4MWAE

1.85 angstrom crystal structure of gcpe protein from bacillus anthracis
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
260
structure length
258
Chain Sequence
b'NEMTHRTKTRPVKVGNLTIGGNNELIIQSMTTTTHDVEATVAEIKRLEEAGCQVVRVAVPDERAANAIADIKKQINIPLVADIHFDYRLALKAIEGGIDVRINPGNIGRRHKVEAVVNAAKERGIPIRIGVNAGSLERHILEKYGYPTADGMVESALHHIKILEDLDFHDIIVSMKASDVNLAIEAYEKAARAFDYPLHLGITESGTLFAGTVKSAAGLGAILNKGIGNTLRISLSADPVEEVKVARELLKSFGLASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
publication title 1.85 Angstrom Crystal Structure of GCPE Protein from Bacillus anthracis.
rcsb
source organism Bacillus anthracis
molecule tags Oxidoreductase
total genus 95
structure length 258
sequence length 260
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2013-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4mwaE00
4S39A 4G9PA 4MWAC 4S3DA 2VEGA 1TX0A 4DJDA 1Q7QA 4MWAE 4O0QA 3TYEA 4O1FA 4NL1A 1Q7MA 4DJEA 4DAFA 2VP8A 4DJED 4S23A 4S3EA 3MCOA 1TWSA 1AD4A 2E7FA 3TZNA 3H21A 4O1EA 1EYEA 3BOFA 3TZFA 4DJFD 4DJDC 2OGYA 4S3BA 3H26A 1TX2A 1AJ2A 2DZAA 2YCLA 3H23A 4DJEC 1F6YA 2H9AA 3TYAA 4S3CA 4D9PA 4NIRA 3NOYA 2Y5JA 2VEFA 2YCLB 3H24A 3H2MA 2YCJA 3TYDA 1AJZA 2BMBA 4DJFA 2H9AB 1Q85A 1AJ0A 4DB7A 3K13A 3TR9A 3BOLA 4PZVA 2Y5SA 4MWAD 4D8ZA 5JQ9A 3V5OA 3MCNA 1Q7ZA 4DAIA 4MWAB 3H2OA 3TYUA 4D8AA 3MCMA 4HB7A 1AD1A 4S3AA 3H2NA 2DQWA 3TYBA 4NHVA 3H2EA 4S38A 4DJFC 4MWAA 3H22A 2Y0FA 4NILA 4S3FA 4C1NA 2YCIX 3TYZA 1TWWA 2YCKX 1Q8AA 3H2CA 4DJDD 4C1NB 1Q8JA 3H2AA 1TWZA 3TYCA 2DZBA 3H2FA 4CCZA
chains in the Genus database with same CATH superfamily
4FK9A 3AQUA 1SO6A 1EJUC 1KRMA 4IQEA 1BTCA 2PWUA 1M7XA 4M82A 3CWOX 5FCZA 3LXBA 1MRQA 3RF9A 4HT3A 3KM8A 4AD3A 1K7XA 3T44A 2OQLA 1WDSA 4LJ3A 1TTQA 1OSEA 2J6VA 2OVLA 2D0FA 3U4FA 3CLWA 2JGYA 4AZGA 3VGFA 5HMFA 3JZEA 3MJMA 1MMFA 4O1AA 1XR2A 4PTXA 3SUTA 1OG6A 3QLDA 7TAAA 1DXIA 4JTIA 3SZ8A 1XYFA 3GNOA 1KM3A 3TIMA 1N55A 4R7OA 2P3EA 2Y8VA 4NNBA 4JIPA 1X8CA 4HPGA 2HK0A 3UWUA 1HO1A 2WHMA 1MUCA 4I8DA 3GLCA 5A2BA 1OD8A 4Y2WA 1W1ZA 2NV9A 4NZ3A 4DYJA 1RPKA 4DB7A 2GYIA 1DKWA 3KXQA 2W3ZA 2C1HA 4JNYA 4LVGA 1SJBA 3DKJA 5AKQA 3UCDA 4ACYA 2DSUA 3EXSA 1QNSA 1MDLA 2J74A 1FWAC 1OX4A 1XRTA 2YL9A 3RJYA 1GOIA 4JNZA 2BSLA 3O6CA 3KDNA 4GGHA 1KRAC 5FI8A 3UZ5A 2OODA 2BZNA 4OGZA 1KCZA 3WJWA 3G8RA 2ZWZA 4DUXA 3WUFA 4UFMA 1Q6QA 1LBFA 5PTDA 2Y8KA 1OT2A 3EKGA 3LPOA 4DAFA 2QCGA 5AC7A 2I1OA 3MPGA 2ZUVA 3A9IA 2VWTA 1UUOA 3AZRA 3FVDA 3WLOA 4XZBA 3SQMA 1EJVC 1PDYA 4UNIA 4ES4A 4C65A 3SSJA 3W4RA 2E1WA 4DUOA 3LX9A 4NJJA 1UCWA 5DBUA 3B06A 3WQEA 1MFVA 3PB0A 1FDZA 6ENLA 2I5GA 4IOTA 1MYRA 1ZAJA 3CHFA 2WMHA 3CAKA 3BXWA 1R47A 3EWUA 1SR9A 2PTDA 2HXUA 3A12A 1VIWA 1S38A 4M6PA 1NAL1 3M0MA 3IIZA 1M03A 4NZ1A 4PMNA 3WG6A 4WGHA 1W91A 4JTRA 1NDWA 3DECA 1EX1A 4GGBA 3LCIA 3WBYA 3C6CA 4WD0A 4LX4A 1SYTA 4HP5A 3H22A 3W7DA 3BCDA 3ALGA 1GYNA 2REQA 3CMGA 3P0XA 4JIIX 2E5BA 1FFQA 5G4HC 4B2DD 1UASA 4DJDD 3VOFA 3PWIA 3XIMA 1BTMA 4DHGA 4AZCA 1R8LA 5LGZA 2JGQA 8XIMA 3N14A 4MSSA 1VEMA 3K46A 3LLXA 4FS9A 3U3HA 4NRRA 1Q7QA 4IQJA 4ECLA 4WK9A 3GYCA 3CUGA 1WKYA 4Z2KA 1ISVA 4NNCA 2ISSA 3WEOA 4US5A 4N2YA 4GFIA 4XV0A 1YTDA 1AK5A 1SU5A 2J47A 1DVJA 4NY2A 4WJXA 4AC1X 5A6AA 5C54A 3BOFA 1ZS2A 2VDHA 2W4XA 1JZ7A 3W23A 2JEQA 2IPWA 2ZXDA 5IOBA 1V7AA 3TTSA 1H1YA 1XH1A 5D8ZA 4LOCA 2YOCA 1ICPA 3S8HA 4NJIA 1RJQA 2ZWYA 1NSJA 4GQBA 3H24A 1E1CB 4FB7A 2BVDA 4F9DA 2X8RA 4M5PA 3LM7A 2W9MA 5BZAA 5AC6A 3W7OA 3K1GA 5AOUA 3EEGA 3PBWA 1X8FA 5GNZA 3WLPA 3L0KA 1KNWA 3WLHA 3M1ZA 4PGLA 4XBJA 1EDTA 2FTWA 2Y7GA 4XAYA 2I14A 4XQ6A 4FP1A 5DELA 4F0RA 2YBVA 3QSRA 4A3YA 1OD0A 3MJYA 4UOJA 1VBUA 2FH8A 3AU2A 3CO8A 1QTWA 4L6OA 3C2RA 3MVIA 1A50A 3CT7A 1GUVA 3TN3A 3AZSA 1UC4A 4F2UA 4ZQOA 3HZ3A 4HPNA 2D24A 4W9TA 5CZSA 4HVXA 1IE7C 4JTFA 4WHBA 2VT0A 5FSEC 4X22A 3CHDA 4LSBA 4J3VA 1RV8A 1S5WA 1MSSA 4AZ6A 1NFGA 3SCSA 3GR7A 5K9CA 4LGXA 1FRBA 1EPXA 3LMYA 1GKPA 3W85A 1HQTA 4JQ3A 3D3AA 3T78A 3NPUA 4PTDA 4YVPA 1XF0A 4OJYA 3TTQA 4KEMA 1KA9F 3UNTA 3H23A 1I2QA 5FAGA 2HSAA 4IFRA 2XVKA 2GVYA 4GC3A 3NOYA 3FXGA 3UPBA 4UOZA 1XLBA 1CB2A 2E6AA 1E1EA 2NLIA 4NI3A 3KHJA 3OLGA 1ODUA 2PAJA 4WX2A 3H4WA 1Q13A 3WQDA 1IT0A 4GUJA 4GK8A 1TCDA 4UCFA 3DESA 3U9IA 2VWSA 3ONBA 4EK7A 3H7VA 4Q8MA 4IIHA 4MY9A 6XIMA 2C1IA 2DVUA 1PCWA 1K3UA 1D8CA 3IV3A 3WD4A 3REQB 2CW6A 4DO5A 3C52A 1C9DA 4KS0A 1RA0A 3W24A 1NVMA 3KUMA 1X38A 3L2MA 3IJLA 1B4KA 2YGYA 3TOPA 4U10A 4F0LA 2Z00A 3HPFA 3P74A 1POKA 3T2OA 1BLIA 5TNVA 3QM3A 5HNTA 1CXFA 3N04A 1NIUA 3FS2A 2NUYA 3CPRA 3FSUA 4JKMA 4IFKA 4J2MA 1IEVA 2XZ9A 3GXNA 2Q09A 1FWFC 3M0KA 1BGAA 4AWEA 3O05A 2ZFAA 3DYMA 3HIJA 4MG4A 1LBMA 3TOYA 2ZC1A 3MC5A 1G4TA 2B7OA 4CNTA 3ERPA 4LCRA 1DIEA 5D02A 4GH3A 5DFAA 2WBKA 1UD4A 1GZJA 3LNPA 3EPNA 2QW5A 1BVWA 4JX5A 3ARXA 3Q37A 3S5OA 2ZXQA 3W7QA 1I0BA 8A3HA 5B80A 3MSYA 4QIUA 3PR2A 3C5QA 3TC6A 2A7RA 3OJGA 3VTRA 1CYGA 1XIFA 4D72A 1IWBA 3WO8A 3CS2A 2NQHA 3S9ZA 1XSIA 3WEZA 4ZTXA 3WDQA 5G2IA 1ITQA 2DSZA 2PDKA 4HBKA 4LAOA 1K8ZA 3FJ6A 3CQ0A 4AY8A 1GYLA 1XKYA 1Q5MA 4M19A 2WMIA 1FDJA 3GRIA 2ZZ1A 1E6ZA 1J0ZA 1PTDA 5HINA 1TFVA 2IQ0A 2W61A 1UR8A 4H2HA 4UMCA 1RBLA 4LY8A 4IISA 4HNOA 3N34A 2BOFX 3MKVA 4ZR8A 2X1TA 2C14A 1FWCC 2D73A 1L6YA 4G1KA 4PTNA 2VD8A 1GJUA 4QAWA 1H7OA 3M0ZA 1AODA 1Y7VA 1FWIC 2ADAA 1RALA 3S47A 4LVDA 3S2CA 4HPHA 4GBUA 4PULA 1GVRA 4PEKA 3BLIA 3DGBA 4UUIA 1HFBA 2R8WA 3SDOA 3W07A 2FFCA 3F5KA 2FGLA 4YWSA 4H6EA 2Y7EA 4HMDA 5C55A 4UCGA 3DU0A 3AS0A 4WRHA 1UP3A 1JCLA 1O66A 2BMBA 2TYSA 3QYSA 3VOHA 1WZAA 3UWVA 2VVSA 4UFKA 3UWZA 1XS2A 4FZIA 4FR1A 1QPNA 4DAIA 4AQLA 1RLDA 4CU7A 2NLYA 5TF0A 1UUQA 4JDBA 1F74A 3AZTA 3C4UA 2VGBA 2V82A 1CPUA 3DFQA 3R58A 5G2HA 3RG6A 1F3TA 3QY8A 3AMCA 1FP8A 4LXFA 4H6RA 4KGJA 3SW6A 3UEQA 2VD9A 4S1FA 1W5MA 1PHWA 2XU2A 1BEUA 4G9PA 2E67A 2GSEA 3S5NA 3CQIA 1TPC1 4FI4A 3D3FA 3M5XA 3STPA 2O9PA 4MKSA 1OJXA 4L9YA 1J2WA 4F0MA 5BU9A 3AXMA 1ZCCA 1GQIA 1YNYA 1A5MC 3TONA 4IIFA 3UQNA 1IEWA 2DP3A 1DE5A 2MANA 3WQFA 3HGJA 4LUTB 4ONVA 1H3GA 7XIMA 4ZXOA 1R2TA 4EAMA 1GJPA 4F48A 4JR5A 5I03A 2CKSA 1TVNA 2DVTA 3N2OA 1VPYA 1NM9A 1VBGA 4HPJA 1VCFA 4K1WA 1AZ2A 4HZMA 3QV6A 1FCVA 3VM7A 4JQ2A 3ZWTA 2FTYA 4LAUA 5IXEA 3R11A 4RR4A 1KFJA 1EGZA 3D0CA 3BAYA 3AIUA 1QK2A 1ONRA 1TPVA 3T42A 3OBKA 4LVFA 2WWCA 4KEVA 2A3BA 4GPNA 3MCMA 4JTKA 4GVIA 2WSPA 3NDYA 2AKZA 1AMYA 2YFNA 4AYSA 3LCFA 3PG8A 1O5XA 1AZ1A 3TXVA 4A35A 3UXIA 3ZYZA 2OLHA 1J2BA 1ZPTA 3A3WA 3DG7A 5CZKA 2CZDA 2OX4A 5D9MA 1W56A 2DH3A 5CGQA 3TJXA 4PRRA 2A5HA 1V03A 1TR9A 4UFLA 1EP2A 3CO4A 3UGVA 4B5NA 3PAOA 3TFXA 4GZ7A 3ARSA 4Z0JA 3AIQA 5B7ZA 1V0MA 3C0LA 1KGWA 3AS3A 3UWYA 4L4OA 2IKGA 4XZWA 4W7UA 2HVOA 5I02A 4QM1A 2ZRVA 3ISIX 4OT7A 1CGVA 2DT2A 3TA9A 3V18A 4HPXA 1O60A 3UXAA 4M3PA 3IJQA 1IEQA 3OHMB 5HANA 2Z4GA 2RGMA 3VMPA 1JDCA 2ZA3A 3MP4A 1E0XA 3NZPA 4PUKA 1ESWA 1IWAA 4NQ1A 3NEHA 4IWWA 2ACQA 2ZRZA 2HMCA 1EH9A 3S1GA 2VFIA 2A85A 2PCQA 1DEDA 3RYSA 3IJ7A 4UZUA 4DPQA 4Y8EA 1R3QA 3QGVA 1QNOA 4IQLA 3T05A 1RAKA 1RXOB 3OIXA 4IFOA 2AKMA 2BLEA 2GFTA 2HVNA 4GXMA 2J9XA 4JTSA 3CWHA 2XIMA 1HN1A 2OKOA 3QTGA 2QV5A 4F3HA 3WK3A 4JIRA 1ISWA 3ABZA 1J6OA 5DRCA 1UWUA 1EZWA 2ZCGA 4XKYA 3LHUA 1W2PA 4IJBA 2PDBA 1SMAA 5GVJA 1ECEA 3EDEA 2G5WA 2A2IA 3DZ1A 2YCEA 3HFTA 4M80A 4Q6JA 1JGIA 2FVMA 1E15A 1LUCA 3G1FA 4US6A 3FN9A 1K70A 2BFGA 3HPZA 1TTJA 4B5VA 2IKJA 4P7RA 1TUFA 2FIQA 2WSKA 3DN5A 4GINA 3NQ7A 4Y9AA 4FLRA 2WNWA 4FPSA 3LTYA 1RCQA 2G8ZA 1S2CA 3NSXA 4O11A 3CAVA 4KCVA 4FMVA 2DEPA 3NL6A 2DZWA 4PL2A 5HMDA 4DYEA 2X1IA 1AUSL 3TTOA 2E8YA 2HBVA 4DBDA 1FWNA 1MQRA 3INPA 4R53A 1WAWA 2EPNA 5E9AA 3ZT5A 1KV8A 2X0SA 2BP1A 2Y5SA 4MWAD 3E96A 3VX0A 3V0TA 2BVYA 1OINA 1EC9A 1UPMB 1VFLA 4K38A 5TQLA 2PP3A 3FXYA 3TLLA 1BSLA 2WNZA 3W7HA 4RZ6A 5CPSA 1OC5A 3QR3A 4NYYA 4JIQA 4EVZA 3WBAA 3IPWA 1FVPA 4S3FA 3LNMA 3RDKA 2DJLA 2X1RA 3R25A 1CGXA 2ZRXA 4EWJA 2A3EA 5E5CA 2ZRUA 4GCAA 5HQEA 3QW4B 1U83A 4H4IA 1QAPA 5EMKA 1H7RA 4QFUA 4E8DA 5KINA 1TV3A 4FX7A 2JEPA 4AY7A 4DELA 4OBSA 2CLKA 2QPSA 3W2MA 4HOWA 1JDDA 2OWXA 3W70A 3THUA 1IEIA 5JMUA 5CC7A 1K9FA 4LUJA 1XYMA 3LD5A 1EEPA 1A5NC 4F2BA 2AQWA 5BXSA 2F38A 2DIEA 1O5KA 1W3IA 1B3XA 2VZVA 2VFDA 5AHEA 2FPYA 2YDAA 3BG3A 3SY1A 2PDQA 2ALRA 3BLPX 4IMEA 4JBRA 4QSFA 3LRLA 3GNPA 1LZOA 2NSXA 4ZSTA 3G77A 1KWKA 1YW1A 4DXKA 4M51A 3TQPA 1TPH1 4YYCA 3ZT7A 4MIMA 1G01A 1ISYA 2WJZA 3LCWA 2CLPA 3VCNA 4RCXA 1RCXB 4BKNA 1V6UA 4UTTA 3F2BA 3T09A 1UH2A 5J8LA 1CLXA 1Q85A 3P8IA 2H8ZA 4QS6A 1Z69A 4GE8A 2VZSA 3R2GA 3QBUA 1FHLA 2RJHA 4XAZA 5BRQA 2IKIA 1S3TC 4Q8UA 2KZHA 3UJFA 2EPKX 2VEIA 4C6KA 4S38A 4A3QA 1QBBA 3QC3A 2WM1A 4N4QA 1J18A 1UJPA 3NVTA 1J8VA 1EPVA 4OBRA 1NJJA 3ES8A 1GGOA 4H41A 4PUEA 4FNRA 2BX7A 3OG3A 1AH4A 1QOPA 1NP0A 5FEXA 5I3JA 1K7EA 1V0LA 1SSGA 5FJJA 4B9YA 2O56A 4MPKA 4S3JA 4PBGA 3GU2A 2VEMA 1S5TA 3W7EA 1XC6A 2JFEX 1JD7A 3SM0A 4CQBA 2PDJA 1ONXA 3WBXA 4LS0A 4PMUA 1K8XA 3BMXA 4RNJA 5A6SA 3W81A 5CZ0A 2VYOA 3BAJA 1OCBA 1CECA 3UR8A 4FNUA 3LBCA 5BOFA 3TMQA 4UMBA 2YXGA 4O0ZA 2DGAA 5AN7A 1TV7A 3CQKA 4TU1A 1Z3NA 3GIQA 3VD7A 4H7ZA 1YPIA 4AYGA 4E2VA 1WOBA 3WF2A 4NP7A 1BKSA 3QMRA 4QJ5B 1PZ0A 3O9NA 4RPPA 3MHGA 1H0IA 3TYUA 1TQXA 4HGXA 4DM1A 1WZKA 4Z08A 5JBFA 3WELA 5CPTA 1FH7A 1XH0A 2INEA 4RZBA 3TW6A 3J7HA 4KGLA 1C8VA 1KO0A 1HJSA 2Q8ZA 1U2YA 4O50A 1TJ2A 3A4AA 3HPXA 1V0KA 4KFNA 5JH1A 3H2CA 1DJYA 1XFBA 4XUGA 4ZO9A 4IUOA 5I79A 3WDHA 2ZOXA 3BLOA 4CVWA 1W1TA 3AAMA 1R6WA 1E3XA 3DAQA 1KFLA 3CH0A 2QPXA 4UTMA 1KM1A 2YB4A 4MFDA 1K02A 1AW2A 3M4HA 3RO8A 2OEKA 2DW7A 4X0VA 1NH6A 4HOZA 3DFYA 2DV0A 1MQQA 1XIHA 1Z8AA 5C2GA 1OC7A 4I6VA 2R6OA 3SUSA 3H4GA 4GQGA 4XIMA 5AC4A 2EPMX 2TRSA 3N4FA 4UZSA 4JTUA 3CZLA 1C7TA 3WNOA 2CBIA 4UXDA 3C2OA 4UQCA 1XKJA 1R30A 1PYMA 2GJNA 4DJFA 3N12A 3A4XA 5EB8A 4TIMA 3BW4A 4ATDA 2PGWA 3OEXA 4U3CA 1GKRA 3GXPA 5KZ6A 3GHSA 3VE9A 4O17A 3ITCA 1ELSA 3LPGA 2REQB 4L1GA 2PTYA 3EOSA 1HKWA 4PUJA 2W79A 4H19A 2OXNA 3W27A 3V35A 3CMJA 1KM6A 4QGCA 4C1NA 4Q4RA 4AZCB 1JF6A 1CCWB 4I7VA 2WYSA 4HN8A 2PB1A 4DEFA 1LWHA 4GX8A 5F7UA 2CBUA 2QJIA 3C86A 2Y4SA 1XIEA 4M56A 2ZA1A 4M7SA 4ZO7A 4GYPC 4DQWA 3ZJ7A 4ORMA 5LXXA 4AD2A 3URAA 4Q4MA 1XIJA 4GA8A 4BQ3A 4E4FA 1MEHA 1O1ZA 4O52A 1VQTA 2FH6A 2XWDA 4HNNA 4X9SA 3KRZA 5DXXA 1K77A 4RV3A 2XH2A 2VR4A 5GNXA 3ATYA 3E5PA 4Z1CA 4JFVA 3AUJA 4ZSUA 2PGRA 1KBBA 4MNLA 1QNPA 2Z1SA 4KCWA 3RM9A 2NQ5A 2PRLA 3HB9A 1L2UA 5H6HA 2WZHA 1X7IA 3AXIA 4AWTA 2FZMA 4F79A 4D6FA 3R8RA 3QPEA 1J10A 2FZDA 3R6IA 2I9UA 1KTBA 1X7FA 3I6EA 3RMJA 3RO6A 3WSUA 1GG1A 1E5NA 3AOFA 1G5AA 2ZZ2A 2DT3A 4O53A 4O8RA 2NVDA 3W1TA 3QR0A 3M0JA 3T4CA 3F2DA 3VZZA 4D6IA 1IT8A 2BXVA 4XSLA 1J12A 3I3BA 2EAWA 1Q6CA 5ABFB 2ZA2A 2HXTA 3QEZA 4DXVA 1PV8A 2OJPA 2DSVA 5G1MA 3N2BA 3H55A 1QCWA 2WVSA 4B16A 3WQPA 4PMQA 2X2GA 1JD9A 4M6QA 3ICJA 4HU3A 1XX1A 1C90A 3WFAA 1OVDA 4LNCA 3BSGA 3HGRA 2D2GA 5DY3A 4MM1A 4AX7A 1D9EA 1MNZA 1ZBVA 4QJ4B 2JBMA 2FZNA 1A47A 1MXGA 2EG7A 3SRDA 1LQ2A 3VZYA 3MSRA 3L23A 1UH4A 4FR6A 1LF1A 4UNLA 3WNLA 2C7FA 3BUVA 1EX5A 1B2YA 1NF7A 2UWFA 3MBFA 1K4HA 3PUDA 1YLVA 1LP6A 1JEZA 3VIPA 1S2UA 3LSCA 3PSVA 5FJTA 3ABRA 4LV9A 1F7BA 1PL9A 1AMKA 4YHGA 1HX0A 4EE9A 2ZZ6A 3P6LA 5LIKX 2WNNA 4HNCA 4AZ5A 2MUCA 2V5KA 5AYIA 1OK6A 3P67A 2NVCA 2A4AA 5CSSA 2ON3A 3F7JA 4P8XA 2C0AA 2PRMA 1XD1A 4GKLA 3O6AA 4NZ4A 1KM0A 1QOQA 4E6MA 2HPMA 1J9YA 1WDRA 4GOAA 4K1GA 3GR8A 4LAZA 3HQPA 5A2CA 1B0IA 4IFKB 4QJ3B 3UESA 4MB5A 1TMHA 4E2OA 4O0QA 2ZUSA 3NO5A 1EA0A 3UYCA 1BYBA 2QJHA 2RGLA 3BDKA 2CBVA 3BG9A 1W3JA 1BWLA 4CLMA 1LRTA 3TFCA 3KCLA 4M6UA 4P8WA 1AQMA 1DWHM 4CQDA 2HROA 2GDUA 1J0IA 3H21A 1JUKA 3QH2A 1LLWA 2NUXA 1VPXA 4K6AA 1MZRA 4JHOA 3CK5A 2GJLA 1OFRA 2OELA 2W62A 1RBAA 1WQ5A 3TC7A 3RX3A 5AECA 1CTNA 1QR7A 1U1HA 1XUUA 3LTPA 4XG1A 2NQZA 1UMYA 4ZOAA 3S83A 2ESCA 4FNQA 1LDCA 2X1UA 3N1AA 1QNQA 3OW1A 2ZUMA 1R9XA 1YXYA 1YRRA 1J0KA 4L4PA 2OU4A 4O8AA 2GDQA 1GZ1A 4HN4A 2WJDA 4RDWA 1PDZA 2VRKA 5F4SA 2R1PA 3EGJA 2W66A 4B5XA 3S5SA 1ZHAA 4FOKA 3MANA 2PBOA 4GI6A 4HK6A 4IMAA 4Y90A 1PEZA 2Z28A 4F0SA 3MSGA 3LPFA 2D0HA 2WMIB 2EPLX 5I24A 1CXHA 3GXFA 2AOSA 2JE8A 3WJXA 5E09A 2C6QA 1HNYA 1AH3A 2ZYFA 3EEZA 5D37A 1M7PA 3IIXA 2B0MA 1ISZA 2CXGA 3W38A 3K2GA 7ODCA 2A7NA 2QDHA 4MYXA 1XPYA 3KL5A 7ENLA 3Q65A 4Q4PA 1GVOA 3KP0A 3N25A 5HNUA 5A6MA 3BZJA 2BS9A 3ZS4A 4P8UA 3T4WA 3B8DA 4AD0A 4CD5A 4D71A 2Y6ZA 4W85A 3E38A 5K2ZA 3R12A 1EO7A 1CT5A 1XLMA 1S1RA 4DJDC 3ARPA 1UJQA 2OEJA 3BAXA 3LDVA 1YXCA 1XPGA 3QVQA 4J1OA 2X0YA 3IK2A 2FB3A 3NYZA 2A3AA 3BZGA 4XK2A 1R2RA 2B7QA 1EGMA 3V16A 1OCNA 3RM8A 3SCOA 1I1XA 3VKDA 5RUBA 2DJXA 3WX7A 4R33A 1KM4A 3MBDA 4UTWC 3CBWA 5EBUA 1XSKA 4CN6A 4RLIA 1MXSA 4MAVA 3BW3A 1XLHA 2P50A 4YJ5A 2XVGA 3SI9A 3N11A 3VIMA 4BWLA 5A2AA 3WH8A 2BV9A 3TU9A 1FWTA 1KCLA 1XCFA 1SJDA 2OT0A 3A6OA 1XSJA 3N18A 3RFAA 3WQWA 2EG6A 1G6CA 1XD0A 3F4DA 2YKKA 1VP5A 1FHDA 2Z29A 4REQA 5KITA 4Q8PA 4LAMA 3WNKA 1RP9A 4JAWA 1EBGA 3I6RA 2X7VA 3M0LA 2P76A 3UETA 2O9RA 1F4HA 1GONA 2WZEA 4JN8A 1K9TA 4XD6A 2WCAA 1XFCA 2BOGX 1G7UA 4AF0A 2ICSA 1E51A 5REQA 3G1VA 4XZ9A 4DNMA 2CLFA 3WD1A 2FHBA 4BHYA 2PTXA 1W5PA 1T5AA 1IXQA 2HNEA 1GJWA 4O1BA 2Z24A 3DHFA 3N19B 3EKLA 1FHVA 1MVYA 3TCEA 2XN2A 3PB2A 3DCPA 3GNDA 1H7XA 3DIPA 4O13A 3UA3A 3GXTA 1NP2A 3LA4A 1WCGA 3AMDA 1JUBA 4H3DA 4HB7A 3VO0A 3BCJA 4I7WA 2BOEX 2O55A 4V1XA 3V0UA 4TX9A 2G3MA 3UF9A 3R5EA 3TAKA 4JTEA 2CZ5A 3PBMA 5H1WA 1OC6A 4E8GA 1Q8AA 3UY8A 2YYTA 2D2JA 1OG0A 5I3GA 4N42A 4XWUA 3RK8A 2PDMA 1YPXA 2G95A 1NF0A 3GG0A 4W8LA 3UZWA 3S46A 3W2NA 2VEGA 3GDLA 4MJ4A 5DRIA 5BXTA 1MW2A 2HE5A 3KEHA 2ATMA 1R86A 4ADSA 3EPMA 5CQ1A 3B8WA 4GXPA 2PU1A 4KESA 3DGRA 3W29A 1TMLA 5JH2A 3FJNA 1V08A 3AIVA 2XN0A 4FXJA 1WDDA 1H63A 1KTNA 3QV7A 4W84A 3VUPA 1NWTA 2CIPA 2VCAA 3KVJA 4H00A 3WQ4A 1U5HA 3A3HA 3LI1A 1FXPA 3U8GA 3W74A 2BODX 5E70A 1YIXA 2PFHA 4K39A 3AHTA 2X41A 4WDTA 4YTQA 4AVOA 3VABA 1SFJA 3F4CA 4I6KA 4LPCA 1A5KC 4N9CA 5BMWA 2QGHA 3DHPA 4AG0A 3PF3A 5C71A 2QS8A 5HOSA 4LWWA 1X39A 3EB2A 3NGFA 4WY0A 5TD4A 1VFFA 4GI4A 1PX8A 3T08A 5BRBA 4EF8A 3VNMA 3ITXA 3U6WA 5CKSA 2F61A 3CUJA 1LUCB 2WKJA 1Z41A 3QHOA 3O63A 3JUGA 4UNKA 5E9XA 4C6LA 1XRVA 4L65A 2VC7A 4AEFA 1C3FA 3LQGA 3AUOA 6REQB 3PP7A 3ARYA 3W7JA 4NX0A 4GQ0A 3WLIA 3FGCA 4ALDA 3KW3A 4IPLA 2VC5A 3PJUA 1ZAHA 1E70M 1GG0A 3T0DA 1NFBA 4QRNA 3LGGA 4RNHA 4ZENA 3AIBA 4NZ5A 1XLIA 2Z1XA 5LNWA 1EP1A 1FY6A 2VX7A 1DJZA 3DH7A 1AJ0A 4WKHA 2VC6A 1EJWC 4CQCA 3TR9A 3BARA 2DZPA 4GIAA 3WD2A 5IRPA 1TR1A 1W8GA 4V28A 4GY7A 3RCNA 4KWUA 3ZLFA 3JS3A 9CGTA 4OHQA 3SGUA 5CH9A 4R34A 4DYKA 4Z2LA 4W88A 3EAUA 1RP8A 1E3ZA 3FYYA 3HURA 3L4UA 1VFHA 3BH4A 4Q32A 4GJJA 4B92A 2HBXA 1ALDA 4AWSA 1ONWA 2E5DA 1WXJA 4WDWA 2JALA 4HSOA 4D1JA 2XPKA 4A3HA 5GNYA 4HNUA 3ZFHA 5D9PA 4PODA 3WQ5A 5LIYX 2G3JA 4ML9A 3EA2A 3VMOA 3STFA 4WLCA 1I4NA 2QJJA 2BVWA 3EB4A 1X6LA 3FHQA 4TVUA 3WQVA 1W2VA 2TODA 3TJLA 3SRHA 2O4MA 1R3TA 3BGAA 3H7UA 3OQEA 1LT8A 1CGTA 2D3NA 2OB3A 3AIRA 5CBIA 4GXWA 4I7UA 1GQLA 4AC7C 1L6WA 3CUFA 1AJ2A 3U2EA 3VNIA 4PUMA 3L21A 1MUWA 4M0XA 3VGHA 1E0WA 1ICSA 4F0KA 1I2RA 3LXAA 3ANUA 4XZMX 2IPGA 3L4YA 1B3VA 5JBEA 1KCKA 5AZ0A 3R0KA 2ZDRA 1AQHA 1PKMA 3TR2A 3N73A 1R3SA 4Q8OA 3T8QA 1M9HA 4UR8A 3EMQA 1GPWA 3BICA 5LYRA 1ZJAA 2EGZA 1RK5A 4MDPA 4IF2A 1VYPX 1CXLA 1RY0A 2UZ9A 4HMNA 2G3FA 1R3RA 4UQAA 3R10A 1X1NA 4LRTA 5BXPA 5M5DA 2NT1A 4K2SA 5F4XA 3H2AA 3LQLA 4P5UA 1QPKA 1EL3A 3MYOA 4Q4QA 3GU1A 3A64A 4HYWA 1XIIA 3CIXA 3NM3A 1G4SA 1DE6A 1NTHA 2R1MA 2E09A 3O06A 2FVLA 2WC7A 3EZ4A 4Q22A 5I00A 5I3IA 3WIJA 4W8AA 1QRQA 3SAZA 1B3YA 5FF4A 3NQGA 4LEFA 3VDCA 4V27A 3NYDA 1NWRA 2UY5A 3LRKA 5KSWA 1RHCA 3L4WA 4GVGA 1V6TA 5CPOA 1E40A 4IIGA 6XIAA 2NUWA 2PGFA 1UOZA 2B7NA 2XTKA 5LNVA 2Y5JA 3W28A 1KB3A 4IPJA 2CNCA 1RLCL 1OFAA 4ZQMA 4XVDA 3UG5A 2Q71A 3G5EA 3W1MA 1HVQA 3OPSA 3N2TA 2NX1A 2FYMA 3REQA 3CB8A 5BXRA 5I09A 1AL8A 3CZGA 4GABA 3A3XA 3VDHA 4D6HA 4NHVA 2ZVRA 3EXTA 4RKAA 4KRZA 3QMTA 3RX4A 2EEXA 2EG8A 2H90A 3M47A 4MHBA 2HV5A 4KKXA 1QXLA 1G67A 3APGA 1OM0A 2XSAA 3K5XA 1QHOA 4QE5A 3PG9A 1V3LA 2J6XA 1EJRC 4RK8A 3W02A 1HKVA 4HA1A 3TX9A 5JVLA 4P2VA 5AHLA 4GX9A 1LG1A 2ZE0A 2V0TA 2JKAA 3GG8A 3GM8A 1B54A 3BL3A 4DWSD 3H8AA 1SJAA 3DOPA 3WKZA 3MZ2A 5FEWA 4KW2A 3E0LA 1GPFA 1R87A 4UQEA 4AMAA 5D2TA 4TO8A 4DVOA 4GUIA 1JCMP 1O7AA 1EFZA 3GHTA 1FH8A 2YPIA 3PBYA 4RNIA 3U5YA 1LLZA 2XISA 5C9XA 3USZA 5M1TA 4J3WA 3BG5A 1BYAA 1O12A 1VPQA 1E6SM 1QI3A 1KXVA 3QPZA 1RZMA 5BU6A 4IP7A 3OVGA 1PB0A 5HULA 3C56A 4JTLA 1F07A 1W9VA 4AIOA 3M0XA 4BK9A 3OGSA 1H61A 2V81A 3GVQA 1HKMA 1BVZA 1S2VA 3U4AA 3BMVA 4GQRA 1MEIA 3VA8A 3W6MA 4GZJA 2PRHA 3DG6A 2YXOA 3TLQA 2ANUA 1V8EA 5AFDA 4G1NA 4ZQRA 3MMUA 2HEJA 5IDZA 2RDWA 5I3KA 3VCRA 5E1QA 2IQTA 2QCHA 3EB3A 1K03A 1RQBA 3CL8A 4NZCA 4X3ZA 5XINA 4MWAC 5CXPA 3T6CA 5C9WA 1IT7A 5DQPA 4A3UA 3GC2A 3FIGA 1BWVA 1I2OA 3E3HA 4PH6A 1B5TA 1EHNA 1PX4A 1I1WA 1SO5A 3GC5A 3E02A 1EJTC 4E4PA 4PL1A 1D7FA 3UCQA 1KBJA 2QT3A 3WQ8A 3L5MA 1BXNA 2C19A 5A1AA 1SW0A 4ACZB 1DYSA 1UZ1A 4IHCA 1QI5A 2J24A 3ORWA 1CXKA 4JXCA 2OX1A 1M01A 3VDBA 1ZSXA 3VI2A 4H9YA 1E9LA 1Y65A 4ERGA 2PI6A 4AX6A 1FWDC 2YIHA 4J35A 3FDGA 3PVFA 2X40A 1OWQA 2B7PA 4NNAA 3BLDA 4ZOBA 2Z2UA 2GDVA 2JKPA 4RV8A 4WCJA 2CERA 3R8HA 2HS6A 1JXKA 3AWNA 4PTMA 1PIIA 3NQMA 3PANA 4XTIA 1EHAA 3H7RA 3C0SA 5AVHA 3THAA 1EJ7L 1TJPA 2XIOA 3ZVHA 1TUXA 3OB8A 3T2QA 4I5XA 3NUKA 1Q6GA 1IHIA 1D7KA 3B4YA 4MPQA 4UTLA 3A24A 3HF3A 1OYCA 3N13A 2BASA 1XYCA 1P4CA 2PBGA 2WLZA 3DKLA 4PMRA 5DCBA 3HA1A 3F1QA 3RRXA 4R9XA 5D2WA 3A47A 4AY1A 2HDJA 1TYGA 3WQ6A 4NG3A 3W83A 3MI2A 3PTMA 4MWAE 4AAJA 3OBAA 1A49A 1H09A 4J2PA 3AJXA 3TCSA 2V69A 4OOUA 3UP8A 4IIBA 4BY3A 3GDKA 4LNYA 1YQ2A 4DO7A 3OYXA 3M0IA 2RDUA 2PEVA 5BYWA 3MB9A 4PTWA 4B15A 1VJZA 4Q4KA 1IYXA 1BRLA 3AICA 4NJKA 4DJEC 4I90A 4O16A 3UVIA 1QJWA 3C2YA 3LS9A 4R27A 1H62A 3RIKA 4IX2A 2C0HA 4UQBA 3NQDA 1GOOA 4N0RA 1EUAA 4HD5A 5EMUA 4IGHA 3DBNA 2INZA 3W73A 3D5HA 4CNOA 4YPJA 5A8GA 1JRCA 1PKNA 4CU6A 1OX5A 1VCGA 2O9TA 1B1YA 3GNRA 1SZRA 4XO7A 1FWRA 2ZDSA 2ZUWA 3UXLA 3OYZA 4YWIA 4PFMA 1BYDA 3IIOA 3MY9A 2QUTA 4HYRA 3CC1A 1U5JA 3IRSA 3E0VA 3AISA 3WEMA 1UH3A 2FQIA 3I4EA 3PZMA 5DXYA 3C3NA 3HM7A 2Y89A 4AHQA 4CCCA 3H2FA 5LZLA 4IJRA 2OO0A 1JPHA 2Z6JA 4JTJA 4JL1A 4AIEA 3IGUA 2NZLA 1LQ0A 4PMZA 4HNVA 2YA1A 4DPPA 4O0KA 3GYEA 4W7WA 3UZZA 3RPTA 2QDGA 1SO4A 3NQVA 1UWTA 4HZ6A 4DZHA 4DZIA 1BF2A 4JY8A 3WQOA 3KRSA 1P6BA 4X63A 1OZQA 1VS1A 1LYXA 4MLRA 1Z42A 3Q2DA 1UKTA 4HNTA 3GDMA 4LYRA 1C8QA 4PB3A 4PN2A 4QBXA 3SCVA 2OKTA 1RR2A 4GI9A 4BI5A 3R13A 5LIUX 5TBOA 1VJIA 3VX1A 3Q4DA 2H9AB 1EP3A 1N2VA 3ZR4A 4WY0F 5A5WA 1ZNNA 1JIBA 2YXXA 2GVEA 3SSZA 4FX6M 4JTCA 4JZ5A 4LVBA 1A3XA 5D2XA 3W2LA 2VELA 3PZOA 1W6TA 1Q45A 3TWAA 5HPCA 5IFPA 2G97A 3CAQA 3CASA 4JCMA 3I68A 1BKHA 4EWND 4ZXLA 4MUPA 3PY2A 3RR1A 2WMKA 5K9XA 2OO6A 2DIKA 4G8TA 3N17A 5LNSA 1BVNP 2J13A 1W31A 5XIAA 5JBDA 5CAHA 3WZ0E 4C6OA 3QXBA 2DUZA 3IJ9A 2OWCA 1MXDA 4BF9A 3NZ1A 1KFKA 2WNQA 4ZO8A 4HA4A 5E93A 1PXGA 4IGNA 3DENA 4BA0A 1V02E 1OBAA 2V68A 3M44A 1DJQA 3WJYA 2E6YA 1QHZA 3GB6A 4QNEA 4S23A 3GG7A 1T7LA 2V67A 5K4XA 4J3UA 2DZVA 1IZJA 3TZFA 3DBPA 1JNEA 1JXJA 1WE5A 3IK4A 2J9ZA 1M65A 2X05A 4M7TA 4DX3A 2PDNA 3C3UA 3GHRA 1RVGA 3ZSTA 5FF2A 2I57A 1S5MA 3U7VA 2HVMA 3TSDA 3SY8A 1QT1A 2BGNE 1US0A 3EWBX 4GHRA 3UZYA 2Z1VA 1GOMA 4GVFA 3VKAA 3MP3A 2P10A 1X6NA 3PZNA 3DXIA 3T2PA 3K4DA 3G6MA 1DOSA 1QPRA 4NKCA 2DQXA 2CKRA 4LV4A 1UP0A 3NQBA 5FF0A 1E71M 1GVYA 3AO0A 5AYYA 1ECQA 3LGDA 3JW7A 1T8QA 3L4ZA 4L61A 5A8PA 4YTTA 4MUZA 3G1HA 3A4WA 4GVHA 4J5NA 4BZYA 2EKGA 4GYJA 1L9WA 4O4VA 4PR4A 2GUYA 5LHEA 5CC6A 3UCCA 1LL6A 1EUNA 4FXFA 3GW3A 3PUEA 4JYEA 4LS1A 3S2JA 3MWCA 3UXKA 2FPVA 3QHMA 3ZQ9A 4Z2GA 4DF2A 3WK1A 3W26A 1EDGA 2CPUA 1JFHA 2H3BA 1GVIA 4JTHA 4AF0B 1J11A 3IIPA 4IL2A 2BG5A 5REQB 2YBUA 3NAVA 1TRIA 1GQNA 2YW4A 5G5IA 1WXZA 4AD5A 3AHXA 3CV2A 2QHAA 4KEZA 5DMMA 2WZTA 3N15A 1SR0A 1GQJA 5D9NA 5C9UA 4CU8A 1JQVA 4QX4A 4AFYA 2CFFA 1J0YA 2WQPA 3RLUA 5J5DA 4H7VA 4N6FA 1KXHA 1P6CA 2XFFA 3VFLA 4DI8A 2ZZ7A 1QBAA 1R5YA 3NSMA 1L6SA 1SZEA 4NU7A 3NPXA 6ALDA 4WSHA 5CLTA 3PJTA 3VGEA 4WKAA 1Q2SA 2O7QA 3H2OA 1TV5A 4JCLA 3GS6A 1H1NA 3PZUA 2BY3A 2WWDA 4LRSA 3UW6A 3CTTA 3I7QA 1IF2A 2FMOA 2XM2A 3DYOA 3GTIA 4LU0A 5G2WA 3FCPA 4Z0SA 1O1HA 3W01A 4UFHA 3HV9A 3BAKA 4DZAA 3WQGA 2HWGA 3WH5A 2O0TA 1DP0A 2DIJA 1XDMA 4JYFA 3PNUA 3ABXA 1FCQA 2FDMA 3ANYA 9XIAA 4WF7A 1H51A 2YDSA 3E1F1 5CPNA 2PU0A 3UBPC 1RJPA 3STCA 4JHMA 3UG3A 3OHIA 3AS1A 1Q6RA 3AYSA 4AMCA 3UNDA 1W32A 1KFBA 3WYZA 3GNXA 3UJ2A 1W9PA 4O1CA 2WMGA 4IMDA 3ZLHA 1Q2RA 4N9BA 3ID7A 3TW7A 6CGTA 4OU1A 2BY1A 2OYLA 3VOJA 3WDRA 3UYIA 3TJ4A 4ZL1A 4B91A 3IVTA 4ZFCA 2D23A 2A3LA 3CZEA 3EXRA 2EJ1A 4INFA 2ACRA 3G1AA 2OOFA 1PS9A 3PFMA 3NL2A 3FJ4A 1T41A 3D46A 5DCDA 3HOJA 4S3GA 2PODA 4P7LA 2OLSA 2O7SA 2EBNA 5IM51 3TQVA 4A21A 1LCOA 3R0UA 1VHNA 4C6JA 3R1ZA 1C29A 1W1IE 4WY0B 4UBPC 1PCKA 1VRXA 4I9TA 5I6SA 4XISA 3TYBA 1FCUA 2R1NA 4GYPA 3CIWA 3K4WA 2QULA 3W1UA 2Q8LA 4MADA 3QQWA 4F66A 3IIVA 2FPTA 4DXXA 4O19A 1ZCOA 1QI0A 4OOZA 3TP4A 3L65A 1N8IA 4U28A 5LHFA 3M41A 2VRQA 4GIEA 2G4JA 3GFXA 3FGCB 3TC3A 1QU4A 4O15A 3BV4A 3DFOA 5A6BA 4IMFA 3S1XA 1DXEA 2J8TA 1ITXA 3RCYA 2KAUC 4ZZ9A 3RLHA 3NWRA 1JCYA 4MKVA 3HPAA 4UTHA 2GGHA 1PWMA 2OYMA 4URIA 2CHNA 2PPGA 2QCDB 2TAAA 5HUOA 3U2CA 1XDJA 1IV8A 1LWJA 3OVPA 1F8IA 1NFPA 1XG4A 4C7GA 1HP5A 1J4EA 2Y7DA 1DWIM 2OEMA 1V4YA 3VC5A 4QG9A 3B0PA 1OK4A 4PB4A 2NQJA 4PTVA 2DZXA 4OUIA 5H8PA 3MU7A 3SQLA 1ZAIA 4QS5A 4FX8A 2VURA 1XG3A 4AEEA 3EX1A 5DY2A 1SZNA 3HG5A 3OTRA 4ADUA 1M68A 4JTDA 3RLGA 2BGSA 2POTA 3TV8A 2R1KA 4MY1A 1TJ1A 4MFEA 1W1VA 3BV7A 5HPOA 3A22A 1NU5A 4CD8A 1YPFA 3B04A 5FL0A 2ASHA 2PE4A 2PC4A 3FW6A 4Y6GA 5M2FX 1XBZA 2VUNA 3VMNA 2VOTA 3FA3A 3ZMRA 6TIMA 3GAKA 2IXUA 3W53A 4IPPA 2PWDA 1NDZA 2RUSA 4KMQA 2NQ9A 4KWVA 3W6LA 2ZUUA 4JDYA 4U3AA 3SIMA 4LUYA 3T1GA 2QIWA 4QCEA 4BCEA 4HU0A 2PF8A 4JEJA 4ICNA 1P6WA 2CZFA 4W8BA 5FF7A 3NEVA 3PTQA 1DORA 1WB0A 5EA9A 4FA3A 1FH9A 4OKDA 4K7YA 1XYBA 1ZFJA 2Y61A 4ILSA 4B4FA 1FKWA 1JYXA 4PUUA 2RJGA 5HA7A 3WH9A 4C90A 5HMEA 1P1XA 5ABFA 4QEHA 1UZDA 4MNKA 4AXKA 1UR2A 2WJEA 3UJSA 2Y63A 4XAPA 3R8GA 2CITA 1GQKA 5BNKA 4W86A 3F5LA 3LPPA 1L0PA 2V38A 5H91A 3DFSA 3WH7A 1UKQA 2QAFA 3WDJA 1SPQA 3W7CA 1H7WA 3IGSA 2OCZA 4S3DA 3NQEA 3GUGA 4XVEA 1EIXA 1SUXA 1Q4NX 2QPUA 5BWAA 1K6WA 2IMRA 1HZYA 4LB3A 2AGKA 5CC3A 2A1YA 1TPWA 3OGRA 3HBLA 2Y7FA 1CGWA 1W1PA 3SCRA 3A21A 3R89A 3G24A 4HNLA 5BCAA 5KETA 3L7RA 3SADA 4R5EA 1T0OA 1EDQA 4RE3A 3IAPA 4Z1DA 4FIRA 2Y2WA 5C0QA 1ONEA 3B40A 2QCFA 3HGSA 1JG9A 3LZ5A 2I5IA 1V3MA 5B7YA 3FNDA 4V15A 3N29A 3NOEA 4D6DA 3ZIZA 3B8SA 4Q33A 3LSBA 1ZJBA 4RE0A 3R94A 3VD3A 1XBVA 4NJHA 2QMJA 1SVDA 1ZTVA 3HG3A 1NEYA 4AVNA 4QXIA 4FXRA 4X60A 1SW3A 3CUZA 1PX3A 3QZAA 1EF3A 1SM9A 5MKGB 1RSCA 1BXBA 1QWGA 3P0WA 2OGJA 1JL8A 1KFCA 3KOZA 3R0DA 3B03A 3ITVA 3SUWA 4M6VA 5G1TA 1EB3A 1IXNA 4RW3A 1QMLA 1U22A 3ZLGA 3UD6A 1JRBA 2J7HA 4QDPA 3AMKA 4B2DA 4DJDA 3NO1A 2A3CA 3SCNA 3O0FA 4Y9NA 1R7AA 3TQ0A 4ZFMA 3ELFA 1GEQA 3E0FA 1KR1A 4HKPA 3MMTA 5DX7A 1W9UA 3AROA 3DI1A 4Q8TA 5U4NA 1W1YA 4Q7IA 2PDCA 3D6NA 4L9XA 1AW1A 6TAAA 4S3BA 4WJ8A 4KFOA 3ZSSA 4UTWA 3WUEA 2WHKA 1F6YA 1E55A 2J88A 4MOZA 4DLFA 3E5BA 3MMDA 3T0CA 1DJHA 1NDYA 4KWSA 4J3TA 1TE6A 1U30A 4U2ZA 2RDTA 2QVNA 3VNLA 5LSMA 4A8RA 5AC5A 4GIYA 2D69A 4NZFA 5D30A 2GK1B 3T55A 1FOBA 3WL1A 2NWRA 1VYSX 3MQTA 2VZUA 3RAOA 3H2NA 4TVDA 4V33A 3PN8A 3QRHA 1EWDA 1OHLA 4Z2HA 3TYZA 1HJWA 4JYDA 4E0CA 3O6DA 3ANVA 4H9UA 3R7MA 1KRBC 5AVNA 2PA6A 3F4VA 1R3VA 2ACSA 2GVLA 1H41A 2HNHA 3SJNA 1C8YA 5F1UA 1HXJA 1TPUA 2E4TA 3B9EA 1N82A 2CEQA 1JZ5A 3UJRA 5FSDC 3KOFA 3EOLA 4XBSA 3TWBA 4OZOA 4CN1A 2OLAA 3I65A 2BHZA 2OR2A 1YNQA 4B4HA 2VEPA 2XH4A 4F9JA 2E6FA 2Y85A 3LY0A 1KR0A 4C60A 4HJWA 5D09A 2NV1A 3NQ8A 5EMMA 3GTNA 1MNSA 3B0YA 3VKJA 2X16A 1I2NA 1MI3A 1WP6A 3E2QA 1EOKA 1PZ3A 1D8WA 1R46A 1QASA 2PWFA 4D9PA 2E8ZA 3VXGA 2QGYA 1XCWA 3II1A 3KTSA 1VB9A 1BQCA 3QFWA 3VNYA 1R7OA 4POCA 3PK7A 4PRTA 5A95A 3UVAA 3FVMA 5AC8A 3W7RA 3I7RA 3ZVHB 4L56A 3L66A 3A9BA 5EGRA 4GISA 4MB3A 4HQVA 5HWJA 1LQAA 2ZC8A 2JK2A 2R91A 1XRSA 1Y5XA 2VXNA 3SRFA 2DDXA 4HIBA 1CLKA 4L5ZA 1R9ZA 2INFA 4I5RA 3G3DA 5TIMA 1M1BA 1ENUA 1TVLA 2WMFA 1QPOA 5A6KA 5CG7A 4S2BA 4D8LA 2PS2A 2XINA 3PTKA 3LV5A 1DIDA 4O57A 4ERAA 5IHRA 3RNDA 1XL9A 3S4TA 2ZKMX 1E6NA 2VVNA 3H54A 2VCBA 5I0DA 3WLRA 2XVNA 3A5VA 3KVMA 4BI6A 1TPEA 4S3KA 2GWNA 1BRLB 3FOKA 1UR0A 2IUZA 1MW1A 1W1A1 2WLYA 2QLYA 4WJEA 2WC4A 5F1VA 2QV4A 3RCMA 3NCOA 3PZTA 4JFWA 1E0VA 2VDIA 4LFYA 2AQVA 3M7WA 4LUIA 3TTYA 1LM1A 1TPB1 1EYWA 1FWWA 2WAGA 4EPEC 3B8VA 1MZHA 1AJZA 4JPGA 2IXVA 3ZJ6A 2G3NA 4NJGA 1GWJA 2DH2A 1GOWA 2QJGA 2FZ9A 2WOQA 4KBXA 4IGMA 4AZHA 3W86A 3G1XA 2RAGA 4HU4A 3MMWA 3SEPA 3GVGA 2XH7A 1ICQA 1KKOA 1UD3A 4J40A 3NQ6A 4QISA 4YHEA 4MKNA 1G94A 3W84A 1WPCA 5G4WA 1KGUA 4JQ1A 8RUCA 4XO6A 1OGGA 4QEEA 1E6RA 4HCHA 3WD3A 1LRNA 2WPGA 2F2KA 2AMGA 2CBJA 1TTIA 2FDSA 4B3LA 5HATA 4RZ4A 1CB7B 3KE0A 1JGMA 4Z2IA 2OQHA 1V5XA 2DPEA 3BW2A 3K8LA 4H7CA 1JAKA 2HK1A 1W9DM 4K68A 2E40A 5FL1A 1CDGA 4BEQA 3KRBA 1K7FA 4QCFA 1B30A 4HYVA 1PZ2A 1ZJHA 3S2NA 2JIEA 3TQKA 1UBPC 3AYTA 1QO2A 1DQUA 1V6XA 1US2A 1YKWA 3SGGA 4Y9OA 2PCEA 4QITA 3M9YA 1JULA 4FLOA 2GL5A 4KCTA 1KQYA 3GVRA 1JDFA 2E3ZA 1CI1A 2A0NA 2PF0A 3WLKX 1PO9A 4O4WA 3G1RA 1HKKA 3I6TA 1XISA 3ME3A 3GIPA 4XBKA 4ZA0A 1M6JA 1AD1A 4DWSC 3WUBA 1JI1A 4H8VA 1K6AA 4P8VA 1Z48A 3DEQA 3G1SA 1CXEA 1JPDX 2ZX8A 3IAQA 4NILA 1DJGA 2YCIX 4Q7BA 1ZB5A 4M1BA 1WBJA 4GRSA 2Y24A 1KC7A 4RDVA 1TWWA 2PLMA 3T0AA 3EPOA 1DPMA 4EXQA 1IGWA 4HHHA 3RJXA 1VLWA 4NX5A 1XV8A 6REQA 5I77A 3QQ0A 5E0FA 4E3TA 2VFEA 4Y96A 1EJXC 3TYEA 3KS5A 2CLLA 4DUWA 4H83A 4OUEA 4R7WA 1FCBA 1G7VA 1VF8A 1JZ4A 4IXHA 1D3HA 1TWSA 1PE1A 1F61A 3GE7A 4M81A 1ZALA 3H26A 1V3IA 1GW9A 3WL0A 1PTGA 1P0EA 1FUYA 2WZIA 4BF5A 2ZIDA 3OO2A 4AZBA 2WSRA 4A2RA 4XUYA 3TSMA 1J5SA 2BGQA 1W1B1 1NOWA 1TIMA 1WUEA 4IPNB 5EMJA 3M5VA 1LLOA 5ECVA 3S6TA 3T7VA 3URBA 3RGTA 1L2QA 4DBEA 3KOWA 1M5WA 3FK4A 3QKEA 1YHTA 3QC0A 3ALFA 1HL8A 1OCJA 1VHCA 3P5YA 4QP0A 3GZ3A 1F3EA 5C2XA 2EXOA 4KWOA 3LLDA 4X9YA 4YL2A 4PUWA 1IEXA 5EY5A 4MZYA 1F8MA 4PE8A 3V5FA 1BF6A 4MJ2A 1YE6A 2VRJA 2CWNA 3XINA 1FHUA 1XIDA 3MSDA 3WCZA 1PIFA 3ITYA 4L6HA 1FKXA 3BWWA 2JIWA 1N8FA 4ATLA 1QWKA 2I9EA 3GFZA 5CJ5A 4XB3A 1RA5A 1CWYA 7REQA 3SIZA 3GDTA 2FHCA 3ZVIA 3BO9A 2ISVA 5JUVA 4GC4A 3BJFA 3SFKA 4H2CA 1BFNA 4QE1A 1PUDA 1FWEC 1HIZA 2DUAA 1H0GA 2XVLA 4CCEA 2BBFA 4FXSA 2Z0IA 3CUHA 2QDEA 1KBIA 4XX6A 4MJZA 2YW3A 1TO3A 4K8HA 2NSOA 1YADA 4EAYA 4HU8A 3O3RA 5HK4A 4Y9PA 4PCTA 1Q4WA 3V4BA 3TA6A 1XRFA 3VOIA 5FF3A 4RXGA 3BGGA 4PCSA 4Z1AA 1XXXA 1IGSA 4PMOA 1ZUAX 3ABQA 5G4EA 3L5LA 3H70A 3TH6A 1BXCA 4CQ9A 3MDWA 1J5TA 4JICA 3VIOA 1AG1O 4HHMA 2J7FA 4AXNA 1SFLA 2YDRA 3W1LA 3MP5A 4A8IA 3WF0A 2ZBTA 4OWGA 3FV9A 4C6FA 1F6PA 5H2ZA 3TJIA 4PMVA 4A05A 2XGIA 4U4MA 3IRDA 1KRCC 2QF7A 1REQA 3HTWA 1TZZA 4KPLA 4C6BA 5K7JA 1YMYA 4CNNA 1OFDA 2WVVA 5F2IA 3QF0A 4D1IA 3KDOA 3NJ3A 3NL3A 4HCLA 4US5D 1CGUA 5I5RA 3NNTA 1R3WA 4FHAA 1F05A 5T26A 4WVXA 3URNA 2CLIA 2Y8UA 4DO4A 4FNSA 3HO8A 3V75A 2HS8A 3PC0A 2XVPA 3THDA 5FOOA 4B90A 3LHZA 3GKFA 4LANA 3EWXA 1Y5VA 3LXCA 2E7FA 2FJUB 4Q8VA 2QUUA 4OE7A 2C8NA 3BLEA 1GT8A 4U33A 1UOKA 2Y5EA 5CAKA 4LC6A 2Z26A 1TWIA 1IZKA 3UR7A 3V0SA 3I7SA 3L2LA 1FWGC 3PPHA 2PDLA 4HCDA 3EMCA 3CZ8A 3S1WA 4B5TA 2VMFA 5SWUA 3CL6A 4QHRA 4HSNA 2QIIA 5DMNA 1O5RA 2AL2A 2PD9A 4GO9A 2OZ0A 4LUSA 4H6KA 3DHUA 4W4QA 1E6PA 1VJSA 2AL1A 1V3JA 4TV6A 4C91A 5FJIA 1L6FA 3PPFA 4L4LA 2V63A 1VFOA 3ITLA 2H8XA 5CZTA 1PBGA 4MWAA 2QZRA 2OZTA 1SZGA 2P3ZA 2R14A 2W92A 3RR4A 2OFJA 4PSPA 1NELA 4PCNA 3BLKA 1TZ7A 1QO5A 2CETA 1YE4A 3B0UX 2GQ8A 4XZHA 3ARVA 4LH8A 3VNKA 3BAWA 3GBDA 2NWSA 2B31A 3GY1A 4JHZA 1C8XA 5ABEA 1ZP4A 1W3KA 2VR2A 1FFRA 3AHVA 3MO7A 4RDZA 4AISA 4HHPA 3VNZA 1JPMA 5LIWX 1O5QA 5D2YA 3PPGA 1E73M 4NF7A 1UZHA 4J3SA 3UWQA 4WR3A 1G1YA 2J7GA 1EQPA 3W9ZA 1GOKA 4M29A 1B4EA 1XLLA 1IIHA 4RPQA 5BOEA 4Q3MA 4GJIA 2H6RA 2P5NA 4O54A 2GSJA 3UWWA 3AYRA 1TZ9A 5T9CE 5KZDA 2CZVA 3QGKC 3TSBA 2OOGA 3ARTA 1MDRA 1RQHA 2QJMA 4YS1A 3U7BA 3LCHA 4WXYA 4CD7A 3CZKA 1UWAA 1K9EA 3TTEA 3GH7A 1SZFA 3CL7A 4R7JA 3M6DA 1DWGM 5C5YA 2WCGA 5BOOA 1P5BA 2ONEA 2BXZA 1DWFM 2V5CA 3I3EA 2G41A 2VX5A 1K8CA 1C9WA 3L67A 5IHSA 3SCQA 3L4TA 1BGGA 2XGZA 3KBWA 4WZHA 5DEZA 3IJIA 3M16A 1J79A 3GWQA 1ZU8A 5AHMA 2X7WA 3BSMA 2G96A 4W93A 3IV8A 2QXWA 3SO7A 3W25A 4KWWA 1RH9A 2R24A 4H9TA 2A6LA 2Z25A 3W71A 1JCXA 1H4PA 4NAEA 5EU9A 3T8LA 3CEPA 4IZGA 1XI3A 4NXKA 4TTUA 1PVNA 3C2EA 1SO3A 1Y0EA 4ACZA 4DJEA 3VIHA 2V3GA 4GYFA 4G7EB 1NOFA 2QJNA 4ROQA 3WF1A 1VEPA 3LCLA 4PMDA 2VFHA 2V3EA 2OG9A 1YYAA 1GHSA 5HBFA 1TJ0A 3WN6A 1XYLA 2ZX5A 1VBRA 4MGGA 3PNZA 1CENA 2GLKA 3EX3A 4LW7A 3IANA 1CIUA 3B9OA 3F4NA 1TIWA 5DT7A 3L0GA 5I78A 3KBJA 1LRQA 3FEQA 5JIPA 1V0NA 4HTBA 2CU0A 3T9PA 3VM5A 1A0CA 3I3DA 4MVAA 4C7FA 3GZAA 1UKOA 3N3TA 3LM3A 2ZX6A 4I5UA 1E0UA 1DTUA 3P62A 3ENLA 2RKXA 5E0CA 2QCEA 1ZGDA 2Z7GA 1F3XA 3F5JA 1E1FA 1FBAA 3QZ6A 4I9MA 2FHFA 2EKCA 1B57A 1HJXA 4UC5A 3SCUA 4CN4A 3QGAC 5CCZA 3VCCA 1V02A 3LENA 5HDRA 1WKDA 1Z44A 3BGJA 2XDFA 3W75A 2WC3A 2ISDA 3RMEA 4PUDA 1W5OA 3TN4A 3HG4A 3A13A 3GTFA 2HQAA 1HJVA 1GNXA 3WH6A 3LB0A 2NT0A 1BWKA 2YL6A 5DCEA 1E9IA 3H4XA 4QTGA 2W5FA 5I07A 1B3WA 1QVBA 2V3DA 3B0XA 2PDWA 4WGXA 4Y7EA 3UXDA 3WDPP 2D2HA 4NYUA 1LL7A 3MS8A 4JGDA 1S1PA 4K8EA 3AYVA 2WANA 3VPLA 3QHNA 1EBHA 2I56A 3C2FA 5CSYA 3M64A 5M3WA 1MUMA 4TX6A 3N3MA 2IPFA 1UR9A 2QF8A 3WLJA 3DFNA 4PFHA 3B4UA 4Q6XA 4JN6A 3BAIA 4JTAA 3AMGA 1VBHA 4UTUA 3M6YA 3ZT6A 2ZQ0A 3G0XA 4EOUA 4TQTA 3OQ8A 2PTWA 4DF1A 1W3LA 5CSUA 1BPLB 4FOUA 5AB3A 1HJQA 1KBKA 7PTDA 2XWEA 4XD5A 5D04C 1S46A 4C6IA 1ZZMA 3FA4A 2F84A 4C5ZA 1EJSC 3LV6A 3QJAA 3OOQA 1U1JA 2P8CA 5D03A 1O68A 5JXQA 4NXSA 3P61A 2Y0FA 1K8YA 3DFHA 3TVAA 1E4LA 1NWSA 4N6EA 3Q67A 4QNWA 4CCDA 1XC4A 2VQTA 2VC9A 4L7ZA 3MVTA 2YLAA 2RFGA 4CNPA 5LIXX 3LCGA 2W0UA 4WIWA 1C91A 3B8UA 2DZBA 4IQDA 3CPGA 1VRDA 1CGYA 4FLQA 4UTFA 3QN3A 1ADOA 4DY1A 4QR6A 4GO8A 2YA2A 1ZQ5A 3RX2A 4IICA 1FWJC 4U5KA 3VIIA 1MFUA 4NASA 3EYPA 3TMLA 4LF1A 2PDXA 4XAGA 1DTNA 3S5ZA 4G2DA 5EMLA 3W1RA 2A21A 4MZ1A 1Q6LA 1W37A 1E5JA 4FNPA 2E68A 3LHTA 3ARQA 2BHYA 1J01A 3PS7A 4G7FA 2Q3RA 1HT6A 3HN3A 2IKHA 1ZBWA 1TX2A 2V2CA 3VGBA 4JX4A 1GVQA 3AALA 4NVTA 4EX4A 3HG2A 3QW3A 4A4AA 4Z1YA 2VX6A 3MO4A 3VD4A 2H9AA 1HF6A 5GQBA 2PLKA 2GSHA 2YYUA 4CVUA 1RUSA 1FTXA 2ZXBA 2Q3OA 3GVWA 5A3HA 4QROA 4A3RA 5DF0A 8TIMA 3OZYA 4LVAA 1YX1A 3CQJA 2ZTJA 1SGJA 1TB3A 4XD3A 3WDIA 1B9ZA 5TAOA 2HJPA 4GCXA 3W1NA 5T91A 3L5AA 3KLLA 3ZR5A 7CGTA 3CWNA 1A0DA 1A4LA 3KWXA 2VQUA 3VOGA 3GQYA 5CC5A 2QAPA 3CYVA 4AU0A 2ZX9A 3UPMA 1CNVA 3IWPA 2V2DA 2WSYA 3SN1A 4TX8A 2E77A 1QHPA 4JFTA 4OVXA 4CUCA 5CJNA 4JY9A 1TE1A 1TVPA 3MKKA 5IBXC 3ZO9A 3EWDA 1CX9A 3MI6A 4IUGA 2XM1A 3JR2A 2OWWA 2AAMA 4UR9A 2FTPA 1YNPA 2D20A 3MUIA 3LI0A 3LBOA 1CLVA 5FKYA 2WW5A 2FB2A 2QCLA 2E9LA 3WLMA 4MB1A 3VIFA 5GJMA 2ISWA 2ABBA 1KW1A 4CEUC 3W72A 1QPQA 1QW9A 2DSWA 2QDDA 4QLKA 3F03K 3BOLA 2E9BA 1XLCA 3S0CA 1YBQB 1Q7ZA 1UD5A 4HTYA 4LTSA 3E49A 4JOMA 4OTKA 1C92A 1OF6A 1VGAA 4ICCX 3B9AA 3FX4A 5E0KA 2WXDM 3HGOA 3GD6A 5C9RA 2CZEA 5C9ZA 3KS6A 3W76A 3VD9A 1X1OA 3WF4A 3PULA 4H8HA 1FDYA 3W82A 4DM2A 1VFSA 3OGVA 3AXXA 2ZUTA 1M3UA 3DFTA 3NDOA 3RU6A 3TE9A 2OPJA 3OU8A 3WNNA 3NM1A 1ME8A 3N6JA 5D33A 1A4MA 1G4EA 1UROA 5EMYA 5LNUA 3RUBL 4W5ZA 4DBSA 4LBUA 1QOXA 1VCVA 4QG8A 4LY4A 3TW9A 1FX6A 3Q45A 1UD8A 3BQ5A 3JZUA 3PZIA 4RNFA 1FXQA 4LBRA 3EX4A 1P7TA 1UWIA 1JFXA 1ZENA 3W3OA 3EWYA 1WX0A 4LBSA 2YSWA 1L8PA 3QV8A 3L0NA 2PWHA 1EXBA 2WKGA 4OFCA 2VFGA 4H9MA 4PUNA 2ZICA 1LT7A 4LCSA 2GGJA 3G22A 4YIWA 1V77A 2DT1A 2Z1BA 3W7PA 4GI8A 2A3HA 3QR1A 2ZX7A 3CXOA 2YJQA 2EPOA 4L64A 1DJXA 3HQNA 3MV11 2NVAA 2CXEA 5K4ZA 4TR9A 5HR7A 1ITCA 1XLGA 4IG2B 2Z7KA 1YDOA 3WLSA 1EIBA 1Y8BA 1ZBKA 4TMCA 5KTLA 1TQJA 1JZ3A 1LBLA 1NY1A 4JTTA 1M7JA 4IXXA 2DVXA 1B90A 4JNMA 1ZBCA 4AW7A 1ME7A 2WCSA 1TELA 3VD5A 2DORA 3CV7A 1E6QM 3JRKA 3GAYA 1BSIA 2V9DA 3W87A 2XIIA 4U31A 2J78A 4WXZA 5T8GA 5DMYA 4EF9A 3NG3A 2F6KA 2Z2AA 4XSMA 5FD0A 1NQKA 3HMCA 2PC8A 3Q94A 4G56A 1JZ8A 3OVRA 1Q65A 3S9YA 5JU6A 1ML1A 3GG1A 1TSIA 2X1SA 4H9XA 2BTMA 3W0KA 2YB1A 5E6ZA 3SR7A 2YCLB 5GJPA 2PDPA 2ZVIA 2X0HA 4PCPA 4J7RA 3ZXWA 1F6KA 4AVFA 1DIKA 3RPDA 1A0EA 1QDSA 1UC5A 4J9JA 2XFWA 2OZ3A 4XTDA 1EEXA 3LRMA 4IPIA 3RLVA 3EOEA 3VDGA 3MDUA 3K30A 3POCA 3W7KA 2V3FA 3BK0A 3QOMA 4TOQA 4CQAA 2MNRA 4IM4A 4NAFA 3P81A 4ATWA 3WUGA 3GNNA 3FHAA 1EQCA 3ZR6A 1T40A 2ATSA 4P61A 2GWGA 1ZL1A 2HTMA 2Q01A 2GGIA 2R1LA 2CWXA 3GXDA 4FEZA 2UBPC 1JDEA 4O18A 4FIQA 5D9OA 3AXHA 2Y88A 5A6TC 1U1UA 3P93A 2WVUA 4JIHA 1BQGA 1QNVA 3L12A 3SBFA 1GTHA 4O28A 1LOQA 4ORIA 2V5LA 2G37A 3ITGA 2Q6ZA 3DERA 2L5HA 3FJLA 1GOXA 2VO5A 3WLNA 4J3XA 3U2ZA 1X98A 3CIVA 1VD6A 3UU0A 4OQVA 4L80A 1Q7MA 3UWEA 3PPCA 1DQWA 4RUBA 2QCDA 4KRTA 1WA3A 4S3EA 1XINA 5HJYA 3W22A 4V1YA 4MLJA 3QQ1A 4HOXA 3W2JA 2F6XA 5HWNA 4B3KA 2G0WA 4E2BA 4N4PA 1A3HA 2AGTA 1Q6DA 4H9ZA 2DZAA 1BD0A 1XQLA 1F2JA 4J28A 1XLEA 3QY6A 3E12A 2VGIA 4JS3A 4E8CA 1NQ6A 3IUHA 3BC9A 1UWSA 5F2LA 4OIFA 1I6NA 3QV9A 1OGSA 3L4VA 2GZXA 3ARUA 3CMFA 3V5OA 1SJCA 3RILA 1RD5A 3VKKA 4LB4A 2QUMA 4D6EA 1DL3A 2PP0A 3GHUA 1Z6KA 3KLKA 2GJPA 1UP2A 4C1KA 2GGGA 3UGRA 2GGEA 7REQB 3P84A 3SN0A 4LQ1A 3SQSA 4FF7A 5CBJA 3VIGA 4C6DA 3NR0A 1G4PA 2D1ZA 4IMGA 1D3CA 5I3FA 1OFEA 5I3DA 4GG9A 3NO3A 1LOLA 3LLFA 1RPXA 3BLLA 1VBJA 4AD1A 1FQ0A 2WB5A 4NL1A 3LGEA 3IACA 1KM5A 1E6XM 1AW5A 4DZ5A 1PKYA 4PRWA 2FVKA 3CNYA 4CQ8A 3BPWA 1H5YA 1RBOB 5CJMA 1R2SA 4DJFD 1UIOA 1V93A 3SFWA 5KEZA 3KHDA 1G0CA 3ZWSA 1QI4A 1PKLA 4KT2A 3CQHA 3AC0A 4BF7A 3CLMA 1IQ8A 1YDNA 2VEFA 1JPKA 1S2TA 2OQYA 2E9MA 2BVTA 1R9YA 1CEOA 2WJFA 4HK7A 4BQ5A 3EDKA 3EOOA 2XH0A 1DJNA 1WBHA 3P2VA 4GY1A 4BS0A 2GUBA 2XIBA 4GUGA 3CHEA 3P8JA 3NQFA 1REQB 3STEA 1XLAA 4AZIA 1EC7A 3TK7A 4IIEA 2WVVB 4N9EA 2OYKA 4YVVA 2YDQA 1XJBA 1UR3M 1DBTA 4I8YA 2O9OA 3ABOA 3KBNA 3UY7A 1GVEA 3TYCA 3W7MA 4CCZA 1IR2A 1JQXA 3R43A 5CPQA 3MUY1 2Q02A 4CGTA 3Q58A 4K36A 3GH5A 3APYA 4GH1A 4YTSA 1PJ9A 1SFSA 4HA0A 5G1YA 3SUVA 4KQNA 4JX6A 3M5ZA 1FP9A 3CPUA 4GY0A 2FJKA 3W1QA 2GVJA 4Y8FA 4DJED 3MCOA 5FEPA 4YNGA 2CLEA 2B81A 4R88A 1I2PA 3LERA 3USBA 5GJNA 4MTVA 5A69A 3K4AA 3I10A 3THCA 1UKPA 1XIMA 1I9CB 3NVDA 3NA8A 4YYFA 3MV01 3NFUA 4WOQA 2YL8A 3GX9A 1QW7A 4PCFA 1JNDA 2DSKA 1B31A 1W17A 3GUWA 2AL2B 4XD4A 5F2GA 4LUSB 3TROA 4FNTA 4N9DA 4HMEA 3RITA 9RUBA 3R4IA 2X42A 2XYLA 4K8GA 4MWAB 1KFWA 1YXDA 3HFYA 5MKGA 3VILA 3IJ8A 2J8GA 4GYKA 4PMYA 1OY0A 3S5YA 1EA9C 1OX4B 1M53A 3EX6A 1J93A 4TV5A 4LF2A 1VKFA 2F9RA 5J04A 4S39A 4Q8WA 3TXZA 1C7SA 4C6PA 2V8ZA 3PZ9A 1TV4A 1XYAA 3SCPA 1UKSA 4IP4A 3AI0A 1ADSA 3MYPA 3PZGA 4ZOCA 3UERA 3KVLA 3T0BA 4QAIA 3SN4A 3KOYA 4ENLA 1RJRA 5DT5A 1BYCA 1E0TA 2VUYA 4DIAA 1OIMA 4GLEA 5LKYA 2JKEA 4ZEPA 3SY5A 3CYJA 1VFUA 3KWSA 1XLDA 3PJXA 3XISA 1F9CA 2OZ8A 3H2MA 1HVXA 2AMXA 4OBTA 5FESA 1KXQA 1UBSA 3K13A 3B97A 3PTDA 2GK1A 3OZPA 3PBUA 1PAMA 3SCWA 4AD4A 5LA0A 1LTDA 5L9FA 5JQ9A 5HR6A 3TEVA 4ICMA 4P7QA 3QZEA 3IEBA 4U2YA 1PPIA 4JFUA 3GSMA 3FEMA 1YEYA 1OFOA 1ME9A 1KBLA 4ZB0A 2ACUA 2XIQA 1QW8A 4TTGA 3NQAA 2DZSA 3DI0A 3SUUA 1B3ZA 4MF4A 3PUOA 3LYEA 4NAEB 1UG6A 4BEUA 3WBWA 2BY2A 4DO6A 4JQ4A 3WY1A 3PSWA 3S1VA 3KL3A 3LHVA 2OMAA 2W27A 3D47A 1DHPA 2P0OA 1UA3A 3IUDA 2ISFA 2GJXA 5HQLA 1ZLPA 4M1RA 2NW0A 3E0IA 3M46A 3BTNA 3WJZA 1FWSA 4EXAA 3GW0A 2VI0A 5LA2A 4TMBA 3O07A 3EMZA 1H2JA 1XLFA 3L2IA 2UV8G 1OT1A 4F2TA 1XLKA 4QQ3A 2EF9A 4P7NA 4Q8QA 3C2VA 3N4EA 2Z6IA 4IX0A 3YPIA 3NQCA 4L1XA 3OZOA 1YDYA 1HO4A 1P43A 2VHLA 1JCTA 4ZQNA 4PA8A 4S3CA 1XW8A 3H6OA 3HU7A 1H60A 4MDOA 2A6NA 1WYIA 4L1WA 2PLCA 4L4MA 4F0HA 2PMQA 5K9DA 1UWRA 3TN5A 5DN1A 5XIMA 2Z2BA 3PZVA 1H49A 1GVSA 1Z32X 4M8UA 4GUFA 1VLIA 3BE7A 2GVGA 1D3GA 5A8QA 5LNRA 1W3NA 5DMLA 1JYNA 3H2EA 2WHLA 5IDIA 3S6OA 1KFEA 1KD0A 3N9RA 4UTIA 3W7LA 4X2PA 4Q4SA 3LEPA 2CYGA 1MWOA 4R9OA 4PEEA 1RQEA 5EL1A 3V5CA 1OGBA 1F4AA 3U57A 1NOUA 3QSTA 3TAOA 5FIPA 4ML4A 2QUNA 2VENA 2CHRA 4C6QA 1FWBC 2QCNA 3NZRA 3QOKA 1WAUA 4CNUA 3AJ7A 1KGXA 2R9RA 3FFSA 1XGDA 4UFJA 3W1AA 5A6JA 3P14A 4FLSA 1PHQA 3CT2A 4C5YA 2O4QA 2B4GA 4GKTA 3T0TA 1UWQA 1TA3A 5F2MA 2J7DA 2CLOA 4GNVA 1DJIA 4DBUA 2GPTA 5AZ1A 1WKEA 1JZ2A 1YDVA 2WV8A 2IS7A 3IJ6A 4AIBA 4DWSA 3LHYA 3GFYA 1E4IA 2J7BA 3GXIA 3N2XA 4ZOEA 4EANA 2C16A 2VR5A 1UZ4A 1JVNA 4LS2A 2C3ZA 4TVCA 3IVSA 4D8AA 3T07A 1QI2A 2V5JA 3DYPA 4E4UA 4ZGYA 5C2CA 2DQWA 5JIWA 1GEHA 1RD6A 2J62A 1S2AA 2SFPA 5EBAA 4YMZA 1IIGA 1VENA 2TSYA 3FAWA 4A2SA 2PURA 2I7GA 2O92A 4HA3A 1CZ1A 1N8WA 2BY0A 1UQYA 3EWCA 3FY1A 4XIAA 1UPPA 4Z17A 1Q6FA 4DN1A 2QCMA 4EKJA 3W6YA 4RW5A 1H5VA 1A5LC 1LL4A 2F6UA 5IFTA 1XLJA 4HSHA 4RJEA 3P7YA 3DC8A 3UR2A 2I17A 2VL4A 2E25A 1WUFA 2VDGA 2VCCA 3RPMA 1YTEA 3S6DA 1TPDA 2VP8A 4Y9MA 5FAJA 2Z1WA 3UG8A 3JU2A 3E6EA 5CPMA 3QTPA 5C8BB 2C15A 3UZJA 4JTQA 2NXGA 2PDYA 1I45A 5HJXA 5E6YA 3STGA 2ZTKA 4KCUA 3RHGA 2XGBA 5KZEA 3R79A 1FWHC 2HE8A 2DW6A 1KTCA 1X97A 4DRSA 1A5UA 4PSRA 4AUBA 3BANA 2UY2A 3WENA 4YVXA 3MKCA 1LROA 1JJKA 1KLZA 1OFPA 4C6MA 1UB3A 3QPYA 2VFFA 3IVUA 4K3ZA 3CV1A 2J77A 3DDMA 4AHOA 3P82A 3V7PA 4LCQA 4AEOA 4HJFA 1XUZA 4D6GA 4GQQA 1OZMA 2ZADA 4XAFA 1S5VA 1T96A 3KL0A 4GZIA 1TWZA 2UY3A 5HMSA 2XFYA 1HKIA 3KBVA 2XHYA 4KFPA 3WFLA 5D8WA 4M24A 1XDLA 1QATA 3CZJA 3W1XA 1THFD 2ZE3A 6A3HA 5AHNA 5BWFA 1PIGA 4YTRA 3EDJA 4LAKA 4F4RA 1DIOA 2XSBA 2QQ6A 1EC8A 3B9NA 2E28A 2WMJA 1E9YB 2RHGA 3WLLA 3EWZA 1BAGA 2J79A 3W00A 3UPWA 1NWUA 3M5YA 2FFIA 2YLLA 3N9SA 5HNNA 3E9AA 4XZIA 1E72M 2IPJA 2W91A 3WMBA 3BSHA 3PZQA 3ONCA 1IZCA 3GK0A 6PTDA 4X61A 3WD0A 3U2OA 1SQ7A 2EQDA 4JIEA 1RK6A 3ECQA 5HNRA 4ZB5A 3HQ1A 3P80A 1UMLA 3KTCA 3N2CA 3BQ6A 4F8XA 3NZQA 3MCNA 1XGZA 1CXIA 4NRSA 5FACA 3S42A 4Z1BA 1I60A 5M03A 3IGHX 1PWLA 4ZMGA 1W5NA 4TUFA 2VJXA 3GR4A 4O12A 1WDWA 4PBEA 3QFEA 3WF3A 2H3DA 1P0BA 2QCCA 2E6DA 3IARA 4FOJA 3FLUA 1JUEA 2C18A 4GJ1A 5C7HA 1KLYA 3NDZA 1H50A 2JF7A 3AFBA 4DNHA 3PBVA 4UOQA 3GBEA 3WNMA 3EX2A 1HUVA 3PUGA 3V1PA 1GVFA 3ZOAA 1K1DA 1TKKA 4KF1A 3C0QA 3GKAA 3KX6A 7A3HA 2QEZA 4B5WA 1Q66A 4UTKA 4HZ8A 1JI2A 1KCXA 1S2WA 1UA7A 4Q7NA 1P7TB 5J5RA 4EXBA 3KP1A 2EO7A 2PUZA 3NSNA 1EKOA 4O1EA 1EYEA 1P0DA 3KCOA 4MZ8A 4CEXC 3KFTA 9XIMA 2WO5A 3NXFA 3RXZA 4WKFA 3K1DA 1E4NA 4HHLA 3B3DA 2E0PA 2XFRA 2HPIA 1GOQA 3VNJA 1U5VA 2XJ7A 1V3HA 4ZQPA 3LHWA 1JPIA 1POJA 1CBGA 8CGTA 3I4KA 2X2YA 1WOAA 1US3A 2P8BA 4FO4A 4MB4A 3L4XA 5HAOA 3O16A 3FKKA 4BFAA 1UR4A 1UYQA 3CM4A 1EGVA 2F7FA 5FA5A 3GH4A 5DANA 4DUVA 2I5QA 3WJSA 4GACA 2A79A 3M0HA 3MTWA 2WQDA 1I75A 3W7GA 2WK2A 2VNCA 1KM2A 3LZ3A 3EOUA 3THQA 5A94A 2YBTA 2PZNA 1W0MA 4KRUA 1GW1A 1D2KA 1A5BA 5CLWA 3PWGA 1WZLA 4H1ZA 1J6PA 2R94A 5AYZA 5F4WA 5ABHA 3ES7A 1E4MM 1J96A 2PGEA 3N6HA 1KWGA 3TZNA 4IP5A 4AB4A 4J4KA 2EPHA 3NIYA 4WSJA 4A8LA 3CB3A 5A8NA 5AYXA 1AVAA 3EDDA 3VOCA 3HQOA 3CGTA 4ZQCA 4RE2A 1HGWA 3WFZA 3RM4A 4MMWA 4B5SA 1NARA 1AA1B 4HK5A 4WEVX 5HUPA 3W7IA 4EPBC 5K3VA 2WVTA 2P1FA 4NAFB 4FSAA 2G50A 4W87A 1VFTA 3OA5A 2I16A 4A8NA 3WLQA 4YN5A 5LGXA 4DWDA 2OSWA 4R85A 4YXGA 4UFIA 1DQXA 3MWAA 3O6YX 3CH9A 3G1YA 3NL5A 3WMCA 4EPKA 1R38A 3U5UA 1JAEA 1Q63A 3URQA 4XZLX 4CNSA 1I0DA 2UY4A 4BI7A 1VAHA 1OABA 1Q8JA 4XKMA 1EZ2A 2WBGA 3MUXA 1P0KA 4O10A 1OF8A 3KBSA 1UW9A 4JQAA 1MW3A 2XSXA 2PSNA 4XKYB 3DC0A 2CLMA 4PMJA 3S2MA 1ZRQA 3BMWA 4UQDA 3ITTA 1DV7A 1W3TA 3EDFA 4UR7A 1MW0A 3CHCA 5I23A 1LJYA 3EKZA 3W2KA 4B5UA 1DWAM 3H53A 3SCTA 3TNOA 4ZCWA 4JD4A 3TKFA 4WSKA 1HGYA 3HMJG 1W5QA 3UZXA 1PTAA 3M0VA 3O7UA 2YL5A 4GIRA 1VYRA 1ISXA 4MAZA 1H1ZA 4WUIA 4CD4A 1H11A 4AWUA 4ASTA 4H04A 2BNJA 4GMEA 4KH2A 2Q8XA 4JEQA 4DF0A 2Y70A 4X2RA 4NUWA 2P88A 3EWWA 3ITOA 1B9BA 2D0GA 5FEZA 1B3OA 2NX9A 3HV8A 1TG7A 7TIMA 2WHJA 3W7NA 1ZY9A 3BJTA 3PJWA 2BDQA 4Z42C 1LOSA 4YU1A 3BOXA 4Q4OA 2GJRA 2FKPA 1H7NA 2YA0A 3G0UA 3G6LA 1AL7A 4ERIA 2J66A 3VC6A 1Z89A 1S5NA 4EP8C 2JF6A 1VIZA 4I9JA 4UB9A 2QKFA 4K7VA 4WOZA 3UA4A 2FLIA 4P7OA 2J7EA 2ZXAA 3PWAA 2XN1A 1V79A 1WXYA 2BWGA 3AS2A 2JQXA 1W9XA 3G1DA 1VFMA 4GBDA 5AYBA 3WBEA 1T99A 3PM6A 2CC0A 2FZ8A 1WV2A 2Y1HA 2PWGA 4G7EA 5CZJA 3VFCA 3GXMA 3WQCA 3UT0A 1EO5A 2OSXA 1OADA 3LBMA 2YZ5A 2EHHA 2Y62A 4RL3A 2GQAA 2WM0A 3C61A 4RX0A 3O2LA 5CPLA 2OT1A 2OGYA 4MJMA 3N9KA 3HJZA 3SRKA 3N4AA 2FGZA 1MRAA 2GOKA 1LWIA 1W54A 2V30A 2FMNA 3M43A 4MNJA 4NZJA 3G2GA 2ZZ5A 3OZMA 1JDAA 1JZ6A 4TXEA 2C71A 1E1CA 2XUCA 2YR1A 2D22A 1X96A 1H7PA 3P60A 4G5DA 5I7GA 2R82A 1PSCA 1R85A 4JTGA 4UIOA 5D05A 3AU6A 4GD0A 3FSTA 4GNJA 5HJLA 5CEWA 3ZZ1A 4IT1A 1Z7AA 5M17A 3T40A 3O0KA 1GZGA 3POHA 5D38A 1GK8A 1Y5WA 3IUIA 3DG3A 3N2MA 4R3UA 5HWMA 3GDRA 2G3IA 3V1HA 5CGMA 1TX0A 2NV2A 4QDMA 1T8XA 1GYMA 4H01A 2D2OA 4CD6A 5H8MA 1TREA 4GFSA 1DJWA 5CBBA 4ZBCA 5LXEA 2V2HA 3KZPA 3PHAA 1V6YA 1GORA 4W7VA 2PWVA 3T81A 4LYPA 2PTZA 1UD2A 3FA5A 4ZE4A 3KOXA 5DLCA 1JYWA 3KVKA 2OSYA 1L8NA 3DUGA 4A6GA 3KBMA 1E9ZB 5C7VA 2ODOA 5DBTA 3LTSA 1SFTA 4H6QA 3ARRA 1WNOA 3KRUA 4E3VA 3G0SA 2V5BA 3M0YA 3S2LA 4GNKB 1F5ZA 1QNRA 2CCRA 4J27A 3GIYA 5LA1A 2PD5A 3M7SA 4UTTC 1EXPA 3OLIA 3TNBA 4QG6A 2XZ7A 2X30A 3UR5A 5IBXA 4LEQA 4KERA 3WK2A 4CKQA 1OYAA 5H8UA 4ZO6A 4DI9A 1XYZA 1AQFA 4H9VA 2AAAA 3F2CA 2BB0A 3K8MA 3GU9A 3ATZA 4D2JA 3MA8A 2P53A 1T6MA 3GTHA 1E56A 4YCOA 4IL0A 3A4JA 2D3LA 1XQKA 5ECUA 3VIJA 1F76A 4S2CA 2YFOA 1HW6A 4MY8A 1XH2A 3MUCA 3LMZA 5D4YA 3OA3A 5DO8A 4C1LA 1UR1A 3TN6A 4UQ9A 3SURA 1MO0A 1OB0A 1GKQA 2X09A 2TPSA 3MZNA 1AD4A 4QE4A 1E43A 3H12A 1VH7A 3U48A 3NXLA 5EFFA 1A80A 2BHUA 2CLHA 5HXMA 1K4GA 4MNMA 4QLJA 2HISA 4I9AA 3SJ3A 2VZOA 1VC4A 1PYFA 1BHGA 4PYSA 4PZVA 3EA1A 4D8ZA 3ZM8A 1Z9AA 3LU2A 5HQMA 1M04A 5KMYA 3W2UA 3VKCA 5FJRA 3COTA 3DX5A 4UMAA 1QFEA 5ENLA 4EACA 4C6NA