3NQFA

Crystal structure of the mutant l123s of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
219
structure length
219
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLSTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: importance of residues in the orotate binding site.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase/lyase inhibitor
total genus 85
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3nqfA00
4UTUA 3W7QA 4UTIA 3ZFHA 1TJRA 3LHUA 2H3BA 1EP1A 3CPRA 4Z08A 1S3HA 4MUZA 3W7KA 1O60A 4CCDA 4HT3A 4DO6A 2V2CA 3FJ6A 3P5YA 2CLOA 4IQLA 3LHTA 3ELFA 1L9WA 4R7JA 3YPIA 1SUXA 5EPDA 1GVRA 5BRBA 5CKSA 1SR9A 1VH7A 3G1VA 3HGJA 4O15A 3W2JA 4RX0A 1T8XA 2I9EA 4X22A 5AC8A 2QAFA 3S6DA 4LVAA 3S5ZA 2OJPA 4DBDA 4AHQA 4U28A 4CQ9A 4Z0JA 3EWZA 1KW1A 3DKLA 1K02A 1SPQA 1FCVA 2ABBA 2C0AA 3I6RA 4K37A 4NXSA 3NA8A 1W1ZA 3LHYA 3NQGA 4JXCA 1OF8A 1K03A 3NNTA 4LUIA 3FYOA 4XTDA 3QW3A 2B7PA 3P7YA 3QQ1A 1S5WA 1MO0A 5CZJA 4UFIA 1VYSX 4CNNA 3QPYA 4BI6A 3MI6A 2RKXA 1H61A 4HNUA 1OFPA 3NEVA 1L6WA 2NLIA 2VFHA 4JY8A 2ZZ5A 4JX4A 2VFEA 1H5YA 3LCXA 4MY8A 3W1PA 2ZA3A 1K8ZA 2VELA 2WSQA 1SZNA 3PAJA 3SR7A 4LS1A 4O19A 3I7SA 2WSYA 1EUNA 3M44A 3EXRA 1F5ZA 1AW2A 3N34A 2I14A 4NJKA 4Y8FA 4CNPA 4ZQPA 4DPPA 4JYFA 4CNOA 4P2VA 4JTTA 3W07A 4UFMA 5HINA 3TC6A 5DY3A 3TAOA 3TR2A 1LOLA 4GUIA 1VS1A 1XFBA 3W75A 1P5BA 4N9CA 1XKYA 1FY6A 1LBMA 3QRHA 3GDRA 3W7NA 1UJPA 3RLVA 2JKAA 5LNVA 1DKWA 3ABSA 1FWSA 1R2SA 2WJZA 1FDJA 4WZHA 4N6EA 3G0SA 1KM3A 3DHDA 3OG3A 3G1XA 2WNNA 3DHFA 5LKYA 3NQ2A 3A22A 4WX2A 2A2IA 4DPQA 2ZRZA 4BWLC 4FNSA 4LT9A 4LV9A 5KINA 4BF9A 2FB2A 1EWEA 1ZNNA 3M5ZA 2NXIA 5K4ZA 1T0OA 2BSLA 4RV8A 4JTLA 4YMZA 3G3MA 5BOOA 1KV5A 3UWUA 1QOQA 3W2NA 5KMYA 3GDLA 2C18A 1C9DA 3B06A 3N2MA 1OFQA 1FQ0A 1R2RA 3TNOA 3F4WA 4PEKA 1OX4A 3NPWA 4CQ8A 4LW7A 3S42A 2V9DA 5AN7A 1H7XA 1P0NA 5CGQA 5AOUA 1QDSA 2B7QA 1D3GA 1EWDA 1LRNA 3S1XA 2YXGA 3DU0A 5AHFA 3QZEA 1BWLA 4HHPA 4WY0F 5DCBA 1V5XA 3IGXA 3MO7A 3FLUA 3L65A 3MW7A 5KSWA 1LLZA 2X1RA 5I3KA 2CLIA 4MY1A 3NL6A 5CPLA 4N9DA 4X3ZA 2GVJA 2UV8G 3E96A 4M7TA 3C0JA 5C54A 1KM1A 2YX0A 1HG3A 2Z2UA 5EA9A 3K30A 1I45A 3DH7A 4JTSA 5DELA 1XBYA 1SZGA 3FA5A 1R2TA 4Y6GA 2JGYA 1I2QA 4NNAA 3WK1A 1JCLA 3DENA 3CC1A 1K3UA 1SZFA 1PVNA 4Y9AA 3TK7A 2YW3A 5C55A 4O14A 4S2CA 3ANYA 4GWEA 4MLRA 3AJXA 5EL1A 2ZRWA 5AC6A 4FEZA 1I4NA 3EX6A 3GDTA 5LNSA 2G97A 3NZ1A 2LLEA 2OX1A 2ZA2A 1GEQA 3DFPA 2Z0IA 1DQXA 2EGZA 5FF3A 3W7DA 4HPXA 1VC4A 4OV9A 1FDYA 6ALDA 2B7OA 1QAPA 2Z6JA 4S2BA 5D04C 3STFA 1MZHA 3CEPA 3NG3A 2DZWA 1B4EA 3IIVA 3NQAA 2DZXA 1GVFA 3BG9A 1HO1A 3UWQA 1XDMA 3LTPA 4Z1BA 4PCFA 1R30A 3B0UX 5CZSA 3A9IA 4PC8A 2A7RA 2Q3OA 3IIOA 1ONRA 3E9AA 3NOEA 5ABTA 1ZHAA 3TQKA 4ALDA 1YLVA 3EX2A 4CCEA 3TX9A 5BNKA 3Q2DA 1Z41A 5CSSA 3L5LA 4O4WA 1J2WA 3CM4A 2ZZ2A 1DVJA 3EXTA 3ABRA 2G95A 4FNTA 4UUIA 5CZ0A 2J9ZA 3GR7A 3FOKA 4O18A 4ADSA 2YDAA 4AWTA 3M9YA 1SW7A 4HNTA 5I3GA 4H3DA 1KTCA 1W3IA 5U7SA 2TYSA 2ZTJA 4LC8A 2V82A 1QPNA 2VOMA 3QSTA 3NXFA 3DFSA 1TPDA 2ZRVA 1ZAIA 4GUGA 4UFJA 1JQVA 2GVLA 3R2GA 5SWUA 4IOTA 2C15A 4UTWA 5TIMA 1L6YA 2PURA 5F1VA 4K7YA 1FXQA 2QKFA 3VI2A 3NPUA 4O10A 3GNNA 5D30A 2EAWA 4JX5A 4N4PA 3WK3A 3M16A 1DBTA 1OK4A 2CFFA 1GTEA 3BK0A 1H7OA 3QF0A 2GQAA 2R14A 1TRIA 5FEWA 4JEQA 3KRUA 2E68A 2P10A 1OFRA 3GVGA 1WBHA 4DEFA 1XC4A 1GYLA 4JTFA 1TTPA 1G7UA 2ISWA 4JDBA 4UTWC 4O1CA 3TMLA 4J9JA 1UCWA 5J5DA 2QUVA 1LORA 3V75A 1OYAA 3MI2A 4AVFA 1L6SA 3TC7A 1IXQA 3DFQA 4GXMA 2C19A 1N8FA 4JTIA 4RKAA 3BO9A 1EA0A 1UB3A 2ZCGA 5LNWA 5FEPA 3W7IA 3TW7A 3S8HA 3EX3A 3QM3A 1NF0A 1QWGA 3PUDA 2YPIA 5F2LA 4JTGA 4MFEA 3W70A 2C3ZA 1YPFA 2CLEA 2X2GA 3GKAA 4RLIA 2QAPA 3S1VA 1FCBA 2ATMA 1F6KA 2F7FA 4HSNA 1W31A 1GJPA 4S1FA 1KFCA 1H7PA 5K9XA 5I3IA 1TV5A 1LM1A 4IGHA 4CQAA 4A22A 1DHPA 4IMDA 4RZ4A 1TMHA 1FXPA 3HPZA 4YWIA 2AGKA 3W7JA 1WDWA 1IXNA 1W0MA 4UMBA 3C6CA 3SW6A 2XN0A 5AHLA 2D73A 5EY5A 1UUMA 4O1BA 1AL7A 1RQBA 3HIJA 5F1UA 3TFCA 3W1LA 2E6DA 3T55A 3N9SA 5C2XA 4R34A 4NU7A 3P67A 2X16A 3UXAA 3W1XA 2XFWA 3L66A 1J5TA 4RZ6A 2CZEA 1BKSA 1VLIA 3S1UA 1AG1O 3G0UA 3N9RA 5HUPA 3OVRA 3TDFA 1SW3A 5DN1A 3I7RA 4XBKA 3UZJA 4KFPA 4RK8A 1O5XA 4QSHA 4N9EA 3TE9A 3QQ0A 2A1YA 2DJXA 2YR1A 4O16A 1VCGA 3TW6A 3THAA 4I9AA 3B0VC 1EPXA 2VFFA 4LV4A 2B4GA 3LV5A 3HGSA 4UTKA 3G1YA 5DCEA 4X9SA 1B57A 4TIMA 4ZL1A 1YDOA 4N4QA 4O17A 3STEA 4FB7A 3M5XA 2NWSA 3DAQA 3H55A 3T44A 1B9BA 5LGXA 3LBCA 3LI1A 4FF7A 1K7EA 3WJWA 3RNDA 1S5VA 2A21A 1AW5A 1F05A 1GG0A 5IBXA 4IMGA 2QUTA 4MZ1A 1EP3A 4ADUA 1JJKA 2E5DA 3M6YA 3O8AA 1TPEA 5AFDA 3PB0A 4FNUA 3W1QA 4C1LA 1WV2A 1Y0EA 1SSGA 4NVTA 5CPOA 5A5WA 3F03K 3IGUA 3QPZA 1IF2A 1QPRA 2B0MA 1LOSA 2F84A 3L2IA 3M0ZA 1TPH1 4NXKA 2PRMA 3O16A 1LRQA 2ZYFA 2HS6A 1K8YA 2C6QA 1TTIA 4A2SA 2QDHA 5HQEA 2QJIA 4LU0A 1VYPX 4KWVA 1DL3A 3HF3A 4OWGA 3IVUA 2ATSA 1CX9A 1OFBA 3HBLA 1LOQA 3M1ZA 1FDZA 3E12A 5IBXC 3SY5A 1ZAJA 3CIWA 3UPWA 3TJLA 2WO5A 4UFKA 2QCDA 4A29A 5I3FA 3A24A 1JCMP 1SW0A 4PA8A 3LRLA 1G4EA 1X7FA 4NZJA 3C52A 3GR8A 1FWWA 4LVBA 5EBUA 4IPIA 3KRSA 1KFKA 3MYPA 5CZTA 3UZ5A 5CPMA 1QPQA 2ZRUA 4YCOA 3UY7A 1A5SA 1ZCOA 5LNRA 2Y62A 3EWYA 2J88A 2TRSA 4HSOA 1WQ5A 1NSJA 1W8SA 5F2MA 4O53A 3UQNA 3GIYA 3TA6A 3ZWSA 2FTPA 1RV8A 4DELA 4FIQA 3TXVA 1JUEA 3N2XA 2ZRYA 1XL9A 3OVPA 3S9YA 4HN4A 3TFXA 3L9CA 1Q6RA 4M6PA 2FPTA 1Q6OA 4DO5A 4E2BA 2C13A 3HOJA 3BGGA 2QCGA 4NX5A 2E5BA 4RCXA 2YFNA 4IX2A 2QCCA 2QCLA 2ZZ1A 3RLUA 1NF7A 3LTSA 1TQXA 1W3TA 1RD5A 3EWBX 4IUOA 5AB3A 4EOUA 3QEZA 3O15A 3NL5A 3LRMA 1TTJA 2G5WA 3FKRA 3SZ8A 3EB2A 5D2VA 3NVTA 3W1AA 3W73A 1X1ZA 4XKYA 3VCRA 3W86A 4AWUA 2ZDRA 3C2EA 3G24A 2Y63A 3LXBA 3P60A 4XWUA 1H63A 2NV2A 4UNLA 3WFAA 1TPC1 1LTDA 5DBUA 1H7WA 1YXCA 1XBXA 2HMCA 3MHFA 4IXXA 4L4LA 5TQLA 5LSMA 1TCDA 2CLKA 4MZ8A 4BK9A 3NDOA 3GAKA 3NQ7A 4UXDA 3PF3A 1GZGA 1TIMA 3Q37A 4RXGA 1VGAA 5G2IA 5AYZA 4ZQRA 4I7WA 2G96A 1KBIA 4O1DA 3O63A 4M5PA 4FX8A 2RDWA 1B4KA 4Y96A 1PV8A 2V5BA 3B03A 5HWNA 1Q45A 3O6DA 1FX6A 2YW4A 2A4AA 5D32A 4LNYA 2V0TA 2ZRXA 1SFLA 3G1HA 3RF9A 1W5MA 4O50A 5F2GA 3W71A 1OFEA 4QITA 5KITA 3HO8A 4QNEA 4TO8A 4C1KA 4IMEA 3Q94A 4CLMA 4MIMA 4ZMGA 3QMTA 1PS9A 3W7HA 3LV6A 3D0CA 3A5FA 3W6YA 3B05A 3UWVA 1RVGA 4JTUA 3FEMA 2E1DA 3VNDA 3GZ3A 3SI9A 4EWND 1D9EA 4UC5A 1W56A 2GJNA 3B4UA 3PC0A 1MEHA 2QCHA 4R33A 2Y85A 3IVSA 3CT7A 2C16A 2GUUA 4K39A 2VEKA 4QQ3A 4Q33A 1N7KA 2V81A 4FNPA 4K8EA 2ZFAA 5K4XA 4Z0SA 1IIHA 2V2DA 1VLWA 1C29A 3I7QA 4R53A 5FF4A 5HNRA 3Q58A 2X1TA 2GPTA 1PL9A 2WKJA 5F4SA 3CWNA 3BW4A 1ME8A 1DQWA 2A7NA 2Y7DA 1Q3NA 4UMCA 3STCA 4UFLA 3GLCA 4UFHA 1GOXA 4ONVA 4JGDA 5EKYA 3HPXA 2VENA 2BX7A 1TSIA 3W83A 2VFDA 5D2XA 3L67A 3S5YA 2NUWA 1W5OA 3W9ZA 2DZVA 2W0UA 4HPJA 1LYXA 3EKLA 4RR4A 4BI7A 3BPWA 4E2DA 1I2OA 3H54A 1IIGA 3QH2A 4LS2A 5G5IA 1QMLA 2OCZA 4UNKA 2V30A 2Y89A 1OFOA 3BLIA 3ATZA 1KA9F 3QJAA 2AQWA 3NQ8A 4OU1A 4NZFA 1KFBA 5DLCA 1NFBA 1G69A 1JUBA 2YGYA 1VYRA 2BWGA 2DZSA 5EYWA 3TCEA 2BTMA 3C61A 4JYEA 3KVKA 2WNQA 3N3MA 1DJNA 3PG9A 3JR2A 4POCA 2Y61A 3BLFA 3UYCA 2VEPA 4O57A 5LHFA 1Z48A 2QJHA 3G1AA 3R5EA 1TPVA 1BWKA 3NPVA 4AF0B 3AO0A 4WOQA 3LCLA 1XM3A 2TPSA 1UBSA 3TKFA 4HNVA 2NX1A 3B04A 4AXKA 1GYNA 3NQ6A 4DF0A 5D2TA 4OBTA 5D2WA 4WY0B 1QOPA 2V5LA 3BGJA 4GBUA 4Q4KA 1FUYA 3LGEA 1VJIA 1OFDA 3LXAA 2KZHA 2ZQ0A 3NQVA 4QISA 3N73A 3T7VA 1TV8A 1QR7A 3USBA 3GAYA 3FKKA 1W5QA 5AYYA 1QCWA 1PIIA 3KVJA 3WJSA 1SO5A 5CSRA 3G3DA 4XBSA 2ISSA 3VFLA 4EVZA 1P4CA 3O6YX 2GJLA 2YFOA 1I2NA 4JR5A 3OA3A 3HG5A 4O28A 3TSMA 1VR6A 2VEIA 2A6NA 3BG5A 1SO4A 1OHLA 5AHNA 1VCVA 4A21A 1ICQA 1KTBA 2CLLA 2FB3A 4K7VA 3TUUA 2J6XA 3PSVA 5D2YA 1LBFA 4MYAA 3OHIA 3CHVA 4LVFA 4BFAA 1XCFA 1JVNA 1WOBA 1XUUA 3NR0A 1XXXA 1F76A 1RQHA 2ZZ6A 4FXSA 3NM3A 4DQWA 3L21A 3PULA 4K6AA 4DF2A 1TJPA 2EKCA 1H1ZA 5D37A 3CWOX 2C1HA 1G7VA 3SFKA 2Q8LA 2ZZ7A 3OEXA 4NJIA 3M43A 1H7RA 3UD6A 3QYQA 1TRDA 1OX6A 3HQ1A 2TMDA 4B5NA 3W76A 3M5YA 5AHEA 3N19B 2O7QA 3R89A 2Y6ZA 4N02A 3TMQA 1S5TA 5D02A 4MZYA 1WAUA 3TXZA 3S5NA 5LGZA 3UXDA 4FNRA 1EIXA 4LY8A 4D2JA 1Z44A 1O94A 1OVDA 1GVSA 1OX5A 1T99A 1LLWA 3W88A 4ICNA 2CLFA 3QC3A 4AB4A 4M6QA 5G2HA 4NT0A 3RMJA 1M7PA 3GKFA 3L68A 3ZS4A 2XN2A 1PHQA 5A8GA 2R8WA 1KM6A 1SQ7A 1N55A 3PB2A 3GNDA 1K8XA 2HTMA 2WPBA 3MP5A 4K36A 3H53A 1KV8A 4HKPA 5HWJA 5DXYA 3GX9A 3W7RA 4JTKA 1GT8A 3C2OA 3M41A 3R13A 2VXNA 2V2HA 2Y70A 1GWJA 3RU6A 4GE8A 2NWRA 5FF2A 4EIVA 4LOCA 2IQTA 3HB9A 1AMKA 2CZFA 1ME7A 1OFAA 4NQ1A 4LRSA 2P0OA 5FF7A 3STGA 3PBUA 4O1AA 3LLDA 3F1QA 4DF1A 1I8JA 4JTEA 5HWMA 5CPNA 4HNNA 2NX9A 1L2UA 4KFNA 3W2UA 2NX3A 3NGJA 4W9TA 5MHBA 4A3UA 2FLIA 2CZDA 2GOUA 1VQTA 4NJJA 2OT0A 3TAKA 3LCFA 4UTHA 2YZRA 3N14A 1IXOA 4L4MA 1K7XA 4JTJA 3W7CA 5HMSA 1FCQA 3PUOA 3IIXA 3LM7A 3WK2A 3E49A 3BLEA 4TR9A 2Z6IA 2OT1A 3LHWA 1PE1A 5H91A 3LOTA 3LX9A 2ZBTA 2Y7GA 1CW2A 3IRDA 2A6LA 3L0GA 1YXDA 4AHPA 1OF6A 1GG1A 4JNMA 4Z1AA 1BTMA 2BZNA 3LERA 4MKNA 4U4MA 2J24A 3DFOA 1GVQA 5K9DA 3MBDA 4LS0A 5C6MA 1R46A 2A85A 1ZY9A 6TIMA 1ML1A 2CU0A 1AL8A 4EF8A 3PR2A 2DU2A 1W54A 3L0NA 3E0IA 4JIQA 3L5MA 4JY9A 4TMCA 4ZQCA 3GXNA 4BI5A 3W1RA 5F4XA 3F4NA 4AMAA 4NNBA 2B7NA 2NZLA 1PCKA 2ISVA 4JTHA 2DZUA 3UWYA 1VCFA 3CLMA 3JS3A 3LHVA 2PC4A 1OYBA 3MYOA 4KWWA 1G6CA 2X1SA 3SSJA 3QMSA 3W7MA 4GUFA 3VE7A 1U5JA 1TPWA 5K2ZA 4O11A 3A23A 4WUIA 4AAJA 1Q6QA 4O4VA 5GVJA 1OX4B 4DXVA 2E77A 1IGSA 4FO4A 3P8JA 4MFDA 2A7PA 1QO5A 3NQDA 3NQMA 4WQ6A 3R8RA 3PM6A 3NZRA 2AAMA 1OJXA 3VE9A 1SZEA 3UPBA 3U2OA 2H8XA 5G1TA 3ABQA 2FPVA 3T40A 4UTLA 3ZR4A 5HULA 3DZ1A 1WX0A 4O0KA 3W74A 1PHWA 1YYAA 3W2KA 1BEUA 3CIXA 2DORA 3W7LA 2WNZA 2QEZA 3ABOA 1A53A 2VFIA 2JK2A 3DI0A 5I3JA 1D3HA 2VKZG 2DZPA 2H6RA 3P74A 2WOQA 1NVMA 1JCNA 2X1UA 3OVQA 3C4UA 2JGQA 2EPHA 4GFSA 5AHIA 2RFGA 3EWXA 3TQ0A 1ADOA 1KLZA 3GXTA 2QDGA 5HR6A 1U83A 4QAIA 2PRHA 3LCWA 3PY2A 4I7UA 3I68A 4NX0A 1XBVA 3EX4A 3TIMA 4WOZA 1H7NA 3B8DA 3MI3A 4QNWA 1JQXA 3W1UA 1AK5A 4UMAA 4PODA 2E6YA 3LHZA 4TU1A 2NUXA 3U6WA 3LCIA 3ATYA 1HUVA 4NNCA 2QCMA 1TQJA 4IMCA 3UWZA 3B0PA 1SU5A 5AC7A 2A0NA 3DI1A 1VZWA 5FESA 3GYEA 4DBEA 3S1WA 3MJYA 4N6FA 3BVJA 3KXQA 4WXZA 2RH9A 1KM0A 1W5NA 4I7VA 4A2RA 3QW4B 4CCCA 4Z1DA 5U4NA 3MP3A 4TMBA 1SFJA 4WXYA 3W7EA 2R94A 4O8RA 1LBLA 4K8HA 4FIRA 3IEBA 5I3HA 3QSRA 1WXJA 3KRZA 3G8RA 3U8GA 5L9FA 3WK0A 4MJMA 5TBOA 2Y7FA 2FJKA 3W2MA 1KLYA 2WV8A 4XQ6A 4OHQA 4GUHA 5D05A 3MHUA 5F4WA 1GTHA 5FF0A 5DXXA 3LTYA 4AH7A 4LUJA 4ORIA 2W79A 3HGRA 2CWNA 3G0XA 5G4WA 1OK6A 2JBMA 1OYCA 3C3NA 4H4IA 3KFTA 3GXPA 1KFLA 3QFEA 4GC4A 1TO3A 2CLMA 1JRBA 1MEWA 2FPYA 3DXIA 3DKJA 5AHMA 5H2ZA 3A21A 1C8VA 1TTQA 2DZTA 1SO3A 3TJXA 4DO4A 1H60A 3EXSA 1JCXA 1X1OA 3DGRA 4E38A 4FNQA 3G1DA 4LTSA 5HR7A 3LLFA 1MXSA 4IPJA 1W3NA 3C2FA 3T78A 4BWLA 1F74A 1E51A 4MPQA 4OT7A 3KOFA 3A5VA 2Q3RA 4O0ZA 2H8ZA 3MMTA 1KFJA 1ZAHA 3LDVA 2Y88A 4PH6A 1TREA 3NAVA 3SIZA 1I2RA 3C56A 4MJZA 1NEYA 1RPXA 3PBYA 2RDUA 1A5AA 4UIOA 4FX7A 3M7WA 4UCGA 1TPB1 3NYZA 4FHAA 3W1MA 1HO4A 1Q6LA 1KM4A 3IVTA 3FIGA 3HG2A 3DBPA 1VPXA 5L6UA 1YDVA 4LC6A 2FIQA 1NAL1 3PSWA 4JX6A 8TIMA 1LCOA 3CQ0A 1LZOA 3GB6A 3RK8A 1A5CA 4ORMA 4ZQMA 2OZ0A 4EF9A 5K3VA 5LZLA 3PG8A 5D03A 1M6JA 1A50A 2V8ZA 1LROA 3BW3A 5AYXA 3W7PA 3WJYA 5DY2A 3THQA 3MWAA 1W5PA 1KM2A 1VRDA 4IMFA 4LVDA 4YL2A 3C2RA 4RXFA 3P5ZA 5E0KA 7TIMA 3NL3A 3QMRA 2E09A 3TSBA 3WJZA 4JIPA 1W37A 5HUOA 1YTDA 2H3DA 3W7OA 2CZ5A 5DCDA 3O6CA 4YXGA 3BV4A 1G4SA 4NUWA 2VC6A 2VFGA 4JYDA 1P1XA 1HL2A 2QUUA 3P62A 3KX6A 3W22A 2GQ9A 4O13A 2TSYA 3LBMA 2RDTA 3S0CA 4OV4A 3EEGA 3FFSA 4G1KA 1TV7A 1EP2A 5IM51 1SO6A 3G8EA 3LCHA 2R91A 2CLHA 4QJ1A 1JCYA 1P0KA 2EF9A 4PTNA 4QIUA 3TV8A 1XUZA 2GVGA 2QCFA 3M5VA 5G1YA 3SGZA 5C5YA 4LVGA 5G2WA 4GJ1A 4O52A 1DJQA 1G4TA 4NJGA 1WYIA 3KHJA 1UASA 1F2JA 3KVMA 1WOAA 3O07A 1YPIA 2JKEA 1EUAA 5J5RA 3L0KA 5EMUA 5LHEA 4HIBA 4H6KA 3TSDA 2XN1A 3KAOA 5E93A 4XTIA 1YXYA 1M7OA 5FEXA 3EWUA 1O95A 3P82A 1ZENA 1TYGA 2DJLA 1FBAA 4JS3A 2Y7EA 1KM5A 4M19A 3KVLA 1G67A 2QJGA 1JR1A 3SGUA 1VHCA 4XUGA 1JULA 3W23A 3PBWA 4ZQNA 3NQFA 3FS2A 4JD4A 3INPA 2NV1A 5F2IA 1F73A 4MOZA 4YCPA 4ZZ9A 5LNUA 3W84A 2PE4A 1IXPA 3PUEA 4KFOA 1DOSA 3NQCA 4X2RA 1F6PA 1KTNA 3W85A 2NUYA 4E0CA 2Q8ZA 1O4UA 3CB8A 3O06A 1R47A 3LRKA 2OMAA 3EKZA 3G1FA 2E6FA 4UR8A 3W2LA 3IIPA 2YSWA 5BMWA 1TPFA 3RFAA 4NJHA 3O05A 2YCEA 2QCDB 1YADA 2GQ8A 2QCEA 3CEUA 3UWWA 1OABA 4IJBA 3C8FA 3TU9A 2H90A 1HFBA 1T96A 3GDKA 3C2VA 3W87A 4AEOA 1H50A 3IGSA 1B3OA 1PCWA 3L5AA 1XI3A 2JKPA 5HJLA 3FYPA 3HJZA 5D33A 3NPXA 3P61A 1DV7A 1LP6A 2EHHA 4Z1CA 1THFD 1ICSA 3NQEA 5KZMA 4GUJA 3HGOA 1HTIA 3G1SA 3LB0A 3P81A 1H51A 1JRCA 2FQIA 4WD0A 2FDSA 2ZZ3A 3PVFA 2NXGA 4M7SA 4XZ9A 4UTMA 1EEPA 4M6VA 2BLEA 3MUXA 1ME9A 2W6RA 1X6UA 4LWWA 1LRTA 2ZA1A 3HG4A 4ADTA 1XDLA 3TROA 3OIXA 5K7JA 2HS8A 3PBVA 3O1NA 2HSAA 2ZZ4A 3IIZA 4FXRA 3OBKA 4MVAA 1CI1A 2J9XA 1ALDA 3W3OA 3DFTA 4N2YA 1K7FA 4K38A 1SSDA 4JICA 4KKXA 3W1NA 3W72A 3W7GA 3FJLA 3BW2A 3ZWTA 4PL1A 3UNDA 3EX1A 4O12A 1ZFJA 2O7SA 5BW6A 4XKYB 3EWWA 5KTLA 1KBJA 2QCNA 1EX5A 4UTTA 1DORA 1ZALA 3MP4A 3CU2A 3WJXA 1UUOA 3V1PA 3I65A 4RZ5A 1Z42A 4LRTA 1H62A 4OQVA 5G4EA 3TQVA 4IWWA 3T4CA 5BMXA 1O5KA 2ABAA 2BXVA 3HPSA 3MHGA 1AW1A 3MBFA 4FX6M 1H1YA 1VHNA 4OE7A 4Y90A 1M5WA 2YYUA 4N9BA 3S5OA 1WA3A 4ML9A 5E1QA 1FWNA 3SJ3A 3PWAA 1G4PA 1MSSA 5T26A 4ZQOA 1FWTA 1KFEA 2J27A 4WJEA 3UY8A 3VKJA 1XBZA 2C14A 4PFMA 2P1FA 2ALDA 4AF0A 3DFNA 4P61A 4BR1A 4UTTC 1TPUA 1YTKA 4AHOA 3P80A 3NL2A 2Z1BA 2FFCA 3LI0A 4ZVJA 1GQNA 3W1TA 2PCQA 2DP3A 1X8FA 2QR6A 5FI8A 1RZMA 4IXHA 2J9YA 4WY0A 3HMJG 3E02A 3PS7A 1WBJA 5DBTA 1I2PA 1QPOA 3NM1A 3P84A 5KZEA 4GNJA 4MY9A 4UR7A 1RR2A 1QNVA 1YDNA 1QO2A 3NO5A 1A5BA 5D38A 1JUKA 2I1OA 2WSRA 4IX0A 5D09A 3LCGA 3JRKA 1MEIA 4GRSA 3G18A 3BARA 5FEZA 4QM1A 3TH6A 4OGZA 1ZJIA 1J4EA 4YLWA 4JDYA 2E5CA 1EB3A 1TB3A 4UTJA 3R12A 2YYTA 3CTLA 1FCUA 2QF7A 2ZTKA 2PRLA 4MYXA 1F7BA 5KZDA 5K9CA 4Q32A 4RJEA 4AWSA 3LXCA 1GVOA 1LDCA 3BG3A 4O54A 3IV3A 4PL2A 1FWRA 3HG3A 4MLJA 1JCJA 2NXHA 2X30A 3M47A 1RQEA 2WQPA 2CW6A 2VEMA 3GK0A 4TX9A 3P8IA 1QFEA 3G22A 1ICPA 4JN6A 3GDMA 5CG7A 1GPWA 1V7YA 2E6AA 1YTEA 1OG0A 3SECA 2A5HA 2RHGA
chains in the Genus database with same CATH superfamily
4UTUA 4XZLX 3W7QA 3LHUA 1KRAC 1WZAA 1EJTC 3CPRA 2GGGA 4JL1A 1S3HA 2HNHA 2WVSA 1TMLA 4DN1A 1Y7VA 3EDJA 1BFNA 1XLJA 3BJTA 3UG8A 1XYBA 1E40A 1SR9A 1XKJA 2HVNA 4IIBA 5I24A 4FSAA 4RE0A 1EYWA 4RX0A 1FWEC 4X22A 4QBXA 1SYTA 3QTPA 2OJPA 4AHQA 4U28A 4CQ9A 1VBHA 1XPGA 1KW1A 1K02A 1SPQA 1XLKA 3ARZA 4K37A 5H8UA 2I5GA 1W1ZA 2PLMA 1FA2A 1K03A 3TCSA 3BAIA 4JZ5A 3V0TA 1MI3A 2GOKA 5ABEA 4GABA 5CZJA 4UFIA 1VYSX 3QPYA 2Y8KA 4NL1A 4PMRA 3N4EA 4HNUA 3IPWA 4IG2B 3NEVA 4LPCA 1L6WA 2NLIA 4PTVA 1YMYA 4JX4A 2Z1KA 1K8ZA 3IJQA 3FW6A 3WFZA 2PGFA 4B2DA 2CESA 4LS1A 4O19A 3I7SA 2WSYA 3EXRA 5DF0A 5FD0A 2EPKX 3N34A 4ZQPA 1QWKA 4MAZA 4INFA 4JTTA 4RE2A 4DYJA 1QT1A 2WK2A 3TAOA 3VMNA 1B3XA 1FY6A 3QRHA 3GDRA 1Z89A 3Q45A 3W7NA 2XIIA 1M9HA 2XG9A 3ABSA 4N6EA 3A12A 3PPFA 2PLJA 3OG3A 4FAMA 3DHFA 3JU2A 2OWXA 6XIMA 4DPQA 2QIIA 4HPNA 4J5NA 2XVPA 5A6KA 4LV9A 4ZB5A 4BF9A 1WDDA 1X39A 3N25A 6REQB 5K4ZA 2BSLA 4OOZA 4JTLA 1HJVA 4ES4A 4YMZA 3ZIZA 3WF0A 1EHAA 1KV5A 3W2NA 3VD7A 3F2DA 3CMJA 1ZJAA 3QKEA 3KBNA 1OFQA 1RY0A 8A3HA 2Y8UA 3TN4A 2BXYA 4KH2A 2NT1A 3MO4A 1H7XA 4CU6A 4ZSTA 1QDSA 2B7QA 1LRNA 4S3JA 2YXGA 4TV6A 3GTHA 1J79A 2YBTA 4H9ZA 3QZEA 4HHPA 4WY0F 3S2MA 3IGXA 3M64A 1LLZA 2X1RA 2G3MA 4Y8EA 1OT2A 1M7JA 3R0KA 2GVJA 2YKKA 5C54A 1JF5A 2YX0A 2Z2UA 3VGFA 3DH7A 1CPUA 3CGTA 3FA5A 2PWEA 2JGYA 3APYA 1LLOA 4HTYA 4JFVA 3WK1A 4PBGA 1S2WA 2NW0A 1R9YA 1PVNA 2G4JA 6ENLA 3TK7A 1BTCA 4GWEA 4RNHA 1PX8A 4UR9A 5EL1A 5AC6A 3E2SA 4FEZA 3VKAA 3EX6A 4GZIA 2LLEA 3DFPA 1BPLB 1C8XA 2Z0IA 3Q67A 5FF3A 4HPXA 1VC4A 3U4FA 4WF7A 3M46A 7ODCA 2Z6JA 3VMPA 3WNMA 3STFA 3S3GA 3BG9A 1HO1A 2WZIA 4NI8A 1VFSA 3TC3A 4YTQA 4Z1BA 2O4QA 4PCFA 1R30A 5EMKA 2A7RA 3KCOA 1V3MA 3L12A 3TQKA 4RV3A 5CGTA 4TX6A 3TX9A 4KGJA 1Z41A 3L5LA 4AZ6A 2NSOA 3ABRA 4GG9A 1WNOA 4Q6XA 2JEQA 2OKTA 2YDAA 4L5ZA 3SCTA 4YNGA 2HK0A 4PUWA 4LC8A 4A05A 1MUMA 1JZ4A 1K6AA 1QPNA 5BCAA 4HPGA 3CZLA 2PDGA 2D22A 2VWSA 3CBWA 4W8LA 5BWFA 5TIMA 3SN1A 4LUSB 4NAFA 4TUFA 1SVDA 1YBQB 3B8TA 3GNNA 4DWSC 2EAWA 4JX5A 3WLOA 3COTA 4N4PA 1AUSL 1DBTA 1OK4A 2QUMA 9XIAA 1TA3B 2ZX8A 4I5UA 5FEWA 2ZUTA 4F8XA 2E68A 2NVAA 1LF1A 2F2KA 4MNJA 3OIHA 3UCQA 3K1GA 4M1RA 4JDBA 2RJHA 5E0CA 2WHKA 3QZAA 7CGTA 4DJFD 1S39A 2QUVA 1LORA 2A3HA 3CHEA 3KE0A 1R8LA 4PUJA 3TC7A 1IXQA 4IQDA 2GVYA 4HU3A 3B9NA 4RKAA 3BO9A 2HE5A 2IS7A 5FEPA 3SURA 3G6LA 3TW7A 1QWGA 3IJDA 2QULA 3PUDA 5FSDC 4E5TA 1XGDA 1EO7A 1R5YA 1RLCL 2CLEA 4D8AA 4RLIA 3UFYA 1RY8A 3S1VA 1PZ2A 2CBIA 2ATMA 1F6KA 2F7FA 1EJWC 1YNYA 1H7PA 1M53A 1OZQA 4CQAA 2D2OA 2FZBA 4IMDA 4RZ4A 2ZUUA 4S23A 3CAVA 4LF2A 1XH2A 2AGKA 2D0HA 1TZZA 3W7JA 3WYZA 4UMBA 3UG4A 4GQ0A 1OCQA 2D73A 1UUMA 4O1BA 4EKJA 3QR1A 3WUBA 2PDBA 3VA8A 3WQGA 4R34A 2X16A 2XFWA 2GK1B 4IIEA 4RZ6A 2PDWA 1EYEA 3N9RA 4Z2IA 3M0LA 3WH7A 5DN1A 4LF1A 3WQFA 3UZJA 3K4AA 3SRDA 4L6OA 3TN5A 3T07A 1EGMA 1ZQ5A 1H4PA 3WMCA 5T9CE 3WQ5A 3B0VC 3G1YA 1DQUA 4TIMA 1UMLA 3GC2A 1UR8A 3NGFA 4UQBA 3EOUA 5EFFA 4FB7A 3W38A 3T44A 2HWGA 5LGXA 2GQ3A 1K7EA 3WJWA 3RNDA 4HCDA 4JIIX 1GG0A 3VOJA 1CWYA 4H7CA 4BKNA 1JJKA 1TPEA 3GFYA 1WV2A 1RCXB 3GNOA 5CPOA 2PDQA 2PS2A 3WQEA 1OGSA 1P7TA 1QPRA 3B8SA 4WKAA 4B5UA 1BYDA 3L2IA 3EMQA 2VHLA 4NXKA 2PRMA 4H83A 3IK2A 3IAPA 4F40A 3CUGA 4DXKA 2C6QA 4JPGA 3AXXA 2V5JA 1HJQA 2QJIA 1EXBA 3BICA 4OWGA 3IVUA 2BNJA 3SCSA 3HBLA 1V79A 3M1ZA 1ELSA 2E3ZA 1XD1A 3EA2A 1X6NA 2WO5A 3AHTA 4A29A 2YL8A 1JCMP 3CK5A 1OGBA 1K9FA 1CLVA 4PA8A 3LRLA 1G4EA 4WSHA 3C52A 4LVBA 4YN5A 4C6OA 3MYPA 5CZTA 4U5KA 2EQDA 3RIKA 4IQEA 2Y62A 3PTQA 2J88A 1HN1A 4GI6A 1WQ5A 1NSJA 1W8SA 3GG1A 2ZXDA 3E5BA 3GIYA 3OBEA 4WJ8A 2YA0A 4AVOA 2POTA 4DELA 2P8BA 4FIQA 5BXTA 3TXVA 1VRXA 3MV11 4Y9PA 1QASA 3APGA 3GBDA 4HN4A 2PP1A 3TFXA 4C90A 1WP6A 3R43A 1Q6OA 4G5DA 2QCGA 4NX5A 4CNSA 2E5BA 4RCXA 3U0HA 2YFNA 4IX2A 4AY8A 3RLUA 2VEGA 1V08A 1TQXA 3VUPA 4IUOA 3EWBX 1AH3A 3NL5A 2BY2A 8XIAA 3DC0A 3N9KA 3FKRA 3OGRA 1WZLA 1XIGA 2VO5A 3E0VA 1UPMB 4MKSA 3GO2A 3AOFA 5EMLA 3VCRA 3W86A 2ZDRA 3G24A 3DESA 1GZJA 1BRLA 4DZ5A 2J79A 3RR1A 3WFAA 2G3IA 5LSMA 1H7WA 1YXCA 5TQLA 2X42A 4ICMA 4L61A 2XVGA 2CLKA 4MZ8A 3NQ7A 4DWSB 4UXDA 3IJ6A 4AD2A 1VGAA 5ECUA 1GW1A 2Y2WA 4I7WA 1M68A 4HJWA 4QSFA 2UY5A 3DFYA 2FTYA 3O63A 4GVIA 3U57A 3EOSA 1DTNA 4R85A 1B4KA 2Y5EA 2ZC8A 1PV8A 1R3VA 3B03A 3R10A 3GU1A 4CN4A 3RU8X 1SFLA 3RF9A 2VR4A 3C5QA 3PNUA 5KITA 1QW7A 4IFOA 4C1KA 3DC8A 2O9OA 3Q94A 2WVVA 3QMTA 4JCLA 3A5FA 5CCZA 3VNDA 1W1PA 2R1MA 3S2CA 2YLLA 3QFWA 1YQ2A 1OY0A 4GXWA 4OUEA 3WDJA 3UR7A 3SDOA 1HKKA 4CQDA 4Z2LA 1VAHA 4BA0A 1IIHA 1MNSA 2WMFA 4GH3A 1ZJHA 3I7QA 1OM0A 4R53A 1Z69A 1KRCC 4QJ3B 3SCRA 5EFDA 2X1TA 1FKWA 1PL9A 4ACZA 2WKJA 5F4SA 4ZENA 3CWNA 1NTHA 3BW4A 1XLLA 3GWQA 2E40A 1B9ZA 1V0KA 2Y7DA 3ECQA 5ABGA 1WXZA 1QBBA 1CEOA 4UFLA 3GLCA 1GOXA 3HPXA 1EBHA 1VIZA 2GL5A 3BJSA 3W83A 1XS2A 4GXPA 4LAOA 1PYMA 2VCCA 3TONA 3JZEA 5AYBA 1W5OA 4TVDA 1EGVA 1HW6A 3EKLA 3H2FA 3BPWA 4I3GA 2EG7A 1I2OA 3QH2A 3DX5A 2DVXA 3LS9A 4LS2A 3B9AA 1VEOA 3ALFA 1KA9F 2AQWA 1EQPA 3TVAA 3GW3A 1KFBA 1MFVA 5DLCA 2YGYA 1G69A 2ZWYA 1VYRA 5I03A 2BTMA 3KVKA 3ITCA 2WBKA 3FSUA 3BLFA 3UYCA 5LHFA 4QRNA 4HSHA 2AKZA 3PJUA 4XAGA 2C8NA 3AO0A 3GNRA 3CZKA 4LB4A 3E3HA 1UBSA 3TKFA 1O68A 4TVCA 4HNVA 4PTDA 4C1NB 5M1TA 3LGEA 2VGGA 1OFDA 1JI2A 2FKPA 3NQVA 4QISA 5AYIA 1HGYA 3T7VA 3AUJA 1TV8A 4R3UA 3USBA 3GAYA 1R3WA 1JFHA 3ISIX 3IJ8A 1W32A 5CSRA 2ACSA 3G3DA 4XBSA 4K1GA 1KKRA 1P4CA 3TYUA 3OGVA 1P43A 2GJLA 3WLMA 3B9DA 4JR5A 1FTXA 1IWBA 1XH1A 1VR6A 2BHYA 3ES8A 3O7UA 1OHLA 5AHNA 2NQ9A 1KTBA 1TJ1A 2CLLA 2FB3A 3PFMA 5D2YA 1HL8A 1B0IA 3CHVA 4LVFA 4BFAA 3ZT7A 4NF7A 4TVUA 3T8LA 3CUZA 4MNMA 4FXSA 4DQWA 3HPAA 4DF2A 1DJHA 1IR1A 2EKCA 3T1GA 5HMDA 1H1ZA 4HMCA 1A47A 1NU5A 3CWOX 2DZBA 2ZZ7A 2OSXA 3M5YA 1TV2A 1FHVA 4Q4QA 4H19A 2VDGA 3MCNA 1E4MM 3QHNA 3TMQA 5AY7A 4XK2A 1VP5A 4D1JA 1QRQA 5BOEA 3WNLA 2PZ0A 1LL4A 3UXDA 2CPUA 4FNRA 4LY8A 1O94A 1GVSA 1OX5A 1OADA 4ATDA 4H6QA 3A47A 4ICNA 4LNCA 2XYLA 3QC3A 3MZ2A 1REQA 3WH8A 1M7PA 3KOWA 4K68A 3GKFA 5A6TC 4DWSD 3VYLA 1QI3A 1X38A 3PB2A 1K8XA 4D8LA 4XIMA 2X2YA 2DV0A 1UR0A 4D6JA 2HQAA 3SSZA 2WPBA 2XH4A 1HXJA 3WF4A 4DBUA 1KV8A 3DECA 1IZKA 4HKPA 3W29A 1XIBA 3GHSA 3GX9A 3WLPA 4MF4A 3R13A 2V2HA 1GWJA 2FYMA 3NQBA 4GE8A 5XIMA 2X0YA 1AMKA 1ME7A 3AXHA 1EHNA 2C7FA 2P0OA 2E28A 3B8IA 3FY1A 3STGA 1OSEA 4U33A 2ZUWA 3F1QA 4WK9A 9RUBA 5CPNA 4HNNA 2NX9A 1W91A 3NGJA 2CHOA 4A3UA 4UTFA 1A5NC 4D6GA 1I0BA 5EMYA 1VQTA 3OLGA 4YVPA 3MMUA 4V27A 1PKMA 1ITUA 3HQPA 4C7GA 3LM7A 4DX3A 4Q8TA 4GYPC 3UPMA 4CQBA 1E9IA 1E73M 1P6WA 3SUWA 3LX9A 2Y7GA 5DMMA 3W26A 1OF6A 2DUXA 4Z1AA 1BTMA 1NOWA 3RAOA 1P6BA 3VGEA 3WBEA 3VNZA 4U4MA 4RE3A 4HA4A 1POKA 4H9YA 1B3ZA 4H9TA 3E5PA 1E1CB 4XV0A 3LSCA 5LIWX 6TIMA 1ML1A 1KKOA 1XIHA 1EDGA 3MDWA 4EX4A 1XICA 2DU2A 1W54A 3ITGA 3L0NA 3MA8A 2WW5A 3ITVA 2YL9A 5G4HC 2PTXA 3L5MA 1VJSA 3W1RA 5F4XA 2W9MA 2NQZA 3ZSTA 4J2PA 2EO7A 4AMAA 3BJFA 1NY1A 3WQPA 1PDZA 4W86A 2NZLA 4PTWA 1PCKA 4GQQA 4L4PA 3N2TA 1DJZA 1VCFA 4Y9OA 1XRTA 4KWWA 2X1SA 3QMSA 4E4UA 4GUFA 1TPWA 5K2ZA 5I77A 4WUIA 4UQCA 4DXVA 4FO4A 4Y2WA 3UPBA 1QW8A 4GGHA 2H8XA 3WH9A 3ABQA 2FPVA 1CGTA 1UKQA 1E5JA 1OCNA 1V6TA 3MCOA 5HULA 3DZ1A 1WX0A 1PHWA 3HN3A 3OZPA 2WNZA 1CB7B 3MT1A 4S39A 1D3HA 2ZXQA 4HMNA 1A5KC 4YVXA 2WOQA 2IKGA 2X1UA 4X9YA 4GJIA 4Q7IA 4GFSA 5HR6A 1U83A 1WPCA 1EEXA 3PY2A 4I7UA 1GPFA 1XDJA 3RJXA 3VC6A 3EX4A 2FVMA 3UXKA 5C9WA 1A5OC 4R9OA 3XIMA 1NQKA 4L1GA 3LEPA 3PPHA 2C79A 1CTNA 4NNCA 1SMDA 4H01A 3DI1A 1B3YA 4PULA 1CT5A 2CZVA 2J25A 5FL0A 3TYAA 4C6CA 2VC5A 3HV8A 2RH9A 3SN0A 3QGAC 1IEIA 1W5NA 4HU4A 5A8MA 4A2RA 2QJJA 2WZHA 3MP3A 5C7VA 4EWJA 4WXYA 4O8RA 1LBLA 4FIRA 3IEBA 5EBAA 3PPGA 3PZ9A 1WXJA 2XVKA 1MMFA 5GJPA 4NYYA 3U8GA 3WK0A 4MJMA 1YRRA 1KFWA 2PB1A 4UOQA 1XR2A 1KLYA 1C90A 4OHQA 3MHUA 1HJXA 4AH7A 3RO6A 2W79A 3HGRA 4AEFA 2CWNA 3MSGA 1S46A 1O12A 3C3NA 4PSPA 4ZO7A 4GC4A 2CLMA 1JRBA 2FPYA 1V3JA 2G3JA 1H60A 3BUVA 3MSDA 3REQA 3I6TA 4FNQA 1WDRA 1NDWA 1O6IA 1MXSA 2BGQA 2F61A 5HATA 5DRIA 1LQ2A 1E51A 4XO7A 1K9DA 2ACUA 1UH3A 4C6IA 4OECA 2H8ZA 3URQA 1TZ7A 1FWBC 1W9DM 2Y88A 2FMOA 4PH6A 1ZBVA 1TREA 1O66A 2PD9A 4MJZA 1A49A 2XIMA 4PB3A 4UIOA 3TR9A 2BFGA 3NYZA 4HOZA 3W1MA 2OB3A 1HO4A 5FJJA 1TJ2A 3HG2A 3BMVA 2YB4A 3SRHA 1E3XA 1NAL1 4Q4RA 1LCOA 4KEUA 4PZVA 4GO9A 1KBKA 2REQA 3AZSA 3RK8A 4AY7A 4ZQMA 1XRVA 3P6LA 4Q7NA 1BXNA 1XIJA 1FH7A 4HZMA 3GM8A 3W01A 5CJNA 2CYGA 5GPRA 3THQA 3MWAA 2E9MA 2DSUA 1KM2A 2DVTA 3T2OA 1VRDA 3OOQA 5REQB 4YL2A 1KGUA 2W63A 5E0KA 3AMCA 1OWQA 3H4GA 1V3HA 3QBUA 1UD2A 3ZXWA 5M17A 1XF0A 2VTFA 2EPMX 1G4SA 3R0DA 1W1IE 1HT6A 2VFGA 4JYDA 1P1XA 2X40A 3KX6A 4AZCB 1ESWA 3L23A 1W1VA 3S0CA 3FK4A 4OV4A 5E6ZA 3FFSA 4G1KA 2C91A 1EP2A 2GSHA 3HU7A 2R91A 2CLHA 3KTCA 2EF9A 3TV8A 3MKCA 3FHAA 3NSNA 2GVGA 1GUVA 1FWDC 5G1YA 3SGZA 5C5YA 1EA9C 4O52A 1DJQA 3XINA 1ZRQA 1QI0A 3O07A 4ZB2A 1EUAA 3KOYA 5J5RA 1E6ZA 5EMUA 1JPDX 1M7OA 2ACQA 5FEXA 3EWUA 2WM0A 3WNKA 2DJLA 3O0FA 2J7CA 4IZGA 1KM5A 3WFLA 3KVLA 1WXYA 2QJGA 1JR1A 4C6QA 1JULA 4PSRA 1P48A 3NQFA 3FS2A 3AMKA 2DSZA 3CUJA 4IG2A 1Q2RA 2YXOA 2ACRA 3PZNA 2ZX5A 1JIBA 1ISWA 4E3TA 1E3ZA 3S9ZA 1CXEA 5LNUA 3KZSA 4KEMA 3W84A 3M4HA 3R94A 4ERIA 1K6WA 3KDOA 3CB3A 2F6KA 2WANA 4GBDA 3URAA 2PI6A 2NUYA 2IW0A 4E0CA 1O4UA 3LRKA 5IFTA 3VKBA 3EKZA 3WCZA 3W2LA 1ZBKA 1CGYA 1PTAA 5BMWA 3NTYA 1DIEA 3IUHA 1TPFA 5I02A 2QCDB 2QCEA 3QKZA 4IJBA 4QG6A 1PUDA 1B3OA 3PP7A 4CEUC 1XI3A 1KRMA 3TOYA 4FR1A 1DV7A 2J7FA 1MUWA 3ARUA 3QLLA 1THFD 3WG6A 5EMJA 2A3LA 6REQA 4FXFA 3AIQA 1HTIA 3WQVA 1KBLA 2FQIA 2NXGA 4M7SA 4BEQA 2WM1A 4M6VA 3VKCA 2HDJA 2BLEA 1JD7A 2W6RA 1FWFC 4GKLA 3HG4A 3VOIA 1XDLA 1V0NA 1OINA 3O1NA 2ZZ4A 4H6RA 2GDUA 3OBKA 1CI1A 2ASHA 1ALDA 3W3OA 3DFTA 4JQ3A 1XLFA 1SSDA 1HGWA 2P76A 3FJLA 3ZWTA 4O12A 2O7SA 4F2BA 3EWWA 5I78A 1KBJA 3VNLA 3KZPA 1Y65A 2HNEA 1DORA 2WJEA 2YCIX 3I65A 5DT5A 3H24A 4RZ5A 5G4EA 3S2NA 4H7VA 5CLTA 4KIRA 3VM5A 3T4CA 4G7EB 4GPNA 4MUPA 2R6OA 4OE7A 1J0YA 4Y90A 1M5WA 2ISFA 2J4GA 3KS6A 3CAQA 3GH7A 1HIZA 5E1QA 2BV9A 1OEPA 5FJIA 3BH4A 4QXIA 1FWNA 2QV4A 4DUXA 1MSSA 5T26A 2WC4A 4WJEA 4HU8A 2C14A 3MKKA 2YDSA 2W67A 2Z00A 4P61A 1AH4A 2VQUA 3NL2A 2JF6A 4ZB0A 2PCQA 1X8FA 5DMYA 2XGZA 5GNYA 3L4WA 2YL5A 3KBWA 2J9YA 3V5OA 1GVYA 1RCOB 2UZ9A 3WENA 4RPQA 1UKPA 2O9TA 4MY9A 3GDBA 3S1GA 4AC1X 1RR2A 3NO5A 2VRJA 1E4LA 1JUKA 2Z29A 2FH6A 2I1OA 3AMDA 3BSHA 3D5HA 3STPA 4IX0A 3SJNA 5D09A 4GNVA 4GRSA 4WVXA 3BARA 1R0MA 4OGZA 1D8WA 1RVKA 1YKWA 1X6LA 2Z24A 3LN3A 2E5CA 1JZ3A 1F7BA 5D8ZA 3NXLA 3P0WA 4RJEA 4LX4A 4AWSA 3T0CA 3BGAA 1R86A 1LDCA 1GKPA 5E9XA 3GU2A 2VUYA 4O54A 1M65A 1YBQA 1FWRA 3LQGA 5BRQA 3M47A 4GFIA 1RQEA 5A1AA 4TX9A 1QFEA 3PZIA 4Q8UA 1ICPA 4JN6A 5CG7A 1GPWA 4KW2A 4MDOA 5I6SA 1UZHA 2E6AA 3SECA 3VOHA 2A5HA 1BVNP 2IKIA 3WH6A 4Q4PA 1QATA 4C6FA 1V0LA 3RCMA 4EP8C 3A4WA 1PKNA 1Q85A 2BBFA 2CETA 4DO6A 1BF2A 3QV9A 3P5YA 1ONEA 5KEZA 3YPIA 5EPDA 4ATWA 4GACA 5CKSA 2J62A 3UP8A 4CD4A 1W2VA 4R7OA 3WDPP 1TX2A 3OP2A 2OELA 4YS1A 3CZ8A 3HGJA 3HURA 2WMIB 3CAWA 5CEWA 1WUFA 3U7VA 3MUZ1 3R79A 2QAFA 2QGHA 4MHBA 5LIUX 1ZP4A 3CNYA 3DKLA 1FCVA 3I6RA 4NXSA 3AHZA 4HVXA 2G37A 1QVBA 1RLDA 4AMCA 4JXCA 1BVZA 1D7KA 1WKFA 2OFJA 3LK6A 3NNTA 4P8VA 4QS6A 1IR2A 3PZUA 1AH0A 1MO0A 2WXDM 3FGCB 2XVNA 3V35A 1XYMA 2ZZ5A 2I9UA 1NFGA 3W6LA 3AZTA 4MY8A 2ZX6A 2ZA3A 3W1PA 2P5NA 3SR7A 1WKDA 3LA4A 1EUNA 3M44A 3BSMA 1EQCA 1F5ZA 1AW2A 3KBJA 4CNPA 4XD5A 1XYAA 2OKOA 3W07A 3WLTA 3GC4A 3TC6A 5DY3A 4GK8A 3POHA 3GHTA 4GUIA 1VS1A 4JTAA 1AJ2A 1XFBA 1TIWA 1JZ7A 4LGXA 2DQWA 3WO8A 1U22A 2OXNA 3RLVA 3E1F1 1IWPA 4M81A 1W2PA 5LNVA 2DGAA 3G0SA 1W1A1 3G1XA 2WNNA 1NOFA 2QVHA 3EA3A 4HJFA 2A2IA 4WX2A 2ZRZA 4FNSA 1GOMA 3CV1A 3B8WA 1GQLA 4AZBA 2TODA 2X05A 2X7WA 1ZNNA 3WD3A 1T0OA 3VD3A 1GOKA 1JDDA 5BOOA 2OQHA 1QOQA 2B31A 4DI9A 1YEYA 1OBAA 2PPGA 2C18A 2Z4GA 4GI9A 1Z32X 1R2RA 4PMQA 4H04A 4LW7A 1BVWA 4M3PA 5CJ5A 1V3IA 5CGQA 1RD6A 5AOUA 1XQLA 1D3GA 1EWDA 2W4XA 3N6QA 3MPGA 1TVPA 3DU0A 5AHFA 5IOBA 4MB4A 3GVRA 2INZA 4ZEPA 1J0HA 1F9CA 5DCBA 3ZVHB 4WDTA 2J75A 5CPLA 4X3ZA 4M7TA 1KM1A 4DO7A 4KCUA 3DBNA 4JBRA 1UA3A 3K30A 5CQ1A 2BVWA 1LWHA 1C91A 4G7FA 5DELA 2Y5JA 4IQJA 3SRFA 3UERA 2BP1A 3GH5A 3F4CA 4Y9AA 1CDGA 2IKJA 3GXMA 2YW3A 3VIIA 2XGBA 4MLRA 1DXFA 2ZRWA 2HEJA 1I4NA 5LNSA 3CUFA 2NQJA 2EGZA 1Q6GA 4W7UA 1FDYA 5CC6A 4QG9A 2B7OA 4B91A 4S2BA 1DXIA 3VGDA 4D72A 3R25A 3RLGA 1WB0A 4AYGA 3UWQA 3OJGA 3VNMA 2DW7A 1LG1A 1MVYA 4CVWA 4PCTA 3GNXA 4URIA 3GG8A 4Y9NA 3N15A 3M0VA 4GI4A 1A3WA 3E9AA 2IXVA 4AZGA 1NDVA 3N2BA 2J13A 1YLVA 4H9UA 3TJ4A 3Q2DA 4HYRA 5CSSA 2ZZ2A 4GHRA 4LUTB 3CV2A 2HV5A 2YOCA 1LJYA 5CZ0A 4ADSA 4UCFA 1SW7A 4HNTA 5I3GA 2Q01A 4IJRA 1KTCA 1W3IA 1CLKA 4KMQA 4I9TA 4N42A 3TNBA 3PBMA 3DFSA 4I9MA 4AEEA 1ZAIA 2CIPA 1JQVA 2GVLA 3R2GA 2C15A 4H8HA 1L6YA 1EXPA 5HXMA 3UXIA 3LENA 5A8OA 4GIYA 3NPUA 2WMGA 4GINA 3LM3A 1GTEA 1YNQA 2OODA 3TYEA 3SUUA 3RILA 5D4YA 3KRUA 1QI4A 5KZ6A 4ZFMA 3KBMA 5C71A 1XLIA 5H8MA 1P1MA 1XC4A 1TTPA 2ISWA 4LEFA 5CBIA 3W6MA 1K9TA 5CLWA 5J5DA 2D0FA 1OYAA 3K5XA 3MI2A 1UOZA 3NIYA 4GXMA 3CV7A 1JZ5A 3KTXA 2C19A 3VCCA 1PTDA 3QM3A 1NF0A 3UZXA 3BANA 2V5DA 1VFOA 5F2LA 1BYAA 4PCSA 3RCNA 3W70A 3V7PA 2X2GA 3GKAA 2P3ZA 4AZ7A 5TF0A 3RCYA 1QNQA 1W31A 2WYSA 3LNMA 5K9XA 5I3IA 3UGRA 3OPSA 4IGHA 4AD0A 4A22A 2PDMA 4W5UA 1FXPA 2XFRA 1PZ0A 2FGLA 3IACA 4L56A 1BSLA 1M1BA 1QUMA 3CV6A 3C6CA 1JNEA 3A4JA 1H0IA 3K8LA 1Y5WA 3AC0A 4S3AA 3WZ0E 2XH0A 1AL7A 3HIJA 4V2XA 3W1LA 3QR3A 2E6DA 4MGGA 3T55A 3AQUA 3WLRA 3P67A 3TWAA 3L66A 2CZEA 1VLIA 3G0UA 1U5HA 3OVRA 3TDFA 4WRHA 3IJ7A 3I7RA 4XBKA 4KFPA 4RK8A 4BHYA 4J28A 4QSHA 1QNRA 4DAFA 4C1NA 1HQTA 1XIEA 1VCGA 4F2UA 1KO0A 3THAA 4YVVA 1GORA 2QPSA 3NSMA 4UTKA 3HGSA 1KB3A 1B57A 3CS2A 3KBSA 1BYBA 4N4QA 4QLKA 2WMJA 3STEA 1VF8A 5AKQA 3AZRA 3M5XA 3DAQA 1B9BA 1EC8A 5E09A 1F8IA 2BOGX 3LI1A 3QHMA 4TTUA 4DJDC 2A21A 4HTBA 3OHMB 1F05A 1HNYA 3F2BA 2QUTA 4MZ1A 1JZ6A 5A94A 2E5DA 5AFDA 3GFZA 3W1QA 4C1LA 1Y0EA 1PKLA 1SSGA 2WVTA 4L9ZA 5JH1A 2OX4A 1PX4A 3QPZA 1IF2A 2B0MA 2WMKA 1RAKA 1D3CA 1DWAM 5FJUA 3M0ZA 5C2GA 4MTVA 3O16A 3GRIA 4C6PA 1LRQA 3U2ZA 4C6EA 3MSYA 3NDZA 2ADAA 1TTIA 1FH8A 3N12A 2ZUNA 4A2SA 1GOOA 1VYPX 1B90A 2VEFA 1DL3A 1JZ8A 4G8TA 5A3HA 4OTKA 4X0VA 3SFWA 1GONA 5EGRA 3WN6A 1WKEA 3SY5A 5KETA 4CN6A 3CIWA 4YHGA 3BCJA 3UPWA 5HPCA 1UUQA 2FGZA 4UFKA 3WLKX 3XISA 5C9ZA 5I3FA 3LY0A 3NZQA 1FHLA 1NIUA 5I79A 5EBUA 4JCMA 3EDKA 3KRSA 1XHGA 5CPMA 2J74A 2ZRUA 4G6CA 4AXNA 4A4AA 4RNFA 5LNRA 1UZ4A 1ZTVA 2TRSA 3T0AA 2E9LA 3BMWA 4OVXA 4U31A 1XRFA 2D2GA 4J1OA 3IK4A 3TA6A 3FDGA 1RV8A 3VNJA 1JUEA 2ZRYA 1E6XM 1XL9A 3O9NA 3WELA 2VX5A 4UOZA 4QG8A 3L9CA 1Q6RA 4M6PA 1UWUA 4JN8A 1LG2A 4DO5A 4E2BA 2C13A 3HOJA 3UJFA 4V28A 1QXLA 5HK4A 2QCCA 2QCLA 2ZZ1A 1NF7A 3CZGA 1Q2SA 1RD5A 5AB3A 4CVUA 4EOUA 1BG4A 3O15A 4NAEB 1XYLA 4B5SA 3LRMA 3ZM8A 1TTJA 2G5WA 3T2PA 3SZ8A 1A80A 3KWXA 5LIXX 4BQ5A 3W1AA 3H7VA 3EBVA 2GGEA 3TYDA 3C2EA 2RGMA 1UR3M 2Y63A 2YXXA 1H49A 4DBSA 3KL3A 1S2UA 3VKDA 1RA0A 1KCZA 2WCGA 4IXXA 2I17A 4WDWA 1FWHC 4OOUA 1R7OA 2PU0A 1M7XA 3GAKA 1PIFA 4PBEA 1AD4A 2PBGA 5BROA 1GZGA 3GBEA 5G2IA 1UWRA 3K13A 1KBIA 3UYIA 2OZ3A 3UA4A 1HX0A 2YCJA 1JGIA 3TYCA 3RPMA 1B2YA 2V5BA 1UWIA 5DT7A 2OVLA 1ENUA 1C8YA 2C71A 3WQ8A 3GZAA 4JKKA 2DT3A 4N7QA 1OFEA 3AHVA 1XLAA 1SJAA 4MIMA 3UXLA 3W7HA 3LV6A 1AD1A 1GHRA 2VC9A 3EOLA 4LYKA 1WZMA 4M51A 4LY4A 1V3KA 3FEMA 1JDCA 3SI9A 4UC5A 2GJNA 4JQ2A 1LUCB 2CBUA 3B4UA 1WDSA 1MEHA 2PAJA 2QCHA 4R33A 2C16A 1XFCA 4K39A 3L7RA 2V81A 5D9OA 4FNPA 2ZFAA 1DWFM 2YIHA 1XLMA 3I3EA 5ECVA 4M8UA 3VC5A 4WIWA 4JN7A 1R7AA 2BDQA 2J7DA 2GPTA 4KCWA 1GKRA 1BHGA 1XWYA 3STCA 3AIBA 4R88A 3E2VA 5IHRA 4ONVA 4JGDA 4M24A 3VDAA 1TSIA 3C0QA 4GY0A 2OLHA 3WD0A 5D2XA 4RE4A 3DDMA 4PB4A 2DZVA 5I3DA 1OT1A 4E2DA 4M0XA 4XZBA 3AS0A 3UWEA 2OCZA 2V30A 4E8DA 3QJAA 1DPMA 3GS6A 4HCLA 1VFHA 3CAKA 4LAZA 1NFBA 2BWGA 4B90A 2QIWA 4P8UA 3C61A 2C1GA 4JYEA 2WNQA 3N3MA 4BEUA 1UPPA 4POCA 4LANA 2VEPA 2EG8A 5HBFA 3AIRA 1Z48A 3R5EA 1KCXA 2VL4A 2F6UA 1H0GA 2V5CA 2TPSA 2VZOA 3W02A 4KESA 1W9BM 3CYJA 3GW0A 2BASA 5CC5A 4AXKA 1Q66A 1GYNA 3WLQA 5D2TA 4DF0A 5HAOA 4OBTA 3GXDA 1QOPA 3BGJA 3U2CA 4Q4KA 1FUYA 3BC9A 2KZHA 1BQGA 1E0VA 1KR1A 2QMJA 4AY1A 1YW1A 3UZZA 1NWRA 1W5QA 1QCWA 4W84A 1KRBC 1PIIA 4A3YA 3A64A 1O1HA 3O6YX 2UBPC 2YFOA 4FOJA 4O28A 2PDJA 2VR5A 3DG7A 4FF5A 4O1FA 1JYNA 3DERA 4BZYA 3CQKA 4XAZA 3RMEA 4A21A 1ICQA 4ERAA 2DSVA 4EACA 3QY6A 4W4QA 1EOKA 1OQFA 1HKWA 1XCFA 1Q13A 1TCMA 1A0DA 2BOFX 3NR0A 1C9WA 3V0SA 1F76A 4RDWA 2ZZ6A 3D3AA 4K6AA 4NASA 1W9PA 4ZO9A 3CZEA 4LAMA 4H1ZA 2C1HA 2OZ8A 1HKJA 3PZQA 2Q8LA 2PA6A 1H7RA 3UD6A 3QYQA 3HQ1A 2TMDA 4B5NA 5ABHA 2HE8A 1B31A 3HQNA 2PP0A 3N19B 2O7QA 4N02A 2D0GA 4L1XA 3GU9A 1WDPA 3K8MA 4MZYA 3TXZA 4E6MA 4PB5A 3OW1A 3S5NA 5A69A 5LGZA 3T05A 3ZJKA 3BOXA 4D2JA 1Z44A 3W24A 2J7GA 2J7EA 3W88A 5FACA 4NT0A 1YIXA 2QF8A 3ZS4A 2IPJA 2R8WA 2OGJA 1SQ7A 1N55A 1J8VA 2EJAA 5LXEA 3GD6A 2BXZA 4AIOA 1XCWA 1XIFA 3H53A 1F3XA 1PKYA 1L8PA 4PMDA 2V67A 4OZOA 5JU6A 2VT0A 3H22A 3C2OA 4GYPA 4ZOCA 1TR9A 4GC3A 2Y70A 5LIKX 5JIPA 5FF2A 4LOCA 2CZFA 1J93A 2ZE0A 4NQ1A 5E9AA 3M0MA 3MQTA 3PBUA 4DF1A 2FTWA 2A3BA 1QU4A 1HKMA 4KFNA 4F48A 2NX3A 4J3UA 4W9TA 5MHBA 2GOUA 2OT0A 1EL3A 3LCFA 5IRPA 4L4MA 2BB0A 2KAUC 4JTJA 5HMFA 1ZBCA 4ECLA 3BQ5A 3WK2A 4DM1A 1I75A 1TG7A 1VFLA 1XYFA 2Y24A 2Z6IA 3VOFA 1H3GA 1CZ1A 2OT1A 3LOTA 2OQYA 2DPEA 3EB4A 4ZBCA 1CW2A 1UYQA 4KRUA 5FJOA 2A6LA 2CNCA 1XP3A 1YXDA 1NDZA 1GG1A 1E43A 4FLOA 2BZNA 1OIMA 2OYLA 4LB3A 1HP5A 3LERA 4ROPA 2Z2BA 1UR1A 1SJDA 1XC6A 4IICA 2J24A 3DFOA 3H4WA 1TKKA 3MBDA 1O5QA 2A85A 2QZRA 4O1EA 1AL8A 2EPNA 3PNZA 4XB3A 2VQTA 1LL7A 4ZQCA 5FAGA 4BI5A 2X0SA 3H2EA 1HJSA 2WZTA 3ITXA 3WMSA 2B7NA 4PMJA 1T6MA 3CQJA 4UB9A 2DZUA 3UWYA 3JS3A 3LHVA 2PC4A 1OYBA 4W93A 1G6CA 1KNWA 3EOEA 4F0KA 2EBNA 2QMKA 3WIJA 3WQWA 1C8QA 1JDFA 4AAJA 2DQXA 2E77A 2XIQA 4WKFA 3P8JA 3MTWA 3VDCA 3NQDA 1QO5A 4PMYA 3NQMA 3H23A 2WSPA 3NZRA 2AAMA 4FPSA 3VILA 4DJDD 2ZX9A 3VE9A 5G1TA 3N4AA 4B5VA 3UR5A 4UTLA 2OR2A 3W74A 3RHGA 1AQMA 2DUZA 3EKGA 1NELA 4U2YA 2QEZA 3DI0A 4XAYA 2VKZG 1S3TC 2HROA 5JBFA 1W9VA 3P74A 3OVQA 2JFEX 1E1EA 4GY7A 3VNKA 5AHIA 3EWXA 1ADOA 3GXTA 4B3ZA 3M0IA 3H6OA 2PRHA 4Q8QA 3DCPA 1UW9A 1XBVA 4OJYA 3G2GA 3MI3A 3FEQA 4I9JA 4B5TA 1E9ZB 2E6YA 3LHZA 1GVEA 4TU1A 3VTRA 4GCAA 3LCIA 3ATYA 3CQHA 4Q3MA 4NY2A 3B0PA 5AC7A 4JQAA 1VZWA 3BVJA 3HTWA 4XD6A 3NO1A 3CPGA 4I7VA 3SN4A 1UWSA 4CCCA 4Z1DA 3AJ7A 4KRZA 4TMBA 1U2YA 1SFJA 4CU8A 5I5RA 3PK7A 4HYWA 4RNIA 1MZRA 4EAMA 3QSRA 1HVQA 3CL6A 2QPUA 3JVAA 5C8BB 3E2QA 3TTQA 2YCLB 5CG0A 2QNEA 3QY7A 3B8UA 3SM0A 2J7HA 4PCNA 4XQ6A 2TAAA 2DH3A 5FF0A 2PWHA 3TYBA 1SMAA 1ADDA 3TQPA 3ES7A 4GYJA 2OU4A 3M0XA 5I23A 3LGDA 4DVOA 1DXEA 4G7EA 4A3HA 1MEWA 1P0BA 3UEQA 2CERA 3A21A 3CMGA 1SO3A 3TJXA 3E74A 4DO4A 3EXSA 1X1OA 1ITQA 4E38A 4XISA 3G1DA 4PCPA 5HR7A 4E8CA 3T78A 4BWLA 4MPQA 3KOXA 1D2KA 2ZADA 3A5VA 4RZBA 1Q7QA 4NAFB 3WMLA 1KFJA 1R3QA 1VBGA 5GQBA 1ZAHA 3LDVA 1KWGA 2OLSA 2WLZA 4YYFA 5JVLA 3MDUA 1NEYA 1RPXA 3PBYA 4LCRA 1G9HA 4ROQA 1HVXA 3RLHA 2DEPA 2GDVA 4L80A 5EMMA 3H4XA 1F3TA 2A3AA 4P8WA 4GQGA 1VPXA 1NP2A 4ILSA 4IL2A 2GJXA 3PSWA 2ISDA 4QLJA 4JX6A 3L4YA 3HMCA 3CQ0A 2ZXAA 3GB6A 1E0UA 1ODZA 1A5CA 3KP0A 4ORMA 1ITCA 5DRCA 3FJNA 5K3VA 4B2DD 5LZLA 1ITXA 4BQ3A 5D03A 2V8ZA 2VX6A 3M7SA 3VD9A 3WJYA 3U2EA 1ZCCA 3WQ4A 4MJ4A 3FAXA 4NI3A 2OWCA 3ITOA 4QQUA 3P5ZA 7TIMA 3VIFA 5CSUA 3H26A 4J40A 1C92A 4JIPA 1Q6DA 1N82A 4AX7A 1ISZA 3BV7A 5HUOA 1JL8A 1YTDA 4YXGA 3BV4A 1OD0A 1HL2A 1HF6A 3DYPA 3P62A 5GJNA 4RNJA 3EDFA 2RDTA 4H7ZA 5HA7A 2VI0A 4EAYA 3W53A 3EEGA 1UR4A 3GHUA 3G8EA 1IT7A 4DRSA 1JCYA 1P0KA 4PTNA 1GKQA 4LVGA 5J04A 3KHJA 1UASA 1IZCA 3KVMA 1WOAA 3SCNA 5LHEA 4HIBA 3MMWA 5E93A 2W66A 3OVGA 1YXYA 2XIBA 1O95A 1Q7MA 4LUYA 4F2TA 3OODA 1ZENA 2F6XA 1MYRA 1FBAA 5DANA 1IT8A 2CHNA 4MAVA 4HK7A 3P93A 4M19A 1QK0A 1V6VA 4CEXC 3UETA 1G67A 3BXWA 4C7FA 1VHCA 2VNCA 3T8QA 3W23A 3PBWA 4ZQNA 4JD4A 2NV1A 3WNNA 5F2IA 1XPYA 5DO8A 4FR6A 2PMQA 3NEHA 1F73A 5LYRA 1J6OA 5BWAA 3UU0A 1P7TB 4ZZ9A 3QV8A 4GGBA 3TOPA 3GY1A 4Q4SA 4ASTA 2WSKA 4WSJA 1DE6A 3RDKA 3RG6A 3W85A 4HHLA 4S38A 1PTGA 3CB8A 1R47A 4J7RA 3G1FA 5HANA 2E6FA 1ZU8A 2BOEX 5J8LA 4Q8VA 4H00A 4HD5A 1UWQA 1A0CA 3RFAA 4NJHA 2YCEA 3L4XA 3GXIA 2GQ8A 3JW7A 4AEOA 1H50A 3IGSA 3ZT5A 1PCWA 3ZJ8A 5LA2A 5HJLA 1PZ1A 3ICJA 3NPXA 5D33A 2ESCA 2WJFA 1QHZA 1AZ1A 1ICSA 4QE5A 4QGCA 5KZMA 4JNYA 1VBUA 3HGOA 1JRCA 5A6BA 4WDXA 1ONWA 4W88A 1EEPA 1UH4A 2FZDA 3S46A 3U48A 3T0DA 4U10A 2PP3A 2OOFA 3I3DA 1UKSA 4XIAA 2ZICA 3H70A 1X6UA 4LWWA 3DUGA 1K4HA 3TROA 3OIXA 3KTSA 5JMUA 1UIPA 3PBVA 2NVCA 3IIZA 2WKGA 1YE6A 3QOMA 3WDHA 5FCZA 2V69A 3VUSA 3AYTA 3ZLGA 4N2YA 2YDRA 4XZIA 4HPHA 3W1NA 1ISVA 3W7GA 4M56A 4QDMA 4PL1A 3CHFA 1ZFJA 1WDQA 5KTLA 2EPOA 1EX5A 2VDHA 1BRLB 3PTKA 2VZUA 3C2YA 3BWWA 4XZNX 1DIDA 4D71A 3A3XA 3CU2A 1V93A 1C3FA 1E9YB 4MWAA 1IWAA 3MS8A 3CUIA 1R3TA 5BMXA 4HOWA 1O5KA 2ABAA 3HPSA 5I2UA 1XG4A 3MBFA 2HISA 1H1YA 2YYUA 2PGEA 3WBXA 3QPEA 1WA3A 2OO0A 2XH2A 3EDEA 4ML9A 3CZJA 4DIAA 4Y9MA 3AXKA 3B97A 1JF6A 3PWAA 5JQ9A 1KFEA 3VKJA 1XBZA 4PUDA 2ALDA 4AF0A 2XHYA 1Q63A 4BR1A 2V38A 4N0RA 3VZZA 4BQ4A 3E0LA 4XD3A 2FFCA 1XX1A 4ZVJA 2O0TA 2DP3A 2PSNA 2QR6A 2IPFA 2JALA 4KWSA 1QNPA 4WY0A 3HMJG 2HXTA 3MANA 1Q7ZA 3AAMA 5DBTA 3SAZA 1I2PA 2XM1A 3GH4A 2XGIA 1AZ2A 1QNVA 1YDNA 3VGBA 1VENA 1CECA 4LUTA 4W8BA 5D38A 3QR0A 3JRKA 2I16A 4JIRA 4JQ4A 3Q4DA 2FDMA 4QM1A 3TH6A 4HA1A 3WLHA 4WGHA 1XLDA 1EB3A 1TB3A 1MUCA 3RPDA 3PPCA 4C6KA 2YYTA 1FCUA 2ZTKA 3H7UA 1V7AA 5E6YA 2VRKA 4Q32A 4AIEA 4A8IA 5JBEA 3LXCA 3M0JA 3H21A 2ZVIA 1NJJA 3IV3A 3OO2A 2EPLX 3B0YA 1JCJA 4S3FA 4KF1A 2WQPA 2CW6A 3P8IA 2WC7A 4I5RA 1GZ1A 1V7YA 1OG0A 4WJXA 2RHGA 1TJRA 3LGGA 5CH9A 1TX0A 2H3BA 3EAUA 4ZE4A 1EP1A 4Z08A 4PMXA 3AIEA 3W00A 3ARXA 3W7KA 1O60A 4CCDA 3U5YA 3WNPA 1PEZA 3BLLA 1FHUA 3ARSA 5C70A 2ZE3A 1NWSA 5DFAA 3LHTA 2OZTA 2DFAA 3ELFA 2PZNA 4IP4A 1L9WA 4DBWA 1CGVA 1SUXA 2OYMA 5BRBA 1SGJA 2WC3A 3G1VA 3I4KA 3W2JA 3BURA 4ZOEA 1T8XA 4KCVA 2I9EA 5AC8A 3L2MA 3DOPA 3S5ZA 4B5XA 4DBDA 3EWZA 1MW2A 4DY1A 1K77A 3PWGA 3LHYA 3NQGA 4LUIA 5EB8A 1VBJA 1Q8AA 3OZMA 3KUMA 4FLRA 3TTOA 4XTDA 4IGSA 4PMVA 2HPMA 3P7YA 1FFRA 2W27A 1OZMA 4IT1A 1WO2A 1JXJA 3C8NA 4BI6A 3MI6A 3WLJA 2PBOA 3SB0A 2BY0A 2PC8A 4JY8A 3FDKA 1H5YA 4JEJA 4MM1A 3SUTA 4M6UA 2W62A 1VD6A 3ZJ6A 3PAJA 4H6EA 2YJQA 2FMNA 4LCSA 3NSXA 4IGMA 2J8FA 4GNKB 1VEMA 4A8LA 2BY3A 4JYFA 3SY1A 5PTDA 3KOZA 4LAKA 4EPKA 4UFMA 2PWUA 2HCVA 1AQ0A 4AWEA 1LQAA 4AD1A 4PYSA 1IEVA 1P5BA 5CSYA 4J4KA 4QX4A 3W75A 2XUCA 1XKYA 2OGYA 1LBMA 4G2DA 1UJPA 3AS3A 3HFTA 4S3EA 1FWSA 2R1NA 1FDJA 1US2A 1A3XA 4MWAE 5LKYA 3NQ2A 2ZXBA 3II1A 1TMQA 4P7LA 3VZXA 1F61A 4LT9A 5TNVA 4C5YA 2INEA 5KINA 4ATLA 1HP4A 2FB2A 3LUTA 1EWEA 2NXIA 1DJIA 1REQB 3GSMA 4RV8A 2WLYA 4AD5A 3UWUA 5KMYA 2MNRA 3VVGA 3QY8A 1C9DA 3QHOA 3B06A 3SEPA 3N2MA 4B3LA 2YB1A 4G9PA 1FQ0A 3F4WA 6TAAA 1OX4A 3W27A 2BGSA 4J35A 5ABFB 3S42A 2V9DA 3PZOA 2RUSA 4REQA 1ZPTA 3H7RA 3SCWA 1GHSA 3MCMA 3AWOA 1ZUAX 3UW6A 4DLMA 3NWRA 3VFCA 5HQLA 2H9AA 1BWLA 4H8VA 4ZO8A 3RX4A 3UG3A 4RUBA 3MO7A 3FLUA 1P0DA 2QJMA 3L65A 3MW7A 5KSWA 5I3KA 2CLIA 4IP7A 3NL6A 2BS9A 1BD0A 2PODA 3LZ3A 1CGXA 4N9DA 2UV8G 3E96A 3MMDA 1BG9A 3D46A 2VRQA 3HJEA 1I45A 4JTSA 3GHRA 1XBYA 2VCBA 1R2TA 4Y6GA 2XSXA 2PTZA 1I2QA 4NNAA 3FXGA 1JCLA 1XSKA 2HJPA 5AZ0A 3DENA 4BJHA 3FVMA 1SZFA 3MC5A 2Y1HA 3WY1A 2PDIA 3FYYA 3BE7A 3GUGA 4O14A 4S2CA 3ANYA 4IUGA 3AJXA 4W7WA 2QXWA 4C6LA 3GDTA 2OX1A 3BLOA 1IT0A 4Q8WA 4TV5A 3P0XA 4WLCA 4XAFA 2AL2B 3WL0A 2EXOA 3UJRA 1QAPA 3BQ6A 5D04C 3VINA 1JGMA 1MZHA 5A95A 3NG3A 2DZWA 3NQAA 2DZXA 1GVFA 3WLNA 1Q6CA 4AG0A 3VDHA 2D20A 3THDA 4FP1A 4DWDA 3B0UX 4V33A 5CZSA 2Y4SA 1W9XA 3O2LA 3DYMA 1J0KA 4Z2JA 1ONRA 3GTIA 3NOEA 4X63A 5ABTA 4LFYA 2Q8XA 2QDDA 4CN1A 4ALDA 1AQHA 1O1ZA 4M80A 2VVSA 3U3HA 4LBRA 3CM4A 3TN6A 1UKTA 3ZLFA 1OG6A 1K9EA 3RRXA 4HK6A 3WSUA 4UUIA 2J9ZA 2D2JA 3FOKA 3S47A 1KC7A 3M9YA 4X2PA 3CXOA 5U7SA 2ZTJA 5A8PA 1Y5VA 2V82A 3ARYA 2GDQA 4CD7A 2MUCA 3ARVA 2VOMA 4H2HA 3QSTA 4EPBC 1TPDA 1QOXA 2ZRVA 2ANUA 2E0PA 4DLFA 3PZVA 4IOTA 5CXPA 3ONCA 4PBFA 3NOYA 2PWFA 4LBSA 4C60A 4K7YA 4F66A 3MUIA 5FL1A 2Y0FA 5MKGA 2BG5A 3MVIA 5TAOA 3FXYA 1SM9A 1EX1A 1XV8A 3WK3A 3M16A 3K8KA 2CFFA 2R14A 2I5QA 1TRIA 2P10A 1OFRA 3GVGA 1IEWA 4NHVA 4G56A 1WBHA 3FNDA 4DEFA 2HBXA 1UD6A 1G7UA 4K3ZA 4UTWC 1F6YA 5I07A 1K70A 4V1XA 4IIFA 1EOMA 2ZUVA 2FZ9A 1EA0A 1XGZA 5LNWA 3W7IA 4W87A 2XZ9A 3F4VA 3S8HA 3QGKC 2YPIA 5CPTA 4EXBA 4JTGA 4A35A 1UWTA 2C3ZA 4F9DA 1R38A 4FS9A 1QBAA 1FCBA 2DSWA 3LD5A 3KEHA 4HSNA 4FA3A 1GJPA 4S1FA 4IISA 1TV5A 4M82A 3KLKA 4Z17A 3R7MA 3AHYA 1DHPA 4R27A 2HZGA 1ISYA 1FHDA 3HPZA 4YWIA 3KS5A 3BLPX 3TN3A 3N6JA 1IGWA 4BS0A 2BHUA 1IXNA 1BWVA 5B7ZA 3ZOAA 3SCVA 3UT0A 4CU7A 3C3UA 1RPKA 1UP0A 5F1UA 3I4EA 1EFZA 3REQB 3QV7A 2ZIDA 3UXAA 3POCA 3N4FA 4DJDA 2ZC1A 1ISXA 2PF0A 2V6AA 1BKSA 3C86A 3BOFA 1DHKA 1RK5A 4U2ZA 2P3EA 3FCPA 4AVNA 2INFA 4N9EA 3CYVA 1D7FA 2A1YA 4YYCA 2DJXA 2YR1A 4O16A 4UQ9A 3TW6A 2GGHA 2VFFA 2VURA 2B4GA 3LV5A 1VFUA 1DJWA 3F5LA 3O3RA 1YDOA 3CL8A 2R1KA 4O17A 1ZJBA 3GXFA 1J6PA 2NWSA 1HKVA 3T6CA 4FF7A 1KXTA 1S5VA 4MNLA 3RO8A 2HVMA 3G77A 5C0QA 4IIHA 4ADUA 4F4RA 3M6YA 3O8AA 3EWCA 3PB0A 4FNUA 2D69A 4B92A 1UP3A 4YHEA 2REQB 3F03K 1MQRA 4GZJA 4Q4OA 5HNTA 3OA5A 1LOSA 4FLQA 4MG4A 2GUYA 5CGMA 1B1YA 1UOKA 4QEEA 1TWWA 3IJ9A 1K8YA 4P7QA 3BAKA 1ODUA 1XLEA 5HQEA 4KWVA 1V6WA 3HF3A 3RN6A 2PLCA 1B5TA 1CX9A 2AAAA 4F3HA 1OFBA 1CBGA 1LOQA 1FDZA 3E12A 5IBXC 2PWGA 3G5EA 4MPKA 1ZAJA 4UQAA 2PLKA 1X7FA 5I0DA 4NZJA 3GR8A 4OIFA 5EU9A 4IPIA 1KFKA 2WJDA 4QHRA 1UD4A 1A5SA 1ZCOA 4HSOA 1G0CA 4NILA 3RYSA 4O53A 1GW9A 4W5ZA 1SZRA 3ZWSA 3AIVA 2FTPA 9CGTA 3LU2A 1EJVC 4D8ZA 1YX1A 4PTXA 4E3VA 3S9YA 5A6MA 2FPTA 3AHXA 4XVDA 1E6RA 3LQLA 4NG3A 2EG6A 3BGGA 3WX7A 3ZR6A 1NH6A 1UJQA 1BXBA 4HOXA 3WBAA 2OSWA 3LTSA 1M3UA 3AUOA 1KXQA 3V5FA 4GIEA 3BCDA 1Q6EA 3RPTA 4DJEC 1VFFA 3EB2A 1F4AA 3TTSA 5D2VA 2XWEA 3PN8A 3NVTA 4JKLA 3W73A 1X1ZA 4XKYA 3WF1A 4AWUA 1RBLA 3CLWA 4NP7A 3P60A 2NV2A 4OUIA 4UNLA 4L4LA 1TCDA 4BK9A 3NDOA 1E4NA 3UJSA 4JFTA 1TIMA 1KQZA 3Q37A 4RXGA 1AA1B 4ZQRA 4ZSUA 1FOBA 5BU6A 3VZYA 1Q4NX 4O1DA 4GVGA 2GWNA 3NVDA 3SY8A 4FX8A 1G1YA 3TZFA 3B4YA 1E6NA 4Y96A 2PTYA 2AQOA 2CKRA 5HWNA 1Q45A 1FX6A 3THCA 3UZWA 2A4AA 5D32A 3GUWA 2O9PA 3DG3A 5F2GA 4QITA 4D6FA 1D8CA 4TO8A 5IXEA 1O7AA 4CLMA 4ZMGA 4E4FA 3RXZA 2E8YA 4PRRA 3A3HA 4HB7A 3SQLA 3UWVA 1RVGA 4C7DA 4F0LA 1E56A 2XJ7A 3GZ3A 1D9EA 3WUEA 1J11A 4XX6A 1HZYA 1PO9A 2Y85A 3IVSA 3CT7A 2VR2A 2GUUA 4QQ3A 3QYSA 1EIBA 3IS4A 1U30A 4Z0SA 4A8NA 1VLWA 2Z1SA 3PTDA 3F2CA 5M3WA 1C29A 1DIOA 4S3KA 5FF4A 4NIRA 5HNRA 3V5CA 2A79A 5I00A 1DQWA 3NFUA 1L8NA 3HZ3A 5DMLA 4M29A 5EKYA 3PHAA 1E6SM 2BX7A 3NO3A 4MB3A 2VFDA 3VO0A 3AROA 1J5SA 3L67A 2NUWA 3WBYA 4L9YA 3W9ZA 1E55A 2W0UA 1LYXA 1QI2A 2PDUA 4JAWA 4GQRA 1AODA 4RR4A 3TJIA 1P0EA 3SCQA 4BI7A 4IM4A 3WD2A 2AMXA 3KL0A 3UCDA 1PZ3A 3VOGA 2PGWA 5JXQA 1OFOA 3BLIA 3ATZA 2FFIA 3ANUA 1JUBA 2VX4A 2DZSA 2ALRA 1JPHA 2J66A 3VXGA 1DJNA 2Y61A