3RLHA

Crystal structure of a class ii phospholipase d from loxosceles intermedia venom
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
278
structure length
278
Chain Sequence
b'GNRRPIWIMGHMVNAIGQIDEFVNLGANSIETDVSFDDNANPEYTYHGIPCDCGRNCKKYENFNDFLKGLRSATTPGNSKYQEKLVLVVFDLKTGSLYDNQANDAGKKLAKNLLQHYWNNGNNGGRAYIVLSIPDLNHYPLIKGFKDQLTKDGHPELMDKVGHDFSGNDDIGDVGKAYKKAGITGHIWQSDGITNCLPRGLSRVNAAVANRDSANGFINKVYYWTVDKRSTTRDALDAGVDGIMTNYPDVITDVLNEAAYKKKFRVATYDDNPWVTFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sphingomyelin phosphodiesterase D LiSicTox-alphaIA1a
publication title Structure of a novel class II phospholipase D: Catalytic cleft is modified by a disulphide bridge.
pubmed doi rcsb
source organism Loxosceles intermedia
molecule tags Hydrolase
total genus 108
structure length 278
sequence length 278
ec nomenclature ec 3.1.4.4: Phospholipase D.
pdb deposition date 2011-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 3rlhA00
5T91A 1QATA 3KS5A 7PTDA 1O1ZA 2PLCA 4Q6XA 1DJHA 2PTDA 3QVQA 4RV3A 1DJIA 1T6MA 1DJGA 3NO3A 2FJUB 4I9MA 4GNKB 3I10A 1PTDA 3CH0A 4OECA 5T9BG 3KS6A 1DJWA 3QR0A 2OR2A 1ZCCA 2ISDA 1DJZA 3V18A 4PTDA 1YDYA 2F9RA 1GYMA 5PTDA 2PZ0A 1PTGA 4RW5A 4QJ4B 2OTDA 3RLHA 5T9CE 2O55A 1DJYA 4QJ3B 3MZ2A 2P76A 3V1HA 3H4WA 3OHMB 1QASA 3PTDA 1T8QA 4S3GA 2OOGA 2ZKMX 4I9TA 3L12A 4RW3A 4I9JA 4I8YA 1V8EA 6PTDA 1AODA 3EA3A 3RLGA 4F2UA 4I90A 1DJXA 3EA2A 4F2TA 4F2BA 1XX1A 3EA1A 3V16A 4R7OA 3QR1A 4QJ5B 1VD6A 3H4XA
chains in the Genus database with same CATH superfamily
5HA7A 2VL4A 5LIYX 3B0XA 3GTHA 4DF1A 3MPGA 4JX5A 1CB7B 4W4QA 1OC7A 4AXKA 3SECA 2PA6A 2Y5JA 4LY8A 1XYZA 1E56A 4FX6M 2PTDA 4O8AA 5I7GA 2GWNA 1GTEA 2Y61A 3QV6A 5D32A 2WJDA 4W9TA 3ATZA 5ENLA 3CEUA 3E96A 1YNQA 1V6XA 1M7PA 1W5OA 1GOQA 2OFJA 2NUYA 4D6FA 4PCFA 3DI1A 1EP3A 6A3HA 3NYZA 3PTKA 1I45A 4XWUA 1DXIA 4RPQA 2ODOA 3VPLA 2R1NA 1RJQA 1KWKA 2QPSA 3W7JA 1Q6GA 4PGLA 1LZOA 3RMJA 4UOZA 5K4ZA 3TSDA 3P5ZA 3ZLHA 1XYLA 1ISZA 2HWGA 3T0TA 4KCTA 3W85A 3PB2A 1S3TC 1W17A 1LWHA 2WCAA 4DWSA 1F7BA 4JTFA 2ZYFA 3RX4A 1BF6A 2BBFA 2ONEA 4MFDA 3B4YA 2YCLA 1OFRA 3T4WA 3IV3A 4O11A 4XUYA 4I9TA 2DGAA 3RLGA 3HGOA 2CZ5A 4WK9A 3R12A 1LM1A 3E9AA 1QNSA 1VJSA 1FHUA 3B8WA 3I7SA 3L4VA 4KGJA 3IACA 4YHGA 3CYVA 1DORA 3G8EA 2ABAA 4JNZA 2O4MA 3UNTA 2EXOA 3RCMA 3RR1A 1NVMA 4DWSD 4HOZA 1I75A 4A2SA 3QW3A 5CPNA 3T07A 5A8QA 4HNCA 3CHVA 3GTNA 1GOXA 4WDUA 4XZNX 4GZ7A 3BAYA 4RZ6A 1NOWA 1R3YA 1JPIA 4TUFA 1QOXA 4K7VA 2EPNA 5HOSA 2JFEX 2HXUA 4ACZB 2YIHA 2BXVA 3UJEA 2F8QA 4DXVA 5HMSA 1O5QA 5D2TA 1E1CB 5HMDA 3DGBA 4QCEA 7TIMA 5G2IA 1F8IA 1NELA 3NVTA 3FHAA 3G22A 2PWDA 1YTKA 1AD1A 3VGDA 1LRNA 4MVAA 3T0AA 1TQJA 3ZOAA 3O6DA 5E9XA 3C3NA 4AFYA 1E3XA 3N9RA 2V82A 3TJIA 3UYIA 3RU8X 4FAMA 2VFHA 3G1YA 1I60A 3P7YA 3W72A 1KM3A 2D0HA 1K8CA 4FXSA 3VKCA 4BWLA 5EL1A 3GTIA 3L68A 1ZBKA 3AS3A 1P7TB 1LOLA 1GGOA 1R38A 3ZLFA 1W1ZA 1PIFA 2E6FA 4DWSC 3FLUA 4GYFA 3PPFA 2GDUA 5HR7A 1HJVA 2XU2A 5EY5A 1K6WA 4NAEB 3KBNA 3GB6A 1Q2RA 1J0ZA 2OGJA 3BLIA 4O0QA 4IGNA 5JQ9A 2EBNA 1FXPA 1W31A 5BXPA 1H7NA 4HTYA 2JGYA 4GIEA 3XINA 3QVQA 4A3UA 1LCOA 3IRSA 3AHXA 1NWUA 5FF7A 5J04A 1XQKA 4QG8A 3HQ1A 4LUJA 1CZ1A 3B8VA 3MUIA 3UF9A 2YL9A 3AS2A 4NILA 3CHDA 1UZHA 4J40A 2C19A 1F8MA 1SSDA 4GKTA 4LB3A 2YCKX 5E6YA 2BGQA 1QHZA 1RK5A 1LL6A 3MI2A 1XM3A 1ZGDA 2FB2A 1TPUA 5I3GA 2WBGA 2CWNA 2W66A 3ZJ6A 3PB0A 3TMLA 5BRPA 1XLGA 3H2CA 4UQ9A 4P5UA 4HYRA 4WD0A 3HPZA 2VGGA 4WDXA 3S46A 4WJXA 3IVSA 3UPWA 2P0OA 5DO8A 4C6CA 4CVUA 1ICQA 5EFFA 4FO4A 2VZOA 1OFAA 3MKVA 4NRRA 3B0UX 2VEKA 1K7FA 2OEMA 1XSIA 4XISA 1DQWA 3ERPA 1JQXA 1M03A 2GDVA 3L4TA 1B57A 4BWLC 3MUCA 1E72M 3H12A 5A94A 4R7OA 4U2ZA 4UFJA 3TROA 1MSSA 3WF1A 1I1WA 4B15A 2X1UA 2NXGA 1TR9A 3VDHA 3C0SA 4HIBA 1FP9A 4C1LA 2A6LA 1ZBVA 2DPEA 3QGAC 2V38A 4MDOA 3T6CA 3OYZA 1M7JA 3EKLA 1K03A 2VC9A 3W2KA 1XIDA 1N8FA 2ZICA 5FAJA 1QO2A 1XLHA 2ZA1A 5TNVA 2PD5A 3V5OA 4IL0A 4O13A 4DJEA 4IQLA 4W7VA 2ZIDA 2E67A 2Z1KA 2G97A 1SFJA 3S2JA 3NJ3A 3N6HA 3Q4DA 4GJJA 4M6QA 4IQJA 2C71A 2WHMA 1QNOA 3INPA 3UZWA 2VHLA 1EP1A 1FWNA 1E3ZA 3A22A 2HROA 1XDMA 2Z24A 4ORIA 4Z1AA 1WXZA 4ERIA 3CQKA 4GACA 1SSGA 4HP5A 5A95A 2EEXA 1OY0A 3L0KA 4GINA 2Y62A 3MQTA 1EUNA 3KE0A 2CFFA 3EOUA 4LC8A 4NKCA 3WBYA 2HVOA 3EA3A 3N2XA 1KFEA 4PB3A 1S2CA 4LNCA 2EPMX 1DHKA 4L4PA 4CGTA 4HA4A 4QS5A 4TQTA 1YKWA 5A6JA 3WK2A 1D8WA 4Q4QA 1P5BA 2VCBA 4Z0SA 4A8LA 3TAOA 4C90A 1YNPA 2X0HA 3TAKA 3EOLA 5DXYA 5TIMA 3TCSA 2J77A 4X2RA 5HWJA 3HPFA 2P5NA 1OZQA 1O94A 1IR2A 1VJZA 4W8AA 3RUBL 3G1RA 4BQ4A 4HGXA 5IDIA 4YL2A 2NZLA 2GVLA 3DG3A 3NTYA 2J47A 4QNEA 2CLIA 4JXCA 5C9ZA 1TQXA 3QGVA 2DVUA 1W2PA 3DBNA 4RXFA 3L0NA 4HKPA 3GU1A 3W83A 4UTLA 1S3HA 1U1HA 1TPEA 4NJHA 3TTEA 2FZBA 1UUOA 2ZTJA 5A8NA 1E0UA 1LBMA 4URIA 3PSVA 3AHVA 3RJXA 4L1WA 1E9IA 1QASA 3FYPA 1JFHA 3JUGA 4D8ZA 2C16A 3PANA 3D46A 1JCLA 4RNFA 3H23A 2EG8A 4EXQA 1NAL1 3BOXA 1S5NA 4J3TA 1U2YA 3DYOA 3NYDA 1NDVA 3H7RA 4AIUA 2BVYA 1LQAA 1O60A 3IGSA 3LV6A 2GOUA 2NLIA 1VBRA 2E8YA 4R88A 4LUTB 3VGEA 5EYWA 2VI0A 2AL1A 4IMFA 1YDNA 2ISSA 4N2YA 3WELA 1IXPA 2HQAA 2Y6ZA 1I0BA 3OLDA 3SAZA 1FH8A 4UFLA 1E9LA 4DN1A 1YADA 4F0KA 3KS5A 3QV8A 2ZDSA 4I7VA 2HBXA 1SJCA 3LTYA 1D7KA 1TMHA 1F4AA 4WJ8A 3UZYA 1OT2A 3WNMA 3W53A 4OTKA 3ISIX 4MB4A 3HQNA 5D4YA 3TSBA 4GNKB 3CV7A 2OX4A 2Z6JA 4M29A 3SIZA 2Y85A 1VYRA 1S2AA 4GYKA 5FA5A 3KBWA 4AZBA 1G7UA 2FFIA 5ABEA 4C65A 1TWZA 2PPGA 4D2JA 5DMMA 3M46A 5TQLA 4RL3A 1PIIA 2A3EA 1Q6OA 1XPGA 3GO2A 2FVKA 3M0ZA 1JF6A 2DQXA 3CNYA 1PHQA 1XBYA 4BI6A 4A8NA 3IUHA 4W5UA 1X98A 1IXQA 3W00A 1VEMA 4RJEA 2FH6A 3KP1A 2VZSA 4LYQA 1SYTA 5C2CA 1Q7ZA 1W9DM 4NXSA 4KESA 1PX4A 3OZMA 3LNMA 4MOZA 5A8GA 2TPSA 2TMDA 4I9JA 1GONA 5FEXA 2OSWA 1HJQA 4QGCA 2ZZ1A 1TTQA 3K5XA 3N6JA 2A0NA 2B31A 4UQBA 1DJXA 3MKKA 4EX4A 4AHPA 3Q58A 1OG0A 3CMGA 3C52A 1X96A 4DAFA 4EXAA 1K9TA 4Q4RA 2ZADA 6TIMA 1T8XA 1W3JA 3B06A 1XC6A 4HHPA 1NDZA 1RD5A 4V28A 2ZUTA 3NG3A 4XTIA 2QV5A 2PCEA 1YPXA 3TW6A 4GI6A 4PMDA 1JXJA 2JKEA 1QXLA 4UTJA 2ZUNA 4IGSA 3K4DA 3MDUA 3W6YA 2H8XA 4HVXA 3Q94A 4FB7A 1WXYA 1ECEA 3TDFA 3F2BA 2QR6A 1DTNA 4C1NB 2OKOA 4O16A 5J8LA 3PUGA 4H2HA 3NZ1A 1AH0A 3A64A 1JPHA 4X9YA 3F4WA 3AO0A 4Y9NA 1ELSA 5AVNA 8TIMA 4PB5A 2NUWA 4S1FA 3E74A 2QLYA 4O1BA 1RJRA 4IPNB 2XGIA 1XKJA 4HU8A 1YEYA 3PUOA 5AHMA 2DSWA 3SGUA 4LUSA 1L6GA 1RLCL 1HGWA 2J7BA 1C29A 3EA1A 1NM9A 3H8AA 4JHOA 3W1RA 2Q8XA 2QCGA 3VVGA 3SUUA 3THUA 2YCEA 3AIUA 1QATA 4MG4A 4GPNA 1LOSA 1A80A 4Z2JA 1MZHA 2HZGA 1UASA 4DM2A 3CLMA 3EX3A 1DJHA 4P7RA 5I3KA 4UMBA 3TU9A 3RF9A 3CHFA 2PDGA 2GUUA 1PKNA 1O95A 2J74A 1KXQA 2C1HA 4LU0A 3W7RA 3RNDA 4R9OA 4LUYA 4JTRA 4MZ8A 1H50A 1QNVA 1OC6A 5AHNA 3HQPA 4HZ7A 4GX9A 1JPKA 1A5CA 4JN7A 3EX2A 4AD5A 4KW2A 1OIMA 3HGRA 3A5FA 3TWBA 4MJ4A 3UWVA 4KBXA 3R8HA 5EU9A 2H8ZA 1CDGA 3WIJA 3GU9A 5A6BA 2ZC1A 2DIEA 1F73A 1TTIA 3GYEA 2WC3A 4ZVJA 3BARA 1UJQA 4B4FA 4CLMA 4QROA 4O28A 1J2BA 2BOEX 2FLIA 4OOZA 3UG4A 3WCZA 1UKSA 3WD2A 2GDQA 3V7PA 1XGDA 3HM7A 2RDWA 3A4WA 1ADOA 2ATSA 3QY8A 3KOZA 1F9CA 1CXIA 4ZB5A 3TTSA 2RGMA 5C0QA 5D2YA 3N2MA 1IXOA 3C4UA 3NO1A 1YE4A 4G9PA 4XBKA 4C7FA 5CGQA 1MW2A 3GNPA 4WJEA 1AL8A 4E8GA 3B0PA 3NDYA 4AY7A 3GXFA 4J5NA 4PA8A 5H8UA 4C6LA 2OSYA 1EA0A 5CZJA 3GZ3A 1VYSX 2J8GA 1A0DA 3UJSA 4X0VA 3EWDA 2RUSA 5AHEA 4KIRA 2MUCA 3ZSSA 1TPFA 2PDPA 3AZTA 3M44A 3O07A 3GH4A 5B7YA 3TW7A 1CX9A 5I09A 3BZGA 3L0GA 3G1HA 3S83A 3QJAA 2GLKA 5FIPA 2ISWA 4PH6A 1S38A 1V0NA 1T96A 2WNQA 4NI3A 5FOOA 1BLIA 4ZE4A 2BV9A 4XVEA 3PC0A 4UWMA 2RGLA 1XG3A 4Q8QA 3RPTA 1MQPA 3AIVA 3LDVA 4UFKA 4LX4A 1QCWA 1OGGA 4LY4A 4NX5A 3L21A 3NL2A 3OBKA 5GJNA 3WD3A 1GKRA 5I79A 3W7DA 1L6YA 3W37A 1R3VA 4QQ3A 4H7CA 4TMCA 1H4PA 5GJPA 4LV9A 1XH1A 2GSJA 2Z7GA 4DAIA 1I0DA 2RAGA 1RV8A 3S9IA 1Q3NA 5LNUA 3HG2A 4ILSA 1WKEA 2QCMA 4JTAA 4W93A 2GFTA 2FZMA 1VFHA 3WH7A 3SIMA 4D72A 4W86A 1B30A 1MXGA 4AD4A 4EAMA 3WLPA 5AHFA 4HSNA 3ZVIA 3P0XA 1BF2A 2YFOA 1A5SA 1VPQA 1REQA 1U1UA 3CB3A 1ME9A 3V18A 2V3DA 1EYWA 2PDFA 3G0XA 4PMVA 3RM4A 2ZXAA 4HK7A 2DUXA 3AMLA 1BQCA 4DPQA 1JUBA 1WDDA 3W6MA 2PP1A 3LCLA 4D6JA 2V5JA 3I3BA 3BQ5A 1IR1A 3NSMA 1SQ7A 2XM1A 5E9AA 2PODA 4Q4SA 5HMFA 5LNWA 2I57A 1JZ7A 4K1GA 3WQWA 5BOEA 3ARPA 3ARZA 3PTDA 4ZOBA 3D5HA 3AHZA 3VM5A 1G7VA 2ZA3A 3ARRA 4H7VA 4UFMA 1H7XA 2A3CA 4A35A 1QPOA 1JNEA 1Y5WA 4AW7A 3WLNA 3PK7A 4ZTYA 3I3DA 3GNOA 2XHYA 4WLCA 1KB3A 1YPIA 1J0IA 1GZ1A 4JCMA 3TYCA 1BYDA 3QQ0A 2IKHA 3EWUA 3JS3A 2QEZA 4BI7A 4REQA 1DJQA 2PRMA 4QG9A 1MRQA 4MM1A 4IL2A 3CZ8A 1KCXA 3LCHA 5M1TA 1QNQA 3CC1A 3T0CA 1IWAA 4UQEA 2G50A 2VX4A 3N4EA 1M7OA 1M7XA 4EF8A 1I4NA 3VC6A 3B8TA 2RDUA 3EDEA 3KWXA 1MW0A 3M0MA 3CUIA 3QMRA 4FLRA 2EO7A 2FJUB 3KWSA 2Y5EA 1XS2A 3S1WA 1ITCA 2WPBA 1I2QA 4FP1A 5JU6A 3CMJA 1IE7C 3MJMA 3CASA 1QDSA 2E0PA 2X41A 4IMDA 5I23A 2OLSA 2E5BA 1TWDA 1X6NA 4TVCA 1H1YA 4GHRA 4GH3A 4Y96A 1E0XA 1L2UA 5BZAA 5A2CA 3N9KA 3B9AA 3GHRA 1FFRA 3T42A 4HU4A 4DI8A 4BI5A 3C8NA 2A6NA 3VTRA 1Q6CA 4BR1A 3IJ7A 3LBCA 1IEIA 2E5DA 2VR2A 2PLJA 3L67A 4O4VA 4OV9A 2Y63A 3P67A 2WLZA 4E8CA 4P7OA 2C14A 4NJGA 2F38A 2WSQA 3AYSA 3IV8A 1W6TA 2WAGA 4BA0A 3FXGA 4RZ4A 3UR7A 4FOJA 4XG1A 3GDMA 2B4GA 3CT2A 3W88A 2CERA 4RE3A 1HKIA 3UZZA 1JPDX 4MNJA 4ZOCA 2PDMA 2ZZ4A 4H9YA 4EK7A 5I78A 1OYAA 2EHHA 3WFZA 1H0IA 3LGDA 3RCYA 2PF0A 4WSHA 3PZOA 1R7AA 1Q6FA 4AX6A 4C91A 1TZ7A 1EBHA 4KCUA 3EPOA 1P0DA 2IXUA 1W3KA 4KS0A 2Z27A 4F9DA 2Y8UA 4WKFA 1T6MA 3STEA 5D03A 3CU2A 1FDZA 2YPIA 4JR5A 2W92A 1RCXB 4QISA 2V5CA 3H54A 4DWSB 1W32A 3N1AA 3GKAA 2HXTA 2Z2UA 1ZFJA 5CBBA 2YCLB 3D3FA 1AQFA 3KRSA 3OB8A 1XYAA 1B54A 1QTWA 4H9MA 2WBKA 4CU6A 3GH7A 4GFIA 1QHOA 4DELA 4WSJA 3RLVA 1K70A 1WZLA 1TMLA 1AH3A 1GEQA 4I7WA 3SCUA 1DEDA 3P3BA 4Y7EA 1TIWA 5H6HA 2NW0A 3EAUA 1U83A 4PMNA 1ZAJA 1TA3A 2NV2A 2B7PA 3VOCA 1JDFA 3UFYA 1XLEA 3T2OA 1AW1A 3NQ8A 2POTA 4HK5A 1SO5A 2HCVA 2HPIA 1PYFA 4IFKA 3RYSA 1F6YA 4NNCA 1HL8A 3UYCA 3MJYA 3O0KA 2BNJA 1CENA 3N4FA 3Q67A 5HINA 3VD4A 2VD8A 4KT2A 4Q8MA 1FWDC 2E6AA 1MUWA 3CQ0A 4QTGA 2E6DA 3VILA 1VEPA 5L6UA 4OHQA 1A5OC 3BW4A 4NY2A 1CXHA 4H8NA 4DJDD 1AQMA 3WO8A 3DUGA 2FGZA 2OWWA 2B7QA 1G01A 3LGGA 3GH5A 4KFNA 2CKSA 4GYPA 1JUEA 5CH9A 4JQ1A 4BCEA 4IG2A 2CESA 3LRKA 3N17A 2QDHA 4ZXLA 3H2EA 3PZVA 2I5IA 2TODA 3QHOA 5BOFA 4P2VA 5FSEC 1TKKA 3A9IA 4IMEA 1OGBA 2VEMA 5EMJA 3SCOA 3AFBA 4FF7A 1THFD 2QJMA 2DJLA 5DMLA 4Q4KA 2P8CA 1OEPA 2UWFA 3LV5A 2J88A 1G0CA 3A12A 1OGSA 3OVPA 4AF0A 2GUYA 3KBJA 2ALRA 1DIOA 2R1KA 4Q7IA 3BLKA 4O53A 1NOFA 4C6OA 4Q8UA 3GZAA 2A2IA 1GOKA 4UCFA 4JTHA 4LAKA 4C6KA 1ZSXA 4JIEA 4Z08A 1NY1A 4ZBCA 3O0FA 1W2VA 3UWQA 2XFFA 3PZIA 3AROA 5FJTA 5FF3A 2ZX7A 1EX1A 4M6UA 1M9HA 4JZ5A 4IP4A 3AIBA 3WUFA 4YMZA 4GQ0A 1J01A 3OA3A 1ZRQA 3PM6A 3PBWA 5F7UA 3ES7A 2AOSA 1J5SA 2EKGA 4BQ5A 3KDOA 2HS6A 4Y6GA 5KETA 3FDKA 1VD6A 3W1PA 4FOKA 3TZNA 1IT0A 1QK0A 2WNWA 2QPUA 4D71A 5A6TC 3HG4A 3O7UA 4B2DD 4X63A 3AIRA 3G1FA 1J10A 2QMKA 1FP8A 4CD4A 3TXZA 2YOCA 2O4QA 3GX9A 4UTTC 4M7TA 5IBXC 4V15A 3QC3A 2YW3A 1UROA 3ABRA 1F74A 3OG3A 4OBTA 3DENA 4O12A 3BW3A 3W01A 1EUAA 2QHAA 2AL2A 2Q71A 3C2OA 2XIMA 3ABXA 2PGEA 5C6MA 3WQPA 3C6CA 1W37A 2YFNA 3EEGA 2OU4A 3CAQA 3T09A 2V3GA 4O1FA 5AECA 4E8DA 3PJXA 4MWAD 4GYPC 2OODA 2X0YA 1EXPA 3NNTA 3WH9A 3WNLA 4LS2A 4XVDA 4F8XA 2NXIA 1E1EA 2VD9A 3E2VA 2QAPA 5G4HC 1XSJA 3HF3A 5EMLA 1LWJA 8XIAA 3EB2A 4JS3A 3O1NA 3U4FA 3W81A 4UNIA 5GNYA 3UERA 2OOFA 3ZM8A 1E4LA 1BYCA 1AJZA 4EF9A 3WDJA 3B0YA 1AH4A 2PDHA 1DWJM 4IPLA 3GFYA 1QFEA 4JD4A 1D9EA 4DYJA 4O0ZA 3MV11 1PVNA 5FEZA 4H04A 3QR1A 4HOXA 4F48A 3HZ3A 1UWTA 3WLJA 4GIYA 3R25A 1SGJA 4AWEA 1BSIA 3NCOA 3DFSA 4PL1A 1UIPA 3O06A 5K9XA 4KCVA 3S47A 5FF4A 1MFVA 2VC6A 4RK8A 1GQKA 1L8NA 1EPVA 4KRZA 3NO3A 4ZO7A 2I5GA 4MWAC 2V5BA 1Q8JA 4HJWA 1QI3A 1TCDA 3ABOA 3OVGA 3GK0A 3WH6A 1R47A 2XJ7A 4IPIA 2QW5A 3A3WA 1OFBA 2A21A 2VQUA 5C70A 4P7QA 4CU8A 2CZFA 4TTGA 4JIHA 1EL3A 2JK2A 1MNZA 3L2LA 3P93A 3E5BA 3KVMA 1P1MA 1WDPA 3DU0A 3CZJA 3UQNA 4DNMA 1FUYA 3URNA 4NHVA 2BY1A 3V1HA 3FV9A 4R9XA 1R3RA 4E38A 4AIEA 3WNKA 1LG2A 2VFGA 2OZ0A 4MNMA 2VOTA 3E0IA 3GBEA 2QIWA 3VE7A 1JJKA 5E1QA 1KGUA 1L6FA 3VGBA 3H7VA 2CLFA 3CQHA 4J7RA 4RE2A 4IIGA 3MWAA 1GKPA 1W5MA 3EB3A 2CITA 3TYDA 4R85A 3G0UA 4HPNA 2JF6A 1LT7A 3AICA 3O3RA 3AS0A 1IIGA 1NH6A 4DRSA 1RPXA 3KVLA 1MEHA 2NQ9A 2Z1WA 3S1XA 4BF7A 4JTEA 3F2DA 5CCZA 3WF0A 1FX6A 2E1DA 3DHFA 4S2BA 3SI9A 5A6SA 2ESCA 3FW6A 5HDRA 5LIUX 4QLLA 1FKWA 4W87A 1WZKA 1BWVA 3VNKA 1FKXA 1NP0A 5CZTA 1RXOB 1OX4A 3DXIA 1LL7A 3PZ9A 1IT8A 2V3FA 3M07A 3B8UA 5I02A 3LPGA 2BP1A 2PZ0A 3W7QA 3THCA 3LBOA 4YCOA 4KKXA 2Y5SA 1QK2A 1KGWA 3OGSA 3G8RA 2QGHA 1E73M 1OF6A 2AQVA 3AAMA 1TVPA 4UR7A 3CO8A 3LXCA 3E38A 1ALDA 4GUIA 2XVPA 1GYNA 1UD6A 2VGFA 1E6ZA 5C9UA 4MFEA 3TQKA 4DHGA 4QLKA 3LHTA 3UD6A 3N15A 3KRZA 3CYJA 1VJIA 4GNJA 3DC0A 4RDVA 2CBJA 4F2BA 4O1AA 2WW5A 1GJWA 3V16A 2DH3A 5AYBA 3GG1A 3OYXA 1L0PA 5A3HA 5CJMA 4KF1A 4HSHA 5CGTA 4S38A 1XLAA 1DWIM 3OO2A 4PULA 3EPNA 5AHIA 4XSMA 1RBAA 4GUJA 1OSEA 3I10A 3STGA 3TJLA 2Y0FA 4OECA 5A69A 3QH2A 3HU7A 3OZOA 1W9XA 3R2GA 2XIJA 1L6WA 4ATWA 2YCJA 1FWEC 1ITQA 3LLXA 1HP4A 1Q6LA 1TJRA 2IXVA 2X1SA 5RUBA 1C7SA 5KTLA 4QDPA 1ZBWA 4H6EA 4JTCA 3AALA 3A4AA 1S2VA 5BWAA 4K2SA 2FDMA 1DWFM 5CLWA 4FXJA 3W87A 3TKFA 4J1OA 3EYPA 2EPLX 4H9XA 3CBWA 1TX2A 2J7CA 8A3HA 4B9YA 2BG5A 4F3HA 5HWNA 4S3GA 3RILA 5JBDA 1EZWA 2FMOA 3UA3A 3DFNA 3BE7A 3FAWA 4B90A 1N82A 1MQRA 3GBDA 5DX7A 1UH4A 1XGZA 3QMTA 3ITCA 3HGJA 3W22A 1RSCA 2YLAA 3EXRA 1KFLA 2QF8A 3II1A 4H6QA 3PBVA 1XISA 3N73A 4B5SA 3WL1A 1W5QA 4IX2A 1JXKA 1TFVA 4L64A 2BOGX 4WUIA 1FRBA 2X40A 3UW6A 3TV8A 3M0XA 4W85A 1DPMA 2WKGA 1QW7A 4LVAA 4UMCA 5GNZA 5BMWA 4GXPA 5I07A 3PBMA 3DKLA 1EJTC 5JIWA 1ESWA 5XIAA 4GO9A 1KM2A 4QE5A 5E0FA 4P8WA 3WD0A 3N11A 1ZCCA 3E49A 3CV6A 2D20A 4E0CA 2VJXA 3QFWA 2WVUA 4LUSB 2RJHA 3ZZ1A 1HX0A 3SJ3A 2CNCA 2GZXA 4FLSA 4MJ2A 1WXJA 1JDEA 1DJYA 4ECLA 1DWHM 4LVBA 2QMJA 1GZJA 4XKMA 5FESA 1GPWA 3NQ6A 3FSTA 3FEMA 1FWSA 2UY3A 4ES4A 1IGWA 2HVMA 3P8IA 2FH8A 1V03A 5JVLA 2NVCA 5A2BA 4IOTA 4CQBA 4ERGA 3MUY1 1UH2A 3W26A 4F0SA 4YCPA 1ISWA 4ZOEA 4OWGA 1H63A 1FHVA 4S3EA 3G0SA 1EQCA 2DZXA 3MI3A 2VGIA 1UD2A 1YDOA 1EJRC 4B9ZA 1S1RA 1M68A 1K9EA 4Y9MA 1KBKA 4ZQMA 1WDQA 3LTSA 1TUFA 4ZZ9A 4GFSA 4JTSA 2PB1A 3UPMA 2VRKA 3V3WA 4PE8A 1AA1B 5G1YA 2NSXA 2NT0A 3C2FA 3GXMA 1ZZMA 1Q6EA 4H6RA 1J0KA 5CG0A 3WEMA 1S5MA 2C15A 2OPJA 1XIIA 1EEXA 4O18A 2OEKA 3LHWA 3N04A 1QHPA 3FX4A 5LIKX 2CW6A 1UC4A 1A47A 3MYOA 5CSRA 2B0MA 3GS6A 3M6YA 1TMQA 1IEQA 1IWPA 4AVFA 1R85A 3KCJA 2OEJA 3BPWA 5KMYA 4YU1A 2YA0A 4E2OA 3QLLA 4ONVA 3BH4A 4YS1A 3CB8A 4MB3A 2G0WA 4HN4A 5CC6A 2PCQA 1UKOA 2ATMA 2WMGA 4GE8A 3QPEA 1J2WA 2HDJA 2E6YA 4HCDA 1GG1A 2PWEA 3THAA 3WK3A 4BKNA 5D8ZA 3EA2A 3UXAA 3UZXA 1B2YA 4P7NA 3VOJA 1US3A 1NEYA 4LEQA 3CUGA 1VCFA 5AVHA 4JKLA 2PTXA 1UR1A 2GPTA 3M0YA 4JGDA 4MNKA 1IZCA 1Q5MA 1OF8A 3NA8A 1G4TA 2YCIX 3H2NA 4DM1A 1PCWA 3UG3A 2JIEA 5HR6A 3XIMA 1EP2A 4HMEA 1OFOA 4PR4A 3PTQA 3HPXA 1F3XA 3BVJA 1QI2A 3K13A 1D2KA 1TWIA 1PZ1A 3RITA 2ZX9A 5AOUA 3LLFA 3W71A 3LMZA 3MB9A 1E6RA 2X7VA 4RPPA 2GGIA 1X1OA 1I2OA 5E0KA 1E6XM 2BMBA 1OG6A 1VGAA 4XO6A 3O2LA 2NV1A 2WC7A 3DKJA 2J4GA 1A5LC 4CU7A 1WDSA 1ZP4A 2GSHA 2FHCA 3ANYA 4CNOA 1QW9A 1U22A 1E1FA 3S5SA 1RAKA 1TE6A 2Y89A 4ATDA 1B9ZA 3TXVA 4WXYA 1O7AA 3VA8A 2VC5A 3B9OA 2QDDA 2WJFA 5CSSA 4GI9A 1IXNA 4LC6A 3MZNA 4HZ6A 3RLUA 3REQA 2BTMA 1REQB 3VMNA 4C5ZA 1D7FA 4BZYA 1GQJA 4WY0F 1W1B1 1DKWA 5FJPA 5XIMA 1T99A 1LQ2A 2XVKA 5BW6A 4CNPA 1V02A 3MHUA 4V2XA 5T26A 3RDKA 2PS2A 4G2DA 3VDGA 4H3DA 4U10A 3SUSA 2H3DA 2W6RA 2W5FA 3BK0A 2I5QA 1ODUA 4N9DA 3W28A 8RUCA 4LJ3A 2FMNA 4CQDA 3G2GA 3M6DA 4H00A 4Q8NA 3LYEA 3VI2A 4JQ3A 1BXNA 1R5YA 4YJ5A 4JEQA 1ISVA 1SPQA 4GYJA 4KERA 2PD9A 1OCQA 1PO9A 2NLYA 2FDSA 1JUKA 4WF7A 3OEXA 4REQB 4M7SA 3M5VA 4LH8A 1GW9A 5AFDA 2AMGA 2ZZ2A 2XIIA 4TX9A 3KOXA 4Q6JA 4PRTA 3VIKA 3APYA 1AJ2A 1GQIA 1Z69A 4LVFA 1WUFA 1YBQA 2O9TA 3DHDA 3WJZA 1W1VA 1A5BA 3ABZA 3R10A 1UH3A 1XD1A 1PE1A 2QCFA 5HJYA 7XIMA 1FH7A 1XINA 5T91A 4Z1YA 4FR6A 2ADAA 1E0TA 1A0CA 3R0KA 2R8WA 1R0MA 3R43A 2O56A 4G56A 1J0JA 1EO5A 1OB0A 3T08A 4P7LA 4IFRA 4TVDA 4AEOA 3CWNA 1R87A 3LTPA 3MSDA 1PTDA 1B4EA 4H7ZA 2FPTA 3K1DA 1Q85A 4F79A 2CPUA 3WNNA 4J3WA 1P0KA 1UBPC 5CPTA 3TOPA 3EDDA 3W7OA 1U5HA 1X97A 5F4XA 5C7VA 3IVTA 4W7UA 2CKRA 5TF0A 1CBGA 4ERAA 4I3GA 2Z2AA 5DBUA 1SZFA 3L2IA 4NYYA 5AZ0A 4AHOA 2QAFA 3A24A 3JVAA 5HAOA 2V3EA 1TZZA 3W1UA 3VNDA 4FXFA 4LW7A 4D6CA 3W23A 5FJOA 3QQ1A 1PDYA 2FFCA 5HUOA 3QV7A 1RJPA 1OJXA 1Z41A 2XFWA 4PUKA 4FHAA 3TE9A 2GWGA 1WDRA 1ZTVA 1XSKA 2G3MA 4NL1A 3K8KA 3TN4A 2WV8A 4NVTA 1Q6DA 2W67A 4LALA 3OJGA 4L4LA 2CIPA 2D0GA 1XLLA 4O1DA 1XLJA 1X1ZA 3CT7A 3TIMA 2X2GA 1LOQA 4GI4A 4LYKA 4UNKA 1VKFA 1LUCA 1CEOA 4NJKA 3N25A 3PY2A 3QSRA 1UD8A 3OBAA 3U8GA 1TA3B 3DG7A 3SN4A 3ZMRA 5F2IA 4XAPA 4XB3A 3U2OA 2EGZA 3K8LA 4M19A 4PUMA 3QRHA 3KCLA 1QPRA 1CXFA 2CC0A 1RCOB 3T78A 3SN1A 5LZLA 3UPBA 2E28A 2PWGA 4MNLA 1LRQA 2WVVA 5AC4A 2ZX5A 4LANA 5HMEA 1WA3A 4Q4PA 4J4KA 1GVOA 3WK0A 4DQWA 2OOGA 2CLHA 3O16A 5ECUA 4XD6A 1HUVA 3KZPA 4GZEA 2VEPA 3WQ6A 1UC5A 2NX9A 4IG2B 1ZL1A 3L2MA 4U33A 4D1IA 3CK5A 1C8QA 1WYIA 4R7JA 4R5EA 1RA5A 1TRIA 2VR4A 1OABA 4PCTA 2GQ8A 3TMQA 3WG6A 4DUXA 3A4XA 3C0LA 2DY3A 3SUVA 2WZMA 1FY6A 4MF4A 1G69A 1W1TA 3QOKA 4D1JA 4LB4A 3T44A 1PKYA 1LP6A 4MB1A 4B3LA 1W9VA 1MVYA 5LHFA 2OELA 4JFTA 2RDXA 1F2JA 1KQYA 1XLBA 5AYZA 1C9DA 3YPIA 3HB9A 2D2GA 3QOMA 1YMYA 1X7FA 2GGEA 4FIQA 3VNYA 3PAOA 2POZA 4HBKA 1BFNA 2VVNA 1JRCA 2UY5A 3NZPA 1UUMA 2XGBA 3IGUA 3H2FA 5CKSA 4RDZA 1GOOA 5KSWA 2D2JA 1VEOA 3W7GA 4C7GA 3VOFA 3FCPA 4YTSA 1XYBA 2J75A 1EXBA 2IPWA 3A4JA 2UV8G 4C6NA 4LT9A 1OD8A 4O10A 3KOYA 4V1YA 1SO3A 5HNNA 2WMIA 4MWAB 4U31A 5CPSA 4WGHA 2GSEA 3UWEA 4PTVA 4MKVA 3WDRA 2PRLA 1HQTA 1E40A 2R9RA 3VKBA 1CGYA 1V8EA 3OIHA 1UR2A 3ITXA 4NZ5A 3B8SA 4HYVA 1JZ5A 1P6WA 1WCGA 1SW7A 3STCA 4OU1A 2AL2B 2HK1A 4AAJA 3H24A 3NR0A 5M2FX 2BY3A 3EMQA 4X9SA 1JYWA 4H6KA 3KEHA 1XIJA 4ML4A 1KCLA 1G1YA 2Y8VA 4OOUA 3TFXA 1FHLA 4Z1DA 3W7HA 3FVMA 4AZHA 2HE8A 2F84A 1EJXC 2PTZA 3AXXA 4WZHA 1VFLA 1JYNA 4O14A 1OK6A 2QJNA 2YL6A 2CBIA 2Z6IA 5H91A 4KCWA 4HOWA 4Y8FA 3LUTA 2PGWA 3GE7A 3K8MA 4PB4A 2VENA 1X6UA 1DJWA 5K9CA 3NQ2A 1V3JA 3CS2A 3IK2A 3NQGA 4GQGA 4DUWA 1K8YA 1C8XA 5BU6A 5XINA 4DZIA 2DZVA 5AC7A 1O1HA 2X2YA 3SCWA 2AGTA 3I6EA 2O55A 3MBDA 1ME7A 3N12A 4KEVA 4R53A 1B3XA 4DYEA 4GY0A 3W7CA 1XYCA 5CC7A 5A6MA 1JCXA 2ZVRA 1OX5A 1F5ZA 1YE6A 2VDHA 3TEVA 3AMKA 5FL0A 3OQEA 4O8RA 4AMAA 1GEHA 3W1LA 2ZZ6A 4IT1A 3CO4A 4EANA 3GIQA 2BHUA 2OJPA 4YN5A 7ENLA 2CU0A 4GI8A 1W5NA 4YHEA 1HZYA 2VZTA 2WM1A 4WQ6A 3I65A 4K68A 2EQDA 1BGAA 4DZ5A 1E5NA 3S5OA 4M81A 4OE7A 1T0OA 2J7GA 3FNDA 3VU2A 4G1KA 1JPMA 1QJWA 1DVJA 4XAZA 2GGHA 1UJPA 1CCWB 2ISDA 3S8HA 3GNRA 1H1ZA 3NPVA 1L6SA 4JL1A 2PDUA 4F0HA 1GOWA 3KFTA 5D2VA 4QE1A 2UY4A 5I3DA 4WHBA 1GVQA 4GJ1A 4OT7A 4G7EA 2VFDA 2ZVIA 2V0TA 4AZCA 4JAWA 2QJGA 2ZWYA 5I5RA 4ZB2A 1MWOA 3RO8A 1LTDA 3S0CA 1VFSA 2VDIA 3H4WA 1PL9A 1DTUA 2ZXDA 2H9AA 5HQEA 1CT5A 4IZGA 4GOAA 3OLGA 3WENA 1HKWA 3I6RA 3W7MA 1UIOA 5C5YA 3S42A 2GGGA 2VKZG 4LS1A 3VX1A 1IYXA 1YDVA 4EVZA 1GCYA 1ZJAA 2E77A 1UWIA 2O9OA 1SZRA 4B16A 5DQPA 3MCOA 1S2UA 1OX4B 2Q3RA 4FLOA 2PDCA 1E51A 3UWYA 5KZEA 3F4CA 2DSKA 1C91A 4Q6XA 4AWUA 4IF2A 2XTKA 5TBOA 1H51A 3GNXA 3WNPA 1D3GA 2VP8A 4ADTA 4EPKA 3NQMA 4Z2HA 1HL9A 2GL5A 2JEQA 4XD5A 1TV3A 4A22A 4AZIA 4MMWA 2EPHA 3UGVA 2XN0A 1R3WA 3LBMA 2D0FA 2PU1A 2ZWZA 3GC2A 2VRQA 3CZGA 2EG7A 4GIAA 4GIRA 1W9UA 2XWEA 3PAJA 3P84A 3G6LA 4LOCA 4HNTA 2C79A 2XN1A 4YYCA 4YTTA 3DI0A 3GU2A 4W7WA 3KZSA 2BWGA 3G1AA 1UR0A 4XKYA 3A5VA 4RKAA 3OHMB 4ZMGA 3MHFA 4TOQA 4WKHA 2OKTA 3PZQA 3E2RA 2YBUA 3MTWA 1E55A 3UCQA 3NL3A 4OIFA 3UU0A 5KZ6A 5U4NA 3LPFA 3S3GA 1NU5A 1WKFA 1XRFA 2GVJA 2HTMA 1XW8A 2YSWA 2I56A 5MF5A 1ONXA 1POKA 2JF7A 2YXGA 4QAIA 3LPPA 3VZYA 3T1GA 5EBAA 3BAWA 1US0A 5CPQA 4K8HA 2CHOA 4N4QA 2BZNA 1TO3A 1OWQA 1MRAA 2WLYA 1CIUA 4IHCA 3BCJA 4H9UA 2GVGA 3FXYA 4D6GA 4JKMA 3GC5A 4H2CA 5F2MA 3W2UA 1KO0A 4US5A 3WQ4A 3O63A 1OINA 2A1YA 1ZJHA 3GQYA 4MPKA 2R24A 3E2QA 5HJLA 3M0VA 4Q8WA 1UPPA 2QJHA 2DSVA 3PUEA 4PMOA 5IRPA 2P50A 5LIXX 2J27A 1K8XA 3L4WA 3NPWA 1KA9F 1ZJIA 4S2CA 3EXSA 4NJIA 3W2LA 3DH7A 2KZHA 4DY1A 3WK1A 3EB4A 3JZUA 4BEQA 3TLQA 4OKDA 1EGZA 1OCNA 5F2LA 2QUNA 1LYXA 4LVGA 1V7AA 3EEZA 4US5D 3UJRA 4IFOA 1LLOA 1BWLA 1JFXA 4JCLA 2YDRA 4BJHA 3CPRA 1O66A 1MUMA 2REQA 4CKQA 4F0RA 3AMCA 4DO7A 1KLZA 2W79A 2WNZA 4LRSA 1F4HA 3HURA 4LYPA 5BRBA 1XWYA 4FA3A 1H09A 1RLDA 4JL2A 3IUDA 1AUSL 5C9RA 2IMRA 3NEHA 1UD5A 3KOFA 4JTJA 4JTUA 1I2RA 1V3LA 5LA2A 1OYBA 1CPUA 3BCDA 4HNNA 3EMCA 4YTRA 4QM1A 3L4YA 1TJ1A 2WHJA 2R1PA 2Z29A 4L65A 1UD4A 1V0KA 2WYSA 1OFPA 3NQBA 4PEEA 4G1NA 3EZ4A 1AMKA 1KRCC 2W61A 4AWTA 5C2GA 1A0EA 3CAVA 4IMAA 1K9FA 4DBUA 1QI5A 3I7RA 4EKJA 5HWMA 4WDTA 3BSMA 4CQCA 4P8UA 1SUXA 1S1PA 2XFYA 3NAVA 5EA9A 1EIBA 3PTMA 2D24A 3FVDA 1UP0A 3NURA 4C6PA 3KXQA 1B1YA 1JR1A 3QYQA 4KIEA 2XH4A 3T0DA 3NOYA 2A5HA 3RM8A 3RRXA 1KXVA 1KTCA 2XSXA 1NQ6A 4K7YA 4A21A 1BEUA 3CTTA 4M0XA 1IEXA 3P0WA 3MT1A 1JCTA 2DJXA 4S3JA 4DF0A 1AD4A 2DZBA 1E0WA 5D30A 4NZJA 2V5LA 4AZ6A 1P0BA 3LXAA 3P2VA 3V1PA 3SCNA 3MANA 4C6IA 1K8ZA 2QJIA 3DG6A 3TSMA 1KTNA 4AMCA 2HVNA 5AN7A 5JXQA 1KNWA 1W1PA 3RN6A 3W76A 5DELA 1UYQA 3MVTA 3EWWA 1JQVA 3SJNA 4C6EA 1WOAA 3BMVA 3VDAA 3A3HA 4LCQA 3W82A 1TV2A 1KM5A 2BHZA 2VT0A 2ISFA 1HL2A 2ZBTA 3I7QA 3AMGA 4HN8A 4ZGYA 1H62A 5FJUA 4CN4A 1LBLA 2VCAA 3VDBA 4W84A 5AKQA 4JTQA 1CWYA 1QNPA 4A8RA 3WLLA 3NPUA 1FFQA 2B7OA 1MUCA 1KM0A 1P4CA 5E93A 4ZSTA 1PTGA 2JGQA 3DEQA 5I3JA 2NXHA 3GWQA 2R6OA 1GORA 1HN1A 3VO0A 4JOMA 3CMFA 3W1QA 3TNBA 4MY8A 3SCVA 4I6KA 1HFBA 1PWMA 3T2PA 3DERA 3H53A 3ITTA 4NXKA 4GCXA 3M0HA 2OWXA 4N7QA 4QSFA 1XF0A 1HXJA 3E0LA 1GQLA 3MO4A 1E4NA 3QBUA 3AS1A 4AD0A 1CGTA 4PCNA 1K1DA 2I9EA 3QFEA 1RZMA 4R7WA 4U5KA 2PWFA 4O4WA 2F61A 3H2MA 1HNYA 2AQOA 2GQ9A 3EWXA 2CBUA 5AHLA 4Z0JA 2F6KA 3TH6A 3BV7A 3GLCA 5DF0A 4F66A 4U3CA 3KVJA 3SSJA 3WDQA 1H7OA 3EOEA 3QY6A 2Z26A 1SW3A 1ADDA 1HTIA 3AZRA 3JW7A 2D3LA 3C0QA 4B3ZA 1PX3A 3I4KA 4JTTA 1PHWA 1ME8A 1J4EA 2DH2A 4ZO6A 2Y1HA 4YTUA 3IJLA 3O6YX 2X09A 3GAYA 4K1WA 2F6UA 5D8WA 3VZZA 3VIPA 4L6HA 4XBSA 2FGLA 1ZB5A 3N9SA 3F4NA 1JAEA 4QXIA 1OFEA 2CHRA 1M65A 3LU2A 4DJED 2OTDA 3MCNA 3CV2A 3MS8A 1M5WA 2PDYA 3SEPA 3PPHA 1JCMP 3ITOA 1CLKA 3QHMA 3ZR5A 2V67A 3REQB 4P8VA 3WY1A 2FZDA 4LBSA 3VCNA 1K4HA 5HXMA 2V2DA 4K36A 1W8SA 3L5MA 5KZMA 4F0MA 1NTHA 3T55A 5DCDA 1LRTA 1LL4A 5E5CA 3MMTA 2A85A 1U33A 2ZZ5A 1PJ9A 5CC3A 2Z00A 4PBGA 5CEWA 4GQQA 3KHDA 1AL7A 3OLEA 1EHAA 3VK5A 1NF0A 3T81A 3UVAA 3V75A 3WDIA 1PAMA 1SU5A 4S39A 3WH8A 1BSLA 1WX0A 1NWTA 2VTFA 1Y5XA 3WNOA 3CV1A 2GOKA 2HNEA 1JDDA 2QIIA 4IMGA 5A8MA 4TXEA 2WKLA 4DJEC 1KD0A 1EC7A 1BPLB 1SM9A 3WQCA 2E40A 2ACQA 4UQCA 3VGGA 1NFGA 3GKFA 1MO0A 4CQ8A 3T0BA 4P8XA 4GCAA 3QHNA 4LUTA 2HS8A 2D3NA 1JGMA 3GTXA 1NFPA 3M43A 3WLKX 3PZUA 3GR8A 1W9BM 3LK6A 4E6MA 3VFLA 3B04A 4J27A 5I3FA 4XAGA 4O17A 3H26A 3SM0A 4Z2LA 4UR8A 1DHPA 1ZU8A 3ONCA 4BQ2A 4O57A 1FVPA 2GUBA 4GC4A 3WJXA 5CGMA 1MMFA 1KBBA 3URQA 1UBSA 4GABA 2PFHA 4CD5A 5IDZA 3Q45A 4H9TA 3UWZA 3C2RA 3N2TA 1XHGA 3WN6A 4A3YA 5K3VA 1Z7AA 3WUGA 3UY7A 5LXEA 2WM0A 2GJPA 4FALA 4L56A 1NWRA 3HO8A 1TREA 1XL9A 2QCNA 4DYKA 1EOKA 3T8LA 4J3SA 3TONA 1C9WA 4IM4A 3R58A 1XXXA 4D8LA 3WD4A 4XBJA 5MKGA 3I3EA 4ZO8A 2HE5A 3S1VA 1RP8A 4OV4A 1JYXA 3CM4A 4UNLA 1E0VA 1R2RA 4YVXA 3WZ0E 1VCGA 2MNRA 3TYZA 3ALGA 3IGXA 4UTKA 3L4UA 2WCSA 3WQVA 3EWZA 1FWBC 4C6MA 4PUNA 1EPXA 3CJPA 1T40A 3VNIA 4S3AA 2I16A 3S5NA 5C71A 1AMYA 2GQAA 2R1LA 4U28A 2Q6ZA 3BOLA 4GVFA 1WDWA 1UR8A 1Z6KA 1LT8A 1RHCA 3IIZA 3LENA 5MHBA 2Y88A 2ZUMA 3S9ZA 3VXGA 1R3SA 3ZFHA 5L9FA 2PAJA 1LUCB 3L4XA 1H2JA 1M3UA 5U7SA 4XK2A 1BTMA 3NWRA 2W3ZA 3ANVA 4ALDA 1VHNA 2OG9A 3H6OA 1QVBA 5BXTA 4I8DA 1SFTA 2PMQA 2XH7A 4S3BA 4K8EA 5DCEA 3RU6A 3W25A 3NZRA 1Z89A 2YLLA 3WLHA 4A2RA 2YYTA 2L5HA 2W27A 1SZEA 4POCA 3BAKA 3TN5A 2ZXQA 5FJJA 1W3TA 4BEUA 1GOIA 2PP3A 2CLEA 2BY2A 1MXDA 3C56A 2XVNA 1TSIA 4GG9A 4LTSA 3VKJA 4XTDA 4JHMA 5T9BG 3VOHA 2E9MA 1UQYA 2XDFA 1GVSA 2AQWA 3ZQ9A 3MWCA 2ZC8A 2J7DA 3UNDA 2V6AA 1VZWA 3BSGA 2QUTA 2EKCA 1OT1A 4GA8A 4GGHA 1KW1A 3LD5A 3R79A 3SFKA 3LLDA 3AI0A 1UMYA 1B3VA 2OX1A 2E9LA 4FZIA 2QCDA 3IIVA 3TLLA 3WJSA 3G24A 4RV8A 2J79A 5F1UA 3EPMA 3ARSA 5CJ5A 6TAAA 5DCBA 1J11A 3ZSTA 1LLZA 3TOYA 4W5ZA 1UB3A 1P1XA 3E0WA 1E6QM 3W1MA 2C0HA 5DEZA 3UCDA 4IIHA 4PTMA 1V3KA 1F3TA 2OYMA 3FSUA 3IARA 1KCZA 3UWWA 1VBHA 2WSRA 3TX9A 1HKMA 2WPGA 3NZQA 3CL6A 2OMAA 1O5XA 1YHTA 1NWSA 1J6PA 1H7PA 3VKDA 3B4UA 1PUDA 2E9BA 2PBGA 1OX6A 1VIZA 4PUWA 2Y70A 1J9YA 3G3MA 2YL8A 2DUAA 5IHSA 1E6SM 2XFRA 4H9VA 4PTNA 4BF5A 3SUWA 3RK8A 4M24A 3V0SA 4UR9A 3ZVHA 5G1MA 1XV8A 1Q4WA 4M5PA 4LAOA 3U0HA 2WMIB 4QRNA 1FWCC 3QTPA 4H01A 5J5RA 5D9OA 3ARYA 2EJ1A 1S5TA 2X8RA 4FF5A 9RUBA 4YVPA 3LI1A 3U5UA 1TV4A 4PODA 5H1WA 3MCMA 3GVQA 2IS7A 3FEQA 3ECQA 4QS6A 4DEFA 3COTA 1PZ2A 2ZCGA 1X38A 4HZMA 1LBFA 2CLKA 3MZ2A 4QJ3B 2GK1A 2PDXA 2VEGA 4JYFA 2VCCA 1DQXA 3BO9A 1H0GA 1UA7A 3OW1A 5A6BD 5G2WA 3LCGA 4RE4A 3IAPA 3AXHA 4QLJA 4RXGA 1OFDA 2IPFA 4Q4MA 1VH7A 2DORA 2F2KA 4DI9A 2J7FA 4UB9A 3MKCA 2ICSA 4MTVA 4FK9A 4ZO9A 3LQLA 3K1GA 1KFCA 4MZYA 1XUZA 3IIXA 4EPEC 5KINA 1RA0A 4PBFA 1S46A 3OG2A 1V6VA 1Y5VA 3VM7A 4IP7A 4NQ1A 3JRKA 4S3DA 3PZNA 2WNNA 1TJ2A 2NX1A 5FKYA 4M51A 3CEPA 3LSCA 2WSKA 1EC9A 3ITLA 4HHLA 3ZT6A 3F4VA 1WAUA 1XJBA 5ABHA 4H8VA 5LA1A 2CZVA 3M5ZA 3DFPA 4MIMA 4HNVA 3TC6A 4PCPA 5AC6A 1UWSA 3F7JA 1VIWA 2ON3A 3NPXA 3SRHA 3W1TA 3HG3A 3CUHA 3IS4A 4GVGA 3WF4A 3MI6A 2VWTA 1H7RA 5JBFA 3NFUA 1QU4A 2PWHA 4MY9A 4QSHA 2CCRA 3M41A 1XH0A 2DW6A 4WIWA 4S3FA 4PBEA 1EIXA 1WO2A 3ZO9A 3A6OA 2FVMA 4AYGA 4CN1A 3HFTA 3CIWA 2DSZA 2WCGA 3GDKA 4ZQOA 5AYIA 1KC7A 1QI0A 2CXEA 1FWFC 1RD6A 4UQDA 2BOFX 1TPC1 3UA4A 4NZ1A 2KAUC 5FF2A 3EWBX 1EJVC 3SQLA 1HVQA 4G5DA 2NT1A 2JQXA 1TCMA 5HULA 1SO6A 3LN3A 1XPYA 3LRMA 3W70A 1WBJA 3CTLA 4BS0A 2WZTA 4Y9AA 3MUAA 2JEPA 1XBXA 3MA8A 1RK6A 2BDQA 1R8LA 3BC9A 3M0KA 4IX0A 1IZJA 2Q02A 4G7EB 3TP4A 3SCTA 3KLKA 4AZCB 3BGAA 4FS9A 4HMDA 2V2CA 3DIPA 4XIAA 1U30A 1KM6A 1V08A 3QKEA 4GVIA 4DXKA 1J8VA 2H9AB 4N02A 4DNHA 4TX6A 2D1ZA 3WF3A 1UKTA 3PZGA 1H41A 1BWKA 2WC4A 2ACUA 2R14A 5CPLA 1ZAIA 4C6QA 6REQA 1BQGA 1XC4A 5E09A 4TV6A 1XDLA 1TX0A 1JD9A 4CQAA 1MYRA 5A8PA 5HQMA 3WF2A 1KFBA 1GWJA 3PPCA 3ME3A 1BVWA 3E1F1 4RX0A 4KWSA 4WX2A 3VUSA 3KTCA 1Z42A 1E43A 4KWWA 4PCSA 4E2BA 1TJPA 4PSPA 3DGRA 3RJYA 3VYLA 3OGRA 2H90A 2GJLA 1D8CA 3LZ3A 3Q65A 1R3TA 4D6DA 1Z32X 4NAFA 5I6SA 1V3MA 3U57A 4E2VA 3R13A 4JX6A 4Z2KA 5BWFA 3GG0A 4GISA 4XIMA 2PE4A 3G18A 1VQTA 2WXDM 3W7KA 3D47A 1V3IA 3MU7A 4HMNA 5LXXA 1Z3NA 1P6CA 4AEFA 4IIBA 1GVFA 3NQVA 4U5IA 1WP6A 1PWLA 1OK4A 3GVWA 3ORWA 5G4WA 3K46A 3FFSA 5REQA 5DFAA 4MB5A 2ALDA 4YYFA 5D09A 3BJSA 4HPXA 4PRRA 1OC5A 2YDQA 3T8QA 2Z1XA 3O15A 4DX3A 1OM0A 4TV5A 3PVFA 3OQ8A 3MDWA 1PV8A 4RR4A 4X0NA 3CHCA 5FSDC 1G4PA 3E5PA 4XKYB 4MWAE 2Z7KA 2X0SA 2J24A 3B9DA 1PBGA 2YJQA 4PUUA 1KFJA 4FR1A 2CHNA 4AD3A 3SRFA 1KFKA 3PG8A 3R89A 1W9PA 4GGBA 1R2SA 4KEMA 4AD1A 1FHDA 1E9ZB 1C92A 3BGGA 3ARXA 5I0DA 3MY9A 3O9NA 1YIXA 3GFXA 2G95A 3ABQA 5C8BB 3CIVA 1AFSA 3QKZA 4B5TA 3TN3A 2X16A 4I5XA 2ZE0A 4L61A 1V6WA 3N14A 3HFYA 3VE9A 4UTIA 2J7HA 3ARWA 4MAVA 1TPVA 2FIQA 4WR3A 2G3JA 4WKAA 3VNJA 5ABFA 4PC8A 1UP3A 3BG9A 6PTDA 3GTFA 4L80A 3CL7A 4UOJA 1TJ0A 4FOUA 3KL5A 2FZ8A 5I03A 3NQCA 1E9YB 2O92A 3PN8A 4PMYA 3PF3A 4CNTA 4CQ9A 3E02A 2Z2BA 3NSNA 4A3QA 3U2ZA 1VLIA 1XG4A 1SR9A 4CNUA 1H3GA 1R3QA 3O8AA 3Q37A 2ZUSA 3UJFA 1RVGA 2IPJA 2P10A 3UXKA 3IGHX 2PDJA 1FWAC 2IKIA 4IXHA 1W3LA 1P48A 1EGVA 2QYGA 1ZJBA 4IQDA 4L9XA 2OGYA 3ITGA 3P80A 1AZ1A 2REQB 2OZTA 4DBDA 1TWWA 2DT0A 1VBGA 4DUOA 1VF8A 3N2OA 3CLWA 2HMCA 3VAVA 4N42A 3SBFA 3ARTA 3VC5A 5FJIA 2ASHA 4QJ4B 3UZJA 3M7SA 3ZS4A 3V0UA 2OO6A 3TJXA 2PGRA 3UGRA 1WPCA 3W84A 2BVWA 1M41A 5I00A 3QR3A 4MUZA 8XIMA 3PSWA 5GVJA 4C6FA 2Q01A 2DW7A 3O6CA 2A3HA 3M16A 4JDYA 4QR6A 3IIOA 4L4OA 1HJXA 1FQ0A 3TC3A 1OCBA 3GAKA 4X3ZA 4N4PA 4E4UA 4ZQNA 2A79A 2PDNA 3W02A 1TB3A 4D9PA 4HPGA 3KLLA 1XIGA 3C3UA 2J9YA 1ZHAA 3SADA 4JDBA 4DO5A 1NDWA 3WEZA 4EACA 4V33A 3FK4A 1H5YA 1TPB1 4QEEA 3V4BA 4EE9A 4JY8A 4NSBA 4L5ZA 1B3YA 2NX3A 3PNZA 2QCEA 1W56A 3KAOA 2WO5A 4WEVX 3GDTA 1JD7A 1JIBA 2IKGA 2CLPA 1GVIA 1A50A 4QJ1A 1O12A 3MUXA 3VD7A 4PYSA 4GK8A 4LPCA 1ZY9A 1HIZA 3DHUA 4V1XA 4DF2A 2F9RA 1VS1A 3W6LA 4IPJA 3HMJG 2EPOA 1YXDA 3NQDA 1VR6A 1RH9A 1KWGA 1J0YA 3CZLA 1N7KA 1L8PA 2EPKX 4B92A 2HBVA 1VRXA 4LBRA 2V81A 5FF0A 4Y9OA 3PPGA 4LEFA 2GGJA 2BGSA 3RXZA 1KRAC 5FL1A 2OQYA 3WLIA 2P8BA 3MSRA 4H9ZA 2CLMA 4B5XA 3PJWA 4R34A 3H2AA 4HB7A 5HK4A 2HPMA 1TIMA 4TIMA 2VFFA 2W4XA 2OT1A 1BD0A 3W2MA 5E70A 3BAIA 2GJXA 5HPCA 3CXOA 2BASA 6CGTA 3AYRA 1EHNA 3B9EA 4PUEA 4LQ1A 3TZFA 4S3CA 1GJPA 1UUQA 3BLFA 3NXFA 3MHGA 3BLPX 5CPMA 3G6MA 4IISA 1GPFA 4UQAA 4KQNA 4XD3A 3GD6A 3T7VA 1PZ3A 7ODCA 2QUVA 5I2UA 2ZOXA 3RRAA 3TFCA 3BJTA 4AY1A 3R8RA 2WZEA 3BDKA 4RZBA 3PBYA 2NV9A 3WD1A 3CZKA 1Q66A 2A3BA 4WGXA 5AC5A 2INFA 1QR7A 3GG7A 3LB0A 2PLMA 3MUZ1 5GQBA 4KWOA 5C2XA 1W54A 2XG9A 2BXYA 4KWUA 2FTYA 3AIQA 1OZMA 3FGCA 5D2XA 2G37A 4D6EA 2JBMA 2A7PA 3KTXA 2WQPA 3C0JA 1UW9A 1EOMA 2PWVA 4NZ3A 3N34A 4UUIA 3CGTA 4AYSA 1XYMA 3M5YA 2BHYA 5I24A 4YWIA 1JULA 2CYGA 2KX9A 1FCQA 3ZR4A 1P43A 4UTMA 4XAYA 1CGXA 3OGVA 1MEWA 1SW0A 4FX8A 1FDJA 1ZNNA 3QEZA 4IGHA 1MI3A 2YDAA 4TMBA 2J13A 4AC1X 5CXPA 2TSYA 3WFLA 4M1RA 1G67A 1E15A 2BVDA 3JR2A 1VBUA 1E70M 2J25A 2V68A 3GYCA 3AHYA 1KR0A 4UCGA 1CLXA 5M3WA 3EX4A 3M7WA 1V0LA 1DE6A 2PDBA 2PLKA 5JIPA 3PFMA 3H55A 4FXRA 1XIFA 3CHEA 3LERA 4N6FA 1TYGA 3E3HA 4L9YA 1ZLPA 2QVHA 4LAZA 2GVEA 1LDCA 3ES8A 1W1A1 2NVAA 1ZBCA 5GNXA 1EQPA 3W7PA 1Y0EA 3NO5A 3EGJA 5HPOA 5G1TA 3EXTA 4XSLA 1HO4A 5AY7A 2FPYA 4OFCA 5DXXA 3TK7A 5PTDA 4AZ7A 2FJKA 3G1DA 2HISA 1QW8A 5CJNA 1JNDA 4XZHA 1VPYA 4LWWA 2AAAA 2ZRZA 5EMMA 2OYLA 4Z17A 2QCLA 3QV9A 5CZSA 4E4PA 1XLIA 3HPSA 1MQQA 1EYEA 5H8PA 1VFUA 1XBVA 3OVQA 1HKKA 5AC8A 1I6NA 2AKMA 3TTQA 3HG5A 3AYVA 3LG3A 3WLOA 3ZWTA 1JEZA 4GZIA 4GUFA 4YVVA 1P6BA 1TPWA 2P3ZA 3LCWA 1RQBA 3QPZA 5DMYA 2XSBA 4NG3A 1ADSA 3W2JA 5CSYA 2V63A 3C86A 3RHGA 3OA5A 4LV4A 3EWCA 1DIEA 5C55A 3URBA 1J0HA 1V7YA 2PLCA 5DBTA 4C7DA 4I6VA 2FZ9A 3WUEA 3OTRA 4M80A 3BV4A 1IGSA 3RFAA 3EX6A 1KFWA 2E1WA 3S6TA 1O4UA 1H1NA 2OYKA 4JTKA 1KCKA 4BQ3A 2QNEA 5I3IA 4WY0A 3PP7A 4X2PA 3HN3A 3XISA 5EFDA 4AIOA 4LGXA 4ROPA 1ISXA 1A5UA 3SQSA 2PZNA 3IVUA 1YX1A 1WQ5A 3CAKA 2XYLA 5CAKA 3TWAA 4E5TA 2O0TA 1MXSA 1QPKA 5A2AA 3IWPA 4QQUA 1M53A 3H2OA 4LRTA 1DWAM 3S5ZA 1VLWA 3WQEA 4Z2GA 3U6WA 4KWVA 4IPPA 4JQAA 3DHPA 4GVHA 1IF2A 3W24A 1UHVA 2BLEA 3DFHA 3BQ6A 4MHBA 1VCVA 5A6KA 5DN1A 3PFRA 4DJFA 3LM7A 5AB3A 1A5KC 1FBAA 4Q8OA 1MZRA 2DZAA 3U3HA 2ANUA 4DXXA 1POJA 2TAAA 1JAKA 4GC3A 3KW3A 4YLWA 3DBPA 2IUZA 4AXNA 4GUHA 1R46A 1FH9A 5MKGB 1KR1A 2IW0A 2VR5A 5D02A 3RX3A 3RX2A 4EAYA 4PMJA 4I7UA 4UXDA 3EWYA 2H3BA 2ZDRA 1HJUA 3HV9A 2BB0A 1YNYA 4OBSA 4DJFD 3ENLA 5BXRA 3EX1A 4PUDA 1QI4A 3S5YA 1XLFA 4JKKA 1BGGA 3CIXA 4NX0A 4G8TA 3MP3A 2Q8LA 1CNVA 5LIWX 3BLOA 4UTUA 1D3HA 1FOBA 4N6EA 4Z42C 3UG8A 4XO7A 2VDGA 1UZDA 3P61A 1DQUA 3WBEA 2NQ5A 3FJ6A 1OIFA 3LQGA 5E0CA 3OHIA 3WJWA 1XFCA 3W7NA 1FWRA 5CZKA 1XIHA 2VC7A 4ORMA 3VIJA 1AW2A 5CG7A 1A3HA 2NWRA 4Y9PA 1ICPA 5FI8A 3KRBA 4MYAA 2W63A 2Z1VA 2YYUA 1GOMA 1QWKA 3UR2A 2E68A 3PZTA 3C8FA 2XZ7A 3I6TA 1DV7A 3W4RA 1NSJA 1W1IE 3G1VA 3RR4A 1KM4A 3VABA 1O6IA 1RVKA 4DJFC 3QSTA 1W3IA 4ZODA 3EBVA 4DIAA 2ZX8A 4TU1A 2CLOA 1A4LA 4ATLA 1Q65A 2Y7DA 3H4GA 4DBWA 3OLIA 1PX8A 5AYYA 4ZQRA 2FKPA 4M82A 2QCDB 4XX6A 2PC8A 3GC4A 4Y90A 4B5UA 5CSUA 3LHYA 1KLYA 4NF7A 3W86A 1U1JA 3CWOX 2PC4A 4ACYA 1CTNA 2YKKA 1N8IA 3RPDA 1V6UA 2DQWA 3WMBA 3S2LA 2QQ6A 6ENLA 3DN5A 5D9NA 3W9ZA 1PCKA 1V02E 1UD3A 1C7TA 1RR2A 3GIPA 3RIKA 3PR2A 4LCSA 4JFSA 4JBRA 1M01A 3R0UA 2ISVA 4YTQA 2DV0A 3WQFA 3QC0A 2PTWA 3UWUA 4FLQA 1EDGA 4OVXA 4TTUA 1F76A 3WQ5A 5BYWA 1VPXA 4AHQA 4UIOA 3LOTA 4S3KA 3UZ5A 3GSMA 3NL5A 5M5DA 3VZXA 4UFIA 5FACA 4OUEA 1Y8BA 2WMKA 1EA9C 1G4SA 3NGJA 4XZMX 2WB5A 3ZVHB 4H41A 1XICA 2G3IA 3EDKA 3VNZA 1XX1A 4XZBA 2Z25A 5H2ZA 4QJ5B 1L9WA 3CUXA 5B80A 4B3KA 1BKSA 1BVNP 4L9ZA 4DLFA 1EKOA 3JU2A 4GNVA 1AK5A 1Q4NX 1WV2A 1FXQA 1QT1A 3LRLA 3QYSA 1I2PA 1S39A 2VMFA 4ZQPA 4Q33A 5SWUA 2GK1B 3UESA 1MDLA 2ZZ7A 4DPPA 3GM8A 1YLVA 5CLTA 3VNLA 3F1QA 1WZMA 3LSBA 1OFQA 4ASTA 5JUVA 3GVRA 3LPOA 4HA3A 2E4TA 3NQEA 3NDZA 2NQZA 3KUMA 3EKGA 3BG5A 5I77A 1JL8A 4CNSA 5KEZA 1KV8A 2A7RA 3MV01 1R30A 1S5WA 3VD9A 3W1NA 1PPIA 4Q22A 4JFWA 4OBRA 3CQJA 1BG4A 2Z28A 4FNUA 3TR9A 3AZSA 1ONWA 1BTCA 4ZL1A 1KTBA 3R5EA 1ZPTA 2XPKA 4HPJA 1F6PA 3B03A 1UP2A 1E6PA 4S23A 3P60A 4B5NA 1AQHA 2C1GA 3TN6A 4JTIA 4RW3A 1XYFA 1QMLA 3FJ4A 1FCBA 4TX8A 4KFPA 4JN6A 1W91A 5I3HA 4E4FA 4U4MA 3IPWA 9XIAA 3B9NA 1ENUA 1EDQA 5CPOA 2NSOA 3VNMA 4EWJA 4F2TA 4Q8TA 1GHSA 5HNUA 3DZ1A 1TTJA 4LAUA 2VEIA 1GZGA 3NSXA 4O1EA 2NQHA 5D9PA 2TYSA 5EMYA 1CW2A 4HMCA 3LNPA 1S2WA 1FWJC 3KBMA 3WLRA 3IEBA 2X7WA 2WHKA 3KM8A 4JTGA 4FNTA 4INFA 3GVVA 1YQ2A 4MDPA 3NM1A 3A3XA 2WANA 4O15A 4X61A 1OYCA 2ZUUA 3N13A 4IXXA 3QM3A 4HZ8A 4HU0A 2VUNA 1V77A 2A4AA 1GKQA 1YW1A 2YXXA 2P3EA 2XVLA 3U4AA 3SSZA 4N9CA 5F4WA 2IQ0A 2PBOA 3WH5A 5BMXA 1UWRA 3BSHA 3R7MA 4CCZA 3RLHA 2J78A 2C13A 1XRVA 4L7ZA 1ZUAX 1OQFA 2YBTA 1HP5A 3PZMA 1O5RA 2Y2WA 2RDTA 3ID7A 5FAGA 2DIJA 2XVGA 3WBXA 4XUGA 3UY8A 3R8GA 4KRTA 3IIPA 4HPHA 2QXWA 2RFGA 3KX6A 4K37A 4U3AA 3AJXA 3ZLGA 4WCJA 4HNOA 1AVAA 4QP0A 3MO7A 3NL6A 3ALFA 1WOBA 4DVOA 4RNHA 3WQGA 1KKOA 2A7NA 5EBUA 4ADSA 6REQB 1V0MA 4L6DA 4FNPA 4H83A 3M5XA 4AB4A 1K7EA 2G3NA 1H11A 2WMFA 3FS2A 3BANA 3HMCA 3C2YA 1JDCA 4PZVA 3SGGA 2PSNA 2PDWA 4J2MA 1NJJA 3HJEA 3SZ8A 2XIQA 3VDCA 1GYLA 3F4DA 4JNYA 4NAFB 4EIVA 1MEIA 3WUBA 3U48A 2NQLA 4Q3MA 1H5VA 3NZGA 3EDFA 1SVDA 2A3AA 2ZXBA 2ACRA 2PI6A 2J66A 2OB3A 1GQNA 1QBAA 3AISA 3G1SA 2I1OA 3FOKA 4PMZA 4QX4A 1FWWA 2DDXA 3CPUA 5DRIA 4NIRA 2D2OA 3DC8A 5REQB 1N2VA 2EF9A 1DIKA 3PNUA 3DYPA 4W88A 3OVRA 5EB8A 3W74A 3K2GA 4NI8A 2C7FA 4AWSA 1XLCA 2ZRYA 4EOUA 1LLWA 1N55A 4I90A 2J62A 3FYYA 1ZS2A 2J9XA 3WSUA 5CAHA 3TA6A 1KXHA 1WBHA 5H8MA 3MW7A 2ZRXA 4BF9A 2XH0A 2XINA 3F5LA 5JH2A 1DL3A 3GW0A 2PDQA 3H4XA 1V51A 4FMVA 4DBEA 3KRUA 1GVEA 1CI1A 3S2NA 4QG6A 2VX7A 4JIIX 4R3UA 1TPDA 1BYAA 3B40A 2ZZ3A 3WLQA 3WQOA 2PWUA 3GHSA 3WFAA 1DJGA 1PXGA 2VX5A 3VGHA 2VELA 2PUZA 3RAOA 1BRLA 3UT0A 4JIQA 1J6OA 1KGXA 4UFHA 4ML9A 2XN2A 2NQJA 2GVYA 1PKMA 4DB7A 1E6NA 5BU9A 4LYRA 4QE4A 5ABFB 2WOQA 4UBPC 1G5AA 1JVNA 3SCSA 1EB3A 3QZAA 4LVDA 3PWGA 1DOSA 2FVLA 3VINA 4TO8A 4GXMA 1IT7A 2VO5A 1MW3A 5DY2A 3V5CA 3QZEA 4K8GA 1FWGC 3VGFA 5D38A 2JALA 4AVNA 1GVYA 4HQVA 3W0KA 1ICSA 1BVZA 3SFWA 4A4AA 2ZFAA 3MMDA 2Y4SA 3BAXA 3UP8A 3QN3A 2YR1A 3BLEA 4K39A 1UR9A 4I5UA 2ZKMX 1KBLA 1K02A 1TUXA 3PS7A 3DX5A 4L6OA 4YPJA 4LS0A 2I14A 3L5LA 4P61A 4GZJA 4AQLA 3KL0A 3QLDA 1KBIA 5CBIA 5ABTA 1FWHC 1I9CB 5HNTA 5FD0A 3F2CA 3VIHA 3DFYA 5DT7A 4DJDA 2HNHA 4GO8A 1KKRA 3UXIA 3THQA 3UVIA 4PFMA 1XI3A 3M4HA 4KMQA 2ZRVA 2PTYA 3OBEA 2QT3A 2HSAA 5AZ1A 1JZ8A 3LI0A 2YA2A 5G5IA 3DFOA 1QPNA 4E3VA 1SO4A 1UOZA 2AKZA 3CWHA 4PRWA 4MPQA 1OADA 3OU8A 2XUCA 1X1NA 5IBXA 4IJCA 3GDRA 5DRCA 4UTTA 1TVNA 4WDWA 5A5WA 1QRQA 4IFKB 3G1XA 1KBJA 4KPLA 2QZRA 2G4FA 1LG1A 1JGIA 2PURA 4LXFA 3MVIA 3HGSA 4ZQCA 4IQEA 3SCQA 3FKKA 5AYXA 2IPGA 5CQ1A 3UG5A 1YXCA 1VBJA 4UTWA 3S2CA 1DP0A 1IEVA 1SZNA 1V93A 1U5VA 3N2BA 2WZIA 4LUIA 3L9CA 2CLLA 2R94A 2DEPA 2UZ9A 4MLRA 4L4MA 2O9PA 3H70A 1HG3A 1Z9AA 2V8ZA 3FIGA 5A6AA 4HNLA 3V35A 1W1YA 1EF3A 2NWSA 3WBWA 4OGZA 2ZA2A 1YRRA 3AOFA 2R1MA 2VYOA 3WKZA 5IM51 3ABSA 1H60A 2J6XA 1UKQA 3JZEA 5FJRA 1J79A 2EG6A 7CGTA 1XLDA 5TD4A 4PEKA 3TYUA 1YTDA 4IP5A 3DFTA 4BHYA 4ZE5A 2RKXA 4A05A 3MSYA 3DECA 4AIBA 3E0VA 3V0TA 4CVWA 4AF0B 4EPDC 1ISYA 1IQ8A 1GVRA 2QF7A 3BLLA 4B2DA 3VD3A 3EOSA 3KBVA 4A6GA 9XIMA 1XH2A 4ICCX 4QIUA 3KL3A 5KITA 4JHZA 3GNNA 3C61A 4A3RA 3PULA 4YWSA 5BRQA 3AHTA 2VEFA 4RV3A 3IUIA 4NASA 4RZ5A 4DJDC 4QDWA 3GDLA 1F05A 1C90A 3LA4A 4I9MA 2WMJA 3RMEA 4C6BA 4NUWA 4PTWA 4MWAA 3MMUA 3TQ0A 2OR2A 5LYRA 1EFZA 4RDYA 3ZXWA 3LZ5A 1FA2A 2QJJA 4PTDA 2OVLA 3FJNA 4H8UA 1N8WA 3GW3A 3KTSA 5HQLA 3VIFA 3PUDA 1TTPA 3S2MA 2WSYA 1W8GA 1HJWA 3S9YA 3GY1A 2GJXB 1RUSA 5LHEA 1CGUA 4PMXA 2BS9A 1V6YA 3KVKA 1SFLA 1FCUA 4MYXA 3GNDA 1VFMA 2H6RA 2NUXA 1XBZA 2C1IA 1B4KA 4UTWC 3PJTA 3SUTA 2XWDA 1Q63A 3AC0A 1C8VA 2PF8A 3H21A 5K4XA 3TC7A 2CZEA 5K9DA 2P53A 3L12A 2G96A 3CAWA 4K6AA 4I8YA 5C7HA 1X7IA 2OO0A 2P1FA 1A3WA 3ZJ8A 3B0VC 1R2TA 4GWEA 3UXDA 4AG0A 2QPXA 3GIYA 4CCCA 1Q6RA 2DT1A 3WDHA 1DBTA 2VOMA 2QUMA 4NJJA 4IIDA 4BY3A 1EWDA 1XIMA 4HTBA 1QPQA 3BW2A 1P0NA 4TR9A 4KH2A 5LNVA 2P88A 4IWWA 1H49A 3FGCB 3H22A 3WDPP 1VFOA 3DOPA 2WK2A 1AJ0A 3L7RA 3GUWA 3LX9A 3KOWA 4IJRA 3POCA 5A8OA 2C0AA 3AUJA 4HT3A 1JCJA 2WZHA 5IXEA 4O19A 2YGYA 5EGRA 2O7SA 2B81A 4CD7A 4J3UA 3WQ8A 1LF1A 3HV8A 3W2NA 1TWSA 3M1ZA 3OODA 1J12A 2O9RA 2G5WA 4LFYA 2FYMA 4J28A 2VWSA 3SRKA 3R0DA 1HJSA 3W73A 3WEOA 1EJ7L 3BICA 4LF2A 1Z48A 3D6NA 3STFA 4OJYA 2BVTA 1SZGA 1JZ6A 1IZKA 5ABGA 2DIKA 3WBAA 4IH3A 3VD5A 2QCHA 1BYBA 3FDGA 2IKJA 2TRSA 2J9ZA 3FKRA 3LHVA 2OZ8A 2ZRUA 1WUEA 3F5KA 4IUOA 4IMCA 1JDAA 4K38A 2ZX6A 3PBUA 4MZ1A 3N29A 3H7UA 1ZQ5A 1M6JA 1MFUA 4CD8A 3T9PA 3I4EA 1OBAA 3VOGA 1XRTA 1A5MC 1A53A 2IQTA 4MKSA 2OLAA 1I1XA 5LGZA 2D69A 5DT5A 4AD2A 1ECQA 1JI1A 3NQFA 1CYGA 3VCRA 1RP9A 3R1ZA 4ZFCA 4E3TA 3KBSA 1RQHA 3KP0A 5HANA 1EO7A 1ONRA 2PEVA 1B3OA 3P74A 3GR4A 4MJMA 2OQHA 3WL0A 4HNUA 3AWOA 4QAWA 2DVTA 4HCLA 2WSPA 5LSMA 3USZA 2R82A 1IV8A 1UR3M 2VUYA 2HRWA 4LAMA 2RHGA 2VRJA 2VFIA 3HTWA 3NXLA 2Q09A 1SFSA 7REQA 2QDEA 1A49A 2R91A 3M9YA 3PWAA 1OVDA 1JF5A 1AQ0A 3POHA 1MNSA 4TVUA 4W89A 4WOQA 3OIXA 2WHLA 1FWTA 1Q6QA 3LGEA 4AU0A 1MDRA 4WY0B 4DUVA 3W7EA 3GUGA 4FIRA 4Z1CA 2QDGA 3AQUA 1AG1O 3S1GA 3O6AA 4JEJA 1OCJA 4IIFA 5BOOA 3OZPA 2JE8A 3WLSA 1J96A 2BXZA 2ZRWA 3SY1A 1TR1A 3U9IA 1EJSC 2XIBA 5I06A 1C3FA 1W5PA 4AEEA 4JN8A 4Q8VA 4GQBA 1F6KA 3VMOA 1XCFA 2IQDA 3UETA 3W29A 3BMWA 3L65A 2QUUA 1FCVA 1KRMA 1YDYA 4Q7BA 3URAA 1R9ZA 3ZJ7A 3ZWSA 3L66A 2F7FA 2I17A 2ZE3A 1BXCA 4M56A 1UKPA 4LF1A 3FAXA 3M0LA 8CGTA 1NARA 3TTYA 1ITXA 2WKJA 1GJUA 4YXGA 5E6ZA 4J2PA 4C6DA 3TCEA 4DBSA 2Q8ZA 5BCAA 1CGWA 4GKLA 4GJIA 2WWCA 4XZWA 1PSCA 3VIMA 2BY0A 3BUVA 1Y7VA 1RBLA 2D73A 1AODA 2VVSA 5LNSA 4CNNA 3STPA 4O52A 2OZ3A 1B5TA 3PG9A 2BGNE 3DYMA 2HV5A 1ML1A 3GDBA 3F03K 3P5YA 4R33A 2SFPA 1SMAA 5FEPA 3VMPA 1E5JA 2YB1A 1VYPX 3EOOA 4DO4A 2J8FA 1BKHA 4JX4A 4J3VA 4HK6A 2G8ZA 4QNWA 1CXKA 4WVXA 1I2NA 3SRDA 4DZAA 1DJIA 2G41A 3EDJA 4H19A 1VHCA 4IGMA 3T05A 4G7FA 1GHRA 2UY2A 3B05A 4CUCA 3IJ6A 3AJ7A 4IUGA 1LORA 5GPRA 3QR0A 4AUBA 3P62A 3FA5A 1Z8AA 4F4RA 1XIEA 3WX7A 4KGLA 4F0LA 5GJMA 2G4JA 5D05A 5CC5A 3KCOA 3PWIA 4ZB0A 1PZ0A 1OD0A 4W8BA 4LBUA 1FWIC 3LHZA 1A3XA 4GH1A 3TYBA 4ACZA 3BOFA 1YYAA 1QO5A 1WKYA 4JICA 1JZ2A 1E1CA 3C2EA 2UBPC 1HO1A 2V9DA 4QFUA 3B8IA 3B8DA 2WMHA 4NRSA 4NZFA 4O54A 3DESA 2XGZA 4CEXC 3QGKC 4F2UA 3T2QA 2V5DA 4AZ5A 4MY1A 4CCEA 1PB0A 6ALDA 1H7WA 3W7LA 1DYSA 3AIWA 2WJEA 1RCQA 2X1IA 4H1ZA 2DP3A 1W0MA 3HA1A 4HA0A 4R27A 2D23A 3BL3A 3ITYA 2QCCA 2DZPA 2RH9A 1TG7A 1P7TA 1UPMB 4JTLA 1EWEA 4NNBA 4AC7C 3IJDA 1I8JA 1A5NC 2QKFA 5ECVA 1NF7A 4NZCA 2PU0A 2DU2A 3WLTA 1AW5A 1XCWA 3N3MA 3WMCA 3QPYA 2VX6A 3TW9A 4B5VA 5JBEA 2QV4A 4NAEA 4PMQA 3SQMA 1VB9A 1XCXA 2D22A 3UXLA 2E25A 4N9EA 3TQVA 1V4YA 4MKNA 3PBGA 1J93A 4EXBA 4QEHA 5BROA 3N2CA 4RNIA 3MYPA 1RQEA 3E12A 1C93A 1KV5A 3AXIA 4FNRA 2F2HA 2YA1A 2INEA 1QUMA 5T9CE 1E4MM 1XD0A 2D2HA 1Q7MA 2Z4GA 3UCCA 5LA0A 4WOZA 1V5XA 3VIGA 3N19B 1UR4A 3CPGA 1OHLA 2BODX 3CZEA 3F5JA 1MW1A 3M47A 1ZAHA 3QMSA 1K6AA 3ELFA 2HEJA 4MAZA 1M1BA 5F1VA 1VENA 1X39A 1XQLA 4Y8EA 2YX0A 3VIIA 4NNAA 2FHFA 3N18A 1EDTA 1V79A 4QDMA 2DZTA 1V6TA 3IJIA 4G6CA 4GBUA 3P8JA 2FPVA 4M3PA 1XKYA 3BCFA 2OWCA 1JZ3A 4JFVA 1RALA 1KXTA 3APTA 4N9BA 5LGXA 3LCXA 2XZ9A 1Q7QA 4JNMA 1TVLA 1TV8A 3FA4A 3P6LA 2BSLA 1V3HA 1UCWA 4EP8C 1NDYA 3QY7A 3AXMA 4ZOAA 1EH9A 1XRSA 1F07A 4K3ZA 2FHBA 1UZ4A 4CEUC 3RCNA 1TZ9A 1X8CA 3WLMA 3LCIA 1C8YA 3WYZA 4QITA 1HF6A 5HJXA 1K3UA 3ICJA 3OP2A 3THDA 1X6LA 4UC5A 1SMDA 1ZP3A 1W3HA 2X1TA 4ZENA 5TAOA 3ZJKA 1J5TA 4UMAA 3RO6A 6XIMA 1GYMA 5K2ZA 3RG6A 2J6VA 4WSKA 3GXNA 4JIPA 3HJZA 2WVSA 3S6DA 1DWGM 2V5KA 2OT0A 3QQWA 4J35A 4Y2WA 1G6CA 2ABBA 4HJFA 3CUJA 4JYEA 4KEZA 4RE0A 3I68A 3W7IA 3USBA 3P14A 4FPSA 4NP7A 2VXNA 3NM3A 1DIDA 1R9YA 4DLMA 2FTWA 5HBFA 4CN6A 2XSAA 5EKYA 3RGTA 2X42A 2XM2A 2X30A 2WVTA 5JH1A 4M6PA 1F3EA 4FSAA 1HKJA 1B9BA 1DXFA 1SJBA 2WWDA 1TRDA 3NQAA 4LSBA 4RCXA 5J5DA 4CD6A 4QBXA 4ZXOA 3MBFA 3DAQA 1T5AA 1FDYA 2V30A 4NYUA 2QS8A 1Y65A 4J9JA 3ZYZA 1A5AA 1Q8AA 3D0CA 4PTXA 1QOQA 2DT2A 3K4WA 1NOUA 1ZALA 4RUBA 1R9XA 2DUZA 4ICMA 4IJBA 4HU3A 3VX0A 3W38A 4B91A 1PDZA 3AIEA 1S5VA 4JPGA 4ZTXA 2X05A 4EWND 1BXBA 1WAWA 4A3HA 3ZIZA 1AZ2A 1R86A 4AY8A 1GT8A 3S1UA 1UOKA 1UG6A 3K30A 1PTAA 1XLKA 4ZR8A 1UWUA 3HPAA 4NT0A 3RPMA 3LCFA 3U5YA 1WE5A 1XIBA 3MP5A 1XDJA 5HNRA 3NQ7A 1UWQA 3R6IA 3AUOA 1EJWC 3FY1A 1VFFA 1QNRA 4HCHA 3G77A 2C3ZA 2VQTA 1CXEA 4ROQA 4B4HA 2Z0IA 3IRDA 1G4EA 1G94A 2OQLA 3SO7A 1HVXA 5G2HA 4XZIA 4HHHA 1EGMA 2W9MA 3TYEA 1EZ2A 1WNOA 1GK8A 3VUPA 2O7QA 4PMUA 2AMXA 1JZ4A 1EJUC 4AX7A 1XP3A 2X1RA 4X60A 1XR2A 1E4IA 4RNJA 2V2HA 4PMRA 5LKYA 1F3WA 1XLMA 1U5JA 3NOEA 3TUUA 5B7ZA 3E6EA 2YB4A 2Y8KA 5T8GA 3FA3A 3A9BA 2ACSA 3DCPA 3ARQA 3S4TA 1R7OA 1BAGA 3D3AA 4O1CA 5FCZA 4AVOA 1YBQB 3IAQA 2JKPA 3GXDA 1JI2A 4ADUA 5D2WA 2W62A 4O0KA 4KETA 3ITVA 1O68A 4IICA 1BHGA 3AU2A 4XV0A 3TVAA 4KFOA 2FZNA 5HUPA 4B5WA 3WJYA 3BXWA 4F40A 1DXEA 2PDIA 3P81A 1TV7A 5IFTA 2AGKA 4UZSA 3PJUA 4KEUA 3OOQA 4C60A 1M04A 3OPSA 4MUPA 1CECA 1UZ1A 5FEWA 1L2QA 3FJLA 1T8QA 3A47A