4RR4A

Crystal structure of human dihydroorotate dehydrogenase (dhodh) with dh03a367
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
365
structure length
365
Chain Sequence
TGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human dihydroorotate dehydrogenase (DHODH) with DH03A367
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
total genus 137
structure length 365
sequence length 365
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2014-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4rr4A00
1SU5A 3NGJA 1FXQA 5AYZA 3DFOA 1YLVA 1W3TA 1MXSA 4AHQA 2Q8LA 3G1AA 3SFKA 1I2PA 2AQWA 4JTHA 2QCGA 5C5YA 3ZFHA 1TIMA 3IIXA 2GJNA 2FB3A 3U6WA 2VENA 1OJXA 3TK7A 2ZZ5A 4DO4A 4WD0A 2LLEA 1H51A 2V2HA 2I1OA 3SGUA 3C61A 3PWAA 1TTJA 3N34A 4FXRA 5C55A 1C9DA 1GPWA 3PG8A 3TAKA 1JCNA 5HWMA 4WY0B 1WAUA 1P1XA 4NXKA 5FESA 1BEUA 3LCWA 2GQ9A 4N4PA 5GVJA 1R46A 1D9EA 4IMGA 1WV2A 3UWQA 4EOUA 1YXCA 2B7OA 4NNBA 2NXGA 2ZRUA 1OVDA 2NZLA 1KTBA 3HGJA 3NL2A 5LGXA 3P62A 5J5DA 2QF7A 2PE4A 2RHGA 3L67A 3HG4A 3UZ5A 3OBKA 2CLHA 1OFQA 1W3NA 5T26A 4NX0A 2E6AA 3TV8A 2BZNA 3EXSA 3INPA 4Q33A 5F1VA 1YDOA 3KRZA 3W1MA 3CQ0A 3G22A 1QPNA 1WX0A 3WJZA 1F73A 2QCHA 3W7CA 3G3MA 2PCQA 1UUMA 2X1TA 1J5TA 1XC4A 1ADOA 3NQGA 4NQ1A 3P60A 2X1RA 1Z41A 3LRKA 4ZQMA 5LNWA 4FF7A 1FBAA 4MUZA 2B7NA 2ZRXA 3LHYA 3PS7A 2AGKA 4A21A 3GXNA 3UPBA 5I3KA 1XCFA 2ZCGA 4NZJA 3G3DA 2DZUA 2VEKA 1M7PA 4M6QA 3S6DA 2D73A 5LZLA 3HJZA 5CG7A 2ZQ0A 4JTIA 1LOSA 4IX2A 1FCQA 1VCVA 3QQ1A 3HGOA 2RDWA 3LHZA 3I6RA 2YCEA 2GJLA 3TXZA 6TIMA 2OJPA 1TQJA 4CCDA 2H8XA 1LBLA 1XDLA 3CHVA 2WPBA 4FEZA 3F4WA 3GAYA 1RR2A 3R12A 3THAA 1XL9A 3W7EA 5DBTA 4NVTA 1L9WA 1DL3A 1RD5A 3MI3A 3QW3A 3UD6A 1H7NA 5BW6A 4MFDA 1YADA 4AHPA 1MEHA 3TQ0A 2NV2A 3LOTA 1Y0EA 3PC0A 4UIOA 4ZVJA 4JNMA 1O94A 3T44A 4X9SA 4IGHA 4LVGA 4MYXA 3BV4A 1TPVA 2R94A 2CLFA 3QRHA 1PHQA 5HJLA 1LZOA 2ZA2A 3MBFA 1W54A 1WOBA 4E0CA 5CSRA 3RK8A 3M7WA 2P0OA 4PEKA 5ABTA 4GUFA 5DCDA 3DI1A 3NZ1A 1IXOA 1QFEA 4DBEA 1O5KA 3FYPA 1BWLA 4LVDA 1H61A 3KRUA 3W2JA 3B4UA 5HR6A 3TIMA 1PV8A 1CW2A 3W7GA 3STGA 5FEXA 1DQWA 2HS6A 3BG3A 4OQVA 4AMAA 3EWUA 3MMTA 3DENA 3C56A 2FB2A 3NPWA 1HTIA 4PL2A 3DFTA 4K6AA 1F6KA 3R8RA 3P61A 3QMSA 4BR1A 5IBXC 2H3DA 2TPSA 4WXYA 4OBTA 5I3IA 2J27A 3NZRA 3LDVA 4RV8A 5EYWA 3UQNA 3W7JA 4K39A 1O95A 3S8HA 1LRQA 1LBMA 1A5BA 2ZZ4A 5G2WA 1JUKA 5DXYA 1KFJA 2W79A 2C3ZA 1A5CA 1OYAA 4XTDA 1TPFA 1ZY9A 4UNLA 3B0PA 1SQ7A 2QJGA 3MBDA 3W7IA 1MO0A 4OE7A 4K8EA 3VE7A 2C6QA 2G95A 5D2TA 1G67A 3MHFA 3WK2A 4A3UA 1W5QA 2I9EA 3MWAA 4LY8A 2RH9A 1HFBA 3GAKA 4UFLA 3E0IA 1XBVA 3L0NA 3EWZA 4JD4A 2YR1A 2FDSA 3N9RA 4LV4A 1OFPA 1GG1A 4ML9A 4MZ8A 5SWUA 2NUYA 1OF8A 2YPIA 3O6CA 5HINA 4BWLA 4QISA 1S5TA 4FO4A 2YW3A 1J4EA 1E51A 3OA3A 5CZJA 5F2LA 1F05A 2NX3A 4RZ5A 3YPIA 1G4SA 4P2VA 3W1UA 2WO5A 4H6KA 1BWKA 1FWTA 1KM1A 4GUGA 3A22A 1C8VA 2DZWA 1R2SA 3H55A 2CLMA 1VYPX 3HG2A 4CLMA 2NLIA 1EX5A 1OFRA 2C19A 2ZRWA 3CTLA 3QSTA 3T55A 2Y85A 4HPJA 2JK2A 5AFDA 3NOEA 3NL6A 4JGDA 3W7OA 3C2EA 3PAJA 4Q4KA 4DF0A 1J2WA 1LCOA 3W86A 4PTNA 4UTJA 3W1RA 4RZ6A 4WXZA 4IPIA 3W87A 2QCMA 4HSNA 5EKYA 4WJEA 2BXVA 4QQ3A 3S9YA 1GG0A 4NZFA 3WJYA 3PSWA 1W31A 2CFFA 2VELA 2C16A 5KITA 2BWGA 3P84A 2QCLA 1NFBA 2A6NA 3B0VC 4ZQPA 1DBTA 3EB2A 3NYZA 1FWRA 3GVGA 4UNKA 1OABA 3TC7A 3W88A 1FXPA 5E0KA 4O57A 3E49A 5AC6A 3IVUA 5FI8A 3OG3A 1VCFA 1VS1A 1PIIA 1THFD 3O16A 3MHGA 3M41A 4WY0A 3KAOA 4N6EA 2F7FA 2X30A 4K38A 2E5BA 4QNEA 4LT9A 3OEXA 3W2NA 3TJXA 4RXGA 3N9SA 5AYXA 2X1UA 4FX6M 3NQCA 1F2JA 4UUIA 1K7EA 4JTFA 5KINA 4O18A 3SR7A 1QWGA 3S5OA 3O15A 5K7JA 5AOUA 5A5WA 3F1QA 3OVPA 1TPUA 4XKYB 1DJQA 2DP3A 4LS0A 3GKFA 3W73A 1SO6A 4O10A 1JCYA 2V2CA 3BARA 4NNAA 5K9DA 1GVQA 3IGUA 4ZL1A 4OV4A 3CB8A 4UTUA 3BVJA 5K4ZA 1RQBA 3B04A 5L9FA 3H54A 4JXCA 2CLIA 2YXGA 3WJWA 2FPVA 2H8ZA 1KFBA 4MPQA 3TFCA 4O28A 3R2GA 3LTPA 4EVZA 3QFEA 1H7PA 4K7VA 4FNPA 1QCWA 4K7YA 1UCWA 4LUIA 1U83A 1NF7A 3G0UA 4G1KA 3PB2A 1G6CA 5F1UA 2GOUA 2Q8ZA 3SI9A 1FDZA 3TQKA 5AHIA 2XN0A 4RXFA 2J9YA 3UWZA 2NWSA 3A21A 1IXNA 3NQMA 4CQ9A 4R53A 1NEYA 3Q94A 3W1NA 1QDSA 4M7SA 5FF0A 2BTMA 4FXSA 4NUWA 2A7RA 1K02A 1A5AA 1YXDA 1B4KA 3TROA 2ZYFA 1OFEA 3RLVA 2YX0A 1ICPA 3M16A 5L6UA 1NAL1 3ATZA 2R14A 2VFEA 1ME7A 1EEPA 4K8HA 3UWYA 5F4WA 4LS1A 3NQVA 3W7HA 3LV5A 1F6PA 1H50A 3MYPA 3PUDA 3T4CA 3GB6A 1TB3A 1JCLA 3GXTA 1FDJA 3NQ2A 3IIZA 2BLEA 4O8RA 4CNNA 4PH6A 1OHLA 3UZJA 2PRLA 2QJHA 2ZBTA 3FIGA 4LC8A 2V81A 3FKRA 4Z0SA 2EAWA 2Y7FA 3B8DA 5E1QA 3LX9A 1IIHA 5LSMA 4OV9A 3NQFA 2E5DA 5I3FA 1P0NA 3I68A 2FJKA 3P80A 2QDHA 4BF9A 3O8AA 3QMRA 4Y6GA 5FF2A 4YXGA 4UFJA 1D3GA 1W5MA 4PC8A 2WQPA 3SY5A 2ZZ1A 1KTNA 4LW7A 1LOLA 4YL2A 2V2DA 1UB3A 1X1OA 3LLDA 4A29A 1IGSA 1GWJA 1EUNA 3M43A 4RKAA 3FYOA 1R47A 1ICSA 4O11A 5F4XA 2O7SA 1FDYA 1TV8A 3JRKA 1ZFJA 3F4NA 1ML1A 3NQDA 2CLLA 2HSAA 4DQWA 4JTGA 1WDWA 3KVLA 3B05A 5DELA 2DJLA 4RCXA 4DPQA 2JGQA 5EMUA 2YSWA 3LI1A 2ZRZA 4MVAA 1R30A 5H91A 3M44A 8TIMA 1TV7A 2Z2UA 3LCGA 3PM6A 3BGJA 5D02A 1VPXA 2B4GA 5AHNA 1O5XA 1ZNNA 4FNSA 1VYRA 5AHMA 3U2OA 2VOMA 2X2GA 4YCOA 3GKAA 4AWUA 1KM0A 2C15A 5FF4A 5D2WA 2OCZA 4JX4A 3EWWA 2RKXA 3I7SA 4DO5A 1LOQA 1ZENA 4ZQNA 4N9EA 3UWVA 4H3DA 4AEOA 4CCCA 5LHFA 3NM1A 3LXBA 2V82A 4N9BA 1GT8A 3LERA 2XFWA 1Q6OA 3QYQA 4FIRA 3G0XA 4XZ9A 4JTJA 5HUOA 3T7VA 3G1XA 4IMDA 3CWNA 3USBA 4UTTA 1SO5A 1YYAA 4DEFA 1TPH1 4HNTA 2NUXA 1K03A 4DXVA 4BI5A 3DHDA 4O12A 5D2VA 3PULA 4NXSA 3QJAA 1EPXA 1VGAA 4J9JA 4GUIA 4UTHA 2AAMA 4IMEA 2NWRA 3DU0A 1K8ZA 3WK0A 3BLFA 4UMCA 1KM3A 3MHUA 1TQXA 3S5ZA 3STCA 3GYEA 3BW2A 5G1YA 4DF2A 5U7SA 4QM1A 4MZ1A 4LTSA 1W3IA 1TSIA 1I2NA 2V9DA 4O1CA 1XM3A 5U4NA 3TJLA 4LVFA 3W7QA 4FB7A 4PCFA 1PS9A 2QCFA 3U8GA 3BG5A 1VLWA 1M5WA 2E77A 2Y70A 1OX5A 4GFSA 4LV9A 1ZAIA 3S42A 4XBSA 6ALDA 1EIXA 1TCDA 3MI6A 4AF0B 3M0ZA 2FIQA 1YTDA 3LI0A 3SECA 3VFLA 3UXDA 2NX1A 4AWSA 4MLRA 1BKSA 1HO4A 3S1WA 2J24A 3FA5A 1JCJA 2A2IA 2UV8G 5AC7A 1FWNA 1LM1A 2XN1A 3HIJA 4O4VA 3EX3A 1TRDA 4H4IA 3TA6A 4QJ1A 1B4EA 2Z6JA 1OFAA 4WOZA 3SSJA 1K8YA 3W74A 1G4EA 2GPTA 1VLIA 5C2XA 3FJ6A 3Q58A 2C18A 5HNRA 4IQLA 3UWUA 5CSSA 3LTSA 1TMHA 3DFSA 1OK6A 1B9BA 3CIWA 1FWSA 3THQA 5BOOA 3W7PA 4CCEA 1G4PA 3MI2A 4R33A 4OT7A 3VKJA 3RMJA 1T99A 1IXQA 1GVRA 5D2YA 3S5YA 2QCEA 3QPYA 4JTKA 4PFMA 3DH7A 3TH6A 2CZEA 4E2BA 3A5VA 4GBUA 5KMYA 2Q3OA 4NX5A 3LCXA 1OX6A 3KFTA 3QEZA 4NT0A 4NJKA 4FNTA 2DZXA 4WUIA 3LXCA 3LGEA 2ZDRA 3JS3A 5J5RA 3PR2A 3L0KA 4MJZA 1SFJA 1DOSA 1UJPA 3ABQA 3ABSA 5AYYA 1QPQA 3TSDA 3NQ6A 4IWWA 1GTEA 2CZFA 1KW1A 2A7NA 1BTMA 3NEVA 3KVKA 3W1TA 1OF6A 4M19A 2QUTA 4EIVA 3HGSA 1FY6A 3GZ3A 3IVTA 2YGYA 3W6YA 1HG3A 2VKZG 1QOQA 5FF7A 3P7YA 2NXHA 1F76A 3DI0A 4LC6A 3EKLA 4FIQA 4E2DA 3PSVA 5AN7A 3W9ZA 3ZWSA 1OYCA 3DAQA 4P61A 5C54A 2WKJA 2PRHA 4BFAA 1F74A 1W8SA 1MSSA 1PCKA 3P67A 1K7FA 3HPXA 1UASA 4NJJA 2ABAA 3E02A 1K8XA 3BW4A 4O1BA 1T8XA 4R34A 1YTEA 1N8FA 3GK0A 1SW0A 2DORA 1KV5A 3TC6A 1EUAA 4AAJA 3HG3A 3ANYA 5DN1A 3LLFA 3W7DA 1DQXA 1EWEA 4YMZA 2A5HA 2C14A 3M5XA 4S1FA 1T96A 3K30A 5LNSA 2H90A 4NJGA 3UY7A 1OK4A 3CM4A 1TPWA 1MZHA 2PC4A 1SW7A 4ONVA 3TFXA 3W1PA 2ISVA 1NF0A 5D03A 5E93A 3C6CA 4JTEA 1RV8A 2HTMA 1LTDA 4HIBA 2Z1BA 3WK1A 3EEGA 1M7OA 2OZ0A 4WX2A 2HS8A 2C13A 3GIYA 5CZSA 1RQEA 5KTLA 4O17A 1B57A 1YTKA 3S0CA 5K9CA 4O1DA 5A8GA 3VE9A 4TMBA 3CEPA 4GC4A 3BW3A 4NJIA 3CLMA 1Q6LA 4X22A 3SIZA 3NDOA 3GDMA 4EWND 1VYSX 1LRTA 3MJYA 1KTCA 4KWVA 1LLZA 3EX1A 3CEUA 1JR1A 2ZRVA 3BLEA 3NO5A 1UBSA 1RQHA 4ORMA 1B3OA 2ZZ3A 5BRBA 3DHFA 2VEIA 1G7UA 1I2RA 3G18A 1TTIA 3W1AA 5D2XA 1EA0A 5AB3A 1TREA 4AWTA 3TDFA 1OFBA 4GE8A 1PVNA 2A21A 5HQEA 1JQVA 2G96A 1I2QA 5CPLA 3UNDA 3KHJA 2ZTKA 5KSWA 2O7QA 4NU7A 4KKXA 3CC1A 3NQEA 3P8JA 4MYAA 1FCUA 1H62A 1ONRA 4NJHA 1HL2A 2OT1A 1SO3A 2A1YA 2NV1A 3M6YA 1M6JA 5CPMA 5TBOA 3EWXA 2VFDA 4TO8A 3TAOA 4UR7A 3IGXA 1AK5A 4CQAA 3EWYA 3NQ8A 4YWIA 5BMWA 1DJNA 3D0CA 1H60A 2QDGA 1KLZA 3G8EA 1VZWA 4QAIA 2V8ZA 2Y63A 3L5MA 4ADSA 3CT7A 1NSJA 3GNDA 2YFNA 1WOAA 3UPWA 4LS2A 2C0AA 1SSGA 2FPTA 4JDYA 1LYXA 3TMQA 2EF9A 1FWWA 4HN4A 2GQ8A 2WNNA 3NM3A 3W23A 3MP4A 2GVJA 5DXXA 2X1SA 1H1ZA 3RLUA 1U5JA 2J9ZA 1TV5A 3OIXA 3LCFA 3RNDA 1SZGA 1Q6QA 1HUVA 4O0ZA 2Y61A 4N02A 2GVGA 3PVFA 4RLIA 4IJBA 4I7WA 3G1FA 1VJIA 5LGZA 2A6LA 4GWEA 4QSHA 2GUUA 3EXTA 3TSMA 3W2LA 5EA9A 4JX6A 3W1XA 3QH2A 2OMAA 7TIMA 1YDVA 2Y62A 3LV6A 5G2IA 4MFEA 5CPOA 1H63A 3MO7A 5AHFA 1KV8A 3E9AA 1SFLA 1VR6A 3NPUA 2OT0A 3GR8A 1A5SA 2RDTA 4XTIA 5D09A 3BO9A 2Z0IA 3W72A 4BI6A 3E96A 5G2HA 3IV3A 4GXMA 1A50A 3DBPA 5DBUA 4UFKA 3W71A 1SZEA 3PUOA 4LWWA 1AL8A 4I9AA 2RFGA 5EBUA 5G1TA 4JEQA 5AHEA 3W1QA 4CNOA 2QCNA 1AW2A 4A2RA 1LP6A 4ZQCA 3RFAA 3O05A 4U28A 5HUPA 4IX0A 3C4UA 3ABRA 5BMXA 1JJKA 2FQIA 4MIMA 1F5ZA 4UTTC 3TNOA 3MUXA 4O14A 1SR9A 4JY8A 1ME8A 1FUYA 2JKAA 2J6XA 4FX7A 4HNUA 2BSLA 2EGZA 4UTWA 3W85A 3GDLA 4JR5A 1Q3NA 3BLIA 3C2OA 2QCDB 2E6FA 2G5WA 5KZMA 3P8IA 1AL7A 5LHEA 3N2MA 4TX9A 1Z42A 2TRSA 1GOXA 3N3MA 3FJLA 1AMKA 4N4QA 3KVJA 2I14A 3TSBA 3B06A 1C29A 3N19B 4M5PA 5DCBA 1Z44A 4JTTA 1AG1O 1H7WA 3G1SA 2H3BA 4UTIA 4RZ4A 1I4NA 4C1KA 2Y88A 5FF3A 1PE1A 1JCXA 4XQ6A 4OWGA 3TCEA 1FX6A 1K7XA 3Q2DA 4M6VA 1TYGA 3F03K 3KXQA 4UMAA 3PB0A 4GRSA 3FOKA 1WYIA 1HO1A 3OVRA 4TR9A 1ZALA 1GTHA 1QO5A 2WNQA 3N73A 1OX4B 4TU1A 3LTYA 3R89A 3IIOA 3ZS4A 1ICQA 3L2IA 1R2TA 3OVQA 2FFCA 3DFNA 1YPFA 3NAVA 4WOQA 3G1VA 4JIPA 2WJZA 1YDNA 2FPYA 2OX1A 4QITA 3CU2A 4O54A 3LB0A 2W0UA 3LBMA 1Z48A 2IQTA 1P0KA 3W70A 3C0JA 1X8FA 3A23A 4HKPA 1TTQA 3E12A 5G5IA 3PBWA 4DBDA 2RDUA 5FEWA 1SZNA 3GX9A 2YYUA 3M5YA 2ZA1A 5TQLA 2WOQA 3BPWA 2ABBA 3L65A 3QF0A 4O0KA 4JIQA 3QPZA 2DZVA 2NXIA 2R91A 2BX7A 1FCVA 5KZEA 1Q6RA 4JICA 2EHHA 1QAPA 2A4AA 4Y9AA 5HULA 4I7VA 4JS3A 3O07A 3NL5A 1G7VA 1VRDA 4O53A 4PA8A 1KM2A 2WSYA 2ZFAA 4AHOA 3NQ7A 4LOCA 2ZTJA 4BI7A 1EP2A 1OFDA 1ALDA 1SPQA 4XKYA 3L68A 1L6SA 2Q3RA 3W7NA 4W9TA 1O60A 3NPVA 3UYCA 3QM3A 4UC5A 1JQXA 3I65A 1CI1A 3M1ZA 1ZAJA 4Y96A 4AH7A 3W7MA 2QAPA 3EWBX 4DF1A 1LDCA 3NVTA 3HOJA 3FS2A 2TSYA 3M47A 5D30A 4O4WA 4ZZ9A 2JKPA 1IIGA 4OHQA 4S2BA 3PBYA 2E5CA 2W6RA 4YCPA 1GYNA 4JYDA 5D04C 2CZ5A 3IIVA 3FKKA 3ZWTA 4HSOA 3W83A 3HPZA 1QO2A 5LNUA 2ZRYA 4K37A 1H1YA 4IMFA 4LUJA 4IXHA 3LM7A 4NNCA 4WZHA 2JKEA 4LVAA 3IRDA 1V7YA 1KFLA 2VEPA 5CZTA 2DZSA 3NPXA 1I45A 2VC6A 4MY9A 2Y7GA 3W1LA 4X3ZA 2GVLA 3VNDA 3T40A 3PY2A 1EP3A 1ZJIA 1VHCA 3W7LA 3LCLA 3UWWA 1XBZA 1PL9A 1W0MA 3A24A 4A22A 3FLUA 4O19A 1OFOA 1PHWA 4CNPA 4DELA 4Z1AA 3AJXA 3HPSA 2E09A 3B0UX 1EWDA 2X16A 3HGRA 4HHPA 1RVGA 3W76A 4O1AA 1JCMP 4EF9A 4POCA 4I7UA 4LRSA 3S1UA 2V5BA 1S3HA 3NNTA 1R2RA 2R8WA 1XDMA 3MW7A 5F4SA 3P5YA 1TO3A 3W75A 1TPDA 3QC3A 2DJXA 3MP3A 4LU0A 4ZQRA 4ADTA 2JGYA 5HWNA 2YZRA 1JUBA 3PBVA 3LXAA 3VI2A 4UTWC 3WJXA 4RX0A 4RR4A 5G4EA 1XBXA 4GUHA 3I7QA 5HMSA 5K9XA 5BNKA 1G69A 1QNVA 1LLWA 4JX5A 2GQAA 3STEA 1VC4A 1ZAHA 4JYFA 1I2OA 4ICNA 4YLWA 3C2FA 3UXAA 1MEIA 2NX9A 1DKWA 1AW5A 3W7KA 4UMBA 2V0TA 3A5FA 5C6MA 2QCDA 3HF3A 4JN6A 1WXJA 3ATYA 1SO4A 3IIPA 1LORA 1VCGA 3MP5A 3IVSA 1KFEA 4FHAA 1KBJA 4M7TA 2QR6A 3KX6A 4A2SA 2V30A 4Z1BA 3KOFA 3C52A 5D05A 5HWJA 4XUGA 1G4TA 5D32A 3R5EA 3UY8A 3LRMA 2QUUA 4D2JA 1D3HA 3G24A 3N2XA 2C1HA 1XUZA 4IMCA 2ATMA 4MJMA 1P4CA 3Q37A 4WQ6A 3W7RA 1W1ZA 3TMLA 4FNRA 3C8FA 1T0OA 3PF3A 5DLCA 1QMLA 4UTKA 2ISSA 3W84A 3HMJG 1JRCA 1XFBA 4RK8A 1KM4A 4O13A 2YDAA 1GJPA 2V5LA 2VFGA 3O06A 1DV7A 4OU1A 4FNQA 3OHIA 1SSDA 3V75A 3L5AA 4DO6A 1KM6A 2FTPA 1Q45A 3M5ZA 3I7RA 4N6FA 4KWWA 3H53A 3W07A 2VEMA 3TU9A 4AXKA 1OX4A 4LNYA 5DCEA 2ZZ2A 3TXVA 2WNZA 4MY1A 5TIMA 3GDKA 3VCRA 3RU6A 1F7BA 1XBYA 3C2RA 1H5YA 1S5VA 3GR7A 1PCWA 3AO0A 5EL1A 5I3HA 3ELFA 2VFIA 4OGZA 4O50A 3LBCA 1V5XA 4KFOA 1W5NA 5IBXA 2A0NA 3L66A 3NG3A 3GNNA 5LNVA 3P81A 1X1ZA 4IPJA 5DY2A 2P10A 4IUOA 1TJPA 5FEPA 1SUXA 3EX6A 3G8RA 2ATSA 4GNJA 1L2UA 4O52A 2ZZ7A 2CZDA 3TX9A 5EY5A 3TQVA 4LVBA 1H7RA 3L9CA 1TRIA 4TIMA 1OYBA 3HB9A 3G1YA 3LHTA 2QEZA 4K36A 1SZFA 4B5NA 3O6DA 4U4MA 3DXIA 3LCIA 4MY8A 3LRLA 1A53A 1KBIA 5CZ0A 4UFHA 3SW6A 4MOZA 1OG0A 3DFQA 3NA8A 5LKYA 2B7QA 4WY0F 5DY3A 2DZTA 3SJ3A 3EXRA 3WJSA 1NVMA 3L0GA 2WSQA 2WV8A 5EPDA 4BWLC 4JTSA 2DZPA 1JUEA 1EB3A 5K2ZA 1I8JA 3G1HA 1KM5A 2YW4A 3SZ8A 3HG5A 3O6YX 3GDRA 1IXPA 1RPXA 2A85A 2Y7EA 3PUEA 4M6PA 2ZA3A 5HR7A 3HO8A 1XI3A 4X2RA 3QMTA 1N55A 3B03A 3V1PA 4LRTA 1ME9A 1TPC1 1XKYA 2P1FA 2CLOA 3P82A 3QW4B 4JYEA 3G0SA 3EX2A 1H7OA 5CKSA 1LROA 1FCBA 3O63A 4N2YA 4MKNA 4FX8A 4PODA 4CQ8A 2CW6A 2H6RA 4JY9A 3EX4A 1YPIA 4Q32A 2QJIA 2XN2A 3IEBA 2QAFA 4KFNA 2YFOA 2VFFA 1QR7A 2Y6ZA 4C1LA 1LRNA 3NL3A 3TW6A 4Y8FA 3HQ1A 1K3UA 3P74A 3M9YA 4UXDA 4HNVA 2CLKA 4ALDA 2VXNA 3CIXA 3GXPA 3STFA 2Y7DA 4L4LA 2J9XA 3TUUA 1KLYA 4ORIA 3L21A 3TE9A 5IM51 3SGZA 4BK9A 2CU0A 2B0MA 4EF8A 4Z0JA 1W5PA 2CLEA 1EP1A 1GZGA 2ISWA 3O1NA 3DFPA 1P5BA 3LHWA 1FQ0A 2B7PA 1KFCA 4N9DA 3CWOX 1GQNA 3NXFA 2ALDA 1O4UA 2KZHA 1WQ5A 4ZQOA 1W5OA 4O15A 4HPXA 1QOPA 4UFMA 2YYTA 1DHPA 4JTLA 5K3VA 1WA3A 3M5VA 2PURA 1JULA 3WFAA 3KVMA 2QKFA 4AVFA 2E6YA 1VQTA 4PL1A 1L6YA 1GVOA 1GVSA 3A9IA 3S1XA 3L5LA 3NQAA 1LBFA 5D38A 4HT3A 3W22A 2ZZ6A 4L4MA 3BK0A 3MYOA 1GYLA 4N9CA 2TYSA 1TTPA 2A7PA 3P5ZA 3LCHA 5CGQA 4AF0A 5LNRA 2Z6IA 4IOTA 3C2VA 2J88A 4QNWA 1WBHA 3CPRA 4MLJA 4JTUA 3BGGA 3PG9A 4UTMA 1KFKA 4XBKA 4ADUA 4HNNA 1X7FA 5D37A 3KRSA 5D33A 5AHLA 4Y90A 4R7JA 4TMCA 2PRMA 2HMCA 3W2KA 1QPOA 1IF2A 1TJRA 4ZMGA 3R13A 5H2ZA 1S5WA 5K4XA 1UUOA 4UCGA 3QSRA 2NUWA 4Z1CA 3N14A 4XWUA 1JRBA 3DKLA 3BG9A 1ZHAA 1CX9A 1GVFA 1H7XA 3ABOA 3IGSA 2G97A 4S2CA 1AW1A 1TPB1 3LHVA 3EKZA 3FFSA 4GJ1A 3T78A 4MZYA 3LHUA 2F84A 1SW3A 1N7KA 1YXYA 4IXXA 3DGRA 1L6WA 5KZDA 3C3NA 4O16A 3DZ1A 1ZCOA 1XUUA 1XXXA 2Y89A 2E1DA 5MHBA 1GEQA 2EPHA 3WK3A 3W2UA 3S5NA 2E68A 5FEZA 4E38A 1DORA 1TPEA 3NR0A 4GUJA 1VHNA 3JR2A 2TMDA 2QCCA 5F2MA 5AC8A 1JVNA 5I3JA 2JBMA 2WSRA 3GDTA 3GLCA 4RJEA 4DPPA 1W56A 1MEWA 3RF9A 4QIUA 1W37A 2FLIA 3FEMA 5F2GA 1X6UA 3HBLA 3TW7A 3W2MA 1KA9F 2E6DA 2EKCA 3QQ0A 1QPRA 3G1DA 4UR8A 5CPNA 3ZR4A 5I3GA 4JDBA 3S1VA 3TR2A 1RZMA 1DVJA 3W3OA 2VFHA 5G4WA 2DU2A 2QUVA 4FNUA 1VH7A 2CWNA 4UTLA 4UFIA 3TKFA 4KFPA 5F2IA 1WBJA 4Z08A 4AB4A 3DKJA 3PBUA 3QZEA 4Z1DA
chains in the Genus database with same CATH superfamily
1SU5A 3IJ8A 3NGJA 4ZEPA 1JNDA 4GNVA 1FXQA 5AYZA 1OGSA 1YLVA 1W3TA 2NV9A 1MUMA 1XPGA 2I17A 1MXSA 2Q8LA 3G1AA 2VHLA 2X1IA 2VC7A 1MDLA 4JN7A 1I2PA 2YBVA 3N4AA 3BDKA 3ZFHA 2YL8A 3IIXA 4GK8A 4YTQA 3U6WA 1OJXA 2YZ5A 3TK7A 2OEKA 4FXJA 4DO4A 1W2PA 1H51A 1KO0A 2FMOA 5H1WA 3BOFA 1F8MA 4P5UA 2V5KA 4FXRA 3IV8A 3UVAA 1KKOA 5JMUA 3VGBA 1YE4A 3FSUA 3BZJA 4YTUA 5DF0A 2QVNA 4R85A 4AZ6A 2CETA 3L4VA 1R46A 1WV2A 3UWQA 4EOUA 4NNBA 4Y9MA 4IIFA 4PCPA 1KTBA 3FA4A 3UF9A 2PWEA 5J5DA 2WJEA 1M9HA 2RHGA 1PYMA 3ECQA 3L67A 1US2A 3VCNA 2XJ7A 1PTDA 3OBKA 4NZ1A 1GUVA 1BWVA 1V6YA 2BZNA 4JZ5A 4GMEA 1GCYA 3W7CA 1UUMA 3MMUA 4NQ1A 4DUWA 4ZQMA 1V02E 2WBKA 3WNKA 3LSCA 4MUZA 3WUEA 5I02A 4JTCA 3LHYA 2R6OA 4JQ4A 4L9ZA 4Y9NA 4KRUA 4LUTA 2YLAA 3G3DA 3POCA 2DZUA 2VEKA 2RDXA 4RDWA 2GWNA 2OSYA 4PUMA 1HJVA 5CG7A 4IX2A 1FCQA 4S23A 1J0KA 1M01A 1XRSA 1TMQA 2W67A 1Z89A 2YCEA 3DIPA 3OB8A 2OJPA 2H8XA 2UY2A 1SMAA 1LBLA 4IHCA 3F4WA 1R0MA 3GTNA 4NVTA 1L9WA 3GUGA 3MI3A 1Y7VA 4AHPA 1RLDA 2PC8A 3PC0A 1O94A 4F2TA 3OZOA 2V3FA 1MUWA 3REQB 1E5JA 4HOXA 5AECA 4HPHA 1PHQA 5HJLA 4DXKA 4EAYA 1LZOA 4PRTA 2ZA2A 4E0CA 4NYUA 1E1CB 3RK8A 1EJTC 3LK6A 3NZ1A 3FJ4A 4ZOEA 3KCOA 2D3LA 3VKBA 3H7RA 5CC6A 3A3XA 3VMPA 3WBXA 2V67A 1QI2A 1VIZA 3VK5A 1CW2A 3STGA 2PDFA 3IJIA 2HS6A 3MJMA 1IWAA 3C56A 2WMIB 4M1BA 3NPWA 3LYEA 4YTRA 3TNBA 1F6KA 2GDUA 1E3XA 3R8RA 2FVKA 4FLRA 4JQ3A 5IBXC 2H3DA 1O6IA 4OBTA 2J27A 1NDWA 3HQNA 3W7JA 4K39A 1LRQA 1H2JA 2XUCA 1LBMA 1UWAA 3AICA 3EDDA 3UXLA 4LUSB 5IDIA 2ACUA 5G2WA 3WBAA 2W79A 1A5CA 4XTDA 1JYVA 1SQ7A 3MBDA 1WZKA 1MO0A 3W7IA 2EPOA 3IANA 2C6QA 2G95A 5JBDA 5D2TA 4ZO6A 1UWIA 1TR1A 1L8PA 1HFBA 3ES8A 4H8NA 1XBVA 3M0XA 1O1ZA 3BANA 3EWZA 3QTGA 2FDSA 1XDJA 4LV4A 1W3LA 5MF5A 4MZ8A 1TWIA 3V1HA 2NUYA 2XINA 2G3JA 3V18A 3SB0A 5HINA 3T8QA 4OECA 1CXEA 2X09A 4I8DA 1EZWA 1RA0A 4UOJA 3W1UA 2DUAA 3B3DA 4AY7A 1X1NA 3AFBA 3ZT7A 3CZJA 3PHAA 3LMYA 2PD5A 1Y5VA 3C3UA 3TTOA 1QTWA 1O68A 3ZIZA 3TC3A 3CYJA 2CLMA 1VYPX 4H1ZA 4HK6A 1OFRA 4FK9A 5HPCA 3QSTA 1XLEA 2Y85A 2JK2A 3NOEA 3ARXA 3JUGA 1EJXC 1UD8A 1LCOA 3OYXA 4GZIA 1ISYA 2E4TA 2OR2A 4RZ6A 1XIFA 3QHMA 4HSNA 2OEMA 5A1AA 3S9YA 1LL7A 3WJYA 2QGYA 2BWGA 3WNLA 1HP4A 3DESA 4EPBC 4ZQPA 1P1MA 3QR0A 3PUGA 3O2LA 4QHRA 3EB2A 1XP3A 4UNKA 3AOFA 2PTDA 3DC0A 3DYOA 3W88A 1PZ0A 1L8NA 3Q45A 5HJYA 4O57A 5HMEA 3WDIA 3DOPA 2WW5A 2DQXA 1L6FA 3BJTA 1JZ4A 1RK5A 2BG5A 4C6FA 4K38A 3ZYZA 3VZYA 4F3HA 4OZOA 1Z32X 3TJXA 3RPMA 3N9SA 3PZOA 1RD6A 1GKQA 4GX8A 3CQHA 4D1IA 3S5OA 1EA9C 1RH9A 3HPAA 1W1PA 3E0FA 4J3VA 3WH5A 4OBSA 3SEPA 2GGIA 2DP3A 2VVNA 3W73A 3H24A 3RX4A 3PNUA 1XYZA 1JCYA 5FAGA 2V2CA 4NNAA 3ZLHA 2XVGA 1FA2A 1W1B1 1A3WA 3BVJA 1TVLA 1O12A 1V77A 2P3ZA 5L9FA 1AZ1A 3NSNA 3CL7A 3NDYA 2H8ZA 5HA7A 2DDXA 3D6NA 2OSWA 3KEHA 1H7PA 5CC3A 1JZ3A 3EZ4A 4LUIA 3GHTA 4YHEA 1U83A 4AIBA 1PPIA 1KBKA 2BY2A 2GOUA 1E6QM 2Q8ZA 4NIRA 1UR3M 2R82A 4LANA 4EPDC 3GWQA 4CQ9A 2FTWA 2GSHA 1QDSA 3AS1A 1S5NA 3RO6A 2BTMA 2IPGA 1XKJA 3NWRA 4Y8EA 3VNYA 1Y8BA 1SFTA 2ZYFA 1OFEA 2VR5A 3M0LA 2XHYA 2YX0A 3BAJA 3MWCA 3RLVA 3WEOA 1ICPA 3M16A 4CN1A 2EQDA 2VFEA 1ME7A 1EEPA 3V35A 3WH9A 1EYWA 4LS1A 3NQVA 3W7HA 3LV5A 3NQBA 3I3EA 3KBMA 1H50A 1UD5A 3MYPA 4U10A 3GB6A 3AJ7A 1JCLA 4Q4SA 1KBBA 4ZGYA 3IIZA 1DHKA 4CQCA 2X7VA 2BLEA 3GTHA 4O8RA 4HU0A 3MA8A 3KHDA 2PRLA 2HNEA 2GJXA 2V81A 5JH2A 1TIWA 3LX9A 4HJWA 1AD4A 2OWCA 4OV9A 5EGRA 4PMRA 4S39A 4O1EA 2HEJA 1E1CA 1DIKA 3K13A 5IFPA 5G4HC 5CAHA 5CCZA 1E1EA 5FF2A 2D0GA 5I3DA 4PC8A 3SY5A 1BG9A 1GOOA 1LOLA 5D9OA 5CLWA 4IF2A 1JL8A 2FHFA 5I07A 3VVGA 1QNRA 3ARSA 1UB3A 4A29A 1GWJA 1ITXA 2OWWA 4MUPA 1LJYA 3M43A 3WEMA 4B4FA 1R47A 3SCSA 4DZ5A 1ICSA 2OFJA 3P0XA 5F4XA 1FDYA 1R8LA 2HVNA 3F4NA 1NDVA 2ZOXA 1S38A 1C7TA 2CLLA 3PFRA 5AZ1A 1EH9A 2J25A 5EMUA 2YSWA 1EIBA 2ZRZA 1R30A 3EOUA 2Z2UA 2OODA 3LCGA 1EJVC 2Q09A 1VD6A 3VDCA 5AHNA 1V6WA 1V8EA 4FNSA 1VYRA 2PGRA 3U2OA 4GYPC 4YCOA 3TN4A 1O5RA 1D7KA 3GKAA 3VTRA 3SN1A 3ZO9A 3NZGA 3ARUA 1BGGA 3CIVA 1YBQA 1V79A 4N9EA 3UWVA 4H3DA 3SADA 4CCCA 1R7OA 4GIYA 2V82A 1Q6OA 3QYQA 5E9AA 4MJ2A 3T7VA 4IMDA 3USBA 2X41A 1K03A 3AMDA 3DHDA 5CC5A 4Q3MA 5EB8A 3DX5A 5D2VA 2WHLA 3PULA 4W84A 4NXSA 1MW0A 2H9AA 3FAXA 4Q8QA 4QAWA 2QIWA 4J9JA 1EF2A 4QJ4B 2WMGA 4DUOA 1K8ZA 3EA3A 3VUPA 3B8IA 1XLLA 1UPPA 3BLFA 3URQA 1F3TA 2DUZA 3MHUA 3S5ZA 4F0KA 1HVQA 3GYEA 3GXDA 4GISA 1PO9A 2J75A 4J3SA 3LQGA 3T9PA 1I2NA 1CLXA 3R10A 1V7AA 1PS9A 3U8GA 4PRWA 4M3PA 1UD4A 3O9NA 4TTGA 2O92A 4YNGA 4PUKA 1M5WA 2E77A 2PDXA 2BXZA 4XBSA 4AF0B 3N11A 2FIQA 4V1XA 1OGBA 1A5OC 4B92A 1C90A 1IZCA 2XZ7A 4MDOA 4XAYA 2J24A 3WCZA 3WUGA 4B9YA 5D8WA 3TZFA 1XGEA 1H4PA 4XSMA 3VFCA 1UMYA 1FWNA 3UFYA 4XAPA 1HKVA 4H4IA 1UR0A 1VKFA 1OCQA 4QJ1A 1B4EA 3TJ4A 1K8YA 3GIPA 3I4KA 2GPTA 2GQ3A 5HMDA 3PPHA 3PTKA 3UWUA 3LTSA 3DFSA 3LM3A 5HBFA 4XAZA 1FWSA 3VNJA 1NWSA 5H8UA 4IGNA 3QGKC 1BAGA 3K4AA 3PPFA 2ZWZA 1T99A 2R24A 1IXQA 3S5YA 2QMKA 3KBJA 2QCEA 3QPYA 3UBPC 4U3CA 3TH6A 3O0FA 1JAKA 3A5VA 4QG6A 2Q3OA 3E5PA 1UZDA 1V3LA 4NX5A 1B30A 1OX6A 3KFTA 5REQA 4NAEA 1KWKA 2IS7A 1UHVA 1YIXA 2HK0A 3R6IA 2DZXA 1VFTA 1IYXA 3IK2A 1VBHA 3RIKA 2J77A 1PIFA 5T8GA 1DOSA 1UJPA 4PMOA 4PMQA 1V3JA 4H9UA 2HBVA 1JPDX 3NQ6A 4IWWA 4U5KA 3NEVA 2PDGA 4MAZA 4WJ8A 4F2BA 1ISWA 2PLMA 4ZOCA 1FY6A 3IVTA 4DLFA 3ZOAA 1QI4A 1DWAM 2QV5A 4PGLA 2QMJA 3OOQA 3GG1A 1HJSA 4KW2A 3DI0A 4CN4A 1V3IA 3PSVA 4OOZA 1FH9A 1N8WA 3W9ZA 4C90A 3TW9A 1MW3A 3KUMA 4L6DA 4N0RA 3RCYA 4PSRA 4H7CA 1MSSA 5LYRA 4IL2A 3P67A 4RV3A 3KL3A 4R9OA 1B3ZA 4BQ4A 1K8XA 1T8XA 3GK0A 1SW0A 4HU8A 2DORA 4AAJA 1GPFA 1YHTA 3ANYA 3LLFA 2ZUWA 4S3DA 3W7DA 1EWEA 2C14A 3M5XA 4NJGA 4J3TA 2ISDA 3UY7A 3OTRA 5C9UA 4Z2JA 1HP5A 4G8TA 4L65A 1SW7A 3W1PA 4HB7A 3FK4A 3BZGA 4C6BA 4HIBA 4LBRA 2NVAA 1PKLA 1W1IE 3EEGA 3GH7A 2HS8A 1FWDC 1GQKA 2C13A 2CESA 3S0CA 5A8GA 1XR2A 3DG7A 4GC4A 4PCTA 3BW3A 1HIZA 4X22A 3KZPA 4EWND 4DJEC 1KTCA 3AU2A 2V63A 4KWVA 3CXOA 1VFFA 4PMVA 1EDGA 3CEUA 4XD4A 2XYLA 3UT0A 3LY0A 2ZZ3A 5BRBA 2CHRA 3SM0A 2VVSA 2F2KA 2VEIA 3QR1A 4DYJA 4LYRA 1I2RA 3ES7A 3G18A 2P8CA 3L2LA 1TTIA 5D2XA 1HJUA 1J96A 1LL6A 2J7GA 7XIMA 2Y4SA 2HWGA 1TREA 1OFBA 1C8YA 5HQEA 4UBPC 1KGWA 3FDKA 3EAUA 2D2JA 2ZTKA 5KSWA 2QDEA 2O7QA 4NU7A 2GK1A 4KKXA 3CUXA 1TJ1A 2GSJA 3AALA 3NQEA 2DZAA 3P8JA 1XRVA 1K6AA 1MDRA 1NFGA 3IACA 1C92A 3QLDA 1V93A 1MMFA 3BCFA 2VGBA 3TAOA 4UR7A 3FGCB 4CQAA 4EXAA 5I06A 3EWYA 1H60A 4K8GA 1UQZA 1VZWA 3RILA 1E0TA 2Y63A 1FWCC 4FAMA 1WOAA 2ZXAA 2FPTA 4KESA 4XZHA 3TMQA 1FWWA 2GQ8A 4OUIA 3SCVA 2E9MA 6REQA 3RLUA 4XD6A 4GQBA 4FR6A 3OIXA 4L9YA 1Q6QA 1ZBVA 1XFCA 4MWAB 2Y61A 2OB3A 4N02A 4RLIA 4GXWA 4IJBA 2X2YA 3MSDA 1EX1A 3GNPA 4H00A 2A6LA 3KE0A 5EFFA 1E40A 2QZRA 3GRIA 1G01A 4JX6A 3VC6A 4OUEA 5CSYA 1YDVA 4ZFMA 1CGYA 3GM8A 3WL0A 1KV8A 2ON3A 2OOGA 3C0QA 1VR6A 4FP1A 1HGWA 4AVNA 4KWUA 4A8LA 1A5SA 2RDTA 4M80A 4V33A 4XTIA 5M5DA 3BO9A 2GGHA 4S3KA 3M0IA 4BI6A 4LPCA 5G2HA 4KCUA 4GXMA 1ZB5A 5JIPA 3DBPA 1SZEA 1AL8A 4HNOA 4WKAA 4XVEA 1ZRQA 5EBUA 1PWLA 1AW2A 4MB1A 1LP6A 4YTSA 2WVSA 4U28A 1C7SA 2FQIA 5CEWA 4MIMA 3GVRA 3CZEA 4UTTC 1OQFA 4O14A 3OGVA 3M6DA 1ME8A 1FUYA 2JKAA 2A3LA 2GGGA 2BSLA 2EGZA 2MNRA 1AL7A 3N2MA 1Y5XA 1TX2A 2CBUA 2X05A 2I14A 1YE6A 3WH7A 1NM9A 5DCBA 1Z44A 2NVCA 1AG1O 1H7WA 1OWQA 1UR2A 2WMHA 3VIKA 1NH6A 3AWNA 3EEZA 1AH4A 2DFAA 3HM7A 4ICMA 1FX6A 3B97A 2VX7A 4M6VA 3K2GA 3PB0A 1DJWA 3FOKA 1WYIA 2DT1A 1ZALA 3U7VA 1RCQA 5EMYA 3ZS4A 2W5FA 3UXIA 1R2TA 1H1NA 1BQCA 2QJNA 3EB3A 5E0CA 1YPFA 3NAVA 3CYVA 3G1VA 2WJZA 1MQQA 2FPYA 1TZ9A 3CU2A 4O54A 5GNZA 3APYA 1Z48A 2FTYA 3UP8A 1Q6EA 1SZRA 5IHRA 4HKPA 3H26A 4DBDA 1SZNA 3GX9A 3V4BA 1S2WA 2WOQA 3BPWA 4U31A 2P88A 1J01A 3BMVA 1XSKA 2OTDA 4DJEA 2W9MA 3E3HA 5CQ1A 1E43A 1QHPA 1ELSA 3LPOA 1FCVA 4CN6A 3MMWA 2WVTA 3KL5A 3VDHA 4I7VA 2VDGA 3NL5A 3T81A 4O53A 3UGVA 3SDOA 1XPYA 2J74A 3UERA 4AHOA 5AC4A 2DH3A 3UR5A 1SPQA 3B8UA 3FEQA 1P7TB 5GQBA 3QKZA 2Q3RA 4JL1A 4UQDA 1O60A 4IQDA 3WUBA 4MM1A 2XSAA 4M82A 4W7UA 3ZJ6A 3MY9A 3COTA 3QOMA 3AIEA 4Y96A 4YJ5A 3PBGA 5DRIA 3RHGA 8XIAA 2EPKX 3PN8A 3OGRA 1LDCA 1KWGA 2E25A 1K70A 1T41A 4MWAC 3PZQA 3S2CA 1BGAA 1R3SA 2TSYA 1JDCA 3M47A 3WLKX 5D30A 1TV4A 4ZZ9A 3IPWA 5XIMA 1IIGA 3D3AA 4OHQA 4YCPA 1OB0A 3WBWA 2A3EA 4IGMA 3ZWTA 3W83A 1PIGA 4K37A 1H1YA 1XICA 4LUJA 1D3CA 3DYPA 4LAOA 3EYPA 2VEPA 1EO5A 2BVTA 1I45A 3TZNA 3WELA 4MY9A 2Y7GA 2HISA 1AZ2A 3GHUA 3PY2A 3ENLA 3H70A 1GOKA 2NQLA 3L2MA 4L4OA 3C5QA 3UWWA 4W7VA 4LYKA 1PL9A 1W0MA 4DJFC 3FLUA 1PHWA 3WQDA 4DELA 1LG2A 3AJXA 4M8UA 3GVQA 4DJDC 3O7UA 4O1AA 1A0CA 4EF9A 3B9AA 4L1WA 1Z7AA 4LRSA 3S1UA 4XIMA 1S3HA 1BYDA 4LX4A 1R2RA 2IXVA 3CPGA 2ZUUA 3A4WA 2WC4A 5C70A 3OZPA 2QW5A 2IKGA 1VIWA 3P5YA 4MAVA 1TO3A 3ITOA 5FKYA 3KBSA 1XF0A 1J10A 1F6YA 3F5JA 4ADTA 1S1RA 1SMDA 3VI2A 1GONA 2YCIX 1PZ2A 1XX1A 1SJDA 5K9XA 1C91A 2J8TA 5DO8A 4M29A 1VP5A 2GLKA 4DLMA 3HN3A 4JX5A 2AL1A 3UXAA 1MEIA 1EYEA 2VD9A 4B5VA 3S5SA 1DKWA 2C79A 1AW5A 1TV3A 3W7KA 1XYAA 2V0TA 2E1WA 1BYCA 2YCLB 3BUVA 1WXJA 3ATYA 2I7GA 3QN3A 3VZZA 3IVSA 2KX9A 3PP7A 4IPLA 5DX7A 4FHAA 2QR6A 4Z1BA 5HWJA 4E8GA 1G4TA 5D32A 3SRKA 2QUUA 4D2JA 1D3HA 2XGBA 2B81A 4LYQA 4F0HA 4DJFD 1J6PA 4D6FA 3UJSA 4I9JA 2PDUA 1P4CA 2IKJA 4D6JA 3E5BA 1Z69A 5GJNA 4LAKA 1V02A 4FNRA 1T0OA 1UWTA 2PWUA 1FHVA 3FY1A 2WLYA 1XFBA 4RK8A 3OHIA 2BVYA 2G41A 3L5AA 3I6TA 2FTPA 3M5ZA 4ICCX 4ERIA 3I7RA 3H7VA 3ZLFA 4AXKA 5DCEA 4MY1A 4D1JA 3VCRA 2CIPA 4AXNA 1XBYA 4Q8VA 4F0MA 3GR7A 3AO0A 2Z1KA 4F0RA 3ELFA 4H9MA 2WMJA 3LBCA 6TAAA 2ZX8A 3U3HA 3P81A 2Y8VA 2P10A 4IUOA 1HZYA 2DZBA 4AC1X 3WLTA 3EX6A 3G8RA 4V27A 4GNJA 1L2UA 4OOUA 4RNJA 4L5ZA 4HTBA 1ZL1A 3VOCA 4ATWA 2AMXA 2XFRA 2XZ9A 4K36A 1SZFA 2XH0A 3O6DA 3M0YA 3GH5A 2HJPA 4MY8A 1KRAC 2YIHA 4XK2A 1B9ZA 3HPFA 3EOLA 5CPTA 4UFHA 3SW6A 5H8PA 1QUMA 1KD0A 2AQVA 1OG0A 2B7QA 2IQ0A 2DSKA 2WV8A 3QBUA 5K2ZA 1C9WA 1WE5A 3HG5A 1UKQA 1PWMA 1QNOA 4JFSA 3HO8A 5FAJA 4LB4A 3DDMA 3BAXA 4X2RA 1N55A 4DNHA 4JFTA 2NLYA 3UZYA 5C0QA 1XKYA 2ZC8A 3VKCA 5AY7A 4TVDA 2CLOA 5FD0A 1UG6A 2Z27A 4NASA 1H7OA 4MKNA 2HV5A 2XWEA 4CQ8A 2CW6A 2H6RA 2W27A 1GW9A 1ZP4A 4QP0A 1QW9A 2XN2A 3IEBA 4KFNA 2YFOA 2Z1SA 4WSKA 1JDFA 2J4GA 2DSZA 2EG7A 1OC6A 1K3UA 3AZSA 3SIMA 5KZ6A 1JYNA 2VXNA 4DO7A 4MNMA 3CIXA 1CPUA 1UMLA 6XIMA 1DQUA 2J9XA 2QPSA 4ORIA 2ONEA 3EPNA 1RSCA 2FH6A 1UR9A 4BK9A 2CU0A 1NY1A 4JKMA 3VX1A 2B0MA 1QPKA 4Y9OA 3BQ5A 1EP1A 2ISWA 3RM8A 3VD7A 3DFPA 3PZVA 3LNMA 4AQLA 3NXFA 1GJWA 3AIBA 5CBBA 5J8LA 4ZQOA 4O15A 4MWAA 2DVXA 3D47A 1FWJC 2F9RA 3N12A 1RP9A 4AMCA 4GIRA 4AVFA 2E6YA 2INFA 5A8PA 1QU4A 4YYCA 3S1XA 1JG9A 2FJUB 5D38A 4HT3A 3KDOA 2VQTA 2ZZ6A 4L4MA 3MYOA 2FZNA 2TYSA 3LA4A 5CGQA 4IMAA 4AF0A 3WNMA 5LNRA 2WB5A 2Z6IA 2J88A 4MLJA 4GQRA 4D6HA 4HK5A 1X7FA 3GTFA 1R3VA 3KRSA 3KBNA 4JNZA 1PX8A 2G8ZA 2PBGA 2PRMA 3WLIA 4J3WA 4GGBA 5T91A 3L4ZA 5H2ZA 4S3JA 4B5XA 1S5WA 4UCGA 4OIFA 4AZIA 4GKLA 1HX0A 2INZA 1S2VA 4NZ3A 4UNIA 4QE4A 3BG9A 2XM2A 1CEOA 3T78A 3LSBA 3N15A 3B9OA 3LHUA 1EOKA 1EGVA 4MADA 4HOWA 4CGTA 2F84A 4MB3A 1SW3A 1YXYA 2E67A 1R3RA 4IXXA 3VKKA 2Y89A 3U2ZA 2EPHA 2E68A 4DZAA 5FEZA 3ZVIA 4QLJA 5FL0A 3VOFA 2INEA 3CAWA 4A3QA 1SJAA 3AHYA 1TPEA 3JR2A 3DG3A 3KP1A 3LEPA 2JBMA 2WSRA 5LIXX 1W56A 4UOZA 1QWKA 3KWSA 4QIUA 1CLKA 3FEMA 3GU1A 1X6UA 5FJTA 1QXLA 3TW7A 4MWAD 1QATA 2BFGA 1OZMA 4GX9A 3GY1A 3QQ0A 3G1DA 3ZR4A 3WG6A 1MWOA 5EMKA 3S1VA 2XIMA 5A8QA 1OADA 3W3OA 5G4WA 1VH7A 2CWNA 5CH9A 4CU6A 4KFPA 2UBPC 4WDTA 3PBUA 3QZEA 1B90A 4YIWA 3DFOA 4A35A 5CSUA 3WQFA 1FWEC 4AHQA 3N4FA 4DBUA 5JQ9A 2GJNA 2FB3A 2VENA 1TMLA 4XBJA 1OM0A 5B7ZA 1CB7B 2ZUSA 3GU9A 1I9CB 3VUSA 3MB9A 4PEEA 5I7GA 2REQB 4KIRA 4L9XA 4NZ4A 3L4XA 3T0AA 1H41A 4U2ZA 4ZO7A 3N34A 4JTDA 2BXYA 3PG8A 3TAKA 3U2EA 1QK0A 3AHVA 1HJXA 4LQ1A 1P1XA 3ABXA 3F7JA 3ZSSA 3XIMA 4QXIA 1BEUA 4G7EB 3TEVA 4N4PA 1Q7QA 4R7WA 3BAYA 4PMYA 4W4QA 1EC7A 3WQ4A 2JE8A 4GI4A 4CQBA 1MQPA 1S3TC 1RLCL 1OVDA 2WZMA 3UR8A 3WNNA 3NL2A 2F6KA 3P62A 1UA7A 2PE4A 4BZYA 3J7HA 3RGTA 4AD4A 3M0JA 3UZ5A 4F9DA 2D2OA 2OGJA 1QNPA 2E6AA 6REQB 3EXSA 1Q6CA 3INPA 4JOMA 4Q33A 1YDOA 3KRZA 5RUBA 1S46A 1R3YA 4JIRA 1AH3A 1F73A 2QCHA 4ASTA 3G3MA 2OOFA 1S2CA 4B15A 1V3HA 1ADOA 3NQGA 2ZICA 3P60A 2X1RA 4D9PA 5LNWA 4GJJA 1EGZA 2DW6A 3CHCA 1A49A 2AGKA 1A47A 1XCFA 5A8NA 4TUFA 1M7PA 3VM7A 4M6QA 2VGFA 2DQWA 2D73A 3ZMRA 4D6IA 5LZLA 4JTIA 4I6VA 1GYMA 3GBDA 3HGOA 2RDWA 3LHZA 3S6TA 3MV11 3PK7A 3OGSA 4J3UA 6TIMA 2EEXA 4NSBA 2PTWA 3OG2A 4GFIA 4AD5A 1XDLA 3CHVA 1K9DA 5AYBA 3GAYA 3XISA 3VGDA 2QPUA 1ZUAX 3ABZA 1QRQA 4O8AA 3THAA 2OLSA 3W7EA 5DBTA 1VB9A 4RL3A 1NFPA 5DANA 5GJMA 4MFDA 1BQGA 2Y2WA 2PTZA 1YADA 3TQ0A 3LOTA 4X9SA 4LEQA 3N4EA 4L6HA 4KMQA 4LVGA 4MYXA 3BV4A 1TPVA 2YCLA 1FHLA 2R94A 2CLFA 1FFRA 3MUAA 4H7ZA 4L6OA 4DY1A 2CXEA 1Q63A 5ABTA 1Z9AA 2IPFA 3GXMA 1IT7A 3SCUA 1QFEA 1QW7A 2HCVA 2XSXA 3SY8A 1S1PA 2QT3A 1V03A 1BWLA 3MUCA 5A95A 1M7XA 1PKMA 3GFZA 3B4UA 3TIMA 3ZXWA 3KP0A 4JKKA 4M0XA 1GOIA 3EWUA 3MZ2A 4AY1A 3UR7A 3KOYA 4PL2A 2ZWYA 3P61A 2XFYA 3TYAA 1ISXA 4BR1A 5E5CA 1K4HA 3USZA 3NZRA 1NWUA 1FHUA 1DWJM 4RV8A 4FPSA 1EKOA 1O95A 2JQXA 5CPSA 2QIIA 1A5BA 1PAMA 2G0WA 1FVPA 3SRDA 1JUKA 3N17A 2C3ZA 1OYAA 1Z6KA 4B3KA 4U2YA 4UNLA 3B0PA 4PN2A 5A6SA 4K8EA 3VE7A 4F4RA 5T9BG 1G67A 2Z1WA 3BLKA 3T0CA 4A3UA 1W5QA 1EJWC 4LY8A 4UFLA 3GAKA 4TVUA 5FJRA 3WD1A 3F2BA 4IG2A 1OFPA 1ONEA 2XDFA 4LYPA 4NRSA 4ML9A 1OF8A 3O6CA 4BWLA 4DJED 1S5TA 4ERAA 3BURA 3URAA 3R58A 3OA3A 3YPIA 1I0DA 2AL2B 2WO5A 1E4IA 3H2FA 1RUSA 3KOWA 1Q7ZA 1WUFA 1X98A 3HG2A 4LCSA 4CLMA 2YB1A 1EX5A 2C19A 3T55A 5AFDA 3NL6A 4H6QA 4PRRA 4XD5A 1JGMA 4MWAE 4DF0A 2E9BA 1OEPA 4PTNA 1TWDA 4UTJA 2BOEX 3GO2A 3E0VA 4WK9A 1J0HA 4GQGA 4IPIA 1XLGA 5HXMA 4WCJA 4NZFA 4GKTA 1M3UA 3M4HA 1KB3A 1ISZA 5KITA 4FXFA 3H7UA 3P84A 3MQTA 2QCLA 1NFBA 4IICA 2D2GA 3ZR6A 3FNDA 2BHZA 1G94A 2WSKA 1DBTA 3RCNA 1BD0A 2OXNA 1OABA 4F0SA 3I4EA 3Q4DA 3AI0A 1V6TA 3OG3A 2PUZA 1LQAA 1THFD 4CU8A 4JHZA 3MHGA 3M41A 4W93A 5ABGA 3LPPA 2F7FA 2E5BA 3VOIA 3GTXA 4QNEA 4U5IA 3MSYA 3ARZA 3URNA 2X1UA 3NQCA 1F2JA 4UUIA 1X39A 2X0HA 1K7EA 5KINA 4O18A 5K7JA 5IFTA 1CNVA 1BVZA 1FTXA 3E1F1 5FA5A 3OVPA 1TPUA 2QV4A 4LS0A 3GKFA 1UZHA 4O10A 1U33A 2YB4A 3IGUA 4ZL1A 5TAOA 4AZ7A 3GFXA 2GFTA 4UTUA 2YJQA 3WLNA 1ZBWA 4RE4A 3V5FA 2CLIA 4I5RA 2B31A 3WJWA 5D8ZA 1E4LA 5JIWA 1KFBA 4DN1A 4MPQA 1UYQA 4WIWA 4FALA 4EVZA 3QFEA 5FSEC 1UCWA 5LA1A 3IJ6A 4DWSC 3SY1A 4IL0A 1LWIA 8CGTA 3TQKA 3CB3A 1B3VA 5AHIA 2Q8XA 2J9YA 3A21A 4CVWA 4QDPA 2J8GA 3VOGA 3AYSA 4FLOA 4EX4A 1P0DA 2Q01A 1EDQA 1E55A 5FF0A 3WDHA 4J27A 1DJIA 3WD0A 4NUWA 1PTAA 4P7LA 1A5AA 1JF5A 1B4KA 3TROA 3WLPA 5ABHA 5BZAA 1HGYA 3JU2A 4GD0A 5L6UA 3ATZA 2R14A 1UKTA 3AUOA 3E2RA 5ABFB 4YHGA 1E9YB 2JEQA 1UROA 4GIEA 4QTGA 1EFZA 3T4CA 1TB3A 1EJ7L 3GXTA 2D2HA 2VJXA 3LPFA 4NF7A 4CNNA 4EACA 4F8XA 4PH6A 1U1JA 1PB0A 4JEJA 3V5OA 1XYBA 2QJHA 2ZBTA 2WHMA 2I5GA 4RZBA 3GE7A 2PU0A 4M56A 4Z0SA 2EAWA 4MNLA 3W29A 4J40A 2E5DA 4E4FA 1EJUC 3P80A 3G6MA 4BF9A 3O8AA 4Y6GA 4YXGA 1D3GA 2QGHA 4E3TA 2YLLA 4QG9A 2ZZ1A 4LW7A 4AY8A 1OG6A 2V2DA 3QV9A 2H9AB 3WQCA 2NVDA 1X1OA 2PSNA 5CG0A 3GHSA 3WNOA 1EUNA 4PUNA 3BTNA 2J7CA 1A5KC 4O11A 3AS3A 2O7SA 4NI3A 5ABFA 2Y5SA 5TF0A 2XG9A 4TV5A 3CO8A 1V6UA 3KVLA 3B05A 1D7FA 2JGQA 3H8AA 4PR4A 1QVBA 2VNCA 5H91A 1QI5A 3M44A 1BYBA 3PM6A 2JALA 1UD2A 5D02A 2MANA 2PDIA 4GYJA 2C15A 1N8IA 1E6SM 1GEHA 2RKXA 1RBOB 1ODZA 2QLYA 3TYDA 4ZXOA 1GT8A 1J0IA 4JQ2A 4U33A 3OP2A 4FIRA 3U48A 1DJYA 4JTJA 5HUOA 5HNUA 3WSUA 2OLHA 1TJ2A 1IEXA 2DSWA 3CL6A 4Y2WA 1XIMA 4GZ7A 4QGCA 4Z17A 4UTTA 1SO5A 4HZ8A 4DEFA 1U22A 4BI5A 3QFWA 4ZODA 3T6CA 1EPXA 4D71A 1VGAA 1QBBA 2XH2A 4IMEA 4W85A 1JZ6A 4XZNX 2OQHA 1CXHA 3GSMA 1EQCA 4J35A 3QHNA 3V0UA 1RCXB 4YPJA 5U7SA 4MZ1A 4B90A 3TJLA 5U4NA 2CXGA 2QCFA 3RCMA 3S46A 1KGXA 1VLWA 4BF7A 5IDZA 1W91A 4Z2GA 2CKRA 2HE5A 1WO2A 1E6NA 3UZZA 3ANVA 1ZAIA 2BNJA 4W5ZA 3PFMA 4ZOAA 6ALDA 3QY6A 5DMLA 1RY8A 1YTDA 2CBVA 1BSLA 3VCCA 4AWSA 5D9MA 2X8RA 4NL1A 3BCDA 3AYVA 3FA5A 3WF2A 3OBEA 4MKVA 3H21A 3CO4A 1TVNA 1ZJBA 3HIJA 4QEHA 2BV9A 3EX3A 2Z6JA 1OFAA 5ABEA 1VLIA 5C2XA 3BGAA 3FJ6A 3ARWA 3KW3A 5C71A 3PZNA 5CSSA 1OK6A 2WK2A 3STPA 1GNXA 3W7PA 3TYUA 1AQMA 3MI2A 4OT7A 3VGFA 1EEXA 3VKJA 2YBTA 1DWHM 3E2SA 4JTKA 1T5AA 3SUTA 4AZHA 5DT7A 4E2BA 1POJA 5KMYA 2OQLA 4M51A 4NT0A 3V3WA 4QS5A 4FNTA 1CGXA 1DIDA 3W6LA 2GVYA 2ZDRA 1JGIA 4XZBA 2PMQA 3L0KA 1SFJA 3ABQA 5AYYA 4V1YA 3QY7A 3AQUA 1GTEA 2CZFA 3PZ9A 2A7NA 4BHYA 3VILA 1W2VA 3KVKA 2X42A 5T9CE 6CGTA 2D3NA 2Y5JA 1AD1A 2QUTA 4EIVA 3GZ3A 5LIUX 3W6YA 1HG3A 2VKZG 1QOQA 1NARA 5FF7A 4JTRA 2PP3A 1F76A 4LC6A 3FVMA 3DAQA 1Q4NX 4P61A 4GINA 3S2MA 3NDZA 2FVMA 4M1RA 5C54A 1JDAA 2PRHA 4BFAA 1OT2A 4AVOA 4ZR8A 2PDJA 3E02A 4R34A 1YTEA 2RUSA 2WM0A 1N8FA 1H0IA 1YKWA 2CYGA 3W01A 3RR1A 2ZE3A 1KV5A 3HG3A 5DN1A 1DQXA 3ZT6A 3W82A 4S1FA 1P7TA 3FDGA 3K30A 3DHUA 3WQ6A 4X0NA 1OK4A 4H01A 4DZIA 1MZHA 1FFQA 2G4FA 3UJFA 2D1ZA 3K4DA 3H4WA 1NF0A 5E93A 1O66A 2PTYA 3C6CA 1S2AA 2PD9A 1GVIA 1RV8A 1Q65A 2Z1BA 3SQLA 2DH2A 3WK1A 3NIYA 1J93A 3FVDA 3S4TA 3T2OA 2GGJA 5E09A 1XH2A 1BTCA 3GIYA 4BQ5A 1YTKA 5K9CA 3VZXA 4LF1A 4TMBA 4HZMA 2GUYA 4NJIA 5A6TC 3N6QA 2ESCA 1VYSX 4H41A 1LRTA 1Q8AA 4H9XA 3PTQA 1A5UA 1O5QA 3NO5A 1UBSA 4ORMA 2L5HA 3K8MA 1K8CA 3AYRA 2GWGA 1EA0A 4DHGA 5CJMA 4NP7A 2A21A 1RALA 3GHRA 1CDGA 2G96A 2QVHA 1I2QA 4HNLA 1CGWA 3UNDA 4ZE5A 1UR8A 1XISA 4MYAA 1FCUA 1ONRA 1W32A 3QKEA 2OT1A 4GLEA 2P3EA 3TWBA 2NV1A 3MS8A 3M6YA 5CPMA 3MDWA 4R3UA 2VFDA 3R4IA 4H9ZA 3S9IA 2J7HA 2W3ZA 1B2YA 1US0A 1V0KA 2YL9A 3TWAA 3FAWA 5BMWA 1DJNA 4CD6A 2PDNA 4A8RA 3HURA 1KLZA 3KDNA 4QAIA 2V8ZA 2QUNA 5AC5A 2WVVB 3CT7A 4W87A 4BQ2A 3OJGA 2YFNA 4CVUA 1XLAA 2QJMA 4XZWA 3UW6A 1IQ8A 4XIAA 4A8IA 1XQLA 3IUHA 2EF9A 4G2DA 4HN4A 5HNNA 2X1SA 1NOWA 2WC7A 1U5JA 1WPCA 1E6XM 1EXBA 1EXPA 2XGZA 3RNDA 4N42A 4O0ZA 1V0NA 1I75A 1X96A 2GVGA 3PVFA 1PZ3A 3G1FA 1VBRA 2VX6A 4GWEA 2G3NA 2GUUA 3W2LA 2PDWA 2EPMX 4XX6A 4AZCA 7TIMA 3LV6A 2J7BA 1K77A 3WD3A 5CPOA 3ARYA 3E9AA 5JVLA 1FHDA 1WB0A 5I0DA 5HDRA 2X40A 2Z0IA 3W72A 1R86A 3OLDA 3LLXA 1HF6A 1TELA 3W71A 3W6MA 1XYMA 2VL4A 5C9WA 1MYRA 5AHEA 3GZAA 3W1QA 4CNOA 1CYGA 4ZQCA 4ZOBA 3O05A 3RFAA 4RE2A 5HUPA 4IX0A 4QROA 1JJKA 3R0UA 1SFSA 5EMMA 3ITCA 1SR9A 6A3HA 4HNUA 1U30A 1FKWA 4YYFA 4UTWA 3GDLA 3ITGA 3BLIA 2QCDB 2E6FA 3UETA 3P8IA 5LHEA 2RGMA 3R0KA 1J5SA 1Z42A 2W92A 3T0BA 1GOXA 3FJLA 3KVJA 3DEQA 4KIEA 1C29A 3N19B 3PANA 4C6LA 4M5PA 4JTTA 1AJ2A 1J6OA 2WVVA 3VGEA 3G1SA 3O6AA 1I4NA 2Y88A 5FF3A 3MVTA 1XLMA 1ECQA 3WUFA 1K7XA 1UA3A 3FGCA 4H04A 4EPKA 3VPLA 5E6YA 2EPLX 3N73A 3LTYA 2OPJA 3R89A 3L2IA 4JAWA 2PWDA 1TV2A 2C0HA 2FFCA 3GVVA 5BXRA 3VIFA 3S9ZA 1S2TA 2D0FA 1YDNA 2TAAA 4CUCA 4C60A 2W0UA 4Y7EA 1ITUA 3W70A 2CBJA 1DTNA 1X8FA 3BICA 3A23A 2FH8A 4IG2B 4KS0A 5G5IA 1VFUA 2RDUA 1XLIA 4KCVA 2YYUA 3M5YA 1J2BA 4DWSB 5TQLA 5I2UA 1CENA 2PB1A 3SQSA 1E15A 2ABBA 3L65A 4E8DA 2RJHA 4O0KA 4JIQA 2FGBA 4TV6A 2EJ1A 4UR9A 4QE5A 1LUCB 3TJIA 4KGJA 5KZEA 1XIBA 3MPGA 3BV7A 2CEQA 2PF8A 3W38A 2PLJA 5BYWA 2EHHA 1ITQA 3A47A 3VGHA 1AMYA 1QAPA 2RAGA 2WBGA 1W3JA 2ZX5A 4AZBA 2W62A 3W26A 3JVAA 4IFRA 2J78A 1VRDA 1J0YA 2BOGX 3UXKA 1M41A 1TWWA 2BDQA 1E0XA 3OA5A 3NQ7A 3FXGA 3S2LA 4LOCA 1EP2A 1L6SA 1BVWA 3L23A 4W9TA 3QM3A 4QEEA 1JQXA 1WDRA 1IWBA 2Z28A 3CHDA 3EB4A 2GK1B 1JFXA 4CNTA 3MKVA 3FS2A 4GO8A 5CJ5A 4O4WA 3PBYA 2E5CA 5FSDC 1EDTA 5D04C 5A6BA 2Z24A 2E8ZA 2GSEA 1UKOA 4HSOA 3OLEA 3CS2A 4H6RA 4IMFA 1M1BA 3ITLA 4UZSA 2JKEA 4LVAA 4F0LA 4RNIA 5FJOA 3UJRA 4ML4A 3U4FA 3EKGA 2DZSA 4AZGA 5XINA 3QV7A 3TOYA 1E72M 4GOAA 3L4YA 3CLWA 3VDAA 4CCZA 4V28A 4A22A 4C1NB 1VFSA 4O19A 3KOZA 4B9ZA 4GO9A 4QLKA 1PBGA 3HPSA 3MANA 2X16A 3HGRA 3W76A 1RJPA 1JCMP 4POCA 1UIOA 1P6CA 2V5BA 3NNTA 4QDMA 2VZVA 3SSZA 2O9RA 4EXBA 3LGGA 5F4SA 5DRCA 3TP4A 1Q4WA 5C8BB 3QC3A 1XG3A 4LU0A 4ZQRA 1S2UA 2YZRA 1NTHA 1OC5A 1AH0A 3LXAA 4D6GA 4UTWC 2E3ZA 1P0BA 4K1WA 5BRQA 3NJ3A 1W17A 2NW0A 2GQAA 3STEA 1VC4A 2NX9A 3VC5A 4UMBA 2VX4A 5C6MA 3HF3A 4JN6A 3GNXA 3WN6A 3IIPA 3T42A 2W61A 3C0LA 4M7TA 3P14A 1CZ1A 3KX6A 3KOFA 4Z42C 3UCDA 4BEQA 3R5EA 3HU7A 3ITXA 3LRMA 1L2QA 3G24A 3UZWA 3N2XA 1OD8A 4MG4A 4LUYA 1R5YA 2PDPA 3UA4A 4KRTA 3Q37A 1A0DA 3SGGA 1E4MM 3VM5A 4QQUA 3PF3A 1PUDA 1VAHA 3AISA 3HMJG 4O13A 3OQ8A 2J7FA 2YDAA 1GJPA 2V5LA 2VFGA 3O06A 1DJXA 3SURA 4FNQA 1W9XA 1LT7A 1SSDA 4DO6A 1KM6A 1Q45A 3C2YA 1E9LA 4Y9PA 2VEMA 2ZZ2A 2BHYA 2J66A 5TIMA 3GDKA 3SUWA 3RITA 3DYMA 2ZADA 3C2RA 4YVXA 1PCWA 2OX4A 3E2QA 4E3VA 1HKJA 1OSEA 1FOBA 3RN6A 3NG3A 3RPTA 4Q7IA 3IGHX 4CD4A 4Q8MA 2NQZA 4TVCA 2FZ8A 4QDWA 1TJPA 4C7GA 3H2EA 1AQHA 2ATSA 4O52A 3WENA 3TX9A 5EY5A 3TQVA 4TIMA 1JPHA 1Z3NA 1EC9A 1UR1A 3G1YA 2C7FA 2PDMA 2QEZA 5A2AA 4B5NA 3QGVA 2VRQA 3U0HA 3DXIA 3VD4A 4NI8A 2V3EA 4HMDA 3LRLA 3VO0A 1A53A 2V5JA 1UP2A 4DIAA 2CZVA 5I09A 5LKYA 5DY3A 3WJSA 1NVMA 3L0GA 3GQYA 4JTSA 2G50A 4QJ3B 2Z25A 3FA3A 3Q65A 1KM5A 3KTXA 2YOCA 3GDRA 4MNJA 3GNOA 4M6PA 4JIHA 1H3GA 3L4WA 4US5A 4I90A 4HSHA 1IHIA 1WKFA 3B03A 3UG8A 4LRTA 1TZ7A 1TPC1 2PGFA 3QLLA 1RHCA 4JYEA 3WF3A 4C5YA 5CKSA 1LROA 2XIIA 1FCBA 4H83A 4N2YA 3HFTA 1ZCCA 3AIRA 2ZKMX 3THUA 1G5AA 2E28A 4C1LA 4LBUA 1NQ6A 4XZIA 1BG4A 2CWXA 3P74A 3M9YA 1M7JA 4A4AA 2VMFA 2BBFA 2CLKA 2TODA 3EBVA 1XRFA 3STFA 4LAZA 5DFAA 9XIMA 2Y7DA 1NU5A 3CMFA 4F40A 3OU8A 3QHOA 3WF4A 3MUY1 3FW6A 3VD5A 2IUZA 4KERA 1LL4A 1W5PA 2CLEA 5LA2A 2VC9A 2B7PA 3ZQ9A 1KFCA 1Q6GA 1LT8A 1GQNA 3GTIA 3B9EA 1JCTA 2KZHA 3U5YA 1ECEA 2WPGA 4HPXA 3MO4A 2YYTA 2QDDA 2WWDA 4OTKA 5AZ0A 1JULA 4Q4OA 2BVDA 1PXGA 1VQTA 3WEZA 4IP7A 4UWMA 3NCOA 1GVOA 3A64A 3L5LA 5A6BD 2ICSA 4KF1A 3VOHA 4G56A 4EAMA 1Q66A 2A7PA 5EMJA 4IOTA 3FHAA 3U57A 3CPRA 1XS2A 3BGGA 3PG9A 4PUDA 3ZZ1A 1Z8AA 3APGA 4MJ4A 1DEDA 5D33A 1MZRA 2P50A 1XLBA 3S3GA 3W2KA 3BQ6A 4HHMA 4J5NA 2BODX 2XFFA 1OIMA 4Z1CA 4IFKA 3N14A 4RW5A 1JRBA 3DKLA 3IUIA 5TD4A 1CX9A 1GVFA 1H7XA 4GJ1A 1TPB1 3LHVA 3N6JA 2HVMA 5TNVA 4A3RA 3C3NA 5CAKA 1EQPA 4HHLA 2E40A 4LB3A 1YEYA 1EGMA 1WDQA 1M03A 1JD7A 4DVOA 3VABA 2JEPA 4GNKB 2V68A 3NR0A 1E6PA 2NQJA 5F2MA 3BSGA 5I3JA 3H23A 1XIHA 4A3YA 1XG4A 1W37A 2FLIA 1ZZMA 1BSIA 1XLDA 2E6DA 1NWRA 3WQPA 2Y1HA 5I3GA 3EPMA 1DXIA 4Q4QA 4JDBA 1RZMA 4E4PA 2IPWA 5GNYA 4LY4A 1WCGA 4UFIA 1UH4A 1OC7A 1V3MA 1WBJA 2OKOA 3PTMA 5HAOA 3HV8A 1ZAJA 1SR0A 2YCJA 4XAFA 1W3KA 2AL2A 4MMWA 1ZBKA 1QASA 3SFKA 1RPKA 4JTHA 3U9IA 5C5YA 4TXEA 1BYAA 3EDEA 2ZZ5A 3DBNA 4ACYA 2LLEA 2V2HA 1XV8A 1M53A 2I1OA 4KT2A 2O4QA 4GJIA 3C61A 1M65A 5C55A 5MKGA 1ZPTA 2DY3A 3C0SA 3NTYA 1RP8A 1YBQB 3QR3A 1HL9A 1A3HA 5FESA 3ZJ7A 2HDJA 3H4GA 4DJFA 5E6ZA 4AIOA 3LCWA 4HPGA 5GVJA 2ISFA 4M81A 2NQ5A 1YXCA 2B7OA 2NXGA 3SQMA 1KQYA 4QRNA 2FZDA 1RVKA 1W3NA 3TV8A 4IQJA 3EDFA 3WQOA 3CQ0A 3G22A 1QPNA 1WX0A 2WLZA 5IXEA 1TE6A 3MSGA 2PCQA 2WHKA 2X1TA 4X60A 1J5TA 3KTSA 2OZ3A 1Y65A 4FF7A 2B7NA 4PMJA 3PS7A 2GOKA 3GXNA 1W6TA 5I3KA 5BU6A 4NZJA 3RM9A 4IPPA 1KBLA 1BXBA 2OZ8A 3HJZA 4PMUA 3WDPP 3BH4A 1VCVA 5XIAA 2DSVA 3VNZA 3NO1A 4YU1A 3AMCA 3GG7A 2GJLA 3TXZA 1BXNA 2WANA 2PPGA 1TQJA 9RUBA 4TQTA 2O0TA 4FEZA 3CBWA 1RR2A 3R12A 4YS1A 1DL3A 3GNRA 4AW7A 3CV2A 4TOQA 1H7NA 1FKXA 5M17A 1MEHA 1NQKA 2NV2A 2AKMA 4UIOA 4ZVJA 3T44A 3LBOA 3CWHA 4IGHA 2EXOA 4AD1A 3IJ9A 3QRHA 1JD9A 2VOTA 1AODA 1B5TA 3MBFA 1W54A 2C1GA 2ACQA 3R11A 4PEKA 2BY3A 4GUFA 5DCDA 3W28A 3DI1A 1IXOA 5CLTA 4AEEA 1O5KA 3GS6A 5CJNA 3FYPA 3V5CA 4LVDA 3NSMA 2WMKA 3W2JA 4CQDA 1SJCA 1RAKA 5FEXA 3MTWA 1DQWA 1FWFC 2FB2A 5DMNA 3DFTA 1GZ1A 3QMSA 3T08A 3MDUA 1GVYA 5I3IA 3N25A 3AIQA 5EYWA 3UQNA 4HA4A 3S8HA 1I1XA 2PS2A 1HNYA 3CUJA 1XH1A 2ZZ4A 4QX4A 5DXYA 3IJDA 3SCPA 2HNHA 4IM4A 4H9TA 3WF0A 1ZY9A 3TVAA 2G3MA 2QJGA 3URBA 1QJWA 1SYTA 1CGTA 3MHFA 3WK2A 1BVNP 2QS8A 2RH9A 3DGBA 4DZHA 3E0IA 3K4WA 2VC5A 1E1FA 5SWUA 1C3FA 4W8BA 3GFYA 1KCZA 2YPIA 1UOZA 4C6JA 4REQA 3QPEA 4FO4A 2YW3A 4FLQA 1E51A 3ZJ8A 5CZJA 1F05A 2NX3A 3CUIA 4RZ5A 1LLOA 2PODA 3VIOA 3NO3A 2XU2A 2D23A 1UJQA 4H6KA 1BWKA 1KM1A 4LBSA 5GJPA 1C8VA 2DZWA 1R2SA 3H55A 4C91A 2ZRWA 4W8LA 1TZZA 1NJJA 3BAWA 1EO7A 4FI4A 3TCSA 5CC7A 3A4JA 3A4AA 3W4RA 4IJRA 3W1RA 4WXZA 1MFVA 1FP9A 3W87A 2QCMA 1R3TA 4WJEA 2BXVA 4QQ3A 2VUNA 3FHQA 3HJEA 1W31A 2VELA 2C16A 2C91A 2DUXA 3B0VC 1TJ0A 3NYZA 1FWRA 1JAEA 1JNEA 1DJHA 1VEMA 1FXPA 1DIOA 4FS9A 3E49A 1WDSA 2XWDA 5AC6A 5FI8A 1VCFA 3WO8A 1VS1A 1XSIA 4WY0A 2X30A 2PDYA 4YVVA 1XYFA 5JXQA 2FHCA 3M7SA 3OEXA 3WBYA 3W2NA 3FV9A 4RXGA 4S3GA 5AYXA 1WKEA 4Z2KA 5J04A 3SR7A 3O15A 5AOUA 2X7WA 5A5WA 5MKGB 3F1QA 4ILSA 4XKYB 3CUGA 4B91A 4HGXA 1GVQA 2Z7GA 1YX1A 3DERA 4OV4A 3CB8A 2CPUA 4PMNA 4L64A 1PKNA 1RQBA 3B04A 4ZTXA 2PU1A 4XSLA 4LSBA 2FPVA 3RMEA 3FXYA 1G9HA 3WQWA 3RR4A 4GHRA 3TFCA 4O28A 3R2GA 1OD0A 4AEFA 3NYDA 3LTPA 3QYSA 4HP5A 4XO7A 4F2UA 4IUGA 4K7VA 4FNPA 1ONXA 1QCWA 3CV1A 2Z7KA 3H2MA 5GPRA 3LZ3A 4G1KA 1DXFA 1G6CA 2WVUA 4GH3A 2IW0A 2XN0A 3UWZA 2NWSA 2V3GA 1W9DM 3NQMA 3CZ8A 4R53A 3CMGA 1NEYA 2REQA 4PULA 3W1NA 1PX3A 2DIJA 5FL1A 2PWVA 1SM9A 1O1HA 4FXSA 4B5SA 3N18A 3TR9A 3H2NA 2BGSA 4DJDA 2PDCA 4NAFA 3FX4A 4K8HA 4X63A 1UP3A 3UWYA 3T0DA 4V15A 5F4WA 2ZUNA 5H6HA 1F6PA 4INFA 4YTTA 3PUDA 4P8UA 4WDUA 4GCXA 2PWHA 4S3FA 1FDJA 1K9TA 3NQ2A 1TG7A 2W4XA 4RDZA 1QT1A 3K1DA 1OGGA 2J8FA 2J47A 1OHLA 3UZJA 3C8NA 3VIMA 4L1GA 3LG3A 2OSXA 3VINA 1XQKA 3FKRA 2Y7FA 5E1QA 4C6OA 1JEZA 5LSMA 2BGQA 3NQFA 2UY3A 1REQA 3ITYA 1XLCA 2FJKA 2QDHA 4HMCA 2PP0A 4WVXA 4IIGA 3KWXA 3LD5A 3UCCA 4UFJA 3RLHA 1W5MA 2OWXA 3KM8A 1YNQA 1CXKA 1KTNA 1U5HA 2I57A 4C6NA 1DYSA 1IGSA 3WLMA 5PTDA 4NG3A 4C7FA 4RKAA 3FYOA 3MKKA 1R7AA 3LGDA 1ML1A 3NQDA 4R5EA 4DRSA 4OKDA 3VD9A 1XIGA 4DQWA 4JTGA 1WDWA 3W02A 4AUBA 5DELA 4Z2LA 4PB3A 4P8XA 2BY1A 3LI1A 1W8GA 4MVAA 3EOSA 3KLLA 4CU7A 3LQLA 4Q8PA 5JBFA 5I79A 8TIMA 4HYVA 2VP8A 2CCRA 1GW1A 1VPXA 3DN5A 1O5XA 1ZNNA 5AHMA 2X2GA 5BU9A 4AWUA 3A4XA 1KM0A 3TTEA 5D2WA 3HA1A 4CKQA 1TCMA 3AYTA 2VO5A 3I7SA 2R1LA 2WCGA 1JDEA 4WDXA 2V6AA 2IQDA 2VT0A 2WZHA 3H4XA 3NM1A 3IJ7A 2WQDA 3CQIA 2ZX9A 4YVPA 2F8QA 4N9BA 3LERA 2XFWA 2G3FA 3G0XA 4XZ9A 1LWJA 3CPUA 1UWRA 3RLGA 1LF1A 4ERGA 3B8SA 1TPH1 2Z1VA 4HNTA 3K46A 4DXVA 4O12A 1JIBA 1IWPA 4BJHA 5DMYA 3NOYA 4GUIA 4GVHA 4UTHA 3PJTA 4QCEA 4S3EA 3DU0A 4X2PA 4JPGA 1AFSA 1KM3A 3AAMA 3STCA 5G1YA 3BW2A 4A3HA 5A6MA 1Q13A 1W3IA 2V9DA 4Q8OA 1XM3A 2DT2A 1OCNA 2OQYA 4FR1A 1EJSC 3BG5A 4M6UA 3HQPA 3UZXA 4I3GA 1X38A 2Y70A 4GFSA 1N82A 3LI0A 5D4YA 1L6GA 2FDMA 3SECA 3UVIA 5AVNA 1A0EA 2NX1A 4NRRA 1DTUA 3RAOA 1HO4A 3MC5A 1KCKA 4DWSD 2A2IA 2V69A 1LM1A 2XN1A 2PI6A 3SUSA 2R1NA 2YDRA 3IARA 3RM4A 3TA6A 2Y8UA 4FZIA 3AWOA 4GA8A 3M0KA 4WOZA 3RO8A 3SSJA 1MQRA 3CMJA 3Q58A 2C18A 5HNRA 7REQA 5HOSA 5M2FX 1IR2A 1TMHA 1WZMA 1HKWA 1B9BA 3CIWA 4JQAA 3GC5A 5BOOA 1G4PA 4LCQA 5BWAA 1TFVA 2IXUA 2BY0A 3VNIA 4WJXA 1GVRA 5D2YA 5FJUA 3MVIA 1OCBA 1Q2RA 3DH7A 4IH3A 2OYLA 2CZEA 4HA1A 4WKFA 3LCXA 4AFYA 3F5LA 3QEZA 4NJKA 1QNSA 3OQEA 2D24A 3CASA 4HPNA 3LXCA 3LGEA 1S39A 3JS3A 1Q7MA 5DQPA 3PR2A 4NAEB 3MZNA 1QPQA 3OLGA 3TSDA 3DCPA 3UPMA 3TLQA 4LAMA 1KW1A 4ZTYA 1BTMA 4IZGA 1A5LC 3GR4A 1R87A 3W1TA 4ATDA 4HQVA 3GH4A 4M19A 4IFKB 3VIJA 3SRFA 4A8NA 5B7YA 1ADSA 1JXKA 3IK4A 1ZSXA 2QNEA 2ACRA 3P7YA 3RG6A 1QOXA 2HXTA 3EKLA<