4WD0A

Crystal structure of hisap form arthrobacter aurescens
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
242
structure length
230
Chain Sequence
QSVLELLPAVDIVDGQAVRLLETSYGTPLEAALNWQNDGAEWVHMVDLDAAFGNNAALISDVVSQLNVKVELSGGLRDDESLERALELGVARVNLGTAALENPEWTRKAIDRFGDKIAVGLDVRGTTLAGRGWTKEGGDLWEVLARLEDAGCARYVVTDVTKDGPNVELLRQMVEKTGKPVVASGGISSLEDLRVLRELVPLGVEGAIVGKALYAGAFTLPEALDVAGRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneam
publication title Crystal structure of HisAp form Arthrobacter aurescens
rcsb
source organism Arthrobacter aurescens
total genus 72
structure length 230
sequence length 242
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2014-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4wd0A00
1PS9A 3PBUA 3TR2A 3AJXA 4IXXA 2P1FA 3N9SA 3GVGA 3EX2A 4NJHA 4IMGA 5K4XA 2HS8A 3E0IA 4AHOA 4K39A 3HPZA 4M6VA 1X6UA 1K02A 5AFDA 5KMYA 2WKJA 3QPYA 1M5WA 2OT0A 3N2MA 1SSDA 3OBKA 5L6UA 1W5MA 2NWSA 3W7PA 3QSRA 4ZQRA 3EXRA 2PCQA 3ZFHA 1ONRA 1G6CA 3RLUA 3W86A 5BNKA 2CFFA 3RFAA 1TV7A 3FKKA 2VELA 4UTUA 4MY1A 3FYOA 1H63A 2TYSA 4LRTA 3C3NA 3PS7A 1OFOA 3LLDA 5K2ZA 2Y89A 3MHGA 3LHTA 1XBVA 3PC0A 5LNWA 4AWTA 1O60A 4IX0A 4LVBA 1QPOA 2G96A 1SU5A 3W1UA 3NPUA 3OVRA 4O1BA 4UMAA 1KW1A 4C1KA 4TMCA 1EUNA 3UXAA 1VRDA 2PRLA 2YR1A 1ZHAA 4JTLA 3H54A 2DU2A 3N34A 4U28A 2G97A 5HJLA 3WJWA 1VH7A 5F2IA 2Q8ZA 1SFLA 1H1YA 4OV9A 3L9CA 4S2CA 3TC7A 1H7NA 2XN1A 3LXCA 3OHIA 1GQNA 5CZ0A 1Z42A 5SWUA 4DPQA 3G1DA 1LRTA 2FPYA 2P0OA 3LHUA 2QAFA 5HUOA 1D3GA 2BXVA 2GUUA 2CLEA 3SI9A 4BWLC 1THFD 1JCXA 1GEQA 4HPXA 4OU1A 3WK1A 4BFAA 3MBFA 1K8XA 2OCZA 1LRQA 2CLIA 5CKSA 4JDYA 4MLRA 1VZWA 3BGGA 4UMBA 3M44A 1FXQA 4Q32A 3NQ6A 4GFSA 3S6DA 3BV4A 1MEIA 2QDGA 3Q58A 3PG8A 2DZWA 2EF9A 1KTCA 3T55A 5D2VA 4R7JA 4IMEA 4JYDA 1R47A 3LHYA 4ORMA 4W9TA 3IIXA 1I45A 1TIMA 2YGYA 3IVTA 2GJNA 3GDTA 3JR2A 5G1TA 4NU7A 3NQFA 1Z41A 2TPSA 3UWYA 5E93A 4LUIA 3HMJG 1FWRA 2Q3OA 5BOOA 1KFLA 1ZAJA 2XFWA 1ICSA 3T4CA 1T96A 3E96A 5HINA 3P80A 1H7WA 3NQDA 3HBLA 3C56A 4K7VA 3EKZA 3G1YA 1LTDA 1W54A 1XDMA 2W0UA 5DBUA 2CWNA 4PFMA 3TSMA 1DV7A 3SSJA 4Z0JA 3QW3A 3MP5A 3AO0A 3CEPA 4NNAA 1ZFJA 3CIWA 4DEFA 4BWLA 3FYPA 3S5YA 4MFEA 3WFAA 4CQAA 3DH7A 1YPFA 1BEUA 3I7QA 3OEXA 4N9CA 4MVAA 1O5KA 3ATZA 1OX4A 1XUZA 1AK5A 4EIVA 1XBZA 1O5XA 1M7OA 3W7EA 3L2IA 2QF7A 4Z1AA 1DL3A 1TSIA 3QF0A 1KV8A 1ZAIA 5D2YA 3CU2A 2QJHA 1BWKA 3P82A 1KFEA 3CLMA 3H55A 4YL2A 2NV2A 3C2OA 1TTJA 4DELA 4UR7A 4IGHA 1NEYA 3KOFA 3TMQA 3LX9A 5C5YA 3CHVA 3B05A 3B03A 4I9AA 3WJYA 1SQ7A 1ZY9A 2CLMA 3DKLA 3HG5A 1NFBA 4FIQA 4NQ1A 3W07A 4CCEA 3TH6A 4EWND 5J5RA 2X1TA 1BKSA 1IF2A 1L2UA 2FIQA 3W1QA 4NVTA 1QWGA 4U4MA 3FEMA 4WD0A 5FEZA 5EPDA 2NLIA 1ZENA 3S5OA 5CZSA 3UWQA 3U2OA 3LOTA 1QCWA 3W72A 2HS6A 4C1LA 1DORA 3IGUA 1DHPA 2WSRA 1ZCOA 4H6KA 3TCEA 3B4UA 3S9YA 3O63A 2NX1A 1TPB1 2ZA1A 3HOJA 3LTYA 1Q6OA 3KRZA 3S5NA 3TXVA 3NL5A 2O7SA 3SFKA 3FKRA 2NUYA 1S3HA 4O19A 2CLOA 2C16A 4JX4A 1AMKA 2WNZA 2Y88A 4JTSA 3OVQA 4GWEA 4UFHA 1UCWA 3E02A 4WOZA 4LWWA 3EX6A 5AC7A 3LCXA 3EWXA 4UC5A 5LNRA 1F2JA 2V2HA 4JX5A 1FCVA 3SJ3A 3OA3A 2G5WA 2RFGA 3P81A 2GQAA 4DBDA 2B0MA 1EP2A 3L68A 3B04A 1S5VA 3P7YA 2DZVA 2CZEA 3WJZA 4PTNA 3L5MA 1PV8A 3L21A 4JTEA 1FQ0A 2YPIA 5D2WA 3BLFA 2V9DA 1Q3NA 1LDCA 1L6SA 2E5CA 4JTHA 1FWSA 1VYSX 4NNBA 5I3JA 3P84A 2VFFA 1KM2A 3W7CA 3LRLA 1EPXA 3TW7A 2EKCA 4HNNA 5AHMA 4JYEA 2I14A 5KZDA 5LZLA 3ZR4A 1YTDA 4O11A 3GDMA 5FEWA 1PCKA 4UTIA 1GZGA 1QOQA 3HF3A 3OVPA 5CPMA 3KVKA 3U6WA 4YWIA 3M9YA 4XTDA 3EKLA 3LCFA 3PBWA 1RV8A 3USBA 2ZRYA 3TXZA 4ZQPA 6TIMA 3DFQA 1W3IA 1B4EA 3IVSA 1HUVA 4LV4A 3F4NA 2C18A 3KX6A 1MO0A 1YADA 4YLWA 3T78A 3QM3A 4G1KA 2ISVA 1Z48A 3T44A 4DF2A 4WY0F 5F4WA 5KSWA 1A5AA 2RHGA 2BSLA 4OQVA 1L6WA 1YPIA 3NQ8A 4JEQA 1O4UA 1SZFA 2YW4A 4EOUA 4E0CA 1YDVA 2VC6A 5G5IA 2Y70A 4MJZA 4OWGA 5LNVA 3PY2A 4O0ZA 3W7QA 1ZNNA 1R2TA 4Z1BA 1QDSA 1GYNA 2BWGA 3W2MA 2ZZ4A 5G4EA 4AB4A 1OK4A 4AH7A 3P8JA 4JTKA 2GQ8A 4UTTA 3QQ0A 5LHEA 3FFSA 4HPJA 1MEHA 4GJ1A 4BI7A 1JR1A 1SUXA 3UYCA 1ICPA 3NQVA 3MWAA 4Y90A 3UPWA 4N4PA 2HTMA 1Z44A 1H1ZA 3NNTA 3GKFA 4A21A 4FNSA 3A24A 1IXQA 4QISA 3R13A 3O06A 4TX9A 2H6RA 3CB8A 3LXBA 2CZDA 3LHVA 1YTEA 1IIHA 4JTTA 4ZQOA 3W85A 3W1XA 1KM5A 1U83A 4ADTA 3F1QA 5AYYA 1WV2A 3NZRA 4ZVJA 3TSBA 4IXHA 1TO3A 3DHFA 3FIGA 2FB2A 4Z0SA 4O8RA 5DY2A 1WX0A 1TPH1 2QKFA 1WQ5A 3QMSA 2JBMA 4RJEA 3GAYA 4O10A 1VCFA 2NX3A 4MKNA 1JVNA 1Q6LA 5D38A 1X8FA 1NSJA 1B57A 1W5QA 4NUWA 1H7RA 5G4WA 3GXPA 4LS1A 4JD4A 1A50A 3P74A 3BVJA 3GLCA 2EHHA 4UR8A 4L4MA 3LV6A 3CWNA 2ZDRA 1K03A 3BLEA 4ADSA 4R53A 4JGDA 4POCA 4FF7A 3MI6A 3G3MA 2X1RA 5AB3A 5FF3A 5EA9A 4QAIA 1Q45A 2ZZ3A 3VE9A 1NF7A 4ONVA 4EF8A 3FJLA 3L0NA 1JRBA 4YXGA 4WY0B 2VEPA 1PCWA 3MHUA 3MI2A 1FWTA 4LVFA 1VC4A 1D9EA 1C8VA 3W1AA 4FX6M 5FEPA 1GVOA 1HG3A 3N2XA 3RK8A 2C6QA 1DJNA 3G1SA 1IXPA 4O18A 4JTJA 2QCHA 1W1ZA 3TNOA 2QUVA 3IIOA 4M5PA 1W8SA 4FNTA 1T0OA 3W1RA 3W7HA 2VENA 2RH9A 3B0PA 2JKPA 5C55A 4RV8A 1F74A 4UTJA 4O1DA 6ALDA 3MYPA 3NL2A 4K7YA 2H3BA 1F7BA 1R2RA 4MZ8A 2YFNA 3VFLA 5J5DA 4O28A 2QCLA 1DQWA 1AW2A 4A29A 4LC8A 4O12A 1B9BA 2ZZ2A 3ZWSA 1LORA 3G8RA 2FLIA 5CZJA 2J6XA 1NF0A 5C54A 3ANYA 1XXXA 4OE7A 4NJKA 3C8FA 1M6JA 2ABAA 4O1AA 4RZ6A 3R8RA 4TMBA 5EY5A 4LRSA 3VI2A 1SO3A 4CLMA 3CPRA 3RU6A 1MXSA 1Y0EA 4UIOA 3NXFA 3K30A 2EAWA 2E6FA 4OBTA 3HG2A 2ZZ1A 1YYAA 1KM0A 3QH2A 3MYOA 3DENA 4B5NA 1TPC1 4Q4KA 4JNMA 3F03K 1TPWA 1H5YA 1D3HA 2W6RA 3W87A 4FO4A 4MOZA 1F5ZA 2A1YA 3TA6A 2X2GA 4TU1A 1VYRA 3W22A 1SZGA 1EA0A 1YDNA 3P5ZA 3MP3A 4RKAA 4WX2A 1YDOA 2QCCA 5AYZA 1WDWA 4MYXA 5ABTA 3EWZA 1JJKA 4XBKA 1SR9A 5A8GA 4RX0A 4DO4A 3G22A 1VJIA 1JCJA 4LS0A 3TV8A 3L5AA 2DZSA 1LRNA 1EUAA 1OYAA 1GJPA 2BZNA 4JTIA 1I2OA 1J2WA 4MJMA 1WYIA 1VQTA 1FDYA 2D73A 5H2ZA 5HWMA 3TX9A 1MZHA 2Y62A 5LNUA 1PIIA 3B0UX 3MBDA 1H61A 3PR2A 2Y85A 4OHQA 1JQXA 4E38A 3PSWA 3B06A 3I68A 4LUJA 3NPXA 3GDKA 3PULA 3G1AA 3W2KA 2A4AA 1K8ZA 1UUOA 3W1MA 3W83A 2E6YA 1TTQA 2A2IA 2CLHA 5AHFA 4CNPA 2JGYA 1O94A 1FY6A 3PSVA 3BG9A 1IIGA 4UTMA 2H90A 5AYXA 1C9DA 3DXIA 1KTBA 5K9XA 5AHIA 3DBPA 4QIUA 1FX6A 3QW4B 4JXCA 5F1VA 1KFCA 5CSSA 2NUXA 1XDLA 3LDVA 3W9ZA 4IQLA 4N2YA 1A53A 1TPFA 4S1FA 1I2QA 3FOKA 3W1TA 1W3TA 1W5NA 1EIXA 4M6QA 4KFPA 3HGSA 3DFSA 4GUIA 4FNRA 4IUOA 3W7NA 4CNOA 2A85A 1PVNA 3DI0A 1K7FA 4NJGA 1H60A 1K7EA 4RLIA 3DU0A 1F6KA 3BO9A 2ZRVA 1FWWA 1TMHA 3EXTA 3TJLA 1N8FA 4UNKA 3SY5A 3ATYA 2J27A 3LLFA 3S1VA 4UNLA 3TFXA 4BI6A 5EKYA 4UFLA 2NXGA 2TRSA 4PCFA 4XKYB 1GVQA 4Y6GA 2QCDB 2ZQ0A 1WOAA 1VHCA 2Q3RA 1R30A 2Y7GA 2ZTKA 1OYBA 1TPEA 2H3DA 3TK7A 3TMLA 1LYXA 2Z2UA 3A9IA 5EMUA 1KFBA 2NXIA 3A23A 3NQ7A 3TE9A 3F4WA 3LCWA 1SW7A 3KXQA 4LC6A 1UJPA 4UTLA 1JUBA 3GDLA 1L9WA 1A5CA 3A5FA 3MHFA 1OK6A 4DF0A 3M6YA 2VFGA 5KITA 1FDJA 2QCDA 2QCNA 3NPWA 1CI1A 2VEKA 4GUHA 2A7RA 3GK0A 5LHFA 2DORA 3LERA 1JQVA 3RMJA 3SW6A 4HSNA 4WJEA 1F05A 3QJAA 3DZ1A 5EBUA 2GVJA 5D30A 4LVDA 1V5XA 4AHPA 3W1NA 3GB6A 1WOBA 3M41A 5LKYA 5L9FA 2V8ZA 2GJLA 4GXMA 5MHBA 5BMWA 1TV8A 2YDAA 2X16A 1ALDA 4CQ9A 1GG1A 3BW3A 3P60A 4PODA 4K8HA 3C4UA 4RXFA 3EX3A 1XKYA 4GBUA 1OFPA 1DQXA 5FESA 3W7KA 5D32A 3G0UA 2PE4A 2ZCGA 3G0SA 3EXSA 1OX6A 2X1SA 3C2EA 4A2SA 3P61A 1TPUA 3STFA 1AL8A 1SSGA 1QPRA 2GQ9A 2QJIA 3HGJA 3LCHA 2DZTA 3D0CA 1DOSA 5BRBA 3LRKA 2X30A 3UWUA 2CW6A 4JS3A 2QCFA 4JN6A 4MY9A 1MEWA 1ME8A 4UCGA 4GUGA 2B7NA 4ALDA 3HB9A 1KBIA 4ZL1A 2WPBA 2J9ZA 3NM1A 1TREA 4YMZA 5H91A 3TW6A 3VE7A 4ZQMA 3LCLA 3PF3A 1OFQA 3LGEA 5F2LA 2E6AA 1KM3A 1TV5A 3LHZA 3LB0A 4OT7A 3EWBX 2TMDA 3QEZA 3SECA 1F6PA 4A2RA 1IXNA 1WXJA 3NM3A 1GYLA 3TQVA 3ZWTA 4JY8A 2CU0A 1KM6A 2GVGA 1OF6A 3U8GA 3PBYA 4MY8A 5HWNA 3N14A 1Q6RA 1VLIA 2V5BA 2F84A 4MIMA 4BF9A 3N19B 1H51A 3ABSA 5AHNA 1LCOA 1O95A 3IIVA 3NA8A 1OF8A 3KFTA 4ZQNA 4NT0A 4O54A 3W2NA 3MJYA 4P2VA 2WSYA 3NL3A 3LHWA 4Z08A 5AC6A 1TQXA 1DBTA 1ADOA 1GWJA 2ZZ5A 3QYQA 4BR1A 3TIMA 1X7FA 3O07A 1OFBA 4IPIA 4GUJA 2DZXA 1SO5A 2ZFAA 3RLVA 2R91A 1PL9A 5CG7A 2V2DA 1VPXA 3I7RA 2YZRA 3STEA 3PUOA 1SZEA 5TQLA 3QZEA 2NUWA 2NXHA 3NOEA 3LTSA 3W7DA 4O16A 3CT7A 4NZFA 3LRMA 3QFEA 2G95A 5TBOA 3EX1A 1G4TA 1UBSA 3L5LA 4EVZA 3W1PA 3OIXA 3G0XA 2QUTA 3UWWA 4YCPA 5CZTA 4IMFA 4LW7A 4WUIA 4AVFA 1GG0A 1RR2A 1SZNA 3NQ2A 3PB2A 2Z0IA 3VCRA 4OV4A 1A5SA 3L65A 3MP4A 1RQBA 3DFTA 1FCBA 4FNQA 4RCXA 1R46A 2ZRWA 4I7WA 4Z1CA 3IV3A 3LBMA 4EF9A 4HNVA 1KA9F 2A5HA 2V0TA 2ZA3A 3PB0A 3MUXA 5BMXA 3W6YA 4O15A 3THQA 1FBAA 1WAUA 5U7SA 5F2GA 1EX5A 4DPPA 1YXCA 3OG3A 4A3UA 5D04C 1V7YA 4LTSA 2Q8LA 3W75A 4WZHA 5KINA 3KHJA 4TR9A 5K9DA 1HTIA 5DCBA 4LU0A 3W70A 5DXYA 4AF0B 3W2LA 2ZA2A 3EWWA 4RXGA 2E5DA 1RQEA 3T40A 4FXRA 3UXDA 4FB7A 4XUGA 5D2TA 1AW1A 3NG3A 2WQPA 2WNNA 3ELFA 2QCEA 3GXNA 1F76A 4JIPA 3P5YA 5FF7A 3SGZA 4LVGA 2VKZG 1JCMP 2B7OA 1XBXA 1G4EA 2E09A 3W88A 4DF1A 5DN1A 3DHDA 3DFPA 4I7VA 4ZZ9A 3Q37A 3GIYA 2V30A 5F1UA 2ZBTA 1OG0A 4BI5A 4PA8A 3M16A 3CIXA 4O0KA 4O52A 4IMDA 3L66A 1OHLA 4FNPA 3E9AA 3GXTA 1UB3A 3BW4A 2GPTA 5LSMA 3O8AA 5LNSA 1I2PA 5D09A 3E12A 1LBMA 1A5BA 4CCDA 1P0KA 4JTUA 2QCGA 2Y7EA 5EYWA 3G3DA 2GVLA 5KZMA 4RK8A 2JKAA 1OVDA 4ADUA 2Y7FA 4H3DA 4N9DA 4DO6A 2DZUA 4PC8A 3O05A 2XN2A 1FUYA 3HG3A 1SPQA 5C6MA 1TPDA 3GDRA 5AN7A 3W2JA 3M5ZA 2RKXA 2WO5A 3GX9A 3IGXA 4PH6A 1RPXA 4E2DA 1KV5A 1I8JA 4ML9A 2QDHA 1HL2A 4O4VA 2QR6A 3W76A 4QSHA 1UUMA 3L0GA 4KFNA 4FX8A 3CM4A 4YCOA 1G69A 2YFOA 4MYAA 3BPWA 3M1ZA 3IGSA 1P5BA 4WY0A 3C2FA 2WOQA 1X1OA 4FEZA 5K3VA 3IEBA 3MI3A 4LOCA 4O57A 4DXVA 1VLWA 3DFOA 1L6YA 1W5PA 1GTEA 4NXSA 5G1YA 3UWZA 2Y6ZA 3PBVA 4XWUA 4TO8A 1W31A 4FIRA 4JTFA 4RZ4A 3JS3A 3TQKA 3TJXA 1XM3A 2PRHA 4LY8A 4UTWC 4O53A 1LOQA 2A7NA 1RQHA 1W5OA 4XZ9A 1QFEA 3W3OA 1W37A 5G2HA 5T26A 2J9YA 2LLEA 1W56A 4K6AA 2A6LA 1CX9A 2E1DA 2ISWA 2VXNA 1VCGA 1KM1A 5FF4A 1XUUA 3GNDA 2A0NA 3IIZA 3W7MA 3QMRA 3NVTA 3LI1A 3BW2A 4NZJA 2NV1A 3RF9A 4AWSA 1FCQA 3S1WA 1JRCA 2YW3A 2ZRZA 5K9CA 2I1OA 1G4SA 1N7KA 3L67A 3W73A 2OX1A 3MW7A 2FTPA 4UFMA 4ZMGA 3TAKA 1X1ZA 2ALDA 3SZ8A 1PHWA 2ZZ6A 1EWDA 2Y7DA 4N6FA 4O50A 1TYGA 1VCVA 1FWNA 4R34A 1P4CA 2J9XA 1FCUA 4X9SA 3CC1A 4CCCA 4HN4A 4CNNA 2A6NA 5F4XA 2Z1BA 4KFOA 4Z1DA 2FFCA 5F2MA 3O1NA 1TTPA 4UTWA 1G67A 5D2XA 1NAL1 1KBJA 1K8YA 2C15A 4MPQA 3DKJA 3GYEA 3LBCA 1JUKA 3TKFA 3HQ1A 3I7SA 3M5XA 3TUUA 1KM4A 1LOLA 4XQ6A 3NDOA 5DY3A 1YXYA 1DKWA 3CEUA 1RVGA 2ZRXA 1TCDA 3ABRA 4X3ZA 5HULA 3G8EA 2J88A 3TSDA 5D02A 2O7QA 1HFBA 1B4KA 3W7IA 4ORIA 1QPNA 1YLVA 4QITA 5EL1A 4XTIA 5FF0A 3BARA 4AEOA 4P61A 1KFJA 1JCLA 3UY8A 5CPLA 5G2IA 3G1VA 3SGUA 3N3MA 2V82A 4BK9A 5CPNA 2WNQA 4LVAA 3TFCA 1OFEA 5CPOA 2DZPA 3KAOA 1ML1A 4J9JA 3I65A 4KWWA 1LBFA 2A7PA 3EX4A 4QNEA 1QR7A 2YSWA 2DJLA 3EWUA 5I3IA 4LS2A 4QNWA 2ZTJA 3QQ1A 3W7OA 1KLZA 1GVSA 4UTKA 2CZFA 5D37A 3GZ3A 1UASA 1G4PA 1AL7A 1J5TA 4NX5A 1J4EA 2C1HA 3PAJA 2JGQA 2FQIA 4IPJA 1I4NA 2CLFA 2WSQA 3DGRA 3R2GA 4FXSA 5LGZA 3NQMA 3LM7A 5HR6A 5AHLA 3HG4A 3SIZA 1OX5A 1OFRA 3TC6A 2YYUA 1OX4B 3NZ1A 4JTGA 4AHQA 1TB3A 4IOTA 3FS2A 4E2BA 3BG5A 3C2RA 3PM6A 1GOXA 3QMTA 2DP3A 5TIMA 3PG9A 5IM51 3WJXA 1VS1A 5AHEA 5G2WA 1MSSA 5GVJA 2VEMA 3HPSA 1HO4A 1QAPA 1N55A 2VFEA 3FLUA 2C3ZA 3N9RA 1H7OA 4XKYA 3KVLA 2DJXA 2F7FA 1QPQA 3NL6A 1FDZA 4M7TA 1LM1A 3G1HA 2R8WA 2P10A 1XBYA 2FB3A 2OMAA 3V75A 1OABA 3UWVA 5K4ZA 1IGSA 2VOMA 3GKAA 4UFJA 1SFJA 2OJPA 3NPVA 3A5VA 3KRUA 3LV5A 1YTKA 3NYZA 5I3FA 3KVMA 5E1QA 3PUDA 2E77A 4JR5A 4MUZA 1TPVA 2VFIA 3Q94A 4UFIA 4HNTA 1WA3A 2RDTA 3S1XA 4FNUA 4N9EA 1E51A 1OFDA 4HSOA 3NAVA 1SO6A 3T7VA 3S1UA 5LGXA 3QRHA 4NXKA 1ME7A 4QJ1A 1ZJIA 4N6EA 3P67A 3TQ0A 2C14A 3W7JA 2AGKA 4HKPA 3STGA 4WQ6A 1I2NA 5KZEA 3DI1A 1W0MA 2QCMA 3EWYA 5DLCA 3MO7A 3O6CA 2R14A 4M19A 4GUFA 5D05A 3G1XA 2WV8A 3STCA 4K37A 4NNCA 3G1FA 4K36A 1CW2A 2R94A 1FXPA 3UD6A 4JICA 1XL9A 4K8EA 4PL2A 3R89A 3TAOA 1AG1O 1OJXA 3CWOX 3NQGA 4H4IA 3ABQA 5C2XA 4UXDA 5F4SA 4D2JA 3G18A 1YXDA 4O13A 1KFKA 1JCYA 4R33A 3M5VA 2ATMA 3G24A 5DXXA 2CLKA 2RDUA 5I3GA 3FJ6A 2NWRA 2I9EA 3HGRA 3IRDA 3W84A 3IIPA 3P62A 2UV8G 3O6DA 4JDBA 1H50A 1TJRA 3M0ZA 4UUIA 1EB3A 3O16A 3JRKA 3V1PA 8TIMA 5E0KA 2QAPA 1VYPX 2YX0A 5A5WA 4AMAA 2YYTA 2IQTA 1Q6QA 4LV9A 4ICNA 1VR6A 2B7PA 2ZRUA 1ZALA 2C0AA 3QPZA 5HUPA 5D03A 5CGQA 3WK0A 4N02A 5IBXC 4DO5A 1K3UA 3L0KA 1S5WA 2ZZ7A 1SO4A 1PE1A 4X22A 3WK2A 4MZ1A 4UTHA 1LP6A 2EPHA 1G7VA 2Y63A 3PUEA 4UTTC 7TIMA 1XCFA 4GE8A 1AW5A 2VEIA 5FF2A 4AWUA 3THAA 4M6PA 1I2RA 4JY9A 5HQEA 3INPA 3B0VC 1ICQA 4JYFA 3NQEA 1XFBA 5DBTA 4Y9AA 4DQWA 1JUEA 2Z6JA 4LNYA 5AOUA 3M5YA 4K38A 4FHAA 3VKJA 2HMCA 3GR8A 1M7PA 2VFHA 4CQ8A 5HNRA 4HNUA 2CLLA 1WBHA 5DCEA 2V5LA 1TJPA 4GC4A 1PHQA 2OT1A 3C61A 3LCIA 3QC3A 1JCNA 1LLWA 2H8ZA 2V2CA 1DVJA 4WXZA 1G7UA 4RR4A 2C19A 1NVMA 3W7LA 1LROA 4PL1A 1XI3A 3BGJA 1R2SA 1U5JA 3BLIA 4PEKA 3HPXA 3GNNA 1H7XA 1C29A 4TIMA 3UZ5A 4O1CA 3B8DA 2E6DA 3GAKA 1EP3A 1GVFA 2B7QA 2BLEA 4JIQA 3VNDA 4A22A 3GR7A 4IWWA 2PC4A 3IVUA 2FDSA 5U4NA 4NJIA 5I3KA 3S42A 1TTIA 1T8XA 1TRDA 5IBXA 2BTMA 3R12A 2FPVA 3W7RA 4MLJA 1EWEA 1QO2A 4O14A 3CTLA 2C13A 2NZLA 5FEXA 4Y96A 1W3NA 3E49A 4HT3A 2XN0A 4QQ3A 2HSAA 3O6YX 5HMSA 3EEGA 3PVFA 1TQJA 1HO1A 4WXYA 2V81A 4HIBA 4IMCA 3LCGA 4GNJA 4GRSA 4KKXA 1LLZA 1K7XA 3M7WA 3W71A 1F73A 4XBSA 4QM1A 3UY7A 5KTLA 3FA5A 2VFDA 3NR0A 3W23A 3TU9A 1TRIA 4IJBA 3UZJA 2Z6IA 1GPWA 2ATSA 3TROA 2W79A 4NJJA 3NGJA 1IXOA 2E68A 4I7UA 3WK3A 1LZOA 5BW6A 1XC4A 5DCDA 3R5EA 3I6RA 3O15A 3TDFA 2E5BA 3S8HA 4JX6A 3PWAA 1GVRA 1GT8A 3LXAA 2KZHA 1B3OA 4KWVA 4AF0A 3W1LA 2AAMA 3UQNA 3NQCA 3NO5A 1ME9A 1BTMA 1VGAA 3BK0A 2YXGA 3HIJA 1LBLA 4DBEA 3S5ZA 1KTNA 1P0NA 3C2VA 3QSTA 1H62A 3LTPA 4OGZA 1QMLA 5AC8A 1ZAHA 3YPIA 3UNDA 1JULA 3HGOA 3A21A 3LI0A 4LT9A 2YCEA 3RNDA 1OFAA 4AAJA 3MMTA 3WJSA 1T99A 2QJGA 3M43A 1DJQA 2QEZA 2JK2A 2TSYA 4MFDA 4HHPA 3A22A 1GTHA 2ISSA 4X2RA 3C0JA 2PURA 3HO8A 2Y61A 4WOQA 2ABBA 5CSRA 3BG3A 2JKEA 3KVJA 3SR7A 3CQ0A 3HJZA 1SW0A 2FJKA 3Q2DA 1BWLA 3ZS4A 4Y8FA 1VHNA 2FPTA 2QUUA 3S0CA 3W7GA 1WBJA 1RZMA 3H53A 2NX9A 5DELA 4IX2A 1OYCA 2ZYFA 3DFNA 3KRSA 3P8IA 1P1XA 4AXKA 4MZYA 2H8XA 2J24A 1LOSA 1KLYA 3ABOA 2RDWA 3M47A 2BX7A 2OZ0A 4N4QA 1EEPA 1QNVA 3C52A 2WJZA 4UMCA 4ZQCA 5HR7A 4N9BA 3W2UA 3DAQA 5I3HA 2X1UA 3N73A 1EP1A 1RD5A 3NEVA 4NX0A 3UPBA 5D33A 4L4LA 4M7SA 4UFKA 3C6CA 4RZ5A 1QOPA 2GOUA 4O17A 5HWJA 5FI8A 4O4WA 1SW3A 3EB2A 2EGZA 1H7PA 2PRMA 3W74A 1S5TA 3NQAA 4FX7A 4S2BA 1QO5A 2B4GA 2A21A 5K7JA 2CZ5A 4Q33A 2AQWA
chains in the Genus database with same CATH superfamily
4D6FA 2O0TA 4Y8EA 2VR4A 1Q6DA 4NP7A 5DT5A 3MSDA 3EX2A 1J18A 2VRJA 3GU9A 4JFWA 3E0IA 2DPEA 3EWCA 4O0QA 5AFDA 1M5WA 2OT0A 3HA1A 1HQTA 4A3QA 2BXZA 2I5IA 3W7PA 3PNZA 3W86A 3FKKA 4MDPA 5FJIA 4MY1A 4LRTA 4D6CA 3PS7A 2GSHA 1OFOA 3LLDA 2B81A 3MHGA 5BXRA 4KEVA 3LPGA 1XBVA 3GC4A 3DCPA 1ZBWA 4IX0A 4LJ3A 4LVBA 2BVDA 3NPUA 3OVRA 4ACZA 5DMLA 4EK7A 4DM1A 2YCKX 3TA9A 4JQ1A 2RDXA 1TX0A 2D2JA 3KBWA 3NXLA 4JTLA 4WVXA 3W26A 1UWTA 4U28A 2OO6A 1KO0A 3KP0A 4WDXA 1AJ0A 2XFRA 4S2CA 1B0IA 3OHIA 3PPCA 3SN0A 1UZ4A 1I6NA 1W1IE 2QQ6A 5BYWA 4DPQA 4LF2A 1X8CA 5HUOA 2HVOA 3WX7A 3AHZA 3OYXA 3SI9A 1CB7B 3WK1A 1GEHA 1V51A 3ERPA 1LRQA 2CLIA 4JDYA 3CUHA 3QHMA 3W25A 1HJVA 3O6AA 4Q32A 4XO6A 3S6DA 2B31A 3W00A 2ZUMA 1E6RA 3M46A 1KTCA 3T55A 5D2VA 1EYEA 2PWDA 5D8ZA 1UWAA 1RA0A 3LHYA 1B5TA 2Z1VA 2JIWA 3GH4A 4EXQA 1NJJA 4LBUA 3GDTA 3JR2A 5G1TA 3SBFA 3BLOA 4NU7A 3NQFA 4MMWA 1Z41A 2CHRA 3N3TA 3HMJG 6CGTA 1TMLA 2XWDA 4FR6A 2C79A 1KXHA 3UCDA 3E96A 3AC0A 4B5TA 3P80A 5FSEC 3E6EA 1H7WA 3NQDA 2PZ0A 4XD5A 4Q4SA 4V33A 3C56A 4K7VA 2PDWA 1LTDA 3LU2A 5DBUA 5CG0A 3RN6A 1G1YA 1IR1A 3ITLA 5A6JA 4URIA 4LAUA 4Z0JA 4R9XA 3QLDA 1AH3A 2WVVB 5FL0A 3M0KA 3NEHA 4NHVA 4PRWA 1UPMB 4TV6A 3DH7A 3TJIA 1YPFA 4LUTB 3FVMA 3JUGA 1RK6A 3L2MA 4HCLA 1XBZA 3W7EA 3L23A 3QF0A 1KV8A 1CLKA 2PWVA 3H55A 2V3GA 3C2OA 2IKGA 3WEMA 2GGGA 4IGHA 3KOFA 3KTCA 3TMQA 2XFYA 3B05A 2W4XA 1SQ7A 1ZY9A 4U31A 1DP0A 3HG5A 3AXHA 4NQ1A 1DJYA 2VJXA 2X1TA 2E0PA 3H7UA 4L1XA 3KDOA 2FHBA 3AHYA 3W1QA 1QWGA 4V28A 2YDQA 3QXBA 2BY0A 4DI9A 1NWUA 2NLIA 1ZENA 4HTBA 3S5OA 5CZSA 3UWQA 2Y24A 3U2OA 1WZMA 1QCWA 3W72A 2HS6A 3WD0A 2WHKA 4JQ3A 4AZ7A 2C8NA 3FGCA 3S9YA 3B8VA 2NX1A 1TPB1 2ZA1A 1EZ2A 3HOJA 3VIPA 2ICSA 4X0NA 1VFSA 1S3HA 4O19A 2WNZA 1AQMA 3OVQA 2O56A 3EWXA 5LNRA 1OD8A 3PTDA 3WEZA 1EJVC 2GQAA 1DIOA 4E4PA 1EP2A 3B04A 1S5VA 3L68A 2DZVA 3ITCA 3L5MA 1KXTA 3PUGA 3HTWA 3L21A 1FQ0A 3N4EA 4XD4A 4J7RA 3O0FA 3VC5A 3BLFA 2OLHA 2FYMA 3W82A 3K1GA 1L6SA 1FWSA 4QEEA 5I0DA 1TELA 3VKDA 4NNBA 1KM2A 3VGDA 1E15A 4FOKA 2HROA 4KCVA 2REQA 4IFOA 4W87A 5LZLA 4IHCA 4EPDC 3GDMA 5E9XA 4DWSA 1H41A 4UTIA 1QW7A 2WNWA 3PBWA 2ZRYA 2AQOA 3CPGA 6TIMA 1W3IA 1V8EA 3HQPA 2XZ9A 4LV4A 1FWFC 5JIWA 2WB5A 4NAEB 3VU2A 3T44A 3TVAA 1A5AA 3CH0A 3L4XA 3CV2A 3HZ3A 4L9YA 4EOUA 1DXEA 4C91A 5G5IA 4OWGA 4XZMX 2WW5A 3GG1A 4KCTA 3ICJA 3VD3A 5A2AA 1JXJA 1R2TA 1GYNA 3W2MA 4CN4A 2ZZ4A 4DBWA 1FWGC 1JZ4A 1BPLB 4GQGA 4JTKA 4RDVA 2R9RA 3OB8A 4KQNA 1TWDA 5LHEA 3FFSA 4JN8A 1VD6A 4BI7A 3LN3A 1X38A 3MWAA 1GUVA 3RDKA 1GOMA 2VX4A 4PRTA 4EPBC 4N4PA 4CU7A 1H1ZA 2NVAA 4A21A 4FNSA 2Y5SA 3VZXA 3UXIA 4Q8UA 4B4FA 1PUDA 2AAAA 4Q4OA 3SUWA 1XIFA 3KWXA 5M2FX 3HFTA 2PLMA 1U83A 3F1QA 1RCOB 2FB2A 3UG3A 5XIMA 3SCUA 3DERA 1TPH1 3U0HA 1VCFA 2NX3A 4MKNA 3FJNA 1NSJA 4C6KA 4D6HA 3WDHA 4HHHA 1U1HA 3ES8A 1T7LA 5FAGA 3GXPA 4JD4A 4N42A 1A50A 4JN7A 3VM7A 3P74A 2BVTA 3GLCA 4V15A 2EHHA 1LUCA 4UR8A 4L4MA 1POJA 2ZDRA 3LENA 4AZ5A 4PGLA 1TJ0A 4R53A 5A6AA 3H4GA 4FF7A 1JDEA 1Q63A 4IIFA 1HVXA 2ZC8A 5KETA 4J27A 5BRPA 2E8YA 4ONVA 4EF8A 3L0NA 1XHGA 1JRBA 1E1EA 4YXGA 3AZRA 2VEPA 2XGBA 3LPPA 1F9CA 2JF6A 1WDRA 1HN1A 4LVFA 1F8MA 3GD6A 3OLDA 1VBJA 3DESA 1WUEA 1HG3A 3ZQ9A 1E6XM 3RCNA 3Q67A 4O18A 4GZJA 1J6PA 2QUVA 4M5PA 1ZGDA 4FNTA 4QDMA 3W7HA 2E3ZA 2Z1KA 4W8AA 2E67A 3LM3A 4GI4A 4UTJA 3WQFA 4QLKA 7A3HA 1A0EA 3WLHA 2GJXA 3NFUA 4W88A 3FVDA 4MZ8A 2YFNA 3WLPA 1C91A 3MWCA 4AZBA 2D20A 1GOQA 1BAGA 4HJWA 4A29A 3QV6A 4GOAA 3PTQA 3AU2A 1FWJC 1NF0A 5C54A 5LIYX 1QRQA 4Q8WA 1J96A 4OE7A 3CQKA 3CQHA 1QNPA 3VI2A 1SO3A 1ZL1A 4FR1A 5H8PA 1Y0EA 4M82A 3E5PA 4UOJA 3NXFA 1ISWA 2EAWA 4A8RA 1NWSA 3B0YA 3QYSA 2E6FA 5I78A 1UD4A 4OBTA 2WMKA 3MT1A 2XVGA 4Q4KA 1TPWA 3SDOA 3LNPA 2V5DA 4B16A 1UMLA 1D3HA 4FO4A 1F5ZA 2A1YA 3IJQA 3TA6A 1LQ2A 2Z1WA 3W22A 4IIEA 2F6KA 1YDNA 4OECA 3TJ4A 1YDOA 5LA0A 4EACA 1E5NA 4XBKA 5A8GA 4J3TA 3G22A 3UJEA 1XCWA 1JCJA 3EA2A 3SRHA 3BMVA 4MJ4A 3TV8A 5LA1A 1W2PA 1JI1A 4BA0A 1B2YA 1XF0A 1LRNA 1GJPA 3UA3A 2VUNA 5A6SA 1VQTA 5H2ZA 3QVQA 5HWMA 1MZHA 4H7ZA 5LNUA 3WH5A 2WZHA 3UA4A 3UJSA 3T0TA 1H61A 1GJUA 4GY0A 3AIUA 1SZRA 5HJXA 5D8WA 4JPGA 4P7LA 3EDEA 5LXEA 3PULA 1MDLA 3RX3A 1KNWA 3W1MA 3WDRA 4ZTXA 2VZTA 3W83A 1TTQA 1Y5VA 3WD2A 2CLHA 4WSJA 5C2GA 1FY6A 4US5D 2QJMA 2H90A 4XZWA 5AYXA 5I2UA 5K9XA 3DBPA 2OPJA 3T42A 3QW4B 4LGXA 2V3FA 4JXCA 1KFCA 3PFMA 2NUXA 2OWXA 1XDLA 4N2YA 1BGAA 1E56A 4H01A 3MPGA 2G8ZA 5EB8A 1I2QA 3RX2A 2VWTA 4Q6JA 2VVNA 1EIXA 4CNUA 4JIEA 4GXWA 1BSLA 2J77A 3UWEA 4IUOA 4CNOA 1R86A 3DI0A 1KRMA 1HP5A 1ADDA 4WDUA 4WGHA 3BO9A 1MXGA 1IHIA 4RZBA 2PB1A 1VFFA 1W9VA 2PDUA 2X2YA 4IPLA 3SCNA 4LYRA 3ITXA 3TFXA 1NWTA 5LIUX 3VNKA 5EKYA 4CD4A 4UFLA 4FAMA 3AS2A 1GVQA 4PUKA 2QCDB 2GGIA 4WEVX 1R30A 4UR9A 1TPEA 3TLLA 4Z2LA 3GO2A 3A9IA 1WO2A 2GUBA 3VD7A 3JZEA 3GYCA 2OGJA 2HNHA 4I90A 3W37A 4UTLA 3URQA 1R3TA 1JD7A 3SQMA 3V5CA 1Z7AA 1E4IA 2QCDA 3V7PA 2VEKA 5FJRA 1I75A 1VEMA 1YPXA 3LERA 3SW6A 1E43A 1GHSA 1KRAC 4WJEA 4I8YA 3DZ1A 2GVJA 4LVDA 4HGXA 3W1NA 3TN3A 3OU8A 1U30A 3WUBA 2J7DA 4DZ5A 2HE5A 3UZYA 3EEZA 2IXVA 3NOYA 5MHBA 3KCLA 4M24A 3FK4A 1XSJA 1NQ6A 1JGIA 1X6LA 2DY3A 4PODA 3IWPA 4K8HA 3LA4A 1EBGA 4RXFA 1YHTA 4GBUA 4AMCA 3WD1A 5FESA 4GYPA 3W7KA 2CLPA 5D32A 3UW6A 1UG6A 3G0SA 3SM0A 1R3QA 2WWCA 5CQ1A 4ZO7A 2XM2A 4RDWA 2UY3A 3SCSA 2ZADA 1R87A 4EAMA 3HGJA 2DZTA 1XLIA 2DH3A 4JS3A 3DECA 4MY9A 1Q8JA 1ME8A 1VEOA 2XH7A 4GUGA 4ALDA 4PB3A 5IRPA 1KBIA 3E74A 4ZXLA 5C9ZA 3AIBA 2A79A 3QGVA 1KGWA 3SFWA 2IPFA 4QX4A 3PF3A 2PLJA 1KCXA 1O5QA 2CXGA 4OT7A 3RIKA 1V03A 1J2BA 3IJ8A 3SECA 1F6PA 3ZR5A 4A2RA 3NM3A 3VABA 2Q09A 2OKOA 3TQVA 1BD0A 4JY8A 4ZGYA 2GVGA 2VCAA 1H3GA 1EPVA 1TZ9A 3CL7A 3WQ4A 1OC6A 4MY8A 3R79A 4FF5A 1C3FA 4KEZA 1Q6RA 4BF9A 1H51A 2EPMX 1LCOA 4QE1A 3NA8A 3KFTA 1AZ1A 5A69A 4NT0A 1XDJA 4HOZA 2O9PA 2VWSA 4LX4A 3E2SA 4GVIA 4Z08A 5AC6A 1B3WA 4FLQA 4BR1A 2X05A 1X7FA 4IPIA 3CUGA 3H6OA 2DZXA 1B1YA 4Q8PA 2R91A 5DANA 3I7RA 4ZOEA 2YZRA 1US2A 4GGBA 3STEA 2XINA 4AZIA 3QZEA 2NUWA 4ZBCA 2NXHA 3LTSA 2PWEA 3W7DA 3DDMA 1R7OA 1G4TA 2NSOA 1A80A 2FVMA 4J35A 1KR0A 2DUZA 2OYKA 2NVCA 3QR0A 1IV8A 4IMFA 2BGNE 1MVYA 4FLOA 5H8UA 1E9YB 1SZNA 3SQLA 4F3HA 1CGTA 1A5SA 1TV3A 3GDBA 1RQBA 3DFTA 4RCXA 3DG7A 3S2LA 4I7WA 3LBOA 3LBMA 3WNLA 1XR2A 5BU6A 2V0TA 1GHRA 2ZA3A 3ANUA 5F2GA 4BCEA 4DPPA 3AS3A 3OG3A 2P3EA 1M68A 4HN8A 2BOEX 2I5QA 5KINA 4AF0B 3W2LA 2ZA2A 2E5DA 3T40A 1PYMA 5D2TA 1FHUA 4UQEA 2WNNA 3ELFA 4FK9A 2BS9A 5FF7A 3TQPA 2PDLA 3I6TA 1XBXA 1G4EA 2NSXA 2OOGA 4I7VA 3Q37A 3APGA 4CVUA 2ZBTA 1OG0A 4BI5A 4XZBA 1XFCA 1JPMA 4HU4A 4PA8A 2IPGA 4KWOA 4Y7EA 3UERA 3USZA 3VMOA 2A3EA 5CC5A 1Q65A 2VOTA 3OPSA 3L66A 4YYCA 4FNPA 5LXXA 1UB3A 1UPPA 1Z3NA 2D2HA 1I2PA 1V08A 1H5VA 5D09A 3KOZA 1W9PA 3MQTA 5HDRA 1P0KA 1XRSA 3GY1A 2QCGA 3RHGA 5C2CA 1XYFA 3G3DA 1P6CA 4HCDA 3K1DA 2ZXDA 3GXDA 5CC3A 4H3DA 4N9DA 4MG4A 2DZUA 4M81A 2DVXA 2QPXA 2HEJA 1MYRA 3O05A 2X09A 5JUVA 3W2JA 2RKXA 3FCPA 1P6WA 1XCXA 4MUPA 3RCYA 2QGHA 4Z17A 4IL2A 2CHNA 4RDYA 2ISFA 4E2DA 3VIIA 1LWIA 1KV5A 1I8JA 4ML9A 2QDHA 1HL2A 4O4VA 3W76A 3ZR6A 3N6JA 1KRCC 1O68A 4GQQA 1XIGA 4KFNA 4FX8A 3FNDA 2YFOA 4MYAA 3M1ZA 3IGSA 4WY0A 2EG6A 1X1OA 2O4QA 3FN9A 3KW3A 4O57A 3SRFA 1QWKA 2P53A 1GTEA 3U7VA 3EOOA 2Y6ZA 3R0KA 3PBVA 1DJZA 2WC4A 1CTNA 3PZQA 5CEWA 2VCCA 2W9MA 1E40A 2J8TA 4HA3A 4B5SA 4W5UA 1LOQA 3H2FA 2G41A 3R10A 1IEQA 1QFEA 3U48A 1EC8A 4GZ7A 4RPPA 3ABZA 2IKJA 1W56A 2A6LA 1CX9A 1VCGA 1KM1A 1JPIA 1S2TA 5FF4A 4S3CA 4QFUA 1W3HA 3QMRA 1H1NA 3BW2A 5JH2A 3RF9A 4AWSA 1PX8A 2IKIA 3S1WA 1JRCA 2YW3A 2KX9A 5G1MA 5ABGA 4JTRA 1U2YA 2A3CA 4X2PA 2OX1A 3R94A 2UWFA 3MW7A 1H0GA 2V5KA 4ZMGA 2WCGA 4ES4A 2W3ZA 1S2UA 1JGMA 2ZZ6A 1DIKA 3GFXA 5BWFA 1KRBC 2OLSA 1S1PA 3VOGA 4AD2A 4LAMA 1P4CA 1XRVA 5I23A 4FLSA 1TV4A 1EJWC 2A6NA 4QTGA 5BXTA 4DN1A 2GGEA 3SGGA 3NGFA 4KFOA 2FFCA 3VNJA 5F2MA 4UTFA 3L4YA 4MF4A 3HURA 4GD0A 1G67A 2AKZA 1NAL1 1G94A 3CJPA 3DKJA 4MNKA 1EF3A 3LBCA 1JUKA 4S3FA 4HNLA 4XQ6A 3NDOA 2PDHA 4KETA 1TVPA 3WL1A 2PD9A 3MV11 1YXYA 1DKWA 2VEGA 2IPJA 1TCDA 4X3ZA 3ITVA 1EO5A 1GZ1A 4H8NA 4C7GA 1X96A 2PDJA 3MC5A 1QPKA 4ZB2A 3GU2A 1I0BA 4IIDA 4ORIA 5MF5A 3G6MA 4AD3A 2WC7A 3A4XA 2HVMA 5DRCA 1QI2A 5GNYA 4C6NA 4HPGA 3BZGA 2CPUA 3N04A 3CZEA 3SY1A 1JYWA 4J5NA 2XVKA 3KAOA 1EHAA 1ML1A 3I65A 2WKLA 2A7PA 1ADSA 3EX4A 4QNEA 4PB4A 5I3IA 2VZOA 1PO9A 4QNWA 3VIGA 1GVSA 3U5UA 4FLRA 5D37A 2VRQA 3GZ3A 1G4PA 3THCA 2WZMA 2FQIA 2Z1XA 1IWAA 1O66A 5MKGB 4J3ZA 3SIZA 1MQRA 1OX5A 1OFRA 2J78A 4XAPA 5T8GA 1OX4B 4JTGA 3IV8A 4AHQA 1DHKA 2ODOA 3FS2A 3WNOA 4ZSTA 4E2BA 3PM6A 2DP3A 1K9TA 4WJ8A 5D9PA 2QIWA 3T9PA 2Z7KA 4EXBA 5IM51 3U2CA 1CCWB 3KBNA 4NZ1A 1MSSA 5GVJA 5A94A 2VEMA 4Q4RA 2WMFA 3HPSA 1ZUAX 1HO4A 1O12A 4WHBA 1N55A 2GL5A 4XKMA 1H7OA 2ACRA 3CZJA 1V0KA 2JQXA 4W7VA 1BXBA 2DIJA 1QPQA 2ZKMX 1LM1A 1QI0A 5HANA 2R8WA 2P10A 1X98A 1XIBA 5J8LA 3ZT6A 3ARXA 3EA3A 4X63A 3KZPA 1CLVA 4UWMA 1E4LA 2OJPA 2WKGA 3A5VA 3KRUA 3QZAA 5I3FA 4LH8A 3RCMA 3CHCA 3DX5A 3VDHA 3DIPA 5CJ5A 3M0JA 3Q94A 2VHLA 3AIWA 3AXXA 4FNUA 5A6BA 1OCBA 4PUEA 1E51A 1OFDA 2CYGA 3U3HA 3QV8A 1UWUA 3CQIA 3S1UA 5LGXA 4NXKA 2I5GA 3IGHX 1UH4A 4S3KA 2VZVA 3H7RA 3TQ0A 2XH4A 3S1GA 3AJ7A 2C14A 4WQ6A 1IEIA 5KZEA 3O6CA 2R14A 3OGRA 4CQBA 5JU6A 4GUFA 2GSEA 5D05A 1SYTA 2INEA 1V6WA 2PDMA 3RLHA 4CQCA 3L4TA 2HE8A 4K37A 3PZNA 4NNCA 4K36A 1XYCA 4KRUA 5FJPA 5KZ6A 2XVPA 1R7AA 4D8LA 3UD6A 3N1AA 3MCMA 4K8EA 1JNEA 3LZ3A 1CEOA 2VL4A 3Q65A 4ML4A 1AG1O 4OKDA 3P0XA 1I1XA 2QMJA 1O1HA 3A9BA 2XVNA 3BOXA 3H23A 1QK2A 1VFHA 4JTCA 1VEPA 3BUVA 1EC7A 2ATMA 2RDUA 3LGGA 5I3GA 3DYMA 3HGRA 4AZHA 3N12A 3W84A 4PFHA 4W85A 3C3UA 5CBJA 3ZVHA 1F3WA 2Z2AA 8TIMA 6PTDA 5E70A 5CH9A 4XSMA 5E0KA 3CPUA 3AXIA 1G5AA 1VYPX 4DAIA 2IQTA 5CSUA 4PSPA 2G3FA 1UUQA 2QUNA 2VCBA 4WCJA 5D03A 4N02A 5JIPA 5IBXC 3BAYA 5AVHA 3STPA 4I5UA 2D2GA 3L0KA 1S5WA 4X22A 4MZ1A 4UTHA 4DIAA 4I9MA 4BZYA 2QV4A 3KDNA 3PUEA 3CV1A 4UTTC 1DE6A 4GE8A 2PEVA 5FF2A 4AWUA 2PDCA 7XIMA 4JY9A 4EXAA 3B0VC 1MMFA 5AZ1A 4F8XA 4PMQA 1LG1A 1M65A 2XGZA 1OBAA 1JUEA 2Z6JA 4LNYA 5AOUA 1W1TA 2HPIA 3I3BA 4XD6A 2VFHA 5HNRA 3CYVA 1NOFA 5DCEA 1ZJHA 3PHAA 3ARSA 1TJPA 2OT1A 3QC3A 4XIAA 1J0YA 3LD5A 4A05A 4PMYA 1R2SA 4PEKA 4DVOA 1X39A 1H7XA 4GC3A 2ZX5A 1C92A 3UZ5A 4A3HA 2ZX7A 3B8DA 5A6BD 4GISA 1UIOA 1IGWA 4IWWA 1AQFA 3GR7A 2Y4SA 3BAKA 3PFRA 1EJ7L 1RCXB 4AIEA 5BOFA 1TTIA 5C9XA 3AOFA 1A5UA 3R12A 3WD3A 2R82A 3NSXA 2XN0A 4J40A 2HSAA 1K8CA 2V3EA 3UETA 4WXYA 4HIBA 4GNJA 3P3BA 3APTA 1J0JA 1KFWA 3W71A 2Z24A 4QM1A 4XX6A 4MDOA 2VFDA 3FA5A 3W23A 4GO8A 1O6IA 3NGJA 3C8NA 4I7UA 3M4HA 1LZOA 3TC3A 4GCXA 4YWSA 2F8QA 1ISYA 4KEUA 4DYKA 4JX6A 1BQGA 2DIKA 4QS6A 3VM5A 2XSBA 2IQ0A 1B3OA 4KWVA 3W1LA 4C6EA 2AAMA 3APYA 3L7RA 2RAGA 2AQVA 1LWJA 2GQ3A 1BG9A 1IZCA 3S5ZA 1KTNA 5ABEA 4UQ9A 3QSTA 4H04A 4W86A 4QJ4B 3LTPA 2GJPA 4RE3A 3RNDA 3CQJA 1OFAA 4AAJA 3MMTA 1YNYA 1T99A 4LXFA 3M43A 1KXVA 3TYZA 2QEZA 2TSYA 4MPKA 4HHPA 1GKQA 3C0JA 3HO8A 1QHPA 1JYVA 2XJ7A 3KVJA 3SR7A 3CQ0A 1Y5XA 3ZS4A 4B15A 4NI3A 3ZYZA 3S0CA 4J3UA 3W7GA 4MAZA 5AVNA 4ECLA 3R8GA 3S5SA 4IX2A 5EMJA 4AXKA 3T0DA 1E3XA 4DX3A 1LOSA 4MNMA 1W9BM 3OZPA 3MDUA 1EEPA 1QNVA 3C52A 4UMCA 4ZQCA 5HR7A 2VD9A 1DWHM 4N9BA 2F9RA 4WDWA 4KCWA 2X1UA 3UPBA 2EQDA 3NEVA 1GQKA 5D33A 2ZX9A 2IS7A 4Q4QA 4RZ5A 4JQ2A 1R3YA 2C0HA 5HWJA 4O4WA 1SW3A 2JFEX 2BHUA 3K8MA 3E2RA 3ITTA 1NWRA 5IDIA 2B4GA 2AQWA 3DBNA 2UY5A 4UZUA 2Z4GA 2P1FA 1HP4A 1V6XA 5A6KA 3UESA 3GS6A 4OFCA 3GVGA 2BOGX 1XICA 3B9OA 4Z2KA 5K4XA 2HS8A 2W61A 4M6VA 1WB0A 2PLKA 1X6UA 5KMYA 2ASHA 2WKJA 3VMPA 5IFTA 1FH7A 1SM9A 1SSDA 2HDJA 3OBKA 4JL1A 3GRIA 5L6UA 1W5MA 3VIKA 3QSRA 4ZQRA 2PCQA 2RUSA 3RLUA 4J3SA 2CFFA 4F2BA 3V5OA 2VELA 4UTUA 1H63A 1ZBVA 3D3AA 3UR8A 3JU2A 3SCPA 2YCLB 3DHPA 2W92A 4B3LA 2D0GA 1UD6A 1QPOA 4JNYA 3LNMA 3MZ2A 4DZIA 1JFHA 3B8SA 5CZKA 1VBHA 4C1KA 1S38A 1HXJA 4MB4A 3S3GA 3U2ZA 2DIEA 3UXAA 3OW1A 1BFNA 4QAWA 3II1A 3DYPA 1N82A 3RGTA 1Y65A 3N13A 2D24A 4F40A 1BYAA 2R6OA 3GXMA 1JD9A 3WH7A 4LCRA 2GYIA 5GNXA 1H1YA 1H7NA 4KIEA 1GQNA 5CZ0A 8XIMA 2EJAA 5SWUA 3PZVA 2FPYA 2PUZA 1OC7A 2QAFA 5I09A 1UD2A 2GUUA 3TYEA 2E9BA 8A3HA 1WKEA 4HPXA 1OZMA 4OU1A 1K8XA 3B40A 5HOSA 2OCZA 5CKSA 4H2HA 1VZWA 4UMBA 4H9MA 3M44A 1J5SA 4GFSA 1GNXA 2WHMA 3BV4A 3OBEA 3ORWA 1MEIA 2QDGA 3IRSA 3Q58A 3PG8A 2VC7A 4XD3A 4R7JA 1I45A 1TIMA 6REQA 2GJNA 4AZCB 1LL6A 3H4XA 3CYJA 3R7MA 3U9IA 3WENA 3NUKA 3F7JA 3QZ6A 5E93A 1FWRA 1K77A 3W29A 3CL6A 1PPIA 1ZQ5A 1KFLA 2MANA 3H2AA 3T4CA 3HBLA 3ALFA 2XYLA 1VIZA 2PTZA 2AKMA 2CWNA 3WLQA 3A13A 3NYDA 3TSMA 3POHA 1KKRA 5JBFA 3C0SA 1QU4A 2EG8A 5JXQA 2AL2B 3QW3A 3MP5A 5REQA 3P0WA 1KQZA 3DN5A 3GHSA 3CEPA 5I5RA 1ZFJA 1JZ8A 1OG6A 3OEXA 1BEUA 3ONCA 4JKMA 1AK5A 5CGMA 4OUIA 4D1JA 3WQ6A 1O5XA 1M7OA 2QF7A 4Z1AA 3CO8A 5DEZA 4IG2A 3FJ4A 2XSXA 2QJHA 3B8TA 4C60A 2HJPA 4FA3A 3KBJA 3GG0A 2AL2A 2NV2A 2VR2A 1V6TA 3RJYA 1X6NA 4RUBA 3WLLA 2OSXA 4C7DA 1FKXA 5C5YA 3BQ6A 3VCNA 1UD8A 2YXXA 5G4HC 3DG6A 3WZ0E 2EBNA 2GDQA 4BKNA 3BZJA 1CGXA 1W9UA 3W07A 3UCCA 4CCEA 2X40A 2BVWA 1QNRA 3NJ3A 2EPOA 3KCJA 1L2UA 4X9YA 3IJ6A 3FEMA 3RM9A 2P5NA 1DJGA 3BCDA 2HQAA 4NSBA 4C1LA 1FP8A 3QN3A 3NZGA 1DORA 5A3HA 4H6KA 3QKEA 4ROQA 1KWGA 1ONXA 4HYWA 4GLEA 3LTYA 4PMDA 4DJFA 2O7SA 2V6AA 4I6KA 4CD6A 2NUYA 1B31A 1CLXA 2C16A 4JX4A 5CCZA 3MCNA 2Y88A 4JTSA 4GWEA 2C71A 3QOMA 4J3WA 4LWWA 3NZQA 5AC7A 3LCXA 1A3HA 3SN1A 4C1NA 3BANA 2G5WA 2RFGA 2B0MA 4HYVA 1OCNA 1S5NA 4J1OA 4QJ3B 3UZXA 3P7YA 2WLZA 3WJZA 4PTNA 3MTWA 1PV8A 3GFYA 4JTEA 3T07A 2XFFA 2XIBA 5F7UA 8CGTA 2DW6A 2V9DA 3CV6A 1LDCA 1DYSA 1VJZA 5A8NA 1YMYA 3NTYA 4N0RA 4R85A 5I3JA 2GSJA 2GWGA 4AD4A 1TWWA 1M9HA 3KE0A 1PEZA 4P8UA 1JYXA 4JYEA 4UOQA 1E0TA 2I14A 1YTDA 3GG8A 3WNMA 2GGHA 3IUDA 2RGLA 4GX8A 3GG7A 4JFVA 1NFGA 3HF3A 3OVPA 3KVKA 3U6WA 3D3FA 4WKAA 2VGBA 4LEQA 3TXZA 3AYVA 3CLWA 1B4EA 3F4NA 2C18A 3KX6A 4YLWA 1YADA 4TVUA 4K1WA 3S6OA 1FFRA 3H8AA 4Q7IA 3L4ZA 3WNPA 2OFJA 3WYZA 5KSWA 2BSLA 1L6WA 3NQ8A 5D9NA 3T2PA 4DXXA 3MUZ1 3U2EA 3HN3A 4U2ZA 1YDVA 4R7OA 5TAOA 1TWIA 4MM1A 2Q01A 3ONBA 5LNVA 3N15A 3R43A 3KS5A 3T05A 2BBFA 4AD1A 4G6CA 2O92A 2P8CA 5G4EA 2XWEA 3U7BA 4K3ZA 4HPJA 3WELA 2AL1A 3EDJA 1MEHA 1U5HA 6XIAA 4N7QA 3ARRA 3UJ2A 1GJWA 1JR1A 1ICPA 3NQVA 3LSBA 3AWNA 3AUJA 3GKFA 3A24A 4Z42C 3O06A 4JAWA 2CZDA 1YTEA 3W1XA 1KM5A 4I3GA 2ZUNA 4I5RA 4DJFD 3TSBA 3FIGA 3KOWA 1V3IA 3OZMA 1OIMA 1WQ5A 2WSKA 1VENA 3GAYA 5FIPA 1OT2A 5D38A 4QBXA 3VNMA 1AA1B 1W5QA 4QEHA 2FJUB 4OJYA 5HMFA 1ECQA 1P0BA 3BVJA 1C8QA 1UA3A 2TODA 4S3GA 4Y9MA 2WSPA 3MVTA 4ADSA 4NAFB 2PDYA 5A1AA 9XIMA 2D3LA 2X1RA 3PNUA 1REQB 1V3JA 5AB3A 5EA9A 4QAIA 1R85A 1Q45A 4L80A 3VE9A 2QGYA 3FJLA 4NYUA 3VKAA 2VDHA 3I3EA 3MI2A 9XIAA 3BDKA 1E1FA 1FWTA 1ITXA 4DXKA 1VC4A 1C8VA 4D6JA 1QOXA 1NDZA 3WF2A 4D6GA 1HKMA 2P50A 3PJXA 3RK8A 3OGVA 3DOPA 2ZE3A 1M41A 1REQA 3WF1A 3N9KA 3R58A 3GTHA 1E0UA 2JKPA 2VURA 4X0VA 3WLOA 2OGYA 4P8XA 4UOZA 1P7TA 2CIPA 1XWYA 3CASA 3NL2A 3ID7A 3BTNA 1RD6A 1U33A 3EMCA 4K7YA 2H3BA 3CAVA 4B92A 2QCLA 4BEUA 1AW2A 3VMNA 2WHJA 4O12A 2ZZ2A 3VC6A 3B0XA 3MCOA 3G8RA 3K46A 2FLIA 5ABFA 2CITA 3AMGA 2EKGA 3I4KA 4PMUA 1PKLA 1JZ2A 1IZJA 1XXXA 4DUXA 4O1AA 4RZ6A 3R8RA 4JOMA 2C91A 1KD0A 2I16A 4GY1A 3CPRA 3GBEA 4LANA 3K30A 5T9BG 1RALA 3ZLFA 3HG2A 3S2CA 1KM0A 3DENA 5C70A 4LBSA 1Q6FA 3L12A 5FCZA 3BLKA 2TAAA 1R3RA 3EGJA 2NV9A 1VYRA 1SZGA 3P5ZA 3MP3A 1PWMA 3WFLA 1RSCA 1SVDA 4GY7A 3WMBA 1N8WA 2DT3A 3EWZA 1SR9A 4WSHA 4DO4A 1SJBA 3FAXA 5CLTA 3L5AA 3EMZA 3AICA 3TN4A 4LY4A 4L4OA 4JTQA 4MJMA 2X1IA 4D9PA 1FDYA 3UT0A 1E6SM 3R1ZA 4KMQA 3PR2A 4C6IA 4E38A 3I68A 1GGOA 4GHRA 3ZT5A 4G7EA 1LLOA 1EJSC 3G1AA 3JW7A 3W81A 5CPTA 2A4AA 1K8ZA 1UUOA 3B8UA 1GVEA 2E6YA 2A2IA 1NDWA 4CNPA 4H1ZA 4C6QA 1IIGA 4UTMA 4XBJA 5AHIA 1EKOA 3LDVA 3W9ZA 2H9AB 3AS1A 1A53A 2XZ7A 2IPWA 1D7KA 4M6QA 4KFPA 1E9LA 1UW9A 3VIOA 4GUIA 1PVNA 4H83A 1ITUA 2GK1B 4NJGA 1K7EA 3R6IA 1VBGA 3CHEA 2ON3A 3TOPA 3W6MA 3ABXA 1TMHA 3M0HA 3TJLA 4INFA 6A3HA 4UNKA 2E7FA 4AIUA 2BXYA 2J27A 4HTYA 3S1VA 4UNLA 1EQPA 3IAPA 4PUDA 3AZSA 4XSLA 2NXGA 1LQAA 4XKYB 3W6LA 4E4FA 4WDTA 4GYPC 1VHCA 2Y7GA 4KCUA 3TK7A 2O9OA 3T8QA 4IPPA 2NXIA 3A23A 3F4WA 3KXQA 3QV9A 4LC6A 1UJPA 1V02A 1IYXA 1JUBA 4B3KA 1Q4WA 1L9WA 3A5FA 1OK6A 1HGYA 2QDDA 3M6YA 3NPWA 1CI1A 4XUYA 1T41A 2YL8A 3ITYA 1XLAA 3RMJA 1IZKA 4HSNA 4L56A 2BGQA 1F05A 1V5XA 1WOBA 3M41A 2VYOA 4DI8A 4QROA 3GNRA 5LKYA 3MKKA 1L6FA 1XIEA 2DVTA 1IT0A 4GXMA 2WK2A 2WM0A 1QI3A 1TV8A 2YDAA 2JIEA 2VRKA 2PGRA 2X16A 1EJTC 3P60A 3U4AA 1F61A 1UHVA 2ZX8A 3C4UA 3TEVA 3BAXA 3EX3A 2RJHA 2J7EA 1JZ7A 5BROA 1GOKA 1EL3A 1DTUA 4H7CA 1LQ0A 3WUGA 2DDXA 3P61A 4ERGA 1QPRA 2GQ9A 2QJIA 5GJNA 2FZ8A 3BAIA 4JHOA 1W3JA 4JN6A 2I57A 4HK6A 4G9PA 1WCGA 3LPOA 4ZFMA 1J10A 4JFUA 2ACUA 3THUA 1EGZA 2BFGA 2J9ZA 4GVHA 1MRAA 2X7WA 1HIZA 3TTQA 3VINA 3VE7A 1DIDA 4TXEA 3C2YA 2PD5A 3LCLA 3LGEA 1E1CA 1TA3A 5F2LA 1QHOA 1I9CB 1GQIA 4UZSA 4DJDA 3EBVA 1J9YA 1IXNA 2WWDA 2J8GA 4AY8A 1GYLA 1BQCA 3A3XA 3ZWTA 4D71A 2FFIA 2CU0A 2NQ5A 5HA7A 4PTVA 3U8GA 4BJHA 4RNHA 1VIWA 3SCWA 3N14A 3KOXA 1VLIA 4OBSA 3N19B 5AHNA 1O95A 3IIVA 4C6MA 1OF8A 4P2VA 2WSYA 1J0IA 1DBTA 1NELA 1NP2A 2ZZ5A 3KOYA 3QYQA 3O07A 1K4HA 3BOLA 1E9ZB 4GUJA 1XG4A 3IACA 4ZENA 1P0EA 1TWSA 2ZFAA 4WRHA 4ERAA 1O1ZA 5TQLA 4XZIA 3WUEA 1YE6A 3UZZA 3CT7A 3GHUA 4HQVA 1YX1A 4BF7A 1UR8A 1UBSA 5A8OA 2BB0A 1D3CA 2GJRA 3L5LA 3VZYA 2OX4A 3W1PA 3KM8A 4MGGA 3OIXA 3NIYA 1DTNA 1NFPA 5IFPA 1RR2A 3VCRA 5A6LA 1M7JA 1CNVA 3EOUA 2FMNA 3L65A 3MP4A 3BSMA 3OLEA 1PB0A 1B54A 1HJSA 4ZO9A 2ZRWA 1ISZA 3IV3A 1KA9F 3KBVA 2J47A 2QVNA 4HK5A 2YLLA 1YDYA 2GLKA 4PTDA 1WAUA 4D6DA 4MSSA 2CXEA 1X1NA 1A47A 3L4WA 1YXCA 4E8CA 1BXNA 1Q4NX 1VFTA 1V6UA 6TAAA 4AC1X 5K9DA 3UFYA 1L8NA 3CUIA 3EWWA 1HT6A 4RXGA 1RQEA 1XJBA 3VGEA 4FB7A 3QGAC 4HSHA 4NILA 2PU1A 3P93A 2QCEA 3P5YA 1IWBA 3W38A 3ANVA 5DN1A 5C7HA 3DFPA 3M0LA 2OB3A 1WE5A 2V30A 5F1UA 5GQBA 5HATA 3WF0A 1U1JA 1LL4A 1XLCA 1FHLA 4DJDD 1OHLA 5IOBA 3E9AA 3GXTA 7REQA 4JCLA 3LQGA 5LSMA 5FAJA 1CZ1A 1FH9A 4CCDA 4JTUA 2Z25A 3N2TA 4EE9A 1K4GA 4K8GA 5KZMA 1YNQA 1YBQA 3OGSA 4DO6A 2IXUA 1IEXA 1DJIA 2JE8A 5D9MA 1UP2A 2Z27A 3GDRA 1O7AA 3GX9A 2PDGA 3AHTA 3WEOA 4PH6A 4Z2IA 2QR6A 4QJ5B 4QSHA 4EX4A 3L0GA 4GYJA 3O0KA 3BCJA 1G69A 3BPWA 3GHTA 3IEBA 3PJTA 1PKMA 3QQWA 1VLWA 4QLJA 2OR2A 4WSKA 2PGFA 4JTFA 2BY3A 4LY8A 4O53A 2D2OA 1W5OA 1UKOA 3FV9A 4L9ZA 1W37A 3LUTA 4AY1A 1V7AA 5G2HA 2EJ1A 4NRSA 5T26A 1RP9A 2LLEA 3RLGA 4K6AA 3WBEA 1PX4A 1CXEA 1NP0A 3GHRA 2VEFA 2P3ZA 2J7BA 3GNDA 1XGDA 3V1HA 3IIZA 3W7MA 1A5OC 3N6QA 2PBGA 4Q8MA 1GYMA 3EA1A 4IFKB 4PBFA 1BLIA 2WMJA 3GNOA 2I1OA 4LFYA 4YS1A 2Y1HA 3W73A 4R27A 1IT7A 4ACZB 4DUVA 1Q7MA 4HZ8A 2HRWA 1X1ZA 2VDGA 1PHWA 3VX1A 4CD8A 1WP6A 5CBIA 1FWNA 4R34A 5FJUA 2QW5A 2QUMA 2J9XA 1FCUA 4C65A 4X9SA 1FKWA 2AMXA 4CNNA 3WMCA 4IFKA 4AQLA 4S23A 4Q6XA 5CSYA 1E3ZA 4LAOA 1PTAA 3D6NA 3O1NA 1TTPA 4OOZA 4AU0A 4C90A 1GKRA 5D2XA 3H7VA 4LAZA 2DSUA 3LG3A 3PPFA 4IT1A 4DZHA 1SR0A 1T6MA 3FA3A 1UA7A 3GYEA 1QXLA 1UQYA 2QULA 1LT8A 1Z6KA 4G2DA 2D69A 3IUIA 1RVGA 2ZRXA 3ABRA 1CDGA 5HULA 4NF7A 5D02A 1B4KA 4MB3A 3W7IA 3EB4A 1QPNA 3IS4A 5EL1A 2XSAA 4XTIA 5FF0A 1ELSA 1KFJA 1JCLA 3CUXA 1BSIA 3G1VA 3N3MA 5I7GA 1H09A 4P5UA 5FJTA 4S3AA 3H2CA 4RPQA 2GWNA 4LB3A 1KB3A 1OD0A 4YVXA 4KWWA 5ECUA 4P7OA 5DX7A 2DJLA 5HXMA 4GVGA 4LS2A 3QQ1A 1XLBA 1KLZA 1TJ2A 4UTKA 1UR9A 3E2VA 1QNOA 3WO8A 2Z28A 4NX5A 3GTNA 2JGQA 3KWSA 4IPJA 3NURA 1JZ3A 4NL1A 3DFYA 1IT8A 1I4NA 2C1GA 3DGRA 3R2GA 5CJMA 1X7IA 1NOUA 5LGZA 2XH0A 3MU7A 3LM7A 1CGWA 1EHNA 5HR6A 3GTIA 5M3WA 2YYUA 3NZ1A 4GH3A 4G5DA 3T2QA 1TB3A 1DJXA 3BG5A 3C2RA 1EDTA 5C8BB 4AXNA 1GOXA 5TIMA 1AVAA 4UB9A 3WJXA 4F79A 3KL5A 5AHEA 5G2WA 1UOZA 1RXOB 3ZSSA 3C86A 3CUZA 1QAPA 2VFEA 4DM2A 4REQA 3GIPA 1YKWA 3KTSA 4HMNA 4A3RA 1FDZA 1XBYA 4ASTA 2XUCA 4I9TA 2PODA 3UWVA 3BOFA 2G3IA 3TYUA 3DYOA 1IGSA 2VOMA 4HA0A 4D6IA 3W4RA 4AZ6A 4QDWA 3OJGA 3FDKA 4UFJA 7PTDA 1ECEA 5E1QA 4G7FA 3ZJ6A 3PUDA 3PZOA 4JR5A 4MUZA 1ZRQA 1CT5A 4LSBA 1WUFA 4UFIA 1WA3A 2RDTA 4PSRA 5BWAA 3S1XA 2PTDA 3WLNA 4HSOA 3NAVA 1W17A 3F4CA 4D1IA 4M1RA 3QRHA 3AMCA 4TQTA 1BGGA 2Q6ZA 3DEQA 1ME7A 1JCTA 2PCEA 2VUYA 1V79A 4NIRA 2X0YA 3GR4A 4HKPA 3FGCB 3STGA 3VFCA 1KXQA 2QCMA 3EWYA 4Y9PA 3M0IA 1TMQA 3PANA 4HA4A 3STCA 5CPQA 1CW2A 1OGGA 1XS2A 5GPRA 1JG9A 2PA6A 2YA1A 4PL2A 2XIIA 4IJRA 4JKKA 4R5EA 3TAOA 4C6JA 4DYJA 1OJXA 4PMZA 3ZM8A 1BRLA 3NQGA 3ABQA 4UXDA 2D23A 4D2JA 4PEEA 3CL8A 1KFKA 1JCYA 3K4AA 4TTUA 1ODUA 1DQUA 2D3NA 2CLKA 5DXXA 2J79A 2NWRA 1MI3A 4O1EA 3OHMB 1TKKA 2UV8G 1CGUA 1MZRA 3E38A 3RM8A 1VBRA 3RM4A 4UQAA 1AMYA 4IIGA 2PLCA 5A5WA 2REQB 4F48A 1P48A 3MB9A 3EOLA 2B7PA 2C0AA 4DWSB 4RNIA 1UR4A 4PCPA 1UYQA 5CGQA 4HU3A 3WK0A 5I07A 2PP1A 2OWWA 2G50A 4PCTA 1A49A 4QG6A 3VGGA 3HQNA 3MSRA 2OZTA 4JIIX 1LP6A 2CBJA 1I60A 1F4HA 3THAA 5EFDA 3PZTA 2QLYA 4M6PA 1EQCA 1QK0A 4DY1A 1UP3A 1HF6A 3F5LA 3RITA 4JYFA 1EC9A 1XFBA 3NZPA 4YTRA 2PDBA 1F07A 3J7HA 2GZXA 3OO2A 4K38A 4FHAA 2HMCA 2HPMA 1ZTVA 4WLCA 3S9ZA 1PHQA 1FP9A 2UY2A 1JCNA 1LLWA 4WXZA 4KERA 2C19A 3NSNA 1LROA 4PL1A 1E6ZA 1TZZA 1U5JA 4L6HA 1V3HA 3VD5A 4TIMA 1ISXA 2OKTA 3GAKA 2E6DA 2B7QA 3VNDA 4A22A 1UC5A 2CBVA 2PC4A 3IVUA 4HU8A 4D8ZA 4PRRA 3BL3A 4NJIA 3WH6A 3PZIA 5I06A 3V0TA 3N4FA 4H8UA 4W7UA 1E73M 4NKCA 3W7RA 3VOHA 1EWEA 1QO2A 3CTLA 2QZRA 2DFAA 1OZQA 3EEGA 1PAMA 3CT2A 4AWEA 3M6DA 1XIJA 2V67A 4IMCA 3LCGA 4IGMA 1RJQA 1YQ2A 1XGEA 3HV9A 4DJEA 3M7WA 3SURA 1F73A 4XBSA 2C1IA 1QT1A 3B9AA 1M03A 2QVHA 3E0FA 4IJBA 4QCFA 2YB1A 3VUSA 3TROA 1IXOA 4JHZA 4F0RA 3WK3A 3TONA 1K70A 2ZUWA 3OVGA 1XC4A 5DCDA 3R5EA 1LUCB 3O15A 2E5BA 4AG0A 3PWAA 2YLAA 5D4YA 1R3SA 1CBGA 4NZ3A 2VT0A 3AISA 3NQCA 1XD1A 2NQHA 2J7FA 2YXGA 3HIJA 1LBLA 4DBEA 4YTQA 1P0NA 3MJMA 3C2VA 1H62A 2XDFA 4JZ5A 2EEXA 1QMLA 3S4TA 1JULA 3HGOA 2J6VA 2YCEA 1ZP3A 2PTXA 1XP3A 1RY8A 2VX6A 3WJSA 2YCIX 2QJGA 5AC4A 1PIGA 3WDPP 1GTHA 4X2RA 3WQWA 4F9JA 3G5EA 4WOQA 2EPNA 1V4YA 3H2OA 3CO4A 4LB4A 1JNDA 4Y8FA 1VHNA 2GJXB 1RZMA 3H53A 4DWSD 2NX9A 5I03A 1OYCA 2ZYFA 1P1XA 4MZYA 2J24A 5BRQA 1KLYA 2RDWA 4KPLA 1PJ9A 3M47A 3W28A 2OZ0A 4N4QA 1XQLA 3BJFA 2BV9A 3LZ5A 2JALA 4LYKA 2DZAA 4L4LA 4IMAA 2DUAA 5A8PA 3C6CA 2X8RA 3MMUA 1V0NA 3P14A 2O9RA 4KWUA 2EGZA 1H7PA 2PRMA 2DV0A 4S2BA 1QO5A 3KL3A 2A21A 4DO7A 4YN5A 2CZ5A 4Q33A 1E0VA 4CN6A 4FXFA 2OZ8A 3TR2A 4CNSA 3VZZA 3AJXA 4IXXA 4GIAA 3E5BA 1GPFA 3N9SA 4NJHA 4E8GA 4K39A 4Q8VA 3VOFA 4E5TA 3IANA 3LSCA 4DJED 1EGVA 3N2MA 1E0XA 2EPKX 3A3HA 1UC4A 4A8LA 3GTXA 2NWSA 2R24A 1CB2A 3EXRA 3PN8A 1ONRA 2ZX6A 3VCCA 5BNKA 3FYOA 2TYSA 3C3NA 4ICCX 2HCVA 3LEPA 4H6QA 5TD4A 2Y89A 3LHTA 3F5KA 5IHSA 5M1TA 4NZ5A 4B3ZA 3UJFA 5LNWA 4AWTA 1O60A 3L4VA 4A8NA 2G96A 2VQTA 3W1UA 3V36A 4UMAA 4P8WA 1KW1A 4ZA0A 3BICA 1PIFA 4TMCA 2QHAA 2VQUA 1EUNA 2PRLA 1WPCA 4DHGA 1EJXC 3H54A 4GXPA 1FHVA 5GNZA 4E3VA 3B97A 2G97A 4CQDA 3WJWA 1VH7A 1XLFA 3RR1A 3ZJKA 5F2IA 2Q8ZA 4DNHA 2CKRA 4S3EA 2WMIA 4JEJA 3TC7A 4EKJA 4YTUA 3KCOA 1UR1A 3DC8A 1Z42A 1TIWA 1E6QM 4BQ4A 2OO0A 3G1DA 2P0OA 3LHUA 1D3GA 4HPHA 1THFD 1GEQA 3GVWA 4FS9A 4D6EA 3BGGA 4HMCA 2DZWA 2EF9A 4TOQA 1VPYA 2A3HA 4IMEA 1VJSA 1F3TA 4ORMA 3IIXA 5HBFA 4PBGA 3GC5A 2MUCA 1PYFA 3AS0A 1PKNA 4CNTA 5TNVA 2TPSA 4DB7A 3HPAA 3G6LA 2SFPA 1K1DA 2Q3OA 3EPMA 1R9YA 4GYKA 3VO0A 5EBAA 4W5ZA 4BQ3A 1ICSA 2WJDA 1RJRA 2HV5A 5C0QA 2WZEA 1NIUA 1S39A 4JTAA 1SMAA 1Q13A 3R11A 1W54A 4S3JA 4GYFA 2W0UA 4RNFA 2WCSA 1EDQA 2X7VA 4F0KA 1M1BA 4H00A 3SSJA 3UR7A 3GZAA 4QG8A 4NNAA 4OBRA 4DEFA 2GFTA 4BWLA 3FYPA 3S5YA 4MFEA 3AYSA 4RV3A 1V6YA 4CQAA 1J11A 2NQZA 4MVAA 1OCJA 3BCFA 3UNTA 3A12A 2YIHA 3L2IA 1DL3A 4DJFC 4D72A 1ZAIA 2W62A 1GONA 2W66A 1BWKA 3GBDA 1L2QA 3P82A 4HMEA 5BZAA 1P0DA 3VUPA 1TTJA 4DELA 3PWIA 1NEYA 4GVFA 4R7WA 1ISVA 3CHVA 1R6WA 1Q2RA 3B03A 4I9AA 1M04A 3BLLA 3WJYA 1EJUC 2VTFA 2CLMA 4ZFCA 1NFBA 4FIQA 1CXKA 3TH6A 4EWND 3FXYA 4GINA 3M0MA 3T81A 5ABHA 1K6WA 3MA8A 3VIHA 1XLJA 3ZJ8A 1EBHA 3PK7A 4NVTA 4KS0A 1A3XA 4WD0A 5FEZA 4QGCA 4KW2A 3VAVA 2V63A 3AMDA 1W1A1 3O3RA 2CBIA 1V3LA 3URNA 2PP3A 3XIMA 4CGTA 1FWAC 1DHPA 2AOSA 2PDXA 3B4UA 4ICMA 4WF7A 1QW8A 1Q6OA 3S5NA 3NL5A 3QR3A 1QNSA 2E9LA 3SFKA 1LL7A 2VC5A 2GVEA 4UFHA 3UG8A 4MB5A 3A6OA 4MTVA 4LUSA 4ZTYA 4UC5A 4Q3MA 1XQKA 1F2JA 3GWQA 3OA3A 1FHDA 3IUHA 3P81A 2Z29A 3WH9A 1EIBA 4Q7NA 3AYTA 1Q7QA 4G56A 4JIHA 1RH9A 3FDGA 4JL2A 3ZO9A 1MRQA 4E3TA 5D2WA 2NQ9A 4GI6A 5JBDA 1Q3NA 4AEFA 1UJQA 4JTHA 1CENA 2BOFX 2VZUA 3WQEA 3WF4A 3TW7A 3ARQA 4TX6A 4PUUA 2FTWA 3QKZA 3SSZA 1UBPC 3IJDA 3E0VA 1J8VA 1PCKA 1MDRA 3T09A 1GZGA 1VAHA 4TVCA 1UROA 3ITGA 3M9YA 4XTDA 4W8BA 3M7SA 3CZ8A 1RV8A 2VP8A 1VBUA 4XVEA 3EWDA 4MB1A 3IVSA 1HUVA 1NARA 4P7RA 1MO0A 1C90A 1GCYA 3QM3A 1QTWA 4C6DA 1R38A 3QTGA 4WY0F 5F4WA 4PBEA 4OQVA 2JEPA 1YPIA 4JEQA 2HBVA 2YW4A 2VX7A 1J0ZA 2IW0A 4E0CA 2Y0FA 2Y70A 4JKLA 2D1ZA 4G8TA 2J7GA 3GNXA 5LIWX 2ZUVA 3PY2A 2R1KA 4O0ZA 3W7QA 2OEKA 4Z1BA 1QDSA 2XIMA 1B9ZA 4EWJA 4AH7A 3P8JA 4UTTA 3MUAA 6XIMA 1XSIA 2VDIA 1XH2A 4BQ5A 4AD5A 3UYCA 4Y90A 4AFYA 3REQA 1Z44A 3NNTA 1CGYA 4MJ2A 5DRIA 1H4PA 1GW9A 3R13A 4IF2A 2H6RA 3CB8A 3RPMA 3LHVA 1MW0A 5AKQA 1NQKA 4ADTA 5AYYA 3NZRA 4ZVJA 1E6PA 3DHFA 3OLIA 4Z0SA 4O8RA 1WX0A 3T0CA 4EP8C 3RRXA 4O10A 5I79A 1X8FA 1B57A 2XIQA 4NUWA 1H7RA 5G4WA 3VDBA 3QBUA 1XLGA 1Q6GA 1W2VA 1HKJA 4C5ZA 2VM8A 4UQBA 1K03A 3BLEA 1JYNA 1R8LA 3PPHA 4JGDA 1FVPA 4POCA 4CEXC 1ZBKA 3LPFA 4K68A 3KP1A 1V77A 3QY8A 3CAQA 4KRTA 1KBLA 1GKPA 1DJHA 2ZZ3A 1GVYA 4U5KA 4WY0B 1DPMA 1PCWA 3MHUA 3UF9A 1K9DA 3UJRA 2OQLA 3W1AA 4FX6M 4KIRA 2FMOA 3CNYA 1ZBCA 2BG5A 3N2XA 2C6QA 1DJNA 5J04A 3WQPA 4C5YA 4A35A 1IXPA 4JTJA 2QCHA 1W1ZA 3AAMA 3UGVA 3IIOA 1W8SA 3XINA 1T0OA 3W1RA 2VENA 3KEHA 3VKKA 2RH9A 4PCSA 3KS6A 4RV8A 1QUMA 3T8LA 4H9ZA 1S2AA 3THDA 4O1DA 3VGHA 3H24A 4JNZA 3WDIA 1L6GA 3VFLA 1W1YA 1RK5A 1RUSA 4F0SA 3NSMA 4PUNA 3VD4A 3TZNA 1B9BA 3VKBA 1OIFA 4Z2GA 3WBXA 4WR3A 4K1GA 1UWIA 2OODA 3NVDA 3ANYA 2I9UA 1OQFA 4NJKA 3C8FA 1M6JA 2CETA 5EY5A 2WLYA 3AXMA 3RU6A 1MXSA 3T6CA 4UIOA 3WSUA 3H22A 4J3XA 3WQGA 1HJXA 1XLHA 1ITQA 1YYAA 3MYOA 4O1FA 3ZSTA 4B5NA 2FZDA 4B90A 3VDCA 4ZOCA 3F03K 1EGMA 4PN2A 3SY8A 1H5YA 1XLKA 4Q8NA 5E09A 2OYLA 2W6RA 1SMDA 1C8YA 2X2GA 2CWXA 3VDAA 4TU1A 2FHCA 3AI0A 4V27A 4D8AA 1HKVA 2QCCA 5AYZA 2MNRA 1WDWA 1SGJA 4MKVA 5ABTA 1JJKA 1HX0A 4RX0A 1VJIA 1C8XA 5EMLA 2DZSA 1WZKA 1OYAA 1EUAA 4JTIA 2W5FA 1J2WA 1DE5A 2O9TA 1WYIA 2Y62A 3C0LA 5XINA 1FH8A 3B0UX 4GGHA 4Q4MA 3MBDA 4AVNA 4OUEA 1JQXA 3PSWA 2FGLA 3B06A 4ZB5A 1MUCA 3H26A 4LUJA 3BLDA 5JBEA 3NPXA 3GDKA 1JPHA 2P0IA 3PBGA 3K8KA 4GQBA 5AHFA 1IE7C 2JGYA 1KGXA 4M6UA 3BG9A 3BJSA 1C9DA 4QIUA 3BMXA 2HK1A 1FX6A 2DEPA 5FACA 5F1VA 2ZDSA 4ATDA 5CSSA 4IQLA 1TPFA 4S1FA 3W1TA 3QTPA 1EXPA 1WDPA 4H9VA 3HGSA 1UKQA 2YDRA 2DSWA 3SO7A 1Q85A 2Y8VA 3DU0A 3SUTA 1F6KA 1FWWA 3WQOA 3AROA 4L1WA 3VPLA 1PZ0A 1EA9C 1TUXA 4GI9A 2R1LA 3WLJA 2OYMA 4JBRA 2TRSA 2D0FA 4Y6GA 2ZQ0A 1WOAA 2FGZA 1W6TA 2ZTKA 1OYBA 4GIYA 1S1RA 1Q2SA 1LYXA 1HJWA 2VR5A 3T2OA 1EOKA 4J3VA 3GVVA 3QV7A 5EMUA 1B30A 2ACQA 3B9EA 4U5IA 3NQ7A 4L4PA 1TV2A 4FPSA 1OGSA 3A4WA 1PDZA 4Q8OA 3GDLA 1LJYA 1A5CA 4QP0A 2NT0A 2WXDM 4DF0A 1ZJBA 5E0FA</