2PDKA

Human aldose reductase mutant l301m complexed with sorbinil.
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
315
structure length
315
Chain Sequence
b'ASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALMSCTSHKDYPFHEEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Merging the binding sites of aldose and aldehyde reductase for detection of inhibitor selectivity-determining features.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 104
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2007-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2pdkA00
2FVLA 3LQLA 4DBSA 1MI3A 3UFYA 3R8HA 4AUBA 1PWLA 1LWIA 4ICCX 3NTYA 4GIEA 2WZMA 3CAQA 4JIHA 2IS7A 4FZIA 2PDNA 3LQGA 3V0SA 4PUUA 4XVDA 2PDJA 4JQ4A 1HW6A 1XGDA 2ISFA 3ONBA 1VBJA 2PDUA 3F7JA 2PDBA 2HE5A 3LUTA 3GHUA 2IQ0A 3BCJA 3COTA 4XZLX 2IPWA 2BGQA 4XZMX 4R9OA 2INZA 2IPGA 4YVVA 2HVOA 3EAUA 4DBWA 3CV6A 4OTKA 3S3GA 4EXAA 3N6QA 4PRRA 3RX2A 4H8NA 3UZZA 2R24A 3CASA 1JEZA 3V0UA 4PMJA 3P2VA 3R7MA 1ZUAX 4IJCA 4XZHA 1AFSA 2PDFA 3O0KA 4YS1A 3M64A 1IHIA 1EXBA 2PFHA 5JH2A 4FALA 2INEA 3MB9A 4WRHA 2P5NA 5M2FX 4XAPA 4GACA 2FZ8A 1SM9A 1AH3A 4XO7A 1K8CA 5HNTA 3U2CA 1YE6A 4JTCA 3LD5A 2HVNA 5LIXX 1AZ1A 4WDXA 2ALRA 4WDUA 1QRQA 1S1PA 1ZSXA 2C91A 3FJNA 1MRQA 4JQ2A 1X96A 2PDIA 5C7HA 4GQ0A 1X98A 2IKJA 3BV7A 3UG8A 3CMFA 1ZGDA 2PDCA 2PDHA 4DZ5A 4PUWA 3H7RA 3GUGA 4G5DA 3CV7A 3VXGA 3N2TA 5HNUA 4QR6A 2F38A 2IPFA 4H7CA 1EKOA 3Q67A 3RX3A 1S2CA 2J8TA 1FRBA 4LB3A 3QKZA 3LZ5A 3LZ3A 1AH4A 4LAZA 2ACSA 4IJRA 2IKGA 4WEVX 1UR3M 2NVDA 4WDWA 4JTAA 4FA3A 3KRBA 3CAVA 1PZ1A 2PDLA 1VP5A 3EB3A 4LBRA 3M0IA 3FX4A 4GABA 1IEIA 1R38A 4JQAA 2PZNA 1GVEA 3LENA 1C9WA 2I17A 1Z89A 1ZQ5A 4RPQA 2PDXA 2PDKA 2FZBA 1Q13A 3Q65A 3LEPA 3BURA 4ZFCA 3UZXA 4YVPA 3ERPA 4QBXA 2QXWA 4JIIX 1RALA 5LIWX 1EL3A 4QX4A 2FZ9A 3D3FA 2PF8A 3WBXA 3M4HA 1OG6A 1AZ2A 3LBOA 1M9HA 2FGBA 1S2AA 1US0A 5DANA 2IQDA 3UZYA 4YVXA 4GA8A 3UYIA 3WBYA 3R43A 1RY0A 4JTRA 5LIKX 2PEVA 5LIYX 1Z3NA 3UWEA 3WCZA 3DN5A 2IKIA 2A79A 2AGTA 3WBWA 1YNQA 3GHTA 3R8GA 1S1RA 3GHSA 3R58A 3MC5A 1X97A 3R6IA 1MZRA 1YE4A 4YU1A 2DUXA 3G1RA 5JH1A 2PD5A 4XO6A 2PDYA 2HE8A 3T42A 5LIUX 4GCAA 4L1XA 4JTDA 3B3DA 1J96A 2HEJA 1T40A 1XJBA 2PD9A 5AZ1A 1PWMA 2CLPA 4QXIA 1HQTA 2DV0A 4I5XA 2PDMA 2DUZA 2BP1A 3G5EA 4XK2A 3H7UA 1PZ0A 3BUVA 4XVEA 2HV5A 4IGSA 3ONCA 4JTQA 4GQGA 2R9RA 1QWKA 1Q5MA 1ADSA 3O3RA 2ACRA 4HMNA 2PDPA 2PDQA 3V36A 5HA7A 3WG6A 2WZTA 1AH0A 3R94A 4F40A 4XZIA 1T41A 2FZDA 4LB4A 1PYFA 1A80A 1LQAA 3C3UA 4JQ3A 3LN3A 2IPJA 1RY8A 4WDTA 2PDGA 2BGSA 4JIRA 4DBUA 1YNPA 4WGHA 2NVCA 4MHBA 3V35A 1Z9AA 3UZWA 4L1WA 4PRTA 3LNMA 4LAUA 1EF3A 4FAMA 3RX4A 4XZNX 3H4GA 2VDGA 3GHRA 2F2KA 5AZ0A 4LBSA 4JQ1A 1XF0A 4Q7BA 3UGRA 4PR4A 4Q3MA 5KETA 2HDJA 2ACUA 1Z8AA 2IKHA 3EB4A 4NKCA 3V0TA 3UP8A 4ASTA 4HBKA 2ACQA 4EXBA 2I16A 3DOPA 2PDWA
chains in the Genus database with same CATH superfamily
1FWDC 4RV3A 4QDMA 1U1JA 2AQVA 4M82A 3QLDA 3U2ZA 5BYWA 2FFCA 4PTWA 5AB3A 1PAMA 4LS1A 3R8HA 5C7VA 1JPHA 1M53A 4ICCX 4XIAA 1HJVA 1G4EA 1EA9C 5HNNA 3GDRA 3UVAA 3NO1A 4AXNA 3EA3A 1QO5A 1C29A 3BGAA 1SGJA 2I7GA 3THCA 3GG0A 2FTWA 4US6A 4CCCA 5CEWA 3HU7A 2B7QA 4HJFA 4Y6GA 1C92A 5D05A 1MUCA 1HL2A 3P14A 1P1MA 2A1YA 1GPWA 1XIEA 1KGWA 1W8GA 1XX1A 3P93A 1Q8JA 1EOKA 5A69A 4JY8A 3QZAA 4KEUA 2WZHA 3CTLA 2FHCA 2VRKA 4ZSTA 3TW9A 1YW1A 1D8CA 3OGSA 2E40A 2PGFA 1JEZA 3V0UA 4PMJA 2OVLA 3E2VA 2X05A 1S46A 2D1ZA 3HG3A 4ZB2A 2F6KA 2Q3OA 3N04A 4FALA 4ZBCA 3T4WA 3TFXA 4S3KA 3KZPA 2OEMA 1RBAA 3TNBA 6TAAA 5DELA 1MDRA 3C3NA 3EOLA 4QFUA 3KL3A 3OBKA 3RCYA 5ABEA 3VNZA 4U3AA 1J4EA 3ZQ9A 4GIAA 4RZ4A 2GSJA 3IGHX 4IQEA 1ME9A 4AD0A 4RCXA 3SM0A 4JQ2A 4L5ZA 1X96A 3I7SA 1C7SA 1O1ZA 3S2CA 4G6CA 4QTGA 1VPQA 2VO5A 3TYAA 4AIUA 1XYFA 2PDHA 2GL5A 4DZ5A 5A8QA 4GZIA 1C3FA 3T1GA 4CN6A 4LRSA 2J62A 2WBKA 4LYPA 3KLKA 1HL8A 1TRDA 4H8VA 3B05A 4TVUA 2YL6A 3VCRA 3W71A 3W27A 1YDOA 3WLTA 1WAUA 2G41A 4NYUA 3FK4A 5J8LA 3NQGA 4GYPC 4FA3A 3QHOA 4HHLA 3CLMA 2NT1A 3ARPA 2ZUWA 4WIWA 2VVNA 4PRWA 4C6EA 2YFNA 2RJGA 4OV9A 3CO8A 3RAOA 5DBUA 4DPPA 1ZPTA 4R7OA 2GJLA 1TWDA 2FH6A 4JIQA 2QIIA 3LEPA 3MT1A 2BX7A 4YVPA 5LGZA 3C0QA 4ZEPA 1NWTA 1UKQA 3STGA 4IG2B 2ZA1A 4M19A 3HJEA 4G2DA 2YA0A 1PBGA 4QLLA 2JALA 1W9VA 2E67A 1KM2A 2OLAA 3APYA 1XICA 3EKGA 4M6QA 5IFPA 1XH1A 3AUOA 2OR2A 2GUBA 1UQZA 1SSDA 2Z6IA 2AL2A 3TSBA 3C2RA 3OEXA 3F4VA 2W0UA 1LZOA 2YCEA 3HG2A 3SUUA 1M7XA 5K4ZA 4O1FA 3AHVA 4Q8PA 3DFPA 4GUJA 3AQUA 3H26A 3TYEA 5M03A 1OFRA 1E0UA 2J7CA 2CETA 2GGGA 3W53A 2WVVA 5HMFA 4RUBA 5EMMA 3H2OA 3UA3A 3KXQA 3O8AA 2XINA 3T81A 1EDTA 2A79A 2FGLA 1I1WA 2YGYA 4X61A 1V4YA 1EBHA 3V75A 3IJDA 1V93A 3BCDA 3GTNA 3R58A 2PI6A 2DSZA 4ORMA 3NQCA 4GPNA 2PTWA 2NQJA 1VIZA 2D3NA 1AJZA 1A4LA 3DGBA 3GS6A 3PUOA 3ZT7A 4Z2HA 1XLFA 2C1IA 3TJIA 3B3DA 3GVRA 1R2RA 5BNKA 1PO9A 2PLCA 4QXIA 5F4SA 3N11A 1IXQA 3LB0A 4JY9A 2I5GA 3QTGA 4EVZA 1T8XA 3L0NA 3QV6A 4S3DA 2QAFA 3A6OA 4AZHA 4XVEA 1J79A 3FGCB 5C0QA 3MDWA 5ABFA 5TD4A 4RV8A 4ZGYA 1P6BA 1VJSA 2F8QA 3LV6A 1H7XA 1QWKA 4GKTA 3AZTA 5AC7A 1XRTA 3VIOA 4J3TA 3T44A 1T7LA 2Y8KA 4M0XA 3WQVA 3CZKA 2X1SA 3K4AA 1H60A 3DZ1A 2YXGA 2VGFA 4X9YA 5GPRA 3A3WA 3NSNA 1C90A 5IDZA 1SYTA 2DW6A 4GMEA 4BFAA 3VFLA 2ZX8A 1TWWA 3RMEA 3W82A 3AXXA 3PBGA 3GNDA 3OO2A 2VDIA 3EB2A 3BCFA 2XJ7A 4F0HA 3ICJA 1TRIA 3AICA 1WZMA 2NQLA 4GE8A 3M0ZA 2Z1BA 2CCRA 3K46A 2EXOA 4JYEA 3KOXA 3VIMA 1J11A 3GFXA 1Z44A 1A4MA 4NJGA 2NSXA 1PIIA 3N14A 3H7VA 4JGDA 4JPGA 5AZ0A 1K9TA 4YYFA 3GIYA 1WDWA 3OJGA 1RJRA 6XIMA 4FIRA 3I6TA 3PN8A 3TWAA 1XIDA 2AOSA 3S9YA 1VFTA 3DOPA 5G1TA 3CO4A 1V0KA 3K8MA 1XYLA 3LQLA 2XSXA 2VRQA 2PP3A 2ZRZA 2C13A 3B9NA 3KHJA 5KEZA 3L65A 1YDNA 3GBDA 3KEHA 4DXKA 3KVLA 1D8WA 3F4CA 3A64A 5C9RA 1TTJA 1Q2RA 1EO7A 4ATLA 3GW3A 3T6CA 5E6ZA 3KWSA 1TR9A 3M0LA 3UR2A 5LHEA 1NDZA 2OX1A 3KRUA 4LOCA 7ENLA 4U31A 2WSKA 1NDYA 4AX6A 4RZ5A 1JGMA 5LA2A 3NPUA 3EWZA 3L4YA 4K6AA 4PUUA 1PB0A 4UIOA 2OGJA 2WPBA 3F7JA 4INFA 4PMXA 5C71A 3MMDA 3WK1A 3WDJA 4G1KA 1NM9A 3CU2A 3W1RA 4PMDA 2BGQA 4E8GA 1P5BA 1FBAA 1FH8A 1WDPA 1YPXA 2V5CA 1WKYA 3WQOA 2J7BA 3L0GA 4FNQA 1SW0A 3A3HA 3LHZA 1VIWA 3P61A 4FI4A 4AD3A 3FNDA 3P2VA 3MUXA 3BLOA 4YS1A 2HBVA 5A6BA 4Q8UA 4WSKA 2DIEA 1FCUA 4N6EA 2P5NA 3WNOA 2ZRYA 3TAKA 4JAWA 4D6IA 3BK0A 2H9AA 2QGYA 3EXSA 4WY0A 1QBBA 2O4MA 2V63A 2C1HA 4CNSA 3OBAA 3CHFA 5HNTA 5HJYA 2VC6A 5TAOA 3PBWA 2QDGA 4O17A 1VF8A 1V3IA 3BVJA 2HJPA 1ISXA 2X42A 4B5VA 3BZGA 2W9MA 5CBIA 1BWLA 3CMFA 1E1CA 3PB2A 1KRMA 4X2RA 4LSBA 1WBHA 4HA3A 1H5VA 4CNPA 4H8HA 2ICSA 3Q67A 5AHEA 2X1IA 1XC4A 1XLKA 4ZENA 1GVSA 4KWOA 1UMYA 3VKAA 5HMSA 2LLEA 4NL1A 2Z2BA 2ACSA 2WSPA 2A6NA 4MWAB 3DX5A 2YBVA 1ZBKA 3GXPA 3NQBA 4DJEC 4RZBA 1N8FA 2YLLA 3NQAA 3B9DA 3ZWTA 2NLIA 1AL7A 1B3YA 3CAVA 4PMNA 3S6OA 4FR6A 5BOOA 1KBKA 1CGVA 4HU0A 2YCLA 4MM1A 3UG5A 1OADA 3VDBA 3WENA 1GVEA 5DY3A 4NAFA 3JUGA 3PULA 5G2HA 4GO8A 2HNEA 2JF6A 4G7FA 2PDKA 2E09A 1XXXA 2ZRXA 4ECLA 2AKZA 1Q13A 4H00A 3ZLGA 4YN5A 4TMCA 3E0WA 2JKEA 4Z17A 4AC1X 1TTPA 2RAGA 2V5LA 3OZYA 3DGRA 3MHFA 4Y9NA 2FLIA 3VGFA 3KS5A 1BD0A 5A94A 2C19A 1EL3A 2FB3A 4DJED 3WBXA 4ADSA 4L61A 1G1YA 3CWOX 3BDKA 3QY7A 3CHVA 4L6HA 4UTWC 1E56A 2YL5A 1PXGA 1T0OA 3IGUA 4MUPA 4E2VA 4BZYA 1GT8A 1G67A 5BMXA 3FS2A 1VJZA 5LIYX 4WJXA 4IH3A 2IKIA 1KBIA 3EOOA 1MFVA 3NYDA 1WPCA 1IYXA 1T5AA 4OFCA 3IV8A 3LTPA 3DU0A 1WDSA 2P53A 1X97A 2WNQA 4QJ1A 4GG9A 3WQ8A 4JEJA 2OZTA 2FKPA 4YU1A 4C6LA 1K4GA 3G1RA 2C7FA 1XPYA 4A35A 3ID7A 5DN1A 1VFSA 4PE8A 2WQDA 3HV8A 3PWIA 2DT3A 2D22A 3S2JA 3SGZA 5LIUX 3VVGA 3Q45A 3HJZA 1UWRA 4UNIA 2HK0A 1VFOA 3TTSA 4KCWA 4TIMA 2CWNA 1Y8BA 3DHDA 1OFOA 3LHTA 3MSDA 1NELA 2GK1B 4C5YA 2WMHA 1OCBA 4HVXA 3UXKA 2XSAA 3PAOA 1PZ0A 5LA0A 3PUDA 4I8DA 3SUWA 5AFDA 3W7IA 1K7EA 2BHUA 3OA5A 1B3XA 1O5XA 3TC7A 3HGOA 1JUKA 1UC4A 1ZP3A 4FNPA 3QY8A 2RGLA 1BSIA 3H2FA 4XD3A 3WLIA 3NQVA 4L6DA 1EA0A 4BCEA 4WSHA 1ICPA 1XIJA 3KS6A 4L4LA 1MUMA 1W1B1 3GYEA 3WJWA 3AHTA 1GYNA 3OW1A 1TPVA 4PMQA 1FDYA 4CQBA 5I24A 5A8MA 2WC7A 4O1BA 4FPSA 2VP8A 9CGTA 4XAGA 1RBOB 2ZXQA 3NL3A 4BEUA 3S83A 4MZYA 1G4PA 3QC3A 4XBKA 4LY8A 1CB7B 1ZFJA 1F74A 1EF3A 1GOQA 2MUCA 3VUSA 1D3HA 2GGIA 1UBSA 3ARXA 1EPVA 3AZRA 2R6OA 3EKLA 4GCXA 3QGAC 4UQEA 4EE9A 5E09A 3LI0A 3PUEA 1A50A 3RLHA 2IKHA 4L9YA 1XWYA 2F6UA 3ALFA 2J66A 3T07A 4CQCA 5K9DA 4FLSA 3BAKA 5FJUA 1UZ4A 4XKYB 4UUIA 2VDHA 1AQ0A 4H6RA 3KBJA 2QS8A 4QJ4B 1J6PA 2ANUA 3H12A 3MKCA 3ITTA 1JQXA 1DHPA 1LOSA 4PTXA 2EF9A 3CK5A 1LL4A 3PG8A 5T26A 5AC4A 2ZUSA 1IT8A 2FVKA 5BROA 4DLMA 3FYPA 4AMAA 1FWBC 3ONBA 4IFKA 1AMKA 1LORA 2IPWA 4GLEA 4HZ6A 3NQ8A 3F2DA 1HF6A 4XZMX 1AD4A 3EX2A 4JX4A 3G6LA 4ZOAA 3OLEA 1KKOA 4KMQA 3EOEA 4ZOCA 3RLVA 4DBWA 3WDQA 3CHDA 4HNNA 3QPEA 1HVQA 1TE6A 1L9WA 1QI3A 2H90A 3WMCA 1VLWA 1OC6A 1ZJAA 3VE9A 1EJSC 1X7IA 2DIJA 4LANA 2NX3A 4XZBA 1EC8A 2PDFA 5LNVA 3O2LA 5D30A 2TODA 1UOZA 4I9JA 4R27A 3URAA 3BLEA 2HXTA 5D8ZA 1I2RA 4D2JA 1X6NA 4W7UA 1PS9A 1E0VA 1FHDA 2X09A 3NOEA 5F4WA 3W9ZA 4MFEA 1AH3A 3MWAA 2BLEA 1QASA 1LWHA 2XFFA 2YL8A 4AU0A 2QV4A 1XFBA 4Q4KA 4HNLA 4H8UA 4K1WA 3VO0A 1W9XA 3EX4A 3W6YA 2E25A 4KCUA 1W9DM 1QW7A 1MNZA 2W91A 3CQJA 4IPJA 4XD6A 4RE2A 3SIZA 3ZR6A 1V79A 4B5UA 3AXKA 3N2TA 1B90A 4JFTA 4I9AA 4MAZA 1QK0A 1UD2A 2IPFA 4NJHA 4HIBA 3FSTA 1TMHA 3AYRA 3HG5A 4HHHA 4AWUA 1FH9A 3UCQA 2VEMA 5J04A 1GHSA 1MQQA 5I07A 4P8VA 4PMOA 3VGGA 1OX4B 3BGGA 3L4UA 4LFYA 3R11A 2PZ0A 2WYSA 3CEPA 3WYZA 2E9BA 4CD6A 3NVDA 1KCXA 3SADA 3NXFA 3G3DA 3GTFA 4GC4A 3SDOA 1W3KA 1ODUA 3RGTA 3WX7A 1SVDA 3JR2A 1R85A 2PDXA 1LJYA 4NZJA 3LPGA 1B2YA 4UR7A 2VTFA 1WKDA 1S2TA 2ATSA 4ZFCA 3M9YA 3ZOAA 2Y24A 1SFLA 1HFBA 4BWLA 3VA8A 3BSGA 3VM5A 5A6LA 1P0EA 3DI0A 4JX6A 2ZZ7A 2ZC8A 4KPLA 3D3FA 2GWGA 3RM9A 3NAVA 3G8RA 3GG7A 2ISSA 4R88A 4GY0A 3V1PA 4W89A 4Y90A 3W85A 1W5QA 2GQ9A 4DF2A 1UD6A 1JPIA 4GVFA 3H23A 1F3XA 1JL8A 2OX4A 4L80A 4UOQA 4HKPA 1QHPA 1AUSL 4IMFA 3Q2DA 1OT2A 3VM7A 1LG2A 3VD4A 1S5TA 2FHBA 2QUUA 2QJJA 3MO7A 2INFA 2HNHA 2JQXA 1ZLPA 1R6WA 3GIPA 1HN1A 2MANA 3PG9A 1SO6A 2YOCA 5T9BG 4S3JA 4EANA 1AJ0A 2VWTA 3CHEA 1W5NA 5BOEA 1CLKA 4HK5A 3S4TA 3W2KA 1T6MA 2YBUA 3NZ1A 1LYXA 4BEQA 2WCAA 1E4IA 3TJLA 1XC6A 1J01A 4NASA 1VZWA 2C15A 1WAWA 4MWAE 3UXIA 3FJLA 3SY8A 4N9DA 1H41A 1LLWA 4HCLA 2J77A 4IGSA 3R0UA 3V4BA 4GXPA 2I57A 4WHBA 3EX6A 2R9RA 2ZZ6A 3UWZA 2ISVA 2ZZ4A 1OZMA 3D47A 1EJVC 4A3QA 1EGMA 4MPQA 3D0CA 4GUHA 4QM1A 2CZ5A 3V36A 3WG6A 4YTQA 2YSWA 3KM8A 4MB3A 3LA4A 3BAWA 2YDRA 4AZ6A 3EMZA 1AODA 1TPB1 3RU8X 4WR3A 1PZ2A 2DSWA 1YQ2A 3VNMA 2X1RA 1TVPA 2ONEA 3U5YA 4X22A 4XB3A 2ZQ0A 1DEDA 1JG9A 4TX6A 3E5BA 3PANA 4FLQA 2G3NA 4JQ3A 2BOFX 4WDTA 4JIRA 5G1YA 3W2NA 2V0TA 4WGHA 1HL9A 2J6VA 4MNJA 1FWFC 1R8LA 3BW2A 2CLFA 3ZO9A 2UY3A 4GZEA 3LM7A 4CU6A 4DY1A 4F9JA 5GNXA 2HTMA 3AIUA 4Q32A 3H4GA 1VFMA 1KRCC 1ISZA 4JKMA 2O56A 2E5BA 1Q7QA 3K8KA 2WQPA 3RITA 3PB0A 4IL0A 4DZIA 2GGEA 3HMCA 1O5KA 3AI0A 3KP1A 4D8LA 3AO0A 1XCXA 4UFJA 3G1AA 1FWWA 2BOEX 1QJWA 3N9SA 4JNYA 2PCEA 3G1HA 3UWYA 3UPMA 1KB3A 1LT8A 1W1VA 3XISA 3C6CA 3H53A 3QFEA 4MWAC 3G1VA 1UD3A 3IS4A 3MJMA 3BLPX 1OCNA 3L66A 1LWIA 2C0HA 4ZXLA 4W4QA 1XINA 4GFSA 3CH9A 1PX3A 4A3RA 1TQXA 3HQ1A 4JIHA 1J2BA 4CNTA 1WOAA 4FNTA 3OZPA 1LDCA 2BY3A 4LVDA 4Q22A 4KEZA 3RJXA 4J3SA 1W32A 5JBFA 1HIZA 3SAZA 3VI2A 3W4RA 3LTYA 1XV8A 4NUWA 3PVFA 4I5UA 3BH4A 4D6FA 5CSYA 4O1EA 2HE5A 3DBPA 3E2RA 1VHCA 3W3OA 5DMYA 1KD0A 4MJZA 4TXEA 4MWAD 1MXGA 1Q8AA 3DBNA 1RH9A 1DQUA 3CXOA 1EXPA 2ZVIA 1ELSA 2WMKA 2G97A 4YWIA 4E4PA 2WV8A 3UZZA 2R24A 1TZ7A 4AD4A 1W17A 3IUHA 1FXPA 1VD6A 2OLSA 3GM8A 3GXTA 3B8VA 1PDZA 3M64A 4WXZA 1EXBA 1Z41A 1YDYA 4CD7A 3M6YA 4QQUA 5D8WA 4HTYA 3L5AA 3IJ8A 4CLMA 3WIJA 1RJPA 4YCOA 1V0LA 1UR1A 1PKLA 1GYLA 3KOFA 1E6RA 2D23A 1F7BA 1BSLA 1HX0A 3Q37A 3OYZA 3CEUA 1R46A 3V5FA 4Y8FA 3FJNA 4PB3A 1XQLA 4IZGA 3FSUA 4XIMA 4J27A 1K77A 1OC5A 1LBMA 4JDBA 1MNSA 1BYBA 1OD8A 3LXAA 3W7GA 3W7PA 3UJEA 1L6FA 3H22A 1FWRA 1YPFA 1R3VA 3UGVA 2WW5A 3M5ZA 2F38A 4NVTA 3KTCA 3ECQA 2J8TA 1FRBA 2E3ZA 5E1QA 3FVDA 4LS2A 1K9FA 2C0AA 4UQDA 4J3WA 1XDMA 1AH4A 3O63A 4L64A 1MW1A 3NQMA 1UR3M 1IZCA 4ADUA 2J13A 2NWRA 2ZX5A 4B5TA 4O10A 1TVLA 3ITCA 3PM6A 2PGWA 4RPPA 2VEGA 4NJIA 2O9PA 4L65A 3FX4A 1NOUA 1XFCA 3CQIA 3NIYA 3W74A 2Q01A 5BWFA 2B81A 3WLKX 3VGEA 3SW6A 5J5DA 5BOFA 2WAGA 4OQVA 7REQB 5I00A 2VZSA 1G6CA 1WA3A 4XBJA 1ML1A 1GW9A 3O07A 3ERPA 3EA1A 4O8AA 3N9RA 1RLDA 1HT6A 4AVNA 4LALA 2VEPA 4AD1A 1ZHAA 2D2OA 1H2JA 2QVHA 3ELFA 3TXVA 2YCIX 1PKMA 4ZQPA 3MUIA 1S2AA 1BVZA 1ME8A 2PU1A 3W24A 1O6IA 3EWDA 1DJWA 4JTRA 3UWUA 3HGRA 2YXXA 2BVDA 3AMGA 3DN5A 4I9TA 1FCBA 3LY0A 3CUJA 4TU1A 2WM1A 1BVWA 1I4NA 2I9UA 4RNFA 4LH8A 2IW0A 1DJIA 4NXSA 5I78A 4B3KA 2BY0A 3ANYA 5JH1A 2VX7A 2I9EA 2CXEA 3RM8A 5HOSA 4AZCB 1OBAA 1XKYA 2E77A 5CC6A 2OMAA 4D6DA 1CTNA 1RUSA 3DENA 3SN0A 4JTDA 5BXPA 5FF7A 5DFAA 1M7OA 2QJMA 3TYBA 3R4IA 1LUCB 3K4WA 4JTHA 5GNZA 1EDGA 1CXLA 5EA9A 2XM2A 3GLCA 4J9JA 1G9HA 3JZEA 3S5OA 5LXXA 4LNCA 3C0JA 4WQ6A 3F5JA 2FZNA 3N2BA 3TLLA 2GVJA 3BMWA 3W75A 2JIEA 2WM0A 3NO3A 9XIAA 3OYXA 5C54A 3WMSA 3UXAA 2ZKMX 5GJMA 2Z24A 3W7NA 1GZJA 2VGGA 1V08A 3BSHA 1KBLA 3MY9A 1ISVA 4KWUA 3OB8A 4UQ9A 3RCMA 3M46A 3PPHA 1SZNA 5JIWA 4H6EA 3ARZA 5LYRA 4JBRA 3R89A 2CHOA 3VKCA 5D03A 1XQKA 4N9CA 1VJIA 4MNMA 3RPMA 4E3TA 4NZ4A 3AYTA 1M5WA 3GRIA 5A5WA 1EIXA 4MYXA 3GVGA 4BF7A 4Z2LA 1IV8A 4LU0A 3DERA 3V18A 3UG4A 2Z7KA 3DYMA 1N7KA 4KW2A 4MSSA 1JFHA 3VZXA 2PWHA 1OINA 4CCDA 3KBVA 1TKKA 4JQ1A 3TU9A 1ECEA 1GVQA 3BOFA 1P48A 4QAWA 3W87A 5E0KA 3LGDA 1RXOB 3CAKA 1XS2A 3AWOA 1BRLB 4CVUA 4IPIA 2D0FA 3PBYA 3W1PA 4JHMA 3HPZA 5DMNA 2XFRA 5F2IA 4MG4A 1H1ZA 4V15A 1QBAA 5JQ9A 3B9EA 4LAKA 1RAKA 4X3ZA 2J47A 3RJYA 4UZUA 3HURA 1K8XA 4GY7A 5AOUA 3WQDA 2REQA 5K4XA 3W07A 4L4PA 2ZBTA 5F1UA 2PE4A 3G6MA 1MVYA 1MXSA 4A3UA 1W1PA 4QE1A 3RCNA 1VPXA 4AX7A 2DT2A 3VC6A 2J27A 4HNUA 4M80A 3G1SA 2YZRA 3TMQA 4ZO8A 1LL6A 2POZA 3PJUA 4OZOA 2Z00A 4GI9A 4RW3A 2XIJA 4MNKA 3BCJA 1PJ9A 3TQKA 4AEEA 3TTOA 3N25A 4O54A 3OG3A 1P0KA 4OKDA 3TJXA 2F9RA 4D8AA 3GVQA 2DJLA 2DSUA 4GNKB 2CBVA 4JFWA 3P0XA 4GC3A 5FESA 2DSKA 3VDAA 1OIMA 3GFZA 1VPYA 3PF3A 2PWDA 3EGJA 3QHNA 1B3WA 4F2UA 1Q85A 2O7SA 3H70A 1RA5A 5KITA 5LXEA 3SQMA 4WJEA 1NAL1 2XVNA 2XYLA 1A0EA 1A5LC 2V67A 1DL3A 4GACA 5J5RA 1BGAA 3TW6A 3BAYA 2OOGA 4IISA 4IMCA 4ACZA 2WVTA 2EPKX 3TCSA 4Z1BA 1FKXA 1OY0A 4LBUA 5CLWA 3NQ2A 1XPGA 3RF9A 1YKWA 5LNSA 4HMCA 1IZJA 3WF0A 1YE6A 3TV8A 1TZ9A 3AHXA 4IJBA 3WLQA 1UQYA 2E8YA 3P80A 3UJ2A 1S1PA 1EQPA 5HR7A 4FF7A 4J2MA 4QG9A 3ZIZA 2V38A 1KGUA 1QK2A 3P67A 4S2CA 1BYCA 2V68A 4G56A 2IKJA 1R9YA 1AG1O 2QR6A 3UR5A 1ZGDA 1UWQA 4NZ5A 4Q8QA 3W84A 4O16A 1GWJA 4Z1CA 3GDLA 4NX0A 1CDGA 1CBGA 5CGTA 2WK2A 2J7EA 3ES8A 2G4JA 3W81A 2OQYA 3MZ2A 2HPIA 3M5YA 2BG5A 4ZXOA 1AJ2A 1F3WA 2FYMA 5HUPA 2E9MA 1IR1A 5D02A 4PUKA 1ZZMA 1FHUA 2GJRA 5I3FA 2VUYA 4HK7A 3MYOA 3IIXA 1VP5A 4Q4PA 1BKSA 2RDWA 3TJ4A 3FKKA 3SRKA 4Q6JA 3CWNA 1C9WA 1S38A 2J24A 2ZYFA 2QDDA 1PX4A 1LOLA 1TX0A 1E0XA 4TVCA 5FL0A 2FZBA 3T0DA 1FTXA 3Q65A 1VFFA 1SJAA 4LUTA 3L68A 2Q8ZA 2YFOA 1FWHC 4V1YA 3UD6A 3O05A 4QJ5B 4BI5A 1N55A 4F2BA 4QX4A 3L4WA 2A3BA 4ZOBA 1OGGA 1S39A 2BDQA 3TN6A 1VLIA 1X39A 1M9HA 4DBDA 3A24A 2GQAA 5FI8A 1G7VA 2R82A 3JW7A 4QEEA 2ZZ1A 1Z69A 3BL3A 3KFTA 1F4HA 5AHLA 3C86A 4PUMA 3PZGA 3UWEA 4W9TA 3WCZA 5MF5A 3E02A 3P60A 5K7JA 2YJQA 1E9LA 2VCAA 2PLJA 2KAUC 3FW6A 1DJQA 1Q6FA 2A7PA 4LYRA 4HPGA 3KRZA 4U33A 5D04C 3WQFA 4B3LA 2ZUVA 2AL2B 1PKNA 2GDQA 2QUMA 4HN8A 2PD5A 1JPMA 3LMYA 4K3ZA 3MCNA 2R14A 4C7DA 2PDYA 3A47A 2PRHA 4F0MA 1FWCC 2O92A 3W00A 5IHSA 2EO7A 5D32A 1YLVA 1DWHM 1P0BA 2XIMA 4K68A 2GVGA 4Z1DA 3NGFA 5C9UA 5CPTA 1YRRA 1J18A 1DORA 4MUZA 3SI9A 5ECUA 2P50A 3CL6A 3TX9A 3IK2A 4HZ7A 1EO5A 3DESA 5CSRA 2FDSA 3QKEA 2Y5JA 2A7NA 4HCDA 3GU2A 1GQJA 2HV5A 4S3FA 1TE1A 3AMLA 3MQTA 2Z1WA 1DWIM 5CPOA 4PL2A 3GG8A 3BG5A 3O1NA 2GUYA 4YWSA 4NNBA 1UWTA 3LOTA 2XPKA 3R25A 4LF2A 1AA1B 2QCEA 1LQ0A 2DZUA 2B4GA 1OHLA 1KM6A 1ONXA 3WQEA 3MDUA 1UPPA 3JS3A 2GOUA 4UTHA 1Q63A 4TX9A 4OIFA 3PPFA 3LHUA 1TV5A 2DVXA 1PYFA 5AHNA 4ML9A 2E6DA 3C3UA 3T2QA 3T2PA 4KRTA 2WO5A 4YJ5A 2DY3A 2PDGA 3U7BA 1AMYA 3IJLA 2QZRA 3QTPA 4I6KA 4F79A 3HFYA 1U2YA 4TR9A 3E2QA 4A8IA 5BXTA 3KL5A 4PCSA 3L23A 1F4AA 2XVKA 5A8PA 1E9ZB 1JAKA 3NL6A 4OBRA 6PTDA 4CEXC 4ERIA 3QV8A 4OE7A 3SUVA 3MSGA 5IRPA 4MADA 2WSQA 1KM5A 1W2VA 1V5XA 3GNPA 3GVWA 4HB7A 2CLMA 3WH8A 1NU5A 3DHUA 3SQLA 3REQA 4ASTA 3P5ZA 4GIYA 4HOXA 2WKJA 5FF3A 3RR4A 1XYBA 4WZHA 3BC9A 4IQJA 3VOFA 4DBSA 2WMIA 2YLAA 5H6HA 3R0KA 4DJEA 2QJIA 1E6NA 3UCCA 3UFYA 4AUBA 3WN6A 1OCQA 4FMVA 3GZ3A 2QJGA 2YYTA 3DECA 4GD0A 3H2AA 2VI0A 4GK8A 3BE7A 2QUNA 3NL2A 1ONEA 3LXCA 1SR9A 5E9XA 3LPOA 2WHMA 1VAHA 3II1A 4CGTA 2G95A 4B92A 3GXNA 3SY5A 1SO5A 1IGSA 3TTQA 4AVFA 3HGSA 3BQ5A 1XGDA 1EX1A 4AWEA 2ISFA 4JDYA 4POCA 1GG0A 3PY2A 2XVPA 2CPUA 2IQ0A 4Q4OA 3GNOA 1V8EA 2EQDA 1CNVA 1KQYA 7PTDA 4ML4A 4GI4A 3ARQA 4IMAA 4C6JA 4DB7A 4E5TA 5XIAA 1MSSA 2WLYA 4W5UA 5G5IA 2Y5SA 4LT9A 3VNYA 3R5EA 1I45A 3I68A 2R1KA 4H8NA 2XSBA 1U22A 4L6OA 1TYGA 1RCQA 1DOSA 4FF5A 4BJHA 2EGZA 3AISA 3MV01 3BG3A 5CZJA 1GQLA 4NT0A 2EKCA 1AFSA 3SIMA 2WPGA 3WJZA 4ICMA 3LDVA 5KSWA 4XG1A 3VIFA 4ZR8A 1JCJA 3UXLA 1XIFA 1TUFA 3TMLA 1UZ1A 2ZFAA 1OB0A 1TSIA 3AS3A 2JFEX 1J0ZA 1HJSA 1JDEA 2XGBA 2V82A 5JBEA 3W2UA 5FF0A 5E93A 2VX6A 2QCMA 2V2DA 4JTSA 4H9XA 4GNJA 3N34A 3ABSA 5FJJA 1UH3A 2A3HA 1XW8A 4M7SA 4ROQA 5A8GA 3U2CA 8A3HA 3DFNA 1JCMP 4M6VA 1DJNA 4JTEA 3E12A 4Q33A 3UJSA 1F07A 1EHNA 2QJNA 1OG0A 1YXYA 5C7HA 1NARA 2QCDA 2V2HA 1MMFA 1QO2A 4KT2A 2ZA3A 4JTIA 4AIEA 1ZJHA 1PCKA 1R86A 1JQVA 1XLDA 2H9AB 2YCKX 5JVLA 2Z27A 4WY0B 4C6IA 3EPNA 1Z42A 2EPLX 1DP0A 1VHNA 5G4WA 2BTMA 1HTIA 4LB3A 1AW1A 3QKZA 2QYGA 3PFMA 4M6UA 3LZ3A 3KOZA 2W61A 3W7OA 1IIHA 1OF6A 4WEVX 5DXYA 2NV9A 1OFAA 1N82A 1A0DA 4M6PA 4KS0A 3WD4A 2B7NA 1PUDA 1EUNA 3GBEA 1UPMB 2OT0A 1MFUA 3G18A 2QPUA 3QGKC 4JTLA 4JOMA 3W70A 1XSKA 4H83A 1AQMA 2J7HA 2OWWA 3U7VA 2DQWA 1H1NA 3GSMA 3O06A 1SMAA 1EPXA 1TIMA 1V3KA 2JIWA 1WZLA 4QAIA 3WQGA 3FDKA 1L2QA 4KRUA 4AD2A 2G8ZA 4IIEA 3WUGA 1GZ1A 1MZHA 1W1TA 2A7RA 4W84A 2D69A 5EL1A 4LCQA 1CGWA 2X16A 3KTSA 4NAFB 4QGCA 4DAIA 1EJ7L 5HXMA 2VM8A 4YMZA 3UJRA 1QDSA 4K38A 3KBSA 3ITVA 4UC5A 1LRNA 3XINA 5F2LA 4GA8A 1GCYA 3F4NA 4C65A 5CPMA 5CC7A 2GSHA 3ARRA 3W7EA 4R9XA 3GNRA 2HK1A 3PBVA 1NP0A 1NH6A 1WX0A 3ABRA 4J40A 5AHFA 1K02A 4TO8A 3UJFA 3TA6A 3SCPA 5KTLA 1AQFA 4WOZA 1K70A 3DDMA 1MZRA 4ZB0A 3GU1A 4AHOA 3FJ6A 3H8AA 2HVMA 4A3YA 5LNRA 4WUIA 1ZAHA 4PUJA 4M1BA 1GQKA 2VKZG 1XM3A 3VZYA 1O95A 4JN8A 1WNOA 3DHPA 5H8UA 1EWDA 3RDKA 4UXDA 1RK5A 4RE4A 5G2IA 5HAOA 4AIOA 4IG2A 1W0MA 4UCFA 5G1MA 3G1FA 5HJXA 3ONCA 4LV4A 4GQGA 2PGEA 4IIGA 4A2RA 2NT0A 1ZBVA 1TJ0A 1BYAA 3LPPA 5REQB 3DFQA 3O9NA 2B31A 4PB5A 3TAOA 3V1HA 3KBMA 2J9ZA 2VFFA 5C5YA 4EPEC 3B9OA 2OYMA 2ZADA 4W85A 2DVUA 1QOPA 4KEMA 4MB4A 5C6MA 3GDBA 4YCPA 2NX1A 1U83A 1EP1A 2NUXA 2PWGA 2VFGA 2Y7GA 3MP3A 4MKSA 1PTAA 5CLTA 4LB4A 4DXXA 4DWSC 3MVTA 1A80A 3NCOA 2FB2A 2ZDSA 2BGNE 2CITA 3LCFA 1CENA 1H0GA 1HKVA 2Y7DA 4M56A 3U48A 4DNHA 4WF7A 1Z9AA 4L56A 1O5QA 1AD1A 2V9DA 3LNMA 1LM1A 1N2VA 3NEHA 1XSIA 3KCLA 1ZRQA 3QGVA 4OBSA 5IHRA 1VYSX 4D6CA 3CPUA 4CNUA 2F61A 4OOZA 4PEKA 3UWQA 4PB4A 1W2PA 2B0MA 1E4LA 4R85A 1KFKA 3OZOA 3OQEA 1Z8AA 3GDKA 2GVEA 3FGCA 2CU0A 4DWSD 3LCXA 3RHGA 1IEWA 1MYRA 1ZJBA 3SZ8A 1JZ7A 3CAWA 3EPOA 1S5NA 1I1XA 4FLOA 1XIBA 3MYPA 3THUA 3BPWA 2ZUNA 4I7VA 3MPGA 4A6GA 4FOUA 4JD4A 2V69A 2X8RA 3RIKA 3GH4A 3PS7A 1E71M 1OGSA 3B8TA 6XIAA 5BZAA 2WVSA 3PZUA 1GONA 4P7OA 1PDYA 1M68A 5ABTA 3OOQA 5KZEA 2QF8A 3BLKA 3IIVA 2A3CA 3W7MA 1IT7A 3ABOA 3V0SA 2VX4A 3TW7A 2WJZA 2PDJA 5C2GA 2HCVA 3CPRA 4NJJA 5HK4A 4S3BA 1XD0A 3GHUA 4S3CA 5KMYA 1E6SM 3COTA 1QPNA 1BQCA 1JVNA 4R33A 3OG2A 1YBQA 1UJQA 3MSYA 1TQJA 3GC4A 4JTGA 3BLDA 3TSDA 1L6WA 2QCCA 2IPGA 1BF2A 4C6NA 2DU2A 1MEHA 4PC8A 2GJPA 3TCEA 1SJBA 4OTKA 5H1WA 4GKLA 4PRRA 1G5AA 3HQPA 1UG6A 1QNVA 5I79A 4GHRA 3RLUA 2AQOA 2DPEA 4IJCA 1B3ZA 3GXMA 4IFKB 2HBXA 1BXBA 4JFVA 5M2FX 3G8EA 5HULA 3LMZA 4F0RA 5D9PA 4M7TA 2L5HA 3NYZA 1KC7A 1TREA 3EYPA 4UFMA 3T7VA 3LYEA 1XISA 1EBGA 3S47A 2BHZA 4XO7A 4C6KA 1CZ1A 1UD5A 3SGUA 2CBJA 2DEPA 3N19B 4CNOA 3LD5A 2BVTA 3TQ0A 2X1UA 1RZMA 3PTKA 1W3JA 4DRSA 3B8IA 4M5PA 4KIRA 2VWSA 4NAEA 3N4EA 1SPQA 1X98A 3O16A 1DIOA 5GQBA 4PTVA 2PDCA 4J3UA 4NHVA 4KKXA 2TPSA 3HZ3A 1ITUA 5EYWA 2PTZA 1KR0A 3I4EA 3W2JA 2UY5A 3GAYA 3W1MA 1Y65A 1QATA 4WGXA 2UWFA 5CKSA 3TA9A 2AMGA 1HJXA 3N12A 5D38A 2NVDA 4WDWA 4JTAA 2J6XA 1W54A 1JRBA 1E4NA 3LHVA 2ZE3A 1QW9A 4RR4A 3QHMA 1R5YA 1WDRA 2PLKA 3BMVA 2WZEA 4O12A 3W37A 4M29A 4IHCA 3ZMRA 2IMRA 4V33A 5HWMA 3A13A 3KE0A 3LERA 1R3QA 2XFWA 1ZCCA 3BW3A 3B4YA 3VDCA 3IV3A 1ZQ5A 2P8BA 2Q8XA 3AWNA 2CLOA 1C93A 3E9AA 3I7RA 1O7AA 4Q4RA 4JR5A 3WQ4A 3VGHA 3FA3A 2V2CA 2OQLA 1J9YA 6ALDA 3AOFA 4IUGA 3ZSTA 4DM1A 3AIQA 3BARA 4PULA 5BW6A 1DTUA 1HKWA 4O53A 5D4YA 2FZ9A 4IGMA 1W5MA 3M4HA 4U5IA 3NM3A 2ABBA 1EJRC 3N3TA 5M1TA 1KQZA 4IXXA 2HPMA 3THQA 5HANA 3WH5A 1WXYA 1QXLA 4Z2JA 4YYCA 3MANA 4IFOA 2EHHA 3L4TA 3H55A 1GHRA 3VCNA 1PX8A 2DFAA 1Z3NA 3CIWA 3H2NA 1OFPA 1SW7A 1M65A 3CZGA 1Y7VA 3WNKA 4MWAA 1X1OA 3FXYA 1V6TA 2BB0A 2W62A 2D24A 1NOWA 2PMQA 4RNIA 1EEXA 5C55A 3BOXA 4ZCWA 2V8ZA 2OTDA 1W3IA 4UBPC 3BXWA 4UQBA 3VMPA 2DUXA 1ODZA 2P1FA 4O0KA 2I56A 3LCGA 3TLQA 4MDPA 1GUVA 2XH4A 1ZP4A 1CXEA 4FS9A 1W5OA 3IAQA 3BICA 1KA9F 4DUVA 4QNWA 1WDQA 1R9ZA 4H9VA 5A95A 1ZY9A 3WFLA 4B5NA 2VEKA 3CBWA 1NFPA 4YTRA 2R1PA 2X0HA 4V27A 1IXPA 1FWSA 4HN4A 2E5CA 4W7WA 5FJIA 3G1YA 2UY4A 2GDUA 2OKOA 1ZS2A 1JNDA 4O15A 3L2MA 4IF2A 1PL9A 4Z2IA 4CN4A 3EOUA 4GINA 2BY1A 1Q6RA 1PZ3A 4IX2A 4PGLA 1OZQA 3IPWA 1X38A 3UERA 3CV1A 4F40A 5FEPA 1WQ5A 3BAIA 4XZIA 4N4PA 4C60A 3K8LA 1OFQA 3KP0A 1JD7A 4I9MA 1Q4WA 1XUUA 3HF3A 3UETA 1A49A 1KXTA 1R3TA 1W3LA 1GJPA 1WE5A 3M6DA 2V5JA 4WD0A 2CLLA 4NIRA 5LHFA 3STPA 1UWUA 3USZA 3NZPA 2DZXA 1RD5A 1CXFA 2VC9A 3M44A 5XIMA 1PIGA 6CGTA 2WBGA 4GQRA 2YCJA 2QCHA 2GK1A 4JIPA 3TONA 2QIWA 4ZODA 3MI3A 4XSMA 1OYAA 4NKCA 1CX9A 4LJ3A 3PAJA 4ZO9A 4US5D 1UR2A 4HBKA 4HZMA 4GVGA 3I10A 5I03A 4X0VA 4X63A 3QZ6A 2CWXA 3PNUA 3PTMA 3K5XA 4A2SA 5HMDA 4RZ6A 3LGEA 2ZTKA 4KWVA 3ZT6A 3VKDA 3TEVA 3TSMA 2QMKA 3GTIA 5D2XA 4EX4A 2XZ9A 1F76A 4IICA 2JEQA 2FZMA 4EP8C 1H11A 5RUBA 4CNNA 4I5RA 2CEQA 4IP7A 4ZTXA 4UQCA 3W7KA 4PZVA 4P7QA 3GXDA 4Z1AA 3LGGA 3RU6A 2PDUA 1LL7A 3DFYA 4E4FA 4ES4A 4HOWA 2EBNA 1A5CA 1NWRA 4XZLX 4LWWA 2TSYA 5D2WA 3M16A 4GNVA 3WQ5A 3W1XA 2INZA 1D7KA 3ARYA 4YVVA 4NZ1A 2ISDA 4HCHA 4IT1A 4AISA 1TPFA 5EKYA 5AYYA 2NXIA 2DW7A 4HOZA 3F03K 3KDOA 4V28A 4MJ2A 3SO7A 2PTXA 1UB3A 2CLEA 1LT7A 4Y9MA 3S1WA 4AQLA 3V7PA 3E74A 1E6QM 2YIHA 4TV6A 1IHIA 5AECA 3AU6A 2QVNA 1UCWA 4C6MA 3OU8A 4WRHA 5D2YA 4M3PA 3H2CA 3IJ6A 3VDGA 4YL2A 3WEMA 3BG9A 3F2BA 2BWGA 4WJ8A 3RN6A 2FJKA 1SMDA 3UEQA 5EBUA 4U5KA 4XD5A 2WLZA 3D5HA 3EWBX 3NWRA 5DQPA 1E70M 4XAYA 3W1LA 4FX6M 5LIXX 1AZ1A 2VEIA 5XINA 3IVTA 2VZUA 1MRQA 4Q8TA 3SUTA 5HNRA 5I02A 4FIQA 3KTXA 3ZJ6A 4UTTC 1TA3B 3P8IA 2CFFA 4YTSA 4UB9A 1F73A 3W7HA 5AVNA 4A21A 5G4EA 3UNDA 3IARA 2OU4A 3ZLHA 4H7CA 1NJJA 1XRSA 1E6PA 1L0PA 4O11A 2HQAA 3WEZA 4MAVA 5A3HA 3F1QA 4IXHA 4D71A 5E0FA 3GKFA 4ZQCA 3O0FA 4AY8A 2VC5A 2FTYA 4DQWA 1VCVA 2XVLA 1TPWA 3AXMA 2H6RA 3TUUA 1PZ1A 2YB4A 4MY8A 2ZVRA 1E5JA 3P8JA 3LK6A 4PFHA 3N15A 5DCEA 5IFTA 4AZIA 3WQ6A 1CI1A 3LXBA 4HSHA 2Z1SA 3ZS4A 1VEMA 5E6YA 3R13A 4S3AA 1PYMA 1K9DA 3EDKA 1MW0A 2TRSA 3CIXA 3CTTA 3P74A 5A6TC 3WUFA 1EC7A 3TDFA 1MRAA 1KO0A 3S42A 1ZALA 4DO4A 5HQEA 3QW4B 4O4WA 1HNYA 3LTSA 1QVBA 4MVAA 2E9LA 4W8BA 1US2A 1B9BA 2XHYA 3N4FA 4AVOA 2FGBA 2WSRA 1KTCA 3SY1A 1E43A 5D2VA 4BI7A 4C6OA 4MKNA 1NDVA 3VKKA 1U1HA 3TTYA 3UR8A 4Q4SA 4Y9AA 1OGBA 2VOTA 3N18A 1XIMA 4QS5A 5BU6A 3SCWA 3CJPA 5CBBA 3GHSA 1P6CA 5B7YA 3Q4DA 4B5WA 3O15A 3VD7A 1K8YA 1WYIA 4OU1A 1O68A 1XDLA 2I1OA 4E38A 2YZ5A 1V77A 1DWAM 3T40A 4YNGA 2JK2A 1NDWA 1VRXA 2XFYA 3TQPA 3HO8A 1XJBA 3PZIA 1EX5A 4W8LA 1R3RA 2CLPA 2Q3RA 3N6JA 3E0IA 3G1XA 2DH3A 4JFSA 3WNLA 3USBA 2BP1A 3TTEA 1MO0A 2Y8UA 3B0VC 4ZQRA 1REQA 3BANA 4AH7A 1R9XA 2VURA 1OK4A 4S3EA 3ARTA 5BXSA 4JTQA 2NZLA 1XYMA 3FV9A 2J74A 5TQLA 1CT5A 2VQTA 4EAYA 1OF8A 5C9XA 1OJXA 2ZX7A 3S9IA 3KCOA 1Q4NX 3DFTA 1SSGA 1J5SA 3NPWA 3S2MA 4FSAA 4XZWA 5ABHA 1ZL1A 1EC9A 3CMJA 1JCXA 1VYPX 2JGQA 4JTJA 3BLLA 2J75A 4JL1A 4FHAA 2FH8A 2Q71A 4PMZA 4F9DA 3B0XA 1X8CA 4LC8A 4O0ZA 7ODCA 1O66A 5PTDA 4URIA 1CW2A 1TV3A 2X1TA 3LSCA 2POTA 1ME7A 4DBUA 2ZOXA 1UD8A 3V35A 3U4FA 3BZJA 5HPOA 3UZ5A 3S6DA 4GX9A 1TPEA 4TX8A 4D9PA 4LVFA 4ICNA 4AZBA 3AALA 1W31A 4NZFA 3M5XA 1E51A 2W6RA 3W25A 1MQRA 3UESA 2DZVA 1TIWA 2OWXA 2OWCA 4JTTA 2ZDRA 4GUGA 4Q3MA 5KETA 3WH9A 1E9YB 4O50A 4PUNA 3NSXA 3LHWA 2QDEA 2PDWA 1Q6QA 1BAGA 4QISA 1TV7A 2CZEA 1MI3A 2TYSA 3L21A 3VNJA 2EPNA 3BJFA 4MJ4A 4ATWA 5EPDA 1A3XA 1Z32X 1FHLA 3DI1A 5CSUA 1W1IE 3EZ4A 3MW7A 4F0LA 3BAJA 4DN1A 5CZKA 4B2DA 4MLRA 1EF2A 3OLIA 3QR3A 4GQQA 3IIPA 1HW6A 3ABZA 4WOQA 3RO8A 1W6TA 4JTKA 3BMXA 3SGGA 4A05A 2OSYA 3W72A 2WWCA 1FVPA 1Q66A 1LTDA 3T09A 4LCSA 5CZSA 4W87A 4GWEA 4RL3A 5CGMA 1PTDA 4IIBA 3H4XA 1TTIA 4HGXA 5MKGB 1VS1A 1BGGA 4DI9A 5DCBA 3RG6A 3CYJA 1WO2A 3S2LA 4E2OA 1WB0A 3BQ6A 4WX2A 3RPTA 1W37A 1UHVA 1OX5A 1EOMA 3PNZA 2VR5A 2ESCA 2ZWZA 4GY1A 1HKJA 1Q6GA 3MB9A 3TR2A 2CHNA 4PL1A 4HNVA 4JNMA 2DZTA 2GJNA 3NA8A 3LRLA 4O18A 5C8BB 4A3HA 1NEYA 2QW5A 3HPXA 2XDFA 5CAKA 5DBTA 1KV8A 1R87A 1ZAIA 1DJGA 3G24A 3VIIA 1QT1A 5F2MA 3BAXA 1NOFA 1EB3A 3N17A 1ZSXA 2C91A 3T55A 4IPPA 3NUKA 3CIVA 4MB5A 4E8DA 3WMLA 5HUOA 7TIMA 4U4MA 3IIOA 2E1WA 3ZZ1A 3ZVHA 2V3EA 4EKJA 1FWAC 1XYAA 4ACZB 4B90A 5CQ1A 2DQXA 2PTYA 2P3ZA 1KRBC 4O28A 3UG3A 5HQMA 4D6EA 3A23A 1XIGA 4AYGA 3ALGA 4IJRA 4PUEA 1XUZA 3OGRA 3MCOA 2G3IA 4DPQA 1HKIA 2R91A 2OOFA 4FXFA 1O1HA 2CBIA 1IEIA 4LYQA 2IQTA 3LENA 1HJUA 3JU2A 4D8ZA 4Y8EA 2E5DA 4WSJA 4A4AA 4LTSA 1DJHA 2C6QA 3ANUA 1TTQA 4OBTA 3VNIA 1UUOA 5CC3A 5I7GA 1F3EA 3W22A 3JZUA 1H5YA 2OELA 4LX4A 1TX2A 4HNCA 4R7WA 1XI3A 1DE5A 5D9MA 4YPJA 4TTGA 1NTHA 4MOZA 5FSDC 1HJQA 1OC7A 1VEOA 2EAWA 1BXCA 1CCWB 2RDTA 1ZAJA 5EMJA 4RE0A 3CUXA 4J3VA 3GH5A 2PEVA 2Y85A 5EMLA 5FA5A 4E6MA 2Y6ZA 1JFXA 2VNCA 3K30A 1RQHA 2PPGA 4IQLA 1AQHA 2W27A 1YNQA 3FEQA 1DE6A 3SRHA 4ZMGA 2P10A 3WNMA 1WUFA 4A8NA 4BQ5A 1VCFA 5BMWA 4XO6A 4F0KA 1RPXA 3FA4A 1HG3A 3BLIA 2OZ8A 2E7FA 3AUJA 5EMKA 3EXRA 3WD1A 4DUXA 2HEJA 3F5KA 4JFUA 3TYZA 3ZSSA 3CUIA 3TP4A 3VOCA 2PD9A 3IIZA 4KEVA 4MGGA 2PDMA 4C6BA 2DUZA 2XH2A 1TV2A 1EGVA 4JN6A 1KFWA 1KFEA 3VNLA 1ZCOA 5HWJA 3GG1A 4RW5A 4H41A 2OXNA 5A6JA 1HZYA 4EIVA 1M41A 3POCA 5FD0A 5HPCA 2Y5EA 3LCLA 4DO6A 5FF4A 1DPMA 2X2YA 1V7YA 4UFHA 4Y7EA 1Q6EA 1HVXA 5AYBA 2A2IA 2HZGA 1R2TA 4HPNA 1TG7A 5T8GA 1KLYA 4DI8A 1GJUA 5EMUA 3PR2A 2VGBA 3IACA 1L8NA 4O1DA 1PHQA 3RPDA 2R94A 1C9DA 3LN3A 1Q6DA 2G4FA 1EJXC 3LBMA 3CL7A 4RJEA 3WEOA 1UWSA 3OBEA 4AZCA 4GBUA 3MUZ1 1SQ7A 1F9CA 3NG3A 1K6WA 4H9UA 1RCOB 1S5VA 4AWTA 3KCJA 3ZJ8A 1L8PA 4XZ9A 4P8XA 1IF2A 2GPTA 1UWIA 4I3GA 5JIPA 2WHLA 4B4HA 2VFEA 1E3ZA 1O12A 2VXNA 2QAPA 3TK7A 1O60A 2X30A 2NW0A 5U4NA 3SCQA 3S2NA 5T91A 2J79A 3ORWA 5CPNA 3VE7A 4R7JA 1D2KA 3WL1A 1T96A 1TPDA 2D2GA 2QUTA 4EXQA 1NWSA 4JNZA 4C6PA 3BV4A 1FP9A 3FYOA 1NF0A 4LAOA 4ERAA 4DZAA 4IL2A 4OUIA 3ZT5A 4G7EA 4FR1A 4DF0A 3QW3A 5HATA 3SSZA 4GIEA 3CAQA 3AFBA 1WV2A 1KXHA 3SFWA 1QOQA 3QF0A 2UY2A 1Q65A 3VKJA 3WNNA 1VH7A 4AHQA 5EGRA 3S1GA 3REQB 5F2GA 2PDNA 4M81A 3G0SA 4J7RA 4JQ4A 4AAJA 1M7JA 2OB3A 2V3FA 4E4UA 2WMIB 2PF0A 1ZNNA 4IGNA 3OVRA 1EUAA 1DXFA 1E40A 2ZICA 1BFNA 2Z1XA 3ABXA 3E0VA 4NYYA 4QITA 3D46A 2YDQA 3HV9A 4NP7A 3DKLA 2EG8A 2WNNA 2GVYA 5K9CA 1JXKA 3IAPA 3TN4A 3PPCA 1RK6A 4PTDA 3CASA 1JPDX 5EY5A 3CZEA 1VBGA 2CESA 5ABGA 4XZHA 1EJUC 1CIUA 1GGOA 3AMCA 4EWJA 5E5CA 2PFHA 6TIMA 2CZFA 1US3A 2Y8VA 4Q4QA 4RLIA 4KESA 2A5HA 2CNCA 5D33A 4NRRA 1ZTVA 4CD8A 2RH9A 1P0NA 1BPLB 2OGYA 3QSRA 2FFIA 2GQ3A 1TPH1 1SM9A 1JYVA 3HPAA 3OLGA 1XG4A 3WK0A 4HNOA 1TV4A 2GJXB 5CPSA 5FEZA 1P7TA 3NXLA 2VOMA 4RDYA 2QCLA 4RDVA 3WD3A 3IUIA 1IXOA 4XX6A 2E68A 5AHMA 3EMQA 2DORA 3GC5A 3GXIA 2QQ6A 3WDHA 1A53A 3A9BA 3CLWA 3E38A 4PMUA 4G5DA 1XLGA 3L0KA 1EEPA 2BVWA 5C2XA 1FQ0A 3CT2A 3DCPA 3AROA 3STEA 4L9ZA 4IOTA 4K7VA 3VIGA 1ZB5A 1UR0A 5FACA 3G1DA 5D09A 1QPKA 1I6NA 2C16A 1IEQA 1QW8A 2Z1KA 5A6SA 3AJ7A 3ENLA 1JAEA 3T78A 1U5JA 2HXUA 3NPXA 2QCDB 1IWAA 4TTUA 1XLMA 1GG1A 4QG6A 4QROA 2W63A 3B03A 5B80A 1Z6KA 1HP4A 4DWSA 3QV7A 2E6AA 2I14A 4PA8A 5JBDA 1D3GA 3SEPA 2HS6A 5DF0A 5K3VA 1EP2A 3HGJA 3JVAA 3UQNA 3BURA 2V81A 1MQPA 1DJYA 4QBXA 3E96A 3HTWA 3WJYA 2YA2A 2QXWA 1BF6A 3ITOA 4OV4A 3URQA 3BGJA 2G3FA 4F4RA 4J35A 3EXTA 4FO4A 3AHZA 4TQTA 3RMJA 5U7SA 4JTFA 4CQAA 4U28A 5EB8A 1SFTA 2FPVA 2OODA 4WVXA 1FFQA 4S2BA 2DSVA 2WSYA 2IQDA 4UR9A 3WFZA 3M0MA 5AVHA 4QDPA 3R43A 1XCWA 1QR7A 3QMSA 3IJIA 1JUEA 4FXRA 1XH2A 4RDZA 1GVYA 3QEZA 3HPFA 2O4QA 3CYVA 1LG1A 1D9EA 1SUXA 1C8YA 1OABA 4W8AA 2J88A 2WJEA 4ORIA 3MC5A 4G9PA 4GYFA 1RLCL 1V7AA 2EG6A 3N4AA 4UFIA 4DELA 1S5MA 3CB3A 3UWWA 3QOMA 4KCVA 1FOBA 2XH7A 2FHFA 2X0YA 3AMDA 4R34A 2HE8A 3UPWA 3R79A 3GIQA 3I6EA 4UMBA 4ZE5A 2WMJA 5I2UA 4KWWA 4X60A 2UV8G 3B0PA 4EACA 3RNDA 1QAPA 4AY1A 2BY2A 2DV0A 4RXFA 1WZKA 5E70A 3QY6A 1B4KA 4H6QA 4KIEA 3U0HA 3E5PA 4HZ8A 4WY0F 2AAAA 3H7UA 4ZQOA 5HR6A 4IX0A 3MUAA 5T9CE 4CQ9A 1OIFA 1XIIA 3M07A 2D73A 3VTRA 1A47A 3H21A 1Q5MA 3SCTA 3QM3A 4OOUA 3LSBA 4KQNA 4MF4A 3TVAA 2WZTA 3CMGA 3R94A 3UW6A 4L7ZA 3WF2A 4LXFA 1DHKA 3TROA 1ZBCA 2OZ0A 2WMGA 4GO9A 1G69A 3VMNA 1A5BA 3WDIA 1FHVA 4ALDA 4H2HA 4HJWA 4DYKA 5D9NA 3DAQA 1F6KA 1U30A 1IXNA 5CPLA 1JDFA 3T0AA 1YTEA 4KETA 2Z2UA 4UTJA 4EK7A 1S2VA 1ZU8A 2GOKA 3G0UA 4MHBA 2F6XA 4DJFC 5CCZA 5EFFA 4U3CA 4PRTA 2CZVA 3A4JA 2G5WA 4J5NA 4Z1YA 3RX4A 4XZNX 4AZ7A 1OEPA 2BZNA 3TZFA 2BXZA 2GYIA 3QPZA 2PP0A 4HT3A 2R1MA 4J1OA 3L67A 3WQCA 3VIPA 1XF0A 3MKKA 1JDDA 3T0TA 4DYJA 3GW0A 4YHGA 2WXDM 3U5UA 3UP8A 3QR1A 4BI6A 4XTIA 3B0YA 3G2GA 4EXBA 1ONRA 2PODA 1DXEA 3RFAA 3WJXA 3AYVA 4L1GA 1B3OA 3FA5A 1SW3A 2PWFA 4HA1A 5A2CA 3P0WA 5FAJA 4DJFD 1UKOA 3QXBA 4HA0A 4K8HA 1V6VA 4JCMA 3NTYA 3CZJA 4IWWA 3OTRA 1F8MA 3P82A 4K36A 2MNRA 5I3GA 2IXUA 4D6HA 3CUGA 5GJPA 1H1YA 6ENLA 1YEYA 3PZVA 4AF0B 1PKYA 4LUSA 1LBLA 3EOSA 4XTDA 1NVMA 4TMBA 3W7CA 3LUTA 1TMQA 3PZMA 1TELA 4NF7A 3SR7A 1KFBA 4JICA 3INPA 4P61A 4LF1A 3EMCA 2X0SA 1RCXB 2RDUA 1JGIA 4Q4MA 4F2TA 3WLNA 4PMRA 2Q6ZA 3E0FA 3OHIA 1V02E 4PEEA 3EAUA 3RLGA 4BA0A 1G4SA 3S3GA 2Z4GA 1FH7A 3W01A 1V6WA 4JCLA 4N02A 2XWEA 3VNKA 1EQCA 4CVWA 2ABAA 2FDMA 1QU4A 1OYCA 1PEZA 2J7GA 2ZWYA 1A5OC 1YBQB 2WHJA 3IANA 4C1NB 1VYRA 2YBTA 2PTDA 1V3MA 2FZ8A 3CQ0A 3POHA 1JZ4A 5IXEA 5KZDA 3T8QA 8XIAA 2WNWA 1F3TA 3BO9A 3SB0A 3FIGA 5A6AA 2P8CA 6REQA 1QPRA 3CC1A 1VEPA 2VMFA 4KRZA 4HPJA 4Z42C 5F7UA 3PJXA 3LNPA 1DQWA 4EOUA 1XBYA 4GQ0A 2XM1A 3A4WA 1V0MA 4B3ZA 4TUFA 2B7OA 3CV2A 1XKJA 3GUGA 1I2NA 3T8LA 3VXGA 1M7PA 2WMFA 4B9ZA 3ZWSA 4O1CA 2WOQA 1D3CA 3ITGA 1KTNA 1FCVA 4EPBC 4D72A 3GNXA 3T4CA 3W2MA 1CXHA 2D2JA 1I2OA 5EFDA 2NQ5A 3S5SA 2W67A 3M0YA 4AXKA 3U4AA 1JI2A 2A6LA 1BYDA 4K37A 1KFJA 1ZENA 3S1UA 3A5VA 4NAEB 2PBGA 2AKMA 3VOGA 3C61A 3ARWA 2Y7EA 1LF1A 2BBFA 4LBRA 1XP3A 3RRXA 5DRCA 1H7OA 2ZUTA 3LLDA 1R38A 4US5A 4RE3A 3HOJA 1UJPA 1H0IA 5FSEC 3DUGA 1UZHA 4RPQA 4KGLA 4ZZ9A 4LEFA 1G7UA 4QRNA 3N2XA 2QT3A 3HBLA 4HHPA 5CPQA 1EYWA 1RA0A 1UA3A 2Z6JA 3TXZA 2E1DA 3NJ3A 3PP7A 4GXWA 3QSTA 1GVFA 1OFBA 3H54A 4P7LA 2DP3A 4FNUA 3GR4A 2J7DA 1OG6A 1JR1A 4XD4A 1B3VA 4ZFMA 1GOWA 4AZ5A 1BVNP 3WUBA 3S46A 1RV8A 3MHUA 4HSNA 1GTEA 1GNXA 3GKAA 3V5OA 1JYNA 4MZ8A 3DFOA 2BODX 4L9XA 3UZYA 2J9XA 3SECA 4YVXA 7TAAA 1XBXA 4IGHA 3TYCA 1Q6CA 3SSJA 5DT5A 2D0HA 3S6TA 4ACYA 4DM2A 1KM1A 3ITLA 3GHTA 3U6WA 4OHQA 4PN2A 3A4XA 3RR1A 2E8ZA 3PSWA 5ECVA 4ZB5A 1RD6A 3ME3A 2VT0A 2GSEA 3NM1A 1CWYA 2QEZA 3S5ZA 3BWWA 2Z0IA 2OO6A 4H01A 2P88A 4N2YA 3FEMA 4Y9OA 3H4WA 3GH7A 4A8LA 3KVMA 3EEZA 3F4DA 3VD5A 2WHKA 3WLLA 1QI4A 5LGXA 1X7FA 5I77A 2XIQA 4KF1A 3FAXA 1N8WA 1J6OA 5JU6A 3SQSA 4K8EA 2PP1A 2RJHA 3I6RA 2O7QA 4AEFA 4GQBA 1IQ8A 4PH6A 4IM4A 3DG6A 5FEWA 3C2VA 1JCNA 1MXDA 4JXCA 1LROA 4HTBA 5HA7A 1TCMA 1E1EA 1CXKA 3MBFA 1UH2A 4QHRA 1XL9A 1Z48A 2ISWA 1CGTA 1UD4A 2Z29A 4TVDA 1KLZA 1CECA 3KL0A 1F05A 4MMWA 3W7DA 9RUBA 2PS2A 4FXSA 3W88A 1KBBA 3M41A 1O94A 1W3HA 1M3UA 1OD0A 1RQBA 4DYEA 5FJTA 5LNUA 4QDWA 2VZVA 2PWVA 3OP2A 5BRQA 3MMWA 3PZ9A 1X6UA 2BXYA 5EMYA 2ZE0A 3ZFHA 4UTTA 1E72M 2Z25A 4CUCA 2GVLA 1QI5A 4FNSA 3E0LA 2RUSA 1YNYA 4HSOA 4JYDA 4PR4A 1PVNA 5G2WA 2HDJA 2ACUA 2VR2A 1HGYA 3TIMA 3VOIA 1QTWA 2XIBA 3WFAA 3WLPA 3LPFA 2ACQA 3WLOA 3HMJG 5I06A 3NDZA 4LV9A 4C1KA 3ABQA 2R8WA 1GEQA 5REQA 1H62A 2VELA 3A12A 2WANA 6A3HA 5BWAA 3KUMA 5A6KA 5FEXA 3IWPA 2QUVA 3C0LA 4BKNA 8RUCA 2JKPA 3RYSA 1DWFM 1KCZA 4DIAA 1VKFA 3VK5A 1MEWA 3AZSA 5F4XA 3URBA 1TMLA 4ONVA 1J0IA 1VFHA 1UKTA 4B4FA 4AFYA 2ATMA 2QF7A 3PBUA 1V6XA 5AC5A 2Y0FA 1E3XA 5I3HA 4C6FA 3EDEA 3NQEA 4HYVA 3QRHA 3C2YA 2J9YA 2WNZA 1KR1A 4Z08A 5CG0A 4NNAA 1K8ZA 1W91A 4PCNA 3BTNA 2WJFA 4AEOA 4K2SA 2VCCA 2WC3A 2BFGA 1CGUA 3VIHA 2QCFA 3LCHA 1S3HA 2I5QA 4NILA 3DG3A 2OSWA 1KGXA 4GJIA 1YHTA 5LZLA 3AXIA 3W7JA 3RO6A 4GJ1A 3IK4A 4X2PA 1TR1A 3U3HA 3MBDA 4KERA 3WBEA 3M1ZA 2PA6A 2RFGA 1ZUAX 5DLCA 2J4GA 3W7QA 4UNLA 2XU2A 4FB7A 2NQHA 3W83A 3WK2A 3QLLA 2INEA 3C5QA 1A5MC 3AIWA 1CLVA 1B0IA 4LPCA 4GUFA 2Q09A 4WXYA 3WQWA 1BTMA 2GLKA 1A5KC 1IEVA 1FWTA 3Q94A 3DFSA 3AIBA 4O52A 2VEFA 3AC0A 4N9BA 1U5VA 3EX1A 4ROPA 5HBFA 2HVNA 1CXIA 3UR7A 4WDUA 2ALRA 1ADOA 3TYDA 3TKFA 4WK9A 4LW7A 1QRQA 1IZKA 4E3VA 5I09A 4UQAA 1WP6A 3N2CA 3MKVA 4U2ZA 1RBLA 3UG8A 1E73M 1JZ2A 4N7QA 4F3HA 4BF5A 2DH2A 1H7WA 5A6MA 3VINA 3MZNA 1QNQA 5F1VA 1YXCA 3R1ZA 4S1FA 3WD0A 3O6YX 4H9MA 1XLJA 1KXVA 1LOQA 1HUVA 3WLSA 3B97A 3G3MA 4DJDC 3S5YA 4H9YA 1WXZA 2WVVB 4K1GA 3EKZA 1UKSA 2WKGA 4WLCA 5M3WA 4FOKA 1TJ2A 2VL4A 3QR0A 1PTGA 2Y4SA 4G1NA 4GGBA 3WH6A 2QDHA 4S38A 3L2LA 1NQKA 4ZA0A 4QG8A 1DBTA 1IR2A 8TIMA 3EWWA 4J28A 1HJWA 3WDRA 1G01A 3M0IA 5HJLA 1VBRA 4PCFA 4QCEA 3P5YA 4ILSA 1Z89A 4OT7A 3R2GA 1OFDA 2PBOA 1QWGA 4PBEA 1P0DA 4DJDD 1FWJC 3CUZA 3DFHA 3MP4A 4D6GA 4LVAA 3W02A 4ZQNA 3CT7A 3IRSA 2OEKA 2Y89A 2PU0A 5CJ5A 4GYJA 3S1XA 1OFEA 2PF8A 1K4HA 2WZIA 2ASHA 2FJUB 5ABFB 1H51A 3MTWA 2FPYA 4RKAA 4JL2A 2BASA 3PZQA 5DANA 2PSNA 1MDLA 1XGZA 1RY0A 3SCOA 1I75A 3W1NA 5CG7A 2XZ7A 2TMDA 3KVKA 1OVDA 1Q7MA 3SCNA 2AGTA 1CYGA 3BJSA 1M1BA 3AYSA 1K1DA 1XLHA 2ZTJA 1PPIA 3WJSA 2O0TA 4MY9A 3WBAA 1FWIC 5TBOA 1OYBA 4RDWA 4K7YA 3SBFA 3AJXA 4UTLA 1A5AA 2CLKA 1IT0A 2FGZA 1GVIA 4HPHA 2ZZ5A 3GD6A 4CD4A 3GZAA 3KBNA 1DIKA 3PZOA 3KHDA 3TH6A 2NWSA 2RHGA 1QCWA 1PWMA 2ZZ2A 5CAHA 4Q8WA 4V2XA 3VX0A 4Y96A 3C2FA 4UWMA 4HHMA 1OWQA 3IUDA 2HSAA 4GIRA 4LCRA 4JN7A 3B4UA 5A2BA 4REQA 3BUVA 2Z1VA 4UFKA 4UMAA 1J10A 8CGTA 1W9UA 1ADSA 3HQNA 3T0CA 1ESWA 3OPSA 3IJ9A 4KWSA 4B16A 4IMGA 1WUEA 2DZAA 5A1AA 3VU2A 1PSCA 2YW3A 3WF1A 4Q8NA 4YLWA 4ZOEA 1E6ZA 1ZJIA 1VRDA 2ZUMA 3O7UA 2VD8A 1QMLA 1NY1A 2YW4A 1REQB 4JTUA 4UOJA 4Q8VA 2V5BA 2IPJA 3UU0A 2YX0A 2DVTA 1RY8A 1JZ8A 5BRPA 4GYKA 3LBCA 4J4KA 1V6YA 2ZXDA 4GGHA 3UY7A 3N29A 1UP3A 1UOKA 2DZPA 3WO8A 3WNPA 3GHRA 3QYSA 4QP0A 2J78A 4W86A 3DKJA 3T0BA 4ZSUA 4PTNA 2YKKA 1W3NA 4QIUA 4GVHA 4Q7BA 4QNEA 4F0SA 1HGWA 4O19A 4PMYA 2V30A 3V0TA 4IUOA 1KBJA 1BG4A 4ZTYA 5MHBA 2EJ1A 1ITXA 3GE7A 2Y2WA 1LBFA 1UMLA 1QUMA 2QJHA 4I90A 3STFA 3P6LA 2FPTA 4QE4A 1ECQA 4DF1A 1ONWA 4PBFA 4N9EA 4DO5A 3DXIA 2FMOA 4XQ6A 2BMBA 4DWDA 2CW6A 1JI1A 1IE7C 2JGYA 5HMEA 5FJPA 4H3DA 2E28A 4PUDA 4ZE4A 1AK5A 1FCQA 3N9KA 2P3EA 4MB1A 3MVIA 1WZAA 4ZO6A 3W26A 2JEPA 3G22A 4P7RA 1TZZA 1VBJA 3URNA 1DWJM 3GUWA 3MU7A 2DZWA 1E1CB 3FKRA 2NXHA 4A22A 3DYOA 2EEXA 1MW3A 3CM4A 3WH7A 5AYXA 3T05A 2PURA 3AS2A 4LUIA 3M0KA 2XGIA 3EWCA 1JYXA 4O13A 3IGXA 3T2OA 1GPFA 4BF9A 3E1F1 3R7MA 4CEUC 3WSUA 5I0DA 2DZSA 3FY1A 1K3UA 3THAA 4IP4A 1J5TA 1XIHA 1LLOA 4N4QA 3XIMA 2GUUA 3AAMA 1DJZA 2YCLB 1E55A 4NSBA 2X2GA 1FA2A 4MIMA 2GQ8A 1DJXA 3LS9A 4UNKA 3U8GA 3ITYA 3B8UA 1I2QA 1K6AA 4H19A 1K8CA 4W5ZA 2GGHA 2CLHA 1IIGA 4NI3A 1XBZA 4Q7IA 1DV7A 3BLFA 3H2EA 3QH2A 1RQEA 1F2JA 3F2CA 5GVJA 3QFWA 3VKBA 4O0QA 1QI0A 1EJTC 3R0DA 4OECA 4L4OA 3GK0A 4UTMA 2X41A 1UA7A 2D2HA 2A85A 1FP8A 5K9XA 1I2PA 2QV5A 4MTVA 5HNUA 4Z0SA 1GOKA 1EKOA 3U2EA 4F8XA 2WCGA 1S2CA 5AY7A 3N1AA 1OCJA 1VCGA 5DX7A 5IBXC 3QOKA 2A4AA 2W5FA 4W7VA 5GJNA 4AG0A 3P62A 3L4VA 1H7RA 1P6WA 1BLIA 3E49A 1GK8A 4DUOA 4BS0A 2ZIDA 3GFYA 1SZGA 4U10A 4F48A 1K7FA 2F84A 2VZTA 4QJ3B 3MP5A 4H4IA 3KRBA 3EB3A 1UH4A 3L5LA 1GJWA 3ZVHB 1WKFA 4FXJA 4B9YA 4CCZA 5B7ZA 4YHEA 5CH9A 2A3AA 2NSOA 1GVOA 5FAGA 1P1XA 2CXGA 2IUZA 1EDQA 2F7FA 2ZZ3A 5SWUA 1UZDA 2QLYA 1OQFA 5A8NA 3UZXA 3TFCA 3DIPA 1GW1A 3WK3A 4FLRA 1FWEC 1V3JA 5EU9A 1H7NA 2W66A 3H24A 5LIWX 2BV9A 3UWVA 4B5SA 3FVMA 1TA3A 3CPGA 3NGJA 1SFSA 4Y9PA 5DXXA 3U2OA 3AU2A 2XN2A 3LBOA 4FEZA 1EJWC 2QULA 3WLRA 3DC0A 3PHAA 3R12A 4E8CA 3WBYA 3GY1A 5FF2A 1E1FA 3EEGA 3MO4A 2OZ3A 1CEOA 2PUZA 1R47A 2VFIA 5L9FA 1QPOA 1SJDA 2FIQA 4H6KA 2XISA 4OGZA 1R3WA 4QEHA 4ENLA 3NPVA 2YDAA 1H50A 3ITXA 1X8FA 4N42A 2EG7A 4H1ZA 3C4UA 1JF6A 4HA4A 1VQTA 3LRMA 3SN4A 5HINA 1Q7ZA 3RK8A 1F6YA 4LQ1A 4ATDA 3T42A 3W2LA 4QE5A 3PBMA 2XN0A 3I3BA 3M7WA 1UR9A 3PWAA 1JZ5A 3WELA 4AD5A 5AC8A 3B8SA 3W23A 2NUYA 5I3IA 2JE8A 1RVGA 4XUGA 2JBMA 1XYZA 4BQ4A 3S1VA 2H8ZA 3W29A 5AC6A 3AMKA 4GZ7A 4N6FA 3NNTA 4WKFA 3HFTA 3CZ8A 3YPIA 3H6OA 4NZCA 4RXGA 2GZXA 7XIMA 3MS8A 4WCJA 4PCPA 4JEQA 3HB9A 3ARUA 1B57A 2VC7A 3NZQA 1A5SA 2HISA 3R10A 1FUYA 1NIUA 3W76A 1LWJA 1A3HA 4P7NA 3O3RA 4IPNB 3AIVA 1JRCA 2DUAA 1J2WA 3A21A 2PDPA 4KBXA 1VR6A 1AH0A 3NQ7A 3S5NA 2P0OA 4B15A 3RILA 1KW1A 5D37A 2O9OA 1E15A 5E9AA 1Y5WA 3ZXWA 3TYUA 3E3HA 1JNEA 1KKRA 2Y61A 3SUSA 4J2PA 4H7ZA 2Y63A 4IIFA 4HU8A 1BKHA 2UBPC 3SCVA 1ICQA 2NLYA 1VFUA 4LAUA 3VABA 5HDRA 2ZX9A 4BK9A 3ANVA 4LC6A 4EF8A 3FN9A 3EPMA 5DY2A 1K03A 4XKMA 3K13A 4HYRA 3AXHA 1XLEA 5BRBA 2ZRUA 2QGHA 3LG3A 2D3LA 1LP6A 1OX6A 3C8NA 5A2AA 1THFD 4DZHA 1QNOA 2NQ9A 3C56A 2PRMA 1WOBA 4NY2A 2ZRWA 3KX6A 4D6JA 1NQ6A 4QS6A 2XIIA 1B4EA 3ZYZA 5C70A 4ZVJA 1EIBA 1PWLA 3L9CA 4WKAA 5AYZA 3WDPP 1Q6LA 1QNSA 2CHRA 1GYMA 4M1RA 4D1IA 4JHZA 5H8MA 1FY6A 2OO0A 4PSPA 2EJAA 3S9ZA 3P81A 4FZIA 2ADAA 4O4VA 5FOOA 1XRVA 4GBDA 1KFLA 3M0JA 5CBJA 4MPKA 3G77A 4XAZA 4XVDA 5LSMA 1W1A1 3S8HA 4UTKA 2P76A 1RHCA 4AIBA 3O6DA 1J8VA 1W5PA 1B30A 4QLKA 3RUBL 4G7EB 3LCWA 4RNHA 1IWBA 4GUIA 4R9OA 4GFIA 2R1NA 1BWKA 1XLBA 3A22A 4UTUA 3DC8A 3PZTA 4Z2GA 2G50A 3U9IA 1C8QA 3CV6A 3NDOA 4XWUA 4Y2WA 3KVJA 3NDYA 3TWBA 1A3WA 3IVSA 4E0CA 1AW5A 5K2ZA 1U1UA 4H9TA 2EPMX 2Z26A 3N3MA 4BQ3A 3STCA 3KAOA 3ARSA 3CS2A 3GTHA 2AAMA 3O0KA 3UT0A 2GDVA 1KWGA 1VB9A 3ZLFA 4MY1A 3ZR4A 1BQGA 3UYCA 1XH0A 2ON3A 5CSSA 2VD9A 3ES7A 4C6CA 1PE1A 2G3JA 1WCGA 1C8XA 1SU5A 1XCFA 3V16A 4AHPA 1WKEA 2Q02A 3MA8A 3VIJA 1ENUA 3QN3A 4J3XA 3KDNA 2VX5A 3L12A 3BOLA 2QPXA 3IGSA 1L6YA 3PJWA 4IPLA 4OUEA 4P2VA 1CB2A 3WLMA 5G4HC 1POJA 4DXVA 4GYPA 4W93A 4PYSA 4DAFA 3H7RA 1KFCA 1GZGA 3M5VA 2G37A 5AYIA 5JUVA 4QR6A 3SJ3A 5MKGA 4BR1A 1S5WA 3AIRA 1M6JA 4H9ZA 4NI8A 3VNDA 4OVXA 1LQ2A 2NUWA 1EH9A 2VR4A 4BHYA 1P7TB 2Y88A 3B9AA 1A5UA 4IQDA 4HNTA 1NSJA 2OSXA 3W1TA 3QYQA 2UZ9A 1XLIA 1J0JA 4H7VA 1WDDA 2PDLA 1JZ6A 2ZC1A 3L7RA 3LLFA 2YA1A 4C7FA 2FQIA 3QQ0A 4GABA 1FWNA 1G0CA 1GOIA 3EWXA 3EX3A 1C91A 4C91A 4P5UA 3OZMA 1YYAA 4PFMA 1GORA 1TJPA 3DHFA 2QHAA 3CNYA 5DRIA 2V6AA 3KZSA 1FX6A 4IMEA 4DJFA 1DXIA 3QV9A 2AGKA 2ZXBA 4FNRA 3QJAA 3VX1A 1I0BA 4RX0A 3LU2A 1RALA 4CD5A 4C1LA 3UNTA 3UXDA 1ITCA 1HXJA 1XDJA 3PTDA 2E6YA 3ZJ7A 4E2DA 2BS9A 3SJNA 3QQ1A 1AZ2A 3C52A 4DWSB 2O55A 3SRDA 4AMCA 1GOXA 1US0A 4IIHA 2Y70A 1QNRA 3OVPA 2WC4A 3NQDA 1JDAA 2EPOA 4M8UA 2X7VA 2C79A 3V5CA 3KRSA 1CPUA 1MEIA 4CN1A 3GR7A 1QPQA 4H04A 3WBWA 3AS1A 1XHGA 2CLIA 1W9BM 1QFEA 1S1RA 1H4PA 4ERGA 3D3AA 1M04A 4I7UA 2QNEA 3R6IA 2XTKA 1S2UA 2VVSA 4I7WA 4AW7A 3FHAA 5A8OA 2ZA2A 4LEQA 3DEQA 3VOHA 2C14A 5C9ZA 1UYQA 1XLAA 3A9IA 3VDHA 4AYSA 5JMUA 1KM3A 5KINA 3W86A 1KNWA 5IOBA 1T40A 1EGZA 1GKPA 3W28A 1J93A 5AZ1A 3DH7A 1I0DA 1NWUA 3NZGA 5A6BD 1TJ1A 4GH1A 3G5EA 5FL1A 1HO1A 5TNVA 1V6UA 4TOQA 3WY1A 2XG9A 1EWEA 2AMXA 2C18A 1TO3A 3M7SA 4EWND 1VFLA 2I5IA 3MSRA 2GGJA 3CZLA 3LCIA 1JUBA 4UTIA 3GAKA 4O57A 4OWGA 3GWQA 4Q7NA 4HYWA 1E6XM 2RDXA 1KXQA 1JULA 1YPIA 2OQHA 3V3WA 2V3GA 5FKYA 4Q8OA 2W3ZA 3W6MA 4C90A 1Q2SA 3ARVA 3FAWA 1XR2A 3LHYA 1GVRA 1KCLA 2IXVA 3VAVA 4EAMA 1E0TA 2Z7GA 1LQAA 2EPHA 3HPSA 1POKA 5LKYA 1BTCA 1A0CA 3G0XA 5IDIA 1RSCA 1UROA 5LNWA 2BGSA 1YNPA 4BY3A 2D20A 1M03A 3FCPA 4E2BA 1K9EA 1W1YA 1A5NC 1HKMA 3DG7A 4XKYA 4OJYA 4B2DD 3APTA 3BSMA 4HPXA 4W88A 4CKQA 3MJYA 5AKQA 2OFJA 3NEVA 3I7QA 4DEFA 4UOZA 4IMDA 1JF5A 4I6VA 2E6FA 4Z2KA 4M24A 3KLLA 4NG3A 1U5HA 3NQFA 3R8RA 5AHIA 1T8QA 3S0CA 2W4XA 5DMLA 1HP5A 5CGQA 1C8VA 5KZ6A 4KFNA 4HU4A 1DVJA 1JJKA 4K8GA 2XVGA 2FVLA 1UUMA 1W56A 2QPSA 4KGJA 4B91A 1B54A 1GKQA 2Q8LA 5C9WA 2Y62A 1V02A 1MUWA 2G96A 3UA4A 5H91A 1FKWA 1L6GA 4HP5A 1SZRA 1DWGM 1FDJA 2WZMA 3CGTA 3VGBA 4C6DA 3GR8A 4AWSA 4QSFA 4HMEA 8XIMA 1Q45A 2V3DA 1AVAA 3IVUA 3M47A 1L2UA 2PDBA 3TE9A 4CU8A 3T9PA 2XGZA 3B06A 2V5KA 2VJXA 3GU9A 3GTXA 4HMDA 3SURA 1YMYA 1JYWA 2AQWA 2XWDA 3NOYA 2HS8A 1BXNA 1E0WA 2NVAA 2RGMA 2YXOA 1LRQA 3AIEA 1ALDA 2PC8A 4X0NA 2PWUA 3J7HA 1DQXA 3N6QA 3MWCA 4L4MA 2XIOA 3QMRA 3JRKA 3MMUA 4HK6A 3QPYA 3I4KA 2SFPA 3Q58A 4LUSB 3TNOA 4LAMA 3B0UX 2G3MA