4JQ1A

Akr1c2 complex with naproxen
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
316
structure length
316
Chain Sequence
KYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C2
publication title Structural basis of NSAID selectivity for the aldo-keto reductase 1C family
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 117
structure length 316
sequence length 316
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4jq1A00
1Z89A 3NTYA 3LNMA 2PZNA 2WZMA 2PDPA 4JTAA 1A80A 1Q13A 2DV0A 2INEA 1AH0A 2INZA 4DBUA 1YE4A 1ADSA 4AUBA 5JH2A 3LQLA 3CASA 3DOPA 1X96A 2C91A 2IKGA 3RX2A 4XZIA 4JQ2A 5AZ1A 1R38A 3UZYA 2P5NA 1ZSXA 1Z8AA 4GCAA 3CAVA 4JTCA 3B3DA 2FZDA 4PRRA 3RX3A 4JIRA 1PYFA 3WBWA 2PDYA 3M4HA 4LB4A 2ACQA 4PMJA 2HE5A 1EF3A 2ACRA 4WDTA 3LEPA 4Q7BA 3LBOA 1LQAA 2WZTA 2IS7A 4LB3A 4PR4A 4XZHA 1QRQA 1ZGDA 1IHIA 1T41A 1XGDA 4XAPA 1FRBA 2HEJA 4WDWA 3LQGA 4JTRA 3G1RA 1GVEA 2HVOA 3UZXA 2BGQA 4XZLX 3M0IA 5C7HA 2ACSA 5KETA 4JQAA 1AH3A 2PEVA 4NKCA 2IPFA 2PDMA 3ERPA 1Q5MA 1QWKA 3LENA 1YNQA 1XF0A 1HW6A 3CV6A 4ICCX 4JTDA 3FX4A 4G5DA 2PDUA 4JIIX 2FZ9A 3BV7A 3CAQA 4JTQA 3V0TA 2R9RA 5JH1A 5M2FX 5LIUX 4FAMA 4FALA 2ISFA 4OTKA 4YU1A 2IKIA 2HVNA 4XK2A 4ASTA 4GABA 4DBSA 1X97A 1AH4A 4GACA 3EB4A 3FJNA 4PUWA 3UWEA 2PDIA 3UGRA 3V36A 3WBYA 3O0KA 1T40A 3COTA 4IJRA 3UZZA 1RY8A 2HE8A 1PWLA 2PD5A 3H4GA 3UFYA 2IPGA 1PZ0A 1X98A 2PDJA 2F2KA 4HMNA 1HQTA 4DBWA 3H7RA 1RALA 4GQ0A 1OG6A 4R9OA 4QXIA 4GQGA 3R7MA 2I16A 4JQ4A 5LIWX 3UG8A 2IPWA 1K8CA 4I5XA 4JIHA 4LAUA 1EL3A 2PFHA 4FA3A 1S1PA 3M64A 4DZ5A 4XO6A 4QBXA 4MHBA 1IEIA 2PDWA 2PDFA 3F7JA 3RX4A 2VDGA 4GIEA 4PRTA 4QX4A 3C3UA 1MZRA 3UZWA 3WBXA 4LBRA 4WEVX 1SM9A 2FVLA 3UYIA 1M9HA 5HA7A 2PDKA 5LIXX 1XJBA 3H7UA 3CV7A 3CMFA 3G5EA 3GHRA 3LUTA 4YS1A 2FGBA 2PDCA 1AZ2A 4RPQA 4Q3MA 5HNTA 3BURA 4XO7A 3N2TA 2NVDA 2CLPA 2IQ0A 3U2CA 1S2AA 3ONCA 2HV5A 3Q67A 3R8HA 4JQ1A 2F38A 3DN5A 5LIKX 4XZNX 4PUUA 3R6IA 2PDHA 2PDLA 4HBKA 3WG6A 3P2VA 1ZUAX 1Z3NA 2ACUA 1LWIA 3MB9A 1US0A 4WRHA 3QKZA 4L1XA 4WDXA 4ZFCA 3V35A 4FZIA 2BGSA 1YE6A 3EB3A 2R24A 2FZBA 3N6QA 4F40A 3GHSA 3O3RA 5AZ0A 3VXGA 2PDNA 1PWMA 2NVCA 4LBSA 5LIYX 1C9WA 3WCZA 4EXBA 4IJCA 1JEZA 1AFSA 1VP5A 3R58A 1ZQ5A 3EAUA 1S2CA 3ONBA 1UR3M 3R94A 2IKJA 4IGSA 3R43A 1PZ1A 2J8TA 2PDBA 2DUXA 2PDQA 1YNPA 4YVPA 3S3GA 4H7CA 3UP8A 2DUZA 4GA8A 3GHTA 4L1WA 1EKOA 4XVEA 1MI3A 3Q65A 2PF8A 2I17A 4YVXA 5HNUA 3GUGA 3D3FA 3LN3A 1EXBA 4YVVA 3LD5A 1Z9AA 3R8GA 2IQDA 5DANA 2PD9A 4WDUA 2HDJA 1AZ1A 1J96A 3BCJA 3MC5A 3LZ5A 4XVDA 3GHUA 4XZMX 4H8NA 2BP1A 3LZ3A 2IKHA 4EXAA 2QXWA 2ALRA 1S1RA 2IPJA 2PDXA 4WGHA 2PDGA 4JQ3A 1VBJA 4LAZA 3V0SA 2FZ8A 1RY0A 2A79A 3V0UA 3T42A 2AGTA 1MRQA 3BUVA 4QR6A 3KRBA
chains in the Genus database with same CATH superfamily
2QAPA 1FWJC 3LNMA 3VK5A 3SN4A 4HNNA 4I3GA 4NJHA 2H6RA 1WDQA 1XSIA 3BMXA 2CLHA 5D2TA 4CNSA 4DF0A 1Q6DA 2JKEA 4YPJA 3A24A 5I24A 1UH2A 4EPDC 5ABHA 1JCMP 2I5GA 2IKGA 5DQPA 3QPZA 1V6TA 2Z1VA 1VKFA 3PBVA 3TOPA 3VX0A 1GVSA 3AALA 3CTLA 2E25A 3KRUA 2E1WA 1TWWA 4GCAA 2TAAA 2NX9A 3K8LA 4UTHA 3SJNA 1O68A 3KVKA 1H0IA 5DRIA 2BHZA 4H01A 1MFVA 3VM7A 1KWGA 3TU9A 3M4HA 3T07A 1A5UA 4HB7A 3KEHA 3FDKA 4H6EA 1Q6RA 4LB3A 1QRQA 2ZUTA 1KM6A 3CZ8A 4HK6A 1FXPA 2X16A 3M0IA 2FDMA 1RQBA 4IICA 2OCZA 1W9DM 2ZZ3A 4QJ1A 2EAWA 3GG0A 4XISA 1AH3A 2NVAA 1ZAIA 3WELA 2FPTA 1KBIA 1JYVA 3BW4A 1HP4A 2CKRA 4NAEA 5BNKA 3N12A 1KR0A 4YTQA 3DAQA 4XBKA 4NASA 1TTIA 4Y7EA 4QE4A 1EC9A 1F3WA 4HNTA 1SW7A 2B7QA 3LMYA 3OVQA 4DXVA 5GPRA 2VCBA 2PU1A 1J01A 3BAXA 4BWLA 4TUFA 1A5OC 3W2JA 2Y62A 1AH4A 3TR2A 3KCOA 2QJMA 2FVMA 1BHGA 1FP9A 3G2GA 5CPLA 4YHEA 5LYRA 1VYRA 2YXGA 4E2OA 3W2LA 3RR4A 1HKKA 3BOLA 1UC4A 1NFBA 1XD0A 2C1GA 5ENLA 2QDHA 4QLKA 4O0KA 3IIPA 2UY4A 4HA0A 2DZBA 3UFYA 4C7GA 3M47A 4YYFA 3WQ8A 2P8BA 2Y0FA 3CUXA 4DI9A 3DEQA 1T6MA 2YA0A 1CI1A 4Y9AA 1M68A 1XKJA 3CUFA 2XWDA 3I6EA 4R9OA 5AYBA 3CPRA 4JKLA 4BA0A 3OGVA 2J4GA 3MPGA 4O4VA 4PUNA 1XPGA 1J79A 4OECA 1OIMA 4Z1DA 2YXXA 1NH6A 3KW3A 2VT0A 1R7OA 4GIAA 3LB0A 3UNTA 2JBMA 2OQYA 4MHBA 1TRDA 4GIEA 1W5OA 4QSHA 3H8AA 4LBRA 2XSBA 2X1TA 1JL8A 4OQVA 3DDMA 2YCKX 2HPMA 3MW7A 3FIGA 1N7KA 3VMNA 2VZVA 3CC1A 1GVYA 3R5EA 3SY1A 1OX5A 4XQ6A 3UU0A 5C8BB 1KCZA 3FJLA 3W25A 3KZSA 2VOMA 1G67A 5EMYA 1HFBA 1TTQA 4IQEA 2FDSA 3G18A 3EGJA 2GUUA 4ALDA 4B91A 5DBTA 5HNTA 1RVGA 1S2WA 3IANA 1N82A 3VNJA 2CLPA 2CLOA 1H51A 1XDLA 1GK8A 4MAVA 4WF7A 1Y5XA 3CQHA 1TJRA 4IIEA 4JDBA 5HPCA 3GWQA 1EP3A 3FKRA 1QAPA 4PCPA 2XGIA 3B9AA 3GXPA 4CN4A 5K9XA 1MXGA 1OCBA 2P8CA 1NJJA 5IFPA 7CGTA 3GVQA 5CBBA 1G0CA 2PSNA 3A9IA 4O52A 2D69A 3HZ3A 4UTUA 2YCIX 3B8SA 4YNGA 2VJXA 3PC0A 2VGIA 1EX5A 1QU4A 4IL0A 1V0NA 4JY8A 1GKRA 4OOZA 1GONA 4FOJA 5FJPA 3CAWA 1H1ZA 1OK6A 1C9WA 3ES7A 1Q85A 1E70M 4KEZA 3WEZA 5HATA 1ZCCA 4OWGA 1P0EA 3G3MA 3VNDA 3C0LA 2Y7DA 2YL6A 2DJLA 4IPIA 3E0IA 2D3NA 5HNNA 1UWQA 4Z0SA 3ZOAA 2Z1KA 3O8AA 1TFVA 2XHYA 1OC5A 3MSGA 4UR9A 3ITGA 4AD4A 1WXYA 4XKYA 4QIUA 4CNUA 4M1RA 1ZFJA 2PBGA 1TREA 4XUGA 2V2DA 4NYUA 3H26A 3NGJA 4QCFA 2V3FA 1UR1A 4AYSA 3Q65A 2IXUA 1PO9A 1E4IA 3W26A 1X6LA 2A6NA 1YRRA 1JPIA 4AIOA 3WNNA 1GJUA 1NDYA 3GUGA 3LV5A 4DJEA 3MHGA 1P1MA 2DZTA 1PDYA 1BXBA 1C8QA 4JNMA 1TVPA 5C9RA 2A5HA 4C5YA 4WY0F 1DWGM 4EE9A 1EUNA 4HSOA 4QDMA 1FHUA 2A3BA 4OBTA 2QF8A 2WLZA 4XZMX 1E5NA 1HIZA 1GKQA 2BP1A 2P1FA 3B4UA 3LK6A 5IDIA 4DXXA 2V8ZA 1FVPA 4R27A 2CLFA 1HZYA 4UTWA 4H1ZA 4M29A 4D6IA 4LAZA 1JZ8A 1FH9A 4ZOAA 2BOGX 4AVFA 2ZIDA 1O5QA 3W7LA 3NEVA 2PZNA 4DYJA 5D2VA 4O0QA 2TMDA 4AXKA 2WMKA 2INZA 3WLOA 4YN5A 2C91A 1CGUA 1B3VA 1B0IA 1DXIA 1R5YA 2YDRA 1R38A 2ZX6A 3AHYA 1ADDA 4R7WA 1CBGA 3PANA 1XG4A 1MRAA 4GI8A 3WUFA 2ZZ6A 3LPPA 4DLFA 3UXAA 3AUOA 2EF9A 3UA3A 3NUKA 2VZOA 4PTNA 1HL9A 3GM8A 3WH9A 3W88A 1DWJM 1W1TA 2HEJA 3UBPC 3QSTA 2O0TA 1S5WA 3G1RA 4NAFB 1YMYA 3UZXA 4UQBA 5D09A 1E56A 3OHMB 3CHFA 1VFHA 3OODA 3MO4A 5CAKA 1SSGA 1D8CA 1NQ6A 1OSEA 4YXGA 4B5UA 1D8WA 4CNPA 1E4NA 1HW6A 3CV2A 4QLLA 2E0PA 4H4IA 1UKQA 3AYVA 1KD0A 2J8FA 3NQCA 4E8CA 3P8JA 2WM0A 3YPIA 1VBUA 5HXMA 3DH7A 3W2KA 5HQLA 3C2RA 1YEYA 1E73M 3AWOA 4D6DA 3I10A 3M0LA 4F0KA 3GXIA 4YU1A 3W7PA 3UESA 3WQDA 4LUJA 5EA9A 2D2HA 4BQ4A 4RV8A 3WLNA 1SZRA 4JFUA 1DXFA 3BZJA 2VMFA 2WHLA 2VEMA 2XJ7A 1GVFA 4MWAD 3DUGA 2CYGA 1GYMA 3UVIA 1XPYA 5CH9A 1NIUA 5EGRA 2R1NA 4O4WA 2OO0A 1D7FA 3HB9A 1E0VA 3VVGA 1TELA 5E6YA 4ZBCA 3AS3A 4Z1AA 1E1CB 5BXRA 3MO7A 3LXAA 4MY8A 5CG7A 3EDKA 1E6QM 4HN8A 5FJUA 1D3CA 5G4HC 1M5WA 2OEKA 3TNBA 3JS3A 3LNPA 3EPOA 5A8GA 1JFHA 3VIFA 4FOKA 5M17A 3VKJA 5F2GA 1JDEA 4GUFA 5HAOA 1FCBA 4LWWA 1TPUA 3AS2A 3NQDA 5E0CA 2ALDA 2KZHA 3TQKA 6TIMA 4WJXA 3EWUA 2PFHA 3VNKA 4FA3A 1XC6A 3G6MA 4NY2A 1EA9C 4CLMA 4AD1A 4LAKA 5A1AA 2A3HA 1XLJA 4C6LA 4CD6A 2QCDB 4H83A 3R1ZA 4PRTA 1FH8A 4GH3A 2J27A 3NAVA 2W6RA 3CYVA 4KCTA 4WEVX 3WIJA 1QVBA 4WQ6A 1UPPA 4GUHA 3F2BA 1J0JA 3LOTA 3QH2A 3AMKA 3HF3A 1GOMA 3OEXA 3B9OA 1LG1A 4LUYA 1UR0A 1EEXA 3GTIA 1E1EA 4ZOEA 3H53A 2ZVIA 4X2RA 2C15A 1UOZA 2V2HA 2ATSA 2FGBA 4ZENA 4DJFC 1ONEA 2HS6A 3OVGA 4GQQA 1V02E 1WX0A 3CGTA 4ZR8A 3D47A 2V5BA 2PWEA 3S6TA 1A53A 1GYNA 3GYEA 3T0AA 2RUSA 2XWEA 3SIMA 1H50A 2VX7A 3HG5A 2WOQA 1I2QA 3CL6A 6TAAA 1MQPA 1QBBA 4MZYA 4AIEA 3WG6A 1KO0A 4QG8A 4HN4A 4QM1A 3EWZA 3HG4A 1L6SA 3N15A 3CQKA 4HHMA 4AEFA 2Y6ZA 2BX7A 3WFZA 3AMDA 1YPIA 1FWTA 3Q4DA 3GIQA 2VDHA 3W82A 2F6UA 3MT1A 1YE6A 4GXWA 3M46A 1HL2A 4N02A 5CZ0A 3GVVA 3UPBA 3GHSA 3HMCA 5I3JA 3BAJA 3KOZA 4JIPA 4UTFA 4F4RA 3GG7A 5AC8A 4N4PA 3VA8A 5LNSA 3QYQA 1JCXA 4J27A 1RD6A 3O6AA 1IQ8A 2P88A 2X2GA 4BHYA 3SN0A 1I6NA 2OEJA 4B5TA 3EAUA 1QASA 4G1NA 2PODA 3TSBA 3RFAA 4JN7A 2DUXA 4DJDA 1KB3A 4HMEA 5E0FA 2QEZA 4U2YA 1W2VA 5I3IA 5JXQA 5K3VA 3TXZA 4TTGA 1XKYA 4N9EA 5IBXC 1P5BA 3U0HA 3LMZA 3W1LA 3W7JA 5HUPA 1U22A 3NSNA 3FEQA 4ROPA 1V3IA 1GOOA 5E6ZA 1PKMA 3ITLA 1ISVA 1DQUA 3W6MA 4DF1A 1PB0A 2Z1WA 1YPXA 4XG1A 1FDYA 1OCQA 4YHGA 2F61A 5HJXA 3ARZA 4AMAA 5ABGA 3A47A 2OYMA 3CUGA 5GJPA 1XV8A 4C60A 1A5LC 3N4FA 4LPCA 4UMBA 5DANA 2ISWA 3TN4A 1XW8A 5HWJA 4GG9A 4YTUA 4DX3A 4A8LA 1EGMA 1V6YA 4A8IA 4S3CA 5MF5A 4Q6JA 1JF5A 1RPXA 3LZ3A 1SR9A 2GZXA 4AIUA 3TMLA 1S1RA 2IPJA 3HA1A 5HQEA 1VCVA 3GD6A 3F1QA 3M7SA 4HA1A 5H6HA 4C7FA 5HUOA 2FZ8A 1LT7A 5I09A 1UROA 4L56A 2AKZA 1VJSA 1XHGA 4ZQNA 1EWDA 2ZX9A 2GSHA 3OP2A 4KESA 2VGFA 5A8QA 1BG4A 5BU6A 3IIOA 4O13A 3HG3A 1UQZA 1LCOA 1E72M 3U57A 3CIWA 1CTNA 3GY1A 1YE4A 5DMYA 2W91A 4A4AA 2VX5A 2V5DA 3T4CA 3ECQA 3PZVA 3BGGA 2OODA 3U9IA 4H9TA 1MSSA 1XUUA 5GNZA 3MMUA 2DP3A 1L6FA 3SRDA 3W6YA 1RSCA 2PC8A 3RMJA 3OZYA 2GLKA 4TMBA 4ADTA 3K30A 2RH9A 3SCNA 1V08A 3OHIA 3LEPA 1KRMA 4ATDA 2C0HA 1S5NA 3V5OA 1X1NA 2EPOA 4W9TA 1ZB5A 5K4XA 2OR2A 1ZHAA 3LQGA 3MYPA 1I1WA 1GVEA 5FI8A 3THUA 3UGVA 3TQ0A 5C7HA 4Y9OA 1YHTA 2Z2BA 1BF2A 2BY3A 1MYRA 2V3EA 4PMNA 2FH6A 3AJXA 4NKCA 2NV2A 5LGXA 1OFAA 2A7PA 1SFSA 1UD8A 1T96A 3ERPA 1A0CA 1EHNA 1A3HA 3FXGA 5C5YA 5CXPA 5B7YA 3D46A 2X09A 4DNHA 1SZGA 4IQLA 1E6RA 3VGHA 2YYTA 1WB0A 3SCQA 3LI1A 2WZIA 4WOQA 4NX0A 1B31A 1G4PA 3S2CA 3EXTA 1C7TA 2ANUA 4FAMA 3WJYA 5GJMA 2YLLA 3GU2A 2QVNA 3TW9A 1SW0A 4XK2A 5EFDA 4C6MA 5K7JA 2V82A 3WH6A 4JEQA 4M82A 3UCDA 2NSOA 2PDIA 4MM1A 3V36A 1B54A 1ZBKA 3PSVA 4UFMA 4FX8A 4JKKA 3M5VA 4MZ8A 2GQAA 1CXFA 4UBPC 3GRIA 2BLEA 2E6FA 3PY2A 5A6LA 1UIPA 1RH9A 4RZ5A 2VELA 4BKNA 4JFVA 1FA2A 3N04A 1ICPA 4ZQCA 4BZYA 5D03A 4LW7A 4HMNA 3WD0A 4CCCA 3SCRA 5IXEA 3VO0A 1CDGA 4FMVA 4DAIA 4HZ7A 3RNDA 1G5AA 1R7AA 2DDXA 2GJXA 4W85A 4JTFA 1QPRA 1UZ1A 2Z2UA 4UWMA 5I3DA 4Q6XA 3GTFA 4NILA 1P6WA 5FEXA 1QMLA 2NWSA 1V51A 1L6GA 2V0TA 3RX4A 3IIXA 1ISWA 3GR4A 5A2BA 2YBTA 1LORA 2YZ5A 3OB8A 3S0CA 5AN7A 1L8PA 3IUDA 3U8GA 1V6WA 2FPVA 4A22A 1M9HA 2ZUUA 2DSKA 1HVXA 4D6HA 3IVUA 4PMYA 2EG8A 1B3YA 5A69A 5KINA 3C61A 4GO9A 1TMHA 4GYKA 3HBLA 4RX0A 3W1TA 4FLOA 2D23A 1W6TA 1YDVA 1WP6A 3W2UA 4XTIA 2DT3A 4MWAB 2G3FA 4KETA 3L2IA 1P1XA 2HTMA 1LL6A 1V7YA 4LEFA 2VFGA 1V02A 5FEPA 3H2NA 5CSRA 3GE7A 4IMAA 3CHEA 3DN5A 2PTYA 3CIVA 1OHLA 1ZBCA 1JRBA 1ZENA 2EXOA 3EEGA 3NL6A 5ABTA 1RJPA 1F05A 3WUBA 3NQEA 5A94A 1LWIA 3VNZA 1VEPA 1EHAA 4QEHA 3QBUA 2O9PA 4ZFCA 3R13A 4LVDA 4F40A 1J2WA 3PG9A 4HMCA 4NNBA 3M41A 5LXEA 2WB5A 3BCFA 3M0HA 1XDJA 5G1MA 3NGFA 1MDRA 2XTKA 4TVDA 4LV4A 5A8MA 1BVNP 3HN3A 3LCIA 1TWDA 1Q6EA 1CXLA 3TC6A 2VR5A 2V9DA 2BVTA 5H8PA 3ALGA 2BB0A 2OSYA 1PL9A 1F4AA 4FF7A 2XN1A 1FWFC 4GQRA 1EP1A 2GGEA 1N8WA 4KCVA 3VNMA 1FWHC 3MKCA 3N2MA 2CCRA 4B2DA 5FEZA 2UWFA 4PUEA 1LOSA 1OCJA 3I6TA 1J5TA 1EKOA 1ZJHA 1MI3A 4R7JA 1UP0A 5D05A 4IXXA 1BD0A 1XGEA 2P10A 4P7RA 1L6WA 2I17A 3UR8A 1XIEA 4JHMA 1YKWA 4PRWA 5I77A 2F9RA 4BI5A 5AYYA 3P0WA 4INFA 2H3BA 4HZ8A 1TPB1 1GZ1A 1JPDX 4UQCA 3IJ8A 3WH8A 3H54A 1SZEA 4X3ZA 3ZWSA 1MNSA 1TO3A 2HDJA 2YKKA 3NYZA 4Z08A 2BG5A 1HKVA 4BWLC 3C8NA 3BCJA 2J62A 2OX1A 1REQA 3WNOA 4UTTA 4IQDA 3APTA 1TQJA 4MNMA 5GJNA 4ZO6A 4F66A 2XFYA 1KTCA 4L5ZA 2DH2A 1LBMA 2JKAA 4UFJA 4HCHA 5A8PA 1Q8AA 3T42A 2GQ8A 4AC1X 4KEVA 1JDDA 4UQAA 3N2BA 3NCOA 3LHUA 1IWBA 1KRBC 3F5JA 3WH7A 1F8MA 3GNXA 4JTAA 1ZJAA 1Q13A 1ODUA 2Y7GA 2MANA 2QPXA 1UCWA 2G8ZA 4L6OA 5AY7A 1X96A 5LXXA 1R2RA 4Z17A 2DSWA 5AVNA 1VQTA 3VCNA 3CQJA 4F2TA 3IJDA 3UZYA 5I78A 3LGDA 3QJAA 3EB2A 3WUEA 1EJ7L 1VGAA 1VR6A 4PMJA 3A12A 2EPHA 4AZGA 1JZ2A 3QXBA 1R8LA 3FSUA 3AIRA 3II1A 3GFXA 2PWFA 1MEIA 3U2ZA 3CHCA 4V1XA 2J8GA 3G1YA 2ISVA 1FDZA 4AISA 2WSKA 5TIMA 3AHZA 3LSCA 3M1ZA 1EJXC 4F48A 3IV8A 3M5ZA 2HVOA 3TJLA 1WBHA 1P48A 5JIPA 3SUTA 2BOFX 1VZWA 5C7VA 5HANA 3T0DA 1TMQA 3VI2A 4MKNA 2PDMA 2CU0A 4L4PA 1TZ7A 2ZXDA 5A6BA 3CV6A 3FX4A 3BPWA 4A3YA 4M24A 4I6KA 2XFFA 5AYXA 3GU9A 3POCA 1X1OA 1DJYA 2O4MA 1KBLA 3RR1A 4RE4A 2AOSA 4CU7A 4DUWA 4MB4A 3GLCA 4PUKA 3C0SA 2BNJA 4RZ4A 2CPUA 4H9MA 1LTDA 1QNOA 2YFNA 3IUIA 1VLIA 3BAWA 4GUIA 4NI8A 3EB4A 3RLGA 1TPC1 4PUWA 3WQ5A 2P53A 3WY1A 3IGHX 1W9VA 3WBYA 3AYTA 4R85A 4GH1A 4MB5A 3UERA 3L4YA 1O1HA 4RDVA 5IHSA 4HK7A 2H8XA 2GK1A 3E3HA 4MJ2A 4O57A 3SCOA 4IFKA 4EK7A 1XLLA 2QIIA 2XH2A 2JIEA 1CLVA 2V2CA 1W3HA 3TJ4A 5DT7A 1H7PA 2CLKA 3NIYA 4C6JA 2ZC8A 4C6FA 3ITXA 3FA5A 4M80A 4BR1A 3DBNA 2Q71A 4EAYA 3MTWA 1PYMA 2Z29A 1IYXA 1H60A 3RILA 1W9PA 4FB7A 3LHWA 3PTMA 3MKKA 4N9BA 2RJGA 4I5UA 1E6SM 4ES4A 4IHCA 1ISZA 1BPLB 2PGWA 3UCCA 4IF2A 3U6WA 5J5DA 3MDUA 3MCOA 2P0IA 4KRUA 4LF1A 2VVSA 5CPMA 4Q8OA 5BXTA 4AD5A 3S42A 3S4TA 1KFBA 1MW2A 2FB2A 3TONA 1JPKA 1XLIA 2WMJA 4B5XA 3PJUA 3KWXA 4JKMA 3WFAA 2D20A 2WSRA 3ITTA 3A6OA 5EFFA 3IARA 3DFOA 2RGMA 1HXJA 1GCYA 4XZWA 2BASA 1AL7A 3ITYA 4LVBA 4GISA 4UTWC 2NT0A 5FAJA 1VFOA 3N1AA 3LRLA 3BQ5A 5F4SA 1P4CA 4J2MA 4JTEA 4DWSD 2ZE0A 1PS9A 3BOXA 1BWVA 5CSSA 4N6EA 3GO2A 2P3EA 1FFRA 3O05A 3RIKA 3QN3A 3VIHA 3A9BA 3SURA 5BXPA 4E2DA 4IMCA 4E3VA 3W9ZA 1XIFA 1OZQA 2O92A 5T9CE 3ATZA 4V1YA 4ZSUA 1AL8A 1UUQA 4GBDA 4GXMA 1LYXA 3P74A 4HK5A 3W1XA 3KCLA 3S2NA 1XSJA 1JFXA 5K2ZA 1TTPA 1LQ2A 2W4XA 1KM4A 3H2EA 3O3RA 1Y5VA 1ECQA 4FF5A 4QP0A 2WHKA 3QGVA 2OGJA 2YR1A 3LERA 5LIYX 1ICQA 4WX2A 5E5CA 2WJEA 2OB3A 4DI8A 4W8AA 3LCHA 4WKHA 1MO0A 3NQVA 5LGZA 4MIMA 2AL2A 4LFYA 1ZQ5A 5ABFA 1HKWA 3AYRA 3PS7A 1A5KC 4EX4A 2W61A 1W5PA 3DG3A 3CUIA 2PB1A 5DXYA 1E51A 1K02A 1XYLA 2RJHA 1DJWA 2J8TA 3O0FA 2EPLX 1KM1A 2P0OA 1BXNA 3U2EA 5KEZA 2FKPA 2NW0A 3DYPA 2WJZA 1H61A 2JIWA 4I9TA 5B7ZA 1DTNA 1WXZA 5I2UA 3GW3A 1TJ0A 4W93A 1FWAC 3ARWA 2NV1A 3LBCA 3GAKA 3SRFA 2WJFA 1OGBA 2I9EA 2XVPA 1GUVA 3VTRA 2WMIB 4JTHA 4QG9A 2ZRYA 1R3YA 2DQWA 1A5MC 4DM2A 3A5VA 2DQXA 4DM1A 3MQTA 4UQEA 3C2FA 1XIBA 1F6KA 1Z32X 3T78A 1H62A 3PWGA 2J7BA 3AQUA 1XIIA 2CBVA 4XX6A 3MKVA 3WBAA 1O5KA 4E3TA 1W5NA 5A8NA 1I75A 3VOCA 1EZWA 2VKZG 2ZZ5A 3GHUA 4ZE5A 4H8NA 3QZAA 5PTDA 1TV7A 3GDLA 4S39A 4WKFA 4H3DA 2OT1A 2PA6A 2QMKA 1BEUA 1A0EA 1KFLA 2VR2A 3CHDA 1VBJA 1B4KA 3W7KA 4FLSA 4IFRA 3LV6A 4CQ8A 1YQ2A 3EDDA 3A22A 3AC0A 4PZVA 4WXZA 4QE1A 3SCSA 4FNQA 3SGUA 2UV8G 1SJDA 3L2LA 1RP8A 3CUZA 3FOKA 3B8DA 1A80A 3GNDA 1Y65A 3MUAA 3ABZA 4UTMA 4IFOA 4US5D 3WN6A 1LM1A 4JTIA 1T8QA 3LHVA 1FOBA 1FWCC 4Y90A 2CZEA 2F8QA 3NPUA 3RCYA 3RX2A 2JF7A 3E38A 2DIJA 4JQ2A 4I90A 4ORIA 5U7SA 3SGGA 1M7XA 4GZ7A 4FIRA 1ENUA 1VEMA 4WY0A 1UR2A 4JTCA 4OBSA 4RK8A 5DMNA 1C8VA 2YCJA 2XH7A 1BAGA 4WKAA 1M7PA 5C2GA 5HWNA 2ACRA 1VBHA 3LA4A 3STCA 3PSWA 1JDAA 4LNCA 1ITQA 1G01A 1IHIA 1TE1A 5BU9A 1H49A 4OFCA 4WHBA 1VPXA 5A3HA 4KMQA 4OOUA 3L4ZA 1D9EA 1B3OA 3PZTA 2V63A 3C6CA 3E5PA 3ZMRA 1LT8A 5KETA 2E40A 2CZDA 2Y2WA 1V0LA 2OWCA 2C13A 4FXRA 3CU2A 3PZNA 1TPFA 1YNQA 3U2OA 4MLJA 1PBGA 3TX9A 3MMDA 4UXDA 4DRSA 1EOMA 3WZ0E 4QJ4B 2PDUA 1G9HA 4TQTA 1IZKA 5CJNA 4FS9A 3L2MA 1ZCOA 1FQ0A 1W3JA 1UMYA 3LTSA 2CLLA 1THFD 3B06A 5EMLA 4N4QA 1ME9A 1ONXA 3DC0A 1KTBA 2DEPA 3NSXA 4E0CA 2HVNA 2HPIA 3NQMA 4DBSA 2ZRUA 1Z69A 3FJNA 1Y7VA 1Q66A 2B7NA 3WLRA 2VYOA 2VZSA 1M3UA 4QJ3B 4A21A 1VHNA 2ZX7A 5AOUA 4QE5A 4PFHA 5C2XA 5J04A 3WDRA 4B9ZA 4GJIA 2O4QA 2XIIA 2ZZ7A 3BL3A 2YDAA 3RYSA 4D72A 4B3LA 2F2KA 3N6HA 5BRQA 2DVUA 1RJQA 3HFYA 1A49A 4ACYA 4IMDA 4ORMA 2Y70A 1P7TA 2CLEA 4RUBA 2VNCA 4DJDC 1I0DA 3N29A 3SADA 5KZMA 1XLMA 1REQB 2B7OA 3ANUA 3QZEA 5JIWA 1KW1A 3VKDA 4BQ3A 1HT6A 2BSLA 2RKXA 3IJ6A 1U1JA 1R86A 7XIMA 1S38A 3A4XA 3S5NA 2VDGA 2PGFA 1HL8A 3HPZA 2VEGA 3WLJA 3NQAA 1AMKA 2DFAA 4IISA 3O16A 4K2SA 2G37A 4LS1A 1K7XA 4GYPA 1T0OA 1J8VA 3NDOA 3H7UA 1J0ZA 5F1UA 1WKDA 3AXMA 2VP8A 1NF7A 4AF0A 3AYSA 3R10A 3ZLFA 1BGAA 3SSJA 4LX4A 2Q3RA 4ZVJA 3ZSSA 2OYLA 4S1FA 1AZ2A 4WXYA 1Q3NA 5BWAA 4EXQA 4GRSA 4HP5A 1CGYA 2XVNA 3N6JA 6CGTA 1PZ2A 1XBZA 4GLEA 1L2QA 2WMFA 3O07A 3R0UA 1EEPA 1DYSA 2HV5A 2NQJA 4A6GA 1OCNA 2FYMA 3QKEA 3K5XA 5LSMA 4OUEA 1ITCA 2EKCA 1HP5A 1G94A 4D6CA 1J6PA 4C1NB 4Z2GA 1PZ3A 1ZUAX 5G4WA 3R12A 3MB9A 1US0A 1KGWA 4KT2A 3QOKA 4GHRA 2VD8A 4DY1A 1P0BA 3QMSA 3GIYA 4WDXA 3V35A 4PUMA 3DFPA 1WOAA 3N6QA 3TZNA 1VEOA 3GR7A 3WK2A 3CL7A 4NIRA 1POJA 5XINA 2YOCA 5A2CA 4GIRA 3A3WA 3O63A 4D1JA 2XGZA 4AB4A 3UY8A 1ZBVA 4GOAA 5CG0A 3B05A 1BLIA 1EGVA 3TQVA 3S9IA 1VFUA 5AHEA 3WDPP 1B5TA 2X41A 4Z2HA 1J10A 4GXPA 1S2CA 1TZ9A 4JOMA 3L66A 2J78A 2WKLA 4AZBA 3APGA 4D6FA 2VD9A 3N3MA 4ZB5A 3F5KA 1PIGA 3UW6A 4JIEA 3G77A 4Q7NA 1US3A 3C4UA 2ZDRA 3MVIA 4EAMA 1E0UA 3TK7A 3E9AA 3E2RA 5I3KA 4GJJA 2GK1B 5CCZA 4W87A 5CPNA 1I2RA 1W1IE 4LH8A 4K7VA 2YDQA 4IFKB 3QHMA 5D9PA 4IIHA 5F1VA 4F0HA 4RNFA 1TWSA 3ABOA 4HZMA 3W1NA 1VIWA 4MKSA 2PPGA 4ZCWA 1DJNA 3KRZA 4CQBA 4C6OA 2IQDA 3GDBA 1NY1A 3LLFA 1E4LA 4S3BA 3NURA 3NJ3A 2YBVA 1XLDA 1MEHA 4ZODA 1Q63A 3IK2A 3OU8A 4M5PA 2V68A 1NDVA 2VC5A 1X8CA 5I02A 3UD6A 2DGAA 3DFQA 2VUYA 2Y88A 4UFKA 3MC5A 4ZB0A 3A64A 4IMGA 5KITA 5AYZA 2V81A 3SRHA 3WEMA 3LBMA 4QQUA 2PLJA 2VQUA 2D2GA 1NP2A 3FA3A 1TA3B 3L5AA 1LLZA 5FL1A 1QOPA 2BHUA 2DW7A 4B15A 2EPMX 3P5ZA 3H24A 2FTWA 2YSWA 5HBFA 4J3XA 2NZLA 5E70A 4US6A 4S2CA 5I23A 4W88A 5DF0A 3P84A 1EO7A 2EO7A 1H5VA 1UD6A 4OUIA 4BS0A 4CEXC 1R3WA 1VF8A 1LJYA 2WNQA 4S3FA 2WYSA 3VU2A 1E1FA 4HTYA 2GQ9A 2DPEA 3BVJA 1OFQA 1GVRA 1SZNA 1WDWA 4ERAA 3TIMA 3M16A 3FHQA 3PPGA 2Z6JA 2P5NA 4W5ZA 2HRWA 3CAVA 4MFEA 4CNNA 4XB3A 1DJQA 1MXSA 3MUY1 4LB4A 1AJ2A 1X6NA 2W62A 1ZTVA 1K4GA 2EG6A 1HO1A 1J0HA 3AIUA 5G1YA 1F76A 1EWEA 4FXSA 2ZQ0A 3ZYZA 3FVDA 4WJ8A 3UXDA 1XGDA 1IT7A 2NUXA 5DRCA 3VOIA 5REQA 1E43A 3Q37A 2E5CA 4W4QA 2PTXA 2JE8A 1HO4A 4MSSA 3DYOA 1BXCA 1WAUA 1M01A 4PBEA 1K8ZA 1GPWA 3TWBA 4U33A 3UPMA 1F74A 3BMVA 5I3FA 3IRDA 3L0NA 1CLKA 3WK3A 4GVHA 3PUGA 3QQ1A 1GZGA 3SO7A 4W8BA 4G5DA 3OVRA 3WNLA 2DVTA 4ILSA 3W1PA 4LXFA 3BV7A 2O7QA 4BI6A 1XXXA 4XZ9A 1I4NA 2Z00A 5LIUX 1DWFM 5L9FA 2WWDA 1K6AA 5FJJA 4EPBC 3AMLA 4QFUA 3B0UX 4HA4A 1U2YA 5FJOA 3P6LA 3PZQA 1NOUA 3M44A 3LM7A 3VIOA 3GIPA 4IUGA 3I3DA 2WVTA 2DH3A 1CXKA 1T40A 3COTA 3FLUA 1A4MA 5AHIA 1XRTA 4CCZA 3GB6A 1SQ7A 1B3XA 2CBIA 3GC4A 4DBEA 3ARUA 2YLAA 3EKZA 4DYKA 3WX7A 3KDOA 1TWZA 1KRAC 1BFNA 3TCEA 3H7RA 4B16A 1W9UA 4QDPA 1OG6A 4FLRA 3WLTA 2QPUA 3NSMA 2I16A 1TMLA 1V5XA 5DFAA 1GTHA 1JUEA 2I5IA 3REQA 3VD7A 5LIWX 1VH7A 4GNKB 1MNZA 3CZKA 1K8CA 4LAUA 1OEPA 4F2UA 1UYQA 4RE3A 3P80A 1S1PA 3RCMA 3KE0A 3B03A 2QJNA 1V4YA 3FAXA 1IXOA 5EB8A 2BOEX 3NA8A 3NNTA 1RLCL 1FXQA 2VWTA 3ELFA 1OC7A 2V3GA 3W75A 5AHNA 4GMEA 4LUSB 3MSRA 1U30A 3KL0A 3TE9A 3TSDA 2OX4A 2NQZA 4U3CA 3R2GA 1MUMA 4LS0A 4E4UA 4N2YA 2JK2A 3WMCA 2G97A 3G22A 3KBNA 3SI9A 4MJ4A 3LUTA 4RE2A 2Q8XA 4V28A 4LC6A 1MW3A 2P50A 3N2CA 3N9KA 4GINA 4LAOA 3IJ9A 3GNNA 4IP4A 3VKAA 2OYKA 4O18A 3E5BA 5D2XA 3T44A 3JVAA 5FIPA 3KLLA 3QLDA 3L9CA 3PTDA 4UTTC 1IZJA 4DWDA 4PB3A 3TYZA 3TVAA 4JQ1A 2DZAA 3QV8A 3G1VA 1Y5WA 1XCFA 1EPXA 1DJGA 4GY0A 2FPYA 2FHFA 3VGDA 3G0UA 3ORWA 2D3LA 3P2VA 4KGLA 1BF6A 3NL2A 4I9JA 2ABAA 2E67A 1SFTA 2KX9A 1V8EA 3S46A 2GJRA 4CD4A 3P14A 4Z1CA 3BH4A 3NZ1A 3SUUA 1KWKA 2VR4A 1XLKA 3WYZA 1E0XA 3E2SA 4C6IA 4UB9A 3RM9A 5LKYA 3U7BA 1VS1A 3H2MA 4L61A 3LXCA 4JYFA 2C0AA 3B8WA 2X0YA 1JD7A 4HHHA 3VNIA 1Q6LA 1H3GA 4LEQA 2QZRA 4N9CA 4ZQRA 1E4MM 4J5NA 1JEZA 2V5CA 1VP5A 3EA3A 1MWOA 3R58A 4MNKA 3K4WA 1R9YA 1FKWA 1XIDA 4FNPA 3THAA 4LBUA 2J13A 4K6AA 4D1IA 1CGTA 1F7BA 3J7HA 3RF9A 3TFCA 3UCQA 3TTQA 3TYDA 3AFBA 4YVPA 4S38A 1OFOA 4PE8A 4O14A 5HNRA 1UWRA 4Q4RA 3VD5A 1C3FA 4Y9PA 1C93A 1POKA 5DBUA 3RPMA 3OTRA 2ESCA 4DZAA 7ENLA 1HJSA 3LHYA 3FNDA 4HQVA 4D9PA 4JCLA 3HM7A 3BAKA 2QUNA 4OBRA 1XISA 3W7CA 4J35A 3CEUA 2XINA 1MW0A 9XIAA 1JIBA 1K70A 4DAFA 3KLKA 3BJSA 3ZT7A 2BY1A 1OYAA 1DIKA 2VUNA 3THCA 1ZLPA 2DZUA 3WLLA 1FWBC 4AWUA 3B8VA 1AW1A 4GI6A 4AWTA 4AIBA 2PRLA 1MQQA 4O17A 3T9PA 1UP2A 3ES8A 1ONWA 2PDXA 1UB3A 1NSJA 1AMYA 2V38A 1VPYA 4ZO7A 3ZXWA 3ZT6A 4GGBA 7REQB 4KWSA 2A85A 1PEZA 2ZOXA 3V0SA 5BMXA 3IWPA 2EGZA 1VFSA 1W2PA 2HBVA 4NI3A 3BLEA 1WKYA 3T1GA 3B0XA 1EJSC 2CFFA 2VRKA 1FWIC 4W7UA 3UA4A 4AF0B 1R3VA 3PJXA 1UD3A 4LF2A 3QGAC 1ADSA 2C1IA 3DOPA 3ZJ8A 5CBJA 3T2OA 5AZ1A 4HNUA 5AC5A 1M65A 1KQYA 1OGGA 1GJPA 2G3MA 4MVAA 3L12A 2WVVB 1EGZA 1JI2A 4J3TA 3CO4A 2YBUA 3FFSA 3N4EA 2Q09A 4NZ4A 2REQA 1EC7A 3VGBA 1KBKA 2F84A 1FDJA 1XYAA 3KVJA 2ZA2A 2ZA3A 3OOQA 2ZBTA 2QVHA 2VXNA 2ATMA 3KX6A 3UF9A 3VOGA 3W86A 5D8WA 4P7LA 1UBSA 4Z0JA 3UZJA 2OU4A 3LRKA 2POZA 3S83A 4PYSA 1WA3A 3RPDA 3UG5A 4E4PA 3SFWA 3FHAA 5E9XA 1YX1A 1V3KA 2E28A 3URAA 3OVPA 2O56A 2C18A 2BVDA 4WSKA 1JUBA 1U83A 5I0DA 3ARYA 1QFEA 4ICCX 1OZMA 4G7EA 5ECUA 4H7VA 4AZHA 3POHA 1XLBA 1UASA 1OX4A 1L2UA 4IG2B 3MI3A 4GQBA 3AROA 3EWDA 5DXXA 3L4VA 2PUZA 5TD4A 4J3UA 3VPLA 1BYAA 4JR5A 2OZ0A 1FCUA 5FKYA 1GTEA 3FXYA 2ZUWA 1DQXA 4NSBA 3P0XA 2HS8A 4AW7A 1RBLA 5FESA 1QOQA 5CBIA 1QATA 5C6MA 4TO8A 3UJ2A 4LVAA 1LOLA 4P8WA 2Q02A 2BS9A 2O9RA 1W9BM 4IX0A 1PWLA 1ALDA 4F0RA 1P0DA 2IXVA 2HK1A 3WLHA 4PTVA 1PZ0A 1X98A 3L68A 5H2ZA 3HPAA 3AZTA 4UFIA 1HJXA 1A5AA 1H7OA 3IJIA 2EBNA 4DBWA 2Z28A 2E7FA 4GQGA 4OGZA 5BXSA 4Q4SA 3F4CA 1Z48A 3G1FA 3L4XA 3DESA 3V75A 2J7FA 3GUWA 1WPCA 3UG8A 3P61A 3PG8A 1AODA 3B04A 4DBDA 4M7SA 4XD4A 3CS2A 3BSGA 4W89A 3A13A 1T99A 2Q8ZA 3VIKA 2Z27A 3MU7A 3M43A 3HURA 2DSUA 4ZOBA 2Y24A 4C91A 4BF7A 3VOHA 2R1LA 1VHCA 3NQBA 1MZRA 4RNHA 1LDCA 4LY8A 3OBEA 5G1TA 5HMDA 1YDYA 2KAUC 2W92A 1XINA 3W1RA 1FWEC 3GX9A 3OLGA 3VILA 1UD4A 1TWIA 3FSTA 3GDTA 5TBOA 2WZEA 1B3WA 3GHRA 2RFGA 4CGTA 4X0NA 3CWOX 4ONVA 4ENLA 3UEQA 1WBJA 3LCFA 2PDCA 2E6YA 5FF2A 2QUTA 4LT9A 2BBFA 4HPHA 3ZIZA 4QTGA 3N2TA 4ATWA 1ME8A 5H91A 4LQ1A 1EDTA 2CWNA 5KZEA 4HOZA 1EJWC 1JZ4A 4LY4A 1DHKA 1Q2SA 3GXNA 4E8GA 4H9ZA 1WXJA 4WVXA 1I60A 1I2PA 3FK4A 3OG3A 1PJ9A 3LTPA 5REQB 3B97A 3ANVA 2GGJA 4EWND 1E5JA 2DZSA 3FDGA 4TU1A 2D2JA 3LGGA 3LPGA 1UP3A 1O6IA 5K9CA 2HZGA 3HQNA 1BVZA 2GDVA 3DHDA 3I6RA 2ZWZA 3TAOA 3LTYA 4NZCA 4IQJA 2E4TA 1HUVA 2POTA 4F79A 2CLMA 2VM8A 3VXGA 1V0MA 3WDHA 2WMGA 1O5XA 4DN1A 6REQA 2XN2A 3U7VA 1GQNA 4LVFA 5D4YA 4JTUA 3NDYA 4RW5A 1AFSA 5A8OA 4KQNA 4NUWA 3IJLA 3TN5A 2IKJA 3M07A 1XLAA 3ZFHA 4QITA 3HPXA 2CITA 4MB3A 5CLTA 2OG9A 4UNLA 4P8UA 1KTNA 4UTIA 3SQLA 3R89A 1YNYA 3EA1A 2Z2AA 2J7CA 1TG7A 3RO6A 3RM4A 5M03A 2QT3A 5CC7A 1PPIA 3CH0A 5EMKA 1R2TA 4Q8TA 1SU5A 1Q6OA 1PDZA 1K8XA 3QSRA 2IW0A 2WPBA 4JICA 1E55A 1BKHA 1OFEA 4IJBA 2B4GA 5E0KA 2AQWA 3VIIA 4LCQA 2VGBA 2OQHA 2QDEA 1X38A 3VOJA 3NPVA 3R8RA 3MSDA 3M6YA 1S5MA 3V5CA 1JI1A 1ODZA 2BY2A 5CKSA 3G24A 2DT1A 4JN6A 3VC5A 2VFDA 3D5HA 3REQB 3W84A 3HPFA 1KCKA 4NQ1A 1QHOA 3C3NA 3EMZA 2VEFA 4AHPA 3K8MA 1JR1A 3SUWA 2C6QA 4XTDA 5HULA 1IEVA 1E6XM 1SJCA 2DJXA 4Q7IA 1PHWA 4I7VA 4DLMA 4PSRA 3E1F1 4QR6A 1Q4WA 3T81A 1GG1A 8A3HA 4AX6A 2J7HA 3AXKA 4HJWA 2QCHA 1XLHA 3W7RA 1F4HA 2BTMA 4Q4PA 3UJFA 4AUBA 1FHVA 3TTOA 3P5YA 3VGEA 1Y8BA 2GDUA 3VMOA 4PC8A 1DP0A 2CHOA 5BRPA 2VFHA 3CZEA 3BLIA 2YL5A 3ATYA 3QW4B 4TOQA 1BRLA 4TX6A 3W83A 3RLUA 1F2JA 3R4IA 3VCRA 2OVLA 3EOUA 2G3NA 4WDTA 1TSIA 4LAMA 2IS7A 4XKMA 5JQ9A 3GTXA 7TAAA 4PR4A 4J4KA 2YCLA 1WO2A 4GYPC 1N8FA 4U2ZA 4XZLX 2QCCA 1W1VA 1KXTA 4M7TA 1UBPC 4QJ5B 3KOWA 4FX7A 4ML4A 2PC4A 2WHMA 1TE6A 2VX4A 4H9UA 1OFRA 1LRQA 1RHCA 3PP7A 1Q5MA 3VUPA 1QWKA 4C90A 1NVMA 1WE5A 3I65A 3VABA 4JNYA 4KGJA 4JTDA 3H55A 4Q4KA 1HJQA 2PZ0A 3MWCA 3FY1A 1MEWA 2PBOA 2QKFA 2ZVRA 3A3XA 8RUCA 3T55A 2R9RA 4C1KA 2IQTA 2W67A 4A2RA 1QK0A 2V30A 3GYCA 4R53A 1XQKA 4A8NA 2DSVA 4AZ7A 2XFWA 4H2CA 3E0LA 7ODCA 4PTMA 3KHDA 2QCFA 3RXZA 2RDXA 1CGWA 3MP5A 4PMZA 3UGRA 3IEBA 3EWCA 4I6VA 1AD4A 3NFUA 4GUGA 1CENA 1XH2A 4JTGA 5FSEC 1GEQA 1VD6A 5CPTA 3WF4A 1DJHA 3TFXA 1QHPA 2EG7A 2IPGA 5MKGA 2YCEA 5IFTA 3FA4A 3WMLA 1GQKA 3M0MA 5EY5A 2YL8A 1EFZA 3IJQA 1QNPA 5ABEA 3CZLA 3BOFA 4O12A 3TA9A 3NG3A 4F9DA 2DZVA 1KM0A 6PTDA 2EKGA 3S1GA 2GFTA 4AD0A 1FHLA 2SFPA 2PTDA 1H1NA 3MHFA 3PZIA 3HTWA 3VDCA 4DO4A 2PDFA 3BSHA 1DJXA 3F5LA 2E09A 4LVGA 3AIVA 4MOZA 1J6OA 4E4FA 4M0XA 1DTUA 4IMEA 5DY3A 4DUOA 1PIFA 4K8HA 3DZ1A 3WNMA 1XLFA 2JGQA 4V2XA 3VX1A 1PAMA 2JEPA 3N4AA 1YXCA 5LIXX 3WLKX 4TXEA 2ON3A 3CMFA 2VZTA 5D33A 3IIZA 2NXIA 4S3AA 4AU0A 4O50A 1EQPA 1KBBA 2VENA 3WQWA 4JTLA 3W2NA 1X6UA 3N11A 3IVSA 4N9DA 3TYEA 3NL5A 1BSIA 4PB5A 1OYCA 1RBAA 4UUIA 3WF0A 3W72A 3HJZA 3ONCA 4E2BA 1OB0A 2YFOA 4RXGA 1R47A 1XS2A 2VURA 3H2OA 2QUUA 3TYAA 2REQB 5BZAA 4UC5A 5LIKX 5CPOA 1EX1A 2PDLA 3K1GA 4QEEA 1KM3A 4PMXA 5JBEA 2ZUMA 2W27A 5E09A 1EDGA 1GW1A 1W3KA 3LU2A 3L4WA 3BO9A 4DUXA 1XLGA 3W1MA 1XRSA 4P8XA 4O8RA 3KOFA 4UOZA 2TODA 4W5UA 4CVUA 1G4SA 1QPOA 1PE1A 1TVLA 5DMMA 2HVMA 2XPKA 2GJNA 3CPUA 4BI7A 3SFKA 2RGLA 4G7EB 3A23A 2Y7EA 1TCDA 1EBHA 1W8GA 2ZXBA 1OX4B 4IJCA 3QMTA 4QAWA 3OZOA 1J5SA 4M6QA 2J24A 3Q58A 4PBFA 1SMAA 2WCAA 3R79A 1CXHA 4IGSA 1UIOA 2G4JA 2D1ZA 1SZFA 2X8RA 3ANYA 4F0SA 2Z0IA 2OFJA 3ARTA 3S3GA 3MWAA 3SJ3A 5IHRA 1MUCA 3DGBA 3GBDA 3UZ5A 4YCPA 4DJED 4L1WA 3E96A 4MADA 4Q8NA 4CD8A 2R1PA 2J88A 1FH7A 2E1DA 1GEHA 2CC0A 4AHOA 3SAZA 1E9YB 1TJ1A 1JZ5A 3B40A 3D3FA 1EXBA 1H09A 3TOYA 5JBDA 3VNYA 2VO5A 3R25A 5GNXA 3P62A 2Y85A 1JDFA 3OIXA 1GOQA 3VYLA 4G8TA 2J7EA 1BKSA 1W1PA 4CEUC 1J96A 3W6LA 3BLDA 4NXSA 4A35A 3PN8A 4M19A 4C5ZA 4H6KA 1IF2A 5EL1A 2VFFA 4FHAA 4O1CA 2HMCA 4MMWA 3G1SA 4IT1A 2OO6A 1FWDC 4IM4A 1W31A 3M6DA 3AIQA 2VRQA 3TKFA 2XH0A 3P81A 2HROA 3VDHA 5C2CA 4HZ6A 3LX9A 4E2VA 1Z89A 3H12A 3SCWA 1JQXA 2WCSA 4GX8A 1CZ1A 3UVAA 1XYBA 2A1YA 2INEA 1DWIM 2PWHA 1Q7MA 5T26A 4A05A 4FLQA 3SB0A 1R30A 3CASA 1KLZA 1XLEA 4HPNA 4U10A 2XIMA 4LC8A 3MJMA 1J0KA 4HOWA 3W7IA 5LHEA 2QAFA 3PBWA 1CWYA 2IMRA 4IPPA 3B3DA 3NM1A 1RR2A 4JIRA 1PYFA 2C3ZA 5FD0A 2TRSA 3NWRA 1TKKA 4AEEA 3SM0A 2OELA 3H4XA 1U5HA 3ARRA 3B8IA 1QJWA 2XGBA 3RRXA 4WDWA 2ISDA 2QCNA 3FGCB 1RPKA 5KMYA 1JCTA 1C29A 4G9PA 1RUSA 4W7VA 4ZZ9A 1DL3A 3Q2DA 5CZTA 4NVTA 2YIHA 2PEVA 3KUMA 3I3EA 4NZFA 5LA2A 1ZY9A 3G0SA 5F2LA 1TYGA 3QR1A 1IXNA 3IUHA 1V3LA 4PTDA 1KFWA 9RUBA 1Z7AA 3N34A 1UW9A 3CIXA 3GR8A 5CJMA 4K3ZA 2QJJA 2L5HA 2GGHA 4DJFA 4X61A 1G69A 3PPCA 3B9NA 4JDYA 1NFGA 4NJIA 3E0FA 3RM8A 1V3JA 2NXGA 1B90A 3WQ4A 4O54A 2QV5A 3W28A 4AYGA 4LV9A 1QI2A 3WF2A 4M6UA 4MYAA 3UWUA 1P43A 5HOSA 3LCLA 1JXKA 3TH6A 3O06A 3UWEA 3N25A 4XAYA 4F8XA 2VHLA 4LTSA 1KXVA 3O0KA 1JYWA 3EMCA 3UZZA 1X7FA 2PD5A 3DHFA 1GOWA 4IGMA 4QS6A 5DY2A 3WD2A 4IGHA 3E02A 4CU6A 4IP7A 1DEDA 3LLDA 2Z7GA 1NEYA 4HNOA 4NAEB 2PAJA 1HQTA 1ISXA 1IEWA 1YDNA 3HOJA 1GVQA 4GQ0A 4Y9MA 2FGZA 3R7MA 3WJSA 1EIBA 3BG3A 4DO5A 1FFQA 2OXNA 3HPSA 1UWSA 4U4MA 3LCGA 2FFIA 1S3HA 1Z42A 5FA5A 4P7NA 4QDWA 1Y0EA 5FF0A 2B7PA 4GK8A 1IGSA 2BXVA 1JG9A 4QX4A 3NXLA 4CKQA 2BVYA 1H7RA 3UZWA 5IBXA 3OZPA 4L64A 2FVLA 3UYIA 4HJFA 3E2VA 2QS8A 1H5YA 3CV7A 3W76A 1FTXA 5I07A 1T5AA 4D8AA 3S1VA 3MBFA 1LQ0A 3NO5A 3HGJA 4KRTA 3HU7A 4B3KA 1MQRA 1AVAA 4AQLA 3CO8A 2C7FA 4TR9A 1ECEA 1YTKA 2HNHA 2FGLA 4PEEA 2X0HA 5XIAA 1V79A 2V5KA 3EWWA 3ITOA 4F9JA 3PBMA 1NWTA 3MUZ1 3RG6A 2GVJA 2F38A 3O6CA 2GYIA 1ICSA 1KFEA 5AHMA 4EACA 1CLXA 3LCXA 3R0KA 1O1ZA 5FACA 4KF1A 3GVRA 2YCLB 4MYXA 1QWGA 1W3NA 4HBKA 4IPNB 4R34A 3NPXA 1IZCA 4A3UA 2OQLA 4XIMA 3WDIA 4GKLA 4PMDA 2QR6A 4H6QA 3FV9A 1K9DA 1U5JA 3QOMA 4QS5A 3ZR4A 2FZBA 1M53A 3RITA 4O8AA 5BOOA 3OLDA 3G1DA 1VRXA 5AZ0A 1IR1A 1JXJA 1EF2A 4O15A 3WQ6A 4HIBA 1DIOA 2BDQA 4PCTA 1SO6A 4LBSA 3OZMA 4DJDD 2ZRXA 5EBAA 4Y8FA 3NZGA 2EJ1A 4LRSA 2GVEA 3LHZA 5DO8A 3M7WA 2Y1HA 1PX4A 1ZJIA 3UWVA 4GGHA 2ZUSA 4NU7A 3WQOA 2AAAA 2QV4A 4MLRA 3CEPA 1BWLA 4GBUA 1YNPA 1HN1A 3WNPA 3QY6A 2C1HA 3QHOA 2I56A 2UY5A 3FCPA 1EQCA 4L6DA 2HWGA 1C90A 3DENA 3W7NA 2CNCA 5I3GA 3VGGA 2XFRA 4P5UA 4J28A 4D6JA 4DHGA 4V27A 4ICNA 3TN6A 4F2BA 1OGSA 1M7JA 3H23A 1L0PA 1LZOA 4U5IA 4ATLA 4E5TA 3C5QA 2LLEA 3BARA 1RZMA 1F3TA 6XIAA 3DHUA 1EB3A 3W4RA 4YTTA 1OT2A 4PBGA 4ACZA 4CD7A 5LNRA 2QMJA 1V6VA 1JNDA 3T09A 1ZBWA 3VDGA 3CM4A 2Y89A 1VENA 3PAJA 1LBFA 3WF3A 3C2EA 3O15A 4ZO8A 3TTSA 5BCAA 4C65A 3U4AA 1Q7QA 3WQGA 3F2DA 4NAFA 1UA3A 4RNIA 2QF7A 2R6OA 3QFEA 1FKXA 3KBSA 1QTWA 4XKYB 4JD4A 4FEZA 4HPGA 1LL4A 4PB4A 3DIPA 2WANA 3PWIA 4L7ZA 2D2OA 3NTYA 3GG1A 3ZSTA 2NSXA 1K03A 1R46A 4HGXA 5KZDA 3T7VA 4X0VA 5D9OA 3WF1A 4FSAA 2XM1A 1TX0A 1UA7A 5HJLA 3TLLA 2NWRA 3LCWA 4QHRA 3P7YA 3EWYA 1NOFA 3WBWA 3GAYA 3EZ4A 4AEOA 4C1LA 1Z41A 2WZTA 4GVGA 4KPLA 4PFMA 1ZGDA 3CTTA 1I45A 2ZRVA 4GWEA 2XSXA 1TPWA 1XI3A 3BSMA 2WNZA 3WL0A 1C7SA 1H4PA 2QGHA 3A21A 3VZXA 1EPVA 1XYCA 3WO8A 5CEWA 2OLAA 3QV9A 1E1CA 2A2IA 4S3DA 5C55A 3LENA 3C8FA 3VIGA 1RAKA 3P3BA 4I7WA 4XIAA 5G2HA 3LI0A 1HJVA 4H6RA 3GU1A 3L0GA 3GS6A 3CB8A 1J12A 3AIEA 3OW1A 3XIMA 1OFDA 3MJYA 4PODA 2XN0A 2RDTA 4IPJA 1EIXA 3KP0A 1EYEA 8CGTA 3QEZA 4GIYA 3WLQA 2IKIA 2R94A 1JVNA 2HQAA 3GNRA 4MAZA 4PMUA 1ELSA 1I2OA 3L4UA 3I4KA 4P7OA 1VIZA 3CJPA 4DXKA 2Z26A 4JTKA 2G3JA 4EANA 1B30A 2J74A 1OJXA 1XIGA 2PI6A 4NJKA 5TAOA 4NF7A 4XD5A 3BW2A 3WMSA 2I5QA 4MWAE 3A5FA 2J7DA 1W1YA 4LU0A 6XIMA 3TAKA 2OLSA 1W9XA 1VPQA 2D0GA 3V16A 4AC7C 2AQVA 2PCQA 4LYKA 2QJIA 1I1XA 3G1AA 2NQHA 4QXIA 3GK0A 2CZVA 4LUTA 3KHJA 3SGZA 2J9YA 2VX6A 3H6OA 4EWJA 1W1B1 3WL1A 4MJZA 1TPH1 3OG2A 1T7LA 1A3XA 1KXQA 3H21A 3UG3A 4YTSA 5HR7A 1EL3A 1R6WA 4PCFA 3SCVA 3SY8A 4DZ5A 2CLIA 2PWGA 3T6CA 4XUYA 1O60A 2R82A 3M0ZA 4EKJA 3DKLA 3VD9A 4PMRA 5FJIA 4EF8A 1Q6GA 3FS2A 3CNYA 2EEXA 4DB7A 4OV9A 4UQ9A 1EBGA 1UJQA 1XBXA 3CT7A 1XBYA 1CT5A 3LLXA 4AZ6A 1W3IA 3L0KA 1R3TA 1M1BA 5HPOA 2FJKA 1W1A1 4NRSA 2ZZ4A 2XISA 1UH3A 3NQ2A 1L9WA 4HCLA 4QCEA 4XO7A 4S3JA 1SW3A 3SECA 2IQ0A 1W17A 1S2AA 4QNEA 3IGXA 1OD0A 9CGTA 2OSXA 2HNEA 1JGMA 4NJJA 1RQEA 4WSJA 4PUUA 1SO5A 4RJEA 4Y9NA 1KCLA 3CH9A 3PNUA 1JCNA 3KAOA 3H4WA 2XYLA 8TIMA 2Z4GA 4KFPA 1Z3NA 2ACUA 3KL5A 4DUVA 1PTGA 3TW6A 4UMCA 5I79A 4Q8UA 2GVLA 4GNVA 2E8YA 1BYCA 1EP2A 1NWRA 3W87A 2YL9A 3BC9A 4DO7A 2V5JA 4B4FA 5BMWA 5BOEA 4W7WA 1PWMA 1NU5A 2MUCA 2DT2A 3ZJKA 2X30A 2QCMA 3WQFA 2CESA 2CBJA 4B2DD 3M0YA 3NDZA 3PK7A 3K4AA 4HPXA 2Y8KA 3T0CA 2Y7FA 2J79A 1JDCA 2HBXA 4MDPA 3TYBA 3EA2A 4MKVA 1VRDA 1Q45A 3QM3A 1JUKA 4DF2A 4BEUA 1NELA 1E6NA 1QNRA 4N0RA 4HNVA 2GDQA 3GHTA 2FHCA 3N2XA 2RAGA 3NQFA 1G4TA 1NWSA 5EPDA 4RNJA 3S5YA 2TPSA 2V3DA 1SUXA 4H8HA 1V6UA 2G3IA 5F2MA 3UWQA 3TTYA 2PF8A 4YVXA 4AZIA 5HNUA 2QCGA 4Z42C 5FAGA 3DX5A 5DMLA 2PWVA 3ARPA 1U33A 1WKFA 2PD9A 1HJUA 4MUZA 1W56A 3WMBA 4CQ9A 1SYTA 2H3DA 4B5WA 1N2VA 4M56A 4FK9A 2G5WA 3JR2A 2NQLA 2ZZ1A 1XC4A 3DBPA 1HKMA 1DVJA 2GPTA 2BWGA 3ZM8A 1JPHA 4TX8A 3VKKA 1DOSA 2Y61A 1QPKA 1J11A 2ALRA 5T8GA 2FTYA 3N14A 2XVGA 2GJPA 1QNQA 5AC4A 2PP3A 1QI3A 4PUDA 2XDFA 3UJRA 3WLPA 4UZSA 3UXLA 4RLIA 2J25A 3VD3A 1MRQA 3MA8A 5AC6A 2H8ZA 3I3BA 5T9BG 4ZQOA 2OTDA 1AJ0A 1V03A 3M9YA 1M41A 1QPNA 3WKZA 1WDDA 4YCOA 2E5BA 2PDPA 2HISA 1GHSA 3N3TA 3GXTA 2ZUVA 1TV3A 1KNWA 4LS2A 1E9IA 3SRKA 3KBMA 4J1OA 3ALFA 2QQ6A 2D22A 1F07A 3GH4A 5EBUA 3GH7A 5HJYA 2Z1BA 3M0VA 3RN6A 1CGXA 4B3ZA 1XL9A 3KM8A 1N55A 2A7NA 1DPMA 1GWJA 1ZPTA 4DZHA 4I9AA 3MCMA 3TROA 4KWUA 3RX3A 5A5WA 4K38A 4UNKA 1SFLA 3UR5A 3CLWA 5K4ZA 1F5ZA 4Q7BA 1OF8A 1VBGA 5KSWA 4Y2WA 1WZKA 4RZBA 1W54A 1J9YA 4XAPA 3QV6A 1K9EA 3M5YA 3PZGA 2W66A 1XGZA 2BGQA 3UJSA 5A6BD 1JD9A 2YGYA 2GVYA 5A95A 1LBLA 4KEMA 3F2CA 1NDZA 2CZ5A 3FW6A 1KV8A 5DCDA 1GKPA 1UKOA 4DJEC 3W85A 3IJ7A 1WZLA 4HU8A 2XSAA 3RAOA 1C91A 4FNSA 2Q6ZA 1P0NA 1OWQA 4PH6A 6A3HA 2FZ9A 3MV01 3BAIA 3ZO9A 3N17A 3PPFA 3S2MA 3T2QA 4PSPA 1IWAA 5JH1A 1OADA 5M2FX 3QC3A 2Z1XA 4YJ5A 2ISFA 5JMUA 4ROQA 3BLKA 2WSYA 5DX7A 4ASTA 4GABA 4CCEA 4XWUA 1SMDA 2X7WA 4K8EA 1G7UA 3V7PA 4YYCA 3HG2A 2PTZA 3UWZA 3VE9A 2Y5JA 3GKFA 2PF0A 4B9YA 1B9BA 4WIWA 3VIJA 4EPKA 3STEA 4ZMGA 5BRBA 3JW7A 3EXSA 3BAYA 4MWAA 4OJYA 1YTEA 3AO0A 2YA1A 3EX6A 4M3PA 3K46A 1SR0A 3BLFA 3UNDA 3G8RA 4B5VA 1NP0A 4ACZB 4D8ZA 5B80A 1TPEA 3BDKA 2VC9A 4I9MA 3RDKA 2RDWA 1V3HA 4QGCA 2VI0A 1PCWA 1HX0A 4ERIA 4ZL1A 3PB0A 4X63A 1XWYA 3WD4A 1GOKA 4G6CA 1GJWA 3GSMA 1W5MA 3UR2A 2A0NA 4C6PA 1YDOA 3FVMA 4K68A 3NQ8A 3PB2A 1BQGA 5A6JA 2EJAA 2GQ3A 3DI0A 4GD0A 2ZXQA 1KKOA 2WQDA 3DU0A 2F2HA 3C3UA 4IP5A 3O2LA 1UH4A 3KCJA 2Q01A 3OO2A 2J9ZA 3QR3A 3UY7A 1KXHA 3LG3A 2X1UA 1GZJA 1DE6A 4S3GA 5BWFA 3H2CA 1Q65A 4KIRA 1IT0A 1ZP4A 3V5FA 4FX6M 5CGMA 1XD1A 3UT0A 1OQFA 2QJHA 2ZTJA 2BZNA 3WUGA 5DLCA 3QLLA 3CZJA 3AHXA 2FVKA 1D3GA 4PL2A 3C2VA 4FPSA 3S6DA 2GJXB 1FWGC 3U2CA 5CPSA 1RBOB 2YA2A 1GNXA 3AMCA 3BCDA 2CIPA 3QZ6A 3NXFA 1GQLA 1QUMA 3WSUA 3VNLA 1C8YA 3G3DA 2YDSA 1EO5A 2NLYA 3H70A 5CSYA 1XRVA 3QY7A 2OWXA 4TV5A 5L6UA 5KZ6A 4BQ2A 1V93A 4PEKA 5G2IA 1K9FA 5F4XA 2EPNA 4NZ5A 1MMFA 3AXHA 4Q8MA 3FYPA 4FXFA 3KTCA 4G7FA 1GOIA 2QULA 3MUXA 1RQHA 2A6LA 3Q94A 1FHDA 4GFSA 3BANA 2QDDA 2X40A 4N42A 3L5LA 2IUZA 3NZRA 3W81A 3ZJ6A 4V33A 2C71A 2NUWA 4REQA 4JCMA 3A4WA 5HMEA 2I14A 3WCZA 3MS8A 2OMAA 1OX6A 3FJ6A 1WCGA 3W7GA 4JPGA 1KKRA 3IVTA 5DCEA 3DKJA 1OFPA 3AAMA 4Z1YA 1PZ1A 1UUOA 5I5RA 1P6CA 3EEZA 3RUBL 3URNA 2E9LA 4DIAA 1TR9A 3MDWA 1XR2A 5C9WA 3AS0A 3CZGA 3MP3A 3EX1A 3QHNA 3DCPA 1W3TA 3W01A 2O55A 2A3EA 2PLCA 1KLYA 3WENA 4DNMA 2G96A 1MZHA 3W7HA 4LGXA 1IXPA 5I7GA 4W86A 5DT5A 3PPHA 1KCXA 3JU2A 1TCMA 2GL5A 2WCGA 3AXXA 3VMPA 2E8ZA 3IGUA 1G1YA 3EDEA 3LN3A 4IUOA 3DYMA 1C92A 3D0CA 4LYPA 2VEIA 3QW3A 1V77A 3GH5A 4RKAA 4LUTB 2PP1A 2GUBA 3MY9A 3LHTA 3OBKA 2BVWA 1QK2A 1K1DA 4Q4QA 3LYEA 4F3HA 4WR3A 1ESWA 4GZEA 4R5EA 3CAKA 2J47A 4YTRA 3S9YA 1S2TA 3LZ5A 3THQA 3RCNA 4JIQA 5GNYA 4FR6A 2VZUA 1I0BA 3A4JA 1TV8A 3K13A 5BOFA 4TTUA 2J75A 1KFJA 3QY8A 3C2OA 3VM5A 3AIBA 1UZDA 3HIJA 3P82A 4HHLA 1QR7A 4POCA 2NQ5A 3KRBA 3L21A 3NOEA 2ZTKA 4U5KA 1TV2A 4MDOA 3W7QA 1Z44A 1TIWA 1KBJA 5SWUA 4IPLA 5I00A 3SSZA 1PVNA 1F9CA 1I2NA 1FCQA 3CT2A 1VCGA 1YTDA 4AFYA 3DFNA 1F73A 4MFDA 2XM2A 1E71M 4A3QA 4BEQA 5D32A 3WLMA 2Y5EA 2I9UA 4L9YA 4LNYA 4A2SA 4YMZA 3LBOA 1LQAA 5AC7A 4MTVA 5EMJA 2FMNA 1EH9A 3BG9A 3SCPA 3KL3A 4OU1A 1ZAJA 3SQMA 4UOQA 1XYMA 2F6XA 1MFUA 2FHBA 2YJQA 1QNVA 4JQAA 3KBWA 1UR8A 2ZKMX 3FEMA 3U5UA 5E1QA 1QXLA 2H9AA 4P61A 3S6OA 4C7DA 4U3AA 4UZUA 2XG9A 3VKBA 3NQ7A 1E0WA 3EX3A 2GWNA 1EYWA 5FF3A 5D02A 5CAHA 3URBA 1HTIA 1LG2A 4LRTA 4AAJA 1UD2A 4AD2A 1AK5A 2TSYA 3LXBA 3S1XA 1TZZA 1JPMA 3V0TA 4QRNA 1UR9A 3RU6A 3EOSA 3QTGA 3MSYA 4Q4MA 2DW6A 3T4WA 2GUYA 4NP7A 5T91A 3QR0A 3MHUA 4JEJA 4LALA 1Q6QA 1KFKA 3C86A 1UWTA 1DBTA 4XBSA 3V4BA 3WQPA 5FCZA 2C8NA 2WXDM 1KA9F 4IIFA 3C0QA 4HU3A 1B4EA 5LA0A 4J40A 4O16A 2V5LA 2HE8A 1GQJA 4X22A 4CCDA 3CUJA 1IEXA 3BWWA 1HF6A 3W7OA 1O66A 3NVDA 4JX4A 2BHYA 3W73A 2PDJA 1AD1A 2DUAA 1GORA 3IRSA 2WZHA 3GFZA 1Z6KA 3M0XA 2HSAA 1XIHA 3IS4A 2NX1A 2CXEA 3AISA 2YZRA 1UUMA 4QLJA 4GFIA 1OINA 1QPQA 4I5XA 3URQA 4Z2IA 4AVNA 1LL7A 3KP1A 3CPGA 5HWMA 2BXYA 3CMGA 2NX3A 3HMJG 2HK0A 3S1UA 1X1ZA 2XIBA 4WGXA 3CBWA 1OG0A 1ZAHA 3WBXA 1EOKA 2OJPA 1XBVA 3ME3A 2ISSA 2VEKA 4GY7A 1AA1B 1NQKA 1YIXA 2PDKA 3T05A 4LSBA 1CXEA 3C2YA 3SCTA 1N8IA 4CN1A 2Y63A 1A3WA 4MPQA 1H7NA 3KRSA 5EU9A 3L7RA 4O0ZA 4U31A 3P93A 1KRCC 3AXIA 1EJTC 4AZ5A 1OYBA 4A8RA 4Q3MA 2F6KA 3MI2A 3TLQA 2Z6IA 1RK5A 4I5RA 1E15A 1NF0A 1W91A 1H63A 1OY0A 3PBUA 1ZS2A 3VFCA 1SO4A 4UMAA 1W3LA 2A3LA 2OKTA 5AECA 2OZTA 3OJGA 4HHPA 2X05A 2J77A 1DV7A 5KTLA 3FN9A 3W07A 2XZ9A 5FJRA 3NR0A 3CUHA 3BLOA 3WQEA 3W7MA 1C8XA 3LS9A 1YBQA 3HV8A 3SZ8A 4C6DA 2YW3A 1BYBA 4B5NA 4GUJA 1BVWA 2BGSA 3EX2A 4FZIA 2WMIA 2WNNA 3EB3A 1R2SA 1YXYA 3TXVA 1AQHA 3OQEA 5D2YA 2PDNA 1CECA 2ZWYA 3SUVA 4NZ3A 3TV8A 2F7FA 2E5DA 3P60A 4PMQA 1FUYA 3H2AA 2PWDA 4KFOA 4YIWA 1QW9A 2ZDSA 3EKGA 4IOTA 4ZE4A 1I9CB 3TNOA 1WOBA 1JCYA 3TYUA 1JZ3A 5FEWA 2PGRA 3SY5A 1DIEA 1OD8A 3W1AA 3TR9A 4H7CA 2BGNE 5AYIA 3ZLHA 3UP8A 2DUZA 3K4DA 1UD5A 3S5OA 5DELA 2X1SA 3S8HA 4S3EA 3I68A 1IE7C 1P0KA 4QISA 4H9YA 1XDMA 4TVUA 4XVEA 4L80A 5DN1A 5TQLA 2QCLA 1TIMA 1MUWA 3ARXA 1WV2A 4YVVA 2ZCGA 3R8GA 2Z7KA 4ADUA 3MMWA 2WWCA 1RK6A 4WUIA 4FNRA 3LPOA 3ITVA 4Z1BA 3U48A 4NNCA 3D3AA 1QT1A 4K1WA 4L6HA 5HQMA 2HXTA 4IL2A 4RE0A 1E9LA 2XU2A 2AL2B 3U3HA 5ABFB 5G5IA 8XIMA 4EXAA 2IKHA 3RPTA 3ZQ9A 4KBXA 2PLKA 2DZPA 2EPKX 3W24A 5LA1A 1IWPA 3WFLA 4JQ3A 3G1HA 3BGAA 1RY0A 1ZZMA 3SR7A 2I57A 3KVLA 4R3UA 4WZHA 1XIMA 3S5SA 3BUVA 1HKJA 1H7XA 1M6JA 3ID7A 2J6VA 4Z2KA 1X7IA 1ZRQA 2GGGA 1C9DA 1V6XA 1PHQA 1R3QA 5HMSA 3CLMA 5F4WA 2PURA 3VIMA 2VC6A 3TP4A 5G2WA 3CWNA 5C54A 2OZ8A 3E12A 1M04A 3HV9A 2J6XA 1ZSXA 2ZRZA 4LCRA 4ERGA 1CPUA 1V7AA 3B9EA 2WVUA 2PDYA 3JRKA 4R33A 2ACQA 3W22A 3GTNA 4I8YA 4PGLA 3T0BA 4HNCA 3W3OA 1JQVA 6ALDA 2R14A 3NVTA 1UZ4A 4URIA 3SCUA 3OYXA 1T8XA 3LPFA 1R87A 3WBEA 4A3HA 4JS3A 1T41A 4JL2A 1XFCA 4BF5A 3UXKA 3TJIA 4G56A 2YYUA 1EUAA 4FNTA 4HYVA 3R0DA 2XVLA 2OOFA 4KWVA 5M5DA 3KS6A 3P67A 1KFCA 3HGOA 3L5MA 2PCEA 2X7VA 5HINA 1FBAA 3RLVA 4ZXOA 1HGYA 4BY3A 1LWJA 2CETA 4WOZA 3NM3A 4PN2A 1WUFA 4IZGA 1XX1A 2XVKA 1LP6A 3V3WA 2XZ7A 4HYWA 4KFNA 3IGSA 5BW6A 4REQB 4KERA 2CHNA 2FIQA 3AMGA 4HTBA 4DQWA 3FJ4A 1LLWA 3AS1A 1RCOB 3CAQA 4JTJA 4K37A 5JBFA 2R1MA 4WY0B 2JKPA 4FR1A 2BXZA 4JTTA 4GNJA 3BICA 5FF4A 2QGYA 4OTKA 2PRHA 1O4UA 5CC5A 1FCVA 4HD5A 3EWXA 1PKNA 1O12A 1K6WA 1XG3A 4XBJA 4O10A 3F4VA 1S46A 1JZ7A 5C9XA 1XCWA 4W84A 2WSPA 1PKYA 3QRHA 4ZSTA 1DJZA 3EKLA 3KVMA 3SDOA 4EF9A 4OE7A 1VJIA 2UY3A 4GPNA 4JX5A 4AH7A 4FXJA 3GTHA 1G7VA 1B1YA 3B9DA 3TUUA 3NPWA 1A0DA 2R91A 9XIMA 4K7YA 3I7RA 4WSHA 3UJEA 2VL4A 4JL1A 1KQZA 1RALA 5I6SA 3EWBX 3F4WA 4L65A 2QLYA 2TYSA 1WNOA 2D0FA 3T8QA 4JYEA 5A2AA 1JF6A 4H7ZA 3DC8A 1S5TA 3TQPA 4C6EA 4C1NA 3E0VA 3KBJA 1UG6A 4MPKA 3GC2A 3MCNA 4IIGA 1SPQA 4M6VA 3CYJA 1M03A 3LRMA 3B0VC 1SM9A 1OBAA 1PXGA 4O1AA 4IX2A 1XJBA 1ITXA 7A3HA 3V1PA 2OLHA 4YS1A 4JFWA 1W8SA 2J7GA 3IACA 4H8VA 2ZX5A 3BZGA 4TV6A 4ZQMA 3BURA 3AUJA 1QCWA 2NVDA 3O6YX 1UHVA 3DFYA 1EXPA 1P7TB 4MY1A 3APYA 3QTPA 1UKPA 2QIWA 1VFMA 3R8HA 2QUVA 3KOYA 3PWAA 1OK4A 5HDRA 1IGWA 2ZZ2A 3WH5A 2B31A 3BQ6A 1S2VA 4AWEA 2PDHA 2ZYFA 5AVHA 5TF0A 4YL2A 4R7OA 3KZPA 4I7UA 3V1HA 3W37A 3ABSA 2EHHA 4IMFA 4NXKA 2PWUA 4DWSA 3QKZA 1HJWA 1YYAA 1K3UA 2GOKA 5XIMA 4L1XA 4XAGA 2P3ZA 3GNPA 2P76A 2H9AB 3UWWA 3NZQA 4FP1A 1SJAA 3OBAA 2ZA1A 3N9RA 4D2JA 3LM3A 4C6CA 4OKDA 4PUJA 1IT8A 4KWWA 4JY9A 2FZMA 3PBYA 2A3AA 2WJDA 3S47A 3ARVA 5F7UA 1AG1O 2VOTA 1OABA 1SVDA 4Q8QA 3W70A 3TSMA 2ASHA 2W79A 4DELA 4H8UA 3UYCA 3GBEA 3SQSA 3NQGA 4FOUA 1TA3A 2PDQA 1TB3A 3T40A 4TIMA 2HXUA 3R11A 4PULA 3WJWA 7TIMA 3N19B 1JGIA 4Q8PA 4GYFA 2WNWA 3C0JA 2Y5SA 2WK2A 2HJPA 3CQ0A 4MNJA 3TZFA 1QW8A 1GW9A 2WV8A 3QQWA 3WQCA 5GQBA 5F2IA 3D6NA 4L9XA 1Q7ZA 3EX4A 2QW5A 4Q33A 4AMCA 4LUIA 1RD5A 5I06A 3VINA 3DFTA 1PX8A 4V15A 4LOCA 4H9XA 5D9MA 1ITUA 5C9UA 1AZ1A 3PUEA 5AHLA 3RO8A 3S5ZA 3W0KA 4OHQA 3L67A 4L9ZA 4XVDA 4ICMA 4XV0A 1RP9A 3ZS4A 3UWYA 3W53A 2WW5A 4Z2LA 1W1ZA 3RRAA 4NX5A 1GT8A 3NOYA 3PZ9A 4UTKA 1A47A 4D6GA 3ARSA 5LNVA 4R9XA 4CNOA 3TC7A 1BWKA 2J9XA 4GZIA 2A79A 4CUCA 3IV3A 4GY1A 3L23A 5HMFA 3PVFA 4MWAC 2CWXA 1VCFA 4E8DA 1PV8A 4NG3A 3G8EA 2PU0A 2H90A 2QPSA 2WLYA 4DBUA 4UQDA 1AQ0A 2JFEX 1E6ZA 1Z8AA 2VWSA 3W7EA 2RHGA 4US5A 2VCCA 3BMWA 5M3WA 2R8WA 4S3KA 1A5CA 4G1KA 4PCNA 4RR4A 1BYDA 1DJIA 2PRMA 2HE5A 2OWWA 3GVGA 1TUXA 5HR6A 4XZHA 2CXGA 2DT0A 3ABXA 4G2DA 1PSCA 5H8UA 1J0YA 3GXDA 3GDKA 3VD4A 4LCSA 4IIBA 2WVSA 2ACSA 1XH1A 1YBQB 2FQIA 1H11A 1TRIA 1SFJA 1FP8A 4ZXLA 4ECLA 2OT0A 4JFSA 2IPFA 1EJRC 3B8UA 4RL3A 2CKSA 4J3SA 1LUCA 1A5NC 1WAWA 1I8JA 1DQWA 3VKCA 4OZOA 4DPQA 1A5BA 2W0UA 2CERA 3GZ3A 1VAHA 4HNLA 5A6KA 4BK9A 5CPQA 3WD1A 1DWHM 3KTSA 1A4LA 4AY7A 2GGIA 4HOXA 3M5XA 1U1HA 1H2JA 3C52A 2ZICA 3K1DA 5J8LA 4FNUA 2D24A 4LUSA 3VE7A 4GACA 1ONRA 3EDJA 3VOFA 3PUDA 1OFBA 1XIJA 1UC5A 5IRPA 3M0KA 7PTDA 4MG4A 4Q32A 1KM2A 4HCDA 4IJRA 4J7RA 1AW2A 1CYGA 3ITCA 2R1KA 1CW2A 4GC4A 4GI4A 4GI9A 4QAIA 3O9NA 2CHRA 3VUSA 3S2LA 3W27A 3BJFA 1XRFA 1X8FA 1V0KA 2AQOA 4BCEA 1DKWA 4PCSA 3MUCA 3BG5A 3TC3A 2QNEA 3IAQA 3WLSA 2W9MA 3SN1A 2FFCA 4P8VA 1GHRA 3W00A 4JIHA 3QQ0A 1CXIA 3EYPA 3N2OA 4XZBA 4XO6A 4QBXA 2PDWA 3OA3A 2Y8UA 2AMXA 5CSUA 1GGOA 5JVLA 1J2BA 4J3ZA 3DG6A 1R9XA 2XUCA 1FY6A 5EMMA 5D8ZA 3MBDA 5CZJA 2PP0A 3VIPA 3CWHA 1X39A 3WD3A 1CIUA 4AZCA 1XYZA 5HA7A 3O7UA 3AJ7A 4EIVA 3WQVA 3G5EA 5IOBA 5FF7A 1WDSA 4J3WA 2PLMA 4GE8A 4DYEA 4AX7A 2E68A 1J93A 1XH0A 5J5RA 1O95A 4MGGA 3KOXA 1IXQA 4JYDA 3BLLA 3MVTA 4BF9A 4D6EA 3Q67A 1CB7B 4O11A 3L65A 1S39A 4OT7A 5GVJA 1TUFA 3HO8A 1OF6A 1XUZA 3PAOA 4A29A 4RDYA 4XZNX 3T08A 4NZJA 3G0XA 4PL1A 3OGSA 4AD3A 2C16A 1LOQA 5CZSA 3CV1A 3G6LA 4I8DA 4KH2A 4JZ5A 4CVWA 3E0WA 3GFYA 4WRHA 4ZTYA 1VB9A 2JEQA 1J18A 1L6YA 1LF1A 3L4TA 4GX9A 2R24A 3AU2A 3H2FA 2D73A 3EXRA 2EQDA 4KEUA 4AXNA 2MNRA 5EKYA 3CHVA 5A6AA 3BE7A 1HNYA 3RU8X 3Q45A 4D8LA 5AKQA 4ZA0A 2CZFA 5IDZA 1OM0A 5K9DA 5CJ5A 4J9JA 2HCVA 3PM6A 4EP8C 3MI6A 1YXDA 1WQ5A 2E6DA 3WK1A 2INFA 2JALA 3V18A 3S2JA 3WDQA 3R43A 3K2GA 2FLIA 4CQDA 1RA5A 3K8KA 5LNWA 3TCSA 7REQA 3TA6A 1TVNA 2VFEA 5C70A 3WK0A 1F3EA 4OVXA 2Z24A 3ZVHA 1WYIA 4B5SA 1LROA 1UQYA 3THDA 1ME7A 1Q4NX 1EC8A 4BQ5A 4KRZA 3BGJA 1CGVA 3TMQA 3KWSA 5LZLA 1RCQA 4JAWA 3LD5A 1KGUA 3CQIA 3E74A 1Z9AA 8XIAA 1H7WA 1W37A 4CN6A 4R88A 1RVKA 1OT1A 2Z1SA 4NJGA 3WDJA 3ZT5A 3PFMA 2WVVA 3ZR6A 5FJTA 4HA3A 4Z2JA 4QSFA 4O1BA 1FWRA 1NOWA 2WO5A 4ZTXA 1TX2A 4NT0A 1ZP3A 3GDMA 1NWUA 2ODOA 1ISYA 3RMEA 3QV7A 2NQ9A 1DHPA 4M8UA 1EA0A 4RCXA 4DVOA 4L4OA 2AGTA 4H9VA 2ZUNA 3SUSA 1Q6CA 1XFBA 4GZJA 1F6PA 5A6SA 2PTWA 1UR4A 3FYOA 2ZC1A 1AH0A 4NRRA 1R3SA 4NL1A 1B2YA 3B0PA 3USBA 3BLPX 5U4NA 1MVYA 1O5RA 3STFA 1H0GA 4QNWA 5JU6A 1TJ2A 3NL3A 4IG2A 1LRNA 3PJTA 5CLWA 3ENLA 3FAWA 3QC0A 1BGGA 4JHOA 3SW6A 4PRRA 4EPEC 1PKLA 1P6BA 1XP3A 1EF3A 1DORA 2Q8LA 1B3ZA 3E49A 4AHQA 1XSKA 4C6BA 2ZX8A 2I1OA 3VGFA 1VC4A 4X60A 4UCFA 5H8MA 1US2A 4Q8WA 2NXHA 3A4AA 1UWIA 3UETA 5IM51 4DWSB 3PUOA 4HVXA 4NYYA 1QI4A 4DPPA 1PCKA 1W0MA 2ADAA 3PF3A 4GJ1A 1JCLA 4F0LA 4YWIA 4XAZA 3CK5A 1DXEA