2PDKA

Human aldose reductase mutant l301m complexed with sorbinil.
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
315
structure length
315
Chain Sequence
ASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALMSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Merging the binding sites of aldose and aldehyde reductase for detection of inhibitor selectivity-determining features.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 104
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2007-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2pdkA00
2ACSA 2IQ0A 2BGSA 4IJCA 2DUXA 3R6IA 1AFSA 3BCJA 4JQ4A 1PZ1A 1ZQ5A 4HBKA 4ICCX 3R7MA 3VXGA 2PDLA 5LIWX 2P5NA 3H7RA 2QXWA 2ACUA 3CASA 4LAUA 2PDNA 4XO6A 4XZLX 2INEA 3C3UA 3N2TA 3ONCA 4JQ1A 3BUVA 3V36A 2BP1A 5DANA 1PWLA 2IKHA 4JIRA 3CMFA 4HMNA 4LBRA 3RX3A 4LB4A 1T40A 1J96A 2HE5A 2PDBA 1EF3A 3MC5A 3FJNA 4GQ0A 3GHRA 2DV0A 2R24A 4XK2A 4PR4A 3CAVA 3D3FA 3G5EA 5AZ1A 2PDUA 1YNPA 4XZNX 3M64A 1S2AA 3NTYA 4DBSA 4WRHA 5JH1A 4WEVX 2INZA 4G5DA 1US0A 4XZMX 1XJBA 1Z8AA 3M0IA 4WDUA 1IEIA 4MHBA 4XO7A 4F40A 3LZ3A 3DOPA 4XVDA 1X98A 4PUUA 3O3RA 3UP8A 2PDKA 3LQGA 1PZ0A 4GCAA 3WBXA 1R38A 1RALA 1QWKA 5HA7A 3EB4A 2PDXA 2PDIA 3UZYA 1K8CA 1LQAA 3UZZA 3QKZA 2PDMA 1OG6A 1LWIA 3LZ5A 2ISFA 3LENA 2I16A 3CV6A 1MI3A 3T42A 2ACRA 4QX4A 2FZBA 5C7HA 4PRTA 1XGDA 4PMJA 1C9WA 2PFHA 3DN5A 2PDHA 4XZHA 3UFYA 2HE8A 4H7CA 4YVXA 3UYIA 4JTAA 4JTCA 1FRBA 1X96A 4WDXA 1GVEA 2NVDA 4JIIX 1M9HA 1YE4A 4JQ3A 3UGRA 3R8HA 2IPJA 2PDCA 1T41A 3RX4A 1YE6A 1MZRA 1ZSXA 4L1WA 3R58A 3O0KA 5M2FX 3COTA 4H8NA 4L1XA 2PEVA 3LN3A 1X97A 4QBXA 4I5XA 4XVEA 4YS1A 3P2VA 5LIYX 1UR3M 1HQTA 4WGHA 2PDGA 4FA3A 2PDJA 3GHUA 4PRRA 3LNMA 1S2CA 3CAQA 4GQGA 1AZ2A 3CV7A 3V0TA 4FZIA 1RY0A 1AH4A 2IKIA 2A79A 3UZXA 3Q67A 2PD5A 1EL3A 5AZ0A 2IPWA 3EB3A 4OTKA 4WDWA 4R9OA 4QR6A 4NKCA 4ASTA 4FAMA 4GA8A 3UZWA 4DBWA 5HNUA 1Z89A 2FZ9A 3KRBA 2PF8A 3UG8A 2HVNA 3Q65A 3LD5A 5KETA 5LIXX 2DUZA 4JIHA 3BURA 4JTDA 2I17A 2PDPA 4AUBA 4DBUA 3V35A 3UWEA 4JQAA 4GIEA 3BV7A 3R8GA 2PZNA 3B3DA 3U2CA 4JTRA 3H4GA 3M4HA 1A80A 2IKGA 1IHIA 3N6QA 3LQLA 1PYFA 2IQDA 3GUGA 3V0SA 4DZ5A 4EXAA 1MRQA 2PDFA 2PDQA 2WZMA 1AH0A 2CLPA 4LAZA 2HDJA 3R43A 3RX2A 5HNTA 1Q13A 1YNQA 2FGBA 2HVOA 4JQ2A 1QRQA 1AH3A 1EXBA 5LIUX 2PDWA 3G1RA 3GHTA 3V0UA 4GACA 1ADSA 3ONBA 3FX4A 2IPGA 3WCZA 3MB9A 4LBSA 3LEPA 2AGTA 3LBOA 3S3GA 5LIKX 1XF0A 2C91A 2VDGA 2BGQA 1EKOA 3WBYA 2FVLA 4ZFCA 2ALRA 1VP5A 2IKJA 1VBJA 1Z3NA 3F7JA 3LUTA 4LB3A 1ZGDA 3GHSA 4YU1A 2IPFA 4GABA 2WZTA 3WBWA 1PWMA 4YVPA 4XZIA 2FZDA 4XAPA 2ACQA 4PUWA 3EAUA 4IJRA 3H7UA 1JEZA 1ZUAX 4QXIA 1RY8A 2PD9A 2PDYA 2J8TA 1Z9AA 4WDTA 1HW6A 1S1RA 3ERPA 4FALA 4IGSA 2NVCA 4JTQA 2FZ8A 1AZ1A 1SM9A 2HEJA 1S1PA 2HV5A 2IS7A 2R9RA 4Q7BA 4RPQA 4YVVA 4Q3MA 4EXBA 2F2KA 3WG6A 3R94A 5JH2A 1Q5MA 2F38A
chains in the Genus database with same CATH superfamily
2AL2A 2AAAA 3GXNA 3TN5A 3KEHA 4IH3A 1ME8A 1A3WA 1S46A 5DRCA 3W7PA 1Z6KA 5KZDA 1XX1A 4FXFA 2CBVA 1XICA 4B91A 4EVZA 2EPHA 3PSWA 1TJPA 2VCAA 2ZRYA 5LIWX 3H7RA 4DJDD 1R7AA 4O1CA 3AZRA 5U7SA 3LV5A 1X39A 2E5CA 2FTWA 4HYRA 1XIGA 3I3BA 1UP3A 5E0KA 4ONVA 3NQ6A 3PPGA 1XLDA 3DYMA 4MWAE 3NOYA 4JBRA 3NYZA 2IKHA 3L4YA 4K8GA 4QE4A 5H2ZA 2OFJA 5AY7A 3E2QA 2HSAA 4HSNA 1WCGA 4NG3A 4QJ3B 2ZX9A 2OYKA 4A21A 3DC8A 2A7RA 1TVLA 1CCWB 2DEPA 3UJRA 3BLOA 4F2BA 2AOSA 2YXXA 4C6FA 5EY5A 4OUIA 1YXCA 3O8AA 4TQTA 4KMQA 3FYPA 3UVAA 7XIMA 3W1MA 5K4XA 1REQB 1VEMA 1UWIA 4YYCA 1OK4A 4LAKA 4WRHA 3UPBA 2QJHA 5FAJA 4HA3A 1I1WA 4G5DA 3RMEA 4C6CA 1DJWA 5E9XA 3FKRA 1P4CA 4KCWA 1TCMA 4D6IA 4QQUA 1C9DA 3B4UA 4GD0A 6PTDA 4UTJA 1ELSA 2V3GA 1CNVA 1SPQA 5C71A 1MQPA 2OEMA 4Q32A 1LBLA 3N1AA 2GLKA 1IR1A 3SIMA 1FWEC 1F61A 1G1YA 3VIGA 3W3OA 2NX3A 3JRKA 2QUNA 2BBFA 3CYJA 1KCKA 4A2SA 3FA4A 3CZEA 1NJJA 4NZ1A 4UTTA 1KC7A 2P53A 1NOWA 1V6YA 3PJWA 2D0HA 1YMYA 2ZDRA 4JTCA 5TAOA 3LBCA 1MDRA 2ZRVA 4PYSA 4DQWA 4GYFA 1ME7A 3VKBA 4ZGYA 5JBEA 4UXDA 1XLJA 3CV2A 4U28A 3UGRA 4JNZA 1GQLA 4LX4A 1QAPA 1X8CA 3TYDA 1EGVA 4AD3A 1JIBA 3KVLA 3B97A 1YE6A 3AHZA 3CMGA 4RZ4A 1HJUA 3IV8A 3W27A 3DAQA 1SMDA 4JTHA 5T9CE 1XISA 4ZE4A 3AIWA 1JFHA 1XWYA 3CWHA 1KGWA 3P2VA 2F6XA 2ZA3A 1E6XM 1OFAA 4D71A 3PZOA 2VZUA 3W71A 5KITA 1P1XA 3LM7A 3EOSA 1HL8A 3ARPA 4M7TA 4V2XA 1CXKA 1OWQA 4PE8A 4HB7A 3VZYA 3N12A 1QI5A 2EQDA 5FF4A 1EZWA 1YNYA 3SCWA 2VRKA 3QSRA 2CW6A 2VTFA 1WDRA 3UXIA 2BWGA 4GQGA 4C6KA 3S42A 3PJXA 5IFPA 3IJ7A 3H53A 4UNIA 4JKMA 5CC3A 3E5PA 3E6EA 1QOXA 2Z4GA 4R27A 3WLTA 4DPQA 1MQQA 3S8HA 4HU4A 3TJIA 2VVNA 3FYOA 4U5KA 1LUCA 4QSFA 5HPCA 1W37A 4JTJA 3IV3A 4J7RA 3NDZA 4H41A 2EG6A 1WP6A 2O9OA 4C1NB 1YKWA 4MPQA 4FAMA 4ZOAA 1JZ6A 2OKTA 3DGBA 5HNUA 4PZVA 4CCDA 2QCCA 1UQYA 1X8FA 2I5QA 5DN1A 3PFMA 3BW2A 3FV9A 2WANA 1PKMA 3UCQA 2XH0A 5LIXX 4WKHA 3AMKA 3GUWA 3M5ZA 3OIHA 4TX9A 3BGGA 5AC7A 1XV8A 5GNYA 4LALA 4C1LA 1SJDA 4PCSA 4UTTC 3RCYA 3H7VA 3I7QA 4A4AA 3THAA 3OODA 1W2PA 1R9ZA 1ISVA 3P74A 5CPMA 1KM5A 2IKGA 3TLLA 4AVOA 3EWCA 3N6QA 4MJ2A 2RUSA 1JD7A 5D33A 2VXNA 3L4ZA 5CC6A 1JDEA 4C6DA 1J6OA 1TX0A 1P6CA 1F07A 4QLLA 1UWQA 3A22A 1TE6A 1YQ2A 1EXBA 3O1NA 2QEZA 3WDQA 2POZA 4KIEA 3N3MA 3EXSA 3NEVA 4A3UA 3CPRA 3LBOA 1XPGA 4HU3A 3NSMA 2E5DA 3LM3A 1YDNA 1WV2A 4GO8A 3W84A 1TTPA 3BC9A 3LB0A 4LB3A 3OW1A 2CLFA 1H60A 2W61A 2IPFA 4GC4A 3WBWA 3FVDA 2JFEX 2OB3A 4I90A 2FH6A 1GOOA 4JNMA 2XSAA 1PIIA 4XD3A 4LAOA 5KINA 1RY8A 1JYNA 1I45A 4AWTA 3HA1A 2PZ0A 2PBOA 3C0SA 4LUIA 1M6JA 2C79A 5MHBA 3OLIA 3IS4A 4MFDA 5D4YA 3S5NA 2PCEA 1NELA 1Q6OA 3KCOA 2ZXQA 3U7BA 3S9IA 4KQNA 1LLZA 3GR8A 1Q7ZA 3GDRA 4W7WA 3GXDA 4F0HA 5ABFA 1VC4A 4AEEA 3UESA 2G8ZA 4M7SA 4NF7A 5DXYA 3SFKA 2F2KA 4Q8NA 3N9SA 2BHZA 3A21A 2GDQA 4GZIA 3PZGA 1DEDA 5K4ZA 3ARWA 4DVOA 3KCLA 1F7BA 3EOEA 3QR1A 4PMUA 4PGLA 1R3VA 5EU9A 3R7MA 3QY7A 5LA2A 2WWDA 3TSMA 2VQTA 2PAJA 4QITA 1H50A 3MCNA 4ZQMA 1FWGC 2ACUA 1CT5A 4JICA 1DKWA 2X1SA 3VIHA 3QXBA 1EP3A 4HNNA 3QF0A 5CPSA 2RAGA 1UR4A 3BUVA 3H23A 1UR8A 1PEZA 1WZMA 3B8DA 3LG3A 2ZXDA 2OR2A 1KCXA 5GJPA 3TYBA 2ZWYA 4H2CA 4Y2WA 2V30A 3MSDA 2F8QA 5LA0A 3B0YA 4IG2A 2VDIA 1FXPA 1CYGA 1EF3A 1TV4A 1V0NA 4PL1A 1OVDA 4CEXC 1FFQA 1ZP3A 2OZ8A 3N25A 4Q6XA 2NQHA 4M6PA 4U2ZA 3CAVA 2Y61A 2BDQA 1WKYA 3E1F1 1NWSA 4LCSA 1H5YA 2Q3RA 4L9XA 5AC5A 1B3WA 2NW0A 3V75A 2P88A 4JFVA 4XVDA 1EDQA 2O9RA 3S6TA 4P8XA 1P7TA 3AIRA 3CQHA 1JZ8A 2WVSA 3ANVA 3EX4A 1A5SA 5A1AA 4H9UA 2J24A 1MW1A 4D6HA 3M43A 2G5WA 4F0LA 4X61A 4IMDA 1M53A 2EAWA 5LYRA 3N2MA 3VABA 3S0CA 3OYZA 2QZRA 3IGHX 4H7CA 3WFZA 4Z1AA 4BI5A 3CZJA 3UR5A 3ZT6A 2WMJA 2FVKA 4FOJA 4IGHA 4DWSB 3QYQA 3U4AA 4L9ZA 1M9HA 1YE4A 1XKJA 1NSJA 3AMDA 1SR9A 3CQJA 2ZZ7A 1I9CB 3SAZA 3ZLFA 4MGGA 1LT7A 4ZR8A 3TR9A 5M1TA 2XVLA 1YPFA 3O05A 4Y9MA 3G6LA 4XKYB 3HJEA 4UOZA 4RE2A 3AXKA 5E70A 3PUOA 5REQA 3M0XA 3KDNA 4HHLA 3SURA 1YTEA 2EPMX 1KRMA 3W6MA 3J7HA 3UF9A 2VURA 4E4FA 2NV9A 2HMCA 2XINA 3WQCA 2ATSA 3HN3A 3M0HA 4X2PA 4B3ZA 2CU0A 2PTYA 3NPXA 3MU7A 4REQB 3W23A 1RCQA 1PJ9A 1U5VA 3FK4A 1H2JA 1GNXA 3N04A 1B54A 3VZZA 4B3LA 4WQ6A 2CHNA 2ZVIA 1FUYA 1YTDA 4OOUA 5CZJA 3EWUA 4O54A 5E09A 1NDWA 3USBA 1HP4A 3RU8X 1OT2A 2TRSA 3WJZA 1ZBCA 4ZQRA 2B81A 3WL1A 4HK6A 7ENLA 4HPJA 4OTKA 5D8ZA 4PEKA 3CHVA 2QCFA 2UY5A 4LEFA 3RK8A 4RPPA 3TC3A 1LORA 2B4GA 2A21A 1NF7A 3OZMA 1FHDA 1S2TA 5D38A 1IQ8A 2ZUTA 5DFAA 2TMDA 1P0NA 1TWDA 1FKXA 4JN7A 2QIWA 1Q6RA 3TMLA 1EX5A 3CIWA 3LCLA 1M68A 2OT0A 5KETA 1FWBC 3T0BA 1E5JA 3PZTA 4OECA 3VNKA 1QATA 4JIHA 5FL1A 3VGDA 2BY0A 3N3TA 4JTDA 4LGXA 4AUBA 2DJLA 3UETA 3F4CA 4DBUA 1BRLA 4XSLA 4UTHA 3EWZA 1W3KA 3BK0A 1JZ4A 1VYRA 1E0VA 4GISA 3MT1A 3H2MA 4UC5A 2CLLA 1VJZA 2VEKA 1XUZA 4B5TA 1X6UA 4S3KA 5CBBA 2PDQA 4CKQA 3KFTA 2KZHA 1POKA 6ENLA 1BTMA 3ZZ1A 1A3XA 1EC9A 5I3FA 3S9ZA 2PDWA 4GACA 3USZA 3WCZA 4LUJA 4QEEA 1FX6A 1K6AA 3LEPA 1OD8A 3S3GA 4KH2A 1UOZA 2C91A 1GEQA 5K7JA 7ODCA 2BX7A 2YDSA 4XAYA 3WBYA 4DYEA 4MZ8A 1VP5A 2VC5A 4QGCA 4DJEA 4WCJA 1OX4B 2BFGA 3S6OA 1V7YA 1N55A 1A53A 3TH6A 3DFOA 2DZPA 3EWWA 1UBSA 4NX0A 5IDIA 3NIYA 1B57A 1FFRA 4UQBA 1Q6QA 2DT1A 5AYZA 1XYAA 4N0RA 3S1XA 3O7UA 1SO3A 4HA0A 4AG0A 4QG9A 1A5UA 2YYUA 2VR2A 1Q85A 3WJYA 3WD2A 3GDKA 4B5NA 3NQBA 1SFLA 3OQEA 1WDDA 1POJA 3WX7A 1TIMA 3UG4A 4NL1A 2J78A 1JPMA 4FX8A 3K1DA 1LQ0A 4LBUA 5CSYA 4F0SA 4NJKA 4RCXA 1W9PA 3VUSA 5BMXA 1VBRA 3MI6A 4Q7BA 4PMYA 4MOZA 4W84A 3FGCA 3EOOA 2Y7FA 4WLCA 2CFFA 2G97A 2GGIA 2MUCA 1UMYA 2CETA 4BA0A 3WK1A 1W54A 3GM8A 1B4EA 2PSNA 4NAEA 4I8DA 3RFAA 3MMUA 3F2CA 1W5PA 4CU7A 1ONXA 1GONA 2DW6A 2V68A 3PANA 2DUXA 4QROA 5HMEA 4CNPA 3AHTA 1AFSA 2POTA 5HJXA 3IRSA 3N34A 4HBKA 2Q6ZA 1VLIA 2VFFA 3M5YA 5EMMA 3RGTA 1R86A 2GGGA 4IQLA 1PO9A 3H54A 4HU0A 1XIJA 2DZXA 2PTDA 3M0MA 1W9BM 4D2JA 3QHNA 4FLRA 3W81A 1FH7A 3WLHA 3BL3A 2F9RA 4IICA 4M19A 5BU9A 2OKOA 4TX8A 5DANA 3MA8A 2VZTA 1MUCA 2XVPA 3EPMA 4LBRA 3DGRA 4S3DA 1DORA 4Q8WA 4TVCA 2FB2A 1IWPA 4QE5A 3LHVA 3BARA 1EQPA 2NX1A 2O7QA 1PZ2A 3WL0A 3GNPA 2OOFA 3FJNA 4WSJA 4DJEC 2PP3A 4CEUC 1NDYA 4IMGA 5G4WA 3CJPA 2FGZA 3NJ3A 1W1IE 1XSIA 2R24A 3FY1A 4NRSA 2YKKA 1NP0A 5BRBA 4CN4A 4JFSA 1QNRA 4DAIA 2H6RA 2BNJA 2Y8UA 4B2DD 3ABQA 1FTXA 2QUMA 3CPUA 5D09A 4QDWA 5AHFA 4WEVX 3KOYA 3R11A 2INZA 3RR1A 4XZMX 3M0IA 4WDUA 1IEIA 1ZNNA 3MUXA 5AVNA 3TTYA 3JS3A 5I3DA 3AUOA 4G7EB 4C91A 3GLCA 9XIMA 2F61A 4CNTA 1PZ0A 4HSHA 1YDOA 2GQ3A 5E6ZA 5HA7A 1VQTA 1F3WA 1HUVA 3PS7A 2ZA2A 3RO8A 3WDIA 2X0HA 3KWSA 3TV8A 3QKZA 4RDWA 3CU2A 3LZ5A 3LENA 3FLUA 3L0GA 3ITGA 5K9DA 4UTIA 3R13A 3CUIA 4UMCA 1UW9A 4FP1A 1JZ7A 3QQWA 4BEUA 2J7HA 3NDOA 3UYIA 1Q6LA 2VI0A 3LDVA 4W5ZA 2C1HA 3GR4A 4GUFA 3F5LA 8RUCA 2X0YA 3BVJA 4JQ3A 7REQA 2X16A 2IPJA 1J5SA 4FXRA 3SQSA 4LNYA 3W83A 1ADDA 3VOJA 3T4CA 3BTNA 3LK6A 3KTSA 2V8ZA 4DF2A 3DZ1A 4NHVA 1ZSXA 2PLKA 3BV4A 1EJWC 3CIXA 3R58A 4FNPA 5H8UA 3COTA 3L7RA 3LLXA 2Z28A 1SYTA 2XZ9A 4PMQA 2FQIA 1ZL1A 1Y5XA 4XISA 1JPDX 2FIQA 2GWNA 4TR9A 1O94A 4L4LA 3RLGA 3I68A 5LNVA 4LH8A 1XC6A 4LUTA 1W5NA 4X63A 2J9ZA 4H9VA 2PRLA 1J5TA 4S38A 4PUKA 2QV4A 4JTGA 2PGFA 2Z6JA 4K37A 2QGHA 1MWOA 4UR8A 1W1YA 3KRUA 1XYFA 5IXEA 1RPXA 2ZZ1A 1OIMA 3GFXA 4Q4SA 4DXVA 1XH2A 3A47A 3ECQA 1K70A 2AL2B 2XIOA 1LBFA 4R9XA 1W0MA 3UERA 1Z42A 3GYCA 4U33A 2ALDA 1A3HA 3NQGA 4GZJA 4FHAA 5AHEA 2XIBA 3CAKA 3B8TA 3PHAA 1DJIA 4PTMA 5AHMA 1XRSA 1RA5A 5A2CA 2QDEA 3P81A 4UOQA 1UH2A 4GVGA 1UH4A 2WC3A 5JBDA 2Y8VA 3QOMA 4H8UA 2Z1KA 5DCEA 4XSMA 3PULA 4N9CA 1OK6A 3QBUA 3KW3A 4ZB2A 3URQA 4JKLA 1W5MA 3K1GA 3RDKA 4A8IA 5EYWA 3L2IA 3R8GA 2PZNA 4DAFA 3EEZA 1IF2A 1WZAA 3OA3A 3HBLA 1CGYA 1A80A 1IHIA 2D1ZA 3PJTA 1RJPA 4TTUA 1L0PA 2HS8A 3GUGA 3BPWA 2VGBA 5AECA 1DWFM 4D8ZA 3VVGA 2WKLA 3KVKA 4NP7A 1PDZA 2XPKA 5I79A 1Q2SA 1E73M 2HVOA 3GG1A 1RD5A 4LVDA 3SUTA 1PIFA 2F6KA 1GZ1A 1O5XA 2ADAA 3P6LA 1DIEA 1F5ZA 4WR3A 2VD9A 1SSDA 4JPGA 1KRBC 3B9DA 1VBJA 4DWSD 4EXQA 4KRTA 3F7JA 1EGZA 1KD0A 1GVIA 3QMRA 2PRHA 2C3ZA 1S5MA 4OBRA 4CD8A 4GVHA 1UZDA 2F84A 3CB8A 1J0HA 4L65A 1EHNA 4JKKA 3GO2A 2D22A 4QXIA 1TQJA 2W67A 5BW6A 4LY8A 2I9EA 3WH7A 3C6CA 2QUUA 1UJPA 5CPQA 1S1RA 3ERPA 3L5MA 2W3ZA 3INPA 2RDTA 3SCVA 3FXGA 3KTXA 2C0AA 2Q3OA 1EIXA 2W63A 2OO6A 5D37A 4AX7A 1AA1B 1F6YA 2VP8A 3O6CA 4CD6A 5I07A 1CECA 3R10A 2J88A 2WVVA 1XDLA 3TP4A 1JCYA 2RDWA 1XLBA 3S46A 2GK1B 3KVMA 1ONRA 3P82A 1W3HA 3I6TA 3W7OA 3THUA 4AZBA 2CC0A 3OBAA 3W2NA 4IJCA 1ICSA 1U5JA 3SI9A 4JY9A 3BAKA 1UP2A 1FWHC 3BCJA 4JQ4A 4ATDA 3NUKA 3RLVA 3QV8A 1UYQA 2PDLA 3SECA 4DJDC 1UUOA 2Y8KA 1K9EA 2NQJA 2ZZ5A 1TWWA 7CGTA 3WK3A 4O53A 4B5VA 1YPIA 1JZ5A 3BWWA 3R25A 3AXXA 4GI4A 1XIBA 5CLTA 3WJWA 1V3LA 2J7CA 4HJFA 3KBSA 1TV5A 4LB4A 3DFSA 1DJNA 3ZXWA 4G6CA 4ATWA 3NL5A 4HNTA 5I0DA 2QMKA 2YSWA 3LNPA 3MC5A 3OLDA 4K6AA 2XGIA 4N9BA 4GJIA 1O7AA 2YLLA 3DHUA 3POCA 3AS3A 2ZA1A 3RCNA 2ZOXA 1S2WA 2JGYA 1TV2A 3D3FA 2FJKA 1VFMA 3D0CA 4XZNX 2FB3A 4IP5A 1RJQA 1WX0A 3M64A 4DN1A 3THCA 3JZUA 3W7EA 3CEPA 4UCFA 4DBSA 4IP4A 1E9LA 4NQ1A 4IIBA 1BTCA 1L6GA 4F79A 1XJBA 2GJPA 1UOKA 3RJXA 4LANA 3QEZA 4F40A 3LXBA 4UZUA 4HPNA 4JFUA 1BF2A 3LXAA 4DO5A 1XBVA 4GRSA 2WSYA 4PB3A 3EB4A 4JYDA 2CITA 2QULA 1XIDA 3GAYA 3TIMA 1UD6A 1M41A 4DJFA 5D2YA 2YXGA 4H1ZA 2W0UA 1GKQA 1T5AA 3WQPA 1OYBA 3TA9A 3W37A 3W24A 2QF7A 4ECLA 3MSGA 2A3AA 2W66A 1SFTA 4GBUA 1XLLA 1H61A 1XUUA 2GQAA 1R2SA 2C19A 4UFLA 2QDDA 1TTJA 1HJSA 3AXIA 3ITCA 2V6AA 2V2DA 1E4LA 4GX8A 1H0IA 3APYA 1V6VA 2GPTA 1K6WA 4IIFA 2OZTA 4C6OA 1GYLA 1W8SA 3QY6A 3PF3A 2P1FA 4AD0A 4IX2A 4W4QA 1MZRA 3CWOX 2WHMA 2HTMA 4F48A 3PTDA 1TKKA 3TQ0A 4L1XA 2E6FA 4AF0A 5A5WA 2ISWA 1B3YA 4I5XA 3TYZA 1W1A1 3M16A 4HOZA 2ICSA 4A6GA 1W3TA 5AVHA 5T91A 3AIEA 1XLHA 2EJAA 2ZRZA 3SFWA 2J7BA 3W72A 3VGBA 3PC0A 4ADSA 2QKFA 4DZHA 4H6KA 1EBGA 3CIVA 4HA1A 4IQEA 2VGIA 3TJLA 1F8MA 4JTTA 3CK5A 5ABFB 1OCQA 3DI0A 3DKLA 4FNSA 3CO4A 3KLLA 3LY0A 1BQCA 1U1JA 3B9NA 2ZWZA 1XBXA 2QDHA 5T8GA 4MNLA 4UNLA 2Y6ZA 1F4AA 1US2A 3XINA 4OFCA 1J2WA 3B9AA 1PZ3A 1XLKA 4YLWA 3T05A 2RKXA 3RR4A 3VKKA 4K1WA 1HN1A 1CENA 4HPHA 4NAFA 1RLDA 3N2BA 1UZ1A 4B5XA 3TCEA 4OOZA 5A8NA 1DJGA 4LU0A 1GJWA 3IJDA 1EA9C 4HNLA 1VIWA 4ERIA 4DJFC 2YB4A 4QHRA 3SB0A 3FYYA 1QCWA 2I57A 1G4TA 3S2CA 2CLHA 1ZY9A 1UJQA 4DNHA 1QJWA 1WDSA 2QVHA 2I17A 2ISSA 4J27A 4J1OA 1J18A 1P6BA 3BGAA 3GVGA 4JQAA 3V5OA 4O28A 1UWTA 1KA9F 1WUEA 1PX4A 3DFNA 3WLOA 3M6DA 2C6QA 1E0WA 1XHGA 1I2PA 5DCBA 3CM4A 1U22A 1QR7A 1ZBWA 5M5DA 2G0WA 2PF0A 4ZOBA 2OCZA 2V5DA 4E3VA 4PMDA 3NQAA 1HFBA 3H2NA 2DSZA 4K7YA 4LC6A 1BWLA 2HDJA 3HG3A 4QG6A 1M65A 4H3DA 2FGBA 5CG7A 3NAVA 4QCFA 3DFQA 2VEFA 1E70M 1RXOB 2OLSA 3TOPA 2P76A 3PNUA 1QBBA 4LSBA 1QI2A 1GG0A 2TYSA 4S2BA 2R1LA 4HYWA 4W8BA 5F4WA 4ERGA 4PH6A 1ODUA 3PBWA 1EZ2A 1F76A 1PPIA 5CQ1A 2FVLA 4AMCA 4YXGA 2ABBA 5C9WA 3O0FA 3NSXA 4AYGA 4U2YA 1P7TB 4HP5A 4D6CA 3AU2A 5A8QA 3AIUA 4GABA 4AX6A 2VCBA 1W31A 3KZPA 1OG0A 1A5AA 2EXOA 4U3AA 2DT0A 2YCLA 2E09A 4YTRA 4ZO8A 1Q63A 1B2YA 3SCPA 3HMCA 3B0XA 1ZCOA 2ZX5A 3UT0A 4W8AA 5FOOA 4IUOA 4H4IA 1WB0A 3KXQA 3KBVA 4QP0A 5I6SA 3W7RA 3VM7A 1SM9A 2J74A 3VKCA 1Q7QA 2D73A 2H90A 2PUZA 1UWSA 4BR1A 5AHNA 5IM51 2WNNA 3AS1A 1TPUA 1I2QA 2J25A 3EXRA 3OHMB 3W87A 3PPHA 4N2YA 1RBLA 3GFZA 2VC7A 3BJFA 1GVFA 4IT1A 1SUXA 2QHAA 2O4QA 4GXPA 3CGTA 1PVNA 2CLEA 1AL8A 4X60A 1O6IA 3ISIX 5REQB 5AFDA 1XYCA 3VKDA 4DM2A 2QCGA 5FSDC 1ZQ5A 1SW3A 1S2VA 4A05A 3TWAA 3P7YA 4M24A 1XLEA 2BG5A 4RL3A 3AWOA 1EJSC 3P84A 4M51A 4LAUA 4MTVA 2GYIA 4E2DA 3ZOAA 1QOQA 4LYKA 2INFA 3W1TA 4TVUA 1DPMA 1TPFA 5LZLA 2C8NA 1A47A 4IPPA 1BWVA 3LCHA 4QCEA 1A5BA 4HIBA 1V3MA 4HTBA 4A8NA 4ORMA 4YN5A 1EJRC 3EYPA 3RX3A 5DT7A 1J96A 3T55A 5CC7A 6ALDA 1XINA 5GJMA 2ON3A 4L6DA 4IISA 1TUFA 1HT6A 2JK2A 1TJ0A 2GVJA 2J6XA 2D2OA 5ECVA 3CHEA 3QGKC 1M04A 3KZSA 4MDPA 2QAPA 2G4FA 4PR4A 3VO0A 4KWOA 3CH9A 3EDJA 4KFPA 3O2LA 1K9FA 5JH1A 4IPJA 2NV2A 1KQZA 3H2CA 5DBUA 4KESA 1QI3A 1KFWA 2VUNA 5CZTA 1TX2A 3DOPA 3Q4DA 4O13A 2ZVRA 3MJMA 1C7TA 1H7WA 2WZHA 5I3KA 4RV3A 1FP9A 2VKZG 1H51A 3WBXA 2XN1A 3LHTA 3P0XA 3UZYA 2CEQA 2YCKX 5FJOA 1Y5VA 1X1NA 1REQA 2SFPA 5CJNA 1VCFA 4M29A 1NWRA 2ZCGA 3SUSA 2FMNA 1ML1A 3GC5A 2HQAA 1BG4A 3DN5A 3SN4A 3IAPA 2REQA 4L1GA 2CCRA 5CPOA 4YJ5A 1D8WA 3HO8A 4EPKA 4JIIX 2CPUA 2A3CA 3AJXA 4GINA 4B15A 1Q6CA 2CKRA 2PWVA 3ITVA 5HQEA 4FIRA 2EPKX 4O4VA 1J11A 2Z2BA 1T41A 1KFLA 3V1HA 3OVQA 2TPSA 1NTHA 3PJUA 1E6QM 1AW2A 3GTHA 5M17A 5F4SA 2Y2WA 3VD9A 1H1YA 3ALGA 3WN6A 4BQ4A 4B9ZA 2XYLA 4NZJA 3B8UA 1ICQA 3AWNA 3SY5A 4PUEA 2WNWA 3PNZA 3OVGA 2DW7A 2NUXA 2YL5A 3DERA 2E25A 3ABXA 1LBMA 1L6YA 2QCDB 3QC3A 1LROA 4GNVA 4O18A 2VJXA 3NM3A 3KRZA 2WWCA 5HJYA 3CAQA 3GY1A 4IJBA 4ZQPA 3HB9A 3ZSTA 4B92A 3FGCB 3CV7A 3MP5A 1B1YA 1IZCA 3Q67A 2X1TA 4MPKA 1MMFA 4NAEB 4NJJA 1FCUA 2P8BA 1WO2A 2P50A 3T0CA 4PTVA 1HJQA 4DUXA 3LTPA 2PA6A 4GC3A 3BE7A 4LV4A 4RZBA 4HHMA 3UZWA 1WKEA 1XBYA 2HISA 4EACA 2HVNA 4PUNA 4C6MA 2VELA 4DLFA 1L6FA 3W02A 1MW3A 1RVGA 2VENA 3AFBA 2Y5JA 3T09A 4YPJA 1QPRA 2WJFA 3TMQA 1SZRA 3H6OA 3BV7A 3B3DA 3L65A 1PL9A 1DJXA 3BQ5A 3OQ8A 2ZZ6A 4DNMA 4J3XA 1TO3A 1FWDC 4C1NA 2HK0A 1PCWA 1GKPA 2E9MA 3OVRA 1W9DM 3BH4A 1OF6A 2F2HA 2VD8A 1RQHA 5D30A 5BXPA 3S1VA 4I5RA 3B0VC 2FKPA 4DUWA 3S5YA 4QNWA 2YFOA 3L23A 1XF0A 5I3IA 1EKOA 3MWAA 3N6HA 4Z0SA 3W1UA 3RAOA 3MV11 1HP5A 4E4PA 3BXWA 2BASA 1TCDA 5LNSA 1GT8A 1XLCA 4MLRA 1EJ7L 2CXGA 3P8IA 2WZTA 1B3OA 4YVPA 3R89A 2OSXA 3NVTA 3LLFA 4XAPA 4IFKA 3GZAA 2Z00A 4HTYA 3R8RA 2XDFA 3AALA 3UG5A 5HR6A 1ITQA 5G5IA 1YRRA 4O15A 1PE1A 2PDYA 2ATMA 3GXTA 1Z9AA 5C2XA 4UQAA 4HZ8A 4EX4A 2Y89A 5XIMA 2E8ZA 4ZA0A 3IEBA 1K03A 3WK2A 5BWAA 4NJIA 3L5AA 1TUXA 3ZQ9A 1QNVA 1S1PA 1HNYA 3KLKA 3BLEA 4YCPA 3DXIA 4N7QA 2FPYA 3G1YA 1K8ZA 4Q7NA 3BW4A 3HFTA 1IWBA 3EB2A 4O0KA 1H7OA 4R7OA 4PBGA 2WZIA 1RJRA 1DIKA 1GVRA 4AZ6A 5EPDA 2V81A 1QHOA 3QPEA 2QAFA 2Y5SA 3GG7A 4H7VA 3OGSA 2YBVA 5I09A 3LV6A 3UEQA 1EJVC 5AOUA 4JTUA 1F74A 1UIPA 3N2TA 1S5TA 2Y88A 3NZPA 1A5CA 3V36A 5ABTA 3PG8A 2BP1A 4R53A 4FOKA 5C6MA 5J8LA 1PWLA 2ZXBA 1YIXA 3BOLA 3DG3A 4WKFA 2V2HA 4K7VA 4AXKA 1PV8A 1B31A 2X09A 3WZ0E 2HE5A 2QV5A 3Q2DA 1E51A 1PTAA 3R2GA 4LS2A 4JAWA 3WKZA 3TN4A 3QV9A 3WNMA 2QIIA 5ECUA 4C7GA 1EUNA 3GWQA 4AD2A 4OVXA 3GSMA 3G1FA 3P60A 4JFTA 2VC6A 3IVTA 3CUJA 6XIMA 1EUAA 3IWPA 4L4PA 3I3EA 1XLAA 1VFHA 4CVUA 4Z2HA 3DENA 3UW6A 1HG3A 2DQWA 1JF6A 1JF5A 3GXIA 4MHBA 2FHFA 3ABRA 1R8LA 1UA3A 3U6WA 8CGTA 1NP2A 3G1AA 1W32A 2Z7KA 4LXFA 3WY1A 3R0UA 1X6NA 1U1UA 1RALA 1F6KA 4GNJA 4DPPA 3T2PA 3UQNA 4HPGA 4JYEA 1D3HA 2CBUA 3BCFA 3HGSA 4E6MA 4HZ7A 1LWIA 2DZVA 3CV6A 4MYAA 3G1VA 2EKCA 3GNRA 1K1DA 1UD4A 2OWXA 4MWAB 3QMTA 1A5NC 2PDHA 4PB5A 3UFYA 1VS1A 4QJ1A 4DLMA 5TBOA 1FWNA 4TV6A 1PBGA 2QDGA 4MZ1A 5KMYA 4CNNA 4IP7A 4JN6A 3L67A 1TMQA 4UFMA 3URAA 1KFCA 5FKYA 1DXEA 3WQ4A 3O15A 2A6LA 4W5UA 2ODOA 4FNRA 3K5XA 3WH5A 2VVSA 4UMAA 3KBMA 4XAGA 3EX2A 4XIMA 1VBHA 1F05A 3HGOA 1VBUA 1JI2A 2I7GA 2VX4A 3CHCA 3WF4A 2DIEA 2O92A 4YIWA 4KFNA 3TJXA 3GG8A 3ZR4A 2CZVA 5HATA 2WHKA 4FI4A 1U30A 2XFRA 1MXDA 4DIAA 1OQFA 3GBEA 2DPEA 3JU2A 2YCEA 2FPTA 3NGJA 5IBXA 1V02E 3STFA 1QW7A 3H12A 2ZICA 1X1ZA 2X42A 1UD3A 3E0IA 3BJSA 3NQ8A 5MF5A 4HNVA 2PGRA 1RQEA 2ESCA 5JQ9A 1T8XA 4G1NA 2PURA 3LNMA 3N14A 2E40A 1JI1A 3N2XA 2PWDA 3DFYA 3VIMA 3W2JA 3DBPA 2WVVB 1SSGA 3WBEA 1RPKA 1FA2A 2QGYA 1HJXA 3LHZA 5FJUA 2Z27A 3AIBA 1H49A 1OGSA 3M7SA 5HOSA 2OVLA 2R1KA 1B5TA 2PD5A 3BMVA 4FPSA 1EL3A 3UJEA 5D04C 3OBKA 4YTQA 2R1MA 4CD5A 1GQKA 3C61A 1QT1A 3BLKA 2B31A 4MJZA 2YJQA 3ZFHA 4KF1A 1OIFA 3I65A 3AHVA 1XSKA 1QPKA 4S23A 4NKCA 3WEMA 4REQA 3HQPA 4RE0A 4P8VA 1J6PA 4DBWA 3QR0A 3KRBA 2ISVA 3LBMA 3K8KA 1CIUA 2JF6A 4GY1A 3DUGA 4J3TA 1JPKA 2YYTA 4H04A 2J47A 2XZ7A 4Z1CA 2R6OA 3W7QA 3CHFA 2DUZA 3B8WA 3NDYA 5D2XA 2Y0FA 1NQ6A 4LW7A 4NRRA 1UROA 2PI6A 3IANA 3NPVA 3V35A 1SVDA 1TYGA 4GPNA 3C0LA 2WNZA 3SUUA 1GG1A 1QPNA 4HGXA 4UMBA 3H4GA 1NAL1 3M4HA 2YL6A 2A1YA 2A5HA 3EGJA 1BPLB 3HOJA 2GL5A 2OEJA 5DT5A 4L6OA 3MSYA 2WC4A 1N7KA 1Q6EA 4KEZA 1G7UA 2WSRA 3PBMA 2YA2A 1P0KA 2VFHA 1EC7A 4MY8A 3K4AA 1AH3A 3H2EA 1E4IA 2P0IA 4MLJA 5EMYA 3MKCA 1KFKA 1GZGA 4PTDA 3ICJA 3ZSSA 3TDFA 4L80A 2C71A 4GVIA 4DWSC 1E56A 3TXVA 5I3JA 1K8YA 1W5QA 2WSQA 1NVMA 1ZGDA 1BXCA 3E2VA 6REQA 2OQHA 2BVYA 2BOFX 3GC2A 4TXEA 4DJED 1DBTA 1IT7A 3KAOA 2QVNA 3C52A 1BGGA 1P43A 3VIJA 2J6VA 3UA3A 3W7KA 4YTSA 4I3GA 1ISWA 1GTEA 2XH2A 4Z2IA 4J3VA 4IMCA 1JEZA 1OY0A 2YA1A 3NEHA 1V6UA 1S5WA 5FEWA 4LF1A 2PLCA 5D2TA 3TTEA 1S5VA 3TTSA 4JL1A 2P3ZA 1I8JA 3ZVHB 5A2BA 3WBAA 1AQMA 5D05A 4I9JA 4MKVA 5BROA 3S47A 1BYCA 1P0DA 1PDYA 1GGOA 2XIJA 2Q01A 2RH9A 1QNSA 1WYIA 2R14A 4RPQA 4Q4RA 2YA0A 4UR9A 4DO4A 4RZ6A 3GTIA 4NASA 2OGYA 1C7SA 1TWSA 1IXOA 4BHYA 3WYZA 1IXQA 2IQ0A 3TNBA 4XD6A 4AF0B 2X2GA 3W7LA 2O56A 1NFBA 5XIAA 3AMLA 2CESA 1PZ1A 1KKOA 4P2VA 5C8BB 2WMKA 3SQLA 2G4JA 1V6XA 3NL6A 3ZJ7A 4DI9A 1K7EA 3KP1A 4CN6A 4JQ1A 3ZWTA 3NZRA 3UR7A 3V16A 3MP4A 4EWND 4M1BA 3RILA 3W76A 3ZJ6A 1LYXA 1LQ2A 4HMNA 4J5NA 4XUGA 1SMAA 4GI6A 3KL3A 2JKEA 3DC0A 1LWHA 4CNSA 3MWCA 3H21A 1E1FA 5H1WA 3TQPA 1ZALA 2QCLA 1XLGA 1EB3A 4WKAA 3QW3A 1CBGA 1N2VA 4FXSA 1IYXA 3EMZA 3E38A 2PGEA 1L8NA 3CXOA 5I2UA 2R94A 3UA4A 1SW0A 1KKRA 1ZP4A 3WUBA 5HWNA 1XQLA 5HMFA 2PMQA 1A5OC 4S39A 3MP3A 4IF2A 3UWUA 2JGQA 3ABZA 4Y9AA 1Y65A 3NQVA 3B8VA 1LL6A 1XIFA 1BEUA 1FVPA 4HNOA 2C14A 4KWVA 3TQVA 3W70A 1R38A 1RVKA 4XBSA 1GW1A 2PDXA 4FNUA 2G3NA 1I1XA 4KT2A 4PSRA 1JCLA 3RU6A 2BHUA 2J66A 3EPOA 5D9PA 4MJ4A 2FZBA 2WK2A 4AVNA 3OGRA 2HE8A 4Q7IA 3HIJA 3W2KA 3LXCA 3R12A 4L9YA 4G7EA 4GZEA 3ARYA 3AZTA 5CAKA 3W28A 2PS2A 1XCFA 3FEQA 4HK7A 5A69A 1LM1A 3C2RA 4Z2GA 3THQA 2Q09A 3GDBA 3SM0A 4B5UA 2VZSA 4GIYA 1KFEA 4M82A 1C8YA 4B4HA 1EA0A 1KRAC 2YDQA 1H7RA 4ILSA 3LCIA 3ID7A 4QISA 4QM1A 2PWEA 1XLFA 1FP8A 1Y7VA 1THFD 3QVQA 1E6SM 1UMLA 1X97A 2YCIX 3FXYA 4D1JA 4XVEA 1MVYA 1U83A 4I9TA 1KBJA 4R85A 5I03A 1JCJA 5L6UA 3QZEA 4NYYA 4UQ9A 4PC8A 4GX9A 1GOKA 2WSKA 4PBEA 5BU6A 4MY1A 1NF0A 1KV5A 3GHUA 4JOMA 5A94A 2A7PA 3B9EA 3O16A 3FA3A 5TIMA 4TMCA 2J79A 1O5KA 4L5ZA 5EBUA 1FWWA 1TPDA 3BANA 1KXHA 1LLOA 4NZ3A 4H6RA 3KE0A 3S1UA 2A79A 1WXYA 5D32A 2DIJA 2D0FA 4HK5A 1VBGA 3UY8A 2GJLA 2CHRA 1AMYA 1JAEA 3G77A 3DDMA 3DU0A 3CZGA 3ATZA 3S5OA 1CGWA 1US3A 4PFHA 1XL9A 3T0DA 2AQVA 5C2CA 3GR7A 2G41A 4IFRA 4Q8OA 4ASTA 3VOFA 2VQUA 1CI1A 1GTHA 3GW3A 1R9YA 3CLMA 1QK0A 4HMCA 5CXPA 4ZTXA 1TMHA 3T78A 5EA9A 1XFBA 1OCBA 1W1ZA 3DBNA 2ZXAA 2BSLA 1E1CA 5D8WA 1YX1A 5A2AA 1WBHA 1NM9A 4CVWA 2D2JA 3LGDA 3C2EA 1IT0A 3U2CA 5DX7A 4GGBA 3IVSA 2OELA 3GU2A 3SQMA 1LG2A 3A23A 3AHYA 3K46A 1MNZA 5FCZA 1HO4A 1GHSA 3LQLA 2FFIA 4XUYA 4Z1YA 3L5LA 5DEZA 1QTWA 3NQ2A 4LAZA 3V4BA 2ZZ2A 3QRHA 3C3NA 4XAZA 2XG9A 3SN1A 4CD7A 3GVVA 4MWAD 4NX5A 3RF9A 5HDRA 1L6SA 3JVAA 1IXPA 5BZAA 3WELA 1JJKA 2AGTA 1S2UA 1LCOA 2ZC1A 2Z1SA 3VOHA 1ZAIA 4Y9PA 3WENA 3ZJKA 3IIVA 2QJNA 3ME3A 2JKPA 4LRTA 3SGGA 3IUHA 3RLHA 1XGEA 2GDVA 4C7DA 3G2GA 3PY2A 1LL7A 4N42A 1OBAA 3GH5A 2QCMA 4CUCA 2HK1A 2E6AA 3DYOA 1GYMA 3P8JA 7A3HA 4QFUA 4JX4A 1KTBA 1HKKA 2XISA 4J3SA 3P14A 2GJNA 2V9DA 4F2TA 2PTXA 1ZBKA 3S2LA 2BOGX 3A9BA 2HNEA 1HJWA 4MZYA 5JIWA 1SO6A 2A3BA 4GJJA 4BWLA 3CT2A 2E1DA 3S5SA 3MCOA 4WDTA 3WDPP 4XX6A 3LRLA 4ACYA 4NILA 1XP3A 1F3EA 1SJAA 2REQB 4GQRA 4AD1A 3PPFA 1O66A 1R7OA 3WLJA 3LHUA 2DSKA 2CBIA 5DMLA 5FEXA 5A6BD 4K1GA 2VGFA 1BWKA 5CEWA 2RJHA 5IFTA 1HF6A 2R9RA 4LC8A 4WSKA 4NZ4A 3WF1A 3URBA 3QR3A 1EBHA 3R94A 4W7VA 3S83A 3CWNA 1J79A 1ZB5A 2VO5A 1EDTA 2BGSA 4RJEA 4OV4A 4GYKA 2CZ5A 3WH9A 1PYMA 2GOUA 4XZ9A 4O16A 3VDCA 1G0CA 2FZNA 2JEPA 3MCMA 4P8WA 4G8TA 4GIRA 1VF8A 4W93A 2Y62A 1GHRA 1N8WA 3G1XA 5FACA 3W7DA 3VILA 1C8XA 4I7UA 3UNTA 4LWWA 1DV7A 3VMPA 1FHLA 4KFOA 3KDOA 1Y5WA 1UC5A 1HJVA 2INEA 2GK1A 4HMDA 4TU1A 3B04A 1AODA 4JTFA 3SY8A 4ZQCA 4LS0A 3TYCA 5EGRA 4J28A 4JIRA 1TA3B 4GI8A 4UQDA 1MSSA 4GOAA 3E49A 2PDBA 3FN9A 1KGUA 3WLMA 7TIMA 2VEPA 4MKSA 4GIAA 3NCOA 1ITXA 1AW5A 3ALFA 3UJSA 3L4UA 2FPVA 5FIPA 5D02A 3SCUA 1E15A 1MEIA 5L9FA 1GQJA 1S2AA 1GZJA 2PCQA 5H8MA 4HQVA 4XZWA 4P7OA 1G5AA 3RHGA 1CLVA 1LG1A 4CN1A 1G9HA 1RBAA 2A7NA 4IM4A 4BWLC 4R7WA 4PUUA 1M7PA 3H8AA 3O3RA 3W0KA 3RXZA 1JCMP 3KBNA 3W75A 3UP8A 4BI7A 3E0FA 5F7UA 1XI3A 2PTZA 4V27A 4PCPA 2YDRA 2DQXA 3ORWA 3GDLA 1IE7C 3QW4B 1FDJA 1GKRA 4FIQA 1RK6A 4IPIA 1M03A 2PDMA 2EJ1A 4AYSA 1VAHA 1DL3A 5CBIA 2TSYA 1TZ9A 2ZE0A 4XTIA 3TTOA 1ZFJA 4RNHA 5A6JA 1KCZA 4CQAA 3ITLA 1B3XA 5B7ZA 1H11A 3H70A 4AQLA 4DJFD 3AMCA 1Z44A 4Y8FA 4C6LA 3CB3A 1IGSA 4MJMA 3V5CA 1HKIA 2VM8A 3S9YA 3VA8A 1R47A 3IGUA 3VDAA 4S3JA 4CLMA 5M03A 2XSBA 4ML4A 1VEOA 1BVZA 3L4TA 4GBDA 3FDGA 3W7NA 1JD9A 1TR9A 1GW9A 3E0LA 5FJIA 3NFUA 5GNXA 4RXFA 3U8GA 1XLMA 4MNJA 2XHYA 4O1EA 1LJYA 3A13A 5C0QA 2HPMA 4KS0A 4IFKB 4M0XA 3N4FA 1R3SA 2FGLA 1CX9A 1KO0A 4UFHA 3PR2A 2I9UA 1HGYA 2GGJA 3MPGA 3EA1A 4O1FA 1HIZA 1TJ2A 4Q8TA 3IIXA 3VIIA 3VCRA 1UR3M 2X30A 4WF7A 4MNMA 2PDGA 2AL1A 4A3RA 4UTWA 3MKKA 3S4TA 1F9CA 5GNZA 3F4WA 4D6FA 3W2UA 5AC6A 3VKAA 1ME9A 3WLNA 3OP2A 1EH9A 5EL1A 3C5QA 4AC7C 3LI1A 1W5OA 3N18A 1MUMA 2NVAA 4FZIA 1W3LA 1W1TA 3A12A 3DFTA 2Z26A 4ZSUA 3T8QA 1IWAA 4ZBCA 5KZMA 2QNEA 4R9OA 3WEZA 3CZ8A 4IMEA 3W7GA 4ZB5A 4R88A 2X7WA 4A2RA 1Z89A 5AHLA 4HN8A 3O06A 1ZLPA 2FZ9A 3BO9A 3A5FA 3V18A 4RV8A 3RMJA 3Q65A 3XIMA 1DJHA 4F0MA 3LD5A 3WNPA 1OHLA 2FTYA 2YW4A 3L2MA 3HV9A 2A3LA 1KBBA 1F2JA 4W88A 1VPXA 4DF0A 4KEVA 4OE7A 4JTRA 2B7NA 1WPCA 4RDVA 3I10A 3CO8A 5HMDA 4BFAA 4GZ7A 2D24A 2J62A 1KWGA 3NM1A 4AZIA 4ZMGA 2CLIA 3NWRA 2P8CA 4HJWA 1DHPA 4OV9A 2CLMA 3OGVA 3SSJA 3S5ZA 4N9EA 3BAYA 1WDWA 3KWXA 1KM1A 4LS1A 3Q37A 5DMMA 5U4NA 4ERAA 4BF7A 2Z1VA 4DBDA 1KR0A 3U7VA 2BGQA 1KM3A 1YXYA 1KB3A 3UJFA 3ZS4A 1M01A 3AYRA 1V51A 4UTWC 3QTPA 4EPBC 4MF4A 1I2OA 3PK7A 2GGEA 3VM5A 1O5RA 3WLSA 5FF0A 2CYGA 3H4XA 3AZSA 3H7UA 3I4EA 4M81A 3RJYA 3RLUA 4AWUA 4H9MA 2QYGA 3IK2A 1FDZA 2J8TA 5FA5A 1HTIA 4JTLA 3LPGA 2IQTA 3E74A 1G4EA 1HW6A 5HANA 1EP1A 1JDCA 1IEXA 2V5KA 2E6DA 3E2SA 3F5KA 3N9KA 1HX0A 4JTQA 4QE1A 1TZ7A 2Y63A 4JDYA 2DZBA 4W85A 2HBXA 3AJ7A 2IS7A 1DQXA 4Z08A 4K8HA 1BYDA 4S3FA 2YZRA 1ALDA 4ROPA 4W86A 2YW3A 4ES4A 3K2GA 4G56A 2WJDA 1I75A 4HCDA 2V38A 3UG3A 4GQBA 3L4XA 5KTLA 1RD6A 3KOFA 5CZSA 3P93A 3NQ7A 3WH8A 2EPOA 1QDSA 2WHLA 1QVBA 4JHMA 1GK8A 3B03A 4XB3A 2XFFA 3UPWA 3NZGA 2PWUA 1P6WA 1H7NA 1GWJA 4XO6A 4GUGA 2WPGA 5M3WA 2BY3A 3LTSA 1E6NA 3ITOA 3F4VA 3LU2A 4PTNA 3TW6A 4IGMA 1V02A 1DYSA 3H26A 4B9YA 1TB3A 3BAIA 5DCDA 3EKGA 1VR6A 1KLYA 3DYPA 3AUJA 1UR1A 3CL7A 3FVMA 4M6UA 1F6PA 4MAVA 3UWZA 1YDYA 1IEVA 2C13A 5BRQA 3EKLA 5A8MA 3CUXA 4ZQNA 3RUBL 2OSWA 5AC8A 1WA3A 4UIOA 1F8IA 5FESA 2WCGA 3DCPA 1WUFA 3TJ4A 3N13A 3O9NA 4U31A 1OX5A 1KV8A 1R6WA 1K7XA 1ITUA 3LZ3A 3W29A 3MZ2A 1X98A 4LUSA 2WXDM 4MB4A 4LYRA 3FSUA 1GUVA 3CQKA 1ITCA 1WAUA 1WDPA 2QLYA 2RHGA 3WQ5A 3NZQA 2VRJA 2RGLA 4R5EA 3UZZA 1A5KC 1UA7A 3BLIA 2I16A 2QJJA 1Q65A 3GIQA 2YLAA 1GJPA 3RPMA 2EPNA 1EX1A 4NZCA 5JIPA 3UD6A 4UCGA 1WOAA 3OG3A 3LS9A 3Q58A 1CB2A 2EBNA 1TPEA 3L68A 4MIMA 4JTAA 1JCTA 4IPLA 4JXCA 3DEQA 4Q4KA 1NDVA 3GKFA 3GIYA 1M7JA 3E0VA 4LQ1A 4QLKA 1LRNA 1ZPTA 4JD4A 4OJYA 2HWGA 1G94A 4D6EA 4M6VA 2WMIA 6REQB 4JEJA 4E0CA 3G8RA 5LNUA 4C5ZA 2BVTA 1A49A 4EIVA 4LVFA 1KM2A 3KOXA 4H7ZA 2C1IA 3GZ3A 1V77A 3AAMA 3SW6A 2VZVA 2BS9A 2R82A 5G1TA 4E4UA 1CDGA 1BAGA 3S1WA 4KCTA 5LIYX 1TV3A 5J5RA 3VNJA 1VIZA 1X6LA 4F66A 1UKTA 3PAJA 4F3HA 2ZTKA 1UQZA 4TO8A 4J2MA 4PL2A 4XBJA 3TCSA 1Q4NX 3VFLA 2FYMA 1OJXA 4O10A 4PCFA 1JR1A 1H0GA 1X1OA 4N9DA 1YW1A 3U5UA 2I56A 2J8GA 2QCHA 1JNDA 3V0TA 4INFA 3CTTA 3C8NA 3WF0A 3N4AA 4H9ZA 1E0TA 3MS8A 3BG5A 2PC4A 3UZXA 3AYSA 1P0BA 5KZEA 4B16A 3VIPA 3FCPA 4PRWA 5FSEC 4WDWA 4V1XA 1I60A 5HBFA 2WBGA 1FH8A 3W9ZA 1X7IA 3M46A 4GFSA 4L64A 3OU8A 4AAJA 1C92A 2DSUA 4LNCA 3VNYA 4QR6A 2QCDA 2PWFA 1KFJA 3HG2A 3M9YA 2X0SA 1IT8A 4LOCA 1V6WA 4UOJA 1U1HA 5H91A 3W6YA 1W56A 1VFOA 3TKFA 2Z2AA 3CNYA 4Q8QA 2E5BA 3RIKA 3U4FA 4O0ZA 3GW0A 2J9XA 5G2IA 3IGSA 5FJJA 3EWYA 5CLWA 2WW5A 4WJXA 2ZKMX 2O0TA 4GIEA 4NI3A 4PUDA 2WB5A 3IIPA 3OLGA 1TIWA 3KBJA 5DF0A 4Z2LA 3F4NA 1DWAM 2CZFA 4BK9A 4US5A 3UCDA 3SJ3A 5G4HC 3ARXA 1UP0A 3JW7A 1UUQA 3ITTA 3GXMA 2G3FA 3LRKA 3R43A 4HKPA 1J12A 1JXKA 1AD4A 1GOIA 1ZJIA 1WKFA 4A35A 5BNKA 4BI6A 1BKSA 1VCGA 1JUKA 2J13A 4AWSA 3UJ2A 1E40A 2DH2A 1V3KA 3K8LA 1TV7A 1ZJBA 1ADSA 3MB9A 3QY8A 3GVWA 5GQBA 2YGYA 3MHFA 2O55A 4C6EA 4IIGA 5LXXA 4KCUA 5HR7A 4K3ZA 2WLZA 4AH7A 1FY6A 4OUEA 3EMQA 4EF9A 4ACZA 1YBQB 3B4YA 4RKAA 5LGZA 1FH9A 1C91A 3NXLA 1YTKA 2J7FA 5I77A 4WJEA 1JDAA 3WDHA 1AMKA 3Q94A 1UKOA 3O63A 5JVLA 2A2IA 4XKMA 1V6TA 4GXMA 2ZZ4A 1KGXA 4MDOA 5LHFA 3IPWA 2AKMA 1R2RA 1OZQA 3LMZA 4IIHA 3R4IA 4NNAA 3M0LA 3PSVA 4AU0A 4DO7A 2VMFA 5ABGA 3FNDA 1K77A 2OOGA 5C5YA 2CKSA 2Q02A 2WC7A 2WO5A 4JHOA 1V93A 4CQDA 4FX6M 4JCLA 1HKJA 3M5XA 5TQLA 1XR2A 2IXVA 1TSIA 4J40A 1DIOA 3W4RA 1R3QA 1VFSA 2I1OA 1TPH1 5KZ6A 4RE4A 3MBDA 2W6RA 1FWTA 1O95A 3M1ZA 3WMSA 4D6GA 4HSOA 4ZSTA 1EYWA 1T7LA 2X1IA 2XFYA 1CZ1A 2WCSA 1EPVA 3S2JA 3TW7A 1RAKA 1BKHA 2JIWA 3UWYA 3KRSA 3L66A 1XYZA 3EPNA 4TUFA 2EG8A 4BZYA 3FOKA 1LLWA 3M5VA 3GRIA 1O68A 4ENLA 3UXKA 1J9YA 2R1NA 4CU8A 1VFFA 4FXJA 2O7SA 2WMHA 3SRHA 1G01A 3PP7A 3QLDA 3PTMA 4WSHA 3TTQA 3QYSA 4OT7A 1XIMA 2YBUA 3TA6A 6XIAA 2YPIA 2E4TA 4FB7A 4MG4A 4O57A 1PIGA 5AHIA 1HL9A 4KEUA 4V15A 4DZAA 4GQ0A 1D2KA 5D2WA 1W2VA 2UWFA 3W2MA 3GHRA 1UWUA 1ZTVA 1BGAA 3ARZA 4IIEA 4Y96A 3KUMA 1AW1A 1JXJA 3H55A 1TPB1 1GCYA 4OBTA 2Z29A 2YXOA 3VD3A 1DJQA 1YNPA 2DZUA 1LT8A 5A8GA 3TAOA 1JUEA 3MMTA 4O8AA 4IHCA 4S3AA 4OQVA 2CLKA 3PB0A 4JL2A 1E1CB 2OTDA 3LGGA 2WQPA 3VYLA 2GDUA 4JTEA 3GAKA 3ZIZA 3BSMA 4PMXA 4KCVA 4AMAA 2JIEA 2DU2A 2PU1A 3DECA 3QOKA 3G6MA 1JYXA 2PDIA 4ZOEA 4XTDA 4AD5A 5A6SA 3W22A 3UWVA 1OFPA 5HMSA 2ACRA 1GQIA 4PRTA 3G18A 3AS2A 3CPGA 1UKQA 1NDZA 4C6IA 3W73A 2P10A 4LUYA 5HAOA 5A8OA 2WVTA 5E1QA 4WDXA 3LPFA 3UPMA 3CL6A 3EWXA 5EBAA 4J3UA 4NT0A 2I5GA 1SZNA 4FNTA 1VJSA 1DJZA 3BDKA 2OPJA 3VD7A 5CC5A 2GSJA 3MTWA 1I6NA 3WFLA 2R1PA 4QEHA 4MWAA 2YR1A 4UBPC 4A3HA 5H8PA 2WHJA 2XFWA 1UR9A 2UV8G 1MW0A 4IQJA 3CYVA 4E2OA 3PZIA 5IHRA 1V8EA 1O1HA 4OKDA 3UXLA 4HCHA 3AYVA 3UXDA 3N2CA 3MUZ1 2YL8A 4RNFA 5K9CA 5JUVA 2FJUB 3DHPA 3CAWA 3VMNA 2PB1A 1ZU8A 1XXXA 4M1RA 1AG1O 1YLVA 1M3UA 2VRQA 3A4WA 4F8XA 3LHYA 3QHOA 4JZ5A 3RN6A 1CGXA 4PMRA 3U5YA 2CIPA 1CGVA 5BMWA 1LOSA 3FIGA 4URIA 1JFXA 5HQMA 3BGJA 1FWRA 4RNIA 4GUHA 2X2YA 5HPOA 1V79A 2XGBA 4FSAA 1JAKA 2ZRXA 1P5BA 2B7OA 4U5IA 1MNSA 4L56A 3BAJA 1E4NA 4C6PA 2Y7DA 4XQ6A 5A6BA 3TN3A 3B8IA 4IZGA 1OC5A 1SGJA 2JEQA 4O1DA 1DWJM 3WF3A 1E6RA 4PMVA 5K3VA 1PX8A 1E0XA 3F4DA 1TPC1 1WZLA 1E3ZA 4NNCA 3ZT7A 2CZDA 2V3EA 3N6JA 3JUGA 2BVDA 3B06A 1CPUA 4MY9A 4WVXA 3UWEA 3MYOA 4HU8A 3JR2A 3MHGA 5F2IA 2GZXA 2UBPC 3BCDA 1XG3A 3EDKA 1QW8A 3DI1A 4O17A 1OC6A 4AY1A 5FAGA 5JBFA 3G0UA 1CW2A 3PAOA 2PDFA 1D7KA 2HNHA 4JGDA 1AH0A 1TVNA 2ONEA 1OCJA 5IOBA 3E02A 3IJ6A 5CAHA 4TIMA 1XDMA 2OWWA 4H6QA 5LKYA 5C9RA 5EMLA 2Y7GA 3HMJG 1GVOA 4MWAC 2FH8A 3FX4A 3LA4A 9CGTA 2CWNA 1IXNA 4DYKA 3VGEA 6TAAA 3M47A 3O07A 3W00A 1R46A 1XS2A 3YPIA 3LCXA 2OLAA 1XGZA 1R5YA 3NG3A 2DUAA 4UFKA 4XIAA 3EDFA 2JALA 4UTFA 6CGTA 2E3ZA 1T99A 4JYFA 1CXIA 2ZUNA 1VFLA 3MUY1 4XZIA 2CNCA 1KNWA 3H24A 2Y1HA 3UCCA 1BYAA 3ITXA 3PB2A 4OHQA 4LVBA 3U3HA 4AHOA 4P7RA 2PU0A 3HZ3A 2D3LA 5CGMA 2VX6A 4Z42C 3OHIA 3KTCA 3C0QA 4NI8A 4E2VA 4FALA 1ZZMA 4S2CA 3VTRA 2FZ8A 1EJTC 4O1AA 2WLYA 3WLPA 5BRPA 1WNOA 1ONWA 2HS6A 2G37A 3TOYA 6TIMA 4M5PA 1V7AA 1RQBA 2R8WA 2MANA 4ICMA 1NOFA 3UWQA 4FLOA 3WG6A 3P5ZA 4ZL1A 1Q5MA 2X8RA 1M1BA 1FHUA 1VHNA 5F2GA 4RZ5A 2JQXA 5I06A 3EEGA 1C8QA 1ZHAA 2BTMA 3TYAA 1SJCA 3CUFA 3NVDA 2OLHA 4QRNA 1K3UA 3ZVHA 1R3WA 2CBJA 4W7UA 1ZAHA 4YHGA 3NGFA 3APGA 4KKXA 3HGJA 1F3XA 2ZFAA 1DWGM 2IUZA 3ANUA 4RR4A 1HKMA 1HKWA 1WOBA 4LFYA 1B9BA 5HQLA 2P5NA 1E4MM 1DOSA 1KQYA 1V5XA 3EZ4A 4N6EA 3A5VA 2X1UA 2DDXA 4QAWA 2EO7A 4QAIA 5EFFA 3MDWA 1E9ZB 4LEQA 2Z24A 3SJNA 2WVUA 1BG9A 4JY8A 5PTDA 3G1DA 2NUYA 4WY0F 3AISA 4WJ8A 3TUUA 3XISA 4HNCA 1EOMA 4P5UA 1S3HA 3I3DA 5AC4A 3UR2A 1VLWA 5E0FA 1OSEA 4GQQA 4H00A 1JRCA 2OGJA 4CCCA 3NQDA 4C6BA 1OINA 3G5EA 4GY7A 4WY0B 5CG0A 2WM1A 5GVJA 1Q8JA 1HGWA 1EDGA 2J7EA 4MB5A 3QPZA 3WEOA 3M0ZA 1US0A 4ZXLA 4A8RA 2E9LA 4U3CA 4C6NA 3G1HA 3QMSA 3IJIA 1NFGA 4G2DA 5LHEA 2WPBA 4C65A 3AHXA 4J3ZA 1J0IA 4E8CA 1WQ5A 1ZRQA 3AMGA 3CS2A 1TVPA 1MQRA 1DIDA 3LRMA 5I02A 5FF7A 1KCLA 4ZFMA 4KERA 4HPXA 2D2HA 5FJRA 4C1KA 3BG3A 1GQNA 4XAFA 3L0NA 5MKGA 2NXIA 1E1EA 3SRDA 4MB3A 2QT3A 3C86A 3NQEA 1EEXA 5DBTA 4K36A 4QX4A 5IDZA 2G3MA 3LSCA 4OWGA 3KOZA 1C9WA 3G3MA 3W53A 3MMDA 5F2LA 1CGUA 3PBGA 3GDMA 2H9AA 4J9JA 2NT0A 3QH2A 3ZYZA 4CNOA 5J5DA 3NO5A 4CNUA 1FRBA 2NZLA 2V67A 2NUWA 2FZMA 1Q8AA 4M8UA 1GORA 3NNTA 3A3XA 5D03A 1TE1A 3WNNA 2OSYA 4LY4A 1AL7A 4GYPA 3UU0A 2A3HA 3HPAA 1JYVA 1AJ2A 3M0JA 1PHQA 2OX4A 1KFBA 3PZ9A 2J75A 1S39A 3O0KA 1UB3A 4QQ3A 4DELA 5M2FX 4QS6A 2XIIA 2V82A 2O4MA 4JX6A 1RCXB 3WQVA 1TR1A 1B0IA 3EBVA 1H63A 1YPXA 2BXYA 5IHSA 4FR1A 1V3IA 4Z2JA 4DX3A 2X7VA 1MDLA 3VGGA 4N4QA 1XYLA 1QUMA 4ZTYA 2PDJA 1ZAJA 2IXUA 4TVDA 4GVFA 5LGXA 4KEMA 1J4EA 3VOCA 1KBIA 2JBMA 8TIMA 2YCJA 4JEQA 8A3HA 1RUSA 4MKNA 3STEA 3VIKA 1GPFA 3MANA 3VNIA 2DVUA 1TPWA 5E6YA 1AQFA 2W91A 3EKZA 1PKLA 2PTWA 4RDYA 1J2BA 1QFEA 3ELFA 3FJLA 3WLIA 3N29A 2VFIA 3QTGA 5DLCA 1RP8A 3KP0A 4I7WA 1QU4A 1QPQA 4NU7A 1A4MA 1D7FA 1GEHA 5FL0A 1E5NA 1L2QA 5LXEA 3VGFA 2FDSA 2GJXA 2X41A 1N8IA 4GI9A 3GU9A 5CGTA 3WD1A 4RW5A 5FF2A 3BOXA 3R79A 1R2TA 2O9TA 4POCA 3Q45A 3VE9A 4BQ2A 1UG6A 3U9IA 2WZMA 4GYPC 4C6JA 1SZEA 1R3YA 3GG0A 3EA2A 1YNQA 1W6TA 4IMFA 2B0MA 4Z17A 4Q6JA 4O11A 4YTTA 3P62A 1DHKA 2GVYA 2DGAA 2V5LA 3L9CA 1CXLA 4LAMA 2ZUSA 1ADOA 2QS8A 1P1MA 3T7VA 3H4WA 3NO1A 2QJIA 1TRIA 1TZZA 1A5MC 4AIEA 4FNQA 1VPQA 4PTXA 4ZFCA 1TWZA 1H1NA 4IX0A 1AD1A 3BMXA 2RFGA 4LUSB 3WD0A 5BCAA 1BF6A 3M0VA 1BXBA 3LUTA 3AI0A 4EKJA 1K9TA 2H8ZA 4QNEA 3IJLA 5DXXA 2OYMA 3FKKA 1PWMA 1JDFA 4GO9A 2VFDA 1TWIA 1RA0A 4ZENA 3EAUA 3TZNA 1B3VA 5BXTA 2W92A 1V0LA 1W1VA 3R0DA 2BY2A 3CTLA 3STGA 2D0GA 3C8FA 3IARA 4LV9A 4UQCA 1PTDA 4IGSA 4XG1A 3R1ZA 4ML9A 3TNOA 1CTNA 2DY3A 3WMBA 4D9PA 5F1UA 1XPYA 4AWEA 3RITA 3OIXA 3QC0A 1A5LC 4R7JA 1JNEA 2J7DA 2WMIB 1G4PA 2DP3A 4AZGA 3N4EA 3PZUA 1XYMA 2BHYA 1I0BA 1NIUA 4PUJA 1VB9A 4M6QA 5AKQA 5A6AA 2OQYA 3G22A 3W82A 5CBJA 1SW7A 2PBGA 3HPZA 4X22A 1Y8BA 5SWUA 4PFMA 7PTDA 4KETA 2DSWA 4ZEPA 1QO2A 3THDA 3T07A 4ICCX 4LPCA 1H1ZA 2OX1A 5C9UA 4I6KA 4BF5A 3O6AA 3RPDA 2NXHA 3K30A 1E6ZA 4W89A 3C2YA 4KIRA 3REQA 3GX9A 3KHJA 4XZLX 5E93A 3WDRA 3C3UA 1I2NA 4UTUA 1EQCA 4NVTA 4BCEA 3V5FA 1FCVA 4M80A 4LVGA 1XG4A 3I7SA 3BAWA 4G1KA 4JFWA 2OZ0A 1L9WA 4KWWA 2XSXA 3IUIA 1XH1A 1M7OA 1CLKA 4AY8A 2YX0A 3ZM8A 3HGRA 5F2MA 3MDUA 1Z41A 2FFCA 2NSOA 4R33A 4O4WA 2C1GA 2WV8A 4AEOA 4YNGA 1UH3A 5DELA 3PVFA 4YYFA 4WOZA 2X1RA 3BSGA 3PUGA 4MUZA 1Z48A 2C18A 4H01A 3NTYA 3N9RA 4O8RA 3V3WA 3SUVA 5JXQA 1JL8A 4NNBA 2GWGA 2EEXA 4PEEA 4QJ5B 3B9OA 1TA3A 1XIHA 3OG2A 3RG6A 4KGJA 1WXZA 4WD0A 3ZR5A 1DP0A 1TTQA 2OZ3A 3T0AA 3I6EA 4C90A 4CCEA 4P7LA 4GCXA 3S2MA 4WXZA 2PPGA 3AIVA 3URNA 2VZOA 1PKYA 1Q66A 4ZE5A 1TJ1A 3PTQA 1XRVA 3IVUA 1SJBA 2GFTA 3TK7A 4F2UA 3MKVA 3OZPA 1PTGA 2BXZA 4IOTA 3HF3A 2VOTA 1OF8A 4HOXA 1R3RA 5CSSA 3NR0A 3UYCA 5CPTA 4PMJA 3OVPA 1QI0A 2OWCA 1Q6FA 5I3GA 1UD2A 4DBEA 3K13A 2VWTA 3RM8A 4UTKA 3T4WA 2EKGA 3W85A 1NOUA 2QPXA 1IZKA 3F2DA 3SO7A 3HURA 3LOTA 3E3HA 2W5FA 4C60A 1JRBA 3R8HA 1PUDA 1UBPC 4ACZB 4J4KA 3G1SA 4DHGA 1J01A 4FMVA 4YCOA 1J0ZA 3CUHA 3EOLA 3FA5A 4HN4A 4YL2A 3RX4A 2J27A 4GE8A 3C2VA 3MVIA 3DG7A 2WKGA 1EJXC 4DXKA 4O12A 1AJ0A 1I0DA 4UFIA 2Q8ZA 3QZ6A 2CLOA 3LPPA 2BOEX 4UFJA 1FWAC 1XKYA 2DZSA 3BZJA 2DH3A 2J4GA 4EPEC 4IWWA 4EP8C 3LN3A 3GTFA 2QJGA 4MMWA 4CQCA 3OPSA 4AIOA 3VAVA 5B80A 3E12A 1CXEA 3QQ1A 1GOXA 4K39A 3TYEA 1HQTA 2VOMA 4NY2A 4WGHA 3QQ0A 3T2QA 1JG9A 1DXIA 2NXGA 1VCVA 2YB1A 4PMOA 3SCSA 1MFUA 1S2CA 1EHAA 3QGVA 3EA3A 5DRIA 5BOFA 4E8DA 1AZ2A 5A95A 2B7QA 4K68A 4NUWA 1RY0A 4GGHA 5G2HA 3WLKX 3DG6A 5KSWA 2VEMA 3K4WA 3D46A 5AZ0A 2QUTA 3IK4A 3VE7A 2IPWA 1A0CA 1Z7AA 4OBSA 3GDTA 3GXFA 4JTKA 4H6EA 1XC4A 3L2LA 4M3PA 4LCQA 3N11A 3VX1A 3TROA 5AYBA 4L61A 3GBDA 2UY2A 3GVQA 3HFYA 4ATLA 2F7FA 3IIZA 4PMNA 2FDMA 1EFZA 4AZHA 1DXFA 1HVQA 3GB6A 3EWBX 3C0JA 1EOKA 4LTSA 2E6YA 3A9IA 4JHZA 1OB0A 2OU4A 2XWDA 3ZR6A 4ZO7A 4FEZA 5EKYA 4RUBA 4F0KA 1OM0A 1KXQA 3ANYA 3M41A 2AQOA 1I4NA 1D3GA 5D9NA 1VKFA 4DWDA 3W1LA 1SZGA 1QWGA 2OODA 1W3NA 4Z1BA 3TC7A 1IZJA 2H3BA 3AYTA 3BZGA 5EFDA 3QM3A 2A6NA 4IL2A 3NPWA 1MRQA 4EF8A 5HUOA 3RX2A 1V0MA 4L6HA 2Y5EA 3BMWA 3E2RA 2WSPA 3PWGA 5D2VA 4JQ2A 2DFAA 2WZEA 3VX0A 3G1RA 2Z1XA 2DT2A 3GHTA 3N17A 3ONBA 4AZCA 4JX5A 4ZOCA 1VGAA 1W17A 3RRAA 2NT1A 5BXRA 2ZTJA 3V1PA 1ZENA 3TFCA 2ALRA 4ALDA 3NQMA 4HZ6A 1VFTA 4HZMA 2Q8XA 1U2YA 3TAKA 3BG9A 3TVAA 3FHQA 4AIUA 3GVRA 2XM2A 2DZTA 1O4UA 3AQUA 2ACQA 1CXHA 3VOIA 1V3HA 2YDAA 3LCFA 3H2FA 4FS9A 1JPIA 3PTKA 1LP6A 2AMXA 4GYJA 1LF1A 4UTLA 3IGXA 1PAMA 3WJXA 1HL2A 5BYWA 2HRWA 1VRDA 2YIHA 1PKNA 3W2LA 3QV7A 2XH4A 4H9XA 3TONA 4QIUA 2D20A 4GUJA 2HV5A 2E68A 3A4XA 2HJPA 3KM8A 4JR5A 4AEFA 1YDVA 3IIOA 3OEXA 2W9MA 4DB7A 2ACSA 2XN2A 3W1RA 1LDCA 3BJTA 1O1ZA 4OIFA 1JGIA 1HZYA 3ES8A 3TYUA 3CUZA 2GQ8A 3B0PA 4DJDA 4DZIA 1G4SA 5GJNA 4LVAA 5JMUA 1LZOA 3GXPA 3QSTA 2DVXA 1KXTA 2VCCA 1AUSL 1QOPA 2ZADA 2PDNA 2Y4SA 2ANUA 1MEHA 4BQ5A 2BVWA 1LRTA 2V0TA 4B5WA 3NL2A 4Y9OA 8XIAA 1JUBA 3CMFA 2X40A 1GOWA 1RP9A 4PMZA 2Z1BA 3S1GA 3FS2A 4A3YA 2XVNA 1W9UA 1E6PA 3TEVA 3W1QA 4IUGA 1MXSA 2VUYA 3E5BA 4D1IA 1QI4A 4Q4MA 3SCOA 2CERA 4DY1A 3N15A 3DIPA 4P7QA 1FCQA 2WKJA 4E38A 1SO5A 2PDUA 3WLQA 1ODZA 3P0WA 3TLQA 3UZJA 4J2PA 3WSUA 4X2RA 1VFUA 1Z8AA 1PXGA 3GIPA 1JVNA 3PBYA 4XO7A 1OT1A 3WLRA 4KWSA 4DM1A 3GD6A 4IIDA 4Q4QA 1U33A 5FJTA 1GOQA 3LQGA 3W38A 3SRFA 4G7FA 3CH0A 3WK0A 1QWKA 5BOOA 2G96A 1H7PA 3BLLA 4GFIA 1K8CA 1O12A 1EIBA 3TN6A 2R91A 4LT9A 2VX5A 3TSBA 1OGBA 2ISFA 2ZQ0A 3WFAA 3HQNA 1MI3A 1Q6DA 2ZX8A 3CMJA 3T42A 4BY3A 3DHDA 1XGDA 4I7VA 3G0XA 1PHWA 3W7CA 4IXHA 1TRDA 1T8QA 4XZHA 2GSHA 1GVYA 1ECEA 4WOQA 4L7ZA 1MFVA 4FF5A 5I7GA 1IR2A 3RM4A 3E96A 3W7MA 2E9BA 3MUIA 1OFEA 1XCWA 4DUOA 4GG9A 1WZKA 3AROA 1TFVA 2PLMA 1DWHM 2XH7A 1YYAA 4ICNA 2WOQA 3VK5A 4XBKA 1ECQA 2KX9A 4AZ5A 3OA5A 1UKPA 4XD4A 3FJ4A 3FHAA 2VR4A 1KWKA 3WLLA 2HBVA 1VPYA 4WZHA 4AXNA 2YZ5A 4GKLA 2I5IA 1NQKA 3MW7A 1XM3A 1ZJHA 3GQYA 2ZDSA 2E7FA 4AHPA 1NWUA 3MSRA 1LUCB 3NO3A 2XM1A 4YS1A 4YHEA 1L6WA 4HT3A 1BFNA 3FW6A 4TX6A 5FI8A 4KBXA 2A85A 2QPUA 3U57A 4V28A 2W4XA 2B7PA 3VNMA 5IBXC 2IMRA 3APTA 3ZT5A 3B0UX 1IIHA 2GOKA 5IRPA 2BV9A 1G7VA 1XD1A 4L4OA 3AIQA 3M44A 1H41A 3RPTA 3FAWA 2BMBA 1FBAA 1G6CA 3D6NA 4GJ1A 5T9BG 2V63A 2Z6IA 4A29A 1NY1A 2VEGA 5DQPA 3D3AA 2G3JA 3CZLA 2UY4A 2D3NA 1VD6A 4C5YA 5BXSA 3SCQA 3HPXA 2E28A 2W62A 5HINA 4JDBA 3W1PA 1JZ3A 4CGTA 3NQCA 4UR7A 1KTNA 2FMOA 5HK4A 2E77A 1B3ZA 3BLPX 1W8GA 4UWMA 1WBJA 1TELA 3T44A 2XVGA 3UG8A 1GVSA 4EAYA 1FWIC 2Y85A 1R87A 4AFYA 3WNOA 1ESWA 3I4KA 2GSEA 3WD3A 5C54A 3VD5A 1JPHA 3QPYA 3NL3A 4QLJA 2PDPA 1AJZA 3SIZA 5DY2A 5JU6A 4GMEA 4WUIA 2PLJA 4LRSA 1TV8A 3H2OA 1Z32X 4HCLA 3CZKA 2Y7EA 1OFQA 1OADA 3EOUA 2HCVA 3NQFA 3L4WA 2OG9A 4PODA 3GS6A 1KTCA 1RCOB 1QXLA 2CLPA 3B40A 3EX1A 4H8VA 2NSXA 4US5D 2Y70A 4EWJA 1TG7A 4EANA 2Z7GA 3WF2A 3TW9A 3OO2A 4AY7A 4MB1A 1S38A 1LRQA 5D9MA 3HJZA 4I6VA 3V0UA 3U2OA 5HNRA 4E2BA 2VL4A 4LBSA 2PWGA 2V3DA 4RLIA 4S3CA 5FF3A 3WQEA 2E8YA 4P7NA 3PN8A 3ENLA 1RV8A 2GUBA 3W7IA 4LYQA 3GH7A 3NSNA 2IKJA 3CLWA 3VDHA 4PUMA 3WQFA 3A3HA 4O1BA 1EPXA 2C15A 5H6HA 3VIOA 1FCBA 5CGQA 1UASA 2ZUWA 5RUBA 3T1GA 5MKGB 4Y7EA 4N4PA 4H9TA 3QFEA 3M6YA 4AZ7A 2F6UA 2H9AB 2HVMA 2ZBTA 3WDJA 2BXVA 1QHZA 3L0KA 2NVCA 1JQVA 3PZQA 1Q7MA 4TV5A 3FJ6A 3MZNA 3OBEA 3DFPA 1AZ1A 2C16A 1YBQA 4PTWA 3QGAC 4XV0A 3TQKA 1WXJA 3G0SA 4DI8A 4R34A 2AQWA 3PUEA 4AIBA 3BQ6A 2CHOA 4FLSA 3HU7A 4Z2KA 3WJSA 2VT0A 1ZBVA 2ZX6A 1BLIA 3T8LA 4EXBA 1FXQA 1L8PA 1OFRA 1A4LA 5JH2A 4K38A 3D47A 3A6OA 3SUWA 2WAGA 4H8HA 3UGVA 2MNRA 4MSSA 2X05A 1VYPX 2DZAA 4B4FA 1S5NA 2NQ9A 5F1VA 1FKWA 4IG2B 1E43A 4RW3A 3U0HA 2JKAA 4NXKA 4NJGA 1I2RA 1H09A 3VXGA 1UIOA 2VX7A 4E8GA 2QXWA 5B7YA 3L21A 4QDMA 1OD0A 4I9MA 2NQ5A 3GNNA 1J10A 4X0VA 2HXTA 5HWJA 2ASHA 4AC1X 4F9JA 4CU6A 1NH6A 4PA8A 3UXAA 4PN2A 1FWFC 1V03A 1UKSA 1BHGA 1OFBA 1T40A 1AQ0A 3ZVIA 1D9EA 1D8CA 4ROQA 3VMOA 3WH6A 2IW0A 1OFOA 3GNOA 4PSPA 1BQGA 1EJUC 2V5JA 3RNDA 5G2WA 4KGLA 4Q8MA 1V08A 4GH1A 1E72M 3OZYA 2DIKA 4KW2A 5AB3A 3KBWA 5AZ1A 3CQIA 2WNQA 2WMFA 1VJIA 1OCNA 1EP2A 3OJGA 1JGMA 3U2EA 4DO6A 3H2AA 3ZLHA 1QK2A 2BLEA 1H5VA 2QW5A 2GJXB 2WJEA 2Y24A 4M56A 2TODA 3WMLA 1BSIA 4B5SA 4HA4A 4HNUA 4ZODA 4MNKA 1V4YA 3OZOA 3BLFA 4K2SA 1R30A 3ZO9A 1B9ZA 3LCGA 3MBFA 3WQ6A 3SRKA 2HXUA 3ZLGA 1DVJA 3CUGA 2OYLA 5GPRA 4ORIA 1SO4A 2J7GA 1MZHA 1EYEA 5FD0A 3I7RA 1GVEA 2D2GA 3PZMA 3TU9A 2HPIA 3SSZA 4LJ3A 3T2OA 3GTXA 1QNOA 4DF1A 1NARA 2P0OA 1ZJAA 1E71M 2VDHA 4NZ5A 2BGNE 1Q3NA 3FFSA 3L4VA 3ARRA 4HHHA 1H7XA 4CD4A 1SU5A 4O52A 4CQ8A 1UD5A 1EC8A 4N6FA 4H8NA 5EMUA 1TTIA 2WBKA 4LCRA 5C70A 2ZYFA 1LTDA 4Q8UA 4D8AA 1Q4WA 1UD8A 4IMAA 4C7FA 1G67A 5A8PA 1EO7A 4H83A 3ZJ8A 2GVEA 3VDGA 2DZWA 4UZSA 3OLEA 5BOEA 1XIIA 1JZ2A 4F4RA 1FOBA 2Q71A 3AC0A 1G69A 5A6TC 3PM6A 1FQ0A 1UHVA 3T81A 1AH4A 3TSDA 2IKIA 2DVTA 1K4HA 1DQWA 3KX6A 5BWFA 1BRLB 3PZNA 5CH9A 3W26A 1H62A 3JZEA 1B90A 4OU1A 3RO6A 1K9DA 3QN3A 2UY3A 4UB9A 1EWDA 3LX9A 4GA8A 4EPDC 3IACA 1R0MA 4G9PA 1UC4A 3A64A 1E3XA 3PFRA 3BICA 4NZFA 5CZ0A 3R0KA 5HNNA 1KM0A 3VKJA 3AS0A 2VYOA 3REQB 3SDOA 4A3QA 1UR0A 2QR6A 5I5RA 2Z0IA 2GGHA 3BURA 2RDUA 2W27A 4BKNA 4AHQA 3MI2A 1OC7A 4FLQA 4N02A 3W1NA 3W74A 4JTSA 3H22A 1XRFA 1UUMA 5EB8A 2VGGA 3CV1A 1VRXA 3CHDA 3VIFA 5LNWA 4GLEA 4J35A 1FDYA 1K02A 4DZ5A 3UR8A 3LPOA 5CSRA 1CGTA 4HOWA 5HNTA 1DWIM 3P61A 1XSJA 4GXWA 4RDZA 3K4DA 2NWRA 5CCZA 3TFXA 3WQDA 1HVXA 2DSVA 3KL5A 3PUDA 3PWAA 4D6JA 1J0KA 4FX7A 2J77A 4V1YA 1JQXA 1X38A 1UPPA 3ES7A 5C9ZA 1PSCA 4ZVJA 3RRXA 3W7HA 5TD4A 1Z69A 3GHSA 3LLDA 4GK8A 2PODA 4HVXA 4O19A 3GYEA 3SGUA 1H4PA 3T0TA 3GE7A 5I23A 3LCWA 4AVFA 4PBFA 1YXDA 1UWAA 2FZDA 3AICA 3GC4A 3F2BA 4XD5A 1OX6A 1CEOA 1ZUAX 3T08A 5D9OA 4X3ZA 2BODX 3MMWA 2PD9A 2PGWA 3VINA 1OEPA 2QUVA 3CT7A 5F4XA 2GUUA 5CJMA 7TAAA 1PCKA 1AQHA 3WIJA 5XINA 3WMCA 3AOFA 2L5HA 2O9PA 4EE9A 4Q4PA 9RUBA 4Q3MA 4OZOA 3M7WA 4XWUA 1C29A 3PWIA 2ZE3A 4H9YA 5I00A 3AU6A 3HPFA 5CPNA 2XIQA 3OYXA 3EMCA 3PBUA 1HKVA 3KVJA 1J93A 1JDDA 1FHVA 3SCNA 2DORA 4ADUA 2BZNA 4U4MA 4BS0A 4OGZA 3OB8A <