4WD0A

Crystal structure of hisap form arthrobacter aurescens
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
242
structure length
230
Chain Sequence
QSVLELLPAVDIVDGQAVRLLETSYGTPLEAALNWQNDGAEWVHMVDLDAAFGNNAALISDVVSQLNVKVELSGGLRDDESLERALELGVARVNLGTAALENPEWTRKAIDRFGDKIAVGLDVRGTTLAGRGWTKEGGDLWEVLARLEDAGCARYVVTDVTKDGPNVELLRQMVEKTGKPVVASGGISSLEDLRVLRELVPLGVEGAIVGKALYAGAFTLPEALDVAGRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneam
publication title Crystal structure of HisAp form Arthrobacter aurescens
rcsb
source organism Arthrobacter aurescens
molecule tags Isomerase
total genus 72
structure length 230
sequence length 242
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2014-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4wd0A00
4AEOA 2WSQA 3LI0A 5CGQA 5I3KA 4RV8A 4BK9A 3HB9A 1F7BA 4ZQOA 4DF0A 2QCHA 3W87A 4YLWA 4ZMGA 4KWVA 5FF0A 5I3HA 2J24A 5I3FA 3UZ5A 1H51A 4ALDA 4YL2A 1QOPA 3VI2A 2Y7GA 1YTDA 4NU7A 4BF9A 2C14A 4JNMA 2VFHA 5DY3A 5F1UA 3NQCA 3TJXA 2ATSA 3MMTA 4NJGA 4HHPA 2DZVA 1TPWA 3PBVA 4Q33A 4JTUA 3L5MA 1QAPA 4ADUA 4CCCA 2QCDB 2I1OA 3C56A 1ZALA 1JRCA 2WNQA 1LTDA 1NSJA 3C2OA 3W2MA 1Q45A 4LRSA 4PC8A 3MI3A 3DFSA 4JTTA 3GR7A 2NUYA 4N2YA 3CIXA 4E38A 2FIQA 3HGOA 3EXSA 3RFAA 4WZHA 3MJYA 1KV8A 5FEPA 2R8WA 3M1ZA 3MI2A 1R2TA 4CNNA 2JKPA 4WX2A 3FFSA 2YDAA 3B05A 3GAYA 3NYZA 3W73A 2BX7A 1UASA 2PE4A 4YWIA 4NX0A 5D37A 5FEXA 4O1AA 1OFAA 1FXPA 3QZEA 3H53A 3LBCA 4JTFA 1RD5A 3HG4A 2V5LA 1GJPA 3TU9A 1SO4A 1VQTA 4IGHA 1V7YA 8TIMA 3HGSA 2H3DA 1R46A 2YFNA 3UQNA 2OZ0A 4C1LA 4WY0A 2J9ZA 3TSDA 4FNRA 2FTPA 3DHDA 4N6EA 3V1PA 3LXAA 3FS2A 3HGJA 3G0UA 2A5HA 3Q58A 3PVFA 4GWEA 4JTSA 3TMLA 4BWLC 3A5VA 4UTIA 3NZRA 5EYWA 1A5AA 4HPXA 4UR8A 1SZGA 1FCBA 4JYFA 3O05A 3W7QA 1VR6A 4LUIA 3W83A 5L9FA 1TPB1 3W9ZA 1VYSX 1XUUA 3TC7A 5E93A 4LY8A 2E6DA 2H3BA 1EP1A 2QCNA 1VLWA 3TW7A 1KFLA 1S5WA 1DOSA 5ABTA 4O8RA 3IIXA 4JD4A 1F2JA 4LS2A 3OBKA 3W7JA 3LM7A 1TV7A 1EWDA 2C16A 2I14A 4K8EA 3BGGA 3TW6A 5U7SA 3ABQA 3LCFA 3P8JA 1L6YA 5HR6A 5KITA 3LLDA 1QPOA 1WXJA 3VCRA 3STCA 5CZTA 4BFAA 4Y9AA 5EMUA 2DU2A 4AWUA 3VE9A 3RLVA 3M43A 1F5ZA 5DN1A 2ZZ6A 3QQ0A 1L9WA 1O5XA 3MHFA 1VC4A 4NNBA 4U4MA 4M7SA 4ZQCA 4IXHA 1QPNA 3CEUA 5D30A 4ZZ9A 5K9CA 4XTIA 4AAJA 1M7PA 1NF7A 3G1YA 3NQDA 4TMBA 1IF2A 3R5EA 3Q94A 1K7XA 3EX4A 1W56A 2YSWA 4KFPA 4AF0A 2VEPA 4LS0A 5LSMA 1FWRA 4RK8A 1YXYA 3LX9A 5HMSA 1HL2A 1G4SA 3W7GA 2W6RA 3W2LA 4MFDA 2QCCA 3O6YX 1SW0A 4M6VA 3BLFA 2WO5A 4HNUA 5HINA 4NZFA 1AK5A 5HWMA 1J2WA 3TV8A 3G1XA 4R7JA 4PEKA 3G3DA 5K3VA 3O8AA 4LT9A 4JTHA 1TTJA 3WK3A 4NNAA 3SJ3A 5CPLA 4XBSA 1B57A 1SSGA 3L66A 4UFKA 2V82A 3MO7A 2QUUA 3LV5A 3HG3A 3W7OA 2EHHA 1KTBA 4RJEA 2QDHA 4GE8A 3W7DA 3L2IA 4FF7A 3MYOA 4MJMA 3LHZA 3P80A 4H6KA 2CFFA 2A85A 3W3OA 3BG5A 3SSJA 1I2OA 2XN0A 1JCNA 3M5XA 1ZY9A 3NQFA 1GTEA 1VHCA 1Q3NA 4JY9A 1TMHA 1TSIA 3A23A 3KVJA 5CSRA 2QKFA 3IVUA 2HMCA 3QMTA 1ZHAA 2G97A 3PAJA 4LNYA 1IIGA 3E0IA 3G0XA 3NA8A 3GVGA 2QAFA 4PH6A 1HTIA 3TC6A 3QFEA 3O1NA 4MZ1A 5BNKA 1TPUA 1DVJA 4Z0SA 5CZ0A 5AHFA 2DJXA 4UR7A 2QJHA 3W2UA 1F76A 2YGYA 3IGUA 3DENA 3MWAA 1W54A 2E77A 3DKLA 1IXPA 3N34A 3IVSA 1PHQA 3GXTA 4IPIA 3TE9A 5J5DA 5AHNA 2QJIA 4ZQMA 3P61A 1PVNA 4QAIA 2ZRWA 4GUIA 3TQ0A 3DAQA 2RDUA 1N8FA 3P82A 3LXCA 3IIVA 4LVFA 4A2RA 1Z44A 3HIJA 1O94A 3HBLA 4Z1AA 2CWNA 2QCMA 1W5PA 2QDGA 2WNNA 3TFXA 3EEGA 4FNQA 2EAWA 4XTDA 1TV5A 2A6NA 4AHPA 1FWWA 4Z1CA 3S1WA 1GVOA 3TUUA 4FXRA 5D2YA 1F6PA 1JUEA 2CLLA 4LC6A 3VE7A 3MP4A 3W7IA 1LBLA 2FQIA 3B0PA 1PIIA 4TO8A 2OCZA 3SGZA 4ORMA 3M47A 4XKYA 2CU0A 4EIVA 3BVJA 1FDZA 3N3MA 4CCDA 4JR5A 4EF8A 3DFNA 3JS3A 4NX5A 1LOQA 3P5YA 3KOFA 5HQEA 3SIZA 2QCEA 3L68A 5C6MA 1OFBA 3W84A 2Y88A 1W37A 4QISA 4UTTC 5DY2A 1LZOA 1HG3A 3FJ6A 1TPEA 2ZTJA 4QNWA 1K7FA 3S5YA 1XBVA 1T96A 2FDSA 5F2IA 1RQBA 3S6DA 4JTIA 2R14A 2ZZ5A 3W07A 1YTKA 7TIMA 3W70A 2X1SA 1P0KA 1IXQA 3GZ3A 3P7YA 2GUUA 2P0OA 5G2HA 3H54A 1H7NA 2ZZ4A 3W1AA 3TXVA 1T8XA 4S1FA 2GQ9A 4MOZA 3EWUA 5IM51 1FX6A 3NL3A 3GR8A 4JDBA 1GYNA 1VS1A 2NWRA 2ZRZA 2VFGA 5D33A 2OT0A 3B06A 4O18A 4A29A 4CQ8A 3UY7A 4WOZA 3QF0A 4O16A 5DCEA 4NZJA 5AC7A 1TPFA 3G1VA 1QCWA 5KZDA 4UNLA 1PV8A 2PRLA 2CLFA 2FB2A 4ADSA 4JY8A 1EWEA 4O19A 3W1NA 3DGRA 4CQ9A 2E5CA 2E6AA 3STGA 3TJLA 2HS6A 3UWQA 4KFNA 3W23A 1XBYA 1LRNA 4O1DA 5EA9A 2HSAA 1L2UA 3NOEA 1WYIA 1W3NA 2Y7EA 3CT7A 2E1DA 1KFJA 2YPIA 1PCWA 4NJIA 4X22A 3TIMA 4B5NA 4N9CA 3THAA 2TRSA 1TJRA 3P84A 4PFMA 3LRMA 3B8DA 4UFLA 2FPTA 2WV8A 1ZJIA 3UWUA 1TJPA 3GIYA 5DCBA 5DXYA 5HUPA 1XKYA 3E9AA 1R30A 4UFMA 5CZJA 4IWWA 1W3IA 3S9YA 1ME7A 1OFDA 2CLEA 4JXCA 3ZWSA 3NO5A 3NL6A 1JR1A 2ZZ1A 4LVGA 1QO2A 1SO6A 4E2DA 4ML9A 3UPWA 4UXDA 4JYEA 4GJ1A 3LBMA 2P1FA 2QUTA 3FIGA 1M7OA 3I65A 1TPC1 2ZDRA 3LCXA 4PL2A 1GVFA 4M7TA 1YTEA 3LOTA 5T26A 3QPYA 1K8ZA 1K03A 3HPXA 5DBTA 1KFEA 6TIMA 4UTWA 4XBKA 2W79A 5D2WA 2Y7DA 3ABSA 1C8VA 2VXNA 4IMDA 2C6QA 4OE7A 4FNPA 1JCJA 2ZRUA 5D2TA 1I2NA 4NUWA 2XFWA 3TH6A 5CSSA 2D73A 3P60A 1OX4B 4O4WA 1T99A 2GJNA 2JGQA 5LHEA 2A21A 4YCPA 4PA8A 1XI3A 4QJ1A 3RU6A 2H8ZA 4WXYA 2VOMA 3EWWA 5LKYA 2ABBA 3PSVA 2H6RA 2VEMA 3VFLA 3F4WA 3E12A 1IIHA 1X8FA 5DXXA 4R33A 4N4QA 4O0KA 3NEVA 1Q6QA 1EIXA 5H91A 4A2SA 3PF3A 1EX5A 1JCMP 1GQNA 5GVJA 1J5TA 1OVDA 1W3TA 3PBWA 1Y0EA 3F03K 2WJZA 1ALDA 1U83A 1SQ7A 5EBUA 3QRHA 4UFJA 1A5SA 1H63A 4I7VA 3HG2A 2NV2A 3HPSA 3M44A 1XM3A 2V5BA 1CX9A 1GZGA 1QPQA 1MEHA 4CNPA 1OX6A 3U6WA 4UMBA 3TAKA 1O95A 1NEYA 5AYXA 2TPSA 1JVNA 3C2EA 1AG1O 1GG0A 1YPIA 4MY1A 4UIOA 2Q8LA 3GDTA 3TROA 2NLIA 2GQ8A 4K39A 3U2OA 3LTPA 2GVJA 3NPWA 4RR4A 3C6CA 5HULA 1A53A 2ZZ3A 2XN1A 3FJLA 3S5NA 1R2SA 4JYDA 1XDMA 1IXNA 1LP6A 3N2XA 5E0KA 2V8ZA 1I4NA 1FUYA 4DF1A 3DFQA 5KTLA 1VHNA 3CC1A 2C0AA 3O63A 4JS3A 2JBMA 3EXRA 3A9IA 3KRUA 2A6LA 2V81A 3QM3A 5LNWA 2CLOA 1CI1A 2F7FA 1P4CA 4MY8A 2VEKA 2QUVA 4MLJA 3N14A 4JTLA 1QNVA 1ZFJA 3PG8A 1K8XA 1WOBA 4WY0B 1KTNA 3B03A 4U28A 2ZRYA 4O17A 4R53A 2J9XA 3OEXA 4X9SA 1LRQA 2NZLA 3ATYA 4HSNA 2X1RA 2X1UA 1A5CA 4QSHA 5BOOA 2A7PA 4E0CA 1D9EA 3EWBX 1AW2A 3S0CA 3WJWA 2VFFA 1JQXA 4DO5A 3W85A 2RHGA 3EKLA 3G1HA 4OU1A 1B4KA 3RNDA 3LRLA 1KM6A 3STFA 3CLMA 3CPRA 1TYGA 1VZWA 1TREA 5EPDA 3NQMA 2B0MA 2E5BA 3C61A 3MW7A 1BEUA 1I2RA 1BKSA 4RZ6A 1HO1A 2Y62A 5C2XA 1H7XA 3B04A 3NPUA 4LVDA 2I9EA 2CLIA 3A24A 5G5IA 4LUJA 3LGEA 4EWND 3QYQA 3SZ8A 4EF9A 5CZSA 4HSOA 2OJPA 3T78A 2E6FA 4P2VA 2Z2UA 3H55A 4JTKA 3M5ZA 4W9TA 3I7RA 4NJHA 4MIMA 3W2NA 1EB3A 3DBPA 4DPPA 5I3GA 3R89A 1Z48A 2VFDA 4WOQA 2Z0IA 3W7MA 1W5OA 1F74A 4OT7A 1R2RA 4LV9A 1T0OA 1JCYA 5H2ZA 5I3JA 1E51A 2FJKA 1AMKA 2B7NA 4O1CA 3G0SA 3DKJA 2CZEA 1JJKA 4DO6A 3GDMA 4BI5A 2Z6IA 4LC8A 4ZQRA 5D38A 3BW3A 2V9DA 2RFGA 3NL2A 4LU0A 4GXMA 2VC6A 4O52A 4IMGA 3Q2DA 2ZTKA 1TRIA 1JQVA 1KM2A 1KFBA 3BW4A 5FI8A 3IIPA 3S42A 3OIXA 1JUKA 3THQA 3CM4A 4AF0B 1GPWA 3MI6A 4I9AA 3LERA 4DBEA 5LZLA 4AHQA 3LRKA 2VFEA 3TK7A 3W7KA 4O0ZA 2DZSA 4WUIA 5DBUA 3DFTA 3LHTA 1VPXA 3A22A 1XC4A 1TPH1 5F4WA 1FBAA 1JCLA 4BI6A 3HOJA 2AQWA 3UNDA 3OA3A 3UXAA 4GC4A 4K7YA 3P8IA 2NV1A 3NR0A 2WOQA 6ALDA 5AHLA 3CWOX 2Q3OA 4O50A 1A5BA 2DZPA 4FNSA 5AB3A 4UTWC 4PTNA 5K9DA 4JX6A 1GEQA 5U4NA 3DFOA 1XBXA 3WK1A 1JULA 4BI7A 3LI1A 3C2FA 4WXZA 1RZMA 2Y63A 2A1YA 3L5AA 2QCLA 4FNUA 3N9RA 2CZFA 3DZ1A 4NJKA 1BTMA 4JIQA 1TV8A 3W1RA 1G4TA 1RQEA 2HS8A 4MZ8A 4UTJA 1ML1A 4OV4A 1SSDA 4C1KA 5CPOA 1BWLA 4O4VA 2CLHA 3NQ8A 3BK0A 5K4ZA 1PE1A 5D2XA 3NQ7A 3BO9A 1W1ZA 3P5ZA 4O10A 3NM3A 3F4NA 2PRMA 1XFBA 3JR2A 5A8GA 1M6JA 2KZHA 1M5WA 1H7RA 1LCOA 3B0UX 1W5MA 2B7QA 5HWJA 1H7PA 1D3HA 4LOCA 1GTHA 4Z08A 4GUHA 2RKXA 2NXIA 3BPWA 1YPFA 3KHJA 2QAPA 5CG7A 3KRZA 1H50A 1A50A 2ZFAA 3S1VA 2EGZA 3W1TA 4MJZA 4DPQA 3W75A 2CZ5A 1Q6RA 5MHBA 4CCEA 1KBJA 2Y70A 4IMFA 4JTGA 1OFRA 3W7NA 1OYCA 1FDYA 1VCFA 2VENA 3EKZA 4Z1BA 5I3IA 5F1VA 5AHEA 1MSSA 3AJXA 3FYOA 3VKJA 2WPBA 1S3HA 1VYRA 4AB4A 2RDWA 1I45A 3T44A 4JIPA 3VNDA 4O11A 4QQ3A 4TR9A 2ZRVA 3F1QA 3WK0A 4UTMA 3W1UA 3LCGA 1PS9A 3PB2A 1H62A 1KA9F 1SW7A 3B4UA 3QSTA 1D3GA 3DHFA 2E09A 5KMYA 4KKXA 1GVQA 3TSMA 1OK6A 4MYAA 5LGXA 2ISWA 2YCEA 2ZA3A 3NXFA 3P74A 5BMXA 2ZZ2A 4UC5A 3KXQA 3EXTA 1H5YA 4AH7A 4NVTA 1MEWA 3CB8A 4XKYB 4AHOA 4HKPA 3SW6A 4L4MA 3O6CA 4IX0A 1QR7A 3IVTA 1K3UA 1NF0A 2A7RA 2H90A 3WFAA 4J9JA 3BV4A 1FCQA 2G96A 3E49A 1ZENA 1XUZA 5FESA 4UMCA 3M7WA 1KTCA 2X1TA 4A21A 2A0NA 4GNJA 3SY5A 5C5YA 2B7OA 3WJYA 4OV9A 4FB7A 1PHWA 3PM6A 5CPNA 4LWWA 2X2GA 3ELFA 1LBFA 2EKCA 1WDWA 3QJAA 5G4EA 2Y61A 2BZNA 1GG1A 1WAUA 4EVZA 1QOQA 4ICNA 5AC8A 4OQVA 1HO4A 3GDRA 4FO4A 1TTIA 3UWYA 3IEBA 2NXGA 4Y8FA 4HIBA 3A21A 3W86A 4MUZA 5LNVA 3W7PA 4IJBA 1VLIA 1FWSA 3QMSA 4O53A 4RCXA 1F6KA 2H8XA 2C15A 2BXVA 4DF2A 2Y7FA 3PWAA 2YR1A 4ZL1A 1VCVA 2XN2A 4M6QA 1I8JA 3KAOA 3QW3A 3CHVA 2GVLA 4LV4A 1FDJA 4N9DA 1UB3A 2PRHA 4LS1A 4RXGA 1OFEA 3GNDA 1DL3A 4YCOA 1XL9A 3GNNA 2DZXA 3IRDA 3ANYA 3MBDA 3NQEA 1F73A 1FCUA 1YXCA 4JX4A 3PC0A 4X2RA 3W71A 3S5ZA 5G1YA 1PCKA 3O16A 3TFCA 3TR2A 1OX5A 2Z1BA 3G22A 3P67A 2C18A 3G1DA 4E2BA 1TRDA 1GOXA 1KM3A 3M0ZA 1TQXA 3DXIA 2YW4A 3NG3A 4L4LA 5TIMA 2UV8G 3PBYA 4K8HA 2YYUA 3UPBA 3B0VC 3G1FA 2ZQ0A 2JK2A 4HNTA 1ADOA 3D0CA 3FEMA 4KWWA 5LNUA 5C55A 4TX9A 1K7EA 4Q4KA 1ME9A 1LYXA 1RQHA 5KSWA 5BMWA 4UFIA 3SFKA 3M9YA 1OFOA 4DO4A 1FCVA 2CZDA 1X1OA 2J27A 4NT0A 1ICPA 3FOKA 4OWGA 2E68A 2PURA 3C2VA 5IBXA 2VEIA 5D02A 2JKEA 3UWZA 1SZEA 3S8HA 2C1HA 5CKSA 4O14A 1WQ5A 2DZWA 3OHIA 3L21A 4YMZA 4ONVA 4GUFA 5AYZA 4CLMA 1SW3A 1QFEA 5AOUA 1OF8A 1U5JA 3KX6A 2QR6A 1TTQA 1B4EA 5EL1A 3LB0A 4O12A 3BG9A 4WD0A 3TDFA 3UWWA 4I7UA 5K7JA 4UUIA 1DQWA 3DI0A 4UNKA 1YYAA 3G3MA 4OBTA 4DEFA 1EP3A 3OVRA 1G67A 3IIOA 5FF4A 3T4CA 1G4PA 3KVLA 5LNSA 3LHYA 3GKAA 4M19A 3BLEA 3G1SA 4OGZA 4Y96A 5D2VA 2JKAA 5G2WA 2FPVA 3LTYA 2YW3A 1FXQA 3IIZA 1SZNA 3N9SA 3BW2A 3NGJA 3EX3A 3ZWTA 4M6PA 2B7PA 1G4EA 4O28A 5K2ZA 4GRSA 3W1MA 3HPZA 1OX4A 2YZRA 1ICQA 2Z6JA 2P10A 3I7QA 2NUXA 2O7SA 3EWYA 5DCDA 3HGRA 4MLRA 3W76A 1EEPA 2V2DA 2TMDA 3PUDA 5G1TA 4DXVA 3LCWA 3PUEA 4CQAA 1WA3A 4H3DA 2AGKA 4UTLA 4R34A 2WQPA 5A5WA 1H7WA 2G95A 3EWZA 4IPJA 3DH7A 4S2CA 1VGAA 3PB0A 1AL8A 1OHLA 4GFSA 3STEA 3SGUA 2GQAA 3OG3A 3BGJA 3GXPA 3FLUA 3IGSA 1SO3A 1DQXA 1N7KA 2DP3A 3WJXA 4N6FA 3UWVA 4HT3A 3W2JA 1G69A 2NUWA 2FLIA 4EOUA 3L0NA 3RMJA 3W1XA 1DV7A 1SO5A 5FF3A 3S1UA 3W7RA 1TO3A 3Q37A 3UXDA 5K9XA 1XXXA 1NVMA 3C8FA 3EB2A 2QCDA 3LCIA 1JRBA 1SU5A 4K36A 4JICA 3TSBA 3GB6A 3NAVA 3CWNA 5LNRA 3CU2A 1DORA 4HPJA 1EA0A 3L0GA 4AWSA 3W88A 3SECA 2R94A 2NX3A 2BSLA 1KBIA 1YDVA 1ZAHA 3LHVA 1TTPA 2V2HA 3DI1A 1G6CA 3I68A 4FX6M 1QMLA 3RF9A 2NX9A 1P0NA 3A5FA 4ZVJA 3EX1A 4FIRA 2EPHA 2GPTA 2NXHA 4JTJA 3EX2A 5EKYA 2YYTA 4UTUA 3GLCA 3TA6A 3N2MA 3V75A 4NXKA 2C19A 1OF6A 4I7WA 2Y85A 3C3NA 3O06A 3S5OA 3R13A 3M41A 1JCXA 4JX5A 1QDSA 3QEZA 3HG5A 2CLMA 2ISVA 4LVAA 3E96A 4ORIA 3GDLA 3QC3A 4MZYA 3ZS4A 1OABA 1QWGA 1LRTA 3W7LA 2Q3RA 1EUAA 2ZYFA 1KM5A 2A2IA 4UTTA 4M5PA 4G1KA 4S2BA 3W72A 5G4WA 3G1AA 3TCEA 5D09A 2GJLA 4UTKA 1PL9A 3W1PA 1O5KA 2ZCGA 4K7VA 2LLEA 2IQTA 4ZQNA 3QPZA 4JGDA 5FF2A 3GK0A 3G24A 1OFPA 1SUXA 1QO5A 5AC6A 3PY2A 3C4UA 1B3OA 3QMRA 1C29A 5FEWA 1L6WA 3NPXA 1XDLA 2FFCA 1AL7A 3N19B 1KLZA 1HFBA 3C2RA 4XZ9A 3O07A 4PL1A 3YPIA 1VH7A 1TB3A 2JGYA 1FY6A 2NX1A 1Q6OA 3ZR4A 5KZEA 2J6XA 3BARA 1OYAA 1MXSA 4JTEA 3LHUA 3JRKA 2Q8ZA 3NQ6A 4IMCA 5F2LA 3QQ1A 2J88A 3LXBA 5TBOA 1H1YA 3M5YA 4FIQA 4JN6A 4WY0F 1FWTA 3R12A 5EY5A 4RZ4A 3PR2A 4RLIA 4N02A 3RK8A 3W7CA 1VJIA 1GVRA 5G2IA 3WJZA 3C0JA 2VELA 4IOTA 1KM1A 1KLYA 3PUOA 1W31A 4O1BA 5IBXC 3NQ2A 3UD6A 1TIMA 4MPQA 5D32A 1LOLA 3GDKA 4XWUA 4DELA 4O13A 3MHGA 3UYCA 2HTMA 5AN7A 1EUNA 4FXSA 2QCFA 3L67A 4AMAA 1YXDA 3ATZA 3NL5A 1MEIA 5SWUA 3UY8A 4Z0JA 4AWTA 1VYPX 5AHMA 3EX6A 3NVTA 2E6YA 1DJNA 3KVMA 2O7QA 4H4IA 2ZA1A 1LROA 1ZAIA 1C9DA 1X6UA 3P81A 1MZHA 3NQVA 3W6YA 3TKFA 1RR2A 2TYSA 1O4UA 1XBZA 3MUXA 3LLFA 1Z41A 1I2PA 4AVFA 3E02A 3IGXA 3HJZA 3HMJG 4X3ZA 1KFCA 4O15A 5TQLA 1VRDA 1ICSA 5LHFA 3MP5A 1TPVA 3HO8A 5HR7A 2V0TA 3PSWA 3HF3A 3MHUA 1WV2A 1P1XA 1NFBA 1DHPA 2YFOA 1W5NA 4AXKA 5D04C 3S1XA 1TCDA 3TMQA 3W2KA 2A7NA 3P62A 3LCLA 2QCGA 2YX0A 4RX0A 4XUGA 1GVSA 4QM1A 3PG9A 2DJLA 4LW7A 4TU1A 2ZZ7A 5AHIA 3USBA 3W1LA 4LVBA 3SI9A 3GKFA 1GWJA 2E5DA 4TIMA 1RV8A 3MP3A 1KV5A 1LBMA 2FPYA 4NNCA 1EP2A 1OG0A 2BWGA 3K30A 4FHAA 4IXXA 3PULA 2OT1A 4O54A 4WQ6A 1SPQA 5KZMA 4KFOA 2DZUA 2W0UA 1H7OA 5F4XA 2VFIA 3NQGA 4HNVA 1IXOA 3KVKA 1OFQA 5BRBA 3FKKA 1VCGA 1OYBA 2GVGA 5F2MA 4FNTA 3T55A 5J5RA 1G7VA 5HNRA 2FB3A 3OVQA 1K8YA 3TX9A 1MO0A 3NNTA 5FEZA 3TXZA 3SR7A 4BR1A 1YLVA 3QH2A 1FWNA 4XQ6A 4FEZA 3TQVA 1SR9A 3NDOA 1Q6LA 3ZFHA 2NWSA 1LM1A 1RPXA 4QNEA 1J4EA 3TAOA 1NAL1 1H60A 2V2CA 1WOAA 4UFHA 4UTHA 3W74A 3L65A 5LGZA 4A3UA 4PCFA 3W22A 2C3ZA 3I6RA 3LHWA 3AO0A 1UJPA 3CTLA 1SFLA 1WBHA 2ISSA 1P5BA 2QF7A 4POCA 1AW5A 1LDCA 1OJXA 3L5LA 5KINA 4O57A 1GYLA 1UCWA 3QSRA 3M6YA 2Y89A 4Q32A 3NQAA 5AYYA 4NXSA 3LCHA 1SZFA 1F05A 1IGSA 3INPA 1ZAJA 3U8GA 1FQ0A 4LTSA 1DJQA 1EPXA 3G18A 4HNNA 4QIUA 3TNOA 3GX9A 3DFPA 3T7VA 1W0MA 4IUOA 4N9BA 2X30A 3NPVA 4NQ1A 4NJJA 3FA5A 1R47A 4N9EA 1JUBA 3T40A 3WJSA 1KM4A 2F84A 4TMCA 1UBSA 1S5VA 3L9CA 2B4GA 4BWLA 2X16A 3HQ1A 4P61A 4GUGA 1H1ZA 4Y6GA 5BW6A 3LDVA 2YXGA 2ZA2A 3OVPA 5D03A 1W5QA 1UUOA 2C13A 4WJEA 4IX2A 4ZQPA 3ABOA 1LOSA 4QITA 3N73A 2WKJA 3DU0A 2WNZA 1V5XA 2EF9A 2OMAA 4IMEA 4MKNA 2WSRA 5FF7A 5HWNA 3KRSA 3O15A 2BTMA 2ATMA 1O60A 2OX1A 3GYEA 2TSYA 4YXGA 3C52A 5L6UA 1KW1A 1X7FA 1DBTA 4UMAA 4Y90A 1LLZA 1ONRA 1YDOA 2ZRXA 3MBFA 4A22A 4PODA 2CLKA 3R2GA 3KFTA 3BLIA 2VKZG 4MFEA 3NZ1A 3WK2A 5AFDA 1OK4A 4MYXA 3LTSA 5K4XA 4ADTA 4MY9A 3MYPA 3CQ0A 2PCQA 2V30A 4Z1DA 1H61A 2Y6ZA 2ZBTA 4RXFA 5DLCA 4FX7A 1ZCOA 5F2GA 5F4SA 2J9YA 2RDTA 3GAKA 3G8EA 1WX0A 1WBJA 3PS7A 5D05A 1XCFA 3W1QA 3LV6A 1GT8A 3FKRA 3GXNA 1YDNA 1Z42A 4MVAA 2DORA 2G5WA 3CIWA 4RZ5A 5HJLA 5E1QA 4LRTA 3O6DA 4IQLA 4JEQA 1SFJA 1QPRA 1ME8A 2BLEA 3IV3A 2R91A 5C54A 1DKWA 3FYPA 4JDYA 1KM0A 2GOUA 2DZTA 3W7EA 2ABAA 3I7SA 4DQWA 2WSYA 4OHQA 2PC4A 1THFD 1HUVA 1LLWA 4K38A 3L0KA 3RLUA 1L6SA 1X1ZA 1S5TA 4DBDA 1W8SA 1UUMA 1ZNNA 5CPMA 2RH9A 3UZJA 4D2JA 3CEPA 3ABRA 4K37A 3BG3A 1LORA 3TQKA 3G8RA 1N55A 1TQJA 3W7HA 5DELA 1BWKA 3PBUA 2QJGA 1B9BA 1K02A 2A4AA 3NM1A 4HN4A 4RKAA 3M16A 2CW6A 4GUJA 5HUOA 1AW1A 4UCGA 1G7UA 3QW4B 2AAMA 3EWXA 2ALDA 3M5VA 1CW2A 4CNOA 2QEZA 1TPDA 4FX8A 1I2QA 4GBUA 1KFKA 1RVGA 4N4PA 1YADA 3R8RA 4K6AA
chains in the Genus database with same CATH superfamily
4AEOA 3URNA 3CV1A 1F7BA 3W87A 4YLWA 1LLOA 4D6EA 4ZMGA 5FF0A 1GZ1A 3WH6A 3B40A 3VI2A 1XYCA 1YX1A 1S39A 2GUYA 3PK7A 3WH9A 1C8QA 4JTQA 4V27A 3LQGA 1TPWA 3NOYA 1F4AA 4HYRA 3S46A 3I6TA 4CCCA 4O1FA 3C56A 1JRCA 2WNQA 3A3XA 1WDRA 1NSJA 3C2OA 3W2MA 1IEXA 4Q6XA 4LRSA 4XIMA 4KWOA 4RW5A 3GR7A 2QDEA 1HQTA 2OEJA 1TV4A 4XX6A 3RM9A 1EQPA 4URIA 4E38A 3F4VA 4J40A 4CNTA 3RFAA 2G3NA 5EFFA 1W3HA 2GSHA 1V02E 4US5A 2QIWA 3TA9A 3W73A 4BF7A 3O7UA 2PE4A 3ZJ7A 4PRWA 1WXYA 2OOFA 4DJDA 4PCNA 4HMEA 1RD5A 3HG4A 2V5LA 1UJQA 3AYRA 1R0MA 3UJFA 2YFNA 4C1LA 4XZMX 3RCMA 1SJBA 3DHDA 4N6EA 3LXAA 1M53A 2E3ZA 3HGJA 4GWEA 3NZRA 1A5AA 5LYRA 4DN1A 4KRTA 3RM4A 3SCVA 1SZGA 5CPQA 3W7QA 3BOLA 1VR6A 2CCRA 3W9ZA 1VYSX 2E28A 4YTTA 1NOFA 2Z2AA 3I4EA 3SADA 3UG5A 1KFLA 2QS8A 1TWDA 3FSTA 5ABTA 7REQA 2DZAA 2RUSA 1JD7A 5HMEA 1JZ4A 3L4YA 3W01A 2I14A 3BWWA 1VEPA 3ABQA 5KETA 2DT2A 3P8JA 1PWMA 1MW2A 4DB7A 3T2QA 3ZLFA 4GFIA 1WXJA 3BLKA 1NARA 4BFAA 3UP8A 1EO7A 3K4WA 3VVGA 4AWUA 1DYSA 5JUVA 2BY1A 1NFPA 1E71M 1L9WA 1TUXA 1VEMA 3N6JA 2PF0A 2Y4SA 3U5YA 5D30A 4ZZ9A 4XTIA 2AGTA 3IAPA 4Z2IA 1QXLA 3POHA 1OGGA 3GUGA 1REQA 3LX9A 4KGLA 4GIEA 4KEZA 3UGRA 5JU6A 1G4SA 3W7GA 3W2LA 2QCCA 4E2VA 1BTCA 3BLFA 2WO5A 1HP4A 5HINA 1E1FA 5I7GA 1TFVA 4NZFA 4GI8A 1E9YB 1J2WA 3TV8A 3G1XA 3V36A 4R7JA 1NWUA 1JZ6A 3MDUA 4IIBA 3WK3A 3ZLHA 3DYMA 3SJ3A 4EPDC 5CPLA 4UFKA 3L66A 3B9OA 2I5IA 3HG3A 3W7OA 2W27A 2QYGA 4RJEA 2X42A 4V15A 4MJMA 2NQ5A 3LHZA 1EYEA 4ZSUA 3ZVHB 3P80A 3GO2A 3APYA 2EPLX 1R6WA 3LYEA 3II1A 2VWSA 1JCNA 3M5XA 4PUWA 2V68A 2WPGA 1Q3NA 1A3XA 2J62A 1WZLA 4CQBA 3PAJA 2ZDSA 4W8AA 4PH6A 3OW1A 4HYWA 3O1NA 1E43A 1DHKA 2PDPA 4I8YA 4JBRA 1DVJA 4Z0SA 1BRLB 4PSPA 3CUJA 1B1YA 3WELA 4UR7A 3F2CA 3IGUA 3DENA 4ZO6A 2Z27A 3N34A 3IVSA 2Q01A 1PTGA 3LD5A 1E0TA 3U4FA 3JZUA 3TQ0A 1N8FA 4DAIA 1J6OA 3MZNA 2IMRA 1UWIA 4G9PA 2CWNA 1UR3M 2QCMA 1TG7A 2QDGA 3TFXA 3T0AA 4GZJA 3KS6A 2EAWA 5REQA 3R11A 8RUCA 3WCZA 3S1WA 3ENLA 1GYMA 2P3EA 3TUUA 4V1XA 2CLLA 4LC6A 3VE7A 5HOSA 4W85A 2E9MA 2C0HA 3CUIA 3V0SA 4TO8A 4HD5A 4C6IA 4ORMA 3DEQA 1L6GA 3NZQA 1GQLA 3W6LA 3H7VA 1FDZA 2J7GA 4EF8A 1WKYA 3DFNA 4NX5A 3P5YA 1Q85A 1UR4A 1Q6CA 2VO5A 5A8PA 3VKBA 1M04A 1OT2A 4XVDA 4UTTC 2FZ8A 5A6JA 5M5DA 1O1HA 3T07A 2VRQA 4M3PA 1K7FA 3S5YA 4QSFA 3N12A 4AXNA 1T96A 3S6DA 3AHYA 5LXXA 3L4TA 4HK7A 1NOUA 1YTKA 4CNSA 1R85A 2O9PA 3GZ3A 3P7YA 4N42A 1W1VA 1H7NA 4GX9A 3ITXA 2XM1A 3TXVA 3BSGA 4MOZA 5HNTA 5IM51 4JCMA 2UY4A 1DTNA 3ZQ9A 1HKKA 1VS1A 3KM8A 2VFGA 3E0VA 4LH8A 3B06A 4NI3A 1OSEA 4YVXA 5B80A 3VIJA 2FZDA 3H24A 3WBXA 2REQB 4P8UA 5DMNA 1TPFA 2OYMA 4YN5A 2QVNA 2MUCA 2DIKA 2EQDA 2UY3A 2FB2A 4OUIA 2PWHA 3SB0A 1US0A 5C9RA 1ADDA 1IEIA 3VZZA 1FVPA 3OQEA 2Z26A 4R9OA 2R1NA 2WM0A 1LRNA 2OYKA 1AH0A 3U3HA 2HSAA 3RYSA 3CT7A 2XVKA 4ZTYA 2XIJA 2R24A 3WO8A 3TJ4A 4C6NA 4IGSA 3SRKA 1XX1A 2R6OA 2WV8A 1ZB5A 3UWUA 3AXIA 1TJPA 5DCBA 5DXYA 1XKYA 2QUNA 3E9AA 2JIEA 3D3AA 3CHEA 5CZJA 3RO8A 1OFDA 4W88A 3ZWSA 3NO5A 1QO2A 5C9UA 3MUCA 4UTFA 3WQ5A 2UY2A 4GYPC 3C86A 3SN1A 5LA2A 2QUTA 3FIGA 1V51A 3NSNA 1TPC1 3KTCA 3TYUA 3CHFA 3WLRA 2AOSA 1CXIA 2EXOA 3LMYA 3LN3A 3CASA 3HTWA 5DBTA 3BSHA 1KFEA 1Q8AA 2IKIA 1RUSA 2D69A 1C8VA 2VXNA 4IMDA 2C6QA 1CT5A 1VBHA 5D2TA 1I2NA 4NUWA 3CV2A 3VIHA 4PUDA 5CSSA 1RA5A 1OX4B 4HNOA 4LGXA 4O4WA 5JVLA 5LHEA 5IFTA 3K1GA 1PBGA 3RU6A 1B3ZA 2CWXA 2P5NA 4WXYA 3EWWA 1V6TA 1E6ZA 3VFLA 1YBQA 1FHLA 4DAFA 1IIHA 4LANA 2PD5A 3H2FA 1AD1A 2AL2B 3EMQA 4I9MA 3WF0A 4XZNX 4C6PA 5BXTA 4GQRA 1ALDA 1P6WA 1SQ7A 5EBUA 4LB3A 1A5SA 4I7VA 2ISFA 1BXCA 3B9EA 3VO0A 3QLLA 4L65A 3IRSA 1V3HA 1CX9A 3CPGA 5AZ1A 1MEHA 4CNPA 4Q4RA 3VNIA 3VD3A 4A8IA 5CC7A 4BQ3A 2Q8LA 4W89A 2IKJA 1O66A 2NLIA 4AZ6A 1CECA 4K39A 3U2OA 3Q45A 1NP2A 4QJ5B 1F3EA 3GBDA 2WZMA 2ZZ3A 1A3WA 2WHJA 1MW0A 1EO5A 1IXNA 4MDPA 4GXPA 4MB1A 1KXVA 4I6VA 2V8ZA 1I4NA 2XFRA 3L7RA 2VEFA 1E0WA 4AIEA 3CB3A 3O63A 3GXIA 3KRUA 4LCSA 5LNWA 2FFIA 1H49A 1EGVA 3KBJA 1F07A 5FJUA 4ZCWA 1IWAA 3MDWA 4LALA 1HVXA 4NI8A 4IG2B 3CWHA 3ITOA 3VD7A 1R3RA 3EA3A 1KTNA 4U28A 3GFZA 3OEXA 4L6HA 4RDZA 4X9SA 1LRQA 2GLKA 4B5SA 2PDJA 4QSHA 4E0CA 1D9EA 3PHAA 3WJWA 1VIZA 3EDEA 5HATA 5RUBA 3SFWA 2GK1A 3WQFA 1PDZA 3EKLA 2WBGA 3ITVA 4IQEA 2A79A 2Y5EA 3BGAA 1CDGA 3EAUA 1MW3A 3STFA 3CLMA 5BYWA 3WLIA 4UQDA 1VZWA 4J3WA 5EPDA 5AY7A 1LWHA 2HQAA 4G7EB 4ERIA 2YCIX 1KXTA 3KWSA 3N6HA 1R7AA 3MCMA 4PMZA 3JUGA 4WLCA 1TA3B 1SJAA 3LGEA 4XZHA 3T78A 2E6FA 4Y9NA 4WCJA 2Z7KA 4MIMA 4KEUA 2WMJA 2WK2A 4NAFA 4S39A 1Z48A 2VFDA 4WOQA 1Y5WA 1RCXB 5FKYA 3SUUA 3TNBA 2F61A 3NVDA 8XIAA 4I9JA 3L4UA 3QYSA 5D38A 3BW3A 2J7BA 1PX8A 4GXMA 2VC6A 4O52A 2EJ1A 3VX0A 3WN6A 2EPKX 1XH2A 1I1WA 2PUZA 1E5JA 2HPMA 1GPWA 2QPUA 4AHQA 3L2LA 3TZNA 2DZSA 2OSXA 1XIGA 3DFTA 5EB8A 4MWAD 3A22A 1FBAA 1JCLA 4BI6A 3CMJA 4GC4A 3GQYA 3P8IA 6ALDA 1OZMA 5AHLA 4LBRA 2Q3OA 3MUY1 4O50A 4PCSA 2ZKMX 2CHRA 3TLQA 4UTWC 3WX7A 4WKHA 1IQ8A 3UZYA 3MVTA 1VJZA 4QROA 3E0LA 2XISA 2A1YA 2PI6A 2QCLA 1FH7A 3N9RA 4RNHA 1BTMA 1DWJM 3E6EA 1G4TA 4KETA 2HS8A 3ARQA 1JCTA 4QLKA 3UVIA 1AMYA 4BS0A 1OINA 1MW1A 4R5EA 3RITA 1AQMA 3NQ7A 4O10A 2XG9A 3AUJA 3NM3A 3WKZA 3CQIA 1TCMA 5HPOA 2XYLA 1EFZA 2J25A 4MKSA 1PO9A 1H7PA 4LOCA 4Z08A 4WRHA 4TV5A 1DJXA 1YPFA 4E4FA 2QAPA 4JFSA 1EC9A 1SZRA 3S1VA 2EGZA 1M1BA 4NZ1A 4CQDA 2CZ5A 5MHBA 4IMFA 1RBAA 3KS5A 1VCFA 3O6AA 4DNHA 2VENA 3EKZA 4ICMA 4WJ8A 3VINA 4XD5A 1MMFA 5AHEA 3FYOA 1VBJA 1P0BA 1O68A 3VC6A 1I45A 2OG9A 2FTWA 3VNDA 4O11A 5C8BB 4PMNA 2OKOA 2VUYA 3VIMA 2Y5JA 2ZRVA 3XISA 2ZUUA 2GJXA 3ZOAA 2PDBA 5B7ZA 1EJWC 3UF9A 1GVQA 4MYAA 2QV4A 1CB7B 3C3UA 2ZA3A 3QHMA 3P74A 4PUMA 2ZZ2A 5BMXA 4UC5A 4DJDC 5A6KA 4GG9A 4AH7A 4NVTA 4ZO9A 1W9PA 4XKYB 2YL8A 1US3A 4AHOA 1PKNA 2PWGA 3OBEA 4L4MA 4D71A 3RO6A 1SYTA 1NF0A 4LYPA 2INEA 3AICA 4XG1A 3WDIA 5FESA 4RE3A 3VDBA 4CEXC 5HPCA 2OWWA 3FGCA 3R4IA 1G0CA 5LIWX 4J3TA 2ACRA 2B7OA 2OSYA 3UJRA 1E0VA 3U0HA 5BZAA 4LWWA 1LBFA 2EKCA 3QJAA 1V0LA 3GC4A 4HB7A 4HJFA 2Y61A 1QATA 2V6AA 1HO4A 4LYRA 4TV6A 3CQJA 3IEBA 2NXGA 2YZ5A 1ZZMA 4O53A 4RCXA 1F6KA 5BU9A 2H8XA 2C15A 4YYFA 3TYDA 2VZSA 3B9NA 3VGHA 1E1CB 3PWAA 1RSCA 1RD6A 1S1RA 1US2A 4M6QA 4F48A 4DZ5A 3CHVA 2GVLA 2YA2A 1DEDA 1FDJA 5D8WA 4WVXA 3SDOA 1KCZA 4N9DA 4H9ZA 1UB3A 2PRHA 2J13A 4RXGA 1OFEA 2PZ0A 4YCOA 3GNNA 2VQTA 3AJ7A 3IRDA 3MBDA 5JIPA 3VILA 4W84A 4LUYA 2E25A 4LXFA 1ZBWA 1PCKA 4Q4OA 4H9UA 3TR2A 2D0FA 2C18A 2ESCA 4E2BA 1F4HA 1GOXA 1KM3A 4GYKA 3M0ZA 1JDEA 4K2SA 4K1GA 2YW4A 3NG3A 1XWYA 3QV6A 1CTNA 4PZVA 3VPLA 2X0HA 3N2TA 1AH4A 1L0PA 1QI2A 4KWWA 5LNUA 3R8GA 4TX9A 1LYXA 3WENA 5KSWA 5BMWA 4LF2A 2Q6ZA 1DTUA 4GISA 4WGXA 1JDDA 1OFOA 1XLMA 3CAQA 4NT0A 3FOKA 4OWGA 3PZTA 5EMLA 3N29A 3RG6A 5IBXA 4JKLA 3VNKA 4PN2A 2JKEA 4Z1YA 4A05A 4DXKA 1EC8A 1VFHA 1WAWA 3CV7A 3OHIA 4W5UA 4ONVA 2C91A 1E0UA 4PSRA 3KX6A 4O12A 4C6KA 1OB0A 3TDFA 3M0IA 3GXDA 3WNLA 5K7JA 1FH9A 4TXEA 4C5ZA 1R87A 1DQWA 3G3MA 1WUEA 3KL5A 5FF4A 1G67A 6ENLA 4K1WA 2HROA 1PKLA 1BWVA 3G1SA 4PMJA 5D2VA 1W9UA 4WDTA 1FXQA 1A5MC 4QDMA 3ZT5A 3GHUA 3EX3A 3QHOA 5FJTA 2HISA 2EG6A 4IPPA 2B7PA 2PA6A 4S3EA 3H8AA 3WLMA 3GG0A 3W1MA 3WD0A 2ALRA 2WJFA 3KDOA 2P10A 1GW1A 5DCDA 3VNZA 2GQ3A 4W8BA 2BFGA 3PUDA 4CQAA 1R5YA 1WA3A 5A5WA 2WQPA 1YKWA 3OA5A 2FH6A 1KRAC 2VCBA 1VGAA 3IUHA 3PB0A 5DMYA 5IFPA 1OHLA 2GQAA 1PZ2A 3PPGA 5EFDA 1QHPA 3VIIA 3ARWA 3W2JA 1XRTA 1G69A 3I3BA 3B3DA 1Q63A 2DQWA 3U7VA 3WFZA 3S1UA 3W7RA 1OM0A 2VR5A 4H41A 4QCEA 1NVMA 4F0SA 3HFTA 3C8FA 4NILA 2YDQA 1ONXA 1WPCA 2X2YA 4ENLA 2ICSA 3CBWA 1JRBA 1JXJA 1EJ7L 3Q67A 5EMJA 4RPPA 4DUOA 2R1PA 5LNRA 4U10A 4EPEC 1S5MA 2GFTA 1EA0A 2FVLA 4ILSA 2W92A 4AW7A 4D8ZA 4W93A 1KBIA 2G3FA 4AD3A 3RUBL 3LHVA 1TTPA 5I79A 1G6CA 3I68A 4QE1A 1FWGC 2DVTA 1AZ1A 1GEHA 4FIRA 3S47A 3N18A 4UTUA 1ZS2A 3N2MA 5IDZA 2NW0A 3V75A 3QZ6A 2W9MA 4D6CA 2XSAA 1FKWA 3C3NA 3S5OA 3CMFA 2I5GA 3M41A 1NWRA 1QDSA 3ALGA 3OU8A 4KEMA 3VIKA 4AIUA 4HPHA 3E96A 2DSKA 2H9AA 4GGHA 3GDLA 1PZ3A 4MZYA 3ZS4A 4P7QA 1QWGA 4QP0A 3WQWA 3AYTA 3EPOA 2Q3RA 1PX4A 1XS2A 3OZOA 4JQ4A 2E1WA 4MUPA 3RU8X 3TCEA 3HQPA 3WLNA 5ECVA 1J01A 2GJLA 3GC2A 1PL9A 3W1PA 4GCAA 4NY2A 5AVNA 1E6SM 2WC3A 5CJNA 1FWFC 4XVEA 4KERA 4H8NA 3WLPA 4J27A 4Q4PA 3G24A 1SUXA 2QIIA 3GTHA 3PWGA 5AC6A 1B3OA 1RA0A 3QMRA 1W17A 4JHMA 4A3RA 3NPXA 3UYIA 1QNOA 3CHCA 3W38A 4PB4A 3QGKC 2PDMA 5BU6A 3QPEA 4Q8OA 4US6A 3T0BA 1HFBA 3GWQA 2BOFX 2YA1A 5DF0A 3WH8A 4ATLA 2OWXA 3S1GA 3KL0A 4YWSA 1GGOA 2Q8ZA 3M0HA 3W37A 3MSYA 3WF2A 3M5YA 3C5QA 1E40A 4R88A 4GYFA 1EJUC 2HVOA 4RZ4A 2F9RA 4N02A 1VJIA 1GVRA 1NM9A 3C0JA 4IICA 2A3LA 4IOTA 4FOUA 5LA1A 1A0DA 1KLYA 3PUOA 1W31A 4KQNA 1TIMA 1LOLA 2G41A 3GDKA 3GVQA 5AN7A 2I5QA 1A3HA 3L67A 1BQCA 1UKTA 3KWXA 5A1AA 3NL5A 1MEIA 4AWTA 1VYPX 2C79A 4AISA 2E6YA 2I56A 1GOMA 2VURA 2BS9A 3GNRA 4RDWA 1QW7A 1BVNP 2V3EA 5MKGA 1EBGA 3BC9A 4DWSA 4X60A 1OZQA 3LPGA 3VMPA 3MUXA 1XBZA 1KXHA 1I2PA 3DBNA 1W9VA 3E02A 4LYQA 1UOZA 4X3ZA 1J0HA 3WD1A 4O15A 4QE4A 5TQLA 4B2DA 2Z7GA 1ELSA 1KWKA 2D2GA 5C2CA 1TPVA 3HO8A 4R7WA 3KOZA 4YS1A 2V0TA 3HF3A 1XLFA 4GKTA 1W5NA 5A2AA 3S1XA 5ABEA 3FK4A 3H6OA 2PC8A 1HXJA 3P62A 3LCLA 2QCGA 2YX0A 4XUGA 2D3NA 1UBPC 4L6DA 2ZWYA 4TU1A 5AHIA 3GXFA 4FMVA 3MP3A 3K2GA 1KV5A 2OZ8A 4NNCA 1EP2A 5E6ZA 1OG0A 3K30A 4IXXA 3PULA 1PB0A 1SPQA 4Q8PA 1NIUA 4HNVA 1IXOA 3I3EA 3BE7A 4Z2HA 3WF3A 4JHOA 4MNJA 1XSJA 4AZGA 1EJVC 3VZYA 4BY3A 2FB3A 1HKVA 2DW6A 1H2JA 1XD0A 3TX9A 3CMGA 4MTVA 3TXZA 3SR7A 1FWAC 4L56A 3OLGA 4OBRA 2XIIA 2BV9A 5D9NA 4JCLA 1ITQA 2GJPA 3ANVA 8XIMA 2VRJA 3TAOA 1XIBA 1NAL1 4LCQA 2HJPA 3ES7A 4IH3A 4DZIA 4UTHA 3W22A 2C3ZA 4C6CA 3LM3A 1KD0A 2PTXA 1UJPA 3GIQA 1S2AA 2WJDA 4NYUA 4WHBA 1AW5A 4R3UA 2WM1A 1FWEC 1GYLA 4CVWA 3M6YA 1G9HA 4Q32A 5AYYA 2ZX5A 2AMGA 3LCHA 5CLWA 3SRHA 1J96A 3H70A 2XGBA 4PYSA 4DYEA 2P8CA 3S4TA 3G18A 4HNNA 1XSKA 1UP0A 3FVMA 3NPVA 3E2RA 4NJJA 4NQ1A 1JUBA 3MA8A 9CGTA 2X7WA 4QEEA 2AKMA 4AZCA 3B97A 3K8LA 4BWLA 4PBGA 1JZ7A 1R9YA 3EB4A 4Y6GA 3ANUA 3LDVA 3BUVA 2ZA2A 3KBNA 4BHYA 1S38A 3RCNA 2NQJA 1W5QA 3PJUA 1EDQA 1Z6KA 1LL6A 5HA7A 1IYXA 2J8TA 5FF7A 1J0ZA 3A47A 1NDVA 3O15A 2OX1A 1CYGA 3C52A 4PBFA 4UMAA 3ARTA 2CPUA 4REQB 2ZRXA 5C7VA 4H1ZA 2CLKA 2NQHA 3WMBA 3D46A 1R3WA 5T91A 3LTSA 2V30A 4Z1DA 4CVUA 3GAKA 2L5HA 3G8EA 1WX0A 5GJNA 3H2MA 2DVUA 3PS7A 2GYIA 4H6RA 2E8ZA 3FKRA 1OT1A 4MVAA 4OBSA 3CIWA 3F7JA 3FJNA 4B92A 1P0EA 3EMCA 3ITYA 1KCXA 4LBUA 3P93A 3FYPA 4JDYA 1KM0A 2CKSA 2XZ7A 2WSYA 3NUKA 4OHQA 1JFHA 2PC4A 1HUVA 3CH9A 3NSMA 3L0KA 4J5NA 4O0QA 3L23A 3OGVA 1X1ZA 1WP6A 5HNUA 5I77A 1ZNNA 5CPMA 2RH9A 1XQLA 3ABRA 3BG3A 2WANA 1TQJA 4HPNA 3CUGA 2HDJA 2QJGA 5I5RA 1TR1A 3CZGA 1VBUA 3NM1A 2DVXA 2QMKA 4Y8EA 1E55A 1JYVA 3QW4B 3WH7A 3RX2A 3S6OA 4CNOA 2I17A 2QEZA 4HHMA 1KNWA 5JMUA 2BVWA 1I2QA 1FFQA 4S3JA 5I3KA 4RV8A 3HB9A 2D1ZA 1LL7A 3GHTA 3GD6A 1RXOB 3P0WA 4KWVA 3V3WA 5I3FA 1H51A 5DRCA 4YL2A 1QOPA 1J79A 2Y7GA 1YTDA 4RZBA 4BF9A 5DO8A 2C14A 3LBOA 1AZ2A 2VFHA 5DY3A 1LUCA 5FJIA 1UOKA 5F1UA 2D22A 2ATSA 3MMTA 1E1EA 5JBEA 3EKGA 4C7FA 1UZDA 1UMLA 3A12A 2QCDB 2OXNA 2VX4A 2IQDA 3ZYZA 5AC4A 4YPJA 1Q45A 4PC8A 1AFSA 4OVXA 4JTTA 2NUYA 5CGTA 4WDWA 5HQMA 2FIQA 3HGOA 4WZHA 2XVPA 5FEPA 1KV8A 3SRFA 1V0NA 3M1ZA 4I5XA 3GR4A 4CNNA 3FFSA 2YDAA 4AEFA 3GAYA 4Q8TA 4U5KA 2BX7A 2ZC1A 4IFKA 3WBWA 2WMFA 2D0GA 4MB4A 3STPA 4X2PA 1BF2A 5BOFA 5FEXA 6XIMA 3S83A 1FXPA 3VGBA 1Z69A 1UD3A 4ZO7A 3TU9A 4IGHA 1V7YA 4BA0A 8TIMA 2H3DA 1R46A 1XYFA 3UQNA 4WY0A 1POJA 3VD5A 4B16A 3ABZA 4W87A 4UOZA 2VEGA 1QTWA 3FS2A 3Q58A 5GNXA 3TMLA 3N1AA 4JTSA 3A5VA 4AZ7A 3HV8A 4HPXA 1OQFA 4UR8A 1BVZA 3GS6A 3EPMA 4ZEPA 3TN5A 3AISA 3CJPA 2PU0A 3RLGA 3TC7A 3TW9A 1AJ2A 1GOQA 3GHSA 3KP0A 4JD4A 4JQ2A 1BGAA 1F2JA 3OBKA 2IPGA 5DX7A 4H2HA 2HWGA 3TZFA 5I03A 3UFYA 4LQ1A 3DN5A 1UWRA 3LCFA 3CTTA 1B3XA 3MO4A 3LPPA 1Y7VA 2E9BA 3STCA 4PUKA 4DZHA 2IS7A 4UBPC 1QW8A 1GK8A 3MUZ1 5EMUA 3BMXA 2DU2A 3RDKA 2QMJA 4YTUA 1JAKA 1E72M 2JEQA 2WVVA 5LIXX 5EMKA 4ERAA 1JFXA 1FWCC 2O9TA 4NNBA 1ZSXA 4IXHA 3CEUA 5K9CA 1HKIA 4AAJA 1M7PA 1UR2A 3G1YA 3NQDA 3ZXWA 1OCJA 2HK1A 4TMBA 1R7OA 1K7XA 3LQLA 3EX4A 2OSWA 1W56A 4WJXA 4RW3A 2VEPA 2WXDM 2YB1A 4LS0A 3I3DA 1EPVA 4RK8A 4G2DA 4EXBA 3EWCA 2PPGA 2XGIA 3BCDA 1PKMA 3MPGA 4QR6A 2PODA 1P48A 1GQIA 2OGYA 5H1WA 4PEKA 3G3DA 4ZR8A 1E4LA 1S1PA 1PEZA 4L80A 1ZJHA 3UG3A 3BLPX 1B57A 3PBGA 2V82A 2O9RA 3UA4A 4GIAA 1KTBA 1MDRA 3H2NA 4WGHA 3V0UA 3QBUA 3W7DA 4MWAE 3A4WA 2JF6A 4FS9A 2DEPA 1GHSA 4H6KA 2CFFA 4P7NA 2V5CA 4CD8A 1RLDA 1V8EA 3IUIA 2NVCA 4C1NA 4MWAC 4GQ0A 3NQFA 1GTEA 3I6EA 1TSIA 3BZJA 4U3AA 1VBGA 1VKFA 2OODA 5BWFA 5J04A 2G97A 1QPKA 1B5TA 3AXHA 3V5OA 1QI0A 2AQVA 3M4HA 4K8GA 2VNCA 4OZOA 3M64A 1XR2A 1BKHA 1TPUA 5AHFA 1C7TA 1KQZA 1XIHA 1UD6A 3UW6A 3MWAA 2E77A 3HA1A 3TN6A 1YNYA 1GKRA 1JZ3A 4ZOBA 4IPIA 3GXTA 5DANA 4GO9A 4QAIA 4PMYA 1TWSA 2ZRWA 3DOPA 2NVDA 2GJXB 4MHBA 1MUCA 3IIVA 4GI4A 3BAIA 1V0MA 2W63A 1Z44A 4ZODA 1LL4A 3HBLA 1KO0A 4A8RA 4GC3A 2WNNA 2YL9A 1BVWA 2Z00A 1DJIA 3KEHA 4EACA 1HJXA 2YCJA 1FP9A 1F6PA 1Q6EA 1XSIA 2FQIA 1KRMA 3URAA 1PIIA 3DX5A 2DY3A 1V0KA 2P0IA 4G1NA 3M47A 1Q7QA 1A49A 1HJUA 4PRTA 4EIVA 4HNLA 3SQSA 3N3MA 5C9WA 3VIFA 4LEFA 1K9FA 1CCWB 1CPUA 5C6MA 3GRIA 1OFBA 3W84A 1D2KA 1BGGA 3H12A 1Q5MA 5DY2A 3RJXA 3OIHA 5I6SA 2P8BA 3DDMA 4DJEA 1CXFA 1W32A 1H3GA 2FDSA 3IUDA 3V7PA 3DECA 4Q8NA 4JTIA 3ZLGA 2R14A 1AVAA 2ZZ5A 4LAKA 1X38A 5BXSA 1KBKA 4IM4A 4Q7NA 3H54A 1KBBA 1LWIA 4HN8A 5C9XA 1K8CA 4S1FA 3MY9A 1BXNA 3QC0A 1IT0A 3WBAA 3GR8A 1QWKA 2NWRA 1J8VA 1E6RA 1UA7A 3QR1A 2OLHA 2QF8A 4O18A 4EPBC 1HKWA 4WOZA 4O16A 3CL8A 3IAQA 4H9YA 2XH2A 5KZDA 4HCLA 1Q6DA 3G1RA 4BEQA 2PRLA 2HEJA 2YDSA 4CQ9A 2E6AA 3TJLA 1RY0A 3UWQA 1NP0A 4KFNA 1XBYA 2IPJA 2WMGA 1EIBA 4PRRA 2VT0A 3NOEA 4BQ2A 5I78A 2Y7EA 1W3NA 1VFSA 3ID7A 2PWFA 4NIRA 4KMQA 1B90A 3TIMA 4ZE4A 2TRSA 1TJRA 1UUQA 3LRMA 2FPTA 3GIYA 2XVNA 4HA1A 4UOJA 4PUUA 1R30A 4UFMA 1MQRA 2DH3A 3FCPA 3NL6A 1OADA 1LQAA 1WDQA 4ML9A 2BY0A 1BYAA 3ZJKA 3GIPA 3R0DA 2PDWA 4UZSA 3FY1A 2POZA 1JYWA 4F0MA 1GVFA 4M7TA 1YTEA 2WMIA 3WNKA 3LOTA 1LG2A 3QPYA 4J7RA 3U2CA 2V5DA 4XBKA 5I24A 1DJZA 4PCPA 3EEZA 2W79A 3NYDA 5JH2A 4I9TA 1EF2A 1UKSA 3PTDA 3E5BA 1XH1A 3P60A 1DPMA 1BD0A 1ZTVA 2CERA 1SJDA 2QPXA 3TJIA 2GJNA 1XI3A 2H8ZA 3B9AA 2ABBA 3PSVA 4HHHA 1EGMA 4MWAB 4AD4A 2PEVA 2PGFA 3E3HA 2XPKA 2VGBA 1J5SA 2FHBA 2QJNA 5DXXA 3WNMA 1HVQA 4S3DA 1VP5A 3BJSA 1EIXA 4AD2A 1MWOA 1F3XA 4DRSA 4A2SA 3WNOA 5EU9A 1EX5A 3PBWA 1W3TA 2FGLA 5JBDA 1U83A 1H63A 1Q7ZA 2NV2A 2WWCA 1XICA 3GVRA 3UA3A 3WQGA 1OX6A 4PMOA 3U6WA 4GZEA 1NEYA 3VDHA 1KR1A 5EMYA 2R9RA 1JVNA 1MVYA 3SCWA 1AG1O 1GG0A 1YPIA 4MY1A 4U2YA 4UIOA 1XGEA 2RGLA 2GQ8A 2WCGA 2GVJA 2WHKA 3C6CA 5HULA 4QGCA 2Z1XA 2V69A 3FJLA 3S5NA 1FWJC 1XDMA 3AZSA 3N2XA 4QAWA 4FI4A 4DF1A 2J7CA 1ITUA 3CC1A 3GW3A 2C0AA 1XIFA 1ZRQA 3A9IA 3QM3A 4LUSB 2CLOA 1LT7A 1Z8AA 1JPIA 2VM8A 3N14A 3VOCA 4JTLA 1QNVA 1ZP4A 5DRIA 2ZXQA 2PCEA 1T8QA 2ZRYA 4O17A 4TTGA 4FF5A 1G94A 4R53A 3KW3A 2J9XA 5A6BA 1XLKA 3M46A 1V3KA 1JI1A 2NZLA 1FHDA 3ATYA 3T2OA 1A5CA 3VGGA 1RK6A 4DBSA 1UMYA 3FX4A 1EEXA 2A7PA 1G01A 4H9TA 1QI5A 3EWBX 2Y8KA 1JEZA 4XBJA 1JQXA 1ISXA 3GNPA 3W85A 2Z1SA 1B4KA 3LRLA 2WNWA 5E5CA 2OZ3A 3NQMA 5HNNA 2VP8A 1C91A 1BEUA 3B8UA 4RZ6A 1HO1A 1H7XA 3B04A 1UD2A 3WD4A 3A24A 4WDUA 1UPPA 2HBXA 1TZ7A 4H8UA 3URBA 1Q8JA 4EWND 1UD5A 4EF9A 3T8LA 2OJPA 4P2VA 3M6DA 3AROA 2Z1VA 1S2UA 3M5ZA 3MMUA 4NJHA 3AIVA 3W2NA 2NSOA 3W6MA 2FVKA 2PGWA 5I3GA 2J66A 1W5OA 1F74A 1X98A 3FXYA 4QJ4B 1T0OA 3P3BA 3UU0A 5I3JA 1AMKA 4J35A 1OCBA 2PLKA 3DKJA 4QCFA 4BI5A 4LC8A 4ZQRA 3VM7A 3Q65A 2FZMA 4AU0A 5ENLA 4IMGA 3AUOA 3PZUA 1JQVA 5FI8A 4JN8A 1Y5XA 2XTKA 1I0DA 3CUXA 1E6PA 4JL1A 3WBYA 3IJIA 4AF0B 3WNPA 5LZLA 1A5OC 3ZT6A 3LRKA 4FK9A 4TOQA 2NLYA 3W7KA 4O0ZA 5A2BA 1VPYA 4WUIA 5DBUA 5F4WA 1XP3A 3HOJA 3SSZA 3PTMA 3UXAA 4NAEB 5IXEA 5C2GA 6REQA 2WOQA 3CWOX 2O56A 1DP0A 1O5QA 4EXQA 2ZX8A 4JX6A 2O4QA 5U4NA 3H26A 3DFOA 3MUAA 4PTXA 1XBXA 2V3FA 4ZOCA 3VMOA 3VNLA 3WK1A 3LI1A 3C2FA 4WXZA 2Y63A 3L5AA 2CZFA 2C1GA 4JIQA 4PMQA 4AMCA 3W1RA 4RNFA 1RQEA 4UQ9A 4XAZA 3MS8A 1CXHA 3OLEA 3N4AA 4V33A 3CLWA 4O4VA 5IDIA 5D2XA 5K4ZA 3NCOA 1DE5A 1LWJA 2NQ9A 3KZPA 4I3GA 3NDYA 3RR4A 3OBAA 3CHDA 2FMOA 3F4NA 1HNYA 1M01A 1K4HA 1U22A 4HMCA 5A8GA 1H7RA 3B0UX 2FH8A 1TR9A 2NV9A 1ADSA 1GTHA 3WH5A 3FAWA 4US5D 5IHSA 3AWNA 5CG7A 1H50A 4D6IA 2ZFAA 3W1TA 2E67A 3ZJ8A 4MJZA 1XLCA 4DJDD 3OLDA 2Y70A 3RR1A 3W7NA 1FDYA 1MXDA 4XO7A 4EXAA 3BQ6A 4PUNA 1EXBA 3VKJA 4XV0A 1S3HA 2XSXA 1P6CA 3CGTA 4AB4A 2RDWA 1ZQ5A 1XCXA 3VK5A 4TR9A 4Y9PA 3TYBA 3VGFA 4QFUA 3W1UA 1I9CB 1PS9A 3PB2A 1EHNA 1SW7A 3EOLA 4QS5A 2ACQA 2GVYA 5KMYA 4F2TA 2OLSA 1OK6A 5KZ6A 2GGHA 2YCEA 2R1MA 4DIAA 2VGGA 3EXTA 2BVYA 2CBVA 3BZGA 3CB8A 4F8XA 1H4PA 3QV7A 2PAJA 1U2YA 3O6CA 1K3UA 2JF7A 1V6XA 4Q8WA 3BV4A 1KC7A 1XUZA 4UMCA 2W5FA 2CKRA 1KXQA 3M7WA 4EE9A 1P7TB 2X1TA 3UBPC 4F2BA 1XLEA 2FGBA 4GNJA 2BODX 3WJYA 2G4JA 2G3MA 2VJXA 5CPNA 3PM6A 1WZAA 4DY1A 1OC6A 3PTKA 2GWGA 2BZNA 4ICNA 5CPTA 3IACA 4JNZA 4XD3A 3IPWA 3GG7A 4FO4A 3UWYA 4HIBA 4GMEA 3ITGA 4IJBA 1VLIA 1FWSA 2PDHA 5C7HA 3S3GA 1UWSA 6A3HA 4XD6A 1IE7C 2BG5A 2YR1A 4ZL1A 3L12A 3KAOA 4J1OA 4QX4A 1NWTA 5A95A 3GNOA 6XIAA 1N8WA 3FA4A 3LG3A 1DL3A 3ARVA 1W3KA 4ACZA 2DZXA 3VU2A 1W1IE 4JX4A 3CZEA 2Q71A 3ARRA 4AY7A 3O16A 2VX6A 3HQNA 3TFCA 1EJSC 1Z9AA 5DFAA 2Z1BA 3G22A 3P67A 1MDLA 4NF7A 1ENUA 5E0CA 4M82A 3PBYA 4K8HA 2YYUA 4GHRA 2AAAA 3FDGA 1B3VA 4H6QA 1TV2A 1ADOA 3FEMA 1BSIA 1DJHA 3W24A 2EJAA 1TWWA 1K9DA 4UFIA 5T8GA 1EYWA 3VDGA 1EDTA 1ICPA 3P2VA 2PURA 4OOZA 2HXTA 4W7UA 3UWZA 1SZEA 2Y1HA 3FA3A 1UW9A 4NASA 1PXGA 3BURA 4O14A 1WQ5A 1YIXA 4CLMA 3AMLA 3EGJA 2JFEX 1OF8A 2IPWA 2QR6A 1Q6GA 3LB0A 4PGLA 3SCNA 1E15A 1HJSA 1MXGA 2XFYA 3NWRA 4UUIA 3TWAA 3KOXA 3LHYA 3DERA 4M19A 1QOXA 2OB3A 4OGZA 2V3GA 4C6OA 3LTYA 1Y5VA 3DC0A 3NZGA 5BCAA 3K8MA 4HP5A 1G4EA 4HA4A 4KGJA 3UETA 3IANA 1AQHA 1UH2A 1XYBA 5FCZA 1E70M 2Z6JA 3I7QA 4TVUA 2QLYA 2O7SA 3LEPA 1LQ0A 3HGRA 2VOTA 5CQ1A 3A6OA 4MLRA 2RJHA 3W76A 1EEPA 2TMDA 4DXVA 3RHGA 3LCWA 4AWEA 4R34A 1GVEA 5BWAA 4G5DA 4DVOA 4S2CA 1AL8A 4GFSA 3SGUA 3OQ8A 3OG3A 3BGJA 3ARZA 3N3TA 1E9LA 4OFCA 3CUFA 3WL1A 3IGSA 4Y7EA 1N7KA 4N6FA 1Z32X 1QNQA 4IP4A 3TWBA 4C65A 1DV7A 5FF3A 3Q37A 1XXXA 4GINA 2FHCA 1MI3A 1G1YA 5JBFA 1ZJAA 5C70A 2WLZA 4OUEA 4NG3A 1UR9A 3GB6A 4WKFA 2Y2WA 1U5HA 4GCXA 4HPJA 1O6IA 2BGQA 3EB3A 4IFKB 2NX3A 1CLXA 3ITCA 1YDVA 1WXZA 2V2HA 3JU2A 3AU2A 3DI1A 1DXIA 4FX6M 1QMLA 5A6SA 2NX9A 3L4WA 4E4PA 3A5FA 3U5UA 2PLMA 5EMMA 4ZB5A 5EKYA 1XGZA 3TA6A 4NXKA 2C19A 1DWGM 4I7WA 1UP2A 1HT6A 3QOMA 1XHGA 1CBGA 4JX5A 1FWIC 5EBAA 3HG5A 2CLMA 1J11A 1FOBA 3UNTA 5HMFA 3IJLA 1OABA 2J75A 1IR2A 2CBJA 1PTDA 4A3QA 1LRTA 4LEQA 3W7LA 2RJGA 1JZ8A 4XZLX 4ERGA 1FH8A 4AIOA 2A2IA 4G1KA 2VQUA 3IARA 3NEHA 5LXEA 4IP7A 1O5KA 4K7VA 1J0IA 1VFMA 3ZT7A 4F0KA 3WQVA 3CL6A 2IQTA 1R9XA 3QPZA 3ABXA 4UQCA 2O0TA 5BROA 3SAZA 5G4HC 3GK0A 3HV9A 1RJQA 3C4UA 2WCAA 3N4EA 5J8LA 1UZ1A 1L6WA 3LMZA 2X1IA 3K46A 5ECUA 4WEVX 4GGBA 3H2OA 4P8VA 4HPGA 4GACA 1HW6A 4J3UA 1KLZA 4ZFMA 4PL1A 2AQOA 3UR8A 3YPIA 4JOMA 2VC7A 3VAVA 1WDSA 1TB3A 3A13A 5KZEA 2J6XA 4RL3A 1OYAA 4OJYA 2G3JA 2V3DA 5E0FA 4JTEA 3LHUA 3A4XA 1GCYA 4IMCA 3QQ1A 3LXBA 1B0IA 5TBOA 1KRBC 4J3XA 4FIQA 2D3LA 4JN6A 1FWTA 3B8VA 1H11A 2FZNA 5EY5A 3M0VA 1RY8A 5PTDA 4XIAA 4H7CA 8CGTA 2PU1A 5G2IA 3WJZA 2CEQA 2ADAA 3W82A 1D3CA 3NQ2A 3UD6A 4MPQA 5D32A 2JE8A 2HTMA 5AKQA 1EUNA 3SQLA 3EOSA 3NVTA 3CV6A 4YTQA 4H4IA 2ZA1A 1ZAIA 1RPKA 3P81A 1RR2A 3S9ZA 4CU8A 3ONBA 4AVFA 2EPNA 3RCYA 3U48A 3HMJG 4XZWA 4FOKA 2GSEA 3TN3A 5HANA 5I06A 1VRDA 1JAEA 1XYMA 1P1XA 1DHPA 1F3WA 2G4FA 3OJGA 5D04C 1TCDA 3W2KA 4Q8QA 3ZVHA 3SIMA 2VDHA 4QM1A 1C8XA 3PG9A 4LFYA 2ISDA 4L6OA 5M1TA 2ZZ7A 3RMEA 3WDQA 4LVBA 2YCLA 2BY2A 2MANA 2X40A 3GKFA 1VFOA 4AUBA 1RV8A 3PZ9A 1LBMA 1XV8A 4FHAA 3SEPA 1SFTA 4O54A 1GOKA 1VENA 1FWHC 2DZUA 5F4XA 1PIGA 2R82A 3CS2A 2Z29A 5KEZA 2GDUA 2PDQA 4KPLA 2VZTA 3HN3A 2VR4A 1BRLA 3T55A 5J5RA 5HNRA 2X8RA 4TX8A 4Q4QA 1TX0A 4DXXA 5FEZA 1UWAA 4IQJA 1YLVA 1N82A 4XQ6A 3BICA 3EBVA 4PTVA 1SR9A 3F5KA 3IWPA 4QNEA 1J4EA 3E0WA 1H60A 2V2CA 1WOAA 4DUWA 4ZB2A 1W9BM 1UQZA 2F2HA 1B2YA 3KP1A 4M29A 4PCFA 1PZ1A 3IJDA 3AO0A 3L4VA 1SFLA 1WBHA 4IIGA 2DH2A 1OJXA 2F38A 4FPSA 1J18A 1UCWA 2Y89A 4NXSA 4EAMA 1W2VA 4WDXA 1ZAJA 3U8GA 4JKMA 1JDAA 4AX7A 1FQ0A 3MKKA 4QIUA 3TNOA 3GX9A 1XYLA 4CD6A 5FA5A 1W0MA 2X30A 4E4UA 3AZRA 2XM2A 3RPMA 3GH4A 2F84A 4GQGA 1S5VA 3BMWA 3L9CA 5CZKA 2UZ9A 4TUFA 4FR1A 3HQ1A 3AS3A 3ARUA 2YXGA 4JFVA 1QNSA 3OVPA 1HX0A 3N13A 1OD8A 4DUXA 2J77A 2C13A 1RJRA 3ABOA 4ZQPA 1LOSA 3N73A 4LF1A 4D8LA 1V5XA 2OQHA 1MUMA 2OMAA 4IMEA 2WSRA 2PTWA 3UXKA 3UZWA 5HWNA 3WD2A 3KRSA 2BTMA 2ATMA 3GYEA 2TSYA 2MNRA 3EPNA 4GO8A 4M56A 4Y90A 2REQA 1A0CA 5BOEA 4E5TA 3MANA 4PODA 4V2XA 1UWQA 3BXWA 3KFTA 1H09A 3S9IA 3QVQA 2F6UA 1EZ2A 3BLIA 2VKZG 5H8PA 2CXGA 3REQB 4L5ZA 3HZ3A 1NDZA 4AYSA 4C6QA 2O55A 1OWQA 5K4XA 2PFHA 2WHLA 4ADTA 4MY9A 5FSDC 3MYPA 3VABA 4Z42C 2ZBTA 4FX7A 1ZCOA 1K70A 4DZAA 4DI8A 1ZUAX 1EQCA 1CEOA 1LT8A 1QT1A 1DIOA 1A80A 3MTWA 2OELA 3GXNA 4D9PA 2DORA 1QI4A 2NVAA 4LRTA 3O6DA 2OKTA 4IQLA 4JEQA 1QPRA 1ME8A 2BLEA 3IV3A 5C54A 4E8DA 3W7EA 2WMIB 3I7SA 3H21A 3THCA 1OCNA 3XIMA 4E2OA 3WMCA 1V79A 2PDCA 4J3VA 2VRKA 1S5TA 2C71A 2ACSA 3ZIZA 3RGTA 3CEPA 2V5JA 1POKA 3LSCA 1WB0A 4OECA 2ZUWA 3AMGA 2GZXA 4H19A 2XWDA 1B9BA 3SRDA 4QS6A 1E6XM 1K02A 3M16A 2CETA 1M3UA 3N25A 5HUOA 2GGGA 3VUPA 3EWXA 2ALDA 5CBIA 3VNJA 3EDJA 4PMXA 3B0YA 5CGMA 2INZA 5A2CA 1TPDA 4FX8A 3UJEA 4Q7IA 1H1NA 4N4PA 4OV9A 1NFGA 2WSQA 3LI0A 5CGQA 7ENLA 4BK9A 3VGEA 1DJGA 1KKRA 4DF0A 1ODUA 5I3HA 2J24A 1LF1A 2AL2A 4ALDA 1J12A 4NU7A 3WF4A 3NQCA 4Q7BA 1UH3A 2W61A 4FLOA 2Z2BA 3TJXA 2BNJA 4HHPA 4JTUA 3H23A 4U2ZA 3W29A 1QAPA 4E3TA 3LPFA 1ZALA 1LTDA 3M7SA 1O12A 4LX4A 2OVLA 4Y2WA 3BH4A 4DLFA 3DFSA 1XG3A 1J6PA 4GY0A 4B3LA 4D8AA 4WR3A 3GBEA 3CT2A 3EXSA 3GHRA 3MJYA 7TAAA 5CH9A 4DUVA 4HK6A 1R2TA 2JKPA 4WX2A 3B05A 3NYZA 4AD0A 1OGBA 2DDXA 4YWIA 5D37A 2OTDA 3SCOA 3MMWA 4IGNA 4HU8A 1OFAA 2WW5A 3ARYA 1KGXA 3H53A 3QTGA 3LBCA 1FWDC 4JIHA 4CD7A 2PB1A 4IG2A 2VX5A 1SO4A 2WB5A 1CNVA 3HGSA 1OGSA 2HE8A 2OZ0A 3TSDA 2J9ZA 5ABFB 4L1WA 2FTPA 1ITCA 4IISA 3V1PA 2OWCA 3SQMA 1J9YA 3PVFA 3BLLA 1D7KA 1JNDA 3EOUA 4ZOAA 1YNQA 4HJWA 3O05A 4QG8A 3SBFA 2J47A 1V3MA 1UP3A 4QDWA 4LUIA 3W83A 2XIMA 5L9FA 3CIVA 3OLIA 3GUWA 1XUUA 4KBXA 5C0QA 3NDZA 3WDRA 2E6DA 1XINA 2H3BA 2QCNA 1VLWA 3MCOA 5A6TC 4O8RA 1JPKA 5A6LA 1IGWA 3COTA 3W7JA 1TA3A 3LM7A 1EWDA 2C16A 4Q22A 5IHRA 3BGGA 5HXMA 3UPMA 3TW6A 4J2PA 5U7SA 1AA1B 3V5CA 3ISIX 1L6YA 3UT0A 3VIOA 5KITA 2X09A 2B31A 2XU2A 3LLDA 2VYOA 1FHUA 3VCRA 3SUWA 4DM2A 3WLQA 2VWTA 3H4WA 3IJ6A 3WEMA 3VE9A 1V3LA 3M43A 5A8NA 1F5ZA 3ZR5A 4BF5A 2ZZ6A 3QQ0A 4LAOA 4BQ5A 1O5XA 4XO6A 3V4BA 3AIBA 1VC4A 4ATDA 1AQFA 1W2PA 4M7SA 1QPNA 2YKKA 1GVIA 1NF7A 1X96A 4MMWA 4CD5A 1IF2A 4J4KA 1O1ZA 5CSYA 1JIBA 2D23A 2GJRA 2HNEA 2WQDA 3IK4A 3VOHA 3ZZ1A 3WBEA 5LSMA 3MT1A 1FWRA 1YXYA 5HMSA 5FACA 1HL2A 6REQB 2J8FA 2W6RA 1F8IA 3O6YX 1XCWA 1MNSA 1SW0A 4M6VA 4AVNA 4NP7A 4HNUA 3KCOA 1XYZA 2BBFA 3KOWA 4GYPA 1AK5A 5HWMA 3ALFA 3WY1A 4DYKA 4X0NA 2WZEA 4LUTB 5DEZA 2WC7A 1TTJA 1V3JA 5I23A 4HHLA 3BOXA 4NNAA 1B31A 3PJTA 3QFWA 4NZ4A 4A6GA 3MO7A 3LV5A 2EHHA 4UQBA 4IT1A 3WUBA 2QDHA 4KRUA 3L2IA 3MYOA 3GSMA 3RM8A 2HPIA 4DJFA 3W3OA 3BG5A 3QV9A 3PPCA 2I7GA 2YLLA 3KUMA 3ECQA 3UG4A 4JY9A 1TMHA 1EXPA 4OIFA 1EKOA 1ISWA 2C8NA 2QKFA 3IVUA 2HMCA 4LNYA 1IIGA 3G0XA 3NA8A 4IL2A 4S3KA 3GG8A 1TVLA 1UIOA 1V93A 3E2VA 3GVGA 1ZP3A 1HTIA 3WLSA 3QFEA 4DWDA 2KAUC 4JQAA 1R9ZA 3S6TA 1QBAA 4B5TA 3OZMA 2QJHA 1SMAA 3ZM8A 2YGYA 1W54A 1IXPA 4CU6A 1FHVA 4AX6A 1PHQA 4CQCA 5AYIA 4L4OA 3BANA 5J5DA 4ZQMA 3P61A 3H2CA 4GUIA 3WEOA 3DAQA 3IJ9A 3ONCA 2Z25A 1FRBA 4IJRA 1XPGA 1YDYA 3HIJA 1O94A 2WMKA 3GG1A 4GA8A 3RIKA 3R6IA 3HFYA 4Z1AA 2JIWA 1W5PA 1PZ0A 3GU1A 4FNQA 4C6MA 4H01A 4XTDA 3F4DA 1HL8A 2A6NA 4AHPA 1E4IA 1HP5A 1GVOA 4FXRA 5D2YA 1JUEA 2Z28A 2CXEA 4F2UA 3W7IA 1CLVA 3CYJA 2OCZA 1UC4A 3PZIA 2X05A 4XKYA 3TYCA 4A8LA 4PCTA 3LS9A 2NQZA 3JS3A 4B5VA 1LOQA 2GGEA 5HQEA 3SIZA 2QCEA 1HKJA 4AC7C 1WNOA 4ZSTA 2Y88A 1MQQA 1QBBA 1QRQA 3TYZA 3F5LA 1LZOA 1BF6A 4I5UA 3FJ6A 1TPEA 2BY3A 1JZ5A 2ZX7A 3THDA 2ZTJA 3VOJA 1GJWA 1XLAA 1M65A 1AUSL 2AKZA 5F2IA 5JH1A 1SVDA 2YL5A 3N17A 2X1SA 1P0KA 4AZ5A 2PP1A 1IXQA 5HQLA 2GUUA 4X61A 3AZTA 1K1DA 3WLKX 1E1CA 1T8XA 3EWUA 3BMVA 3WQEA 5CPSA 1UR1A 1ZPTA 5E70A 4JDBA 2ZRZA 2CYGA 3A4JA 5D33A 4CN1A 2XINA 1TE6A 4CEUC 4LJ3A 4JIRA 3UVAA 5DCEA 3KOYA 4NZJA 1R86A 4PB5A 1XLLA 1PV8A 2VDIA 5HDRA 4JY8A 3KBSA 1EWEA 1X7IA 2PGRA 1YE6A 4DWSD 4IQDA 3PZGA 3EYPA 4WSJA 3T42A 3STGA 1UA3A 1J93A 2J8GA 2PDXA 1L2UA 4E8CA 1WYIA 2E1DA 1IWPA 4B2DD 1LQ2A 1PCWA 4X22A 1NELA 4N9CA 3P84A 2PP0A 2X0SA 2RDXA 4UFLA 1VRXA 5HUPA 3MQTA 3H7UA 4IWWA 3ARPA 1W3IA 3S9YA 4JXCA 4D6JA 4QLLA 1JR1A 1MRQA 2XH0A 4EANA 2HNHA 1RHCA 3UPWA 1XIJA 4GJ1A 4JYEA 2P1FA 1IV8A 2ZDRA 1QASA 3LCXA 4PL2A 7A3HA 1JF5A 1NJJA 4LSBA 1K8ZA 5T26A 1WKEA 3WEZA 1Q4WA 3HPXA 2TODA 3QKZA 4UTWA 5XIMA 4WKAA 1BG4A 5LA0A 3ABSA 4EX4A 4QXIA 5I0DA 3PAOA 3OHMB 2XFWA 3TH6A 3VA8A 1PJ9A 4RNJA 1T99A 3W27A 4YCPA 1I75A 3VUSA 1TJ0A 1M7JA 3AHTA 1HJWA 2PWUA 3FW6A 2VOMA 4YIWA 4NRRA 2QNEA 2A3BA 2H6RA 2VEMA 3NQBA 4M51A 1TJ1A 1UPMB 1EJTC 4N4QA 5CJ5A 3NEVA 3WL0A 1Q2SA 1Q6QA 5H91A 4H9XA 1YE4A 1JCMP 1J5TA 1HZYA 1H5VA 3ARSA 4Q4MA 1A5NC 2VTFA 3TTQA 2WJZA 5E6YA 2PLJA 3HG2A 1E56A 3HPSA 3M44A 1XM3A 3E2QA 4F0HA 4JTRA 4D1JA 3R10A 4UMBA 1J2BA 4MF4A 4CN4A 5AYXA 4JKKA 2FDMA 3R25A 4H2CA 2CC0A 3U9IA 3GDTA 3TROA 3HU7A 1NWSA 3LTPA 4C5YA 4RR4A 1B54A 4L1GA 3WQDA 3WFLA 4LBSA 1F6YA 2XN1A 3MSDA 5CC5A 4YVVA 3V0TA 1LP6A 2A3AA 3PPFA 3N11A 1NH6A 4HA3A 4D6FA 1FUYA 2W91A 2F8QA 5KTLA 1XF0A 2QQ6A 4IGMA 1VHNA 2IKHA 2A6LA 2V81A 1KBLA 2PBOA 1CI1A 2F7FA 4A8NA 1VEOA 3OZYA 3W26A 5M2FX 5XIAA 2QUVA 4MLJA 1V7AA 4GQQA 1PTAA 4QRNA 1ZFJA 2PDKA 3GU2A 3PG8A 3B0XA 1WOBA 4NKCA 2HXUA 3RLHA 5HK4A 3E0FA 3GZAA 2X1RA 1I60A 3G6MA 1G5AA 4W8LA 1C9WA 1QI3A 3IS4A 1QK2A 3S0CA 4G56A 4HA0A 4MPKA 2RHGA 1E9ZB 5JIWA 3RNDA 4I90A 5DT7A 2D2OA 2ZE0A 1KM6A 5H8UA 1F8MA 3CPRA 3AMKA 1TREA 3E38A 3B4YA 4P8XA 3C61A 3N2CA 1GHRA 3P0XA 7REQB 5C2XA 3WUGA 4CUCA 4KH2A 1XRVA 4LUJA 2YOCA 3QYQA 3SZ8A 4HSOA 2QT3A 2Z2UA 3H55A 2YXXA 4KESA 4W9TA 3BDKA 3NFUA 2YA0A 4ZENA 3DBPA 2E9LA 3S2JA 3AHXA 3R89A 2Z0IA 4OT7A 1AD4A 1JCYA 2BASA 4GJIA 2OO6A 4C6LA 3ZSSA 3EDFA 1JGIA 2FJKA 3UCCA 3N04A 1M68A 1JJKA 4QHRA 3GDMA 3MKVA 4N0RA 4JPGA 2V9DA 2RFGA 4LU0A 3URQA 4KRZA 2ZTKA 1TRIA 3F2DA 1KFBA 2WKGA 1QJWA 3IIPA 4INFA 3S42A 1ZBVA 3WLHA 1JUKA 3CM4A 1UR0A 4C6JA 4ROQA 4NL1A 3LERA 2CNCA 4P7RA 4DBEA 3FNDA 1REQB 3N15A 5FOOA 3TK7A 3LUTA 3N9KA 4YTRA 4H9VA 2IQ0A 2XVGA 3AQUA 2V5KA 2Y0FA 1GZJA 3LHTA 2WC4A 1XC4A 3F4CA 3TLLA 2QHAA 1EJXC 9XIMA 3UNDA 4HMNA 1TMQA 4F40A 4K7YA 3QR0A 4PBEA 2NV1A 2GUBA 3NR0A 4GNVA 2D2HA 1EH9A 1VB9A 2GDVA 3RJYA 4UWMA 5EGRA 1A5BA 3BAJA 3UCQA 5AB3A 3U2ZA 4HZMA 4PTNA 4YU1A 1GEQA 2FTYA 4RUBA 4QDPA 1NOWA 3WZ0E 4JEJA 4B9YA 4GPNA 4MADA 1B3WA 4MM1A 3LNMA 1HGWA 4NJKA 5DMLA 3FAXA 4FR6A 4MZ8A 3TTYA 1SSDA 3MUIA 5H8MA 4C1KA