4RR4A

Crystal structure of human dihydroorotate dehydrogenase (dhodh) with dh03a367
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
365
structure length
365
Chain Sequence
TGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human dihydroorotate dehydrogenase (DHODH) with DH03A367
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
total genus 137
structure length 365
sequence length 365
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2014-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4rr4A00
3Q94A 4RKAA 4Y96A 2BSLA 2O7QA 5AHNA 3MI6A 5C55A 5HULA 5AHMA 1QPNA 2DZPA 3FYPA 3STCA 5LNVA 1TCDA 5AHFA 4LVBA 2ZRXA 4UFMA 1DHPA 5BNKA 3EX3A 3UWYA 2ABAA 5KZDA 4S2CA 1SSDA 1H7OA 3S1VA 4LU0A 1W5MA 1JVNA 3W7LA 3G1FA 4UFLA 1JCLA 1GG0A 4J9JA 4X2RA 1O95A 3W2NA 4M6PA 3DKLA 3LCGA 3DBPA 5LZLA 2DZVA 4H4IA 4DEFA 4UTWC 1DBTA 3QC3A 4QM1A 5AYYA 3LXBA 2E6YA 4NJIA 2Z6JA 4JICA 4RV8A 3PVFA 5L6UA 1TMHA 3W70A 5HUOA 3STGA 1LM1A 4H3DA 1F2JA 5HWJA 5BMXA 2JBMA 3S1UA 1MEIA 2PC4A 5D02A 2YGYA 2QUVA 4RJEA 1B9BA 4NNAA 4QQ3A 5D2XA 4RZ5A 1VH7A 1LOQA 4K7VA 4LS1A 3E9AA 4Z1BA 2XFWA 3STFA 3E12A 3TIMA 4UMBA 1JUKA 1TTIA 4IPJA 1MSSA 5C5YA 1BKSA 1DJNA 4UFIA 3QJAA 3W7CA 3W7PA 3BO9A 2QUTA 4TR9A 1I2QA 4JTGA 3WK0A 1UUMA 1X7FA 4UTKA 4UNKA 5BW6A 1KW1A 4CNNA 2Y85A 5I3KA 3K30A 3DZ1A 3EX4A 4JX6A 1G4TA 1TB3A 3EB2A 3DHFA 5E0KA 4O11A 3MYPA 3RU6A 1NF0A 2P0OA 1TJRA 5EMUA 4HPXA 5AFDA 5CZSA 1IXPA 2VKZG 4ICNA 3KVLA 3LTSA 5F1UA 2ZZ1A 3EWUA 3NVTA 3WK3A 2FLIA 2E6AA 4NNBA 2DZXA 1W5PA 3TAKA 4BI6A 5K3VA 3NL5A 3VNDA 4NQ1A 3PY2A 1VYPX 4YMZA 2EKCA 1RPXA 4N9EA 1JUEA 4MUZA 3M44A 3W76A 3VCRA 3TFXA 3N2XA 1JCJA 1G6CA 4K37A 1SO3A 2YXGA 1GOXA 4O15A 2WSQA 3MWAA 1LRQA 3GDKA 1LP6A 1Q3NA 4AWTA 4L4LA 4NJGA 1K7EA 1QR7A 4GE8A 4PCFA 1AL8A 4DPQA 3W1NA 3LXCA 2GOUA 5HWNA 4N4QA 3C2EA 4IMEA 3L21A 3OG3A 1SQ7A 1JUBA 1OF6A 2ZTJA 1A5CA 4GXMA 2ZZ3A 3NPWA 4OQVA 1EUAA 3T4CA 3HG2A 2R94A 4OWGA 1LRNA 3DFSA 4MLJA 1WAUA 3M7WA 1N7KA 4W9TA 2E5DA 2GJNA 3CLMA 2ZZ5A 2WNQA 3M41A 2JGQA 2GPTA 1T96A 5LNSA 5LSMA 5KMYA 3VE7A 3W2JA 1ALDA 3TC6A 4O52A 2C6QA 3PS7A 3NG3A 4BI7A 1UJPA 3LGEA 3RLUA 2EHHA 5F4XA 2QCMA 3P8JA 1IF2A 4UC5A 3QM3A 5F4WA 1FWWA 1WDWA 4MLRA 4PODA 3C52A 3W7EA 1I4NA 4E2DA 2I1OA 4HT3A 3LI1A 4LWWA 5LNWA 2KZHA 1EP1A 2RHGA 1ZAIA 3PG8A 2F7FA 1FBAA 3TA6A 1EA0A 3NZ1A 3KRSA 4MY8A 3SJ3A 3S8HA 2FPYA 4QAIA 2YYUA 1D9EA 3FJLA 4RCXA 3MW7A 3GDTA 3W87A 3BW4A 1FX6A 1OFEA 5F4SA 3NYZA 1RR2A 1VRDA 2QKFA 1SR9A 1TPH1 4LC6A 3TFCA 2R91A 3CIWA 4JN6A 5TQLA 4M7SA 4NT0A 4XKYB 1Z44A 3UWVA 4UMAA 4KFNA 3DU0A 5HWMA 5G1YA 3EKLA 3W85A 2E1DA 4S2BA 1EIXA 3SFKA 1B4EA 2A4AA 1C8VA 3F4WA 1LBMA 3TROA 3MBFA 3MHUA 5D03A 4JXCA 4HSNA 5DY3A 4JTFA 3W7KA 4TMBA 3GAYA 3PBVA 3B0PA 3L67A 3LHVA 3V1PA 1FCQA 3HGJA 5K7JA 3NDOA 3THAA 4YCOA 2PURA 2CLKA 1M7OA 3CIXA 2VFFA 4O13A 2WQPA 1M7PA 4KFPA 5FEXA 3ZWSA 3TK7A 1G4SA 4Z0SA 2WKJA 1SU5A 2C15A 5D2YA 3GXNA 3LHTA 2DP3A 3QFEA 1ZCOA 4JDBA 4AMAA 3IIZA 4O1DA 1ICPA 3LHZA 3WJZA 1W56A 4JNMA 3M0ZA 4LVDA 1DOSA 1DL3A 2QCEA 4XUGA 3RFAA 1N55A 3HMJG 1GTEA 4Q4KA 1DQXA 1TIMA 1LYXA 2A21A 3WJYA 3M5YA 4UCGA 3OVRA 1GVRA 1TPDA 1I45A 4E38A 3GIYA 3IGXA 1ONRA 4NZFA 5BOOA 3CWNA 3TSDA 3O05A 2NUYA 3DAQA 1G4PA 3QMRA 4BWLA 4O1BA 3GNDA 4UMCA 3LBMA 1GYLA 3VFLA 5HNRA 3WK2A 3HOJA 4RZ4A 5F2IA 3M1ZA 1YLVA 2ZRVA 1JR1A 4ZL1A 3TJLA 3C2FA 1PCKA 3KOFA 3W71A 2X2GA 3FIGA 2Y61A 3QPZA 1ICQA 5DXXA 3TC7A 1W8SA 4QIUA 3S5ZA 4ADSA 3U6WA 4R34A 3TJXA 4GUIA 2H6RA 3H55A 4C1KA 3CQ0A 3TCEA 1UASA 2PRMA 3CC1A 5TIMA 4PH6A 4XKYA 4JDYA 1A5BA 2E6DA 3HG4A 5CGQA 1UB3A 4LS2A 1H1ZA 3VE9A 3P8IA 3W1XA 1OFOA 5F2MA 3QYQA 4XBKA 1J2WA 1KA9F 2NXIA 3INPA 1OX4A 1PL9A 1J5TA 1IXQA 1K02A 2NV2A 3ELFA 2CW6A 3NQVA 2EGZA 3LLDA 1A53A 3GXTA 3TQ0A 4RLIA 3G8RA 3W2UA 3DFPA 2J6XA 6ALDA 5AHEA 3BLEA 4UTMA 2YYTA 1FXPA 3GKFA 5HUPA 4JTTA 3SIZA 4DF0A 4O0KA 1O94A 3W6YA 4UTUA 1V7YA 2X1TA 4MZ1A 5AYZA 4FEZA 1F7BA 3W1QA 2CLFA 4O12A 2H3DA 1PCWA 4BF9A 1XBXA 2A6LA 1ZALA 4K39A 4CQ8A 1PE1A 4IUOA 2VENA 2FPTA 3ZFHA 2QCCA 2FPVA 3W7RA 1BTMA 2WSYA 3W7OA 4N2YA 1G69A 2EPHA 2Y7EA 3M47A 1HFBA 2CLIA 2RDUA 4TMCA 4NJJA 4ZQNA 3LXAA 4PL2A 2CLHA 3HIJA 3MUXA 4FX6M 5FI8A 4YCPA 1OFQA 3IIVA 1OX5A 1WBJA 1I8JA 2JKEA 3DENA 3PC0A 1FCUA 3NXFA 4PEKA 1AK5A 1SW3A 3I65A 3ATZA 2YFNA 2QAPA 3W2LA 2Q8ZA 3NQ6A 4IOTA 3LCLA 3NM1A 4POCA 3OVQA 2ZRWA 4AWUA 4JD4A 2QUUA 3PBUA 3SR7A 3Q2DA 4FF7A 2H90A 4RR4A 1EB3A 4HHPA 1I2NA 4YLWA 5EY5A 3W07A 1H5YA 1K7FA 4CQ9A 3JR2A 1OHLA 2NX1A 1P0KA 4A29A 3BV4A 1DQWA 4FNQA 4N6FA 1VGAA 5G2HA 3UXDA 1SFLA 4NXKA 3ABSA 3W75A 4MY1A 2D73A 3G0XA 1I2RA 1LROA 5CG7A 2Z1BA 5D2TA 5K4ZA 2GQ8A 3UYCA 1VCFA 4LY8A 2W6RA 4IX2A 4JTLA 4LC8A 1FQ0A 4ML9A 2Y62A 1ZAJA 1SUXA 4IGHA 4MKNA 4JTJA 1GQNA 4UTWA 4WXZA 1SFJA 3QZEA 3N34A 1X1OA 5EYWA 4X9SA 4HPJA 3RF9A 3W7MA 3MJYA 1SSGA 2O7SA 1L6WA 3H53A 2RH9A 1H7NA 3SGZA 3TXZA 2X16A 3LHUA 3S1XA 1MEHA 1H61A 3RNDA 4BI5A 3IVSA 1F5ZA 3S42A 3HGRA 4P61A 4CNOA 4FO4A 3O1NA 4EF8A 4ONVA 3A9IA 3CU2A 5AC8A 1DKWA 1HTIA 2JK2A 3NQ2A 4JGDA 1BWKA 2ZQ0A 3LV5A 1WA3A 3F4NA 4N6EA 1RZMA 5EPDA 3HG3A 1KFEA 1EP3A 1W5OA 4JEQA 2YFOA 3IIOA 1S5WA 2CZDA 3W7DA 2VXNA 1Y0EA 1X6UA 3FOKA 1XM3A 1QOPA 3E96A 3LB0A 2R8WA 3L0GA 5F1VA 2GJLA 1OVDA 1X8FA 1KM6A 4P2VA 4ZZ9A 3T40A 3LRKA 4UFJA 4WD0A 1R2TA 2Y63A 3LBCA 1R46A 4DELA 4IMFA 4K8EA 3C2VA 3WJXA 4DPPA 2DORA 3TKFA 2ISWA 1ME7A 1TPWA 2X30A 3G1HA 1GVQA 1OX6A 1OK4A 4NJKA 3B0UX 2ZRYA 3B06A 1QPRA 1LDCA 3M9YA 1DORA 3P67A 2C1HA 2VFHA 3TMLA 3L5AA 1C9DA 5DCEA 3IRDA 1L6SA 1NSJA 3QW4B 4R53A 2BWGA 3ANYA 2V9DA 1A5AA 3ABRA 2OCZA 2VC6A 2QAFA 3NL2A 1PVNA 1W3TA 1TV8A 5LHFA 2E77A 5LNUA 3FKKA 5C54A 1H51A 1Q6OA 1IIGA 1H7PA 1P0NA 1F74A 3TQVA 2QR6A 3UPWA 1P1XA 4MFEA 4LV4A 1R2RA 2C19A 1KFLA 1TYGA 1QPQA 4K8HA 1Q6LA 4XWUA 2NXHA 4MOZA 4AVFA 1YDNA 3HBLA 1NAL1 1QDSA 1SW7A 2WNZA 4WX2A 2CFFA 1GTHA 2VEIA 1WV2A 4XTIA 3TX9A 1YXCA 4UTHA 5AHIA 5FEZA 4CCCA 4E2BA 5DN1A 3NEVA 4LUIA 3B05A 5U4NA 1CX9A 3G22A 4ZVJA 2V82A 1SPQA 2XN2A 4TX9A 3R2GA 1XBZA 2NUWA 4EIVA 3B0VC 3AJXA 1FCVA 1VS1A 4KWWA 2I14A 3O63A 1IXNA 3T7VA 2R14A 1HUVA 2RFGA 3WK1A 3TSMA 1KM2A 1TPUA 1LCOA 1ML1A 3UY8A 2WV8A 3HF3A 1B3OA 2FB2A 3G1YA 4GFSA 2ZRUA 2DJXA 2ZZ2A 2FB3A 5G2IA 3NPXA 3LDVA 1Z48A 4UUIA 3W1LA 1G7UA 5J5DA 4YXGA 3T78A 1FUYA 2A6NA 3PB2A 3P61A 1TPVA 3LHYA 4O18A 1KTBA 3G1DA 4U4MA 3IIXA 4HNTA 3H54A 5DY2A 4AB4A 4UTTA 4JYFA 4JTSA 4JYEA 1OABA 2TSYA 4IX0A 5LKYA 4N9BA 1ADOA 5J5RA 2A85A 3ZS4A 4UIOA 5HINA 1YPIA 2Q8LA 1YXDA 3MP5A 4O14A 5I3FA 2B7QA 2OT1A 4MZ8A 5G4WA 1SO6A 1Z41A 1V5XA 1YADA 2PE4A 2ISSA 3W73A 2RKXA 3BG5A 3G0UA 3RK8A 1YYAA 4WUIA 2GVLA 4MIMA 4ZQRA 3HJZA 5AHLA 2QCFA 4O4VA 3RLVA 5KZEA 5CKSA 3QMTA 2FQIA 2CU0A 3R89A 2YX0A 5G2WA 4JIQA 3W2KA 4NNCA 1FDJA 2P1FA 3R12A 4HSOA 1ME9A 1KM1A 3M5VA 4LV9A 1NVMA 1PHWA 1GPWA 4Y8FA 2EAWA 2ZTKA 1WOBA 1TPC1 4L4MA 1H7RA 3TW6A 3U8GA 1OYAA 3NM3A 3O8AA 3A5FA 4ZMGA 3S6DA 5HQEA 2W79A 1LOLA 1KBJA 4Y6GA 3CM4A 3G3MA 1S5VA 5CSRA 3S5OA 3NQAA 3EXTA 2B7OA 3NQFA 3L0NA 3A21A 2A7NA 3C2OA 3IGUA 4CQAA 2Y7DA 5F2LA 2V5LA 1ZY9A 4UTJA 3GB6A 2B0MA 4FNRA 5EKYA 4HNUA 4LTSA 3W1MA 2V2CA 4Z08A 1ZNNA 5D30A 3UXAA 5G5IA 3QEZA 3SI9A 3DHDA 4O17A 4MYXA 1M5WA 1AW2A 1GWJA 2GQAA 3N9SA 3C0JA 2VFIA 3HB9A 3FJ6A 4DO5A 1EPXA 3TE9A 4FX7A 2NUXA 3T55A 2CWNA 1KFKA 3W9ZA 3UNDA 1UCWA 2B4GA 4IXXA 5DBUA 2AQWA 4O4WA 1G4EA 4QJ1A 1F6KA 1B4KA 4WXYA 1OFBA 2ZFAA 3M5XA 2W0UA 1THFD 3OA3A 4WZHA 4M6QA 5KTLA 3LCHA 3LM7A 2PRLA 3A22A 3P7YA 3BPWA 1LBLA 1H60A 4O0ZA 3L66A 1SZEA 3EWYA 1KTCA 3W22A 1OFRA 3PF3A 3HO8A 1F73A 5ABTA 1RD5A 3TNOA 2Y7FA 3N19B 4D2JA 2ZA1A 1SO5A 3FYOA 5D38A 1FCBA 5FF4A 4UNLA 1YTKA 3OEXA 1EUNA 5I3GA 1K03A 3S1WA 4MPQA 4GUGA 3D0CA 1N8FA 5CZTA 5C2XA 5MHBA 3G24A 3L5LA 1MZHA 2CLMA 1H63A 4UXDA 2WNNA 8TIMA 2E5BA 3I6RA 3NL6A 1YDOA 2TPSA 4OV4A 3O07A 1LZOA 4OT7A 2QCLA 4JTHA 3IV3A 5IM51 4OHQA 3SZ8A 1WOAA 1G67A 4O16A 3QSTA 2A5HA 1AMKA 2VELA 3W1PA 5K4XA 1MEWA 3TAOA 1XXXA 1IGSA 4AF0A 5C6MA 2J27A 1W0MA 5CSSA 1OX4B 3EKZA 3UWWA 2Z0IA 1AW5A 2VFEA 2IQTA 2V30A 3LCIA 3AO0A 3LI0A 3IGSA 1VYRA 1YTEA 1KM0A 3W7IA 2V81A 3ATYA 2GQ9A 1RQBA 5D2WA 1W5NA 1PIIA 4KFOA 1TJPA 4JYDA 2VOMA 2ZZ4A 4JTEA 1W3IA 3R8RA 3GNNA 2ZDRA 4K7YA 4GBUA 5TBOA 3GLCA 4FNPA 2Y70A 3FEMA 3N73A 4MVAA 3FKRA 1WXJA 4ZQCA 4JS3A 5FF7A 2QCGA 1X1ZA 3G1XA 5BRBA 2VFDA 1IIHA 1OYCA 2YDAA 3GXPA 3SSJA 4IQLA 3IVTA 3DXIA 3KX6A 1WBHA 5KINA 4XBSA 1JQXA 4FNUA 3W1UA 4MFDA 5HJLA 1O60A 4M7TA 1RQHA 1HO1A 4DF2A 2ZBTA 3KVJA 2YR1A 4EWND 3HPXA 2Q3RA 3W7NA 2NXGA 2WO5A 3NO5A 3CEPA 3L5MA 1GG1A 4JTIA 1RV8A 1XKYA 1KM3A 3PSVA 1P5BA 1OFDA 2WOQA 2E5CA 4UFKA 1TTJA 2H8XA 1K7XA 1T0OA 2CLLA 4MY9A 1VHCA 5CZ0A 4O50A 3NQEA 3G3DA 2Z6IA 2Q3OA 3MI3A 4HN4A 3GVGA 3M43A 3BLIA 1H1YA 2HSAA 4EF9A 5HMSA 3BLFA 3NQDA 1TV7A 4IMCA 3EX2A 2YW4A 1OFAA 1XBYA 5D33A 1BEUA 3B4UA 3OBKA 3VKJA 1QNVA 3R5EA 3SECA 4ALDA 5H2ZA 1ICSA 3DKJA 1QOQA 2DZSA 1R47A 3O16A 3IEBA 1JULA 2P10A 4AEOA 4AAJA 2GVJA 4O28A 1XC4A 2E6FA 3KFTA 3M5ZA 4NX0A 1H7XA 3UZ5A 4B5NA 5CPNA 1KTNA 3EWBX 2JKAA 3F03K 2RDTA 4UR8A 3DI0A 3W7QA 3NQ7A 7TIMA 3G1SA 3QQ0A 4WJEA 4FXSA 1WQ5A 4G1KA 2NWRA 3GDMA 1W3NA 3WFAA 1JCNA 4ORMA 4NJHA 4DBDA 4N9DA 1SZFA 4FX8A 4LW7A 3EWZA 2C0AA 3B04A 1VHNA 1L2UA 1VCGA 4TU1A 2NX3A 2FTPA 5LHEA 5I3HA 3LRLA 3TUUA 3NAVA 4M19A 4R33A 5D04C 1YPFA 2V2DA 3KRZA 3L68A 4X3ZA 2TRSA 4Z1CA 2FJKA 1TO3A 4N02A 4WY0B 1U83A 2AAMA 2QCNA 1DJQA 1TPEA 4DBEA 1E51A 4AHOA 5A5WA 4Z1DA 2CZ5A 3MP3A 1S5TA 2FIQA 4WOQA 3BVJA 3G1VA 3THQA 2ABBA 3O6DA 3W1TA 3P60A 1YTDA 2YSWA 2YW3A 3HQ1A 3N2MA 2ZA3A 1IXOA 4C1LA 5SWUA 3EXSA 4O1CA 2XN1A 2WSRA 4EVZA 2TMDA 3HG5A 4RK8A 1XI3A 1FY6A 2QJHA 2YPIA 5HR7A 5DCDA 3LV6A 3UWUA 4JY8A 1EEPA 3C56A 3UZJA 2B7NA 5FF0A 2RDWA 2OMAA 2UV8G 4NX5A 4BFAA 1VC4A 4U28A 4MJZA 2A1YA 1TRIA 4H6KA 4GWEA 5CPLA 1VZWA 3G18A 4PTNA 5G4EA 5K9CA 1XFBA 1W54A 4KKXA 4QSHA 1PS9A 1XDLA 2ISVA 3M6YA 4LOCA 1L9WA 3TU9A 3FS2A 4BWLC 2DZWA 1JJKA 3C4UA 5LGXA 2G96A 1OG0A 2GUUA 3G0SA 5I3IA 1W37A 3B8DA 1R2SA 3PUOA 4IWWA 2HMCA 1DV7A 1H50A 3SGUA 3P5YA 4O1AA 1TREA 5K9XA 4NZJA 2A7RA 1FWSA 1LRTA 3UWQA 1KLYA 2Y6ZA 3S5YA 1GEQA 1R30A 4UTLA 1B57A 1MO0A 1H7WA 2NZLA 4JTKA 3TDFA 1K8ZA 2AGKA 2CLOA 4N4PA 2Y88A 4LS0A 2C18A 2OT0A 5LGZA 2DZUA 4TIMA 3L9CA 2JGYA 3PUEA 1H62A 3GDLA 3EX1A 3W23A 3W72A 1VJIA 5IBXA 1S3HA 1EWEA 2QDHA 3UY7A 4YL2A 1DVJA 1SO4A 1ZAHA 2VFGA 3IVUA 1XL9A 1SZNA 4JIPA 1Q45A 3A5VA 3P82A 3W7JA 3VI2A 3S9YA 5CPMA 3MHFA 5DELA 1XBVA 3YPIA 1QAPA 4JX5A 3DFOA 2DJLA 3G8EA 1ZFJA 4RXGA 2PRHA 4FIQA 4DXVA 3SW6A 5AC7A 3V75A 1UBSA 1QCWA 4GRSA 4LNYA 5GVJA 3TSBA 4I7VA 4I7WA 5HR6A 3P80A 3KRUA 2A2IA 5L9FA 4NU7A 2G95A 4WOZA 3GR8A 1W5QA 3OIXA 3C6CA 1QO2A 1VLIA 3W88A 3PG9A 4DF1A 2V0TA 2NV1A 1CI1A 2G5WA 3E02A 4AHQA 1VR6A 1EX5A 1Z42A 1SW0A 5CPOA 1TQJA 1T8XA 1F76A 3C2RA 3NGJA 3MYOA 3PUDA 2HS8A 5AB3A 3NL3A 1F05A 3C3NA 3DFNA 1TSIA 1C29A 1AL7A 3FFSA 3U2OA 4NVTA 3NPUA 5CZJA 3EWXA 3EXRA 4A2RA 2J88A 1WX0A 4M5PA 1A5SA 3W3OA 2ZCGA 2CZEA 3BW3A 3JRKA 3UD6A 3BG3A 1K3UA 1CW2A 3Q58A 5U7SA 3HGSA 4K36A 1KV8A 3S0CA 1OJXA 3GR7A 2FFCA 4K38A 3NPVA 3HGOA 4WY0F 5G1TA 1QWGA 5FESA 1M6JA 4K6AA 4JR5A 1NFBA 1K8YA 4QNWA 3PAJA 3NR0A 1O5XA 3TR2A 3LX9A 2BX7A 4O8RA 3ABQA 5AYXA 1VYSX 4ADUA 2V8ZA 3G1AA 2VEKA 4IMDA 2Y89A 2ZYFA 1GJPA 4HIBA 5K9DA 4FNTA 1F6PA 1HG3A 3LOTA 3PULA 3QQ1A 3MBDA 3L65A 1KV5A 3BW2A 3NZRA 1W31A 3W2MA 5D32A 4BR1A 4GUHA 4NXSA 5D37A 5EBUA 1JRBA 4KWVA 1JQVA 1TV5A 2BXVA 3GX9A 3NOEA 3MP4A 4ZQPA 3GK0A 3UPBA 3TQKA 4CLMA 3IIPA 3WJWA 1LTDA 3BGGA 3PBYA 1NF7A 3LCWA 1KM4A 2H3BA 1GVSA 1W1ZA 3I7QA 2C13A 4OGZA 2X1SA 3NQ8A 5DLCA 4LVFA 2PCQA 3I68A 5EL1A 3E49A 2CZFA 3P84A 3C61A 1LORA 2BTMA 4XZ9A 1ZHAA 1A50A 3CHVA 3HPZA 1OK6A 3PBWA 2X1UA 3QH2A 1LOSA 2A0NA 3CWOX 3L2IA 3HPSA 2I9EA 2HTMA 1FWNA 1D3GA 2ZA2A 3CT7A 3TMQA 4LUJA 3QPYA 1TTPA 4GC4A 4A2SA 4AWSA 5FEPA 4DO4A 4O54A 3O15A 5KZMA 4WQ6A 3I7RA 2ATMA 5E93A 1K8XA 5EA9A 3W74A 2YZRA 3T44A 2EF9A 4LRSA 1GZGA 4AF0B 2QJGA 3JS3A 3M16A 2QEZA 4Z0JA 1YXYA 5AN7A 2OJPA 4EOUA 5AC6A 2J9XA 1TRDA 3F1QA 5FF2A 3MI2A 3MHGA 4FB7A 3LCFA 4GJ1A 4Q32A 2ALDA 4FIRA 4ZQOA 3PWAA 1I2OA 3GDRA 2J9YA 1OYBA 4IXHA 3CPRA 3CTLA 2Z2UA 3UQNA 3KVKA 4O53A 3LLFA 1LBFA 1XUZA 4UR7A 4PFMA 5D2VA 4XQ6A 4FNSA 1BWLA 4MZYA 4RXFA 1Q6QA 4FXRA 3PR2A 1J4EA 3WJSA 3DGRA 1KFJA 1KBIA 1UUOA 1PV8A 3LCXA 3GKAA 4A21A 2JKPA 2X1RA 3OVPA 4MYAA 5DXYA 3ZWTA 4M6VA 3W83A 5AOUA 5K2ZA 1LLWA 4A3UA 2DZTA 2E68A 3KAOA 4Y90A 6TIMA 2WJZA 4XTDA 3QW3A 1EP2A 3NQMA 1WYIA 4NUWA 1JCYA 4LVGA 4O19A 2GVGA 1KFCA 1KFBA 3W86A 4LRTA 3CB8A 1GVFA 1OFPA 4ADTA 3DH7A 1XUUA 2TYSA 4HNNA 4WY0A 5H91A 1ME8A 3A24A 1O5KA 1FDZA 4OE7A 1T99A 3LHWA 3TXVA 1KM5A 4I9AA 1FDYA 3NA8A 3ABOA 3GYEA 3QSRA 2OX1A 4UTIA 5DBTA 3W7GA 2E09A 3P5ZA 3MMTA 4YWIA 4UFHA 3GZ3A 3EX6A 1TPB1 2NLIA 4Y9AA 4A22A 4JX4A 2J24A 3STEA 1PHQA 4GNJA 3R13A 4E0CA 3BK0A 1JCXA 1Q6RA 1HO4A 3OHIA 3N14A 3QRHA 2BZNA 2Y7GA 1G7VA 1ZENA 5KITA 3I7SA 4PC8A 4JTUA 1XDMA 2XN0A 3Q37A 1VQTA 2B7PA 4AH7A 2BLEA 4OV9A 1O4UA 2FDSA 4IPIA 4UTTC 1TPFA 2C3ZA 5D09A 3QMSA 2OZ0A 3LTYA 1KLZA 2C16A 5T26A 3TW7A 2YCEA 1L6YA 2VEPA 1VLWA 4X22A 4RZ6A 5FF3A 2G97A 3E0IA 1YDVA 4JY9A 2V5BA 1GVOA 4O10A 3NQCA 4ZQMA 1OF8A 5D05A 5KSWA 3FA5A 3O06A 4CNPA 3L0KA 4QNEA 3NQGA 1QPOA 2ATSA 1VPXA 2DU2A 2QJIA 2QCDB 1ZJIA 3LRMA 4Z1AA 4RX0A 4CCEA 3EWWA 3FLUA 4LT9A 3B03A 2NWSA 4R7JA 3P62A 4AXKA 1AW1A 1JRCA 1MXSA 5BMWA 2ZZ6A 5I3JA 3RMJA 2CLEA 2V2HA 2ZZ7A 2WPBA 4MJMA 2J9ZA 4IMGA 4TO8A 3ZR4A 3P74A 3GAKA 1QMLA 5E1QA 4S1FA 4CCDA 3O6YX 1NEYA 4QISA 4LVAA 3BGJA 2QDGA 3TH6A 2QCHA 3CEUA 5FEWA 2QF7A 3TV8A 4FHAA 4PA8A 1GYNA 3LERA 1LLZA 4QITA 3P81A 1HL2A 4N9CA 3DI1A 4IJBA 4DQWA 2NX9A 4DO6A 2VEMA 3W7HA 3PSWA 4AHPA 3QF0A 3A23A 3W84A 2HS6A 4GUJA 3KHJA 3N3MA 1EWDA 3UWZA 1I2PA 3KXQA 4GUFA 3MO7A 4BK9A 1RQEA 4OBTA 3DFQA 3EEGA 5DCBA 2F84A 2A7PA 1FWRA 2C14A 3LTPA 4Q33A 1QO5A 3O6CA 4O57A 1TTQA 1XCFA 3C8FA 3KVMA 1TQXA 3NNTA 1SZGA 4ORIA 3BG9A 3N9RA 4I7UA 3PB0A 2QCDA 4OU1A 1D3HA 1GT8A 3S5NA 2ZRZA 1RVGA 3SY5A 1JCMP 1FXQA 1QFEA 4HNVA 2H8ZA 5IBXC 5LNRA 3DFTA 1AG1O 1P4CA 3W1AA 3BARA 1U5JA 3USBA 3PM6A 1VCVA 2LLEA 4HKPA 5A8GA 5F2GA 3W1RA 1FWTA 4PL1A
chains in the Genus database with same CATH superfamily
1DEDA 1CXHA 4RKAA 7ENLA 2O7QA 5C55A 1UHVA 4MNLA 3WNOA 5HULA 3K4AA 1B9ZA 5E0CA 5LNVA 1HL9A 4LVBA 3ZT7A 3WNMA 4DJFA 3EX3A 3UWYA 3T2PA 2ABAA 4AFYA 1SSDA 1IT7A 3MS8A 4GO9A 1AUSL 3VM7A 2XHYA 4DUOA 4LEQA 3I3DA 4B2DD 4UFLA 3L4VA 3AXIA 4X2RA 3W2NA 1NWSA 3LCGA 3BAIA 1DBTA 3NSXA 2AQOA 1Z3NA 2Z6JA 4JICA 3WFLA 2PTDA 3PVFA 5L6UA 5CC5A 3WLRA 5BMXA 2PTZA 2JBMA 1R85A 2BMBA 4QQ3A 1EFZA 2QVHA 1EHAA 4DRSA 3P93A 3FGCA 1LOQA 4K7VA 2XFWA 4UMBA 4CNTA 1TWZA 3SN4A 1VB9A 3D47A 4IGSA 4LF1A 5BCAA 2V3FA 3AMLA 8XIAA 1E1CB 4JIHA 3VOFA 5AZ1A 3KBNA 1HIZA 4NAEA 3R11A 1J8VA 2VRQA 1EL3A 2XH2A 3ZVIA 5LIWX 5E0KA 5GNYA 3MYPA 3RU6A 3QR0A 1D3CA 1U1HA 4HPXA 4Y9MA 3UYIA 1IXPA 3IRSA 3KVLA 2VD9A 3LTSA 4GYJA 3EWUA 4PTVA 3NVTA 3TEVA 4NNBA 3EBVA 1W5PA 3URAA 5M17A 1XLHA 1B1YA 4YMZA 4IISA 1RPXA 5D4YA 3WDPP 3VCRA 3TFXA 1S46A 4JZ5A 4K37A 1GOXA 2WSQA 1JNDA 3F5JA 1LP6A 1Q3NA 4HPGA 5BOFA 3T2OA 5CPTA 5I03A 5JIPA 5HMFA 4NJGA 3LBOA 1K7EA 4GE8A 4PTDA 1XD1A 3KDOA 1LL6A 4DPQA 3UEQA 5A2BA 2XGBA 1PUDA 1UIPA 2BFGA 3OG3A 1SQ7A 3EGJA 2OZTA 1JUBA 4NRRA 1OWQA 3NPWA 1R9ZA 1C9WA 1CGUA 4AMCA 3HG2A 2KX9A 1XKJA 3GXMA 1LRNA 4DB7A 4WSHA 1BXCA 2GJNA 2VGGA 4GABA 3JU2A 2WNQA 3V35A 2GPTA 5LNSA 6REQB 1PDZA 3OGVA 2PBOA 1KR1A 4F3HA 3LGEA 4Q4MA 4GQGA 2EHHA 2EXOA 1S2AA 2W67A 3FGCB 4HYRA 2ACQA 1FWWA 3KUMA 2AGTA 1I4NA 4E2DA 2I1OA 4DX3A 2HXUA 4LWWA 3W6LA 3W37A 1FHUA 4R7OA 1EP1A 2I5QA 3WQDA 3DDMA 3S8HA 3ITXA 1XGZA 1QI0A 4QAIA 4WIWA 1C8XA 3SCTA 2YYUA 3NWRA 4DYKA 4AIOA 2YCLA 4C60A 3N18A 3VIHA 4LC6A 1LWHA 2Z2AA 4IP4A 1I6NA 4JN6A 3UR5A 4M7SA 4UMAA 4KFNA 1G0CA 3EKLA 2E1DA 3MUAA 2V5CA 4S2BA 3RHGA 4J40A 1B4EA 3BOFA 2A4AA 4OZOA 1C8VA 3F4WA 2XIIA 3QTGA 3VC6A 3MBFA 5D03A 1KBLA 4JXCA 4HSNA 1TX0A 1A4MA 5DY3A 3P0XA 2PFHA 3L67A 2ZXQA 3S46A 5K7JA 4YCOA 2PURA 2GGHA 4H1ZA 1RK5A 1XJBA 3UG3A 1FFQA 3V0TA 4IJRA 2VFFA 3ZWSA 3TK7A 2HQAA 1G4SA 3TN4A 3L4YA 3O9NA 3LHTA 3QFEA 4JDBA 3OYXA 1CDGA 4B4FA 3LHZA 2YCIX 3WJZA 4JNMA 4LVDA 4FOKA 2I57A 3MDWA 4J28A 1HJQA 3KM8A 1N55A 5JUVA 1GTEA 3EEZA 4PCSA 1QK0A 4B92A 3WJYA 4A35A 2QGHA 1V3LA 1X38A 1GVRA 2BOFX 1TPDA 3PJXA 4D1JA 4RE0A 4E38A 1ONRA 3WF2A 3U48A 3CWNA 2PAJA 2NUYA 3DAQA 1G4PA 2G3NA 2NVDA 5HNRA 1XH0A 1GW1A 3WK2A 3B9OA 1ZP3A 3M1ZA 1YLVA 2X2YA 4Z1YA 4KWUA 4ZL1A 1LG2A 3TJLA 3C2FA 2QPSA 1XQKA 4CVWA 3ZR5A 3G6LA 1FWBC 3S5ZA 3OODA 4WKFA 1PYFA 4QG6A 1XLEA 4R34A 1NIUA 3VA8A 1BGAA 4L4OA 1VFLA 2D20A 4JDYA 1A5BA 1JI2A 2E6DA 5CGQA 3GG8A 4LS2A 1F8MA 1H1ZA 2OO0A 3W1XA 4GZEA 1ZBCA 3TOYA 3INPA 4O1FA 1OX4A 4TVUA 1PL9A 1J5TA 1K02A 3ELFA 3F2CA 3R8HA 2Q01A 2DQWA 3HMCA 4IPNB 2J6XA 2J62A 2ASHA 1R3QA 2YYTA 3CASA 3GKFA 4HJFA 3MT1A 4O0KA 2UY5A 5KZ6A 3PWIA 3W6YA 4UTUA 4MZ1A 1O6IA 2CLFA 2H3DA 1PCWA 1P0DA 4GY1A 1F4AA 4EXBA 2P88A 1OT2A 1PE1A 2P3ZA 4DN1A 2FPTA 3ZFHA 4TTGA 3OJGA 1XIHA 2QCCA 3FN9A 1LL4A 3W7RA 2ZUVA 3BE7A 2Y7EA 3M47A 1HFBA 2G3MA 3LXAA 1E40A 2CBIA 2VQUA 5FI8A 1S2TA 2XJ7A 4YCPA 5M2FX 1UBPC 1W6TA 5E6ZA 1EPVA 4QP0A 4JKMA 3NZQA 3AIRA 1FCUA 4F8XA 2ZX6A 2YB4A 2QAPA 4DBUA 4C6PA 3NM1A 1CZ1A 2QZRA 4LBSA 4ACZA 3N04A 4ZOBA 3SR7A 3SSZA 2H90A 4HHPA 1EQPA 3BAWA 1XLAA 4YLWA 3HURA 3JR2A 2FVKA 4A05A 4A29A 5EMLA 3ZIZA 5G2HA 1VGAA 3UW6A 3CMJA 2VDGA 1UPPA 3K1DA 1T7LA 3G0XA 1JPHA 3AHTA 4LUTA 4UQAA 3WBYA 2GQ8A 3M64A 3B97A 1KKOA 4LY8A 4IX2A 2V5JA 4ML9A 2Y62A 4UB9A 1GQNA 3DG7A 3QZEA 1UH2A 2BXZA 5D9NA 1RJRA 2HVMA 3MJYA 2ZXAA 2RH9A 3SGZA 3TXZA 3WLPA 3S1XA 3FAXA 4BI5A 3IVSA 3WNKA 1KC7A 3KTXA 4JTAA 3TTQA 4P61A 3PN8A 3WDIA 1MI3A 1J5SA 1Z9AA 3CU2A 3SGGA 3ES7A 5AC8A 1HTIA 3NQ2A 3NO3A 3VKBA 2CEQA 4JGDA 1C90A 2ZQ0A 3LV5A 1A5KC 4N6EA 1VFHA 1EP3A 4WF7A 3BWWA 4JEQA 4BY3A 2ADAA 1S5WA 1N2VA 2CZDA 1Y0EA 1X6UA 9XIMA 4A3QA 2F2KA 4U10A 2CZVA 2GJLA 1J11A 4B3ZA 3T40A 3LRKA 2DZAA 4WD0A 1E1CA 3F4VA 4Q3MA 5HA7A 4FLOA 3PWGA 2PA6A 3VMOA 4DVOA 4M1RA 3TKFA 4UZSA 2OG9A 1OK4A 3LA4A 4NJKA 1VIWA 1QPRA 3PBGA 3MPGA 1JZ8A 1LDCA 4F48A 4HA3A 2C1HA 4AD2A 3L5AA 1T6MA 1QK2A 1DWAM 1C9DA 2PDNA 1NSJA 4R53A 2G4FA 3GVWA 3MA8A 1U1JA 1A5AA 2VC6A 2XSAA 4LUSB 1TV8A 2P8BA 5LNUA 1S1PA 1H7PA 1M68A 1CGWA 3LQLA 3MSDA 4LY4A 4WDXA 4C1NA 1P1XA 1R2RA 1YIXA 1KFLA 3ONBA 1TYGA 2FZBA 3AIBA 4PMQA 5LIYX 4AVFA 1HKMA 1AH4A 1YDNA 3HBLA 4WR3A 3EDKA 4PMOA 1XGEA 3WLOA 4NIRA 3WUBA 1GTHA 2VEIA 1WV2A 3TX9A 4UTHA 5AHIA 1AMYA 1E9YB 5DN1A 3NEVA 3AIUA 3WELA 1BQGA 4TX9A 1QBBA 4FOJA 1A80A 4I8YA 1VS1A 3O63A 1LLOA 3T7VA 2R14A 4XZLX 4ZXOA 4MWAC 2RFGA 1KM2A 2QJMA 4QBXA 4C6JA 3MTWA 2J7EA 3GIQA 1ML1A 5T9BG 5FJRA 2XUCA 1M01A 1MXDA 2FB2A 4GFSA 2ZRUA 1ITUA 2D0FA 2DJXA 4HBKA 5G2IA 3DEQA 3NPXA 2Q71A 2I5IA 1Z48A 4UUIA 1JG9A 1EJVC 1GOIA 3P61A 1B3VA 1UR2A 1JDCA 1V3JA 5CZKA 4U4MA 4HNTA 1J18A 4JYFA 2C7FA 4JTSA 3VGDA 4IX0A 3ZJ6A 1ADOA 5J5RA 2D69A 5IFTA 2HBXA 1UR0A 3EOEA 4GI6A 3TN6A 2HWGA 1XHGA 2NSXA 4MZ8A 1EYWA 4HYWA 1SO6A 2WZEA 2PE4A 2XU2A 3HQPA 3VU2A 2ISSA 4KCTA 4WCJA 3SO7A 2WSPA 3RK8A 3UGVA 2INZA 1X6LA 2OOFA 1OC6A 3RLVA 3QMTA 3WEOA 2YX0A 4HTYA 5BXPA 3W2KA 5A8QA 3WF1A 2UY3A 4NNCA 3TTYA 3L2LA 3GVRA 4XD3A 7CGTA 2P1FA 4ZB5A 2XFFA 1ME9A 2A79A 4LV9A 1NVMA 2ZUTA 1XICA 2ZTKA 4GVFA 3RO8A 1ZSXA 2VX6A 4W7WA 3VO0A 3K46A 1HJWA 1YE6A 3NM3A 3A5FA 1IEVA 3LPGA 4ZMGA 4B9ZA 5HQEA 1EJTC 1S5VA 2PU0A 1NWTA 2C71A 3NQAA 4GYKA 3EXTA 2B7OA 3A21A 4J7RA 2AMXA 4QG8A 2W5FA 7XIMA 3TP4A 1DP0A 3TYAA 2PWUA 1WXYA 1DQUA 2PWGA 5EKYA 3W27A 3W1MA 3LY0A 1J0ZA 3PZTA 4HYVA 3QEZA 3EMQA 1AW2A 1GWJA 4US5D 4B16A 4L9YA 2CHRA 3FJ6A 4DO5A 3VZXA 4L80A 5BU6A 4FX7A 2XYLA 3S2NA 2NUXA 4R9XA 4LAUA 1KFKA 3CUHA 4OVXA 1UCWA 4GK8A 2X40A 1MRQA 3M0VA 4PR4A 4DBSA 3LPPA 1F6KA 1B4KA 2ZFAA 3OA3A 4H8UA 3BMXA 4B9YA 1FWGC 3K4DA 3WQFA 4QFUA 5M3WA 3LCHA 3UJSA 3A22A 5CPSA 4ERAA 4O0ZA 1KTCA 2NVCA 3ID7A 1A0EA 4Q7IA 4ASTA 4FSAA 1RD5A 4EP8C 2Y7FA 4BQ2A 1E9IA 5D38A 5FF4A 3V7PA 4ATLA 4UNLA 1QW8A 1YTKA 3OEXA 3WQ4A 4ATDA 4U5IA 1XLMA 3UWEA 5CZTA 4NASA 4PCTA 2CLMA 4TXEA 2WNNA 5FSEC 3I6RA 1WKEA 3FVMA 2Q02A 2TPSA 3UFYA 4OV4A 4EXQA 1LZOA 1SZRA 4PBEA 4QEHA 2VX7A 2WHMA 3P0WA 1AMKA 3W1PA 5K4XA 4HMNA 2VHLA 4NAEB 1IGSA 4JFVA 1EZ2A 3EKZA 3RITA 1AW5A 4Q4OA 4GKLA 2IQTA 3II1A 3LCIA 1E1FA 3IGSA 3Q45A 4IL2A 2PLKA 3TJ4A 4HJWA 4HZ7A 3F5LA 2PD5A 2V81A 4Z2HA 4XAPA 5GQBA 4CD8A 2NVAA 4DWDA 5HOSA 3SCNA 4TVDA 3POCA 2WC7A 1TJPA 4P8VA 4JYDA 2ZZ4A 5B80A 1W3IA 1E5NA 3R8RA 4Q8VA 1AQ0A 1E55A 4GBUA 2CBJA 1D8WA 1KXQA 3UBPC 3GLCA 3UESA 2RJGA 3N73A 1J01A 3NO1A 4JS3A 2QCGA 2CBVA 1X1ZA 3ZJ7A 2VFDA 2YDAA 3GXPA 1T5AA 4IQLA 1GOQA 4LGXA 5B7YA 5KINA 4XBSA 2ZDSA 3WNLA 4IG2A 5HJLA 3RRAA 4AZ7A 4YYCA 3VAVA 4BKNA 4BZYA 4MSSA 3W82A 3HPXA 4E8GA 3FA4A 2J66A 2NXGA 3EOLA 4V33A 2DT0A 2IPJA 1J0YA 3WLQA 3U7BA 4B3LA 2D2OA 1TE6A 4UFKA 3GG0A 3ZM8A 2OODA 3S5SA 1SJDA 4E6MA 3NQEA 4AIBA 3MI3A 4C6BA 4GPNA 8XIMA 1H1YA 4EF9A 5HMSA 3GTXA 4IJCA 4WSKA 1BG9A 4IMCA 4KF1A 4GQBA 1QNVA 3GTFA 1YHTA 1Q63A 1ICSA 5EFDA 3FW6A 2X42A 4G8TA 4I5UA 4AAJA 1UKTA 2BY3A 4CU7A 4NZ3A 4C7DA 4TV6A 1PTAA 1XC4A 3KFTA 2J7FA 1H7XA 1MNZA 3CUZA 4D6FA 1UZ1A 4UR8A 3W7QA 4NI3A 1GNXA 2VP8A 4EWJA 1TV4A 3IJQA 3QQ0A 4M6UA 3VNIA 4FXSA 3C3UA 1W3NA 2I7GA 1Y5VA 3CMFA 3DESA 2ZWYA 2F9RA 3EWZA 2XM2A 2C0AA 1BD0A 1IZJA 2V5DA 1UWTA 3MVIA 2POTA 2NX3A 1E4NA 3AXMA 1ZB5A 2Y2WA 4PN2A 2DSZA 3TUUA 1XRFA 4C5ZA 4IFKA 2GSHA 1BGGA 4RZBA 3SQLA 4EPEC 5D04C 3PK7A 2V2DA 4X3ZA 2BVDA 1MZRA 1ZLPA 2XZ9A 2FJKA 3VILA 3LYEA 2AAMA 4M3PA 2QHAA 4PCPA 3QY7A 4DBEA 1TJ1A 5IHRA 3S9IA 1U1UA 4PMYA 3NVDA 4Z1DA 2CZ5A 1CBGA 1J12A 2CNCA 4WOQA 3THQA 2ABBA 2POZA 3T0BA 1MDRA 3BAJA 3WEZA 1R6WA 4XZWA 3DYOA 1B5TA 2ZA3A 3SCUA 3UR7A 2D2JA 1R7OA 2FGLA 4RK8A 2YPIA 2KAUC 3E2VA 2VI0A 4LYRA 4JY8A 1UQYA 1XRVA 2W27A 4Q8NA 3TYZA 2J8TA 4U28A 4JEJA 1YQ2A 2DGAA 2A1YA 3ARRA 4NYUA 4HU4A 5XINA 4JIRA 2F61A 4GZIA 5H8PA 4GD0A 1DYSA 1NWRA 3QOMA 3PJUA 4QSHA 1PS9A 2ISVA 3P6LA 3KZPA 1C3FA 3M6YA 2WSKA 4LOCA 1L9WA 2GJXB 3MCOA 3FS2A 4BWLC 1P1MA 2DZWA 3VK5A 4XVDA 1OG0A 3D46A 5A2CA 4LH8A 4P7OA 1W37A 4DNMA 3B8DA 3VMPA 1X97A 3A4WA 1OZQA 1TREA 5K9XA 2FMNA 1E6PA 3MMUA 3U3HA 4UOZA 1UR9A 2Y6ZA 1R30A 3PTMA 1JXJA 1B57A 2MUCA 2XM1A 5BRQA 2PGFA 2Z00A 2CLOA 3SRFA 4N4PA 4JBRA 1LT7A 2OT0A 2VVNA 4IL0A 4ZB0A 1BSIA 1RD6A 1E3ZA 6XIMA 2JGYA 2XVGA 4IP5A 4D6DA 2QIIA 3LLXA 1VJIA 3CZ8A 1S3HA 1CXEA 1M04A 4GA8A 2QDHA 3WSUA 4F2TA 4CEXC 2WM0A 3UXLA 2VFGA 1XL9A 4JIPA 1Q45A 3MHFA 3AS0A 2PGWA 3AAMA 1XBVA 1V8EA 1TV3A 3G8EA 6A3HA 4F79A 4W93A 2IQDA 1GQIA 4UQ9A 4I7VA 5HR6A 3KRUA 3PPHA 2A2IA 3B0XA 1AFSA 1TR1A 1L0PA 5LXEA 1J0JA 3GR8A 3WQVA 1VPQA 1ADSA 1GQJA 2FTWA 2UY4A 3K8MA 3OPSA 3W88A 2V0TA 1HT6A 5JU6A 2NV1A 4LYKA 5C9WA 3BV7A 1EX5A 3L12A 4HK5A 3H7VA 4HOWA 2HZGA 1TQJA 1T8XA 3IJ8A 4S3BA 3NL3A 4U2ZA 4J2MA 3CBWA 1ZUAX 3U2OA 4R5EA 1S2UA 1V0MA 1ZJAA 1XIFA 1DJZA 2D3LA 3EWXA 3VABA 3O2LA 4ZR8A 3KBVA 3GVVA 2ZUSA 3VGFA 4G7FA 2ZCGA 4GY0A 2CZEA 4ZE4A 4QLKA 3VCNA 1XS2A 5H8UA 4KCWA 2VL4A 2QQ6A 5I78A 4R88A 4LB4A 3R43A 2GDUA 3GR7A 5G1TA 1XSKA 2YBUA 4D8ZA 3FJ4A 1E4LA 1NFBA 4WDWA 4QNWA 3VUPA 3PAJA 5A8PA 4D6IA 3ABQA 3I6EA 5AYXA 3PBMA 2I5GA 3R1ZA 1OCJA 4J5NA 2GWGA 1U22A 3MWCA 3LOTA 3PULA 3QQ1A 2ZADA 3V36A 1MNSA 3W2MA 2XVPA 4PMXA 4HQVA 1JRBA 1US0A 4XAYA 3DGBA 1P43A 4QX4A 2NV9A 5EMKA 1NP2A 2AKMA 1NF7A 3R94A 3LCWA 2H3BA 1W1ZA 5E9AA 1K9EA 4OGZA 1EA9C 4W87A 3E49A 1LORA 3ENLA 3PBWA 1Q8AA 3HU7A 3ANVA 3QH2A 1F3TA 2A0NA 2I56A 2HTMA 1FWNA 1CYGA 2OB3A 3B3DA 5FAGA 3FSUA 4GC4A 4A2SA 3J7HA 4AWSA 3MMDA 4DO4A 3SN0A 3WQGA 1KO0A 1GUVA 5E93A 2YZRA 4HMEA 4WLCA 2QJGA 2NLYA 4YHGA 3GU2A 5FJOA 3M16A 4YWSA 2HK1A 2WVSA 5AC6A 2AOSA 2Z27A 4FB7A 1H4PA 3LCFA 3PNUA 2OO6A 3VKCA 2ALDA 1YNQA 3N29A 3CPRA 4GO8A 3VKAA 5IHSA 5C7HA 4RDZA 3LLFA 1V51A 3N15A 5D2VA 3WLLA 1RJPA 2ZE0A 3PR2A 1TE1A 4ZA0A 3LCXA 1UKOA 1NDZA 2JKPA 2X1RA 4AD3A 2ZUMA 1J10A 4M6VA 3NGFA 4CEUC 1MUCA 3GNRA 5AOUA 1VAHA 3VZYA 2RAGA 4BEQA 2C8NA 4Y90A 1SM9A 4DAFA 2WJZA 4S38A 4PTXA 4JCLA 1K1DA 1VEPA 1TWDA 4KRTA 4O19A 4L61A 4L1GA 2J47A 1GVFA 4F66A 1U5HA 2CETA 3E0VA 2I16A 1UD6A 1BYDA 1PX4A 5JH2A 3A12A 3LHWA 3TXVA 1KM5A 1FDYA 3NA8A 3ABOA 2L5HA 2OX1A 2E09A 5CCZA 4YWIA 4UFHA 4I6KA 3CYVA 3C2YA 2NLIA 2QDDA 1DXIA 2J24A 1PHQA 2Y8UA 3KWXA 4GNJA 3BSHA 2BHZA 3R13A 5AVNA 4GYPA 3UXIA 3QRHA 2BZNA 1G7VA 1VQTA 3S2CA 2VR5A 1O4UA 1TPFA 1WZKA 4AD5A 5T26A 1C7SA 1LJYA 1VBHA 2G3FA 2VEPA 3IJDA 2G97A 3UA4A 1YDVA 4JY9A 4MNKA 2V5BA 4LYPA 2YBTA 1JPMA 3DFHA 5D05A 3GW3A 3O06A 3AMGA 1VPXA 1WKDA 2QJIA 1KRCC 4CGTA 3LRMA 2WAGA 4LT9A 2ANUA 1XLLA 3S6TA 3P62A 5BMWA 3T07A 2IS7A 4KH2A 2CLEA 1ENUA 4O1EA 2WVTA 4MJMA 3MANA 4S1FA 4H9ZA 3WH9A 4G1NA 5FEWA 1W9BM 4JTRA 4PA8A 4WEVX 4GMEA 2DY3A 1R9XA 3THDA 3ITTA 4XSLA 4LF2A 4AHPA 1S2CA 2D24A 9XIAA 3UWZA 2PDJA 4GUFA 3MO7A 3VNKA 4OBTA 4F0HA 1FWRA 1GKRA 1EHNA 2PSNA 3A9BA 5AY7A 1RBAA 4HA4A 2GUBA 1NOUA 2INFA 4RNHA 2AL1A 1WUEA 3RO6A 4ORIA 3GQYA 2HJPA 2J79A 1DWGM 1QFEA 4HNVA 1GW9A 2H8ZA 4TTUA 5LNRA 4G2DA 1P4CA 4BCEA 4AQLA 1WB0A 2B31A 3REQB 3WD0A 4RPQA 4H9XA 2DH2A 3N6HA 5JIWA 4PL1A 1KXVA 4YTSA 1X8CA 2BSLA 2PUZA 2J25A 2MNRA 5AHMA 1TWWA 2DZPA 3FYPA 4M80A 4XD6A 1MW2A 3JZUA 1TCDA 2RDXA 5AHFA 5IDIA 1DWIM 4UFMA 1DHPA 5CSYA 4P7RA 4ZSUA 3S2LA 4LU0A 4YYFA 1JVNA 2J13A 5LXXA 3DKLA 3K1GA 3DBPA 4RDYA 3UVIA 1OC7A 4C6OA 4H4IA 4DEFA 3NTYA 4UTWC 3C0SA 4QM1A 2WW5A 5AYYA 2FHCA 4I6VA 4NJIA 4Z2IA 3SAZA 3EZ4A 2J74A 4GIAA 4BJHA 1TMHA 3AUOA 4Q4PA 3W02A 4Q8QA 3STGA 1FWAC 1LM1A 2QULA 4H3DA 1NARA 1XRTA 1F2JA 3S1UA 2PC4A 2BHUA 2YGYA 4RJEA 4NNAA 3KHDA 3H2AA 4DWSC 1W91A 3E9AA 1E70M 1GOOA 3STFA 3E12A 3TIMA 3A3HA 1MSSA 3D5HA 2Z28A 3WEMA 4C6KA 5MKGB 2WJFA 2Z1SA 3QPEA 2PZ0A 3USZA 1F6YA 1I2QA 3WQPA 1X7FA 4DI8A 4UTKA 2DV0A 1LT8A 1LUCB 4UNKA 2DVTA 4CNNA 5I3KA 3K30A 1J9YA 5DT7A 4XUYA 3C0LA 1TB3A 2IPGA 4O11A 1NF0A 5EMUA 5CZSA 2VKZG 3CAQA 5F1UA 2ZZ1A 2QV5A 2DZXA 5BXRA 5K3VA 5FJIA 1S38A 2DVUA 2WLZA 3PY2A 3QR1A 4F2UA 4IIBA 2EKCA 4N9EA 3N2XA 3RXZA 1JCJA 3VKKA 5A8MA 3ZLFA 4BQ4A 2WXDM 2AL2A 1L6GA 5DEZA 4PMZA 3AMDA 1Q2RA 2VCAA 3MWAA 1VPYA 2CBUA 3FDKA 4L4LA 1QR7A 2OVLA 3FCPA 3AYRA 4PCFA 4L9XA 3VC5A 3W1NA 1UQZA 3LXCA 3TCSA 1Q7QA 3AYTA 3BZJA 1ONEA 3C2EA 3QV7A 2PLMA 3L21A 1ZS2A 1Q6FA 2ZZ3A 1SFTA 1EUAA 2R94A 4J3TA 3UU0A 1WAUA 3M7WA 1BYCA 1N7KA 4G7EB 1T40A 3CLMA 5ABFB 5GJPA 2FHFA 4W8AA 5KMYA 3MZNA 2REQB 5M1TA 1ALDA 1W9UA 1A0CA 3NG3A 4Z2JA 1R5YA 2VTFA 1UJPA 1IF2A 1JD9A 4HMCA 1CGTA 4PTMA 2D0GA 3B8IA 4PODA 2VUNA 3I6TA 2QJJA 4KGLA 1J93A 1ZPTA 5C9RA 1XLFA 2OZ3A 4QJ3B 2X0HA 2RHGA 4I8DA 1FBAA 3TA6A 2O55A 1EA0A 2OKOA 4WJXA 3KRSA 5DFAA 3QFWA 2FPYA 5CBIA 5CLTA 2CERA 2QF8A 4Q8WA 1D9EA 1PKMA 4QE5A 2PF0A 3A13A 2OEJA 3W87A 3BW4A 1FX6A 1OFEA 3SN1A 2Y0FA 1RR2A 2FVMA 1SR9A 1TPH1 3H2OA 3CIWA 4AD4A 4K68A 1V6WA 3LS9A 3ITGA 1UR3M 3AXKA 4V1YA 5A6BD 1O66A 3HJEA 2AMGA 3SFKA 4QR6A 4R9OA 4LUTB 4JHZA 1AD4A 3TROA 4D6HA 3MHUA 3GTIA 3GAYA 3V1PA 3B0PA 3LHVA 1BVNP 4RUBA 3HGJA 3NDOA 4AY8A 3T09A 2FH6A 5DMYA 2VEFA 1B3WA 4UBPC 1WCGA 2CLKA 3T4WA 1JIBA 3WYZA 1E4MM 3MKCA 1MUWA 3V16A 4O13A 2WQPA 1DIEA 1M7PA 4KFPA 3DN5A 2CIPA 2OLAA 2WCGA 2DIEA 2W3ZA 2BY2A 1Z89A 1SU5A 2BP1A 3T81A 1VFTA 2EG8A 3CK5A 4IPPA 1PKLA 4Q4QA 4AMAA 3CZKA 1XYMA 4O1DA 1ICPA 4S39A 1RP9A 3M0ZA 4W89A 2WJDA 2Z29A 3GO2A 1DWFM 5HXMA 4PTWA 2ON3A 1K9DA 4MM1A 3NDZA 3VGEA 1HW6A 4L5ZA 2QDEA 1UR1A 3N11A 1LYXA 4D72A 4JFTA 1ONXA 4JIEA 3IS4A 1I45A 4YTTA 3ABZA 3IGXA 2D23A 5C9ZA 3FAWA 3TSDA 4O1BA 4UMCA 1GYLA 2CHOA 3POHA 1JR1A 1E6SM 3BLDA 4RDVA 3ABXA 2Y61A 4MB1A 3QPZA 1ITCA 1BG4A 1RCOB 3TC7A 3MCMA 4QIUA 1BLIA 6CGTA 2G3IA 3TJXA 4GUIA 2H6RA 4GIYA 5G4HC 4C1KA 3CQ0A 1KBKA 1TVNA 4LFYA 3W53A 1DJHA 3SRDA 4HA1A 3WDJA 3WH8A 3FEQA 1VD6A 4YJ5A 2D1ZA 3B40A 4P8UA 4DJDD 1OFOA 3QYQA 1N8WA 2NSOA 1NP0A 1IXQA 1UIOA 3E1F1 2JIWA 3RN6A 3NQVA 1WZLA 1TJ0A 4OTKA 3AISA 1UG6A 3W2UA 6ALDA 1I0BA 3BLEA 3TONA 3PZNA 4Z17A 4UOJA 5HNNA 1JI1A 1V0KA 1O94A 3L4UA 1JDAA 3HTWA 3BMWA 1F7BA 1L8NA 3SDOA 4O12A 2OR2A 2PI6A 5ABEA 1EXBA 1ZALA 2QT3A 2WVVA 3RGTA 4LSBA 4KRZA 1XINA 4IUOA 5EBAA 4CD7A 5REQB 2QUNA 1GONA 2IPWA 1FA2A 2Y5SA 2OOGA 1X6NA 2CLIA 4NJJA 3H24A 4PL2A 5CH9A 3SB0A 3HIJA 2VEGA 5J8LA 1GOWA 4PMNA 2Y4SA 1MYRA 2YCJA 4AEFA 1I8JA 4KEZA 2JKEA 1CECA 2XGZA 4F0MA 4IF2A 4PEKA 1AK5A 3WH7A 1PIGA 1YEYA 1YW1A 2WMJA 2YFNA 3HZ3A 3W2LA 2Q8ZA 1OY0A 3DCPA 2WZIA 3KOXA 4C6FA 1JD7A 3I10A 3WBEA 1IZCA 3OVQA 4AWUA 1XLBA 3PBUA 1V08A 1A5LC 3AFBA 3Q2DA 4IM4A 2WBKA 3W07A 3BH4A 1H5YA 4CQ9A 3TZFA 1A5MC 1W2VA 2P76A 1R87A 2FZMA 4X0NA 1F3EA 4FNQA 3AS3A 1SFLA 2PS2A 1BXNA 2DUXA 2D73A 3E5BA 1US2A 1O12A 1I2RA 3AZRA 5D2TA 4YNGA 3WD1A 5M03A 2W6RA 2VOTA 4QCEA 4YTUA 1ZAJA 2WQDA 4IGHA 3UZYA 4C65A 4JTJA 1S5MA 3RRXA 1EJXC 1JFXA 1F8IA 4X9SA 3RF9A 3W7MA 1SSGA 2O7SA 3H53A 5FA5A 2QPUA 3UR8A 3LHUA 1MEHA 5A6AA 4J3WA 2EEXA 4DJFD 3EOSA 1WDSA 3SY8A 3O1NA 4EF8A 2VD8A 1DKWA 2O9PA 1MFUA 3WF3A 4PSRA 2Q09A 2FZNA 1P7TB 1KFWA 2WPGA 1WA3A 3F4NA 5EPDA 4H7CA 4RNFA 1KFEA 5IRPA 3WX7A 4HZMA 1ZRQA 4L7ZA 3WUGA 2ZUUA 1XM3A 1PKNA 2R8WA 3L0GA 5F1VA 3G77A 3DX5A 4MF4A 4LB3A 4LNCA 3KS6A 2PDQA 3DOPA 2OYLA 3FY1A 3V5OA 1XLDA 2GK1A 1R2TA 3LBCA 5JBDA 2CKSA 1R46A 1LUCA 3KL3A 4DPPA 1TPWA 3OOQA 1GVQA 1OX6A 3B0UX 1JF6A 1JDDA 3B06A 1R7AA 4HNOA 5FOOA 3M9YA 1EQCA 3AYSA 3P67A 3FDGA 2VFHA 3N1AA 3TMLA 4M0XA 3Q65A 3XINA 4UNIA 1YE4A 2A3BA 3ARSA 3IRDA 5IXEA 1UD3A 2V9DA 4AY7A 1DJXA 2OCZA 2ONEA 1KWKA 1TKKA 2QAFA 4WVXA 2WVUA 3E38A 4MNJA 3MC5A 2WMIA 4S3EA 4KPLA 3ES8A 4QS5A 1PSCA 1H51A 1Q6OA 1IIGA 3R25A 4H8VA 1CXFA 3MB9A 4A8NA 2WMFA 4JNZA 4L1WA 2VZUA 5REQA 3SADA 4ES4A 4MFEA 2P50A 3MCNA 4L9ZA 1HNYA 3CMGA 4K8HA 3WLSA 4LX4A 2WC4A 4WX2A 1EF3A 2CFFA 5BU9A 3C0QA 4XTIA 4JNYA 2JQXA 4JL1A 4ZVJA 3OG2A 2V82A 3N6QA 2XN2A 4C6CA 2PBGA 3MDUA 1DIOA 2GJXA 1FH9A 3ITCA 3AJXA 1B30A 4KWWA 3M0JA 4IQJA 3H4GA 5FJJA 1QW7A 3WK1A 2J7GA 4PULA 1TPUA 2OQYA 2BY1A 3HF3A 4F0KA 8CGTA 2BS9A 1W1TA 3ARPA 2FB3A 4IIHA 4LAZA 3LDVA 1G7UA 4KS0A 4YXGA 3T78A 5JH1A 3PB2A 3GFYA 1TPVA 1PXGA 3LHYA 4O18A 2WKLA 4GVGA 3ECQA 3PFMA 4AB4A 5DY2A 1TZ7A 2V3GA 2VM8A 5LKYA 4N9BA 2A85A 4FOUA 3ZS4A 5CQ1A 4UIOA 3CV6A 3ICJA 1YPIA 4UZUA 2Q8LA 1ISWA 3C86A 3EDDA 5E0FA 1L6FA 3BUVA 4XKMA 1YADA 1QHOA 4REQA 1RAKA 1B31A 2DFAA 1H2JA 3KTCA 1I75A 3G0UA 1EBHA 6XIAA 2GVLA 1W3KA 1Y8BA 4ZQRA 1UR4A 1LG1A 2FQIA 1KNWA 3PANA 4H7VA 4JIQA 1B3YA 3E2QA 2YB1A 5ECVA 1TG7A 1TVPA 3R12A 4HSOA 3SIMA 1KM1A 4EAMA 1JGIA 2CXEA 3R4IA 1QTWA 1WOBA 3NFUA 1OYAA 4AZCB 3QHOA 1IWBA 1RA5A 2QNEA 4Y6GA 3EDJA 1XW8A 3CM4A 1UWQA 2EPMX 3OB8A 1OIFA 3S5OA 4HA0A 3NQFA 4XIMA 1YKWA 3RILA 1X98A 1E4IA 2EO7A 2XGIA 2HVNA 4UTJA 2ZUWA 4FNRA 3IJIA 2V2CA 4Z08A 1ZNNA 3GM8A 2AKZA 4GGHA 1KCXA 2QPXA 2J75A 5G5IA 3SI9A 1E0WA 1M5WA 2OLSA 3C0JA 3HB9A 3T55A 4U2YA 2CWNA 1K70A 3UNDA 3BTNA 3M7SA 2B4GA 2CXGA 4IXXA 4HN8A 3IAQA 3BJSA 3CZGA 1G4EA 1TELA 4QJ1A 2PTWA 4XB3A 2HISA 4WXYA 1Q4NX 1OFBA 3G5EA 3M5XA 2W0UA 5I79A 4LBRA 4DWSB 2E67A 1R3RA 4M6QA 4G9PA 3LGDA 3WH5A 1Q5MA 3BOLA 1EDGA 3LM7A 1HVXA 3O6AA 1UKSA 5A6TC 1F73A 5ABTA 1JPDX 1L8PA 3GU9A 4D2JA 1Q8JA 3WQ6A 1FCBA 2VGIA 4DYJA 4NZCA 1W3HA 1CENA 1FHLA 4QCFA 3D0CA 4PMVA 3G24A 4WKAA 1H63A 4UXDA 4QE1A 3RX4A 2OEKA 1WOAA 4O16A 3QSTA 1P6BA 2VELA 1M3UA 1MEWA 2G41A 1XIBA 1XXXA 4YS1A 5C6MA 2J27A 3TNBA 3BDKA 1VBRA 1PWLA 1S2WA 3D3FA 3LI0A 4JPGA 3IJ6A 4UWMA 3ATYA 3CV1A 5EU9A 4Q4SA 4NYYA 4KFOA 3LMZA 2WVVB 4A8IA 1ITQA 3TW9A 1UWAA 3H2NA 1OBAA 2ZX9A 4FNPA 5ABFA 3FEMA 4MVAA 1A3HA 4C5YA 3FKRA 4MADA 1WXJA 3UVAA 3GVQA 5B7ZA 3G1XA 3W28A 1YPXA 4MFDA 4NI8A 4M7TA 2OYMA 1RQHA 1HO1A 3IWPA 1FH7A 2OLHA 3OQEA 4DF2A 3NO5A 3CEPA 2XZ7A 3OZMA 1R3TA 3VM5A 3QZ6A 1OFDA 4LUSA 4HHLA 4YTQA 1DTNA 5G1MA 2CITA 2E5CA 2FVLA 1K7XA 1T0OA 4PMUA 3PZVA 5H1WA 1TWSA 3VINA 4JQ2A 2F2HA 3PAOA 2Q3OA 3GUWA 3M43A 4DLFA 1QI3A 4X9YA 2I9UA 3BLFA 4PBGA 4JFUA 1OFAA 3B4UA 3R5EA 4JOMA 2EJAA 3SECA 3IJLA 4ALDA 4E4PA 2DZSA 1R47A 3O16A 2EPNA 3IEBA 2W4XA 4ZSTA 3AMCA 1RCXB 2E6FA 2EQDA 4HVXA 4ML4A 1OGSA 1DJYA 4GIEA 5CPNA 5AECA 1KTNA 1Z7AA 5DMLA 4DWSD 2H9AA 3DI0A 3OW1A 3GC4A 1XLGA 5JVLA 3G1SA 1KRAC 1JDEA 4IGMA 4PB4A 4WJEA 4F9DA 5FKYA 3TR9A 3UJRA 4G1KA 2HXTA 1AH3A 3GDMA 2BOEX 3WFAA 4N9DA 4LW7A 4ZO8A 3TWBA 2OFJA 3TQPA 4LALA 3B04A 3WNPA 4AZ6A 1V6VA 4GYFA 2FTPA 1EBGA 1UA7A 4W85A 1TA3A 1WO2A 2PCEA 4M19A 3MV01 3WQEA 1QT1A 4IG2B 5BWAA 4BF5A 2VYOA 1DPMA 1TO3A 3KRBA 3SUTA 4WY0B 2QCNA 1IEQA 1DJQA 3ISIX 3SFWA 3ZXWA 3SBFA 2IPFA 5A5WA 1XC6A 4QS6A 3GWQA 3MP3A 3KBMA 1A3WA 2DEPA 2FIQA 1I1XA 3AZTA 3G1VA 3M0YA 1WKFA 2QUMA 4NAFA 2YW3A 3N2MA 2E7FA 1IXOA 3TN3A 4C1LA 5SWUA 1ODUA 3VDCA 4E2VA 3L4XA 1XD0A 3HG5A 1AA1B 1FY6A 4XZNX 5DCDA 4CQBA 3LV6A 2DQXA 3DYMA 5I00A 2B7NA 3NSNA 2UV8G 4NX5A 3M07A 4IZGA 4BFAA 1AJ2A 1TRIA 4GWEA 1Y7VA 5CPLA 1HQTA 1VZWA 3QYSA 4V27A 4RW5A 5A69A 3B9AA 3UCQA 1C93A 3BICA 1XFBA 4KKXA 4X63A 3E2RA 4XZMX 2YXOA 5A3HA 1M1BA 5LGXA 2GUUA 5I07A 1WPCA 1QASA 1GKPA 1R2SA 2XINA 2DZBA 2O9OA 1H5VA 1H50A 3GG7A 4OECA 3I3BA 3SGUA 3P5YA 3B9EA 1A5NC 2A7RA 3UWQA 4J3VA 2P5NA 3PZQA 1KLYA 4GY7A 1MO0A 2VC9A 2BV9A 2W91A 3TDFA 3N2BA 3AOFA 2C18A 3FX4A 4DIAA 1EJRC 1G5AA 4TIMA 3VOGA 3WQWA 3W72A 1EWEA 3PUGA 4YL2A 4YN5A 3TA9A 1DVJA 2JALA 1SO4A 1ZAHA 1NFPA 4LCQA 4QRNA 3ME3A 1EJUC 1SZNA 3A5VA 2F38A 3P82A 3UGRA 3CO8A 5DELA 4JX5A 1H09A 1MVYA 2DJLA 2PRHA 1R86A 4FIQA 1P6CA 3OLIA 1TMQA 2ZE3A 3TSBA 1KWGA 3ALGA 1ZL1A 1XCWA 5JBEA 3P80A 2E4TA 3VIFA 1UH3A 1MW0A 2YDSA 4NU7A 4U3CA 1QO2A 1VLIA 1EXPA 3EWCA 1QJWA 1JYNA 1EC7A 3XISA 2VWSA 3T08A 1ISYA 3W0KA 4HTBA 5HQLA 1F76A 2ZC8A 4QHRA 3NGJA 1GHSA 3MYOA 4D8AA 1C29A 3FFSA 3R8GA 1RSCA 3NPUA 9RUBA 4EKJA 4QG9A 2NQJA 5CZJA 5AVHA 3LNPA 2EG7A 1LQAA 2F6XA 3N13A 5GNZA 1WUFA 4M5PA 1A5SA 1LQ2A 4OBSA 1K3UA 4M51A 1CW2A 2PP3A 4C6QA 3HGSA 5FL0A 4K36A 4DJEC 4AZBA 4HMDA 3H21A 4DJED 3NPVA 1OGBA 4AVNA 1DHKA 4H9TA 4WY0F 1QWGA 2GGIA 5FESA 2VZTA 4K6AA 4PSPA 4P8XA 2HPIA 3DECA 2RUSA 1VYSX 1EJSC 4IMDA 2Y89A 3MZ2A 2WJEA 3VD7A 1GJPA 4FNTA 1F6PA 2R1MA 1HG3A 3B9DA 3QC0A 3MBDA 3L65A 3BW2A 3MUZ1 4B91A 4W8BA 3IARA 1W31A 3NZRA 5D32A 1O5QA 4DUVA 1QATA 4BHYA 3K4WA 1TV5A 2BXVA 3GX9A 1E1EA 1RPKA 3TQKA 4H9MA 3WJWA 1H0GA 1KXTA 3M0KA 3K8LA 1GVSA 3QLDA 1VIZA 3I4EA 3VGGA 3P84A 4XZ9A 1OSEA 4ZTXA 1A50A 3WBWA 5A6BA 1OK6A 3CWOX 2OWCA 1E72M 3QKEA 3R6IA 1Q85A 1D3GA 3ANUA 1TTPA 2WB5A 3WIJA 2QMKA 5CJNA 2A3HA 5EA9A 5PTDA 3T44A 2FZ9A 3JS3A 2XIOA 3OLDA 4Z0JA 3A3XA 4ECLA 1J2BA 2OJPA 5FF2A 4GQQA 4QSFA 1XIEA 4AWEA 1PKYA 2PGRA 3RMEA 1VFSA 3PWAA 3W00A 2J9YA 1OYBA 4IXHA 3CTLA 3CQIA 4ZCWA 1XUZA 4UR7A 2PDIA 4XQ6A 4FNSA 1BWLA 4MZYA 1Q6QA 3MSRA 4H2HA 5A6LA 3SRKA 4FXRA 1HL8A 4IQEA 3GFZA 4B3KA 1RALA 2GOKA 1KFJA 2ZX8A 6REQA 4MYAA 3OVPA 3IUIA 4BS0A 2IKGA 3B8WA 1PZ3A 1LLWA 2DZTA 2ALRA 3F4DA 1RHCA 4PRWA 1B0IA 1DWHM 5C2CA 4KCVA 4XTDA 1EGZA 1Q6GA 3QW3A 2PZNA 4LVGA 1QOXA 4QTGA 1KFCA 4IGNA 5CJMA 4CU6A 2O92A 1RP8A 3CB8A 3AHZA 3D3AA 4GVHA 2YA1A 3P3BA 4HCDA 3ZVHB 4PCNA 3AXHA 2CKRA 1HKWA 5H91A 1EOKA 5I06A 1FDZA 3IV8A 4OE7A 4XAFA 3UG5A 1T99A 2DW7A 4I9AA 9CGTA 1B54A 1TR9A 2H9AB 4XK2A 3B4YA 1JPKA 4CD4A 4MUPA 4UQEA 4JX4A 1PDYA 2QYGA 4J1OA 1YNYA 4F4RA 3BK0A 2DUZA 3AU2A 2Y7GA 1AJ0A 3VDAA 4DLMA 2Y8KA 1HGWA 3Q37A 1XLJA 3ARTA 2FDSA 2C3ZA 5D09A 3LTYA 1KLZA 1XSJA 3V18A 2WWDA 1XYFA 3S4TA 1W2PA 4XO6A 3OU8A 3ZT6A 1GVOA 2PF8A 4O8AA 2ODOA 3NQCA 4GBDA 1OF8A 3VMNA 3FA5A 3CT2A 4PUJA 4CNPA 3NQGA 4DUWA 3IACA 4AYSA 1ZJIA 4Z1AA 3UP8A 4CCEA 3EWWA 5HQMA 3OVGA 4R7JA 3ZJKA 4AXKA 1JRCA 2ZZ6A 4DY1A 3RMJA 2VWTA 1OEPA 2WPBA 3VD5A 5DT5A 1VFOA 2J9ZA 4TO8A 1HX0A 3VKDA 4V1XA 4LCRA 4CCDA 3O6YX 4QISA 3AS1A 2QDGA 3WMSA 2WM1A 4E2OA 3Q67A 2R82A 3U9IA 4QITA 3P81A 4M29A 1HL2A 4N9CA 2O4MA 3DC0A 3GXFA 4WKHA 2GVYA 4XX6A 4UR9A 4DO6A 4QLJA 2XIQA 2P3EA 2Z26A 3VX1A 1FWJC 3W84A 2HS6A 1GEHA 7REQA 1EWDA 2PLCA 1RQEA 4EAYA 3HQNA 3DFQA 5DCBA 4ZXLA 3BMVA 4KT2A 4JFSA 4US5A 2MANA 4W86A 1B2YA 3UJ2A 3ALFA 4O57A 4B90A 1TTQA 1E0XA 3C8FA 1AJZA 3NNTA 3E3HA 3BG9A 4P5UA 4DI9A 1Q65A 2ZRZA 1RVGA 2PDGA 1GVIA 3LMYA 3PZGA 1AG1O 3BARA 4AZHA 5F2GA 5I6SA 2DT1A 1F61A 3W1RA 1W32A 3MVTA 4Y96A 3HN3A 5E5CA 4LQ1A 2BG5A 1UWUA 1VEOA 1QPNA 2X0YA 3AIWA 4A3RA 1RXOB 4I5XA 3ZJ8A 2ZRXA 1GOKA 1TUFA 5BNKA 1CB7B 3LGGA 1H7OA 1I0DA 1W5MA 4PUEA 4AW7A 1PYMA 2BB0A 3G1FA 1JCLA 1GG0A 4J9JA 1O95A 4V15A 4M6PA 4QLLA 1TUXA 2DZVA 4RNIA 5CLWA 3QC3A 3LXBA 1WXZA 2E6YA 1BSLA 4HGXA 3AHYA 4RV8A 2FDMA 2E8YA 5LA0A 3EAUA 5HUOA 2JIEA 3KCJA 1MEIA 1XWYA 1B9BA 3LSCA 3CAKA 4GH1A 1DJGA 1VH7A 2G3JA 1JUKA 2CCRA 1QBAA 3LK6A 4IPJA 4QDMA 5C5YA 1BKSA 4UFIA 1UMYA 3QJAA 3W7CA 3AHVA 3BO9A 1KGWA 4TR9A 2BGNE 3WK0A 1UUMA 3BSGA 1AZ2A 1FVPA 3T0CA 3H12A 3PFRA 2IW0A 3EB2A 3DHFA 3N3TA 4ZOCA 3NJ3A 3L4WA 1E6ZA 1TJRA 3KE0A 3WQCA 5AFDA 7A3HA 3H7RA 3LG3A 4GINA 4ICNA 1M7XA 1O5RA 5A6MA 2FLIA 3TYUA 3TAKA 2G50A 3NL5A 4H19A 3HPFA 1Z32X 4V2XA 4MUZA 3W76A 3M44A 3LM3A 4H00A 1ESWA 1XLIA 1LRQA 3ZMRA 4P7LA 3GDKA 1EDQA 4DXXA 2NQHA 3QV8A 3QTPA 2C79A 5HWNA 3CGTA 5I77A 4IMEA 5CXPA 4NSBA 1OF6A 2ZTJA 1A5CA 4I5RA 3LNMA 3T4CA 4OWGA 5DO8A 1Q13A 3DFSA 4GCAA 2VR4A 1VBJA 3QXBA 2IQ0A 2NQZA 1T96A 5LSMA 2YKKA 3W2JA 3HM7A 1AODA 2BBFA 2C6QA 5GJMA 5TF0A 2YJQA 3PS7A 4ACZB 4BI7A 1Y5WA 2DT2A 5F4XA 3P8JA 1SYTA 4MPKA 3T2QA 4UC5A 3QM3A 3LQGA 4MLRA 4XIAA 3C52A 3W7EA 1E0UA 1V0LA 2YL8A 3KOYA 1XPYA 2KZHA 2PDMA 2OSXA 4YHEA 2XG9A 2EKGA 1ZAIA 2F7FA 1NWUA 4MY8A 1UYQA 3BCFA 1D2KA 4HU0A 5A2AA 3BOXA 2OEMA 1FTXA 1L2QA 3MMWA 1Q6CA 2X05A 1QXLA 5F4SA 1BVZA 3NYZA 1VRDA 5AKQA 3TFCA 2EPLX 4ICMA 3VD4A 2R91A 3MQTA 5TQLA 4NT0A 4XKYB 1Z44A 3DU0A 1B90A 4HHHA 4HSHA 1B3XA 2C1GA 4DM1A 3LU2A 1E43A 2BVWA 2GGEA 3SRHA 3KLLA 4ILSA 5CSUA 4C6MA 3VIGA 2VCBA 3W7KA 1A49A 4J35A 3PBVA 2GWNA 1FCQA 5DX7A 3AIQA 4EE9A 3THAA 3BANA 4JHMA 1OGGA 1EC9A 5CBJA 3LEPA 3UF9A 2YA2A 3CIXA 1V3IA 1IWAA 1FWHC 4MWAA 4Z0SA 7TAAA 1TZ9A 2DVXA 7PTDA 1W56A 3OBEA 2SFPA 5FAJA 3UG4A 1DL3A 4TV5A 2FZDA 3N2TA 4G6CA 4L6DA 3RFAA 2PDUA 1QI4A 2BASA 3HMJG 3PZMA 5MF5A 3VOHA 2VJXA 3WLHA 4Q4KA 1TIMA 2A21A 1V6UA 3GG1A 3M5YA 3KOWA 4UCGA 2ISFA 3OVRA 4QJ4B 1OD0A 1C8QA 5BOOA 5C8BB 4MDPA 1VEMA 3O05A 1PZ2A 1K8CA 3WFZA 5CGMA 2GGJA 5E9XA 4BWLA 3OHMB 3A4XA 3QOKA 3LBMA 3U0HA 4PEEA 1OG6A 3HOJA 2ZRVA 4R27A 1PCKA 3KOFA 3W71A 1GK8A 2X2GA 3FIGA 1ICQA 3OO2A 4PUKA 5M5DA 3BAKA 5DXXA 3EPMA 3U6WA 1V3KA 4AZGA 3A64A 3EPOA 3TCEA 1R3VA 3CC1A 4M8UA 5TIMA 2XIBA 4NL1A 3ERPA 3V4BA 3T0AA 5E09A 2IXVA 4OKDA 2W62A 8A3HA 2A3AA 2E9LA 2R1KA 3VE9A 5BWFA 4XBKA 3AHXA 1GQLA 1ISZA 4GNVA 2CW6A 1NQKA 2EGZA 4QJ5B 1A53A 5E6YA 2D3NA 3GXTA 3TQ0A 2VZSA 4RLIA 4D71A 2P0IA 1RCQA 4CN6A 5AHEA 4UTMA 1V93A 5HUPA 4XG1A 3N9KA 3S9ZA 3GXDA 4DF0A 4Q7BA 3CPUA 1V7YA 4XAGA 2QMJA 1US3A 3SCRA 3SUWA 4BF9A 1XBXA 1WDRA 2A6LA 4LEFA 3T8QA 4K39A 1GJWA 1N82A 1TZZA 3RPMA 3WKZA 3WG6A 1POJA 3Q4DA 3QHMA 3TYCA 5C2GA 3RM8A 2VR2A 1GCYA 4XD4A 1CXLA 2WSYA 2AQVA 1RH9A 4N2YA 1G69A 4LXFA 3U7VA 2RDUA 1ZJBA 1EJWC 1XCXA 2NQ9A 1OB0A 4FX6M 2ZWZA 5D8WA 1OFQA 1OX5A 1WBJA 2J7BA 5GPRA 4KIRA 1Z69A 3NXFA 1E3XA 5A6JA 4ZENA 4XZIA 3O0FA 4HD5A 3UJFA 3CNYA 3ATZA 1X96A 3NQ6A 2NT0A 1HN1A 2J7HA 4POCA 2ZRWA 4JD4A 2QUUA 3B0YA 1I9CB 4MB3A 4RR4A 1EB3A 2XWEA 2CLPA 5EY5A 3GR4A 3N4EA 1KCKA 4ZODA 1EOMA 1NU5A 1OHLA 1XLCA 3WMLA 3BV4A 2X1IA 1NM9A 1JF5A 4A3YA 3N25A 3VNYA 3ARWA 3UCDA 2FJUB 1LROA 5CG7A 2Z1BA 5K4ZA 3UYCA 5CG0A 1T41A 1VCFA 1HJXA 4JTLA 4LC8A 6PTDA 4M81A 1SUXA 2X09A 4AXNA 1QRQA 4UTWA 4WXZA 1SFJA 2VVSA 1X1OA 5EYWA 3W26A 4HPJA 3TWAA 5CAHA 3PNZA 4U33A 1P48A 2X16A 1YMYA 4KWSA 3DUGA 3RNDA 3QLLA 1F5ZA 2HNHA 1W3LA 3FNDA 2X8RA 4Z2LA 1O68A 5CPQA 3PTQA 2XPKA 4DZ5A 3TYDA 3SM0A 3RCNA 4GCXA 2VGBA 2YFOA 1QOPA 3M4HA 1HKJA 1X8FA 4ZZ9A 5LIUX 4UFJA 3LZ5A 1J96A 4DELA 2XVLA 1F3XA 3H7UA 4K8EA 4AZIA 1E0VA 1ONWA 2PEVA 4DJDC 1KB3A 1K4GA 5D9PA 2PLJA 4Y2WA 4CD6A 2ZRYA 1QW9A 2HK0A 2WLYA 4Y7EA 1PX3A 3FSTA 2PDFA 1WKYA 3PHAA 3QW4B 3OBAA 1M53A 3ANYA 1UWIA 3U5YA 2F6KA 3NL2A 3BCJA 3GW0A 1PVNA 3BQ5A 3AIEA 2BY0A 1HKKA 3MY9A 5LHFA 4FZIA 1XYCA 3OZYA 2VDIA 4S3DA 2PDKA 4K1GA 1JZ2A 3TQVA 5IDZA 1XIMA 2WANA 3UPWA 3EOUA 5RUBA 4JQ3A 2C19A 1UKPA 3CZJA 4X61A 1Q6LA 4XWUA 2NXHA 1GYMA 4K2SA 3WN6A 3L4ZA 1H49A 2CESA 2UY2A 3GRIA 4KQNA 2QW5A 3E6EA 1NAL1 1QDSA 4D9PA 1W9PA 2IMRA 2VT0A 4M1BA 4B5XA 4MWAD 4JTQA 4LUIA 3B05A 3G22A 3LN3A 3CIVA 5CC6A 5JMUA 1XBZA 2NUWA 4W4QA 1POKA 2FH8A 1FCVA 2I14A 1IXNA 3WLJA 5BROA 3U2EA 4FR1A 1REQB 4GG9A 1M03A 3SUSA 3D6NA 5FACA 3URNA 1CWYA 2WV8A 2WYSA 1B3OA 3GYCA 3G1YA 4ZFMA 4Q8PA 5J5DA 3W1LA 4PMJA 4TOQA 2IKIA 1BHGA 4LPCA 3AWNA 3ARZA 2A6NA 1NFGA 4JN8A 1KTBA 3IIXA 1J0HA 2JFEX 5FJUA 1EO5A 2EPOA 4UTTA 1XQLA 1ZBKA 2EPKX 1OABA 2TSYA 5IOBA 3CUXA 2DIJA 1VENA 3H4XA 4O14A 2B7QA 5G4WA 1Z41A 1V5XA 4Z2GA 2HBVA 3ORWA 2Z4GA 2OGYA 4L6OA 2RKXA 4DNHA 4FXJA 4ZE5A 1F4HA 3HJZA 5AHLA 2QCFA 4O4VA 4DUXA 5KZEA 1OD8A 6TAAA 2CU0A 3GHTA 3R89A 3HV8A 5G2WA 3H6OA 3VNMA 1FDJA 4I9TA 4H01A 3PPGA 4FALA 3M5VA 4RW3A 2TAAA 1PHWA 2GDQA 1KD0A 4Y8FA 2EAWA 2JEQA 1PTDA 1TPC1 1H7RA 3U8GA 3O8AA 3ZR6A 3S6DA 1LOLA 4Q22A 1J0KA 2XIMA 2Z1WA 3G3MA 1DTUA 3OIHA 2Z2BA 2VC7A 3E74A 3GFXA 3WUEA 1RK6A 4U3AA 2E25A 3L0NA 3IGUA 4XVEA 1V6YA 2A3CA 2C91A 4CQAA 3BLLA 5F2LA 2V5LA 2PWFA 2BODX 2B0MA 2QGYA 3FXGA 2W9MA 3E5PA 2OX4A 2YA0A 2GYIA 1JZ7A 3BC9A 4O17A 3DHDA 4MYXA 1U2YA 2VFIA 2YOCA 2RGLA 1E73M 1FRBA 1E6XM 3ZLGA<