4JQ1A

Akr1c2 complex with naproxen
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
316
structure length
316
Chain Sequence
KYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C2
publication title Structural basis of NSAID selectivity for the aldo-keto reductase 1C family
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 117
structure length 316
sequence length 316
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4jq1A00
2HE8A 2FVLA 3V36A 4H7CA 3BV7A 3ONBA 1PZ0A 2PDIA 4AUBA 4WDTA 1PWMA 4YS1A 2IKJA 2PDXA 4JQ4A 1AH4A 3BCJA 2IKIA 3WBWA 4IGSA 4PR4A 2WZTA 2ACQA 3LUTA 1C9WA 4PUWA 4JTQA 3UZXA 1MZRA 2IKGA 3V0TA 3LN3A 2IPGA 2IPFA 4JTAA 3WBXA 3B3DA 3DOPA 2PD5A 3R8HA 3FJNA 2PDCA 4L1WA 1YNQA 3O0KA 2HDJA 2FZ8A 4JIRA 3QKZA 1ZGDA 4YVPA 4RPQA 4HMNA 4XAPA 2I16A 4DBSA 2I17A 1X97A 1PYFA 2PF8A 1UR3M 2F2KA 5JH2A 2BGQA 4XVDA 3UZZA 1OG6A 2IS7A 2AGTA 2IKHA 4EXBA 2PFHA 2HE5A 3CV6A 2INEA 1J96A 3M0IA 1IHIA 3R7MA 3WCZA 1VBJA 3H7UA 2PDQA 4WDUA 5LIUX 3ERPA 3LEPA 3BURA 1XF0A 3KRBA 2FZ9A 4FZIA 3R94A 4WGHA 3CMFA 2ACRA 3G5EA 2PDGA 2IQDA 4JIIX 4H8NA 1RY0A 2ACUA 1EXBA 2PEVA 3COTA 1MRQA 1EF3A 3LZ3A 1EL3A 2R24A 4QXIA 2ISFA 5M2FX 3N2TA 4ICCX 5AZ1A 2PDMA 3BUVA 1R38A 3EB4A 1GVEA 4GA8A 1Z9AA 3H7RA 4FAMA 1FRBA 4JTDA 2DUXA 3M64A 3UGRA 4JQ3A 3UWEA 5HA7A 2P5NA 4XZNX 3CASA 1Z3NA 2HVNA 1T40A 3R8GA 2FZBA 4JQ2A 2CLPA 4XK2A 4GIEA 2C91A 1Q13A 4GQ0A 3GHRA 3R6IA 4XO7A 1RALA 1S2CA 4GACA 3LBOA 2DV0A 3CAVA 5JH1A 3Q67A 4XZHA 4L1XA 2PDPA 3V35A 2PDKA 3D3FA 4Q3MA 4ZFCA 2FZDA 1S1PA 3GHTA 2HVOA 3LZ5A 3MC5A 2PDUA 1ZSXA 3EB3A 1HQTA 1LWIA 1YE4A 1AH0A 2FGBA 3CAQA 1X98A 2PDYA 4QBXA 4QX4A 3R58A 4JTCA 3LD5A 2INZA 1A80A 2A79A 4FALA 4LB3A 3S3GA 2VDGA 3LQGA 4HBKA 1JEZA 2NVDA 1LQAA 3LENA 3WG6A 1PWLA 3GUGA 2WZMA 3CV7A 3Q65A 3V0UA 1S2AA 3G1RA 4PRRA 2J8TA 3M4HA 4GABA 1YNPA 1S1RA 4R9OA 5HNUA 5AZ0A 4I5XA 4MHBA 3MB9A 1AZ2A 1XJBA 4WRHA 4DBWA 1ADSA 2PDJA 4XVEA 3U2CA 3C3UA 4JTRA 1SM9A 2HV5A 4LBSA 3UZWA 4DBUA 3UFYA 1QRQA 4Q7BA 1EKOA 1AH3A 2QXWA 4JQAA 3GHUA 3LNMA 4WDWA 3UYIA 1PZ1A 2ACSA 3N6QA 1Z8AA 5LIYX 2PD9A 2PDWA 4OTKA 1T41A 3LQLA 4XZMX 2HEJA 4DZ5A 2PDBA 4EXAA 4ASTA 3H4GA 3P2VA 2DUZA 3ONCA 3NTYA 3T42A 2IPWA 4PRTA 4FA3A 2ALRA 3FX4A 1IEIA 2BGSA 4QR6A 3R43A 3GHSA 1VP5A 1Q5MA 4G5DA 3V0SA 2IQ0A 2PDFA 1HW6A 4IJCA 4NKCA 5LIXX 1MI3A 4XZIA 2IPJA 4LAUA 4YVXA 4XO6A 4IJRA 1AZ1A 4JIHA 2PZNA 3DN5A 1US0A 1ZUAX 5HNTA 1QWKA 4PUUA 3VXGA 5LIWX 2BP1A 5DANA 3UZYA 4F40A 4LB4A 3F7JA 3EAUA 4YVVA 1RY8A 4GQGA 3WBYA 1Z89A 3UP8A 2PDHA 3O3RA 1AFSA 1YE6A 4GCAA 2NVCA 4PMJA 4LBRA 2PDNA 4YU1A 1M9HA 5C7HA 4JQ1A 5KETA 2F38A 3RX2A 1K8CA 2PDLA 1X96A 4XZLX 5LIKX 1ZQ5A 3UG8A 4WDXA 2R9RA 1XGDA 3RX4A 4WEVX 4LAZA 3RX3A
chains in the Genus database with same CATH superfamily
1XYFA 4UTTA 3V36A 1TQJA 2F6XA 2Y85A 1PB0A 2XM2A 4H7CA 1PZ0A 3EX3A 4GUIA 2XIIA 2CHRA 4FP1A 3RJXA 1TA3B 2YCLB 3SRKA 1G1YA 4KIRA 3GKFA 3K8MA 3WNNA 4I3GA 2C1GA 4RV8A 1WOBA 2CLLA 1YHTA 1OZMA 3BANA 3O2LA 2X7WA 2DSUA 5FJUA 3SJNA 2W5FA 3QPZA 4LUIA 3PB0A 1GZGA 2EGZA 5D05A 1QO5A 2AAMA 2WANA 3QN3A 1BF2A 3RO6A 4Q8MA 1XLGA 2ZX9A 4QEEA 2NQZA 2E9BA 1X39A 4PFHA 5HMDA 2I17A 3ITGA 4CCDA 3WNLA 3N17A 3GR7A 2F84A 3N34A 3KUMA 1RV8A 3HG4A 5C2CA 3HPSA 4ACZB 5JH2A 1XC4A 2O0TA 3TWBA 3OBKA 5IDZA 1KM5A 1WAWA 4DAFA 1BF6A 3BZGA 3UCCA 3AYSA 3N19B 2XN0A 3WFLA 1V8EA 2BMBA 2OOGA 1BGAA 4CUCA 3SM0A 2CWNA 4QFUA 2DU2A 1F7BA 3BW3A 3BVJA 3ZLHA 3PTMA 4Q8VA 3LTYA 1GVQA 3KL0A 3L67A 4GZIA 2NV2A 2AQVA 3ZJKA 4GBUA 3V5FA 3VE7A 1RAKA 1EQCA 1BGGA 4CNTA 4ZO6A 3A47A 3CMFA 3VNYA 4YHGA 4A8NA 1GCYA 2JGYA 4UTKA 4MB5A 1XIBA 3ALFA 2C15A 4ALDA 3PR2A 3CIWA 4U33A 1VQTA 3ITTA 3FNDA 3LK6A 5RUBA 5CC6A 1MQQA 4W8AA 3GSMA 4UQEA 2VFFA 3MV11 4MF4A 3M64A 1TWWA 3H4XA 1P1XA 4UB9A 1YMYA 1AUSL 4QEHA 3EWXA 4PTMA 1OFBA 3NPUA 1AMKA 4PB3A 3SEPA 5C2GA 3N2CA 4GIEA 5FAJA 4GACA 5I07A 1FXPA 1OY0A 2XFWA 3DENA 3MI3A 5C2XA 1VZWA 1UKQA 3TJXA 3MZNA 1PTGA 3LLFA 2Z1VA 3JUGA 2PDPA 5AYIA 3N9RA 4HQVA 3LV6A 3WUGA 4HHMA 4TX9A 5CGTA 1MMFA 4S3JA 1XH0A 2YBVA 2X1IA 4AVFA 3BW2A 1DWHM 3RLUA 1QATA 3OW1A 1FUYA 3H24A 5DT7A 4GISA 1KXTA 1RCQA 3HMCA 1VIZA 5E0CA 2PC8A 4FIRA 1CGYA 3NWRA 4WJXA 1A0CA 4JS3A 3T81A 3UWYA 1FXQA 4TXEA 2G97A 4M80A 4GZEA 4M29A 2BSLA 1H62A 3WLHA 4MG4A 4YPJA 5BWFA 4JKLA 3N11A 1PX4A 1G5AA 4D71A 4PC8A 3TC3A 1I75A 1CLXA 4GBDA 1GZ1A 3EDJA 3WQDA 3ABXA 5CBIA 3W74A 4TX6A 3P8JA 4MWAA 4BK9A 4HK7A 3RILA 3FDGA 4NZFA 3FGCA 5J5DA 2GWGA 2E1DA 2ZRYA 3WIJA 5AZ0A 1HL9A 3BSGA 1XYLA 2PTXA 5HPOA 3K4WA 5JVLA 1G4TA 2CLFA 2VGBA 3EOOA 1V6XA 1VPXA 4AMAA 2V5BA 3KVLA 4L5ZA 2NQJA 3RNDA 1DEDA 4PBEA 3HPXA 3HO8A 3KE0A 3VFCA 2JK2A 1QPQA 3L5MA 1NOWA 5HJXA 5LGXA 1DJNA 3PF3A 3GHUA 1WXZA 4AZGA 4LVFA 2NSXA 4HOWA 5LYRA 8XIAA 1DTNA 3HFYA 3O6DA 3WD0A 2VYOA 1YYAA 1Z8AA 1PJ9A 3W7JA 4CN4A 3WMBA 4XZMX 3VM7A 2EJ1A 2Z1SA 2V5DA 3L4ZA 4RCXA 2DZXA 3NTYA 4K1GA 4WSHA 2IPWA 4NXKA 1REQB 1ODUA 2OSYA 3PK7A 4FA3A 2WO5A 3BG5A 4Z0SA 5E0FA 5CJMA 4H2HA 4HPHA 4IWWA 1SZRA 2BGSA 3BAXA 3CZJA 4NJKA 3A4WA 2BHZA 4DYJA 1CECA 1I2NA 2IQ0A 3GKAA 1GOWA 1O5RA 1QHZA 1RBOB 9RUBA 1MFVA 3A6OA 1A0EA 4LAUA 2PWGA 3VAVA 3GDTA 2DT1A 1Q66A 2YFOA 5CSSA 3TFCA 3THUA 1WZKA 1EHNA 1UW9A 1US0A 1XH1A 2DDXA 3P7YA 5HNTA 1XRVA 4DVOA 3C5QA 1SFSA 2J7CA 5LIWX 4LGXA 3WLQA 3U4AA 2GK1A 2NXHA 4BHYA 3W27A 1WKEA 4PCNA 3T44A 1Q4NX 2PA6A 3UWZA 3SQLA 2ZC1A 3LPOA 1E70M 4FNSA 3GTFA 1VENA 2PSNA 4LEQA 3TN3A 3ITCA 4V1YA 4S3DA 5C7HA 4WQ6A 1A3XA 3UR5A 3M1ZA 5E1QA 2WK2A 1TTIA 1IZJA 3HQPA 1ZQ5A 3AU6A 4UMCA 4IP5A 1HJVA 5LNWA 2ZFAA 4FXRA 1B4EA 4GG9A 4M51A 2C7FA 4F0KA 4NYYA 2A7NA 1OX5A 3SN1A 4OV4A 4QE5A 4ZQCA 4HNOA 4GJJA 4AVOA 1KM2A 2P8CA 3KP0A 2MANA 3STEA 4HD5A 3LXAA 3NQ8A 5DXYA 3XINA 1RBAA 3Q37A 1FKXA 3QMRA 3N29A 3HFTA 1QNSA 4URIA 3FSUA 1CWYA 4JTQA 3UZXA 1LUCA 2JKAA 3ARTA 3TTOA 5DLCA 2WNQA 4JYEA 3I4KA 1TE6A 2VWTA 5HQLA 3UU0A 2VD8A 5E0KA 1A5NC 4X9SA 5IBXA 4TVDA 4N4QA 3CQ0A 4L1WA 2V5KA 2XVNA 1H5VA 3DXIA 2Y0FA 1LRNA 3KL3A 2ADAA 1UR0A 1XG3A 1UKSA 4FX7A 3UR8A 4KCTA 5GJPA 1W56A 3G1XA 3VVGA 3LRLA 3WEZA 3IJDA 4O11A 1HVQA 2PBGA 3ME3A 3TR2A 4ATWA 1VEOA 1W8GA 4CEUC 1DJHA 2RAGA 1KCKA 3S47A 3WLTA 1RR2A 1SR9A 1XSIA 2VDHA 2I5GA 1VBJA 4INFA 1WE5A 3NZGA 3NVDA 3EZ4A 3K46A 1DIEA 1V79A 2YW3A 4ZOCA 5AC4A 3P82A 2HPIA 5GNZA 4H9YA 4E2DA 3G1AA 1FQ0A 1R47A 4FZIA 1LRTA 1F07A 3G5EA 3QZ6A 4DXXA 5C9WA 1KV5A 4LW7A 2V0TA 5I3GA 1R0MA 1B30A 4V1XA 1OGSA 4L6OA 1JDAA 4Z42C 4TTUA 1EXPA 4WKFA 2OU4A 4Q6JA 3L4VA 4C1NA 1HG3A 3WX7A 4MZYA 2WV8A 1M41A 4MY8A 3EB4A 2H6RA 3G6MA 1U2YA 1E4MM 5TBOA 2QV5A 3UGRA 4IPLA 5HA7A 4GD0A 3BOXA 2W66A 4XD4A 3KTXA 4L4OA 4L56A 4GGBA 3WQGA 3PBVA 1MW2A 5A8GA 1QCWA 5EMUA 3ZOAA 1ZJAA 1MNZA 1BRLB 2XINA 3S9ZA 4W7WA 1KBLA 4QG6A 4B5XA 2CW6A 1TMHA 5HMSA 3GNRA 3NSNA 5H8MA 2PP0A 2E5CA 3QZAA 1KR0A 1DXIA 2B31A 4Q3MA 3T7VA 1WDSA 1V02E 4C7GA 3HMJG 4NRSA 3LZ5A 3OYXA 5D9OA 1YE4A 4MNLA 5A2BA 3CZLA 4G56A 1DIOA 3QQWA 4QM1A 2GVLA 3UF9A 3MDUA 3LOTA 1LBMA 3GX9A 2I7GA 1H63A 3Q4DA 5EKYA 1WX0A 3GXTA 3O15A 4F3HA 3N14A 1K9DA 1O66A 4JTCA 3MCOA 1JPDX 4A2SA 5LSMA 2WKJA 4HOZA 2PRMA 2OLHA 1J4EA 1DQUA 1PIGA 4BA0A 3L68A 3IACA 4S3EA 1UQZA 4WF7A 2A85A 3AXIA 5KTLA 2P8BA 4TVCA 1OQFA 2NVDA 1HKMA 1LQAA 1IGSA 3M47A 4HU4A 4ONVA 2WZMA 5DMMA 4FLSA 1IIGA 3V75A 4S3KA 1VBHA 4H7VA 4DEFA 3PPHA 1E15A 2HBXA 3N4AA 4OBRA 2Q8XA 3STGA 2CCRA 3KFTA 1PZ2A 1CB7B 2EJAA 1EJXC 2WVSA 3U2CA 4IUOA 3K4DA 1CPUA 3DHPA 1M03A 4QDMA 4OU1A 3OB8A 3S1GA 3WBEA 4RXFA 1SZGA 5D03A 3L2IA 4GIAA 4H8UA 1RPXA 1VYRA 1QU4A 1R3TA 3H8AA 1JPHA 3T9PA 3PZNA 3LHUA 5CPQA 1BPLB 1OSEA 4OTKA 4B16A 2HJPA 3LHVA 2VR4A 4RDZA 3H21A 4O53A 1QWGA 3HZ3A 1VAHA 3RCNA 1XLIA 5HULA 4BR1A 3CQKA 1W9VA 1LTDA 1JG9A 3MSRA 4DZIA 4MFDA 1BYBA 3B0YA 1IEIA 1YNYA 4WJEA 3VD7A 2BLEA 1VYPX 4AWEA 1PO9A 2C13A 4DJDA 1GHRA 2D24A 2PDFA 3OBEA 2PLMA 4O19A 5ABFB 1W3LA 2V68A 1FWAC 1E3ZA 2BBFA 3P84A 3BJFA 4QJ3B 3UWVA 2VZOA 1GYNA 1ZUAX 1PL9A 3RYSA 3MTWA 1IXPA 4PUUA 5DANA 1MQPA 3MCNA 1GQNA 3WEOA 1E56A 4ZO8A 4YHEA 5D9MA 2CWXA 4DF2A 1E40A 4Q8UA 1YE6A 2YL5A 4FI4A 4IQEA 3NYZA 3TDFA 2J6VA 3SCOA 2VEKA 4AYGA 4F0HA 4RJEA 5T9BG 1BWKA 1AODA 1PKMA 2NXGA 3AIRA 1NEYA 1SU5A 4D1JA 1KBIA 2YCJA 3S9YA 4PUEA 3N13A 4LY8A 4XAFA 1FWJC 1W3NA 4GVFA 3FY1A 4H9TA 3ITOA 3K5XA 1WAUA 1DJGA 4D9PA 2IKJA 4G7FA 4YTQA 3T0CA 3PBMA 4DNMA 1R87A 1VR6A 1UP0A 3GW0A 1JRCA 4A3RA 2DVTA 3SIZA 3UJFA 1OCNA 2QVNA 1RSCA 1E5NA 4UTWC 2D73A 2WNNA 3C2FA 4JTIA 1ZBCA 3DC8A 2F6KA 1DJQA 1JYXA 4CD8A 3PFRA 4KCVA 3CLMA 1UR8A 3CUXA 4LEFA 1OVDA 4JTEA 1UD2A 4XAZA 2CZFA 3QKZA 3VDHA 3B4YA 1UP3A 3NO1A 2QDGA 1B9ZA 2QCHA 2QDDA 1F05A 4JZ5A 1TJ1A 1XRSA 4O1EA 4MIMA 1H09A 3CZGA 1OG6A 3H26A 2H9AA 3W7QA 4M19A 2E68A 1Q6EA 3RIKA 2ZRZA 3TYZA 4QDPA 2J88A 1T6MA 4QS6A 4XUGA 3BE7A 3OQEA 3UT0A 3RRAA 5I0DA 4IM4A 4GQQA 5FACA 3WYZA 3G3DA 4US5D 1JUBA 3GG0A 5CJNA 4BWLC 2V2CA 2RFGA 1EF2A 1WO2A 2D23A 1U1JA 3VCNA 4GX9A 2DQWA 4C7DA 5DRCA 1NFPA 1C93A 3V7PA 2OJPA 4XAGA 3R4IA 3GIQA 1KBBA 2ACRA 3QYQA 9XIMA 1H0GA 1TV4A 4UTUA 5G4WA 1EHAA 2F6UA 5A1AA 2WC7A 1EPXA 3VIIA 3MP3A 4J40A 1H41A 2PU0A 1MEIA 2ISFA 3GK0A 4RKAA 3M0JA 1PX8A 4DJED 3S6OA 3NQ2A 4LCSA 3EMQA 4FXSA 4TU1A 3FXYA 4UR9A 1GVEA 4GA8A 2BY0A 2WQPA 4F8XA 3MA8A 1HJQA 3PSWA 6REQA 4E4PA 3VK5A 4BQ5A 3F1QA 3KOFA 1OFAA 5DFAA 1EGMA 1LP6A 5K9CA 3UESA 5A6AA 3VUSA 3CASA 1TG7A 3NIYA 5CG0A 1T40A 2WZIA 3VPLA 3OLGA 1FP8A 4IL0A 1PTDA 3S2MA 5XIAA 4DAIA 3CU2A 4AZ7A 3F2CA 3OHIA 3W75A 4AEFA 3R0KA 5HMFA 1RCOB 1F74A 4W4QA 2V67A 3TQ0A 4TQTA 4X0VA 2V3DA 1F9CA 3QH2A 1GKQA 2VUNA 4GYPC 2WMGA 5H2ZA 4YYCA 4N6EA 2C8NA 4YLWA 3VD5A 3GG1A 1HQTA 3FA3A 4GQRA 4ZOEA 1IYXA 1X6LA 3MBFA 2OSXA 3WDQA 1TA3A 1G7UA 1UZHA 3FVMA 5D32A 3W29A 1M5WA 4QBXA 3VOIA 2ZUNA 3R58A 2QJNA 3LHZA 4D6HA 4C6BA 5EFFA 1NOUA 4PMVA 3VIOA 2YDRA 5BW6A 4FB7A 3PY2A 3WL0A 4DY1A 2XG9A 2QF7A 3H55A 1M68A 4Q8OA 3N12A 3TTEA 3OYZA 4ZGYA 2QT3A 4J3VA 1FCQA 4Z2GA 3Q65A 1FH9A 2SFPA 4JTGA 4K6AA 3IV3A 3PWIA 4ACZA 2ZRVA 2PGRA 4KGJA 3HOJA 2PWVA 4ZSUA 5I3FA 4C6QA 1EJRC 4XWUA 3L21A 4PMQA 2V3GA 4J35A 5ECVA 2DH2A 3TAKA 3ZR5A 4AX7A 1QDSA 4U4MA 1A5BA 1W91A 3NL3A 3CEUA 3E1F1 3STPA 3GY1A 3CUJA 3KZPA 1O6IA 4QIUA 1TVNA 1AH3A 6XIAA 4PN2A 4L9ZA 2EG6A 1NSJA 2D0HA 1E73M 2GJRA 1EB3A 3QMSA 1LLZA 4J3XA 4IP4A 1H11A 4TMBA 4C60A 1D9EA 4CNUA 1FP9A 1XYAA 3HURA 2KZHA 3N04A 4R5EA 3T42A 4JTLA 3EWUA 4WXYA 1A5AA 3UZ5A 4M81A 4JIPA 3GDRA 3W00A 3TOPA 3BPWA 5I78A 1V3KA 5A2AA 3VIFA 2WMHA 3FYYA 1HW6A 4REQA 3KBVA 3TCEA 5DCEA 3B8WA 4HPNA 4NG3A 5B7ZA 4AZBA 1TWDA 4JR5A 5AYYA 4FXJA 1DWAM 3OODA 2XSAA 2XGBA 3LBCA 4GUJA 1S5MA 1SFJA 4P2VA 1GPFA 1W1IE 2W9MA 3USBA 5KINA 2DJLA 1H1YA 1UP2A 2QCLA 2I9EA 3PUOA 3CB3A 3I68A 3D5HA 5KZMA 1AFSA 4KH2A 4JN8A 1HTIA 3NYDA 3BLDA 3M0HA 4O15A 3EOLA 2FIQA 3R2GA 4NJIA 4YU1A 2ZZ5A 2ZE3A 4ADTA 2ZA1A 5BCAA 4R53A 4UFHA 3OG3A 3LPFA 1JRBA 1IEWA 4GHRA 3UG8A 3T40A 3IS4A 1C8VA 4K3ZA 3AMCA 4K68A 4N0RA 5E09A 2OQHA 4RV3A 3HGJA 3H2EA 1QK0A 4J9JA 3L7RA 3W1LA 3S5SA 4DN1A 2UZ9A 1K8ZA 1VHNA 1O60A 4WDTA 1LG1A 4C6IA 5FJJA 4PMRA 3NL6A 3SCRA 2RKXA 3GDBA 4IGSA 3T1GA 3UERA 5KSWA 1H50A 5C71A 3E6EA 2WHJA 1FWTA 5JIWA 1THFD 1WYIA 3SB0A 4HOXA 5C8BB 4U5IA 3SBFA 1JR1A 1PX3A 5CPSA 4R9XA 4ZR8A 3LN3A 1NP2A 4JTAA 1MW0A 1J2WA 4XKYB 1XGEA 3IPWA 5JIPA 3FJNA 1GEHA 1UA7A 1C29A 1B3XA 2YPIA 5AECA 1LZOA 3K4AA 5AYBA 3L66A 4DF0A 3WL1A 1UOZA 1FHUA 5E70A 3W7MA 3CUZA 1P4CA 1ZAIA 1UD5A 1YTDA 4AHPA 2CPUA 1TV7A 4FR1A 2F2KA 2BGQA 4E3TA 1UZDA 4NILA 2E8YA 3SQMA 1REQA 1QW9A 1VH7A 2A3LA 2CEQA 2INEA 1IHIA 3C2YA 2BXVA 1FWBC 1HGYA 1EWEA 2OWWA 4D8LA 4DWDA 3W70A 2A2IA 4QQ3A 1UMYA 1I1WA 3BO9A 4LQ1A 3QHOA 3DZ1A 1ADDA 1E6QM 2ZUMA 1N8FA 8CGTA 3L4YA 4ZFMA 4KT2A 2IUZA 4H1ZA 2RH9A 4MAZA 1YXCA 2R24A 1KV8A 1YRRA 4ICCX 2H3BA 3VCCA 5I00A 4GRSA 3RPTA 2VFIA 3KRUA 4D1IA 3GC5A 3MW7A 4AG0A 2VGIA 1UKOA 2YA1A 2H8XA 1LLOA 4JTDA 4AIOA 2E5BA 1DP0A 3R10A 4J3WA 5C9RA 4NQ1A 1YIXA 4MKSA 3M5YA 8XIMA 1RA5A 3R8GA 3WMSA 1UWUA 4NZCA 2W6RA 3DI1A 2CLOA 4RL3A 3BOFA 2ISSA 4QCFA 3R6IA 1YXYA 1WNOA 1KGWA 5JH1A 2WNWA 4CKQA 3U6WA 3GH4A 2AGKA 2X05A 2D2OA 1EJUC 1OFPA 4B4HA 2Y8UA 2I14A 4JD4A 4JTFA 2CHNA 3SI9A 3IIOA 1KCXA 1XISA 2ZIDA 4RK8A 4UZSA 3GXMA 2OB3A 3S5YA 1XS2A 1V3HA 3M9YA 2PTDA 2WW5A 3GG7A 3UJEA 4ZMGA 1UWRA 4PULA 4D6GA 4GZ7A 3ARVA 4NAFA 4OOUA 1L2QA 4P7RA 4NAEB 2GSJA 3CS2A 2J8FA 2QIWA 1PHWA 3WQWA 3E0WA 3GVWA 3OGSA 2FJKA 4NY2A 5LA1A 1KFJA 3NL2A 4NNBA 1J79A 3N4EA 1UD6A 1PWLA 2PF0A 1IXNA 3RLVA 3CUHA 3CQHA 4GIRA 1VJIA 3CV7A 2VVSA 1S2AA 3E38A 4G9PA 5G1YA 3WF1A 2WVVA 3OZPA 2A3BA 2Y61A 3O9NA 3AIWA 1B2YA 1K6AA 4KERA 4C5YA 4LJ3A 3NQ7A 1XPGA 3NM1A 4FNTA 3NQ6A 4H8VA 4JTSA 4E2BA 3WLNA 3JZEA 5CZ0A 4Q4RA 5DBTA 3BCFA 2HBVA 1NFGA 4A3UA 1F6YA 4HU0A 2XVPA 1A5MC 4PCTA 1QRQA 4RNFA 1JUKA 1NP0A 5D2XA 3KRSA 3WQ8A 1ZJIA 1JQXA 4GH1A 1FKWA 3C0SA 4MDPA 2E8ZA 1XKYA 1EIBA 5H8UA 3QLDA 1L8PA 1LLWA 4QLLA 3U2OA 5AC7A 2PDWA 4RE3A 3B0UX 3ZT5A 4EWJA 4BI6A 2YW4A 1PKYA 2BVWA 3MU7A 3ONCA 1DJIA 5G1TA 3W7EA 1EPVA 3LCFA 4MM1A 3CXOA 2XN1A 3VIGA 3GXFA 1ZNNA 1LL6A 3GFZA 5A6TC 4JX6A 4DYEA 1E4LA 4HMCA 4JY9A 4MJZA 3LLXA 1HX0A 2I56A 4G6CA 3BOLA 2HTMA 2QF8A 4IJCA 2ZTKA 3WJZA 4NP7A 1XIMA 5CSRA 4L80A 4BFAA 1GKPA 3H2FA 2DIJA 1F2JA 4DM1A 1CXLA 2BB0A 3CQJA 4Y9AA 5BOOA 5AHEA 4UIOA 3A4AA 5FF3A 2CERA 1GJUA 4HNUA 3UXKA 5HXMA 1BRLA 4KBXA 4MB4A 1KRCC 4K39A 4R7OA 4HK5A 3B9EA 2ZYFA 3TA9A 5AFDA 3CB8A 1OFRA 1EJWC 3E5BA 1HXJA 1JZ3A 1Q8AA 2V2DA 2XIQA 3A12A 1ITCA 5HMEA 3M43A 1X7IA 4C6FA 4U28A 5F1UA 1A5CA 2YA2A 4POCA 2G3IA 1YBQA 4M5PA 2GSEA 1FOBA 2F38A 1UMLA 1DOSA 2OO0A 3BICA 4E0CA 3VGHA 4H19A 1MWOA 4LAZA 3R0DA 3II1A 3LM7A 3RO8A 3VNMA 3IIVA 4LNYA 2YL9A 1ZY9A 3PWAA 1ISXA 1NVMA 4IFKB 1ME7A 3LGGA 3AJXA 3ZZ1A 2V5LA 4H2CA 1CW2A 4I9MA 3GXIA 1UH2A 3EDDA 2O56A 2IKIA 1E5JA 2C0HA 2VO5A 2RJHA 4MJMA 4UMAA 5GPRA 4ZOAA 1FDYA 4PUWA 3T55A 4HNNA 1VBUA 5A6LA 4O54A 3V0TA 3WFAA 1PHQA 3UY7A 1KWKA 1SZEA 4LC6A 3DHUA 4M8UA 2IPFA 5IFTA 3C4UA 3A9BA 3ITYA 1W1PA 4L1GA 3M16A 3TYAA 3GVQA 5HWJA 4YTTA 4UFLA 4PFMA 2Q3RA 3W4RA 3UA4A 2GQ3A 2YLLA 3T05A 4EPBC 5CLTA 2V5CA 3MKKA 3MP5A 5CGMA 2WMIA 3B97A 2JFEX 1KM4A 1KXHA 4HSOA 3QTGA 5HDRA 2OODA 2BVTA 3VOCA 1ZFJA 2A6NA 3RLGA 1JXJA 1RCXB 3GAKA 3DFOA 4FNUA 4L64A 4O10A 1MSSA 2YL8A 4N42A 3TJLA 2J27A 3FVDA 3MS8A 3VIMA 1L6YA 4GYFA 3DEQA 1DJZA 4B92A 3POCA 1CTNA 5C9XA 3R7MA 1L6WA 3IV8A 4K37A 1W3KA 4ZO9A 4JCMA 3SSZA 3WD4A 3B0PA 4V2XA 3BC9A 5F2IA 5M17A 4LS2A 5C54A 3CPUA 3WLKX 1ISVA 1ISWA 1J8VA 1Z42A 3DH7A 4PL1A 3LEPA 2C0AA 3BJTA 4ECLA 3UR7A 3B8UA 1WKDA 1KFBA 1CXIA 4LYPA 1EEXA 1O12A 2ESCA 3WDIA 1GJPA 2GGHA 1VFTA 2VEFA 3QR1A 1GZJA 3O8AA 4GZJA 2YBTA 2GDVA 1EL3A 4GI4A 1E6RA 1TKKA 3FFSA 1M7XA 2OEJA 2V5JA 4QCEA 3GRIA 3NQBA 2J8GA 1N2VA 1WUEA 4FK9A 3E0VA 1BKHA 1FY6A 1Q6QA 5ECUA 1HL8A 4RLIA 3RU8X 4H00A 4DJFA 3K13A 4ZXOA 3GYEA 1I6NA 2Y63A 3SY1A 4HYWA 2Q8LA 3LYEA 4M3PA 1GYMA 1GVFA 4AVNA 4BF5A 2CLEA 4XO7A 3LBOA 1TJ0A 4M1RA 1R3RA 1EDQA 4Z08A 4AD0A 4FO4A 2WWDA 3V35A 5B80A 1HT6A 1X1ZA 3D3FA 3VGGA 4GJ1A 4LY4A 1AL8A 3UJSA 1CENA 5REQB 2Y4SA 3DFPA 5I79A 1FWHC 9CGTA 2TAAA 2P0OA 5D30A 1L0PA 2DVUA 7PTDA 1R7OA 4X2RA 3IUIA 2XH2A 3F5JA 2CZVA 4R33A 4V33A 1I9CB 1IR1A 3VIJA 4W85A 1TPDA 4OV9A 2VEPA 3OLIA 1VFLA 3NPVA 3S6DA 4F48A 4PB5A 1JAKA 4DI8A 4Q8NA 1U5HA 2PP1A 3GDKA 2PRHA 3G22A 1UBSA 2JF7A 3SCWA 5ABTA 1XLCA 3LQGA 2ZVRA 3WJYA 1B3ZA 1GW9A 4J3TA 4LYQA 4A8RA 4QG9A 4E5TA 1HJUA 3SADA 4YXGA 5GJMA 1YXDA 1JZ4A 3L9CA 1EX5A 1DTUA 4F79A 1S1RA 4OVXA 1QI5A 4XTDA 2DZAA 4MYXA 3E5PA 1DV7A 2INFA 1SYTA 2YIHA 3P61A 1ZP4A 4Z2HA 2NUYA 1U22A 4L4PA 1BVZA 4HA3A 4NZ5A 2OPJA 1IXQA 3GE7A 4C7FA 1GYLA 3HGSA 3AROA 1M65A 2OZ0A 1J0KA 1Y5VA 3N25A 4X9YA 3TMLA 1JZ6A 3AI0A 1TTQA 4IIEA 3T0TA 1KQZA 2WMJA 3DC0A 1TELA 4JOMA 3L4XA 3BGAA 4RW3A 5DELA 2YDSA 5KZ6A 1BLIA 3N6QA 4N9CA 4HJFA 1A50A 2PD9A 3ICJA 2Z25A 3VNIA 3LQLA 3GFXA 1TWIA 2P50A 2WLYA 2WHMA 4ASTA 4UTHA 4LVGA 3CAWA 1M53A 1NF7A 2DVXA 4NZ3A 1T8XA 1VJZA 3AYRA 3BQ5A 4Z0JA 3CPRA 4CQAA 4DO6A 1YEYA 3DYOA 3MWCA 4BQ2A 1V93A 3LA4A 4JL2A 2B7OA 2RGMA 3VYLA 5MF5A 3WMLA 1BYCA 3M5VA 3H2CA 1RVGA 3E12A 2IPJA 4NXSA 2JQXA 2YJQA 5XIMA 1CEOA 3W0KA 5CH9A 4PGLA 1V3MA 2I1OA 1AZ1A 3LDVA 1IR2A 1K9EA 4DO5A 3DYPA 2D3LA 4D8AA 3STCA 2G5WA 2BP1A 1FX6A 4XBKA 3IVTA 4ZEPA 5I6SA 1C91A 4GNVA 1XLMA 2XIMA 4ZQPA 1W8SA 3LMYA 3EDKA 4GCAA 3IIPA 3F4VA 2IQTA 2RHGA 4JQ1A 1ZAHA 1F3EA 4EXQA 1ZTVA 1G4SA 1R3SA 5C0QA 2DSVA 3FAXA 4K7VA 5B7YA 3EBVA 4FLQA 3RN6A 1F4AA 4K36A 1GKRA 3CV2A 3W7OA 1GUVA 3TP4A 3EA3A 3AU2A 4MOZA 5MKGA 3CL6A 3KLKA 2CLIA 3ARRA 4LVDA 4O1FA 3QVQA 3JZUA 5G2HA 2PE4A 4XISA 4AD5A 3OO2A 1LG2A 2CETA 1W3JA 3TNBA 3ITLA 2Y70A 1XH2A 3E74A 3IAPA 2ABBA 3MHGA 1EP3A 3CH0A 4IQDA 3IJLA 3WDPP 4UTJA 3S6TA 1D3GA 1AW5A 1OYBA 4XZ9A 3BLIA 1FVPA 2FMOA 5D9NA 1B3YA 3AMKA 5BXRA 5D37A 3S5OA 3WFZA 1QPRA 1SSDA 1V6TA 3M5ZA 2IPGA 3NNTA 3MUAA 3MUXA 4M0XA 3B3DA 3TKFA 2PD5A 2W62A 1W1VA 3ZVHB 4JL1A 2Z1XA 1OG0A 2X42A 4L6HA 5FEWA 1WXJA 4XAPA 2E4TA 2I16A 1H0IA 2PC4A 1X97A 3FKKA 2DT2A 1TYGA 5LA2A 4GINA 3W1MA 3ZT7A 3FKRA 3VTRA 3C0JA 1GT8A 2FJUB 2ZADA 4B9ZA 3FA5A 3PZGA 2VURA 4A8LA 2J25A 3M0IA 1GWJA 2VGFA 5DX7A 3B0XA 1MRAA 2OWXA 1W54A 2PDQA 4CNPA 3LTSA 1FFRA 1K9TA 4W88A 3IAQA 4YIWA 3GTHA 4E4FA 1MO0A 3ERPA 1HIZA 3RF9A 4ZTYA 4DRSA 4BF7A 4Q4PA 2R82A 2IW0A 1US2A 4WGHA 1LBFA 4IMGA 4P8WA 3JR2A 3VNZA 2F61A 2FLIA 4H8NA 3ECQA 4FLOA 4ATDA 2PEVA 7XIMA 1OD8A 1E51A 4CCZA 2DH3A 3LCGA 2GSHA 4PSPA 3WLPA 4W89A 3W9ZA 4XX6A 3WNOA 1K7XA 1Y0EA 4OFCA 2DUXA 2XFFA 4U2YA 1W2VA 4WD0A 1S39A 4DELA 4AHOA 4ZQMA 4CD6A 4ORMA 1W5PA 2P5NA 2PI6A 4MFEA 2TPSA 1KLYA 4Q4OA 3C8FA 3H23A 2O4QA 3TYUA 4FHAA 2H90A 3GHRA 2HWGA 5K3VA 3B04A 1OX4A 2NX1A 1WBJA 4QGCA 4A29A 2ANUA 3ENLA 3VE9A 4HZ6A 2G96A 4YTSA 3EKLA 1RJRA 3VGDA 3MC5A 5E93A 1ZSXA 3H12A 1U30A 4P7NA 5A8PA 1AH0A 1YDVA 3SN0A 2Z1WA 1YTEA 2YCIX 4JYDA 1SMAA 4Q8PA 5F2GA 1Q6RA 1AJZA 3APYA 1DPMA 3WQFA 4NI3A 5HR7A 4YNGA 3VZYA 3ID7A 1UH3A 1JUEA 5AB3A 1GW1A 1F76A 3JS3A 3MVTA 2OEKA 4HN4A 3F5KA 4QP0A 4XKYA 2X0YA 5I3KA 1LQ2A 1HJWA 3ARZA 4EACA 1HNYA 3SCTA 1S5VA 2CXGA 3DECA 4IMDA 4OUIA 2FB3A 1JEZA 1MUMA 2X16A 4LF2A 3PUGA 4UTTC 2X2YA 1R5YA 3MUCA 4WGXA 2GQ8A 4R9OA 1XUUA 3M0LA 1KXVA 2DP3A 1O7AA 1JGIA 3E2QA 3G8EA 2AAAA 4S3CA 1TWZA 4CQDA 1AZ2A 4DWSA 3B9OA 5G5IA 2C14A 3C6CA 1GOXA 4LRSA 4OZOA 4DHGA 4IJBA 3WH6A 2VDIA 3K2GA 1ESWA 5H1WA 1BAGA 3VILA 3FCPA 2ZX5A 3JU2A 7REQB 1TVPA 1WPCA 4Y8FA 1OT2A 2O9PA 2P3ZA 4MZ1A 5K7JA 5M1TA 4YWSA 3O1NA 5TAOA 4RDVA 4EIVA 1VPYA 1WZMA 4B5WA 2WM1A 3ABSA 1V77A 2DORA 3P60A 3OIHA 4XBJA 1A5UA 1CGUA 1XPYA 4DZ5A 1DJWA 3EWWA 3H4GA 3QF0A 3UR2A 1P0DA 4CU8A 2WC4A 5BWAA 1PCWA 3A3HA 3ZWSA 3MMWA 3SRDA 3APTA 1IEXA 4QR6A 4DXVA 3GHSA 3P80A 1JFHA 2W0UA 1VP5A 3WLIA 2G3NA 2CZDA 2FTWA 3AHVA 3QHMA 3ZVIA 1RJPA 3KBWA 2BXZA 3E02A 4JBRA 3Q2DA 1ADOA 3E0IA 3R79A 4IT1A 3W82A 5BXTA 5CAKA 3KBJA 3LHYA 5E6YA 1QXLA 4JIHA 4PTNA 3ZT6A 3VD4A 2PZNA 4IMAA 1D3HA 2QAFA 1NARA 5A6BA 2XWDA 5AC6A 4LB4A 3UCDA 3KVJA 2FGZA 1Q2SA 1ZBVA 1NAL1 3BTNA 2D0FA 5EB8A 3HN3A 3K1DA 2A7RA 4TOQA 3TQPA 3POHA 4IMCA 3FEQA 3GNOA 3QFEA 1PE1A 3L0NA 3EXTA 3QKEA 4PMDA 1JD9A 1K8CA 4GY0A 2BVDA 1UZ4A 3FSTA 1XKJA 3MJMA 1X96A 1JDDA 3WN6A 1B31A 3LGDA 5LA0A 2G3MA 2GL5A 4JFUA 4CQBA 4RX0A 4WEVX 3G24A 2G95A 2ABAA 5FF2A 1B5TA 1FH7A 1XBXA 2JEQA 3WJSA 3M6YA 1MQRA 1WQ5A 3BV7A 1VIWA 1PWMA 3QQ0A 4EK7A 1D2KA 3P67A 2XWEA 1L9WA 3T09A 1E9ZB 8RUCA 5FJRA 2WZTA 2QGYA 4FX6M 4MUZA 3N73A 3M0MA 3A4XA 1JIBA 3ALGA 4O1AA 3FHAA 3ZJ6A 1DKWA 1N55A 3FJLA 5BZAA 3NPWA 3W88A 1FH8A 1OCBA 1R3YA 1W37A 1SJBA 1IZKA 3N2OA 2XIOA 2YDAA 2WQDA 5BU9A 1IT8A 3CK5A 4C6MA 2VFHA 4RPQA 4HMNA 1XSJA 4PBGA 2HK1A 3NQEA 1M7PA 1IWAA 1XLAA 3UYCA 1K70A 4Q6XA 5CLWA 2NQLA 4ERGA 5I09A 1Y5WA 3SQSA 4Q4SA 4PL2A 2GJPA 1V6UA 3OVGA 2E9LA 3AXKA 2Y24A 4MWAC 4KFNA 4ZODA 1Q45A 2VFGA 4A6GA 3CYVA 3Q58A 1X8FA 2J7HA 1VJSA 2QQ6A 4DF1A 2OQLA 3FYOA 3MP4A 3WCZA 3W7KA 4AC1X 1FHVA 1I0BA 1DXFA 3PG9A 3CTLA 1FWIC 1IXOA 2YA0A 2ALDA 3UWUA 2E67A 1VFOA 3TZNA 1W9BM 2WCSA 2FTPA 1BTCA 1H61A 2FZ9A 3R94A 3W85A 1BSLA 5LGZA 3BARA 2C1HA 2CBJA 2ACUA 2R1KA 3RDKA 3GC2A 1YPIA 2WKGA 2PWUA 4LT9A 5FL1A 5CZSA 5DF0A 5AZ1A 3TZFA 2GFTA 2XGIA 3BAWA 5HAOA 1XIHA 2OYMA 4J4KA 1F4HA 4XIMA 4WIWA 2WB5A 5A8NA 1Z3NA 3LHTA 2HVNA 3ZLFA 4ERIA 3AHZA 4B2DA 1EA9C 1QPKA 2YBUA 1KM3A 3NQCA 2Z1KA 1UJQA 1XGZA 1R46A 4JFWA 3DFSA 1E1CB 1UG6A 1J10A 3EB2A 4IFKA 3WF2A 3WDJA 1V3JA 2E25A 2WSQA 3EB3A 2DT0A 4V15A 3R11A 3PJTA 4WKAA 4YN5A 1TPFA 2H8ZA 1P1MA 3QOKA 1LWJA 1RXOB 1UKPA 4ADUA 4FF5A 4F9JA 3P0XA 2ON3A 4LWWA 2ZX8A 3DKLA 3MUY1 9XIAA 5HANA 1H3GA 1V0MA 4UFJA 2FYMA 4NT0A 1MEHA 1CLVA 1H1NA 3EX1A 4G1NA 4JX5A 1BKSA 4CN6A 4Z2LA 4H8HA 2VTFA 1ISZA 4E8CA 1FWFC 3L4TA 4UQAA 4RE0A 4C6OA 1E1EA 4IX2A 1LBLA 4EP8C 1ML1A 1AQ0A 4IX0A 3A3XA 2VC9A 3H2NA 2R6OA 3BSMA 5CPNA 1UUMA 2J9YA 1E0XA 4PTWA 4ERAA 1Q4WA 1CDGA 1MFUA 2OZTA 1V3LA 2A6LA 1XSKA 3ZO9A 2PDJA 4Z2IA 4XVEA 1O68A 2DW7A 3RPDA 4S39A 2X1RA 1JZ8A 2O9TA 7ENLA 1WA3A 3VM5A 2R14A 4LBSA 1UR1A 2NX9A 2YDQA 3GUWA 4Q7BA 1OYAA 1X38A 2GJNA 4ZBCA 3VOGA 1EEPA 1TPEA 3LCIA 4WDWA 2WJDA 3R13A 3WH8A 1B90A 2PB1A 3G0XA 5IBXC 3G1HA 2BDQA 3TCSA 2XHYA 3GIYA 2V9DA 4BEUA 1JFXA 3LY0A 4NU7A 3WQ6A 3CGTA 1VB9A 4L6DA 1ZHAA 3BLKA 4LTSA 3TJIA 3UCQA 2E28A 2WKLA 4UQCA 3DGRA 5CQ1A 2Y8VA 3CZEA 2GJLA 2ALRA 3FX4A 3WQVA 2AQOA 3A4JA 2JF6A 3V4BA 1QFEA 1VHCA 3CV1A 2NUWA 1VEPA 1Q7QA 1E6PA 3W1PA 1HZYA 3CL8A 1JVNA 3CUFA 2AMXA 1IWPA 1K02A 2VCAA 5BXSA 1JCYA 4M24A 2QAPA 3LERA 4NJJA 1OYCA 4I5RA 4XD6A 4BI7A 4K38A 1FCUA 1O95A 3Q94A 3VXGA 3EWBX 3L2MA 3GR4A 4RR4A 1JPMA 3F7JA 3QV8A 2Z27A 3I7SA 5REQA 3OZOA 3T8QA 1SJDA 2VL4A 4TV6A 3S42A 2X2GA 3BLFA 4BY3A 2NT0A 1W3IA 3TQVA 2J9XA 2ZZ2A 4RDWA 4IG2B 4HMDA 4YTUA 2DZBA 2X8RA 4XSMA 3SUVA 2B4GA 3QY6A 3GU9A 3D46A 2E77A 4ZXLA 3NZRA 2HE8A 1Q3NA 3WDRA 2QEZA 3DFHA 1FHDA 2DSKA 3WKZA 1TUXA 2GJXB 2Y89A 5I2UA 1DXEA 2ASHA 3EXRA 2W67A 4LCRA 4LUTA 4E3VA 2GVYA 4LC8A 5A6SA 3WUBA 3WBWA 2BG5A 3DFQA 4WZHA 3V3WA 3QBUA 4RZ5A 3N1AA 3MHUA 5GNYA 3ARUA 2QV4A 2VELA 3JRKA 3H54A 1TMLA 2A4AA 3CMGA 1XBZA 1AVAA 3WBXA 4X63A 3WQPA 3WNMA 1A3HA 4OBSA 1FHLA 3THAA 1TTPA 1GONA 4GE8A 2UY4A 2A5HA 3ZR4A 2ZC8A 3GTNA 3SJ3A 3HIJA 5DMNA 2CXEA 4OT7A 3GB6A 2DZPA 4XVDA 1EDGA 4MPKA 2C1IA 5DMLA 2DZVA 4JHMA 1R3VA 2Z6IA 3EOEA 1Y5XA 2Z00A 3LPPA 2HE5A 2VRQA 3E0LA 4C6CA 5AY7A 3W7PA 1GOIA 4HU8A 2POZA 4DUXA 4UTFA 4E2VA 3QFWA 3P74A 3V5OA 1EUNA 3BK0A 1CYGA 2BTMA 3H7UA 4QROA 1BXBA 1YX1A 5LIUX 1XX1A 4NUWA 1D3CA 4AXKA 4PA8A 3WK2A 1OK4A 1EUAA 4CNOA 2QJGA 4J2MA 4CNSA 4CVUA 4LUJA 2J6XA 2PDGA 2IQDA 1HKIA 4X61A 4CN1A 3QSTA 4C6PA 4F4RA 2B7QA 2WJEA 3L65A 3ZXWA 1HVXA 2VX5A 4K1WA 4AFYA 5CCZA 1XYZA 1JF5A 2Q09A 6XIMA 5T8GA 4QS5A 2YYTA 1UWIA 3VGEA 1TB3A 3E0FA 2O7QA 3WSUA 1E3XA 1E4IA 2FVMA 1W31A 3BG3A 3KBSA 5FA5A 2Z1BA 3IJIA 1S46A 3GBEA 1SJCA 4DO4A 3TONA 3MMDA 2YFNA 2WMFA 5KZDA 5I77A 4XZBA 5L9FA 1DQWA 3DIPA 4GVGA 1N7KA 3PZVA 1BWLA 4DJDC 1MXGA 2VXNA 2ZX7A 3AWNA 2ZUUA 2Z2UA 3CAVA 3O16A 3Q67A 3O6AA 3AIEA 4LFYA 4HP5A 1ICPA 3N2BA 1QBAA 5LHFA 3WJXA 2DIKA 4MWAB 2V69A 2B7NA 1JJKA 2DW6A 3UPWA 2UY5A 1FDJA 2NUXA 1UR4A 1I2PA 4E8DA 3IJ8A 3INPA 1UH4A 1PS9A 5K9DA 3AS0A 6PTDA 4QNEA 1HJXA 3LD5A 4HZ7A 1OADA 5DRIA 2R8WA 4PUDA 1R3WA 5HATA 3S2JA 1EP2A 3M0XA 3ZVHA 1PIFA 1B3OA 3WG6A 1NWTA 2ISWA 1K77A 4L9XA 3V0UA 4UNKA 1KWGA 2VJXA 1ZCCA 2FMNA 2J7FA 1VBGA 3ZMRA 4JAWA 1L6SA 4HKPA 5D2WA 3W1UA 3GH5A 3ARXA 3CYJA 4DNHA 2FZNA 3NVTA 1CLKA 4DBWA 3NQGA 2ATSA 4AZHA 3R8RA 4JTRA 1LROA 3MO7A 2HV5A 3ES8A 5I23A 4LAOA 2PCEA 3CWHA 3OPSA 1PCKA 2HROA 3OA5A 1TSIA 2CYGA 2XU2A 4MY9A 4B15A 3EX4A 1QPOA 1EJ7L 4EWND 1I45A 1XG4A 4OKDA 5D2TA 3HG2A 2GLKA 4US6A 3VZZA 4PMNA 3PAOA 1K4GA 2Z7KA 3AYTA 2EPNA 2HEJA 1TQXA 4HCHA 2JKEA 3P2VA 3BXWA 1I1XA 3SURA 5M5DA 3IWPA 1ME8A 1I2OA 5CSYA 1ZAJA 1E6XM 2QHAA 3MPGA 5L6UA 4P7LA 4B3LA 1GVOA 1YDYA 4R88A 2QGHA 2B7PA 4O8RA 5FKYA 1PKNA 3RAOA 2Y88A 1KFWA 3ZWTA 4GQBA 2A3HA 4JKMA 1QO2A 5CC5A 1HKVA 2W27A 2GDUA 4J28A 1H7RA 3G1YA 2E0PA 3MDWA 4MSSA 3IARA 3UG5A 3PN8A 3DAQA 3NCOA 8A3HA 4ZQNA 3O6YX 1KFLA 4JTHA 3QRHA 4QE4A 1IEQA 2O92A 1XWYA 1KLZA 1XLJA 1V0KA 3LPGA 1GVRA 4UZUA 4LVAA 5FF4A 2PGFA 1E9LA 2TSYA 4PB4A 1GVYA 2WXDM 3ANYA 2Q02A 1HL2A 1IWBA 3GS6A 4F66A 5ABEA 1TV3A 4F2TA 2VHLA 2FPVA 1LUCB 4JY8A 3P3BA 3O63A 1YPFA 4L4LA 6ALDA 1UHVA 1A5KC 2G3JA 4M6UA 4RW5A 2JEPA 1RJQA 5HWNA 3UNTA 4AAJA 4O52A 4I9AA 2AL2B 2ONEA 3LB0A 4ZSTA 3TX9A 2W92A 5T26A 2PDIA 2VENA 1TTJA 1ZRQA 2DPEA 5LNVA 4QSHA 2BY1A 3GBDA 1K3UA 1IF2A 4PR4A 2FKPA 2BODX 3C8NA 3B8TA 4CU7A 3P14A 3URAA 1NDWA 1MZRA 3OU8A 4MGGA 3TN6A 3KTCA 1D8WA 2BNJA 3TV8A 1WV2A 2W63A 4GUFA 3W7GA 1Z44A 7REQA 2VZTA 4O16A 2PDCA 5HWMA 1R2SA 1ONWA 3D47A 2Z26A 2FZ8A 3RK8A 5HR6A 3AALA 2GYIA 5AOUA 4GK8A 4HA0A 4GUGA 1TJRA 1OFEA 3W7LA 1UUOA 2C16A 2WM0A 1P7TB 3B40A 1V02A 1XICA 2ZXDA 1EOKA 4NZJA 3UZZA 3NZPA 3DG7A 3WDHA 1ONRA 3KOWA 2WZEA 1BVWA 2F7FA 3TW7A 2G8ZA 4YJ5A 3ABOA 3CZKA 4UTIA 3PNZA 3W1RA 3CV6A 5IRPA 5LNSA 4NL1A 1ZLPA 2FPTA 2JBMA 3NDZA 3KHDA 2WBGA 4TTGA 1AK5A 1POKA 4IIBA 4P7OA 4MNJA 1V51A 4PUKA 4PTXA 1WCGA 3CWOX 5KZEA 3BLOA 3WY1A 2CFFA 2EXOA 1H7PA 3H6OA 3WK1A 2FB2A 2VUYA 1R2TA 3EKGA 3GDLA 3W2JA 3F4DA 4D6IA 1Z7AA 1SQ7A 2CLHA 4J2PA 4Y9MA 5J04A 1XLFA 1Q6OA 1VKFA 2H3DA 1SVDA 4Y8EA 5BRQA 4ZL1A 2GOKA 1V3IA 2O9RA 3VZXA 3AXXA 2OVLA 1E0TA 3NEVA 2PDMA 2WSRA 4GH3A 2G37A 3OP2A 3QW4B 1V03A 5F2MA 2GVGA 4O57A 2NXIA 7TIMA 1VPQA 1XIEA 4PH6A 3TH6A 4JNMA 2OT0A 4G7EA 4JYFA 4MUPA 4DLFA 1TJPA 4UQBA 3W28A 1Q6CA 3CPGA 3U7BA 3QGVA 5KEZA 2ZVIA 1FFQA 4P8VA 4QHRA 3UWQA 2IXVA 5LHEA 3PB2A 3AO0A 1MYRA 1SJAA 1RALA 5IXEA 2QCDB 1B1YA 5LNRA 4XD3A 2F8QA 4IMEA 1W9XA 3G8RA 6A3HA 2QYGA 2EF9A 1AD4A 5CKSA 2VM8A 2QPXA 2UY2A 1J5TA 2QIIA 1DVJA 5GNXA 4UXDA 4XZWA 1VCFA 4JTTA 2HISA 3HM7A 3PBWA 1LWIA 1L2UA 2AQWA 2FGBA 3DG3A 3TYCA 1FBAA 3DKJA 3CT7A 4UR8A 3P5YA 2Z4GA 4XSLA 4HMEA 5AC8A 3EPOA 4V27A 3PM6A 1T0OA 1ECEA 2ZUWA 2YR1A 3KOZA 3DDMA 3E2VA 1R7AA 4AD2A 4DZAA 3ZSSA 1TZZA 1TVLA 3H2OA 5D38A 3LENA 4IPNB 4JTJA 4IL2A 4UNLA 1I8JA 3GUGA 2EEXA 3AS2A 1GOQA 3MQTA 5CJ5A 2FH8A 3H70A 4AU0A 2D69A 4P5UA 3FLUA 1TMQA 4N9EA 1BXCA 3E9AA 3PZMA 3SIMA 5HNUA 3OLEA 1S5NA 3K1GA 5K2ZA 1Q63A 3RU6A 3GZ3A 4C5ZA 2Q71A 1C92A 1AQHA 1HJSA 1A49A 3TW9A 5BOEA 1ADSA 3SAZA 3KS5A 1Z6KA 4EVZA 1W17A 1VFMA 5EYWA 2B81A 1HP4A 1XQKA 2UV8G 3B9AA 2F9RA 4KRTA 3O0FA 2CIPA 3TTQA 2REQB 4W8LA 2Q8ZA 1TV2A 3FAWA 3W1AA 4DQWA 2FVKA 2RDUA 1HF6A 3U3HA 2O55A 2GUUA 4TO8A 1RD6A 4IPPA 4R85A 1W1ZA 1O5XA 4JNYA 2OKOA 2D20A 3CHDA 4L4MA 1KD0A 3TXVA 3N18A 4H01A 4PUMA 4DXKA 3B8VA 3PFMA 1I2QA 1R86A 3UY8A 2C19A 1OF8A 2ZUTA 1UROA 3QYSA 4JHOA 1QUMA 2ZICA 1MUWA 2EO7A 4FXFA 3WLJA 1LT7A 1V7YA 3D0CA 4AWSA 4I6VA 4L61A 4AD4A 2VZVA 3VNJA 1BG9A 2ZE0A 4US5A 1QBBA 2ZX6A 4EF9A 2ATMA 3SRFA 3QC3A 4C90A 2FFCA 2QDEA 1YPXA 4PCFA 1A3WA 3NSMA 1KFEA 1E1CA 3TJ4A 3KHJA 4I7WA 1MUCA 4GOAA 4LYRA 3AHXA 3WQOA 3CO4A 2EPHA 5CSUA 5DT5A 1HKKA 4B90A 3QHNA 3L4UA 2E6YA 3GO2A 2G3FA 2LLEA 3IRSA 1RH9A 2XIJA 4WOZA 2HXUA 5A95A 1XYMA 1PTAA 1IT0A 2DT3A 3K8LA 1YQ2A 4DJEA 5EY5A 4CU6A 2QCGA 3CHCA 1W2PA 1ZS2A 2A3EA 1GNXA 3B05A 3RHGA 1V0LA 2B0MA 3CT2A 4NJHA 1BEUA 1V0NA 5H91A 4UTMA 4D2JA 2FZMA 2ZRXA 4AX6A 3C56A 5CPLA 1PIIA 2QUTA 2PTYA 1B4KA 4MJ2A 2V30A 1NDVA 5J8LA 3UXIA 2X7VA 1VEMA 1UWSA 4IIGA 1AH4A 1EO5A 1U5JA 3NO5A 1KKOA 1E6ZA 1M3UA 3W7HA 4KWSA 1TR9A 2WJZA 3GVVA 4IPIA 1CNVA 3W02A 4X22A 3L0GA 3RPMA 3A64A 3ARPA 4NJGA 4GFSA 3NXFA 1HGWA 1W5NA 3CC1A 2YXOA 2WSKA 1XLBA 1XI3A 4Y2WA 3DOPA 5D33A 5CBJA 3UG4A 2HDJA 4WLCA 2RDTA 3QM3A 1MW3A 1W9PA 5FJTA 4AB4A 1AQFA 2WC3A 4DBSA 3SUWA 5DY3A 1GJWA 3R5EA 1OCJA 1NDZA 3SUSA 2YCLA 3H2AA 2EQDA 1M6JA 2HNHA 1CGTA 3G1DA 4ZE4A 1SR0A 4MYAA 5C7VA 3RG6A 1KM6A 1KM0A 4O17A 4YTRA 3S5NA 3HU7A 5ABHA 2P53A 4IMFA 3SSJA 4IXXA 2HRWA 2Q6ZA 3W1XA 3UXLA 3ITXA 1SO6A 1TPB1 1IE7C 1DE5A 1XF0A 4WKHA 3FW6A 4JTKA 3LXBA 3QR3A 1IQ8A 3S2LA 1TPWA 2WCAA 2P10A 3J7HA 2G50A 3ATZA 3TLLA 2DUAA 3MI2A 4UCGA 3RRXA 1C8QA 3NURA 4NNAA 2DZWA 1JPKA 5DEZA 4QLKA 4CEXC 5EBUA 2NX3A 3B8IA 2KAUC 1OGGA 3GTIA 2POTA 3KDOA 2ZUVA 4FAMA 2V8ZA 4KF1A 4DBEA 1NELA 1L6GA 3W71A 1Q6FA 1JZ5A 4PMOA 2CESA 1S2WA 3NGJA 1HKJA 4ZZ9A 3ZJ7A 1YW1A 4FPSA 1QAPA 1KFCA 4IG2A 1UUQA 2WYSA 2ZXQA 4FOKA 3V1PA 2QCCA 5IFPA 2A21A 3G1VA 3C3NA 4Q7NA 1TR1A 4HSNA 1GQIA 3C2RA 2ZZ6A 4XZHA 4AD1A 1UWTA 2GJXA 3BAIA 4XKMA 1H7OA 2VFDA 4O1CA 4KGLA 2HVOA 3G18A 4XBSA 5CPTA 3KBNA 1XRTA 4E38A 1QJWA 2J24A 4HZMA 4F0LA 1RLDA 5EA9A 3ZS4A 3DYMA 4RZ4A 1XL9A 1NU5A 4LRTA 1Z69A 4UNIA 4HGXA 1TZ7A 2INZA 4I8YA 2Q3OA 4H3DA 5T91A 5HNRA 4NF7A 5BNKA 2VDGA 3O6CA 3VINA 1ZZMA 2QVHA 4X2PA 3MSYA 5FSDC 5A8QA 2GQAA 3H22A 3LU2A 3HPZA 2QKFA 3V16A 3DBNA 3GW3A 4HNTA 3H2MA 4HN8A 4MHBA 4O4WA 4N4PA 4PCSA 1JYNA 4B3KA 4KKXA 1XJBA 5EMJA 2BZNA 3W1TA 4KCWA 1X7FA 2YB1A 1AQMA 3VKKA 4QJ1A 1SM9A 2WJFA 4ROPA 3RMJA 3BAKA 3G1FA 3JW7A 5HQMA 4J3ZA 5FJPA 2YXGA 1A4LA 4CVWA 4REQB 1IT7A 1UWQA 3LNMA 1VFFA 1G67A 1RHCA 4AC7C 2NQ5A 2ACSA 4YCPA 2MNRA 4HK6A 1JDFA 2Y62A 4IQJA 3P0WA 3RM4A 1KTNA 4DUOA 4PEEA 4GYJA 3XISA 4H9XA 5GVJA 5FSEC 5EMYA 3HJEA 1Q85A 3WLOA 1KR1A 4GI9A 2G41A 3VIHA 1LOLA 1Y7VA 4Q4MA 4M56A 3TQKA 1QI3A 4A3YA 1VLIA 4C1LA 3PG8A 4B91A 4AY1A 1VCVA 1RZMA 5FAGA 1ECQA 2VQUA 4NKCA 5HUOA 5LIXX 3PP7A 4XZIA 2WPBA 1OK6A 3Q45A 1CXEA 2FFIA 3AYVA 3HJZA 3W1NA 1A5SA 2D1ZA 1A5LC 3DN5A 2EHHA 4XD5A 1XLDA 2VZSA 2QUVA 3CZ8A 4MWAE 1JCJA 3GVRA 3CIXA 1EOMA 1XDJA 3MVIA 4F40A 1CX9A 3RCMA 5MHBA 1AJ0A 3WJWA 3LRKA 1P0NA 4IIFA 3QZEA 5AYZA 4C6LA 1VRXA 3PZOA 4GC3A 2D2HA 2JALA 3HQNA 4QTGA 1JQVA 5A3HA 3QV9A 4LBRA 1PV8A 2Y7DA 2ZBTA 3WEMA 2QMKA 2PDLA 3F4WA 1F61A 4HPXA 5AHIA 2ZXAA 2OQYA 2HS8A 1QNQA 1WKFA 2R9RA 2R94A 4MWAD 1DYSA 4JX4A 3H4WA 4DJFC 7TAAA 3DHFA 1JL8A 3AS1A 2E5DA 5G2IA 3BLPX 4B9YA 4OQVA 1BD0A 1XLEA 1SFLA 5FF7A 1BQGA 1K4HA 2HSAA 1DJXA 4AIUA 3LHWA 1J0HA 1ENUA 3BGGA 1FA2A 4MMWA 1OEPA 1E43A 3XIMA 3PPGA 3SDOA 1XDMA 1NTHA 3M6DA 1GOKA 1H1ZA 1SFTA 1E71M 4LYKA 2NZLA 3ANVA 2VCCA 3WH9A 4M6QA 4OBTA 3TYDA 1Z41A 1OM0A 4P8XA 1TRIA 1CXKA 3W2MA 1DWJM 1K8XA 3ORWA 3QSRA 5BRBA 4QDWA 3IIZA 1FWDC 1TIWA 2O4MA 2XH4A 4E6MA 1DWIM 2YX0A 3T2QA 1WOAA 2NV9A 3N9KA 4IFOA 3V18A 3VOJA 1ELSA 1U1UA 1NDYA 1VCGA 5TNVA 3VD3A 1DWFM 1UIOA 2NWSA 2C71A 1T8QA 1OFQA 4A3HA 1CZ1A 3VNLA 2J62A 3KLLA 2D2GA 1K03A 1OZQA 2IMRA 4PMXA 5BMXA 1CI1A 2WSYA 4LALA 2J4GA 3LX9A 2OLSA 4EPDC 1WB0A 1C9DA 2XH0A 4Y6GA 3VDGA 1AA1B 1EF3A 4S1FA 2BS9A 2ZDSA 4FSAA 3D6NA 3VD9A 4X3ZA 1UOKA 3R25A 2ZA2A 3TFXA 3AHYA 2WPGA 1IZCA 1EBHA 4HT3A 1XM3A 4KEZA 3M7SA 1BYDA 3VNDA 4FS9A 1UIPA 3TMQA 1Q8JA 5BRPA 1O1HA 3WNPA 3EEGA 1QNOA 4NAFB 3B03A 3OVRA 1AJ2A 2OGJA 5H6HA 4B3ZA 3BCDA 4RPPA 2CLPA 2J77A 4XK2A 3S1VA 4GQ0A 5D2VA 2CBVA 4MKVA 5EBAA 4BF9A 4R34A 4FNPA 1R3QA 4C6JA 1W5QA 2AL2A 4AIBA 1P43A 3M5XA 1GK8A 3N2MA 3W7CA 1W0MA 3W87A 1N8IA 1PPIA 2QLYA 3AZSA 2WVVB 4QJ4B 4EE9A 1XIGA 2AOSA 3IRDA 1OX6A 2Y5SA 5BOFA 1QI0A 3GTXA 4C6NA 4OHQA 4FR6A 4Z1CA 3IUDA 2GGEA 3BMXA 3HBLA 4ZOBA 2QULA 2PDYA 4B5UA 2DEPA 4QX4A 3IGUA 4F0MA 3BJSA 3RR4A 4F0SA 3T0BA 4H9MA 1EGZA 1SO5A 3ANUA 4UUIA 3NDYA 5C70A 2PLJA 3LCWA 1OFOA 4LB3A 2OR2A 1VBRA 1HP5A 4KIEA 1X6NA 4DI9A 3VMOA 3W6MA 2ZZ4A 1ZBKA 3W26A 1J9YA 3LRMA 3GIPA 2QJHA 1NOFA 3U7VA 3LTPA 6TAAA 3ABRA 2HMCA 1CXHA 3EPMA 1HN1A 4Y9NA 5TIMA 1NH6A 1P7TA 3QLLA 3S1XA 1K7FA 4JEQA 2VFEA 1E55A 1BQCA 4WX2A 3VOHA 2PLKA 3KP1A 3KDNA 1TFVA 2DSZA 3EOUA 3QV7A 1TRDA 4IGNA 4W9TA 1W9DM 5FOOA 1UPMB 3M0YA 3HG3A 1WDDA 4GNJA 3G0SA 3C52A 3UZJA 2UY3A 3WELA 3B8SA 1QOXA 1EKOA 4KEVA 4DB7A 1ITQA 1WUFA 2XVKA 3GAYA 5AHMA 4E8GA 1ZENA 1XD1A 2OOFA 2A1YA 4XV0A 2DZTA 1UBPC 4HA1A 1T41A 5FEZA 5A94A 5BU6A 1JCXA 3W81A 2DUZA 2TMDA 2Q01A 3GQYA 2JIEA 4PE8A 3A23A 3ARYA 1ISYA 3GC4A 1QASA 3OA3A 5A6MA 2ZRUA 5I3DA 4DZHA 1OB0A 3P93A 6TIMA 4JXCA 4DPQA 1C8XA 3RGTA 3PHAA 4LOCA 1YBQB 2ISVA 1KKRA 2QJIA 3SGUA 1VC4A 5AKQA 1CBGA 3G0UA 1E9IA 3EGJA 5D02A 3WQCA 3CAKA 4XO6A 2V2HA 1JULA 1J0ZA 4M82A 4IGHA 1EC7A 5AHFA 1XLLA 4H7ZA 4Y9OA 2QZRA 2OTDA 1TV5A 1OC5A 1CIUA 2QCDA 1QPNA 4L7ZA 1MVYA 4N02A 1QT1A 3L2LA 3MY9A 2RDXA 5FIPA 3U9IA 4WXZA 3IJ6A 3W07A 5I3HA 1FTXA 4LXFA 2ZZ1A 1KTBA 2BY3A 4YVVA 4HA4A 3G77A 1RY8A 4IIDA 5I3IA 4JFSA 1MXSA 1UC5A 3NM3A 1U5VA 3UP8A 2WOQA 1WZAA 4FOUA 4PMYA 3SCQA 3TR9A 4GY7A 3P62A 3SCUA 5FJOA 3VKJA 1A53A 4KEMA 3VX0A 4S38A 5ABFA 2J78A 4EKJA 1MXDA 4KFOA 4S3GA 4UCFA 4HHHA 4OECA 1J6OA 1NWSA 4AWTA 4MPQA 1S3TC 1WP6A 2QJMA 3ABZA 1R9YA 2FVLA 2WMKA 4O0KA 1XBVA 3BV4A 4FEZA 4UBPC 1OIFA 3P81A 2WMIB 4CLMA 1RQEA 2AMGA 3M46A 3NDOA 5K4XA 2VEGA 4JQ4A 4UWMA 1KXQA 3BCJA 3DBPA 3L5LA 3QGAC 3N9SA 5U7SA 2QR6A 2GWNA 5GQBA 1VLWA 3LUTA 3ZSTA 5A6KA 1E0WA 5I03A 1KRBC 3VU2A 3GNXA 3S46A 3DFYA 1WDWA 1LRQA 1XQLA 1KFKA 4N9BA 2CZEA 4HTYA 4A2RA 1BSIA 3TN4A 4C6EA 4W8BA 3R8HA 3SRHA 1RP8A 1YNQA 3LCLA 4LS0A 4WK9A 5FCZA 3IJQA 2X41A 1XIIA 1V6YA 1YDNA 4JIRA 2GDQA 2REQA 2A3CA 4YVPA 1U33A 2BGNE 2GGIA 2E1WA 1UKTA 1PYFA 2PF8A 4RNHA 4DLMA 4OGZA 4D6JA 3TE9A 4JPGA 1QOPA 4CNNA 1E9YB 4GLEA 4DJDD 3HGOA 4S3BA 3H7VA 3FOKA 4LV4A 1NY1A 2PP3A 3GLCA 3QJAA 5JXQA 1VRDA 3AZTA 5LNUA 5A5WA 4PEKA 4AD3A 4MDOA 4O50A 2WAGA 2V3FA 4D6FA 2FDMA 2X30A 1B9BA 1D8CA 5TQLA 4DWSC 3LCXA 3L5AA 4IQLA 3TEVA 4BZYA 3OVPA 3NJ3A 3BURA 4J5NA 2YL6A 5M3WA 3PJWA 4AW7A 4CCCA 4AQLA 2Z24A 1K9FA 4C91A 1XIFA 3DU0A 3COTA 1MRQA 4A8IA 5HBFA 1T99A 2G4FA 2Z2AA 4PMUA 1GTHA 2OZ3A 3KWSA 2ODOA 3MKCA 1LJYA 1LCOA 2PWHA 3CBWA 3TYEA 4F2BA 4H9VA 1KTCA 3EWYA 4JQ3A 4D6DA 3N4FA 1XC6A 2QMJA 2YGYA 3VIKA 1JD7A 2KX9A 4GMEA 4XZNX 4IUGA 3A21A 4AYSA 1EQPA 5DCBA 3FS2A 4GKTA 1XYBA 1S2CA 1G6CA 3TK7A 4XG1A 3MSGA 1F6KA 4LH8A 3G6LA 3W6LA 3N15A 3I3DA 1GG1A 3THCA 4L1XA 3W73A 3KOYA 4EF8A 4IGMA 4GGHA 4PYSA 2QUMA 3UGVA 3AISA 1CGWA 5GJNA 1W3HA 3VDAA 1NF0A 1JZ7A 2W3ZA 4ZCWA 4KETA 1O1ZA 1YDOA 4B4FA 2BV9A 5A2CA 2WVTA 1XINA 3ELFA 3C2OA 3ATYA 3TWAA 1TIMA 3MHFA 3P5ZA 4NZ1A 1QMLA 2VZUA 2XM1A 1WDPA 4J3UA 3ZJ8A 3I6TA 4HBKA 4GVHA 4LX4A 1RQHA 2J8TA 5CBBA 2VVNA 3TUUA 4GABA 1KBKA 3W2UA 2HK0A 3QOMA 4JEJA 4MLJA 1SZFA 4PUNA 1MDLA 2VT0A 2RJGA 3AIUA 1KNWA 1S38A 1ZALA 1RVKA 1ZP3A 5LKYA 3MCMA 2EPMX 4D72A 4KWVA 1LOSA 2E40A 5FI8A 3SGZA 2G0WA 3KAOA 4IP7A 1SZNA 3REQB 4B5TA 4KWOA 1AW2A 2NW0A 3PC0A 1RK5A 5F2LA 3UYIA 3BWWA 1SW7A 4KRUA 1Q2RA 4HIBA 3TAOA 3VKCA 1QW7A 3MMUA 1H7XA 2P3EA 5DN1A 1GOMA 1I4NA 1HFBA 2GVEA 3M0ZA 2J7EA 5A8MA 4KQNA 2GVJA 2A3AA 1TE1A 3WENA 3FEMA 2ZRWA 4FLRA 4A22A 3R43A 5ABGA 3GD6A 1NIUA 4H6QA 2CZ5A 4IPJA 5D2YA 3V0SA 1F5ZA 3W37A 2D0GA 4OWGA 2ZZ3A 2YKKA 4NYUA 3EPNA 3HV8A 1WDQA 3PBUA 4Q22A 3LI0A 4YVXA 3OGRA 4U2ZA 5E5CA 4LVBA 5U4NA 2J7DA 3S2NA 2E6FA 5MKGB 3GNPA 1JNEA 1LL4A 5EMKA 2J75A 2PZ0A 4GIYA 3T8LA 2HPMA 1J6PA 2Y7EA 1XD0A 1QW8A 1PEZA 2WWCA 4U3AA 3NZ1A 3A3WA 4RDYA 4W7UA 4R7WA 1JYVA 2VKZG 4MAVA 4PMZA 1Z89A 1JDCA 2PDHA 3TXZA 3O3RA 3WLMA 3HGRA 2FPYA 4AY8A 2E6AA 2X1UA 3EX6A 4Y9PA 5JUVA 1TPH1 1V5XA 3B06A 3RX2A 1B3VA 4O1BA 1XP3A 3O05A 5EU9A 4XZLX 4AEOA 1R30A 2VWSA 2EKCA 1S3HA 1KCLA 4S3FA 3RX3A 4GUHA 3TTYA 2VR5A 3AHTA 2YB4A 3SGGA 4X60A 3NQAA 3ZQ9A 1LT8A 1BWVA 1PAMA 1KQYA 4K8EA 2QCFA 1W1A1 1JAEA 4G2DA 1B54A 1EA0A 1FCVA 4GXWA 2GZXA 3DCPA 5H8PA 2PDXA 3VO0A 1Q65A 5XINA 3PS7A 4H9ZA 3ZR6A 1JYWA 2PRLA 2J66A 3GXPA 5JBEA 2VX4A 1WZLA 1HO4A 3IGHX 4WSJA 2IKGA 2P88A 5LXXA 3UEQA 2XISA 3W2NA 2YZ5A 4GX8A 1UQYA 1GGOA 3LM3A 1W3TA 4NNCA 3IJ7A 4NSBA 1E4NA 5TD4A 4QSFA 4ML4A 3CNYA 2Y5JA 5ENLA 5A69A 2FDSA 3QXBA 4RNIA 4ZQOA 4E4UA 1GHSA 1FCBA 4U5KA 2V6AA 3CL7A 4HB7A 2IS7A 3GFYA 3E2RA 4I7UA 2IKHA 3PZTA 1JCTA 1XUZA 2C6QA 4O0QA 4JFVA 2PFHA 4GO8A 3KBMA 1S5TA 1POJA 3R89A 1J96A 3N3MA 3K30A 3CHFA 1LDCA 5IM51 4JN7A 1EO7A 3GDMA 5CG7A 1EWDA 5G1MA 1H49A 3U4FA 4KCUA 3S2CA 3SCNA 1FWWA 4AZIA 3AWOA 3VGBA 4JIIX 1KO0A 3KS6A 5EMLA 5BROA 1RY0A 2J13A 1OX4B 3NUKA 4JDBA 4FNRA 4PRWA 4LUSB 2BFGA 4YYFA 4F9DA 2BHYA 3TSBA 5IHRA 1QI2A 4K2SA 1B0IA 4FF7A 1H4PA 4DYKA 1EC9A 5C9UA 4KW2A 1L8NA 4JCLA 4LU0A 4MNMA 5BMWA 1UWAA 4ENLA 4OOZA 1FRBA 3BQ6A 3OBAA 1W32A 4PCPA 2PWFA 4GXPA 3EEZA 1QHPA 3I7QA 3F5LA 3I4EA 5JQ9A 1KC7A 4RUBA 3A13A 4MKNA 4IIHA 3EMZA 4UOJA 3GR8A 4QITA 3WUFA 3OVQA 4GPNA 4Z1AA 1JCLA 1A47A 2PGWA 3BAJA 1XCWA 4AY7A 4ZE5A 4GO9A 4E2OA 3VC5A 4NZ4A 1W1YA 5JU6A 5IDIA 2XVGA 3W23A 4HVXA 2OLAA 2YCKX 4UTWA 3NG3A 4EX4A 4CD5A 5F7UA 1KRMA 3T07A 4I9JA 4IHCA 5CGQA 4M7SA 8TIMA 1HO1A 5FL0A 1XFBA 4DUWA 3NQMA 1N82A 3OOQA 3TTSA 1JCMP 4Y7EA 4Z2JA 4DWSB 3MO4A 4RZ6A 4WY0B 4LNCA 1E6NA 2VOMA 2GGJA 5HJLA 3HPFA 2DIEA 2DQXA 4S3AA 3E49A 3TSMA 1GG0A 2E6DA 2WBKA 4KS0A 3WH5A 3IUHA 4QISA 3M41A 3GZAA 1H5YA 3TN5A 4AIEA 4N7QA 4LPCA 2WVUA 3VKBA 2OCZA 3C2VA 3MYPA 2R1MA 3MKVA 1OC7A 2PMQA 4UFMA 1FWSA 5C5YA 3QPEA 3FV9A 2PWEA 1Q7MA 2A7PA 4BWLA 1GQJA 2Y2WA 1SO3A 4AEEA 4AF0B 2XSBA 1V7AA 4NAEA 3VCRA 1JZ2A 3BMVA 3U5UA 1DHKA 3E2SA 5PTDA 1J12A 3NQDA 5D9PA 3APGA 5A8OA 4Z1YA 2VEIA 4PBFA 4H6RA 3KM8A 2VRJA 4V28A 4P61A 3BLEA 4J3SA 1FWNA 4K8HA 4UQDA 1F3XA 4B5NA 3NGFA 3BDKA 1LM1A 1X1OA 5LXEA 2QPSA 4W86A 1A0DA 1ITUA 3UW6A 2QCNA 5LIYX 3AZRA 5FD0A 4NVTA 1P0BA 1EJVC 3EWCA 3TW6A 1C7TA 2V63A 1G7VA 4ZB2A 4AZ5A 1GEQA 3NO3A 5JBFA 1C90A 4ZQRA 2VEMA 1CCWB 2VRKA 3W22A 3WQ5A 3MMTA 2HNEA 2QNEA 3PPCA 4ICNA 1GVIA 1R9XA 4FOJA 5FF0A 1PVNA 3HF3A 1P6WA 3E3HA 5D8WA 2O7SA 2OYKA 3R12A 3AIBA 2QUNA 4G5DA 4GXMA 3W2KA 1GQKA 4FNQA 4OUEA 3OJGA 1WBHA 1NJJA 3CWNA 2GOUA 2AKZA 1YTKA 4DO7A 1JGMA 3L0KA 4LUYA 3PBGA 3T4WA 1PXGA 2FHFA 4GYPA 4ZA0A 4KESA 3EDEA 4IFRA 4MNKA 5JBDA 1YKWA 2FTYA 4GKLA 3MJYA 3TOYA 1V6WA 2BWGA 5E9AA 3JVAA 3NOEA 4HNVA 3M44A 3FDKA 3F4NA 3EAUA 4PUJA 3S9IA 3I6RA 5CZJA 3RMEA 4Q4KA 4XUYA 3PWGA 3EWDA 3FHQA 3U48A 2NQ9A 4LAKA 4W84A 1XLHA 1UA3A 5J5RA 1P0EA 4QNWA 3LXCA 4ZENA 2QJJA 1SSGA 2PDNA 2VD9A 4EAYA 3M0VA 3OG2A 4U3CA 2VMFA 4HYRA 4KEUA 4Z1DA 3CLWA 3QY7A 4D6CA 4JDYA 4Y90A 4PODA 3UG3A 1TPUA 3N2XA 4NX0A 3VKAA 3V5CA 3GU1A 3KTSA 5HJYA 3LSBA 3QC0A 3U5YA 1AD1A 1XYCA 2YXXA 1FWGC 4U10A 4F0RA 3HQOA 3ONBA 1TPVA 1CGXA 3ARSA 1NQKA 3U8GA 4YS1A 2BXYA 3MUIA 3O7UA 7A3HA 1XIDA 2CHOA 2G4JA 2RUSA 3F4CA 3WBAA 3TSDA 1C9WA 3EYPA 1G01A 3SECA 3CUIA 3H53A 2OGYA 4R7JA 2W61A 3DFTA 4I5UA 3NA8A 1S5WA 4N9DA 3T08A 3UXAA 1F3WA 2WCGA 4AH7A 1C7SA 3PAJA 3CEPA 1ZGDA 4W87A 1ZB5A 3WLSA 3W86A 3I65A 3PZUA 2RGLA 3LBMA 1Y8BA 1OINA 1P48A 1R9ZA 4GY1A 2CITA 3E96A 3I10A 3T0AA 2OO6A 4CQ8A 2XIBA 2Y7FA 2DZSA 3KCJA 3WO8A 4AZCB 1RUSA 1TV8A 1VD6A 4K8GA 4D6EA 1BHGA 2NWRA 3QGKC 3AOFA 3VGFA 1HUVA 2R91A 3W83A 3UXDA 1E0UA 1K8YA 1US3A 2ZDRA 3GU2A 1WKYA 4WDUA 3W24A 1CXFA 4I8DA 4G1KA 4Q7IA 1R85A 4W7VA 2OT1A 5DQPA 3W7RA 4QG8A 2ICSA 2PBOA 5HUPA 3KRBA 4I9TA 4CGTA 5A6JA 2Z7GA 2PTZA 3B9NA 4HSHA 1FDZA 1J11A 1H7WA 1UJPA 2DFAA 3VDBA 3MZ2A 5AYXA 1PDYA 4MVAA 1FWCC 5D8ZA 3RM9A 1J5SA 4DPPA 3LZ3A 4JKKA 4GYKA 3P8IA 3LV5A 3N2TA 5LZLA 2WSPA 4XTIA 3WF4A 1UD4A 2F2HA 2J9ZA 1BXNA 3TIMA 3I7RA 4EOUA 1P5BA 2XN2A 3CHVA 4EANA 1BYAA 4LBUA 2CLKA 2JE8A 2GUYA 4JICA 3QMTA 3AMLA 1D7FA 5DBUA 3UQNA 3A24A 3OLDA 3HTWA 1YADA 1VFUA 2BOFX 3D3AA 4RXGA 1O5QA 3VDCA 1VS1A 4LF1A 4JQ2A 1S2VA 2EBNA 2GUBA 1AG1O 1H2JA 1XLKA 4BS0A 2PS2A 4PTVA 4GVIA 4LV9A 1E72M 3OZMA 2PDKA 4C6KA 1KB3A 4IF2A 4EAMA 1EIXA 3WD2A 1RLCL 1PYMA 3GHTA 1EZ2A 1KRAC 4TUFA 3QR0A 2C3ZA 1V4YA 3PBYA 2UWFA 2P76A 5K4ZA 1AL7A 5E6ZA 3CAQA 3GG8A 4QLJA 3STFA 4RNJA 1X98A 2CBIA 1LQ0A 1EBGA 1NWRA 3RR1A 4UOQA 3THQA 1V08A 1LF1A 3UPBA 3DHDA 3QQ1A 3G1SA 3W1QA 2VI0A 1IV8A 2JGQA 1QNRA 3LNPA 1A80A 2Y6ZA 3QTPA 3ABQA 3SFKA 4FALA 3RCYA 1QVBA 3FXGA 3VNKA 3AJ7A 5I5RA 3G2GA 3OHMB 5EGRA 2J74A 2XVLA 2I57A 3AIVA 1ZCOA 1JPIA 1MZHA 5HOSA 3I3EA 3BMWA 2CC0A 4PRRA 2VGGA 4TV5A 1O4UA 2HCVA 3TU9A 3WK3A 3SR7A 4I5XA 5D09A 3W84A 4CD4A 3RM8A 3MB9A 3WD1A 1UR2A 3TNOA 1XFCA 4WRHA 2A0NA 2BY2A 1AMYA 3VABA 3C3UA 1XR2A 3BL3A 1OT1A 5DY2A 3UZWA 2W79A 1EX1A 4X0NA 5D4YA 4S23A 1W5MA 3S8HA 4GFIA 3QPYA 5EPDA 2V38A 3N6HA 4CCEA 2QXWA 4MTVA 4N2YA 3PTQA 4JQAA 1P0KA 4H9UA 4BCEA 3OGVA 1EYWA 1K1DA 4BEQA 1BFNA 3GXNA 4XB3A 1AW1A 2TRSA 2Y7GA 4TX8A 2OMAA 3RFAA 3IJ9A 3WF0A 3SY5A 3AFBA 3T2OA 3PZQA 3TC6A 4A4AA 1Q7ZA 3CTTA 2WNZA 4Z17A 3DUGA 3EXSA 4PRTA 4DJFD 2HQAA 1R6WA 2PU1A 1RQBA 3FYPA 4Q32A 1R2RA 3KL5A 3ZFHA 5I3JA 3OTRA 1G94A 1XCXA 4J7RA 3TROA 4JN6A 2XYLA 3RUBL 1G4PA 4HJWA 4MADA 1QI4A 3HV9A 2E7FA 3UPMA 3VUPA 3TVAA 3AMDA 4TMCA 2XFRA 1MNSA 5HK4A 4GI8A 1W9UA 4AHQA 5I06A 1E1FA 1QOQA 4DX3A 1MW1A 3N3TA 2NLYA 3CH9A 1ZU8A 3PZ9A 3PNUA 3VA8A 3L12A 3IEBA 2PTWA 2EKGA 4OIFA 3RJYA 4LUTB 2I9UA 2I5QA 1GVSA 1SMDA 1CGVA 2VQTA 3NQFA 3SN4A 2NVCA 3ARQA 3KW3A 4BKNA 2QW5A 2PUZA 1ICSA 3W7DA 4A3QA 4QAIA 3PULA 3NZQA 4QE1A 4AISA 2PLCA 4YL2A 3UBPC 4IH3A 3BW4A 3ITVA 1M1BA 3DFNA 2ZTJA 1SPQA 3RX4A 3MBDA 1X8CA 3C86A 4I6KA 3WF3A 3NFUA 1EYEA 4D8ZA 4P7QA 2ZOXA 4O4VA 4A21A 5AN7A 1DE6A 1JNDA 4NHVA 3QY8A 5TF0A 4C1KA 1ALDA 1D7KA 1Q6DA 2FQIA 3BZJA 4KRZA 3ZLGA 3NAVA 2W4XA 2ACQA 1TZ9A 3TA6A 1X1NA 4H04A 3GM8A 1MEWA 5AHLA 4HCLA 4KWWA 3RITA 2EG8A 3DG6A 2ISDA 3DESA 5JMUA 2YYUA 4HPJA 7CGTA 2P1FA 1DJYA 2OZ8A 3HPAA 3IVUA 4NI8A 4EPEC 3WUEA 4C6DA 1OIMA 4R3UA 3VC6A 1PZ3A 4O8AA 4JTUA 1UPPA 1K7EA 3ES7A 4AXNA 3REQA 4JHZA 4WY0F 4Q4QA 2WHLA 4ROQA 1UC4A 4DIAA 3L4WA 4Z2KA 1XIJA 1GORA 2PPGA 3FGCB 1ZBWA 3ISIX 5I7GA 2GPTA 4R27A 3CJPA 3BG9A 4PTDA 2AGTA 1UB3A 5DO8A 4ICMA 1QTWA 4GNKB 4YCOA 1J0JA 2PWDA 3OQ8A 2VC6A 4O13A 1ZL1A 2BOEX 2C79A 3U2ZA