1LOQA

Crystal structure of orotidine monophosphate decarboxylase complexed with product ump
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
209
structure length
208
Chain Sequence
RLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords orotidine 5'-monophosphate decarboxylase
publication title Crystal structures of inhibitor complexes reveal an alternate binding mode in orotidine-5'-monophosphate decarboxylase.
pubmed doi rcsb
source organism Archaea
molecule tags Lyase
total genus 81
structure length 208
sequence length 209
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2002-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1loqA00
3GK0A 4L4LA 1GTEA 4ORMA 1TJRA 3TROA 3W2NA 3W7PA 1GT8A 3B0PA 2NZLA 1SW0A 3TW6A 1OFRA 3M47A 5I3GA 1YDVA 3P62A 4RZ6A 5AC6A 2Z6JA 3E0IA 3E96A 3W1TA 5LZLA 2CLMA 5C5YA 2O7SA 2A6NA 1XBXA 1FY6A 3T55A 1U83A 2E6AA 3MBDA 4CCEA 1SZNA 4DO6A 3ANYA 3NQEA 3TA6A 1C8VA 4O1BA 1TCDA 4YL2A 2WV8A 3G1YA 4MFEA 3GXNA 4AWSA 1ALDA 4WY0B 3C56A 3HIJA 4JTFA 1XC4A 4X3ZA 1P0KA 3C8FA 1SR9A 2IQTA 2ZBTA 4JXCA 5AHLA 3G3DA 4E2DA 2HSAA 4S2CA 3ATZA 1NAL1 3EWZA 3HPZA 3LHYA 1F6KA 3LRLA 4O1CA 1JCXA 2Q8ZA 3FOKA 1YADA 2WPBA 2A4AA 2Z2UA 3G1SA 3O16A 5HWMA 1LOLA 3C61A 3DFSA 4NX5A 3UNDA 4JY8A 3EWBX 3W71A 3LI1A 2A1YA 1EIXA 1SQ7A 3LRKA 4JTHA 1TQXA 4NZFA 4NX0A 1WQ5A 4HSOA 4IMEA 1DHPA 1D3HA 3UWVA 1W5NA 1CI1A 1TPFA 4JD4A 5AHNA 4LRTA 1TPWA 3TC6A 1X1OA 1KFBA 4QSHA 1P1XA 3TKFA 4O54A 3FLUA 1F5ZA 3QM3A 1HFBA 1Q3NA 5AFDA 3TSBA 4JNMA 4PCFA 4PH6A 3OG3A 3P61A 3W83A 1J4EA 3A24A 3IVSA 3EWWA 3PWAA 1L6SA 1AW1A 5HQEA 1TRDA 1B9BA 5BMWA 4Z1BA 5D30A 4M7SA 5AYXA 5LNVA 1GYNA 3O6CA 4IXXA 3T40A 4JTGA 3R12A 2JKPA 3Q2DA 1I45A 1Q6QA 3OBKA 1VYRA 4O12A 2E5CA 1NF7A 4UFJA 1WXJA 3W76A 4AB4A 4TX9A 4GJ1A 5MHBA 5G2WA 4NXSA 1KTCA 3HMJG 4NQ1A 1JR1A 1UJPA 4MZ8A 3PUDA 4O18A 1OX4B 1EP3A 1M5WA 3M0ZA 4UUIA 3N2XA 4IX2A 1GVQA 1TPDA 2A7PA 4K39A 5EY5A 4LVGA 1Y0EA 2TPSA 3TIMA 1LM1A 3M43A 3GKAA 4RLIA 4M7TA 3TUUA 5H91A 3N73A 2B7NA 1FWRA 3NPXA 3S6DA 4IMFA 4P61A 4QAIA 2OZ0A 1ZFJA 2PRMA 3FYPA 4NJKA 1EA0A 4YCPA 4HN4A 2PCQA 3MW7A 4DPPA 4NT0A 1XXXA 2VFEA 1XKYA 4JY9A 2H3DA 5EMUA 3W1PA 4LWWA 1IXPA 2JGQA 3UZJA 1QR7A 2V30A 3GDMA 5F4WA 1N7KA 1G4EA 2J6XA 3G18A 5FI8A 4WZHA 4N6FA 1RR2A 3EWXA 4IJBA 1KA9F 3SI9A 4AVFA 4MOZA 2X1SA 5HWNA 1W56A 3LI0A 1WBHA 1KBJA 2V5BA 3MJYA 4LC8A 1TV7A 1XBVA 2NXHA 2X1RA 3M7WA 2H6RA 1SO4A 3GZ3A 1IF2A 2QAFA 2Y7EA 4QJ1A 1W1ZA 1S5TA 3MO7A 4FNTA 4G1KA 3WJSA 4BI6A 5HJLA 3NEVA 4WXZA 4MJZA 1QFEA 4GE8A 3QMRA 3DFTA 1W3NA 3E9AA 3IRDA 4HT3A 1RZMA 3NQ8A 1VRDA 4TO8A 3I7SA 3LXCA 3KRUA 4JTKA 2ZTKA 3BPWA 3RK8A 1OVDA 1XDLA 2NX3A 2P0OA 4LV4A 4N9CA 4O4WA 4RR4A 5CPMA 1ICPA 3W75A 3PUEA 2ZZ2A 5E93A 2X2GA 1KFCA 4DF0A 2RDWA 2DJXA 4WY0A 1VQTA 1QAPA 2QUUA 2YGYA 5F2GA 1LYXA 1SZEA 3NQFA 4HPJA 2ATMA 3VE7A 4O53A 1PS9A 3NM1A 5E1QA 4ADUA 4RV8A 1JUBA 1HG3A 2J27A 4DELA 3QQ1A 2B7QA 3LXBA 2XN1A 3W7GA 1VYSX 2C3ZA 4IMCA 1JRCA 3MI3A 4ADTA 5C2XA 5AC7A 2CLLA 1IXOA 2NV1A 2A2IA 2ABAA 3U2OA 3A9IA 5HULA 1ZAJA 4D2JA 3U6WA 3TX9A 3HG3A 1KTBA 4AWUA 1LTDA 2YW4A 3UPWA 3ABQA 1LLWA 1O95A 5AHFA 1E51A 4FNRA 4DQWA 4O50A 2JKAA 4NVTA 2V8ZA 1MO0A 1TYGA 3UPBA 1H7OA 1QOQA 4JDBA 1JCJA 2E1DA 3TQVA 1GVOA 2I1OA 1OK4A 1IIHA 2E5DA 4UFMA 3KVMA 1B57A 1GWJA 4Q33A 1RQEA 4M5PA 4HNUA 3CPRA 2R14A 4QISA 5CPLA 4QNEA 1LDCA 2G97A 4J9JA 1SZGA 4FEZA 3QMTA 3G8EA 3DXIA 3LHTA 5DLCA 3I68A 4C1KA 4MJMA 4MZYA 3KRZA 1S5WA 1UUOA 5KTLA 3A23A 3DU0A 2C15A 2WNNA 4NUWA 1VGAA 3S5OA 1L9WA 1JCLA 2QUTA 3BLEA 3L68A 3GNNA 3P74A 3QW4B 2EGZA 4TR9A 3LCIA 2QCEA 2RFGA 1HO4A 1PCWA 3W1QA 3E12A 1K7FA 4OV9A 3WJZA 4I7WA 5D38A 5D32A 4R53A 3S5ZA 3CTLA 4KFOA 3TJLA 1TPB1 4N9EA 4S2BA 1GZGA 1L6YA 4GRSA 1OX6A 3EWUA 3M9YA 3NPVA 4XTDA 2OCZA 1RV8A 1T8XA 1GEQA 1VHCA 3GAYA 4KKXA 3CQ0A 2WKJA 4XUGA 5HNRA 4Z1DA 1FQ0A 3UWUA 1OFQA 1GJPA 3HGJA 1YPFA 4XWUA 3OHIA 1U5JA 2JK2A 5FF3A 2GOUA 1OX5A 3BARA 3PVFA 3LCHA 1LOQA 3CWOX 1VH7A 3DAQA 4GXMA 1AL7A 1TJPA 4IGHA 4ZQMA 1IXNA 2RHGA 3W1LA 1FBAA 4M6VA 3BLFA 4JTTA 2HS6A 1M7OA 3QH2A 3RU6A 5DY2A 3JS3A 3PSWA 3M6YA 1DJNA 1FWWA 2ALDA 3NZ1A 4EF9A 1WBJA 4EF8A 3GNDA 4UC5A 3OVQA 4XBSA 3TE9A 1Z41A 1XBYA 2QKFA 4LS1A 4POCA 4JYFA 1PCKA 3L0KA 2DZVA 4L4MA 1GPWA 3CB8A 3R8RA 3W7LA 2C13A 4IX0A 4OU1A 3W74A 4PC8A 3W6YA 4IOTA 3W7QA 3EXRA 4GUHA 2G96A 2YYTA 3GR7A 5LGZA 2PRLA 1H60A 3DFNA 5EKYA 2YSWA 3O07A 2WOQA 3DI1A 1AG1O 2BX7A 1NFBA 2R94A 2C19A 3EB2A 3LBMA 1J2WA 3N9SA 2QCFA 5FEXA 4EIVA 4RXFA 1SFLA 3W3OA 3PBUA 5EL1A 1K8XA 3QQ0A 1EWDA 1X1ZA 2WJZA 3W7NA 3L66A 1Z48A 4A3UA 3P81A 4CQ8A 2F84A 3LCWA 4UTIA 3G0SA 5A5WA 3SSJA 2CZEA 1K7EA 3PG8A 3JR2A 5KZEA 3GR8A 3UYCA 4O15A 3TQ0A 1TO3A 3NQ2A 1NEYA 2PE4A 4OV4A 3SJ3A 1EEPA 1IIGA 3G1AA 4Z0SA 4RCXA 4HHPA 1QPRA 4CQ9A 3ATYA 4JDYA 3C2RA 1DKWA 5CSSA 1G7VA 4GUFA 4GUGA 2GVLA 5F1UA 3NOEA 3IIOA 1QDSA 1ME7A 2ZRXA 2WNQA 4WD0A 3HGRA 1G7UA 1I2PA 4O57A 2NWRA 5AOUA 1WOBA 1D3GA 4RKAA 3TAKA 3GDLA 2CU0A 1G67A 1NSJA 5IM51 2H3BA 4UXDA 1TPVA 3B8DA 2A0NA 4YMZA 1M6JA 1K02A 3IIVA 1TPEA 4K38A 2V9DA 1YDNA 1BEUA 4NJHA 5CZ0A 3E49A 4AEOA 3PG9A 3EXTA 4CLMA 1QWGA 3WJXA 4IWWA 1WOAA 3R89A 1KTNA 4FIRA 2Q8LA 2GPTA 2H8XA 2DZSA 3DHDA 1I2OA 3IGSA 3VNDA 1KV5A 2ZRYA 2A85A 1JJKA 3DHFA 3QEZA 3O06A 3A5FA 2NX1A 4R7JA 1QNVA 5BRBA 3L0NA 3O6DA 3GIYA 2JGYA 4KWWA 3KHJA 1DOSA 3QZEA 4DO5A 1D9EA 2TMDA 4DBEA 1THFD 1C29A 2FLIA 3ABRA 4DO4A 2VENA 1EWEA 3LOTA 4FNPA 1XI3A 3O05A 1FDZA 4Y9AA 5HMSA 5D2YA 2HTMA 4UTJA 2ZRVA 2G5WA 4I7UA 3K30A 5LHFA 3VE9A 2BLEA 1SZFA 2ZRWA 3JRKA 3NM3A 5DCEA 1LOSA 4BFAA 4WUIA 1PE1A 1W5OA 4RX0A 4JS3A 4LV9A 3W2UA 4MFDA 2CLEA 1LBMA 1QOPA 4QNWA 2QF7A 2WSRA 4ZZ9A 8TIMA 3IIXA 4GFSA 1JULA 3NVTA 5AN7A 3A21A 3CWNA 3TSDA 4X2RA 3BG9A 1LZOA 2E5BA 4OE7A 1TRIA 1OFOA 4MVAA 4O17A 1AW5A 1H1ZA 2Q3RA 3TJXA 3QSRA 1BWKA 3HG4A 3PR2A 4BK9A 3E02A 5TIMA 3ABOA 3WJWA 1R30A 3BVJA 1ZNNA 1W5MA 3S1WA 3R5EA 3LCXA 4TMBA 4YXGA 2NXGA 1F6PA 4FX8A 2V82A 1FDJA 3IIPA 3GDKA 2BWGA 4XTIA 4ALDA 1XUZA 4E38A 2ZYFA 5KINA 1IXQA 3OA3A 4TU1A 5FEZA 4PODA 1EP1A 1IGSA 3T44A 1A5CA 2YFOA 5DN1A 1KBIA 5KZDA 4ICNA 3NG3A 1AW2A 1FDYA 1R2RA 3HF3A 2W6RA 1QCWA 3STFA 3S5YA 4MLJA 1H1YA 4LVFA 4LUIA 2NUYA 1EPXA 3W7DA 4ORIA 3R2GA 3SIZA 1ME9A 3WFAA 3L5LA 4IMDA 1I8JA 5C54A 4K8EA 1PHQA 4QITA 3HG2A 1KFKA 3C4UA 3THAA 2GQ8A 2RKXA 1NVMA 1WX0A 4K36A 3TK7A 4M6QA 4ZMGA 2FPVA 3PBVA 2EF9A 3GDRA 3EEGA 5F4SA 3S9YA 1HUVA 1ZCOA 3IGUA 3TFXA 5C6MA 2FPTA 3EWYA 3CLMA 3H53A 4DF2A 1FXQA 4UTWC 2DZXA 2X1TA 3SGUA 4DEFA 3NYZA 3SECA 1DJQA 1Q6LA 4O1DA 3VKJA 4O4VA 1JUEA 3NL3A 4OT7A 2WNZA 1LORA 3NZRA 2CLHA 2DU2A 3LHUA 4U4MA 2QJHA 2Y62A 3M5ZA 1ICQA 3TW7A 3HJZA 4A2RA 3VI2A 4MPQA 1PVNA 4NXKA 5D37A 1LRNA 1XCFA 4HKPA 2DZUA 2I9EA 2FB3A 5HR7A 5G4EA 3MUXA 2FQIA 2XN2A 3C2OA 1WYIA 3CU2A 3TXZA 4LW7A 1ZAIA 1KM0A 3STCA 1VS1A 2I14A 2Y61A 4NNBA 3KVKA 4AHPA 2QCLA 3LX9A 2GUUA 4DXVA 4AF0B 5DXYA 5AB3A 4H4IA 1EB3A 5F2LA 5TQLA 4AHOA 1VC4A 3L67A 3BW3A 5G1YA 1LROA 1TPH1 1SSDA 1OFDA 2QCDB 5K2ZA 3KVJA 1FWTA 3TFCA 1VCVA 4LUJA 1OK6A 4ZQPA 4FO4A 1KV8A 2J9ZA 5IBXC 1GTHA 3LCFA 4LY8A 3W1NA 1BKSA 5G2HA 3PBWA 4RZ5A 3LRMA 4JTUA 5I3HA 4QIUA 3I7QA 3L2IA 4UMBA 4UTMA 3S0CA 3KFTA 3FJLA 1KM4A 1ZAHA 1ONRA 1LCOA 5CZTA 4KFNA 1I2RA 5DCDA 2DORA 2W79A 3LTYA 2QEZA 4UTKA 5J5RA 4K8HA 5D2WA 5I3IA 3NL2A 1N8FA 5DBTA 1VJIA 4FB7A 2Y85A 2VFDA 2WO5A 2Y88A 3LHWA 4UTHA 3NO5A 1ME8A 1F74A 2E6YA 1G69A 1EP2A 4JGDA 1K8ZA 4KWVA 4WQ6A 1B4KA 3OVRA 4O28A 4IUOA 1MEHA 3TC7A 3UXAA 4UNLA 3W7CA 2NXIA 2H90A 4UMAA 3LCGA 1F05A 3KX6A 3FFSA 2ZZ1A 4CCDA 2DJLA 5G1TA 1KLYA 5U7SA 2Q3OA 3LGEA 4UTTC 3KOFA 5K9DA 3TXVA 5LNUA 3QMSA 1O94A 2TYSA 2ZTJA 1A53A 1JQXA 1ML1A 1WA3A 4FX7A 5CPOA 1DVJA 4TMCA 4HPXA 4HSNA 4IXHA 3NPWA 4H6KA 4JTSA 1JUKA 2CWNA 1RVGA 2DP3A 5FF4A 3WK0A 5GVJA 2QUVA 3DH7A 3BV4A 5D04C 5HUOA 1W5PA 4FNSA 1YXYA 3CHVA 3UWZA 1XDMA 1K7XA 4MYXA 2GVJA 4YWIA 4JTEA 4EWND 4X22A 3W85A 3ZWTA 3I6RA 5LSMA 5EYWA 3NR0A 4FXRA 1H7NA 1MEIA 3M1ZA 3PBYA 1K8YA 2RDUA 2VKZG 3CEPA 3F1QA 3AJXA 3UD6A 3I7RA 3YPIA 4LVBA 2J9YA 4HNTA 1W8SA 4WOQA 3INPA 2DZTA 3HBLA 4A22A 1I2NA 1MXSA 1WV2A 1FCBA 3DFOA 3W1MA 3GVGA 3KAOA 2EAWA 3W86A 1SO3A 1ZHAA 5DELA 1JCMP 4RK8A 4ADSA 3GKFA 1ADOA 4Y6GA 3G0UA 4N4QA 5BMXA 3HGSA 2JKEA 1TSIA 1HTIA 2C18A 1DQXA 4I7VA 1GVRA 3B05A 2C6QA 1OFAA 2UV8G 4W9TA 2BZNA 3LCLA 4N2YA 1OX4A 7TIMA 4IMGA 2GJLA 1YTDA 4M19A 3G1VA 5F2IA 4UFHA 5AC8A 3FS2A 2R91A 2C16A 3SY5A 1H7RA 3NQMA 4O10A 3W07A 1ICSA 1TMHA 3KVLA 5HWJA 3CM4A 4O14A 2J24A 3W1UA 1LLZA 4LS0A 2NLIA 2VEIA 1I4NA 1F76A 3O15A 2CZDA 4MZ1A 3NPUA 3MP5A 3OVPA 2ZZ5A 1V5XA 3QFEA 5EA9A 2ZFAA 3G0XA 3NXFA 3W2JA 6ALDA 1QO2A 2Y7DA 5CZSA 1LBFA 2FDSA 1B4EA 3MHUA 2VEMA 3D0CA 4X9SA 5DY3A 5HUPA 2VFFA 3IIZA 4UMCA 1BWLA 1RQBA 3W72A 2V2DA 5K4XA 3NDOA 2GVGA 1DBTA 4O8RA 2ISVA 2RH9A 1GG0A 3TU9A 4UCGA 3BGGA 4PA8A 4JX6A 3N2MA 2AQWA 3O8AA 3NNTA 4NNAA 4AHQA 3W7EA 1VR6A 2R8WA 5DBUA 4AF0A 2EHHA 3O63A 2TRSA 2H8ZA 3SW6A 5HR6A 1CW2A 2XN0A 4IPJA 3W2MA 2QCDA 2QDHA 1JQVA 1LRQA 4O1AA 3MI2A 1MSSA 3O6YX 5G2IA 3BGJA 1VCFA 2QR6A 4R34A 2A21A 3GYEA 4I9AA 3BLIA 1OFEA 2P10A 4LOCA 2EKCA 5FF0A 2E77A 3Q37A 1K03A 3LHZA 3N19B 3MBFA 3USBA 4IQLA 5AHEA 4BR1A 5BW6A 3UY7A 4B5NA 5FF7A 3RFAA 1KW1A 2WSQA 5CKSA 3EKZA 4Z0JA 3G1XA 1OF6A 3KRSA 1GVFA 1A50A 2ZCGA 4JYEA 5L6UA 5K7JA 5KZMA 1OYAA 4ZQOA 3TNOA 3UY8A 1VCGA 1W37A 3TCEA 5KMYA 1EUNA 1K3UA 2AGKA 1R2TA 2OX1A 4JIQA 3MHGA 3DFPA 5LHEA 1GG1A 1A5SA 3W23A 4GUJA 1KM1A 1VHNA 2V0TA 3UWQA 5BOOA 3UZ5A 1WDWA 4BWLC 2HMCA 4BF9A 3UXDA 1HL2A 1NF0A 2QCMA 2YDAA 3EX2A 4MIMA 1S3HA 2FJKA 1UUMA 4AMAA 1S5VA 4MLRA 4MUZA 4DPQA 2B4GA 3NQGA 1PIIA 2YYUA 3NL5A 3B06A 5FF2A 5D03A 1GQNA 1Z42A 4WOZA 3W84A 4UTWA 1W0MA 3HOJA 3GDTA 4MY8A 4N9BA 1W5QA 2C0AA 3W1RA 3IVTA 5I3JA 1A5AA 1FX6A 5D2XA 3EX1A 4N6EA 4XQ6A 1XM3A 4NJGA 2B7OA 1H7PA 3TMQA 1YDOA 1J5TA 5L9FA 1VYPX 2WQPA 1TPUA 3DENA 3FKKA 2CLOA 4K37A 3MYOA 1H62A 4LC6A 4ZQRA 2C14A 3EXSA 1C9DA 2A7RA 5LKYA 1RPXA 4Z1AA 3UWYA 2E6FA 3HG5A 5C55A 4AXKA 3QYQA 5DCBA 2ATSA 4AH7A 2G95A 2CW6A 4LS2A 5LNRA 1CX9A 3S1UA 3PAJA 5ABTA 5IBXA 1L2UA 3RMJA 3W7IA 1XFBA 1FCQA 5CPNA 2CFFA 3MI6A 3M44A 3TAOA 3Q58A 4PL1A 2FPYA 3BW4A 3N34A 3BG3A 1AMKA 3SZ8A 3W88A 3RLVA 1EUAA 4GWEA 4JYDA 1VLIA 1X8FA 1TQJA 1W3IA 1DQWA 4FXSA 3NQVA 1H7XA 2X16A 4NZJA 1I2QA 2YCEA 1KM3A 1PHWA 4EOUA 3QJAA 3QPYA 2DZPA 3L21A 2X30A 1OHLA 3G22A 3MHFA 2NUWA 1O5KA 1T0OA 1LRTA 1TTPA 1UBSA 2VOMA 5EPDA 1BTMA 5TBOA 1G6CA 1TV5A 1RD5A 4GUIA 3B4UA 3OIXA 4GBUA 2BSLA 4FNQA 3B04A 5HINA 4XKYB 3NAVA 3TMLA 4LTSA 4AWTA 4BI7A 3U8GA 1G4TA 3CEUA 4K7YA 3F03K 4N02A 3T4CA 4UTTA 1AL8A 3DZ1A 5K9XA 4R33A 4CNPA 1G4PA 1JRBA 2VEKA 3M5YA 4LRSA 4C1LA 3PY2A 1HO1A 1RQHA 6TIMA 4WXYA 1KM5A 1PL9A 1QO5A 2KZHA 4O0KA 1KFEA 1B3OA 2X1UA 3S8HA 1OYBA 1ZALA 1YXDA 4XZ9A 1OFPA 3QSTA 3LXAA 3EX3A 3WK1A 1YTKA 3M5VA 2JBMA 3A5VA 1H50A 3CIXA 1H7WA 3P8IA 3THQA 3N9RA 1GOXA 4UFLA 1QPOA 4OWGA 3NQCA 3LTSA 1A5BA 4O13A 3QRHA 3TDFA 5AHIA 3L65A 3ZFHA 3ZS4A 3LV5A 3PSVA 1YPIA 1F2JA 2FFCA 4JTJA 3BG5A 5H2ZA 5LNWA 1SFJA 2YFNA 2FTPA 4A29A 4JTLA 3LBCA 1W31A 3GXTA 2D73A 4QQ3A 4E2BA 2OT0A 1H5YA 4RJEA 3LHVA 5FESA 4Q4KA 1F73A 4U28A 2GJNA 3W7JA 4DF1A 4LVDA 3LB0A 3DI0A 3WJYA 2B0MA 3NQ7A 2GQAA 2B7PA 3FKRA 1KFLA 2ZZ4A 3RF9A 2Y70A 3M41A 2TSYA 3NQDA 1SO5A 1GVSA 4NJJA 1PV8A 5D09A 3C0JA 3TV8A 2J9XA 2F7FA 4JICA 5AHMA 2ABBA 4HNNA 2A5HA 1OFBA 3FJ6A 1O60A 1X7FA 3F4NA 2ZRZA 3W7OA 3F4WA 4FNUA 4Y96A 2ZA1A 2ISSA 2WSYA 1JCNA 5DXXA 4OGZA 3WK3A 1XBZA 4OQVA 4O16A 2ISWA 4AAJA 3EX4A 3HPXA 3R13A 3I65A 1YTEA 2VFIA 4UR7A 1UB3A 4ZVJA 1TV8A 4UR8A 1O5XA 4JN6A 4UFIA 3NL6A 4QM1A 1T96A 1VLWA 3P82A 4KFPA 4WX2A 4JX5A 3MP3A 4ZQCA 1MEWA 3SFKA 2HS8A 3TR2A 4UTLA 4UTUA 3L9CA 4UIOA 2Y7FA 1V7YA 3L5MA 4O0ZA 3HO8A 4FIQA 3W87A 5CSRA 4XBKA 3HB9A 5D33A 4FF7A 4WY0F 3GX9A 3S1VA 3C6CA 2PRHA 4JIPA 3C2EA 2QCCA 3LLFA 4JR5A 1WAUA 1QMLA 2Y6ZA 1R46A 1ZJIA 3TH6A 3N3MA 2PC4A 2VFHA 4JEQA 3O1NA 2W0UA 4TIMA 4BI5A 1EX5A 2GQ9A 4MYAA 1YXCA 1KFJA 2QAPA 1OABA 3P5YA 4PFMA 4CNOA 3LDVA 3GAKA 3WK2A 3W9ZA 2Y63A 5I3FA 1SU5A 3SR7A 2CLFA 2CLKA 4Y90A 2QCGA 2V81A 3L0GA 3S5NA 1YYAA 4CCCA 2E09A 4PTNA 2BXVA 4RZ4A 2P1FA 3C2FA 4ZQNA 1GYLA 4NJIA 5I3KA 3C2VA 2YR1A 4ZL1A 3KXQA 5T26A 3ELFA 3STEA 3UQNA 3DGRA 2CZ5A 4HNVA 3PB2A 3PM6A 2NX9A 3L5AA 1ZENA 3T7VA 3MWAA 5CGQA 3W73A 4BWLA 2YPIA 3V75A 3Q94A 1Q45A 2ZZ7A 3M16A 1TREA 3PS7A 3FA5A 4XKYA 3TQKA 3NA8A 3GB6A 3NQAA 5D2VA 3IV3A 2YW3A 1KLZA 3P5ZA 5SWUA 5U4NA 1P4CA 3H54A 1SUXA 4GNJA 5A8GA 2QDGA 3M5XA 3W22A 1TTIA 5D2TA 2QJGA 3P60A 4O19A 4UNKA 2RDTA 3OEXA 1KM2A 3ZR4A 1T99A 1W3TA 1H61A 3STGA 4LNYA 5EBUA 3RNDA 5F4XA 4PL2A 5FEPA 1FCUA 3NGJA 4K7VA 2BTMA 3P8JA 3PUOA 3BW2A 1FWSA 3IEBA 2ZDRA 4DBDA 2YXGA 2NV2A 3BK0A 5CZJA 5KITA 2ZZ6A 4NU7A 4JX4A 1JVNA 1VPXA 1FCVA 1VZWA 4S1FA 1R2SA 2VELA 4UFKA 5K9CA 3CC1A 3P80A 4EVZA 4LVAA 3QPZA 4CQAA 2ZA3A 2C1HA 1W54A 3DKJA 3PULA 4Q32A 3V1PA 2V2CA 3P7YA 3C3NA 2VEPA 2FB2A 1DORA 3LLDA 3W1AA 1QPQA 5LGXA 3G1HA 1Z44A 4M6PA 1UASA 4FHAA 3RLUA 2ZRUA 3HQ1A 1F7BA 1R47A 3S1XA 4MY1A 4IPIA 4NNCA 1P5BA 3ZWSA 1Q6RA 2VXNA 3H55A 3W7MA 3P84A 1ZY9A 1Q6OA 1JCYA 1OG0A 2EPHA 3T78A 3GXPA 4LT9A 3IGXA 3CT7A 4GC4A 2LLEA 3W2KA 4H3DA 3W7RA 5LNSA 1SW3A 2YX0A 3BO9A 1KM6A 5G4WA 1LBLA 3MP4A 5E0KA 3P67A 3VCRA 5K4ZA 4MKNA 3FIGA 3CIWA 2OT1A 5D02A 4JTIA 2A7NA 2A6LA 5F1VA 3LTPA 1YLVA 1XUUA 4P2VA 3B0VC 3G8RA 4YLWA 2NUXA 1FUYA 2PURA 4YCOA 2Z0IA 2DZWA 2XFWA 3LV6A 4Z08A 1DV7A 3W1XA 3DFQA 3PC0A 1TPC1 2Y7GA 3G3MA 4N9DA 2OJPA 1H51A 1OF8A 4HIBA 4CNNA 3HPSA 3EKLA 3PB0A 3DBPA 3W70A 1TTJA 3G1DA 4Z1CA 5AYYA 4OBTA 1OJXA 2E6DA 1FXPA 2NWSA 2V2HA 1OYCA 2QJIA 1SPQA 3AO0A 2FIQA 3G1FA 1X6UA 3LERA 2Z1BA 1TB3A 3TSMA 2E68A 5KSWA 3C52A 2ZA2A 1G4SA 2AAMA 5FEWA 3GLCA 5AYZA 3S42A 3QW3A 1O4UA 1SO6A 2ZQ0A 1H63A 2VFGA 4K6AA 1SW7A 3HGOA 2QCNA 1TTQA 4ML9A 3B0UX 5G5IA 4N4PA 3PF3A 3DKLA 3IVUA 1L6WA 1AK5A 3FEMA 4E0CA 3MMTA 4ONVA 4OHQA 4A21A 3G24A 3B03A 3QF0A 5F2MA 2Z6IA 5BNKA 2QCHA 4O11A 4RXGA 4A2SA 2OMAA 3EX6A 4PEKA 2J88A 4WJEA 3VFLA 3W2LA 3N14A 2ZZ3A 1SSGA 5K3VA 4MY9A 5CG7A 2Y89A 1N55A 2VC6A 1M7PA 3LM7A 5D05A 5J5DA 4LU0A 1UCWA 3MYPA 3FYOA 1XL9A 2O7QA 2CLIA 4Y8FA 2CZFA 3SGZA 3ABSA 3UWWA 1P0NA 4O52A 3W7KA 3W7HA 1MZHA 1FWNA 3QC3A 2V5LA 1QPNA 1LP6A 1DL3A 1TIMA 3NQ6A 4FX6M 3A22A 2YZRA
chains in the Genus database with same CATH superfamily
2OWWA 3VC5A 4ORMA 4IISA 3W2NA 4S3FA 1GT8A 2IQ0A 3ZYZA 2QNEA 1K9DA 1ISVA 1RBOB 2Z6JA 3URAA 1Q2SA 3T55A 4DO6A 1Z7AA 1TCDA 2CLPA 2VR2A 4MAZA 4Q8MA 3M0MA 5A6BD 2FDMA 1UR4A 2IQTA 3W6LA 2ZBTA 4JXCA 1GEHA 1IZCA 4UQ9A 3ARRA 4GJIA 4S2CA 4XBJA 3FV9A 4Q8UA 4AYSA 3EWZA 3LHYA 1C90A 4D71A 1BVZA 2OLAA 1EH9A 1CDGA 4PUMA 4W85A 2WPBA 3ZO9A 1CXFA 1OEPA 4HMEA 3G1SA 2PFHA 3C61A 1E73M 2P0IA 4NX5A 3IJDA 2C7FA 4KMQA 2ZOXA 1TQXA 4NX0A 1WQ5A 1DHPA 1QHZA 1D3HA 3I4EA 4C7DA 5JH2A 1XIMA 4GHRA 4JD4A 1TPWA 3TC6A 1WKDA 1WDDA 5IRPA 3TKFA 3PZOA 1E1EA 1LT7A 3UJSA 5A2AA 3IJ9A 2F6XA 1HFBA 5AFDA 4JNMA 2WVSA 4PCFA 4PH6A 4F66A 1J4EA 1OG6A 4XZMX 4RW3A 3MB9A 4FZIA 1L6SA 5HQEA 5BMWA 1BQCA 2GDQA 5D30A 1XLGA 5AYXA 4FP1A 4US5A 2FTWA 3T0DA 3T40A 3CV7A 3N4EA 4EACA 3WDHA 3GH5A 1XFCA 4QG8A 2F8QA 1Q6QA 1VYRA 3MUIA 4H8UA 4DUVA 6TAAA 1LWJA 3CBWA 4UFJA 3W76A 4HPHA 3UZZA 1LJYA 2XGIA 1HKMA 4QDMA 4EXQA 3BCJA 1KTCA 3HZ3A 4PUEA 2VZTA 2AMXA 1ADDA 4MZ8A 4B5XA 2VURA 2NT1A 3M0VA 4IX2A 1TPDA 2EPMX 3OZOA 5EY5A 2GYIA 1DWFM 3WDPP 4HMDA 3GKAA 5A6BA 2B7NA 3NPXA 4ZA0A 3MV01 1A0DA 2PWHA 1DWHM 2PMQA 3BAJA 1ZFJA 2PRMA 1EA0A 2PCQA 1XCXA 3GTHA 4NT0A 2ZWZA 2VFEA 4JY9A 3G77A 2JGQA 3T05A 1QR7A 4JL2A 2V30A 4NZ1A 4WZHA 1VBRA 3W53A 3RYSA 3EWXA 1UW9A 4NAFB 3SI9A 4GH1A 4IMAA 5EMYA 4U3CA 2J47A 1W56A 3BMXA 2PDLA 3CASA 3OA5A 3RDKA 2P88A 1XBVA 1KR0A 4QJ1A 4ES4A 4P7RA 1GVYA 2OOFA 4FNTA 1W1A1 3H4XA 4MKSA 1PYFA 3HPAA 3UJ2A 1JEZA 1QFEA 3QMRA 2ON3A 3MSGA 3DFTA 3WLRA 4HT3A 3IJ7A 1RZMA 3NQ8A 3I7SA 3LXCA 1VENA 1E0VA 2WJDA 3RK8A 1OVDA 2P0OA 1IYXA 4PMRA 1S2WA 2PB1A 4RR4A 3W75A 5E93A 2X2GA 1T7LA 4GIYA 4DF0A 2Y24A 2DJXA 1PBGA 2NVCA 1VQTA 1F3EA 3MA8A 2YGYA 4I9MA 2ZDSA 1TE1A 2WWDA 1FH8A 3NM1A 4ADUA 5TD4A 2OG9A 2B7QA 2R6OA 4DZ5A 1P0BA 2C3ZA 1O1HA 3N9KA 1GUVA 1E6PA 2OWXA 2BP1A 2BHZA 1CT5A 1QBAA 2PTDA 2A2IA 3U2OA 4ATWA 4E3VA 1XIFA 2YOCA 3S9IA 3B0XA 4JKLA 1XYAA 1KTBA 4AWUA 2Q01A 3UPWA 2ZUTA 1E51A 1EZWA 4DQWA 3HU7A 4O50A 5C9XA 1WDRA 1QOQA 4JDBA 2OSYA 4AY7A 1OK4A 5XIAA 1Q8JA 3PBMA 4AD1A 2E5DA 4UFMA 3EDDA 4KPLA 3WX7A 3UPMA 1GWJA 1HXJA 1OC6A 3SCQA 4M5PA 3NFUA 3CPRA 1WUFA 2WPGA 2WKLA 1SZGA 4FEZA 3QMTA 3I68A 2XSXA 2DQXA 4CD5A 3UVAA 4GQ0A 1J8VA 4AZ7A 1L9WA 1P6CA 4ATLA 3BLEA 3IRSA 3L68A 3UGRA 1IE7C 3GNNA 4KH2A 2J7HA 2CEQA 2WVUA 2EGZA 2CESA 4IIHA 2CCRA 3LCIA 1QASA 5KZ6A 3WD3A 1HO4A 3GR4A 4NI8A 1FWCC 4I7WA 3QV8A 5D32A 1PWLA 3S5ZA 1HKVA 2EJAA 1L6YA 4GRSA 4XTDA 2OCZA 3VKCA 4RNIA 3HM7A 1VHCA 3GAYA 4KKXA 1C9WA 1XYFA 1RD6A 2Z7GA 1BXNA 3SSZA 5IDZA 5FSDC 1XG4A 3JVAA 4G7FA 3REQB 4XUGA 5I03A 4IFKB 3UWUA 3HGJA 3OHIA 4YYCA 4D6EA 1UR8A 1LT8A 4FLOA 1VFMA 2BOGX 2YL6A 1DYSA 3LCHA 3CWOX 4GXMA 4WDWA 2FGBA 1KR1A 4ZQMA 4C6QA 4M6VA 3BLFA 2HS6A 2L5HA 3B0YA 3WUBA 2FMNA 2BODX 1J0JA 3C0SA 4NAFA 4DZAA 3NZ1A 4EF8A 3B8VA 4JIIX 5HMFA 3ITYA 4KGJA 4LS1A 4DNMA 3WF2A 4LXFA 4PMQA 4GLEA 2ZXAA 4XAYA 2C13A 4OU1A 2PDKA 3SQLA 3GRIA 5BXSA 2X7WA 1V08A 4GUHA 2G96A 2WM0A 2PRLA 2ZVIA 5HNTA 3RR4A 4QCFA 5LIYX 2R94A 3EB2A 3LBMA 2GK1B 3N9SA 4EIVA 1KXVA 2FVMA 1SFLA 3SUWA 3VPLA 4PCPA 4ACZA 3QQ0A 1JL8A 2FHCA 2XM1A 2XFFA 3MUZ1 3MT1A 3U2EA 2NQLA 3PG8A 4O15A 3SUUA 3EOUA 1NEYA 2PE4A 4MNLA 4OV4A 4Z0SA 3G1AA 3VO0A 2VC7A 1QPRA 4HHPA 1DJIA 3C2RA 3B8TA 5CSSA 1G7VA 3MDWA 4DLFA 4LYQA 2IKHA 3DDMA 2HWGA 4WD0A 2Z29A 3HGRA 1NDWA 3PHAA 5C0QA 5I06A 4W5ZA 1GQKA 1XR2A 1E1FA 4RKAA 3GDLA 1Q6FA 3WBXA 4FLQA 1REQB 4ZOCA 2H3BA 2F38A 2OKOA 3AXMA 3VYLA 4ROPA 4KF1A 1YDNA 4AEOA 3E49A 3EXTA 3SCOA 1V3MA 3WJXA 1WOAA 4L80A 2VP8A 3QYSA 1UD4A 4FIRA 4EE9A 2DZSA 5MKGA 1EJTC 1I2OA 2WLZA 3IGSA 2BFGA 5FA5A 3U2CA 2A85A 1JJKA 1ZPTA 5BRBA 3L0NA 1ISXA 2DQWA 4DO5A 3BMWA 4C91A 3OB8A 1THFD 5FACA 1U1UA 2FLIA 3ABRA 2OSXA 4FNPA 3BICA 1XI3A 2DVTA 3R25A 1V51A 5HMSA 3VX1A 3NO3A 1ELSA 4UTJA 1YKWA 1TV4A 3MCNA 2XIOA 3VE9A 3HV8A 4JQ2A 1DTUA 5DCEA 3SN4A 2W91A 3MCOA 4MNKA 2CXEA 3SURA 3W2UA 4JN8A 2CLEA 1KQYA 1QOPA 4QNWA 4ZZ9A 1R3YA 1B3WA 1JULA 4PUJA 1V3JA 3TSDA 4JCMA 3BG9A 4DVOA 2BHUA 4KEVA 1TRIA 4MVAA 4O17A 3W25A 3LSBA 3PPFA 2WVTA 3TJXA 3QFWA 2XIQA 2OYLA 1CGXA 4TXEA 3WNLA 2FZ8A 4ACYA 3R5EA 3ANUA 1PWMA 4TMBA 4YXGA 1F8MA 1B3VA 3QOKA 4FX8A 3H8AA 2PU0A 2BWGA 1BD0A 4ALDA 1DWAM 1XUZA 3VXGA 1IXQA 2EQDA 3OA3A 1W1YA 1JIBA 5FEZA 4ZODA 1HJWA 5GPRA 2W63A 4PBFA 1GPFA 5I23A 2YFOA 2E8ZA 6XIMA 5KZDA 1GOIA 1AW2A 3HF3A 3STFA 1UWQA 2D69A 2YL5A 1GQIA 1W32A 1H1YA 4NZ5A 1A47A 3MMWA 4HMNA 1EPXA 3I6TA 3UFYA 3W7DA 3H2EA 4ORIA 1Y5XA 3R2GA 4L9ZA 5CSYA 4CD4A 3SN0A 3HG2A 1R9YA 2RKXA 2VDGA 3CHDA 1HKWA 1VP5A 1NVMA 4K36A 2FPVA 2EF9A 4GG9A 4H7VA 1E72M 3XIMA 5F4SA 4I90A 4H8HA 4HP5A 3IGUA 3TFXA 5ECVA 1OWQA 2FPTA 4DF2A 2MNRA 1EGMA 4MSSA 3RJYA 3V4BA 2GK1A 3SECA 1DJQA 3W82A 4MDPA 1MUCA 4O4VA 1JUEA 3LM3A 1LORA 1JDCA 4NKCA 3S2LA 1ICQA 4F2UA 1RALA 1BSLA 5C7VA 3QR1A 1LQ0A 2I9EA 1V6YA 3A9BA 5G4EA 2OTDA 2UWFA 3SEPA 4KWSA 2PTZA 3SCVA 4HPGA 2OODA 1PKLA 1UKTA 3DEQA 1KM0A 2BY1A 2Y61A 4GI4A 4R88A 4NZCA 2V5DA 4IP7A 1MI3A 2GUUA 4UWMA 4KBXA 1TWSA 3OJGA 3BW3A 2X8RA 1TPH1 3N4FA 1OFDA 3H2FA 3CZEA 3CYVA 1OK6A 1REQA 2R82A 4FO4A 1HJUA 1PPIA 2OU4A 3O9NA 4BQ2A 2Y0FA 1GTHA 3O3RA 1GJUA 5LA2A 1JFXA 4RZ5A 1JYNA 3ZVIA 4BHYA 3A12A 2AAAA 3GS6A 4MB5A 3S0CA 2CZVA 1ONRA 4TOQA 2W79A 5J5RA 4LBRA 3WUEA 3NL2A 4XKMA 4FB7A 2Y85A 2VFDA 5E9XA 4UTHA 4B3ZA 4F0HA 1F74A 2VZOA 1O1ZA 3ID7A 1X8CA 4B91A 1T8QA 3CO4A 2PDNA 5H1WA 4GQRA 2ICSA 4O28A 1E4MM 1S2TA 4HU8A 4IUOA 1MEHA 1QU4A 4UNLA 1IQ8A 4DWSB 2H90A 3NCOA 4CU6A 4IP4A 1MQPA 3LCGA 1FP8A 2NQHA 3K4AA 5H8PA 1KXQA 3DIPA 2OPJA 3FJNA 2P76A 5LNUA 1XLIA 2DT3A 2V5JA 1O94A 2TYSA 2ZTJA 1JQXA 1M9HA 1WA3A 3RLGA 4PE8A 5CPOA 4TMCA 1PX4A 2YCJA 1LQ2A 1EZ2A 4H6KA 1GOOA 3WLJA 1LL4A 1XX1A 4XO6A 5FF4A 3VK5A 1Z69A 2QUVA 1R8LA 5D04C 2EG6A 1E40A 1MZRA 2QPXA 4EXAA 2HBXA 4MYXA 2GVJA 3LY0A 2E9BA 4X22A 4FMVA 3ZWTA 3ORWA 3I6RA 5LSMA 5EYWA 3VDHA 2XVNA 1QJWA 1RBLA 1YBQB 3ERPA 2VKZG 3OZYA 1OZMA 2CKSA 3I3BA 3F1QA 3UD6A 1ONEA 2OZ8A 3YPIA 1QTWA 2WYSA 5M03A 2CKRA 2OSWA 2D3NA 1F6YA 2J9YA 3PJXA 4WOQA 3HBLA 3UERA 1WV2A 1XS2A 2EAWA 4PUWA 2PDWA 1HP4A 1ZHAA 5DELA 4C65A 4W93A 2J8TA 2ZX5A 1CXEA 4FALA 3R0KA 4N4QA 2J13A 4XAZA 1W9VA 2JKEA 1TSIA 1YDYA 2GFTA 1HTIA 2C18A 4I7VA 1KRAC 3B8IA 1OFAA 5E9AA 4DWSD 5ABHA 4AZ5A 3GTXA 1FKWA 4N2YA 7TIMA 3UXIA 4M19A 5F2IA 1ZBCA 3QV9A 3SY5A 2V69A 2YBUA 4PN2A 4O10A 3SCSA 3W07A 5HWJA 1DP0A 3BOLA 4AUBA 2J24A 4HCLA 4OECA 1F76A 3O15A 4MZ1A 5FJJA 3MP5A 4ASTA 2VRKA 4AZGA 2QVNA 3C8NA 3QFEA 4GY1A 1M3UA 3W2JA 4WK9A 3WQEA 1QO2A 2XJ7A 1LBFA 1IT0A 4TTUA 5HUPA 4C6LA 5I2UA 3WENA 4J2PA 3ITLA 4UQBA 2VEGA 2V63A 5K4XA 1HL9A 2RH9A 1GG0A 3USZA 4DBSA 3LNMA 3WBAA 3ITXA 1VR6A 2R8WA 2TRSA 4ILSA 2CIPA 2DUAA 2H8ZA 5HR6A 1OIMA 1CW2A 1H0IA 2WWCA 3W2MA 2QDHA 3PZMA 4Q4MA 1LRQA 3L4XA 1YQ2A 4R34A 4G9PA 4I9AA 3BLIA 5FF0A 3CAQA 3H4WA 1MRAA 1N2VA 3E0LA 4BR1A 2EO7A 3WMCA 3G1XA 3KRSA 4JYEA 5D4YA 1QK0A 5K7JA 2JIEA 4ZQOA 5HANA 3TNOA 1EEXA 3UY8A 3CQJA 1TZ9A 4IG2A 1VJSA 3TCEA 2OXNA 4JIQA 3ZR6A 1GG1A 1HKIA 2EEXA 3LMYA 2RUSA 3CS2A 1VHNA 4AZCB 4XAFA 5BOOA 1X1NA 3UZ5A 4BWLC 2Y1HA 1QI4A 2HMCA 1EA9C 3NEHA 1NF0A 2FFIA 2NT0A 4YVXA 3LU2A 3EX2A 3VNLA 4DWSA 1S3HA 4PMYA 1MUWA 3ZJ7A 3LK6A 3EMCA 1S5VA 5AYIA 4MLRA 2PEVA 3PNZA 4UOZA 3WSUA 2BOFX 1E0WA 3LQGA 4DPQA 1J10A 2A3LA 1W3KA 3R94A 2VOTA 4H01A 4HNCA 3W84A 3UYIA 3E3HA 1EJSC 3BLLA 4N9BA 3ZT7A 1J6OA 1T41A 3VMOA 1EPVA 4L7ZA 4XZNX 3OLDA 3TMQA 1FA2A 1YDOA 3BAWA 1T5AA 3WELA 3TLLA 3WLMA 5L9FA 3LGGA 4U5IA 1O7AA 1YBQA 1OY0A 2DT0A 2VZSA 3Q4DA 3RHGA 3DC8A 4EPEC 5KETA 3EXSA 2QDEA 1C9DA 3A47A 3T42A 3GXMA 3NSNA 4FR1A 2IPGA 5J8LA 3NQBA 1X39A 2E6FA 3HG5A 4AXKA 4IM4A 4LS2A 1GOWA 3HFYA 5ABTA 5IBXA 3GUWA 1J5SA 1W9PA 3W7IA 1XFBA 5CPNA 3TAOA 3ARVA 3BLPX 2FPYA 1AMKA 1EUAA 1KKRA 1X8FA 2QJJA 4A4AA 1W3HA 2QF8A 4AIBA 3GU1A 1OCJA 2XVLA 1POKA 4NZJA 1PHWA 4EOUA 3QJAA 3OPSA 2X30A 1UZHA 1AQMA 1CIUA 3MY9A 1F4HA 1T0OA 3H12A 1I6NA 1H3GA 4O8AA 1BTMA 5TBOA 1G6CA 1TV5A 4GUIA 1L6GA 3FY1A 3W26A 4ZOAA 3AOFA 1J0HA 4U3AA 4OOZA 1OSEA 3U8GA 3MKCA 4HPNA 1VFFA 2O9OA 1DWGM 3T4CA 2VVNA 1MDLA 1WDPA 1U1JA 3DOPA 1JPHA 3PY2A 4M3PA 3I3DA 1HO1A 5IHSA 4J7RA 4WXYA 3VOGA 2KZHA 4DZIA 3IJQA 1E6QM 1E6ZA 1ZALA 3PPHA 1YXDA 1OFPA 2VD9A 5HMEA 5C9ZA 3WZ0E 1I1XA 1WZKA 3WK1A 1YTKA 3LNPA 1H50A 3KOZA 3TYZA 2D2JA 1RBAA 3DYPA 4BEQA 1G0CA 4OWGA 4MJ2A 4L64A 3TDFA 1YPIA 1RLCL 3PJUA 3WNPA 1KRBC 1MNZA 1Q5MA 1RLDA 1S39A 2ZUMA 1S5NA 1H11A 3OP2A 1SFJA 2PBOA 2YFNA 3N04A 3THCA 3S2CA 2ZWYA 4AZCA 4M56A 2OT0A 3V36A 4RJEA 3TOPA 1LG2A 4CU8A 3W7JA 3URBA 4DF1A 4MUPA 3DI0A 3VIKA 4P7QA 1K8CA 1EQPA 2GQAA 3AICA 3FKRA 1KFLA 1SYTA 3WLTA 4O1FA 2G37A 1HVQA 5D09A 3QLLA 3TV8A 4JIHA 3BMVA 1IR2A 4M0XA 4R85A 2DPEA 4PCNA 4PBGA 4IPNB 3WNMA 3AWNA 2A5HA 2VCCA 3WNKA 1OFBA 1X7FA 3H23A 2DDXA 2QJMA 3W7OA 4PB3A 1P43A 2QV4A 3K46A 1AVAA 2BB0A 1NM9A 1V6TA 1YTEA 3I65A 4I6VA 4ZVJA 3LZ3A 1A5OC 3NL6A 3WQPA 1TA3A 2X0SA 4QM1A 1T96A 4YIWA 3GVVA 1VLWA 5CQ1A 3WDJA 3SFKA 1MRQA 4WCJA 1TELA 4UTLA 3ISIX 4MB4A 3IWPA 3DESA 2OGJA 2I56A 4JQ1A 3KW3A 5CSRA 4XBKA 4HZMA 3GX9A 2HK0A 3MV11 3DUGA 2PRHA 2PI6A 3MJMA 1TWDA 1QMLA 2Y6ZA 7REQB 2PC4A 2GQ9A 1YXCA 1YMYA 4IFOA 4YTTA 2QAPA 3CLWA 2VQTA 3W9ZA 3PTMA 1SU5A 4Y90A 5EMLA 2FHFA 1CLVA 4D6FA 5IOBA 3ZZ1A 2BXVA 4RZ4A 4F9JA 3ANVA 2E7FA 4WF7A 4Q8WA 5A8QA 2DVXA 2GQ3A 3ELFA 5JBFA 2CZ5A 3GH7A 2GOKA 1V4YA 3L5AA 3MUAA 1WPCA 1MMFA 4PUDA 3ONCA 3V75A 4CD6A 3BE7A 5AKQA 2WZMA 4D6GA 1IHIA 4IQEA 2QW5A 1EYEA 1W1IE 3RUBL 1ITQA 4H8NA 1QW8A 4CN1A 2PZNA 2JE8A 5U4NA 3UR5A 1O5RA 1Y5WA 3N4AA 5A8GA 3M5XA 3QR3A 3W22A 2QJGA 3P60A 2ACQA 2HJPA 3KBSA 3OEXA 1PKNA 4YHEA 3M7SA 5XIMA 1JXKA 1W3TA 3TVAA 2VX5A 3MPGA 4PTVA 1V0LA 3RNDA 5F4XA 5FEPA 3UCDA 3P8JA 4PMNA 4RDYA 3QHNA 3IEBA 4CU7A 2XFRA 4U31A 2F9RA 2NV2A 2ZZ6A 4NU7A 4DM2A 5K9CA 4S1FA 1VZWA 2VELA 4UFKA 3UJRA 4W7UA 3GUGA 4QROA 2EKGA 1FWGC 2PWUA 3QPZA 3GVRA 9RUBA 1MW2A 2WXDM 4W7WA 4Q32A 2UY3A 4F3HA 3SM0A 2FKPA 4QHRA 3LLDA 1Z44A 4J1OA 3RLUA 3HQ1A 1VFHA 1BAGA 2PS2A 4DJDD 4S3GA 4XAGA 4Q4OA 3L4YA 2AQVA 3VINA 2EPHA 3F2DA 3T78A 1M03A 4L6OA 4H3DA 1EIBA 1SW3A 4KQNA 3BO9A 3RCMA 3LUTA 2CHNA 1LBLA 4LAMA 1EOKA 5E0KA 1H5VA 2VDHA 4OUEA 5K4ZA 4MKNA 3FHQA 3CIWA 1VEPA 1F4AA 4JFTA 3GWQA 2PP0A 2QGYA 1JGIA 4GNVA 2DW7A 1FUYA 2YLLA 2XFWA 3E5BA 3MANA 3OO2A 1DV7A 2G3NA 2QXWA 3A3HA 3PB0A 3FXGA 3DBPA 1TTJA 3V1HA 2QPSA 4IIGA 5FOOA 4JQ4A 5I5RA 2HRWA 2HCVA 3TNBA 4JFUA 3AIUA 1C93A 1J11A 1X6UA 4X61A 2BVTA 2P3ZA 2BDQA 2ZA2A 2AAMA 5AYZA 3OGRA 3S42A 3H7RA 3TR9A 1EQCA 1UWRA 4P8WA 1DJWA 3VM7A 3UETA 3E0WA 3JW7A 1D7FA 7REQA 2A3AA 5G5IA 1L6WA 1AK5A 1OQFA 3FEMA 4E0CA 1NDYA 3B03A 3GSMA 4I8YA 2Z6IA 1XICA 4BQ4A 2I5QA 5BNKA 1W6TA 5I24A 2QCHA 1F3WA 1XLMA 2OMAA 4MB1A 3N14A 1SSGA 4MY9A 1PAMA 3GTNA 1N55A 1V77A 3H2MA 4HK7A 3SQSA 5J5DA 5JBDA 4LBUA 4LU0A 3MYPA 4Y7EA 4JQAA 2CZFA 4RDZA 5T8GA 3SGZA 3UWWA 4PMZA 3UG5A 1E15A 4LJ3A 3R6IA 2VR4A 1P0NA 1MZHA 1FWNA 4AMCA 2D20A 4DJDA 4LAOA 1DL3A 1TIMA 2P8BA 4I5XA 1H7NA 5C71A 1GTEA 1TJRA 3B4YA 3W7PA 1D3CA 4MKVA 4TX8A 4LCSA 1OFRA 3M4HA 1QW9A 3AIBA 1JZ3A 3P62A 3TWAA 4D6JA 5C5YA 2O7SA 1XBXA 1U83A 3RRXA 3MBDA 4HOWA 2J7BA 1SZNA 4LGXA 3NQEA 1F61A 3FA4A 1EXPA 1UWTA 4WY0B 1ISYA 4AEEA 4AC7C 1ZS2A 4X3ZA 1SR9A 1QNQA 5AHLA 2OX4A 1R3SA 1AJ2A 3XINA 3ATZA 4NZ3A 1NAL1 3HPZA 1F6KA 2OYMA 6XIAA 3LRLA 2FZMA 3FOKA 3MS8A 2A4AA 3B9DA 1UKPA 3TTEA 3O16A 2W4XA 3DFSA 3POCA 4JY8A 3EWBX 3ZIZA 1XYBA 1BYAA 2A1YA 4IMEA 4TVDA 1YNYA 4LANA 5AHNA 1TZ7A 2DT2A 3COTA 3BANA 5EMKA 4QEEA 3CZLA 3DCPA 2BVWA 3BSMA 4LALA 4HOZA 3EZ4A 1V6UA 4RE2A 3P61A 1AZ2A 3A24A 1OIFA 1K9TA 1PXGA 4RE0A 3KP0A 4Z42C 1TVPA 4TV5A 5C9WA 3W00A 1HJQA 4CKQA 3VKBA 4BQ3A 3ZVHB 4AQLA 2JKPA 2WZTA 3Q2DA 4O12A 4AB4A 5E70A 4GJ1A 5G2WA 2IPFA 4HTYA 4NQ1A 4O18A 5BYWA 3VDCA 4C5ZA 3TTQA 4UUIA 3UESA 2W66A 5A8PA 3VNKA 1FWHC 2JQXA 5AVHA 2GGIA 1QXLA 4JTAA 4GI8A 2POZA 2O9PA 1CGUA 3FXYA 4LVGA 1W8GA 1Y0EA 5GJMA 4H6QA 3TIMA 1LM1A 4HK5A 1TVLA 1SJCA 1OT2A 5H91A 1Q13A 3S6DA 2HK1A 3HQPA 4QAIA 2WC7A 3Q65A 4NJKA 5BWAA 1XXXA 2J8GA 1WZLA 2H3DA 5D9NA 1KCZA 3W1PA 3UZJA 2PTYA 2IKGA 3WMLA 4K8GA 4PMXA 1YPXA 2W9MA 3G18A 5FI8A 4GI6A 4V28A 4WJ8A 4AVFA 3EB3A 2X1SA 4L5ZA 3MJYA 1B5TA 1JDEA 1TV7A 2NXHA 2X1RA 3EGJA 3ENLA 1VIZA 1W1B1 3M7WA 3PFMA 1IF2A 2Z7KA 2Y7EA 3VNYA 1W1ZA 3MVIA 1S5TA 3MO7A 1VF8A 3WJSA 4E8DA 2BGSA 4YNGA 3M0JA 4WXZA 3L4TA 3LPFA 4MJZA 3BURA 4PSRA 2E9LA 2WHLA 3UR2A 3WQ6A 3E9AA 3VGHA 1HL8A 4ENLA 3SO7A 1Q6EA 3KRUA 3NSXA 1QI0A 2NQJA 2UZ9A 2X40A 2ACSA 1XDLA 2GJPA 4WDTA 3WEOA 4Q22A 4O4WA 1P6WA 3NJ3A 5CPMA 1FWIC 2PDQA 1KFCA 2RDWA 2YBTA 1J0KA 2OO6A 4WY0A 1SZEA 2VR5A 4XZLX 1BKHA 1PIFA 1QNOA 4LUYA 4C6EA 2J27A 4DELA 2AQOA 3QQ1A 3UR8A 2G3IA 4XSLA 2J78A 1DIKA 3KWSA 2XN1A 3W7GA 1DJXA 1VYSX 4IMCA 1JCTA 3AS2A 4G5DA 5GQBA 4ADTA 5DANA 1UKQA 1BG9A 2CLLA 3V5FA 2ABAA 3WF3A 1ZAJA 3U6WA 1KO0A 1U5HA 3C86A 3ABQA 4GYPA 3QXBA 1K70A 2JKAA 1SJBA 2V8ZA 1MO0A 1NARA 1RPKA 1KNWA 1HGWA 3RO6A 3TQVA 3FX4A 1PO9A 4PULA 3KVMA 3T8LA 3BQ6A 4JKMA 4HNUA 1MYRA 3GHUA 1LDCA 2PD5A 1DJHA 1DTNA 4UZSA 3G8EA 3QZ6A 5DLCA 1PYMA 2NSOA 2PA6A 4IIFA 5KTLA 4QJ4B 4WVXA 3A23A 3DU0A 4ZB5A 1VGAA 3ZVHA 1UH3A 4YVVA 3PUGA 5FAGA 3M46A 4QCEA 3VGGA 3VUPA 3P74A 2QCEA 1W1TA 1M01A 1FFRA 4MDOA 5BXTA 4OV9A 3S2JA 3L2LA 4IT1A 5D38A 4X9YA 4XB3A 4KS0A 4RE3A 4KFOA 3M0HA 3NZQA 1EJUC 4J3VA 1OD0A 4HHHA 3M9YA 3NPVA 1OGSA 4QJ3B 1Q7ZA 1RV8A 1JDAA 1T8XA 4OBSA 1E71M 4B9YA 3RMEA 3E2SA 1YPFA 1OD8A 2PF8A 1LOQA 4AZHA 2V68A 3FAWA 2RHGA 2WSKA 2YXOA 3M64A 2EXOA 5CCZA 3NSMA 1E3XA 4W7VA 1Z89A 3PSWA 1FHUA 1FWWA 1Y5VA 1WBJA 1RJQA 4NIRA 2C1GA 4UC5A 3OVQA 4XBSA 3TE9A 1Z41A 1R9XA 3C0QA 2I16A 3P0XA 4JYFA 2YKKA 4D8AA 3WH6A 4W4QA 3R8RA 3TYEA 3BWWA 1YE4A 3W74A 3WNOA 2DVUA 1KCLA 3W6YA 4IOTA 4OOUA 5LGZA 1H60A 1JI1A 3DFNA 4QSFA 3ES8A 2VT0A 3CYJA 2BX7A 4S3DA 4XK2A 1NFPA 2C19A 2J62A 3RO8A 2GSJA 3W3OA 2F6KA 4GACA 2DSVA 3PBUA 2MANA 2DH2A 1G5AA 4UTIA 2QMJA 1WKFA 4GXPA 4UB9A 5TAOA 3SSJA 1B3YA 1K7EA 3JR2A 5KZEA 3CZ8A 4JFSA 3ZSSA 3SJ3A 4RCXA 4CQ9A 2BY3A 4Q7NA 4Y2WA 1DKWA 4XX6A 3N6HA 4GUGA 1E4NA 4Q7IA 1QDSA 1VJZA 5JMUA 4DJFC 1XDJA 2NWRA 5AOUA 4F2TA 4DX3A 3AU2A 3VIMA 4S23A 3VKDA 3VM5A 2CU0A 2Q71A 1NSJA 1US0A 3NIYA 5IM51 1TPVA 4PGLA 3AQUA 3B8DA 4YMZA 3KTSA 3IIVA 3VD9A 3QOMA 4K38A 1BEUA 2INFA 4CLMA 2WVVB 2V5CA 1E0UA 1QWGA 4PB4A 3R89A 4CUCA 2VDIA 2I17A 1V6XA 2H8XA 3OQEA 1LL6A 1JZ6A 2ZRYA 4BS0A 3A5FA 3F5JA 4R7JA 1QNVA 3O6DA 3FDKA 2V67A 3KL0A 3SCWA 2JGYA 1P6BA 3T0TA 4JNYA 1PZ0A 4LYRA 1R9ZA 3KL5A 3NXLA 1C29A 4E2VA 3W27A 3MKVA 2P8CA 2VENA 3D6NA 4ERGA 2PPGA 3LOTA 2WK2A 4MM1A 1JZ4A 3PTQA 4WGHA 4ECLA 3LQLA 4Y9AA 4Q4SA 5D2YA 5CBJA 2IS7A 2ZRVA 1EYWA 1SZFA 1IEWA 4BFAA 3MO4A 2PUZA 2ZX6A 1W5OA 4JS3A 3W02A 1HJXA 3S5SA 2WB5A 5AN7A 4C6PA 1WXYA 3E38A 4X2RA 1LZOA 4PMUA 3WIJA 4ERIA 3VOFA 1AW5A 4B5WA 3EWCA 5C9UA 1W3LA 3AYTA 1OCBA 3PR2A 4BK9A 4DJEC 3WJWA 1XLJA 1XYCA 1W5MA 3LCXA 5A8MA 1OC7A 2NXGA 2V82A 1FDJA 3IIPA 4E38A 2X41A 2NSXA 3FDGA 4PODA 1VAHA 1EP1A 4HYRA 4D1JA 3RILA 1E4LA 4PBEA 4G6CA 1YEYA 5HK4A 4QE1A 3GY1A 1KBIA 2BY0A 2W6RA 1QCWA 2FTYA 3LPOA 2VC5A 3FVMA 3FSUA 1RVKA 1OC5A 2A3CA 1R5YA 2Q09A 5EU9A 3AMLA 1J0ZA 4IZGA 2P3EA 3AS3A 3SIZA 4IMDA 5C54A 5I79A 4OFCA 3C4UA 4IGMA 3IGHX 3GDRA 1ZTVA 3EEGA 1CYGA 3S9YA 1RP8A 4UQEA 1NH6A 4IL0A 3EWYA 3CLMA 2D0HA 4GC3A 3SY8A 3JU2A 2DZXA 2X1TA 9XIAA 2WW5A 3SGUA 4DEFA 3NYZA 5ABFB 2EPOA 3GZAA 3NL3A 4OT7A 2WNZA 2XVKA 3LHUA 3WQ8A 4GKTA 3A4AA 2O4QA 3QKEA 3VI2A 4FSAA 5F7UA 4GISA 3VGDA 6A3HA 4N7QA 1XP3A 4M24A 1LRNA 1XCFA 4WSJA 2DZUA 4QP0A 2XISA 2FB3A 3MUXA 3PWIA 3TXZA 4LW7A 1Q85A 3SFWA 4MPKA 4S3KA 4W86A 1VS1A 1RHCA 2Z24A 3CTTA 2E3ZA 4AHPA 3MUY1 3WD2A 2WCSA 1TR1A 5HNNA 4H4IA 1LLOA 1GW9A 2PGRA 1IZJA 5G1YA 1I75A 4OIFA 1XQKA 4LUJA 1FVPA 3BDKA 4NG3A 4A3HA 3SUVA 3WLQA 1QT1A 1XIDA 4ML4A 1TZZA 2X42A 4LY8A 3ARZA 2W3ZA 2WVVA 1QBBA 3LRMA 2G4JA 3ZXWA 3KP1A 1ZJAA 5I3HA 5G1MA 1I0DA 3I7QA 1LCOA 4I6KA 5DCDA 1AA1B 2DORA 4YTRA 3UR7A 2JALA 3LTYA 3B97A 1VJIA 2OQHA 1JDFA 2WO5A 3LHWA 3ES7A 1Q8AA 1ME8A 3D47A 3OZMA 2DEPA 1MW1A 4WQ6A 2GL5A 1EC7A 1B4KA 3IANA 3UXAA 3GVQA 2Y8KA 3HJEA 4Q4PA 3WNNA 4J2MA 3FFSA 4CCDA 5G1TA 3OQ8A 4AW7A 1AODA 5HNUA 4UTTC 1WO2A 3KOFA 4QS5A 1Z8AA 1A53A 1ML1A 4FXJA 3EAUA 2Y5EA 1XLDA 4JTSA 5ECUA 1DJZA 3TQPA 4GXWA 4LAKA 5GVJA 3DH7A 5HUOA 2EJ1A 4KESA 3CHVA 1K7XA 3R0UA 1S2AA 3TYUA 2J74A 4JTEA 1L2QA 4LAUA 3W85A 5DF0A 4LB3A 4FXRA 1MEIA 3PBYA 3WYZA 1EBHA 4Q8QA 2Y8VA 2RDUA 2XWDA 3CL6A 1KXHA 2RDXA 1A3WA 4CNUA 2VZVA 3VNJA 3AJXA 1SR0A 2J66A 5GNYA 3U4AA 2OEMA 1TCMA 4HNTA 3WQ5A 2DZTA 2QYGA 1CGVA 4A22A 5C7HA 1SMDA 3PBGA 1E43A 3W1MA 3GVGA 1SO3A 1XKJA 1Q6CA 4QEHA 7ENLA 1ADOA 4Y6GA 4TTGA 4DB7A 2CHRA 3HGSA 2HVNA 4Y9OA 2P53A 3CUJA 2C6QA 4XZBA 4PR4A 1RA5A 1JZ8A 4W9TA 1OX4A 1XRVA 1YTDA 4ZO7A 2BXYA 3AIRA 4UFHA 1HN1A 2OWCA 4Q3MA 2HPMA 1H7RA 3NQMA 3TONA 5ABFA 1QVBA 3D3AA 3RIKA 3EDEA 3CM4A 4IGSA 4O14A 4L1XA 1POJA 2NLIA 3NPUA 5HDRA 5EA9A 1XRFA 2ZFAA 3G0XA 2WMHA 3AMKA 6ALDA 2Y7DA 5CH9A 1X7IA 2ACUA 1B4EA 3MHUA 3D0CA 1EC8A 1JPMA 1ONWA 4UMCA 1RQBA 1RH9A 5HA7A 2YB1A 1DBTA 4O8RA 3JZUA 2IXVA 3VMNA 4PA8A 4JX6A 3ALGA 3O8AA 2J7FA 4AHQA 3VZXA 1MQRA 1C8XA 2E1WA 3O63A 3VGEA 4F40A 1J2BA 2XH2A 1Y8BA 3FVDA 1KRCC 2BGQA 1AMYA 1SJAA 2YJQA 4O1AA 1DE6A 3MI2A 4YWSA 5G2IA 3BGJA 2QR6A 4YTSA 4PMVA 5D9PA 1XIBA 1NOUA 4JQ3A 3N19B 3MBFA 3USBA 5AHEA 4S3CA 1ZLPA 3WQ4A 5FF7A 3RFAA 3CUZA 3EKZA 3HA1A 3W28A 4DYKA 1ZBKA 1GVFA 1UMYA 2QT3A 1NP0A 1YNQA 1OYAA 1W37A 1SJDA 2VZUA 3VFCA 2AGKA 2OX1A 5E0FA 1SVDA 7XIMA 5LHEA 1CGYA 1A5SA 3GG0A 3W23A 1UWAA 4LPCA 1J6PA 1NDVA 3BV7A 4JPGA 4GX8A 1E6SM 3NURA 3THUA 2YDAA 1G9HA 1TUXA 1UUMA 3BC9A 2PDGA 1GGOA 3EMQA 4HN8A 1TWWA 1DIEA 1R38A 3PZ9A 3NQGA 3I4KA 3A3XA 2HXTA 3OGVA 5D03A 1GQNA 2HNEA 4DRSA 3EDJA 4L4PA 4MWAE 4UTWA 3RG6A 3O0FA 4MY8A 3T81A 4BKNA 1W5QA 1UPPA 3N13A 1E6RA 1UWSA 2WLYA 1A5AA 2YXXA 3IJIA 4A05A 3I6EA 4FK9A 1H7PA 3AS0A 1EGZA 4HCDA 4MF4A 5HPCA 3WLIA 1DPMA 4PTXA 2WQPA 3FKKA 4L61A 1GVEA 1JPIA 3RAOA 1IR1A 3V35A 1M7JA 2VO5A 5J04A 2C14A 1TWZA 2VD8A 4DI9A 3AI0A 5TNVA 1SZRA 2A7RA 1DXFA 2XIJA 2VRQA 2FZBA 2R1PA 1RPXA 4LUSA 4J3XA 3UWYA 1D7KA 4XO7A 5C55A 4IJRA 1VBJA 4L56A 1FWAC 1EJ7L 2CW6A 4AEFA 2VX4A 4GBDA 4FA3A 3PAJA 3S83A 3KOYA 1A5UA 1H09A 1UG6A 3AHTA 3VCCA 3UZYA 2CFFA 3MI6A 4XD6A 3M44A 4CQBA 3N6QA 3BG3A 3W88A 3SZ8A 1CXLA 3CIVA 4JYDA 3EPOA 1TQJA 4RDVA 4FXSA 5ENLA 1UR0A 4AD5A 5LIXX 5CBIA 1A0CA 1I2QA 3VDBA 3QPYA 4WR3A 2DZPA 3L21A 1PKMA 3NDZA 3G22A 2A3HA 3MHFA 3UNTA 3XISA 4MTVA 3ZLFA 1O5KA 1LRTA 1TTPA 2G3JA 2PBGA 2XSBA 4X0VA 1C91A 4GBUA 2BSLA 3BAKA 4XKYB 2G50A 4GVHA 2P50A 1G4TA 3P6LA 3CH0A 4B2DD 1JF5A 4N02A 2CBVA 4K3ZA 2PDXA 4CNPA 2VEKA 4LRSA 3IUDA 1RQHA 6TIMA 1QO5A 4CVWA 4O0KA 3WMSA 5H6HA 2ZKMX 3S8HA 4RV3A 4MWAB 1ZSXA 2FVLA 3CAVA 4KCUA 3M5VA 2JBMA 4N0RA 3CIXA 1Q65A 4QLKA 4GQBA 4DXKA 5BRPA 1QPOA 4ZBCA 3VABA 3N2OA 3S1GA 3GG7A 3QRHA 4O13A 3QY8A 3QGVA 4PYSA 2NQ5A 1H1NA 3PSVA 1F2JA 4PMOA 2QIIA 4XIAA 2CBIA 1GOMA 2HROA 1H41A 4DAFA 1W31A 2J79A 4JKKA 4GZIA 4X63A 2E9MA 4E2BA 5FESA 3LHVA 4WSKA 1AD1A 1Q2RA 1EHAA 1BYDA 1KWGA 2B7PA 3H2OA 4MB3A 2ZZ4A 1ZB5A 4KWOA 2TSYA 4MMWA 3L12A 3WN6A 1SO5A 3RX3A 4EKJA 1V0NA 4NJJA 3RCNA 1EFZA 1Z6KA 1E1CB 5AHMA 1C7SA 3V7PA 4QAWA 3LS9A 3CAKA 2WHJA 2ZRZA 3F4NA 1B90A 1ZP3A 4Y96A 2ZA1A 4YTUA 1GOKA 5DXXA 4OGZA 2G3MA 1HNYA 4OQVA 3AZSA 2ADAA 4GI9A 1N8WA 1V03A 4LYKA 3LENA 3HPXA 1I60A 4MWAD 4UR8A 2D0GA 4JN6A 2VNCA 4UFIA 4INFA 3WO8A 1TX0A 1J0IA 3K5XA 5IDIA 3IPWA 1EGVA 4KFPA 4JX5A 3GIQA 3IUIA 3MP3A 4ZQCA 1RXOB 1K9FA 1SM9A 4AG0A 4H9XA 3TR2A 1TIWA 2EPNA 4B2DA 3L9CA 4UIOA 5EBAA 3A3WA 1XRSA 2A79A 4O0ZA 2CBUA 5HBFA 4FIQA 4C60A 3W87A 4PSPA 1VFTA 2BY2A 4WY0F 3S47A 4EP8C 1PDZA 3WLLA 1RY0A 4MADA 3C2EA 4ACZB 7CGTA 4JR5A 4JAWA 1PJ9A 4TIMA 3O1NA 2W0UA 4Q8OA 4XISA 4MYAA 1Q6DA 1YNPA 1XGDA 2YA0A 4PFMA 3LDVA 5CPSA 1TKKA 2PDHA 4GZEA 4Q8PA 2Y63A 5I3FA 2D2OA 2CLFA 3KBWA 3GW3A 3L0GA 3SAZA 3S5NA 3UGVA 2QMKA 2P1FA 3DECA 1E0XA 1LWHA 4NJIA 5I3KA 3C2VA 2Z1WA 1NOFA 2Z4GA 5BZAA 1US2A 3DGRA 1KBBA 4HNVA 2GDVA 4UTFA 5E09A 5DT5A 1YW1A 4LBSA 2WMIA 5CGQA 2YPIA 2GGGA 4RL3A 1HJSA 4AISA 3M16A 2C91A 1XLLA 3A13A 2INZA 3FA3A 4XKYA 3GB6A 1A5LC 3EWDA 1KLZA 5MKGB 4W8LA 3FCPA 1F9CA 3AC0A 3DERA 4TV6A 3E74A 4BY3A 3G5EA 5D2TA 1A0EA 2RDTA 4GK8A 1TJ1A 1KM2A 4YTQA 3STGA 4G1NA 4LNYA 2ISFA 4MWAA 4C90A 3J7HA 1X6NA 4S3AA 1RK6A 3NGJA 4LX4A 5A6TC 3VMPA 3GDBA 2ZDRA 1F8IA 4TVCA 2PDPA 4DBDA 3DHUA 2JF6A 5CZJA 5C2GA 4JX4A 1XLBA 3GNOA 4AZ6A 3P80A 3WLKX 5LIWX 4E4FA 5I07A 1TMLA 4BQ5A 3DKJA 2J77A 3PULA 5I00A 1EF2A 3H6OA 4XG1A 2VEPA 3QTPA 4CD7A 1DEDA 1IT8A 3RRAA 1S1RA 3WH5A 3FK4A 3RM8A 3S1XA 4MY1A 4NNCA 1P5BA 1PUDA 1Q6RA 5CC6A 2YBVA 1Q6OA 4AC1X 5T9CE 3WQOA 3PJTA 4ZFMA 3UEQA 1SMAA 3OYXA 4JBRA 4GC4A 2LLEA 3N11A 4W5UA 3W7RA 3D3FA 1E1CA 1MUMA 3S4TA 1KM6A 5G4WA 3WCZA 1WKYA 4W89A 2V3FA 3P67A 1VFUA 3WH7A 4Y9PA 1AQ0A 3V3WA 2OT1A 2IKIA 5D02A 4JTIA 4B15A 3LTPA 2PWDA 4NF7A 4ZB2A 3T0CA 2WJFA 1XUUA 2PDFA 4P2VA 3B0VC 3A6OA 3WF1A 2DZWA 4GQQA 3LV6A 4GVGA 4Z08A 3EOLA 3DFQA 2WC4A 1TPC1 5A3HA 4MNJA 3G3MA 4CCZA 4N9DA 2OJPA 4XZIA 4Q7BA 4LCQA 3UF9A 1KFWA 1QI5A 3HPSA 4HB7A 3L4VA 1KD0A 2QV5A 4OBTA 3RPDA 3BH4A 2V2HA 3CAWA 1SPQA 3R79A 2Z1BA 1VFLA 4HZ6A 3PNUA 5FEWA 3TC3A 4B5VA 3FW6A 4I5RA 1SO6A 4C6BA 4M8UA 2ZQ0A 1R85A 2ONEA 2VFGA 2V6AA 2X1IA 7PTDA 1BGGA 3L4UA 2QCNA 1TTQA 4ML9A 2HVOA 3PF3A 3DKLA 1EF3A 1UD8A 4NL1A 4ONVA 4A3YA 1RSCA 3QF0A 4C7FA 2HBVA 1CCWB 4NRRA 4P7NA 4P7OA 2ZICA 4JHZA 4O11A 3VVGA 3WL0A 4A2SA 1G01A 2J88A 3W2LA 1U2YA 5K3VA 2Y89A 2C8NA 3EB4A 4DBWA 1UCWA 1A4LA 2XPKA 2CLIA 3GW0A 4CD8A 3QC3A 4DM1A 4HGXA 3NQ6A 2O55A 3AIWA 4G7EB 3SJNA 3GNRA 4GCAA 3GK0A 3TROA 3KL3A 2GVEA 2NZLA 4BJHA 1SW0A 5G4HC 3M47A 1NQKA 1E6XM 5I3GA 3DHPA 4ICMA 4RZ6A 1TR9A 1TV2A 3W1TA 1QPKA 1SGJA 3UZWA 2A6NA 1VPYA 1CECA 1TJ0A 5AVNA 2FGZA 3TN6A 4CCEA 3ANYA 2ZUWA 2VC9A 4OZOA 4QLJA 4OVXA 4HJWA 5A6MA 1XLFA 3U7VA 4AWSA 1ALDA 3CNYA 1UQZA 4L9YA 3M07A 3HIJA 4RZBA 4JTFA 1XC4A 2OOGA 3CL7A 3QY7A 1P0KA 4AVNA 3R43A 5BOEA 2R1NA 1QWKA 2HSAA 5RUBA 1ISZA 2W27A 4RNFA 3AYSA 1TFVA 3BJTA 4C5YA 3N15A 2XTKA 4O1CA 1JCXA 4M1BA 5GJPA 4UQAA 5HWMA 1LOLA 3PFRA 3W71A 3SADA 1SQ7A 3LRKA 4NZFA 5T9BG 1R86A 3KCOA 4HSOA 4A8NA 4WEVX 1A5MC 3CL8A 1CI1A 2GUBA 1TPFA 2Z2BA 4W84A 5CJNA 4LRTA 3WBYA 3APGA 1UD6A 1XIJA 3GG8A 3WEZA 4AIOA 3BZGA 4O54A 4FS9A 3WH8A 2CPUA 2VX6A 1F5ZA 1WDQA 3PTKA 3PZQA 1Q3NA 1XISA 2HISA 4PCSA 3VIGA 2RJHA 1PZ3A 3IVSA 4HYWA 3EWWA 3HQNA 2PP3A 4Z2KA 1AW1A 3B9EA 1B9BA 4Z1BA 1U33A 3WFZA 4M7SA 3EOOA 2YL8A 5C70A 3R58A 5LNVA 3MZ2A 3O6CA 3W0KA 3W6MA 5CGMA 1V3HA 1JFHA 5BRQA 4NASA 3R12A 3UXLA 1I45A 3OBKA 2Y4SA 2E5CA 1NF7A 4JFWA 5BU9A 3N29A 2FH6A 3PUDA 1IEXA 1M5WA 3M0ZA 3N2XA 3AIEA 3BTNA 2XH7A 4ZGYA 3TTOA 4K39A 1O68A 1B3ZA 1X6LA 3T2OA 2TPSA 2R1KA 5D9MA 4RLIA 4M7TA 3TUUA 4FI4A 4NSBA 1UR3M 3N73A 1Y7VA 1V93A 3FYPA 4PRWA 4HN4A 3MW7A 1AJ0A 2IPWA 2QZRA 3K8KA 1XKYA 1CBGA 3OVGA 2PWEA 4LWWA 1XRTA 1DXEA 1KWKA 3GDMA 5HAOA 3WLHA 1N7KA 2J6XA 1RR2A 1KC7A 2C79A 4L1GA 5MF5A 1PZ1A 5LIUX 1OM0A 4MOZA 5HWNA 3LI0A 1WBHA 3MWCA 1KBJA 2V5BA 1BQGA 3WQDA 2WHMA 3OGSA 2H6RA 2DH3A 3ITOA 4F0SA 5M5DA 3A64A 3GZ3A 4LNCA 4HU3A 3MMDA 1DWIM 1QNPA 3SY1A 4BI6A 2XVPA 5HJLA 3NEVA 4C6KA 1I9CB 4G7EA 4HU4A 4LEFA 2D24A 2WCGA 2AL2B 4GE8A 3DYMA 1M65A 3GO2A 3IRDA 4ZE4A 4C6CA 4KEMA 2GJXB 1VRDA 4B5UA 1FWEC 3W01A 3GE7A 4WKFA 3AYVA 4JTKA 2ZTKA 4FOUA 4IG2B 3U57A 3AALA 3ZOAA 3GC5A 4LUTA 4N9CA 3HV9A 4OBRA 2OELA 1H49A 1ICPA 2ZZ2A 5B7YA 4KCVA 1KB3A 5F2GA 3WQWA 2YA2A 1YHTA 2ATMA 4O53A 1UA3A 1PS9A 4H83A 5E1QA 2NQ9A 2W5FA 4RV8A 4P7LA 1HG3A 1Q6GA 2DW6A 3EDKA 1AH3A 3RXZA 3SIMA 3LXBA 4HYVA 1RY8A 1JRCA 3MI3A 3IACA 1CXIA 5AC5A 1M04A 3T6CA 2NV1A 3FEQA 3A9IA 5HULA 4D1IA 3NVDA 1FFQA 3RJXA 1NP2A 1QATA 1S46A 1W1PA 1LTDA 2YW4A 3FNDA 1NOWA 3WDRA 3SCNA 1LLWA 2KX9A 5AHFA 4FNRA 5EB8A 1LL7A 4DY1A 4AXNA 1Q4WA 4NVTA 1L0PA 8XIAA 3IJLA 1VFOA 3KHDA 4WGXA 4YS1A 3F2BA 2I1OA 1IIHA 4GINA 1B57A 1F07A 1RQEA 4AU0A 5I78A 2PGFA 2X7VA 2R14A 4QISA 1FH9A 4PTDA 4QNEA 2G97A 4J9JA 2ZXBA 3CZKA 3GD6A 1XC6A 3QN3A 3LHTA 3G1RA 4MJMA 1S5WA 1UUOA 3B3DA 1Q4NX 1V6WA 3H70A 1YE6A 4BF7A 2C15A 2WNNA 2XDFA 2E67A 4GVFA 4QS6A 4NUWA 2VMFA 2XHYA 1JCLA 3SRHA 2QUTA 4FLRA 2CETA 2Z1VA 4K2SA 2V3DA 5A95A 3GBDA 4IGNA 3QW4B 4TR9A 2QGHA 4E6MA 3WDIA 1EDTA 1QNRA 3MQTA 1HQTA 5HOSA 3SCPA 1K7FA 2BGNE 3GXIA 3WJZA 3DC0A 4DUWA 3TJLA 1ZGDA 4N9EA 1GZGA 4H41A 1EJWC 1OX6A 3EWUA 4G56A 1HJVA 1JG9A 1GEQA 3IK2A 5A94A 4UCFA 1IEIA 2WKJA 3TWBA 5HNRA 4Z1DA 2XWEA 1FQ0A 4XD3A 1OFQA 4ZR8A 3KM8A 2Z27A 1EJVC 5FF3A 1PB0A 1OX5A 3BARA 1TV3A 3PVFA 2XFYA 3DAQA 2EG7A 4W88A 1AL7A 4IGHA 3W1LA 1FBAA 1FTXA 3ME3A 5A2CA 3QH2A 5AZ1A 3RU6A 1E6NA 4EAMA 2ALDA 3MSYA 4EF9A 3GNDA 2XU2A 1W2VA 1XBYA 2QKFA 2E25A 1PCKA 3L0KA 2DZVA 1GPWA 1HT6A 3RITA 4JEJA 3IK4A 3CB8A 5HQMA 1Q63A 3W7LA 1XPGA 3RCYA 2ANUA 5FJTA 2AL2A 2YYTA 2WBGA 5EKYA 3O07A 3GBEA 3O2LA 2ZUNA 4C7GA 3DI1A 2GJXA 1AG1O 1LQAA 1L8PA 1NFBA 1AFSA 2TAAA 3NZPA 4ATDA 1J2WA 2QCFA 3PAOA 3RU8X 2GSHA 4J40A 4J3WA 5EL1A 2OKTA 3U7BA 1K8XA 2H9AA 4NYUA 5A69A 1X1ZA 2WJZA 4NY2A 3L66A 4P5UA 1V0MA 4A3UA 4CQ8A 4H8VA 3LCWA 4X60A 3G0SA 3GC4A 5A5WA 2XSAA 4QTGA 3UYCA 2PP1A 1XIIA 1ZRQA 3GC2A 2QULA 3ATYA 2V38A 4JDYA 4V15A 1J18A 1AUSL 3VKAA 2VTFA 3NOEA 5LA1A 1E9LA 2XGZA 1M41A 3NZGA 1EO7A 1PTGA 2WNQA 4J3TA 2O4MA 3ARXA 4UBPC 2WZIA 3FN9A 1WOBA 4U2YA 3T2QA 3H26A 3N12A 5A6SA 1XD1A 1G67A 6PTDA 5DMNA 3ARTA 2PODA 3VZZA 1M6JA 5H8MA 2F6UA 3M0YA 4P8VA 3AMGA 2V9DA 4NJHA 1A5KC 3PG9A 2GLKA 2ZX7A 1DQUA 5I7GA 8RUCA 2WMJA 3AZTA 4IQJA 2ACRA 1S2VA 1KTNA 2GPTA 3DHDA 2W67A 3AIQA 1TA3B 3VNDA 1KV5A 2QLYA 3DHFA 3O06A 1VEMA 2RGMA 1JD9A 3URQA 4ZO6A 2NX1A 4KCTA 1XH1A 4JZ5A 3GIYA 1JYXA 1D9EA 2TMDA 3BXWA 4ZFCA 3ITVA 4DO4A 4XD5A 1EWEA 1KBKA 3V16A 1E4IA 3NUKA 2OZ3A 3O05A 1FDZA 3B9OA 5IFPA 2HTMA 5CBBA 4D72A 3N2TA 4I7UA 4XSMA 4WUIA 2VVSA 4RX0A 4LV9A 1V0KA 1LBMA 2QF7A 2WSRA 4GIEA 4XD4A 8TIMA 2BG5A 4PB5A 4GFSA 3NVTA 3A21A 3MZNA 3IAPA 2PLCA 1OFOA 1ESWA 1H1ZA 3CUXA 3N1AA 2CNCA 4LFYA 1BPLB 3ITCA 2VWTA 3QSRA 2R1LA 3ZM8A 4ZE5A 3HG4A 3S9ZA 5TIMA 3V5OA 1R30A 1X38A 1WAWA 3R11A 3F7JA 4H19A 3QHOA 1A49A 1F6PA 2X2YA 4XTIA 1OINA 2FMOA 4IIBA 2ZYFA 5KINA 4TU1A 4C6DA 3B9NA 4GZ7A 4E2OA 1IGSA 3T44A 1A5CA 3PPCA 4RW5A 4E4PA 3QC0A 1R3TA 2F61A 2HQAA 3DG6A 4LVFA 2NUYA 2JEQA 3WFAA 3VU2A 3CPUA 4K8EA 1PHQA 4M81A 4QITA 3DYOA 3THAA 3U5UA 4DWSC 1WX0A 4GABA 4L9XA 3TK7A 3WFLA 3PBVA 3KTCA 1BYBA 1YIXA 1ZJBA 1HUVA 1ZCOA 1BF2A 4P8UA 1P48A 1QW7A 2VCAA 1FXQA 4R9XA 2PD9A 1RJPA 4G8TA 1Q6LA 4O1DA 3VKJA 2CLHA 2QJHA 3M5ZA 3HJZA 3EA3A 4A2RA 4MPQA 1PVNA 4NXKA 3KTXA 5D37A 4HKPA 2FGLA 4FR6A 2PCEA 3LA4A 3PJWA 1S3TC 1WE5A 4PTWA 3C2OA 1WYIA 4NHVA 3CQHA 2E0PA 3LN3A 4HNLA 1E56A 6CGTA 4S38A 3I10A 2I14A 4GY0A 2VI0A 5CPQA 1E55A 3BLKA 4NNBA 2QCLA 3LX9A 2BNJA 3FJ4A 3APYA 5DXYA 4AF0B 4B90A 5F2LA 4UQCA 2D0FA 4AIUA 5EFFA 1LROA 3V0UA 3KVJA 3TFCA 4IPPA 1VCVA 2BVDA 2WZEA 3CO8A 1WUEA 4ZQPA 3N2BA 2DGAA 4GA8A 5IBXC 1M53A 3W1NA 2CC0A 2QUNA 1VBHA 2BOEX 3AROA 1OCQA 2KAUC 1O66A 4QIUA 1MW3A 3CZJA 4UMBA 4UTMA 3FJLA 1KM4A 1ZAHA 2DY3A 3SCT