1KFKA

Crystal structure of tryptophan synthase from salmonella typhimurium
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
251
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title On the role of alphaThr183 in the allosteric regulation and catalytic mechanism of tryptophan synthase.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
total genus 94
structure length 251
sequence length 267
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2001-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1kfkA00
1I2OA 1G4PA 1H1ZA 5J5RA 2FIQA 2X1TA 4XZ9A 1G7UA 5D30A 4XQ6A 1GYNA 3UZJA 1VS1A 3B0VC 1PIIA 4FIRA 1THFD 4GUHA 4K39A 3CEPA 3P62A 1DORA 4WUIA 3PC0A 4XTDA 3W22A 1FWWA 3KVKA 1KW1A 4YLWA 1YXCA 3KRUA 1CX9A 3GXPA 4WXYA 1C8VA 2W79A 4RCXA 3UQNA 1R2TA 2NLIA 2QKFA 3D0CA 4MPQA 4Y96A 1YTEA 3OEXA 3W83A 1JRBA 3W07A 3CU2A 2A4AA 5F1UA 4JXCA 4P61A 1KFLA 4Y90A 4A21A 3GIYA 5K9XA 1VRDA 5I3KA 1DQWA 2V81A 5CZ0A 3P60A 4JYFA 1BEUA 4O10A 2FB2A 1YYAA 4JS3A 5EKYA 2ZZ7A 4NQ1A 1TJPA 1TPC1 1EP2A 2VENA 4PL2A 5BW6A 2FPVA 4RXGA 4OU1A 1GVRA 5D04C 2F7FA 3G3MA 3W2KA 3W23A 1QPRA 5G4EA 5DY2A 1NAL1 3MI6A 2FPYA 3BLFA 2DP3A 2QCNA 4UC5A 1TV7A 5C54A 5C6MA 1A5CA 4DXVA 1O94A 1OG0A 4RV8A 1KM5A 1H7OA 2YR1A 4XWUA 1H7RA 4N2YA 1GQNA 2A5HA 1TCDA 1F5ZA 4AMAA 4NNBA 3UXAA 1W3NA 4NX5A 3G1XA 4O1BA 1H51A 3GX9A 1Z42A 1OFAA 1JCJA 1O4UA 2A21A 4X9SA 2GJLA 4ZQMA 1PV8A 1VH7A 4QJ1A 1TO3A 3W1RA 5F2IA 3NQDA 1TIMA 4JDYA 3PG8A 4PCFA 3QQ0A 2BSLA 3NL2A 4UFLA 4O8RA 4BI7A 3CIWA 4HPJA 3GDTA 1UBSA 3GAKA 1AW1A 2CWNA 2LLEA 4UIOA 1MSSA 1F2JA 1WV2A 3BG9A 2NV2A 4OHQA 4TU1A 3MW7A 1M6JA 3UZ5A 5FF3A 3ATYA 3TIMA 1F73A 4Y8FA 2P10A 3ZWTA 1W3IA 1LORA 4A22A 3QFEA 1ME9A 2YYTA 4M7SA 1DOSA 2X1UA 3W71A 1FY6A 1MXSA 1W5QA 1JRCA 4LY8A 4LTSA 1WAUA 1Q6RA 4IPJA 3LBMA 2E6DA 2ZBTA 3LHTA 2CLIA 3H54A 1TPH1 3O16A 3UPWA 1JCXA 3IGSA 2IQTA 5EL1A 5HWMA 3E12A 1VPXA 4AHPA 2YPIA 3N19B 4PL1A 5FESA 3P8IA 3E96A 5H2ZA 3TC7A 2V2HA 4M7TA 3PG9A 2WSYA 1LROA 1OJXA 5T26A 4OWGA 1R30A 3SGZA 4G1KA 1VJIA 2EKCA 5EY5A 3F4WA 1SFLA 3O6DA 1IXPA 1R2SA 2VEPA 2R94A 3IVUA 3JR2A 3FYPA 3BGGA 2A2IA 3PR2A 3TC6A 4Z1CA 1H63A 4WD0A 2ZZ6A 2CZEA 5EBUA 3A21A 2CLHA 4CNOA 3MP4A 3NO5A 3K30A 4LU0A 1ZENA 4GUJA 3CWOX 3STFA 4BWLA 5AC7A 1GTEA 2CLFA 3JS3A 1ZFJA 4A2RA 4UFMA 1OFDA 3LCHA 1QPNA 2E6AA 3M41A 4AXKA 1OK4A 1LRTA 3SI9A 1S5VA 3P67A 3FKRA 3TDFA 4NJIA 1AW2A 2JKEA 3QPZA 1GPWA 2QUUA 2VFEA 2WSQA 1LP6A 1F7BA 2I1OA 4JTJA 2BLEA 3S5NA 3NGJA 3NAVA 5I3IA 4UUIA 3UWUA 3PSVA 2OCZA 3PWAA 4UTKA 3LDVA 5D2XA 3G1VA 3IIOA 4A2SA 5LHFA 2YFNA 2TYSA 1WDWA 2QDHA 3PY2A 3HB9A 3SJ3A 1SO4A 4CQAA 4FX7A 4K8EA 3QF0A 4O50A 3NEVA 1TTJA 5DY3A 2NXIA 3KRSA 4GWEA 3O05A 3DFSA 3W76A 2ABBA 1ZJIA 2WV8A 1SO3A 3PS7A 4Z1DA 3G24A 1H50A 1VYSX 3TSDA 1TRIA 2Z1BA 3S1UA 1SPQA 3H55A 3HJZA 4LNYA 5D2YA 1JULA 5G2WA 3TA6A 2TMDA 1PHWA 4N4QA 4QIUA 1MEIA 4UR8A 2B7OA 4XTIA 4JGDA 4RJEA 3V75A 1SZEA 1B4EA 2VEKA 5FF0A 3ABQA 3LCWA 4DBDA 2B4GA 3VFLA 4Z08A 2QAPA 2ZZ4A 3IIXA 3TKFA 1XBVA 2C13A 4HNTA 4JD4A 2QDGA 1KA9F 2V2DA 3CQ0A 3QMRA 5EA9A 3EXRA 2BZNA 1KV8A 3S1WA 5DXXA 3H53A 1DL3A 5AHMA 4GRSA 1SR9A 3BK0A 2VXNA 1FDZA 1B57A 3LCGA 2V82A 4NU7A 1FWSA 4NNAA 1TSIA 4LS1A 3O1NA 2OZ0A 3NZRA 2DU2A 4UFHA 2FPTA 5D2VA 4FXRA 1ICSA 1NFBA 3MJYA 1LDCA 1PL9A 2Q3RA 1N55A 5L6UA 2X30A 3PVFA 3TXVA 4ONVA 1SUXA 1TRDA 4QSHA 4YL2A 1U83A 1G4SA 3RNDA 2Y7EA 5K4ZA 3TMQA 3RLVA 4ADUA 4XBSA 5BOOA 3M1ZA 1G6CA 3C61A 4RX0A 3LM7A 1RQHA 1KTBA 1QPOA 1MEWA 1BTMA 4WZHA 1W5NA 4GXMA 3P8JA 2RDWA 3T7VA 4RKAA 1T99A 1K8YA 3M6YA 4UTUA 5HUPA 2FQIA 1KFEA 3M5XA 5AHFA 3MHUA 2ZZ1A 3NQMA 2GVGA 1PE1A 4CNNA 3ZWSA 4AEOA 3GXTA 1WX0A 1O60A 3TAKA 3ABOA 1FWTA 4FEZA 2GQAA 2NXGA 3Q2DA 2PC4A 5D02A 3ELFA 3A5VA 4IMFA 2CFFA 3G1SA 4OBTA 3KFTA 2ISVA 4CQ9A 3DZ1A 3M7WA 1LBFA 3C8FA 3EWWA 3PSWA 6TIMA 3U2OA 3L68A 1HG3A 1OF8A 3CC1A 2F84A 2YCEA 1D9EA 3GYEA 5LNVA 1ZY9A 3TW7A 2VFGA 4JYEA 2NX1A 3C2VA 3KOFA 2EAWA 4B5NA 4FNTA 1OABA 1K03A 3TMLA 2NZLA 3LLFA 3WJSA 3I7RA 4AWSA 4UMCA 3UWZA 3WFAA 2V30A 1D3GA 3W74A 2WOQA 2HTMA 3FFSA 4CQ8A 1GYLA 3NG3A 2B7NA 3BG3A 5FEXA 4KKXA 4ADSA 1DQXA 4MIMA 2J9XA 3EKLA 5D37A 1IIGA 4AWUA 1FWRA 4IX0A 5AYYA 4AWTA 1R46A 3BLEA 1LOSA 4EF9A 1XBZA 4Z0SA 4MY9A 1YLVA 5KZDA 1XC4A 5G1YA 3O07A 1A5SA 1LOQA 1KV5A 5AHNA 4UTWC 3C56A 1VR6A 4AHOA 3M0ZA 1JQXA 3O8AA 1CW2A 3O6CA 2O7QA 3E9AA 4BI6A 5BNKA 1DV7A 1NEYA 2WPBA 3TR2A 1QR7A 1W8SA 3C3NA 1BKSA 3CTLA 5AC6A 3P5YA 2NV1A 2AGKA 3P61A 2H90A 3R89A 5FF7A 3PAJA 2E1DA 1XXXA 1EWDA 1HUVA 3RK8A 4MYXA 4JNMA 1F05A 1QPQA 1LTDA 5IBXC 3VE9A 1TTIA 4K37A 4LW7A 8TIMA 1Q6QA 1GT8A 1ML1A 2ZQ0A 3DFNA 1KLYA 3W73A 1W5MA 5CPNA 4O14A 2YYUA 5KINA 3TSBA 4FNQA 2O7SA 1EPXA 2I14A 2QEZA 2NXHA 1YPIA 1JCMP 3HGOA 3W7NA 3NQ2A 1OYBA 2G95A 3W7JA 2Q3OA 3G1YA 2OX1A 3DKLA 4FXSA 4NXSA 4MLRA 4J9JA 3NM1A 4AHQA 1QNVA 2GVJA 2Z6IA 2QCHA 1SO5A 4JTIA 1SW0A 3GXNA 5LGXA 2C16A 4UFIA 5KITA 1KM2A 5D03A 1H61A 4DF2A 4RLIA 4IGHA 1PCKA 5CSRA 1SW3A 2E5BA 4DO6A 4NJHA 3B05A 3R5EA 5F2LA 2A7PA 4UXDA 2J24A 3W84A 3DHDA 4O4WA 1JR1A 4FB7A 3MMTA 2Y7GA 3MYOA 3HGSA 1AG1O 1QCWA 3S1VA 3DFOA 4JY9A 2X16A 4O1DA 3P84A 3QW4B 3CM4A 3EKZA 3STGA 5U4NA 1FDYA 2RHGA 3HG3A 3LCXA 1GVSA 2BTMA 4NNCA 1MEHA 1IXOA 3NR0A 4JX4A 3G0SA 3LCFA 1ADOA 5BMXA 4HKPA 2FJKA 1LZOA 1A53A 3EX1A 1A5BA 2Y88A 3LHYA 1UUMA 3QRHA 2J9ZA 4JTEA 1LRQA 2CW6A 3SY5A 1QO2A 1XDMA 3IVTA 2BXVA 4E0CA 1B4KA 1FCVA 3LI1A 1PS9A 1ALDA 5CZJA 1DKWA 2ZCGA 3OBKA 2X1SA 5J5DA 2ZA1A 4AAJA 1TPDA 2FTPA 3FIGA 2QR6A 2XN2A 4IMGA 3USBA 4N02A 1FBAA 4LRTA 2QCLA 2ISSA 3KVJA 4EF8A 1LOLA 1WBJA 3N3MA 4S2CA 4EVZA 3P82A 4P2VA 1SZGA 4JTGA 1KM6A 1MO0A 1OK6A 3GDLA 3FS2A 3BLIA 3HO8A 4ADTA 1GTHA 1JCNA 3W7LA 1IXQA 2WNZA 4DF1A 1TTPA 4X22A 1JQVA 4KWVA 3MHGA 3LV6A 3THQA 1EIXA 1OF6A 3M44A 4L4LA 2CZFA 3TCEA 1WOAA 5HWNA 4IX2A 3S5OA 5K2ZA 1OYCA 2WKJA 3IGXA 2CLMA 4K36A 2NWSA 4FNPA 3C2OA 2GPTA 3W9ZA 1P4CA 2DZSA 3W88A 3GR8A 3R8RA 5F2GA 2A6LA 3B8DA 3L0GA 3W1PA 3L66A 3LTYA 4LWWA 2J88A 2YZRA 1GG0A 2NUYA 3EB2A 1DVJA 1OFRA 5G2IA 3DFQA 3IGUA 5A8GA 3B4UA 3LV5A 4PH6A 5L9FA 1SZNA 2XN0A 4LUJA 3SW6A 5MHBA 1S3HA 1TPWA 4JTSA 1K8ZA 3L5AA 3L67A 2Y89A 3W75A 3B0PA 5KZEA 4K7VA 2G5WA 3YPIA 1EP1A 1WYIA 1TPFA 3CIXA 2A6NA 5EYWA 2QAFA 3TFCA 1XFBA 4A29A 2DZTA 1DJQA 4HSNA 3PB2A 1KFJA 5H91A 4O54A 3NOEA 4OGZA 5AYXA 3W1AA 4M6PA 4WY0A 1W0MA 1FXQA 1NF0A 2TSYA 1PCWA 4O0KA 3N2XA 2A0NA 4RZ4A 4Z1BA 3W72A 4JX6A 4JYDA 3WK2A 3ABRA 3S6DA 3GDRA 3FEMA 3QC3A 2Y61A 1C9DA 4GJ1A 1PVNA 3ZR4A 1VCFA 1WA3A 4DPPA 3SGUA 5HNRA 4JTLA 1Q6LA 1RQEA 3LHVA 3SSJA 4NX0A 1Q6OA 3C6CA 3W70A 3MO7A 1C29A 1XBXA 1YDNA 3GKFA 4N9BA 3L2IA 5G5IA 2Y70A 1Z48A 3EX4A 5KSWA 1EP3A 5TBOA 1I8JA 2ZRXA 3W7HA 2J27A 3W1TA 2QJHA 4O28A 4MY1A 3LOTA 1I45A 1J4EA 1ONRA 3T44A 3L21A 2VFDA 3AO0A 5BMWA 5KMYA 3TU9A 3S5YA 3F1QA 3WJXA 4ZQOA 3HPSA 3N9SA 4S1FA 3W7MA 4QISA 3O06A 1UASA 4PTNA 4CCCA 4WOQA 3NPXA 1KM3A 3FLUA 1TTQA 1NF7A 5HUOA 4YWIA 2WSRA 3GDKA 3WJWA 2YW3A 1G4EA 3CHVA 3UY8A 3L5LA 3NNTA 4LS0A 2H3DA 4UFJA 5LNRA 5E0KA 3NQGA 1QOPA 4K38A 1ZAIA 5AHLA 1ME7A 3ANYA 1HFBA 1FCQA 3ZS4A 3PUDA 2ZDRA 3W85A 4DQWA 3PBWA 4TR9A 5AYZA 3MI3A 2B7QA 3JRKA 1W37A 1Z44A 4HT3A 1B9BA 4QM1A 1KTNA 3SZ8A 3GK0A 3MBFA 3EWYA 2DZPA 2G96A 4BF9A 3M5YA 4O57A 2QCMA 1EX5A 5K9CA 3W1MA 4TMCA 4Q33A 4GNJA 1OX5A 4M19A 5DLCA 4E38A 1OX4A 3TE9A 3DKJA 4R34A 3T40A 3FYOA 4CCDA 3T55A 1EUAA 2ZA3A 1SZFA 4QNWA 3SECA 3FJ6A 2QCDB 3LTSA 3KXQA 3L9CA 2CZ5A 1L6WA 2YSWA 4MZ8A 3KAOA 2H8XA 1K7EA 4JIPA 3INPA 3NPVA 3MP5A 3LLDA 1M7OA 1KM4A 5CSSA 4MYAA 3PM6A 2DZUA 3M43A 1XUUA 3W86A 2JK2A 2H6RA 1H7XA 4UNKA 5CG7A 3TUUA 3BPWA 2ABAA 2CU0A 2QUVA 3LCIA 4JTUA 2Y7DA 3DI1A 5D09A 2E5DA 2JKAA 4ZQPA 3W7KA 3S42A 3LTPA 1LRNA 2V8ZA 5E93A 2H3BA 4UTIA 1SU5A 3B04A 4RXFA 3ZFHA 1Y0EA 4JTHA 4AF0A 1AW5A 1MZHA 3DGRA 3IEBA 4LVBA 3BARA 4K7YA 2Y63A 2C15A 4YXGA 1LLWA 1V5XA 1TQXA 3MBDA 4ZVJA 3G8RA 1SFJA 1BWLA 5F4SA 1L6SA 3A22A 5HR7A 3HG4A 5LHEA 2GUUA 3LCLA 4MZYA 4ZQRA 2DJXA 1FCUA 3NVTA 1M7PA 1DJNA 5TQLA 4QAIA 4DEFA 2YGYA 3E49A 3KRZA 3UWYA 2GQ8A 5AFDA 2BX7A 3CLMA 3A9IA 3FOKA 2PE4A 3TK7A 3WJZA 1XDLA 1EA0A 3HMJG 4NZJA 3A24A 1GOXA 2XFWA 2C6QA 4HHPA 2Z0IA 4ML9A 3W7EA 3GKAA 1XUZA 5F4XA 2UV8G 3CB8A 2DORA 3T4CA 2XN1A 1GVFA 4LV4A 3DBPA 1P0KA 1YXDA 4HNNA 1KLZA 2QJGA 3LGEA 3LHWA 2ZTKA 4R33A 1TQJA 4BI5A 3QQ1A 3C2FA 3DH7A 3TAOA 1Q3NA 3EXTA 4YCPA 2RFGA 3N2MA 5DXYA 1T8XA 3SIZA 1J2WA 1RV8A 3I6RA 3HOJA 1H7WA 2WNQA 5F1VA 2D73A 5KZMA 4O18A 1VQTA 3RLUA 2RKXA 4Z1AA 1TYGA 3QJAA 1YPFA 5HWJA 4I7VA 1JCLA 1I2QA 4IOTA 1JCYA 7TIMA 1RD5A 1VHNA 1AMKA 1X1OA 1F76A 3GVGA 2W6RA 5AOUA 5TIMA 2G97A 2KZHA 3FA5A 1ME8A 2C1HA 5LSMA 3N9RA 3L5MA 3S9YA 4I7WA 5I3GA 2NWRA 4LOCA 3N14A 3G8EA 3TXZA 2A7NA 5AB3A 2NUXA 2YXGA 5FEZA 4K6AA 1TV5A 2GOUA 4O4VA 4MKNA 3P7YA 4JY8A 1EB3A 2YDAA 1WBHA 4ICNA 2JGQA 5HULA 3IIPA 4O52A 3QH2A 1V7YA 4FHAA 3P80A 4M6QA 3BVJA 3CPRA 1H5YA 1ZHAA 1PHQA 1I2RA 1ZAHA 3W6YA 4TO8A 3L0KA 3LERA 1XI3A 3NZ1A 5FI8A 5HJLA 4AB4A 1JUBA 3HIJA 3N34A 2Z6JA 3F03K 2EGZA 4MFEA 1TB3A 2HS8A 1GVQA 3CWNA 4JR5A 1XCFA 4CNPA 2E68A 3P81A 1VYRA 4UMBA 4AVFA 2VFHA 4BFAA 3BGJA 4N9EA 4E2BA 4Y9AA 5FF2A 3HQ1A 1UB3A 4DO4A 3R2GA 1FX6A 4QNEA 4E2DA 1L6YA 1N7KA 3PUOA 3DU0A 4KFOA 1F6KA 3G1AA 4DPQA 1H7NA 1QMLA 4JEQA 4LV9A 4CLMA 3AJXA 3W1XA 3EX3A 1KM0A 3M16A 1LBLA 2EHHA 4KWWA 3TH6A 2QF7A 3NL6A 4EOUA 4HIBA 2WNNA 4C1KA 4PODA 1SW7A 4N6EA 3RMJA 1O5XA 1R2RA 5SWUA 1A50A 3QZEA 3W7GA 4IJBA 3S8HA 3PF3A 3UWWA 1XM3A 2C0AA 1QFEA 5D05A 1SSGA 1F6PA 4GUIA 1ZCOA 3TJXA 3DAQA 1F74A 1LYXA 2H8ZA 5FF4A 1W56A 2ALDA 1LBMA 3L0NA 4ZZ9A 2B0MA 3GNDA 1KFCA 1OFBA 3O6YX 4NJKA 1ICPA 2ZRWA 5AC8A 2QCDA 1O5KA 4LC6A 3LXBA 3Q37A 4MZ1A 4LVDA 1VC4A 3W1QA 2J9YA 3NQFA 1IIHA 1VLWA 2DZVA 4CCEA 2OJPA 4WQ6A 4NVTA 3QMSA 2JBMA 3NM3A 3GR7A 3NXFA 2VEMA 4UR7A 3UXDA 2Z2UA 4IMEA 1OFQA 5FEWA 2B7PA 2V5BA 1W31A 5K4XA 4JDBA 5DCBA 3TNOA 4A3UA 1VLIA 2E6FA 4KFNA 2ZFAA 3RF9A 4IUOA 1P0NA 4ZMGA 2BWGA 2R8WA 4ZQCA 3EWBX 3LHZA 4X3ZA 2YW4A 4NXKA 1GZGA 1L9WA 1AL8A 3O15A 3KVMA 1K02A 1TREA 1NVMA 1OX4B 3HF3A 5HQEA 4PC8A 2ZRZA 5BRBA 1XBYA 4JTKA 4PA8A 1M5WA 4OE7A 4GUGA 4WX2A 1H62A 3MI2A 3KX6A 1FUYA 2VFFA 5AHIA 4JN6A 4HN4A 3VE7A 1RR2A 3QW3A 3OG3A 3DENA 1Q45A 5I3HA 3KHJA 4NJJA 3IRDA 5C2XA 3F4NA 2WO5A 3RFAA 3FKKA 1KFBA 3NQAA 4N6FA 1B3OA 1OFPA 4OV4A 1NSJA 1OHLA 4O53A 2ZYFA 4N9CA 2C19A 1FXPA 4XUGA 4H3DA 3Q58A 2RH9A 1O95A 4JX5A 1SO6A 5EPDA 1QDSA 2E09A 2ATMA 2HS6A 1LM1A 4NJGA 3E0IA 4LVGA 3UNDA 1DBTA 1H60A 3NL5A 4BWLC 1P5BA 2PRLA 4IQLA 1UCWA 1G7VA 1JJKA 1KBIA 3G1HA 4POCA 4K8HA 4LUIA 3WJYA 3MHFA 1QOQA 3TX9A 3W2NA 1R47A 2FDSA 3OVQA 4FX8A 4I9AA 2ZRYA 1VCGA 4WY0B 5I3FA 1VHCA 4O17A 4D2JA 3TJLA 2R14A 5E1QA 4WXZA 3R12A 4JTTA 5CPMA 3P74A 3B0UX 3EX6A 4Q4KA 4MJZA 4Z0JA 5F2MA 1K7XA 1OX6A 2YFOA 4TIMA 4WJEA 4O1AA 4M6VA 3QM3A 3NQ6A 5I3JA 1TMHA 3EEGA 4IXHA 3EWZA 2OT1A 3G0XA 5D38A 3TROA 3G1FA 3W1LA 4R7JA 3B06A 3MYPA 4N9DA 1N8FA 2RDTA 3CT7A 1TPVA 4Q32A 5LGZA 3GNNA 2ZZ2A 1UUOA 4EWND 1GJPA 1W1ZA 5CPLA 3SR7A 1AK5A 4FX6M 3QEZA 3BW2A 3LHUA 4O15A 2P1FA 5K9DA 1VGAA 4BK9A 3LRKA 3W3OA 4H6KA 2CLKA 3OHIA 2A85A 2V5LA 3HPXA 1XL9A 3W7RA 1GEQA 3NQEA 3MP3A 5FEPA 3FJLA 4HNUA 2VEIA 2QJIA 3TQ0A 1KTCA 3VNDA 4UTWA 1EEPA 4UTMA 2C18A 3EXSA 3N73A 1JVNA 4LVAA 2A1YA 1EUNA 3Q94A 1TPUA 4ZQNA 1TPB1 4RR4A 3E02A 3I65A 3UY7A 3DFPA 2VKZG 3NPWA 4WY0F 5DN1A 2V0TA 3GB6A 4IMDA 3C52A 4ORMA 2OMAA 1KM1A 3QSRA 2ZTJA 1TJRA 4PFMA 1YDOA 3C4UA 4QQ3A 4YMZA 4AF0B 3DI0A 3M5ZA 2ISWA 2FLIA 3CEUA 5CKSA 3U6WA 1AL7A 2QCGA 1EWEA 4R53A 1G69A 2WJZA 3W7DA 4ZL1A 1HL2A 1X6UA 2DZXA 2R91A 5K3VA 3NPUA 5G4WA 3W7CA 2TRSA 3A23A 1X8FA 3IIZA 4HNVA 1E51A 2Q8LA 2HSAA 4GUFA 4OQVA 4OT7A 2C3ZA 1D3HA 4ORIA 2DJLA 2V9DA 2P0OA 3HBLA 1JUKA 1W5PA 4ALDA 4RZ5A 4GC4A 2EF9A 2Q8ZA 2ZZ3A 2Y7FA 4LT9A 5GVJA 4DO5A 3PBVA 4FNRA 4MJMA 4DELA 2X1RA 1OYAA 3PB0A 2NX3A 4JIQA 3MUXA 4H4IA 2I9EA 1P1XA 4DBEA 3QMTA 3NQCA 1OVDA 4MY8A 4GBUA 2GVLA 2QCCA 2Y6ZA 1VYPX 1W54A 2QCEA 2J6XA 5HINA 3LXAA 3GDMA 3DXIA 2PRHA 5LNWA 3NA8A 3TQVA 2CZDA 3U8GA 4PEKA 2Y62A 3HPZA 4QITA 1QWGA 1IF2A 4W9TA 3OVRA 1OFOA 5DBUA 4O1CA 1QAPA 3HG2A 4HPXA 3W7QA 3IV3A 1IGSA 5HMSA 1H7PA 4LS2A 4MVAA 4C1LA 4IMCA 5LNSA 3W87A 5CZSA 4XKYB 5D32A 3C2EA 2CLEA 1RZMA 2V2CA 1GVOA 5EMUA 3PBUA 3I68A 1K7FA 3UYCA 5F4WA 4LRSA 3DHFA 2TPSA 2GJNA 3ATZA 4IPIA 2CLOA 4UTHA 3M47A 4NUWA 3GAYA 1HO4A 3UWVA 1IXNA 1W5OA 3W7OA 5CZTA 1OFEA 1UJPA 4FIQA 4WOZA 1GG1A 5LKYA 1HO1A 5LNUA 3LRLA 3LX9A 3LB0A 3NDOA 3P5ZA 2X2GA 1CI1A 3BV4A 5DCDA 3I7QA 3DFTA 3EX2A 1L2UA 4M5PA 1FDJA 2Y85A 2QCFA 1I4NA 1RQBA 4GFSA 1VCVA 4MUZA 4IXXA 4FNUA 4GE8A 3T78A 1H1YA 1J5TA 3LBCA 2NUWA 4O13A 3WK0A 1S5TA 3S5ZA 3TW6A 3VI2A 1VZWA 5A5WA 4O16A 1SSDA 4OV9A 4UTJA 3W7PA 4JICA 3W2MA 2YX0A 4AH7A 4U4MA 3QYQA 3W2LA 1RPXA 3GLCA 3G22A 5U7SA 1DHPA 2VC6A 5D33A 1KBJA 2QUTA 2PRMA 1U5JA 3G18A 1YDVA 3WK3A 3OA3A 2GQ9A 4JTFA 2CLLA 1K8XA 3BW4A 2RDUA 1T0OA 3STCA 1G67A 4FF7A 3EWUA 4LVFA 3WK1A 1T96A 1ZAJA 3TSMA 3O63A 3BO9A 3SFKA 2ATSA 3UD6A 3ABSA 3QPYA 5C5YA 3NL3A 2FFCA 2VFIA 3S1XA 2ZZ5A 5AN7A 1TPEA 1K3UA 2WQPA 4Y6GA 2A7RA 3LRMA 1FWNA 1TV8A 4FO4A 3QSTA 3NQ7A 2E6YA 1YTDA 3W7IA 1SQ7A 1KFKA 2C14A 2DZWA 4I7UA 3G3DA 3BW3A 3LI0A 5G1TA 3HG5A 3EWXA 3PUEA 1YXYA 2FB3A 1Z41A 2ZRVA 3OVPA 1A5AA 3HGRA 4N4PA 2JGYA 3UWQA 3W2UA 3MWAA 1GWJA 3VKJA 3NYZA 4L4MA 3RU6A 3TV8A 2PURA 5G2HA 1X1ZA 5C55A 3KVLA 2W0UA 4FNSA 2JKPA 1RVGA 5DELA 3V1PA 4TMBA 2VELA 3STEA 3C0JA 1WOBA 5DCEA 1WXJA 3B03A 4UFKA 4IWWA 3W2JA 5ABTA 4RZ6A 3A5FA 1ZALA 1JUEA 1LCOA 2E77A 1ICQA 4YCOA 4UTLA 3M9YA 4UTTC 5D2WA 5KTLA 1G4TA 5CPOA 5IM51 4MLJA 2PCQA 3IIVA 4MFDA 5AHEA 4O12A 3L65A 5IBXA 4DF0A 4RK8A 1FCBA 5LZLA 3I7SA 3HGJA 2E5CA 4O19A 2OT0A 3G0UA 4O11A 4UNLA 3BG5A 3W1NA 6ALDA 1BWKA 3M5VA 4O0ZA 3OIXA 2AQWA 2HMCA 3PULA 5D2TA 5K7JA 1ZNNA 3THAA 2EPHA 1XKYA 5DBTA 1WQ5A 4XBKA 3UPBA 2NX9A 4XKYA 4TX9A 4BR1A 4UTTA 3TQKA 2AAMA 4MOZA 5CGQA 3LXCA 2VOMA 3GZ3A 1X7FA 1YTKA 4HSOA 3S0CA 1W3TA 4LC8A 3NQ8A 4U28A 4UMAA 3TFXA 1I2PA 4X2RA 2ZRUA 1S5WA 4NT0A 1QO5A 3R13A 3W1UA 1LLZA 3G1DA 1HTIA 3C2RA 1I2NA 4EIVA 3NQVA 3VCRA 1FQ0A 4S2BA 3PBYA 4UCGA 2ZA2A 3IVSA 5HR6A 1YADA 4NZFA 4KFPA
chains in the Genus database with same CATH superfamily
1I2OA 2O56A 2VX5A 5M1TA 3WQCA 3BLLA 2X1TA 4XZ9A 4ROPA 3AJ7A 4LBRA 3N6QA 4J3VA 4K39A 5E0FA 5T9BG 4US5D 1HW6A 1XICA 1FWWA 1XH1A 1OEPA 4YLWA 1E0VA 3GRIA 3CYVA 3HQOA 2J79A 5DRIA 1TMLA 4LBSA 3GXPA 5DQPA 2VDIA 2NLIA 4PB5A 3D0CA 1Z8AA 3SN1A 3AXHA 3LG3A 3W83A 3VGDA 2VUYA 5F1UA 4JXCA 1VPYA 1NQ6A 4A21A 1FWGC 1QW9A 3FCPA 4QP0A 1DQWA 4CD6A 1US3A 1U5HA 4PUKA 2G4FA 5EKYA 1YNYA 4I5UA 5DFAA 4E8CA 1Q8AA 3QV8A 2FPVA 4RXGA 3W2KA 2R1MA 2HV5A 4S3EA 4EANA 2WPGA 1QPRA 3S2NA 1NAL1 4UQDA 1WKYA 2DP3A 4GQQA 2P8CA 3M0MA 3KCLA 2PMQA 3CAKA 2A5HA 4X60A 3FK4A 1K9FA 3FHAA 3R58A 1HP5A 1OM0A 4AMAA 1W3NA 4GI8A 4XD6A 1VD6A 4O1BA 1H51A 1Z42A 5D8ZA 3UW6A 1O4UA 3EDDA 1PV8A 1VH7A 1ENUA 1ZSXA 1U30A 4QJ1A 3LPFA 5F2IA 3PG8A 3HTWA 4PMUA 1V6UA 3NL2A 4P7QA 1ZQ5A 3DERA 3CIWA 3KP0A 3GDTA 2RDXA 1E6QM 3GAKA 3AXIA 1KCLA 4UIOA 4AZHA 4F48A 4OHQA 3SUTA 4ZFMA 2ZVIA 3H2AA 3ATYA 3TIMA 2G3NA 1F73A 2ADAA 2A3EA 1W3IA 2AL2B 1DOSA 1FH7A 4YPJA 1FY6A 2O9OA 2QLYA 3E2VA 1JRCA 4RW3A 4JCLA 3SSZA 1BXBA 5CAHA 2JIWA 1RVKA 1MQPA 2NQLA 3O16A 3MSGA 2DW7A 2X2YA 3OODA 1FKXA 2YPIA 3N19B 1XR2A 3P8IA 5FJUA 3HFTA 4ZE4A 5H2ZA 4Q8NA 3TWBA 4R7WA 2ZUSA 3N6JA 1UHVA 5T26A 1R30A 5BXRA 3SGZA 2EKCA 1N82A 1KGUA 3BLKA 2NV9A 1CENA 1R2SA 2VEPA 3JR2A 3FYPA 2A2IA 1DWHM 3VKDA 1UWRA 4WD0A 4GO9A 2CLHA 3WLSA 4CNOA 1Q6EA 3C8NA 2FVMA 3GW3A 1V3MA 1ZENA 1E9YB 3CWOX 4GUJA 4MWAB 4C7FA 4BWLA 4UFMA 1OFDA 5GNYA 3LCHA 5FAJA 3GHRA 1ITUA 2E9LA 3EAUA 3QPZA 4LUTA 3CO4A 4OTKA 4LCSA 3FSUA 3WNMA 1UWUA 2I1OA 4PYSA 4EACA 1MQRA 2BLEA 3S5NA 5I5RA 5I3IA 3PPCA 3ZT6A 4UTKA 2R82A 3M0XA 1W3JA 3NWRA 5D2XA 3G1VA 5LHFA 1WDWA 3SJ3A 2BVYA 1SO4A 4CQAA 1US0A 4QDMA 1JPDX 1ZL1A 3AIRA 4YNGA 4FX7A 1TTJA 3I3DA 1YMYA 3KRSA 3MJMA 1JD7A 1SMDA 1BRLA 1ZJIA 3PS7A 4Z1DA 1MRQA 1KXHA 3TSDA 3H55A 4MNKA 4LNYA 3KL5A 2VZOA 4ACZB 1MEIA 2JEPA 3PZTA 2FZ8A 1Q65A 1E6ZA 1O68A 3V75A 4XZBA 3VZYA 3LCWA 3RX4A 2D0FA 4DBDA 1CYGA 1UIPA 1IZKA 5AVHA 2ZZ4A 3IIXA 2C13A 3IJQA 1E56A 4JD4A 2V2DA 1KA9F 2R1PA 2W27A 3VOJA 4M1RA 2PA6A 1Q4NX 3H53A 3WQEA 5AHMA 3VDBA 1A49A 3J7HA 1B57A 3OVGA 3LCGA 3KRBA 2FGLA 1MYRA 2V82A 1EDQA 4C6LA 1FWSA 4HGXA 1Y65A 4XK2A 1I1WA 3O7UA 4NNAA 3BLPX 2OZ0A 1BHGA 4BY3A 3KLKA 2IS7A 2E7FA 1ICSA 1NFBA 1PWLA 3MJYA 2Q3RA 4BA0A 1N55A 4KRUA 3WF0A 1H09A 2V69A 3AHZA 2QPUA 1HJWA 1MW1A 4M1BA 3GE7A 3WF3A 1SFTA 4IFKA 4HYRA 3QKZA 3H2EA 2ZUNA 4XBSA 5BOOA 4ATLA 3UZWA 4RX0A 2ZWZA 1RQHA 5H8MA 3N2CA 4WZHA 2ZXQA 2EG7A 4HK7A 2VVSA 4GXMA 2V67A 3T7VA 3VIMA 4F0RA 1K6AA 1KKRA 3MHUA 1GVEA 4NASA 2OO6A 3IJ7A 3GXTA 1O60A 3NFUA 4L65A 1FWTA 4R9OA 1EOKA 1UR0A 2NXGA 3TJ4A 5D02A 2X8RA 3QQWA 4IMFA 2CFFA 3QHOA 3CT2A 2ISVA 3WD2A 4CQ9A 4I8DA 3M7WA 3EWWA 3BICA 1OF8A 4LJ3A 3CC1A 2F84A 3UR8A 5LNVA 3UR5A 5IXEA 3OHMB 5FL0A 3HQNA 4QAWA 2NX1A 3RX3A 3C2VA 4FNTA 2NZLA 1LWJA 2VGGA 3I7RA 3SQSA 4AWSA 3WFAA 4QE5A 1OC5A 3W74A 2HTMA 1LWIA 1CGUA 3N12A 4GMEA 1YKWA 4O1EA 1JD9A 1FWRA 1OADA 5AYYA 1SM9A 1R46A 1LOSA 4MY9A 4XD3A 3VIIA 2DW6A 1XC4A 1POKA 2EEXA 2EO7A 3GD6A 4UTWC 4C6FA 4R7OA 1RXOB 5IOBA 1CW2A 4BI6A 3AS1A 2BY1A 1DV7A 1NEYA 1W8SA 1JYVA 2AGKA 3PAJA 2E1DA 3U4FA 2WVTA 5I79A 1LTDA 3U2CA 4LY4A 1TTIA 4K37A 1RAKA 2DT0A 4P7RA 4GIYA 1YBQA 4GJIA 4NY2A 1GT8A 1ML1A 2ZQ0A 4HHLA 1W5MA 2YYUA 4GQ0A 3SAZA 1EPXA 3LD5A 3HGOA 3EKGA 2Z24A 2G95A 1UR4A 3C3UA 2P5NA 2DH2A 5M5DA 3G1YA 1WZMA 3B9NA 4QEHA 4U3AA 1RBLA 1A4LA 5LGXA 5LIUX 4UFIA 3HU7A 4JIIX 1KM2A 3UBPC 5CSRA 1LWHA 3OZOA 2E5BA 4DO6A 4HSHA 3KWXA 3ITCA 4ZXLA 2RJGA 4UTFA 2J24A 3W84A 1K1DA 2ACRA 3MZ2A 1MUWA 4C6DA 1JR1A 3MMTA 3NGFA 2Y7GA 1W9PA 1G94A 3S1VA 3DFOA 3F4VA 5REQA 3FVMA 2Z4GA 3AYRA 4PTXA 5U4NA 2YA1A 2VQUA 1NP2A 2VNCA 2BTMA 4NNCA 3BQ6A 3G0SA 1OY0A 5BMXA 4HKPA 3BJFA 1LZOA 4IFOA 4KQNA 4QLJA 2Y88A 4NKCA 2BHZA 3KOXA 4JTEA 1LRQA 1LG2A 3FXYA 3ZQ9A 3SADA 3V0SA 2NSOA 3A13A 1PZ2A 5D8WA 7REQB 1QATA 1E3XA 3M0IA 2ZCGA 3LPPA 2IPJA 4AAJA 4QTGA 1EC7A 4N02A 2ZE3A 2WVUA 1B3ZA 3TN6A 2J7BA 4H9UA 1C8XA 1WBJA 3LMYA 3P82A 3IRSA 3D6NA 2ZUVA 1GPFA 3N2TA 1KM6A 1OK6A 2E8YA 2V5KA 1JCNA 3W7LA 1IXQA 2WNZA 3D3FA 3KP1A 3RYSA 1KGXA 3L7RA 1JQVA 1OG6A 4J7RA 4ATWA 4PRRA 3LV6A 3THQA 1PX4A 4W7VA 3M44A 4L4LA 4CNSA 1WOAA 5HWNA 5K2ZA 2P76A 1BVWA 2WKJA 5I07A 3GVVA 1BD0A 3C2OA 3W9ZA 3ALFA 3GR8A 2W92A 2FHFA 4ZGYA 1D7KA 4HOZA 3W1PA 5JUVA 3LTYA 4LWWA 3ARYA 1GG0A 2NUYA 1OFRA 1D2KA 5G2IA 4DYEA 5A8GA 3THDA 2HVNA 5A8QA 3QY6A 4ZR8A 3T4WA 3K4AA 3MUAA 3B0PA 5KZEA 4ERAA 2G5WA 3YPIA 5B80A 3FN9A 3KEHA 4LF1A 3AZTA 4L4PA 1XFBA 3RM8A 4Z1YA 1KFJA 3GHTA 3KL3A 4HU4A 3W1AA 4M6PA 4WY0A 4R9XA 1XRFA 2A0NA 5LIXX 1K6WA 3OLIA 1XD0A 3WK2A 2VCAA 3DECA 4GNKB 4U31A 1UC4A 3B8UA 1T6MA 1WA3A 3EDKA 4JTLA 1UYQA 3W70A 1R86A 3ITXA 4A6GA 1OCJA 2J7HA 2WM1A 3GKFA 1QNOA 5TBOA 1UR1A 2ZRXA 3GTXA 2J27A 2YB1A 3OTRA 5DT7A 4BKNA 2DUZA 1HKWA 4MY1A 1KKOA 2QVHA 3GNRA 1I45A 4B92A 3F5LA 3VAVA 3AO0A 2FHBA 5KMYA 4DAIA 3WJXA 4D6IA 3HPSA 2BOEX 5KETA 3CUZA 1W3HA 4CCCA 1YPXA 1CXHA 3NPXA 3WLQA 3FLUA 2J8GA 3M0KA 2QIWA 3U2EA 4DX3A 2VVNA 1P6CA 3WD0A 2OR2A 1G4EA 2YW3A 3CHVA 2GFTA 1WDSA 1QOPA 2FVLA 3TLLA 2VEFA 3ZS4A 1SFSA 4A3HA 1UR9A 3QTGA 5C0QA 4DQWA 2EG6A 5AYZA 4HJWA 2ZE0A 4HT3A 1R3QA 1L6FA 4H41A 1B9BA 4QM1A 3ZVIA 1CXKA 3SZ8A 3RGTA 2PWDA 3ZM8A 3AIVA 2DZPA 1ISWA 2ZWYA 4O57A 4GCXA 1CXFA 3VMPA 3UG3A 1NWSA 2FZNA 1FWHC 4Q33A 1ZRQA 2J8FA 2H9AB 3T6CA 3T40A 3FYOA 4NI8A 1E1CA 3T55A 1RCQA 4MNJA 2HPMA 4ZCWA 4J28A 5H1WA 4KEUA 4WDWA 3L9CA 2YLAA 3GS6A 4DB7A 2YSWA 1GQIA 2J6VA 2Y5JA 1WAWA 2DV0A 4L1WA 4W7WA 5A6AA 2VURA 2JK2A 3TUUA 2CU0A 4JTUA 3BCFA 2BHYA 2PDFA 3H6OA 3ZJKA 1J6PA 1LRNA 5E93A 4GFIA 4GVGA 2CHRA 1P0EA 2XM2A 3GC5A 4GJJA 4RXFA 3ZFHA 2YCIX 4JTHA 1U1JA 1AMYA 4I9TA 2Y63A 4H6QA 1LLWA 2INZA 2CXGA 1ZCCA 3PJWA 4QE4A 2YBVA 5HR7A 5LHEA 2HPIA 4UCFA 5HMDA 5TQLA 3W25A 2WKLA 3E49A 3UWYA 5AFDA 2BX7A 3T2OA 1EGZA 2NQ5A 1J9YA 2HXTA 1UZ1A 3E2RA 2C6QA 3BQ5A 3ZVHB 2Z0IA 2VTFA 3GKAA 5F4XA 2DORA 1EHNA 2HVOA 3O2LA 1XIBA 1YXDA 4E6MA 5J04A 5RUBA 4R33A 1TQJA 1VJZA 3C2FA 3CZGA 3EXTA 2RFGA 1XLIA 5JU6A 3WN6A 3DESA 4FK9A 4CN4A 5KZMA 4KWUA 2PGWA 3RLUA 1VQTA 1JFHA 4REQB 4LXFA 3TWAA 3OO2A 1JCLA 1YRRA 1VHNA 2HK0A 5AOUA 2G97A 2KZHA 3VM7A 2JF6A 2CIPA 3KLLA 3L5MA 3S9YA 1JEZA 4Q8UA 2UBPC 3G8EA 4PTMA 4AWEA 4QG9A 5FEZA 3GM8A 1RBOB 4JY8A 2YDAA 1B30A 4ICNA 1UWIA 1A5NC 1TKKA 2JGQA 2VDHA 4O52A 1UROA 1GOQA 1KD0A 1ZHAA 1PHQA 3W6YA 1MW0A 1RPKA 2VD9A 8XIMA 3AMDA 3HIJA 3JUGA 1FFRA 1FHDA 2EGZA 3G77A 2HS8A 2ZUUA 3VUSA 3CNYA 2ASHA 3S1GA 4BFAA 3GXMA 4Y9AA 5DX7A 3HQ1A 3NSNA 4CVWA 1LUCB 4UQEA 4E2DA 2CNCA 4IGSA 4DWSC 3PUOA 1WP6A 3PFRA 3ZIZA 4Y9PA 1ISZA 3V4BA 3K46A 2IPGA 1WKFA 1XGEA 3H2CA 1GOWA 3MVIA 3M16A 1TA3A 4D1JA 4M6UA 2PP1A 1LL4A 1O5XA 5SWUA 3AWOA 1ITXA 3PF3A 2REQA 5I6SA 1SSGA 3MSRA 3TJXA 2PB1A 4Q8PA 3DAQA 1M04A 5FF4A 3CQJA 1W56A 1JPIA 4HBKA 1P7TA 2B0MA 3GNDA 2GJXA 4AD4A 4UQBA 3L4WA 2ZRWA 5AC8A 3USZA 3KBWA 2QCDA 4TV6A 1O5KA 5TF0A 5AECA 1I75A 4LVDA 2ISFA 4AC7C 3I10A 1BWVA 3WUBA 2DZVA 4CCEA 4WQ6A 3QMSA 1HKJA 3WLPA 2WNWA 3GXDA 2GYIA 3E1F1 4N42A 3H4XA 4IMEA 3H23A 4HVXA 4PUWA 4HNLA 3OJGA 5DCBA 3TNOA 4DN1A 1P48A 4IUOA 3BLDA 2DGAA 3CZEA 1CCWB 2R8WA 4C6IA 3LHZA 4NXKA 2QJNA 3QPEA 1TREA 9CGTA 2WMHA 3HF3A 3VDAA 4F3HA 1XBYA 4AZCA 3SUWA 2XVPA 4JTKA 5DT5A 3NDZA 3WL0A 3H4GA 1BGGA 1QNRA 2IKGA 4GX8A 3ARZA 3QW3A 1EX1A 1XWYA 3A12A 4YJ5A 1CGXA 2WM0A 1Y8BA 3UCQA 4MKSA 4N6FA 4AD2A 3IUIA 4OV4A 5GPRA 4MPKA 5HMEA 3BMXA 2XYLA 2E4TA 1AJ0A 1VBHA 4H3DA 3T07A 1O7AA 2RH9A 4IF2A 3LNMA 3QHNA 5JMUA 4Q3MA 3UJEA 1AD4A 3UNDA 1DBTA 1A3HA 1H60A 3NL5A 4NHVA 1P5BA 2PRLA 4IQLA 1UCWA 1JJKA 1GCYA 4K8HA 3U2ZA 3DDMA 3TX9A 4FX8A 2YA0A 2PTZA 4QROA 1VCGA 5I3FA 1N2VA 2WZEA 1BYCA 1ONEA 7ODCA 4FPSA 5IFTA 1GOIA 5CPMA 1QVBA 1PXGA 3B0UX 3VX1A 3UJRA 1J0KA 2YFOA 1FOBA 4IISA 3EEGA 3WLIA 1Q6DA 4M29A 4GBDA 1YNPA 2OT1A 3G0XA 3VU2A 4UBPC 2OEMA 2XWDA 4R7JA 3T0DA 3A3HA 2RDTA 4Y7EA 5HXMA 3GNNA 4UWMA 1PX3A 4PMZA 4KCVA 3SR7A 3IS4A 3RU8X 2PGEA 3WLKX 4W8AA 1PIGA 2Z2AA 3A4JA 4O0QA 2XIMA 2FFIA 5K9DA 3A47A 4E4UA 3ARXA 1MZRA 1ZP4A 2VDGA 4NAEA 4YTQA 3HPXA 2W63A 4AYGA 3FHQA 3MP3A 4EK7A 2ZUWA 1JPKA 1O5RA 2GJRA 3H2OA 2OSXA 1NOUA 1HKKA 4YYCA 1RLDA 3VNDA 3AALA 1XG4A 3LPGA 1CXIA 1KR1A 1V79A 2AQVA 2JF7A 3N73A 4AY1A 4WRHA 2A1YA 1UMLA 4JL2A 1E9IA 1GKRA 1TPB1 2OQHA 4L61A 4BEQA 3E0VA 4MNMA 3E5BA 1NM9A 2A3BA 3GB6A 4IMDA 1J10A 3C52A 2ALRA 1EQPA 4YS1A 4PFMA 1RJQA 3ES7A 1YDOA 2XUCA 1JI2A 1NJJA 2ISWA 2FLIA 3BLOA 1VP5A 3WELA 3CEUA 4KW2A 1EWEA 4R53A 4V1XA 3M6DA 5XIAA 1AQ0A 3W7DA 4ZL1A 2BOFX 2DZXA 4JFWA 2XIOA 5K3VA 3NPUA 2PD5A 3GUWA 5LXEA 3IIZA 4HNVA 2CXEA 1E5NA 1YE6A 4GVIA 1D3HA 3QBUA 2V9DA 4GYJA 4US5A 3CL6A 4GC4A 2HE5A 2Q8ZA 3QY7A 3SFWA 3NO1A 4FNRA 2CPUA 1OYAA 4U5IA 4FOKA 2NX3A 3UCDA 1GKQA 5JBDA 1OVDA 4MY8A 3PNUA 1UZ4A 4AIUA 2Y6ZA 1TVPA 2QCEA 3XINA 3H24A 5EB8A 3XISA 3DXIA 3QZAA 2CZDA 3V0UA 2QXWA 1JDAA 3BDKA 1IF2A 3ZXWA 4W4QA 2PBOA 4O1CA 3HG2A 2EPKX 3ANUA 1IGSA 5I00A 2HBVA 4C1LA 1E4NA 4MTVA 2PGFA 3MZNA 5D32A 3WQ5A 3C2EA 2CLEA 1IHIA 1RZMA 2DVTA 2V2CA 4ROQA 3VIFA 1V6TA 4G7FA 4UR9A 1JYXA 5F4WA 3LYEA 4U2YA 1DJYA 1UBPC 4UTHA 3M47A 3NZGA 2GK1B 5CLWA 2WWDA 3W7OA 1UJPA 1PZ0A 4FIQA 4WOZA 5LKYA 5LNUA 5MKGB 2WANA 3LRLA 1B0IA 3QGVA 2PS2A 3NDOA 4RE3A 3W28A 3AMLA 3I7QA 3EX2A 4U10A 3ERPA 3SRKA 1FDJA 5I03A 2Y85A 5H8UA 3EEZA 1CGTA 4DO7A 1I4NA 2XM1A 1VCVA 4JNZA 5CC6A 1XX1A 3H2MA 2AMGA 4L7ZA 2D23A 4B5XA 1EH9A 3LBCA 3WK0A 9XIAA 4Z42C 3VI2A 1VZWA 1A0DA 1F4AA 4AZBA 4O16A 4Q7IA 3N29A 3QYQA 1GOOA 5D9OA 3GLCA 3U57A 1AVAA 2QUTA 4ZODA 2PRMA 1U5JA 3G18A 4RDWA 3WK3A 2Z1WA 2GQ9A 4HMDA 1K8XA 3BW4A 3MQTA 1EJUC 3CHDA 3THCA 2D2JA 1AZ1A 3VNJA 1G67A 3EWUA 3SCPA 1BXCA 1ZAJA 2WKGA 4B5TA 5C8BB 1I1XA 4DJFC 2X7VA 1W9UA 3S1XA 2ZZ5A 1TPEA 4P7OA 1GOMA 4HYVA 1KRBC 3M7SA 3NQ7A 1O66A 1R5YA 3W7IA 1SQ7A 4NAEB 2C14A 2DZWA 3KTXA 4WKFA 2XH7A 5LIKX 3LNPA 4DJEA 2Q8XA 4A8RA 5GQBA 2WJDA 3PUEA 2CKSA 1A4MA 2ZRVA 4ZSUA 4N4PA 2UY2A 1UQYA 4IGMA 2O0TA 3UWQA 2J7CA 4WF7A 1GWJA 1UKSA 2WCGA 4ZTXA 2PURA 2PTXA 1XYZA 2F8QA 1BGAA 2W0UA 2BXZA 3O0KA 1W2VA 2JKPA 4TMBA 4XG1A 1AJ2A 4IMAA 5I2UA 2OELA 3LGDA 1WXJA 3B03A 2AGTA 3KOWA 5BWAA 5AKQA 3K1GA 4YCOA 3K1DA 3M9YA 1G4TA 3IIVA 4MFDA 5AHEA 4O12A 3L65A 5IBXA 5LZLA 5LXXA 3I7SA 3B40A 2E5CA 4D9PA 5A94A 3VNLA 1WZKA 3BG5A 4PUEA 3W1NA 5CZKA 3OIXA 2AQWA 5K7JA 1XKYA 1UD8A 4QS6A 3WNNA 5DBTA 4XBKA 1EFZA 1X6NA 5CGQA 5CBBA 3LXCA 3NZQA 4LYRA 4LAKA 2WVVA 3WLRA 1JZ6A 1RD6A 3NQ8A 1FH8A 4U28A 3QKEA 1I2PA 4MAZA 5C7HA 2G3FA 2PAJA 1S5WA 4TTGA 1QO5A 2PWGA 2G50A 3WYZA 3OZYA 3W1UA 3FAXA 2ACUA 1HN1A 3C2RA 4OIFA 4EIVA 1V77A 2YDQA 2ZA2A 1YADA 4NZFA 2R6OA 1G4PA 4MUPA 4ZOCA 5J5RA 4IIHA 3S2CA 1BFNA 2BGQA 1GYNA 2AMXA 4GKLA 3UZJA 1TV4A 3MUY1 3WDQA 4GUHA 3PWIA 2PBGA 3TYBA 1Q6FA 4WUIA 3PC0A 3W22A 1ADSA 1F8IA 1YXCA 1QT1A 1UD6A 2QNEA 4E4PA 4IH3A 1QI0A 4QS5A 4RCXA 3W24A 3ZLFA 1R2TA 3OLEA 2QKFA 2GWGA 1YTEA 4LPCA 3HPFA 3CU2A 1XFCA 5E6YA 3PZNA 1PIFA 1XIGA 2P8BA 3GIYA 1E72M 1VRDA 4A35A 2VR5A 1E3ZA 1ZBCA 3LLXA 5CZ0A 5EMYA 5EMMA 1AA1B 3URBA 3DG3A 4O10A 3GTHA 4CEUC 4IQDA 4M0XA 3EGJA 4JTDA 4NQ1A 2VENA 1FP9A 1V3IA 2WZTA 4OU1A 1X39A 4WGXA 2EG8A 1V6WA 1UKTA 4HMEA 3W23A 2YCKX 1VFFA 2QCNA 4B5VA 3UYIA 3ABZA 3WEOA 4DXVA 4QJ5B 1KM5A 2YR1A 4XWUA 2OZTA 1O1HA 1HGYA 3RO6A 3F4CA 4H9ZA 1EO5A 7XIMA 3UXAA 3W81A 1H3GA 3JVAA 4NRRA 4EPBC 2VM8A 2GGJA 4X9SA 4ZO9A 2GJLA 4ZQMA 2ZC1A 2DIEA 3B8IA 2OEJA 2J13A 1PDZA 1TO3A 5E6ZA 4KBXA 4PCFA 3UU0A 1V02A 2BSLA 3BAWA 3N9KA 3T81A 1Q7MA 2WLYA 3APYA 4O8RA 1W8GA 1XLAA 1M7JA 2DSUA 4DY1A 4HPJA 1UBSA 2HZGA 1VF8A 2E40A 1EZ2A 2NV2A 1L6GA 1W17A 3MW7A 1M6JA 3VDGA 1E55A 5FF3A 1US2A 2POTA 2P10A 2QPXA 3ZWTA 4D6CA 1TA3B 3HV9A 4M81A 2X1UA 3HZ3A 3W71A 1QK0A 3QOMA 3D3AA 4BF5A 4LY8A 2D3NA 1WUFA 5DANA 1OGGA 2J62A 1Q6RA 4IPJA 5I0DA 1VIWA 2CLIA 1A80A 4OBSA 3UPWA 1OD8A 5ABGA 4GOAA 3IGSA 2IQTA 3E12A 1VPXA 3KOYA 4AHPA 2GVEA 4PL1A 3NSMA 5FESA 4AIEA 2V2HA 3UF9A 5CSYA 3MO4A 5HQLA 1JNEA 4OWGA 2D69A 1NU5A 1FWDC 4GH3A 3WY1A 3POHA 1IXPA 3O6DA 2R94A 2F2HA 2DUXA 5MKGA 1E40A 2ZZ6A 1B54A 1J0HA 3K30A 3RJXA 3CUIA 4GGBA 3GY1A 1UD3A 1J12A 4X2PA 3L23A 3AC0A 3M41A 4AXNA 1LRTA 2BS9A 1W91A 3SI9A 2WCSA 1QBBA 4F40A 3TDFA 2PWFA 4LB3A 2P3EA 4IP7A 3ZLHA 3MCOA 4JTJA 1VEPA 1MNZA 3VD7A 3NAVA 4UUIA 3UWUA 4H9MA 4ICCX 4LFYA 4A2SA 1PBGA 1DJXA 2YFNA 3PY2A 2QDHA 4DUWA 1B3YA 1DWJM 2FTYA 2CWXA 3GU2A 2QVNA 4W85A 4GVFA 3W38A 1BQCA 1OINA 4K8EA 1R3RA 3NEVA 1HJQA 4F9DA 1Q6CA 2BY3A 3W76A 2ABBA 1L0PA 3M4HA 1SO3A 3IUDA 2PLKA 1NFPA 3JU2A 2X40A 1ITCA 1SPQA 3HJZA 5D2YA 1JULA 2TMDA 5A95A 1PHWA 3BJTA 3AZRA 5JQ9A 4EWJA 4P7NA 1D8WA 3CASA 2R1NA 1NDWA 4JL1A 4TQTA 3H4WA 3AMKA 2DT2A 1OCBA 4JGDA 5JVLA 4F2TA 4QGCA 2ESCA 3F2CA 4H7ZA 3MKVA 4IPLA 3N25A 4Z08A 2OG9A 4GQRA 1DYSA 3TKFA 2Z2BA 4MB1A 4HNTA 3CQ0A 1V4YA 1NDVA 1MFUA 2OWWA 4GRSA 1SR9A 2VXNA 4UOZA 3NXLA 3I3BA 3PTQA 1A5UA 2POZA 4L9YA 2UZ9A 1JZ2A 4LS1A 3STPA 3O1NA 4UFHA 4GIAA 2I57A 4B2DA 3F2DA 5L6UA 4D6DA 3N17A 4FS9A 1B3XA 4ONVA 2J4GA 2OSWA 4HU8A 4QSHA 3SUVA 4YL2A 4H01A 5G4HC 2Y7EA 5K4ZA 1W1B1 5HANA 5FOOA 4ADUA 3G5EA 4QJ3B 3VABA 4DUXA 3RMEA 1G6CA 1AZ2A 3AYVA 1QPOA 3DC0A 1H1NA 4DJFA 1DWFM 1TIWA 5AC5A 1K8YA 2E67A 2GVGA 1A5MC 2IKIA 3OYZA 3ZWSA 4AEOA 1WX0A 1MW3A 4UOQA 2R24A 2WXDM 2PC4A 5HOSA 3ELFA 3QV9A 1WXYA 2EPMX 4OBTA 1R6WA 3N2BA 4M56A 3T0CA 1XQKA 1FHLA 3BURA 1DE6A 4IIDA 2YCEA 3CO8A 3QXBA 3GR4A 2VFGA 4IZGA 4JYEA 3T8LA 2PDJA 3FXGA 1IR2A 4B5NA 1OABA 1JPHA 1K03A 1HQTA 3VOIA 1NP0A 1HJUA 1O12A 3FV9A 2Z00A 2RUSA 3MMDA 3BAJA 2WOQA 3QTPA 4LQ1A 4S3CA 3NG3A 3H26A 3BG3A 5DEZA 3KBNA 4BEUA 5D37A 3UVIA 4FSAA 4AWTA 4EF9A 3K2GA 4HCHA 5CC5A 1IWPA 1OB0A 3BZJA 2FH6A 2C91A 1TG7A 4OFCA 3AIWA 5I7GA 3O07A 1A5SA 4X63A 4DHGA 3MCMA 4F8XA 2NQHA 4J5NA 3C56A 2PCEA 4YWSA 4EXQA 3EYPA 1JQXA 3REQA 3GG8A 3O8AA 4DNHA 4S39A 2O7QA 1LT8A 3WQPA 3TR2A 3CTLA 3C3NA 4PZVA 3P61A 2JFEX 4AZCB 1FHUA 1UZDA 2RJHA 1VBGA 4JNMA 2ZXBA 1QPQA 1JYNA 1CZ1A 2F6KA 3DG7A 3GH4A 3TYDA 3KTCA 1XS2A 3UPMA 1HF6A 3VCNA 3VPLA 4DWSD 2YL5A 1XRVA 1VFHA 1KXVA 3CHCA 4FNQA 1BLIA 2O7SA 4JFVA 2I14A 2QEZA 3CQHA 4FXJA 2NXHA 3UFYA 1A5KC 1VJSA 3W7NA 3CV1A 3NQ2A 1OYBA 4WSJA 4GLEA 4V1YA 3V5FA 5GJPA 2Q3OA 3QV7A 4GYFA 3KTSA 2EPNA 4MLRA 5E70A 3WQDA 3NM1A 1GVYA 2Z6IA 1SO5A 4JTIA 4PMNA 5M3WA 1Y5XA 1NH6A 1B1YA 2EBNA 5LIWX 1QHOA 1H61A 3IGHX 1PCKA 4IGHA 3S2LA 5C71A 3CZKA 3NDYA 1R3VA 4BF7A 2VZSA 3B05A 4B16A 3NEHA 4O4WA 1Q4WA 3Q65A 3RPTA 1E4LA 2VZVA 4JY9A 2X16A 1D8CA 5B7YA 3WNPA 1JDFA 1HL8A 2X09A 3U7BA 1W1A1 3VCCA 3EKZA 1W1PA 2WHJA 1Z6KA 3HG3A 4E8GA 1B5TA 3KS6A 1GVSA 2QF8A 3QGKC 4M82A 2PDWA 1MEHA 4JX4A 3TYCA 4V33A 4XIMA 3ARTA 4OOZA 2FJKA 4U2ZA 1AODA 3LEPA 2J9ZA 3SY5A 1R7AA 1B4KA 1UZHA 1JZ3A 1SJAA 5CZJA 3AISA 3CJPA 2X1SA 2ZA1A 1TPDA 2FTPA 4X9YA 3SCWA 4IMGA 5CGTA 2VX7A 4EF8A 3KVJA 4PUNA 4IHCA 4R3UA 4F66A 4EVZA 3OZPA 4S3FA 3GDLA 3BLIA 1CEOA 1BSLA 3G6MA 4YHEA 1V08A 3WL1A 5C2CA 1EIXA 1OF6A 2WLZA 4GIRA 3WMSA 3UA3A 2GQ3A 4US6A 4PCTA 4PSPA 3WD4A 3IGXA 4K36A 2NWSA 1E9LA 2GPTA 4XZNX 2DZSA 3R11A 3W88A 4B5WA 3B8SA 1POJA 2WC3A 3L4VA 3DX5A 1F4HA 3H12A 3L66A 4KGJA 1XINA 2J88A 4ZOAA 3CUHA 3BAKA 3DFQA 3MPGA 5CH9A 2XN0A 3MMUA 4DUOA 5MHBA 3RDKA 1S3HA 4GI4A 1TPWA 4JTSA 3L5AA 4BQ2A 1YHTA 2GSEA 4PCNA 1IQ8A 1EP1A 5HAOA 3QN3A 1AH4A 3VZZA 2Z26A 2PTYA 1TPFA 1F3TA 3VC6A 5EYWA 3TFCA 4A29A 2DZTA 4HSNA 3V0TA 3NOEA 2IXUA 4UNIA 3E0LA 4QCEA 5E9XA 2Y5SA 3N2XA 4RZ4A 4Z1BA 1J2BA 3MDUA 1PYMA 2XH0A 3ABRA 2RGLA 2XIJA 3GQYA 3F5KA 1VCFA 1MXGA 3CYJA 3NVDA 5D9MA 2D24A 4M8UA 5HJYA 4QEEA 4NX0A 4FLOA 1UIOA 4AZGA 4JFSA 4Z2IA 4LYQA 3PTDA 1XGZA 3O0FA 4AVOA 3L2IA 1EP3A 3I4EA 3W7HA 2BY2A 4I9MA 2QJHA 4O28A 3FDGA 2VUNA 1JPMA 1V0LA 1J4EA 2XSBA 3ZOAA 1KRAC 4E2OA 4IUGA 4RNHA 5A69A 3TU9A 1B31A 4BCEA 5AY7A 3AFBA 4RPPA 4QISA 3O06A 1CBGA 1UASA 2OB3A 1KM3A 4HPGA 4MG4A 1TTQA 3WDIA 4HMNA 3CUJA 4HQVA 1JAKA 4YWIA 4JCMA 3UY8A 4G7EA 3L5LA 4LS0A 3PZ9A 3V7PA 4PUUA 1XYLA 5E0KA 3NQGA 2DEPA 1ME7A 3ANYA 3IJLA 1X6LA 1BPLB 2ZDRA 1UH4A 1TV2A 3B0YA 3PBWA 2PUZA 1WB0A 4N7QA 3MI3A 3UCCA 3JRKA 1Z44A 3A4AA 4M3PA 1E1EA 2OGJA 3OGRA 3WQ4A 3KBSA 2ODOA 3DCPA 3M5YA 3R8HA 2YBTA 4TMCA 1S5MA 5EMJA 5DLCA 4E38A 1OX4A 3PTMA 3V5OA 3ZJ6A 3ZT7A 2WZHA 1EUAA 5HBFA 2WJEA 3LM3A 4QNWA 3CGTA 3IJIA 3WLTA 2WSPA 1TUFA 1J5SA 2BGNE 5FA5A 3KAOA 4LUSB 1K7EA 3NPVA 1V8EA 1M7OA 5A8NA 4NYYA 2Z27A 2BB0A 5CSSA 1KBBA 3P2VA 3PM6A 3IWPA 3M43A 5A2CA 3W86A 4UNKA 1H7XA 4GY1A 2ABAA 3MT1A 2QUVA 3DI1A 3TTYA 2XFFA 4ZQPA 3W7KA 2V8ZA 2ZKMX 4RW5A 1M7XA 4EKJA 4UTIA 3CB3A 3G1RA 2PTDA 2PDBA 3W26A 3UNTA 3S6TA 1AW5A 1MZHA 3HPAA 3ZZ1A 5CPSA 3A22A 3HG4A 2GUUA 1ZZMA 1RP8A 2DJXA 4GK8A 4BQ5A 3NVTA 2NLYA 1GZJA 2DSKA 3AU6A 2YGYA 1EF3A 1ZS2A 2GQ8A 1MQQA 3CLMA 4EPKA 3A9IA 4I90A 3CHFA 1UPMB 4KEVA 1NY1A 4DBSA 3RN6A 1EA0A 3WKZA 1Q13A 4LYPA 3W7EA 2UV8G 1ZBWA 3S2MA 5JBEA 3UERA 3PFMA 3IARA 2OTDA 2XFYA 4GKTA 5BU6A 3R94A 3UXIA 1Y7VA 3WF4A 4HNNA 1KLZA 2F6XA 5EMKA 3UJSA 2NQ9A 2Z7GA 3TJIA 1R0MA 1Q3NA 1SYTA 3S6OA 2FMOA 1T8XA 3VX0A 5F1VA 1ZJBA 4H7CA 4O18A 4IIEA 2XWEA 5BWFA 2ZIDA 5HWJA 1V7AA 5JIWA 3OBEA 1I2QA 2NVCA 3IK2A 4RE4A 7TIMA 4DAFA 1AMKA 4B2DD 3RRAA 2C1HA 3L4YA 2NT1A 5LSMA 3ECQA 4F0MA 3N9RA 2J7DA 4I7WA 3BL3A 5I3GA 4LOCA 1UR2A 1P7TB 1IR1A 3ZYZA 4AFYA 3K13A 3VYLA 4MKNA 5D4YA 1EB3A 1WBHA 4AX6A 5HULA 3SDOA 1V7YA 4M6QA 3BVJA 3K8KA 3CPRA 1I2RA 4R88A 1AQHA 4Q8VA 2VGBA 2IUZA 1PKYA 3B3DA 1DXFA 5A6TC 5FI8A 3TN3A 5HJLA 4AB4A 1JUBA 3LU2A 3L4XA 4X0VA 4MFEA 4GY0A 1GVQA 4JR5A 1XCFA 4CNPA 5KZ6A 4ENLA 3ZR6A 2FYMA 4UMBA 4AVFA 3AXXA 2VFHA 3QOKA 4N9EA 3A9BA 5FF2A 1UB3A 4B3KA 1TX2A 2W9MA 3TLQA 4V15A 4KS0A 1N7KA 4PCPA 1DQUA 1VFUA 5JXQA 1F8MA 3DU0A 4KFOA 1SZRA 3L4TA 4DPQA 1H7NA 4LV9A 4CLMA 3WH7A 4PCSA 2VOTA 1M03A 1KM0A 2AL2A 2EHHA 4KWWA 5C9RA 3TH6A 2QF7A 3NL6A 2WNNA 5DRCA 4C1KA 4PODA 1SW7A 1S5NA 4N6EA 3RMJA 3MDWA 1BG4A 3WQFA 4B15A 5I78A 4ZOEA 4XVDA 1FWEC 1LF1A 3S4TA 3UXKA 2DVUA 1LYXA 2WMJA 3DOPA 2ALDA 2W66A 4XSMA 3L0NA 4ZZ9A 1Q2RA 7ENLA 2ZX8A 2VO5A 5BOFA 3ARQA 3GVWA 1KGWA 3Q37A 4IQJA 4DLFA 2MANA 4PGLA 2FJUB 4J3ZA 3S3GA 1XLKA 4JQ3A 2J9YA 4JEJA 1IIHA 1VLWA 1W9XA 3C86A 1X8CA 2OJPA 3VIPA 2XPKA 2F61A 2JBMA 2OWCA 3NXFA 1C93A 3EOLA 4ZO6A 2VEMA 3BXWA 1HKVA 4FALA 1OFQA 5FEWA 2B7PA 2J47A 4I5XA 4JDBA 5CEWA 1JNDA 1YW1A 4DJDD 2ZFAA 3RF9A 5ABEA 3MKCA 1SJCA 2ZVRA 1P0NA 4KH2A 2BWGA 4LALA 3EWBX 3B97A 5ENLA 4X3ZA 1GZGA 3N2OA 4C1NB 3W00A 4JZ5A 3FJ4A 2HJPA 4GZIA 1OX4B 3RJYA 5HQEA 4PC8A 3COTA 3ITOA 4DM1A 4E2VA 1M5WA 2OU4A 1H62A 1EGMA 3KX6A 5AHIA 4JN6A 4XZMX 4XZLX 1TJ1A 3OG3A 4C6EA 4C6QA 1HGWA 4LUYA 3AS0A 4DZ5A 4NJJA 3F2BA 5C2XA 1E0XA 2OFJA 1DTNA 4JHOA 1IEXA 2A3HA 1HVQA 1ELSA 2GJPA 3GZAA 1Q6GA 3RFAA 4KWSA 3FKKA 1KFBA 1DTUA 2P53A 6XIMA 3NQAA 5FJJA 1Q8JA 1B3OA 4CU7A 3R0DA 1NARA 1OZQA 1R38A 4C65A 4S3JA 5DMNA 2ZYFA 4ASTA 2GLKA 5I02A 4XUGA 3MCNA 3Q58A 3G6LA 3WZ0E 5BRQA 3LZ3A 1PAMA 1X96A 1O95A 1SO6A 3S83A 5KEZA 1E6SM 2BOGX 2ATMA 4LVGA 5IFPA 2YB4A 4UQ9A 4OBRA 3Q67A 4BWLC 3BGAA 1KBIA 3G1HA 3PJTA 4MWAD 4KPLA 1R47A 1J8VA 2BY0A 1XLMA 4GCAA 1VHCA 1R3WA 1XYCA 3TJLA 2W91A 5E1QA 4PUJA 4JTTA 3VD5A 1SJBA 2X0HA 4QLLA 1J79A 3T42A 3EX6A 4Q4KA 1XKJA 4Z0JA 1XSIA 2DPEA 2PF0A 5CCZA 4O1AA 4M6VA 3S2JA 3MY9A 3EWZA 4GACA 4H8VA 3N1AA 3TROA 1HVXA 3B06A 1N8FA 5LGZA 1W9VA 4J1OA 4MJ4A 4GINA 4FX6M 3BW2A 4O15A 2P1FA 3H7RA 3WLMA 3WNKA 3GDBA 2CEQA 4BK9A 1R7OA 3W3OA 2A85A 5EMLA 3W7RA 3RLGA 3KBJA 4HNUA 1WZLA 3QR3A 2VEIA 1PZ3A 4CNUA 4UTWA 2ON3A 5A6BA 4NP7A 3RCMA 3PZMA 4GXWA 1B2YA 1U2YA 1QI4A 4LVAA 3DYOA 2WHLA 3PHAA 4D72A 4L56A 2WQDA 4ZQNA 1KR0A 4S38A 2OYKA 3E02A 4DXXA 3I65A 3UY7A 3DFPA 3NPWA 5DN1A 4PSRA 3GH7A 2OMAA 3UZZA 6ENLA 1BYDA 2F38A 3CS2A 4QQ3A 4QDWA 1TUXA 2YIHA 2D3LA 4Q8OA 3SCTA 6CGTA 4H9YA 5CKSA 1AL7A 5HDRA 4L6OA 1G69A 4GX9A 2WJZA 3EZ4A 3W27A 4C5ZA 4EX4A 1VPQA 2TRSA 4B3LA 1EGVA 1TWDA 2C3ZA 2E28A 4ORIA 2DJLA 2ZADA 2P0OA 1H4PA 3PPFA 1OCQA 4RZ5A 1YX1A 2EF9A 1XIFA 5GVJA 4DO5A 4XIAA 2ZICA 4P5UA 4DELA 1F3EA 4PFHA 2GVYA 4HMCA 2O4MA 4DBEA 1WDRA 3W01A 4GBUA 3GSMA 3H21A 1WPCA 4ZBCA 5XINA 1X7IA 3GDMA 1H0IA 2PRHA 5JH1A 4RNFA 3AIBA 3NA8A 4ZB2A 3PP7A 2Y62A 4QITA 2WMIB 3AOFA 1U1UA 1X38A 3EA1A 3HFYA 1V6XA 1UMYA 1Q2SA 1OFOA 1RJRA 4DI8A 3MUZ1 1QAPA 3DN5A 4A4AA 4HPXA 3W7QA 3IV3A 2FVKA 4LS2A 4RNIA 4IMCA 4I6VA 4XKYB 2ISDA 3WDPP 4JFUA 3I68A 4LRSA 1JI1A 2X0YA 4Q7NA 2GJNA 2VC7A 1KWGA 4NUWA 4D8LA 1EPVA 1W5OA 4KIEA 1FWAC 3KL0A 3AYTA 1GG1A 1HO1A 2GUYA 3LX9A 5GNZA 2I5GA 3FDKA 3P5ZA 1E15A 1PUDA 3Q45A 4KMQA 2P0IA 4ERIA 4NILA 3WEMA 1XW8A 3RILA 4M5PA 1NQKA 5JH2A 2QCFA 5A6LA 1RQBA 1TR9A 4GFSA 3RG6A 2GDQA 2XISA 1H1YA 1ZJAA 1J5TA 4HA3A 2FH8A 4O13A 1S5TA 2WC7A 4PMQA 3LPOA 3ITVA 1XLLA 4IL0A 4OV9A 1SSDA 2ZOXA 3W7PA 4XX6A 2YX0A 4AH7A 9RUBA 4U4MA 3QR0A 1RPXA 1EXBA 2JIEA 5U7SA 1HP4A 4QRNA 3VTRA 2VC6A 3A6OA 1KBJA 1M65A 1A3WA 3T2QA 4DJED 3F4DA 3M07A 4H6EA 4JTFA 1NWUA 1XPYA 4D6FA 2RDUA 2XG9A 2PDCA 4LYKA 3ALGA 3UXLA 1OIFA 1T0OA 4LVFA 3SQMA 1EJSC 4W8LA 2BFGA 1TZ9A 1KXQA 3BO9A 5EGRA 3ABSA 5C5YA 3R0KA 3NL3A 2B31A 2WQPA 3V18A 1FWNA 4FO4A 2WZMA 4C6NA 1XPGA 5T9CE 3QSTA 4GHRA 1M1BA 1XRTA 1EBHA 4B5SA 1KFKA 3T2PA 3BW3A 4QR6A 3EWXA 1YXYA 1Z41A 4XD4A 3W4RA 4WLCA 3OVPA 4D6EA 4UZUA 4QDPA 3UP8A 3MWAA 3VKJA 4NZ3A 3NYZA 3RAOA 1Z9AA 5G2HA 5H6HA 5C55A 3BSGA 3VKBA 1HX0A 1RVGA 3STEA 1H2JA 3NCOA 3AXMA 3C0JA 1WKDA 4IWWA 4KGLA 3LUTA 3LN3A 5IDZA 1WNOA 4RZ6A 4ACYA 4QX4A 2GWNA 4PBGA 2Y8UA 2E77A 4RDVA 5D2WA 5IM51 4WJ8A 4MLJA 5IDIA 1OGBA 1FCBA 3V35A 3HGJA 3GBDA 4O19A 2OT0A 4XVEA 5HA7A 4ECLA 2D2HA 3TA9A 3M5VA 1TZZA 1O6IA 3UPBA 4XKYA 2WHKA 2BP1A 3VDHA 1GONA 4TUFA 3ID7A 1X7FA 1YTKA 2REQB 4HSOA 1NOFA 3S0CA 3EA2A 2XVGA 5BXTA 3O9NA 3THUA 3MV11 3VGBA 2OLAA 4Q8MA 1S39A 4NT0A 4O8AA 4L9XA 2PPGA 2G4JA 3WQVA 1Q5MA 1VEMA 3G1DA 1BYBA 3W6LA 1I2NA 4Q4QA 4H2CA 4DBUA 3NQVA 3VCRA 3O3RA 1FTXA 1FP8A 5C9XA 1FWJC 4K68A 2PP3A 4KFPA 4MGGA 5HATA 3SBFA 1TWZA 2V3DA 4INFA 5D30A 3PK7A 2PDQA 1VS1A 1ZBKA 1THFD 4FIRA 4LX4A 5E09A 2ACSA 3CEPA 3P62A 4XTDA 5FL1A 2YCLB 4IG2A 4F2BA 3KVKA 1KW1A 4LAMA 4CD8A 1UW9A 2XGBA 1RY0A 4WXYA 3OG2A 3TNBA 4Y96A 3KM8A 1XLJA 3OEXA 4M51A 1JRBA 3W07A 1E6XM 1XYFA 1J96A 4Y90A 5K9XA 4HOWA 3L2LA 2GGIA 3P60A 4GYPA 1BEUA 2EKGA 1S38A 3V36A 2P50A 1GYMA 2FB2A 4JS3A 2ZZ7A 1RJPA 3WG6A 1TJPA 1TPC1 1EP2A 1G1YA 4PL2A 1GVRA 5D04C 3G3MA 4LAOA 3GTIA 3EMCA 5G4EA 4LCRA 2WSKA 3BLFA 4UC5A 3N4FA 3VO0A 1TV7A 5C6MA 1TX0A 1IT0A 4PEEA 2XDFA 1OG0A 4RV8A 1H11A 8CGTA 1M53A 2QULA 2J7GA 1EJXC 4N2YA 3W6MA 3E3HA 1CXLA 3ZLGA 1KQYA 1F5ZA 2PDIA 4RPQA 3WH5A 4NNBA 2IKJA 4CNTA 3G1XA 4P8UA 1XLDA 4DWDA 1OFAA 2CHNA 1E0WA 1JCJA 1H0GA 2A21A 1RALA 5D9PA 1DJIA 2E9BA 3II1A 3NUKA 2BV9A 4I8YA 4IFRA 6REQA 3ITLA 4UFLA 5C7VA 4JHMA 1IT7A 4BI7A 2CBJA 1RCXB 2YL9A 3V3WA 5C2GA 3WDHA 4PMJA 2CWNA 3H7UA 1UH3A 3BG9A 2Q02A 1TWSA 1Q63A 1MMFA 3UZ5A 4Y8FA 3W82A 4DWSB 4H9VA 4A22A 3QFEA 1ME9A 2YYTA 4M7SA 4JN7A 4S3DA 4L64A 4IT1A 3E6EA 3WD1A 1MXSA 1W5QA 2IPWA 2PDGA 4LTSA 4ILSA 1XD1A 2Z1XA 1CPUA 1XIJA 3H54A 1JGMA 1GEHA 1O1ZA 2OXNA 1XG3A 3OW1A 2Z7KA 3MB9A 1KXTA 3FNDA 3E96A 3TC7A 2W3ZA 3FYYA 3PG9A 2WSYA 1E6RA 1OJXA 2Q6ZA 3KCJA 5DF0A 1DP0A 4G1KA 4IPPA 3HQPA 5EY5A 4DBWA 2E3ZA 3SN4A 3F4WA 3TW9A 1PPIA 2XSXA 3IVUA 4Q7BA 2C0HA 2Z25A 3BGGA 3BZGA 4W88A 3TC6A 5T91A 1H63A 3VD9A 3TC3A 1V3JA 2UY5A 5EBUA 3A21A 3BJSA 3MP4A 5BYWA 1DIOA 1YQ2A 1GTEA 4GZ7A 3JS3A 4A2RA 4AXKA 1OK4A 1T8QA 1S5VA 3LZ5A 3HA1A 3EOUA 3H7VA 1NDZA 3UJ2A 1LP6A 4NAFB 1F7BA 3AHXA 4Q6XA 1KWKA 3NGJA 2BG5A 2DVXA 3PSVA 4IJRA 4HD5A 3UVAA 2QJMA 1KBLA 2F9RA 2HE8A 2I5QA 3HB9A 1KRCC 4PTWA 1FRBA 5IHRA 2HDJA 4E8DA 4PMOA 2QPSA 5DY3A 3WQGA 2XH4A 4GWEA 2QDEA 3DFSA 1U22A 1PTAA 3M0HA 4IL2A 4Y9OA 3N11A 3TN5A 2BVTA 4XISA 5LYRA 3G24A 3P0WA 2VX6A 3B0XA 3S1UA 2I7GA 3OIHA 3TA6A 3RX2A 1O5QA 4QIUA 4KRTA 2YA2A 2VGFA 4XTIA 4DYJA 4NZ1A 1SZEA 1XLBA 2VEKA 3PBMA 1QBAA 8RUCA 2E25A 1CNVA 4NZCA 3VFLA 4H8HA 4EPEC 3AMCA 2QDGA 1EC9A 3VD4A 1W3KA 5EA9A 1NOWA 2BZNA 4X61A 3GG1A 1KV8A 3ARVA 3S1WA 2IQDA 3BK0A 3LBOA 4MWAE 3ARPA 3GNPA 4XSLA 4GI6A 1TSIA 2VC9A 4J3WA 2DU2A 3CV2A 5F7UA 5AYBA 1B90A 4FXRA 3CZ8A 1PL9A 3ITTA 2X30A 3PVFA 4QG6A 1SUXA 4C90A 1KCKA 4E3TA 5FSEC 2VR2A 3RNDA 3ITGA 1C7TA 1MUCA 3GXFA 3TMQA 3RLVA 4MMWA 3M1ZA 3NZPA 1ZPTA 3MANA 3E5PA 3VDCA 1KTBA 1BTMA 1R3YA 2C8NA 3HURA 1W5NA 3T0TA 2PLJA 1MDLA 3VIOA 3MWCA 1T99A 4UTUA 1PKNA 5HUPA 3ARWA 3B9DA 4U33A 5AHFA 2ZZ1A 3NQMA 1EYWA 3GYCA 4Y2WA 2XTKA 4IGNA 3ABOA 2R9RA 1YIXA 4L6DA 4FEZA 2GQAA 4RDYA 3RLHA 5CC7A 3WH8A 3WNOA 3Q2DA 2KX9A 1CGWA 1M68A 2W62A 3KFTA 3EDEA 1V6YA 2AOSA 6TIMA 3C8FA 3U2OA 3L68A 1HG3A 3EWDA 1D9EA 3GYEA 2J8TA 3TW7A 4CD7A 1PTDA 3TMLA 1G01A 3FY1A 1REQB 4UMCA 4AZ5A 4LAUA 4YHGA 2V30A 1D3GA 3NSXA 3FFSA 3EDFA 4CQ8A 1WXZA 3VILA 1GYLA 1F61A 4KKXA 5AC4A 7PTDA 1LL7A 5FIPA 2BXYA 4AWUA 4IX0A 3BLEA 1QNQA 1Z89A 4Y8EA 3U0HA 2DZAA 5KZDA 2XSAA 2D0HA 3UGVA 1DXIA 1LOQA 1KV5A 2I56A 4ML4A 4QHRA 5A6JA 2OX4A 3M0ZA 3WBYA 3T9PA 3PAOA 1D7FA 3O6CA 3BH4A 3E9AA 1BF6A 2J7FA 4ICMA 3TTQA 2P88A 1CIUA 1QR7A 5AC6A 1BKSA 3C0QA 3P5YA 1XLHA 2NV1A 1AJZA 2H90A 5GJMA 5FF7A 1EWDA 3RK8A 3VZXA 5IBXC 2A3CA 3VE9A 1JZ8A 2R1KA 3WBEA 3BCJA 1Q85A 3B8WA 2WK2A 4LW7A 8TIMA 1Q6QA 1TJ0A 2PC8A 3AHTA 4TV5A 4O14A 2OLHA 2GGEA 3EB3A 3TSBA 1JDCA 4URIA 1YPIA 1XGDA 4HB7A 4AC1X 4TXEA 1GW1A 3U7VA 2OX1A 3DKLA 2QZRA 4FXSA 4XBJA 4NXSA 4J9JA 2WWCA 2O4QA 2PZ0A 1FFQA 2J25A 1V02E 2GVJA 1SW0A 3GXNA 2C16A 5KITA 3AUOA 1J6OA 1ECQA 4EE9A 3TEVA 3ZSTA 2JQXA 2WMIA 4DF2A 1UC5A 1SW3A 2WAGA 2A7PA 2WCAA 4DUVA 4UXDA 3DHDA 4NL1A 1PO9A 4FB7A 1AG1O 5FJIA 4O1DA 3P84A 4ZA0A 4LNCA 3HJEA 4L6HA 1IT8A 4MSSA 3STGA 5JIPA 4PR4A 3RITA 1IXOA 1HIZA 4HHHA 1GUVA 1E71M 2J75A 3CQIA 1ADOA 1J0JA 4V27A 1A53A 4Q4PA 3VXGA 4K1GA 3EX1A 1A5BA 1UUMA 1WKEA 3QRHA 3SCQA 4EP8C 4KETA 3CAVA 2YBUA 3K8MA 1XIIA 1XDMA 4E0CA 1FCVA 3LI1A 5LA0A 1ALDA 3TVAA 1DKWA 4JQ2A 3OBKA 3VK5A 1R9XA 2QR6A 3M0YA 1FKWA 3USBA 4AZ7A 3MUCA 1FBAA 4LRTA 2QCLA 3BAXA 1LOLA 3WMBA 3ARRA 3N3MA 4P2VA 4ZFCA 4K3ZA 4Y9MA 1JIBA 4LUSA 4KEZA 1W1IE 1PX8A 4JTGA 1MO0A 2CBUA 3FS2A 3HO8A 3VNYA 2TAAA 4BS0A 4DF1A 4X22A 2PWHA 2VR4A 1RK5A 3MV01 2CZFA 1FWFC 2XGZA 4IX2A 3GNOA 3IUHA 1CLXA 1OYCA 4JIRA 2ZX6A 3TTEA 4FNPA 4KIRA 1P4CA 3LGGA 4HCDA 5F2GA 3R8RA 4RE0A 2A6LA 3L0GA 4EXAA 1VRXA 4JKKA 5M17A 3CHEA 3GFZA 3SGGA 1V93A 1UPPA 4MWAC 2YZRA 1OGSA 3EB2A 1DVJA 4Z2JA 2VWSA 1BVZA 2PDPA 3IGUA 3NTYA 4OOUA 1EJRC 1UJQA 3LV5A 5ABFB 5HPCA 5L9FA 2PTWA 1SZNA 1V0NA 4B9ZA 1GHRA 1R9YA 5FJPA 1K8ZA 3VC5A 3GU9A 3L67A 4YVPA 5IHSA 2Y89A 1IV8A 1LQ2A 1R3SA 1WYIA 3B9EA 2A6NA 4TVUA 2QAFA 1GK8A 1S2AA 1DJQA 5DMYA 5H91A 3URNA 4WIWA 1FXQA 1NF0A 5HNUA 3RO8A 3W72A 2C7FA 2HWGA 3E0WA 4HHMA 3VGGA 4JYDA 1JDEA 4FR6A 3TZFA 3R1ZA 1C9DA 4GJ1A 1PVNA 4R85A 4UZSA 3ISIX 4DPPA 2VZTA 3VKKA 3SGUA 5HNRA 1Q6LA 1RQEA 3LHVA 3WMCA 5EBAA 3SSJA 1KBKA 3C6CA 1ZJHA 3ZT5A 3KOZA 4AY7A 1EO7A 4N9BA 4B91A 2PWUA 1Z48A 1I8JA 4LANA 2YKKA 3W1TA 4A3RA 2D20A 3WH6A 1IWAA 2FTWA 3K5XA 4YVVA 1OT1A 2CHOA 5EFDA 4AUBA 4ZQOA 3N9SA 4S1FA 2YXXA 3W7MA 4PTNA 1TMQA 4WOQA 4IP5A 2QDDA 1NF7A 3EWCA 2I5IA 3GDKA 3WJWA 4JTAA 2O55A 1LQ0A 3OOQA 3VNKA 1E9ZB 1FCQA 3PUDA 2Y5EA 1DIEA 2YLLA 2DT3A 3PBGA 3GIPA