4MWAE

1.85 angstrom crystal structure of gcpe protein from bacillus anthracis
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
260
structure length
258
Chain Sequence
NEMTHRTKTRPVKVGNLTIGGNNELIIQSMTTTTHDVEATVAEIKRLEEAGCQVVRVAVPDERAANAIADIKKQINIPLVADIHFDYRLALKAIEGGIDVRINPGNIGRRHKVEAVVNAAKERGIPIRIGVNAGSLERHILEKYGYPTADGMVESALHHIKILEDLDFHDIIVSMKASDVNLAIEAYEKAARAFDYPLHLGITESGTLFAGTVKSAAGLGAILNKGIGNTLRISLSADPVEEVKVARELLKSFGLASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
publication title 1.85 Angstrom Crystal Structure of GCPE Protein from Bacillus anthracis.
rcsb
source organism Bacillus anthracis
molecule tags Oxidoreductase
total genus 95
structure length 258
sequence length 260
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2013-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4mwaE00
3TZFA 1F6YA 3H2AA 3TYZA 3TYAA 1TWWA 4MWAC 1Q7MA 3H2CA 1AJ0A 3TYBA 2YCLB 3H2FA 4C1NB 4MWAE 2DZBA 1TWSA 4S3DA 4PZVA 4DJDA 1Q8JA 4O1EA 2DQWA 3MCMA 1AD1A 4DJDC 2BMBA 1AJZA 4NL1A 2H9AB 4NHVA 2E7FA 4D8AA 4S3FA 3BOFA 1AJ2A 4D8ZA 4NIRA 4O0QA 4C1NA 3MCOA 4D9PA 4MWAB 1Q7QA 2Y0FA 4DJFD 2VP8A 4CCZA 4DB7A 3H26A 4S39A 3TYDA 4O1FA 3H24A 4MWAD 2Y5JA 3TR9A 2VEGA 1Q7ZA 1TX2A 4S3CA 3H21A 1AD4A 3H2EA 4DAFA 1TX0A 2YCKX 2YCLA 3TYCA 1Q85A 2DZAA 2YCIX 4S3EA 4S3AA 4DAIA 3H2MA 2YCJA 4DJED 5JQ9A 3BOLA 3NOYA 2VEFA 3V5OA 3K13A 3TYUA 1Q8AA 3TYEA 2OGYA 4S23A 1EYEA 4DJDD 2Y5SA 3H22A 4S3BA 4DJEA 3H2NA 2H9AA 4DJFA 1TWZA 4S38A 3MCNA 3H2OA 4DJEC 4MWAA 4G9PA 3TZNA 3H23A 4HB7A 4DJFC 4NILA
chains in the Genus database with same CATH superfamily
3S83A 2FZBA 1ADOA 5KZDA 3UJFA 4JTIA 1RCXB 3AAMA 3SGGA 3VTRA 2YW4A 1ZHAA 1DORA 2F9RA 2PD5A 4PODA 3D5HA 4HT3A 4IUGA 3LLXA 1L8PA 1OX4B 5D02A 2J4GA 3TR2A 4IMAA 4MPQA 2IKIA 1K7FA 5IBXC 3KZPA 2YKKA 3LMZA 4ZMGA 4NI3A 2A5HA 3XINA 1PCKA 1JCTA 2QUMA 4DJFD 3REQA 1LRNA 3T8QA 4M6VA 3P7YA 2V9DA 4L6HA 3W2NA 1IEIA 4MWAD 1TTQA 1WA3A 3M0KA 3WK0A 4KF1A 2XSBA 1J6PA 4LRTA 3LGEA 4RK8A 3VDAA 4GA8A 3N6HA 1N7KA 3M0YA 4Q8QA 2OYKA 1KBLA 2XDFA 1VIWA 2W27A 3AS0A 5DN1A 9XIMA 1SFTA 3ITCA 4UTJA 2BLEA 5DMMA 4MY1A 1QBBA 3MHFA 2GSEA 4M0XA 5J5RA 3E5PA 2GUBA 4WHBA 1SZEA 4HZ8A 5LA2A 1LT7A 3SB0A 1LRTA 2J27A 1R3SA 5GPRA 1E0TA 3GLCA 4C6DA 4AIBA 1LQ2A 1BTCA 2J13A 5AC5A 4EK7A 1CLVA 4Q7BA 3B0VC 4GIEA 1QAPA 3WH7A 3TUUA 1LDCA 1FOBA 4AX6A 2PDUA 1JFHA 2Z7GA 3N73A 3A23A 1VPYA 4KFPA 4OBTA 1TRDA 2GL5A 3K1DA 2NWRA 3TJXA 1QI2A 5HOSA 5C70A 1NOWA 5HMDA 2OFJA 1EC7A 2VJXA 3HU7A 4WCJA 1WDRA 1LTDA 5G4HC 1GZ1A 4U2ZA 3GDRA 1SW7A 4BQ4A 2J9YA 3A9BA 3QQ1A 5D8WA 5HAOA 1VLWA 1W8SA 2QULA 1S2VA 1MQRA 4QHRA 2WPGA 5CBJA 1KFJA 4HNTA 2DZSA 2HXTA 4QG8A 5DF0A 4N42A 4NRSA 1GOIA 1QXLA 3FS2A 1G7VA 5IDZA 2I5QA 5CJ5A 3L65A 1IQ8A 2OYMA 3POCA 4HU8A 3LPPA 1GQJA 1XLCA 2YZ5A 3CV7A 2WNWA 3KBNA 2IKJA 5DY3A 1TMLA 4UB9A 1WZAA 3S5SA 4GYFA 4NG3A 2J6VA 3K2GA 4W8LA 1W3NA 4DWSC 3MU7A 4UQCA 1BXCA 1R2SA 4IP5A 3D3FA 3UXLA 2QDEA 2J8GA 1LOQA 2QCNA 2O4QA 3GC2A 2IKGA 5LNUA 2YB1A 1NOFA 4FZIA 4LOCA 1DV7A 3UA4A 2OX4A 3SY8A 2PURA 3KTCA 5FJPA 4ROQA 2O7QA 3EXRA 4L56A 1MO0A 1EJTC 2Y1HA 2VTFA 3ZJ8A 5TF0A 3BPWA 5HQLA 2VCCA 3AS1A 4BQ2A 1V79A 3NZ1A 4ZB2A 4FNTA 4IIBA 2XGBA 2ASHA 4UTWC 3GNOA 3SRHA 4JKLA 4I6KA 2GYIA 3L12A 5I09A 2ISSA 4NJHA 1R0MA 4AWTA 2Y0FA 2Z6JA 4NU7A 1R46A 2WZHA 1RP9A 2YDRA 4LS2A 4WQ6A 4CNTA 4JTUA 2PZ0A 2QAFA 3SUSA 3NQDA 5KINA 4KEZA 4K1GA 2G41A 3DFQA 3QSRA 5CLWA 3LTPA 1DJNA 5D09A 5DFAA 4P7LA 1HGYA 4CVWA 3CQHA 1QWKA 3G8RA 3TTQA 2PDPA 4O4VA 1E43A 1GJWA 4POCA 2YA0A 1GVIA 2EJAA 3I7QA 4F0SA 3WUGA 3BJTA 2VQTA 3AXXA 1RPKA 3N2BA 1JGIA 4JEQA 2NT1A 4J3WA 4Q4MA 3DHDA 3FN9A 1VCVA 3KVJA 3ZYZA 4B9YA 2NZLA 4LALA 2Z7KA 1VJZA 1KM1A 4GI4A 4I8YA 2QF7A 4K39A 2YLLA 3L68A 1B4EA 4UCGA 4JTSA 4EX4A 1F4AA 3HG2A 2PWGA 2IQTA 3BK0A 3HZ3A 5E0FA 4HNOA 5LIKX 3RN6A 3TMQA 4XBKA 3S5ZA 2A3AA 1VEOA 2NW0A 1FWTA 4JS3A 3G77A 2FHBA 1DVJA 2QNEA 4JTGA 2ZX6A 1XDJA 4F79A 3B4UA 1VCGA 3QOKA 2D2OA 3FIGA 1XCFA 3WN6A 1MI3A 3IJ7A 1Z9AA 4IOTA 3EDJA 4B4HA 3BAWA 4V2XA 4E4UA 3BLKA 1X6LA 1KCLA 3VD9A 2I14A 1FCQA 1G67A 3CPUA 2PP3A 1GQIA 3PG9A 3RHGA 2AKZA 4XZBA 2O9OA 3SADA 3IIXA 1HN1A 1Q85A 1X8FA 3GVGA 3K4AA 4YYFA 3AI0A 1WP6A 5TD4A 4J3TA 2YCJA 4H9TA 1R47A 2FZNA 1EP1A 5AHNA 2P88A 2CCRA 3U5UA 4ICMA 2PGFA 3GTHA 4DPQA 3U7BA 1UUOA 3WBXA 1LG2A 4GZJA 1SPQA 2P0IA 4UUIA 5EMKA 2PDFA 2BHYA 4OQVA 5CKSA 4ZSTA 3W1RA 2W62A 2ZIDA 3NDZA 2OR2A 4HP5A 4CNPA 3WNPA 3SJNA 4Z1CA 1J18A 4C90A 2PDMA 2EG8A 2XIJA 3GDKA 3E74A 3IJ8A 4WDWA 2C1GA 1SO3A 1ZJIA 3MP5A 1XGEA 2DU2A 3L4WA 3GHUA 2G5WA 1TMQA 3NQ6A 5C6MA 5IBXA 4MM1A 2AMGA 2R1MA 3NR0A 3C86A 4LF1A 3PN8A 1PL9A 2CLKA 4TMCA 3W38A 4XO6A 1FHLA 1M53A 3G1FA 2DORA 4PTWA 4JTKA 1M01A 1ZAJA 4PUJA 2G97A 4CQAA 3EB3A 3CWHA 4D9PA 4KW2A 1DJGA 1KM6A 3WJSA 2VC5A 3ARVA 1F74A 4WDXA 4Q8MA 2PDGA 1IWBA 1LLWA 3D6NA 4GYPA 1QT1A 3IACA 1VAHA 2YSWA 1QTWA 1PHQA 4JIQA 1E6SM 3DKLA 2I16A 2D73A 2HE5A 3B0UX 4U4MA 3BV7A 3PUDA 2ZTJA 5D9OA 5G2IA 1I4NA 4HGXA 1BGGA 3U2EA 2X2YA 2J6XA 2V30A 5H8MA 4GQBA 5IXEA 4AEFA 4DJDD 1TV2A 5D4YA 2GVEA 2ZRYA 2E1DA 1K3UA 1ZCCA 4FNSA 5CZ0A 1K70A 5DY2A 2WZEA 4OECA 3TZFA 1SJCA 4GPNA 1AH4A 3MQTA 1YMYA 3KOZA 3WDRA 4J35A 1KM0A 1AH0A 1OK6A 3VCCA 3WIJA 1I2NA 1IWAA 1XLAA 3QR3A 2Y8KA 3MSGA 1V6UA 2XYLA 3GAKA 4OBSA 1AG1O 1NARA 2A79A 3L9CA 5FCZA 3ZR4A 2VENA 4OIFA 4KGLA 1AVAA 4H2HA 4WY0A 3O15A 3GIPA 4J4KA 2XSXA 4G2DA 2MNRA 4W87A 2IKHA 2P8CA 2OX1A 4GHRA 4HK6A 3W7OA 3OBAA 1OCJA 5HUOA 2WNZA 2QW5A 5IHSA 1ISYA 3GXMA 4HD5A 4JR5A 1I45A 3TWAA 3VPLA 1V51A 3VVGA 3NYDA 1K02A 4S3AA 1PIFA 2V2HA 4P7QA 2HXUA 4NXSA 3SQMA 1IEWA 4PTNA 1H0GA 4N6FA 2DZPA 3CZLA 3N04A 2R1KA 4P8VA 3H6OA 3TC6A 1VR6A 3C2EA 2R82A 1KA9F 3IEBA 3KDNA 3BOXA 5AVNA 1W3TA 4DPPA 4HU4A 1XXXA 3WDJA 3ZLHA 1F2JA 3MI3A 1K1DA 1EO7A 7PTDA 1J2BA 1A5CA 4RNIA 3EMQA 1BF2A 2YBUA 4IGSA 5FD0A 4YJ5A 3AUJA 1L0PA 2YX0A 5G1MA 2J7HA 5FJJA 3NXLA 2NLYA 4E0CA 4V27A 4ZB0A 4M3PA 2X42A 3SGZA 3TCEA 4DI9A 3COTA 1JAKA 3VD3A 3BW2A 1ZPTA 4NYUA 3WLIA 2JK2A 3WKZA 1BSLA 1WZLA 1FWJC 1U83A 1D3CA 4LPCA 4YU1A 3GU1A 4US5A 4XUYA 1TCMA 4ZFCA 1P6BA 3OGVA 1XDMA 2YDAA 2ZWZA 1UWSA 3G2GA 3AIBA 3LZ5A 1EB3A 1CLXA 3JW7A 2I57A 4XISA 2FTPA 1S5MA 1Q6EA 2XIQA 4CN1A 3VD4A 1EYEA 3VC6A 2OGJA 3BAKA 3ZVHB 1VCFA 3FFSA 4LBSA 1IXQA 2YFOA 1E3XA 1GVSA 2XIBA 1XRSA 5A3HA 3CUXA 1EPVA 1NF7A 1AK5A 1YDOA 5HWMA 2E6DA 4E4PA 1ONRA 5H8PA 3BE7A 1E9LA 2HPIA 2GK1A 3YPIA 2WQPA 2JALA 3KVMA 1O5QA 1C9DA 4O11A 1S5TA 3TAKA 1UB3A 1X1NA 2NLIA 1IR1A 3VXGA 3B9DA 4H41A 2D22A 2WM1A 3CZJA 3KVKA 3S9IA 2WZMA 3KHJA 5CC5A 2PTWA 5DRCA 1X6NA 7ENLA 1RQEA 4LVAA 4LUSA 4HN8A 2ACSA 3GW3A 1E6ZA 1UH4A 3FLUA 4J3UA 1VJSA 2X1UA 3SW6A 2GVGA 1ZAIA 4DB7A 2ZKMX 3WQVA 4YVXA 3C3NA 3NO3A 2JIEA 3LZ3A 4ZCWA 5C0QA 2XUCA 3WH5A 4JN8A 4GY0A 3MKCA 4WRHA 3PPHA 2WHMA 2HVNA 1NEYA 2DIKA 2PEVA 1YQ2A 1TR1A 1AW5A 1EGVA 4XZHA 2VGGA 2WANA 3NQ7A 2NT0A 5HMEA 2HBXA 5FF3A 1ONEA 2UY3A 1W37A 3BLIA 4RDZA 2P5NA 3LY0A 4TV6A 1V02A 3AZTA 4AZ7A 1UR9A 3WBAA 1QW8A 3O07A 4YVPA 2OODA 2OYLA 2FVLA 3MP3A 2WNQA 3IUIA 1ZP4A 2NXIA 1BVWA 4HA4A 3KP1A 1OEPA 2DGAA 2E28A 4M19A 1KD0A 3B8DA 2D3NA 4GABA 1UD8A 2VGIA 4JN7A 3RIKA 5EKYA 1W5NA 1N8FA 5RUBA 3BXWA 4Y2WA 5BXPA 2IQ0A 4IFOA 4XG1A 3W2JA 2QV4A 4AD2A 3ICJA 4HYWA 2G4FA 4IUOA 1SMDA 3F5JA 3CASA 2I1OA 4QE1A 1DWGM 5C9ZA 2HMCA 1FWDC 2J47A 4HVXA 4AX7A 4ORMA 3NJ3A 1IT0A 4ATLA 4DN1A 4DLMA 1UKQA 4AC7C 3PULA 3EAUA 4PL1A 1MDRA 1RLCL 3QPEA 3G6LA 1V4YA 3L23A 4FNQA 4TU1A 3S9YA 1UWTA 4HU0A 4X63A 2Y7EA 3LCGA 1REQA 1ENUA 4W84A 3EKLA 4BEUA 3EA1A 5I3JA 2X7VA 3WQ6A 3INPA 4I7VA 1YNQA 1O12A 3UP8A 1L2QA 4L4LA 4AEEA 3ABQA 3PUEA 1HKWA 1DQWA 4FLSA 3W1NA 4F0RA 1Z7AA 1VH7A 4GCXA 4ILSA 4JIEA 5BOFA 1TMHA 3MZNA 2RJGA 3WQFA 1UMLA 2WSPA 1UBSA 1GG1A 2NQLA 3GG7A 3DERA 1D3GA 3WJZA 3RU6A 2VL4A 3DU0A 3LV5A 3BCFA 5BCAA 3MVIA 5I7GA 1UW9A 1QO5A 1T41A 2INZA 1EP3A 5T8GA 1UP0A 4K1WA 1AL8A 2E6AA 4HCHA 4QM1A 4IX2A 2CESA 4XAYA 4ENLA 4URIA 2DJXA 3MBFA 1OADA 1QW7A 1MMFA 4JQAA 4JAWA 4US6A 1AJ2A 3RK8A 1RBOB 4K3ZA 4NZJA 3DZ1A 2D69A 2WCAA 3DG6A 1X1OA 5HPCA 4E8DA 1UWQA 3LMYA 1E1CA 3RITA 3W24A 3M5ZA 1P7TB 2E5DA 3WH6A 2XZ9A 3TP4A 6CGTA 4DF1A 5IOBA 2A0NA 4CCEA 3L0NA 2OQLA 2WKJA 1P0KA 1R7AA 5J04A 2V5LA 3FCPA 4BQ3A 3SEPA 3B3DA 4PN2A 3LHZA 5FL0A 3H54A 2XH0A 3BOLA 1FUYA 3BAIA 2QLYA 3PJUA 1NQ6A 5J8LA 3RGTA 2YZRA 5EBAA 4WJEA 4C6PA 4A05A 3M16A 5BU6A 1BQGA 1V6WA 2ZWYA 4BI7A 5HBFA 4NAFB 1W1VA 3R8RA 5HJLA 3LCWA 1UWAA 2XM2A 1E4NA 3KP0A 3V36A 3CT7A 1XISA 3UYCA 5HR7A 1OCQA 1FXQA 2DT2A 2QMJA 4UQ9A 1W1TA 4C6KA 4LAZA 1ECQA 1K8CA 3CH0A 3NAVA 3BW4A 2V68A 1MW3A 3AHXA 3DHFA 4Z2KA 2HVMA 3UJRA 1VYPX 3L0KA 4JTDA 3B8IA 1XI3A 2JIWA 5EMMA 2PS2A 1C7TA 4QDMA 2GJLA 4UR9A 3MKVA 4YL2A 2VNCA 5I0DA 5G4EA 1ISWA 3ES8A 4KBXA 5DQPA 3W6LA 5LIYX 3P62A 4NX5A 3ZIZA 1WKYA 3ABZA 1ITXA 4DVOA 3W76A 2VYOA 1ZCOA 5TIMA 4MB5A 3H2EA 3O05A 3HMJG 2O92A 3DI0A 3QC3A 5DBUA 3WLHA 3RRXA 5LNRA 3WH9A 2CU0A 4NXKA 4D1IA 4QXIA 1XIGA 3VDGA 4C91A 3SCPA 4WXYA 5I3HA 3VKAA 3N18A 1LJYA 2QCDA 4DI8A 3HPAA 2V2DA 3DENA 4JTQA 3C8NA 3E1F1 3MCNA 2F6UA 3O9NA 2OWCA 3GZ3A 3KRSA 3G24A 3NOEA 4HYVA 3WQ4A 2HROA 3KUMA 3O16A 4MB4A 1NDZA 3L4UA 3PS7A 3CUGA 2CZFA 1D3HA 1JZ6A 1OFPA 5DXXA 1F3WA 3QHMA 1T8QA 1OC5A 2Y61A 2QCHA 3G1RA 4JIHA 4NASA 2J74A 1QNRA 4I7WA 3UR2A 3HV8A 4BF5A 3C61A 3IWPA 2PAJA 4QSFA 1F6PA 1JYWA 2ISFA 2FPYA 3IRSA 2ZQ0A 1VBGA 1H1YA 3P6LA 1YTEA 1J0KA 4HA3A 1XC6A 2JKEA 4Y90A 4UMAA 4Q8PA 5E0KA 3TYDA 1SZGA 4DF0A 3LOTA 1H50A 4DYJA 1EJWC 3TQKA 1MW0A 1WKEA 2YXXA 3R58A 4LB4A 1R5YA 3NWRA 1OX6A 5C9UA 1RJQA 1HL2A 2B81A 5JUVA 4M81A 4GWEA 5XIMA 2POZA 3CO4A 3GXNA 4CU6A 2GVJA 4IP7A 1MFVA 4IXHA 5AYZA 3SCWA 3SN0A 4TV5A 3PJXA 2PDLA 3DEQA 3WNKA 4AD0A 3THCA 3W01A 1MFUA 3LCHA 1CB2A 1LBFA 5A1AA 4QNEA 1K8XA 1QK2A 4IHCA 4B5WA 5KTLA 3TAOA 2Z25A 3AHYA 1O1ZA 5HJYA 2E09A 1HP5A 1XIJA 1JJKA 3CMFA 4JTHA 4RR4A 1FTXA 1FKXA 3W7CA 1HJQA 3E0LA 3VIIA 2DUAA 2VI0A 3Q37A 4LCRA 1NM9A 1XD1A 2GJXB 2D23A 3CV1A 3APGA 4R34A 2V3FA 1DWFM 1QBAA 5KMYA 1YX1A 1OD0A 2ZDSA 1ZJHA 1E0XA 1UD4A 1XBXA 3F4NA 2XHYA 3M46A 4H9UA 4O8RA 1HL8A 3QQWA 1YPXA 3G1AA 4I5XA 2OU4A 2VWTA 3PZNA 3PZMA 4CNSA 5DO8A 3BAYA 1FA2A 1UPMB 1RA5A 5JXQA 4GX8A 3SY5A 1K8ZA 3N2TA 3NPWA 2TMDA 1FDJA 1EGMA 4PMVA 3H70A 1DJWA 4GYJA 3VMPA 5F2LA 1Z44A 3UWYA 2G95A 4CEUC 4Y7EA 1KLYA 1V3JA 1H3GA 4AISA 4H19A 1PJ9A 4D6CA 2HWGA 5FL1A 4B91A 5CGMA 3UGVA 1C29A 1E70M 2V5BA 3BLPX 3OLGA 4X2PA 1QW9A 2QIIA 5CQ1A 3NO1A 3N11A 1VHNA 1ZTVA 4D6JA 2Y4SA 5K3VA 1WKFA 4Q32A 3WQCA 1EXPA 3M5VA 4C1KA 1JYXA 2P3EA 1TELA 2OVLA 3BGJA 1S46A 4XAPA 1W8GA 4GIRA 3HF3A 4FXFA 4PCSA 3DYMA 4GXPA 3TSDA 3QBUA 2ZX8A 3DCPA 3FHAA 3NSMA 4LGXA 3MWCA 1ISXA 4F9DA 3T1GA 4Z1AA 3S2JA 3R5EA 2GGEA 1TV3A 2PC8A 2FZMA 1FH9A 2UBPC 4WX2A 3PNUA 2VUYA 4F3HA 1BGAA 1JCNA 1BD0A 4DWDA 2QV5A 3OG3A 4CCZA 2PLCA 3QYSA 3RLUA 3R94A 4GG9A 3E96A 2Q8ZA 4Y9OA 3VYLA 4RJEA 3UR7A 4KRZA 3IK2A 2EO7A 3WELA 4N2YA 4N0RA 2C91A 3RMJA 2PDYA 4CVUA 1FFQA 3DFHA 2Y24A 5E70A 2Q3RA 3ATYA 3DIPA 1F07A 5AY7A 3R8GA 2Z29A 2RGLA 5K4ZA 1TWZA 3IV3A 2GGIA 3KWSA 3M0VA 3TU9A 3JS3A 1QI0A 2H8ZA 1CECA 2ZA3A 2EEXA 2ZZ6A 4YCOA 3MJYA 2V5KA 3ME3A 4RNJA 5H8UA 5BOEA 1N8WA 1WXYA 2ZC8A 1MUMA 2HS8A 2BASA 1KFLA 3UZXA 3S6OA 4XK2A 2A1YA 2E4TA 2NX1A 5GVJA 5L6UA 2IPFA 3VX1A 3RLGA 4C7FA 4KETA 5FSEC 3U2ZA 4TTGA 4DUOA 2EF9A 4O1EA 2C13A 1EQPA 1FWEC 3MCMA 4PA8A 4WVXA 1SSGA 2ZICA 2ZFAA 2WBGA 4MYAA 1XM3A 5CC7A 1XFCA 1CIUA 3BCDA 3T0DA 4NIRA 1AW2A 4Y9PA 1KC7A 4RE4A 1MSSA 3Q4DA 3FV9A 2CBIA 3HO8A 5EU9A 4DNMA 4HZMA 3GTNA 3OBEA 1NP0A 1K4GA 3DHUA 3FYYA 4IXXA 4R9XA 4JFVA 1AZ1A 3ZT5A 1C8YA 2ZYFA 3WDPP 3W7PA 5BRQA 1EX1A 1EH9A 1F3EA 1EA9C 4AZCA 4GOAA 5D03A 3TH6A 4DJED 1UWIA 4RPPA 4YS1A 2IS7A 2QJIA 3NQBA 3TOYA 4W93A 3QYQA 3TFCA 3M4HA 3WLLA 1J0JA 2EPNA 4UQEA 1RP8A 1LQ0A 4WLCA 2RDXA 3AISA 3MUCA 3TLQA 1UYQA 3IIZA 1PO9A 2ZC1A 3I6RA 3VO0A 2FHCA 3VGHA 3H23A 4HMCA 3OG2A 3CQKA 4LY8A 1WO2A 3M7WA 1KNWA 1XBZA 1XFBA 2JEQA 2DFAA 2XFYA 1V6YA 4MSSA 4JHOA 4PCTA 3ITLA 2X1TA 3NO5A 4GZIA 1THFD 3UBPC 1LBLA 4RZ6A 4C1NB 4DXKA 1EYWA 2DVXA 7TAAA 1O6IA 2Z1VA 4NAFA 1OQFA 1LUCB 1CXHA 1T0OA 3CLWA 1BRLB 2FH8A 4INFA 1OG0A 1DE6A 3W74A 1NFBA 2P3ZA 4JYFA 5BYWA 1LG1A 2A2IA 1KQZA 3EX3A 3UCQA 3VDHA 1I60A 1VPXA 3ZVIA 1KWKA 3EBVA 1U5JA 3WNLA 1PX8A 1EWEA 5ABFA 1RR2A 4UOQA 4QCFA 3A12A 1W3KA 4BFAA 3W29A 1J93A 4XSMA 3EGJA 2V2CA 4PL2A 5TQLA 5BNKA 4PBGA 4JIPA 4NY2A 4C6QA 2YFNA 4ZBCA 1W9XA 1JAEA 2QYGA 3I3DA 1HJWA 5F1UA 1O5KA 4Y9NA 4C6JA 1Y5VA 2CW6A 2DSVA 4H8NA 4I3GA 3UFYA 4CQCA 3AIQA 3CAWA 4XD3A 1DL3A 2PBOA 2VHLA 2J7EA 5AFDA 3KLLA 1AMKA 3STFA 2BOEX 5G4WA 3S2MA 1DIOA 1ZJBA 1G4PA 2FKPA 5A6BD 1LLOA 4AH7A 3KHDA 1B90A 1XCWA 3AHTA 2VVSA 1X97A 3BJSA 3ARSA 2FZDA 5AECA 3VABA 4P2VA 3GBDA 3BGGA 3AICA 3EZ4A 2EJ1A 3LRMA 5HINA 3P5ZA 3ITTA 4LANA 1TUXA 4RE3A 4PSRA 2XVGA 1ONWA 3LX9A 2D2JA 1XYLA 4PBFA 1E9ZB 3UY7A 4FXSA 2DIJA 3FGCB 4QDPA 5I23A 1JDDA 5A2AA 4MKVA 2Q8LA 1SMAA 1OM0A 2D2GA 3DGRA 1TPUA 1D7KA 3G1XA 2YXOA 1HP4A 4S39A 5FJRA 3FJNA 4UBPC 1GTEA 5AC4A 2RKXA 1OFAA 4V1XA 1N82A 4PRRA 2YCIX 1E1EA 4G7EB 2QS8A 4QITA 4YXGA 5IFTA 4QS6A 3W25A 4GXWA 5EFFA 1G01A 3V1PA 1K7XA 1EC9A 3C2YA 4O1DA 5HNRA 3M44A 3K8MA 3R2GA 2P10A 1CGYA 3NXFA 3U57A 4GGHA 2P76A 3S5OA 1R3VA 2GJNA 4A4AA 4QP0A 5A6TC 3SO7A 2PA6A 1V8EA 3HN3A 4FAMA 5C2GA 3RF9A 1JDCA 3BICA 3OJGA 5CBIA 4ZQRA 1WE5A 2H3DA 3IK4A 5KZ6A 2EHHA 3NZQA 2V0TA 3SFWA 3EKGA 3HMCA 3N3MA 2RJHA 3N17A 1OINA 3RX2A 4IL0A 1OT1A 4EF9A 5CCZA 3W27A 3CAKA 2YR1A 3FOKA 4P7RA 2ABAA 2BXVA 1YKWA 2BWGA 5CSYA 1HVQA 5BXSA 3T7VA 3OVQA 4OJYA 3FA3A 3MUZ1 3VUPA 3AMDA 3AYTA 4IIFA 2BB0A 3CAVA 8TIMA 1GK8A 1YADA 3Q65A 4DUWA 1NDWA 4DBWA 1OYCA 4ERAA 1FHVA 3VKJA 3TQVA 4E6MA 3THUA 3C52A 1UA7A 5CC3A 3P81A 4G5DA 3WFLA 1VS1A 2VQUA 1LORA 5FAGA 1KR1A 2ZE3A 2Z27A 3IPWA 3L0GA 4LYPA 2AL1A 4WOZA 3W07A 1OJXA 3E9AA 1UMYA 4A8IA 1TPB1 4DZIA 4DJFC 4PUMA 1MW1A 1A3HA 3CB8A 4M6QA 4JD4A 4M1BA 1IGWA 4Z08A 4MWAC 5JH2A 5FIPA 1QASA 3I3EA 3QC0A 1FCBA 2QCLA 3KVLA 4Q7NA 1AQFA 3WBYA 4U31A 1BYDA 3O7UA 1CPUA 1YEYA 2BY1A 4YTSA 1GKRA 3OOQA 3ZO9A 4Q4OA 5D30A 6XIAA 1BYCA 2V81A 1JPDX 1V3IA 3W53A 1J96A 2OSWA 3AXKA 3P14A 2G3IA 4NL1A 2X0YA 4PBEA 1HJUA 3B97A 4ML9A 4DELA 3LGDA 2GUUA 3QKZA 3MC5A 1VRXA 2OKTA 2RFGA 1TZ9A 2YJQA 3PPFA 1Q5MA 2O9TA 1I2RA 3O6CA 4WDTA 2X30A 4S2CA 1Z42A 5F7UA 3MI6A 3CHFA 1NU5A 3URNA 1EP2A 4CN4A 3A13A 4C7DA 2NXGA 3O8AA 3ZWSA 1GNXA 1Y5WA 2ZOXA 1UIPA 2DT1A 3PBWA 1XL9A 3LCLA 1HW6A 4NZ3A 3DHPA 1JDFA 3PB0A 3R13A 3VDBA 1IE7C 1H49A 3UVIA 2DH3A 5DMLA 2GQAA 1ZP3A 3S2LA 3WD1A 4O52A 3GTXA 5C71A 4G9PA 2PTZA 1CB7B 4QJ4B 4AZIA 5BOOA 2XWDA 4QISA 1CGXA 2R1LA 1VFMA 3TIMA 1IT8A 2XN1A 4HPGA 3IAQA 1Q2SA 1W3HA 2RGMA 3GZAA 2O9RA 3LHWA 5EA9A 4ZTXA 3STPA 3ALFA 5H91A 3GS6A 3BLOA 3LPGA 4NUWA 3G5EA 1MWOA 1A5OC 3UYIA 4TX9A 1YLVA 4TQTA 4UFJA 1EKOA 1R8LA 2E7FA 4W7VA 5CG0A 5KITA 1XLEA 3PZ9A 5C7VA 1X96A 8RUCA 2I9EA 1GW9A 3QRHA 1R2RA 1XPYA 3LQLA 2FJKA 4E2DA 1KW1A 4LXFA 4Y96A 3AYVA 3AXIA 4JQ1A 4FMVA 3VIJA 2TYSA 1W56A 3GYEA 3KW3A 5B80A 7REQB 3MSYA 3N15A 5HJXA 1EEPA 3H55A 3B8VA 2OLSA 4ZXOA 4DNHA 3SM0A 4IIGA 2WMHA 5AYIA 4HNUA 5FSDC 4FX7A 5LXEA 4IICA 4GK8A 2QDHA 1O4UA 1PDYA 1OYAA 1E5NA 3FEMA 2FVKA 3N12A 5CAKA 2PCQA 4MJMA 1VYRA 3QVQA 4FNRA 1XYMA 4CEXC 4EXAA 3GH7A 3T09A 5I3GA 3UR8A 4ZO8A 5BMXA 3LTSA 1W1IE 3E2RA 1KTCA 2X09A 4MHBA 4M7TA 3MUXA 3M41A 1ZU8A 1RA0A 1JF5A 1VIZA 3W73A 1FP8A 1CBGA 1JPMA 2PWDA 3SUVA 2WJDA 1KR0A 4IIEA 4H6EA 4C1NA 1JNDA 3W88A 1KCZA 3CTTA 3WMSA 1J5SA 3HGRA 2E25A 4HMDA 4RL3A 2YB4A 1L2UA 5CGTA 2GUYA 3FK4A 3L4VA 1F5ZA 3ZLFA 2F2KA 1GEQA 1W0MA 2UY4A 1PS9A 1Y0EA 4AG0A 2HZGA 3UG4A 2YDSA 1MZRA 3THAA 2XZ7A 3S2CA 1HKVA 1A0EA 4P8WA 1MEWA 1HKKA 5HNTA 3TTYA 1EBGA 4GFSA 2VD9A 1UD3A 5XIAA 3ZR6A 2VZOA 1OFRA 3JZEA 2HVOA 2EGZA 4IJBA 3PVFA 2L5HA 4Z1YA 2HK0A 2VZSA 3O1NA 1PB0A 1XBYA 4GQQA 1FP9A 1POJA 5M17A 5FAJA 1UBPC 2Y89A 3ZJ7A 4DZHA 2V6AA 3RO8A 2WMIB 1OD8A 1QI3A 1CW2A 2G37A 3QMSA 4QS5A 4V28A 4JFSA 3G18A 4DLFA 2ONEA 4GD0A 3QV9A 1V6VA 1Y7VA 4S3DA 3OVPA 3W87A 3GVQA 5A2CA 5D9PA 2V3DA 4Q4QA 1K6WA 2OZ3A 3QGKC 1P0BA 1X7IA 2XG9A 3C2OA 4L6OA 1VBJA 3VOHA 3S46A 4FXRA 4DQWA 4GC4A 3LXBA 3PBUA 5I3IA 3P2VA 2C8NA 4ZEPA 1VF8A 3GXPA 1KRAC 4K8GA 1W54A 1YPFA 4FA3A 1C8QA 1ICPA 3OYZA 4N9DA 4PE8A 4E38A 4PRTA 1XIDA 1LL4A 3WLSA 2XIMA 1L6WA 1TREA 3W7NA 1IZJA 4IM4A 3TW6A 4CU7A 3H2MA 3IJLA 2PLMA 4AWSA 3NEHA 1QRQA 4JDBA 2CFFA 4AD5A 1NDVA 2ZVIA 1YDYA 5I79A 3EA3A 5JIWA 3CAQA 3KE0A 3I3BA 5LA1A 4GC3A 1G4SA 2DVTA 1C93A 1XIMA 2DZWA 4K8EA 4DJFA 3GUWA 4CLMA 3V5CA 1ME8A 4S38A 5LNVA 2UWFA 3KRZA 1C9WA 4CD5A 2VRQA 4MWAA 4YYCA 4HB7A 2E9MA 1JIBA 3IAPA 2ZUMA 1P4CA 1K8YA 2D20A 1QI4A 1ADSA 4A8RA 4KWVA 4L9XA 1NH6A 2BV9A 3CK5A 3IUDA 2CYGA 1M5WA 3CV6A 2VOTA 3E2QA 3RYSA 1TYGA 2OO6A 4MKSA 4D8LA 3WLNA 3FXYA 3TJLA 3VNDA 2VC6A 2OWWA 1G5AA 2QXWA 4DJDC 4WGXA 1WXZA 4HKPA 4AZHA 2CBJA 2W91A 4RDVA 3RJXA 5LSMA 2X41A 4R88A 1DPMA 2QT3A 4ZFMA 2HTMA 2W9MA 3B8WA 1KM2A 4US5D 3EDEA 1B4KA 4QBXA 3VGBA 1ZAHA 2DEPA 5BU9A 4O1FA 5D2XA 1UOKA 1YPIA 4H9MA 3CIWA 3KOYA 2IPGA 4FOKA 5FI8A 3S5NA 1RD6A 3FHQA 4UMCA 1RPXA 4X9YA 4EKJA 1DTUA 4JNYA 2C79A 4L65A 3NQCA 1UQZA 1XIBA 4UTUA 3R1ZA 3DFOA 4I5RA 1EJRC 2GQ3A 1F05A 3DYPA 3GW0A 3T0CA 4M56A 1A5AA 3TKFA 2NXHA 1CGVA 3VI2A 3LM3A 2W66A 2XH2A 5HWNA 4WR3A 2JFEX 4IF2A 3VKKA 3GAYA 1NFPA 1HL9A 1CLKA 1CXLA 3L5LA 2CEQA 4TX6A 1I2PA 2WKLA 3NPXA 3W37A 1ICQA 1OF8A 4PCFA 1P6WA 4CKQA 4ADTA 3HJEA 4J9JA 1XYFA 4J3VA 1KGUA 3RCNA 4NZ1A 2A3BA 3B9AA 2C7FA 4KWWA 2E8ZA 3T78A 2NV1A 4J3XA 4R7JA 3FX4A 3TNOA 1XLHA 3WLMA 2BSLA 2VFDA 1L6SA 4JQ3A 3N4EA 1GOQA 3C0QA 3AMGA 1YTDA 4PTXA 3T0TA 3WDQA 5AZ1A 3LSCA 5K4XA 2R1PA 1XLMA 4W5ZA 3BSHA 3BSMA 3HFYA 3MY9A 2C19A 3P61A 4ICNA 3L4ZA 1RBLA 2QVHA 2VRJA 4W5UA 2CLOA 4GVFA 3W00A 3BARA 3T44A 2C16A 1Q3NA 3P3BA 4JTFA 2V5CA 2PMQA 3S1UA 4XZIA 4DM1A 5FJUA 4PC8A 4JQ2A 4RKAA 1FFRA 4MAVA 4A3HA 3NZRA 2E5CA 1GVEA 4WKHA 4P7NA 1KBJA 1N8IA 4S3JA 3SCUA 1X1ZA 7A3HA 1BKSA 1NWTA 3BW3A 4Z2JA 5EY5A 4N9CA 3W2LA 5JVLA 1ISZA 4K36A 4O50A 4QFUA 4W86A 4RNHA 4AHOA 2QJGA 3SSZA 2YYTA 1R3TA 1UKSA 3PTMA 2DSWA 3RX4A 1A3WA 2WVUA 3O3RA 5CEWA 3MDWA 1WBJA 4OGZA 4FS9A 4YIWA 3W7GA 3E2SA 4Y9MA 4IFKA 3ZSSA 1TVPA 1I0DA 4XSLA 4EAYA 3QJAA 3D0CA 5MKGA 2FZ8A 3QFEA 2PDCA 4MZ1A 4Z2IA 1W3JA 1XSIA 1XC4A 2QCGA 3D47A 4JTCA 1DTNA 3SCTA 1HXJA 4PUNA 5E6YA 2VC9A 3SRFA 3PHAA 1IV8A 4N02A 2UY5A 4Y9AA 3ZJ6A 4H04A 3LHTA 1RALA 1DJHA 2FQIA 4TUFA 5H2ZA 3WL0A 4XX6A 2ACRA 3F1QA 4GGBA 4WEVX 5XINA 3EWZA 2YCKX 3U2CA 4F0KA 3QY8A 1A50A 4N9BA 1ME9A 3MT1A 3T0BA 2C0AA 3UERA 1Z6KA 5CPSA 3MSRA 3BVJA 5U4NA 3GNDA 4Z42C 1J8VA 3OBKA 1S2WA 4GUGA 1LWJA 2Y8VA 2Z2UA 1EJ7L 2VX4A 1VBRA 1W1YA 2VZTA 4MG4A 1XICA 2C3ZA 1IWPA 2WWDA 5GNXA 2XVNA 3NNTA 5I3KA 4U2YA 2DW6A 3E5BA 1L9WA 1DP0A 1W9BM 2CETA 4MFDA 2J66A 5D33A 4LS0A 1G0CA 2FDMA 1D9EA 4HK5A 4ZTYA 2DQWA 1Z3NA 4QROA 5CAHA 1WUFA 4HZ7A 3IGUA 2XISA 2Z24A 3IVUA 4PMNA 1XX1A 3TE9A 5AB3A 4YTTA 5CXPA 3CHVA 3P8IA 2CKSA 4AEOA 3PPGA 1PKYA 5A95A 4A6GA 5T9CE 1CXKA 1WAWA 2VDHA 2WXDM 3GR4A 4KGJA 3EYPA 3V4BA 5DT7A 1JRBA 4FR1A 4JPGA 1UR3M 2E9LA 1IXOA 2E67A 5FACA 3H21A 2XH7A 3JZUA 2WZTA 3EOEA 4H00A 4XBJA 4P5UA 3MYPA 7XIMA 3LRLA 1GYLA 1JCYA 3WLKX 5ABTA 2D2HA 1E6PA 3DFYA 4PMOA 3S0CA 1A0DA 1RXOB 2JBMA 2D0GA 2OLAA 1XBVA 3V35A 2PRLA 1RVGA 3N29A 4GUJA 3AYRA 1SW3A 1WB0A 1UJQA 2QZRA 4U5KA 2W79A 3W75A 4RPQA 3ARUA 1WPCA 2BGSA 3RXZA 3VZXA 1TJ2A 1J79A 4ZOCA 1FWNA 4JOMA 4Y6GA 1WCGA 1J5TA 3C0LA 5GNYA 4FNPA 3AO0A 6ENLA 1TO3A 4H7VA 1XLDA 4DJDA 3W85A 4L64A 4QDWA 4DX3A 3VILA 8XIAA 3KRUA 4OHQA 3HBLA 1GVRA 1DJZA 3HM7A 1GVYA 3DKJA 1X6UA 3G1DA 1CCWB 4JBRA 4JZ5A 3GNPA 3PANA 1NP2A 4HPNA 4UNLA 4CQDA 5CC6A 3UJ2A 3MTWA 4W7WA 6TAAA 4F48A 1XIFA 4D6EA 4OT7A 1CI1A 1V03A 2CXGA 4J2PA 5C2CA 2V38A 2WCGA 4QG9A 3VFCA 1B3VA 2NVCA 4LAKA 2FTWA 1XYAA 4ZQPA 1OC6A 3QLDA 4PGLA 2G8ZA 1FWBC 1ONXA 4WY0B 3WQWA 3EMZA 3UXKA 3DH7A 2H9AA 3VZYA 2RH9A 4CNUA 4BA0A 1NDYA 4PCNA 1R85A 1TTPA 3GFZA 3EB2A 6TIMA 4AYGA 3KTSA 2V67A 3S1XA 3OB8A 4QR6A 3DFNA 3RNDA 4AIEA 1QNSA 5A8MA 2QCFA 1C7SA 4MNKA 3I68A 3PZIA 3TYAA 1TV4A 4WOQA 2Z1KA 3EWWA 1M68A 3GKAA 3OVRA 4CD4A 2XFWA 3WEMA 1TVNA 3WLPA 2YW3A 3ES7A 1K9TA 3PAOA 3BG9A 2VC7A 5C2XA 4PSPA 1XIHA 4HCDA 2GJPA 5BXTA 1KTBA 2OB3A 3KBVA 3T81A 3N2CA 2YGYA 3VKCA 4DWSB 2PWVA 1AD1A 1Z48A 1EPXA 2GDQA 3EWUA 4S3FA 4XD6A 1KXHA 3W0KA 2ZZ1A 1SQ7A 3K46A 3LI1A 2QUUA 4LTSA 3NSXA 4RV3A 4HA1A 1EHAA 3RLHA 3G22A 1V6TA 3AZSA 1Y8BA 2W61A 3A5FA 1BFNA 2ZCGA 1JQVA 3EPOA 3UWEA 3CJPA 2QMKA 4LC8A 4LEQA 1FWAC 1Y5XA 4ADSA 1FWWA 3UVAA 2B7NA 1HT6A 3VNLA 4CU8A 3VOFA 5D9MA 2PDWA 1DE5A 1VFHA 1QU4A 1R3WA 4MDOA 1LL7A 3PZTA 1ZENA 1WUEA 2QVNA 4Q4RA 5AVHA 1XH0A 2FMOA 3TROA 3ITGA 2BY2A 1I6NA 4Q33A 3SCNA 3NQFA 4L1GA 3A4WA 1Q6DA 3GYCA 2YL6A 4BQ5A 5I06A 1KM5A 4Y8EA 4UXDA 5BW6A 3MUIA 4PUDA 4MMWA 3W4RA 3NUKA 2D3LA 3O2LA 1QOQA 3JU2A 4JCMA 1TJPA 5IFPA 3H2FA 1RK5A 4WSKA 3WLRA 4FO4A 3EPNA 2ZE0A 1WX0A 5ABEA 3GG1A 3B4YA 2VX7A 4QQUA 4KS0A 2XN2A 3DC0A 4H8HA 4LCSA 3LYEA 1SJDA 4AQLA 1GUVA 4I90A 1H1ZA 3OYXA 1OFQA 3C4UA 3R89A 1Q66A 4OUEA 5FA5A 4C6FA 3DC8A 1R86A 3KS5A 1K77A 4TOQA 2PDXA 4I9TA 3ABSA 5HNNA 1TJ0A 2D0HA 4N9EA 1M9HA 2GK1B 3KDOA 2ESCA 3E38A 1YBQA 2A3CA 1DQXA 1TZZA 3VNJA 1LWIA 4LAOA 4OOUA 1JZ5A 3GUGA 1F76A 3NGJA 1QNQA 2XSAA 5CZTA 1JZ8A 4O0KA 1US0A 4EANA 3AIVA 4G8TA 4W7UA 2G3JA 1JCJA 3P0XA 1DXEA 5K9CA 2Y62A 1S38A 3GVWA 3DGBA 3SQLA 4GMEA 3V75A 5G5IA 1DXFA 4MZ8A 4QEHA 4IP4A 1QOPA 4RUBA 4LUSB 4LYRA 2XN0A 5AOUA 2X0HA 2DSUA 1JR1A 1S1RA 5CJMA 1EO5A 3RPTA 1F4HA 3SRKA 2AAAA 3DFTA 5DBTA 3BDKA 3GXIA 2Y8UA 3STCA 2HJPA 4Z2GA 4P7OA 1C8VA 3S6DA 5A69A 3V1HA 3C2RA 1XINA 4L9ZA 4FLOA 5J5DA 5CPNA 2WJZA 3QMRA 4DYKA 3EMCA 3SUUA 4K7YA 1OZQA 4REQA 5D2WA 1MEHA 3WBWA 3GDLA 3TWBA 1NY1A 2GDVA 3OA5A 3B06A 3CHCA 1ZALA 2ATSA 4LVDA 4KEMA 1I2QA 4K7VA 3CU2A 1WOBA 3KEHA 3GXTA 5K9XA 1YRRA 4GQRA 3E0WA 1K6AA 3E02A 2CC0A 4GI6A 2NUWA 2J75A 4JCLA 1UZ4A 4A21A 3G1HA 1WNOA 2DSKA 1FWRA 4OOZA 1VFSA 3GSMA 1CYGA 4ATWA 4B5TA 2H3BA 4WUIA 2DUZA 3M0JA 1UG6A 1ZNNA 2J88A 4EPKA 4JYEA 3LXCA 2RHGA 1TVLA 3IARA 5H6HA 2DSZA 1BSIA 2J25A 5A94A 4F2UA 5AC8A 5KEZA 1KXQA 3B9OA 3AWOA 3GR8A 4PEEA 1XIIA 4E3TA 3PF3A 2FYMA 1FWCC 3TSMA 4GKLA 3H12A 3GFYA 4UR8A 5LNWA 1REQB 3SUTA 4GCAA 3STGA 3IIVA 3QR0A 2Z2BA 4JTEA 2QEZA 4KFNA 1KTNA 5T26A 4PUKA 1TV8A 3KX6A 1OBAA 3AHZA 1XH1A 4QLLA 3G1YA 4MPKA 3TK7A 2WMFA 1C92A 1JNEA 2NV9A 1GJUA 3HOJA 1TQJA 2CLPA 2WJFA 1VFUA 1GEHA 3H7UA 3W83A 1EL3A 3UNTA 1S5NA 2DVUA 1PTAA 1UHVA 2GVYA 1XJBA 2C15A 4XKYA 1TRIA 1YDNA 5HWJA 3CEUA 3T40A 1FX6A 1EXBA 3OGSA 4MLRA 4Y8FA 4H6RA 2BVTA 3AWNA 4K37A 3VM7A 3U2OA 3FNDA 2CLLA 2R8WA 3UZWA 1T99A 3TTOA 3NEVA 4ACYA 2O9PA 3CL8A 3A21A 1PIIA 1HKIA 1KBBA 4L6DA 3AS3A 3EWDA 3NL5A 2TRSA 1UKPA 3F4VA 1E1CB 4UFKA 4C6OA 1JL8A 3W7JA 2NSXA 1CWYA 4UZSA 5A6JA 1CT5A 1V08A 3MMWA 3VD7A 4LBRA 1EZWA 1OABA 4AMCA 3VOCA 4OUIA 2PF0A 2BGQA 1GOXA 1ZY9A 5M2FX 4MWAE 5I02A 3DAQA 1J0ZA 3EXSA 1UZHA 3AS2A 3QPYA 2G3NA 4DEFA 2NV2A 4LX4A 3WQ5A 1SYTA 1US3A 1X8CA 5I3FA 1BAGA 2Y2WA 4RLIA 3AQUA 1JYNA 2Z1BA 4H8UA 4GXMA 4KRUA 2OWXA 3VNYA 3C3UA 4BI5A 3NM1A 2ZADA 2ZXDA 3APTA 2GQ8A 4Z2HA 3N25A 2F84A 3BLDA 4L5ZA 4LSBA 3V5FA 1B0IA 1H60A 1A80A 4Q8TA 3B03A 1D2KA 3A22A 3CUZA 1H7OA 3QY6A 3KBMA 2OZ0A 4KFOA 2BOGX 3BJFA 1TX0A 5EPDA 1TCDA 1EHNA 3URAA 2VD8A 1UP2A 4L7ZA 2FPTA 4UCFA 3GU9A 1L6GA 3EOOA 5C55A 2X0SA 4DIAA 4XTDA 1GGOA 2TAAA 4GFIA 3LBOA 1RY0A 1BXNA 2GWGA 4A2RA 4BEQA 2ZX7A 1I2OA 1XW8A 2QJJA 5CJNA 1LL6A 4IPPA 1AZ2A 3BWWA 1CGUA 1N2VA 4MADA 1UR4A 2JQXA 3R0KA 1YNPA 4QJ5B 3URQA 3FYOA 1DXIA 4DO4A 1XKJA 2BOFX 2CHOA 2EPKX 2PLJA 2HSAA 5GJNA 4O15A 1ZBCA 4IH3A 1NVMA 3WEOA 4AVOA 3OQEA 4E4FA 1POKA 1SR9A 4R27A 3CV2A 4H6QA 1F61A 2DW7A 2QCDB 2X40A 3WJXA 1UUQA 3AZRA 1G4TA 3L5MA 5CPLA 1E6RA 4FSAA 1W17A 3WK2A 3M64A 3U7VA 4XKMA 1WXJA 1SUXA 4D6HA 1GONA 4ZE5A 2C1IA 4WKFA 5CBBA 2FGLA 4DWSA 1BPLB 2HE8A 1F3XA 2OT0A 3U3HA 4Q8OA 5C8BB 4CD7A 2QJNA 5EL1A 1AL7A 1PYMA 1B2YA 1HQTA 2YL8A 4PTVA 1YDVA 2INEA 1ZFJA 3BG5A 4HA0A 2HDJA 3U4AA 5DMYA 1LYXA 1H7PA 3MO4A 4YVVA 1IZCA 4RV8A 3TYEA 4B15A 1QATA 3AIWA 1CGTA 3UWZA 4UWMA 3EDDA 4LAMA 1GZGA 4JTAA 4B2DD 3GDBA 1GTHA 1A5UA 4I7UA 1VJIA 1P43A 2WB5A 3ARXA 3TZNA 1IIHA 2WLYA 3W7LA 2FH6A 3CL7A 5HXMA 4HSNA 4UTWA 3CO8A 8XIMA 1HGWA 2CZ5A 2DH2A 3S47A 1XR2A 3CUIA 2FB2A 3SQSA 4W85A 4E2OA 1NWRA 1GCYA 3CUHA 4GUHA 4ICCX 1EIBA 1NTHA 2YA2A 3LBMA 3ZS4A 1EIXA 2WC7A 4RZ5A 3KTXA 4PMUA 1MUCA 2NQ5A 1Q6CA 4HOXA 3KLKA 4MGGA 2VFEA 4EXQA 4RE2A 3NQMA 2AQOA 4R7WA 2ACUA 2IMRA 2J8FA 1XCXA 4DYEA 1P1XA 1ML1A 2G96A 4GX9A 1JFXA 2GDUA 3ISIX 3POHA 2SFPA 1HFBA 4O14A 3S8HA 4ES4A 3RCMA 3IJIA 1QHPA 2HRWA 3W9ZA 1DYSA 4AW7A 2WHKA 1QK0A 5K9DA 1M41A 3IGHX 1T8XA 3L2IA 3LXAA 2X05A 1SSDA 1C3FA 3PJTA 3RR4A 9CGTA 1V77A 5BXRA 3OLDA 4GO8A 3IRDA 4HCLA 2PU0A 5A6AA 3N6JA 3VNZA 4MFEA 1BLIA 1PBGA 1KFBA 3UCDA 3WF1A 1EWDA 1EBHA 2REQA 3RO6A 2PWUA 3IIOA 4M82A 1ZSXA 4R9OA 5JBDA 3WJWA 3S42A 3PBVA 4H7CA 1DBTA 3M6YA 4KWUA 1XF0A 5FF4A 1H1NA 4X9SA 3C8FA 3L4YA 2GGJA 4NZ5A 5AHIA 1W9DM 4J3ZA 3SBFA 1WDWA 3U5YA 3VGDA 1MDLA 1QPNA 2OEKA 4F0HA 3HIJA 1KFKA 4AB4A 1WBHA 5E1QA 4Q4KA 1O1HA 1P1MA 2OO0A 3AJ7A 1I1XA 4QE4A 1FHUA 4RDYA 1XQLA 3MPGA 1LM1A 2VZUA 2O56A 3KCLA 4LS1A 4OTKA 1YTKA 1XYCA 3LEPA 5E9AA 2R9RA 2XPKA 5EMJA 2VEKA 5AHMA 3GE7A 4B3KA 3SJ3A 2JE8A 4KQNA 3CZGA 3OZOA 2J7FA 3S4TA 4XWUA 3CNYA 4C65A 1S2TA 4PEKA 4BCEA 3MSDA 3VE9A 2GVLA 3WDIA 2A7NA 3W1AA 1KFWA 1KKOA 3K8KA 4S2BA 1HTIA 1MRAA 1TQXA 3S1VA 2ACQA 4MUZA 1R30A 3WMBA 3PC0A 4GRSA 1NIUA 4AD1A 2F38A 1WDPA 4JX6A 3A6OA 2I56A 4Q7IA 1JZ2A 2PTXA 3VM5A 4HPHA 1M6JA 3U48A 3GH4A 2ZZ3A 4DHGA 4HU3A 1H7WA 1O5XA 2HEJA 2OEMA 3H4GA 4NNAA 2Y70A 3CIVA 4XZLX 1A5KC 1R87A 3WQPA 1QWGA 3IGXA 3HQNA 1IF2A 2G3FA 3M5XA 3S9ZA 2NX3A 4FI4A 1JPHA 4LUJA 2QF8A 3PZUA 2OJPA 3OTRA 3QGVA 4F9JA 4TO8A 3R11A 4GJIA 1V0NA 3ANVA 5PTDA 4FR6A 4TVUA 1OWQA 3AFBA 1TX2A 1OIMA 4RXFA 4XD5A 3C2VA 3FSUA 1KLZA 3ABOA 3AC0A 4GYKA 4PFHA 3FXGA 2ANUA 2DY3A 1O5RA 5FEWA 3WJYA 1XDLA 3C6CA 2PU1A 3AMCA 1U22A 3B9EA 3IJDA 4XBSA 4U33A 5AYYA 4PUUA 5E93A 4GINA 4D72A 3B8UA 5FKYA 2WOQA 4NKCA 5DT5A 2AMXA 4JKKA 2CNCA 5CG7A 4PCPA 1FKWA 1KFCA 4WJ8A 5REQB 2WNNA 4CCCA 1FY6A 4W9TA 2W5FA 4GQGA 1I75A 3LB0A 2WHLA 3VNIA 4M29A 1IHIA 3SIMA 4N7QA 4AZCB 1Q4WA 2VUNA 2C18A 1ZQ5A 2BHUA 3CBWA 4IMDA 2PZNA 2YLAA 4JFTA 3VIGA 2PDQA 4DUVA 4L9YA 1P5BA 2X2GA 4D8AA 1HVXA 3HV9A 2PB1A 1QCWA 4O0QA 3ZZ1A 4EP8C 2PP0A 1A5MC 4PFMA 5A6SA 5A8PA 4MF4A 3VIOA 1EZ2A 2EQDA 4EXBA 1US2A 2VKZG 3CYJA 1VC4A 4QLKA 1G69A 3GVRA 3UZZA 3OIHA 4XIMA 3VNKA 3KBSA 2F6KA 5EBUA 3RX3A 4HPXA 3ONBA 5C9XA 1VFOA 2X1RA 3PUGA 3B40A 4QNWA 4TVCA 1KV5A 1UD6A 4QEEA 4UIOA 1GKPA 4OBRA 1UC4A 3WENA 2W63A 4GNKB 4MTVA 2P53A 1BXBA 2VFFA 3SDOA 4XO7A 3L67A 3PTDA 1UWUA 4XTIA 1XGZA 4ZO9A 2UV8G 4NNBA 1AQ0A 1B3ZA 4PMDA 2BY3A 5F4XA 1U1JA 1UZ1A 5HQEA 5ABFB 2HV5A 4NQ1A 1PTGA 3GO2A 4GY7A 5EB8A 1DEDA 1R9XA 1A4LA 2IXVA 4HSOA 1MXSA 3S2NA 1CENA 1OHLA 4R3UA 3P74A 2DZBA 1QOXA 3V0TA 2PTDA 3THQA 4K8HA 4ORIA 4GVHA 3QY7A 3DECA 3G1SA 4KWSA 1EGZA 3HG3A 1OZMA 3FDKA 1SZFA 3EA2A 4D2JA 4GBUA 6A3HA 2PGWA 3QEZA 2B7QA 2PWFA 3P0WA 5A6BA 1JPKA 1XSJA 2A3HA 4GE8A 4NT0A 3WD2A 3N4FA 3NFUA 4ZOAA 3M7SA 1WKDA 2VFHA 5CZJA 4D6FA 4HNNA 1B3YA 1H41A 3AIEA 3RDKA 4HZ6A 5ABGA 3A5VA 1SZRA 1HJVA 2H6RA 4GISA 3VC5A 2DUXA 4XZNX 1RZMA 1KKRA 1M65A 2RDTA 1EJUC 3LSBA 3FA4A 2VEPA 4NP7A 3ZOAA 4GUFA 2WC4A 2ZXBA 2G0WA 3S1WA 4Q4PA 3GHTA 2EXOA 4GYPC 2CKRA 4HMEA 1B30A 3GNNA 4Q8WA 1TTIA 3TTSA 3SGUA 4Z1BA 1OFOA 1ZS2A 3MHUA 4Q3MA 1E5JA 2J9ZA 3TN5A 3NYZA 3LENA 3H4WA 3IJQA 1FQ0A 4M1RA 2E6YA 3MA8A 4ZGYA 5B7YA 1RQBA 4CNOA 5BMWA 4H8VA 3PNZA 4A8LA 2BXZA 1GQKA 2KAUC 7ODCA 2OOGA 3KS6A 5G1YA 3CZ8A 4UTLA 1EJXC 1VQTA 1XD0A 4KT2A 1HZYA 3ZT6A 4YCPA 4ERIA 1IXNA 3WYZA 2FB3A 1XLLA 3GU2A 5D37A 1OC7A 5A5WA 4UTHA 2VM8A 3CHEA 3IUHA 4GZEA 1I0BA 1AW1A 1WZKA 2CWXA 5ECVA 4H2CA 2TSYA 1CGWA 4JQ4A 3GXFA 5DRIA 3LD5A 3WUFA 4F0MA 1PWMA 2QPXA 4U5IA 3WF2A 2VCAA 3ZJKA 2ZX5A 1E6NA 3DI1A 3W7DA 1JI1A 1J10A 3LLFA 3HG4A 4IG2A 5IHRA 4O57A 2ISVA 5GJPA 3WUEA 2OPJA 3UESA 1H4PA 1Y65A 3ID7A 1GOWA 1JUKA 2FDSA 2ZRXA 1PYFA 1EJVC 3AIRA 3P93A 3I65A 2NSOA 5EGRA 4K6AA 1G6CA 1F6KA 4X22A 4IFRA 1PIGA 4AZ6A 3BC9A 2VX5A 4HK7A 2BBFA 5EMYA 2WMKA 1Q63A 4O8AA 1PE1A 2FVMA 4NAEA 1KV8A 4O10A 3TW7A 2WVSA 2Z4GA 1S39A 3W1TA 1MEIA 2Z6IA 3F5KA 3T08A 5G2WA 4LT9A 2R24A 3UEQA 4X0VA 3SRDA 4MJ4A 2AGTA 3VDCA 1GPWA 2JKPA 4R5EA 2J7BA 4XVDA 2VEIA 4JKMA 6XIMA 5TNVA 5KZMA 2WK2A 3WDHA 1SO4A 3CIXA 2F6XA 3GC5A 4QX4A 1QPQA 3GRIA 2Y5EA 3DBPA 3BMVA 4ASTA 4UFHA 1TFVA 2BXYA 4QJ3B 4QLJA 2V5JA 3EOUA 3NPVA 1O94A 1OIFA 1E0UA 3KOWA 1GVOA 4I6VA 4BZYA 3EWXA 1GQNA 1W6TA 3F2CA 3OPSA 5FF7A 2CIPA 1KBKA 1U33A 2QPSA 2FGZA 4BKNA 4TVDA 1JF6A 1IXPA 3W2UA 2X16A 3PUOA 3WG6A 3WLTA 3WL1A 2GWNA 4KIEA 4EACA 1V7YA 3G3DA 2O0TA 2NQHA 4GVGA 2C1HA 5FEZA 4Z0SA 3TQ0A 2AQVA 4AF0A 1PZ3A 4AIUA 4NJKA 1E4IA 3TONA 5I03A 1I8JA 4R53A 1OK4A 3UA3A 4LF2A 3UPWA 2E68A 4TXEA 2Z28A 3FJLA 3W02A 2F2HA 1CTNA 1U1UA 4JIIX 4MKNA 3W1PA 3PY2A 3G1VA 2PC4A 3E6EA 4QE5A 4M24A 2PGRA 2OMAA 3T05A 1Q7QA 3ZFHA 1GVFA 2YIHA 1PDZA 3PPCA 3ONCA 4H01A 3ATZA 3W1QA 6REQA 3N13A 1VD6A 5HMFA 2WVVA 4FOJA 1T96A 5DANA 2Y7GA 3W86A 2PDHA 3BLLA 5U7SA 3WQDA 1D8CA 1VKFA 2YCLA 3BAXA 3JR2A 3OO2A 1TA3B 3GIYA 1LBMA 1G4EA 3RJYA 2C0HA 1W9UA 2DT3A 3ZSTA 3A3HA 4Q4SA 4AZGA 3S5YA 1B31A 4RZBA 5T9BG 2CXEA 2WM0A 3NZPA 4WXZA 3OHIA 4KCWA 4IQDA 4L1XA 4S3KA 1K4HA 2CHNA 4GO9A 2DPEA 5DELA 4XAGA 2DZVA 4PMXA 4H9YA 3GDTA 4YWSA 4A22A 1ZZMA 3AHVA 3DUGA 1MQPA 5ABHA 4P8XA 1RD5A 1ZRQA 3ITOA 1QPKA 1EJSC 1UC5A 1PPIA 5I78A 5CSSA 1V93A 2W67A 4AY7A 4ZXLA 1Z32X 2ZXAA 4HSHA 4F40A 5REQA 1X39A 4UNKA 3B0PA 1NWSA 2RDUA 3GKFA 4GH3A 3IJ9A 4WK9A 3MVTA 1JCLA 3K8LA 3UETA 2CBVA 3HQPA 3WFAA 1HIZA 4G1NA 2Q6ZA 2BODX 1X98A 1JCXA 1SO5A 3WUBA 2XVPA 3F4CA 2XH4A 1XLBA 3PFRA 8A3HA 1RJRA 2ALRA 2DJLA 2GFTA 4MJZA 4P61A 4CQBA 5BZAA 1O7AA 2PD9A 4QTGA 4NX0A 3XIMA 1UR1A 2DV0A 3MP4A 1K7EA 4ZODA 4XV0A 1P48A 3SCOA 1QNPA 5AN7A 3UG5A 1R9ZA 3NQAA 1PSCA 3M0XA 3W1LA 2E0PA 1LOSA 1Q6OA 4AZBA 3CQ0A 3UCCA 3WF4A 3LQGA 3H2NA 1GOMA 3N2MA 4AHQA 1QO2A 2DZTA 3HJZA 3KM8A 1FVPA 3CT2A 1BF6A 1LOLA 2XFRA 3I10A 3KAOA 4RW5A 7TIMA 3V16A 3D3AA 4NNCA 1RCQA 3CB3A 3TDFA 1DOSA 5I3DA 4F2BA 1G1YA 4IPJA 4ZQNA 3RCYA 3ERPA 1JUEA 1M03A 2EAWA 1OCBA 3GB6A 3ZR5A 4ZB5A 1X38A 3RLVA 1BVZA 2AKMA 1NF0A 4ACZA 4M7SA 1M3UA 1E0WA 3CEPA 3NQVA 4BI6A 1GW1A 3ARWA 1E73M 4AYSA 4H9VA 1UUMA 3OHMB 2JGQA 4LUTB 4ZZ9A 3HA1A 4TMBA 1F8MA 3PBYA 2GGHA 1CX9A 1ESWA 4AVNA 4TX8A 3PWIA 3R25A 5IDIA 9RUBA 4MB1A 2YPIA 3NIYA 4IWWA 1U2YA 5JBEA 1A5LC 1JUBA 3KZSA 2X1SA 3TMLA 1EA0A 1Q13A 1WOAA 2OZ8A 1QDSA 4GY1A 2P0OA 2E9BA 4YMZA 1KCKA 2QGHA 4JFWA 4F66A 3LM7A 3R0DA 3WQOA 1OX4A 1SR0A 1DWAM 2DP3A 3E0FA 1O66A 2A85A 4C6CA 3N34A 4XZMX 1ITQA 4JY9A 3QH2A 1PKMA 1TTJA 2WBKA 3A4AA 4OVXA 3NPUA 3AYSA 4X61A 3P8JA 4MNJA 2BFGA 1W2PA 4O13A 4ONVA 4UC5A 2OT1A 1W1A1 2OG9A 3LHUA 2FPVA 4O1BA 3TLLA 3KL5A 1DIKA 3ALGA 1TPDA 4X3ZA 1BWLA 4UQAA 1EFZA 5A8QA 4L80A 1UCWA 3VNMA 4ZO7A 3MDUA 1J01A 5LGXA 4AY8A 3UWUA 4C6EA 2JKAA 2CZDA 1SU5A 4AAJA 1TWDA 1KM3A 3HURA 2I9UA 1V3HA 3MJMA 2GOKA 4DY1A 1Q8JA 4JYDA 1VLIA 3EB4A 5LGZA 3O0KA 3ZM8A 4C6LA 3I6TA 1P0NA 2DDXA 3I4EA 5IM51 1F9CA 4UFMA 3AMLA 4UQBA 4AU0A 3JVAA 5TBOA 3A4XA 4MWAB 1ODUA 1SFLA 3VIMA 4Z17A 5I77A 3TX9A 3KWXA 4LYQA 3BSGA 1U5VA 2G3MA 1B5TA 1S3TC 3SCQA 2X1IA 3CZKA 4IX0A 3QW4B 2ZBTA 1IYXA 5K7JA 1AMYA 2P1FA 3QF0A 1QMLA 1J0IA 1J6OA 1HJXA 3MWAA 2Z0IA 2OXNA 3UD6A 5D38A 5E9XA 1ZJAA 5CH9A 5C9RA 1KRBC 4FLRA 1ZLPA 2YA1A 3B8TA 2VEFA 3LTYA 4LY4A 4DXXA 1ITCA 1OVDA 5A6KA 2A7PA 2OZTA 1GKQA 3FJ4A 3M0HA 2VVNA 3RR1A 3M0ZA 4AZ5A 1PAMA 2Y7FA 4KRTA 2V8ZA 3H2OA 4B5UA 4BR1A 4JL2A 2G50A 5JU6A 3H2AA 4YTQA 5HPOA 2GSHA 1BVNP 3P5YA 3RM4A 1A47A 3TA9A 1PKNA 1XPGA 1JRCA 1EF2A 4JGDA 3UGRA 3VD5A 3F7JA 1XH2A 3LCFA 2VDIA 1DQUA 4FX8A 3LPOA 3EWCA 2OELA 3W1MA 4MVAA 1QI5A 2I17A 2CLMA 3AJXA 1P6CA 2Z26A 3MB9A 3QV6A 3TOPA 3A4JA 4U10A 1TIMA 3M9YA 2Q09A 6PTDA 2QKFA 1W2VA 1E3ZA 2ZZ4A 4O16A 3KRBA 3VU2A 4HN4A 1KRCC 1SW0A 3ARZA 2EBNA 2FMNA 1HF6A 3GNXA 5M3WA 1UH2A 3OEXA 1VFLA 3PZOA 3CH9A 4EPEC 1J9YA 1HNYA 3ARTA 4WJXA 1VP5A 3TXVA 3EXTA 3EWBX 2R14A 1ICSA 3SZ8A 2OKOA 5A8NA 1DIDA 3TTEA 2Z2AA 5I07A 1TPWA 1JDEA 2BVDA 1MZHA 4O28A 2HISA 3H8AA 3BUVA 3VX0A 1TV5A 2EPMX 2W4XA 1UR0A 4QCEA 2AL2B 1RVKA 1WV2A 1TWIA 3AOFA 3NSNA 3WD3A 4RXGA 2VX6A 2EKGA 4HBKA 1W1ZA 1C91A 3QKEA 2BS9A 2V82A 1XQKA 3UT0A 1K9FA 3W2MA 4FF5A 2OSYA 2C6QA 4LRSA 1AJ0A 4U3CA 4HJFA 3WK1A 5HA7A 2NQ9A 3AXHA 1Z89A 3CLMA 2CLEA 1HO1A 1PKLA 3BMXA 1QPRA 4IISA 4ZQMA 1E56A 5EFDA 4D6DA 3O06A 4GNVA 4KCVA 5MHBA 3TFXA 1KGXA 3TN4A 4JHMA 1BKHA 3U6WA 1ITUA 4N6EA 1SGJA 4F0LA 4JNZA 1IGSA 3LK6A 3UXIA 4M6PA 2EPLX 5M03A 3W7MA 1JQXA 3V18A 3GHRA 4LEFA 2ON3A 4LVFA 1JYVA 3UY8A 5F4WA 1OT2A 3NTYA 3OQ8A 1JD7A 2FTYA 4IQEA 3ZMRA 1WDQA 4EAMA 4WGHA 3B0XA 3SUWA 5KETA 2PPGA 4IFKB 5DEZA 3FAXA 4LH8A 3ZLGA 5MKGB 3A3WA 1E51A 1W32A 3GDMA 3WX7A 3W3OA 5D2TA 4L4OA 2OGYA 1V6XA 3II1A 1OFBA 3FDGA 5DCEA 3LERA 4AC1X 1W3LA 3T2OA 5LKYA 8CGTA 1RJPA 2GPTA 1XHGA 4KMQA 1W5MA 3LLDA 1GJPA 1FRBA 2WV8A 4OFCA 3ITXA 5TAOA 1TA3A 4LYKA 5IRPA 5C54A 4KH2A 3MMUA 3W1UA 1G7UA 1MXGA 1ZUAX 4DBUA 4UTFA 2FGBA 1M7XA 4OV4A 3UPBA 5LIXX 4A29A 4QSHA 1HX0A 1TPVA 3HQOA 4JN6A 3SAZA 3RFAA 1EF3A 3NQGA 5HQMA 3GVVA 1R7OA 4MIMA 2Y85A 3PTKA 5FJTA 1VFFA 4R7OA 1ME7A 4AVFA 3BZGA 3P82A 4NF7A 3QSTA 4FLQA 2J77A 4ZQOA 1GT8A 1H51A 2A21A 3MBDA 1UD2A 4J28A 1H11A 1WAUA 2IUZA 1V5XA 2A4AA 5BROA 2IXUA 1GOOA 2MANA 1H7RA 2ZA1A 3R43A 3QV8A 3NQ8A 1RCOB 4JTLA 1SFJA 5CGQA 3RILA 1XLJA 1M7JA 1XSKA 2XU2A 1AD4A 3W28A 3B04A 1H63A 3USBA 4C6BA 4DBEA 4IIDA 5F1VA 2WQDA 1C90A 3W70A 5DCBA 3V7PA 3GTIA 1S2UA 3K13A 3UG3A 5DLCA 1XKYA 1JI2A 1DKWA 4EPDC 1UH3A 1PZ2A 4KWOA 4GKTA 1SZNA 1OFDA 1KQYA 3VIPA 2PUZA 3M1ZA 3EEZA 5JMUA 2Q02A 1OCNA 1IZKA 3GH5A 1V7AA 1ALDA 3G6MA 5GNZA 5I5RA 1S5WA 4UTKA 3LV6A 2BX7A 4C5YA 2PDKA 2YDQA 1OYBA 1NJJA 5KZEA 3FYPA 3TNBA 4Z2LA 1KWGA 2V3EA 4JEJA 3GIQA 3GHSA 1E40A 2WLZA 1WDDA 5F2MA 3GTFA 5FJIA 1H09A 3USZA 3QTGA 3KL0A 4XUGA 6ALDA 1ZB5A 1OSEA 4LUTA 3R79A 4JTRA 1PUDA 2LLEA 4W8BA 5C5YA 3G8EA 3F5LA 3RM9A 1GQLA 1FWSA 2VURA 2E3ZA 2BTMA 4ECLA 3PB2A 2ZUWA 4KKXA 5K2ZA 3W22A 3HTWA 1TPC1 4KERA 4WD0A 4PUWA 4I9JA 2YCEA 1VYSX 1AQHA 4A8NA 2IPJA 2XGIA 1F7BA 4IPNB 1D7FA 3VCNA 1A5NC 1B57A 4KIRA 3ARPA 2ZRVA 3UWQA 1W1B1 2VGBA 2VO5A 1FCVA 2O7SA 3QZEA 4MB3A 1RK6A 2D0FA 3ZT7A 1QR7A 4NJIA 4FP1A 3DOPA 4HPJA 4X2RA 1ZL1A 2CPUA 2B4GA 4QG6A 2Z00A 1V0KA 1ZBWA 1VB9A 1B1YA 5AHFA 3UNDA 3LCIA 4UOZA 4E2BA 2PODA 1MVYA 3CXOA 4J2MA 2W3ZA 3A3XA 3WNNA 4MNLA 2H9AB 2X8RA 2VEMA 5A6MA 3M5YA 4H3DA 3O63A 3K5XA 4DWSD 2IQDA 4B5XA 3DFPA 4JTJA 3LU2A 3GY1A 3MUAA 4G7FA 3K4DA 1KXTA 1K9EA 4LUIA 4H9XA 4NZ4A 3WZ0E 3NVTA 2INFA 1WZMA 2C71A 3P80A 4ZSUA 4B5VA 4PRWA 2BVWA 3CGTA 2ZX9A 4D6IA 3R6IA 3OZPA 2BNJA 4GI9A 2P8BA 4LV4A 3L2LA 3UZJA 2BDQA 1KBIA 3RRAA 4JIRA 3MHGA 2EG6A 2QUVA 4RDWA 1GZJA 2VR2A 3RPMA 2OQHA 4NZCA 4M6UA 2AAMA 4LVBA 1D8WA 4B16A 4RNFA 3DN5A 4GNJA 3WD0A 4FIRA 4E8CA 3DFSA 3ABRA 1JDAA 4MY8A 2Q8XA 4WSJA 5LNSA 2CZEA 3QPZA 5AC7A 4ZENA 4YN5A 1H5YA 1DWJM 1PX3A 1I1WA 1KXVA 3WK3A 1HUVA 2GOUA 3LG3A 4C6NA 2E1WA 4ALDA 2QIWA 2F8QA 3LRKA 2XIIA 3FSTA 3M47A 5I00A 2J78A 1R2TA 5D32A 2PF8A 2OTDA 4GZ7A 4GBDA 4KCUA 3ZVHA 3TJIA 1E71M 1AUSL 1LT8A 1VZWA 1Q4NX 3OODA 1RAKA 2AQWA 2VMFA 2ISDA 3WLQA 3RMEA 2NQJA 1O60A 4KEVA 4KPLA 2OLHA 1NAL1 1LRQA 3PWAA 4PMJA 2NWSA 4ADUA 3WD4A 3ECQA 3TYCA 2CITA 1BYBA 2DZAA 3ARRA 3OP2A 1MW2A 4HJWA 1BHGA 1JZ3A 3MV01 3BL3A 3G3MA 1TB3A 4GVIA 4KCTA 4S3BA 1YE6A 3L7RA 3GQYA 4RCXA 1Q6RA 4UFLA 1N55A 3F2DA 4NJJA 4FEZA 3SURA 2DQXA 4B3LA 1TJ1A 4N4QA 1MRQA 4JY8A 2R91A 2XFFA 1YBQB 1FH7A 1BG4A 4Q8VA 2AL2A 5AHLA 3Q94A 3CTLA 1UR8A 1V0MA 3T0AA 4ATDA 1T5AA 3FEQA 4HHLA 3W2KA 3OA3A 4LBUA 3L2MA 2EPOA 3MI2A 2B31A 1JD9A 5I24A 4IQJA 4M51A 1S2CA 3CHDA 1RLDA 1DWIM 4PMQA 2VCBA 1JCMP 2HS6A 4HOZA 3APYA 3NQ2A 4ZO6A 4D1JA 1KB3A 3MO7A 1XG4A 3CPGA 1E6XM 3CM4A 1W5QA 3FVMA 2CLFA 2Y5JA 2UZ9A 3BTNA 4X60A 3UXDA 3CWNA 3BCJA 5EYWA 3TN6A 2WYSA 4H7ZA 3M07A 1H7NA 2VGFA 1QHOA 3EEGA 4WIWA 1CZ1A 4LWWA 5CZKA 1R6WA 4EF8A 4B3ZA 2WVTA 3TEVA 3CQJA 1RV8A 1IEXA 2RUSA 4I8DA 1H62A 3B8SA 1GVQA 3MYOA 3B0YA 3NL6A 4GIYA 4REQB 4QRNA 4LQ1A 1XV8A 3L21A 3QV7A 4AWEA 1S5VA 1TPEA 1NWUA 5A2BA 3ENLA 3TYZA 3S1GA 4LV9A 1EC8A 3HPSA 3C2FA 3TV8A 4U3AA 1J4EA 1QVBA 3H7VA 1JXKA 4CD8A 3CQIA 1CDGA 3FA5A 1YW1A 2WAGA 3LNMA 4EVZA 2VFGA 1QNVA 1F8IA 2DT0A 1PHWA 4C6MA 5EMUA 2YYUA 3GG8A 2O55A 2PE4A 4Q6JA 1VENA 4MZYA 1GYNA 2H8XA 2ZRWA 2WW5A 1H2JA 1YIXA 2QQ6A 4ZL1A 1M7OA 4DO5A 2FFIA 2OSXA 3HPZA 2I5GA 3LHYA 4HNVA 3BLFA 4JHZA 4J3SA 4K68A 3BH4A 3HGSA 3C0SA 2XVKA 3UQNA 3S3GA 4HYRA 4QAWA 1YNYA 3ITVA 4NRRA 5CZSA 3P67A 4CD6A 1EUAA 4BF7A 3GNRA 3HPXA 1CEOA 4IGNA 1GHSA 4AD4A 4BWLC 1Q45A 3JUGA 3V5OA 2Q71A 3CZEA 3PK7A 5A8OA 3SN4A 3UU0A 4FX6M 1FWFC 1LLZA 4PTDA 5BRBA 3EX6A 3TC3A 5A8GA 1LP6A 2E5BA 1PZ0A 5E09A 1PX4A 3TQPA 5A6LA 3XISA 4L4PA 1EOMA 1P7TA 4XKYB 4C5ZA 2OCZA 1AODA 3VE7A 2P50A 4GACA 4CQ9A 1AH3A 1J0YA 1UP3A 1E0VA 3KBWA 1R38A 2FFCA 2JF7A 4A35A 1UKTA 3PFMA 1ZBVA 2WMGA 3VMOA 3EPMA 3PAJA 2W0UA 1QNOA 1S2AA 4FB7A 4OWGA 1AA1B 2E6FA 4DBSA 3N6QA 3SSJA 4Q6XA 3TXZA 3P60A 3R8HA 1OY0A 1R3YA 2HBVA 3H26A 2ZUSA 2PDBA 2JGYA 3H24A 2XINA 2QR6A 3DG7A 3W7QA 2B7OA 2D24A 2XIOA 2OEJA 3DESA 1BEUA 4PMYA 3U0HA 1GORA 1OFEA 4XZWA 1VEPA 4UFIA 3G0XA 3L4XA 1NOUA 3TA6A 3V0UA 3N4AA 3QR1A 3CPRA 4D6GA 2Y5SA 3QHNA 1SVDA 3VAVA 1UOZA 4J1OA 2IPWA 1KO0A 1Q6LA 4PB4A 3KXQA 4UOJA 1VEMA 4AIOA 1TE1A 2CWNA 2BP1A 1W91A 2E77A 4ZOEA 1YHTA 1VGAA 2TODA 5I6SA 3GWQA 1H61A 1GOKA 3FVDA 2ZVRA 2NVAA 1R3RA 3UJEA 4ZR8A 3WSUA 4HTBA 2ZUTA 2ADAA 3IVTA 4BS0A 5D05A 4F2TA 4R85A 3GK0A 2VR4A 3T8LA 3KOFA 3E2VA 1CXIA 1XWYA 3ABXA 3MANA 1HO4A 1NQKA 5F4SA 1E9IA 4HHMA 1UQYA 2Y88A 3MUY1 5JBFA 4LUYA 4E2VA 4WZHA 2ZRZA 4E8GA 1MNZA 2DZUA 2QCCA 4MLJA 1VHCA 1GWJA 1OB0A 4WSHA 4B5NA 1J11A 1OX5A 3KOXA 3FY1A 1HG3A 3T2QA 4GI8A 5JH1A 1Q2RA 3VKDA 1H0IA 4LJ3A 3SR7A 3AXMA 4DAIA 4O4WA 3CUJA 2ALDA 3WQEA 1XYBA 3Q45A 2VWSA 3WO8A 3QZ6A 2J8TA 1UWRA 3EWYA 1B9BA 1FCUA 1XRFA 2CHRA 5AZ0A 3PZVA 3QFWA 1NSJA 4IZGA 4W89A 3HG5A 4OU1A 1EQCA 5BWFA 4WKAA 4HHPA 2FHFA 4O1CA 3TSBA 4ZE4A 1QJWA 4JICA 1EDQA 1RHCA 4Z1DA 3IV8A 5G2HA 3UXAA 2VZVA 1TPH1 5BWAA 2V3GA 1XLKA 4EIVA 1DHPA 2WSYA 1O68A 2X7WA 4E5TA 1S1PA 5FEXA 1CNVA 2DIEA 4H1ZA 4G6CA 1G9HA 4LB3A 3IANA 3O0FA 4KESA 4B2DA 3WQ8A 1GPFA 3OZMA 4GIAA 1F3TA 4HTYA 1DJIA 1RQHA 1ISVA 1V02E 3CS2A 3ZWTA 4RZ4A 2I7GA 3KL3A 1XUZA 1RUSA 3G0UA 4UTTC 1TV7A 3GC4A 4MYXA 5M5DA 5CPQA 3EX1A 5FEPA 3N9SA 2J24A 5CSUA 3LCXA 5LIUX 3PZQA 3C5QA 4JX5A 3A9IA 2QCMA 1RBAA 1DJYA 5HUPA 5B7ZA 3T07A 3QZAA 1CXEA 4V15A 4DZAA 3WMCA 4PYSA 3B05A 3H22A 3FKRA 2GJXA 2XM1A 4AXNA 3WMLA 2Q01A 3I4KA 3TCSA 4CN6A 3KCJA 2E40A 1FH8A 5HDRA 3R10A 4NYYA 1HKJA 2V63A 2NUXA 4K2SA 4FALA 5C7HA 1W5OA 5CLTA 3ITYA 3WF3A 2WWCA 4JFUA 3W7RA 2D1ZA 2GZXA 4AWUA 2QAPA 4S1FA 1DHKA 3FAWA 4W88A 5E6ZA 3GG0A 4LC6A 1JXJA 1V3LA 4B9ZA 3N1AA 2VT0A 2YBTA 2F7FA 1E1FA 2BMBA 1MNSA 4UTIA 2GGGA 3EOLA 1EX5A 2REQB 3K4WA 4C60A 3MS8A 4GJJA 3WLOA 1A4MA 3LA4A 5DX7A 3SFKA 1XLIA 1LQAA 3F2BA 4HOWA 2NVDA 1BTMA 3W6YA 4B5SA 1QHZA 4WY0F 2J9XA 4L61A 1T40A 4BWLA 2WSKA 5LZLA 3FJ6A 2KX9A 3VOJA 3E3HA 3VUSA 2A6LA 3RM8A 1Z8AA 4NVTA 3UG8A 2PDNA 3QXBA 5D2YA 2FLIA 4FHAA 3BAJA 4UTMA 3MMDA 5LA0A 3A47A 1QPOA 1VRDA 3M0IA 4HMNA 3VIKA 4O1AA 3SCSA 3LGGA 3CL6A 5C9WA 3QHOA 4J27A 3R12A 3W84A 1S3HA 1J0HA 3M0MA 4Z0JA 1UKOA 3W23A 4HIBA 1IR2A 2GLKA 1E55A 3RU8X 3SIZA 4B4FA 1K03A 3OLEA 5D04C 5FF0A 4EWND 1PEZA 4IMEA 3MV11 1JVNA 1TWSA 3GX9A 2IW0A 2NQZA 1YYAA 2Y7DA 4P8UA 1E4LA 2A6NA 5CSRA 1SM9A 2CZVA 2Q3OA 3TJ4A 4NHVA 1P0EA 3TC7A 1FHDA 2B7PA 4BY3A 3HQ1A 2A3LA 1DIEA 2CLHA 2ODOA 3E0IA 4MAZA 3E0VA 4O17A 4X0NA 1G94A 5LIWX 1IIGA 2W6RA 4ZVJA 1ZGDA 3I6EA 2QUNA 2NX9A 1WQ5A 1T6MA 3LS9A 4LNYA 3MMTA 4G56A 1DWHM 3WNMA 2ZUVA 3K30A 4M5PA 3WY1A 2WZIA 3N9RA 3N3TA 2QPUA 4MDPA 1UROA 1W9PA 1WDSA 4L1WA 5AC6A 2KZHA 1FDZA 4LNCA 4NI8A 3O6DA 3PWGA 4QGCA 1Q6FA 3T42A 3TW9A 4YHEA 1MXDA 2Z1XA 2V5DA 3H53A 1JULA 4LW7A 3V0SA 2PDJA 3W7HA 3C0JA 3AUOA 4PR4A 3E49A 4AY1A 3NDOA 2YOCA 4A3RA 4CGTA 4FPSA 3WF0A 3SN1A 3BO9A 3D46A 4J5NA 2DZXA 4XD4A 3R4IA 4D71A 3UJSA 2AOSA 1XS2A 2YBVA 2J62A 1UA3A 4C7GA 3LI0A 3Q2DA 5DXYA 3LHVA 1ADDA 2HNEA 3IIPA 3VOGA 2J7GA 4AFYA 4HNLA 3MKKA 4I9MA 3STEA 4QIUA 2ZA2A 1P0DA 3G0SA 3RPDA 2XTKA 1E6QM 4UZUA 2QGYA 3BANA 5LXXA 3VIFA 4JDYA 2POTA 3DXIA 4JNMA 3BURA 4LU0A 3O6YX 1HKMA 5MF5A 1Q65A 3GR7A 1FBAA 3GD6A 2EKCA 3WLJA 3GM8A 3NL2A 1V3MA 1OGSA 4AD3A 1NELA 4DO7A 4AUBA 1V3KA 3VINA 4DZ5A 1E15A 1RSCA 3LPFA 4FF7A 1LF1A 1W1PA 3BQ5A 1UIOA 2XWEA 2ISWA 3W71A 3I7RA 2QHAA 3PSVA 2H90A 3CWOX 2GJRA 1TSIA 3VKBA 3AMKA 3K1GA 1FDYA 1KM4A 1EDGA 3AALA 5SWUA 3TYUA 2FZ9A 2Z1SA 1LUCA 2EPHA 3QLLA 3HB9A 4EWJA 5E5CA 3J7HA 3TVAA 1BRLA 2QJMA 5CPMA 3UWVA 4PB3A 4EPBC 2FIQA 1WYIA 4W4QA 3LN3A 4ZOBA 3UW6A 3AU2A 1BG9A 3Q67A 3W81A 2PGEA 4HHHA 1X7FA 1R3QA 1TWWA 1PVNA 3QQ0A 1HJSA 4JX4A 3FKKA 1LCOA 3PZGA 2TPSA 4M80A 1TUFA 1MUWA 3HGOA 4FXJA 5KSWA 3IS4A 3TN3A 4B92A 3QGAC 2XGZA 4YTUA 2WSQA 4MJ2A 1UJPA 5ENLA 5E0CA 5EMLA 1VBHA 3W72A 3DDMA 4LCQA 2BHZA 4B90A 5H1WA 3UPMA 5FF2A 3ZQ9A 1VFTA 3W82A 3L5AA 3IGSA 1B9ZA 1T7LA 2GSJA 2I5IA 1A53A 1UD5A 1OG6A 4UTTA 3VIHA 1W3IA 2ZRUA 4K38A 5FJOA 3MCOA 1DJQA 3NG3A 4RX0A 4MY9A 2GQ9A 3N2OA 3F4WA 4QQ3A 5HATA 3S6TA 3CMJA 2R6OA 2WPBA 3UR5A 1VBUA 2BZNA 3L66A 1C8XA 3DG3A 4ROPA 4H9ZA 3RAOA 4A2SA 1UPPA 4NJGA 3VA8A 2AGKA 3MW7A 3BGAA 4UR7A 3N2XA 5GJMA