4WD0A

Crystal structure of hisap form arthrobacter aurescens
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
242
structure length
230
Chain Sequence
QSVLELLPAVDIVDGQAVRLLETSYGTPLEAALNWQNDGAEWVHMVDLDAAFGNNAALISDVVSQLNVKVELSGGLRDDESLERALELGVARVNLGTAALENPEWTRKAIDRFGDKIAVGLDVRGTTLAGRGWTKEGGDLWEVLARLEDAGCARYVVTDVTKDGPNVELLRQMVEKTGKPVVASGGISSLEDLRVLRELVPLGVEGAIVGKALYAGAFTLPEALDVAGRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of HisAp form Arthrobacter aurescens
rcsb
source organism Arthrobacter aurescens
molecule tags Isomerase
molecule keywords 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneam
total genus 72
structure length 230
sequence length 242
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2014-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4wd0A00
3N3MA 3QEZA 1LORA 3C2VA 1B4KA 1OFPA 2QCMA 1O5XA 4R7JA 3W7DA 2DJLA 2CLKA 2JKEA 3MWAA 3NPXA 1QR7A 1WA3A 3LRLA 3D0CA 2CWNA 4MJMA 2C16A 2ZZ1A 3N34A 4I7WA 1MO0A 1GVSA 2VFGA 2X1UA 3W2UA 2EPHA 3EWUA 3S9YA 1LCOA 2RHGA 3LM7A 4RXFA 5HWMA 3GAYA 2A0NA 4MJZA 3R12A 2P1FA 3B04A 2C13A 3DU0A 2FFCA 4LT9A 3CB8A 1XBYA 1KM1A 3GR7A 4DXVA 5LZLA 5FF4A 5IBXC 1KM3A 3S5ZA 3TDFA 3N14A 1GOXA 3GNNA 1B3OA 2NX3A 3E0IA 3HBLA 1TO3A 1X1ZA 2JKAA 2Y61A 3TAKA 2YR1A 1G67A 3GX9A 3R13A 4JR5A 5EKYA 1UUMA 1OX6A 1ZALA 1LRQA 3ABQA 3DI1A 4FHAA 3KOFA 1I2RA 4J9JA 4LC6A 1JRBA 4NJJA 2PURA 4LVAA 1T0OA 3C52A 2GPTA 1AG1O 3LHVA 5C55A 3PBWA 4NNAA 4ICNA 3LRKA 3P8JA 4Y9AA 4EF8A 3IIZA 3PF3A 4N9CA 5EYWA 5DCEA 2X1TA 1G7UA 2NXHA 3KAOA 4DO6A 3LHUA 3Q2DA 3LLFA 3C4UA 3FKRA 4XBKA 3BLIA 2DZPA 1TQJA 5AYXA 1G6CA 1P0NA 2UV8G 2WOQA 3F4NA 1JCLA 4XKYA 1TTPA 3W1RA 3EX6A 2C6QA 3MP3A 2DORA 2Z1BA 4LS0A 1XBVA 3W88A 4JYEA 1UUOA 3N2XA 3QW4B 1NEYA 4A2RA 4PODA 4Y90A 5J5RA 2ISVA 4ADTA 2P0OA 3GYEA 1F6KA 3SECA 4LV4A 2NWRA 5K9XA 1EUAA 1VYPX 3G1AA 4LRTA 1KTNA 3L2IA 3FLUA 1FWSA 2QDGA 1ALDA 2Q8LA 4NJHA 5AB3A 1H1YA 4BK9A 5D02A 2V2CA 1QPRA 1B57A 2BLEA 1LLZA 4UXDA 4FNQA 1FWRA 1R2SA 2CZ5A 3P8IA 4JIQA 3LV5A 3AJXA 2WO5A 2VELA 3R89A 5HULA 2RKXA 1I8JA 4LVGA 4EWND 2BTMA 4UMCA 4O10A 2Y62A 3BLEA 3QF0A 1O4UA 1W56A 3QJAA 2H8XA 5K3VA 2W79A 4C1KA 3NQCA 1S5WA 4AHPA 3RNDA 5K7JA 1Z44A 1RQHA 1Q6OA 2VEIA 2EGZA 4JX4A 2TPSA 2BXVA 3ZWTA 5AN7A 1YTDA 3L9CA 4E2DA 1TPC1 1GTEA 4WOZA 1X1OA 1K8ZA 1LP6A 1W1ZA 4AMAA 5EBUA 1TYGA 1PIIA 2JBMA 1PL9A 2A7NA 4UTIA 4FX6M 4JEQA 1F74A 1H51A 2CW6A 1HFBA 1ICSA 4UIOA 3PULA 1K3UA 2ZQ0A 2XFWA 5LHFA 3N9RA 2YYUA 2H3DA 1KM5A 5I3JA 2ZRYA 3DZ1A 3HG3A 4DF1A 1C29A 5KSWA 1OG0A 4MFEA 2W0UA 2FB3A 3ZFHA 3G24A 3GDKA 4U4MA 1OFRA 3CHVA 3OEXA 5D32A 5FEXA 3W1LA 3PUDA 1TV5A 4N2YA 5C6MA 5AC7A 4O16A 1S3HA 1GPWA 4HNTA 4WY0B 5FF7A 3NPVA 1TRDA 3UNDA 2EHHA 4ZZ9A 5EL1A 4O0KA 1KFEA 2ATMA 2ZRWA 2EKCA 3GAKA 5E93A 5HMSA 4JTTA 1IIGA 2WV8A 4KWVA 3VNDA 2QF7A 3TFXA 3PVFA 3L66A 4AXKA 4KFOA 2E5CA 4O4WA 5E1QA 3CWNA 3TSDA 1WBJA 4LY8A 1MXSA 2R94A 4O13A 3G1YA 4LV9A 2BZNA 4P61A 3O6CA 1MEHA 1VJIA 4C1LA 1IIHA 1TB3A 1T99A 5F1VA 2PC4A 3FJ6A 2B4GA 3B0VC 3W9ZA 3CPRA 4OV9A 2YX0A 5FF0A 2QCDB 1ICPA 3GDMA 1YTKA 1SU5A 4UR7A 1TMHA 3NEVA 5BRBA 3G0UA 1OK4A 3TIMA 2J24A 5FF2A 1AW5A 3FYOA 4WY0F 1Q6LA 3SIZA 4Z1AA 2B7NA 3M0ZA 4Y96A 3I68A 1JR1A 4IMFA 4UMBA 2O7QA 4FEZA 2FB2A 1F7BA 2HMCA 5F4XA 3O1NA 1ZCOA 4S2BA 1SW0A 5EPDA 3C6CA 5KZDA 1GVOA 3N9SA 3GXTA 4K7YA 2VENA 4FNRA 3QW3A 3P7YA 7TIMA 1KBJA 3PG9A 3TXVA 1Q6QA 3VCRA 2Y7FA 3LB0A 1VYRA 3GXNA 4CNNA 3BGGA 1U83A 2ISWA 4LU0A 4MY1A 5G2HA 5DBUA 1X7FA 1SO5A 2DZSA 1OVDA 4XWUA 5U4NA 4EVZA 3P67A 3M43A 2I9EA 2TYSA 1W54A 3N2MA 1H50A 1KTCA 3TW6A 2WKJA 5BW6A 3BG5A 2V9DA 1SO4A 4KWWA 3QMTA 1OJXA 2Y7DA 2VOMA 4N4QA 1FXPA 5D04C 2ZZ6A 3MMTA 4K37A 1K02A 1W3NA 4HHPA 1OF6A 1A5SA 2YDAA 5CZJA 3W86A 4DBDA 2V0TA 4EOUA 4Q4KA 1XL9A 5LNRA 4A21A 2JKPA 4QIUA 4XTIA 1LYXA 3UPWA 3O05A 2FJKA 3GZ3A 3DXIA 4ZQNA 3U6WA 5L9FA 4R53A 1QPOA 3SSJA 3EX1A 2V2DA 3IIOA 4A3UA 1F05A 2Z2UA 2CLIA 2OX1A 1TIMA 1FDYA 3Q94A 4UR8A 4YMZA 3E02A 3T44A 3B06A 4RK8A 3MBFA 3YPIA 3DFNA 5D2TA 4U28A 4ZVJA 1TPFA 3CTLA 2CLOA 4O53A 3SY5A 4JDBA 3BW3A 3EKZA 3LCLA 3FOKA 1Z48A 2J6XA 2VFFA 4UTTA 4OGZA 4O52A 5LKYA 2QUTA 4UNLA 1QPNA 3Q37A 3W75A 4N02A 1XC4A 3I7SA 1QO2A 3WJWA 2P10A 3W7RA 3W76A 5FF3A 4E38A 4K6AA 4AWSA 4RKAA 1RD5A 4JTHA 1OFEA 3R5EA 5CSSA 2V82A 1VGAA 4QQ3A 1S5TA 1TSIA 4PA8A 6ALDA 5DY2A 5D2YA 1PVNA 3DFQA 3VFLA 3M5YA 3LXAA 2CLEA 3OA3A 2VC6A 4JXCA 4TX9A 2OCZA 3BW4A 1N55A 4YLWA 1FWWA 2E5BA 3MYPA 3HO8A 1W37A 1YDOA 2XN1A 2E77A 2V8ZA 2DJXA 4X3ZA 4JYDA 4UFHA 1OK6A 2A6LA 5AHFA 1LRNA 4GJ1A 3UD6A 3GDTA 3IVTA 3STEA 4XTDA 2E6DA 5G2IA 2RDWA 1QNVA 2FDSA 3WJSA 4MPQA 3DFPA 4HPXA 1C9DA 3UPBA 1LOLA 5ABTA 3NXFA 2CZDA 5AHLA 3SI9A 1ME8A 4JNMA 4S2CA 3HGRA 1KV5A 3UY7A 3W7NA 3W1NA 1A5AA 3QSRA 1QMLA 1JVNA 3PM6A 1G4SA 5F2IA 3RFAA 3STCA 1JQVA 3HPZA 4NZFA 1GG1A 5HINA 4FNUA 4DO5A 4JTSA 5AYYA 1GWJA 1ZENA 1FWNA 3DHFA 3LLDA 1OFDA 3DFOA 1XUZA 3W1PA 3LHWA 1SSDA 2WNQA 3FEMA 2J27A 3A24A 1LROA 4IX2A 1TCDA 3P74A 4LRSA 5F1UA 3TXZA 3E9AA 4FIQA 3UXDA 4JX5A 1KW1A 3G22A 3N19B 4AAJA 1B4EA 3W7GA 1AL7A 1HO1A 1MEWA 2BWGA 3GIYA 3O63A 3TSBA 3NL3A 4UUIA 4ZMGA 5HR6A 2WJZA 1ICQA 5CPOA 3M44A 1AW2A 3W7CA 1TV7A 3EXTA 3CEUA 2YSWA 5FI8A 4Q33A 5G4WA 1TPUA 1L6YA 1YXYA 2GOUA 4LS2A 3VE7A 1W5NA 1W5OA 3IEBA 3S1VA 5LNSA 4WY0A 3RF9A 3PG8A 3W73A 1KV8A 5TBOA 3G1HA 4IXHA 1K8XA 3FIGA 2E09A 1NSJA 4PFMA 3ANYA 3UY8A 2YW4A 3H53A 4TIMA 3FKKA 3CT7A 3EWXA 4NVTA 3C3NA 2DZXA 4M6QA 3NOEA 3MP5A 1IF2A 2A1YA 1FCQA 3S42A 1V5XA 3S1UA 2DZVA 1KFCA 4NJKA 5EA9A 1FBAA 1F2JA 3KHJA 3PUEA 1QOQA 3EEGA 2A7RA 2A5HA 1MSSA 1KM2A 4I9AA 3EWYA 2X1SA 4WD0A 1ZY9A 3UZJA 3GDLA 3A21A 3B4UA 5K9DA 4JS3A 1M5WA 3MO7A 5K9CA 4YCPA 5HUOA 5D09A 2NZLA 1XBZA 4QITA 5CZTA 5KINA 4PEKA 1T8XA 3P61A 4CLMA 2WNZA 4LNYA 3STFA 1JQXA 5KZEA 3EX3A 4MLRA 5CPLA 2NLIA 1I2OA 4LTSA 5C2XA 3MBDA 4MZ1A 5LGXA 2HSAA 5D03A 3W7HA 1RPXA 1XCFA 4E0CA 3LDVA 1ZHAA 3B05A 4OWGA 4DBEA 4BWLA 1QOPA 3NQ8A 2C14A 3L65A 4MZYA 4LOCA 4RXGA 2NV2A 3LRMA 1J5TA 3SR7A 3FJLA 1ME7A 1OABA 3TJXA 4GUGA 3PBUA 3C8FA 1FXQA 3LHZA 1VH7A 1KBIA 8TIMA 3QPYA 2YGYA 1EIXA 3LGEA 2J88A 3RMJA 4FXRA 5HQEA 1OYAA 3ZWSA 2YZRA 1FQ0A 1R47A 4O1DA 6TIMA 3LOTA 4MUZA 3WFAA 5F2LA 3LTYA 1QCWA 3W83A 3C2EA 2QDHA 3SGUA 4N9DA 4ORIA 1TQXA 4H4IA 4JICA 3HQ1A 3M5XA 1SZFA 1UBSA 5I3KA 4AHQA 4DELA 3L5LA 4OT7A 3W7EA 2NXGA 4O19A 4O15A 2FIQA 1H7RA 2JK2A 1KFLA 2Z6IA 4LUJA 3GLCA 4UNKA 3HJZA 5AHMA 1NVMA 2VEMA 3BG3A 3CIXA 1WOAA 5DN1A 1IXQA 3VE9A 2A21A 4UTMA 4MY9A 4OQVA 4PC8A 3L0NA 5J5DA 3OVRA 1KLZA 3OBKA 4MYXA 3ZS4A 5BOOA 5FESA 2HTMA 4D2JA 5DELA 4RR4A 3A23A 4JTGA 3M5ZA 4IPJA 2OZ0A 4PTNA 2G97A 5T26A 1CX9A 4K8HA 5KTLA 5DCBA 3SFKA 1SUXA 2VEKA 4UCGA 3BW2A 3TFCA 1XI3A 1EA0A 2NV1A 2QR6A 3W70A 1AW1A 2CZEA 2VXNA 5CZ0A 1N8FA 4M6VA 4JTFA 1Y0EA 4Q32A 3T78A 1PCWA 4HNNA 3KFTA 3C2RA 1VZWA 2AQWA 2NX9A 1FCVA 4UFKA 3S1XA 1SZNA 4FNTA 1VLWA 2WSYA 3MYOA 3B8DA 4N9BA 3W7KA 3W74A 1AMKA 2Y6ZA 4JTKA 2QUUA 3S0CA 2NX1A 3TJLA 3V75A 1R46A 4WUIA 1KFKA 4HN4A 2JGYA 4HT3A 4WZHA 1EP3A 4QJ1A 4L4MA 4CCCA 4JTUA 3TCEA 2QCNA 3EXSA 2TRSA 3G0SA 1QAPA 1GQNA 1JCJA 5KMYA 4IMCA 1DOSA 4OE7A 3TE9A 2J9XA 3BK0A 1XFBA 4FNSA 2ZTJA 1OX4B 1YPIA 4KFPA 3PY2A 5TQLA 3KRZA 3KXQA 3QPZA 5K4ZA 4NXKA 5C54A 1LM1A 2C0AA 3O07A 1P5BA 1RV8A 1W0MA 3NNTA 1GZGA 5A8GA 5HR7A 1PHWA 1GG0A 1OFQA 3WJXA 3NZRA 3DHDA 1X6UA 4DPQA 2C18A 3M16A 3W23A 4PL1A 4LW7A 1L6SA 4IMEA 3N73A 3UWVA 4UTWC 2E68A 3U2OA 1XM3A 4UTTC 4GRSA 1LBFA 3G8RA 3L21A 4K38A 4TR9A 4UTJA 2ZDRA 5I3GA 1F6PA 1BEUA 4NNCA 4ML9A 3BV4A 2VFDA 2C1HA 4AF0A 3OHIA 4XZ9A 3CIWA 2QCLA 4UTHA 3M47A 1XXXA 1OFAA 3GKAA 2F7FA 3TH6A 3L0KA 4RJEA 3FFSA 3W85A 3UWZA 3EWBX 3P84A 3W7PA 5D37A 1NAL1 4WXYA 4TU1A 5EY5A 4KFNA 1H7OA 5D05A 1ZFJA 2CLLA 4GXMA 3CC1A 4JD4A 4K39A 1H5YA 4UFMA 1J2WA 2B7PA 5D33A 4A2SA 3W7OA 2W6RA 1TPH1 3G1FA 3L0GA 2Y85A 2B7OA 1WX0A 2GQ8A 4GUJA 3NQAA 3LX9A 3L67A 4O0ZA 1YXCA 3TMQA 4OV4A 2QKFA 1EP1A 1S5VA 2Q3OA 3S6DA 1K7XA 4PCFA 1SR9A 4TO8A 3W72A 1H63A 1W5PA 3JS3A 5AFDA 2WPBA 3DENA 2YFNA 3DFSA 5LNVA 4IGHA 2QEZA 2ZRXA 3MI2A 3NZ1A 4ORMA 3DGRA 3NO5A 3NL6A 5CPMA 4ZL1A 4WXZA 5DXYA 5DLCA 4O1BA 4MVAA 2DZTA 3T7VA 1TV8A 3G1XA 2GQAA 5I3FA 3LTPA 3HG4A 4JIPA 3FA5A 4G1KA 1B9BA 3HIJA 4B5NA 3B0UX 1GYLA 2J9ZA 3QM3A 2Y70A 1T96A 1E51A 2Z6JA 3QFEA 2YYTA 4LS1A 3SJ3A 1DJNA 4UTUA 3EKLA 5KZMA 1TREA 5FEPA 3G18A 3GDRA 1GT8A 4N4PA 1Q3NA 4NZJA 3S5NA 3LXCA 1VQTA 2QJGA 2Q8ZA 2OT0A 4GUIA 2PRHA 4XKYB 4Z0JA 3W1XA 4NXSA 5H2ZA 3BARA 1LRTA 1SSGA 4BF9A 3TX9A 2GJLA 1A5BA 3F1QA 4ZQPA 3IRDA 2C3ZA 3HPXA 1F5ZA 4WJEA 3TKFA 1UJPA 5D2VA 5AYZA 2EAWA 2ZA3A 3OVPA 1JJKA 4IJBA 1H7PA 3G3MA 4CCEA 2ZFAA 5F2GA 3LCIA 5AHIA 5MHBA 2I1OA 1MZHA 4RCXA 3L5MA 5HJLA 1A50A 2ZRZA 1FDZA 1FCUA 1UASA 1VYSX 2QCDA 4KKXA 1L2UA 5F4SA 4MKNA 2E1DA 2ALDA 2E6YA 3QRHA 3NQFA 1HTIA 1DJQA 1O94A 3NQEA 1HUVA 4ADSA 4Y8FA 4TMBA 3RLVA 4AWTA 3UZ5A 1NF7A 1H7WA 4CNPA 4BI7A 2NWSA 4AF0B 4RZ4A 1CW2A 3LV6A 4WX2A 5AC8A 3DI0A 1Q6RA 4WOQA 3MHUA 1VCFA 3W1MA 1I2QA 3QC3A 4PL2A 1G7VA 1KFBA 3TW7A 2J9YA 1YTEA 3M1ZA 3W1TA 3PC0A 2Y63A 2C15A 4RZ6A 4HNUA 1TPB1 2GVJA 3HPSA 4O17A 5FEZA 3MUXA 1WOBA 3HG2A 3LHTA 1FUYA 1TPEA 3F03K 1EWDA 3GR8A 3M41A 5IBXA 1XDMA 3NQDA 4BI5A 1YADA 4POCA 5G5IA 1C8VA 4Y6GA 4YXGA 4O8RA 1RQBA 1IXOA 1UCWA 4NX5A 3USBA 2KZHA 2YXGA 3LI1A 3S1WA 1D3HA 2ZTKA 2ZCGA 3TQVA 2DZUA 2GVGA 3W2JA 2Y7EA 4RX0A 1DQXA 5BMWA 3TV8A 1Z41A 3THAA 2QUVA 3K30A 2XN0A 2A4AA 4RV8A 1VS1A 2V5BA 2PRMA 1EB3A 2XN2A 1VCGA 4O14A 3M9YA 4FB7A 1D9EA 3PSWA 1M6JA 1G69A 2VKZG 3CM4A 3HOJA 1LZOA 2LLEA 1QO5A 3A22A 2Y7GA 2QCEA 4YCOA 3VI2A 1QFEA 3W2MA 1H1ZA 2X2GA 3G1DA 1EPXA 1THFD 1F73A 4MOZA 4JTJA 3WJZA 1ME9A 3EX4A 3KVMA 3NM3A 5D2WA 3TQKA 4IWWA 4JYFA 3P60A 3LCXA 1O5KA 1VHCA 5HNRA 2EF9A 3W7LA 4R33A 3O8AA 4FIRA 3EWWA 3CWOX 1JCYA 4M6PA 3ABSA 2TSYA 3TU9A 2X30A 4H6KA 4JY9A 4UTLA 3GK0A 3GB6A 3R2GA 3W22A 3NG3A 2H3BA 4FO4A 4YL2A 3UWWA 2ABBA 2WNNA 1DV7A 5I3HA 3ATYA 1BTMA 3WK1A 1R30A 2QCGA 5F2MA 3MI6A 3NL5A 2RDTA 3EX2A 4NJIA 5AOUA 4O54A 1W5QA 1K03A 3W2LA 4A22A 2PE4A 3FYPA 3EWZA 4WQ6A 2ZZ4A 2YW3A 3PBYA 1H62A 4AVFA 1XDLA 1TJPA 4JDYA 4UMAA 5H91A 1LBMA 1K8YA 3PWAA 4QAIA 3H54A 5A5WA 4MZ8A 3TC6A 2ATSA 3LBMA 1DORA 3MHFA 3KX6A 3QYQA 1ML1A 3FS2A 4OU1A 3I65A 5AHNA 4O11A 1RZMA 4QSHA 3CEPA 3DKJA 4E2BA 4ZQMA 3AO0A 4XBSA 1TTJA 4NT0A 1CI1A 5GVJA 1WBHA 1TRIA 5G2WA 4W9TA 1TPVA 2BSLA 1D3GA 1KTBA 5AC6A 5HWNA 3C56A 3TMLA 2QCHA 3PR2A 4MLJA 1OFBA 1OFOA 1EWEA 1U5JA 2D73A 4HSOA 1JCMP 2VFHA 1ZAHA 3ABOA 2HS6A 1KLYA 1OX5A 2YPIA 3QZEA 2GUUA 4XUGA 5K2ZA 1R2TA 2NUXA 1I2NA 1LLWA 3ZR4A 3QMSA 3LHYA 4O28A 1DL3A 3GNDA 1VHNA 3W7QA 1TJRA 4HIBA 4MFDA 2ZA1A 3EXRA 2A2IA 4JX6A 4ONVA 2VFEA 5U7SA 4ZQOA 4JN6A 1Q45A 3CQ0A 2FPVA 4NU7A 3I6RA 3PUOA 3BPWA 4EF9A 1TTQA 1KM6A 4DO4A 2R14A 4NQ1A 1JRCA 1OX4A 4O1CA 3P82A 3TROA 5CKSA 4GUFA 2B0MA 3T40A 4JTLA 2HS8A 3L5AA 4YWIA 1ADOA 3HGJA 4RLIA 2PCQA 3NPUA 3NQVA 4IUOA 2V5LA 4UTKA 4K36A 5F4WA 1LOQA 1AK5A 3LXBA 1W3TA 1P4CA 5IM51 3G1SA 3TR2A 3LERA 4HNVA 4IMDA 3C61A 3P81A 1SO3A 1YDNA 4LUIA 1V7YA 1YDVA 3RK8A 1IXNA 4Z1BA 4N9EA 2I14A 4BWLC 3G1VA 2AGKA 4DF2A 1XUUA 1RQEA 1PV8A 2PRLA 1WXJA 1JCXA 3OIXA 3IGUA 3BG9A 3HG5A 1A53A 3TQ0A 3HMJG 1Z42A 4M5PA 4ALDA 1WAUA 2H90A 4CNOA 3ATZA 3NPWA 4FF7A 1R2RA 2YCEA 4HSNA 1SQ7A 1NF0A 3QQ0A 1QDSA 3M5VA 1PE1A 4N6EA 1GVQA 3KVLA 1O60A 3F4WA 3OG3A 1LDCA 1MEIA 1YXDA 2OMAA 5G1TA 1FCBA 3W1UA 4AEOA 3JRKA 5LHEA 1DVJA 3PS7A 5TIMA 1I45A 3IV3A 2QCCA 2E6AA 1JUKA 4R34A 2ABAA 1I4NA 3S5YA 5BMXA 1SZGA 1FX6A 1LOSA 2ZZ2A 3OVQA 3P5YA 1J4EA 3W07A 4DPPA 2ZBTA 4M19A 1M7PA 1FDJA 2QAPA 2ISSA 4X9SA 3LTSA 1K7FA 1N7KA 4AWUA 1HO4A 2DP3A 4NNBA 5DBTA 1FY6A 3W71A 3HB9A 3TA6A 4O18A 4ADUA 2TMDA 1YYAA 1GTHA 2X16A 2GQ9A 4AB4A 4CQAA 3A5FA 2QCFA 1EX5A 1KA9F 3E96A 1WDWA 3LCFA 4LVFA 2QAFA 3INPA 1H7XA 5D38A 3EB2A 3O6YX 2R91A 1TPWA 3SGZA 1TPDA 3T55A 2FPTA 4Z1CA 1W5MA 1VR6A 2G5WA 4Z0SA 1DBTA 1G4PA 2NUWA 3LCHA 2GVLA 5L6UA 1YLVA 1ONRA 2RH9A 3O16A 3LBCA 4OBTA 5HUPA 5C5YA 2FLIA 4O12A 5D2XA 1BKSA 5G1YA 3W84A 3G8EA 4H3DA 5CSRA 2Z0IA 3KVJA 4LC8A 1H7NA 2YFOA 1SO6A 3LI0A 3MI3A 3LCWA 4GE8A 5LSMA 1AL8A 3I7QA 1WYIA 1HL2A 1M7OA 4UFIA 3M7WA 1GVFA 3LCGA 1SPQA 3NQ7A 3Q58A 2NXIA 3IGXA 1SW3A 1DQWA 2ZA2A 3UWYA 4O50A 2RDUA 4I7UA 2CZFA 4BR1A 3WK0A 5LNWA 5G4EA 2CLMA 4S1FA 4N6FA 1OHLA 3E12A 3NYZA 3JR2A 3W1AA 3IVUA 3NR0A 4GUHA 3C2FA 2A7PA 1WV2A 4AHOA 3NQ6A 2JGQA 4CCDA 4M7TA 2V2HA 1L6WA 4A29A 1VC4A 2WQPA 4ZQCA 5LNUA 3P5ZA 1KM0A 2ZZ7A 3CLMA 3W3OA 3NVTA 1G4TA 1JUBA 3L68A 3O15A 5I3IA 2DU2A 3UWUA 4GWEA 1H61A 2V30A 3BO9A 2ZYFA 5D30A 2G96A 3O06A 4RZ5A 4HKPA 2A85A 3TNOA 1OYBA 3UQNA 3DH7A 1WQ5A 4MYAA 2CLHA 4CQ8A 4IPIA 2Y89A 3SW6A 3ABRA 4PH6A 2F84A 4QNEA 4MY8A 2FTPA 2OT1A 1ZAJA 4DQWA 3IIPA 4GFSA 3TAOA 3U8GA 1JULA 3WJYA 3DAQA 1EP2A 2X1RA 3A9IA 4MIMA 2FPYA 3C2OA 4GNJA 4DEFA 1A5CA 3RLUA 3NQ2A 2AAMA 3UWQA 3HF3A 3I7RA 3TSMA 1YPFA 4FX8A 1VRDA 4NJGA 5SWUA 3MW7A 1KM4A 4BFAA 3STGA 3W1QA 5LGZA 4UC5A 1HG3A 1F76A 1GJPA 1LBLA 3NAVA 3IIVA 5HWJA 1L9WA 5KITA 3DKLA 3R8RA 1FWTA 4UTWA 3T4CA 2QJIA 2OJPA 1KFJA 1DKWA 5CG7A 4O57A 3UXAA 2O7SA 4JGDA 1NFBA 1EEPA 1XBXA 3O6DA 3IVSA 4Z1DA 1QWGA 4GC4A 4X2RA 3SZ8A 3M6YA 4O1AA 2FQIA 1XKYA 1VLIA 3W2NA 5CGQA 3MP4A 1OYCA 5BNKA 1SZEA 5DXXA 4K8EA 4TMCA 4JY8A 5DCDA 3GVGA 2G95A 1P0KA 3DBPA 1I2PA 3W7JA 3PB0A 3NA8A 3BGJA 4BI6A 2CLFA 3KRUA 4FNPA 1JCNA 3P80A 1JUEA 3TUUA 3GKFA 3G3DA 2VFIA 3KRSA 3VKJA 1W31A 3W7MA 3W87A 3NM1A 1ZNNA 2GJNA 4FXSA 4O4VA 3BLFA 2C19A 3RU6A 3PB2A 3PSVA 2H6RA 4LVBA 4FX7A 1SFLA 3NL2A 2Q3RA 1GEQA 4DF0A 3NQMA 4M7SA 2R8WA 3CU2A 4ZQRA 4JTEA 3GXPA 2V81A 3TK7A 2CU0A 4IMGA 4QISA 3G0XA 4IX0A 3IIXA 1RVGA 3MHGA 4QNWA 3A5VA 3PAJA 3S8HA 4OHQA 2CFFA 3BVJA 3W7IA 4UFJA 1BWLA 1W3IA 2ZZ3A 3H55A 1PHQA 1VCVA 3HGOA 4JTIA 1W8SA 4Z08A 1TTIA 3P62A 4IOTA 2RFGA 3ELFA 3IGSA 4LVDA 3V1PA 2H8ZA 1GYNA 3HGSA 2WSQA 4P2VA 1PCKA 2NUYA 3TC7A 1G4EA 1OF8A 1X8FA 5CZSA 3W6YA 5CPNA 5K4XA 2E5DA 2IQTA 1LTDA 1VPXA 2DZWA 3S5OA 1QPQA 5AHEA 4XQ6A 2VEPA 1ZAIA 3QQ1A 1DHPA 2ZZ5A 3E49A 2A6NA 3PBVA 3DFTA 2WSRA 3B03A 4I7VA 2BX7A 5EMUA 1RR2A 3KVKA 3NQGA 1ZJIA 3NGJA 2E6FA 3QSTA 4IXXA 4L4LA 3UYCA 1P1XA 4NX0A 2ZRVA 4K7VA 2QJHA 3NDOA 1BWKA 3WK2A 1O95A 4X22A 1IGSA 4UFLA 1PS9A 4GBUA 3QMRA 3WK3A 4CQ9A 3W2KA 2B7QA 1IXPA 5E0KA 1EUNA 3QH2A 4QM1A 3THQA 3C0JA 1UB3A 2ZRUA 3B0PA 1H60A 4AH7A 4EIVA 1SW7A 2Y88A 1GVRA 4LWWA 1K7EA 5FEWA 1SFJA 5DY3A 4NUWA 3MJYA 4HPJA 4IQLA
chains in the Genus database with same CATH superfamily
1M68A 3N3MA 2ZX8A 2UY2A 4PUMA 1BQGA 4EXBA 5DT7A 2P76A 1O5XA 1V3HA 4A05A 1SZRA 1QR7A 3LRLA 3D0CA 2VR2A 4E6MA 3BV7A 2CWNA 4MJMA 5I5RA 4AZCB 3R0KA 1MO0A 5C9WA 2PDYA 2EPHA 3TTOA 1A47A 1Q7QA 5ECVA 3MY9A 1LCOA 2FFCA 4IF2A 4LT9A 4D6HA 1AODA 2YDSA 1KM1A 3GR7A 4OJYA 3PN8A 7CGTA 1XGDA 3VOCA 4HZ7A 1DEDA 1QPKA 3S5ZA 3URQA 3U4AA 3DFYA 3HBLA 2JKAA 4PUWA 2X0SA 3BLPX 2OEJA 3TAKA 2YR1A 3GX9A 4JR5A 1UUMA 1GNXA 1OX6A 1ZALA 4DIAA 3ZQ9A 4PB4A 1E56A 3T42A 1I2RA 3GXIA 1E6PA 3QHNA 4BQ5A 4LVAA 2IMRA 2GPTA 1AG1O 3ARSA 4J3SA 1LF1A 4Y9AA 4GZIA 5DCEA 2VR5A 2CCRA 5LIUX 1VBRA 1XLDA 1G7UA 3WDIA 1TJ1A 3PPFA 4AXNA 4MWAC 1G6CA 4EXAA 3W1RA 2WMKA 2C6QA 2DORA 4JKLA 4LS0A 2GGEA 3W88A 3THCA 1IEXA 1NOUA 1QI4A 4X2PA 5CBBA 2GJXB 4UZUA 3LM3A 2X1IA 3HFTA 3GY1A 1CTNA 1F6KA 4D9PA 3E0WA 2IPFA 3ZYZA 3LQLA 4LRTA 3FLUA 2QDGA 1ALDA 4NJHA 3CL6A 2GVYA 3WLSA 2V2CA 1UUQA 1Y5XA 2BLEA 3W27A 1LLZA 4UXDA 3BAWA 1NARA 2DUAA 4Q6JA 3M0XA 3JZEA 3LV5A 2ODOA 3EMCA 2F6UA 3R89A 4KGJA 3GD6A 1I8JA 4EWND 4WSKA 2BTMA 2Z25A 4O10A 3BLKA 1RBAA 2O55A 5D9OA 3BLEA 3QF0A 1EF2A 5K3VA 3U0HA 1TWZA 2JIWA 3S2CA 3UZWA 1S5WA 4AHPA 3RNDA 5K7JA 1KR0A 2GVEA 5CXPA 1Z44A 2WMFA 2XGBA 2TPSA 3KBJA 3BLOA 1REQB 1YTDA 1TPC1 4DYJA 4Z2IA 1AD4A 1FKXA 1X1OA 3SBFA 1W1ZA 4LGXA 1TYGA 4XX6A 2A7NA 4UTIA 4AIUA 4FX6M 1HFBA 1K3UA 2D23A 3MKVA 5LHFA 3N9RA 3TJIA 2H3DA 3FSTA 5I3JA 3DZ1A 5A2AA 5KSWA 4ZO7A 4Q8MA 1KBBA 3AHTA 3OOQA 4MFEA 4IFKA 2W0UA 2EJ1A 1DWGM 2FB3A 3LS9A 2HV5A 4C6PA 4CNUA 1GUVA 1OFRA 1P48A 3L2MA 4W4QA 4EAYA 4N2YA 3T6CA 4O16A 1S3HA 3SUSA 4R7OA 1J0YA 4ACYA 3NPVA 1TRDA 1LLOA 1OSEA 2XIOA 2EKCA 3WLPA 3PWIA 3VZXA 4P7LA 4E4PA 3TFXA 1QHOA 4L6OA 2XHYA 5IRPA 2E5CA 2ZXBA 3MUZ1 1UH3A 3SUTA 1UWIA 3IARA 4O13A 3WNMA 1KFWA 1V6VA 4LV9A 2BZNA 4EPBC 2XU2A 1E5NA 1PTAA 3KCLA 1IIHA 1T99A 2XM2A 1XIMA 3C5QA 3CPRA 3REQA 1LQ0A 4CU8A 4D8ZA 1JG9A 4L6HA 1BF2A 4ICMA 4UTFA 1EBGA 3TIMA 1AW5A 3FYOA 1ONXA 2DT2A 2HNEA 1ISWA 2EG7A 4WY0F 2BY0A 4PYSA 4Q8WA 6XIAA 2B7NA 4Y96A 4HZ6A 4D8LA 4O0QA 4B5TA 2O7QA 1MW3A 4NG3A 2UWFA 3O1NA 4XISA 3NYDA 4Q4SA 4Z2JA 3N9SA 1UHVA 3H2FA 3QW3A 2DW6A 3PG9A 4XD4A 1Q6QA 4E2OA 2QNEA 3CHEA 1BF6A 3L4UA 4IP4A 3VD4A 4KBXA 3GVWA 3BGGA 4LX4A 4E2VA 1X7FA 1SO5A 2DZSA 3NZPA 5U4NA 3P67A 3M43A 2I9EA 2FGLA 2TYSA 3S47A 2BOEX 1H50A 3TW6A 1REQA 5BW6A 2XFFA 1SO4A 4KWWA 1EZ2A 7ENLA 3QMTA 3U2CA 2ZZ6A 4EXQA 4K37A 2JF6A 2E7FA 1OF6A 2VJXA 1E55A 2V0TA 4OZOA 4ZFCA 3WFLA 4H00A 1GOWA 5EB8A 1TKKA 4QIUA 5GJPA 3B8WA 4XTIA 1UPPA 3GU9A 1J5SA 4AX7A 1R9XA 4MKVA 3GZ3A 3A3XA 3DXIA 2NSXA 3F5JA 3T07A 2VVSA 2VMFA 3QN3A 3B0XA 4A3UA 4TX8A 1F05A 2DPEA 1TIMA 2CNCA 3O0FA 1FDYA 1T7LA 2BGQA 4UR8A 3T44A 3BOLA 4PCNA 4ZVJA 3CTLA 4XUYA 3D3FA 4DX3A 2WK2A 3DCPA 1Z48A 1R3YA 2WC3A 3UR5A 2VFFA 4DI8A 4O52A 3KOYA 5LKYA 2E9LA 2NQ9A 4F66A 2W67A 1YRRA 3I7SA 3BZGA 2P10A 4B2DA 3W7RA 1I1WA 5D9NA 3GSMA 1OFEA 2JEPA 1AQFA 4YVXA 3TYEA 3UERA 3N2OA 5BCAA 1XIIA 3VXGA 5DY2A 1PVNA 4QS6A 5FAGA 3DFQA 3VFLA 5C9ZA 1EX1A 1P7TB 1YQ2A 1AZ1A 1FWWA 3HO8A 2XN1A 2E77A 4AQLA 3G6LA 1K8CA 1H11A 1XYAA 1OK6A 2A6LA 2DZAA 4ERGA 3ALFA 1FH7A 5CBIA 1Q7MA 3A13A 3UD6A 3RAOA 1N8IA 1AJ0A 3PANA 3IVTA 3AIRA 4D6EA 2VX5A 2E6DA 1IE7C 1WKYA 2RDWA 1SM9A 1D3CA 4HPXA 1LT7A 1C9DA 4XO6A 4C7FA 1CYGA 2PWHA 4R9XA 3SI9A 1ME8A 7REQB 4PB5A 1UA3A 4H9YA 3UY7A 3W7NA 3S46A 2CKRA 4YYCA 1QMLA 3SDOA 4HK6A 4LAZA 5CC7A 2OZTA 3STCA 3WF2A 3AICA 3MVTA 1Y7VA 4OIFA 1GWJA 3A3HA 3ZVIA 4X0VA 1DIOA 1I60A 4MPKA 2Z4GA 2PWVA 4JQ4A 5I03A 3O3RA 3A24A 2BGSA 2ADAA 1TCDA 3FJNA 1XLEA 3UXDA 2ZADA 4DJFA 4ACZB 1S5MA 5BXSA 4H7CA 2XIIA 1HO1A 3GIYA 1M03A 4P7RA 4F4RA 2J74A 5HR6A 4BJHA 2WJZA 3DDMA 3W7CA 5I09A 4ZSUA 3U2EA 4MWAE 1V0MA 3TTQA 3BSMA 1TPUA 1K6WA 1RBLA 2GDUA 3HZ3A 1CECA 3T0BA 3K4DA 3CPUA 2VI0A 1UKPA 3IEBA 3A64A 3H23A 3VGBA 5DMMA 3W73A 3FHAA 5TBOA 3G1HA 4IXHA 4ZR8A 2JQXA 1OCQA 3S2JA 3TYAA 1ZCCA 3C3NA 3H2NA 3W37A 3MVIA 3NOEA 3MP5A 1XIDA 1IF2A 2A1YA 2XWDA 1S2CA 4DUOA 1GPFA 1B31A 3CV2A 1MMFA 3IAQA 4ZE5A 3EEGA 3WD1A 1MSSA 4JQ1A 1S1PA 5AZ0A 2AKZA 4E4FA 4US5D 4HHMA 5K9DA 3QLLA 4JS3A 1M5WA 1Z8AA 4YCPA 3GHSA 5I23A 3H8AA 4QITA 3CV1A 5KINA 1F3TA 3E0VA 1T8XA 3S83A 3ARWA 3STFA 1JQXA 4M80A 4AD0A 4H8VA 4RE2A 2GLKA 3IUDA 3NZQA 3H26A 4MZ1A 5D03A 1CGXA 1RPXA 4W85A 1TWSA 1ZHAA 4WK9A 4BWLA 1U33A 3FGCB 2QGHA 4LOCA 4RXGA 1E73M 4XD3A 1ZBWA 1B3YA 3TJXA 4GUGA 1ODZA 4HOZA 1FXQA 3LHZA 2IKGA 1VH7A 1XC6A 1KBIA 8TIMA 3QPYA 1UKOA 3LGEA 4DYEA 2C71A 2ZC1A 5A6TC 3ZWSA 2YZRA 1FQ0A 1R47A 6TIMA 1DJHA 3KS5A 3LTYA 4HMDA 4N9DA 1F3WA 1VRXA 3HQ1A 3THUA 1UBSA 3CZGA 3WQ4A 4PUEA 5I3KA 1F8IA 4AHQA 3U5YA 3L5LA 1IWBA 4O19A 1BVWA 3OQ8A 4R88A 2FIQA 1H7RA 2J7GA 1US2A 3GLCA 1E0UA 2P53A 5AHMA 2X41A 3T0CA 4E8GA 1HXJA 4JFSA 2OQLA 1GOMA 4MY9A 2VVNA 4PC8A 1TA3A 5J5DA 2VGBA 3OBKA 4RDWA 3WENA 4MWAA 5BOOA 4D2JA 3RLHA 1T41A 3A23A 4PMNA 2OZ0A 2YJQA 3KDNA 5KTLA 4QROA 1JZ6A 4GYPC 1WCGA 4OECA 5IOBA 4IHCA 1Z3NA 3TFCA 3H24A 2Y24A 3BSHA 4F0MA 3C0SA 4FAMA 2VXNA 5CZ0A 4GD0A 1BSIA 3O9NA 3AHXA 3LSBA 1PCWA 3KFTA 4JAWA 4UFKA 4MB3A 4GQBA 1QXLA 4U2YA 2HJPA 2PDQA 2DIJA 4N9BA 3DBNA 3W74A 4P8XA 1MW2A 2XZ7A 1R46A 3AHVA 1KFKA 2V6AA 4WZHA 3GTIA 3CHCA 3POHA 2VUNA 1W3KA 1GW1A 1QAPA 1JCJA 4LCSA 4XAFA 3TE9A 1W9UA 3UESA 1XFBA 2ZTJA 1OX4B 2BHZA 1VEMA 3M6DA 4C6EA 3AYVA 3KRZA 1H1NA 3QPZA 3EDKA 1IT7A 4HA3A 4NXKA 1RJRA 1LM1A 2C0AA 5E9AA 3CASA 1D2KA 1OY0A 1W0MA 3DFHA 1V7AA 2VR4A 1MUWA 3UF9A 1GZGA 3K13A 3AQUA 5D9PA 4IIDA 3VDGA 3EZ4A 1WDPA 1OGBA 3KP0A 3DHDA 1V8EA 3FA3A 4HHHA 3LY0A 3SCVA 4BY3A 1L6SA 4OUIA 3SUWA 4C1NB 3GS6A 4YS1A 4ZSTA 1XM3A 4UTTC 1RP8A 3G8RA 2WCAA 4TR9A 5M03A 3AIBA 5I3GA 1F6PA 4NNCA 2PODA 4ML9A 3R25A 1C9WA 2D3NA 2VFDA 1P7TA 2BODX 4AF0A 4XZ9A 4NILA 2QCLA 4V28A 2F7FA 3TH6A 4PCPA 2RJGA 4AMCA 1XYCA 2OKOA 1UOKA 4OBRA 3PNUA 1H5YA 4O1EA 1J2WA 2B7PA 4A2SA 3L0GA 3EOEA 2PTWA 2POZA 2O9OA 3AU2A 3SN4A 5DRCA 2GQ8A 3DC0A 3VIPA 4GUJA 3GE7A 4K2SA 5A8MA 3WH9A 4X63A 2PU0A 2D0FA 2IS7A 3WNPA 3VOFA 1EP1A 1SR9A 3K8MA 1W32A 3W72A 1H63A 1QU4A 1Q8JA 1B54A 3MDUA 1CEOA 2ZUSA 4D1JA 2QHAA 4AZIA 3IJ8A 3DENA 4AIEA 1LG1A 3DFSA 3AS3A 5LNVA 4A3QA 4IGHA 2PLKA 3MI2A 3NZ1A 1SJDA 5CPMA 4ZL1A 3UP8A 4O1BA 1R0MA 4MVAA 2DZTA 2J66A 1XIEA 4L9YA 3G1XA 4KEVA 3FA5A 1B9BA 3HIJA 3E5PA 1GVYA 3BJFA 1RY0A 2PWFA 3B0UX 4ZEPA 1W2VA 2GJRA 2Z6JA 2YYTA 4LS1A 2WC4A 3WMCA 4UQ9A 5KZMA 4GJJA 3GDRA 5GNYA 5HQLA 4N4PA 5T91A 1VQTA 3GTFA 3N6QA 1SVDA 4GUIA 2DVUA 4XKYB 3GYCA 4IQJA 1EC7A 4UQCA 1JGMA 4HK5A 3HV8A 3N3TA 2ZA3A 1E9IA 3PJUA 1CB7B 3OVPA 1V6YA 3G3MA 2FZ8A 5F2GA 3LCIA 5AHIA 4L4OA 3L5MA 1TA3B 1FCUA 1UASA 5ABHA 5F4SA 4MKNA 2E1DA 1LWHA 4H04A 2PD9A 2E6YA 4D6JA 2ZOXA 1HTIA 5CGTA 1HUVA 4Y8FA 3RLVA 3U4FA 5GNZA 3ES7A 4PBGA 4DNHA 3QYSA 2HK0A 1L6FA 4QG6A 5DO8A 1CW2A 1S5NA 1H2JA 5AC8A 1RCOB 8A3HA 3GFXA 2OLSA 1Q6RA 1R8LA 1HJVA 3MHUA 1VCFA 3GU1A 1G01A 5FACA 4PL2A 4GBDA 3M1ZA 3ISIX 3TYZA 2Y63A 2NQHA 4RZ6A 3ARRA 1M65A 1YNYA 1EWDA 4ATLA 4PCSA 1T6MA 1XDMA 4HTYA 3NQDA 5C8BB 4BI5A 4NL1A 2IXVA 1C8VA 3LMYA 4Y6GA 4YXGA 1W17A 3WBXA 1RQBA 4G6CA 2ZX7A 1OB0A 2KZHA 1NWRA 3VIFA 1P6BA 2YZ5A 2DZUA 2GVGA 2Y7EA 4RX0A 3UU0A 1DQXA 5BMWA 3W4RA 4D6FA 2QUVA 2PSNA 2OOFA 4REQB 1VS1A 3VO0A 2PRMA 2QMJA 1EIBA 3M9YA 3MZ2A 3PSWA 1UQZA 1GQJA 1QO5A 1ZBCA 3AIEA 2Y7GA 4YCOA 4I9MA 3TWAA 3VI2A 1MDLA 3B8IA 1QFEA 4HNCA 3BJTA 4JTJA 1XGZA 1O5QA 1BPLB 4IWWA 1ZJAA 1O5KA 4U31A 4DI9A 2EF9A 3PZ9A 2R1KA 2BHUA 4AYGA 4PBFA 3CZLA 2TSYA 3TU9A 4JY9A 1J10A 2E40A 3R2GA 4W7UA 2QIIA 3FK4A 2BOFX 3SY8A 2PGEA 1G5AA 3MI6A 3NOYA 3FA4A 3EPOA 2A3AA 4R3UA 2YW3A 1TG7A 4LJ3A 1M9HA 3WLHA 1TJPA 4I5RA 4JDYA 1WDDA 4UNIA 1EOMA 3URAA 3GWQA 2QZRA 4B91A 4A8RA 2WVSA 3H54A 4MZ8A 3TC6A 1PKLA 3MHFA 3KX6A 2QS8A 3FS2A 3I65A 3AIQA 1WO2A 3FSUA 3DKJA 4ZQMA 3AO0A 2FVLA 3ALGA 1RLDA 1WBHA 4H19A 4W9TA 3SQSA 4RNJA 1D3GA 1XDJA 3C56A 4MLJA 1W9BM 1OFOA 1EWEA 4B9YA 4HSOA 1JCMP 4NZ3A 2HS6A 1FWAC 1KLYA 2YPIA 3QZEA 2GUUA 3ZT5A 3B97A 2NUXA 3I4KA 1XF0A 4AC7C 2IKHA 3VINA 4JIIX 5HA7A 3FAWA 1M1BA 5DF0A 5GJNA 3PPHA 2F2HA 4ZO8A 1CXFA 2ZVRA 4IMAA 1Q45A 5BRPA 1E1EA 4QX4A 2XH2A 4JFTA 3PUOA 3S6TA 1P6CA 4XZIA 5J04A 2R14A 3VC5A 1OX4A 3P82A 5CKSA 3FYYA 4GUFA 3T40A 3ZR5A 1KRMA 4JTLA 2PDBA 4YWIA 2WMIB 5J8LA 3RMEA 4K36A 3UCQA 1LOQA 3LXBA 1WXZA 2QGYA 4AZ7A 3OGRA 4QLLA 4Q8QA 4HNVA 1XSKA 2VO5A 1GORA 3ITLA 1SO3A 3WQ6A 1YDNA 1OCBA 3RK8A 1IXNA 1GONA 1QRQA 2AGKA 3A9BA 4DF2A 2YBUA 3SN1A 3GQYA 4ES4A 3BG9A 1NFPA 2ZICA 5I7GA 3VPLA 4ALDA 2H90A 2FMOA 4FF7A 3ITOA 1R2RA 1RP9A 1QNSA 2WVVA 1XWYA 3KVLA 2BBFA 3F4WA 3OG3A 4GQGA 1YXDA 4HYVA 2OMAA 2VD9A 3W1UA 4K1GA 3PS7A 3IGHX 1I45A 1DIKA 3WH7A 2EBNA 3NDYA 2WMIA 1XLIA 1XJBA 3LZ5A 1ZB5A 3WZ0E 1PAMA 2HVNA 4JNZA 1LOSA 2ZZ2A 4OOUA 3K4AA 3OVQA 2QV5A 3P5YA 4PR4A 3WQGA 2HROA 2CETA 2ZBTA 1FDJA 7A3HA 4AZBA 3LGGA 4X9SA 1HP5A 1ADDA 3WLJA 3RUBL 1HO4A 2PDXA 3OHMB 4OTKA 1K9DA 4NNBA 1FY6A 3TA6A 1Q6DA 4ADUA 1J79A 3WQPA 2GQ9A 4AB4A 1EL3A 3CIVA 2QCFA 3I3BA 3E38A 1AQHA 3UCCA 3LCFA 3EWCA 3ICJA 3K46A 2R91A 1XYMA 4P7OA 4Q3MA 2FPTA 1G4PA 5ABFB 4NIRA 4TXEA 3VKKA 1YLVA 4XK2A 2EEXA 5D2XA 2VDGA 3UG3A 5G1YA 3W84A 1UH2A 2YA0A 4GZEA 3TTYA 1VFHA 2P0IA 4BF7A 3WBEA 3N2TA 1E0WA 2YFOA 1HKJA 4KWSA 2VRQA 2WJEA 1XRVA 1AL8A 3MV11 2XJ7A 3HURA 1MZRA 1GVFA 3ES8A 3Q58A 2NXIA 1SW3A 1BD0A 5RUBA 4O50A 3RR1A 3CQIA 2CZFA 3M64A 4LUTA 3P0XA 1KGXA 3CZJA 4N6FA 3E12A 3F7JA 3UNTA 1WV2A 5HQMA 2BVTA 2E8YA 2V2HA 4ZQCA 3E74A 2ZZ7A 1GK8A 2WNWA 1G4TA 3UGRA 3O15A 4DUXA 2DU2A 3W81A 1UR9A 3TZFA 5D30A 4LAOA 4D6GA 4IL0A 4HP5A 1U22A 3WEOA 3UQNA 4MYAA 2CLHA 4IPIA 2Y89A 4TVDA 2ZXQA 3OO2A 1N2VA 2HBVA 4KGLA 2F38A 1ZAJA 3VKDA 5A95A 2X1RA 3WLTA 4MIMA 1OQFA 4GNJA 1A5CA 3RLUA 3NQ2A 3BJSA 1V3KA 3UWQA 3I7RA 3TSMA 3KM8A 1Q65A 2D1ZA 1CGVA 4FX8A 5SWUA 3VTRA 4XZMX 1HG3A 1F76A 5DQPA 2J4GA 3RLGA 3R8RA 2INZA 4UTWA 4QFUA 4IPLA 1KFJA 3VM7A 2OU4A 4O57A 4QE4A 3NQBA 4X2RA 5A8NA 3SZ8A 1GHRA 1HL8A 3F4VA 4O1AA 2FQIA 3V5OA 2POTA 5FL1A 1Q5MA 2YCIX 2ACQA 3TOYA 2HE8A 5DCDA 1YEYA 3GVGA 4LAMA 3RGTA 1P0KA 3RRXA 2BVWA 1I2PA 3W7JA 1DE5A 1W9PA 3PB0A 3NA8A 4BI6A 1ZGDA 2CLFA 4XAPA 4RW5A 5A3HA 3NCOA 3RYSA 1OD0A 4J3TA 1JUEA 3EDFA 1DE6A 3AZRA 4F0LA 3KRSA 1GJWA 4FOKA 3H70A 4TUFA 4O4VA 2H6RA 3WELA 3TJ4A 1Q7ZA 1EDTA 4Z2GA 1FFRA 1XSIA 4TX6A 4GYJA 3NWRA 2V81A 4DY1A 5E6YA 4C7DA 1QW9A 4IMGA 1R5YA 2ZVIA 3K5XA 3MHGA 4QNWA 4B3LA 3CUXA 4D8AA 1BWLA 3GW3A 2VEFA 1VCVA 2BMBA 3AWNA 1W8SA 4Z08A 1RY8A 2PWUA 3ELFA 4WRHA 4UB9A 3V1PA 1PPIA 2XDFA 1UMLA 2G3MA 4X9YA 1GYNA 5DMYA 4P2VA 4L61A 1E3ZA 1PYMA 2J25A 1JD7A 4NI3A 7PTDA 2E3ZA 4AU0A 5A6SA 3A6OA 2E5DA 5AHEA 4IQEA 1ZAIA 4CGTA 2CXGA 3WMLA 3WCZA 4WKFA 1VFLA 1WKEA 3NIYA 3CB3A 3BE7A 4JCMA 1MRAA 3MCOA 2OO6A 1BWKA 1WNOA 4H6QA 4X22A 2L5HA 3DYMA 4KT2A 2W4XA 3W2KA 1V0NA 2B7QA 1M53A 4JHZA 5TD4A 2ZXAA 3BAYA 1C91A 3NTYA 2ZRUA 1H60A 1R3WA 5FEWA 1Y8BA 5DY3A 1B3ZA 3H2CA 4NUWA 4FLRA 2QCMA 1WZAA 4D71A 2I9UA 2DJLA 1VENA 2Z1VA 2CLKA 2X0YA 4JFVA 4W88A 1TR9A 1RALA 4US6A 3WL1A 1GVSA 2X1UA 1NOWA 3CUJA 1TX0A 3WD3A 4RXFA 1CGYA 2G0WA 2P1FA 3B04A 3DU0A 4HQVA 3R8GA 3B9NA 1XBYA 4PN2A 4AVNA 4J2MA 4DXVA 3TYUA 5FF4A 2PWEA 4S3AA 5FJRA 3UXIA 3WMSA 3WQDA 1KM3A 3ABZA 4ECLA 4HCLA 1TO3A 4FF5A 1X1ZA 4OKDA 3R13A 1E6QM 2XVKA 3ABQA 1KNWA 3IRSA 3ANVA 4J9JA 3SN0A 1V51A 5C55A 4ICNA 3LRKA 3SO7A 4EF8A 4D6DA 2PF8A 2X1TA 2D2HA 3B40A 2CERA 4JN7A 2NXHA 3KAOA 3Q2DA 2W5FA 4XBKA 1FFQA 1MQPA 1HNYA 2DZPA 1TQJA 4G9PA 2G3FA 1P0NA 2UV8G 3F4NA 1JCLA 1V0LA 2X42A 4XKYA 4IJCA 3V1HA 4I6VA 2VRKA 3AYSA 3MP3A 4UQEA 2PP0A 3AXMA 1XBVA 4XD6A 4IZGA 1UUOA 1EGZA 3F2CA 1WPCA 3VU2A 3WG6A 1NEYA 1E0XA 1IV8A 5J5RA 1E6SM 1UR8A 3A47A 3BZJA 2ISVA 4YHGA 3A3WA 1NTHA 3ENLA 1QW8A 5C71A 1UKTA 4K1WA 3VKCA 1H1YA 1IEQA 5I6SA 4WDUA 1B57A 1E9YB 2QJMA 4FNQA 4XSLA 4I6KA 4DBUA 1IWAA 4JIQA 2E0PA 4Y8EA 3VD7A 2HNHA 2VELA 2QJNA 3FGCA 3H21A 2RKXA 5HULA 4LVGA 1V3LA 4UMCA 4GIRA 4KF1A 4ACZA 3QJAA 2D2OA 2H8XA 3MKKA 4JN8A 4J2PA 5DMLA 2ZWYA 4QJ4B 1VBHA 1RQHA 1Q6OA 5CZKA 1J2BA 2FVKA 4W5UA 5T9BG 4E2DA 2PTDA 1VFMA 1GTEA 3A4XA 5BYWA 3QY6A 2GUBA 1UYQA 1LP6A 2DQXA 4AMAA 5EBUA 1PIIA 4QXIA 1A5UA 4AY1A 4LCRA 3ZLHA 1H51A 1E4MM 1K1DA 4AISA 4UIOA 4MF4A 4DLMA 4DWDA 2VM8A 4PMRA 2REQB 1K9EA 4FI4A 4GYFA 4L64A 5HMDA 3CLWA 1KQYA 2RJHA 3G24A 3RPTA 2CBVA 3OEXA 3W1LA 3PUDA 1CGTA 1GPWA 3CUZA 5PTDA 4HNTA 2ZUTA 3S2NA 3UNDA 3TNBA 1EJ7L 1KWGA 5D8ZA 1YMYA 5E93A 3AI0A 3CK5A 5HMSA 4JTTA 2WV8A 1E1CA 2I5IA 3VNDA 3R7MA 4KFOA 1A4LA 5E1QA 4W86A 5M5DA 1OGGA 1QWKA 2R94A 2PFHA 2Y5EA 3ID7A 3WQ5A 2B81A 3WNOA 1VJIA 2C91A 3QGVA 4QLKA 1DTUA 3H4XA 3OZPA 1IEVA 2PC4A 1ELSA 3CUHA 3FJ6A 2B4GA 3LYEA 4LNCA 4OV9A 4XAGA 4HYRA 1V02E 1SU5A 2FHBA 3GFYA 3GIPA 3NEVA 1JIBA 5XIMA 3VVGA 2J24A 4GX9A 1AFSA 3CL7A 4I8DA 5CJNA 1Q6LA 3EOSA 3WEZA 1L0PA 3T2QA 1JR1A 2XSXA 2OGJA 2EO7A 3KS6A 4H9VA 5C2GA 3QC0A 3GBEA 2HMCA 5F4XA 4JHOA 1OIFA 5EPDA 2C8NA 1BXBA 1GVOA 3PPGA 3GXTA 4K7YA 4FNRA 4A6GA 2EJAA 3TXVA 1PX4A 3P3BA 2ZE3A 2QVNA 2V63A 4IG2B 3VGGA 4CNNA 1U83A 2ISWA 1EXBA 4MY1A 2D3LA 4WDTA 1OVDA 4LXFA 4O8AA 2J7HA 1HKMA 3I6EA 4HSHA 3BG5A 1RXOB 2V9DA 4R9OA 3V0SA 5DX7A 1MFVA 1OJXA 2Y7DA 3TW9A 4L5ZA 4N4QA 3W0KA 5D04C 3MMTA 1K02A 1W3NA 4JBRA 1NDYA 3W24A 2YDAA 4DBDA 2CHNA 1XL9A 1U1JA 2VHLA 3KCOA 1HJXA 4PEEA 4FXJA 3OZOA 5CSYA 2JKPA 1BXNA 1AQMA 3UJ2A 2AMGA 2E4TA 4ZQNA 4W84A 2ACUA 2OWCA 3TYCA 4IP5A 2V2DA 1X8CA 2P50A 3B8VA 4KCTA 2OX1A 5CJMA 1MXDA 3Q94A 2XH7A 3B06A 4RK8A 4YU1A 2P8BA 1DJYA 2NT1A 4O53A 3BW3A 3LPPA 3A4JA 3E2QA 2D22A 2QUTA 3W75A 2DFAA 1TVPA 2IPWA 1XC4A 3DG3A 1XD0A 4RE0A 3AUOA 3W76A 5FF3A 2REQA 4JTHA 1ITQA 4LYRA 3CZ8A 3RX3A 4E4UA 3EPNA 4LBRA 1VGAA 4QQ3A 1TSIA 5CPQA 3NSXA 4PA8A 1OINA 3SCUA 3VKAA 5JU6A 2WHKA 3WUBA 2YDRA 3DESA 4JXCA 4O1FA 2NSOA 3BW4A 1N55A 2YDQA 4YLWA 1FVPA 2E5BA 4C90A 1W37A 4EKJA 2WHJA 3IANA 3LPFA 3PFRA 1LRNA 4FLQA 4PMYA 6ENLA 2YL6A 1GHSA 2G3JA 4XTDA 4DM2A 3K1DA 1QNVA 3LA4A 3KUMA 4MPQA 2AGTA 4N42A 4JTCA 1KRBC 3IAPA 5TAOA 1HJWA 1LJYA 4XIAA 3KDOA 4JNMA 3HGRA 3CUFA 1JZ3A 3MU7A 2PP3A 3ZJ8A 4LEFA 2E25A 3QSRA 3WBAA 4L9XA 1ISXA 1MNSA 1G4SA 5A8OA 5F2IA 1KBLA 3RFAA 3HPZA 4NZFA 3WUEA 5IXEA 4EPEC 1Q63A 3LLDA 1FWNA 3DHFA 1OFDA 3DFOA 3W1PA 2XPKA 2OEKA 2WNQA 3D5HA 2MUCA 3FEMA 1OZQA 4EX4A 4B2DD 1NDWA 3P74A 5REQB 4LRSA 3S4TA 3E9AA 2RGLA 3VCCA 1XQLA 4JX5A 3W38A 1MDRA 3G22A 1XCXA 2JALA 3N19B 2P5NA 3W7GA 3RCNA 2BWGA 3O63A 4MSSA 3TSBA 2OX4A 3BGAA 2IQDA 3ARPA 5GJMA 4ZMGA 5CPOA 3M44A 3CEUA 2YSWA 3OJGA 1XX1A 1R85A 2H9AA 4C5YA 3QR3A 1H41A 3S1VA 5BXPA 2C7FA 3RF9A 5JXQA 1KV8A 4DUWA 2E09A 3UY8A 4CKQA 5HPCA 3GH4A 4B15A 3S9IA 1PYFA 1EJVC 3B9OA 3SCOA 4GLEA 4IUGA 2VQTA 1FCQA 1V5XA 5HBFA 1V02A 1Z6KA 2NQZA 1FBAA 1KCZA 3I6TA 2A5HA 3R11A 3AC0A 3UZXA 2WM1A 1I6NA 3A21A 3CAKA 3M0JA 3MO7A 1EO5A 5HUOA 3FVMA 3PTKA 1F8MA 4PEKA 1NQKA 1XYZA 1R38A 5KZEA 3CBWA 4HN8A 1A3XA 3EX3A 3SURA 4A8LA 5HJYA 1I2OA 2PDUA 5C9RA 2YL9A 3E2VA 1U30A 5LGXA 4PUDA 3VNZA 4BCEA 3LDVA 4EK7A 1CLXA 2HWGA 3NQ8A 3M0HA 5E70A 5H1WA 4DWSD 3VNLA 3GNOA 1ZQ5A 1W1TA 1M41A 2ZC8A 2NV2A 8XIAA 3LRMA 2CITA 1OABA 1FOBA 4C6KA 4F9DA 1XPYA 4ENLA 1EIXA 1B3VA 5AVHA 5HQEA 2FZBA 3ZJ7A 4GI8A 3BCFA 4O1DA 5F2LA 1L2QA 4ZXOA 3W83A 1US0A 1EDQA 1TQXA 4H4IA 4JICA 4AD3A 1XS2A 1SZFA 3SADA 1BG9A 4J5NA 2WYSA 1W1YA 2WPGA 1O68A 4C6CA 2JE8A 5CGMA 2ZUUA 2PDMA 2D0GA 1LL4A 2JK2A 4GKTA 4LUJA 1J96A 1QVBA 4UNKA 4F9JA 2YCLA 2VEMA 3DOPA 2BDQA 4XAYA 3VE9A 2A21A 3POCA 3OVRA 1RA5A 3GNXA 5FESA 1JGIA 1NH6A 2XIJA 3W01A 1GVIA 2G97A 1PKYA 5T26A 4K8HA 5DCBA 1A3HA 2ZKMX 3SFKA 2O9TA 1SUXA 3E0LA 1XI3A 1EA0A 1IT0A 1ZLPA 3W70A 5IDZA 5ABGA 4HMCA 3VDAA 3ZOAA 2YA2A 3IV8A 1Y0EA 3HQNA 2J6VA 3T78A 2D24A 3FX4A 3VAVA 4HNNA 4WIWA 1VZWA 2NX9A 4J1OA 1VLWA 1T40A 2WSYA 3NXLA 2Y4SA 4NAEB 2QUUA 4AY7A 3V75A 2QJJA 4WUIA 3F2BA 4C60A 3WH8A 4HN4A 4DJEA 2JGYA 1LL6A 1EP3A 4QJ1A 4XZBA 3VD5A 3WQFA 1KXHA 4AW7A 3WD0A 7ODCA 1AH0A 2G41A 3OLGA 4REQA 3AWOA 3H6OA 1DOSA 4OE7A 3FXGA 2J62A 3WDJA 3BK0A 3N1AA 3KOXA 1YPIA 4KFPA 2X7VA 3ZVHA 3G5EA 4QP0A 2VGIA 4ZB2A 3VNKA 4KRTA 5JH2A 3AIWA 1P5BA 3CAWA 4YNGA 5A8GA 3LU2A 1PHWA 1V6WA 3MPGA 1O5RA 1X6UA 4DPQA 4KERA 1E43A 3WYZA 3AS0A 2E68A 2R1NA 1LBFA 1RH9A 4K68A 2EXOA 2OWWA 3IWPA 3UT0A 2C1HA 4P8UA 2QW5A 1HKWA 4B3KA 3CIWA 4UTHA 3V3WA 1OFAA 2SFPA 3RM9A 3L0KA 5DFAA 3RCMA 3QLDA 5T8GA 3FFSA 4A8IA 4LB3A 3UWZA 3P84A 4IIGA 1X7IA 3E5BA 4IIEA 1NAL1 1J8VA 3APYA 3V18A 3RO6A 5EY5A 2FJUB 2ICSA 5FJTA 2VC9A 1ZFJA 4JD4A 4K39A 4UFMA 5MKGB 5D33A 1G94A 3W7OA 3G1FA 3AXKA 5DRIA 2BNJA 4B4HA 5A69A 1WX0A 1HP4A 4QTGA 2WWDA 3NQAA 4A8NA 3LX9A 2CXEA 5HK4A 4MJ4A 1OIMA 3TMQA 4OV4A 4BQ4A 2Q3OA 3S6DA 1JZ2A 1NQ6A 3DC8A 4DJFC 4ML4A 1VEPA 4ZOEA 2WBGA 1OEPA 1ZBVA 3VD3A 1QI2A 4YIWA 2QEZA 3MSRA 4QAWA 1SMAA 3QY8A 3NO5A 3NL6A 3OYZA 3UZZA 3GRIA 4IH3A 4BA0A 4WXZA 5DLCA 1SMDA 3T7VA 1TUXA 1EEXA 5I3FA 3LN3A 3HG4A 3LTPA 3NDZA 3RN6A 2FTYA 2Z2AA 1DWJM 1C92A 4B5NA 1ISZA 4LUYA 2J9ZA 4C7GA 4MNKA 4JPGA 4LY4A 1XG3A 4ZENA 2Z29A 3PZGA 3E3HA 5LXXA 1DJNA 4AC1X 4IIBA 3BXWA 1BYCA 3EKLA 4F0KA 3ORWA 5FEPA 3G18A 5F7UA 1Q3NA 4NZJA 2X40A 2W92A 4GYKA 4HPHA 2OT0A 4Z0JA 2INFA 3QHOA 4LFYA 1LRTA 2VT0A 1TV2A 4BF9A 4CUCA 3TX9A 2CBIA 3AMKA 3F1QA 3TONA 3ZO9A 3C86A 3XINA 4WJEA 3S2MA 1UJPA 5D2VA 4AIOA 1JJKA 4CCEA 4LAKA 3KZPA 1DJGA 3GXFA 1MZHA 5HJLA 2ZRZA 1FDZA 3L23A 4EE9A 1VYSX 4FOUA 3BCJA 1PTGA 1TVNA 4U33A 2X8RA 3N12A 3NQEA 1NDVA 3UPMA 3MUIA 4IPNB 3UZ5A 1NF7A 1H7WA 4CNPA 4BI7A 5CBJA 2HRWA 4Q4OA 4GXPA 3VABA 2PPGA 1KBKA 4DJED 4RNFA 3QC3A 1KFBA 2IKJA 1TWIA 4Y9PA 3AAMA 3QHMA 3IUIA 4AG0A 4O17A 5CSUA 3NO1A 3MUXA 2V3FA 1FUYA 1OCNA 1TPEA 3TN3A 1C93A 3GG0A 4HU0A 1KXVA 5IBXA 1QK0A 5G5IA 1KD0A 4RUBA 1VEOA 3CPGA 4O8RA 1V79A 1UCWA 2DUXA 4JCLA 1D3HA 3QZAA 2ZCGA 3P0WA 4DVOA 2Z1KA 1E4LA 3MUY1 2VCAA 2GJXA 5CPTA 2XN0A 5E0FA 4PMDA 1EB3A 4BEQA 4FB7A 4H8UA 1W1PA 1G69A 4JL2A 1LZOA 1DQUA 4JQAA 1CLVA 2ACRA 3A22A 1D7KA 2QCEA 3GVQA 2OSXA 4TVCA 4DZAA 4JKMA 1A80A 4JZ5A 3BH4A 3G1DA 4DJDC 2BGNE 4MOZA 3WLQA 2IQ0A 3EX4A 4JYFA 1BQCA 3LCXA 1VHCA 1W9DM 2P3EA 2X2YA 4R33A 3O8AA 4FIRA 1JDFA 4DAFA 4Z2KA 2Y5SA 1JCYA 2PCEA 3FNDA 5FL0A 1CCWB 3L4ZA 3GB6A 4ATWA 4YL2A 3SQLA 1P6WA 2WNNA 1Q6CA 3W00A 2QCGA 4LYQA 5F2MA 4NJIA 5AOUA 2EQDA 1W5QA 3WMBA 2PE4A 4WQ6A 2DQWA 1XDLA 3RILA 1VBGA 4TVUA 3ECQA 2HE5A 2PDFA 1LBMA 3B8TA 3P93A 1YPXA 5A5WA 3CQJA 1I0BA 2ATSA 1ML1A 4OU1A 3OTRA 5H8UA 2WKLA 1CBGA 4GI4A 2VURA 2ZUVA 4XBSA 1E71M 1CI1A 1LUCB 3GH7A 4NZ4A 4LBSA 5G2WA 5CCZA 3F5LA 1A5LC 2EG6A 1KTBA 3TMLA 3PR2A 2XVNA 1YHTA 1JDEA 1WZKA 1B9ZA 2D73A 2XG9A 3ABOA 2NQLA 2PLJA 2ANUA 4XUGA 5K2ZA 4PMJA 4Q6XA 3VOIA 4W8AA 1DL3A 3GNDA 1VHNA 3W7QA 4HIBA 1X97A 2GQ3A 3EXRA 4JHMA 3BWWA 2VFEA 2XTKA 5U7SA 3CQ0A 3IPWA 4NU7A 1ISVA 4B92A 2J7BA 4DZHA 3BPWA 1E1CB 4NQ1A 3TROA 3DECA 4HMNA 1I75A 1FWBC 3EDJA 5D8WA 3UBPC 4JKKA 3NPUA 4M0XA 1WDRA 3G2GA 3CUGA 4H41A 4X60A 5F4WA 3EWDA 3K8LA 2MNRA 4I5UA 2VP8A 1P4CA 2O4MA 1ZUAX 5IM51 3G1SA 1W6TA 3TR2A 3V5CA 3WDRA 4GVHA 3LERA 1KKRA 2WZMA 4IMDA 4NAEA 5AYIA 3VDCA 3SRDA 1VF8A 1HX0A 2QPSA 8RUCA 1XLHA 4KRUA 3T08A 4Z1BA 1VPYA 2PWGA 1HT6A 3CAVA 4BWLC 1XUUA 3N17A 1PV8A 1JF5A 1WXJA 3CV7A 3OVGA 1A53A 1XLGA 3VOGA 1HGYA 4L7ZA 1JYWA 2XVLA 3NPWA 3QXBA 3MKCA 2YCEA 3EA2A 1NF0A 3N04A 1T8QA 5FD0A 3M5VA 1PE1A 3BOFA 4TV6A 4N6EA 1JPDX 3PUGA 1MEIA 6TAAA 4J3WA 5G1TA 3PHAA 2G37A 1JZ8A 4MWAD 3TEVA 4UZSA 2QCCA 1BXCA 1JUKA 2DDXA 4PTDA 1UKQA 4KEUA 5BMXA 4HGXA 1SZGA 4L1GA 4RDYA 5CQ1A 3WO8A 5CEWA 1LQAA 1I1XA 2F8QA 2VYOA 1JDDA 4M19A 1SJAA 3GO2A 1VFUA 1R3VA 3BLDA 3H2MA 3WN6A 1N7KA 4DUVA 1VBUA 1EO7A 2ZX9A 4NAFA 2VNCA 5DBTA 3W71A 3HB9A 4F0HA 2PTXA 1L8PA 2GUYA 4ZE4A 1JYVA 2ZXDA 1PX3A 2WXDM 1Q4WA 4CN1A 1NP2A 2QUMA 3M7SA 1BGAA 1LQ2A 3OZMA 3N2BA 2QAFA 1LT8A 3INPA 1DWFM 3EB2A 4PRRA 2BY1A 1TPDA 1BLIA 1S2AA 1QHPA 4Z1CA 2BV9A 2G5WA 2PZ0A 3IS4A 2Y1HA 3LCHA 4J3VA 3L4WA 2GVLA 2RH9A 3O16A 2OSYA 3THDA 3ZJ6A 4YVPA 4OBTA 5HUPA 5JUVA 5C5YA 4UWMA 3AROA 3G8EA 4H3DA 1ONWA 4M1BA 2BP1A 3C3UA 1TIWA 4LC8A 5ENLA 1H7NA 3N2CA 3LCWA 4GE8A 3PWGA 2J7DA 5CC3A 4DJDD 1R87A 5LSMA 1HL2A 1M7OA 4UFIA 1Z7AA 4XKMA 4ZODA 1NY1A 3IGXA 2RDUA 4I7UA 2DIKA 5EGRA 3GZAA 1D8CA 4WDXA 3NYZA 4GKLA 3JR2A 1W1A1 3W1AA 1QNQA 1HVQA 1EQPA 2QPXA 1AJZA 3CHDA 4AHOA 3LQGA 3NQ6A 2JGQA 1DWIM 2DGAA 3LD5A 2PLMA 3L4TA 3IUHA 4C6MA 4C6JA 3BDKA 1F61A 3TOPA 3W3OA 1JUBA 3L68A 2FGBA 2V67A 4F40A 3DX5A 3SRHA 3ITCA 3TLQA 3VIOA 4RZ5A 2OODA 3ZT6A 3TNOA 1OYBA 3AUJA 3DH7A 1WQ5A 3FN9A 4GYPA 4PH6A 1EGVA 4QNEA 3ITGA 3WKZA 1Q6FA 2OO0A 1QI5A 4ILSA 3AIVA 2IPJA 3IIPA 3WJYA 5M17A 3TYBA 1JULA 2Q09A 1EP2A 4B5VA 2OQHA 3C2OA 3UG8A 2DVXA 4DEFA 4QSFA 2AAMA 3VGFA 2FZMA 3UJSA 3U2ZA 1JD9A 1YPFA 3EB3A 3MW7A 3GH5A 1W1IE 2VDHA 5LGZA 3G1RA 4UC5A 4KCVA 1LBLA 1IGWA 5D4YA 1OWQA 4PMUA 3T4CA 2OJPA 3M0IA 3ZJKA 2PDKA 3R0DA 3WLIA 2VD8A 2O7SA 4TQTA 3UA3A 3UXAA 4JGDA 3ME3A 3WX7A 4J3UA 4Z1DA 1QWGA 2VEGA 4AWEA 4PMOA 3PBMA 3GTNA 4PRTA 3OA5A 1XKYA 3QOKA 3MP4A 2VTFA 4GY7A 4Q4MA 4D6CA 2FZ9A 1YKWA 4PMZA 5A6KA 3WUFA 2E9BA 1QTWA 3SM0A 3LK6A 2XISA 3V0UA 3CTTA 4B5SA 1IZKA 3G3DA 4LANA 1JPIA 4S3GA 2GJNA 4FXSA 3BLFA 1HQTA 3PSVA 2BB0A 4BKNA 3CT2A 1MUMA 3BUVA 4FX7A 3SAZA 3PZUA 1SGJA 4NF7A 2XIMA 1PKMA 4DF0A 4M7SA 1GZ1A 1WXYA 3WQEA 1F3EA 2ISFA 1UR0A 4BZYA 3CH0A 5JQ9A 4F2TA 6XIMA 4IX0A 4XG1A 4J40A 3UWEA 1CNVA 3A5VA 3PAJA 2CFFA 1OT2A 4U5IA 4UFJA 3EA3A 3H55A 2FZNA 3HGOA 4JTIA 5EMJA 2B31A 3FXYA 4RW3A 2OLAA 4H9XA 1SFSA 3W53A 1CPUA 3KBSA 3VA8A 1G4EA 3W6YA 3WDPP 1Q8AA 4DWSB 2NLYA 4QDMA 4HA4A 2IQTA 4OOZA 1VPXA 3AMDA 3S5OA 4MAVA 3U48A 2A6NA 3OLDA 5EMUA 1RR2A 4BQ3A 3IJ7A 1OGSA 1ZJIA 3NGJA 3DEQA 3I3DA 3UYCA 4BQ2A 3JUGA 2WM0A 4ZOAA 4AFYA 1IT8A 2HZGA 3NDOA 5FJUA 3NURA 1TMQA 3F2DA 3AS2A 4HK7A 2DT0A 3WK3A 4GIAA 3CNYA 1IXPA 3U7BA 4QM1A 3THQA 1UB3A 4JIHA 4AH7A 4EIVA 1P0DA 1GVRA 3WIJA 1K7EA 2YL5A 3HPFA 5LA1A 1BG4A 4IQLA 1LORA 4GZ7A 3C2VA 1GZJA 1UJQA 1V4YA 3II1A 1OFPA 4V1YA 3UR7A 4R7JA 3W7DA 2JKEA 1ZJHA 3AMCA 2VQUA 3MWAA 3NPXA 2JIEA 3RG6A 2YXXA 1HJSA 2ZZ1A 3N34A 1UWTA 3AHZA 3UXKA 3RDKA 4DXXA 5BZAA 1PIFA 3W2UA 3QKEA 5HPOA 1DWAM 2RHGA 3LM7A 4AD2A 3GAYA 2A0NA 4MJZA 1YNPA 2C13A 1CENA 1CLKA 1UWAA 3CB8A 4CNTA 7REQA 4ATDA 4WDWA 2HEJA 5IBXC 3LNPA 3S6OA 4MTVA 1GOXA 1PB0A 3GNNA 3H22A 2NX3A 3E0IA 1UC4A 3GDBA 3FEQA 1G67A 1O12A 1O1HA 2HPIA 3B9EA 3QY7A 1WE5A 4NJJA 4HU3A 1T0OA 3C52A 3LHVA 3PBWA 4NNAA 1E6ZA 4B5XA 4C6LA 4N9CA 2QT3A 3IJIA 1VIZA 5C7HA 4AZ6A 4DO6A 3LHUA 3LLFA 4W7WA 3BAIA 3FKRA 4LEQA 2YKKA 4EPKA 2J78A 4GQRA 2CC0A 1DJWA 1TTPA 1D8WA 1YDYA 1UZHA 1XISA 1CXLA 1MI3A 3UGVA 3WF0A 3CMFA 2Z1BA 5HXMA 1MW1A 4JYEA 3N2XA 4GVGA 3DYOA 4PCTA 2GSEA 1RD6A 4A2RA 3OB8A 3W6MA 2X09A 3L7RA 4Q7NA 2VZOA 2BY3A 2O92A 2Z00A 2WLYA 4FS9A 2NWRA 3URNA 5I02A 3WDQA 1VYPX 2BVDA 3G1AA 3MZNA 1KTNA 1FWSA 3NEHA 3A4WA 2V5DA 3UJFA 1FWFC 5AB3A 1AUSL 1J01A 5D02A 1BGGA 3GVVA 4WVXA 2FKPA 3SCSA 1R2SA 2CZ5A 4L1WA 3P8IA 2PDJA 1VFOA 2V5CA 4GJIA 1GKRA 4A3HA 3H4WA 3PBGA 2WO5A 2Y8VA 3KRBA 4AY8A 1Q4NX 3OU8A 5ABFA 1IR2A 1ESWA 3R8HA 4YPJA 4J27A 4FSAA 2IKIA 3WF1A 2HXUA 1O4UA 1W56A 4S3CA 3UETA 1KGUA 4OBSA 4Y2WA 3NQCA 3H7RA 2J77A 3AISA 9XIMA 2XH4A 2VEIA 4I9JA 2EGZA 5FJOA 3WNNA 3K8KA 2XVGA 3ZWTA 1FWHC 3L9CA 4PUKA 5EFFA 4JIRA 4DO7A 1FP8A 3WD2A 1K8ZA 2NQJA 3SCPA 1BRLA 2W27A 3GXDA 3MCMA 4KPLA 3MV01 4D72A 5C9UA 1UWSA 2CW6A 2R6OA 3SQMA 4EWJA 1ICSA 4J4KA 1GKQA 2PBOA 5AKQA 4E8CA 3PULA 2XFWA 3OPSA 2G8ZA 1GCYA 2WCGA 1Q66A 1R3TA 5FOOA 4LSBA 4DF1A 4NASA 1D7FA 2Z28A 1IR1A 1Z32X 1J6OA 4R5EA 1O1ZA 1OG0A 3ZZ1A 2WW5A 5BXRA 2Z2BA 3EMQA 4LF1A 3GDKA 3CHVA 5D32A 5FEXA 2V3DA 5C6MA 4GI9A 1P43A 1OC7A 4WY0B 4WSJA 5FF7A 3RM4A 2EHHA 2FH6A 5EL1A 1KFEA 1ITXA 2ATMA 3Q67A 5HAOA 5AC4A 1QNOA 3GAKA 3KP1A 5JH1A 5KZ6A 3ZVHB 4GABA 4KWVA 4F48A 3UVAA 5BOEA 2QVHA 1HN1A 1C90A 3VGDA 4AXKA 3LGDA 4H6EA 3ZM8A 3CGTA 4LUSB 1W3LA 1WBJA 1C8YA 4GH1A 4LY8A 4E3VA 4P61A 1W1B1 4D6IA 3O6CA 3CMGA 1FHLA 4FOJA 1MEHA 4C1LA 3O2LA 5F1VA 1TB3A 2QIWA 3B0VC 3W9ZA 1KR1A 4Q22A 3OBAA 3PPCA 2QCDB 4UR7A 1TMHA 5BRBA 4WJ8A 3G0UA 1WUFA 4RL3A 3VM5A 4FXFA 2R1LA 1KC7A 3SIZA 5EMLA 2E1WA 1CXKA 3I68A 4P5UA 2RUSA 4UMBA 4FEZA 1KRAC 5A8QA 4S2BA 1S46A 1MWOA 4RV3A 4TTUA 4JNYA 4F3HA 3KLLA 3KBWA 3ARQA 7TIMA 4PTVA 1KBJA 3V7PA 3K1GA 4EANA 3APTA 1PKNA 4X0NA 1VYRA 3OIHA 4CD7A 5I0DA 3T2PA 5G2HA 5I2UA 4YJ5A 4XBJA 3C8NA 1K77A 2C79A 3N2MA 2VCCA 3FAXA 1CWYA 4HBKA 2J13A 1TWDA 3RIKA 1FXPA 5JBEA 3LMZA 2I16A 4HHPA 4FLOA 1A5SA 4Q4KA 5LNRA 3CL8A 1ZRQA 1K9TA 4HCHA 4QBXA 1LYXA 5JVLA 3O05A 1J11A 3PTMA 4FMVA 5L9FA 4R53A 4W89A 3EX1A 4FZIA 3IIOA 3KBNA 4HPGA 2Z2UA 4QEEA 1AJ2A 4NYUA 4YMZA 2A79A 3E02A 4ROQA 5A6JA 3WNLA 1JEZA 3YPIA 3DFNA 4IL2A 3KWSA 4U28A 1R9ZA 4JDBA 3EKZA 3IJQA 4D1IA 1XSJA 1YW1A 2J6XA 4UTTA 4DB7A 4OGZA 3B9DA 4DNMA 3WJWA 3EBVA 4RKAA 2OSWA 3R5EA 5CSSA 4Q8VA 3OQEA 4G8TA 1S5TA 4J7RA 5ECUA 1ZP4A 1EJTC 3M5YA 3LXAA 1GOQA 3OA3A 4TX9A 4Z42C 2OCZA 4GZJA 1BYBA 4B90A 1FWGC 3NJ3A 3H4GA 2QQ6A 5E5CA 4G56A 3S2LA 4JYDA 1K9FA 4MGGA 5AHFA 4KW2A 2O9PA 3GDTA 1FH8A 2CESA 1Y65A 3WLRA 4XVDA 3WY1A 2FDSA 1UR2A 1J0IA 3WJSA 3DFPA 5AY7A 1Q6GA 4S39A 5ABTA 4GA8A 2AQOA 2YCLB 3AZSA 3UA4A 1KGWA 2CZDA 2VCBA 3E6EA 1KV5A 1NELA 1JPMA 3HTWA 3W1NA 1A5AA 4PGLA 4LYKA 4C5ZA 3PM6A 3VGHA 1ZBKA 2J8FA 4KESA 1PBGA 5HINA 1GG1A 1YE4A 4DO5A 5AYYA 1ZENA 1S2TA 2DSUA 5LIWX 4HD5A 3BANA 1NJJA 1B3WA 1SSDA 6A3HA 4PTMA 2J27A 4H9ZA 4IX2A 1J0KA 3NZGA 4HA1A 2YCKX 4FIQA 2OYLA 2OXNA 4EP8C 1CDGA 3UW6A 1B4EA 5A8PA 2VZTA 5BOFA 4UUIA 2ZWZA 4R27A 3EXTA 4AX6A 5FI8A 4Q33A 5G4WA 5A2BA 3BAJA 1L6YA 3VNJA 1YXYA 2GOUA 2DSKA 3VE7A 1W5NA 4KWOA 5LNSA 4U5KA 3MC5A 5A1AA 3FIGA 1NSJA 2Q02A 3B4YA 2DIEA 1ECQA 3ANYA 3ZSTA 2PTZA 3N25A 4DJEC 3EWXA 4M6QA 4UQBA 2I17A 4JL1A 1Y5WA 1MVYA 2F6XA 4CD4A 3S42A 3S1UA 3MSYA 4JTAA 1KFCA 5EA9A 4Z2HA 1J0HA 1F2JA 4FPSA 3KHJA 1B1YA 1QOQA 4RNIA 4QS5A 2V3EA 5E09A 4NZ1A 2HBXA 3BMXA 1E5JA 4M51A 4I9AA 3EWYA 2XSBA 2X1SA 1ZY9A 4K3ZA 5JIPA 2CIPA 3GDLA 3B4UA 2XZ9A 5XIAA 4RDZA 5K9CA 1QOXA 1U2YA 1R3SA 2ZX5A 5CZTA 5IHSA 3M0YA 4CLMA 3V36A 1RHCA 2DZBA 4MLRA 5CPLA 2VZSA 5D9MA 2NLIA 2WMHA 3BL3A 3MBDA 1WZLA 2HSAA 2FH8A 3W7HA 1XCFA 4QRNA 4E0CA 1JCTA 1HKKA 3I3EA 1QOPA 4R7WA 4KEZA 2C14A 3CJPA 3EDEA 4CVUA 1ISYA 4JOMA 1J5TA 1J0ZA 3BMWA 3SR7A 3GFZA 3FJLA 2PLCA 1OCJA 4YHEA 3PBUA 3C8FA 2PU1A 3LENA 2CHOA 1E40A 5KEZA 1KCLA 1WP6A 3RMJA 4FXRA 3UEQA 4GNVA 3WBYA 5CLTA 3CYVA 3I10A 2BG5A 4MUZA 3WFAA 4H7VA 4Q8OA 1QCWA 2VX7A 3C2EA 3SGUA 4CN4A 3WLKX 3M0MA 4ORIA 4HB7A 1UWUA 3OP2A 3SCQA 4LUSA 2GK1B 3URBA 4OT7A 3W7EA 1FWJC 1YE6A 1JI2A 4WSHA 4AZCA 4P8VA 2PF0A 4CD8A 2Z6IA 2BFGA 4UOJA 4GVFA 2VC7A 9RUBA 4ZOBA 3TTEA 5DN1A 1IXQA 4WCJA 4UTMA 3RM8A 3DG7A 4OQVA 5MF5A 4DXKA 3FHQA 3L0NA 1KLZA 3PZIA 4MYXA 3ZS4A 1KXQA 3H2AA 4KIEA 1HJQA 4JFUA 2Q8XA 4RR4A 3R0UA 4IPJA 5CC5A 4PTNA 1CX9A 2G50A 4MG4A 2A3HA 3H12A 2E8ZA 1TCMA 4Q7IA 3IJLA 4UCGA 5C0QA 3BW2A 2QR6A 3VX1A 1AW1A 3WQWA 4JTFA 2PZNA 3IK4A 4M29A 4Q32A 2AQVA 4OVXA 1W2PA 2GOKA 3C2RA 1QW7A 1FCVA 3APGA 2XSAA 1E4NA 2RGMA 3B8DA 3W7KA 4LB4A 1AMKA 4PUNA 1EZWA 1HKVA 2NX1A 3S0CA 1B0IA 4KCWA 4DWSA 4Q4PA 1EJXC 4IQDA 4NZ5A 3NSNA 5BRQA 4MDOA 4GX8A 4L4MA 4CCCA 5FIPA 4JTUA 2QCNA 5HNTA 4DBSA 1UG6A 2TRSA 3G0SA 3BTNA 1GQNA 3AMGA 1DJIA 3CAQA 2ZUMA