1KFKA

Crystal structure of tryptophan synthase from salmonella typhimurium
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
251
Chain Sequence
b'MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title On the role of alphaThr183 in the allosteric regulation and catalytic mechanism of tryptophan synthase.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 94
structure length 251
sequence length 267
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2001-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1kfkA00
3E0IA 3KX6A 3JRKA 3LBMA 5EYWA 5J5RA 1B3OA 1H1YA 1W5QA 5AYXA 4Y9AA 1PCKA 2FPTA 1OFEA 2VEIA 2YYTA 1HUVA 1N7KA 4JIPA 2A6NA 4JTHA 3EXRA 2EKCA 1YLVA 2Y62A 5LNVA 4UFHA 2WNNA 3I7SA 3RF9A 3C2VA 1IIGA 1WA3A 1S3HA 1H63A 2ZA2A 5AHEA 4O50A 2CLKA 3UPBA 2C16A 3QC3A 1AW5A 1ME8A 1KM3A 2QUUA 3CB8A 3G8RA 1LLWA 3W7MA 5I3JA 1T96A 2I1OA 2CZDA 4PODA 2G97A 2RFGA 1ZY9A 4WJEA 3MYPA 3T44A 1QAPA 5AHLA 4FEZA 3CPRA 3T40A 3Q58A 2A4AA 2QEZA 3C2EA 5D33A 3IVUA 3IIXA 1SW7A 2B7NA 5TQLA 2TMDA 1TQJA 1GG0A 5HQEA 5I3GA 1QPOA 4JX6A 1V7YA 2NUXA 3W83A 4O52A 4AF0A 1SO5A 1XUUA 3SW6A 4Q4KA 3NQAA 2W79A 3HPXA 1TPC1 5H2ZA 1QO2A 3DHDA 3QSRA 1EX5A 1WOBA 5E1QA 2YSWA 1XKYA 3W7EA 3TQKA 2GPTA 4J9JA 1K8XA 4FIQA 1DV7A 2DJXA 5D2WA 3U2OA 5LNUA 2CLHA 4JICA 1M5WA 3M6YA 2G96A 4ADUA 1ADOA 4HNVA 1KW1A 1KFJA 1WBJA 3EWWA 5HR6A 5FEWA 4CCEA 1QOQA 1THFD 3KAOA 2WSRA 1GEQA 4ZQOA 1U83A 1DHPA 4KFOA 1Z48A 4LVBA 2GJLA 2E77A 4UTTC 1BEUA 1EPXA 1G4SA 3LI0A 1LOQA 4NX5A 4YL2A 5G4WA 3O63A 2QCHA 1AK5A 3IRDA 1UASA 1EIXA 4OV9A 4FNSA 4LUJA 2FQIA 3ELFA 3EXSA 4MY9A 3INPA 3USBA 3Q94A 4PEKA 1JQVA 4OE7A 1OF6A 2A2IA 1VH7A 3B06A 1T0OA 2H90A 2W6RA 2NX9A 3PB0A 4BWLA 2OT1A 1EWDA 3ZS4A 3L2IA 1O94A 3ABOA 4O4WA 3PBWA 3NQFA 3HG2A 3HPSA 1B4EA 4S2BA 1C29A 1W3TA 1OX5A 3DXIA 5D04C 3ANYA 1VLWA 3SJ3A 3SGZA 4XTIA 2E1DA 3NNTA 1ZAJA 1DJNA 1PIIA 4WY0B 4M6VA 4RZ6A 3S5ZA 4K7YA 4O8RA 4N9CA 3NA8A 5FEPA 4ZZ9A 3M7WA 3LV6A 4R33A 2YYUA 5K4XA 2V30A 2CWNA 1VLIA 3TFCA 3LX9A 3MYOA 5FF7A 1Q3NA 3TH6A 4X2RA 4LVAA 3NM3A 4X22A 3CT7A 3UZJA 3TQVA 3N73A 4GNJA 3MP5A 3TIMA 2WNZA 1NEYA 4HHPA 4JGDA 2DP3A 4Z0SA 4W9TA 3VNDA 4AMAA 4AHQA 3PSWA 3W6YA 1Q6LA 1RD5A 2E6AA 4BR1A 1PV8A 2UV8G 4ZQMA 3BPWA 3QPZA 3TUUA 1JQXA 1JRBA 2V5LA 4GUHA 1T99A 3HPZA 4M7SA 5BRBA 3NPUA 3C6CA 3CM4A 1VHCA 3KFTA 4R34A 2E6FA 2NX1A 2TSYA 4IWWA 3LERA 3BK0A 3NPVA 4NU7A 3UWQA 3W23A 4MKNA 5G5IA 4O0ZA 3GDMA 1E51A 3W7DA 3TQ0A 4TMCA 5K7JA 3G0XA 1FDZA 3LTSA 3P84A 3N9SA 1TSIA 5BMWA 3BW3A 1P0KA 4HSNA 1H1ZA 3DFOA 1WV2A 5D2XA 3IIVA 3P7YA 3W87A 4CNNA 2FDSA 2A21A 4MOZA 5I3FA 4L4LA 1T8XA 1UUOA 2RDTA 2VENA 2ZZ7A 3NQ6A 2A85A 1UB3A 3L68A 4HIBA 2ZTJA 1ICQA 4GFSA 4YWIA 1VHNA 1C8VA 2Y61A 3R13A 5E0KA 3G1XA 3QYQA 1KFKA 4HSOA 1TPB1 3P80A 3PUEA 3FYOA 3TK7A 3R8RA 1YADA 2EAWA 4O4VA 2Q8ZA 3QMTA 3T4CA 2QCLA 1M6JA 2KZHA 4Z1AA 2V2DA 1YDNA 3M47A 4MLJA 3UY7A 2ZZ2A 3THQA 1SFJA 3PULA 4IMDA 1FXPA 2QAFA 2QCEA 3QQ1A 3ATZA 4YXGA 1TTIA 3C61A 1GJPA 1KTBA 3WK1A 4GXMA 3ZFHA 4NJJA 1Y0EA 1G7VA 1LBMA 4MJZA 1D3HA 3BLFA 4K37A 3TDFA 1W54A 1LRTA 4IXXA 1ALDA 2JBMA 2DORA 2QJIA 4NQ1A 1R46A 2BTMA 4A3UA 2ZDRA 4O10A 3RK8A 4Q32A 4FNTA 5G1YA 3CHVA 5DCDA 1FCQA 3V1PA 1OFQA 3LI1A 3WJSA 4O11A 4FNRA 3IVTA 1FXQA 4HPJA 1I2OA 2CFFA 3NM1A 4WUIA 1VCGA 4JTSA 3BG3A 3W1LA 4UTTA 1A53A 4M7TA 1PL9A 3LB0A 4M5PA 4OU1A 1ICPA 3LHWA 4O16A 3LCFA 4QJ1A 1A5BA 3TKFA 3W1AA 1KBJA 2A1YA 3U8GA 1P5BA 2V5BA 3KVMA 5G2IA 5J5DA 3QM3A 3DGRA 3W7CA 4UNLA 1EEPA 3OIXA 3LXAA 4O1BA 4JEQA 3ABSA 4JX4A 4MY8A 3NQ2A 1KV8A 4LC8A 4PH6A 3UNDA 4MPQA 4TU1A 3NZRA 4DELA 1G4TA 3H53A 3TFXA 1LOLA 3IIOA 4JN6A 4L4MA 2P1FA 4E38A 5U4NA 2NWRA 5AC8A 3WK0A 4TR9A 5F4XA 1LP6A 2CLEA 5LNRA 4FXRA 3W7KA 3NEVA 4JTJA 5HJLA 3RLUA 1DJQA 4N2YA 5KITA 2OCZA 1LORA 4QNWA 1RZMA 5HUPA 3WK2A 5E93A 1A5CA 2O7QA 2ZFAA 4JS3A 3HF3A 4O54A 1VR6A 4OV4A 2ZRXA 3C0JA 5KZDA 1FWTA 1W37A 4C1LA 3W1XA 4LOCA 2IQTA 4I7VA 4RLIA 4UUIA 3OVPA 1JUBA 1IIHA 4JD4A 3N2XA 4GC4A 3HG3A 1XC4A 1MXSA 2QJGA 1FDJA 4ZQCA 3GVGA 3MI6A 5DXYA 3G0SA 3GDKA 3TXZA 3M9YA 1W5NA 4EIVA 3ZWSA 4GJ1A 3PBUA 4DF1A 1FWSA 2JGYA 5HINA 1FBAA 1OX4B 5KZMA 5D38A 2NV1A 3N3MA 4O53A 4QITA 5SWUA 5CGQA 2NXGA 5I3KA 3W1TA 5FESA 2C1HA 1EP1A 1JUKA 1FDYA 1QCWA 4YLWA 1W56A 3TC7A 2NX3A 3GDTA 3DBPA 1BWLA 3W22A 4FNQA 2B7OA 5CZJA 1VYPX 5F2MA 1TQXA 3WK3A 1FWNA 2VFGA 3UXDA 2R8WA 4AWUA 4CNPA 3B0PA 5KZEA 3E02A 3P5ZA 3RU6A 1EB3A 4YMZA 2ZQ0A 3RLVA 4OHQA 5TBOA 3W85A 1GYNA 2EHHA 3MW7A 1ZAHA 1LOSA 5AN7A 1Q6RA 1YPFA 4FX6M 4MY1A 3BW4A 3W88A 1MEWA 3S5NA 3EKZA 1LZOA 3C4UA 1YTDA 3LOTA 2XFWA 4GUGA 4H3DA 1QPNA 3A5FA 5F2LA 3P8JA 1BTMA 2VKZG 2BZNA 1TPWA 1TRDA 3O15A 1XM3A 1FWRA 2VFDA 5FF3A 2A7PA 1KM6A 4IOTA 4RV8A 1WXJA 1RQHA 2VC6A 3O8AA 2BXVA 1YYAA 3B03A 5K4ZA 3N34A 3G0UA 3MI3A 3IIZA 2OZ0A 1OFAA 1GOXA 5HNRA 3PS7A 3W1MA 3MP3A 5DBUA 4Y96A 1O5XA 1AMKA 1C9DA 4TIMA 1OX6A 2FB3A 1FQ0A 4UMBA 5CPMA 6TIMA 4JIQA 4LRTA 4X9SA 4ZQRA 2GOUA 1G4PA 2PRLA 3GDRA 3O05A 1GYLA 4O1AA 3LRKA 3W2MA 4G1KA 1OFPA 2X1SA 4UFJA 3G3MA 3QH2A 3LBCA 4HNTA 3IGSA 5HMSA 1KTNA 1W1ZA 2I14A 4NVTA 1V5XA 1OYAA 1I2NA 2I9EA 1XUZA 1ZALA 3F1QA 2Y7FA 2DZTA 4QM1A 5D37A 2NWSA 2X30A 2ZA1A 1H60A 2X2GA 4QIUA 4IPIA 1DOSA 4P2VA 2NXHA 4S2CA 1XFBA 3TCEA 1DBTA 1YXDA 3FJ6A 4U28A 5KINA 1LBFA 1K8ZA 3NL6A 4K8HA 4H4IA 3DENA 3NO5A 1H61A 1TPUA 3HQ1A 3C2OA 4AHOA 4DPQA 3FEMA 5DY2A 1XBVA 3L65A 5LGXA 5LZLA 1QPRA 5IBXC 2VFFA 4JTUA 4UTWC 4RXGA 3LDVA 5EA9A 3MI2A 1F6KA 2WSYA 4CQ8A 4U4MA 4N9BA 1XBYA 4XBSA 3O16A 3W9ZA 2E09A 4LWWA 5D30A 2YR1A 1F5ZA 4GE8A 1TYGA 3R89A 2ISVA 4MYAA 4K8EA 3AJXA 2OMAA 2VEMA 1G69A 3G1AA 2C14A 3NOEA 1OABA 1VZWA 3NXFA 4UFLA 4XKYB 1J2WA 1L6YA 4R53A 3KHJA 2P0OA 3DU0A 4O28A 5I3IA 2VEPA 3HJZA 2Q3RA 1J5TA 3S6DA 2E6YA 3R5EA 1Z42A 3EX3A 4HT3A 4S1FA 1TTQA 3GIYA 3VKJA 5F4SA 3NQVA 2WNQA 3C52A 4DPPA 3MJYA 2ATMA 3UWYA 5DN1A 1LROA 2EPHA 4XWUA 4RZ5A 2Q8LA 3V75A 3W86A 1SU5A 1XXXA 1GQNA 3PSVA 3TC6A 1TO3A 3G22A 4DO4A 2GVGA 4E0CA 1ICSA 5CPLA 3PY2A 5C54A 5F2GA 1Q6OA 3ABQA 4UCGA 3SSJA 2DZWA 5LHEA 1JCXA 1F2JA 1Q6QA 4ML9A 2AGKA 4JYDA 2ISSA 3W73A 1LM1A 4HN4A 3GLCA 1SUXA 4AXKA 2VOMA 3OEXA 3S1UA 2RH9A 1GTEA 3UD6A 5HWNA 3CQ0A 3GX9A 2YDAA 1GVOA 3PM6A 4FHAA 3CWOX 3HO8A 5LKYA 2PE4A 1ME7A 2CW6A 2PURA 2OX1A 1W8SA 2ZZ5A 3I7RA 3OVQA 3R12A 2DZXA 1RV8A 4GUFA 2JGQA 5DCBA 3QW4B 4JNMA 5C5YA 1EP2A 2FFCA 3BW2A 1NF0A 4M19A 3GXNA 2NV2A 1OYCA 3NQCA 2V0TA 1Q45A 3N9RA 1PHQA 3E49A 5DLCA 2CLOA 1KTCA 3HIJA 1F74A 2ISWA 1VCFA 1ZENA 4RXFA 2O7SA 1ONRA 1HO1A 2HTMA 3GNNA 2Y7GA 2YFNA 3M1ZA 5L6UA 3BO9A 4O17A 4LC6A 3GZ3A 4AF0B 3EX1A 3SY5A 2XN0A 3MHFA 4RX0A 1L9WA 1YXCA 1TPFA 3OG3A 3W1PA 4UTHA 3L21A 4UR8A 4LS1A 2GQ8A 1TB3A 3TXVA 1TTPA 5K9CA 1P0NA 3LRLA 2LLEA 3BVJA 3QRHA 4PTNA 3LCIA 2YFOA 4MYXA 4PFMA 4MUZA 3GNDA 3DFPA 1D9EA 3M41A 1AW1A 1K3UA 2C18A 2EGZA 3GKFA 3EX2A 4Z1CA 3NG3A 3TX9A 5BW6A 4N4QA 3NL2A 2WQPA 3UWVA 1MEHA 2V81A 3F4NA 3KVKA 4JDYA 3H54A 3PG8A 5K9XA 1JJKA 3UY8A 2A6LA 1MO0A 3W2JA 2H6RA 1X1OA 1EUAA 1SZEA 1WDWA 3W75A 2DJLA 3PG9A 1KM4A 5CG7A 3IV3A 3AO0A 4NJHA 3DHFA 5D03A 3B4UA 2PC4A 4ZVJA 1TPEA 1KFLA 4DEFA 2QCDA 2ZRVA 3LTYA 4GWEA 3LHVA 4C1KA 3SZ8A 5D02A 4ZQNA 4M6QA 3PWAA 5I3HA 3QPYA 2QCFA 4LS0A 3SGUA 5IBXA 1LCOA 1QDSA 2DU2A 1LDCA 2CLMA 5DELA 2ATSA 2YCEA 4UTWA 1VCVA 1S5VA 3W72A 1ZNNA 4XTDA 4XUGA 4ZQPA 5TIMA 1HO4A 4UR7A 1TREA 4MIMA 1TPVA 2RDUA 1WAUA 4LU0A 4JY9A 5H91A 4WY0F 2EF9A 3P82A 1O5KA 4AAJA 3QMRA 5HULA 1OF8A 4BF9A 3NYZA 5EBUA 1IXQA 3FYPA 1S5TA 4P61A 2WOQA 4Z0JA 1K7EA 2R14A 3WJWA 3VCRA 1XDLA 3W1RA 1O4UA 1KM5A 1W3IA 2ABAA 3TR2A 3GR8A 1PHWA 3CU2A 2PRMA 3W84A 1NFBA 4NJKA 3TSBA 2QCGA 3NAVA 3HGOA 3P60A 3W7IA 3LLFA 3BARA 3FFSA 4NNBA 2B7PA 3KVJA 4LVFA 2TRSA 2G5WA 4WXYA 4NZFA 1KLZA 4MFDA 2J9YA 1DL3A 1RQBA 5MHBA 4X3ZA 3ABRA 4AEOA 1M7OA 1XCFA 2ZZ6A 1OFBA 3OBKA 3DAQA 3L9CA 1GVRA 5CZ0A 5A8GA 1GVFA 3TROA 1HL2A 4N9DA 2VFHA 1K03A 2A7NA 5DXXA 3TNOA 2NXIA 3W7LA 4JR5A 3THAA 1GVQA 3SR7A 3PAJA 1SW0A 2RKXA 4BFAA 2QAPA 1JRCA 2JKEA 2FPVA 1QO5A 3C2FA 3IEBA 1PS9A 5AC6A 3QFEA 1L6SA 3LXCA 4ALDA 4PCFA 1YXYA 1YTEA 4NJGA 3JR2A 2VEKA 3G18A 1LRNA 4JYEA 5CSRA 3SECA 2V2CA 3NZ1A 3L67A 4DBDA 4ZL1A 4IMEA 3MHUA 1L6WA 2B7QA 4RJEA 3F4WA 4IUOA 3S0CA 4CQ9A 1X8FA 1EWEA 3DFNA 4LNYA 4JDBA 3A23A 1MEIA 1NAL1 3FKKA 1SSGA 4UC5A 2E5DA 3FA5A 3FJLA 3PBYA 2YXGA 1GZGA 3EKLA 2NLIA 2TYSA 5C6MA 3F03K 3DI0A 2G95A 3KOFA 4O1DA 5G1TA 3W2UA 1EP3A 4NUWA 5G2HA 3MWAA 2JK2A 3HB9A 3L5LA 5U7SA 5AC7A 3NQMA 4PC8A 4EWND 3S9YA 4TX9A 1N8FA 4JYFA 2X1RA 4PL1A 4CCDA 4LT9A 1UUMA 4PA8A 4K7VA 1OHLA 1JR1A 4K39A 1G6CA 5D32A 4O12A 1ML1A 3KRUA 3VE9A 3W2LA 3DZ1A 1DKWA 3L5AA 3M5XA 4UTMA 5FF4A 1U5JA 4LVGA 1AG1O 3C56A 2QUVA 1MZHA 3L0NA 3TSMA 3LCXA 3G1FA 3HGSA 1KA9F 2GJNA 2RHGA 4LV4A 4WX2A 3FS2A 3HG5A 2YGYA 3N2MA 3UWZA 3W7JA 3PB2A 4XZ9A 4HKPA 1JCNA 2V9DA 1H7OA 3TJLA 4IPJA 3WJYA 2GVJA 2HSAA 5LSMA 5FI8A 5LNWA 3M44A 3T7VA 1NSJA 3S1VA 3B05A 3ATYA 3PC0A 5K3VA 3DFSA 2C15A 1FX6A 2J9ZA 3TV8A 4JTFA 1TJRA 5GVJA 4IX0A 1H50A 2FPYA 4GRSA 3RNDA 2Y88A 4QQ3A 3UZ5A 4Z1DA 2QUTA 3TW6A 1CX9A 1XL9A 2E68A 1B57A 2DZPA 3LCHA 1VRDA 3PBVA 1OK6A 3GXTA 1K7XA 1W0MA 1IXOA 2Z0IA 2ZRWA 5F4WA 4AB4A 1DQXA 1TRIA 4MLRA 4UFIA 4WQ6A 3UPWA 5DY3A 5C55A 3MP4A 3ZR4A 4I7WA 4JXCA 3EWXA 3EX4A 5LHFA 4WOZA 5HUOA 4A21A 3O6DA 1KM0A 2CZEA 1MSSA 3BGJA 4N4PA 3TU9A 2YW3A 4Q33A 3W7HA 4O57A 1SO3A 2ZZ4A 3M5ZA 4IJBA 4XBKA 1R30A 3DH7A 5D2TA 3UXAA 3BG5A 3W3OA 2XN1A 3P74A 1P4CA 4RR4A 1OYBA 3H55A 3NQGA 3QW3A 4WXZA 3EWYA 3W74A 1VS1A 2QJHA 2WPBA 4H6KA 1FCUA 2QCCA 3UQNA 1QFEA 4JY8A 4AH7A 4AWSA 4AVFA 2F84A 4NNCA 4FIRA 4Z08A 4FXSA 3OA3A 3NQ7A 4LUIA 1R47A 2X1UA 1IF2A 2H8ZA 4UFMA 3FOKA 1W5PA 3NDOA 2VFEA 3GAYA 4XQ6A 3W7NA 3S8HA 3W7QA 5IM51 3TMLA 4UTIA 3U6WA 1DQWA 1LTDA 3LHZA 4O14A 3GXPA 3RFAA 1TCDA 3LHUA 5AHMA 1Z44A 2FIQA 2C19A 3BV4A 3SFKA 4KKXA 4K38A 3L5MA 3B0VC 1SZGA 1VJIA 3NQ8A 1GPWA 3CC1A 5F2IA 4O0KA 2DZUA 5C2XA 1SO6A 3GYEA 4UTUA 1WX0A 3EB2A 2CZ5A 5CPOA 3KRSA 4OGZA 4M6PA 1NVMA 1KLYA 2C13A 3G1SA 4LVDA 4NT0A 1X7FA 4CNOA 1GWJA 2E6DA 3TA6A 5KSWA 2R91A 4E2BA 1RPXA 2Y70A 7TIMA 3L66A 4UMCA 4NNAA 2P10A 3O07A 2ZBTA 3W7GA 1LLZA 3O6CA 2FTPA 3QZEA 5EMUA 3STFA 2ZRYA 3S1WA 3NVTA 4QSHA 2A0NA 3MBFA 4CQAA 4WY0A 1SZNA 5AOUA 1QPQA 1OFRA 1VYSX 3P61A 3G3DA 2QKFA 1F6PA 4EF9A 3W1QA 5FEXA 3G1DA 1P1XA 2PCQA 1OFDA 4NXKA 3EX6A 4ORMA 2X1TA 4IXHA 2Y7EA 3LCLA 4AWTA 1I4NA 4A22A 4EOUA 1OVDA 3CTLA 3NL3A 2QF7A 2JKAA 1O95A 3LXBA 1BWKA 3UWWA 2FJKA 4RK8A 1ZCOA 3PUDA 2CU0A 3EWUA 4ICNA 5L9FA 1FY6A 3W76A 3UWUA 2YZRA 2ZCGA 4JTKA 4WOQA 2H3DA 4UTKA 5CPNA 3KVLA 5F1UA 1L2UA 4WZHA 3M0ZA 4KFPA 1YDVA 4RKAA 1A50A 4FNPA 4NJIA 1R2TA 3PVFA 4UNKA 1TJPA 3YPIA 3IGUA 1IXNA 3B0UX 4BI7A 3B8DA 1W31A 1F73A 2CLLA 4DQWA 1H7RA 1NF7A 3IGXA 3M5YA 2AQWA 3I65A 1W5OA 1YTKA 2WJZA 1HG3A 4LW7A 1K02A 1CI1A 3QQ0A 1B9BA 3LHTA 3NR0A 1TMHA 3SI9A 1JCLA 2FB2A 1QNVA 4DO5A 1ZAIA 3CLMA 4QNEA 4UMAA 5AHFA 3M43A 3G1YA 1J4EA 2PRHA 2Z1BA 2V8ZA 1EA0A 4TMBA 2QDHA 1G67A 4GUIA 4JTEA 3B04A 4KWWA 4FO4A 1HTIA 1KBIA 1A5SA 1VYRA 2C3ZA 2C0AA 5KTLA 4I9AA 4O15A 3A21A 3WJXA 3C8FA 5FEZA 2J24A 1OJXA 5HWMA 2QCMA 4E2DA 2CLIA 3MMTA 2NUYA 3QMSA 3I6RA 2H8XA 1WYIA 4R7JA 1TPDA 4D2JA 3QSTA 3C3NA 1JVNA 3GDLA 4ZMGA 1KFBA 5AB3A 2V2HA 4OWGA 3RMJA 4A2SA 2JKPA 1DVJA 3CEUA 1QOPA 3M5VA 3FLUA 3HBLA 1EUNA 5T26A 1D3GA 2Y85A 4MZ8A 2OT0A 5EPDA 3DI1A 5LGZA 1QR7A 4Y8FA 3NPXA 1I8JA 4ONVA 1GVSA 3TE9A 3QF0A 1X1ZA 4LY8A 3WJZA 5CZTA 1BKSA 4YCOA 1F76A 3O06A 4HNUA 1RR2A 3VE7A 3GK0A 4MFEA 2BLEA 4FNUA 1Z41A 1QWGA 5KMYA 1A5AA 1I2PA 1K7FA 1VPXA 1KFCA 4OQVA 3W7OA 4A2RA 3GKAA 3DFTA 3W2KA 3LGEA 4CLMA 2ZRZA 5EL1A 4EF8A 3JS3A 4Y90A 1FWWA 1SQ7A 1H7PA 3M16A 2H3BA 1IGSA 2VFIA 3IVSA 3A5VA 3CWNA 3Q2DA 3A24A 4LTSA 2R94A 5ABTA 3BGGA 1VQTA 3PR2A 1R2SA 4UFKA 2C6QA 3EEGA 2J27A 3S5OA 1WQ5A 4EVZA 1I45A 1LBLA 3O1NA 3HGJA 3STCA 4O13A 4ORIA 3GB6A 2YX0A 2Y89A 3TAOA 2ZRUA 1GG1A 2W0UA 3BG9A 4IGHA 4IMFA 2Z6IA 1WBHA 3MBDA 2GVLA 1TIMA 4GUJA 1XBXA 3HG4A 2GQ9A 1KV5A 4AHPA 2QCNA 1SZFA 2HS6A 4NXSA 1SW3A 5AHIA 5D09A 3S1XA 3LHYA 8TIMA 4RCXA 3G1HA 3FKRA 1N55A 4N6FA 2NZLA 3PUOA 3LCGA 2E5CA 3IIPA 1LRQA 4UXDA 2VELA 2DZVA 4B5NA 2Y7DA 3MHGA 2DZSA 5FF2A 1DORA 2BWGA 5EKYA 1HFBA 3A22A 4PL2A 1FUYA 4O19A 4QISA 4JTLA 4FF7A 2J6XA 4YCPA 3HGRA 2TPSA 3MUXA 3GAKA 1TV5A 1UCWA 2J88A 4Z1BA 5BOOA 2QCDB 1PCWA 3DKJA 2QR6A 3NGJA 3CIWA 1IXPA 3I68A 5CKSA 2ZTKA 2V82A 1ZJIA 2Q3OA 1O60A 1OX4A 3KRZA 2WSQA 3TMQA 1YDOA 3VFLA 1LYXA 3LRMA 4FB7A 2YPIA 1B4KA 1XBZA 3P8IA 5AYYA 5CSSA 2A5HA 1KM1A 5G2WA 3N14A 1H62A 1JULA 1AL7A 4K6AA 1TPH1 1XI3A 1JCJA 3E9AA 4DF2A 4WD0A 1SO4A 4BK9A 3P5YA 5D2VA 2B4GA 2Y63A 1CW2A 3TW7A 3GR7A 1FCBA 1SPQA 3DKLA 5G4EA 1I2RA 3LM7A 3A9IA 3P81A 4JTTA 3LCWA 5HWJA 3ZWTA 3N19B 3BLIA 3R2GA 1TV7A 3W7PA 1H7NA 1K8YA 1VC4A 2WO5A 4LS2A 4Y6GA 1F05A 2Z2UA 3W1UA 4ADSA 5CZSA 1KM2A 1KFEA 4KWVA 5BMXA 2B0MA 1ME9A 1F7BA 3TSDA 2ZZ3A 4KFNA 5DBTA 1W3NA 1JCYA 1SSDA 1UJPA 5AFDA 3TAKA 4DXVA 3W2NA 3KXQA 3NQDA 1R2RA 4N6EA 4JX5A 5K2ZA 1TTJA 4IMCA 4OT7A 2X16A 3D0CA 3S5YA 1OK4A 1ZFJA 2WKJA 3FIGA 3I7QA 1TV8A 3QJAA 3G8EA 3EWZA 1S5WA 1VGAA 3PF3A 2XN2A 4OBTA 3LV5A 3G24A 3NL5A 3K30A 4IMGA 1AW2A 5F1VA 4MZ1A 4RZ4A 2BSLA 2CZFA 2OJPA 3UYCA 3QEZA 1JUEA 3TJXA 2AAMA 3W07A 4MVAA 3T78A 5LNSA 4IX2A 3VI2A 3BLEA 1XDMA 4JTIA 5D2YA 4POCA 2GQAA 4I7UA 2BX7A 2E5BA 1H7XA 4FX8A 1PE1A 2J9XA 4BWLC 1SR9A 4LV9A 4A29A 2D73A 2GUUA 3SIZA 6ALDA 2HS8A 1H7WA 4UIOA 4GBUA 3MO7A 3W1NA 4N02A 3W7RA 4BI5A 3E12A 4UTLA 4MZYA 1OFOA 3L0KA 3NQEA 4O1CA 5A5WA 2ZYFA 3W70A 5K9DA 2ZA3A 3STGA 3CEPA 4UTJA 5DCEA 4ADTA 2QDGA 3Q37A 4CCCA 1QMLA 3OVRA 2YW4A 4QAIA 1H5YA 2Z6JA 4DBEA 3DFQA 3C2RA 2HMCA 3L0GA 4K36A 1JCMP 4LRSA 3OHIA 3P67A 4O18A 4BI6A 3STEA 1I2QA 3W71A 4XKYA 1ZHAA 4IQLA 2ABBA 4DF0A 5D05A 5AYZA 2WV8A 1YPIA 2VXNA 3S42A 3HMJG 1H51A 2RDWA 2Y6ZA 1G4EA 2A7RA 1UBSA 1AL8A 1GT8A 1W5MA 1PVNA 5HR7A 3E96A 1G7UA 4N9EA 4DO6A 2ALDA 2CLFA 5FF0A 1WOAA 3O6YX 3LLDA 3P62A 4NZJA 1X6UA 1RVGA 3CIXA 3HOJA 1GTHA 3LTPA 1FCVA 4NX0A 5BNKA 2FLIA 5AHNA 3EWBX 3T55A 5EY5A 4MJMA 4HPXA 1SFLA 4FX7A 4JTGA 1RQEA 3NPWA 1M7PA 3EXTA 2ZZ1A 1OG0A 4HNNA 3WFAA 4TO8A 2F7FA 3G1VA 2NUWA
chains in the Genus database with same CATH superfamily
3JRKA 5J5RA 1B3OA 1ELSA 3A4WA 4AEEA 1RVKA 1P0BA 1W5QA 2WHJA 4Y9AA 3S83A 1MFVA 2FPTA 1OFEA 4W5UA 2YYTA 2A6NA 2GSEA 1UPPA 2DSKA 4R85A 1MQRA 2EKCA 2Y62A 1W8GA 4UFHA 2PZNA 3I7SA 1ZL1A 4GYFA 3H26A 5AZ1A 3RCMA 2J6VA 2ZA2A 1CXLA 1BYBA 2XFYA 2CLKA 4ATDA 3CK5A 3QHNA 4WR3A 2QUUA 3CB8A 4P8WA 5C71A 1V6YA 1LLWA 1T96A 3NGFA 4WJEA 3LM3A 3AYVA 2Z7KA 3RCYA 4YYFA 3C2EA 1SW7A 5EFDA 1CXFA 1GG0A 3SM0A 3U7VA 1QPOA 4B3KA 4DLMA 1AUSL 4GI4A 1JDEA 4Q8UA 3MY9A 4AF0A 3TEVA 3V0TA 3UR5A 2VUNA 4PUJA 2X7VA 4ECLA 2INZA 2YLLA 2CHRA 1P43A 3T8LA 3W7EA 3TQKA 3WH5A 1F3XA 3OODA 3M6YA 4ADUA 3R0UA 2VCCA 3EWWA 5D9PA 1XGZA 1GEHA 4CCEA 4W85A 3VKKA 1UJQA 1PYFA 4XZWA 1YNPA 4UTTC 2YA2A 3CUIA 2ZXAA 1BEUA 4YL2A 1LOQA 1IZJA 2F61A 2YDRA 5IFTA 2QCHA 3LN3A 5AC4A 4OV9A 1KRCC 3TW9A 3INPA 1JQVA 4OE7A 1BXCA 1MRAA 4QXIA 1T5AA 3RCNA 1T0OA 1CDGA 3SEPA 2OT1A 3VNMA 8CGTA 5JBFA 4DJDC 1XGEA 1W3TA 1G94A 3HTWA 1C8XA 3DXIA 3SJ3A 4EPDC 1QI4A 1WXYA 1E4LA 2WVUA 4PUMA 1YX1A 2YCLA 4K7YA 5MKGA 4N9CA 1NARA 4GIAA 2ZUVA 4ZZ9A 4A8IA 1EC9A 2V30A 3LX9A 2DVUA 1OY0A 3KOWA 3CASA 1HZYA 3ARTA 3IWPA 4IIBA 1UZ1A 4X22A 3VMOA 4H9ZA 3TIMA 3WD4A 4EWJA 3R7MA 1KRBC 1W9UA 1X39A 1BRLA 3S47A 3EA3A 5M17A 1Q6LA 3U4FA 1RD5A 1TX0A 1KQYA 4KGLA 1C92A 2ONEA 7A3HA 3EDJA 5HJYA 1JQXA 3CZGA 1JRBA 3CAQA 1DWFM 2V5LA 2MANA 3CQHA 4M7SA 1ZPTA 4MHBA 1PTGA 3NPUA 3KFTA 4LEFA 4GYPC 2TSYA 1VIWA 3LERA 2HNHA 1UD2A 2P3ZA 2HE5A 3GBDA 5I79A 5RUBA 5K7JA 3P84A 3NSNA 1A80A 3MV11 3FDGA 1H1NA 3C8NA 4XZLX 1UZ4A 4XIMA 3PFMA 2BFGA 4PUKA 1UUOA 2RDTA 6A3HA 4QRNA 1J12A 4S39A 1QK0A 1ICQA 4RE0A 2NT0A 3G1XA 2QDDA 4ZCWA 1XCWA 2R6OA 5REQA 4XO6A 4B2DA 4O4VA 3QMTA 3T4CA 2QCLA 4U31A 5E6YA 2KZHA 3M47A 1YDNA 3G6MA 4MLJA 1BGAA 3UY7A 3GTIA 3THQA 4D8AA 2HVNA 4QFUA 4HYVA 4R5EA 3TZFA 1CIUA 1GJPA 2YCIX 3ZFHA 1MVYA 1S3TC 4NJJA 4CEUC 5A6JA 1XH2A 3PTMA 4YU1A 1D3HA 3BAKA 3BLFA 3RAOA 1R3WA 1ISZA 3TDFA 3WNMA 2Z2AA 2VJXA 2D0GA 1H41A 2QJMA 1S2WA 4YN5A 2Q71A 4NQ1A 4A3UA 3AALA 4MJ4A 3R10A 1E3ZA 2J74A 3R4IA 1XLGA 3QR3A 1FCQA 4C6PA 1EEXA 1OFQA 3T08A 3URNA 5HXMA 3GSMA 1SVDA 4AY8A 1W9DM 1VCGA 1SR0A 3W1LA 4PRTA 1C90A 4M5PA 3GWQA 3SN4A 3LHWA 3SCWA 1MFUA 2FZ9A 2ACUA 3A4JA 3TKFA 4N0RA 3LENA 1XIHA 3COTA 3PPFA 1EEPA 2PEVA 3DFHA 4O1BA 4JEQA 1OGSA 4B2DD 2V38A 4JX4A 4HZ7A 4MY8A 1E0TA 3O9NA 3NZRA 5A8OA 4IP7A 3KLKA 3T81A 2VDHA 1G4TA 3TFXA 1LOLA 2OLAA 1R9XA 3IIOA 2P1FA 2PWDA 2NWRA 5AC8A 5CBBA 5C2CA 2CLEA 4FXRA 5HJLA 1IZKA 4MKVA 3RLUA 3KZPA 3SCSA 4LUTB 1RHCA 4AZCA 3EWCA 4ERIA 1TWSA 3RG6A 4O54A 4OV4A 2ZRXA 4YHGA 3C0JA 1FWTA 1UKSA 3IJ7A 4LOCA 3WKZA 2GLKA 3BJFA 3ICJA 3TYAA 1FWEC 1UR1A 4HMEA 2W9MA 2DH2A 4GC4A 4L6OA 4QS6A 5IDIA 4MWAE 3DHPA 4C6OA 3MI6A 1BXBA 3G0SA 3KHDA 3GDKA 3UF9A 4Q8OA 2KX9A 4LALA 2G3MA 2WQDA 5FJRA 1W5NA 1Z3NA 3W4RA 2GOKA 4EIVA 4AD1A 3ZWSA 4DAIA 3CL7A 4GJ1A 4IGSA 1FWSA 1ZJAA 2JGYA 3LPPA 1EC7A 5SWUA 3F4VA 2NXGA 5A8MA 1U1HA 3W1TA 2OTDA 2C1HA 4GH3A 4K3ZA 3DBPA 4N7QA 4AD2A 2YL6A 3WK3A 2YL9A 3UXDA 4KH2A 5KZEA 2CBUA 3QN3A 2DEPA 4OHQA 2EHHA 3ES8A 1US2A 4GMEA 4LH8A 4H9XA 4S3GA 1M41A 4MY1A 5CPTA 3BW4A 4GOAA 3W88A 5C8BB 1MEWA 2PP3A 3LZ3A 4DN1A 1LZOA 3LOTA 3A5FA 5HDRA 1C8QA 2BZNA 1KCXA 2CXEA 4F4RA 1XM3A 4L61A 3EB3A 4U3CA 2VFDA 2A7PA 1KM6A 1RQHA 1BHGA 3VIPA 3RLGA 2VCAA 5DEZA 1GOXA 3KBJA 3PS7A 3H4GA 3MP3A 3V5OA 1YBQA 5DBUA 4Y96A 1MDLA 3QGVA 1OX6A 1FQ0A 4ES4A 4UOQA 1BSIA 5CPMA 3DYOA 6TIMA 4LRTA 1CGXA 4QCEA 3RPMA 2GOUA 4J3ZA 4U3AA 2WVVB 3A13A 1M68A 3AYRA 3LRKA 3F2BA 1RBLA 4AX6A 4GI9A 1OFPA 1V0MA 4C5YA 4WJXA 1QNQA 5ECUA 4KEUA 3IGSA 1ZJHA 5HMDA 4JL2A 2I14A 4NSBA 2PWFA 2VDIA 1PKYA 3T2OA 6REQA 4OFCA 4QBXA 4QIUA 1DOSA 5CJNA 3E2SA 3KCJA 4S2CA 3TCEA 1DBTA 3BJTA 4GO8A 4K8HA 3NL6A 4IZGA 3DENA 1TCMA 1TMQA 3F5LA 1HP5A 1XBVA 4XISA 4IJCA 1B2YA 3GDBA 2VFFA 4UTWC 2YIHA 3LDVA 3MI2A 4CQ8A 1XBYA 2E09A 3EDKA 5DO8A 4AZIA 4DZ5A 3ENLA 1GOQA 3R89A 3AYTA 2OMAA 5D9OA 2PGEA 1XLBA 3NXFA 4XKYB 1L6YA 4W93A 3FA4A 1JF6A 3KHJA 2WMJA 2P0OA 3EDEA 1LJYA 3OLEA 1W3LA 4OOUA 2WMFA 4B3LA 5I3IA 3DECA 4L1WA 4V2XA 2D2GA 2VEPA 3HJZA 3BGAA 3S6DA 3WL1A 4HT3A 1TTQA 5F4SA 3IPWA 3C52A 4I6VA 2PDNA 2EPHA 3PSVA 4DO4A 3G22A 4C6QA 4E8CA 1ICSA 3FN9A 1FWDC 3PY2A 2JEPA 2YBVA 4DZAA 4YNGA 5F2GA 9RUBA 3ABQA 4KCWA 3WLKX 5BXTA 5M2FX 2AGKA 2OU4A 3W73A 1SUXA 3QLLA 4YTRA 4C7FA 3UD6A 1J0YA 5E70A 5HWNA 4HCLA 1GVOA 4KETA 3TYDA 1IYXA 5AVHA 4ACZA 2PURA 3MTWA 2OX1A 1U5HA 3FSUA 4XZIA 3GHTA 3I7RA 3SFWA 3R12A 2DZXA 1JDAA 2QMKA 1RV8A 4C6CA 3QW4B 4JNMA 5C5YA 1DWHM 2FFCA 3BW2A 4M19A 3OPSA 1H0GA 2NV2A 1X96A 1J79A 1CBGA 2PA6A 2V0TA 5I0DA 2PGRA 3BC9A 3E49A 1OINA 3HIJA 1F74A 5I2UA 1PUDA 4LQ1A 3BCFA 2O7SA 4WDTA 4Y9PA 1ONEA 3V18A 1P0EA 1SJAA 2Y7GA 2YFNA 3M1ZA 1W1TA 5CBJA 5AYBA 5E5CA 1P48A 3EX1A 3WQFA 2QQ6A 1YXCA 1EGMA 1KCLA 2IS7A 5A94A 4LS1A 2W67A 3I3BA 3BVJA 3QRHA 4PTNA 4Q8VA 2B81A 4MYXA 4OKDA 1W1VA 3B0XA 1TE1A 4JIEA 3SN0A 1CEOA 4GYKA 4TUFA 4ENLA 3NG3A 3AS1A 3ITGA 1VBUA 3F4NA 1YE6A 4Q3MA 4CD8A 4JDYA 1QK2A 1XYLA 3UY8A 1OADA 3FY1A 3AWOA 4HNLA 3AU2A 1L8NA 3PG9A 1KM4A 5CG7A 4Q4QA 4H6QA 3AO0A 5A6KA 3DHFA 3OQEA 1I1WA 5D03A 3I6TA 1TPEA 1KFLA 4DEFA 2QCDA 4GNVA 2PS2A 4C1KA 3SZ8A 1J93A 5D02A 2P3EA 3ME3A 2ESCA 1CLVA 2QCFA 2D23A 4LS0A 2ZKMX 4J27A 3QY6A 1B5TA 2CLMA 4EP8C 1XIGA 3W72A 4XTDA 1JI2A 2FVMA 4ZQPA 1HO4A 4GCAA 1W2PA 2GGHA 4ZENA 5C9XA 2W63A 4O1EA 2OXNA 4E5TA 4EE9A 5H91A 1RK6A 3B3DA 4WY0F 4W8AA 4AAJA 4L4OA 4HK6A 3NYZA 1QI0A 3R8GA 4MTVA 5E9AA 3SCRA 3WSUA 2ADAA 2VMFA 4F2BA 1KM5A 1W3IA 2ABAA 5IXEA 3CU2A 3FVMA 2PRMA 1NFBA 2QCGA 3KBSA 4OVXA 5GNXA 3LLFA 1DYSA 3TYZA 3VDAA 2NQ5A 4B90A 3H7UA 1OGBA 2B7PA 3KVJA 2TRSA 6ENLA 1NP2A 4MWAA 1KLZA 2J9YA 3URAA 1DL3A 4X3ZA 3N15A 3PTDA 4DAFA 1TVNA 1W2VA 2WCAA 3T2PA 3S5SA 5I09A 3OBKA 5HATA 1B3VA 3GTXA 3S3GA 4NZCA 3H12A 1MW0A 3TNOA 3BQ5A 3W7LA 4A05A 3MCNA 3SR7A 3CMFA 4O8AA 2OQLA 4H9TA 4RUBA 1GQKA 1J18A 3QR0A 1VD6A 1PS9A 1GVEA 3QFEA 2ICSA 3P0XA 4C6IA 2PWGA 2WWDA 3VX1A 4KMQA 5CSRA 3SECA 1UYQA 4X2PA 1LUCB 3MMDA 2ZWZA 4ZFCA 1PEZA 4D6DA 3MHUA 2B7QA 3F4WA 1XW8A 4GHRA 4LNYA 3A23A 1MEIA 2PU0A 4PMVA 4UC5A 2E5DA 4FR6A 2YZ5A 4CU6A 5A8PA 1RAKA 3EKLA 4PMXA 3BAJA 2G95A 1NWSA 3POCA 3W2UA 1EP3A 3OGRA 1UWAA 5I5RA 2FYMA 2OR2A 4B92A 3CLWA 5KEZA 2J79A 4PZVA 2VZUA 5C2GA 3VUPA 2BODX 4PC8A 1LWIA 1V0KA 1GJUA 1N8FA 4RDYA 4WSHA 1NDVA 2CBIA 2JF6A 3S2MA 2QYGA 4WK9A 4O12A 3S9IA 3FVDA 4U2ZA 2VC5A 3DGBA 4UTMA 3IJIA 1U5JA 4LVGA 3C56A 1UUQA 4B5UA 1XLAA 4B91A 2QV4A 1KA9F 2GJNA 3OZPA 3OP2A 1W1A1 1Y65A 1AQHA 3E2QA 3AIQA 4I8DA 3TONA 2WSKA 4OUIA 2PMQA 1EOKA 1MW2A 1AH4A 3PB2A 4WRHA 4XZ9A 4HKPA 1PAMA 5DQPA 2V9DA 2BVTA 4IPJA 2GVJA 3M44A 4JTRA 2IUZA 1NSJA 4RE4A 2DT2A 4LF1A 2EXOA 5K3VA 3DFSA 5CQ1A 4IX0A 2VURA 5FAGA 1GHSA 5LIKX 4Z1DA 2QUTA 4W84A 3TW6A 1CX9A 1W9XA 5XINA 3LPFA 2IKHA 1I6NA 2V3GA 4PMOA 3ZLFA 1K7XA 2Z00A 4B4HA 4CEXC 1DQXA 1EGVA 1VFSA 5DY3A 5C55A 2ZE3A 2CXGA 3EX4A 1A5MC 4A21A 2CZEA 4E2OA 3L4XA 3V5FA 1Q2RA 4O57A 1BSLA 1SO3A 2VVNA 2ZZ4A 3APYA 3M5ZA 9XIAA 4M82A 3DG7A 3ITYA 1R30A 3DH7A 4NAEB 5G4HC 3BG5A 4UNIA 1E6NA 3S4TA 1DJIA 3NQGA 4WXZA 3GC5A 1VBGA 4C60A 2WMHA 1TR9A 4K2SA 1FCUA 3G77A 5GJMA 1CTNA 5CGTA 4GQRA 4AW7A 3UQNA 5ABFA 4BCEA 5AZ0A 5BWFA 5CLWA 4DBUA 2X1UA 3ZVIA 4TTUA 1OEPA 4W87A 4CU8A 4UTIA 1DQWA 2FTWA 3EKGA 5CLTA 4KESA 3T0CA 4M1RA 1KCKA 4PSRA 2CC0A 3BV4A 4LANA 1GHRA 1UOKA 3FNDA 3T0TA 3KOZA 2XVLA 1EJXC 3E5PA 3NQ8A 3PBGA 5F2IA 3AICA 1SO6A 3GYEA 3BZGA 3B9DA 3VINA 4P7RA 4ZXLA 5CPOA 3VM7A 1NY1A 2XISA 3DG3A 1FWFC 4HD5A 1X7FA 1GWJA 2J7DA 2R91A 3VIIA 2YCKX 3WH8A 5EMMA 1PX8A 4W7VA 4DZHA 3L66A 3LUTA 3RILA 2ZX6A 3GHUA 1XRFA 4TTGA 3I4KA 4HCHA 2ZRYA 3S1WA 4QSHA 2A0NA 2YKKA 3O7UA 4QSFA 2QXWA 4UTFA 3Q65A 2BDQA 1F61A 4K1GA 2DUZA 2V5JA 2QKFA 2ISFA 3W1QA 1RSCA 2RGMA 1BXNA 1FH7A 4IG2A 2X1TA 2W92A 2Y7EA 4KRUA 1RP9A 4ZB5A 1OVDA 1RH9A 2QF7A 1WCGA 2E9BA 3WF0A 4E8DA 1BWKA 2IXUA 4MSSA 1TJ2A 1UR3M 2D69A 1CB2A 3SCQA 2NSXA 1XG3A 1BPLB 5GJPA 3WF4A 1EF3A 2HBVA 3FHAA 2XVGA 1L2UA 1IEWA 2BGQA 5I78A 3S6OA 1YDVA 4I3GA 4FNPA 2DW7A 4HA0A 4OOZA 4AD0A 3M07A 3B8DA 4BQ5A 1AH3A 1NWUA 1F73A 1WUFA 1H2JA 3VXGA 4FF5A 3M5YA 5HNUA 1W5OA 1QOXA 5FJOA 1HG3A 3GNXA 5M03A 1B9BA 1J9YA 3AMGA 3LHTA 3SI9A 4AFYA 2WB5A 1QNVA 4JNZA 1ZAIA 4QNEA 5AHFA 3M43A 3UFYA 1PPIA 1J4EA 4XX6A 3NDYA 3POHA 1XIMA 4GO9A 4UOJA 3LYEA 2XGIA 4JCLA 2V8ZA 4GG9A 4RNFA 2VR5A 3A9BA 3B04A 1EBHA 4JHOA 2WHLA 3DOPA 4PMZA 3LG3A 2YBUA 2C3ZA 1FWCC 5KTLA 1VF8A 4O15A 4JQ2A 1RJRA 3AZTA 2E9LA 2J24A 4E2DA 2CLIA 4NYYA 3QMSA 2PTXA 1E6SM 3GDLA 4G1NA 1KFBA 3CIVA 4PMUA 4DYKA 2V2HA 2XWEA 1HJQA 1ZUAX 4OWGA 3RMJA 2JKPA 3CEUA 1WKEA 1DXEA 3WUEA 3FLUA 4H9YA 3N6HA 4JIHA 1NOWA 1NQ6A 5T26A 3KOYA 3C0LA 1D3GA 3V7PA 7CGTA 2OFJA 1B9ZA 4S3AA 4Y8FA 3PPHA 2V63A 1WDQA 3LQGA 4B15A 4NL1A 1X1ZA 4LY8A 1L6GA 1UD8A 3SCNA 1BKSA 3O06A 4RDZA 2QDEA 4L1GA 2VWSA 4MFEA 3CV1A 4MMWA 1HX0A 2CEQA 1PIGA 1QWGA 2VM8A 1I2PA 3PJTA 3W7OA 3WD1A 2ZDSA 4NI3A 3VU2A 1YNQA 2PSNA 4EF8A 4Y90A 2QVHA 2EG6A 1XLJA 1HKMA 4I5XA 4TQTA 2RAGA 5FD0A 1GVIA 3CWNA 4REQA 3WNOA 3B8WA 1VQTA 3PR2A 4G56A 4W86A 4CUCA 3EEGA 4JTDA 1PDYA 2J66A 1AD1A 1CB7B 1ZB5A 1BAGA 1I45A 3O1NA 1E0WA 3STCA 3MVTA 1K9FA 1GG1A 2W0UA 4IGHA 3VDGA 1CGYA 3AHTA 2GVLA 3CQJA 3BZJA 4F0MA 2GK1B 4DJEA 4MDPA 2Y5JA 3HG4A 2EJ1A 1KV5A 1QWKA 2GWNA 3K1GA 2QCNA 2HS6A 4AZBA 3MDWA 3APGA 3LHYA 1L8PA 4NASA 3G1HA 3KCLA 3U2ZA 4XAGA 5BCAA 4YTTA 1HKJA 4A8LA 3IIPA 1LRQA 4GINA 2VELA 3IJ6A 3CUJA 4UXDA 4Q4RA 2PI6A 1OC7A 1EJUC 3A22A 1RK5A 1KFWA 4I8YA 4O19A 4QISA 1C91A 4JTLA 4IPNB 4YCPA 1UCWA 2WAGA 4GLEA 4HU0A 1V77A 4WGHA 3KRZA 2WKLA 1YDOA 1UKOA 4WKFA 4FB7A 4P8UA 1K8CA 3VVGA 1XBZA 2EBNA 3P8IA 5CSSA 5I6SA 3UPMA 4BJHA 3UW6A 1H62A 1DJYA 4D6FA 3E9AA 2OYMA 1UC4A 1SO4A 3P5YA 3T42A 2Z1WA 3A6OA 1CW2A 1EC8A 3GR7A 3TN3A 3IUDA 2FFIA 3OYZA 3LCWA 2E9MA 3GXMA 2GGEA 3E2RA 1KWGA 3S2LA 3H21A 3BLIA 4Z2LA 1NDYA 2WO5A 2Z2UA 1QHOA 1Q7MA 2PDQA 4YVXA 1DJWA 2D20A 2PODA 5BMXA 1DQUA 3EMQA 1FP9A 3TSDA 1AODA 2VC9A 2CWXA 1EXBA 2XH4A 4X0VA 1W3NA 1JCYA 1UJPA 1HF6A 3NQDA 3UJFA 5G1MA 5PTDA 1W9BM 1J5SA 5H6HA 3UVAA 1CT5A 4WIWA 3WF2A 4OT7A 2X16A 4JHZA 3S5YA 4PTMA 1I1XA 1BLIA 1CXKA 3VYLA 2W61A 1TV8A 4GISA 3QJAA 3G8EA 2F9RA 4NZ5A 1CENA 1S5WA 4X63A 2XN2A 1BVWA 4OBTA 3VGEA 3G24A 2QVNA 5CAKA 3NL5A 3HQOA 2J7FA 2QZRA 2CZFA 3S9ZA 4H6EA 4S38A 2REQA 3UYCA 4JN8A 1P6BA 2D24A 3W07A 3VIMA 5LNSA 3BLEA 3H8AA 4JTIA 1DJZA 1VFLA 4POCA 2OSWA 3NEHA 3USZA 2BX7A 1E1CB 2E5BA 3WQEA 4A29A 3SUSA 5BWAA 6ALDA 1CECA 4XV0A 1H7WA 3M0JA 5B7ZA 3MO7A 4H00A 3SRKA 1KNWA 3W7RA 5A2CA 2YB4A 4ZOBA 1AQMA 3L4WA 4MZYA 4O1CA 2ZA3A 4XG1A 3TLLA 3MANA 2PDMA 3CEPA 4PB3A 3TP4A 4DY1A 3IJDA 3AIRA 3L2MA 1TV2A 4MNLA 1QMLA 3RJYA 1V51A 4QAIA 1XJBA 4DBEA 1Z9AA 2HMCA 5HANA 2D2HA 1F3EA 2PDYA 3KUMA 3OHIA 3P67A 4BI6A 3AHYA 4PTDA 1NU5A 1J11A 1ZHAA 2VZVA 3VZYA 5M5DA 5AYZA 4HCDA 2VXNA 2XSBA 3EMZA 3KM8A 1G7UA 2ALDA 2CLFA 3OW1A 1LLOA 1WOAA 2I5QA 3VIGA 4L5ZA 2DSWA 1FCVA 4NX0A 1RBOB 5AHNA 3EWBX 4MJMA 2EPNA 3NPWA 3EXTA 1W3JA 1VFUA 4TO8A 1PO9A 3G1VA 5DMNA 3C5QA 2WLYA 3KX6A 3LBMA 5EYWA 4AC7C 1H1YA 3FDKA 3II1A 1PCKA 2J7CA 2VEIA 4GIEA 1AZ2A 4M24A 2EJAA 2PBOA 1UKTA 5A6SA 3CQIA 3PTQA 4GY0A 5LNVA 1JZ7A 4YTQA 4E4UA 1M53A 3AS2A 2OWCA 2MNRA 4O50A 3UPBA 2WSPA 4AY7A 1ME8A 1IT0A 2I1OA 4PODA 2G97A 1ZY9A 2WHKA 1E9YB 5ABHA 5AHLA 4FEZA 3CPRA 1DTUA 2QPUA 1K9TA 4P7OA 2D0FA 5D33A 3G5EA 2TMDA 5HQEA 4F48A 3EBVA 5I3GA 4J3SA 3IJLA 4JX6A 4C90A 2NUXA 3LSBA 1O7AA 1XUUA 3C0QA 1BWVA 2ZX5A 2BP1A 3GU9A 1QUMA 3N2BA 7REQB 1XKYA 5DFAA 1S5MA 3QY8A 5DT5A 3WFZA 4UCFA 3UWEA 4HBKA 1DV7A 1NELA 2XVKA 4Q4SA 5LNUA 4HN8A 4LGXA 4JICA 1M5WA 3R79A 1ADOA 3EA2A 1LWHA 5HR6A 4IHCA 1QOQA 2DIJA 3KAOA 4IFKB 1DHPA 1Z48A 3G6LA 2GJLA 4M0XA 3KS6A 1EPXA 4NAFB 3GFXA 3IRDA 2WBGA 4LUJA 3EXSA 4HTYA 2J8FA 2YXOA 4ACYA 3NZPA 4MY9A 4PE8A 3ZR6A 3L12A 1VH7A 3H4WA 3F2CA 3B06A 3ARXA 2YL5A 3MMUA 2W6RA 3PB0A 4H9VA 1EWDA 2GGGA 3L2IA 3ABOA 4O4WA 3RIKA 5C70A 3WLMA 3HPSA 4S2BA 3WZ0E 4US5A 1U1JA 4F2TA 2FGLA 4LUSB 3SGZA 4XTIA 3CH9A 3M4HA 2XVNA 2AL1A 4M6VA 4QG6A 3UR2A 3GG1A 4DBSA 1IEXA 3PZOA 3GVWA 3NA8A 4R33A 3LV6A 2CWNA 1UA3A 1EL3A 3TFCA 1VFOA 5FF7A 4ZEPA 1Q3NA 3TH6A 4X2RA 2DZBA 2E8YA 1W1B1 3BAIA 3ZQ9A 4LJ3A 1S2CA 4AXNA 3DC8A 1NEYA 1IEIA 4HHPA 1FHDA 3WLPA 4W9TA 2JEQA 1UD4A 4AHQA 1ZCCA 3WLOA 3QHMA 4BR1A 2UV8G 4C6EA 1N8WA 2OG9A 1M04A 1EJWC 4XD4A 3HPZA 2AOSA 3W38A 1UP3A 3CO4A 3C6CA 3CM4A 1VHCA 4MAZA 3R58A 4V15A 3NPVA 4HU3A 4W5ZA 4MKNA 4O0ZA 4JAWA 1E51A 1SFTA 1O1ZA 2PC8A 3LTSA 4JFWA 3N9SA 3AROA 5I02A 2VRJA 3MVIA 5ABEA 1W1IE 1UWRA 1OT2A 1WV2A 1POKA 1XG4A 1AJ0A 4D9PA 3W87A 2FDSA 1UR4A 1A5NC 4JEJA 2W91A 4J3UA 3V16A 2VENA 2ZZ7A 3NQ6A 3RM8A 1UB3A 4HIBA 2BS9A 3BL3A 3ITOA 4GFSA 1XQKA 1VHNA 1C8VA 2Y61A 3Q67A 1JZ8A 3U2EA 3QYQA 4HSOA 4C1NB 4TVDA 3PZTA 4NHVA 4NP7A 1YADA 2Q8ZA 5CEWA 2ZUWA 3JZUA 2WZEA 1M6JA 3OU8A 4Z1AA 2SFPA 4QG9A 3L4UA 2Z26A 2QCEA 3BLKA 1XIJA 3QZAA 1JZ4A 3C61A 4FP1A 4V33A 4GXMA 3TJIA 2NVAA 2Y8VA 2PP1A 4NF7A 3GRIA 1Y0EA 4MJZA 1YDYA 4K37A 4MB3A 1LRTA 2ZXDA 3GZAA 1X38A 3N4EA 4IXXA 2BY1A 4LAMA 2DORA 2QJIA 1R46A 2BTMA 1G1YA 3RPTA 4O10A 3RK8A 1O6IA 1T7LA 5DCDA 3AU6A 3FXGA 1FXQA 3GFYA 3NM1A 1S5NA 1EH9A 4JTSA 2GJRA 1EZ2A 1ICPA 3SADA 2OQHA 5I77A 4QJ1A 4KWSA 4GNKB 2EPMX 2XH0A 3RPDA 3CUZA 3ZM8A 1KBJA 2V5BA 1X7IA 3GR4A 5J5DA 3QM3A 3DGRA 2Y1HA 1Y5XA 4EPBC 3ABSA 1KXTA 1ZS2A 3DDMA 4PH6A 1EJTC 3M0KA 2QHAA 3CYJA 4TU1A 1XYCA 4DELA 4ZA0A 5IDZA 2E67A 4JBRA 3H53A 4L4MA 4E38A 4YWSA 5U4NA 2FZ8A 3LK6A 4J40A 3WK0A 1LP6A 4PMJA 4ZOAA 1T40A 3W7KA 1Y5VA 3NEVA 3PZIA 3KTSA 4N2YA 1BVNP 5KITA 1TWIA 5E93A 4IJRA 2O7QA 5JH2A 1EO7A 2J7EA 3SRDA 3HF3A 1EJVC 1LT7A 1XIIA 4C1LA 3OZOA 3THDA 3WMLA 3WNPA 3B0YA 1WUEA 3M0LA 3SAZA 3MUZ1 3KDOA 4EPKA 4L6DA 4JD4A 2VYOA 3HPAA 3HG3A 2VQTA 1E9ZB 1MXSA 2QJGA 1FDJA 1JGMA 5DXYA 3K4AA 1PKNA 3TXZA 3WD0A 4L4PA 5I03A 3QFWA 2YDSA 1WDDA 1OX4B 4QTGA 1R87A 4U5KA 5KZMA 5E0FA 2NV1A 3N3MA 4O53A 3F4DA 4KT2A 1IEQA 3FJNA 1EP1A 3HV9A 4LYQA 1QCWA 2EG8A 4YLWA 1W56A 3AUJA 1OG6A 1PX4A 3GDTA 4Y9MA 1BWLA 4TV5A 1BQCA 3CXOA 3ARWA 3EOLA 5CZJA 1TQXA 1FWNA 2VFGA 2C7FA 4ROPA 4AWUA 1V3LA 1OC5A 1MNSA 1EB3A 2ZQ0A 1RP8A 1GYNA 3VCNA 1AQ0A 5D8WA 1ZAHA 1WKDA 2Z1KA 6XIMA 3OOQA 1YPFA 4FX6M 3VGGA 4YTUA 1TZ9A 3EKZA 2VO5A 4J28A 4IFOA 2XZ9A 3C4UA 2XFWA 4GUGA 1QPNA 2XIIA 4MB1A 1Z69A 3GH4A 3PTKA 3VNYA 1BTMA 1EF2A 2VKZG 4GQGA 1TPWA 5EU9A 3WUGA 1FWRA 1KB3A 1UW9A 2BXYA 2WVSA 4AG0A 1YYAA 4BQ3A 4L1XA 2PDJA 3AS3A 3N34A 3G0UA 1R85A 1R7OA 4QE4A 2O9PA 2AQVA 1OFAA 2I5GA 4GZIA 4XD6A 2ZE0A 2A3AA 4TIMA 3I10A 5M3WA 1V93A 4UMBA 5JVLA 1UHVA 3W6MA 4G6CA 2DT1A 3RU8X 2PRLA 3GDRA 1GYLA 3ISIX 4G1KA 2I7GA 4UFJA 3G3MA 3QH2A 2HE8A 2VGGA 2I9EA 1CWYA 1JZ3A 3I3EA 4QM1A 2NWSA 2X30A 2GFTA 3ZYZA 1UQYA 2NXHA 2XFFA 5A8QA 3KOXA 3MC5A 1XFBA 1V02E 1YXDA 4GGBA 3FJ6A 3VDBA 3URBA 4EPEC 3WLTA 1K8ZA 4H4IA 3NO5A 4E2VA 1MDRA 2ISDA 5DY2A 3L65A 3L4TA 5H1WA 4A8NA 5EA9A 5FJIA 3W00A 1IWBA 4U4MA 5B80A 4B5TA 3VIFA 2DSVA 3W9ZA 4LWWA 5DF0A 3OB8A 1UD5A 4JPGA 4MYAA 1IT8A 1G69A 3UR7A 4UFLA 1J2WA 5A1AA 4R53A 4DWSB 1NM9A 4OBRA 2VEFA 2Q3RA 2E6YA 1Z42A 4S1FA 3NQVA 1JPIA 3N1AA 2EO7A 2ATMA 2I9UA 1TV3A 3TYBA 4XWUA 2Q8LA 2D3LA 1XXXA 1TO3A 2W27A 3TR9A 4WSJA 4MWAC 3P2VA 3WNLA 4UCGA 3SSJA 1BQGA 5LHEA 4ML9A 4ZXOA 4AXKA 3ZVHB 1A5UA 4ZB0A 1S2TA 3UNTA 1FWIC 3GX9A 2DUAA 2DZAA 2Z1XA 4PRRA 5A2BA 3PZMA 2HWGA 3CWOX 3HO8A 2A3BA 5LKYA 1K4GA 2CW6A 3ZZ1A 3PZVA 3RRXA 5DCBA 1B3ZA 1GOIA 4NI8A 1QW7A 3QPEA 3UJRA 2G4JA 1VEOA 2R1LA 1HW6A 2HISA 3OIHA 1J10A 3RHGA 1PB0A 3IK4A 3N9RA 4E3VA 3RO8A 1E0VA 4LAUA 1IV8A 1QI5A 1XD0A 1MW1A 4GABA 2CLOA 1KTCA 2VRKA 1VCFA 3I3DA 1YHTA 4RXFA 1ONRA 2Z29A 4NYUA 4KEZA 2HTMA 4DM2A 5L6UA 4O17A 5FCZA 1YMYA 3SY5A 5BOFA 3U48A 2QJNA 4RX0A 2HK1A 4DJFD 1TPFA 3OG3A 4ZGYA 2LLEA 1S1RA 2YFOA 3UG4A 3B8VA 3GU1A 1LQAA 1VRXA 1OC6A 3DFPA 1EHNA 1AW1A 1K3UA 2C18A 2EGZA 3BMVA 3IRSA 2FMNA 4DI9A 3NL2A 4H8NA 2V81A 3KVKA 4W89A 1Q4WA 3H54A 3PG8A 1BF6A 2Z24A 1JJKA 4GFIA 1XQLA 4GVFA 1CGUA 1XP3A 2VI0A 1SZEA 3W75A 2DJLA 4HOWA 1AH0A 3ARRA 2GSHA 3HJEA 1QI2A 4J1OA 2IXVA 3W0KA 1UWIA 4ZVJA 3NIYA 4DZIA 4HJWA 1XYZA 4BF7A 1F4AA 3LGGA 2QF8A 3LTYA 2WK2A 3NZGA 4CN1A 2Q02A 4XD3A 3WQOA 1J0IA 3PWAA 1N2VA 4HMDA 4U2YA 5GPRA 3SGUA 4US6A 5IBXA 1LCOA 1DXFA 4ZSUA 3TOPA 2BVYA 3ZLHA 4L80A 5DMMA 3CUGA 4UR7A 1TREA 4LF2A 1JXKA 2EG7A 1TPVA 2W62A 1GZ1A 1R5YA 4JY9A 3WBXA 1DIKA 4W4QA 2HXUA 3NTYA 1O5KA 1J0JA 4QLLA 3EDDA 2WMIA 2QUMA 5HULA 3VD4A 4BEUA 1IXQA 1S5TA 4AVNA 2P8CA 2R14A 5GQBA 2YXXA 3UA3A 3VCRA 1O4UA 8RUCA 3TR2A 3GR8A 1JXJA 3W84A 4NJKA 3TSBA 3P60A 2DQXA 1AJ2A 3O0KA 3FA3A 4AC1X 2C91A 3WLSA 1FKWA 4NZFA 4MFDA 4CNUA 2WMGA 1O5RA 3ABRA 3PANA 1M7OA 5CGMA 3GW0A 3VNJA 1OFBA 4GIYA 5KETA 3DAQA 5CZ0A 3CWHA 4MPKA 2VFHA 4KQNA 1RCQA 1GNXA 1GVQA 2F2KA 2EQDA 3E38A 4UQDA 4BFAA 2FPVA 4D6JA 2OEKA 4G8TA 1Y7VA 4NJGA 4QJ3B 3HPFA 2VEKA 3G18A 4PULA 4JYEA 2VGBA 4ZOCA 2V2CA 3NZ1A 4DLFA 4IMEA 4W7WA 3CGTA 4JNYA 3S2NA 4GXPA 3N4AA 3MPGA 4IUOA 3A4AA 4CQ9A 1XR2A 1I75A 3VD9A 2Q8XA 4E3TA 3FJLA 3PBYA 2YXGA 3GIPA 1GJWA 2NLIA 5C6MA 5CPSA 2QV5A 3F03K 5G1TA 3K13A 3MWAA 3VNKA 2JK2A 3L5LA 5U7SA 1H0IA 5FL0A 3NQMA 3WQWA 1V6VA 2WZHA 4EWND 4TX9A 2J77A 2X1RA 4CCDA 1FFQA 4NRRA 1NIUA 4MF4A 3CHEA 4QG8A 3E5BA 1UUMA 3KRUA 1DKWA 3L5AA 1A4MA 1O12A 2JIEA 5FF4A 1A0DA 3VKCA 1P6WA 4LPCA 3L0NA 2WANA 3LCXA 3HGSA 4ZO9A 4D6HA 1KGXA 3V1HA 2AKZA 4WX2A 2BHZA 3SGGA 2G0WA 3N2MA 3H2NA 1LQ0A 2V6AA 5I24A 1OWQA 1V3MA 4AIEA 5FI8A 5LNWA 4L9YA 1L0PA 2L5HA 4GJIA 3MZ2A 2J7HA 1FX6A 2J9ZA 3L4YA 1JIBA 2BV9A 2FPYA 3BDKA 1B57A 3MMWA 1IZCA 3PBVA 2JF7A 2G8ZA 3KL3A 3GXTA 2FGBA 1IXOA 2AL2B 2Z0IA 4MLRA 4UFIA 4I6KA 1IR1A 4H7CA 4FA3A 2PGWA 3ZR4A 2DIEA 4IIHA 1XD1A 3T0DA 3E74A 1E56A 2W66A 4Q7NA 3WQPA 1F8IA 3SQLA 1EDTA 1MSSA 4RNIA 1VBJA 3W7HA 2Y8KA 2CHNA 1UH4A 5HJXA 1GQJA 3BSGA 3UXAA 2H9AB 2ZIDA 3NSXA 3W3OA 1W17A 3P74A 4AD3A 1OYBA 2GJXB 3H55A 1Q85A 5C9RA 3EWYA 3W74A 2QJHA 2WPBA 4H6KA 4EAYA 4G9PA 1Y8BA 2ZADA 4A3RA 2G3JA 4JY8A 3VD7A 1W1YA 2R1MA 2X41A 4AWSA 4QLJA 1CNVA 4NNCA 3C3UA 4LUIA 1DWIM 2H8ZA 4UFMA 1W5PA 3AIWA 2VFEA 2I56A 4XQ6A 3S8HA 2Z2BA 3AYSA 4X0NA 3LHZA 4NZ1A 3EAUA 2F6KA 3RFAA 1TCDA 2HQAA 5AHMA 2FIQA 1VFTA 4K38A 1JNDA 4XUYA 4FK9A 1JD9A 1SZGA 1QATA 3DERA 2YCJA 4O0KA 3EB2A 2CZ5A 1JNEA 1ISVA 1NVMA 1KLYA 2C13A 2VNCA 3SB0A 3URQA 3AI0A 4HYWA 7TIMA 3T07A 4HA4A 2P10A 2WCSA 1OZQA 2BB0A 3O6CA 4ICCX 3STFA 2FH6A 1V3JA 5BU9A 4JFUA 1GOWA 1TFVA 4UQEA 3ZOAA 8XIMA 1QPQA 1OFRA 1VYSX 3P61A 4EF9A 3LA4A 2WW5A 3H2FA 4PMDA 4DJEC 4XO7A 1OFDA 2IPWA 2QULA 1WDSA 3LCLA 2YL8A 4GIRA 1GQIA 1R7AA 3SCUA 3G1RA 4LYRA 3I6EA 4EXAA 4EOUA 5HNTA 3NL3A 3GTHA 3GM8A 4Q8NA 1O95A 3LXBA 1JDDA 3QV6A 3UWWA 4RK8A 5E0CA 2WYSA 2ZCGA 2OQYA 4XSMA 1NTHA 3AHZA 3QTPA 3UXKA 3AAMA 4UTKA 4DHGA 3BOXA 4FOKA 3AMDA 5F1UA 1F9CA 3M0ZA 4KFPA 3WG6A 3DCPA 4NJIA 5D4YA 1DP0A 4J4KA 2INEA 1W31A 4LCQA 3T1GA 3SIMA 3CUXA 5C9ZA 3GIQA 4M51A 3IGXA 4JQ1A 4KEMA 2AQWA 2WWCA 3I65A 1YTKA 3M6DA 2WJZA 5FSDC 1K02A 1CI1A 3QQ0A 2GUBA 4KPLA 4DO5A 4UMAA 4HU4A 2Z1BA 3N3TA 1UROA 1XYBA 1A5LC 4LAZA 3CL6A 4ERAA 1G67A 2WC7A 3QOKA 3ZT5A 1FFRA 1HTIA 3NO1A 1VYRA 1XLLA 3VGDA 5I07A 3A21A 5BU6A 3C8FA 5FEZA 3BWWA 3LPGA 2IPFA 2I57A 4INFA 2NUYA 3STPA 2J47A 3H2MA 1CLKA 3HM7A 4V27A 2CYGA 3C3NA 1OBAA 2E4TA 1TKKA 1B1YA 1V79A 2PDLA 1QOPA 3M5VA 3HBLA 3WH6A 4W88A 4BA0A 2Y85A 5EPDA 5CBIA 1B90A 4B5SA 5C9WA 1QR7A 2CKSA 5BXRA 2C79A 1GVSA 1XLCA 5LIXX 3MUY1 4PB5A 3QF0A 4HTBA 3WJZA 4JIRA 1DEDA 2QIWA 4RE3A 4HNUA 1B3YA 1J0ZA 4S3FA 3WEOA 1RR2A 3VE7A 3GK0A 2BLEA 4WDUA 2GJPA 5ENLA 2BOFX 1A5AA 1LF1A 1GKQA 1K7FA 1VPXA 4F9DA 1KFCA 4A2RA 3DFTA 4CLMA 1FWWA 1MWOA 1H7PA 1GOKA 3M16A 4U5IA 2H3BA 2QNEA 2PDHA 3D3AA 3IVSA 3A5VA 3Q2DA 5LA1A 2R94A 3BGGA 4M29A 1R2SA 4UFKA 1OSEA 3LMZA 3PWGA 4MGGA 2C6QA 1W1PA 3BAWA 3WD2A 5ECVA 5LIYX 1LBLA 1PX3A 3HGJA 4ORIA 2YX0A 2Y89A 3TAOA 1YQ2A 4IMFA 3BANA 3D47A 4D6IA 4LUTA 1XYMA 1W32A 3MUIA 1TUFA 1RD6A 2ZC8A 2GQ9A 2BHYA 1SZFA 4YVPA 2BG5A 3KL0A 3MDUA 3THUA 3FKRA 1N55A 4N6FA 2NZLA 3PUOA 2DZVA 4IM4A 1XLDA 3KLLA 5EB8A 3MHGA 2DZSA 5FF2A 4NZ3A 1FUYA 3R0DA 4KWUA 2J6XA 3V4BA 1HQTA 4WLCA 1TV5A 1D8CA 2DIKA 3R1ZA 1FP8A 1IXPA 2ZTKA 1K1DA 1RY8A 1A0CA 1Z89A 3VFLA 1LYXA 2J78A 1B4KA 3GG7A 1JYWA 4IICA 1KM1A 2CITA 4IUGA 1AL7A 3NSMA 1XI3A 1JCJA 2Q01A 4F3HA 2P76A 2UY4A 4F0HA 4TVUA 1UMLA 3AMKA 4P7QA 2CHOA 3TW7A 3P93A 1WB0A 3SCPA 4TX8A 2ZICA 5G4EA 3A9IA 3ZWTA 3N19B 3IK2A 3RR4A 2XSAA 2CBJA 5C9UA 4R3UA 2C8NA 1ONXA 3R2GA 1YKWA 4I9JA 3T2QA 1TV7A 1ISXA 1GUVA 1VC4A 4LS2A 4Y6GA 1F05A 4PBFA 4F0RA 1JI1A 3DX5A 3EPNA 4CVUA 5CZSA 3WDPP 2ZZ3A 3VNIA 4IISA 2CKRA 5A6BD 4JFVA 1SSDA 2EEXA 3VGHA 4DXVA 1Q65A 3W2NA 1E4MM 1XWYA 2XYLA 2A79A 2POTA 5K2ZA 1FWBC 1TTJA 1UZHA 4AX7A 1UIPA 1LL7A 3AFBA 4IMCA 1OCJA 3FEQA 2ZWYA 1OK4A 1ZFJA 3ARSA 4C6JA 1UOZA 2WKJA 3U5UA 1SJCA 3VIKA 1L2QA 1VGAA 3NWRA 1ZQ5A 2V5DA 1HNYA 2PF8A 4Z1YA 3K30A 5F1VA 4MZ1A 2WVVA 4RZ4A 3RUBL 5A69A 1PZ3A 4L6HA 4JQ4A 2OJPA 1JPHA 3QEZA 4PUDA 4YVVA 3TJXA 1WKFA 4S3BA 1ZZMA 1YEYA 4MVAA 2FVKA 4UR9A 3EPMA 4PBGA 5LYRA 3B8SA 3UJSA 4C91A 1CXHA 5CZKA 1KO0A 4AIBA 2D0HA 4I7UA 2E3ZA 4FX8A 8XIAA 2GUUA 3CAVA 3C0SA 4UIOA 3QGAC 2ZX9A 1DHKA 2PAJA 4K68A 4PUUA 3BLDA 2PP0A 3E12A 1A3WA 4UTLA 1R3SA 3L0KA 3NQEA 2V67A 3CTTA 1A0EA 2CCRA 1NWRA 3AMLA 3STGA 4F0LA 1DWAM 3ZO9A 3ALFA 3KW3A 4ADTA 4CD6A 4JZ5A 4CCCA 3OVRA 1ZU8A 2OGJA 1UPMB 3NO3A 3TC3A 3DFQA 2AAAA 4GVHA 4K36A 1JCMP 2FMOA 1REQB 1W91A 5GNZA 1I2QA 3OG2A 3W71A 2DPEA 4XKYA 1UA7A 4C6DA 3GFZA 4DRSA 3K46A 1GCYA 2P50A 3CB3A 4UQ9A 2OKOA 3HMJG 1H51A 4G7EB 1QNRA 1UBSA 1GT8A 1W5MA 1PVNA 3E96A 5EFFA 3O6YX 2XPKA 3GTNA 1FH8A 1X6UA 4GI8A 2J62A 4Z2IA 1TJ1A 5FOOA 3VGBA 3CIXA 3HOJA 2HXTA 1GTHA 5BNKA 4IPLA 2X05A 1EIBA 1BG4A 5EY5A 4UZUA 1RA5A 1RQEA 2ZZ1A 4BHYA 2F7FA 3MSYA 3IJQA 2J75A 3E0IA 2ZUUA 4Y7EA 1E5JA 4B5VA 5AYXA 2Y5EA 1N7KA 3TWAA 4JIPA 3VKBA 2O56A 2Y4SA 4HOZA 1YLVA 8A3HA 3RM4A 1XHGA 1V08A 2XIJA 3C2VA 1T6MA 1WA3A 1S3HA 2WJDA 4QX4A 3REQB 4L56A 1WKYA 4LFYA 2C16A 4WF7A 2BHUA 5LXXA 1UWSA 1KM3A 3G8RA 3W7MA 3WYZA 2CZDA 1QT1A 1QAPA 3T40A 2WM0A 3ZR5A 2OKTA 3Q58A 3N29A 2QEZA 3UETA 5H8UA 2HBXA 2B7NA 3IIXA 1JCTA 4H41A 2F2HA 3QY7A 1V6XA 2ZUMA 4JFSA 3W83A 3IUHA 4RZBA 1SO5A 3SW6A 4Q4KA 3NQAA 2W79A 1VEPA 3G2GA 1OZMA 3T6CA 3DHDA 4WJ8A 2HNEA 3QSRA 3WENA 4H01A 1EQPA 2GPTA 4J9JA 1K8XA 1UD6A 1XIFA 1NH6A 2A3LA 2G96A 3CPGA 1AJZA 1SZRA 5FEWA 1CGTA 1HKVA 4HHHA 2WSRA 4P7LA 4PMRA 4ZQOA 1U83A 3OLIA 1G4SA 4NX5A 3B9OA 3O63A 1E43A 1EIXA 2G41A 2FQIA 3ELFA 2E0PA 5I06A 3JU2A 3N04A 2OLSA 3USBA 4E4FA 3TTOA 2A2IA 1XRSA 3ZJ6A 1WZMA 2XH7A 1UWTA 4XKMA 3WH7A 1Q7QA 2H90A 2NX9A 4BWLA 3H6OA 4QEEA 1O94A 1ZBVA 3A3XA 1V3HA 4OZOA 5T91A 2HJPA 1G01A 1EHAA 4PB4A 1B4EA 2P8BA 2ZOXA 4F0SA 1OX5A 5D04C 3ANYA 1VLWA 4D8LA 5FACA 1DTNA 3LEPA 2J25A 3M0YA 2E1DA 1PIIA 3UZYA 4WY0B 4RZ6A 2PD5A 4HU8A 3PWIA 1B3WA 5FEPA 2YYUA 5K4XA 4OIFA 1VLIA 3ORWA 5CH9A 4PFHA 4YJ5A 4ZO8A 3MYOA 4DM1A 1VJZA 4LVAA 3NM3A 3CT7A 3UZJA 4D8ZA 3UR8A 4WDXA 3SUWA 3MP5A 2OOGA 2WNZA 2DP3A 4Z0SA 1XRVA 2R82A 3QOMA 4AMAA 7PTDA 1J96A 2CETA 1FH9A 4R9OA 5FAJA 1R3VA 2PDIA 5C7HA 3TTEA 1PV8A 1XS2A 3BPWA 3QPZA 3TN5A 3GNOA 3PPGA 1FA2A 2PZ0A 2WJFA 3GVVA 3TTQA 1V8EA 2OO0A 2NX1A 1DE6A 4NU7A 3TN6A 2VZSA 3UWQA 3W23A 5CCZA 2V3FA 3OTRA 3W29A 2PLJA 7ENLA 4IL2A 1FDZA 2I17A 5BMWA 4YYCA 3U7BA 1E9IA 1IWAA 1TWWA 4JTCA 5CJ5A 4HSNA 3N12A 4Q8MA 1H1ZA 3K4DA 3O3RA 4B5WA 5D2XA 4DUVA 2QLYA 4CNNA 3MCMA 4L4LA 3O2LA 1TELA 3WN6A 2G3NA 4RNJA 3T8QA 3E2VA 2A85A 1Q8AA 2ZTJA 3CHDA 4J3XA 5EBAA 3R13A 5JQ9A 2ZXQA 1KFKA 1LUCA 3PZUA 4CD7A 2AGTA 3GD6A 3PUEA 3FYOA 3R8RA 2EAWA 2G3FA 1TVPA 2BY3A 2A3CA 3H2EA 4Q4MA 3FAWA 5JIPA 3UXIA 2ZZ2A 1SFJA 4IMDA 1M7XA 4DI8A 5DX7A 2GDQA 4LNCA 4H6RA 4CN6A 3QQ1A 3ATZA 4YXGA 3GNPA 3A47A 3W01A 3NUKA 3HMCA 2X0HA 4EANA 1MNZA 3CHCA 4H7ZA 3OA5A 4CD5A 3GHRA 2JBMA 1ZP4A 2DVXA 2ZDRA 1H5VA 2C0HA 1XH1A 4MUPA 1EOMA 2CBVA 2OLHA 1MW3A 1E70M 4O11A 4FNRA 4WUIA 3K1DA 1LWJA 2X2YA 1DJXA 3LB0A 2PTDA 1WNOA 4OU1A 2XU2A 3CMGA 4O16A 3T05A 1QBBA 3DIPA 3E0LA 3FGCB 1A5BA 4FXFA 2PPGA 3IGHX 3N25A 5A6LA 3W1AA 1QW9A 4FALA 3U8GA 3KVMA 5G2IA 2ODOA 4URIA 1EKOA 2OODA 4UNLA 3OIXA 1P0DA 2ACRA 1TA3B 1XLFA 1DIEA 3AIBA 1UR8A 1UD3A 3NQ2A 1KV8A 4LC8A 4MPQA 4ZE5A 3WF1A 4JN6A 2ZVIA 3B9NA 4TR9A 1EJ7L 3ARYA 1SYTA 4Z2JA 3GC2A 4ZE4A 1E1EA 4H2HA 3UVIA 5LNRA 3EOEA 1Q5MA 4WKAA 3WF3A 4FR1A 2OCZA 5HUPA 1S1PA 2ZFAA 1P7TB 3PNUA 5IRPA 1V0NA 1W37A 1UQZA 1W3KA 3ARUA 2IQTA 3CYVA 1SM9A 1SMDA 4S3JA 2NSOA 5LXEA 4H8UA 4NAEA 1IIHA 3N2XA 4J5NA 1XC4A 3ZSSA 2PDGA 2UWFA 3H22A 3M9YA 1K6WA 5JU6A 1RJPA 3QR1A 3WLQA 5DMLA 1YNYA 1FBAA 3TNBA 2NVCA 1BVZA 1HVXA 4X9YA 1J0KA 2GGIA 5CGQA 4P8XA 1F07A 3U3HA 1FOBA 1D3CA 1JFXA 3W6LA 1JGIA 1IWPA 4JFTA 1FDYA 3TC7A 2NX3A 1KD0A 1TWZA 3QV8A 4FNQA 3T0AA 4E6MA 1U30A 2VHLA 3PBMA 3RU6A 2JQXA 4KWOA 5EGRA 3RLVA 4HGXA 1J6PA 3AXHA 1CYGA 4Y8EA 3AWNA 3MKCA 2D1ZA 3B8IA 1KXHA 2BOGX 3P8JA 4D6CA 1PXGA 3K5XA 4QGCA 1ITXA 5AECA 4IOTA 4RV8A 1F3TA 2VC6A 4WEVX 2BXVA 4QS5A 4LXFA 3MI3A 3IIZA 2OZ0A 3KCOA 3OJGA 3EOOA 5HNNA 1M7JA 4XSLA 1R6WA 3W1MA 1F4HA 1QRQA 3LBOA 1C9DA 3PZ9A 4EX4A 3CV2A 3OBEA 2FB3A 1I9CB 4JIQA 4X9SA 1HL9A 4GZEA 1KGWA 3O05A 2DV0A 1XSJA 3E3HA 3R94A 3VPLA 2PDWA 2GUYA 1KTNA 3HQNA 2BBFA 4PMNA 1OYAA 1ZALA 1EGZA 2Y7FA 1Q66A 1WXZA 5D37A 1EJSC 2ZA1A 1H60A 2X2GA 4WSKA 3WQCA 2VL4A 2ZVRA 3U57A 2Z28A 2FZBA 1NFPA 4GZJA 2VX5A 5KINA 2J4GA 5AC5A 1H61A 1TPUA 3FEMA 5LGXA 5LZLA 1QPRA 4O1FA 5IBXC 3TWBA 1CCWB 3B8UA 4RXGA 1ENUA 1C9WA 2WSYA 4N9BA 3O16A 1XICA 4MNJA 5D30A 4AVOA 2YR1A 4GE8A 4HHMA 4AIOA 2ISVA 1GGOA 4K8EA 4S3EA 3WDQA 4HA3A 3UCQA 3G1AA 3BCJA 4YPJA 2C14A 1OABA 1VZWA 3TYCA 1CGWA 2YLAA 1QPKA 2PWHA 4C6NA 2Z25A 4CGTA 1XPYA 3DU0A 4O28A 1KC7A 2IQDA 1J5TA 1IR2A 3R5EA 2PF0A 4WHBA 3VKJA 2YBTA 4Q22A 4DPPA 1ODUA 3BE7A 5DN1A 4RZ5A 3EA1A 4HSHA 1XCXA 1EA9C 1GQNA 2GVGA 4IL0A 2C1IA 4E0CA 3EOSA 4RPQA 1R3TA 2CNCA 1I0BA 5CPLA 4XAYA 2RUSA 4IIFA 3BLLA 1UR0A 5C54A 1RA0A 3GU2A 4PBEA 1JCXA 1F2JA 1Q6QA 4JYDA 1LM1A 5EMKA 5CC6A 2VOMA 3OEXA 1DE5A 3VCCA 4GCXA 3CQ0A 2YDAA 1Q13A 3PM6A 4FHAA 3VC6A 1B54A 2PE4A 6XIAA 5CJMA 1UR2A 1TJ0A 3OVQA 2BXZA 3VFCA 1LL4A 2W3ZA 3K4WA 4Y9NA 5D9MA 1LQ2A 1OYCA 2FHCA 1JYXA 4L9XA 2PDBA 2WM1A 2OB3A 5DLCA 1MMFA 2ISWA 1ZENA 4FZIA 1HO1A 3BO9A 4AF0B 3WDHA 4GYJA 4IT1A 2XN0A 2VOTA 1XISA 3M0VA 4UTHA 3W1PA 3L21A 2GQ8A 1TB3A 3LRLA 3LCIA 3W25A 3VOCA 4MUZA 1N82A 1D9EA 1VAHA 3M41A 4JKMA 2GK1A 2UBPC 3GKFA 3EX2A 3GTFA 3VAVA 2PTZA 5BW6A 4LAOA 4CQBA 3UWVA 1MEHA 2VDGA 3E0WA 1R9YA 1A5KC 3C2YA 4Y9OA 1M65A 3VOJA 3NJ3A 4KIRA 1ADSA 4A4AA 2HPMA 3GC4A 4QQUA 9CGTA 4XZHA 1X1OA 3LU2A 4QROA 1GOMA 3TJ4A 2NLYA 3E0VA 4K1WA 4H9MA 4C6KA 3IV3A 4NJHA 4IIEA 3B4UA 4GJJA 4AIUA 1XIDA 3AZSA 1PZ2A 4BY3A 1ODZA 4ZQNA 4GQ0A 5I3HA 3QPYA 1S46A 1XLMA 3HV8A 2DU2A 1I60A 2ATSA 1VCVA 1S5VA 2YCLB 1RALA 4HP5A 5MKGB 2OO6A 3BJSA 5TIMA 2DSZA 1A4LA 1C8YA 1GZJA 3TN4A 1FHUA 2PDKA 1WAUA 3U4AA 1U33A 1RY0A 3P82A 3S46A 4R27A 3QMRA 4LB3A 3P14A 4BF9A 3FYPA 1BRLB 4Z0JA 3A3WA 3R8HA 4M3PA 1GOOA 1KWKA 3WJWA 1XDLA 3GXFA 3AJ7A 3GYCA 1PHWA 3IARA 3NAVA 1PIFA 1KKOA 4WCJA 3FFSA