2PDKA

Human aldose reductase mutant l301m complexed with sorbinil.
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
315
structure length
315
Chain Sequence
ASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALMSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aldose reductase
publication title Merging the binding sites of aldose and aldehyde reductase for detection of inhibitor selectivity-determining features.
pubmed doi rcsb
source organism Homo sapiens
total genus 104
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2007-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2pdkA00
3CAVA 3CV7A 5JH2A 1QRQA 5AZ1A 3O0KA 4Q3MA 2FZ8A 3UZWA 4GIEA 3M64A 3B3DA 1RY0A 3DN5A 5LIWX 2HV5A 4PR4A 4XO7A 3LN3A 4L1WA 2BGQA 1YNQA 1T41A 1A80A 3UZXA 4F40A 2HVNA 4NKCA 4XK2A 2CLPA 1GVEA 3S3GA 1HW6A 1QWKA 1EKOA 2PD9A 3QKZA 4GA8A 3R8GA 1Z8AA 4HBKA 3FX4A 4PUUA 4ICCX 1IEIA 2WZTA 2PDJA 3WBXA 2FZDA 2IKHA 4GABA 3EB4A 1ADSA 2HVOA 2PDBA 2IPGA 2P5NA 1MRQA 4JTRA 1S1RA 2PDUA 3MB9A 2INEA 3LUTA 1FRBA 2DV0A 3H4GA 1XJBA 2F2KA 1AH4A 1VBJA 2IKGA 1RALA 2PDIA 3KRBA 3BUVA 4JQ1A 2PF8A 4GCAA 4H8NA 4ASTA 3C3UA 3DOPA 2QXWA 1EF3A 1LQAA 2PDHA 4DBUA 3G1RA 1ZQ5A 2BGSA 2PDWA 4JTQA 3G5EA 3UG8A 3WCZA 2FVLA 2PDXA 5HA7A 3COTA 2PDYA 3ONCA 1VP5A 3H7RA 1YNPA 1Q5MA 2R9RA 2PFHA 2VDGA 4EXAA 2HE5A 4XO6A 5JH1A 2IQ0A 3UFYA 2PDNA 3M0IA 4EXBA 3LBOA 3N2TA 3VXGA 2PZNA 1MZRA 3LQLA 4WDTA 3U2CA 2PDKA 2C91A 3LD5A 5HNUA 2R24A 4PRTA 3UWEA 4FA3A 1SM9A 1YE6A 2IQDA 3BCJA 5LIKX 4XZIA 3WG6A 3GHRA 4HMNA 2PDLA 4RPQA 3EAUA 1PWLA 1JEZA 3V0TA 4AUBA 2ACQA 1PWMA 4WDXA 3V35A 1US0A 4PMJA 2DUZA 1X96A 3O3RA 2BP1A 3ONBA 3MC5A 2PDMA 3GHSA 5LIXX 4YS1A 1ZUAX 4L1XA 3CV6A 3NTYA 3M4HA 4JQAA 3R43A 3CAQA 3T42A 1AZ1A 2PDGA 1XGDA 1Q13A 3LENA 1X97A 4XZLX 2ISFA 3LZ3A 4WEVX 1MI3A 4MHBA 3D3FA 3R6IA 4XZMX 1X98A 5AZ0A 1YE4A 4WDUA 4I5XA 3P2VA 2PDQA 1XF0A 5KETA 3R8HA 2IPJA 3WBWA 3GUGA 2A79A 4GQGA 3WBYA 3R94A 2DUXA 3R58A 2IPWA 3V0SA 4Q7BA 1PZ0A 4JQ4A 3UYIA 2IS7A 2PDPA 3LNMA 4IGSA 3CASA 3UZYA 3UZZA 1J96A 5LIUX 2I17A 1K8CA 4PUWA 2HEJA 2PDFA 4FALA 4YVXA 2WZMA 4LAUA 2FZBA 2IKIA 2PEVA 3H7UA 2AGTA 4IJCA 4OTKA 3FJNA 2INZA 1AZ2A 1UR3M 1S2CA 4XZHA 4FZIA 2F38A 3V36A 3RX3A 1ZSXA 1OG6A 4YVVA 5C7HA 4ZFCA 4JIHA 4R9OA 3EB3A 4XVDA 1HQTA 4LBRA 2FGBA 4JTDA 1T40A 3BV7A 4QXIA 2ACRA 3BURA 4LB4A 4WGHA 3GHUA 2NVDA 4JQ2A 3RX4A 4DBSA 4QX4A 4PRRA 3UGRA 2FZ9A 3F7JA 1ZGDA 1R38A 3R7MA 2IPFA 4QBXA 1M9HA 1Z9AA 2NVCA 2ALRA 1PYFA 1LWIA 4DZ5A 4LB3A 4JTCA 4YU1A 4JIRA 4QR6A 2ACSA 4XVEA 2PD5A 5DANA 4GACA 2PDCA 4JIIX 1EXBA 3CMFA 5M2FX 3Q67A 4JTAA 2I16A 4G5DA 1AH3A 3Q65A 3V0UA 1S2AA 4H7CA 1EL3A 1C9WA 1IHIA 1PZ1A 1RY8A 4WRHA 3UP8A 3LZ5A 5LIYX 1AFSA 3LQGA 4JQ3A 3LEPA 4XZNX 4GQ0A 1AH0A 4WDWA 2J8TA 4XAPA 4DBWA 1Z89A 1Z3NA 3RX2A 4FAMA 2HE8A 2IKJA 4LBSA 3ERPA 4IJRA 2ACUA 1S1PA 2HDJA 4LAZA 3N6QA 5HNTA 4YVPA 3GHTA
chains in the Genus database with same CATH superfamily
3LMYA 2ZTKA 2EXOA 1QWGA 1RLCL 4JY9A 1WE5A 1E9ZB 3DFQA 1SZNA 1LT8A 4MSSA 4PUNA 4D72A 1OFRA 4A6GA 3PPCA 4N0RA 3TMQA 1UKSA 4QNEA 5D2XA 2D22A 4XO7A 4W8AA 1W5OA 2V63A 2BGQA 3L4UA 3IAQA 4GWEA 1X1NA 3PHAA 3W72A 3DKLA 1OCNA 4XK2A 3S3GA 1TPC1 1NWSA 4C6IA 3OHIA 3BJSA 3DYOA 3CEUA 3R8GA 4B15A 5CQ1A 2DSWA 3LLXA 4PUUA 2D3LA 5JXQA 1KM6A 2F2HA 5CBJA 3W6LA 5LHEA 4ATLA 1XIBA 2IKHA 3VFLA 1ZS2A 2G0WA 3BAYA 2VUYA 4FHAA 4O28A 2PDBA 1OF8A 4O50A 2P5NA 1OX5A 1CI1A 2WKGA 5DF0A 4GCXA 5E1QA 3DG6A 4FNSA 2V5DA 3PJUA 4LTSA 2OVLA 1W1VA 2MUCA 2Y1HA 1D3HA 2ZRYA 4ORIA 1BAGA 2F6UA 4XISA 2J79A 1K03A 3E0VA 3B4UA 3TC6A 2AGKA 3W71A 4BWLC 4ES4A 4QEEA 3H2EA 4KIRA 4A3YA 1NWUA 1MXDA 1W9BM 3NGJA 3QLDA 3FJLA 1LQAA 1JR1A 1VPXA 4MY1A 4P7QA 3AQUA 4FOUA 3OP2A 3W7OA 4B5NA 1DE5A 2E9MA 4R3UA 4GZ7A 4AHQA 4AY7A 4W9TA 4GYJA 4CU7A 2VUNA 3VIPA 5U7SA 1XCWA 3EXRA 3MWAA 4M6UA 4XG1A 2ZC1A 4J40A 2NLYA 4HPJA 3G8RA 1N55A 4R88A 2QCDA 3AXIA 3LXBA 2DZTA 3OW1A 4V1YA 3ARQA 1GOXA 1UKTA 3TX9A 2CLOA 3W82A 4WKAA 3TTOA 3VXGA 6TAAA 2JFEX 3CHVA 3UR8A 1E0VA 1QPNA 5KINA 4JHMA 3VOHA 2QCFA 1W3IA 4HP5A 3CHEA 1K7XA 2C91A 4AZHA 2YDAA 3BDKA 4AYGA 3W1RA 1H7RA 1W32A 3SIZA 1G4TA 3IIVA 1TREA 4WF7A 1I60A 1N7KA 4AY1A 2O4QA 1C93A 3TYCA 1JZ3A 4YLWA 4AUBA 3W4RA 4OUIA 1YXCA 1FHDA 4GFSA 4K37A 1X8FA 4UOZA 5A2BA 3LV5A 1JYWA 3O2LA 4FI4A 3LTSA 2GQ9A 4YTQA 1HKIA 1EHAA 4ATWA 1FH8A 2TSYA 1AMYA 4PTVA 4PGLA 3AMKA 4DUXA 3OEXA 1S38A 2QIWA 2DU2A 2QUNA 1YX1A 3T55A 3T42A 1FHVA 2IUZA 1WZAA 3T7VA 3VAVA 5XIMA 1XYMA 1KRMA 4QS5A 2CXGA 3OBAA 2ISFA 1O94A 1AJZA 4TVUA 7XIMA 4WEVX 3W84A 2W3ZA 2BODX 4HNCA 3TJIA 4P8UA 4HD5A 4C6PA 3G18A 3TC7A 4WDUA 1PIGA 6TIMA 3KUMA 2OX1A 3ARPA 3LNPA 2DQWA 2C16A 2IPJA 1DP0A 2NT0A 4AXKA 3R94A 8CGTA 5F2IA 3EMCA 4DZIA 2UWFA 1VFTA 4JL2A 3O0FA 1TKKA 2IS7A 3RRAA 1UCWA 1PHQA 3Q58A 3O6AA 1J96A 1BG4A 3ZWSA 4MKNA 4QRNA 4QSHA 4IICA 2Y70A 3MUIA 1TYGA 1XQLA 4YMZA 2RGMA 5FJIA 3VOGA 1C8QA 1K9FA 1LG2A 2QAFA 2E6YA 5ABTA 2PUZA 1AW5A 1ONEA 1ZPTA 3LI0A 4LAOA 3QLLA 1VFHA 3WNMA 5JBFA 3WDJA 1JQVA 5A2CA 1I45A 4ALDA 5FJRA 5EA9A 4PRWA 4EAYA 3H70A 1RBAA 2ZICA 2YOCA 4GK8A 3ZR4A 3V1PA 3IGXA 4ZGYA 3WH9A 3G3MA 2BVTA 1POJA 2ZVIA 3APTA 7ODCA 1DV7A 1VCFA 1UMLA 4QX4A 1LL4A 1TELA 2VC5A 3LM7A 2BHUA 1R8LA 3SRKA 3UWZA 3KBVA 5IHRA 4W85A 3KTXA 3I6EA 3G1FA 4JIRA 3GZ3A 4JNMA 2X0HA 3GR7A 3GAKA 3LYEA 1XLCA 4NAEB 2Y7FA 2QDDA 1CIUA 4NJKA 3IJQA 3FN9A 1WXJA 4Z0SA 4G6CA 4JTAA 3HPAA 3VIFA 3E2VA 1HXJA 4NZ1A 1FWBC 1EWEA 2OFJA 1IHIA 1ODUA 4GX9A 4ACZB 3SFWA 1VFLA 3B0PA 4DXVA 2DT0A 2DZPA 1GVRA 5HK4A 3P0WA 2RKXA 1KD0A 3TW9A 3KLKA 3BLKA 3RX2A 4FAMA 2Z1WA 3VTRA 1RQBA 3WNLA 4AEFA 3PWAA 2ZZ2A 1E6NA 2O55A 3RU8X 1H3GA 2Z1VA 1CXLA 5DELA 4LAZA 1PUDA 2CLHA 4WD0A 1AQ0A 2XZ7A 1CGVA 2J7GA 4XIMA 3PPGA 4B90A 4YHEA 5DRIA 3C86A 3LCGA 5FL0A 3RM4A 1PZ3A 4XTIA 4RNHA 3ISIX 3TN3A 5J04A 2ANUA 2W6RA 3C56A 1L8NA 4PC8A 4HZ6A 1OK4A 1ME9A 2P88A 4FX8A 1LWHA 5HJYA 1UR4A 2E1WA 3IVTA 1JPIA 3ME3A 2VCBA 3I7SA 1RV8A 3BOLA 1J79A 5DLCA 2OTDA 3PB2A 1V0KA 4AIUA 1UZ1A 1XYFA 3F4DA 2ZCGA 5LYRA 1J12A 3TA6A 2G3FA 4LFYA 5BWAA 1HO4A 5A6SA 3UYCA 3VNYA 4DBEA 3RN6A 1ZZMA 1Q6GA 4X2RA 1XIIA 5BNKA 3LI1A 4BA0A 1A5BA 3W7GA 3I3DA 1TX0A 3L5LA 5I09A 3UEQA 3SCVA 5AHFA 3ARWA 3HQ1A 5DY2A 3NQ2A 4XSLA 3WDIA 4GG9A 3CJPA 2WPBA 3KS5A 3WBAA 1WKEA 4Z2IA 5A6BD 4JTRA 1Z69A 1HKJA 2INEA 3B8UA 2HRWA 3WLLA 1SPQA 4H9XA 2NXIA 4M82A 1Z7AA 2Z1SA 1DIOA 1GZJA 5L6UA 3S8HA 4QE5A 2WC7A 2PTDA 1WXYA 3DHDA 3WUFA 3ELFA 5M3WA 1FX6A 2IKGA 4C7DA 4QDWA 4POCA 2Y5SA 4MF4A 3BUVA 3G1YA 1JIBA 5I00A 2P53A 3UBPC 3G0XA 4GJIA 2QJHA 4C65A 4H6KA 3VM5A 5RUBA 5A6TC 2FZNA 3NZGA 1LORA 1RCOB 2J6XA 3LG3A 3G1RA 3JW7A 1HN1A 2PDWA 3VIOA 2HPIA 1HKKA 1ITUA 2NWSA 3S6OA 4XQ6A 3G6MA 3MUZ1 1HFBA 3R11A 5I02A 3COTA 1GQIA 3ONCA 3MJYA 2CZ5A 3QYSA 1V51A 3M0MA 4LAMA 3N11A 2GL5A 2WC4A 1ZBWA 2POTA 3VX0A 3LERA 1KGWA 3R1ZA 1VFSA 3IV8A 2ZZ4A 1FWDC 4K8HA 1UG6A 4PUKA 5A1AA 3SJ3A 4WDTA 4JFTA 2ZYFA 3EOOA 1TQJA 2DVTA 3F4VA 4FA3A 1LBLA 1NDZA 4Q8WA 2XN1A 3IRSA 4FLQA 1H0GA 4I9JA 2WCSA 4IL2A 2PZ0A 3H2MA 5CG0A 4O14A 1W5QA 4UMBA 4B3ZA 4W5ZA 1U22A 2ZE0A 3WQFA 1FWFC 1TWDA 4RDYA 3CZKA 3BK0A 3FLUA 1V6WA 2JEQA 4TTGA 3UPBA 1P6BA 3L2MA 3UPWA 4F0KA 1NFBA 3MQTA 4GKLA 3SCTA 5JQ9A 4Y9NA 2X30A 1EH9A 1EJSC 1F74A 3HQPA 3I3BA 4IMAA 3G3DA 2G4JA 1XYZA 3STEA 3ZFHA 3SDOA 4AWUA 3K5XA 4JKLA 1EC8A 3W7RA 3UWYA 1M7OA 1I9CB 4O18A 3AS1A 4W5UA 4AZGA 4C1NA 1E0TA 4RW5A 3VDBA 2D20A 4DO5A 5EMYA 4O1FA 3IUHA 2FYMA 4G7EA 1ZJAA 1R9YA 1W2PA 2E68A 1KCZA 4Q6XA 5H6HA 5KETA 3C0LA 3TIMA 2A79A 4M6VA 1KC7A 2DIKA 4IPIA 1V7YA 4E4UA 3CTTA 3KBMA 5C7VA 3DESA 3VKAA 1Q6QA 5EMUA 4H04A 3D46A 3QW4B 3EWYA 5G2WA 4YIWA 3PWIA 1WUFA 1OFOA 4BS0A 4C6EA 3CNYA 2YXGA 1DQUA 1IIGA 2QDEA 3E1F1 3W7LA 1UYQA 3LHYA 2VELA 5IOBA 1K8XA 4HNLA 1R7AA 2GJPA 1SW3A 1AD1A 1PBGA 2WQDA 1VHCA 2GGJA 2PEVA 4KWVA 4QE1A 3AXHA 4IJCA 1MW3A 5DMMA 5DT5A 3WFLA 2GK1B 3VIIA 3EYPA 4UTLA 4XAYA 2ZXAA 2DQXA 3WQ5A 1PKYA 5HOSA 1M65A 4Q4OA 5D32A 1WXZA 3VE9A 1UKQA 1OC7A 1PE1A 4DO4A 5D33A 2PI6A 1T40A 1IE7C 4BI7A 1DIDA 4KF1A 1Q63A 3KOZA 3UXKA 4HQVA 3H4WA 1MZHA 5C9ZA 3F1QA 4PRRA 1NOWA 2DW6A 2Y6ZA 2FHBA 5DBUA 2O7QA 5DO8A 2GJXA 4GXMA 1XYBA 4QBXA 1EIXA 5GJNA 1Z9AA 3IGHX 4K2SA 1XUUA 1Y8BA 2NQHA 4JY8A 1KQZA 5D30A 4GXWA 4AIOA 1IEQA 1BVNP 1OFPA 4XVEA 1JF6A 3U6WA 2PDCA 2BVWA 5A8QA 4IPNB 3AWNA 2TPSA 1BG9A 3CV1A 4OU1A 3TN6A 1XLGA 3AYTA 5F4XA 3HTWA 4IQDA 4XX6A 1Q45A 2CERA 2A0NA 3A47A 4H7CA 1BF6A 3IUIA 5LIYX 2F61A 3R12A 3STPA 2Z00A 3SUUA 3W2LA 5DN1A 5H2ZA 6REQA 2W63A 4JX4A 4AC7C 4LRSA 2WPGA 4L4OA 4GQBA 1OC6A 1Z3NA 1ZAJA 2XTKA 1MQRA 4QAIA 5CLWA 1RUSA 3FYYA 4PODA 3H12A 1H63A 1UWSA 2ZUNA 3IS4A 4XAGA 3AI0A 2HDJA 3CBWA 4IX2A 3C0QA 1E43A 4RL3A 5CPMA 5A3HA 1W3KA 4GVGA 4AF0A 3O0KA 1D3CA 3EMZA 1QPOA 2XVNA 1A50A 5LIWX 1JDCA 2HV5A 1R3YA 1OABA 1GJPA 1C7TA 4NZCA 5HMEA 1JI1A 2OR2A 2ZA2A 2ZRXA 3WQVA 1R3WA 3ANYA 2Q8ZA 1AUSL 3MYPA 1FWCC 2GPTA 2QVHA 1HKVA 3NQDA 5LNVA 1XCFA 4W8BA 1P0KA 3VKDA 1N8IA 2RUSA 2WZTA 3W88A 2ISDA 4RR4A 3P8IA 3CV2A 2EPNA 1EYWA 2Y7GA 1BKSA 4LS1A 2B4GA 1IT8A 4DUOA 3VNIA 1IZKA 1JGMA 3MB9A 3AHYA 1OFBA 4PCFA 4UQDA 2ONEA 3QEZA 4S39A 5I03A 1VFMA 1E9LA 4WIWA 5E0CA 4C6BA 4LY4A 2VRJA 4K1WA 4DAIA 5FF3A 2GOUA 4DWDA 2B7QA 4D6IA 3WLRA 3F5LA 2BHYA 2WZIA 4IUOA 3WO8A 3O63A 4PTXA 4I9MA 1EC9A 4IGHA 4CQBA 1FH9A 4O0QA 4O0ZA 3QM3A 1RJQA 1XH1A 3NXLA 4KWUA 3EPOA 4DM1A 3WCZA 3F4WA 3VGHA 3B4YA 1BSIA 2DJXA 3MYOA 3VD7A 3ZOAA 4H1ZA 1I4NA 3N73A 3E49A 3GDBA 5A8PA 2DSVA 2QV4A 3UCCA 2VYOA 1IZCA 2EKCA 1HGWA 2ZKMX 4D6DA 1ZBVA 4TX6A 5E93A 3LXCA 2QPXA 4K68A 5A2AA 3KP1A 4XZ9A 3AMDA 2EKGA 3M0IA 1GVQA 4EXBA 1MEWA 2ZX9A 3NDZA 5FJJA 5HPOA 1TV2A 2VTFA 3C2RA 3GU9A 3WNNA 3N2BA 2OB3A 3BZGA 1T96A 2Q8XA 2GJNA 4EE9A 3VNMA 2PU1A 3Q37A 3NZQA 4RJEA 2EPKX 3EAUA 3LRKA 2FTYA 2WWCA 4LY8A 3O3RA 2C3ZA 4EPBC 3T0BA 1S5VA 1LLZA 4Y8EA 1CGXA 1BYAA 1OYCA 1KBBA 1VFOA 1IXOA 2OU4A 2VR5A 1WA3A 5E0KA 3PS7A 2FFCA 3CAQA 3LTPA 1RD5A 4HCDA 3WF4A 4C5ZA 3W7CA 4GIAA 4WKFA 3RU6A 4RE2A 2OODA 4HU3A 1OYAA 5FEPA 5F1VA 2GGHA 1QAPA 1B3VA 4J27A 3ZT6A 6CGTA 1FFRA 2VZVA 2NUYA 4E3VA 2ZRWA 4CD6A 1NJJA 4EPDC 4TX9A 1Q2SA 1F73A 3NQGA 1O6IA 3AC0A 4I5XA 1P1XA 2W61A 4YJ5A 3P6LA 3R8HA 3WBWA 4L7ZA 1LBFA 2FVKA 4GY1A 5C8BB 2I5GA 1O68A 4KH2A 1ONWA 1TWWA 2CWXA 2VQUA 4REQA 3V0SA 4Q7BA 1W1IE 2P76A 3GW3A 2WO5A 3WF0A 5HWNA 5BCAA 2XGZA 1UWIA 4B9YA 4F2TA 4FMVA 3W9ZA 4HNOA 2DY3A 3UZYA 1ZBKA 3S2CA 3G2GA 2NUXA 4IQEA 4V27A 4AG0A 3QGVA 4NUWA 2CBUA 4Z1DA 1A4MA 2FB2A 2ISSA 3NSXA 1NDWA 2IKIA 3PF3A 3RM8A 3AXMA 3KOFA 1BVWA 4BEUA 5KSWA 4MFDA 5ECVA 1UR8A 1ITQA 4P7NA 1DWAM 3L23A 3ZVHB 3BC9A 3GB6A 3P7YA 1F6KA 4HYRA 4JTUA 4QLKA 3KOWA 4OBTA 4L9ZA 4HHPA 3UG3A 1NARA 1H7OA 4P7LA 1AQFA 4PB4A 4Z2HA 3RPTA 5IDZA 4PFHA 1UD2A 1UKOA 2WVSA 1WDDA 2VC7A 2Z7KA 4M6QA 2ZX8A 3ANVA 5AVNA 1J5TA 1EJWC 4LB4A 2VD8A 4JQ2A 3WMCA 7REQB 3QY6A 4C6LA 3ZLFA 4F9JA 4QITA 2VZOA 3ZT7A 1MWOA 4NRSA 1ZGDA 3CWHA 3RUBL 3KWXA 3FHAA 4MZ1A 2ICSA 4O57A 3SQMA 3B97A 1GKRA 4GVIA 3LA4A 3SSZA 3LX9A 3PK7A 2PD5A 1KFCA 3AZRA 1E40A 1E6PA 1V7AA 4B5UA 1DTUA 1GVYA 1IEXA 1KFLA 2WBKA 4R9XA 2J6VA 3GVWA 4WKHA 3NQ7A 2WB5A 3EA2A 4HCHA 3QC3A 1G1YA 1F9CA 5CPLA 2NT1A 1WDRA 3ZM8A 1CENA 1GOOA 4K7VA 2OEJA 2WV8A 3N9RA 4UOQA 5LNRA 3AHXA 4J9JA 4NNAA 3R0KA 4DUVA 4B91A 2H8ZA 5AC5A 4GVHA 1D3GA 1NM9A 3FVDA 2XIIA 3QY7A 3IARA 1IXQA 2FHFA 3WH6A 4ZSTA 4E8CA 3SCNA 2KX9A 2PCQA 3PBGA 2NSXA 3HPZA 2OSWA 3EMQA 1JG9A 1W2VA 3GC2A 3HFYA 4MB4A 1FWTA 4GXPA 2NV2A 3TNBA 2FZ8A 4AWEA 3TSDA 1FWRA 1EGMA 3M64A 2DT3A 3CHDA 3MANA 3PUEA 3OHMB 4LRTA 4MLRA 1A0EA 4UNIA 4K8GA 5FSEC 3VKJA 3ATZA 2VHLA 4AVFA 4WQ6A 4J4KA 1OEPA 1M01A 4Z1YA 5CGQA 5HWJA 1W9DM 3QHNA 4E4PA 1GK8A 3O8AA 2WSYA 3G0UA 3STCA 1O12A 1BRLB 3L9CA 2FZDA 3DXIA 3THCA 2GSHA 1WKFA 4C6QA 1TCMA 4LV9A 1G94A 5ABFB 2PWUA 4JXCA 3FGCB 4DHGA 3TXVA 3IK4A 2GJLA 1H11A 4DJFC 1VEPA 2P0IA 2CXEA 3L4ZA 4DO7A 4L61A 3PNZA 2YCKX 3CUGA 1WUEA 1H09A 1LZOA 2G41A 3KBSA 2PF8A 1OFQA 4UB9A 3WMLA 4KWOA 3WY1A 3C61A 3NPWA 4B5SA 3DX5A 4GCAA 1XLEA 2FZMA 1BTCA 1E3XA 1E15A 5LZLA 2HPMA 3BJTA 3BLIA 4CQ8A 1B57A 2FJKA 5DCDA 2XGBA 3NL3A 4LUTA 3VCCA 3IEBA 2R14A 2W0UA 3VCNA 4D6JA 2HK1A 4RDZA 2QVNA 3G22A 4I7WA 2ZZ1A 3VOFA 1HIZA 2IQ0A 4Z0JA 1M7XA 4KCVA 1T8QA 1OB0A 4QJ1A 2Z2BA 3SECA 4IG2A 1T0OA 5KZEA 1TA3A 3U2ZA 3NPVA 3BLFA 3BCJA 3N2XA 4XZIA 2PMQA 3GHRA 3EWUA 4UOJA 1B3WA 2I5IA 2Q3OA 3ZQ9A 3TR9A 3AOFA 2WC3A 1V6VA 3GBEA 3O16A 1HTIA 5C6MA 1A0DA 3OVPA 2QW5A 1F6PA 2AKMA 3W86A 2W67A 1OGBA 2V6AA 2PCEA 3RYSA 1CB7B 3MS8A 5JU6A 1RP8A 3BGAA 3W2NA 1ZUAX 1OADA 4C91A 3WMBA 1Q7QA 4Y7EA 4KCTA 4HHLA 4HA3A 4KIEA 3CYJA 2QCLA 2J7EA 3S6TA 1OVDA 3N9KA 1C92A 2X0YA 3WQ6A 1UJQA 1LG1A 1SZEA 4UTKA 1JFHA 2JKPA 5IBXA 5M03A 1IXNA 4AZCA 5KEZA 3LENA 2DW7A 4XZLX 3W23A 3MHGA 2Z24A 3EKZA 4QTGA 4OOZA 2VNCA 3H23A 1NQ6A 2WMJA 1YDNA 1Z44A 1YEYA 3R6IA 4CU8A 4UTWA 3VM7A 3SIMA 4D8LA 4AHOA 5HXMA 3W2MA 2PLKA 2DVUA 3WQGA 5LA0A 4PCNA 5B80A 4G1KA 3EDDA 1QUMA 1O5XA 3LHUA 1XV8A 2WXDM 3TH6A 4GZIA 3OU8A 1E4MM 4N42A 2NX3A 3QV8A 4UMCA 1TMLA 2ABAA 5AN7A 1A5UA 4X61A 3QZEA 3DFYA 1CT5A 2G3MA 3NURA 3PM6A 3MMDA 2EJ1A 2UY4A 1UWAA 4JFWA 1EZWA 1PXGA 4JTFA 3AO0A 3CQIA 5DQPA 4Q7IA 2FZBA 2BHZA 4A2SA 2BY2A 2CCRA 3NOYA 9CGTA 1NIUA 3NO1A 4TTUA 3TTYA 2X40A 3T2PA 1EGVA 3AUOA 1VZWA 4IL0A 4HK5A 3GNDA 1EUAA 3A3XA 4DLMA 1QI0A 5HULA 1HQTA 3ARUA 5ABHA 2FFIA 3WDRA 3EWCA 5IBXC 4ERAA 1R85A 2XIOA 1OX4A 3IJ7A 2YL8A 2WYSA 1GG0A 4HZ8A 3NQCA 1F5ZA 3DUGA 4BQ5A 1LT7A 5HNRA 1OFEA 2ZDRA 2EAWA 4UTWC 1X1OA 2I9EA 3MCNA 1EPXA 4ZTYA 5G4HC 2CBIA 1QNVA 4R33A 4GUGA 1W17A 4UQ9A 3CWNA 4PBFA 4LB3A 1SQ7A 4QDMA 4MKVA 3TP4A 1US3A 4OECA 1ADDA 3GXTA 3NZRA 5MKGA 2G4FA 5FJTA 2X8RA 4YHGA 2VEKA 4DF0A 1XLFA 3OLDA 1RCXB 1XLIA 2VWTA 3W74A 4DM2A 3T1GA 2PRLA 5DFAA 3TJXA 4G2DA 4AZ7A 4JX5A 2JQXA 3EDJA 1PKNA 1M41A 4R34A 3ZLHA 3NL2A 4OQVA 3E9AA 4QP0A 4QGCA 5LNWA 1H1ZA 1OD8A 2HXUA 1MO0A 2ODOA 4LBSA 1B5TA 1QT1A 3RCMA 2H9AA 2BV9A 3H4XA 2PWVA 2NQJA 3KRUA 3S2JA 2A7NA 3MVIA 3LU2A 2XIQA 4ECLA 4IZGA 2FMOA 3G1SA 2DORA 2YLAA 1ZY9A 1QOPA 3MSDA 3I10A 1UA7A 3TDFA 5K9CA 4H9TA 2VC9A 1GQKA 4Q3MA 3W2KA 4GUFA 4DPPA 3DCPA 4O52A 1KWKA 2VRQA 4ZQOA 1O7AA 3VNLA 3P93A 4EK7A 4WJEA 1EXPA 4DX3A 4UQEA 3BG3A 4JHZA 3BGGA 2BASA 4WLCA 4ADUA 1FQ0A 1ZRQA 3IJDA 5IFTA 3FIGA 3LPFA 5I77A 2BZNA 4LF1A 2PLJA 2OWWA 1UOZA 1XIDA 1W1PA 1KCLA 2VZSA 2EQDA 2OKOA 4BEQA 1GGOA 2E6FA 2Z2AA 4F8XA 3KVLA 4PUMA 3WUBA 1D8CA 1EKOA 1NQKA 3SEPA 1GJWA 1NVMA 3TWBA 3SQSA 1IEIA 1TPEA 3RITA 1VLWA 4IJBA 3I3EA 3BTNA 2O4MA 2XFWA 5D2VA 4IH3A 3W87A 1ADSA 4UR8A 3EWDA 4FPSA 3MI3A 2AL2A 4D71A 3WQPA 1H4PA 4EAMA 1QI5A 2QJNA 1Q4WA 1XGEA 1W3NA 2YKKA 1TTIA 3T0CA 1H51A 4K1GA 1SMAA 3WLQA 3G1AA 4DEFA 4IFKA 2PC8A 2W79A 5BRPA 1RP9A 4KERA 3J7HA 1C9DA 3GU2A 1YADA 5BXTA 5ENLA 1V3JA 4UTJA 3FSTA 3ABOA 3ZYZA 1XLMA 4DNMA 4ZXOA 3C4UA 1JZ4A 1R2TA 1XM3A 3HPXA 4A22A 3LCXA 3CC1A 1R2RA 5BW6A 1X7FA 2BY3A 1FWEC 4JTHA 5C9WA 3MTWA 3T4WA 3S0CA 4ILSA 4UXDA 1GOMA 2HE5A 4AD3A 2WWDA 1OFAA 3EGJA 3IIPA 4D9PA 4WK9A 3VI2A 3T4CA 3GNRA 2A3BA 2VXNA 4PB3A 3LQLA 2R82A 3T08A 3GH7A 2QMJA 3MU7A 5A8GA 2I1OA 4Z08A 1SM9A 3TQPA 1QXLA 3I65A 5DBTA 4NAFA 5I07A 3EB2A 3HG2A 2Q02A 4JTIA 3U48A 3NDYA 1KM3A 3GNOA 3EEGA 4HU0A 4YYCA 1PWLA 3NUKA 1VJIA 1BKHA 2DUZA 2VKZG 1X96A 3GYEA 4S3GA 1BHGA 3D3AA 2ZQ0A 3WLIA 3SURA 2A1YA 3OJGA 4MAZA 3NSNA 3KVJA 3TZFA 2GUBA 3TMLA 4H6RA 2CZVA 2A7RA 3PZOA 4GNVA 1O5RA 3R43A 4GYFA 4GISA 3TWAA 2D73A 5D4YA 3WNPA 1ZL1A 2RDUA 1OCJA 3E6EA 3QYQA 4AZIA 1E1CA 4FS9A 3ABRA 3MKVA 1EHNA 4LGXA 3VVGA 3TOPA 1Q6OA 1X98A 1QOQA 2IMRA 1UR1A 2J24A 1HVQA 3SUWA 2E6AA 5I3HA 5HJLA 3UJFA 1ZCCA 4U5IA 2GVLA 4LV4A 1XIHA 3GUGA 1D7KA 1V8EA 2W9MA 3CQ0A 3B04A 1SO3A 4HHHA 3TNOA 2AMGA 2VEIA 4PUEA 3N2CA 1NFGA 1F2JA 4BF7A 1BYCA 1HP4A 3CASA 2GFTA 2JIWA 1IIHA 3QF0A 1OCBA 3QBUA 3F03K 2CWNA 3ZWTA 2ZOXA 3C2FA 1R47A 4IXXA 4NZ4A 2PDFA 4FALA 2JGYA 2DZAA 3GUWA 4ML9A 3GTNA 1U1UA 2VMFA 2XM1A 4XZHA 1KW1A 3UXDA 1F8MA 4ZR8A 3RJXA 3THDA 1WCGA 1XUZA 4LVFA 4U2YA 3LPPA 1JAKA 2WJZA 1XC6A 3RJYA 1IZJA 3EB3A 4F0LA 5K2ZA 4A4AA 5E09A 2O56A 3BV7A 4Z2KA 1E1EA 1XIJA 1MDRA 2HNHA 1FWAC 3VZYA 2CETA 5D2YA 4EWJA 3AYVA 1NEYA 1VBGA 1SYTA 5T8GA 4DBSA 3ATYA 3SN1A 3PZTA 3G24A 4WR3A 3UT0A 1V3KA 4YCPA 2VURA 1JYVA 2IPFA 5FF4A 3A22A 1CXIA 5AHIA 2CPUA 2VCAA 5BXSA 1I0DA 2ALRA 1XSIA 2E0PA 5KZDA 4A8NA 4AX7A 3AFBA 4TU1A 4QR6A 1T6MA 1ZJBA 1ISVA 2Q01A 3AYSA 2FH6A 4XB3A 1WZMA 4QJ3B 4GACA 1ODZA 4QG6A 5FF7A 3I7QA 2FHCA 6XIMA 4L80A 4ADSA 4G5DA 1GT8A 4D6EA 4HU4A 4FF7A 2CZDA 1J10A 4WRHA 2PWFA 3W7HA 4GQ0A 3JU2A 3P5ZA 3W7NA 4S3AA 3XINA 2C7FA 1Z89A 3H2AA 3WYZA 4E8GA 5TNVA 1XBZA 5CXPA 3DH7A 2WANA 2J88A 2XSBA 4EANA 1TTQA 3GSMA 3CPRA 1V6UA 3VO0A 4ZOBA 4M0XA 2Y7DA 3IJ9A 1KXTA 3PANA 2VGBA 4R5EA 1GOKA 4Z1CA 1VYRA 3PBYA 1TB3A 2YPIA 3D0CA 4MIMA 2Q6ZA 3VU2A 1LBMA 2QCGA 3PAJA 5HMDA 3TU9A 4H6EA 4M7SA 1N8WA 3UZXA 3UZJA 4D1JA 2NUWA 3TAOA 5HATA 1J0YA 2SFPA 1K70A 3M0VA 3WENA 3AHVA 1J11A 5L9FA 5I3FA 1GVEA 2PPGA 1QTWA 1TPVA 2ZBTA 1OQFA 1KNWA 4Y9MA 2BY0A 3GVVA 1KV5A 4AWSA 4KT2A 4QEHA 1REQB 3FX4A 3HGSA 3AMLA 3KOYA 1J2BA 1WDSA 4U10A 4CQ9A 2BVYA 4DF2A 1VQTA 4DAFA 1FXQA 1CBGA 2QYGA 1E4LA 1UB3A 1KA9F 4Y8FA 3ZJKA 1VYSX 4AEOA 1MVYA 2HS8A 1TV7A 1HGYA 5FJUA 3TQ0A 3D47A 3N29A 4A35A 5FF2A 2ISWA 4NJHA 1Q6CA 3ID7A 1N82A 1MNZA 3UA4A 1D8WA 2E4TA 3QPEA 3LM3A 3GXIA 1Q3NA 2PODA 3ENLA 3MI6A 5F2LA 4A05A 4FOKA 4UMAA 3BOFA 4HJWA 4DBUA 2XVGA 3A5FA 3CHCA 3FV9A 3M5YA 3WELA 1ZQ5A 4US5D 1HX0A 3UG8A 3QSTA 2VEPA 3PZVA 1CPUA 2BS9A 1KXVA 2NQ5A 2Z27A 3W28A 2GWGA 1KFWA 4JTKA 3W3OA 3BXWA 1ZAIA 2V5BA 3IAPA 1FHLA 1TUFA 2AOSA 5CZ0A 2OYMA 4JTGA 3QQ1A 2VO5A 1MQQA 1TV3A 3UWWA 3T07A 3UWVA 4NILA 1MZRA 1PIIA 2WVVA 2FMNA 4H8UA 3R5EA 3GVQA 3LD5A 5HNUA 1J5SA 3NCOA 5I06A 3KW3A 4B3KA 3RO8A 4UUIA 2E9BA 5M1TA 5MF5A 2X16A 4P61A 4WY0A 3DFOA 4EPKA 1V0NA 3SSJA 2H6RA 3IWPA 3LBCA 3VD9A 2CZEA 4S1FA 2WKLA 5IHSA 1JPKA 2YXXA 1UBPC 3E96A 3MP3A 3W6YA 4JR5A 1XG4A 5CC6A 1B31A 5DXYA 1EF2A 3WDHA 1B54A 4Y90A 1RD6A 1UUQA 4OE7A 4ZQPA 3A9BA 1HJWA 1XHGA 4JFVA 4YS1A 1V6XA 4RCXA 4IT1A 4M1BA 5E5CA 3FYPA 1DHKA 4U3AA 1SMDA 4G56A 1RZMA 2Y89A 3WNKA 1XGDA 5AC4A 1QHZA 4MWAD 4CKQA 4MDPA 4GI9A 3RRXA 2L5HA 3NG3A 3A21A 3BCDA 3DHUA 4GJ1A 4MHBA 3SR7A 4RZ6A 1DPMA 3BE7A 1UP0A 2I56A 3D3FA 4ZSUA 2CHOA 4MNJA 2C8NA 4O8AA 4XZMX 1GTHA 2Z0IA 2B81A 3HGRA 3AMGA 2ZIDA 1MSSA 2PDQA 3CWOX 1K4GA 4PSRA 3DEQA 2DUXA 3W7JA 5FCZA 1QNOA 4E8DA 4NNBA 1P43A 2YDQA 2FIQA 4M8UA 3QMTA 2BLEA 2DIJA 3CUZA 2V2CA 1Q6DA 3BSHA 4CCCA 3BZJA 3HURA 1V03A 1JPMA 4OVXA 1OIMA 2CEQA 3MT1A 2HWGA 4QQUA 3UA3A 1VFFA 3I6TA 4QJ5B 4LXFA 2ATMA 2F84A 1E6RA 3LK6A 3WH5A 3MZNA 2J7DA 2Y85A 1C3FA 2P1FA 4GINA 4DJDA 2TYSA 2EJAA 4NU7A 1VC4A 3W7IA 1NF7A 3U5UA 4J3UA 1EC7A 3QY8A 4H3DA 5HJXA 1SUXA 4CNSA 4DLFA 1Q6LA 4C5YA 3QGAC 1L6YA 1HKMA 3PTKA 3UJSA 1WX0A 3CB8A 1Q6RA 1J18A 3T2QA 1QR7A 1TWZA 4MYXA 4Q7NA 1EIBA 1K9TA 4WGHA 3W29A 6A3HA 3TUUA 1JUEA 1I1XA 2P0OA 4H7VA 4AW7A 3JVAA 3E0IA 3UGRA 3BCFA 2FZ9A 5CPNA 4Y6GA 5D9MA 3ICJA 2XM2A 4OGZA 3CH9A 3W1QA 3S1XA 3DFPA 4MWAE 1MNSA 5TF0A 3WQWA 3OOQA 4RX0A 4E2OA 1G69A 1U30A 1DXIA 4JTCA 2WZHA 4X63A 1SSDA 3UVIA 5EB8A 5ECUA 1UWUA 2Z2UA 2DH3A 4LCRA 1KM5A 1P7TA 4O11A 2ZUWA 2QNEA 3S1UA 4PB5A 1EXBA 1GZ1A 4WVXA 4D6GA 3EX4A 2V3EA 1O1ZA 3L7RA 4IFOA 4NYYA 2PWGA 1H7WA 3UG5A 1LRTA 2WSKA 4JYFA 4W87A 1MFVA 3KCOA 3CM4A 3UD6A 4DPQA 4URIA 4DJDC 1UW9A 4Q22A 2EHHA 1S2WA 1FUYA 2GZXA 3ERPA 1K7FA 5D09A 2FTPA 2WSQA 4V33A 3CEPA 2J7FA 1TIWA 1AG1O 4UBPC 4TV5A 1TJRA 1QJWA 2CLIA 4UTUA 5JH2A 1K1DA 4QNWA 1AQHA 3FNDA 2YB1A 3BG5A 1L6SA 2ZZ6A 1KRCC 5I3IA 1J0ZA 3T8QA 5CGTA 2CC0A 4L1WA 1FWIC 4P7RA 2WOQA 3ITCA 1KV8A 1A80A 1ISWA 4WY0F 3K1DA 2P8BA 1XFBA 4S3BA 4C7FA 4FF5A 4F0SA 2G3IA 4RV8A 3SCRA 1FCQA 1OF6A 4J35A 3CL7A 4ZENA 4Z42C 1QWKA 4KEVA 3QKZA 3U4FA 3M0YA 4MZYA 5HDRA 1ML1A 4JGDA 3WBXA 4W7UA 4KETA 2X1TA 3BH4A 3UQNA 3CUHA 2QS8A 2XU2A 3HV9A 5JUVA 2PWHA 4PH6A 4W84A 3S2MA 1JUBA 4FO4A 4G7FA 3VNJA 3VA8A 1S3TC 2VGIA 3N9SA 4RV3A 4HVXA 2WM0A 4J3VA 4BI6A 1U5JA 4JDYA 2XFFA 3R4IA 4PMZA 1IGWA 1MXGA 2GVGA 1BF2A 5CZTA 1KLYA 4ZQRA 4LH8A 5FEXA 3KRBA 2WHLA 1S2VA 2Y61A 3NL6A 4GO9A 4JQ1A 4LNYA 4AD2A 1QK0A 1XDLA 3MA8A 1JQXA 4DJEC 3RF9A 2CHRA 3A4JA 4XD6A 5K4ZA 4IIBA 4K3ZA 3H2FA 4CNUA 4O53A 4P8XA 1NY1A 1DJYA 1ME8A 2VQTA 5JIWA 4OOUA 4P5UA 4LUSA 4JDBA 3DKJA 3IACA 2A6NA 3C6CA 4ZB5A 5BZAA 1L6FA 3MCMA 4HIBA 2D23A 4HOZA 2FKPA 1O5KA 3QQWA 7ENLA 1Q5MA 3AXXA 2Z1KA 2PFHA 1XI3A 3OZYA 1GEHA 2R6OA 4EXAA 4YWSA 2ZRVA 5JH1A 1T5AA 1VPQA 3TZNA 5FOOA 3T0AA 3BAXA 3S42A 5EYWA 3VC6A 1ZAHA 4MWAA 4GRSA 3JZEA 5HANA 1JUKA 3WH7A 5FF0A 3M41A 3CQKA 3FSUA 1DWGM 2D0HA 3BAIA 3ABSA 1GTEA 1J01A 3UF9A 1CDGA 3SRDA 3NNTA 4FLSA 3SCQA 3QXBA 3VNKA 4IIEA 1CLKA 2A3LA 4ZQCA 2WMFA 4G1NA 1PCKA 3UJ2A 3W1MA 3ARSA 5FL1A 1FH7A 3SN4A 4Q4KA 3GTHA 3N4EA 2QMKA 1I0BA 3FDKA 2X7VA 3NVTA 4CLMA 5CSRA 1UP2A 1JDFA 3TFXA 3R79A 2WVUA 3M4HA 3L67A 2PBOA 2NSOA 1DTNA 1ME7A 2VFHA 3VIMA 1XD1A 1FWGC 2A6LA 1J0IA 1G9HA 3HM7A 5BU6A 3IK2A 3WX7A 5CG7A 4IMFA 4NZFA 2ISVA 2B7OA 5G2IA 3P60A 1KGXA 3T8LA 4JPGA 1QFEA 5C54A 2YZ5A 3LGGA 3M6YA 2WSPA 1DQXA 4Q8MA 3P2VA 3N14A 1XLLA 2QCMA 2WCGA 1Q4NX 1OYBA 1XLDA 1QI4A 4GFIA 2DFAA 3ABQA 1XX1A 2PB1A 4UQAA 8XIMA 5C9XA 3EOUA 2V5JA 5G5IA 3UYIA 4J28A 3RCNA 3GE7A 1YPXA 3P0XA 4PA8A 4B2DD 4JIQA 1ALDA 1VRXA 2J66A 4J7RA 2V81A 1TE6A 2C0HA 5KZMA 1UPMB 3ITGA 3WD2A 2BX7A 2C13A 4DZAA 5CPOA 3FJNA 3SQLA 3N25A 2ZX6A 3TYUA 1AL7A 1QPRA 4LYQA 1JZ5A 3NZ1A 3V36A 4BR1A 3GQYA 1A3HA 4NI3A 2VX7A 2VC6A 5LA2A 1FXPA 1P0BA 4MDOA 5G1TA 2RDXA 3FS2A 3N34A 1TJ2A 2WHKA 3USZA 1W1ZA 3CZEA 2QHAA 4QROA 2VWSA 2JGQA 3QHMA 1EP1A 1PS9A 1FTXA 4HJFA 2A21A 1OX6A 2D0GA 3VKKA 4NIRA 5GNZA 1C8YA 3RDKA 3RPMA 4AH7A 2WVTA 1YTKA 3TV8A 3W7KA 5I78A 1HL8A 2VI0A 4PMQA 4UFLA 3W2UA 5HPCA 1S5TA 4RZ4A 5K9DA 3CZ8A 2Z6JA 1TPH1 3WKZA 2D1ZA 4MPKA 1XCXA 5M2FX 1WP6A 2YB4A 4O1BA 1FHUA 1R86A 2I16A 2OQHA 5DCBA 3PZMA 1AH3A 3CLMA 3W7DA 4E2VA 4YWIA 1MDLA 2QGYA 1XKYA 1E5JA 2BFGA 3LEPA 1RA5A 2C79A 3T6CA 2YDRA 4WDWA 3DI1A 4IOTA 3A23A 3TE9A 3VZZA 3BW2A 1YIXA 4LC6A 3WLSA 2W5FA 3TK7A 3GFXA 1YBQB 3M0LA 3PBVA 3HMCA 3BGJA 3B9NA 3LOTA 1XL9A 3GHTA 1BQCA 4XAFA 1FP9A 5FIPA 4ZO9A 1A5NC 5HMFA 1ADOA 2C18A 4GIEA 1TO3A 3MP4A 1W5MA 5A8NA 1B3YA 3BLOA 4ENLA 4S3CA 3WD4A 3TLLA 4XZWA 4F40A 1RBLA 1PSCA 2F6KA 2P3EA 1W1TA 4G8TA 1R30A 4AISA 5C2GA 3URNA 2XPKA 1GNXA 1UP3A 3CZJA 1V08A 2J47A 4S3KA 4YN5A 4N9CA 1GYNA 3PP7A 3ITVA 4LC8A 5CAHA 1E55A 2PDJA 1E71M 1GUVA 5A6AA 5AC6A 3PUGA 2WMIB 3W26A 1G4EA 2Y2WA 3HFTA 2H8XA 2B7NA 2E5BA 2PTZA 3MMWA 3I7RA 4R85A 3VK5A 3QV7A 2C1IA 2F2KA 3EOSA 2XHYA 2XVLA 3AS0A 3C3NA 3PZIA 1R7OA 2A3HA 1VB9A 4KKXA 3IVSA 1RALA 4IQLA 4H9VA 4NASA 2FJUB 4S3DA 3NVDA 4EACA 1EJXC 2E77A 1WDQA 2UY5A 4M24A 2OX4A 1GVSA 1J9YA 4J5NA 4ZL1A 3PJTA 4GUHA 2WJDA 5DRCA 5I6SA 4EWND 1TJ1A 3VC5A 3FOKA 5CPSA 1LUCB 5D8WA 4FNPA 4ZOEA 4HYWA 3M46A 2PTXA 2ZRUA 1H61A 5XINA 3EEZA 3UXAA 4LNCA 2R1LA 3MSRA 5EMJA 5TAOA 3U7BA 1YNPA 1MMFA 1GOWA 2J8GA 3ZLGA 2EG7A 3VD4A 1EA9C 2VDGA 3TOYA 1IWPA 3ITOA 1GOIA 3E2QA 3WQDA 3VDGA 2VZTA 1W5NA 2RH9A 3TC3A 5H8MA 1S3HA 2XDFA 4OWGA 5D37A 2R94A 2R24A 1CNVA 3ARZA 2DIEA 2OGJA 3BVJA 1UD3A 2VEGA 4PL2A 3WEMA 1QDSA 5KMYA 1NDVA 1KTBA 2QV5A 1XINA 5GQBA 1M53A 2BP1A 3ONBA 4DYKA 3MC5A 2CKSA 2YFOA 5CZSA 3B0VC 1PX4A 5JMUA 1AD4A 4RKAA 3CYVA 3N04A 3WDPP 3JS3A 3TLQA 3N2MA 3CL6A 3EDKA 3T09A 5I7GA 1VEMA 4N9DA 3HG3A 1AZ1A 4CN1A 4PSPA 3SCOA 1XDJA 2J9XA 1V3IA 1LOSA 4W93A 1EB3A 4NRRA 4LQ1A 3PZQA 2GVEA 1PZ2A 2QJGA 3ITYA 2ZE3A 3CL8A 4MY9A 1IYXA 1XG3A 4PULA 4CEXC 1FCBA 3L12A 2QF7A 4D1IA 2PP0A 5REQB 4HN8A 1MUWA 4CCEA 4NYUA 3GW0A 2YL9A 2Z28A 3POCA 1ICPA 4J3WA 4ADTA 2GGEA 3UJEA 2YSWA 2GUYA 4US6A 3AIBA 3A5VA 4YXGA 2PP1A 2J62A 1YMYA 3GDKA 5HQMA 1MEHA 3IGSA 2HMCA 1PTGA 1UD6A 2EBNA 4NJJA 1F05A 4ZZ9A 5K3VA 1KM2A 4Z1AA 3W1LA 1W37A 1SO6A 3VDAA 2I17A 4UNLA 1UC5A 2GYIA 3WLNA 1G7UA 1EEPA 4GBDA 4LAUA 4HMCA 4KFPA 5BMXA 1HZYA 3E38A 1GW1A 3SFKA 1Q66A 1KFKA 1JYXA 2VFIA 3RHGA 1V3MA 1X6LA 4XWUA 3AALA 3DI0A 1EJVC 1GHRA 1VGAA 1BEUA 2OSYA 2OSXA 2FPTA 2EPLX 4LBRA 4CEUC 3TCSA 4NG3A 2ACRA 4HMEA 4RNJA 3S5SA 1XH2A 3BURA 3BQ6A 1XSKA 4AX6A 1A0CA 4K6AA 4I7UA 3N6JA 3VD5A 2A3EA 1LCOA 1U1JA 4B5WA 4FK9A 4WOZA 1C90A 4F0HA 3GVGA 2CLFA 4BHYA 1KWGA 2ADAA 5E9XA 5CEWA 1RJPA 3W25A 4GPNA 1R3VA 4JN6A 4Q4PA 3FXYA 3URBA 4HOXA 3A24A 1SU5A 1EO5A 4I5RA 2Z1BA 2OPJA 1CW2A 1W3JA 5AB3A 3PPHA 1SSGA 3BO9A 1VENA 4M80A 3O15A 5FI8A 4CQDA 1J6PA 2WNZA 5LGXA 3VABA 2VDHA 1ZNNA 4H9MA 2CU0A 1W91A 3HGOA 3RG6A 3G77A 1ZHAA 1M6JA 1ZP4A 4DWSD 1DWIM 5G1MA 4IMCA 4XKYB 2YGYA 5IRPA 1KTCA 1QCWA 3O1NA 3GDMA 1A3WA 1F3WA 4HNNA 1RY8A 3MP5A 3LCFA 4NAEA 1AFSA 4KS0A 3MUXA 2VRKA 4GIYA 4XBKA 3ZMRA 1KKRA 3E74A 2FGLA 5BOFA 1H41A 5CJNA 2YCJA 2ZA3A 1H49A 5CBBA 3RLVA 4KPLA 3B8IA 4ACZA 4A3HA 4C6OA 3VNZA 4IJRA 2XN2A 5F2MA 2GVJA 1EX5A 3T78A 4L6DA 2Y0FA 3P8JA 3AHZA 1K6WA 3DG3A 2D0FA 2ZVRA 3T2OA 2NWRA 4LX4A 4I90A 1TMQA 2R1PA 4HTBA 3BPWA 1F3XA 2V69A 1W56A 2XH2A 3EX1A 2CFFA 3H7VA 3KEHA 4UFJA 3FK4A 3I4EA 4WUIA 1ITXA 3WJSA 1KR1A 4BFAA 4DI9A 3OVRA 1BPLB 4H19A 2AQVA 4ZA0A 1XPYA 1ESWA 3CZGA 5A6JA 5D9NA 4IIGA 4MM1A 4W4QA 4JIPA 2JKAA 3N4AA 5F4WA 4Q6JA 3IJIA 3HIJA 3JRKA 1GJUA 4GC3A 2QUMA 3KTCA 2VZUA 1T8XA 3L21A 4HN4A 1Z8AA 4MKSA 3UZ5A 4ICCX 3Q2DA 1VS1A 3ES7A 1G0CA 1U2YA 2F8QA 3WDQA 2HVOA 1UZHA 1MW2A 4ZODA 2OELA 2E7FA 1QNSA 4O0KA 3AJ7A 3H4GA 5D38A 1H1YA 3MVTA 3VIHA 3CAWA 3FA4A 3KHDA 4DN1A 3SI9A 3Q45A 1VCVA 3GAYA 5LHFA 3N4FA 4ZVJA 4V15A 1WPCA 3E2SA 1OIFA 4U4MA 1F6YA 3DC8A 3SRHA 1KXQA 4QISA 4KRTA 3ARRA 3MBDA 1DJIA 3V1HA 1K9EA 4Y9OA 5AC8A 4YL2A 5F7UA 1A3XA 4UFKA 1HP5A 5CSUA 4L9XA 2XINA 5E0FA 2VX6A 1JDDA 2PDXA 3K8KA 2BDQA 4GZJA 3DENA 3H7RA 1NTHA 1YKWA 2BSLA 5C2CA 4OV4A 4S23A 3LCIA 4MB5A 1GPWA 3W70A 3CUFA 4LPCA 3PZNA 4NI8A 2XSXA 3UERA 3UFYA 4G9PA 4O19A 3N18A 1KKOA 3N1AA 4DWSB 1GW9A 4D8AA 3WQCA 2OO0A 3PTMA 1W8GA 4K7YA 4FXFA 5I0DA 4EXQA 3GIQA 1BXNA 3LPOA 1VR6A 3IJ6A 4GMEA 5HR6A 1W5PA 2HXTA 2OMAA 1AA1B 4LW7A 4RE3A 2ACQA 6ALDA 1J6OA 2Y7EA 3W1XA 3E02A 4H7ZA 3ITLA 1UH4A 3MHUA 3SAZA 9RUBA 1G01A 3OG2A 5F4SA 4HPNA 1V3LA 3YPIA 1FOBA 1DL3A 4ICNA 3WLPA 1WNOA 1FWJC 1O4UA 3O6DA 1R9XA 4NHVA 2REQB 2WAGA 2OZ8A 4WGXA 1WYIA 4MTVA 3ALFA 1B90A 4DY1A 2A85A 3FFSA 2RJHA 4GBUA 4V28A 3BLEA 3NM3A 3U9IA 2ZADA 4H41A 3VGGA 4ZEPA 3TTEA 4CGTA 5K9XA 2A2IA 3S1WA 4JICA 1ECEA 5A6MA 3GLCA 3TYZA 2YZRA 4PTDA 5D2TA 1TTJA 1M7JA 1YE4A 1NP0A 4NZ3A 2BXVA 5FAJA 1GQJA 1J0HA 3GR4A 3L66A 3WF2A 5XIAA 4NXSA 3REQB 1I2PA 3GC4A 1UMYA 1TPDA 3FKRA 1JVNA 3KBWA 4IPJA 1EWDA 1KM1A 4PBEA 3W1UA 4IGSA 4UFHA 4RPPA 1K9DA 1Z41A 4L56A 3INPA 4MADA 2QJIA 3P3BA 1M5WA 3M0JA 4UZSA 1XXXA 1K8CA 4Q8PA 1G4PA 2V67A 5A6BA 4O13A 2AGTA 2VOTA 3ZSTA 3CPUA 1L8PA 2PGWA 5M5DA 3TYBA 1EYEA 3EDEA 3OGRA 4JIHA 5EFDA 1MW0A 3ZZ1A 1QNRA 2GK1A 2WKJA 1XYCA 5E6ZA 4F0MA 2XH4A 2ZUMA 1P6WA 2QKFA 3UGVA 4H9ZA 3FAWA 2B0MA 5CAKA 4NX5A 3SN0A 4W8LA 1A47A 3NYDA 3F2CA 4F48A 3OA5A 1C7SA 3B40A 3CUJA 3F7JA 3K13A 5A8MA 2ZXBA 4CU6A 3RPDA 2Y63A 4F2UA 1R87A 4ZBCA 4JCMA 2OEMA 4XV0A 2PC4A 4L4LA 2VCCA 5DANA 5BOEA 5C5YA 1YRRA 4CD4A 4A3UA 5PTDA 4RDVA 2OLSA 4GH3A 2ZRZA 1RJRA 1NSJA 3LCWA 5FA5A 1EFZA 2V82A 1S2AA 2UV8G 5IM51 4WOQA 3GH4A 3WJYA 1QU4A 1UJPA 3VOJA 1NDYA 3WD1A 3SADA 6PTDA 1CGYA 1JGIA 1X39A 3CZLA 1R3RA 5J5DA 3W7MA 2EGZA 2HS6A 4CCZA 3NSMA 3PFRA 2YJQA 2IKJA 4RK8A 2NXHA 1EDQA 1L2QA 3KX6A 3GNNA 3WNOA 5HR7A 3URAA 5C2XA 4PMYA 2ACUA 3GYCA 4UTHA 5CSYA 4LS0A 1CWYA 3VGDA 1TPWA 2ZDSA 3TJLA 3M0XA 1Y5XA 3VGEA 3UR5A 3KTSA 2Q71A 1QO2A 4LUJA 4R53A 3C8FA 1B3ZA 1EJRC 2DZBA 3V4BA 1JCYA 1MW1A 3KBJA 3ZJ7A 1W9PA 4OFCA 1S5NA 1PTDA 2QDHA 1GHSA 2YCEA 5AECA 3ARXA 3HGJA 2HCVA 2CLLA 2CLPA 4N6EA 3B9DA 4BI5A 3MO4A 2PD9A 4MJ2A 1H1NA 4NL1A 2FQIA 2JKEA 2WMHA 2DSZA 3EB4A 1F4AA 1KFEA 3L0GA 2OYKA 4DELA 2Q8LA 3LUTA 2AMXA 2O9RA 4HZMA 1LLWA 4LYPA 3UWQA 3PUOA 2XGIA 4XUGA 2RDTA 2XFRA 1JXKA 3SB0A 2IXVA 1HUVA 3KL0A 4Q8QA 3GFYA 5F2GA 4ASTA 3RMJA 4U3CA 3C3UA 3O05A 1X38A 2QXWA 4FSAA 3MDWA 1B3OA 2QCDB 4ATDA 4KWWA 4AD0A 4M81A 1EX1A 1MQPA 3NL5A 2BGSA 2G3NA 4CVWA 2HSAA 1OJXA 2X7WA 3M5VA 4FLRA 2D2JA 3GXMA 4LVGA 2V68A 3M43A 4KGJA 1MFUA 1VP5A 1ZBCA 3BLLA 2H3DA 1RPXA 1E4NA 4MB1A 1BYDA 4RXFA 1VAHA 1KRAC 2ZUUA 4DRSA 2GQ8A 2QUUA 2PDNA 4J3TA 3EKGA 4RLIA 3KM8A 3W81A 4UFIA 4CN6A 4HSHA 2PLCA 2VP8A 3W02A 3H21A 4PRTA 3N2OA 4N7QA 3TN4A 5LXEA 1L6GA 1R5YA 1BLIA 3F5KA 2TAAA 3QW3A 2YL6A 4JHOA 3C0JA 3HG5A 3W38A 4P2VA 4TXEA 1PWMA 1PJ9A 2GUUA 4HA0A 1GWJA 3S2LA 4QG9A 5DXXA 2W66A 5HQLA 3E0LA 3EXSA 3WLKX 3HA1A 3RR1A 2PDMA 5CCZA 5LIXX 1PVNA 4BQ2A 1EBHA 1B30A 1Z42A 2KZHA 3W85A 4B5VA 1OFDA 3S5NA 2WLZA 3CMJA 3ZT5A 1QPKA 1J0KA 1J2WA 3AHTA 2Z26A 2PDGA 4FOJA 2NLIA 1XQKA 4CNOA 3R0UA 3S9IA 4FR6A 1OT1A 2WNNA 2PGEA 3MMTA 3AMCA 2ZUVA 4X22A 2YIHA 5B7YA 3GRIA 2Z1XA 4Q8OA 3N15A 4EX4A 3QVQA 1UA3A 4QDPA 2WK2A 2POZA 4CVUA 1PO9A 3DGRA 3ARTA 3VMOA 4M19A 3FJ4A 3N6HA 3NM1A 4D8ZA 3UR7A 1LLOA 1ZALA 3MCOA 3K1GA 3QOKA 2HNEA 4S38A 1DWHM 5CPTA 4OBSA 5A69A 4HKPA 4MUZA 1FWWA 4DYJA 1A5CA 2V5LA 4XTDA 3TYAA 1W1A1 4N2YA 5D2WA 3CIXA 1IWAA 1HL9A 3HJZA 2D2GA 3V18A 4GI6A 1GG1A 1HO1A 2PU0A 3SUVA 5LIUX 2DZVA 1TUXA 1XH0A 1H7NA 3IRDA 1T99A 3BJFA 4PYSA 4PTNA 3A3HA 3AAMA 3OBKA 3A4AA 3K8MA 3H7UA 4C7GA 4PEEA 1BFNA 3O9NA 3A3WA 1VIWA 2W62A 3VDCA 3CUXA 3C2VA 3DGBA 1RCQA 2CIPA 3O7UA 4PFMA 3U4AA 1HT6A 3H2CA 4CNPA 1B9ZA 4KFOA 4ZOCA 1Q8AA 4XUYA 1Y7VA 1OWQA 4XVDA 5EFFA 5DX7A 4AXNA 3EWZA 2C19A 3GX9A 4MJMA 3ZVHA 5G4EA 3QV6A 3C2YA 4HK6A 3VD3A 4LS2A 3ZS4A 4MMWA 2DT1A 5CSSA 4LWWA 4HZ7A 1K8ZA 3H26A 4KCWA 2G5WA 2AKZA 4K36A 2BY1A 2E40A 5CPQA 1M1BA 2WW5A 1XRFA 5CKSA 7REQA 3EX3A 1US2A 2KAUC 2ZZ5A 2XWEA 5D9PA 3LLFA 1LROA 4MLJA 2UY2A 5C55A 1TVPA 3LHWA 4EF8A 3ORWA 3SY1A 4JOMA 3ZVIA 3AXKA 1TZ9A 3RCYA 3TSMA 1I2QA 3A9IA 4LUYA 4N9BA 3BL3A 4AIBA 3CH0A 1AL8A 1QHOA 2G96A 3CT7A 1EZ2A 2Z25A 1G4SA 2ZUSA 5GNYA 1EJUC 3EPNA 2Y8KA 2ZTJA 4FNRA 3MKKA 1WAUA 2Z6IA 2JALA 1YXDA 3S5OA 5FJPA 5FESA 3CLWA 3QOMA 2XZ9A 3OODA 2DVXA 2WJFA 3VOCA 2X05A 1WQ5A 1DHPA 5HNTA 1JZ8A 3VKBA 1E6XM 4O54A 5C71A 4QAWA 4PMNA 1P0DA 1OCQA 4V2XA 2ZA1A 4YCOA 1E56A 3OVGA 5FEWA 1UQYA 1ZJHA 4HNVA 3BWWA 2YR1A 4K8EA 1CLVA 4PR4A 5I5RA 2ZWZA 3TONA 3W37A 1T41A 1E51A 1DJXA 5AHEA 1FKXA 4NKCA 3H55A 2YL5A 3NYZA 1KRBC 1TZZA 4AWTA 3POHA 2QGHA 3DHPA 3JUGA 4L64A 3V7PA 3CTLA 2PGFA 2XVPA 3PBUA 1JPHA 4IQJA 2QCCA 4ZOAA 3SCSA 1RHCA 4L4PA 5TD4A 4IP4A 3WQ8A 1CGWA 2BOGX 2CNCA 4HSOA 3KL5A 4AVNA 1TV8A 2QEZA 1FRBA 1DWJM 1BRLA 1BWKA 3TW7A 2HTMA 2X1IA 4JFUA 2OEKA 3GKFA 3QN3A 1VBJA 1SFSA 3OIHA 3OGVA 3VIGA 3OG3A 3QR1A 3DDMA 5ABFA 1VBRA 5B7ZA 3FGCA 4FP1A 2PDIA 1RK6A 3ZO9A 3P81A 4WSKA 4GZEA 3K2GA 2PS2A 1FP8A 3HMJG 1TWSA 3WK3A 2X41A 3G8EA 4KGLA 3DZ1A 4BZYA 4IX0A 5U4NA 1R3SA 4MNMA 4FB7A 3Q4DA 1LJYA 3DG7A 4CQAA 1UWRA 4JCLA 3B03A 4J1OA 1KFJA 1LQ2A 4DBDA 4D6HA 2D69A 3OBEA 2GSJA 2J77A 4GNJA 3W53A 3H2NA 5AYIA 1MYRA 1PIFA 1E5NA 3BOXA 3TXZA 3EX2A 3W1PA 3GXFA 4C90A 2OCZA 3KHJA 2AAMA 1EBGA 2PDKA 3GDRA 3NGFA 4JN7A 1R46A 3SGGA 2DUAA 4U28A 1JDEA 3DAQA 5ABGA 1UIOA 3TTSA 5T9CE 1CX9A 3L0NA 2NQZA 3TCEA 1FDYA 2WNWA 3NQBA 3CIWA 3V0TA 4HNUA 1SVDA 1US0A 3KCJA 2V5CA 4QM1A 4GD0A 4FX7A 1XLAA 1SO4A 4K39A 4IF2A 4JIEA 1TQXA 1Q85A 1DJZA 4O1CA 1A49A 2O9OA 2YW3A 4HT3A 5D8ZA 2XISA 3PAOA 3CV6A 3OPSA 3M7SA 3ZJ6A 1RVGA 3SGUA 1VEOA 5AHLA 4KW2A 1B1YA 4C1NB 4I7VA 1LRQA 1YTEA 1BGAA 2XFYA 3VIKA 4G7EB 4RZBA 4E0CA 3DBPA 4GI4A 1KTNA 2BMBA 1UQZA 3BAWA 1OSEA 1H62A 1CB2A 3PTQA 3G1XA 1OINA 5KITA 3TYDA 1K7EA 1TR1A 3UR2A 1IWBA 4RDWA 1OY0A 2C6QA 3BLPX 4DYEA 3MKCA 3KDOA 2CITA 1L6WA 5EMLA 3L5AA 2OO6A 2V2HA 3PUDA 2VVSA 4PEKA 3HG4A 3WFZA 3R58A 1ZJIA 1GVFA 3QV9A 5BYWA 1I2NA 1PZ0A 3IGUA 3PVFA 4H9YA 1DIEA 3G1VA 4B16A 4ONVA 3LNMA 1JPDX 4TIMA 3OB8A 4N4QA 4Q4RA 3UZZA 4PMRA 3V75A 4NSBA 1GONA 3MDUA 3GD6A 3M1ZA 3NIYA 4DQWA 5IDIA 1IEVA 3VUSA 2DZSA 3VIJA 2GDUA 1KCXA 1EPVA 3EX6A 1P0EA 4IPLA 4M3PA 4FZIA 5EL1A 5CBIA 4L9YA 1DJNA 5AFDA 3QKEA 1ZSXA 4YPJA 1W9VA 4OV9A 4L5ZA 4TQTA 1PYMA 2I57A 5AOUA 2DGAA 2GJXB 3CO8A 1B9BA 3AU6A 3LLDA 1I6NA 1K3UA 5D9OA 3NFUA 2CESA 1UPPA 3WQ4A 4U33A 3M5ZA 3MY9A 5HINA 3WFAA 2D3NA 3SY8A 4W7WA 4XZBA 4A8IA 3L4TA 1JL8A 3S1VA 1IT0A 1W8SA 4QHRA 3B9EA 4HHMA 1KO0A 1LWIA 4DZ5A 3GG8A 4HNTA 5FD0A 2ACSA 4Y96A 4PN2A 3P67A 2VGFA 1D9EA 1JJKA 4JFSA 4PBGA 1K8YA 1DJHA 1JZ6A 2ZZ3A 3K46A 2E09A 4YTSA 6REQB 1D7FA 1JF5A 1E6SM 4QJ4B 3PNUA 4LVDA 3CS2A 3HB9A 2HK0A 4IWWA 3GU1A 1J8VA 3Q65A 4WSJA 1KQYA 2ASHA 2CZFA 4IISA 3LQGA 3PZGA 1TPFA 3AS2A 1H7XA 4J3SA 3U2OA 1RK5A 3QQ0A 2BVDA 2NVAA 2ZUTA 4AB4A 3UESA 4AF0B 5EMKA 1Q2RA 3NPXA 4UTIA 3GFZA 5MHBA 1MUMA 2HVMA 1HNYA 1NU5A 3GG7A 3B0UX 1W9UA 3BV4A 1SZFA 5JBDA 3OA3A 3EOEA 1TFVA 5AZ1A 1B4KA 1DBTA 1TTPA 1V77A 5BROA 2J9YA 3T44A 1BD0A 3AIUA 9XIMA 1NH6A 3B3DA 2FLIA 1RY0A 1E0UA 4C6NA 4PE8A 4MB3A 1BXBA 1R3QA 3RK8A 2X1RA 1JRCA 4S3JA 1O5QA 4ROQA 3MW7A 1DORA 3O06A 1QBBA 1JCMP 4Q8NA 4IMEA 3W76A 2WHMA 2TRSA 4XKMA 4UQBA 2WLYA 4O10A 2XIJA 3NO3A 1HW6A 1ZB5A 4FLOA 3OYXA 4KWSA 3CPGA 1RXOB 3ANUA 3CMGA 4IM4A 3F5JA 1PKLA 1HJXA 5EGRA 2PF0A 5BWFA 3FKKA 5M17A 1JZ7A 2VFDA 4UZUA 3W7QA 3GZAA 4F79A 4GGHA 1VYPX 2PDUA 1NAL1 4FXJA 4J3ZA 3R2GA 4PMDA 1HL2A 3GG1A 4O12A 1AJ0A 3SY5A 4KEUA 5E6YA 3NQAA 2VEMA 3CAKA 2Y24A 4NNCA 3ZJ8A 4A29A 3EKLA 2A7PA 3RM9A 2X42A 1XIGA 2P8CA 1UASA 1EF3A 1KFBA 4IMDA 4J2MA 3V5OA 3KRSA 2F6XA 4L6HA 2IQTA 3V5CA 3VCRA 4JTQA 4AY8A 1E70M 1BGGA 4F9DA 3IANA 3K8LA 5HNNA 3OO2A 1WO2A 4H8VA 3BICA 5I24A 1BTMA 3BANA 1XBXA 4IMGA 1U83A 2ALDA 1SR0A 2EF9A 1AJ2A 4HA4A 4E4FA 4MAVA 5LA1A 1UKPA 4NZJA 2FDSA 4AYSA 5HWMA 3VFCA 3RAOA 1XS2A 5ABEA 1QOXA 1PAMA 1UH2A 2OOFA 2PRMA 1GKQA 1NELA 4EP8C 1GKPA 1WKDA 1O1HA 4FXRA 5I3DA 3CUIA 4DJFD 1WV2A 1JCLA 4AMCA 4RPQA 1XFCA 2QJJA 1EP2A 3L65A 4PMJA 5E9AA 3LRMA 4GY0A 2WSRA 4Y9AA 3GC5A 1WZLA 4H9UA 2OOGA 4LT9A 2E5CA 2Q3RA 3N13A 4NJIA 4QFUA 3GHSA 1QBAA 1O60A 1XRVA 4MZ8A 2WJEA 2BXYA 4F4RA 1EO7A 3TFCA 5AHNA 3IIZA 2YYTA 4MVAA 2CLKA 3S83A 1E9YB 1VBUA 1QI3A 5SWUA 4GHRA 4ZMGA 4B92A 3R25A 3QGKC 1EJTC 3S9ZA 2QCHA 3TROA 1E73M 3KWSA 4OIFA 1A5SA 4E2BA 3B9AA 5AKQA 1KBLA 3THUA 4ORMA 3L4WA 4W86A 1OGGA 4TMCA 4ZE5A 3DFTA 2OLHA 2UY3A 1P5BA 3W83A 4REQB 1EQCA 3RXZA 4GUJA 4LF2A 2HROA 1AQMA 2PGRA 4KEMA 4IP7A 2QF8A 5EU9A 4PCTA 4I8YA 3OZPA 3UJRA 4D6CA 4AIEA 3U2EA 4GQGA 1THFD 1WDPA 2H3BA 1OT2A 2XJ7A 1Q6FA 1ZCOA 2A3CA 2NXGA 2B7PA 1O95A 4EOUA 3M0KA 1FFQA 1VBHA 3WLMA 4IIFA 5AYBA 4HYVA 4L4MA 3E5BA 4U5KA 4LYRA 5EBUA 2DJLA 2EO7A 1CGUA 5A94A 4PUWA 2Z29A 5EKYA 4V1XA 1Z48A 1NOUA 4NP7A 3WUGA 2QLYA 2PA6A 2EG8A 1RQHA 1W31A 3O07A 3GK0A 1IXPA 1NF0A 3NEHA 1AZ2A 2YCLA 3M44A 5DEZA 1NWRA 2XUCA 4OT7A 3RX3A 3WL1A 4ZFCA 4P8WA 5H1WA 4IIDA 4JTDA 1VJSA 1Q8JA 1EOKA 4ZTXA 1KBKA 1FCUA 4AZ6A 4GI8A 1E0XA 5CC5A 3RX4A 3G1DA 3K4WA 3VINA 3D5HA 1UR9A 3GNXA 2YBUA 3BSGA 5KZ6A 3U57A 3AIRA 2C1GA 2XH0A 1XPGA 2NVCA 2PP3A 5BOOA 3L4XA 4MJ4A 3W27A 1E6QM 4DF1A 1TE1A 4JL1A 4FNQA 4R7WA 3WSUA 2PSNA 2JF6A 1S5WA 4LVBA 3CK5A 1LOLA 3P80A 3QZAA 2OZTA 3FW6A 2PWEA 1JRBA 4DI8A 1SZRA 1KM0A 1NFPA 5CC7A 2DP3A 4INFA 4GLEA 1RH9A 3TJ4A 3P84A 1UUOA 1R2SA 2HJPA 2RHGA 1PX8A 5A8OA 3UCDA 1Q6EA 2E6DA 1XR2A 2FH8A 3UXIA 4JQ3A 1G5AA 2V0TA 3WLTA 3HV8A 3M0HA 2FTWA 4XBJA 4DBWA 1XDMA 3MO7A 1KCKA 1EEXA 3STFA 1X6UA 4Q32A 5GVJA 4NVTA 3LBMA 3KRZA 1QMLA 4KMQA 4TMBA 4XSMA 2GVYA 2IW0A 3E5PA 1YPIA 5BU9A 3B05A 2FPVA 4JTEA 3NA8A 3HO8A 2E8YA 3SCPA 2P3ZA 3XISA 2YDSA 3B8TA 3CV7A 4S3FA 1DEDA 4RE4A 3F4CA 3UZWA 2Y4SA 2A5HA 4PMXA 3AS3A 4L65A 3SCUA 3LN3A 3EOLA 3BSMA 4E38A 2AQOA 2JEPA 5LNUA 1PX3A 2DZXA 4H4IA 1YTDA 1B2YA 2J8FA 4JEJA 1ISZA 3QPYA 3N12A 5AYYA 3S1GA 5I3GA 5LNSA 1UOKA 1YDYA 1WBHA 3BG9A 4H01A 4GQQA 3G0SA 1WBJA 3GM8A 3GTXA 1I1WA 1CXKA 2GLKA 4O8RA 1XBVA 2O0TA 3MI2A 4PTWA 4ZB0A 4Q8VA 4TX8A 4H2CA 1REQA 3OIXA 5CZJA 5LKYA 3BW3A 4GE8A 4O16A 2V8ZA 4HU8A 4C6MA 3TYEA 2J78A 4EVZA 2PWDA 3KAOA 1XICA 3II1A 4I9TA 3WF3A 1CZ1A 3AYRA 3AZTA 4CD8A 5EBAA 3GDLA 4LUTB 1UR2A 3PR2A 2QAPA 3M9YA 4WX2A 5K4XA 4DJFA 1YW1A 2PDHA 3VGBA 4HPGA 4CUCA 3OLIA 3G5EA 3QTGA 1F76A 2X2GA 3WJWA 1H2JA 2FVMA 5AY7A 3W1TA 4FNTA 3LCHA 1K4HA 1IR2A 4BK9A 3H22A 5HA7A 2NZLA 2PDYA 3B0YA 4NF7A 1OG0A 4IG2B 3W24A 1V79A 1QNPA 2R9RA 3I4KA 5CZKA 1TA3B 2OQYA 2R8WA 2DDXA 3PTDA 3MV01 2CYGA 5G4WA 3H6OA 2WBGA 3ZR5A 4M56A 1R0MA 3NXFA 3VGFA 1HJUA 3JZUA 3FY1A 3WQEA 1B3XA 4AD4A 1S46A 3CQJA 2YFNA 4WHBA 3OLEA 2Z7GA 4ZE4A 4ROPA 4UFMA 1JI2A 1OZMA 4AVOA 3WH8A 2ABBA 5FJOA 1UZ4A 1YE6A 1J0JA 3WG6A 2I9UA 3CU2A 3EA3A 4HMNA 4TUFA 1MUCA 2UBPC 1PL9A 4AEEA 1A5MC 4Z17A 3DU0A 2PRHA 2GOKA 3OQEA 3PZ9A 3C2OA 3S47A 4F3HA 3V3WA 4PTMA 3W07A 1U1HA 5C0QA 4AZCB 1S2TA 3GO2A 5DT7A 5AHMA 1YYAA 3UNDA 5AYZA 3K30A 3NOEA 7TAAA 1HJSA 2AAAA 2VDIA 3MBFA 2Y8UA 4R7OA 5C9RA 5LGZA 1J4EA 1PCWA 4JKKA 4JTLA 2BOEX 2Z4GA 3L68A 1UD4A 1X97A 1UR0A 1GQLA 4OUEA 2QUTA 1JFXA 4M5PA 3IVUA 2OXNA 4W89A 3GIYA 4TR9A 1XKJA 3R89A 3M07A 1JXJA 1EP3A 5HUPA 1C8VA 1DJWA 1K6AA 3GTFA 3AICA 2R1MA 3C5QA 1W54A 5CJMA 4I6KA 3W01A 3QZ6A 3TKFA 2CLEA 5IXEA 2X0SA 2IPWA 3T9PA 1Y65A 5G2HA 1ONRA 4WCJA 3MJMA 1QVBA 5HQEA 1IQ8A 3QHOA 1W3HA 4BQ3A 3WD0A 4MJZA 2VX5A 2GDVA 4A2RA 1CXHA 2WMGA 2GDQA 2W91A 3B06A 4HOWA 3EA1A 3CXOA 1U5VA 1X1ZA 3ES8A 3AIQA 3QRHA 2INZA 1UR3M 1S2CA 1XLHA 3HF3A 3M16A 3LXAA 3PBWA 4JS3A 1OX4B 2C71A 1SZGA 2VEFA 1RVKA 4YVVA 5C7HA 4IGMA 2OWCA 1EOMA 3H54A 8RUCA 5JIPA 3S2NA 2C15A 1W6TA 1FWSA 2V5KA 3S9YA 4BF9A 3TQVA 1UHVA 4XAZA 1F3EA 4ZQNA 3BQ5A 4B3LA 3B8VA 2O9TA 2NVDA 1DOSA 1VRDA 5BRBA 1J93A 2A4AA 4EF9A 3VILA 4US5A 2CW6A 3EWWA 1B0IA 4Q8TA 1R38A 3HJEA 4J2PA 2HISA 5MKGB 1M9HA 2E28A 2G50A 4IHCA 4EPEC 3UY7A 5BXPA 4AHPA 1PYFA 1SFLA 1SFJA 4PMUA 1UROA 3DFNA 3OZOA 1QK2A 2DSUA 2X1UA 3ABZA 1CEOA 3GY1A 1Y5WA 1PEZA 1TJ0A 5EPDA 1KBIA 3QH2A 3SCWA 4GQRA 2D2OA 2EPMX 1E3ZA 3PY2A 1A53A 3RLUA 2CBVA 4HMDA 1E1FA 3CB3A 3FVMA 5C9UA 2H9AB 4UTMA 2VVNA 2WHJA 3NAVA 3KDNA 5GPRA 3KS6A 1LRNA 1ONXA 3C0SA 3UY8A 3OQ8A 1BVZA 4GOAA 1QATA 5D03A 1H5YA 1CTNA 1BQGA 3FEQA 2TMDA 1UZDA 1LWJA 3N6QA 3PULA 3S5YA 2W27A 3N17A 2TODA 1PDZA 5JBEA 5TIMA 1P48A 1QRQA 4GVFA 3F2DA 1DYSA 4PUJA 3WLJA 3SUTA 1Z6KA 5DMNA 1JCXA 3DN5A 4NX0A 1F07A 4XD4A 1E72M 1SJCA 1YXYA 4C6KA 1YNQA 2VOMA 1RSCA 3RLHA 2FGZA 3AWOA 3BW4A 2HVNA 3AZSA 2R1NA 1GYMA 1U33A 3PB0A 1JDAA 3I6RA 3U7VA 3M0ZA 2YA2A 4BCEA 3KZPA 2J7BA 1S5MA 1E6ZA 4W7VA 3SM0A 2AL2B 8TIMA 2A3AA 4HBKA 4MGGA 3U5YA 3LMZA 3WK0A 2DZUA 5CGMA 4AMAA 3CIVA 3PJXA 3WMSA 2GGIA 4CN4A 1GEQA 3N3TA 1JCJA 4LCQA 1MRQA 4IFKB 5DCEA 2DV0A 4LBUA 3THQA 1SJDA 2INFA 2JIEA 5H8UA 1VJZA 4H83A 2G37A 4P7OA 3K4DA 4DXKA 3Q94A 5GJMA 4ZO8A 1W0MA 2CKRA 4N9EA 1EJ7L 1CECA 4IPPA 1YPFA 2E3ZA 2CLMA 3DBNA 1N8FA 3EBVA 4M51A 4C6CA 4DIAA 4QQ3A 5I23A 3IPWA 3WLHA 3T81A 2BOFX 3MWCA 3ITTA 2EPHA 1B4EA 2QULA 1XRTA 1QASA 2E5DA 2DT2A 4LJ3A 2O9PA 4LYKA 1TCDA 1V6YA 4MYAA 4MWAC 3C52A 2FVLA 2XSAA 4F2BA 3CHFA 2BB0A 4QLJA 3MSGA 3TA9A 3HN3A 2VT0A 1DXEA 1OBAA 3ARVA 2IXUA 3B0XA 2NX1A 1I2RA 2XVKA 2YX0A 4NT0A 4UWMA 1UD5A 1VHNA 4JAWA 4XO6A 1M04A 2QPSA 3VZXA 3RILA 1W3LA 4NAFB 4Q4SA 1VIZA 1TR9A 3KL3A 3LBOA 3N2TA 3ABXA 3RMEA 4AZBA 3M5XA 2PE4A 1LYXA 3APYA 3KZSA 1R9ZA 1SFTA 1XLJA 4PCPA 1EDGA 2RAGA 1GQNA 2IQDA 1XSJA 1IV8A 3LPGA 4ERGA 4B5XA 1F61A 3E0FA 1EA0A 3KP0A 2OLAA 1P6CA 1HG3A 2DEPA 3K4AA 1JEZA 5T91A 4Q8UA 2E9LA 1XRSA 1S2UA 2V38A 1HJVA 4O4WA 4F0RA 1SGJA 2BG5A 3PZUA 3L4YA 1XBYA 2G97A 1YNYA 1JNDA 1K77A 4I3GA 2HBVA 1ZENA 3DHFA 1X6NA 3TVAA 3KE0A 2BBFA 3E0WA 3KFTA 3M6DA 1GOQA 2ON3A 3NO5A 3FXGA 4XD5A 1E1CB 2RFGA 2ZXDA 1JZ2A 1EGZA 1F7BA 1KBJA 3VOIA 4IP5A 1TRDA 7TIMA 1DQWA 1DIKA 1Q13A 4O4VA 1W3TA 1QO5A 1V4YA 4ML4A 3S46A 1VKFA 4B4FA 3GKAA 3HPSA 3XIMA 3P14A 4GC4A 3WF1A 4EIVA 5D02A 1YLVA 1N2VA 3HZ3A 4JD4A 1QNQA 4FIQA 2VGGA 4OJYA 1I8JA 5A5WA 1OK6A 3B8SA 2OT1A 3A13A 3AIWA 3FAXA 3RNDA 1MRAA 3W6MA 3U3HA 1SW7A 4BY3A 1BWLA 4PMVA 5IFPA 2VL4A 2ZX5A 5T9BG 3O6YX 1Q65A 4LCSA 3MPGA 2V2DA 2HEJA 1ZP3A 2NQ9A 2WZMA 4GYKA 4WZHA 2PAJA 2E8ZA 4YTTA 1L9WA 1OC5A 3QSRA 4RXGA 1H60A 2VR4A 2J74A 4LU0A 1UBSA 1OG6A 1HJQA 5FKYA 3FA5A 4P8VA 1GVOA 3FEMA 1QW9A 3GDTA 4M7TA 2FPYA 3L5MA 4GNKB 3W22A 1TV5A 4H6QA 1V02E 3GHUA 2DH2A 4LEFA 3P74A 1IR1A 4HA1A 2YW4A 1KXHA 1AK5A 1QPQA 2QIIA 1GPFA 5KTLA 4O15A 1JD9A 1LL7A 1A5OC 2JK2A 3MUY1 4F66A 1OD0A 3SZ8A 3AIVA 2R91A 4TO8A 3L2IA 4HPXA 1Y0EA 2J4GA 4JTSA 5LSMA 1FWNA 3VMNA 3WK2A 3NDOA 3PWGA 1TVLA 4JIIX 3LGEA 2NQLA 2V3GA 3GVRA 5DY3A 1IT7A 3A6OA 1DKWA 3AJXA 2MNRA 4UCGA 2WMKA 3T40A 1M68A 4WXZA 3W75A 2RGLA 1RAKA 3IJLA 4ZB2A 3U8GA 3W7EA 1ZTVA 2J9ZA 3UWUA 1C9WA 1PZ1A 2QQ6A 2G95A 2Y62A 3EZ4A 3IV3A 4Z1BA 2WNQA 1NWTA 1GYLA 2XN0A 1BWVA 4N4PA 5A6KA 1AH0A 4OZOA 2XG9A 3GBDA 1A5KC 2YLLA 2Y8VA 3MUAA 2QZRA 3LS9A 4TOQA 2VFEA 2V3FA 2QJMA 2YCLB 2XYLA 2I5QA 4A3QA 3TN5A 1CCWB 4QS6A 3NQ6A 4C1KA 2PBGA 3NQ8A 1KM4A 2E1DA 4YVPA 1Y5VA 3W1NA 3CAVA 1TRIA 4KCUA 4UTFA 1A5LC 3WEOA 3F2BA 1XIMA 3EWBX 3NQEA 3UETA 5TBOA 1YBQA 2ZC8A 4CNTA 3TEVA 3W7PA 4I5UA 3UCQA 2O7SA 4A8RA 1Z32X 4TVDA 1I75A 4QCEA 1HKWA 1I2OA 4EKJA 2WCAA 4TVCA 3S4TA 4CD5A 3H53A 2JBMA 4BKNA 3H24A 4NY2A 4UCFA 1ISYA 3LGDA 2OZ3A 1LQ0A 4A8LA 2FDMA 4E6MA 3M47A 2BWGA 3FJ6A 5G1YA 2YYUA 1XLKA 4UIOA 4FNUA 3A12A 3NPUA 1JULA 1C29A 5LXXA 4NQ1A 3WLOA 1T7LA 2IPGA 3VDHA 1S1RA 3RO6A 2NV9A 3H8AA 1VF8A 2QCNA 1CLXA 4H00A 2J7CA 4D6FA 1XJBA 3WQOA 4HB7A 2YA0A 4UR7A 4DJDD 5AYXA 5EMMA 1AH4A 4B2DA 5CC3A 3TR2A 3AUJA 2WMIA 4KBXA 4AAJA 4TV6A 4HTYA