4MWAE

1.85 angstrom crystal structure of gcpe protein from bacillus anthracis
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
260
structure length
258
Chain Sequence
NEMTHRTKTRPVKVGNLTIGGNNELIIQSMTTTTHDVEATVAEIKRLEEAGCQVVRVAVPDERAANAIADIKKQINIPLVADIHFDYRLALKAIEGGIDVRINPGNIGRRHKVEAVVNAAKERGIPIRIGVNAGSLERHILEKYGYPTADGMVESALHHIKILEDLDFHDIIVSMKASDVNLAIEAYEKAARAFDYPLHLGITESGTLFAGTVKSAAGLGAILNKGIGNTLRISLSADPVEEVKVARELLKSFGLASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
publication title 1.85 Angstrom Crystal Structure of GCPE Protein from Bacillus anthracis.
rcsb
source organism Bacillus anthracis
total genus 95
structure length 258
sequence length 260
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2013-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4mwaE00
4D8ZA 4G9PA 2VEGA 4DB7A 3NOYA 3H26A 3TYEA 3MCOA 1AJZA 4DJDA 3MCNA 4DJEC 3TYUA 4O0QA 2E7FA 2BMBA 1Q7MA 3H2MA 4MWAD 3TYBA 3H21A 1Q85A 4DAFA 3H22A 4NL1A 2DZBA 4CCZA 2VEFA 3H2AA 1AD1A 4DJDC 1TWSA 2Y5SA 4S3EA 4DJED 4S3FA 3H2EA 3H23A 4MWAB 4O1EA 3K13A 4DJDD 3TR9A 5JQ9A 4NILA 4DJFA 2YCJA 3TZNA 4S3DA 3BOLA 3H2FA 4NHVA 3TYAA 2Y0FA 4S3AA 1Q8AA 4DJFC 4S38A 2DZAA 3H2OA 3BOFA 4C1NA 2H9AA 4NIRA 1F6YA 2VP8A 1Q7QA 1Q8JA 4MWAE 4DJFD 1TWZA 1EYEA 1TWWA 1TX0A 4DAIA 1AD4A 4PZVA 2Y5JA 4C1NB 3MCMA 1AJ2A 3TZFA 3H2CA 3TYZA 2H9AB 4S39A 4HB7A 1AJ0A 4D9PA 3H24A 3H2NA 2YCLA 1TX2A 2DQWA 4D8AA 4MWAA 4S23A 2YCKX 1Q7ZA 3V5OA 4S3BA 2YCIX 3TYCA 4S3CA 3TYDA 4O1FA 4DJEA 4MWAC 2OGYA 2YCLB
chains in the Genus database with same CATH superfamily
1TRDA 1BYCA 1XYLA 1G4PA 3WNMA 3GNRA 1LQ0A 4CD6A 2XH0A 1UR0A 1CGUA 5BXSA 2J7EA 3GVVA 2ZIDA 2NV2A 2VEMA 3IJ8A 4RJEA 3A3XA 2GVEA 3AUJA 2ZC8A 2F6XA 3EDKA 4WGXA 3GH5A 2NVAA 3W7QA 4J1OA 4CQ8A 2BLEA 1NFPA 4MYXA 3M16A 4UTJA 3DHPA 4GHRA 1P1XA 3NEVA 4WX2A 1B57A 4HOWA 2JFEX 1A0EA 3ITXA 1P6BA 1RP9A 4UTMA 4V27A 1Q8AA 4F2UA 1B30A 1EJUC 3GDKA 2X41A 3UY8A 3PWGA 5CJ5A 2W61A 4B9YA 1V7AA 2PDCA 4IPIA 1Z48A 1IT0A 4K37A 2QPSA 5LNUA 2OYKA 4M1BA 1FKXA 3SADA 3BCJA 3DKLA 4B4FA 4XX6A 5AYYA 2J6XA 1DBTA 5LIWX 4Z1DA 3E74A 2EKCA 1AA1B 3PZOA 4I7VA 5D9NA 1NY1A 5C0QA 1ZL1A 4ICMA 3S1WA 1YIXA 2WWDA 3W70A 3EKZA 1NF0A 3R5EA 4P8WA 4RW3A 4JIQA 3V0TA 4TIMA 3NUKA 4Z0SA 4LPCA 1GVOA 4LAMA 2Y5EA 3H4GA 3G1AA 2FZNA 3LTYA 2VELA 1UH4A 1OG0A 5LNWA 3R1ZA 4K1GA 4LS0A 2GGJA 3VE7A 3WF2A 4AX7A 2Y88A 1TPVA 4C6OA 1F8MA 3WFAA 2CWNA 4RX0A 1QNVA 3VGBA 2O55A 3N9SA 3QTPA 1SW0A 4PE8A 1MW3A 5BRQA 4GI8A 1O5KA 4UIOA 1NWSA 3ITCA 4D72A 5BXRA 3EOLA 3DKJA 3OBAA 2Y61A 2X05A 1GVRA 2GFTA 2XIBA 4I9TA 1C8XA 5LA1A 3STFA 1NFGA 3OEXA 3W1PA 4F2TA 5CC5A 2ZX8A 1KRCC 1GW1A 1V93A 3F7JA 4P7LA 4WD0A 4KERA 4IFKA 2YFNA 4XB3A 1CTNA 1A5SA 5AHFA 1J96A 1UWQA 1GEQA 1EDQA 1XIEA 3ARVA 4BEQA 3VGHA 3LHZA 4IIGA 4HHHA 3CO8A 3L2MA 3UA3A 4H9TA 4XTDA 3BLIA 3RK8A 2I9EA 4PR4A 1PBGA 4JR5A 2NQZA 1D9EA 2BXYA 2Q02A 4PFHA 1RA0A 4IMDA 3ZLGA 1A5MC 4A21A 1J5SA 1GHRA 3UW6A 2A3HA 2ASHA 4E0CA 4WJEA 3LU2A 5I07A 4JDYA 2RGLA 4H6EA 1E72M 1HX0A 5E70A 1SO3A 2VEPA 4GINA 4K6AA 2ALRA 3LGGA 4JKKA 2VZTA 3SECA 4S3FA 4OV9A 3M46A 1QMLA 4NP7A 3CQIA 1VBHA 3DEQA 2R91A 3GXFA 3H2FA 3NL6A 2V30A 2WHJA 2XFYA 4F8XA 4B5XA 4MYAA 2QGYA 4S38A 4YL2A 3AMCA 4MY1A 2VVNA 3VXGA 5DANA 3BE7A 3M64A 4MPQA 4A6GA 3DC8A 3A22A 3CB3A 3QMRA 3QV7A 1DJQA 2GZXA 1L8PA 1IWBA 5CGMA 2VFIA 4L4MA 2HBXA 4ZBCA 4YNGA 2WLYA 5AHNA 3L9CA 4H4IA 3ZR5A 2G0WA 2J7DA 3EDJA 4AEEA 1R87A 3N2XA 1C91A 3AQUA 1FRBA 1ISWA 4QS5A 4RDVA 1Z32X 1VEPA 2XIOA 4PUKA 4QLJA 3WLKX 1GZJA 4I6VA 3UJEA 3WUBA 3QKZA 1PUDA 4LUTA 3S42A 4DLMA 1DJNA 1TB3A 1LLZA 4CD8A 4ZTYA 4WHBA 4C6FA 3HV9A 1MWOA 1H62A 3WL0A 4CN1A 5LHFA 5LGXA 3ONBA 4JBRA 1B3WA 1HGYA 3VX0A 1V08A 4W8BA 4R3UA 1FHVA 3L68A 2ABAA 4FNPA 4R53A 1ZP4A 2ZXBA 1EGVA 4JQ1A 4GCAA 5B80A 4IXXA 1DJXA 3MHGA 4C6CA 3EDDA 1XF0A 2AQOA 2WLZA 5T9CE 1H7OA 4WJXA 3WELA 4GFIA 4HT3A 4MOZA 3KUMA 3UZZA 3SN0A 1UUQA 3IJLA 2X40A 1JYNA 3THAA 2JQXA 1R7OA 3PPGA 2AOSA 1GYNA 1UASA 3ZVHA 3FK4A 1EGZA 2JGYA 4LY8A 3W81A 3LYEA 3SCNA 1VEMA 3TA6A 1W3TA 1IEXA 4H8NA 1TCMA 3NFUA 3TTYA 3EX2A 3AHXA 1KKOA 1OIMA 3LN3A 4G1KA 3RX2A 3E38A 4RK8A 3UWVA 2Z26A 4MADA 1YX1A 1EQCA 2HROA 2V3EA 4IX2A 4D9PA 1WKDA 2A2IA 3DU0A 2WMIB 4M6UA 3DFNA 2BVDA 4NI8A 4DUVA 2GGIA 4QG6A 2F7FA 2VR4A 1JIBA 4D6HA 2OSXA 2VFFA 3QGKC 4JTDA 3O15A 1UWAA 4FB7A 2I5QA 3K4DA 4BS0A 7REQB 3LCGA 3PBWA 3VGEA 4CCCA 2Z6JA 3BCDA 5K9XA 1J0IA 1K9FA 3WF3A 3CHDA 4LAUA 4DWSA 3AC0A 1E3ZA 5LA2A 1IZCA 1HUVA 2D24A 5AN7A 3MKCA 1E6NA 1JDCA 1LL4A 1J5TA 1UD5A 2G5WA 4UR9A 4AD2A 4LWWA 1XD0A 1D2KA 3OVPA 2TSYA 4LEFA 2PWVA 3UJFA 2J7CA 3EKLA 1R30A 3EWZA 5FAGA 4L61A 2WCSA 4N9CA 4JS3A 3C8FA 3QSRA 3MQTA 4JTIA 4XO7A 5U4NA 4QNEA 2XWEA 1ZY9A 4A35A 2RH9A 4G6CA 1EIXA 3TX9A 2C14A 4NNBA 2QGHA 7ODCA 3AU2A 2OGJA 1F4AA 3MUY1 1BD0A 4O28A 5EU9A 3CV7A 2FHBA 6TAAA 4WQ6A 3CC1A 3NXFA 2VFEA 3RO8A 2R24A 4P5UA 5E09A 5J8LA 4AY7A 3RXZA 1EYWA 2YSWA 2QJIA 4CU7A 1S2UA 3QRHA 4D2JA 1E6PA 2Z1KA 2RFGA 1TE1A 3N19B 1WE5A 2C19A 1EJXC 3AZTA 4BF9A 1O1ZA 2EPNA 1G4TA 1XH2A 3SRDA 1O5XA 4AQLA 3GSMA 1SYTA 1WUFA 3I6EA 3FV9A 1S2WA 4GO8A 1V5XA 3H7VA 4OGZA 4C91A 4M82A 2CESA 2DJLA 1JUKA 1KRMA 3CLWA 3A4WA 3GTXA 3UEQA 1VGAA 1G7VA 1V02A 3ARTA 4XD6A 3WNOA 2G3JA 4GUHA 2CZFA 1EA0A 1S5WA 4CD4A 1PXGA 2WMGA 2YB1A 1W6TA 3BGAA 2EJAA 1NIUA 4AU0A 5A8PA 4J4KA 1EF2A 2PTYA 3WLRA 3T40A 3UZWA 4GABA 1BTMA 4B9ZA 4EPBC 4U3CA 2PWHA 3FAWA 3SUTA 3KHJA 5E1QA 4M5PA 2FDSA 3KOZA 4O57A 3MT1A 5DELA 4JL2A 1LBFA 4YXGA 1J11A 3H54A 1J10A 2V2CA 5ABGA 4ZTXA 2GVGA 3DFOA 3T7VA 4PEEA 1EJ7L 3MHFA 4MY8A 3EOOA 3IV8A 4LJ3A 4L4LA 1R5YA 2R6OA 3MJMA 3PZTA 4CKQA 4W7WA 2VDIA 2PTWA 1OQFA 1JUEA 8A3HA 3GDLA 3CUGA 3DHDA 1TJ1A 1JZ5A 1ONWA 3WN6A 2QULA 4TVDA 3THQA 3W00A 2EEXA 3CPGA 5A94A 1CW2A 1WBJA 1ZBKA 3AALA 1BHGA 5D30A 3P62A 1GOKA 2Z1XA 1FFRA 1C93A 1YE6A 2J62A 4D6JA 1EKOA 1DJYA 1V3LA 4PMQA 1H1YA 1PKMA 2I1OA 3D5HA 1ISYA 4JGDA 3CEPA 1US0A 5T26A 4EXBA 2IPWA 5ABFB 2Z7KA 3WEMA 4JYEA 3W2MA 1CGTA 2QCGA 4DAFA 4AVOA 3HU7A 4DHGA 1JI1A 4AC7C 1SMDA 3FKRA 5EY5A 1S5MA 2OELA 1SU5A 1WBHA 3M0LA 2R1KA 4HNOA 3R13A 3L5MA 3AIBA 2A1YA 2DT1A 5AKQA 4MLRA 4LB3A 2WKJA 4KEUA 1XBYA 1E6RA 1HKWA 2GQ9A 4UZUA 3KP1A 2GQ3A 5K7JA 3GDBA 1TV2A 3T2QA 1IZKA 1EDGA 2O9TA 3KS6A 4DI9A 1WZAA 4ZO8A 4QBXA 3M0ZA 3WK2A 4TO8A 4JCLA 1EXBA 2PGEA 1EJVC 4UWMA 5C71A 4AF0A 2ZZ5A 4Q6XA 3OA5A 1XYMA 4GI9A 1LOLA 1CGXA 2Z6IA 5HPOA 3W2JA 5HANA 3RITA 3I3BA 3PJWA 3GO2A 3UR8A 4I9JA 4MGGA 1MVYA 2W5FA 1MEHA 3W76A 4AVNA 4PH6A 4ZXLA 4G8TA 3VIMA 1DL3A 3ATYA 2OWWA 4ZOAA 2J7GA 1PKLA 3GQYA 4NQ1A 1OIFA 3FFSA 2QDEA 5HWNA 3AXMA 4H04A 2ZRVA 4MWAD 4FOUA 1OYAA 1YDVA 3WEZA 3SO7A 1KGWA 4CCZA 5EA9A 1TZ7A 1BSLA 1VBJA 2GSJA 1UD6A 3HA1A 3U7BA 1FTXA 3RRXA 6A3HA 1KCZA 3R4IA 4ERAA 3T55A 1AK5A 4F66A 1XLEA 4H9UA 1KBBA 3H2EA 3TXVA 8XIAA 3IIXA 4IL0A 2UY4A 3A13A 2I7GA 2QMKA 2HISA 3W07A 1JPMA 5BRPA 3KE0A 1BQCA 3TAOA 3RRAA 1V6YA 1XIJA 3VI2A 1JPHA 3MA8A 3MTWA 4IUOA 4LXFA 4JOMA 3WLHA 1XLIA 2Y7DA 3PSVA 3KBVA 4JTLA 4WSKA 3TSBA 1PX8A 1YTEA 4LRSA 3E96A 4MY9A 4GQBA 5BU6A 3DFTA 1ZPTA 2ON3A 3WLMA 1NF7A 3OVRA 2WHKA 3GXMA 4HB7A 4A3QA 4UNIA 2A3LA 3VOHA 3U5YA 4NRSA 2XN1A 1J01A 3P2VA 4ZFMA 1OSEA 2P50A 3IAQA 2QDDA 2Y4SA 3AYRA 5E6ZA 2W27A 2REQB 3NL3A 3M5VA 3IGHX 2E6YA 4K39A 4EAYA 2VYOA 4QDWA 1EPVA 3PZNA 5KETA 3NOYA 2CKSA 3AS3A 1JI2A 5BXPA 3NZ1A 3O16A 1VZWA 5A8QA 1VENA 3TYBA 5I24A 3IRDA 5HPCA 3WLQA 3LXAA 1TPB1 1XYZA 2UV8G 1SZGA 4AEFA 1RD5A 4FX6M 1Y0EA 3W6YA 3IARA 1JYVA 1VBRA 4XD4A 2OXNA 1ITUA 4UMCA 2BHUA 3UG8A 3S1XA 4PMYA 3W53A 4Z0JA 3N6QA 4IP4A 3AHVA 1OB0A 4JQ2A 4JHZA 3O0KA 1GPWA 3R7MA 3TUUA 4XKMA 3RYSA 3M41A 3UF9A 1A4LA 1UW9A 2HPIA 1IF2A 5ABEA 1E4LA 5CQ1A 5C7VA 1W3NA 4KPLA 1V51A 5DY3A 3WK3A 3MANA 3EA1A 1H1ZA 2VX7A 2D1ZA 1ITQA 2ISDA 1DIDA 4JFUA 1XBVA 1WO2A 3ZO9A 3W38A 4DNHA 4GYKA 3DX5A 2J79A 3AHTA 2QYGA 4UQ9A 5F2MA 3TYZA 2DIEA 3A4XA 4H41A 2Q6ZA 2WSRA 4ACYA 1IIGA 2HNHA 2X09A 4CQAA 4WDTA 2ZADA 1S2TA 4QLLA 4MFDA 4US5A 4ZENA 1DWFM 3N9RA 3K46A 4LFYA 1O95A 2YA1A 1C8VA 2Y63A 4CNTA 1FKWA 2ZZ1A 3ECQA 1GQKA 5DT5A 1O68A 1QBAA 1VCGA 1KFEA 2CEQA 4Q8QA 2ANUA 5FEPA 1HVXA 5CSYA 3VZZA 1XIDA 4HA0A 4FMVA 4C6MA 4AISA 4NXKA 4RW5A 3XINA 3LHTA 4B2DA 4TVUA 5HMFA 1X7FA 1A5AA 4LAOA 1JCXA 5I09A 1CWYA 1HW6A 1QTWA 1BTCA 1EQPA 1KTNA 5D38A 1UA3A 1PIGA 2I9UA 1TELA 1QFEA 4N6FA 2AQVA 5LNSA 2Z2BA 4AZ5A 1NARA 2F2HA 2VO5A 2V3DA 1U83A 2OJPA 1QHPA 4JTFA 2W91A 2GVLA 4H83A 4LALA 1KLZA 5LIKX 4ML9A 1EC8A 1LRTA 5XIMA 2XZ7A 4W84A 3MCMA 3VIJA 2Y89A 3P8IA 3NZQA 3FLUA 3GLCA 2DV0A 3EKGA 5JH2A 4W8LA 3TU9A 3M0VA 4F3HA 1L8NA 1S3TC 4IGMA 1XWYA 3UBPC 2RDUA 1QATA 4LW7A 2YDQA 1IXQA 4GY1A 4LUYA 1XJBA 3W01A 4Q3MA 4P61A 1PCWA 4O52A 1GVIA 4CD7A 1XIHA 1FQ0A 1PDYA 3GXDA 5BOEA 1C8QA 3O07A 1QPNA 1V6VA 4M51A 4UC5A 3VCCA 4C6QA 5DN1A 3M5YA 4KCUA 2CHNA 2DQXA 1BG4A 2VENA 4GRSA 4PN2A 3UERA 3OBKA 3PY2A 4RNHA 4H8VA 1NOFA 1MW1A 3EB3A 3P7YA 1N82A 2Q01A 5JQ9A 3EPOA 3NQMA 2FQIA 1FCQA 3TWAA 2XDFA 4WSJA 1XFBA 1XYAA 3USBA 4Y9NA 4X0NA 3IUIA 4PTNA 1H7XA 4ROQA 1W9PA 3P67A 3C61A 2W0UA 4ACZB 3L0GA 3O0FA 3P0WA 4YWSA 1G6CA 4GI6A 1IT7A 3B0YA 3W1MA 4O1BA 1MXDA 1C92A 3M9YA 1JGIA 4O19A 2H3DA 1WDWA 3WLSA 4QCFA 2B7OA 3P14A 1H61A 3M43A 1H5VA 1KLYA 4NAFB 4MWAA 1FDJA 3LSBA 1HP4A 1KXVA 4IQLA 1MFVA 1X39A 4L6HA 4E3VA 4E2OA 2Z0IA 4A2SA 1K8CA 2G3IA 3O3RA 1YPIA 3SB0A 1IIHA 4DXKA 3OB8A 3ZJ6A 2YYUA 4WRHA 1K9EA 4MUPA 3TTEA 1FXQA 1UPPA 4J9JA 3PZMA 3KZPA 1XSKA 4L1WA 3UWZA 1WZKA 3DIPA 1Q13A 3QQ0A 3I6TA 3TSDA 1T5AA 4Y6GA 4LC8A 3TSMA 3D3AA 1ZB5A 1P0DA 3OIHA 3TTSA 3P74A 3LLXA 3LUTA 2GJPA 3R0DA 4NZ5A 4RZ6A 5CJMA 2B7PA 1GKQA 1OFDA 3PUDA 1NU5A 4AAJA 4DQWA 3NXLA 1JR1A 4HCLA 3PAOA 1KC7A 9CGTA 4N9BA 1T8XA 1XLGA 2ZRXA 3VOJA 1I8JA 3WBWA 3GNXA 4KEZA 1Z8AA 3HMJG 1KFJA 1RBAA 1FDYA 1KQZA 2ZXDA 3VPLA 4UFKA 2WSPA 3PUEA 2NW0A 1TJ0A 2E6DA 2OWXA 4X9SA 1Q6OA 1FX6A 5FJJA 2VC6A 4GA8A 1SJDA 4LGXA 1TUXA 3B03A 1UWTA 3SFKA 1QASA 1ITCA 1B2YA 4WJ8A 2QVNA 3C0QA 3GDMA 1LOQA 4IICA 1E40A 1G9HA 1B3XA 4KW2A 5F4XA 1S2VA 1BVNP 3FVDA 2ATMA 1PKYA 1E5NA 2ZRUA 2EG6A 3MHUA 1RSCA 4Q4KA 4MJZA 4L9YA 4MNJA 1QI0A 1GVFA 3TC3A 2J25A 4O54A 5LXXA 3IIPA 1P5BA 1H60A 2FZ8A 4NILA 2DZXA 3NYZA 1THFD 4DO5A 3F1QA 1XICA 3CH9A 1P43A 1TVPA 2D0FA 3S9YA 1TZZA 3W27A 3BOFA 1H09A 2FGZA 5BW6A 1YMYA 2BP1A 4I5UA 4FAMA 1YHTA 2WSQA 4MVAA 3I4KA 5EMJA 1QOPA 3AJ7A 4F4RA 4W7VA 2VTFA 3P3BA 2VD8A 4G7FA 3EOEA 2KAUC 4CQ9A 4KESA 4BF5A 3IIZA 1CZ1A 3DFSA 3U8GA 5EMUA 3RU6A 4GOAA 2D20A 3F4CA 5HJXA 4QHRA 2Y8UA 1XI3A 5MF5A 3VA8A 2EXOA 4MFEA 3TNBA 3BLDA 4EWND 4KF1A 4LB4A 4WGHA 3VD7A 2BG5A 4F9JA 4WCJA 2JGQA 2A79A 3TYCA 3H4XA 5E6YA 2ADAA 5G4WA 1Q6QA 2XISA 1V0LA 3RM8A 4WY0A 4G7EB 4DO7A 3STPA 1CIUA 2CNCA 2CCRA 3BVJA 3QLLA 3UCDA 3QR0A 5HUOA 3SAZA 1AD1A 1W37A 1KM4A 1VP5A 2EPHA 1DQWA 2FZBA 1SSDA 5A2CA 2V5JA 4RLIA 3SCPA 2YLLA 4YTTA 2XH7A 4YTQA 4UMBA 1RCXB 2B7NA 2BY0A 2VXNA 2PAJA 3R8HA 1YDNA 3UXIA 5IFPA 2BVYA 2Y0FA 1YDYA 2FPYA 4PSRA 3LGEA 5C6MA 2EPKX 4FIRA 3QY7A 4ROPA 2DVXA 4DBEA 2R9RA 4POCA 3UFYA 2VNCA 3WG6A 1TUFA 4P2VA 2NXGA 4JKLA 3AXXA 4JFTA 5CPTA 7CGTA 1CGYA 1RJRA 2WM0A 3C8NA 1M7OA 1IE7C 4N42A 4US6A 3FJLA 4B5NA 3ABXA 2CZVA 4ZZ9A 1CENA 3ANYA 1CPUA 2QCHA 3BTNA 3KM8A 4ZSUA 3CUFA 3S2JA 4AEOA 2ZZ7A 5FF0A 1ZBWA 3NDOA 3MSYA 1I0DA 3KX6A 3P5YA 3GC2A 5M17A 4LF1A 3L21A 1PSCA 2JKEA 3WLJA 3WFZA 3BAWA 4MDPA 4L1XA 2PZ0A 5DXYA 1PZ1A 3LZ5A 4MB5A 4RE3A 1JDEA 4XZBA 1EBHA 1V3KA 3VZYA 1KBJA 3WJXA 1SQ7A 1WV2A 3K8KA 4RZ4A 2W67A 1BKSA 3DCPA 2PWEA 4Q4QA 4QDPA 1TIWA 5D04C 2RJHA 1X7IA 3LENA 3AWOA 2PRMA 3ARWA 5JU6A 3HF3A 4Y9MA 3PUGA 5CZSA 4DIAA 1XSIA 1BGGA 1EOMA 3N17A 3O05A 3SQMA 1BVWA 2WKLA 1LLWA 1KM1A 3GH7A 1KBKA 1J4EA 1CXIA 2WZIA 5IFTA 2V8ZA 3CWHA 3CZEA 1HKJA 2WMIA 1A50A 2QUTA 3VC6A 3MB9A 5I3HA 3AUOA 3QLDA 2C1GA 3F4DA 4EAMA 3ZQ9A 1DJIA 3N11A 4LYQA 1QDSA 1M7PA 4GJ1A 2ESCA 4OECA 3W28A 5LIXX 1TREA 1D3HA 5LYRA 3L12A 1Y7VA 1UROA 2VDHA 3URQA 1ZENA 2QJMA 1JCTA 4Q22A 3A4JA 2UY2A 3TCEA 3MI6A 3FEQA 3PC0A 4MWAC 1AH0A 3AO0A 3GS6A 4UFHA 3SRHA 5CPOA 2GSHA 4DRSA 4JTSA 3CV1A 3M0KA 3UG4A 1CGVA 8CGTA 3VDAA 2GK1B 2WSKA 4DPQA 3C5QA 4GQ0A 4AVFA 3NURA 3WD0A 1XD1A 3HN3A 4RV8A 3WDJA 3TFCA 1V6XA 3SCWA 5BWAA 5DO8A 4RPQA 3GVGA 5TAOA 1LROA 2NQ5A 3HMCA 2W9MA 3S8HA 1P7TB 3G22A 4BI7A 4XG1A 5FJRA 1NP2A 3MC5A 3T9PA 5A8MA 3K1DA 1XIMA 2PE4A 3PN8A 2VURA 4IP7A 3DYMA 2DH3A 1RQHA 3TOPA 2Z1BA 1E15A 3MV01 1ONRA 4GVGA 2J47A 1JCLA 4C6LA 4BQ4A 2Y2WA 2P1FA 3KLLA 4E2DA 1KO0A 2OX4A 4JX4A 4DZAA 3BMXA 1F74A 2C91A 2OODA 3V5FA 3C0JA 5A1AA 2PURA 1VYPX 1TV7A 3PG9A 3K8MA 1QK0A 4H00A 4F0MA 3VIKA 3F2CA 3TFXA 3GUGA 2DSVA 3LG3A 4IGHA 2CKRA 2E7FA 4D71A 1DORA 2EGZA 3CB8A 1LWHA 1X8CA 1YBQB 3L4UA 4K68A 2HCVA 2OTDA 1PHWA 3PZIA 1JAEA 3AHYA 3G24A 1OD0A 1MQQA 2Y5SA 3MS8A 2H8ZA 1B0IA 4LU0A 1JNDA 1LJYA 3B9DA 2OLHA 3ZYZA 1KFBA 1A5UA 4TQTA 1BF6A 1WXZA 3VKAA 4BY3A 4AX6A 4DO6A 1G01A 4JNZA 1ODZA 1W1ZA 3L2LA 3G1HA 3UY7A 2PB1A 3L4VA 2CLOA 3GFXA 4V33A 2R1NA 4UCGA 1BGAA 1QR7A 2HK0A 4WXZA 2X0YA 4WDUA 3VNJA 2ACQA 2CLLA 4KIRA 5JBFA 1FWWA 3DYPA 1HFBA 2QUUA 3N2BA 3WQ8A 1XBZA 1NAL1 3RM9A 3WUFA 3QW3A 6PTDA 2PTZA 4ZO9A 3GG1A 5DX7A 1E1EA 4CD5A 3W1XA 1R3QA 4GUFA 1V3IA 4Q8MA 3KWXA 2BY3A 3CGTA 5ABFA 1SMAA 1KA9F 3P0XA 4H8HA 3S5NA 1ZJHA 4HYWA 4J5NA 3ANUA 4JZ5A 4LCQA 4O1FA 3BSHA 1SUXA 3RLGA 4LVAA 2OYMA 2J8TA 4AD3A 3SURA 1CLVA 4I8DA 2V2DA 1MI3A 2JEQA 2PP3A 3HQNA 1UR4A 1FWNA 3HG5A 4S2BA 4AIUA 4GIAA 2FMOA 3UCCA 2XG9A 3TDFA 3GFZA 4DEFA 4OKDA 3DFQA 4D6EA 4DJDD 1KD0A 4GFSA 3G6LA 3VMPA 3EEZA 4UTIA 3N04A 3NA8A 4ML4A 3VMOA 1WAUA 2PPGA 4Y96A 3I3EA 2XVLA 4WDXA 1U33A 4IM4A 4RZBA 4UB9A 4J3SA 2XFFA 2YXXA 3BV7A 2Z2AA 3WD3A 4HMNA 5KSWA 4YLWA 4XZMX 3RIKA 1DWIM 4F0SA 3G1XA 3UWWA 3DUGA 2GJRA 2GSEA 4O17A 3AAMA 3KBJA 4AY1A 4GC4A 4UR7A 4D6IA 1JCJA 2Y5JA 1AW5A 1PX3A 3WLIA 4HJWA 1FXPA 3CUXA 2ZXAA 3F03K 2YA2A 3VIHA 3QGVA 1TJ2A 4RNFA 3IJ9A 2I5IA 2WHMA 1H4PA 3M0XA 4J3ZA 5TF0A 5CZ0A 5GJMA 3GX9A 2G50A 1VIZA 1J2WA 3NDYA 2VI0A 4R7JA 2Y24A 1DQXA 2OYLA 3M6DA 4BFAA 4TX8A 1VFUA 5AYXA 4AHOA 2BMBA 3G18A 3SCOA 3N2CA 3L2IA 4DUWA 1IEQA 4N4QA 3V7PA 1K9TA 1QNRA 4IG2A 2W4XA 3IJIA 1UZ4A 4HNVA 2HVOA 4XSLA 3S3GA 1EF3A 3VNLA 1BXNA 1HT6A 2ZICA 1MXGA 3S6OA 4PTMA 4UTWC 3TMLA 1WUEA 5BROA 3T1GA 3Q37A 1M01A 3H4WA 3PBMA 3VNYA 1BXBA 2F9RA 4O0ZA 3W6LA 2OR2A 1I4NA 1PX4A 3E2VA 1PPIA 5REQB 2VFDA 3O63A 2X0HA 1OCQA 2F6KA 2BGNE 2OB3A 1MFUA 4H01A 1UP3A 4C1NB 1F7BA 2REQA 4EPDC 1XR2A 1BPLB 4LBSA 3L5AA 4JIIX 3MBDA 3TQPA 1TTPA 1S5VA 3KCLA 1NVMA 2ZFAA 4ZQRA 2DFAA 3RGTA 2VR2A 5LGZA 1E0WA 2WMJA 2PTDA 2DEPA 4W93A 4I9MA 5E0KA 3OVGA 1K8XA 3S4TA 1UR3M 3WSUA 1E0UA 5FEWA 2WAGA 2WQPA 5TBOA 2YFOA 3DZ1A 3B8VA 2WC3A 2W3ZA 1OX5A 3R25A 3SUVA 3W7CA 2D73A 4S2CA 3MUXA 4QX4A 2A85A 3QFWA 3W73A 3WQGA 3ZR4A 4QSFA 5HNUA 4Z2IA 1EOKA 3WD2A 1P4CA 3VC5A 2GYIA 2A6NA 5HINA 3CZGA 3WX7A 4E6MA 1V79A 4HU8A 2QUVA 3IPWA 4F9DA 3M0HA 1V3JA 4PB5A 4YTSA 2YW4A 3WDQA 5A6AA 4NSBA 1O60A 1IV8A 3MUZ1 4PRWA 2PWGA 1H7NA 4QLKA 2Z24A 3B0UX 3B3DA 3GYCA 5G2WA 3S83A 1PTDA 2XM2A 4GXPA 1GZGA 3HG4A 2NWRA 3RMEA 3VOIA 1JCNA 2L5HA 5CZJA 4PTVA 3QH2A 2DIJA 4ZO6A 9XIAA 3DBNA 2OCZA 2ZX6A 8TIMA 3CU2A 5J5DA 2ONEA 3RPMA 2ZC1A 3BAYA 3FSTA 4AZ7A 3TW6A 5DLCA 4BQ2A 1F9CA 2GDUA 1WDQA 5KZEA 4H7VA 5CKSA 5L9FA 2CZDA 1U1HA 1ZCOA 3MPGA 1ME8A 3OZOA 1NQKA 2ATSA 2PDMA 4PA8A 2X16A 2ISSA 3MKVA 1XRSA 1TWSA 5C54A 2XIJA 2YW3A 1A47A 3UXAA 1LM1A 4RL3A 4TXEA 1E73M 1T0OA 1IZJA 3I10A 2WC7A 3LMYA 3N13A 4NASA 1V03A 2CITA 5HMSA 3S1GA 1UKSA 2Z4GA 4EVZA 2DW7A 1QI4A 1B3YA 1OFPA 1EZWA 3Q67A 3L65A 2EHHA 1VCFA 2J78A 2WCGA 3HFYA 4LUIA 1MMFA 7TAAA 1BQGA 4A29A 5A3HA 2YBVA 1WXYA 4HKPA 1PL9A 2RKXA 2UBPC 3PJTA 3VABA 1BYDA 1VBUA 3WH9A 2Y7GA 1ZFJA 2PP1A 4DWDA 3TONA 3HQ1A 2E25A 3T44A 3O6CA 3PF3A 2E3ZA 7XIMA 5FF7A 2VC5A 3C3UA 2JE8A 1FWCC 3OVQA 4X2PA 2A0NA 1UMYA 4QAIA 3FA4A 3VFLA 1OBAA 4EK7A 1ICSA 4AD5A 3L4YA 4XVDA 1UWRA 5I3JA 1W5PA 1DV7A 3YPIA 4DJDA 1A0CA 2PS2A 4IX0A 3SY8A 1NSJA 4HNLA 3U9IA 4DX3A 1XIBA 5CLWA 2XSAA 5AYBA 2DSZA 3GNOA 4RDZA 3VOGA 1UR9A 2ZUNA 3POHA 4AZCA 4BK9A 4ALDA 3QHMA 1EP3A 4QS6A 3GUWA 3EBVA 1UMLA 4IQEA 3R79A 1W2VA 4ICCX 3WLOA 4OU1A 4PUNA 3QMTA 2OQYA 1GVYA 4JTGA 1Q65A 4Y9AA 3AIVA 3B8TA 2GL5A 5AB3A 4NJIA 3CZ8A 2Q3RA 1V3MA 1EC9A 3HIJA 1FOBA 4ZQMA 4J7RA 1XINA 3GBEA 3NQ7A 1N8IA 5FF2A 1PVNA 1V8EA 1GCYA 1LORA 3HFTA 4HCDA 1E6XM 2G4JA 2J74A 3FYYA 4NJHA 2VCAA 1RUSA 2VZVA 3OTRA 2YOCA 1W9BM 4S23A 2XFWA 4FO4A 1OZQA 4IIDA 4DF2A 3QJAA 3WLPA 5A6BA 1JEZA 1EP2A 4Q32A 4UTTA 3IS4A 2Z1SA 3VDHA 2VX6A 3UD6A 1VFFA 3C0LA 2QCFA 3W7NA 4AWEA 3CBWA 2PA6A 1NFBA 1OYBA 1HO4A 2JK2A 1WNOA 3EWBX 5L6UA 3UR2A 2D3LA 5I3FA 2BY1A 5BMXA 1RHCA 1XSJA 1GQIA 1QPQA 4OIFA 4QJ3B 3HTWA 4PTWA 2A21A 1K3UA 3BGJA 1K6WA 3WDPP 2A7RA 1OFAA 1GONA 1XRTA 2PZNA 1K8YA 3ES7A 3NQBA 3SIZA 2P8CA 1AVAA 5AC7A 3GIQA 1J6OA 3M5ZA 2P76A 4K1WA 4I5RA 1ZP3A 1TPWA 4HA4A 4A8LA 2V82A 4L5ZA 3TJIA 4TV5A 4MNLA 4OE7A 4CQDA 1YDOA 2WOQA 1OF6A 5JIPA 2QCCA 2WHLA 4ZOBA 2WO5A 3KVMA 5C9RA 2YXOA 1KTBA 2JEPA 3WBXA 2IKJA 4M7SA 1RXOB 4CUCA 4RXFA 3DGBA 4ZR8A 2VFHA 1ADDA 1B4EA 3NQGA 1R38A 1GVQA 2V6AA 5LNRA 1W2PA 1GPFA 5CCZA 4HZ8A 1WXJA 3NQ2A 5FJPA 1RAKA 3TLQA 1B90A 4GYPC 3BMVA 4LUSB 4AD4A 4HSHA 1E9IA 1N8WA 1IXPA 2B4GA 3W1QA 1DTNA 2IXUA 3JR2A 3DH7A 3O1NA 4GZIA 1UD8A 2X8RA 3F4WA 5EMKA 3FNDA 3NQEA 2YL6A 1Q3NA 3GR8A 5A8NA 5LNVA 1L6FA 2PLJA 4KWSA 4LBRA 1VFMA 3HM7A 3T0AA 4AZGA 1TTJA 1FA2A 3GHRA 2FGLA 5M03A 3BL3A 3KDNA 1AFSA 2CC0A 2QKFA 2XVNA 4YYFA 2XINA 1ISVA 5CAHA 3FXGA 4XK2A 3FJ4A 1KCLA 1AH4A 2RGMA 5I3IA 1K7EA 1US3A 1TPC1 4U31A 1MEIA 4JYFA 1H49A 4H1ZA 3LY0A 5D9MA 3MMWA 3G5EA 3FX4A 3B0VC 3E0IA 4KRUA 3OGRA 4RCXA 2VR5A 2QCEA 2QJNA 4K8GA 3BG9A 1DJHA 1EDTA 1TX0A 1DXEA 3BLOA 5GPRA 1W5MA 1TFVA 1X1OA 1OCNA 1SFTA 3RCNA 4WOQA 2XSXA 4XKYB 1V3HA 5J5RA 3AHZA 1SZEA 2DZSA 1XGZA 4G7EA 3GFYA 1YRRA 3BXWA 4RV3A 3AROA 3CL7A 2INFA 4HU0A 4LAZA 3TR2A 3BOXA 1XKYA 3H26A 3LTSA 4QJ4B 2BS9A 2DU2A 2YJQA 4E2VA 3BC9A 3GM8A 2OZTA 2FVMA 4E3TA 5LIUX 1R0MA 2UY3A 3W23A 2C8NA 1WCGA 2R82A 3BCFA 2W92A 3A5VA 2ZVIA 3ITLA 2GWGA 1MDLA 1JFXA 1DP0A 1EGMA 3SCSA 2PFHA 1QU4A 2MUCA 3UGRA 4W9TA 3ZT6A 3CUZA 2A4AA 1E1CB 2PD9A 2OX1A 4W87A 3VFCA 3PSWA 4JN8A 3NSMA 3H55A 4C60A 1UWSA 2ZZ4A 1HZYA 1E9ZB 2VKZG 2J24A 1XCXA 3PR2A 4AMCA 2YBTA 4QCEA 1RQBA 2XGIA 4DUXA 4NAEA 2WVUA 1SR0A 2YYTA 3LV6A 1QCWA 2X0SA 3QF0A 4DBDA 4EP8C 4UQBA 1L6YA 3JS3A 3A5FA 3UYIA 3E2QA 3KRBA 2CZ5A 3P5ZA 1L6GA 1S2AA 3NDZA 3AJXA 1UR8A 3WNLA 3SUWA 3MU7A 5AOUA 3SUSA 1LWJA 4LANA 4L80A 4MNMA 2J9YA 2JKAA 3AFBA 3IVTA 4EPKA 3HV8A 3PPFA 5BOOA 1GG1A 1S5TA 1W8GA 1AJ0A 3OGVA 3QHOA 4A4AA 5AVHA 3W2UA 2DT2A 4ZFCA 3LTPA 4LS1A 4GIEA 4QJ5B 4NL1A 4EPEC 2B0MA 1P6CA 3WK1A 4DJDC 1M5WA 3HURA 3PJXA 1KFKA 2VGBA 5I0DA 4G2DA 3CK5A 3UR7A 4V1XA 4B5SA 2TODA 1Z9AA 2C71A 3CMFA 3T2OA 1IEIA 4ZQOA 4U4MA 3QHNA 1L2UA 2VCCA 4N9EA 4GIRA 4MUZA 2OWCA 2V3GA 3VD4A 2HS8A 4H6QA 3V4BA 4DY1A 3MY9A 3ZJKA 2VC9A 3PZQA 4GO9A 3VKKA 1GORA 2E6FA 2WNQA 3FW6A 5GVJA 1OYCA 1FWAC 4HBKA 3L4TA 3W85A 3BQ5A 1M9HA 4LQ1A 3S6TA 4XZIA 1R7AA 1U1UA 2VUYA 2YDSA 3ZR6A 4WR3A 4GISA 2ZRWA 3IJ6A 1SO4A 1DEDA 3BDKA 1UQYA 4PMOA 4GD0A 5BWFA 4UTKA 3AMKA 1PTAA 1J8VA 2QHAA 4FNUA 1W3IA 2YKKA 3CZLA 3U2CA 3LD5A 1XYBA 1RBOB 3E9AA 4YIWA 1QI3A 4GH1A 4R9OA 3ID7A 4UTTC 4CU6A 3OYZA 4YN5A 2YDRA 3OO2A 2D2GA 4BA0A 4HD5A 5M2FX 1SSGA 4KKXA 1BYAA 3V1HA 5G4HC 3WUEA 4PEKA 4C6BA 3GIPA 4NYYA 3K13A 4PMUA 3CL6A 1PHQA 5EYWA 3ZWTA 1PO9A 2XM1A 3WMSA 5KEZA 3D0CA 5ENLA 1UUMA 2VVSA 2WVSA 2INEA 4F40A 1VLIA 3NEHA 4ZSTA 2GGGA 4PUDA 2Y6ZA 4MLJA 1Q4WA 1I2RA 3DBPA 1S1PA 4TVCA 2Q8XA 2HV5A 1F6YA 1NM9A 2V5CA 5F2GA 4HSOA 2IKGA 3AICA 3ZSSA 3LK6A 4IMFA 3B97A 3QM3A 2CXGA 5CJNA 3OW1A 2IPGA 5BCAA 5H8MA 1WZLA 4R34A 1UR2A 3V18A 3G1DA 1CXEA 2H9AB 1LRQA 2XJ7A 2Z27A 1W3HA 4IWWA 3RILA 3ANVA 5JIWA 1K77A 1LL7A 3OLIA 4B16A 1GWJA 3QR1A 4N7QA 2EPMX 2PTXA 2FPTA 4CNSA 3GY1A 4M7TA 1W54A 3GC5A 4HZMA 4EIVA 1EO7A 2EJ1A 4ATLA 3S9ZA 5AHEA 1G94A 1YBQA 2WNWA 2ZZ6A 3N2MA 1H5YA 3LZ3A 3FN9A 4BF7A 3ITTA 4DWSD 2AKZA 5CZKA 1QI2A 3PWIA 3CWOX 1AJZA 3NSXA 4JTRA 1VR6A 2V5LA 3SY5A 3S5YA 3NG3A 1XUZA 4WKAA 4XAPA 3PAJA 1E55A 1XIIA 1B5TA 1DHPA 4O53A 4NYUA 1FCUA 1FDZA 3P82A 1Y5XA 1W9XA 3OLEA 4LAKA 1HO1A 5M1TA 5FJIA 5IBXA 3NIYA 3CH0A 5G2IA 3CTTA 2V68A 2Z29A 3ARSA 4K3ZA 2Y85A 1SJAA 2Y1HA 3A3HA 4CU8A 3T4WA 2OZ3A 2XWDA 2C18A 1XL9A 4PTXA 2R14A 3MYPA 2E68A 5HULA 4O0KA 4JN6A 4R27A 4FI4A 2JKPA 3FCPA 4Z2JA 4M81A 3W24A 1JDAA 2BB0A 4BCEA 4TR9A 4E4FA 1JG9A 2F2KA 1GUVA 1UIPA 1GOXA 1SR9A 3P61A 3STCA 4GVIA 3CPUA 3CQKA 1H2JA 3BW3A 3GIYA 3R0KA 4TMBA 2DORA 3T42A 1F4HA 2GUBA 3EDFA 5CG0A 4PUEA 2D0HA 1NDWA 4QE1A 2AAAA 4DBUA 1VH7A 3RX4A 4P7OA 5I06A 3SBFA 2CIPA 3G0UA 3W75A 3M0JA 1QW9A 3UNTA 4EOUA 1T99A 3G1VA 4O12A 1UJPA 4LBUA 4K38A 2J9ZA 1EUAA 3WQ5A 1QO5A 3L23A 3SCUA 1R9ZA 3M07A 3QQWA 4AH7A 4F2BA 3IEBA 3GAKA 3PM6A 1L9WA 4WVXA 1BVZA 1ZBVA 3W7RA 3ISIX 3TAKA 3EXSA 4R33A 5BZAA 5DCDA 1JQXA 3KOYA 3SN4A 4ZQCA 4PUUA 4QM1A 4GKLA 3SJNA 1EXPA 3WDIA 2P88A 4UFMA 4IGSA 1HIZA 3VAVA 1SJCA 2FYMA 2NT1A 2J7FA 1QNPA 3DAQA 1QO2A 1DTUA 4A3YA 2DSWA 1DXFA 3ATZA 5B7YA 2D0GA 1O1HA 4AHQA 5FL0A 1Y8BA 2CETA 3HJEA 2E28A 1TG7A 1CGWA 2E1DA 3VIPA 1CT5A 3WMCA 1I2NA 1JNEA 3SCQA 2WBKA 3UGVA 5EPDA 3MSGA 1R85A 4Z17A 4HK7A 4X9YA 1TJPA 1AZ1A 1HL8A 3Q4DA 1YXDA 4KGJA 1LLOA 3KTCA 3EMQA 5FA5A 4AUBA 2FHFA 4JTUA 1V6UA 1WDDA 4XO6A 3BW4A 1XLKA 4MG4A 5DMNA 2PD5A 4Y8FA 2XSBA 3XISA 2YCIX 6ENLA 3TIMA 3PBGA 3EPNA 1Q5MA 3SN1A 2X1RA 1JYWA 2J75A 3G3MA 1OGSA 3C52A 4QQ3A 1JD9A 1WDPA 1YTDA 3IVUA 2HE8A 2J4GA 4M0XA 1J0YA 2E8ZA 3CMJA 1KCKA 2OEJA 1F6KA 3VILA 1RLCL 4JIRA 3INPA 1KM0A 3W82A 4JX6A 4Z08A 3PP7A 1FY6A 1JZ8A 3C2YA 2A5HA 1CDGA 3PULA 1GT8A 4L4OA 3PG8A 2FVLA 4RR4A 2PP0A 4HTYA 3NM3A 2JIWA 4LVGA 3FY1A 4I7WA 1QI5A 4S3AA 1NP0A 4U33A 5FJOA 3NPWA 2VT0A 4C1NA 1FHLA 1MZRA 4I5XA 3U57A 2H6RA 1C9WA 2AAMA 2OU4A 3GVQA 1OADA 4L65A 4REQA 3TJ4A 2QAFA 4C6PA 1EBGA 1ZJBA 4JHOA 3THCA 4ATDA 3PUOA 2OT0A 1O4UA 3G6MA 1TA3A 4S39A 5HQLA 4UBPC 3UU0A 1JZ2A 4C7GA 1M53A 4IXHA 4M29A 4FF7A 5TD4A 1CLXA 3LQLA 2R94A 1KGXA 3GU9A 3W83A 3W1RA 3B9EA 3NOEA 3S0CA 1EZ2A 1HNYA 1LCOA 4PC8A 1OX6A 3PK7A 2XN2A 3CT7A 1EX5A 1FWTA 3ZVHB 1A3WA 5C9XA 3C86A 2OO6A 4PRTA 1X1ZA 4LNYA 3U2EA 2G41A 2NWSA 1UWUA 2OEMA 3SDOA 3GRIA 1GTEA 4HU3A 5I00A 4D8LA 2QCDB 1E9LA 1YADA 1XUUA 1EWEA 1BWLA 3GTHA 4IIBA 4QG9A 4XIMA 1IEWA 3ARZA 3NGFA 2Z25A 1AQ0A 3BJFA 4X3ZA 3FJNA 4KRZA 5KZMA 4CVUA 1GJWA 1HQTA 1ZLPA 3HB9A 4J3VA 5CC3A 4HMCA 1OFOA 4KCTA 3OG3A 1XYCA 5H6HA 2NZLA 1D8CA 1LBLA 1X38A 1VFTA 1LTDA 4V28A 1OC7A 2C1HA 3S46A 3PWAA 2Z7GA 1TPH1 1DXIA 3BW2A 1KRAC 3WLTA 2R1LA 4J27A 2Y62A 3UZJA 4QQUA 2W66A 1VBGA 2O4MA 3EA3A 2I56A 3OZPA 3DG6A 2V5BA 1OZMA 3APYA 1U1JA 4UQCA 4E4UA 4JQAA 2BNJA 6XIMA 1DJWA 3OQEA 1RVKA 4IPPA 3GBDA 2D23A 2V69A 3U5UA 2ZZ3A 3D47A 3NPVA 1G69A 2EKGA 3HOJA 4GGBA 1LF1A 4NF7A 4ZOEA 4GX8A 4F0LA 3HQOA 3I3DA 4LCSA 1JCYA 1FWJC 5TQLA 4LV9A 2GQAA 2XVKA 3TNOA 1LWIA 2POTA 3HGRA 2BVTA 3UVIA 1FP8A 3NQVA 3H8AA 1LOSA 4HZ6A 3WNNA 1JZ4A 1DOSA 2PF8A 1I2PA 4AZIA 4HNNA 1JULA 4H3DA 4U28A 4KETA 3DFPA 5C2GA 4PBEA 4D1IA 1GQLA 3N18A 5DCEA 2XFRA 3GHSA 1J9YA 4IFOA 5IXEA 2OG9A 2IKIA 1XS2A 3V35A 2R8WA 4AG0A 7PTDA 4LNCA 1D8WA 1I1XA 2B31A 1TMLA 3JUGA 3AI0A 2TPSA 2ZX7A 2IUZA 3BLKA 4ONVA 1KTCA 4HQVA 5CBJA 1I0BA 2QJHA 3T05A 4NZJA 3B4YA 3IWPA 1CXLA 2J13A 3LB0A 2CLKA 1TPUA 4WUIA 4M80A 3CZJA 4PCTA 3Q94A 2C7FA 3AIEA 1PDZA 3HG3A 3TQ0A 3EX4A 1D3CA 3MI2A 3TLLA 3JZEA 4US5D 3HPFA 3W87A 3LNPA 1R8LA 1JD7A 4FXJA 1X8FA 3DENA 4NXSA 3MCOA 1FWSA 2DGAA 4UR8A 1UHVA 1BRLA 1SJBA 2IXVA 4CNPA 2J77A 4E8DA 4IJRA 1A5BA 1YQ2A 1GNXA 3C56A 2ZVRA 4PFMA 5HATA 4L56A 3URBA 4P8UA 4B2DD 3BH4A 3R89A 4N9DA 3W7GA 2XH2A 3AZSA 3UR5A 2HDJA 2WB5A 1K70A 1Z44A 3C6CA 3TR9A 5HBFA 2BASA 2PDXA 1YPXA 2BOEX 4LC6A 4XAYA 1RCOB 5XIAA 1OINA 2G37A 3T0DA 3RLVA 1ADOA 1ICQA 1YPFA 3LBCA 2W63A 1CEOA 1I75A 1W9DM 3E2RA 3U4FA 3KRSA 3CAKA 4O18A 1I2QA 1TWDA 1Q8JA 5ABTA 4GLEA 3RAOA 4DJFD 3Q58A 3L7RA 3O2LA 1P1MA 1MRAA 5I2UA 3VD3A 4PZVA 2QIWA 2QEZA 5I3GA 3OLDA 1AJ2A 1N55A 2BOGX 4EF9A 2VMFA 4NZ1A 2IQTA 5DXXA 1AUSL 1EFZA 1ZTVA 1QHOA 3NQFA 5IOBA 3EZ4A 4S3BA 3AISA 1KV8A 1VRDA 2V67A 5CBIA 1JVNA 3W7PA 3BANA 1UKPA 4U10A 4Y8EA 2EO7A 2MANA 4YHGA 1BG9A 1K6AA 3NL5A 4Y2WA 4DVOA 1C8YA 4XVEA 1TCDA 4GMEA 1JZ6A 3LOTA 1BAGA 1UZDA 2FDMA 4K8EA 4YJ5A 5DMLA 4QNWA 3ICJA 4AF0B 1AH3A 1E56A 3KL0A 3NVTA 2NX3A 2GWNA 5AHMA 3SGGA 1VFOA 4QEHA 2E09A 4TX6A 1XIFA 1FWRA 5A6SA 4CNOA 3ZZ1A 3U7VA 3RR1A 4NT0A 2ZZ2A 2DZPA 2VGIA 1DIOA 2WJEA 1HKMA 2VZUA 2TRSA 3OBEA 1XQLA 1AQHA 1F73A 2OMAA 2B81A 4UCFA 1AODA 4N6EA 1YE4A 1HJWA 1B3ZA 4IPLA 1TPEA 5I3DA 1XRVA 3HPXA 1FHDA 1KCXA 1UJQA 1H51A 1UCWA 5HQMA 2V5DA 1C29A 4FR6A 4LUSA 1EWDA 3U4AA 3ABQA 4ZQNA 2WW5A 2IKHA 2Z1VA 3H70A 1H7RA 4JNYA 3GXIA 2I57A 3N15A 3MO7A 4XBJA 1U5VA 3RR4A 4OTKA 2YLAA 3MWAA 2X2YA 3L4ZA 2XPKA 2Q3OA 2HZGA 4B4HA 3LA4A 3WFLA 3LGDA 4KBXA 4DBWA 1QPKA 3VDBA 4FLSA 5DF0A 4HZ7A 1TV4A 1MDRA 2R1MA 3POCA 3EX1A 4PODA 2VWSA 1R3TA 4CN4A 1U5JA 3MUCA 5JBDA 3O9NA 3N1AA 2TMDA 2YB4A 3V16A 3UYCA 1MXSA 3EXRA 3GAYA 1REQB 4O1EA 4KH2A 1ZGDA 3S47A 3B04A 4GQGA 4KT2A 4WF7A 2WVVA 4OBRA 4ASTA 1DYSA 1WDRA 4JTCA 2CBUA 4IQJA 1HTIA 2VWTA 4AY8A 3CASA 2BHYA 3QV6A 4L9ZA 3ME3A 5GQBA 2CBVA 4GE8A 1LL6A 2B7QA 3CYJA 3THDA 5LKYA 3R10A 4YHEA 1EC7A 1GTHA 2Q8ZA 1WKYA 1E0VA 2XVPA 4UMAA 3QZ6A 1J12A 4DAIA 2E6AA 3GHUA 3W4RA 2Y70A 2BFGA 4JICA 4GC3A 2GVYA 5EMLA 4JEJA 1V6WA 2ZRZA 4L9XA 2FJUB 4ENLA 1NWRA 3O7UA 4DWSC 3OHIA 2X42A 3K2GA 1MUMA 2VD9A 4QTGA 2CHOA 1J0KA 5JH1A 3VM7A 4ZL1A 4D8ZA 1F3TA 1H7WA 3QPZA 2PDIA 3KVJA 3KCOA 3FHQA 4R7OA 3W26A 1QRQA 3PZGA 4LF2A 3N3TA 3RX3A 5BRBA 1CXHA 1XG3A 3B8WA 4N0RA 3TYUA 1CXFA 1MYRA 4DXVA 4JEQA 4PCPA 1DJGA 1GYMA 5I6SA 1WAWA 3N2TA 2O9OA 1AZ2A 3E02A 3AXKA 2XIMA 4MB3A 4DXXA 5G4EA 3A64A 4FHAA 2W79A 1GGOA 2DZTA 4NU7A 2QCMA 2RDTA 3IIVA 4PGLA 5D37A 4OV4A 3W74A 1VPYA 4D6CA 3R8GA 5LSMA 2NUYA 4C6JA 3QBUA 3MWCA 3E12A 1UBSA 2J27A 1E0XA 3MO4A 4B5WA 2G3NA 2V81A 3ITYA 5G1MA 3KDOA 1TR1A 4GZ7A 2ABBA 1U22A 3CUJA 4OT7A 2ZKMX 2JIEA 5T9BG 3L66A 3REQA 4LCRA 1ZNNA 1NWTA 1EO5A 1B9ZA 1JPIA 3LHYA 5A6TC 4OHQA 5A6JA 4KFOA 4Q8UA 4A3UA 4GBDA 3VU2A 2PLCA 3ARYA 3UXLA 3EA2A 3D46A 5I5RA 5GNYA 1PYFA 2A7NA 5A2BA 5CEWA 1XV8A 4JTQA 1XDJA 3BARA 3AOFA 1YKWA 5EKYA 2OZ8A 2GJXA 3WH6A 4Y9PA 1DIKA 3SRKA 1KWKA 5G2HA 4WOZA 3CZKA 3VE9A 4KMQA 1UP2A 4GZJA 4DF1A 3AIRA 1WYIA 1OHLA 3H2MA 4BWLA 2YZ5A 1JDDA 3T8QA 1H11A 5E5CA 5CH9A 3NQDA 3UWQA 5A8GA 1JDFA 1SZFA 4UZSA 3IANA 1OGGA 4XZLX 2FJKA 3B8IA 3F4VA 5HMDA 4DJFA 5AECA 1TO3A 3S2NA 3HQPA 4JD4A 4Z42C 3GKFA 1Q4NX 1MZHA 4X0VA 5A69A 1K4HA 1VQTA 2X7WA 3C2EA 3N6HA 4ORMA 3PBYA 3S2CA 1A5NC 1CX9A 2QLYA 2G97A 1NOWA 1AQFA 3W2NA 2CHRA 1XLJA 4DF0A 1AL7A 3RHGA 2WC4A 5I02A 5HXMA 3TJLA 2ZYFA 3DI1A 2EG8A 2NT0A 4KWWA 1C7SA 5CSRA 3H2CA 2A3AA 3MP5A 4E38A 1OGBA 5SWUA 4X60A 1I2OA 3QC0A 4GIYA 3T0TA 5C2CA 1KW1A 4G5DA 1NJJA 5DMMA 2QW5A 2NVCA 2HTMA 2AGTA 3PNUA 4S3CA 1KXHA 1QOXA 3NQ8A 2QCLA 3KOXA 5RUBA 2NX9A 1FWDC 2AL2B 1R6WA 3DG7A 1XYFA 3E5PA 3MSDA 4KGLA 4H8UA 1SW3A 4ES4A 5DBTA 3KW3A 1Q6CA 2X1SA 1KM6A 2AL1A 1YW1A 3G8RA 3I7QA 5D2TA 1GW9A 3F2BA 4MWAB 4QG8A 6REQB 2ZA1A 4HPGA 3FDGA 2Y8VA 4GQRA 3QC3A 4FNQA 1MUWA 3V0UA 4MJ4A 3WKZA 2GLKA 3BZGA 1XIGA 4AZBA 2H9AA 1IWAA 3W0KA 4MDOA 4AD1A 1GKRA 3B8UA 5FJUA 4UQDA 1GOIA 2WQDA 4JNMA 3RG6A 1XP3A 3TJXA 3FYOA 5A5WA 5AC8A 2OQHA 3IUDA 4K7VA 1LG2A 1VHCA 3H2NA 5H91A 5HWJA 1V6TA 3TEVA 1LQAA 5DY2A 3CXOA 3NZPA 3HGSA 1WQ5A 4PCNA 4DM2A 2VGGA 3PZ9A 1Q2SA 3GU2A 3N2OA 3WZ0E 2ZOXA 2GUYA 4RUBA 4AW7A 4W89A 1QPOA 4IMGA 3W1UA 3TYEA 3SSZA 3GXPA 2C15A 1VIWA 2Z00A 3RUBL 3KAOA 3S6DA 2VX5A 1RJPA 2VQTA 1QWGA 1E0TA 1EL3A 2ISWA 5HAOA 2CLPA 1Q6EA 3PPHA 4XUGA 1VPQA 4OBSA 1E51A 4ZCWA 3CAWA 4IPJA 4DJED 2V0TA 1R86A 1Y5WA 2YL9A 3WBAA 3UNDA 2ZA3A 2WMFA 4BI6A 1LQ2A 5JUVA 4UUIA 2NVDA 3SQLA 2G3MA 4W88A 1H50A 1S46A 2FH6A 4GZEA 4K2SA 1ZBCA 2X7VA 1SFSA 3A23A 1L2QA 1G4EA 1UYQA 2FMNA 5AC5A 2XIIA 1J2BA 4IIEA 1R3YA 3RLHA 1A49A 2YA0A 3ARPA 3E3HA 3RLUA 3BG3A 2G95A 1PS9A 3LX9A 3RNDA 3B9AA 2ZX9A 1EYEA 3ENLA 2MNRA 2QIIA 1M3UA 2YL5A 4PMJA 4PMVA 1MW0A 1E9YB 4FR1A 1DPMA 4QIUA 2WZMA 5H8PA 4UFIA 1MSSA 2HXUA 1BWKA 3KOFA 2QZRA 2W6RA 5D33A 1FUYA 3RO6A 3ABOA 1VCVA 2C0AA 3G1YA 4LX4A 1R3SA 3Q2DA 9XIMA 1V77A 2FPVA 2VCBA 5IM51 1YNQA 4K36A 3EYPA 4Q4SA 4IMEA 1IXOA 1HJUA 2QT3A 4E2BA 4M1RA 1DHKA 1FP9A 2WPGA 4NY2A 1RJQA 1R2SA 3KBNA 2PDQA 3APGA 5DFAA 4W7UA 1JGMA 1B54A 4GYFA 5D8ZA 1M1BA 3OZYA 1KM3A 4IQDA 1WA3A 2EAWA 2CLIA 5D9OA 4O1CA 1W1A1 2VEKA 3WD4A 3FXYA 3UWYA 1QNOA 3TYAA 1ENUA 4FXFA 5TIMA 5EFFA 2XZ9A 4HJFA 3OYXA 4HK5A 1JZ3A 1VB9A 2DZVA 4IGNA 3IRSA 4HN8A 3WL1A 5K2ZA 4WY0B 1O94A 4Q8NA 3GW0A 4DLFA 3FJ6A 4O16A 3GW3A 3FAXA 5I77A 5BYWA 2HNEA 3LCIA 3IJQA 4WEVX 1ALDA 4LRTA 3OJGA 5LIYX 3CT2A 3G1FA 5I79A 4DZIA 4PMZA 3C2RA 3VKDA 1A3HA 4ORIA 3TE9A 1F2JA 1TX2A 2PDPA 4W8AA 1E6ZA 3ITGA 3I6RA 3BO9A 5C9ZA 2OLAA 4FLRA 3QW4B 4NNCA 3M5XA 3DFYA 5E9XA 4MMWA 3GE7A 1XM3A 1LYXA 5AYIA 2PUZA 2PC4A 2Q8LA 1P48A 2XUCA 3B8DA 3AIQA 3LBMA 4I3GA 1TJRA 3ALGA 4NX5A 4PB4A 4XZWA 4PUJA 5K3VA 5AY7A 4O1DA 4EACA 2VEFA 3BQ6A 5KZDA 3V1PA 3B4UA 3EB2A 4DBSA 5XINA 3GZAA 2BGQA 4BWLC 2VRKA 4FZIA 3W25A 3IACA 2NQ9A 4OZOA 3WBEA 1BLIA 3A4AA 4HHMA 3LRMA 4YVPA 4ZA0A 2OLSA 4F48A 1I45A 2OKOA 4HOXA 3KFTA 1VJZA 3UG5A 3V5CA 4DJFC 4I8YA 2PGRA 2NV1A 1H7PA 1X98A 1R46A 3H12A 2JBMA 1KM2A 4NZFA 4IISA 3A9BA 3N12A 5CSUA 3AS1A 4HYVA 1UUOA 3P8JA 3O6YX 1LUCB 3KVKA 2DP3A 3I7RA 4ERGA 3DECA 4HHLA 2EF9A 3MUAA 4MB4A 4JX5A 5DRCA 3BURA 3M1ZA 4CQCA 1WDSA 5BU9A 3NQCA 3SEPA 1F61A 3WQPA 2CLMA 4GNVA 4RXGA 3DXIA 2ZE0A 3MJYA 4KWUA 3T8LA 2NV9A 3V75A 1A4MA 2W62A 5FEZA 2G4FA 2QCDA 3FGCB 3URAA 3Q45A 3LV5A 4PB3A 1PIFA 3GVWA 1A5CA 2GGEA 2FLIA 4HPJA 4QAWA 3GXTA 5CG7A 2E9LA 1F3WA 5FF3A 3K1GA 2BXVA 5F4SA 2P53A 1E43A 3W84A 4DNMA 1M03A 3LSCA 3GYEA 1S38A 2IMRA 4KCWA 2DT0A 2E4TA 3QKEA 4X2RA 4DYJA 3B9NA 1LT8A 5ECVA 7REQA 3H2OA 3VGGA 5FI8A 2HE5A 2YDAA 3N6JA 1HN1A 2ZA2A 2DVUA 2BZNA 1EEXA 3U48A 3LPPA 1NEYA 3FVMA 2DIKA 2RDWA 8XIMA 1TR9A 1JCMP 1UIOA 5AC6A 1Q6RA 1ZAHA 2C6QA 2PLKA 4IJCA 3KL5A 2F6UA 1TV8A 2NX1A 2OEKA 3OPSA 4J3UA 1AW1A 4H7CA 4JTTA 2YXGA 4ZB5A 4U3AA 3URNA 3GTNA 1X97A 1FCVA 2VUNA 4MAVA 3WLLA 4PUWA 3A47A 2DUZA 4JPGA 3TYDA 3NNTA 4DJEA 4FLQA 3W7OA 1KWGA 1W56A 3T81A 2DZUA 1OX4B 1EHAA 3LLDA 1BFNA 4Y7EA 1W1B1 4N4PA 5E0CA 4O0QA 3FYPA 1EUNA 4YMZA 5HOSA 5CXPA 1W8SA 4QEEA 3NO1A 3KWSA 1PYMA 4CGTA 1XLHA 4C5YA 4KWOA 3CEUA 2Y7EA 3IVSA 4IL2A 3VDGA 1XKJA 5HQEA 3IGXA 1JXJA 4KWVA 2A3EA 1ISXA 1ZALA 5CGTA 3NQ6A 2J8FA 1XRFA 1UZHA 5HJLA 2WK2A 4DYEA 2GJNA 1KB3A 5A6LA 5FEXA 3TK7A 3VCRA 3E0FA 4TOQA 2WANA 2DUAA 4HGXA 1EA9C 4NRRA 1M68A 1K03A 3WF4A 2OSYA 1XLLA 3PTKA 1AD4A 3CWNA 3TA9A 1AG1O 3A6OA 4QROA 4AYGA 1P6WA 3R2GA 4UTHA 2D22A 3MMDA 5EBAA 3K8LA 4UFLA 1M6JA 4Z1CA 1A5KC 3MVIA 1UPMB 3WQWA 4IP5A 4JIEA 2CPUA 3CQ0A 4M19A 1IYXA 3GB6A 2XIQA 5HA7A 2GOKA 4FA3A 2QVHA 1YXCA 1JAKA 4GYJA 5FESA 7TIMA 1MO0A 3L67A 5HR6A 1UBPC 3ZSTA 4C6KA 3SQSA 5AZ1A 4O4VA 3U3HA 3TKFA 4CCEA 1OK4A 2DPEA 1W1PA 4QISA 1JUBA 3HG2A 3SW6A 5D9PA 4AXNA 2YX0A 1OM0A 2J8GA 4JQ3A 5FF4A 4B5VA 3BV4A 2O4QA 1EEPA 1XLCA 4WIWA 5T8GA 1Q6FA 3GTFA 5MKGB 3EWWA 4GWEA 3WYZA 3KBSA 4IHCA 3U2ZA 3MV11 4PMNA 1JPKA 4HA3A 4YVVA 4HHPA 2BDQA 3BAXA 3TN6A 3BJSA 2WNNA 4GGHA 3VX1A 4BJHA 3GKAA 3FHAA 4TTUA 2FHCA 4AIOA 2IQ0A 3LXCA 3EXTA 3STEA 3WMLA 4WLCA 1QUMA 4CVWA 2NLYA 1PKNA 5LZLA 4YTRA 3BZJA 1HKKA 1RK5A 2HMCA 3VOCA 3W7HA 2HK1A 4CEUC 3FS2A 3NGJA 3PFMA 3VZXA 4DM1A 1O66A 2Q09A 2YL8A 1Z7AA 3B0XA 1WPCA 4I9AA 2SFPA 3KEHA 1WP6A 1MQRA 1UOKA 3R58A 2ZRYA 5E0FA 2PDYA 3MW7A 4N02A 1OWQA 5H1WA 3EMCA 2P3EA 2ZWYA 4TMCA 4PYSA 4EANA 3AZRA 2BY2A 4FNSA 4WY0F 4HMDA 5FCZA 2ZUSA 1ZJAA 2FZ9A 1ICPA 3QXBA 5K9DA 1JZ7A 1VD6A 4XQ6A 7A3HA 2BOFX 4BQ3A 2E5CA 3QVQA 1TQJA 4O8AA 1FWGC 5H8UA 3T4CA 2NXIA 3CAVA 4JCMA 5BOFA 4HP5A 4S3JA 4KEVA 1ZAIA 4LVBA 3W7IA 4GUJA 1P0NA 4GBUA 5DMYA 2VP8A 1HKIA 1W3KA 4UOQA 2X1IA 4MKSA 3VNDA 4PCSA 2PDHA 4NVTA 4FALA 4IG2B 3L0KA 4ZGYA 3TZFA 4GCXA 2ZX5A 3QV9A 3MZNA 3UT0A 2PDJA 4CNNA 4CLMA 5IHRA 4GX9A 1T7LA 3T09A 3EDEA 3T6CA 5A6BD 3M7SA 2XN0A 4FXRA 1X6LA 3UESA 2CU0A 4INFA 1KKRA 5A2AA 3SM0A 2PWUA 3NPUA 4JN7A 4OBTA 3LS9A 3F5JA 1X6NA 3KXQA 4UQEA 5EFDA 1REQA 1H1NA 2WBGA 4OJYA 2DSKA 1HJVA 1XG4A 3G3DA 4NZCA 2BGSA 2O0TA 3PBVA 4FNRA 1Q63A 2OZ0A 2BSLA 5CPQA 3ITVA 3F5LA 1XH0A 3H23A 1ITXA 2WYSA 4C1LA 3VNIA 1VJSA 2XGZA 1UC5A 4R85A 5HUPA 1J0HA 1H41A 1PTGA 4PBGA 1WOBA 4J35A 2IPJA 1R47A 4Z2KA 4H19A 3PTQA 2V5KA 4NIRA 1ZHAA 2UWFA 1SFJA 1KBIA 2P8BA 1DKWA 1V4YA 1EX1A 4Z1BA 3BK0A 1OFBA 4MSSA 3VNKA 2QDHA 3GNDA 4JQ4A 2INZA 1MNSA 2J88A 1HP5A 4GJIA 4XZ9A 3C2OA 4PCFA 1K7XA 2WZHA 3VIIA 1XLDA 2E9BA 2NQHA 3BSGA 3BJTA 3AU6A 1WB0A 3EX6A 4C6DA 3W2KA 3CV6A 1VFSA 3LCLA 4XISA 1JFHA 1H0IA 4Q4MA 1VKFA 6ALDA 1TMHA 2CLHA 1W5NA 3EWUA 2PWFA 3B0PA 5D2YA 3PB2A 4DJEC 3AMGA 1Q2RA 3VMNA 2ZUUA 3SFWA 1GVSA 4JDBA 2QAPA 3TP4A 3CMGA 1V0MA 1B3VA 2VC7A 1XGEA 3W9ZA 2OSWA 3DERA 1U2YA 4GACA 4HPNA 3BOLA 1W91A 3EOSA 4ZEPA 3TV8A 2A3CA 2Z28A 2ZE3A 4GK8A 2PRHA 3BSMA 1K1DA 5B7ZA 1ELSA 3M0IA 3P93A 2QCNA 3PTDA 1PZ2A 3MMTA 4ZO7A 1A3XA 1UB3A 4XAZA 3PJUA 1E71M 4Q4OA 4LYPA 3CO4A 1DIEA 3NYDA 3ARUA 3T0CA 4U2ZA 2XH4A 3WDRA 1TPDA 3DFHA 2Y8KA 3IGSA 1J6PA 3AWNA 1ZUAX 1VF8A 4F79A 4B3LA 1PWMA 1DWAM 2FTYA 5CBBA 3QV8A 3B05A 3ZLHA 2BWGA 1SFLA 5C2XA 2OGYA 2ZDRA 3CJPA 2AMGA 4DPPA 2E67A 3LDVA 1F5ZA 4QE5A 1DQUA 1NDYA 1FWEC 2PU0A 4HNCA 4YWIA 3PBUA 3GR7A 3W88A 4E4PA 1ZS2A 5GNZA 9RUBA 5I3KA 4MPKA 1QJWA 2PBOA 1A53A 3PHAA 4MZYA 1HJSA 4HYRA 1QWKA 1BKHA 1XDLA 4JIPA 1DWHM 3GU1A 4W5ZA 1OK6A 1PE1A 2F84A 3QYSA 4IUGA 1VJIA 1KFLA 2C79A 4ILSA 4U5IA 1JPDX 4H6KA 3RDKA 2ACRA 3RJXA 1J0ZA 3GK0A 2FFIA 3WK0A 4Q33A 2WVTA 4QRNA 2WNZA 1ZQ5A 3N4FA 1W0MA 5DEZA 4W5UA 1RALA 1B9BA 4JAWA 3RU8X 4FOKA 5TNVA 1G5AA 1P0KA 5JXQA 1QPRA 1ZSXA 3BLEA 4AZCB 1SO6A 1XW8A 1OF8A 2E5DA 1ESWA 3MZ2A 1F6PA 3TOYA 3QEZA 4HPXA 4BR1A 2XVGA 3EEGA 1VYRA 4AC1X 4L6OA 1QBBA 4IFRA 1XCWA 3BICA 2AL2A 4XBKA 1ZAJA 5HK4A 1RCQA 3AS0A 2P10A 3WCZA 3WJYA 1GZ1A 1SZRA 3LNMA 1UKOA 5K4ZA 4CQBA 3KL3A 3RCYA 3VVGA 1HJQA 1HL9A 3QR3A 4C7DA 4D1JA 3W86A 1LRNA 2D2HA 4ZQPA 4ACZA 5EMYA 2PU1A 3U0HA 4K7YA 1TV5A 4MJMA 6REQA 4BEUA 2EBNA 2VQUA 1JRCA 2FIQA 3C2VA 1RY8A 4M6PA 4MTVA 5JMUA 1EJTC 2HQAA 2O7SA 3GTIA 2IW0A 1CECA 1RH9A 3KHDA 3SGZA 3TZNA 1MRQA 3AXHA 4NAFA 4Y9OA 1VHNA 1GG0A 4WK9A 2XU2A 3W1TA 3F4NA 1B4KA 4ZE4A 2QF7A 2PCQA 4MKNA 1VFHA 5D2WA 1P0EA 1W9VA 3GXNA 1Q7QA 4JTHA 1XPYA 2VHLA 2ACUA 4HVXA 1FH8A 1XXXA 4O1AA 2ZQ0A 4J28A 1VFLA 2A3BA 4XAFA 5EB8A 1XH1A 1V02E 4JYDA 4O10A 4PMXA 4RKAA 4JFSA 1KXTA 1QHZA 2E8YA 1XGDA 1OCJA 1LT7A 1VYSX 3NTYA 3I7SA 4BZYA 4WKHA 1TE6A 1RPKA 3LEPA 2JF6A 1BXCA 3G77A 3JU2A 5EMMA 1N7KA 4AHPA 3WQDA 5KZ6A 4H2HA 1HVQA 1XQKA 5T91A 3E5BA 1GYLA 3KP0A 2CBIA 3UWEA 2BV9A 2ISVA 4V2XA 5I03A 4QITA 1UA7A 3U6WA 4H2CA 1ZCCA 3W7DA 1I1WA 1SZNA 3MKKA 3EWCA 2PLMA 3H53A 4H9VA 1S2CA 3OODA 2R1PA 2GOUA 3M44A 1W3LA 3LXBA 3Q65A 1K9DA 3XIMA 5AFDA 4S3DA 3GG7A 2Q71A 2X1TA 1CXKA 3W1NA 3QY6A 1RBLA 4JTJA 2HS6A 4PBFA 3V0SA 3LPFA 3LHVA 1ZZMA 1F76A 3F5KA 1UKTA 4V1YA 3WY1A 3B06A 1XBXA 1QT1A 4LEQA 3ARRA 4B15A 3VYLA 5BXTA 1WZMA 5GJPA 4XSMA 1H0GA 3ES8A 4DUOA 5PTDA 2OT1A 4AMAA 3OHMB 1XX1A 3RF9A 3TROA 4L1GA 3EMZA 3LRLA 1LP6A 1G4SA 3DESA 3VKJA 4NUWA 5FD0A 4RDWA 1W32A 1K7FA 3WF0A 4YYCA 3GVRA 2QUMA 4MNKA 3EWDA 2V38A 3JVAA 4H9YA 4XD3A 2FKPA 2FVKA 3GWQA 1C9DA 1B31A 2PGFA 4M3PA 3NWRA 1JF6A 3BG5A 3HJZA 2BVWA 2EPLX 3PNZA 3EPMA 3WJZA 1O5RA 3QFEA 1Q6LA 3UWUA 3PS7A 1S3HA 2IQDA 3UA4A 4GQQA 3VO0A 1QNSA 4Z2HA 3QOMA 1BSIA 4NI3A 4EWJA 3HO8A 1UOZA 3KOWA 1EJWC 1LDCA 3G1SA 4KIEA 4IPNB 2QMJA 3ABRA 3NQAA 1I9CB 3UJSA 2A7PA 4NJGA 5CPSA 4AB4A 4J3TA 3P80A 3W37A 5CC7A 5LXEA 5D2XA 1C90A 1KRBC 3NM1A 3RN6A 3MSRA 3LI1A 4XZNX 3GG0A 5G1TA 4PTDA 3RM4A 3M47A 2QJJA 6XIAA 3E0LA 1RY0A 2FH8A 2OKTA 2WCAA 4AFYA 3E0VA 1OC6A 2FB2A 4LYRA 1R3RA 2WWCA 4M6QA 4ICNA 4IIFA 4HN4A 5A6KA 1L6WA 1GQJA 2PDFA 4Q7NA 4AWTA 4OOZA 1M7JA 2ZWZA 4YU1A 2WXDM 3DN5A 2VDGA 4RE0A 1GJPA 5M3WA 1WKFA 1VRXA 5BMWA 1I60A 1WKEA 4FK9A 2ZTKA 4HMEA 5FL1A 3AIWA 3OGSA 2PDUA 5FSEC 2D2OA 1LZOA 1PCKA 1GHSA 4GG9A 4NAEB 4MIMA 3II1A 1TVNA 3K5XA 2BODX 2DZBA 2QV5A 3E49A 3SY1A 1TYGA 4KS0A 4H6RA 2WZEA 1F3XA 4AIBA 3WQOA 3BWWA 1OJXA 4BI5A 1RV8A 4QE4A 3VKBA 2O7QA 4V15A 1EJRC 4Q8WA 1GOWA 4MHBA 1JQVA 3MYOA 4JY9A 2NQLA 5DCBA 4QR6A 3VINA 3FA5A 1Z42A 2DW6A 4PSPA 1PJ9A 5F4WA 1LUCA 4FX8A 4KQNA 3ZJ7A 3R8RA 4L7ZA 4GPNA 3SCVA 3CHVA 4MZ8A 4ADTA 1Q66A 4UTWA 3QTGA 1D7FA 1OC5A 2HBVA 3STGA 4I90A 3DYOA 1M41A 1R3WA 2O56A 2PCEA 3WD1A 3KRZA 2YBUA 2ZUWA 4O13A 3CIXA 3GHTA 3VK5A 1BWVA 1RK6A 3OA3A 2DY3A 3FGCA 3NZRA 3WQVA 2PRLA 3G8EA 3AYTA 7ENLA 1OFRA 2GVJA 3GR4A 3KBWA 4XIAA 1EJSC 4KCVA 2QNEA 3H6OA 4MB1A 1GVEA 3N4EA 1IR1A 3RCMA 3MDUA 3VGFA 3WQEA 3OQ8A 1OT1A 2YCLB 2ZXQA 2FB3A 4JY8A 2HVNA 2PDKA 4O8RA 4UQAA 3TH6A 3TW9A 2WJFA 4A05A 4FP1A 3QYQA 2V2HA 3WQFA 1W1VA 2VRJA 4Q7IA 3ZVIA 2OPJA 4DYKA 4GVHA 3LCXA 1PZ3A 5LHEA 1K02A 4R88A 1TVLA 4PMDA 1OEPA 1RVGA 4XV0A 4AYSA 3CQHA 4I7UA 8RUCA 1TWIA 3SR7A 4A3HA 1CI1A 4Z2GA 3I65A 2O9PA 3L4XA 4J2MA 2H8XA 4QJ1A 4WSHA 1OY0A 1RA5A 3W02A 1ML1A 2AKMA 1VEOA 3MDWA 4NZ3A 3V3WA 1K4GA 3I68A 4D6GA 4ZE5A 1QOQA 5D2VA 3J7HA 1TWWA 3SI9A 1U30A 1E1FA 3B9OA 2QQ6A 1MQPA 1KFWA 2ICSA 2GK1A 1MNZA 4E8CA 3NCOA 5AHIA 4RPPA 1U5HA 1M04A 4MM1A 2VM8A 1E4IA 3UG3A 2DQWA 2E0PA 5H2ZA 1OX4A 4Q8OA 2HRWA 4ZB0A 3GC4A 1XLFA 1AL8A 2I17A 3DDMA 4JKMA 3V5OA 1HJXA 2FFCA 1P7TA 4O4WA 1NOUA 1D7KA 1ZRQA 1M65A 3F2DA 3NO5A 3OIXA 4UTUA 2DVTA 1XDMA 3LLFA 3A24A 1US2A 4AD0A 3UPBA 3KS5A 5F1VA 2AGKA 5EL1A 3NO3A 4IIHA 3VM5A 4XAGA 2CW6A 2P3ZA 2X1UA 3QMSA 1NQ6A 3TWBA 2ZUTA 1OVDA 4KFPA 3PZVA 2E1WA 2GJLA 3BGGA 3BPWA 1IXNA 2UY5A 4C65A 1BYBA 4JTAA 3SUUA 4OWGA 1Z69A 3CHCA 5F2LA 3WIJA 1PAMA 1GOMA 3QGAC 4H9ZA 1XPGA 1M7XA 3A21A 3ZT5A 4FPSA 1YXYA 1GKPA 2KZHA 1E6QM 3M7WA 3CAQA 3H7RA 3RJYA 1QAPA 3OU8A 2J6VA 3THUA 1SO5A 2BXZA 4ATWA 2D69A 3QY8A 4DZ5A 4EE9A 1CBGA 1E4MM 4FIQA 1HGWA 3TN4A 3N34A 4L64A 4C1KA 2A6LA 5HMEA 4ECLA 1O5QA 1NTHA 4C6NA 1ECEA 2WV8A 2QPXA 4B91A 2DZWA 1LG1A 3VIOA 4B5UA 3ZLFA 1KV5A 3VNZA 4LTSA 3DI0A 3KVLA 2HVMA 3VIFA 1YNPA 3JRKA 3CUIA 1MW2A 3VOFA 1G67A 1IGWA 1H3GA 3C4UA 1QK2A 2GPTA 4W86A 3VDCA 2PODA 3WNKA 3WDHA 1GOQA 1C7TA 3HGJA 4ZODA 2RJGA 1NDZA 4M56A 1Z41A 1W31A 2XTKA 3FDKA 1RR2A 5C9UA 1A5OC 5BNKA 2TYSA 3BLFA 1DE6A 3EGJA 3KCJA 4OUIA 4Q8TA 2DJXA 2J7BA 1Q7MA 4B90A 2HEJA 3GG8A 1VAHA 3CHFA 4OFCA 1J93A 4U5KA 5MKGA 3I4EA 3L5LA 1KQYA 3UETA 4BHYA 1JRBA 4TX9A 1UQZA 1UZ1A 4GH3A 4FNTA 4FF5A 1DWGM 2YCJA 3UP8A 3ABSA 3E2SA 1IWPA 4P8XA 2DSUA 1I6NA 1E4NA 4EX4A 1PIIA 5CPMA 3NZGA 2PDBA 1UD2A 3EB4A 3W7MA 3M4HA 3W7EA 3UVAA 2ZUVA 4JFWA 5CSSA 1FWHC 3KZSA 4MWAE 5F7UA 5A6MA 1C3FA 3GNPA 5M5DA 4JL1A 4URIA 2C16A 1O7AA 3QN3A 1KR1A 2TAAA 1KFCA 4HK6A 2YPIA 1G1YA 3VNMA 3EAUA 1HG3A 1POKA 3IK4A 1H63A 4PRRA 4AZHA 3E1F1 4IFKB 4LVFA 1JF5A 3L4WA 1PEZA 1X96A 1IT8A 1PV8A 1PWLA 1HXJA 4FSAA 2WMKA 2BBFA 1CB7B 5FKYA 4H9XA 4B92A 5CPLA 2VFGA 3FOKA 3HZ3A 3PANA 4K8HA 3W71A 3AYVA 1ME9A 3H22A 3QOKA 1CLKA 2PWDA 3S5ZA 3DGRA 2OOFA 4P8VA 4GXMA 4AXKA 3S2MA 4WDWA 1HF6A 1W5QA 3TMQA 1QW7A 3CHEA 4ADSA 3TW7A 3WLNA 4OVXA 4ZB2A 1T96A 4D6DA 1KBLA 2OVLA 3ARQA 1XLBA 4TU1A 1FWFC 2FZDA 4NJKA 4A2RA 3HPSA 4CEXC 5KITA 4AWSA 5C7HA 3LHUA 3TTQA 2BHZA 2IS7A 3FEMA 1F8IA 1QNQA 2C1IA 4GUGA 4N2YA 2QUNA 4I6KA 2Y7FA 3WJWA 3TC6A 3R6IA 2QXWA 4QSHA 4IH3A 4XZHA 2RHGA 3S9IA 4RE2A 3RPDA 3TCSA 3IUHA 3LERA 3MP3A 1OCBA 4E8GA 4LYKA 2J7HA 1Q45A 2WMHA 5LA0A 5ECUA 3PFRA 2F8QA 4HA1A 4J3WA 2GDQA 4B5TA 1B3OA 4QDMA 5DRIA 3NVDA 3R11A 3WQ4A 3UQNA 1MUCA 4LV4A 1GJUA 4A8RA 4JHMA 3EWYA 3KBMA 2G8ZA 1QW8A 4UFJA 3W7JA 5REQA 4GYPA 3SJ3A 4REQB 1XC4A 4W4QA 3BAJA 4LUTB 3EOUA 4KFNA 1FH9A 1TA3B 1ZU8A 4DN1A 5D8WA 4EF8A 3BMWA 5HNNA 1AMKA 4EKJA 3TN5A 4R9XA 3QZEA 3IK2A 1E70M 3DOPA 4HSNA 3LPOA 2PGWA 2QDGA 1F3EA 3ZM8A 1TMQA 1OT2A 2HSAA 4O50A 4M6VA 4UXDA 3GZ3A 3WBYA 4HPHA 2X2GA 4EXAA 2P5NA 5E93A 1VLWA 2DZAA 3N14A 4CN6A 4LUJA 3GH4A 5D4YA 2CZEA 4FS9A 3T08A 2YCEA 1ODUA 2GUUA 2VOTA 1Y65A 1QXLA 3OZMA 1TWZA 3VD5A 3W29A 1OFEA 4D6FA 2NXHA 4UNLA 4DI8A 3UJRA 3WQ6A 3UJ2A 3NJ3A 4GJJA 1RD6A 4YCPA 2CYGA 3ZJ8A 1YEYA 3COTA 4CNUA 4PUMA 3BLPX 1KM5A 3K4WA 4GI4A 2VRQA 4RDYA 4XWUA 4EXQA 4MAZA 3G0XA 4FLOA 5IHSA 3M0MA 4IZGA 3WH7A 2YZRA 3GNNA 2VEIA 1W9UA 1SW7A 1TPFA 5D02A 5AHLA 2PDNA 2VX4A 1L0PA 2OFJA 2CLFA 3VUPA 5HJYA 3H21A 4ERIA 2HXTA 3H2AA 2WZTA 1RZMA 3LI0A 4BQ5A 4S3EA 4DWSB 3K30A 1VC4A 3R12A 2PMQA 3UPMA 3ZS4A 4U2YA 3GDTA 1IGSA 3WH5A 3W1AA 1UD4A 4HCHA 3CIVA 4NZ4A 3N29A 2WJZA 4GUIA 3QSTA 3TXZA 2ACSA 3HGOA 4TUFA 4Q8PA 4YVXA 4L6DA 1Z6KA 5IRPA 1UP0A 3KLKA 3MVTA 1XLMA 3TC7A 3S1VA 2F38A 3R94A 4Q6JA 1TSIA 3WQCA 4C90A 4RZ5A 3JZUA 5GJNA 1R9YA 1NDVA 1XLAA 2UZ9A 1TKKA 4OUEA 4Q7BA 2POZA 2ISFA 4XUYA 1EHNA 3HBLA 1UH3A 1UWIA 3W6MA 2H3BA 4F0HA 2DH2A 5C8BB 2NSOA 3AXIA 1EH9A 3H24A 1IQ8A 5HR7A 4G56A 4UOJA 2FTWA 2YIHA 4ADUA 2P0OA 4C7FA 1Y5VA 1XC6A 4IMAA 5FAJA 2QR6A 2CLEA 1W5OA 4AIEA 3IV3A 3NSNA 4F0RA 1LBMA 2ALDA 2VJXA 3AMLA 2NQJA 5JBEA 5IDZA 4IF2A 2NSXA 3WH8A 1UH2A 2C0HA 1ECQA 1Z3NA 3A9IA 5IBXC 3JW7A 3UPWA 3M0YA 2PI6A 2EG7A 3OOQA 1J0JA 3SGUA 2D2JA 4IT1A 4LY4A 3KTSA 3WF1A 1GOOA 1E6SM 2PEVA 2WPBA 1W3JA 3C3NA 4NHVA 4C6EA 3N4AA 4GY0A 3USZA 3IAPA 1IHIA 1RP8A 2PDLA 2VL4A 4QGCA 4NG3A 3PZUA 1O12A 4GNJA 4TTGA 2P0IA 3BAKA 4R7WA 1BRLB 3AMDA 4NNAA 3H7UA 3HPZA 3WNPA 4IJBA 3UCQA 1KGUA 1N8FA 5FIPA 1ME7A 1YYAA 3KTXA 1SPQA 3GDRA 4LT9A 1F07A 4X61A 2AMXA