4JQ1A

Akr1c2 complex with naproxen
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
316
structure length
316
Chain Sequence
KYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldo-keto reductase family 1 member C2
publication title Structural basis of NSAID selectivity for the aldo-keto reductase 1C family
rcsb
source organism Homo sapiens
total genus 117
structure length 316
sequence length 316
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4jq1A00
3BUVA 2PDJA 2FZBA 1YNQA 2HEJA 4Q7BA 2BGQA 3UYIA 2PDNA 3MB9A 2DUXA 3LQLA 2I17A 2PDUA 2PDFA 3LBOA 2FZ8A 2HDJA 2CLPA 3V36A 4JQ4A 4DBWA 2IKJA 4ASTA 1AH4A 4DBUA 4LB3A 3G1RA 2HVOA 3EAUA 3MC5A 2PDPA 2IQ0A 1VBJA 3LENA 3C3UA 2ACRA 2INEA 3COTA 4YU1A 3GHSA 4JQ3A 3WCZA 4FAMA 2IS7A 2FZDA 1QRQA 5DANA 1S1RA 4GQ0A 3U2CA 4GQGA 3LN3A 1MRQA 2IPFA 5HNUA 4JQAA 4XZIA 3CAQA 3O3RA 3GHTA 3WG6A 2ALRA 2PD9A 5AZ1A 3ERPA 2C91A 3LNMA 1ZQ5A 2PDHA 1ADSA 1PZ1A 1S2AA 1X96A 3UG8A 3H7UA 2IKGA 2PFHA 1XJBA 3V35A 4RPQA 4QXIA 4LAUA 3UZYA 3O0KA 4QR6A 3LUTA 1R38A 4WDXA 2IKHA 4JTCA 1ZUAX 2PDWA 3M4HA 3CV7A 4MHBA 4ICCX 2DV0A 1J96A 4PRTA 4XK2A 5KETA 1EF3A 4WDUA 3WBYA 1S2CA 3N6QA 3UZZA 1AZ2A 4XZNX 1C9WA 4XZMX 4PUWA 5M2FX 1YE4A 3UZWA 4DBSA 2R9RA 1HQTA 2PDLA 3Q65A 4WDWA 1RALA 2IKIA 3ONCA 1Q5MA 2PDKA 1XF0A 4JTDA 2BP1A 1YNPA 4LBSA 5JH1A 1PWMA 4NKCA 1RY0A 4FA3A 4PMJA 3DN5A 2PDXA 1EXBA 3EB4A 3UWEA 3WBWA 3EB3A 3T42A 4JTQA 1IHIA 1YE6A 1LQAA 1AH3A 3M0IA 3LZ5A 1X98A 2IQDA 3RX3A 2NVCA 2ACQA 4GCAA 2PF8A 4JQ2A 2PDQA 2WZTA 4YVPA 3RX4A 3NTYA 4IGSA 3ONBA 1Z8AA 3F7JA 4L1XA 4QBXA 1EKOA 2ACSA 4H7CA 5LIYX 3UP8A 3G5EA 4GA8A 4ZFCA 3UZXA 1PWLA 1T40A 3UGRA 4GABA 4XVEA 4R9OA 3Q67A 2IPWA 4FZIA 1ZGDA 2I16A 1OG6A 4G5DA 3GHRA 3GUGA 4XZLX 5LIXX 4YS1A 3FX4A 2AGTA 3R8GA 2FGBA 4JQ1A 3B3DA 2HV5A 4PUUA 4IJCA 1HW6A 4FALA 3CASA 4HMNA 1UR3M 3R43A 2NVDA 3R58A 3CAVA 2PD5A 4XO6A 1AH0A 1EL3A 2J8TA 4Q3MA 2FZ9A 1S1PA 1MI3A 5HNTA 5AZ0A 1AZ1A 4DZ5A 2PEVA 2A79A 2R24A 3WBXA 2BGSA 2F38A 4GACA 4JIHA 1PYFA 4YVVA 4AUBA 4H8NA 1GVEA 2PDBA 2HE8A 4WEVX 2PZNA 3H4GA 2ISFA 1LWIA 3FJNA 2PDGA 3M64A 5LIWX 1Z89A 4EXBA 3N2TA 3D3FA 4HBKA 1ZSXA 1US0A 3V0UA 2PDCA 1M9HA 4WDTA 2PDYA 3DOPA 2ACUA 4I5XA 2IPJA 4PR4A 3QKZA 3CV6A 2INZA 4WGHA 4JTAA 3KRBA 3GHUA 3R7MA 4PRRA 1FRBA 2QXWA 3BV7A 1Z9AA 2IPGA 4LAZA 3LQGA 1PZ0A 4EXAA 3BURA 1VP5A 2P5NA 5LIKX 1MZRA 1K8CA 2DUZA 1Q13A 4LB4A 2PDIA 4YVXA 1IEIA 4F40A 1JEZA 4XO7A 2HE5A 3CMFA 3RX2A 4JIIX 3V0TA 1Z3NA 4L1WA 4OTKA 4GIEA 3P2VA 5JH2A 1AFSA 5C7HA 3H7RA 1T41A 4IJRA 2FVLA 4JIRA 1A80A 3S3GA 2WZMA 3LZ3A 5LIUX 3V0SA 4XVDA 2HVNA 3R6IA 3UFYA 3VXGA 4WRHA 3R94A 4LBRA 2F2KA 4QX4A 1X97A 2PDMA 4XZHA 1QWKA 5HA7A 2VDGA 3BCJA 1SM9A 3LD5A 4XAPA 1XGDA 3LEPA 4JTRA 1RY8A 3R8HA
chains in the Genus database with same CATH superfamily
2DW6A 3NQAA 3ES7A 5TBOA 4WSKA 4GVGA 4Q7BA 1CDGA 2OTDA 3AMGA 3XIMA 1AQ0A 1ZENA 2YIHA 3RNDA 2PDUA 3MVIA 3OW1A 2BODX 3MUZ1 4IPLA 1MQPA 4Z2LA 4XV0A 5HJYA 4BR1A 1UIPA 4DBUA 1XH0A 4IIBA 2NSXA 2DZVA 2HPIA 1TWWA 3C3UA 1XUUA 1VJIA 3U8GA 3NEHA 4LGXA 2X05A 1CWYA 3DKLA 3MQTA 5GNXA 1L2UA 3UERA 4PEKA 3T07A 2CLHA 2NQJA 4US5A 1H1NA 2O7QA 1Z6KA 1YIXA 2A7RA 2UZ9A 4D8AA 4JQAA 1GW1A 1DWFM 1US2A 1EGVA 4CNOA 2VD9A 1I4NA 4GZ7A 4HU4A 4D6EA 4FIQA 5HXMA 1SFTA 1NFPA 1MW2A 3LNMA 2HRWA 3P0XA 3UYCA 3CU2A 4I5RA 3SSZA 3TTQA 2E68A 3BJSA 4J7RA 3R25A 5T9CE 3A9BA 1A0CA 5HR7A 1K6WA 4C6NA 2FZNA 5DX7A 4XBJA 3BLFA 2DT2A 3WUFA 1CEOA 4I7VA 1TREA 1B4EA 4LCRA 4C6JA 2C14A 1TTQA 3TIMA 4TO8A 2R14A 3E12A 3ITLA 4D6JA 3U4AA 4K39A 1OK4A 4LUTA 3GVWA 2QUVA 2OGJA 4WHBA 1LG1A 4JTFA 4MY9A 2H6RA 4UOQA 4B3ZA 1Q65A 5IRPA 3A47A 4WSHA 1Q2RA 2GJXA 3LA4A 4ZR8A 2C1GA 4B3KA 2CWNA 7XIMA 3PR2A 3ICJA 1W54A 1N8FA 3P8JA 1UP2A 3LTPA 5I09A 1KTBA 1OFOA 4D8ZA 3ZLFA 1OEPA 1UUMA 1YDOA 2F7FA 4EPEC 3UY8A 4XTIA 3VD7A 4CN6A 4UFHA 3THCA 4NUWA 3UPBA 1NF0A 1FWEC 4NZ3A 4KCTA 2I5QA 3ITXA 1GQJA 1W9VA 1YPXA 2VDIA 1V51A 3TYUA 5JBFA 3TW7A 4RDYA 1W1VA 1IIHA 3UWEA 3V1PA 2VDHA 4QP0A 3L23A 3A21A 1S2TA 4KCUA 1FCQA 3QZEA 1HKKA 1PTGA 2E9MA 1OG0A 3HG4A 3H2FA 3MI6A 1X6LA 2JKAA 3O2LA 3KCOA 4JX6A 1QW9A 1WOAA 3EYPA 4MWAB 5G5IA 1VS1A 3WNNA 1M01A 5I78A 3M0YA 3A23A 2VEMA 4NJGA 3UGRA 4GABA 3SADA 5LGZA 4RV8A 1VHCA 3TMLA 1ISZA 2X1UA 3CB8A 2O9TA 2FMNA 5IFPA 3VIMA 1CI1A 1FH8A 2Z28A 2ZOXA 2QDGA 6TIMA 1TE6A 1TMHA 4G5DA 2CIPA 3AWNA 3IJ6A 3C5QA 4TVUA 4B9ZA 4PMUA 3OQ8A 2AQWA 1XG3A 3N2BA 5CPLA 4YIWA 3SCSA 2CITA 5DT5A 4UWMA 5FA5A 4DYJA 1ZCCA 3CASA 1M7OA 1HUVA 2PTYA 1QI3A 3VU2A 4XBKA 1EL3A 2VUYA 4UMAA 1EC7A 1KW1A 1FDYA 3POCA 3QPEA 1UR2A 2VEIA 3L4WA 3R0UA 2JGYA 4EWJA 3MV11 3MJMA 4LBUA 4Q8OA 3PBYA 3VCCA 1VQTA 3EWDA 3P5ZA 3OBAA 2ZVIA 1J01A 4UQ9A 4PMOA 2XIOA 4J2PA 4LC8A 3H4GA 3TSBA 1OFEA 4DWSC 3EGJA 4D8LA 1GHSA 5HWMA 1AQFA 1POKA 4RXFA 3RCNA 4CU8A 2ZUUA 2DZUA 3M1ZA 1A5UA 5A69A 4LH8A 3ZWSA 1UR0A 3WEMA 2G4JA 1EDGA 2V67A 2YFOA 3IIOA 3CV6A 3VM5A 4WR3A 3E5BA 3PPCA 3HFYA 1W2PA 5BRPA 1ZCOA 3VMOA 4RX0A 3K5XA 3CHFA 3PNZA 1VR6A 1TYGA 3N6JA 3PB0A 2R82A 4WSJA 1RQBA 2GQ8A 3VGDA 1QNOA 1VF8A 4PSRA 3E3HA 2P5NA 4H6EA 4Q4PA 3B8IA 3ZJ7A 5BNKA 1XC6A 1IR1A 2QIIA 5L6UA 4IJBA 4YVXA 2P8CA 1JCLA 4HT3A 1W1B1 1IEIA 2BOGX 4A3UA 4CQCA 1TFVA 3E96A 4MSSA 4M8UA 1OC5A 3RX2A 1OT2A 3GW0A 6ALDA 1WDSA 4P61A 1FFQA 3R79A 2VFEA 1HXJA 2WMIB 4IWWA 3LTYA 1QNPA 3BOLA 4EPBC 3SGZA 5KTLA 1E4IA 5IDZA 2WBKA 2ZZ4A 4CD4A 3HPSA 4UZUA 3WK0A 4PODA 5G2IA 5LIUX 4I5UA 4MFDA 2G37A 1EJTC 4JNYA 4ML9A 5CG7A 3WLSA 2OOGA 2HVNA 4FLOA 3D0CA 3PJXA 4DO5A 4L65A 1QI4A 2JEQA 4NNAA 3T0DA 1LRNA 3GM8A 3JW7A 2WC4A 4LYRA 1TA3B 4MM1A 4TX6A 2DSWA 1LROA 2WK2A 1E5JA 2A1YA 4LS1A 4MYXA 2WC3A 5CPMA 1LF1A 1A50A 1IZKA 4F9DA 5EL1A 1CCWB 2Z7GA 4PE8A 1PE1A 3HJEA 4UFJA 4W7UA 5CBBA 1G5AA 2I17A 2EPNA 3SCPA 2WVVA 3MBDA 3E74A 1E6XM 2GWNA 1D3GA 3CBWA 2Y5JA 1O5QA 1XKJA 4K68A 3CLWA 1A3WA 3AXIA 2IKJA 4PCNA 4KRTA 3OBKA 3K30A 1XBVA 1AQHA 3IJ8A 1TPWA 1E3XA 3UA3A 2TAAA 4UTUA 4NU7A 2JALA 3MC5A 3KLKA 5HWNA 1VYPX 4HJWA 1XYAA 5DY2A 2QT3A 4IFRA 1H51A 2WSPA 3WEOA 3A4JA 1NDYA 1S1RA 4K3ZA 2OZ3A 4D71A 1GQKA 1KBIA 3C0LA 2VX6A 2FJKA 4Q4RA 2IPFA 3KBSA 3QFWA 1E9LA 3GVVA 4DJDA 3F5LA 1KXTA 4W87A 4O0KA 2Q8XA 2PWVA 3WG6A 4RZ4A 2E9LA 3FKKA 2ON3A 3C2YA 3H4XA 4PYSA 1M5WA 1ADSA 3E0IA 5G4HC 2Q8ZA 3UG8A 4L4LA 3G1YA 3H7UA 3DDMA 4AZ5A 3R13A 3I6TA 3UZYA 2O92A 1O12A 3EDJA 1VCVA 1K1DA 3M9YA 3WK2A 5C9ZA 5DFAA 3R0KA 3WK1A 1X1NA 3ATZA 1BYBA 4AX7A 3QOKA 2X2YA 2Z1KA 3SFKA 1K9DA 1BTCA 1WPCA 1RP8A 1UOKA 1UZDA 1D9EA 1K3UA 1BD0A 2C79A 2NV9A 1B1YA 5FD0A 1UP3A 3U4FA 1J96A 3KL5A 4AHPA 2F6XA 4FHAA 3ZLHA 4GXPA 3W01A 4PEEA 1J8VA 1JDDA 3WH8A 1Z42A 6ENLA 3QV9A 1C9WA 4GH3A 4NAEB 3WENA 4TUFA 4EWND 4PBGA 4YNGA 5GJNA 1Y8BA 4KIEA 3JU2A 1GQIA 3W37A 4H19A 4MADA 1JYWA 4MWAA 3PZIA 1F4AA 2J13A 5F4WA 1QHPA 3PBMA 4N42A 4U10A 3IJ9A 4QGCA 1N55A 2OQLA 2G50A 5AC8A 2PDXA 3PSVA 5I3JA 1OABA 2QAFA 4JTQA 3QY7A 1DJWA 2YL5A 4I3GA 5HAOA 3S42A 1QATA 1X98A 3BXWA 2G96A 4RDWA 3ONBA 2D2OA 3C2VA 4EVZA 4S1FA 5LNUA 4Q33A 3HGOA 1ISXA 1ZBVA 5D9MA 1J5TA 3UP8A 3L4TA 1CLKA 4JZ5A 5T91A 1QR7A 2X0YA 4AB4A 2VEGA 4U2ZA 4FZIA 3WQDA 1DIKA 4MMWA 1JGIA 4PMZA 1H5VA 1MNZA 1NH6A 3KRUA 4LU0A 3NFUA 4M19A 2ZA3A 2V3DA 2YBVA 3FX4A 4HJFA 1KGXA 3EDDA 1V4YA 5A5WA 1TTIA 3W3OA 5JBEA 3DHUA 3IV3A 3G1SA 2G0WA 1HW6A 2TYSA 3UCCA 2NT0A 4GFSA 1HKIA 3B8DA 3V5FA 1WKYA 4Y2WA 3EOSA 3WL0A 4XO6A 4UTIA 2NSOA 3TZFA 2XH0A 4ZQPA 4XG1A 4OHQA 3PZ9A 2Q01A 4LQ1A 3TSDA 3O63A 4EAMA 1W3NA 1Q6LA 4CNPA 4M51A 1OHLA 3BOXA 5A6BD 1UWTA 3ORWA 3AAMA 3KP0A 4PTVA 4JTLA 4KEUA 4E8GA 1V6WA 3GIQA 4M7TA 2PZNA 2DY3A 4US6A 3P67A 2VENA 2RDWA 1XINA 3E38A 1ZALA 3M64A 4OU1A 4O8AA 3NZPA 3T4CA 3WH9A 2YCJA 3QZAA 3D3FA 1XLAA 3H2OA 4PTDA 3CIVA 2BVYA 4MWAE 1I1XA 4C1LA 4S3FA 1XYCA 3W07A 1MEHA 2QS8A 5A2BA 3TN4A 1VPQA 1R3VA 3W72A 5EFDA 4MYAA 1I9CB 2WMIA 3ABRA 4MY1A 2FTPA 2YLAA 4LY4A 2HTMA 5DO8A 1Q6RA 3GC4A 4O19A 5LIKX 5GJMA 1C8XA 4QS6A 3PTQA 3N2CA 3R5EA 2VC9A 3A22A 2VI0A 1EO7A 4AEOA 4GY7A 1YTDA 1DP0A 4IIEA 4ZOEA 2C13A 3W1LA 3DFHA 3STEA 3V0TA 5IHSA 5CQ1A 1HFBA 2W92A 4OTKA 2ZC1A 4BWLA 3C4UA 4NZ4A 4NXSA 3NJ3A 1JD9A 2HNEA 3AXHA 3FVDA 4JIRA 4O54A 1LUCB 3P0WA 1JIBA 3M5VA 1PHWA 3IS4A 4HNUA 2YPIA 4CNNA 5FF7A 3GH7A 3VUPA 2V5BA 2XUCA 3S1XA 1QFEA 3VXGA 1BSIA 3TXZA 4DYKA 4AWUA 1IV8A 1J2WA 4XZBA 4EPDC 4PMNA 4KW2A 1C8YA 4IFKA 4C90A 3WQ6A 3QLLA 4C7DA 4JIQA 2J6VA 2VFFA 4IHCA 1DKWA 1RY8A 1UH2A 2VO5A 4DLMA 2QQ6A 5RUBA 3STGA 2OU4A 2RH9A 4GZIA 1B30A 3FY1A 2OYMA 1DIEA 3B04A 3MW7A 2JIWA 4YXGA 1JYNA 3LBOA 1FH9A 4U5IA 4JR5A 1QOQA 1BWVA 4MZ1A 1P4CA 2I1OA 3NQ2A 1JRCA 2C15A 3PJUA 1RAKA 5HOSA 4UOJA 1TZ9A 1QTWA 4O0ZA 3KBJA 1W0MA 1JGMA 2PDPA 3TONA 4KFPA 5GPRA 4QEEA 1EEXA 3LV5A 2XIJA 2QJMA 2GJPA 3NDOA 3W88A 5CC7A 3RJYA 3OYXA 3PNUA 3LN3A 2FPYA 4RE0A 4NVTA 1MRQA 1VJSA 1SFSA 2ZWYA 2DPEA 2ISSA 4PSPA 5LA0A 4PUJA 2PI6A 2ALRA 4GZEA 5K3VA 1DJGA 4RUBA 1V08A 2F61A 2Z25A 3A24A 2PWFA 4RK8A 1X39A 4PH6A 4RLIA 3EWCA 5E0CA 4NAEA 1XJBA 5HNRA 3GNDA 4UNKA 1FWWA 1E43A 2D20A 2P3EA 4MFEA 4UQDA 3LMYA 1JDAA 3EX2A 1EWEA 1E4LA 1OCJA 5CC3A 3VI2A 3UT0A 2WLYA 4KT2A 1EJWC 4ATLA 4I9TA 4W88A 1W1TA 3L67A 1A5NC 4HNNA 2QPSA 3VD4A 3F4WA 2NX9A 2D69A 3EEGA 1W91A 1AL8A 4DJFC 3UG4A 3QHOA 5A6AA 4N02A 3WBYA 4WOQA 1UJQA 3VX0A 4NNCA 1MNSA 1PO9A 3QKEA 3KBMA 5HQEA 5E0FA 1BQGA 2EJAA 3PBWA 3L4XA 5HNNA 4JEQA 4ACZB 3GQYA 4J3TA 1FDZA 2PA6A 1UD3A 3N9KA 1Q2SA 4M1RA 4E8DA 1EB3A 1ZPTA 3ONCA 4J3XA 1E9ZB 4C7FA 3TAOA 4NZJA 5A2CA 3PK7A 3RN6A 4JTDA 1UD4A 1HGYA 3W7OA 1VLWA 3P74A 2OODA 4LC6A 1TO3A 1K4GA 4LBSA 3N9RA 4XSMA 2PTXA 2O9PA 3VC6A 1JI1A 1JDCA 2YCEA 1VIZA 2HVMA 1BSLA 1IXOA 5ECUA 2ISVA 3MWAA 3VINA 4O1EA 4S2CA 5E93A 3OVPA 1XDMA 1QU4A 3CXOA 2QKFA 4BJHA 1V03A 3P8IA 3IEBA 4NF7A 1F3TA 3WLOA 3IJ7A 5G4EA 4BKNA 2ZZ3A 3WQ5A 3FA4A 3QY8A 4GE8A 1BRLB 3W1MA 1KBBA 4CLMA 4QLKA 2E28A 3GU9A 2PC8A 1IQ8A 3ANYA 4KQNA 1I0BA 2QULA 4MKSA 1E55A 1AK5A 2X1RA 2WMJA 4GGBA 4XSLA 4NX5A 5KMYA 2WSYA 1Q45A 4L9XA 4MNKA 5CAHA 3WELA 1TPC1 3B03A 3KOXA 4P8WA 3WJZA 3VNJA 3TU9A 2J8TA 4C1NA 5CGTA 1U5JA 3SIMA 3F5KA 3AXXA 1AZ1A 2XZ7A 3GXMA 4N9CA 4CKQA 3RDKA 2G3MA 1HJXA 1IWBA 2VFGA 5DCDA 4JIHA 3MKVA 2DZTA 8RUCA 2BTMA 3EB2A 4HNTA 3CK5A 3RIKA 2GGGA 4XTDA 3GNPA 4WEVX 1KCZA 1B9BA 5LIWX 4QHRA 2QCLA 4DZAA 3DKJA 4F0MA 1OSEA 5CG0A 4FLRA 3AIVA 3UJEA 1VFMA 5D33A 1DOSA 2OSYA 4XQ6A 4LEQA 4DWSD 5FCZA 1XR2A 3WY1A 4AY7A 3DGBA 3SUSA 1GVYA 4UTTC 3AFBA 4I6VA 4C6PA 1XLFA 4HQVA 5KITA 1HJUA 3VOJA 2Z0IA 5D37A 1R5YA 2VCCA 4QIUA 1IXPA 2YL8A 2VEFA 3POHA 5JVLA 2P10A 3VOHA 3CAWA 4F0SA 3RCYA 2B4GA 3GR8A 4IISA 1V6XA 1RLCL 1XG4A 4P5UA 1ITUA 3G24A 3FA5A 1T8XA 3MI2A 4EACA 4XZ9A 4IL2A 1T5AA 3EXSA 2ZX9A 2Z6JA 3M0HA 2ZDRA 3IANA 4NHVA 4I90A 3LLFA 5JH2A 4MKVA 3LRMA 3H7RA 2D0HA 2J4GA 1K03A 4O28A 1REQA 5F4SA 1H61A 5ABHA 1ITCA 4NZ1A 3UWWA 4LSBA 1UPPA 3BAIA 5HJLA 3SQLA 3W1TA 1R9ZA 3P81A 1O7AA 4ZGYA 1LL4A 2VJXA 1CPUA 2E6AA 4FNRA 3W7HA 3H21A 2QHAA 4LBRA 2YDAA 4LRSA 4AH7A 5AB3A 4P7LA 4S3EA 3PJTA 4XZHA 5JIWA 1JNEA 4NJHA 4H6KA 1AD1A 5D02A 2YLLA 4AZIA 4XAFA 4F0HA 1FVPA 2KAUC 3LD5A 3CMJA 1B57A 2DZBA 2VMFA 3W6LA 3R1ZA 4AWTA 1BEUA 4A3YA 3BUVA 4Z2GA 6XIAA 1KV5A 1KTCA 4ZXOA 3WQVA 1Q6GA 4OVXA 2OMAA 2HNHA 4Q7IA 1F6KA 4ALDA 4JAWA 2CZEA 1XD1A 4DIAA 1RCXB 5D8ZA 3SJ3A 5C8BB 1E6SM 3V5OA 1F4HA 2V0TA 3NO5A 4JXCA 1JDFA 1WOBA 1W56A 1C3FA 1F3XA 4JS3A 1KXQA 1DIDA 4LB3A 5DN1A 2BSLA 4FP1A 3VNLA 4WLCA 2INEA 3B4UA 4ZQCA 3KFTA 3GHSA 4C6DA 3WCZA 1QPKA 2QDEA 1H3GA 3PZMA 3WFZA 4NQ1A 2ZYFA 3NVDA 3W29A 4GQGA 4GLEA 3AYSA 5AC6A 2FPVA 4J3VA 3TMQA 1XISA 3U5UA 3KRSA 4RE2A 2HPMA 1FCVA 4M7SA 2NV2A 3PS7A 4TV5A 3MHGA 1TV4A 4OGZA 4YYCA 2IUZA 4A2RA 1S38A 4UCFA 2NXHA 4ACZA 4IL0A 4IIGA 4F4RA 2F8QA 4E2DA 1UUOA 1X1ZA 3NQ7A 1BGGA 5EYWA 1R7OA 1LBFA 3SM0A 1KCXA 2IMRA 2Q8LA 3RR4A 3RM4A 3O9NA 4E4PA 4DBEA 3GC5A 1DL3A 2BNJA 1GYNA 3TC6A 4LUIA 4NX0A 3NQVA 4E2OA 4IICA 4H7VA 4NZ5A 3H2AA 4XIAA 4Y8EA 3PAOA 5M2FX 2GK1B 4D6FA 4HOZA 1EA0A 2R9RA 4HKPA 3TNOA 4FI4A 4HVXA 1O1HA 1MWOA 3OODA 5ECVA 3H26A 4ATWA 5HPOA 2JF6A 3LERA 2ZC8A 3SIZA 4E2VA 2J8FA 3HM7A 3VKKA 2YL6A 2V82A 1U22A 1DWJM 1X1OA 1TPVA 2FHCA 1BRLA 1F05A 1C93A 2WVSA 4GYPA 4KF1A 2CKRA 2BASA 2RGMA 2VNCA 3WLHA 4RW3A 5HMFA 3OGSA 4LUSB 3BZGA 1OYCA 3IIXA 4U5KA 4PCTA 5D2WA 4DWDA 1AH3A 4O53A 4W5UA 3PC0A 3CWOX 3LZ5A 3AXMA 2A6NA 4XAYA 2DT3A 2ACQA 4GCAA 1ZBKA 2PDQA 2G41A 3BLEA 1GW9A 3CMGA 1A3HA 2WZEA 3IAPA 3WMLA 3GR4A 5KZDA 2E40A 3UXIA 1UKSA 3LXBA 2C19A 1T40A 2ZUNA 3PN8A 2VFDA 3BCFA 2QJHA 3D47A 2VFIA 2VC5A 1KBLA 1OD0A 3AS2A 2WNZA 4UC5A 4QJ4B 3UETA 3F2CA 1ZAIA 1GZJA 2B31A 3KS5A 3KXQA 3CL8A 4H9UA 3I4EA 3S9YA 1OC7A 5A8GA 1P6WA 3VZYA 4JFVA 1E4NA 2OCZA 4JQ1A 5LHEA 1YBQA 1WZAA 1O66A 5C9UA 3A4XA 2HK0A 4HA0A 4Z0JA 1DEDA 5FJPA 4AHQA 2OKOA 4Y7EA 3OG2A 3L65A 3W1QA 1YXYA 3L66A 4HPGA 4HSNA 4IPPA 1NEYA 2OX1A 3CUFA 4ADSA 1W3TA 4PULA 2PEVA 2R24A 2BXYA 3W28A 3ZFHA 5D09A 3IIPA 1MUMA 2FYMA 1I45A 1U30A 4FPSA 5AFDA 1GYLA 3BPWA 4NZFA 4XIMA 1PYFA 4NJIA 1FCUA 4Z1DA 4WVXA 1AODA 3C2EA 2PDBA 2V69A 1KXVA 4AD1A 3OGVA 2YKKA 1Z89A 5EMLA 4F8XA 1M68A 3M46A 4HBKA 4FLQA 4ERGA 3E6EA 1ZHAA 2X0HA 1GGOA 1BPLB 2Z26A 3BVJA 4UTWC 4H1ZA 4RW5A 2QUNA 3Q58A 1I60A 4OOUA 3S1WA 3C52A 4EPKA 2YB4A 1RCOB 5AECA 4LAZA 1PZ0A 2Y61A 2NV1A 3MYOA 4HPHA 2PRLA 3NQFA 4R7WA 2WPBA 3RR1A 1HP5A 3M16A 1JEZA 1TZ7A 4XO7A 2VCBA 4A2SA 2OWCA 3HQNA 3W82A 3THDA 4U3CA 2OEKA 4A8NA 4U31A 1DWAM 4XZWA 2O0TA 2HQAA 1XSJA 4H4IA 5A6BA 3WBAA 4AY1A 1YXCA 3H7VA 3GXDA 5DQPA 1OCNA 3SW6A 1AA1B 2RAGA 1FWGC 1A80A 4HSHA 1PSCA 3EWXA 2VEPA 3LZ3A 3HO8A 3RU6A 2GQAA 3PZUA 3E5PA 4P7QA 1OF8A 4HA4A 5D03A 2WSQA 1JG9A 5M17A 1ZTVA 2VC6A 2J7CA 5TD4A 2YXGA 4FB7A 1Q3NA 1AVAA 3GZ3A 1OB0A 2OELA 4F2UA 1XW8A 3D3AA 4CVWA 1XIJA 2EPHA 2BG5A 3N2XA 2CHNA 5CPTA 3TC7A 3NUKA 2W67A 3AZRA 3CO4A 1DWGM 2YL9A 1YNQA 2Q6ZA 2WJZA 1ONXA 3K46A 4IXHA 7ENLA 3LQLA 4POCA 4JTGA 4U28A 1ONWA 3BARA 2HDJA 5GQBA 1GYMA 4Y9OA 2I57A 2DU2A 5FJJA 1JCJA 3V5CA 3TNBA 1OYBA 1WXZA 4LY8A 1VYSX 2H8ZA 3ITGA 4J27A 2HVOA 4E5TA 3RLVA 2AL2B 2V81A 1VBJA 2XFYA 2ACRA 5C71A 5FJIA 2AAAA 1XFBA 3BJTA 3MZNA 4YU1A 4WKFA 4HTBA 1EUAA 5E09A 2JF7A 2FZDA 1C90A 3MSRA 4ERIA 3QN3A 1W9UA 4GQ0A 4J1OA 4GIAA 3UVIA 3N2OA 1PV8A 2YA2A 1NDVA 3PTMA 4RDZA 5F4XA 5HNUA 4HZ6A 3LSCA 1P0NA 1TCMA 1PBGA 2PU0A 2L5HA 4BF7A 5FEWA 5I0DA 5BCAA 4R34A 9CGTA 4XBSA 3O6CA 2B81A 4X61A 5E0KA 1UD2A 4L6HA 3S2MA 1FWIC 4NZCA 3WLQA 2J7HA 3QF0A 3WH5A 1WKDA 2Y7FA 2GK1A 4CCZA 1BF2A 4EK7A 1IR2A 2RGLA 2BFGA 3WQEA 3L0GA 4TX8A 2P0OA 3W2JA 2H9AB 2XTKA 3U5YA 3KHJA 1ZBWA 3H55A 1UKTA 3ARSA 5F1VA 4PUEA 3CT2A 1TIWA 1UIOA 5B80A 4LPCA 4DLFA 4KEVA 1DTUA 1XXXA 4KPLA 1JVNA 1E0UA 2QF7A 2R1KA 4AZBA 2ZRVA 4CNTA 3CYVA 3DI0A 1F6YA 1UKOA 1K4HA 1B31A 1DPMA 4DJFD 4CCCA 2Z2AA 3SCUA 1EO5A 3Q65A 4YJ5A 4CD6A 1IEWA 4CNUA 1OX5A 2WW5A 4QCEA 3CT7A 3P60A 4KRZA 4UR7A 4JTSA 5D30A 5H2ZA 3AISA 3WD0A 2Y5SA 1OCBA 2VWSA 4DHGA 3WKZA 3HV8A 3EB3A 3EX1A 1TPEA 1LQAA 3CTLA 4MJ4A 1PTAA 4A3RA 2D24A 2QNEA 3VGEA 4O1AA 5C2CA 3DEQA 5IBXC 4HN4A 4A8LA 1Z8AA 1SO6A 2YYTA 1CECA 1EKOA 1NSJA 1RHCA 5GVJA 3W38A 3A13A 4IP5A 3M5XA 2NXIA 1XD0A 4PCPA 4H01A 3BAWA 7REQB 4IOTA 3TN5A 3Q67A 3CYJA 1XYMA 3N1AA 3EWZA 4AZCB 3AIWA 4PUDA 2WNWA 4LYKA 5CPOA 1KKRA 4P2VA 3L4ZA 2Y1HA 5CPNA 1W6TA 3MDUA 5LXEA 2B7OA 4P7RA 3HB9A 5BXTA 2GVJA 2J24A 3T2OA 5DRCA 2ZXAA 2VD8A 1UWQA 2HV5A 2W61A 4O14A 5C6MA 3AS1A 1UBSA 3R43A 3IIZA 2E5BA 3CAVA 3CPUA 3HZ3A 4ZO9A 1UC5A 2J75A 3HBLA 4AXNA 1BVNP 5AOUA 1SYTA 4C6LA 3CZEA 1P6BA 3A3XA 2PLKA 1A5MC 4QQ3A 2J8GA 1BKHA 1PKYA 2ZE0A 2ZFAA 1EDTA 3HN3A 3PVFA 3BQ5A 2XVNA 1OFAA 5MKGA 4Z1CA 2E8ZA 2ISFA 5IHRA 1YLVA 5AYBA 3M0VA 3TC3A 1LWIA 4D6DA 3GX9A 3OG3A 4TR9A 1V02A 4FMVA 3EZ4A 3LPFA 3PJWA 3EKZA 4RE3A 4H6QA 4C6QA 1HX0A 4X2RA 2Z6IA 2Q3OA 4PTMA 2XFFA 4WD0A 3GVQA 1GKQA 2DZPA 3WMCA 4EANA 1QPQA 5M3WA 3KL0A 5EB8A 3LPOA 3T40A 3WD2A 5CH9A 3EPMA 3TROA 4JNMA 3KDNA 4JNZA 3PTDA 3UF9A 1Y0EA 3EX4A 1TX0A 4AD0A 2WNQA 4GBUA 3F2DA 5E5CA 4EF9A 2ZX7A 4LB4A 3VYLA 1K70A 4O17A 4DUVA 1FUYA 2W63A 4TU1A 3UR7A 2HE5A 2WZIA 2VT0A 1ML1A 1FWRA 3WEZA 5D9PA 3BMVA 3K8KA 3P2VA 2VGFA 1XLBA 3W2KA 3IJQA 2X09A 4NL1A 3OVQA 3CQIA 1V3IA 4UQCA 5LZLA 4HHLA 4HMDA 1XRSA 3JZEA 2Y8KA 3LHVA 2V8ZA 4Z1AA 2WZMA 4DAFA 1B3YA 1UR1A 3TYCA 3MP4A 5C9WA 4ROQA 1FWSA 2EEXA 2Y7EA 5AVHA 1CX9A 4DO4A 1IT8A 1A5AA 1W9BM 3ZR6A 3EDKA 4V2XA 1QCWA 3IRDA 2W9MA 4UMCA 4JFWA 1ICQA 5L9FA 1GEQA 4XD6A 1JULA 5A6LA 1FY6A 1ZJIA 1XGDA 2AL2A 3PWGA 1BLIA 4M56A 4GCXA 4I7WA 2XM1A 4GX9A 2CLFA 3GNXA 1TR9A 1XH1A 2JBMA 4GI6A 2DUXA 5XINA 4MJ2A 1MZHA 2PDFA 3GTIA 2CPUA 3SN4A 2WKGA 4AISA 4MZ8A 1V02E 1FHUA 2WKJA 3H6OA 1R85A 2BHYA 3GBDA 4Q8QA 3REQB 3EX6A 3N29A 3QV8A 3W7QA 3G1RA 3WQ8A 4UUIA 3PANA 3PM6A 4UIOA 1TJ0A 4KCVA 3GTXA 3C56A 1KFKA 2YR1A 1PIIA 4O57A 4OV9A 3T4WA 2I9EA 3UGVA 1P43A 2H9AA 3UZJA 3HIJA 3OO2A 4X3ZA 4B90A 5A6TC 1JJKA 1ME7A 3GB6A 5I03A 4YYFA 4R33A 2VCAA 2Y8UA 2D1ZA 2POTA 5CJ5A 4H6RA 2GDQA 3NZRA 1B3XA 1S2AA 3PB2A 1X96A 2X16A 3IUIA 4RPQA 2XSAA 4AIBA 4IQEA 3UVAA 4JDYA 3VD3A 2CBVA 3VFLA 3E0WA 3GAKA 1TJRA 3WUEA 1EYEA 4WX2A 3EX3A 4GXMA 2FTWA 3FYPA 3IGHX 4JTCA 1Y5WA 3OIXA 3FCPA 3N4EA 3PUEA 1L6FA 3VDCA 4YTRA 4MHBA 3WLMA 2CYGA 4G8TA 1KR1A 4QLJA 3QYQA 5CGMA 3VTRA 1XL9A 3O7UA 3QC3A 4WZHA 4TTUA 3VILA 3N19B 4WDUA 3NM3A 1QPRA 2DSUA 2BY1A 3NO1A 4FK9A 5CLWA 3YPIA 3WDRA 4PUWA 1YE4A 4GC3A 1E71M 2D3NA 3HGJA 2PCQA 1YTKA 3S5ZA 1GQNA 1OY0A 1WDWA 2E8YA 3LCGA 2QUUA 3BMWA 4PB4A 3ARUA 3K8MA 2R1MA 3MP5A 4AIUA 4Z2IA 3TCEA 3AIEA 1Z44A 4RDVA 3WNPA 4DRSA 4MB4A 4NRSA 3MT1A 1KA9F 3IK2A 5I23A 4PL1A 1UZ1A 2JK2A 3UR8A 2EAWA 5EU9A 5CGQA 3I3DA 3FDKA 4WY0B 5C5YA 1V6VA 1US3A 1N8IA 4J28A 3P84A 3GG0A 4L1XA 1K77A 4MNMA 4PMXA 1AG1O 2OT1A 1V3KA 2XHYA 3FHQA 8CGTA 1KRBC 3UZXA 3RRXA 2NUYA 4XVEA 1CT5A 1V5XA 2Q09A 2X41A 2HSAA 4UNIA 4L56A 3GU2A 2I16A 1PAMA 1WBJA 4Y9NA 4UTKA 1FWJC 1JDEA 3CWHA 4L4PA 5LKYA 3GHRA 4D9PA 1KXHA 2A7NA 5A95A 3PTKA 3U7VA 4YS1A 1LRQA 1EHAA 1YDVA 2CLLA 9XIMA 3GYCA 3T6CA 4JN6A 5FSEC 1Z41A 4IIDA 3AWOA 5I02A 1V3JA 1QHOA 1I2NA 4MLRA 5C54A 2DZXA 3TTYA 3OLIA 3BC9A 3NOEA 5LNVA 5BU6A 4ROPA 3A3HA 1CBGA 1ZY9A 3GVGA 5HNTA 4NYYA 5AZ0A 2E77A 3TX9A 4B15A 4B4HA 2WMFA 4IPNB 2NQLA 4MDPA 4GACA 2ADAA 4O18A 1Q66A 2CHRA 3M6YA 1JPKA 3QTGA 1SZRA 1EIBA 1OX6A 4BI7A 2X1TA 4H7ZA 1LOQA 1J2BA 5HUPA 1H7RA 2FGZA 3B8TA 3KOFA 5ENLA 2OG9A 3KL3A 4FOUA 2OGYA 3IRSA 1W2VA 5LXXA 3CL6A 3CJPA 4FXJA 4AY8A 2NQZA 3AHVA 4DUWA 1U2YA 1F7BA 3DESA 3KBWA 5DBTA 2IPJA 4OOZA 4BY3A 4AD2A 5GNYA 1W3HA 1WUFA 2BHZA 5HMSA 1TPH1 7TAAA 1FFRA 2GLKA 3BGAA 3KRBA 3TA9A 3AS0A 3ABZA 1FRBA 3T0BA 1H60A 1OADA 2YZRA 3UA4A 2W62A 3TOYA 1N7KA 3SI9A 3ARPA 2GGHA 1FHLA 3T8LA 3PF3A 2QJGA 1P0EA 1PKNA 4UXDA 1OBAA 2W66A 2E6DA 4X0VA 1F9CA 3WF1A 5HK4A 4AYGA 1MO0A 4D1JA 3VIJA 3I4KA 1OZQA 1E4MM 3ZSSA 3QH2A 4UFLA 1F61A 1TQXA 4I6KA 1ISVA 1CB7B 4WQ6A 3LLXA 3PWAA 4CN4A 2VWTA 3EA3A 1GZ1A 1Q8AA 3NQ8A 4XD5A 3VDHA 3JS3A 3G8RA 4N6EA 1W8GA 3EWYA 1AFSA 1UZ4A 3DG6A 4PUKA 2MANA 1BXCA 2J77A 2QCNA 3HPXA 1CGYA 1XDJA 2GGIA 3NQBA 5B7ZA 1LYXA 4DVOA 4AVOA 2H8XA 4JKLA 1WAUA 3G77A 1MEIA 4PZVA 2X42A 3TTEA 3ITTA 5I3DA 1R9YA 1GOOA 4OUIA 4XAZA 3V3WA 4ZFMA 4WRHA 2HCVA 1V0LA 3RO8A 1CTNA 5C2GA 3M0XA 4ATDA 3E2VA 4QQUA 3WIJA 3REQA 4V1YA 4ZEPA 4UQAA 4HA1A 2QUMA 3GXPA 4QE5A 4MB5A 2Q3RA 3S2NA 2ZXBA 4G1NA 4Q8WA 3UPMA 1BXNA 2JIEA 4KESA 3MCNA 4AZ6A 1LT7A 1ZBCA 1HGWA 1DXFA 3KAOA 2PDNA 1PX4A 3NO3A 2DH2A 1J5SA 1H50A 3OVGA 1DJQA 1B3VA 3MB9A 3E2SA 3EMZA 3S9IA 2DSZA 2XWDA 1DYSA 3TCSA 4UQBA 4GQRA 3FYYA 4S38A 4EP8C 3WJSA 4LUTB 2HZGA 1Z7AA 1Y5XA 1DQWA 1M65A 1LLWA 3LU2A 4Q8UA 4ORIA 4QLLA 1ZJAA 1V79A 2VURA 3U6WA 5A6MA 5LNWA 1YTEA 8TIMA 3GXNA 4S3GA 1TG7A 4ZE5A 3K4WA 4ENLA 3G1DA 4M3PA 3WUGA 2PP1A 1W9DM 1XCFA 1XFCA 3MUY1 2YCLB 1BKSA 1GOKA 1O6IA 1FXPA 2GPTA 5F2MA 2A2IA 4GJ1A 3GSMA 2XH7A 3WBEA 4W89A 3LM7A 3PAJA 5BMWA 5DMNA 1JXJA 5C0QA 3THUA 3C0QA 2I5GA 1UD8A 1F3WA 3J7HA 4DJDC 2PUZA 3LCIA 3O0FA 3AJXA 1U33A 4H8VA 4EAYA 3BDKA 3MDWA 3O0KA 3KEHA 3GDBA 1F76A 4B5TA 4G6CA 3L7RA 1P5BA 3GDLA 2IKHA 3LGDA 2GVEA 3NDZA 3II1A 4N0RA 1P7TB 4UFMA 4IXXA 2QJJA 4GI4A 3LDVA 2CU0A 5EBAA 3BLKA 1EP1A 4L9ZA 3SCTA 1LQ2A 3W25A 1RVGA 3WD4A 4L6DA 4LVAA 3N6QA 1KM1A 3DZ1A 1GG1A 4B92A 4R85A 2G3NA 4JBRA 2D22A 1RR2A 3SQSA 1DJIA 3FKRA 3W2MA 4B9YA 4L5ZA 1LP6A 4OKDA 2IQTA 3SRDA 2OEMA 4PBFA 3UZWA 3VD5A 4NXKA 1JCTA 3WNKA 1GCYA 3CC1A 3VZZA 5MHBA 3MO4A 4JFSA 2YA0A 1EGMA 2VX7A 3DENA 4AF0B 3H2EA 2YDQA 3TQKA 2ZDSA 2AMXA 1AW1A 3WFAA 1HL2A 4Q8NA 3RPDA 1O5KA 3VIGA 3DYPA 5JH1A 5D9NA 5E6YA 4BF5A 4MWAC 4W4QA 3ID7A 1B3ZA 2Z1XA 4EXQA 3M0IA 4AEEA 3TQPA 2PF8A 2J27A 1V0NA 2FQIA 4JPGA 1JAEA 3FJLA 3ZXWA 4M5PA 2ACSA 2XU2A 1P1XA 2Q02A 4LNCA 4DNMA 1DJHA 4ZFCA 2QMJA 3GY1A 1KWKA 1NFGA 5F2LA 2J7FA 1GVSA 2GDUA 4V27A 2ABAA 3NNTA 3LPGA 1Y5VA 1NF7A 5AYIA 3BSMA 2HMCA 1U5VA 2DVTA 3SECA 5CC5A 1KFCA 3URAA 1GONA 1KCLA 2XPKA 3TJ4A 3T55A 1VBRA 4E8CA 3DERA 3UXLA 1KLZA 5DEZA 2WWCA 1KRCC 3WDPP 1OJXA 4XUYA 1E0XA 2IW0A 3VE9A 5BWAA 3APGA 1C7SA 3QW3A 1RA5A 3W75A 4DO6A 4KWOA 2G97A 2DT1A 4DBDA 4CQ9A 1F8IA 2C8NA 4GUJA 1MI3A 2CKSA 1R86A 3LXAA 2QEZA 1I1WA 5FF4A 1YNYA 4YTUA 3OTRA 3EXTA 2PGWA 4LAMA 4H83A 3CAKA 3FK4A 2WCAA 3W22A 4AQLA 3FS2A 2R91A 1RLDA 1J18A 1GVEA 4CQ8A 3URNA 1AMKA 4L7ZA 2YDSA 3PZTA 3S8HA 3FGCA 3HMJG 1F2JA 1G6CA 3W1NA 1R2SA 1JPMA 1XLIA 2E5CA 2R6OA 3MMUA 2G3FA 3KBNA 3GG7A 3KHDA 3RM8A 2PDCA 1XBXA 2WV8A 3FEQA 4LUJA 5FJOA 3LI0A 3KTXA 1IEVA 1EF2A 2Z2UA 2INZA 4WGHA 3TDFA 4LX4A 3WK3A 1J93A 1CZ1A 4I8YA 3QPZA 5JUVA 1OINA 2D2HA 1WXYA 2OQYA 3S6DA 3T0CA 5EFFA 2YXXA 1UG6A 2HJPA 2QCFA 1Z9AA 4QNEA 2C18A 4AG0A 1CXIA 4S3KA 1DVJA 1K9FA 3BGGA 2ZZ7A 1WKFA 2YGYA 4MVAA 3M07A 2GVYA 1MQQA 4C91A 8A3HA 1RUSA 4NI8A 3PG8A 4HZ7A 4B2DA 1XQKA 4PFHA 2D2JA 3T78A 2WVVB 2P50A 5HDRA 3P14A 4C6CA 1TELA 2NT1A 3TXVA 2BOEX 1X7FA 2DFAA 2FB2A 4GIEA 1EJRC 1XSIA 4CD7A 4I9JA 1EA9C 4JTEA 4GNJA 5I79A 2J78A 2E6YA 2WANA 3NVTA 4UFKA 3S2JA 5AKQA 3W1XA 3DFYA 2J47A 3K4AA 2UWFA 1EC8A 1ODZA 4BWLC 1Q6EA 4E6MA 4B5VA 2PWUA 3CQ0A 4OBTA 3NL5A 3RMEA 1E72M 4QG8A 1SW0A 3AIQA 1X97A 1R87A 4XAGA 4PFMA 5DY3A 4TIMA 2QCCA 1D2KA 1RCQA 2R94A 3DFNA 1H5YA 3UWVA 3USZA 5G1MA 3ZS4A 4HP5A 2FHFA 1W5OA 5BRBA 3LEPA 3W73A 1Q6OA 4DF0A 2O4QA 3DUGA 2FVKA 3IUHA 5M1TA 1US0A 3OU8A 3PP7A 4O15A 4E38A 5LNRA 1YMYA 4AX6A 1XP3A 1VJZA 2G95A 1NU5A 2WKLA 2BGQA 4K37A 5U4NA 2V5KA 5AHMA 3W7JA 2YCLA 2VGGA 2OO0A 2OO6A 1H63A 1XBYA 2AQOA 2Z27A 2XM2A 1AL7A 3QQ0A 1DE6A 1XLDA 1KFBA 3AZTA 2PS2A 3U2ZA 5CXPA 1KD0A 4HCHA 1VEPA 3WNMA 4IX0A 3W87A 2OT0A 3WO8A 3ARWA 4DAIA 2D3LA 1KB3A 3ZIZA 3NXFA 2VOTA 1EC9A 1IGSA 1C91A 1GOXA 4C5YA 4FNUA 5HPCA 1W31A 2VKZG 3W86A 4HIBA 1DWIM 1PTDA 2O55A 1DJYA 1M6JA 4A3HA 3DG3A 1NP2A 5C2XA 2EPLX 3LPPA 5E1QA 3VM7A 2J7GA 3WQGA 3SCQA 1P7TA 4MGGA 1L6GA 5CCZA 1VEOA 1UMYA 1WXJA 2FJUB 2GVGA 4MTVA 4XZIA 4BEUA 1VH7A 2CW6A 2IXVA 3DXIA 1M41A 4H3DA 3GKAA 3DX5A 3M0JA 3N3MA 4Q8MA 1K7XA 1XRTA 2OYKA 5G1TA 1YKWA 4Z17A 4TVCA 1ENUA 1WAWA 2PFHA 3AJ7A 1BFNA 3QM3A 2Y62A 4BQ4A 3EBVA 3M0MA 5BXPA 4US5D 2ZUVA 4S3BA 3L5MA 1R38A 4V28A 5E9AA 3QGKC 1ZFJA 2PCEA 3O05A 4FR1A 4B5WA 5I3GA 5DXXA 4FSAA 4AF0A 1E9IA 3HF3A 4IFOA 3NPWA 3QMSA 1J4EA 1QWGA 4CUCA 5A6KA 4PRTA 1D7KA 3AS3A 3INPA 4UOZA 1EF3A 5D38A 3MI3A 5AY7A 4KWWA 4RNJA 3ZM8A 3L0KA 1OK6A 3LYEA 1AZ2A 1WYIA 4IP7A 2WHKA 4R7JA 7CGTA 3LHWA 1G0CA 2OJPA 3G6MA 4DEFA 2ZX6A 1JQVA 4ZBCA 3W27A 1TB3A 1YRRA 1CXHA 4LCSA 2NUXA 5K2ZA 3MZ2A 1X8CA 3LMZA 3OQEA 3IAQA 1TTPA 1MQRA 1ITXA 1HJSA 3GTFA 3H22A 1DXIA 3BSHA 2BP1A 3TP4A 1V7AA 3CQKA 3G1HA 1B54A 4PMVA 1Q6DA 4H41A 1K9TA 2YCIX 8XIAA 1FOBA 3DHFA 1FBAA 1EXBA 3EB4A 4JKKA 3B8WA 2EBNA 1G7UA 1GTEA 2V5LA 5I24A 3VKJA 1QNRA 4W85A 1GVRA 1MUCA 4Z1BA 3SUUA 4JQ2A 4IIFA 3KTCA 3NTYA 1VAHA 2Y2WA 4JGDA 3F7JA 2FFIA 1IGWA 1VFTA 3MTWA 3IJIA 2WVUA 3G5EA 1PZ2A 1UH3A 1X8FA 2VFHA 1J6OA 3SCRA 2XN2A 4PTWA 3FVMA 3WLLA 1OD8A 2O56A 5CZJA 3S5SA 1TQJA 1EUNA 3UZ5A 2V5JA 3QR0A 4FNPA 4QDWA 3UWQA 4DF2A 3WJXA 4IUGA 1SPQA 3KE0A 5CSRA 2PC4A 3W81A 1VPYA 1PKMA 3LSBA 4X9SA 3HG3A 1TPFA 4M6UA 1YPFA 1L6YA 4K2SA 1HVXA 2CHOA 4A29A 2OLHA 2VRJA 5DMYA 4FALA 2WBGA 2HBVA 3VAVA 4UTHA 4RPPA 3R58A 4DPPA 4Q3MA 3WMSA 1XI3A 2E1DA 3U9IA 3S0CA 3WF4A 4IGNA 1QPNA 3ZT7A 4ZZ9A 3TKFA 1Q4WA 1O94A 4IUOA 3PPHA 5AC7A 1SFLA 3E0VA 3UCQA 3B0UX 1R3TA 1MRAA 2BY2A 3H70A 3TA6A 5TAOA 1FWFC 5GJPA 1JZ6A 4JYDA 3BW4A 4DI9A 2W6RA 4NAFB 3W74A 1FXQA 1TUXA 3USBA 3W7DA 1ZSXA 1OFRA 4FX7A 2PDYA 3S4TA 1JNDA 4K1WA 3B0XA 5KINA 4DNHA 3LCWA 3T44A 1GNXA 4WUIA 2A3BA 1GVOA 1HT6A 3GIYA 1LZOA 4IFKB 4NASA 3L2IA 3R7MA 4NT0A 3QGAC 2PWHA 2DEPA 2R1LA 2IPGA 3HQPA 4JICA 4RZBA 3RU8X 2A21A 4PUNA 5I5RA 4ML4A 5IFTA 1BWLA 2HWGA 2VVSA 5E6ZA 3DBNA 4QS5A 4WY0F 2DUZA 3PBVA 1MDRA 2NLIA 1EZ2A 4HU8A 1E6ZA 5HWJA 1IT7A 2HXTA 3CMFA 3SO7A 3N13A 4ZQOA 3TFCA 1KFEA 1UBPC 1OT1A 2ZCGA 1MYRA 1Q8JA 3DBPA 4HMCA 1UR9A 2VGIA 3PUDA 4PMQA 4CEXC 1PIGA 1GOWA 3ARTA 3HV9A 3ZLGA 2QUTA 2FVLA 5C70A 1YXDA 3MVTA 1KTNA 3W83A 5DELA 3OEXA 2VC7A 3GR7A 4GYJA 4NIRA 2G3IA 2ZTKA 3V18A 4RZ5A 3U2EA 2OKTA 4HYVA 3B8SA 5TF0A 4WKHA 1HN1A 1W3IA 3OYZA 4PCFA 1W1A1 3P3BA 5H8MA 2HS6A 4MIMA 1V93A 2EXOA 4RNFA 3S9ZA 1RJPA 1UQYA 1RQEA 2AL1A 3UESA 3PSWA 3DAQA 3FN9A 3HURA 3V75A 1JYXA 4C7GA 1XGEA 3CZJA 3BQ6A 3OLDA 1AJ2A 4UTWA 1ISWA 4AD5A 1RD5A 2F6KA 3IV8A 1NELA 3A5FA 1G94A 1R30A 1WZKA 5FAGA 4LALA 2AAMA 4DBWA 4D72A 4LUYA 5T9BG 2FMOA 1AH4A 5FF2A 3AI0A 1JXKA 2QMKA 3GRIA 3LM3A 2WSKA 3FJ6A 5EA9A 2C71A 1B2YA 2QDHA 3LENA 3P7YA 4UFIA 3WUBA 4QDPA 3R12A 4KERA 3SGGA 4O1DA 1QRQA 2X7WA 3F4NA 3I3EA 2J9XA 4M81A 5FI8A 1LTDA 1X6NA 1S5VA 4Z42C 3DFOA 5M03A 5XIMA 1QW7A 3LCHA 2GQ3A 1A0EA 4LNYA 4WXZA 3W6MA 1U1HA 3RLUA 4K38A 1G4EA 4CGTA 1N82A 4K1GA 1VGAA 5D05A 4QROA 2ZIDA 1HVQA 5SWUA 1YYAA 4LOCA 5BRQA 2F9RA 3QHMA 1Y65A 3MCOA 4AC1X 3QOMA 1H0GA 3Q37A 4QXIA 4LAUA 2WMGA 1JZ4A 3HOJA 4O4VA 1O5RA 3M0KA 7A3HA 1ZZMA 1HJQA 4Q7NA 1OVDA 1JAKA 4DJDD 4K36A 4QAWA 3NGJA 5K9DA 3F5JA 5EMJA 1ZAHA 3VDAA 1E40A 2ONEA 3G2GA 3QGVA 5BOFA 3MCMA 1R3RA 3I6EA 3ARZA 3NAVA 2FPTA 1S39A 4PMYA 1KR0A 3UZZA 4F0RA 2PP0A 3B9AA 1WX0A 2ATSA 2BOFX 3TYAA 3IK4A 4L4OA 4DJEA 1WBHA 3THQA 4AXKA 3G0SA 2KX9A 3W2UA 4Y9MA 4X60A 2QAPA 1Q7QA 3QPYA 1A53A 1KRAC 4O52A 1SU5A 1QT1A 1JZ7A 3EDFA 4JY9A 3C2FA 1XICA 5H8PA 3B9NA 3W9ZA 4HCLA 4C1NB 2BY3A 2P3ZA 3WYZA 4XUGA 2J25A 3GVRA 3HGSA 4LCQA 3T42A 3PZNA 1YE6A 2XVLA 1G4SA 2XN1A 1QBBA 2IQDA 1ZU8A 1CW2A 3KTSA 3RX4A 4MWAD 3WQ4A 2GJLA 1R3SA 3KBVA 3GO2A 2E5DA 2ASHA 1ZP3A 3Q2DA 4ICNA 1ZRQA 4CQBA 4W93A 4IM4A 3URBA 3H12A 1QI0A 4L6OA 4UTMA 1XM3A 1UZHA 3M5YA 4ZQMA 4ZODA 3F4VA 2XJ7A 3SFWA 2X7VA 3L68A 4CU7A 4S3CA 1W9PA 3ARYA 3RJXA 3LLDA 5T8GA 4DELA 1GZGA 1Q7MA 5HULA 2PU1A 1AMYA 1DIOA 3VGFA 4W9TA 3N25A 4NJKA 3SY5A 4J35A 4DM1A 1C9DA 3KCLA 3HPZA 3VMNA 2BGNE 2OQHA 4UR9A 3SCNA 4NAFA 1GG0A 3QY6A 2ZZ5A 1F6PA 4EF8A 4GKTA 4OE7A 1AW5A 4HMEA 4IQDA 3L4UA 3O1NA 3IACA 2ZTJA 3URQA 1S5TA 3G3MA 1OX4B 2BGSA 2F38A 2QYGA 3O06A 4W8AA 1W5QA 2GDVA 3W26A 3NSXA 3HQOA 2X2GA 1CENA 1P1MA 2PAJA 4KFOA 3FEMA 2D0GA 3PBUA 1OFPA 2HE8A 3CNYA 3QYSA 1REQB 3ZSTA 3VA8A 3M0ZA 3TLQA 1XWYA 4Q22A 4EXBA 1KFWA 1OGSA 4J5NA 4J3WA 2CZDA 5IBXA 1NJJA 1XLCA 4CCEA 2VOMA 3OGRA 1TPUA 3PUOA 3B0YA 1XLKA 1DE5A 3VCNA 3DC8A 4S3AA 1E0TA 2PWGA 4LWWA 1XH2A 4C6OA 1KBKA 1MXDA 2EQDA 4OECA 3O6AA 5AHIA 3UWUA 2QXWA 2TODA 2BB0A 4ZTXA 2YW4A 3KVMA 1XRVA 1HTIA 4ZO6A 4KCWA 3N3TA 1T8QA 1UCWA 1N8WA 3PHAA 3W24A 2DP3A 4GKLA 5K7JA 3AU6A 3S46A 1N2VA 3N2MA 2WCSA 4R5EA 3GH5A 4GYFA 1JZ2A 2Z1WA 1GJPA 2XH4A 1NWRA 2X0SA 3WDHA 6XIMA 3BAKA 5A94A 1ZNNA 4YLWA 3AZSA 3B8VA 4PN2A 2NWSA 1E6PA 2A3AA 1KWGA 5TIMA 1T41A 1VCFA 2ZUMA 3TH6A 5ABTA 4FR6A 2QZRA 4GUHA 4AFYA 5D9OA 3AICA 4ADTA 5DF0A 3R6IA 2H90A 5C7VA 4R53A 4N9EA 2A4AA 5H1WA 1NTHA 2E0PA 5CBJA 3TAKA 5B7YA 3ABXA 1TRDA 4MUZA 4IZGA 5I06A 3UQNA 4HHHA 1HIZA 3MY9A 1XKYA 2Y8VA 3FYOA 3NZ1A 3LX9A 1BWKA 3LRKA 1RJRA 1SZFA 3VD9A 3R8HA 1MSSA 2X30A 2FLIA 4JTKA 4LYQA 4IIHA 3L5AA 3UW6A 1IXNA 4QAIA 1E0WA 1DTNA 4ACYA 1WDQA 5J8LA 2CETA 1E1EA 1UWSA 3FOKA 3NSNA 4JIPA 3QRHA 4GI9A 5CJMA 9RUBA 3V36A 4PTXA 2ZX5A 1ADOA 4RL3A 2UY4A 3TV8A 3V1HA 3VNDA 4PB3A 1UR8A 4NJJA 3M47A 1QVBA 4ASTA 2PGRA 4GO8A 3H53A 4GHRA 1HZYA 1JUKA 2VX4A 3QR3A 5EY5A 2VTFA 2RJHA 1UWAA 4GUIA 3DFTA 3SUVA 3W7LA 3WLPA 1TKKA 1SW3A 4OWGA 2KZHA 3E1F1 1JL8A 1L8PA 4QG9A 1B90A 4ZL1A 4N7QA 1TCDA 3NPXA 3U2CA 3DC0A 2GL5A 1EBGA 3NXLA 1OIMA 4WOZA 1VFFA 4WGXA 3AO0A 2WM0A 5D4YA 5D2VA 3UJ2A 2GSJA 4P8XA 1OCQA 3R4IA 1RQHA 3CPGA 4UTJA 3UG3A 3PY2A 3ERPA 2C91A 1NOFA 3CS2A 1F3EA 3N15A 4KFNA 4AWEA 1E73M 4JTUA 1UASA 1FP8A 4O1BA 3WLNA 4LXFA 2JKPA 2CXGA 4FEZA 1UP0A 3WLRA 3KP1A 1X38A 1UKQA 3UY7A 1TUFA 1OM0A 1GPWA 4NILA 5BOEA 4JCMA 1GORA 1FHDA 4YTQA 4AU0A 2Y89A 2VGBA 4GINA 4P7NA 3QXBA 4HHPA 3DYMA 5ABGA 1ZUAX 1WDPA 1EQPA 3EPNA 3W7CA 3FDGA 1SZEA 1J0ZA 1PKLA 3F4DA 5KSWA 2DV0A 1LLZA 2EO7A 3MPGA 4W84A 3WQCA 3VMPA 3CZKA 4I9MA 2DZAA 4W8LA 3OIHA 3OBEA 4LS0A 1U83A 2OXNA 3LBCA 5K9CA 4R3UA 2CBJA 1KQYA 3CL7A 3E0FA 1HL9A 4MNJA 1YBQB 1QBAA 1VFOA 1HG3A 3NL2A 1I75A 2CLKA 2CZFA 3NURA 3ALFA 1HL8A 1EOMA 5PTDA 3SBFA 1TV7A 3W70A 1S3HA 5A8NA 1EX5A 3LCFA 3NQDA 6PTDA 1UROA 1OF6A 3W23A 4AW7A 4CD8A 2PPGA 1UWUA 1PEZA 3Q45A 5A2AA 2C1HA 2OOFA 3P82A 1UA3A 3ARXA 1ZB5A 3EOOA 1KM4A 1OC6A 2F2HA 3W76A 4CQDA 3LNPA 4JOMA 1FA2A 3AYRA 1WP6A 2O4MA 5EBUA 1J9YA 4MG4A 1PX3A 1V3HA 5IOBA 1ZGDA 5AYXA 2RUSA 2I9UA 4YMZA 2XVPA 4Q6JA 1SJBA 1OX4A 2MNRA 3N4FA 1OFQA 3OHMB 1UW9A 2ZXDA 1PIFA 2AQVA 6A3HA 3M7SA 3B3DA 3GDMA 3MUXA 1UYQA 4AEFA 3PG9A 4Q8PA 1NWSA 5LHFA 1MEWA 3NG3A 1DJXA 4PBEA 4GISA 1H62A 4OT7A 5I3FA 2FZ9A 1GJUA 3TQ0A 1VRXA 2E9BA 2ZRYA 3BLIA 4A6GA 3VIFA 3E02A 1TTJA 3EXRA 5EMMA 1Z32X 4H00A 4MAZA 4Y90A 3XISA 1TJ1A 4EX4A 3HA1A 2NQHA 1EWDA 3AHTA 3BOFA 2X1SA 4H9VA 3D46A 2QDDA 5BOOA 1RPKA 3EWWA 3S6OA 4BZYA 1VKFA 1LOLA 1EHNA 3P80A 2ZRZA 2ACUA 3VIIA 3G0XA 3QKZA 4FF5A 2ZZ1A 3CLMA 5BMXA 1CLVA 2FZMA 3W7MA 2ZUTA 5J5DA 2ZZ2A 1ICSA 5K9XA 2YJQA 3NIYA 1I2OA 3HPFA 3FAWA 1F73A 1RK6A 1S3TC 2DIJA 2ZADA 2CZ5A 1XLJA 1WUEA 4JX5A 3WLKX 1KFJA 3MMWA 2XGIA 2C7FA 1H2JA 2NXGA 2INFA 4QDMA 3BG9A 5DXYA 1WV2A 4MJZA 1IEQA 1W5PA 4FS9A 1V0KA 4F40A 1RBOB 4MAVA 4AZ7A 4C65A 1YHTA 3CM4A 1KM5A 4H04A 1DBTA 1XX1A 1XLLA 1FTXA 1V0MA 4M6PA 2QCHA 1LCOA 3FSTA 4GPNA 1HNYA 2R1NA 4JL2A 3HQ1A 3AHYA 1SJAA 3UXAA 3NYDA 4BS0A 4K7YA 2ZRWA 4WJEA 3GDTA 3LI1A 1XHGA 1PVNA 4XVDA 1PX8A 1NP0A 2HK1A 3UR2A 4L1GA 2G8ZA 4PGLA 3R94A 3BLLA 3SR7A 3AIUA 3F2BA 4QX4A 2XIBA 2Y85A 5FJTA 1XIGA 4ZCWA 4A8IA 4RR4A 1FWCC 3WL1A 2WPGA 1DJNA 1K02A 2R8WA 5D8WA 2ANUA 1G7VA 5EKYA 3MS8A 1TV5A 2UBPC 2J62A 2TPSA 1B0IA 2CWXA 2BVDA 3WX7A 1UR4A 3SUTA 1K6AA 2FZ8A 3SAZA 1EPVA 3BW3A 2GWGA 2FVMA 4YWIA 4YHGA 1UWIA 2FH8A 4JYEA 3GFZA 1KGWA 5C9XA 4JTHA 4Y9PA 4QSHA 4JEJA 5D2XA 4OBSA 4KWSA 2ICSA 1VRDA 1QPOA 2QGHA 4W5ZA 2WOQA 4IP4A 1XIDA 2GGEA 3K1GA 4S3JA 1Q6QA 1A0DA 3ALGA 1VBHA 5A8QA 4MJMA 4JQ3A 1W1ZA 3C2RA 4HCDA 2DT0A 1BYDA 2GSEA 3OVRA 2V2HA 3UG5A 3W53A 3KM8A 2V2CA 1GEHA 3W1RA 3TLLA 4GY1A 1FWAC 3SURA 5MF5A 4GWEA 4J3SA 2PTZA 3P5YA 4ZVJA 4Z2JA 3GHTA 1WZMA 2JE8A 3MSDA 3AALA 1ELSA 4I7UA 3ITVA 3T09A 5LGXA 1UH4A 1XC4A 2PDHA 4F0KA 1DORA 4A05A 3T7VA 4CEUC 5AC5A 2IKGA 3V35A 1RVKA 1H7OA 1PCWA 3KOZA 1E56A 2UV8G 4KRUA 4W7WA 4WDXA 1JCNA 2QCMA 4LJ3A 2PDWA 4K8EA 4NNBA 2QPXA 4GY0A 3HFTA 4XK2A 1F5ZA 1HKVA 3I7SA 1XGZA 2YSWA 3GXTA 1TPDA 3OJGA 3RMJA 1OGBA 2ZA1A 1VIWA 1M7PA 3MV01 3DFPA 5D2TA 1YADA 1QI5A 2CXEA 4LF1A 3KZPA 1QO2A 5GNZA 4DB7A 4ICMA 1BVZA 1LBLA 1TV8A 1UMLA 1XF0A 5TQLA 1G01A 3FFSA 2CLOA 1G9HA 3O6DA 2WYSA 1Z69A 3W1AA 3B9DA 4UTFA 3A5VA 3B97A 1NVMA 2XISA 4O11A 3DN5A 2WNNA 3OPSA 1IHIA 1CGUA 3O07A 3AYTA 3VDGA 2O7SA 2FKPA 3C86A 4O1CA 3LHUA 4FXSA 4J40A 1XYBA 3VIHA 3QTPA 1LRTA 5MKGB 3LK6A 4GO9A 2ATMA 2CC0A 1FWDC 4R9OA 4GGHA 4HNOA 4DO7A 2ZX8A 3B0VC 2XVGA 2EJ1A 5FEXA 1R0MA 3VE7A 1OG6A 1LBMA 1QOXA 5HMDA 4YCPA 3PZVA 2ABBA 3JVAA 4PMDA 5I3KA 2RDTA 3R8GA 1ISYA 2JEPA 1A5SA 2ZE3A 4D6IA 1V6TA 4PUUA 5JMUA 5BW6A 3WDIA 4IJCA 3B9EA 1UR3M 2OLAA 1RA0A 1VEMA 1SO5A 3B40A 3RGTA 1E9YB 4GD0A 4MPQA 1S1PA 2VL4A 3NZGA 5HQLA 1GK8A 1PL9A 1SW7A 2Y63A 2BXZA 3JUGA 3G0UA 1SSGA 2EF9A 3IPWA 3B9OA 1TWZA 5E9XA 3BAXA 1TPB1 4H8NA 1G4TA 5DMLA 3QBUA 4ZOBA 5BZAA 4X9YA 4XKMA 4L80A 1JPDX 4AHOA 3RCMA 3FJNA 2WQPA 4HHMA 1HKWA 2PDGA 1I2PA 4CU6A 4DPQA 4EE9A 2WJFA 3N2TA 4LEFA 3BWWA 2ZXQA 4XX6A 2XYLA 4N2YA 3TOPA 5BWFA 2QV5A 3P62A 4HU0A 1H1ZA 2ZA2A 3ZQ9A 1JUBA 3DOPA 5AYZA 1W8SA 4OV4A 1C7TA 3NQ6A 4M6VA 5DRIA 3CQHA 1LWHA 3U48A 2WO5A 4DWSB 4WJXA 2REQB 4PUMA 3D6NA 1O60A 3GHUA 4LF2A 2EG6A 3GNNA 5AHLA 4GRSA 1XIFA 1R3YA 3EKLA 4QJ5B 2NX1A 4EXAA 4E4FA 2PB1A 3BSGA 2FDSA 3NSMA 1EFZA 1KFLA 4CVUA 3CHEA 3L9CA 3WLTA 2PDIA 3UWZA 1XUZA 4FNTA 3BGJA 2QCGA 4QJ1A 3S5OA 2ZQ0A 2HS8A 1E51A 4XKYB 3F03K 4CNSA 1O95A 2ISWA 1A49A 2I56A 4J4KA 1Q4NX 4H2CA 4RXGA 1XCWA 1TV2A 4J2MA 1E0VA 1TV3A 4DXKA 3H4WA 2XIIA 4HD5A 5CSYA 3BW2A 5K4XA 4PB5A 1IF2A 1D3CA 3O16A 2C0AA 3RF9A 2YX0A 3GLCA 2E7FA 2A3CA 3V0SA 1LG2A 4TMBA 3U3HA 3QC0A 1YEYA 1P0KA 2EPOA 1MW1A 1DV7A 3LBMA 3A9IA 1J0HA 4YL2A 2PDMA 3CZLA 1J0YA 4DX3A 1GWJA 2Z24A 1VC4A 3NQEA 3P61A 3G8EA 5CZKA 5JU6A 2VDGA 3TZNA 2R1PA 5DMMA 1SZNA 4JD4A 4JHMA 4LS2A 3GU1A 3PUGA 3VOFA 5I7GA 1QNVA 3HTWA 3GFYA 4G1KA 1A5BA 4IGMA 5CKSA 3UYIA 2BX7A 3UCDA 2ZUSA 3ABOA 4YWSA 1YPIA 4GVFA 2BLEA 3MUAA 3QJAA 4HOWA 2XWEA 1I8JA 2CLIA 3TR9A 1BXBA 4HNLA 1CB2A 3A4WA 1QW8A 5F1UA 2YA1A 4WKAA 4GG9A 4LAKA 4M6QA 2E6FA 3HGRA 3ZT5A 2PODA 1VPXA 1NDZA 4JIEA 3MWCA 3DFQA 1TJ2A 1ONEA 2X40A 3IGXA 1PDZA 3I7QA 3EPOA 2AKZA 2Y7DA 3NPVA 1CGWA 3T05A 2IXUA 1X7IA 3EA2A 1M1BA 1A5CA 2JQXA 3M6DA 4ZXLA 1FHVA 1P0BA 4WJ8A 1TA3A 2VQTA 3VNZA 4F2TA 4O0QA 4O13A 4W7VA 3WD1A 3M43A 3B06A 4KGLA 2UY5A 1NWTA 4PA8A 1W3JA 2UY2A 2OSWA 1TJPA 4M1BA 5CPQA 1G4PA 3LUTA 1PYMA 1V7YA 2OX4A 4GJJA 3UBPC 3RRAA 4ZA0A 4GMEA 5I2UA 2WHJA 3R2GA 1NWUA 3CEPA 3W00A 4MB3A 1K8ZA 3CV7A 3QFEA 1TVNA 5EMKA 1QK2A 2D23A 3W7GA 3K2GA 1IZJA 3IJLA 3FLUA 3WQPA 1K8YA 4AMCA 3RG6A 3I6RA 3ANUA 4TX9A 4IF2A 3UXDA 1U1UA 2GJRA 3G1AA 5IDIA 1H09A 5J04A 3T2QA 4GXWA 1DWHM 3VDBA 4H9MA 4Z08A 4G2DA 2D73A 2XG9A 3EWUA 2YB1A 4DXXA 1XYZA 2Z1SA 1FKXA 4LYPA 3G6LA 1AW2A 1CGVA 1C8VA 5FKYA 2PDKA 3ES8A 2O9RA 2V68A 2W0UA 3VVGA 2PMQA 1EGZA 1D3HA 4R9XA 1EXPA 1MW3A 1Q7ZA 4MOZA 3GWQA 3IVTA 1J0IA 1VYRA 4TQTA 4LANA 3C8FA 1DJZA 1WKEA 3GNOA 4GOAA 3KOWA 5CSUA 1IYXA 1R3WA 1JQXA 4B91A 4D6HA 3SY1A 3MUIA 2V3GA 2YFNA 4MDOA 1KM6A 4O4WA 4M0XA 3G18A 4QM1A 4REQB 3ABQA 5DLCA 4FIRA 4QBXA 4QFUA 4H7CA 4ZB5A 4JL1A 4LVGA 2VQUA 4Z2HA 1EPXA 3W2NA 2WQDA 3CIXA 1EJXC 4Y96A 2HXUA 2BY0A 3KS6A 2IPWA 2E67A 4RJEA 1VFLA 2PGFA 1EX1A 2J74A 3GC2A 5HANA 2DQXA 1NOUA 2FHBA 1HO4A 1KM2A 5FL0A 3CHDA 5LIXX 4GUFA 1GOQA 1WDDA 5EGRA 1QJWA 4O8RA 4X63A 1XQLA 5CZSA 3U57A 2FTYA 3E9AA 1B3WA 2CZVA 3FXYA 4HMNA 3KW3A 2ZUWA 3DFSA 3PZQA 4OIFA 1NY1A 1H41A 3R8RA 1RH9A 7ODCA 1OGGA 1SZGA 5A8MA 2Y24A 1T0OA 2NLYA 1JFXA 4HPJA 2C3ZA 1BYAA 4Z2KA 3VX1A 1LJYA 1S46A 1UD5A 1E1FA 3WBXA 1QK0A 3L0NA 3M41A 3BLDA 3ECQA 4JHOA 2WWDA 4DWSA 1EJVC 2REQA 1LM1A 2RDXA 1OFBA 1CXKA 2PLMA 3BAJA 1JUEA 3VO0A 2VP8A 3H2CA 3SB0A 1CLXA 1IXQA 3AMDA 1WZLA 2A3EA 3GUWA 3QR1A 2VELA 3N04A 3V0UA 1Q85A 5AC4A 1PUDA 1VFHA 3VIOA 1GVFA 4FXFA 4WK9A 2A0NA 3KOYA 1JYVA 2J6XA 3CUHA 4XKYA 3VKAA 1XPYA 2PBGA 3C0JA 2OLSA 2VZTA 2CNCA 1SJDA 4JTAA 3S5YA 1TX2A 3AIRA 3N17A 1MMFA 3SN0A 4AC7C 3NM1A 3OZYA 4HNCA 4B4FA 4C5ZA 4AIOA 2YYUA 3VOGA 1PPIA 2WJDA 1BVWA 1ICPA 1VENA 3BURA 3ITCA 5CPSA 5JBDA 3TE9A 1UD6A 5D2YA 1L8NA 3N4AA 2W5FA 4RNHA 2Z7KA 1BQCA 1XBZA 4J3ZA 3TTSA 4BFAA 2P76A 1MXGA 1TVLA 2AOSA 3EMCA 3CV1A 1WA3A 2P53A 1QI2A 4F48A 3UJFA 3MP3A 3SDOA 5I00A 1E3ZA 3CZGA 2GFTA 4H2HA 1J79A 4BA0A 2GGJA 1JCYA 3T8QA 3UFYA 2NW0A 1W17A 3PULA 3NPUA 3R11A 4P7OA 3WJWA 4AVNA 2E25A 1M03A 1KM0A 4C6KA 2I14A 3EEZA 3TUUA 2PBOA 4HB7A 1EH9A 2HBXA 1VCGA 2XH2A 2DVUA 5DCEA 4JTRA 4PRWA 2GSHA 3ENLA 3L2MA 1ECQA 3TYBA 1E6NA 4YCOA 1NAL1 2HEJA 2BHUA 2OZ0A 4YN5A 1OFDA 1V8EA 4GQBA 5KZEA 4IMGA 2CLPA 1S2VA 1I6NA 1TWIA 3SCOA 3N73A 3CUGA 3A12A 2C0HA 1EIXA 1F74A 1KLYA 2EHHA 4G7FA 5A6JA 1GOIA 4A8RA 3FW6A 2XSBA 3SGUA 2IQ0A 1LUCA 2ZZ6A 2BS9A 4LAOA 3VKBA 3K4DA 2TMDA 2F84A 3MKCA 1TIMA 1EYWA 3VNYA 3BE7A 2WMKA 1SJCA 1XLGA 3Q94A 5LSMA 1EJUC 2DDXA 1SUXA 3RILA 3SY8A 5LA2A 1GUVA 1GKPA 1I0DA 2DIKA 2QV4A 2V2DA 3MANA 4ONVA 3SZ8A 3KVLA 1HJVA 3S47A 1PZ1A 1PZ3A 1SR0A 3TFXA 4BQ5A 1JF6A 1GQLA 1EDQA 2Y88A 1KO0A 1FWNA 4URIA 5AVNA 2TRSA 2J66A 1PS9A 3HPAA 2Y5EA 1R9XA 3QZ6A 1RD6A 3AHXA 1W1YA 3VC5A 4ICCX 3ZJKA 4TVDA 4DXVA 5I07A 2O9OA 1G69A 5KETA 2XN0A 4C6FA 2GVLA 3JZUA 4GH1A 1LL6A 3BLOA 3L5LA 2XZ9A 3GDRA 2VZUA 2V5DA 3BICA 5CBIA 1C29A 3WD3A 1SQ7A 3IVSA 1GTHA 5I3IA 4ZSTA 4REQA 2CLMA 1QOPA 3ELFA 4HGXA 1J11A 4B5SA 2PDLA 1LDCA 2IKIA 2NWRA 1Q5MA 4F9JA 4NYUA 4FOJA 3RYSA 2WMHA 3LHZA 2ZWZA 1L9WA 3AMLA 4IMCA 3HG2A 4NKCA 2GUUA 4ZOAA 4L61A 3VCRA 1XSKA 3T2PA 4HOXA 1NARA 4GFIA 5FJRA 2QJIA 4GX8A 4V15A 3KRZA 5FIPA 2PF0A 4TV6A 3E2RA 1FX6A 1UOZA 4DUOA 1A5KC 3B05A 4V33A 1EJSC 2FIQA 4ZTYA 1IT0A 3ZWTA 1CGTA 3FGCB 1TRIA 1PWLA 2V9DA 1MXSA 3P6LA 3TN6A 2ZICA 1AJ0A 1KC7A 5HR6A 3BJFA 1I2RA 4AD4A 3UEQA 3WDJA 2WXDM 3WNLA 1OWQA 3FV9A 4MKNA 4XZLX 3CHCA 3AMKA 4F79A 3GTNA 3N9SA 1AQMA 3NWRA 4NSBA 1SGJA 2PSNA 3ZJ8A 3HMCA 2PURA 3HJZA 2FGBA 3QV6A 1W3KA 5G4WA 1TMLA 4X22A 1XV8A 4X0NA 1R2RA 1M53A 3E0LA 3TSMA 1FWHC 3N12A 3SUWA 4AD3A 3IGUA 1FWBC 3LS9A 4FX8A 3BCDA 4GVHA 3DU0A 5FEPA 2A79A 3GW3A 1ZLPA 2GOKA 2BVTA 3MJYA 3M7WA 1D7FA 1BG9A 5KZMA 4INFA 1TWDA 3C6CA 4BI5A 3W02A 4IH3A 3GK0A 3PFRA 1O68A 4U3AA 3B4YA 4N4QA 1QMLA 3TJIA 1CYGA 1B9ZA 3EDEA 2RJGA 4K6AA 1TVPA 2DZSA 3ZZ1A 1S2WA 4TOQA 1ODUA 4A4AA 1AJZA 3IARA 5CSSA 1XIHA 3QEZA 4Z1YA 1LT8A 4KIRA 3OHIA 1CNVA 1ZJBA 2PP3A 3S2LA 4JKMA 4GNVA 3TJLA 3RFAA 2ZRXA 3LTSA 4LVDA 5CEWA 1J0JA 5A8OA 3MUCA 3OA3A 3BV7A 4FLSA 2PE4A 3MHUA 4O1FA 2V30A 3AIBA 2XFRA 4C1KA 4M80A 2DSVA 3PPFA 3RPTA 3WF0A 1W37A 1W5MA 5TNVA 1NIUA 4A35A 1M7XA 4S23A 3VKDA 4KMQA 2WLZA 2JKEA 1KKOA 3L4VA 2A3HA 3LGGA 1QHZA 4H9XA 2Q71A 1WB0A 2P1FA 1BHGA 3DCPA 3RK8A 1Z3NA 4L4MA 2EG7A 1LOSA 1BGAA 1W1IE 2E09A 1H11A 1I2QA 3G1FA 2DZWA 4BHYA 2OVLA 1VBGA 2CEQA 1VB9A 1HKMA 3S3GA 3WH6A 1H4PA 2E4TA 3I68A 4I9AA 4GIRA 3UNDA 4O12A 1B5TA 4AZHA 5F7UA 3GXFA 3GKFA 4DY1A 3L4YA 4JY8A 4JTIA 5AHFA 3OOQA 2NQ9A 3WLIA 3ZR5A 4LFYA 1VD6A 3DHPA 1RK5A 3QHNA 1R46A 4MPKA 3T0TA 2YBTA 2RKXA 5DT7A 2XGBA 4N4PA 2J7BA 5HATA 3WF2A 3I65A 4IMDA 2VR2A 4HYWA 1RJQA 4FO4A 2XVKA 1KNWA 3H23A 3W6YA 3SRHA 3GE7A 1G1YA 4TMCA 3ARQA 1W9XA 1V3LA 3ME3A 3ZT6A 1WE5A 2J7EA 2D0FA 4Q4QA 3K8LA 1R7AA 1DHPA 2DIEA 3BMXA 1GVQA 3CWNA 2JGQA 4BF9A 3M5ZA 1THFD 5HUOA 4ECLA 4HN8A 5ABFB 4IG2B 4LV9A 4A21A 1K7EA 6CGTA 3I7RA 1ZP4A 3BH4A 5BXSA 3COTA 1NDWA 2VXNA 3VKCA 4LV4A 1DQUA 4WIWA 5J5RA 3MHFA 2A85A 3UPWA 1E5NA 5A8PA 5I77A 2NUWA 3NQCA 1VBUA 1ITQA 1TR1A 5K4ZA 3BV4A 1O4UA 2I7GA 5HMEA 4MB1A 3NA8A 1FCBA 3CAQA 3KDOA 3O3RA 3UU0A 1XRFA 4QITA 3PFMA 2V63A 2EPKX 3N11A 4JFTA 5BXRA 1KGUA 3W7KA 3FSUA 2J79A 1JCMP 2VEKA 2C1IA 3O15A 2FFCA 3S1GA 3STCA 1A4MA 4MLJA 3MBFA 3MSYA 4V1XA 1QASA 2CERA 4KEMA 4QTGA 4Z0SA 5I3HA 4ES4A 1L0PA 4FF7A 2RFGA 4QR6A 2QLYA 4S39A 3GNRA 4OQVA 3LOTA 3JR2A 3SQMA 1MW0A 4DJFA 4HPNA 2Y7GA 3P93A 3TW9A 3VGBA 4QCFA 3ABSA 2W27A 2AMGA 1A3XA 2FB3A 1S2CA 3RAOA 5G2WA 3GS6A 1LWJA 1CXLA 3EMQA 3AYVA 4M82A 4S3DA 2ZBTA 1W1PA 1FWTA 2XSXA 1BF6A 2BWGA 3WQWA 4DBSA 3E2QA 1DXEA 4WDWA 5CC6A 1RALA 4ERAA 4IX2A 4IQLA 1QAPA 3MKKA 3Q4DA 3VNKA 2EKCA 3TYDA 4DJEC 1XS2A 2GZXA 1TSIA 4JYFA 5EMUA 2NQ5A 3O6YX 1P6CA 1S5NA 2XDFA 2QVHA 2P8BA 3MMTA 3ISIX 3C61A 1VFUA 1K8XA 4Y6GA 3RLHA 3OLGA 4FX6M 4J3UA 2EG8A 3RX3A 1GJWA 4YVPA 2WZTA 3TEVA 4IGSA 3L21A 3NOYA 2OWXA 1JI2A 3TK7A 3NYZA 4G7EB 1FDJA 3BK0A 5JQ9A 4OJYA 4GA8A 4EIVA 4L64A 4RV3A 4IPIA 1RXOB 5HJXA 1B4KA 1BYCA 4GIYA 2X1IA 4GJIA 4LRTA 4GBDA 5M5DA 3UD6A 4AYSA 3W85A 3W7IA 4MUPA 2V5CA 3V4BA 4AZGA 1ME9A 1NM9A 3AU2A 2FH6A 3IVUA 1EP2A 1T99A 1WNOA 1GT8A 2C6QA 1ONRA 3VABA 2DGAA 4HYRA 1H1YA 3PWIA 4HK7A 1UWRA 4K8HA 4QE4A 2DQWA 2MUCA 3FIGA 3N34A 3GD6A 4BCEA 4AMAA 3H8AA 4ZE4A 4LUSA 3DI1A 5BROA 1K9EA 2PTWA 1IWAA 3CO8A 3EOLA 2W4XA 3KLLA 2EKGA 4D6CA 3VNMA 3PZGA 3QW4B 4C6BA 2EGZA 4C60A 3ITOA 5BYWA 1XIEA 1R3QA 1LL7A 2B7NA 3ATYA 1T6MA 5REQB 2BVWA 2WSRA 5FESA 2PWDA 2XIQA 3O8AA 4HTYA 4UTTA 2BBFA 3TW6A 2A6LA 2XINA 3N6HA 1M9HA 5H8UA 2PTDA 4MY8A 4HK5A 2YXOA 1SSDA 5F2IA 1GKRA 4JTTA 1V3MA 2X8RA 3ZVIA 3N18A 4LW7A 2XGZA 3TTOA 5D32A 2CCRA 1CGXA 1XPGA 3BLPX 8XIMA 3RHGA 1HF6A 4B5UA 4B3LA 2WC7A 3GFXA 3CHVA 4N9DA 3R89A 1TE1A 3QQWA 2E1WA 1J0KA 1XIMA 2GYIA 5LNSA 3LQGA 1AUSL 4JN8A 4JDBA 1VP5A 1NOWA 4D6GA 1WQ5A 4Q8TA 1KCKA 1W32A 3GG1A 1VHNA 3LHTA 1K8CA 2EPMX 5C9RA 3L12A 2VZOA 3VNIA 1GVIA 4OZOA 3T08A 3TWBA 4BK9A 4JIIX 4ADUA 3I10A 1JZ3A 3W4RA 4GC4A 1EBHA 6REQB 3OZMA 1EOKA 5C7HA 1HKJA 4IMFA 3OZOA 4DM2A 2OWWA 4HNVA 4YHEA 3B8UA 3V7PA 3TYEA 4H9TA 1X6UA 1YX1A 3VZXA 3RM9A 4R7OA 1MFVA 4AVFA 4B2DD 1DQXA 3GYEA 1GPFA 3RO6A 4O50A 2UY3A 2F2KA 2Z1VA 3NDYA 1QWKA 1BAGA 4EOUA 2CFFA 4B16A 3BTNA 4KKXA 1QNSA 3AOFA 1UUQA 3BCJA 1FQ0A 1UA7A 5ABFA 5U7SA 3LY0A 4IG2A 4XAPA 1SR9A 3ANVA 2YOCA 4IMEA 4UZSA 1D8CA 5FSDC 1XDLA 1XLMA 2CBIA 3LCLA 4D1IA 2V3FA 1MDLA 2FZBA 4H8HA 3CPRA 3AROA 2QW5A 1JRBA 3U2OA 3ARRA 3G1XA 2GQ9A