4RR4A

Crystal structure of human dihydroorotate dehydrogenase (dhodh) with dh03a367
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
365
structure length
365
Chain Sequence
TGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
publication title Crystal structure of human dihydroorotate dehydrogenase (DHODH) with DH03A367
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 137
structure length 365
sequence length 365
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2014-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4rr4A00
5F4WA 3T40A 3GXPA 3HG4A 3B03A 5AOUA 2NUWA 1TTIA 1AL7A 1XBVA 1ZAJA 1LDCA 3BV4A 3QJAA 4NJHA 3L68A 5D2TA 4RV8A 1OJXA 2VFDA 1DBTA 4UTTA 5GVJA 4YXGA 3R2GA 4M6QA 3F4NA 5AYYA 3TXZA 5AC8A 3UZ5A 1IIGA 4LUJA 2HMCA 4JNMA 4Z0JA 2QDGA 2Y70A 3G1SA 3PWAA 2FTPA 3QEZA 1JCMP 3LOTA 1ML1A 5CZJA 1VRDA 1QWGA 2I1OA 3TA6A 1AW1A 3UPBA 3M47A 1HO4A 4ZQMA 3DFSA 3ABQA 5KZDA 5LGXA 2Z2UA 3EWZA 4JTSA 3LCLA 4PTNA 2VEIA 4L4MA 2FB3A 2E77A 1WA3A 1JULA 4GRSA 2BXVA 5CZTA 3CWNA 4GXMA 1ZHAA 2ATMA 5DY2A 3IIPA 3KVMA 4JX4A 2AGKA 2BSLA 4WY0F 1W5MA 4ZQNA 3B4UA 3W1AA 1GWJA 1S3HA 1QCWA 2EPHA 1WOAA 1SZNA 1XC4A 1VHCA 3S1UA 2OX1A 5F2GA 1XBXA 2DZUA 5HJLA 3GNDA 4K8HA 4U4MA 4FIRA 1BWKA 4AHQA 3W7CA 3W07A 4IMDA 1M5WA 4IMEA 2Y85A 5D32A 1K8XA 2P10A 2C0AA 2J9YA 1OX4B 1OABA 3LCIA 1M7PA 2B4GA 3UQNA 1JRCA 4RLIA 4QSHA 3FKKA 3HMJG 3M0ZA 3G3DA 3M5VA 3T44A 1LBMA 3C6CA 4O17A 1N7KA 5I3GA 1GT8A 3NM3A 2H90A 5CKSA 1XUUA 3W2NA 3CQ0A 4Q33A 1K8YA 3ZS4A 1W5PA 3MP4A 2YDAA 4K36A 4AAJA 4PEKA 3NPWA 3LGEA 3STEA 3L65A 3RLVA 3CIWA 3WJWA 3E02A 3DAQA 4JGDA 5KSWA 5HR7A 3H54A 3QW4B 1WV2A 1UBSA 1FCQA 2QCFA 1K7FA 4GC4A 3A5FA 1IXOA 1TYGA 1TTQA 2HS6A 3W7JA 3L5MA 4K6AA 3LXAA 5TIMA 1NF7A 4J9JA 2YW3A 1YTDA 3MI3A 1FWTA 2ISSA 2FPVA 3QW3A 5G2IA 4TMBA 1T8XA 2J88A 3TX9A 4Q32A 3VI2A 5DBUA 1KFJA 2V0TA 3CC1A 1PS9A 3NGJA 5K9CA 3TK7A 1U5JA 4DO4A 3LHYA 3G1HA 3NM1A 1TQJA 3MHUA 5FEPA 5U4NA 3ZR4A 1EB3A 2I9EA 3GDLA 3QMSA 1IIHA 4JEQA 1MEIA 4NXKA 3EX1A 4KFOA 3BO9A 4NVTA 1VQTA 1ZAHA 1T99A 2JBMA 3W1RA 5ABTA 2QJGA 1FWSA 1VC4A 3NQ2A 3WJXA 1Q6OA 4R33A 3NYZA 2PURA 2E68A 1EX5A 4OU1A 1ZNNA 3CB8A 2YPIA 1HL2A 3TIMA 1P1XA 4B5NA 2R14A 3C56A 4MZ8A 4DELA 4JTFA 3I7RA 4NJIA 3ATZA 5I3IA 2QCDA 3TXVA 3E49A 1FDJA 5D2WA 1C8VA 1TPH1 2X1UA 1B4EA 5I3KA 4NX5A 2X30A 4BWLA 3C4UA 4E2BA 2GVGA 3GLCA 4A2RA 3M44A 3NL3A 2NWSA 1G4TA 1KM0A 5E1QA 4HNUA 2YR1A 3EEGA 3I65A 4RJEA 5G5IA 2ZZ4A 4WY0B 3KVKA 1H7NA 5IBXA 4FEZA 3O07A 4O10A 2C16A 4IMCA 5BOOA 4LVBA 1JCLA 3T4CA 2RHGA 2ZRZA 3NZ1A 3M1ZA 1QOQA 1I45A 1P0KA 3ZWTA 2DZSA 3N19B 4IXHA 1B57A 4JIQA 3DENA 4O53A 2OZ0A 4PC8A 3SI9A 1RD5A 3GB6A 4OQVA 1LBLA 1DJQA 3DH7A 4D2JA 3LHVA 3F03K 3GDKA 1RPXA 2A21A 5FEZA 3ABSA 4EOUA 4QITA 1GVFA 1MO0A 5EPDA 2QEZA 1AL8A 3S42A 2ZTKA 4ZQPA 3G3MA 3G24A 3KXQA 5D2XA 2WO5A 3FKRA 1CX9A 1YADA 4A2SA 3G1YA 4JR5A 4UMAA 3O15A 1WBJA 4R34A 3BGGA 2P1FA 2DJLA 3MUXA 8TIMA 1KA9F 5KZMA 2DZXA 1KFLA 1PV8A 2UV8G 1QMLA 4ZZ9A 1ZALA 4HPXA 2EAWA 1EIXA 1OFBA 2XN0A 2X1SA 1TPFA 3UWYA 1LCOA 1B4KA 3W86A 2ZDRA 3E96A 4YMZA 3LCXA 3HGRA 4MZ1A 3DFTA 4LVFA 2YGYA 3PUOA 3N2XA 1OX5A 4DF2A 5DXXA 1S5VA 2Z0IA 4H6KA 3N34A 4K39A 3HGJA 4N02A 4N4QA 1QR7A 3GKFA 2A7NA 3TMLA 1PCKA 1GG1A 5CPOA 1H62A 5HNRA 3IVSA 4QNWA 1UUOA 4O1DA 2NV1A 3W1TA 1TPB1 2A6LA 3QH2A 3LERA 5DELA 1R46A 3CU2A 3BLEA 5D2VA 1SFLA 2VXNA 3NL2A 4AHPA 1HG3A 1YXDA 2VFHA 4JYDA 3M5ZA 3UWUA 3W2KA 3R89A 2OJPA 1TV8A 2ZRUA 5FEXA 3W87A 4RR4A 4FHAA 3TC7A 1E51A 3HPSA 5AHMA 1LOLA 3RFAA 1ZFJA 4IWWA 4WJEA 4FX8A 3PULA 4RZ5A 4BI6A 3QM3A 4FX7A 3HIJA 4CQ8A 5J5DA 3E9AA 3S6DA 4JXCA 2YW4A 4ADUA 3M5XA 3QSTA 2QJIA 4GUFA 2CLMA 3BW4A 1Q6QA 2E6AA 1LORA 5FESA 4LW7A 3G1XA 3ELFA 3W7EA 1AMKA 5IBXC 3LHZA 3O16A 2YFOA 2P0OA 4JICA 1D9EA 4OGZA 4PL2A 5FF0A 1XCFA 2GQ8A 3U6WA 1OF8A 3G0SA 3I7SA 4FF7A 1W37A 1XDLA 5C6MA 1GZGA 4MLRA 1ME8A 4MYXA 5L6UA 1EA0A 3UWZA 3W7DA 3EWXA 1LRTA 4ZL1A 3RMJA 1VCGA 3CWOX 3B04A 2RDUA 3W7IA 1ADOA 4N9EA 3R8RA 4HNTA 3DFPA 4Y96A 1TRIA 1GVSA 3OVPA 2QCEA 1GTHA 3ABRA 4CCCA 2E6FA 3STFA 3S5YA 2G95A 5G2WA 2PE4A 1L6WA 3DGRA 3P80A 3TSBA 3MYPA 1JJKA 3TQ0A 1SZGA 3SSJA 4DF1A 5F1VA 5C5YA 1ALDA 1TSIA 3TAKA 3L21A 1KFEA 5CGQA 1WBHA 2GVLA 4N6EA 3G1FA 4LV9A 2AAMA 3TV8A 3EWBX 1RQHA 1XL9A 2WSQA 3LI1A 1NVMA 3TE9A 1V7YA 1JQVA 4QIUA 3T78A 1KM3A 1FUYA 1LYXA 1Q6RA 2B7NA 5AFDA 4NQ1A 2TMDA 3BLFA 1JUBA 4POCA 2E5BA 4BI5A 4RZ4A 3S1WA 3ZFHA 4UTLA 1J4EA 2HTMA 4MJMA 3W84A 2D73A 2G5WA 2NX1A 2Y89A 1W8SA 4NUWA 4JTJA 2FPYA 2A2IA 3PS7A 5C54A 3S8HA 2IQTA 4XQ6A 3SIZA 5EA9A 1SO4A 4MVAA 2A4AA 3L2IA 1KLZA 2QCDB 4ICNA 3IIOA 2Q3RA 4DO5A 1NSJA 2B7OA 3RU6A 3G0XA 3L0GA 3VNDA 1L6YA 5CPLA 3DHFA 3NEVA 1O95A 3RF9A 1LZOA 4M19A 3BLIA 4AWUA 2V2HA 2X1RA 2ZZ5A 1RV8A 1BKSA 3LTPA 2OMAA 1OFPA 4WZHA 6TIMA 1DQWA 5F2LA 1P0NA 1G4SA 2Z6IA 2J27A 3LXBA 1SQ7A 2WNNA 3PF3A 2CW6A 4E38A 3TUUA 4LU0A 1Z42A 5D2YA 4IMFA 1I2RA 2Q8ZA 2R94A 1SW7A 2PRMA 3JRKA 4Z1AA 1B9BA 3IV3A 1DORA 3C2FA 4MZYA 2ZZ1A 4UTIA 3NL5A 1BWLA 2DJXA 5LSMA 3HGSA 4K8EA 4EWND 2EGZA 1JCXA 1VR6A 4IPIA 3HQ1A 4LVAA 4EF8A 3B8DA 1QPQA 1X7FA 2VEMA 3TROA 3NQVA 3SFKA 1R30A 2H3BA 4Y9AA 3LI0A 1SW3A 1VYSX 2Q8LA 4TO8A 1DOSA 2QAFA 3NG3A 3Q58A 3B06A 3W22A 2E5CA 4NXSA 4ZVJA 1QDSA 4FNRA 1JUEA 4RK8A 5AHEA 3NPVA 1W5OA 3EXRA 1W5QA 3KRSA 3IGUA 5H91A 3G1VA 4FNSA 3TCEA 1QPNA 1Z44A 4JDYA 5E93A 1VYPX 3HG3A 1OK4A 3W83A 3NNTA 1MZHA 3NQAA 2TRSA 3O6CA 3W88A 1RQBA 2QKFA 3EWUA 4XBSA 1Z48A 3FOKA 4Z1BA 3TKFA 1H1ZA 1SZFA 4UTWC 3Q37A 3W7HA 3B0PA 3LCHA 5IM51 1KBJA 4OV9A 4NU7A 1S5WA 1XKYA 3LX9A 3UYCA 4MUZA 3NQGA 4M6PA 1A5BA 2QF7A 4WX2A 5CPNA 2FJKA 3H55A 4CLMA 4UMCA 1Q6LA 3TQVA 3OVQA 1A5SA 2GJLA 2YX0A 5AHIA 2QCNA 3GZ3A 2ZZ7A 1KBIA 1R2RA 2A5HA 5FI8A 1H7XA 3WK1A 4GUGA 2ABAA 2E6DA 5AHLA 3C8FA 4AF0B 4ADSA 3B05A 4XTIA 7TIMA 1PL9A 5FF3A 1XFBA 4BFAA 4HNVA 1KFKA 3TR2A 1F6PA 1K7EA 3S1XA 4LRSA 1FDYA 4O54A 1GTEA 4OV4A 5LNSA 1K8ZA 1TO3A 1OK6A 4FXRA 2QDHA 1LM1A 3L5LA 3QFEA 3LLDA 5J5RA 1OFOA 1XBZA 2QR6A 2WKJA 1G69A 1TB3A 3NQFA 3UY8A 3CTLA 4OT7A 5HQEA 1M7OA 4M7TA 3BG5A 4KFPA 1G7VA 2H3DA 4UR8A 5K9DA 4UFMA 3SECA 4HN4A 3TW7A 1I8JA 3A21A 3GVGA 1TPC1 4IOTA 3NVTA 1FXQA 5D03A 1ME9A 1FX6A 4I7VA 3WK3A 3QQ0A 4PH6A 3TH6A 5EL1A 1UASA 3E0IA 1MEWA 3LHTA 2NLIA 3PBYA 2BLEA 1DKWA 3QRHA 1F05A 1MEHA 3Q2DA 3MHFA 4LVGA 3GR8A 3W9ZA 1QO5A 4O1BA 1SZEA 4LT9A 4Y90A 2WPBA 2QCHA 4HNNA 3DFQA 3G8RA 1W0MA 2ALDA 4ONVA 3IGXA 3GNNA 1EUAA 1CI1A 1AK5A 1DL3A 3V75A 3R12A 5EYWA 4N9DA 4GUIA 4IMGA 4LY8A 1PHWA 3LDVA 1FBAA 5G2HA 3TC6A 1YLVA 5U7SA 5LKYA 4O12A 4ALDA 3DXIA 3W85A 3CEUA 4A3UA 2RH9A 3P5YA 3P5ZA 3MP3A 1KLYA 2H6RA 3UZJA 3I7QA 3FJ6A 3LCGA 1LRQA 3HB9A 1IF2A 2R8WA 2Y88A 3HBLA 4DEFA 1YXYA 4PODA 1VGAA 3LRLA 4IXXA 3GK0A 4ZMGA 1C9DA 4WQ6A 3O8AA 3TJLA 4JX6A 3MJYA 3PVFA 3UD6A 1DV7A 1W3NA 4FX6M 4P61A 5K3VA 4GWEA 4O52A 1WOBA 3P82A 1PE1A 1OYAA 3LV6A 3H53A 1AW5A 2J9XA 2WV8A 3A9IA 3W74A 4QM1A 4GJ1A 1TQXA 2DORA 3LB0A 4UTUA 5A8GA 1THFD 4QISA 2DZTA 2EHHA 3FYPA 5K7JA 1VCVA 1UB3A 5D05A 4BK9A 3HG2A 2H8XA 2ZRXA 3QMTA 3TAOA 2CLIA 4K7YA 1KM5A 4AEOA 1GJPA 1H50A 5HWNA 1XBYA 1YXCA 3KFTA 3GIYA 5DCBA 1H7PA 5LNRA 5CZSA 5KTLA 1KTNA 1Q45A 4A29A 1FCVA 2VFEA 3PUDA 3P60A 5I3FA 2C1HA 1TPVA 4N9BA 4DBDA 1A50A 2O7QA 2QCCA 1R47A 4ORMA 3M5YA 2J6XA 3WK2A 4A22A 4JIPA 3EWYA 3W1NA 2GVJA 3O6DA 1X6UA 1H51A 3NZRA 4CNPA 4O1CA 1OX6A 4UTHA 2ISWA 4YL2A 1ONRA 2XN2A 2Y6ZA 2C15A 2BZNA 3HF3A 4RCXA 1N55A 3DHDA 3D0CA 3PC0A 3A5VA 3P61A 4WOQA 1HUVA 2YSWA 5HUPA 5AHFA 4NT0A 1F74A 3OBKA 2W6RA 1CW2A 5AHNA 1TCDA 1T96A 4O50A 1HFBA 2A0NA 3BG3A 1SPQA 1IXQA 3C2RA 4LC8A 1F5ZA 1R2SA 2X2GA 3W1PA 3STGA 3SJ3A 2CZEA 4HSOA 3LXCA 4JS3A 2I14A 4W9TA 1KM1A 4AVFA 2PRHA 1VLIA 3N2MA 3QC3A 3C2VA 4LWWA 3GDTA 4M5PA 4XKYA 1TV7A 3HOJA 4AF0A 5CZ0A 3WJSA 2CFFA 5G1TA 5H2ZA 3NXFA 3NQ6A 4G1KA 1GYNA 1SO6A 1ICSA 3EX4A 5D09A 3TQKA 3T55A 1BTMA 2G96A 3P7YA 5I3HA 2X16A 4FB7A 1F2JA 4UXDA 3MWAA 4MIMA 3S1VA 1B3OA 1NEYA 3BW2A 2DZVA 1P5BA 3ANYA 1VLWA 1LRNA 3BG9A 3DKLA 1ME7A 3AJXA 1FQ0A 2FB2A 2PCQA 1JCYA 4UFKA 5LGZA 2CZDA 2Y7FA 1UJPA 2YFNA 2QAPA 3TNOA 3MBDA 1TMHA 4TIMA 3VFLA 2VC6A 3L5AA 3P81A 3W71A 5LNWA 3MBFA 3L67A 4MKNA 1KV8A 4TX9A 2C14A 2ZZ3A 3F4WA 4LUIA 5TBOA 4H4IA 4BR1A 3W7PA 3TFCA 3I6RA 3NA8A 3SZ8A 4KWVA 2TSYA 3BARA 5FF2A 3W7OA 4I7WA 1O60A 2JKEA 2JKAA 5D33A 2CZ5A 1VPXA 5T26A 4DPPA 3W1XA 6ALDA 4UTWA 4CQ9A 1EWDA 1DQXA 3MP5A 3NOEA 1FWRA 1EWEA 2ATSA 5G1YA 3IIZA 3TW6A 1ICQA 1YTKA 4UTJA 3GR7A 4NNAA 2Q3OA 4XZ9A 3N3MA 1LOSA 2WSRA 4RXFA 3W1LA 4JTIA 2J9ZA 4Y8FA 4FNUA 3FIGA 4NNBA 3ZWSA 1O5XA 4UFIA 1R2TA 2LLEA 3EXSA 1O94A 1Z41A 1SSGA 3VCRA 3FJLA 2QUVA 4LS1A 3CM4A 3L0KA 1LP6A 3OA3A 1QPOA 3WJYA 2A7PA 5CPMA 2O7SA 4CCDA 4IUOA 1LLZA 3A24A 3EB2A 1FCBA 3IVTA 1YYAA 1AG1O 5CSSA 1RR2A 4BF9A 4CCEA 2G97A 3W70A 4Y6GA 2JKPA 3YPIA 3W23A 1TTPA 2VFGA 3TDFA 1ZCOA 3UWVA 3INPA 3LM7A 2WSYA 1IXNA 3FA5A 5EKYA 1G6CA 4MJZA 3PSVA 1W3TA 5MHBA 3IIVA 2WQPA 2C3ZA 3E12A 3NR0A 3W7QA 4IQLA 3UPWA 3T7VA 1YTEA 2RDWA 5HMSA 5HULA 2FFCA 3TSMA 2ZYFA 2BWGA 1I4NA 2VENA 1H7WA 1TREA 1HTIA 1SO5A 3TJXA 4AWSA 4UFLA 1TPWA 5HINA 4MFEA 3WFAA 3S5NA 4GUJA 5DBTA 1JRBA 5HUOA 3SGUA 3W2MA 2PC4A 3QSRA 4OE7A 1FWNA 4LS2A 4HHPA 4CNNA 4OBTA 4EIVA 3EWWA 1SUXA 4M7SA 3QMRA 1QFEA 4GFSA 2NWRA 3G1DA 3OVRA 3EXTA 1A5AA 3USBA 3W72A 4RZ6A 1RQEA 4LTSA 2ZFAA 4N6FA 4NJJA 2HSAA 1TJRA 1A53A 1PCWA 3R13A 1QAPA 1EPXA 4JTEA 2VOMA 1GVOA 5DN1A 2F84A 4MY9A 5BW6A 2W0UA 3Q94A 4DPQA 2WJZA 5KINA 1O4UA 5D30A 2DZWA 2JGYA 2CWNA 3W6YA 2C6QA 1VH7A 2RKXA 4LRTA 5DCDA 3EX2A 4AH7A 3QPZA 3THQA 1I2PA 1OHLA 2DZPA 2GQAA 5FF4A 1O5KA 3KAOA 3OHIA 1JCJA 1SFJA 3U2OA 3WK0A 2ZA1A 4C1LA 3W7RA 3PUEA 1EEPA 5BRBA 1H61A 2VEKA 3HO8A 1N8FA 2QCLA 1HO1A 3CEPA 5F4SA 4JTTA 4O28A 1F7BA 3S9YA 2VEPA 2CLOA 5BMWA 2C13A 3O63A 5LHEA 4PCFA 4TR9A 1ZAIA 1TPEA 3RK8A 3UXDA 2Z6JA 5DXYA 5F1UA 1KW1A 3GAKA 1W1ZA 4O14A 2NXGA 4EVZA 2E09A 1EUNA 2E1DA 1WX0A 3HPZA 4KKXA 3LHWA 3LV5A 2ZZ2A 3NDOA 1BEUA 2VKZG 3C52A 1TTJA 1LTDA 3N9SA 4IX2A 4O0KA 3QPYA 4XKYB 1XM3A 4WD0A 3S5ZA 4JDBA 3RNDA 5K4XA 1AW2A 4PA8A 1NFBA 3NO5A 3O1NA 4N9CA 1YDOA 1SSDA 5D02A 1NF0A 3HJZA 3SGZA 3P67A 1YDNA 4E2DA 4E0CA 1Q3NA 3IEBA 2ZA3A 3C61A 4YLWA 5TQLA 3PY2A 5AYZA 4IGHA 1VCFA 2NX3A 1K03A 4FNQA 1SU5A 3TFXA 1C29A 3ABOA 1WDWA 5KZEA 2B7QA 5HWMA 3LCWA 3G0UA 3W7NA 1I2NA 1V5XA 3OIXA 1KTBA 3A23A 2V9DA 1K7XA 2Y7EA 4LC6A 4YWIA 3P62A 2WNZA 4HPJA 1FDZA 2PRLA 2F7FA 4UCGA 4QAIA 2B0MA 1OFEA 3PBUA 3ATYA 4I7UA 4OWGA 3MI2A 2V81A 2RFGA 3W1QA 1ZY9A 1F6KA 1SR9A 2TPSA 3O06A 5LZLA 4HIBA 1FY6A 2BX7A 1L6SA 2C18A 5HWJA 3NAVA 3NQCA 2EF9A 1X1ZA 1KM4A 1PIIA 3G8EA 5AN7A 4CQAA 4IX0A 3SY5A 3W75A 4DQWA 4JYFA 2KZHA 3CT7A 1TIMA 1G4EA 4AMAA 4O13A 2NV2A 1VYRA 2GJNA 4DBEA 5K4ZA 1XXXA 1W54A 2VFFA 1DHPA 3KVLA 3A22A 4H3DA 1MXSA 3DKJA 2EKCA 3EKZA 3L9CA 3QQ1A 4GE8A 1Y0EA 2V30A 1X8FA 4GBUA 4FNPA 1GVRA 4OHQA 3R5EA 1XUZA 4N2YA 3W2JA 3KRUA 4JTHA 3G18A 1WYIA 3PM6A 3DU0A 5EBUA 4O4WA 3LRMA 4JD4A 1SW0A 4Z08A 3C2OA 3LTYA 3LBMA 4EF9A 3UNDA 4UTTC 1OF6A 4UMBA 2XFWA 2A1YA 4O19A 3KRZA 4WXYA 5CSRA 3VKJA 5BMXA 4JTLA 3B0UX 3W73A 3M9YA 2NXIA 4HT3A 5G4EA 3NQDA 3IRDA 4MY8A 4S1FA 1NAL1 3LHUA 4WOZA 4NJGA 2W79A 4ORIA 4AWTA 1ZJIA 4O11A 3GXNA 3GYEA 1G67A 2E5DA 5LNUA 2AQWA 4MLJA 3W76A 2OT0A 3OG3A 3VE7A 3EX6A 3NQEA 3BW3A 3W1MA 3W7KA 1GEQA 4Q4KA 2J24A 1RVGA 4IJBA 1TRDA 3DFOA 4UNLA 3CHVA 4UFHA 2ZRWA 4L4LA 3DFNA 3DZ1A 1WAUA 3W7MA 4KWWA 3HGOA 1VJIA 5C55A 3JS3A 2B7PA 2H8ZA 3N73A 1JVNA 1LROA 1OFRA 3V1PA 3W1UA 4DF0A 4XBKA 4YCPA 1FWWA 1MSSA 1KM6A 3KOFA 4O18A 1TPUA 5LNVA 2FDSA 3KVJA 5KMYA 2FPTA 1WXJA 5F2MA 4LS0A 4O0ZA 2VFIA 3LRKA 2V5LA 3TMQA 3GDMA 3LBCA 4CNOA 4GUHA 1OYCA 4XUGA 3W2UA 4NZFA 1GYLA 3TSDA 2CLHA 3DI1A 1H7OA 2V82A 4X22A 1YPIA 3HG5A 4UFJA 3G22A 4O4VA 3BPWA 3SW6A 4BI7A 5D04C 2QCMA 3KHJA 5AC6A 4O15A 4UC5A 5F2IA 2QUUA 3KX6A 4A21A 4JYEA 2OT1A 2HS8A 2CLLA 3CLMA 3GX9A 1OVDA 5D38A 1I2OA 1OYBA 2WOQA 5BNKA 2ZRVA 1S5TA 1KM2A 2NX9A 3GKAA 1ICPA 3CPRA 3MMTA 3P84A 4S2BA 5FF7A 1OFAA 1TV5A 1KV5A 4UTMA 3EX3A 2V2CA 4JY9A 1LBFA 3NQ7A 1YDVA 4TU1A 1W5NA 1U83A 4JN6A 1J5TA 4UIOA 4WXZA 1GVQA 1G4PA 4MYAA 4X3ZA 2ABBA 3B0VC 5A5WA 4YCOA 4DO6A 4FXSA 3LLFA 4UUIA 1EP3A 3IVUA 4O16A 2Y63A 3WJZA 3PG9A 1J2WA 2NUXA 2R91A 3IIXA 2QJHA 4UR7A 4HSNA 3NPXA 3PBVA 2YCEA 3C2EA 1FXPA 1OG0A 3BK0A 2BTMA 3THAA 4TMCA 5E0KA 4QQ3A 1GQNA 2Y61A 2YXGA 4I9AA 5AB3A 3I68A 1LLWA 1A5CA 3PB0A 1OX4A 4JY8A 4ADTA 1I2QA 3MHGA 2V5BA 4HKPA 1JUKA 4R53A 4X2RA 4Z1DA 1L9WA 5C2XA 3AO0A 1JQXA 4ML9A 4QNEA 3DI0A 5AYXA 5SWUA 2GQ9A 5DY3A 1L2UA 2ZRYA 4QJ1A 5F4XA 1OFQA 2GPTA 4KFNA 5I3JA 5G4WA 3P8JA 3OEXA 1EP2A 3PSWA 1GPWA 3S0CA 4JTGA 2GOUA 3W3OA 1ZENA 3N14A 2YYTA 3FS2A 3FLUA 3P74A 4JX5A 2FLIA 1YPFA 3PAJA 1D3GA 4LVDA 4BWLC 3O6YX 3W7LA 5L9FA 1P4CA 1W56A 2V8ZA 2A6NA 2DP3A 4FIQA 3S5OA 5K2ZA 3SR7A 2WNQA 4PFMA 4Z1CA 2CZFA 4X9SA 3L0NA 1PHQA 1W3IA 5EY5A 1VS1A 1W31A 4LV4A 2NZLA 3C3NA 4JTUA 3VE9A 3MYOA 3FFSA 3FYOA 1IGSA 4Z0SA 2CLFA 3GDRA 1K02A 2ZZ6A 2FIQA 1H1YA 5CG7A 2CLEA 3BVJA 2CU0A 2QUTA 1VZWA 4NNCA 2TYSA 1PVNA 4XTDA 1QOPA 3M16A 4ZQRA 4FO4A 4O8RA 5AC7A 1TJPA 5DCEA 3PBWA 4MPQA 4LOCA 3NPUA 4R7JA 4LNYA 3C0JA 4AB4A 4AXKA 4N4PA 2JGQA 3K30A 1JR1A 4S2CA 5KITA 1IXPA 3BGJA 2Y62A 1LOQA 2Y7DA 3NQMA 3P8IA 4UTKA 2A85A 2NXHA 1T0OA 3UY7A 2GUUA 4GNJA 1QNVA 2Z1BA 5HR6A 1XDMA 2ZQ0A 3STCA 2CLKA 2ZBTA 2C19A 4PL1A 5FEWA 4M6VA 3W7GA 4NX0A 1UCWA 2VELA 3M41A 4K37A 4AHOA 1X1OA 2NUYA 3M6YA 3NQ8A 3G1AA 3RLUA 2A7RA 3EKLA 1QO2A 5DLCA 4JTKA 1XI3A 2JK2A 2XN1A 4C1KA 2OCZA 4ZQOA 5K9XA 2X1TA 3M7WA 1GOXA 4RKAA 1FCUA 4P2VA 1JCNA 4MY1A 1H63A 2V2DA 4WY0A 2Y7GA 4ZQCA 1DVJA 3M43A 1KFBA 2YYUA 4RX0A 2E6YA 4UNKA 1OFDA 1H60A 3PB2A 1EP1A 3QYQA 2ZTJA 1SO3A 3DBPA 4IPJA 1DJNA 3IGSA 5D37A 3JR2A 4MFDA 3UXAA 3PG8A 4WUIA 4K38A 2DU2A 3GXTA 2QCGA 2ISVA 4NZJA 1RZMA 1G7UA 1D3HA 1F76A 2ZCGA 3QZEA 1VHNA 4U28A 1KFCA 5EMUA 1WQ5A 4NJKA 3LCFA 1H5YA 1H7RA 2ZA2A 2RDTA 5LHFA 3L66A 3LTSA 4O1AA 3CIXA 4FNTA 2FQIA 3HPXA 4XWUA 1K3UA 3MO7A 3GAYA 3UWQA 1GG0A 3MI6A 2YZRA 1TPDA 3FEMA 4MOZA 3F1QA 4DXVA 3W2LA 3NL6A 3N9RA 1UUMA 3TU9A 1QPRA 3PR2A 4O57A 1M6JA 3QF0A 3U8GA 1F73A 3MW7A 4K7VA 3O05A 4RXGA 3UWWA 1KTCA
chains in the Genus database with same CATH superfamily
2BFGA 5AOUA 1MQRA 2GYIA 2NUWA 2J7BA 1AL7A 1JXJA 4G5DA 2VJXA 1N2VA 5D2TA 1MW3A 4RV8A 2VFDA 4I8YA 3VIFA 1JIBA 1J01A 1E5JA 3R2GA 4M6QA 1XGEA 2WANA 5AC8A 2NQLA 1L6FA 2QNEA 3CQHA 4AY8A 1P0EA 3A3XA 3QEZA 1JCMP 2PTXA 1ZJAA 3VMPA 1XC6A 2INZA 4L9ZA 3DFSA 3ABQA 3VDCA 3EWZA 3AYVA 3K8KA 4L4MA 1NARA 3TTEA 1IT7A 4YIWA 2J78A 3CWNA 4Z17A 1QATA 1S2CA 1GUVA 5DY2A 1X7IA 4W5ZA 3DG3A 4GNVA 1E0UA 3A12A 3SCWA 3B4UA 2BY2A 1O68A 3QZAA 4G7EA 3MT1A 4FR1A 2DZUA 3GNDA 3DFYA 3WMLA 1YNPA 3EOLA 3S2MA 4IMEA 1OCNA 1TUFA 2WC7A 2P10A 3V0SA 3AICA 3LCIA 2DUAA 4ENLA 3URAA 3GG1A 1LT7A 4CGTA 1VBUA 1JRCA 1OCQA 4RLIA 3HFYA 3M0ZA 4MF4A 3M5VA 3OQEA 2W66A 1N7KA 1OC6A 3EEZA 1R7AA 3NM3A 3IJIA 3POHA 4NIRA 3W2NA 3MP4A 4OUIA 4K36A 4AAJA 3APYA 3L4XA 3MUAA 3GHSA 1L8NA 3T08A 6REQB 3P93A 3LGEA 1WUFA 4JN8A 3DAQA 5HR7A 1XRVA 1IWAA 1FCQA 2VT0A 3A5FA 1D8WA 2F9RA 3D3FA 4B9YA 2FHFA 3QZ6A 3LXAA 3NJ3A 5TIMA 1NF7A 2Y24A 2YW3A 1YTDA 3MI3A 2ISSA 2VQTA 4LBRA 3QW3A 5EU9A 4HJWA 1E73M 1QBAA 1T8XA 5DBUA 3T2QA 3VKKA 5K9CA 2FZMA 4DO4A 4HD5A 1UR0A 3MHUA 1FWGC 2P0IA 4JEQA 1MEIA 2DVUA 3MDUA 4DRSA 1QBBA 4NVTA 1ZAHA 1M41A 2XTKA 3W1RA 3ZSSA 5ABTA 2QJGA 3WJXA 1Q6OA 4R33A 2REQB 3WLPA 3QTPA 5IXEA 2YCIX 2OKTA 4DLFA 4L80A 1EFZA 2R14A 4MZ8A 4REQA 4IL0A 2E1WA 1RY8A 1V93A 1I0BA 3H21A 1G5AA 2OODA 1EDGA 1W9BM 3ARVA 3L2MA 4BWLA 2GVGA 3IJDA 3S5SA 4A2RA 4UWMA 4C6DA 1RBOB 3M44A 4H01A 3WQ4A 2NWSA 4V33A 3W38A 2ZZ4A 3N3TA 1MZRA 1FHDA 2Y1HA 4EXAA 1EHAA 3H4WA 1ZUAX 3SCOA 3WLMA 4LVBA 2ZRZA 2ZVRA 3CPGA 2EPNA 2PLCA 3NZ1A 3VNIA 3BZJA 3N2OA 1NP0A 5C9UA 1RD5A 4LGXA 2WMFA 3DH7A 3ZQ9A 5CC7A 1CGYA 5EGRA 3LHVA 2CETA 2YXOA 3F03K 3T9PA 3RDKA 3LEPA 4D6EA 1QT1A 4EOUA 1J9YA 4QITA 5GNYA 3SFWA 3U2ZA 3CV7A 5EPDA 5ABFA 2ZTKA 2CLPA 2QVNA 3G24A 1V0NA 1HVXA 5LIKX 4A2SA 3GVRA 5T9CE 2ACSA 2G50A 2IPWA 1WBJA 4KCVA 3BGGA 5CCZA 2QZRA 3WO8A 4PEEA 3SCSA 3R1ZA 3WNLA 4DJED 2OSXA 1QMLA 1MQPA 2ACUA 1WDPA 1YRRA 1YEYA 1FWCC 2OU4A 3WH8A 2D0HA 2X1SA 1OQFA 4XB3A 3R94A 1TZZA 2ZDRA 3TYUA 3LCXA 1IQ8A 3PUOA 1S5VA 3FNDA 4H6KA 1EXBA 4KQNA 3HGJA 3L23A 4S3CA 1PCKA 3AMLA 3URNA 1GG1A 1R9XA 1PWMA 5CPOA 1H62A 5HNRA 4QNWA 2I17A 2DIJA 2YCJA 3W1TA 4P7RA 3U3HA 4F2TA 4IPNB 4QJ5B 5DELA 4A3QA 3CAWA 3TTQA 3VD5A 3F7JA 1SFLA 4AHPA 3PWGA 1YXDA 2VFHA 4JYDA 3T1GA 3M5ZA 4AEFA 1TV8A 4RR4A 3PJTA 1F4AA 2VD8A 1WNOA 3HTWA 3VNZA 3LYEA 4FX7A 3MSDA 1GVIA 1FWFC 4MADA 3AHVA 3L7RA 2YL5A 3OJGA 2YW4A 5A94A 3FJ4A 1Z69A 3QSTA 2QJIA 3GVVA 2E6AA 5FESA 2CXGA 4Q7BA 1FWHC 5HDRA 3DC8A 1IYXA 4M24A 4JICA 4DM1A 1KXHA 2XFYA 5FF0A 1OF8A 4FF7A 4RNIA 4EPKA 1ME8A 4MYXA 1TCMA 1V6YA 3UWZA 3BAJA 3W7DA 1VCGA 3CWOX 2EG8A 1UPPA 2RDUA 3W7IA 4HNTA 4Y96A 4GYJA 3A9BA 4XUYA 3STFA 3S5YA 1L6WA 1XLFA 3P80A 3W82A 2D2OA 5F1VA 1ALDA 3TAKA 2GVLA 4FK9A 1XL9A 3LI1A 3NZGA 1V7YA 1FUYA 1Q6RA 3D47A 4LAZA 4HGXA 4QLKA 2VDGA 2R1MA 4XX6A 2E5BA 1J10A 4RZ4A 3S1WA 1JGMA 5C9ZA 3ZFHA 4MJMA 3W84A 2G5WA 3PZQA 3ECQA 1W8SA 1X1NA 3A4JA 3QN3A 4AU0A 3S8HA 1OCJA 2IQTA 4DJFC 1SO4A 4MVAA 2A4AA 3T09A 4CCZA 1FHLA 3FYYA 4YTSA 4RE0A 3CNYA 1EO5A 3IIOA 3RN6A 5CPLA 3DHFA 5IHSA 3DHUA 1WUEA 2OQLA 3N6HA 1O95A 2J74A 3N6QA 3WQWA 4M19A 4AWUA 4E2OA 3QR1A 2OMAA 1OFPA 6TIMA 1DQWA 5F2LA 5ECVA 2GDUA 2ZKMX 3LXBA 1C8YA 5HNNA 3KBSA 1O5QA 3PF3A 2J7HA 2CW6A 4E38A 4AXNA 4LU0A 4Z1AA 3FDKA 4HZ8A 4XIMA 1V03A 3AWNA 4ICMA 1HJSA 1BWLA 4E8CA 4NZ3A 3KOXA 2WWCA 4EE9A 5LSMA 2YB4A 1O1HA 2CIPA 4AMCA 1JCXA 2X40A 4GQQA 3OYZA 3B8DA 4TV6A 2VEMA 3SFKA 4AIBA 5G4HC 1QNSA 3LI0A 3GO2A 4NZCA 3KP0A 3N29A 1JD9A 4FLRA 1QDSA 1F9CA 3IJ6A 1JUEA 2W91A 1W5OA 3Q67A 3UFYA 2PDUA 5HOSA 1W5QA 5A2CA 1WE5A 1XYMA 3G1VA 1QPNA 2VI0A 5TNVA 4JDYA 3XISA 1VYPX 2Z26A 4F0SA 2X2YA 1I1WA 2FZDA 3TYZA 4J3SA 3VOFA 2WJFA 2PP1A 3NNTA 1E1CB 1XLDA 1G0CA 1MZHA 4C7DA 4DZ5A 2G4JA 3SN0A 1RQBA 4CU8A 2Q8XA 2QKFA 1UBPC 1S2WA 4Z1BA 1KFWA 1A47A 2XVLA 1XHGA 4CVUA 3FA4A 1SZFA 3GBEA 4UTWC 1M04A 3VU2A 3VX1A 5EFFA 3WENA 1XKYA 1XH1A 3WY1A 3LX9A 3UYCA 4OECA 1A5BA 9RUBA 4WX2A 1DXFA 4DI9A 2CWXA 2EPMX 2GJPA 3L4YA 3RR1A 4DJDA 1UP0A 5FJJA 3GZ3A 3E2QA 1R2RA 4MWAE 3CMJA 4U31A 2A5HA 1F3XA 4JZ5A 2P53A 2CERA 4JIIX 4GNKB 4AF0B 1PYMA 1XR2A 1W6TA 7TIMA 3WLKX 1JFHA 1SMAA 1XFBA 3GFYA 5E09A 4GIYA 1K7EA 5HBFA 3OTRA 4LRSA 2PGWA 3QGKC 4JNYA 1REQB 2PWVA 3APTA 4FLOA 3LQGA 2Z24A 4Q4QA 4XO7A 1JDEA 4WR3A 3THCA 4L64A 2VVNA 2Z1XA 3N15A 1LM1A 2CITA 1A5LC 5J5RA 2QR6A 1MFUA 2WKJA 2JIWA 3UY8A 4F0KA 3ABXA 4M7TA 3BG5A 1G7VA 4UR8A 3SECA 4HPGA 4JFVA 3GVGA 4IOTA 1MVYA 6ENLA 2WCGA 1EYWA 2DIKA 2OPJA 4CN4A 4W7WA 4GIAA 1YHTA 3ITOA 3WK3A 2V5CA 4LUSA 1Z89A 5EL1A 1UASA 2VVSA 2VQUA 4NZ4A 4QP0A 3N17A 3PK7A 1DKWA 4ZFCA 4HTYA 1F05A 5CBIA 3HV9A 4IIGA 3W01A 2L5HA 3GR8A 3W9ZA 4O1BA 1SZEA 2W63A 1J93A 3DEQA 1I6NA 4LYPA 1XG3A 1JNEA 5C9WA 3VIOA 4HNNA 3DFQA 1KGUA 2ALDA 4HA1A 1BLIA 4L1XA 4GXWA 5A6LA 4FMVA 4LF2A 4PUDA 4I6KA 4C6LA 1EUAA 3CUHA 1LL6A 3R12A 5EYWA 3BLDA 4N9DA 1IT0A 1ECQA 5G2HA 3TC6A 4DIAA 3ARXA 3DXIA 1AFSA 1NIUA 3M46A 3BJSA 4A3UA 4H2CA 2V3DA 1Z8AA 3QV7A 2QQ6A 3EDKA 3UG5A 4NY2A 1IF2A 1BG9A 2Y88A 1YXYA 4PODA 4F0MA 4IXXA 3RM9A 1B1YA 3O8AA 2DZAA 2D2HA 1O5RA 3NSXA 1W9VA 3NDYA 5FJIA 3UD6A 2PLJA 1W3NA 4FX6M 1ZBCA 4P7NA 1BYBA 4C1NA 3HURA 2W62A 4O52A 1WOBA 2VMFA 3ZJ6A 3RIKA 3H53A 2GDVA 1AW5A 1YKWA 4GISA 3W74A 1TA3A 5A8NA 1JYVA 2PU1A 1MDLA 5A2BA 1KBKA 5K7JA 1MW1A 1VCVA 4BK9A 5CPSA 1BVNP 1D8CA 2ZRXA 1DEDA 3QY8A 3TAOA 2CLIA 1DTNA 3OLEA 1KM5A 4AEOA 1KXQA 3KFTA 3GIYA 1H7PA 3KWXA 3IWPA 1R38A 1XRFA 4W5UA 1DIOA 5KTLA 1KTNA 4AW7A 1QI2A 2VFEA 4L6OA 3QHNA 5HATA 2PF0A 1CGWA 1GW1A 3ORWA 2J6XA 3WK2A 3I3BA 3UR7A 1S2AA 3EWYA 5XIAA 2FDMA 2DZBA 3JW7A 3O6DA 1E72M 1TIWA 5E6YA 3C0SA 4C7FA 3SCUA 3HF3A 1N55A 3D0CA 3A5VA 1V6VA 2Z29A 4WSHA 3TR9A 5AHFA 2W6RA 3THUA 1T96A 4O50A 2A0NA 3GUGA 3T6CA 3IPWA 4G9PA 1ZP4A 4KT2A 2CZEA 4JS3A 3LXCA 3H24A 1QRQA 4DJEC 3N2MA 3CAQA 3GDTA 3HOJA 2X7VA 1ISWA 5CZ0A 5G1TA 3NXFA 3PPHA 1UHVA 4H1ZA 4G1KA 2G3IA 3BTNA 1SO6A 1QHPA 2ZADA 5D09A 1YW1A 1WB0A 5BU9A 4AEEA 1BTMA 4Y9OA 1HF6A 3AU2A 4FB7A 4AVNA 4M29A 2VGFA 4MIMA 1QK0A 3S1VA 1B3OA 3V16A 3G6MA 3ANYA 1E4IA 1WXZA 3DKLA 3AJXA 2P8CA 2EKGA 1Q6FA 4KESA 2GDQA 4ACZA 2J79A 1UJPA 2Q02A 4TIMA 3P81A 2PBGA 2QT3A 4MWAC 4MKNA 1KV8A 3IACA 3O3RA 3WX7A 3F4WA 2J13A 1PKLA 3RMEA 5TBOA 4D1IA 3NA8A 3SZ8A 3CPUA 4YNGA 3W7OA 3MSGA 4I7WA 1O60A 4LAUA 5D33A 2VCCA 3N13A 1XF0A 3LG3A 3IV8A 2PSNA 1XKJA 2BOEX 4GGHA 2JIEA 2ATSA 2V3EA 4NNAA 2Q3OA 4XZ9A 3IJ9A 3VM7A 2WSRA 1U1UA 3ITYA 4FNUA 4HPNA 3FIGA 3ZWSA 2LLEA 3EXSA 3W26A 1O94A 3T42A 1AA1B 3WLLA 5M5DA 5CPMA 1K9FA 2ACRA 4IUOA 1RUSA 3EB3A 3P6LA 4L1GA 3A13A 4GPNA 4ZTYA 3N6JA 3O0KA 4BF9A 4CCEA 3I3DA 2JKPA 4ZXLA 3W23A 1TTPA 1ZCOA 4B2DA 2WSYA 5DMLA 3N25A 3UEQA 1E9IA 1J0YA 1BSLA 3PSVA 1W3TA 1JI1A 3IIVA 2WQPA 1ZL1A 4IQLA 3K4WA 6CGTA 3PBMA 2VHLA 7ENLA 3VGDA 4PMUA 2FFCA 3TSMA 2ZYFA 1I4NA 4PUKA 2A3LA 3IRSA 3TJXA 2CCRA 4UFLA 3T8QA 1J0ZA 4EP8C 3Q45A 4GUJA 3W25A 4I5RA 3UA3A 1CPUA 3UR8A 3W27A 4OE7A 1FWNA 4LS2A 4HHPA 3VCCA 3WNNA 3QMRA 4GYKA 1ZQ5A 4GFSA 2NWRA 3MVIA 4FOJA 2I16A 2OVLA 4N6FA 4UZSA 1MWOA 4NJJA 1BFNA 1HKVA 1PCWA 1J79A 4XV0A 1MNZA 1EPXA 2VOMA 3FGCA 5DN1A 2RJGA 3UR2A 8RUCA 4A4AA 2CWNA 3V5CA 1VH7A 2NVDA 4LRTA 3AS1A 4IISA 3I3EA 4H00A 4CNUA 2R1PA 2WHJA 2DZPA 4HNLA 1RBAA 2IMRA 2AQVA 4YHGA 3WK0A 3RHGA 2OOGA 4FF5A 4JN7A 4W88A 5BRBA 5F4SA 4JTTA 4K1WA 1R3SA 4OUEA 4JIRA 3K1DA 4HU8A 5BMWA 2C13A 1V08A 4PCFA 3UW6A 3TJ4A 5EB8A 1I9CB 3RK8A 1VEOA 2Z6JA 2VC5A 3GY1A 4M81A 1S2VA 3G6LA 3R0KA 3WCZA 3UETA 4R5EA 3GAKA 1W1ZA 4GFIA 4O14A 5REQA 4CN1A 4TVUA 4IGSA 4MM1A 3LHWA 4B3KA 3C52A 5BXTA 1TTJA 4P8UA 3VOHA 4XKYB 2I5GA 4WD0A 4JDBA 1ONXA 3ES7A 5K4XA 5GQBA 4PA8A 3NO5A 1SSDA 5IHRA 3CMGA 2NLYA 1W9PA 1WKDA 1YDNA 4E2DA 4QR6A 4DYKA 3GHTA 4BA0A 2O0TA 4QCFA 1B3WA 4S3BA 1VB9A 1CNVA 4XAGA 5TQLA 3PY2A 1VCFA 2NX3A 4W93A 2E4TA 2B7QA 1WCGA 5HWMA 2X41A 1ZBKA 4G7FA 3OIXA 1HL9A 1A49A 1V5XA 4MJ2A 1NOWA 3N4FA 1JCTA 4LC6A 3CZ8A 3PZUA 4Q8WA 4HU3A 1OFEA 1IEVA 3C0LA 1VRXA 4OWGA 4A3RA 1F6KA 4HIBA 4KETA 3QV8A 3UZWA 2C18A 4AZ6A 4Y7EA 5HWJA 3NQCA 4H9TA 1KM4A 1PIIA 3G8EA 3OGVA 1PWLA 2GGIA 3M0VA 1H09A 3F5JA 4C6NA 4KCUA 2PTZA 4QBXA 3W75A 4DQWA 1G4EA 2D1ZA 1RA0A 2NV2A 2QJJA 5FAJA 2ZE3A 1AQ0A 3AOFA 1HN1A 2UZ9A 4H3DA 4GJIA 2EKCA 3WF0A 5AVNA 1X8FA 4E6MA 4LYQA 4GBUA 1QOXA 2NQ9A 1FTXA 2VL4A 4OHQA 3ZLHA 3W2JA 4JTHA 4X9YA 2FGLA 2ZOXA 4B5TA 2ZXQA 3DU0A 2D2GA 2OFJA 1M53A 2VR4A 3B8IA 3LTYA 1ITUA 1VFOA 1GQJA 4H2HA 4E8GA 4UTTC 5I6SA 1XLKA 2FTYA 4UR9A 4O19A 1LQ2A 4WXYA 1QNPA 1GQLA 3RR4A 3W73A 3DIPA 3M9YA 3V18A 5G4EA 3MC5A 3NQDA 3C8NA 4MY8A 2ZX5A 3SRFA 2W79A 1UJQA 1ZJIA 3KWSA 2UY5A 3AZSA 1QASA 3W7KA 3U48A 2J24A 1TRDA 4UNLA 3B9AA 3K5XA 4UFHA 3DZ1A 1QNRA 4D8AA 1V79A 3N73A 2B7PA 1LROA 3V1PA 4FOUA 4F3HA 4XBKA 4YCPA 4LY4A 4E2VA 2ZUTA 2F2KA 2X1IA 3S46A 3TYCA 5CZKA 5LNVA 2FDSA 3KVJA 2WZMA 2F38A 5F2MA 4LS0A 5DFAA 3LRKA 4Z42C 4GKTA 7PTDA 3TMQA 3GDMA 3LBCA 4CNOA 4GUHA 3W2UA 4NZFA 3M0LA 1RY0A 3TSDA 4HMNA 3DI1A 5HJYA 1H7OA 2V82A 2CESA 3K8LA 4X22A 1E1FA 3G22A 4BI7A 3K46A 3KHJA 3ZJ8A 1WXYA 1UP3A 4MJ4A 3N11A 2QUUA 1RLDA 2J7DA 1E1EA 2NQZA 2CLLA 2Q6ZA 5JH1A 3R0UA 1OYBA 1VFUA 2WOQA 2WPGA 2EPKX 4JFSA 3R25A 1JF5A 2AL2B 1S5TA 2XH0A 3CB3A 2C79A 3EX3A 4AY1A 3NQ7A 1W5NA 3POCA 3CZJA 4UIOA 2VZTA 4X3ZA 2G3FA 3CUGA 4FXSA 2WLZA 5I7GA 1PKMA 3PG9A 3P2VA 1J2WA 2WAGA 3WNMA 3WLNA 1ELSA 4E3TA 4FP1A 4J5NA 3ITGA 1BVZA 1PTAA 3WLIA 5FIPA 2YCEA 1K77A 3BK0A 2BTMA 4Q7IA 5E0KA 3E74A 1GQNA 1H0GA 1VBGA 5AB3A 3WLJA 3PANA 1A5CA 1I2QA 3MHGA 2V5BA 4M0XA 1A4MA 1FH8A 2V5KA 4Z1DA 4GVGA 1KKRA 1C90A 1VBRA 5BROA 1JQXA 4ML9A 2ZXBA 4GQRA 1C8QA 3A47A 4M3PA 1QI0A 1YE4A 2CBVA 4BQ3A 2GQ9A 3EB4A 1L2UA 4HU0A 4QJ1A 2GPTA 3OZMA 2HJPA 1XV8A 5G4WA 3OEXA 1EP2A 2W92A 1QW7A 2GOUA 5G1MA 3FS2A 3AXXA 1YPFA 1D3GA 3W7LA 1UR9A 3H70A 6REQA 3KLLA 4FIQA 2XSXA 3DDMA 4B3LA 4X9SA 1L2QA 1KRAC 4WCJA 1W3IA 2V6AA 5EY5A 1HGWA 5A8OA 2NZLA 4JTUA 1P7TB 2R1LA 3FFSA 1XIDA 3F2DA 3GD6A 4Z0SA 3VTRA 4MDPA 3AS0A 4D6CA 1ZRQA 1CXIA 1VZWA 4LCQA 4JKMA 1PVNA 1VBHA 3W81A 2VOTA 4O8RA 5AC7A 4Y9NA 1GOQA 3BSHA 2P76A 3NPUA 1SJDA 3ITLA 4R7JA 2REQA 3C0QA 4AXKA 3SO7A 1QVBA 1JR1A 5KITA 3SUVA 3EWDA 4RE2A 3WEZA 4I5XA 4MNLA 5EMMA 3MUIA 3NQMA 3P8IA 3G77A 1OG6A 3QTGA 1Z32X 5I5RA 3UY7A 3B9EA 4GNJA 2EJ1A 1QUMA 3U4AA 2Z1BA 2ZQ0A 2ZBTA 2YA1A 1FVPA 4GO8A 5CLWA 2FVKA 4YTTA 2X05A 3VKAA 3RYSA 3M6YA 4NKCA 3G1AA 1JG9A 3L4VA 5DLCA 4JTKA 3DHPA 4C1KA 4KWUA 4BY3A 4HMEA 5K9XA 2X1TA 4RKAA 2HQAA 1FCUA 2KX9A 4B9ZA 3P0XA 4REQB 2V2DA 3B9NA 2Y7GA 1GOWA 4MTVA 5A2AA 2CKRA 1FA2A 4IGNA 4UNKA 3T0BA 1H60A 3DBPA 1XH0A 1DJNA 4MWAB 3W53A 1TWSA 3UNTA 3UXAA 3BWWA 2AMXA 4OVXA 4C6BA 2ISVA 4NZJA 2F6XA 3SSZA 1F76A 1WQ5A 4NJKA 2PU0A 1H7RA 3LPFA 3UVIA 1FWEC 5FAGA 3L66A 2HDJA 3CIXA 4FNTA 1XGDA 2FQIA 5FSEC 1XG4A 3P14A 1MW0A 4A8NA 3FN9A 1GG0A 3MI6A 3KE0A 3FEMA 4MOZA 3F1QA 5CGTA 3NL6A 3H12A 3N9RA 3TU9A 1QXLA 1TKKA 4ATLA 1U1HA 1M6JA 2GUYA 3QF0A 1F73A 2WMJA 1S5MA 2WC3A 3O05A 3UF9A 1C8XA 4Y2WA 3CHCA 5LIXX 4WVXA 4NAEB 2OYKA 3T40A 3B03A 2HNHA 4HN8A 1XFCA 1BVWA 2OTDA 5B7ZA 4NJHA 2Z1VA 4GBDA 1C91A 1I60A 1DBTA 5GVJA 3F4NA 3UZ5A 1IIGA 4B5VA 5BXRA 4GACA 3UXKA 4JNMA 3MKKA 3MUZ1 1WDDA 1RD6A 5A6TC 2DGAA 1CB7B 3AJ7A 1PXGA 1QWGA 2I1OA 2GWGA 4NI3A 3M47A 4ZQMA 4PR4A 7CGTA 2F2HA 4U3AA 2FB3A 2E77A 4JHOA 1WA3A 4QG8A 4GI8A 4YN5A 1S2UA 2UY3A 2FFIA 4GXPA 5CZTA 1XYCA 4JQ1A 3AUJA 2I7GA 3BCFA 4JCMA 3KVMA 4JCLA 4JX4A 1Y5XA 2AGKA 1DJYA 3W1AA 1GWJA 3CHFA 3VXGA 4F40A 1SZNA 2QDDA 3PZGA 3T0DA 3S1UA 1XBXA 5J8LA 4TQTA 1F61A 3RX4A 4K8HA 5AYIA 4U4MA 4MAZA 1TE6A 4AHQA 2HCVA 4HB7A 2Y85A 5D32A 1K8XA 1OABA 1TZ7A 1W9XA 2F6KA 4DYJA 1B3XA 3UERA 3CO4A 4QSHA 3HMJG 4BEUA 2Y2WA 1LBMA 4O17A 2INFA 3PPGA 4AIOA 3DGBA 3H6OA 1NDYA 2H90A 5CKSA 1XUUA 2JE8A 4Q33A 1K8YA 1W5PA 2YDAA 4LAMA 4PEKA 1K70A 4IP4A 3STEA 3RLVA 3WJWA 3E02A 1W3LA 5KSWA 3QW4B 3MSRA 1K7FA 3MSYA 4GC4A 3S4TA 1IXOA 1VENA 2D3LA 1TYGA 2HS6A 4S3FA 3W7JA 1WZMA 3QY7A 3EPOA 4J9JA 1XLIA 4MHBA 4J1OA 3G1RA 2WZHA 1E9LA 3TX9A 3VI2A 1JPKA 3CC1A 2GL5A 1PS9A 3TK7A 1U5JA 2PWHA 4PZVA 3ZR4A 3GFZA 4CQCA 3EZ4A 3GDLA 3VD7A 4DXXA 3VGBA 2JBMA 4DI8A 3CS2A 1FWSA 1VC4A 1XYLA 3AUOA 3AHYA 2PURA 3A4AA 1TVNA 2XGZA 3H7UA 1HL2A 3TIMA 1P1XA 2G8ZA 1AQFA 2VC7A 3C56A 2WLYA 2ZVIA 1E9YB 4ZSTA 1CXEA 3I7RA 4NJIA 1PO9A 3ATZA 3WKZA 4HA4A 1VD6A 2PWDA 5FJUA 2DSVA 3L4TA 4NX5A 1BTCA 1EOMA 1W2PA 4CD4A 3GLCA 4DJDD 1JPHA 1ZBVA 1KM0A 5E1QA 4HNUA 4WF7A 2YR1A 4RJEA 3ARYA 3T0CA 3KVKA 1H7NA 1CZ1A 1FFQA 1ITQA 2EPOA 4O10A 3UG4A 4IMCA 5M03A 1UPMB 4QG6A 2ALRA 3WH7A 1JCLA 3T4CA 5CPTA 2Q71A 3M1ZA 4WIWA 2FMOA 2WBGA 1QOQA 4H8VA 1ZU8A 1YQ2A 2WZEA 2XVNA 1V6TA 2PDJA 2ZC8A 3NGFA 2DT2A 1V8EA 4Q8MA 1B57A 1PTGA 3IUDA 3GTIA 4O53A 3R8HA 3GB6A 5I09A 4PMXA 4U10A 2VX7A 1RPXA 2E3ZA 2A21A 2I9UA 1TV2A 3ABSA 3ZIZA 4XISA 3LNPA 1AL8A 4WGXA 3S42A 4C91A 1CXHA 3FKRA 2GOKA 2Y8UA 5CSYA 1YADA 3G1YA 4LUTA 4YWSA 1UD5A 3VCNA 4XZLX 3O15A 4CU7A 8TIMA 2BS9A 1XLCA 2DZXA 3GW0A 2GUBA 1E1CA 1PV8A 4R27A 1PKYA 1WP6A 1DE6A 1UWAA 1ZALA 3GWQA 2EAWA 4NL1A 1EIXA 1DWFM 1OFBA 2XN0A 3D3AA 4KS0A 1B4KA 3W86A 3E96A 3MMUA 4LVFA 1VFFA 5M17A 1YNQA 3N2XA 1SJAA 4DF2A 1BHGA 3ICJA 4K39A 3PFRA 4N4QA 4YTUA 3GKFA 2YXXA 4PUUA 1QI5A 3TMLA 2ADAA 3IVSA 4O1DA 4K1GA 1NTHA 3CUJA 4Y9PA 1E40A 3BLEA 2VXNA 1UMYA 4IFKB 2VWTA 5FD0A 4ERGA 3VOCA 4KEUA 5IDZA 3W87A 1NDVA 1REQA 5LA2A 1ZFJA 2ZWZA 4WJEA 4FX8A 4KPLA 4KIRA 2IUZA 2NQHA 4BI6A 4J28A 1XIHA 3SUTA 5J5DA 1A0EA 3U7BA 2PTDA 3PNZA 4LAOA 5BOEA 4IQEA 3VFCA 3V36A 4QTGA 4A6GA 2CLMA 3V5OA 3LSBA 3A6OA 3R11A 3H7RA 3U4FA 3LHZA 4QFUA 1C7TA 2B81A 3K2GA 2WKGA 4J3XA 2GQ8A 2Q09A 1W1PA 4CD5A 4MLRA 5LIYX 2QUMA 3RO8A 3EWXA 1VEPA 2Y8KA 1JPIA 5EBAA 1TRIA 1GVSA 5FOOA 3N1AA 2FGBA 1AZ2A 3S2LA 5JBFA 1VFSA 2E6FA 1PZ1A 2G95A 1MNSA 3TQ0A 1UR4A 4HTBA 1SZGA 4EWJA 4DF1A 4DN1A 1ZJHA 1OCBA 5CGQA 4N6EA 3G1FA 4LV9A 4ZB0A 2AAMA 1LWIA 3CL6A 1NVMA 1FWAC 3THDA 4WKFA 3T78A 1KM3A 4IQJA 3S3GA 2TMDA 4ZFMA 2YIHA 3KBJA 4TTUA 3URQA 4AIEA 3QHMA 3W02A 1J4EA 2HTMA 4D6JA 5JQ9A 2D73A 2Y89A 4LYRA 4NUWA 4QQUA 3PJUA 4ZBCA 2OSYA 3UZXA 2A2IA 1RP9A 5JBDA 4I90A 1R3TA 2XH7A 3HN3A 1MRQA 1V3JA 3L2IA 4L6DA 4CD6A 1X6LA 4ICNA 1SMDA 3G0XA 4W8AA 3GVQA 1L6YA 2WSPA 1QK2A 5AECA 1LQ0A 5JIPA 1RV8A 2HVNA 1Q7ZA 3PNUA 3AAMA 1JYNA 4WZHA 1P0NA 1G4SA 1BF2A 4Q8VA 3AIEA 2PZNA 4J40A 3AXKA 3ARWA 5KEZA 2UWFA 3LGDA 3KS6A 3TUUA 1XRSA 1IZKA 5D2YA 2R94A 3JRKA 4EKJA 4TX6A 3EOSA 2R6OA 4PUJA 3OIHA 4MZYA 3NL5A 3VAVA 2DJXA 3DFHA 3KOWA 3P3BA 3OA5A 4IPIA 4ZE5A 1VAHA 1POKA 5CC5A 3TROA 4Y9AA 4DVOA 1VYSX 2Q8LA 1DOSA 3W22A 5HQLA 3OBEA 3M7SA 5ECUA 1HZYA 2E5CA 4FS9A 4ZXOA 5J04A 4GI6A 2IQDA 4FNRA 3LQLA 1O6IA 3GC5A 3RRAA 3NPVA 3IGUA 3VC6A 4ZSUA 2OYLA 3GDBA 3TCEA 4DNMA 5AZ0A 3ARPA 4JTCA 1H49A 1K9TA 3HG3A 1OK4A 1ESWA 3ONCA 3NQAA 3O6CA 1VP5A 3EWUA 1E6QM 1Z48A 3TKFA 2YCKX 4S39A 5HMDA 1EOKA 3B0PA 3BLOA 5IM51 5HXMA 4D6HA 4YPJA 1S5WA 4RW3A 1P6CA 4MUZA 1CLXA 1YMYA 4J27A 2ZZ7A 3CTTA 4J4KA 2IW0A 4YVVA 5C2GA 3HA1A 4PFHA 5A6AA 3WK1A 4GUGA 1DJGA 2YA2A 2E6DA 4HHHA 3B05A 4KWSA 4XTIA 4US5D 2VRQA 2DEPA 1PL9A 3G5EA 4HNVA 3TR2A 3U2CA 1F6PA 3S1XA 4O54A 1FHUA 1V3KA 2X42A 4OV4A 3VZYA 2PLKA 1RP8A 1Z6KA 2QV5A 1TO3A 2Z27A 1EZ2A 1OK6A 3W37A 4FXRA 3WLTA 4PBFA 1OFOA 3U7VA 1G69A 4GZJA 1TB3A 3FAXA 3FVMA 3HJEA 3CTLA 4OT7A 1M7OA 5K9DA 3FXGA 1XIJA 3TW7A 3A21A 3NVTA 3U9IA 1ME9A 1B3YA 2WZTA 1H41A 1HKIA 2FTWA 3VGEA 4I7VA 5A6KA 3TH6A 1TX2A 2W67A 4M51A 1DIDA 2BLEA 1DWGM 3R43A 4HOWA 4D6DA 3MHFA 3LN3A 2IXUA 1NWUA 1Q63A 1QO5A 4LT9A 4Y90A 1L6GA 4GQ0A 1CGTA 2WPBA 2QCHA 3B3DA 3G8RA 2FZ8A 2IKHA 4BZYA 3M0MA 4ONVA 1Q13A 2D0FA 3GNNA 4H6RA 1ISXA 1AK5A 3VDAA 1YLVA 2DV0A 3QHOA 1E6SM 1XS2A 4PUMA 4W87A 5H6HA 4MNJA 3P5YA 1UQZA 3M0YA 3MP3A 3WF2A 4DWSD 1UWQA 2WMIA 3EWCA 5A8PA 3LCGA 1LRQA 1XICA 5HANA 4I8DA 3HBLA 4JFUA 4BS0A 5C71A 3ZM8A 1A3HA 3GK0A 2QPUA 4ZMGA 5KZ6A 1C9DA 4WQ6A 3MJYA 1JDCA 3ENLA 1E0XA 3PVFA 2TAAA 4GH1A 3L12A 2GZXA 1JD7A 1DTUA 3AMCA 1PE1A 2OYMA 2PDFA 2WV8A 4UQEA 3CBWA 1IWPA 4QE1A 1TV4A 4HYVA 4GJ1A 2DORA 4DJDC 1THFD 1IV8A 1AH4A 4QISA 1PX3A 3VKBA 3BICA 2CYGA 5FL1A 1ISYA 1GZJA 2PDLA 3KP1A 4EXBA 3QVQA 3Q4DA 1E6RA 3S2CA 1R3QA 3GTHA 1UIOA 1VJSA 3VPLA 3ZVIA 3E0FA 1YXCA 2ZXAA 1Y5WA 2PWUA 4A3HA 5DCBA 1I75A 2ZUMA 5LNRA 4L6HA 3CQKA 1OZQA 1UG6A 2J8TA 4UZUA 3PUDA 4XBJA 1XSJA 4DBDA 4N9BA 2IS7A 4YYFA 1R47A 5A6BD 4ORMA 3LS9A 3T4WA 4A22A 3I10A 3W1NA 3FGCB 1CGUA 3NZRA 1H51A 3B40A 2PC8A 4O1CA 1OX6A 4UTHA 2WZIA 1ONRA 5BWFA 1SGJA 2BZNA 3DHDA 3PC0A 2YL6A 1KB3A 3AS3A 3KZPA 3WUEA 5HUPA 1F74A 3OBKA 1CW2A 2YA0A 4CKQA 3KOYA 3UCQA 3BG3A 4IM4A 4WDXA 3TTSA 4HSHA 4LC8A 1F5ZA 2X2GA 3GG8A 2BOGX 3SJ3A 2IKJA 4AY7A 1PPIA 2QIWA 4AD4A 4AVFA 1J0HA 2O4QA 1RH9A 1TFVA 4XKYA 2DQWA 1KGWA 1B3VA 2CFFA 3PTKA 4JFWA 1UWIA 1WO2A 2Z1SA 5HNTA 5I23A 3NQ6A 1S3TC 4KRZA 1W1YA 2XFFA 4JFTA 5REQB 1GYNA 3H2OA 3CZGA 4RNJA 3EX4A 3FX4A 3LZ3A 4QLLA 3S6OA 4R88A 4G2DA 1F2JA 3PZVA 4BF7A 4UXDA 3BW2A 2DZVA 1VLWA 1LRNA 2E9BA 3BG9A 3WBEA 1ME7A 4WHBA 1FQ0A 2FB2A 1B31A 8A3HA 2CZDA 2Y7FA 4KEMA 3MBDA 4EK7A 2VC6A 3W71A 5LNWA 3MBFA 4QJ3B 2R1NA 5JUVA 2ZZ3A 3OPSA 4IIDA 1WKEA 5JH2A 2WNWA 3F5KA 4KWVA 4A3YA 2E40A 2EJAA 3MUY1 5I07A 4F48A 5E5CA 1EA9C 1Q4WA 3NCOA 2JKEA 4JQ3A 2CZ5A 2WVUA 1GOIA 5T26A 1XQKA 1P6WA 3B8SA 1HT6A 1PSCA 2ZUNA 4UTWA 4CQ9A 3MP5A 4ZENA 1ITXA 3GH4A 3TN4A 4BJHA 5BXPA 1E70M 1EWEA 1KRCC 3IIZA 3TW6A 1ICQA 3W0KA 1H3GA 4RXFA 1P6BA 4JTIA 5BOFA 4Y8FA 1O5XA 1R2TA 1H2JA 1U22A 2ACQA 2PD9A 3VCRA 4RL3A 4LS1A 3CM4A 4AZCA 1LP6A 1QPOA 4V27A 5FSDC 3I4EA 2O7SA 1EF2A 1A5UA 3BH4A 3UP8A 1IEIA 3UZZA 1FCBA 4UTFA 4N0RA 5CSSA 3VIIA 3AXMA 3ZXWA 2OWWA 2RGMA 4WSJA 4OZOA 3YPIA 3KUMA 3CJPA 4NRRA 3EA2A 3OU8A 2VFGA 3UWVA 3LM7A 1LWJA 1U30A 3OZPA 2GJXB 1IXNA 4GD0A 3FA5A 4HPHA 1UZ4A 2GSEA 2C3ZA 3BAKA 3E12A 3FVDA 4CUCA 3UPWA 3T7VA 3GH5A 2RDWA 2XUCA 5HMSA 3QV6A 1TJ2A 2BWGA 1H7WA 1MXGA 4AWSA 1TPWA 1CBGA 5HINA 4MFEA 3WFAA 1DHKA 3S5NA 1XDJA 1Y65A 3K4AA 3ALFA 1JRBA 5I3DA 3V7PA 4US6A 1IE7C 4Z2KA 3HQNA 2VRJA 2IKGA 4CNNA 4M7SA 4MB1A 4BCEA 3O9NA 5BYWA 4RPQA 1X8CA 4B5XA 3G1DA 3TYBA 1A5AA 4IH3A 4R9XA 3W72A 4LTSA 1E3XA 3M4HA 3WNOA 1A53A 4ERAA 4Z2LA 3R13A 3KS5A 2ESCA 4JTEA 5GJNA 4MY9A 3TWBA 1TZ9A 2WJZA 4ZOBA 5D30A 2GSJA 2RKXA 4AH7A 4M82A 3CAKA 3QPZA 3VMNA 3THQA 2G0WA 2V63A 4XZHA 1QI3A 1TWZA 3UJEA 4LF1A 5FF4A 3WDIA 2AL2A 3RU8X 3GNRA 3RPMA 4I3GA 1RK6A 1SFJA 2DT0A 2PDCA 1T41A 4QEHA 5ENLA 1NP2A 2ZA1A 4C1LA 2ASHA 3T2OA 3PUEA 2NSXA 1EEPA 1HO1A 3CEPA 1HJUA 4L9XA 1F7BA 4PTVA 3O63A 5FJPA 3UJ2A 2PDPA 3AZTA 5I03A 2QHAA 2VX4A 2GQ3A 4I9TA 5DXYA 1Q85A 5F1UA 3CV1A 4NASA 2DFAA 2X8RA 4EVZA 1NOUA 4UOJA 2OGYA 1KRBC 1XGZA 1EUNA 2E09A 5GJPA 1GK8A 3LV5A 1ZJBA 3NDOA 4XAPA 2XG9A 1LTDA 4NYYA 4O0KA 3QPYA 1VPYA 1XM3A 3HZ3A 3PHAA 3RNDA 3GS6A 1PB0A 3MUCA 3VVGA 5D02A 1NF0A 4A8RA 1C92A 2MUCA 3MZ2A 5CC6A 2O9TA 2J4GA 4XSMA 1FP9A 3DX5A 4KH2A 4XO6A 2QW5A 3C61A 4W8LA 4YLWA 4IGHA 2QMJA 4LALA 1XLMA 1SU5A 5KZEA 1C29A 3ABOA 4Q7NA 3LCWA 3G0UA 4LXFA 3W7NA 4DM2A 1I2NA 4QCEA 3A23A 4K2SA 2VO5A 3E2RA 5T9BG 2WNZA 3AIRA 3M6DA 3EPMA 1P7TA 4JNZA 1FDZA 4AFYA 4AD3A 4QAIA 4ZR8A 3WDPP 3AU6A 1BRLB 2HVOA 5A1AA 4B15A 4X0NA 3O06A 3KTSA 4LX4A 3OBAA 2AL1A 1FY6A 5DMYA 1P43A 1RCQA 1RHCA 4IIBA 4CQAA 3EMZA 2CBUA 1ZTVA 3WQ8A 4AMAA 3WD3A 4DJEA 2XH2A 1VYRA 4DBEA 1WAWA 3ZJ7A 5CPQA 3VABA 4TVDA 1MXSA 3DKJA 3GXFA 4GA8A 3BGAA 3L9CA 5AC5A 2V30A 3HPFA 4D1JA 2YL9A 4FNPA 1GVRA 2PWGA 1UZDA 4Y8EA 4N2YA 2A3CA 3G18A 2R1KA 3SGGA 4JHMA 4QE4A 1G94A 4O4WA 3LRMA 3ME3A 4JD4A 3ARZA 3WD2A 1EZWA 2BY1A 3LBMA 2BVWA 3CO8A 1EGVA 1OF6A 4UMBA 3KRZA 1JYXA 4J3TA 3RO6A 4B4HA 3B0UX 5AKQA 2D0GA 4HT3A 2XSBA 2WXDM 1NAL1 3LHUA 4NJGA 4DAFA 3ISIX 1I0DA 4AWTA 2VZUA 4MWAA 4O11A 5IRPA 4WDTA 3GYEA 1BYAA 4D6FA 3UG3A 3KL5A 3OG3A 3EX6A 3NQEA 2YZ5A 4R9OA 1GEQA 4IJBA 1H5VA 3DFOA 4QLJA 3KBWA 3HMCA 1NU5A 1WAUA 4QDPA 3WF3A 4DWSC 2DPEA 3PN8A 4KWWA 5M1TA 1LLOA 3R10A 1TV3A 5E70A 1IZCA 5A6MA 5CLTA 2H8ZA 1JVNA 1OFRA 5I2UA 1OIFA 3NSNA 3OOQA 2WMKA 2C7FA 3DESA 2ZWYA 4GQBA 1OSEA 4ICCX 4ZE4A 1F4HA 2QULA 2VYOA 4AYSA 2FPTA 2A3HA 4O0ZA 4NAEA 3ARSA 4WKAA 2VNCA 1VPQA 1MFVA 1ONEA 2CLHA 4PMDA 3F4DA 4E4FA 4XZNX 2XIIA 3HG5A 2V69A 4O4VA 1PZ3A 1Q2RA 2QCMA 5IFTA 4V1XA 3EGJA 3PTQA 4LH8A 4O15A 4UC5A 1BGGA 4RW5A 3KX6A 3OLDA 1R3RA 3PTMA 2VGGA 1UOKA 3NWRA 1OVDA 4C6CA 2AOSA 4TVCA 3BLPX 3GKAA 2VGIA 1ICPA 5LYRA 3ZJKA 2DSKA 1R86A 2DH3A 1TV5A 3TEVA 4JOMA 2V2CA 4TU1A 3ZT6A 2OZ3A 4JN6A 4L65A 1B3ZA 3WBYA 3KTCA 4MYAA 1F3WA 2DY3A 4PRRA 5C8BB 3LLFA 1WPCA 4UUIA 1EP3A 3IVUA 3MS8A 4O16A 2XGIA 2FZBA 1V4YA 3WJZA 2F6UA 2CKSA 2R91A 5EMLA 2VZSA 4HSNA 4IIEA 1QI4A 3C2EA 5M3WA 3THAA 4TV5A 3VOIA 3STPA 2YXGA 1LLWA 3PB0A 1UD6A 4HKPA 4X2RA 3GZAA 3ES8A 2CHOA 3DI0A 1TWDA 2J8FA 4R7OA 3FV9A 3SQMA 2WKLA 1OFQA 4AX7A 1ZENA 5I77A 2YYTA 5HQMA 3AXHA 4JX5A 1HJQA 2ZXDA 3PAJA 4LVDA 3O6YX 1W56A 3IUHA 2V8ZA 3CH0A 3S5OA 5K2ZA 1E71M 2FZ9A 2WNQA 3AFBA 1DPMA 1OEPA 3L0NA 4J3VA 3ABZA 1VS1A 3USZA 4LV4A 2BGQA 1UIPA 1Y8BA 1EKOA 2CLFA 9XIMA 1K02A 4S38A 4DZHA 4DUVA 3N2BA 1CXFA 2FIQA 1O7AA 2D2JA 4C60A 5XINA 2CLEA 4Q6JA 5LIUX 1A4LA 4C6PA 3WF4A 3QKEA 3VIHA 3OVGA 2WVTA 5D4YA 3ERPA 4LOCA 4LNYA 4CD7A 3C0JA 5BZAA 3K30A 4JTAA 4S2CA 3AC0A 3BANA 1QNOA 3BGJA 3H2EA 3ZLFA 1UR1A 2Y7DA 2RJHA 3AHZA 4UTKA 2OEKA 3OGRA 1QNVA 2YBVA 5HR6A 4GOAA 1OT1A 5FJTA 2EXOA 3UJFA 3FCPA 4Q4SA 4JHZA 3H7VA 4IJRA 4XD5A 4C5YA 1OGSA 2A7RA 3EKLA 4ROQA 1QO2A 1UD4A 1XI3A 2JK2A 3TONA 3M7WA 1GOXA 2EBNA 3E0VA 1UWSA 4JEJA 4LB3A 1KRMA 1TVLA 4A05A 4RX0A 5FACA 3T0AA 1UD8A 4IPJA 1A5OC 2OQHA 4MFDA 3PG8A 2W61A 4L4PA 3VM5A 3GXTA 2QCGA 1RZMA 1UQYA 1D3HA 2ZCGA 4AWEA 3COTA 3LCFA 2RDTA 2YDRA 4EPDC 3WELA 1N8IA 4O1AA 1EJRC 3LTSA 3FK4A 2PDHA 3MO7A 3UWQA 3QBUA 2YZRA 1TPDA 1WDQA 2E7FA 4S3AA 5I0DA 3CAVA 3PR2A 4J3UA 1AUSL 4O57A 1LG2A 3CZKA 3MW7A 2OX4A 4K7VA 3KOZA 4RXGA 1HP4A 3UWWA 2XPKA 2EG7A 5F4WA 4UNIA 4LANA 4V2XA 3IANA 1U5HA 2QJMA 1LDCA 3BV4A 4HP5A 1UA3A 1LG1A 4UTTA 4YXGA 1E0VA 1NQ6A 5AYYA 3TXZA 4LUJA 2GK1A 4Z0JA 4LUTB 3PWAA 3GU9A 4DXKA 3LOTA 3H22A 1WKYA 1J96A 1GONA 1VRDA 3UXIA 2GGHA 3TA6A 1AW1A 4HA3A 2VZOA 1P0BA 2QV4A 3E0WA 3OZYA 5KZDA 3RM8A 5LGXA 2Z2UA 4KRTA 4H41A 3LCLA 4JTSA 4PTNA 3UR5A 4ATWA 1ZCCA 4JIEA 4QDMA 1JULA 2BXVA 1DXIA 3RPTA 4PCTA 3VIMA 3JUGA 1OZMA 2WMGA 1C7SA 1G01A 4IFKA 1PIFA 2YOCA 3OO2A 1XIEA 3S83A 1VFHA 2BSLA 5EFDA 3GHUA 4WY0F 1W5MA 3CGTA 3APGA 4HU4A 1S3HA 1QCWA 2EPHA 3FEQA 1VHCA 2OX1A 1H0IA 4MSSA 3WQOA 2G3MA 3VX0A 2ZIDA 5HJLA 1ECEA 4WDWA 3HQOA 1BWKA 3A4XA 3W7CA 5A8MA 3RCYA 2C0AA 2Z2BA 2O9OA 3UQNA 3VILA 2F8QA 3TYAA 3UPMA 3T44A 3BL3A 3C6CA 1SZRA 1JZ6A 5I3GA 1EJ7L 3IJQA 1GT8A 4U33A 1CECA 4U5IA 5TAOA 1BQCA 3ZS4A 4WJ8A 4YVXA 2Z1WA 1BGAA 2QLYA 3WQPA 4DHGA 3L65A 2HK1A 1DIKA 3WH5A 3CIWA 4DLMA 1JEZA 4JGDA 3AZRA 1TTQA 2JF6A 2ONEA 2GGJA 4K6AA 4H9ZA 4IFRA 5MF5A 1GORA 1FWTA 1UR3M 5G2IA 1EQCA 1KFJA 3MPGA 2V0TA 2UBPC 3LHYA 3G1HA 4ATDA 1TQJA 3IJLA 1EB3A 3V0UA 3BXWA 2I9EA 2QUNA 5C70A 1JGIA 3N4EA 1B30A 3QMSA 1IIHA 3EX1A 3BAIA 1DWIM 3BO9A 1VQTA 2BBFA 1GCYA 3NQ2A 4QJ4B 3CYVA 3KZSA 4KWOA 3FAWA 1EX5A 4OU1A 1ZNNA 3CB8A 1JDFA 5H8UA 4PBEA 4B5NA 4DELA 4JTFA 4PB3A 3R58A 4C6KA 1D7KA 4JTDA 1HGYA 4QAWA 3U0HA 5I3IA 1EH9A 3REQB 4J3ZA 3E49A 5D2WA 4ZOCA 3WUGA 1C8VA 1TPH1 2X1UA 1B4EA 5I3KA 2X30A 3C4UA 4B90A 1MUMA 5C2CA 2IPFA 4F79A 1RJRA 1G4TA 1JZ5A 3E0LA 3EEGA 5G5IA 1W2VA 3CUIA 5IBXA 4FEZA 3O07A 2C16A 2X0YA 5BOOA 3S2NA 5A69A 1ODZA 3KDOA 3O6AA 4LBUA 2GVEA 3KBNA 2J25A 4HHMA 4P8WA 3DYPA 5FA5A 1Q8AA 1Q7QA 4H9UA 1P0KA 3WLQA 3PZOA 3SURA 4KEZA 4PGLA 3QFWA 1UP2A 4IXHA 2C8NA 3NURA 4H9VA 1Q6DA 3DENA 2VP8A 2OZ0A 3SI9A 2IXVA 4XSLA 1AQMA 2P50A 2V68A 2XIMA 3GDKA 5D9MA 3PZIA 3ZT5A 1SVDA 2WWDA 3GG0A 4GABA 2J75A 1GVFA 1MMFA 1VKFA 2VRKA 2WO5A 3A4WA 2XZ7A 1E4LA 1J0IA 5HAOA 4H8HA 4AYGA 4FAMA 2PUZA 4ILSA 3MUXA 1KA9F 5LIWX 1SYTA 1AQHA 5HPCA 4KERA 1KFLA 2UV8G 3VMOA 3HQPA 4AZIA 4HPXA 2C91A 5CAHA 1LCOA 2PDWA 2VTFA 1V6UA 3MB9A 4IP5A 3BAYA 4MZ1A 1BF6A 2YGYA 5DXXA 4ZO6A 1FWBC 3GNOA 2YDSA 3VGFA 5DRCA 4PTMA 4CEUC 2NV1A 7ODCA 4IT1A 2A6LA 1J6OA 2A3EA 3CIVA 4OKDA 3LERA 1EPVA 4GIEA 3SY8A 4CQBA 4XZWA 3S9ZA 3CU2A 3N2TA 4DWSB 3B8VA 3NL2A 3H4XA 1S39A 3W2KA 1JF6A 3R89A 2OJPA 2W3ZA 4MG4A 1EJWC 4FHAA 4QDWA 3TC7A 4Q6XA 3HPSA 3BOXA 4A35A 5AHMA 4C6MA 1LOLA 4U5KA 1J11A 1Q4NX 1GOMA 3PULA 4RZ5A 1BAGA 3RJYA 4H7VA 3E9AA 5HA7A 3E1F1 3W6MA 1ISZA 1QWKA 7REQB 3M5XA 4GUFA 3QQWA 4MKVA 1Q6QA 1FKXA 1LORA 2XU2A 4LW7A 3G1XA 4L7ZA 3GG7A 3SRDA 4R85A 4B5SA 1RJQA 2YFOA 3KDNA 4XAYA 1FH9A 1NOFA 1CGVA 4OGZA 4PCPA 4PL2A 1UWUA 5LA1A 4M1RA 3WQ6A 4YTRA 3GH7A 1TELA 3ARTA 2BVTA 1F07A 5C6MA 1GZGA 2FJUB 5L6UA 2JALA 1L8PA 1C9WA 1LRTA 3MMWA 3RLHA 4C6FA 4ZL1A 3RMJA 2GGEA 1ADOA 2OGJA 3L4ZA 3R8RA 3DFPA 4BF5A 2VGBA 5D9NA 4O1EA 1GTHA 3ABRA 4CCCA 1S38A 2WM0A 2XM1A 4GVHA 1FRBA 2PE4A 3DGRA 3MYPA 4WRHA 3LPGA 3SSJA 4PSPA 1V02A 1TSIA 5DQPA 3L21A 1KFEA 1TUXA 1NWTA 1FWIC 4PMVA 3EWBX 2J7CA 1RQHA 2WSQA 3TE9A 1JQVA 3B0YA 5AFDA 2E28A 3OZOA 3F2BA 4NQ1A 4IPPA 4J2MA 3AYSA 3KBMA 1KR1A 3QLDA 1JUBA 4POCA 4BI5A 1CCWB 3M0HA 4UTLA 1AD4A 1XPYA 1UZHA 1XIGA 2DW7A 2PGRA 3HPAA 3WH6A 3EDDA 2HK0A 3PS7A 4Q8QA 4YVPA 3WBXA 4XQ6A 4DWDA 4S3JA 2CC0A 2QCDB 3E6EA 3BQ6A 2OLAA 1F8MA 4NF7A 3RU6A 1S46A 3L0GA 2WM1A 3NEVA 1POJA 3RF9A 5LXEA 1ZZMA 2WMIB 2V2HA 2X1RA 2ZZ5A 4MB4A 1BKSA 1QJWA 5TD4A 3BJFA 3CH9A 2Z28A 2J27A 5CXPA 3KCJA 4EX4A 1Z42A 3N04A 4IMFA 2Q8ZA 1SW7A 2PRMA 4P7OA 1B9BA 1DORA 3C2FA 3GRIA 1OD8A 2PDBA 1XIMA 3DG7A 2PWFA 3RXZA 1XIIA 3HGSA 3U5YA 4K8EA 4EWND 1GQIA 2C71A 3HM7A 4AZ7A 4LVAA 4F2BA 1XWYA 4EF8A 1U5VA 3WQDA 3SN4A 1X7FA 3GXMA 4K68A 1EJVC 1ZBWA 3NQVA 1R30A 1B54A 3SDOA 2H3BA 2Y5EA 4GX8A 3SUWA 4BQ2A 4TO8A 3WD4A 3NG3A 3V0TA 4NXSA 1U33A 2V38A 4LEFA 5HMEA 2YJQA 3E5PA 4XVDA 2QGHA 4RK8A 5AHEA 4LB4A 4RDYA 3EXRA 3M0JA 1AJ0A 4FLQA 1HL8A 1Z44A 5E93A 5E9XA 2OR2A 1MUCA 3W88A 3NXLA 1IR2A 1JFXA 4W85A 2VM8A 4XBSA 3UYIA 1M01A 3FOKA 3TOYA 4GCXA 3TWAA 3XINA 1H1ZA 1R3VA 1J2BA 2VURA 3NYDA 3TYEA 2G41A 3E3HA 3W7HA 3F4VA 3ZYZA 1XYZA 3LCHA 4OFCA 1KBJA 4OV9A 4NU7A 2NW0A 1E0WA 4S3EA 2J6VA 4M6PA 2ZC1A 4PMQA 3H55A 4AZGA 4CLMA 4F0LA 4UMCA 2NV9A 3TQVA 3OVQA 6XIAA 3D6NA 1A5SA 2QPSA 2GJLA 5F7UA 2YX0A 4QROA 5AC4A 3WLRA 1KBIA 3SBFA 4F2UA 1FFRA 1R6WA 1H7XA 5LXXA 2W5FA 4WGHA 5AHLA 3C8FA 4ADSA 1S1RA 1V3LA 1JAEA 2VUYA 4PBGA 5FF3A 3CASA 3QXBA 1KWKA 4BFAA 4C65A 1K6AA 1KFKA 1RCOB 3V4BA 4I5UA 1LWHA 1DP0A 4E4UA 4PB4A 1GTEA 4DZAA 1AJZA 1BYDA 3ZOAA 4QHRA 1WZKA 4A8LA 2QDHA 4HYWA 3L5LA 4MPKA 4UBPC 2BXYA 3SEPA 3L2LA 3M0KA 1XBZA 4PB5A 3NQFA 2PWEA 3VIKA 2WQDA 5HQEA 2F61A 4UFMA 1I8JA 1E3ZA 4O0QA 1TPC1 5D03A 1X38A 1D2KA 1FX6A 4BEQA 3QQ0A 4G8TA 4PH6A 2J47A 3ANVA 3NO3A 1MEWA 3LHTA 4LEQA 3PBYA 5E6ZA 5CBBA 3VUPA 2WW5A 3QRHA 3TZNA 2V3GA 3RITA 3LNMA 1EYEA 3OHMB 2Z4GA 4PUNA 3TNBA 1W0MA 1JDAA 1OIMA 4Q8TA 3EOUA 1CENA 1WDRA 3RPDA 1J0KA 3MKVA 1DL3A 3V75A 4W7UA 4HMDA 3MV01 4GUIA 3O7UA 4IMGA 1FBAA 4ALDA 4DX3A 2DVXA 2OWCA 2SFPA 4AZCB 2R24A 3BCJA 2GJXA 2RH9A 4L1WA 3I7QA 1SFSA 1JI2A 2UY2A 5BRQA 1B2YA 2R8WA 3LPOA 4DEFA 2FVMA 1LT8A 3VD4A 1VGAA 3LRLA 5C9RA 2YBTA 1XSKA 2V67A 3GR4A