1KFKA

Crystal structure of tryptophan synthase from salmonella typhimurium
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
251
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title On the role of alphaThr183 in the allosteric regulation and catalytic mechanism of tryptophan synthase.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 94
structure length 251
sequence length 267
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2001-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1kfkA00
2R14A 3MYOA 4XKYB 3NL2A 2ZZ3A 4IMDA 3C6CA 5HJLA 3MHGA 1TQJA 4CNPA 1H7OA 1Q6OA 3W7NA 1W5NA 2WNZA 1ME8A 4MKNA 4I7VA 2HSAA 4QAIA 2CLLA 1CW2A 2BSLA 3YPIA 2NXGA 3PG8A 3MP4A 1SFLA 3G24A 3I7RA 3VE7A 2ZZ2A 3HPZA 1G7VA 1FWNA 2JK2A 1CI1A 2QCMA 5HR7A 2G5WA 3CIWA 4X2RA 1QNVA 1C9DA 1WYIA 1F5ZA 4K37A 1GZGA 2B7PA 4BI7A 4LRSA 1P4CA 4IPIA 5AYYA 3T40A 5L9FA 3IIXA 2ZRZA 3NQFA 2EF9A 1IXOA 1W56A 4GUJA 1JUKA 3STCA 2VEIA 2C14A 1JUEA 4JR5A 3WK1A 4UTUA 1T0OA 4NJGA 2V9DA 4R53A 1XKYA 1A5CA 3TMLA 1W5OA 2VFEA 1IXQA 3LCLA 4PH6A 2VEKA 3R13A 5G2HA 4UTTC 1DOSA 1GWJA 1O95A 2E6YA 2ISSA 3CIXA 2YXGA 1OHLA 1GVSA 3BW3A 4EF8A 5GVJA 6TIMA 2VKZG 1F2JA 3GDTA 4JTEA 3KVLA 1H1YA 1EP3A 1UUMA 4QNWA 1EWDA 2NWSA 3MHFA 3E12A 2NXHA 3LTSA 3NM1A 1L6SA 2WKJA 3MI6A 2Y7GA 3RU6A 3M43A 3NL6A 2ZTJA 4UTMA 3NQVA 1AL8A 5HNRA 5HULA 3O6YX 3KRUA 3CB8A 2VFFA 4BF9A 2Y89A 3T7VA 1JRCA 1PCKA 4JGDA 5DXYA 5CZJA 2V2CA 4EOUA 1KBJA 1Q3NA 4YL2A 3NL3A 1OFDA 4FX7A 1W3NA 3CEUA 1PCWA 3W84A 3DAQA 4IMFA 3G1SA 2B7NA 1JVNA 3W2NA 1FX6A 1DBTA 3GDRA 5F2LA 3SJ3A 5E93A 2VC6A 3P67A 5FF4A 3EX6A 4OT7A 1XFBA 4FF7A 1LOLA 4O1DA 5CZTA 2YX0A 2JKEA 2Y7EA 1A53A 1TTQA 2TYSA 1NF7A 1HTIA 3PR2A 4LTSA 3HBLA 1IIHA 3NPUA 1XBYA 3IGSA 4JY9A 1YXCA 2ZBTA 3UXAA 4FIRA 1RR2A 4KKXA 2QDGA 3L5LA 2A5HA 3M6YA 1WX0A 3LRLA 4Y90A 2CU0A 4MY9A 5LNUA 3TA6A 3H53A 4JN6A 3P81A 1KLZA 1YPIA 2EAWA 3WJZA 1KM6A 2ISWA 2H6RA 4NXKA 1JCNA 4YLWA 3GB6A 3TJLA 3DKJA 1TPC1 5AHMA 1DQWA 4K36A 1TTJA 3L0NA 1KM2A 4IGHA 4TX9A 4X9SA 3G1FA 1MEHA 3HQ1A 3S6DA 2WNNA 2ZA1A 2YZRA 1YXYA 1ZY9A 3CWOX 4HHPA 2AGKA 1H50A 2B7QA 2GPTA 3G1AA 3KFTA 3KXQA 5HINA 2E68A 4OU1A 2Y88A 2QCCA 1MZHA 1HG3A 3OBKA 1JUBA 2C1HA 4A21A 4NNCA 5TQLA 3SI9A 5EA9A 3W7GA 5D2XA 1ICPA 5DBTA 4N6FA 1ICQA 1RQBA 2WSQA 4UFLA 3TK7A 1Q6LA 1H5YA 3GR8A 3BO9A 3BLIA 3VE9A 1TMHA 3W7RA 4MIMA 2QCDB 4O15A 4ALDA 4AXKA 2BZNA 2G95A 5DELA 3SZ8A 2ZRYA 2NUYA 1JCMP 1RD5A 1LRTA 3NDOA 2QJGA 1K3UA 2ZCGA 3CC1A 4IWWA 4NJHA 2Z1BA 2YW3A 3LI1A 3BGGA 2NZLA 3P5ZA 3O16A 3RNDA 4K7VA 2QKFA 3UWWA 2C13A 5FESA 2A7RA 4OE7A 1P5BA 3G1YA 3GXTA 1MXSA 1SQ7A 4FX8A 1OFEA 5LHFA 3M7WA 1NF0A 3Q58A 3B4UA 2H90A 1KM5A 1V7YA 3BLFA 3ZWTA 1YPFA 3W7OA 2GVLA 3W88A 5HQEA 4JS3A 3Q94A 3KVKA 2BXVA 3G8RA 2ZA3A 3MO7A 3ANYA 1OK6A 2NX3A 1WQ5A 3HO8A 4OQVA 3A23A 4NU7A 4LV4A 2DZPA 3E0IA 3DENA 3A24A 1TQXA 1R46A 4N6EA 3W22A 3GX9A 1VS1A 1Z42A 4L4LA 5K2ZA 1TSIA 2V5BA 1KM4A 3T4CA 2PRLA 4K7YA 3KHJA 3EWUA 3HG2A 3C8FA 5D2TA 2CZFA 4M5PA 4S1FA 4WY0B 2ZZ7A 1EPXA 1L2UA 4N9CA 3P7YA 4NT0A 3ZFHA 3TAKA 2DJXA 5D03A 2V81A 4EIVA 2F84A 2NX9A 2RFGA 3TC6A 5G4WA 1GQNA 3R2GA 4GWEA 3DI1A 2V0TA 3G1XA 1H51A 1UCWA 3HF3A 3N2MA 1KTNA 5EKYA 3W2LA 3TKFA 1L6WA 1ADOA 3O06A 2QR6A 1WAUA 3W71A 4HIBA 5HUOA 5CSRA 2EKCA 4HNTA 2VXNA 2O7SA 4O14A 1PHWA 3S1UA 2NLIA 3NVTA 4XTIA 4NJJA 4QQ3A 1X6UA 1BKSA 2E5BA 1B57A 1SZNA 2RDUA 2Y70A 3LTPA 1TTPA 4NJIA 3IV3A 1XBVA 2AQWA 1SO6A 3C56A 4UC5A 5F2GA 4I7UA 4LW7A 3LGEA 4RR4A 4MY8A 2DU2A 1QPNA 1YDOA 5D02A 1XBXA 2FDSA 5KINA 1P1XA 2GJLA 4O57A 5E0KA 3PBUA 4J9JA 3G1HA 3OG3A 1YTEA 3NNTA 3HGRA 2QCEA 1H1ZA 3TW6A 1OABA 2GQ9A 4JTHA 4LS1A 3LCFA 1RV8A 4N9DA 1DV7A 1BTMA 2Q3OA 3C2EA 4GFSA 2CW6A 4KWWA 5HR6A 4GBUA 2V2DA 4R7JA 1MEWA 3ABRA 2W0UA 2V82A 1IF2A 5G2WA 1ZALA 1GVFA 3GIYA 4DPPA 4O13A 2XN1A 4MZ1A 3P80A 1GPWA 3EX1A 1OX4B 3C4UA 3QH2A 3CM4A 4A3UA 3IVSA 3W76A 4RZ4A 2JGQA 3DHFA 4LC8A 5CZ0A 3NZRA 2RDTA 3QRHA 1QCWA 1ZENA 2A6NA 4AHQA 2RH9A 3W7HA 2LLEA 5DY2A 2QCGA 2Q8ZA 1A5AA 3M47A 1VHCA 1LRQA 4GUIA 2I9EA 4UR7A 3H55A 3E02A 1WXJA 5BRBA 3GXNA 3PUDA 3MBDA 2X1RA 5CZSA 3SFKA 4WD0A 4FXSA 5AYZA 3SECA 1LBFA 4M19A 4AEOA 1G67A 3LB0A 2PRHA 2EGZA 4GXMA 1QO5A 4HNNA 1AK5A 4E38A 4MLJA 3O63A 5HWMA 4A2SA 3QC3A 5KZEA 1QR7A 3DFSA 1XM3A 1JRBA 3MWAA 3EKZA 1YTDA 3EEGA 1TJPA 3MHUA 3WJWA 4O50A 3I65A 2X1UA 1LTDA 3MP3A 1FXQA 4TR9A 4UTLA 4CQ8A 1MEIA 1ME7A 2NWRA 2DZXA 5LGXA 2WSRA 3B0UX 3FJLA 4O52A 4I9AA 1Q45A 4DXVA 4QIUA 5HMSA 1SW3A 3ABQA 3GVGA 4MY1A 3LTYA 3TV8A 4XKYA 3KRSA 3IGXA 1IXNA 3S0CA 1X1OA 2DZVA 5DCBA 1EUNA 1SSDA 3NOEA 1F76A 1F6PA 4BWLC 5LGZA 4JTTA 1G4PA 3G0XA 1FBAA 1O5KA 3KX6A 3NZ1A 1QMLA 2Q3RA 1FCQA 3TQVA 1OFQA 4S2CA 3O6CA 1JQXA 2QJIA 4OHQA 3C2FA 1HUVA 1LP6A 1RZMA 2ZRWA 5AOUA 3W72A 3U6WA 3CLMA 3LLDA 5AFDA 1FCBA 4ZQPA 2O7QA 1XBZA 3GAKA 3W9ZA 2WSYA 5D09A 1S3HA 2ZFAA 3LM7A 3G3DA 4UTWC 4DELA 5EMUA 1IGSA 3NO5A 4UR8A 1KA9F 3HG3A 2VFHA 4A22A 3TSMA 3QW4B 1TRDA 4LC6A 4IXHA 3M1ZA 4K6AA 3SW6A 4IX0A 1H7XA 1SSGA 3NQ2A 1YADA 5CPLA 3IGUA 3DBPA 3PC0A 1FDYA 3L0GA 2VFDA 3NQAA 1LOQA 5G5IA 4GE8A 4UTJA 5FEZA 2CLKA 1H7WA 3EWXA 3GDKA 3LCHA 2I1OA 3TAOA 1R47A 4LUJA 3A5VA 4UUIA 3FKRA 3W7DA 5K4ZA 1M7OA 4RZ6A 3QMSA 4DO4A 4MLRA 1S5VA 2Y6ZA 5AHIA 3C0JA 3O07A 2HMCA 1L6YA 1ZCOA 1TV5A 3TC7A 4ICNA 1XL9A 2B4GA 4GJ1A 3W2JA 4HSNA 1I8JA 3TFXA 2FJKA 1EB3A 3BG9A 5FF7A 3T78A 3UY8A 1OFPA 1G7UA 4RK8A 3S5YA 3NPXA 2QF7A 3OEXA 1SZFA 3TW7A 1Q6QA 3EX3A 4WQ6A 4UFHA 5EL1A 5C2XA 4JXCA 3TUUA 2WJZA 4K39A 1W31A 4UNLA 1SZEA 2XN2A 1KV5A 2CLEA 3DFOA 4IXXA 1DJNA 3MI3A 1KBIA 2DORA 4UFMA 3ATYA 2FFCA 1QAPA 3LCWA 3OHIA 2TSYA 3GNDA 3TQ0A 1DKWA 3TCEA 5CPOA 4N9EA 1AMKA 1PV8A 4WJEA 5A5WA 1ZAJA 3EWZA 1ZAIA 3D0CA 4NX0A 1RQEA 3FS2A 1WBHA 2WQPA 3LLFA 3UWVA 2OCZA 5BOOA 2RDWA 3FA5A 2FTPA 3LI0A 3H54A 4JX5A 1OF6A 4NXSA 2GQ8A 3LBMA 4JDBA 5I3IA 2A85A 1EP2A 2BLEA 3LX9A 5CPMA 2XN0A 1TO3A 5HWNA 1GTEA 1VR6A 3L5MA 2YDAA 3EWYA 4MOZA 3Q37A 4KWVA 4KFNA 4AHPA 1FY6A 3HPXA 3EXTA 2HS8A 3O6DA 5BMXA 4A29A 3QEZA 2Y63A 1C29A 4WXYA 1AW5A 3NR0A 3SIZA 4UMCA 1Y0EA 4LY8A 2J9YA 4X3ZA 4CQ9A 5ABTA 3WFAA 2ZRXA 2H8XA 3SSJA 4ORMA 5G1YA 1OYBA 4K8HA 2VOMA 3TR2A 3RK8A 3TFCA 1XDLA 3TSDA 3BW2A 3MMTA 3LCXA 1OX5A 3BPWA 2DZUA 1N55A 1EP1A 1XC4A 1KM1A 4Y9AA 5FEXA 3W70A 3C2RA 1OYAA 1K03A 4JTLA 1OVDA 3ABOA 1GG1A 3FYPA 3G18A 2XFWA 3F4WA 1N7KA 3W83A 5AHFA 1H62A 1A50A 2WO5A 1KFKA 1OF8A 3EX4A 1J4EA 1DORA 1W5MA 3F4NA 3NPWA 4XTDA 1DJQA 4TMBA 3CU2A 1J5TA 1SR9A 5CGQA 1OJXA 2QCDA 3S1XA 1W1ZA 1VYRA 2YPIA 2G96A 3G0SA 3L65A 2QEZA 3CPRA 4O28A 2YR1A 4ZQNA 4MZYA 3PB2A 1TJRA 1DVJA 4MYXA 1JR1A 3DU0A 3BG3A 1PS9A 1I2OA 2QUVA 1TPFA 3HGJA 4ZQRA 5FF0A 4MJMA 4O4VA 2C19A 4OWGA 4ADTA 3LDVA 3SGZA 4LVFA 1P0NA 1KFBA 1WDWA 3KVJA 1OFAA 3MUXA 3MYPA 4O18A 3ELFA 3QMTA 1I2NA 4LWWA 1ME9A 4PL2A 4JDYA 5DN1A 5FEWA 1H7NA 4PCFA 5LNRA 3O15A 2PRMA 3W7KA 5C6MA 3HG4A 4NNAA 3TIMA 1F6KA 1WOAA 3EWWA 1OX6A 2AAMA 3PY2A 4O1CA 4ZVJA 4WXZA 4AB4A 2JGYA 4LUIA 1DL3A 3L9CA 3TXVA 2Y61A 4UTHA 2ZDRA 2QCHA 1U83A 3QSRA 4LS0A 2NX1A 1SW7A 4BWLA 1M6JA 3C2VA 4IX2A 3I6RA 3GK0A 3G0UA 2NUXA 1EA0A 4Y8FA 5HWJA 3THQA 4ZZ9A 4LVAA 3BVJA 2Y7FA 4HN4A 1WOBA 5FEPA 3MI2A 1KTCA 1QWGA 4B5NA 1G4EA 3PG9A 3M5YA 4UMBA 5C5YA 4WY0A 4YXGA 3LHTA 2GVGA 1JCYA 2F7FA 2FPVA 3S8HA 3LV5A 4U28A 1UJPA 2Z0IA 1BWKA 3SY5A 5LKYA 4UTWA 1RPXA 1UBSA 5T26A 2YFOA 4RJEA 3EWBX 1VRDA 1TYGA 4O8RA 5D38A 1B3OA 3OVPA 4JTFA 5AHLA 2X30A 3NPVA 1HO4A 3S1WA 5LNSA 3N2XA 2WOQA 1DHPA 3LHVA 5EPDA 3W07A 3W7MA 4EF9A 3JRKA 3HGSA 2YGYA 4ZMGA 5AYXA 3O05A 3UWYA 4PTNA 3CQ0A 1TV7A 4HPJA 5EBUA 1FUYA 3N14A 1XUZA 1S5WA 4OV9A 4HKPA 2CLMA 1KFEA 2TPSA 1SW0A 4IMEA 4XQ6A 4W9TA 3CHVA 3PBWA 5AC6A 1G6CA 1GJPA 1SO3A 5DCEA 3W74A 4LV9A 4L4MA 4DPQA 3IIVA 2X2GA 3DKLA 3HMJG 4JICA 1ZNNA 1O5XA 1D3HA 1WBJA 4JEQA 4U4MA 3PSVA 1A5SA 1E51A 3ZS4A 1JCLA 4WOZA 2ABBA 3W1MA 1I2RA 2E6FA 4O0KA 3DI0A 1B4KA 4O12A 1LOSA 3RFAA 4UTTA 3QPZA 3RLVA 1TB3A 2H3DA 3WK0A 3PUEA 4JTKA 3HOJA 4JTSA 4JTIA 4MZ8A 1JCXA 4N2YA 4YMZA 4GUGA 1VGAA 4AH7A 1OX4A 3HGOA 1X1ZA 2D73A 3LHWA 4FX6M 4JX4A 4Q33A 4H6KA 4CCDA 3K30A 4QJ1A 1TPB1 3N3MA 3HIJA 5FI8A 2RHGA 1FWSA 1GYNA 3W73A 3U2OA 2GQAA 3RF9A 2ISVA 3IIZA 4MFDA 1QPQA 1QPRA 5U4NA 4AF0B 3ABSA 4NZFA 4PA8A 3N73A 1G69A 3G22A 3UPBA 2FPYA 3NXFA 2BTMA 5I3JA 2TRSA 2R8WA 3M9YA 1O60A 3FEMA 4JNMA 4RV8A 2Z6IA 3PULA 4PEKA 2QCLA 3W7JA 3TU9A 1NVMA 3S42A 1ALDA 4RX0A 3SR7A 3N19B 3GNNA 4BK9A 1WA3A 2ABAA 1Q6RA 4AAJA 4GUHA 5EYWA 1FWWA 3GDMA 2OMAA 2ZTKA 3R89A 1V5XA 2V5LA 3OVQA 3KVMA 4QITA 3NA8A 1EUAA 3NQ6A 1GG0A 1SO5A 5D2WA 4PC8A 4RCXA 4FNRA 1C8VA 3BK0A 3S9YA 4GUFA 4CCCA 1A5BA 3W75A 3LXBA 3PF3A 3NG3A 2J9XA 3DZ1A 4N02A 1G4SA 3DFNA 5KZMA 4EVZA 4ADUA 4HNUA 4WX2A 3VKJA 3NM3A 2Y7DA 1LORA 3GYEA 4DF1A 4RLIA 4CCEA 4NQ1A 3W1RA 3LRKA 2C6QA 4DEFA 2NXIA 4MPQA 3KAOA 3S1VA 2C0AA 4K8EA 5LNWA 3NQMA 3UQNA 2Z6JA 2VFGA 5KMYA 5LZLA 5D2VA 4IPJA 1OFRA 4DO5A 1R2SA 3M16A 3W1PA 3WK3A 1P0KA 1G4TA 4NVTA 2E5CA 1TCDA 4JTUA 5TIMA 4WY0F 4JY8A 3UZ5A 3MJYA 3OVRA 4HT3A 7TIMA 1FWRA 3NEVA 4KFOA 3PSWA 1UASA 2A7NA 1GTHA 3PVFA 3UY7A 2ZZ4A 3VI2A 3AJXA 3WK2A 1T8XA 2FQIA 5U7SA 1K7EA 2E77A 3ZWSA 1GVQA 3HB9A 1I4NA 4M6VA 5HUPA 1O94A 4JX6A 3ZR4A 3THAA 2QUTA 5CKSA 3WJSA 2EPHA 4UTKA 3GZ3A 3UWUA 3G8EA 4S2BA 2A21A 1EWEA 4E0CA 5DCDA 2FB2A 2ZQ0A 5C54A 4RKAA 4AWTA 1SU5A 2CLIA 1VYPX 3BARA 3P74A 1W0MA 3USBA 2RKXA 5K7JA 4IJBA 2YYTA 3LV6A 5IM51 3W7LA 3UWQA 5KTLA 1PIIA 4CQAA 2ZZ1A 5K9CA 3STGA 1VZWA 1PVNA 3W3OA 5G1TA 3QMRA 1I2QA 3PB0A 3ATZA 1YDNA 3M5ZA 1U5JA 3KRZA 1VPXA 3CT7A 3GAYA 4QNEA 3W1XA 2CFFA 2JBMA 2VFIA 5LNVA 1TPWA 4QISA 2KZHA 4FXRA 3GXPA 2C18A 5IBXC 3UNDA 3BGJA 4ADSA 5I3GA 3DH7A 5D2YA 1GOXA 3M0ZA 4P2VA 3W7PA 1F73A 1AG1O 1BWLA 1ZFJA 4ZQCA 1TRIA 3EX2A 4XBKA 4KFPA 3S5ZA 2QCFA 3L68A 3VCRA 1FDJA 4Z0SA 4UFJA 1EIXA 1XCFA 5F2MA 1TPEA 3JR2A 4ZQOA 2HS6A 5DLCA 5F1UA 1LRNA 2X16A 4IQLA 3FYOA 3O8AA 2J6XA 5K9XA 2NV1A 3W86A 3GR7A 5CSSA 3QYQA 3W1TA 2GOUA 1B9BA 1SFJA 2QUUA 2DP3A 3S5OA 3SGUA 3LHUA 1SUXA 1K02A 4JD4A 3TH6A 4NNBA 5MHBA 3BG5A 3QJAA 1OFOA 3QM3A 1TPVA 4UFIA 4ONVA 1SZGA 3LHZA 5J5RA 3FOKA 3I68A 1NEYA 4JTJA 5H91A 3W1LA 4R34A 1TPDA 4CNNA 2ZZ6A 5DY3A 3T44A 1LLWA 2A0NA 5LSMA 2J88A 4O17A 3DFPA 1GEQA 5F2IA 2G97A 1AL7A 1YTKA 4OGZA 4YCOA 1W5PA 2C3ZA 3FFSA 1NAL1 4FIQA 3W7QA 1R2RA 1ICSA 3QPYA 4FNUA 2X1SA 5F4SA 3IRDA 1SO4A 1EEPA 3W6YA 3W1AA 2HTMA 3G3MA 1TV8A 2VEPA 4WOQA 1AW1A 1W8SA 3NQ8A 3WJXA 3C61A 3IVTA 3L21A 3A22A 4P61A 3A21A 2A1YA 4PODA 4Z1BA 2FPTA 4D2JA 3PUOA 4UMAA 3EKLA 1AW2A 4FO4A 3IIPA 2Q8LA 2ATSA 4HPXA 3W1NA 2VEMA 2ZRUA 2H3BA 1EX5A 3N34A 4X22A 2CWNA 5AHEA 3P8JA 1KTBA 3CWNA 3N9SA 5AHNA 4TIMA 5FF2A 1NFBA 1W37A 3GLCA 1O4UA 2QAFA 1FWTA 1VYSX 3NQEA 2JKPA 1VHNA 1I45A 2DZWA 3B0PA 2ZRVA 4XBSA 3P8IA 3G1DA 2V2HA 2J27A 4DO6A 1BEUA 1GVRA 3GKFA 5D37A 4ML9A 1CX9A 1KLYA 3QQ0A 1N8FA 3B04A 4M7TA 3PWAA 5D32A 4E2BA 5D05A 1VCGA 2I14A 1WV2A 4LNYA 1W3IA 4WUIA 1LDCA 2E5DA 3IIOA 1IIGA 3NL5A 4MUZA 4MJZA 4JYFA 5D33A 1VC4A 4O0ZA 1PHQA 2WNQA 4Y6GA 5G4EA 2YYUA 5BMWA 4H4IA 4EWND 3PBVA 5SWUA 4FNPA 4Z1AA 2VENA 3F1QA 3F03K 4XWUA 4AWSA 2OX1A 1H60A 4UIOA 3GDLA 3A9IA 3M5XA 4XUGA 2QAPA 1LBLA 1K8XA 1Z44A 1OK4A 3JS3A 1LLZA 1RVGA 3NYZA 3TJXA 1ZHAA 3GKAA 1TPH1 4LS2A 3TX9A 1FDZA 1F74A 4IMGA 4Z1CA 3UZJA 1K8ZA 4OBTA 5KITA 3OIXA 2GJNA 4PL1A 1I2PA 4HSOA 4UFKA 5EY5A 1H7RA 2GVJA 1YYAA 3L67A 4Q4KA 3LHYA 2A6LA 3INPA 5TBOA 2GUUA 1K7XA 2A7PA 2W79A 2J9ZA 3MW7A 2PC4A 1LM1A 1Z48A 3RLUA 2P1FA 1H63A 4Z08A 1K8YA 3W1UA 4NZJA 4DBEA 1K7FA 3FLUA 3G1VA 5I3KA 4Y96A 3TXZA 5FF3A 4PFMA 1HFBA 2ZZ5A 5H2ZA 3L0KA 4O53A 1SPQA 3P5YA 4TU1A 3U8GA 3UWZA 3M44A 3W2KA 2YFNA 1QOPA 1W3TA 2P10A 4O1AA 3W2UA 4O4WA 2OJPA 2YCEA 4CLMA 1VCVA 4RXGA 5AB3A 2CLHA 3A5FA 2UV8G 1QFEA 4AHOA 3QZEA 5F1VA 3BW4A 1HO1A 4BFAA 4LOCA 4UNKA 3DGRA 3NQ7A 2ALDA 5A8GA 1W5QA 1Z41A 2VELA 2IQTA 2CZDA 1KV8A 1QOQA 3O1NA 4TMCA 3RMJA 3TDFA 3NAVA 4Z0JA 4YCPA 5E1QA 5CPNA 4TO8A 1T96A 4FEZA 2WV8A 3UD6A 5D30A 2C16A 2QCNA 3R12A 3R8RA 1GT8A 1KFJA 3B0VC 1W54A 3TNOA 3TE9A 3DHDA 2H8ZA 2V8ZA 3NQCA 1TREA 5IBXA 5D04C 2B0MA 4GNJA 1XDMA 3PM6A 3B8DA 3W87A 1FQ0A 3LBCA 5CG7A 2CZEA 3NGJA 1KW1A 5I3FA 1XI3A 2ZYFA 4LRTA 3TQKA 3BLEA 1KM3A 3WJYA 3R5EA 3W7IA 1J2WA 2CLOA 1LZOA 1L9WA 3VNDA 5J5DA 3UXDA 2E6AA 1FXPA 1JJKA 5KZDA 2JKAA 2OT0A 1JCJA 3L5AA 2Y85A 3STFA 1T99A 2FB3A 3TSBA 2DJLA 3EB2A 4AF0A 3PBYA 1VLIA 4ORIA 2PE4A 3HPSA 3CTLA 3QW3A 3W85A 2E1DA 3S5NA 1UUOA 2E6DA 4IOTA 5G2IA 1VH7A 4FNQA 3NQGA 4M7SA 3V1PA 5AC8A 2A2IA 3NQDA 4XZ9A 2R91A 1VJIA 3UYCA 3B03A 1FCUA 5LHEA 2FIQA 6ALDA 1DQXA 3PS7A 1VQTA 1PL9A 2OZ0A 4O54A 2WPBA 3I7QA 3P60A 3I7SA 4Q32A 3N9RA 2OT1A 2NUWA 4BR1A 1THFD 4O10A 1KFCA 3HJZA 1TTIA 1R30A 4A2RA 3BV4A 2P0OA 2TMDA 1NSJA 3AO0A 4JYDA 1H61A 1ONRA 4FHAA 4C1KA 4C1LA 4MYAA 5DXXA 3QSTA 2C15A 2DZSA 1JULA 4LVDA 4R33A 2E09A 4BI5A 1OG0A 3QFEA 1F7BA 2V30A 3FIGA 4N4PA 1OFBA 5KSWA 3W23A 1IXPA 1VLWA 3C52A 3OA3A 3IVUA 4UXDA 1UB3A 3W2MA 5K9DA 4BI6A 3W7EA 1R2TA 1M5WA 4NX5A 4ZQMA 3M41A 2W6RA 4ZL1A 1KFLA 2QDHA 2YSWA 5F4XA 4FB7A 4O16A 4RZ5A 4JIPA 1GVOA 3CEPA 2FLIA 3EXRA 1ML1A 4YWIA 4UCGA 4E2DA 3C3NA 3FKKA 3DFQA 4DF0A 2BX7A 1YDVA 1X8FA 2BWGA 4LU0A 3TMQA 2EHHA 4LT9A 4HNVA 4UTIA 3LXCA 4IUOA 4N9BA 1M7PA 2DZTA 4IMCA 1GYLA 4GRSA 4RXFA 3LOTA 3VFLA 1HL2A 1B4EA 1PE1A 4G1KA 4N4QA 3HG5A 3L66A 4O11A 1OYCA 3LERA 4H3DA 4O19A 3E9AA 3DFTA 2NV2A 4LVGA 3L2IA 1QO2A 1TPUA 4DQWA 4GC4A 1X7FA 2ATMA 3QQ1A 4DBDA 2CZ5A 3E96A 3C2OA 4MVAA 2R94A 3P62A 5F4WA 4CNOA 3MBFA 4WZHA 1RQHA 3V75A 4JIQA 4DF2A 3PAJA 1MSSA 3P84A 1YLVA 2ZA2A 3B05A 3W7CA 3LCGA 4I7WA 4MFEA 8TIMA 3Q2DA 4O1BA 2YW4A 1MO0A 3FJ6A 5C55A 3EXSA 1LCOA 3LXAA 3T55A 1YXDA 4OV4A 2Y62A 3M5VA 2PURA 3W1QA 2CLFA 4FNTA 3P82A 1LYXA 1JQVA 2X1TA 3UPWA 2Z2UA 1ZAHA 4JYEA 5AC7A 3E49A 3P61A 4NUWA 3STEA 3TROA 2QJHA 1ZJIA 2B7OA 3LCIA 3B06A 1H7PA 4POCA 1LROA 5L6UA 1QPOA 4NJKA 5K4XA 3IEBA 4AWUA 3QF0A 1TIMA 4K38A 1F05A 5DBUA 1XUUA 4AMAA 3MP5A 3DXIA 4JTGA 2J24A 1QDSA 4FNSA 1S5TA 1FCVA 4M6PA 5BNKA 2PCQA 5K3VA 1D9EA 2A4AA 4LVBA 4Z1DA 1VCFA 1D3GA 3LRMA 5BW6A 4QM1A 5AN7A 3KOFA 1KM0A 1LBMA 5I3HA 4AVFA 1XXXA 4M6QA 4QSHA
chains in the Genus database with same CATH superfamily
2EJ1A 4L6OA 2Y8VA 2YDSA 3C6CA 1LQ0A 1JDCA 2WMKA 2OYMA 5IDIA 4WDXA 2XDFA 2NXGA 3AYVA 3UJRA 2OU4A 1MMFA 3NJ3A 2CBVA 4OECA 2JK2A 1W1IE 3KCLA 3IJ8A 2Y1HA 1QNVA 4NZ4A 3URAA 1GZJA 5JBDA 2WCGA 1F5ZA 2B7PA 4LRSA 3AUOA 5CC6A 5ABFB 1ZBVA 3AISA 3NQFA 2G37A 2V9DA 3USZA 3G6LA 4R53A 5LIUX 4HA3A 1A5CA 1ZJAA 5T9CE 1W5OA 3LCLA 2Z1KA 3AIVA 2HISA 3EOOA 5GVJA 1XIBA 2ZX7A 4EAMA 1F2JA 4JTEA 2Z29A 3KVLA 3RRXA 1LG2A 3OW1A 1X7IA 2PP1A 3MPGA 3VOFA 4KCUA 4KESA 2NXHA 1L6SA 2EPOA 3MI6A 3RU6A 3M43A 3NL6A 4DAIA 3QXBA 2J79A 1W9VA 1Q13A 4GK8A 3U2ZA 4AIOA 4XG1A 5HULA 4XAFA 3CB8A 3ARPA 4V33A 2ZADA 1BRLB 2Y89A 3T7VA 3ABXA 4P7NA 4B92A 1JPMA 2QLYA 4JGDA 2QDEA 2V2CA 4C7GA 3HQPA 3WQFA 3EEZA 1TJ1A 4FX7A 3CQKA 4XK2A 1J10A 3L4VA 4BF7A 1MDRA 4IMFA 2DT3A 1UKQA 4A05A 4CGTA 1US3A 1JVNA 4FLQA 4GINA 3G5EA 1CYGA 3ARUA 4B5VA 1MNSA 5J04A 5FF4A 2WMIA 4FF7A 2X8RA 2TYSA 3PR2A 4KEMA 5IFPA 3LPGA 4DZHA 2ZBTA 1E3XA 3UXAA 2QDGA 2A5HA 1AVAA 3H7RA 5ENLA 1VFMA 5LNUA 1TWSA 4JN6A 5BOFA 1KLZA 1UZ4A 2EAWA 3I10A 3WJZA 3B8VA 2OO0A 1KM6A 1JCNA 2BVWA 2HPMA 1HQTA 1TPC1 4PTMA 4QJ4B 3IJ6A 2ZUVA 2J6VA 9CGTA 3L0NA 1KM2A 4IGHA 4TX9A 1IR1A 2WCSA 3EPNA 3P93A 1R87A 2XIOA 3QV7A 3UJFA 4Q8MA 3A3HA 3CWOX 3WEZA 4HHPA 4LCRA 2AGKA 3ARZA 3G1AA 5A6JA 4XAPA 5HINA 1ISYA 4B5SA 2Y88A 1ZBKA 2GL5A 3FHAA 1WNOA 3RITA 1ZTVA 1KQZA 4NNCA 1PTDA 4W84A 1G94A 5EA9A 1GJUA 2D24A 2ACSA 5I7GA 3KOYA 4C6LA 2OEKA 2VI0A 4XO6A 5LIWX 1H5YA 3GR8A 3BO9A 3LD5A 3VE9A 2ZX6A 4D6FA 3W7RA 3AMKA 3REQB 4GI6A 3QC0A 1K4HA 4I3GA 3WX7A 2EG6A 4GGHA 1MVYA 4BQ4A 5GQBA 3OP2A 4MHBA 1UKPA 3HFTA 1K3UA 4D8LA 3O16A 4K7VA 1X38A 3S83A 1WZAA 1JCTA 3H26A 3B40A 1DXEA 3G1YA 4H41A 3N6HA 1JDAA 3MV01 4PGLA 2WWCA 3B4UA 1DQUA 1AD1A 3BLFA 1VFOA 1YPFA 3W7OA 5E0CA 5GNZA 4AY8A 2BXVA 1TE6A 2RDXA 2YL9A 3MT1A 1HF6A 4PRRA 3HO8A 3A23A 4NU7A 2J75A 1GEHA 2DZPA 3A12A 2IUZA 3GX9A 1VS1A 3XINA 3N2OA 4GY7A 3ITOA 2V5BA 4F0KA 1QVBA 3EA1A 3QGKC 3TCSA 1NFPA 1W2PA 2CZFA 4S1FA 1VD6A 3E2QA 2WZTA 4XIMA 1KGWA 5A8NA 3QKZA 4C6MA 3P7YA 3ZFHA 3TAKA 2DJXA 3APGA 3IAPA 5D03A 3R25A 1QNQA 3DDMA 3RRAA 3DI1A 2ZICA 2WCAA 5CJMA 4ICCX 4TV6A 3O06A 3GHRA 3W71A 4HIBA 4HYVA 5C0QA 2OKTA 4HBKA 3BSHA 3NXLA 3VNMA 3DG3A 2PDXA 4O14A 3S1UA 2NLIA 3UJ2A 3NVTA 4XTIA 4QQ3A 1EJWC 4AD5A 1BKSA 1TV3A 5MKGB 2RDUA 4NJIA 3U5YA 2AQWA 1PIGA 3C56A 2BV9A 3TN5A 4A3QA 3T0CA 3VOJA 4PMUA 5D02A 4US6A 2E28A 5E0FA 3K8KA 2GJLA 3KOXA 4B90A 1DTUA 4S3GA 3G1HA 3LN3A 2RAGA 4JN8A 3ERPA 1H1ZA 1UOZA 2GUYA 4JTHA 3I6EA 1QW8A 1MYRA 4N9DA 1A80A 2GFTA 3TQPA 4F0MA 1CPUA 4R7JA 1TUXA 2V82A 3FEQA 4MZ1A 2JIWA 4N0RA 4NILA 3WNNA 2YCLB 2NVCA 1O12A 4A3UA 3GD6A 4R88A 4RZ4A 4A8IA 4Y8EA 5CZ0A 1ZENA 4IM4A 4AHQA 3GXDA 3PJTA 2LLEA 4AD2A 1AFSA 1VHCA 4UR7A 3E02A 5BWFA 5AZ0A 1REQB 3CUXA 3SFKA 4Q7IA 3RDKA 4AEOA 5FIPA 3URBA 5D8ZA 3LB0A 1O6IA 1K9TA 4GXMA 1QO5A 1AK5A 1CZ1A 1U1UA 3O63A 1XIDA 4F2TA 3N25A 3AIWA 2ZE0A 1GCYA 1F07A 3NYDA 4G8TA 2DT1A 3E3HA 1EPVA 1XM3A 4NZCA 3MWAA 3EKZA 2OZTA 2OODA 1QK0A 3B8SA 1YTDA 3CQIA 1Y5VA 3WJWA 5FAGA 3MP3A 4CQ8A 1ME7A 3LY0A 4Z2IA 4JNYA 2PAJA 2VUNA 1Q45A 4DXVA 5FJUA 4AZCB 2FZMA 4A4AA 3ABQA 2WK2A 3WQ5A 1WKEA 1JZ8A 2D20A 2QVNA 3AHVA 3S0CA 2HNHA 4DJDD 1ZB5A 1EUNA 4PB5A 1SSDA 2PI6A 5LGZA 2PDNA 2IPFA 1G4PA 2VDIA 4GMEA 4QCEA 3SIMA 2FZBA 3B9NA 3H2MA 3VIHA 1DJZA 3NZ1A 1OFQA 5A8QA 4FR1A 2QJIA 3WH5A 3C2FA 3DN5A 5AOUA 4HU8A 1FCBA 4ZQPA 5F7UA 3W9ZA 4GHRA 3ZT6A 3LM7A 1LT8A 3G3DA 4DELA 5EMUA 1JFXA 1AH0A 5A6BD 3GR4A 1KA9F 1XW8A 3CMGA 1GJWA 2VR4A 3LGDA 3TSMA 2XHYA 1TRDA 3IJ9A 1UWIA 4S3EA 3DC0A 1DJXA 3V5FA 1XH0A 3N11A 2O55A 3NQ2A 1YADA 1FDYA 3Q4DA 1ZGDA 1EJVC 3NQAA 1LOQA 3MCMA 3CV2A 4I5RA 4JFTA 3TW9A 4TVUA 1RBOB 4J3UA 2CHOA 1QRQA 4I90A 3GFZA 3GU9A 1CENA 4PULA 4AIUA 4LUJA 3BLOA 4UUIA 2BBFA 3G6MA 3W7DA 1EC8A 3H2EA 4DO4A 4ZENA 4LX4A 1LL6A 5AHIA 3F2BA 3C0JA 3O07A 3AROA 1BYCA 4KEZA 1TV5A 3TC7A 3V5OA 3EMCA 4ICNA 3H2FA 4PTWA 4HSNA 1EB3A 5H8PA 1G7UA 5JXQA 5DRCA 3NPXA 3QLDA 2QZRA 4ZA0A 4O0QA 3OEXA 1SMDA 2JQXA 1Q6QA 2VD9A 1OWQA 3C2YA 3MU7A 4K39A 3UCCA 1CGTA 1DJNA 3VINA 2YZ5A 4QP0A 3MI3A 1KBIA 4IGNA 4UFMA 3ATYA 4L4PA 3TQ0A 5B80A 1R6WA 1UP2A 4N9EA 1J01A 5A5WA 5H8MA 3GC5A 4GC3A 2GK1B 3IK2A 3D0CA 5XIMA 3LLFA 1H0GA 2RDWA 2XVNA 3O6AA 2FTPA 3LI0A 3NTYA 1DIDA 4KIEA 1MRAA 4HMEA 4JDBA 5D9NA 1F3TA 1JEZA 5CPMA 5XIAA 4QG8A 1RH9A 3HPFA 1GTEA 3IACA 2UBPC 4E4FA 4NZ3A 7CGTA 3AIQA 3B8TA 4KWVA 3AIEA 4A29A 4K8GA 1UD4A 4ERGA 3NR0A 4GGBA 1VIWA 3S6OA 1EZWA 5ABTA 3HV9A 3CQHA 4DUXA 1W1B1 1U22A 5FKYA 2FH6A 2FGZA 2Y5SA 4BZYA 1OYBA 4K8HA 3RK8A 3TFCA 3TSDA 3BW2A 1V51A 2P0IA 2DZUA 1EP1A 2EXOA 2VVNA 1KM1A 5FEXA 3MS8A 4XUYA 1KNWA 4JTLA 1GG1A 2XVGA 1N7KA 3W83A 5AHFA 2ANUA 4XV0A 4RNIA 3UG5A 4KT2A 4PEEA 2EJAA 2WO5A 2FKPA 3EX4A 2PDPA 4A3YA 1J5TA 1SR9A 4DLFA 1JGMA 4IPLA 1LQAA 3UR8A 3VD3A 1OJXA 3L4UA 1WKFA 3S1XA 2XVKA 1VYRA 2YPIA 1E0TA 4F4RA 3L65A 3JVAA 6REQB 3VNYA 4ZQNA 2ZKMX 1DVJA 5C8BB 3WQWA 3DU0A 2TAAA 3V3WA 4G1NA 1I2OA 4DZAA 3HGJA 4ZQRA 4O4VA 1GONA 1KXVA 4C1NB 1KFBA 4BHYA 1OFAA 4D6HA 3MUXA 5E70A 2BY0A 3ELFA 4GCXA 4JDYA 2VO5A 5H6HA 2FTWA 4B5TA 3E0VA 4JHOA 3SURA 1D8CA 2PRMA 1HT6A 2J13A 3HG4A 4NNAA 3TIMA 2CXGA 2AAMA 1I1WA 2QVHA 3AQUA 3TXVA 2Y61A 5EMLA 2RUSA 1PKNA 2ZOXA 4HHMA 3ZJ6A 2NX1A 1TWWA 4IX2A 2WW5A 3GK0A 3I6RA 3G0UA 4LH8A 4A8NA 4GX8A 3V1HA 5HWJA 4LVAA 3THDA 2O9TA 1QWGA 1KTCA 4B5NA 3S2MA 1GOMA 1DWIM 3KWXA 5DEZA 4DWSD 4YXGA 1ZP3A 3FJNA 2UY2A 1OQFA 1JCYA 3AWOA 2FPVA 3BLKA 1GKRA 3P6LA 1TVPA 3ZXWA 3SUTA 4F9DA 3LV5A 4IPNB 2Z0IA 5EGRA 3N13A 4WR3A 3ZIZA 3IS4A 2XGZA 3S1WA 5LNSA 1DHPA 3H23A 2D0GA 2VX6A 3I4EA 3FA3A 2DVTA 5HMEA 3T9PA 3K4AA 2F6UA 2R1KA 3LENA 3N14A 1XUZA 5DMNA 4KWSA 3ZVHB 3FY1A 1Z6KA 4XQ6A 3CHVA 3PBWA 1GJPA 1SO3A 1TFVA 5JH1A 1LLOA 4E3VA 1US0A 4GIAA 3KCOA 1XQKA 4JIEA 4D8AA 2X2GA 3LNMA 1ZNNA 1D3HA 1WBJA 2X0HA 8XIAA 3ZS4A 4P8XA 4L4OA 1I2RA 3BANA 3V5CA 1XLJA 1B4KA 4MAZA 2VR5A 1U5HA 1TB3A 3WK0A 3TTEA 4IQDA 2AAAA 4JTKA 4JTSA 4N2YA 4JTIA 1JCXA 4YMZA 2DGAA 3UBPC 3HMCA 4AH7A 4JX4A 1ZRQA 3V0TA 3K30A 3QPEA 3M0KA 4UQBA 3AYSA 4H01A 3WLHA 3BAJA 1NOWA 1C8YA 3UCQA 1PB0A 3DG6A 3OPSA 1XLBA 4PA8A 4NZFA 3N73A 4JOMA 2C8NA 1UWUA 2BTMA 4Q7NA 5I3JA 2R8WA 3M9YA 1JFHA 3URQA 4Q6JA 3VC5A 1EZ2A 3RILA 3B0XA 4W7VA 3W7JA 1NVMA 1UPMB 1ALDA 3NDZA 1L6GA 1CGVA 3GNNA 4HP5A 1WA3A 1Q6RA 5ABGA 3RO6A 4AAJA 4GVGA 3WF2A 3T2PA 4QFUA 1IQ8A 1WAWA 2DT0A 3R89A 3TONA 1EFZA 1M1BA 3OVQA 1PBGA 4QITA 1E6ZA 3CAQA 3NA8A 1EUAA 4KGLA 2NLYA 1GG0A 5C7VA 1JF5A 3WG6A 1T7LA 1C8VA 1V3MA 5C9RA 3WMBA 4GUFA 1A5BA 2VRKA 3LXBA 3DZ1A 1UWSA 4N02A 1BF2A 3AMGA 3BSMA 3EGJA 1EX1A 2E8ZA 3GYEA 4DF1A 3W1RA 2NXIA 4MPQA 3KAOA 1A0DA 3GTHA 2C0AA 3WQPA 5LNWA 3VGGA 1V8EA 1S2WA 1PPIA 3UVIA 5D2VA 4IPJA 3BLDA 4DO5A 5A94A 3GW0A 3M16A 5B7ZA 4REQB 4S23A 2HBXA 1P0KA 4M1RA 1G4TA 2QJNA 1TCDA 5CPSA 4PMNA 1QK2A 5XINA 7TIMA 3NURA 3UY7A 1E0XA 2ZZ4A 3AJXA 5T9BG 2FQIA 2Z1WA 2VGGA 4MJ2A 1RK5A 3CWHA 5KEZA 1FFRA 3UXIA 4FAMA 4Q4QA 4M6VA 2WBGA 5CKSA 2OYLA 4ERAA 1KRAC 1A4LA 3UWUA 1CTNA 2FVKA 1PXGA 4A3RA 4ECLA 4IZGA 1J93A 5DRIA 2PDWA 1M3UA 1JPKA 3MDWA 3ITGA 1SU5A 3ES7A 4AC1X 1VYPX 4DZ5A 5A2BA 5LIKX 1FWEC 1XIMA 1JD7A 2YDRA 3T0AA 2RKXA 4IJBA 3FJ4A 4HK7A 5IM51 1MQQA 1J6PA 1PIIA 1QJWA 2PMQA 5K9CA 1VZWA 1VBHA 4S38A 3ICJA 2J8TA 3QMRA 1I2QA 2ACQA 4GI8A 1D7FA 1KXTA 3GH7A 4GACA 3M5ZA 1U5JA 1XG3A 2BDQA 3KRZA 1QT1A 4QNEA 4I6KA 1XRSA 4FXRA 5EMMA 1EXBA 3GXPA 2C18A 1HKWA 3BGJA 1R85A 3DH7A 3UR7A 4DI8A 2YBUA 3WLMA 4XSLA 4L7ZA 3W7PA 4GH3A 1EGZA 1R0MA 1TRIA 4J35A 1CGXA 1FDJA 4Z0SA 1J96A 1NDWA 1TPEA 1Z89A 1W1PA 2FGLA 4ZQOA 1XRFA 4IFOA 2HXUA 2PGRA 2X16A 3O8AA 4V1XA 1DJHA 2BHUA 3W86A 4PUJA 1C90A 3JZUA 3QYQA 3V7PA 5CG0A 1B9BA 1HJUA 3PHAA 5I23A 1EH9A 2QXWA 3BG5A 3QJAA 2YXXA 4M6UA 2HE8A 4UFIA 4ONVA 4NI3A 1JGIA 1SZGA 2PTDA 4NHVA 2OQYA 1X39A 4I8DA 1GNXA 3FOKA 3I68A 4EWJA 1BGAA 2ZZ6A 2A0NA 5LSMA 2J88A 2Z7KA 4N7QA 3DFPA 4JEJA 1GEQA 1ZSXA 4PCSA 1RD6A 5F2IA 3VD4A 4PUNA 1AL7A 1W5PA 2C3ZA 5MF5A 3W7QA 4MGGA 2PDQA 1V0MA 4FNUA 3W6YA 2FHCA 7ENLA 2WMHA 4KW2A 3G3MA 1B3YA 4J3XA 4WK9A 1AW1A 3WJXA 4DXKA 4PODA 4Z1BA 1OINA 3R6IA 1PX8A 1AW2A 4HPXA 3LSBA 4BQ3A 3KP0A 2VC7A 4KGJA 5JUVA 3VNZA 1OBAA 1H3GA 3N9SA 4TIMA 4AYSA 1O4UA 1FWTA 2JKPA 2BS9A 1VHNA 2PP0A 3P8IA 2FZDA 2FMNA 4DO6A 1BEUA 1GVRA 2I5QA 1DWAM 5D37A 4C91A 1CX9A 4E5TA 3B04A 5D05A 4C6OA 2I14A 4EXBA 1HL8A 1FWAC 4WUIA 1XCXA 2P5NA 2E67A 4DJEC 4WSHA 2WSPA 4JYFA 5D33A 2ISFA 4UB9A 3N18A 4OUIA 3M0YA 1W1VA 4L61A 5SWUA 2Z2BA 4HU3A 4XWUA 4AWSA 3A3WA 4PMJA 5FL0A 1NY1A 4XUGA 1JAKA 5HPCA 4PMOA 1LBLA 1FWCC 3W37A 4WKFA 4GYPC 3ZJ8A 2QF8A 1LLZA 3F2DA 4JKMA 1W91A 3W53A 1FDZA 3SCSA 1DIEA 4Z1CA 5IDZA 1S2VA 3WLJA 4QS5A 5CZKA 4HSOA 1H7RA 2GVJA 1ZL1A 3NSMA 3EDEA 1JI2A 5TBOA 3MW7A 3ZT7A 4BY3A 3A9BA 3RLUA 1H63A 1UR9A 4ERIA 3AS1A 2ZUMA 3RGTA 4PMDA 4V1YA 1K7FA 3FLUA 3G1VA 4ATLA 1UD5A 4D72A 3M44A 1HJSA 3W2KA 2YFNA 4O4WA 3GRIA 2EG7A 4LCQA 2VQTA 4LAZA 3THCA 1FHDA 2QIWA 1QFEA 1RK6A 3TOYA 1E72M 3WL0A 1E71M 1EGVA 4LCSA 4BFAA 3TTYA 3W29A 4QLKA 3NQ7A 2DUZA 2XFFA 1CWYA 4V2XA 2CZDA 1KV8A 3C0QA 1QOQA 4MB3A 3WY1A 3T0TA 3NAVA 2NVDA 1CXEA 4Z0JA 1W9UA 5I02A 5E1QA 4YCPA 1EO7A 5CPNA 3UD6A 2XG9A 3UA4A 2C16A 1K6AA 3H4GA 1KFJA 2J66A 3LUTA 2G50A 2CNCA 1R9YA 3VIIA 1D2KA 4Z2GA 5D04C 3B8DA 3W87A 1U1HA 4P7LA 4AZ7A 1KC7A 4H2HA 5I3FA 1R5YA 3RHGA 3RPMA 1KM3A 5E9XA 3R5EA 3EBVA 8XIMA 2FFIA 3NSXA 4C6NA 1F3WA 1L9WA 1VFTA 4HA0A 1FHLA 3LMZA 3UXDA 2E6AA 1FXPA 1OT1A 3L5AA 4DWDA 1CCWB 3N3TA 1NDZA 2DJLA 1VLIA 3A4JA 4ORIA 2PE4A 4J5NA 2Q09A 3CTLA 2UZ9A 3QW3A 1M03A 4J7RA 4YHGA 4FALA 4QHRA 5C2GA 3PNUA 2REQA 5G2IA 4FNQA 3QZ6A 4H19A 3V35A 4GQ0A 3CNYA 3NQDA 2DH2A 4G56A 3EA2A 3B03A 1FCUA 3T09A 1VQTA 3RJXA 3ZOAA 2WPBA 3I7QA 1R7OA 3TN4A 3FXYA 4CU6A 4BR1A 3MTWA 5I79A 5D9MA 1TTIA 3DFHA 2OR2A 3SCRA 4A2RA 4KERA 3AO0A 4L65A 2NQJA 1L2QA 4C1KA 3IJLA 4LAKA 4MYAA 2IQ0A 1OZMA 2C15A 4R33A 1JULA 3T8LA 2IXVA 2E09A 2FVMA 1KKRA 1XDJA 1F7BA 2PWUA 3FIGA 1D3CA 4F0LA 1OFBA 5DMYA 2ZX9A 3W23A 3STPA 3H7VA 1DP0A 4U2YA 3VOIA 2GJXA 2F2KA 2FZ9A 3MZNA 4US5A 3IVUA 1POKA 1OGBA 5K9DA 1B2YA 1A49A 1B90A 1R2TA 4DWSB 1T5AA 3MVTA 1UW9A 4ZL1A 1LWJA 2YSWA 3WMCA 2V5CA 3NDYA 1V79A 1OIMA 3K1DA 2E9MA 4MSSA 2OELA 4RL3A 4YWIA 4WSJA 4E8DA 3C3NA 1G5AA 2BMBA 2BX7A 2EBNA 4LU0A 2OGJA 2EHHA 4HNVA 3LXCA 1VRXA 5FJRA 3OZMA 1QWKA 2NQHA 1GYLA 3GWQA 3VFLA 3EKGA 2PGEA 1HL2A 1WZKA 1PE1A 3HG5A 4C6QA 3TOPA 1XYLA 1OYCA 3LERA 4H3DA 3DFTA 1TPUA 4GC4A 2CZ5A 3E96A 4WJXA 3P62A 2EPKX 1IWAA 3FSTA 2O92A 3V75A 1EA9C 4L1XA 2AL2B 4H7VA 4DF2A 5I3DA 4IP5A 3LCGA 4I7WA 2PUZA 4MFEA 8TIMA 1Q63A 2J8GA 4C6JA 2YW4A 3FJ6A 9XIAA 3SUVA 4RE0A 3AI0A 4LAOA 2CLFA 1X98A 4FNTA 3B0YA 2X1TA 3UPWA 1DWFM 1Y8BA 4NUWA 3P61A 3STEA 3LCIA 3B06A 3EB4A 4MAVA 5L6UA 2PD5A 2Y24A 4RE2A 5DQPA 1UA3A 4JIRA 3T6CA 3QF0A 4K38A 3ARTA 4YTUA 3LS9A 1XUUA 3MP5A 3DXIA 3TR9A 2HXTA 2J24A 3DGBA 3KBVA 4EPKA 4ML4A 3TLLA 3CJPA 5BNKA 4BQ5A 2PCQA 5K3VA 4OFCA 2A4AA 4Y2WA 3LU2A 3RR4A 1VCFA 2DPEA 1UG6A 4XZBA 3VUPA 4IMAA 5AN7A 4C90A 1KM0A 4F8XA 1ECEA 3I6TA 4QSHA 4AD4A 3LZ5A 2VL4A 4HCLA 4QEEA 4B5UA 4UOZA 1TQJA 1H7OA 4WJ8A 1Q6OA 3VDBA 1UD2A 1FP8A 1W5NA 2CLLA 4IH3A 3YPIA 1S1PA 1SFLA 1EXPA 5B7YA 2HQAA 2ZZ2A 3HPZA 4NP7A 1G7VA 1FWNA 1DPMA 1KGUA 1UBPC 5HR7A 4CN1A 5E6ZA 3CIWA 4HSHA 2DZAA 4QQUA 4A3HA 1XX1A 4PTVA 4GD0A 2WKGA 1WYIA 4GXPA 5C70A 4PZVA 4H6EA 1XIGA 4BI7A 3C86A 5C9WA 5C7HA 2IXUA 3T40A 1CNVA 3IIXA 2E3ZA 4H9XA 1XLLA 4KH2A 4DM2A 1IXOA 4GUJA 1RLDA 4FLRA 2V38A 2VEIA 2C14A 3F5JA 2WQDA 1XKYA 3TMLA 5CBIA 3R13A 3UT0A 5T8GA 3MCNA 2VKZG 5A69A 4IFKB 3TLQA 1EP3A 3R43A 3W26A 1EWDA 3WDRA 4PUKA 3NM1A 2WKJA 2Y7GA 2PDYA 4C7DA 3SFWA 3NQVA 1AL8A 2RGLA 3F4VA 4DX3A 1JRCA 1PCKA 2JFEX 4QR6A 1YBQB 4EOUA 1KGXA 2X7WA 2WNWA 1M68A 3TA9A 1PCWA 1C9WA 1V6XA 2E8YA 2FTYA 1WO2A 1WXYA 2B7NA 2V63A 3UYIA 3DESA 1FX6A 1DBTA 1PZ2A 4QDWA 2IQDA 5F2LA 3PZIA 4Q8NA 5E93A 3SN0A 2PU1A 1X6NA 4OT7A 1XFBA 3BXWA 4AEEA 3QV8A 1J0JA 1E6NA 3BMWA 1TTQA 1NF7A 1LL7A 4LTSA 1XLCA 2DVUA 3WUGA 1IIHA 5IHRA 3IGSA 1RR2A 4ZOAA 5CGMA 3LRLA 4PMQA 3W82A 3H53A 1JD9A 2VR2A 3P81A 1VEPA 2HK1A 1YPIA 4DJFC 2VT0A 4D1IA 5AKQA 4XZLX 4YLWA 2I7GA 3GB6A 3TJLA 4KWUA 4K36A 2GZXA 1YPXA 2WC4A 3WBYA 1RCOB 4LB4A 4X9SA 3A13A 1W9PA 4LUTA 3HQ1A 3S6DA 1EOMA 2WNNA 4UQ9A 4R5EA 2B7QA 1E56A 2GPTA 3KFTA 2YBVA 1FKXA 3VIKA 1PTAA 2QCCA 5IXEA 1MZHA 1HG3A 6TAAA 3OBKA 4Q4RA 2XIBA 2PSNA 5TQLA 3U4FA 1F8MA 4OJYA 1CXHA 3G77A 5DBTA 1HW6A 1BG4A 4UFLA 4GYFA 1Q6LA 2EKGA 4NASA 2W5FA 3JU2A 5FL1A 1TMHA 3RM8A 5HQMA 4MIMA 3ZZ1A 3WQOA 2QCDB 3C5QA 4ALDA 3VMPA 1DEDA 4AXKA 2BZNA 2BG5A 4B4HA 1U5VA 2XPKA 4NAFA 4NYUA 6ENLA 2NUYA 2AMGA 1LRTA 3NDOA 3CC1A 1NP0A 2CEQA 4PCTA 2Z1BA 3H7UA 2YL8A 2PDBA 2NZLA 3OZOA 3P5ZA 3RNDA 5A6TC 2A7RA 3RLGA 1A5MC 3WNOA 2HCVA 1MNZA 4JFWA 1MXSA 1PZ3A 4FX8A 3V16A 4WLCA 1VJSA 3Q58A 4WKHA 1DJWA 3O9NA 4H9VA 3WBEA 3ZWTA 3EMZA 3R7MA 4Q4PA 3W88A 3BDKA 3Q94A 1GKQA 3PANA 3PP7A 3MO7A 3S3GA 5E6YA 1WQ5A 3UERA 4P8WA 1LUCA 2ZC8A 3DENA 4OOUA 3A24A 3RLHA 3SCWA 4N6EA 5BXPA 3W22A 1E40A 5AZ1A 2BHZA 5JBEA 1Z42A 4LSBA 4JTQA 5HDRA 4MDOA 5K2ZA 3FW6A 1TSIA 5E9AA 4DBSA 4XD6A 4AX7A 3EWUA 1VPYA 4Z2LA 5D2TA 4MPKA 1J18A 3KTXA 4M5PA 4WY0B 1L2UA 4ZTXA 3AXHA 2ZVIA 2PZ0A 4Q6XA 4L56A 2NX9A 2RFGA 2DY3A 4IG2A 1PSCA 2VP8A 3H12A 1K6WA 1UCWA 4JTDA 3QR1A 1XH1A 3WNKA 2X0YA 4MTVA 1MRQA 3T8QA 1WAUA 3K4WA 3KLLA 2CHRA 5CSRA 3M4HA 4JPGA 1GOWA 4XD3A 3S2LA 4HNTA 1GOOA 5EMYA 2O7SA 3VX0A 2QUMA 2VWSA 2E5BA 3TTOA 1SZNA 3IV3A 4L1WA 1A4MA 5F2GA 4I7UA 2DU2A 1H4PA 4O57A 4J9JA 5GJPA 2OQLA 3OG3A 3O7UA 1YTEA 3WF3A 4HN8A 3NNTA 2X0SA 2GQ9A 1F6YA 4ILSA 1DV7A 3F7JA 4DB7A 3MQTA 2W0UA 4HTBA 2VGFA 4DPPA 2OLSA 1HX0A 3GG0A 4O13A 1OC6A 3CTTA 2CESA 3NO3A 3P3BA 1E5JA 1H41A 2E40A 3QH2A 3CM4A 5BWAA 1WDRA 1XCWA 2JGQA 4R3UA 1V3IA 3FAXA 2D0HA 2PZNA 1FWDC 1NH6A 1LL4A 1ZZMA 1N8WA 3GIQA 3W7HA 3M0MA 2QCGA 3M47A 4DJEA 3CQJA 3MSDA 4GUIA 5AVNA 5BRBA 4AC7C 3GXNA 3PUDA 3MBDA 2X1RA 2YA2A 4WD0A 4AMCA 4HNCA 4I5XA 4M19A 3W38A 3D3AA 5CC3A 1S2CA 2DUAA 3MUIA 1UWRA 3S5SA 4E38A 4MLJA 1E9YB 5HWMA 2P3ZA 3LBOA 4A2SA 3QC3A 5KZEA 4MWAA 1QR7A 3ARSA 2J7GA 3U2EA 1OEPA 1RAKA 2GGJA 3EEGA 1E1FA 5A1AA 2P8CA 1TWIA 4JTCA 2G0WA 4KS0A 3O0KA 1LTDA 2IPWA 4TR9A 1MEIA 3BJSA 2DZXA 1F9CA 1BQCA 2ZUWA 3FJLA 2IMRA 4IIFA 4PBFA 3URNA 4TOQA 2BB0A 3CL7A 4QIUA 1RJPA 3TV8A 3LZ3A 4WEVX 2OQHA 3W01A 4XKYA 4HNLA 2AKZA 4Q8UA 1X1OA 3TEVA 1XQLA 4Z17A 3H2OA 4FA3A 2ZXQA 3FGCB 2HNEA 3G0XA 1O5KA 3MSYA 1XSKA 4IQJA 2QGYA 4Z42C 4NAEB 1JQXA 2YCIX 1OGGA 2PFHA 1HUVA 3GVQA 4X0VA 3W72A 3U6WA 2PDFA 5M3WA 3CLMA 2VJXA 1NDYA 3GAKA 3AXKA 1OCQA 2WSYA 3L4WA 3P0XA 4XAZA 4AZBA 4UR8A 3RYSA 4CNTA 4A22A 5I09A 2CIPA 4UCFA 3APTA 3EB3A 3GW3A 2HRWA 3ITCA 1SSGA 1PWMA 3VMNA 4UQAA 1Q2RA 1TVNA 4V28A 1Y65A 1G1YA 1M41A 4IISA 4M24A 3BICA 5LA0A 2I1OA 3CS2A 3N2CA 1WDDA 3PBGA 4BKNA 3WNMA 1R47A 4QEHA 1D7KA 3A5VA 3VKAA 1M7OA 1UMLA 3QMSA 1QHOA 1RY8A 3GHTA 1HKIA 4ROPA 1TA3A 1ZCOA 2VYOA 2O9OA 1C7TA 2GJRA 1R8LA 1XL9A 1ITUA 4ZO7A 1KRMA 3TFXA 3GS6A 3BG9A 3T78A 3UY8A 3S5YA 1UQYA 2GGHA 1U33A 5CLTA 3FCPA 4DBWA 1WE5A 5A6BA 4EAYA 1CXKA 1Z32X 1IZKA 1TZ7A 4UNLA 4DYEA 1SZEA 2VZTA 3DFOA 4IXXA 3WCZA 3OLDA 5LXEA 2Y8KA 3M0LA 4KCVA 4TV5A 2DORA 3OU8A 1QAPA 3LCWA 1JF6A 2IKIA 3WF1A 3AAMA 1DKWA 2HVOA 1ZLPA 4WJEA 4BS0A 4YTQA 2W4XA 1ZAJA 1EHAA 3II1A 4NX0A 3FS2A 5BOOA 2OCZA 3L4ZA 2BVYA 3RO8A 4K2SA 2Z1XA 3OYXA 5C2CA 2XSBA 3BMVA 5A6AA 5I3IA 2A85A 2PC8A 1TO3A 4QCFA 2YDAA 3EWYA 3Q37A 4CU7A 5BMXA 1XLMA 2Y63A 3SDOA 2CLPA 3SIZA 4LY8A 2ISDA 4X3ZA 4GBDA 2ZRXA 2H8XA 3TR2A 2PTYA 3MMTA 4CVUA 1N55A 5JIPA 4Y9AA 3TYBA 3QHNA 1K03A 1PZ1A 3FYPA 1OC7A 3F4WA 3LSCA 1H62A 3RM4A 4HOXA 3FK4A 1O68A 1GW9A 1KFKA 4M0XA 1CGYA 3F4NA 3NPWA 4O1EA 1DJQA 3N6JA 1B9ZA 4KF1A 4PMRA 3CT2A 4W87A 2WBKA 1NDVA 2BGSA 2PWDA 1GQJA 2QEZA 2YR1A 1DYSA 2R1LA 1R3YA 1TJRA 3CMFA 1BXNA 2WZEA 1XD1A 3QQWA 2QUVA 1TPFA 4W4QA 1VKFA 3W02A 3KP1A 4E2OA 3TWAA 3PNZA 1V0NA 4ADTA 3MO4A 3SGZA 1P0NA 3GDBA 2GDQA 4OTKA 1EF3A 4N42A 2V3GA 1JL8A 3AUJA 3XIMA 4PCFA 4GKTA 2GVEA 4J1OA 3EWWA 3BAYA 3PY2A 1DIKA 3BAXA 3QHMA 2BY2A 2V3FA 2JGYA 2PDJA 4LBUA 1DL3A 1BTCA 3I4KA 3UU0A 2WVVB 2QCHA 1E70M 5DFAA 1U83A 3QSRA 4LS0A 2J8FA 1MWOA 4BWLA 4HHHA 3VXGA 4JL1A 3MY9A 4Y8FA 2F6KA 3ITXA 1NQ6A 2OTDA 1R3RA 5FEPA 3TYCA 5AECA 1E55A 4QE5A 4XIAA 4QLJA 1W9DM 4H9ZA 4UMBA 5A8MA 2Z00A 4CKQA 1SJCA 3S8HA 2MNRA 4U28A 3LLXA 4HVXA 1UJPA 1BWKA 4EP8C 3SY5A 1M7JA 3ABZA 4PYSA 4UTWA 1LJYA 3WBWA 1VRDA 4IHCA 5D38A 1B3OA 4JTFA 1X8CA 2X30A 3GBDA 2Q6ZA 3M6DA 2QMJA 2WOQA 4CEUC 2E9BA 3FHQA 3LHVA 5EPDA 2J7CA 2G3MA 5DMMA 2AL1A 3O05A 3P0WA 3VA8A 1JYWA 2BY3A 2J47A 3CQ0A 1E6SM 3VK5A 3AIUA 2CLMA 2CKSA 1KFEA 4JAWA 4BF5A 4IMEA 3FDGA 3UPMA 3VDCA 5HK4A 5A6SA 3IIVA 1ZU8A 2NV9A 4JICA 1O5XA 2FMOA 5LA1A 4LJ3A 3CL8A 4MNJA 4F66A 3WUEA 2E6FA 2J62A 1JPDX 3ANVA 3VDAA 4W8BA 4YVXA 1K8CA 1LOSA 3GTNA 3A47A 4IIEA 3RLVA 2XWEA 2H3DA 1XISA 3S9ZA 1TV4A 1L0PA 4Q4SA 3T4WA 1A0EA 1E73M 1OX4A 2OKOA 2D73A 4FX6M 4CCDA 3V0SA 2QV4A 3HIJA 3KRBA 4ACZA 4W86A 1GYNA 5JH2A 3RF9A 1SFTA 1MFVA 4MFDA 2W3ZA 5U4NA 3U2CA 1LQ2A 4IP4A 1O66A 2ZXDA 3BL3A 2H9AB 3QVQA 2YOCA 3VAVA 1O60A 1CLVA 2ACRA 4PEKA 5RUBA 3TU9A 1TCMA 1HL9A 1E1CA 3S42A 2AMXA 3VC6A 3TYAA 3N19B 4BK9A 1VIZA 1TE1A 2XH2A 1SJBA 4GUHA 5EYWA 1AQ0A 2OMAA 3GO2A 2ZTKA 3IRSA 1XYZA 1QATA 1JZ3A 4FXFA 3BUVA 4H8VA 1U2YA 5JVLA 5D2WA 1V6UA 4FNRA 2OXNA 4X60A 2PWFA 1TZZA 1QUMA 1VBGA 4GX9A 1G4SA 2JIEA 4W5UA 5KZMA 4ADUA 1EJSC 2BHYA 4HNUA 3UNTA 4WX2A 4R9OA 3WDIA 1E0VA 3NM3A 3PPGA 4C6BA 3B9OA 4URIA 4YPJA 3Q67A 4HMNA 3CASA 2OSYA 4RLIA 4D6DA 4NQ1A 1JZ2A 2B81A 5FSEC 3NQMA 4DJFA 3UQNA 7REQA 3VTRA 2Z6JA 2VFGA 3GVRA 5KMYA 1CIUA 4GY1A 3VFCA 4DUWA 2CBIA 3T2QA 3W1PA 4CNUA 1TMLA 4LAUA 3BAKA 3E0LA 5CC5A 5CEWA 5CXPA 3I3BA 3PSWA 1E1EA 3PVFA 3WK2A 4I9TA 1RLCL 5U7SA 1K7EA 2J7FA 3K8LA 2XVLA 1GVQA 1I4NA 2CXEA 4G9PA 2Z24A 1E15A 4ZB5A 1O94A 5E09A 3WUFA 3ZR4A 4AIEA 4ZBCA 3QYSA 2EPHA 4UTKA 3ES8A 3WMSA 2FZ8A 1OSEA 2Q71A 2GOKA 3G8EA 4BA0A 1EWEA 1M01A 3WH6A 1K4GA 4AU0A 4Q8TA 3VM7A 3MCOA 4IF2A 4KRUA 2G3NA 3BARA 4XSMA 3USBA 5DMLA 2YYTA 1MUMA 2CWXA 3W7LA 5KTLA 4CQAA 2VX4A 4NKCA 3W4RA 3STGA 4IFRA 3DYPA 3W3OA 4A6GA 3PB0A 2J25A 1DWJM 1PUDA 5FJOA 1P0BA 3GAYA 3W1XA 2HWGA 1AD4A 3R8GA 3GHSA 2KZHA 3QOMA 1UD6A 2YL5A 5HMFA 3LA4A 3OB8A 1XF0A 1UR8A 2A79A 2ZDSA 3EWCA 4GI4A 3RU8X 5I06A 1BWLA 1JZ4A 1ZFJA 4ZQCA 2Z27A 1J0KA 3WEMA 4KFPA 5CAHA 3DX5A 4UOJA 4QDMA 5BXRA 2BVTA 6XIMA 2POTA 2HS6A 3UR5A 4IQLA 3FYOA 5K9XA 2NV1A 3ENLA 4B2DD 5CSSA 1SFJA 2HPIA 2DP3A 1TR1A 1K02A 2R24A 3SUWA 1NOUA 1QBBA 3VNKA 2CHNA 1QNRA 4HZ6A 1OFOA 1F3EA 3QM3A 1JIBA 1TPVA 4ZEPA 3WD3A 3LHZA 4HPHA 1TR9A 3QFWA 4MNLA 5J5RA 1EBHA 3JZEA 3W1LA 4R34A 1TPDA 4RV3A 3CV1A 1U30A 2O0TA 3MKVA 4M80A 1RHCA 1MI3A 2WHKA 3AXIA 3DBNA 2GLKA 1ISWA 1UWQA 3FFSA 4JKLA 1ISZA 4FIQA 3QPYA 2X1SA 4Q8PA 4O8AA 3F5KA 1JPIA 2HTMA 1TV8A 3C61A 4Y9OA 3F2CA 4XO7A 3PUOA 2PLKA 4GXWA 2Q8LA 4FO4A 1KBBA 4GQRA 1EX5A 3WQCA 3WDQA 2OSXA 3IJIA 4WDWA 4E3TA 3KL0A 1E9IA 2GSJA 4H04A 3OVGA 3GLCA 1VYSX 2FHFA 3BWWA 3VD5A 2VEGA 3G1DA 1PDYA 2J27A 2V2HA 4PBGA 5HNNA 3QR0A 3GKFA 4ML9A 4YWSA 1N8FA 1XLAA 1QI4A 3VCNA 4M7TA 4M1BA 5D32A 1EL3A 3L2MA 4C6FA 5BZAA 4KPLA 1W3IA 1LDCA 3WBXA 3NL5A 5CBJA 4H8HA 1VC4A 1IR2A 1PHQA 3MUAA 1EQCA 2WNQA 4CQDA 3VKCA 5G4EA 5HQLA 3MUZ1 4EWND 2VENA 4ROQA 3LG3A 2XINA 3BOFA 1H60A 3VOHA 2QAPA 4W93A 3MKKA 3BJFA 3G1RA 1Z44A 1OK4A 1GGOA 1GQIA 3JS3A 1S2AA 2WMIB 1RVGA 4PB3A 3PWGA 3NYZA 2DVXA 7ODCA 4CQCA 2BXYA 3RUBL 3CZJA 5E5CA 1QW9A 1ISVA 1V7AA 4AQLA 1GVYA 1K8ZA 3CBWA 8CGTA 1I2PA 5EY5A 4Y7EA 1ZBWA 4Q4KA 3LHYA 1HKJA 2W79A 3LQGA 3CHCA 3CUZA 4HJWA 1Z3NA 4FXJA 2XWDA 1Z48A 2X09A 1G9HA 1UROA 1K8YA 4S3KA 4OZOA 3E5PA 3B9AA 4DVOA 2GUBA 3MMWA 2YBTA 3TXZA 5FF3A 1T8QA 2VEFA 2GDUA 2CPUA 5CPTA 2R1NA 3L0KA 1GK8A 3P5YA 5DO8A 3E5BA 4GCAA 1W3TA 2P10A 4ATDA 1UR0A 2CYGA 4CLMA 4RXGA 3WD2A 2CLHA 4PBEA 1FRBA 1W9BM 4QLLA 1HO1A 4U33A 1WKYA 4UNKA 2ALDA 2F8QA 2VELA 3O1NA 3RMJA 3TDFA 5CSUA 1TX0A 4KBXA 1IEQA 4Z2KA 3GIPA 4Q3MA 4M51A 5D30A 2QCNA 5M5DA 1GT8A 3VGBA 3NQCA 3BOXA 3BQ6A 5IBXA 1PX4A 1OD8A 1FQ0A 3LBCA 4MKSA 3B9DA 4FSAA 4XZHA 1XI3A 2ZYFA 4NI8A 3TQKA 3GNOA 4YHEA 2MANA 1J2WA 2ESCA 3TJ4A 1LZOA 1C8QA 4HD5A 4TX8A 1DJYA 3WELA 2BOFX 4JN7A 1TUFA 2DV0A 2WJFA 4W7UA 1NP2A 3NSNA 3AHZA 1JJKA 1KCZA 4AEFA 4MADA 4IIDA 2YJQA 3TSBA 4AF0A 2A3CA 3GUGA 4HZ8A 4CNSA 1B30A 3W85A 4PR4A 4JQ2A 3FVDA 4IOTA 1VH7A 3DECA 3NQGA 3V1PA 4B91A 1VJIA 4A8RA 2WC7A 6PTDA 3L12A 2W92A 3DYMA 4H6QA 3VM5A 2FIQA 5LHEA 6ALDA 2PTWA 2GGGA 2Z4GA 3PS7A 3V36A 3P60A 1JZ5A 1O5RA 2OT1A 2NUWA 5FJTA 4J28A 2WANA 3U7BA 1X6LA 4OOZA 1XC6A 3EA3A 4GKLA 1UR2A 3PBMA 2TMDA 5D8WA 2V67A 1NOFA 5DXXA 3ITLA 1Q65A 3KL5A 4BI5A 1OG0A 3M0VA 3NEHA 3U48A 4N4PA 5KSWA 5FJPA 1VLWA 4V27A 3BZGA 3OA3A 1UB3A 4U5KA 2W9MA 3W7EA 3WD1A 3VCCA 5I5RA 1KFLA 4RPQA 3BURA 4C6KA 1FP9A 2D2OA 5F4XA 4FB7A 4HHLA 1RALA 1P7TA 2PGFA 2FLIA 3EXRA 3SQMA 1IT8A 3KWSA 4QDPA 2GWGA 3FKKA 4XB3A 2NQZA 4B5WA 3UZWA 2BWGA 3VKDA 1KFWA 5BRPA 2XISA 4L9YA 1I75A 1YEYA 3UWEA 1CECA 1P43A 4QTGA 4IUOA 4N9BA 3CXOA 1J12A 5FSDC 2XGBA 4RDWA 4RXFA 3GNPA 1NWRA 4C65A 4G1KA 5M03A 3L66A 1VEOA 4ZGYA 4LVGA 3L2IA 1QO2A 3WF4A 1WPCA 1JXJA 1X7FA 2ATMA 4R7WA 1V3JA 1VPQA 3GM8A 4KMQA 1X1NA 5F4WA 4WZHA 1RQHA 1MSSA 1JYVA 3B05A 1NTHA 3Q2DA 3WH8A 5JBFA 1HN1A 3LXAA 4OV4A 3M5VA 1OC5A 3CAWA 4UQEA 1T40A 2BGNE 2CITA 3P82A 3CZEA 3MMUA 1ZAHA 4JYEA 4AY7A 2PWHA 4TTGA 3TROA 2B7OA 2WKLA 4F0HA 3GBEA 2I56A 2X42A 1R7AA 3KBJA 1LROA 4E8GA 1QPOA 4G7EA 4NJKA 4L9XA 5C9ZA 2IKGA 1F05A 1KBKA 3GFXA 3GH5A 1AZ1A 2EPLX 1P6CA 4C6PA 2PDCA 1S5TA 4M6PA 4LUSA 3CO8A 1D9EA 3WNLA 5HJYA 1YHTA 4Z1DA 4QRNA 3RN6A 5BW6A 3K5XA 2Z2AA 2BOEX 4QM1A 3KOFA 1LBMA 1XXXA 4XBJA 4M6QA 3MYOA 2QUNA 3DYOA 3NL2A 1XLEA 2ZZ3A 2XM1A 4IMDA 4LUYA 1BYDA 1XWYA 4L80A 5I2UA 1WCGA 4NRRA 2OLAA 1F4HA 2DZBA 2HSAA 2BSLA 2WVUA 1R9XA 4UR9A 2ASHA 3I7RA 2DFAA 5DX7A 1CI1A 1A3WA 1E4LA 4HOZA 2PEVA 3APYA 4PTXA 1SJDA 4U2ZA 4LGXA 1UWTA 3VMOA 1GZGA 2GWNA 3WLIA 1P4CA 5AYYA 3BZJA 3Q65A 2AQVA 5L9FA 4QJ3B 4IJCA 4GNVA 1W56A 1JUKA 4B9YA 1JUEA 1E4IA 1QHPA 4JR5A 4UTUA 1T0OA 5M17A 3CV6A 1MUCA 1IXQA 4WHBA 4QJ5B 1PYMA 2VEKA 1NQKA 1DOSA 1W32A 3WIJA 1GWJA 1O95A 2E6YA 2ISSA 2P3EA 2YXGA 1OHLA 3BW3A 6TIMA 1Z9AA 1XR2A 5LA2A 3O2LA 1UUMA 2NWSA 4HA1A 2ZWYA 3MHFA 4X61A 1B54A 3E12A 3RPDA 1W1TA 2PDGA 4RDVA 3VGFA 4JBRA 5HNRA 4J3WA 3IUHA 4V15A 5I77A 3SO7A 3C8NA 3W81A 4F48A 4MJ4A 4J3ZA 5CZJA 3WL1A 4HZMA 1KBJA 1Q3NA 4LFYA 3NL3A 1OFDA 4GZJA 3OZPA 2J7HA 1W1YA 3DAQA 3CUFA 3G1SA 3SCTA 4HPGA 3XISA 3MDUA 1EJTC 3AC0A 2DSVA 4P7RA 3EX6A 4DUOA 4I9MA 1E4MM 5CZTA 2IS7A 2JKEA 2Y7EA 1A53A 2JF7A 2J7BA 3HBLA 4PRWA 1XBYA 4AUBA 4JY9A 1YXCA 4Z1YA 3L5LA 3M6YA 1WX0A 3KZSA 4MY9A 3DUGA 2XIJA 2VZUA 3FYYA 2WM0A 1XSIA 2ISWA 4DBUA 1XFCA 2R9RA 1XYAA 1DQWA 2XIIA 2PBGA 5EMKA 1RSCA 1TTJA 4XZNX 1EC7A 3G1FA 3SY8A 3W27A 4CD8A 1FWBC 4M29A 3PTKA 1H50A 3KXQA 2E68A 3RX2A 2QMKA 3W6LA 4DYJA 1JUBA 3OODA 3SAZA 2TODA 3POHA 3UR2A 4A21A 2VUYA 3SI9A 2GYIA 1H49A 5D2XA 4LBSA 4N6FA 1ICQA 1W17A 1I1XA 1E6RA 1BAGA 3D46A 3UG3A 1SZRA 2G8ZA 5EU9A 4D71A 5DELA 3SZ8A 8A3HA 4KIRA 1XIIA 4X2PA 2XFRA 1RD5A 1A5OC 5EBAA 4BEUA 2QJGA 2PDKA 3HV8A 1XD0A 2YW3A 3NIYA 3W6MA 3LI1A 1NM9A 3VUSA 2QKFA 4HPNA 2B31A 2C13A 4HK6A 2INEA 2VCBA 1P5BA 3GXTA 3EAUA 4EXQA 1OFEA 3M7WA 1IV8A 5EB8A 1BPLB 2H90A 1KM5A 3UP8A 4XVEA 1C8XA 4RNJA 4ZFCA 1AZ2A 3JUGA 1J0IA 4UBPC 3EOUA 3KBSA 4P8VA 5HA7A 3KVKA 3G8RA 2ZA3A 1UP3A 1OK6A 4OQVA 3OQEA 2PPGA 1JNDA 4LV4A 4G7FA 3E0IA 1TQXA 1R46A 4XZMX 1XRVA 1UR4A 2OSWA 4G6CA 1U1JA 4HMDA 3VZYA 4F40A 3N04A 2QYGA 4US5D 2PRLA 4K7YA 2BNJA 3C8FA 1QASA 4P7OA 3QV6A 3IPWA 2WHMA 2VZOA 4ICMA 2CERA 2ADAA 3UCDA 4MKVA 3CB3A 3L4TA 3AYTA 2Y5EA 2V81A 1W3LA 4EIVA 2YXOA 2OB3A 4LYQA 4AIBA 1E6XM 5G4WA 4Y9PA 3CLWA 3TP4A 4GWEA 1IEVA 2V0TA 3G1XA 3HF3A 1KTNA 5EKYA 4GIYA 3W2LA 3H4WA 4QSFA 2IPGA 5BOEA 3L7RA 4B3KA 3MB9A 1DE6A 2PODA 2QR6A 2VGBA 3ZM8A 1W3KA 1B1YA 5HUOA 2Z7GA 3GU2A 5CC7A 2EKCA 3AS3A 2HVMA 4L6DA 1PX3A 4GA8A 7PTDA 1UH3A 1X6UA 5HAOA 3OQ8A 1RP9A 2CC0A 2Y70A 3K13A 3LTPA 1TTPA 4NRSA 4WRHA 1XBVA 1SO6A 2GVYA 2IPJA 3LGEA 4RR4A 1RVKA 3DEQA 1QPNA 1BVWA 5HANA 3UZXA 4P7QA 5I03A 2EO7A 2FDSA 5KINA 1BG9A 1P1XA 5E0KA 3M0JA 1SJAA 9XIMA 1ZJBA 5REQA 1HJVA 1FWIC 3HGRA 3GNRA 2QCEA 4WF7A 3LPPA 3GXMA 3TW6A 1OABA 1AODA 3KOZA 5FCZA 4LS1A 3LCFA 3B8IA 1CGWA 1BTMA 2Q3OA 4RDYA 3OGRA 4KWWA 5HR6A 1PWLA 4GBUA 3ABRA 3GIYA 1GVFA 1UPPA 3AMDA 4K3ZA 4PRTA 3P80A 2E0PA 1GPWA 3EX1A 3C4UA 2PDLA 4HJFA 3DHFA 1J8VA 1EIBA 1DXFA 1MQRA 1P6WA 2XM2A 2RDTA 3QRHA 2A6NA 2D22A 4RPPA 1B3WA 2RH9A 5DY2A 2Q8ZA 1LRQA 2I9EA 4YTTA 1WXJA 4AZIA 2D23A 4LYPA 4Q8WA 5AYZA 4FXSA 3SECA 1S5NA 1G67A 5A6LA 4HNNA 4XAGA 3SUUA 1ZBCA 3VOGA 1R3SA 4XVDA 3N4FA 3GFYA 3ISIX 5CSYA 1TJPA 9RUBA 3MHUA 1HVQA 4GO9A 2VTFA 5JU6A 2YDQA 3I65A 1FXQA 2NWRA 3TN3A 3WDHA 1VFLA 1R3WA 1S46A 1IZCA 1DHKA 1WUEA 4I9AA 4O52A 5HATA 1MUWA 5HMSA 2PWGA 3GC2A 3ARWA 3AIRA 3GVWA 3CUJA 3IGXA 1IXNA 5I0DA 5DCBA 4UNIA 3U0HA 1J0YA 2V6AA 3WH9A 1XGEA 3TQVA 1S38A 1SVDA 4S2CA 3IJQA 1JPHA 4M56A 1LP6A 2ZRWA 3LMYA 4ZOEA 1YMYA 4D6GA 3LLDA 3GTIA 1PKYA 1TIWA 1IWBA 5D09A 1S3HA 5ABFA 4ASTA 1IT7A 3NO5A 3CPGA 3HG3A 3UJSA 3DIPA 2VFHA 3SUSA 3SM0A 5LYRA 2NVAA 4LC6A 4IXHA 1E9LA 1XIJA 4H7ZA 2D2JA 3TNBA 1H7XA 1UJQA 3OHMB 2EPMX 4GZIA 3N4EA 2C0HA 3DBPA 3S2CA 3L0GA 2VFDA 3N17A 1RJQA 3DOPA 5G5IA 4IGSA 4GJJA 5FEZA 4X0NA 3H4XA 1H7WA 4JQ4A 3LCHA 3VDHA 5TAOA 3TAOA 3VVGA 3PN8A 4QE4A 1BFNA 2QGHA 2QHAA 3FKRA 1OCNA 4RZ6A 2YA1A 3ZT5A 3TYDA 2QIIA 4MLRA 1XIHA 1S5VA 2CKRA 1BRLA 2G41A 3SQLA 3EZ4A 3D6NA 3BMXA 4ZODA 4DIAA 4XKMA 2XH4A 1Q7QA 4GJ1A 3KUMA 4WCJA 4AZHA 1Q5MA 1OFPA 1YNPA 5LIXX 2O56A 4IL0A 3A4XA 1SZFA 3TW7A 5ECUA 1KCKA 4NYYA 2VC9A 3AHYA 4WQ6A 1AQFA 3IK4A 5C2XA 3TUUA 1RJRA 3DHPA 1KXHA 3WD4A 2XH0A 4DO7A 3ZSSA 3T42A 1XYCA 2CBUA 2FFCA 3OHIA 1HGYA 2TSYA 3T2OA 3AS2A 1R86A 5CPOA 4CD6A 4W7WA 1PV8A 2QT3A 3EWZA 2ZXBA 1RQEA 2WQPA 7A3HA 3H54A 4JX5A 4ZR8A 1XLKA 4FOJA 1XLGA 4NXSA 4AFYA 4F0SA 4KRTA 1EP2A 2BLEA 2XN0A 2C7FA 5HWNA 1DJIA 1VR6A 3L5MA 4L1GA 4GQBA 4D6IA 2ZE3A 4MOZA 1FY6A 3HPXA 2YCKX 3EXTA 1C29A 2UY5A 1AW5A 4UMCA 2J9YA 4CU8A 3ORWA 1CB7B 1L8PA 4PN2A 1Q85A 3D47A 3SSJA 1UA7A 4ORMA 1ESWA 4QXIA 5G1YA 2ICSA 3D3FA 1XDLA 3LCXA 1OX5A 3EDFA 3BPWA 3W70A 1OYAA 4WSKA 2C71A 1OVDA 3ZO9A 4W89A 3LM3A 1DWGM 1FH7A 4GNKB 4RDZA 1RUSA 3VZZA 4J3VA 3HZ3A 1J4EA 1DORA 3GE7A 3PTMA 3PTQA 4XTDA 2XTKA 4P5UA 3REQA 5CGQA 3WSUA 1J0HA 1W1ZA 3M0HA 4PCPA 3VIMA 1JXKA 2RJHA 4MF4A 4MZYA 4W88A 3PB2A 4MYXA 1NARA 1S2TA 1Q2SA 1PKLA 1PS9A 2HVNA 3SCPA 5FF0A 4MJMA 3A3XA 3LDVA 4LVFA 1WDWA 1BWVA 2DW6A 4O18A 1ODZA 1I2NA 4LWWA 3RAOA 3WF0A 5BXTA 4PL2A 2YIHA 2QS8A 5LNRA 3ARXA 3W7KA 1F6KA 2DIKA 1ADDA 4O1CA 4B4FA 2NT0A 4GIEA 4ZVJA 5IOBA 1OZQA 3L9CA 4J3SA 2ZDRA 1CB2A 4MUPA 4TX6A 3L23A 1KBLA 3C2VA 2XZ7A 2NUXA 1EA0A 4WIWA 2D2GA 4EPDC 4AY1A 4GY0A 3CZLA 3OBAA 2Y7FA 1CLXA 3MI2A 1G4EA 1XGZA 5LXXA 3M5YA 5C5YA 2GVGA 5A8PA 4D6JA 1FKWA 4B9ZA 3SRDA 4H1ZA 3UZZA 3N1AA 5ABHA 1UBSA 5T26A 1J79A 2P76A 3EWBX 4I6VA 1TYGA 4O8RA