4MWAE

1.85 angstrom crystal structure of gcpe protein from bacillus anthracis
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
260
structure length
258
Chain Sequence
b'NEMTHRTKTRPVKVGNLTIGGNNELIIQSMTTTTHDVEATVAEIKRLEEAGCQVVRVAVPDERAANAIADIKKQINIPLVADIHFDYRLALKAIEGGIDVRINPGNIGRRHKVEAVVNAAKERGIPIRIGVNAGSLERHILEKYGYPTADGMVESALHHIKILEDLDFHDIIVSMKASDVNLAIEAYEKAARAFDYPLHLGITESGTLFAGTVKSAAGLGAILNKGIGNTLRISLSADPVEEVKVARELLKSFGLASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
publication title 1.85 Angstrom Crystal Structure of GCPE Protein from Bacillus anthracis.
rcsb
source organism Bacillus anthracis
molecule tags Oxidoreductase
total genus 95
structure length 258
sequence length 260
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2013-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4mwaE00
4NIRA 4S3EA 4MWAB 2YCLA 4DJDC 2BMBA 2YCIX 4HB7A 1TWZA 4DAIA 3H2MA 4DB7A 1TWWA 2DQWA 3TR9A 2E7FA 3H2FA 1Q7ZA 3MCNA 4S38A 4O1FA 4NL1A 3H22A 4O0QA 3TZNA 1EYEA 2VEGA 4D8ZA 1AJ2A 1Q7MA 3TYUA 4MWAD 4S3BA 3H2EA 4MWAA 4D9PA 3TZFA 3H2OA 3BOFA 2Y5JA 3H26A 2H9AB 4C1NB 4S3DA 4CCZA 3H23A 4S3FA 1TWSA 3V5OA 3H21A 4DJFC 2DZAA 4O1EA 3TYZA 3BOLA 1AJZA 3H24A 4D8AA 1TX2A 3NOYA 4MWAC 4DJFD 1AD4A 3MCMA 1TX0A 4DJFA 1Q8JA 1Q8AA 3TYDA 4S3AA 4S39A 2Y5SA 4DAFA 2YCJA 2YCLB 3MCOA 1F6YA 4DJEC 2H9AA 2VEFA 3TYBA 1AJ0A 4C1NA 4G9PA 4DJED 3H2CA 2YCKX 3TYCA 4DJEA 4MWAE 4NILA 4DJDD 4DJDA 5JQ9A 2DZBA 1Q85A 3K13A 4S23A 3TYEA 3H2NA 4S3CA 3H2AA 2Y0FA 4NHVA 2VP8A 3TYAA 1Q7QA 2OGYA 4PZVA 1AD1A
chains in the Genus database with same CATH superfamily
2GJNA 4KPLA 3VZYA 4CLMA 3KRSA 5FAGA 3M0YA 1UZ1A 1H3GA 3W73A 2DQWA 4YYFA 4Q4OA 1GQLA 4W9TA 1OINA 1Z3NA 4LAZA 3WH9A 4MFDA 1E3XA 4YIWA 4LPCA 4MB1A 3UJEA 1EX5A 3GYCA 1YYAA 4Q3MA 2G41A 3DG3A 4D9PA 4K36A 3VNYA 3DUGA 3BSHA 2ZBTA 4LX4A 4HTYA 1R85A 1XUUA 2YDRA 2PODA 4FNUA 3H23A 4K1GA 8CGTA 4FNRA 1W9UA 5I77A 2NX3A 5HULA 5LKYA 3GNNA 1LRTA 3O6DA 3PZIA 3AIUA 4WOZA 3NOYA 1NQKA 4KEMA 2FJUB 2EPKX 1VJZA 1NDWA 3FDGA 9XIMA 4CNUA 1FDZA 2J7HA 2XISA 4W7VA 3WD4A 2NV1A 2YX0A 4WR3A 3S5SA 3WLOA 2QJHA 2H9AA 4AZ6A 1BLIA 5D9MA 1KM6A 3FGCB 4XTDA 3UJSA 1XIDA 5BOOA 4F4RA 4Y96A 2ISVA 2V63A 2PDPA 1TV5A 2YYTA 4XAZA 1QWKA 1FWCC 3EX6A 2Q8ZA 1DJWA 2PFHA 1Q7QA 2Q02A 2XZ9A 2O55A 4TX6A 3STCA 3UCQA 2PD5A 3U2CA 4H9VA 1QOXA 4DZHA 1UYQA 4AFYA 5H91A 1E70M 3TTYA 3AYRA 3I4EA 1TJ0A 4IG2A 3WLPA 1P48A 5HNNA 4RV3A 4LTSA 2C1HA 3LCLA 3SCPA 3W7IA 3UPMA 2P5NA 1XYMA 4WLCA 4XZIA 1G7UA 3GVWA 5I3HA 4XVDA 5CPTA 1WQ5A 1BWLA 4TIMA 4ZTXA 2PDNA 4YVPA 4FHAA 4MG4A 3L65A 2NWRA 1G0CA 2VFGA 4GZIA 1WKEA 4MWAC 4DI9A 3LPGA 1UUMA 1H7XA 2OT0A 3W7DA 3CO8A 4O13A 1B4KA 1J4EA 2G4JA 5CQ1A 5REQA 4F2BA 3KEHA 5GJPA 4MY1A 1LQ0A 4MADA 3TYBA 3CH9A 5D8WA 2NSXA 1F8MA 1QPRA 1TZ9A 2OFJA 2QCDA 4GIAA 4JYFA 4PL2A 4CD5A 3EWXA 1YMYA 3TR2A 1QI2A 1W3NA 2VMFA 5BNKA 3E74A 4DXKA 3K4DA 4MIMA 4CCCA 3PK7A 2OU4A 4GO9A 5H8UA 5M5DA 1NM9A 1O95A 4US5D 1DJQA 2WM1A 3WD2A 2GSJA 3KHJA 4CNOA 2P50A 1XYZA 3E38A 3S3GA 1UP0A 3TTOA 4QISA 3LI0A 3EKZA 3R25A 1P6WA 3ANUA 5C9ZA 1EQCA 4DO6A 5HWNA 1F3WA 2C79A 2DFAA 5CPQA 3C2VA 1FCVA 2BY3A 2XVGA 2ADAA 1XBYA 2ON3A 1EJXC 1BKHA 2DJLA 3L4WA 4OBSA 3GG1A 1JI2A 1CDGA 2JKAA 3M0KA 4PH6A 4EK7A 1QK2A 3E2QA 3LERA 4O1AA 2CW6A 1BVWA 2OQHA 5I6SA 3THQA 4PC8A 1NOUA 5EU9A 2Y1HA 4GQGA 5AY7A 1ZAHA 4TV5A 3EWUA 4HYVA 5CSRA 1XSKA 4MKVA 3TC7A 2V30A 2OSXA 3UZXA 1KXTA 2X0SA 5LXXA 4E2VA 1E5NA 3L4XA 4O57A 4YLWA 3MY9A 3VILA 4A2RA 3GC5A 4I8YA 3FY1A 1QMLA 3AHZA 2OO0A 3NEHA 4WUIA 3OZPA 4G7EB 1TJ2A 3BOXA 4B91A 1DL3A 3PS7A 2WPBA 1VZWA 1B30A 3NPVA 2L5HA 4LANA 3QZAA 4M51A 4F9DA 2UY5A 3VC5A 1EDQA 3WN6A 4XZLX 3RLGA 3L21A 2YZRA 4NJIA 3T44A 3TW6A 1OT2A 3MCNA 4NY2A 3RX3A 4P7QA 2A21A 1M41A 3FAXA 5ENLA 4Y8EA 3EEZA 4X61A 3WF3A 4FS9A 2V3FA 2E4TA 5EL1A 4PA8A 3N9SA 3HTWA 4POCA 2GJLA 2CBUA 1AL7A 3I7SA 4RXFA 2ALDA 1GW1A 3CGTA 4ZBCA 2V5KA 4IMFA 2DPEA 3TJXA 1QW8A 1XRFA 1XCXA 3GXFA 3OHMB 5IRPA 5DCDA 1VBJA 3S2JA 3CT7A 5AHMA 1M7PA 3HJEA 5CC5A 2XG9A 1KM3A 3UY8A 3UXKA 4JN8A 1H09A 1TQJA 3T2OA 5EA9A 1HUVA 3DBNA 2IPFA 3G1XA 3G1AA 4L9YA 4HOXA 4LB4A 2O9TA 3ZXWA 5I3KA 4GCXA 4AY1A 3QY7A 1S1PA 1DHPA 4N9DA 2CZEA 2OXNA 3LZ5A 2OGYA 3WUBA 1YDVA 2NUXA 4IUOA 5KTLA 2EPOA 4NI8A 2TYSA 3VD7A 2JF7A 4MSSA 1VQTA 1XL9A 3NXFA 4Q8WA 3A9BA 5EMKA 3S1WA 2ZE3A 3LPFA 3W86A 4DO5A 3KBWA 2B7NA 2E25A 1DHKA 1SFLA 4O4VA 2H3DA 2YGYA 3DEQA 2PDWA 1VFHA 4O10A 1QBBA 2H9AB 4PUWA 4I9MA 4MZ8A 2FTWA 1EEXA 1UHVA 2D2JA 5F2GA 4WGHA 2OZ8A 4BS0A 4H6EA 3IRSA 4ZE5A 2C7FA 4WJEA 3NQMA 5GNYA 1TFVA 5A6JA 3MUY1 4JCLA 1OF6A 1G4EA 2JIEA 5C71A 4LCQA 4Z1BA 5DMYA 1V7AA 5M03A 1W8GA 1QHOA 3GBEA 2Y8UA 2VC5A 1P1MA 3UGVA 4J35A 3DKJA 3C2OA 2W3ZA 2DIKA 4M6QA 3ARUA 1BGAA 3FYYA 3AS0A 3TJ4A 1V8EA 1DIKA 3F4DA 4DWSA 1JRCA 2OR2A 1NFPA 4XBJA 1YXYA 2J7BA 3MMDA 4ALDA 1PWMA 2VDIA 4IH3A 3CMGA 3EMZA 4GE8A 4JTQA 4IG2B 5U7SA 4MFEA 3PWGA 5FF7A 4KEUA 1SVDA 4PSPA 1K8CA 1EEPA 1R46A 1K7FA 5ABHA 4EPKA 4LNYA 1N8WA 3DU0A 3RMEA 3MKVA 4GI9A 1R3SA 1WCGA 1DWAM 2WQDA 2ZADA 4C90A 4DEFA 3UA4A 2JEPA 3W2KA 5A8OA 3JZUA 1HP4A 4HPJA 2XU2A 1UUQA 2HS8A 4E2OA 3DFYA 1UPMB 1CLVA 1U1JA 5REQB 4YN5A 5A8GA 2GSEA 2X42A 3AJXA 4MDPA 3OYXA 4GQRA 4ZB2A 3OIHA 2QCDB 3MUZ1 3CASA 3SECA 1PBGA 3FVMA 3GWQA 5HMSA 1IEXA 1B9BA 2ZDRA 1JZ4A 3CWNA 4JIPA 3AZSA 1BXCA 2J88A 2V67A 5CCZA 4Z08A 4CNNA 1UP2A 3G8EA 3C6CA 4MF4A 4X9SA 1MEWA 4PMVA 2NVAA 1HQTA 3L2IA 5EBAA 5E1QA 4CQBA 3LG3A 4NNCA 2AL2A 5M2FX 4DZIA 1E6NA 3WLHA 1SFSA 4XD6A 3SGUA 4AD0A 2EAWA 1G5AA 4R85A 1Z48A 2QMKA 2VX6A 4B2DD 3SCUA 2DVTA 1EQPA 1UMLA 3EWDA 1H11A 5HATA 4H3DA 3T0DA 3EDDA 4LCRA 1EHNA 2OEMA 1EC7A 1DXFA 3VDHA 4AD5A 3SRKA 5KSWA 1PZ2A 4HHHA 2QPXA 4IIEA 1ZU8A 6A3HA 1JCJA 4PFHA 4HCLA 4NNBA 1LRQA 3WNKA 1J0IA 2EKCA 2VENA 2E0PA 3D3FA 1H7PA 3W7QA 3EZ4A 2JIWA 2VCAA 3HIJA 1RY8A 1SJDA 1RQEA 3O07A 3PUDA 4UMCA 1UBPC 3RCNA 4PODA 3R0UA 5CGMA 3M44A 3AXMA 3L2MA 4B4FA 3CS2A 3PB0A 1LQ2A 3ANYA 5IDZA 4GQBA 3TP4A 5KINA 2ZWZA 3A64A 3GIPA 5JH1A 1H1ZA 2VUNA 4W8BA 3L4YA 1GHSA 1V02E 1SU5A 1S5TA 3UJ2A 5K4XA 5C9RA 2IPJA 4QBXA 4E4FA 4AG0A 3SUSA 3H2AA 1WB0A 1BWKA 5DFAA 3W1AA 1VH7A 1OC7A 2INZA 3OGVA 4LAMA 3A22A 1UKTA 3QV7A 1ZENA 3G0UA 4O54A 5DX7A 1DQUA 3AWNA 2WHMA 1C91A 1RVGA 3GHSA 4EOUA 3UG5A 5M1TA 1HP5A 1JI1A 5C54A 5JBEA 1DJZA 3S9IA 5J5DA 3T81A 3S6OA 4YVXA 5IOBA 3QZEA 1FVPA 3CV2A 5JBFA 3OHIA 3SCQA 1YDYA 3G22A 2PPGA 3PFMA 4GRSA 3K8KA 3B8WA 1XLFA 3CMJA 1I45A 4N02A 1RP8A 2HEJA 2RDTA 4Q4QA 4N4QA 1IZKA 1CTNA 4J3ZA 3W70A 3K4AA 3GVGA 3NL2A 1T8QA 2WNQA 3TLLA 5CC6A 5C9UA 2PB1A 4EANA 3IJ8A 2HISA 2NVCA 4QAIA 8A3HA 3WQWA 4UQAA 2FYMA 3CZGA 3VUPA 2WSYA 1NP0A 4V2XA 4B90A 4GD0A 2WZHA 1E4MM 1RBAA 1W9DM 3DX5A 2YL6A 4G9PA 2NX9A 3G3DA 1VKFA 3SUTA 4W7WA 3QFWA 2ZX5A 1XKYA 3A5FA 3WFLA 2PP1A 2PF0A 2VD8A 1PTDA 2CLOA 6ALDA 2P8CA 3JZEA 2E6YA 4OE7A 2YXXA 4RK8A 3TV8A 4UOJA 2GUBA 2QAPA 3NA8A 4LVAA 2NV9A 3D3AA 3GX9A 3Q94A 3O16A 3UWYA 5AC5A 1MNZA 4FSAA 2EG8A 2FGBA 3O0KA 3C2EA 3LHZA 3SN1A 5T9BG 2ZRWA 4A35A 2J78A 4FEZA 3LMZA 3Q67A 5DEZA 1W56A 3N4FA 2IXUA 4PULA 2YJQA 3VIFA 4IPPA 1SYTA 1TR1A 3IARA 1Q7MA 3K2GA 3KAOA 5HR6A 4JYDA 3M7WA 2VCCA 4C6LA 4CU7A 2G3MA 4KEVA 1MNSA 5BXPA 4WEVX 1R87A 1TWSA 4DWSB 3FA3A 4LNCA 3NPUA 1UR3M 1TMLA 2QGYA 4ZSUA 4D6JA 3EPNA 3LTYA 1KLYA 1CPUA 4PCPA 3AYSA 1I2PA 2Y63A 3VXGA 4CD7A 1K77A 3TN5A 4FIRA 4YTUA 3M64A 3TYCA 1JZ2A 2NQZA 1NELA 3ARPA 4E2BA 4IGMA 4P8XA 2ANUA 4QGCA 2VKZG 3B9AA 3QQ0A 1YNQA 3WK2A 1BEUA 1Q4NX 4CQ9A 4K8GA 5A6MA 1QHPA 3BSMA 2W27A 2W66A 1TPH1 3BLIA 2OLAA 1ELSA 3TXVA 4C6JA 1UIOA 4TX8A 1TTJA 2FZMA 2VQTA 3FJ6A 1OX4A 2WO5A 1P7TB 1ZP4A 2WBKA 1JPHA 2HBVA 2ZX7A 2HNHA 3MS8A 1GZJA 1KTCA 3TOYA 3MMUA 2EHHA 3LS9A 1FWWA 3DFOA 3P62A 4E8DA 1ZJBA 4M81A 3NZGA 4JHMA 5DY2A 3WQOA 1JQXA 4EPDC 3HA1A 1OADA 2ZUVA 4HGXA 4MNKA 4CQDA 2VWSA 4TXEA 4IISA 3K4WA 1M68A 2R8WA 4OVXA 3R6IA 3IVTA 3EOEA 1CT5A 3T1GA 4JTRA 4JX4A 1R2TA 3B8SA 2PWDA 3UWWA 2PLKA 2QW5A 1HJWA 2WC3A 4ZB0A 2INEA 4FOJA 2VEPA 3DXIA 5GJMA 3H2CA 3PNUA 4JL1A 1V7YA 3UXIA 1TV3A 4XO6A 4AU0A 2DZBA 4GOAA 1AMKA 2FB2A 3QVQA 3IGSA 2ALRA 3CHFA 1XLMA 2BOGX 1EGVA 3N11A 3W72A 3ITXA 4XVEA 3WELA 3E1F1 4HU0A 1VIZA 4DJDC 4EX4A 4QE1A 3SBFA 4QDMA 4UR7A 1RLCL 2VVSA 5BOEA 3T7VA 3N6JA 1TPUA 3S47A 1DIEA 4EXAA 4ONVA 5HNUA 4Q7IA 2HXTA 1IZCA 4DNMA 2Y88A 2J9ZA 2ZA3A 5KMYA 5LNWA 4NZ4A 3B97A 4BEQA 1GOMA 3G18A 1UC4A 3G5EA 1E0WA 3KP1A 1CGWA 4PTVA 2P1FA 4ZE4A 5EMMA 3NQVA 5LHFA 4LF1A 4AIEA 1O1HA 1ZSXA 3CZ8A 3S9YA 3W7PA 4CU8A 1AVAA 1CXHA 3HG3A 4GY1A 4HNOA 5CPOA 2XZ7A 1JXJA 2PBGA 1JRBA 2VDGA 2ZZ5A 3H7RA 5I06A 5D9OA 1GKPA 4UFKA 2RJGA 5CZKA 4MNLA 3AXHA 4O52A 1HGYA 3M7SA 1J12A 1XLCA 3NQEA 5A94A 3LXCA 2E5DA 3F4WA 3SSZA 4CD4A 4YXGA 3GKFA 4JBRA 1GT8A 4JFVA 3NGJA 5LGZA 4I8DA 3OP2A 2FKPA 4DX3A 1R47A 1SMAA 4QFUA 4DF0A 1P4CA 3ZSSA 2C1GA 3QKEA 4PTXA 3FEMA 3PSWA 4PRWA 5CZJA 1PCWA 4ILSA 5HNTA 4F2TA 2IKGA 4YCOA 2BLEA 3LK6A 1KV8A 1QFEA 5A8MA 3QRHA 5LGXA 1J11A 1R9YA 5I78A 3W81A 1QNQA 2WV8A 3WD3A 3DGRA 1E56A 1ONXA 1Z32X 3M4HA 4PEKA 1DORA 5CSSA 3O1NA 5D38A 4XSMA 1W9XA 2DT3A 2HSAA 5HA7A 5A5WA 4WZHA 4BR1A 3II1A 4I5RA 1YX1A 4Y9PA 4HNVA 4R53A 4R5EA 1RK5A 5LZLA 2F6UA 2Z2UA 2Z1KA 4GLEA 1QW7A 4FNQA 3HU7A 2YR1A 2EPLX 2CWXA 5CZ0A 3WLLA 1S2VA 4OOZA 3D46A 1BSLA 3DBPA 2FPVA 1TV7A 4DBDA 4HJWA 3TNOA 4LYKA 1B3VA 4MNJA 3T55A 4YHEA 3MYPA 3FXYA 4DWSD 4AIOA 3EWYA 4D8LA 3SY5A 1FA2A 5BXTA 4GFIA 2YPIA 4MUZA 4HNCA 2XJ7A 3T6CA 4A3YA 1NDVA 2DW6A 1M03A 1PO9A 1JZ5A 2WVVA 2Y7GA 3KVMA 1TKKA 1DWGM 5AB3A 1FHDA 1K8YA 3GFXA 1X1NA 3SGZA 4XBSA 4GJIA 5TNVA 1UR9A 2B7OA 3WD0A 2CLIA 3PAJA 4MVAA 2WK2A 4ADTA 3AS1A 1DPMA 2GWNA 1UROA 5FSEC 1KBBA 1S39A 2YBVA 4YS1A 1A53A 1ZHAA 5TBOA 2A1YA 3NNTA 3LGDA 4LGXA 3SY8A 4UTMA 4QLJA 3BLFA 1Q66A 3LD5A 4LOCA 3IIOA 3TKFA 2JALA 1SJBA 2WAGA 2ZYFA 3ITOA 3CXOA 5A2BA 3TYZA 3EWCA 4HPNA 1EJVC 2J8FA 1D2KA 1UH2A 1MEIA 1QPQA 1TVPA 1Z69A 1J9YA 1UZDA 4H9YA 3IJQA 1RUSA 1Q8AA 4ACYA 3W29A 3S1VA 2XYLA 1RPKA 4DVOA 3AZRA 3TW9A 2VC7A 1OCJA 1DTUA 3W7LA 2A5HA 1AK5A 2FTYA 4P2VA 1WXJA 4Q8MA 1D8WA 3QV9A 3OTRA 4WDUA 1C29A 3QXBA 2OZTA 1FWDC 1OX4B 3UWVA 3EAUA 2I17A 3V75A 1A0EA 1VFUA 3KL3A 1W91A 4C91A 4AWSA 1QR7A 1B3YA 4DPPA 4TU1A 3S5YA 3WL0A 3ZT6A 3FYPA 4ZL1A 1M9HA 4BQ4A 3LYEA 4ZENA 2CLEA 4WXZA 3M0XA 4JQ1A 3GXPA 4O1CA 1J0YA 4JXCA 4QCFA 2AGTA 5C8BB 4XBKA 1VAHA 2VGFA 3DI0A 1VLWA 4DZ5A 3BMVA 2DZSA 4DF2A 2W91A 1H0GA 3DFPA 1OGSA 2VRKA 3AIBA 3MWAA 5E6YA 2JFEX 4NT0A 5DT7A 4D8ZA 4IIHA 2EXOA 4L65A 2DSZA 2HVMA 3RILA 3VTRA 4AIBA 2FZ9A 3VNJA 2Y61A 3MSGA 2VFFA 3MKKA 2I5IA 4JY9A 2R1KA 4Q4SA 2AMXA 1A3HA 4N6EA 5KZMA 2PWVA 3U3HA 4B3KA 3QPZA 3W22A 2R1NA 1HJQA 4IPIA 3C3NA 4Y9MA 5AZ0A 4FX6M 3SCNA 3P8JA 3RDKA 1CIUA 2BY2A 2ZUMA 3E6EA 3W28A 2PTXA 2V3GA 2ASHA 1A49A 1YDNA 2HWGA 4H6QA 4BF9A 1WDWA 4HU4A 5GVJA 4WKFA 3ONCA 1PYFA 4TVCA 2X1SA 4AEOA 1UR0A 3V5FA 1DE6A 3AC0A 4EAYA 1SR0A 2PWGA 1QAPA 4PBGA 1YW1A 3WMLA 5I24A 5A8QA 3BAWA 1W1B1 4W93A 4C6PA 5FF0A 1V51A 2ATMA 1EX1A 4ROPA 1J10A 4LT9A 3E0LA 3DDMA 3G1YA 3GB6A 3TE9A 1NJJA 3GVVA 1W8SA 4NL1A 4Z0JA 1FOBA 3SCVA 1I2QA 3TZNA 2VOTA 4OV4A 3EB4A 1XWYA 5LA2A 2BP1A 3NUKA 2E6AA 4HA3A 3IIPA 3OA3A 3QBUA 4V1XA 4BQ5A 3RITA 2E9MA 2D2HA 1GVSA 1V3JA 1J0ZA 3LLFA 2B31A 3G1SA 4S3FA 4ZOCA 1FCQA 2GJRA 5BRBA 6TIMA 4O1DA 5CC7A 3KUMA 3UNTA 1OVDA 3WUFA 1XBVA 1M6JA 1H7WA 4RCXA 1RD6A 1WXYA 3GFYA 4Q6XA 3BG9A 4H7ZA 5AHNA 1VPXA 2Q71A 1HJSA 3WJYA 1NDYA 3R94A 4WY0A 4AY7A 3ZWTA 2OLSA 1XSIA 3ME3A 3MHGA 1JZ7A 5HK4A 1KRMA 1B54A 1IYXA 5CGQA 3APYA 1U5HA 3THCA 5FEPA 5JUVA 4HSHA 2Y8KA 1VEPA 4LAOA 1RR2A 1XRVA 4GFSA 1L9WA 3KL0A 4A3HA 3CZJA 2NUWA 3FA4A 3QR3A 2ESCA 4U5KA 1E0TA 2XDFA 7A3HA 4BWLC 3QC0A 2VZSA 4NJKA 3EPMA 1FCUA 3UEQA 4CNSA 1ZJIA 3VIKA 3CLMA 3VPLA 2YZ5A 1Z41A 1A47A 2QUMA 3VINA 1EL3A 2XGZA 4IPNB 2BXYA 1ZBKA 1J0KA 1A5KC 3GXDA 3GR8A 4P5UA 1SJAA 2J62A 5AVNA 1K70A 3FLUA 3D5HA 4XKYA 2FHCA 3VMPA 3DCPA 3IJ6A 1K03A 1O68A 4LYQA 3W53A 2YYUA 4A22A 1YKWA 1JDCA 1WX0A 3I3EA 4WDTA 1NDZA 2BHYA 2JBMA 4IFOA 5ECUA 3EA2A 4S3DA 1YBQA 3B0XA 3WDPP 1ZJHA 1SFTA 4D8AA 2DW7A 4ZOBA 1EIXA 3HQNA 3P82A 5LNVA 3C8NA 4R7WA 2WVVB 1HT6A 3RN6A 2QDHA 2CHNA 2VI0A 1A4MA 1BHGA 4KFOA 4UIOA 1GVFA 1WXZA 1XYLA 4C7FA 3TFXA 2XPKA 4L7ZA 2UBPC 3L4ZA 4C1LA 3G1DA 1KFWA 2Z27A 5D03A 4GJ1A 3IIVA 2QUNA 2BNJA 3BDKA 2PBOA 3O6YX 4F9JA 1V03A 3GNOA 4OQVA 4NRRA 4GBUA 4YYCA 3MKCA 1FUYA 3T09A 3FJLA 3ABQA 2OYKA 1SSGA 4GXMA 4RZBA 1IWBA 4JTIA 3AZTA 2RDWA 3S46A 2FMOA 3N2CA 1VS1A 3WKZA 3O8AA 3VU2A 3QOMA 1M65A 1MYRA 1V08A 4J4KA 4YMZA 5C0QA 3VD4A 1XW8A 2G37A 1P6CA 3P7YA 1DQWA 3N14A 3AU2A 5E9XA 1LZOA 4H04A 3WENA 4X22A 4H6RA 4OECA 1OFDA 3ENLA 4TV6A 1JZ6A 2QIIA 1A5BA 4HCHA 2PI6A 3VIOA 3OZMA 2X7VA 1I2RA 1RBLA 3IANA 4M19A 4UQBA 3V36A 3T05A 2QGHA 3PPCA 4H8HA 4W4QA 7REQA 3CAWA 1UB3A 3NYDA 2R94A 2ZFAA 1OX5A 4MYXA 4QNWA 2G50A 2Y85A 2P53A 4NZ3A 1UBSA 2XIOA 1UWQA 3CYJA 4C5YA 4NYYA 3FK4A 3G77A 3WG6A 3A21A 1QCWA 4UTHA 5AFDA 4LAKA 1U5VA 3APTA 3SI9A 3DENA 2Z7GA 5DCBA 4S23A 4HVXA 1TIWA 3G0XA 2V6AA 3GKAA 3MSRA 3G1RA 2WXDM 4HCDA 1OIFA 1HVXA 1MW1A 1A0CA 1JG9A 1QHZA 2VCBA 1K9TA 2WVSA 3SFWA 3UR5A 4X9YA 4AX7A 4WX2A 3RF9A 2PWHA 3GHTA 4XZ9A 2WMGA 3AFBA 4JCMA 1X1ZA 1SM9A 1HJVA 1WA3A 3FV9A 4Z2IA 1PEZA 3PVFA 3PJTA 3BZJA 2DQXA 2AOSA 4FALA 1SO3A 4Q32A 3B04A 1A3XA 1UA7A 4E0CA 1A5CA 4F0SA 3OYZA 1TPB1 2GGJA 4JN6A 2CU0A 4B9YA 4DF1A 4JD4A 3TAOA 1WBHA 2VURA 3H12A 2GGIA 5EMLA 5F1VA 2HV5A 1POJA 3WLSA 3PZMA 3EMCA 2J7FA 1XIGA 3M47A 2ZZ4A 4TVDA 5A6LA 1NWSA 1C8QA 1GVRA 2VYOA 2TMDA 3WNPA 3LHWA 3TYDA 3EA1A 1UR4A 5CSYA 3BPWA 3S83A 4H83A 4RDWA 1BTMA 4E4PA 4AD4A 2R14A 2Y24A 4S2BA 3H55A 2CLHA 2YFNA 3ARVA 1JXKA 4PYSA 1X39A 1E6QM 3RAOA 2FJKA 4LBRA 3KLKA 4JDBA 1OFRA 4QJ4B 2ZTJA 1TMQA 4WRHA 3PUGA 4HHMA 3CQ0A 2Z7KA 2WHJA 2DU2A 3UG3A 2X30A 6CGTA 3G24A 2PDUA 2NX1A 3PBYA 2WMIA 1TRIA 3GTIA 1B5TA 4AZIA 2Z25A 3RFAA 3GNXA 5E0KA 2QKFA 3DH7A 4WY0B 3VCNA 2Q3RA 3QGKC 3LNMA 3U2OA 1WPCA 4GX9A 4PUMA 1GYMA 2WB5A 2G95A 3N17A 3W2UA 4PUDA 3WZ0E 4HZ6A 3V5OA 4XUYA 5I2UA 4XK2A 5FL1A 3KVJA 1A3WA 1AD4A 4GJJA 4LCSA 2MUCA 1VRDA 4KESA 2QPSA 1OM0A 1O7AA 3KZPA 3KBSA 3WEMA 3GHUA 3MMWA 3SURA 1XLJA 2ZTKA 3INPA 3QR0A 5CJNA 4US6A 3DG6A 3VC6A 2QUUA 3VOCA 1HN1A 3UCDA 4CQAA 4JNMA 2A0NA 2DP3A 3EOUA 4LC8A 1H62A 3E2RA 4UTTA 3E49A 4XKYB 3CUZA 3NYZA 4WK9A 3DECA 1AD1A 3V4BA 1WUEA 4Z0SA 2ZIDA 2Z28A 3B06A 1M1BA 4UC5A 3ARRA 3N18A 3UXDA 3SN0A 3U7VA 1MZHA 1YBQB 4HSOA 4KRTA 3GTFA 3N19B 2OKTA 3L5AA 1BG9A 3TW7A 3NXLA 2CZVA 3GU1A 4REQA 1PJ9A 4R9XA 2F61A 4UMBA 1S2AA 3MA8A 4PCTA 1Q65A 4DYJA 3EXTA 3PG9A 3QJAA 4M1BA 4R27A 3LQGA 2EF9A 2YFOA 5LIYX 2DZVA 5HUPA 2G3IA 2OELA 1W1IE 7TAAA 5CBIA 3NVTA 1TX0A 2OODA 3UXLA 4JS3A 5TAOA 1I1XA 1DP0A 3QY8A 1TPFA 4GI8A 1K02A 1CB7B 4JFSA 4K6AA 1Z89A 3P93A 4A05A 5AHFA 4H7CA 1H7RA 1LBMA 4DJEC 5E5CA 2XSXA 2IS7A 4JEQA 3HN3A 3DN5A 1Z8AA 2Z0IA 4TO8A 1UQZA 5AHIA 3BARA 4Z2GA 2G3NA 3E02A 2Z1WA 3E3HA 2QEZA 4L1XA 1O5XA 2Z1VA 3CQIA 2XSBA 1IXPA 2YL8A 1U83A 3GU9A 1MQPA 1J18A 1JGMA 3UR2A 1WE5A 3W7JA 4MNMA 3IGXA 2NUYA 2QT3A 5HJYA 3W1XA 4ES4A 1SJCA 3LCXA 2Y62A 4C60A 4KETA 1XYBA 4K7YA 4KRZA 2PDBA 4CGTA 5AN7A 4U33A 4H9UA 3ZZ1A 4JR5A 4PTDA 1KGXA 2DZWA 2PGEA 4W8LA 1CGYA 4LVDA 1VFOA 1D7KA 3NDOA 1LT7A 3WJSA 7REQB 4UZSA 3M46A 3UPWA 4AX6A 1FDJA 3LCFA 4LEFA 4AW7A 3SRDA 4FR1A 3N34A 4IJCA 1OCBA 4E3VA 3PZTA 4MDOA 1ZL1A 3NL3A 3TJIA 3CO4A 4AHPA 1FCBA 3BURA 3W3OA 4HQVA 1S5NA 1C90A 2QJJA 5BROA 4E8GA 5LIXX 3W7CA 3S6TA 1AZ2A 3NSXA 1V79A 1WKFA 4N9CA 3CV6A 2R1LA 1J5TA 2H8ZA 3MMTA 3NTYA 3DC0A 1OFEA 3HGRA 1DJGA 1LOSA 2GWGA 1UWSA 2TSYA 3HV9A 3PTMA 3VDCA 3WBAA 4JPGA 4RNIA 1TREA 5BU6A 1REQA 3GXIA 3CV7A 4F0LA 3PF3A 2R6OA 5G5IA 1NFGA 3OLDA 1PKLA 3A9IA 3ZSTA 1F7BA 1ONWA 4HU3A 3VOHA 3P5YA 1DXIA 5EGRA 2C91A 4O0ZA 3ABZA 3N25A 2QPUA 4U28A 3N6QA 1PHWA 2YDQA 1HKMA 1RCQA 4LS2A 1F3EA 3MBDA 1IT8A 1NP2A 1K9FA 1QNRA 1ZNNA 3HGJA 4XO7A 1PX4A 1POKA 1JUBA 1PTGA 4IMCA 4GPNA 2OB3A 4RX0A 5KITA 1E73M 3I6TA 5AECA 3B9EA 3VIHA 1U1HA 5AYYA 2O9PA 3PTKA 4AY8A 2ACUA 2PDJA 5AOUA 3ZR5A 5AC8A 1EHAA 3AICA 1A0DA 3T07A 3UXAA 1V0LA 3MZ2A 3TJLA 2D73A 4MJ2A 4F66A 4JTUA 4M0XA 3A4JA 1VR6A 4ZTYA 4QJ5B 3KBNA 4WVXA 2OSWA 2HTMA 4JICA 4GI4A 3EOLA 3BSGA 4HN4A 2GPTA 2XFWA 1EGZA 4FK9A 3U57A 5LXEA 3V18A 2FDMA 3BGAA 5J04A 3ITCA 4DXXA 4UNIA 3QM3A 2E40A 1MW3A 5C2GA 1KXVA 2XUCA 1CGVA 4K38A 4OUIA 3AQUA 1JCXA 2V9DA 1I0DA 1XD0A 2YCKX 2WBGA 4DJEA 4D6HA 1OHLA 1V93A 4DWDA 4K7VA 3WH7A 4L1WA 1OG0A 1F3TA 4AWUA 4BI6A 1KTNA 2WMIB 2V0TA 2DT1A 3ZLGA 4CCDA 3W85A 3S2NA 1AZ1A 1Q6CA 4I7WA 4J27A 1BTCA 1TB3A 1XLDA 3W1UA 5JBDA 4R9OA 4E3TA 3EWBX 3GIYA 1TIMA 3AJ7A 2ODOA 2Z29A 5AZ1A 4K39A 5DRCA 1UCWA 4RE4A 3URQA 1O5RA 2ZE0A 4IQDA 3BO9A 1R3TA 3NO5A 3MT1A 2OLHA 1OJXA 1RZMA 4O28A 1U2YA 2V3DA 2BVYA 3AMLA 4GIEA 3ONBA 3QTGA 4OGZA 5BYWA 2XVLA 1KNWA 3BOFA 4KWUA 1TSIA 2QQ6A 2EBNA 3L4VA 5K2ZA 5I7GA 4Q4MA 3W1TA 2D22A 3N6HA 4G8TA 2UY3A 3W71A 5MF5A 1TO3A 2CLLA 3A13A 1P5BA 4A8IA 1G7VA 4CD8A 2YOCA 1YRRA 3CL6A 4NQ1A 1S5WA 1NTHA 2VTFA 3WIJA 2XIIA 1XRSA 3TDFA 1UUOA 5MKGA 2VC6A 5D02A 1VBRA 4RE3A 1K3UA 2D2GA 1L8NA 5HDRA 4DBUA 3R13A 4LVFA 4K37A 4DXVA 4M56A 3W1QA 5HPOA 4REQB 1RLDA 3USBA 4XUGA 4XX6A 1HJXA 4MUPA 4ZOAA 3H54A 1JYNA 4Q8OA 3IJLA 1CLXA 4WXYA 3MP4A 3S2LA 3SQLA 2W0UA 4HHPA 1WDDA 4M82A 2F38A 4ACZA 1GOOA 5A95A 3M1ZA 2C16A 4R33A 1H41A 4Z1DA 4S38A 1LLWA 1UJQA 1TZ7A 5DANA 4LWWA 1EDTA 1SW0A 3GDRA 3CAVA 1XIFA 1W1TA 1AFSA 1OBAA 2J24A 5F4SA 3GDLA 4IXXA 2VFIA 2W9MA 4N0RA 3E2VA 3E0VA 4ML4A 3BG5A 2PU0A 4TQTA 3TONA 2GSHA 2IKIA 5AHEA 4KGLA 3W1LA 3CWHA 2WKGA 3VUSA 3NQGA 1F74A 4LV4A 2ZA2A 2VX7A 5LNRA 3EWZA 1Q6QA 2GVJA 4MAZA 3MC5A 3WBXA 1Q6DA 2JQXA 1WP6A 1JCLA 4AB4A 4CD6A 1L6FA 1TE1A 4QRNA 3EGJA 4DUXA 4PEEA 3L9CA 1DVJA 2REQA 1EJWC 2HXUA 1M7OA 3TN3A 1XCFA 2C8NA 4QJ3B 2Z4GA 1BWVA 3PFRA 4ERIA 2NXHA 1QWGA 4EWND 3O6AA 5G2WA 3UW6A 5A2AA 2WLZA 3BGJA 2MNRA 4GH1A 4DI8A 4RNJA 4NZCA 3M0JA 1SO5A 1W1VA 3MUIA 4LB3A 1JFHA 3I7QA 1ICPA 3E12A 1US3A 1HFBA 1GW9A 4J3TA 3P67A 4PCSA 1OFPA 6REQA 2PP3A 2P0IA 1N7KA 4RUBA 1GG1A 2HS6A 4L4LA 1MEHA 3AS2A 2FFIA 1GUVA 1KFLA 2DORA 4IGNA 1B3OA 3CV1A 2HZGA 1ITXA 4L61A 2Y5JA 3POCA 2V5DA 1YADA 3PWAA 1F5ZA 1XLKA 5FJUA 5C2CA 4GC3A 1REQB 2POTA 1EFZA 2Z00A 1QNOA 1DIDA 5A8NA 1AJZA 2ZICA 3GQYA 5EKYA 4AZ7A 5HBFA 3NZ1A 1NY1A 3WQDA 3GUWA 5T8GA 4GY7A 3HMCA 3T40A 5H6HA 1AW5A 3ZQ9A 4IGHA 2VZUA 3B0PA 2VL4A 4AZHA 2QV4A 2CBVA 1QI0A 4DRSA 3HQ1A 1KGWA 4HZ8A 2WKLA 3TN6A 1PUDA 2WKJA 3W75A 4O8RA 3K13A 3MB9A 3LBOA 4W86A 1I60A 1WNOA 1R3VA 1BG4A 3AHVA 2AAMA 1ODZA 3VO0A 4NSBA 4GNVA 1N2VA 3S1GA 1V6XA 2YLAA 1PIIA 1GYNA 1ZRQA 3M9YA 3WX7A 5TIMA 3F5KA 1BVZA 3EYPA 1BXNA 1YEYA 1Q7ZA 1Y7VA 5I07A 3CZEA 1KRBC 4AYGA 3KRUA 4QXIA 2HBXA 3TYUA 3A4WA 4KQNA 2J74A 1BSIA 4H4IA 3DC8A 2VR5A 3I6RA 4HTBA 5AYIA 1S5VA 3T8QA 2A3BA 4H19A 4IP4A 3BXWA 4PMJA 4U31A 1RD5A 3VNZA 1Z6KA 3MVTA 1QO2A 2WZEA 2OZ3A 1MVYA 3P0WA 2A3HA 2FVLA 2C71A 3TUUA 2VELA 4NRSA 3F1QA 3ARSA 3SR7A 2YIHA 3M5ZA 5A1AA 2OGJA 3TLQA 1MSSA 4HHLA 4OHQA 1KFKA 1KV5A 3SADA 2AQOA 4IWWA 4CEUC 1UQYA 3SQSA 3UG8A 4Q22A 2ACQA 1XRTA 4Q7NA 3SN4A 2F9RA 4W84A 3SCOA 3GW3A 3PPGA 3GFZA 1NQ6A 3E96A 2CLKA 4H9ZA 1X98A 4LC6A 2WMFA 2HNEA 1MXGA 2VGGA 4CVUA 3W6LA 3Q45A 2ZUSA 3M0IA 4NZ5A 3P60A 1L6SA 4UOZA 3SUUA 1GTHA 1V5XA 4QSHA 1DJHA 4F79A 5G1TA 3W4RA 3CIVA 2C6QA 3W1RA 2CLFA 2CCRA 4IX0A 1EWEA 4JQ4A 3VMNA 3T4WA 3W88A 3AXXA 4QDPA 2P76A 3N73A 4JEJA 1IR1A 4DZAA 4UQ9A 1W5OA 5MKGB 3M0MA 5FKYA 1EJRC 2E5CA 1YTDA 4BK9A 2FZNA 3A3XA 4TMCA 1OG6A 4J40A 4O12A 3O3RA 2P3EA 2ZA1A 3ATYA 3AMDA 4NG3A 2X1RA 3LN3A 4PE8A 3HO8A 3ECQA 3RIKA 1EUNA 3HOJA 7ODCA 4KIEA 1ZCOA 4HA1A 4ZO6A 3H70A 3VNLA 5I0DA 3QFEA 1WBJA 2C1IA 3NQBA 2E9LA 3E0FA 1ECQA 9RUBA 3M41A 1SZRA 4ACZB 3PANA 2RAGA 1KW1A 1UD3A 3OW1A 4LUJA 5BMWA 1T5AA 4MLRA 1A80A 2QF7A 2IXVA 1LG2A 3EX2A 3CYVA 3ZM8A 1S1RA 3TFCA 4MKNA 4PSRA 4Q4KA 4HMNA 4LS1A 2PWUA 1V0NA 1XPYA 4UBPC 4DYEA 4XAFA 3LHYA 5D2YA 3W2MA 4GKLA 1CNVA 1PYMA 5J5RA 1PZ1A 4HT3A 3QMSA 1Y65A 2IKHA 5IDIA 3NAVA 4XISA 5AC4A 4QE4A 3KE0A 1LYXA 1AJ2A 2I5QA 1RXOB 5KETA 5FJRA 3W2NA 1R8LA 4D1JA 1XGZA 1XLBA 2REQB 1F2JA 6TAAA 3ZS4A 4CNPA 4AXKA 2OT1A 3FFSA 3UZJA 4TOQA 3HG4A 4C6KA 3W27A 5HPCA 4C6OA 1SO6A 1U1UA 3BLEA 4JIQA 3W26A 4BHYA 3R7MA 3JS3A 3ITYA 4L5ZA 4ICCX 2J47A 2J8TA 3TSDA 3TTEA 4S3AA 4EE9A 3IJIA 3V0TA 1P0BA 1XICA 4PUKA 3IJDA 4B5XA 3OG2A 4WGXA 5BOFA 2BOEX 3CHDA 4GVFA 2OWCA 4FR6A 6REQB 4FX7A 1ZP3A 2YA0A 5DBTA 3LSBA 3Q4DA 3LXAA 2G96A 1K7XA 1DWIM 3W25A 2R1MA 1Z9AA 3VKDA 2OG9A 1E9LA 4ZCWA 1Q3NA 1Q2SA 3VGBA 4F0RA 3OVRA 3DYOA 4CVWA 1XSJA 5AC7A 3VOJA 3ARZA 4W85A 2X0HA 4H00A 1AH4A 1BD0A 1NU5A 2EPHA 2JF6A 3GNDA 2VHLA 1UIPA 2W5FA 2ZUWA 5EMUA 4IIBA 1W3IA 3QN3A 4IIGA 1JYVA 3WD1A 2POZA 3Q37A 2DSWA 3DIPA 3RX4A 4WJXA 2ISDA 1OK4A 4C7GA 2CXGA 2E8ZA 3RRXA 3L4UA 1VPQA 1GYLA 2FVMA 1SPQA 2DZPA 3SDOA 4V28A 3NO1A 2A6LA 1E55A 1JNEA 1W3KA 4FIQA 1UWTA 3OPSA 3MJMA 4JTKA 4U4MA 4AXNA 2QVHA 4KS0A 3A4XA 5I3GA 3LPPA 4DUWA 4DO4A 2QULA 3CQHA 4GVHA 4JZ5A 3U4FA 3ZJKA 3MI2A 3PPFA 3VKBA 4FZIA 3VX0A 4LALA 3THDA 5LNUA 5DMNA 2I57A 2BG5A 4DJED 1CXLA 1FWJC 1C3FA 5HUOA 2E28A 1MRAA 3CIXA 3HGSA 4GUGA 1R3RA 1B31A 1FP9A 1FXQA 2GL5A 3BLDA 3D6NA 3OLEA 2XN0A 3SY1A 1FWGC 1T6MA 4O1BA 4C6EA 2A85A 3N4AA 5LHEA 1EP3A 1UR8A 3FKKA 1GTEA 3FNDA 1JQVA 4OT7A 3L67A 4NZFA 4Z42C 3KVKA 4GIYA 1ZPTA 4N9EA 3WDRA 2YCIX 3MO7A 3SCSA 4X0NA 4JKKA 2G97A 3LQLA 5DXYA 1GQJA 1ITCA 1OD8A 2FHFA 4DIAA 3L68A 4XD4A 3SIZA 3R43A 1ZALA 5FACA 3RGTA 2ATSA 3O15A 4O0QA 1JD9A 3R0KA 5HWMA 3O6CA 2X7WA 1KFBA 1OCNA 4A2SA 4JTEA 3OGRA 3AXIA 3TXZA 2OEKA 1E72M 3B4YA 1QXLA 4UR8A 1H1NA 3AYTA 3UESA 1IWPA 2QR6A 2Z6IA 4WY0F 4HOZA 3PBGA 3EB3A 4H7VA 3URNA 4EF8A 4DJFC 3L4TA 3EKGA 4EXQA 3ABOA 4Y9NA 3P14A 2XH4A 3L23A 4FI4A 4NP7A 3ICJA 1VJSA 1O66A 4JHZA 2YCJA 2W6RA 3QPEA 3C52A 4LUIA 3BW2A 4Y90A 4Y9AA 5FJIA 2BV9A 4IM4A 1XH1A 4D6GA 1E6SM 4TVUA 3I3DA 1RPXA 1E4NA 2OOFA 2BBFA 4JQ2A 4DBWA 5G4WA 1HO4A 4ZXLA 3KOZA 1O60A 5FJJA 2WNZA 3KL5A 4MB4A 1ISYA 1X6UA 1K1DA 4Y7EA 3TC6A 1KCKA 5B7ZA 2G3FA 2QF8A 2VVNA 1EYWA 1TTQA 1DXEA 1F07A 4ZQPA 4N9BA 3OO2A 3W2LA 4LU0A 4M6VA 3R8RA 1F6KA 3C2YA 4IT1A 4RE0A 3U2ZA 5JIPA 3HPSA 3DHPA 3O06A 3P80A 1US2A 2GGHA 3L0GA 2J8GA 1FFRA 1KFCA 3LY0A 1ZAJA 2F8QA 2VX5A 2WC7A 3BAKA 4MWAA 1FWAC 2C19A 2OQLA 1QPKA 1KO0A 1FX6A 4FNTA 3KOXA 4F8XA 3NDZA 1K6WA 3QMRA 4BCEA 1DWJM 2BY0A 1GQIA 3DFQA 3WQ4A 5D4YA 3GC4A 3WQ8A 3O05A 4DPQA 1QUMA 3F4NA 5DLCA 5D8ZA 2CZ5A 4DBSA 1OFOA 2IQ0A 2VT0A 3AISA 3OZOA 1WDPA 1IIHA 1NIUA 3ARQA 1OFBA 3V0SA 1L6GA 1GQKA 3AHYA 5C2XA 3LCHA 4LV9A 2O9RA 3T0TA 1CW2A 3S1XA 4PBEA 5FA5A 2VP8A 4FNPA 3QC3A 1S2WA 2HK1A 3BANA 4PCFA 2XN2A 3N12A 3LTSA 1AL8A 2NXGA 3UT0A 3PJWA 4N42A 2A7RA 3F7JA 4WHBA 3HFYA 4M7SA 2UZ9A 5AYZA 3VOFA 1QPOA 4LY4A 3TR9A 2HPIA 3NQ7A 3AU6A 2X16A 4MPQA 1JZ3A 1ZY9A 2CKSA 3LRMA 1XDLA 1XQKA 1UG6A 1WOAA 3M16A 1TVLA 1R0MA 4LFYA 4HMCA 4LQ1A 5JMUA 3W7RA 4JTJA 1GKQA 5L9FA 1NWTA 4PTMA 1QW9A 4GVIA 3NJ3A 4GH3A 4E2DA 1CENA 1W1YA 1YDOA 4DJFA 1QVBA 4X63A 2V3EA 3NQ2A 2P88A 1EC8A 3TTSA 5FOOA 1XBZA 2BZNA 4UNLA 3K8MA 4IGSA 3QMTA 4WJ8A 3QW3A 4ERAA 4EAMA 4C5ZA 1E0UA 5D9PA 1G69A 1HG3A 4JTDA 3UQNA 1IXOA 3S9ZA 1PHQA 2VRJA 3FSUA 3VM7A 1V3HA 2C3ZA 3SRFA 3SCRA 1WYIA 1E51A 3B05A 2D20A 4HNNA 4NYUA 3Q65A 3LENA 1BQGA 3W82A 3ZIZA 2GVGA 1JD7A 4KCVA 4QTGA 2E5BA 2BMBA 4JTLA 3DFTA 5U4NA 4B5TA 4HMDA 1HKIA 1MO0A 1Y5VA 5DT5A 3B4UA 2O9OA 4A8RA 1P7TA 2V2HA 4HKPA 4PMQA 3DFNA 4FXJA 2O7SA 4J3UA 3UGRA 2VWTA 4UTWC 4H9TA 4ZR8A 2VUYA 2JKEA 1N8IA 3L0NA 2OEJA 3HQOA 3F03K 3R10A 4NAFA 1C7SA 3IJ9A 4OU1A 3DHUA 4I9AA 1I1WA 1PE1A 4UUIA 3VGDA 5HXMA 3CEPA 2QCFA 2PLJA 3VABA 3MUAA 4QQUA 1OCQA 1PTAA 1U5JA 3UZZA 2EG7A 1B1YA 1FWIC 3PG8A 4UB9A 4LRSA 3Q2DA 3F2CA 4P8WA 4MOZA 4BF7A 2V82A 1Q85A 1UD8A 4HSNA 4JIEA 2NXIA 3GW0A 2BVWA 2CNCA 3U6WA 3TMQA 2WSQA 4NZ1A 3CZKA 4S2CA 5L6UA 4JIHA 4MB3A 3ZT5A 3OIXA 4B9ZA 3VGFA 3GLCA 1N55A 1R3WA 1OC5A 1AH0A 4QS5A 4J1OA 2HJPA 2GVEA 4FO4A 5A6SA 2ISSA 3HPZA 4P8VA 1EIBA 4UFHA 3PJXA 3S2CA 3VFCA 4GMEA 1VD6A 2ZWYA 3LV6A 3S8HA 3VOIA 2G5WA 3VFLA 1VEMA 1TR9A 1ZZMA 1G4TA 3DG7A 3W01A 2GFTA 3BAXA 4I5UA 5ABGA 2BVDA 4ZQCA 3CHVA 3GAYA 3W7MA 1O5KA 1T8XA 1MW0A 3MV01 1ADOA 3BUVA 3WNLA 3LPOA 4ML9A 4HYWA 1TCMA 1MQRA 3E0IA 3N9KA 3CPGA 4KCTA 2PCEA 4WDWA 1WAUA 3WQFA 4W8AA 1B90A 3I10A 1FWHC 3PULA 1S2UA 3ITGA 5F2IA 3RYSA 3PJUA 3V0UA 1K8ZA 1ME8A 1OY0A 3LV5A 3EA3A 3T4CA 1IF2A 1QASA 3C3UA 1GOIA 4LBUA 5FF3A 1BF6A 1RVKA 4WQ6A 1WZKA 3GDBA 4ENLA 3TAKA 2PP0A 1IXNA 4UTJA 3HM7A 3AIRA 4IJRA 3F2BA 3N04A 1UD5A 7PTDA 3CTTA 4JKLA 3NVDA 4MWAB 1JGIA 1EDGA 2ICSA 1Q6OA 3HBLA 3KDOA 1DBTA 2TAAA 3I68A 3GG7A 4D6IA 5A2CA 4M80A 1UZHA 3BJFA 2E3ZA 3OBKA 3YPIA 2RUSA 3NPWA 2OVLA 3W76A 1GG0A 3HG5A 2BY1A 1JIBA 3B0VC 5AVHA 2Y6ZA 1EKOA 4ZMGA 2PDMA 2DIEA 3BV4A 4UTWA 1N8FA 3QHMA 7XIMA 1FQ0A 2QYGA 4ZSTA 1TTPA 3PWIA 3TA6A 4XD3A 1IR2A 1ZQ5A 2PE4A 3M6YA 3MCMA 5I23A 1W5MA 4LXFA 5F2MA 3R8GA 4YCPA 3PZQA 1K6AA 4AISA 1QK0A 1EA9C 1KD0A 1M3UA 2Y89A 2XSAA 3RJYA 3KCLA 2D1ZA 2WVTA 2FLIA 4MTVA 4RL3A 3TOPA 4UCFA 2VEMA 3H4XA 4AAJA 3KX6A 2ZXBA 2ZXAA 3ALGA 2ZRXA 2WNWA 4TTGA 4OV9A 3WLNA 2ACSA 2PGFA 3BICA 3L2LA 1SZFA 1C9WA 4HPHA 3BV7A 4X3ZA 2ZRZA 2BXZA 1EO5A 3WNOA 3FJNA 5AKQA 1BAGA 3EXRA 1PZ3A 2YCLA 2E8YA 3W7HA 2Y70A 2NQJA 4IFRA 5D09A 1XC6A 3H7UA 2YA1A 3UG4A 3M5YA 2EG6A 5RUBA 3KHDA 2VM8A 3RX2A 2OCZA 1Q5MA 1V3LA 5FEXA 1H5YA 2PSNA 4AWTA 1TRDA 3PZVA 2WNNA 1OT1A 1R9XA 2HMCA 3QHNA 1XCWA 1MFUA 3MZNA 4RKAA 2GOKA 5A3HA 1SR9A 4TMBA 3NCOA 5M3WA 1KCXA 1IGSA 5A6BA 2JGYA 1EJ7L 4O17A 2BFGA 3SUVA 2DZAA 3RPMA 4I90A 2YSWA 3AMCA 3BJSA 3BMWA 2VGBA 3AO0A 1GEQA 3PSVA 4L4MA 1SUXA 2R24A 3GS6A 3UZYA 2GK1A 3L12A 1K8XA 4GYJA 1SZNA 4Q33A 1IQ8A 4P7NA 3EX3A 1JDAA 4KMQA 3EOSA 3E9AA 3BTNA 3O7UA 4PB3A 4JDYA 2PDYA 2X41A 1AQMA 3RUBL 3IIZA 2F6KA 1TELA 4HN8A 3P6LA 4KW2A 1RBOB 3N13A 2BTMA 3DI1A 4EP8C 4NAFB 3GH7A 1LBFA 2A3CA 3V5CA 1X6NA 1ME9A 2RH9A 3DKLA 2DY3A 4Q8PA 3S0CA 3LA4A 4L56A 2YLLA 4E8CA 4F2UA 5D30A 3FW6A 2ZUUA 3TMLA 3C61A 4E6MA 2V8ZA 1W3LA 1JULA 2GZXA 5A6AA 3UJRA 2WCSA 1FDYA 1LT8A 1GVEA 4RDYA 1ADDA 2W61A 3SCTA 1UJPA 4PRRA 1C9DA 5F2LA 1WOBA 2WQPA 1TX2A 4PMXA 2Q6ZA 1OYAA 4MYAA 1VC4A 3VGEA 4URIA 1CCWB 2PDKA 1JZ8A 3WQVA 5A8PA 3NZRA 3P74A 3PBMA 3CUFA 3H8AA 1FH9A 1J79A 4Y6GA 3UYIA 3T08A 4OFCA 1A4LA 3WDQA 1V3MA 2ZXQA 3LRKA 4PCNA 3WSUA 3QGAC 4MJZA 4GINA 4IOTA 3CNYA 5HJLA 4EKJA 5LA1A 1JNDA 1IEVA 3A5VA 4TX9A 2WOQA 4L4PA 1V3KA 3WK1A 3EB2A 1TJRA 2JE8A 1GONA 3ZOAA 4L64A 1WZLA 5FF2A 1XLLA 3AIVA 4YJ5A 2G8ZA 3E5BA 3E5PA 1RJQA 4ORIA 5BWAA 4GUJA 3VGHA 4MWAD 1W5PA 4D6DA 1CGXA 1VCFA 7ENLA 2RJHA 3FEQA 5AHLA 4O11A 1I0BA 4B5WA 3W24A 3TZFA 3UU0A 4GBDA 4UFIA 4IP7A 2GDQA 1P1XA 1O94A 4PMZA 5BRPA 5D2VA 3STPA 3H21A 4PN2A 2PRHA 1JPKA 4LS0A 2YW3A 1TPDA 2Y7EA 5I3DA 5B7YA 1V6YA 1SW3A 3AAMA 3WH5A 3BLPX 3NIYA 3VIJA 5DY3A 4UTKA 2IQTA 2FHBA 1CECA 3LLXA 5BWFA 1NF7A 4K8HA 3MWCA 4Z2LA 4KT2A 1KRCC 5HAOA 3WFAA 4GGBA 4D1IA 3VIMA 4C6FA 3MUXA 3M0LA 1LWIA 4LEQA 3WDHA 4FB7A 5SWUA 3T78A 1KWGA 5GQBA 5H8PA 1F05A 1JCTA 2NT0A 4AHQA 3RO8A 4E5TA 3ALFA 3QEZA 3PZNA 1TWIA 2P3ZA 1H1YA 3SO7A 5CLWA 1AH3A 3MO4A 2ABBA 1XH2A 2A2IA 2QXWA 2ABAA 5XIAA 2UWFA 4V15A 2B4GA 1EGMA 2WMJA 3HPFA 4NJGA 1GJPA 1LL7A 1OFAA 3LNPA 3T8LA 1EWDA 3W02A 1UOZA 2WJDA 1KM4A 2VNCA 1GKRA 4IX2A 3PP7A 3KBMA 4BY3A 3RM8A 1QI3A 2Z24A 4MLJA 5LA0A 1VYRA 3IVUA 4F0MA 1X97A 4L9ZA 2FQIA 4AZ5A 4JFTA 2J77A 3V1HA 3WLRA 4LSBA 1XPGA 4N6FA 3ZFHA 3VKCA 3VD3A 2F2KA 3E2SA 1JCMP 5E0FA 3QY6A 4DJFD 1VCVA 5D37A 4MM1A 3KWXA 2I7GA 4DNHA 3AIEA 1IE7C 1ITUA 4RPQA 4K2SA 3HQPA 2ACRA 1I2OA 1MXSA 2QCHA 2YCLB 5DRIA 4JTHA 5IBXC 1E0XA 3WMCA 2OQYA 4JIRA 2Q3OA 4JYEA 3I4KA 2AKZA 2O56A 5CH9A 3SUWA 3JW7A 3KS6A 3IEBA 1B3XA 3OEXA 4NF7A 1E6PA 3QSTA 2YCEA 4WCJA 1CXIA 4DJDA 2YW4A 4GG9A 4ZZ9A 3MPGA 3DFHA 1WDSA 3LLDA 2TRSA 3DERA 4GABA 4S3GA 1PB0A 4HK7A 3ABSA 1OABA 4RNFA 1IEQA 1D3CA 4G1KA 2DJXA 5IHSA 2X1UA 3PB2A 1XF0A 1MZRA 4XQ6A 2ZRUA 2RKXA 1VBHA 2PTWA 4Y8FA 1QATA 1M53A 3CQJA 3W37A 4LVGA 5LIUX 3HG2A 4AVOA 4W87A 4DUOA 5AYXA 1W5QA 1XLHA 5F4WA 3AXKA 3W7KA 1MMFA 2FB3A 2Y5EA 3NFUA 1QOPA 2H3BA 1L0PA 4WKHA 1XGDA 1P0DA 2DV0A 1D9EA 1XJBA 2GK1B 2BGNE 5F7UA 4PGLA 1XQLA 5EFDA 4Q6JA 3G2GA 2YKKA 4W7UA 4D2JA 4OTKA 4G6CA 4RJEA 2CXEA 4WOQA 3UBPC 3VD5A 4NX0A 2PRLA 1XI3A 2DSVA 3C0LA 4FOKA 4YTQA 5E0CA 4AVFA 2J9YA 3CL7A 1QOQA 4HZMA 3FCPA 4IMDA 2E9BA 3OU8A 1TJ1A 1VFFA 4YL2A 1I9CB 1ZBCA 3UCCA 1I6NA 3EDEA 1PXGA 4CN6A 2CHOA 1CZ1A 2QCEA 2ZUNA 3WJXA 4EPBC 4OWGA 3DYPA 4J7RA 4Y2WA 3GH4A 1KM0A 1OD0A 1KTBA 3S2MA 3KFTA 2PU1A 2VOMA 3W1PA 4YTSA 2Y0FA 4DWSC 4P8UA 3SCWA 3URBA 3VIIA 3B8DA 3NSNA 4WD0A 3TROA 1ZJAA 4D6FA 2QLYA 3W00A 1WKDA 4H01A 4GVGA 4EF9A 5K4ZA 4K8EA 1OB0A 3LCGA 3F2DA 4IHCA 1OEPA 1IZJA 4DY1A 4O50A 3O63A 1E9IA 2Z1SA 4K68A 2FTPA 2BASA 3VOGA 1EYEA 1LLOA 3B40A 5CJMA 1E43A 5EBUA 3ES8A 2E68A 4H6KA 1OIMA 2QJIA 1QTWA 3W74A 3GR7A 3FHAA 3N9RA 5C9WA 1T40A 1JCYA 6PTDA 1WDQA 4S3JA 1EA0A 2XVNA 1RK6A 3RJXA 3NQAA 1G01A 1R2SA 3OG3A 1NSJA 5FL0A 1F3XA 3VZZA 2GYIA 3W38A 2G3JA 3BQ5A 4XZMX 4C6DA 2QDDA 4Q8NA 3HV8A 3VKJA 4H9MA 3H4WA 4OKDA 1TWDA 2WJFA 5IBXA 3CUJA 1DYSA 1JAEA 1T41A 1THFD 4KGJA 2NSOA 4PMNA 2J27A 1E4IA 1BYAA 3V3WA 2BHZA 1G4PA 1PWLA 1PVNA 1PS9A 1F73A 3GD6A 4ZO7A 3I65A 1G67A 3WH8A 1WKYA 1E1EA 3N3TA 4OBTA 1BXBA 4FPSA 3U48A 2BWGA 3OB8A 4NZJA 4CEXC 3L5MA 4GYPC 4FF5A 1VENA 3PR2A 4FLQA 3MUCA 4YHGA 4PRTA 3NM1A 2VEGA 2C15A 1KR1A 3EX1A 3XIMA 2XGIA 2I9UA 5CG0A 4UTUA 3VGGA 4PUUA 2R9RA 2XIJA 4XIAA 4ZVJA 1AQHA 2IW0A 2DSUA 1R3YA 2CETA 1HKKA 4UFLA 2X8RA 4J3XA 4CQCA 3CK5A 3VE9A 1G9HA 1ALDA 3LBMA 1EO7A 3MHFA 5ABEA 4QX4A 4LUYA 1QT1A 2YL5A 3ATZA 1UKSA 1X7IA 1J6PA 2FGLA 3FA5A 8RUCA 4AZGA 3WUGA 4FA3A 1FHLA 1T99A 3ARWA 4LYPA 3WQEA 4ORMA 1AJ0A 3UP8A 2IMRA 3KTCA 4IL0A 1MI3A 1O6IA 2Z1XA 3N2OA 1E6XM 1JDEA 5JIWA 3R58A 4XV0A 4B4HA 3NURA 3DYMA 1W9VA 5CG7A 2FZBA 4UR9A 1Y5WA 3N3MA 5CXPA 3WQGA 2D3NA 5CPSA 2RGLA 2QV5A 1R30A 4C65A 4L6HA 4XAYA 1RJRA 1KBJA 1KM1A 1VEOA 3GSMA 1W17A 3VK5A 4IMEA 1NOFA 3LGEA 4HOWA 3T0BA 4JOMA 3ZJ7A 2J13A 4R7OA 1A5OC 1NWRA 1GQNA 5PTDA 1R2RA 3CEUA 2Z2AA 3I7RA 3DFSA 3BZGA 4NJHA 3JR2A 4G56A 4QAWA 3CUGA 3BLKA 2FFCA 3N1AA 1GZGA 5HANA 5FJOA 2UY4A 2NLIA 1VF8A 3AHXA 1V4YA 3TN4A 5A6BD 3ZJ8A 3VM5A 1L2QA 4KCWA 2CESA 4IFKA 3BOLA 4C1KA 1Y5XA 3IACA 4X2PA 3U0HA 3MI3A 5FI8A 5E93A 4IP5A 1HKVA 2VXNA 1DIOA 3KVLA 1TV2A 4W5UA 4XKMA 1XLEA 1XG4A 2VR2A 2QIWA 1XIIA 5D05A 5TF0A 3CC1A 6ENLA 5C6MA 5C5YA 9XIAA 1MW2A 3AIWA 4UXDA 5C70A 3RU8X 4MWAE 2J7DA 2E6DA 4NILA 4H2CA 3FSTA 4O14A 3VMOA 1WO2A 2RGMA 3LTPA 2OZ0A 3KLLA 2Z1BA 2ZCGA 1E6RA 2HE8A 2ZX8A 3GZ3A 2ZZ3A 4CKQA 1J2BA 3B9NA 1W3TA 2EPNA 2VFEA 3MTWA 4J3SA 3GVRA 3U7BA 3OLIA 1TCDA 2F2HA 2GQ8A 2VZVA 2FMNA 3QF0A 4U5IA 2PA6A 2WJEA 3IUIA 4LJ3A 2YXGA 4CNTA 4AIUA 5DN1A 4UMAA 1H51A 3MU7A 5IFPA 4R3UA 3OZYA 1HNYA 3TSBA 5I3FA 2TODA 5GJNA 4GYPA 2W63A 1KBLA 3DAQA 3VDBA 2WSKA 1NF0A 3H22A 3FXGA 3WLIA 2QNEA 3THUA 3WLJA 2VZTA 4M6PA 2W62A 2E09A 3KTSA 2CLPA 3R89A 2OWWA 3T2PA 3A23A 3GRIA 1JYXA 3G3MA 3CJPA 1P0EA 4JTAA 3IAPA 1QO5A 5CAHA 4OZOA 1QI4A 3S5OA 2HPMA 1BPLB 1UC5A 3OQ8A 3RG6A 3RCMA 2X2YA 2YXOA 1LG1A 1ONEA 1LOLA 3UNDA 3NQCA 3RRAA 1RA5A 3KS5A 5GPRA 3TX9A 1B9ZA 3DOPA 1LP6A 2PUZA 4PUNA 4AEEA 4M5PA 1A5AA 1B57A 5T91A 4BWLA 3UY7A 2V5JA 2E1DA 1P0NA 4CU6A 3AWOA 4A3QA 1ITQA 2RDXA 3WLKX 4AYSA 3UERA 1XC4A 1LROA 1ONRA 3WQ6A 4KWOA 1XDMA 3LZ3A 1EUAA 1P43A 3ZMRA 3PM6A 4S3EA 4NXKA 2IPWA 2X1IA 3QV8A 1C7TA 3UETA 3WFZA 1VFSA 1H60A 1HF6A 1NOWA 3SAZA 2A7PA 3RR4A 1X8FA 1XDJA 3QV6A 1PZ0A 5C7VA 1G1YA 4A8NA 5HMFA 3UWQA 1J5SA 2AAAA 3QHOA 1W0MA 1CWYA 5DELA 3M5VA 2W4XA 1EZWA 2HVNA 8XIMA 3ID7A 2ZZ6A 3V7PA 3WF0A 2PWEA 4IPLA 1UOKA 3AI0A 2X1TA 3P0XA 1HVQA 4CQ8A 1BFNA 3BW3A 1TUXA 3WLQA 5CJ5A 4O1EA 5CAKA 1E4LA 3KRBA 2Q01A 4PMUA 1CLKA 5CGTA 1ZBVA 1W31A 4K3ZA 4QG9A 3NZPA 2YA2A 1UMYA 2VJXA 3JRKA 1S46A 5JH2A 3RNDA 4NKCA 1MWOA 3UJFA 1JEZA 3BLOA 2GDUA 3ARXA 5E70A 5I03A 1UPPA 3DESA 2PD9A 4KERA 3QYQA 3GE7A 4QIUA 1QU4A 4KWVA 2CERA 2VO5A 2A7NA 2PDCA 4NUWA 3K8LA 3SJNA 1R38A 4GGHA 4MKSA 3LBCA 3NSMA 4XIMA 1XFBA 4U3CA 4B15A 1XM3A 3JUGA 4O19A 3U5UA 4UQCA 4MAVA 2NVDA 5EFFA 1FWNA 5B80A 5CBJA 3R4IA 4RLIA 3F4VA 1F76A 5D2WA 3O0FA 3T42A 4H8NA 5K7JA 2IQDA 2C0AA 3MVIA 1XR2A 2XIQA 1W5NA 3GY1A 4AWEA 3D47A 1LWJA 3JU2A 4IQEA 4E4UA 1XYAA 1FKXA 3RLUA 1JCNA 1J96A 2NV2A 4D72A 3OVQA 5D32A 3H26A 3HB9A 4L6DA 4IXHA 7CGTA 5EPDA 1YXDA 2BS9A 3A3HA 3I3BA 3UD6A 1YPXA 2XIMA 4CCEA 3CAKA 4Q8VA 4HBKA 3FX4A 3R8HA 3VAVA 5HQLA 4GIRA 3AROA 1VLIA 1Q8JA 3ZLHA 3UFYA 4IQLA 3M43A 1X6LA 1V6UA 4DQWA 1JYWA 2CEQA 3NQ6A 1O5QA 3W7EA 4GZEA 5BCAA 2Z26A 4QLKA 4AVNA 3NDYA 3KBVA 2WMHA 3C56A 4OOUA 4ZEPA 2QCGA 2XH0A 4DJDD 1OGGA 2QDGA 5I3IA 5K3VA 1CB2A 1VYPX 1HX0A 1NAL1 3GNPA 2WHKA 2WLYA 2FH6A 4ERGA 1ML1A 4WIWA 3B0YA 4U2YA 4EIVA 2DUAA 1VHCA 4ZQMA 1UD2A 3GDTA 3GTHA 5A6TC 5T26A 3NG3A 3CL8A 1WDRA 2WCGA 4BJHA 3HF3A 2A3AA 2XWEA 3GTXA 3KW3A 2YBTA 4FLSA 3QLDA 4JQ3A 2E1WA 2MANA 3ABXA 3RCYA 4IFKB 5D9NA 2HCVA 3TQ0A 5BXRA 1GVQA 3PBWA 2OWXA 3WLMA 3GYEA 1ZB5A 2LLEA 1N82A 3H2EA 2O7QA 1DOSA 4DLFA 3BG3A 3ITTA 3H2OA 2BODX 4GXWA 1I2NA 1SZGA 1JPDX 5CPNA 3NL6A 1RJPA 2DH2A 4JIIX 4DO7A 1XLIA 1V6WA 4FP1A 3IS4A 1YPFA 4IJBA 4Z2KA 3SGGA 1H5VA 4MY8A 1F6PA 2JKPA 4H8UA 1HTIA 2ZDSA 2OJPA 2DIJA 4LUSA 1IXQA 1M01A 4ZQNA 1RP9A 3GO2A 2QUTA 1Q6FA 5KEZA 3M07A 4FXFA 2OTDA 2X2GA 1OK6A 4N4PA 2AQVA 2AL2B 4PB5A 4XTIA 2JK2A 2QUVA 5FD0A 3LDVA 2NLYA 1LQAA 3A4AA 3VX1A 5IFTA 1ZCCA 4GYKA 3QLLA 4AMCA 1DTNA 1FH8A 2ZC1A 2PEVA 1V3IA 1BGGA 3H2MA 4FMVA 5I3JA 3RPTA 3SW6A 3B03A 4ZFMA 1DWHM 1VYSX 1ZBWA 1AG1O 3L0KA 5HMDA 1OX6A 4Z1YA 1RY0A 4QJ1A 2HDJA 1GOKA 1R7OA 4IPJA 2Y7DA 4M24A 1L8PA 2DT2A 4UFMA 1XG3A 4UWMA 1PKNA 3A12A 4LW7A 3MSDA 5G2IA 4JGDA 4LF2A 4ZO9A 3MW7A 3SQMA 1LTDA 3N2MA 5M17A 1DE5A 2DZXA 2EKGA 2QCCA 5BMXA 4HYRA 2D2OA 5HR7A 3WBWA 3A3WA 2ZC8A 3EX4A 4RW5A 1D8CA 2V68A 2GJXA 2D69A 3P81A 3APGA 1Z42A 5HWJA 1UASA 5JVLA 3KOWA 1LLZA 1ZGDA 3VZXA 2DSKA 3KRZA 2QZRA 3FAWA 1DV7A 4WKAA 3B8VA 1W3JA 2WYSA 2DT0A 4GISA 1XYCA 4UFJA 4F0KA 4QITA 1TWZA 1YTEA 2PRMA 3CMFA 4PUEA 4O0KA 4DM2A 3GTNA 3QSRA 4QEEA 1AW2A 2FGZA 2J66A 1WV2A 3N2XA 4A29A 2A79A 1EXPA 2VDHA 1TA3A 5FESA 4O18A 1JJKA 1FH7A 3F4CA 4GNKB 1ISVA 4KEZA 1KBIA 4HNUA 4MB5A 1ZFJA 1QNVA 4IZGA 4CUCA 3A47A 2G4FA 1QI5A 1AMYA 1EBHA 1UKOA 2VFDA 4DUVA 4D71A 1VB9A 3CTLA 1OYBA 5FEZA 1VJIA 3QR1A 2I9EA 1EF2A 3ZO9A 4B5NA 4TR9A 4X2RA 1B3ZA 1XX1A 1MFVA 2WJZA 2WZIA 2C14A 3TNBA 1PIFA 4RW3A 2AQWA 4ZA0A 1SQ7A 4UOQA 2PF8A 1PX3A 1TUFA 3ZT7A 3VNMA 1JUKA 4JL2A 1VCGA 1PIGA 4I7VA 1F4HA 3LU2A 4GHRA 2B7PA 2PLCA 2CKRA 4BI5A 4GK8A 1ME7A 4B3LA 4S3CA 4C6CA 5F4XA 5DF0A 1OQFA 3GBDA 1M7JA 3O2LA 1EPVA 9CGTA 3M0ZA 4I9JA 2O4MA 2NT1A 1GOWA 2B81A 1S3HA 2PAJA 2GQ3A 1RQHA 1JFXA 4J3WA 1X96A 3WQCA 4O4WA 1GJUA 3RM4A 1GVYA 7TIMA 3H2FA 4EPEC 2EEXA 5I5RA 1GOXA 4QR6A 1DWFM 1GGOA 1KRAC 3CAQA 3ELFA 2VFHA 2OO6A 2AL1A 3IV3A 5GNZA 3MQTA 5FAJA 2GQ9A 1TE6A 3PZUA 5CZTA 1GPWA 3VCRA 1OWQA 3NQFA 4GUFA 3URAA 4ICNA 2YDSA 4BEUA 1EJTC 3V16A 4A8LA 4V1YA 4KF1A 3QKZA 4HZ7A 4MJMA 5LNSA 1KA9F 2ZZ2A 4F0HA 4IIFA 2OOGA 2GGEA 3KM8A 5FIPA 3UR8A 4QNEA 1SO4A 2F7FA 2YDAA 4XZNX 1R9ZA 4JKMA 1BYCA 4FXRA 1UKQA 3RMJA 1CXEA 2NWSA 1VHNA 3QPYA 1TJPA 4N7QA 3LCWA 4JTCA 4HK6A 3VDGA 3WY1A 4QHRA 4OUEA 1VIWA 4KFNA 3V1PA 3WMBA 1H7NA 1O4UA 4B5SA 4B5VA 3FIGA 2YL9A 4O15A 5G2HA 3ZYZA 1Q2RA 2X40A 3KCOA 4FXSA 3U4AA 4ZO8A 2B0MA 3U9IA 2GQAA 1D3GA 4HB7A 3N2BA 4IUGA 3M0VA 2R82A 1CYGA 4JTTA 5FEWA 1AA1B 4INFA 3AUJA 3AHTA 3MANA 4L9XA 3RPDA 2PDFA 3IWPA 4IQJA 3G8RA 1UR1A 1DJIA 1A5LC 1KFJA 3WMSA 3CM4A 3EDKA 3UWEA 1HKWA 2PTDA 3CB8A 1WZMA 4LUSB 3CWOX 1HZYA 2XFRA 1LRNA 4S3BA 1XXXA 4QQ3A 3C8FA 5DMLA 2Q8XA 1KC7A 1W1ZA 2HVOA 1KXHA 1LUCA 1F9CA 4NI3A 2A4AA 3QTPA 1E15A 1ZAIA 4G5DA 3EPOA 3RLVA 3GG0A 1W1PA 3UWZA 3GC2A 2G0WA 4I5XA 4AC7C 5JU6A 2WZTA 3R5EA 3PPHA 3TQPA 2Y5SA 1GCYA 3KWSA 2XINA 3WEZA 3XINA 3LEPA 4C6MA 2C18A 4GNJA 3ES7A 1KWKA 3CLWA 1C8XA 4MZ1A 3IGUA 1EJUC 5HMEA 3UWUA 2YBUA 1PCKA 4GZJA 1WUFA 2EJ1A 2VEKA 2DGAA 2PDLA 2CWNA 3RR1A 3G1VA 2D23A 1R6WA 3HGOA 1MUMA 3UVIA 1TMHA 2PZ0A 4BQ2A 1ADSA 3OVGA 3THAA 1DJYA 4QDWA 1MDRA 3GDMA 2GVLA 4H8VA 3FOKA 1FWRA 1YLVA 4GUIA 3WK0A 4AH7A 1DKWA 1Q6RA 3VKKA 1K7EA 4EWJA 1B3WA 4O53A 1JDDA 3IV8A 5ABFA 3ZVHA 2H90A 4ZQRA 4JY8A 2FDSA 1J8VA 4PR4A 3S4TA 1CX9A 1RA0A 1IEWA 3B8UA 1CI1A 3PUOA 1KLZA 2V81A 3GVQA 4FOUA 4GQ0A 3KTXA 4WSKA 1SZEA 1E3ZA 3WNMA 3GIQA 1BKSA 1E9YB 4FF7A 3XISA 3H53A 4YVVA 2BOFX 5CEWA 1UP3A 4XG1A 1J0HA 2GJXB 1OYCA 3POHA 2IKJA 3C0SA 2NQLA 2O4QA 2AKMA 1ICSA 2DUXA 4A3RA 1TPVA 1QRQA 4FLOA 1K9EA 3QH2A 3PTQA 4PL1A 4RNHA 3OLGA 5G1MA 3IPWA 1FTXA 4J28A 1MUWA 3TA9A 2WWDA 3SM0A 2FVKA 1M5WA 4PMRA 2WC4A 4DYKA 1F61A 2OMAA 4W89A 3LOTA 1RQBA 1BVNP 3TIMA 3IK2A 5F1UA 2NQ5A 1D3HA 1S38A 2VX4A 4YPJA 4W5ZA 1TA3B 4KH2A 3LHTA 2PMQA 4X0VA 4X60A 3TQVA 2XH2A 4PZVA 1B2YA 5HOSA 3VDAA 3G6MA 1LWHA 4DAIA 3MYOA 1RAKA 4AQLA 2FIQA 1RHCA 1KQZA 3ARTA 3OJGA 4Q8UA 1GPFA 2D3LA 2PLMA 1YE4A 4HNLA 4UCGA 4AZBA 2I1OA 3MP5A 5H1WA 1GWJA 5HJXA 4CN4A 4YTTA 2OPJA 1GK8A 4WSJA 2NQ9A 1I4NA 4XAGA 2AMGA 1Y8BA 3HFTA 1Q63A 1YPIA 1Q45A 3P2VA 1IHIA 1IIGA 4KWWA 1UH4A 3K5XA 3WBYA 2V69A 1T0OA 1C8VA 2H8XA 4AC1X 4C7DA 4K1WA 4Q8TA 3QOKA 3CQKA 2ZRVA 2J6VA 3BC9A 3OBAA 4JNZA 4D6CA 1MQQA 3COTA 3ERPA 3PAOA 5CPMA 4XZHA 1JL8A 3IUHA 1R5YA 5T9CE 3STEA 2V2DA 3LX9A 1LL6A 5LIKX 1AQFA 1F4AA 1OGBA 4GC4A 3T9PA 1EXBA 2VRQA 3P5ZA 2Z6JA 1OF8A 2Y8VA 2V38A 1QBAA 3ZWSA 3VYLA 3CH0A 3CBWA 1G6CA 4XD5A 1OC6A 3GG8A 1B4EA 1SW7A 4C1NA 3BAYA 4GWEA 1JPIA 4IIDA 1CBGA 1RCOB 4ZOEA 3W0KA 1W1A1 3LSCA 3WF2A 1LF1A 2W92A 2WW5A 2P10A 3E0WA 1J93A 1V77A 3HMJG 1IT0A 1E40A 3JVAA 3EEGA 1EZ2A 1FWTA 3LHVA 3WH6A 4A21A 2ZQ0A 1KKRA 1IWAA 1UKPA 3UA3A 3R12A 3BGGA 4J2MA 1EPXA 3VD9A 2J25A 1EF3A 1GVOA 1PKMA 1LCOA 3BQ6A 5I00A 5XINA 3MHUA 1RSCA 1WAWA 3NGFA 4RR4A 3RK8A 4UTIA 1CXFA 1W2PA 4AMAA 2O92A 1SMDA 2FZDA 3A24A 4GCAA 1V6TA 3PC0A 4H41A 1XLAA 4LH8A 4RZ4A 2ISWA 5IXEA 3NQ8A 4YNGA 1TYGA 3CUIA 1ODUA 2QAFA 4XWUA 2W67A 4ATLA 3VA8A 1DQXA 5HQEA 4C6NA 3GU2A 3GXTA 2PDHA 3EWWA 1EBGA 1PDZA 1E9ZB 3L5LA 1ZUAX 1NWUA 6XIAA 2GLKA 2ZOXA 5ECVA 4LVBA 4M1RA 1U22A 4H2HA 5IHRA 4WDXA 2UV8G 3GHRA 4OIFA 3MJYA 4DELA 1SSDA 3T2QA 5DMMA 1OZMA 3BL3A 4J5NA 3OOQA 3WL1A 1EJSC 1XGEA 4GKTA 4R34A 1W6TA 3BW4A 4L80A 5CLTA 4NX5A 5CC3A 3PZGA 4DM1A 4M29A 2WZMA 4BFAA 5DO8A 2PDIA 3QZ6A 3U5YA 1BF2A 1V0MA 3IGHX 5EMYA 1H7OA 1LM1A 3BCJA 1I8JA 2PTYA 3ZVIA 2F84A 4HPGA 2VGIA 1S2CA 2Y4SA 3DZ1A 3VIPA 4C6IA 3H7VA 1GORA 1L6YA 1W2VA 2XIBA 3C0QA 4WSHA 3CUHA 4B5UA 1E1FA 3QW4B 3WLTA 1W9PA 3FJ4A 1LUCB 4M3PA 4UTTC 3WEOA 3FYOA 2NQHA 3OGSA 2QS8A 2HRWA 3WUEA 1K9DA 4S3KA 3W87A 2WCAA 1U33A 2XFYA 3ARYA 1YNYA 5D04C 2ISFA 6XIMA 5I79A 3WDJA 2I14A 4S1FA 2QMJA 1Y0EA 3AYVA 3R79A 1F8IA 1E71M 4PBFA 4IMGA 2B7QA 2QCLA 2BVTA 2D0FA 1SGJA 2P0OA 1HL2A 2BDQA 1E0VA 1NEYA 4RV8A 3Q58A 4ADSA 4JQAA 3RU6A 3SZ8A 2QJNA 1UH3A 3W6YA 2CPUA 5ABFB 1QDSA 3ZVHB 4ATDA 1KXQA 5H2ZA 1RV8A 2DUZA 5JQ9A 3I6EA 4I7UA 4FNSA 1MUCA 4A3UA 2FPYA 2V5CA 2ZRYA 1RCXB 4RDVA 5DQPA 1T7LA 1R7AA 2XVPA 4V33A 1EH9A 5BRQA 3K30A 2YB4A 3MBFA 1XP3A 1J6OA 2JEQA 1LL4A 3U2EA 3QQWA 4H1ZA 5IM51 1M04A 4FAMA 1XYFA 2QCMA 3W83A 2V5LA 3WDIA 3ANVA 2KZHA 2ZVIA 3STGA 1FHVA 1UWUA 5C9XA 4AD1A 1VGAA 1I75A 3G0SA 4BKNA 3H4GA 1UZ4A 3FS2A 3K1GA 2CBIA 2GJPA 3HPAA 3VCCA 2P8BA 3MDWA 3W7GA 4DN1A 3R11A 3K46A 4EACA 4P7LA 3MP3A 1ISXA 3TCEA 3GR4A 2R91A 5HINA 8XIAA 2OX4A 2OSYA 1PAMA 3TC3A 5A69A 1PKYA 1EOKA 4UQEA 3LUTA 3B8TA 2F6XA 3HURA 3VNIA 1EC9A 3LI1A 3WYZA 2OKOA 3TWBA 4Z1AA 3W84A 3BWWA 4LYRA 1Q13A 3WJWA 4N2YA 3NWRA 4AEFA 4P7OA 4NU7A 3BVJA 5I09A 4G2DA 2J7CA 3PTDA 4HJFA 1TPWA 4EXBA 4QLLA 2DH3A 1O12A 3MDUA 4O16A 2BHUA 3N2TA 2Q8LA 1YXCA 4DLMA 4P7RA 4F48A 3W7OA 4HU8A 4RE2A 1E5JA 1S5MA 4NIRA 4KIRA 1GNXA 2V5BA 2QVNA 1TQXA 4AZCA 4TTUA 2RFGA 2CIPA 2PGRA 4PMYA 4B92A 3S5NA 3W23A 1VFMA 2XH7A 3GNRA 4NAEA 1XLGA 2AGKA 1HL9A 4J9JA 3NM3A 2FPTA 3ZR6A 5EB8A 2EO7A 3AUOA 2DVUA 3UPBA 2PWFA 3ISIX 3W1NA 3IAQA 1D7FA 4D6EA 5CBBA 5JXQA 1CGUA 3B8IA 1GJWA 3MI6A 3PBVA 2XWDA 4MMWA 4C1NB 3CPUA 3LCIA 1IT7A 3RHGA 1PSCA 2BXVA 1X8CA 2KAUC 3SB0A 2FZ8A 1NARA 1DJXA 4GI6A 1BQCA 4DAFA 3MSYA 2VR4A 2Y2WA 3FN9A 3OVPA 4J3VA 3WCZA 3EKLA 1W54A 1QNPA 3VVGA 3WK3A 4PUJA 4M7TA 3ORWA 3TK7A 1XIBA 1XHGA 4I6KA 4LUTA 1JVNA 3F5JA 4Y9OA 3UVAA 4NHVA 5CSUA 2I56A 2XM1A 1LDCA 4KFPA 4UTFA 1G94A 1AQ0A 5GNXA 3BJTA 2R1PA 3R2GA 5EMJA 5BU9A 3IVSA 3LM7A 5C7HA 1XIHA 4PTWA 1GVIA 3RM9A 3LMYA 2OYLA 1Q4WA 3T0AA 1LOQA 5A6KA 4L4OA 3T0CA 1YTKA 4JFWA 4ECLA 1V0KA 4LAUA 2DVXA 4NVTA 1KCLA 5DCEA 1WZAA 2ZX9A 1GZ1A 3MV11 2J9XA 3DGBA 1RALA 1A5NC 2Q09A 4JFUA 1K4HA 4XZBA 1KKOA 3WQ5A 1TVNA 1UD6A 4B3ZA 1CGTA 3M0HA 3H24A 1NH6A 5BW6A 1VBUA 4I3GA 1UR2A 4AF0A 3GM8A 4QCEA 2ZX6A 2W79A 3MCOA 2PDXA 3DHFA 1LBLA 3NZQA 4OBRA 2PC4A 2PTZA 4Q4RA 4ZB5A 2GDVA 2QCNA 1JF6A 3KBJA 1W3HA 4MZYA 5K9DA 1XINA 1FKWA 1FRBA 1UWRA 4ZQOA 1A50A 1IEIA 4XAPA 1HL8A 2EPMX 1HW6A 2FH8A 2ONEA 3EBVA 5XIMA 1Z7AA 5E9AA 4C6QA 4JAWA 3NO3A 3STFA 1KQYA 4NNAA 2RHGA 3N29A 4XSLA 4Z2JA 1LJYA 3DHDA 4JTGA 2CITA 1X38A 5CZSA 1QPNA 2BB0A 3BE7A 3K1DA 1Q6LA 3TVAA 4Q8QA 4I9TA 2C0HA 4O1FA 5G1YA 3TU9A 4PMDA 4W88A 2WANA 2ZKMX 4RZ5A 3AMGA 1H63A 2NW0A 3KDNA 1XUZA 1EP1A 2DZTA 3GAKA 4HP5A 3KCJA 4I6VA 3PNZA 4UNKA 4JX5A 1J0JA 1FP8A 1S2TA 4QEHA 1Q6EA 3BMXA 1V02A 4GQQA 5D2XA 4CCZA 5TQLA 3GXMA 1IV8A 5KZDA 3TCSA 2ZZ1A 4AUBA 2KX9A 1XH0A 1BRLA 1P6BA 1NFBA 3OODA 3ZJ6A 3WF1A 4HD5A 2WMKA 1XKJA 1TG7A 4S39A 4BF5A 4L6OA 2CZFA 1JAKA 1H49A 1IGWA 4MJ4A 5AC6A 1AW1A 3BAIA 3N4EA 4UTLA 1DJNA 1ECEA 2D0HA 3FVDA