4RR4A

Crystal structure of human dihydroorotate dehydrogenase (dhodh) with dh03a367
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
365
structure length
365
Chain Sequence
TGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
publication title Crystal structure of human dihydroorotate dehydrogenase (DHODH) with DH03A367
rcsb
source organism Homo sapiens
total genus 137
structure length 365
sequence length 365
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2014-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4rr4A00
1DJNA 3UPWA 4POCA 1KV8A 2AQWA 5FI8A 3I68A 3H53A 5CGQA 4HT3A 2PCQA 5AHFA 1J4EA 1QFEA 4AHOA 2OJPA 3LCIA 1W31A 3S1WA 3UZ5A 3L0GA 4QM1A 2Z6JA 5HULA 2QCGA 4YXGA 5BOOA 3LRLA 4XQ6A 1H7PA 4UFJA 4AHQA 1KTBA 3UQNA 1Y0EA 3QFEA 3GZ3A 4QJ1A 4U4MA 3B04A 4I9AA 4MJMA 4Y6GA 5HJLA 3W7QA 4S1FA 1VC4A 2OCZA 1PVNA 5EL1A 4UTJA 4JTGA 1VHNA 5F1UA 3QSRA 1NF7A 4JX5A 4OV9A 4UTLA 2PRLA 3IIVA 4FNSA 3TQ0A 4X22A 3UNDA 5F2IA 4IXHA 3EXSA 4IJBA 3PVFA 3TR2A 2HMCA 3M5YA 5FF2A 4K36A 4JIQA 2WQPA 5KSWA 2CZFA 5DCEA 1SSDA 2OT1A 2WSRA 4I7WA 1PIIA 3JR2A 4ZQNA 1LORA 4M7TA 2VXNA 3A21A 4O11A 4OHQA 4DO6A 2Y7EA 3NQFA 5AYXA 4O17A 1NF0A 5D33A 2QR6A 1SO4A 3GIYA 1GQNA 2DU2A 4N02A 2FJKA 2J24A 3EKLA 3EWZA 3LCHA 2DZWA 2H3BA 3TKFA 1DKWA 1VCFA 2V2HA 3GKAA 3MMTA 3NA8A 1XBXA 3NPXA 4PH6A 1UUMA 1H7XA 1R46A 3C2VA 2VFDA 3LLFA 4R33A 3F03K 1SSGA 2ZA1A 3L68A 2E6YA 1SFLA 3HGOA 4DQWA 4BK9A 3SY5A 4GXMA 4MY9A 5DY3A 3O63A 3PUDA 4AWSA 5AB3A 4LVGA 3PBWA 1XL9A 2JKPA 3BG5A 1RQEA 4OWGA 3T78A 1P0KA 2FTPA 3FLUA 4S2CA 4YCOA 3PUOA 1XBVA 3A5FA 4LRTA 2V81A 3HOJA 4UFMA 3THQA 1P0NA 1B4EA 2DJLA 4MFDA 3ABRA 3CQ0A 2FPTA 3IVSA 2CU0A 2GJNA 1KFCA 2JGQA 3IRDA 4R53A 3L67A 1UJPA 3LBCA 3TQKA 3W1QA 4IMEA 1XM3A 5FF3A 5G2IA 2V0TA 5LHFA 4OV4A 1KLZA 3OIXA 1R2TA 2ABBA 4JY9A 3W07A 5I3KA 3BLEA 4NXKA 1VYPX 3GNNA 4P61A 2QAFA 5I3GA 2CZDA 5EKYA 2NXGA 3ATYA 3DFPA 1XDLA 3LCFA 3VFLA 3NL5A 2TPSA 1TV5A 1B3OA 3EXTA 4O50A 3A5VA 2Y85A 2GQ8A 1UASA 3INPA 3MP3A 4LS0A 2Z0IA 3B0UX 2HS8A 1OFDA 2Q3OA 5HUOA 3S1UA 5H91A 4ZL1A 4L4LA 3GNDA 3CC1A 1OF8A 2E5DA 3L0KA 1ICSA 3IIXA 5CG7A 4PA8A 1IXQA 5EPDA 3TX9A 2J9YA 3RLVA 2EF9A 4HN4A 5HWMA 3KRZA 4QNEA 5HWNA 3O6CA 3S0CA 2EPHA 4Z1CA 4MYXA 2W0UA 3CU2A 3G1YA 1EB3A 1OX6A 3L9CA 4IMDA 2V2DA 3OVQA 3PF3A 4NUWA 1LP6A 5D2TA 3G8EA 1T99A 2GPTA 4LU0A 2X16A 5L9FA 4FHAA 5HNRA 5CZ0A 1LOLA 4OBTA 3MI2A 3MWAA 3UWYA 3TJLA 3GDTA 2ZZ1A 4ORMA 2C19A 3R5EA 5KTLA 2JBMA 4UMAA 1ZHAA 4AMAA 4XBSA 3EWYA 3LTPA 4GJ1A 2BWGA 2QCLA 1H7WA 4FNQA 4UUIA 4RX0A 1K02A 2DZUA 3L0NA 4NNBA 4JDYA 1LZOA 1VQTA 3NQGA 5TBOA 4AAJA 5AYZA 3W7GA 1QPOA 2VEPA 2ZA2A 5I3FA 2Z2UA 5U4NA 4UTMA 3G8RA 1JUEA 1R2SA 4JN6A 4N9DA 4UFKA 5CPMA 2NX3A 1ALDA 1TPC1 1FDZA 2NXHA 1HO1A 1QCWA 3W2NA 4ZQCA 3R13A 2VC6A 4DF0A 3ZWSA 1I8JA 3N2XA 2YCEA 2ZRVA 4QIUA 1G7VA 2Y62A 5F4XA 1S5TA 4TU1A 4FNTA 3MYOA 2ZRXA 5LNRA 1ONRA 4OGZA 1J2WA 3G22A 4XTIA 3GAYA 2G95A 1OFQA 1ZFJA 4A2RA 5LNVA 1CI1A 3HG2A 1TPDA 3NGJA 3PR2A 4TO8A 4JTHA 1SUXA 5LNSA 1IXOA 3N73A 2O7QA 3I7SA 1QWGA 4O10A 3M0ZA 1N7KA 1KW1A 3LB0A 1TTQA 4UFLA 3PB0A 3O8AA 3TU9A 1QDSA 1TTIA 1D9EA 1KFKA 2HSAA 4JTEA 1EP2A 5I3JA 4UTUA 5G2WA 3UZJA 3TNOA 2QUUA 3CM4A 3W7KA 1SPQA 1YADA 3GK0A 3IGXA 3FYPA 3NXFA 2FPYA 2B7QA 2ZZ4A 1JUKA 5K4XA 5KITA 1KFJA 1YTEA 3NL6A 5HUPA 3N14A 3TC7A 4K8HA 3P80A 4EOUA 3BO9A 1O5XA 5CZTA 4PEKA 2BTMA 5EA9A 2Y88A 3KVMA 1TCDA 3LXAA 1K8ZA 3V1PA 3W75A 2Y7GA 4IMGA 4CNPA 2X1SA 1FUYA 4I7UA 3M5VA 2ZTJA 3FIGA 1HG3A 1S5WA 1W54A 3GDKA 1OK6A 1YDVA 1JCYA 1GOXA 2H6RA 1DVJA 1KM4A 1LRNA 5KZDA 2G96A 1JCJA 4BI6A 5KINA 1NEYA 1WX0A 4CQ8A 3B06A 3D0CA 4RZ4A 2CZEA 2QCDA 2WV8A 1ZJIA 3P81A 3TSMA 2A85A 4FF7A 4EIVA 2DZXA 3S6DA 3NQAA 4HNVA 2QCNA 5HR6A 1PCKA 2CLMA 2ZYFA 1ZAHA 3DFNA 3E49A 4UNKA 2I1OA 2NZLA 3TMLA 1EA0A 2YR1A 1WDWA 3N34A 3W7RA 3E9AA 3UPBA 2GVLA 5G4EA 2EGZA 5F4WA 1QR7A 3LM7A 3BLFA 5AOUA 4H4IA 5F2LA 1TRIA 3KRSA 2RDTA 5D09A 1P4CA 2V5LA 3MYPA 3SI9A 1BTMA 4O52A 3O05A 4XZ9A 1AW2A 4N6EA 4A2SA 2V8ZA 3GXNA 1F74A 3NO5A 1ICQA 1H50A 4NX0A 2YZRA 5AC6A 2V9DA 2DZVA 4NU7A 1PL9A 2OX1A 3TXZA 4ADTA 5I3HA 2VOMA 1R47A 4M5PA 3NPUA 5TIMA 1I2RA 2B7OA 4MUZA 3QPYA 2ZA3A 4UR8A 4FX6M 3NQEA 1JQVA 2J9ZA 3QEZA 4DPQA 3G1SA 4WJEA 4H6KA 2VFHA 3MP4A 1OABA 1GVOA 4MPQA 2ZRUA 1TPFA 5G1YA 3QH2A 4K7VA 4FEZA 3G1XA 3KVJA 5F2MA 2Y89A 2NUXA 1TPH1 2VEIA 3U2OA 3UWUA 2ZRWA 4GBUA 2ISVA 5E93A 3W2UA 2XN2A 4WOZA 1W56A 2VFGA 1FWRA 4E0CA 4O16A 4M6VA 2Z1BA 5H2ZA 1ME8A 2QJIA 3EX2A 4XTDA 2DORA 2YDAA 4KWVA 3NL2A 1ICPA 3LTYA 3GXPA 3W1TA 2AAMA 5FESA 2Q8ZA 4E38A 3SIZA 4OT7A 3FKKA 5CZJA 1TIMA 1Z41A 3O6YX 3W1LA 3QF0A 3G18A 1K3UA 2A1YA 3STEA 3WFAA 3RF9A 1VLIA 3RK8A 5D32A 1THFD 3TSBA 2RKXA 1RPXA 1W1ZA 4K6AA 1LLZA 1KTCA 1YXDA 4LV4A 4N9BA 2YX0A 4HPXA 1IIGA 4L4MA 4UFIA 1Q3NA 1O4UA 3NNTA 2BXVA 3C56A 1IGSA 2NLIA 3U6WA 1O5KA 1W5NA 1DHPA 3W70A 1HTIA 5AHEA 1ZCOA 3LERA 1FDYA 2ZZ5A 1TMHA 4JX6A 2H3DA 2QKFA 3O15A 4X2RA 1TPB1 3AO0A 4JTKA 3P61A 2DP3A 3M5XA 3S42A 3S5OA 4N4QA 3SSJA 3QYQA 3SW6A 2NWRA 4UC5A 3M9YA 6ALDA 3TFXA 3W2LA 3U8GA 3PWAA 4LT9A 3B8DA 4N6FA 3TQVA 4X9SA 3ZWTA 1SZFA 3NVTA 3PB2A 4JTFA 2B0MA 1OHLA 5FF0A 1OX4B 3GR8A 2QCDB 2HTMA 4NJGA 2ZFAA 3C2FA 3CIWA 3LI1A 3E02A 3NG3A 2VEMA 5AHNA 3QZEA 5IBXA 4EF9A 4M6PA 3NEVA 5IBXC 2YXGA 3AJXA 5CSSA 3ANYA 3B0PA 3BG3A 2A21A 2R94A 4M7SA 5I3IA 1PHQA 1JQXA 3LHUA 3LHVA 3TH6A 3RFAA 4QAIA 2ZZ3A 4QNWA 3LCXA 1MSSA 4RR4A 1B4KA 5E0KA 5D2XA 4YWIA 1TQXA 1G4PA 3CPRA 2RH9A 4DO4A 1A53A 1AG1O 2B7PA 1WAUA 3FS2A 3NPWA 3W87A 1B57A 4RJEA 3GVGA 2CWNA 4A3UA 3W85A 3DKJA 1W5QA 4CCEA 5HQEA 1L6WA 5D05A 4IWWA 4MLJA 3H54A 2YW3A 3EB2A 1XUZA 4O57A 1U83A 3BGGA 3TV8A 3ZR4A 2GVJA 4UR7A 1N8FA 3NQVA 1M7OA 5DBTA 1GYNA 3M16A 3P74A 3W1XA 3GX9A 3PAJA 4RV8A 3NQ2A 3JS3A 1SZEA 1ZAIA 1BKSA 1NFBA 2EKCA 4I7VA 3UYCA 4B5NA 7TIMA 3W7LA 4RKAA 3LDVA 3LRMA 3QW4B 5LGXA 3LTSA 1ME9A 3M47A 2R14A 1A5AA 2C3ZA 3EWXA 4PCFA 4AHPA 5DY2A 2BZNA 4O19A 4WXZA 3ELFA 2GQAA 5K2ZA 1SQ7A 4MLRA 1FCVA 3UXDA 2CLEA 3HIJA 4R34A 1WQ5A 3EX6A 3LCWA 2ISSA 4GWEA 2QCFA 4GUHA 4IPJA 5K9XA 1G67A 3RLUA 1DL3A 1OG0A 1HL2A 1GJPA 4DPPA 1X7FA 3O6DA 1I45A 1TYGA 4Z0JA 1RZMA 3T40A 4JX4A 5K4ZA 3TAKA 4UTHA 3W2MA 1N55A 3KAOA 4ORIA 3T7VA 3HPXA 2I9EA 3A23A 3QSTA 4FXRA 4IMCA 1XXXA 1Q45A 3PS7A 2ABAA 2WNNA 4GUIA 4A29A 4X3ZA 3B05A 3VI2A 2AGKA 4QITA 4CQ9A 5F4SA 1X1ZA 3LV6A 1W5MA 3HJZA 1BEUA 1KFLA 1EP1A 1EUAA 4NNCA 3S1VA 4ZMGA 2ATSA 1KM5A 4JDBA 5D30A 3KVLA 4UTKA 1G69A 2J88A 5G4WA 5AC8A 1Q6RA 4KFPA 4K38A 1ZENA 3PULA 4IX0A 2VFIA 3P60A 4LS1A 1TB3A 3STFA 2H8ZA 1H61A 1EUNA 4GFSA 3UY8A 2RDWA 1EPXA 3DU0A 1XUUA 3T4CA 4XWUA 1KFBA 3QQ1A 3P84A 5KZMA 4UTIA 4UCGA 3CEUA 3UWQA 1KV5A 3UY7A 3C61A 5AHMA 4UTTA 3M44A 5FEWA 4Y8FA 1QO2A 4UTTC 3C4UA 4HHPA 1GTHA 2FIQA 1FXQA 3O1NA 1VRDA 3MI3A 3W1PA 2FPVA 2QUTA 1LOQA 1FWWA 1PHWA 2ZZ7A 5FEPA 4E2DA 3LV5A 4DXVA 4Q33A 3CHVA 1JRBA 3A9IA 2CZ5A 2A7RA 3NZ1A 3P5ZA 1I4NA 3LXCA 5F1VA 1SO6A 3R12A 1C9DA 3QW3A 2C1HA 2X30A 4UFHA 1QPQA 3WJWA 3EKZA 3WK1A 3NYZA 2ZDRA 1VZWA 5HR7A 3IIOA 6TIMA 4O18A 1H1YA 4EVZA 2FLIA 3KFTA 1BWLA 2WSQA 5K9CA 4JGDA 1YTDA 4WOQA 1M6JA 3S5ZA 2TYSA 3DAQA 5HMSA 3NQCA 2KZHA 1WOBA 1VLWA 5K7JA 1VR6A 3O07A 1OFEA 1KLYA 1W3NA 3W7OA 3L5AA 3HG5A 1V5XA 5LHEA 3GDMA 1WXJA 1TRDA 2P1FA 1XBYA 4AF0A 4LVBA 3PBUA 3R2GA 4O1CA 4CCDA 2PURA 1H7NA 2VELA 3EX4A 2NUYA 1VCGA 3HB9A 4FO4A 4FNUA 3DFTA 3NQ8A 1WBJA 1LROA 2YYTA 1K8YA 1VHCA 1TJPA 1G4TA 3WK3A 2H8XA 1KM0A 4AH7A 3M1ZA 3W7IA 5L6UA 1I2OA 1SR9A 1SW7A 1WBHA 4NXSA 4LS2A 3W22A 4S2BA 2QUVA 4UMCA 1UBSA 4M6QA 1YLVA 3DHDA 2C15A 3G1AA 3TIMA 2R91A 2TSYA 3T44A 4LUJA 4WZHA 3QMSA 1KM3A 2V2CA 4MY1A 4LWWA 3PM6A 3W7CA 5J5RA 4JTTA 4FXSA 1VH7A 2E68A 2CLLA 1ADOA 3OEXA 2RHGA 1LLWA 3UD6A 2A0NA 1T96A 5D03A 4O0KA 1OK4A 4NJJA 1T8XA 1XCFA 4GC4A 4QISA 1JCLA 4JYFA 1FY6A 1H7OA 2DZSA 1DORA 3HG4A 5LGZA 1C29A 3G0XA 1AL8A 2E5CA 3IGSA 4NX5A 5HWJA 3N2MA 1UCWA 3ABQA 4NZJA 3JRKA 1MEHA 4LY8A 4ZQPA 1NAL1 4C1KA 4JTJA 2XN0A 1A50A 5AN7A 1OX4A 5EYWA 3TFCA 4Z1AA 3W1MA 2QDHA 3W1UA 4NZFA 3OVPA 3STCA 3H55A 4CLMA 4JTLA 3R8RA 3GYEA 3WK2A 1GZGA 1TREA 4XBKA 2ZZ6A 3CB8A 3B03A 3LXBA 3G24A 2YSWA 4MJZA 2EHHA 3LCLA 3NM1A 3SGZA 3FJLA 4NT0A 3LCGA 3EWBX 2Y7FA 1NVMA 1QNVA 4W9TA 2Y70A 3GLCA 3GXTA 1IIHA 3BK0A 4DO5A 3VKJA 3RMJA 2C18A 4UNLA 2CW6A 3GB6A 1C8VA 4JYDA 2A6NA 3QMTA 3MBDA 3DZ1A 5EBUA 2JK2A 1Q6OA 4RK8A 4BWLA 1K7EA 5KZEA 3OA3A 2CLOA 5GVJA 2B4GA 1FCQA 3PY2A 3A24A 3GAKA 3BARA 2W79A 4O28A 1LBFA 2NUWA 1X6UA 2HS6A 1PV8A 1H51A 2QJGA 1LYXA 1VS1A 3DFSA 2ALDA 1L9WA 1O60A 3G1HA 3S1XA 2FB3A 4FX8A 3NOEA 4HSNA 3TW7A 5E1QA 2X1UA 3S5YA 2Y7DA 4TMBA 3Q94A 4AF0B 4TMCA 3W2KA 3Q37A 2YFNA 3OVRA 2TMDA 4MYAA 1EEPA 1FCUA 3G1FA 5T26A 2QF7A 4NVTA 3TW6A 3OG3A 1FX6A 2NX9A 5CPOA 3KXQA 2E77A 3HPZA 1V7YA 3KX6A 3HPSA 3S8HA 1CX9A 3ATZA 4UMBA 3FOKA 4JYEA 1PCWA 1F76A 3GDLA 3LOTA 3CWNA 3NQ6A 1QO5A 5BNKA 1FDJA 4LRSA 4ICNA 3O16A 2A7NA 3VCRA 3GDRA 2V30A 3LRKA 2C0AA 3N3MA 1W3TA 2Q8LA 2BSLA 3M6YA 2VFEA 1FWNA 4R7JA 5BMXA 3FJ6A 2E5BA 1A5SA 4NJIA 2X1TA 1GT8A 3PSWA 1ZAJA 4FNPA 1Z42A 1JCXA 1K03A 3KRUA 4K8EA 3RU6A 1GYLA 1A5BA 4QSHA 3IEBA 1GG1A 4KKXA 4WXYA 4AXKA 5LSMA 4WY0F 1SFJA 1XI3A 2Q3RA 1OFPA 3EX3A 5C5YA 4JEQA 2DJXA 1H7RA 2GUUA 4GRSA 1MZHA 2CLKA 1RQHA 1SO5A 3C2RA 1KM1A 4G1KA 4ADSA 4K39A 3CTLA 5BMWA 1S5VA 1RV8A 3I6RA 4FIRA 1TO3A 4HSOA 3PBVA 5D2YA 2VKZG 2LLEA 2BLEA 3HO8A 3W1RA 3NL3A 1GWJA 1XDMA 5A8GA 4Z08A 5IM51 1EIXA 4Y96A 1YXCA 2ZQ0A 4O1BA 3BVJA 3HQ1A 4GUFA 3PC0A 3EWWA 4O12A 2PC4A 3EXRA 3W88A 4BF9A 3N19B 3PBYA 4ADUA 3S9YA 3NM3A 3DI1A 1KA9F 1LOSA 4O13A 1OYBA 4HNUA 3DI0A 3NZRA 4LV9A 3SFKA 2E09A 4DF1A 3MHGA 2B7NA 1M5WA 2GQ9A 4OQVA 4JY8A 5J5DA 3T55A 3WK0A 5AHIA 1MEWA 3ABSA 3TMQA 3TUUA 1RR2A 1YXYA 1O94A 1WOAA 3W7MA 3KHJA 1JCNA 4HKPA 3CT7A 1AK5A 1S3HA 1MXSA 5D2VA 3MBFA 1K7XA 2QAPA 3W76A 1KBJA 4O54A 3UWVA 4LOCA 5DXXA 3P67A 1K7FA 3C8FA 5EY5A 2ZZ2A 1I2NA 4AEOA 3SZ8A 3PSVA 1ZALA 1W0MA 3MP5A 3W1AA 4Q4KA 2NV2A 5G5IA 3P7YA 5D38A 2OT0A 4RZ5A 1RVGA 2YYUA 4BI7A 4EWND 2A5HA 1W5OA 3G1DA 4N4PA 1VJIA 5DN1A 4LVDA 3LGEA 3ZFHA 1EWDA 1LM1A 4WX2A 4PC8A 3BW4A 4HIBA 1G4SA 2GVGA 1LBLA 1TV8A 2QCEA 1JJKA 3L5LA 4XKYA 1D3GA 3L65A 3Q58A 4CQAA 2YFOA 1XC4A 1DJQA 5D37A 2JKEA 5EMUA 1EWEA 3W1NA 3G0SA 3I7QA 4LUIA 1F5ZA 1JR1A 1F05A 4GUGA 3HF3A 3G3DA 1Q6LA 5CPNA 2WKJA 3LHZA 5C55A 2QCMA 1GPWA 2RFGA 4XUGA 3TAOA 3LHTA 4O0ZA 1F7BA 1XFBA 4BFAA 2RDUA 1YDOA 4DELA 1HUVA 1ZNNA 4A21A 1KM6A 2QJHA 2C13A 1H62A 4D2JA 1L6SA 5BW6A 3TDFA 4FNRA 2ISWA 2QDGA 3HGJA 3B0VC 5C2XA 1WYIA 2FB2A 1OVDA 5A5WA 3DKLA 4KFNA 1MEIA 3QRHA 3NQMA 5CSRA 3W74A 1QOPA 4JD4A 4NQ1A 1LBMA 4Z1BA 3WJSA 3F4NA 4JXCA 2ATMA 1YPIA 1AW5A 1ML1A 2Y61A 4M19A 4O14A 4PFMA 1UB3A 2UV8G 8TIMA 3NPVA 4LC8A 1JCMP 3N9RA 3BW2A 4NJHA 1TJRA 1FWSA 4HNNA 1QOQA 2PRMA 4N2YA 1JRCA 2CFFA 1TQJA 3B4UA 1HFBA 4DBEA 5AFDA 1F73A 1QPRA 2XN1A 3W23A 1AL7A 4IPIA 1OF6A 4U28A 3IVUA 4Q32A 4ZQRA 4QQ3A 3FYOA 3W72A 1H63A 3CLMA 1CW2A 4DEFA 1K8XA 1FQ0A 2QEZA 3IV3A 3MI6A 2C14A 4MY8A 4O15A 3C2EA 5BRBA 3DFOA 3MHUA 1QMLA 1QAPA 1TTJA 4A22A 3HG3A 3TSDA 1G7UA 3WJZA 2E1DA 1SU5A 1HO4A 3BGJA 3C2OA 1Z48A 1VPXA 4ONVA 3W7PA 3W73A 2A4AA 3HGRA 1G4EA 4TIMA 3TCEA 4O4VA 3PG9A 2G5WA 3G3MA 5LNUA 5G2HA 5DCBA 3W6YA 2C6QA 3NQ7A 2WO5A 3IIZA 4LTSA 5K3VA 1KFEA 2YGYA 3W7HA 1OFRA 2OZ0A 3G0UA 3TJXA 5AC7A 1M7PA 4MZ1A 1SW0A 1BWKA 4MZYA 1L6YA 2X1RA 4ALDA 3QQ0A 5DXYA 1VYSX 3GR7A 3EEGA 3QJAA 2A7PA 4RLIA 3TC6A 2WJZA 1GTEA 2OMAA 3V75A 2V5BA 1GG0A 1W5PA 1PS9A 3WJXA 3UXAA 3G1VA 1GVFA 2FQIA 4WY0A 3VE9A 2X2GA 3LLDA 1D3HA 2Y6ZA 5CZSA 4PODA 2J27A 2ZRZA 4ZVJA 4YMZA 1SW3A 3EX1A 2WSYA 3MUXA 2JKAA 3CEPA 3DHFA 2WNQA 5LZLA 4WD0A 4YLWA 3MW7A 2XFWA 3LBMA 3NAVA 4RXGA 1P1XA 4GNJA 3TK7A 1W8SA 1QPNA 1TSIA 3DFQA 4XKYB 5F2GA 4WQ6A 1YTKA 4N9EA 4YL2A 4EF8A 1H60A 2PRHA 3W7EA 1Q6QA 1GVSA 1OFAA 3TXVA 1JVNA 1J5TA 1H1ZA 3S5NA 2O7SA 4RZ6A 2ZCGA 3C52A 3K30A 1DQWA 4FX7A 3KOFA 3NQDA 1F6KA 4ZQOA 3BPWA 1O95A 3I7RA 1XBZA 1TTPA 4DBDA 3M7WA 4NNAA 2P0OA 4AB4A 2QCHA 2E6AA 1KM2A 3C6CA 1IXPA 2CLIA 3P8JA 4DF2A 4OE7A 2V82A 3W84A 3L5MA 2A6LA 1XKYA 5MHBA 4JNMA 4HPJA 2QCCA 1OFBA 2FDSA 2J6XA 2G97A 1FXPA 3L21A 2NV1A 3HBLA 4MIMA 4N9CA 1Z44A 4MKNA 4FIQA 4YCPA 1KTNA 4MVAA 4HNTA 1EX5A 3FKRA 5FF4A 3F1QA 4Y90A 3TE9A 3P8IA 3SJ3A 3HMJG 3W7DA 1U5JA 3P5YA 3LI0A 4RXFA 4IUOA 3USBA 4O8RA 1DBTA 3W7NA 1W3IA 4P2VA 2CLFA 1X8FA 3MO7A 5C6MA 5TQLA 4K7YA 3WJYA 2C16A 1JUBA 4AWTA 3R89A 3IIPA 4JTUA 4AVFA 4C1LA 3SR7A 2FFCA 2D73A 1VGAA 5G1TA 1VCVA 4BI5A 4MZ8A 4FB7A 2TRSA 4IOTA 2ZBTA 1W37A 2BX7A 4BR1A 4WUIA 2P10A 3P62A 3LHWA 1OFOA 1H5YA 3DXIA 3IVTA 3L2IA 2E6DA 1SZNA 1F2JA 4CCCA 3FEMA 3E0IA 3MJYA 1I2PA 5C54A 4O53A 1YDNA 1LDCA 3QC3A 3P82A 3N9SA 4GE8A 1IXNA 1NSJA 3QM3A 3HGSA 1OX5A 3M5ZA 3LHYA 2Y63A 1B9BA 3W71A 2NX1A 2GJLA 2ZTKA 2YW4A 3W2JA 3C3NA 2WOQA 2DZPA 5AHLA 1E51A 1YYAA 4PL1A 1DQXA 3YPIA 1T0OA 5HINA 4K37A 1SZGA 1GEQA 3RNDA 3THAA 1LTDA 3STGA 5DCDA 3ABOA 2VENA 4ZQMA 1LRQA 5D02A 2Z6IA 4J9JA 2VEKA 4BWLC 1TPVA 3DBPA 4IQLA 2CLHA 1UUOA 4GUJA 2VFFA 4JIPA 3CIXA 4WY0B 3F4WA 3CWOX 4OU1A 5ABTA 1VYRA 3OBKA 1GVQA 2EAWA 4IXXA 3W83A 3DENA 4E2BA 3W3OA 1OYCA 3BG9A 4IMFA 4JS3A 4Z0SA 5KMYA 4O1DA 2F84A 3PUEA 4JICA 4JTIA 4UXDA 1G6CA 4JR5A 1P5BA 5CKSA 1R30A 3FFSA 1SO3A 4UTWA 5CPLA 3BV4A 2WNZA 3W7JA 4UTWC 1JULA 3A22A 1LCOA 4KFOA 1L2UA 3BW3A 1DV7A 3TA6A 3M41A 2F7FA 3NDOA 2YPIA 5D04C 2A2IA 4IX2A 4LVFA 3TROA 2PE4A 4Z1DA 3PG8A 3VE7A 5AYYA 3OHIA 3W86A 5DBUA 1OYAA 1PE1A 3LX9A 4O1AA 2NXIA 1TPWA 2W6RA 1X1OA 5U7SA 1TPUA 1RQBA 4JTSA 5FF7A 1OJXA 3C0JA 4CNOA 1WV2A 2JGYA 5SWUA 1FBAA 1FWTA 5D2WA 4CNNA 1TV7A 2H90A 3SGUA 4IGHA 3IGUA 4H3DA 4TX9A 2NWSA 5FEXA 3M43A 3DGRA 4MFEA 3I65A 3KVKA 4NJKA 4ZZ9A 5LKYA 2ZRYA 4RCXA 4LC6A 2DZTA 4O4WA 3FA5A 4KWWA 4TR9A 4Y9AA 1A5CA 3W9ZA 2I14A 1GVRA 3L66A 4PTNA 1WA3A 1ME7A 4AWUA 1F6PA 1KBIA 4ML9A 3UWWA 2GOUA 3NR0A 3DH7A 1YPFA 2J9XA 3UWZA 2WPBA 3QPZA 1EP3A 4LNYA 1FCBA 5DLCA 4LVAA 2E6FA 1AW1A 1AMKA 3BLIA 3MHFA 3Q2DA 3O06A 1I2QA 3VNDA 1IF2A 1DOSA 3E12A 3QMRA 2R8WA 3ZS4A 4MOZA 4PL2A 5K9DA 4UIOA 1LRTA 3SECA 5LNWA 5DELA 3EWUA 1MO0A 1ZY9A 3GKFA 1TPEA 1RD5A 2IQTA 1R2RA 4LW7A 3E96A 5FEZA
chains in the Genus database with same CATH superfamily
1KV8A 4BQ5A 1KQYA 1HT6A 4J3WA 3GXDA 4E5TA 1J12A 1R86A 4GX9A 2PCQA 4N42A 4PCPA 1BYAA 4QJ3B 3R25A 4MDPA 2Z6JA 1CZ1A 4NAEB 2QCGA 5CLWA 4C6CA 4YXGA 1QATA 3SCQA 4LF2A 5C71A 1HGWA 3UQNA 3TC3A 4QJ1A 4Y6GA 3W7QA 1ZCCA 4Q4MA 5FJRA 3IJIA 1PVNA 1X97A 2AGTA 4UTJA 5EL1A 4JTGA 1HF6A 1VHNA 3T8LA 4KRZA 4JX5A 2PRLA 1UMYA 1KXVA 1PIGA 4GY7A 3CIVA 3P3BA 3AS2A 3EXSA 4IJBA 4HU4A 3UG3A 2E67A 5E0CA 2RGLA 1BSIA 4P8XA 2CZFA 3EDEA 4ZBCA 2J75A 2JE8A 3BDKA 3KLKA 3BJFA 4ZQNA 5C9XA 3WCZA 1LORA 4M7TA 2VXNA 1NF0A 5CC6A 4GZJA 2CNCA 2FJKA 1N82A 1UC5A 5DEZA 4JTCA 1H2JA 2CBIA 3OOQA 1V3HA 4KERA 5BYWA 3F5JA 3MMTA 3LMYA 3RMEA 4V1XA 4ZO6A 4PH6A 1UUMA 3LLFA 3F03K 4J2MA 3L68A 2XDFA 4BK9A 4BF5A 1O6IA 1HNYA 3WBEA 4HMCA 4W7UA 4YVXA 3EDFA 4LVGA 1XL9A 3BG5A 4YTTA 4L64A 2FTPA 1VB9A 3FLUA 2QZRA 4S2CA 3VOHA 3PUOA 1CENA 4LRTA 3N15A 1UD5A 4UFMA 3WKZA 4F0HA 3IVSA 2YDSA 1CGUA 2CU0A 2GJNA 1KFCA 2YL6A 4J35A 2JGQA 3IRDA 2GGHA 4IL0A 3WO8A 2QULA 1CXKA 3V0TA 3W1QA 4IMEA 4MKSA 1KLZA 1IHIA 3TEVA 1BG4A 2J78A 3KDOA 5DT5A 4NXKA 4P61A 2PLKA 1G0CA 2NXGA 3DFPA 1XDLA 3PHAA 1YMYA 3VFLA 3RRAA 4M51A 4GABA 1FTXA 2XFYA 2YDQA 3WQCA 3V36A 2GQ8A 3INPA 4HK6A 4B2DD 1E0WA 2HS8A 2Q3OA 4L4LA 3VCCA 4KEZA 1ISZA 3GNDA 2Z2BA 2E5DA 3IIXA 4F9DA 2J9YA 4HVXA 2EF9A 4HN4A 5HWMA 2EPHA 4Z1CA 4MYXA 3CU2A 3G1YA 4ACYA 4ZOCA 4CU8A 4Z2LA 3OVQA 4NUWA 3M0YA 2CZVA 4FLQA 1Q65A 1RCQA 1Y8BA 1YQ2A 4LU0A 1I6NA 1TIWA 5CZ0A 4KCTA 1LOLA 3MI2A 3RPMA 1XLKA 1XIJA 3GDTA 2ZZ1A 4Q8NA 4ORMA 2C8NA 3CJPA 4JTDA 4AD4A 2YJQA 4AMAA 3NO3A 4GJ1A 1JXKA 4HPNA 4UUIA 3RCMA 2ISDA 4F8XA 2FKPA 2PDUA 1E4NA 2ZUMA 4LYPA 1F4AA 2P8BA 4AAJA 3E0WA 3PPGA 5I3FA 2AAAA 1UH4A 1JG9A 1XLFA 2AL1A 1R2SA 3V18A 4HHLA 4UFKA 5BOFA 5CPMA 1TPC1 1NOUA 2NXHA 4ZOBA 2P53A 4IM4A 4Z2HA 2X05A 1R9ZA 2ZRVA 4XIAA 1GOMA 4FNTA 1ONRA 1TZZA 4YTSA 5JBEA 3W28A 3DHPA 1QNRA 4GOAA 3SQLA 1OFQA 4AD0A 2EPMX 5CJMA 1ZFJA 4A2RA 5LNVA 2ZWYA 2BY3A 1OSEA 3NGJA 3NQBA 1SUXA 1IXOA 3ITCA 1QI0A 1A5OC 3I7SA 3N2TA 1QWGA 1GVIA 4ML4A 3M0ZA 3R10A 1DPMA 3WYZA 1EYWA 1AQ0A 2VRKA 3UGRA 1HVQA 1QDSA 1D9EA 3UCQA 2WVSA 1FKXA 1CECA 1BVZA 1EP2A 5I3JA 4UTUA 5G2WA 3UZJA 1E40A 4DZ5A 1EJSC 3VD7A 3UCCA 2FPYA 1KNWA 2ZZ4A 3IV8A 3EA1A 2PS2A 3IJQA 4W5ZA 1U1UA 1TZ7A 3NL6A 3WD1A 3N14A 4GQGA 4ZXOA 1O5XA 4PEKA 2BTMA 5EA9A 2Y88A 3W75A 3LXAA 1K8ZA 4XG1A 3V1PA 1RH9A 2TAAA 2Y7GA 1M65A 3M5VA 1K9DA 1RUSA 1S5WA 4IHCA 2BVYA 4GJIA 3GWQA 1B9ZA 4UQBA 1GNXA 1OK6A 4GYPA 1GOXA 5E0FA 4ROPA 5KZDA 4DO7A 1VEMA 5KINA 1W32A 1WX0A 3D0CA 4RZ4A 1CNVA 1J18A 2CZEA 1ZJIA 3TSMA 3V0SA 3TN4A 3NQAA 3KZSA 1XIHA 4FXFA 4L7ZA 2DSZA 4EE9A 2CLMA 3EPOA 4IIFA 2QXWA 4F2BA 1G01A 4MTVA 3TMLA 3W7RA 1D3CA 1AD4A 3TOPA 1EXBA 1UKPA 2EGZA 5F4WA 2IPWA 4KCVA 3CUFA 2V5LA 3SI9A 3O05A 4XZ9A 3MU7A 3PTMA 2V8ZA 1V08A 3NO5A 4F40A 1ICQA 1H50A 4PUUA 3WSUA 1QBAA 4NU7A 4DJFD 2VOMA 1R47A 1TV4A 5BCAA 4IGSA 3NPUA 2VO5A 3MSRA 2B7OA 2IQ0A 3STPA 3QPYA 1MW2A 3UJ2A 1C91A 3RJXA 4DAFA 3BCJA 4WJEA 2VFHA 2YCLB 4JQAA 2VDIA 4M1RA 4MPQA 1TPFA 2WJFA 4XAFA 3G1XA 4J3TA 2BASA 2NUXA 1US0A 4FA3A 1GOQA 4U3AA 3WL0A 5E93A 3W2UA 2XN2A 2VFGA 4O16A 4KPLA 4M6VA 2CBUA 3DHUA 4NRSA 1PYMA 4KBXA 2QJIA 2XIQA 3B8SA 3GSMA 3W81A 1ICPA 2FMNA 1XX1A 3D5HA 3W0KA 5IOBA 4E38A 2BXZA 3WFAA 3RF9A 1I75A 1VLIA 5D32A 1THFD 3TSBA 2EQDA 1JFXA 3II1A 2ZXDA 5M2FX 3H24A 3TZNA 4AU0A 4LV4A 4TV6A 1NP0A 3S83A 2ZX7A 2ASHA 2XIOA 4L4MA 1XIGA 4OBRA 4UFIA 1LWJA 3SCWA 2UY5A 4PBEA 1O5KA 1DHPA 2HK1A 5CPTA 1E6ZA 2OWCA 1VBRA 3UZWA 1EOMA 5BRQA 1NWRA 2RJGA 4C90A 1CB2A 2XU2A 3AO0A 2MUCA 3SSJA 3GNXA 3E6EA 4MAZA 3E0FA 2XIIA 3W2LA 2FZMA 1H5VA 3PWAA 2PAJA 4AY8A 4KGJA 4JIEA 4N6FA 3L4TA 2D2GA 2PWFA 1U22A 2EPNA 2R1LA 1OX4B 4V1YA 3QV7A 3SN4A 4D8ZA 2QCDB 1C8XA 1KGUA 2HTMA 3C2FA 3CIWA 3LI1A 2QVHA 5AHNA 3NEVA 5CSSA 3WH7A 1IEXA 3ANYA 3RO6A 3ZQ9A 2D1ZA 1L2QA 3W02A 3WD0A 2A21A 1RY0A 3ZT6A 3LHUA 4AIUA 1M7XA 3TH6A 1TWWA 4GIAA 3CH0A 4RR4A 1B4KA 4YWIA 3HN3A 1G4PA 4GK8A 1UR0A 4DO4A 1ZJAA 2B7PA 1AG1O 1WAUA 4BHYA 1V79A 3Q45A 4EACA 1ITQA 1B57A 4A3UA 3W85A 3W26A 3OB8A 3UW6A 5DQPA 1L6WA 3H54A 4QEHA 3L4XA 3U9IA 4O57A 2WJDA 1U83A 3O3RA 2QV4A 5HMFA 4ILSA 2W67A 1N8FA 3NQVA 5DBTA 4JIIX 3FV9A 2X7VA 4JHZA 4GMEA 1CIUA 4TOQA 2PDMA 3GX9A 3QHMA 3PAJA 3NQ2A 3GFZA 1R85A 4B5NA 7TIMA 1VP5A 3W7LA 1MVYA 5FJJA 1ONWA 1EC8A 3OIHA 1PZ1A 2XISA 4L5ZA 1E6PA 4H2CA 2J7GA 2BZNA 1ESWA 4XZWA 3ELFA 2NT0A 5K2ZA 5FL0A 2PLCA 1DP0A 4AISA 3ME3A 3GHRA 4MB3A 3VZYA 2VDHA 3WZ0E 3F7JA 3DYMA 1XLIA 3H4GA 3R8GA 1J93A 1XHGA 2D23A 3T7VA 3HPXA 1F8MA 1P7TA 5EGRA 3QSTA 2NVDA 3WX7A 3WF2A 4AFYA 2VR4A 4H9ZA 2PDBA 1Q45A 3PS7A 4PBGA 4GUIA 4X3ZA 1AJ0A 4H8HA 3TWBA 1VFUA 1BEUA 1EUAA 2Q01A 4AD2A 3NZGA 3S1VA 4ZMGA 1U2YA 4RDZA 4KFPA 1MDRA 1ZENA 2GGIA 3AMLA 2XZ7A 4IIEA 1IV8A 4LS1A 3STFA 3VOCA 4JEJA 4NZ4A 1H61A 1KRAC 1W1A1 1EPXA 3DEQA 4RPQA 5I06A 1ZS2A 2VX6A 2JF6A 1KFBA 1K70A 3H2EA 3BUVA 4UTIA 4IJRA 1PTDA 4UCGA 1SYTA 4X0NA 3C61A 1M3UA 6CGTA 5AHMA 4YVPA 3KS5A 4UTTA 2YCIX 1YNYA 3SURA 4UTTC 1GTHA 2FIQA 3O1NA 4I90A 3MI3A 5CSYA 2FPVA 3TYZA 1SM9A 4DXVA 3VFCA 1XH1A 1A5MC 4BCEA 3CHVA 1JRBA 3A9IA 5ABFA 1NH6A 2A7RA 2G50A 4GVIA 2C1HA 3WMCA 3I3DA 4UFHA 3B8TA 3ZVIA 2G3NA 3M7SA 3WJWA 3EKZA 3M0LA 3FN9A 3WK1A 4H6RA 3SRFA 5A95A 3MPGA 3QN3A 3LPOA 3KFTA 3MKKA 1M6JA 2TYSA 2QJNA 5HMSA 2IKJA 3NQCA 5K7JA 3VNMA 1W9XA 3SCRA 1JDFA 5LHEA 2X40A 3TYCA 2P5NA 3GU1A 4AF0A 4LVBA 1WDDA 4ZEPA 6PTDA 5CAKA 1W9DM 4ZB2A 3I6EA 1L6GA 1ZBVA 5BROA 1QVBA 3HB9A 2OGYA 1H0GA 1WKYA 3NQ8A 1WBJA 3GNPA 1LROA 4H7CA 2JALA 1YNQA 3SUTA 1BLIA 1GQJA 3DDMA 1Y7VA 3IJ6A 1KM0A 1TWSA 3W7IA 2HDJA 1WE5A 3T42A 1VJZA 3S9ZA 4NXSA 2OLAA 2QUVA 1X6LA 4D6DA 3DHDA 3G1AA 2TSYA 3SB0A 4LUJA 2ACSA 3N3TA 4LWWA 1UZ1A 2PFHA 4JTTA 4QE4A 2FGBA 1PKLA 3TYEA 3WQPA 4C6OA 1JI2A 3WNNA 3AZTA 2F6KA 3GTNA 3HZ3A 4JQ1A 1Z8AA 3AHTA 3A4JA 4G1NA 2W3ZA 3H23A 3VILA 1XCFA 4J4KA 1JCLA 1B1YA 1XGDA 1RJQA 2DSWA 3O7UA 1FY6A 3BC9A 1B31A 2OO6A 3UZZA 4AIEA 1SVDA 5I00A 2E5CA 2ZX8A 2DFAA 3FYYA 1LWIA 4NZJA 3JRKA 3MT1A 2FHCA 1TCMA 1BYBA 1UH3A 1A50A 4CVUA 3TA9A 2Z1WA 4R88A 2VP8A 5EYWA 4Z1AA 3W1MA 3GZAA 3W1UA 2REQB 3ISIX 4NZFA 2XH7A 2PMQA 3H55A 2D0FA 4ZO7A 4RNHA 2BV9A 1ITCA 4Q22A 4RE3A 2VWSA 4C6PA 3WD2A 3GYCA 1V6WA 4S3CA 3LXBA 3G24A 2YSWA 3PPHA 3V5OA 3LCLA 3CYJA 3NM1A 2WPGA 4IH3A 4B5UA 4HK7A 3LCGA 3EWBX 1YIXA 2VC5A 3BZGA 1QNVA 3GLCA 2OOFA 2BY1A 1AA1B 4DO5A 4HPGA 3OGRA 3VKJA 5C7VA 1XG4A 5D9MA 2C18A 2NVAA 5HK4A 7REQA 1Y65A 2A6NA 3MBDA 4KEUA 5EBUA 2VI0A 5KZEA 3VAVA 1LL7A 2BVTA 4F3HA 4EPBC 2VR2A 3GAKA 3URAA 4O28A 1LBFA 3GQYA 4DXKA 1X6UA 4PMYA 2JFEX 1H51A 5H6HA 2YA1A 3EMZA 4JPGA 3ARZA 4FX8A 3BMVA 3TW7A 3S6TA 1A5LC 5T8GA 3S5YA 1E6RA 3HPAA 1REQB 1YDYA 2VDGA 2PF8A 1PBGA 2YFNA 2TMDA 2W66A 1EEPA 3W24A 3HTWA 1IGWA 2PDIA 5AYIA 5C2CA 3KXQA 2E77A 1YBQA 3HPSA 4P8UA 3ATZA 1UQYA 1NOWA 1F76A 3EDDA 2FZDA 1WKDA 3IGHX 4L6OA 3URBA 1FDJA 1NFGA 1XYMA 2A7NA 3VMOA 9XIAA 1OCQA 2V30A 3BAXA 4OTKA 4UQAA 2J6VA 2OB3A 2IUZA 3BLKA 2BSLA 1FWNA 1IT0A 1RLDA 4HCHA 3F4CA 4A6GA 4W84A 3BICA 3ANVA 3ZO9A 2BY2A 1EFZA 3VNZA 2QPUA 4WXYA 4LYRA 4AXKA 4WY0F 2CERA 2Q3RA 1OFPA 2GUUA 2R9RA 3ZZ1A 2ZUSA 2CLKA 4XX6A 1R5YA 3WBYA 5A6BA 4ROQA 3I6RA 3PBVA 2EPKX 4DJED 3WD3A 4BF7A 3R79A 5D2YA 1R9XA 2LLEA 3CPUA 2BP1A 3QHOA 1GWJA 3OW1A 2J7DA 4PN2A 3NDYA 3QKEA 4NZ5A 1K77A 1UMLA 3WN6A 3PC0A 4D6HA 2OXNA 4PEEA 1OCJA 4XIMA 3UU0A 1LOSA 1A49A 1C7SA 2OX4A 2J77A 1DHKA 3MUIA 4S3AA 3MHGA 3FCPA 4A3HA 3VMPA 4JY8A 5J5DA 4IP7A 3WK0A 1CBGA 1VBUA 1YXYA 4GA8A 3KL5A 3T09A 3W7MA 1S46A 4ZOEA 4HKPA 1JZ5A 4B15A 3CAKA 4D6GA 4LEQA 2QAPA 3W76A 4O54A 3AISA 3URQA 1MRAA 3MV11 3VNIA 2V5JA 2VGBA 4XSLA 3HU7A 1XFCA 4Q4KA 5G5IA 3PNUA 1D2KA 4EWND 3SN1A 1W5OA 4XKMA 4N4PA 1VJIA 3GO2A 5DN1A 3LGEA 1A47A 4H19A 5CBJA 3B9EA 1EWDA 4WX2A 3AC0A 1I0BA 1G4SA 3DG6A 3GVQA 4ZE5A 1UIPA 1JJKA 3L5LA 4XKYA 1E1CA 1XCWA 1XC4A 2J7CA 4GFIA 2JKEA 1EJUC 2HQAA 5REQB 2HPMA 2PWGA 1EL3A 2CIPA 2WKJA 1OBAA 2RFGA 3TYUA 3EEZA 4GI9A 4C1NA 4O0ZA 1ZBKA 3L2MA 4BFAA 4JZ5A 1XLCA 1H11A 1VPYA 3T0DA 2YB1A 1GJUA 1KM6A 2WKLA 1EHNA 2C13A 4HQVA 4FNRA 2QDGA 3JZEA 5C2XA 1WYIA 1KQZA 7XIMA 1QOPA 4BY3A 1W1TA 5E6ZA 4MJ4A 3WJSA 4YU1A 1JXJA 1NDVA 1YPIA 1AW5A 1B3VA 1PYFA 4W8AA 1VIZA 2Y61A 4IT1A 3TW9A 4O14A 1UB3A 4DUVA 5XINA 4LC8A 1W9UA 5DX7A 1NIUA 2PBGA 3KCJA 1FWBC 1AH0A 4N2YA 1TQJA 3M0XA 3N13A 3RJYA 4C65A 3JZUA 4IPIA 1OF6A 1UROA 4Q32A 4MWAB 4EXAA 3UJFA 2V5KA 1CW2A 4EANA 1K8XA 2QEZA 2C14A 4KGLA 3KUMA 5BRBA 1ZQ5A 5IFTA 1TTJA 4B4FA 4JTRA 3TSDA 2WB5A 1SU5A 3BGJA 1GW1A 4UQEA 6REQA 1XLLA 3CV1A 4KF1A 3MC5A 1L0PA 2G5WA 1WDQA 3RPDA 2PTDA 6XIMA 5G2HA 2OSXA 5K3VA 1RJPA 3AYRA 2PSNA 1KFEA 4MWAD 1VIWA 3PPFA 2OZ0A 4L9XA 3H6OA 1GZ1A 3OVGA 4GACA 4MZ1A 3DIPA 1L6YA 4ALDA 3ARXA 3QQ0A 1I9CB 1FWAC 4L4OA 3EEGA 2YZ5A 3SQMA 1ZP4A 3EAUA 4RE2A 2OMAA 3V35A 1OB0A 2V5BA 1GG0A 4M1BA 4WY0A 3FXYA 4AZGA 3EWCA 4JIHA 2Y6ZA 3NSMA 4L61A 4RNFA 2J27A 4HD5A 3THUA 3K4WA 2WSYA 3G6MA 5M3WA 3FAXA 2JKAA 3DHFA 5BXTA 2WNQA 5BWAA 1ADDA 4N7QA 1QU4A 1WB0A 2XH4A 3ZM8A 3LBMA 2VX5A 1E6XM 4DVOA 4WSKA 3G5EA 4GNJA 3TK7A 1W8SA 1QPNA 1K8CA 4WQ6A 3DOPA 4YL2A 4AD3A 1H60A 2ZUUA 5BOEA 5TNVA 3W82A 2PRHA 2Z1XA 5DMLA 1GKPA 1OFAA 1K4GA 3KS6A 1JVNA 3TXVA 1GZJA 4RZ6A 5A1AA 3K30A 2DIKA 1G9HA 4A8IA 4A3YA 1F6KA 3BPWA 4BZYA 1O95A 1TTPA 1CLKA 1WDSA 1UWRA 4QR6A 2XIBA 1ZTVA 2C79A 3P8JA 1HJVA 1N8IA 2V82A 2FGZA 2I16A 3GG7A 4NL1A 4AC7C 3RCYA 1ECQA 2G97A 2NV1A 4MIMA 3T2PA 4MKNA 4FIQA 1Z9AA 4HNTA 3MCNA 2DVUA 1TELA 3W7DA 3WQEA 3PZNA 3P5YA 4H83A 2P3ZA 3AXXA 3USBA 1DBTA 3A4XA 4YTRA 1W3IA 4C60A 4UZSA 2XWDA 1EZ2A 5TQLA 2C16A 3MSDA 3R89A 3IIPA 4HOXA 4JTUA 3LQGA 4U33A 4DJDA 3UGVA 4DJDC 2PI6A 4C6MA 1TKKA 1UIOA 3TTEA 4J3SA 1PUDA 1P6WA 2V3FA 2ZBTA 1W37A 4BR1A 3VOIA 2P10A 1OFOA 3FJNA 2WZEA 3VM5A 3DXIA 4AD1A 3L2IA 1SZNA 1DJWA 3FEMA 3SY8A 4O53A 1NQKA 1KD0A 2XWEA 2PD9A 4GE8A 2XSAA 3APGA 3U4FA 5LIWX 3HGSA 3M5ZA 1WZLA 1E9LA 3LMZA 2Y63A 4GCXA 1J10A 1KCXA 5FCZA 4MNLA 3AXHA 3YPIA 2G41A 1NQ6A 2OYKA 3FNDA 3RUBL 4AW7A 1OQFA 1SZGA 2F2KA 4OIFA 1Q7ZA 4WDTA 1XYCA 1LRQA 1UKOA 2DY3A 1VEOA 4DBUA 1YNPA 2CLHA 4LBRA 1UUOA 4GUJA 4JIPA 3CIXA 1T40A 4OU1A 1VYRA 3OBKA 1GVQA 2NQHA 1NOFA 3MUAA 1NARA 3DENA 1OYCA 2WBKA 4IMFA 4JS3A 3KOWA 4A05A 3MSYA 3U48A 2IKGA 5HA7A 4JTIA 3DECA 1MI3A 3WLLA 4RW5A 1IZCA 1EC9A 4ZODA 1P5BA 1V3IA 3BV4A 3A22A 1K6AA 1L2UA 1A4LA 3GC2A 4EAYA 2VRQA 2YPIA 3VKCA 2A2IA 2O56A 4E8DA 2GJXA 3T0TA 1PE1A 3OYZA 3VD3A 7A3HA 5U7SA 3ONCA 1TPUA 4GYFA 1TX2A 3PJWA 3L2LA 5FF7A 1XLMA 2VUNA 2XVLA 5LA1A 3ZVHB 2JGYA 1FBAA 1FWTA 3RYSA 5D2WA 4CNNA 3OG2A 1KGXA 3SGUA 1UA3A 3THCA 4IPNB 3Q67A 4ZZ9A 4QS6A 1OWQA 4RCXA 1CTNA 2P3EA 1IEWA 2OELA 3FA5A 4H8UA 4OFCA 1XIMA 3UJSA 1ONEA 1KBIA 3BQ6A 3UWWA 1Z69A 3NR0A 2A3CA 3PBMA 3DH7A 3RX3A 1GKQA 5A8OA 2YLLA 2WPBA 1CGTA 4UQCA 4LNYA 4JQ2A 2XSBA 4LVAA 4PBFA 1AW1A 1NTHA 3Q2DA 1I2QA 3P0WA 5BU6A 1IF2A 3SADA 2E8ZA 4HU8A 1BKHA 2IKHA 3LPFA 3QMRA 2XVGA 3OQEA 3ZS4A 3CHDA 4MOZA 3AHZA 1XRVA 2E9BA 1LRTA 4JL1A 1NU5A 1ZY9A 1GVYA 3C0QA 4V33A 1RD5A 4HZ7A 2GGGA 4H2HA 4DYJA 2OSYA 2UY3A 3WQVA 2AQWA 1S1PA 5CGQA 3A47A 3AICA 5AHFA 2QHAA 3NGFA 1QFEA 2PA6A 4AHOA 2IPGA 5CCZA 3L0GA 2GQ3A 5HJXA 3LU2A 1H7PA 1LUCA 2HWGA 3GFXA 1D8WA 5EB8A 4AHQA 3N2OA 1XSKA 2PLJA 2PZNA 1JAEA 1VC4A 2OCZA 2VCBA 4CVWA 3QSRA 3BQ5A 4OV9A 3ITTA 4I5XA 4FNSA 3TQ0A 4IMAA 4ZCWA 3R6IA 4IXHA 4DWDA 2UZ9A 3PVFA 3U57A 3M5YA 5FF2A 1PB0A 5JUVA 3CAQA 3SCVA 3WH8A 5I23A 4OHQA 5JXQA 1DWHM 1A80A 1SO4A 3GY1A 4ZB5A 3GM8A 8CGTA 1W9VA 2DU2A 2DZWA 2R24A 3WBAA 3PPCA 1VCFA 2HE5A 2V2HA 3K1DA 4L9YA 3GKAA 4HMDA 5HAOA 3B0YA 2VZTA 3IUHA 1GPFA 3DFHA 1NWUA 1BTCA 4NILA 1DIEA 3AIVA 2VFDA 3N9KA 4LCSA 4GIYA 4NIRA 1SSGA 1S38A 4BQ2A 2E6YA 4GXMA 4HOWA 3HQPA 3W27A 5DY3A 4QP0A 3PUDA 4HZ8A 1F8IA 3AS0A 3GW0A 2JKPA 3WQ6A 4ATWA 4MSSA 4OWGA 1P0KA 4YCOA 1XBVA 3A5FA 4C6QA 3MMWA 3HOJA 5C2GA 1P0NA 4MFDA 1QK2A 2Z29A 3LBCA 4GYKA 3TQKA 1PTAA 4HK5A 3OIXA 1R2TA 1PZ3A 3W07A 1VYPX 5GPRA 5HPOA 2QAFA 1VPQA 5EKYA 1EBGA 9XIMA 1J11A 3KBJA 3NL5A 4OZOA 4LUSA 2ON3A 4R27A 4KCWA 4M3PA 3MP3A 3MA8A 2OQHA 3CUXA 1R87A 1BF6A 2ZX9A 1OFDA 3UG5A 1L8NA 4UQDA 2DT1A 1UZDA 3L0KA 5B7ZA 3CQHA 1IXQA 2G3FA 2DSUA 4PA8A 3TX9A 1KO0A 3VKBA 4QNEA 3S1GA 5HWNA 3WF1A 3QGKC 3VC5A 2WLZA 1EB3A 4AZ7A 1C93A 1S2VA 1OX6A 3IRSA 1LP6A 3FHQA 3PJUA 3G8EA 1O12A 4PMQA 3OZYA 3OZMA 2GPTA 4LUYA 4CQDA 2HROA 3BOLA 3MWAA 1J96A 3TJLA 5I0DA 2SFPA 3VIOA 4DUWA 3AIRA 2OZ3A 1E6SM 5H8PA 1ZHAA 1HGYA 3ZLHA 1QNOA 3L0NA 2Z1VA 3L7RA 3UXLA 1XRTA 3F5LA 1V0KA 1MW0A 1VQTA 3NQGA 4H1ZA 5AYZA 3GC4A 3U5YA 2ZA2A 4HJFA 2Z2UA 3AHYA 5U4NA 2I17A 4Z2IA 3R13A 3ALGA 1MQRA 4Y9MA 2YCEA 4QIUA 1G7VA 2Y62A 4Z17A 4GH3A 4Y7EA 1J2WA 3EWDA 3CHFA 3GAYA 4ZSTA 2G95A 2VVNA 5EMJA 3A13A 2CC0A 3ES8A 3ERPA 1BQCA 1R6WA 1E9IA 5LNSA 1GHSA 3LA4A 5E09A 4TXEA 2O7QA 3VOGA 1N7KA 2QQ6A 2XFFA 1ZGDA 1TTQA 4HTYA 3MJMA 1TTIA 2HSAA 3OLIA 3H21A 3TNOA 2QUUA 3CM4A 3W7KA 4CD4A 4ACZA 3TN5A 3KL0A 3KE0A 1R7OA 1P0BA 5BRPA 3O0KA 1E3ZA 4YVVA 5HUPA 5FD0A 3S2CA 4F9JA 3VZXA 3KVMA 1TCDA 2V63A 3IARA 1EJTC 4J1OA 2ZTJA 3GDKA 3QHNA 1GHRA 1YDVA 2H6RA 1JD7A 1DVJA 3MZ2A 3S2MA 1JCJA 1YX1A 1NEYA 4S3DA 5FAGA 3LZ5A 1DE5A 4J3VA 2A85A 4NZCA 3ZJKA 1A3WA 1AQHA 2QCNA 5I77A 2WBGA 3DFNA 1ZAHA 1PZ0A 3E49A 1MW3A 4ERAA 3IANA 4UNKA 2I1OA 4FLSA 3UERA 3WFLA 4P7RA 1EA0A 1LF1A 5T9CE 3WLKX 3N34A 3AMDA 3URNA 2VX7A 3UPBA 5TAOA 3TLQA 1QR7A 4LAUA 4PUKA 5AOUA 5IRPA 5F2LA 1TRIA 3AXIA 1H49A 1GOIA 4Q8PA 1AW2A 2WM0A 2V5DA 3V1HA 4MUPA 4A2SA 2YCJA 3TTOA 4I5UA 3GXNA 1F74A 5C7HA 3PN8A 2V9DA 1ZBWA 2IMRA 5I3HA 5TIMA 2OZ8A 3KDNA 4J2PA 4UR8A 1H4PA 3SRKA 2VOTA 4P8VA 1UC4A 3MP4A 3QQWA 1OABA 2WAGA 1GVOA 3P14A 1LG2A 3TOYA 4FALA 3QH2A 3BCFA 4XAZA 3GU2A 3ZLFA 3BURA 4PB4A 2ZRWA 4GBUA 4S38A 2P76A 4WOZA 2VYOA 1UHVA 5H2ZA 3D3AA 3WELA 2ISFA 2YDAA 3LTYA 3GXPA 4R3UA 3W1TA 4AY1A 1EZWA 3CUZA 5CZJA 3O6YX 2PBOA 4KQNA 1K3UA 2A1YA 4JBRA 1NWSA 1B5TA 3T6CA 2GSHA 4PTWA 4JFWA 1RPXA 1W1ZA 1KTCA 3H26A 4LFYA 3VDGA 4HPXA 1IIGA 1UZ4A 1Q3NA 3CLWA 4KMQA 2DV0A 2FZ9A 3QOKA 4RDYA 3NNTA 4HA4A 1JF5A 1FKWA 2NLIA 3QZAA 4J28A 3U6WA 5A8MA 2PP1A 1QNSA 1ZCOA 1CXFA 1GOOA 1FDYA 2ZZ5A 3EDJA 5D4YA 5AVHA 3U7VA 3UR7A 2QKFA 2F6UA 1DTUA 5J8LA 3O15A 4X2RA 1CXIA 1TPB1 2Q09A 2D3LA 2DP3A 3M5XA 3S42A 4B2DA 4RDWA 4TVCA 3PTQA 3QYQA 3SUWA 3B8UA 4FSAA 3NOYA 3TFXA 1QHOA 3U8GA 4LT9A 4ZFCA 1NY1A 1SZFA 3PB2A 2CEQA 2B0MA 2W62A 5C8BB 3UPMA 1JNDA 5CC5A 1E6QM 3FAWA 3PNZA 4ZO8A 2PF0A 1VFOA 3I4EA 3FY1A 2WMIB 3R94A 2R94A 2J8FA 1JQXA 3LHVA 4PMNA 2Z7GA 4QAIA 1FVPA 3AYTA 1BSLA 2HZGA 3O0FA 4WDUA 2I7GA 2DDXA 3CZ8A 1JEZA 3B97A 2Z25A 3E5PA 1JFHA 4TQTA 3W87A 2CWNA 1OGGA 2BODX 1HKKA 4PTVA 2GGJA 1RHCA 4IWWA 2YW3A 3EB2A 1XP3A 1LWHA 1B30A 3RITA 4LQ1A 1M7OA 3GVWA 1XLDA 3BLLA 1MDLA 3VGEA 3RHGA 4BQ4A 3P74A 3DBNA 2Z26A 4RV8A 1O1ZA 3UYCA 1QNPA 1V6TA 3LRMA 3GFYA 1XYAA 1W1PA 5LGXA 3WD4A 3VX1A 4GVHA 3GNOA 2FYMA 4GKTA 1OC6A 3CZEA 4O19A 2CWXA 3AJ7A 2BOFX 2GQAA 3BH4A 1SQ7A 4MLRA 4M81A 8XIMA 2CLEA 2W63A 3HIJA 2DUAA 3LCWA 3U0HA 3MTWA 2QCFA 4O8AA 4IZGA 3T0AA 4PMXA 3RLUA 3UR2A 4J5NA 4CGTA 3LSBA 2PDXA 1X7FA 4GQBA 1I45A 3T40A 5K4ZA 3TAKA 3EPMA 2O9OA 2XG9A 3K1GA 2OVLA 2XTKA 4U10A 1N55A 3VX0A 3GDBA 2I9EA 3VIIA 3A23A 3AIQA 3WY1A 2PC8A 3DG3A 2VWTA 4PSPA 1ZPTA 2Y2WA 2FVKA 2NVCA 5BZAA 1XLGA 2J4GA 2VC9A 3N2BA 4TTUA 2HCVA 3B8VA 2AGKA 3BAJA 1X1ZA 1W5MA 1MW1A 4Q4SA 1AFSA 5AC8A 4K38A 3VIMA 2PWVA 3PULA 2ZKMX 3N6HA 3P60A 2C1IA 3AUOA 2NSXA 3ARSA 4GFSA 4G7EB 3DU0A 1XUUA 2C7FA 1P48A 3W6MA 4XWUA 1E3XA 3PJXA 3UY7A 4AC1X 3M44A 4Y8FA 3C4UA 3OQ8A 3CMJA 1ADSA 4BKNA 3P6LA 3W1PA 5M03A 4DJFA 1LOQA 1FWWA 1PHWA 2O4MA 4DJFC 2ZZ7A 5FEPA 2BOGX 4W5UA 3SIMA 3NZ1A 5CSUA 1SO6A 1ZZMA 3D3FA 2AOSA 1WZKA 1R38A 5HR7A 3IIOA 4QCEA 3SSZA 1H1YA 3TJIA 3H4XA 3AFBA 3USZA 3WDPP 2EXOA 5K9CA 4JGDA 1YTDA 2ZE3A 1W91A 3EB4A 3DAQA 2OYMA 2EO7A 1VLWA 2ZC1A 4AG0A 1EDQA 1KLYA 3MO4A 2GSEA 3K8LA 4IPLA 3L5AA 4XZHA 5TD4A 1WXJA 1RP8A 2P1FA 4DM1A 2BDQA 1HJSA 2W4XA 4HN8A 3A4AA 1UG6A 1H7NA 1J5SA 3B40A 3CBWA 1VCGA 5CEWA 1EJ7L 2F2HA 4FNUA 2YYTA 4G2DA 1VFFA 3N17A 4RZBA 3RN6A 1G4TA 2H8XA 1LL6A 1RK6A 4QE1A 1RVKA 1SR9A 2AL2A 1WBHA 4I3GA 4QROA 3IUIA 4J3UA 3BSMA 3SM0A 4UMCA 1UBSA 4M6QA 4PUNA 1E9YB 2C15A 1OEPA 3R0DA 3V5CA 3ITOA 3AQUA 4FXSA 4LUTA 3JUGA 9CGTA 2E28A 3WQ8A 4X63A 2E68A 4QDPA 3WG6A 3MUZ1 3QGAC 4XO6A 3OEXA 1Q63A 3UD6A 2AMGA 1YRRA 5D03A 3CS2A 1WXYA 1XQKA 3GU9A 4FP1A 2WWCA 1T8XA 2QVNA 5B80A 1RA5A 4I6VA 3BAYA 3TYBA 1H7OA 3HG4A 5LGZA 1C29A 2DIEA 3G0XA 3IGSA 1CPUA 1VFSA 3UF9A 1AVAA 3BWWA 1UD3A 3CPGA 3TYAA 4IISA 4C1KA 4JTJA 1EBHA 4JNZA 1OX4A 3CTTA 1KCLA 4DRSA 5JVLA 1QHPA 3SRDA 3STCA 4CLMA 4JTLA 3R8RA 5JU6A 1RJRA 3BE7A 3EMQA 3FSTA 1E56A 2BHUA 2P88A 2Y7FA 1T7LA 1NVMA 2DVXA 4W9TA 3GXTA 3XIMA 2PODA 1JI1A 3QPEA 3RMJA 1QT1A 3GB6A 3VNKA 3QMTA 4TTGA 3DZ1A 3LENA 4PCTA 4TV5A 4E4PA 4HPHA 4BWLA 2CLOA 5GVJA 4QEEA 1FCQA 2CYGA 3BARA 3OA5A 4IQJA 4GZIA 2QJGA 4GQQA 1VS1A 3PZVA 3NOEA 4ICMA 4HSNA 1VFHA 1JAKA 2X1UA 2Y7DA 4GINA 1ZBCA 4AF0B 4TMCA 3Q37A 2VEGA 3HMCA 1K9EA 4MYAA 2GDVA 3PUGA 1LQAA 2QF7A 4NVTA 3TW6A 1GCYA 2IW0A 4IG2B 1HKMA 1R3YA 1P0DA 3HPZA 3KX6A 3S8HA 1RA0A 4JYEA 3QLDA 4PMOA 3LOTA 1H09A 3NQ6A 2RJHA 5BNKA 1C8YA 3M0JA 4MPKA 4IIDA 3GDRA 1PDYA 2V3DA 3LRKA 3GHTA 3GTIA 1XLBA 1DJXA 4EP8C 1TWIA 5BMXA 3FJ6A 2QW5A 3W4RA 4NJIA 2X1TA 1I1WA 3PSWA 1LT7A 1Z7AA 3DERA 4QG8A 4CNTA 4K8EA 3RU6A 1EDTA 1GYLA 3IK2A 3A3XA 4KKXA 1QASA 1TJ2A 3S2JA 1EJRC 4GRSA 4QE5A 3N29A 3H2OA 4H01A 2DZAA 2ANUA 1KM1A 4K39A 3CTLA 1TO3A 2EPOA 1IE7C 1O7AA 3E38A 4GVGA 2WLYA 3NCOA 2OPJA 3HO8A 1QTWA 1XSIA 4Z08A 1TA3A 1EIXA 2ACQA 2WCGA 4RW3A 3BVJA 4P5UA 5T91A 3HQ1A 1EEXA 4GUFA 2Z7KA 2PDPA 2YBUA 4FPSA 3N19B 1EKOA 3VNYA 3S9YA 3NM3A 3T9PA 3WLTA 3EOLA 1KA9F 2OODA 5EMMA 1JPDX 1OYBA 4HNUA 3DI0A 3SFKA 3MWCA 4UNIA 4EPEC 1KCKA 3BTNA 2PDLA 2B7NA 1M5WA 1M1BA 5AHIA 1MEWA 3WLIA 5G1MA 4LCQA 3ABSA 2WZMA 3KEHA 1X8CA 4MM1A 1O94A 3T2QA 1ELSA 1OC7A 3CT7A 1AK5A 3PFRA 1OY0A 2G8ZA 5BXPA 7REQB 3MBFA 1K7XA 1KBJA 3CO4A 4S3BA 1TUXA 4YPJA 1K9TA 3P67A 1XYLA 3MS8A 1J2BA 1I2NA 3SZ8A 3VNJA 4Q4QA 1ZALA 4OJYA 1XIFA 3TZFA 3KBMA 4KS0A 1SFTA 4LVDA 2PTYA 1J0ZA 3ZFHA 3T1GA 4LF1A 3SUSA 4PC8A 2DW7A 2W92A 3ARRA 3FSUA 4Y9NA 4YN5A 1LBLA 1TV8A 3DYOA 4FOJA 4CQAA 4BQ3A 1DJQA 5KETA 3W1NA 4JKLA 2E1WA 3G0SA 1YBQB 4LUIA 1JR1A 2Z28A 1DIKA 4GUGA 3HF3A 1Q6LA 5CPNA 4KEMA 1B3ZA 1NELA 3LHTA 2WC7A 1XFBA 2RDUA 1PWMA 3ZSSA 3R0KA 4RE4A 3TDFA 3H8AA 2ISWA 3S2NA 4AEEA 4JTQA 3ZYZA 1Q6CA 2IXVA 1P0EA 1PX3A 3QRHA 3NQMA 1QK0A 5CSRA 3M4HA 4MNMA 4NQ1A 2NQJA 2NQ5A 1LBMA 4M19A 4PFMA 3HM7A 1US2A 3NXLA 3NPVA 3PZTA 3N9RA 4HMEA 2PDGA 3CGTA 1FWSA 2FJUB 3MB9A 1HJUA 1FH9A 2CFFA 1U1HA 3B4UA 3T07A 1XYZA 2DGAA 2E25A 4Z2GA 1UW9A 3QR1A 3NDZA 4DAIA 2RDXA 3W72A 3CLMA 4WRHA 4DEFA 1F6YA 1FQ0A 4MY8A 1E55A 2FZ8A 3HURA 3C2EA 3CHCA 4UBPC 1QMLA 2AQOA 3VIFA 1J01A 3HG3A 3MMDA 4A22A 3WJZA 5A6BD 2E1DA 3IPWA 1QI5A 4HBKA 3ZXWA 3H2MA 1Z48A 3W7PA 3WMSA 2A4AA 1BG9A 2DZBA 4GKLA 1T6MA 5CZKA 3L23A 3WMLA 5LNUA 3RXZA 4LNCA 3W6YA 3S9IA 3NQ7A 3H7VA 2WO5A 3IIZA 1BGAA 1CLVA 3G0UA 4B4HA 3CNYA 5DXYA 3VYLA 1ECEA 4YTUA 3GR7A 1X39A 4PFHA 5CPQA 3ITVA 1ZJBA 4WKHA 2H9AB 1GTEA 3V75A 4B5TA 2VX4A 5MKGB 1HKIA 1BVNP 1GVFA 2X2GA 1D3HA 5CZSA 4MGGA 1HJXA 5CGTA 1DWFM 4LAOA 4PODA 4DNHA 1SW3A 2W61A 3ES7A 1B2YA 4RL3A 2V3GA 3RIKA 3H2FA 4YLWA 3MW7A 4S3JA 3OHMB 1UZHA 4XKYB 1TSIA 5F2GA 1E1CB 4ES4A 1RD6A 4F0MA 1YKWA 3E74A 3H12A 4A3QA 3UCDA 1V0NA 3W7EA 2G4FA 1Q6QA 1GVSA 4US5A 2D22A 4GX8A 3EPNA 4F66A 3CUGA 2O7SA 3WLNA 3GH4A 1DQWA 4F2TA 2HJPA 3KOFA 2FZNA 3QV9A 4ZQOA 4QTGA 1OCNA 4DBDA 4M8UA 4AB4A 2QCHA 1WAWA 2E6AA 1WXZA 1IXPA 3WFZA 4DF2A 4QJ4B 2JF7A 1U30A 1WCGA 1S5MA 2EG6A 3L5MA 4DJEC 3DG7A 3EMCA 4GH1A 2QCCA 3B9DA 2XIMA 3WMBA 2FDSA 1FXPA 3L21A 5CPSA 5LIKX 2YCKX 5AC4A 4XAGA 2J7HA 2ZXQA 4YCPA 1KTNA 4MB5A 1IT8A 1EX5A 1X6NA 3SJ3A 1XR2A 2VURA 3L4WA 1MZRA 4RXFA 4C7FA 2Z00A 3WNOA 4O8RA 3SJNA 4P2VA 2CLFA 3WH5A 3MO7A 2QNEA 1E71M 4TX6A 5IDZA 3WJYA 4K7YA 1H0IA 4AWTA 3AHVA 2VMFA 1E0UA 1IEVA 1PIFA 1DE6A 1QWKA 3IAQA 1BFNA 1XIBA 1GOKA 1DYSA 3UWEA 2X8RA 4MZ8A 1MXDA 4WJ8A 2TRSA 2FH6A 4UOQA 1S5NA 3P62A 3VM7A 1JZ7A 4Z2KA 4ZXLA 1P6BA 3IVTA 2EG8A 3AAMA 4DWSB 2E6DA 1CWYA 2O9RA 1HL8A 4JNYA 3QC3A 1JZ3A 1VJSA 2FVMA 3QM3A 3VDAA 1OX5A 3LHYA 4GI4A 2Q02A 2GJLA 2YW4A 3DC0A 3W2JA 1E43A 2X41A 2DZPA 1E51A 1TFVA 1EA9C 3AS1A 1HIZA 5HINA 4C6KA 3ICJA 1OM0A 4K37A 4HNLA 3L4UA 4JN8A 3THAA 4DWSD 4ERIA 1VBJA 3AZRA 2VENA 4J9JA 2IPJA 1KR0A 2VZUA 4HA1A 1VFMA 2AQVA 3AI0A 4IQLA 4ZR8A 3BAIA 1FP8A 4WY0B 1UP3A 3IK4A 3CWOX 4ICCX 4GXPA 2ALRA 4FF5A 3GTXA 4I9MA 1PZ2A 1V93A 2Y8VA 2E0PA 5GJPA 4GG9A 4JHMA 5KMYA 2PDKA 2F84A 4AX6A 2PDFA 2OKTA 3ABZA 3WDQA 2MNRA 1R30A 3FFSA 1J0YA 1SO3A 5CPLA 3W7JA 1OT2A 4QFUA 5REQA 3PTDA 1DV7A 2PWDA 4JFVA 2F7FA 2W27A 3HQOA 5D04C 1FHLA 4INFA 4LVFA 2PE4A 3KTSA 3DC8A 5EFDA 3N25A 4C6FA 3OHIA 4S39A 5DBUA 3LX9A 4O1AA 2XSXA 1T41A 1O5QA 3H7RA 2R1NA 1ZL1A 5HMEA 2VC7A 4JTSA 1X38A 1M9HA 3UNTA 4Q6JA 3AS3A 3WEZA 4NAFA 4AVNA 3VUSA 1NM9A 2DW6A 3N12A 1TV7A 5A2CA 2YL9A 4IGHA 4H3DA 4TX9A 2XHYA 5FEXA 4MFEA 3I65A 3MMUA 3BL3A 4XAPA 4X60A 4CN1A 2DQWA 5CBIA 1GVRA 3L66A 1WA3A 1HVXA 1U5HA 3GG8A 4M82A 3EBVA 3N4FA 3ARPA 4ML9A 1Q7QA 2GOUA 1UD8A 1W3LA 4MWAC 1U1JA 3COTA 1YPFA 2J9XA 4NI8A 1D7KA 4CUCA 3BANA 3QPZA 7CGTA 2BGNE 4RV3A 5DLCA 4E2OA 5E6YA 4Y8EA 1CXHA 3G77A 2GDUA 3BLIA 3AYVA 4ATLA 3O06A 1DOSA 4QSFA 3V7PA 1XLAA 1PJ9A 1G5AA 2JIWA 3ID7A 1H3GA 5D9PA 2PP0A 2XINA 4PL2A 2XGBA 2WCSA 5LNWA 2ZUNA 3EWUA 1MO0A 5KEZA 3E96A 2O55A 5FEZA 4K8GA 1DJNA 4POCA 5FI8A 3I68A 2PEVA 3H53A 2WHMA 2ZUWA 3H7UA 3NVDA 4DZAA 4D1IA 4ZOAA 3UG8A 3V3WA 3SO7A 1FWDC 3LCIA 1W31A 5HNTA 4F0RA 2W91A 4QM1A 2HEJA 3E0LA 3E3HA 3LRLA 4W85A 4UFJA 1M01A 3QFEA 3HA1A 4U4MA 4G6CA 1FWIC 3B04A 2G3JA 4I9AA 4MJMA 5HJLA 3R0UA 5BWFA 3A9BA 4D6JA 4B5XA 1TX0A 4TVDA 2WVUA 5F1UA 5AY7A 4X22A 5F2IA 5HBFA 3TR2A 4OOZA 1VEPA 4XZIA 3S2LA 4K36A 4JIQA 4NP7A 4HU3A 4ZFMA 1SGJA 4XISA 4XBJA 5DCEA 1JPHA 3CMFA 4WR3A 4I7WA 4W8LA 1PIIA 3JR2A 1FFRA 4H9XA 1IEQA 3A21A 4O11A 4LJ3A 3AIEA 3UA4A 3NQFA 4O17A 1Q4WA 4S3EA 5C9RA 4PUDA 4LYKA 3GIYA 1GQNA 4N02A 2J24A 1V0LA 2H3BA 4NI3A 5C9ZA 3SAZA 3RPTA 2CCRA 1LJYA 4IPPA 5CC7A 2NQ9A 4XD3A 1XBXA 1H7XA 2OWWA 2ZA1A 1K9FA 1SFLA 1V77A 4DQWA 3SY5A 4I8DA 4MY9A 4JQ3A 1L8PA 4AWSA 3QV6A 1TVLA 2Z1SA 3K46A 3PBWA 4PUWA 3GBDA 1EX1A 2B81A 3T78A 1AZ2A 3VGDA 3V4BA 3FW6A 4D8AA 4QLLA 2NT1A 5DANA 3THQA 1B4EA 4PMZA 3CQ0A 1OD0A 2VRJA 4GISA 2C0HA 1XKJA 2CETA 3APYA 4R53A 3L67A 4DYKA 1JDCA 1UR8A 4HMNA 2HVNA 5G2IA 3VA8A 2ABBA 4JY9A 4AQLA 3BLEA 1NWTA 2CZDA 4KIEA 1UOZA 3PWGA 3U2EA 3WNMA 3M0MA 2TPSA 2ZX6A 2ZC8A 1B3OA 4O50A 3A5VA 1TG7A 1MYRA 1QHZA 1UASA 3RLGA 1EO5A 2Z0IA 3B0UX 5FAJA 4ZL1A 2PZ0A 3CC1A 5EPDA 4CNSA 1RSCA 3RLVA 3OPSA 3KRZA 3TLLA 3O6CA 3KTXA 2QV5A 3KWSA 4LXFA 3L9CA 4IMDA 2V2DA 3PF3A 4MDOA 3UZXA 3T2OA 1LUCB 1R3VA 2CKSA 2HBXA 5GQBA 3WENA 2X16A 5L9FA 4FHAA 4ENLA 3UWYA 1F07A 4LALA 1X1NA 2OQYA 3R5EA 5KTLA 4UMAA 4GCAA 3EWYA 3W53A 3LTPA 1JGIA 1UR9A 4RX0A 2X09A 1BWVA 2VM8A 1K02A 2DZUA 4WCJA 2P8CA 2GSJA 5BXSA 3S5SA 3W7GA 1QPOA 5LXXA 3S3GA 2X0HA 2E40A 2ZUVA 3UJEA 1J6OA 3N11A 4UTMA 1JUEA 4N9DA 1WP6A 2NX3A 1BHGA 1FDZA 4R7WA 1NJJA 2HNHA 3A3HA 4DF0A 3ZWSA 1I8JA 3N2XA 5EU9A 4TU1A 1XIEA 2PDQA 3AMGA 2ZRXA 3UXIA 4U3CA 2WMFA 4OGZA 1BXNA 3WF3A 2OOGA 1DWIM 1A5KC 2PU0A 3ZVHA 2PPGA 1QBBA 1F4HA 3HG2A 1C7TA 4JTHA 4C7GA 5FSEC 1V8EA 1Z89A 3N73A 1KBKA 3KBNA 1W2VA 3PZOA 2AKZA 2WZHA 4XVDA 3FK4A 1KW1A 3HJEA 3LB0A 4UFLA 2Y1HA 2PDCA 2VD9A 4MAVA 4JTEA 4XZNX 3LQLA 3VTRA 3HV8A 4LAMA 4M56A 4MHBA 4W8BA 3A4WA 1VKFA 5LXEA 4GHRA 4QRNA 1TV3A 2J62A 3GK0A 3IGXA 2RGMA 3FYPA 3LLXA 4IF2A 1JUKA 2X2YA 5K4XA 5KITA 1YTEA 4K8HA 3P80A 4YYCA 5F7UA 2FTWA 1WZMA 5CZTA 1MMFA 3SBFA 1XD0A 4IMGA 4S3GA 4CNPA 4I7UA 2XIJA 1HG3A 1W54A 1Q85A 3GS6A 3GHSA 1JCYA 3H2AA 1KM4A 1LRNA 1P1MA 1UKQA 3QYSA 4BI6A 4CQ8A 3B06A 4LGXA 4ZO9A 1PAMA 1B90A 2WV8A 1A5UA 1DWGM 1UBPC 2ODOA 4WF7A 3VO0A 4EIVA 1KB3A 1ZUAX 2DZXA 3S6DA 3AZSA 4LUSB 4HNVA 4C6LA 1YW1A 2VZVA 2F6XA 4XK2A 4IIGA 2WJEA 3WDJA 5G4EA 3FA4A 4H8VA 1FWGC 3EA2A 2RDTA 4JHOA 5HNNA 1P4CA 2QDEA 3OLDA 2OLHA 1ZRQA 3WH6A 4N6EA 1Q2RA 2I5QA 8RUCA 4PCNA 2DZVA 3TXZA 2OX1A 1VRXA 1M53A 4M5PA 2D0HA 3AU6A 1I2RA 5A8NA 4MUZA 1UR1A 1ISYA 4GI8A 3AIWA 3C3UA 1RBOB 2J9ZA 3QEZA 4DPQA 3QV8A 4QGCA 3AOFA 2ZRUA 3VGGA 5G1YA 1GQIA 4K7VA 5C0QA 4G8TA 1MNSA 2Y89A 5ABGA 1TPH1 1S2AA 2VEIA 3U2OA 3UWUA 3VXGA 1QW8A 3GVRA 1B3XA 1NP2A 5RUBA 3K2GA 1RALA 3VKDA 4E0CA 3V5FA 2QJMA 1RBAA 2VEFA 1KKRA 1ME8A 1KBLA 4XTDA 1POKA 2WVVA 1LT8A 2AAMA 3SIZA 4OT7A 2MANA 3W1LA 1UD2A 3STEA 3VK5A 1AQFA 1WPCA 3AU2A 2RKXA 1TMLA 4K6AA 4IP5A 4N9BA 4ZA0A 4Q8VA 3NIYA 4PUEA 4HA3A 4FAMA 1O4UA 1XIDA 1M03A 2BXVA 1EH9A 2OG9A 1TE1A 1O1HA 3MVIA 4CNUA 2DPEA 5AHEA 1XQLA 2Y8KA 3LERA 1SJCA 4ACZB 1TMHA 2H3DA 4HP5A 3UR5A 2POZA 3ARVA 3W37A 1DXEA 3P61A 4KRTA 3S5OA 2JQXA 4XD6A 4CD7A 3SW6A 4FLRA 2NWRA 3M9YA 5EFFA 3PZQA 2VCAA 4X2PA 6ALDA 4XZMX 1TVNA 3BJSA 4WGXA 3VKKA 5A6LA 3L4VA 3REQB 4JTFA 4CQCA 3MQTA 3OJGA 1OHLA 5FF0A 1XD1A 3GR8A 2ZADA 3P93A 3U5UA 4LPCA 1Q4NX 4NASA 3NG3A 5IHSA 2VEMA 2XUCA 5IBXA 1ITUA 1W17A 3ARWA 5IBXC 3ZLGA 1AUSL 3UEQA 1UP2A 1TUFA 3B0PA 3N18A 3MV01 3CH9A 1XRFA 4IFKB 4IICA 9RUBA 4QNWA 2PDNA 1GVEA 5E0KA 1F61A 4C6IA 4KWUA 5E9XA 3POCA 3CPRA 1XRSA 5DRIA 1A53A 3BZJA 4PB5A 3WDIA 3NPWA 3TR9A 3LPGA 4PRRA 3GVGA 1BRLA 2BGSA 1W5QA 4CCEA 5HQEA 2JIEA 2G37A 4GNKB 4FR1A 2NLYA 4MLJA 5IHRA 3WLSA 3BGGA 1AODA 3TV8A 5HJYA 2GVJA 4AIOA 2HV5A 1EQCA 3I10A 3N1AA 4H6QA 3NEHA 3W1XA 3W00A 3FHAA 4A3RA 3IJDA 2W9MA 4QS5A 1BKSA 1NFBA 2D24A 4AZCB 3QW4B 1TE6A 2O9PA 3UXKA 3AWOA 2VGGA 3LTSA 5A6JA 3M47A 3UBPC 4BS0A 2R14A 2C3ZA 4WXZA 4GQ0A 1MQQA 1FCVA 1KC7A 5PTDA 4V2XA 3WBXA 1EIBA 4R34A 4DN1A 4H8NA 3K13A 2ISSA 1E72M 5K9XA 3TWAA 2GZXA 4AIBA 1DEDA 3F4DA 4ATDA 1LG1A 2YIHA 1UQZA 1DL3A 4HHMA 4H9MA 2WVTA 3UVAA 4CD8A 1TYGA 4JX4A 4JQ4A 3W2MA 3WQFA 3KAOA 4HCLA 1RBLA 5AC5A 2BNJA 1OT1A 4FXRA 3U2CA 4JFTA 2CHNA 1E70M 1XXXA 3O2LA 4MNJA 2QLYA 2WNNA 3CO8A 3CZGA 4A29A 1GQLA 4OVXA 4QITA 4CQ9A 4UR9A 5F4SA 2BVDA 4OUEA 3OZPA 3HJZA 1A0DA 2I5IA 1EP1A 2EG7A 1EGVA 4JKKA 1KM5A 2DIJA 4JDBA 4UTKA 3KRBA 4IFRA 1G69A 2J88A 3KCLA 4GPNA 3WIJA 5G4WA 5JQ9A 4XV0A 4IX0A 3BOXA 2BFGA 4PUJA 3N4EA 2UY2A 4UZUA 3LYEA 4QCFA 2EJ1A 3VIJA 3PJTA 2H8ZA 3UY8A 4WDXA 2RDWA 2OEJA 1QOXA 1H1NA 4I9TA 5CGMA 3NZQA 2VQUA 1QW7A 1KV5A 3RM4A 1HZYA 2NSOA 4W4QA 3MCMA 3KHDA 1JD9A 1BQGA 4E3VA 1FXQA 3KBWA 3LS9A 3UFYA 4YIWA 3LG3A 3F4VA 1WZAA 4E2DA 2X0YA 4Q33A 1UD4A 2CZ5A 1MRQA 1I4NA 3LXCA 3R12A 1C9DA 1EHAA 2X30A 2HVMA 3NURA 4WLCA 4E2VA 4D72A 5JBDA 1XINA 3VIKA 2ZDRA 1VZWA 3N6JA 1V6UA 6TIMA 4MWAE 4O18A 4EVZA 4UCFA 2WSQA 4JCMA 4JL2A 4WOQA 4FOUA 4Q8OA 5AECA 3S5ZA 3BSGA 2VCCA 3SRHA 1VR6A 2FDMA 1OFEA 2XVNA 3O07A 1DIOA 1RXOB 1W3NA 1V3KA 2HBVA 4OUIA 3FA3A 4AD5A 3HG5A 2EKGA 1V5XA 2JEQA 3GDMA 1CXLA 1E1EA 1TRDA 2OU4A 3RX2A 4LB4A 1CT5A 2OYLA 2PTZA 5HANA 2I57A 4E3TA 3CL8A 3VD5A 2VELA 2NUYA 3GG0A 3UT0A 2YBTA 3DFTA 2VT0A 1K8YA 1VHCA 5EBAA 3WK3A 1V02A 4AH7A 1I2OA 4M0XA 1SW7A 2HXUA 3F2DA 3WLJA 3KCOA