA 3DFYA 3G1DA 3WELA 5C7HA 3MI2A 1WO2A 3T0AA 5ABGA 3AYVA 1A3WA 1J6PA 1QW8A 4W7VA 4JY8A 4GH3A 1LROA 4MFDA 3W53A 4WY0F 2QDHA 1SW3A 4CD8A 1XLBA 1G1YA 2ICSA 5FAJA 2ZX9A 1XCXA 3T40A 5DF0A 4ZB0A 1CX9A 1J8VA 4O8RA 2FMOA 1E6NA 1O1ZA 3VO0A 2ZZ2A 1H1ZA