1LOQA

Crystal structure of orotidine monophosphate decarboxylase complexed with product ump
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
209
structure length
208
Chain Sequence
RLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords orotidine 5'-monophosphate decarboxylase
publication title Crystal structures of inhibitor complexes reveal an alternate binding mode in orotidine-5'-monophosphate decarboxylase.
pubmed doi rcsb
source organism Archaea
total genus 81
structure length 208
sequence length 209
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2002-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1loqA00
1X1OA 1AL7A 1OJXA 1FY6A 1TO3A 4QM1A 4MY1A 2G96A 3EX2A 3LXAA 3MYOA 2EGZA 1I2OA 4WY0F 3EWUA 5LNRA 3W7MA 1OX5A 4MIMA 1ZAHA 4NZJA 2W6RA 1QMLA 1TYGA 3V1PA 4H6KA 5F4WA 3D0CA 2LLEA 5FF7A 3QW3A 4GBUA 3FJLA 3G1DA 2V5BA 3W9ZA 3GKFA 3PSVA 4AWSA 1K8XA 4IWWA 4JTGA 4RZ5A 4IUOA 4I7VA 1JULA 3UPWA 1M7PA 4UTWC 3CLMA 3W1MA 2AAMA 4R33A 5HUPA 1GG1A 2CLOA 3IRDA 1H63A 1WBHA 1Z42A 1OFQA 5CGQA 2ZZ4A 2QKFA 3L65A 1YYAA 5D03A 4NUWA 4XKYB 2QAPA 5HJLA 1AMKA 3W3OA 2YGYA 2RFGA 3GDKA 5T26A 1VR6A 3TQVA 1GWJA 4UTUA 3UD6A 1X6UA 3LCWA 4ZQPA 3GR8A 5IBXA 3N9SA 4GUIA 1F74A 1JUBA 3MI6A 3W84A 5L9FA 4LT9A 3LCXA 1KTCA 1TB3A 2H8XA 3AO0A 1I2PA 4Y8FA 3W2LA 1Q6RA 3L66A 1LBLA 1F2JA 4RXFA 4FX8A 4O0ZA 3W2UA 3KXQA 2C0AA 3T40A 1B4KA 2E6FA 1KLZA 1BKSA 5D38A 2EKCA 1R2SA 4JTIA 1IF2A 1H61A 3ATYA 4ZZ9A 3HMJG 4K7YA 3W75A 2V81A 3LRMA 5HWJA 1VC4A 3W1NA 4K6AA 3WK2A 3W7CA 4HNTA 1PV8A 2A6NA 2JKAA 3W2KA 2E6DA 2QUUA 3IIOA 3GDMA 5E1QA 1VCFA 3V75A 4UIOA 3W1LA 3ZR4A 4NXSA 1VCGA 4FO4A 2A7PA 1KFEA 1OF6A 5F2GA 3L21A 2C19A 1KM1A 4NNBA 4E2DA 1Q3NA 2ZCGA 4M6PA 3THAA 3MWAA 3MW7A 3GDTA 4UTMA 3QZEA 3IVSA 3TSBA 3SI9A 1SFLA 4Z1AA 2EAWA 3BLFA 3CWNA 3GK0A 2E09A 1K7EA 4D2JA 1VH7A 2Z2UA 3PB0A 4NJHA 5DN1A 1LBMA 3G0XA 2Q8LA 3ZS4A 3A5VA 3NQ2A 2E5DA 4U28A 3P5YA 4I9AA 2D73A 2E5BA 1ZHAA 2GPTA 5I3KA 4IMGA 2V5LA 5DY2A 3TJXA 5HWNA 2VFHA 2I1OA 4JTTA 4O52A 1KTNA 1WQ5A 3C56A 1C29A 1VLIA 2BLEA 3M5ZA 3A22A 3BG5A 3M7WA 1ZNNA 1W31A 5AYXA 5CZSA 4LU0A 1J5TA 4KKXA 1IXNA 2A85A 4KFPA 2YFNA 4M6VA 1W5QA 1IXPA 1VRDA 2XN0A 1PVNA 3NQMA 5E0KA 2RDUA 1A50A 2WSQA 3LI0A 3GKAA 2GVJA 2TRSA 3Q37A 1R30A 1M5WA 5F1VA 1W5OA 4NJGA 3HPSA 1W56A 3DFNA 3EXRA 3OG3A 1G7VA 3NZ1A 5F4XA 3O16A 2YYTA 4JIPA 3NO5A 4FXSA 2B7QA 2TPSA 1KFKA 1WXJA 2P0OA 1FCBA 1ADOA 2W79A 3PUEA 5AOUA 4IX0A 1G4TA 3UNDA 1JCXA 3HO8A 3R8RA 4KFNA 1JQVA 2Z0IA 1T0OA 4MZ1A 4O12A 4MJMA 3ABRA 5G4WA 4UTKA 3G1YA 1G6CA 4ADSA 1SU5A 2IQTA 3GR7A 4AEOA 5BMWA 5I3IA 4TU1A 1VYPX 4UMBA 4XTIA 1BWLA 4GUJA 2YYUA 2ZA2A 1B4EA 4GC4A 4MFDA 4E38A 1H50A 4UMAA 1DV7A 2H6RA 1NVMA 3DBPA 3CB8A 1RR2A 4M7SA 4O15A 1KFCA 5E93A 3I7QA 4UR8A 5G2WA 3STCA 1T8XA 4QITA 4IQLA 2A0NA 3RLVA 1WX0A 3JR2A 3LBCA 2ZBTA 3SY5A 5FEXA 4RZ4A 2DJLA 1OFPA 5DLCA 3QH2A 4RX0A 3WFAA 5EA9A 4EF9A 5AC7A 1YXDA 1H62A 4QJ1A 3NA8A 3QMSA 3W70A 1VYRA 1G69A 2ZTJA 2NUYA 4JEQA 4GUGA 3W7JA 3DGRA 3G1SA 3NPVA 4TMCA 3GDLA 2QCDA 2X1SA 4UCGA 3EWXA 2V2DA 5ABTA 2FIQA 4MLRA 1OG0A 1RQBA 4MVAA 3UWZA 4FX7A 4UFLA 4S2CA 3CEPA 4MY9A 4K38A 5HULA 1SQ7A 3IVUA 3M0ZA 3RU6A 3FYPA 1ZY9A 3OHIA 4OHQA 4WJEA 1FBAA 3PBYA 1TCDA 1OFAA 2NWSA 3R13A 1F6PA 1KFBA 1OYBA 4FNPA 1DKWA 5C2XA 4MUZA 2CWNA 5LZLA 3I6RA 4IX2A 3TQKA 3E02A 2QR6A 3EWYA 3GZ3A 4Y9AA 2VEPA 3U6WA 4CNNA 5D2WA 1PIIA 4QSHA 3W07A 4QAIA 3TMLA 4UFHA 4YCPA 1QR7A 4MY8A 2FFCA 3G0UA 1MO0A 3M47A 1U5JA 4ZQOA 4DO6A 1GEQA 1KM5A 2WNNA 4NX5A 3DXIA 3PS7A 2NXIA 1GT8A 4PCFA 3TR2A 1KLYA 1ZCOA 2ZA1A 5K9XA 1KBJA 3NVTA 4AHOA 1OFBA 3FFSA 5CPLA 1F7BA 1W5PA 4UTJA 3LTPA 4LVBA 3QMRA 3TXZA 1L2UA 1MZHA 3W7KA 3QM3A 2E6AA 5AYZA 1XBXA 4HPXA 4ADUA 2C13A 4BK9A 1FXQA 5LNWA 3R89A 4KFOA 4Q33A 1NEYA 1LLWA 1ME7A 3LRKA 4UTTA 4Y96A 3HBLA 1UASA 3O15A 3B8DA 4P61A 2A1YA 4DELA 1TQJA 3UXAA 5AHLA 1LDCA 3HJZA 3T78A 1R2TA 2HMCA 3NQDA 4ZL1A 1PS9A 1Q6QA 1P5BA 2Y88A 1ME9A 3FA5A 4ADTA 3P7YA 5H2ZA 1FWWA 3TIMA 3TFCA 2RH9A 3TROA 4EOUA 1C9DA 3LRLA 3DU0A 1P4CA 3ABOA 5D2YA 3S6DA 1FCUA 4O19A 1Q6OA 3M41A 4W9TA 3P60A 2E68A 2QCHA 4N9BA 5BW6A 1C8VA 1T99A 3R12A 4E2BA 4BR1A 1VS1A 1SSDA 1CW2A 3HG3A 1H7RA 1P1XA 3M43A 3THQA 3E96A 3E49A 3LCFA 5DELA 3SFKA 2YFOA 1OFRA 4LNYA 2TMDA 2ZA3A 3W87A 2Y6ZA 2FPTA 1F5ZA 3NEVA 4LTSA 3S5OA 2ZRVA 1X7FA 4FX6M 3HG2A 4MZYA 1D3HA 1KFLA 3N73A 1UBSA 3B06A 5EKYA 2C14A 4LVGA 5LGXA 5KZMA 4BWLA 4NVTA 3SJ3A 1JVNA 5CSSA 5D2XA 3LXCA 1XL9A 5AN7A 2V0TA 2HTMA 1TTPA 4MZ8A 2Z6IA 2Z6JA 3LERA 1HG3A 2OX1A 4O0KA 1LRQA 2BWGA 2PCQA 1JR1A 4UTWA 3G24A 1GVFA 4GWEA 2V9DA 1GZGA 2QCFA 4IOTA 1LOSA 1G4PA 3LCLA 3S5NA 4EWND 2NUWA 3ABSA 5HQEA 4N02A 4CCDA 1QO5A 4IXHA 3H54A 1HL2A 4XTDA 1EPXA 1EB3A 2NX3A 3CC1A 4UTTC 1R46A 4M6QA 3BGGA 4LS2A 3G1XA 3SW6A 3L0NA 4FNUA 3UQNA 4JYEA 2G97A 1IXOA 3JRKA 3RNDA 2ABAA 4Y6GA 4FIQA 4O53A 3M9YA 4AF0B 5C55A 3NQAA 2QCEA 4O14A 1KM6A 1B57A 1DJNA 4NQ1A 1XUZA 4Q32A 3VNDA 2J9YA 2C16A 1FXPA 3CIXA 5HWMA 5EL1A 4S1FA 1OF8A 1SO4A 3P80A 1OK6A 5HMSA 3K30A 2VFIA 1TPH1 3NPXA 5BNKA 1ONRA 5D02A 4FXRA 4LRSA 4Q4KA 2VOMA 3G1VA 3LHWA 5FEZA 3EX4A 1PHWA 4POCA 5HINA 3IV3A 4TO8A 5G2IA 2XN1A 4XZ9A 1UUMA 2QJHA 4HPJA 1YTEA 3NM3A 1TQXA 1TPVA 5LNUA 3PG9A 5K9CA 4CCCA 2PURA 4FEZA 4JTUA 1GG0A 1HUVA 1EEPA 1OX4B 3O05A 3F4WA 2VFFA 3BLEA 3GNNA 2ISSA 4JYDA 1LP6A 4M7TA 4RV8A 5G1YA 5SWUA 1XXXA 4BWLC 3B03A 3NXFA 3O8AA 5FEWA 5BRBA 4CQ8A 4O57A 2Y70A 3F03K 2NXGA 4O1DA 4UMCA 1JJKA 4UC5A 2VEMA 1N8FA 5K4ZA 1QNVA 2QJGA 2ZRUA 3QQ0A 4JIQA 5BMXA 4A2RA 1X1ZA 3EEGA 1AG1O 1XKYA 1Z44A 3SSJA 5MHBA 3TU9A 1KV5A 5AFDA 1XI3A 1AL8A 3BK0A 3PR2A 5FF3A 1L6SA 2ZZ1A 3QQ1A 1F73A 1O4UA 3KRUA 3HGSA 3EX3A 4HN4A 2HSAA 4JY9A 3LLDA 5KINA 2X1UA 5EBUA 1RD5A 3QC3A 4FF7A 3SIZA 1YDOA 1H7NA 4QISA 2QUVA 2GUUA 3UYCA 1R47A 2VEIA 1RQHA 1DORA 3O63A 4XKYA 3W7DA 1RV8A 1I8JA 2QDHA 1TJRA 1QPNA 3L9CA 3WJYA 3QMTA 2J9ZA 3NQEA 1W0MA 3CU2A 3KVJA 3PVFA 2A2IA 4FHAA 1LZOA 1QPQA 2CLFA 4MOZA 4BI6A 3C2EA 3GYEA 5H91A 3TW7A 2RDTA 3W85A 2F7FA 3WJXA 2B7PA 1IIHA 1TTJA 2QF7A 3BV4A 3C61A 3PAJA 2WPBA 1L6WA 2E1DA 4QNWA 1F05A 1UJPA 2ZQ0A 4CCEA 1LLZA 1WAUA 1SPQA 3EX6A 3ZWTA 3OVQA 4UFMA 2CLEA 2CU0A 2B4GA 3NQFA 3DFSA 5F1UA 1FCVA 3LV5A 1EWEA 3W76A 6TIMA 3FLUA 2P10A 4DPPA 2ISVA 1GYLA 1UB3A 5LNVA 3LBMA 3W1QA 4UFJA 2B7OA 5D09A 1D3GA 5G4EA 4ML9A 2DU2A 2DZUA 5F2LA 1KBIA 4NT0A 1G4EA 3S5YA 3P61A 1G67A 1U83A 2G5WA 3B0PA 1NAL1 3WK0A 3EXTA 4AH7A 1E51A 1JRCA 1VPXA 1F6KA 1XDLA 1SW0A 3VI2A 4K8HA 3RLUA 3W2MA 4O10A 3W23A 4WOZA 3T44A 1M6JA 1NFBA 5EMUA 3USBA 3W71A 4C1KA 5KMYA 4O54A 1AW5A 2PRMA 4BI5A 2V8ZA 3DFTA 4O28A 4ORMA 2FLIA 1W5NA 3KRZA 4O16A 4Z0SA 4AHPA 3MP5A 1OFDA 1W3TA 4JXCA 3QF0A 4JX6A 4NZFA 4AAJA 1GJPA 5CG7A 1TMHA 3S1UA 3QJAA 1TRDA 2GQAA 3HGRA 2JKPA 2WO5A 1TPEA 3DKJA 3UWVA 1TPC1 2FB2A 4WD0A 2X16A 3UWQA 1ME8A 2QCLA 3G22A 3PBWA 3Q58A 4DXVA 4MFEA 1B9BA 1PCWA 4JICA 3S8HA 1SZNA 4AHQA 3GXNA 1XC4A 4O1CA 3A9IA 4I7UA 4N4QA 5K4XA 1K8YA 1R2RA 2CLHA 1YPFA 4N2YA 2YW3A 2GOUA 4JX4A 3A23A 5U4NA 3GIYA 1SO3A 4ZQMA 1GPWA 3P67A 4Z0JA 3INPA 1LORA 4JGDA 5AHEA 4AMAA 3STEA 3NYZA 4LUIA 3HPZA 4N9CA 2Y7GA 3O6DA 4JD4A 1B3OA 3W1TA 5D30A 1HO4A 4R34A 1DQXA 5C5YA 3KOFA 2BX7A 2WOQA 2PC4A 2G95A 1Q6LA 4N9EA 3G3MA 3I7SA 1H7XA 1LM1A 1XBVA 2NV2A 2RHGA 4AVFA 1TPB1 4NNAA 5J5DA 2ALDA 3B0UX 3NM1A 3W7LA 1QOQA 5D33A 4FNTA 2NWRA 2Y85A 3WK1A 4HNVA 1O94A 3A5FA 3BPWA 5DCDA 3W7PA 3ANYA 2CLIA 3TUUA 3CT7A 2Y7DA 4GRSA 1LOQA 1W3IA 3CTLA 1FDZA 1H60A 2YXGA 2C6QA 2DP3A 5IM51 1XBZA 1TTQA 1P0KA 1Z48A 3T7VA 1TJPA 3C0JA 2ZZ6A 3DAQA 2EHHA 2ZYFA 3ATZA 2QCDB 4RJEA 4NXKA 2KZHA 4GUFA 4RK8A 4IPIA 2VEKA 4N6FA 4IXXA 3W7NA 5LKYA 5K7JA 3I7RA 3M16A 4DQWA 3FJ6A 3OVRA 1THFD 2ISWA 3W7OA 1KA9F 4GE8A 4NJIA 2AQWA 2Y62A 1VYSX 2DZTA 1TTIA 4LC6A 3EKZA 3L2IA 5KSWA 3BW2A 3S0CA 1H51A 3UWYA 1KM4A 4M5PA 3BLIA 4YLWA 1SZGA 4JTFA 1MEWA 2GQ9A 3MHFA 1WYIA 1GTHA 1ML1A 4WY0A 3WJSA 2ABBA 3U2OA 1DHPA 2ZTKA 3M44A 1LOLA 1DVJA 3G3DA 2P1FA 1QOPA 2QCGA 4PTNA 4KWWA 4M19A 3W73A 3T4CA 4UXDA 4LOCA 3EX1A 1MSSA 1OVDA 1K8ZA 5CZ0A 3S1WA 1W1ZA 1X8FA 4KWVA 2GJNA 1OHLA 3NQ8A 4YXGA 3MI3A 1S5VA 3KVLA 1AW2A 2QCCA 1RVGA 1JQXA 1OYCA 1DBTA 2ZRWA 3C3NA 5HR6A 2YSWA 3VKJA 3PF3A 3QSTA 3OIXA 4HIBA 4N6EA 3FIGA 1VZWA 2RKXA 2QCMA 3BW4A 3C2FA 2PRHA 3IIXA 3NQVA 1SUXA 4QNEA 3PSWA 3ZWSA 5I3GA 4HSOA 4MYXA 2J6XA 3G1HA 2J88A 3W7HA 5AHFA 2I9EA 5AHIA 3VE7A 3LTYA 1SR9A 3TJLA 2FB3A 5KZDA 5TIMA 3C8FA 5LNSA 1IIGA 3KX6A 1KM2A 2OJPA 2VENA 1ZENA 3U8GA 4LC8A 4BF9A 2EPHA 4DBEA 3TA6A 3I65A 2B7NA 3CQ0A 3QPYA 1W8SA 2A5HA 3M1ZA 2YW4A 2CW6A 3P8JA 3LI1A 4HNUA 3PULA 4RCXA 3P8IA 1OFOA 2CLMA 2VFDA 3N9RA 3TX9A 3W7IA 4OBTA 3W86A 3MJYA 1KV8A 3IGUA 5G5IA 3SECA 3DI1A 3PWAA 4XUGA 3TSMA 1TV8A 4DF0A 3KVKA 5TQLA 1ZAJA 3IGSA 1VJIA 3STFA 4CLMA 1JRBA 5HNRA 4TMBA 3PBVA 4A29A 5KTLA 1TPFA 1IXQA 2OCZA 1SW3A 3LDVA 2WQPA 3IEBA 1EA0A 2NV1A 3NL2A 3M5VA 3NNTA 1LYXA 2RDWA 5LHFA 4LVFA 4G1KA 1QDSA 1O60A 1UCWA 2XN2A 3ZFHA 3RK8A 4MYAA 3BG3A 2BXVA 4IMDA 4XQ6A 5BOOA 2VELA 3W7GA 5KITA 2DZXA 4ZQNA 2C15A 2O7SA 4JYFA 4ZQCA 2Y61A 3IIVA 3W7QA 1DQWA 3B0VC 1H5YA 5C54A 3TW6A 4O4VA 1F76A 2YX0A 3G0SA 1G4SA 1H7PA 1TIMA 4HSNA 2ZZ2A 2YPIA 3IIPA 1PE1A 2VFEA 1Q45A 4AF0A 3TV8A 4ZVJA 3DHDA 4FIRA 3WK3A 5J5RA 3IIZA 5LSMA 3O1NA 5D37A 4AB4A 1JCLA 3TAOA 3LHTA 4CQ9A 1I45A 1ZAIA 2TSYA 2YDAA 3NPUA 3PB2A 3RMJA 1QPOA 4ALDA 3TQ0A 3GLCA 1A5CA 4JTEA 1K7FA 3NZRA 5D2TA 3GVGA 4OQVA 4WZHA 3L67A 3FS2A 3P5ZA 2ZRXA 2CLLA 3N19B 1J2WA 3MBFA 1JCYA 3LXBA 3W22A 4JY8A 4LUJA 1QAPA 1D9EA 1LBFA 2Y63A 3IGXA 3STGA 3G8EA 5I3HA 3NOEA 4UFIA 3H53A 4WXZA 3N2MA 1LROA 2F84A 3CPRA 4IGHA 4DO4A 4WQ6A 1YDVA 1FWTA 5K2ZA 4DF1A 5K3VA 4B5NA 2UV8G 4H4IA 1VQTA 2C1HA 2J24A 3C52A 1GVOA 3NQ6A 2H8ZA 3EWZA 2Y7EA 4O50A 1LTDA 4GJ1A 3M6YA 5G1TA 5L6UA 3BVJA 5AB3A 1FWRA 3SGUA 4RLIA 4NNCA 2FPYA 3MMTA 3T55A 1MXSA 1EWDA 3QEZA 4Z1BA 3G1FA 4IMCA 3LTSA 1FCQA 1W3NA 3FKRA 5AHNA 3CIWA 3NDOA 1EP2A 3DKLA 5EY5A 4O1BA 3UXDA 1BEUA 3L68A 1K7XA 1HFBA 2R8WA 2A6LA 4GFSA 4HHPA 1O95A 3BGJA 2YR1A 2CZEA 3OVPA 2YCEA 2TYSA 4ICNA 1I2QA 1KW1A 3QPZA 4PFMA 2GQ8A 2WSYA 4LVAA 3TE9A 4Z1CA 4WOQA 4Z1DA 3TSDA 1LRTA 3NQGA 4YL2A 3I68A 5KZEA 3O6CA 1CI1A 5AHMA 3W1PA 3HOJA 3TFXA 1QFEA 1XBYA 1EP3A 3PY2A 1GVSA 5HR7A 4A22A 1ZJIA 3EWBX 1TRIA 1DL3A 4OT7A 3W1AA 3BARA 3NL5A 1S5TA 2H3DA 2WNZA 4O11A 3CWOX 3UZ5A 4P2VA 1MEIA 4JDYA 5I3JA 5CZJA 2JK2A 4UR7A 3W72A 5TBOA 2FPVA 2V30A 2EF9A 4PL2A 2HS6A 3S1XA 3BO9A 3L0GA 3MUXA 4O18A 4TR9A 5DCEA 3LCGA 1CX9A 4QQ3A 1VHCA 3PG8A 4A2SA 2ATMA 4A21A 3DFPA 3EB2A 5DBUA 1EX5A 1SO5A 4K8EA 1NF0A 1H1YA 1ICPA 3L0KA 2W0UA 4ZQRA 5FF0A 1RZMA 1XFBA 3ABQA 2CZ5A 1GVRA 2V2CA 3HGOA 4PA8A 4MLJA 5D04C 2NX1A 3P84A 3UWWA 3DHFA 3W1UA 2R91A 1LCOA 3OBKA 2ZRZA 4L4LA 3QFEA 3TK7A 2C18A 3DZ1A 3W88A 1GOXA 3LHZA 5LHEA 2QCNA 1YDNA 3MP3A 2ATSA 4LRTA 4QIUA 3S9YA 1XM3A 5HUOA 2QDGA 4O17A 1EUNA 3NQCA 4X9SA 3KVMA 3UPBA 3HG4A 3W6YA 2JBMA 3TDFA 2Y7FA 4H3DA 4DPQA 3PBUA 4UNKA 4JTJA 3LX9A 2BSLA 1FWSA 1FDYA 4UTLA 5EYWA 5LGZA 2Q8ZA 1SZEA 2PRLA 3C2OA 3SGZA 2PE4A 3KHJA 3O07A 4N9DA 4FNRA 3FYOA 3S1VA 5F4SA 3OA3A 2WNQA 3DENA 2VXNA 2DORA 1ICQA 3L5MA 5FI8A 4JTHA 3BG9A 1NF7A 2CZFA 2X1RA 4O8RA 4LV9A 2GVGA 5DXXA 2GVLA 2JKEA 5AYYA 1KTBA 5C6MA 1MEHA 1QO2A 2C3ZA 2WKJA 3NL6A 5F2IA 1I4NA 1L9WA 4K37A 2Q3OA 3G18A 3MI2A 1JCNA 1V7YA 4UTIA 3SR7A 2H3BA 1XDMA 2R94A 4EVZA 4XBSA 3F4NA 1ALDA 3HG5A 4RKAA 3BW3A 3P81A 5IBXC 2ZRYA 2E77A 3NGJA 1GTEA 3Q2DA 3AJXA 3B04A 3HIJA 3MBDA 3ELFA 3H55A 4HKPA 3IVTA 1VCVA 2CFFA 4OGZA 5DCBA 2DZPA 1A5AA 3WJZA 2VFGA 1GQNA 2E6YA 3TNOA 4N4PA 3L5LA 4FNQA 4GNJA 3WJWA 2J27A 4OV4A 2FQIA 1OFEA 3OEXA 4JS3A 1WOAA 4PL1A 5FF4A 3W2JA 2HS8A 4JTSA 2A4AA 2OT1A 3TCEA 2QEZA 4LWWA 3C2RA 3E0IA 3TXVA 1TPUA 4K7VA 1ZALA 1SO6A 4HT3A 1VLWA 3HGJA 4DEFA 4FB7A 4OU1A 5A8GA 5EPDA 4YMZA 3EWWA 3LV6A 2BTMA 3CHVA 4UFKA 2R14A 1JUEA 4OE7A 5FF2A 3S5ZA 1TPWA 2NUXA 4BFAA 3PM6A 4JTLA 1N7KA 1KFJA 3GAYA 1A53A 1S5WA 2OZ0A 1GVQA 3R5EA 3TMQA 1OK4A 4DO5A 1I2RA 3R2GA 4R53A 3MP4A 3TC6A 1SW7A 3P82A 3QYQA 2NXHA 4X22A 3E12A 1TV5A 2QJIA 4UTHA 3W1RA 4DF2A 5D32A 1JCMP 3HPXA 2QAFA 4CNPA 3DH7A 1WA3A 3MHGA 4K36A 2ZZ3A 3NQ7A 4PEKA 4EIVA 1OYAA 3TC7A 3F1QA 3FOKA 5CKSA 5CPNA 5CZTA 4WXYA 4X3ZA 5A5WA 3VE9A 3NL3A 4YCOA 3E9AA 3LB0A 3MYPA 1O5XA 8TIMA 1OX6A 3FKKA 1JUKA 1QPRA 2B0MA 4LS1A 1SSGA 1W54A 3W1XA 3KFTA 4JR5A 1W5MA 5I3FA 4U4MA 1ICSA 1TV7A 3W7EA 2YZRA 4MJZA 5F2MA 1SFJA 3YPIA 1GYNA 2A7RA 3TH6A 4AWUA 1BTMA 4EF8A 3G1AA 4O13A 1FWNA 1WV2A 2DJXA 5GVJA 4Z08A 4AWTA 2FDSA 3MHUA 3GNDA 4WY0B 4BI7A 4I7WA 1H7OA 2Q3RA 1G7UA 4ORIA 1WDWA 1M7OA 4CNOA 4RXGA 4K39A 4JN6A 4JTKA 3KAOA 2ZZ5A 2BZNA 4XWUA 5CPOA 4GUHA 1KM3A 3DFOA 4NU7A 2A21A 3LM7A 2Y89A 4E0CA 1LRNA 1N55A 1JCJA 3CM4A 5DY3A 4AXKA 1TREA 2DZVA 1YTDA 5U7SA 3N34A 3N3MA 1FQ0A 3JS3A 1O5KA 4XBKA 4IMEA 3LCHA 3W2NA 2I14A 1YXCA 2E5CA 4O4WA 2ZFAA 3A24A 1PHQA 1K02A 3N14A 2NZLA 1NSJA 4YWIA 4IMFA 2A7NA 2WV8A 4S2BA 2X1TA 3EKLA 1Z41A 2O7QA 4OV9A 1EIXA 1HTIA 1AW1A 4A3UA 3GXPA 4PC8A 1P0NA 2WJZA 3QSRA 1KM0A 3M5XA 5K9DA 3W7RA 3LHVA 4ZMGA 3NAVA 1OABA 2Z1BA 4DBDA 1PCKA 2X2GA 7TIMA 3UWUA 2XFWA 4TIMA 5AC6A 2H90A 3GB6A 1HO1A 3P74A 2JGYA 3LOTA 4MKNA 1EP1A 4PODA 2NLIA 5DXYA 2J9XA 1DOSA 1WBJA 1SZFA 1FX6A 3L5AA 4J9JA 3PC0A 3C4UA 1EUAA 1A5SA 4TX9A 4WUIA 1UUOA 1A5BA 5D2VA 2V2HA 1XUUA 3DI0A 4FNSA 2VC6A 4JDBA 4UNLA 3EXSA 3HF3A 2V82A 3UY7A 1ZFJA 3TAKA 5FEPA 3RF9A 1RPXA 1BWKA 1DJQA 4ONVA 1TSIA 4CQAA 2CLKA 2VKZG 1L6YA 2JGQA 1YTKA 4Y90A 3LHYA 3TKFA 4JX5A 3QRHA 1YPIA 1RQEA 5G2HA 1VGAA 3PUOA 3LHUA 1V5XA 3S42A 2WSRA 1I2NA 1T96A 3A21A 3DFQA 4LV4A 3HQ1A 3VCRA 3LLFA 4WX2A 3UZJA 3G8RA 5D05A 3VFLA 3HB9A 4L4MA 5FESA 2AGKA 2ZZ7A 2CZDA 2DZSA 1Y0EA 3GDRA 4R7JA 3W83A 4JNMA 3C2VA 4RR4A 2GJLA 1H7WA 1IGSA 3C6CA 1W37A 4LY8A 1FDJA 3B4UA 3GX9A 1VHNA 4PH6A 3UY8A 1K03A 4IJBA 4X2RA 1QCWA 1YADA 1PL9A 3O6YX 3SZ8A 3CEUA 3NPWA 2X30A 4HNNA 3FEMA 2QUTA 3M5YA 4GXMA 6ALDA 5AC8A 2DZWA 3LCIA 5CPMA 3RFAA 4OWGA 3B05A 3O06A 3MO7A 2OMAA 4NJJA 2ZDRA 4LS0A 5DBTA 3NG3A 3LGEA 1QWGA 1YLVA 4NJKA 1WOBA 4IPJA 4UUIA 3P62A 1K3UA 1FUYA 2NX9A 4MPQA 1AK5A 1TPDA 3NR0A 4NX0A 1XCFA 3GXTA 2FJKA 3PUDA 2FTPA 4C1LA 3QW4B 3N2XA 3GAKA 5CSRA 3KRSA 1J4EA 4LW7A 3Q94A 4O1AA 2OT0A 3W74A 1OX4A 4LVDA 1YXYA 1S3HA 4RZ6A 1H1ZA
chains in the Genus database with same CATH superfamily
1NOUA 1AL7A 4QM1A 3MUAA 4MY1A 3LG3A 1G0CA 2G96A 1X6LA 3EX2A 1JGIA 3CH9A 2YL8A 3W7MA 1M9HA 1TUFA 1ZAHA 3EAUA 4MIMA 4ZBCA 1W3KA 4D6IA 1TYGA 1GOQA 4YYFA 2E0PA 2LLEA 4GVGA 1UZ1A 1K9FA 3REQA 2ZC8A 3W9ZA 3FA3A 3PSVA 3M46A 4IWWA 4Q22A 1Y5XA 3KDNA 3UPWA 2HVOA 3BCDA 4C6JA 5LIXX 1E71M 4GMEA 4PB4A 3NQBA 4B9ZA 3ZXWA 4DUOA 2BXZA 3L65A 5D03A 1TG7A 4MPKA 3VIIA 1WZMA 1CXKA 3TYCA 2BXYA 3I10A 1GEHA 2WWCA 5T26A 4DYEA 3HM7A 3TQVA 1H41A 3GC4A 1CYGA 4E3VA 4UTUA 1AH4A 5I03A 4ZQPA 1JGMA 4GUIA 1F74A 3MI6A 4WDXA 3HU7A 2X2YA 1F3EA 2H8XA 1I2PA 4Y8FA 1BLIA 4L64A 4WKHA 1S2UA 2ZUSA 2VX5A 5BXTA 2C0AA 3T40A 1B4KA 1TA3A 5CC3A 4U3AA 1KQZA 5A8QA 2BV9A 1BKSA 1IEVA 3ATYA 4LUYA 2QIWA 3HMJG 1HVXA 2E9LA 2V81A 5HWJA 1PYMA 1Z3NA 3WLTA 1IT7A 3W7CA 2YLLA 1WE5A 2G8ZA 4C1NA 2QUUA 3IIOA 2YB1A 2XVKA 1VCFA 4J3XA 5H6HA 3CZLA 7REQA 3V75A 4UIOA 1Z89A 1WUFA 2XZ7A 2ZX7A 1VCGA 1JZ7A 1OF6A 3ABXA 4L4OA 2Y8VA 3L21A 1N8IA 4IQDA 3THAA 5C9UA 1HGWA 3GDTA 4DJEA 3KOZA 1A3WA 1QNOA 1SFLA 3NFUA 3CWNA 3GK0A 4I9MA 3WENA 2DPEA 3PB0A 3AQUA 5EGRA 4WJ8A 5DN1A 3KL5A 2PUZA 3G0XA 3A5VA 3P5YA 2E5BA 2RGLA 5DY2A 1UG6A 3KHDA 1VBRA 2VFHA 3A13A 4JTTA 5E9XA 3GVVA 1KTNA 1WQ5A 1P0BA 1VLIA 1WAWA 5DT7A 3A22A 1O7AA 1WPCA 1W31A 5AYXA 3TOYA 4KFPA 4PMDA 2YFNA 1Q8AA 1VRDA 2XN0A 1LT7A 5A8PA 3NQMA 4KRUA 5A2BA 1W1YA 1M1BA 2WSQA 2GZXA 3ZR5A 3LI0A 2GVJA 1F4AA 5BXRA 1ZTVA 1K6WA 2VQUA 1M5WA 1W5OA 2PGWA 1M7XA 3HPSA 2ZX9A 4JTAA 4LH8A 1H09A 3NO5A 4MWAD 1XYMA 2B7QA 2TPSA 3KOYA 1WXJA 2P0OA 5AOUA 3RGTA 1VB9A 4DHGA 2JQXA 4U33A 3A3XA 1JQVA 1DWJM 3OTRA 4MUPA 3W24A 1ZJBA 4C6DA 1GVIA 3TC3A 4AWEA 2C8NA 2IQTA 3BL3A 1KFWA 4G5DA 4Q4QA 4CVUA 5I3IA 2JEQA 3VABA 5BCAA 1E9IA 4XTIA 1KWKA 4PUEA 2YYUA 2ZA2A 3T0AA 2V63A 3PBMA 2JF7A 3EWDA 4MFDA 3SN1A 2H6RA 1KGXA 4FF5A 1TV4A 5DMLA 7CGTA 1TVLA 4TX6A 4O15A 4HK6A 5E93A 4PUNA 3MKCA 4QITA 2A0NA 1WX0A 3BOLA 5DEZA 1HJVA 1AODA 1XLMA 2JE8A 2DJLA 5DLCA 5A6SA 5EA9A 5AC7A 1OC5A 1YXDA 3UG4A 3WQWA 4QJ1A 3NA8A 2Y5JA 2WMKA 4AZCA 1IYXA 3G1SA 2X1SA 2V2DA 4HBKA 1Q7ZA 3H4GA 3PAOA 2D3NA 4MLRA 4HOWA 3HJEA 1T41A 1PTDA 3UWZA 4FX7A 4LAKA 2WVTA 1EJVC 1FKWA 3GU9A 5FJRA 3WQ6A 1X6NA 1FBAA 3WLSA 1EKOA 1JPKA 2NWSA 3GG0A 4DYKA 1KFBA 4FNPA 1HKWA 5LZLA 1I1WA 1RCQA 2QR6A 3VIOA 2VEPA 4CNNA 3GHRA 3TMLA 4YCPA 1QR7A 2FFCA 3GUGA 1UP0A 3M47A 4A8RA 4ZQOA 2ONEA 4NX5A 1AQHA 3B8TA 4PCFA 3H2MA 2FJUB 3PZTA 3TR2A 1ZCOA 2PP0A 2ZA1A 3EYPA 4NI8A 5K9XA 3WLLA 5A69A 3T0DA 3ME3A 4AHOA 4GJIA 1OFBA 3L7RA 1W5PA 4MJ2A 1W91A 3LTPA 3IAPA 4LVBA 1MZHA 2DW6A 5AYZA 4HPXA 3IPWA 4QRNA 3R8GA 4W7UA 1GJUA 1MDLA 3B8DA 4NI3A 3VIHA 4DELA 3WY1A 3T78A 1BQGA 3NQDA 1PS9A 4D8ZA 3VM7A 3FA5A 5LIYX 4JKLA 4KETA 1E6XM 3PZNA 4EOUA 4W9TA 4N9BA 1B3ZA 4PULA 4MF4A 4YWSA 4H8UA 4W7WA 3SEPA 3TA9A 2J66A 1U5HA 1A3HA 1EC7A 2YFOA 3VX0A 1OFRA 4H7VA 2ZA3A 1A80A 4DNHA 2Y6ZA 1F5ZA 4AIEA 3NEVA 2ZC1A 2ZRVA 2OYMA 3SFWA 1KFLA 5MKGA 4V15A 2C14A 4WEVX 4QLJA 5LGXA 2WW5A 1JVNA 5D2XA 5AN7A 3V35A 1OINA 3GG1A 2PA6A 1S2VA 3B8VA 2FZ8A 3K2GA 1V77A 1QATA 1JR1A 4QG9A 4GWEA 2ANUA 1TWDA 3WEMA 3UG8A 1G4PA 2X0HA 2NUWA 3FEQA 1FWCC 1IR1A 4AD0A 3WQPA 4CCDA 3IUHA 2J6VA 4GXWA 5I07A 3H54A 4W5ZA 2PDWA 2FDMA 1N2VA 4WK9A 1R46A 5A1AA 2DY3A 3ARXA 1YQ2A 2PI6A 5A6JA 2BNJA 5M3WA 4NQ1A 2J9YA 4BJHA 1VPQA 1J0YA 1V03A 1XF0A 5HWMA 4S1FA 5CJMA 3EPMA 1TPH1 2I9UA 5D02A 5GJNA 4FXRA 1UOKA 4QG6A 2WJFA 3LHWA 3C2YA 4J40A 4Y9MA 4GY7A 1KQYA 5G2IA 1V3JA 3K1GA 4LJ3A 4NL1A 4HPJA 5K9CA 2PURA 4FEZA 2OZTA 4QS5A 1OX4B 1K4GA 3BLEA 4IISA 3V5OA 5RUBA 4YPJA 5G1YA 2XGBA 1HL9A 3CZEA 2XJ7A 2YJQA 1HKVA 2HVNA 3BOFA 3MMWA 4O57A 3ZJKA 3BSMA 3F03K 2NXGA 4O1DA 3KZPA 4PBFA 1JJKA 2PDLA 1QNVA 5BROA 2Q01A 3R7MA 2E25A 4XIAA 4FI4A 4Z2LA 1POJA 5AFDA 1XI3A 5FF3A 2ZZ1A 4IMAA 3QQ1A 1WO2A 1RPKA 3HGSA 4HYRA 2HSAA 4JY9A 3V16A 3LLDA 2J7FA 4A3YA 2UY2A 2PDYA 5EBUA 4H7CA 3UF9A 1UKPA 4QISA 4JTQA 2QUVA 1R47A 3A3WA 1DORA 3O63A 3R25A 1I8JA 3CAWA 1AH0A 1QPNA 2ZIDA 4CN1A 1PYFA 2YDRA 3KVJA 3H2NA 1QPQA 2CLFA 3APTA 3F2CA 1CBGA 2YOCA 3W85A 4LBUA 2DVUA 3QY7A 2B7PA 4NSBA 4WKAA 3DC8A 2QF7A 1S2AA 3QN3A 3UEQA 1BTCA 3WFZA 1E70M 2PAJA 1QBBA 3KL0A 1WAUA 2CBUA 2ZXBA 3GD6A 3OVQA 3OZMA 4UFMA 2CU0A 3NQFA 2YBTA 3BTNA 1MQRA 1ITCA 3BC9A 1J0ZA 5A94A 1WZKA 5JU6A 4UFJA 5D09A 4J28A 2DZUA 2R1LA 1KBIA 4NT0A 5BWAA 3S5YA 4B15A 4CD7A 1RK5A 1NAL1 4XAPA 3VC6A 3EXTA 1JRCA 1F6KA 1V51A 1SW0A 3MV01 3W23A 1M6JA 4L6DA 5EMUA 5LXEA 4LAUA 1XQKA 3W71A 3EEZA 2ICSA 2DUXA 4IIGA 1OT1A 2V8ZA 3N6QA 1G9HA 4ORMA 3CHFA 1KWGA 4MDOA 1UWTA 3BURA 4JX6A 4NZFA 1GJPA 4AAJA 3WQDA 3ZVHB 4JN7A 2VVNA 5HPCA 1CLVA 3BLKA 3DC0A 2WBKA 4X0NA 1EC8A 3HGRA 3R8HA 3DKJA 1Q85A 2XSBA 4GI6A 3PTDA 3UWQA 2HJPA 3QV6A 3S8HA 3PZMA 5C0QA 4AHQA 3WD3A 1ISVA 3W37A 3A9IA 5U4NA 3L4XA 2I5QA 3S3GA 1GPWA 3P67A 4Z0JA 4DM1A 2ISFA 4RV3A 3CZ8A 2FHBA 4JGDA 4LB3A 1S1RA 2DVTA 4N42A 4LUIA 4N9CA 2Y7GA 4QQUA 5I7GA 1A5OC 1B3OA 2OXNA 3AWNA 1HKMA 1H0GA 4PUWA 2G95A 1JXKA 4IT1A 3I7SA 1FWEC 2VRKA 2RHGA 3KBWA 3NEHA 4AVFA 4YVXA 3WYZA 5DMMA 2WMIB 3LNMA 3GW3A 4BKNA 1JDEA 3GSMA 5D33A 2GJXA 2GJPA 3VMPA 4FNTA 2X09A 3AXHA 3ZVIA 1O94A 2VX4A 3BPWA 3GZAA 1XLCA 3TN4A 3ANYA 2WLYA 3URNA 2BVWA 3JW7A 3TUUA 3P93A 3E74A 2XTKA 2YKKA 1YEYA 4S3GA 1G5AA 2PDNA 1W3IA 2JALA 3LEPA 4GO9A 1S46A 2DP3A 1P0KA 2G3JA 1TJPA 2ZZ6A 3DAQA 2ZYFA 3DCPA 2OWXA 5JIWA 3T9PA 2QCDB 1CLKA 3OBEA 3WBYA 5K7JA 3U2ZA 4DQWA 3P0WA 1PKLA 3LQGA 1W2PA 3TTQA 2J7EA 2ISWA 1QWKA 2AQWA 3DGBA 3L2IA 1IR2A 1QI5A 2HPIA 1U1HA 2GQ9A 4JNZA 1GTHA 4XZBA 3VAVA 4DWSB 3AUOA 1YE6A 4WY0A 1E1CB 4HU8A 2ABBA 3U2OA 1XGZA 4M19A 1JZ6A 1UD8A 4ECLA 3XISA 1MSSA 5CZ0A 1K8ZA 1JFXA 4V27A 1V6TA 4KWVA 2G37A 3W0KA 4YXGA 2F2HA 1US2A 4UB9A 3I3BA 2FYMA 3CYVA 1OYCA 4KGJA 5AC4A 4KWUA 2PWDA 4HA1A 1M04A 4Q8PA 4YTTA 4HIBA 3VCCA 1VZWA 1R38A 3GQYA 3C2FA 3UFYA 3NQVA 1S2WA 4B90A 1ONEA 3CZJA 2I9EA 5AHIA 3LTYA 3RM9A 1B1YA 2FFIA 3C8FA 4J5NA 3LQLA 1NDVA 4BF9A 4LC8A 1JF6A 2EPHA 5A6AA 2E4TA 3I65A 3CQ0A 1B5TA 1W8SA 2CW6A 3P8JA 5HMDA 1UHVA 5AC5A 3UXKA 3BJSA 3WQOA 1R7AA 2VFDA 4HK7A 5DMNA 3TTYA 4FS9A 4BS0A 1JG9A 1KV8A 4ILSA 3TSMA 3NSNA 4WGHA 1J0IA 1TV8A 4F9JA 3IGSA 5ENLA 3STFA 1UZHA 5HNRA 5CJNA 3PBVA 4A29A 4W4QA 2FZMA 2HCVA 1SW3A 3LDVA 3BMWA 2YCKX 3IEBA 4B4FA 3KOWA 3IGHX 1DXIA 2NV1A 2BGQA 3M5VA 4Y9OA 2RDWA 5LHFA 4LVFA 1NJJA 2VX6A 1O60A 3ZFHA 4BQ3A 2XSXA 1CECA 1JAKA 3BJFA 2GUBA 7TAAA 3AUJA 1UZDA 1NWUA 1KRMA 3CPGA 5CG0A 2J8TA 2DZXA 4ZQNA 5E70A 2O7SA 3FGCB 4JTDA 2Y61A 1F3WA 3GC2A 4XO6A 5FIPA 5C54A 4O4VA 3TYDA 4IZGA 1DJIA 3D46A 3G0SA 1W1A1 1BGAA 1BPLB 4EAMA 2ZZ2A 4GXPA 1XLDA 4XUYA 3AS3A 2DT0A 3OLIA 1PE1A 3PZGA 3BICA 1WP6A 2V3FA 2W66A 1LLOA 3OZPA 3DHDA 3QQWA 3IIZA 1Q7QA 2WHLA 3G2GA 4CQ9A 2TSYA 2QDDA 2YDAA 3NPUA 1QPOA 1K7FA 1MZRA 1E1FA 3NZRA 1ODUA 3L67A 2YDSA 2ZRXA 3TR9A 3W22A 2VL4A 1UH4A 3BAKA 1LBFA 3STGA 2PS2A 5I3HA 1ZPTA 4UFIA 5HAOA 2I17A 1XH0A 1JCTA 3F4VA 4RNHA 2PZNA 1DTNA 2F84A 4QCEA 4DO4A 3AJ7A 4WQ6A 3AMGA 5K3VA 4H4IA 2C1HA 2PTZA 3C52A 3QLLA 1GVOA 2OPJA 3EWZA 4JFSA 1TVPA 4GJ1A 3QGKC 1AFSA 3MZNA 3SGUA 2WKGA 2WKLA 1EXPA 3H7RA 2YXOA 4E2VA 3QEZA 3VOFA 3G1FA 3BANA 3LTSA 1C8YA 4BA0A 1ITQA 1FCQA 4I6KA 1W3NA 3P6LA 4GABA 3CIWA 1EP2A 3DKLA 5A3HA 1KR0A 5EY5A 2DDXA 3ARRA 3QV9A 2E9MA 5IDZA 2XGZA 5J8LA 3B97A 3TJIA 4CD8A 3F2DA 2BASA 3BQ5A 4YU1A 2YCEA 1TVNA 1C93A 1NP0A 3GM8A 4CN6A 4Z1DA 3TSDA 1LRTA 1BYAA 1W1PA 2OR2A 5KZEA 1GUVA 1MFVA 1FTXA 1K1DA 4PMXA 4I6VA 3D3AA 4XSLA 5HQLA 4MTVA 3UGVA 4DJDA 4M81A 5I6SA 4O11A 3CWOX 3UVIA 1FH8A 4H8VA 3UZ5A 3TYZA 4P2VA 4KF1A 1MEIA 2SFPA 1RAKA 5TBOA 4GI4A 2EF9A 4KEZA 4PL2A 1TA3B 5DCEA 3KS6A 2ACQA 1CX9A 4QQ3A 4I9TA 5HOSA 3ARWA 2ATMA 1PB0A 2GSHA 2NQZA 1EX5A 1SO5A 1WKEA 1E9YB 4OJYA 2GYIA 4ZQRA 4PMVA 3KLKA 4C1NB 4IGNA 4Z2JA 1RALA 3MSRA 1QJWA 1AJZA 2ZRZA 4EXBA 3M4HA 3BAWA 3KCOA 3DYMA 3TK7A 2UY3A 4Q7BA 1LT8A 2C18A 3UERA 1GOXA 4F0MA 3CASA 1R3TA 4Z17A 4NYUA 3M0VA 4GCXA 4UQBA 1YDNA 2VR5A 3ARUA 5IDIA 2J25A 3MJMA 1UPMB 3TYEA 1IZJA 2QDGA 2J7DA 3BLDA 2EPKX 2DSKA 3NQCA 4X9SA 1E5NA 3GG7A 3JZUA 1FDYA 2FTYA 3ZLHA 1BG9A 2O4MA 4L1XA 1SZEA 1JYWA 2PE4A 3O07A 3S1VA 3FYOA 2DSUA 4BHYA 2WNQA 1R3WA 1P1MA 1ICQA 4YHEA 4JTHA 1ZQ5A 3UZWA 2WNWA 1ZBVA 4LV9A 5C6MA 1KTBA 1MEHA 1QO2A 4EXAA 1TV2A 5F2IA 1L9WA 3SN4A 2Q3OA 1JCNA 2H3BA 3FY1A 4EVZA 3HG5A 1ALDA 2E77A 1GTEA 2I7GA 1O66A 3B04A 4PEEA 3MBDA 4GCAA 1DJHA 5DCBA 4FR6A 2VFGA 4BF5A 3FX4A 1TWWA 3OO2A 3WJWA 2J27A 5H1WA 2FQIA 3OEXA 1IEQA 1Y65A 1WOAA 4PL1A 4FLRA 3V5CA 2AL2A 2OT1A 4LWWA 3RRXA 3E0IA 4AD4A 1TPUA 1SO6A 1KKOA 1VD6A 4HA0A 1VLWA 1JI2A 1XIDA 4OU1A 3W81A 5EPDA 3R43A 1BFNA 3LV6A 3TTOA 2O0TA 3IJDA 4D1IA 2PLMA 3RPTA 3PM6A 3MVIA 5AVNA 3LA4A 2ADAA 4TVDA 3H26A 4C6MA 3CL6A 3R58A 3SCSA 1MMFA 3NUKA 1OGSA 2XIQA 1SW7A 2EG7A 2QJIA 4UTHA 3W1RA 3AS0A 1O1ZA 3OVGA 2XIJA 2QAFA 5CZKA 3UPMA 4PUDA 4CNPA 3MHGA 2VZSA 2NSOA 1UD2A 4PEKA 3VUSA 3TC7A 1O6IA 3FOKA 4AYGA 1QT1A 3WH7A 1DYSA 3GYCA 5CKSA 5A5WA 3APGA 3E0WA 4HN8A 2WHJA 3NL3A 3ZLGA 1PWMA 1JPHA 4FXJA 1HP5A 3F4DA 3RILA 4WVXA 2WM0A 4DJFD 4TV5A 4Q8VA 3N9KA 4JIEA 1Q6FA 4LS1A 1NDWA 2ZKMX 1UMLA 4MJ4A 3KFTA 4IFKB 1TV7A 3W7EA 4H6EA 4MJZA 1GZJA 3QHMA 3YPIA 2Y2WA 4KMQA 4GIEA 2CC0A 3KTCA 4EF8A 1FWNA 4GPNA 2FDSA 1UD3A 2Q3RA 3NYDA 1RJRA 2Z25A 3URQA 1G7UA 2BGSA 2HXUA 4E4UA 4RXGA 1EGMA 4M6UA 2YCJA 3SAZA 3UXLA 1P6WA 3DFOA 4E0CA 4MB5A 2VHLA 1BYDA 3ALGA 3CV7A 2DZVA 4RW3A 4DY1A 1MUWA 4YHGA 3G5EA 1P43A 3H23A 3LPFA 4IMEA 1GCYA 2I14A 4YNGA 1YXCA 2E5CA 3O0FA 4NASA 5ABHA 1HKKA 2ZFAA 1QHPA 3ZYZA 2XVLA 4AZHA 1NFPA 1Q6CA 4YVVA 1R3VA 5DRCA 2YXXA 3W28A 1V3LA 2GK1A 1FOBA 2QYGA 1KXHA 3QSRA 1KM0A 2NT1A 2QIIA 1VFSA 3W7RA 3RITA 2Z1BA 2FVLA 3IK2A 3UCDA 1WDPA 4GKTA 1J96A 3PPCA 3UETA 3P74A 3GTFA 4PODA 1XLIA 1K9EA 1DOSA 4CQBA 1SZFA 2ZOXA 3VZYA 1B9ZA 3KW3A 1EUAA 2BS9A 3GFYA 2WM1A 1UR8A 3RM8A 1GOIA 5D2VA 3VD3A 5MKGB 2OU4A 1XUUA 5EMLA 2VC6A 3T09A 4RUBA 1UOZA 3EXSA 1JXJA 4A4AA 1V6YA 1RY0A 1ZFJA 3TAKA 5JUVA 1EQCA 1KKRA 1CB7B 1DJQA 1RSCA 1KR1A 2CIPA 1UD6A 2Z28A 2Z29A 3K46A 3DG6A 2PWGA 3HQOA 4H6RA 1OZMA 1YTKA 3LHYA 3PHAA 4U31A 4GIRA 3QRHA 1YPIA 5FJUA 1C92A 1M01A 1E6QM 1F8MA 3PUOA 4Q4SA 1UJQA 1V5XA 3S42A 3UG5A 2WSRA 1I2NA 4FZIA 1HNYA 3GXIA 2BB0A 3A21A 2QUNA 4E2OA 1M53A 1S2TA 3B9DA 3P3BA 8XIMA 3SCTA 5FESA 4RE3A 2AGKA 3AXMA 2CZDA 3DESA 2BOFX 3MUCA 4A8IA 1XLFA 1CGVA 3W83A 3C2VA 3E2QA 3ARYA 3OU8A 3CJPA 1DJWA 3B9EA 4ZB0A 1W9PA 3BAYA 1JD7A 1FDJA 4L5ZA 4PH6A 3AZSA 1C8QA 4IJBA 1QCWA 1WZLA 4DXKA 3O6YX 1IT8A 3NO1A 6ENLA 2CBIA 2BGNE 1PX3A 4YTUA 2VOTA 2OLSA 2X0YA 5AC8A 1OD8A 3WF2A 4G2DA 2OMAA 2Q02A 4NJJA 4HZMA 5CC7A 3ICJA 4JTRA 1YLVA 5BWFA 1EJUC 4IPJA 2D2GA 4P5UA 3P62A 3MS8A 2NX9A 3TTEA 2YDQA 3NR0A 1E6PA 3QW4B 3IJQA 4A6GA 4JHZA 3Q94A 4UQDA 4UCFA 2OT0A 3TN5A 1S3HA 3PJXA 1U1UA 1EDGA 4PUKA 1CZ1A 4WY0F 3LGGA 3VOHA 1QMLA 4TUFA 3UG3A 4H6KA 3VK5A 5F4WA 3D0CA 2ISDA 1W17A 5BXSA 2VEFA 5BZAA 4MNLA 1NELA 1AQFA 4DJED 1LG2A 3ARPA 3GTIA 4RZ5A 2PGRA 4AZ7A 3PZVA 4KCVA 2OEMA 3SCUA 4C6BA 1DWIM 1EO5A 3WZ0E 2VNCA 2HDJA 1V4YA 3W1MA 2AAMA 5HUPA 1GG1A 3PN8A 3CMJA 1H63A 1WBHA 1Z42A 5CGQA 4ML4A 1GHSA 1YYAA 1TR1A 3EBVA 4NUWA 4CQCA 3VDBA 1R85A 1YDYA 1AMKA 3W3OA 3GDKA 1SR0A 3QFWA 1GWJA 2Z7GA 1KCKA 3UW6A 1X6UA 1JYVA 3W84A 5L9FA 3BE7A 2CKSA 2YA2A 3GNXA 1KTCA 1XS2A 3MT1A 3DG3A 5C2GA 1LBLA 1KXQA 3I3DA 4RXFA 2Z27A 4AZGA 2E6FA 3WUBA 3DHPA 3BWWA 4RDYA 1IF2A 2CWXA 3CMFA 4ZOAA 4K7YA 4D6FA 5BYWA 3W1NA 1PV8A 3W2KA 2XIBA 3Q65A 3B9AA 4B4HA 8A3HA 4NXSA 1KBKA 4DNMA 4L6HA 4AIBA 4FO4A 5J04A 1TMLA 4XZWA 3HQPA 2IS7A 1KCXA 2ZCGA 3MWAA 1R3SA 2JIWA 3OZYA 4UTMA 1UWSA 1YBQA 3IVSA 3TSBA 4Z1AA 2EAWA 2WC4A 3BLFA 3GBEA 2WMFA 1XG4A 2E09A 2PDQA 1VH7A 5I06A 2Z2UA 1M68A 4GQBA 1LBMA 4KCWA 2Q8LA 1WKDA 2NT0A 4I9AA 1ZHAA 1XRSA 5I3KA 3TTSA 3PANA 2E7FA 4HA4A 1XLKA 4I9JA 1C29A 3AICA 3M5ZA 3AI0A 1EGZA 1ZB5A 1ZNNA 3V1HA 5CZSA 4KKXA 1IXNA 2V5CA 4I5RA 3VD5A 4GI9A 5AKQA 3DYOA 3CLWA 1O12A 2RDUA 1A50A 4H2CA 3GKAA 3VKCA 3O3RA 3HPFA 3WH5A 4ZSTA 2QV5A 2D2JA 1R30A 1EPVA 3N17A 5F1VA 3H12A 2E28A 4NJGA 3HTWA 3DFNA 3OG3A 3QR3A 3H2AA 1DEDA 1G7VA 3NZ1A 2EBNA 4LF1A 1C7SA 5IRPA 3WEOA 3OQ8A 4EXQA 2C7FA 3PUEA 1G4TA 3T1GA 1I0DA 1JCXA 1NOWA 2CBVA 4GH1A 1IZCA 3LK6A 3AU2A 4B3ZA 2VZVA 3H6OA 4MZ1A 2VUYA 3ABRA 1G6CA 3OQEA 3NDZA 4ADSA 3UJSA 1W1B1 5A6TC 1UIOA 4H7ZA 4P7LA 1IWAA 1FVPA 4GYKA 1DIDA 4AZ5A 3H22A 3FXYA 2PDIA 1EJRC 1V08A 2CLPA 1C3FA 1W2VA 2VJXA 3CB8A 2I56A 3I7QA 4QLLA 1T8XA 3RLVA 5CAKA 3THDA 3JR2A 3FDGA 2A3EA 4IICA 3CBWA 4RZ4A 1ZP3A 4BZYA 1EHNA 3SCOA 3L4ZA 1GPFA 1ITXA 3W70A 1G69A 2ZTJA 2NUYA 3C0QA 1VEOA 4TMCA 3NPVA 1XIMA 1XIIA 1N8WA 5ABTA 1R87A 1JDAA 2Y5EA 1TZZA 4C7GA 1OG0A 2ZE0A 3L4TA 3ZLFA 1C90A 1IEWA 4UFLA 1U5VA 4MY9A 3AIWA 2PTDA 3IVUA 3RU6A 3BLLA 2NV9A 1TFVA 3VMOA 4ZE4A 2GOKA 1F6PA 2VZTA 2VDHA 1DKWA 3M7SA 2NQJA 1YHTA 1WB0A 3DFHA 4MUZA 3I6RA 2VR2A 4PTMA 3U6WA 1JZ8A 3OBAA 1PIIA 3GU1A 2EPLX 4DUXA 3G0UA 1MO0A 1U5JA 6XIAA 4S38A 4XZLX 3MCNA 3S2JA 1VEPA 1C7TA 5CSUA 3OJGA 2G0WA 1KLYA 1J01A 4DZAA 1FH9A 1XJBA 3FFSA 2OWCA 3ZMRA 5CPLA 3OGSA 3QMRA 3TXZA 5BRQA 3W7KA 4KESA 4B2DA 5LNWA 3R89A 2O9RA 4KFOA 2XISA 1NEYA 3GVQA 1ME7A 4Y96A 3EA3A 1UASA 3O15A 5BXPA 3UXAA 5AHLA 2WMJA 1M3UA 2HMCA 4JBRA 4ZL1A 4CU6A 3RX3A 1UC5A 3L2LA 3WL1A 3MY9A 3P7YA 3TIMA 3VGBA 1BF2A 1I0BA 1U1JA 3LRLA 5D2YA 1FCUA 4O19A 1Q6OA 1SFTA 1QOXA 5BW6A 1C8VA 4BR1A 1TIWA 4F9DA 4LANA 1CGTA 3C86A 3AYVA 3LCFA 3SFKA 2CZVA 4ATLA 1WKYA 2XFRA 5I24A 1AA1B 4LTSA 3S5OA 1T7LA 3VGFA 3HG2A 1ONXA 1D3HA 1ZU8A 1QRQA 3SRDA 2WJDA 5EKYA 1NH6A 2Y8KA 1QNRA 3W38A 3WBXA 4NVTA 4HCDA 1XL9A 4D71A 3MKVA 3GVWA 3LERA 5CXPA 4QLKA 4W86A 4XK2A 2PZ0A 1LRQA 4O0KA 3VDAA 2BWGA 2PCQA 3EDDA 2Y4SA 1JPMA 1GVFA 1GZGA 5EB8A 3ARSA 2EJAA 3LCLA 1FP9A 1UPPA 2XVPA 1UP3A 3ABSA 4N02A 3RO8A 1MW2A 5IFTA 3FN9A 2XSAA 1EPXA 1XYBA 2ZWYA 1EB3A 4UTTC 1XIEA 1TX0A 4M6QA 3BGGA 4LS2A 3VDGA 1FWBC 3SW6A 2J7CA 4Q4PA 4Y6GA 4FIQA 3BCFA 4O53A 5C55A 2QCEA 1KM6A 1DJNA 3VNDA 1IV8A 3OW1A 4GGBA 3W27A 2KAUC 3UGRA 1R0MA 1ONRA 4Q4KA 1BXCA 1B54A 4UWMA 3EX4A 2PODA 4TO8A 2F61A 4XZ9A 4M82A 1UUMA 3FCPA 1UR4A 2FGLA 4ZR8A 1YTEA 1BGGA 1W3JA 4FSAA 3PG9A 1UWRA 3EMCA 1CXFA 3BAJA 1ISYA 3O7UA 1HUVA 3MV11 4AFYA 1EEPA 4KIRA 1M41A 3F4WA 3GNNA 4M7TA 1UA7A 4RV8A 1ENUA 2OSWA 5SWUA 1DWFM 4BWLC 5H8PA 3NXFA 1OCNA 3RU8X 5FEWA 3IAQA 2PGEA 4HMCA 1TJ0A 2Y70A 1RA0A 5K4ZA 3O0KA 3UXIA 2QJGA 1GGOA 1AG1O 4ZXLA 5C8BB 4NILA 3GO2A 5MHBA 1KC7A 1KV5A 2GFTA 3BK0A 2DVXA 2GDQA 1XIJA 3EOLA 2HE8A 2INEA 4H2HA 2J4GA 3KRUA 4HQVA 3OGVA 1WNOA 3FV9A 3KBJA 2FZBA 3EDJA 1B31A 1YDOA 1QNPA 3LLXA 1F3XA 1JL8A 4XKYA 3W7DA 1RV8A 3OLGA 3WJYA 3QMTA 5FAJA 4IP7A 3CU2A 2QF8A 4FHAA 1Z8AA 4MOZA 3C3UA 3C2EA 3GYEA 1XLJA 5H91A 4KIEA 2RDTA 2AQVA 2GGGA 2F7FA 2TAAA 2PSNA 1VBJA 2WSPA 3EOSA 3WD2A 3QY8A 3MTWA 4PBEA 4C7DA 2AAAA 3KP1A 4H01A 4DYJA 1NFGA 1US0A 1OCBA 2F2KA 1XDJA 3UCQA 3BV4A 2WPBA 1XYZA 1UJPA 4AD1A 1GW1A 3GW0A 2D23A 3ZWTA 2ZUUA 2B4GA 4JKKA 4LAZA 5F1UA 3VXGA 4ROQA 2VGGA 3WG6A 2OWWA 6TIMA 1EBHA 2GGHA 3GHSA 2P10A 1W1TA 4DPPA 4UR9A 1UB3A 2NVCA 4PUMA 1U33A 2B7OA 1D3GA 2VP8A 2DU2A 3S46A 1SFSA 2X05A 1G4EA 3VIFA 3P61A 2G5WA 2IW0A 3WK0A 1E51A 4LYQA 1XDLA 4V33A 3W2MA 3WL0A 4O10A 4QDMA 3BMVA 3USBA 4C1KA 3WBEA 1ADDA 1AW5A 1NOFA 4FLOA 4HHMA 4US6A 4JTCA 1OG6A 4WDUA 2EPMX 1W5NA 4GQGA 4L9YA 5ABFA 3KEHA 2NVAA 3KLLA 1Q4WA 4H9ZA 5JMUA 3UVAA 2CITA 1OFDA 3ITLA 4OKDA 4JXCA 4J3SA 4R3UA 3QJAA 2C1IA 5HXMA 2D2HA 3C8NA 1XYFA 1TRDA 1XHGA 4PFHA 1TPEA 3WNKA 3ONBA 1YNPA 2DEPA 4WR3A 2NLYA 1MW1A 3PBWA 3KDOA 4MFEA 2R9RA 1XC4A 4O1CA 4N4QA 3NO3A 1R2RA 2CLHA 1YPFA 2GQ3A 5A2AA 4N2YA 3GFZA 3AZRA 2AL2B 2WC3A 3GIYA 1MNZA 1SO3A 4ZQMA 3BSHA 3GFXA 3H4WA 1LORA 3GTHA 3STEA 3NYZA 3HV9A 5F7UA 3O6DA 3ORWA 1EHAA 5D30A 4R34A 3UJRA 1A4LA 1Q66A 2PDUA 4IFRA 3LPGA 5JVLA 3OLEA 4N9EA 3ZQ9A 1XBVA 4XZMX 3UNTA 4HTYA 2ACUA 3KBNA 4HZ6A 4NNAA 4GVFA 3B0UX 1J93A 2QLYA 2FHFA 1TZ7A 2NWRA 3WK1A 4HNVA 4PR4A 1ISXA 5DCDA 3B3DA 3B9NA 1PX8A 4QBXA 2ZUTA 3CT7A 3WLOA 2Z2BA 1IGWA 1XCXA 2ACSA 4W8BA 1H60A 2YXGA 1XRFA 5IM51 1L0PA 4M80A 3VZZA 4M3PA 3NOYA 1E0VA 1Z48A 3C0JA 1OY0A 1VFTA 4NXKA 2KZHA 4IPIA 5BU9A 2X0SA 3M16A 3VMNA 3FJ6A 3OVRA 1KA9F 3MUY1 4NJIA 3EKZA 1H51A 4OBRA 1KM4A 4GGHA 4DX3A 4JTFA 5EMYA 2W63A 1WYIA 3NSMA 1ML1A 2WVVA 3VDHA 1PZ0A 1DHPA 1RCXB 1LOLA 3SCNA 3G3DA 2P1FA 2QCGA 4PTNA 3IARA 3VOIA 3WUEA 4LOCA 3U48A 2AMXA 3S1WA 5M2FX 1KGWA 3W00A 2GJNA 1XLAA 1OHLA 4WDTA 3DUGA 3NQ8A 3MI3A 1S5VA 1AW2A 2QCCA 4XD4A 2OKOA 2AGTA 4H00A 4HJWA 3GXMA 5I3DA 4D72A 1QHZA 4Q8UA 1LWHA 2YSWA 1MXDA 3PFRA 4GINA 3QSTA 2EQDA 2YBVA 3SO7A 3RHGA 1E3ZA 2P5NA 8RUCA 1XYAA 3ARQA 2PRHA 2VRJA 3PSWA 5T9CE 4F4RA 3SJNA 3F5LA 1A4MA 2GK1B 1HL8A 3VE7A 3WFLA 5BOFA 3XIMA 1REQB 5LNSA 3KX6A 7ODCA 1KM2A 4UQEA 3TN6A 3U8GA 1MFUA 4M8UA 4P8XA 1ADSA 2B7NA 4L65A 3CUJA 3VKBA 4HMNA 3BQ6A 3M1ZA 3ITCA 2AKMA 1XD0A 3P8IA 4C91A 2DH3A 1HT6A 3BH4A 3IGUA 5G5IA 3SECA 5FOOA 5A8MA 4DF0A 5TQLA 1ZAJA 2Z7KA 4EANA 3WH8A 2Z00A 3WCZA 1V93A 5GNXA 4GOAA 2PCEA 2OCZA 3CAKA 1O68A 2DT3A 4IHCA 2PDHA 1ZBWA 1IT0A 3NNTA 3W25A 2XN2A 2WJEA 1T6MA 2VELA 1H49A 3W7GA 1F61A 1J10A 1V0KA 5T8GA 2C15A 1RA5A 4JYFA 4ZQCA 1E6ZA 1GVYA 5EBAA 4GX8A 4YN5A 1J11A 1G4SA 2WB5A 3UA4A 5A6LA 5I79A 4HSNA 2WYSA 3C0SA 4KCTA 3FVMA 2V3DA 1CTNA 2J77A 3AWOA 1CB2A 4P7NA 3PZOA 4W7VA 3TV8A 3FHQA 3S1GA 3QR0A 2P0IA 3EMZA 2CXGA 4DJDD 2RAGA 3O1NA 1Z6KA 1MQQA 4ZO7A 4DIAA 3VC5A 4ALDA 3TQ0A 4JL2A 4QSFA 1A5CA 4JTEA 1SM9A 4U2ZA 3IJ9A 2CXEA 3GVGA 4GBDA 4HNCA 3FS2A 3IANA 2CLLA 2V6AA 1JCYA 3LXBA 3L2MA 2EJ1A 4LUTA 4HA3A 4LUJA 1G94A 1PZ3A 2XZ9A 3AYRA 3P0XA 1ITUA 1Z7AA 4CU8A 2QGYA 1F4HA 1S5MA 4WXZA 4EPDC 3QHNA 4NAEA 4NAFA 4PN2A 4IGHA 3GUWA 2V67A 2HWGA 4DF1A 2UV8G 2J24A 4HTBA 1GNXA 4D9PA 2Y7EA 1LTDA 2VX7A 1FWRA 3KP0A 5JH1A 3MMTA 3T55A 3TYUA 1EWDA 2OG9A 4Z2IA 4IMCA 2OYKA 3ALFA 2I16A 3FKRA 1SJCA 3UZXA 1FHDA 2HV5A 1UD4A 3S2MA 4DBWA 2R8WA 4HHPA 3NURA 4F2BA 3BGJA 4C60A 2CZEA 3OVPA 2EG6A 4P7OA 4RW5A 4ZXOA 1KW1A 4M56A 2WSYA 4LVAA 3WELA 3EOOA 4WOQA 4DVOA 4DUVA 3NQGA 2D1ZA 1Q4NX 3O6CA 1CI1A 1D7KA 4DZHA 3EWBX 1DL3A 3AHVA 3LUTA 2PU0A 1S5TA 9RUBA 2WNZA 3N2BA 4OBSA 4JDYA 2V3EA 1Z9AA 1AD4A 4UR7A 4L1GA 1RY8A 2FPVA 2V30A 4REQB 4Z1YA 1FHLA 4UOJA 3S1XA 3BO9A 3LCGA 1VHCA 3LS9A 4A2SA 1EH9A 3DFPA 1XPYA 2ODOA 4C6EA 4Q4MA 2PBOA 1NF0A 1TV3A 4AYSA 1ICPA 4QAWA 1B2YA 2W0UA 1XFBA 3OB8A 3VPLA 4IIBA 1GVRA 2V2CA 3HGOA 4PA8A 1CENA 3I4KA 3VIKA 5D04C 1MNSA 4BQ2A 3VYLA 4GYJA 2Z1WA 1LCOA 3U5UA 3W1UA 4L4LA 3BXWA 1R8LA 2DGAA 4EK7A 4D8LA 2G3MA 2HNEA 3W88A 3MO4A 5C70A 5LHEA 3TONA 2DUZA 1GKRA 1GJWA 2WAGA 1EJWC 3QY6A 1EJTC 3IUIA 2WWDA 3OZOA 1YBQB 4Y7EA 4H1ZA 3S9YA 5C7HA 2QMJA 5HUOA 2ZWZA 3GVRA 1Q65A 4O17A 1E1EA 2VDGA 3OPSA 3PPFA 4KEVA 4AMCA 1GZ1A 3MANA 4F48A 1MYRA 4XV0A 1MDRA 5IFPA 4H3DA 4DPQA 3PBUA 2PPGA 5A8OA 3LX9A 2BSLA 1FWSA 5EYWA 4TVCA 8XIAA 4JIRA 5LGZA 3C2OA 1B3YA 3S47A 1FWJC 2XH0A 2XFYA 2YL5A 3DENA 4ZO6A 1QTWA 1BD0A 4NRRA 1PAMA 1XIBA 2CZFA 4Y9PA 2X1RA 4R85A 3EDEA 3D47A 2GVLA 4GYPA 2C3ZA 2WKJA 4HJFA 1E6NA 2IXUA 5GNZA 4WJXA 3RPDA 1OGBA 1XDMA 2R94A 4BQ5A 3DG7A 2WCSA 3BW3A 4LPCA 4IP5A 2ZRYA 3Q2DA 3NGJA 3AJXA 2VT0A 3F2BA 1QHOA 5HJYA 2CFFA 3KBSA 2DZPA 1Q5MA 1GQNA 2E6YA 3TNOA 1ISWA 4RNJA 1OIFA 3L4VA 1OFEA 3T08A 2Z1XA 4XO7A 3PJWA 5HMFA 3VUPA 4JTSA 2MNRA 2ZX5A 5LXXA 1QK0A 2QEZA 5EFDA 3E38A 3U9IA 3C2RA 1ZBKA 2W61A 4DWDA 2OZ8A 2REQB 4CEUC 2HNHA 1GHRA 3V4BA 3S9ZA 4MADA 4DO7A 3IJ8A 4AY7A 4PTVA 4UFKA 2BTMA 3CHVA 4OE7A 1JUEA 1BQCA 3S5ZA 1CIUA 1TPWA 4BFAA 4C6LA 1N7KA 3CO4A 1SZRA 1KFJA 4ASTA 2E8YA 2NQLA 2OODA 1Y8BA 2CCRA 2OZ0A 1MUMA 1XIFA 2PLCA 4K1WA 3FJ4A 3ZSSA 2GDVA 4PCNA 3R2GA 2Y8UA 1OQFA 4R9OA 3P82A 1TV5A 3DBNA 1AQ0A 3LNPA 5D32A 1F9CA 3PJUA 4IGMA 3DH7A 1UKTA 4HSHA 3AMLA 3NQ7A 4H9TA 4EIVA 5I02A 4X9YA 3S9IA 1LL4A 4AZIA 1RJQA 5CPNA 5CZTA 4WXYA 4WLCA 4YCOA 2PD9A 3MYPA 6CGTA 4DBSA 2XIIA 4J3ZA 4YYCA 1O5XA 4GVHA 3H70A 1OADA 4J1OA 2HE5A 1TELA 3N25A 4WSKA 4JZ5A 1JUKA 4QR6A 3AOFA 4GHRA 2B0MA 1SSGA 4QDWA 4PCTA 3SGGA 3W1XA 4JR5A 5CC6A 4ZOBA 2GGJA 5DFAA 4MWAE 5IHSA 3RRAA 1GYNA 3T42A 3CHCA 2A7RA 2OFJA 1BTMA 1EX1A 2VZOA 3UBPC 1EZ2A 1AJ0A 1V3IA 4O13A 1WV2A 2JFEX 3MHUA 1IQ8A 4I7WA 2GGIA 3V0UA 4AD3A 1WDWA 1VFOA 1E3XA 1E4LA 5A2CA 1YRRA 4GUHA 2ZUVA 2A21A 1LRNA 2AL1A 1JCJA 5FJIA 1TREA 3AXIA 1FQ0A 3JS3A 2J7BA 5LA0A 3EOEA 3ES7A 3KWXA 4JIIX 1DJGA 4O4WA 5AECA 5HDRA 1JYNA 2C1GA 1K02A 3N14A 1ELSA 1NSJA 4FAMA 2A7NA 1XQLA 1AZ2A 3TZNA 4S2BA 2X1TA 3EKLA 3VDCA 2O7QA 4JQ1A 2X7VA 5AZ0A 1ZSXA 3HA1A 1E72M 4PC8A 4AQLA 2HK0A 3M5XA 7A3HA 1D2KA 4ZMGA 2BHYA 2GSJA 1OABA 4PGLA 2JEPA 4IIFA 4TIMA 2X7WA 6PTDA 2VURA 2VZUA 2H90A 3GB6A 2JGYA 3LOTA 3TWAA 5DXYA 3RLGA 1WBJA 4D6EA 3LMYA 2ZUWA 2J8FA 1FX6A 4J9JA 2PDFA 2WHKA 3AIEA 3CV2A 3DI0A 4FNSA 4J2MA 5EMKA 3A4WA 2V82A 2GGEA 3TOPA 1TSIA 2VYOA 2BVTA 4D6HA 4V1YA 2CLKA 3FAWA 2BY1A 3PTQA 1HJXA 3RLHA 5HA7A 4IJRA 2HXTA 4QTGA 1T96A 3ANUA 3WD0A 3DFQA 1QW8A 3HQ1A 1IWBA 3HB9A 4MNMA 4DLFA 4F2TA 2DZSA 2ALRA 3D6NA 3VNYA 4JNMA 2J62A 2GJLA 2I5GA 1US3A 1H7WA 1KXVA 2D3LA 4LY8A 1E5JA 3B4UA 1VHNA 1LL7A 5JXQA 4E6MA 3UP8A 2V69A 3UY8A 1K03A 3N11A 4X2RA 1EQPA 2VVSA 1YADA 4JKMA 1PL9A 2UBPC 3SZ8A 1Q7MA 2HQAA 4EPEC 3RX2A 4HNNA 2X30A 3FEMA 2DZWA 3N04A 5CPMA 3RFAA 4OWGA 3B05A 3O06A 3ITYA 4W85A 1QW7A 4HPHA 3WF4A 5DBTA 5D8ZA 3EB3A 1JZ3A 3NG3A 1ZZMA 1QWGA 3CT2A 1HGYA 1OB0A 3TNBA 4UUIA 1DP0A 1K3UA 2F6UA 3FJNA 1AK5A 1TPDA 3GXTA 4R7OA 4WSJA 3PUDA 2FTPA 4C1LA 3U7BA 4LNCA 3SRKA 1EBGA 1J4EA 4LW7A 4O1AA 1OX4A 3T0CA 1YXYA 2QJJA 4RZ6A 1AVAA 1H1ZA 1KO0A 3RCYA 1UR2A 3MB9A 1TWIA 2V5KA 3BUVA 2BY2A 2V3GA 3LXAA 2QPXA 3MYOA 3IACA 2EGZA 1I2OA 2FKPA 1OX5A 2Z1SA 4L61A 4NZJA 4LALA 2W6RA 2R82A 4HYVA 3V1PA 2E1WA 2XU2A 4FOKA 4AEFA 3G1DA 3GKFA 2BMBA 4XD6A 3BGAA 4AWSA 2POZA 4ZSUA 1V3MA 1JULA 2YA0A 1E56A 1M7PA 4A05A 4ZO8A 3CLMA 2WCAA 1S5NA 1NWSA 4LQ1A 4EAYA 2WMGA 4S3JA 1WKFA 2IQDA 3TZFA 1L8NA 4HNLA 1OFQA 3L4WA 2ZZ4A 1ODZA 4XKYB 3FYYA 5HJLA 1R3RA 2YGYA 4XX6A 4OZOA 4PMUA 1YW1A 8CGTA 2Z1KA 3UD6A 1V02E 5B7YA 3LCWA 3GR8A 1DIKA 5IBXA 4LT9A 1XD1A 2HBXA 3LCXA 3TQPA 3WN6A 4AX7A 1MWOA 4HU4A 5I2UA 3FSTA 1Q6RA 3L66A 1UKQA 1GQLA 4HHLA 4FX8A 4O0ZA 3KXQA 2EKCA 2YCIX 3Q67A 2INZA 3T0TA 3BZJA 1J0JA 5C9ZA 3W75A 1VC4A 3HMCA 3LSBA 3WK2A 1GOKA 3IK4A 1DHKA 2E6DA 5DMYA 4M0XA 2GWNA 5E1QA 1IHIA 1W9DM 3W1LA 3ZR4A 4XD3A 3HQNA 5A8NA 1W9UA 5CC5A 1UR0A 1DJZA 4NNBA 4UOZA 5DF0A 5LIKX 2FGZA 4FPSA 1E6SM 5CBBA 2OX4A 4UOQA 3ENLA 1QK2A 2ZX6A 3LMZA 1K7EA 4CUCA 1M65A 3IWPA 1OBAA 3E2RA 3EOUA 2E5DA 3Q4DA 4U28A 1UIPA 4E4PA 2V5DA 2AKZA 3E0FA 2V5LA 5HWNA 1A0CA 1EC9A 3T07A 4OTKA 5ABFB 4O52A 2IMRA 4W84A 3LSCA 3POCA 4NZ1A 4Q8MA 4RE0A 2BLEA 4PMYA 2PMQA 3BG5A 1OC7A 3RUBL 4Q8OA 3JU2A 4LU0A 1J5TA 2A85A 1W5QA 1IXPA 3F4CA 1PPIA 4KBXA 1PIGA 3PZIA 3VOJA 6XIMA 3SUTA 2TRSA 3Q37A 4EPBC 3EDKA 3U4FA 3WDRA 4Z2KA 4TVUA 1W56A 3APYA 3EXRA 5E0FA 5F4XA 4JIPA 2R1MA 2PGFA 1KFKA 3T2PA 1FCBA 1ADOA 3N6HA 1BF6A 4IX0A 2E9BA 4NY2A 3MKKA 2H9AA 4BF7A 3R8RA 1ECQA 2Z0IA 1V3HA 4Q3MA 1V6UA 3TLLA 1T0OA 3QGAC 4MJMA 4R88A 4UTKA 3G1YA 3K4DA 3T4WA 1SU5A 3DOPA 2FH8A 4W8AA 1VYPX 4UMBA 4MHBA 5XIAA 4B2DD 4GUJA 1JZ5A 3SSZA 1B4EA 4ACZA 1V6VA 1H50A 4UMAA 4R5EA 3WD1A 1VPYA 1NVMA 4M7SA 1RR2A 5M03A 2BBFA 4UR8A 5G2WA 3STCA 4IQLA 5I00A 4PMZA 2WLZA 3LBCA 2ZBTA 2NW0A 5FEXA 5TF0A 3VFCA 3UJ2A 3LZ5A 5GPRA 3M64A 3QH2A 5CLWA 3B9OA 4GIAA 1H62A 3QMSA 2XWDA 3UCCA 3WMLA 3WNNA 1HXJA 1W1IE 4O0QA 3DGRA 3GDLA 2QCDA 2P3EA 4UCGA 3EWXA 3CZGA 3H24A 5FJJA 2BOGX 2VQTA 4IUGA 4L1WA 1RQBA 2ZUMA 5REQA 4D6GA 1XYCA 4MVAA 1KB3A 1CEOA 4S2CA 3CEPA 5HULA 1SQ7A 3M0ZA 1ZY9A 3MVTA 1DJYA 4WJEA 1WDDA 3NZGA 1TCDA 1OFAA 3VU2A 5JH2A 3R13A 2WVVB 4DWSA 1CGYA 1E1CA 2CWNA 5LA1A 1XICA 2QS8A 2IPFA 1LUCA 3TQKA 3EWYA 4Y9AA 4QSHA 3GXDA 4UFHA 3H4XA 1OCQA 4QHRA 3URAA 4IGSA 1R3QA 2WNNA 3SQLA 2OSYA 3DXIA 3VGEA 3GG8A 3PS7A 2NXIA 1GT8A 1X97A 3VNZA 1HKJA 3GH7A 3MPGA 3NVTA 3T6CA 1ONWA 3IRSA 1EYWA 1E0XA 4DI9A 1L2UA 3QM3A 2E6AA 4BK9A 2BOEX 1FXQA 3DHUA 4Q33A 3VD9A 1LLWA 3VX1A 3GWQA 3LRKA 3TCSA 2Z4GA 4UTTA 2X1IA 1AQMA 4M1RA 5PTDA 3TYAA 4P61A 2A1YA 2WQDA 1TQJA 3HJZA 4C6QA 4TOQA 1DIOA 3KTSA 1Q6QA 1A47A 2Y88A 1ME9A 4FLQA 3WIJA 4ADTA 5H2ZA 1DWHM 4JHOA 3TFCA 2RH9A 3TROA 1C9DA 5H8UA 3DU0A 1P4CA 3ABOA 3NCOA 3CPUA 2QCHA 4RPPA 1T99A 4M1BA 3R12A 4E2BA 1VS1A 3VILA 4AVOA 1H7RA 3AMDA 2QXWA 3E96A 5DELA 2W92A 2PEVA 1E9LA 3LBOA 2DH2A 2TMDA 2I5IA 1VENA 3LD5A 3B0YA 3ZT5A 2WVSA 4G9PA 3N73A 1XWYA 4PSPA 5I5RA 3LU2A 2VC7A 5KZMA 4BWLA 4TQTA 5CSSA 4GNVA 3LXCA 4XD5A 1RBOB 3SN0A 3OYXA 1VF8A 4H9YA 4A3RA 2Z6IA 2Z6JA 4MWAC 2D2OA 1TZ9A 2OX1A 4OFCA 2WCGA 4UTWA 3G24A 3G1RA 2CHNA 1XGEA 3WKZA 4IOTA 3S5NA 4XZNX 3AROA 3A47A 1ZCCA 5HK4A 2R6OA 4IG2B 5HQEA 2VGBA 3T8QA 1CXIA 2OZ3A 1QO5A 2XHYA 2PWHA 5CQ1A 4IXHA 4OVXA 1MQPA 4CD6A 1FFRA 3TYBA 3FVDA 4XTDA 3WUFA 4L7ZA 4KQNA 2NX3A 3CC1A 4G1NA 3ONCA 3CQJA 4FNUA 3UQNA 3BLPX 1IXOA 3WMBA 3RNDA 2BDQA 3DERA 3NQAA 4O14A 1VBGA 1B57A 1XUZA 5I09A 5MF5A 2GL5A 2C16A 3UR8A 1FXPA 5DO8A 3CIXA 5EL1A 1OGGA 3P80A 2VFIA 1I1XA 3ITVA 3NPXA 5BNKA 3R1ZA 1HJUA 5CLTA 2OEKA 1W32A 1BHGA 2GDUA 5FEZA 2YCLA 3GR4A 3VIJA 1WXZA 1WDSA 4LUTB 2QJHA 3CL8A 4GLEA 2NVDA 1TPVA 1NM9A 4I5UA 5LNUA 4DXXA 4AIUA 4GQ0A 4K8GA 4PTXA 1T40A 4NAFB 4NAEB 3EZ4A 4E8DA 2W9MA 1Z32X 2VFFA 2ISSA 1LP6A 4G7FA 3I6EA 1A0DA 1A5LC 1HKIA 4S23A 1CXEA 3B03A 2G3FA 4V28A 5BRBA 3E5PA 4CQ8A 2HISA 4BEQA 4WKFA 2OYLA 1WUEA 5GJMA 3GNPA 4UMCA 2J74A 4UC5A 3CUZA 2EPNA 2ZRUA 3QQ0A 4JIQA 1KXTA 5BMXA 4A2RA 1HQTA 1X1ZA 2DSVA 2GSEA 3GIPA 4E8CA 1XKYA 1Q6DA 3REQB 4KT2A 3T0BA 4S3AA 4F8XA 3TU9A 2R1PA 1ZL1A 2OQYA 4XVEA 4Z2HA 1AL8A 2PDBA 4AD2A 4XAZA 2QVHA 1F73A 1J2BA 1K70A 3EX3A 5KINA 4U2YA 3SIZA 3VGDA 1BWVA 3WQ5A 1RQHA 2PLKA 1DPMA 1DE6A 2QDHA 1TJRA 1LJYA 3MDUA 3L9CA 3WO8A 3RM4A 4WRHA 3TEVA 4GC3A 6A3HA 2J9ZA 1U22A 3NQEA 3WQFA 3PVFA 4ICCX 2A2IA 5CGTA 1LZOA 4Q8NA 1VAHA 3N13A 2Q09A 3GC5A 3WJXA 4HCLA 4XAFA 1U30A 5C71A 2VGFA 1IIHA 1MW3A 1A5MC 3STPA 4B5SA 4ES4A 1HIZA 1XW8A 1VIZA 5AYIA 1L6WA 3RR4A 3N12A 1F05A 4MAZA 4CCEA 1LLZA 3WNPA 2CLEA 3AHTA 3DFSA 1FCVA 3LV5A 4US5A 4NRSA 1EWEA 3W76A 4TTUA 1VFLA 4AD5A 7REQB 3SCPA 2UY5A 2ISVA 4OOUA 4GFIA 1GK8A 2CESA 3EPNA 5G4EA 4ML9A 3WDQA 4LAOA 1VFFA 1UWUA 4PCSA 3MSGA 1G67A 4S3BA 3B0PA 5HJXA 4AH7A 3Q45A 9XIMA 3VI2A 4K8HA 3RLUA 3S6OA 4C6FA 5LYRA 4WOZA 5CSYA 3UZZA 3T44A 2ESCA 1PZ1A 2FMNA 2QUMA 9CGTA 3AU6A 1XLLA 1E73M 3AIRA 3M0IA 3SM0A 3AHZA 4BI5A 2WC7A 1TUXA 4Z2GA 3TN3A 4O28A 3EB4A 1BVZA 4Z0SA 3MP5A 3T2OA 1W3TA 2A3AA 5CG7A 1E43A 3WLPA 1TMHA 1XSJA 2VWTA 1JZ4A 1RXOB 2BG5A 1FWFC 4CU7A 3IUDA 2GQAA 4TV6A 2JKPA 2J7GA 3CH0A 3UWVA 1TPC1 2P53A 4WD0A 3ANVA 3A9BA 3Q58A 3AISA 4DXVA 1B9BA 1PCWA 3AS1A 4JICA 3VNMA 3SCQA 1TWSA 4EKJA 1SZNA 4X63A 5K4XA 5FA5A 2YW3A 4JX4A 3RR1A 5CBJA 1HJWA 4ZOCA 5AHEA 3MC5A 2IPJA 9XIAA 3N2CA 4CKQA 4PBGA 3HPZA 1GQIA 3B4YA 3CQKA 3W1TA 2EXOA 3FAXA 1HO4A 5C5YA 4HMDA 1RK6A 2PC4A 2PWFA 3SRFA 4HOXA 4GQQA 1LM1A 2NV2A 4EPKA 2G4JA 1TPB1 2UZ9A 2INFA 1XLGA 1R5YA 3P2VA 4JAWA 3RJYA 1UZ4A 3NM1A 2EEXA 5IOBA 1XC6A 5C7VA 3W7LA 1KNWA 1CXLA 1YE4A 5JQ9A 1EO7A 1UWQA 4QEEA 2BODX 2YIHA 5E5CA 1EJSC 1S38A 2Y7DA 4XAYA 3CGTA 4DM2A