3SUTA

Crystal structure of beta-hexosaminidase from paenibacillus sp. ts12 in complex with pugnac
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
519
structure length
504
Chain Sequence
HHHHSSGLVPRGSHMSQPSILPKPVSYTVGSGQFVLTKNASIFVAGNNVGETDELFNIGQALAKKLNASTGYTISVVKSNQPTAGSIYLTTVGGNAALGNEGYDLITTSNQVTLTANKPEGVFRGNQTLLQLLPAGIEKNTVVSGVQWVIPHSNISDKPEYEYRGLMLDVARHFFTVDEVKRQIDLASQYKINKFHMHLSDDQGWRIEIKSWPDLIEIGSKGQVGGGPGGYYTQEQFKDIVSYAAERYIEVIPEIDMPGHTNAALASYGELNPDGKRKAMRTDTAVGYSTLMPRAEITYQFVEDVISELAAISPSPYIHLGGDESNATSAADYDYFFGRVTAIANSYGKKVVGWDPSDTSSGATSDSVLQNWTCSASTGTAAKAKGMKVIVSPANAYLDMKYYSDSPIGLQWRGFVNTNRAYNWDPTDCIKGANIYGVESTLWTETFVTQDHLDYMLYPKLLSNAEVGWTARGDRNWDDFKERLIEHTPRLQNKGIKFFADPIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-hexosaminidase
publication title Gaining insight into the inhibition of glycoside hydrolase family 20 exo-beta-N-acetylhexosaminidases using a structural approach
pubmed doi rcsb
source organism Paenibacillus
molecule tags Hydrolase
total genus 192
structure length 504
sequence length 519
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF02838 Glyco_hydro_20b Glycosyl hydrolase family 20, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3sutA01
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3sutA02
2G4FA 4WSKA 2XJ7A 2VUYA 3SEPA 4CUCA 3NJ3A 3VDBA 2XG9A 4D6CA 5CGMA 1KBKA 2DH2A 3N1AA 5DF0A 3CHCA 2XIIA 3WD4A 1W3HA 2QMKA 5F7UA 1QI5A 4GZEA 2ZUNA 3ZR5A 3T09A 5A6BD 1JFHA 3CZEA 2EPKX 3SCOA 1VAHA 2DT0A 3WEOA 2GSJA 3NSMA 1UZ1A 3OLIA 1K6AA 3WQWA 1HKJA 4HOXA 3AZSA 3SUVA 2DIEA 3EMZA 1AMYA 1Q6EA 1QW8A 5I23A 2Y4SA 1OT1A 2CETA 2C0HA 4GXPA 5BXSA 3MUY1 3TTOA 3W38A 4GI6A 3K1DA 3PZOA 5E70A 1US3A 4EE9A 2PWGA 2W67A 1HKKA 1V3IA 1EH9A 1OWQA 3W0KA 1B0IA 1BHGA 3ARYA 2QPUA 1EOMA 1RP9A 5CQ1A 2XUCA 1XGZA 2J8GA 4DWSA 3RDKA 4CU6A 3UG4A 1C8XA 1WZKA 2JF7A 1XH0A 4KGLA 3OZPA 2ZWZA 3POCA 3MANA 1CEOA 3CHEA 1OGSA 1JZ4A 1J11A 4BQ4A 3N18A 3W6LA 1CIUA 5BXPA 3AIVA 1J0KA 4JFWA 3PTKA 1CGYA 2D0FA 3SCVA 1GHRA 2BFGA 3VIIA 4ACZA 1JAEA 4AZ5A 3WMSA 5IFTA 1LWHA 1LQ0A 1DWHM 1UD3A 3WF3A 4YHGA 3ARPA 4B9ZA 2XM1A 4ATLA 3MUAA 3VD9A 4B9YA 2IUZA 4M8UA 5FKYA 4OUEA 5I2UA 1GOKA 2BXZA 2EQDA 1KXQA 2X0HA 3HU7A 5AYIA 4BQ5A 4AY1A 5CZKA 5M3WA 4OOZA 2OLHA 7CGTA 2F61A 4AZCB 3U7BA 4HZ8A 4AIUA 3THCA 4UFJA 3GXMA 4MB3A 4XZWA 5EFFA 1GQIA 1D7FA 3WDQA 4GZIA 2E3ZA 1KGUA 2YL8A 4FLOA 3L4VA 3GNOA 3LPGA 1GOOA 3AMGA 4UFHA 1QNSA 4WK9A 5D9PA 4CCEA 3WF1A 4E8DA 4IPNB 3VU2A 4GZJA 4QLKA 1JI2A 1EHAA 3I3BA 1QI3A 3VGFA 4Y7EA 3PTMA 1FP9A 3GTNA 1PX4A 2QF8A 4MNLA 1M04A 4JFSA 4JFTA 3VNYA 1QVBA 3L4UA 3OG2A 3NDYA 5AYBA 1OD0A 2WBKA 4LXFA 4EK7A 4RE2A 2W61A 3VINA 4U31A 1CXKA 1E5JA 1W91A 3GH4A 1GNXA 2YDRA 4FLQA 1TVPA 1G01A 5CPSA 2YKKA 1KR0A 1X1NA 2C7FA 4V28A 4AZ6A 1E4IA 1RH9A 1RPKA 1UR1A 4M80A 3WNOA 1W32A 1FFRA 4J3WA 2J25A 2E9LA 4CN1A 1JZ7A 3VIHA 1FFQA 3AHYA 1E72M 2PB1A 1W9DM 3AMDA 3ARTA 1C7TA 1E4LA 3AYRA 3ZSSA 1D2KA 4Z2LA 1BYBA 2CNCA 3BCFA 1KQYA 2WMIB 1D3CA 2XVPA 4QCFA 1KGWA 4PMOA 5I3DA 3WQ5A 1W3KA 3W81A 2V3DA 4B3KA 2XWEA 1UH3A 3G6MA 4OOUA 3PZMA 1MW3A 1NOWA 3N9KA 3WQ4A 2VX6A 3AYSA 2F2HA 1HX0A 3VX1A 1DWJM 1NARA 4MADA 3T08A 1J12A 3GNPA 1G94A 4BF7A 4PCSA 3ZT7A 5A8MA 5A69A 4WSJA 2EPOA 2PWDA 2G41A 1FA2A 3WF4A 5DFAA 4H2CA 3OGRA 2A3AA 4MJ4A 5BRQA 1BPLB 3BSGA 4NSBA 1JGIA 1JZ6A 4JHZA 1QHZA 1F4HA 1I1WA 3SCWA 2XVKA 4H8HA 3WEZA 5A3HA 1SYTA 2VRKA 1GQJA 2EPNA 3CO4A 2OWCA 4OKDA 2VX4A 4FLRA 2OSWA 4DM1A 3VIFA 1WPCA 2MANA 4U33A 1QNQA 4P7OA 1ZBKA 3CGTA 1ODUA 1W1YA 1XYZA 8A3HA 1TG7A 2OYMA 3EBVA 5DT5A 1HIZA 4YHEA 2VMFA 4W88A 4W8BA 1XC6A 3WQ6A 2OWXA 1UD6A 2YA2A 3FW6A 5LYRA 4V2XA 3CZGA 1XSKA 1NM9A 2W62A 4UFMA 4IISA 3POHA 1EHNA 3ZT5A 2VQUA 3B8SA 2NT1A 5LA1A 4K68A 1XHGA 3TTSA 1CDGA 2ZE0A 2ZUSA 3T2OA 3VMNA 1UWSA 2DIJA 1W2PA 3SCNA 3L4ZA 1HL9A 4UQ9A 4D72A 2WPGA 4QFUA 2CBVA 4PMDA 1W9UA 1TR1A 4EKJA 1Q6CA 2O9TA 3PZ9A 5E6ZA 1R85A 4GQRA 2EXOA 2XIBA 3WD1A 5M17A 4D1JA 5DEZA 2DSWA 4IUGA 2CPUA 1U2YA 1EO7A 2JF6A 3PZNA 2G3IA 5HOSA 3SURA 1GHSA 3OLDA 1CXFA 2GJXA 2CERA 3A6OA 5A8NA 1W9PA 2XYLA 2VX5A 4U2YA 2FGLA 1CXLA 2XHYA 1DP0A 2AOSA 2YL6A 2C8NA 1V6YA 3MS8A 4OIFA 4HA3A 4XUYA 3ARVA 3WH9A 5LA2A 1E0VA 1XSIA 5BCAA 4DUXA 3D5HA 2D0HA 2WM0A 2VOTA 2D23A 3CHDA 3VIOA 2W63A 1EGZA 1V6UA 5A8OA 4TUFA 2A3EA 4URIA 4AD5A 1V02A 1EO5A 4AW7A 3KZSA 2BS9A 1H2JA 5KZ6A 5HPOA 6CGTA 1MFVA 3NCOA 3WD0A 1WKYA 1WDPA 3VD7A 2Y8KA 1HVXA 2PI6A 2EPMX 1CPUA 1JDDA 4W7WA 2J8FA 1UA7A 3RM8A 3AS2A 3N15A 4D6GA 4TX8A 2EBNA 4GO9A 1B30A 1W1TA 1EXPA 4HZ7A 2XVGA 3U5UA 4Z2IA 3AS3A 3EYPA 1E3XA 1W2VA 4CD6A 1H0GA 4UQDA 3RCNA 1K9DA 1ESWA 4AEEA 1J0IA 3AMCA 1UWIA 1UD4A 3QHNA 1UR2A 2HVMA 4D6EA 1ISWA 4TTUA 1E6PA 4H04A 4PMXA 2UY4A 2VTFA 2WVVA 3N12A 1XV8A 3MSGA 2CYGA 3VX0A 4XB3A 1UH2A 2W5FA 2WVTA 3IJ8A 5FL1A 5E0FA 1VEPA 1FP8A 1JNDA 3RJYA 3WENA 4JKKA 5D4YA 3TONA 5BYWA 2YLAA 1E5NA 1OD8A 2WHMA 4AD0A 1HJXA 1HF6A 1WZMA 5GNZA 4PEEA 1CECA 1ECEA 2GK1B 1NOUA 1CLXA 4NI3A 4GPNA 5A6LA 2ZXDA 3WIJA 3IANA 3AXIA 4CD5A 4UFLA 3CIVA 4UQAA 1R86A 1QHOA 1H4PA 5GNYA 4R5EA 4D1IA 2WHLA 1VF8A 3AISA 1H1NA 4UFKA 3GBEA 4UOQA 4J27A 3VM7A 2ZX9A 3VGDA 2OSYA 2ZWYA 3WF2A 4DWSD 4V27A 3VGEA 1TA3A 2Z1SA 5IFPA 3U7VA 3BSHA 1ZU8A 1UWRA 4JCLA 5CJ5A 3ZJ7A 5EBAA 1BFNA 3IJ9A 2EEXA 4HMDA 4LYRA 1E0XA 1ZBCA 1UR9A 3A47A 2V38A 4GIAA 3QR3A 4PTWA 3W24A 2WZIA 3WKZA 3WH8A 3GH5A 1NWRA 3AXHA 4FMVA 1X6LA 3NSXA 1Q6GA 3WFZA 5CLTA 3T0AA 2OYLA 3K4DA 3A4WA 4KH2A 1X6NA 3WFLA 1GZJA 5GPRA 1MQQA 2IXVA 1DWFM 3LMYA 2FH6A 3RILA 4ATWA 1QI0A 1CXIA 3RIKA 1VFUA 3QOKA 1WDSA 4WKFA 4U3AA 3DHPA 4QLJA 3MMDA 1CZ1A 3AIRA 4WJXA 3SCQA 5CG0A 2J4GA 3VVGA 3W6MA 4P8WA 1AQHA 4PRWA 1CGWA 2DSKA 3GZAA 2X0YA 1NOFA 4TOQA 4D6FA 1H5VA 3GNRA 1VBRA 5GNXA 2VCBA 3VMPA 3WQ8A 3CUGA 1E40A 2VNCA 2VR5A 4PTVA 4C7GA 3N13A 4GI9A 4AIOA 2BVYA 2J78A 3VPLA 1E9LA 4JL2A 3AHZA 3WMBA 4J3SA 5BROA 3ZM8A 1TE1A 3ECQA 5EMYA 4MJ2A 2QV4A 3MV11 4NRRA 3AOFA 1TZ7A 2GDUA 3VTRA 1WP6A 4W7VA 4P8XA 1V3MA 1AQ0A 2XFYA 4DWSB 1H11A 4M1RA 1H09A 4W93A 2WCAA 1CWYA 1PZ3A 4BQ2A 3MU7A 4PSRA 1FHDA 3AIQA 1V0NA 4TTGA 1U30A 4ZEPA 4JKLA 1KXTA 1JYXA 5EB8A 1W1PA 3BAKA 3WDHA 2PF0A 4D71A 1E6NA 1EA9C 2CBIA 1BSIA 2E9MA 3VIMA 4F79A 3II1A 3E1F1 2WC3A 2WVUA 2O92A 1NWUA 3W25A 2PBOA 2WB5A 4AZIA 4WLCA 5JIWA 1KFWA 4PTMA 1Z32X 3SCSA 3CMJA 4FLSA 2CCRA 3RPMA 3BCDA 5HNNA 3ALGA 3ZIZA 1V0KA 4H8VA 3EDEA 3AHXA 4CN4A 5A94A 4P8UA 3F5JA 3IK2A 3ZT6A 4HOZA 2JEPA 2ZOXA 2DEPA 2UY2A 2J7DA 1J0JA 3K8MA 3S2CA 3AJ7A 3BH4A 1G0CA 3WDJA 1MW0A 3HJEA 1E6QM 1CYGA 4S3JA 5EFDA 3WUEA 4HOWA 3NYDA 1GOMA 1FH8A 1XYFA 1GONA 1MWOA 3OA5A 4JZ5A 4B15A 4TXEA 1V02E 2BNJA 2W66A 1GORA 1MXDA 3WDRA 1JFXA 2JFEX 3WL1A 1KWGA 1JXJA 2VJXA 5A6BA 1IT0A 4W7UA 4Q7NA 1BF2A 4CD8A 2J7FA 2X2YA 3PZQA 2DT3A 4TVUA 4M81A 2WAGA 2GUYA 2WVSA 3SUUA 3BAIA 2XTKA 4J3VA 4JKMA 4EAMA 2UY3A 3A4AA 1LL7A 1WAWA 4W87A 2V3GA 1DWGM 2JIEA 4RE4A 1RP8A 3WH7A 2FHBA 5A8QA 3ZJ8A 1UHVA 4J3XA 1V03A 1QOXA 1EDTA 3MUZ1 2VURA 1OINA 4MNJA 2D3LA 3F5LA 1LLOA 1H41A 3LPFA 1XRVA 1NP2A 2WXDM 4JAWA 4CCCA 4L4PA 2VVSA 3CZJA 4UTFA 2ESCA 1O6IA 1V6VA 2ZIDA 1UD8A 3ZOAA 1YHTA 5E6YA 3ARUA 4M82A 3OLEA 1JZ3A 3LPPA 4D6DA 1DEDA 2E4TA 3WBEA 4W86A 4JCMA 3CTTA 1OCQA 4J3TA 2QMJA 1B3VA 5D9MA 2CKSA 2D3NA 3K8LA 1UR8A 4UZUA 1ISYA 1HP4A 1HKMA 4ACYA 1BYDA 1I1XA 5D8WA 1LF1A 1BAGA 1E56A 3PZIA 4P8VA 3ALFA 3QHOA 1EDGA 1W9VA 4P7QA 2BY0A 3W28A 2E8ZA 2VR4A 1R7OA 1UOKA 4QCEA 1JZ2A 5E9AA 2E9BA 4AD2A 3K46A 3AROA 3K8KA 3PHAA 3T0BA 2WMIA 1E4MM 3MKKA 2VRJA 3AMKA 5BXTA 4WKAA 4H8UA 4U3CA 1B9ZA 2ZICA 4PYSA 1JD9A 2WCSA 4PMVA 1WDQA 5DO8A 3BMWA 4WKHA 1GOIA 3UETA 5C70A 3FAXA 1VJZA 1V3LA 3PN8A 1SR0A 4P7LA 3VGBA 2FHCA 2ZXAA 3ZR6A 2VC9A 3PZGA 1V6XA 2O9RA 2VZOA 4C90A 3FHAA 1JYWA 4BA0A 1G9HA 1E1EA 5I0DA 1HP5A 2VQTA 1E43A 1CGUA 3M07A 2ZUMA 4AZGA 1C3FA 2VT0A 5I79A 4D6IA 3WELA 1IV8A 3B9AA 1J9YA 3L4WA 3GXFA 4UNIA 5A2AA 1I75A 1EIBA 2V5DA 2A3BA 2WMJA 3FN9A 1PZ2A 2VO5A 1Y7VA 3ZO9A 4BQ3A 4PN2A 4RL3A 4CN6A 3ARWA 1QNOA 2BV9A 4ZFMA 2FGZA 2D20A 4KWUA 4HMCA 4HA4A 3VDAA 2GVYA 5ABFA 1HNYA 4HPGA 1TCMA 4MNKA 1QI4A 3VDCA 1GOWA 5BRPA 4N42A 4ZXOA 1UA3A 1EDQA 2BHUA 3AQUA 3ARQA 3PTQA 1HT6A 3GXDA 1V0LA 3EDKA 3WD2A 1QBBA 2ZUUA 1E4NA 1KXVA 2PBGA 2VZVA 3VGHA 1CENA 4LGXA 1EOKA 3AMLA 1J10A 3MMUA 1C7SA 1HKIA 2YDQA 2XVLA 3KL0A 2B31A 2F8QA 4XV0A 1MQPA 1V3HA 4HA1A 1ISXA 5JBDA 4Z2JA 2XM2A 1XCXA 4MDPA 2YA1A 4F8XA 1Q6FA 4L4OA 4AMCA 1CXHA 4Q22A 4A3YA 5CSUA 1JF5A 3BC9A 1JG9A 1UKTA 5AY7A 5A2BA 2ZXQA 2YL5A 3UR7A 1Q6DA 3F5KA 3FY1A 4E4PA 2WYSA 4HMEA 3WNKA 3BLPX 3I3DA 2EJ1A 1GVIA 1KR1A 1FH7A 1ZJBA 1HJVA 3VOCA 2PC8A 5TD4A 1H3GA 3MV01 1WZLA 3DYPA 1E6RA 4J28A 5CPTA 3DYMA 3GM8A 3QOMA 1E15A 3AI0A 2BHZA 3NSNA 1PEZA 1FH9A 5IDIA 2X8RA 4LQ1A 2FHFA 1E55A 4AD4A 3KL5A 4PMRA 4RE3A 1QNRA 1GJWA 2VVNA 4TVCA 2E40A 3GBDA 2O9OA 3ARRA 4WIWA 4H7VA 4BCEA 3UR8A 1OIMA 2WMKA 3W26A 4AIEA 4D6HA 2WSPA 1ZS2A 2WMFA 4MAZA 1CTNA 1HN1A 1XH2A 2WZEA 3AS1A 3KWXA 3L4YA 3TA9A 3SCRA 2CBJA 3SCPA 4B16A 3EDDA 2WVVB 2D1ZA 4UQBA 1UKPA 4CVUA 3ZQ9A 2VZTA 2JE8A 1JL8A 2BVTA 1GCYA 1YQ2A 4ZENA 2EO7A 2VRQA 2ZUTA 1PX3A 2J77A 2XFRA 1E1FA 4CU8A 3L4XA 4A4AA 1B3WA 3WL0A 2J47A 1OBAA 3FXYA 5CPQA 3UCQA 5HPCA 4H41A 1GW1A 2XVNA 3CUFA 2G8ZA 4W85A 1NWTA 1PX8A 4GKLA 4OJYA 1TUXA 4PMQA 1JI1A 1O7AA 4UZSA 1CLVA 2DSUA 1CGVA 5C8BB 2FH8A 1OGBA 2VL4A 3G6LA 3WNNA 2WK2A 1Q4NX 4W5ZA 5DT7A 3RMEA 5ECUA 5AC5A 1V6WA 2DSVA 1GOQA 4CVWA 5A6KA 2RGLA 1VJSA 4PTXA 1IZJA 4MTVA 5JBFA 1UUQA 3CHFA 3FAWA 1TA3B 4MDOA 1PJ9A 3L2MA 1A47A 3VILA 2YDSA 3BMVA 4LX4A 3UEQA 4KRUA 1BQCA 4J3UA 1VEOA 1QHPA 3OGSA 3W27A 2XSBA 3AHTA 4AD1A 3W53A 1OGGA 1GPFA 1JD7A 3N04A 2YOCA 4PMYA 2X05A 3ZMRA 4YPJA 2VZSA 3VIGA 2G3NA 3WEMA 3SUTA 1VEMA 4W8LA 3RM4A 3KL3A 2YL9A 5BXRA 4CGTA 2E8YA 5A6AA 5IXEA 1BVZA 2DDXA 1MFUA 1SFSA 1UWQA 3QHMA 5FCZA 3L4TA 1UKSA 3MSDA 1MVYA 2D22A 3VM5A 1M01A 1B1YA 4AYSA 3RM9A 4DWSC 2J75A 3VMOA 3MUIA 1WDRA 2XSAA 4M29A 4YN5A 2J7HA 1BYAA 3A4XA 3HN3A 4MB5A 3F4VA 1QNPA 2ZUWA 3FHQA 2ZX6A 2XWDA 1GVYA 2GFTA 2WWCA 1VRXA 4FF5A 1KGXA 1VFFA 3AHVA 1UQYA 3AIUA 1J0HA 1B31A 1C92A 3SUSA 3KE0A 4J7RA 3GYCA 3OLGA 5DMYA 2YBUA 1W1VA 4X9YA 3LPOA 2VI0A 4PCTA 3WNPA 2WANA 4E2OA 3NUKA 2WNWA 1BTCA 5FD0A 1HJWA 3OIHA 2XPKA 4S3KA 1BVNP 7A3HA 2DPEA 2OSXA 4W84A 1IZKA 4MB4A 3W29A 4UFIA 1MW1A 1UD2A 1BG4A 1MW2A 1G1YA 2D2OA 1E3ZA 2AAAA 3BAWA 3OGVA 3WDPP 3JUGA 4JFUA 1ZBVA 4QP0A 1JZ8A 1H0IA 2WKLA 3DYOA 3M6DA 2V5CA 2WHKA 3M46A 1JF6A 1KCKA 4A3HA 4ML4A 2CXGA 1W3LA 1UR0A 1CGXA 2NW0A 1J01A 4ACZB 3AFBA 3BGAA 2CEQA 3VIPA 3L2LA 3TTYA 4BZYA 4C7DA 3OZOA 1W3JA 2CITA 1GUVA 2YBTA 1ITCA 1E6XM 1LG1A 2G3MA 4BS0A 1GJUA 1VFMA 4U5IA 2ZX5A 3IAQA 2VCAA 4OZOA 4HTYA 4P7NA 1UQZA 1UWUA 1EQPA 3T2QA 1PIGA 1NH6A 2ZX7A 1JYVA 2WSKA 2J7CA 4Z2GA 4U5KA 5A95A 1LL6A 1HVQA 3W4RA 1B3XA 1V0MA 2YLLA 1QI2A 4LPCA 2GDVA 3B9EA 4W8AA 4Z2KA 1QW9A 3CMGA 1PIFA 3VD4A 1UYQA 1UKQA 3WF0A 1KXHA 1DTUA 1XD1A 4KGJA 4W5UA 1DWIM 1ZBWA 4M24A 3O9NA 1K9TA 5I77A 1RD6A 3J7HA 3HMCA 5BWFA 4UOJA 4UCFA 5M5DA 3BAYA 4QAWA 2J7GA 4AZCA 2WLYA 1R8LA 4DUVA 3OB8A 1VENA 3WSUA 1TMQA 1OM0A 3QGVA 4LYQA 4GO8A 1V3JA 1K9EA 1WZAA 2BY1A 5D8ZA 1OB0A 3VD3A 3AIBA 1U33A 4GI8A 5D9OA 4CD4A 1UR4A 5JBEA 1BGAA 1WCGA 2Z1KA 3EDJA 1FHLA 2CKRA 3CUIA 1ITXA 1M7XA 3AIWA 9CGTA 1HXJA 3AZTA 2GJPA 2ZX8A 3MMWA 2XGIA 4CU7A 2OYKA 1LL4A 3VGGA 2WKGA 4F66A 1HJSA 2RGMA 5C71A 5I24A 1J0ZA 2WW5A 5FIPA 2Y5EA 2BY2A 4CKQA 1PBGA 3VO0A 1TFVA 4DM2A 2GJRA 1E6ZA 1UZ4A 2CBUA 3WUBA 3RO8A 1MXGA 1M03A 4UQEA 5HXMA 2W4XA 1NP0A 3ARZA 3BLKA 2VX7A 1JDAA 2VCCA 1GQLA 2J79A 4KRTA 4QLLA 4AWEA 3FNDA 2Y24A 2PWFA 3EMCA 1F4AA 1TVNA 4UR9A 2OWWA 4AC1X 1B2YA 2VZUA 3AS0A 2DQXA 3OBAA 1BGGA 5CXPA 1UWTA 1UH4A 3SIMA 1E71M 4FK9A 3DHUA 1C8YA 4P7RA 2X09A 3AIEA 4ZE5A 6TAAA 4F9JA 1DHKA 5HBFA 3VUPA 2DH3A 2G3JA 2J7BA 4PUDA 1C91A 1L8NA 3CLWA 4D6JA 3WDIA 3WNMA 1OIFA 1BLIA 3D3AA 3PZUA 3WH6A 1P6WA 1H49A 3TP4A 1VIWA 1WNOA 3DC0A 5LA0A 3WN6A 3CZ8A 3THDA 2NT0A 1W9XA 5A6SA 2DT1A 2AMGA 2BVDA 4C7FA 3VD5A 2A3CA 5D9NA 4MB1A 4UQCA 3CZLA 5FOOA 3IJ7A 2JIWA 3I3EA 1E0WA 5GQBA 4JIEA 5AC4A 5E0CA 5A1AA 3VIKA 3GXIA 2QHAA 3NDZA 3GDBA 4F9DA 4JFVA 1W9BM 2WZHA 3N11A 5FL0A 1JAKA 2J7EA 1BYCA 1S46A 1R87A 2J62A 2Y2WA 2WMGA 4ZE4A 3MO4A 4NZCA 5JIPA 5ABFB 2DGAA 1MQRA 3SCUA 4AEFA 1CBGA 1WO2A 4KMQA 4AZ7A 2GJXB 4OBSA 2HISA 7TAAA 5A6MA 3WNLA 1HJUA 1UKOA 3WD3A 3WUGA 1QBAA 4U2ZA 3NIYA 3PZVA 3UERA 4W89A 1NWSA 3KEHA 1B3YA 1OSEA 3ZSTA 3CPUA 1JIBA 4JL1A 3ARXA 2DT2A 1L0PA 1DWAM 2Y8VA 5ABGA 2CHNA 2WLZA 5M03A 3W82A 3SCTA 1JYNA 2O9PA 1PAMA 3WY1A 4PBGA 3A3HA 3PZTA 4NRSA 1VB9A 3AZRA 2A3HA 3CZKA 4LYPA 4ZXLA 2WHJA 4AZHA 2W91A 3WQVA 4PUEA 4AISA 2UWFA 1E70M 1KBBA 4TVDA 1ZB5A 1AVAA 3EDFA 3GH7A 3CBWA 1VBUA 1JDCA 5I6SA 1LWJA 3ZJ6A 1M53A 4X0NA 5CSYA 3UG3A 3VDHA 2WCGA 3CUJA 3N17A 3T2PA 1WB0A 5A6JA 1GQKA 8CGTA 2TAAA 1CXEA 3BAXA 5HDRA 3AICA 1KWKA 2ZUVA 2E0PA 1JZ5A 2D24A 4HPHA 4MPKA 3PBGA 3AXXA 1V3KA 3U57A 1C90A 4PSPA 4N0RA 1XH1A 3UG5A 1N82A 4NF7A 1SMAA 5ABEA 2PWEA 4XX6A 1R7AA 4GQQA 3TOPA 1A3HA 2W92A 1KB3A 2WBGA 2IXUA 4AD3A 1ZJAA 2WC4A 1HJQA 2XFFA 1B90A 1WE5A 1LG2A 4EANA 4Z2HA 4HZ6A 5A2CA 4XZBA 4TX6A 3WBAA 2WWDA 2BXYA 1US2A 1JNEA 5KEZA 3IAPA 1CNVA 3M7SA 1E6SM 4AXNA 3CH9A 2V3EA 3VIJA 2V3FA 5E09A 1UD5A 1MYRA 5CLWA 2UY5A 1QPKA 3TTQA 4OBRA 2D0GA 5I5RA 5IHRA 5ABHA 1B3ZA 3BAJA 4HU8A 1HL8A 1KCLA 1OT2A 3DECA 3O6AA 4CD7A 4PMUA 5JUVA 1ZL1A 2Q8XA 1ISZA 1XCWA 1J0YA 2WMHA 2CESA 4X0VA 2YJQA 3ZJKA 1C8QA 1LJYA 3ARSA 2WC7A 3WUFA 4QDMA 4DUWA 3BXWA 4JHOA 3K4AA 4HU0A 1FOBA 4IM4A 3WH5A 1UG6A 2FDMA 2DSZA 1KQZA 1V08A 3CUHA 5IHSA 3T0DA 2QPSA 4HP5A 3U5YA 2PWHA 4MNMA 4PMNA 4B3LA 1BG9A 4E8CA 4M56A 1SMDA 2GK1A 4CCDA 2BHYA 4WF7A 5I78A 1NQ6A 1C93A 2CIPA 3SUWA 1ODZA 3UESA 4PMZA 2JALA 3VNZA 1PPIA 4GINA 1VFOA 4ATDA 1ISVA 3EMQA 1XD0A 1XSJA 3APGA 2ZXBA 3VKKA 2EPLX 1J18A 4C91A 2YA0A 3WMCA 3W37A 4MAVA 1E73M 3S6TA 2X1IA 2NSXA 4R27A 4UOZA 1CGTA 5A8PA 2J74A 1EQCA 2QLYA 6A3HA 1G5AA 3RJXA 1JXKA 1K9FA 2JEQA 4AZBA 2YIHA 4IPLA 1AQMA 3B9DA 2CHOA 3O2LA 2XGBA 5CGTA 2BY3A
chains in the Genus database with same CATH superfamily
3EX6A 5G2HA 4UB9A 1EB3A 1GKQA 4IIGA 1SPQA 4NAFA 3W74A 2V5BA 4YYFA 3VDBA 4LVFA 1JRCA 1XDMA 1QO5A 1G4PA 1BRLB 3G22A 4QXIA 4ZTXA 2QMKA 2XIMA 5F7UA 4CNNA 2TMDA 1PV8A 2R14A 3CZEA 4IPIA 4L9ZA 4AMAA 3CU2A 3QMTA 1LT8A 4K8HA 5D2VA 3WEOA 3G77A 3C52A 6REQB 1YPIA 2TSYA 3A23A 4UTWC 4YU1A 1PO9A 1AMYA 2VWSA 1KCXA 1Q6EA 5D09A 3ZXWA 2Y4SA 3TR9A 2D73A 3MUY1 1LBLA 2GSEA 3EX1A 4JQ4A 3TTOA 3NNTA 4EE9A 4PB5A 1EGVA 4XD4A 1SFJA 3UP8A 3BW4A 4IIBA 5G4WA 3KHJA 4NHVA 1RP9A 5CQ1A 4GLEA 3GQYA 4LUSB 1C8XA 5FF2A 1J5TA 1RLDA 4FNPA 1HZYA 3MANA 1OCJA 2QR6A 1J11A 3W6LA 5KZMA 5LXEA 3AIVA 4JDBA 4ZR8A 2ZFAA 3K4WA 4F0RA 1S5MA 2D0FA 1GHRA 4AZ5A 4NJIA 1LWHA 5KMYA 3KVMA 1W6TA 1DWHM 1EYWA 5D30A 4F40A 3O07A 2ANUA 4O57A 4NU7A 4ORIA 4ZSTA 4DBUA 4YHGA 3T40A 2NLIA 3DN5A 4M8UA 5FKYA 2E7FA 4BF5A 5EMUA 1JR1A 2EQDA 1KXQA 4JHMA 5CZKA 5M3WA 4OOZA 4IUOA 5FEWA 7CGTA 1OZMA 3LERA 3W2LA 3HG4A 1JCJA 3GXMA 2GGIA 1EPVA 4GX8A 3O16A 5EFFA 3MCOA 4GZIA 3SN1A 2E3ZA 4GD0A 1EJVC 3GNOA 3TCEA 5DMMA 3LPGA 4WK9A 4UFHA 1XL9A 4O1CA 3WF1A 4IPNB 3VU2A 1FUYA 2PDUA 1W5OA 3SY5A 4Y8EA 2BG5A 1FP9A 1M04A 4JFSA 4F48A 2GVLA 3TNBA 3OA3A 2W61A 5J8LA 3CQKA 2Z6JA 3VINA 1W91A 3NPVA 1V6TA 2HV5A 4FLQA 3WJZA 2NQHA 1TVPA 1KLYA 1ZLPA 3TYAA 1KR0A 1L6GA 1X1NA 4LEQA 4OTKA 2EKCA 3N9RA 1E4IA 2HBVA 3DKJA 3BK0A 3PJWA 2Y5SA 4ZO7A 2I14A 2I56A 4CN1A 3VIHA 3AHYA 1TQXA 3QEZA 1W9DM 3SW6A 3AMDA 1HQTA 2DU2A 1E4LA 3VA8A 3AYRA 3V5FA 3VNMA 3PPCA 3UNDA 4Z2LA 1BYBA 1AFSA 5I7GA 2VGBA 4ECLA 2WMIB 1D3CA 1DXIA 3BOLA 4QCFA 1KGWA 3W7PA 2PZNA 1KM0A 3PZMA 4K1GA 1MW3A 1RV8A 1OFQA 2R1NA 1VPQA 1M65A 2XH7A 3CNYA 3I68A 3T08A 3PBVA 1J12A 3GNPA 3S9YA 5HUPA 3PPGA 4PCSA 4WSJA 4DF0A 1TX2A 2G41A 5H8PA 3WF4A 5DFAA 3W2JA 2QVNA 4ZO8A 2PAJA 2RDXA 3GY1A 3NL2A 4IFKA 1VFTA 1JGIA 1IZCA 3APYA 1QHZA 1F4HA 3SCWA 2XVKA 1SYTA 1PSCA 2EPNA 1TWZA 3EA3A 3GW3A 2ACQA 5LIWX 4Y9NA 3P5YA 5BOFA 3CL7A 2PMQA 3SI9A 4QRNA 2OYMA 3EBVA 2HWGA 4C6PA 3TXZA 4Y96A 1BKSA 2VMFA 4W8BA 3D6NA 4GQGA 4V2XA 1XSKA 1NM9A 1ITUA 3BGGA 3UWVA 4IISA 3POHA 1EHNA 1ME8A 1IWAA 4LVDA 3ZT5A 3DG7A 3QPZA 3V75A 1CDGA 2ZE0A 2ZUSA 4LVGA 1UWSA 1W2PA 4UQ9A 2BZNA 3NZQA 2PSNA 1W9UA 1Q6CA 4EOUA 3R43A 4GQRA 2GVGA 2EXOA 2EF9A 5M17A 2QXWA 2P3EA 2DSWA 2CPUA 3HO8A 1U2YA 1TV3A 3RG6A 3OG3A 2RDTA 3SURA 1H63A 1NELA 2CERA 1PZ0A 5A8NA 4KEZA 2VX5A 4U2YA 1EF3A 3GDTA 1XLFA 4ZOBA 4HZMA 1F8IA 1W3NA 1HL2A 3L9CA 3QY8A 4XUYA 2BWGA 3WH9A 5C9RA 5DLCA 3N2TA 5BCAA 2OMAA 4MF4A 1W8GA 2ZA2A 2QNEA 5LIXX 3CHDA 1ENUA 1KM3A 1VFLA 3NZ1A 3NDOA 2W63A 4LNCA 1V6UA 5A8OA 1TO3A 4AD5A 1LBMA 2QCCA 3R89A 4AW7A 4B5XA 2BS9A 1H2JA 5KZ6A 1RJRA 4IP4A 1DIDA 1D3GA 1MFVA 1NF7A 4YIWA 2Y8KA 3TQ0A 4L80A 5CBJA 2V68A 3OQEA 3WJSA 2WO5A 4PUNA 1JDDA 2J8FA 4QEHA 2CW6A 3AS2A 1W1TA 1O1HA 2CZVA 3URBA 2XVGA 2C1GA 3B0VC 3SBFA 2ZRYA 3MI2A 4ZOCA 3C2RA 1M3UA 5HMFA 3N73A 2QCLA 1ESWA 2R1MA 3QMSA 3APTA 2EGZA 3S5NA 3BQ6A 3L7RA 1UD4A 2HVMA 4Z08A 3TMLA 3G1DA 2I17A 2DORA 4ONVA 3N12A 1XV8A 3UU0A 3LHTA 3VX0A 5AYZA 3A5VA 2NLYA 1XI3A 1VEPA 4INFA 1JNDA 3W3OA 3WENA 1JCLA 3N19B 3O8AA 1P1MA 2YCEA 1GYNA 1E5NA 1BQGA 1EC8A 2GDQA 2RUSA 4IGNA 3EWCA 4PEEA 4RW3A 3N4AA 4KFOA 3W00A 1CLXA 3ABZA 1G67A 4NI3A 4GPNA 3TLLA 2GJNA 1D8CA 2X1RA 5K3VA 1LP6A 2C0AA 4D1IA 1VF8A 3AISA 4KWWA 4C6MA 3GBEA 4PBFA 1QWGA 3ONBA 2TRSA 3C2FA 4V27A 1HGWA 1EJSC 4NZ3A 3W7NA 4IIHA 1VKFA 8TIMA 2YZRA 4IH3A 1ZU8A 2EEXA 2Z7KA 3ZS4A 4GYJA 4YTUA 1E0XA 1ZCCA 1ZBCA 3IVSA 4AG0A 4DPPA 3OYZA 1T96A 1TCDA 3QR3A 4NP7A 5L6UA 1FWAC 3VUSA 1PUDA 3NSXA 4HCHA 1TPVA 1Q6GA 3WFZA 4DJDD 1E0TA 2OG9A 2DVXA 4GUFA 2YPIA 4RJEA 1GZJA 4IPJA 1Q6OA 4FR1A 4LY8A 4ATWA 1QI0A 4L4LA 3W7MA 2J9YA 1WDSA 2AQVA 1OCNA 3JS3A 3DHPA 3GAKA 3SCQA 4L6DA 4IXXA 2J4GA 3GR7A 2PTYA 4Z1BA 1AQHA 5I02A 1AK5A 4K38A 4PRWA 4Q8VA 2DSKA 3PUGA 3GZAA 2X0YA 1H5VA 1S5VA 3GNRA 1PDYA 2VCBA 3H53A 5MKGA 1K3UA 2ZKMX 5H91A 1E40A 4TV6A 4D2JA 4Q8UA 5C54A 5MHBA 5D2WA 1MUCA 3VPLA 4QS5A 1OC5A 3HGJA 4GH3A 4V15A 4NG3A 1OFAA 2PDWA 4J3SA 5BROA 1TE1A 3BSMA 5KITA 2QV4A 2SFPA 3MV11 3PJUA 4NRRA 1TZ7A 2GDUA 2GSHA 1RQEA 2I1OA 1WP6A 2V5LA 4GIEA 3W2KA 3G1HA 4W7VA 1AQ0A 1OEPA 2XFYA 3WQGA 1GPWA 4HHLA 1GVRA 1IHIA 2WCAA 4BQ2A 3MU7A 1UASA 1ELSA 4MY9A 3LX9A 1KXTA 4IMGA 5EB8A 1W1PA 4Q6JA 2KZHA 4MMWA 2E9MA 3QR0A 3VIMA 5KINA 1EEXA 4DX3A 2WVUA 3RU6A 2WB5A 5JIWA 4IG2A 5DQPA 1YE4A 1GGOA 5B7YA 2CCRA 3LRMA 5FJJA 4IJRA 1D8WA 1V0KA 3GD6A 4A3UA 4O11A 5A94A 3T07A 4N2YA 4PH6A 1KFJA 1L2QA 4G9PA 2A6NA 3CLMA 4N4PA 4ZQCA 1J0JA 3K8MA 1MW0A 1E6QM 4QEEA 1FHUA 1FH8A 1XYFA 3L68A 4JR5A 4TXEA 1GORA 3USZA 5HQEA 4S3DA 4A29A 4W7UA 5XIAA 1DQWA 4Q7NA 4CD8A 2J7FA 3LQGA 3NQEA 2DT3A 3EXTA 4GYFA 3KDNA 2QCDB 3SUUA 1ZY9A 2REQB 1ZAHA 2CLPA 3L5AA 1LL7A 4W87A 5T9CE 2PD9A 3R6IA 1GZ1A 1W3TA 3KBJA 3WK2A 3HJZA 1F5ZA 4J3XA 2VEFA 2X7WA 3GTHA 2XFWA 1UC4A 3VKAA 1OINA 4MNJA 1AL8A 2HZGA 1LLOA 4EXQA 3HPZA 2E77A 2WXDM 4JAWA 5HAOA 1XC4A 4UTFA 5TIMA 1QFEA 3ARUA 5F2IA 4OHQA 3OLEA 1SO6A 3CV7A 3BVJA 4GVHA 4H01A 2INZA 4W86A 1OCQA 2R91A 4O0QA 5D9MA 3K8LA 1EYEA 3LCFA 4MKSA 1I1XA 2Z2BA 1OC6A 4HVXA 1LF1A 1ML1A 3F7JA 4P7QA 5FF4A 1EZ2A 4O1EA 1LLZA 3RAOA 5E9AA 4AWTA 3NAVA 3WZ0E 4LAKA 1E4MM 3P80A 4IX0A 3GDLA 2V5KA 5BXTA 4JTHA 4NT0A 1B9ZA 1O12A 4DN1A 1EJ7L 3S9IA 1I0BA 3KVKA 4WKHA 4AIBA 4AQLA 1GOIA 2GWNA 4PFHA 3V5CA 4R88A 4MLRA 3ZR6A 2VC9A 1X96A 2E6AA 3KM8A 2O9RA 2Z24A 3FHAA 4JTKA 3UJSA 5I0DA 1JUEA 3N6JA 3S9ZA 5TF0A 4HN4A 1IV8A 3L0NA 3ITXA 4C1KA 3E2RA 5A2AA 3LSCA 3O1NA 4QJ5B 3W1LA 4LF1A 4I9MA 3UZWA 2A79A 2PP0A 1PZ2A 1W37A 3TJLA 4ADSA 4BQ3A 2PDFA 3QKZA 4FEZA 3R10A 3ARWA 1QNOA 4XQ6A 1UJQA 1XISA 4HA4A 3P67A 4UR7A 3EX3A 1HNYA 1TCMA 3EKLA 1GOWA 1KFLA 3VOIA 1EDQA 3MY9A 1D7KA 4GVIA 3WD2A 1E4NA 3ES7A 2VZVA 4Z1DA 3VGHA 3I65A 2OQYA 1PWMA 1EOKA 1SZGA 3FSTA 1FWGC 1S1RA 3AMLA 3AWNA 3E0FA 5C9ZA 2F8QA 4XV0A 2WSYA 4A6GA 2XH4A 4WDWA 1V3HA 2FGBA 3GXTA 4XKMA 3CAVA 3IACA 4HA1A 3N6HA 5GJPA 4K2SA 4L4OA 4HK7A 4Q22A 4UBPC 5A8GA 1JF5A 3BC9A 1JPMA 3EWZA 3S1GA 2JGYA 3CTLA 3CL8A 4B5TA 3U0HA 2PU1A 3RGTA 3FY1A 3LQLA 5LHFA 2WYSA 4HMEA 4JXCA 3BLPX 1NAL1 4ILSA 1GVIA 2HS6A 4O1AA 1ZJBA 2I16A 1HJVA 2PC8A 5TD4A 4REQB 2CLKA 3BJTA 4H00A 1H3GA 5CH9A 4HJWA 3DYMA 4FIQA 4CNTA 2ADAA 3FLUA 1W1IE 2X8RA 4LQ1A 3BOFA 5AOUA 4AD4A 3KL5A 1DPMA 4IX2A 1OHLA 4TVCA 3ARRA 3VI2A 3UXIA 2IQDA 4EPKA 3DBNA 2VGGA 1TWSA 3BE7A 2WMKA 4AIEA 1VYPX 4D6HA 1HUVA 4MAZA 1OC7A 4FZIA 3DFHA 1HN1A 1XH2A 3AS1A 1TJ1A 3MHGA 4FR6A 3EDDA 2FTPA 2WVVB 4K39A 2VZTA 1GCYA 2ZZ2A 4ZENA 3SDOA 2W79A 2CLIA 4Y6GA 1PX3A 2XFRA 1XG4A 3NEVA 4I6VA 3BV7A 4OUIA 1B3WA 3WL0A 3FXYA 4S1FA 3UCQA 3NO5A 3W7KA 4LYKA 4W85A 1TUXA 2HPIA 1XLHA 4UTHA 1JI1A 4UZSA 4JEQA 1IEXA 3LGDA 1JEZA 5EMKA 5AB3A 1CX9A 3QF0A 5C8BB 2NUXA 3G6LA 9XIAA 2P76A 4XD5A 1KFBA 4GE8A 5EY5A 4CVWA 3MZNA 1O60A 5A6KA 1VJSA 5CZJA 4O8RA 4PTXA 4C6JA 1IZJA 2F2KA 1TA3B 1PJ9A 3W2MA 3LB0A 3DHFA 2GQAA 4TR9A 3UEQA 3CQHA 4KRUA 1BQCA 4J3UA 2P3ZA 3HQNA 1QHPA 4LVBA 2VFHA 5AHFA 2XSBA 5JH1A 3NL3A 1OK6A 3W53A 4F0SA 2PDIA 2NUYA 3W1TA 2VC5A 1L6FA 2YOCA 2V2HA 3B04A 3QQWA 4YPJA 3FDKA 4W8LA 3RM4A 5CGQA 1YBQA 1W1B1 1X98A 3KL3A 2YL9A 3TA6A 4B91A 5A6AA 5IXEA 3DCPA 1FDZA 3PTDA 4PZVA 5HJXA 1SFSA 5FCZA 2RDUA 5D03A 1F05A 4F0HA 3MSDA 3T78A 2OKOA 2D22A 4LU0A 1TRIA 1M01A 1P7TB 1EL3A 4DWSC 7TIMA 5C2CA 4M29A 2E67A 4YN5A 3HPSA 3NO3A 3HQPA 1QNPA 4MZ8A 2XWDA 5FEZA 5CSSA 4QE1A 4KPLA 1P0BA 4ICCX 2QIWA 1UQYA 3DOPA 2BB0A 3DKLA 1ICPA 1C92A 2OLAA 3KE0A 4J7RA 3OLGA 3A4JA 3OVRA 3QZAA 1RXOB 1YDVA 3WNPA 4H9XA 2P53A 4L9XA 1HKWA 3M6YA 2E25A 1MUMA 4MUPA 4NL1A 1BVNP 2DPEA 4GYPA 2OSXA 1IZKA 5HNTA 1E9ZB 3FJ6A 5LHEA 4A8IA 1DJZA 2AAAA 3OGVA 3JUGA 4XSMA 4IHCA 4QP0A 1H0IA 2WKLA 2BSLA 4S23A 1JF6A 4L1XA 4A3HA 1I9CB 1C9WA 2DZVA 1W3LA 2Z25A 3E2VA 1CGXA 1PKMA 4NAEB 1R3TA 2Y7GA 1AW2A 3VNKA 3BGAA 4OECA 4RNFA 4C7DA 3OZOA 4U5IA 3OW1A 2DZAA 1ZFJA 2PDXA 1EQPA 4X22A 4PL2A 1PIGA 5CBBA 1NH6A 2HBXA 4Z2GA 1T8XA 1QTWA 3L65A 3TH6A 4YCPA 4OT7A 2ZA1A 2YZ5A 3HV9A 4LPCA 4LS2A 4Y9MA 1QW9A 3OBEA 2GZXA 4RLIA 3VD4A 1UYQA 1XQKA 1XPYA 1XYCA 1QK2A 5AHLA 1XD1A 4KGJA 4W5UA 1ZBWA 4F0KA 3ITCA 2DUXA 2F9RA 3J7HA 4DQWA 1QAPA 3M5VA 5BWFA 4UCFA 3GVWA 4QAWA 4HMNA 3ME3A 3UT0A 1XF0A 1TMQA 2PTXA 2Z29A 3QGVA 1JCYA 3H4WA 1RSCA 3VNDA 5D8ZA 3PVFA 1OB0A 3VD3A 4A8RA 2QCMA 4B5UA 4CD4A 4Z1AA 1I4NA 5JBEA 1BGAA 3GTFA 3EDJA 3PWAA 3QLLA 4GBUA 3MBDA 3NPXA 4ROPA 3B8WA 3EPOA 3AZTA 4IQEA 1O94A 3TR2A 2NQZA 2ZX8A 3TU9A 2GVEA 2WKGA 5GVJA 4MLJA 5C71A 5I24A 1QJWA 2WW5A 1R38A 2Q3RA 1TFVA 4KCWA 4AF0A 1KV8A 1GG1A 1FVPA 4N9EA 3RU8X 5F1VA 3E12A 1NP0A 3DERA 3IIPA 3GG1A 1T0OA 2Y24A 1A4LA 2EHHA 4RW5A 1YNYA 2VZUA 2DQXA 3OBAA 3UXKA 3TN5A 1H1ZA 5CBIA 5CXPA 1UWTA 3GIQA 2ZVRA 3SIMA 4MHBA 3DHUA 1C8YA 4Q4PA 1KLZA 1A4MA 2AL1A 1DHKA 3VUPA 5CCZA 2DH3A 3W6YA 4IFKB 4WXZA 4JS3A 5AECA 3GG8A 3H2CA 3I6TA 1R2TA 3PC0A 2CLLA 2IKIA 2VC7A 1KM5A 2ABBA 3D3AA 4DI9A 5CPOA 3PZUA 1P6WA 3TP4A 1WOBA 1O5RA 1VIWA 2RJGA 1WNOA 3O0FA 1J6OA 5JVLA 2Y85A 3THDA 4PB3A 3EB4A 2NT0A 1W9XA 2DT1A 2AMGA 4LY4A 3DC8A 4ZCWA 3N29A 4JPGA 4IQDA 4NUWA 3CZLA 3KBSA 2FZNA 1LQ2A 2JIWA 3I3EA 3BGJA 1XW8A 2NX3A 5A1AA 1AD1A 5FEXA 4EAYA 1Q2SA 3N11A 3WLOA 1OFBA 5FSEC 2G37A 1BYCA 3WQFA 1B9BA 3T81A 2BODX 2J62A 3QN3A 3DIPA 3MO4A 1FWEC 5ABFB 1BXCA 5HJYA 1TV8A 1T6MA 7TAAA 2HISA 5C2XA 3W2NA 1R3YA 1OFEA 1YPFA 4U2ZA 3PZVA 2VEKA 4W89A 5IBXC 2VEIA 3EWUA 1B3YA 1LM1A 3LI1A 4XSLA 1TPH1 3SSJA 3W86A 3ARXA 3MMTA 4PUUA 4MJMA 4JTQA 5DXYA 1NDWA 1JYNA 1QO2A 4R7JA 5BOOA 1VCFA 1G69A 3N25A 4MKVA 1E9YB 1VB9A 3VCNA 3AZRA 3LDVA 2A3HA 4LYPA 2WHJA 2W91A 4KCUA 1SO3A 1P0KA 3KZPA 1KBBA 3CBWA 1A5MC 1XJBA 1JDCA 1Y8BA 2PDLA 3GK0A 4QHRA 1YYAA 2OJPA 5CSYA 1RBOB 1M6JA 3CUJA 1X8FA 3G1FA 1G4TA 3UBPC 3A22A 1CXEA 4Z0JA 4WJ8A 1J2WA 1S2WA 4HPHA 1VFHA 3IGSA 1V3KA 3Q4DA 3REQA 4FSAA 3UG5A 3GLCA 1GOXA 3PM6A 3BURA 4NZ4A 3A21A 4JOMA 2PGEA 2PWEA 1OYBA 5DXXA 3O05A 3G18A 2B0MA 2W92A 1KB3A 1TYGA 2V9DA 4AD3A 1HJQA 1W8SA 3TC6A 1R3RA 2AL2B 4QG6A 2BDQA 4XAZA 3VDGA 1LG2A 3UWZA 4PCNA 5C7HA 4M6VA 3O0KA 4Z2HA 1A5UA 4XZBA 1S3HA 1H7NA 4TX6A 3LENA 1E1CA 3IAPA 6ALDA 3LY0A 4F2UA 1TV2A 3CH9A 2V3EA 2RJHA 1O5QA 1PTDA 1UD5A 1MYRA 3IIVA 4NX5A 5CLWA 4OBRA 4AY8A 4S3GA 5IHRA 1B3ZA 3SN0A 1KCLA 2G96A 4NXSA 3W1UA 4XZNX 5HUOA 1J0YA 4DZHA 1KV5A 4MZYA 2YJQA 2RDWA 4JTIA 3ZJKA 1QWKA 3E38A 1SZEA 4IP7A 1NQKA 1Q6QA 4HU0A 2PPGA 2UBPC 4HNTA 5KSWA 3CUHA 5IHSA 1H1YA 1ECQA 2FVKA 4E8CA 5KETA 4ASTA 4M56A 4R34A 5B7ZA 4CCDA 4XUGA 2BHYA 4WF7A 5I78A 3NFUA 4PMZA 2QW5A 2JALA 3O6YX 3TQVA 2VFEA 4JICA 4GINA 4ATDA 1ISVA 3SRHA 3APGA 4XWUA 2EPLX 1J18A 3M5YA 1Q45A 4C91A 4DO5A 4YS1A 2YA0A 3DX5A 1E73M 1XICA 3W1MA 5A8PA 2NQ9A 3EWDA 4GY1A 3M0MA 6A3HA 1G5AA 2PCQA 3QZEA 1TTIA 4DB7A 1JXKA 2C6QA 1K9FA 2OT0A 4AZBA 3PBMA 4ZQPA 3BMXA 3L23A 1KKOA 3UY8A 2XGBA 4O0KA 5CGTA 1GK8A 4NX0A 3GFYA 2G4FA 4O50A 2VUYA 1K03A 3TUUA 3QVQA 5MKGB 2XIIA 1W3HA 5AYYA 3KHDA 3P5ZA 3G0UA 2E5BA 6XIMA 1XRFA 5T26A 2DT0A 1SR9A 4HPNA 4WX2A 2ZRXA 3RK8A 2PA6A 5BU9A 4DJEC 1UZ1A 3OLIA 1F6PA 2I9UA 4DLMA 3MBFA 3C2YA 4RNJA 4HOXA 4QQUA 3B9NA 3EMZA 1RLCL 2YFOA 3A13A 4DVOA 3V7PA 4C6DA 3TAKA 2XZ9A 1UIPA 1XLLA 3K1DA 3AAMA 4HK5A 5E70A 1US3A 3CJPA 3S2LA 1R3SA 1ZHAA 2W67A 3N2CA 5F1UA 1V3IA 1F3WA 2ZVIA 4I5XA 3ARYA 5AVHA 3V36A 2ZZ4A 2J8GA 2QPXA 3W01A 1WZKA 4OU1A 2JF7A 2J9XA 4FOJA 4JN6A 5XIMA 3E5PA 1R9ZA 1RHCA 3POCA 2WQDA 4WY0A 3B8VA 1XCFA 3N18A 3E3HA 1CLKA 2QDHA 2HQAA 3LBMA 3FOKA 5C0QA 1J0KA 4E0CA 2IMRA 2BFGA 1JAEA 4AY7A 2NVDA 3DI1A 1LQ0A 3R58A 1W3IA 3WF3A 4O17A 3ABRA 4IZGA 4CNPA 3MUAA 3VD9A 2P10A 2IUZA 1ZENA 2PDGA 1GOKA 5HATA 2X0HA 5AYIA 5I3KA 4BQ5A 1UIOA 3NQ8A 4U28A 3W7IA 3U7BA 3THCA 2HMCA 1T99A 4GQ0A 1KTCA 4LUTA 3V5OA 1GQIA 2BGQA 3MB9A 2YL8A 4FLOA 2GLKA 1KKRA 4KIEA 1QNSA 4CCEA 3QW3A 3VKBA 3E9AA 4GZJA 1LT7A 4YXGA 4BI5A 2BOEX 3ITVA 1JVNA 4Y7EA 4W4QA 1IYXA 3BLLA 1KNWA 4G7EA 3EWBX 4Q4KA 2QF8A 4MNLA 2YCJA 1LBFA 4JFTA 1WOAA 7REQB 3NDYA 1OD0A 2WBKA 3EOUA 1L2UA 2XSXA 4G5DA 4YVXA 4GC3A 1CXKA 1X8CA 1I0DA 3GH4A 2YDRA 2DZXA 2VELA 2QAFA 1NFGA 3L0KA 4QG9A 2PLKA 3PBWA 4LRTA 3P0XA 2PTWA 3KVJA 4YYCA 3AJXA 3MSYA 2C16A 1B3OA 1RH9A 4UTTA 3WNOA 3HIJA 1EX1A 3UNTA 4J3WA 1FFQA 1RUSA 1JPHA 2E6FA 3G5EA 1PXGA 4N02A 4OQVA 3SQMA 3BG3A 3QYQA 2JBMA 1GKPA 1F6KA 1BD0A 3C0SA 4GIYA 3UGVA 3T42A 4PMOA 1W3KA 3W81A 2V3DA 2XWEA 5DN1A 4KEUA 3VOJA 1LORA 4OOUA 2V67A 4Y2WA 1NOWA 1H50A 3H24A 4O54A 4GXMA 1POJA 2F2HA 3TC3A 1EEPA 1DWJM 2Q8ZA 1EP3A 1O95A 5LSMA 3ZT7A 5A8MA 3S0CA 5A69A 3NM1A 4H2CA 1L9WA 3FCPA 2A3AA 3OGRA 5H1WA 3HM7A 4IFOA 3BSGA 3FS2A 4O1FA 1JZ6A 5K9XA 1SSGA 2V2DA 1I1WA 4OV9A 3P7YA 3CQIA 1YDYA 4HNOA 4TU1A 2VRKA 1GQJA 2CZFA 3SJNA 2OWCA 1XRSA 3IUDA 4FLRA 1GTEA 3MHUA 3VIFA 4DIAA 2P8CA 3CGTA 3A3XA 2GGHA 5TQLA 1RCXB 4XD6A 2G50A 1EF2A 2PDMA 2EJAA 3W71A 3WQ6A 4K6AA 2OWXA 2HK0A 2YA2A 4XG1A 5LYRA 1FCUA 3HG5A 4PA8A 1ZPTA 3CZGA 1UB3A 1H7RA 2VQUA 3V16A 2Z28A 4K68A 5JU6A 3EEZA 3W7JA 3N4EA 3L4ZA 1HL9A 4D72A 2PDQA 3HOJA 2WPGA 3KLKA 3F03K 3LXBA 1N8FA 4PMDA 2HNEA 1OG6A 2XGZA 2O9TA 4ICMA 4QR6A 3PZ9A 5E6ZA 1R85A 1K1DA 1KFEA 3TAOA 3WD1A 1ZQ5A 3HBLA 3NOYA 2JF6A 5C9WA 2GJXA 4PUWA 3D3FA 3L5MA 3KOWA 3A6OA 4RDVA 1A80A 1XLBA 1QPRA 1TPUA 3TXVA 3H26A 1CXLA 2XHYA 1VGAA 4DYJA 3ERPA 2YL6A 4KEVA 2IKGA 3MS8A 1K77A 1XWYA 4LUYA 4HB7A 3KBWA 3ELFA 1UMLA 4DYKA 5FAJA 1SSDA 1XSIA 1ITQA 3QV7A 4AXKA 2WM0A 2PGFA 2VOTA 3TYUA 4HIBA 1PYMA 2FVLA 5CC7A 4GCAA 2HVNA 1GWJA 4J35A 4I5UA 1P0EA 4FXJA 4O1DA 3BW2A 3N34A 2BASA 1G4SA 2OZ3A 4JGDA 3IIZA 6CGTA 1WKYA 4XZ9A 5IRPA 1H5YA 1HVXA 1AD4A 3H2MA 3RNDA 3PY2A 3RM8A 1WXZA 3UJRA 4JTFA 4S39A 1Z42A 1R9XA 1B30A 3UGRA 4DZAA 2NQLA 4UXDA 1Q5MA 4O18A 4IQJA 3EYPA 1JQXA 3QQ0A 1W2VA 4CD6A 2EAWA 2PRLA 2VEPA 4UQDA 1K9DA 2E1DA 4AEEA 1AH4A 1J0IA 3AMCA 2PWVA 5AZ0A 1UWIA 3G8RA 1EX5A 3R0DA 2VC6A 3GNDA 3QHNA 4BF9A 2UY4A 1ADDA 3KOFA 4RZ4A 3W73A 1Q3NA 3R5EA 2VEGA 2WOQA 3VXGA 3IJ8A 2IW0A 5E0FA 2V6AA 4KW2A 1FP8A 1IXNA 4JKKA 5D4YA 2ZDRA 3O63A 1DJHA 1M7OA 1VYSX 4D8AA 3MYOA 4GYKA 3S1UA 3S3GA 4AD0A 1FWDC 1HJXA 1DJXA 4LAOA 3TSMA 3LRLA 2OZTA 2OKTA 3IANA 4KKXA 1GG0A 3AXIA 4CD5A 3KAOA 5EA9A 3SFWA 1VYRA 4UQAA 2G97A 1H4PA 4IMEA 3NR0A 4GACA 4R5EA 3ITGA 2WHLA 1H1NA 4CNUA 4C6QA 4AX7A 4DWSD 2C71A 3W75A 2PP1A 3KCJA 5IFPA 3BSHA 3F4WA 3IIXA 3GVQA 3IARA 4J1OA 1UWRA 4LFYA 3ZJ7A 3MDUA 5EBAA 3IJ9A 4G6CA 4XIMA 1J96A 3NGJA 1GVQA 1Q66A 3STPA 2J6VA 2PFHA 3QXBA 1JPKA 2WJDA 2ISWA 2V38A 3URAA 1PHWA 4JN8A 5DRCA 3EKGA 1TPDA 1OYAA 2PS2A 1XXXA 3MW7A 3VFCA 4BK9A 1X6LA 3H6OA 1SFLA 3G2GA 3I7RA 3SIZA 4LCRA 5GPRA 5LIYX 4MJZA 3SECA 4GJJA 1YADA 4ADUA 3DG6A 3D47A 3RILA 4GI4A 4JIRA 1CXIA 3RIKA 3H4GA 3UWUA 1EP2A 4U3AA 3EPMA 4WJXA 3WLLA 3VVGA 3TNOA 3GFZA 3SFKA 1CGWA 1NOFA 1VBRA 4BWLC 3TE9A 1P0NA 1OCBA 2NXIA 3HFYA 3BJFA 4C7GA 2A85A 4JD4A 3H21A 4GI9A 3SAZA 2B7OA 1TTQA 4HPJA 3AHZA 3N3TA 4DJDC 3BJSA 1EKOA 4EIVA 3NZGA 4S2BA 1QU4A 1QOPA 3AOFA 4FP1A 5FEPA 3VTRA 3TYDA 4PR4A 1IEQA 4DWSB 4M1RA 5D02A 3EXRA 4W93A 1CWYA 1PZ3A 4OBTA 1EJTC 3VCCA 1BWVA 3AIQA 3UA4A 3NEHA 4TTGA 1U30A 2WQPA 1R5YA 4JKLA 3C5QA 3PNUA 3FEQA 1ZALA 4D71A 2VR2A 2AKMA 2WPBA 3NXLA 3STFA 2INEA 4WSHA 3II1A 3E1F1 3IS4A 3H2OA 1ZTVA 2PBOA 3CXOA 1HO4A 1YTKA 1Z3NA 2DVTA 2OGJA 4YWSA 4TX9A 4L6OA 4PTMA 4L1GA 3SCSA 4FLSA 4YTRA 1I2OA 3NQDA 2VFFA 3QPEA 4GA8A 4CN4A 3TLQA 1I2RA 3W76A 4KT2A 3F5JA 1FWWA 4ZODA 1EBHA 3ZT6A 1WDWA 2OB3A 2UY2A 3AJ7A 3MP4A 3WDJA 5BMWA 4NQ1A 3HJEA 4S3JA 4HOWA 4GUIA 1SW0A 1FKWA 4JYDA 2BNJA 4LEFA 3WDRA 4EVZA 2JFEX 3WL1A 1KWGA 4A22A 2VJXA 5JMUA 2V81A 5C9UA 1BF2A 2OEMA 2X2YA 3PZQA 1H7XA 4TVUA 4LBUA 4M81A 4DI8A 2WVSA 1F61A 2IKJA 4JX5A 1UROA 2NXHA 3GZ3A 3A4AA 2Z27A 2NQ5A 2V3GA 3TJXA 4RE4A 1RP8A 3FIGA 4M5PA 2FHBA 4E2VA 4K1WA 5G2IA 3W1XA 2CC0A 4IJCA 5HQMA 2ABAA 2J24A 3AC0A 2ACRA 2VYOA 2L5HA 1Q6LA 1IWPA 3C2VA 1V6VA 1UD8A 3URNA 3ZOAA 3CWNA 3JRKA 3LPPA 3WBEA 3T1GA 3RX3A 4YTSA 3QM3A 1TMHA 2QMJA 4DBDA 2CKSA 4LBSA 4UZUA 4LS1A 3W7QA 4FPSA 1HP4A 1HKMA 2A3LA 4B92A 5C2GA 1BYDA 3LHVA 2WJFA 3CM4A 3PBUA 4FOUA 3PZIA 4GX9A 3QHOA 2BY0A 4V1XA 1AQFA 2E8ZA 4JTUA 1LDCA 2QT3A 4AD2A 3K46A 2Z1WA 3K8KA 1FX6A 1TPEA 4Q7IA 1KBJA 3W85A 2GQ8A 3JZEA 4UNLA 3MKKA 2QF7A 2VOMA 1PL9A 1MUWA 1U83A 4H8UA 4U3CA 4M3PA 4PYSA 4JTEA 5F4XA 3FDGA 4C6LA 5DO8A 1LROA 4GUJA 3U48A 2QJMA 3FAXA 4OVXA 1VJZA 1SR0A 1B4KA 2BVWA 2ZXAA 1JUBA 3OBKA 2WSQA 1V6XA 2DIKA 1JYWA 4BA0A 1TJ2A 1HP5A 3VNLA 1E43A 2DUZA 4NKCA 5I79A 5AC8A 4QE4A 4Q4SA 3B9AA 3L4WA 1K8XA 4LTSA 3VNJA 4F3HA 3MQTA 4UNIA 4MGGA 5HINA 1I75A 2A3BA 3A12A 1JCNA 1MNZA 5AC7A 4PN2A 4ERAA 3S5SA 4FALA 4CN6A 2D20A 3G8EA 1VCGA 4LC8A 3VDAA 2ZBTA 3P8JA 2GVYA 3EPNA 3EZ4A 4KWSA 3VDCA 2A2IA 4F4RA 4LV4A 4N42A 2PLCA 3AQUA 4K7YA 2ISVA 4N9CA 3PTQA 3GXDA 1P48A 3CHVA 5FJOA 3GU1A 4PTNA 1J10A 2YDQA 1OF6A 3HGOA 4RDWA 2FZMA 2Y7EA 1ISXA 2XM2A 3C8NA 1XCXA 1DTNA 4MDPA 5A5WA 1Q6FA 4B3ZA 4AMCA 2GYIA 1CXHA 3PWGA 1UKTA 4NNCA 5AY7A 3UR7A 1Q6DA 2QJGA 3I3DA 4XISA 3W7OA 4N4QA 4IMDA 3C0JA 1FH7A 1NU5A 1FWFC 4GUHA 3UXDA 1J2BA 3MV01 5CPNA 1E6RA 5HMSA 4J28A 4L61A 1DE5A 1F3XA 1P6CA 3GDKA 2VDGA 3AI0A 2BHZA 1R3WA 2OQHA 2QQ6A 3IVUA 1PEZA 1FWHC 5RUBA 4C6BA 3U9IA 7ENLA 3ABOA 4PMRA 1GJWA 3GBDA 2O9OA 3LTSA 1S5WA 1Y5WA 4XBKA 3TVAA 1OIMA 3KP1A 1TELA 1R30A 3NTYA 2Y6ZA 3SGUA 4Y9OA 3L4YA 5FJRA 4GUGA 1BXBA 3SCRA 1F76A 4AWSA 3SCPA 2D2JA 5KZDA 4B16A 3B97A 5CC3A 3KCOA 4D9PA 4UQBA 1OVDA 1UKPA 2JE8A 5CG7A 1YQ2A 2EO7A 4JEJA 1OADA 4YJ5A 3L4XA 2DJLA 2J47A 5EIYB 4QISA 4CEUC 5HPCA 2PDJA 4H41A 3MO7A 2XVNA 1ADSA 3V0TA 1PX8A 1UPPA 4GKLA 4PMQA 2OPJA 5HMEA 2DSUA 4H9ZA 2BP1A 1OGBA 2VL4A 1DXFA 3RMEA 5I3FA 5AC5A 3H2NA 3KRZA 3LSBA 1UCWA 5FJUA 5REQA 3LG3A 1EA0A 2RGLA 3UW6A 4XTDA 1GEQA 3YPIA 4PB4A 4ZO9A 4XAGA 3G1VA 4HYVA 2UZ9A 4M6PA 3BMVA 3SR7A 1XKYA 4S3EA 1Q7ZA 1WBHA 1VEOA 3MDWA 1B4EA 5EL1A 2O7SA 3AHTA 4WUIA 2JKAA 3NQ7A 1JD7A 4ADTA 4OV4A 1GW9A 4J2MA 2F6UA 1IQ8A 3UVAA 2X05A 4GCXA 3TMQA 3BWWA 2WZTA 3WEMA 4HCDA 2DW7A 2ZC8A 2PD5A 1VD6A 3V4BA 5BXRA 4XK2A 4ZB0A 3E0IA 2DDXA 1UWQA 4DJED 1ZCOA 4Q7BA 1UKSA 3CASA 5MF5A 2J88A 2DZBA 1QNVA 3VM5A 1UWAA 4US6A 4BKNA 4L4MA 1GVFA 4AYSA 3RM9A 5TAOA 3VMOA 3MUIA 2YCLA 4WDUA 1WDRA 2XSAA 3TN3A 1REQB 2QJNA 1FQ0A 1UR3M 3F4VA 3HMJG 2ZUWA 3FHQA 2PLJA 4YWIA 4O13A 2GFTA 1VFFA 3AIUA 1BRLA 1S2UA 5DMYA 3LNPA 3OODA 1W1VA 3R0KA 4PCTA 2VI0A 4E2OA 2ZC1A 4AHOA 2WNWA 1EJRC 5FD0A 1HJWA 3OIHA 3RPTA 3EAUA 3NO1A 1O68A 2JGQA 6REQA 1R2RA 2IKHA 4DF2A 3W29A 1TMLA 4UFIA 1MW1A 3IRSA 4HHMA 1RA5A 3ZVHB 2D2OA 1V79A 3LLXA 4ICNA 3ZR4A 3BAWA 2VUNA 4WY0F 1PCKA 1ZBVA 3DYOA 1EBGA 3E96A 1Z6KA 3T6CA 1ZP4A 5DCBA 4PUKA 1WQ5A 2BX7A 1UR0A 3R79A 4FX7A 2P50A 3PANA 3CB3A 4IMAA 4ALDA 3EB3A 1AMKA 4BZYA 4LUSA 1ITCA 1E6XM 4BS0A 2Z1XA 2ZX5A 1XGEA 4OZOA 4X2PA 4HTYA 3RN6A 4RR4A 5T91A 1PKLA 2WSKA 2X7VA 3V1PA 1ZGDA 1I2NA 5A95A 1HVQA 3SGZA 2ISSA 3B0YA 4LNYA 3W4RA 1B3XA 1G4EA 2GDVA 2QULA 4W8AA 1UP0A 2V0TA 3CMGA 4PGLA 5DBTA 3QFEA 1UKQA 3WF0A 4PCFA 3RMJA 1Z7AA 1EJUC 2AQWA 4GMEA 3FJNA 1XYBA 1TTPA 4M24A 1K9TA 4CEXC 5I77A 1K7FA 1EWEA 1KBIA 1TJPA 3HMCA 1NFBA 4LV9A 3M0XA 4UOJA 4S3FA 5M5DA 4NYUA 2C14A 3KWSA 2J7GA 3CO8A 2AAMA 1NFPA 2WLYA 3P84A 4DUVA 1K7EA 2ZA3A 4L7ZA 3WSUA 4IGMA 4XTIA 4QJ1A 5IDZA 2Z0IA 3LA4A 4LYQA 1SJAA 1DOSA 3FGCB 2YCKX 1FXPA 2BY1A 1QT1A 3JU2A 3AIBA 1U33A 4KFNA 5D9OA 3WLNA 1QDSA 3PPFA 2Z1KA 4Z1CA 2CKRA 3RLHA 4RZ6A 4MOZA 1YIXA 3NA8A 3CMFA 3NQFA 4WOZA 2XGIA 4CU7A 4N9DA 5I3HA 2OYKA 1LL4A 3VGGA 3KX6A 2I5GA 4GJIA 4HNCA 3VC5A 3BLIA 2Y5EA 4CKQA 1PBGA 1DJIA 4CLMA 4JTSA 4JTLA 1S39A 3RO8A 2C18A 4BI6A 4KRTA 4QLLA 4LRSA 1VFSA 1W17A 2PWFA 3B40A 4LB4A 1TVNA 4O19A 2OCZA 1B2YA 1OY0A 1U1JA 3CAQA 1KCZA 1M7JA 1E71M 1B54A 3LTPA 2DUAA 2X09A 1X6UA 3OVQA 2VDHA 3QKEA 4NJHA 4ZE5A 3GIYA 4YTQA 4EPEC 3B05A 2J7BA 5AKQA 2DVUA 4PUDA 4D6JA 3E02A 1XX1A 3WNMA 1IWBA 1ZNNA 1OIFA 1BLIA 1FHVA 3HPAA 3COTA 3P74A 1H49A 3W1AA 2VD8A 2GQ3A 4L6HA 4ENLA 1M68A 3WN6A 2BVDA 1F3EA 3BLFA 2G0WA 2VHLA 5D9NA 4UQCA 3KS6A 4GGBA 3IV8A 1AODA 5J5RA 2TPSA 4JTCA 3RLGA 1ONEA 5GQBA 5AC4A 3GTXA 4H8NA 2Z2UA 3AALA 2H3BA 2QHAA 4OWGA 3B06A 5FL0A 1JAKA 2QZRA 2J7EA 1SZFA 1S46A 3B8DA 3BICA 1U5VA 5EBUA 4KCVA 3PFRA 1R87A 2WMGA 4B5VA 5JIPA 1UW9A 4Q8PA 4MFDA 1MQRA 4PRTA 3FX4A 4GQBA 1WO2A 4LT9A 4KMQA 4O12A 2GJXB 2Y0FA 1YXDA 1WKEA 3WNLA 1HJUA 1UKOA 4R9XA 1F7BA 1PDZA 2PLMA 4FXSA 5FJPA 1VLIA 3UERA 3LMZA 1NWSA 1O4UA 3OTRA 3SRDA 4UUIA 4LUIA 3WK0A 1RZMA 4HKPA 1OSEA 3UZZA 3UF9A 3ZSTA 1PYFA 3CPUA 4YMZA 1JIBA 4JL1A 2YXOA 3NQVA 3WJXA 2DT2A 3B8UA 4LB3A 3CYJA 2Y8VA 2CHNA 4QQ3A 4Y90A 3WMLA 2D2HA 3GVGA 3DU0A 3DZ1A 1PAMA 3MKVA 4Q8TA 3A3HA 4E2DA 4HGXA 1VPYA 3PZTA 3RYSA 3IJLA 3CZKA 4AZHA 3E49A 4R9OA 1K8ZA 4PUEA 4AISA 2UWFA 4FXRA 4K37A 1ZB5A 2FMNA 2OODA 3EDFA 3GH7A 1RY8A 1VBUA 3LV5A 3ZJ6A 4P5UA 4X0NA 3FA3A 4Q4RA 2WCGA 4WDTA 4B90A 4H9VA 1LUCA 1K4HA 3CS2A 1XLMA 2HTMA 2PC4A 3CPRA 3VKCA 3GSMA 4LAMA 2DZWA 2ZUVA 3IWPA 4M7TA 3Q58A 3AXXA 2R9RA 3KLLA 4PUMA 1C90A 1O66A 4H6EA 4N0RA 1XH1A 1N82A 2OT1A 4NF7A 1KD0A 1CW2A 4JQ2A 3RCYA 1LTDA 4IIFA 1R7AA 2PP3A 3GIPA 4RKAA 3BQ5A 2FFCA 1UUMA 1ZJAA 3GDMA 1IEVA 3E0LA 4EWND 1LRQA 2XFFA 2WNZA 2R24A 4EANA 4L64A 5C7VA 3H2EA 3SO7A 4HZ6A 5A2CA 1US2A 1CNVA 4NASA 3F4CA 4AXNA 2ACSA 3I7SA 4PTDA 1QPKA 3TTQA 4E3TA 3SSZA 4HU8A 3DECA 1T40A 3ANVA 1ISZA 3DI0A 4WHBA 1XCWA 3NQ2A 3E2SA 3GHRA 4X63A 2G3FA 1GYMA 3WUFA 4QDMA 3BXWA 2VWTA 2HXTA 1KQZA 1V08A 2CLEA 4HP5A 3NM3A 4B3LA 3L12A 3GKFA 1DQUA 3OOQA 4I9TA 4NZFA 5EMMA 2Z1BA 1C93A 3SUWA 1ODZA 3NG3A 3UESA 2C19A 1PPIA 2FJKA 1QASA 1T5AA 2QUNA 1B57A 2GL5A 3QGKC 5D05A 4UTUA 3FK4A 3LI0A 3WMCA 3Q65A 2PDYA 4QBXA 2X1IA 4R27A 2QLYA 4WCJA 4XVEA 3GC4A 3RJXA 4XZIA 1W1A1 1AQMA 3B9DA 2CHOA 5EJ1B 5C55A 5JH2A 2XJ7A 3W1PA 3SEPA 3NQMA 3S83A 3GAYA 4D6CA 3CIXA 4ERIA 1RALA 1KBKA 5DF0A 4A05A 3CHCA 3LK6A 4IL0A 1DHPA 1F2JA 1XIGA 3T09A 3WQOA 1JFHA 3WBXA 3SCOA 2WV8A 2GSJA 1XINA 3NSMA 2QCNA 4A8LA 3IGXA 3OJGA 3N3MA 3S5ZA 4H3DA 4IF2A 5BU6A 2A4AA 3AZSA 3SUVA 3VE7A 5I3GA 1XLAA 3BUVA 1J5SA 1OT1A 2CETA 3ITTA 2C0HA 4F2BA 4HHPA 1J93A 1OX5A 3NPWA 3PZOA 1D3HA 4C1NB 2C15A 1HKKA 4YVVA 3QV9A 1BHGA 1P5BA 3BLDA 3BV4A 1BTMA 2QPUA 1EOMA 1ZAJA 4JY9A 1WKDA 2XUCA 1YX1A 3UFYA 3RDKA 4K36A 4CU6A 3LZ5A 1A5NC 3TQPA 1XH0A 1J4EA 5E5CA 1XIDA 3OZPA 4MWAA 3STGA 3PSWA 4OE7A 2ZWZA 2ONEA 3PSVA 3CHEA 1JZ4A 4BQ4A 1YMYA 4JBRA 1CIUA 5BXPA 4CCZA 4JFWA 4ACZA 1CGYA 3ANYA 6TIMA 1IEIA 2VENA 3WMSA 1UD3A 1F8MA 3ARPA 4B9ZA 3O15A 4DJFA 5KZEA 4B9YA 2FDSA 2ACUA 4Z17A 5I2UA 2FQIA 2BXZA 4IIEA 2GQ9A 2XH0A 3HU7A 3NGFA 1BWLA 1XBYA 1HTIA 2OLHA 2PGRA 2AGKA 4AZCB 3QR1A 2TODA 4UFJA 2Q6ZA 3BARA 4XZWA 3PB0A 3FKRA 1A5LC 1YKWA 3WDQA 2GGGA 3L4VA 3AMGA 4P2VA 4QLKA 1JI2A 1NSJA 1EHAA 2C13A 3I3BA 3LCGA 1XUUA 3VZZA 1I2PA 1PX4A 3S1WA 1R0MA 3FJ4A 1QVBA 4IPPA 2QCDA 1TWDA 3HGSA 3AUJA 3VABA 4LXFA 4EK7A 1T8QA 5C9XA 4Q6XA 2Z1VA 1VIZA 1J8VA 3TN6A 1GNXA 3H12A 2P88A 2H3DA 5CPSA 2YKKA 2NV9A 3W7DA 3EWWA 4V28A 4HSNA 1VHCA 3DHDA 3THUA 3LCLA 2FLIA 1W32A 1UP2A 3C0LA 1TX0A 3QC0A 1SGJA 3V1HA 4C6NA 2J25A 2E9LA 1PZ1A 1RJQA 1E72M 2H6RA 2PB1A 1SFTA 3H7VA 3ARTA 3ANUA 3GB6A 5EPDA 3M41A 1XLCA 3BCFA 1E51A 1KQYA 2XVPA 3QY7A 2VGFA 2XISA 1ADOA 4I3GA 4B3KA 3TFXA 1UH3A 4XZHA 1DQXA 5I07A 3LYEA 3WQ4A 1K4GA 2P5NA 1PTAA 1EFZA 3CUXA 4HYWA 1NARA 3KVLA 4MADA 4S38A 1G94A 1PS9A 1I6NA 3PS7A 1IXOA 2EPOA 4UNKA 2PWDA 4I7UA 2ON3A 1FA2A 1YNPA 4NZ5A 5BRBA 4MJ4A 4M7SA 1BPLB 2BXVA 3DGBA 4NSBA 4FXFA 2PDPA 4H8HA 5A3HA 3HB9A 3CL6A 1TVLA 4OKDA 3W70A 2VX4A 4IQLA 4IP5A 3E0VA 4FO4A 3GFXA 1WPCA 2MANA 4WGHA 4P7OA 1TPFA 1KM6A 2YW4A 1TG7A 2H9AA 4L9YA 1VBGA 5DT5A 1OX6A 5ENLA 4W88A 3NZPA 2HE8A 2OGYA 4N9BA 2YXXA 1UP3A 8RUCA 1LRTA 4UFMA 1OFPA 1XDJA 3RRAA 3M0IA 5DMNA 3LGEA 2QV5A 3B8SA 3C56A 4N6FA 1XLIA 2NT1A 3RX2A 5LA1A 1RAKA 3MCMA 3VMNA 2DIJA 3AWOA 3SCNA 4PE8A 1A0CA 1MZHA 3LCXA 1WAUA 4QFUA 2CBVA 4H1ZA 2CZDA 1GJPA 1TR1A 4EKJA 1Z89A 4N7QA 1UBSA 4PMJA 4D1JA 4IUGA 1XRTA 3T4WA 4WRHA 2Q02A 1EO7A 2G3IA 3OLDA 1CXFA 1KM4A 3OQ8A 4GY7A 1OG0A 4R53A 1YDNA 4ZVJA 3P61A 2FGLA 4I6KA 4H6QA 1DP0A 2OTDA 2AOSA 1JPIA 1DJWA 3JW7A 2YYTA 2C8NA 1XBXA 5LZLA 1SO5A 4AAJA 4DAIA 3C61A 5LA2A 3IJDA 3D5HA 2FTYA 2D0HA 2YFNA 4NILA 5D33A 3VIOA 1O1ZA 4MWAE 5TNVA 4LANA 3TOYA 4DEFA 1IR1A 3DESA 3BZJA 3P2VA 3KRBA 4ZB2A 4JX6A 4URIA 3PUOA 4IIDA 3D0CA 1EO5A 2CLOA 5CPLA 3FEMA 4HQVA 3QQ1A 2PDNA 3QV8A 2XIOA 3HURA 3NCOA 3WD0A 4J5NA 4REQA 3VD7A 4EP8C 3PUEA 2PI6A 2EPMX 1MRQA 4JTTA 4JQAA 4UMCA 3WLHA 1QPOA 2R8WA 1G6CA 4W7WA 4XAPA 3G1YA 1TJ0A 4GO9A 3B9OA 2XDFA 3M0HA 1K6WA 2I5QA 1UPMB 4ZGYA 1E3XA 2AMXA 1OX4B 1THFD 3RCNA 1Y65A 3LM7A 4O52A 1VCVA 3VNIA 1C29A 3I6RA 4I8YA 3UZ5A 1UR2A 4IWWA 4H19A 4JIHA 4D6EA 1ISWA 3M16A 4H04A 2HNHA 3QBUA 2WVVA 3SY1A 1GT8A 3IVTA 2PUZA 2CYGA 2XIJA 1UH2A 5EGRA 4X2RA 2W5FA 2WVTA 4WOQA 5D04C 4J40A 1CI1A 3UG8A 3RJYA 3TONA 1CB7B 5BYWA 5REQB 4Q8QA 2YLAA 4TQTA 1FDJA 3HPFA 1H60A 3ATZA 1HF6A 1WZMA 5CC5A 1CECA 1ECEA 2GK1B 2C91A 5E9XA 3R7MA 3WIJA 3WJWA 1R86A 1Q13A 3Q45A 4UTIA 5GNYA 3TYBA 3DFYA 1KM2A 4UFKA 4UOQA 3O06A 4J27A 5HANA 5HR6A 4GVFA 2FJUB 1EPXA 3GG7A 1O5KA 2OSYA 2A0NA 2ZWYA 3VGDA 2UV8G 4F0LA 1TA3A 3RO6A 3NZRA 2Z1SA 5DCDA 1QUMA 4LJ3A 1HW6A 4JCLA 5CJ5A 3W83A 1BFNA 1VC4A 4LYRA 3GU2A 1IF2A 4UTKA 1UR9A 4NNAA 1F6YA 4J9JA 4GYPC 3N4FA 2RHGA 2NQJA 4GIAA 3I10A 4PTWA 3KFTA 2ZQ0A 4JN7A 1ZJHA 2WZIA 3WKZA 3WH8A 1L6WA 3EB2A 2YCLB 3THAA 1BWKA 3GH5A 1NWRA 3AXHA 1LQAA 4C6OA 4RK8A 3UWYA 1YTDA 4NAFB 4H7ZA 3T0TA 3K4DA 3A4WA 3DFOA 1X6NA 4KH2A 2WM1A 1MQQA 2IXVA 1FCQA 4BEUA 4LBRA 5BNKA 2QCEA 3U8GA 4H83A 4EF8A 1VFUA 1P7TA 5I3IA 3KP0A 5G4HC 4QLJA 3PWIA 3MMDA 1CZ1A 2YBVA 3TROA 5CG0A 2ATSA 3ISIX 4FX6M 4J4KA 1L6YA 4TOQA 4D6FA 8XIMA 4QSFA 4GHRA 3FYYA 2XU2A 3VMPA 3PP7A 3WQ8A 3CUGA 5I06A 2DZSA 3QV6A 2OEKA 3SN4A 2HEJA 3RR1A 4AIOA 2J78A 4IJBA 3WMBA 3ZM8A 3ECQA 5EMYA 3IJQA 4MJ2A 3B8TA 3C3NA 2F6KA 5CZSA 1V3MA 1H11A 5K7JA 4BFAA 4A2RA 4L65A 3NVDA 1AJ0A 3KW3A 2F6XA 2OO0A 2V8ZA 5ABTA 3VYLA 3OYXA 5AZ1A 4ZEPA 1JYXA 3UD6A 4ORMA 4JX4A 2BOFX 3CV2A 3BAKA 2PF0A 2FFIA 1E6NA 2CBIA 1BSIA 3SGGA 1SZNA 4F79A 4UCGA 4NAEA 1MO0A 4ZTYA 1NWUA 4H4IA 3DEQA 4AZIA 4C5ZA 1FWIC 1S5NA 1Z32X 2PDKA 1RQBA 3BCDA 5HNNA 3ZIZA 4UTWA 3GE7A 4ML9A 4H8VA 3AHXA 4FNTA 4P8UA 4H9MA 1ONRA 3TX9A 1AW5A 3M64A 1KTBA 4GC4A 1TZ9A 2JEPA 2ZOXA 3BH4A 1GZGA 3GS6A 2NX9A 3LHUA 4FS9A 2QDDA 1FDYA 5FAGA 4CQAA 3H23A 5EFDA 4ZMGA 3WUEA 5I03A 3NYDA 3OPSA 4UTMA 1GONA 3OA5A 3TFCA 4JZ5A 2GVJA 2W66A 1PWLA 4QX4A 1S5TA 5EKYA 2VEMA 5A6BA 1IT0A 3WG6A 1OFOA 5EU9A 3TDFA 1WA3A 3N2MA 5K4XA 3BAIA 3AU6A 4JKMA 4EAMA 2GJLA 3SZ8A 4EWJA 3GNNA 3Q37A 3P6LA 3FJLA 1UHVA 1V03A 4UR8A 2DZPA 2POTA 4H9YA 2D3LA 3O6DA 1H41A 3EOSA 3LPFA 1FWBC 1XRVA 2YX0A 5G5IA 1MI3A 3F1QA 1NP2A 3WK3A 1LYXA 2PGWA 4L4PA 3WO8A 2WSRA 2ESCA 1O6IA 1XFBA 2ZIDA 1U5JA 1YHTA 4N6EA 3UJFA 3IGUA 4HBKA 5CAKA 1JZ3A 3S1VA 3H22A 4D6DA 3PPHA 2EKGA 1DEDA 1SZRA 4JCMA 1X7FA 3CTTA 2ISDA 3VFLA 3UCDA 3W87A 2R1KA 4J3TA 1B3VA 3STEA 2D3NA 2O4MA 3TYEA 1UR8A 1JRBA 3L0GA 4A2SA 4JTGA 4KETA 4ACYA 4GJ1A 4RPQA 1BAGA 1XP3A 1E56A 3ALFA 1EDGA 7ODCA 2ALRA 6ENLA 3W28A 1FRBA 3IIOA 1MEHA 2PURA 1JDEA 1V8EA 1R7OA 1JZ2A 2ZZ1A 1R2SA 5DY3A 3AROA 2QUVA 3PHAA 3T0BA 3ZFHA 3AYVA 1EC7A 2VRJA 3A9IA 3AMKA 1TPB1 4WKAA 4RX0A 1EIXA 3MJYA 3C2EA 3W7CA 5I00A 1JD9A 3TJIA 2OO6A 3K1GA 4F0MA 3W1QA 1AUSL 3BMWA 2PE4A 5HA7A 5AHIA 3UETA 1DIKA 3IEBA 5E0KA 3UPWA 2CHRA 3M0KA 3MCNA 4P7LA 3PN8A 4AFYA 1NEYA 2FHCA 4RNHA 3LV6A 3ONCA 3UY7A 2VZOA 1G9HA 1DV7A 2VQTA 1CGUA 3M07A 3R8GA 5JQ9A 2VT0A 3WELA 2D69A 1Q2RA 5HQLA 3GXFA 3HGRA 3LCIA 3QW4B 1EXBA 1EIBA 2PEVA 2WMJA 3FN9A 1XBZA 4ZO6A 4C5YA 3SRFA 2VO5A 1Y7VA 3ZO9A 2FZBA 1OJXA 1QXLA 4RL3A 2BLEA 2BV9A 1WKFA 2Z6IA 1HKVA 3R1ZA 4HMCA 1TV5A 5ABFA 4HPGA 4MNKA 1QI4A 5A6TC 1UA3A 1HFBA 1I8JA 1P43A 4XIAA 1U1UA 3ARQA 1HT6A 2FZDA 3EDKA 4UMBA 3F2BA 3NL6A 1QBBA 2PBGA 4RDYA 1CENA 1YXCA 1GKRA 4R33A 3EKZA 4D8LA 5FJTA 4B2DA 1C7SA 1HKIA 2ALDA 3KL0A 1PB0A 3WLTA 2B31A 2GGEA 2ZTJA 4L5ZA 1GVSA 4HJFA 1AZ1A 4J3ZA 4Z2JA 1LUCB 3QPYA 4F8XA 4JYEA 1HO1A 3G1AA 4O1BA 4A3YA 1TREA 3PB2A 3LN3A 1W5MA 4IFRA 2GWGA 4DO6A