1LOQA

Crystal structure of orotidine monophosphate decarboxylase complexed with product ump
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
209
structure length
208
Chain Sequence
b'RLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords orotidine 5'-monophosphate decarboxylase
molecule tags Lyase
source organism Archaea
publication title Crystal structures of inhibitor complexes reveal an alternate binding mode in orotidine-5'-monophosphate decarboxylase.
pubmed doi rcsb
total genus 81
structure length 208
sequence length 209
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2002-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1loqA00
3C6CA 3G0UA 2A4AA 3W9ZA 4A3UA 1XBZA 4LY8A 4PFMA 1XFBA 3VCRA 4RJEA 4A2SA 3HPXA 1UUMA 3UQNA 1KA9F 2WO5A 3HG3A 3INPA 4NJHA 5TQLA 2A6NA 2H3DA 2H8XA 4LVBA 2JK2A 4IMDA 4S2BA 2HS8A 1ZALA 1G69A 3GXPA 4NJKA 3PUOA 2ABBA 1OVDA 4NJJA 2FJKA 4FX8A 4E0CA 3TIMA 1QFEA 1TJPA 1MEHA 1XBVA 4JTKA 4O4VA 3OVRA 1LP6A 1FCQA 1WBHA 4JTFA 3IIZA 1YYAA 3L68A 1KLYA 3VE7A 1BWLA 4X2RA 1TPFA 3EX1A 3M0ZA 3R89A 3PG9A 5BRBA 1LROA 2B7NA 2ZZ1A 1U5JA 3LCIA 3TQKA 2CLLA 4XTDA 3GDMA 5EY5A 3LCWA 1JR1A 3G22A 4WOQA 5G4EA 1R2TA 3W7HA 1YADA 1TSIA 4CQ8A 3PSVA 3LM7A 3SECA 3MBDA 1PCKA 4HHPA 3IVTA 4KFOA 3BGJA 2QDHA 4X22A 3T4CA 2CU0A 1SW7A 1S5TA 1SZEA 2BLEA 5BMWA 1KV5A 2W79A 2Y62A 3PBVA 3TROA 3S5ZA 4AEOA 3T40A 3GAYA 1TRDA 2H3BA 1G7VA 1SZFA 5F1UA 4PA8A 1CX9A 3RMJA 1SSDA 2X16A 4AH7A 2V30A 2ZTJA 5CZSA 2GVGA 3FIGA 3H55A 2NWSA 1PIIA 3LI1A 4Q4KA 4WY0F 1MEIA 4UTUA 3QJAA 3L5LA 3SI9A 4GC4A 4JTHA 1KM1A 1ZAHA 3N73A 3W83A 3W2LA 1YXCA 1MEWA 5L9FA 3A21A 3W87A 1F2JA 1LORA 3VFLA 4N9DA 1NSJA 5TIMA 4K8HA 3N9SA 3UPBA 3NQVA 4HPXA 4AAJA 3GX9A 4LS0A 1S5WA 2WNZA 4LS1A 1SR9A 1H62A 5HULA 2FTPA 2R14A 3SZ8A 4XTIA 1JRBA 4U4MA 4JX6A 5KMYA 2HMCA 1QWGA 3TU9A 5I3FA 4UMCA 2VOMA 2ZQ0A 4MUZA 3MP3A 3WJSA 3QC3A 2ZRYA 1Y0EA 2NZLA 5CG7A 3P5YA 1VZWA 4UNKA 1YDOA 1TTQA 5HUOA 2QAPA 2UV8G 2YW4A 3S1UA 1A5CA 4LC8A 1FDYA 3G1SA 1WA3A 1F05A 1NAL1 3LV5A 1F6PA 1ZCOA 3NVTA 1O94A 3UWUA 2Y7FA 3HGJA 3KVLA 2C0AA 4Y90A 1TYGA 4D2JA 1VYRA 1BEUA 4E2BA 3NPVA 5L6UA 2P10A 1K8XA 5CPOA 4CQAA 1QCWA 3P5ZA 3BW4A 3AO0A 3RK8A 4RXGA 1ADOA 1TV5A 4O0KA 5HNRA 3SY5A 4DEFA 1RZMA 1KBIA 3C3NA 4TU1A 2YYTA 1FY6A 1QPNA 3R12A 1PE1A 2BZNA 3R2GA 4A21A 1CI1A 2YSWA 3W1UA 3S8HA 1V7YA 1C29A 1KBJA 3FYOA 3B0PA 3IV3A 2NXIA 1IF2A 5HR6A 4IOTA 4UTJA 4UMAA 3GK0A 2WSYA 4AHPA 4IX2A 2RHGA 4Z08A 3HJZA 1LBMA 3M9YA 2A7RA 1EP1A 1E51A 1NF0A 2LLEA 1EA0A 2GPTA 2O7QA 1S5VA 1KM2A 3W1NA 2GVJA 1JCNA 3W1LA 4A29A 1FBAA 2E5BA 3OHIA 5D38A 3C61A 3CIXA 4O8RA 3TSDA 3EKZA 4ORMA 4MZ1A 3S1VA 4MPQA 3M1ZA 1UUOA 1SFJA 3NO5A 4CQ9A 3M5ZA 3KOFA 4H3DA 3IGXA 2Y61A 1WYIA 4QJ1A 3P74A 2XN0A 3G3DA 2VEKA 1IIGA 1TV8A 4LRTA 1XBXA 4OBTA 3M16A 2OX1A 3OEXA 1LM1A 2C18A 1OK4A 4GXMA 1X7FA 2DZXA 2NX9A 1LBFA 3NNTA 1DHPA 4JNMA 3RLVA 3S5OA 1ME7A 4O13A 1H61A 1YDVA 2C19A 2ZA3A 4NNBA 3NQCA 5G5IA 1ONRA 1B4EA 5D2YA 5FESA 2WJZA 3W1TA 5AOUA 5BNKA 4ZMGA 1OFEA 1G67A 3W72A 1Q6LA 1LLWA 5EKYA 5FEWA 3O63A 2PRHA 4RZ4A 5KINA 2A7NA 2ABAA 2QJGA 4OHQA 3GXTA 3F03K 1XDLA 2BSLA 2YFOA 5K2ZA 2NV1A 4MJZA 5G2HA 2R91A 3WK0A 1FWWA 4IPJA 4AB4A 2WNQA 3STCA 2V82A 3MJYA 1NFBA 2H6RA 4ADSA 2ZFAA 1WQ5A 1MSSA 2WPBA 5AHIA 3ELFA 4DO6A 4HSNA 1GVFA 3NR0A 2TYSA 4M19A 1ZAJA 2DORA 2BX7A 4NNCA 3TR2A 1LCOA 1B4KA 1K02A 4Z1AA 1OFAA 2NXGA 3HGOA 3HIJA 4O54A 5I3KA 2AAMA 2QCEA 1VHCA 3CEUA 3QFEA 1RR2A 4XWUA 2V5LA 3TK7A 3PBUA 3O05A 3T7VA 3A23A 1JCLA 3G18A 3JS3A 4N4PA 1WOBA 2NLIA 5SWUA 2E77A 3B8DA 3IGUA 3LOTA 3OIXA 3EWBX 4LTSA 4N6FA 2PRLA 3W76A 1X1OA 3C56A 1HG3A 4UFKA 4O0ZA 2V9DA 2JKAA 4UCGA 1SO3A 5D09A 1O95A 1H7PA 3EWZA 1SO5A 5G2IA 3W7CA 3BW3A 3O6CA 5DCDA 2RKXA 4X9SA 2CLHA 3LHWA 4DBDA 4DF0A 1KV8A 5G1TA 2B7PA 4WXYA 3A24A 3FJLA 4RLIA 5D03A 4RZ6A 2B7QA 3NQ7A 5LKYA 1H1ZA 3O1NA 3TV8A 3ABOA 2R8WA 1F76A 3NPWA 2FPTA 4ALDA 2ZZ4A 1UB3A 4OQVA 4ADUA 2V81A 1OX6A 3W71A 1XL9A 4HKPA 2VFIA 3EKLA 4H4IA 4HNVA 5GVJA 3C0JA 3PF3A 2CLIA 2AGKA 2QCGA 4MJMA 3KVMA 5CZJA 4JTGA 1VLWA 3NM1A 4N9EA 4MLRA 2ZZ2A 3NL5A 2NUYA 3C4UA 3ZS4A 1EB3A 5F2GA 1K8ZA 3NQ8A 2RDWA 4LW7A 3O15A 3TSMA 3LHVA 3W1MA 5CPLA 2YX0A 2G97A 3PY2A 3NYZA 3CC1A 2QCNA 4OGZA 3QMTA 5CSSA 3TAOA 4O1CA 1SUXA 2GJLA 1W3TA 6ALDA 1SW0A 5FF3A 3BO9A 3P61A 3EX2A 1OK6A 4QAIA 3LXBA 4WY0B 4WJEA 3WJXA 1VPXA 3EXTA 4QISA 4O12A 2G96A 4AXKA 4O52A 4CNPA 1VC4A 4LC6A 5HQEA 1XDMA 5C6MA 2VKZG 3UWWA 1V5XA 3G8EA 2CZDA 3QW3A 4HPJA 2CWNA 4WXZA 2ZYFA 4NXSA 6TIMA 2W6RA 3LXAA 4JDYA 2OJPA 3RNDA 4ZQOA 5DXYA 1YXDA 2CW6A 4CCEA 4GUJA 3DI1A 3LHTA 4LNYA 2CZFA 3YPIA 1SO6A 3CQ0A 4RX0A 5LHEA 2WOQA 4Q33A 3SGUA 3E96A 4NT0A 1FCBA 3QZEA 2YZRA 2YGYA 4DF2A 1DV7A 2CLFA 4JTTA 3P82A 1RPXA 1IIHA 3ABRA 3PC0A 5K9CA 3P8IA 4CNOA 3CPRA 1VLIA 1RQBA 2A1YA 2YXGA 3TC7A 5DCEA 2QCDB 5FF2A 2CLKA 4M5PA 3CIWA 1SO4A 3NXFA 3PR2A 1KM5A 1SSGA 1YTEA 3NOEA 1JVNA 3MP5A 3LRMA 5EPDA 4FF7A 3P84A 2J9ZA 4K37A 1EWEA 2P0OA 4Z1BA 3PVFA 2QUVA 1Z42A 1TJRA 4Y96A 3QPYA 1TQXA 3W70A 5CKSA 1GG1A 1H7OA 1H7WA 3P81A 3C2EA 3R13A 4JEQA 2ATMA 3BK0A 1K7FA 1FQ0A 1IXPA 3M41A 4PL2A 4JY8A 4WY0A 3DU0A 4K39A 2H90A 3LGEA 3QRHA 1P1XA 5AYXA 3VNDA 3K30A 3B05A 2QCMA 3OVPA 1YLVA 2QCHA 2GQ8A 1W3IA 1I2PA 1NEYA 1ME9A 1TREA 4LVDA 5CPMA 3SGZA 4FNQA 1TPDA 1W3NA 3BLIA 2DJLA 1IXQA 4M6PA 4O17A 3TKFA 4JTIA 3L0KA 1I8JA 5LNRA 4OE7A 1JUKA 2C13A 5HWJA 4DO4A 3MHGA 3RF9A 3DFOA 3UYCA 4XQ6A 3GKFA 1UCWA 2YR1A 3L66A 4MOZA 1ZY9A 2E09A 3KRSA 2WV8A 3PWAA 3SW6A 1RV8A 2QJIA 4IPIA 4P2VA 5TBOA 3W2JA 1KFLA 3DZ1A 4LUIA 4O11A 1QOQA 5EBUA 1WOAA 1B3OA 3ZFHA 2A0NA 3FKRA 2KZHA 1JJKA 3G0XA 4R53A 5C54A 1GYNA 1I2NA 1OYAA 2TMDA 1AW5A 2RDUA 4MYXA 2DJXA 3S0CA 1A5BA 2NX3A 2G5WA 1GTEA 3TMQA 1LDCA 2CZ5A 2ISWA 2HS6A 4JGDA 5AHFA 3QM3A 1DORA 5LGXA 3P67A 1DOSA 2CLOA 3KVKA 4Q32A 5DBTA 5A8GA 4OV4A 3Q37A 1OFQA 4IQLA 3DGRA 4M7TA 4JIPA 3G24A 1RQEA 1AK5A 1W37A 1QAPA 5LZLA 3TA6A 1QPOA 5F4XA 1D9EA 4Z1CA 1MO0A 4IJBA 3C2VA 4AHOA 4GNJA 3WJWA 1OYCA 3HQ1A 3WK2A 3BVJA 3I65A 4L4MA 2DP3A 1GOXA 3MP4A 1A5SA 4MVAA 3MW7A 3MYOA 3SSJA 5HMSA 2XFWA 5F2MA 4R33A 4UIOA 1JCMP 5D05A 5BOOA 2WNNA 4JICA 4TR9A 3S5NA 4MY8A 3W22A 3MHFA 3HGRA 1G6CA 5D2WA 1A5AA 5LSMA 1IXNA 4EIVA 2QAFA 4JY9A 2ZZ5A 5FF4A 3LTYA 4QITA 3UWYA 4DPQA 1ZJIA 1G4EA 3M6YA 4P61A 3RFAA 3DKJA 1N8FA 3I7RA 4Z0JA 4IMCA 5KTLA 1OFBA 4TIMA 1KFKA 4GUIA 1JCXA 2X1RA 1TMHA 1O5XA 3EXRA 5K9DA 2Q3RA 2JGQA 3Q58A 1GPWA 2D73A 4DO5A 1LBLA 4O14A 2J9XA 3G1XA 3LCXA 4HNUA 3GIYA 2FPVA 1KLZA 5LHFA 1N55A 2QCLA 4BI5A 1DJNA 1GQNA 2NWRA 3CT7A 3GDRA 3QF0A 3WJZA 4DXVA 3W7MA 4UTHA 4UR8A 3UXDA 4K38A 1GYLA 1JQVA 1FUYA 4YCOA 4E38A 4DELA 3KHJA 4CCCA 3IEBA 3W2MA 2QF7A 4U28A 3FKKA 3NQ6A 1H50A 2YCEA 3L5AA 3W85A 3FLUA 1H7NA 3G1AA 4N9CA 4WUIA 4G1KA 4RR4A 1HO4A 3MO7A 3ABSA 1XUZA 3P80A 3UNDA 3W7IA 4LOCA 1BTMA 3B03A 1KM0A 3W7OA 5KZMA 3GZ3A 3SIZA 3W7RA 5DBUA 1G4PA 1ALDA 3DH7A 1W1ZA 1XKYA 3DKLA 3GNDA 1XXXA 3JR2A 5AB3A 4MZ8A 4M6VA 3W7JA 5F4SA 1FX6A 4PC8A 3M43A 3PS7A 1H63A 4UFIA 1W5QA 3EWUA 1VR6A 4I7VA 3PULA 3I6RA 3NGJA 1TRIA 3UZ5A 4I9AA 2Y85A 3L5MA 1Q3NA 3WJYA 3IIXA 2FDSA 3G8RA 3BARA 4HNNA 3TW7A 3STGA 2X1TA 3OBKA 5G1YA 4NZJA 1J4EA 4Z1DA 4CCDA 1ZAIA 3VKJA 3MHUA 4KFNA 3BPWA 4WOZA 1O4UA 5DCBA 5G2WA 1LYXA 3ATYA 3QMSA 2VEMA 1XBYA 3GLCA 3GDKA 3BG3A 5LNVA 3GDTA 5KSWA 1FCUA 2QJHA 4JTJA 4IMFA 3H53A 5CSRA 5G4WA 3TW6A 3G0SA 1FWRA 4XZ9A 1QR7A 4A22A 3IIOA 1TPWA 4LRSA 3LHZA 4ML9A 1ZFJA 4LVAA 3OG3A 3EXSA 3TFXA 1FDJA 3B0UX 2V0TA 4NX0A 3AJXA 2BWGA 1L9WA 3GR7A 1I2OA 5DN1A 2V2DA 3MI6A 1WBJA 1L2UA 3BLEA 1W5MA 4MFDA 1GVSA 3NG3A 2I9EA 2CFFA 1TCDA 3NDOA 1HTIA 2YW3A 2Y7EA 1W5NA 3L2IA 3T55A 3OVQA 4DF1A 3G3MA 2FB3A 5LNWA 4N6EA 2DZUA 2Q8ZA 3TC6A 4MFEA 3LHYA 2NUWA 1X6UA 4AF0B 3Q2DA 3TFCA 4M6QA 2EHHA 1K3UA 2GQ9A 3TAKA 1EEPA 1R46A 5K4XA 4HT3A 4X3ZA 2G95A 3C8FA 4DQWA 4JTEA 2RFGA 4LT9A 2VFDA 2O7SA 3E02A 3DFSA 3L0GA 3RU6A 3DHDA 1ICPA 1K7XA 3M5YA 1KM3A 3NQAA 1BWKA 3NQDA 5AHLA 1G4TA 4N02A 1YXYA 3A22A 3HPSA 3GXNA 5H2ZA 2EKCA 3JRKA 5BMXA 3UWQA 1JULA 3NL3A 1GT8A 4FNUA 1ICQA 1TPVA 4TX9A 1KM6A 4IGHA 4N9BA 5J5DA 4JDBA 4K36A 3E0IA 1PV8A 5D32A 2V5BA 3M7WA 1Q45A 4NXKA 1H7XA 5CZ0A 2GUUA 5U7SA 2CZEA 5LGZA 1JRCA 1QO5A 1WX0A 4OU1A 2E5DA 4MLJA 3CWOX 4IMEA 3HG5A 3NZ1A 4S1FA 5A5WA 1OABA 3T78A 5DY3A 1DJQA 3LLDA 1GG0A 4O1AA 1BKSA 2OMAA 4O4WA 3LI0A 1KFEA 1VCFA 2FB2A 1SU5A 2E1DA 3I68A 1OFRA 2W0UA 4NU7A 5D37A 1DL3A 1JUEA 4AWTA 3LTSA 1EIXA 3PAJA 4QM1A 4M7SA 5AN7A 3W3OA 4UTTC 1OX5A 4UFLA 1KW1A 1P0NA 3QQ0A 1VYPX 3HBLA 2Q8LA 3R8RA 4IXXA 3PM6A 2Y63A 1AG1O 3W7DA 3VI2A 3WK1A 4N2YA 4WD0A 1GZGA 2Y6ZA 3LCGA 2C6QA 5AHEA 3UD6A 2A85A 5U4NA 4TMCA 4UUIA 5I3IA 3I7QA 1AL8A 5K7JA 1OFDA 5FI8A 3W75A 1SZNA 4EVZA 4FNTA 1LLZA 5AC7A 3W1PA 4UFMA 1O5KA 2ZA1A 1T96A 3D0CA 2DZVA 4FNPA 1KFJA 1T8XA 3KVJA 4FNSA 1LOQA 4RKAA 4AWSA 3NA8A 3SR7A 2ZRZA 3CEPA 1VCGA 1VRDA 2F7FA 1OF6A 1NF7A 1TPUA 5F4WA 1KM4A 2Y70A 2R94A 4OWGA 3TNOA 3W7KA 1JQXA 3GYEA 5DXXA 3S5YA 1LTDA 3KXQA 2DU2A 1J5TA 1FXPA 3B04A 2VC6A 2TPSA 3BG5A 2BTMA 4NZFA 3NPXA 4C1KA 2GQAA 1EP2A 4MY9A 3G1DA 4R7JA 2EPHA 4QNWA 3LB0A 2E5CA 4PEKA 5AYYA 4AMAA 5I3JA 1W5PA 2V2CA 3MYPA 3B0VC 1W54A 1XCFA 2PURA 4PH6A 3DXIA 5FEXA 2I14A 3TE9A 1THFD 3GDLA 2I1OA 1SZGA 5K9XA 3EX3A 4J9JA 3N2MA 3F4WA 4UTKA 3HG4A 4IXHA 3W7NA 2FPYA 1B57A 3VE9A 2OZ0A 1ML1A 4ADTA 4K8EA 4ORIA 1F5ZA 2C14A 3CB8A 5D30A 3U2OA 2E6FA 2QUUA 3FFSA 3TX9A 5C2XA 2WSQA 4HSOA 3W88A 4QQ3A 1EX5A 3LDVA 4KKXA 3TDFA 1GWJA 3PB0A 3MI3A 2Z6JA 1F7BA 1H7RA 3HPZA 1WXJA 3UZJA 5BW6A 3KRZA 4NVTA 5D2TA 3DI0A 3LCHA 2ZA2A 4IWWA 4BI6A 3UY7A 1MXSA 4Y8FA 1GVQA 2TRSA 3LCLA 5HINA 4FO4A 2A21A 3W23A 1H60A 5E93A 4GUHA 2ZRXA 4PCFA 3LLFA 3NPUA 3QSRA 2YFNA 4JXCA 1M7OA 2QCCA 2VEIA 5MHBA 3O6YX 1PVNA 2WKJA 4YWIA 3B06A 4LWWA 1LRQA 3EEGA 2A6LA 4JIQA 3CWNA 4FHAA 3N2XA 4XUGA 1C9DA 4ZQNA 3LRLA 4BWLC 2VXNA 3GNNA 2DZPA 3M47A 1TV7A 1P0KA 2V2HA 1R2SA 2X30A 3P62A 3W7LA 3EWXA 5FEPA 4AHQA 3TQ0A 1W5OA 1EUNA 4H6KA 1Q6OA 4KWVA 4FEZA 4FNRA 3W7GA 3WK3A 1D3GA 4K7YA 3TJXA 3MBFA 1EPXA 3ATZA 3EWYA 3M5XA 1YDNA 2QDGA 2Z1BA 1QDSA 5EMUA 3NL6A 3NQEA 4IX0A 4KFPA 3U8GA 1MZHA 4Y9AA 2Y88A 3DAQA 3LX9A 3L21A 3PUDA 2DZWA 1F73A 4RV8A 4EF8A 4NQ1A 2Y7GA 1HL2A 4HN4A 3HG2A 1DQXA 4I7WA 3HOJA 2ZRUA 2QEZA 4A2RA 2C3ZA 3P60A 4UXDA 1LRNA 1VGAA 3A5FA 3G1FA 4UTIA 4EOUA 4YXGA 1F74A 4BK9A 1K8YA 3BGGA 3DHFA 1A53A 1T0OA 4BF9A 1VCVA 2XN1A 1P5BA 3BG9A 4CNNA 3L65A 4UNLA 4MIMA 4UFJA 4QSHA 1RVGA 5FF7A 3DFNA 2Y7DA 3TH6A 1QOPA 1YPFA 3GKAA 3THAA 2ZRWA 3R5EA 4O1DA 3IVSA 5KZDA 1K7EA 3KFTA 1CW2A 3DFPA 3W1RA 3PBYA 2E6AA 3NL2A 1PHWA 1T99A 1X8FA 1Z48A 4OV9A 1QPQA 4UC5A 2J24A 1GJPA 3NQMA 3G1VA 1FXQA 2QUTA 3ANYA 3O8AA 4O19A 1WAUA 4E2DA 1I45A 2NUXA 2FFCA 5DLCA 5CPNA 2OCZA 5D2VA 1YTKA 3QW4B 4W9TA 1ZENA 3L0NA 4DBEA 4O1BA 1OX4B 3LXCA 3Q94A 3FJ6A 2YYUA 4MYAA 1AW2A 1ICSA 4NUWA 3MUXA 1P4CA 1TTJA 4AVFA 1PL9A 5HWMA 4WZHA 3W7PA 3LRKA 5DELA 1B9BA 1XI3A 3B4UA 1VH7A 3N9RA 5HR7A 3QQ1A 2Z0IA 3EX4A 1VJIA 4JYFA 2VENA 1WV2A 2DZTA 2P1FA 3QSTA 4GUGA 3LBCA 4GWEA 1K03A 5HJLA 1SPQA 3LV6A 5LNUA 1U83A 3LERA 4S2CA 1R30A 5F2LA 3U6WA 3DBPA 1LZOA 4ICNA 3W1AA 1SQ7A 1VHNA 2YPIA 4XBSA 3W7QA 2A7PA 1OF8A 4NNAA 2BXVA 3TUUA 1I2RA 3FYPA 5F1VA 2EAWA 2Z2UA 2QCFA 3NAVA 2GOUA 5CGQA 1M5WA 1H51A 4JX4A 3A9IA 8TIMA 2DZSA 1XM3A 5D2XA 3STFA 4K7VA 3P7YA 2PE4A 3T44A 5HWNA 3W73A 1RQHA 4YMZA 1TO3A 5AHNA 4O16A 3HGSA 4B5NA 1HUVA 3SJ3A 3KX6A 4Z0SA 3UWVA 4ZZ9A 4JD4A 2ALDA 5FEZA 1TPEA 3C2RA 3N3MA 3CTLA 5IBXA 5EL1A 1GEQA 1TIMA 3NEVA 4JTLA 4LVGA 4ZQPA 1EUAA 2QCDA 3PSWA 2E6YA 5D02A 4R34A 4UTWC 5C5YA 2RH9A 4GRSA 4PODA 3BW2A 2VFHA 2VEPA 4PTNA 5EYWA 3DFTA 3S1WA 3HO8A 2CLEA 4TMBA 1OX4A 4UTTA 2ZTKA 4MY1A 3CM4A 4BFAA 3N19B 4UMBA 2ISVA 1LOSA 3PUEA 2JGYA 1ME8A 3W6YA 5K3VA 4GFSA 4BWLA 4O57A 4O28A 1GTHA 2ZZ7A 2GJNA 1W0MA 2EF9A 3M44A 3W84A 3PBWA 2QKFA 1UJPA 1R47A 4GJ1A 5KITA 1PHQA 1AL7A 5E1QA 3EB2A 4LV9A 1IGSA 5ABTA 3ABQA 3EX6A 3QMRA 1TTIA 3LHUA 3S1XA 2WSRA 3SFKA 3TSBA 3E9AA 5D33A 3PG8A 3L9CA 1TTPA 1KFCA 1H5YA 5C55A 2J27A 2GVLA 5K4ZA 3MI2A 4LV4A 1AMKA 3ZWTA 4RXFA 1KTNA 2ZBTA 4MZYA 1JUBA 1TQJA 4CLMA 5J5RA 4JYDA 1Q6RA 4O50A 2C1HA 4QNEA 4L4LA 5HUPA 1F6KA 2X1SA 4KWWA 2ZDRA 4FXRA 4DPPA 2VELA 3OA3A 4XBKA 4RZ5A 2NXHA 1QPRA 4YLWA 4ZVJA 1TPC1 2FIQA 4YL2A 3O6DA 1QO2A 2NV2A 3E49A 3FS2A 4ZQMA 1FDZA 1ZNNA 2VFGA 4ONVA 3STEA 2Z6IA 3W86A 4O18A 1HO1A 3TXZA 2HSAA 1W8SA 4BR1A 3EWWA 4YCPA 2QR6A 3I7SA 2ZZ3A 1RD5A 1AW1A 4K6AA 3HF3A 2B4GA 5DY2A 4Y6GA 2A5HA 3S42A 3UWZA 3C2OA 3A5VA 1R2RA 4FB7A 2EGZA 1O60A 3F4NA 4GBUA 4BI7A 1SFLA 1A50A 3MMTA 3M5VA 3QPZA 5AC8A 5AYZA 3UXAA 3W7EA 2PC4A 4NJIA 1XUUA 3NQGA 4N4QA 4ZQRA 1Z41A 3O16A 3FA5A 5AFDA 3L67A 1SW3A 3ZWSA 1JCJA 3TQVA 4UTLA 2YDAA 3V75A 1N7KA 1OYBA 4FX6M 2V8ZA 1C8VA 5EA9A 3DENA 1S3HA 7TIMA 4JR5A 2PRMA 4NJGA 2Y89A 2B7OA 1KFBA 1I4NA 5F2IA 4JX5A 1GVRA 3P8JA 4JYEA 4MKNA 1DQWA 1OFOA 4JTSA 2NX1A 2FQIA 1M6JA 2OT1A 4FXSA 1DVJA 2ZZ6A 4XKYB 1EP3A 4IMGA 3O06A 3H54A 1DKWA 2PCQA 2H8ZA 4EWND 3HMJG 2WQPA 4LS2A 3GVGA 3W2NA 2X2GA 1YPIA 2OT0A 4C1LA 5D04C 4RCXA 2J6XA 4O53A 3TXVA 1OHLA 1VYSX 3USBA 5T26A 1Q6QA 3GAKA 4UFHA 5I3GA 1HFBA 3W1XA 1W56A 3O07A 3V1PA 3NQ2A 1EWDA 2C15A 5IM51 1FWSA 5KZEA 3N34A 3IIPA 4QIUA 1KTBA 1I2QA 3S6DA 3THQA 2B0MA 3S9YA 1TB3A 4WX2A 1FCVA 3W1QA 5E0KA 2JKEA 3CU2A 2FLIA 2ATSA 3IGSA 3RLUA 1G4SA 3G1YA 4TO8A 3N14A 3DFQA 5IBXC 4HIBA 1OFPA 2F84A 3UPWA 1VS1A 1X1ZA 1M7PA 2C16A 1ZHAA 2ZRVA 1JCYA 1WDWA 1DBTA 4UTWA 1L6WA 5CZTA 1GVOA 1G7UA 2RDTA 1PCWA 4ZL1A 3KAOA 2TSYA 4FIRA 3TMLA 3NZRA 1LRTA 2X1UA 2Q3OA 3GB6A 2JKPA 3W2UA 5FF0A 3CHVA 1YTDA 4UTMA 1QNVA 3PB2A 4NX5A 1NVMA 2JBMA 4JS3A 1UBSA 4UR7A 3QYQA 2J88A 1OG0A 4LVFA 4O10A 3KRUA 1L6SA 3BLFA 3W2KA 2J9YA 1VQTA 3QH2A 3NM3A 4PL1A 1PS9A 1IXOA 4XKYA 2ZCGA 3TCEA 4EF9A 4AWUA 2A2IA 4FX7A 2VFFA 3BV4A 4I7UA 3W07A 2VFEA 4GE8A 5AHMA 3F1QA 4WQ6A 2XN2A 3IRDA 4O15A 3HB9A 1J2WA 4ZQCA 5AC6A 5I3HA 1FWNA 4OT7A 3C2FA 3NQFA 3UY8A 4POCA 1L6YA 3E12A 3LCFA 3LBMA 1LOLA 3LTPA 4JN6A 3W74A 2E68A 1QMLA 3WFAA 1D3HA 2HTMA 1UASA 3ZR4A 5H91A 2ISSA 1KTCA 3CLMA 1TPH1 3FOKA 4IUOA 2CLMA 1Z44A 4GUFA 3FEMA 5LNSA 3MWAA 4RK8A 4FIQA 3C52A 2AQWA 3GR8A 4JTUA 2IQTA 1XC4A 4LU0A 1OJXA 4LUJA 1TPB1 3IIVA 1H1YA 3IVUA 3TJLA 4AF0A 3QEZA 1W31A 1FWTA 3G1HA 4HNTA 2E6DA
chains in the Genus database with same CATH superfamily
1RP8A 1XBZA 1PTDA 3MDUA 3CZ8A 4LY8A 4RDZA 4H6QA 1UUMA 4M29A 1JXKA 4L6OA 5D8WA 3N4AA 4ERGA 4NASA 4LVBA 4KCUA 1MUCA 1XPGA 4IMDA 1R0MA 1G69A 4NJKA 1Q8JA 4FX8A 4LSBA 3TIMA 4I6KA 4HZ8A 3WF0A 3XIMA 1MEHA 1XBVA 3BQ6A 4QE1A 2BVTA 3L12A 4AISA 3M7SA 2DIKA 3IIZA 3U2EA 1YYAA 3AFBA 2CHNA 4C5YA 1SJBA 8XIMA 2VJXA 5BRBA 1LROA 3TQKA 3LCIA 1C8QA 5A6MA 3LNPA 4XTDA 4G2DA 1VF8A 4WOQA 1MFUA 3BE7A 1FWJC 4V1XA 3PSVA 1XYBA 3B0XA 2QW5A 3K13A 4HHPA 3IVTA 5KEZA 3TYUA 5FD0A 1SW7A 1SZEA 1HKKA 2BLEA 5BMWA 1LL7A 3PBVA 1UIOA 2GWNA 5A8MA 1VFFA 4CU8A 2A3BA 1JYXA 1TRDA 2W4XA 1M1BA 4HZMA 4PA8A 3RMJA 5JVLA 3FVDA 4MM1A 5CZSA 4ZE5A 1PIIA 3LI1A 4WY0F 3CV7A 5BU9A 2W66A 3FHQA 5HA7A 3CL8A 3L5LA 2L5HA 4JTHA 1KM1A 3GR4A 3AOFA 4YU1A 3N73A 1YXCA 4DJDC 1AQ0A 1F2JA 1LORA 1JAKA 4GCXA 2IKIA 2ACSA 1I6NA 4L6DA 1ZJHA 2BASA 3UPBA 1U1JA 2I9UA 4AAJA 4LS0A 2VX5A 1O68A 3UERA 1V6TA 2WNZA 4LAUA 2WWDA 4JCLA 4GH3A 2IKGA 1MNSA 4U4MA 1AQMA 1OD0A 1ADDA 4XISA 4DYEA 1KXHA 5LIYX 1L6FA 4MUZA 1P6CA 3WJSA 2ZRYA 1Y0EA 2FVKA 1YDOA 1TTQA 1E6XM 5HUOA 4DN1A 2J13A 3J7HA 4LAZA 4B3ZA 3OA5A 3T0BA 1OT2A 5E9AA 5EMLA 4L5ZA 3W01A 2Z2BA 1KGXA 1V4YA 1O94A 3AWNA 4YYCA 2PDMA 2VZUA 4HBKA 4KEZA 1DQUA 3KS5A 3WBAA 3URNA 3NPVA 5CPOA 4PUKA 5FAGA 2GK1A 4CQAA 1QCWA 1J0IA 4RXGA 1KC7A 3FGCB 5BCAA 1AH0A 3SY5A 4DJDD 3N2BA 4DEFA 4TU1A 3MSGA 4QG9A 3O0KA 1M7XA 1GQIA 4J3SA 2YSWA 4ZOEA 3DN5A 3IV3A 1NOWA 2PDKA 4UMAA 5CC5A 1CDGA 3D47A 1OM0A 4AHPA 4IX2A 3G6MA 4UQAA 2HV5A 4Z08A 3CAKA 2A7RA 2LLEA 2XM1A 1K77A 1KM2A 4A29A 1FBAA 2E5BA 2J7EA 5ABFB 2OOGA 2EG7A 1EBGA 1CTNA 4HN8A 1BSLA 3C61A 3CIXA 3VINA 3F5KA 4JL1A 3AIEA 2GGJA 1TG7A 1UUOA 1SFJA 3VO0A 2WB5A 4CQ9A 3M5ZA 1V02A 3KOFA 4H3DA 3IGXA 3P74A 2XN0A 4XD4A 1IIGA 3MCNA 1TV8A 1XBXA 3C3UA 5IFTA 2OX1A 2IW0A 3ECQA 1LM1A 2C18A 4Q4PA 4K3ZA 3GBEA 4H01A 2BV9A 4JIHA 3S5OA 3S3GA 1UP2A 4O13A 1H61A 3PPHA 1O7AA 1MMFA 2NVAA 1XH1A 3JZUA 1PB0A 3CGTA 4QAWA 2WJZA 4A4AA 4ZMGA 1OFEA 2XVLA 7REQA 4RZ4A 5JBDA 1P0DA 3F7JA 5KINA 1WXZA 2DDXA 2QJGA 1KGWA 4GNKB 4OHQA 1XDLA 1UKTA 2YFOA 4IPJA 4BY3A 3H4XA 4FR1A 5C9RA 1BYBA 1Q6DA 3ELFA 4S3DA 2IXUA 4OFCA 1GVFA 3NR0A 2BX7A 3TR2A 2WHLA 1K02A 1OFAA 3HIJA 3BOFA 2QCEA 3SQMA 1FRBA 2GSJA 2ZXAA 4XWUA 2R9RA 3M0JA 3JS3A 1WOBA 4IIFA 3PN8A 4LCQA 3ZM8A 4DJFC 2ESCA 3IGUA 2XIIA 4N6FA 1W1TA 3VD5A 1OGGA 2DUXA 3OPSA 1X1OA 2Z2AA 1KXTA 3BSHA 1E6QM 3B9AA 4JBRA 1AODA 3ARWA 3CHCA 3ZR6A 3THDA 1KXQA 4E4PA 1SO3A 1XLCA 3GHSA 3S47A 3BMWA 3W7CA 3PBGA 3O6CA 5HNTA 4W5UA 5DCDA 3EBVA 2B7PA 3GTXA 3ARXA 3UCDA 4RZ6A 2FGLA 2JE8A 3GG0A 4AD1A 6REQB 1V03A 4WKFA 4DZ5A 2R8WA 4ZENA 3NPWA 2FPTA 5HJXA 1UB3A 4NZ3A 2V81A 4Q7IA 4E3TA 4KETA 5GVJA 2A3AA 3PF3A 2CLIA 4GYKA 2WHMA 4JTGA 3VMNA 1VLWA 4HMEA 3KEHA 4F9JA 3DC8A 1O6IA 1T40A 2AL2B 1EB3A 2RDWA 5GNYA 3O15A 1M53A 8RUCA 4A8RA 3AYRA 4G56A 3DHUA 4RE0A 5CPLA 3PY2A 3H21A 3UA3A 4OGZA 2PODA 1SUXA 2D3LA 1FHVA 1CB7B 1W3TA 1Q2SA 5FF3A 3P61A 1EYWA 3LEPA 2CYGA 3WJXA 2QVNA 4QISA 4O12A 2BDQA 4YTSA 3FJ4A 1GKRA 3POHA 4H7ZA 4TOQA 1VC4A 3CNYA 1XDMA 1XRTA 2VKZG 5HQEA 4IZGA 1QBAA 3KBNA 4XZBA 2ZYFA 3CQIA 2OJPA 4W87A 3VKAA 3VPLA 1YXDA 1VEOA 1QI4A 1F9CA 4BCEA 4LNYA 2ACUA 2VM8A 1FH8A 4PZVA 4Q33A 3SGUA 4NT0A 1FCBA 4O8AA 3ABRA 1P6BA 2EPMX 2VX7A 4G9PA 2OLHA 1E0UA 3WLNA 2YXGA 1E6RA 1ODZA 3UJFA 1BXBA 3MUY1 1PWMA 3GM8A 3MP5A 2EBNA 3LRMA 2VRJA 1A5UA 1NDWA 1EWEA 3PVFA 1NDYA 4PMZA 1RH9A 2PTXA 3PJUA 2VUYA 3M0VA 1J0JA 2ATMA 5A6SA 4HU0A 2JEPA 1IXPA 3BCJA 5HBFA 4PL2A 4WY0A 1D3CA 3DU0A 4K39A 2YBVA 4IIDA 3LGEA 3QRHA 3DYPA 2WSPA 4NAEA 3OVPA 2D3NA 2WC7A 3SGZA 1V0KA 5CPMA 3GHUA 4ATLA 3TTQA 4FAMA 1TPDA 4RE3A 2RDXA 4M6PA 1Z7AA 5LNRA 4DO4A 3UYCA 4R85A 1UCWA 3BTNA 1DWAM 4LUTB 1ZY9A 1R85A 2Z27A 5TBOA 1CGWA 1TJ1A 1HKIA 1KFLA 2WMKA 1R3RA 2A0NA 4OTKA 1JJKA 2ZDSA 2J75A 2DJXA 2NX3A 3QHNA 1GONA 2G5WA 2CESA 4G7EB 5D4YA 1JDEA 2ISWA 4JGDA 1CB2A 3A4XA 1KKOA 1V08A 4I9JA 4GIRA 1B3ZA 5M2FX 1H3GA 3B9DA 1HJSA 1T8QA 1QPOA 4Q8WA 1IYXA 1RP9A 2NT1A 4IJBA 3WQFA 4HOWA 1CIUA 1XH0A 2XVKA 4GNJA 1OYCA 3HQ1A 2Q01A 1VIZA 3I65A 4L4MA 4ATWA 1VFHA 4MVAA 1XIGA 2O92A 2QPSA 1RD6A 2QS8A 5HMSA 2XFWA 2GGEA 1ONEA 1HP5A 3S1GA 4Q3MA 5A6BD 3E74A 4JICA 2I57A 1Y8BA 3W22A 3MHFA 1A5AA 4DM2A 1R3VA 4Y7EA 4WHBA 5FF4A 4QITA 4LANA 4DPQA 1ZJIA 4F0KA 1AH3A 4Z0JA 5KTLA 3N2CA 2FVMA 1KFKA 4XAGA 2X1RA 4IGNA 1QK2A 3EXRA 5K9DA 3CUIA 5BYWA 3G1XA 3IJ9A 1JPIA 1WKDA 2FPVA 4GQBA 4PCPA 3TTSA 1W9UA 2J6VA 3CAWA 2QCLA 4C7FA 1FKXA 4UB9A 5TNVA 4B3KA 3CT7A 3GDRA 5B80A 3W7MA 2XZ9A 4CNSA 2YL5A 1FUYA 1OWQA 4DELA 1J11A 2B81A 3I10A 3GVRA 1QWKA 5I2UA 2JIEA 1Z32X 3ZSTA 1KRAC 3ES8A 1VAHA 2JF6A 3BL3A 1I0BA 3B4YA 4TVCA 3NQ6A 4NZ1A 2YCEA 1B1YA 3W85A 3SJNA 1PX3A 3NYDA 4GD0A 1XUZA 2YL8A 5M17A 3M0XA 1RSCA 3MSYA 2DIJA 3W7IA 2PGEA 1LWHA 5KZMA 2P76A 3NZPA 3S2NA 3SIZA 3H7RA 3TN6A 1W1ZA 3CO4A 3K8LA 3UR7A 5AB3A 1FX6A 4IIBA 2NV9A 3REQA 3EWUA 4KRUA 1FH7A 2ZUVA 2AGTA 3PULA 4MWAA 3UZ5A 2DVUA 1Q3NA 1C3FA 3WQDA 1BSIA 2GFTA 5BXTA 4S38A 4GLEA 2X1TA 4CCDA 3VKJA 5IOBA 3BPWA 1JYWA 4GABA 4H6EA 4B4FA 3ATYA 3QMSA 4IG2B 4IF2A 4XO7A 4NG3A 3TVAA 1FCUA 3EDFA 4L9ZA 1UW9A 3TW6A 4Q6JA 3G0SA 1LQAA 2VR5A 1QR7A 4A22A 3IIOA 1TPWA 4LRSA 4ML9A 3VKCA 3OG3A 3WL1A 3EXSA 4L65A 5BXPA 1MDRA 3ZZ1A 3WH9A 2V0TA 4Q8VA 4NX0A 3GU9A 3AJXA 2BWGA 1I2OA 5DN1A 3MI6A 2E0PA 4F79A 2VGBA 2BFGA 5LXXA 4L1GA 3KLKA 3QR3A 3NDOA 1HTIA 3WDHA 3OVQA 4ZA0A 3AAMA 3TC6A 3SEPA 2OB3A 3Q2DA 3TFCA 2D2OA 2CXGA 2GGIA 3IGHX 1R46A 3APGA 2HPIA 2RFGA 2XJ7A 3EOEA 3DFSA 3L0GA 3RU6A 2IS7A 3DHDA 5FJOA 1QNQA 2G3IA 1EC7A 3NQDA 2F9RA 1YXYA 2YCLB 2VCCA 3GXNA 3OQEA 2QGHA 5H2ZA 4ZFMA 2EKCA 3VD4A 1JULA 2J7CA 4FNUA 1ICQA 1TPVA 5J5DA 3QV8A 4JTRA 1ZLPA 3QN3A 1PV8A 1GQKA 4AEEA 1XLJA 2V5BA 3VM5A 2FKPA 1PX8A 3EPNA 3QPEA 3LM3A 3BXWA 1JRCA 3QV6A 2E5DA 2PZ0A 4L64A 4S1FA 1KD0A 5CAHA 2WMGA 5DY3A 3E1F1 1OCJA 1DJQA 3PK7A 1FFRA 3LLDA 1BKSA 4H9MA 5I03A 1Y65A 4LYPA 1KCKA 1SU5A 1QK0A 3QXBA 5DT5A 1JUEA 2R1LA 3AXMA 3WD0A 4M7SA 3IARA 2BGQA 3SIMA 4UFLA 4W84A 1VYPX 4HVXA 4RE4A 3PM6A 3HJEA 4GQRA 1IEVA 2WK2A 4D6IA 3CPGA 4GBDA 3VDHA 4I5XA 2QDDA 3GNPA 3UD6A 2AKMA 4TV5A 3W02A 5BU6A 1PYMA 3LLXA 1OFDA 3JUGA 1LLZA 2OVLA 4BHYA 4H7CA 4YHEA 3D0CA 2WKLA 5H6HA 1QW9A 1V51A 1I0DA 4J3TA 3IAQA 4C6IA 3MB9A 4RKAA 4AWSA 3NA8A 2JIWA 6PTDA 1ISZA 3OLIA 1F3XA 2VNCA 5F4WA 1KM4A 1ZBWA 4R5EA 3WFLA 3LK6A 3WLTA 4PMOA 3NO1A 3VVGA 1JQXA 2V38A 2PDCA 4OIFA 2YA2A 3KXQA 1J5TA 3HU7A 2PDPA 4DWSA 2DSKA 3BG5A 2G3NA 3N6JA 4XBJA 3URQA 5C70A 3MQTA 3EGJA 1J2BA 3LB0A 3TEVA 2I14A 3SRFA 1K9DA 3FYYA 4BQ4A 4F2TA 2VR4A 2BP1A 2IQ0A 4IXHA 4ZO6A 3VE9A 1ML1A 1UA3A 2OZ3A 1F5ZA 5A6LA 4K1GA 4US6A 3TX9A 1OB0A 1EX5A 4KKXA 1GWJA 1ONWA 1H7RA 3PTKA 4Z2JA 4P7OA 4RUBA 1ZP3A 5G1MA 4AXNA 1WXJA 3UZJA 1U22A 1PEZA 3WEOA 1XD0A 4FR6A 2BY3A 3IJDA 2PDFA 4ZB5A 1JGMA 4RW3A 2P0IA 2ZA2A 2Z1WA 1E1FA 1DIDA 2Z29A 4FO4A 2BGSA 3VIGA 1AJ0A 5BRPA 1H60A 2WJFA 2Z1XA 4PCFA 1M7JA 2YFNA 1M7OA 2PDNA 1UQZA 4B91A 2XG9A 4GPNA 1VFUA 3CWNA 2WMIB 4FHAA 3N2XA 2F6XA 4JL2A 1FWEC 3LRLA 3VGFA 3GNNA 2NT0A 2DZPA 3GXDA 1P0KA 2V2HA 3P62A 3W7LA 2VHLA 3H2CA 5FEPA 3N29A 3FDKA 3BSMA 4H6KA 4JHMA 2AMGA 4S3JA 1NIUA 2CCRA 1Q66A 4FEZA 1DXIA 3BV7A 1H5VA 3ATZA 3R1ZA 3WD4A 2O4QA 4RW5A 3B8WA 2IPJA 4IX0A 7PTDA 1EOKA 3EZ4A 3LG3A 3DAQA 3L21A 4V33A 1UR1A 1EJTC 1W1A1 2Y7GA 4I3GA 3WNLA 1HL2A 1PTGA 4I7WA 3WEZA 1JDFA 1JDCA 1JF6A 4A2RA 1J0YA 2C3ZA 3P60A 5C2GA 1VGAA 3ITXA 3EPMA 3QZ6A 1XGEA 3AZSA 2Y8UA 3L7RA 1IT0A 3B8TA 4UQCA 4YXGA 1KWKA 2ZKMX 4BK9A 3RR4A 1IEQA 3BGGA 3W26A 1T0OA 1DJGA 1A5MC 2X1IA 2XN1A 3SADA 5A6BA 4CNNA 4UNLA 2YA0A 2XSBA 3F2BA 1RVGA 1YE4A 4MTVA 1V02E 2PDYA 1YPFA 4IICA 1BVNP 4EAYA 4C65A 3R5EA 2QJNA 5KZDA 1WNOA 3W1RA 4HYWA 3PBYA 3QTGA 1S39A 3ITYA 3EMCA 1RBOB 1Z48A 4OV9A 1X97A 2XWEA 1WZMA 1FXQA 3FVMA 3ANYA 4H8UA 3WLSA 4ZXOA 3R79A 2XVPA 3HZ3A 1XPYA 3NIYA 5CPNA 2OCZA 1TZZA 1YTKA 5KETA 1OY0A 1ZENA 4IMAA 4DBEA 1I1XA 1OX4B 3LXCA 4AUBA 1RJQA 1BYDA 3S6TA 2G4FA 3K1DA 3OIHA 2HBVA 2OEMA 1A5NC 5I23A 2E40A 1TTJA 5BWFA 2ZX8A 4WZHA 3W7PA 1XYZA 4QG6A 3SQSA 5DELA 4IQJA 4GIEA 1XI3A 3B4UA 2WM1A 2Z0IA 3ONCA 1IWAA 1VJIA 4JIIX 4CNTA 1W17A 1BVZA 1WV2A 3TTEA 4UQBA 4GUGA 1K03A 4EWJA 4NIRA 1LZOA 1FOBA 1XLEA 1EDQA 1VHNA 2YPIA 5FA5A 4JCMA 2BXVA 2I56A 3ZLHA 3I6EA 5FKYA 4TUFA 4S3BA 3UESA 5CGQA 1M5WA 3A9IA 8TIMA 1LLOA 2DZSA 1XM3A 3STFA 3FY1A 1K4GA 5HWNA 2V68A 2ZUTA 1B2YA 4H04A 4Q8TA 4YMZA 4PSPA 4B5NA 3PWIA 1W1PA 3BANA 4ZZ9A 2YOCA 4ERAA 5EBAA 2ALDA 2BY1A 2VT0A 5IBXA 1M9HA 1W3LA 1LG1A 4LVGA 3OG2A 1M03A 5A8NA 4UWMA 1TCMA 5D02A 4EAMA 4AYSA 5HQLA 4GRSA 4PODA 3WELA 2HVOA 3BW2A 3DFTA 4QS5A 1X1NA 1HKMA 1MWOA 4PFHA 1BG9A 2CXEA 4BFAA 4CNUA 2HISA 4X9YA 3PUEA 3T05A 3CPUA 4HHLA 6XIMA 2HVMA 4K68A 2GJXA 4GFSA 3T8LA 4D6JA 1EA9C 3UNTA 3FCPA 1GTHA 4TVDA 1JEZA 1GORA 3IS4A 1XLLA 3XISA 1U30A 1BGGA 1Q6EA 2VD8A 5GNXA 2QKFA 4GJ1A 1V6WA 1REQB 4HD5A 3W25A 1AL7A 4QTGA 3E2RA 1JXJA 4LV9A 1IGSA 1DPMA 3CT2A 2YLAA 2Y24A 2AOSA 1H41A 4DI9A 4KF1A 2WSRA 2EJ1A 2YXOA 3P3BA 5IDIA 3DG3A 3WQ4A 3MMUA 2XM2A 3TLLA 2CNCA 4YPJA 5K4ZA 4HGXA 4MAZA 4NKCA 4LV4A 4DJED 3ZWTA 3SRKA 2VZSA 4XZNX 3W0KA 4AZHA 3NVDA 4HU8A 4CLMA 4CQCA 4JYDA 1VFTA 2F6UA 3CYVA 4KWWA 4GMEA 4CN1A 3BCFA 4GZJA 3OA3A 1TFVA 4HPNA 3E0LA 2NXHA 4IGSA 1TPC1 4YL2A 4FA3A 3O6DA 2NV2A 3FS2A 3WSUA 1FDZA 3MCOA 1TKKA 3S2LA 1ZNNA 3U4AA 3STEA 2Z6IA 3W86A 3VGGA 4LFYA 2QR6A 4NAFB 1AQHA 4GZ7A 5DY2A 5A1AA 3UWZA 3C2OA 1NQ6A 1R2RA 4J1OA 3SCUA 2XFFA 1V8EA 4GH1A 3P0WA 1J6PA 4NJIA 4B5WA 1XUUA 3M0LA 3O16A 1XIJA 3TR9A 5AFDA 4DM1A 3ZWSA 4M3PA 2GGGA 3IJ7A 3UGRA 4AIEA 4OUIA 2YDAA 1JZ2A 1N7KA 3CZEA 4MNLA 3W37A 5MF5A 1QT1A 1XSJA 1QBBA 4RPPA 7CGTA 1KFWA 4E2VA 4DWSD 4NJGA 1E0XA 1KFBA 5F2IA 4JX5A 1DWFM 2DEPA 3W6MA 1EC9A 1OFOA 3HM7A 2E25A 3MMDA 2H8ZA 3NEHA 1ZPTA 3NGFA 1TUFA 2WC4A 4LS2A 3GVGA 4C6FA 2X2GA 1DJXA 4PMQA 1JNDA 4YVPA 3P6LA 1EXPA 4UFHA 3MT1A 2OQYA 3W1XA 1S2VA 3GFYA 3O07A 3OW1A 4MB3A 1RPKA 1UUQA 1KTBA 1I2QA 3TYDA 1R86A 5T9CE 3THQA 2W91A 4F0HA 4R7WA 1FCVA 2VL4A 2HEJA 2QDEA 2GJPA 2VQTA 3IGSA 3WNPA 4QHRA 1DYSA 2AAAA 2PLMA 4TO8A 4LEQA 3I3EA 2QJJA 3UCCA 2C7FA 4HIBA 4F48A 1OFPA 1N8WA 4RNJA 2C16A 1ZZMA 1C7TA 2WZMA 1WDWA 3ZJ6A 1L6WA 4A35A 1OEPA 2YBUA 1NM9A 4Q7BA 4DJEA 2G4JA 4KESA 1I60A 3CBWA 2O56A 3NZRA 2Q3OA 3GB6A 2JKPA 3BAYA 4XIMA 3VD9A 1YTDA 1WCGA 4XSLA 1QNPA 1NVMA 1UBSA 4UR7A 1SJCA 3KW3A 5MKGA 4WKAA 4CD6A 3BLFA 2J9YA 1VQTA 3QH2A 3NM3A 2OSWA 4EF9A 2VFFA 2Z1VA 4I7UA 2VFEA 1JD9A 3F1QA 4WQ6A 3K4DA 4B92A 1J2WA 3BOLA 3FAWA 2F8QA 1L6YA 4AC1X 3QR0A 1JAEA 1WUFA 5LYRA 1Y5WA 4BS0A 4Z2KA 3W28A 2WMFA 4JN6A 1K9EA 5LIUX 2ZVIA 5DMMA 3WUEA 4KH2A 3WFAA 2HTMA 2WM0A 2A79A 2ISSA 5FAJA 1KTCA 5H8PA 5CBJA 4KCVA 3OYXA 4HSHA 2CLMA 2FHBA 4GUFA 3MWAA 4FIQA 2ZUNA 4V28A 4JTUA 2IQTA 5C8BB 4LU0A 4CVUA 2BODX 3IIVA 1PKMA 3PFMA 3TJLA 1L8PA 4AF0A 2DY3A 3C6CA 2FVLA 1AZ2A 2A4AA 3W9ZA 4AD5A 2AQVA 3KCLA 1US2A 1XFBA 4EXAA 1ZSXA 4RJEA 4A2SA 3QVQA 4JHOA 5IHSA 1UC5A 2ZX6A 4CKQA 3INPA 4GJIA 2YZ5A 3MV11 1ZALA 3GXPA 3PUOA 4NJJA 4MB4A 4E0CA 1QFEA 1Q13A 5B7ZA 4W8LA 4JTKA 4O4VA 8A3HA 1LP6A 1WBHA 3ARVA 4B90A 1PIGA 3L68A 2J8FA 2VVNA 3HV8A 2QVHA 3R89A 1UKOA 2ZZ1A 3WYZA 4AMCA 1J01A 1XLAA 3GDMA 3AZRA 1ZU8A 4ZB2A 4C7DA 4FXFA 1POJA 1PCKA 2QDHA 1MUWA 4X22A 1E6NA 1B31A 3SY8A 4UOZA 4ATDA 4LB4A 3S5SA 3V3WA 2W79A 2HROA 3UXIA 2YL9A 3TROA 2GK1B 2XVNA 2VUNA 3GAYA 5F1UA 1CX9A 2XH4A 5E09A 2ZTJA 2GVGA 3FIGA 3H55A 5GPRA 2NWSA 2W62A 4W86A 4YTRA 5H8MA 4WRHA 3QJAA 3HN3A 4PULA 3FEQA 2PGRA 3SI9A 4I8DA 2DPEA 1MEWA 3R10A 3W87A 3PPFA 1NSJA 4GI8A 4TX8A 4LEFA 5TIMA 4K8HA 3WH8A 2GDUA 4LGXA 5I79A 2REQA 3GX9A 5CBIA 4A3HA 5C9XA 5ABFA 4HTYA 5CEWA 1ELSA 1H62A 3ITTA 3K2GA 3SN1A 2R1MA 1JRBA 4JQ1A 4DHGA 2HMCA 4AZ5A 2YL6A 1QWGA 4NILA 3TU9A 3M46A 4UMCA 3D5HA 4IPNB 3GUGA 2ZQ0A 1TWDA 3IK4A 1ONXA 3MP3A 3QC3A 2NZLA 5CG7A 4UNKA 1AZ1A 3FXYA 1LF1A 2BB0A 3G1SA 4UTFA 1XHGA 2P3EA 4PE8A 4EXQA 1ESWA 3OJGA 3GC4A 3KVLA 3S4TA 2C0AA 3Q45A 4Y90A 4KWUA 1TYGA 4D2JA 5A2CA 2PI6A 4Q6XA 4IM4A 1BEUA 4E2BA 3S2JA 1NH6A 3OP2A 1EJWC 3EKGA 3P5ZA 5DQPA 3BW4A 4U10A 3TONA 5A8QA 7REQB 3VIMA 3B8IA 3T2OA 1TV5A 1LL6A 5HNRA 4A3RA 4Q4OA 1RZMA 1KBIA 3C3NA 3VNJA 1VFOA 3ITVA 2I5QA 1PE1A 1OINA 3R2GA 3IJQA 3W1UA 2J66A 3I4EA 2GZXA 3S8HA 1C29A 3T4WA 3ZT6A 5JH1A 1W9VA 1KBJA 5E9XA 3OOQA 3FXGA 3B0PA 2NXIA 3LUTA 1IF2A 4D71A 1UKQA 4DBSA 5C9WA 1R3WA 3BH4A 3W82A 1EOMA 1PPIA 1LBMA 3HJZA 1Y5XA 1E51A 1EA0A 3GHTA 2WJDA 2GPTA 4WSKA 4JTQA 3UPMA 4PMRA 2QGYA 1ZUAX 3A3WA 3OHIA 1WB0A 1OGBA 4PTDA 3TJIA 1TVPA 3JVAA 3M1ZA 3NO5A 3N15A 4S3FA 2HCVA 2Y61A 4IISA 4M1BA 1FHUA 4LRTA 1NWRA 4OBTA 3WH7A 3OEXA 3IV8A 4ASTA 2NX9A 1LBFA 3NNTA 4JNMA 4PSRA 3KLLA 3RLVA 1C92A 1ME7A 5CJMA 2D0GA 2ZA3A 4NNBA 3DBNA 3AU2A 5G5IA 5CSYA 4C90A 4AZCB 3LQGA 2Q02A 5AOUA 3ITLA 1Q6LA 2YCIX 3O63A 2PRHA 1HN1A 3AXKA 2FJUB 4JIEA 1RUSA 3DFYA 3GXTA 3F03K 2OO0A 2R91A 3WK0A 1W3KA 1FWWA 1K1DA 3GVQA 1NFBA 3CQHA 1AH4A 1LWJA 2H6RA 4ADSA 1WQ5A 5AHIA 3NJ3A 3SFWA 2E8ZA 5A6JA 1EZ2A 4HSNA 5I07A 2IMRA 3UWEA 3GO2A 1QNSA 4NNCA 4Z1AA 2AAMA 4PCSA 4R9XA 3UJEA 1RR2A 2A3CA 2V5LA 3TK7A 4D1IA 3B8VA 3O05A 3QOKA 4H83A 1JCLA 2WHKA 4N4PA 2CBIA 3APTA 5I6SA 3MTWA 2HZGA 3LOTA 3WUGA 2PRLA 3C56A 4LF2A 1Z6KA 2V9DA 3BICA 2Y4SA 2VMFA 4UCGA 3W27A 2NLYA 2CBVA 2VTFA 2XWDA 3P2VA 4BA0A 1MW0A 4QDMA 4DF0A 1KV8A 3PZUA 3WBXA 3A24A 3FJLA 4RLIA 4GXPA 2YKKA 4OVXA 5LKYA 1H1ZA 5E6YA 4H2HA 4M1RA 4ALDA 2ZZ4A 3CHDA 4ADUA 2C1GA 1D7KA 1OX6A 2XGZA 1XL9A 4HKPA 2VFIA 4HNVA 3AWOA 1LL4A 3SAZA 4M80A 4ZOAA 1P0BA 3V0SA 5CZJA 3KVMA 2FGBA 4IIGA 5AKQA 5DFAA 3TYZA 3NM1A 3H2AA 5T91A 3C4UA 2E9BA 3IJ8A 4DAIA 3GUWA 1F3EA 1VFSA 4JIRA 1JZ8A 3TYAA 2NVDA 3WDPP 2YX0A 2QCNA 3UT0A 1SJAA 1GYMA 2W3ZA 1X38A 4I90A 1KRBC 3LGGA 4GFIA 1HF6A 1RJRA 4ZXLA 2OO6A 1OK6A 4QAIA 3M64A 4WY0B 3BJSA 3EXTA 3GIPA 2G96A 1NDVA 4GI9A 1CEOA 4CNPA 4NAEB 4UBPC 1TVNA 1EF2A 3OODA 3UWWA 1V5XA 3G8EA 3QW3A 2CWNA 1ZB5A 4Q4MA 4TTGA 1UJQA 4F4RA 4QEHA 1E0VA 3LSCA 2UY4A 5DXYA 1ITUA 4C6BA 2BMBA 4GUJA 2WSKA 2DGAA 4QQUA 1BGAA 4J7RA 3YPIA 1SO6A 3CQ0A 1ZBCA 2CEQA 3E96A 1R38A 2YZRA 2YGYA 4AZIA 1DV7A 1VB9A 4J2PA 2CLFA 3WQGA 1RPXA 2EKGA 1UR4A 2Y5EA 4HCHA 2A3LA 2A1YA 3KP0A 1FWHC 2J62A 3K8MA 4LAMA 4CEXC 2NQZA 1PDZA 1IGWA 1SO4A 3PR2A 1V77A 1EO5A 1YTEA 3E0VA 3NOEA 6CGTA 4S3KA 2H9AB 4C6JA 3HMCA 4HYVA 4U5IA 1CGXA 3P84A 2J9ZA 5AVHA 1AQFA 4E8DA 4LYRA 2ZXQA 2QUVA 4A6GA 3SY1A 1QPKA 3CUXA 3S46A 3VIHA 1TQXA 1KXVA 5CKSA 1GG1A 4EK7A 3ID7A 3R13A 3PZ9A 2DT0A 4KQNA 1XJBA 1XS2A 3BDKA 1K7FA 4Z17A 1FQ0A 4Q8QA 1GPFA 3A4AA 3M41A 4C6KA 2WCGA 4AIBA 1VP5A 3SCRA 3B05A 2QCMA 3MANA 3T0AA 2XIQA 2GQ8A 4QS6A 1W3IA 3UU0A 1JI2A 3E0WA 1NEYA 1ME9A 4FNQA 3WD1A 1OC5A 3BLIA 1MNZA 3EA1A 3DEQA 4I6VA 3DCPA 1L2QA 4O17A 3TKFA 3L0KA 1JUKA 2C13A 5HWJA 4XQ6A 4AW7A 4MOZA 3SW6A 2FFIA 2O9OA 2DT1A 1HT6A 2WNWA 2PCEA 4AD2A 2PF8A 4GK8A 3DZ1A 4LUIA 4O11A 4A8IA 5EBUA 1B3OA 1FH9A 3U2CA 4ZODA 3CYJA 2KZHA 2WCSA 5C54A 1OYAA 2NQHA 1TWWA 1A5BA 1Q65A 4CQDA 3DESA 4GGBA 3PFRA 1FWBC 3TMQA 1LDCA 2WCAA 3AYVA 4LQ1A 4S3GA 5LGXA 4XG1A 3KVKA 4Q32A 5DMLA 3CL7A 4WJ8A 1OFQA 3Q37A 1IV8A 4JIPA 1OCNA 4EX4A 1RQEA 6ENLA 4I9MA 3TA6A 4MHBA 4Z1CA 2HDJA 4YJ5A 4AHOA 3AIVA 4D6HA 4RL3A 3WK2A 2DP3A 1KQZA 1GOXA 3NURA 4A8LA 1AUSL 3ITCA 1V7AA 1T41A 3CUFA 2Z25A 4V15A 2O4MA 1GGOA 3RRXA 3EWCA 4R33A 3F2CA 1BG4A 1JCMP 4D6EA 1XYCA 4F0MA 4J35A 3S5NA 4MY8A 4DLFA 3HGRA 1V3HA 3E6EA 1S5MA 3U3HA 1IXNA 1MRQA 3LTYA 4GJJA 3UWYA 1TA3A 2C8NA 1WDRA 4DUWA 3I7RA 1V93A 4TIMA 4GUIA 1JCXA 3MJMA 3TA9A 2ICSA 2JGQA 1JDDA 1JCTA 4DO5A 1DE5A 1KLZA 2EG8A 2E28A 3L4UA 1DJNA 3EA2A 2J4GA 2QQ6A 4DXVA 4AZ6A 1JFHA 3N12A 4DVOA 4IFKA 1DJHA 4K38A 1JQVA 1HZYA 3VIKA 4E38A 3KHJA 3LS9A 1CXEA 2I17A 3IEBA 7ENLA 3AUJA 2QF7A 3QY8A 4LB3A 2IUZA 1NY1A 3RRAA 3VNYA 2YCKX 2WLZA 4N9CA 5IXEA 3MO7A 3ABSA 2QNEA 5D8ZA 3UNDA 5I78A 2GDQA 4B5VA 1KM0A 4CCZA 3PZOA 3MS8A 3GZ3A 4NYYA 3AHXA 1ALDA 2OSXA 1XKYA 3P0XA 1XXXA 1KBBA 2J7BA 3UG3A 4M6VA 3W7JA 2OGYA 1H63A 4UFIA 1W5QA 4I7VA 1VR6A 1D7FA 3I6RA 1TRIA 4I9AA 3QV9A 1BKHA 3G8RA 3BARA 4CD7A 5A2AA 4Z1DA 3OBKA 3THCA 9XIAA 1V6VA 4KFNA 1O4UA 2WVVB 4FLSA 4ZO7A 1LYXA 3L4VA 3GXFA 3ZMRA 5XIMA 1XBYA 3GLCA 3GDKA 4FOJA 3BG3A 3PJXA 1MVYA 1IZCA 2XUCA 1OGSA 5G4WA 4E4UA 5CSRA 4DYKA 3CUJA 3L23A 1TR1A 4XZ9A 1KWGA 2I16A 1FDJA 3SO7A 2BVWA 1XRFA 1UZDA 3WMCA 3NG3A 3ERPA 1XC6A 2E3ZA 2YW3A 3L2IA 4GI4A 1JPDX 2TODA 3G3MA 2FB3A 1EGMA 3O9NA 1UOKA 2FTWA 3PBMA 4GO8A 4MFEA 3A64A 2NUWA 4J3XA 2Z26A 1JI1A 4HU3A 1DHKA 1K3UA 4LALA 1BF2A 4CD5A 4Z2GA 1UPPA 5K4XA 3VGHA 3BZGA 3RG6A 3VD3A 3LPPA 2OQHA 4DB7A 2VURA 4QCEA 5HJYA 2EJAA 1KM3A 1R9ZA 3F4DA 1G4TA 1VENA 4YNGA 1W1IE 4N02A 2W9MA 1LUCA 2ZICA 2X09A 2E8YA 3NO3A 4M56A 1HW6A 3NL3A 2NSXA 5LA0A 4TX9A 1G94A 4JQAA 3E0IA 4JQ3A 3M7WA 1Q45A 1UZ4A 1PO9A 1ENUA 4NXKA 5CZ0A 2GUUA 1X39A 3AYTA 5LGZA 4YN5A 2SFPA 1QO5A 1DXEA 3GBDA 4MLJA 3CWOX 3AIRA 3NZ1A 1OABA 2DW7A 3TLQA 3C2YA 3U9IA 1GG0A 1YBQA 2OMAA 1RJPA 1VCFA 3LI0A 3WY1A 4PEEA 1OFRA 2W0UA 3MKKA 4AWTA 1RY8A 2DFAA 1EIXA 3SCSA 3OTRA 4N7QA 4QM1A 4IGMA 3H24A 3W3OA 4PUNA 1R87A 4UTTC 1OX5A 3KOYA 3NCOA 4IXXA 1AG1O 3W7DA 3WK1A 4F8XA 1WO2A 4AWEA 2P3ZA 2Y6ZA 3BLPX 2VX4A 4GVFA 3EEZA 3ZVIA 2A85A 3ABZA 4F40A 4G7FA 4PRTA 4F2UA 2PLCA 2BVYA 4UUIA 3GS6A 3I7QA 1AL8A 3WLRA 4FNTA 3TWAA 4D8ZA 1O5KA 1UP3A 4XZIA 1KFJA 1UZ1A 1UC4A 3TYCA 3GH7A 1LOQA 5C2CA 3SR7A 4WCJA 3CEPA 2F7FA 1OF6A 2R94A 3TNOA 1EXBA 1XH2A 4LJ3A 3W7KA 4DWDA 5A94A 3GYEA 4ICMA 3V4BA 2WMIA 3F4CA 4Q8UA 1XIMA 1FXPA 2QXWA 1YPXA 8XIAA 4HA3A 3WQWA 2EPNA 4MY9A 1FWAC 4CVWA 2GVYA 4QNWA 1HJQA 2Z7GA 4AMAA 3BLKA 1W5PA 2V2CA 3RU8X 1CENA 1YKWA 5HNUA 1QOXA 3SUVA 5HMFA 3TE9A 3OLGA 1THFD 3UA4A 3UG5A 5K9XA 4WR3A 3EX3A 4YS1A 2OPJA 3F4WA 4UTKA 4CQBA 1MDLA 4PR4A 2PTYA 3ZJ8A 4K8EA 1W1B1 2C14A 5D30A 3U2OA 3FFSA 7TAAA 3AS2A 1GOWA 3ZT5A 1ITCA 1XIFA 2Z6JA 1F7BA 2VEGA 2JFEX 4UQDA 3HPZA 4CD4A 5DANA 2OODA 4YVVA 3VDGA 5BW6A 3KRZA 3GU2A 3H2OA 2OFJA 3LCHA 3SN0A 3OZOA 4IWWA 4UZSA 3EWDA 3UY7A 4Y8FA 1E9YB 1GVQA 3LCLA 5HINA 3S83A 1Q7MA 1OBAA 4S3CA 1MZRA 4U33A 4U2ZA 3W23A 5CJ5A 2BHYA 5E93A 3QSRA 5LA2A 1A5KC 2WVUA 2CBUA 2QCCA 4M81A 2DVTA 1XFCA 1PVNA 3B06A 3UR2A 3OBAA 3U5YA 4XO6A 1E1CB 4GX8A 3EOUA 2BOGX 4XUGA 4ZQNA 3DUGA 4BWLC 3ARSA 1SFSA 2VXNA 2JALA 5GJPA 3M47A 3QV7A 2QIWA 2ZXBA 2DH2A 2GJRA 5I02A 2WKGA 1PBGA 2ZUWA 2WPGA 2Y5JA 1W5OA 1EUNA 1Q6OA 2A3EA 1XF0A 3F4VA 4P7LA 3CLWA 4FNRA 3W7GA 3WK3A 2WJEA 5I7GA 1D3GA 1I9CB 4K7YA 4W7UA 1EPXA 2OELA 4XK2A 3TW9A 3V0TA 5EU9A 4BQ5A 2Z1BA 4W4QA 4KFPA 3U8GA 1MZHA 2BOEX 3LX9A 1WZAA 2XYLA 2DZWA 4RV8A 3BGAA 4NQ1A 3V5CA 5EFFA 4L6HA 4PB5A 2CHOA 3VOFA 3HOJA 3O0FA 5E0FA 2QEZA 3KWSA 3B9EA 3TYEA 1HKJA 3G1FA 1J0ZA 3EDJA 3OZMA 5EMYA 2CITA 3G77A 1TUXA 4D6FA 2R1KA 3L65A 4MIMA 4UFJA 4NRRA 3OGSA 2ACQA 2Y7DA 3THAA 1DJIA 4GY0A 2QULA 3OHMB 1PDYA 1S2UA 2XIBA 4F0RA 3SCPA 1PHWA 1S3TC 2J74A 1Q6FA 4WVXA 2E9MA 3B0YA 2YB4A 4J40A 3IUHA 1GOIA 4ZO9A 3O8AA 1WAUA 3U7BA 2YDQA 3PJWA 3F5JA 2FFCA 3NQBA 4F66A 3VZZA 5D2VA 1FWCC 3QW4B 3POCA 4RV3A 4GISA 3RHGA 3QR1A 3VXGA 4O1BA 2FH8A 4P7QA 1UR9A 4NHVA 1GOOA 2POTA 4W5ZA 2GLKA 2Y5SA 4ERIA 2GWGA 6REQA 1MQRA 1QNOA 3NZQA 1O5QA 3EX4A 4JYFA 3WFZA 1F4HA 3WCZA 5LNUA 1U83A 3LERA 4S2CA 1R30A 5F2LA 2WZEA 1PZ2A 3U6WA 5I09A 3W1AA 4FPSA 1SQ7A 2NSOA 3W7QA 2A7PA 1OF8A 4NNAA 2PTWA 3RDKA 4A8NA 5F1VA 3WH6A 2AL2A 3N6QA 2QCFA 1UWUA 2GOUA 4TXEA 1H51A 4U2YA 3IPWA 4K7VA 4GYPA 3KTCA 3P7YA 1PX4A 1TO3A 5CAKA 5AHNA 3KTXA 3H70A 1QRQA 4Z0SA 4GZEA 1V79A 4FSAA 5FEZA 4QJ5B 2CERA 1FKWA 3N3MA 1OZMA 5EL1A 1GEQA 1TIMA 2GVEA 5AECA 2PD9A 4IP4A 2Y0FA 4JTLA 1GKPA 3T0TA 1EUAA 2QCDA 1QW7A 1NJJA 2E6YA 1NWSA 2OEKA 3SN4A 4UTWC 3H2FA 2RH9A 1UZHA 4PTNA 4LYQA 3H2EA 4PUUA 4WDUA 3S1WA 1Q4WA 1JD7A 2CLEA 5CJNA 4TMBA 1F3WA 1TWSA 1C90A 4NAFA 2W92A 1N2VA 3N19B 3WF2A 2JGYA 3W6YA 5K3VA 3HTWA 4O57A 4O28A 1N8IA 3WQOA 2ZZ7A 2ZC8A 2GJNA 4UOQA 3N4FA 5I77A 1JPKA 3M44A 2XH7A 3PBWA 1H11A 4KGLA 5KITA 5HNNA 4GOAA 2J8GA 3EB2A 4AIUA 4IFOA 5ABTA 1CPUA 1J6OA 3ABQA 1V3LA 5I5RA 4L80A 3TSBA 3M0KA 4B9ZA 3L9CA 1TTPA 4PBGA 1KFCA 2D1ZA 4LH8A 3VNZA 2GVLA 4HZ7A 3MI2A 1VRXA 4DWSC 1GUVA 4RXFA 1KTNA 1DJYA 1R7AA 4ZCWA 1RCOB 4PYSA 1YEYA 3QYSA 4O50A 2C1HA 5HUPA 4WF7A 2X1SA 1O12A 3KCOA 3H7VA 2FZBA 2FIQA 1KB3A 3WLLA 3IANA 3E49A 4MGGA 1FTXA 2VFGA 2HSAA 4GX9A 2JEQA 3V5OA 4R88A 3GG1A 3EWWA 4GI6A 4YCPA 2WZHA 3RX2A 2A5HA 4FB7A 2V63A 4S3EA 1O60A 5A69A 4JQ2A 4GBUA 3T2QA 2HE5A 1SFLA 1A50A 3M5VA 3UXAA 1IEXA 3W7EA 5BXSA 1MRAA 2PC4A 3U0HA 1MQPA 1CBGA 1S5NA 3L67A 2OYMA 1JCJA 3RIKA 4UTLA 2F6KA 1XGDA 2XGBA 3URAA 1ECQA 1OYBA 3QBUA 4HNCA 3EMQA 1C8VA 2ZADA 1S3HA 7TIMA 4JR5A 2Y89A 4HZ6A 4EE9A 2B7OA 2UZ9A 1CXIA 4WDTA 3QZAA 1LJYA 4JYEA 4MKNA 3OO2A 1DQWA 1YE6A 4JTSA 1Q63A 1RBAA 4FXSA 1QHZA 1EP3A 3H54A 2PCQA 1PSCA 4BF7A 2OWXA 3U4FA 4EWND 2INFA 3HMJG 3B8SA 2EEXA 4GO9A 3SCQA 3EOOA 3TTOA 3U48A 3RLHA 1UH4A 3DGBA 3OVGA 5D04C 2J6XA 3TXVA 1AD1A 1VYSX 3USBA 2EPKX 1WDPA 1Q6QA 3W6LA 3GNOA 2F2KA 3NQ2A 1EWDA 5IM51 1FWSA 1HNYA 3IIPA 4Q8NA 4QIUA 1CLXA 4NI8A 2D20A 1XIIA 2B0MA 4PB4A 1C8XA 1LQ2A 3S9YA 4WX2A 5CC6A 3RLUA 3N04A 3N14A 3E2VA 5JXQA 4F2BA 4M24A 2P88A 1VS1A 3R6IA 4H2CA 2XINA 1JCYA 1U2YA 2E7FA 1H49A 1G7UA 4PMVA 1Q6GA 4ZL1A 3EB3A 1TX0A 4QJ3B 2X1UA 1TZ7A 1XYMA 3SCVA 1J93A 4IFRA 3R0UA 5FF0A 3MUZ1 1QNVA 4B9YA 1IZKA 4X63A 1K9TA 3WENA 2E1WA 1OG0A 4BEQA 5C0QA 4O10A 3KRUA 4GXWA 1XG3A 1FP9A 3MSRA 3WLOA 1PS9A 3WD2A 4Z2LA 1YW1A 2A2IA 3O6AA 4GE8A 2XN2A 4O15A 3HB9A 1FWNA 4YYFA 1VBRA 2X7WA 2TAAA 4POCA 1UR3M 3RJXA 3RX3A 3VX1A 3LCFA 1HJVA 3EA3A 5XINA 2DW6A 1LOLA 4GG9A 2E68A 2WBGA 1QMLA 1D3HA 4DYJA 3REQB 4DI8A 1MXGA 5H91A 1ZCCA 4MWAB 3AIUA 3MZNA 1Z44A 5TD4A 4X61A 5LNSA 2X41A 3C52A 4DNMA 3GW0A 4YTUA 4HHHA 4ROPA 1V0NA 3IVUA 4ZEPA 1Q85A 1OZQA 3QEZA 4FP1A 1FWTA 4IG2A 4HNTA 2E6DA 2HXTA 3G0UA 1QU4A 4G1NA 3ITGA 1NTHA 2ZXDA 4EPEC 1GHRA 3I4KA 1P7TB 3HPXA 4IHCA 2HE8A 3ZVHB 4NJHA 5TQLA 2A6NA 2H3DA 1N82A 2H8XA 2JK2A 4S2BA 2DVXA 5CPTA 2REQB 1ZBVA 1OVDA 4UNIA 3AS0A 1TJPA 1XLGA 3NXLA 3OVRA 1EJ7L 1VBGA 1UWRA 3K1GA 4GYJA 1KLYA 3VE7A 1BWLA 3VX0A 4JFUA 1F8IA 2V3GA 1TPFA 3M0ZA 2YJQA 1HVQA 3PG9A 2CHRA 2XFYA 1U5JA 1QUMA 3AU6A 2CLLA 3NDYA 3AMKA 3LCWA 1JR1A 4J4KA 2GL5A 3G22A 3W7HA 1XW8A 1TSIA 1YADA 3LM7A 4LY4A 1UR0A 3NOYA 9XIMA 4KFOA 1T6MA 3VAVA 1JZ6A 4QSFA 4U3AA 2CPUA 1KV5A 1NWUA 2Y62A 2OQLA 4D1JA 4E8GA 3S5ZA 4E6MA 2DSWA 3VFCA 3OYZA 2F2HA 1UD6A 1JDAA 1QI3A 2X16A 2V30A 2G50A 2VX6A 5XIAA 3UFYA 3PPCA 2PS2A 3CHEA 1F07A 5CH9A 4DJFA 1EDTA 1IE7C 4ZOBA 3V0UA 5JU6A 1ZAHA 4RPQA 3W83A 3AMGA 1OIFA 3A21A 1HL9A 2YBTA 4LPCA 2QUMA 3ZXWA 5HMDA 3EYPA 3ZOAA 1IEIA 3N9SA 1DWJM 1R8LA 1S5WA 2OGJA 5A95A 4QX4A 5HULA 2FTPA 2R14A 2PP3A 4XTIA 5GJMA 2DIEA 4M82A 5KMYA 1OSEA 5E5CA 2UY5A 4N42A 1PZ1A 2QMJA 2VOMA 5A2BA 3P5YA 1VZWA 4R9OA 4LUSB 2QAPA 2YW4A 3VTRA 1FDYA 1XLFA 2PDLA 1E55A 2DQWA 3LPGA 1ZBKA 4W8BA 4U31A 3R8HA 3UWUA 1GZ1A 2QHAA 3AS3A 2Q09A 4HP5A 1XQLA 4AZCA 4A3YA 1K8XA 5DT7A 5CGTA 3QOMA 1JIBA 1QXLA 5HXMA 3RUBL 4DWSB 2WQDA 1MW2A 3PANA 4M6UA 3WL0A 2YYTA 2RUSA 3R12A 2BZNA 2V67A 1NOFA 3GH5A 4J3ZA 4MJ4A 4J28A 1V7YA 1AJZA 1CXHA 2R24A 4HYRA 2QIIA 4LCSA 2VR2A 1K8CA 5HR6A 2PDWA 4IOTA 4UTJA 4AD0A 1H2JA 1US0A 2DSUA 4W7WA 2WLYA 3GK0A 4IJCA 1A4LA 3O7UA 2PWVA 4UR9A 1GCYA 3UG8A 4B2DA 1A49A 5FL1A 3M9YA 2IPFA 4HTBA 1EP1A 3ES7A 2O7QA 3HA1A 2I5GA 1ZJAA 2VGGA 3W1NA 3V7PA 1JCNA 3W1LA 2NQ5A 4MB1A 5D38A 1XLHA 4O8RA 3EKZA 4ORMA 3GVWA 1OIMA 1E9IA 3HURA 1VIWA 3H22A 5AY7A 4DBWA 1WUEA 1CZ1A 1WYIA 2Z28A 3G3DA 2VEKA 1L6GA 3A4WA 3M16A 2ZWYA 1K9FA 4GXMA 1X7FA 1NQKA 4C60A 3CO8A 1EC8A 1WDQA 3MV01 4A3QA 1DHPA 2ON3A 4EXBA 4ZOCA 5ABEA 1YDVA 2C19A 1ONRA 1HXJA 4XD3A 1RALA 3PP7A 5CG0A 1WKEA 3QTPA 2PDQA 4MKVA 1EJRC 3W72A 1LLWA 5EKYA 5FEWA 1MW3A 3UG4A 3VU2A 3SUWA 2A7NA 4DUXA 2ABAA 2GYIA 1YX1A 1JF5A 2BSLA 5K2ZA 4MJZA 5G2HA 4AB4A 3STCA 4ENLA 2V82A 2XGIA 4AG0A 5BRQA 4PMYA 3QHOA 1RA5A 4DO6A 3VOCA 1LCOA 1B4KA 2NXGA 3HGOA 5JQ9A 3OGRA 1X8CA 3CEUA 1E5NA 3MPGA 2JF7A 3T7VA 3A23A 4OOUA 1RK6A 1O1ZA 2NLIA 5SWUA 4DBUA 2E77A 4MPKA 1E0TA 4B5SA 3OIXA 1I1WA 4OBRA 3GTNA 1QW8A 1RVKA 3W76A 4XIAA 3ANUA 2I5IA 3RITA 4DJDA 4XB3A 4UFKA 4O0ZA 4QR6A 4AZ7A 1V0MA 4WGXA 1W1YA 3CB3A 2JKAA 3TYBA 3VNMA 5D09A 4YTQA 1O95A 3EWZA 4I8YA 3BW3A 2RKXA 4DBDA 2PD5A 1Q2RA 5G1TA 4WXYA 3TP4A 1PKLA 4FF5A 3R11A 3AS1A 3TV8A 3O1NA 2ACRA 2HVNA 4OQVA 2PDUA 3FDGA 1ZTVA 5I3DA 3W71A 4H41A 1KKRA 3EKLA 3UJSA 1TMQA 3KBVA 3EDDA 3PZQA 4JFWA 1J96A 1NDZA 2ZZ2A 3NL5A 1AMYA 4FI4A 1B30A 1ITQA 2WZTA 5F2GA 3NQ8A 1ZGDA 2UWFA 4XSMA 1EJXC 4LW7A 3PTDA 2YLLA 3LHVA 4OZOA 1C93A 2ADAA 5TF0A 3QMTA 5CSSA 1B54A 3AIQA 2ALRA 3V35A 1DP0A 3BO9A 2QJMA 1MFVA 4D9PA 2EG6A 1VPXA 4O52A 1XX1A 3UF9A 2QT3A 1PWLA 3T0DA 3L4TA 3ZLFA 2BBFA 5C6MA 1RLDA 5IHRA 2CZDA 3NZGA 4WDWA 4NXSA 3GIQA 1GOMA 2W6RA 4PUDA 3LXAA 4JDYA 1UPMB 3A4JA 3RNDA 4ZQOA 3DI1A 3LHTA 4ZBCA 2KAUC 2QLYA 3CL6A 1S38A 3KZSA 3VOIA 4D6GA 4RX0A 4REQA 2WOQA 3QZEA 1F6YA 1BYCA 4IQDA 5CLWA 1XYAA 4JTTA 4Q7NA 4AEFA 1YNQA 3P82A 5K9CA 1NFGA 2INEA 5RUBA 3PJTA 3LD5A 4L1XA 1RQBA 3H6OA 3KE0A 1OG6A 4DX3A 5C7VA 3TC7A 4H1ZA 5FF2A 3WF3A 1WZKA 1PXGA 1JFXA 4Q8PA 2GGHA 1KM5A 3FJNA 1NARA 1JVNA 3GC5A 5FJTA 4C5ZA 3QC0A 1A3WA 5EPDA 4FF7A 4K37A 2EQDA 4TVUA 3VK5A 4JPGA 1Z42A 4HNOA 4Y96A 3M0IA 3QPYA 3W70A 1BPLB 1E4MM 3C2EA 1MYRA 4B4HA 2OR2A 4AYGA 3GC2A 2G3JA 1KRCC 3VOHA 3GNXA 4JY8A 1UD2A 1PJ9A 3RCNA 2H90A 3VGDA 2OEJA 5AYXA 4OJYA 3VNDA 2DH3A 3UGVA 3K30A 1YLVA 4Y2WA 1I2PA 4XAYA 1E4NA 1REQA 1C91A 1E5JA 2OU4A 1W3NA 2Y2WA 3BZJA 2DJLA 1ODUA 1UMYA 1US3A 1UKPA 3GKFA 2YR1A 4KEVA 3VCCA 1EJUC 3AALA 3BC9A 2WV8A 2FZNA 4KMQA 4P2VA 4HNLA 2VEFA 1BF6A 2J7DA 1KO0A 1WOAA 3GWQA 3UBPC 3I6TA 3ZFHA 5FOOA 3P93A 3FKRA 3TNBA 3TWBA 2TMDA 4J3WA 1VKFA 3S0CA 3TTYA 3UZXA 3WLPA 1BRLB 1GTEA 3BLDA 3BUVA 2XVGA 5M5DA 5FJIA 2G37A 5A8OA 2CZ5A 2HS6A 5AHFA 3QM3A 1DORA 4QBXA 2ZWZA 1SYTA 5DBTA 5A8GA 4AD3A 1YRRA 3G24A 3WQEA 4BQ3A 1AK5A 1QAPA 2QMKA 5F4XA 1D9EA 1W3HA 1E72M 1GOQA 1MO0A 4F0SA 3LMYA 4AVOA 1ISWA 3ICJA 2VDHA 5DF0A 3UZWA 3BVJA 5CPSA 1EQCA 5JBFA 5DO8A 3RPDA 1SGJA 3MYOA 1BXNA 5F2MA 4UIOA 2OKOA 3A47A 4ES4A 4TR9A 1TR9A 4HCLA 3V16A 2YIHA 1BWVA 1G6CA 1Z9AA 5LSMA 4EIVA 4JFTA 4Z1YA 5LIXX 4HJFA 2ZZ5A 3VZXA 2D0FA 3GSMA 3M6YA 4X2PA 2EPLX 1OFBA 3PZMA 1TMHA 3VD7A 1PKYA 2Q3RA 2V69A 2NQLA 3Q58A 2WVVA 2GSEA 1GPWA 1TZ9A 1LBLA 5BOEA 3EPOA 3LCXA 4HNUA 2F38A 1B3VA 5T8GA 2XSAA 3ARPA 3H8AA 3RX4A 2IXVA 4H19A 3CJPA 3LMZA 3T9PA 4YCOA 3W53A 3LPOA 4ROQA 5I06A 1VBHA 3DDMA 3VABA 1MI3A 2EXOA 4KRZA 4U28A 2FDMA 3N2TA 1M68A 3N4EA 3G1AA 4IL2A 4WUIA 4G1KA 4RR4A 1HO4A 4DJFD 2XSXA 3V18A 3KBMA 3P80A 4K8GA 4LOCA 1GZJA 3B03A 4JNZA 4ZSUA 2QV5A 4GGHA 3AMCA 4UQ9A 2YB1A 3ZO9A 5DBUA 3AROA 1E4IA 2PGWA 3GNDA 4ACZB 1ZQ5A 4MZ8A 2YDRA 4URIA 3M43A 4MB5A 1LUCB 1CYGA 3K4AA 5MKGB 1XGZA 1K4HA 3NGJA 4JKLA 1EO7A 3WJYA 1YNYA 1W9BM 2FDSA 2CLPA 2HNEA 3TZNA 3DIPA 2VWSA 4Q8OA 3STGA 3CV2A 5G1YA 4NZJA 1J4EA 1ZAIA 5AC5A 5DCBA 5G2WA 2YXXA 2BOFX 2VEMA 1PKNA 4YVXA 4WJXA 4S39A 2CIPA 3BAJA 1OCBA 3GDTA 3WUBA 3BURA 2QJHA 4JTJA 4IMFA 3H53A 1YBQB 4Y9PA 3HQOA 3KM8A 1RBLA 2ZE3A 1ZFJA 4LVAA 2GQ3A 5CBBA