1KFKA

Crystal structure of tryptophan synthase from salmonella typhimurium
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
251
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title On the role of alphaThr183 in the allosteric regulation and catalytic mechanism of tryptophan synthase.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
total genus 94
structure length 251
sequence length 267
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2001-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1kfkA00
1LP6A 5CPLA 1KM2A 1XBYA 3B0VC 4FNSA 3CEPA 1OYBA 4AVFA 3NR0A 2YPIA 5I3IA 3JS3A 2OMAA 2ZZ7A 4RZ4A 4DBEA 5HWJA 2YX0A 4RR4A 4B5NA 3RMJA 3NPVA 3W85A 5LHFA 2VENA 2JGYA 4PEKA 1W3NA 3EX2A 5CKSA 5F2LA 3GX9A 4FIQA 4NT0A 1R46A 3NZRA 4AHQA 3O1NA 3ELFA 3LOTA 4CCCA 3W83A 2EGZA 1N7KA 4O4WA 2ABBA 3MBDA 5BOOA 2ZA3A 2A6LA 1A53A 3A9IA 3TAKA 4DQWA 4IX0A 3V1PA 3LI0A 1P1XA 4DELA 1TSIA 3W7NA 2V5BA 1V5XA 3QMRA 4IMDA 1FCBA 4UTKA 1Z41A 1OVDA 1QMLA 1NF7A 5LGZA 3ATZA 1S5WA 4MVAA 2CLEA 1ALDA 4XKYB 2H8ZA 1I4NA 4X3ZA 3SR7A 1AK5A 3STCA 3CTLA 1B57A 4UMCA 1WA3A 2IQTA 1PCWA 1SO6A 4RCXA 4WD0A 2Q8ZA 4S2BA 1RVGA 5D2VA 4ICNA 2FB2A 3E96A 4XTIA 1LRQA 3P82A 3TUUA 2ZFAA 4NJGA 2PCQA 3LTYA 3WK2A 4IOTA 5D30A 1TQXA 3DENA 4JICA 1HL2A 1ZHAA 2B4GA 1LORA 4DO5A 4UTUA 1W3TA 2ATSA 1QPNA 3HIJA 4Y96A 5F2MA 2ZBTA 2YR1A 2BX7A 4RKAA 3T40A 2JBMA 4OHQA 2I14A 1F73A 2G95A 5EKYA 5L6UA 4DF0A 3STGA 3W76A 3LTPA 4O53A 4N9BA 1SFJA 3HGSA 4FX6M 1JUKA 1R30A 2R91A 2BWGA 4BI6A 2B7NA 4OU1A 1L6YA 2Q8LA 1ZENA 3GXTA 4Q32A 4FNRA 2J9ZA 3P8JA 3PBVA 4WJEA 2YSWA 3PWAA 3HJZA 3PC0A 2YYTA 3C2EA 3L0GA 2HTMA 4UUIA 5TQLA 3M5ZA 1SUXA 2HMCA 3PM6A 1M5WA 3F03K 4LC6A 1I2OA 3B8DA 1OFEA 2QKFA 1WDWA 3E49A 3S8HA 2G96A 1T99A 3PBUA 2VXNA 3FJ6A 2CZFA 4ZQRA 5HR6A 4JDBA 2ZA2A 3CIWA 3BO9A 4MPQA 1VR6A 4QNEA 1GYNA 4Z1BA 4A21A 3LCLA 1QPOA 3P7YA 3FYOA 5KINA 2ZZ2A 1GTHA 1W5PA 4GXMA 3T7VA 5F4XA 4FNPA 3TC6A 1V7YA 4ADUA 3C3NA 1TO3A 3P5YA 2DU2A 1DV7A 1HUVA 3NNTA 4MJZA 3W9ZA 3SY5A 3AO0A 3EX3A 5D33A 1AW1A 3UD6A 4WXZA 5D05A 4X22A 3LBMA 1W31A 2E09A 3M47A 4NQ1A 3BARA 2QAPA 2Z0IA 4M7TA 2YFOA 3P74A 2E6DA 5K4XA 1UUMA 3NL3A 2QCMA 1GWJA 2V2DA 4WQ6A 3MUXA 5HJLA 5J5RA 4BWLC 3UNDA 1L9WA 3QMSA 2V8ZA 1H51A 4OWGA 3W1TA 4KWWA 3DFNA 2PRHA 5LNWA 1NFBA 1B9BA 3NQEA 3MI2A 3QSTA 3HG3A 3R89A 4ZMGA 1UB3A 2A2IA 4DO4A 1UCWA 3GB6A 2YZRA 1I45A 3FLUA 3JR2A 4JTEA 1Z48A 1Q3NA 1W5MA 5D09A 3UY7A 4GUFA 3NDOA 4FF7A 2WSYA 2V81A 5FF0A 2LLEA 1TQJA 4GUGA 4ZL1A 1DBTA 1KBIA 2FJKA 2EAWA 1ICPA 2Y63A 1GVQA 3TE9A 2NXIA 1LRNA 3PVFA 4JTSA 5G1TA 3MHFA 1FX6A 1F76A 4GC4A 1VYSX 2RH9A 3W87A 1JQXA 3VNDA 3F1QA 3BLEA 5FF4A 2WPBA 3F4WA 4JTGA 5F1VA 4GFSA 1G6CA 1ICQA 3KX6A 4QM1A 3TC7A 1SW0A 3QSRA 3DFQA 4E38A 1Y0EA 2C6QA 3MHGA 4ADTA 1GVFA 1S5TA 2ALDA 1SZEA 5D2YA 3HG5A 4CNPA 3LERA 3C56A 2OZ0A 3LHUA 1UUOA 4I7UA 3W7LA 5K3VA 3W7OA 1CI1A 4FHAA 2VKZG 4RLIA 1JR1A 1OYCA 1WOBA 1VLIA 4UTTA 2ATMA 3RLUA 2XN1A 1I2QA 4OQVA 1NF0A 1A5SA 2YFNA 5AHNA 1KM1A 1RZMA 2VFDA 4E0CA 5HINA 4IGHA 5CZJA 4N2YA 4NJHA 2VEKA 3LXBA 3W2KA 3WJSA 3TKFA 3MMTA 3PUEA 4ZQNA 2QF7A 2CLIA 5HWMA 1EUNA 3S5NA 3GZ3A 5K7JA 1KM0A 2GPTA 3TCEA 5BRBA 5AOUA 2Z6JA 3KAOA 3W71A 1O5XA 3TW7A 3P8IA 3EX1A 3LXCA 1OK6A 4A2SA 4QNWA 3UZ5A 5AHLA 1GVSA 4Y8FA 2FFCA 3IVSA 3DKLA 3TW6A 3JRKA 3CWNA 1H7XA 2Y85A 2X1SA 1K03A 5CSRA 3TJLA 1TTQA 1ZY9A 3Q58A 3TIMA 1QCWA 2B0MA 2PURA 4HNVA 2Y70A 3DBPA 4WY0A 3M5XA 4LV9A 4UNKA 2BLEA 3SGUA 4KFNA 3PSVA 2C3ZA 1XL9A 2XFWA 2Q3RA 5AC7A 4I7WA 4K7YA 3UXDA 7TIMA 2E1DA 5IM51 1DVJA 1NSJA 4FIRA 2C1HA 1EP2A 2BSLA 3T55A 1D3HA 3G1SA 2J24A 2Z2UA 3M9YA 3W22A 5F4WA 1MO0A 2I1OA 2QDGA 3HOJA 1NAL1 4UTMA 2A6NA 1SO4A 1X1OA 3PSWA 3LLFA 3G0XA 1JCNA 1F5ZA 3GKFA 1IXPA 3BW4A 3ABRA 3D0CA 2RDUA 5EY5A 1YLVA 3L21A 4UIOA 4CCDA 1H7PA 5CG7A 5K9XA 1BKSA 1LLZA 1FQ0A 3PG9A 2JKAA 1G4TA 3IIZA 1SFLA 2WSQA 2C14A 3G1VA 3O15A 4YCOA 4S2CA 3DXIA 4CNOA 1LLWA 1VLWA 3KHJA 3HPXA 2I9EA 3W7HA 2YW3A 4NJIA 4O8RA 3T44A 2QCNA 2DP3A 1AMKA 1XKYA 4U4MA 1R2TA 4JEQA 3M1ZA 3B4UA 4NXKA 2DZWA 3S5ZA 3W2NA 4MKNA 1SO3A 3VE7A 2FTPA 2QCDB 3WK1A 4FXRA 5HUOA 1O95A 4Z0JA 5TBOA 3M43A 5KITA 2GOUA 4MY8A 2NUXA 1EUAA 1KTNA 3SIZA 3O8AA 3P62A 3QEZA 5D03A 2VFGA 4PC8A 1DJQA 3L9CA 3R13A 3LB0A 2O7SA 4UTWA 3NXFA 2ABAA 1GTEA 1OFDA 4HNNA 1ZAJA 2J27A 3L66A 3OEXA 3RU6A 4R33A 2PRMA 3C6CA 4MY1A 2A7PA 5IBXA 3O05A 5AFDA 4QJ1A 3W1QA 1J5TA 3H55A 5TIMA 1OHLA 3UY8A 1FDJA 1O5KA 3G3DA 1LOSA 3NL2A 1H1ZA 1KFEA 1R47A 1KBJA 3NQGA 4Z1CA 5G2HA 3KFTA 1HFBA 2FPYA 3OA3A 4JTLA 2R8WA 1A50A 3OG3A 5D38A 1TMHA 2CW6A 4HHPA 1BWKA 5KZDA 4NX0A 3TMQA 4POCA 4H3DA 3W7QA 3TDFA 4CQAA 1QOPA 5AYYA 1TPB1 1DOSA 3W2UA 5HQEA 1KW1A 2EKCA 2E6FA 4MJMA 4RXGA 2FQIA 2CFFA 1VZWA 3LRKA 1PHQA 4RZ5A 3G8RA 4WX2A 1HTIA 4FEZA 2C13A 4O1AA 2QR6A 2X1UA 1WOAA 3G1AA 2V2CA 3BLIA 2FDSA 2YXGA 4AF0A 2A7NA 3G18A 2JKEA 2C16A 3SZ8A 1OFBA 2R14A 3TXZA 4A3UA 3YPIA 4JR5A 3I7SA 2ZRXA 4L4MA 2CZ5A 4P61A 4IJBA 3W72A 3IVTA 3MW7A 3PB2A 1LCOA 3GKAA 5DCBA 1RQBA 4ZQPA 3N9RA 3SW6A 2QUUA 1VS1A 3BV4A 4ZQOA 3UWQA 2H3DA 4WY0B 3RK8A 3MYOA 3GAKA 3VKJA 3W1XA 1YTDA 3NA8A 1VCGA 1Q6RA 4JN6A 2A7RA 2CLHA 4JTHA 4AMAA 4QSHA 4LS2A 5FEWA 2WKJA 2C15A 5E93A 1I2NA 2WOQA 2GJNA 2QJGA 4K6AA 3NYZA 4ZQMA 2DZPA 5K9CA 2FPTA 3TA6A 1OK4A 3QMTA 4U28A 4XZ9A 2QAFA 1O94A 5CSSA 3EWWA 2A21A 3S1XA 2GVLA 1YDVA 1AW2A 2TMDA 2QCHA 1XUZA 2ZZ6A 2YW4A 5AHMA 3H54A 2CLLA 3Q2DA 5A5WA 4R53A 1XC4A 5DBTA 3L5MA 3MBFA 5CZSA 1OYAA 3TQKA 5CZTA 3FJLA 3NL6A 4JY9A 5I3JA 4Z1AA 4O4VA 1TV7A 4MZ8A 1NVMA 1TPWA 3GDRA 4FX7A 1F7BA 1BEUA 2HSAA 3BPWA 3PS7A 3QZEA 3C8FA 3GXPA 3W1RA 2GQ9A 5CGQA 1P5BA 2GUUA 4M5PA 1LYXA 5U4NA 3L5LA 1GEQA 3QJAA 1IIGA 3HGRA 4YMZA 2E6YA 5G5IA 3OHIA 1JCXA 5D04C 5G4EA 1GQNA 1OJXA 1LM1A 4UTJA 2VEIA 1OFPA 3W3OA 1W1ZA 5CPNA 4Z1DA 3O06A 1HG3A 1ZALA 5C55A 1W5OA 3FOKA 4AHOA 4NNBA 4O52A 4IWWA 3EWXA 3W2JA 4MLJA 3LHTA 4Y6GA 1FCUA 1KA9F 3G1FA 4K8HA 2B7PA 2NX9A 3IGXA 4M6PA 2ZRZA 1K7EA 1TPUA 1KM6A 3TQ0A 2E5CA 3ZFHA 3ZR4A 1OABA 3TK7A 1KV8A 3LRMA 3IEBA 4A29A 1M7PA 1WXJA 3HQ1A 2X1TA 4OE7A 3BG3A 1LOQA 4JX6A 1Q6LA 3CT7A 3KVKA 1R2RA 5KTLA 4A2RA 1UBSA 2NUYA 1XBXA 3I68A 3MP4A 5G4WA 1MXSA 3ANYA 3VCRA 4NJJA 5D32A 1P0NA 5L9FA 4PFMA 3NVTA 1KFCA 2WSRA 3NGJA 1XXXA 3WFAA 3PR2A 3W7MA 1TPH1 2QCLA 3B04A 3Q37A 4XQ6A 1B4EA 3FA5A 4MFDA 2WQPA 2ISSA 3GYEA 4AB4A 4MZYA 3LCGA 2Y7GA 3S5YA 3R8RA 3FYPA 3CM4A 3NG3A 4IXHA 3QQ0A 2ISWA 1XI3A 4GUIA 3W7JA 1TPDA 4DXVA 1LBFA 3GIYA 3S5OA 3VE9A 2H6RA 3CHVA 4LVAA 2E5BA 1LRTA 2JK2A 5T26A 1VHNA 3DH7A 3B05A 3W2MA 5K2ZA 2D73A 5EYWA 5CZ0A 3CLMA 1ME9A 1SQ7A 5K9DA 3LCWA 4EVZA 1DQWA 3NPXA 3M5VA 3WJXA 4QQ3A 1SPQA 3NQVA 2YYUA 4FXSA 1GJPA 1G4SA 3UWWA 2DORA 4H4IA 2QDHA 3EEGA 4IX2A 4XWUA 3UZJA 4BK9A 5EMUA 1LROA 2GVJA 5HR7A 4AHPA 4NZFA 1W56A 2OT1A 1T8XA 1H7RA 4X2RA 5D37A 4E2DA 3SGZA 1IXOA 2VFEA 3S42A 2TYSA 3PUOA 1G67A 4G1KA 2Z1BA 3M0ZA 2YGYA 3USBA 2NV2A 5BMXA 1W37A 4GWEA 1QWGA 1Q6QA 4JIPA 3N2XA 2QCEA 4N9EA 4BWLA 4LRTA 2Y7DA 4YL2A 3VI2A 1L2UA 3SFKA 2W6RA 4O0ZA 1F6PA 5LNVA 2RDTA 4LY8A 4R34A 4JYDA 3O07A 4DF2A 2OT0A 4HNTA 4ZVJA 2V0TA 3IGUA 2DZTA 1L6WA 2AGKA 3NPUA 3NQ2A 3HGOA 1M6JA 1WBHA 3U2OA 3M44A 4LTSA 1PV8A 4XUGA 3QPZA 3KRUA 5EL1A 1B4KA 4JTIA 3MHUA 5FF2A 3I65A 4AF0B 1GG1A 1H5YA 1PE1A 5ABTA 2FIQA 1G4EA 5AHFA 3MYPA 5BNKA 2NX1A 5U7SA 3IGSA 1LDCA 3LLDA 3FKKA 1ZFJA 4FB7A 1SW7A 4LVGA 1IXNA 3NO5A 2X16A 1K02A 1DORA 2QJHA 5A8GA 3P80A 3DHFA 5DBUA 5CPMA 4HN4A 3W7EA 3TSMA 1LBLA 3EX4A 1D9EA 5AC8A 1BTMA 1H50A 1YDOA 3STEA 5EBUA 4AAJA 4N4PA 3EWZA 4DF1A 3C4UA 2EPHA 3NQ6A 2CLKA 1FCVA 3CPRA 4JDYA 5D2XA 4JIQA 4BI7A 4OV9A 1N8FA 1YDNA 3KVLA 1IGSA 4FNQA 1FWNA 1X1ZA 2NXHA 1EWDA 3DHDA 2V9DA 2X30A 3NQAA 3TMLA 4JTUA 1QAPA 3C2OA 4GNJA 4GUJA 3W1AA 2ZZ3A 2P10A 1IIHA 1QFEA 3WJYA 1FXQA 1IXQA 1KFBA 1QO5A 4AWTA 3TSDA 5EPDA 4WOZA 3GDKA 3N73A 5FF3A 1VYPX 3W7DA 2RDWA 2GJLA 3M5YA 3R2GA 4LRSA 2J9YA 4N02A 3A5VA 3O6YX 3TV8A 2C0AA 1WAUA 2Y62A 3QW4B 3DFPA 2VEMA 3M16A 5G2WA 4WZHA 1T96A 1U83A 4UTHA 1ICSA 3IVUA 2NX3A 3NM1A 1W3IA 4DPPA 1FY6A 1Q6OA 2V30A 4Q33A 1OG0A 4TMBA 2E6AA 2P0OA 1J2WA 1ZCOA 3IRDA 2CLMA 3DGRA 2BTMA 4I9AA 3GLCA 3UPWA 3LXAA 1QNVA 2NWRA 4JTKA 4Z08A 5FI8A 3NL5A 3BG5A 5AYZA 3KRSA 3DAQA 2Y6ZA 5E1QA 3DKJA 4O12A 4AEOA 1KTBA 1X8FA 3LHVA 3P61A 3UPBA 2E5DA 4PTNA 4ZQCA 1K8ZA 1T0OA 3L5AA 5G2IA 4UFHA 3C52A 1I2PA 4WXYA 3UXAA 2E68A 1ZAHA 3PBWA 4Y90A 3W1UA 5AB3A 1OF6A 3UWZA 4NVTA 1EEPA 5HUPA 5LZLA 3A22A 3R5EA 1W5NA 4UMBA 1OX4B 1K3UA 4CQ9A 4UFIA 3PUDA 1SSGA 3L0NA 4XBKA 3LV6A 4YXGA 4DEFA 1LZOA 3EKLA 3TSBA 4MY9A 3ZWSA 1TJPA 3KVJA 4RX0A 3KVMA 2CZDA 1O4UA 2Q3OA 2ZDRA 4LUIA 4K8EA 4K38A 5MHBA 4LVDA 5C6MA 4UFMA 2P1FA 1MZHA 3V75A 3O63A 4MIMA 4HNUA 1TCDA 5LKYA 2KZHA 1GVRA 4LOCA 3TJXA 1YXDA 3N19B 4HKPA 4GUHA 4LT9A 3KRZA 1A5BA 1B3OA 3EWUA 1WX0A 1HO1A 3HB9A 3QW3A 3W7KA 4MFEA 1D3GA 1BWLA 3W88A 4HSOA 3W7PA 4UXDA 1TRDA 3NAVA 4N6EA 3W70A 2JKPA 2R94A 2ZRWA 2X2GA 4BF9A 1W0MA 3HO8A 1G69A 1RV8A 3BGGA 3CU2A 1XFBA 4UR8A 3FIGA 4UFJA 1RR2A 1A5AA 4LNYA 1ME7A 3P84A 2EF9A 4TO8A 1XCFA 3QF0A 3W6YA 3P81A 1OFOA 3LBCA 1OF8A 3CEUA 2NWSA 3TU9A 3R12A 1PL9A 2AQWA 4N4QA 3UWUA 4C1LA 4L4LA 4O13A 1WQ5A 2FB3A 1TRIA 4GE8A 4IPJA 1K7FA 2PC4A 2ISVA 3C2VA 2DJXA 1ONRA 3G22A 3TQVA 1DL3A 2GVGA 4MZ1A 1KLYA 3L65A 4OGZA 1SU5A 4A22A 1I8JA 2QJIA 3G0SA 1AL8A 3KOFA 2CU0A 3GAYA 4O50A 5E0KA 5KMYA 1YYAA 3BK0A 1A5CA 3W1NA 1XUUA 5F2GA 3LDVA 4WUIA 5FEPA 4JGDA 1ZNNA 4RK8A 3WK0A 3M41A 3IV3A 1W54A 3IIOA 4QIUA 3UQNA 1JCMP 3TROA 2HS8A 4J9JA 2ZQ0A 4M7SA 3I7QA 3SJ3A 3W1LA 4EF8A 1O60A 1YTKA 3UYCA 3W86A 1CW2A 1F05A 2A85A 5DXYA 3CQ0A 3DZ1A 3PG8A 1VCFA 4LVBA 4XKYA 1RQEA 3LHZA 2DZSA 5FEXA 1VGAA 3LTSA 1TPVA 3A23A 3E02A 3NEVA 4M6QA 5KZMA 4YWIA 5AYXA 2ZZ4A 4ONVA 4QAIA 1F6KA 2ZRUA 1GOXA 3W75A 1YXYA 5C2XA 1DQXA 4S1FA 3G1XA 3C0JA 3G0UA 1H7NA 3MP3A 3DI1A 4O14A 4PL2A 5DY2A 4OV4A 4LWWA 3QC3A 3L67A 1YTEA 1FXPA 1K7XA 3S1WA 4KWVA 4CQ8A 3EXTA 3QH2A 5LNRA 1TREA 4O0KA 3THAA 1JCYA 4UFLA 1AW5A 4EF9A 1EA0A 4HSNA 1VPXA 8TIMA 3LV5A 4PODA 3BVJA 1KV5A 1KLZA 1Q45A 4DPQA 2V2HA 3CIXA 1XM3A 1TTPA 4IPIA 1F2JA 5DY3A 3DFTA 1SSDA 5F1UA 1VRDA 3NOEA 4IMEA 1GZGA 4JY8A 3W07A 5F4SA 2Y7FA 1OFAA 1JULA 1C9DA 5HNRA 4YCPA 3NQMA 2ZTJA 4WOQA 5KSWA 1GVOA 1X6UA 1KM3A 1KM4A 1ML1A 3OVRA 2NLIA 2F7FA 3OVQA 3SI9A 3T78A 4BR1A 2W0UA 5FF7A 1JRBA 3QQ1A 4TIMA 1ZJIA 2WO5A 1TV5A 2ZTKA 5LNUA 4IMGA 3ABQA 3HMJG 2VFIA 2ZA1A 5I3GA 1VH7A 3EXRA 2NV1A 4DBDA 4UTIA 4UMAA 3QPYA 5DN1A 1QPQA 2QEZA 5I3FA 2Y61A 1WYIA 1WBJA 2NUWA 1TTJA 4JYFA 2ZCGA 1L6SA 1AG1O 3TFCA 3HGJA 1TTIA 5I3HA 1W8SA 3FKRA 4IUOA 4P2VA 4PA8A 2V82A 4UTWC 4CLMA 4JXCA 2V5LA 2FPVA 3W1PA 3N14A 4CNNA 5AC6A 3I7RA 3W7CA 1EP1A 3B0PA 4NZJA 4MYXA 1Z44A 2OJPA 4BFAA 3INPA 1JVNA 3BG9A 1H63A 1RQHA 3GK0A 3N3MA 4ORIA 2A4AA 5C5YA 3Q94A 3QRHA 3NQ7A 3EKZA 1TPFA 2Y7EA 4ZZ9A 3F4NA 3MI6A 3SSJA 1H62A 3DI0A 2CLOA 4IXXA 2DZVA 4PH6A 1KFKA 3T4CA 1OFRA 4QITA 1GT8A 4FX8A 2DZXA 2JGQA 3FFSA 2XN0A 3W74A 5D02A 3GVGA 3LCXA 5D2WA 1Z42A 5F2IA 1K8YA 3WJZA 4UTLA 3M7WA 1FWRA 2E77A 4M19A 1PS9A 2QCCA 1TB3A 4O28A 3W1MA 4NJKA 3TNOA 3HF3A 3PB0A 5G1YA 2WJZA 5AHIA 3G8EA 4O19A 6TIMA 3GNNA 1EPXA 2A0NA 4O15A 1JRCA 1I2RA 1XBVA 5AN7A 4JS3A 3RF9A 3S0CA 4NX5A 4X9SA 3IIVA 4JTFA 3B0UX 2QCFA 3UWVA 5LNSA 3CB8A 4Q4KA 1QPRA 5BW6A 1LTDA 3EX6A 3GDLA 4N9CA 5HWNA 4XTDA 1H60A 3MWAA 1YPIA 3S9YA 5HULA 4O57A 1K8XA 1FBAA 3H53A 3W84A 3S1UA 4K39A 3IIPA 2CZEA 1ADOA 4MLRA 2VOMA 1GYLA 3ABOA 2B7OA 4O11A 4XBSA 4KKXA 4UR7A 1G7VA 3A21A 1NEYA 2RKXA 1S5VA 4N6FA 3L2IA 2VEPA 4K37A 3DFSA 3GDTA 1TIMA 3HPSA 2J9XA 4JYEA 4JNMA 3TH6A 3A5FA 2BXVA 3C61A 3PAJA 5DLCA 5AHEA 4ALDA 1THFD 2CLFA 4MYAA 4N9DA 1RPXA 4PCFA 3NZ1A 3LCFA 4R7JA 1C8VA 3PULA 1VJIA 1OX4A 1EIXA 1SZFA 3B06A 3O16A 4QISA 2G97A 4UTTC 1CX9A 3W73A 3W23A 3WK3A 3VFLA 1WV2A 1GPWA 3CWOX 3G3MA 1G4PA 2W79A 4O10A 3DFOA 2OX1A 4HPXA 4H6KA 4W9TA 1UJPA 3HG2A 3NQFA 1SO5A 1JCLA 4ML9A 1H61A 1MEHA 5IBXC 1PCKA 3LHYA 1UASA 2QCGA 3A24A 3TFXA 4JTTA 4BI5A 2WNZA 3C2RA 1GG0A 3MO7A 4NU7A 1QOQA 4M6VA 2GQ8A 3P67A 4TX9A 3G1HA 3MP5A 1FWWA 3W7RA 2UV8G 2XN2A 3G24A 1OX5A 1RD5A 1KTCA 3ATYA 4OT7A 1FDZA 3MI3A 5D2TA 2VFHA 2J88A 1VC4A 2F84A 2RHGA 1HO4A 3RNDA 4O1BA 2H3BA 1TJRA 2RFGA 3W7GA 3PF3A 4RJEA 1SZGA 3G1YA 1EX5A 1TYGA 3P60A 3U8GA 5H91A 4AWSA 1H7OA 2HS6A 1X7FA 2DZUA 5K4ZA 1H1YA 1QDSA 3S6DA 2QCDA 3TR2A 4NUWA 3QYQA 1YADA 2Y88A 3NQ8A 4CCEA 1FWTA 1DKWA 2TPSA 2G5WA 4NXSA 3O6CA 4UNLA 4JTJA 2ZRVA 4HPJA 4UC5A 5LGXA 1VCVA 1VQTA 1J4EA 1DHPA 1VYRA 4NNAA 1PIIA 3TXVA 5FEZA 3W7IA 3K30A 4AWUA 3GR8A 3TAOA 1MEIA 2YCEA 2DJLA 3M6YA 4LV4A 4GJ1A 4Z0SA 3B03A 5SWUA 3LCIA 3RLVA 2PE4A 4LUJA 2CWNA 1DJNA 4LS1A 5BMWA 4GRSA 4IQLA 1YXCA 4IMCA 3THQA 2C19A 2ZRYA 4FNTA 3S1VA 1P4CA 4GBUA 4KFOA 2ZZ5A 3MJYA 4RXFA 1JJKA 4O18A 3ABSA 3N34A 1QR7A 5LSMA 5DCDA 4DO6A 1U5JA 3SECA 2Z6IA 2TRSA 5J5DA 3KXQA 3N9SA 1FCQA 4MOZA 4EIVA 2FLIA 1JCJA 3E0IA 2AAMA 3GNDA 3L0KA 3RFAA 3OVPA 1C29A 4D2JA 3LM7A 3W2LA 2OCZA 1TPC1 3DU0A 1ZAIA 3HG4A 1R2SA 1P0KA 4LW7A 4PL1A 4ADSA 4WY0F 3UWYA 4TR9A 2C18A 1KM5A 3NPWA 1JQVA 1SR9A 3FS2A 4O1DA 3O6DA 3QFEA 5C54A 1EWEA 5H2ZA 1JUBA 2BZNA 4UFKA 2ZZ1A 1F74A 4C1KA 2WV8A 3ZS4A 2TSYA 4FNUA 2NXGA 2EHHA 1OFQA 4EOUA 3NM3A 2GQAA 1LOLA 4K7VA 3HPZA 6ALDA 2H8XA 3FEMA 2WNQA 1TPEA 1KFLA 1FUYA 4OBTA 1OX6A 4HT3A 3TX9A 5DXXA 2X1RA 2VFFA 4TU1A 2VC6A 1JUEA 1XDMA 1M7OA 4JD4A 2VELA 4O17A 5DCEA 1N55A 1SZNA 2ZYFA 5GVJA 1LBMA 4HIBA 1XBZA 3EWYA 1XDLA 3STFA 5LHEA 3LGEA 3BW3A 3E9AA 2QUVA 1S3HA 3NQCA 1FDYA 1FWSA 1W5QA 4RV8A 3BGJA 3WJWA 4O54A 3PBYA 4LU0A 3CC1A 4ORMA 3IIXA 5I3KA 3LRLA 4MUZA 3LX9A 1E51A 5KZEA 2B7QA 3PY2A 3AJXA 1MEWA 3C2FA 2Y89A 4UCGA 1IF2A 4LVFA 3ZWTA 1PVNA 1QO2A 3OBKA 4AH7A 1EP3A 1PHWA 5HMSA 3LI1A 5EA9A 2O7QA 2YDAA 3I6RA 3N2MA 1EB3A 3G1DA 3L68A 4KFPA 1TV8A 3HBLA 1G7UA 5DELA 2A5HA 1MSSA 1ME8A 3EXSA 1AL7A 2A1YA 2QUTA 4NNCA 3QM3A 1H7WA 4EWND 3E12A 2J6XA 4LS0A 4LC8A 3OIXA 3BW2A 5CPOA 1VHCA 2PRLA 4FO4A 2NZLA 4YLWA 3P5ZA 3NQDA 3EB2A 3EWBX 3LHWA 1KFJA 3BLFA 3GR7A 4O1CA 1SW3A 3LCHA 4AXKA 4E2BA 4I7VA 4TMCA 2H90A 3GXNA 4Y9AA 2WNNA 4JX5A 5FESA 4IMFA 3GDMA 1YPFA 4K36A 4JX4A 3U6WA 4O16A 4RZ6A
chains in the Genus database with same CATH superfamily
1LP6A 5CPLA 1A47A 1PKLA 1OYBA 4US5D 3BOXA 5I3IA 3EYPA 4RZ4A 3POHA 1F3XA 5HWJA 3DYMA 3ZJ7A 3T2OA 4AG0A 7A3HA 2Y5JA 1V51A 3NZRA 4AHQA 4BEUA 3W83A 4NILA 2Y4SA 3L7RA 4TXEA 3MBDA 3UJFA 4LY4A 3A9IA 4DQWA 4GC3A 3OBAA 4HA0A 5BCAA 1AJZA 3EMZA 3AMLA 3W7NA 4Z2GA 4CU7A 1JDFA 1REQB 3II1A 4UTKA 1QMLA 5A8MA 4L1WA 3ATZA 1S5WA 1F3WA 1DWGM 2CLEA 4XKYB 3VIJA 5DEZA 4H8HA 1EO5A 2QPUA 4CU8A 2FH8A 2PD5A 5CJNA 1HW6A 3SCUA 1PCWA 4Y9NA 3W53A 4WD0A 1J93A 1MW2A 4S2BA 4ICNA 1HJXA 4Y8EA 3E96A 1HKIA 4XTIA 2ZFAA 4L7ZA 2PCQA 5DF0A 3WK2A 4EK7A 1OWQA 3DENA 5GPRA 3I3BA 1Q6EA 2PDHA 2IMRA 3FGCA 1R3YA 1JF5A 4Q7BA 3RRAA 2ZBTA 2YR1A 4OOUA 3T9PA 2V69A 2I14A 5IXEA 2F8QA 2G95A 4XD4A 1RK6A 1D8WA 4DF0A 3STGA 5HNNA 1EC7A 4O53A 2QYGA 2R91A 3HQPA 4BI6A 2B7NA 4OU1A 1L6YA 4F0MA 2Q8LA 4HOWA 1UD8A 2CCRA 2GJXA 2J9ZA 4MSSA 4DX3A 1KRMA 1Q2RA 1XX1A 4C1NB 1HGYA 2HTMA 1UD5A 1SYTA 2PWUA 4PMVA 1M5WA 1I2OA 3W27A 4MDOA 2QKFA 1E4NA 1WDWA 3S8HA 1T99A 2YB1A 3WDPP 3FJ6A 2AAAA 1LL6A 2DIJA 5JIPA 1PYFA 3WQ5A 1VR6A 3R1ZA 1J6PA 2WXDM 4Z1BA 3FYOA 2OYKA 3A6OA 3FXYA 1CPUA 2PDWA 3LA4A 1U1HA 1K70A 4E8CA 1R3VA 2OODA 3TC6A 4CNUA 3EOUA 1TO3A 3VZYA 4FR6A 2VD8A 1I75A 2ACSA 3UR5A 1E4LA 2O9PA 3R0UA 3EB4A 5D05A 5A95A 4NQ1A 4JFWA 6PTDA 2Y8VA 3BARA 4PMQA 3IUDA 4M7TA 4F4RA 1E9ZB 1JDDA 1Q85A 1OD0A 3NL3A 1GW1A 3OQ8A 4BWLC 4KCUA 4N42A 1N82A 3W1TA 3OLIA 1LUCA 3VIIA 3NQEA 3EA3A 2OZ3A 3R89A 1UB3A 2PGWA 5HOSA 3SY8A 2Z1WA 4F2BA 4B3LA 3E0LA 4GG9A 3JR2A 4B5UA 1W91A 4JEJA 4X0VA 2XIMA 4PUUA 3DN5A 2R82A 2EAWA 3VZZA 2WANA 2CC0A 1FX6A 2WBGA 3WMCA 2GJRA 3EMQA 7PTDA 3W87A 2BVWA 4AMCA 3BLEA 5FF4A 2AMXA 1UP0A 3K13A 2P88A 3F4WA 2XPKA 3REQA 4GFSA 1UJQA 1ICQA 1SW0A 3QFWA 3DYPA 3QSRA 1MRAA 1FWEC 2C6QA 1GHSA 2DT1A 3MHGA 1S5TA 1SZEA 2VGIA 3GHUA 3W7OA 1Q8JA 3SURA 2OKOA 3RO6A 4JAWA 3SM0A 1CGVA 1SJDA 4E0CA 1ZBVA 2YA1A 2QS8A 4C7DA 4IGHA 4QTGA 1AQHA 4NJHA 4XK2A 1UW9A 1C3FA 2VWSA 2RAGA 3PUEA 2FJUB 4J3UA 2VT0A 5K7JA 1KM0A 4GVFA 4KW2A 5FD0A 5BRBA 5AOUA 3KAOA 2J66A 3TW7A 4BQ5A 2YA2A 2EO7A 3XISA 3WQWA 3P8IA 2FTYA 4DJEC 1R8LA 4GO9A 4QNWA 4DBWA 3S3GA 1BFNA 4EX4A 4GCAA 2FFCA 3RN6A 3HV8A 1E6QM 3A9BA 3VNYA 5C9XA 2ICSA 2X1SA 2VEGA 1JNDA 1B3VA 2W61A 3TJLA 3OYXA 4P7QA 3MANA 3TIMA 3TOPA 2J8GA 2XJ7A 1QCWA 2B0MA 3UJEA 4GO8A 3M5XA 3WUFA 3KUMA 2BLEA 3F4CA 3WLOA 3CAVA 2C3ZA 1XL9A 2XFWA 2VZVA 3WLNA 2E1DA 5IM51 1VJSA 2C1HA 1EP2A 1FP9A 3BWWA 3QQWA 3G1SA 4MDPA 4MGGA 2Z2UA 3M9YA 3W22A 2QDGA 3UR8A 4CD8A 4UTMA 4GCXA 2GDUA 1M65A 4CQCA 3GKFA 3BW4A 3D0CA 3L21A 1R3WA 4CCDA 1XS2A 5CG7A 3IANA 4ZO7A 5BOEA 3IIZA 1EGVA 1SFLA 4GBDA 2C14A 3O15A 4YCOA 2CKRA 4JCMA 5HBFA 3DXIA 3HPXA 3AISA 1NFGA 4AC1X 2CETA 4O8RA 3THCA 2DP3A 3O6AA 1XKYA 1QHPA 1R2TA 3GRIA 3W2NA 5E0CA 2GGJA 4ZE4A 1OADA 1QI2A 4AD5A 4AW7A 1J2BA 1TWIA 3BOLA 1O95A 3AHZA 4Z0JA 3M43A 2GOUA 5IHRA 1TUXA 1EUAA 3ZT7A 3GC5A 5I0DA 3P62A 3QV8A 4PC8A 1V3IA 3R13A 1R87A 4OFCA 3PPCA 1UWIA 3GNXA 2O7SA 4UTWA 2ABAA 4J3XA 1GTEA 2H9AA 3L66A 1YX1A 4DWSB 3ARUA 3T0TA 5I07A 5AFDA 3W1QA 1ZJHA 3H55A 3UY8A 1KFEA 3A13A 3QZAA 5AZ1A 4Z1CA 1HFBA 4JTLA 4GVIA 4WIWA 1J0JA 5D38A 1VD6A 4HHPA 1PTGA 1BWKA 5KZDA 1A5NC 5I24A 3MSDA 4D72A 3CL6A 4DUXA 4LPCA 9CGTA 3IJ9A 1EJRC 1W1A1 2E8YA 1N8IA 1R0MA 4EAYA 4KEUA 3UVAA 5FOOA 1DOSA 3JUGA 5C9RA 2DVXA 2WHKA 1GOWA 1ADDA 2V67A 3GW0A 3IJQA 3KOYA 4MJMA 4RXGA 4BHYA 2PDMA 4DZHA 1DIDA 3G8RA 1HTIA 4FEZA 4O1AA 4HNOA 1JD9A 1BG9A 5A69A 2FDSA 1AMYA 2R14A 1ADSA 3MV01 1JPMA 5XIMA 2ZRXA 4L4MA 4DM1A 3GO2A 3W72A 3S2JA 3MW7A 5E09A 1LCOA 3N9RA 2ZUWA 3WQPA 3H2EA 2IQDA 4B2DA 2H3DA 3EWDA 1UOKA 3MYOA 3GAKA 3BXWA 3OQEA 1VCGA 5LXEA 2HJPA 1Q6RA 1C9WA 3IJ6A 5DT7A 3L4XA 1WAWA 4JTHA 4LS2A 2PTDA 4Q8TA 1JG9A 1I2NA 1JZ4A 2W5FA 1J96A 3IJ8A 2FPTA 2WMKA 3TA6A 1W2PA 4U28A 4XZ9A 4PUNA 4ZXOA 2J74A 3TYBA 2QCHA 1EX1A 3JZEA 1MXGA 5DBTA 3L5MA 1OM0A 3MC5A 1UR3M 3TQKA 3PZNA 3CQJA 4ZR8A 3QYSA 5I3JA 2WQDA 4Z1AA 3Q65A 1NVMA 3B8IA 1YEYA 1BEUA 3PS7A 2GQ9A 3RMEA 1EJXC 5U4NA 3WUEA 3L5LA 4RE4A 4H2CA 3QJAA 4Q4SA 4WKFA 5G5IA 3OHIA 1JCXA 4ATDA 5G4EA 4IIHA 4UTJA 1ZUAX 2VEIA 3OGSA 4Z1DA 1ODUA 1D3CA 3GNRA 5C55A 4WDTA 1L0PA 4OBSA 3PFRA 4S3KA 4P7NA 4IWWA 1O68A 3WUGA 1ZRQA 2ZRZA 3EDDA 1FWCC 1KM6A 4ASTA 3PK7A 3ZFHA 1OABA 3GXIA 1CXFA 3LRMA 3UZWA 1D8CA 4H9MA 1WXJA 2WCGA 2W66A 4HB7A 3AIWA 1VFOA 4OE7A 4GMEA 1TV4A 3BG3A 1LOQA 2E0PA 3RCMA 2ZUNA 1R2RA 4O8AA 1W3JA 3I68A 3BTNA 3VCRA 5D32A 3OW1A 2P50A 5I77A 3WQ4A 4C65A 4A4AA 4NP7A 4OIFA 1XXXA 1DHKA 3TVAA 2VUNA 3W7MA 3RHGA 3B04A 2XGBA 3ARXA 4TX8A 1Q4NX 2ISSA 1AQFA 3S2MA 3ARTA 4MZYA 3WDHA 2Y7GA 3QPEA 3R8RA 1KGWA 1VJZA 3FXGA 4RE0A 4L5ZA 4GUIA 2H6RA 3CHVA 2E5BA 2JK2A 4F66A 5T26A 4KH2A 3SFWA 3U4AA 1ZS2A 3B05A 3BAYA 2D73A 1DIEA 1RBLA 5EYWA 5CZ0A 1CBGA 1XJBA 5BXPA 1K6WA 3S4TA 1X6LA 2WM1A 3NPXA 2ACRA 3OBEA 3ZVHB 4E2OA 3NQVA 3GD6A 3ES7A 4XV0A 4QE4A 4IX2A 3TQPA 1H7RA 4PB4A 4E2DA 3SGZA 3R25A 3KBVA 2IKIA 2TYSA 4GJJA 1GPFA 3CPGA 3G1RA 4G1KA 2OTDA 1J11A 2WJDA 3VD3A 2YGYA 4JIPA 5BOFA 4LRTA 3V4BA 4C6JA 1L2UA 4RNHA 1P48A 1F6PA 1W1YA 5LNVA 4US6A 3B4YA 1EXBA 5GNYA 3SRDA 1M6JA 1WBHA 3M44A 4LTSA 1CGUA 3QPZA 3VIKA 4GQBA 5MF5A 1VIWA 1H0GA 4M3PA 3MHUA 5FF2A 1OC7A 4AF0B 1U33A 2X42A 3WN6A 5ABTA 3F2DA 1FHDA 2FIQA 4AD1A 3LLDA 2GUYA 1SW7A 3RDKA 3U5YA 8RUCA 2X16A 4ERAA 3MDWA 3DHPA 1B5TA 1UD2A 5A8GA 1MUMA 4PUMA 3EDKA 2Q71A 3W7EA 3TSMA 5CPQA 1D9EA 5EBUA 4BCEA 1AZ2A 4CD5A 2WPGA 1A0EA 2WJEA 1XH2A 4UZUA 3CPRA 1WZKA 4LBUA 4F40A 1A3HA 4Q3MA 4BI7A 1AODA 3MWCA 1E4IA 1UR4A 4NZ3A 4MNLA 3CMFA 2V9DA 5DFAA 1QAPA 3KCLA 1K1DA 1ZTVA 5LIKX 3VDGA 3W1AA 1P6BA 5C7VA 1QFEA 1QO5A 2PWHA 3VIFA 1J0IA 3VOGA 1GOMA 5HQLA 4N02A 4GZIA 1VBJA 1EJTC 3A5VA 4L9XA 2QGYA 3AS1A 1WAUA 2Y62A 2WK2A 3CUJA 4QP0A 1XW8A 2VEMA 3M16A 5G2WA 1T96A 4UTHA 4G8TA 3CTTA 1W3IA 2V30A 4KCTA 3KOXA 2E6AA 1AD1A 3UXIA 4A8IA 3W81A 3IRDA 3NWRA 2BTMA 3FGCB 3LXAA 4LSBA 2WWDA 4GPNA 3WQ6A 2Z1VA 1AJ2A 3NL5A 1HF6A 3BG5A 5AYZA 4ATWA 3KZPA 1C7TA 5TD4A 5JBDA 3QC0A 1QW7A 5E1QA 3HM7A 1J0ZA 4GIAA 5BU6A 3LSCA 4AEOA 1KTBA 3VK5A 4J1OA 2E5DA 4PTNA 4J3ZA 2BV9A 4YVVA 1US2A 3S2LA 1S46A 3B8SA 5G2IA 4WXYA 3QGVA 3D46A 1ZAHA 4MKSA 3W6MA 4PFHA 4Y90A 1GOOA 3W1UA 4NVTA 1EBGA 3R5EA 4IM4A 2PTZA 4CQ9A 4UFIA 2VTFA 1FWJC 4J2PA 4YXGA 4DEFA 4P8WA 3UFYA 2WMIA 4MY9A 3ZWSA 1TJPA 2DSWA 4HVXA 1S2CA 1BGAA 1Z6KA 1JZ2A 3KVMA 2CZDA 1O4UA 2EG8A 1UWAA 2DH3A 3WLJA 1E4MM 4K38A 1IEWA 1EJUC 1GVEA 1ENUA 3WLIA 1TJ2A 4S3DA 2YKKA 3FVMA 3NZPA 1PZ0A 4HNUA 1TCDA 1EDGA 1PKYA 1KQZA 3T05A 3TC3A 3M0XA 4W8BA 4HKPA 3EWUA 1DE5A 4AIBA 3QW3A 4IIEA 4MFEA 1D3GA 4TVUA 4I5RA 4DZAA 1PIFA 4WRHA 3W7PA 1TRDA 3NAVA 4N6EA 3W70A 4AC7C 1M9HA 4XX6A 3AZRA 3BLPX 1RV8A 4GOAA 3CU2A 3VPLA 4FLRA 4O1EA 3AC0A 3AZTA 2EF9A 1XCFA 4DY1A 5EMKA 3LBCA 1OF8A 1RCOB 3RXZA 3TU9A 3STPA 2P76A 4ICMA 1QXLA 4NZCA 2EEXA 3T8QA 2W63A 5JMUA 1FHLA 4PTXA 1S1RA 3C2VA 1UKOA 4WVXA 3C5QA 3WD0A 1IQ8A 1XQKA 1KKRA 1V0LA 5BROA 3E38A 1AL8A 1B9ZA 4GZJA 2MNRA 1LWJA 1PX8A 3A4WA 3MMDA 1BPLB 3CZGA 4RK8A 2BOFX 4CU6A 3UQNA 4L6DA 4DB7A 4M7SA 3I7QA 3SJ3A 3W00A 4EF8A 4GYPA 1RCQA 3KL0A 4IGNA 4RDYA 1W3KA 3APTA 1F05A 3WMLA 1JPHA 4AD4A 4L4OA 5DXYA 4QSFA 3QY6A 3PG8A 4JBRA 1HKMA 1MWOA 1TPVA 3A23A 1XIEA 3M0YA 2ZRUA 1YXYA 3G0UA 3E3HA 3VYLA 4O14A 4I5XA 1MI3A 3QC3A 3C0QA 4WLCA 3S1WA 4KWVA 4BF5A 1MUWA 1R3QA 4V27A 2DY3A 2HV5A 4XZWA 1JCYA 2PZNA 4TV5A 3R94A 1MVYA 4EF9A 4HSNA 1ZPTA 2YL9A 2W67A 4IPPA 4IFRA 2V2HA 1EQPA 4L9YA 4JIHA 1WDDA 3AU6A 3IJ7A 1MW0A 2G37A 4MTVA 4MF4A 3NQMA 4XSMA 2ZUSA 4NZ1A 3RPDA 5A2BA 5KSWA 3CUZA 1YE6A 3OVQA 5FF7A 4GVHA 1TV5A 1T5AA 3HMJG 2R1PA 2UY3A 1ZBWA 1H5VA 2JIWA 3SCRA 3JU2A 2VI0A 1NWUA 3AUOA 2Y61A 3TJ4A 3UJRA 1JZ7A 4YWSA 4JYFA 5HMFA 3N11A 1AG1O 3TFCA 1TTIA 1MQPA 4P2VA 2JIEA 2BG5A 5CGMA 1HKWA 4PGLA 3L4UA 3N14A 3B9AA 3WH5A 5AC6A 3W7CA 4I9TA 3B0PA 4AYGA 3W4RA 4F0LA 3UP8A 1KNWA 3LNPA 1ZSXA 3EPNA 3PN8A 3AWOA 2OJPA 4IG2A 2JEQA 3INPA 1H63A 2WHMA 4AXNA 1E6XM 1CDGA 3Q94A 3HJEA 1FFQA 1PYMA 4IFKA 1TPFA 2ZX6A 3K1DA 1V6XA 2GVEA 2EPKX 2XZ9A 1H62A 3SUVA 1NWRA 4QITA 1RPKA 4KPLA 4KRTA 3I3EA 1GT8A 2Z25A 3OTRA 4GX8A 3RRXA 2JGQA 3FFSA 2FMNA 2XN0A 5D02A 1Z42A 1K8YA 2INZA 1KBLA 1ZJBA 1YNPA 2WC3A 1FWRA 2A3AA 3GWQA 4M19A 3HFTA 1CGYA 1QNRA 2FGBA 4E4PA 4H9TA 2A79A 2ZE3A 3L4WA 4ZOBA 1RJRA 2OPJA 3EA1A 2O56A 3VU2A 6TIMA 4O15A 4S3GA 2PDGA 1XBVA 5AN7A 3RF9A 3WQOA 3IIVA 3W29A 2C79A 4J35A 2YDRA 3OJGA 1V0KA 2EPOA 2J7CA 4ZGYA 3MVTA 1VFUA 3G6LA 1LTDA 3EMCA 3WELA 4B92A 1TWWA 4N9CA 3VIOA 2W91A 1BXNA 1H60A 3I3DA 3S9YA 2XSAA 1WCGA 3V1HA 2PWEA 5HULA 3SRHA 1TJ1A 3AJ7A 1FFRA 3CXOA 1LQAA 3S1UA 5AVNA 4I3GA 4WKHA 4CNSA 2CZEA 4C91A 4Q22A 2VOMA 3U57A 3FHAA 3LY0A 2B7OA 3CK5A 3UJ2A 1UD6A 3A21A 3ARYA 3F5LA 4WJXA 5A8NA 4JQ3A 3DFSA 3H70A 3LPFA 3GDTA 4IL2A 3HPSA 1GKPA 2J9XA 4JYEA 4JNMA 3QKEA 3C61A 4K1WA 3PAJA 5ABEA 1DPMA 1DXEA 4LBSA 2RGLA 3AIUA 2YOCA 1VJIA 2ZX8A 1GW9A 1KCLA 4GABA 4HYWA 2POZA 1JD7A 3W23A 1WV2A 1GPWA 3CWOX 3T0DA 2ZXBA 1PDZA 1FOBA 1MZRA 3BAXA 2FDMA 4HPXA 3CH0A 2OXNA 1UR1A 4H6KA 5IDIA 3NQFA 3WDQA 3QKZA 4PRWA 1F3EA 2QCGA 3A24A 2WAGA 4BI5A 3BCFA 3LQLA 1P6CA 3WBWA 4BQ4A 3ES8A 2GUBA 1QOQA 4Z2JA 4TX9A 1FWWA 3MUY1 5CSUA 4LF2A 3BLDA 4XB3A 3E5PA 1HO4A 3BJSA 4ZB0A 4M82A 2H3BA 4CD7A 4QCEA 4RJEA 1SZGA 3MPGA 4HD5A 1EX5A 1BRLA 1TIWA 2GK1A 3WLRA 3U8GA 5H91A 4RDVA 4AWSA 2GGEA 1NTHA 1H1YA 3PZMA 1WKYA 4C5ZA 1DE6A 3VOHA 1BXCA 2VURA 1XGEA 3NQ8A 3SCQA 2VR2A 3TYZA 1WP6A 1DKWA 2G5WA 3O6CA 4JTJA 2AQOA 3P0XA 1DHPA 1LF1A 3APGA 1RY8A 4PSRA 4NNAA 3CV1A 1EPVA 1H3GA 4F9JA 1BYAA 1KXVA 4GA8A 2G3IA 4AUBA 4KESA 3V3WA 1W9VA 3NQBA 3WL0A 4LS1A 3Q67A 1R86A 5BMWA 1XKJA 3THQA 2C19A 4HHLA 2QV4A 1P4CA 5FSEC 1KWGA 1GQJA 4Z2LA 4KWUA 3VMNA 4Q6JA 1QR7A 5LSMA 1UPMB 3QLLA 4XD6A 3SECA 3SUSA 1FCQA 4IIGA 4ECLA 1G0CA 3E0IA 2AAMA 3L0KA 1NIUA 1P7TA 3VOJA 1DJZA 1Q13A 1TPC1 3DU0A 1C91A 1ZAIA 1P0KA 2ZC1A 3UWYA 2C18A 2PS2A 2EQDA 4JIIX 3FDKA 3FS2A 3E2RA 3O6DA 4HYVA 1EWEA 5GJNA 4A3YA 2WV8A 3AIEA 2XH7A 4ZENA 1R7AA 4FNUA 2NXGA 1SFSA 2EHHA 2GQAA 5JH2A 2PODA 1K9DA 4AIEA 1FUYA 4RW3A 1EHNA 3RYSA 3TX9A 2WSKA 4HNLA 4DJFC 3H2MA 4FOKA 2R6OA 3UCQA 3E0VA 3PBMA 3V7PA 5A8PA 1N55A 1TUFA 4DHGA 1X96A 5EFDA 3VC5A 2INFA 2YDSA 4Q6XA 1QK2A 3E9AA 2G3FA 1FDYA 4CD6A 1WUFA 3NUKA 2CXGA 4RV8A 3PBYA 4P7LA 4URIA 5KZEA 2B7QA 3O3RA 1M04A 4HHMA 3TTSA 1MEWA 1XH1A 3WQFA 3PZVA 4CQBA 4AH7A 1EP3A 1EYWA 1DJHA 1NDVA 2REQA 3OGVA 1NELA 2O7QA 2YDAA 3AOFA 3S2NA 3UERA 3CZLA 3I6RA 1KB3A 1GK8A 2WVTA 1GHRA 4KFPA 4KRUA 5A6TC 1ONEA 3R0KA 3M07A 2GJPA 1NJJA 3TN5A 2HE5A 3EXSA 1OC5A 2A1YA 4DNHA 4ZBCA 3B8UA 3KM8A 2HXTA 4NNCA 1C92A 2XIOA 4LC8A 2HVOA 2JALA 3WH8A 3NXLA 2V5KA 2CERA 3EWBX 3BAIA 4HOZA 3GNOA 5HPCA 3BMXA 5A2CA 2IXVA 2GGIA 3K4WA 3LYEA 4HK7A 2H90A 3ZSSA 3WNNA 5XINA 2A3BA 3VTRA 1V4YA 4K36A 1TKKA 4O16A 1FWIC 1KM2A 1H4PA 3BL3A 3GNPA 3NR0A 3WL1A 2DDXA 4XZIA 2ZZ7A 3VABA 3VXGA 4MKVA 1E1CB 1RH9A 3ZYZA 3KE0A 2YX0A 4RR4A 4B5NA 1US3A 3NPVA 2VGGA 1XLBA 2VENA 3W85A 5LHFA 3VKDA 2XU2A 3W82A 3NDZA 2YIHA 3BICA 4WSKA 4MUPA 2HCVA 1TMQA 4QLKA 5HPOA 4NT0A 2BASA 1FWAC 1UH3A 1R46A 1E40A 5AY7A 3O1NA 3ELFA 4JL1A 3LOTA 5D4YA 4LAMA 2WWCA 1KR1A 1N7KA 2ZKMX 4OOZA 2NQ5A 2ZA3A 3LPGA 3QY8A 1A53A 1AH4A 3ZQ9A 3V1PA 1P1XA 1JCTA 4FMVA 1XIGA 2G50A 3ZVHA 1NQKA 1V5XA 1FCBA 1UHVA 4QE5A 1Z41A 5LGZA 2WMGA 3K8KA 4MVAA 1ALDA 5HNUA 4L6HA 4IG2B 3GXMA 4X3ZA 3VKBA 4DO7A 2OU4A 3ARSA 4JFSA 3AMKA 3WY1A 2IQTA 3OOQA 2YCKX 1ITUA 3AIRA 1J01A 2Q8ZA 2B31A 1GNXA 1GZJA 1RVGA 2FB2A 1LT8A 3EOLA 3RITA 3TUUA 1LRQA 4H9UA 4NJGA 3VUPA 3LTYA 3MA8A 3R0DA 1XIMA 1ZHAA 2CBVA 2ZUVA 1EF3A 3ZXWA 2ATSA 2BGQA 4Y96A 2QNEA 2NVDA 1PPIA 4QX4A 3T40A 2JBMA 2XGIA 1B0IA 1CCWB 1JYVA 3W76A 4ZO9A 3SCTA 3LTPA 4N9BA 1ZLPA 4J3WA 2PDUA 4IJCA 1V03A 1GJWA 2X0HA 2BWGA 2VRJA 2XDFA 5BRQA 1ZENA 3CHEA 1DWJM 4LXFA 4FNRA 3PBVA 4GI9A 2GDQA 1CWYA 2FVMA 2Z27A 3PWAA 4G1NA 4H01A 3C2EA 3L0GA 3WFLA 4IZGA 2DGAA 5TQLA 4B5TA 7ENLA 1SUXA 4MAVA 5XIAA 4LC6A 3GG7A 4JNZA 1REQA 3CV6A 1OFEA 4IGMA 3PNUA 1UQYA 2FZBA 2Z1XA 2VXNA 3PTQA 1IT8A 4ZQRA 4JIEA 3FVDA 2VDGA 2ZA2A 3CIWA 2Z24A 2DSVA 1OY0A 1QJWA 1QPOA 3P7YA 5HATA 1FVPA 4WR3A 3TW9A 1GTHA 2CBUA 3N9KA 4ZOCA 3T7VA 3GIQA 2ISFA 5F4XA 3CPUA 3T08A 4AZCA 4ADUA 1X1NA 3C3NA 2DU2A 1DV7A 1HUVA 2NSXA 2O9TA 3NNTA 4MJZA 2OLAA 1R6WA 5IOBA 1K8CA 3AO0A 1FTXA 4LEFA 3W6LA 1XYCA 1BTCA 4WXZA 2JE8A 1E0VA 3LBMA 1AH3A 3CZKA 2GSEA 5FL1A 4FOJA 4L64A 4OJYA 2Z0IA 1XFCA 2YFOA 3P74A 1XDJA 1P6WA 1ISZA 3VNMA 1OSEA 5G4HC 4ZSUA 5HJLA 5J5RA 2PLJA 2TAAA 3UNDA 1H51A 2PDJA 4OWGA 5LNWA 1VFTA 3FK4A 4J40A 3MI2A 2UBPC 3HG3A 1HNYA 1QNSA 4DNMA 4ZMGA 2OR2A 3WF1A 4DO4A 4EP8C 1UCWA 3GB6A 3MU7A 1I45A 4AZGA 4JTEA 1E0XA 4H9VA 1UIPA 5FF0A 2GJXB 2EXOA 2VR4A 4PRRA 1TQJA 4XAPA 4GUGA 4AZBA 1DBTA 2R24A 4S3FA 2NXIA 3ECQA 1RLDA 5FJRA 4EKJA 1LRNA 3PVFA 3MHFA 4BQ2A 2RH9A 3BLLA 3BQ6A 1XRTA 3TEVA 1AQMA 3ZT6A 1TMLA 4JTGA 5F1VA 1G6CA 3ITVA 3KBJA 4H1ZA 3FAWA 4E38A 8XIMA 4ADTA 2DVUA 1R3TA 1EFZA 2QZRA 2DIKA 5D2YA 1B31A 3HG5A 1OCNA 3T4WA 5CG0A 3LERA 3ITCA 2OZ0A 4FHAA 1GQLA 3RPMA 3TONA 1OYCA 1WOBA 2Y24A 1JYNA 1KBBA 4OQVA 4K68A 1KM1A 2BP1A 3CASA 4B3ZA 3VZXA 4NYYA 3WH9A 4R7WA 3KWXA 4WDUA 3U2CA 4HCHA 5HMDA 1JL8A 3TKFA 1BG4A 2CLIA 1XISA 3CQHA 4KERA 1WDSA 2V3GA 2GPTA 3M64A 1A5LC 1O5XA 1IEQA 3LXCA 1HP5A 1CNVA 1VEMA 1E6ZA 2AMGA 4AQLA 5A1AA 3NJ3A 2Z4GA 1LWHA 5AHLA 4NHVA 4Y8FA 2IPWA 3TW6A 2P3ZA 1UH2A 2Y85A 4EXBA 2WW5A 3UVIA 1TZZA 3KWSA 1K03A 4J4KA 1Q6CA 1MW1A 3Q58A 5C9UA 3ALFA 4LV9A 2VHLA 7REQB 4KFNA 4DYJA 4G9PA 2FZ9A 1K6AA 3WQVA 5LA2A 1XSJA 2Q3RA 3SCWA 4AZ7A 4I7WA 7TIMA 1Z3NA 4QDWA 3MUZ1 1D3HA 3LEPA 1AH0A 3P14A 1MO0A 2KAUC 1NAL1 2TODA 2OWCA 1YRRA 4TQTA 3LLFA 3G0XA 1JCNA 2PBGA 3QZ6A 2F61A 2NSOA 5EY5A 1BKSA 1LLZA 1KRAC 3HU7A 3L4TA 4FSAA 4KIEA 3VIPA 1TX0A 3GUWA 1XRSA 3ORWA 3G1VA 5BXTA 5I02A 4CNOA 3KHJA 1VFLA 4M24A 2YW3A 3VMPA 4NJIA 3M7SA 4JEQA 4Z17A 3M1ZA 3B4UA 1NDWA 1XWYA 4NXKA 3S5ZA 4MKNA 5IHSA 1IEXA 3WENA 1F4AA 4WSHA 1GZ1A 1UKTA 4FXRA 4YTSA 1HJSA 4LFYA 1U1JA 6XIMA 3NZGA 5EMYA 1NWSA 2FTWA 3WLMA 4PUWA 1PWMA 5CPSA 5AYBA 3O8AA 2YCLA 3P93A 2VFGA 3SY1A 2HBVA 1W9BM 4R85A 3VC6A 1RJPA 3KL3A 3WUBA 4R33A 2A7PA 3T81A 5IBXA 1A49A 1LWIA 3UEQA 5TIMA 3BAWA 3WBXA 4CUCA 5GQBA 4B90A 3NL2A 4CEXC 3NQGA 3M0KA 1BF2A 3H22A 5G2HA 2C71A 3FW6A 4Z2HA 1ZBKA 3OA3A 1A50A 4KETA 1TMHA 2CW6A 4JTRA 1Q6DA 3TMQA 2RDXA 4POCA 2PDQA 4PB5A 1F9CA 2VCAA 4OVXA 4CQAA 1WZAA 2VGFA 4Q4OA 4G2DA 3HA1A 3GW3A 3SADA 3MUCA 5CJ5A 1H1NA 2VYOA 3N29A 4GQGA 2E1WA 3N04A 4LUSB 4WX2A 4BY3A 4LYPA 2X1UA 1RBAA 3FSUA 4AF0A 2YXGA 4U33A 2A7NA 4Y7EA 2JKEA 4PN2A 3UXKA 3YPIA 4JR5A 3KBMA 1TWSA 2O4MA 3H4WA 1KGXA 4ZXLA 4C1NA 3TTOA 1KXHA 2PU1A 1RQBA 3F4VA 2PMQA 3KDOA 1T6MA 2ZUTA 1LL7A 1HQTA 3UETA 4WY0B 3WMSA 4GVGA 4AZHA 1VB9A 1J0YA 4JN6A 2CLHA 4AMAA 1AQ0A 4QSHA 3OYZA 4DJDD 5FEWA 3N17A 2WKJA 1POJA 1F8MA 4HCLA 2YBTA 5E93A 2PDPA 2QLYA 2G3NA 2VDIA 3NGFA 3NYZA 1JZ8A 3T07A 5K9CA 1OK4A 3CS2A 3ITYA 5CSSA 3S1XA 2BOEX 5CBIA 1AW2A 2XIJA 1XUZA 4PBGA 2ZZ6A 2YW4A 4U2YA 4G6CA 2CLLA 1BQGA 2PUZA 5A5WA 4R53A 1XC4A 4MNKA 3R8HA 3OZOA 3MBFA 5CZSA 5CZTA 1E9YB 4JL2A 1XYLA 3NL6A 4JY9A 1XCWA 1E0WA 4V1YA 4O4VA 1TV7A 3ARRA 4AEFA 1ZB5A 3CB3A 5LYRA 2HZGA 2HSAA 3BPWA 4M8UA 3C8FA 3GXPA 2GUUA 5A3HA 4M5PA 3F4DA 1JAKA 3GG8A 1GEQA 2XH4A 3QV9A 4YMZA 3CNYA 3T0CA 2O0TA 4Y9MA 4B4FA 1OJXA 3WNKA 4C6PA 1OFPA 3G2GA 3O06A 1V02A 4RL3A 2E9LA 3UNTA 1W5OA 2OSWA 3WEZA 2HNHA 2VUYA 4NAFA 2VWTA 4DWSD 4MJ2A 3WNMA 4O52A 1GKQA 4MLJA 4H8NA 3KS5A 3G1FA 4K8HA 2B7PA 3IGXA 4M6PA 3QR0A 1K7EA 2AL2A 3TQ0A 4GX9A 1B3XA 3H2NA 2E5CA 3QHNA 1ZZMA 4HK5A 3ZLGA 5HMEA 3TYEA 4AZ5A 4XG1A 1EO7A 3GHRA 3IEBA 5AC4A 3KTCA 1M7PA 1UBSA 3MUAA 1O1HA 4PBEA 5CC3A 1MXSA 7ODCA 1P0NA 3UF9A 4ZFCA 2QVNA 3QLDA 4QG8A 2VL4A 3WFAA 3MKKA 1X39A 2YL6A 3Q37A 1XIDA 1B4EA 4MFDA 3URAA 2Y1HA 3KCJA 2R1LA 2F9RA 3FEQA 3GVQA 3LCGA 3CM4A 4IXHA 3SRKA 3MY9A 3QQ0A 4N0RA 2ISWA 1CLKA 3LSBA 2J7BA 1TPDA 4DXVA 3PTDA 2X0SA 3VE9A 1XIFA 1LRTA 2FVLA 1VHNA 4HPGA 5GNXA 5BXSA 1AUSL 1DXFA 4HA3A 4WDWA 2PC8A 2CHOA 3VGBA 1ME9A 3I4KA 4PE8A 1G5AA 1DQWA 3PPFA 1QI0A 2WMJA 4BZYA 4KWOA 3N2TA 4PBFA 2YYUA 3DBNA 3DFYA 1Q6FA 2QDHA 1PTAA 4LBRA 3EEGA 4XWUA 4WHBA 2EG7A 3N6HA 3UZJA 1PTDA 2GVJA 4AHPA 2D23A 1T8XA 4ZTYA 2V5JA 2VFEA 2PDKA 1G67A 1V8EA 3M0ZA 3M0JA 3AS0A 3DG3A 3USBA 4GWEA 2QCEA 4N9EA 1TELA 2Y7DA 1L6FA 2Z2AA 3SFKA 3GQYA 5M03A 5I3DA 5C2GA 3A64A 4UOJA 3IGUA 1FH7A 1L6WA 2DZTA 4D6GA 3NQ2A 5EU9A 3U2OA 1SJBA 5TNVA 3CZ8A 1Z8AA 4MNJA 5EL1A 1B4KA 3B8VA 4JTIA 3I65A 4GHRA 1GG1A 1OD8A 3M4HA 3MYPA 5BNKA 2NX1A 3C8NA 3IGSA 2EKGA 1LDCA 3UG4A 1ZFJA 3V0UA 3NO5A 1CB2A 1UMLA 4RUBA 2VM8A 3K8LA 3P80A 2VX7A 4V15A 5CPMA 1C8YA 3RGTA 1H50A 1YDOA 3C86A 4JFTA 4H04A 4AAJA 2WKGA 2XISA 1HL8A 3NQ6A 4JDYA 3TN6A 4UQ9A 1ZP3A 2VVSA 5REQA 1YDNA 1FWNA 4AU0A 1X1ZA 1YHTA 4DI8A 2X30A 3NQAA 3BJTA 4JTUA 3VOCA 4GNJA 5B80A 4GUJA 1IWPA 2GYIA 2ZZ3A 3FV9A 1FXQA 2Z1KA 3XIMA 1DWAM 1KFBA 3AYVA 3AICA 1EJWC 4RNFA 5FF3A 3UZYA 5KETA 2GJLA 4LX4A 2JF7A 4LRSA 4E4FA 2J9YA 3O6YX 3ISIX 5BWFA 2YBUA 4GK8A 2D2GA 3AYSA 4G5DA 4D1JA 3U7BA 4WGHA 1ICSA 2NX3A 2QIIA 2F6KA 3FSTA 3F2CA 1FY6A 4NASA 3POCA 4TMBA 2YJQA 1B30A 1KKOA 2VZUA 2CLMA 3UPWA 4GZ7A 3VOFA 1JPKA 3LU2A 4AFYA 1TZ9A 1C8QA 4FA3A 1RCXB 3TN3A 2D0HA 2Y6ZA 4OZOA 3GC2A 2G4JA 1X8FA 3P61A 2Y8UA 3L5AA 1I2PA 3PBWA 5AB3A 1D2KA 2E9MA 1EEPA 5A94A 1K3UA 1SSGA 4XBKA 3VM5A 1JZ6A 3K2GA 4IJRA 4MWAB 3CUFA 2PLMA 2BDQA 2CLPA 3PNZA 4K8EA 1GONA 3Q4DA 5C6MA 4UFMA 2P5NA 2IPJA 1W3LA 4MIMA 2GSJA 3UR7A 5LKYA 3NSXA 2KZHA 4FPSA 1GVRA 4M0XA 3UG5A 4U5IA 3N19B 3CHFA 1RA5A 4LT9A 1A5BA 1WX0A 3W7KA 3BMVA 4I6KA 2HQAA 1E9LA 1CECA 1RP9A 2IKGA 2R94A 1Q65A 1BHGA 4LJ3A 1W0MA 1G69A 4UR8A 4UFJA 1RR2A 3N2CA 4LNYA 4U31A 1ME7A 4DZ5A 3W6YA 3P81A 4JQ4A 3CBWA 5DX7A 1UBPC 2HISA 4FK9A 4RV3A 3WBYA 1XLLA 1PL9A 3AZSA 3WMBA 4L4LA 3O7UA 1ISXA 1WQ5A 5GJPA 5CBBA 1TRIA 4IPJA 2WLYA 2WVVB 3G22A 2YXXA 3AQUA 1DL3A 4JHZA 4B5WA 1QHZA 5CGTA 4OGZA 3CUHA 1CLVA 4Q4QA 1I8JA 2QJIA 3G0SA 1KR0A 3KOFA 2CU0A 1L8NA 4H6EA 4O50A 5KMYA 1YYAA 2IPFA 1A5CA 3W1NA 4FS9A 5F2GA 4DYKA 4HZ7A 4WUIA 4U3CA 1FWHC 1ZNNA 4KEMA 3VM7A 3IV3A 1W54A 3IIOA 1JCMP 3C0SA 2YA0A 4CCZA 4J9JA 3GH5A 5H8MA 1F07A 2FZNA 3FY1A 4R3UA 2DW7A 2BFGA 1CW2A 4D1IA 7REQA 3DZ1A 3C3UA 1GVIA 3GIPA 4XKYA 3LHZA 4DI9A 1OB0A 2DZSA 2J78A 1NM9A 3EZ4A 3NEVA 1MDRA 4F8XA 4YWIA 4ONVA 1F6KA 3SO7A 1QPKA 3WQCA 3WLLA 1DQXA 3V36A 5C2XA 3G1XA 1H7NA 3MP3A 4PL2A 3GXDA 4OV4A 4LCRA 4H7CA 1B2YA 5BWAA 1K7XA 3WQEA 1ZP4A 2F2KA 4Y9PA 4IIDA 2XGZA 1XV8A 4PODA 3BVJA 5BXRA 4IIBA 1JF6A 4AZIA 4J3SA 4DPQA 1S38A 2ZUUA 2J7HA 5MKGA 1WB0A 3NOEA 4IMEA 5F4SA 1JEZA 3PPGA 2VCCA 5CBJA 4L6OA 1H49A 3U7VA 1KM3A 4PCTA 1KM4A 3OVRA 2F7FA 1AVAA 3PWIA 3SI9A 3T78A 4P7RA 2W0UA 3RJYA 4P8XA 4TIMA 1ZJIA 4CVWA 5LNUA 3ABQA 4UB9A 4ACYA 1UZ1A 4MWAC 2VFIA 2ZA1A 1MDLA 1Y7VA 2NV1A 1QI5A 2NQLA 4UTIA 4UMAA 4DJDA 2XTKA 5DN1A 2PI6A 1QPQA 2QEZA 1RVKA 4GIEA 3MS8A 1A0DA 1PX4A 3KLKA 1Y65A 1W9UA 4D8AA 4IUOA 3QTGA 2ADAA 1VP5A 3ARWA 4GQQA 2XVLA 1GOIA 3SGGA 3QHOA 2V82A 3ZLFA 4CLMA 1EP1A 4HZ8A 2PTWA 1CTNA 4NZJA 3OP2A 3QOKA 4A3HA 3P0WA 4QXIA 1E6SM 1S2UA 1Z44A 3ARVA 2GLKA 4PMZA 3L23A 1RQHA 2WC7A 4ORIA 1XIJA 2A4AA 3V16A 5C5YA 1XLCA 1U5HA 3QRHA 1NARA 3NQ7A 3EKZA 2QJJA 1V3LA 2J7GA 4HSHA 3SSJA 4C6LA 2DZVA 4QG9A 1KFKA 3OODA 2D22A 2OELA 1UKSA 1K9FA 3RUBL 1TWDA 3W74A 1HXJA 3GVGA 1RHCA 2WKLA 5CQ1A 4QS5A 1EJSC 4AWEA 1UMYA 3R11A 3CYVA 3GC4A 3PB0A 1K9TA 4NY2A 4DUWA 2PEVA 2WJZA 5AHIA 1DXIA 3G8EA 2YL5A 4O19A 5J04A 3GNNA 2A0NA 1DWHM 1JRCA 3QR1A 3RLGA 1HT6A 5GJMA 2J4GA 2QCFA 4IIFA 2XZ7A 5LNSA 3CB8A 5BW6A 3GDLA 3N1AA 3CGTA 1UR9A 1XQLA 3ZLHA 1LT7A 1E55A 4KBXA 1UA3A 4M56A 1K8XA 2VZTA 4TOQA 4EXQA 1EH9A 3W84A 2VOTA 1V7AA 4MLRA 2BVTA 3NSMA 3RX2A 5EGRA 1GYLA 3UGVA 4XBSA 4AX6A 4UR7A 1NEYA 3DHUA 4GZEA 1MUCA 3M0IA 1S5VA 3L2IA 1KD0A 3CJPA 4S23A 4Q8VA 3E2VA 4AVNA 3W24A 3WDRA 3A5FA 4CN4A 3OO2A 4UQEA 5DLCA 2VMFA 4ALDA 2CLFA 4N9DA 3BLKA 1J6OA 5FAGA 1EIXA 3B06A 2WZMA 2G97A 1CX9A 3W73A 3WK3A 4WKAA 1VRXA 4F48A 3ITGA 4KGJA 1WZLA 4B91A 3PHAA 2BY2A 2J7DA 5REQB 5ECUA 1V02E 1KC7A 3COTA 1UJPA 3WIJA 4ACZA 2O4QA 2WJFA 2G3MA 3ZM8A 5JIWA 5FA5A 2G41A 3TFXA 3N2BA 2XWDA 2WNZA 3ICJA 1GG0A 2W4XA 2UZ9A 3PJWA 4S39A 3P67A 3G1HA 1QRQA 2DH2A 3W7RA 2XN2A 4PTDA 1OX5A 3ATYA 1TA3B 1OC6A 2QMJA 2RHGA 4GY0A 1W2VA 1ESWA 3W7GA 4CNTA 2AKMA 3AS3A 2POTA 3G1YA 4DWSC 1K9EA 3UBPC 1TYGA 3P60A 3U0HA 4ES4A 3U5UA 3VDBA 3GG1A 1H7OA 1RXOB 3A4JA 5K4ZA 1QDSA 1NQ6A 3CAKA 4NUWA 2OYLA 1XLFA 1DTUA 3VCCA 2PFHA 4UNLA 5ABFA 4HPJA 3RJXA 1J4EA 1VYRA 3O2LA 3TXVA 5FEZA 4AWUA 4QGCA 4HU3A 3TAOA 3HZ3A 3BJFA 3VNIA 5JU6A 1JGMA 2DJLA 3V0TA 4F9DA 5M1TA 4PCNA 3DFHA 4DJFD 1PSCA 2PE4A 4J27A 3LMYA 1YMYA 1P0DA 2CWNA 1XLMA 2FZDA 4YVPA 4IQLA 1YXCA 2FHFA 1ZL1A 4GBUA 2I57A 2BGSA 4L65A 3ABSA 3QTPA 5DCDA 4DO6A 1U5JA 4GJIA 3KXQA 5B7YA 2FLIA 3GNDA 3OVPA 2GK1B 2XM2A 2OCZA 1E56A 1R2SA 1TA3A 4LW7A 4PL1A 4WY0F 4W8AA 3DOPA 4ADSA 3U2ZA 4O1DA 1JQVA 5CH9A 3QFEA 4ZCWA 2BZNA 4HQVA 2ZZ1A 3FCPA 4C1KA 3GTNA 2MUCA 4C90A 4JNYA 4EOUA 1LOLA 4K7VA 4C6IA 6ALDA 2H8XA 3BE7A 1I60A 2WNQA 1TPEA 4W84A 4A6GA 4HT3A 4NKCA 2R1NA 3I6EA 4MB4A 2X1RA 2VFFA 2R1MA 3QN3A 3KTXA 1JGIA 3T2PA 1KXTA 4O17A 5DCEA 5GVJA 4RPQA 3EWYA 3U3HA 3EDFA 3B40A 4B5XA 5LHEA 4A3RA 1S3HA 2PDIA 3NQCA 4C6FA 3A3HA 1YKWA 4IFOA 4O54A 3CC1A 2D1ZA 3LX9A 4C6EA 2ONEA 1E51A 3VIMA 3PY2A 3AJXA 4XZBA 4UCGA 3TZFA 4XAYA 2HROA 3ZWTA 5I7GA 1H11A 3IUHA 1PVNA 3OBKA 2ZE0A 1R3SA 1EGMA 3MZNA 4LAKA 5ABFB 3DX5A 1TFVA 5BRPA 5HMSA 2RUSA 2QDDA 5EA9A 1XYFA 4RE3A 4NAEB 2WZEA 1NDZA 1ME8A 3NYDA 4ZB2A 1AL7A 1ISWA 1OEPA 3RCYA 1H7WA 4EWND 2DFAA 1JNEA 4LEQA 3SQLA 4QEHA 2HNEA 4QR6A 4W89A 2NZLA 3C0LA 1PZ2A 3EB2A 4RW5A 1KFJA 1M53A 1BGGA 2Q02A 1UP3A 2XH2A 5FJOA 3LCHA 4AXKA 2OVLA 4GI4A 5FESA 2BXYA 3GDMA 2ZICA 1YPFA 4JX4A 3U6WA 4RZ6A 4CEUC 3B0VC 1XBYA 3JVAA 1UWQA 2V5CA 2YPIA 2XFYA 2VGBA 2D2HA 1OBAA 3LK6A 4IF2A 4J3TA 3CV7A 4K8GA 4ML4A 4DZIA 1CXEA 4AVOA 4MB1A 3RMJA 3WQ8A 3TTEA 2OQYA 3EX2A 3V5CA 5CKSA 4QJ4B 4LYRA 4NRRA 5F2LA 2Y5EA 4MMWA 1AA1B 4CCCA 3H2FA 3KBWA 2X41A 2D24A 2ABBA 1S39A 3CO4A 1ONWA 4IPLA 3TAKA 3LI0A 3WX7A 4S38A 4DELA 1TSIA 3IARA 2E67A 4IMDA 2NVCA 4GI6A 5HK4A 4D6IA 1PKNA 3HFYA 1HKJA 1OQFA 3NURA 2W27A 3STCA 4W8LA 1LL4A 3B9NA 4GXWA 4HPHA 3UPMA 3EGJA 4LCSA 3OB8A 5A6MA 3V18A 2J25A 3KS6A 2DEPA 4E5TA 5D2VA 3P82A 5JXQA 4IOTA 5D30A 4JICA 2FYMA 3S46A 2B4GA 3M0HA 1QBAA 4UTUA 1W3TA 5F2MA 3OGRA 1EGZA 1XIIA 3PANA 2FHCA 3LPOA 1E3XA 1F73A 4IICA 4Q7NA 5H1WA 3PPHA 2GOKA 1V3JA 2EG6A 4PSPA 3SSZA 3SN0A 4LAOA 4Q8NA 1M7XA 1SFJA 4FX6M 3LBOA 1NP0A 4LQ1A 3TYCA 5FJUA 3EPOA 3KBNA 2QXWA 3GVVA 2V38A 3ENLA 1ZU8A 1E1EA 1UG6A 1QI3A 4Q32A 5DMYA 1FWBC 4WCJA 4IH3A 3CQKA 3LUTA 4UWMA 2VZSA 3HJZA 3LPPA 5HNTA 2YYTA 5LA0A 4AY7A 4UUIA 3LZ5A 1EC9A 2HMCA 3PM6A 3F03K 1B1YA 1C93A 4HYRA 3T09A 2QUMA 3KEHA 1QW9A 3B8DA 2GZXA 2G96A 2FH6A 1BYDA 5M2FX 5CSYA 2OFJA 2QT3A 3K5XA 3EKGA 3TP4A 2CHNA 5T9BG 2PPGA 4A21A 4ILSA 1UZ4A 4W88A 2ZZ2A 3WD4A 4C6DA 4UR9A 3LZ3A 1W5PA 4GXMA 1EXPA 1PX3A 2FGLA 4RNJA 2P3EA 4FNPA 4IUGA 1V7YA 3UYIA 3P5YA 4B9ZA 2UY4A 4GKTA 3W9ZA 3SY5A 1BD0A 1AW1A 1S5NA 4ICCX 1A4LA 4ZFMA 4X22A 2BXZA 5E9XA 1BWVA 3WLTA 3H4XA 2QPXA 2E6DA 1UUMA 4LUTA 4PCSA 3MZ2A 1GWJA 2UY5A 1QU4A 2E25A 2WCAA 4WQ6A 3GY1A 3DERA 2GFTA 1L9WA 1QT1A 3DFNA 3VGHA 5DQPA 1TR1A 3VA8A 3QSTA 1HVXA 3AHVA 4GYPC 2OZTA 4X63A 2A2IA 4R27A 2YZRA 2ESCA 5KEZA 3FLUA 2WBKA 4R88A 3TYDA 1Z48A 1Q3NA 5DT5A 2PLCA 5D09A 4GUFA 5JBFA 4AZ6A 2FKPA 2V81A 2V68A 2X7VA 4JTQA 1PAMA 4HTYA 4ZL1A 4FI4A 1KBIA 1ICPA 2Y63A 1LQ2A 3TE9A 1HL9A 3UW6A 1JDEA 4RE2A 1F76A 4KWSA 2HVMA 1QUMA 3VNDA 3W37A 3F1QA 4B5VA 2FMOA 1CIUA 2WPBA 4GY1A 1XRFA 3BOFA 1KQYA 3KX6A 3DFQA 4CD4A 1GVFA 4MAZA 2C7FA 4CNPA 1T40A 1PXGA 2IKJA 3C56A 4I7UA 1CI1A 2VKZG 3URNA 1JR1A 3NEHA 4EAMA 4UTTA 2XN1A 1I2QA 2ZXAA 2ZOXA 1UC5A 4MM1A 1NF0A 1A5SA 5DMNA 5AHNA 1RZMA 4D6FA 4ZB5A 5HINA 1XYBA 5C2CA 5CZJA 4N2YA 3MB9A 3IUIA 1NOWA 4LB3A 3MMTA 4QCFA 4ZQNA 2QF7A 1ONXA 3GZ3A 4GISA 1US0A 3TCEA 2Z6JA 4GNVA 1TX2A 4A35A 4Q8OA 1K77A 5EMLA 3EX1A 1UR0A 5CLWA 1OK6A 3VD9A 4A2SA 3WNOA 1WNOA 4PYSA 5ENLA 4J5NA 4JFVA 3UZ5A 1GVSA 4MNMA 4J28A 3JRKA 1ISYA 3AUJA 2QF8A 1DQUA 2ZXQA 3G5EA 5CC5A 5LIWX 3WLKX 1ZY9A 4AD2A 5D9OA 1NFPA 4HMEA 2PWVA 4HNVA 3DBPA 4WY0A 4CQDA 4UNKA 3SGUA 3MJMA 1E3ZA 1V3HA 1OGSA 5AC7A 4AY8A 1Z89A 2PB1A 2Y2WA 1DVJA 4KF1A 1NSJA 4FIRA 3T55A 2BSLA 4BJHA 5CXPA 5F4WA 2I1OA 1SM9A 1XYAA 3ANVA 2A6NA 1SO4A 1X1OA 2X7WA 4HA4A 1F5ZA 4OKDA 4YTUA 3ABRA 1YLVA 4HP5A 4BF7A 5K9XA 4YTRA 3U48A 3T42A 1FQ0A 3IS4A 1G4TA 3DUGA 3FDGA 2WSQA 3AHTA 3MCMA 3WDIA 3WLHA 1RP8A 5I5RA 1LLWA 1S2VA 1VLWA 2Q09A 3W7HA 3SCNA 2Y8KA 2PWDA 2V3EA 4DJEA 1WZMA 4US5A 2PDXA 4HNCA 2FTPA 4A8LA 2QCDB 4IP7A 4KCVA 3EBVA 4HTBA 2ZX9A 3H8AA 1XCXA 1CEOA 4MY8A 2NUXA 3AXIA 3T0BA 3AXXA 4S3BA 5D03A 3S6OA 2A3HA 1B54A 1KRBC 2DQWA 2DUAA 3PZGA 4AISA 1KCXA 5JUVA 3NXFA 3LLXA 4HNNA 1ZAJA 2J27A 4IT1A 3OEXA 3RU6A 3RU8X 4WDXA 4MY1A 1O1ZA 1CGTA 4JQ1A 4QJ1A 1MNZA 3LMZA 2A3EA 5T8GA 4ZE5A 1EDTA 3GTHA 3G3DA 1DWFM 1SGJA 1RLCL 1KBJA 2RGMA 1M3UA 5FSDC 3UESA 2J77A 1XP3A 2FPYA 2VZOA 4XBJA 3VNKA 1X6NA 2R8WA 5EB8A 3K1GA 1JYWA 3E2QA 1T8QA 2V5DA 4MG4A 4Q8UA 2I56A 1I6NA 4YYCA 3TDFA 3UG3A 1QOPA 2QVHA 4GINA 5HQEA 1KFWA 3M0LA 3N13A 1BLIA 2E6FA 4S3CA 1NDYA 3TYAA 1NOFA 1UA7A 2CFFA 1I0BA 4TX6A 3LRKA 4RZ5A 5CC7A 5EMJA 5HJXA 2W92A 1EJVC 1GJUA 1ITCA 3G1AA 3BLIA 1Q7ZA 3SZ8A 4E3VA 1OFBA 3TXZA 4LF1A 1Q6GA 2HWGA 3I7SA 3MKVA 2X09A 2CZ5A 4P61A 2BY0A 3RO8A 1IZCA 3IVTA 3GZAA 9XIAA 4DIAA 3PB2A 3GKAA 3PAOA 1W9PA 3SW6A 3B8WA 4E6MA 1VS1A 3BV4A 2IUZA 3UWQA 4TVCA 2HPMA 3VKJA 2QMKA 3W1XA 1YTDA 2ON3A 2PBOA 4QJ3B 3BCDA 1O66A 3TZNA 2C15A 3L4ZA 3VCNA 1M68A 2OO0A 1ECEA 2FZ8A 2GJNA 2QJGA 1ZGDA 3KOWA 1TV2A 2DZPA 1VPYA 2VC5A 1JI2A 2QAFA 1O94A 3VINA 3F5KA 3EWWA 2A21A 2GVLA 2QHAA 2TMDA 2VJXA 3U9IA 2FGZA 5AHMA 3H54A 3Q2DA 1W1IE 3ARZA 4DAIA 2WMFA 2DPEA 1QNOA 3DGBA 1OYAA 4J3VA 3S9IA 2YL8A 4DJFA 1SVDA 4MZ8A 1L6GA 4IP5A 1BVNP 1EKOA 1R9ZA 5BYWA 1E6PA 1IYXA 3W25A 1F7BA 1Z69A 4E4UA 4MWAE 2C0HA 4UZSA 3W1RA 3QZEA 1M41A 5CGQA 1LYXA 1DIOA 2OQLA 5J8LA 2ZIDA 1IIGA 3HQOA 4XISA 2J47A 2F2HA 1F8IA 1V0NA 4YTQA 5C71A 4ENLA 3DC8A 2E8ZA 3SCOA 4AHOA 1KRCC 1IHIA 2HK1A 3W26A 1VBRA 3EWXA 3W2JA 3LHTA 4Y6GA 1FCUA 1GQIA 3N6JA 4I6VA 2PCEA 3OLDA 2HRWA 2WYSA 4Y9OA 3ZR4A 3MKCA 3TK7A 1KV8A 1OCJA 4A29A 2I5QA 2X1TA 3BAKA 4JX6A 1Q6LA 1L8PA 3CT7A 5EBAA 4EPKA 3MP4A 2PF0A 5G4WA 3ANYA 4NJJA 9RUBA 5L9FA 4UOQA 3NVTA 3VUSA 1KFCA 2WSRA 2D20A 3NGJA 1TPH1 1OZQA 4YYFA 3FA5A 1MQRA 1BF6A 3G6MA 5D9PA 4C5YA 5DMLA 5C0QA 3NG3A 4JOMA 5FAJA 1XI3A 1V0MA 4PZVA 3ONBA 1LBFA 3GIYA 4LVAA 1J9YA 1EC8A 3FN9A 2BS9A 2IQ0A 3DH7A 4LYKA 3W2MA 3QOMA 3AYTA 3UT0A 2O9OA 4U2ZA 5K9DA 3LCWA 1TJ0A 4CKQA 4QHRA 4XAGA 1EBHA 3M5VA 3WJXA 3VD7A 3WF2A 4HPNA 2ODOA 6REQB 2DORA 2QV5A 2WM0A 4H4IA 8A3HA 4NZFA 1W56A 4RNIA 4X2RA 4H00A 5D37A 3BUVA 3RM4A 1IXOA 2YB4A 1OIFA 2QDEA 3TLLA 1I1WA 3D47A 3EOEA 1PBGA 4F2TA 3PUOA 1JPIA 4K3ZA 1TCMA 1W9XA 2NV2A 5BMXA 1QWGA 1Q6QA 1UR2A 3N2XA 4BWLA 5ABGA 4ROQA 5DMMA 3VI2A 2W6RA 5E6YA 2RDTA 3GVWA 4LY8A 4EANA