3RLHA

Crystal structure of a class ii phospholipase d from loxosceles intermedia venom
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
278
structure length
278
Chain Sequence
GNRRPIWIMGHMVNAIGQIDEFVNLGANSIETDVSFDDNANPEYTYHGIPCDCGRNCKKYENFNDFLKGLRSATTPGNSKYQEKLVLVVFDLKTGSLYDNQANDAGKKLAKNLLQHYWNNGNNGGRAYIVLSIPDLNHYPLIKGFKDQLTKDGHPELMDKVGHDFSGNDDIGDVGKAYKKAGITGHIWQSDGITNCLPRGLSRVNAAVANRDSANGFINKVYYWTVDKRSTTRDALDAGVDGIMTNYPDVITDVLNEAAYKKKFRVATYDDNPWVTFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Sphingomyelin phosphodiesterase D LiSicTox-alphaIA1a
publication title Structure of a novel class II phospholipase D: Catalytic cleft is modified by a disulphide bridge.
pubmed doi rcsb
source organism Loxosceles intermedia
total genus 108
structure length 278
sequence length 278
ec nomenclature ec 3.1.4.4: Phospholipase D.
pdb deposition date 2011-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 3rlhA00
4I90A 4R7OA 4I9JA 1GYMA 4F2BA 5T9BG 1AODA 3H4XA 4RW3A 3CH0A 3QR0A 2PZ0A 3OHMB 4Q6XA 3EA1A 3EA2A 1O1ZA 1QATA 4I9TA 4QJ4B 2FJUB 2F9RA 4S3GA 5T91A 3H4WA 4F2UA 3EA3A 2OR2A 1PTGA 2ZKMX 3QVQA 1ZCCA 1DJWA 3NO3A 1VD6A 2O55A 2OTDA 1DJIA 2ISDA 1DJGA 5T9CE 3QR1A 4QJ3B 4RV3A 6PTDA 1DJZA 1PTDA 7PTDA 3RLGA 3V1HA 1XX1A 3V16A 3RLHA 4QJ5B 1DJYA 3PTDA 1DJXA 3I10A 4RW5A 1DJHA 4I8YA 1YDYA 2PLCA 3L12A 4PTDA 1T8QA 2OOGA 1V8EA 2P76A 3MZ2A 4I9MA 4GNKB 4F2TA 1QASA 3V18A 1T6MA 3KS5A 3KS6A 2PTDA 5PTDA 4OECA
chains in the Genus database with same CATH superfamily
1O7AA 3U2OA 3N6QA 1B3VA 3ARXA 4HPGA 1GOKA 3NQAA 3UXKA 4C1LA 3HPXA 1RR2A 4FB7A 1ITXA 2E09A 1X1OA 4MUPA 3D46A 4Q7NA 1FWDC 3PZVA 3NTYA 5A5WA 4IL0A 1SJBA 1B57A 3EEGA 2PLJA 4NX5A 4PCNA 3EPNA 4UCFA 4UXDA 2WYSA 4B5SA 3LCXA 5CC6A 3LERA 4ERAA 1MZRA 4LQ1A 4AXKA 2RDXA 1QI3A 1R87A 3GFXA 3DG3A 4DUOA 1P0BA 1A49A 2CC0A 3WQEA 1J0IA 1S2VA 4ORIA 1O5KA 2VI0A 1TFVA 2PTXA 4EE9A 5CXPA 3LOTA 3G1DA 2V38A 4IGHA 4KGLA 2RFGA 2CCRA 2Z27A 1TREA 4GYFA 1CB7B 1NQ6A 3QKZA 4QQ3A 2HMCA 3TYDA 1HO4A 4X2PA 4JL2A 4UMAA 2INFA 2WOQA 4LY4A 1BG9A 3THUA 1B31A 2F2KA 4O0KA 1K7FA 2I16A 4R9XA 4PYSA 5BMWA 2Y7DA 1SVDA 1PS9A 1XLAA 2J78A 4I9MA 5BXRA 1HJUA 3QFWA 2QIWA 3C8FA 4KKXA 3RR4A 1K6WA 1R3YA 1CGXA 3WCZA 3K8MA 3E0FA 4BF7A 3AALA 2R14A 4S3AA 3QMRA 2G0WA 2VEIA 3CPUA 1I6NA 4DJFC 4O57A 4PTVA 1TV5A 4H2HA 3UZXA 5KZ6A 4AD0A 3NYZA 4S3EA 4ZQPA 2WZMA 4C90A 3BJFA 3FXGA 2QV4A 3MU7A 4IPIA 1TTJA 3DHFA 4H6RA 1W9DM 2QCEA 4C7GA 2A3EA 5I78A 3O9NA 3OLGA 5D32A 2J25A 4IQJA 3N2MA 2G4JA 1ML1A 1KXVA 1IEWA 4MFEA 5HUOA 3K5XA 2FVLA 3CC1A 2WJZA 4XQ6A 3SRDA 2V69A 3AMGA 3WL0A 1R3TA 2P5NA 3QYSA 1GT8A 1UIPA 1E0TA 4LYQA 4DZ5A 3TROA 3IV3A 5DO8A 1RK5A 2B7QA 3GAYA 2VFEA 3JRKA 2VEMA 1KCZA 3U2EA 4I6VA 1XYFA 3ALGA 3E9AA 1E4IA 3SDOA 2RAGA 3R1ZA 4OBSA 3KTSA 4UB9A 1IT7A 2DVXA 3RM9A 2EPNA 5DELA 4GYPA 4EXAA 1JNEA 2JKPA 2OB3A 2FMNA 1AMKA 2GSEA 1BWKA 2VCCA 1WCGA 5AZ0A 1TCDA 4WEVX 2XN1A 3T0DA 2E67A 2DJLA 3STPA 5A3HA 4HSNA 1W5PA 3AMKA 1UD4A 3OHMB 3A4AA 4L9XA 4GX8A 4DUVA 3FFSA 4LS0A 1I0DA 4LALA 1ICQA 3H54A 3K1GA 5I7GA 4J2MA 1V6UA 2J27A 4N0RA 5G4WA 4O1AA 3TN3A 1JFXA 4NI3A 4BQ3A 4IHCA 3R4IA 5GJPA 4ZXLA 2AQOA 1NM9A 4V2XA 1C7SA 5G1MA 4FNQA 3W83A 4BF9A 2O55A 3UWUA 3WD1A 4C7DA 4ROQA 2W91A 1XGEA 4IMEA 2Z24A 4K38A 4MGGA 1O6IA 3LG3A 1O95A 1DWGM 3DKLA 5AYBA 2XIMA 3EDDA 3UXLA 3IAQA 3L68A 1F3WA 4Z42C 4HHPA 1OYBA 2E6FA 4B9YA 4JIEA 3WLNA 4YVVA 3WMSA 4J35A 4GXWA 2WVUA 3PANA 2DH3A 4OBTA 3TMQA 1XI3A 2NVDA 4GNKB 1IGSA 1YDVA 4RR4A 3PZOA 3NQVA 5FJUA 4G9PA 2PTZA 2A2IA 2CPUA 1M04A 1MXDA 5U4NA 4GQRA 3P82A 3DC8A 1T8XA 4S3JA 3QYQA 3WLJA 2VDGA 3W1LA 3B0YA 4J3VA 3RHGA 4DJEC 2BGNE 2PD5A 1K8CA 1XSKA 1HFBA 3NOYA 3IGHX 4AZHA 1J0ZA 1NF0A 3STCA 5I2UA 1FWGC 3WUBA 3W2JA 5FJIA 3TYEA 2YA0A 3COTA 1EEPA 3WMLA 4RZBA 3OGVA 1TTPA 4OU1A 1I2QA 1ZQ5A 2Y2WA 1QRQA 3CHVA 4XZBA 2NSOA 2Y1HA 1GVRA 3KL5A 3NQEA 2BVWA 3W2LA 4RUBA 4GMEA 3LPOA 2A6NA 4O18A 3RAOA 1ZJBA 1BYCA 2OOGA 1A5UA 1MNZA 3CT7A 3CTLA 3NSMA 3UESA 4UQEA 3MI2A 3MSYA 5AFDA 4NXSA 1TZ7A 4E4PA 3L5AA 3L2LA 4LSBA 1GKPA 1TX0A 3TYCA 3BOLA 2C1HA 3DFYA 8XIAA 5TQLA 2G5WA 3DN5A 2QJJA 3LENA 2RH9A 4MJMA 2CHRA 1XIMA 1WP6A 2QHAA 3IIXA 5TF0A 2IKIA 1EP1A 2VT0A 2CBUA 4TX8A 3N9SA 3Q65A 1Z7AA 1FA2A 3I7SA 4W85A 3OLIA 2ZXAA 3IIPA 3LLDA 1QNOA 3I6TA 3WF3A 4IIEA 4JCMA 3C0LA 4QDPA 4IISA 3TJXA 3SSJA 1EYEA 2GVLA 4GUJA 1POJA 5A95A 2FLIA 1N55A 3UWZA 4W8LA 1OT1A 2EPOA 4AWUA 1IGWA 5CSRA 1NOFA 4S23A 4ZTXA 3EMQA 4DN1A 1ZJIA 2VOTA 3OLEA 1ADDA 1HG3A 3UW6A 3OHIA 3BMXA 2E8ZA 2JKEA 3R2GA 2DW6A 4DJFA 1VEPA 2WCGA 3LHVA 4LVAA 4GFIA 5I3HA 3T6CA 3F5JA 4D6CA 3W1RA 4LYRA 1FDJA 4JZ5A 4AEOA 1EZWA 1G4PA 1VRXA 4IP4A 4JEQA 2YL5A 2DT3A 2BVDA 5I5RA 4GBUA 3G0XA 2O56A 4JY8A 3RU6A 2FTYA 3L7RA 2Z1SA 3EGJA 4TTGA 4HU3A 3TP4A 1CX9A 3OJGA 1VAHA 4YTRA 3IVSA 4LUSB 1RZMA 1Q6RA 1I60A 2YBTA 4AIBA 1TTQA 2Q09A 1Y5XA 3GK0A 2OU4A 2J62A 4A2RA 4FK9A 1M41A 4K7VA 2X42A 3NQMA 4KRTA 3N6HA 1SO5A 4JYDA 1OT2A 4IFOA 4TXEA 3NZ1A 3ARVA 4M82A 1BYDA 1ESWA 5H8UA 2ZUVA 5D2YA 3GKAA 3UZ5A 1QI5A 1IT0A 1XLMA 3S6DA 3E49A 3UGRA 2AMGA 3WBYA 1XWYA 5FIPA 4UNLA 4JYFA 4QAIA 2A7RA 3KOFA 1HKJA 1DWFM 4LUSA 4CCCA 5DCBA 1H5YA 2P50A 1PO9A 1TJRA 3WQ8A 1XRSA 1BWLA 3ENLA 2V82A 1W1A1 4FXFA 1HX0A 3I3DA 3RLHA 3FN9A 3T4WA 4DBUA 1GORA 1Q6DA 3MYOA 5MKGA 1O1HA 4LVBA 4LCQA 5FEWA 2QCNA 4I7VA 3W6YA 1C93A 2I56A 2FZNA 2V8ZA 3I6EA 3NQ8A 3RPTA 1X97A 2GOKA 1Q4WA 3K4WA 1QASA 2NXHA 3SQMA 3UXDA 4WIWA 1SM9A 3PSWA 1W1IE 3XIMA 4I5UA 4QG9A 3U9IA 1QK2A 3HG3A 4PB4A 3O63A 2I9UA 1OX5A 3I65A 4PUWA 3O15A 1L6WA 1V51A 4GVGA 4HOXA 3UCDA 2ZZ6A 2P8CA 2FIQA 1MSSA 3W7JA 1QOPA 3P8JA 2X1RA 5CAKA 2VZOA 1GQNA 2EJAA 1MW0A 3ANUA 4DI8A 1RJPA 4GVHA 1QDSA 3C2RA 1Q4NX 1Q85A 1H50A 1VIZA 5IRPA 2X7VA 4DRSA 5BOFA 5HMEA 1CB2A 1D7KA 1OCJA 1YIXA 3VNDA 3FJ6A 1EQCA 1DJWA 3NO3A 1Q8JA 2AGKA 1DXFA 2VEFA 3O6CA 2DUZA 3KHDA 1TMQA 4U5IA 1DJGA 4IFRA 1O94A 3IJ9A 4LEQA 2OQLA 2VHLA 2IQDA 3W7LA 3HGJA 4QQUA 4FNSA 3MSRA 4ZA0A 1UD3A 3APGA 1A3XA 4G7EB 4Q8UA 1EP2A 3W28A 1AW2A 4DJEA 3V5OA 1UASA 4RE0A 3BH4A 4AMAA 2GYIA 3GH7A 1A5KC 2W4XA 2HNHA 1M03A 1U2YA 1ZU8A 3C2EA 1KFEA 4INFA 4TO8A 3ZLGA 2YCJA 5A8QA 5HWJA 3GTHA 1EGZA 3AS1A 4IPLA 3DHUA 4HN4A 1MYRA 3OB8A 5DRCA 4D71A 4JNZA 1M7XA 4DF0A 1YXCA 1KGUA 1ME8A 2D3LA 4G7EA 2JBMA 1K9DA 2R8WA 3V5FA 3QV8A 1KFCA 2WJFA 2WZTA 3BSMA 1HXJA 3QGVA 2X1TA 4Z1BA 5A2BA 2Y5JA 4MPQA 5A2AA 3EDKA 1PHQA 1UWQA 3O0FA 4A3RA 4BQ4A 5RUBA 4AF0A 4AVFA 4PMNA 1RCXB 3W1NA 3AJXA 1BSLA 2PDJA 2W92A 2G3IA 3VILA 3CQJA 3L4YA 1AZ1A 2E6AA 1XINA 3OTRA 3GHUA 3W75A 4XAFA 4TR9A 4CCDA 4E3TA 2DZXA 1UC5A 3F03K 5FESA 1I2PA 4CN1A 4LJ3A 3ZO9A 2Q3OA 3WK1A 3KZSA 4JX6A 3M0YA 2ZX6A 5D05A 2AMXA 4NKCA 2REQA 4BK9A 4I8YA 4Z1CA 1ZP4A 3STFA 3EWZA 2PU1A 4GI4A 3AYSA 3PWIA 2QCHA 1F73A 2AL2B 1R9YA 1ECQA 5DMNA 4ICMA 1M01A 3D5HA 1EPXA 3BCFA 5BXTA 2VGGA 2GJXA 2ZIDA 3OQ8A 2FH6A 2PP1A 5EYWA 4WGXA 4WXYA 4AUBA 3TC3A 4NZJA 3NPUA 1OK4A 4ZO8A 4YPJA 2F84A 2CHNA 4J3TA 3GC2A 3L4TA 2OEKA 5D8ZA 2X05A 4BWLC 3PZTA 1MW1A 2J7HA 1K4GA 1TPC1 5C8BB 1CENA 3HPSA 1ONWA 4V15A 4KF1A 1ONXA 1V02A 1V5XA 2AL2A 1YRRA 3G18A 4FOKA 4FR6A 4D72A 3ITCA 1JQXA 4DY1A 2IW0A 4B91A 4NJJA 1XYAA 3GNNA 3ZWSA 4O1DA 1PWLA 2J7FA 3ABQA 3AMDA 3A5FA 2ZE0A 2G41A 2IQTA 5LZLA 3PUDA 3NPVA 5I6SA 3JS3A 3W23A 5DCEA 1NELA 5FJTA 4ZMGA 4LVDA 3OW1A 1H7OA 3GH4A 4B5UA 2C0HA 2P88A 4AD3A 3QY7A 4Q7BA 3MT1A 4GINA 3UYIA 4KFPA 1XIBA 3BTNA 2ASHA 3AIVA 5KITA 3CAWA 1V6TA 1AK5A 1XKYA 4P7RA 1PAMA 4K37A 1ZBWA 3AFBA 1SYTA 4N9BA 4AWEA 2BXVA 3L4ZA 3M0XA 1L6SA 3E0LA 4EWJA 2YBVA 3A3HA 2I5QA 3NZRA 2CEQA 1GVEA 4PL2A 1EHNA 4ICCX 4EP8C 4OUIA 3IK2A 4KESA 2XG9A 4PMQA 1XL9A 4U2ZA 5CGQA 4AWTA 1JPDX 1KKRA 1OINA 1XRTA 3SCVA 1LOSA 2L5HA 1NIUA 1Q6LA 1H5VA 2PC4A 1OF6A 3A13A 5C55A 3W29A 2ALDA 1XR2A 3SCUA 1XIFA 5KINA 3P8IA 3VZZA 2QPUA 1GVSA 4M0XA 4AH7A 1RLCL 1RV8A 1BHGA 3W85A 1XW8A 2O4QA 3EWYA 1V93A 4MIMA 2QUNA 2NW0A 4LRTA 3N9RA 3PZNA 1E3XA 5FKYA 1HKMA 4XD5A 3TWBA 1D8CA 3ELFA 4HA4A 1R7AA 4MB1A 4NL1A 3KCJA 2XVGA 2ZA1A 2YKKA 4OOZA 2C16A 5T9CE 4MKVA 4RV3A 3GUWA 1EJRC 2W0UA 4B5VA 3W2KA 3EDFA 1SO6A 4FOUA 4XKYB 5FF3A 4R88A 4H7ZA 3RMJA 1M5WA 3CT2A 2D2HA 3TZNA 4IFKB 2PDKA 1T5AA 1W56A 3BDKA 4GLEA 1S39A 5K3VA 3B0VC 3C0JA 1QCWA 2QQ6A 2EO7A 4ZB2A 4B5WA 1VCVA 2WLZA 4Z1DA 1YNQA 4HHHA 4DHGA 3G6MA 1CECA 5IM51 1HJVA 3P0WA 3TLLA 4AX6A 3PZ9A 4Q32A 4JTSA 3R94A 3CUXA 4XKYA 6XIMA 1DXEA 2OEJA 1E4LA 2DUAA 4BEQA 1OIFA 4NSBA 5L6UA 1GTEA 4QNEA 3E96A 3S2MA 2IXVA 4Q4RA 3B8IA 3CEPA 4B9ZA 4M29A 1XM3A 2OWCA 4W89A 4E0CA 1JUKA 2VWTA 5AYIA 2I9EA 4AIUA 2PAJA 4H6KA 3G22A 5A6MA 4OWGA 5K4XA 1KFBA 1EHAA 1KBLA 4CNNA 1ZAJA 3QY6A 4UQAA 4MNMA 4PCSA 1F3EA 3BG9A 7TIMA 1JULA 3S5OA 2TRSA 4O28A 4PB3A 5FF7A 3S1GA 1PL9A 4NRSA 4JTFA 3LLXA 1UP3A 1ZSXA 1OBAA 1A4MA 2X1IA 3WD3A 2PDLA 2J8GA 1XH2A 5DLCA 4O11A 3WDQA 3BOFA 1Z8AA 2EF9A 3P7YA 4A3UA 2CIPA 4KEZA 1W2PA 3DFHA 2DVTA 1KC7A 2NUXA 3M0HA 2WNWA 3BWWA 3LS9A 4BQ2A 4QR6A 1JR1A 5DMMA 4AY8A 5F1UA 3LCHA 3BE7A 5AN7A 1XQKA 1S2CA 1Q66A 4AXNA 3GH5A 1HJSA 3ITVA 4AZCB 3S1VA 2C14A 2VRQA 1M68A 1QNPA 4MJ2A 2CLEA 2HZGA 3TN5A 1WZKA 3SIZA 3W4RA 3TLQA 1R2RA 2GUUA 3EEZA 3GSMA 5CJNA 3AHXA 3RCNA 3IS4A 3LZ5A 2VD8A 5EY5A 3LMYA 5FJOA 1UH4A 1J6OA 2HBVA 5G5IA 2DEPA 1FHUA 2VGIA 5A8GA 3GVGA 1SW0A 1N8FA 3ZS4A 1XCXA 3A47A 5EMYA 5BU6A 1MDRA 4AZCA 2QVNA 4FAMA 1AMYA 1W1YA 2OO6A 4AISA 1XX1A 2D24A 4XUYA 2CBIA 4BWLA 4ZODA 2XJ7A 3I10A 4M19A 2ABBA 5D33A 3SAZA 5JUVA 2CXGA 1A5BA 1V3MA 5DRIA 4R7JA 5AC7A 4IPJA 3T55A 1TCMA 4PMJA 1ZJHA 5L9FA 1WAUA 5HWNA 4S2BA 3L21A 1FOBA 4JDYA 1BEUA 3LPPA 2WWCA 2Z0IA 4ZO9A 2PGEA 3AAMA 3QGKC 2OWWA 3SCSA 4A6GA 4K68A 1IWBA 4O8RA 2ZRZA 3IWPA 3MWAA 5JBFA 1W1B1 3CAQA 3MBDA 3P61A 4JTKA 3IUIA 1YHTA 4HZMA 1U22A 5F2IA 2ESCA 2R1PA 3S1WA 3PG8A 4F9JA 5AECA 4NRRA 1ICSA 3SCNA 1J10A 3F4CA 3KP0A 1VBHA 2O9TA 4J28A 3ARYA 4O19A 1IZJA 4YLWA 4OQVA 4JFWA 3ARWA 1QBAA 1I2NA 1ZPTA 2WC3A 4DWDA 3FVMA 4WKHA 3SR7A 3BV4A 3MJYA 1RVGA 3TR2A 2DH2A 4UTKA 4FLOA 1YNYA 2JGYA 1XYMA 3GNDA 3UZZA 1FWAC 1KRAC 3M0ZA 3ZVHB 1FH8A 3M16A 2EEXA 1GOXA 3GNOA 4PMUA 1EUNA 4H1ZA 4MTVA 5HOSA 3W7PA 3RDKA 1S3HA 4BI7A 4Q22A 1TUXA 1W9PA 1W32A 1U83A 4I8DA 3OGRA 2PC8A 3E2VA 1ZENA 3MUAA 3W1QA 4TX6A 2NQ9A 2Z2UA 3WIJA 2E5CA 1E4NA 4PTWA 1PYMA 5LA1A 4GRSA 1CYGA 3AO0A 3ZVHA 3T09A 3A9BA 1B54A 1T7LA 4I5RA 2HDJA 3EX2A 3GVQA 4Q8VA 1QWGA 2P1FA 4FLQA 4I3GA 2B7NA 3EMZA 4JXCA 4IJBA 4ZOAA 1AJ0A 1KM2A 4RX0A 4JTJA 2VGFA 3G1RA 5LIYX 4MAZA 3LX9A 5DANA 5AC8A 2TPSA 1OWQA 4GZIA 3APYA 3QC3A 4GKLA 4C6EA 1BYBA 1RP9A 2GK1B 5CJ5A 1V3HA 1TJPA 1NEYA 3H7RA 4FPSA 2ADAA 4F79A 4HCDA 1KD0A 3NAVA 1AH3A 3T0CA 4U3CA 1B5TA 3URQA 4EVZA 2P3EA 3LHZA 3PP7A 4WKAA 1B3YA 1UWSA 3NDZA 1FRBA 3QR1A 1NFGA 4D6EA 4JTHA 5M2FX 1Q6OA 3XINA 2G4FA 4GC3A 1XYZA 2FPVA 1IZCA 3RLGA 2FJKA 3T05A 3T4CA 5G1YA 3WLPA 1UD5A 4JKMA 4NJKA 4HZ6A 2VFDA 1V7AA 2R24A 4L4MA 3EDEA 3VKCA 4AYGA 4WD0A 3GS6A 1K77A 3NGFA 1WQ5A 2GK1A 3QM3A 4PBGA 4REQB 3VO0A 2V0TA 4QBXA 2OYKA 9XIAA 4Z2GA 3BAYA 4DF2A 3WQCA 4BJHA 3W76A 2NWRA 1FDZA 5CQ1A 5HDRA 2QZRA 4XUGA 2NUWA 1LQAA 1XD1A 2AOSA 1J4EA 1NWTA 2E6YA 2VELA 3N29A 1QHPA 4LCRA 3BC9A 1EF3A 1JDEA 1Z41A 2A85A 3JR2A 1IT8A 3FK4A 5DN1A 3NUKA 2XIBA 1W0MA 3EDJA 4IGNA 4GVIA 4V1XA 3N2TA 3CLMA 3CJPA 3VD9A 4REQA 5LIUX 4W87A 2QF8A 4PN2A 4X0VA 1SGJA 2NXGA 1HZYA 3T78A 1JCLA 3WNMA 3VA8A 1K4HA 3UP8A 3ALFA 4CNOA 5F7UA 4CQ8A 3EKGA 1BF6A 3QW3A 2H8ZA 4WOZA 4UFJA 1F8MA 1KA9F 3IVUA 4PUJA 1P4CA 3L67A 1UWTA 1ZY9A 4HBKA 3ZJKA 1OF8A 1VJZA 1RCOB 1EOKA 3V16A 3ZJ8A 3LV6A 1OD8A 1YDNA 4OZOA 3TSBA 3R79A 1QU4A 4AD2A 2PTYA 4PFHA 2J66A 3SB0A 1ODZA 2O0TA 4P61A 1LOLA 2FKPA 3DENA 4HB7A 3BQ6A 3KDNA 4MDOA 5A1AA 4BI6A 4MF4A 3IGUA 3B8SA 3KVLA 3FS2A 1O5XA 1UH2A 1KLYA 1W9BM 1E72M 1JAKA 1EC9A 4C6IA 3VABA 4O12A 3SFKA 1QNSA 2O9OA 1XUUA 4H01A 1UJPA 1TZZA 2V3EA 2QPSA 3NDYA 1DL3A 1QTWA 1N82A 3DHDA 2GWGA 4QS6A 2BSLA 4BA0A 1B9BA 3VMPA 4HMEA 4JR5A 1EYWA 2XM1A 2QDDA 8CGTA 2J9YA 4UBPC 4IM4A 2X1SA 1KM5A 4HU0A 1T40A 4U33A 3VGEA 4C60A 4XZWA 5HQLA 4E2BA 2D0GA 1VYPX 3PNZA 5D30A 2DORA 4LF2A 1V6XA 1X1ZA 2G8ZA 2ABAA 4YHEA 1BKHA 2CLPA 3O6YX 3PR2A 3VD5A 2CLHA 3OBEA 3PTDA 3W7DA 2B31A 3HF3A 4E3VA 1F3TA 3VIOA 3LTPA 4H04A 2FPYA 2WKGA 1KRMA 3QKEA 3GQYA 3MW7A 5TIMA 2ODOA 3D3FA 2NQJA 1ISWA 3BW3A 4JHOA 3DZ1A 3L2MA 2VC6A 5BYWA 2QDGA 1XH0A 4HPNA 4ZFCA 4NZCA 2Z26A 5CH9A 2YCIX 3SRFA 1FWBC 4B92A 3DXIA 2WC4A 4L1XA 4LCSA 3L0KA 2WZHA 4M6UA 3T08A 3TU9A 5KTLA 3QGAC 1SU5A 1B0IA 3FOKA 4OT7A 3B03A 3FHQA 1OGSA 3VUPA 1TZ9A 2XVKA 4GZEA 4OV9A 3HMJG 5G4HC 2J7BA 4UQBA 3F4WA 4FNPA 2PRHA 5AHNA 1E9ZB 4WKFA 5C6MA 3CMJA 1TVLA 2E7FA 4R7WA 3CV7A 3D6NA 2Y5SA 2CKSA 4JIPA 2XIIA 3MA8A 4UTHA 2Y8KA 2PDCA 3LDVA 4MLRA 4XZ9A 4XO6A 1S1PA 4CEUC 3VI2A 1TPUA 3MZNA 5FAGA 3IJDA 3EB4A 3KFTA 1UPMB 1F07A 4HNVA 2G3MA 1FY6A 3PZGA 5BXPA 1XIHA 2Z1VA 4PRWA 1B4KA 5AYXA 4XBKA 2A6LA 4Q4PA 1EOMA 4R7OA 1SPQA 2V68A 4E8DA 1SFSA 1W3HA 2QAPA 2X41A 3MUZ1 3AIUA 4E8CA 3NZGA 3F2DA 4JIQA 2Q71A 1EA0A 2X8RA 1UW9A 1LRQA 3SY8A 6REQB 1B3XA 4OTKA 2A3CA 3BG5A 5IXEA 1NARA 2V6AA 2IKJA 3H55A 2I57A 4N2YA 4XIMA 4A21A 2BDQA 2VX7A 2H90A 2BODX 5U7SA 4KCVA 4HIBA 1UR9A 2LLEA 1XG3A 1F61A 3UZYA 3PTQA 1IEXA 4JKLA 3B04A 2B4GA 5JH1A 2A7PA 1VFTA 2ZA2A 4US5D 4YYFA 4JTAA 5C0QA 3ZXWA 1LLZA 1OFPA 4GH3A 3T8LA 5A6LA 1MWOA 5I00A 2CBJA 4HNUA 1BWVA 4HNOA 4L1GA 6REQA 3SZ8A 1LROA 1EJUC 3VMNA 4DBDA 3L9CA 2GDQA 2D22A 1R8LA 3WH6A 3EXSA 7XIMA 3N13A 1IXPA 1NSJA 3A3XA 3NJ3A 3GU1A 1ADSA 3DYMA 4A2SA 3QJAA 3MVIA 4L9ZA 5HNUA 2WLYA 1P5BA 1QI4A 3SJ3A 4C6QA 3DBNA 4Q8WA 5A6TC 3GG7A 4NZFA 1RUSA 3T2OA 2J7EA 4O17A 4FIQA 3HA1A 2YYTA 1H1YA 2VL4A 4HSOA 1GZJA 2FB2A 2Z25A 2CLKA 3VDGA 3DEQA 5D37A 2ACSA 1YE4A 3W70A 3AJ7A 4R85A 4JN7A 4KWVA 1GZ1A 2BMBA 1L2UA 3IAPA 2J4GA 4O10A 5E0FA 1QNVA 4IUGA 4UMBA 3DFNA 3MMDA 1EP3A 1XYCA 2WZEA 4PC8A 1GTHA 3MUCA 2ZUWA 4HT3A 1RCQA 4HSHA 1KFJA 2HISA 2XZ7A 3HG4A 3GBEA 2VD9A 5HQEA 1RVKA 1GOOA 2X7WA 3NNTA 3VE7A 2E9BA 4GI9A 5TBOA 2IQ0A 3FGCA 1OYCA 1FXPA 2Y4SA 1YNPA 1REQB 4WHBA 3LD5A 4F0KA 2D1ZA 4DO5A 1EX1A 4C1KA 1QFEA 1NP0A 4CU8A 1TV2A 1PX8A 5C54A 3TX9A 2QF7A 4D1IA 2HS6A 1FP8A 1BGAA 1JXKA 1LWIA 3WQ6A 4JN8A 3E0WA 1JDFA 4GCXA 4L9YA 1XUZA 4JHMA 3VCRA 2VFHA 1X6UA 4UTFA 5H2ZA 4DYKA 5DXXA 3P5YA 1REQA 3BK0A 3CZ8A 3BLEA 1P1XA 4N6EA 3T81A 4LUJA 1Y65A 4XB3A 3UA3A 3VIJA 4QTGA 3CWHA 3FA4A 3RGTA 4E2DA 4KMQA 1H60A 1W5NA 1XSJA 3SADA 4LYPA 1GHSA 3CIXA 2Y8VA 3CB3A 5A6JA 2Y6ZA 4GO9A 3LHYA 5CJMA 4CQCA 2PBOA 1J11A 4HPJA 5J04A 3VC6A 2NVAA 2QR6A 2GDUA 3LLFA 5I3JA 1ZZMA 3SCRA 3OBAA 1E5NA 3H4WA 2PDHA 3ABSA 1RJRA 5DFAA 4WVXA 3EXTA 1ZAHA 3MKVA 1FWCC 1FDYA 2ZZ1A 2CLMA 3VMOA 1VFUA 4M81A 3DECA 4E2OA 2HK0A 4YTSA 2PF0A 1JFHA 2P0OA 3WFLA 2FZMA 3LQLA 2VM8A 1N8IA 4ROPA 4J3WA 3TFXA 1EB3A 3VIGA 1SW3A 1EWEA 3EX6A 1OVDA 3LRMA 2WNQA 5FACA 5F2LA 1EZ2A 4KT2A 3E0IA 1S46A 3ZIZA 3G77A 4XD3A 2BXZA 2F61A 4YVPA 4DNHA 3WEZA 2IUZA 1VP5A 2XM2A 2DVUA 3IIOA 3PUGA 3TQ0A 3EXRA 2WK2A 2TSYA 4U4MA 4DQWA 4ADUA 3VM5A 3NYDA 4MHBA 4C6LA 1PKNA 2QDEA 1TPFA 5LGXA 5CSUA 3AS0A 3W2NA 2YZRA 3DYOA 1KM3A 1TSIA 4RXFA 1A47A 3CH0A 1IEQA 3PNUA 4GUIA 5CZKA 1QPNA 1XCFA 1B3WA 4HZ7A 2OX1A 1Q65A 3H6OA 4L65A 5F4SA 5AC6A 1XIJA 1DQWA 5FJRA 5G2IA 2J47A 1AW1A 1RLDA 4MNJA 4NY2A 4A8RA 1SZRA 4HMCA 1KV5A 4JNYA 3H2EA 1JNDA 3UCQA 4D6JA 4KFNA 3M47A 3UWYA 4AHOA 4RDWA 4TQTA 2WJDA 3MHGA 5AHFA 1YYAA 4IMDA 3E12A 3KP1A 5LNVA 3U7VA 5HMSA 3VGFA 5KETA 5LHEA 3LHWA 1TVPA 4NI8A 1NFPA 3FKKA 3SIMA 4XZMX 1IWAA 3FA3A 2NVCA 4WSHA 2PPGA 2XVLA 1G5AA 2J8FA 3KRUA 3WYZA 4DO7A 2PFHA 1R38A 5H6HA 1YDYA 2V2HA 4PMRA 4KWOA 2WM0A 2ATMA 3VIKA 2NX9A 2YLAA 5FD0A 5C9UA 3GTFA 4H00A 4C6PA 2Y7EA 4ZEPA 4Y6GA 1YQ2A 3BGJA 1GJUA 3O07A 4YCPA 4HD5A 5IOBA 3TN6A 4U5KA 3KBSA 4OVXA 2ZFAA 4AZIA 1BG4A 3FIGA 3OGSA 3CQHA 2O4MA 1HKKA 3SQSA 4RW3A 3OO2A 4EF8A 3RX2A 3WDRA 2ZCGA 4AHQA 2TMDA 3KBVA 4B2DA 4N4QA 4WX2A 3BW4A 3UPBA 1QOQA 2CZ5A 2EAWA 1OSEA 3LTYA 1DOSA 1J01A 5GNZA 1Z44A 2X16A 1KQYA 3MUXA 3GXPA 4IPPA 5CZ0A 1K7XA 2QJGA 3UZWA 4MZ1A 1TE6A 2PLMA 3GDMA 5IFTA 1OX4A 4QDWA 3GVVA 5A6SA 3WUGA 5K4ZA 2A3BA 4RDVA 1FWTA 2VWSA 4LU0A 3SCTA 2AQWA 3N17A 3BO9A 2XVNA 2NQZA 1UR3M 5CBBA 3IANA 2E0PA 3TTQA 1QAPA 1MEIA 1YMYA 2PDBA 4NG3A 2BFGA 3TMLA 2DT1A 1UR2A 4LV9A 1ZFJA 1ZHAA 3S5ZA 4DWSC 1A0DA 1R3QA 4EPDC 1V0LA 1HGWA 4G6CA 4DPQA 3NOEA 4GJ1A 3WLMA 1GKQA 4PTNA 4WJXA 5E09A 4Q7IA 3ZQ9A 3V18A 1LL7A 4AX7A 1GQLA 1FHVA 1Q3NA 4RE2A 4KGJA 1UKTA 5D2TA 3SW6A 1QXLA 2V81A 1OCQA 3CZJA 1H41A 3WQGA 2VFGA 5GNYA 3MHFA 4Q8PA 3DG7A 1KCKA 3N2BA 4MVAA 4K1GA 1YBQA 3QC0A 3NSNA 3TZFA 1JZ2A 4ZOCA 2VC9A 3B8DA 4H41A 4HGXA 4AZGA 3GHSA 3RCMA 3KRZA 5HMDA 3WD0A 5I0DA 1JGIA 3QHMA 4JFVA 3TKFA 4JTUA 3GFYA 1L2QA 3WO8A 5C2CA 2HEJA 2Q3RA 1CLKA 4QCFA 4CGTA 1V3LA 1UBSA 5AB3A 4ONVA 3KCLA 2DUXA 3FCPA 2Y8UA 1L6YA 2CW6A 1PZ1A 2OXNA 3RF9A 4FSAA 2AKZA 2PWGA 2GSJA 4GHRA 3ABXA 5CZTA 4RZ6A 4GY7A 1H51A 4P5UA 4RPPA 1E71M 4E4UA 3AXIA 3ABOA 3TTEA 2X0SA 3O6AA 3R10A 4RV8A 2WBGA 4TMBA 4L61A 4EANA 4BR1A 2FMOA 4HA3A 5FAJA 1KQZA 5TD4A 1YPFA 4LF1A 5DT7A 1WDQA 1FWRA 3GDLA 3BLDA 3GTIA 1CXEA 1LYXA 2OCZA 3HV8A 4ILSA 3PBVA 1C8YA 3QZ6A 2WVVA 2QJNA 3PPGA 2BVTA 3CU2A 1RBLA 3CL7A 4JS3A 4ZQNA 1JPKA 2RGLA 4UZUA 1FH9A 1VPQA 4QAWA 2HSAA 3H21A 2WSQA 4O4VA 1B90A 3PWGA 1DE5A 1RD6A 4UMCA 3R89A 2GJRA 1TPB1 4LY8A 1XLHA 1BXBA 2GVYA 3QQ0A 4D6HA 1ZNNA 4C6KA 2OQHA 4B90A 3P84A 3GXNA 4GXPA 5A8PA 5TNVA 2ISWA 4O52A 1VS1A 1SFLA 1NOUA 4GA8A 1S2TA 3RX3A 4R53A 1L6GA 3XISA 1THFD 4C6DA 3NG3A 2DV0A 4D6IA 4NNCA 3DFOA 3QMSA 1SQ7A 2VFIA 3PK7A 5K9CA 1RAKA 2C71A 3TQPA 4LRSA 2F6KA 3U2CA 2O9PA 1RPKA 1Z42A 3FHAA 4FXJA 4DF1A 1QNQA 3VKJA 2JEQA 2Z28A 3F4VA 1YW1A 2IPGA 3UVAA 3WJSA 4QCEA 3GNRA 2JFEX 4MLJA 5G2HA 2PGRA 3GU2A 4Y9MA 2GQ9A 3QSTA 1U1UA 3M43A 2W66A 3QBUA 3L65A 2E4TA 4C5YA 4X22A 2Y0FA 4GOAA 1W3TA 1JZ6A 3CQ0A 1HTIA 1PB0A 1XXXA 1P43A 1ME7A 4PSPA 4TTUA 3TWAA 3H53A 4B5NA 1H49A 4XD6A 3PPCA 2F8QA 2Q02A 3LCFA 3AU2A 3FEQA 3EOLA 4PRRA 1NU5A 3BARA 1UZ1A 3BAXA 4X60A 1BXNA 4ADSA 5HBFA 4UR7A 4GGBA 3EBVA 2I7GA 1B30A 3P74A 5DY2A 4UFLA 2UV8G 1EJSC 1QATA 2XGIA 3RMEA 1JZ3A 3HM7A 3PTMA 1JRBA 4B3LA 1BSIA 3KOXA 3WQ5A 3KLLA 1ZRQA 2WZIA 3R8HA 2W27A 2WMIB 1EJTC 3NM3A 4FR1A 4YN5A 3SRHA 4GQ0A 1TPEA 2O9RA 4G8TA 3SRKA 1CXHA 5M3WA 4FXRA 1IEIA 4WDWA 1F2JA 3UR5A 2RJHA 4MAVA 3WJYA 3PG9A 2OEMA 3LCGA 1M9HA 4UQ9A 2YXOA 5M03A 4UOZA 3ID7A 1NQKA 1WBHA 4LBSA 3ARRA 5FF4A 3O6DA 2W63A 3UNDA 5C2GA 4S39A 4XIAA 3TIMA 1TTIA 4CN6A 2ACUA 4CNUA 3MY9A 3SFWA 4LWWA 4LH8A 4W8BA 1MQQA 3N1AA 4QM1A 3UG8A 3WFAA 3RLUA 1JCMP 1EDQA 5AHEA 1UQZA 1GNXA 3V3WA 4RK8A 5FSEC 3SGGA 3KEHA 4ATLA 4E2VA 4O0ZA 5D9PA 1UMLA 1P6BA 4JOMA 2GVEA 3A3WA 1T6MA 5EMKA 1JYWA 4YWSA 3G5EA 2OJPA 3QLLA 3AS2A 3RO8A 2PDPA 3E02A 5F1VA 1JF5A 2QGYA 5CCZA 2HJPA 1ITCA 5REQB 4CUCA 4OOUA 1S5NA 3AMCA 3PWAA 4F3HA 2OKOA 3S1UA 4H9XA 1AH4A 4G7FA 3TXVA 3F5LA 5J5DA 3H12A 1AJZA 3GIQA 3UXAA 4Q8MA 1GYLA 3NWRA 2P8BA 4WK9A 3VIFA 1FCVA 2BTMA 4AVNA 4DWSA 1L8NA 3QZAA 5D4YA 4QITA 1JZ7A 4DJFD 4JPGA 1SFJA 3P81A 4AIOA 3QPYA 1DQXA 1ZTVA 2PI6A 3UNTA 3KRBA 3OVGA 9XIMA 5GQBA 5REQA 4U31A 2RDTA 3T42A 2E25A 2D2OA 1OFAA 1TUFA 2PDIA 1MVYA 4O16A 2BX7A 3RK8A 2EKCA 2Q8LA 1GONA 2IS7A 3Q58A 2PWUA 4L6OA 2UZ9A 2GGHA 2CKRA 4H8NA 3V1HA 4N42A 1UKQA 4XZHA 4A29A 1RBAA 5BRPA 2A1YA 1JUBA 5CC5A 1B1YA 1Z9AA 2TYSA 2A7NA 4OBRA 4QE5A 3V0TA 4EX4A 2Z1XA 3MWCA 3KW3A 4KPLA 5KZEA 5LKYA 2VX6A 4MPKA 3PBGA 5AHMA 1Q6QA 4Y9OA 4QE4A 2QNEA 4A4AA 3S6TA 3VX0A 3EA1A 3TNBA 3PPFA 3S3GA 1W6TA 4CLMA 3CUIA 3GHTA 1UP0A 3W38A 4JD4A 1O5QA 3E5BA 1JCYA 1XC4A 3LCWA 4KH2A 4AW7A 2OGJA 5IHRA 3B8WA 5EFDA 2XGZA 4M80A 5FF2A 5EMJA 3PY2A 1X1NA 2DY3A 3LK6A 4C6CA 3B0UX 2XIQA 2J7GA 4J3SA 4WSKA 2NQHA 4FNUA 4P7NA 3G1XA 1PIIA 3TYBA 5B7YA 5I02A 3GX9A 1J5SA 2XPKA 4QGCA 1S2UA 4HU8A 3N34A 2CLLA 1JCXA 1F74A 2PRMA 1VEMA 3PJTA 5HANA 1SMAA 4KWWA 4MB5A 3OPSA 5HA7A 4XD4A 4HPXA 3AZSA 2AAMA 5GJMA 4F0HA 2DZAA 1K70A 3ZWTA 2NXIA 4QXIA 2AAAA 3IJ8A 5CLWA 2Q8XA 3O7UA 3HGSA 4WUIA 3WLKX 1GOMA 3GC5A 2WWDA 3ANYA 2WMJA 8TIMA 1H7PA 2WV8A 4Y9AA 4ZFMA 3HPZA 2YCKX 3AWNA 5IFPA 1NAL1 1BKSA 4ASTA 3D47A 3UZJA 4W9TA 1FCQA 3NL5A 1GQIA 3CZLA 1GZGA 3BG3A 5ABFB 1S5WA 1Y5VA 2V2DA 3S9IA 1E55A 4FNRA 1GYNA 1W9XA 2PDUA 3W22A 2OX4A 3CV6A 2RUSA 3B40A 3CUHA 3L4XA 1UUQA 4UTTC 3ARQA 3IGSA 1JEZA 9RUBA 3H26A 4H8VA 3MP4A 2PGFA 3NZPA 2OQYA 1PWMA 2ZKMX 4DJED 2Z4GA 2Z6IA 5DX7A 3TC6A 3U5UA 1UB3A 1GVFA 2V5KA 1LBMA 3N9KA 5JIPA 1W1TA 1K9TA 3H2OA 3KUMA 1EJVC 2ZZ7A 3CYJA 4R27A 1XG4A 1XC6A 4YNGA 1GPWA 5ABFA 1S5VA 3RJYA 3PB2A 3OVQA 3FEMA 3ITYA 3W7OA 5H8MA 5FEPA 2G3NA 5MF5A 1Z32X 1LUCB 4H8HA 4BHYA 1JD7A 4ALDA 7REQA 3T9PA 4WZHA 1MQPA 2VVSA 3RXZA 4IX0A 2XINA 3UA4A 5FL1A 1IXQA 2CNCA 1AG1O 4RJEA 2BVYA 4DBSA 1KTBA 1R9ZA 4JHZA 3CHCA 1RQEA 1HW6A 4B4HA 2XHYA 3SJNA 4KCWA 1AODA 4NVTA 5KZMA 5ABEA 3ZSTA 2DZVA 5CZJA 2ATSA 3W1UA 1GGOA 3FNDA 3TXZA 3M5VA 2CZVA 4IGMA 2DQWA 1LUCA 4PULA 1G69A 3V5CA 3PZQA 3AWOA 3W7RA 2PDXA 3ARPA 3OVRA 4GY1A 4AYSA 2ZOXA 3SGUA 2YDSA 2ZRXA 4PEKA 4IP7A 4LYKA 1E56A 2VZUA 6TAAA 1XISA 2WCAA 3BURA 1KR0A 1XGDA 4EOUA 5LNRA 1E4MM 3MUY1 3WDPP 1GKRA 3EB2A 1TV4A 1G4EA 1P0EA 3PC0A 4HK5A 3MCOA 1VFFA 4UR9A 4UOJA 1D3GA 1H7XA 4CD6A 1MW2A 3W25A 4MWAC 3E74A 4HOZA 1A0EA 5EGRA 2NUYA 3DCPA 3T2QA 3R0KA 3SM0A 4S3CA 4XKMA 5H1WA 4F0MA 3LBMA 5M1TA 4FS9A 1LRTA 4ES4A 3CUJA 4TV5A 1QR7A 2PTDA 5HULA 5LHFA 3MPGA 4NF7A 1WKDA 1ZB5A 4JNMA 1I4NA 3FDGA 4JFSA 3AYVA 4K6AA 5T9BG 3WLHA 1V02E 3FXYA 2VDIA 4XG1A 3T0TA 1AQMA 1I9CB 2FGLA 5BXSA 3CHEA 1BRLB 4PL1A 2WVSA 3VGBA 3UWVA 2PMQA 2ZVIA 3R5EA 2C13A 4PODA 3VVGA 4YTQA 2YJQA 1NDYA 4P8UA 4X63A 1W1ZA 5T8GA 1R3RA 2OSYA 5BRBA 1DBTA 3HPFA 2CHOA 2VC5A 3E1F1 2VRKA 2GSHA 4LUTB 3WBAA 3MO7A 1VHCA 2EPKX 2ZRVA 3A12A 5K9DA 3H22A 1F05A 1BRLA 2IPWA 1XLJA 4Q4SA 4ML9A 5CPNA 1Q7QA 1TWDA 3KE0A 4J5NA 1WPCA 1S5MA 4PZVA 5HJLA 3L12A 1RBOB 3MSDA 3GYCA 4U3AA 3AYRA 1UWRA 3NL2A 1UJQA 3K8LA 2QV5A 3GYEA 3RNDA 4U2YA 2ZZ4A 1XDJA 2YGYA 3D3AA 1AQHA 1F6KA 1EIBA 1S5TA 3WH5A 4I90A 3VINA 4LUTA 3O3RA 2ZXQA 2ZDRA 3E2SA 4X9SA 4AG0A 2C8NA 1G7VA 3LUTA 4UQCA 1CT5A 4H6QA 4H83A 2KZHA 2PDYA 4DM2A 2WO5A 1ALDA 3QH2A 5H91A 4FLRA 3HV9A 5DMYA 1QO5A 3Q2DA 1B4EA 3GNPA 4GUGA 3FKRA 3LBCA 5DT5A 1KXTA 3LRKA 1OB0A 4P7LA 5LYRA 3SN0A 3W37A 1W5MA 1XFCA 2FTWA 1GG0A 3GXTA 3EA3A 4EIVA 2ZX9A 2DIEA 3KM8A 4D9PA 3ANVA 3MVTA 1WZAA 3HTWA 3EPMA 1XBVA 1P6WA 3H23A 1EIXA 1NFBA 4J7RA 4EPEC 3PFMA 1R85A 1FXQA 3W2UA 4NUWA 4H6EA 1MRQA 4HYWA 4P8WA 1V3IA 4XV0A 1FWEC 1TJ2A 4XK2A 1KTNA 1DWJM 5AVNA 2X1UA 3P14A 3VM7A 1VBGA 4LGXA 2DSKA 4RW5A 3KCOA 1AQ0A 2Y7FA 1UD2A 3G0SA 4ENLA 3HOJA 3W0KA 1PDZA 4MKNA 5D2VA 4UTTA 5CSSA 3HN3A 5A69A 3EOOA 4GISA 5AC4A 1XRFA 3NQ6A 1VCGA 2EPHA 2X0YA 5KEZA 5KSWA 4CNTA 2ZUSA 2ZXDA 1F8IA 1OFRA 3O16A 3PZMA 3WLLA 1W9UA 2TODA 4YYCA 1A3WA 2PZ0A 3FJ4A 4P7QA 3WUEA 1XSIA 2YX0A 3TTOA 4H8UA 4IIBA 4Y9NA 2XFYA 4P2VA 2WSYA 5IHSA 4MZ8A 3C52A 5EL1A 2W5FA 3NA8A 1U1HA 1JI2A 3EWCA 1VLIA 1IWPA 1FCUA 3KVKA 4J9JA 4P8XA 1UCWA 4S1FA 3SBFA 3IARA 1YEYA 1W3NA 5LA2A 2ZZ2A 3WQWA 1HQTA 4LS1A 5EKYA 1H3GA 3LXCA 4DO6A 3W71A 4DZHA 1UPPA 5JQ9A 4MB3A 5HQMA 3N19B 5FOOA 1TWSA 2HPIA 3UQNA 3DOPA 2YA2A 3GDRA 3BMWA 3GG1A 4JQAA 1K9EA 4QLLA 4XZNX 3AI0A 4O1CA 2ZRYA 1PVNA 2AKMA 2OLHA 3CZEA 4UNIA 4MWAB 4W88A 1A5NC 3MMWA 1SR0A 1LOQA 2A5HA 2I14A 4CEXC 2WKLA 4XVEA 5HXMA 2B7OA 4HOWA 1RQHA 4QEEA 2NZLA 1P7TB 3APTA 1JDAA 3LCIA 5MKGB 3BGAA 3RR1A 3A9IA 1US0A 4GJJA 1IR1A 4JQ1A 2WQDA 3AHZA 4LOCA 3W53A 1G7UA 2JALA 4Y90A 3W7GA 1PZ0A 3QR0A 1A5MC 2BOEX 3E38A 1CXLA 1WUEA 2W3ZA 2EGZA 3AU6A 3UWEA 2FHBA 1RK6A 2V63A 1W3LA 2A3HA 3OQEA 4Q8OA 5HNTA 2Y88A 3TA9A 1LQ0A 2JQXA 4MWAA 2WNZA 2WBKA 5DY3A 3OZYA 4ZQCA 3TE9A 5J8LA 3C2FA 2R9RA 2X2GA 2ZWYA 3FJLA 1P7TA 4IQEA 4PA8A 1VBRA 1AH0A 1X7IA 2C18A 1CLVA 4UTUA 1A80A 1LBLA 1NDVA 3H4GA 4G56A 3WJXA 2HBXA 4H9ZA 4MJZA 3CUZA 3A22A 4EWND 4ZQMA 3E2RA 4RDYA 1JPIA 2UY3A 3KOZA 3AHTA 1LLWA 4FF5A 4F66A 4W8AA 1UWIA 2YCLB 1KBBA 1TG7A 1O66A 2DZSA 3EMCA 1GW1A 4B4FA 5C2XA 1WAWA 3TJLA 2G97A 2VKZG 5E9XA 4UFMA 2R1NA 2YPIA 4AD4A 5DBTA 3C3NA 3IPWA 3W7HA 3NGJA 3JU2A 3ZVIA 4QSFA 4GIYA 1Z6KA 2YDAA 3WL1A 1V4YA 4KW2A 3GDTA 4QSHA 4M56A 1LBFA 4FP1A 3QMTA 3VOGA 3WKZA 2F38A 1VPYA 3LGGA 3M7SA 1O1ZA 4FX8A 1AJ2A 2YCLA 4XVDA 1YKWA 4D6FA 1FBAA 2XDFA 3BGGA 3SCWA 3T40A 1J12A 1KNWA 1TV8A 3W24A 2C1GA 3GG0A 4GG9A 3VFLA 3TK7A 4ATDA 2PP0A 3ABRA 1N8WA 4JGDA 3R12A 4QE1A 3UG5A 1V77A 3LHUA 2Y85A 1W8GA 1Q6GA 4EXQA 1GEHA 2XN0A 1WXJA 4AMCA 2W61A 3AHVA 1Q13A 3W1XA 3A6OA 5C71A 4NJIA 4N6FA 2C1IA 4R9OA 3ORWA 1QWKA 3UCCA 4AF0B 2ZYFA 2R94A 3CEUA 3STEA 2PZNA 2E8YA 4WDUA 4PBEA 3EPOA 3EX1A 4ZQOA 2YXGA 5AKQA 1EGMA 2OVLA 3NQBA 3E3HA 2PSNA 3GXDA 1O4UA 1VB9A 2D0FA 2EPLX 4NZ4A 1XBYA 2VCAA 5FF0A 2QGHA 4KWUA 1KM4A 4MG4A 3U3HA 2OO0A 3BSGA 1PKLA 1DJQA 2FB3A 2DDXA 3NDOA 4H3DA 2FZDA 3PZIA 2REQB 2NT1A 3G1FA 3SCPA 4PH6A 1OC7A 2E3ZA 2YIHA 3N4FA 2X09A 4XSMA 4F4RA 1C91A 1GEQA 5H8PA 4KEUA 1PJ9A 2ZZ3A 1SUXA 2QCLA 2VX5A 1SSGA 2GJXB 4WCJA 1DVJA 4ERIA 2H6RA 2Q01A 1R7OA 4YS1A 2VVNA 3VIIA 2YOCA 4Y2WA 4YTUA 1VYSX 1J79A 3FYPA 2XIJA 1K02A 2DGAA 2V5LA 1CZ1A 3HO8A 3OA5A 3SEPA 4ZE5A 1OFQA 4LANA 3BOXA 3WD4A 4CKQA 1Y8BA 1W3IA 2VDHA 1CBGA 5I06A 4X9YA 2DFAA 1DTUA 4IT1A 4NZ1A 5E0CA 4JTDA 2VTFA 3SGZA 2VZVA 3L0GA 1DJHA 2X30A 1JRCA 4LAZA 2V5CA 1Q45A 3WNOA 1EDGA 1VYRA 5EBUA 3EOUA 3L4WA 3W7KA 1C8VA 5HAOA 4WY0B 3CAKA 1QK0A 2YB1A 4LS2A 3UR7A 3KS6A 7A3HA 1HL2A 1UC4A 1IXNA 4QROA 4W86A 1E1FA 3B4UA 4HMDA 5MHBA 1CXIA 4C91A 4Y96A 1ECEA 3KBNA 1M7JA 2EHHA 1SR9A 2VEKA 4K7YA 1EJ7L 3KTCA 1G67A 3VGHA 4ZB0A 3THDA 3QV9A 1LG2A 4DNMA 5I07A 1OX6A 3W1AA 3WK3A 4JTTA 1EO5A 4HMNA 3DC0A 4PTXA 4RDZA 1PXGA 5JBDA 3WQ4A 2GVGA 1N2VA 1OJXA 1UWAA 2CESA 4WY0A 3QR3A 1EUAA 2ZTJA 2FHCA 5ENLA 4XTDA 3R43A 1E9YB 1BVWA 2B0MA 3DYPA 5I3GA 2INEA 4ZXOA 1TVNA 1VENA 2PU0A 2J88A 1Y5WA 4KEVA 3UWQA 3ZR4A 5A6KA 1KCLA 3NVDA 1M7OA 1JI1A 2BOGX 2HK1A 3QV6A 2OT1A 3N14A 5JXQA 5BMXA 4RZ4A 3VDHA 3B9NA 1W2VA 2FGZA 2PGWA 5CAHA 3MI6A 1OFEA 2ZUNA 3QN3A 2FDSA 1TWZA 1Z48A 4IMAA 4UTWC 1I1XA 5CC3A 6ALDA 1M6JA 1WDRA 3M0MA 2D0HA 2B81A 3CASA 1IZKA 3N2XA 3L0NA 4HU4A 1P6CA 5JH2A 3VOFA 4MNLA 2JGQA 1EQPA 1V0MA 4QX4A 1QJWA 3L23A 2QJIA 2ICSA 2PRLA 5GNXA 3W7EA 4IIHA 1CXKA 3DI0A 2D73A 3PULA 3THAA 4F8XA 4L4LA 1QW9A 4AD5A 4AQLA 3EOSA 4IF2A 3Q45A 2V67A 3VGGA 5JMUA 3H24A 3WJWA 3U2ZA 2QKFA 4PSRA 1C9WA 3AZRA 2E40A 3TCEA 3LY0A 5LXXA 2QUMA 4C6FA 3N18A 3HMCA 3VDAA 4JN6A 3QY8A 3BVJA 1TA3B 2YLLA 5C5YA 4ECLA 2A3AA 8A3HA 5DF0A 1YTEA 3GBDA 3ITOA 3TOPA 2C19A 1OZQA 1KWGA 2QMJA 2G37A 5I03A 1XBZA 4Z0JA 1DPMA 1ITQA 3J7HA 4H9YA 4J3UA 3S5NA 3MCNA 2WSPA 2QPXA 4MB4A 4J40A 4G5DA 4F9DA 2ZX8A 1QI0A 3LA4A 2VXNA 1P0KA 1W1VA 1TA3A 1US2A 1XH1A 2HRWA 3AXHA 3RCYA 1LLOA 4N9CA 2Y62A 3R13A 4DXVA 2GGEA 3O2LA 3OVPA 4Q6JA 3CHFA 3TW6A 2JIWA 4MJ4A 1IV8A 3K4AA 2OOFA 4C6JA 3TOYA 5CKSA 3WK0A 4LX4A 5BWFA 2ZBTA 2GQ8A 4Q6XA 1Q2SA 4UFHA 2VRJA 2BASA 3ITXA 1X6NA 3GRIA 3THQA 1PX4A 4A3HA 2RDUA 5CPMA 3AXXA 3DHPA 4CCEA 1R3SA 1AQFA 2B7PA 1F9CA 2EXOA 1ADOA 3LU2A 4IUOA 4ZB5A 3RRAA 2DJXA 3FAXA 3I3BA 3VX1A 3OA3A 1DV7A 3VD3A 3B97A 3LNPA 2WAGA 1WX0A 1IE7C 1W5QA 3VKAA 3RM4A 3SO7A 1ZCOA 8RUCA 1WDSA 2A79A 1NF7A 5I3FA 1XJBA 4M24A 5BOEA 5JIWA 5FEXA 2NLIA 3GWQA 3RN6A 3MP3A 4UOQA 3ZZ1A 2WHMA 4JFUA 4QDMA 2IXUA 1YPXA 1VPXA 4Z2IA 3W2MA 1E6QM 1TKKA 4ZQRA 1BLIA 2MANA 4C6NA 4YJ5A 1AVAA 4GIRA 5F2MA 1OEPA 1XPYA 3UWWA 5I77A 2QMKA 3W7NA 2UY5A 3WLOA 1FWJC 3OYXA 5KMYA 2AQVA 1RJQA 1L9WA 2YR1A 4MFDA 4A22A 2DU2A 2POZA 2YL8A 2WB5A 3NPWA 5DEZA 1OFDA 1A0CA 3R0DA 5CG0A 4IPNB 3DG6A 5HPCA 1IEVA 2FJUB 5FSDC 1B3OA 4YCOA 2F6UA 3W87A 4AZ5A 5CG7A 1CCWB 4URIA 1EJXC 2PD9A 3BICA 1ENUA 1OGBA 4ZE4A 4JKKA 1MZHA 2ZUTA 4CQ9A 1G4TA 3SN1A 3SECA 1M1BA 1WBJA 1UIOA 4H4IA 2HVNA 2OTDA 3C86A 1KGXA 3M9YA 3LPFA 5LSMA 1R47A 3KAOA 4M6QA 2PE4A 3WUFA 3P0XA 2PB1A 2QCDB 1X8FA 2OZ8A 4G1KA 1BQGA 4GI6A 1SJCA 4GIEA 3S5SA 4UFKA 4L1WA 1CNVA 3ZT5A 1KB3A 1VHNA 1PDYA 2XH7A 3UXIA 4Q4KA 4DI9A 3RITA 2G3FA 1CEOA 4FO4A 3DFQA 2V30A 5HNNA 2RHGA 1DEDA 1AW5A 2XWDA 3AYTA 3MZ2A 4D6DA 4ATWA 1MRAA 2GJLA 2WKJA 1XLFA 4LC8A 2ZRUA 3KWSA 1XBXA 2A4AA 4S3DA 4XX6A 4F2BA 2QCDA 3PUOA 1H62A 3H2AA 2BBFA 1JDCA 1XIEA 3EZ4A 4IL2A 1W3JA 1HN1A 3RPDA 5E6ZA 2QULA 1CTNA 2DSVA 4NT0A 1WDDA 3MP5A 3TQVA 3A21A 2ALRA 2O7SA 4R3UA 2F9RA 3BANA 1H4PA 3ARUA 4IQDA 1Q5MA 1EKOA 4FA3A 1WZLA 3F7JA 1DIEA 4K1WA 4UTWA 2CZEA 3W1TA 4F2UA 3W86A 1LWHA 1HJQA 1FTXA 2CXEA 5HK4A 3TYAA 3ARSA 3OZOA 2KAUC 3L4VA 1WB0A 4EAMA 3CK5A 1AD4A 2J9ZA 5HNRA 3V7PA 1LZOA 2WHJA 4A05A 1TO3A 4JIHA 1BTMA 4QJ3B 1BD0A 1J2BA 4DPPA 2ZRWA 1Y7VA 4CD7A 4W7UA 3VD7A 1YTKA 1PCKA 4UUIA 3A4XA 1GVYA 3KZPA 3I7RA 2QUTA 4Y9PA 1HKWA 3VDCA 2QW5A 2BLEA 4DJDC 2QCGA 3C6CA 4GUHA 4NILA 4Q3MA 1A5OC 4L56A 2FFCA 2CZDA 3DI1A 3GM8A 2VCBA 4DXKA 4BF5A 3KS5A 3KX6A 4L6DA 5PTDA 1FKXA 1CXFA 1WYIA 3BCJA 5FI8A 1SZEA 3DFTA 2J6XA 4HA1A 3LCLA 3YPIA 4PUDA 5ECVA 3WLIA 1LL4A 1PIFA 2D2JA 2EG6A 4FMVA 6ENLA 4AZ6A 4QHRA 4AHPA 4GD0A 3OYZA 2UY4A 2DZUA 3HFYA 5HR7A 4GWEA 7CGTA 4PMYA 4ZL1A 1XS2A 5CPTA 1LCOA 2WC7A 4PRTA 1ISVA 3QF0A 1A5SA 3E0VA 1XHGA 2CITA 3OIHA 1R86A 3VKDA 2E1DA 4WQ6A 4X3ZA 2DQXA 3RPMA 1ONRA 2PDGA 1EA9C 3R8RA 1OM0A 3WH9A 4GQGA 3H7UA 6XIAA 1OIMA 2ZUMA 3LB0A 3RO6A 1HJXA 3A64A 3W01A 4W5ZA 2OZTA 1E6PA 1E3ZA 1DTNA 2ACQA 5F2GA 1H7WA 1XCWA 2I1OA 4B15A 1ZL1A 4M7TA 4S3KA 3M6YA 1EEXA 1H0IA 4ICNA 1XLGA 4PMDA 4LAMA 3VOIA 3IVTA 1MUMA 3AS3A 2DSUA 3VZXA 3ONCA 1J8VA 1LDCA 3GZAA 4AFYA 2BZNA 1NP2A 3LNMA 2V5DA 3TH6A 5A2CA 1KW1A 2OLAA 1HP5A 3CO4A 4GABA 3LSCA 2J6VA 3CL6A 5CPQA 4DEFA 3B9AA 4JCLA 2WMHA 1M7PA 2OZ0A 4GGHA 1MXSA 1KR1A 3HJEA 4JX4A 1U5JA 3WZ0E 2DZTA 5FCZA 3C56A 1O60A 4K8EA 1Y0EA 3TSDA 3LEPA 3CPRA 3W1MA 1Z89A 3G1VA 2ONEA 2WPBA 1KFLA 3WF1A 3QXBA 5BCAA 3CM4A 3F2BA 4WSJA 3HQOA 2QJHA 4H9TA 4W7VA 3EWWA 1PHWA 4CD5A 3QSRA 3S2CA 3CO8A 1PTGA 1X96A 1EBGA 3GXIA 3SQLA 1E73M 2IKGA 1OFOA 4EACA 4GO8A 1VJIA 1XD0A 1VBUA 4ZSTA 3B3DA 2ON3A 2A0NA 3W26A 3LM7A 4FIRA 3PAOA 1I45A 1FWHC 3S9YA 4NNBA 2HROA 3K1DA 1DJXA 1TQXA 1K8ZA 3W7MA 1LT7A 2NV1A 1VJSA 1UQYA 4LVGA 2IPFA 1V8EA 4MNKA 1SO4A 4B2DD 4F2TA 4Z2LA 4GBDA 1KM0A 4GACA 6CGTA 2ZVRA 4IP5A 2XU2A 2GJPA 1XYLA 4FX7A 1BVZA 1M53A 3WDHA 1XYBA 4FEZA 2MNRA 2OSXA 2YXXA 5TAOA 3W9ZA 2CETA 3GKFA 4PR4A 1DWIM 1FP9A 7ODCA 1LORA 1W54A 3W1PA 3W72A 1CGYA 1QPOA 7ENLA 3UETA 1HVQA 2V9DA 4NX0A 2IMRA 3GTXA 3CBWA 4JQ4A 3C4UA 4Q8QA 5AC5A 4JDBA 1FCBA 1EFZA 3T8QA 3WK2A 2DZWA 3WLRA 1Q2RA 5FL0A 4GKTA 3HU7A 5EFFA 3N12A 5A8NA 3ICJA 2F7FA 4YL2A 1UKPA 1PZ2A 9CGTA 1X39A 4L4OA 4ZBCA 2J9XA 1VLWA 3BAWA 5EPDA 3KWXA 3JZUA 3S6OA 4MY8A 4DYJA 2Z6JA 2OELA 2VENA 1TPVA 3C2OA 5EMLA 1FX6A 3TJ4A 5D2XA 1Q63A 2Z2BA 3W7QA 5CPSA 4LUIA 4EPBC 3LSBA 2VR2A 2CERA 3M0JA 4O14A 3TEVA 1AD1A 3PF3A 5A6AA 1IF2A 1ZBVA 1XF0A 5IBXC 1T8QA 1UZ4A 5M5DA 1FWNA 2V3FA 1V03A 3NVTA 1Q6EA 1UA7A 3PN8A 3RX4A 3DBPA 2VNCA 3AIWA 1W9VA 4HNTA 4IH3A 3H2NA 3VOHA 5ABGA 3QTGA 1OK6A 2ZICA 1NDZA 4XTIA 4JICA 3C8NA 1UA3A 1ZBCA 1MDLA 4AEEA 3FV9A 4UR8A 5A6BD 4Q4MA 4I9TA 5K9XA 2W79A 4EKJA 4KBXA 5LNSA 4ZZ9A 5LIWX 2VP8A 1KGWA 4DJDA 2FTPA 2QT3A 2XFFA 3UVIA 1KCXA 3HGOA 1V6VA 2C7FA 3M0LA 2J7DA 3BCDA 4ZO7A 1E40A 5HPOA 3AXKA 1VD6A 5CBJA 1ZS2A 2YL9A 4HZ8A 3WQPA 2Z29A 1QUMA 3GB6A 4LB3A 1DJZA 3K4DA 1HKIA 1KBIA 4LAKA 1E1CB 7PTDA 4M51A 3USZA 3RYSA 3NR0A 3MBFA 4F40A 1J0KA 5C7VA 3TV8A 2JK2A 3IRSA 3TJIA 1FVPA 3VU2A 2GUBA 4KWSA 3HIJA 1PUDA 3UJFA 1PE1A 4UTMA 1AL7A 4LV4A 4NYYA 2EQDA 1JCNA 3UD6A 4TOQA 3BZGA 3SUVA 2CLOA 3S83A 2QXWA 1NVMA 4Q8TA 5HMFA 4WJ8A 1TB3A 1F3XA 4XBSA 3NO5A 4O53A 1E1CA 4O50A 3K46A 3N3MA 3W07A 1JYNA 1BYAA 4G2DA 4TX9A 3S5YA 1LP6A 1SZNA 1TR9A 1G1YA 3M7WA 4Z2JA 3N3TA 2E6DA 1I75A 3M0KA 2F2HA 4RNHA 3K13A 5T91A 2GGJA 1D7FA 3GUGA 2P0IA 1RXOB 2ZXBA 3AIBA 3ZM8A 4GVFA 1ZBKA 4J1OA 1JYXA 3VOCA 4PEEA 1WE5A 1YXDA 2VEPA 3QOMA 1RQBA 5D38A 2J8TA 4JTCA 1NOWA 4GJIA 2OYLA 2WM1A 1VH7A 5B7ZA 2GFTA 4NYUA 1YLVA 2J13A 1PTDA 2WSRA 4Y8FA 3F2CA 4Z2KA 3G24A 3OG2A 3WENA 3GU9A 4FOJA 3EWBX 3LN3A 3SCOA 4B3KA 1V3KA 2YFNA 4GXMA 4D2JA 3LRLA 4N02A 4BI5A 3FDKA 1ICPA 1E5JA 3AC0A 2VZTA 3FGCB 1XFBA 1VF8A 1WOBA 2ZA3A 3RG6A 1C90A 1GUVA 3LXBA 4MM1A 4XWUA 2EPMX 3CGTA 4HJWA 2ZC1A 3QZEA 4P7OA 4EPKA 1A3HA 1OC5A 4DUWA 3G3DA 1XP3A 1G01A 3RU8X 4TVDA 1OGGA 4HN8A 5GVJA 3MQTA 1FQ0A 2Y61A 3O1NA 2X40A 4O13A 1F76A 2Y5EA 4CNSA 2XSXA 3WQOA 3STGA 3ZFHA 3VNLA 3ES8A 4FI4A 1CDGA 1JCJA 1A5AA 2OZ3A 3GD6A 3PJWA 3SURA 4JQ2A 1RY8A 1XLIA 4PUNA 4G1NA 4S3GA 3GVRA 1X98A 3GDBA 1JG9A 3MKCA 4PE8A 1G4SA 4IIDA 3QVQA 1E6NA 4LEFA 1EO7A 1BFNA 1P48A 2XSAA 2CLFA 3S8HA 4ZR8A 3ARTA 3G1AA 1GW9A 3UJEA 3M64A 1DJIA 3S47A 3UPMA 4NZ3A 1XDLA 2G95A 3RJXA 6PTDA 3DKJA 5K7JA 3MI3A 4N9DA 4KERA 4F48A 1EDTA 1R30A 2AGTA 4AEFA 1UR1A 4LVFA 1ZLPA 4Q8NA 3G6LA 4NHVA 3OIXA 5DMLA 2NX1A 2VQTA 1UD8A 3NPXA 2FPTA 4EF9A 4LTSA 1VFSA 4YMZA 1BTCA 1JDDA 4US6A 1DJNA 1QNRA 3GR4A 1EC7A 3NCOA 3FYOA 5FEZA 3ITGA 3IGXA 1E43A 2VGBA 3Q67A 4HPHA 4DWSD 4OHQA 3POCA 3MV01 4V1YA 1K6AA 1WOAA 3MUIA 1KO0A 3REQB 3L4UA 4WR3A 2OSWA 3R0UA 2GWNA 5C7HA 1V6WA 5FJJA 1I2OA 1D3CA 2C79A 3DFPA 1QVBA 3PHAA 3GZ3A 4QJ4B 4EXBA 3PBWA 1D9EA 3VDBA 1NWSA 5IBXA 1FFRA 1TRIA 1YE6A 3REQA 4DAIA 4IICA 3WQFA 1G94A 4Z08A 4FZIA 4KCTA 3CIWA 3POHA 1EF2A 2Z7KA 3L5MA 1E0VA 4ADTA 3T0AA 2EG8A 3V75A 2ZQ0A 1SMDA 2OWXA 1SFTA 3VC5A 3QFEA 4QNWA 3P6LA 3U8GA 4JTIA 4GE8A 3UY7A 3U57A 1U1JA 1DIKA 2VR4A 4GYKA 4EAYA 5BU9A 4HTYA 3HBLA 1SJAA 3CV2A 3BL3A 4ZOBA 2XZ9A 3W27A 2I5IA 6TIMA 3NXFA 2YCEA 2YYUA 1R2TA 1O5RA 3SUUA 4BCEA 3KLKA 3NXLA 2DT2A 3FW6A 2Z1BA 1RH9A 4ACYA 4ZO6A 1CPUA 2HS8A 2XUCA 1K1DA 4A8NA 1E15A 3ZLHA 4GC4A 4O1BA 2ZTKA 4A8LA 2ZX7A 1I0BA 1TMLA 1HNYA 5AY7A 2Y89A 4MKSA 3IIVA 5AYZA 2QAFA 4JX5A 1FWFC 5JU6A 4HK6A 3UJ2A 1DIDA 4LC6A 3T2PA 4HYRA 2QIIA 3M4HA 1OFBA 3CLWA 1KBJA 4IFKA 1J0YA 1YPIA 3U6WA 2R1LA 1IYXA 4RZ5A 1DXIA 3W7CA 1QOXA 2X0HA 2QUVA 4UCGA 1UOZA 1LTDA 3MCMA 5E6YA 1YXYA 4Q4OA 3RILA 3VCCA 3URBA 2E77A 5GJNA 2XH4A 3M46A 1OX4B 3S9ZA 1RPXA 2FZ9A 2P76A 4XBJA 3GDKA 4IJCA 2W67A 1PKYA 4M1RA 1H09A 4XAYA 1UBPC 1E0XA 3VNJA 4LPCA 4I6KA 3CHDA 1U5HA 2BG5A 1EC8A 4O15A 4GQQA 3B9EA 1TYGA 5E9AA 1QO2A 4S38A 1V7YA 2PBGA 4V28A 1F4AA 3OZMA 3VFCA 3MV11 2HE5A 1QPQA 3NEVA 3EB3A 4UZSA 2BV9A 1XLKA 2QLYA 1GK8A 4O54A 2YW3A 3WF2A 3WMBA 1UROA 3CV1A 5AHIA 2FQIA 3S1XA 5IDZA 1C9DA 1YBQB 1QHOA 2ZDSA 1LL6A 2OR2A 3CH9A 5D04C 3W00A 4HK7A 3OP2A 5KZDA 1C7TA 2FZBA 1I1WA 1H7NA 1RP8A 1C3FA 4CN4A 2C15A 4DXXA 5D09A 1AL8A 1J96A 2PUZA 3LI1A 3IJQA 3CXOA 2BNJA 3V35A 4ERGA 2R82A 2P53A 2J75A 5D9NA 1US3A 1DQUA 3R25A 1F6PA 5F4WA 2XTKA 4UNKA 3UPWA 4NQ1A 5C9ZA 2FYMA 4W84A 1OYAA 4BY3A 3B0XA 1O12A 4DBEA 3CMFA 3ERPA 3GNXA 2P10A 3JZEA 3GHRA 4FF7A 2A21A 4LB4A 1NH6A 5I3IA 2Z2AA 1S2WA 1S38A 5E5CA 3IRDA 3ECQA 4LT9A 4MY9A 5SWUA 1ELSA 3BAJA 4AU0A 1W3KA 1W37A 1ISXA 4RCXA 4HYVA 2A3LA 3UG4A 2PA6A 3URAA 4XAGA 3T1GA 3KHJA 1Z3NA 4J2PA 1QW8A 4K39A 4GX9A 3KBMA 4IXHA 1WXYA 2XH0A 4NZ5A 1J6PA 3RFAA 1OADA 1FWIC 2JE8A 2WVVB 3UF9A 5A6BA 2BS9A 3LV5A 1HL8A 3KVMA 2F6XA 4S3FA 2ZWZA 3MMUA 4JIIX 3C2VA 2XVPA 1BF2A 3NQCA 2E28A 1RA5A 2V3GA 2Q8ZA 2Y24A 3U0HA 1E6XM 2BY3A 5J5RA 1KM1A 3HG5A 1UZHA 4V33A 1TJ1A 4IXXA 2J79A 4M6PA 4IG2B 2WHLA 5G4EA 3TFCA 3VUSA 2VFFA 2QVHA 1FH7A 3BLFA 1MMFA 3DFSA 3U5YA 1SO3A 2J77A 5LNUA 1HL9A 4IZGA 1C92A 3VGDA 4AC1X 1DWAM 4QG6A 3EX3A 5D03A 3KBWA 3KRSA 1R46A 4HTBA 1H63A 2FH8A 2VUYA 1Q6CA 2ZADA 1A53A 3TA6A 3BSHA 1XPGA 2NT0A 1KM6A 2I5GA 2YSWA 1M3UA 3DERA 3O06A 3HB9A 4YVXA 1JPHA 3WN6A 1FUYA 2PDMA 3KOYA 2Y63A 3ES7A 3OU8A 5JVLA 1E9IA 3H4XA 3IK4A 1MI3A 4IG2A 3TCSA 3VKBA 3W3OA 1DORA 3M5YA 5D02A 3IJ7A 4PUEA 4AZ7A 3EWDA 5ECUA 2BOFX 1JQVA 2RKXA 3BMVA 2PWDA 4XAPA 1HF6A 1JCTA 4KCUA 4O4WA 3KL0A 1TWWA 3M5XA 3PB0A 2XYLA 1WO2A 3CB8A 2VOMA 4XISA 3U4AA 1EX5A 4YXGA 2E5DA 1LM1A 4W93A 3NQDA 3M1ZA 1N7KA 5BRQA 1V0NA 3PAJA 1X8CA 2PWFA 1F5ZA 1ITUA 2XFWA 2ZX5A 3WH8A 1UKSA 3SCQA 3LGDA 3V1PA 2XFRA 4RPQA 1KTCA 3ZR6A 2R1KA 2D69A 4LXFA 3UY8A 2H3DA 4E6MA 4ZOEA 2C6QA 4F0LA 3UJRA 2NV2A 3KBJA 2VURA 4PFMA 4C1NB 1IXOA 1V08A 5D9OA 1EBHA 3OEXA 4GPNA 4K8HA 3V0UA 3PUEA 3ZMRA 3FY1A 1MXGA 1QBBA 3HURA 3QEZA 3PFRA 4Q4QA 4D6GA 3B05A 4GYJA 3TAOA 3BXWA 1DWHM 4DYEA 5HATA 4IOTA 3CMGA 4MDPA 2VZSA 2WANA 3G3MA 1WZMA 3HG2A 3WF4A 1PZ3A 3TDFA 1MEWA 1XIIA 4QLJA 1H0GA 3VAVA 4MYXA 4B3ZA 4TVCA 3GXMA 4Q33A 4C1NA 3FA5A 4Z2HA 1RSCA 4CD4A 2HQAA 4IMGA 2NQLA 4HHLA 2VX4A 3P67A 4GI8A 4UTJA 5LXEA 2OKTA 4L7ZA 1BAGA 3A4JA 1ONEA 4O8AA 4J4KA 5HR6A 3EAUA 2GZXA 2DP3A 1XQLA 5D9MA 5EA9A 4NAEB 3QHNA 3F1QA 1XLCA 1K7EA 1CIUA 4OE7A 3HQNA 5E93A 4DWSB 5CGMA 2DZPA 3S4TA 1PV8A 1TQJA 3GE7A 2O7QA 1G6CA 3LMZA 3UT0A 1OG0A 4H2CA 3S2JA 1PPIA 2I17A 4H7VA 3UJSA 3WSUA 1UKOA 2XIOA 2NLYA 5XIMA 4BEUA 3LM3A 2GDVA 4MYAA 1LT8A 5C9RA 1MUCA 3C0SA 1KRCC 3IJLA 4NP7A 1XLBA 3MKKA 4NAEA 1UUOA 3M44A 2JIEA 1TMHA 3WNNA 4A3QA 4JEJA 2E9MA 3MB9A 4GZJA 4WY0F 3FJNA 4NXKA 1L8PA 1T0OA 4GNVA 5DCDA 3WQVA 1G9HA 4IQLA 1DHKA 1VC4A 1CGUA 4LFYA 1TV7A 4KS0A 4N7QA 3ONBA 1D3HA 1TIWA 2OGYA 2Z00A 1SZGA 3TN4A 3M6DA 3HQPA 4X0NA 4KETA 2FVKA 3QHOA 5A94A 3H70A 3Q94A 3EWXA 3AIEA 3FSUA 3CZKA 2HNEA 1LJYA 4YIWA 3O05A 3VIHA 1E70M 1H2JA 3VXGA 1IR2A 2CZFA 4C6BA 2E1WA 3WEOA 4MY1A 1VFLA 3C2YA 1TE1A 5IDIA 4HKPA 1GWJA 1JL8A 3WBXA 1XICA 3VNZA 4X2RA 4DIAA 5EMMA 3TVAA 1L6FA 4HP5A 2HTMA 1JD9A 2YL6A 3TW7A 2O92A 2TAAA 3NL3A 4JIRA 1XLDA 1UUMA 3NM1A 4KRUA 1QT1A 1CGWA 3PTKA 2PF8A 2GVJA 2BGQA 2HCVA 4A8IA 1HT6A 2DSZA 5BNKA 3PBYA 4O1FA 3I68A 1UMYA 1TPH1 3MSGA 2WJEA 2PDNA 3EWUA 1WKEA 1BVNP 4MWAD 4WLCA 2HWGA 2ISSA 3TQKA 3ITTA 3IJIA 4RNIA 4S3BA 3WLQA 1H7RA 3B0PA 1TV3A 3O0KA 3KTXA 7TAAA 4NU7A 4MWAE 1G0CA 1XRVA 3GC4A 3SUWA 1EPVA 5XINA 3CTTA 1J0JA 1ISYA 1UZDA 3W82A 2W62A 3A24A 3MS8A 1W5OA 4Y7EA 2GLKA 1IIGA 3WJZA 3DESA 4K2SA 3VK5A 4GK8A 1W8SA 3WNKA 3G2GA 4M7SA 3U48A 4AD1A 1GQKA 3O8AA 2AL1A 2BGSA 2VR5A 1ZGDA 2YDQA 4ZCWA 3MANA 4C6OA 2BWGA 3EYPA 4TVUA 4HA0A 1TRDA 4AIEA 3CQIA 3L66A 2OFJA 5I24A 5AZ1A 1NY1A 1K8YA 4MZYA 4OFCA 2BY2A 4QRNA 4JL1A 3LXAA 1WUFA 2RDWA 2WCSA 2E68A 5ABTA 1V0KA 4QJ5B 1DJYA 1GJPA 1SZFA 5EU9A 1L0PA 4B5TA 1JYVA 1Q7ZA 3P3BA 4GQBA 1YADA 3I6RA 3G0UA 4I7UA 4RXGA 2J7CA 1ISZA 4KRZA 2CWNA 1E6ZA 4V27A 4D8ZA 3TC7A 3LI0A 3JW7A 4XZIA 4W4QA 4JBRA 2PP3A 4Z17A 3N04A 3A5VA 3EKZA 3FVDA 1IQ8A 3DDMA 1DKWA 3VTRA 4TU1A 3UG3A 1CI1A 7REQB 2IPJA 1AZ2A 5F4XA 1AA1B 4OV4A 1F7BA 2QDHA 4M5PA 2POTA 3AROA 1MW3A 1DYSA 1YX1A 2INZA 5XIAA 2Z1WA 2FGBA 3IACA 3V0SA 3PJXA 2C0AA 2XSBA 2CBVA 4E4FA 3GLCA 4KIRA 4F0SA 4QFUA 3P2VA 1KBKA 5DQPA 2PCEA 2YZ5A 1I2RA 4HNNA 1NTHA 4RE4A 3HGRA 5M17A 1H1ZA 5LA0A 1GCYA 2ISFA 3SUSA 1DE6A 3TW9A 4I5XA 4TUFA 4B5XA 2J74A 4L5ZA 1GOWA 3ZLFA 1VFHA 3E6EA 3AOFA 4A35A 4KFOA 1DHPA 3QQWA 2PCQA 4UQDA 5AYYA 2ZUUA 2DW7A 1TJ0A 2FFIA 3M41A 3M0IA 2R91A 4PTDA 1GG1A 2VEGA 4LNYA 2BP1A 4PB5A 4K36A 2WQPA 4HCLA 3NL6A 1JUEA 4OJYA 1XIDA 3FLUA 3WH7A 2ANUA 4PMVA 3SY5A 4OECA 1RY0A 1GYMA 4A3YA 4AC7C 4H9MA 5CPOA 1IHIA 5D8WA 1P0NA 2OODA 3U7BA 3ISIX 3G8EA 4HCHA 1VGAA 3N73A 1RHCA 2CFFA 5D2WA 3MTWA 3G1HA 3NURA 4LUYA 3N2OA 2UWFA 2VMFA 2V5JA 4KEMA 1IIHA 3AMLA 4E8GA 2QEZA 5CC7A 1W17A 3CS2A 3H7VA 3LTSA 2UY2A 4N9EA 3B8TA 4NJHA 1ZAIA 2YFOA 3GY1A 2KX9A 3VNKA 2BHZA 3WY1A 1SSDA 2Q6ZA 4D8AA 3G8RA 4IMFA 4PMXA 1AFSA 2RJGA 5BZAA 2WPGA 2QYGA 3PPHA 5HJYA 1UHVA 1GVIA 2WNNA 3D0CA 3INPA 3K30A 1GVQA 1KFWA 3R8GA 4DVOA 1J0HA 2NX3A 2JF7A 4MSSA 1UD6A 4M8UA 5I3DA 3M5ZA 1F6YA 4KQNA 3JUGA 3LBOA 1K9FA 4CQBA 2NSXA 1E0UA 2SFPA 1P1MA 1V79A 3NEHA 5LNWA 3BJTA 1JIBA 1HP4A 2XN2A 3WDJA 4QEHA 1GOIA 3L2IA 4QG8A 1POKA 4FXSA 3PBMA 2WMFA 1K8XA 4CNPA 5JBEA 3W74A 2ZC8A 5B80A 4W5UA 1SW7A 4JQ3A 2OMAA 3VPLA 4CU6A 2PWEA 1PTAA 1MEHA 5GPRA 1PIGA 4YTTA 3K8KA 1WNOA 3WLSA 2GJNA 1BPLB 1CGTA 2IKHA 1E6RA 4PCTA 1PCWA 2C91A 3K2GA 1OZMA 3RIKA 1C8XA 1QPKA 4IMCA 1TIMA 2NV9A 1GQJA 4ACZB 4OGZA 1WXZA 3WG6A 1VFOA 3P62A 3B9OA 1PSCA 5CSYA 3ZJ7A 1D8WA 4JY9A 2VC7A 3MMTA 1UWUA 4GFSA 4HQVA 2VYOA 4IWWA 4JFTA 4IJRA 4NNAA 4YHGA 1OCBA 1ODUA 2D23A 4NIRA 3BLIA 1PKMA 1UP2A 1JF6A 4MADA 2H8XA 4DELA 5I09A 4TIMA 2HXTA 1Q8AA 5LIXX 4H9VA 3WNPA 3KXQA 2NQ5A 3H2CA 4E38A 3A4WA 2DIKA 3VD4A 4M1BA 4AWSA 4D1JA 4LW7A 3LGEA 4H9UA 1UYQA 3S0CA 2YA1A 3MO4A 1PYFA 4LAOA 1BGGA 4FX6M 1E51A 1DP0A 4ACZA 3L5LA 1FWSA 3NQ2A 4HNCA 3KOWA 1XIGA 3ZT7A 1U5VA 2PWHA 3B9DA 4LAUA 3TSMA 1J2WA 4RNJA 3SN4A 1SJDA 1K03A 3UEQA 1OABA 2GQ3A 1VCFA 3WELA 4D8LA 1HGYA 4TMCA 4O0QA 2OYMA 4GH1A 3W6LA 2R6OA 3BV7A 3P60A 4IIFA 2GUYA 4C65A 4H19A 1UOKA 3IUHA 4N4PA 2G50A 1B9ZA 4R5EA 4R34A 4DO4A 3P80A 3ME3A 5E1QA 1EH9A 1WDPA 4IIGA 3BQ5A 4DZIA 3LQGA 4ZTYA 4RLIA 4C6MA 2WMGA 4BQ5A 2HE8A 4PMZA 5I79A 1Z69A 4X61A 3AISA 4CQAA 2H9AB 2G3JA 4KIEA 4FLSA 3TYUA 1VBJA 4LNCA 2CYGA 4U28A 3GXFA 2WXDM 1GVOA 3NZQA 4BS0A 1VEOA 3DU0A 3GIPA 1EXBA 1WA3A 4JYEA 1OG6A 3FYYA 1JXJA 1LG1A 1T96A 3PSVA 3OG3A 2QCCA 1KWKA 3R58A 1EGVA 1XLEA 4O1EA 4K3ZA 3PBUA 1PEZA 5C9WA 1W31A 3CIVA 3T7VA 2BHYA 2HVOA 3AUOA 4WDTA 4EK7A 2H9AA 3PS7A 3WEMA 3WQDA 3QTPA 2PTWA 3DGRA 4JTQA 3VNMA 3V36A 3ZJ6A 3MYPA 1TPWA 1UR8A 2WHKA 2J24A 5HINA 4PBFA 5CLTA 3RM8A 3AXMA 1TWIA 3IUDA 1WKYA 3B8UA 3HJZA 4IX2A 1A5LC 1KXQA 4HJFA 1VRDA 1MUWA 2QCFA 3WNLA 4WDXA 3H2MA 3NSXA 1EXPA 5BOOA 2W6RA 3USBA 1HIZA 4AZBA 1Q7MA 4L4PA 2PODA 3N2CA 3M0VA 3VIPA 4L6HA 4L80A 2H3BA 3T07A 2C3ZA 3PJUA 3UBPC 2YDRA 3GO2A 3QRHA 1VKFA 4RE3A 4ML4A 3GVWA 1CLXA 2HVMA 2XISA 1PX3A 2ISDA 1MNSA 3C5QA 3I3EA 2XH2A 3W73A 4E5TA 4CVUA 1XKJA 2VO5A 3A23A 4MMWA 1X7FA 4PGLA 3PM6A 2X2YA 4YU1A 1J93A 3N4AA 4JTLA 4CD8A 3B06A 3ZT6A 3BJSA 3CYVA 3THCA 1CWYA 1OC6A 5CZSA 1CGVA 3TTYA 4S2CA 2P3ZA 1E9LA 4Z1YA 3BLOA 2YBUA 3G1YA 3F5KA 4GNJA 1TX2A 1NWRA 3OBKA 2EJ1A 1E6SM 1U33A 1UR4A 3W88A 1JZ5A 4GIAA 3CNYA 3S46A 2FZ8A 5HWMA 3S42A 3CAVA 2HXUA 2JKAA