1LOQA

Crystal structure of orotidine monophosphate decarboxylase complexed with product ump
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
209
structure length
208
Chain Sequence
b'RLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords orotidine 5'-monophosphate decarboxylase
publication title Crystal structures of inhibitor complexes reveal an alternate binding mode in orotidine-5'-monophosphate decarboxylase.
pubmed doi rcsb
source organism Archaea
molecule tags Lyase
total genus 81
structure length 208
sequence length 209
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2002-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1loqA00
2J6XA 3A22A 2W0UA 3LTSA 1QWGA 4GRSA 1LOLA 3R8RA 3HMJG 2PC4A 4UTUA 1NAL1 1O5KA 3TSDA 5C2XA 1EEPA 5D32A 4JYFA 5DY2A 2ZZ6A 4O57A 1TPFA 3S5YA 3W1QA 3DFOA 3C2OA 3BG5A 1F76A 3A23A 4Y6GA 2J9YA 4ZQRA 4WUIA 2H8XA 3C61A 4RKAA 3EKZA 3W9ZA 1BKSA 1VYSX 3G1VA 3HJZA 4I7WA 4IX0A 3TMQA 1LBFA 5D37A 1TTQA 1ADOA 1EP3A 2DZTA 3W88A 4NT0A 2HS6A 2C1HA 3L9CA 2V9DA 3QQ0A 2TYSA 1JUEA 3TQVA 1GOXA 1TPH1 4HNNA 3GXTA 4JIQA 3L5LA 4FHAA 2NXHA 4WY0F 4IPJA 3ABRA 1SO3A 3PUEA 3TDFA 1VPXA 1FCBA 2ATSA 2CWNA 3NQ7A 5J5DA 1KLYA 4K8EA 2NX3A 4R34A 1OFQA 5HR6A 1W5MA 1EB3A 1GYLA 3BGJA 4A21A 4LOCA 2ABAA 1WDWA 5CSRA 1YPFA 1KBJA 3UWVA 5K9DA 3NEVA 4OGZA 3S9YA 1DQXA 4JY9A 3LCWA 4IGHA 3SGUA 4O4WA 1L6WA 1JCNA 1ICPA 4AEOA 4U28A 4N6FA 3SI9A 1JCLA 2FB2A 1WOAA 4Y96A 3B03A 4RZ4A 3UXDA 4WOQA 5ABTA 5AFDA 4TU1A 1PL9A 1YXCA 3IVSA 4UFIA 1KFLA 5D05A 3NA8A 4RV8A 2GUUA 1KTBA 1O95A 2CLEA 1VLIA 3C8FA 3PWAA 2QCDB 5FEXA 3GKAA 3O15A 2QAPA 4IPIA 3NQCA 4ML9A 5KZDA 1I2NA 4OV4A 5CKSA 1O5XA 2CZ5A 1Z42A 3NO5A 4BR1A 1KM3A 1H62A 4O1CA 5FF4A 1ONRA 4HHPA 3W7CA 3STFA 3W07A 5CG7A 1QR7A 3AJXA 4Z1AA 1OVDA 3HGOA 2ZRXA 2XN2A 3PR2A 5U7SA 3VE7A 3SFKA 3M41A 4FNRA 3W84A 3P5ZA 1NSJA 3SECA 3G0XA 1L6YA 3DGRA 1FXPA 1VS1A 1TB3A 2VEIA 1F74A 3UWYA 1KTNA 2H3DA 4GUJA 1QDSA 3L5MA 4UTTA 3EX3A 4ZQPA 3QFEA 2GVJA 4EF9A 1H7RA 1W5OA 2QEZA 5AC6A 3LHVA 3W76A 3O05A 3KX6A 5F2IA 1RQBA 5F2LA 3IVUA 4M7SA 4R53A 3A21A 1G6CA 1L2UA 3G8EA 3UWUA 3P74A 4AMAA 1F73A 3VKJA 1XI3A 2VFEA 2ISSA 2WKJA 1VCFA 2J9ZA 2GQAA 2C6QA 2QCGA 3TC6A 2JBMA 3V75A 2BLEA 3TAKA 3LCFA 1N55A 1MEIA 4JYEA 1TPC1 5AHFA 4DXVA 5G2HA 1MXSA 1W0MA 4AVFA 1OYAA 4LUJA 1XBYA 3WK0A 4DBEA 3C4UA 3GX9A 1T0OA 2ZZ4A 4LRTA 4JTSA 3KHJA 3THQA 4FNTA 3W7LA 2VC6A 1F05A 2Y61A 1KM0A 3EXRA 2H6RA 3GNDA 4JDYA 1Q3NA 4Y9AA 1RQHA 4Z1DA 2CLLA 3M5XA 4AF0A 3STCA 4OE7A 4WQ6A 5AYXA 1SSDA 4JGDA 4Y8FA 2ZTKA 1PV8A 4I7VA 3LHUA 3LI1A 3TIMA 4M7TA 3V1PA 5AHLA 1OX6A 5I3GA 4IXXA 1KFEA 1CI1A 4LS2A 4LC6A 2ZRUA 1M7PA 4HPJA 2JGYA 1W5NA 3W7NA 2WV8A 3B0PA 3HF3A 3DFSA 4JY8A 2E5DA 2R8WA 1FUYA 1T96A 4AWUA 2CZDA 4RR4A 2A7PA 1KFJA 2HS8A 1WBHA 1H63A 4IJBA 3OVPA 3T4CA 3HGRA 1G4PA 2ALDA 1XM3A 3GKFA 4HN4A 3QQ1A 4DO5A 3GDLA 4ZMGA 2BX7A 1KLZA 1I2PA 1SFJA 1L9WA 3R5EA 4YMZA 3TK7A 2ABBA 5F2MA 1P4CA 2WSYA 4XKYA 3PSVA 3MWAA 2CZFA 1OG0A 3N3MA 4XZ9A 1I4NA 3KAOA 3L5AA 3HG5A 2RDTA 2ZYFA 4K36A 4WZHA 4NNCA 4BF9A 4IMDA 4DO6A 1NF0A 3DFPA 1GVRA 3GIYA 1BWKA 2EAWA 1YXDA 3ZWTA 3W7PA 2DU2A 1KV5A 3BLFA 5AHNA 4JTEA 1EP2A 5C5YA 1VYRA 4BI6A 3B05A 1OK4A 2YSWA 4Z0SA 4LT9A 1SUXA 3EXTA 4WY0A 3W87A 3H53A 1TTPA 1LORA 1W8SA 4NNBA 4NUWA 3DFTA 2VFDA 2A6NA 4HIBA 2V0TA 3PB0A 4UNKA 1SFLA 3UY8A 1YTEA 1RV8A 4AHOA 3O1NA 3CEPA 2TPSA 3HQ1A 5EKYA 3NL2A 4Q33A 3TFXA 3UPWA 3HIJA 2EHHA 5J5RA 1BEUA 4GJ1A 4FB7A 4O17A 1KM2A 3H55A 2VEKA 2GQ9A 2OCZA 5HULA 2J27A 2FPYA 3WK2A 1RZMA 4GNJA 1W56A 5LHFA 3CWOX 2QCFA 1B9BA 3W1MA 2JKPA 1TJPA 5F1VA 1IIHA 1VZWA 4KFOA 1DVJA 4O13A 4AHQA 5I3JA 4YL2A 1OHLA 2NWRA 3LV5A 3OEXA 5DBTA 3MHFA 4UMAA 5I3IA 4NJGA 1Q45A 2RH9A 2PRHA 5I3KA 2C18A 1T8XA 4ADSA 3MYPA 4QAIA 3LOTA 1RPXA 5DLCA 2TSYA 3HBLA 3O63A 2ZCGA 1QPRA 2FLIA 4UTTC 3N9RA 3E49A 5K9CA 4KWWA 4BK9A 1BTMA 4E0CA 4IWWA 1TQJA 1KFKA 4ICNA 5K3VA 4FO4A 3EWUA 1TTJA 3S1VA 1LLZA 4UTIA 5A5WA 3UYCA 1J2WA 1SPQA 5AYYA 4A2SA 3CQ0A 2ZQ0A 5HUOA 3IIOA 5CZSA 3ABSA 3UY7A 4N6EA 1XFBA 4K38A 3IIVA 3IIXA 4Z0JA 3S1UA 2B7NA 5AB3A 1RQEA 3BK0A 4JEQA 4L4MA 4MKNA 2G95A 5KINA 5EL1A 1ZJIA 4H3DA 2JGQA 1I2QA 1WXJA 2YX0A 1TPB1 5FF7A 2DZPA 3W7RA 1KM4A 1PCWA 2FDSA 3W74A 4C1KA 2YR1A 4ADUA 1UB3A 2J9XA 3C52A 2QCDA 3P61A 1OF6A 3I68A 2B7QA 4MFEA 2C13A 4PL2A 3TJXA 3MMTA 1H51A 1WOBA 3DHDA 5D38A 3WJYA 1VLWA 4OBTA 2CW6A 1WQ5A 4MVAA 1M6JA 5DXYA 3C56A 4UTKA 1I2OA 5C6MA 3BGGA 5CZ0A 3O8AA 1AG1O 1H1YA 3LRKA 1NF7A 3NG3A 4P2VA 2DJXA 3PVFA 3QMTA 4GUGA 1VR6A 3L0NA 2ZZ2A 2PURA 3G0UA 1S5TA 1DV7A 5K2ZA 4I9AA 2I9EA 2ISVA 2DZVA 2V2HA 1IF2A 1YXYA 3VI2A 3M6YA 2QR6A 3NNTA 3PB2A 4JXCA 1TV7A 1G7UA 3C2VA 1KFBA 3JR2A 2QUUA 2GOUA 1KM6A 5HINA 4TMCA 4M6QA 3TQKA 1FY6A 1TPDA 2E09A 3MUXA 2OT1A 4FX6M 2QCEA 4PTNA 3L67A 1Z44A 1FCQA 1Q6OA 2NUYA 1MSSA 3W1NA 4S2BA 4O15A 2A4AA 4JD4A 4O0ZA 4B5NA 4QNWA 4XKYB 1PVNA 4CNPA 3QW4B 3TU9A 4HNVA 4GUHA 2A85A 1LRQA 4MYAA 3MP3A 3UPBA 1H1ZA 1KBIA 3PUDA 1OFAA 4K7VA 1H60A 2YPIA 3LXBA 4MOZA 4XUGA 4MY9A 3HGJA 1HG3A 1S5VA 1Q6RA 3FOKA 4Z1CA 1F2JA 1TMHA 3MJYA 5HMSA 1WBJA 4LU0A 2R91A 3KOFA 3TH6A 1GYNA 1OFOA 1FWRA 3LGEA 5LGXA 3NVTA 3M5VA 5DBUA 2A0NA 4O18A 3GAKA 2DZUA 4LC8A 1W5QA 3TMLA 5DCBA 3T40A 4NX0A 3LTYA 3EWXA 4PCFA 3CWNA 1H61A 4I7UA 4OV9A 3F4WA 1OF8A 3L65A 3DI0A 3FKKA 2BZNA 3LBCA 5CPNA 1XBXA 3TSBA 3TA6A 3SGZA 4UTMA 4N9CA 4R33A 1W1ZA 1EUNA 5U4NA 5KZEA 1GG0A 1B57A 2GQ8A 1TQXA 3THAA 2QJGA 4MFDA 4HNUA 4AXKA 2Y7EA 1OX4A 4CCCA 3BW4A 3W1TA 1PE1A 5KITA 1YTDA 3STGA 1QO2A 4JX4A 3ZFHA 4DPQA 1VQTA 3L21A 3W2MA 1TRDA 1FXQA 3L2IA 3N9SA 2X16A 3QRHA 1TPWA 4CCDA 3GDRA 1H7PA 5K7JA 3DI1A 1KFCA 3OVQA 1DHPA 3LHYA 4QISA 3NQEA 2Z6IA 4KKXA 1SO5A 1MEWA 3JRKA 4XQ6A 3LCIA 3AO0A 3NQMA 3UD6A 2WNNA 2Q3RA 3N2XA 3LB0A 1H7XA 2P0OA 5C55A 3NQDA 2FJKA 5FI8A 3NL3A 3W2NA 5AC7A 2Y88A 4M6PA 3RLUA 1YTKA 1JCJA 3RF9A 5F2GA 6ALDA 3JS3A 4JIPA 2RDWA 3UWZA 3BARA 3EX4A 1A50A 3QZEA 4AAJA 2C14A 4TR9A 1YYAA 1JCYA 4O28A 1LOSA 1QCWA 2ZZ5A 4BI5A 3EWWA 3STEA 3M9YA 5F1UA 1FX6A 1HUVA 1EWDA 2GJLA 4E2DA 4LVFA 1X7FA 2NV2A 2YW3A 1JUBA 3GZ3A 4CCEA 2FPTA 4DF1A 2VKZG 4R7JA 4AHPA 5G2IA 1G4TA 3LRMA 1SQ7A 5AHMA 1OFPA 8TIMA 2CZEA 3TFCA 3RNDA 3BW2A 1TCDA 3GDKA 3P5YA 4OWGA 4GC4A 2VELA 3TKFA 2X1RA 1GTHA 3M43A 4MJZA 3NR0A 2AGKA 4FXRA 4O14A 2CFFA 2HSAA 2BTMA 2NUXA 3EWZA 2Y6ZA 2CLIA 3ABQA 2ZZ7A 3LI0A 2V30A 4GBUA 2VEPA 1X1ZA 1TRIA 3QSTA 1OX5A 3W7QA 3A5VA 1IGSA 2QUVA 4FF7A 3P81A 4MYXA 3W7JA 5AC8A 1LCOA 3L0GA 3B8DA 3CB8A 3NYZA 5AHIA 3WFAA 4MLRA 3W7IA 2ATMA 1VH7A 4LS0A 1Y0EA 4QM1A 3WJXA 2NX9A 4N2YA 4NJKA 1XL9A 1F6KA 3DHFA 1SW7A 3S1WA 3OVRA 1DL3A 3TW6A 3GK0A 4RXGA 3PUOA 4OQVA 1HFBA 5E93A 5HR7A 3QYQA 2VXNA 1QPQA 3GB6A 4UR8A 5TQLA 1EIXA 3IVTA 1GVFA 1WAUA 3ANYA 1GVQA 1R46A 5L9FA 4IQLA 3W1AA 1UUOA 5LNSA 1A5SA 1DOSA 4A22A 1K7EA 3IIZA 2QUTA 3M47A 1QPNA 3HPXA 2WOQA 2XFWA 2AQWA 3PY2A 5CSSA 4OU1A 1U83A 2XN1A 4MY1A 3SR7A 3LM7A 3NQAA 4RZ5A 4EWND 3EXSA 4N9EA 3KXQA 3O6YX 3L68A 1N7KA 2YDAA 1WYIA 4FX7A 1GPWA 4EVZA 2XN0A 2O7SA 3GLCA 2E6FA 1T99A 4JTIA 1K8XA 2V2DA 5HWMA 5AN7A 3VFLA 4UTLA 4RK8A 2R94A 2JKEA 4XTIA 1JRBA 4JTKA 1ME7A 5FEWA 2VFFA 1XC4A 3W83A 1XUUA 5D2TA 5HNRA 4O4VA 4IUOA 3R89A 2VFIA 4O19A 4K8HA 4G1KA 2F7FA 1PS9A 3GVGA 1ME8A 3IEBA 3N73A 5LNVA 3BLIA 3GAYA 5D2XA 5T26A 3OG3A 3CU2A 4FNSA 3W7KA 4UFLA 3IGSA 1A53A 4K37A 3YPIA 1RVGA 4H6KA 2I1OA 4XWUA 3O16A 1SO6A 1FQ0A 1YDOA 3O6CA 2NLIA 2Q3OA 4O52A 1LROA 5DCDA 1S3HA 4NU7A 1OX4B 3QMSA 3TW7A 1FCUA 4O1DA 3C6CA 2YYUA 4O50A 6TIMA 2OMAA 3W7OA 1PIIA 1KW1A 3GNNA 2NUWA 4UCGA 3GR7A 5H2ZA 3FA5A 4BFAA 3W2JA 5LGZA 3W1UA 4N4QA 4W9TA 3LHTA 1YDVA 3QPYA 3LX9A 5BNKA 2OX1A 1R2TA 3DZ1A 3S5NA 3W7HA 5DELA 4MZ8A 2QJIA 1TIMA 1F6PA 2G96A 5F4WA 3OHIA 3ATZA 4RZ6A 3M1ZA 3NPUA 1EX5A 3HOJA 5D09A 3G22A 5KTLA 5BMWA 1LYXA 1HO4A 1X6UA 1X8FA 2DZXA 3N34A 3QJAA 2RFGA 3TJLA 3P62A 4MUZA 2OJPA 3UNDA 3ZWSA 1R2RA 2VFGA 1YDNA 2WSQA 3DBPA 4MPQA 4FNUA 3W1LA 1DQWA 2C16A 4O12A 2KZHA 1JR1A 1H50A 2WPBA 3G0SA 1GT8A 1KA9F 3S5OA 3CPRA 1G4EA 4ZL1A 4E38A 2GJNA 2IQTA 4MIMA 1W37A 4EOUA 3OIXA 3W6YA 3P7YA 3NZRA 4TX9A 3LCGA 3FJLA 1OFRA 3P80A 1WA3A 2Z0IA 5K4XA 4LNYA 5G2WA 3EWBX 2NWSA 1FWNA 5CPLA 1GQNA 4H4IA 1JCMP 3G3DA 1LTDA 4YLWA 1N8FA 4WD0A 1LZOA 4NX5A 3T7VA 3WJWA 1AW5A 3LCXA 4O16A 4CNNA 4O1BA 4NZFA 1B3OA 3TC7A 2ZRZA 4LY8A 4LV9A 4IMGA 3QH2A 3UZ5A 1LRNA 1SZNA 3TE9A 1XBZA 4WY0B 3I65A 2CU0A 3CTLA 1C9DA 3B06A 2C15A 3S6DA 2FPVA 1R47A 3EEGA 3TCEA 4UR7A 3WK3A 1QNVA 3UWQA 2BXVA 3VE9A 5LSMA 3EX1A 1YPIA 3EWYA 4O10A 5G1YA 1G7VA 5EMUA 3DKLA 4N4PA 4HNTA 3M16A 4XBKA 4D2JA 4WJEA 5EPDA 3NL6A 2GVLA 3C2FA 3CC1A 3HGSA 3SY5A 3VCRA 1UASA 2VOMA 4PH6A 1GEQA 3MP4A 4JDBA 3TROA 3FS2A 5BMXA 1IXQA 4JYDA 3MYOA 3TR2A 4UUIA 4M6VA 5MHBA 3U2OA 1IXNA 1RR2A 1W3IA 5SWUA 3EB2A 3SJ3A 2WNZA 2E1DA 4RXFA 1OK6A 1UUMA 2A2IA 2NXGA 3NM1A 3HB9A 2X1SA 1GWJA 3LLFA 3KRZA 5LZLA 1NVMA 3Q58A 2D73A 3PBWA 3SW6A 2O7QA 2WJZA 4EF8A 4RJEA 5TIMA 2ZBTA 1O60A 1QAPA 2ZFAA 3G18A 4POCA 3B04A 4HKPA 4JNMA 3G1HA 1FWWA 1HO1A 1ZAHA 2A21A 1P0NA 3DFQA 2OZ0A 2QJHA 1ZALA 4UMBA 5FF2A 2NV1A 3QPZA 4JN6A 3PULA 4GE8A 2A7NA 5KSWA 3HO8A 4Z08A 2ZA2A 1WV2A 2QCMA 4NZJA 3TX9A 1AK5A 3TNOA 4CQ8A 5BOOA 1XUZA 1F7BA 4BI7A 3BPWA 3PS7A 1TPUA 3W23A 3CEUA 1IXOA 3QSRA 3IRDA 4WXZA 4N02A 1DKWA 2ZDRA 4JTTA 1CW2A 1Q6LA 2CLMA 3DKJA 5E0KA 1K7XA 1XKYA 1GVSA 4PFMA 5E1QA 5IBXA 2NXIA 2ZZ3A 4QQ3A 3F4NA 4LWWA 3W7EA 3PG8A 4GWEA 4UTWA 1PCKA 1M7OA 3Q2DA 4UTHA 2G97A 1MO0A 3FFSA 1SZGA 3TQ0A 2GVGA 3W2KA 3CM4A 3GDMA 2W79A 5IM51 4JS3A 4N9DA 1QO5A 1H7OA 1ML1A 3TV8A 1ME9A 3G1YA 2YXGA 4MLJA 1QOPA 1SR9A 1SZEA 1SU5A 2C19A 5D2WA 1QMLA 4TIMA 4DF0A 3O07A 2QF7A 4IOTA 2E6AA 2E5CA 1E51A 3O06A 2P10A 4X22A 1EA0A 4X3ZA 4DQWA 1FDJA 4LS1A 1D3HA 1JVNA 5LKYA 1B4EA 3S5ZA 3INPA 1YADA 1B4KA 4DBDA 4UFHA 2H90A 3FKRA 1OFBA 3W1XA 1J4EA 4DPPA 2DP3A 2ZA1A 4YCOA 4NJIA 1I45A 3S1XA 4UFMA 3NQGA 2QAFA 4LV4A 1ICSA 1VHCA 1JQVA 4Y90A 3NXFA 1Z41A 1GG1A 2CLOA 3PG9A 1UJPA 3LDVA 4QSHA 1VJIA 3G3MA 5I3FA 5HQEA 3RFAA 5FESA 1TPEA 2A7RA 2EKCA 4ADTA 3LLDA 2V5LA 5C54A 3R13A 1GJPA 3E96A 2CLFA 3CIWA 2VENA 3BV4A 3WK1A 1KM1A 1ZAIA 2FB3A 1Z48A 3P82A 3IGUA 1AL7A 2ZRVA 4O8RA 4ORIA 4S2CA 3NQ8A 2ZRYA 3HG3A 3QEZA 4QIUA 1U5JA 1LRTA 1FBAA 3HG2A 3P84A 5D04C 4QNEA 1TJRA 1VYPX 3CIXA 4K6AA 3G24A 4UC5A 1ZY9A 4KFNA 3NM3A 4U4MA 1P5BA 2I14A 1SO4A 3FLUA 3W71A 1LBLA 3ZR4A 3LERA 3BO9A 2LLEA 1UCWA 2UV8G 4MJMA 2WQPA 3N14A 4NJHA 2JK2A 3BLEA 3H54A 2A6LA 4PEKA 3MW7A 1XDLA 3NQFA 3UWWA 3GDTA 5EY5A 3CHVA 1LDCA 1FCVA 3FEMA 4C1LA 2BWGA 3NDOA 1EPXA 5LNRA 3WJSA 3RLVA 2B0MA 3I6RA 4EIVA 4JTLA 4YXGA 2DZSA 1C29A 4E2BA 5BRBA 2V82A 3VNDA 3ATYA 2EF9A 4ZVJA 2Y89A 4GUFA 4UFKA 3NQ2A 4MY8A 4A3UA 1QFEA 4FEZA 4CNOA 1XBVA 5DXXA 5HWJA 4GFSA 2CLKA 3TUUA 3S42A 1L6SA 5D33A 2QDHA 2HTMA 1W3TA 5A8GA 2Z1BA 1JCXA 2ZZ1A 3O6DA 2TRSA 3C0JA 4UNLA 3W73A 1TV5A 2PRMA 5GVJA 2YFOA 4WX2A 2ZRWA 3OBKA 1V5XA 5EYWA 3MBDA 4WXYA 1PHWA 3T78A 3ELFA 4PODA 1AW1A 4A29A 3C2RA 1ZHAA 3CT7A 1IIGA 4CQ9A 4JTHA 3TSMA 4RLIA 2Y62A 3B0UX 2FTPA 1AW2A 2ZA3A 3MI6A 4FX8A 3KVJA 1DORA 1G4SA 3IGXA 3B4UA 3L0KA 4NJJA 4A2RA 1A5BA 3FJ6A 3MP5A 1EP1A 4JX6A 4ZQMA 5D2VA 1VHNA 3W75A 1M5WA 2QDGA 4KWVA 4UFJA 3W1RA 5DY3A 4IX2A 5HWNA 4QJ1A 2Y85A 2V81A 3LXAA 3N19B 1G69A 3F1QA 1LLWA 3P60A 2QKFA 5TBOA 2H3BA 1VRDA 1GTEA 5IBXC 3E02A 3W72A 3EKLA 3QF0A 5F4XA 3G1AA 2YZRA 3KVLA 3PSWA 4PL1A 3W70A 2DORA 4OHQA 2NX1A 4UTWC 3QM3A 3DFNA 1HTIA 3FYOA 4QITA 2B4GA 4IXHA 3ABOA 2E6YA 3G1DA 3HPSA 4MZYA 4UTJA 3PC0A 3P8JA 1CX9A 2Q8ZA 3BG9A 4YWIA 3T44A 3E9AA 1AL8A 5G4EA 3EX6A 1VCVA 2YCEA 4KFPA 1LOQA 1LM1A 2PE4A 3W3OA 3HG4A 3T55A 3M44A 1VC4A 3RU6A 3SZ8A 3I7SA 2VEMA 1W3NA 2W6RA 3OA3A 4LW7A 3A24A 4FIRA 4N9BA 1FWSA 2Q8LA 3R2GA 3W7DA 2DJLA 1R2SA 4BWLA 2RKXA 3D0CA 3LCHA 5G4WA 1NFBA 2RHGA 4PA8A 3Q37A 4YCPA 4O54A 4ZZ9A 3USBA 3BG3A 1MZHA 4GUIA 3NOEA 3E0IA 4NQ1A 5DN1A 4FNPA 1DBTA 2V2CA 1JQXA 2J88A 4O1AA 2G5WA 3Q94A 1ZAJA 5I3HA 4DF2A 1SW0A 3G8RA 4JTJA 3NAVA 1WX0A 2Y7DA 5CGQA 4K7YA 3DXIA 4IMCA 1JJKA 1THFD 2Z6JA 3TXVA 5F4SA 3M5ZA 2YW4A 3W86A 3W2LA 2BSLA 3G1XA 1LP6A 3P67A 4O0KA 1GZGA 1JRCA 5BW6A 2CLHA 3I7QA 2WO5A 2AAMA 2H8ZA 3MBFA 4RCXA 1BWLA 5FEZA 1UBSA 4AB4A 1Q6QA 1TSIA 4FXSA 1IXPA 3KRUA 1LBMA 3RMJA 3KRSA 4LUIA 1DJNA 1G67A 4WOZA 2EPHA 5H91A 1ZCOA 5KZMA 4Q4KA 3UQNA 3NGJA 4FIQA 2B7OA 2B7PA 3LHZA 1ZENA 1SW3A 3S8HA 3M7WA 1SSGA 5FF0A 4HT3A 3C2EA 1I8JA 1OABA 3PM6A 3LXCA 1A5AA 1TV8A 1ZNNA 1H7WA 3TXZA 2ISWA 2X1TA 1JULA 1XXXA 2GPTA 3QC3A 1EWEA 4NNAA 4LVDA 1O4UA 4HSNA 3NZ1A 1HL2A 5K9XA 1FDZA 5L6UA 4P61A 1XDMA 3N2MA 2FIQA 1P0KA 3GYEA 5G1TA 3GXNA 5D30A 1NEYA 4XTDA 4LVGA 2YFNA 5K4ZA 2PCQA 3WJZA 1TPVA 1OFEA 3NL5A 3W7GA 2QCCA 5LNUA 4AWSA 4NXSA 5G5IA 1ALDA 4TO8A 4LTSA 5D2YA 4JR5A 4X2RA 2QCNA 2Y7GA 5FEPA 1D9EA 5CZTA 2RDUA 1TREA 1P1XA 1V7YA 1GVOA 1FWTA 3GXPA 4X9SA 3F03K 3LHWA 3QMRA 4JX5A 5EA9A 2NZLA 2J24A 3L66A 1KV8A 2R14A 4JTUA 1AMKA 3DH7A 2DZWA 3QW3A 1QPOA 4GXMA 4HPXA 2Z2UA 3LRLA 4DELA 2JKAA 1FDYA 2ZTJA 1K03A 3HPZA 1YLVA 3U6WA 2TMDA 3A9IA 4DO4A 3DENA 1K8ZA 4PC8A 1OYCA 1S5WA 3U8GA 3P8IA 3LTPA 4L4LA 1W5PA 5FF3A 3G1SA 3LCLA 2YYTA 3MHGA 4DEFA 4ORMA 3DU0A 3KVMA 3PBYA 3W7MA 2WSRA 3IIPA 4NVTA 2P1FA 5D02A 1W54A 4ZQCA 3PBUA 1QOQA 3M0ZA 3NQ6A 2V8ZA 1VGAA 3W1PA 2YGYA 1OJXA 1TO3A 1D3GA 3W2UA 5LHEA 4JTGA 5DCEA 2FQIA 3I7RA 3NPXA 2OT0A 3M5YA 2X30A 3FYPA 5CZJA 4IMFA 1KTCA 3CLMA 4UIOA 4OT7A 1OFDA 3TAOA 3NPWA 1ICQA 2A1YA 3K30A 1OYBA 2QCLA 4O53A 4AWTA 2E68A 1K02A 1RD5A 3EX2A 5CPOA 4Q32A 5KMYA 1ZFJA 2EGZA 3S0CA 2C3ZA 4K39A 3PAJA 2F84A 2QCHA 3BW3A 3MI2A 2Y7FA 1DJQA 2X2GA 1R30A 3LBMA 2C0AA 1A5CA 4AF0B 5D03A 3A5FA 1SZFA 4NXKA 4M5PA 3NPVA 4BWLC 1X1OA 4UXDA 1H5YA 3IV3A 3MO7A 4JTFA 1TYGA 1KM5A 4S1FA 4FNQA 3LV6A 3KVKA 5HUPA 3W85A 4IMEA 7TIMA 1VCGA 4JICA 5EBUA 1K8YA 4UMCA 1H7NA 4J9JA 3G1FA 4LRSA 3BVJA 1K7FA 2VFHA 3PBVA 3NQVA 5AOUA 1PHQA 4LVAA 2PRLA 2X1UA 5AHEA 4MZ1A 2E5BA 5AYZA 4O11A 4Z1BA 4AH7A 5LNWA 1EUAA 4ZQOA 3E12A 2V5BA 3UZJA 3FIGA 3SSJA 1F5ZA 3W22A 4CLMA 1C8VA 3R12A 3KFTA 1W31A 3DAQA 1I2RA 3UXAA 2FFCA 3MHUA 4ONVA 1JUKA 3SIZA 4RX0A 3ZS4A 2E77A 4XBSA 1MEHA 2HMCA 3RK8A 2E6DA 3C3NA 1O94A 2WNQA 1TTIA 4TMBA 4LVBA 4ALDA 3MI3A 5HJLA 4ZQNA 5CPMA 3PF3A 3B0VC 2Y70A 3GR8A 1K3UA 1J5TA 1XCFA 2A5HA 4M19A 2Y63A 4CQAA 4HSOA
chains in the Genus database with same CATH superfamily
3KBWA 2J6XA 4I5XA 2DUZA 3LTSA 4GRSA 2VC7A 4N0RA 3M0VA 3HMJG 1EQPA 5FD0A 1NAL1 1O5KA 3TSDA 1CWYA 3DYMA 5D32A 4PRRA 1ZJHA 3MWCA 4UB9A 2QNEA 3K4DA 1TPFA 3A23A 3N25A 2J9YA 4H9YA 4Y6GA 4IHCA 4WUIA 1VYSX 4EANA 4I7WA 5D37A 4A8RA 4KS0A 4US5D 1W3JA 2V9DA 3GSMA 5HNUA 4LCSA 1GOXA 4EKJA 4HNNA 3WLOA 3L5LA 4EXAA 1M04A 4JEJA 4NP7A 4WY0F 3PUEA 1VPXA 1BPLB 3NOYA 1NDWA 1GW9A 3K8LA 3NQ7A 4DJDD 2CHOA 4MB1A 4FALA 4Q7BA 4HK7A 1W5MA 3VUSA 2WAGA 4MB3A 5BROA 3BGJA 2XSXA 3TOYA 3THUA 3PN8A 1J0ZA 2NSXA 5CSRA 3B8VA 1KBJA 3UWVA 1DTUA 3NEVA 1DQXA 1ODUA 4S3DA 2FHFA 1JCNA 1ICPA 4U28A 4YVPA 1RXOB 1KRBC 1WOAA 1XRTA 2PTWA 1EOKA 3B03A 3EPNA 4WOQA 4AU0A 2WVVB 1G0CA 3ARSA 3FK4A 2REQB 2NQLA 3RCMA 1KFLA 1QNOA 4RV8A 1HJUA 3T6CA 1ELSA 1BG9A 3S1GA 1CTNA 1HX0A 3PWAA 3GKAA 1XV8A 1TX0A 4H6RA 4FOKA 3PPHA 1I2NA 4OV4A 4NYUA 1Y5XA 2BGNE 4AD5A 5FF4A 1ONRA 4HHPA 2E9MA 4CUCA 4EPBC 1S2UA 1R85A 1QATA 1ITUA 3AJXA 2PWEA 1V3MA 5C0QA 3M41A 3P5ZA 2HDJA 3G0XA 1A80A 4B5UA 3QV9A 2VEIA 1F74A 1U2YA 2H3DA 3M6DA 4GUJA 3OP2A 3H6OA 1JDAA 4UTTA 4GVGA 1ONXA 3QFEA 3M4HA 5E6ZA 2ONEA 3GVRA 2FZ9A 1W5OA 2ZE0A 1RQBA 4MJ2A 4ZSUA 3EDFA 1JPKA 2VFEA 3N1AA 2VQTA 2WKJA 5REQA 2J9ZA 2C6QA 3BANA 3B9OA 5I79A 2QCGA 3CXOA 2BLEA 4LX4A 2J7CA 4UNIA 1C7SA 1V4YA 3ECQA 1PJ9A 5G2HA 1MXSA 1W0MA 4AVFA 1OYAA 3H2FA 1UHVA 2ZXQA 3PTQA 2J7GA 4A05A 2PI6A 3MKKA 2WMGA 8XIMA 4RV3A 1MDLA 4OOUA 3THQA 1Q2SA 4FNTA 4CCZA 1KM0A 3LN3A 2E9LA 2J7DA 3HTWA 1Q3NA 4RE4A 4KMQA 4ROPA 1KCLA 4Z1DA 2X7VA 4LEFA 3STCA 2NW0A 4WQ6A 4JGDA 4Y8FA 3OQ8A 2ZTKA 5BRQA 3SQSA 4RNJA 5DRIA 3LHUA 3LI1A 2PS2A 3M46A 3PZQA 6XIMA 4LS2A 1RCXB 2YBTA 4LC6A 1M7PA 4HPJA 3W7NA 3H22A 1EJVC 5CGTA 4WSHA 1XCWA 2EEXA 3DFSA 4ZE5A 5TAOA 5CH9A 1HKIA 3AXHA 3KLLA 1B31A 4QR6A 4AWUA 3T2PA 2A7PA 2HS8A 5I09A 1R9YA 4G7EA 4S3GA 3VVGA 3JW7A 4QS6A 3VOJA 1E9LA 1XLMA 1OWQA 2XH2A 3GKFA 3QQ1A 3TJIA 4ZMGA 2OYMA 1KLZA 4IPNB 1P4CA 2QDEA 4S23A 2WLZA 3H23A 3KAOA 3WBAA 4D8LA 3HG5A 2AMGA 2CLPA 3SCQA 3VDHA 3QKEA 4IMAA 4AY1A 1YXDA 2D23A 1M9HA 2DU2A 1VBJA 1FH8A 2XU2A 3BLFA 5AHNA 4QLKA 3H2NA 3B05A 1OK4A 1SUXA 3EXTA 3W87A 1ZBCA 5FA5A 1W8SA 3RITA 4WVXA 4NNBA 3DFTA 3ZJ6A 1EDTA 4JFSA 3CAVA 3PK7A 4J2PA 4LBRA 3SY8A 1LF1A 4UNKA 4FOUA 1XW8A 1U5HA 3UY8A 3O1NA 2JEQA 3CEPA 4J3ZA 4HMDA 4Q33A 1LWJA 2GJPA 4LYPA 3TFXA 3B8SA 3HIJA 3WCZA 4LSBA 5A6KA 4FB7A 4O17A 1VAHA 3EPOA 4ROQA 2J27A 2FPYA 4S3FA 4MKSA 1RZMA 1VFLA 1W56A 4UCFA 1B9BA 3UFYA 4ZENA 1DQUA 1TJPA 3OLEA 5F1VA 3KP0A 1RY8A 4LQ1A 3KS5A 2A3CA 4AHQA 1OHLA 1WDQA 3OEXA 1NFGA 3MHFA 1Q45A 4YTUA 1XSKA 2WHLA 2PU1A 3MYPA 1US2A 3OOQA 3FW6A 4QAIA 4OTKA 5JBDA 5GNYA 1YEYA 1RALA 5DEZA 2TSYA 3HBLA 3SCWA 3E2RA 1KKRA 3N9RA 2J25A 1F9CA 4BK9A 4C6LA 1KFKA 4ICNA 2E28A 4FO4A 3H2CA 3LNMA 4UTIA 5A5WA 1QI4A 2PP0A 5A6SA 1RD6A 3ABSA 3TC3A 1H1NA 4GYPC 3IIXA 4O1FA 1JXKA 2GGEA 1E4IA 3ARRA 5AB3A 4ML4A 1TWIA 4JEQA 3UG3A 3B8IA 5EL1A 3F5LA 1EF2A 2REQA 4P8XA 4L9XA 5C9RA 1F4AA 1T7LA 1MUCA 4Y2WA 3GTHA 1YNQA 2DZPA 1KM4A 5H1WA 2BV9A 3C52A 2XGZA 1B3VA 1IQ8A 3TYCA 3QGKC 1WZKA 3AXIA 4XIMA 3A9BA 2C13A 5D38A 4BQ2A 4B9ZA 2BGQA 1CT5A 4OBTA 1WQ5A 4ZTYA 6CGTA 3C56A 5A6TC 5LA1A 2BMBA 3GTIA 4P2VA 2RUSA 3AISA 3QMTA 4GUGA 2YB4A 2ZZ2A 4C6BA 3UR8A 2PDJA 3KZPA 2ISVA 2V2HA 5ABFA 3MDWA 3PZ9A 3M6YA 2EJAA 3PB2A 1PDYA 2ZC1A 3W00A 1G7UA 1Q4NX 5EFFA 1VIWA 2QUUA 4I6KA 3C0SA 3L12A 5HINA 4WGHA 2RDXA 2C8NA 3E5BA 4Y9PA 2E09A 3M0YA 1Z44A 5FJOA 1WCGA 1BVZA 2GDQA 4DVOA 4C6EA 1NY1A 1XG3A 4CU7A 2OVLA 4LEQA 4FAMA 4M8UA 3IPWA 2YBUA 3WEZA 4J3WA 4MYAA 3CGTA 3UPBA 1Q8JA 2QF8A 3T2QA 3GS6A 4Q4MA 3M64A 3VDCA 3WX7A 2DVUA 3P0WA 1Z8AA 3AIQA 4H8VA 2PDNA 5I23A 2VM8A 4IJCA 4Z1CA 1TMHA 2PLKA 1XINA 3KEHA 5HMSA 3VNYA 5AC5A 4QJ3B 4LU0A 1UH2A 5JVLA 2P8BA 1OFOA 1FWRA 3NVTA 1Q7QA 2BGSA 3MJMA 3GNPA 3OQEA 4NX0A 3EWXA 5I78A 4PCFA 4HU0A 4TOQA 1H61A 4GMEA 1WUEA 3VOFA 3UJSA 7ODCA 3FKKA 3S5SA 3B97A 1W3LA 5CPNA 4TTUA 3SGZA 4UTMA 3AFBA 4R33A 4DX3A 4DWSB 4MADA 1YX1A 3TOPA 4IH3A 1MFUA 4HNUA 1EHAA 1XPYA 1R3RA 2BHYA 4CCCA 3PAOA 4DBWA 1YTDA 4UQ9A 2VQUA 1EBGA 2XWEA 1DEDA 3L21A 2VZTA 4EPKA 2WSKA 4JQ3A 1FXQA 2X16A 4CCDA 3EAUA 5K7JA 3DI1A 4NI8A 3OVQA 4QISA 5FJJA 1UR0A 4IT1A 4KBXA 1SO5A 4XQ6A 2WSPA 4FLRA 2CPUA 2WNNA 4GG9A 3LQGA 3NQDA 3WF2A 2ZWYA 4AQLA 2Y88A 4IG2B 2XH4A 3WKZA 3GO2A 3JS3A 3ZM8A 1SFTA 3BARA 3EX4A 3QZEA 1NOUA 2PLJA 2BBFA 1YYAA 4O28A 1QCWA 2ZZ5A 3R10A 3EWWA 3SRDA 3AZTA 5F1UA 4C1NB 2CKRA 1HUVA 2A79A 3MVIA 1OT1A 5I2UA 1VFTA 4FLSA 1KB3A 3GNRA 4GISA 1RLDA 5ECUA 4AHPA 5HJXA 1SJBA 1SQ7A 2G3FA 4W5ZA 3SRKA 1Y7VA 3LMZA 1TCDA 1NQKA 4OWGA 2VELA 3TKFA 3IACA 2YL9A 3AAMA 2CFFA 2ZX5A 2PBOA 3UCQA 1GOMA 3HN3A 1KCKA 1U22A 2PWGA 1OX5A 2VP8A 3W7QA 1IGSA 4FPSA 4MWAB 3W7JA 3L0GA 3G6MA 3NDYA 4G56A 3CB8A 4V1YA 1UD4A 4MLRA 4INFA 3W7IA 4X2PA 1Y0EA 1T6MA 2NX9A 3UBPC 5DMMA 2Y1HA 2XZ7A 4L1WA 3ZT6A 3TW6A 3TJ4A 5M1TA 4KESA 4A8LA 4NG3A 2VGFA 3CH9A 2VX5A 1W8GA 3QR1A 2W62A 3GB6A 4BJHA 1I60A 4PRWA 4FS9A 5LNSA 5HDRA 1DIKA 1DOSA 1JI1A 4PCTA 2V5DA 3SJNA 2OQHA 2XFWA 3C0QA 5CSSA 1BF2A 1TFVA 1K6AA 4EWND 5M5DA 4LAKA 4B3LA 1SMDA 3AMDA 3OPSA 1LG1A 4N9EA 3GXIA 3O6YX 3L68A 4LF1A 1WKEA 1WYIA 4GJIA 4Q8QA 2INFA 2DDXA 1K8XA 2P50A 3DN5A 5AN7A 3VFLA 3MV11 4RK8A 3DBNA 4AY8A 4XTIA 3WD4A 2D1ZA 3KTSA 3VNKA 2QV5A 1WPCA 3W83A 4ATDA 1XUUA 4WKHA 1B30A 4EK7A 4UTFA 2XIJA 1HJWA 4ICCX 1PIFA 1Q6FA 2F7FA 4M80A 1ME8A 1DWGM 3CPUA 3IEBA 3AUJA 1W1IE 3AHXA 5KEZA 2EBNA 5DQPA 4FNSA 2Y5EA 3W7KA 4C5ZA 2JE8A 1P1MA 1LQ2A 3IGSA 1RVGA 5ECVA 4H6KA 4XWUA 2OGYA 2ZDSA 4H8NA 1GKRA 3L4XA 3W4RA 3SCPA 3OZOA 2WB5A 2DSWA 2Q3OA 3O6CA 4OECA 3CUGA 1S3HA 1QK2A 2GK1B 1OX4B 3OG2A 1FCUA 3PJTA 1TVNA 4O1DA 4B9YA 4AX7A 1E3XA 1TMLA 4PMVA 1PIIA 4V2XA 1AQHA 1P0DA 2YZ5A 3GR7A 2I9UA 3SM0A 1E1EA 1WXZA 3FA5A 3W2JA 4BFAA 3U4FA 4F66A 1YDVA 2YL6A 3TNBA 3S5NA 1OEPA 4JL1A 5DELA 2ISDA 1AQ0A 2QJIA 2G96A 1F6PA 2ZXBA 1VJZA 4RZ6A 3TLQA 4I6VA 3HOJA 2OTDA 2YA0A 1JCTA 2DZXA 3N34A 2RFGA 1WNOA 1EJWC 3ZWSA 1PKNA 1R2RA 2VFGA 3DBPA 3RAOA 4FNUA 3TCSA 2C16A 2DFAA 3KBSA 4O12A 5CC7A 4P7LA 3S5OA 3CPRA 4IPPA 5JU6A 5EU9A 3RR1A 2GJNA 2IQTA 4Q4QA 3OIXA 3DX5A 4PMNA 3XISA 4HPHA 3NZRA 3LCGA 1FWFC 1CGTA 3KCJA 4LNYA 4DWSA 1JAEA 3Q4DA 4PMXA 3EWBX 1S46A 3CHDA 3KRBA 3PBGA 3PZGA 3D46A 3N11A 1EFZA 2W3ZA 3LM3A 4Q4SA 3T7VA 2PF0A 1AW5A 2WZIA 5GNZA 4O1BA 2ZRZA 1IEXA 3CZJA 4LB3A 4PB4A 3QH2A 2W9MA 1SZNA 1U1UA 4U5IA 3TWAA 1LLOA 1C9DA 4ZO8A 1QI2A 2J47A 4GX8A 1XG4A 4IG2A 3CV1A 2BXVA 2GZXA 2QJJA 4M81A 3VE9A 5I6SA 5LSMA 1OC5A 4O10A 4CQDA 3D47A 4A4AA 3AALA 5EMUA 1X97A 1HJVA 4N4PA 3PJWA 2OEJA 2GVLA 3NL6A 3C2FA 3HGSA 3V7PA 4DRSA 2RGMA 1J0HA 3I3BA 4QRNA 3VCRA 4C1NA 3OLIA 2VOMA 4DYKA 3MP4A 4KT2A 3MUIA 2G41A 4LBUA 3MYOA 1V02E 3KBNA 5DO8A 4E3TA 2UY2A 4H41A 2IPGA 4M6VA 3BLLA 3ARVA 3AXMA 3QTGA 1A3HA 9XIMA 3OLGA 3SB0A 2D2JA 4P5UA 2O9RA 2A2IA 4GIEA 3NM1A 1BRLB 1A5KC 4C7FA 1GVEA 5CSYA 4BA0A 4RJEA 4KEMA 3IJQA 5FSDC 3A4XA 3FYYA 4EXQA 1QHPA 4POCA 3N6JA 4MWAA 3UPMA 2CNCA 3WQFA 2UY4A 1ADSA 4WLCA 5LA0A 4UMBA 1DJWA 5JIPA 4LGXA 3WFZA 1WV2A 3ZOAA 2WM1A 2VTFA 4L6DA 4YU1A 1BVWA 1A3XA 3HV8A 4QX4A 1JZ4A 3VILA 3DG3A 1KBLA 2Q6ZA 3PS7A 4C5YA 1GVIA 4WXZA 4PBGA 2YDRA 1QI3A 3IAQA 3URAA 3AMCA 3RRAA 2CLMA 5E0KA 3RDKA 3S83A 1MDRA 1GVSA 5E1QA 3BOFA 1WE5A 3TYUA 3F4NA 4LWWA 2P5NA 1M7OA 2WC7A 3Q2DA 4IISA 3EWCA 2O9TA 1SZGA 3W2KA 3GDMA 1KCZA 4JS3A 2ZE3A 1H7OA 1ML1A 1E71M 5T91A 3G1YA 1QMLA 3LSCA 1RK5A 1SJCA 1ENUA 3KL5A 5A8NA 4IOTA 3VGBA 3BCDA 2E5CA 1E51A 1CGYA 2P10A 2ACSA 4X22A 1GEHA 1J0JA 4HA3A 4M29A 4J1OA 3W81A 1JVNA 1ZJAA 3DG6A 1FFRA 4QEHA 3GTXA 2R1PA 4HZMA 3IWPA 4DBDA 1NIUA 3RXZA 5E0FA 1TCMA 4HP5A 1BHGA 1CYGA 1NDVA 3NUKA 4ZODA 3UGRA 4DPPA 2DP3A 2GK1A 3WH6A 4U3AA 1IZJA 3FCPA 3GHUA 3NQGA 3ITCA 4IGSA 3W6LA 2GVEA 3A12A 2IW0A 2CLOA 3PG9A 3AHTA 4P8WA 3U7BA 4H19A 4QSHA 3ARQA 5I3FA 5G1MA 2E8YA 3CQJA 3LLDA 2V5LA 3R13A 4H7VA 3E96A 3AQUA 1K6WA 1Z48A 3IGUA 2FHBA 1JNEA 4BF5A 4HZ6A 3P84A 1VYPX 2GSHA 5LXXA 2C71A 1LT7A 1SO4A 2WBGA 4I8YA 1ISZA 3NFUA 1BQGA 1LBLA 1OD0A 3S6OA 4XB3A 1IEVA 2LLEA 4JFVA 2HBXA 2GSJA 3IUIA 4H6EA 1RJPA 3K2GA 3SN1A 4J3XA 2A6LA 3WLLA 4M1BA 3KOWA 2D20A 2DSVA 5H8PA 1L6FA 2IPFA 5EY5A 3B8UA 3EZ4A 1FCVA 3C8NA 4RNFA 4TVUA 4S38A 3WJSA 2XIIA 5JMUA 2QULA 3RLVA 4JKKA 4EIVA 1C8QA 4E2BA 5BRBA 2EF9A 2CHNA 4ZVJA 2L5HA 4UFKA 3NQ2A 3VGEA 4B4HA 3CMJA 2QQ6A 1XQKA 3WDHA 2ZICA 3GG0A 4WK9A 3MSYA 1NTHA 4E8GA 1W3TA 3WLNA 4PUNA 3M0XA 4W5UA 1IWPA 1QXLA 2EJ1A 1DJHA 4UNLA 3VU2A 3VAVA 5CC3A 3NZQA 3KBJA 2PRMA 3PNZA 5GVJA 4WX2A 2PDYA 2JIEA 2XG9A 1PHWA 3ELFA 1AW1A 4PB3A 4E4UA 1E6ZA 1WZMA 4CQ9A 4Z2KA 4RLIA 3B0UX 2FTPA 3FJNA 1MI3A 5CXPA 5CPTA 3IGXA 4HB7A 3S47A 1A5BA 4LBSA 1A47A 3CZLA 4RDYA 4ZQMA 3W75A 2OOGA 5DY3A 4IX2A 4PBEA 3WQOA 2Y85A 3WDQA 3P60A 1E0TA 4IUGA 1HKMA 3E02A 1WDPA 5JH1A 1VFSA 4UOZA 3G1AA 1ZP4A 1Q6GA 3D3FA 3W70A 4UTWC 4XZHA 1J12A 2WMJA 3QM3A 2J13A 3LD5A 3CYJA 4B92A 3LPPA 1HTIA 3A3HA 4AD1A 4KPLA 4QITA 6TAAA 3ABOA 3VZYA 1BRLA 4GQGA 3PC0A 2Q8ZA 4HNOA 1A4LA 4V1XA 1WDDA 2GYIA 1GQLA 2OLAA 2XZ9A 3W02A 1VCVA 2YCEA 1XLKA 3T55A 3FHQA 1VC4A 3SZ8A 1XLHA 1ZZMA 3I7SA 4KEZA 2Z2BA 3U2EA 3OA3A 1PO9A 4LW7A 4JIEA 4FIRA 2BVDA 4N9BA 4DM2A 3ZJKA 4BWLA 1QU4A 1E15A 3Q37A 2ESCA 3BG3A 5IFPA 2HQAA 3FA3A 1ZBVA 1JPIA 4FNPA 3P6LA 2J88A 3QTPA 4O1AA 1UWTA 1R6WA 3MC5A 1DJZA 2G5WA 3VZZA 3QN3A 2X09A 4B5TA 4QP0A 1GHRA 4Q8NA 3G8RA 4HA0A 1K4HA 4D8ZA 4JTJA 2CESA 4XSMA 4AVNA 1E0UA 4FR1A 3OO2A 2XGIA 5CGQA 1THFD 3TXVA 1GGOA 5F4SA 3M5ZA 3W86A 1LP6A 1EJTC 5BW6A 4YS1A 2WO5A 2AAMA 2H8ZA 4ZCWA 4RCXA 1UR2A 5FEZA 2E1WA 4DUXA 1I75A 4LUIA 5H91A 2XINA 4Q4KA 3UQNA 3U2CA 3LHZA 2O55A 1CLXA 3MPGA 4E5TA 1X39A 1I8JA 1OABA 2CKSA 2Y2WA 3BWWA 1ZNNA 4RDZA 2X1TA 2IQDA 3N3TA 1ADDA 3QC3A 1H0GA 1OC6A 1VFFA 1UG6A 2J78A 4AZCB 4W7VA 4JCLA 5I24A 3WO8A 2BASA 4S3BA 4CN4A 3R8GA 3L2LA 4FR6A 3VDBA 4NRSA 1YE6A 4GABA 3ORWA 5A69A 4QAWA 2PDUA 2PCQA 3WJZA 1OFEA 3SUTA 3ZQ9A 4AWSA 4DXKA 4G2DA 3DECA 4X2RA 2QCNA 3AMLA 3IUHA 2HE5A 4F4RA 2G8ZA 3AIRA 3L2MA 4LAUA 5DMYA 2XUCA 2J24A 1FWDC 3WDJA 3QW3A 1QPOA 4GXMA 5BOFA 2Z2UA 2BS9A 3I3EA 2DW7A 4CU8A 2OSWA 1V6XA 3SCSA 3U6WA 1K8ZA 4PC8A 3I4EA 1VEOA 1S5WA 3P8IA 4ZXOA 1TA3B 4E8CA 9RUBA 4I90A 4P7OA 2RJGA 2Z1KA 3LBOA 3MHGA 4F0KA 3KVMA 5BU6A 4XAFA 1W54A 5CC6A 1KRAC 4ZQCA 1IT8A 2QPSA 3NQ6A 3WDPP 3K1GA 2C1GA 4ZO9A 1E4LA 2QXWA 4C6CA 5CZJA 2I16A 1KTCA 3REQB 2MNRA 3WQWA 3VZXA 5AKQA 1ICQA 2A1YA 4GC3A 3BAKA 5E5CA 4A3HA 4BY3A 3EX2A 4MTVA 3S0CA 2C3ZA 3BW3A 3VGDA 3A4AA 1VRXA 4HGXA 3STPA 4L5ZA 4NXKA 3VKDA 3BLPX 4UXDA 3PFMA 1H5YA 3IV3A 3CL6A 3MO7A 4JTFA 4ZE4A 4MAVA 3W85A 1HL9A 1VCGA 4HSHA 5EBUA 3AMGA 1XCXA 4R27A 1H7NA 2OX4A 4J9JA 3G1FA 2WMIB 4O8AA 1K7FA 1NARA 2VFHA 3AIUA 4JHZA 3NQVA 3M7SA 1RSCA 3UG8A 4LVAA 5AHEA 1HKVA 4MZ1A 4O11A 1MW0A 2Z26A 1W9XA 1WZLA 3MVTA 3MU7A 2V5BA 1GJUA 3FIGA 4W4QA 1C8VA 1Q5MA 3R12A 4RPQA 4D9PA 4N42A 4ERGA 1BFNA 2FFCA 2NVCA 4RX0A 4JIIX 1E72M 2HMCA 4WHBA 3TYAA 1HF6A 2VZVA 3E2VA 1E1FA 4PCPA 4ALDA 3QXBA 4ZQNA 2VX4A 2HXTA 1J5TA 3D3AA 4GCAA 4REQB 2A5HA 2Y63A 3ALFA 4D6EA 3F4VA 3A3XA 4HSOA 3C2YA 3UNTA 3D6NA 3EMQA 4PMDA 4PMUA 4TX8A 3A22A 2VURA 4UTUA 1CXFA 2E0PA 2J8FA 5DY2A 4TQTA 4J5NA 2H9AB 2YLLA 1UR8A 4Z2IA 4ZQRA 2PGEA 2UWFA 3C61A 2V3DA 4AUBA 1AA1B 4RKAA 5KZ6A 1BKSA 1PZ3A 3G1VA 3HJZA 1LBFA 1XSJA 4BQ3A 2VD9A 1EP3A 2D2OA 2DZTA 4OVXA 2FMNA 1E6RA 2C1HA 2YL5A 3QQ0A 2OQLA 1TPH1 3CPGA 4JIQA 3RO8A 2XFFA 1V6UA 4FHAA 2NXHA 4KWUA 4U10A 3TDFA 1FCBA 1UZHA 1CGXA 3WQGA 3R7MA 1E43A 4XIAA 1B3WA 2DT3A 4K8EA 4W84A 2FFIA 5XIMA 3BJSA 4GX9A 6REQB 4GYFA 2JALA 4ATLA 4EAYA 2ABAA 4FXFA 2WW5A 4IIBA 1EX1A 1WDWA 3FEQA 3S9YA 4JY9A 1H41A 3SGUA 1Z6KA 2VGBA 3N2BA 3WLPA 4QGCA 4N6FA 1M68A 4F2UA 3APYA 4CNUA 3OYZA 4TV5A 2AKMA 3THDA 4RZ4A 5ABTA 2VUNA 4TU1A 4EPEC 2Z1SA 3IVSA 4UFIA 4AFYA 4DNMA 3MCMA 2I56A 2NLYA 2OKTA 4WDWA 2GUUA 4MWAE 4HQVA 4CNTA 1O95A 3RUBL 1VENA 3R4IA 2QCDB 1XIBA 3NQCA 3NO5A 1KM3A 2WHMA 2PDHA 4CGTA 3STFA 3QOMA 1QR7A 4Z1AA 3HGOA 2ZRXA 4QDMA 3PR2A 3VE7A 2FTWA 3W26A 5D9OA 2OYLA 1NSJA 4QG9A 3DGRA 4MDOA 4E3VA 1O12A 3UWYA 2D24A 2PTDA 1A0CA 4YTQA 4KCWA 1IT7A 2F61A 5AC6A 1UC4A 2FGZA 3PFRA 3LHVA 3PTMA 5F2IA 1PWMA 5F2LA 5LIKX 3KOYA 1P6BA 3A21A 1L2UA 2OWCA 4GYPA 3VIOA 1F73A 1KCXA 2BXYA 1XI3A 3V18A 2ISSA 1VCFA 5LXEA 2X05A 3PTDA 5CEWA 3WLTA 5I02A 1JG9A 2Z27A 2JBMA 1QPKA 4NI3A 4JYEA 1TPC1 4W85A 2WBKA 4DXVA 3LZ3A 3B9EA 1DYSA 3REQA 1EZ2A 3N9KA 4GVFA 3C4UA 2XJ7A 1T0OA 4CN6A 1MQRA 4R3UA 2FGLA 3HQOA 1T40A 1JL8A 3W7LA 2VC6A 3K1DA 4HK6A 3VXGA 2Y61A 1QOXA 4B15A 3EXRA 2H6RA 2IKGA 5FJIA 2CLLA 4GZIA 3DC0A 4B4FA 2FGBA 4MB4A 3DHUA 4AW7A 3OIHA 1PV8A 1TV4A 4I7VA 1CIUA 1TX2A 3IJ7A 5AHLA 4IXXA 1OIFA 1QHZA 2BOFX 2ZRUA 2JGYA 3ITYA 1CGVA 3B0PA 3EPMA 4JY8A 5BU9A 1KXQA 2WMIA 3IJLA 1T96A 4AZ6A 3AIBA 4PN2A 3COTA 4RR4A 5M17A 1KFJA 1N8IA 3QGAC 1WBHA 2HV5A 4IL0A 3OVPA 3T4CA 3HGRA 1G4PA 2ALDA 1XM3A 5C7VA 2HEJA 4HN4A 1I2PA 3TK7A 1L9WA 1EL3A 3F4CA 3CZEA 2YLAA 3PSVA 2CZFA 2GLKA 3N3MA 4K68A 1I4NA 2YL8A 1BGGA 1ZUAX 2ZYFA 1UW9A 4NNCA 4PTDA 4U3CA 2GGHA 4L4PA 1OY0A 1FFQA 1BWKA 2EAWA 3CL7A 3WLQA 3W7PA 1KV5A 1JZ8A 2PMQA 1PX4A 5C5YA 3H7UA 3HJEA 3ONBA 1ISVA 4BI6A 3MY9A 4REQA 2GDUA 2YSWA 1E6PA 1EO7A 4LT9A 5AYBA 5DX7A 1LORA 4LNCA 1TKKA 4XVEA 1ITXA 1UD6A 2YB1A 3MTWA 1SFLA 1DTNA 2TPSA 3HQ1A 2QIIA 2V67A 2Y24A 3BAJA 4I5RA 2XFRA 2H9AA 3VNMA 1ZBKA 3SEPA 3BSMA 4C6PA 2EHHA 4L7ZA 1BEUA 1UUQA 1MZRA 5A8PA 3H55A 3L4TA 3PTKA 2PGWA 2XIMA 2OCZA 2Q71A 4AIOA 3WK2A 1AJ2A 3KTCA 1TUXA 3FGCB 1KRCC 1FWAC 4GXWA 1S1RA 1VZWA 3QV7A 1DVJA 4O13A 2GWGA 3VIGA 2NWRA 5DBTA 4LF2A 5H6HA 3VM7A 4NJGA 3R79A 3WDIA 2RH9A 1XDJA 2PRHA 2PC8A 2C18A 1T8XA 2DIEA 4ADSA 5CAKA 3MCNA 3WQDA 1CXLA 1HNYA 3ERPA 5EGRA 4YTSA 3M0HA 6REQA 2PTXA 5E0CA 3T8QA 4KWWA 2QUMA 4E0CA 3GTFA 4RDWA 2J7BA 4S3KA 4D72A 1TTJA 3S1VA 3ZSSA 3UYCA 5AYYA 3CQ0A 4DY1A 1F3WA 4K38A 1MVYA 4YVXA 5FAGA 5M2FX 1T8QA 4L4MA 4J4KA 3MSRA 4BEUA 5B80A 1RA0A 3GRIA 1I2QA 1GZ1A 1XR2A 1JZ2A 2FDSA 4C1KA 3P61A 2QCDA 5C2CA 1OF6A 3I68A 1PEZA 8CGTA 2B7QA 4PL2A 4HYRA 1WOBA 3DHDA 1NH6A 2Q8XA 3WJYA 1VLWA 2ACUA 1S2CA 1UP3A 1I2OA 3CHCA 3FV9A 3BGGA 2P76A 4JNZA 5CZ0A 3O8AA 5JBEA 1AG1O 1H1YA 1MW2A 1NF7A 3LRKA 3NG3A 1XIJA 4ZOEA 1VR6A 3L0NA 3GU9A 2RJHA 3C3UA 3N04A 4NAFB 3V3WA 1AUSL 3GYCA 5K2ZA 4I9AA 1XC6A 3ARXA 2ACRA 2QR6A 3OJGA 3ZVIA 5DMLA 1TV7A 1KFBA 4H9MA 3T0DA 3JR2A 1TJ1A 2F2KA 1TPDA 2QPXA 4IIDA 1FCQA 1Q6OA 2NUYA 1GOWA 2F8QA 4O15A 2A4AA 2FZNA 4O0ZA 1UIOA 1K9EA 4XKYB 2BOGX 1JD7A 3OZMA 1I6NA 4GUHA 4KERA 3KCLA 3BJFA 3H70A 3UYIA 3MP3A 2Y0FA 3SCOA 3PUDA 2QLYA 3UETA 1PKMA 3F2BA 2OYKA 5CCZA 4K7VA 2YPIA 2W92A 4AIUA 4MY9A 3HGJA 1HG3A 1XSIA 1O1ZA 2EKGA 3FOKA 1F2JA 1O6IA 2Z1VA 1VKFA 2R91A 3Q65A 4MUPA 4O18A 5HNTA 3TMLA 3LTYA 2DUAA 4I7UA 5BZAA 1REQB 3CQIA 3VNLA 3TSBA 1S3TC 3OVGA 4DWSC 2V3EA 5KZEA 5D4YA 1GG0A 4XAYA 4ZEPA 1F3TA 4AXKA 3TZFA 2J7HA 2Z24A 4CEUC 3BW4A 3GH4A 3SCNA 3U0HA 2NSOA 1DIDA 4JX4A 4DPQA 3W2MA 3GBDA 5IXEA 4ILSA 1TRDA 4XD6A 4L6HA 4L9ZA 2V3FA 1H7PA 3R0KA 3NQEA 4KKXA 2G4FA 1HN1A 1XGZA 1PSCA 2IPWA 1C8YA 4EPDC 3LCIA 2INZA 3NQMA 3UD6A 2QMKA 2Q3RA 4H8UA 1Q7MA 5C55A 3GG8A 3NL3A 1EZWA 3APTA 3W2NA 4QSFA 3N17A 1YMYA 3UVIA 1NOWA 1NQ6A 3PUGA 3V0SA 5BXSA 4XZBA 5DT5A 1MNSA 2FVKA 4Q4PA 2O9OA 4NYYA 3CASA 2GJLA 4OOZA 2QHAA 3RM4A 1EC7A 2VRQA 1JUBA 3GZ3A 3WEOA 2YCLB 1M53A 1K1DA 5G2IA 3LRMA 5CLTA 5AHMA 1UA3A 2ZUVA 1OFPA 8TIMA 2CZEA 1K9DA 3FGCA 1N8WA 1RJQA 1TWZA 3NGFA 3RNDA 3RX3A 4MGGA 1V79A 9XIAA 2X1RA 3MUZ1 2NQZA 3AYSA 4O14A 4M51A 4BEQA 2NUXA 3R25A 1E4NA 1TWDA 4IGNA 3ABQA 3UR7A 3NJ3A 5AZ1A 4GBUA 3WL1A 1V6VA 3QSTA 1Y8BA 4Q8OA 3A5VA 1J10A 4MWAC 3SBFA 1DXEA 3VK5A 4MYXA 2FZMA 3B8DA 4H6QA 3WFAA 4RE3A 2ATMA 1DPMA 4UOQA 4PB5A 1VFOA 4W8LA 3S1WA 1R5YA 4HMNA 1DL3A 1CB2A 3SQLA 3WLSA 3EGJA 3GK0A 1XLEA 2V6AA 5RUBA 1KD0A 3S9IA 3GC2A 3QYQA 2CHRA 4CEXC 3RPMA 4HOZA 4GPNA 1OIMA 2YCIX 3NVDA 4CN1A 2J7FA 4Q8UA 5FJPA 3M47A 3PPCA 2WOQA 1GOIA 2XN1A 1EC8A 1KXTA 3RN6A 4KCVA 2HWGA 4IP7A 1N7KA 2BDQA 4FX7A 1GPWA 4EVZA 3WELA 1T99A 3LZ5A 1EJ7L 3A64A 3SY1A 3W53A 1G5AA 3U3HA 2R94A 2JKEA 3P93A 4JTKA 1TUFA 4DLFA 2VC5A 4HHLA 4O4VA 2G3JA 4IUOA 1ECEA 2OODA 3EB3A 2VFIA 4O19A 4NAFA 2CXEA 3B0XA 3KBMA 3GAYA 4GD0A 3SUUA 5T26A 3OG3A 4LUSB 4C90A 2OEMA 3PANA 4GI4A 3EBVA 4HZ7A 2IUZA 3DOPA 4MG4A 3LLXA 1FQ0A 1MWOA 3O9NA 1LROA 1US0A 3QMSA 4O50A 5DF0A 4DUOA 3CJPA 6TIMA 4YYCA 1LQAA 2OMAA 1RCQA 3ARPA 2VX6A 2NUWA 4UCGA 2R24A 2TODA 5LGZA 3W1UA 4W9TA 3E0VA 1CXKA 1XFCA 3VIKA 1C90A 2ZUNA 1R2TA 2WANA 1UOZA 4C6IA 1XYCA 4QE4A 2PDXA 5F4WA 3OHIA 4HVXA 2PWHA 2FZBA 3CWHA 4JBRA 4WDTA 5C70A 5D09A 3G22A 3JUGA 3CAWA 5KTLA 1JPMA 1X6UA 3QJAA 1X8FA 4MUZA 2OJPA 3UNDA 5BYWA 3WBWA 2VD8A 2WSQA 2X8RA 3CUJA 4L65A 3NQBA 3PNUA 4K1WA 1MNZA 1JR1A 3FX4A 4AIEA 2YA2A 4D6IA 1V51A 1GT8A 1EGVA 2YDSA 4V28A 5EFDA 1FHVA 1REQA 3N4FA 2PWDA 1W37A 5BXRA 3W01A 3FJLA 3H26A 4GZ7A 4WRHA 1JDEA 4FXJA 5G2WA 3RG6A 4FA3A 1H11A 4H4IA 1JCMP 5I7GA 1LTDA 4LPCA 1LZOA 3SFWA 5A6AA 2ASHA 4B5WA 3AIVA 3BTNA 4YIWA 2ACQA 2WKLA 4LY8A 1RP9A 4LV9A 4IMGA 1NELA 3V0UA 4DNHA 4CU6A 1VD6A 2G3MA 4LALA 3I65A 3LEPA 2PWFA 2O92A 3CTTA 2FPVA 3EEGA 4XD5A 4G8TA 3TCEA 4B5SA 4NZ3A 4QFUA 2PODA 1QNVA 3UWQA 3PWGA 4J3SA 4HCDA 5C9ZA 4NIRA 4X0NA 1CXHA 1BYCA 5CGMA 4D2JA 4WJEA 2IKJA 2PFHA 1KKOA 3AS3A 4M6UA 2X40A 3CV2A 3RHGA 3UGVA 1IXQA 3GZAA 4LY4A 2YCLA 1KC7A 1EBHA 2WCSA 1CZ1A 2DVTA 2J79A 1CLVA 5MHBA 2Z1WA 3U2OA 4R9XA 1RR2A 1W3IA 3BOXA 1JXJA 1XYAA 4XVDA 3BH4A 1UKTA 1OK6A 4WGXA 1W32A 3HB9A 2G0WA 4B2DA 3KRZA 3RM9A 1NVMA 2D73A 4C6DA 4IIEA 5TIMA 3F2CA 2ZBTA 1O60A 1QAPA 3G18A 5CJMA 3B04A 4JNMA 3LU2A 1FWWA 4DI9A 3WH7A 1P0NA 3DFQA 3QOKA 1GORA 2XVPA 4TVCA 2Q01A 1RLCL 1ZALA 4JN6A 3OGSA 3CMFA 3PULA 1WZAA 2A7NA 3MUAA 4Z08A 2ZA2A 4NZJA 1QVBA 4C7GA 3FJ4A 4JQ2A 4FK9A 1R7OA 6PTDA 1OCJA 1XUZA 4C65A 3AWOA 1V0MA 3S3GA 2BY0A 3CAKA 1W1TA 3CAQA 1FH9A 4WR3A 4QDPA 3IRDA 4N02A 1R3TA 4NASA 2IXUA 2ZDRA 4PMRA 1XKYA 4C60A 2GGGA 4OKDA 2GDVA 4PFMA 4F2BA 2ZZ3A 4GCXA 4ERIA 3W7EA 2FYMA 4UTWA 3KL3A 2G97A 3ICJA 1FWCC 2VI0A 1XLAA 1EXPA 1QI5A 1U1JA 2W79A 5BRPA 3ZLGA 1VEPA 4GYJA 4GBDA 1QO5A 3LSBA 3TV8A 4A8NA 1QOPA 5HQMA 3T81A 1HVQA 1ZRQA 1SU5A 2C19A 5D2WA 4TIMA 2EPLX 5LA2A 2QF7A 5GJNA 4F3HA 1QW7A 3O06A 3WIJA 1EA0A 1FDJA 1XGEA 5DANA 1QT1A 4S3EA 1F61A 4LUSA 3GVVA 2ICSA 1YADA 2F9RA 3SCRA 1B4KA 5EBAA 1YNPA 5C7HA 3B8WA 3C5QA 3T0CA 3C86A 1OFBA 1S1PA 1FWHC 1J4EA 3ZO9A 1QHOA 1DJYA 4YCOA 4NJIA 3LNPA 1I45A 1TJ0A 4UFMA 1XRSA 4M0XA 1ICSA 2BNJA 4D71A 4B5VA 1Z41A 1GG1A 3RLHA 1UJPA 3KM8A 3LDVA 3RFAA 1CENA 3GIPA 4ADTA 2PWVA 3VC5A 4ERAA 3BV4A 4G6CA 2FB3A 3GFZA 3NO1A 3P82A 4AD0A 1AL7A 2ZRVA 4ORIA 5HJYA 2WYSA 4KEVA 2ZRYA 1BYAA 1LRTA 3UJEA 3HG2A 4ZBCA 4QNEA 3CIXA 4K6AA 4L80A 1ZY9A 4KFNA 4J7RA 4LUTB 3NM3A 4U4MA 3WNNA 2HZGA 3QHOA 3ZR4A 1JGIA 2UV8G 3ZIZA 3VPLA 1HVXA 2EQDA 3N14A 4NJHA 4AIBA 2JK2A 3MZNA 1BXNA 4PEKA 5CBBA 1E9ZB 1CECA 2A3BA 2ZWZA 3FEMA 5A94A 3NDOA 1EPXA 4LANA 5LNRA 1AZ2A 3WQPA 4JTLA 4RW5A 2V82A 1OC7A 1JZ7A 4GUFA 4MY8A 4A3UA 5ABHA 2P8CA 4FEZA 3B9AA 3M0JA 3WQCA 1XH0A 3GNXA 3S42A 4C6QA 1IE7C 5D33A 3FA4A 2ZUMA 2BVYA 4JQ4A 2TRSA 4J27A 3F2DA 3OBKA 1V5XA 1T5AA 1C92A 4U31A 4PODA 2NQ9A 3K4AA 1ONWA 1V8EA 4GY1A 4H9TA 3LUTA 5D8WA 2Y62A 3MI6A 2ZA3A 3KVJA 4GQQA 1ZP3A 1V08A 3FJ6A 2V5CA 1UBPC 4TV6A 1UD3A 1M5WA 2QDGA 4UFJA 3W1RA 1E5NA 5HWNA 3N19B 3JZEA 3G1RA 2VYOA 1XISA 1VRDA 1JYNA 1GTEA 4M24A 5IBXC 2NQHA 4S3JA 4PTXA 3EKLA 2YZRA 4J40A 2POTA 3KVLA 2DORA 4GO9A 4MNKA 4JTAA 4Z17A 3DFNA 5C2GA 4FMVA 3VKKA 1EXBA 1PB0A 3FYOA 4XZWA 2E6YA 3G1DA 3HPSA 1GKPA 3P8JA 2WHKA 4BKNA 4YWIA 3T44A 5G4EA 1AL8A 1V3KA 2JF6A 1B2YA 3EX6A 1O68A 3H4XA 1LM1A 2PE4A 3WBYA 2C7FA 1V02A 2VGIA 3CZGA 3WF0A 3RU6A 3R11A 1BSIA 1V0LA 1QUMA 3O0KA 1X96A 1FWSA 2Y5JA 4JL2A 2DJLA 1R2SA 3E1F1 2RKXA 1IEWA 3E0LA 4HHHA 3WQ8A 3BSHA 5G4WA 4CQBA 5FJTA 1UWSA 4Q7IA 3N2TA 3USBA 3BLDA 4GUIA 5DN1A 3TTSA 4AC1X 2OR2A 4AY7A 3ZR6A 3ITXA 2OQYA 3E0WA 3Q94A 4JKLA 3B40A 1US3A 1ZAJA 4PUDA 5I3HA 3OGRA 4DF2A 2D3LA 1SW0A 2WJFA 2W66A 4D8AA 1WX0A 4V33A 2Y7DA 3TW9A 3E38A 4O0KA 4UQCA 3RPDA 3BCFA 5LIUX 2CLHA 1HZYA 1OT2A 3VIFA 3GU1A 4AB4A 1UH3A 1B3XA 1IXPA 3KRUA 1LBMA 3KRSA 3KUMA 1G67A 2EPHA 1D3CA 4FIQA 2B7OA 1P43A 1YNYA 2B7PA 2HNHA 3OYXA 1EJSC 4H2HA 4LYRA 5C9WA 4XG1A 4HT3A 4P8UA 3C2EA 1A5AA 1TV8A 3TXZA 1XXXA 1A5LC 1EGZA 1DHKA 1EWEA 1T41A 3BLKA 4AMCA 1PDZA 2PA6A 4HSNA 3NZ1A 3WL0A 1FDZA 4HHMA 2DSUA 4CD8A 4P61A 3AYRA 1X8CA 4BF7A 4H9VA 2FIQA 3GYEA 3GXNA 1TV3A 1XYMA 4KEUA 1MRQA 3RYSA 4H83A 2VNCA 2XIQA 2PGFA 3UJRA 4XAGA 3QLLA 3NL5A 3W7GA 3W29A 1BG4A 1KNWA 2QCCA 4B2DD 4NXSA 4TO8A 1DXIA 2I57A 4H7ZA 5IDIA 2DT0A 2Z2AA 3KL0A 3VDGA 5FEPA 1D9EA 3MV01 1TREA 1P1XA 3FNDA 2VVSA 1XIMA 2DEPA 1AMYA 2Z28A 2PDBA 5EA9A 3R43A 2NZLA 3U5UA 2ZIDA 3L66A 4JTUA 3MUY1 1E73M 4HPXA 3LRLA 3WMSA 3WF3A 2CETA 1YLVA 3TYZA 3VGHA 2DVXA 1F8IA 4GH3A 2JF7A 2VRJA 4EP8C 4L4LA 2F6XA 4JAWA 3LCLA 2YYTA 4FLQA 2D2HA 4ORMA 1IWBA 3PBYA 5BXTA 3ES7A 3IIPA 1HKKA 1WUFA 1KGWA 2XIOA 3M0ZA 1HIZA 2BHZA 4GY0A 3W1PA 2YGYA 2CC0A 2O4MA 2Z29A 2WVVA 1J0YA 1FWJC 1OJXA 1WDSA 4DZIA 3QVQA 3W2UA 5LHEA 4JTGA 3I7RA 5A2CA 3QR3A 2X30A 3W27A 4IMFA 5T8GA 1V0NA 4DWDA 3UU0A 4W93A 2UY3A 3K30A 3NPWA 4A35A 4O53A 3IRSA 1QK0A 3RLGA 3S2CA 3WMLA 1K02A 4KWOA 1FH7A 3HURA 2EGZA 2ZX8A 3F5JA 3PAJA 2F84A 3MI2A 2X2GA 3LBMA 3GH7A 3UZXA 4AF0B 2VL4A 4H1ZA 1SZFA 3WLRA 5KETA 4M5PA 3NPVA 1X1OA 1KM5A 4BHYA 4FNQA 5I77A 4Q3MA 4RNHA 3CV6A 3KVKA 5HUPA 4DBUA 3M0MA 2J75A 1K8YA 4LJ3A 4UMCA 4LRSA 1A5UA 3HFTA 3VX0A 1PHQA 1CB7B 4QHRA 3VYLA 3WUEA 4JTRA 4I5UA 2PRLA 2X1UA 4Z1BA 3VNJA 1YHTA 5GPRA 5LNWA 2AGTA 1SGJA 2WZTA 3SN0A 1OM0A 3UZJA 4TX6A 1FWBC 1AH4A 3W22A 3NTYA 1VBUA 3GVWA 4XZNX 3T08A 1UWUA 1UD2A 3WY1A 3L4UA 4Q7NA 3T1GA 3UXAA 3MHUA 4ONVA 4H2CA 5TF0A 3ZS4A 4XBSA 1MEHA 4D1JA 4HA4A 3RK8A 3C3NA 1O94A 4H04A 2Z00A 3AS0A 4AG0A 4LVBA 3MI3A 5BCAA 1LJYA 3QZ6A 1KR0A 2Y70A 2X41A 1Q6EA 3R58A 4WY0B 4NY2A 2QW5A 2W0UA 3CUIA 3R8RA 2VMFA 5C2XA 1EEPA 1FWIC 1R8LA 5CC5A 2NVDA 1RJRA 1OD8A 4IIFA 4O57A 1LUCB 3W1QA 4HOWA 3BG5A 2OZ8A 2C1IA 2H8XA 3ONCA 3DEQA 3EKZA 3W9ZA 3V0TA 4IX0A 3WFLA 1W1A1 4IQEA 1TTQA 1ADOA 1Q2RA 1EDGA 3TLLA 3KWSA 4NT0A 3VA8A 1RUSA 1QNQA 4AWEA 1WO2A 4A3YA 2TYSA 1JUEA 4QG8A 3TQVA 4JQAA 7XIMA 5BWFA 2HVNA 4HU8A 1UWIA 1BXBA 3D5HA 4L61A 3ABRA 1SO3A 2ATSA 2VCBA 5LIYX 3EMCA 2CWNA 2XPKA 5J5DA 1SR0A 2NX3A 4IM4A 1WKFA 1UA7A 3ABZA 3ALGA 1UMLA 1GYLA 3NYDA 4TVDA 4LOCA 1WP6A 3GC5A 4YNGA 1W3KA 3GW0A 2QVHA 3BZGA 5CZKA 4OGZA 5EMJA 3UG5A 4IGHA 4O4WA 1JPHA 1L6WA 3AMKA 4AEOA 1B5TA 1JCLA 2FB2A 3VOIA 1AQFA 1XS2A 4Y96A 3UXDA 5AFDA 3LYEA 4FZIA 3HMCA 4ZOCA 4B5XA 4Z1YA 3NA8A 3BV7A 2BHUA 1KTBA 4N7QA 4JKMA 3G6LA 4PUKA 4JTDA 4DO7A 1J96A 5EMKA 1CBGA 3N2OA 5KZDA 1UQYA 3SDOA 2PZ0A 1O5XA 2CZ5A 1Z42A 1GOOA 1LT8A 5A6BA 3WH5A 3AROA 4Q8TA 3DDMA 3W7CA 1SJAA 3W07A 1PKYA 2OG9A 3OW1A 1OVDA 3AU6A 2XN2A 4QJ5B 3IGHX 4FNRA 1E55A 4OUEA 1BSLA 1VS1A 2NT1A 3UXLA 4GOAA 4DJDA 1JDDA 1KTNA 1VFMA 1QDSA 3L5MA 5AYIA 5GJMA 4NL1A 1O7AA 4HN8A 2J7EA 4EF9A 3CHFA 1H7RA 2PTZA 3VNIA 3A13A 3KX6A 1PWLA 3EKGA 3CZKA 4M7SA 1EGMA 2PZNA 4R53A 3P74A 4PMYA 4AMAA 3VKJA 1U1HA 1RH9A 1UP2A 3QR0A 5HMFA 3TC6A 3EYPA 3TAKA 1NWRA 3LCFA 3T0TA 5IFTA 1N55A 4QLJA 1MEIA 3C0LA 1B3ZA 4B16A 1XGDA 1XBYA 1C91A 2GUYA 3WK0A 4DBEA 3PWIA 1HJQA 3GX9A 2ZZ4A 4LRTA 1EJUC 2HVMA 2YJQA 1F05A 3FHAA 1HW6A 3GNDA 3TTQA 3BCJA 3M5XA 2HVOA 4W87A 4AF0A 4GA8A 3WLKX 3WNOA 1B0IA 1EHNA 4C6OA 1EEXA 1PYFA 3FDKA 1ECQA 5XINA 1WB0A 2IXVA 3V1PA 1OX6A 4EXBA 5CLWA 1GCYA 1CI1A 3P14A 1J01A 2WM0A 3HF3A 2J74A 4WDXA 2R8WA 5FJUA 1MQQA 3RILA 2WXDM 1H63A 4DJFC 1X98A 4IJBA 4DO5A 2R6OA 2BX7A 3CO4A 3CUHA 3WNKA 5H8UA 3R5EA 2ABBA 3URBA 1VBRA 2WSYA 3BQ6A 5EMYA 1H2JA 4JTCA 5JUVA 3QY8A 1AZ1A 3V16A 4KQNA 4XZ9A 2DZBA 3RCNA 1A3WA 2DQWA 1JPDX 2RDTA 3N12A 3TR9A 4K36A 4BF9A 4PCSA 4DO6A 1NF0A 1M7JA 3TTYA 1GVRA 3GIYA 3QBUA 1G1YA 3ZWTA 3VDAA 4DZ5A 3LQLA 1YIXA 4HPNA 2ZXDA 3MMDA 1VYRA 3OHMB 3GUGA 4MF4A 3ZT7A 3M07A 2NT0A 4WY0A 4HCLA 2X0SA 3I6TA 4E4PA 2A6NA 4HIBA 3UZYA 3PB0A 3O2LA 3E5PA 3QZAA 1Y5VA 1YTEA 5EKYA 3NL2A 2W4XA 4L64A 3A47A 1LUCA 1E5JA 3SRFA 3ANVA 1KM2A 2VEKA 2GQ9A 3MQTA 5HULA 2DSZA 4GZEA 2DUXA 5FKYA 4GNJA 3GWQA 2WJDA 3EOUA 3CWOX 4NHVA 1PTDA 4HBKA 3W1MA 3UJ2A 1IIHA 2PF8A 1DWHM 5MKGB 4YL2A 4H8HA 1CXEA 4UMAA 5I3IA 2Z1XA 4PMJA 1MW1A 2CITA 4ZO7A 4MB5A 2RGLA 4IP5A 4IJRA 3LOTA 3TYEA 4R7WA 3WD3A 5DLCA 3O63A 1QPRA 4JIHA 3E49A 3H2OA 4IWWA 1TQJA 5K3VA 3CUXA 4NZ4A 3EWUA 1J2WA 1SPQA 3IIOA 3UY7A 4N6EA 3IIVA 2DH2A 3LGDA 3S1UA 1RQEA 4RE2A 4MKNA 2G95A 5KINA 3KOZA 2XSAA 2JGQA 1WXJA 2YX0A 3UZWA 1J5SA 3B9DA 1S39A 4JQ1A 2YR1A 1UB3A 2J9XA 2ZUWA 2XVLA 1LG2A 4U33A 2OO6A 1D7FA 4YN5A 2OEKA 4MFEA 4GZJA 3TJXA 1XLIA 3OTRA 3LGGA 4IFOA 1XYLA 2FJUB 4MVAA 5DXYA 3W6MA 3ARUA 1ZBWA 4WKFA 5C6MA 4H9ZA 2XHYA 4QTGA 2QDDA 2GJXB 2JIWA 3AZRA 3U57A 1MUMA 2X0YA 3PVFA 3F7JA 3SRHA 1ZJBA 2PURA 3HQNA 3NZGA 1JDFA 2Q09A 3W28A 3H7RA 2I9EA 1IF2A 3VI2A 3NNTA 5CAHA 1KQYA 2P53A 3AIWA 3HQPA 3SUVA 1DIEA 1KM6A 4TMCA 4G7EB 1FY6A 3XINA 3CO8A 3MUXA 4FX6M 2QCEA 4PTNA 3W1NA 4S2BA 1V6TA 2W63A 4B5NA 3ZMRA 4CD4A 3ZJ8A 4QNWA 1C7TA 2QJNA 4CNPA 1EIBA 3QW4B 3TU9A 3WNLA 3GFXA 2WVSA 4P7RA 1Y65A 3GFYA 1HP5A 4GI9A 4PULA 3LXBA 3CBWA 1JZ5A 1B54A 1UR3M 1S5VA 3GY1A 1Q6RA 4QE1A 3RM8A 3KP1A 3B0YA 1UZ4A 3KOFA 3HFYA 3V5CA 1MW3A 2FTYA 4ZOBA 5DBUA 2A0NA 1XD0A 4LC8A 4MPKA 5DCBA 1W17A 2PBGA 4OV9A 4GKLA 3ZVHB 3L65A 5ENLA 1EO5A 3DI0A 2B31A 4ACYA 2ZADA 3LBCA 4N9CA 3OB8A 4ECLA 1W1ZA 3VIIA 3IJIA 5U4NA 3TQPA 1Q4WA 1TQXA 2ZX7A 5A6BD 2QJGA 4MFDA 3K13A 3N6QA 2Y7EA 1OX4A 3O3RA 3W1TA 4TUFA 5KITA 3GD6A 3STGA 1QO2A 5IRPA 4GQ0A 3ZFHA 1O66A 1DWJM 1GOQA 1R3QA 3IS4A 1VQTA 3GH5A 1P6CA 3L2IA 3N9SA 1RP8A 3S2NA 1KRMA 3GDRA 4OFCA 2X2YA 1DHPA 1IR2A 1C3FA 3JRKA 5HAOA 1UP0A 4OZOA 1D8WA 2HROA 3AO0A 1PZ0A 3I6EA 2QZRA 2V63A 3BE7A 3EA3A 3FVMA 5A8QA 4M6PA 4LAZA 3UESA 3SGGA 1JCJA 3RF9A 4Z2HA 1H0IA 6ALDA 4GIAA 2RDWA 1A50A 3N4AA 2YA1A 4AAJA 4TR9A 4WCJA 5BXPA 1JCYA 3URNA 3VMOA 1LOSA 4BI5A 3EB4A 2PDWA 1G9HA 3M9YA 2XYLA 2PSNA 1FX6A 1EWDA 4IP4A 1SZRA 5AVNA 4E2DA 4LVFA 2NV2A 3AXXA 4F9DA 4Y9NA 3UVAA 4CCEA 2GOKA 1DE6A 3T07A 1E0XA 1S2WA 2VKZG 1G4TA 4JFWA 3LENA 2OB3A 1EA9C 3TFCA 4KGJA 3BW2A 1RBLA 3F5KA 3P5YA 4X9YA 1GTHA 4R88A 5HPCA 2Y8KA 1O1HA 5MKGA 3NR0A 2BTMA 3EWZA 2Y6ZA 3GHRA 1ZU8A 2ZZ7A 3LI0A 1UWRA 4JNYA 2VEPA 4QG6A 2DV0A 1TRIA 3WLHA 4MNJA 3P81A 4L56A 1YKWA 3CQHA 5AC8A 2EXOA 3CL8A 5IHRA 2IKIA 3NYZA 3L23A 3AZSA 1YDYA 1HGWA 1VH7A 5ABFB 3N18A 3WQ5A 4QM1A 3WJXA 1U5VA 2ZX9A 3CS2A 5E9AA 4NJKA 1IEQA 3DHFA 4QEEA 1WKYA 4AISA 3UA4A 1HJSA 1S2VA 4RXGA 3PUOA 4OQVA 4C6KA 4KRUA 5E93A 5HR7A 1SFSA 4UR8A 2VXNA 1QPQA 1VP5A 5TQLA 1EIXA 1GVFA 1ZL1A 1WAUA 1R46A 1V6WA 2WVTA 4IQLA 1UUOA 3W1AA 1A5SA 2J66A 4A22A 3IIZA 2QUTA 3W82A 1QPNA 5I0DA 5M3WA 3HPXA 2ZUSA 2AQWA 3PY2A 1SMAA 3SCVA 1U83A 3JZUA 2G37A 3SR7A 1S5MA 4RZ5A 4YWSA 3EXSA 2OXNA 2YDAA 3EOEA 2QUNA 4UZSA 3MDUA 4JTIA 3WENA 5HWMA 1F8MA 2R9RA 4UTLA 3CLWA 2GJXA 3UT0A 3QFWA 4NZ5A 5FEWA 3U48A 2VFFA 4PRTA 1XC4A 3Q67A 4GVHA 5D2TA 1MXDA 4QXIA 3QKZA 2WCGA 1IR1A 2HNEA 3ISIX 4G1KA