1LOQA

Crystal structure of orotidine monophosphate decarboxylase complexed with product ump
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
209
structure length
208
Chain Sequence
RLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of inhibitor complexes reveal an alternate binding mode in orotidine-5'-monophosphate decarboxylase.
pubmed doi rcsb
source organism Archaea
molecule tags Lyase
molecule keywords orotidine 5'-monophosphate decarboxylase
total genus 81
structure length 208
sequence length 209
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2002-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1loqA00
3O6CA 3G3DA 3F4WA 3MP4A 1DQWA 3HBLA 3NQCA 3PG9A 2FDSA 5FF4A 1Z41A 1XDLA 2JGQA 3CIWA 3M6YA 1G4EA 3EWBX 2GPTA 2QUVA 2G5WA 3S1VA 5I3IA 3I7QA 1ZAIA 4RZ4A 5HJLA 3UWUA 5U7SA 4HNNA 3NR0A 3L5LA 1TTQA 4GXMA 3KVMA 1KTBA 3CEUA 1EWDA 3GAKA 1B4KA 3G0XA 1P0NA 1SQ7A 3S5YA 2NXIA 3LTSA 4ZQNA 4FF7A 4RV8A 4CQ8A 3JR2A 2WV8A 1XBZA 3DKJA 2E6YA 5K9CA 3NPUA 4O52A 2PE4A 3DFQA 2C0AA 4WOQA 3NQDA 3YPIA 1XKYA 1M5WA 5G2HA 4RXFA 3LTYA 3BVJA 1XFBA 1PIIA 1DV7A 1WX0A 2WSQA 3E02A 4N2YA 2V0TA 3NVTA 3V75A 3LXBA 3MMTA 2GQ8A 4X9SA 3MBDA 1HO1A 3HGSA 1TREA 3W7CA 2VEPA 1B4EA 3THQA 5D09A 1CX9A 2ZZ4A 4JS3A 2CLLA 1L6WA 1L2UA 2R14A 1KFEA 4IMDA 1X7FA 4Q33A 3LX9A 4RZ6A 3C2FA 3MP3A 1OYCA 1JJKA 5AC8A 4NXKA 4ZQMA 4AWUA 5AC7A 2EGZA 1PL9A 3G1VA 4RZ5A 3GAYA 4K7VA 3SR7A 2O7QA 2XFWA 5D02A 4QISA 2R91A 3UD6A 1GPWA 3FFSA 3LCWA 3W2NA 2R94A 2NUXA 2CLMA 4DXVA 3E0IA 2ZBTA 1X1ZA 3S8HA 3UYCA 1UCWA 3NL5A 2RDTA 1OFRA 1U5JA 4RK8A 2B7OA 3PY2A 3MI2A 5D03A 5DLCA 4JYFA 3ZWSA 4RX0A 4AWSA 3GDTA 4YXGA 1H7OA 3DFPA 3HF3A 3SI9A 1K7FA 1XXXA 2ISSA 1TO3A 1EP1A 1FDYA 2CWNA 1QR7A 1JCNA 1KLYA 3LM7A 4ZZ9A 3P81A 4GUJA 2CZFA 1T0OA 3NXFA 4CCCA 1SSGA 4Z0SA 1K3UA 4OGZA 2NXHA 1LLZA 2V5LA 1XM3A 2WNNA 2P0OA 1SW7A 1WV2A 3CT7A 3HPZA 4FNUA 4FEZA 3O63A 4EF8A 3TNOA 1A53A 1P1XA 1GT8A 3QH2A 3KXQA 4XWUA 4KFNA 2ZRZA 1ZJIA 2GOUA 3T44A 4AMAA 3BGJA 2Q8ZA 2OX1A 3I68A 3PVFA 2HS6A 1OFOA 1GVOA 4LVDA 3W87A 5BOOA 2E09A 3UPBA 2Q3OA 3OVQA 4HPJA 3IVTA 1UASA 1GYNA 1I2OA 3HGRA 4A2RA 2PC4A 1WXJA 2A6NA 1CI1A 2DZVA 3ABSA 4FXSA 2WQPA 4RKAA 4AVFA 3S0CA 1H1YA 2VFDA 3NQ8A 2B4GA 3PWAA 3LCFA 2FJKA 3Q58A 4O10A 5F2GA 4K37A 4JY8A 3MWAA 2H6RA 4CNNA 2YGYA 5AFDA 3W22A 5C54A 5K2ZA 2NV1A 5G2IA 3GVGA 3DFOA 4QNWA 4CCDA 4AH7A 1NSJA 3QMSA 2X1UA 3GXNA 4O14A 5CPOA 3OIXA 4HNUA 4FNTA 3W86A 3O16A 2VFEA 1TIMA 4WQ6A 3LCIA 5CG7A 2JKAA 2QJGA 3LDVA 3VCRA 4DO5A 4IOTA 4MY1A 5DY3A 3W7OA 2JK2A 3CIXA 5KINA 3EWYA 3W7KA 5C5YA 4ADSA 3THAA 1AK5A 4OHQA 1AG1O 5D05A 3HG5A 1DVJA 3STEA 4ADUA 4LS1A 1LBLA 4N9EA 1TV8A 4JX4A 2WOQA 4UC5A 3Q37A 1O5XA 2ZRUA 1QO5A 3S5NA 3DU0A 2H8ZA 1LRTA 3W7LA 5FEWA 1FXPA 4ONVA 4UFHA 4NU7A 3LLDA 3W7GA 3EXRA 1SZEA 1JRBA 1FCQA 1EA0A 2G95A 3L2IA 3IRDA 4XKYA 1BKSA 3GDRA 4JX5A 3R89A 2XN0A 3PB0A 1O5KA 4X22A 4FIRA 1VYSX 2ABBA 5HR7A 5CGQA 3BW4A 3G0UA 4X3ZA 4AHQA 3VNDA 4UTTA 1FBAA 5F4SA 2IQTA 4JTTA 5H2ZA 3Q2DA 4OWGA 5CZ0A 1A5SA 3M0ZA 3I7RA 3KAOA 3DKLA 1YDVA 4AAJA 3L0KA 3LI1A 2NUYA 2F84A 1LLWA 1H7NA 3DBPA 1R30A 2I1OA 4RXGA 5D2YA 1DJNA 5F2IA 2DZPA 1C8VA 1G67A 2CZ5A 3TROA 3PSWA 4OE7A 5LHEA 3PBUA 4AHPA 4JNMA 1VCVA 4PC8A 2CLEA 1TPFA 1YXYA 4GFSA 1IXQA 5D38A 3DXIA 1EPXA 4MYXA 4JTFA 2W79A 4J9JA 4KWVA 1QOQA 4Z1AA 3BK0A 2Q3RA 4O15A 2VOMA 3B06A 1KFCA 5FI8A 2JKPA 3EX6A 4JTUA 1LZOA 3H54A 4MKNA 4N9DA 4OU1A 3S9YA 4S2CA 2DP3A 3B0UX 2H90A 4ZMGA 3EWZA 2NX9A 2QUUA 2BTMA 5HUPA 1LDCA 5DBUA 2QCDB 2CZDA 3S1XA 2E68A 3P62A 1W3NA 3G1XA 1YLVA 2VXNA 2RKXA 4OV9A 1THFD 3VFLA 3LHZA 3ABOA 3LLFA 1X1OA 2NX1A 4UTWA 1TYGA 4O0KA 1F76A 4MYAA 4UFMA 4IXHA 1FCBA 3SFKA 4N4QA 4XTIA 1EEPA 4BR1A 4M6VA 2V30A 1L6YA 4QITA 2QJIA 3QEZA 3A5FA 3K30A 1RPXA 1R2TA 3BV4A 2J6XA 2YSWA 4Z1DA 3JS3A 1B3OA 3IVUA 4KKXA 1GEQA 3P5YA 3ZR4A 3KHJA 3NQ7A 5HWJA 2J9XA 4U28A 3HGJA 4N6EA 3FOKA 2QF7A 1I2NA 3SJ3A 3TUUA 3MBFA 1L9WA 2ZZ5A 2ZZ6A 1RD5A 3NNTA 3NQEA 1JRCA 1XDMA 4I9AA 4NNAA 4K6AA 3P84A 5I3JA 3L66A 2V81A 1TQXA 1H62A 2ALDA 4YWIA 1YXCA 3NM1A 3DZ1A 4BWLC 1H5YA 3LRMA 1F74A 1TJRA 4DF0A 4DPQA 4BI7A 3P74A 3FLUA 3LHUA 1G4TA 4S1FA 4UTTC 3NPWA 1KBIA 2Z2UA 1MO0A 1F05A 4GUFA 1DJQA 1WDWA 4HKPA 3CHVA 1UJPA 4UXDA 1O94A 4X2RA 2Y63A 4O1BA 1FWWA 1JCYA 3SSJA 3NQ2A 1W1ZA 3TSMA 4A29A 3B0PA 2A2IA 2VFIA 4H6KA 1SO6A 4NX0A 3MHUA 1OG0A 5G1YA 3RLUA 1KFBA 1GG1A 3W7DA 3NZ1A 5CZTA 2H3BA 4JEQA 4WZHA 2Y7DA 3TW6A 4EIVA 1F2JA 2B7PA 3FEMA 5ABTA 3P80A 1SSDA 3UXAA 4MY9A 5HWNA 3TMLA 4IX0A 1FWNA 4HT3A 3KRUA 3M5VA 4JY9A 5E93A 3W1NA 1W3TA 3P61A 1IXOA 4QNEA 1K02A 4NJKA 1BWKA 3NDOA 4UTKA 2FPTA 5DBTA 4GC4A 3B03A 3UXDA 2V2HA 2YZRA 1ICQA 1VYRA 4N9BA 1OABA 3AO0A 3GKFA 2B7NA 4MLRA 3N73A 3RF9A 4K8EA 4ML9A 3W83A 5L6UA 1SO5A 1K7EA 2C3ZA 1VJIA 2ZA1A 3C4UA 1ZAHA 3GXPA 4BI5A 5HINA 3PUDA 2VENA 3AJXA 2J27A 1AL8A 4BF9A 2QCDA 3KX6A 4N02A 4R34A 4ZL1A 1G7VA 3UY7A 5TQLA 4MY8A 4UUIA 4NX5A 5CPLA 4DF2A 1AL7A 3ABRA 3G8RA 4PH6A 1QPQA 4LW7A 3FA5A 3WK1A 3M47A 1TRDA 3WJZA 3MW7A 1BEUA 1SZFA 4NJIA 3L0NA 1ZAJA 3P5ZA 1GOXA 1N7KA 3SY5A 4YL2A 1VH7A 3QQ1A 4IXXA 4PODA 4R53A 1R2RA 1EIXA 1TPVA 2QKFA 1QWGA 3TE9A 4FX7A 1EP3A 2FB3A 1K03A 4LU0A 3W7JA 3LERA 3O07A 4O13A 5LKYA 1JCLA 4JX6A 4B5NA 3HG3A 3ZFHA 2TRSA 2J24A 4U4MA 2TPSA 2DZTA 1ZHAA 4HNVA 1W3IA 1N8FA 1VCFA 2QCCA 2RFGA 3BARA 4LV4A 4IJBA 2OT1A 1LOSA 2BZNA 1KV5A 3TFCA 2OJPA 3LCHA 3FJLA 3W71A 4O28A 4FNQA 4XBKA 1GQNA 4AXKA 4JTLA 4CQ9A 4UTMA 3WJSA 5F2MA 2HSAA 4IPJA 3W72A 3LRLA 3W2UA 1D9EA 3P82A 5CPMA 4UCGA 5AOUA 5K3VA 3W88A 3H53A 7TIMA 5EBUA 2Y61A 1YTDA 1P0KA 2Z1BA 3MJYA 3UQNA 4O1AA 5FEXA 3TMQA 1Z48A 1SZNA 3WJYA 1EUNA 3IIVA 4I7UA 4LUJA 4KFOA 4Z08A 4C1LA 5KSWA 5FF3A 5I3FA 2DORA 3QW3A 4LVBA 1TPDA 1PS9A 3TC7A 2NUWA 2NWSA 1S3HA 3GNDA 5A5WA 2VEKA 2V2DA 5J5RA 1H7RA 4YLWA 1VYPX 2F7FA 1TPEA 1OYBA 3KRSA 3G18A 3SIZA 4JGDA 2P10A 5D30A 5F1UA 2AGKA 1Q45A 1SW0A 2VFHA 3USBA 3NG3A 1K8XA 1WAUA 2WO5A 1XBVA 1T8XA 1ME7A 1GVQA 1UB3A 3C0JA 3DFTA 2EF9A 3VI2A 3Q94A 3EEGA 4PEKA 1X8FA 1H7XA 4NZJA 3BG9A 2ZRWA 1ME9A 4LVAA 2NV2A 3HGOA 5I3HA 1GZGA 2VFGA 3W23A 1H60A 4BWLA 3MYPA 4MZYA 2Y70A 3GLCA 1TPH1 3T4CA 3ZS4A 5K9XA 2OMAA 1VHCA 3L0GA 3GR7A 2X1TA 4IMFA 5C2XA 4GUHA 5LNVA 1TSIA 3PBWA 2AQWA 1OK4A 4UTJA 4E38A 3QW4B 1WA3A 3LBMA 1F73A 1T96A 4O18A 3ZWTA 1VS1A 4C1KA 5I3KA 5KZEA 5IM51 3E96A 1LOLA 1OHLA 3G0SA 1DBTA 3EKZA 1O4UA 4IUOA 2GQ9A 1V7YA 1NVMA 1CW2A 1W5NA 4Q32A 4JYDA 5EL1A 3L9CA 4A2SA 3O15A 4IMGA 3DI1A 3M5YA 4DPPA 3QRHA 1KM6A 3L68A 5TBOA 1A50A 1BTMA 4LY8A 3N3MA 2Y85A 4ZQRA 5LNWA 4KFPA 4E2BA 1SFJA 3P60A 4GE8A 3F1QA 5CZJA 2CLIA 4PFMA 1VLIA 3BPWA 4POCA 4GRSA 3TU9A 2TSYA 4JN6A 1YDNA 3EX3A 2H8XA 3C6CA 1IIGA 2YCEA 1FCVA 3W1MA 4QQ3A 3W07A 5KITA 1J2WA 4G1KA 3PAJA 3HB9A 2BLEA 2A4AA 1G6CA 1JVNA 3LOTA 5BMXA 3GK0A 5DN1A 3RLVA 1EX5A 4JDYA 2QDGA 3EX2A 1TMHA 3WK2A 4AF0A 3CWOX 2VC6A 3STFA 5K9DA 3W6YA 6TIMA 3DHFA 3B8DA 1OYAA 3GYEA 2DJLA 1LP6A 5EMUA 3NL3A 3IGXA 4WXZA 2YFOA 1D3HA 1ZCOA 1K7XA 3PBVA 3IIXA 3IIZA 3IVSA 1P4CA 2QCGA 4HHPA 3TXZA 3N9SA 5D2VA 3NQMA 2QDHA 3FKKA 3DFNA 2C6QA 2CFFA 2KZHA 2RH9A 3RMJA 4IWWA 5FEZA 1XL9A 3S1UA 2DZUA 3PUEA 5K4XA 1VRDA 4KWWA 2C14A 4IQLA 3NA8A 4TX9A 3W1AA 4JTIA 1K8ZA 4WY0F 3D0CA 5EPDA 1MXSA 1GVFA 4ZVJA 5LNRA 3I6RA 3S1WA 2E6DA 4TMBA 3BLIA 4IMEA 2FB2A 3LI0A 4DQWA 4WXYA 3UWZA 4IPIA 4FB7A 5D04C 3U8GA 2Y89A 4LVFA 2ZZ2A 1V5XA 2P1FA 4L4MA 4O8RA 2HMCA 1G4SA 1F7BA 2Y6ZA 4LS2A 4HIBA 2Z6JA 4OBTA 4Y96A 4D2JA 5AHLA 5LSMA 3L67A 3C61A 1ALDA 2WNQA 1W5PA 4M19A 5AN7A 1JCMP 1VCGA 2YDAA 4WY0B 1LOQA 4BK9A 4UMCA 3R8RA 2WJZA 1Q6OA 4BFAA 2QCHA 3CM4A 4ALDA 5K4ZA 1ML1A 3OBKA 1LCOA 1WBJA 3LB0A 3DFSA 1H7PA 1GYLA 3QM3A 5J5DA 1OF8A 2E1DA 3W2JA 3HO8A 3PM6A 1KBJA 2QCNA 3U2OA 3BLFA 1JUBA 4R7JA 1Q3NA 5SWUA 1EB3A 3F03K 1DL3A 1RQEA 5F1VA 4JXCA 1ZALA 3TSDA 3C2EA 3IEBA 5CKSA 5KTLA 2V9DA 4TU1A 1K8YA 1BWLA 4UR8A 5IBXA 5AYYA 3G1HA 2WNZA 3W7HA 1VZWA 1FWSA 4XZ9A 4O16A 3OVPA 3W7IA 4JTJA 4ZQCA 4N4PA 5TIMA 4UMBA 4LTSA 3GDMA 2RDWA 2A7NA 2ZTKA 4K36A 5BNKA 1TPC1 1IIHA 1M6JA 2C15A 5AHEA 4O57A 3QSTA 1C9DA 1J5TA 2Z6IA 2C1HA 4BI6A 1I2PA 2PURA 3EWUA 2X30A 3N2XA 3CTLA 4DEFA 4JIQA 5F4XA 1OVDA 1KTNA 4MOZA 1HFBA 2Y7GA 4PA8A 3LHTA 3UNDA 3W7QA 2ZDRA 5CPNA 3C2VA 5DCEA 5AHMA 3W2MA 1VLWA 2CU0A 4ZQPA 4GJ1A 3QQ0A 3QSRA 2Q8LA 3G3MA 4MJZA 4CCEA 1PE1A 4Y8FA 4EF9A 4TR9A 1I45A 2FTPA 2JBMA 3I7SA 3VE9A 4TO8A 3N9RA 3L65A 1JUKA 3TX9A 1TPUA 3E12A 2ZZ1A 2YW4A 1GVRA 1KM4A 3LHWA 3M44A 2A85A 3A22A 3MUXA 4MJMA 3GX9A 4RR4A 1I2RA 1QDSA 2EHHA 5AYXA 1UBSA 1Z44A 3C2RA 1RQBA 1ZFJA 2YW3A 2YYUA 3B4UA 4HSOA 3UY8A 1QAPA 2XN2A 2NLIA 1KW1A 3W73A 4DELA 3INPA 5AHNA 1M7OA 3W7NA 4O11A 3EKLA 4UTIA 1FWTA 4QSHA 3MO7A 4QAIA 3W3OA 2ZCGA 3MHGA 1VQTA 2PRMA 2YYTA 3SW6A 3BO9A 2FPVA 4LC8A 4WOZA 1JUEA 1MZHA 3IIOA 5A8GA 2CLFA 3C8FA 1KFKA 1B9BA 3NL2A 1C29A 2OCZA 1HO4A 2VEMA 4EVZA 4NT0A 1TV5A 2CLHA 3H55A 1GVSA 4MFEA 2WPBA 3EX4A 2BSLA 4A21A 2BXVA 4OQVA 3TH6A 4FX8A 1YADA 4K7YA 4NZFA 4O12A 3TAOA 2NXGA 4O4VA 3TKFA 1WQ5A 4WY0A 1GWJA 1XC4A 1H61A 3QYQA 4IMCA 3TJLA 3M5XA 4O54A 3U6WA 3NEVA 4LNYA 2V5BA 1ADOA 3UZ5A 4Z1BA 4MPQA 3B0VC 1OX4A 4OT7A 1PVNA 4IGHA 1LROA 2YXGA 4UFJA 2J9ZA 5AB3A 1GTEA 1FUYA 1YPFA 5BW6A 2I9EA 5HNRA 4JIPA 1WOBA 3W76A 5AHFA 4CNOA 3CLMA 2EKCA 1Q6LA 1DOSA 3PF3A 3GDKA 1L6SA 3W2KA 3EWWA 3G1DA 4ZQOA 4DBDA 1TTIA 3FKRA 3PB2A 4CNPA 2DU2A 2ZA3A 3L5MA 3M5ZA 1DQXA 4Y90A 5EKYA 2BWGA 3CC1A 5FF0A 3B04A 2DJXA 3TC6A 5U4NA 5HWMA 3UZJA 1IXNA 1TCDA 4PL1A 3IGUA 3M41A 5LGXA 1H63A 3QZEA 4NUWA 1H7WA 1SO4A 3NOEA 1VPXA 1QNVA 3UWYA 1FCUA 1LTDA 2ISWA 3EXTA 1MEIA 2W0UA 4M7TA 3BW3A 2GVLA 3GR8A 2DZXA 1LORA 3HMJG 2YPIA 2E6FA 2ZRVA 3RFAA 5L9FA 2TMDA 5GVJA 1I8JA 5G4EA 1W37A 1A5CA 3A5VA 1RZMA 2QR6A 3S5ZA 3HPSA 1YTEA 4OV4A 1F5ZA 4QIUA 1B57A 3QMTA 4FHAA 4W9TA 5HUOA 5EYWA 2UV8G 1XBYA 2AAMA 1DKWA 2J9YA 5K7JA 2YFNA 1PCKA 1F6PA 5D32A 4O1CA 4LVGA 3KVLA 4FX6M 1NFBA 4NQ1A 5EA9A 1Q6QA 1OFDA 3W7PA 1XCFA 5C55A 1FWRA 5I3GA 1IF2A 3IGSA 3G1SA 1W5QA 2XN1A 1RV8A 2ATSA 4JDBA 3W70A 3E9AA 3N34A 1JCJA 3IV3A 1JCXA 1HG3A 5DXYA 3WK0A 3UWVA 2QCLA 6ALDA 4UNLA 3TJXA 3W1RA 4CQAA 1HTIA 2C13A 3C3NA 4JTEA 4MUZA 3TV8A 5LGZA 2LLEA 2DZSA 4CLMA 4UTWC 3TFXA 4LWWA 1YYAA 3QF0A 2WSYA 4O50A 4XKYB 1AW5A 1KLZA 5HULA 3LHVA 1H50A 4EOUA 3C2OA 1ICPA 1KFLA 5D2WA 1FDZA 2C16A 2FQIA 3G24A 1FQ0A 1A5BA 3JRKA 4RLIA 2G97A 3BG3A 1WBHA 3ABQA 3P8JA 1MSSA 1OFBA 4O0ZA 5FF2A 1QCWA 3KOFA 3PC0A 4RCXA 1UUOA 3ANYA 1ICSA 4XUGA 2D73A 2ZZ7A 3TSBA 1VGAA 1G4PA 2B0MA 5EY5A 5G2WA 4HNTA 5AYZA 4AHOA 2VEIA 3W9ZA 2GJLA 5E1QA 3CEPA 2E6AA 2QCEA 1OFEA 3P67A 2V2CA 3GZ3A 1N55A 3R2GA 4LUIA 3EWXA 1UUMA 4P61A 2VKZG 4NVTA 3LHYA 4K39A 1XUUA 3BGGA 3MI6A 4QM1A 1G7UA 1W54A 1RR2A 3BW2A 4MFDA 4WUIA 5LHFA 3DAQA 3T40A 4FIQA 1MEWA 1OF6A 3NQAA 5DELA 3EXSA 3NQGA 3W75A 3O6YX 4UMAA 3PUOA 1SR9A 2B7QA 4HN4A 3T78A 1SUXA 3BG5A 3TW7A 2TYSA 1W8SA 1TPWA 1O60A 3HPXA 2FIQA 2X2GA 4XTDA 2W6RA 1RQHA 1TRIA 3SGUA 5KZMA 3LCGA 3CU2A 3G1YA 4RJEA 3PR2A 1QMLA 2ZTJA 1SU5A 3WFAA 3M1ZA 5HMSA 2YX0A 4N6FA 4JTKA 4NNBA 1KM1A 2EAWA 3GB6A 3M43A 4Z1CA 3KVJA 3HQ1A 1W5MA 3TXVA 4K38A 3HG4A 2BX7A 1LM1A 2V82A 4UFLA 3F4NA 5DXXA 4P2VA 1NF0A 2X1SA 4UIOA 1P5BA 4TMCA 2GJNA 3TIMA 2ZQ0A 2J88A 4AB4A 1SZGA 3RK8A 1X6UA 3OA3A 2CW6A 4S2BA 1TQJA 3GKAA 3W1QA 1QPRA 3VE7A 3LV5A 2FFCA 4E0CA 2VELA 1F6KA 1ZNNA 4O53A 4Z0JA 4GUGA 2Z0IA 4GNJA 4WD0A 3G1FA 4M6QA 3TR2A 5G5IA 3NAVA 1NAL1 4MVAA 3IIPA 1YDOA 4R33A 3I65A 1YXDA 3W85A 4Q4KA 3DH7A 3EB2A 4GBUA 4E2DA 3WK3A 2JGYA 3WJWA 4YMZA 1YTKA 4MZ8A 1ZENA 3UWQA 5C6MA 5HR6A 3NQ6A 3CQ0A 4Y9AA 3S6DA 1EUAA 4FO4A 4TIMA 3ATZA 3QC3A 1W5OA 1NF7A 3W1XA 3NGJA 1LRNA 1J4EA 4M6PA 3MP5A 5E0KA 3W7MA 1ONRA 5F2LA 3LRKA 1LYXA 3OHIA 2DZWA 2CLOA 4JICA 1QPOA 3PULA 1VHNA 3QMRA 1FXQA 1GTHA 1KM2A 3MHFA 1OX5A 1T99A 3MI3A 5LZLA 3BLEA 1LBFA 1Q6RA 2ISVA 5HQEA 3TQVA 4UTHA 5MHBA 5T26A 2ZRXA 3DI0A 2CLKA 4FNPA 5LNUA 3C56A 2ZYFA 4A3UA 3A23A 1H1ZA 3LTPA 4NJJA 1XUZA 3R12A 2HS8A 3W7RA 2GVGA 3T55A 5AC6A 4DF1A 3SZ8A 2E5CA 4N9CA 3CPRA 2A7RA 1A5AA 1QO2A 3EX1A 3OVRA 4UTLA 2C18A 1IGSA 1KM0A 4QJ1A 3DHDA 3KFTA 3HJZA 3MYOA 3NM3A 5DY2A 5FESA 4O4WA 4LS0A 1QFEA 2A21A 2H3DA 1RVGA 1AW1A 4UFIA 1R46A 4O19A 1DORA 2OZ0A 5BRBA 3V1PA 2EPHA 3PG8A 1G69A 2QAFA 3STGA 2ZZ3A 1YPIA 4FNSA 1R2SA 1ZY9A 2ZFAA 3LCXA 3TA6A 2ABAA 3O6DA 2QEZA 3S5OA 4M7SA 1S5TA 1Y0EA 3HG2A 4ORIA 3RU6A 3GNNA 1Z42A 4PTNA 1FX6A 1TTJA 4PCFA 3A9IA 3KRZA 3TDFA 2NX3A 5G4WA 3LGEA 4LC6A 1VR6A 5D33A 3NL6A 3UWWA 3A21A 1AMKA 1HL2A 4DBEA 3OG3A 2HTMA 3SECA 3W84A 2GQAA 1I4NA 2Y7FA 3KVKA 2A0NA 3NQVA 4M5PA 5D2XA 4O17A 3TQ0A 3TK7A 3W1PA 3N2MA 3M16A 3L5AA 3QJAA 5BMWA 1HUVA 4XQ6A 1W56A 3W1LA 1SW3A 5FEPA 4UTUA 2Y62A 3LXAA 3FS2A 1TV7A 3CB8A 2GVJA 3DGRA 3TAKA 3NYZA 4JTSA 2A5HA 5FF7A 5CZSA 3WJXA 2E77A 4WJEA 3GDLA 3O05A 4UNKA 3G1AA 3FYOA 4L4LA 3CWNA 3NO5A 2V8ZA 1E51A 2JKEA 1VC4A 2I14A 4NJHA 3FIGA 4ADTA 3W1UA 4DO4A 2PCQA 2O7SA 2PRLA 3ELFA 5LNSA 2E5DA 1OK6A 4JR5A 4DO6A 3HOJA 1OFQA 2A7PA 3S42A 5CSSA 8TIMA 4JTGA 2WKJA 3QPZA 1JQVA 2ZRYA 1XBXA 3P8IA 1AW2A 1U83A 4AWTA 3LV6A 3UPWA 3SGZA 2Y7EA 4GWEA 5IBXC 4FNRA 4O1DA 1M7PA 4YCPA 5DCDA 2NWRA 1KFJA 1GJPA 2CZEA 1FY6A 4A22A 5D37A 5D2TA 2X1RA 3A24A 3G22A 2VFFA 1IXPA 1D3GA 3OEXA 4IX2A 4LV9A 1FDJA 1OX6A 2G96A 2PRHA 4JTHA 1MEHA 2QCFA 4WX2A 1PCWA 3N19B 4MLJA 4LRTA 2GUUA 3G8EA 5F4WA 4HSNA 4K8HA 5KMYA 1LRQA 2C19A 3B05A 3NQFA 4H3DA 1SFLA 1WOAA 4YCOA 1SO3A 1KA9F 1W31A 3QFEA 3O8AA 1OJXA 2FLIA 3LCLA 2NZLA 2X16A 1ME8A 4HPXA 3W2LA 4LT9A 1EWEA 4NXSA 3PBYA 4JYEA 2ZA2A 4FXRA 4H4IA 1S5VA 3M9YA 3ATYA 5CSRA 3VKJA 2OT0A 4ICNA 4LRSA 3FYPA 3T7VA 1TJPA 1JR1A 3W1TA 2QAPA 3FJ6A 5AHIA 3C52A 1S5WA 3R13A 3PS7A 1PV8A 3PSVA 2R8WA 4JD4A 2A6LA 3NPXA 1W0MA 2Y88A 1WYIA 4LOCA 3TQKA 1TPB1 2QUTA 2RHGA 2WSRA 1NEYA 3LBCA 1R47A 4I7VA 1LBMA 1I2QA 2E5BA 4NJGA 3DENA 5KZDA 1JULA 2RDUA 1KTCA 4Y6GA 1H51A 3R5EA 4EWND 1KM3A 3O06A 3P7YA 3STCA 5G1TA 3W7EA 1KM5A 1OFAA 1PHQA 1JQXA 1SPQA 3E49A 4AF0B 2QCMA 2A1YA 4UR7A 4UFKA 4AEOA 2FPYA 2ATMA 1TTPA 3NZRA 4ORMA 3M7WA 4PL2A 4MIMA 5H91A 1GG0A 3N14A 1OFPA 1O95A 1QPNA 3L21A 1XI3A 3LXCA 1OX4B 5DCBA 3HIJA 4NNCA 3TCEA 4GUIA 3W74A 4I7WA 1KV8A 3O1NA 1EP2A 4MZ1A 3RNDA 1QOPA 3GXTA 4XBSA 2QJHA 1PHWA 3NPVA 1TB3A 3QPYA 3GIYA 2YR1A 1DHPA
chains in the Genus database with same CATH superfamily
2DQWA 1P7TB 3MS8A 2W27A 1DQWA 1MMFA 3NQCA 2FVMA 3SBFA 2I17A 4D6FA 4GO8A 2ACQA 3CIWA 1UZ1A 1G4EA 2W4XA 2QUVA 1HZYA 1JYWA 2ZICA 1QU4A 3RCNA 1P48A 4IPPA 5ECUA 3BLOA 3G0XA 4DJDA 4DAFA 4AQLA 1UP0A 3GS6A 4RV8A 1TE6A 2GK1A 3EDEA 3OLEA 1YBQA 3MUZ1 4GI8A 4PMXA 2PE4A 1PKLA 1TZ9A 1Y5XA 3YPIA 2CZVA 1CENA 4RXFA 1FWDC 3WBEA 3BVJA 1EJXC 5EFDA 1XFBA 1EBGA 1DV7A 1R8LA 1WX0A 3TYCA 5DMNA 5JU6A 2XFRA 1D7KA 4BHYA 4C91A 3AMCA 1M3UA 1A5UA 3AS2A 3E02A 4M82A 4N2YA 2G4FA 3REQA 4GI9A 3LXBA 5E9XA 3THQA 4U33A 3MB9A 2J7CA 3V3WA 1KXVA 3MVIA 1DIOA 2R14A 4IMDA 1X7FA 4Q33A 4ZOBA 4RZ6A 3C2FA 1JJKA 5AC8A 4LB4A 3L4VA 4NXKA 4ZQMA 3U4FA 5CLWA 3G1VA 3SR7A 2E8YA 4KMQA 3OLIA 3D3FA 1V77A 1R0MA 4WK9A 3UF9A 3M6DA 3OP2A 4WGHA 4LBSA 1VFLA 3DDMA 5DRCA 3D5HA 3S8HA 1ZSXA 2NQ5A 7REQB 4W5UA 4MKSA 5D03A 3GD6A 2WPGA 3UR5A 3ZWSA 5H1WA 3WH5A 3HF3A 5IXEA 3WQ8A 1K7FA 3WSUA 5CC6A 3LPPA 4QEEA 1QR7A 1JCNA 3LM7A 4PULA 3KS5A 1VFMA 1K3UA 2Q6ZA 3F2CA 1UD2A 2V5LA 4Q7IA 2NQJA 2P0OA 1WV2A 2DVUA 4IIGA 1EGVA 4EF8A 4PUMA 4J3SA 4Y9OA 4PE8A 3KXQA 4XWUA 1ZJIA 2GOUA 1TJ0A 1H09A 3GQYA 3S2JA 3W87A 4C6IA 3H2EA 2ZXQA 1DJWA 3QC0A 2NVCA 2PDPA 3IVTA 1UBPC 1UASA 4YYCA 4A2RA 4B3ZA 1WXJA 2UY5A 2DZVA 3ABSA 4FXSA 4RKAA 4PB4A 1GQJA 3S0CA 3TYZA 2VFDA 2ZX5A 2DVTA 1F07A 2INZA 5E0CA 3E2VA 2B4GA 1AD4A 2V3GA 3QY7A 2I7GA 2H6RA 4CNNA 2YGYA 1TIWA 5C54A 1QNSA 5K2ZA 3OVGA 5G2IA 3L4UA 3BC9A 2OEMA 2VTFA 1NSJA 2X1UA 3GXNA 5CPOA 1S5NA 4KBXA 4HNUA 3MSGA 4J3UA 2JKAA 5AYBA 2X40A 2QV4A 4IOTA 3W7OA 3CIXA 1MW2A 3EWYA 5FCZA 1NWTA 5D05A 4YWSA 3L4TA 4LALA 1VBGA 1XX1A 1DJIA 2WOQA 1R3RA 4XIAA 3Q37A 1O5XA 2ZRUA 3M0MA 3S5NA 2R1LA 3DU0A 3ZR6A 1LRTA 4ONVA 3NJ3A 4UFHA 1HL8A 1RUSA 3H6OA 1OM0A 3ANVA 2DSWA 3OODA 7TAAA 3OYZA 1YMYA 3F4DA 4D9PA 3G2GA 1O5KA 1VPYA 7PTDA 4AHQA 3G0UA 4X3ZA 1HIZA 4RDVA 4ZTXA 3WLJA 3QR0A 1J96A 1WZAA 4JTTA 1I0BA 1ZBWA 1PX3A 3QV9A 3I7RA 3S2MA 3KAOA 2VWTA 4WJ8A 2V5JA 3L4YA 2WJDA 1XLLA 2YZ5A 1E6QM 2GSEA 2NUYA 1LLWA 1T5AA 1H7NA 1TVPA 2I1OA 4F66A 4RXGA 1DJNA 1XRSA 3SCUA 1V6WA 2CZ5A 3TROA 3PBUA 3UCDA 4PC8A 2CLEA 3FN9A 4GFSA 3H21A 1EPVA 5D38A 1EPXA 4HZMA 3B9OA 1QOQA 2XSBA 4O15A 1NQKA 2F2HA 2VOMA 4ZSTA 3WO8A 4GJIA 2WMHA 2YL6A 1ECQA 2WWDA 4S2CA 4G8TA 4E8GA 4HCDA 2GZXA 2W91A 2CHRA 4ATDA 3LENA 4S3FA 3OZPA 3RR4A 4TTGA 3S1XA 2E68A 1F61A 1LT7A 4ROPA 2VXNA 2RKXA 4OV9A 4MWAD 3VFLA 5MKGB 1GKQA 2NX1A 4UTWA 5C0QA 1F76A 4HN8A 2VD8A 2BODX 5CEWA 1PKMA 4QG6A 3VX0A 4QJ4B 1EDQA 3B9AA 3E0VA 1CTNA 1UD5A 2DZAA 3ZSSA 3UJ2A 3A5FA 1QTWA 1RPXA 2J6XA 1XLKA 2WZMA 3RX3A 2A3HA 3IVUA 1GEQA 3VKCA 1RD6A 1VFHA 3KHJA 3NQ7A 2J9XA 4U28A 3AHTA 3KOYA 3OLDA 3TUUA 1BGAA 5JIWA 8XIAA 3PPFA 1DE6A 1RD5A 3M0XA 3AMLA 4CEUC 4LAUA 4HMCA 1H62A 2DIKA 4YWIA 1E3XA 3DZ1A 1AJ0A 3LRMA 5T9CE 1TJRA 5CC5A 4RNJA 3RJYA 3P3BA 4J28A 1OBAA 1K6WA 1TJ2A 1F05A 4GUFA 4BQ2A 1WDWA 1V4YA 2Y63A 4KWOA 2OGYA 1W1ZA 4R5EA 2ZXAA 3WG6A 4H6KA 4PSPA 3AXIA 1UP2A 2JF7A 2WXDM 3NZ1A 5CZTA 4JEQA 5LIXX 3E0LA 4L6OA 3TW6A 4FPSA 3MZNA 1J79A 2W92A 1DWJM 4B90A 3FEMA 3MZ2A 5ABTA 4Y7EA 5FACA 4QEHA 4IISA 3ALGA 3W4RA 5HWNA 5CLTA 1Q4NX 4UZSA 2CESA 1IXOA 2PDWA 1X98A 2OWWA 2Z25A 1QT1A 2X8RA 2JALA 2YZRA 1ICQA 1VYRA 4N9BA 4B2DD 3AO0A 2B7NA 3C5QA 3N73A 5AECA 3W83A 1XH2A 1VJIA 1E4IA 3C4UA 4V1YA 5HINA 3V0TA 3MSYA 2VENA 1TR9A 1JPIA 4C6MA 1AL8A 2QCDA 4QG8A 4PUEA 3WEMA 1CB7B 3DHPA 4H9XA 3UY7A 3NUKA 3PZVA 4UNIA 2ZUWA 2WVVA 3ABRA 4RPPA 4NL1A 4QCFA 6PTDA 2VZOA 3ALFA 3WLMA 3OA5A 1AH0A 2VC9A 3WJZA 1TRDA 3UU0A 1SZFA 3SURA 1EA9C 1D8WA 3QHOA 4MJ2A 2UY2A 3N29A 3QQ1A 4R7OA 3QHNA 4IXXA 1W9DM 1J0KA 4W7WA 1ZJBA 3L12A 2QKFA 3ZJKA 1QWGA 3TE9A 5IFTA 2Z7KA 2G3FA 2FB3A 3H4XA 1K03A 2WLZA 4LU0A 3AIEA 3IJDA 3POHA 3B9DA 1HT6A 3Q65A 1IV8A 5LKYA 1JCLA 4JX6A 1R3SA 3HG3A 4C6CA 4DIAA 2PDLA 2CKRA 4K3ZA 4HNVA 4QBXA 3GU9A 2QCCA 4IJBA 4YS1A 4AY7A 5B7YA 2P0IA 4MKVA 3SM0A 3I6TA 4XBKA 1GQNA 5T91A 4NZCA 1TV4A 2Q02A 4JTLA 1V6YA 4CQ9A 3NQBA 3P6LA 3OIHA 5F2MA 1XLAA 4PMUA 1KXQA 1P0EA 2DSVA 5CPMA 2DY3A 3ISIX 3ARQA 3H53A 7TIMA 5C70A 1YTDA 3TMQA 3PFMA 1E1FA 1EUNA 3GW0A 3IIVA 3BSHA 1ZJAA 2DGAA 3QZ6A 4LVBA 3CK5A 2XUCA 4S3KA 1S3HA 2NSOA 3U5YA 1W1PA 2VX5A 1H7RA 4YLWA 4ZOEA 2QPSA 3ITOA 1WE5A 1XF0A 1SW0A 2VFHA 3AZRA 4GH1A 1DIDA 1VBUA 2CXGA 3C0JA 1T8XA 2PA6A 4J3XA 1J01A 4QRNA 2W61A 3Q94A 2XVPA 4PEKA 1X8FA 2X0YA 4H9MA 5JMUA 3GIQA 4OFCA 4NZJA 3T42A 3BG9A 1MRAA 2ZRWA 5I3HA 3GU2A 1E1CB 2BGNE 3AI0A 2QXWA 4WF7A 1R7OA 3GLCA 1MUWA 1TPH1 3HQOA 2OMAA 3ZMRA 1VPQA 4U5KA 4U3CA 5C2XA 4GUHA 5LNVA 4E38A 1NM9A 2PWGA 3QLLA 3QW4B 2QPXA 2VEFA 4PMQA 4HYRA 1JFHA 3T4WA 1KGWA 4MNJA 3BSGA 1BXBA 1CW2A 4JYDA 6XIAA 1CB2A 4LFYA 4F2TA 3DI1A 4DPPA 1KM6A 2MNRA 3AS3A 1BTMA 3N3MA 4LNCA 4HYVA 3IRSA 1VLIA 4POCA 1OGGA 2BP1A 3C6CA 1IIGA 1FCVA 3W1MA 3W07A 3BMVA 3B3DA 4G1KA 3HB9A 2VO5A 4FR1A 1TUFA 3LOTA 3GK0A 4GYKA 4GZEA 5DN1A 4F0RA 2QDGA 4C7FA 4AF0A 3W6YA 4D1IA 3PZOA 3DHFA 3ES8A 3NL3A 1B31A 1ZCOA 3ZYZA 3VGGA 3IIXA 3IIZA 3VM5A 2GWNA 2ZE3A 1P4CA 3MCMA 3TXZA 4GGBA 2QDHA 1SJBA 2ESCA 2KZHA 3WEOA 4D6HA 3N6QA 4ZTYA 5HA7A 2DZUA 5K4XA 2PTZA 3FK4A 3GC2A 2SFPA 4TX9A 4WY0F 4J4KA 3I6RA 5T9BG 3CNYA 5C7HA 1C8QA 3BLIA 1EJUC 1E70M 1MXGA 4WXYA 2HVOA 2WVUA 3TN3A 2Y89A 4LPCA 2WMIB 4CQDA 4L4MA 2P1FA 2HMCA 4EX4A 1G4SA 3O0KA 4HIBA 2PGFA 3EBVA 4YVPA 4OUIA 2DDXA 3L67A 3C61A 5A69A 4TQTA 1VCGA 4Y2WA 3ZJ6A 1OWQA 3R8RA 4HZ8A 2QCHA 4ALDA 3D6NA 1DJGA 1HXJA 1VD6A 4IPNB 3TP4A 1GYLA 3QM3A 2WWCA 4EANA 3HO8A 1NWSA 2HK0A 4JFVA 3U2OA 1PIGA 3FX4A 4KGJA 1DL3A 1W3HA 4RDYA 5DT5A 2CBIA 2HE8A 5E9AA 5KTLA 5IBXA 4URIA 1RLCL 2PDQA 5FOOA 4WSHA 1HJWA 3OVPA 1OZQA 3O9NA 4ZQCA 2QUMA 1UWSA 3BGAA 4LTSA 1PX8A 2UZ9A 4I9JA 4AZBA 1TPC1 5GQBA 3CQHA 4ACYA 1M6JA 4V33A 2P53A 1C9DA 4FOJA 2X30A 3DN5A 4UQAA 1C90A 4PBFA 1EXPA 3BV7A 1AQHA 4GLEA 2PWUA 4P7OA 1ISWA 2BDQA 4RNFA 1LG1A 1LT8A 2ZDRA 1CGUA 2CU0A 1ECEA 4XZNX 3G3MA 4MJZA 4Y8FA 1OADA 3I7SA 3LK6A 1E4NA 1V0NA 4TO8A 3ZQ9A 2DW7A 3UERA 2VNCA 3TX9A 2XWDA 1KM4A 1XPGA 4W89A 4UOQA 1LWHA 1OCJA 1FKXA 4L80A 3FVMA 4MJMA 4K1GA 5M17A 1W3KA 5GNYA 3VOGA 1YNPA 2YYUA 2BGSA 2YW3A 3F7JA 1M7OA 4GVFA 3EKLA 1FWTA 4W86A 3K4AA 1A3HA 3MHGA 1VQTA 2YYTA 4Q4OA 4WEVX 3ITVA 2FH8A 2HV5A 3OB8A 4WOZA 1JUEA 1MZHA 1OINA 2R1KA 5CH9A 3JZEA 1GQKA 3B8SA 3QXBA 3SCNA 4Q7BA 4Q22A 1AH3A 3N18A 5IRPA 4MFEA 2WB5A 1EZWA 4EKJA 3EX4A 2O9RA 3WD1A 3CUHA 2BXVA 4OQVA 1CDGA 3TH6A 1JD9A 3SCWA 3CUIA 4FX8A 4K7YA 4O12A 3S9IA 2G0WA 1CNVA 1XIIA 1UQYA 1VIWA 3OBEA 2OO6A 2QZRA 3UNTA 3U6WA 2NSXA 1RP8A 1ADOA 4OOUA 4MPQA 3C86A 3MANA 3NZQA 2GOKA 1X8CA 1PVNA 4IGHA 5AZ1A 3HQPA 2YXGA 3W53A 5AB3A 4F8XA 3QOMA 3WQCA 1RCOB 2VRQA 4JIPA 4H9UA 3T81A 5AHFA 2EKCA 4F0KA 2V38A 1E55A 5FJUA 3WLPA 4X2PA 1XHGA 2IXUA 3FKRA 4NILA 4CNPA 1ZU8A 1BKHA 1G9HA 1TA3A 2XIMA 1BF6A 5AY7A 2XIJA 1TMQA 2OYMA 4B5WA 5C9XA 3B04A 2GDQA 2GSJA 5HWMA 2PTWA 4DYEA 1TCDA 4CQBA 3KWSA 1RHCA 3PP7A 1H7WA 3QKZA 2TODA 1GORA 1YE4A 4PTDA 1OT1A 1XYZA 3GXFA 1FCUA 1LTDA 2ISWA 3LPOA 1R85A 2AMXA 1GJWA 2GVLA 1TWWA 3GR8A 2DZXA 3HMJG 2PDJA 3MPGA 3TTEA 1A4LA 4E8CA 4OTKA 5GVJA 1I8JA 2GUYA 4YYFA 5A8MA 1RZMA 3HPSA 1V08A 3LGGA 1YTEA 3BLLA 4QIUA 2FTWA 4FHAA 1CCWB 1GYMA 3DG6A 5HOSA 5MF5A 5TF0A 3XINA 1ZBCA 3KBNA 2YFNA 4KEZA 4O1CA 5D32A 5AYIA 4W84A 4ECLA 3POCA 4NQ1A 3W0KA 2J7BA 2REQB 5C55A 1OZMA 1B3WA 5C9RA 5I3GA 1EDTA 3E9AA 3IV3A 1QNPA 2ZWYA 2O0TA 3WK0A 3WLTA 4H7ZA 6ALDA 3FV9A 2ALRA 3R10A 3LEPA 3DIPA 4GMEA 2LLEA 4LWWA 1J0HA 3THCA 3AXHA 2Y5EA 1KLZA 3CZJA 5HULA 4FR6A 3VM7A 4LUSA 2C16A 3TZNA 4RLIA 2INFA 3P8JA 2OWXA 1D8CA 4O0ZA 5FF2A 1HJVA 4WDWA 2E28A 4E6MA 3R0UA 1CXIA 2QV5A 4A35A 3ANYA 2EQDA 4IICA 1KRMA 1HJSA 2B0MA 2PBOA 5G2WA 2CWXA 5AYZA 3PJTA 2QCEA 1E5NA 4OIFA 4INFA 3R2GA 2BASA 3EWXA 4DRSA 4P61A 4B3KA 4K39A 3MI6A 4XK2A 4QM1A 1G7UA 2WJEA 2FZMA 2E67A 2KAUC 5LHFA 1EIBA 4FIQA 4V1XA 1K9EA 2EO7A 5DELA 2NT0A 3W75A 4W7UA 3O6YX 1XYCA 3PUOA 1SR9A 1BFNA 3LD5A 2TYSA 1RA0A 1JG9A 3HPXA 2FIQA 4XTDA 1RQHA 1DHKA 3N3TA 3TONA 3PR2A 1RBLA 4IT1A 3WFAA 4HA1A 2I9UA 3KL3A 3N6HA 3PTMA 2VCCA 3GB6A 3VC6A 3GC5A 4AC7C 3KVJA 3WQWA 3HQ1A 1E40A 3TXVA 4K38A 3HG4A 3OQEA 4YNGA 2CERA 2ZUTA 4ZGYA 4P2VA 1V3LA 2X1SA 3T05A 3PUGA 2GJNA 4AB4A 2DIEA 3PPGA 3RK8A 1X6UA 3OA3A 2CW6A 1A80A 1W3JA 1US2A 5GJNA 3GKAA 4JIHA 2EKGA 3BICA 4E0CA 1F6KA 4Z0JA 3APGA 1XWYA 3MC5A 3PTKA 4IG2B 3G1FA 3GHTA 1BG4A 1HX0A 1RBOB 1M68A 1NAL1 3BE7A 1YDOA 4QX4A 1OT2A 4MGGA 1SM9A 2RAGA 2VMFA 3L23A 4GBUA 3T9PA 4UTFA 2RJGA 3WK3A 3W29A 2I56A 4YMZA 1YTKA 5E5CA 4D6DA 2YIHA 5TD4A 1ZENA 3RM9A 4GX9A 4Y9AA 4UBPC 3ATZA 3BQ5A 2FKPA 3NGJA 1J4EA 4M6PA 3AU6A 3MP5A 4LAOA 1UD3A 3LRKA 1LYXA 4JN8A 1C8XA 1QPOA 5C7VA 1Y7VA 2ZX9A 3MI3A 3W38A 2ISVA 5HQEA 2PDUA 1UZDA 1ZRQA 2KX9A 3TQVA 5MHBA 2PZNA 3UA4A 4DLFA 1V6VA 4BEQA 2V5DA 1E6ZA 4YJ5A 3VKAA 2BS9A 5I00A 3C56A 2ZE0A 3N25A 1PTDA 4U2ZA 4X63A 2XINA 3GYCA 3R12A 5CAKA 2VX7A 3WNOA 3T55A 3SQMA 4DF1A 3E74A 2E5CA 4N9CA 1V6XA 1M1BA 3ARVA 1NIUA 3EX1A 4KH2A 1IGSA 1KM0A 3PJWA 5CGMA 3BAKA 3NM3A 2GDUA 1H49A 5FESA 3VZXA 4O4WA 3A13A 4NZ3A 3R94A 3T8LA 1RVGA 4UFIA 1R46A 2OZ0A 5BRBA 1G69A 3AHYA 3E5BA 1W9UA 1R2SA 1ZY9A 1XISA 4F4RA 4AVNA 1PJ9A 4GQBA 1FWAC 4ORIA 4GA8A 2BY2A 3A9IA 4PUNA 2NX3A 2ISFA 3R6IA 3U3HA 3VIJA 4Z17A 1AMKA 2VHLA 1VFFA 1HL2A 2VGIA 3WF3A 2CITA 1I4NA 3KVKA 3UJEA 3NQVA 1U33A 5D2XA 2VUYA 2WC3A 3GBDA 3R79A 3TK7A 3TQ0A 4KQNA 3RX2A 2PLCA 3QJAA 2DZBA 4I5XA 3IAPA 4NZ5A 5A94A 2Z27A 1GOMA 1MVYA 4UTUA 3FS2A 2GVJA 1V0KA 4IGMA 3NYZA 1UH3A 1BGGA 2E0PA 1WNOA 3NSNA 2J13A 2GFTA 3KL0A 2J8GA 2OEKA 4WJEA 1QI0A 3EOEA 3G1AA 2QW5A 3TC3A 4WSKA 1J18A 1IEVA 3NDYA 4A3HA 3W1UA 2OGJA 4AWEA 4CD8A 1Q2SA 3V4BA 5A2AA 1VFUA 3GG8A 2GWGA 4L7ZA 2A7PA 5CSSA 4XD5A 3QPZA 3MMUA 1JQVA 3FSTA 2P76A 5B80A 3BAIA 4P7QA 3CV1A 4GWEA 3UGVA 4O1DA 1M7PA 3GU1A 4QR6A 2CZEA 4A22A 5BOFA 4QS5A 1XIDA 2ZUSA 5D37A 1POJA 4M6UA 2X1RA 3A24A 4LV9A 1M53A 1OX6A 1KCKA 2PD5A 2R6OA 3MDUA 3G8EA 4DYJA 4K8HA 1J93A 5KMYA 4H3DA 4GHRA 4D6JA 4IP7A 3QFEA 4TVCA 3L2LA 2C8NA 1AD1A 4HPXA 2V3FA 1ENUA 1F9CA 4FLSA 3P0WA 4JKMA 1TV3A 1BPLB 3NXLA 4ICNA 4RW5A 3RLHA 3FYPA 1GNXA 4PCPA 4RE0A 1YDYA 2YL8A 2QAPA 4JNYA 1W9BM 3BAJA 4Q4SA 2PDGA 4FA3A 2FGZA 1S5WA 3WQFA 2HXUA 3R13A 1PV8A 2NVAA 4N0RA 3G6LA 1OY0A 1NARA 3PSVA 2XVLA 4JD4A 3ITTA 3NPXA 1KWGA 2VOTA 2XIQA 2Y88A 3ITCA 4FLQA 3B8VA 4AZGA 2Y8UA 4PUJA 2AMGA 1BD0A 2WSRA 1NEYA 3DG7A 3CH0A 4G5DA 3CL6A 1H51A 2DEPA 3PN8A 3WENA 3STCA 4FP1A 1KM5A 1PHQA 2VJXA 2QCMA 3VD9A 2A1YA 2ICSA 4UR7A 4UFKA 4NHVA 3SRHA 5IHRA 1KR1A 1Z3NA 5H91A 1TZZA 1GG0A 1RY0A 3N14A 2YXXA 1SGJA 5JH1A 1XV8A 1OX4B 3NSXA 4GUIA 1KV8A 1IZCA 1Y65A 3GWQA 3O1NA 3BXWA 3ARTA 3SFWA 2J7HA 2X09A 5A2BA 2HNEA 1VP5A 3C0SA 2Z2AA 3IUHA 2Z4GA 1DHPA 3WUBA 3F4WA 3N2BA 2QQ6A 3LZ5A 4U3AA 2VQTA 5FF4A 1UJQA 1XDLA 2UWFA 3V1HA 1AJ2A 4M3PA 3ITYA 3BLKA 4XZMX 3N17A 4CU8A 3QV6A 1ZAIA 5HJLA 3UWUA 4HNNA 1X1NA 1TTQA 4GXMA 3V0SA 3COTA 4H8HA 3CEUA 3GAKA 1NP0A 3D47A 1QVBA 4C6DA 5D8ZA 1E5JA 4CQ8A 1C7TA 3ZVIA 3PWIA 3OGVA 3H23A 1K1DA 3T0AA 2A3EA 4D6CA 4Q6XA 1S46A 1M65A 3UG8A 3K8KA 3DFQA 4WOQA 3VNMA 2D3NA 2HQAA 3LTYA 4WDUA 3HPFA 4GI4A 6XIMA 3U2ZA 5GPRA 2V0TA 3V75A 1W1VA 3BANA 4PBEA 1J9YA 2VDGA 2QT3A 2YDSA 3HGSA 2VEPA 1VBJA 3OG2A 5XIAA 4H6QA 1GEHA 2GJRA 2ZZ4A 2CLLA 1L6WA 1Q5MA 1L2UA 3MUAA 4IFKB 1EC7A 1W2PA 1ONEA 3DOPA 1O5RA 2V63A 1CXEA 3MP3A 5C71A 5IHSA 2QGYA 5AC7A 5EMKA 3E2SA 1NWUA 4J27A 3RRAA 5BXTA 4RZ5A 4B92A 3GAYA 1M7XA 5HXMA 5D02A 4QISA 1CT5A 2J74A 5DF0A 2ADAA 2R94A 2NUXA 1JZ4A 3GUGA 1OQFA 1UR2A 1V03A 4Y9PA 3F2BA 1X1ZA 2O9OA 2ZDSA 3NL5A 5FD0A 4HNCA 4RK8A 1JPMA 2DH3A 4S3GA 2EXOA 1XP3A 1P0DA 1M9HA 1W9VA 3CAQA 4F3HA 1QHOA 3CL7A 4YXGA 1H7OA 3EPOA 3A6OA 3ZZ1A 1VIZA 1FDYA 1QK2A 4GUJA 4WDXA 1CLXA 4CCCA 3VMOA 3BJFA 3ITLA 1UPPA 3B0YA 2WNNA 5FA5A 1SW7A 3CT7A 4FEZA 3O63A 1P1XA 2PMQA 4W93A 1RLDA 5LXXA 4AMAA 3BGJA 2Q8ZA 3I68A 3A47A 4LVDA 2X05A 5BOOA 2E09A 3V35A 2Q3OA 1RK6A 3QGAC 4H9TA 1GYNA 3HGRA 4GNVA 1E1CA 4HNOA 1X39A 3IJQA 4W85A 1CI1A 3UZXA 2Q71A 1OCNA 3E6EA 1H1YA 2RGMA 1Z69A 2EBNA 4H7VA 1FWGC 3KBWA 3PWAA 3AZTA 4O10A 5F2GA 1WKFA 4JY8A 4J7RA 3PFRA 2WCSA 3ZJ7A 5G4HC 1P43A 3O16A 4Q8NA 2VFEA 1XH1A 3IS4A 1HGWA 4WQ6A 5CG7A 4PMOA 4DO5A 3VD3A 1XQLA 5DY3A 2JK2A 5KINA 3WQ6A 3W7KA 3LSCA 3IJIA 1AG1O 3N4FA 3STEA 4U2YA 2P8BA 4LS1A 2XGIA 4N9EA 1TV8A 4JX4A 2VM8A 4HOZA 1E9YB 1E6XM 4NF7A 2BOGX 3W7LA 1H1NA 3WDPP 4WKHA 3DYMA 5CJ5A 4DLMA 3GXIA 3LLDA 3GHUA 3VIOA 3OJGA 2OOFA 1JRBA 1FCQA 3KL5A 4IL0A 1QASA 3M0YA 1EA0A 3L2IA 2QLYA 3GDRA 1W1TA 4JX5A 3PHAA 3KBVA 2XN0A 3PB0A 3L4XA 4FIRA 1UR4A 1VYSX 2ABBA 3BW4A 2IQDA 4EPDC 5F4SA 4JFWA 4F40A 3CBWA 1A5SA 2VVSA 3DKLA 4YTRA 2YBUA 1MUMA 1BVNP 2PGEA 2DUXA 5LHEA 1VCVA 3KDOA 1B9ZA 4MWAC 4J9JA 3B8IA 2PZ0A 3BK0A 2Q3RA 2HCVA 4E4UA 3B06A 2J7DA 5FI8A 1JGIA 3EX6A 3H54A 1FP8A 2Q8XA 1Q66A 4P7LA 3DC8A 1LWJA 1ELSA 2I5IA 2NT1A 1K6AA 2EPOA 1D2KA 2QUUA 2BTMA 5HUPA 3ZIZA 3A4XA 2CHNA 4HU4A 1JXJA 1O7AA 4NI8A 1VAHA 3O6AA 4PRRA 4A8NA 3H4WA 1TYGA 1CLVA 4HD5A 4XTIA 4BEUA 4JOMA 4F79A 4M6VA 2QJIA 3K30A 4GZJA 4CUCA 3BV4A 3OTRA 2YSWA 3PWGA 1TKKA 3EDKA 4MF4A 5DT7A 3ZR4A 1GOIA 1FH8A 2W62A 4N6EA 5FL0A 1L9WA 1OB0A 1DWFM 2XYLA 1XDMA 4I9AA 2OPJA 3WLNA 2PS2A 1TQXA 3AU2A 2XPKA 3UT0A 2ALDA 4RL3A 2AGTA 2XTKA 1UKSA 2I5QA 3AIUA 1EZ2A 3WL0A 5CJNA 1KNWA 4N42A 4DPQA 1B5TA 3LSBA 3GNOA 4UTTC 1F6YA 4CD4A 4DUVA 3CYVA 1K4GA 1DJQA 1BQCA 4HKPA 4GQQA 1UJPA 2OZTA 3A4AA 4UXDA 1O94A 1FWWA 3SB0A 2OOGA 3QY6A 1XIFA 3TSMA 4A29A 1CWYA 2VFIA 3MHUA 5G1YA 2E25A 3RLUA 2PDMA 1IT0A 1KFBA 3W7DA 3WUFA 2H3BA 4WZHA 2Y7DA 2VX6A 4HU8A 1UH2A 3P80A 1A3XA 4HT3A 4JY9A 5E93A 1O1HA 5HQMA 3CAKA 2YLLA 3ZOAA 3LBOA 2D22A 3P61A 1CGXA 3IAQA 4NJKA 1YE6A 4FALA 3EOSA 1P6BA 1W8GA 3NDOA 4UTKA 5DBTA 2IS7A 1OIMA 3UXDA 2NQLA 1H4PA 3TN4A 1F8IA 4H19A 1OABA 1ZLPA 4MLRA 1GJUA 1WDPA 1ISZA 2POTA 1K7EA 4XD3A 4IPLA 2C3ZA 2HJPA 1LQ2A 3GXPA 4PR4A 5LYRA 5AKQA 2VZUA 2UY4A 4ZL1A 2WVSA 1S39A 1E15A 4NI3A 5TQLA 4DF2A 3SN0A 2O9PA 2VD9A 4AZIA 2NW0A 2FZ8A 4PH6A 1QPQA 1EBHA 3FA5A 2ONEA 3ZXWA 3VGEA 3MW7A 4PN2A 1HKVA 4EPKA 1UR1A 4R7WA 4XZHA 1OC6A 3ES7A 3G6MA 1GOXA 1VH7A 4X61A 4PODA 4R53A 1R2RA 1EIXA 4D6EA 1V79A 1TPVA 2V6AA 2E9LA 4FX7A 4GIAA 3OLGA 3W7JA 2D69A 3BZGA 4GCXA 2FHBA 4DX3A 2DT3A 2OX4A 3ZFHA 1X38A 3MSDA 2Z00A 2TRSA 2J24A 1XYMA 2FTYA 4BF5A 1ZHAA 4DJED 1E6NA 3CZ8A 3RG6A 1B3VA 4XAPA 4IP4A 3FHAA 1KV5A 3T0BA 2OJPA 2X0HA 3GC4A 4P8VA 3EGJA 3WQ5A 1QNRA 2J4GA 1UZ4A 3CUFA 4HA4A 3JUGA 4IPJA 3W72A 1D9EA 3W02A 3WDIA 3A12A 3GFYA 3TVAA 7REQA 3P2VA 5EBUA 2Y61A 1DEDA 3MJYA 2Y8KA 4WCJA 4O1AA 4I3GA 5FEXA 1Z48A 1SZNA 3BAXA 4LUJA 4HJFA 5I3FA 1EFZA 3IANA 3QW3A 3VOHA 4L1XA 1PS9A 2DT2A 6A3HA 3GNDA 5A5WA 2F7FA 2VUNA 1OYBA 5BZAA 3B4YA 5F1UA 3T2OA 2AGKA 1WUFA 1CEOA 2XVKA 3USBA 1OCQA 3GH7A 4S3DA 1WAUA 1IGWA 3U57A 3VDBA 1GVQA 1LJYA 2EF9A 3EEGA 3H7UA 3GHSA 3SCQA 3AHXA 4WDTA 1H7XA 3PNZA 3DCPA 2NV2A 3HGOA 1KBKA 1GZGA 4YHGA 4ZE5A 4Q8PA 3R8GA 3MYPA 4HZ7A 2VZTA 4TVUA 3VNLA 3RM4A 3PJXA 4I6VA 3GY1A 3L0GA 2PODA 3GR7A 3KM8A 2X1TA 4NY2A 2XH2A 3PBWA 2IUZA 2CIPA 2E3ZA 4O18A 3ZWTA 1VS1A 1Q6GA 3ZJ8A 4E3VA 1LOLA 1TJ1A 4LX4A 1OHLA 2PAJA 3AIBA 1Y8BA 5DRIA 4CD5A 4ERAA 1NVMA 2OZ8A 5EL1A 5HPOA 3L9CA 3ZVHB 3N04A 2MANA 1TMLA 4US6A 1UZHA 3L68A 1A50A 1GOKA 4UQBA 2OQHA 4LY8A 3IJLA 3REQB 4ZQRA 2BXZA 4KFPA 3ZSTA 3UVIA 1SFJA 3I10A 3AS1A 3F1QA 2YKKA 2CLIA 1H3GA 3AROA 2TSYA 5M1TA 2AKMA 2YCEA 4QQ3A 1BTCA 3CZGA 3KP0A 1CYGA 4PMYA 5BMXA 1V3KA 3P14A 3RLVA 1EX5A 4IHCA 6CGTA 3SDOA 1TMHA 1S2AA 3CWOX 3STFA 5K9DA 2ZVRA 4EXBA 3B8DA 1OYAA 3GO2A 3GXDA 3GYEA 4WXZA 1PZ2A 1PBGA 1K7XA 4HA0A 1B3ZA 4MNMA 3FXYA 4F48A 5BXRA 3NQMA 3FKKA 3V7PA 3IJ7A 2AAAA 1IT7A 3DFNA 2RH9A 3PANA 1DJHA 3KS6A 1JF5A 4IWWA 5FEZA 3R1ZA 3WDQA 1XL9A 1XC6A 4H41A 4XAZA 5ECVA 3AYVA 1Q7ZA 3NA8A 4JTIA 1MXSA 4P5UA 1GVFA 2E6DA 4B5TA 4TMBA 3UGRA 2NQ9A 2FB2A 3LI0A 2BVTA 3BOLA 1V51A 3M0LA 4GFIA 1CGTA 4L1GA 3UWZA 4DJFD 4LXFA 4FB7A 1PXGA 5D04C 3I6EA 4HB7A 4LVFA 2ZZ2A 3H7VA 3TLQA 4O8RA 1F7BA 8CGTA 4Y96A 4ZFCA 2YA1A 5AHLA 2PD9A 2F6XA 3N15A 4M19A 5AN7A 2CKSA 2OG9A 2CPUA 4GXWA 2Y5SA 2DV0A 1XLBA 4E5TA 4F0MA 4A8RA 1WBJA 3DFSA 2PPGA 5J5DA 3W2JA 1ZTVA 4YPJA 3TYUA 4R7JA 4DXXA 1WKEA 1HGYA 5SWUA 1EB3A 3F03K 3V5OA 1RQEA 2I57A 4JXCA 1EL3A 3PBMA 4F0HA 4KRTA 4A4AA 4FXFA 2Z1XA 1VZWA 1FWSA 4MWAB 4WR3A 3PPCA 3ID7A 1V02E 1E3ZA 4K36A 2ZTKA 2QIIA 1A0DA 5BNKA 2X7VA 2C15A 5GJMA 4QE5A 3EMQA 2XHYA 2C0HA 2Z6IA 4BI6A 2C1HA 2VGBA 4B4FA 3N2XA 3CTLA 1WDRA 4JIQA 2GVYA 1HFBA 1QATA 2BGQA 2OWCA 3W7QA 4KETA 5CPNA 1PX4A 1IE7C 1OSEA 2PSNA 3CHFA 3W2MA 4ZQPA 2XM1A 5C8BB 1O66A 3QQ0A 3QSRA 1M03A 4OZOA 4CCEA 1PE1A 1QWKA 1R3YA 3VE9A 3G5EA 3AXKA 3N9RA 5DANA 2PDFA 4L6HA 3BOFA 4M81A 3LHWA 4U31A 1E6SM 3U4AA 3A22A 3MUXA 1SZRA 3QR1A 2EHHA 1V7AA 3QY8A 3QKEA 3TWAA 5AYXA 4MAVA 1Q6FA 3C2RA 3K46A 3UY8A 2BVDA 5AHNA 4A05A 4O11A 3HZ3A 3W3OA 2ZCGA 4YN5A 4DJFC 4FF5A 4PCNA 3SW6A 1HL9A 2PF8A 2PU0A 2NQZA 2BHUA 1SVDA 1B9BA 3NL2A 4YIWA 4QCEA 4ACZB 4AX6A 5T8GA 1TV5A 2CLHA 4DM1A 4NKCA 4D71A 1KO0A 1RP9A 3NIYA 1QK0A 3T09A 1GHRA 3B8WA 1EQPA 1G5AA 1N8WA 1F3EA 3TKFA 3UETA 5D9PA 1VB9A 2NQHA 4QAWA 2L5HA 3AS0A 3M5XA 3EB3A 4O54A 2WVVB 3NEVA 4LNYA 3AUOA 2CHOA 1AFSA 4ZB5A 4Z1BA 3WLLA 2WMFA 2XFFA 3EOUA 1OX4A 4CU7A 4QLLA 2DIJA 1LROA 3V36A 3FNDA 4UFJA 1R87A 4HOWA 1GTEA 1FUYA 2J75A 2I9EA 1EF2A 1WOBA 3WF4A 4CNOA 3CLMA 4KIEA 4C1NB 1QNOA 3PF3A 2DQXA 3W2KA 4QXIA 3EWWA 1ZBKA 4DBDA 2ZUUA 3PB2A 1VFSA 4HMEA 4C7GA 3EOOA 2PWDA 2WM0A 1ISYA 3M5ZA 3B8TA 4DWSB 3CJPA 3CC1A 5FF0A 4K8GA 3TC6A 1EQCA 4Z2IA 2HK1A 4PL1A 1ITCA 3M41A 3RR1A 2J62A 4IUGA 1H63A 4NUWA 3BSMA 1FWBC 4AD0A 3UWYA 4DWDA 4LQ1A 1DXIA 3K13A 1Q6EA 1ZZMA 1POKA 3BW3A 2WSPA 2A3LA 4M0XA 1U1JA 1K77A 4Z2GA 3KP1A 1JAEA 1OGBA 5L9FA 2TMDA 4TX8A 2XISA 3A3XA 5G4EA 1W37A 4LBRA 5LA0A 1A5CA 1R9XA 3VDHA 1PKNA 2JEPA 3S5ZA 3DYPA 1F5ZA 2QUNA 4HYWA 1B57A 3QMTA 3STPA 1TUXA 3NSMA 5EYWA 1U22A 1XBYA 3AMKA 2J9YA 2EPNA 3HPAA 2VVNA 3F4VA 3VNZA 3GE7A 3KVLA 3U48A 3E2QA 1Q6QA 4AMCA 2QF8A 3KOXA 2ACUA 4B5XA 4G7EB 1Q2RA 1W5QA 3W70A 3K4DA 5DXYA 1JCXA 1UWAA 2VR5A 2QCLA 3CAVA 3ZLHA 2ODOA 4J40A 4B4HA 2IW0A 2C13A 4JTEA 3WH7A 4MUZA 3SEPA 4ZODA 1IYXA 1F3TA 2WSYA 4A8IA 3GNXA 5BXPA 4S3JA 3LPGA 2WCGA 4TV5A 3UR7A 1H50A 3C2OA 4DUWA 1D7FA 5D2WA 1LG2A 1J8VA 2VI0A 1FQ0A 3G24A 1OD8A 1J5SA 3V5FA 3RX4A 2G97A 1WBHA 3RO6A 1GKRA 1L8PA 4AIUA 3VIIA 1PDYA 3CQJA 4IM4A 4MB5A 1QCWA 3PC0A 1QUMA 3NFUA 3VPLA 1FVPA 4LAZA 2WKLA 4XUGA 5HK4A 2E4TA 2R82A 2BB0A 5EY5A 1W9PA 1E71M 2GJLA 4AC1X 2E6AA 3CEPA 5DMMA 5BRQA 1AMYA 2D3LA 5BXSA 4MM1A 2OU4A 5GNXA 3QVQA 2PDKA 1ITQA 4NAFA 2PGWA 5EGRA 2E7FA 3CPGA 2AQOA 3BW2A 4WUIA 1E0TA 1EHNA 3MKCA 1CLKA 1MEWA 3UBPC 1ADDA 2QVHA 4W8BA 1SUXA 1JAKA 3VIKA 1Q13A 1J10A 9RUBA 1U1UA 4L1WA 1W8SA 1TPWA 1O60A 2PDHA 2O4MA 5BWAA 1IWPA 2O4QA 3FYYA 1IT8A 4XV0A 4XVEA 1TRIA 2FFIA 4RJEA 4V2XA 3ONCA 2VC7A 2YX0A 4N6FA 4JTKA 4NNBA 4MDPA 4M29A 2EAWA 5DQPA 4GYPA 2BXYA 1EF3A 1W5MA 1I9CB 3GHRA 1ISXA 4C6PA 4PB3A 2X41A 3SADA 1LM1A 2A3BA 3F4NA 3EWCA 1DJYA 1S5MA 2PTYA 4J3ZA 1P5BA 3TIMA 1KR0A 4C6JA 1SJDA 1SZGA 5HATA 1D3CA 1TQJA 1NOFA 3VE7A 3W00A 2FFCA 4NP7A 2R1NA 4O53A 4GOAA 1W1A1 2ON3A 1R6WA 3B9EA 4WD0A 3Q45A 1UA3A 3W01A 3RPTA 2PLMA 3ARZA 3BL3A 3GXMA 1RJQA 3DH7A 2IKJA 1GW1A 2A3AA 1LQAA 3W26A 1V0LA 3SSZA 1FHDA 3WJWA 1S2WA 4UCFA 3EDFA 4MZ8A 3OZMA 1I75A 3GUWA 5HNTA 4LUSB 3M4HA 1EUAA 4LYRA 4FO4A 4TIMA 1W5OA 1WXYA 1TE1A 2OZ3A 3JU2A 2W5FA 1LRNA 3SCPA 1ONWA 1W3LA 5A8OA 5E0KA 1GPFA 4G7FA 1S1RA 4ROQA 3K5XA 2CLOA 4XO7A 3NZPA 3QMRA 1KM2A 3OZOA 4HVXA 1T99A 5LZLA 3BLEA 3JZUA 3U5UA 5C9WA 3L7RA 1NTHA 2ZRXA 4H6EA 3WYZA 2VQUA 4FNPA 5LNUA 4A3UA 4KRUA 1VFTA 2BBFA 1CECA 3ZO9A 3WNKA 1H1ZA 4HPHA 3QZAA 3G77A 1XUZA 2WSKA 3RJXA 2HS8A 2GVGA 5DMLA 3QGKC 3SZ8A 1QOXA 3VU2A 3CPRA 1WP6A 2HVNA 3TA9A 3OVRA 1JPKA 1C7SA 3NDZA 2C18A 3URQA 3VOIA 3AUJA 4K1WA 3KFTA 3GBEA 3MYOA 4HU0A 4IFRA 4IGSA 5DY2A 2D20A 3I3BA 3ARYA 2OSWA 4DM2A 4LS0A 5HAOA 2H3DA 1ZPTA 3WELA 1AW1A 4P7NA 1RK5A 3TTQA 2BY3A 2VP8A 1FP9A 2QAFA 1XIGA 4FNSA 3LUTA 3LCXA 4W88A 4W8LA 4JQ4A 3O6DA 3II1A 3MUIA 3S2NA 5CJMA 1S5TA 1Y0EA 3UXLA 3RU6A 3KRZA 2HBVA 4DJFA 4KGLA 5D33A 1S2VA 3UWWA 3SCTA 3AC0A 4DBEA 3OG3A 1T40A 1PTGA 2HTMA 2QMJA 4KW2A 5CG0A 4M5PA 2A0NA 3M0IA 4OBRA 3CZEA 2GSHA 3W1PA 3N2MA 3PZQA 3HN3A 3GTXA 3CUJA 3EDJA 4H01A 4PB5A 1VFOA 4XQ6A 1SW3A 5FEPA 2GQ3A 3ERPA 3LXAA 1TV7A 3CB8A 2JFEX 3DGRA 1XGEA 3RRXA 3TAKA 1TWZA 2PEVA 3RM8A 1RPKA 2A5HA 1KB3A 3PPHA 3O0FA 4EK7A 2XIOA 4RE3A 3GDLA 4AXNA 2UY3A 4GI6A 1RCXB 4L4LA 3CWNA 4AY8A 4JPGA 3FIGA 2JIWA 5M2FX 4LYQA 4L5ZA 1O1ZA 1A5KC 4AYSA 3GSMA 2IPFA 4GISA 3WH8A 4JR5A 5CAHA 1GK8A 2FYMA 1OFQA 2FHFA 2WKJA 2ZRYA 4LANA 1Q65A 3P8IA 1AW2A 2YBTA 4DAIA 1CXLA 4R27A 1H11A 2HRWA 3S2CA 4JQ1A 1DTNA 4XG1A 3VK5A 1KFJA 3E38A 2D1ZA 1GJPA 1FY6A 3GTNA 5D2TA 3VO0A 3DX5A 3G22A 4MTVA 2VFFA 1IXPA 1D3GA 1NDZA 3O7UA 1UWTA 3MSRA 3DFHA 1LRQA 5I77A 1WOAA 4YCOA 4PUKA 1W31A 1BWVA 5LIYX 3O8AA 3TYEA 2FLIA 4LGXA 5HPCA 2HE5A 1ME8A 1UMLA 4CEXC 1ISVA 2WZHA 3EA1A 3WD0A 3CPUA 1KGUA 5CSRA 2OT0A 1XGZA 3L4ZA 4KCVA 1R7AA 1IHIA 2FMNA 4MUPA 1JR1A 1IR2A 4Y9MA 2V69A 1XR2A 1WDQA 1W1YA 5PTDA 1LF1A 3C52A 1NJJA 1RSCA 4XBJA 4X60A 2A6LA 3VMPA 1W0MA 5A6AA 3VINA 1A5MC 2QUTA 4GGHA 3W81A 1R47A 2OLAA 4I7VA 2WMIA 1UA7A 1I2QA 3BAWA 3NO1A 4Y6GA 1X96A 1XD1A 4S3AA 2QJMA 4F0LA 3F5KA 3W7EA 1AVAA 4XZLX 3C2YA 4G56A 1JQXA 1SPQA 3E49A 2PGRA 5C2CA 4EWJA 3PZIA 1TTPA 3NZRA 4PL2A 4L56A 3M7WA 1AQFA 3TJ4A 3PZGA 4GINA 1OFPA 1O95A 1NY1A 1VEOA 2C7FA 1NDYA 5I6SA 1FWIC 2W9MA 4I7WA 3XIMA 1BVZA 3RNDA 5A8QA 1P1MA 2QJHA 3NPVA 4PCSA 2QJNA 4D6GA 1GHSA 4TUFA 1JFXA 1TX2A 4DJDD 3EWDA 1HVXA 3O6CA 4LUTA 1HKWA 2NLYA 2Y4SA 2JQXA 4P7RA 4DYKA 2F6KA 3SY8A 3HBLA 3PZNA 5DFAA 2FDSA 4NAFB 4GK8A 4PBGA 2P88A 5EMYA 3WD4A 1KCXA 1V3IA 3S1VA 3HURA 2E9BA 5IDZA 1NU5A 3I7QA 4HMDA 2I5GA 3H2CA 3NR0A 3L5LA 3KVMA 1KTBA 4C60A 1EWDA 1P0NA 1WKDA 4H8VA 2NXIA 4A3YA 3LTSA 3AIRA 3GTIA 3VCCA 1E9ZB 3LMYA 3WD2A 3JR2A 4QFUA 1XLFA 1FFQA 1YBQB 2WV8A 2WCAA 1XBZA 2WLYA 3DKJA 1WAWA 5A6KA 5K9CA 3NPUA 2ZADA 4O52A 3KCLA 3U9IA 4KRZA 1M04A 1XKYA 4L9XA 5G2HA 5A95A 4AVOA 4Q8UA 1KQYA 4PMDA 4S39A 2DH2A 2FZNA 2Z1KA 2WSQA 3KCOA 1B3XA 4JQ2A 1HN1A 1JPHA 2HPMA 1TWDA 3LLXA 3NVTA 3TN5A 1B1YA 3MMTA 4E4FA 2D2GA 2GQ8A 5JBFA 4X9SA 1TREA 3W7CA 4JEJA 2C1GA 2ZX6A 3QYSA 1CX9A 1JZ5A 4C6NA 3WQDA 4JS3A 4ICCX 4Z2JA 1KFEA 1OGSA 1OYCA 2PDBA 2PWVA 4DVOA 4AWUA 1PL9A 4K7VA 3M0HA 2EPLX 2FH6A 3QV8A 2O7QA 4XAFA 3UD6A 3LCWA 3MMDA 3FSUA 3W2NA 2CLMA 2CLPA 1G1YA 3E0IA 4IJRA 1QI4A 1HKIA 3OHMB 1UCWA 1BF2A 1G94A 1QRQA 2RDTA 1OFRA 1U5JA 4M8UA 1IEIA 4DI9A 2UBPC 1SYTA 1EJVC 4JYFA 4RX0A 1SFSA 1DWGM 3GDTA 3AALA 3DFPA 5LIKX 1MNZA 1Q7MA 1E4LA 3HJEA 5A6LA 3WLRA 1Q85A 1KLYA 4I9MA 4ZZ9A 5C9ZA 2CZFA 2G37A 2J7GA 1V02A 4OGZA 2NXHA 3V0UA 1XM3A 1ZGDA 4ERGA 3HPZA 1AUSL 3WH9A 4HK5A 1A53A 3VD7A 2ZRZA 3LY0A 3MWCA 1F3XA 3T44A 3MV11 3K2GA 2HS6A 1OFOA 1GVOA 2WK2A 3APTA 2TAAA 4C7DA 3OVQA 4NRRA 2YDRA 2BV9A 2PUZA 3FJNA 5I78A 1B0IA 4AVFA 3RAOA 5RUBA 3MUCA 5ABHA 3NQ8A 3VNYA 4FOUA 5ABGA 1UKQA 1YNYA 2FJKA 2VDIA 4UR9A 4UQDA 4IIBA 1AQ0A 3DFOA 4QNWA 1NDVA 2J47A 4CCDA 3QMSA 4LJ3A 3CYJA 4O14A 3OIXA 3THDA 4FNTA 2YLAA 1PSCA 4BS0A 2QJGA 3LDVA 1JI2A 3SUTA 4NRSA 1UG6A 4YTQA 2XM2A 3OYXA 3VA8A 3GVQA 3EYPA 5C5YA 2YCIX 1H41A 3THAA 5FJPA 1W32A 1AK5A 3HG5A 4ADUA 5FL1A 1XJBA 2XU2A 3VD5A 4JZ5A 4I8YA 1FWFC 1CBGA 3ARRA 1PWMA 1DXFA 1QO5A 4DXKA 3QLDA 5FEWA 4AZ5A 4YVXA 1FXPA 4W7VA 4RPQA 2DSKA 1A3WA 1DJXA 4NU7A 3W7GA 3EXRA 5FJJA 2XIIA 5IFPA 1BKSA 3R89A 2OXNA 4X22A 3UG5A 5HR7A 4UTTA 3VNDA 3E1F1 2Y1HA 3A3HA 1FBAA 1GVEA 3BOXA 1J0JA 4OWGA 3M0ZA 1YDVA 3L0KA 4R3UA 4R85A 3CV6A 1XCWA 4PFHA 3DBPA 1R30A 1UPMB 5I5RA 4J2MA 5D2YA 2PCEA 1C8VA 4RUBA 5H8UA 4QGCA 1O68A 3PSWA 4AHPA 1X7IA 4DBUA 1YXYA 1JZ3A 1IXQA 3DXIA 4GPNA 4JTFA 1KFCA 3SRDA 4JTUA 1LZOA 2GL5A 3H70A 4MKNA 3S9YA 3HQNA 3B0UX 4GBDA 4NYYA 3EWZA 1LDCA 5DBUA 3MCOA 2CZDA 1EH9A 2P8CA 3P62A 9CGTA 3CTTA 4ZO6A 5HNUA 1W3NA 3G1XA 2D0FA 4DJEA 3ZM8A 2YCLA 4GZIA 1THFD 1PYMA 3LHZA 1DJZA 2F2KA 4O0KA 3UEQA 4LF1A 2IPGA 4MYAA 3J7HA 1YHTA 3IK4A 3R43A 4IXHA 4JHZA 3WQEA 3SFKA 4N4QA 1US3A 3VDAA 1EEPA 2OEJA 3CMGA 2ZX8A 4FI4A 4BR1A 2XDFA 2ZOXA 1R9ZA 4HCLA 2BHZA 4HBKA 4QITA 3VNIA 3QEZA 2GLKA 1AZ1A 4C5ZA 1R2TA 3VOFA 4AZ7A 4Z1DA 2BMBA 4KKXA 3KLKA 4ZR8A 3VIPA 5HWJA 3HGJA 2QF7A 1I2NA 3SJ3A 3MBFA 3QHMA 2ZZ6A 3H24A 3NNTA 5CPSA 3NQEA 1JRCA 4BKNA 4NNAA 4JIRA 2V81A 4HTBA 2G50A 1PYFA 4B3LA 4BWLC 4J3TA 1BHGA 1H5YA 1HP5A 3DFYA 1F74A 4DF0A 4BI7A 3P74A 3FLUA 2DFAA 2DPEA 2JIEA 3NVDA 4Q3MA 3UP8A 3SSJA 3MCNA 3VXGA 4HCHA 1G0CA 5FJIA 2A2IA 2OO0A 1E56A 1OG0A 3JVAA 2VRKA 1XD0A 3WMLA 4EIVA 5E09A 4RV3A 2B7PA 1PAMA 1SSDA 3UXAA 4MY9A 4NZ1A 3TWBA 4IX0A 1FWNA 2Q01A 3CV2A 3KRUA 3M5VA 3KE0A 3LMZA 2OYKA 3W1NA 4PMZA 1WDSA 4QNEA 1K02A 2WHKA 3S1GA 1BWKA 1JD7A 2RGLA 2XGZA 4GC4A 3GTFA 3B03A 4X0NA 2O9TA 3SAZA 1C93A 3GKFA 2ZVIA 3RF9A 1TCMA 1SO5A 5BWFA 1MZRA 3KEHA 2CBVA 1MW3A 3H2OA 3PUDA 2G8ZA 2J27A 4BF9A 2FJUB 4JQAA 1DWHM 4R34A 1CZ1A 3UCCA 4UUIA 3PZUA 5CPLA 1AL7A 5EU9A 5EMJA 1OC7A 3G8RA 3H2AA 3CWHA 4LW7A 1K4HA 3DUGA 3M47A 3W6LA 3WY1A 3L0NA 1ZAJA 4DWSC 3P5ZA 2MUCA 3F5JA 3WEZA 4P8WA 1N7KA 3SY5A 4KEMA 4YL2A 1UR8A 4IJCA 2XH7A 3T07A 6REQB 2WW5A 4DWSA 1CGWA 3S46A 3W24A 1Z6KA 2WZTA 1VJSA 3VAVA 1EP3A 4PYSA 1MDRA 1W6TA 4J3WA 4LSBA 5CBIA 3LERA 4L6DA 4O13A 3RXZA 2FGBA 5XIMA 1XIBA 3WLSA 1DIEA 3FJ4A 3VDCA 1K9FA 5BOEA 4L4PA 3H2MA 1W3IA 1N8FA 1XSJA 2RFGA 3BARA 5JUVA 4GC3A 4LEFA 4R9OA 3FJLA 3W71A 1HJUA 4O28A 7ENLA 4AXKA 1A49A 4KEUA 4YU1A 1TELA 3AHZA 4GD0A 3BJTA 2HSAA 3UXKA 1Q6DA 4HK7A 4UCGA 3NEHA 5K3VA 3W88A 2VZSA 4NSBA 2ZIDA 3KUMA 5FJRA 1I6NA 4B5SA 2Z1BA 1GZJA 3UQNA 4C1LA 4Z08A 4H00A 4KFOA 1F3WA 1RXOB 1TPDA 4PTWA 2FDMA 5H8MA 3TC7A 1JIBA 3GVWA 1PB0A 1KFWA 3CB3A 2OLSA 4JBRA 2RJHA 2NWSA 4G7EA 2CBUA 3D46A 1ADSA 2VEKA 1ODZA 2DW6A 1VYPX 1TPEA 4PRTA 1FH9A 1N2VA 3G18A 3SIZA 2RDXA 2EPMX 4L61A 4GQGA 5D30A 4JFTA 4AW7A 1Q45A 1K8XA 2WO5A 3DBNA 1ME7A 3WD3A 1JEZA 2GYIA 3DFTA 1GQIA 4U5IA 4GZ7A 3VI2A 1XLMA 1ZQ5A 1WXZA 1O5QA 3FW6A 2INEA 1ME9A 3IACA 3MUY1 4TOQA 3PZTA 2GJPA 1I1XA 1UWUA 4MPKA 7A3HA 2VFGA 3QTGA 3UJFA 3WDRA 5CGTA 4BWLA 4MZYA 1FA2A 4CCZA 4LF2A 1K8CA 3VYLA 3KTXA 3T4CA 1IZKA 1VHCA 5B7ZA 2FHCA 3URBA 1LWIA 4IMFA 5GNZA 4RW3A 2VURA 2GDVA 2AQWA 1OK4A 3LBMA 3LNMA 1QI5A 1TVNA 4C1KA 2CYGA 3SN4A 4J5NA 5IM51 8RUCA 1DBTA 3EKZA 2VR4A 4ILSA 5JBDA 2GQ9A 4NASA 4Q32A 8A3HA 4QROA 3O15A 3CS2A 3M7SA 2XGBA 4JFSA 4BY3A 1E43A 1GW9A 4PCTA 3PTQA 3EZ4A 2Y85A 4GIYA 1JDFA 1TG7A 4KEVA 1WPCA 3P60A 4UWMA 3FXGA 4A3QA 5CZJA 4L4OA 1IQ8A 1DXEA 1XLHA 4IFOA 4GRSA 4DJEC 1YDNA 3EX3A 2H8XA 5DEZA 4FLRA 2ZUMA 4JQ3A 5I23A 5XINA 3B97A 3LGDA 5KITA 1J2WA 5G1MA 1BYBA 3HV9A 3TYDA 3PAJA 2BLEA 2A4AA 2CXEA 3TZFA 1JVNA 3WLHA 1A0CA 1WDDA 3BMWA 2GGIA 4XZIA 4JDYA 3WK2A 2VC6A 6TIMA 4XO6A 1W2VA 2DJLA 1D3HA 3PBVA 1W1IE 6TAAA 2QCGA 4HHPA 3N9SA 5D2VA 5JIPA 4PGLA 2Y5JA 2YCJA 5LIWX 3AXMA 4NAEB 2C6QA 2DT0A 3RMJA 1V3HA 4EXAA 3WNNA 3S1UA 4NIRA 1A4MA 1VRDA 3M64A 4IQLA 3W1AA 1K8ZA 5EPDA 4P8UA 4US5D 3S1WA 1E0WA 1NFPA 3UA3A 4DQWA 2ZUNA 3DG3A 1WO2A