3NQFA

Crystal structure of the mutant l123s of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
219
structure length
219
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLSTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase/lyase inhibitor
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: importance of residues in the orotate binding site.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 85
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3nqfA00
3C2RA 1UCWA 4I7WA 4CCCA 3CWOX 1PL9A 4LS2A 1XXXA 1RV8A 4LTSA 1OFRA 4DXVA 1N8FA 2NUWA 3EX6A 1VPXA 5D02A 3FFSA 3UNDA 5LHEA 1FCQA 2QJHA 2P0OA 4ICNA 3W1XA 1XBVA 1JUEA 4LW7A 1M5WA 5CZSA 4JYFA 4N2YA 2D73A 1EP2A 1G7VA 2G95A 3G1SA 1J5TA 4EF9A 3R2GA 3O6CA 5BMWA 2F84A 5LGXA 2KZHA 4GUIA 4ZL1A 1JCXA 2Y62A 1P0NA 2FQIA 2ZA1A 1IF2A 3GXPA 3WJWA 3MP4A 2XN0A 3CC1A 3OHIA 5EYWA 1PV8A 3EKZA 4CNNA 1EX5A 1EWEA 1SW0A 3ZWSA 5DXXA 3G1YA 4LNYA 4UCGA 3TJXA 4XTIA 4DPQA 3W7NA 5U4NA 1H7NA 1UBSA 1XBXA 3QM3A 4WQ6A 3W9ZA 2EKCA 1JUKA 2I9EA 3IIPA 2B4GA 2NZLA 4K37A 4NNBA 3WK1A 3TAOA 3M7WA 3WJYA 1DVJA 3IRDA 1XBYA 4JICA 1SZNA 3LRKA 4KFPA 1UB3A 5HWMA 2NV2A 1TPFA 4GUFA 4A29A 4FIQA 2ZZ5A 3T40A 3NA8A 4UR7A 1JRBA 1VHCA 1FBAA 5D2WA 4MFEA 4AHPA 3UZJA 2H90A 3IEBA 3LI0A 2QDHA 1KA9F 1TQXA 1EWDA 4K7YA 4JYDA 4JX5A 1BKSA 1QDSA 1TPC1 4ADUA 1IXQA 3G0XA 3THQA 1MZHA 3UWQA 4GRSA 3VCRA 1SU5A 3VKJA 3C6CA 1W5MA 4N6EA 3BG3A 3HBLA 3BW3A 1OX4B 1QFEA 3EWBX 4O12A 5K9DA 2C3ZA 1GPWA 3QZEA 3W7KA 1X6UA 1YXCA 5LNUA 1EP3A 4E38A 2Q8LA 3EX3A 3TXVA 4ZZ9A 3BG9A 1H61A 3R13A 3DAQA 1N55A 3DI1A 4LOCA 2H8XA 3MHGA 4FHAA 3E0IA 1I2NA 3TUUA 4FNUA 3NQ6A 3TSBA 1TPVA 2RDWA 2G96A 3N19B 3UPWA 4A21A 2E1DA 2H8ZA 1ZHAA 1VQTA 2DZXA 3GXNA 3EEGA 1YADA 3QMRA 1TJPA 4K36A 3OVRA 4O13A 1QWGA 4RK8A 1NVMA 2J6XA 4JEQA 3ABRA 4FNSA 3C8FA 3JS3A 4JTFA 2PRHA 1T0OA 3PBUA 3PG9A 3HO8A 3C61A 2VFFA 4JY8A 5C5YA 2JGYA 2WNNA 3NL3A 3INPA 5FF0A 4JTGA 4MY9A 5LNRA 2CLFA 1LBFA 3Q37A 3W2LA 1KTNA 4NX0A 3QJAA 2PE4A 2I1OA 2ZZ1A 1ZAJA 3C0JA 5EMUA 1GOXA 4QITA 1FWRA 2ATMA 5AC8A 5LNWA 4XTDA 3U6WA 2Q3RA 3W7GA 4QSHA 1EP1A 5C2XA 3B0UX 3NGJA 3HPXA 4I7VA 3M0ZA 3QMTA 2CLIA 2R14A 4Y8FA 3S5ZA 1VYPX 2Z2UA 3G0SA 3U8GA 3ZWTA 5F2MA 1TPEA 5IBXC 1VYRA 2ZRWA 2RHGA 3NQEA 1HUVA 5DBTA 4OWGA 1GVSA 2YSWA 4B5NA 1K8XA 4X3ZA 2A5HA 4DO4A 3LRMA 3M6YA 4JTHA 1Q3NA 5AOUA 1G67A 3I6RA 1GVOA 1W8SA 1K7XA 2LLEA 2WOQA 2X1TA 1VHNA 4AHOA 1W5NA 5AHIA 4DO6A 3L0GA 4A2SA 3L67A 3W7RA 3Q94A 5G1TA 1WX0A 1KLZA 3HG2A 4M7TA 1OFBA 2ZRZA 4N9CA 1DQXA 3PBVA 3W7PA 2P1FA 4JDYA 3MHFA 3LLFA 2NWSA 3N9RA 1WYIA 2V5BA 2Y7GA 4AEOA 2DZTA 3S42A 2JGQA 3CHVA 1B4EA 3IVUA 4JTJA 3SI9A 3OBKA 1G4SA 2WV8A 2E68A 2A2IA 3SGUA 2QCFA 3M5XA 1LOSA 1Z48A 3MBFA 3M5ZA 1A50A 1SPQA 5K7JA 3WFAA 4KWWA 4QM1A 3I68A 2XN1A 2PURA 2WSRA 4E2BA 3SGZA 2W79A 4BK9A 2J27A 1O4UA 1OF6A 5HQEA 4DF2A 3NZ1A 1OG0A 4LC6A 4FXRA 1NEYA 4O4VA 4NVTA 4O19A 3LM7A 3QYQA 1TJRA 1WAUA 1B9BA 3W7LA 4LRSA 3GR7A 4RXGA 3NQFA 2EGZA 4RV8A 2RFGA 3STCA 1XC4A 4C1LA 3MW7A 1D9EA 2B0MA 4J9JA 1O95A 3DI0A 2B7QA 4IPIA 1ICSA 1ONRA 3S1WA 3L5LA 4JTTA 1F5ZA 2ZTKA 3W73A 4AWUA 3ABQA 1FCBA 3UWWA 1A5BA 2C6QA 1GYLA 4M6VA 1VCFA 2V2CA 1UASA 1C8VA 3G3DA 3S1XA 1QPQA 4TIMA 1SQ7A 3B4UA 4NQ1A 3W6YA 1ZALA 3GKFA 2VXNA 5KSWA 1QPRA 1FWWA 2V2HA 3NQMA 2CZ5A 2Z0IA 5HJLA 3I7SA 1LROA 4JX4A 1QCWA 5CKSA 2E09A 1IXNA 4GUJA 1YYAA 1OVDA 3LCHA 4LV9A 2C14A 3EKLA 3UWUA 4ZQPA 3P74A 2ZRXA 3LV6A 3PWAA 5HWJA 1F7BA 3M5YA 1ZFJA 1BWLA 3R12A 5K3VA 1W0MA 1X1OA 1JCJA 5D2VA 4MYAA 4NJIA 2V0TA 3ATYA 4UNKA 3W1RA 1J2WA 1TB3A 4LVDA 4N9BA 3N34A 2CLKA 5TBOA 5TQLA 1LLZA 1VCVA 4IX0A 4DBDA 3Q2DA 3TNOA 3W85A 3CT7A 5AN7A 5I3IA 1GZGA 2CW6A 4HKPA 5LGZA 3P8JA 3JR2A 3O6DA 3LGEA 1UUMA 1Z42A 2V8ZA 3TMQA 2DZSA 2E6DA 2QJGA 3M5VA 4A3UA 3TROA 5DBUA 3DGRA 4LUIA 2FB2A 3TFXA 1KLYA 2Q3OA 3W75A 2GVGA 4XWUA 1FWSA 4WXZA 3GDKA 3W1AA 3V75A 3PM6A 2CLLA 1MSSA 1LP6A 3P67A 3EWZA 4UMAA 1V5XA 3BLIA 1F05A 2OZ0A 4RR4A 1G69A 4R33A 4MPQA 1KV8A 2V82A 3RFAA 3HB9A 3MP5A 4NNCA 1GQNA 1H7PA 1GTEA 5G2IA 5AC7A 5CPMA 4HN4A 4WUIA 2Y85A 2ZZ2A 4ZQOA 1CI1A 1NF0A 3D0CA 5FI8A 1N7KA 3C2OA 2C18A 5K2ZA 4LS0A 2CLHA 1VC4A 3IIOA 4IMDA 1W37A 3LXBA 2C16A 1I2RA 1MXSA 3FLUA 4MUZA 3W1NA 4HPXA 3QC3A 3F4WA 1S5VA 1EUAA 3LBMA 3B8DA 3DKLA 2I14A 4TX9A 3FKKA 3IGUA 4MJMA 3WK0A 5HWNA 4K39A 3N2MA 1GEQA 5AHFA 3W87A 3CEPA 4FNQA 1XI3A 3T4CA 1NAL1 4YCPA 4UFKA 4IX2A 4G1KA 4FF7A 4FB7A 5CZ0A 4ZMGA 4WJEA 3TX9A 2E5BA 3HG4A 3TIMA 3ABSA 2Y89A 1AK5A 6TIMA 1IIHA 1ZENA 2VEPA 3LHVA 1GJPA 4BI7A 2JKAA 3QEZA 3P5ZA 4X2RA 3P80A 4FIRA 4JY9A 1QPOA 3KRZA 4DEFA 1KBIA 3NQ2A 5HUOA 4WX2A 4R34A 4IQLA 5EBUA 1TPWA 4Q32A 2ZDRA 3NQCA 3TJLA 5CPNA 2DZUA 2VELA 3HGJA 1IXPA 1H5YA 3W7CA 3NQVA 4GBUA 1XCFA 2HTMA 4YMZA 3EB2A 4JNMA 1TV5A 1P5BA 4ZQNA 3O8AA 3MYOA 4JTSA 4H6KA 2X1SA 4OV9A 3DH7A 4FEZA 2CZFA 1DORA 5F1VA 3UXDA 1KBJA 5I3FA 5F2GA 5K4ZA 4JN6A 1EUNA 2H3BA 3EWUA 1ICPA 3GLCA 1SFLA 2YR1A 4ORMA 3GR8A 4LUJA 4P61A 3TXZA 3W2JA 5KZMA 1JQVA 3W1QA 3GVGA 3LOTA 5U7SA 3LV5A 4IPJA 3NL6A 4M6QA 1QOPA 1XDLA 4O1CA 1FDYA 2PC4A 1L6SA 2DU2A 3MHUA 3NOEA 3W23A 1SZFA 2DZWA 4UXDA 3TDFA 4JIQA 3DFTA 3QQ0A 3G1XA 2VOMA 3SECA 1OFEA 2X30A 4KFNA 3UYCA 4IXHA 3PULA 1KM4A 3G1DA 2QCGA 4K38A 3PSWA 1KFLA 1PCWA 3QSTA 3GDRA 2HS6A 2NUXA 4WOQA 1WBJA 1K8YA 3NL5A 4O53A 4TO8A 2YXGA 2IQTA 1HTIA 2ZCGA 3M41A 3N14A 4JR5A 4RXFA 3NQAA 3CWNA 3L0KA 2X16A 4O28A 1JCYA 3L21A 3PB2A 4MKNA 1F6PA 1JCMP 1GG1A 3F1QA 4MFDA 1M6JA 3FYOA 4IMCA 4NXSA 4AAJA 4A2RA 4IMGA 1HG3A 1IGSA 3W71A 4M6PA 2QCCA 3BGGA 4IUOA 2XN2A 2ZZ4A 3TCEA 3CU2A 5L9FA 1OF8A 4O57A 1KTBA 8TIMA 5CG7A 3NEVA 3TFCA 1OK4A 1KFKA 3NQDA 2YX0A 1L6WA 1TTIA 3W76A 2QAFA 1U5JA 4CNOA 1K02A 1VLIA 4DF1A 1RQHA 3IGXA 5J5DA 3DFOA 5HNRA 1KW1A 1H50A 3P82A 5FESA 1X1ZA 3FEMA 1LOQA 1W3NA 3FYPA 3FJLA 1OX4A 3A5VA 3PUOA 4MZ8A 2ZRUA 3W2MA 3MYPA 3Q58A 4AXKA 3QPYA 1XDMA 1PE1A 4FNTA 2ZZ3A 2HS8A 5I3JA 3P84A 3W7IA 2V5LA 5AHMA 1H7OA 4FX6M 1KM3A 3BVJA 4O50A 3O1NA 1TREA 4AB4A 1S3HA 1KFJA 3YPIA 3M44A 3MUXA 5F1UA 1PIIA 2QCLA 2TPSA 5HR7A 5DY3A 1WOAA 1EB3A 3B04A 3TMLA 1LCOA 4UR8A 1H7RA 4E0CA 3W84A 3GDLA 1FWNA 1QO5A 2FPYA 3QW3A 3NM3A 3W83A 4EWND 4GUHA 3EWYA 1GVQA 4HIBA 2J88A 3E9AA 1O94A 2YFNA 4MOZA 1ZCOA 5DCBA 3WJZA 3DENA 1OFAA 3H53A 4O52A 1B57A 1H62A 3LBCA 1RD5A 3VE9A 1IIGA 3LRLA 1TV8A 3AJXA 2ZZ7A 3EWXA 3AO0A 3ATZA 1JVNA 3C52A 5E0KA 2H3DA 2CLMA 5FF3A 4DO5A 1SO5A 3TQVA 2BLEA 2C19A 3NQ7A 1A5SA 4ADTA 1QOQA 1KM5A 1WV2A 4M5PA 5LZLA 2RDUA 1BWKA 1Q6LA 1KM0A 4HSNA 5G4WA 1JCNA 1KM1A 4PCFA 1FY6A 5AYZA 2CFFA 1IXOA 1MEWA 3LXAA 5KTLA 3UY7A 2QJIA 3MP3A 5CZJA 2QUTA 3TR2A 4HHPA 3LLDA 5FF2A 2FDSA 3DBPA 3THAA 1QAPA 2Y88A 3BV4A 3W07A 1WDWA 3C2EA 3TH6A 4X9SA 5HINA 4IXXA 5TIMA 4PA8A 5LHFA 4JIPA 3G18A 3PC0A 4Z1CA 1W5QA 3O06A 5HULA 3OIXA 2VFDA 1P0KA 4GFSA 3GXTA 2J9YA 1X8FA 2X2GA 3RLVA 2QCNA 3FA5A 3MMTA 4ORIA 1I2PA 2A7NA 4RZ5A 3LB0A 1WQ5A 2WPBA 1F6KA 3GYEA 2E5DA 2Q8ZA 1WOBA 3IVTA 1ME7A 4BWLC 1RPXA 2NUYA 3NM1A 5AHNA 3TU9A 3NZRA 1A5AA 1XUUA 1R46A 4O14A 1ZAIA 3STEA 3LERA 3UZ5A 5I3KA 1VGAA 4MZYA 3FJ6A 4O1BA 4QIUA 3GX9A 1AW5A 1G4EA 4JDBA 4UTTA 1KFBA 1YXYA 1H51A 3CM4A 3G1FA 1OJXA 3OA3A 5AYYA 2H6RA 3TW6A 2A4AA 4YWIA 4UFHA 2VENA 1SFJA 3TKFA 5CSRA 4N6FA 2BSLA 2VKZG 3PY2A 4O10A 1RQBA 4MLJA 3EXTA 4OU1A 2EPHA 1G4PA 2YYUA 2BTMA 2E77A 4NJJA 1A53A 3LDVA 3LHWA 1AW2A 1LLWA 4OT7A 3R8RA 2QUUA 4OE7A 3LHUA 4RCXA 1CW2A 1JJKA 5HUPA 1I8JA 2ZZ6A 4GE8A 3GNNA 1TO3A 4JS3A 7TIMA 1H1YA 3L68A 4CNPA 3KXQA 1FQ0A 3UQNA 1XL9A 4UC5A 4K8EA 1VZWA 5FF4A 4NNAA 1C9DA 2A85A 2YPIA 3PSVA 3QFEA 3HMJG 5AC6A 4ONVA 1GTHA 3A22A 2FPVA 5D2YA 2BZNA 1THFD 1GG0A 3N73A 3W72A 3W7EA 2YW3A 1K8ZA 5DCDA 5C55A 2DORA 2AGKA 3MI3A 3S5OA 3T7VA 2PCQA 3M47A 4ZVJA 5GVJA 2DJLA 2YW4A 5F4SA 2CWNA 2E5CA 2O7QA 2GJNA 3M43A 3G0UA 3G1AA 4JGDA 1ALDA 4RLIA 2CZEA 4LRTA 1PHWA 1VS1A 4UTHA 5EA9A 1QO2A 2PRMA 3TW7A 2B7NA 2G5WA 1ML1A 2RKXA 3VNDA 3E49A 1L6YA 2YZRA 4QAIA 3LTSA 4N4QA 3L65A 2X1RA 3TA6A 3B0PA 1LRNA 1ICQA 4TU1A 4GNJA 3MWAA 3RLUA 4RZ4A 3W2KA 4DQWA 1KTCA 1M7PA 2GPTA 4O11A 4OV4A 3WK2A 4TMCA 1PCKA 2YFOA 3SIZA 2ISVA 1GVRA 3R89A 1OK6A 1SZEA 2V30A 1XKYA 1BTMA 5G2WA 1OFDA 1NSJA 3EX2A 1EA0A 2CU0A 3KX6A 3IIVA 5ABTA 2TYSA 3DZ1A 5KZDA 1NFBA 3R5EA 5DELA 3SSJA 3STFA 3NPWA 4WOZA 3PS7A 2BXVA 2R91A 2EF9A 5FEWA 1LZOA 2JBMA 4JYEA 5D32A 3NQ8A 1FXPA 5AHLA 3I7RA 1TSIA 2A1YA 3PF3A 4QNEA 5T26A 3W7OA 1SSDA 2OX1A 5D2XA 1LTDA 2QAPA 3EX4A 4O1AA 1XFBA 1I4NA 3LTYA 4EF8A 1H7XA 4I7UA 3GDTA 1VJIA 4RJEA 3RNDA 1HFBA 1F76A 2NV1A 1JCLA 4NUWA 5D37A 4TMBA 4ZQCA 1L2UA 1EPXA 2QCEA 3IGSA 1W3TA 3W7QA 3PR2A 4O0KA 4RX0A 3EWWA 4NX5A 3CEUA 2E6FA 1O5XA 2FTPA 4MIMA 3ABOA 1AMKA 5DCEA 4FX8A 2EAWA 1XBZA 4O1DA 3QH2A 4Y9AA 1NF7A 1LM1A 2ISWA 3O07A 1OFQA 3QSRA 2YYTA 2VFGA 3FIGA 1YDNA 4Z0JA 2ZRYA 4OGZA 3V1PA 4X22A 1AG1O 1FX6A 2DZVA 3LCGA 3CB8A 1F73A 3W2NA 2Y63A 5SWUA 4KKXA 3A24A 1TTPA 4HNTA 2A6LA 3HOJA 3SZ8A 3PAJA 3BG5A 3W7MA 4GUGA 1I2QA 3P62A 5I3HA 4NXKA 3PBWA 4GXMA 1R2SA 2J9XA 2PRLA 4JTLA 4ML9A 4PH6A 4LT9A 3LXCA 2ZQ0A 3NO5A 5FEXA 2DZPA 3G8RA 3W7HA 2GVJA 4EOUA 5AFDA 1W5PA 1L9WA 4CQ9A 3NYZA 4MYXA 5D2TA 2Y70A 2GQAA 4N02A 1CX9A 1K03A 3RK8A 3C56A 1LRQA 1XUZA 2A7PA 3STGA 2GQ8A 3A5FA 3E96A 4O4WA 2WQPA 2J24A 4MY8A 3P7YA 1RR2A 4PC8A 2GJLA 3M1ZA 2ALDA 2O7SA 4UTTC 3MBDA 4JTEA 3GB6A 3S9YA 3H54A 3G1HA 3HG3A 3HGOA 4I9AA 1EEPA 1FCUA 1Q45A 5D33A 2TRSA 5CPOA 4AH7A 3C2VA 1P4CA 3CPRA 4Q4KA 2Z6IA 4PODA 3ZR4A 1BEUA 3HGRA 3KAOA 4UFLA 3W86A 4DBEA 1JULA 1F74A 4S2BA 3B05A 5F2LA 1A5CA 1YTKA 1JRCA 3TQ0A 4FNRA 1H1ZA 3BPWA 1HL2A 3QRHA 4IOTA 5G1YA 4UFIA 5HMSA 2W6RA 1TTQA 3LCIA 2GOUA 4UTWA 5EL1A 1Q6RA 3IV3A 3GIYA 3LCLA 3W70A 3HIJA 4XKYB 3UWVA 3C2FA 5LNSA 4Z1DA 3W1UA 2GVLA 1W5OA 1PS9A 1P1XA 3OG3A 5E1QA 4IWWA 4O15A 1C29A 3SR7A 1YLVA 2FIQA 3M16A 4MY1A 4Q33A 2ZYFA 3M9YA 2XFWA 1YXDA 2GQ9A 1HO4A 3GAYA 2QEZA 1DBTA 1KM6A 1W54A 1R2RA 4UUIA 3HG5A 4LVAA 3A23A 3SY5A 3GNDA 1SO3A 1VYSX 2QCDA 3ELFA 3LCWA 4MLRA 3E12A 2FJKA 3S6DA 1RQEA 4UTUA 3GDMA 4OQVA 2CZDA 3NAVA 1YPFA 1MEIA 5DXYA 2R94A 3TK7A 3O6YX 2Y7FA 1ZY9A 3P5YA 2ZA3A 3MO7A 4N9EA 2OJPA 3G24A 1FXQA 5D09A 1T99A 4BI6A 4O54A 3DFQA 4UTKA 1V7YA 2F7FA 4JD4A 4WZHA 4HNVA 1AL7A 3QW4B 4XQ6A 4Y90A 1TYGA 2Y7EA 1Z41A 4U4MA 5KMYA 3E02A 4PL1A 1W1ZA 2WKJA 5L6UA 2BWGA 4K6AA 4E2DA 1DV7A 2QCDB 2VEKA 3FOKA 1YDOA 3N2XA 4PTNA 2NXGA 5K9XA 1YTEA 4GJ1A 4WY0A 1ZNNA 3OVQA 1YPIA 2QDGA 1U83A 1JR1A 2A7RA 5G4EA 4YXGA 4WD0A 1DL3A 2ABAA 2E6YA 1MO0A 1JUBA 1YDVA 3KVKA 3TAKA 4ZQRA 3NPXA 2EHHA 4BFAA 3SFKA 3LHYA 4K8HA 1KM2A 3FKRA 1F2JA 5J5RA 3G22A 3K30A 3BLFA 2V9DA 1TRDA 2X1UA 3BK0A 2WJZA 3VFLA 3NQGA 3NXFA 4NJKA 4KWVA 4IMEA 4R7JA 3VE7A 1R30A 4XBSA 4PFMA 4BR1A 3UD6A 1LDCA 2CLOA 2ZFAA 4WY0B 4XUGA 1TIMA 2NXIA 1DHPA 3G3MA 4HT3A 3NR0A 3BO9A 2YCEA 5LSMA 3PB0A 1TPH1 4MJZA 1FUYA 4WY0F 1Z44A 2ZTJA 5D05A 1DKWA 4Y6GA 5HR6A 1LBMA 3JRKA 5DLCA 4QNWA 1GWJA 4LC8A 1QPNA 4S1FA 2ABBA 1SO4A 3P81A 1G7UA 4NU7A 4P2VA 1SO6A 4QJ1A 2E6AA 4GC4A 3W88A 3WJSA 3TC7A 3B0VC 4ALDA 3G8EA 3U2OA 3TE9A 3O63A 2NLIA 1Q6OA 5DY2A 2Y7DA 1LBLA 1OYAA 4JTKA 2QUVA 3EX1A 3BW2A 3W22A 4LY8A 1O5KA 1TV7A 2Z6JA 3W1MA 3UWYA 1DJNA 4Z08A 4HPJA 5BW6A 3O16A 3IIZA 2C13A 5D03A 4FO4A 2R8WA 1OABA 5CPLA 5H2ZA 4CCEA 1GYNA 3OEXA 3PBYA 2AQWA 1I2OA 2DJXA 1VLWA 2JKEA 3PUDA 4UMBA 3W1PA 2QR6A 3B06A 3QQ1A 1H63A 3KFTA 4LV4A 4PEKA 1S5TA 3DU0A 3LCFA 1W56A 4LVFA 4CCDA 1FDJA 4PL2A 5G2HA 4HSOA 4BF9A 1OYCA 3RMJA 3HGSA 4FX7A 4Z0SA 4POCA 4O17A 4L4LA 5AHEA 5FF7A 1E51A 3O15A 5K9CA 1OX5A 4JTIA 1D3GA 1FCVA 1H7WA 3S5NA 1I45A 5E93A 4CLMA 1LYXA 2VC6A 2V81A 3WJXA 4DF0A 4UTJA 4LWWA 2NXHA 2VFIA 4AF0A 4NZJA 2ATSA 3HQ1A 3KVJA 4UFMA 1VRDA 3LCXA 2Y6ZA 4UFJA 2YDAA 3DHDA 4UTIA 4EIVA 3TC6A 2VFEA 1SW7A 1GVFA 1LORA 1TMHA 2TMDA 2JK2A 4LVGA 5A8GA 3S8HA 1OHLA 1DOSA 4O16A 1B3OA 2JKPA 5F4WA 3UXAA 4Z1BA 4YCOA 2OT0A 1O60A 3BW4A 3KVMA 4R53A 4H4IA 4MZ1A 5H91A 3QPZA 3QF0A 3KRUA 4UTWC 5CSSA 3DFSA 3OVPA 2DP3A 5F4XA 4AF0B 3L2IA 2Z1BA 2OCZA 2A6NA 4LVBA 4RZ6A 3NPVA 1X7FA 4O8RA 3CQ0A 1SW3A 1RVGA 2CLEA 3N9SA 4A22A 4K7VA 3P8IA 1Q6QA 2VFHA 3H55A 3QMSA 4Y96A 2WO5A 3L9CA 4HNUA 1H60A 5EKYA 1ME9A 4MVAA 3TV8A 5AB3A 1OX6A 5EY5A 2GUUA 1JQXA 1TPB1 4OBTA 3HPSA 4H3DA 3W7JA 2QCHA 2NX3A 4U28A 1WBHA 3DFNA 1T8XA 3F03K 3L66A 4BI5A 2V2DA 3SW6A 3T55A 4ZQMA 1J4EA 1WXJA 1SZGA 1T96A 3RU6A 4N9DA 4NZFA 5KINA 1SUXA 3I65A 2QKFA 2FLIA 2QF7A 1FWTA 1Y0EA 1G4TA 1ZJIA 4FXSA 4IMFA 4DPPA 3SJ3A 2G97A 3UY8A 1R2TA 1VCGA 2NWRA 2VEMA 3CTLA 4OHQA 4O18A 3MI6A 5AYXA 5C54A 1PVNA 3S0CA 1TQJA 2C15A 1K7EA 5FEPA 4AHQA 3VI2A 4TR9A 3DFPA 4S2CA 1YTDA 2BX7A 2FB3A 4GWEA 2QCMA 1K7FA 3G1VA 2C0AA 2Y61A 3GAKA 3L5AA 1QR7A 1K3UA 2OT1A 3IVSA 4N4PA 4UMCA 5C6MA 5KZEA 3LX9A 4AMAA 1TPUA 1WA3A 2RH9A 4O0ZA 3A9IA 3BARA 2A0NA 3W1LA 4ADSA 5BOOA 3LHZA 2HMCA 1G6CA 3MJYA 3F4NA 1KFEA 1TRIA 1UUOA 5IM51 3TQKA 4UNLA 3LI1A 4AWTA 2RDTA 1QNVA 3ZFHA 5EPDA 3S1UA 4JXCA 3LTPA 3S1VA 3GK0A 4W9TA 2W0UA 4WXYA 2AAMA 2WSYA 1R47A 3KHJA 1OFPA 1W3IA 3C4UA 4HNNA 3S5YA 1DQWA 3PG8A 5DN1A 2P10A 2NX9A 2OMAA 3BLEA 1KFCA 2YGYA 4EVZA 3PUEA 3W74A 1LRTA 3KRSA 5MHBA 3B03A 1ME8A 3KOFA 5D38A 5FEZA 5LKYA 2J9ZA 4NJGA 3P61A 3W3OA 4AVFA 3GZ3A 1MEHA 2WSQA 3HJZA 5CZTA 3W2UA 3KVLA 1S5WA 5KITA 4FNPA 4UIOA 3O05A 1SSGA 2WNZA 1XM3A 4YLWA 4UTLA 2NX1A 4UTMA 4L4MA 4CQ8A 3WK3A 3NL2A 3P60A 4IGHA 4Z1AA 5BNKA 3NNTA 5D04C 2ZRVA 3GKAA 5LNVA 3DKJA 1ZAHA 3UWZA 5G5IA 3EXRA 3L0NA 4JTUA 4JX6A 5BMXA 3DHFA 3BGJA 5BRBA 1OYBA 3TSMA 1B4KA 3W7DA 4LU0A 1AL8A 5IBXA 1QMLA 1PHQA 3C3NA 6ALDA 3RF9A 3T44A 4CQAA 1DJQA 1AW1A 3I7QA 1OFOA 3L5MA 1W31A 5F2IA 3W1TA 3IIXA 3USBA 4NT0A 4M7SA 3CIXA 4BWLA 2ISSA 2HSAA 3DXIA 4QQ3A 4AWSA 1EIXA 3T78A 3UPBA 1LOLA 1M7OA 2FPTA 1RZMA 1KV5A 1TTJA 4KFOA 4IJBA 4DELA 3EXSA 1TCDA 3LHTA 3A21A 4NJHA 4M19A 2B7OA 4XKYA 3FS2A 1GT8A 2UV8G 1HO1A 1FDZA 3ANYA 3NG3A 4LS1A 1TPDA 4QISA 5K4XA 2TSYA 3NDOA 3ZS4A 5A5WA 2VEIA 2ZBTA 2FFCA 3CIWA 4C1KA 3MI2A 2ZA2A 3PVFA 1VH7A 1ADOA 5D30A 4XBKA 2WNQA 4YL2A 2A21A 3TSDA 4RKAA 5I3GA 1VR6A 2C1HA 3N3MA 3CLMA 4D2JA 1D3HA 1SR9A 2B7PA 1UJPA 3NVTA 3HPZA 3HF3A 5CGQA 3NPUA 4XZ9A
chains in the Genus database with same CATH superfamily
3B9AA 3C2RA 4Q4MA 1KC7A 4I7WA 4CD7A 4HZ6A 2OGJA 3CWOX 1E9YB 4ZOBA 4LS2A 1XXXA 1RV8A 2CCRA 1OFRA 2NQ5A 4DXVA 1N8FA 5D02A 1ITXA 4ERGA 1HZYA 3CGTA 3PP7A 1XBVA 3W53A 2WLZA 4H9TA 3H7RA 4YNGA 5LIKX 3L23A 4C60A 4E2OA 2G95A 2CC0A 3OGVA 4EF9A 5JQ9A 4Q8MA 3O6CA 1K70A 3DDMA 5BMWA 4DUWA 2F84A 4GUIA 3B40A 2FQIA 3QR0A 5LXXA 3CWHA 3UG5A 3CUXA 1ZL1A 3MP4A 2XN0A 1YBQB 3CC1A 2PLCA 4YU1A 1XRFA 1E3XA 2PS2A 3A4XA 2OLHA 4IMAA 4CNNA 5DXXA 3PHAA 1XIHA 3TZNA 4PMJA 4GOAA 3V7PA 3W7NA 4Q8UA 1H7NA 1UBSA 1YEYA 4TV5A 3QM3A 3IJ6A 1JUKA 2I9EA 3K8LA 4ZOEA 2J62A 2NZLA 4A3QA 3DC8A 3AYTA 4L5ZA 4NNBA 2PDWA 2IPGA 1XQLA 2A3EA 4ZFMA 4O0QA 2PZNA 5FJUA 4KRZA 3DN5A 4GISA 4QQUA 5HWMA 2NV2A 4U5KA 2DVXA 3QZ6A 4KWUA 4A29A 4E2VA 2PA6A 5I3DA 4UR7A 1HW6A 4B5VA 5D2WA 1KO0A 3KCJA 1XLEA 4GQRA 4EP8C 2QDHA 1KA9F 5BRPA 1V3MA 4HU4A 4J27A 1IXQA 3G0XA 3THQA 3SB0A 4HNOA 1PX4A 3UWQA 1A3WA 5M2FX 4Q8NA 3HBLA 2PDLA 1GKRA 4XZNX 3BCJA 2VT0A 1YXCA 4TQTA 5LNUA 1EP3A 3GNOA 1R9ZA 2BMBA 3WBAA 4ZZ9A 1ISYA 4PMDA 4H7CA 1N55A 2XDFA 1DYSA 2H8XA 3MHGA 1BF2A 3WQFA 2VZUA 2EQDA 3AS1A 5DRCA 1MZRA 3UPWA 1G9HA 2IMRA 2D0GA 4AZIA 3TCSA 1CENA 2DSWA 2VNCA 4IUGA 4LYKA 3SUTA 1MQQA 1UP0A 2XPKA 2WNWA 3ABRA 1OGGA 3GTIA 3E74A 5BWAA 1RALA 3C61A 1QUMA 4JY8A 1EF2A 3T2OA 5KETA 3INPA 5FF0A 1C93A 4MY9A 4PCPA 1QK2A 3LG3A 1XIIA 3RGTA 4HA4A 1XLIA 3C0QA 3EKGA 4KRTA 4F0MA 2I1OA 2ZZ1A 4J3WA 2HK0A 3C0JA 1XDJA 2WVSA 4QP0A 4AEEA 5AC8A 1J18A 4MKSA 2DT1A 5LNWA 4XTDA 3U6WA 3WBXA 2Q3RA 4QAWA 4A35A 3W00A 5C9WA 1JZ8A 3NGJA 4WDXA 1VBUA 3M0ZA 1DJYA 3RYSA 1HKWA 5F2MA 3SUSA 5IBXC 1CXKA 1O1ZA 1XLBA 5F7UA 2JIEA 4X3ZA 4JTHA 1Q3NA 1WXYA 1UMYA 1GVOA 1W8SA 1O12A 5I07A 1DXFA 2X1TA 3H4WA 5IFTA 4GI8A 3D46A 2ZRZA 4N9CA 1DQXA 2P1FA 4ACZA 4PZVA 3MHFA 3E0VA 2FHFA 1UOKA 3D6NA 3ZXWA 5C7HA 1XR2A 3IVUA 1BAGA 3SI9A 3OBKA 1G4SA 1PB0A 1VPQA 1OM0A 3SGUA 1VD6A 1Z48A 5AYIA 1VBGA 1A50A 5K7JA 2HXUA 1RA5A 2BOGX 3WFAA 2XVGA 3I68A 4B5SA 1FH9A 3WQ8A 2XN1A 3SGZA 1ZP4A 3IWPA 3FGCB 3LPPA 4LC6A 3LM7A 3DFYA 3T0DA 5D9MA 2RJHA 1B9BA 3WEOA 3DX5A 4LRSA 4RXGA 3DIPA 3H26A 3VIJA 1EJUC 1FHVA 1XC4A 3STCA 3GH4A 3QR3A 2WW5A 2PDKA 3DI0A 2WM1A 3N13A 3IJ7A 3S1WA 3UZXA 1ENUA 3EPMA 2ZE3A 3EPOA 4V1XA 1Z7AA 1GOOA 4K3ZA 4NZ3A 3WQOA 3DYPA 4AWUA 5EGRA 5HMDA 1RJRA 4IFOA 1R3RA 1VCFA 4TIMA 3B4UA 4AIOA 3CYJA 1VRXA 3WY1A 1M7XA 2DT3A 3HPFA 3ISIX 2XTKA 2BXZA 1QBAA 3I7SA 3MS8A 3AFBA 4YHEA 4JX4A 1QCWA 4LF2A 3C86A 4TUFA 4ZOAA 4ZQPA 1DWIM 1PJ9A 2ZX8A 1TR9A 3PWAA 1GZJA 2JF7A 1I75A 1L8PA 3L4ZA 1BWLA 5K3VA 1Q85A 1W0MA 1X1OA 5D2VA 1R3VA 1OSEA 1J2WA 1VCVA 5BU6A 4C6FA 2UY4A 4DBDA 2WB5A 3CL6A 3OQ8A 3CT7A 4WKFA 1GZGA 4O8AA 4C6NA 4HKPA 1P48A 4R85A 2G4JA 1AJZA 3JR2A 3MB9A 3O6DA 2NV9A 2ACUA 4M8UA 1GPFA 4DZIA 3EDEA 2NVAA 1M65A 4HVXA 2FB2A 3CZEA 4RW5A 1MI3A 3V75A 3PM6A 3D3FA 3KOWA 5M5DA 5KZ6A 1G1YA 4W84A 2D2HA 3JUGA 2OZ0A 1PKYA 4RR4A 1G69A 4R33A 3U7VA 1GJUA 3FJNA 4B3ZA 1GQNA 5AC7A 3BCFA 5CPMA 4HN4A 2ZZ2A 3PTQA 3W6LA 1NF0A 5FI8A 3TN3A 3W02A 3C2OA 5K2ZA 4LS0A 2CLHA 5TNVA 1TVPA 3UJFA 4HPXA 3W82A 5CC6A 3CV7A 3RPDA 4Q8OA 3B8DA 3DKLA 1P1MA 2ZICA 4A8LA 4HA0A 1DJZA 1GEQA 3CEPA 3T4CA 1KCXA 3MZ2A 4YCPA 2QJNA 3KWXA 4FB7A 1V3KA 3EB3A 3ABSA 3T05A 1M9HA 2VCBA 3GHTA 3LHVA 1ECEA 1IV8A 2GK1A 5E70A 2JKAA 4X2RA 3P80A 3KRZA 5A8QA 1KBIA 4QS5A 1JPDX 3O9NA 2BB0A 4Q32A 5M03A 1Y7VA 1UQZA 3TJLA 2BXYA 3BOXA 4GI4A 2DVUA 4UTFA 4GBUA 4JHZA 4YMZA 2QGHA 2OLSA 2HISA 1KRMA 1W9VA 2C91A 3PJUA 3IARA 1O6IA 4IQDA 3TOYA 1UIOA 3RPTA 2QHAA 3DH7A 4L4OA 3VO0A 2X40A 5I3FA 5F2GA 2H3BA 1XYBA 3GR8A 4QR6A 4P61A 2ANUA 1MQRA 5DX7A 4F66A 1ZJBA 3CJPA 2J8GA 3GRIA 2XISA 3NOYA 3LOTA 4WCJA 4M6QA 1L6SA 3EMQA 3GZAA 3W23A 2OQYA 1SZFA 2DZWA 2OOGA 4UXDA 3GTNA 2X0SA 1V3LA 3DFTA 2X30A 3NUKA 3UYCA 3PULA 1KM4A 2EPLX 2QCGA 4K38A 1PCWA 4IIBA 2WMIA 3XIMA 4C6BA 3PBGA 2VJXA 3M41A 1JCYA 1RCOB 2DQWA 3VNZA 2QDDA 1EIBA 3PB2A 4MFDA 3FYOA 1U33A 3PTKA 2PBOA 3TR9A 2VQUA 1K77A 3W71A 2VC9A 2QCCA 1XYFA 3AS0A 4E3TA 5L9FA 4J1OA 5HATA 2OXNA 4O57A 3PJXA 3WNNA 1UZDA 1EGVA 3NEVA 4KIEA 1OK4A 1KFKA 3NQDA 2YX0A 3UJEA 3O2LA 2QAFA 2PGFA 1FP9A 3K8MA 4DF1A 3VKAA 3KBWA 3W01A 3P93A 3BAIA 5HNRA 5I00A 5HNTA 1HP5A 1X1ZA 1EC9A 4LUSA 3FYPA 1WE5A 1OX4A 3ABZA 3R7MA 2QULA 2VZTA 1K8CA 3MYPA 3Q58A 4AXKA 2G4FA 1B54A 3L4TA 1CB7B 3VK5A 2ZZ3A 1ZRQA 4GVIA 3P84A 5AHMA 4WJXA 3BVJA 4AB4A 2WYSA 1HKVA 3MUXA 5F1UA 5A8NA 5I5RA 1EB3A 3AHZA 4LEFA 4PMZA 1V6VA 2XYLA 3W84A 2O9OA 3QW3A 2HVOA 1S1RA 2J88A 1O94A 1H0IA 2PWVA 1X98A 4JZ5A 5DCBA 3DENA 1VJZA 3GHSA 1RD5A 2O9PA 1XRSA 3RPMA 4AZ6A 1B1YA 5I06A 1HN1A 8XIMA 2XIMA 3LY0A 2CLMA 3NZQA 1QT1A 1SO5A 2FDMA 5I02A 3S46A 3TQVA 1V3JA 2OYKA 2C19A 1OD0A 4ADTA 1R7AA 3FSTA 1CZ1A 3DG6A 1KM5A 1RSCA 3IANA 3GE7A 4M5PA 4XV0A 5A8PA 1KM0A 1HQTA 1BKHA 5G1MA 1MFVA 4ERIA 1FY6A 3PWIA 1UROA 4CEUC 3CHDA 1WZKA 4IL0A 2CFFA 1R0MA 5DANA 1IXOA 5KTLA 3GC2A 2PBGA 4C91A 4IPLA 2GUYA 1A3HA 1Q13A 2QJIA 4J3SA 3KBMA 2QUTA 3TR2A 3LLDA 1XIJA 1NDVA 3BV4A 3UEQA 3C2EA 5HINA 3VDCA 5TIMA 4DNMA 4Z1CA 3A12A 3VDBA 5I09A 1P0KA 1WDSA 4CD6A 1MUWA 2X2GA 2W92A 1EJRC 5DO8A 1JDCA 3UT0A 1XYLA 3VNLA 2WPBA 1UR8A 2E5DA 1ME7A 4G5DA 3TU9A 1A5AA 1V6TA 1E6ZA 4Y7EA 3IJLA 3LERA 3CL8A 1M53A 3LS9A 1VGAA 3FJ6A 4MZYA 3BOLA 1AW5A 2AL2B 3EBVA 1GORA 3CM4A 2F6XA 3JZEA 3WF3A 1H09A 4DJEC 4YWSA 3IUDA 2BY2A 3TTEA 5C2GA 2A4AA 3SBFA 2VENA 4GQQA 2BSLA 2VKZG 3PY2A 1XIBA 1RQBA 1XH2A 3DESA 4GG9A 3GIPA 2EPHA 1G4PA 4GJJA 3L2LA 2FGLA 4PEEA 1F3EA 1A53A 1QI3A 1GYMA 4G8TA 4UQAA 1LLWA 4NAEA 1X6NA 2CBIA 5AC4A 3MTWA 2E0PA 2QUUA 1C8YA 1NH6A 1JJKA 5HUPA 2ZZ6A 4QLLA 2ZDSA 2CWXA 4M24A 4JTDA 4UR9A 1TO3A 3L68A 2WAGA 1LQ0A 4GY1A 3AZTA 1XL9A 4CU7A 5I24A 4ZB2A 4DXKA 3BLLA 4MWAA 1C9DA 2YPIA 3KTCA 3QFEA 2Z28A 1GTHA 2BZNA 4M81A 2Y5EA 3N73A 3W72A 3W7EA 2DORA 4XAZA 4J2PA 2J7GA 3M47A 2BVYA 2DJLA 2YW4A 5FJOA 5MKGA 1A5OC 3N3TA 3M43A 3WLLA 3G0UA 3G1AA 1ALDA 1W1YA 4F9DA 3SO7A 2YB1A 2Q01A 3H8AA 4UTHA 3EDJA 1O1HA 1QO2A 3TW7A 1TX2A 2B7NA 2G5WA 3PAOA 4LCQA 2RKXA 5DF0A 3E49A 1L6YA 2YZRA 1A80A 3UXLA 4N4QA 4XBJA 3NFUA 2V69A 3PNZA 4ICCX 3M0YA 4DQWA 1KTCA 2GPTA 1W3JA 1XIMA 4TMCA 3WDPP 4FOUA 4IF2A 1SZEA 2V30A 2BOFX 3V4BA 5G2WA 4YHGA 4Q6XA 4M82A 3DZ1A 3ZJ7A 2VDGA 7A3HA 5DELA 3H4XA 4HSHA 2CBVA 1FXPA 9CGTA 3E0FA 3LBOA 1E1CA 2J7EA 2A1YA 3UR8A 3W7OA 1SSDA 1LTDA 2X7WA 2QAPA 2WMJA 1MVYA 4RUBA 1XFBA 1ZUAX 3TC3A 3U48A 4LH8A 4U5IA 1VJIA 2R24A 1HFBA 1YNYA 6PTDA 1F76A 3HN3A 2NV1A 4NUWA 4GH3A 3H2FA 2OSYA 4I9MA 4UQDA 2PLJA 4H9XA 4R9XA 3ARZA 2KAUC 2HK1A 2QCEA 3ZR5A 1XLAA 3W7QA 2YJQA 3QHOA 4LX4A 3ITVA 1L6GA 4NX5A 3UJRA 4LBUA 2O9RA 2FTPA 3OYXA 1XS2A 5KEZA 2IKGA 3ABOA 2EAWA 4C6MA 4ZB0A 2ISWA 4OUIA 3O07A 1RD6A 2YYTA 2VFGA 3E0WA 4Z0JA 3GH5A 2V5CA 1LLOA 1F73A 5JMUA 4KKXA 4DYJA 5A2CA 2P8CA 3A24A 1TTPA 1FFQA 4HCHA 1P7TB 3HOJA 3SZ8A 2PDMA 3BG5A 1XYZA 3WH7A 4W4QA 4GUGA 1I2QA 1OT1A 3WLQA 4PH6A 1UKQA 3H21A 5FEXA 2DZPA 3G8RA 1XLMA 2BVWA 3WEZA 1MW2A 1IWBA 4RDVA 4XZBA 4NYUA 1L9WA 3EEZA 4OOZA 3PZMA 5BU9A 1CX9A 1K03A 4PUMA 3UESA 1XYAA 2A7PA 3L4UA 4RE3A 3BSHA 1WAWA 2X2YA 3SRHA 2GGEA 3ARXA 2WQPA 4MGGA 4BJHA 1I60A 2W5FA 5CSYA 4MY8A 4DNHA 3O6AA 3PPCA 1O66A 3M1ZA 5IOBA 3U4FA 4UTTC 3THDA 2ZVRA 4JTEA 1W3KA 3SQLA 3S9YA 1R8LA 3G1HA 3HGOA 1J0HA 1P4CA 4F3HA 3ZR4A 3QZAA 1WNOA 3NDZA 4DBEA 2QPUA 3B0YA 1PIGA 1F74A 2V3DA 4S2BA 2PDHA 4MADA 3CV1A 3WMCA 4BQ4A 3WUFA 1E56A 4HB7A 3BPWA 2I5GA 3M0VA 3VD5A 3QRHA 4IOTA 4ASTA 2AKMA 3UU0A 4PMRA 4ZFCA 5I23A 4UFIA 2W6RA 2PDGA 3POHA 1FWCC 4CN4A 4Z17A 1J0KA 5DMMA 4OVXA 3N9KA 4I8DA 3W70A 3HIJA 3R0DA 3UWVA 3E6EA 3W1UA 1W5OA 4MTVA 2ONEA 2HJPA 3Q45A 4O15A 4AC7C 1MYRA 4S39A 4D8ZA 5A2AA 3ALFA 4QX4A 1W1B1 1NWRA 2QEZA 3IS4A 1P0DA 1V93A 2GSJA 1J12A 1EBHA 4PB5A 3A23A 1NP0A 3GNDA 3KOXA 3B0XA 3U2ZA 4YJ5A 3QXBA 3ELFA 2X05A 2Y8VA 1F4AA 3E12A 2FJKA 1IEXA 1IT8A 1KXHA 2R94A 3O6YX 2P76A 4IFRA 2HBXA 3PZ9A 3C0SA 5JU6A 3WD2A 1V7YA 4GKTA 2OSXA 4H9MA 4HNVA 4D71A 1TYGA 2Y7EA 1Z41A 3E02A 4S3BA 5L6UA 4E2DA 4V28A 1DV7A 2QCDB 3FOKA 3N1AA 1CLXA 1OT2A 1ZNNA 2QDGA 3CNYA 4GCXA 3SY8A 3OZYA 4U2ZA 2HWGA 4WD0A 1FOBA 3ZVHB 3WDQA 2WVUA 3OHMB 2E6YA 4PBFA 1YDVA 3V36A 3TAKA 1E40A 1Q4NX 4J3ZA 4QS6A 3ONCA 5J5RA 5AZ0A 4GQBA 3K30A 5BYWA 3BLFA 4LY4A 1TRDA 2X1UA 2PDNA 3CZ8A 3EOSA 2RGLA 4NJKA 3ZSSA 5FSDC 5LIYX 1XV8A 4J3VA 1MW0A 1R30A 4KGLA 4XBSA 3H12A 2FZ9A 3UD6A 2FZBA 1LDCA 2RAGA 2ZFAA 3J7HA 1WDDA 1U1JA 4AIEA 2INZA 1N8IA 3G3MA 1OCJA 5D8ZA 5D05A 3ZT7A 2WKLA 4K1GA 1LBMA 3JRKA 3URNA 4LC8A 1V6YA 2WVVB 2Z27A 1Z69A 1SO6A 2E6AA 1Z6KA 4S3JA 1EO7A 1EOMA 4GC4A 1AQ0A 1KBKA 1FWHC 1KQYA 4HBKA 4ALDA 4WGHA 4HTYA 2J66A 1Q6OA 5DY2A 4DO7A 1NWUA 4IPPA 5I78A 4JTKA 4G7FA 1W2VA 2DFAA 2XU2A 2ZADA 3W22A 8RUCA 4GY7A 1O5KA 3UWYA 4Z08A 1K9FA 4EXBA 4HPJA 5JH1A 3MKCA 3IIZA 2G8ZA 4GX8A 3BZGA 1E6QM 5D03A 3DGBA 4FO4A 3TYEA 5H2ZA 4CCEA 1GYNA 2AQWA 3PUDA 2QR6A 3B06A 4LV4A 1S5TA 3UCCA 4CCDA 1FDJA 2VHLA 4W8LA 4QDWA 1Q6DA 4BF9A 5LA1A 4Z0SA 2AAAA 2G3NA 4O17A 2BHZA 5K9CA 4KCWA 4P8WA 1NOUA 1D3GA 1RCQA 5CBIA 4HD5A 1H7WA 3S5NA 5E93A 4GQ0A 1V77A 1LYXA 3U0HA 2VC6A 3WJXA 2YXOA 3KE0A 3WMLA 4H8VA 3TP4A 5XIMA 1UWSA 2DSZA 2VUYA 3ABXA 2BP1A 2VVNA 2VFEA 3ZVIA 2ICSA 1V02A 1FWBC 5A8GA 3S8HA 4GVHA 1H4PA 4P7NA 2QV4A 4FXJA 3BW4A 2DIEA 3GD6A 3KVMA 3KS5A 4AXNA 4DIAA 3R25A 2VX7A 3OVPA 3B8VA 4AF0B 4U3CA 2Z1BA 2A6NA 1AZ2A 5A1AA 1GHRA 3HV9A 4LVBA 4RZ6A 5EMYA 4DBWA 1D8CA 1ZS2A 2C79A 3N9SA 4OBRA 4RE2A 3UG8A 3P8IA 1Q6QA 3H55A 5HNUA 2WO5A 4O1FA 3N25A 3WQ4A 2QIIA 3PZQA 1H60A 3VGFA 1ME9A 1XG4A 3TV8A 3MWCA 2EG6A 3VXGA 4JL2A 5AB3A 4KQNA 2GSEA 3H2EA 3N4FA 3OG2A 4FZIA 2XFYA 3P6LA 1I6NA 3GBEA 2X41A 2NX3A 2Q09A 1T8XA 1QATA 1QTWA 4G6CA 3VIOA 3F03K 4CUCA 4BI5A 2V2DA 2W67A 2CXEA 4DBSA 1KQZA 4G2DA 1T96A 1LT7A 3IUIA 2Y2WA 3I65A 3MA8A 2FLIA 1Y0EA 4FXSA 4C6QA 3K46A 1EYWA 3BMXA 4OHQA 1TUFA 4KERA 3S0CA 3PZOA 1TUXA 1ZBKA 1C91A 1J0JA 3S83A 3DERA 4QHRA 3BMVA 4TR9A 3I3EA 4GWEA 1Z32X 3LM3A 2GFTA 1ZLPA 4X60A 3B8UA 3L5AA 4EWJA 2FH8A 5C6MA 1YMYA 3SQMA 1WZMA 3B9EA 3POCA 5A6LA 1Q2RA 1RPKA 4DN1A 3BARA 3CH9A 5LYRA 3W1LA 4ADSA 6TAAA 2HMCA 4GY0A 4FR6A 1G6CA 3T42A 3TQKA 2RDTA 3ZFHA 3PK7A 3QY8A 1L0PA 4FP1A 4DWSD 3GK0A 2W0UA 1B3ZA 4WXYA 4PMQA 3UYIA 2YCJA 1E55A 4HNNA 3S5YA 1DQWA 4ZENA 4H9VA 1E4MM 2XZ7A 1A5UA 2TODA 3MUAA 2QF8A 3KOFA 2F8QA 5D38A 2J9ZA 1XKJA 5DT5A 1FWIC 3P61A 3W3OA 3AROA 3AU2A 5CZTA 4XZMX 5KITA 4FNPA 2DW7A 3O05A 3RILA 2FZ8A 1YE4A 3NL2A 3P60A 4JTRA 6CGTA 3GKAA 1RY0A 1ZAHA 4AFYA 4BF5A 5M3WA 4HNLA 3L0NA 4JTUA 1LT8A 1PYFA 3FVMA 3WQCA 1OYBA 1GONA 4C6JA 4C5ZA 4C65A 1AL8A 5IBXA 3RF9A 3T44A 1AW1A 1UOZA 3FY1A 1J93A 1W31A 5F2IA 3USBA 1XSKA 4NT0A 4M7SA 3CIXA 4BWLA 2ISSA 4QQ3A 1ADSA 4AWSA 1EIXA 2OQLA 4HA3A 1MDRA 2PTDA 1LOLA 1UC4A 1M7OA 1BRLB 4Q4RA 1TTJA 3V1HA 4EAYA 3S2CA 1AMYA 3FX4A 3OLEA 4CCZA 4ZE5A 5EU9A 1XIEA 4US5A 3FS2A 5HA7A 3APGA 3N4AA 1XWYA 2UV8G 1FDZA 3PANA 3UR2A 2YCLB 1KRBC 2ZBTA 3LUTA 5LIUX 4I90A 1EJWC 2W62A 1ADOA 2PF0A 1RXOB 2BY3A 1B0IA 1J8VA 1ITCA 3AQUA 3CLMA 1U5HA 1D3HA 3SAZA 3WMBA 3VGGA 3NPUA 4XZ9A 2F2KA 1TR1A 4J2MA 4HPNA 4P7RA 1E6NA 3L7RA 2D2GA 3QLLA 4AD1A 1E73M 5HMEA 4B5XA 4LTSA 4CGTA 2NUWA 3EX6A 2DPEA 1VPXA 3FFSA 5LHEA 1FCQA 4GD0A 4Q3MA 4C6LA 3W1XA 3R11A 2IS7A 1M5WA 5CZSA 3EMZA 3GTXA 2BG5A 4D6EA 4EE9A 4J3TA 1J5TA 3R2GA 3OBEA 4G1NA 4KEVA 4ZO8A 3T0AA 3WLJA 3AIWA 1EJ7L 4PBEA 2DSUA 4J5NA 1LWIA 3GNPA 4V15A 1XIGA 4ZOCA 3KLLA 3GXPA 2ZUUA 3FDGA 1TWIA 3OHIA 2XINA 3EKZA 3BL3A 1BYCA 2NQZA 4LNYA 5LXEA 1JZ2A 1VEPA 3AUOA 4E4PA 4XTIA 1NWTA 3BLDA 5U4NA 1NFGA 1XBXA 3BWWA 1MDLA 4WQ6A 3W9ZA 1V3IA 2ACSA 1UR1A 3IIPA 2W63A 4HK5A 2ASHA 4K37A 4ATDA 3WK1A 3TAOA 4KT2A 3WJYA 4IP5A 3R1ZA 4D6JA 1JDFA 4H1ZA 1SZNA 1CPUA 1UB3A 3E3HA 3NA8A 1H11A 4LEQA 1FBAA 2DEPA 4BQ5A 3T0BA 4U2YA 3WLHA 1OC5A 3IEBA 3LI0A 3A9BA 1TQXA 3PPFA 3UVIA 1XH1A 2J7DA 3EOLA 1TJ0A 5TD4A 4JHOA 1MZHA 3ID7A 1WO2A 3VCRA 3C6CA 3W37A 3BG3A 3BW3A 1QFEA 3U3HA 2JF6A 4O12A 1KCLA 1AA1B 5K9DA 1GPWA 4NHVA 3F2CA 1LF1A 1PX8A 4E38A 3EX3A 3TXVA 4GYKA 4CN6A 2I5QA 4LOCA 1QASA 3NQ6A 3GG1A 3TSBA 1TPVA 1UR3M 1WZLA 4W8BA 1J01A 3LZ3A 2DZXA 1VQTA 4BS0A 1MNSA 3EEGA 5BXRA 1PAMA 3QMRA 4QLKA 3OVRA 1Q7ZA 4O13A 1QWGA 1NVMA 4JEQA 6REQA 4FNSA 3C8FA 2XVNA 2NSXA 4JKMA 4XSLA 4B5WA 4B4HA 1YNPA 2GDUA 1RK5A 4Q8PA 5CPTA 3WLTA 1I0BA 3Q37A 2IQDA 1KTNA 3KOYA 3LPGA 2PGWA 4NX0A 3ZLHA 3GIQA 2PE4A 4C6IA 3CMJA 3IK4A 3RU8X 1H3GA 4UZUA 4WSHA 3VOCA 5C8BB 1JCTA 1FWRA 3GTHA 4MF4A 4QSHA 2XG9A 3UXKA 3QLDA 1EGZA 4DWSB 4MHBA 3CK5A 4E4UA 3QMTA 2QLYA 4YVVA 3SUWA 4Y8FA 4ZSTA 3G0SA 4IZGA 3U8GA 3ZWTA 1TPEA 3GYCA 2ZRWA 1UP3A 1SYTA 5A6TC 5DBTA 2E7FA 4OWGA 1GVSA 1K9DA 3CHFA 4TTUA 2A5HA 4Z2JA 3LRMA 3M6YA 1G67A 2PUZA 1K7XA 1C92A 1OGSA 1PXGA 3VOHA 1D7KA 2OVLA 1VHNA 4AHOA 5AHIA 1WKFA 3GUWA 3KRBA 4I6VA 4TVCA 1KLZA 2IUZA 2XVPA 1OFBA 1UW9A 3FXYA 2JIWA 3IAQA 4KH2A 2NWSA 7REQB 4FOJA 3N9RA 2V5BA 1EQCA 4AEOA 2WJFA 3S42A 4FPSA 2XJ7A 4JTJA 3CQIA 3NIYA 1BGAA 2WV8A 1RH9A 2E68A 1UHVA 2Z24A 2QCFA 5EFDA 1FTXA 4OECA 4ROPA 5I2UA 1V6XA 3M5ZA 1SPQA 2DIKA 4QG8A 3QV6A 4MMWA 3UA3A 4LAOA 4KWWA 3WQPA 2W79A 1O4UA 1OF6A 3VNIA 4DF2A 1NEYA 4O4VA 1V03A 1XH0A 3A4AA 3PTDA 3QYQA 1JDAA 1WAUA 3W7LA 3GR7A 3ZZ1A 4GZEA 2XSAA 4X63A 3HU7A 4J9JA 1QHPA 1ONRA 3WQDA 4FOKA 3XINA 2FH6A 3M7SA 4JTTA 2PDIA 4W93A 3SURA 3W73A 1FCBA 4WKHA 1A5BA 1GYLA 1QPQA 1UPPA 4I5RA 1EA9C 3LD5A 5KSWA 1QPRA 1FWWA 1TMQA 3IJ8A 3NQMA 2WCSA 5HJLA 4ZA0A 2I7GA 2DDXA 5CKSA 1IXNA 3OA5A 4GZJA 4KCVA 1YYAA 1OVDA 2C14A 3OJGA 1R3SA 3UWUA 4L61A 4CD4A 2EBNA 5HWJA 5A6JA 4JFTA 2HROA 3PZTA 2ZX7A 1TJ1A 1ZFJA 3R12A 1V79A 5C71A 4NJIA 4UNKA 4NRRA 4LVDA 3TOPA 1SFTA 2CHRA 2CLKA 3RHGA 1E5NA 2PU1A 5AN7A 1R9XA 3SGGA 5I3IA 1EZ2A 4Z2IA 3CIVA 4REQA 3LGEA 4EPEC 3EGJA 2V8ZA 2YA1A 3TMQA 2E6DA 2QJGA 4ROQA 4A3UA 4LUTB 3AIQA 3I4KA 3DGRA 3W75A 1BQCA 1UR9A 4XWUA 1BYDA 1EYEA 4WXZA 3AISA 1BF6A 3W1AA 3DFHA 2GOKA 5AVHA 2P0IA 2ADAA 1B31A 1LP6A 3O0KA 1SR0A 3P67A 1Y5WA 4UMAA 1V5XA 2E9LA 1TELA 1F05A 3M0MA 5C9UA 1XIFA 2V82A 3HB9A 3MP5A 1ZQ5A 4JFWA 3SN4A 4NNCA 4ZR8A 5G2IA 1HL9A 1OG6A 3FA3A 1CI1A 3MSYA 3D0CA 1N7KA 2E8YA 3WBEA 2C18A 3VUPA 4C6KA 1VC4A 1ISXA 4IMDA 3LXBA 4UB9A 1I2RA 1MXSA 3GXFA 4HTBA 4RPQA 3W1NA 3LBMA 5J04A 4TX9A 2VYOA 1IEVA 3VZXA 3MDUA 5HWNA 4K39A 1JZ7A 2YL6A 4YPJA 1XI3A 4HMEA 3WD0A 4XX6A 4IX2A 5D9NA 2VZSA 4RW3A 3UR5A 2E5BA 1P6WA 1W1VA 2Z1SA 1AK5A 6TIMA 3AIUA 3MZNA 3N04A 4GYFA 1HJSA 3QEZA 4KMQA 1BLIA 4JY9A 3BAWA 1QPOA 4DEFA 5HUOA 2OELA 4I5UA 1HP4A 4R34A 1M68A 4IQLA 3AUJA 2ZDRA 1KGXA 2QNEA 4AVNA 5C70A 2VELA 3RX2A 1A49A 1UG6A 1IXPA 3LNMA 3SUVA 3PN8A 1KGWA 1QRQA 3KBNA 4Q8VA 4DJEA 1PTAA 1ADDA 1F9CA 4JHMA 1QK0A 3AOFA 2GK1B 3BICA 3COTA 3AHVA 1KBJA 1M3UA 4NI8A 1EUNA 4H01A 1ICPA 1SFLA 2YR1A 2FGBA 3EOOA 4KS0A 5CAHA 2J7FA 4JKLA 4IFKB 2R1KA 2CBUA 3MCOA 2Z7GA 4AIUA 5KZMA 3UZZA 3GVGA 3R6IA 4IPJA 3NL6A 1XISA 1XDLA 1FDYA 3BURA 4MWAD 3APYA 3NOEA 3RCNA 3FA4A 1DXIA 1GVEA 4Z2HA 4JIQA 4DJDC 3G1XA 3SECA 1E5JA 3KL5A 4DHGA 4DI9A 1XLCA 1S2AA 3G1DA 4H6QA 3PSWA 3ARWA 1WUFA 2HS6A 1J0ZA 2DUZA 2D3LA 4LJ3A 4TO8A 1REQB 2YXGA 3SSZA 3ITCA 1HTIA 3CT2A 2PTYA 1QHOA 1S1PA 3CWNA 4CQDA 2QYGA 4LF1A 1T5AA 4O28A 4OUEA 3KCOA 2YA2A 3E38A 3LK6A 4MKNA 2ZXDA 5M17A 2DUXA 1GG1A 1NDWA 4WIWA 1AD4A 4PCTA 4UOQA 4IMGA 3WO8A 3BGGA 2BY1A 2EG7A 4XAGA 2Z7KA 3ZT6A 3TFCA 2V5KA 3HQNA 4PB4A 3W76A 1EOKA 1KXQA 2D2JA 5J5DA 3DFOA 1KW1A 2FZMA 4I6KA 3VA8A 3FEMA 4LYQA 3PUOA 3A5VA 1MRQA 1CGYA 3VZYA 3AYSA 2J47A 1UKPA 3QPYA 1XDMA 1JEZA 3GR4A 4R27A 3BAYA 5D9PA 3W7IA 4FX6M 1KM3A 3VDGA 3DUGA 3O1NA 1S3HA 4QSFA 3GHUA 3QHMA 3WSUA 1H0GA 5DY3A 1H7RA 2NQHA 1K6WA 2E3ZA 3EWYA 3NTYA 1GVQA 3E9AA 2WHJA 4MOZA 4H19A 2OZ3A 1ZCOA 3H7UA 3QTGA 3H53A 4O52A 1B57A 3CMGA 3VE9A 1V3HA 1XLFA 1TV8A 3AJXA 3AO0A 1ZJHA 2H3DA 1EHAA 4DO5A 3PPHA 1GEHA 2DY3A 1A5SA 1UWUA 3B8SA 4YTUA 3V0TA 1UKTA 3PBMA 1QOQA 4Y9OA 1WV2A 2JEPA 5E6YA 2BS9A 1MQPA 3MSDA 1VPYA 5G4WA 4PCFA 1QW8A 4F0KA 1HT6A 4CNSA 3LPOA 4CN1A 1TA3B 3KBVA 1MEWA 1ISVA 4DVOA 4OOUA 3RXZA 3MP3A 5CZJA 2VD8A 2VD9A 4YYCA 3F4DA 4HHPA 7CGTA 3DBPA 2Y88A 3AXXA 2AMXA 2ZKMX 3L12A 4K1WA 1GCYA 1WUEA 4JQ4A 4HJWA 1GOMA 5HULA 5XINA 3OIXA 2BBFA 2J9YA 2PTZA 4ORIA 3DC0A 4PUJA 1C8QA 3LB0A 1WQ5A 1CLVA 4C6OA 3IVTA 3ZT5A 2NUYA 4D72A 1NELA 5AHNA 3NZRA 1R46A 4O14A 3MUCA 2B81A 4O1BA 4HU8A 1G4EA 3TJIA 4MUPA 2X8RA 4UTTA 1KFBA 1YXYA 1OJXA 1AQMA 2HXTA 1PSCA 4ZXOA 2GL5A 3FGCA 3WYZA 4YWIA 5DMYA 4UFHA 3TKFA 5CSRA 1R38A 4O10A 4ZSUA 4HOZA 4MJ4A 4MLJA 4OU1A 4GYPC 1VFUA 2E77A 3CPGA 2A79A 3N12A 3LDVA 3LHWA 1AW2A 5BRQA 1PIFA 4WK9A 3PZVA 3M0JA 4RCXA 4L65A 4M1BA 4TV6A 2WBGA 4FSAA 4C1NB 4X61A 1H1YA 1KKRA 3WQWA 2HVNA 3KXQA 3UQNA 5C9ZA 4AMCA 4KWSA 3B9NA 3TWBA 4K8EA 1IE7C 1VZWA 4PTWA 4NNAA 3RJYA 2O4QA 3PSVA 4M3PA 5AC6A 4QE5A 5A6BA 4JBRA 2J77A 1DWHM 5A6MA 4FXFA 2WC7A 1KRAC 3MKKA 2YW3A 4N42A 1K8ZA 3GC5A 4WDWA 1J9YA 4Q6JA 4DZAA 3T7VA 2PCQA 1YIXA 4ZVJA 5GVJA 1E4LA 4HZ7A 4XIMA 3GY1A 1EJTC 4AD2A 2Y0FA 1EFZA 1PZ1A 1VS1A 3U5YA 1L6FA 2PRMA 1E6PA 3ITYA 2WC4A 1ML1A 3VNDA 3L65A 1JIBA 1VEOA 3MUIA 1DQUA 1KXVA 3BQ5A 4AD3A 4C7GA 3MWAA 2PF8A 1M7PA 1PCKA 2O0TA 4Y9PA 3VIMA 2YFOA 2QIWA 3SIZA 3QC0A 1BTMA 3LSCA 3P0WA 3MJMA 1ZBWA 3MCMA 3VMOA 2Q02A 3VFCA 5KZDA 5CQ1A 4EPKA 3SSJA 1E71M 3NPWA 2R1LA 3PS7A 1RBLA 4QG6A 5FEWA 4JYEA 4BKNA 4XZHA 3LMYA 1VFTA 1Y5VA 3WLPA 3PF3A 4QNEA 5T26A 4KF1A 4MKVA 2OX1A 4GA8A 4GXWA 1JYXA 3EX4A 5CGMA 4JAWA 1I4NA 3LTYA 4EF8A 3DBNA 1H7XA 1CXFA 2PP3A 3QGVA 1DJXA 3VAVA 5GPRA 2P5NA 5D37A 2CYGA 3S2JA 5MF5A 4O0KA 3V5OA 5CCZA 3CEUA 1C9WA 2ZUVA 1UA3A 3VKDA 3FEQA 1BXCA 5DCEA 4YIWA 1W1PA 4DWSC 4Y9AA 1LM1A 2PEVA 1OFQA 1TFVA 4RNIA 3FIGA 4Q7NA 3RLGA 3V1PA 3W29A 1EKOA 1XRVA 3NXLA 1OADA 2EKGA 1TWSA 3CB8A 1K9EA 2Y63A 2PMQA 3VNKA 4WGXA 1ESWA 3VDAA 7PTDA 2VWTA 3P62A 5M1TA 4NXKA 1E1FA 4GXMA 1R2SA 1JNDA 1J5SA 2X7VA 3AMGA 3RX4A 2PRLA 1UWAA 4QE4A 1PWMA 4ML9A 4LT9A 1K1DA 4L6OA 5HMFA 4PUWA 3K4WA 3C0LA 3KS6A 5HXMA 2WVTA 2PPGA 2QXWA 2QPSA 3HQOA 4GGHA 3N6HA 3NYZA 3ENLA 2Y70A 4N02A 2G3IA 3GU9A 1KFWA 4GIAA 4IHCA 3STGA 2I16A 2QGYA 4HMNA 2CKRA 4NASA 2J24A 4NILA 3P7YA 1RR2A 4QCFA 4PC8A 3AHYA 2W9MA 2ALDA 5XIAA 2QJMA 2EEXA 1FWAC 4NYYA 4I9AA 2UY3A 1Q45A 2XSBA 4ZGYA 1LWHA 1CGWA 2ALRA 4Q4KA 5BZAA 3H22A 3HGRA 3W86A 4B2DA 4XK2A 5CSUA 1JULA 1R86A 1NARA 3B05A 4LAMA 2X42A 5F2LA 2FHBA 1OBAA 3GVRA 3E2RA 1H1ZA 3VM5A 1JG9A 4HU0A 5CC7A 3SQSA 4U31A 1TZZA 2YB4A 1TTQA 2V67A 3LCIA 4UQEA 2D3NA 3IV3A 3N4EA 3H2NA 3C2FA 3VZZA 2FVMA 3JZUA 3WUGA 1XLJA 3WUBA 1PS9A 4IWWA 3SR7A 3WQEA 4Q4OA 1YLVA 2FIQA 3ZYZA 4Q33A 1MW1A 2POTA 2XFWA 1YXDA 1HO4A 4J3UA 5FL1A 1WCGA 4OJYA 4PSRA 4TXEA 2RDXA 3HG5A 3KL0A 4F40A 2D20A 3A6OA 1PEZA 3MVTA 4MLRA 2QUNA 4UTUA 1Q7MA 2CZDA 3WNOA 1YPFA 3FJ4A 4NZ4A 1P43A 3W27A 2Y7FA 3VIPA 2Q71A 4QBXA 3LMZA 3P2VA 2BHUA 4GCAA 4JTAA 4KWOA 2NSOA 3DFQA 4MDPA 2I17A 3GG8A 4WZHA 2W66A 1AL7A 1PDYA 3QW4B 4XQ6A 4U4MA 5KMYA 2Y5JA 4PL1A 1QVBA 3TN6A 1HVXA 2BWGA 4K6AA 1A0CA 3VC5A 2PI6A 1YDOA 3NCOA 2V3FA 3AYVA 4NY2A 3N2XA 4PTNA 4IG2A 5K9XA 1YTEA 1U83A 2WC3A 3S2MA 2R82A 3IGHX 3W24A 4M1RA 5E5CA 4DX3A 2XSXA 3F4CA 1B3VA 1NP2A 2Z1WA 1DWAM 4BFAA 3TYUA 1Z9AA 2G37A 3DCPA 3G22A 3BK0A 1V6UA 1UMLA 3VFLA 3NQGA 1S38A 3NXFA 4F79A 3G6LA 4IMEA 5AYBA 1FWFC 1W3HA 3EOEA 1SM9A 1XLGA 3B4YA 2OTDA 2WM0A 4BY3A 1GZ1A 3THUA 3NR0A 3BO9A 2YCEA 3GH7A 1RK6A 1FUYA 4WY0F 1DKWA 4Y6GA 5HR6A 3I6TA 2VL4A 1GWJA 1UZ4A 2R1NA 4DM2A 5LIXX 1SO4A 3P81A 1G7UA 4P2VA 3SUUA 3GXIA 4YTQA 1PZ3A 1U1UA 4GX9A 1KB3A 3KBSA 3B0VC 4L9ZA 3TE9A 2NLIA 1OYAA 3EX1A 3N6QA 2AL2A 4IIDA 4J40A 3TYDA 1B3YA 4LY8A 1TV7A 4P8VA 2BODX 2DT2A 5I6SA 2IPFA 1UD6A 3TN4A 5FSEC 4E8GA 1BYAA 5HQMA 2X0YA 3MSRA 1T7LA 2R8WA 5CPLA 4GK8A 4KIRA 1HJUA 1VLWA 3W1PA 1E6SM 2XH4A 3IUHA 1I9CB 3LCFA 2VZVA 4US5D 4PL2A 3TTOA 4HSOA 1M03A 1HVQA 1K4HA 3WIJA 4L4LA 3WNPA 5FF7A 1Y65A 5LIWX 1NDZA 3BAXA 5ABEA 3QY6A 4PMNA 1FWGC 3VOJA 1FA2A 1GJWA 4DYKA 4INFA 2HRWA 3N6JA 3WKZA 2POZA 4GXPA 2NXHA 2VFIA 3VIIA 4QG9A 1QPKA 1UD2A 3HQ1A 2E1WA 3KVJA 3LCXA 5H8UA 4H41A 3TC6A 2XM1A 1CCWB 3MV01 4Y8EA 1EDGA 2P88A 1YDYA 4L4PA 3OOQA 3T81A 4ZTXA 3BH4A 1B3OA 1T40A 1O60A 2OU4A 4H4IA 4MZ1A 3VKCA 3HM7A 1XSIA 3QPZA 3DOPA 5D9OA 3UFYA 2J7BA 3WL0A 3DFSA 4URIA 2DP3A 5BOEA 1E72M 1PTDA 3WF1A 2YDQA 2CERA 2ON3A 1EH9A 2F61A 2YLLA 5EMLA 1A5NC 3NPVA 4O8RA 3N2CA 3CQ0A 5HDRA 4TTGA 1RVGA 2WPGA 4DJFC 4A22A 4R7OA 2VFHA 3IJIA 4TOQA 5IXEA 1NQKA 1UPMB 5EKYA 1HKMA 4XAPA 1P0EA 4MVAA 1OX6A 3GBDA 5EY5A 1AH4A 4B9ZA 3UGVA 3R58A 1O68A 2AMGA 4H3DA 5HOSA 4GFIA 2QCHA 2B31A 3SW6A 1X7IA 1J4EA 1SZGA 1MMFA 3AIBA 3RU6A 4NL1A 4N9DA 4NZFA 2A3HA 5CJNA 4HA1A 1H49A 2CEQA 1FWTA 1ZJIA 1G4TA 2V3EA 4IMFA 3DYMA 3RIKA 2BDQA 1CGUA 3SJ3A 2G97A 2VEMA 1QJWA 1G5AA 1PVNA 3OP2A 3UR7A 1FWDC 3U4AA 3N11A 1E0UA 2NQJA 2FB3A 2QCMA 3VGEA 2O4MA 1K7FA 3D3AA 3GAKA 2Y61A 1QR7A 1H5VA 4N4PA 1TPUA 2RH9A 3A9IA 3AWOA 1HL8A 4RNFA 3SN1A 4MNMA 2BFGA 3LHZA 3MY9A 1F3TA 1TRIA 3H2MA 4UNLA 3LI1A 2PWEA 4AWTA 1QNVA 5EPDA 1P7TA 4W7UA 4JXCA 1W91A 3C8NA 3B8TA 3S1VA 4W9TA 4DWDA 3ORWA 1W3IA 3C4UA 1EC7A 3BLEA 3SCPA 4CVWA 1F8MA 3W74A 1LRTA 1ME8A 1XINA 5LKYA 5BWFA 4NJGA 5CEWA 2Z2AA 2XH2A 4AVFA 2FFIA 1B3XA 1MEHA 3HJZA 1MXDA 3UA4A 1VENA 1ONWA 2XIBA 1S5WA 2BVTA 4UIOA 2PDFA 3QGAC 1J0IA 1OD8A 4YLWA 2NX1A 4UTMA 2CBJA 4L4MA 3WK3A 4IGHA 4Z1AA 1RBAA 2GDVA 4S3EA 1A5LC 2WCAA 5H1WA 2EPOA 4JX6A 2Y24A 5BMXA 4N0RA 2Q6ZA 3S3GA 2OSWA 1B4KA 4LAKA 3I7QA 2HE5A 5FJJA 3L5MA 4I3GA 3CYVA 3SADA 2WXDM 5DFAA 1QW9A 2H9AB 3SCSA 3RAOA 4D6HA 4XVEA 4Z42C 1RZMA 1KV5A 4C6EA 4RE0A 1BVNP 4DELA 3EXSA 4NZCA 1EBGA 3A21A 4M19A 2B7OA 1F8IA 4WHBA 1HO1A 4H8UA 4LS1A 4QISA 2YBUA 5K4XA 2TSYA 3NDOA 1F07A 3ZS4A 2QS8A 2RGMA 2VEIA 2PD9A 4PUDA 4C1KA 3MI2A 1WZAA 1TWDA 2ZA2A 3O0FA 3PVFA 4QTGA 1PKLA 2F9RA 4YL2A 5CLWA 1DEDA 5FCZA 1OZMA 3URAA 2PU0A 4D2JA 2B7PA 1NM9A 2OKTA 3HF3A 2XIIA 4UZSA 1UCWA 4LBSA 4CCCA 4S3AA 3WFLA 1PL9A 4QFUA 1JXJA 2QPXA 3CUFA 3IK2A 4DZ5A 1JZ3A 3SCNA 5EMMA 3UNDA 4CKQA 1QI4A 4HPGA 1XSJA 1JUEA 2WKGA 4LW7A 4LUYA 3GG0A 3S4TA 2OGYA 4N2YA 3VD7A 2D73A 4IICA 2PZ0A 2J8TA 1G7VA 3G1SA 4M6UA 2XZ9A 3EZ4A 2PGEA 2FHCA 2KZHA 3HMCA 5J8LA 3MKVA 2Y62A 3ICJA 4GNVA 4B90A 1IF2A 1KKOA 4FAMA 4DAIA 3EWDA 3L4WA 3ZVHA 1PV8A 1N2VA 3FHAA 4D6GA 3USZA 1EWEA 1SW0A 3ZWSA 3G1YA 2PD5A 5I0DA 4UCGA 3TJXA 1RVKA 3H23A 2EKCA 5CPSA 2WMKA 1UWIA 4U33A 5E0CA 1CB2A 2CNCA 2VEFA 3T9PA 4UQCA 3M7WA 4UOZA 3FNDA 1XBYA 3LRKA 3KZSA 1TPFA 3RMEA 4GUFA 1EJXC 3HQPA 1KBBA 2J75A 2ZZ5A 3MSGA 1JRBA 5B7YA 2ZX9A 3EB4A 4CQBA 1MNZA 3OLIA 3EA3A 2H90A 2O9TA 3CXOA 3ECQA 1IR1A 4K7YA 4JYDA 5I77A 3RCYA 1CXHA 4JX5A 3WNMA 1BKSA 2EG8A 5FJIA 1TPC1 1Q5MA 1CYGA 3TNBA 1AD1A 3WBWA 1MXGA 3I10A 4GRSA 1SU5A 4N6EA 1KR0A 3O7UA 4I9JA 2WQDA 3WELA 4R3UA 3EWBX 1XIDA 4XUYA 2HPMA 2C3ZA 3QZEA 3HFTA 5RUBA 3W7KA 3AI0A 4W85A 5CJMA 4U3AA 1POJA 3VCCA 3BG9A 3DAQA 1LL6A 1VIWA 2VGGA 4D8LA 4FHAA 3E0IA 5GNYA 2PFHA 5CBJA 4FNUA 3UZYA 1WKYA 2RDWA 1XLHA 2G96A 1V4YA 4GGBA 1ZHAA 3GXNA 3QY7A 4L7ZA 3OU8A 3AHXA 4UOJA 1TJPA 4K36A 1BFNA 3T0TA 1A4MA 1AH0A 4RK8A 2J6XA 3UETA 4JTFA 3BV7A 3AIVA 2HEJA 3PBUA 3FYYA 3HURA 2XWEA 2WNNA 3ITGA 4LYPA 1VP5A 5LNRA 2CLFA 1LBFA 3I3BA 2WHKA 4XD6A 4NF7A 5HK4A 2AL1A 4L9XA 4FA3A 2GGHA 2YXXA 3S6OA 4QITA 2ATMA 2Z1XA 1R85A 1TJ2A 3VOGA 1UA7A 4IP4A 2QVNA 1DXEA 5C2XA 2J6VA 4I7VA 3KLKA 2CLIA 1LG2A 2R14A 3G1RA 3W81A 1S2UA 1VBRA 2EO7A 5CJ5A 1U1HA 4IPNB 1VYRA 2RHGA 1HUVA 4W7WA 2YSWA 2UBPC 2VMFA 4B5NA 1K8XA 4HN8A 3THCA 2J7HA 3FCPA 4H6EA 2PP0A 5AOUA 1EC8A 2D24A 1TKKA 2LLEA 1C3FA 1WP6A 2IXVA 3KL3A 4L9YA 2WOQA 4MAZA 1W5NA 3BJSA 1PKNA 3ES7A 3L0GA 3T07A 4A2SA 3L67A 3W7RA 3Q94A 5G1TA 1WX0A 3HG2A 4UNIA 3TTQA 3KBJA 1JYNA 5CC5A 3W7PA 3PBVA 4LBRA 2UY2A 4JDYA 4GZ7A 1ZGDA 3LLFA 2Y7GA 4MJ2A 1E0VA 2PB1A 4Q4QA 4WLCA 1CXEA 2VUNA 3CHVA 2IKJA 4DZHA 1XX1A 1QI2A 2ZXQA 1Q4WA 3D5HA 4B92A 2WK2A 2A2IA 3SRDA 4DJDA 3MBFA 2XH7A 3AIRA 1J6PA 1P6CA 1UD4A 3WLOA 3M6DA 2PURA 4E2BA 1RJPA 4A8RA 4BK9A 2DGAA 5HQEA 5GNZA 1V51A 4NVTA 2VGIA 1VFSA 3ZIZA 1TJRA 2F2HA 2JFEX 1UWQA 3NQFA 2AQOA 2EGZA 3H6OA 4RV8A 2RFGA 4C7FA 2OKOA 4C1LA 4RZBA 4B9YA 1FP8A 1D9EA 2B0MA 3VX0A 1BTCA 2B7QA 4IPIA 1ICSA 4L80A 3L5LA 5CLTA 1KD0A 1F5ZA 2ZTKA 3ABQA 3UWWA 3HJEA 1GQIA 3SFWA 2C6QA 2V2CA 3G3DA 1EPVA 1ZALA 1FHDA 4ECLA 3H7VA 1Z8AA 2XIOA 4JCMA 4I9TA 5JUVA 1LROA 3IACA 4RNHA 2E09A 4HK7A 1FFRA 4IQJA 3ITOA 3KOZA 4FLQA 1US3A 3EKLA 2ZRXA 3LV6A 3Q4DA 1WDQA 1F7BA 3M5YA 5E9XA 2HDJA 2E25A 3W1RA 1TB3A 4NAFA 5TQLA 5TBOA 3VTRA 3Q2DA 3TNOA 4S3KA 2CW6A 1JPMA 3VOIA 1S5MA 3P8JA 1CEOA 4NSBA 1Z42A 3DYOA 1E6XM 5BXSA 3QR1A 2V6AA 2ZUWA 3SEPA 4GMEA 3UPMA 3EYPA 2E67A 1HX0A 3TROA 4ERAA 2E4TA 1VEMA 1KLYA 2GVGA 2WZMA 3WDIA 1FWSA 2MNRA 4M80A 6ENLA 3ZOAA 3R79A 1I1WA 3ITTA 4JKKA 3RRAA 4E6MA 2ZUMA 4AW7A 1B9ZA 3OW1A 2WSKA 3VABA 3MUY1 4AZHA 1C8XA 3K5XA 4JPGA 3TTSA 4QJ5B 3EWZA 2VCAA 3BLIA 3OGRA 4AY1A 1ZZMA 4I5XA 4GH1A 2YKKA 1XLLA 4G7EB 3C5QA 1V6WA 3BLKA 4OTKA 3I3DA 3ZMRA 1H7PA 2PODA 4WUIA 4ZQOA 4HHLA 2WZTA 4EANA 4CU6A 1DE5A 2GGIA 1TVLA 1VFHA 3RDKA 1U30A 3VCNA 2BHYA 2Z4GA 4J4KA 4QE1A 1QBBA 3QC3A 2Z1VA 1EUAA 2OPJA 2Z2BA 3B8WA 2I14A 3FKKA 3IGUA 3T2PA 1SJAA 5AHFA 5T9BG 3ARTA 3Q67A 1VKFA 1BRLA 2GSHA 2FGZA 5CZ0A 4WJEA 2VP8A 3TX9A 3HG4A 4H9ZA 2VEPA 5CPQA 1XGZA 1GJPA 3C3UA 1LG1A 3ZO9A 3N17A 3P5ZA 4KEMA 4F0SA 2YCLA 3DHPA 4MG4A 3VM7A 1PO9A 3NQ2A 2JALA 4AZGA 4S38A 5EBUA 1TPWA 4WDUA 3SCWA 2WZEA 3NQCA 3QV9A 5CPNA 1W1IE 5BXPA 4D1IA 3TN5A 2X1IA 3HGJA 3ITXA 3NQVA 3W7CA 4GINA 1TV5A 2OLAA 3O8AA 1OC6A 3MYOA 2J4GA 1CXLA 6XIAA 2X1SA 4KCUA 2CZFA 3UXDA 2W3ZA 3UW6A 4JN6A 5DEZA 4GYPA 3WZ0E 1DIEA 3EWUA 3GLCA 4W87A 4O1EA 4ORMA 1X38A 5JBEA 4IIEA 3WLNA 1F61A 4BQ2A 1E3ZA 2G0WA 5U7SA 3HZ3A 4Z2LA 1QOPA 2YDSA 4O1CA 3N2BA 3F2DA 3CO4A 1JF6A 2D69A 3VD4A 5A6BD 3NDYA 4NZ5A 3TDFA 3QQ0A 1GOWA 4MB3A 3CAQA 2PDQA 1W9UA 3BLOA 3GFZA 3NJ3A 3T6CA 3HPAA 1JPKA 4IXHA 2XH0A 1LQAA 1KFLA 3GDRA 1JPIA 1XYCA 3PTMA 4D6DA 1E70M 1WBJA 1K8YA 3NL5A 2OYLA 4O53A 1H2JA 4ZB5A 4GVGA 3B97A 2ZCGA 3N14A 4ZBCA 2PGRA 5AVNA 4JOMA 3KW3A 5A6AA 1EL3A 3L21A 4DUVA 3MPGA 4ZO9A 1F6PA 1XCWA 1JCMP 2HZGA 3F1QA 4Y2WA 1XFCA 4CD5A 3LNPA 2PP1A 4IMCA 2ZUTA 1RY8A 4AAJA 4A2RA 2EPKX 1HG3A 1IGSA 4M6PA 1Q6EA 2NT1A 2ZZ4A 8TIMA 2OZ8A 4A05A 4GNKB 1BXNA 4QJ4B 1TTIA 1RJQA 1X97A 3IGXA 3A3WA 2VZOA 4E5TA 1Q66A 3BXWA 1H50A 3SCUA 4R7WA 5FESA 3LQLA 1W3NA 2EXOA 4J35A 3BSGA 2XIQA 3CAVA 1KR1A 7ODCA 2ZRUA 2ZXBA 4QLJA 3AICA 2YOCA 1F3XA 3U5UA 4Y9NA 3CUIA 1H7OA 2C1IA 3LN3A 3WL1A 3BUVA 1TREA 4GQGA 3CAKA 2O56A 2TPSA 2UWFA 1WOAA 3WLIA 3TMLA 1LCOA 4UR8A 4E0CA 2GZXA 3MU7A 2FPYA 4AZCB 4GO9A 3NM3A 3K4AA 3W83A 2Y8KA 2J78A 5EB8A 4HIBA 5E0FA 1WKEA 3GVWA 3AMKA 1RAKA 1XJBA 3WQ6A 3PWGA 4A8NA 1H62A 3LBCA 2BY0A 2GJRA 4ZE4A 3FHQA 2XWDA 1IIGA 3LRLA 3PZNA 1E9LA 2ZZ7A 1JF5A 1NU5A 3EWXA 3M64A 3ATZA 2J25A 1JVNA 5D4YA 2XUCA 5E0KA 3H24A 2GQ3A 1P0BA 4DWSA 1DJWA 3OZPA 1R3TA 1TZ7A 3SCRA 2VWSA 3VKKA 1KBLA 3BCDA 3CAWA 3ARQA 2EJ1A 2W27A 2YL8A 2RDUA 3QBUA 3LGDA 1Q6LA 2D2OA 3CBWA 1F3WA 4X0NA 1RLDA 1E15A 3UERA 3LXAA 4W7VA 3UY7A 2HBVA 2REQB 5FF2A 3TTYA 2FDSA 2GJPA 3W07A 1OINA 4IM4A 4X9SA 2HV5A 4JIPA 7REQA 3PC0A 1W5QA 4PMVA 6A3HA 1PYMA