4JQ1A

Akr1c2 complex with naproxen
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
316
structure length
316
Chain Sequence
b'KYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C2
publication title Structural basis of NSAID selectivity for the aldo-keto reductase 1C family
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 117
structure length 316
sequence length 316
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4jq1A00
3MB9A 1PYFA 2PDMA 3GUGA 3LEPA 4JQ3A 3LQLA 2FZBA 4LAUA 3GHUA 1YNQA 2PDNA 2PFHA 2IPFA 4XZLX 3LNMA 3NTYA 2DV0A 1OG6A 1X97A 2PDQA 3UZYA 2PDHA 2PEVA 5LIKX 4FZIA 4LBSA 2R24A 4WRHA 4IGSA 4WDXA 1ZQ5A 1PZ1A 2HE8A 3H7UA 2FZ8A 2ACQA 3EB3A 2PDWA 3Q65A 4PRTA 4LBRA 1EKOA 1R38A 1S2CA 2IPWA 3CMFA 4ZFCA 3R8HA 2PD5A 2HE5A 4XVDA 2VDGA 2PDFA 3T42A 3LZ3A 2HEJA 4XK2A 4FA3A 2FVLA 3C3UA 4GCAA 4DBSA 1AZ1A 3P2VA 1EF3A 4WDWA 1IHIA 4PRRA 1YE6A 3ONCA 3R94A 1YNPA 4GIEA 4Q3MA 2BGSA 1C9WA 3LZ5A 2NVCA 2IPJA 4L1WA 4I5XA 3F7JA 4ICCX 3GHTA 3R7MA 1HW6A 3M4HA 1PWLA 2PD9A 1SM9A 2INZA 1T41A 1ZGDA 2PDCA 5DANA 4JQAA 1JEZA 4YU1A 2PDGA 1T40A 3UZZA 1Q13A 1IEIA 2IQ0A 1AZ2A 4H8NA 4DZ5A 4JTAA 3LENA 4XZHA 1X98A 1GVEA 1MZRA 1XJBA 3RX3A 5JH2A 1QWKA 2IKGA 3BUVA 3B3DA 2HVOA 2FZDA 1AFSA 3FJNA 4LB4A 3KRBA 2C91A 2F38A 1AH0A 3UG8A 4PUUA 2IS7A 4JQ4A 4YVXA 2ACRA 1S2AA 1A80A 3R43A 2QXWA 4EXAA 4QR6A 4YVPA 5HA7A 4DBWA 1ZSXA 4YVVA 2PDPA 2J8TA 2DUZA 1MRQA 4IJRA 4GQ0A 1Z89A 1AH4A 3MC5A 4XZIA 3UYIA 3WBWA 2IKHA 4H7CA 1RALA 2FGBA 3GHRA 2R9RA 2PDYA 3CAQA 4JTQA 1K8CA 5C7HA 4WGHA 2WZTA 4WDTA 1LWIA 3H7RA 3S3GA 5M2FX 2I16A 2PDLA 3M0IA 3UZWA 4MHBA 3M64A 3D3FA 1US0A 3LBOA 2HV5A 1Z3NA 5HNUA 4LAZA 3O3RA 4JQ1A 4ASTA 4XO7A 1S1RA 1PWMA 3Q67A 3UFYA 4FAMA 3H4GA 3CV6A 4JQ2A 2PF8A 4IJCA 4PR4A 2ISFA 1ADSA 3DOPA 4WDUA 3COTA 3FX4A 3LQGA 2IQDA 4AUBA 3RX2A 3WCZA 2ACSA 3LUTA 4XO6A 4NKCA 4JTCA 3ERPA 4WEVX 1YE4A 4EXBA 5LIWX 3V35A 4FALA 4JTRA 1PZ0A 2CLPA 2IKIA 3V0SA 1QRQA 1XGDA 3N2TA 5JH1A 1X96A 5LIYX 4GACA 3V0TA 1M9HA 3U2CA 5AZ1A 5AZ0A 4XAPA 1XF0A 4JIIX 3G1RA 3RX4A 1VP5A 2PDXA 1Z8AA 4HBKA 1AH3A 3G5EA 5LIXX 2FZ9A 2PDUA 1FRBA 2NVDA 2ACUA 2INEA 2PDBA 1RY8A 1MI3A 4G5DA 4LB3A 1J96A 1S1PA 3UGRA 3N6QA 2DUXA 2AGTA 5LIUX 4XVEA 4F40A 2BGQA 4OTKA 1RY0A 3UZXA 3VXGA 1UR3M 4RPQA 3BURA 4QBXA 3QKZA 4XZMX 2HDJA 2PDJA 1LQAA 3BV7A 4JIRA 2HVNA 3V0UA 4QX4A 4PUWA 2BP1A 3CV7A 3UP8A 4PMJA 3WBYA 3DN5A 1ZUAX 2PDKA 3GHSA 3WBXA 3LN3A 3CAVA 4R9OA 3EB4A 2ALRA 3CASA 3R8GA 5KETA 2IPGA 4JIHA 1VBJA 5HNTA 4HMNA 2P5NA 4QXIA 2WZMA 4GABA 3R58A 1Z9AA 4Q7BA 3UWEA 4JTDA 1HQTA 2PZNA 3ONBA 2I17A 3R6IA 4XZNX 4DBUA 3LD5A 2IKJA 3WG6A 1EXBA 3BCJA 4GQGA 2A79A 3V36A 4YS1A 3O0KA 2F2KA 1Q5MA 4L1XA 1EL3A 3EAUA 4GA8A 2PDIA
chains in the Genus database with same CATH superfamily
3W2JA 4GY0A 3J7HA 3HG3A 1C8YA 2V9DA 4GVFA 4JFUA 3I3BA 2VGIA 4DJEA 2Q09A 1FWHC 4LVGA 3MKKA 3PC0A 2XIIA 2WMIB 3GHUA 1B3OA 5FESA 2HMCA 5K3VA 3VKKA 4X0VA 2ZWYA 6TIMA 3SCQA 4GUGA 1ME9A 4F9JA 3ABSA 4HU3A 1J0IA 4WSHA 3T4WA 3PAJA 2AQWA 2O9OA 1RP8A 2PC4A 3L7RA 2OEJA 3U8GA 4ZVJA 2GWGA 1HT6A 3TEVA 4A8RA 4Q8QA 1EQCA 1JD9A 1Y5XA 3DU0A 1O5RA 2GLKA 4C5YA 1MVYA 4KCWA 3TC6A 4J2PA 4P7NA 2R1LA 2E9LA 3NQVA 3QR1A 1QNRA 4FZIA 1E5JA 1U30A 1V5XA 1CXLA 4QSFA 2VEFA 4ZQPA 3WK2A 3MVTA 1KQYA 1SJCA 3RXZA 5M3WA 2EAWA 2ACQA 3EX6A 1A50A 4R34A 1Z32X 3KTCA 3NM3A 1MYRA 1K9FA 3CHEA 1GK8A 1KM6A 1EJUC 4X2RA 3CMFA 3PUGA 3DX5A 4CQDA 3TCEA 1UKTA 3ZLGA 1BWKA 1E0WA 1NOUA 7XIMA 4MWAC 5F1VA 2H6RA 4H04A 4LUTA 1GW1A 4N0RA 3IVUA 4AZ6A 4LCQA 3S6TA 3TP4A 1RCQA 4KPLA 4CCDA 1X1NA 4JD4A 3R4IA 2BDQA 4M6QA 1TUFA 5A2CA 4OGZA 4PN2A 3TLQA 5A3HA 4P7OA 2I5GA 1F05A 4U28A 3GAKA 1ITXA 4E5TA 2OZ0A 5LHEA 1Z44A 2B7OA 4Y9OA 3QKEA 4J2MA 1LOLA 4H83A 3GG8A 5A8NA 2Y8UA 3W1NA 3LG3A 1EP2A 5CPOA 4CEXC 2TPSA 2QYGA 1J01A 5C2XA 4J27A 2VX4A 2BFGA 5ABEA 1L8PA 3WDRA 3MQTA 3C2RA 4DJDA 2JGYA 1LJYA 2CBVA 4OOUA 1ZJIA 3NURA 3L0GA 4DBEA 2PLMA 2YA0A 1REQA 3B3DA 3W7PA 4BI6A 1UWUA 3NXLA 1F4AA 2Z1VA 1OHLA 2QCDB 2Z1SA 3AFBA 1QDSA 4LOCA 3RM9A 4JQ4A 1R85A 1Q63A 2VL4A 4XV0A 1X1ZA 4HK5A 3QF0A 1KCKA 1Y8BA 1QK0A 4DJFC 1VQTA 1DBTA 3G2GA 4K8GA 1XFBA 4JTKA 1NF7A 1WDRA 3UZJA 3BOXA 2WV8A 2D69A 2FYMA 5FJIA 3KX6A 2JKEA 1J79A 4AXKA 3A3XA 4HZ6A 4ZQCA 5AOUA 4CCCA 2A7RA 4LVDA 1RQHA 4UTWA 4AD2A 3QGAC 5I7GA 1A5KC 2VD9A 1HJQA 1XLHA 2GQ9A 3UWYA 2HPMA 5FL1A 4W8AA 5PTDA 3IIXA 2HK1A 4J7RA 5DCEA 1ITQA 5KZEA 5D2TA 2ZZ6A 3M7WA 3IACA 3G1HA 4WIWA 1P7TA 4DZHA 5CPTA 1HFBA 3MMTA 4IFOA 2J9ZA 1ECEA 1KRCC 3TKFA 2DH3A 1G01A 4AX6A 4IJCA 4DJDD 5LXXA 4H9XA 1CCWB 4Z2KA 4ROQA 4EPBC 3LCHA 4JYEA 3WFLA 3G6LA 2WVVA 4U33A 3A6OA 4W84A 1BVZA 1V3LA 1TX0A 1ZAIA 4AIOA 2Q8ZA 5G4WA 1CXFA 4PFMA 1JNDA 4CQCA 1B4EA 3S4TA 1YTDA 3AIBA 1P1MA 4B2DD 1LOSA 5BMWA 2PP1A 3V0SA 2VEIA 4PB3A 1Q6RA 3VYLA 1RQEA 2PSNA 3A13A 3GBEA 2Y0FA 5BOFA 1MUMA 1E3XA 2B7NA 1TV8A 3AIUA 3HGOA 2QT3A 1GJPA 1NELA 2Y70A 2ATSA 1XIHA 3TTYA 1ZALA 5LYRA 3QC3A 5HMFA 4V1XA 1P0DA 4BY3A 2I9EA 1QI4A 2WLZA 2DIJA 2YBUA 1RLDA 1XIJA 3R1ZA 3EWZA 4E3TA 3II1A 4W9TA 3V4BA 4JFSA 3KDOA 1Y65A 4LB3A 3U5UA 3FKKA 4DO4A 2DUXA 3KW3A 3AZSA 3K4DA 1ONRA 3W86A 1WX0A 3LHYA 3S8HA 3NPXA 5CSYA 3LV5A 2TSYA 3RFAA 3CB8A 3GTIA 1A4MA 4C6BA 2RGMA 3F4DA 2GL5A 3FK4A 4TVUA 4FLSA 4MZ1A 4A05A 2PP0A 4Q8NA 2XTKA 3WZ0E 2DUAA 4QX4A 3DI0A 4I6KA 2V30A 1E71M 3BLKA 2XIMA 4R3UA 3EB4A 4D72A 3DH7A 5DRIA 4PBFA 2ZADA 2Y63A 3B8IA 3T1GA 1Q66A 4HMNA 3VK5A 1FQ0A 3ARYA 1QR7A 3GR7A 2C14A 5HAOA 3WY1A 2PS2A 4F0SA 2ZC1A 2QCLA 5CC7A 1J93A 3NQAA 3VFLA 3M44A 3UETA 3ANUA 1LDCA 3WL0A 1XL9A 4C6MA 4CKQA 2NUXA 4TIMA 1TPEA 4H6QA 2CHNA 1EL3A 3BAIA 5D04C 3INPA 3QC0A 4FSAA 2NWRA 3M47A 4KT2A 2CKRA 4UNKA 4GA8A 3ABRA 2FPYA 2DPEA 3P62A 3MB9A 4NAEA 3RR1A 4DF0A 1ISXA 3CK5A 4LAUA 4RZBA 3E38A 3KOZA 3WF0A 3VDBA 3DXIA 2BZNA 3DYOA 2QUMA 2UY4A 4HZMA 2Y62A 2VXNA 4L6DA 1A4LA 1F6KA 3ZS4A 2VNCA 4R27A 2QDHA 3B05A 2YCIX 2WPGA 5SWUA 3UESA 3FOKA 4QE5A 2DEPA 3ARTA 3N4AA 4TV6A 3GK0A 5I2UA 4LS2A 1J11A 2PDWA 1RUSA 4DI8A 4IMCA 2I5QA 1EX5A 2Z26A 4HOXA 1GQJA 1O60A 2H9AA 1O7AA 4NZ1A 3SM0A 3ARWA 3ZVHB 3LOTA 4J5NA 5JIPA 3LBCA 3KDNA 4LUIA 4RPPA 4FA3A 4PCSA 1Q2RA 4DBSA 2RDXA 1C92A 3UXIA 2XHYA 5CAHA 1ZBWA 3W1AA 1E0TA 1TPC1 2ALDA 1TA3A 2C8NA 1PS9A 3HQPA 2ZKMX 2YBTA 2VFIA 3IWPA 1NM9A 4P2VA 3W2MA 3R94A 3TNOA 3IV8A 4QHRA 1JYNA 4V1YA 3LZ5A 2NVCA 3NQ8A 2QHAA 1CLXA 5FJTA 5CG0A 3W27A 5ABTA 3AXXA 3DG3A 2OSXA 4WY0A 4DM2A 3D6NA 4FLRA 4BQ2A 1T41A 4ATDA 1E51A 3OOQA 1TZZA 2XZ7A 1PCWA 3HV9A 2H3DA 1H7WA 3CHCA 1SU5A 1W3HA 1C93A 3STGA 2F6XA 2V81A 4HNNA 1OQFA 4O1EA 4N2YA 1IEVA 4R7OA 4ZO6A 3STCA 3VNIA 1W3IA 3CZGA 1XUZA 3IIPA 1XINA 1NWRA 2WWCA 2YFOA 1AFSA 1OG0A 4IGNA 3OHIA 3H2AA 3N2CA 1DL3A 4XUGA 1XGEA 4HPNA 3OLDA 4DM1A 3AYSA 1AH0A 4Q33A 3B0VC 4INFA 2ZRXA 3TOYA 5HUPA 1KXQA 4I7WA 2CZDA 2QXWA 4YMZA 1VJZA 4B5UA 3AHXA 1FWTA 1ZSXA 5H8MA 1T6MA 4GG9A 2WWDA 1V8EA 1XLIA 4HMCA 1X7IA 1OYAA 2WSPA 1TPUA 1WOBA 3GLCA 1E6QM 3G6MA 1CLVA 4GYKA 2PTXA 1R3VA 1NIUA 1JZ2A 3IGHX 4H7CA 4LUSA 4IP4A 2WAGA 3DI1A 1LRNA 1HKWA 3AIWA 1E4IA 2HZGA 3KVKA 5U7SA 4A29A 2WC7A 3CZJA 5TIMA 1H11A 1YKWA 1LWIA 4CCEA 1UZDA 4CD6A 3M0IA 2X0HA 4DF2A 4H9MA 5FF2A 4QDWA 3O3RA 3QZAA 2E77A 2Z25A 4X3ZA 2OU4A 4LXFA 2E68A 4TUFA 5GJNA 4HYRA 1XRTA 3CBWA 3ZJ6A 4JXCA 1IR2A 3KZSA 2CITA 1FWNA 1UD2A 4Q4RA 3LM3A 2AAAA 3UR7A 2Y7EA 3S5YA 5MKGA 4Q4PA 3CZLA 3CT2A 3N15A 4Z0SA 3WFZA 3WLJA 1N7KA 1PO9A 2EPLX 4GYFA 3LGEA 4M29A 3TJIA 3F2CA 4IPPA 1X7FA 3VNJA 1GCYA 3W1TA 4TR9A 3DYMA 4EAMA 1DP0A 2PMQA 3DESA 4BQ5A 1MDRA 2NV9A 3WJYA 4HVXA 1A5AA 4HA0A 2RHGA 3IRDA 3K8MA 2TODA 2V3DA 4WKFA 4NSBA 4WLCA 3UA3A 3KP0A 2WNWA 1SFLA 5AZ0A 4E4UA 4XAPA 4HHMA 4MDOA 4MNKA 4J40A 3HBLA 2X7VA 4LYQA 3N2MA 1VFFA 1OF6A 2FTWA 3ARPA 4HGXA 2QUNA 4HBKA 3NQGA 2YKKA 4UTHA 4U2ZA 2PGFA 2DH2A 3LHTA 4PMYA 4N9DA 4IF2A 3CL6A 3SADA 1UR0A 2IUZA 3VGEA 1UQZA 3IUHA 2X0SA 4I8DA 3GWQA 3O63A 3PWAA 5LNRA 1KFLA 5IHSA 3PZVA 4IIDA 1KBKA 1W31A 2YL5A 4MM1A 3VXGA 5BRPA 1V79A 4P61A 5D03A 2PDJA 4CLMA 1KGUA 3UU0A 1F5ZA 1UJQA 4JIRA 2PU0A 1B1YA 4XZ9A 3CMGA 4LUJA 4GH3A 1XM3A 2XM1A 1B30A 1EEPA 4C7GA 1F73A 1XQKA 1E15A 4N7QA 3GHSA 1EWEA 3TWAA 5E9XA 4FNTA 2ZTKA 3QW4B 4TX8A 1TIWA 3S2JA 4JX5A 1EP3A 4IL0A 2PRHA 4DJEC 4OUIA 1QI0A 5CZKA 3W01A 1MEIA 4HA1A 3R58A 1EP1A 4J3VA 2CLIA 3U57A 3NQ7A 4E3VA 1JJKA 3TX9A 1XQLA 4P7QA 1EOMA 3R6IA 1K6AA 3GM8A 1TV5A 3USZA 3N1AA 5AYXA 2INFA 2VRJA 3THQA 3B0PA 4AHOA 2F2KA 1E43A 2V67A 3NDOA 1QNOA 4IIGA 5A6KA 2BY3A 1PYMA 2BY0A 4KIEA 1M7OA 3GUGA 3TSMA 3G0SA 1OSEA 4DN1A 1VFOA 3AS3A 3LMYA 3VOCA 1TFVA 3KOXA 3AYTA 1UD3A 5ENLA 2FJUB 3GG1A 3OVRA 4A6GA 3ZQ9A 3LNMA 1ZBKA 2J79A 3I68A 4UB9A 4UIOA 3QPYA 5HXMA 3DC8A 3WNPA 4QROA 5J5RA 2QDGA 1ITUA 3BZJA 4U3AA 3NNTA 1W8SA 3F4WA 4MUPA 1ELSA 3CWNA 4RNIA 3HTWA 4IMGA 1XXXA 3NO1A 4K68A 1GEQA 4V28A 1W2PA 3WQPA 1SMDA 3W85A 5CSRA 2QCGA 2QDDA 4ZFCA 4AFYA 4Y7EA 5CLTA 1DXEA 3G77A 1M01A 4XVDA 3REQA 1GQLA 3GIYA 4NJHA 3MUXA 1P5BA 4DAFA 4QS6A 3WMBA 3OP2A 4IIBA 1EC8A 1CBGA 5ECUA 5C0QA 1AZ1A 1ZAHA 5AYYA 1IHIA 1JDFA 3FY1A 7REQB 2JK2A 1X39A 3WIJA 1TJ2A 5E0KA 5IOBA 4WKHA 3IGUA 1XX1A 5FJOA 4UTFA 1IT8A 5LSMA 2Y88A 2Q02A 2V5JA 1BLIA 4ICCX 5AC5A 1K8ZA 3OVGA 3BW3A 4IOTA 5FJUA 3CWHA 3QTGA 2XG9A 3GTXA 2D23A 3GX9A 1RVGA 2NUWA 2PC8A 1QT1A 2JALA 3Q37A 4LAOA 4US5A 1G67A 4EKJA 4FEZA 3NQCA 4KGJA 2E40A 1GG1A 3CQKA 3KFTA 3W6LA 1S5WA 4WXZA 4W8LA 3PJXA 3CQJA 4HU4A 1V02E 2Z7KA 2H8ZA 4B16A 5C2CA 2EXOA 4JN8A 3SCVA 1XD0A 3DHDA 1S46A 2NXIA 4PUUA 2NSOA 1U5VA 1JGIA 4HNOA 3WYZA 5GQBA 3CAWA 2PE4A 4YVPA 1K77A 1M6JA 4UNIA 4QJ3B 3WNMA 2W0UA 1LT8A 4JTHA 3LHWA 3KM8A 4XZWA 3ZR6A 3BTNA 2DJXA 1LL4A 1HX0A 3TIMA 1H1YA 4RXFA 1WBHA 1JZ6A 1E9ZB 2PDYA 4DWSB 1RJPA 3LRMA 5C7HA 4GINA 3TN4A 4DHGA 3B9AA 4E8DA 1V7YA 1JG9A 2R94A 1NU5A 2C19A 3HPZA 1LM1A 3TA9A 3TMQA 1KB3A 2CNCA 5FEWA 3UR2A 2C18A 2WVSA 3HMCA 2J66A 4K1GA 2JGQA 3TN6A 3KVLA 1VIZA 1ZB5A 3H7VA 4O4WA 3NSXA 2I1OA 4UMAA 3I7QA 4C6KA 1FKXA 3PG8A 3COTA 2QR6A 2CXEA 1LUCB 3BLFA 4G7FA 3SCWA 4W88A 3RX2A 5ABFA 3M07A 2C0AA 4GQQA 3WKZA 1GOKA 1XICA 1XBYA 4H9TA 3R0DA 1VGAA 4P8XA 3ERPA 3FJLA 2V68A 3AICA 3OU8A 3NZGA 2R1PA 4I90A 2R8WA 4C6LA 2QGYA 2CLPA 1TX2A 1E40A 1C8QA 1UUOA 5C9XA 4CQAA 4GOAA 4ECLA 3LB0A 2FZNA 1NH6A 2PGWA 2G8ZA 5GJPA 4QJ5B 4PBEA 3WH9A 1ZAJA 2EG6A 4LEFA 3VIHA 4DPQA 3RX4A 3GNXA 1K03A 3PULA 1AQMA 1EJRC 5LIXX 1KWKA 1LLOA 1OJXA 3GIQA 1S5NA 1ODUA 1MI3A 2DU2A 1J96A 1S1PA 3EXRA 1RAKA 4BS0A 3LPFA 3KRUA 2WMIA 3AAMA 3MHGA 3RUBL 3AXKA 4C60A 2BGQA 2GYIA 4C6IA 3W6MA 3FCPA 4WD0A 2ABAA 3WUGA 4Z0JA 1ICSA 3LNPA 2XH7A 5LA0A 5LA2A 1KGXA 4Y90A 4XD3A 1SSGA 5CC5A 1GOQA 3EWCA 1QI5A 3L0KA 4F0KA 4D8LA 4GI8A 1QNVA 3RJXA 1JYVA 3ARQA 3BQ5A 4FLOA 3RU8X 1F8MA 3NJ3A 3SI9A 3DGBA 4PMJA 3PPHA 3NYDA 2X09A 2A6NA 1Y5VA 4R53A 3CUJA 3WLLA 1VBJA 1KKOA 1GHRA 4M3PA 3XIMA 4MZYA 4PMNA 5I00A 3AXHA 1JZ5A 2GJLA 3JVAA 5DX7A 1Q8AA 4NZ5A 2GVYA 3DERA 3N4EA 4C6PA 4PUDA 4W7WA 1MFUA 4TX9A 4OHQA 2AQOA 4C6FA 1U2YA 2XN1A 2E0PA 4G8TA 4DWDA 1SVDA 3BG3A 4FR1A 2GJNA 3TTQA 3O15A 4N02A 4LC6A 2GGIA 2XVNA 2VTFA 2GDQA 4ZGYA 2C3ZA 1A5MC 4QJ4B 3C2YA 1JCMP 2JEQA 7ODCA 4Z2GA 1R3SA 1DTNA 3A64A 3SRKA 4GI6A 1EX1A 3MJYA 4X60A 1EOKA 1NF0A 1R0MA 1VCVA 1WUEA 1ZLPA 2Z2BA 1F8IA 1D7FA 4JEQA 3NZPA 2QJGA 4TMCA 2XFWA 2YA1A 5AN7A 1NY1A 1BXNA 4IIHA 1LBMA 3ITLA 3RHGA 3L67A 3Q2DA 4QM1A 1FCUA 3LRLA 2CLHA 4GH1A 2REQB 3EWDA 2Y8VA 3AXMA 3ENLA 4ZBCA 2BHUA 1ME7A 4IGSA 4GKTA 3C8FA 5JBDA 4AEFA 2OODA 4BWLC 3Q65A 1WDSA 8XIAA 1R9XA 2QCDA 3ZT5A 1E5NA 1R47A 1X1OA 1W1IE 3FHQA 2HNHA 3CZ8A 3SQLA 5F7UA 2AQVA 1EYEA 2OWCA 1K70A 2VDGA 1XYCA 4GI4A 1IF2A 3L0NA 5CBIA 3ABQA 3LZ3A 1ESWA 3PY2A 2R1MA 2ZDRA 1LTDA 1GVFA 4J3UA 3GAYA 1KLYA 4UQCA 2QF7A 5LGZA 2EPKX 3THCA 1DWIM 4IQJA 3SUSA 3N6JA 3ONCA 3LLDA 3QJAA 2OQLA 1YPIA 4HSOA 4W7VA 4KRZA 1TCMA 4X63A 3MSGA 3N4FA 4QG8A 5IDIA 2QCCA 2IPJA 1RBAA 4MY9A 3R7MA 4LALA 2W62A 4X22A 5G2IA 2OOGA 1H09A 4D6EA 3I7SA 4JCLA 9XIAA 3W7QA 1Q7ZA 1Z69A 4MNMA 1KFEA 4BFAA 2VZUA 2XH2A 1QU4A 4NF7A 3OJGA 2X2YA 1HKVA 1SZGA 3MYOA 2I56A 1G94A 4G1KA 5FF7A 1SW3A 4MY8A 1OD8A 3VGDA 1WKDA 4RKAA 3CV2A 3CPGA 3LGGA 1KFWA 1TJRA 3K30A 2DSZA 3I3EA 1OFOA 4K38A 3QYQA 2F38A 1VFSA 3G1YA 3CUXA 1YXDA 2Z7GA 3MCOA 2UY5A 5A69A 2Y85A 1CGTA 2OPJA 1GW9A 5D09A 2V0TA 1NP0A 1IGWA 5DMYA 1GYNA 4JTSA 3GO2A 1LBFA 2VC6A 1HZYA 1TKKA 3VNMA 5CZSA 3Q4DA 4GC3A 4IPNB 2DSVA 3L5LA 2JF6A 4O11A 1RALA 1S38A 1EJXC 1TREA 1OCBA 1VAHA 2OQHA 3BOLA 4B9ZA 4AC1X 1LOQA 1PHQA 3H12A 3M5YA 2I16A 4KWUA 2I14A 2QGHA 1WZLA 4C6DA 5CZ0A 3M7SA 3C4UA 2D73A 1BVWA 3A4JA 5DT5A 1OADA 1NDYA 2QIWA 3BE7A 4H8VA 1OFBA 2ZWZA 3Q94A 1XSKA 1ADSA 3H2MA 2ZXBA 2VGGA 3W37A 3VD4A 3LM7A 1HVQA 2GGGA 1QOPA 3MYPA 3UG5A 1R2TA 3LUTA 3N73A 5HQLA 2ISVA 4WEVX 2QIIA 1WZKA 1OWQA 4ZMGA 3VVGA 2RUSA 4ACYA 4AF0B 2WVTA 4A35A 4H8UA 2VP8A 1UPPA 4WGXA 4AWTA 1XRSA 2QF8A 1JPDX 4R5EA 1B57A 1IGSA 1WAUA 2XVGA 3UNTA 1RA0A 4H9VA 1XG4A 1CGVA 4K37A 3ABZA 2FFIA 2Q6ZA 3G1RA 3HG2A 1Z8AA 4O12A 3UA4A 3G5EA 3VGFA 4H1ZA 3VOGA 5DY3A 4EANA 3GH7A 2FMOA 3UXDA 2W3ZA 1TJ1A 3WJXA 4IH3A 4G5DA 4O8RA 3T2QA 1I1WA 3S9YA 1RPKA 3RCNA 4S39A 3APGA 1THFD 1EJTC 4M80A 3PPGA 4YHGA 4I7UA 3GTFA 1ZP3A 4CN1A 1G69A 1I8JA 2VFGA 3KBMA 4FIQA 2GOUA 4E4FA 2ISSA 1ICQA 2E3ZA 1KBIA 5BZAA 3IUIA 5E9AA 3UP8A 4QIUA 1R87A 3O0FA 3OYXA 3HOJA 3H22A 2P3EA 1CGYA 1UWIA 4Q8OA 2VZOA 4IFRA 3S1WA 1O68A 1F74A 4WOQA 2CCRA 1OFDA 1NWSA 4AIUA 2VVNA 3B4YA 1Q4NX 3EB2A 3APYA 3UEQA 1V6UA 2E1DA 3ANVA 4RV3A 3KBSA 2WZMA 3LSCA 3UPWA 3UD6A 3BLIA 3VAVA 4HQVA 2PZNA 4F9DA 4M1BA 2ABBA 4Y9PA 3NQ2A 1F6PA 3ZWTA 3DFNA 1BFNA 3GVGA 3NGJA 3LY0A 5KZMA 1Q6EA 3BJTA 4XAYA 4AIEA 3HQOA 4IXXA 4H2CA 4R7WA 5G1TA 4R88A 3EAUA 2CYGA 3ZT7A 3GUWA 2UY3A 3SCNA 4Q8UA 3HPAA 3T09A 2ZUVA 4U4MA 3VNKA 4W4QA 3OYZA 1IQ8A 4IQEA 1ICPA 1N8FA 4ZTYA 4KH2A 1TR9A 3FAXA 3F5JA 1XLEA 4JQ3A 3R10A 3T40A 3S1GA 4UFKA 4ALDA 4LS1A 1J10A 1YNQA 4YNGA 2Y7FA 1AJ0A 4YTSA 4D9PA 4DEFA 4QE1A 1EIXA 1NP2A 1FY6A 1ODZA 5D33A 1EPVA 2WHJA 5AECA 1OG6A 2G41A 3S1VA 1BQGA 3CYVA 2PTZA 3CH0A 1OFQA 1DQWA 3PZ9A 3VIIA 3ARUA 4J9JA 2PDHA 4ICNA 3PAOA 4S3GA 1TE1A 4QLKA 1K4HA 2QVHA 3WQ6A 3DEQA 1TZ7A 2FGLA 1UP0A 1S2UA 2YBVA 1FWCC 5CPQA 3GC5A 5IBXA 6REQB 4YTTA 1UC4A 2C1GA 3E0WA 4L65A 4Q6JA 2BOGX 1BWLA 3R8HA 4B5WA 5C6MA 1HJSA 1QI2A 1GOXA 2V2CA 5AHIA 2J7HA 3H2FA 4XK2A 3H54A 5CBBA 2CW6A 5MF5A 3C3UA 1VCFA 1QXLA 3W83A 2WSQA 1JDEA 1Q3NA 3AIRA 3AMKA 3V5OA 3C2FA 4O1FA 4U10A 4F4RA 3L12A 3MA8A 4MFEA 1D7KA 5XINA 1GOOA 1F9CA 4DPPA 1W9XA 3LRKA 4ML9A 4PZVA 4MJ4A 1C9WA 5AC4A 2CHRA 3BCFA 1YTEA 3DKLA 5BWFA 8RUCA 3NPVA 2B81A 3TZFA 2CFFA 2YXGA 2HWGA 3WMLA 3K8LA 3HGRA 2CZVA 1E4LA 4K8HA 3LGDA 3ARXA 4F2BA 1GGOA 2ZYFA 3TN3A 3DKJA 3BXWA 1OYBA 3CS2A 3EA2A 3OGSA 2I9UA 4O54A 4YCOA 4NZCA 2FMNA 4IX0A 1C29A 1IEIA 4GGBA 4C6CA 2IQ0A 3UY7A 2PLCA 2YCKX 3T4CA 5HJYA 1GONA 1QOXA 3IGSA 4RL3A 2X7WA 2C13A 3KBJA 3IJ6A 1OX5A 1GVSA 3OTRA 2WVUA 3GH5A 2J27A 3UJFA 2ACRA 3I6EA 1WKFA 2O92A 1BGGA 1PX4A 5HWJA 4DBWA 4BR1A 1GHSA 2ANUA 2P1FA 3C56A 5DY2A 5EMUA 4V15A 3RK8A 3I6RA 1QHOA 3FA4A 2J7BA 2ZE3A 3PZMA 4PMVA 2FGBA 3BK0A 2Z28A 4HK6A 1H7OA 4UCFA 1K8CA 4WGHA 1FH8A 1BEUA 3MT1A 3CQHA 1FXQA 2AGKA 2CXGA 5T26A 4XAFA 2GJXA 1BKSA 4K1WA 4WF7A 1UBPC 3PN8A 5TD4A 1KTBA 3NIYA 3A4WA 5CPNA 3FDKA 4ASTA 3EX2A 1QNSA 3STPA 1H51A 1KXVA 1XCFA 3XISA 1LQ0A 4GJJA 3LCFA 1VFHA 4LX4A 2XIQA 4CN6A 3ARRA 1TZ9A 2XSBA 3GXMA 4W89A 2DT1A 2O4QA 5FEPA 3WQ5A 4XKYA 2HROA 1UOKA 2DDXA 1GJUA 2WC3A 4NP7A 4QQ3A 3MCNA 2X40A 3WCZA 3LHVA 3ZJ7A 4JYDA 3KEHA 1DWFM 3HA1A 1D2KA 4GGHA 3LU2A 3PZOA 4HP5A 1A3XA 3ARZA 3RYSA 2PB1A 2O4MA 5CJNA 3LV6A 2GFTA 1EDQA 1XGDA 3QH2A 1FA2A 3W88A 4CUCA 2BMBA 1GJWA 2QKFA 4DNMA 1OC7A 3VD9A 1J5SA 5CGMA 2PWFA 1D3GA 4D6DA 1VYRA 1FH9A 1FRBA 1E6XM 1GKQA 3KRSA 4Z2LA 4JTTA 3HF3A 3TE9A 2G97A 4UBPC 5H8PA 1OC5A 3EWWA 1EQPA 4H9UA 3EOLA 1VYSX 3W76A 3O8AA 3JZUA 3G8RA 4XKMA 4FXRA 3NPUA 2OGJA 2G3NA 3W1PA 1FWSA 3BURA 4B5SA 2LLEA 3MMDA 4PULA 1OB0A 1LLZA 3ITCA 5HQMA 2GUYA 1B9BA 1EGZA 4F0HA 1I45A 1UB3A 3M5VA 4K7YA 3BV7A 3ZM8A 3RDKA 4MMWA 1T99A 1B3VA 3SCOA 3E5PA 2RGLA 1MQPA 4PUWA 1XRFA 5HWNA 2A7NA 4D6HA 4DY1A 3TN5A 3DN5A 1EDTA 3ITXA 3HQ1A 3WBXA 3HG5A 3XINA 4MWAB 1PUDA 1VKFA 1XIFA 1KLZA 3CTLA 3GVQA 4AEEA 2IPGA 2GK1A 2CU0A 1K7FA 3UVAA 2X05A 2A0NA 1H7RA 5G2HA 4TTUA 3S5SA 4GABA 5FF4A 1CXKA 1LQ2A 1Z9AA 1EEXA 3LCGA 2OYKA 1ZY9A 4M24A 4CN4A 2ZUNA 5B7YA 1SW0A 1UH4A 3ATYA 1FDYA 1XIMA 4GXMA 3IJ8A 3WEOA 6CGTA 4HTYA 1GORA 1US2A 3H2OA 1DIOA 4N6EA 2QPSA 3CUZA 2VX7A 1JCNA 4C5ZA 5CSSA 1IXNA 4GPNA 4WJEA 1A53A 1M5WA 1F6YA 2FB2A 3IJ9A 3AIVA 5D2YA 3W71A 2GSEA 3RR4A 1ZJAA 1KO0A 2VD8A 2YZ5A 4LS0A 3WLNA 4KETA 1PYFA 3KCOA 4DUXA 1DIKA 2Z0IA 3LQLA 2E25A 4JYFA 5CQ1A 2OYMA 1H0IA 3S1UA 1GWJA 3ORWA 1GYLA 3UCDA 5I02A 3GTNA 3OHMB 3EEGA 1XSIA 1TIMA 1VHCA 4HA4A 4L4PA 4LFYA 1NJJA 2HTMA 5I06A 2B7QA 1OZMA 4OQVA 2VFDA 2NUYA 4AMAA 5BXRA 4KRTA 1KWGA 1PIGA 1XIDA 3MDUA 3PTKA 4IIEA 1UD8A 3UG3A 4C1NA 3HPSA 2AL2A 1WBJA 3HZ3A 4AY8A 1GZJA 1EKOA 4ATLA 3M0LA 3TYUA 4EE9A 1DIDA 1SZRA 3FEMA 3GXPA 1UHVA 2HE5A 1XYMA 4IISA 3B9DA 2PDFA 4PMXA 2E09A 1SPQA 2HEJA 1L2UA 2XINA 1S5TA 2WOQA 5AY7A 1TVNA 3FHAA 4I9AA 3GE7A 4XWUA 3U48A 2Q8XA 2P10A 1EYWA 5CG7A 1EF3A 2WKGA 4B9YA 3OA3A 3B4UA 4S3BA 4BQ4A 3E02A 5C2GA 2JKAA 3TYDA 4MUZA 4FOKA 1ZBVA 5A8PA 1MSSA 2BS9A 2D3LA 4OOZA 3TC3A 4AB4A 1O1ZA 1O66A 5IHRA 3BL3A 1KR1A 3ITYA 1E6PA 4QE4A 3CU2A 1KTCA 2P53A 2X2GA 1E73M 3W00A 2ZBTA 4ZE5A 4G7EB 4RE3A 1WXZA 4GK8A 2A1YA 2BBFA 5HULA 4Y96A 3VUPA 2HXUA 2XN0A 3NQFA 4URIA 1P6CA 2NQJA 2PDGA 1LUCA 3D47A 4K3ZA 1POJA 1IWAA 2A3AA 4TXEA 2ZUSA 3JR2A 3KLLA 4DX3A 2P8BA 5I3DA 3PBWA 3C5QA 2CLEA 1Q6QA 2VGFA 3EXSA 3BARA 2J6VA 1VBUA 2FZDA 4G6CA 4RW3A 2ZOXA 4WXYA 3I3DA 1RA5A 3BAKA 2FPVA 5FF0A 1J18A 2UZ9A 3NXFA 5LHFA 1TWDA 3R43A 2O7QA 3TH6A 3B8DA 5HA7A 3R79A 3AHVA 2OEMA 1QPNA 4FF7A 1O5QA 3FDGA 1H41A 2XDFA 3GTHA 3VINA 1YBQA 2ZZ4A 4Z1DA 3MC5A 2ODOA 4MAVA 3UGVA 3WBAA 3I10A 3WBWA 3AXIA 4S3DA 3VMPA 2ZQ0A 2BG5A 1W17A 1WPCA 1GUVA 3NDZA 1KV5A 5HQEA 4JN6A 1JUEA 1GPWA 3QGVA 4TMBA 4S3JA 4ZO8A 3O6DA 1ZJBA 4WVXA 4HCDA 3MANA 5A2BA 1A3HA 4XBSA 4UZSA 3KBNA 5CPLA 2FZMA 2ZX6A 3PHAA 3TTEA 3QHNA 1H1NA 3PJTA 1M41A 2J4GA 4Q7IA 4B92A 1U1JA 2VEPA 3T2OA 4GNVA 3FJ6A 5BXSA 4BKNA 4FALA 3M0HA 1W1B1 3A47A 1WQ5A 2G3MA 3VIFA 4IM4A 1BF2A 2FB3A 3WQ4A 3SBFA 1C91A 3MTWA 3R12A 1X96A 5BXTA 2WSYA 2YPIA 4I9TA 1M3UA 3RMEA 1BTCA 2ZTJA 5TNVA 5A6AA 3OBAA 2QEZA 4B5VA 4C6OA 4O15A 4RCXA 3LX9A 1P6BA 2CBIA 3AS0A 1MW1A 4KRUA 4O0KA 3G1DA 2WQDA 2EF9A 3K46A 4BQ3A 3WNOA 5K7JA 3CPRA 3GVVA 3PF3A 1DJNA 4EVZA 3FFSA 4FPSA 3PS7A 2CEQA 2AGTA 3OIXA 3URQA 1ZPTA 3E6EA 2OR2A 4LY4A 4D1JA 2WHLA 3W7MA 1UWAA 4GFSA 3TTOA 3S2NA 2Y2WA 1QWGA 1NDWA 4PSPA 3A12A 3GDKA 4PCNA 3UJRA 3E2RA 3KCJA 1XBXA 2WKJA 4ERIA 3MUCA 3AJXA 2DZVA 1DKWA 4ERAA 1BRLA 3C0LA 1F4HA 3NM1A 5U4NA 4IFKA 5AHEA 2VR5A 4GX9A 3TQVA 4DIAA 3G18A 1OX4B 3SEPA 1NSJA 3W7IA 3AQUA 5FKYA 3VILA 1H3GA 3IK2A 2NLYA 1SO6A 3P84A 5T91A 4C6QA 2YDQA 3KHJA 3UG4A 2YXOA 3ZMRA 3WD0A 3VX0A 4NAFA 2GVLA 3K8KA 2E5BA 3LN3A 3UR8A 3UYCA 3R8GA 3TSBA 4C7DA 4EX4A 4L9ZA 5HJXA 5J8LA 3B97A 2P5NA 1VS1A 1H63A 4HPJA 3WBEA 3KL3A 3W25A 1B2YA 4Z1YA 3LI0A 4JTDA 1J12A 4PUNA 2YX0A 3P67A 5I0DA 4I9MA 3B8SA 3PBYA 1TWZA 1OVDA 3L4TA 3IJ7A 3EX4A 4ILSA 2XIOA 3IJQA 5HDRA 3CQIA 2F8QA 4AZ5A 5F1UA 4PTWA 1E56A 1U22A 2WZIA 4FNQA 3PTQA 3Q45A 2J6XA 5IBXC 1OM0A 3H4XA 4AVOA 2DZAA 1W32A 2FZBA 5EMLA 3T08A 3A9IA 1VZWA 1WE5A 2AMXA 3ZO9A 2GSHA 1AW5A 1ALDA 1F2JA 2UBPC 3BLDA 3B0YA 2YCLB 2FGZA 4D6GA 5EB8A 1FWAC 1L6WA 3WFAA 1L6FA 1GOIA 2JE8A 4GVIA 1BYCA 2DQWA 4HMDA 1EJ7L 3L2IA 1V3JA 3K4AA 3GXNA 2J25A 4LBSA 3GB6A 1WAWA 3U4FA 2OZTA 3W53A 1J5TA 1GYMA 2W9MA 1W5OA 3BLPX 4L61A 1R2SA 4LBRA 2OWWA 2O7SA 3VNDA 3LYEA 4S23A 2P76A 5ECVA 1D3CA 2EG8A 2ZRVA 3U7VA 2VGBA 1UA7A 1I0BA 3E5BA 1HIZA 4QLLA 2W92A 5M5DA 2G50A 5CGQA 1PZ2A 3AHYA 3P82A 1LWJA 4MFDA 1R5YA 1KM2A 3N2OA 1QVBA 1H62A 3LK6A 3BLLA 3EX3A 2DZWA 5H91A 5FA5A 1XH1A 4LPCA 1IE7C 1YQ2A 5DFAA 3TA6A 3EZ4A 5HK4A 3KTXA 3ZJKA 3RRXA 5C71A 4MNLA 4JCMA 4UOQA 2V3FA 1SM9A 4MNJA 4DUVA 4AHPA 4KWWA 2INZA 1MEWA 2CESA 4QITA 3ABOA 4NQ1A 5CBJA 1TYGA 3RCYA 4HPHA 2V3EA 3SRFA 2GGJA 5I77A 3FSTA 4MYAA 1WOAA 1AZ2A 4WSKA 3T78A 3WNKA 4XZHA 1QW7A 1XJBA 3A5VA 4G2DA 1NDZA 4CU8A 2R82A 1YXYA 4CGTA 1FX6A 3N14A 1IEQA 3WD1A 1DJHA 3UG8A 1JXJA 4MYXA 1H2JA 1VRDA 4ADUA 1VH7A 1SFSA 1XLLA 2ZC8A 2ZUTA 1W2VA 4IXHA 4N42A 2C71A 4DAIA 1TPH1 3PBUA 2WHKA 2FTPA 2YXXA 3AOFA 4HA3A 1QNPA 1E9YB 3L5MA 5REQA 4KFPA 2PURA 3ZR4A 3IJIA 3T8LA 4XZIA 2BVDA 4PTVA 2GDVA 4U5KA 3WD2A 3QPEA 5FAJA 3WEMA 3S5OA 2IMRA 3GFXA 1J9YA 3N3TA 4HZ8A 2OX1A 2XH4A 1H5VA 2WYSA 2WZTA 3N25A 3G22A 3CNYA 3LPOA 2XVKA 3H7RA 1GZ1A 3MBDA 2Q8LA 4HJFA 1HKMA 4A3QA 8CGTA 4ADSA 1XFCA 1LZOA 3E2VA 1EJVC 1XD1A 1FWJC 5C55A 5A6JA 1GKRA 2V38A 4KWVA 4JEJA 3R25A 3FX4A 3LQGA 3U2EA 5D8ZA 4GYPA 4X2PA 2YR1A 2H8XA 1E9IA 1EDGA 3M0KA 3CQ0A 1GG0A 1KXTA 2VUYA 3DFYA 4L80A 3VNYA 4A3YA 4B3LA 3VIMA 3E96A 1P0KA 3FSUA 5EPDA 4LUYA 3CIXA 2OO6A 1PZ0A 5FSEC 1NVMA 1JR1A 2CWNA 4IICA 1TPDA 4NZ4A 1WDDA 1XYBA 4BHYA 4KMQA 1PBGA 2E6AA 3KWXA 2F9RA 3CHFA 5A95A 4AEOA 1W1TA 3SN4A 3EWBX 2BOFX 1XF0A 3GYCA 4UC5A 1VCGA 1Y7VA 4AHQA 3IUDA 4H9ZA 4YCPA 2G37A 3VDHA 1ZHAA 3VI2A 3C0QA 4BCEA 4C1KA 1OGSA 1Q6LA 4WUIA 3EYPA 4IGHA 2PDBA 2PLJA 2VX5A 2MUCA 3MKVA 4DRSA 3BMXA 3W74A 1ZCOA 5I3HA 4LUTB 1P4CA 2V69A 3VTRA 3PR2A 3P61A 1UMYA 4FF5A 4S2CA 3LLXA 5F2LA 3VMNA 1M65A 3DHUA 3PK7A 4N4PA 4TQTA 4ZQRA 3W1MA 2HSAA 3VCCA 4O1DA 4N9BA 1J0YA 3UF9A 3FVDA 3IJDA 2Y7DA 1XDMA 3H26A 3HG4A 5HPOA 3V0UA 3SQSA 4ZZ9A 2XJ7A 3QR3A 5EKYA 5LNWA 3LCIA 4AZCA 3CUHA 3KWSA 3OBEA 3RAOA 3QTPA 1YTKA 5KZ6A 2XVLA 4JIHA 3UPMA 4KWOA 3UXLA 5HNTA 4AX7A 2PBOA 2O9TA 5I79A 1WB0A 3T44A 5HPCA 3MWAA 3LERA 1XIBA 1A5SA 3MUY1 4KESA 2W6RA 3AROA 3DFTA 3C52A 1J4EA 1AA1B 2HNEA 1VPXA 3OZYA 3NL5A 4I7VA 1XG3A 4RR4A 1RBLA 1KW1A 4MLJA 3ECQA 4XSLA 1BSIA 3VC5A 2BXZA 1JRBA 3FS2A 4H01A 3QLLA 4IPLA 3SGZA 1UA3A 3SQMA 4O4VA 1PDZA 1OABA 5E0CA 3THDA 1YHTA 2BHZA 4NVTA 4ACZB 4H2HA 3N3MA 2EPMX 5HJLA 3U3HA 1NTHA 2NQLA 3LTPA 3N2BA 4EPEC 4LQ1A 7PTDA 1IEWA 3ITTA 3JZEA 3TDFA 3D46A 4IT1A 3W1QA 1VFLA 1ISZA 2TYSA 3UERA 3IAPA 3IJLA 3DFHA 2VJXA 1UR9A 3WNNA 1F3TA 4B2DA 1TTJA 1XLFA 5FJRA 2GJPA 3W7GA 4A21A 1U5HA 2R24A 2OGYA 3A3WA 4Q6XA 3LA4A 1B31A 5LNSA 2YLAA 4BJHA 1P7TB 1XYAA 4P5UA 2BWGA 2B0MA 3KS5A 4JS3A 3WLKX 2WMFA 4UR7A 3AHZA 3P60A 2V2HA 4H9YA 4CQ9A 4LGXA 1NARA 3N04A 5T8GA 1AMKA 2PD5A 5JUVA 3UJEA 2WVVB 1R30A 3C6CA 4DYJA 4ZO7A 1PKYA 1E9LA 2QUTA 1MZHA 2XFYA 4M51A 4KERA 5K9CA 1DJIA 2BB0A 4M6PA 3SFKA 3WMCA 2IQTA 2ZX9A 5EA9A 4HOWA 1OD0A 3L65A 5HMEA 2C15A 3FAWA 3FYOA 1UUQA 2BGSA 3FIGA 3WF4A 1D8WA 1DJXA 1T8QA 2WW5A 2VOTA 1UR2A 2VZTA 5E6ZA 1PAMA 1UH2A 2ZRWA 1V6YA 1HW6A 1SYTA 3T0BA 4AVFA 3L5AA 3ITOA 1IZJA 1UIOA 3AZRA 1FOBA 1JF5A 1X8FA 3B9OA 3YPIA 2XISA 1CIUA 4IUGA 2EPHA 3CV1A 3BAWA 4S3CA 3UXAA 4HK7A 3SSJA 4UTKA 1IT0A 4GHRA 4S3AA 1RVKA 5IFTA 2W4XA 3K5XA 5KINA 3KBVA 4FO4A 4LV4A 1X98A 3WDHA 4WR3A 8TIMA 1XYFA 3CT7A 4M56A 3WLOA 4CVWA 4JTGA 3EOOA 4CU6A 1W3JA 3M41A 4UUIA 2YCJA 3NZQA 1UQYA 2FHFA 3TAKA 4JNMA 1A0CA 4EXAA 4UFIA 4GUHA 4JTEA 3O2LA 3L4XA 4BF7A 2O0TA 5JQ9A 3G1VA 2PDPA 3VABA 4RUBA 2NQZA 3BG9A 4L9YA 1DWGM 3EDDA 2QJIA 1BYDA 3UYIA 3E0LA 1XLMA 3F1QA 4KQNA 2WXDM 2OFJA 4L64A 4XIMA 4DO6A 4F0LA 3LBMA 3CWOX 4D6IA 4WDTA 3CUFA 2Y24A 3BC9A 5KZDA 3QHOA 4ZOAA 4U2YA 2CLLA 4OV4A 4XO7A 2VR4A 3EDKA 2J8GA 3ZFHA 3C86A 3T05A 1W9VA 2NWSA 1YNYA 3HURA 4DO5A 4JQ2A 5KTLA 1Q6CA 3DOPA 1DWHM 3BGJA 4HMEA 1SZNA 1KNWA 4I6VA 3N18A 1X6NA 2XSAA 4ORMA 4HU0A 2ZICA 4KEVA 4RNHA 3CHVA 5EMMA 1MQQA 2DGAA 7ENLA 3RO8A 1N82A 3KHDA 1PE1A 2Q3OA 2PCEA 1F3WA 1ZL1A 2PGEA 1JPHA 1AODA 3C61A 4B4HA 3C3NA 3OQEA 3BMVA 2RDWA 3W73A 1JCTA 3PBMA 3AJ7A 1CI1A 1OFRA 1OINA 3L2LA 3W0KA 4C65A 3L21A 4O1AA 1GQKA 5KSWA 1JULA 3WLQA 3GXDA 4HJWA 2H9AB 3NUKA 2FZ9A 1EBGA 1C9DA 3T81A 1SJAA 2ZXDA 1PHWA 3ABXA 3URNA 3ZZ1A 4Z17A 2VI0A 1RR2A 4GO8A 1XIGA 4GC4A 3UGRA 1OIMA 1XDJA 2NX1A 4DELA 2UV8G 2VURA 2BVTA 4NT0A 3DDMA 1JYXA 4AC7C 5LNVA 1E1FA 4PUEA 2G5WA 4MKNA 1TA3B 1OCQA 1J6PA 3R0KA 4GX8A 1Z6KA 2DY3A 1WDQA 3TLLA 3JRKA 4LU0A 3DUGA 4KCUA 3E0VA 4NILA 2WMKA 1SR9A 4O14A 4UFHA 2A7PA 4CNOA 1GQNA 4YTQA 4A22A 2QUUA 4NX0A 2ZX8A 2JIWA 2WANA 1E0UA 3EX1A 4RJEA 5D9PA 4MWAD 1BPLB 5TBOA 3WBYA 2BTMA 4H6EA 4QDPA 2J78A 5J5DA 1HKIA 2WPBA 2OLHA 4V33A 3V5CA 3S42A 5AC6A 3M46A 1OCNA 3RO6A 2Z29A 4RW5A 4RXGA 3H4WA 2RJGA 1U83A 3W07A 1V02A 3QQ0A 3B8WA 4WJXA 3SY8A 1PTAA 1DWJM 4CD4A 3KTSA 1KCLA 1E1EA 3EKLA 3M6YA 3EWXA 4BZYA 4IUOA 3OIHA 3M0VA 4ZFMA 4DBUA 3LD5A 2P8CA 1XWYA 3WUFA 1B3XA 2A3BA 3STEA 3KRZA 1Q5MA 2VDHA 4GZJA 2TAAA 4P8UA 2YSWA 1XHGA 3N9SA 2SFPA 5C7VA 1KC7A 3W7JA 2OSYA 2E9BA 3THAA 1PVNA 4D8ZA 4NHVA 5IDZA 1PZ3A 3HJZA 1E0VA 3U7BA 3MV01 3VC6A 3S9ZA 5GJMA 2VEGA 3FYPA 3PP7A 1GVYA 5DCDA 3CL8A 1FDJA 1UR4A 1MXDA 3GC4A 2ZRZA 3LMZA 4QP0A 3S5ZA 3O1NA 5M17A 3NWRA 1HO1A 4UQEA 2PDNA 2D22A 4X9YA 1XKYA 4M82A 4LUSB 2PFHA 2WSRA 1GOWA 3WK3A 3HN3A 4FB7A 3P5YA 5A6TC 2HQAA 3POHA 1QW9A 3NQ6A 1JNEA 1QMLA 4YWIA 3EMCA 3SO7A 3PPCA 3BG5A 3N34A 4DJFD 2NVAA 8XIMA 2QQ6A 2W67A 2OZ3A 5K9DA 4MB5A 2G3JA 2HE8A 4UQDA 2GZXA 3CUIA 3L23A 1A0DA 3W7CA 3WELA 3B8UA 3H2NA 2FIQA 3B9EA 2WM0A 4RDWA 2X42A 6TAAA 5AFDA 1ZP4A 4UR8A 2QV4A 2GSJA 3TYZA 1M7PA 2O9PA 3TAOA 1EUAA 4MOZA 3UQNA 1HNYA 3FGCA 3GU1A 2YJQA 5K2ZA 1BF6A 2BY1A 3L66A 4IIFA 3RNDA 2PGRA 3RLHA 2DZUA 1DJZA 2VX6A 1S2VA 3LHZA 4TV5A 3BLOA 5DMNA 4D6CA 2B31A 4PRRA 4L4MA 3UCCA 3HPXA 5C9ZA 1AVAA 1BVNP 2AOSA 4TVDA 2VFEA 4GZEA 1JQVA 3EBVA 5T9BG 1ZBCA 3N9KA 1HG3A 3FXYA 4NXSA 1FHDA 4P7LA 1L0PA 3TUUA 2E28A 3CAKA 1FCBA 2POTA 4HNUA 1Q7MA 1I75A 1X6LA 3SZ8A 3GQYA 4ZXLA 3ALGA 3TW6A 5DANA 4YU1A 3QHMA 2XYLA 1BXBA 3IK4A 2OX4A 1RHCA 2VWSA 1AW1A 2ZA2A 2XSXA 1NQ6A 3OQ8A 1JF6A 2DZPA 4JDYA 2PAJA 3G24A 1SZFA 3GRIA 2YL9A 3ZLFA 5TQLA 2X30A 2E9MA 4PL1A 3ALFA 3A5FA 3AUJA 5D38A 2HVOA 4PBGA 5JXQA 1P0NA 2VZSA 4EF9A 3TQ0A 1G0CA 1A3WA 3WH6A 5FACA 3AHTA 4E38A 4BI7A 4DYKA 1EO7A 2CETA 4CU7A 4B4FA 3SJ3A 3QV7A 2OCZA 5CGTA 1C90A 3SUWA 3F4NA 2ISWA 1O1HA 5AHFA 3ZJ8A 4F2TA 3OG3A 4O19A 3TMLA 4GYPC 1UPMB 2H90A 2WNZA 1I1XA 2IKHA 3QZEA 1G7UA 2R9RA 4I5UA 3BMWA 4PRWA 4XTDA 3ZYZA 1R8LA 4ZEPA 1HTIA 1G4SA 3SFWA 1VBGA 5I78A 1JVNA 4I5RA 4NYYA 1DE5A 1FWGC 3M64A 4A8NA 1U33A 3W84A 4LAZA 2XFRA 4E2VA 1IWPA 4B90A 4Q22A 1TPB1 3K1DA 1QFEA 4FNPA 3UXKA 3WLIA 3PJUA 4UFMA 4NNCA 1V6VA 2PWHA 2EO7A 4GUFA 4ZSTA 4AYGA 3USBA 2PF8A 4PR4A 5EFFA 3S0CA 2D0FA 1MW0A 3PZIA 5HMDA 4M8UA 4ZENA 4WJ8A 4AUBA 4H8HA 3ATZA 5BRBA 5AC8A 3EPOA 3QFWA 1LLWA 1UD5A 3NEVA 5GNZA 2VENA 4EXBA 2DFAA 3TROA 3A22A 1PIIA 3BQ6A 3V35A 4GIAA 1OC6A 2UY2A 4QQUA 1JD7A 3BAYA 1RJRA 5FEXA 2YZRA 3HB9A 3VPLA 4LJ3A 4ZB0A 5C54A 1QCWA 2GUBA 2Z27A 4OV9A 1CGXA 3TYCA 3OG2A 3TJ4A 4JFVA 3IV3A 2BV9A 3WENA 3MCMA 1FWWA 2DT0A 4UTMA 3L4WA 2E7FA 3AS1A 4RZ4A 4IG2B 1IEXA 3BSHA 3BSGA 1UD4A 3R11A 4YXGA 4LCSA 2CZFA 4CNTA 2Q3RA 5A94A 4HYVA 3GU9A 3UR5A 3P8IA 1BTMA 3OVPA 4Z2JA 3SCSA 2NVDA 5B7ZA 3P81A 3CL7A 1FXPA 1POKA 3REQB 4LNYA 2PTYA 1FCQA 3OZOA 4MWAE 4GI9A 1LP6A 2Y5JA 2JQXA 1FWRA 2QW5A 4NZJA 4F40A 3TU9A 3M5ZA 3QZ6A 4WCJA 4E2DA 1W9PA 1I2QA 2QS8A 4UZUA 1CGWA 1B4KA 4RPQA 4DQWA 1V6XA 6PTDA 3U5YA 2YCLA 3QKZA 2MANA 1W0MA 3H23A 2DZTA 3M0JA 1LQAA 2XVPA 4GVHA 2OG9A 2QMJA 3T9PA 1AQHA 2NQ5A 4NUWA 3GZ3A 4Q4SA 3W38A 1Z48A 2ZA3A 1NQKA 1ONWA 2O9RA 2BVWA 1KFJA 3RMJA 4MTVA 1PX8A 1TE6A 1VLWA 4ONVA 5A2AA 3QGKC 4DXXA 1OCJA 3R89A 2Z4GA 1KRBC 1X38A 1DIEA 1JZ3A 2VC9A 2VKZG 4QCFA 5F4WA 3DBNA 5E5CA 1HF6A 1CZ1A 2E5DA 4DJDC 4IMDA 4OE7A 4L1GA 1WKEA 2D3NA 1XLAA 3MI3A 4D2JA 4XZNX 4TTGA 3NFUA 4PE8A 1XP3A 2Y1HA 4GQGA 1O5XA 2V5KA 1DE6A 3RJYA 4WY0F 3F2DA 3L68A 2PI6A 4NNBA 4L1XA 2A4AA 3P0XA 4JHOA 1KQZA 2GVGA 4IMFA 4WZHA 4HPXA 1DHKA 1HL9A 1K02A 3LEPA 2QCFA 4FS9A 1PKNA 3V3WA 4E8GA 3VZZA 4BF9A 4TOQA 5HBFA 3N12A 2NW0A 3UVIA 1Q45A 3OW1A 1UWSA 2BNJA 5DBUA 4PB5A 3TSDA 3TYEA 3U9IA 5IXEA 5ABHA 3WDIA 1PXGA 1QPKA 1E70M 4W8BA 4UTWC 3CB3A 1OK4A 2D2HA 1G4EA 4XB3A 2PEVA 3U2ZA 3GNDA 3RG6A 3W7NA 3GFZA 2ZX5A 1XKJA 1OFAA 1IXQA 4HPGA 3POCA 2QAPA 3NPWA 4GXPA 1R2RA 2VM8A 3EB3A 4PRTA 4LRTA 1JAKA 3PFMA 2Q01A 4MADA 4HHHA 1HKJA 5ABFB 1QPOA 4UNLA 1JAEA 1XSJA 4UQAA 3WQCA 4XD4A 2IW0A 4MVAA 3QXBA 2OMAA 3KLKA 3W1XA 4GBUA 3HU7A 1CPUA 1TV2A 3SUTA 3BCDA 1OT1A 1EZ2A 3P2VA 1JZ8A 2HVMA 4W87A 4ZL1A 5F2MA 1TJPA 3S2CA 1WCGA 1VFMA 2G4FA 4MG4A 4GWEA 3OGVA 2X1SA 3VKDA 4PL2A 1HL2A 2DSKA 3CLMA 3QN3A 3ZT6A 1A47A 3PZTA 4MIMA 2NT0A 1VBHA 4HB7A 5A8OA 3M0XA 1T0OA 2TMDA 4GCXA 2PD9A 3V1PA 5RUBA 4FI4A 1JUBA 3VIPA 2VMFA 1HGYA 1GTEA 5I6SA 3RM4A 1W3TA 3OLIA 5EMYA 3PPFA 5E1QA 1Y5WA 4FNSA 1K9DA 5E70A 4LNCA 4Q4OA 5G2WA 1LORA 4DZ5A 3AZTA 4EF8A 3STFA 1B3WA 1H5YA 1R7AA 1I2PA 3RX3A 3MU7A 3VX1A 1OX6A 4B3ZA 2CKSA 2XWDA 4XD5A 2HPIA 4PTMA 1RV8A 3KRBA 4J35A 4LB4A 2C91A 3VCRA 1UP3A 1DQUA 2ZRYA 5A6SA 2E6DA 1PJ9A 1A80A 5C5YA 4M5PA 1W3KA 3GY1A 3DYPA 4RE0A 1H61A 1Q4WA 6ENLA 3EOUA 4BF5A 4GQ0A 1AH4A 2VCAA 3MJMA 4QEEA 1JZ7A 2Z00A 2O55A 4UTLA 5XIAA 1Q85A 4MJ2A 5TF0A 2CHOA 1BYBA 4Z2IA 5ABGA 1VC4A 3S3GA 5M2FX 5A8MA 1W1VA 4A8LA 3ARSA 5EGRA 3D3FA 4LVFA 3KVMA 1US0A 5HNUA 4B5NA 1K3UA 4YWSA 1NFPA 2NX3A 1S1RA 2A2IA 4DJED 4FAMA 4DB7A 3B8VA 3NL6A 4LANA 3P5ZA 5AKQA 3S1XA 3WNLA 5HNNA 3SDOA 4GBDA 3M9YA 3R13A 1TUXA 2XUCA 2AMGA 3ZIZA 2E8YA 4M6VA 4WOZA 1UP2A 2NV2A 3S6DA 1AUSL 4JAWA 4DVOA 4UOJA 1X6UA 1XLBA 3FXGA 5BOOA 4N6FA 3W2UA 2CIPA 4JL1A 4M7TA 2VQTA 2J75A 3OZPA 5AHLA 3BV4A 1VR6A 3JU2A 4HU8A 1VENA 3AS2A 4CEUC 4JICA 2E5CA 2AKZA 1B0IA 2EQDA 1UKOA 1VP5A 1LROA 2X8RA 1RK5A 3RM8A 1UKSA 4DXVA 3CZEA 1W37A 4ZXOA 4DBDA 4PMDA 3NQMA 1TVPA 4R85A 1RY8A 1I2RA 1MNSA 1YW1A 2Z24A 3CUGA 3W29A 3F2BA 1ONXA 4ACZA 4B3KA 3M0YA 5LGXA 4IWWA 3MBFA 3QY7A 2PWEA 1A5UA 3MSRA 1RY0A 3WLRA 2V5LA 4HD5A 2WJZA 4GXWA 2QMKA 1G7VA 3F5KA 1FWFC 1X8CA 4XZMX 5HATA 1MQRA 2EJ1A 2W79A 2W61A 1VHNA 3IAQA 2OT1A 3O9NA 1J2BA 3GXTA 3TW7A 1M53A 3CV7A 2VCBA 5HANA 4W7UA 1UBSA 4GJIA 1V0KA 2V2DA 3QV9A 5K4XA 4WHBA 4HZ7A 4D71A 3NSNA 4RNFA 1V0MA 3CASA 1XLKA 3NVTA 1DWAM 4AY7A 4GD0A 4AXNA 4JL2A 1NDVA 3NZRA 4F66A 3PB0A 1FBAA 3GC2A 2GQAA 3VNLA 1J6OA 1WZAA 1FWIC 3NZ1A 4AWEA 2OLSA 3IVTA 3WG6A 4YTRA 4F0MA 3WQOA 1CWYA 2MNRA 1W5PA 3TC7A 3G1XA 1V93A 3W7EA 3AU6A 1IZKA 4CD5A 1QTWA 1WKYA 3V5FA 1EJSC 3VM7A 2BHYA 5IRPA 2G3IA 2DIEA 1ZRQA 2Y4SA 2OOFA 2JF7A 1O94A 1ZZMA 3NOEA 1PEZA 4EACA 4O1BA 3PWGA 1GZGA 4RK8A 4EXQA 4AD1A 1NOFA 3MW7A 5FSDC 2IPFA 3BOFA 3G8EA 3T0AA 4MF4A 4UMBA 2ZXQA 2VWTA 1Q6DA 1SW7A 4MKVA 1DJGA 4XSMA 2EHHA 3NA8A 5L9FA 4JZ5A 2G0WA 4S3FA 1L2QA 3S5NA 3SUVA 4WRHA 3T8QA 5G1YA 3RLUA 3QSRA 4LWWA 4Q4QA 3G3MA 2JKPA 4LH8A 3AISA 1AJZA 1MUWA 2ZZ5A 5IFPA 2OQYA 5CC6A 2WO5A 3Q58A 3VO0A 3P93A 4UXDA 2PUZA 4WK9A 1R38A 1ECQA 3B40A 1C8XA 2I7GA 4K8EA 3T42A 2WJEA 1L8NA 3TW9A 2YB4A 4NJJA 4AH7A 3VOJA 4OBRA 1P0EA 2J8FA 3GW0A 1ZTVA 4HN8A 4UTIA 1FDZA 2FVLA 3WQWA 4H3DA 4DLFA 5M03A 4UR9A 3SSZA 5I3IA 1RSCA 1WYIA 2VUNA 1W9BM 3W4RA 4S1FA 1MMFA 3PFRA 3SUUA 2PF0A 2FQIA 3UCQA 3TVAA 3N29A 2EKGA 1MFVA 1VPQA 4IPIA 3UWZA 4L5ZA 1J0KA 1KFKA 3U6WA 4HNCA 4RDZA 3GKFA 4X0NA 4JKKA 3WDQA 2WBGA 5H8UA 1XC6A 3SW6A 4IP7A 5DQPA 2DSWA 3QY8A 3GFYA 5BU6A 2PDCA 4HT3A 1SO3A 1V6WA 2QDEA 2YDAA 4I9JA 3RF9A 3FJ4A 5CH9A 2XFFA 1K6WA 3UZZA 2C0HA 3NVDA 1JDDA 1TG7A 3H8AA 2ZFAA 4JTAA 3GBDA 4B5TA 2DZXA 4W93A 4FXJA 1BQCA 4CD7A 3KS6A 5HR6A 4EOUA 1JYWA 5C9RA 4X61A 4YLWA 4L4OA 4YVXA 1S2AA 3PNUA 1QW8A 4ZOEA 3WDJA 5CLWA 3P14A 3KP1A 2F61A 1W8GA 4W5UA 2IXUA 4YVVA 2D2GA 2HCVA 4LYPA 1ME8A 1YYAA 1XIEA 1F7BA 4O17A 3FA3A 2DUZA 2VFHA 1MRQA 3MI2A 1V3IA 1NFBA 1YDOA 1SGJA 5BROA 4W86A 3GNPA 4MB4A 4PCTA 3OZMA 4S3KA 4ZB2A 1I2NA 4RNJA 2ON3A 4C7FA 3KOYA 4REQB 3KCLA 5CKSA 2PDLA 4FNUA 4AZBA 3AUOA 1TMHA 4C6EA 3WL1A 4B5XA 3GS6A 1UD6A 3MHUA 3WK1A 4ATWA 4P8WA 1BXCA 2Z1WA 3UFYA 1BG9A 4BWLA 1UYQA 3RLVA 1IZCA 4Z2HA 1V0LA 2RDUA 3CHDA 4AVNA 4O8AA 3AALA 4O1CA 3ZVHA 4RZ5A 4OU1A 2FTYA 2J7FA 3MWCA 2GUUA 1DORA 5FL0A 2O56A 2ONEA 2EPOA 2ZXAA 2QCNA 1E3ZA 4JX6A 5EU9A 3UWVA 4H19A 4DZAA 3VOHA 1BG4A 1RD5A 1QO5A 3K13A 5CZTA 3F4VA 4LBUA 4OFCA 2EKCA 3RPMA 2OELA 4N9EA 1MDLA 1Y0EA 7A3HA 4LCRA 4AISA 1QATA 2P3ZA 4QDMA 2PDXA 3VIKA 3TFCA 2VELA 1KBBA 1E0XA 4Q8MA 4FX6M 3ANYA 3M43A 1W5QA 3VGHA 1OF8A 4QRNA 4JOMA 3S2LA 3OO2A 1ZFJA 1AMYA 4NI3A 3RCMA 3N6QA 3W1UA 1GVQA 3TOPA 3ZXWA 5LIUX 1JRCA 2Y89A 4GJ1A 1F3EA 2BLEA 4M0XA 5AVNA 2C6QA 3TFXA 3TYAA 5A6LA 4ZSUA 4OJYA 3WF1A 3SRDA 5F4SA 1FP9A 1M04A 1KTNA 4H7VA 2NV1A 3G3DA 2A5HA 2OXNA 3OGRA 3MZNA 1P6WA 3MVIA 3OA5A 3WUBA 3IIVA 2PWUA 2D0HA 3DIPA 3RITA 1HL8A 1EGMA 3G1FA 5FD0A 1VEOA 3UJ2A 3WQFA 4QLJA 4US6A 4KCVA 4CNPA 2XM2A 2QVNA 4O16A 3SCUA 4PA8A 1B90A 3G0XA 1V77A 2BY2A 3WK0A 3IANA 1R3QA 1S39A 1HJWA 4NJIA 1UR1A 3GR4A 4Q7BA 1K8YA 5BNKA 3P0WA 2DORA 1HN1A 4AD3A 3WLHA 2JBMA 2R14A 4EWJA 2OKTA 3MMUA 4TVCA 1G5AA 1LYXA 4HHLA 2ADAA 1N8IA 1UMLA 4NASA 2W91A 4HCHA 1LBLA 1UJPA 1DJWA 1GT8A 5EY5A 1RJQA 2WCGA 3W7DA 1QHZA 2DVTA 5D05A 3NEHA 2QCHA 4LTSA 1TRIA 4DUWA 3UWQA 1GNXA 3O7UA 3ID7A 4FP1A 2FH8A 4EP8C 3E3HA 3GR8A 3MV11 1ITCA 4ES4A 1CB2A 1EO5A 3VOIA 3EOSA 3QPZA 1CENA 1JQXA 2F2HA 4L6HA 1X97A 1IT7A 2GJXB 5LIKX 4NL1A 4AYSA 4NXKA 3DFSA 1PZ1A 2VRQA 2FZ8A 4M7SA 3P74A 3M16A 3MMWA 4Q7NA 3GG0A 1HVXA 1AQFA 3CTTA 4HNVA 1XH2A 1A5CA 1H4PA 3TCSA 4MDPA 5KITA 1AD1A 5G4EA 4XKYB 1O12A 1MEHA 4NG3A 3SGUA 3SY5A 5EYWA 1JPIA 3QM3A 1G4PA 2A3EA 3NL3A 4UQBA 4QAIA 2ZDSA 4O50A 1IYXA 2PA6A 2BSLA 2FHCA 4Z42C 3V16A 3QBUA 1YLVA 4GCAA 5FEZA 4UOZA 1YDVA 2DW6A 1W9UA 1OFEA 1EA9C 9CGTA 3BJFA 3QEZA 4AMCA 1UZ1A 2J7DA 4GNJA 1QBAA 1H1ZA 3RPDA 3CM4A 1PDYA 5EMJA 1RQBA 3D0CA 4HHPA 4I3GA 3BW2A 1BYAA 4AQLA 1JCXA 4L1WA 1NWTA 3F7JA 2V8ZA 3GHTA 1K8XA 4KKXA 4OIFA 3AI0A 3WQ8A 1JI2A 4PYSA 1CB7B 3H70A 2ZZ3A 3B03A 3HFYA 5C8BB 1ZGDA 3A24A 4Y9NA 1BHGA 2A3CA 1Q2SA 4JTJA 2BASA 1R86A 3QQWA 1O5KA 5C9UA 3W02A 4F2UA 3VE7A 3VGGA 3BSMA 1UWTA 4HOZA 3GNOA 1TWSA 4ICMA 2IKGA 1F76A 2X16A 4PSRA 4XQ6A 4Q8TA 1XLDA 5JBEA 4FHAA 3TNBA 1XLCA 3VKBA 3ZR5A 2GQ8A 3KL0A 2P50A 4S3EA 1CEOA 1ZJHA 3TZNA 4QCEA 4ZTXA 5DT7A 1RD6A 1KM4A 2IS7A 3BGGA 3AYVA 1DQXA 5JMUA 3W26A 3KAOA 4OZOA 5DLCA 2CLMA 4ZQNA 3O6YX 2WJFA 3NOYA 4IG2A 1T96A 2PRLA 3AO0A 1JGMA 3MPGA 2GK1B 5DXXA 3W2NA 5H6HA 1W9DM 1I4NA 4D1IA 3PSVA 4UWMA 4XBKA 3OPSA 3VD3A 4JKMA 3EXTA 3BAJA 4U5IA 5H2ZA 4LVAA 3L4YA 4JY9A 3UZWA 1KM3A 2PCQA 1QUMA 2CZ5A 1PPIA 4EIVA 4JQ1A 1W3NA 3W7HA 3MO4A 1GVIA 1PWMA 3G1AA 3SCPA 2DSUA 4NIRA 4PCPA 4EPKA 4HSNA 4ENLA 2G95A 1XUUA 4J4KA 3S9IA 1P43A 1JCJA 4P8VA 3WMSA 1W56A 4JHMA 1WXYA 3TONA 1QK2A 2PU1A 4JX4A 1KA9F 3TJLA 2YOCA 4UMCA 1WO2A 1IIHA 3VOFA 4JTCA 1GKPA 2X1IA 1OZQA 2EEXA 7TIMA 1XCWA 4GO9A 3PTMA 5HINA 1L6SA 4E4PA 4WQ6A 4YYFA 3DBPA 4HSHA 7REQA 3U4AA 3M0MA 4MGGA 4JTIA 4GACA 4O10A 2CERA 1JL8A 1MXGA 5BCAA 3I7RA 2OB3A 3TWBA 3W1LA 3A3HA 3LDVA 5HMSA 4C1NB 4NRSA 2AL2B 1XCXA 4I8YA 1FHLA 5TAOA 4JBRA 4IJBA 2F84A 1B5TA 1YPXA 4MLRA 5B80A 1A5BA 4JHZA 4A2RA 3HO8A 3CC1A 5G5IA 1TQXA 4XAZA 4XZBA 5DXYA 4DF1A 5LA1A 1K1DA 1E6NA 2QJHA 4OTKA 5DEZA 4O28A 5K4ZA 3DCPA 2YLLA 3A9BA 1XLGA 1KFCA 2W66A 1UUMA 2YB1A 3DZ1A 2HVNA 4EK7A 4IZGA 4NX5A 1TMLA 4LSBA 3PZNA 2E6YA 1IV8A 1PCKA 1TMQA 3KE0A 3E2SA 5I07A 3E74A 1FCVA 3GXFA 4ZQOA 2Z1XA 1TR1A 1XW8A 4FLQA 3W81A 4US5D 1BWVA 1EXPA 3FN9A 2D20A 3APTA 3PUEA 2WLYA 3LTYA 4Q8WA 3MI6A 4AWUA 1FFRA 3UT0A 3KBWA 3BAXA 4A8IA 3QMSA 1QJWA 3EWUA 4S2BA 3OLEA 1VBRA 2DT2A 3LS9A 2GGHA 4DWSA 4AD0A 1C7SA 1HQTA 4HNTA 1LL7A 1Q6FA 2FDMA 2PBGA 1UROA 1US3A 3AWOA 5G4HC 5BMXA 1G6CA 3L4UA 3JS3A 4A3HA 1M7XA 5I09A 4RE2A 3V36A 3LCWA 4AD4A 5I3JA 1KR0A 4NZ3A 1N55A 2F6UA 1K4GA 3PTDA 2PDIA 3SY1A 3CIWA 2POZA 4E2BA 3B0XA 3R0UA 3PUOA 2JEPA 3T2PA 4BK9A 4PMQA 3WQGA 3T0DA 1YBQB 4ML4A 3TQPA 1WNOA 3LXAA 1W1ZA 9RUBA 4RLIA 4O18A 4E2OA 3NR0A 3WLMA 4C90A 5FCZA 4UTJA 3GZAA 3NTYA 1H0GA 1K9EA 4XG1A 4FOUA 4TU1A 3UZYA 4GQRA 3D3AA 3IEBA 2BXVA 1J0HA 1P48A 1UOZA 3FV9A 3CH9A 3VKJA 4ZE4A 1TV4A 3E9AA 3H7UA 1V7AA 1FWEC 3SCRA 4HTBA 1W91A 4R9XA 1VRXA 5CPSA 1KCZA 3L9CA 2YA2A 4E6MA 4DWSD 3DFQA 2P0OA 2HS8A 4LC8A 2D24A 1DPMA 3N13A 3OB8A 3PZQA 2GPTA 2A6LA 2PODA 4Y8EA 2Z6IA 3V1HA 3DECA 5GPRA 1OY0A 1ZNNA 1UR8A 1VEPA 3I6TA 3MSDA 5XIMA 3SGGA 4L7ZA 1A49A 3ZWSA 1ISYA 2PP3A 4H41A 4KEMA 3WEZA 3PM6A 1YXCA 4F3HA 4PUJA 1KKRA 3MO7A 2ZUWA 1DJQA 3VFCA 4LW7A 1ADDA 2WMGA 4PCFA 1VPYA 3L2MA 5F4XA 3A23A 1EUNA 1W6TA 2DVXA 3AMDA 1A5LC 4F0RA 1CLKA 2V3GA 3M4HA 1PKMA 3GW3A 1PWLA 3T07A 1HXJA 1OT2A 1KM0A 2E4TA 1EPXA 2WZHA 5D9MA 2ZZ1A 2RDTA 1TTIA 1OFPA 3S83A 1JEZA 1G4TA 1CT5A 3SURA 1XPYA 1FTXA 3GSMA 3WJSA 4GZ7A 1Q13A 5I3FA 3GXIA 3TJXA 1TJ0A 4Q4KA 3DFOA 4OBSA 5FF3A 1KV8A 1MZRA 4AW7A 3MDWA 4OKDA 2PZ0A 3BUVA 1ENUA 2XGIA 1BRLB 3BDKA 4IFKB 4K2SA 5FOOA 1HKKA 3P8JA 4KS0A 3AIQA 1JXKA 3TR9A 4QFUA 2V63A 4PC8A 1EGVA 5DELA 3WQDA 4NAFB 4IHCA 3DFPA 3PNZA 4HIBA 2PWDA 4Y9MA 3ARVA 3T7VA 4AAJA 2WSKA 3VD7A 4GIRA 6ALDA 1WDWA 1LT7A 1KXHA 4UTTA 3UZ5A 2REQA 1T5AA 3TYBA 3MP5A 1UASA 1SR0A 4QG9A 4ZR8A 1Z3NA 4DNHA 3NG3A 1WZMA 3WQEA 1Q6OA 3SN1A 4Q32A 4FX8A 1I0DA 2PWVA 5CXPA 3IVSA 3SCTA 3CV6A 3SIMA 3QRHA 2EG7A 3LI1A 3CJPA 4V27A 1TV7A 2QULA 3FA5A 1XISA 3MY9A 3W2LA 1D9EA 2ACSA 1YMYA 4DUOA 1DV7A 3S2MA 1ISWA 2P0IA 3QQ1A 1CYGA 3IARA 2FPTA 1ADOA 3VIOA 3UWWA 1RZMA 1AG1O 5JH1A 3QYSA 1V03A 3K2GA 4U31A 3T55A 3U2CA 2VEKA 1F07A 2VC5A 4DO7A 4ZO9A 3CEPA 2WC4A 5BYWA 1IR1A 3AC0A 5D02A 2PTDA 3PWIA 1GEHA 3ZSSA 3GVRA 4YIWA 5AC7A 3V7PA 1V08A 1L6GA 3H2CA 4IMAA 2WM1A 3O6CA 2YL6A 1YDNA 4K36A 2OSWA 2ZA1A 1JDAA 4U3CA 2YDRA 5AYBA 1QPRA 4V2XA 3VDCA 5A8QA 4JTLA 3BANA 5F2GA 2ZVIA 2VHLA 3MUAA 3HQNA 3AMLA 3C8NA 2DQXA 1OGGA 1A5OC 4OWGA 4Q4MA 2PRMA 4Y6GA 1TB3A 3MHFA 2X41A 2V6AA 1D8CA 2ISDA 2PDKA 3B04A 5HNRA 2YGYA 1WXJA 1JCLA 1GVRA 4YL2A 1MW2A 5L6UA 2BGNE 3OLGA 4YJ5A 3N6HA 2J62A 3N17A 1HP4A 1CNVA 3VD5A 4O52A 3PZUA 1XBVA 4QJ1A 1QHPA 5D30A 4ZB5A 4J1OA 3TR2A 3E12A 3ONBA 1DEDA 5I3GA 1FHVA 4PEEA 1P1XA 3GVWA 2IKJA 2X1UA 1R3YA 2I5IA 5IM51 1EBHA 4PMRA 4UCGA 3W75A 3O0KA 4Y8FA 3CZKA 2HBXA 1ISVA 2XZ9A 3BVJA 4KEZA 1P0BA 3LCLA 4FK9A 3EPNA 3W87A 1D3HA 1PV8A 2NT1A 4QAWA 3CIVA 3NQDA 1TPWA 4H4IA 4F79A 5REQB 1E1CB 5BWAA 1E4MM 1UZHA 2I57A 5A6MA 2GVEA 1RLCL 3T6CA 3WN6A 3E1F1 4GY7A 4D6FA 4DXKA 4AF0A 1RCXB 4GUIA 1G1YA 2PDQA 1K7EA 2QNEA 4XTIA 3K1GA 3L4VA 3K4WA 2QJMA 1F61A 1LL6A 2VR2A 4M1RA 4WDXA 1F3XA 2XPKA 4LVBA 2NZLA 1TV3A 4WSJA 5FIPA 3VCNA 3OEXA 3ELFA 2OYLA 1FUYA 2QCEA 4IGMA 3QLDA 3ITVA 2IPWA 4A2SA 4M19A 1VFTA 3W7KA 4JNYA 4A3RA 2VT0A 1VEMA 4IP5A 5H1WA 1EH9A 4JGDA 3BZGA 3W3OA 5E6YA 3SB0A 5JU6A 1CXIA 3LHUA 5D2VA 4KF1A 4KW2A 1KBLA 1EB3A 4QGCA 3SIZA 1W5NA 2FJKA 1BSLA 1I9CB 1XPGA 1XH0A 4KEUA 1EF2A 4GLEA 1Q7QA 4PUMA 2VOMA 3WF3A 4QTGA 1SFTA 3TTSA 2WNNA 3AMGA 3EMZA 1NEYA 4XBJA 4JPGA 3LCXA 1XIIA 4NRRA 4Q8VA 2XN2A 4REQA 4CCZA 2CBJA 4FXFA 2OKOA 2D2JA 4I5XA 2GGEA 3W2KA 5D37A 1QAPA 2J24A 4FX7A 4PUKA 4JTUA 3HV8A 3PBVA 2F7FA 2HBVA 2QJJA 1MNZA 1E6SM 4ZOCA 2WK2A 4JQAA 2YDSA 2CC0A 5D32A 4DZIA 3P6LA 3GU2A 1T40A 3EDEA 1EHNA 2ATMA 2VZVA 3ISIX 3UPBA 6A3HA 3EOEA 4B15A 1XYZA 3CPUA 1SMAA 5KMYA 3LENA 3UY8A 4AY1A 2NXHA 1GVEA 2EPNA 4NYUA 5JIWA 4FOJA 4PEKA 3W7LA 5MHBA 2R1NA 3VDAA 1E72M 1B54A 3C0JA 1M7JA 2YIHA 4MSSA 3AWNA 4F8XA 2J7GA 5A6BA 3CO8A 5M1TA 3PG9A 1UWRA 1J8VA 1SZEA 4MJMA 4QR6A 1FVPA 4AZCB 2ZRUA 4QNWA 3IGXA 3W6YA 5HUOA 2XH0A 3URAA 3RIKA 2J8TA 1SO4A 4IJRA 3WJWA 1XS2A 2Y6ZA 2XIBA 2XGZA 2A85A 4R7JA 2RH9A 5D2XA 3PBGA 5DRCA 3ZSTA 3WSUA 1O4UA 3AIEA 4IQDA 2Z1KA 1UH3A 2G96A 1MW3A 3TXVA 1GQIA 1VFUA 4JFWA 5AB3A 1TSIA 3NQEA 2G3FA 1XC4A 3M0ZA 4ZODA 4EAYA 5HOSA 6REQA 2PTWA 3O07A 5D2WA 4PODA 4GUJA 4YHEA 2ISFA 1W3LA 2QPXA 4WDUA 2J9XA 3CYJA 3GDRA 2P88A 1ZU8A 1PTDA 1AK5A 2X1TA 4ZQMA 4O53A 1HJVA 2DVUA 1E55A 4XO6A 1CTNA 1TWWA 1O6IA 4LAKA 2KAUC 1LG2A 1REQB 2WNQA 4FR6A 5EBAA 3VGBA 4JTRA 5A6BD 3DHFA 1UKPA 3E0IA 4IX2A 4YYCA 4XUYA 4IQLA 4AU0A 3N2TA 1VB9A 6XIMA 4OUEA 1TELA 5EFDA 3W23A 1H7NA 2ASHA 5EBUA 4NY2A 1NWUA 5AZ1A 4RDVA 3S46A 5I24A 1OGBA 3DG7A 3VUSA 4AIBA 1CXHA 1V3KA 4GZIA 2JIEA 3RU6A 3VM5A 1GOMA 2QZRA 1IXPA 3PJWA 4K6AA 1KM1A 1VJIA 2Z2UA 1PSCA 1IWBA 1JDCA 3FYYA 4L9XA 1V6TA 3W1RA 1EFZA 1LRTA 1H49A 3OVQA 1MXSA 5FJJA 3A21A 2GDUA 2NQ9A 4YN5A 3VIGA 4K7VA 3CO4A 3CXOA 4JFTA 1ML1A 6XIAA 3MUZ1 4C6NA 5I03A 2DZBA 1K9TA 4QBXA 4MKSA 1HGWA 4DWSC 3SJNA 5JVLA 1S5VA 1XRVA 5CPMA 4PGLA 3KOFA 2DW7A 4L56A 3VIJA 2YL8A 1OBAA 3THUA 4E0CA 3EDJA 3TQKA 5LZLA 2BX7A 1EHAA 1ZUAX 1BKHA 3ZOAA 3WH7A 1TCDA 4R9OA 3M6DA 4QNEA 3HIJA 3LXCA 1WDPA 8A3HA 2JFEX 4MB3A 3GH4A 1Q8JA 2OTDA 1B9ZA 1MO0A 3SECA 3NYZA 4C6JA 5CCZA 1BGAA 1VLIA 1QO2A 4LYKA 2ZIDA 3D5HA 2CBUA 1YDYA 2QLYA 2DZSA 1CX9A 2V82A 1XDLA 1Z41A 1OEPA 1C3FA 2NLIA 3E2QA 4N4QA 5CJMA 1OYCA 1JCYA 2FDSA 1SJDA 4BEQA 1C8VA 1YEYA 4DLMA 4O13A 4POCA 4QISA 4KWSA 2AL1A 2GWNA 4A4AA 3PB2A 3GIPA 3EWYA 3QOKA 2EBNA 5AYZA 4PTDA 2YYTA 2OWXA 4O57A 1E6RA 2VO5A 3N11A 4LY8A 2PDMA 2J47A 4JKLA 1DHPA 4H6RA 2R6OA 3SR7A 2OLAA 1CXEA 1XLJA 3KL5A 3WD4A 5BU9A 3GDLA 2ZZ7A 1HP5A 3G1SA 2FKPA 1CW2A 1RXOB 5G1MA 4XIAA 4HYWA 2DV0A 2QJNA 3R8RA 2QUVA 1JIBA 2X0YA 1SJBA 3CEUA 3HFTA 3H2EA 1C7TA 2R91A 4LF2A 2AKMA 4G9PA 1H60A 1PKLA 3KXQA 4CQBA 5C70A 3AU2A 3ME3A 3O06A 4AZGA 2E8ZA