3RLHA

Crystal structure of a class ii phospholipase d from loxosceles intermedia venom
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
278
structure length
278
Chain Sequence
GNRRPIWIMGHMVNAIGQIDEFVNLGANSIETDVSFDDNANPEYTYHGIPCDCGRNCKKYENFNDFLKGLRSATTPGNSKYQEKLVLVVFDLKTGSLYDNQANDAGKKLAKNLLQHYWNNGNNGGRAYIVLSIPDLNHYPLIKGFKDQLTKDGHPELMDKVGHDFSGNDDIGDVGKAYKKAGITGHIWQSDGITNCLPRGLSRVNAAVANRDSANGFINKVYYWTVDKRSTTRDALDAGVDGIMTNYPDVITDVLNEAAYKKKFRVATYDDNPWVTFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a novel class II phospholipase D: Catalytic cleft is modified by a disulphide bridge.
pubmed doi rcsb
source organism Loxosceles intermedia
molecule tags Hydrolase
molecule keywords Sphingomyelin phosphodiesterase D LiSicTox-alphaIA1a
total genus 108
structure length 278
sequence length 278
ec nomenclature ec 3.1.4.4: Phospholipase D.
pdb deposition date 2011-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 3rlhA00
1XX1A 4QJ5B 2PTDA 4QJ4B 1PTDA 3QVQA 1T6MA 3KS5A 4R7OA 2OTDA 4RW5A 5T9BG 3RLHA 3EA3A 1DJHA 1PTGA 3KS6A 4RV3A 3RLGA 5PTDA 3QR1A 1QATA 3MZ2A 3H4WA 1ZCCA 3V18A 1DJYA 1O1ZA 3NO3A 4GNKB 3OHMB 3I10A 1DJIA 2F9RA 4I9TA 4I90A 3H4XA 4F2TA 3CH0A 2PLCA 3EA2A 4I9JA 4PTDA 4F2UA 3V1HA 2PZ0A 1QASA 3L12A 1DJZA 2FJUB 4I9MA 5T91A 2P76A 1AODA 2OOGA 2OR2A 1VD6A 4S3GA 1DJXA 1T8QA 2O55A 3QR0A 1YDYA 1GYMA 4OECA 4RW3A 2ISDA 4QJ3B 4F2BA 3EA1A 6PTDA 4I8YA 3PTDA 3V16A 1DJGA 1DJWA 1V8EA 4Q6XA 2ZKMX 7PTDA 5T9CE
chains in the Genus database with same CATH superfamily
2D24A 3MKVA 1FQ0A 1ME8A 1V6VA 3WLMA 1QBBA 2G8ZA 2R94A 3TAKA 2D2GA 1N8WA 3C0QA 2ALDA 1H7WA 1W9PA 2Z27A 1WA3A 2XIQA 8CGTA 3UJFA 1KW1A 3W88A 8TIMA 4H6KA 1KLYA 3DYMA 3QYSA 3EOUA 1AK5A 2XINA 2XWEA 3EPMA 4K37A 3AJXA 4XZIA 1NDVA 3FS2A 4B91A 3H26A 1PE1A 4ZO6A 3MSGA 1K4HA 1AW5A 4JYFA 1EO7A 5HQEA 1W3HA 1PZ3A 3VXGA 2DZVA 2G3FA 1OGGA 4YTUA 4QX4A 1EDQA 1UA3A 1XH2A 3M64A 1OB0A 2PWDA 1W1IE 2GUYA 4EACA 4IQEA 1M65A 3FK4A 4C60A 1J0HA 1Y8BA 3W1XA 3EMCA 1H0IA 1EHNA 2QAFA 4RPPA 4L61A 5FL0A 3AHXA 1E4MM 2C7FA 3PJTA 1DQUA 1S3TC 4UBPC 1ZAIA 2QCMA 3QMSA 1FWDC 3GVGA 3LNMA 1OJXA 2MUCA 4BEQA 3PZ9A 1YW1A 4RZ4A 1H50A 3PB0A 4TO8A 3C3UA 1J5TA 1EQCA 1KLZA 4WHBA 3KWSA 1H7XA 4HSHA 2V3DA 4GI6A 3GU2A 2OWWA 1JG9A 5IDIA 8XIMA 1PO9A 4EX4A 1U1HA 3PTDA 1XKYA 1C8QA 1S5NA 1JCYA 3BCJA 3TC7A 4OOUA 4D8ZA 4WKAA 2E9BA 3A22A 1S3HA 5LNRA 5KETA 5D8ZA 3R94A 3A4JA 3C5QA 3O1NA 2P3ZA 3LMYA 3PZQA 4DM1A 4IG2B 3VOGA 1F7BA 4B5UA 1TTQA 2DZUA 2ZVRA 1ZB5A 1VFLA 3RLHA 4AZCA 1Q2RA 2JF7A 1ITXA 3UCCA 1W9XA 3W2NA 1FFQA 3B8TA 4QRNA 3KP0A 3ZVHB 3AS0A 3C2EA 2AQOA 2VUYA 3SGZA 4NZCA 2V3FA 5I77A 3M46A 4EPEC 4HU0A 2EKGA 2CBJA 3VD4A 2CPUA 3LRKA 3VDBA 4B92A 3U2OA 1W3LA 3DG6A 4PN2A 4OBTA 4UTTC 4WF7A 1E71M 3H2OA 3O6CA 3S47A 3KOWA 3V1HA 3U6WA 1DJZA 3WJYA 4F0LA 3EBVA 3BQ6A 1N82A 1W2PA 2EJ1A 1E5NA 1S5TA 1AFSA 5LKYA 4H19A 3K4DA 1US3A 4YVVA 3BGAA 3DBPA 5F2MA 2ZUTA 1MVYA 3I4KA 5GJNA 1PWLA 4HHLA 1TVPA 4HCLA 3DI1A 2B81A 3AQUA 4C7GA 3WDHA 1G69A 1DIOA 3M4HA 3DFOA 1E6QM 1FXPA 4J3UA 4ICNA 4NU7A 4EVZA 4F0MA 1KTCA 1FWHC 4PUUA 4FLQA 4OBSA 4DJFC 1HJVA 2PDLA 2J8FA 4HA1A 2A6LA 4U33A 2ZUNA 2P0OA 1KFJA 4X3ZA 2HVNA 4G9PA 3HM7A 1B3XA 1YPXA 1Q6CA 1UD3A 1B54A 3STCA 3ARYA 3STGA 4TQTA 4E6MA 4FP1A 4O1DA 3C6CA 1GQIA 5U4NA 3WLLA 3GIQA 4AVOA 1P0NA 1XFBA 2XGBA 1OD8A 2XN0A 3CM4A 5JBDA 1PZ1A 1RVGA 4UQ9A 2OQLA 2ZX7A 4ZTYA 3SY8A 2DT0A 4XISA 3AXKA 1BKSA 1EZ2A 4GVIA 3WQVA 1SFSA 3W7LA 4V1YA 1ADOA 1K02A 3SUVA 4DJFA 4MYAA 1TO3A 1BXBA 5JIWA 1QPOA 4ZR8A 2JKPA 1B90A 3VO0A 1OFRA 3QBUA 5I3IA 3J7HA 2R1PA 1M7JA 4W85A 4D71A 1JQXA 2HROA 3T7VA 3VUSA 2D23A 5SWUA 3PC0A 3UR8A 3DECA 4YYCA 3OHIA 4IJRA 3F2DA 3FDGA 3WSUA 1JZ2A 2DUZA 4DWSC 1W1VA 2J47A 1OBAA 3IJLA 4XBKA 2WOQA 2Z1VA 2D22A 3ZVIA 5C55A 4KBXA 3GNNA 4A3HA 2IQTA 1KM1A 2QDEA 3EKZA 4TX9A 3TR2A 3CJPA 4JCLA 2IPGA 1TRDA 2I56A 3TQPA 8XIAA 1SJCA 4UZUA 3ARVA 3O15A 1XISA 1US0A 2V2CA 2AQWA 3C3NA 4M8UA 4LCQA 4PBEA 1TJRA 5LNUA 2RUSA 4N02A 4UR9A 5MHBA 3UZWA 1LF1A 3NQVA 1ONRA 5HWMA 2HE8A 2PDMA 2CLEA 1ONWA 1K1DA 1UKPA 3VVGA 5ECVA 3CAWA 1PAMA 3PJXA 3NGJA 3HO8A 4J9JA 1F2JA 4PA8A 2PE4A 4D6EA 1UIPA 3AU2A 1MZHA 1Z89A 1U1UA 1KV5A 1LL6A 1V02E 1Z41A 4LFYA 4YPJA 1J0ZA 1FKXA 1LQ0A 2FKPA 4GACA 2QJGA 2DSVA 5LA2A 4YXGA 3QFEA 1RQEA 1Y7VA 5T9CE 3NGFA 4UQCA 4LBRA 1JULA 3B4YA 1GHRA 1Q5MA 3PWGA 1PCWA 1QPRA 3P81A 3WD4A 4IFKA 1WE5A 4QDPA 1WKDA 2C13A 2CLLA 4ZB5A 3U2ZA 2WSQA 2RDUA 4WVXA 1D8WA 1A5OC 1AA1B 2YYUA 4H8VA 4YYFA 3GG8A 2EXOA 3E0LA 4GUFA 1BWLA 2GDQA 4UIOA 3N6JA 5C7VA 1NH6A 1UROA 2FMNA 3NO3A 2Y88A 1T8XA 1YIXA 2JKAA 2H90A 1CXLA 3KOYA 4WD0A 3W07A 2P53A 3LX9A 3V3WA 1Q6EA 3N13A 2QS8A 3W29A 4J28A 3W7OA 2ZWZA 3KRBA 3M16A 3KS5A 5JBFA 3Q58A 4H00A 4DQWA 4DO5A 3WD1A 4RXGA 2DV0A 4D6JA 2X30A 1F9CA 3QGKC 4IIHA 1H1YA 5CGMA 4GYPA 5G5IA 1O4UA 2CKRA 2VD9A 3MKCA 1XP3A 4FMVA 3ZLGA 3IUIA 1DPMA 4C5YA 1Q6QA 2A1YA 4REQB 4J35A 1VCGA 4JTTA 1I9CB 2D73A 4DXVA 1REQB 3GBEA 5HNRA 1EP1A 1XLAA 1A5SA 4GGHA 4HSOA 2CLKA 1WOAA 1MZRA 3MVTA 2OYMA 1C93A 2NQ5A 1EUAA 4JIHA 4NJKA 4QNWA 4JQ1A 5E6YA 3DFPA 1MW0A 4DY1A 4S2CA 4EKJA 3L5LA 2VENA 3ZO9A 3OVQA 3DHFA 4NYYA 3PULA 4JIIX 1KFCA 4MFDA 2YFNA 1WQ5A 1LROA 1GKRA 5CZJA 3WD2A 1GQNA 3E0FA 4A3RA 2FDMA 3M41A 4S3AA 1X6LA 1GJWA 2XH0A 5JH2A 1FH8A 3NQMA 2PODA 2A7RA 1V3KA 3C61A 1JI1A 1E4LA 1GVIA 5D38A 5LGXA 2YL9A 2XISA 4MSSA 2Y4SA 2F2HA 4ZE5A 2VL4A 4L9XA 1ZGDA 4C6BA 1N2VA 4UQBA 2XU2A 3TWBA 1EA9C 2HPIA 3LA4A 3QHMA 2E8ZA 2I5GA 2CZEA 2ZZ4A 4O1AA 2J7CA 5CZSA 3LQGA 1J6PA 1QK0A 1YBQB 5HJLA 4GZJA 4PB3A 8A3HA 4ZOBA 2DT3A 1IZKA 4MY8A 3V75A 3LXBA 3MQTA 4O4WA 3GVVA 3PB2A 3B0XA 4CU7A 1FWSA 1Q4NX 3W9ZA 5M03A 2ZBTA 3GD6A 4K8GA 3VNLA 3ATYA 4C6DA 3FLUA 1OCQA 3WD3A 3WLSA 1RJRA 5BRBA 3LERA 5H8UA 4Q8QA 2YL8A 3SBFA 4MKNA 3NIYA 4XVEA 3NQFA 4UTLA 1RY0A 4YNGA 3WK1A 5BOFA 2CHOA 2FZDA 4DI9A 3R0DA 3WEOA 2X0YA 4I9JA 2O7QA 2FHBA 1V77A 3RN6A 3CGTA 4AZIA 2NZLA 2PWUA 4FF7A 4ZQCA 1S5MA 3P0XA 3L66A 4OBRA 3VIHA 3MJMA 2ISWA 4ZB0A 4DUOA 1W54A 1FOBA 5ABFA 5I2UA 4GO8A 4C6OA 1V03A 3GC4A 4IOTA 2HTMA 4PC8A 2R1KA 1XIHA 5A8GA 3BGJA 3OVGA 2A5HA 5DANA 3WQFA 3E49A 2OFJA 5AFDA 4ROQA 3HN3A 1LUCA 2BY3A 4P8XA 4BKNA 3PNUA 2VEFA 4TTUA 3NAVA 4YS1A 3HJZA 2YX0A 1XPGA 1V3JA 3IJIA 1J4EA 4AIBA 4JNZA 3TONA 2IUZA 3GC2A 1MXGA 1ADDA 5BOOA 1B3VA 3S5SA 2W61A 1ZY9A 3WX7A 1QPNA 3R8RA 1VD6A 1YPIA 5DT7A 3WQWA 2DIEA 3UZ5A 1RH9A 2OKOA 3AALA 4JY9A 3BOXA 2HNEA 4JCMA 2Y8UA 2GVEA 4HCDA 5CBBA 2E28A 3BH4A 5A6LA 1Q13A 5BROA 4LALA 3V0UA 3TSMA 2JIWA 4CNPA 5BWFA 3QW4B 2G3NA 3UY7A 1E6SM 3OLEA 1E4NA 1DJQA 1CLXA 3SM0A 3Q37A 2NQLA 2XZ9A 1RHCA 4GCXA 4IPJA 1ESWA 4AEFA 5CLTA 4FS9A 2CWXA 4DN1A 5FKYA 2PDPA 4Q8UA 1XIEA 1HF6A 3L4TA 4AHOA 1EGMA 2WHJA 2GQAA 4IZGA 2VC5A 3IARA 2ACQA 1HX0A 1X98A 3OW1A 4B16A 4HN8A 2Q71A 3LUTA 5C7HA 2E5DA 1SMAA 2WBKA 3QW3A 2QJJA 3T42A 3XINA 1G6CA 3GDKA 4Q8TA 1NOFA 4XG1A 2O92A 3UY8A 3TEVA 1A3WA 1MI3A 4Z2HA 2CXGA 3E12A 1GG1A 3HQNA 1C7TA 1LBFA 3TMLA 2E25A 2XZ7A 3HURA 3W76A 3EX1A 2EHHA 1UQZA 3DFNA 1NFPA 4W7VA 3EWXA 4AD5A 4J3SA 1PDZA 4NAFB 3UP8A 3MPGA 3Q67A 1L6WA 3WQ4A 4Q3MA 3SZ8A 1OCNA 1ZP4A 1R47A 3RAOA 1U83A 5CPMA 3FSTA 1R5YA 4YIWA 1HQTA 4HYRA 1XIIA 4IJCA 5I00A 2ZXAA 3NL2A 4LAKA 7A3HA 2CLFA 3QC0A 5E1QA 1V6TA 2HWGA 1EKOA 1HVQA 3I6RA 3L67A 4J7RA 1AD4A 2ZX8A 1V6UA 4RNIA 4ADUA 7TAAA 1BYAA 2XIBA 2BXVA 2G4FA 4IP5A 3W38A 2WHMA 1QU4A 4XTIA 1SPQA 3SSZA 3SY1A 3CLWA 1R0MA 4M80A 4WJXA 1WNOA 3MU7A 1P7TB 2YW3A 3DUGA 5D37A 2QEZA 3VABA 1XD0A 2DQWA 4RE3A 3IACA 1EEPA 3PG8A 3AC0A 2G3JA 1MW2A 3PPCA 4A22A 4HBKA 3V36A 1JD7A 1LZOA 4M81A 2NVCA 1WXZA 4GY1A 4OHQA 3BCFA 4GRSA 5T9BG 1AL8A 1NM9A 4W7UA 2Q3OA 1F6PA 1M7OA 5C2GA 4HPHA 3LB0A 2F9RA 3NR0A 1VRXA 1OZQA 2WC7A 1Q2SA 3S1UA 3COTA 2OR2A 3G1SA 1SZEA 1T99A 4UMBA 4X9YA 1TE1A 4TX6A 5ABHA 2QKFA 4U31A 1Q6FA 2PZNA 3PPGA 3QV9A 3SGGA 1ITUA 1H60A 2CZFA 3M0KA 1CWYA 1IGWA 4IMDA 4UTIA 1KXQA 1UPMB 1B1YA 3UXAA 1VFUA 4ACZB 4NAFA 3QSTA 3HGJA 1S2AA 4EE9A 3ZYZA 5CPQA 3IK4A 4AD1A 1OFOA 2NQ9A 2D0FA 2QULA 4QTGA 1YQ2A 4U5KA 1RJPA 2PU0A 3GBDA 1KR1A 1DWFM 3AIUA 5A6BA 1ZU8A 1HKKA 1ML1A 1CGUA 2WWCA 4PRRA 3IJDA 1BFNA 5JH1A 3KHJA 3RRXA 2NUYA 3O3RA 5IM51 3FJ6A 3R43A 3XIMA 4FF5A 5CAHA 3ZOAA 2D20A 1I75A 4M24A 1SR9A 2Y6ZA 4QQUA 2FQIA 3QJAA 3WNOA 1Q6LA 5CZKA 4LYPA 3SIMA 5TBOA 3LGGA 1XX1A 4J1OA 5LNWA 2VGBA 2WMKA 1EH9A 2PDCA 4IICA 1LQ2A 3KOFA 4GYFA 1DXEA 2OZ0A 1TUXA 3T0AA 1C3FA 3RNDA 4D72A 2Y7FA 1JL8A 1WDSA 2H6RA 2VEKA 2V5CA 2WQPA 1J01A 3VA8A 4JNMA 4B3LA 2Z0IA 4X2RA 1FBAA 1TB3A 4FHAA 4CU6A 2DZSA 1HVXA 4BR1A 2J77A 5CC7A 5U7SA 1KM6A 2ZUVA 1C8XA 3LN3A 1TX0A 3VOHA 5ABTA 9XIAA 3P61A 3MVIA 1I2OA 4HMDA 5AKQA 4XQ6A 1AH4A 5HAOA 3B04A 4I90A 2OEJA 1R6WA 4WUIA 4N4QA 1VJSA 3CEUA 5CZTA 7REQA 3NURA 1XYLA 4C1KA 3FAXA 3I3EA 3P7YA 3U4FA 1UR2A 2QLYA 1E1EA 1NWUA 1KD0A 1FP9A 5XINA 3WH6A 3MO4A 1VEOA 1NSJA 2DVXA 1OM0A 3ONCA 2HV5A 3BXWA 3AUJA 4JIPA 4DPPA 4ML9A 5HMFA 3B9AA 1SO6A 1QCWA 4BI5A 3DKJA 4G1NA 3LHUA 1LJYA 3D47A 2UWFA 3T0DA 4JTAA 1XLHA 1QNPA 2YLLA 1D7KA 1KV8A 1NARA 4IMCA 2VC7A 1U30A 2XFWA 4H2HA 1W5NA 1QAPA 1T8QA 4D6HA 1UZ4A 4ES4A 3BZJA 2VEMA 1PKLA 4WY0B 4F3HA 1EYEA 2WLYA 1ITQA 4O1FA 4LXFA 4RE0A 2HZGA 1UR3M 4H9UA 1TWZA 1W3TA 1JDDA 1SZRA 3MHUA 3O6YX 5BU6A 4JTFA 2OEKA 1DKWA 4MTVA 4L9ZA 4PTXA 3RIKA 4XZMX 4AD3A 4DNMA 5D9PA 4L5ZA 4O16A 3GDMA 1E40A 4HTBA 4PCSA 4GBDA 3N9KA 4DJDA 3S1VA 2QW5A 3REQA 4LVGA 1EXBA 4DHGA 4DNHA 4JIEA 3LLFA 4KWVA 4OE7A 3CMGA 2AMXA 3N15A 2FFCA 3VIGA 1R30A 4ZO9A 5C9XA 4KEZA 5A8MA 1NAL1 2VFHA 2EG6A 4JQ4A 1H61A 1XLFA 4OQVA 4B5XA 3WYZA 1X8FA 3L0GA 2ZE0A 1GOKA 1JVNA 1IZCA 3FJLA 1KKRA 2O9TA 3H53A 4GINA 2E8YA 1XQKA 3VD9A 5C6MA 1XICA 3VZYA 4Y9MA 3WZ0E 4GIAA 1GUVA 5BOEA 4ERAA 3KBNA 1EPVA 3M0JA 2BVYA 1FWAC 2XVKA 2ATSA 1QUMA 3D3AA 1BSLA 3GK0A 5E9XA 5D32A 4PB4A 5AECA 4ERIA 1XH0A 4M6PA 4JHOA 3L4WA 3BWWA 4DWSD 1FDYA 5B80A 4K7VA 2VX6A 3DHDA 3OEXA 1XDLA 5AYYA 1Q65A 3TYUA 1WUEA 3T0BA 2XM1A 3U57A 2QDHA 4PUDA 5AC8A 3QPEA 1JYNA 2GQ9A 1J9YA 3AYVA 3M44A 3BG9A 1CX9A 5DCDA 3SW6A 2AL2B 3KUMA 2Q01A 5A2AA 2QCFA 2BXYA 3GW3A 3MSYA 1MUMA 4GUJA 4NX5A 1E6RA 4WDTA 1GYMA 3JS3A 3ZSTA 2YGYA 2ISSA 5K7JA 5IHRA 4RJEA 2E3ZA 2VTFA 3LI1A 4NAEB 3W7RA 2EEXA 2BDQA 3U3HA 1K6WA 3W1LA 3G77A 4HNTA 1F61A 3UVIA 1US2A 5K3VA 1EF3A 4QAWA 3OZYA 3VKAA 2VZVA 3A47A 5I3FA 1OFDA 2FZ8A 2VOMA 3FV9A 3UWZA 1EJTC 4XKYA 1MEIA 4J3VA 1EIBA 3W1AA 5DY3A 4XIMA 1K6AA 3G1FA 4HNLA 3RO6A 4NNBA 2X41A 3CUIA 2POTA 1QATA 2VHLA 1M41A 1RK5A 4OU1A 2QGYA 7TIMA 3RILA 4XZ9A 1GHSA 3CAKA 1GOOA 5IBXC 1XYCA 2CZVA 1FWJC 3NQAA 3AMGA 4QG9A 3FCPA 1KQYA 4R9OA 1AVAA 1XM3A 3S6DA 4BCEA 1XPYA 2PDKA 1R3VA 1KQZA 3VGHA 4QEEA 1ME7A 5FESA 1ALDA 3VOCA 3PZVA 4R27A 2DVUA 2NXIA 2IPFA 5DCBA 2ADAA 3V7PA 2VGFA 3ARSA 3IUHA 1ZFJA 2RGLA 5B7ZA 3WO8A 1J0YA 1JPKA 3T81A 1TV7A 3UNDA 5LIWX 2OO0A 2XYLA 2W9MA 3O05A 1HO4A 4C6CA 4C6NA 4FR6A 3EB4A 1LOQA 3AMKA 1CXIA 1TV3A 3QFWA 1OVDA 4S3JA 3SEPA 4V2XA 5I3GA 2A3EA 1P0KA 4M1RA 4LS2A 3O0KA 1CENA 3R7MA 3PK7A 4AYGA 1DWIM 2VFIA 4GH3A 3T55A 1U22A 1R87A 3BPWA 1LM1A 2VFEA 1DWGM 5EMMA 3OG2A 4ILSA 5IOBA 2QYGA 1OX4B 3TZFA 3WNNA 2IMRA 2Z2UA 3DAQA 1SJDA 1B3ZA 1ZRQA 1POKA 2X2GA 4HJWA 4RX0A 3V4BA 4DWDA 1IT7A 4Z0JA 5TIMA 2W5FA 3VYLA 2ZC8A 3M7WA 2VX7A 3URQA 4E4PA 2BHYA 1MEWA 5FF4A 1MFUA 2WCGA 3IWPA 4HTYA 5FEZA 1W1A1 1EL3A 4YVPA 3EA3A 1IWAA 4KWUA 1S2CA 4RXFA 2HS6A 4TIMA 3UA4A 4POCA 4FLOA 1WBJA 2VX5A 4KCTA 3OO2A 1S2WA 2XVNA 1QWGA 3LS9A 3W6YA 4DJEA 5CPSA 3NPVA 1UR1A 3NQGA 2YBUA 1JJKA 1FWBC 4DXXA 4UNKA 2INFA 5I3DA 3KBSA 3FN9A 4Y2WA 1C9WA 4DZAA 3PZUA 4PE8A 3UCQA 4QJ1A 2E68A 1VCFA 1YXYA 4DBUA 4M0XA 3TSDA 1EPXA 3PWIA 4MB1A 1QO2A 1QRQA 2WV8A 3W24A 4IL0A 3NOYA 2YA2A 3INPA 3T6CA 3G1AA 4C6LA 4NSBA 3WLJA 3CO8A 3SB0A 1W9UA 3W7NA 1O5KA 1UHVA 5A6KA 2FTWA 1XI3A 1ISYA 3OA5A 3T05A 2VWSA 1X6NA 3G1HA 1TPFA 3ID7A 1TWDA 1RV8A 3C2OA 2X1RA 3S6TA 7ENLA 4RPQA 1ZCOA 1V7AA 1KCXA 3SRKA 3I3BA 1R85A 3HBLA 3P0WA 4R5EA 3TR9A 2D3NA 2CBUA 3CB8A 2WM1A 4GNJA 4M6QA 3D0CA 1KBJA 2IXUA 2FJKA 3KOXA 3VDCA 2JF6A 2WMHA 3PBYA 1JZ7A 5I6SA 4DWSA 1Q6OA 1BXCA 3CH9A 5I06A 4FSAA 4O10A 2WMJA 3GXFA 1IT0A 1JNDA 4FIQA 2C0HA 2RJGA 1HP4A 2X40A 3UWQA 1VBRA 4TVDA 4UZSA 3PM6A 2PGEA 2BXZA 3R5EA 1WP6A 1A0EA 1VCVA 2E1WA 5BXRA 4V1XA 3L5AA 2UV8G 4GQ0A 4YTTA 4OKDA 3MC5A 4GY0A 3FVMA 1GVEA 4DLFA 4NZ5A 1ZL1A 2C0AA 4L4OA 2W66A 4NRSA 2D2OA 4DZHA 3GTNA 3SCNA 1XW8A 4J2MA 1V0KA 4H7VA 4C6PA 2G3IA 5A6JA 1LL7A 4HD5A 4A3QA 2ZYFA 3NEVA 3ITXA 3MTWA 4G56A 2PWVA 2OZ8A 1AD1A 2VJXA 3L12A 4QE1A 1TPWA 3VD7A 1W1PA 1YDVA 3TWAA 4A8LA 4JTJA 1PL9A 3UG5A 4ADTA 1AQMA 5F1UA 4A3UA 4G8TA 1DJYA 1MDRA 2VCCA 4H9VA 4L6DA 4PCTA 2JGYA 2VP8A 2XN1A 4KFPA 3D6NA 4I7UA 4PMJA 2PBOA 4LEFA 3A6OA 1JYWA 2O4MA 5AHLA 4Q8VA 3VGBA 3EWYA 5D09A 3SCRA 3EGJA 1KBIA 5JBEA 3E38A 3LLDA 4MZYA 3EYPA 1BWVA 4BS0A 2V5DA 4NZ3A 1S2UA 1PTDA 3GG7A 4RLIA 3DG3A 4LV4A 2NX9A 1ZLPA 1N55A 4EANA 3R89A 1B4EA 1K70A 4JYDA 3I7SA 3M9YA 1GZGA 4HNOA 3F03K 3H6OA 1UP0A 1VKFA 3V35A 1LBMA 2PWHA 1ZALA 1DJWA 1GORA 4AHQA 4FX6M 1WX0A 1WKFA 5LIYX 3LZ3A 2EG7A 3HZ3A 1BLIA 4KF1A 3RR1A 3NQ2A 2ONEA 3W83A 1A5CA 4ZSTA 4PBFA 3G6MA 1CGXA 1VLWA 1XKJA 3DFQA 4C6IA 5HR7A 1C8VA 4QDMA 3GVQA 5EMLA 4LOCA 3W1TA 4AC1X 2Q09A 3AZTA 3LK6A 3KL3A 4US5D 3WQ6A 3BLOA 1H49A 2EF9A 1HL2A 1H7NA 3EDEA 3KVLA 4LW7A 4NASA 4NZJA 3AS2A 4D1IA 4C91A 2CLIA 1YNPA 1GT8A 1O5QA 1TVLA 4A35A 3SRDA 5AC7A 3II1A 2Z6IA 1QT1A 4ZQMA 3S2MA 4XAFA 5D4YA 2XM2A 3G1DA 3ZJ6A 3MUXA 2A3HA 3AZRA 1F3EA 4QJ3B 3BO9A 3TV8A 5BXSA 2X1UA 3UT0A 3E0IA 2FB2A 1OSEA 4Q8PA 3CZ8A 4EPBC 3SQSA 3SN0A 5FEXA 1UC4A 1F6YA 4XBSA 2YA0A 5LNVA 4X61A 1V08A 3L2LA 2GK1B 4O52A 4ATDA 1R2TA 3CO4A 2PA6A 3LXCA 5C54A 4JIQA 4ZO7A 1TELA 3UXDA 1FCUA 1DHPA 5AB3A 3P5YA 3M0YA 3WLIA 1OADA 3EDFA 2FMOA 4A21A 5LIXX 3IV8A 4BI7A 1BTMA 3GAYA 3M0VA 4C1NB 1UKTA 3EX4A 1B4KA 1JPMA 2HDJA 4AC7C 3KXQA 4D6FA 2A3AA 9CGTA 1CNVA 1Q85A 4TX8A 3DFTA 1R3SA 1QI2A 2Y61A 2ZA1A 3QHNA 4KETA 4PFMA 2DW7A 3TLQA 3UPBA 4QLJA 1L8NA 1PIFA 3UEQA 3DZ1A 3ITLA 1IXOA 4GI4A 2OG9A 3LG3A 5FJRA 3QZ6A 4HYVA 4PUJA 5D2VA 5A94A 3KEHA 4E2VA 1PYMA 4OECA 4IIDA 1UD6A 3QF0A 3R8HA 3U7BA 1GOQA 4FALA 3ONBA 4CD6A 4UUIA 1ZBVA 1QNRA 4CUCA 1P0DA 3TNOA 1XSIA 3RCYA 2ZTJA 4Z2JA 3H7UA 2AMGA 1B9ZA 5I78A 2OLSA 4AX6A 2DZTA 3LOTA 4EPDC 3VIIA 1H5YA 1OX5A 4EK7A 1VH7A 1EOKA 2Z6JA 4EAMA 2H8XA 3U4AA 3A12A 4UFMA 5HNTA 2WJEA 3KLLA 3WL0A 3A9IA 3C0JA 4KIEA 3RCNA 4ZOEA 1JDEA 4PMYA 4J3TA 5E93A 1XV8A 4US5A 2XGIA 5KZ6A 4YLWA 2J4GA 4HCHA 4JN7A 4LV9A 5D9MA 1IEIA 4R3UA 1JZ5A 3T8QA 4G1KA 3VNDA 4IUOA 2AGTA 2PP1A 1PXGA 5EMUA 4BF9A 3SAZA 2JK2A 3HFTA 2NT0A 3OYZA 1WO2A 1V4YA 3O16A 4DZIA 3TYAA 4KKXA 1FWCC 3A5FA 5XIAA 3PZIA 4QS6A 1XIMA 3ANVA 1VENA 1VPYA 3RHGA 1NWRA 4XZNX 3CAVA 1KWKA 5C70A 1XIBA 3MI3A 2X16A 1UMLA 3G8EA 4GWEA 4O8AA 2P1FA 4I3GA 3WK0A 1V02A 4Y8EA 4ZZ9A 2VRKA 1UH4A 1KBBA 1YDNA 1P6BA 1P5BA 2ZKMX 1D9EA 1DBTA 4GOAA 2HRWA 4LX4A 3TX9A 2YA1A 4EXQA 1ZS2A 3B0UX 2V3EA 1THFD 4I5XA 4N42A 3MA8A 3B8SA 5A3HA 3VC6A 3VD3A 2WCSA 1ZJAA 2DFAA 1LLWA 2UBPC 4PMVA 1DP0A 4WJ8A 3RPDA 3QQWA 2XSXA 4XBJA 5A6MA 2J74A 1KTBA 1H3GA 4HHPA 1CXFA 3KBMA 1ZBWA 1VFHA 2QT3A 5DCEA 1I45A 1FH7A 3L2IA 3S2NA 5C2XA 3S5NA 4JX6A 1CCWB 3W7EA 1NELA 2R9RA 3EWWA 4LUSA 1U5VA 3TA6A 1BTCA 2QPUA 1U5HA 1PB0A 4E4UA 3RFAA 2RAGA 4ZB2A 3W7PA 3ARQA 3ITTA 3LCWA 3QV6A 2BS9A 4JICA 2VMFA 2PP3A 2XFRA 3GH5A 3TP4A 2YL5A 3VINA 4ZQOA 2HE5A 4NXKA 4L4MA 4UTKA 4MF4A 4AX7A 4FX8A 4HYWA 5CBJA 1EOMA 4MB3A 3PN8A 1H51A 3CV7A 2PDGA 3I68A 4QISA 2PF0A 1P43A 2FZMA 1EC7A 2YL6A 5LIUX 3T40A 5FSEC 1MUWA 2Q8XA 3VCCA 1K4GA 4FLRA 4LH8A 1W9BM 1V93A 2J7BA 4CVUA 1EP2A 1ICPA 3QGAC 8RUCA 3PBMA 1T5AA 2PDFA 3MMDA 3MYPA 1A0CA 4IJBA 1LQAA 1UA7A 4P7NA 4AU0A 4JIRA 3FDKA 3H2FA 3S1XA 5AZ0A 1UPPA 2QXWA 1JPDX 2DZPA 4E8GA 2WMGA 2R1NA 4GMEA 5EA9A 2RFGA 4H9XA 4CQBA 2O55A 3G6LA 2XN2A 1TE6A 4DELA 1O66A 2NV2A 5FSDC 2CCRA 4J3ZA 4Y96A 4H1ZA 4JEJA 4HOZA 1XBVA 1RR2A 2BG5A 1PHQA 1B5TA 2INZA 2AAAA 3KOZA 3S42A 5BXPA 4ORMA 1I6NA 1XLMA 4LF2A 2QUMA 3MB9A 3C2FA 3MW7A 3N9RA 3BAKA 4LUSB 2VZOA 3DESA 1UKOA 1XGEA 1TV5A 3N9SA 1JCXA 4R53A 4MNJA 3H70A 2W3ZA 1XLBA 1Q6RA 3F4VA 4OT7A 3NM3A 4OVXA 4F79A 3V1PA 2POZA 2GDUA 3AISA 4I8YA 4MKSA 2DSZA 1CGWA 1L6YA 4UQDA 6ALDA 1EDGA 4J3XA 3JR2A 2YB4A 2ZXBA 3TN5A 3S9IA 3SUTA 3KP1A 1IXQA 3WUGA 3WDIA 1SW7A 3VIKA 4ATWA 3IJ9A 3NQEA 3V5OA 1OG0A 3HG2A 1I0DA 1NQKA 3TIMA 3NA8A 2I16A 5I24A 1FWTA 4UB9A 1TMQA 5CJMA 2OPJA 3CQIA 3CZJA 3Q45A 4AMAA 3FA3A 1PVNA 1GVRA 3ARRA 1SO3A 4KCVA 7ODCA 3IIXA 3ITOA 3ZFHA 1QBAA 4WEVX 3EOOA 1I2NA 1OABA 7REQB 1F76A 2O9PA 1OT1A 2B0MA 3KBWA 1MDLA 3TA9A 1S2VA 3THUA 3TW7A 4ZBCA 1W5QA 1ME9A 3NO5A 1S5WA 1DWAM 4DYKA 5A5WA 1V7YA 3MUCA 4PYSA 3H23A 1XINA 4GQRA 2W91A 5CPNA 3WQ5A 3XISA 3EXSA 3OA3A 4LRTA 4MNKA 5CPLA 4DPQA 3TFCA 5AHMA 5G4EA 1LWIA 1OEPA 3W0KA 4U10A 4AISA 5BMXA 2ZVIA 4F40A 6REQB 4CGTA 2NLIA 4F0RA 3LU2A 3N6QA 3RCMA 4UFKA 4DYJA 1AJ2A 2PI6A 2YBVA 3QGVA 3CH0A 3OQ8A 2ZA2A 3ISIX 3MMTA 1B3OA 4H6QA 1WDPA 4E0CA 2AQVA 2WZEA 2NSOA 5HUOA 1ZBKA 2C18A 3QKEA 4AXNA 2NQJA 1GYLA 3W7CA 1GOXA 1LORA 1XIJA 1F07A 1TIMA 3W1UA 1UQYA 1QHZA 1UYQA 3STFA 4JKLA 1YDOA 3CUZA 4I9MA 3WH9A 2DH3A 1QTWA 1T40A 1ISXA 1QDSA 4LUJA 2GUUA 1MXSA 1I1WA 2ZZ7A 2ZUMA 4G6CA 2EAWA 4NYUA 3ITVA 5I3HA 2AL2A 3UGVA 1B30A 3KWXA 2A7NA 1RCXB 3AIVA 3AMLA 5H1WA 4MZ8A 2O0TA 3W37A 3S8HA 1KGXA 2XWDA 2ZUSA 1QVBA 1NWTA 1W3KA 3AHZA 1KO0A 4MWAB 4F48A 1XDJA 5CXPA 4H8NA 2VOTA 3W22A 2A2IA 3MANA 2VI0A 3OG3A 3TDFA 3LCXA 3PZOA 1LYXA 3QXBA 2VELA 3EWUA 4AXKA 4B2DA 3WQOA 2HVMA 5HMSA 3ECQA 3KBJA 2CKSA 2WC3A 2X1IA 3M1ZA 3T08A 3P80A 3K4WA 2Z2BA 1CI1A 1IWPA 2FH8A 5AHEA 1YTEA 2X8RA 2ZTKA 5H91A 3M43A 1XGDA 5JUVA 1F8MA 2WKJA 3HOJA 4O0ZA 4XD5A 2FFIA 5KZDA 2DUAA 4Q4SA 1RLDA 5D30A 2W92A 3HIJA 1QI5A 3WK3A 3B3DA 2BVTA 4K8EA 1GZ1A 2DPEA 1W91A 3AHVA 3ARTA 3DFHA 3P60A 3LY0A 4L65A 3URBA 4D6IA 3PZTA 4WY0A 1UR4A 2XGZA 4Q4RA 1H41A 3EOEA 3POCA 2Y7GA 4UTWA 5H2ZA 2D0HA 2E1DA 2VVNA 1NF0A 5CQ1A 3CZEA 3VE7A 3R13A 4PUKA 3EB3A 1FY6A 3SCWA 4A2RA 3CV2A 3MUY1 4XKMA 3DBNA 4GZIA 4P7QA 4LB4A 2E6DA 1R7AA 3UR5A 1KM2A 1OC6A 5EY5A 1RA5A 3MDUA 1YADA 3LCIA 1AODA 4HNCA 2GGIA 3S9YA 2Z25A 3RPTA 3S6OA 1W5PA 1G94A 1UUQA 3A21A 4LTSA 3NQDA 4JFVA 1VHCA 4N6EA 3B0YA 4IGHA 1J0IA 2AGKA 3AZSA 2C15A 3P62A 1W17A 3OGVA 5DF0A 4LNCA 1B3YA 3SJNA 3EX6A 5J04A 3OGSA 1RJQA 2YCLB 2ZRWA 1XQLA 4HPJA 1FHVA 4HA3A 4DM2A 2ZDRA 1NU5A 4GXPA 5K2ZA 3G3DA 1BVZA 1EWEA 4UQAA 2PDBA 1PSCA 4XD3A 2NSXA 3HPSA 1JDCA 1S38A 1NVMA 3STPA 4AB4A 1IEWA 1G4SA 3QPYA 3M7SA 5KSWA 2P50A 1ISWA 2PD5A 3CTTA 4NIRA 1M53A 3NL6A 1MQPA 3PS7A 3CHEA 4PL1A 2NQZA 1PYFA 5IBXA 5I23A 2NT1A 3CC1A 1JF6A 3PG9A 4KPLA 4ENLA 2D2JA 2VC9A 1NQ6A 1GTEA 1DJNA 3TYZA 1XIFA 3U7VA 4XAPA 3BSHA 4GC4A 1HG3A 5C71A 1TYGA 2TMDA 4GXWA 3N3TA 4GJJA 2O56A 1X1OA 2VDIA 3LHTA 1P48A 3RJXA 5MF5A 3RU8X 1CLVA 3IGUA 3EEZA 3K46A 1R7OA 3EWDA 4DJED 1CW2A 1H62A 2OWXA 2QVNA 3G0SA 2F6XA 3BTNA 1UKSA 3WF2A 2WVTA 1XFCA 2AOSA 2CW6A 4M29A 2W67A 2OGJA 4S3CA 2ZUWA 3CZGA 1XWYA 3LM3A 4H9ZA 4RCXA 3QN3A 3ZT6A 1UD8A 3SIZA 3OTRA 3TYEA 3W53A 3RDKA 1Z3NA 3BLEA 3SRHA 3JRKA 4R34A 4HZ6A 4N9EA 4BA0A 3R1ZA 2PRMA 5I03A 2ANUA 4FNTA 1JUBA 3SY5A 3MDWA 3H55A 1W5OA 5AHIA 4P8WA 2J88A 5TNVA 4K8HA 3URNA 1JEZA 2HNHA 2G95A 4LAMA 3GS6A 4O19A 2GOKA 1IF2A 1QNOA 5G2IA 1PX4A 1V3MA 4PTNA 2WCAA 1SJBA 2VM8A 5D02A 4Q4MA 1E9LA 3PVFA 2E6YA 2NVAA 1Q6GA 3B0PA 3BOLA 1RP8A 2IW0A 2CFFA 1FXQA 3MMUA 1VFOA 2JBMA 2DEPA 3WJZA 3GH4A 4PMNA 1LG1A 3F4DA 3RRAA 1U5JA 4IX2A 4NNAA 1KFLA 5I02A 2DH2A 1ADSA 3N2CA 4XZHA 4XTDA 3HMJG 3EWBX 5KZEA 2IKHA 3TLLA 3WFLA 3ABRA 3G0XA 3AWOA 3ZT7A 3LRLA 3OYXA 4MM1A 1OFPA 3TOYA 4IXXA 3NNTA 1ZNNA 1X1ZA 1UJPA 3G1RA 4MFEA 1E4IA 3VMOA 4BF5A 3FA5A 1X39A 1Q45A 1BG9A 1D8CA 2P0IA 4HNNA 3WUFA 2DQXA 1JCMP 1GVOA 5J5RA 2ESCA 2EKCA 3FSUA 4M3PA 2CETA 2OO6A 1SVDA 2J24A 4GYKA 3BV4A 4L4LA 1DEDA 5FJIA 2C14A 3CQHA 4LBSA 1I2RA 3N34A 1TPH1 3CUGA 3LZ5A 4ATLA 5FL1A 4MVAA 4NQ1A 3TJXA 3WLOA 4LYKA 4K36A 3RR4A 4S2BA 4BJHA 2PGWA 3DOPA 3BAXA 1Y5XA 5D2WA 4HN4A 6TAAA 3TW9A 4LGXA 3HPXA 5ECUA 1FH9A 2QJMA 2CERA 3AS1A 2GGEA 3GWQA 4XO6A 4RNFA 1AZ2A 1WV2A 5DMMA 3KE0A 2VR5A 1KRMA 4Q8OA 2FVKA 1NDYA 2GGJA 4GVHA 5FI8A 1GVQA 1CBGA 3SECA 4AMCA 3W25A 3W01A 3THDA 5HATA 3WBWA 2EG8A 3EDKA 4QCEA 1C9DA 3FYOA 5FJUA 1IQ8A 3NQBA 5AYIA 4AZ5A 2JQXA 3VIJA 1OCBA 4K38A 4Y90A 4WCJA 3TTSA 3RUBL 3FHQA 1EQPA 4Z1BA 1PIGA 4JN6A 2QJHA 3PWAA 3K30A 2YCIX 3B8IA 1AJZA 1SYTA 4O13A 3AIRA 3MZ2A 1ODZA 3IIZA 3OODA 3EMZA 3TUUA 1IR2A 2J7DA 4LS0A 3MZNA 3IK2A 1M03A 3WQCA 1PKNA 5I79A 2PDHA 4Y9PA 5KMYA 2YSWA 3NCOA 1GYNA 2BMBA 4GUIA 4IUGA 4WJEA 3SO7A 2BB0A 1UOKA 4LQ1A 3H8AA 2WZTA 4IL2A 5FJOA 4E2DA 1EC9A 5CPOA 4M19A 4BEUA 3WF4A 1P4CA 2CNCA 3WMCA 3QKZA 3KL5A 3EDJA 4RW3A 2CWNA 4C5ZA 1UWSA 3EKLA 3T44A 1XBZA 1JQVA 1FCVA 2VGGA 4CCEA 3M5VA 1Z9AA 1JYXA 3WNPA 2W62A 1XYZA 4WZHA 4F2UA 5FF7A 3W85A 4HZ8A 3W2LA 5FCZA 1CYGA 1UWQA 2QMJA 4O14A 3ARXA 1G5AA 3GUGA 4JEQA 3N17A 4GVFA 2OLAA 5K9CA 1HZYA 1W31A 4JX5A 4WDUA 5HK4A 1S1PA 3C0LA 4KT2A 4KRZA 3K8KA 1S1RA 4WY0F 1E70M 2QCCA 4B4HA 3PJWA 1M7PA 4F9JA 1X7FA 1OC7A 1UWIA 3NQCA 4BY3A 4P8UA 3MJYA 3AYSA 4TMBA 3A64A 1B31A 1XXXA 4HT3A 5HJXA 3PUOA 4XD4A 2GJLA 3TC6A 5ABFB 1RLCL 3ZS4A 2QGHA 1XSKA 5HJYA 4JTCA 4H9TA 4JKMA 4RW5A 3UXLA 2NX1A 3IVSA 4KWWA 4I9TA 1GCYA 1WYIA 4ZOCA 3ZJ7A 1KBKA 3N2XA 4HA0A 1TRIA 2ZXDA 2PDQA 3W1MA 3KDOA 3QZEA 1XSJA 1FRBA 2HPMA 4ZL1A 4Q4KA 5A2BA 1NY1A 4MLJA 3AICA 1BHGA 5JU6A 3KVJA 2XDFA 2OCZA 3W74A 3QEZA 1J10A 3M07A 3B9DA 1RPXA 1RAKA 1WB0A 3UNTA 3GXDA 1TZZA 2XJ7A 2YZRA 2JEPA 3S4TA 1GOWA 2EQDA 1R3QA 2C8NA 1TTJA 1M6JA 2ON3A 3DG7A 3O6DA 3L0NA 3U0HA 5TAOA 1E51A 1KWGA 1TZ9A 1V5XA 2GQ8A 5FF3A 3VU2A 1OT2A 3SJ3A 4ZFCA 3GXNA 2D0GA 2PUZA 1GJPA 3CLMA 2VCBA 2VURA 2ZX6A 3RITA 3KL0A 4S3BA 1VJZA 3BCDA 7XIMA 4LUYA 1MW3A 3FVDA 3LPGA 4HK6A 1L2UA 5HQLA 4PTVA 4MGGA 2ZZ1A 1JZ3A 3GTIA 1NIUA 3BUVA 4C6QA 3IEBA 4PZVA 4JD4A 2HQAA 4LWWA 4IISA 2Y85A 4C7DA 2J75A 4TVCA 4UQEA 3V0SA 2GJNA 2R1LA 4IM4A 1SMDA 1UIOA 2ZRZA 1CEOA 2QCNA 2VFDA 3AMCA 3BMVA 5KZMA 2AL1A 4XZBA 1KBLA 2NXHA 4GUGA 1U33A 3S83A 3A23A 3KTXA 4WIWA 5AHNA 3PBVA 2E67A 3UPWA 2BNJA 5HR6A 2QPSA 1R9YA 4D9PA 4EWJA 3GYEA 3W7JA 4H4IA 5B7YA 2V2HA 3QR3A 1ZUAX 1Z6KA 4UCGA 2VO5A 1FX6A 1HJWA 5EU9A 2CXEA 4W4QA 1PBGA 4IIGA 4HZMA 1G67A 4H04A 4W8LA 5CKSA 2JIEA 4OUIA 1IE7C 4IGNA 1XYBA 3B9EA 1TWSA 2VD8A 4AFYA 4P7LA 4TOQA 3M0MA 3R58A 4NJIA 5G2WA 4QCFA 1SU5A 2KAUC 1HIZA 5CSRA 1QPQA 1RVKA 1TZ7A 1F73A 1DIEA 1ZPTA 2FHFA 1KM3A 2PDNA 2E5CA 3CPRA 1D7FA 5C0QA 3CHFA 4S39A 4MWAE 3BG5A 3WDQA 1UB3A 4DJFD 4KCWA 4JTDA 1MUCA 3E0VA 4X63A 5A95A 4XZWA 1SJAA 2NX3A 4NHVA 3WQ8A 1BYDA 3FKRA 3WQGA 5LHEA 4DJDC 4O0KA 3W3OA 4HB7A 4ZFMA 1F3XA 1Z8AA 1SW0A 3NXLA 1ZAJA 2ISDA 3NL3A 2PURA 3RLUA 3IAPA 4IFKB 4A8NA 4F8XA 2W79A 4E4FA 2V9DA 5AN7A 3L7RA 1R86A 4HIBA 2DSWA 3MSRA 1LLOA 1G4TA 4X60A 1SQ7A 3NPXA 2F8QA 4YHEA 1D2KA 1V3LA 1TPUA 3VNYA 4MWAC 3CV6A 1YTDA 4Z1DA 4FXSA 2W27A 1J93A 2HCVA 3QOMA 2C71A 4L6OA 4RE2A 2XG9A 3LYEA 3SFWA 1JFHA 4XO7A 1T96A 3E5BA 3GW0A 1TKKA 2O7SA 4Y8FA 3UYCA 4YWIA 4N7QA 3DH7A 2F84A 4D6GA 4GE8A 1PIIA 3F1QA 1D3HA 3EWCA 5EFFA 4S3GA 1XIGA 1JIBA 3LHWA 4J5NA 6PTDA 3GO2A 2Z00A 2PDXA 4AG0A 1X38A 1M5WA 3OVPA 2GVJA 2PFHA 1OZMA 1IEQA 2X42A 4B4FA 4MDPA 2BODX 2ZZ2A 2FZ9A 3ZMRA 5FJPA 3EMQA 4CQDA 4U2YA 4HMCA 3GQYA 3QRHA 3LCFA 1UCWA 2WVVA 5LA1A 1JXJA 4N6FA 3EX2A 1YKWA 1HL8A 3KHDA 3CWNA 4RDWA 3LRMA 4DUVA 5D2XA 1ONEA 3CYVA 4J40A 1LG2A 4MB5A 4TMCA 1E55A 4PCPA 3E2QA 3T0TA 5EYWA 3GXIA 5DQPA 4MWAA 3DDMA 4QITA 2EPLX 3GDTA 5HPOA 2Y8KA 1NDWA 4CQ9A 2EPNA 2IXVA 3L9CA 2QZRA 4CQ8A 1H7PA 3CK5A 4LY8A 4JTLA 1F3WA 3TYBA 3W86A 3T1GA 1EJUC 3N6HA 4HZ7A 4QNEA 3W7GA 2E7FA 4DAIA 1E6ZA 3NG3A 3DEQA 3ME3A 4I5RA 4W89A 4W93A 1HGYA 3WNMA 3W75A 4F9DA 1K7EA 4JL1A 2IPWA 3PBGA 1TSIA 1KCZA 1XYAA 1RBOB 1N8IA 4M6VA 1CLKA 1B3WA 2C79A 1L6FA 4PEEA 3KRZA 4CCCA 2WVVB 1BF2A 2PDUA 4JNYA 3JZEA 3IUDA 4S3FA 2Z28A 4FX7A 2XHYA 4F0SA 1DV7A 2WC4A 2CIPA 1QOQA 3A4AA 5AYXA 2OX4A 1KC7A 4XAYA 5TQLA 4LEQA 5MKGA 2I14A 3L65A 4AIUA 1VEMA 2ZZ6A 1WDQA 1Q8JA 3NSXA 2V68A 4L4PA 5E09A 3CIWA 4AVNA 1E1CA 3R0KA 1CGYA 3TZNA 3C56A 1MNSA 3N4EA 3LBMA 1BAGA 3MHFA 3B8UA 3CTLA 2OZ3A 1Q3NA 2IS7A 4JS3A 3GR4A 2YXOA 4QLLA 1ZJBA 4N9CA 3LMZA 1HFBA 1VFMA 1NP2A 1W9VA 4MAZA 4BK9A 1M9HA 4MHBA 2XIIA 3NQ6A 2WZMA 5DXYA 3GB6A 3BL3A 1EJRC 4GYJA 1FUYA 4GISA 4QFUA 4R85A 2GVLA 2DY3A 3BW2A 2WSPA 1ISVA 1OFAA 3KDNA 3MT1A 3R12A 4X2PA 2O9RA 4Y9AA 2HS8A 1J0KA 3DHUA 1Z7AA 4HU3A 2NVDA 2VXNA 2WB5A 4RDZA 1MXDA 5GNXA 4B5VA 4GIEA 3BURA 4QQ3A 1A4LA 3HV9A 1E5JA 4RDYA 2WSYA 3D3FA 2O9OA 4UMCA 3IGXA 4QSHA 1UWTA 3GVWA 4YVXA 5HANA 3R79A 2VCAA 3Q65A 4CD5A 2R82A 1ZP3A 5JIPA 1Z44A 3KZPA 3NQ7A 3G1XA 4G7EA 1WZLA 1GG0A 2YCJA 5K4XA 3UG8A 2BLEA 1LOLA 1ONXA 3ES8A 3PANA 1L8PA 2V81A 3I7QA 3HB9A 1RALA 5EGRA 4PMDA 1DIKA 1JD9A 3NOEA 3QVQA 4XWUA 3G2GA 1Q6DA 1K7FA 1J5SA 4QS5A 4QG6A 4XSMA 3H2AA 3WQPA 3HFYA 5A2CA 4WKHA 1WZKA 2OGYA 4IG2A 3WY1A 3ZR4A 4I7WA 1ENUA 1A3HA 3HPAA 3EPNA 4QHRA 4G5DA 3OLGA 3LTPA 3KS6A 3QR1A 1VR6A 2I57A 4UCFA 3TYDA 3GY1A 4F2TA 4PRWA 3GHRA 1TVNA 1MEHA 3GDLA 1OFBA 3KTSA 3WCZA 2DORA 1KGUA 3MY9A 3AFBA 3N2BA 4DF1A 4HHMA 3NPWA 3V5CA 1XLLA 1UH2A 1XG4A 3GTXA 2BZNA 1A5AA 4BFAA 3W81A 1XHGA 2FJUB 4UR8A 4OWGA 2OWCA 3S5YA 4OZOA 3F4NA 3QC3A 3KRSA 3TTEA 1M68A 4AZ7A 2Y63A 1J2BA 3O9NA 4PUMA 2R91A 5FEPA 3UJSA 1OYBA 2UY5A 5HMEA 3AIWA 3HQOA 1XYMA 1M01A 1TQJA 4NT0A 1DJIA 2Z26A 1S2TA 1VEPA 4US6A 1JPIA 2CEQA 4K3ZA 2PLMA 3AUOA 3N1AA 3EAUA 1F8IA 5HWJA 3QQ1A 2PMQA 1K8XA 2FZBA 1LUCB 2J7EA 1QW9A 2VYOA 1R3TA 4DO7A 1XR2A 2NV9A 4B5TA 4AEEA 6XIAA 3G8RA 3G0UA 3W7QA 2FIQA 3FGCB 2ALRA 2NLYA 1TPDA 3BSGA 1VP5A 2NWRA 4JTIA 3DX5A 1WZAA 2PLJA 4GUHA 4KW2A 2PC8A 2E4TA 2WJFA 5DRCA 2OLHA 2ZE3A 2GVGA 2ISFA 4AD0A 4Q22A 4AD2A 3W26A 3G1VA 3H24A 3JUGA 2JEQA 4C6EA 4DYEA 2PTWA 2A21A 3FFSA 4GZ7A 5G1MA 4JQ2A 1DHKA 1HP5A 1H11A 1V0NA 2QDDA 3PR2A 4EOUA 1A80A 4KWOA 2WKGA 3GNDA 1XBXA 5CC5A 3AIEA 1NWSA 4C6MA 4HP5A 4D6CA 1PX8A 1XGZA 3KCLA 4O57A 2GL5A 4B2DD 1AW2A 2FPYA 3UFYA 3CQKA 2GJXB 2H9AB 4B15A 4JFSA 4AZGA 5FOOA 2D69A 1WUFA 3U5UA 3W27A 2WNNA 3LHZA 2WYSA 5L6UA 1LLZA 2VR2A 1I0BA 4H83A 4A8IA 2WXDM 1HJSA 3TCSA 4F0HA 4ONVA 2B7PA 3CUXA 3NYDA 4FPSA 4WSHA 2R8WA 4JTKA 3IJQA 3N25A 4ZVJA 1DTNA 3EEGA 3WDPP 3GDBA 2OSYA 4ZXLA 3IIOA 2BVWA 2XFFA 1FDJA 2YW4A 1O68A 2BX7A 5CLWA 3N4AA 4GI8A 4M6UA 4P7RA 3LM7A 2D2HA 2J8TA 5I7GA 1R9XA 2DZAA 1VS1A 2PD9A 1Q7QA 4W7WA 2L5HA 5GNYA 1Y0EA 5E0FA 1EUNA 1F4HA 4JL2A 1QJWA 3IPWA 2WPBA 4S1FA 1WOBA 3PHAA 2GDVA 3B9OA 5FD0A 2E40A 3MI6A 2H3DA 3UJRA 2QR6A 2BWGA 3AO0A 3LGEA 3CUFA 5CH9A 2PGFA 3MWAA 4K6AA 2B7NA 3NYZA 1VB9A 2ACSA 5HDRA 5EBAA 3W82A 4MJZA 2DT1A 2O4QA 2ZX9A 4QIUA 1P1MA 1JNEA 3OZMA 3CXOA 3UZYA 1O1HA 3UXIA 4AH7A 4FXJA 1KTNA 3PTQA 1E9YB 1NJJA 1DE5A 3GAKA 1BGAA 5BWAA 4DO6A 3UW6A 1P6WA 2Z1KA 2IKGA 4AF0B 1BVWA 2WHKA 1KRCC 1KRBC 3W6LA 4UXDA 2V5KA 1REQA 3C86A 4DEFA 4ZQRA 2Z7GA 5K9XA 4MMWA 3ES7A 4RE4A 2VRQA 2ZRVA 2OSXA 1H1ZA 4Z1YA 2DT2A 5EB8A 2JGQA 1GOMA 1A49A 3WJXA 3TJ4A 1ZQ5A 2G97A 2C1GA 3WD0A 4BWLC 4GBUA 4NX0A 3R0UA 4GPNA 1XG3A 1G7VA 2PDYA 5EMKA 4EF9A 4GQBA 1UD5A 3UWVA 3WDJA 2BOEX 3DYPA 1FHUA 1BGGA 3VX1A 3B8WA 2D1ZA 4BHYA 4H9MA 5G2HA 3GXMA 4MZ1A 4ZSUA 4IFRA 2VZUA 5LXXA 3AMDA 3H21A 1BYCA 1GPFA 3B05A 4X22A 2HBXA 3C4UA 4IMAA 3NJ3A 5AC4A 4H7ZA 1JXKA 3S2LA 3WK2A 4L7ZA 4R7OA 3RLGA 3BDKA 1K9EA 2FB3A 1F3TA 4Z1AA 1W1YA 1O7AA 3PSVA 1ECEA 3NDYA 1UP3A 1DOSA 1DE6A 3WKZA 3VDHA 1W9DM 2C91A 2Y0FA 5JMUA 3FNDA 4MNMA 1W1ZA 4S3EA 3HJEA 3TTQA 5F7UA 4RDVA 4B3ZA 2E5BA 4FNPA 3GLCA 3TTOA 5A6SA 5DN1A 5CJNA 1YE6A 4OJYA 4QXIA 5C5YA 3LCGA 2WMIA 3UGRA 3GHTA 3TW6A 1BD0A 3OP2A 1A47A 3G1YA 2NXGA 1POJA 2AKZA 3PZNA 4GJ1A 3IGHX 2YFOA 1LCOA 4WR3A 3L4YA 3G5EA 4JKKA 4FOUA 1JDFA 3BLLA 3V0TA 2XVPA 5RUBA 1OX6A 1BRLB 3W7MA 1RZMA 2G96A 3K4AA 4PTWA 3TCEA 4CU8A 1VPXA 3ICJA 3VMPA 3UETA 1DYSA 1KR0A 1ZBCA 3ITCA 1UZDA 3C0SA 5H8MA 3QLDA 5E5CA 5KEZA 1H7RA 2IKIA 3WFZA 5M17A 4KS0A 2P88A 2G41A 4IPPA 3LHVA 1RBAA 4OIFA 2I5QA 4O11A 1W2VA 2VFFA 3UWYA 2X0HA 1E1FA 1O5XA 3N12A 2X7VA 3MV11 2QV5A 3BMXA 4WX2A 4BQ5A 4QE5A 3W28A 5CBIA 1HJQA 3BG3A 3T78A 3WMBA 5M5DA 2A0NA 4DRSA 4J3WA 4PSPA 1FDZA 1T0OA 3P14A 1TJPA 4HSNA 4IQJA 2EJAA 1XC6A 1AMYA 1H5VA 3M47A 1J8VA 2DSUA 2QUVA 3SUWA 3MI2A 4PR4A 1N7KA 1ICSA 1AH0A 4O18A 1GEHA 2ZIDA 4CD7A 4GA8A 2VWTA 1GVSA 3BC9A 4ICCX 2OU4A 1C90A 3EZ4A 4Z0SA 5AZ1A 2E6FA 3NL5A 4S3DA 3GDRA 3TQKA 4WGXA 4P7OA 3UZXA 4CCDA 4MIMA 1OHLA 4I6KA 2PSNA 3T09A 2J6XA 4HU4A 4REQA 3ARZA 2PLCA 1NTHA 3QM3A 3F2CA 1K3UA 3A13A 3HPFA 3EB2A 3PP7A 3WEMA 5D2YA 3GX9A 4BF7A 1Z32X 4AD4A 4JTHA 4AY7A 3RPMA 4JDBA 2G4JA 1G4PA 5A1AA 1EA0A 1GW1A 2PU1A 3WQEA 3W2JA 3SDOA 3RK8A 3SR7A 1VQTA 4M51A 4AVFA 4BWLA 3NVTA 4NI8A 3VKKA 1DORA 4HVXA 2FGLA 4QAIA 4JN8A 4KEUA 4PH6A 3E2SA 5C9WA 2YCLA 2Z1BA 3LTYA 4C6FA 3LBCA 2XVLA 2G3MA 1NFBA 5BMWA 1TTPA 5D03A 3UU0A 2XIJA 2MNRA 1H09A 2W6RA 3WELA 4XUYA 1I4NA 4OV4A 4N4PA 5GQBA 1O5RA 2CBVA 3C2RA 4IMFA 1KFKA 1E6NA 1LRTA 4L1XA 2OTDA 1UOZA 3H2NA 4CNNA 1TJ1A 1ZZMA 4U28A 4KRTA 3LTSA 3WJWA 2GQ3A 3R10A 3EA2A 3UYIA 1M3UA 3B4UA 4Q7BA 1LL4A 1PZ2A 2ZZ5A 4IH3A 4IMEA 2GZXA 2ZRUA 4ADSA 2ATMA 1VYSX 5CG0A 2TYSA 4M7SA 3VDAA 5CPTA 3ABOA 1EYWA 2VRJA 4LC8A 4IP7A 2QUUA 3GHUA 3E2VA 1FA2A 4QLKA 4LRSA 1JZ8A 2G50A 3LLXA 4Q4PA 4JTEA 3CT2A 2YYTA 1IZJA 2NUWA 2OT1A 4CNSA 3CMFA 2DP3A 2OVLA 2YIHA 3SQMA 1RQBA 6CGTA 6XIMA 4QBXA 4Q32A 1J11A 3I6EA 3VOFA 1UR9A 2ZXQA 4IMGA 4F0KA 2PRHA 2PP0A 2R24A 4JX4A 3HTWA 3Q2DA 1R3RA 3P67A 2GSHA 4DX3A 2EPHA 2WQDA 3WLTA 3F7JA 5C9UA 3SCQA 4OOZA 2V69A 3VIFA 4O12A 1MNZA 3W02A 1VBGA 3V18A 1EGZA 5GNZA 2AKMA 1QOPA 3ZWSA 2H8ZA 3W70A 1E6XM 3TH6A 4ASTA 3F5LA 2BSLA 1QR7A 2XH7A 3GR8A 4UWMA 2ZFAA 4W87A 2Y7DA 2A3BA 1C92A 4J2PA 2ZX5A 2NW0A 3DERA 1OCJA 1M7XA 2ZICA 2Z1WA 3UVAA 3GU9A 4WXZA 1KM4A 1WXJA 3R6IA 1FTXA 5K4ZA 1SW3A 2YB1A 4IF2A 1WXYA 4R7WA 5E6ZA 3UJEA 3CYJA 1KXTA 4S3KA 3IGSA 1L2QA 3OIHA 3W1PA 4KEVA 1TWIA 4ZQPA 1WCGA 3APTA 3VGFA 1W8SA 4TU1A 5I07A 2OOFA 3WENA 1OFQA 4NJGA 4NKCA 3HGSA 5CSUA 1XLKA 3T2QA 1TPVA 4W84A 5I0DA 4GKTA 1BQCA 5AVHA 5DBUA 3BGGA 4K39A 3PTMA 4AW7A 2DJXA 1UUMA 2F7FA 3OBAA 5FF2A 4ACZA 4EF8A 3NPUA 5G1TA 1V6XA 1D3CA 1YX1A 4CQAA 3K8LA 4MJ4A 3PFRA 2DIKA 1XRSA 2CLHA 4DIAA 3QPZA 2ZC1A 5JVLA 1HJUA 3DGRA 3SCPA 4A8RA 2UY3A 3CAQA 2GLKA 2I9UA 3NVDA 4TXEA 1IWBA 1OWQA 3EKGA 2DZXA 1EC8A 4GI9A 4JQ3A 3TE9A 3FKKA 2P8CA 2QCHA 3W72A 4CNUA 1J18A 2E09A 3D46A 1F5ZA 1EBGA 2WW5A 5IHSA 2RDTA 4E3VA 2WKLA 1AQHA 2GJRA 4E5TA 1VJIA 3O8AA 4UC5A 2Y2WA 1AG1O 5BW6A 1Y5VA 5AC6A 4EWND 4JGDA 3L23A 3QV8A 3BOFA 4LCRA 3TTYA 1PZ0A 3H7RA 4RUBA 1RD6A 3CZKA 3RM4A 4FXRA 4LVFA 3S9ZA 4FR1A 2HSAA 1XLJA 1ZENA 3R25A 2QCLA 1GEQA 1VIZA 1BG4A 5EBUA 3BLFA 4H9YA 1JZ6A 4BQ3A 5BU9A 3NEHA 4AY8A 4W8BA 3PY2A 2PDIA 1TCDA 3HMCA 4JR5A 1DVJA 3AIBA 2HEJA 1P1XA 2P76A 1XRVA 3VFCA 3APYA 3W73A 1G7UA 3E2RA 2REQA 3NDZA 4E8DA 4Q4QA 4O15A 3ZJ8A 4AIOA 2OJPA 3MUAA 2CZDA 4GYPC 1QPKA 4PSRA 3CL8A 5CC3A 3O63A 3FX4A 3FEQA 3VDGA 1I2PA 4P2VA 2Y7EA 1XUUA 4AZCB 3GFXA 3IS4A 2F38A 3FHAA 3W00A 2Z29A 2GWNA 4B90A 1G01A 4PBGA 2A3CA 1V3IA 3P6LA 1GPWA 3H2CA 1K03A 2A3LA 2Q8LA 3L21A 4EPKA 4QJ4B 3UPMA 5HXMA 3W2MA 3A24A 3T0CA 3KZSA 2ZDSA 3C8NA 2IQ0A 5F4XA 1HO1A 2PBGA 5DT5A 4MWAD 3I7RA 3RU6A 3OZPA 2FH6A 2Y1HA 2PS2A 1A5KC 3S0CA 1R3WA 3IRDA 4IWWA 4O1BA 3OPSA 5TF0A 3ZJKA 3RO8A 4LAZA 3ERPA 2B7OA 1WDRA 1QHOA 3MV01 3SN1A 5DFAA 4LCSA 2XSAA 4AZHA 3RM9A 4GGBA 2I1OA 3E3HA 2FHCA 3M5YA 1XDMA 3FYYA 2J8GA 2OYLA 4JTQA 1X8CA 1YDYA 1A5BA 3WLHA 2V0TA 2VFGA 2ZQ0A 2FTYA 2J9YA 4XVDA 5CSSA 2PTDA 4XSLA 1JUEA 4HPNA 3BMWA 1DJHA 4WK9A 3K1GA 3GNPA 2X05A 3HQPA 3U5YA 3OU8A 4ZENA 2BTMA 3EOSA 1CZ1A 4LVDA 1F74A 2G0WA 2CYGA 2RHGA 2VDHA 1UBPC 2G5WA 1BYBA 1I60A 3DI0A 3ABXA 2OSWA 4M1BA 1IGSA 2RJHA 2CITA 3L4VA 4XX6A 1EXPA 1SFTA 3AIQA 3FYPA 1JFXA 3E6EA 2ACUA 1HW6A 3OJGA 1CTNA 3F5KA 1KXHA 4U3CA 4JY8A 1I2QA 4NZ4A 2BHZA 4FB7A 1DXFA 4O0QA 2VT0A 3H12A 3NQ8A 2PCEA 3HV8A 4HK5A 4OFCA 1KGWA 4ZOAA 1H63A 3D5HA 4Q8MA 2I7GA 3E0WA 3GNRA 4N9BA 5E70A 1PUDA 3KCOA 3GUWA 2JALA 1ICQA 4R88A 2GJPA 3SADA 4FNSA 4S23A 3RXZA 2YDAA 4XZLX 3NM1A 4AEOA 3K5XA 3ANUA 3HQ1A 1XLCA 2C1IA 4K2SA 5PTDA 4XAGA 2V82A 4ALDA 2BASA 2JFEX 3A3XA 2BGQA 3NUKA 4WOZA 5A6TC 1PKMA 2PDWA 1CB7B 1V3HA 4F2BA 3UESA 2J62A 3ZQ9A 4O17A 3M6YA 4P8VA 3S5OA 1K9FA 4P5UA 3FGCA 3LPFA 1KRAC 2WVUA 1YNQA 5KITA 2W4XA 4GFSA 1LP6A 3DU0A 3L0KA 3H4XA 2ASHA 4EXAA 3O07A 2BY0A 2NV1A 4WLCA 1WPCA 1WBHA 4FAMA 1UKQA 3FXGA 3W23A 3VD5A 2HXTA 2A85A 2CU0A 1DWHM 1E56A 2OX1A 1FWFC 3DKLA 3VKJA 4E3TA 3UF9A 4HGXA 5CSYA 1VBUA 5GJMA 1X96A 2PTXA 3TK7A 4HPGA 2ZADA 4O8RA 3LDVA 1HKWA 5EPDA 4GH1A 3DC0A 3TXZA 3TOPA 3TAOA 1GK8A 1RP9A 5HPCA 4FNRA 3VGDA 3DFYA 4Q7IA 2PPGA 1XD1A 1AW1A 2TSYA 1IYXA 3BW3A 3K8MA 4HPXA 4HA4A 3LCHA 4X9SA 3G3MA 2I5IA 4AWUA 1Q7ZA 3VI2A 3SGUA 4FOJA 4O1CA 2GSEA 2QJIA 4HOXA 4B5SA 2FZNA 3O2LA 3T2PA 2FYMA 2V30A 2ZRXA 4DJDD 2WWDA 1VFFA 5CGTA 1VRDA 5HBFA 3MSDA 5DMYA 9RUBA 3KLKA 1HGWA 2JE8A 3AAMA 4HQVA 2Y5EA 3PFMA 2OOGA 3MO7A 3ARUA 3T8LA 1R46A 4RV8A 3E96A 3M6DA 5FACA 3F5JA 1ODUA 4PMZA 6ENLA 1RUSA 1FWNA 3H2MA 3IJ8A 1TR9A 2JKEA 3TNBA 2UY4A 4YCPA 3FXYA 1S5VA 4TV5A 2Z24A 3QLLA 3ZM8A 5F4WA 4JFTA 4Q8NA 3EA1A 2Y62A 3AOFA 3M0IA 3M5XA 4MUPA 3P84A 4QSFA 4AWEA 5CAKA 3Q94A 1YTKA 3TQVA 1DIDA 4U5IA 5REQB 3U2EA 3R8GA 1IEVA 4MG4A 4NL1A 4IGSA 2E0PA 1PHWA 2DZWA 5F4SA 4DBDA 4WGHA 4LPCA 1OYCA 1EO5A 1UD2A 3FAWA 2OB3A 2NQHA 4ZXOA 4RNHA 4NVTA 1TWWA 1XLGA 4NZ1A 1XLEA 4NF7A 2PLKA 2ZUUA 4GY7A 1SZFA 2FTPA 1UH3A 3QZAA 4H01A 1L6GA 3AXIA 3IANA 5ENLA 4K1GA 2DJLA 2Y70A 3WDRA 1CXHA 3N11A 3R11A 1ZCCA 1JI2A 3WLNA 3S2CA 3CS2A 1LDCA 1PDYA 4AQLA 3NZRA 2BP1A 1JF5A 4JHZA 4E2OA 4NY2A 3WNKA 4DUWA 1L9WA 4LUTB 2XVGA 3VGEA 3ABSA 3N29A 4LSBA 1Q8AA 1LRNA 2Q02A 4ZQNA 1TV4A 1EJ7L 4RKAA 1PCKA 1P7TA 3K1DA 3I6TA 4V15A 3LV6A 4JFWA 1RXOB 1Z69A 3K2GA 1FKWA 4YCOA 3AJ7A 3WLRA 4JZ5A 3ABZA 2J7FA 5I3JA 2VGIA 4Q6JA 5CJ5A 3EDDA 4UR7A 5LSMA 1XLIA 4JTGA 4UTMA 3PSWA 4FNUA 5I09A 2A7PA 1G1YA 3W4RA 5AHFA 5T8GA 4OTKA 4N2YA 4KMQA 2DU2A 1A4MA 5LA0A 5DRIA 1QW8A 2VQTA 3F4CA 4GZEA 3ZLHA 4O4VA 2X7WA 3LSBA 4Y9OA 3IAQA 1H1NA 1LRQA 4KFOA 4IX0A 3CPGA 4RNJA 1QK2A 3FOKA 3WG6A 4RZBA 2VVSA 3ZT5A 3H4GA 4MB4A 3VPLA 2WNZA 2QV4A 4IHCA 5LHFA 3F2BA 2J66A 3APGA 3RYSA 5BNKA 1CDGA 2V63A 3KVKA 3LEPA 3K13A 2MANA 4CN1A 1BQGA 5C9ZA 4H6RA 2PDJA 4ML4A 4HNUA 1XF0A 3VIMA 1DQWA 5LXEA 3CV1A 5G4WA 3ZIZA 3ATZA 4OUEA 5H6HA 2VKZG 4IQDA 3W1QA 2BFGA 3GIYA 4MNLA 3OOQA 4D6DA 1VAHA 2FVMA 3L4ZA 3BAJA 4L1GA 3GNOA 4PMRA 4RZ5A 3VIPA 4PGLA 1MQRA 2DW6A 3HPZA 1P0EA 3WF3A 5CEWA 4ORIA 3TYCA 1A5LC 1MSSA 3A4XA 3NTYA 4ACYA 4NILA 4YTRA 2R14A 5JXQA 4GXMA 3W2UA 1YEYA 3CWOX 1E0XA 1IXPA 1IXNA 3MMWA 2I9EA 3T4CA 3VNKA 3MS8A 4AWSA 4IQLA 1YE4A 3WEZA 4UTWC 2I17A 4TUFA 4WRHA 3GKFA 1OYAA 4UFJA 2HISA 4MJMA 3BJSA 1JRBA 3GTFA 3GM8A 5I5RA 1VHNA 1E6PA 2BOGX 3PF3A 3M0ZA 3N2MA 6REQA 3GTHA 1EF2A 3PJUA 3LSCA 3KAOA 3IIPA 4ZODA 3GKAA 4G7EB 1OIMA 1FWIC 4IT1A 5F1VA 2HMCA 1J96A 3ELFA 4R7JA 4QROA 3ANYA 2F2KA 5DXXA 2DZBA 1HNYA 2YXGA 1GGOA 4IPLA 4UTUA 4O28A 5CC6A 1P6CA 2FVLA 1TFVA 1U2YA 4MKVA 3V5FA 2WPGA 2Z4GA 3WH7A 4PFHA 4OGZA 4NZFA 4Q4OA 4MLRA 3DIPA 3P5ZA 3KX6A 2A79A 4UNLA 5KINA 1QMLA 4NJHA 4NRRA 4MY1A 1VFTA 3SFKA 3VNMA 1F6KA 4RZ6A 1UZ1A 1FHLA 3UA3A 3GFYA 2WM0A 1H4PA 3W7HA 1MRAA 1ELSA 1L0PA 3B9NA 3FJNA 3KW3A 4WSJA 2J13A 4KCUA 3E5PA 2BY1A 5DBTA 3DGBA 1IEXA 1T6MA 3JW7A 3IRSA 3ZVHA 4UFHA 2WK2A 4UOQA 4KWSA 5M2FX 4DBWA 1LBLA 4CQCA 3AYRA 1OF8A 1X97A 4QEHA 4B3KA 3GXPA 1IHIA 1V79A 1NF7A 1ZHAA 4FZIA 1EJXC 3N73A 4JPGA 3SI9A 4PMQA 5DMLA 2XTKA 1XH1A 1XRFA 5HA7A 2ZZ3A 3CQ0A 1Y5WA 3GR7A 1QNVA 4GX9A 4PMOA 4B9YA 1R8LA 3PTKA 5M1TA 1KA9F 3LQLA 4ZTXA 2DDXA 4M7TA 4LF1A 2WZIA 3CQJA 1YBQA 4Y7EA 3CU2A 3P82A 2CBIA 3W71A 1J79A 3MCOA 3USBA 3AROA 4XAZA 1BVNP 1VFSA 1IV8A 1VLIA 2GUBA 4GLEA 3QYQA 3U8GA 4PCFA 1EWDA 4QJ5B 4NI3A 3HG5A 1YMYA 4O53A 3FEMA 5E0KA 1XLDA 1Y65A 3DENA 2YLAA 3QY7A 3BAIA 3GHSA 4UFLA 2X1TA 1LTDA 2YKKA 4CN6A 2V8ZA 3W84A 1GJUA 3CMJA 4KGLA 1C29A 3KFTA 3UCDA 3IJ6A 3HG3A 3LENA 2WZHA 1P0BA 3L5MA 4RV3A 3CBWA 4IPIA 5AC5A 3KBVA 3SCSA 4W5ZA 4PTDA 2X09A 1K9TA 3YPIA 2WAGA 1OX4A 1Q63A 2J27A 2AAMA 2QQ6A 7PTDA 5EKYA 2WSRA 4YU1A 1GTHA 2WO5A 1QFEA 2C1HA 2WJZA 1CPUA 1YRRA 4IIFA 1A0DA 3UZZA 4BQ4A 1FWEC 1EJSC 1SO4A 4CVWA 5IDZA 1RSCA 4B9ZA 4HMEA 4O50A 3KCJA 4PUNA 3MUZ1 5AYBA 3N14A 1TPEA 4Z2GA 2CLMA 3CHDA 3OQEA 1CGTA 2UY2A 1SFLA 1TTIA 3JZUA 2PTZA 5BYWA 1E15A 1SZNA 3VE9A 4WOQA 4WDWA 5D04C 5FAGA 4MAVA 3WBEA 4PODA 3DFSA 2F61A 1PJ9A 2QIIA 2XFYA 2PEVA 4FIRA 2BGSA 3B40A 4AIEA 4AZ6A 1KFEA 3QY8A 1OC5A 4DBSA 3GU1A 4L6HA 1E3ZA 2YDQA 2QCGA 5AVNA 4TTGA 5HINA 4CCZA 2X2YA 3AHTA 2Y24A 2GOUA 1LT7A 4QG8A 1ZJHA 2KZHA 4V27A 2OEMA 1KM0A 3T9PA 3USZA 1KCKA 2DVTA 2ABBA 4XUGA 5FAJA 5BXTA 1RCOB 1UBSA 2TODA 1FWGC 4PUEA 4LB3A 1K8CA 3THQA 4MUZA 4TVUA 3WH8A 1XC4A 3WFAA 3VZXA 2VR4A 5HWNA 2CC0A 4UTHA 1EHAA 2OKTA 2OODA 4FA3A 1MMFA 1KNWA 2CZ5A 5LYRA 1RA0A 4Y9NA 4DO4A 4MJ2A 3EWZA 3KRUA 3DC8A 4ZO8A 1DTUA 3N04A 4NUWA 1WAUA 3ALFA 1XCWA 4A05A 1YHTA 1BSIA 3BW4A 4X0VA 2D3LA 1TR1A 3FIGA 1XCXA 3P2VA 5EMJA 3C2VA 3SRFA 1OGSA 1EB3A 3PNZA 5DLCA 4D8LA 3I65A 4EIVA 4LAUA 1W3IA 5GVJA 3AWNA 2XUCA 4MADA 3CZLA 2V5JA 1QW7A 3B06A 3ARWA 1J6OA 5LGZA 3MP5A 2NUXA 2P10A 3SUUA 3V16A 2INEA 1XJBA 5ABGA 5REQA 3VKCA 3LBOA 2QPXA 1H2JA 1JPHA 1H0GA 1UP2A 2EGZA 2P3EA 3DXIA 2E6AA 2QNEA 2VUNA 1SSGA 5DELA 1J2WA 1AUSL 4Z1CA 3I10A 3W7KA 4GQGA 3ABQA 1IIHA 3AXHA 3ZZ1A 1HL9A 4JFUA 3TFXA 4ROPA 1UMYA 1DXIA 2GSJA 3VZZA 3BVJA 4C6KA 3AYTA 1TUFA 3SCUA 5E9AA 4CD8A 4I9AA 3LI0A 1KB3A 4BQ2A 4O54A 2QCDB 3PAJA 3VCNA 4LUIA 4INFA 3H7VA 1O6IA 4MYXA 1JYVA 3LCLA 3MCNA 3WMSA 1GOIA 4IXHA 4C7FA 4TV6A 1K9DA 1CT5A 2HVOA 3GZ3A 3PUEA 1GQLA 4AYSA 4PTMA 3RMEA 3QR0A 3RJYA 2WJDA 4DVOA 1VIWA 1TPB1 3CWHA 4CLMA 4CN4A 1RD5A 3PUGA 4YN5A 2REQB 1RK6A 1OK6A 4FEZA 1GVFA 1E0UA 5DEZA 3UBPC 1TQXA 4A3YA 3TC3A 1OD0A 4JOMA 1WAWA 3SQLA 1V0MA 3TU9A 3FY1A 4KEMA 3CL7A 2Z1SA 2J6VA 1Z48A 1SO5A 3FJ4A 2YCEA 4L56A 1D3GA 2V3GA 3BLIA 2E9MA 5EFDA 3OB8A 1FCBA 1PWMA 3RGTA 1A5NC 3MP3A 4IIBA 1FCQA 1F4AA 2GK1A 5G4HC 5HULA 1OFEA 4GKLA 4GVGA 2KX9A 2R1MA 3B0VC 1JCJA 2OYKA 3N4FA 3VGGA 3E02A 4CNOA 2OELA 5LZLA 2GGHA 3IVUA 2VEGA 1GNXA 4GIRA 4DBEA 1R38A 1KFWA 4NXSA 3GH7A 5DX7A 1HTIA 4I5UA 3SCTA 5IRPA 4UTFA 3OZOA 1SZGA 3UD6A 5FIPA 1BEUA 4S38A 3CPUA 1K8YA 3OLIA 3CASA 2GJXA 4UMAA 3E9AA 2X1SA 3VNJA 2V2DA 4D8AA 3UERA 3GG0A 3SN4A 3GG1A 3BAYA 3GC5A 4PL2A 2V38A 5CG7A 3DYOA 5L9FA 2RH9A 2C19A 2YOCA 2YDSA 1ITCA 3PUDA 4EXBA 3I3DA 1CIUA 1JR1A 4XD6A 3LNPA 3UWUA 1WDDA 1PTGA 4N9DA 3IIVA 4W86A 2RKXA 3BANA 1J12A 4W5UA 2VNCA 2XIMA 3BJFA 2J9ZA 2XH2A 4MPQA 2J78A 2QVHA 1A50A 1X1NA 1FWRA 3RM8A 4KESA 4O1EA 1YYAA 3ZWTA 1W0MA 3BICA 4HNVA 3W1NA 3WF1A 4DAFA 5A69A 3QTGA 2G37A 4U2ZA 1IT8A 2ICSA 1OY0A 3H4WA 3CUHA 2FPVA 4A29A 3BQ5A 1GWJA 4JTUA 2YCKX 1UC5A 5D9OA 1Q4WA 3A3WA 1HKMA 4PUWA 2QMKA 4LVAA 3POHA 4ZA0A 4LYQA 1E3XA 4JBRA 3GIPA 3N19B 4QDWA 1VBHA 2EO7A 2FGZA 5G1YA 2WNWA 3L4UA 1I1XA 3WLPA 3A3HA 3PPHA 3LPOA 2B4GA 1KCLA 3HG4A 4L1WA 3AI0A 1NDZA 2TAAA 2QCDA 3GXTA 2PWEA 3RX3A 3SSJA 3S1WA 3B8DA 5FJTA 4DLMA 2QF7A 2XH4A 1JZ4A 1CXKA 2QIWA 3THAA 4R9XA 3MCMA 3QV7A 3BLPX 1JGMA 4ZCWA 1UR0A 1GQKA 2WMFA 1MFVA 1UWAA 4HKPA 2RGMA 4UNIA 4ERGA 4X0NA 5BCAA 1SGJA 4FI4A 4E38A 4UTJA 3U9IA 3N2OA 5E0CA 4XV0A 1JGIA 2OQYA 2PAJA 1K8ZA 1OQFA 3HGRA 4JDYA 1NFGA 2ZA3A 1W6TA 1RQHA 4I7VA 4IFOA 1PPIA 4GO9A 3WNLA 1A3XA 1YXCA 1BPLB 2NWSA 2LLEA 1O12A 3VC5A 1TCMA 4I6VA 1R2SA 2QF8A 2J25A 3M0LA 2V6AA 2PC4A 1OIFA 2HJPA 3RF9A 2DUXA 3HU7A 4LC6A 2QUTA 4K7YA 4JTRA 4CEUC 3AU6A 3SCVA 3RLVA 1E0WA 2TRSA 5D8WA 3M0XA 4QP0A 4C1NA 2V5BA 1OINA 4HOWA 1UR8A 1T41A 1VBJA 3ZR5A 1W3JA 2YZ5A 4NP7A 4YWSA 5FF0A 1KM5A 1TG7A 6TIMA 2WVSA 5BZAA 4GCAA 3NDOA 1QNQA 3B8VA 4GNKB 4Q7NA 5FEWA 3CB3A 3VIOA 4EAYA 1HXJA 1UWRA 3WL1A 3TN4A 3GVRA 1E43A 1EEXA 4LBUA 5D05A 3WLQA 1L6SA 1QNSA 4Z2IA 3KTCA 3C8FA 3VILA 5T26A 3MHGA 2P8BA 4HU8A 3NZPA 4H8HA 4YL2A 5CZ0A 3N18A 3DN5A 1E73M 4Z2LA 1EDTA 4HHHA 5HOSA 3UZJA 3VOIA 3VX0A 1WZMA 3RX2A 1E1CB 2WBGA 3P93A 3R2GA 1V6YA 2PRLA 2VZTA 1C7SA 5BRPA 3S3GA 3LV5A 4GC3A 2C6QA 1YLVA 3LXAA 3W7IA 4LY4A 3KM8A 4LVBA 3Q4DA 3OGRA 4B5NA 1ISZA 1TMLA 1BXNA 3UWWA 4CEXC 3WMLA 3H2EA 5D33A 3EX3A 1GKPA 1UJQA 4LS1A 2ABAA 4PEKA 4AAJA 3T2OA 3RG6A 1M1BA 1ZAHA 3W2KA 3W6MA 2F6KA 2CESA 1LT8A 2WSKA 5GJPA 3DHPA 2YDRA 1VYRA 1GONA 3EOLA 4G7FA 2ZOXA 3BJTA 2B31A 3E74A 4KGJA 1F05A 1PX3A 3L2MA 1HKIA 4IGMA 4W88A 1J0JA 2BV9A 1CXEA 1XBYA 1UUOA 4R33A 2GGGA 1I8JA 4V28A 4RL3A 1EX1A 1Q66A 2CHRA 1MRQA 1OGBA 2YR1A 3P74A 4H3DA 2VQUA 4GIYA 5BRQA 3P3BA 3BLDA 2IPJA 4ZEPA 4DF2A 4FK9A 3S46A 1JRCA 2RDWA 2YBTA 1WKEA 3VUPA 2PWFA 4WKFA 2GYIA 1X7IA 3SUSA 5IXEA 3OBKA 3NZGA 3C52A 1B57A 4XK2A 3WLKX 3VKBA 2GVYA 3IJ7A 4NJJA 6A3HA 3CL6A 5F2GA 2PB1A 3VKDA 4PMUA 1W1B1 2Z2AA 3TXVA 1OK4A 1T7LA 3NZQA 3LD5A 3TQ0A 3BK0A 2Q6ZA 3O0FA 4FLSA 1AZ1A 5F2IA 2E77A 1A53A 3M5ZA 4ZGYA 1BRLA 4IIEA 2RDXA 3WBAA 1UD4A 2PGRA 3GRIA 1A5MC 1JCTA 3LGDA 4LANA 1W32A 4U4MA 5C8BB 3FA4A 3NSMA 2E9LA 4WQ6A 4LNYA 1EZWA 4GK8A 1GKQA 1TV2A 4XIAA 3LHYA 3QY6A 4YMZA 2IQDA 2BGNE 4GHRA 1AL7A 4Z42C 1AQFA 3VNZA 3G22A 1VPQA 1OF6A 3BSMA 4GQQA 3W7DA 7CGTA 3ENLA 2X0SA 4H7CA 3S5ZA 2Z7KA 3O6AA 1HN1A 4JAWA 3EXTA 3GSMA 3EPOA 2F6UA 3P8IA 3ZXWA 2FDSA 2PF8A 3BLKA 1AMKA 1B2YA 3BV7A 5DMNA 3TKFA 1C8YA 4GNVA 3PAOA 2J9XA 4NG3A 3G24A 4A6GA 1TJ0A 3B97A 3PBUA 1MO0A 5I3KA 3VMNA 1JAKA 4KRUA 1W1TA 2EPOA 5HNNA 3JVAA 3A4WA 5A8QA 4Z08A 2ISVA 3WUEA 4Q8WA 2SFPA 3RMJA 1EBHA 1QASA 3PZMA 4AY1A 2V5LA 1IIGA 1NOWA 1R9ZA 1Z42A 2A6NA 3L68A 4J4KA 3S1GA 3QSRA 3WH5A 2C3ZA 1A5UA 3BAWA 1AJ0A