3STGA

Crystal structure of a58p, del(n59), and loop 7 truncated mutant of 3-deoxy-d-manno-octulosonate 8-phosphate synthase (kdo8ps) from neisseria meningitidis
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
268
structure length
260
Chain Sequence
MDIKINDITLGNNSPFVLFGGINVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDKPRSSIHSYRGVGLEEGLKIFEKVKAEFGIPVITDVHEPHQCQPVAEVCDVIQLPAFLARQTDLVVAMAKTGNVVNIKKPQFLSPSQMKNIVEKFHEAGNGKLILCERGSSFGYDNLVVDMLGFGVMKQTCGNLPVIFDVTHSLGRRAQALDLALAGMATRLAGLFLESHPDPSALPLHLLEDFLIRIKALDDLIKSQPILTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 2-dehydro-3-deoxyphosphooctonate aldolase
publication title An Extended (beta)7(alpha)7 Substrate-Binding Loop Is Essential for Efficient Catalysis by 3-Deoxy-D-manno-Octulosonate 8-Phosphate Synthase
pubmed doi rcsb
source organism Neisseria meningitidis
total genus 90
structure length 260
sequence length 268
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2011-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3stgA00
5D09A 1SPQA 4IMCA 1GVSA 2QCFA 3NQFA 3PS7A 1UJPA 4W9TA 3DXIA 4AHPA 3S42A 3STFA 2EKCA 5D37A 5HMSA 4OHQA 3LOTA 4AAJA 3MWAA 2CLKA 2FFCA 4AMAA 1KFEA 1OHLA 1W5OA 1S5VA 1ME9A 3OVPA 1R2SA 2ZA2A 3GDKA 3GDMA 3W1AA 3A23A 3LTPA 1I2QA 3W2JA 1TPB1 1LBLA 3IIZA 5AB3A 1DVJA 3HIJA 1PV8A 2X1RA 5EKYA 1H7XA 4GUFA 1GPWA 1H62A 2QR6A 5CSSA 1D3GA 2C1HA 1FCVA 1XM3A 2V30A 2V2CA 2ZRZA 5EBUA 3W7OA 3MJYA 1B3OA 3S6DA 1AL7A 5KZMA 3FKKA 5I3KA 2CLFA 3GDTA 3QPZA 3TC6A 4JDYA 3TXVA 2I1OA 3HGJA 2QCGA 1KTNA 3KVJA 4UCGA 2CLOA 3TMLA 3I7QA 4N2YA 4YLWA 2C18A 3IRDA 4LUJA 3EX3A 4XBSA 1NEYA 3NQ2A 3G1SA 3EB2A 3R13A 5CPOA 2WV8A 3LCGA 3CC1A 4IPJA 1P0NA 4NZFA 3QMRA 5F4WA 5FESA 4EOUA 4O16A 4H6KA 2VFEA 3A5FA 3PBVA 1XL9A 4TIMA 4JGDA 1ZAHA 3STCA 2WNQA 3N2MA 4JY8A 5H91A 4RR4A 4IQLA 3NZ1A 2WNNA 4ICNA 3M0ZA 3BW2A 3LRKA 3BLFA 3W73A 2LLEA 5BMXA 4MZYA 3PUEA 3PB0A 1EPXA 1FDJA 2TSYA 3Q2DA 4KFOA 4JX6A 1P4CA 5F1UA 3OG3A 4MOZA 4L4MA 1D3HA 3W1RA 2OT1A 3PG8A 2YFNA 3LDVA 3FYOA 2H6RA 3NL6A 4RXGA 3UQNA 3W1LA 2DZTA 1L6SA 4DBDA 1A5SA 2RHGA 4AH7A 3LBMA 1Z41A 2NXHA 4POCA 4UFHA 1L2UA 1GJPA 1SQ7A 4CNOA 4NJJA 4NNCA 3VFLA 2GOUA 2JKAA 3TSMA 2X30A 3QSTA 5EA9A 5E1QA 1F7BA 2QF7A 5F2GA 1VYSX 1TSIA 4OV9A 4JD4A 3NQEA 3W72A 1QPOA 2ZQ0A 2WQPA 5HWNA 3CTLA 1TTPA 1IF2A 3Q58A 2JGYA 2NWSA 4Z1BA 3HG4A 5D2XA 2RFGA 3SECA 4UTLA 4GBUA 3ZR4A 2NUXA 1OFOA 1YXCA 2PRLA 3TNOA 1W37A 4FB7A 3O6DA 4WOQA 1SW7A 1KFLA 2Y7EA 2BWGA 1I4NA 1SW0A 3O15A 3C2VA 1IXQA 1XKYA 3WK2A 1RR2A 2C19A 1TJRA 3GNNA 2QCHA 3S1XA 2NXIA 1H60A 1GYNA 4IMEA 3SIZA 3T55A 1ALDA 4JTEA 1ICQA 2A0NA 2J6XA 5H2ZA 1V5XA 2Y7DA 3G3DA 1DV7A 3BV4A 4O1DA 3THAA 2WO5A 1QWGA 4O17A 1O5XA 3CQ0A 1QCWA 1H51A 5K9XA 4AXKA 4Z1DA 4JTFA 3PR2A 1JUBA 3UY7A 3G1DA 2QJHA 2J27A 1MSSA 1Q6RA 2YXGA 4LU0A 1B9BA 1W3NA 4QITA 4UTTA 1SSDA 2X16A 4XKYA 3S5YA 1JULA 4JTUA 1IIHA 1X8FA 3O05A 1YDOA 3LGEA 3B0VC 1LTDA 4GUGA 3S8HA 2VFHA 5F4SA 1OX4B 4Y96A 3O16A 3IIPA 4R34A 2XFWA 1GTEA 3W85A 1VH7A 2RKXA 1G7UA 1B4EA 3QW3A 3STGA 5DLCA 4H4IA 3IGXA 1JRCA 4FEZA 1ICSA 1XBXA 5I3HA 1WOAA 1O60A 3E12A 3NQ6A 4O53A 3MO7A 5CZJA 1OJXA 3G8EA 4IXXA 1TPFA 3E49A 1FXPA 2W79A 2DZWA 5DBUA 3N3MA 3EWZA 1B4KA 5DY3A 1OF8A 3W87A 3W74A 5K2ZA 4ZL1A 3E0IA 1OFPA 4OQVA 3NVTA 3PUOA 3QW4B 2VELA 2JGQA 4DXVA 2A4AA 2GQ8A 5AN7A 3P8IA 4O1CA 3C61A 2GVLA 3VE9A 1ADOA 2GVGA 4HPJA 4A21A 3LXCA 3L67A 4N4PA 1F74A 3NDOA 3ANYA 3W1PA 5CKSA 1OYCA 1VCFA 1YPIA 1W3TA 5HQEA 1IXOA 3EKZA 1K8YA 3HGRA 3QRHA 1N55A 3LLDA 1DJNA 4K6AA 4NNBA 4Y9AA 2B4GA 3TKFA 4HNUA 1DOSA 2C16A 2FPYA 3BG5A 3ZWSA 3IGSA 3M9YA 1HUVA 3HQ1A 4FNQA 2AQWA 2DZPA 4MZ8A 3C2RA 3Q94A 2E5BA 5AFDA 1DKWA 1QPQA 5BOOA 5AHNA 1TPUA 1PHWA 3FJ6A 1GWJA 4YCOA 2X1TA 4UFKA 4UTWA 1TPC1 3KHJA 4I7WA 3DENA 2ZRXA 3LHVA 3S5NA 1XCFA 2C15A 4WQ6A 1N7KA 4UFJA 5DELA 2CLHA 4M5PA 4QJ1A 2ZRUA 1ZFJA 1FXQA 4RCXA 5D33A 2YPIA 3GB6A 3EKLA 4NX0A 5FEPA 1A5BA 1W31A 2C3ZA 3KRSA 4IJBA 2I14A 5ABTA 2DZXA 3NR0A 4M7TA 4PA8A 5CPMA 3DBPA 2DJLA 5K9DA 4Z1CA 3HPXA 1MXSA 4IXHA 3MP5A 3E9AA 3W7QA 5EMUA 5LNSA 4BI7A 1RPXA 3B8DA 4A2RA 2NXGA 3LXBA 4H3DA 4ZQNA 4DO4A 3WK3A 3L5MA 4M19A 2O7QA 1JCXA 4O12A 4MKNA 2A1YA 4ADSA 1WBHA 3O07A 5F2IA 3HG5A 2TPSA 4N6FA 1F2JA 1T99A 2GJLA 5G1TA 2VFDA 4UTTC 3C3NA 1FWNA 2WNZA 3W2UA 2XN0A 1WDWA 3N14A 1OABA 4N02A 3CIWA 3TMQA 2WSRA 3P81A 5K4ZA 4BF9A 2CLLA 5G4WA 3L0KA 3W7DA 1A50A 2G97A 3BVJA 1K3UA 4A22A 3VKJA 3LB0A 2FB2A 1IIGA 2RDUA 3W7HA 1K03A 2ZZ3A 1VCGA 1ZAIA 3B04A 4ORMA 1JQXA 1QPRA 1KM0A 4TMCA 3B05A 5CG7A 3WJZA 3TH6A 3BGJA 3W76A 4MY9A 3L9CA 4O18A 4CCEA 2QEZA 1Q6OA 1SW3A 4XKYB 3QH2A 5I3IA 3KRZA 4ZQMA 2FJKA 1H50A 4N6EA 3B0PA 3LI1A 4GXMA 4LW7A 2ABAA 3OA3A 2D73A 3SY5A 2ZDRA 2Y63A 1ICPA 3QYQA 4LVFA 4LY8A 2WSYA 1K7EA 4OWGA 1S5TA 4YXGA 1HL2A 1M5WA 1TTJA 1TV7A 3W3OA 2CZFA 4XZ9A 1UB3A 4RZ4A 1OX6A 1KFBA 3CEUA 2VEMA 1RV8A 5FF3A 3LCXA 1P5BA 1FUYA 5J5DA 1O4UA 3SFKA 3PF3A 5AOUA 4WD0A 5D03A 2OX1A 1SUXA 1TV8A 1WBJA 1QAPA 1JUEA 4QAIA 3CT7A 3DHFA 2V81A 3MI2A 1J2WA 1PIIA 1H7WA 2NX3A 2HSAA 2ZA1A 4JYDA 3T7VA 3W70A 5C5YA 3C4UA 1FY6A 1R30A 5I3GA 1HO1A 1ONRA 4PODA 2WPBA 4O54A 1F76A 1FWWA 4PH6A 1GZGA 4A2SA 3IV3A 3NXFA 4FXRA 2YDAA 4K8EA 3P74A 4UTWC 2QUUA 2VOMA 3L21A 1P0KA 1GVRA 2XN1A 3C56A 3TW6A 5TIMA 1VJIA 2ABBA 1G4SA 2YGYA 1P1XA 3W7GA 3LHTA 5AC8A 4PL2A 3LRMA 4JS3A 1FQ0A 3LHUA 2PCQA 2YFOA 4DBEA 4ZMGA 3O6CA 4FNTA 1A5CA 4JIPA 2C13A 2WSQA 1XBVA 3W2NA 4DPQA 2E5CA 3IIOA 3TUUA 2HS6A 3PY2A 4HNNA 3S9YA 1W3IA 3NPWA 1UASA 1BTMA 4LRTA 3B4UA 3C2EA 3DKLA 2F84A 3F03K 3W7IA 3G1FA 1TPWA 3G1VA 4X22A 4O4WA 3N9RA 5K4XA 3NEVA 3W23A 2ZCGA 2A7RA 5EY5A 4JICA 4DPPA 5FI8A 4HSOA 4RXFA 2V2HA 1VYRA 1WX0A 4O1AA 3DAQA 5F2MA 4CCDA 5MHBA 4B5NA 1VYPX 3HGSA 3NQDA 2ZTJA 2CLIA 3O6YX 1FCBA 2DU2A 3W7JA 5D2TA 2ZRWA 1SFLA 4I7UA 1KFJA 2DJXA 3LBCA 1TV5A 1FX6A 1XBYA 5HNRA 2E77A 4I9AA 1KV5A 4TR9A 1O95A 5BMWA 2CWNA 4WXZA 1BWKA 2Z1BA 1W54A 3MP3A 2GPTA 3TDFA 3HMJG 1H63A 2NUYA 1QMLA 3G1AA 5HINA 4OU1A 4FNSA 3O63A 3U6WA 3RF9A 1LRQA 1F5ZA 2A2IA 3HF3A 1ZAJA 1KM1A 2QCEA 3KAOA 3LCLA 3NL2A 3NGJA 5K7JA 4HSNA 4IMGA 1TO3A 1X1ZA 3G8RA 4NX5A 2EGZA 3GR7A 1L6YA 2FQIA 2C6QA 2QUVA 3LTSA 1OK6A 3N19B 3TQKA 2DZUA 1UUOA 4EIVA 2A85A 3TE9A 3PAJA 3TJXA 3MI6A 4OE7A 3ABOA 3BLEA 1YTKA 4O11A 3SR7A 1MZHA 1I2PA 4JYFA 5HR6A 1EX5A 4N9DA 2Y7GA 1VHNA 4GNJA 4LS0A 1J5TA 4UR8A 2QJGA 3KVMA 1QOPA 2E5DA 3EWYA 2G5WA 3W83A 3KRUA 1GEQA 2H90A 2NWRA 4FNPA 3BW4A 4O0ZA 4KWVA 4P2VA 4E0CA 4Z0JA 3I7SA 4OBTA 4AWUA 4K36A 3WFAA 3L68A 3CHVA 1JCNA 4CLMA 4ZQCA 1JCJA 5BW6A 4XWUA 3GX9A 1B57A 1EB3A 1XDLA 1TCDA 1DJQA 1WA3A 3DU0A 4X3ZA 2Y89A 3EWBX 4S2CA 3OIXA 5LNUA 3UY8A 1TRDA 3PB2A 3R2GA 2DP3A 3S1WA 4GE8A 2VC6A 2A6LA 2WJZA 4LRSA 4NU7A 5TBOA 1SZNA 3UYCA 4ZVJA 2F7FA 3M7WA 3OVQA 1M7PA 4O4VA 1IXPA 3GKAA 3FYPA 1ZCOA 3C2OA 3UWVA 4PEKA 5L6UA 3R12A 2JK2A 2FPVA 3FFSA 1LOLA 4U4MA 3G0UA 3VE7A 3EX6A 3PSWA 1F6KA 3F4NA 3BO9A 5HJLA 4JTJA 1DL3A 2C0AA 4IOTA 5D04C 1EP2A 4MJZA 4JEQA 4PL1A 3A24A 3P5ZA 4ZQRA 3BW3A 3TFCA 2E1DA 4HKPA 3MHUA 4IWWA 3ATZA 1EWEA 4R33A 2X1SA 5BNKA 2QUTA 2Y70A 3GZ3A 3NQAA 3HPZA 5G4EA 2NUWA 1CW2A 2QCCA 4N9EA 1H7OA 1YTDA 5AHEA 5CZSA 4N4QA 5FEZA 1K02A 2B7QA 3QJAA 1L9WA 2VEIA 3QFEA 4GRSA 4UTJA 2ZZ1A 1I2NA 3RK8A 1FDZA 3GK0A 3DFSA 3GKFA 1DQWA 3TK7A 3UZ5A 3QEZA 4MLJA 3NYZA 3L5AA 4MY8A 4WJEA 5FEWA 1WV2A 3NPXA 3G1HA 2OZ0A 1H61A 1JVNA 3MW7A 3UPWA 1AW1A 4PTNA 4NJHA 4JTTA 3C0JA 4M6QA 3IIXA 1FWTA 6TIMA 4RJEA 1KLYA 3BLIA 3EXSA 1DORA 4KKXA 4CQ8A 4Q4KA 4BI5A 3DZ1A 3INPA 3DFPA 1D9EA 5LGXA 1RVGA 3IVTA 4ADUA 3V75A 4L4LA 3AJXA 3KX6A 5D32A 4BR1A 1Q45A 1VHCA 3MUXA 4O13A 2Y88A 1SZGA 3NQVA 1KBJA 1HFBA 5LZLA 1AW5A 5AHIA 4CNNA 3I68A 1UCWA 3U2OA 2QCMA 4AEOA 3W7NA 3NM3A 2YZRA 4Z0SA 5C54A 1XFBA 3P84A 5AYZA 3VI2A 2TMDA 3SI9A 4UUIA 2ZZ2A 4FX8A 4J9JA 3WK0A 4JDBA 1U5JA 3I7RA 3A9IA 4O50A 5LNRA 1R46A 4XQ6A 3EEGA 4HHPA 1YADA 1TMHA 3FOKA 3CIXA 4CCCA 5C6MA 3NM1A 3R5EA 4LOCA 5DXYA 2P0OA 3CU2A 4G1KA 2J9ZA 1NF0A 5HWMA 1OK4A 3LERA 4ZQOA 2G96A 1A5AA 3HG2A 5CPNA 3A22A 4WUIA 4AF0A 3M5ZA 4JNMA 2BSLA 3GIYA 3TROA 4AWSA 3KFTA 1LYXA 3GAYA 3U8GA 3M5YA 3P80A 4FX7A 4QIUA 3RNDA 3K30A 1GOXA 3W6YA 1JR1A 3DGRA 5D2VA 5LSMA 2FB3A 3S5ZA 3PG9A 4UIOA 1GTHA 3NQGA 2FLIA 1HO4A 1PVNA 3G0XA 2R8WA 2VFGA 3B06A 4UR7A 1KA9F 1JJKA 1H1YA 4LUIA 3OVRA 3MYOA 3P5YA 5DCEA 4NJIA 4NXKA 1LLZA 1V7YA 1WQ5A 4UFIA 3LV5A 3R8RA 5E93A 3G1YA 5D05A 3PWAA 4UC5A 3B03A 3N34A 3NNTA 1W1ZA 3GNDA 3JRKA 3G3MA 2QJIA 4LV9A 1SO3A 4NT0A 5HWJA 2V9DA 3BARA 3DI0A 1LBFA 1EP1A 4JIQA 1Q3NA 4E38A 3TSDA 4WX2A 4YMZA 1W56A 2OCZA 2CZDA 3BG3A 2CU0A 1LLWA 4FO4A 5LHFA 3FKRA 4RX0A 3TR2A 3FA5A 4XUGA 5DN1A 3NG3A 4NNAA 1ME7A 5L9FA 1GVOA 4O57A 5HUPA 2O7SA 4GFSA 4M7SA 1G4TA 1LDCA 2Y6ZA 4ML9A 1SR9A 4O52A 3HJZA 2R14A 4Z08A 2WOQA 4NXSA 1LBMA 3M47A 1ZHAA 2VFIA 4HN4A 1XUUA 2PC4A 3TFXA 1BKSA 4JYEA 2VEPA 2GQ9A 4HPXA 2VENA 2E6AA 3UWQA 1VCVA 1AMKA 4ADTA 3W7CA 3TAOA 4LVAA 4TO8A 1LROA 2ZA3A 3BGGA 4U28A 2H8XA 2A7NA 4AWTA 1F05A 1W8SA 1Y0EA 1EEPA 3FEMA 5D38A 1NSJA 4Y8FA 1THFD 1LCOA 3THQA 3NQCA 1OYBA 1LZOA 1EA0A 1JUKA 1EUNA 2HS8A 3ABQA 1KM3A 4K39A 3TV8A 1FBAA 5DXXA 1TQXA 5AHFA 4EF8A 5LKYA 2A5HA 4RLIA 3LHZA 1EWDA 2EF9A 5LGZA 4DO5A 5F4XA 1NFBA 1NAL1 2Q3RA 5HR7A 4DQWA 1OYAA 4LC8A 4UNLA 1HTIA 4NJKA 1PCKA 4DO6A 3P62A 1OFBA 5BRBA 4C1KA 3ELFA 4N9BA 1Z42A 1QNVA 3G1XA 5G5IA 3TAKA 3CPRA 3IVUA 3OHIA 1Z48A 3M16A 3N9SA 4MLRA 1G6CA 3QM3A 4WXYA 2BXVA 2IQTA 3PSVA 3W7EA 2QDHA 4DELA 4GC4A 2QAFA 1Q6QA 3UPBA 3PBUA 1PS9A 2OJPA 1Q6LA 4MZ1A 1YXYA 2EHHA 2OT0A 3UWZA 4HIBA 3W7KA 3MHGA 2OMAA 1YYAA 4A3UA 1PL9A 3SSJA 1KM6A 3GLCA 3RLUA 1OFDA 2HTMA 2W0UA 4JTIA 4O8RA 3S1VA 3SZ8A 4LTSA 5KTLA 1K7XA 4OV4A 3NQ8A 4JY9A 3TX9A 2ATMA 2ISSA 2YW3A 4C1LA 3ATYA 3STEA 3F4WA 1OVDA 2RDWA 1UUMA 2I9EA 4IPIA 2ZFAA 1G4EA 2DZVA 4KWWA 1T0OA 4MPQA 4QNEA 4MIMA 1WYIA 4O15A 3ZWTA 4AHOA 3CWNA 4MFEA 4MUZA 1IGSA 4R7JA 3LCHA 3N2XA 4JTLA 1SO5A 1OFAA 3MBFA 5C55A 2B7NA 1W0MA 3EXTA 3M1ZA 4M6VA 3QQ0A 1E51A 1XC4A 1TPH1 7TIMA 4ALDA 1GT8A 3NOEA 2ZZ4A 1T96A 1H7RA 1H7NA 3C6CA 3C2FA 3HOJA 3JR2A 3ZS4A 4O19A 3LCIA 5FF2A 5LNWA 2AGKA 1AG1O 2YR1A 4AF0B 2NX9A 3M41A 2C14A 3G24A 3ZFHA 5CSRA 2Y62A 3S0CA 1KM2A 3E02A 2QCLA 4YCPA 1GG1A 2QAPA 1LP6A 1GVFA 1G67A 4NJGA 1VS1A 2GQAA 1DBTA 1JCLA 1LOQA 1VLIA 3KOFA 4RV8A 4LT9A 4MJMA 3CM4A 1TREA 1F73A 3I65A 4JX5A 3LLFA 2ZRVA 1Z44A 4AHQA 3BK0A 5F1VA 1KW1A 3TQVA 1I2OA 1RQHA 3RFAA 3HBLA 1R47A 2XN2A 3NA8A 4PC8A 1KM4A 2EAWA 3L0GA 3WJYA 1TPEA 3TC7A 3T40A 3TCEA 2Y85A 1J4EA 3ABRA 4LNYA 2E6DA 4IUOA 3IGUA 3W7RA 2QDGA 2E6FA 1W5MA 5AC6A 1WAUA 2TRSA 4GUJA 3GDRA 3M5XA 1ML1A 5C2XA 2Q8LA 1HG3A 1VR6A 4JN6A 5G2WA 3T78A 1GQNA 4TMBA 3B0UX 3ABSA 4Q33A 4XBKA 1ZNNA 1JRBA 1JQVA 3TQ0A 5G1YA 2ISVA 3W1XA 4WY0F 1ME8A 3TJLA 2VEKA 4HT3A 1OX5A 2BTMA 4DF1A 3QMSA 1GG0A 3WJSA 3UZJA 4UTIA 5LNVA 1FCQA 2V82A 3O06A 4E2BA 2YSWA 4FHAA 3P7YA 1SFJA 5SWUA 3EX4A 5I3JA 4CQ9A 2X2GA 4JXCA 4UFLA 5DCDA 1YTEA 4S2BA 4TU1A 2J88A 3WK1A 2B7PA 3I6RA 3A21A 1KM5A 3W7PA 3GVGA 2ZBTA 2PRHA 4IMFA 4ONVA 4FIQA 3GXNA 4YWIA 4E2DA 1MEWA 3L66A 4I7VA 2GUUA 1SO4A 1FCUA 3L5LA 1UBSA 4IX2A 3RLVA 5TQLA 1L6WA 2QCDA 3W22A 4EVZA 2ISWA 4JX4A 4LS1A 3GXTA 4UNKA 1C9DA 3USBA 4YL2A 2J9YA 3PBWA 4JTGA 3EX2A 4FNUA 1W5PA 1K7FA 3G22A 4LVGA 1QR7A 4PCFA 4RZ6A 2QCNA 3NL3A 3KVLA 1MO0A 3WJWA 1QDSA 4JR5A 3LX9A 4TX9A 1GVQA 2PRMA 4K37A 3O1NA 2Z6JA 3TIMA 3EWUA 3SW6A 3TU9A 1OFEA 3CEPA 3QC3A 3LCWA 3TXZA 3LV6A 4K7YA 2VKZG 1QOQA 1VZWA 1SZFA 2PE4A 3W7MA 3W84A 1YXDA 3DH7A 3PC0A 4IGHA 3W9ZA 5A5WA 3WJXA 4BWLA 1H1ZA 4MYXA 5K9CA 2V0TA 1AW2A 2H3BA 1I45A 4UTKA 5IBXA 3HGOA 3W2MA 1OG0A 2JKEA 3O8AA 3KVKA 1C29A 1PE1A 3MI3A 3W88A 1YPFA 2V5LA 2A21A 3L2IA 4Y6GA 1ZENA 3LTYA 3HG3A 4GJ1A 1RD5A 3QF0A 5AC7A 1PCWA 2A6NA 4OT7A 3IEBA 1I2RA 4GUIA 4MY1A 1A53A 3W1UA 5K3VA 1SZEA 5FF0A 1LOSA 3DFTA 1LRNA 1QPNA 3C8FA 1LORA 3S5OA 3W1TA 2FPTA 3MMTA 5CGQA 5KMYA 3SGZA 2X1UA 1N8FA 2Z0IA 5AYXA 2GJNA 4Z1AA 2E68A 3NPUA 3QSRA 1TB3A 1NF7A 3LCFA 3DFNA 4MVAA 2W6RA 3PM6A 3PUDA 5F2LA 5EYWA 2V8ZA 1LRTA 5FF4A 4QSHA 2E09A 1PHQA 1VC4A 1M6JA 3IIVA 3QZEA 4RZ5A 3TA6A 2H8ZA 2AAMA 4LS2A 4S1FA 1KFCA 2G95A 4WY0A 1JCMP 4UTUA 3W71A 3NQMA 4K7VA 2B7OA 1EP3A 3LM7A 1RQEA 3BG9A 2FIQA 4P61A 3A5VA 3N73A 2EPHA 3TW7A 5CZ0A 1M7OA 3W86A 5D30A 3VNDA 5IM51 1X7FA 3HO8A 5G2HA 3EWWA 2ZRYA 5DCBA 4JTSA 5KZEA 3CWOX 3C52A 1CI1A 5KITA 4N9CA 5AHMA 2FTPA 3W07A 4QM1A 4Q32A 1QO2A 4CQAA 2Z2UA 1S3HA 2J9XA 3W75A 2VXNA 3M6YA 1KV8A 3E96A 4EWND 4LVDA 2BX7A 3SGUA 1ZJIA 1G69A 1XDMA 3UNDA 4BK9A 2YYUA 2ZYFA 3L65A 1XXXA 3LHYA 2ZZ5A 1ZY9A 3QQ1A 3M5VA 2ATSA 1MEIA 1WOBA 2Y61A 4M6PA 4WZHA 2P1FA 3W2KA 3QMTA 4AB4A 4O1BA 3NPVA 2RDTA 3GYEA 1QFEA 1YDNA 3EWXA 3F1QA 4UMBA 1CX9A 3NQ7A 1VPXA 3PULA 4K38A 5KINA 1H7PA 1JCYA 4UTMA 2GVJA 3GDLA 3W1QA 3CB8A 3RU6A 5CPLA 3P67A 1XBZA 2FDSA 1GYLA 1EUAA 4R53A 4UTHA 5LHEA 2YCEA 1TTIA 1AK5A 5AYYA 5U4NA 5D02A 3FIGA 4O28A 4EF9A 4FF7A 1W5QA 1AL8A 5DY2A 2Q8ZA 6ALDA 4OGZA 1LM1A 4WOZA 5FEXA 2QCDB 4CNPA 4ORIA 2B0MA 2DORA 4DF2A 2Q3OA 4IMDA 4HNTA 3JS3A 1KTBA 2Y7FA 4MFDA 2NV1A 2ZTKA 2NX1A 4BWLC 3LXAA 3TSBA 2CFFA 3DKJA 3LRLA 5I3FA 3EX1A 3GXPA 2ZZ6A 4NUWA 3UWWA 5KSWA 3FLUA 1F6PA 3H53A 4FXSA 1SSGA 5IBXC 3P8JA 4O14A 3V1PA 3BPWA 2NZLA 1BEUA 5T26A 4AVFA 4O10A 5D2YA 3HB9A 1SO6A 3RMJA 3UD6A 4BI6A 3DFOA 1FWRA 3GAKA 1TPDA 4ZZ9A 5A8GA 5U7SA 3Q37A 1BWLA 1EIXA 3CLMA 5EL1A 4K8HA 4MYAA 3G18A 2DZSA 4UFMA 2JKPA 1C8VA 1I8JA 4QQ3A 4FNRA 4NZJA 4JTKA 3MBDA 2H3DA 1NVMA 3T4CA 3SJ3A 2CZ5A 4X2RA 3NAVA 1TYGA 3NL5A 4LC6A 4GWEA 1U83A 3PBYA 3LI0A 1G7VA 3IVSA 3H55A 1VLWA 1FDYA 5GVJA 1WXJA 1QO5A 2BLEA 5CZTA 4LWWA 2P10A 2A7PA 3EXRA 1FWSA 3UXDA 2YYTA 1OF6A 1KLZA 4ZQPA 1H5YA 1TJPA 3FJLA 3MHFA 2YW4A 1O94A 3W1MA 1KFKA 1RZMA 3R89A 4QNWA 1W5NA 3NZRA 4PFMA 4XTIA 1TQJA 1TPVA 1VRDA 2CW6A 4BFAA 3D0CA 2UV8G 1TIMA 1SU5A 4KFPA 4NVTA 3HPSA 1VQTA 1OFRA 1VGAA 4FX6M 4IX0A 3AO0A 3MP4A 3P60A 3OBKA 1XI3A 2V5BA 3UWUA 4UXDA 3P82A 4DF0A 4FIRA 5KZDA 2R91A 2V2DA 2NLIA 1OFQA 2WKJA 3VCRA 1K8ZA 4KFNA 1YDVA 4WY0B 4NQ1A 3M44A 1XUZA 2HMCA 3NO5A 3UWYA 4LV4A 5J5RA 3LHWA 4RKAA 1S5WA 5DBTA 3OEXA 4QISA 1TRIA 1R2RA 4GUHA 5HULA 2J24A 3DI1A 3PVFA 2R94A 3UXAA 4HNVA 1K8XA 2TYSA 1T8XA 4O0KA 2VFFA 4Y90A 1TTQA 3QPYA 2ZZ7A 5G2IA 3W1NA 1KBIA 5D2WA 1O5KA 1ZALA 2Z6IA 3KXQA 1G4PA 3S1UA 5E0KA 1X6UA 4RK8A 3L0NA 3H54A 3YPIA 2QKFA 3W2LA 2ALDA 5EPDA 3MYPA 4D2JA 2E6YA 3GR8A 4XTDA 2PURA 1IXNA 1X1OA 2RH9A 3DHDA 2BZNA 4DEFA 4UMAA 2JBMA 3FS2A 3P61A 5FF7A 8TIMA 4A29A 5HUOA 2CLEA 1RQBA 5AHLA 1OX4A 2YX0A 1DQXA 3DFQA 4UMCA 4X9SA 1DHPA 2KZHA 2CZEA 3W7LA 3M43A 2CLMA 2NV2A 4JTHA 3T44A 1R2TA 1YLVA 1KTCA 1MEHA 4LVBA 3G0SA
chains in the Genus database with same CATH superfamily
3KOZA 3NQFA 1Z3NA 4PULA 1P0EA 3L2LA 3S5SA 3UJSA 4OHQA 3MWAA 2CLKA 2FFCA 1KFEA 1OHLA 1S5VA 1HZYA 3TC3A 1NOWA 3WEOA 2I9UA 4MB1A 4DRSA 3KRBA 1I2QA 1TPB1 1DVJA 3HIJA 3H21A 4L1XA 4TVUA 1D3GA 1CZ1A 4QEHA 3O6AA 2VUYA 3GDTA 4JDYA 2I1OA 5C9ZA 2IKIA 5A94A 4RL3A 2CLOA 3TMLA 2PDMA 4AIBA 2EXOA 4J3XA 1EGVA 1NEYA 2BGSA 1EEXA 3ARTA 3OGRA 2DT1A 5C7HA 1YX1A 1CENA 5CPOA 2WV8A 3BLDA 4IPJA 4EOUA 1K9DA 3I3BA 4XZMX 2I17A 2CXEA 3CUJA 1ZAHA 4ES4A 4IQLA 4ICNA 1TWIA 3XISA 1O5RA 5B80A 1KKOA 3OZMA 5BMXA 3LUTA 1PKYA 2TSYA 3Q2DA 1FKWA 4MOZA 4ZO7A 3AIWA 3FVDA 4Q6XA 4JHZA 4XD4A 4YHGA 1D3HA 1QXLA 1CGWA 3PG8A 4V33A 3FYOA 2H6RA 1H4PA 1J10A 5LXXA 3W1LA 2WJDA 1L6SA 5FSDC 2RHGA 4EWJA 1Z41A 1XLKA 2NXHA 1GJPA 1GVYA 4IMAA 4GI9A 3SAZA 3TQPA 2GOUA 2GK1B 2YDQA 3HFYA 5EA9A 5E1QA 1TE6A 1F7BA 2INZA 4DI8A 4V1YA 1TSIA 2XIJA 4JD4A 2OSYA 4XSMA 4E4UA 1TV4A 4LUSB 1QPOA 4OOUA 4HB7A 5HWNA 1IF2A 4DXXA 2WXDM 4R9XA 1FVPA 3SN0A 2CHRA 3V36A 4QE4A 4C5YA 1GJUA 4DBWA 4PCPA 2OYMA 2PRLA 1QW7A 2ZXQA 3POHA 4Q8PA 4MB3A 2WMIB 1SW7A 2Y7EA 1B1YA 3C2VA 4PCSA 4NRSA 1IXQA 1XKYA 1RR2A 1GZJA 3URAA 3GNNA 3VA8A 2A0NA 2J6XA 1V5XA 3VUPA 4W8BA 1QCWA 1H51A 1GCYA 4L9YA 1TMLA 4JTFA 5AVNA 1A3XA 1MSSA 2YXGA 4LU0A 3UT0A 1EO7A 3CUXA 3A3XA 1GK8A 2OG9A 3CL6A 3F5JA 4FPSA 3OP2A 3S5YA 4X2PA 1IIHA 3H12A 4HMNA 2ZUNA 3EGJA 1EOKA 2AQOA 3VO0A 3TN3A 1LTDA 4XX6A 1ZJAA 3S8HA 4HCLA 4PMRA 4Y96A 3O16A 1MWOA 3R0KA 3IJQA 3W85A 1AD4A 3GG7A 1VH7A 1G7UA 4CU6A 1B4EA 2PF8A 3IGXA 3DERA 1ICSA 3ITVA 5I3HA 3NQ6A 4O53A 3VMNA 3MO7A 5CZJA 5I5RA 3EEZA 4GVFA 4IXXA 1ITXA 4W5UA 3VIJA 4FLQA 5DO8A 4QROA 2YCLA 1ISWA 4CD7A 1S5MA 3MU7A 3JZEA 1B4KA 3FHQA 1XIEA 4AEEA 3NVTA 3I6EA 3PUOA 8RUCA 1DP0A 1L2QA 2A4AA 4DYKA 2GQ8A 2WLYA 3CMJA 3C61A 1IR1A 2GVGA 2IMRA 4HPJA 3SUSA 3BTNA 3ZT5A 4XBJA 3L67A 1JEZA 4B3KA 1F74A 2YA2A 4C6CA 3W1PA 2ICSA 3VGHA 4PEEA 2J7DA 1IXOA 5JUVA 1DJNA 4K6AA 3TKFA 2B4GA 4IF2A 2PMQA 1VEPA 3ZWSA 4FNQA 2AQWA 3APTA 3M64A 5A6AA 2DZPA 3VNKA 5A6KA 1LWJA 3VDCA 3OZPA 2XYLA 3WD0A 5AFDA 1ZZMA 1Q2RA 1O12A 2DQXA 1PHWA 1W8GA 1GWJA 2CBVA 2IQ0A 2X1TA 4GMEA 4OBRA 1TPC1 3M0YA 4I7WA 3ZJKA 1LT7A 1FA2A 4E8CA 2W61A 5KZ6A 5DELA 2OWCA 5AZ0A 2ZRUA 4ZSTA 1FXQA 1S3TC 4RCXA 3M7SA 2KAUC 3AMLA 1Q7MA 3AMCA 3KRSA 2VR5A 3LNMA 4QX4A 3KP1A 2DZXA 4Q7NA 4GCAA 3WEMA 4M7TA 3LMYA 3BUVA 4B90A 4RE3A 1UH3A 1A0CA 1GQJA 2XSXA 5CGMA 4KEVA 5EMUA 4BI7A 1P1MA 3TTYA 4NZCA 4A2RA 5IOBA 2NXGA 3IPWA 2O7QA 5ABHA 4MWAC 3IAPA 1L6FA 4GLEA 1NY1A 2G3FA 1V8EA 4H2CA 2TPSA 6CGTA 1T99A 1YKWA 5G1TA 2XH2A 1J79A 4UTTC 2OWXA 4KCVA 1QNPA 1QBAA 2BG5A 3W81A 1IHIA 4LF1A 2XPKA 3ZJ8A 4ZOCA 1SZRA 5IHSA 3TTSA 2TODA 4N02A 2F61A 4C7FA 3QHMA 5K4ZA 2CLLA 5G4WA 1E6QM 2GOKA 4HK6A 1V79A 1A50A 2G97A 3BVJA 1UPPA 5E9XA 2EG7A 4C6IA 3W7HA 3CQKA 2ZZ3A 1VCGA 2WM0A 1ZAIA 4ORMA 2Z29A 4B5VA 2W91A 3W76A 4MY9A 1CB2A 4O18A 5MF5A 5I3IA 4R85A 4Q4SA 4G9PA 2UBPC 4HU8A 3KRZA 4GABA 5B7ZA 4HQVA 1C3FA 2PGWA 3B0PA 3M6DA 3WQ8A 2D73A 2ZDRA 1EXBA 2QV5A 4Y9PA 2BDQA 1Z7AA 4E6MA 4AWEA 4YXGA 1HL2A 4LB4A 1CT5A 1V0NA 4PRWA 3NIYA 3CEUA 4Z2KA 1RV8A 2J77A 3LCXA 5J5DA 1O4UA 3JZUA 4FAMA 1GONA 5AOUA 4WD0A 5JBEA 4K1WA 2F38A 3KZPA 2NQLA 1JUEA 2Q71A 3CT7A 2V81A 3MI2A 2YCLB 1VRXA 2J79A 2HBVA 1R30A 1OG6A 1ONRA 1JI1A 1FWWA 4PH6A 5HBFA 4A2SA 4DBUA 3IV3A 1EOMA 2XH7A 3GHRA 3NXFA 4FXRA 2YDAA 3VIKA 1TV2A 4PCTA 3P74A 3VX1A 2QUUA 5CC6A 3L21A 3SUWA 2FZDA 3TN6A 1P0KA 2YGYA 1I1WA 4R88A 4JL1A 4PL2A 2YXOA 3LRMA 4GACA 3VAVA 1BYAA 4DBEA 4FNTA 4JIPA 1QNOA 4IISA 1DJIA 1UJQA 4GQRA 2WSQA 3IK4A 1PUDA 1XGEA 3OU8A 1RHCA 2E5CA 3N13A 3VIFA 3GWQA 3S9YA 1OINA 1W3IA 1UASA 2V3FA 3UJRA 4LRTA 5ECUA 4D8ZA 3F03K 4QDMA 2R6OA 5LIKX 4S3GA 4HSHA 2QULA 4E4PA 1HJQA 2PD9A 1SMAA 3N9RA 3DG6A 5K4XA 2V68A 5EY5A 4ZENA 4DPPA 5FI8A 5M2FX 4WCJA 1W9DM 1XLAA 3D47A 3WMBA 1UOZA 1RLDA 4DM1A 1GYMA 3WBXA 2NVAA 4DUXA 3NQDA 2ZTJA 1FCBA 2DU2A 1ZLPA 2DJXA 3LBCA 1TV5A 1XBYA 5CPTA 1OC5A 1Q85A 2CWNA 3WQWA 5TF0A 1HQTA 1W2PA 3WMSA 3MP3A 4GZIA 3CNYA 1M41A 3AIRA 5HINA 3U6WA 2ASHA 1F5ZA 2XH4A 3GNPA 3DFYA 3LPFA 4PB3A 3NL2A 1A5OC 2VZUA 3FXGA 1W1IE 3F4CA 4HSNA 2NW0A 5BCAA 4U2ZA 1X1ZA 1X38A 3G8RA 4NX5A 1J12A 1U5HA 3H2CA 3N6QA 3B4YA 7CGTA 1XIFA 2DZUA 3ARQA 5DX7A 4HMEA 3TE9A 3BOFA 3PAJA 3MI6A 3ABOA 4WKAA 5DRCA 4GYKA 3VDBA 1EX5A 4V2XA 2X7WA 3VD5A 4GYJA 1N2VA 4GNJA 4LS0A 4UR8A 2QJGA 4R7OA 2R1NA 2G5WA 3E1F1 3MCNA 4FNPA 4JHMA 5FL0A 6A3HA 3WO8A 1Q6DA 4E0CA 4D8LA 5GJPA 4AWUA 3WFAA 1SJAA 3L68A 5I07A 3CMFA 2ZE3A 3GX9A 1B57A 1BF6A 1EA9C 5CSYA 3DU0A 4X3ZA 2F9RA 4QS5A 2W62A 1TRDA 4DZIA 1PJ9A 5JU6A 3PN8A 2V5KA 1J01A 3CBWA 1ONEA 2F7FA 3M7WA 3OVQA 1IXPA 2VR2A 1MFVA 4QGCA 1PKNA 1ZCOA 3WNMA 3AHTA 3KCJA 3FFSA 3AI0A 3S9ZA 1AH0A 3BH4A 4B3LA 3F4NA 1V3MA 3PPGA 1E3XA 1EP2A 1DIEA 5T8GA 3HQOA 4ZQRA 3P5ZA 3TFCA 1S2VA 5DEZA 2OQHA 3MHUA 3ATZA 3GBDA 5BNKA 4L5ZA 2QUTA 2V5CA 3AHVA 4H9TA 3GZ3A 3HPZA 2QCCA 3AIUA 5AHEA 3M0KA 5FEZA 2B7QA 4NYYA 2VTFA 3OTRA 1OY0A 3STPA 2DSKA 1I2NA 4DI9A 2VGBA 1FDZA 2VD9A 2G0WA 1B3WA 2FH8A 3TK7A 4MLJA 3NYZA 4HZMA 3QC0A 1R38A 3CQHA 2GDQA 1JVNA 3UPWA 3ITTA 1FFQA 4KEZA 3EXSA 4CQ8A 1RBOB 4Q4KA 2WMGA 4BI5A 1NWRA 3INPA 3WIJA 3DFPA 2INEA 1DE5A 1F3TA 3V75A 4L4LA 3GVWA 3AJXA 3KX6A 2NQ5A 3UCDA 3B8IA 5D32A 4BR1A 4F0RA 4RV3A 4L6DA 1E1EA 1H09A 4O13A 2Y88A 1SZGA 5LZLA 3A4AA 2BY2A 4AEOA 3L4XA 2D0FA 2OSXA 3W7NA 3WBYA 3EPOA 3SCVA 3SCSA 4JQ2A 1X8CA 2ZZ2A 4J9JA 3WK0A 3FN9A 4M56A 2DUAA 3A9IA 1YADA 1TMHA 5C6MA 2BBFA 4H8VA 5E9AA 3WH5A 3R5EA 4LOCA 5GNXA 3MT1A 4W89A 3RR4A 3LERA 1UZHA 2QS8A 4ZQOA 4KEUA 4WUIA 4AF0A 1FTXA 3O9NA 1US3A 2DSUA 4IH3A 5FSEC 3T8QA 1WKEA 1JL8A 1KGUA 3DC0A 4FX7A 3RNDA 1MI3A 3KZSA 1CXFA 5HQMA 3LGGA 1QHOA 1UWQA 1X7IA 4QCFA 1GOXA 4KGJA 1JYXA 2GVEA 2BVDA 2IPFA 3DGRA 2YZ5A 3Q65A 4UQBA 3VD9A 4FOKA 1LWHA 3TTQA 3NQGA 4J1OA 2DH3A 2FLIA 4CEUC 3G0XA 4GCXA 3WD3A 3B06A 5IFPA 4G1NA 3WYZA 5CSUA 3AXHA 4PMDA 1XRVA 4D6DA 2PDGA 2YCIX 3WL1A 3JRKA 2QJIA 5FCZA 4KMQA 1TELA 4ZO8A 3MUIA 2V9DA 4E38A 5EMKA 1WZAA 5CH9A 1IYXA 5LHFA 3FKRA 4RX0A 3VK5A 3FJNA 3FA5A 3TR2A 1RVKA 3NG3A 4G5DA 1GVOA 1EDGA 4CGTA 3GBEA 4TTGA 2O7SA 3LK6A 1PIFA 4W88A 2Y6ZA 4ML9A 3HJZA 5IRPA 1V6TA 4NXSA 1E70M 3M47A 4HJFA 4ZFMA 1ZHAA 2OLAA 4KT2A 3VKAA 2E25A 2W3ZA 2VX6A 2GQ9A 4HPXA 2VENA 1XLDA 2E6AA 1VCVA 3V5OA 8CGTA 5A95A 3W7CA 4PYSA 1I6NA 3VGEA 4QP0A 3S6TA 3F7JA 1ZB5A 2H8XA 1DWIM 1Y0EA 1W8SA 4F0HA 1EEPA 4JTRA 3FEMA 4Y8FA 3GE7A 1QW9A 3NQCA 2R1MA 1OYBA 1LZOA 3IRSA 4QQUA 3L4UA 3ABQA 1KM3A 3TV8A 5HJYA 1P0DA 1DPMA 5LKYA 2YA1A 3LHZA 2R1LA 1EWDA 2HNEA 2Q3RA 4YYFA 3T42A 1WCGA 1HTIA 4S38A 4DO6A 1OFBA 1V3JA 1WKYA 1US2A 4US6A 1Q8JA 1SJBA 3BWWA 1Z42A 3E0VA 3REQA 3IVUA 4I8DA 1A5NC 4MLRA 4K8GA 3QTGA 4NG3A 2EJ1A 4DELA 3THDA 3PBUA 4PRTA 1Q6LA 4MZ1A 2PDLA 2DPEA 1YXYA 4JFVA 3IJLA 2V3GA 5FKYA 3UJ2A 1ISVA 4HTBA 1PL9A 1KM6A 4R27A 1UMYA 5LIWX 1JAKA 4UTFA 1LQ0A 1GQKA 2NQ9A 3GD6A 4O1EA 2Q09A 2QJJA 1B30A 4JTIA 4LTSA 3NQ8A 3OLIA 1WB0A 4CQBA 1P6CA 4H9MA 3FJ4A 1OVDA 3TOPA 2RDWA 1UUMA 3FV9A 2ZX8A 2DZVA 1U33A 2A3EA 4CD5A 2MUCA 3T81A 3N1AA 4MFEA 1IGSA 2PDUA 1KKRA 1SO5A 1GQIA 2ZX7A 4D8AA 1QI5A 3WG6A 4QS6A 5I24A 2WQDA 5BYWA 3IV8A 2ZZ4A 2VC5A 3GXMA 1H7RA 1H7NA 4A4AA 1QI0A 4QLJA 5FF2A 5LNWA 3VVGA 5HOSA 5EFFA 5FJUA 4AF0B 2PDIA 3M41A 2ZUVA 5I77A 2Y62A 3E02A 3MMDA 1LP6A 1GVFA 1G67A 5D9NA 3WUFA 4YVVA 2VNCA 3CB3A 2EPOA 1KXQA 1PAMA 2HRWA 4L7ZA 4I9MA 3I65A 3MZ2A 3V0UA 2ZRVA 1Z44A 2VWSA 1E71M 4YNGA 3PTDA 3B0XA 1O7AA 1RQHA 2UWFA 2GGGA 4NI3A 2XN2A 2WMHA 3R11A 4LBRA 1S1RA 2JALA 4ZOAA 1KM4A 3BMVA 3VDGA 3WJYA 4JNZA 3JUGA 3ABRA 1F3WA 2XZ7A 4RNHA 3IGUA 2QDGA 4WDWA 2X41A 3SCTA 2PDBA 1FWJC 4G56A 4Q4QA 2O9PA 2TRSA 4HMDA 4AYGA 1FWEC 3PBGA 1VEMA 2Q8LA 1W3LA 4JN6A 4FK9A 1CCWB 1NM9A 4XBKA 4GBDA 3TQ0A 3AIBA 3TJLA 2WWDA 3MCOA 1TX0A 2BTMA 2A79A 3FNDA 3ARXA 3WJSA 1XKJA 4BEUA 2WC7A 2YL5A 3P7YA 1SFJA 1T41A 3EX4A 3KLLA 2D69A 2AMXA 4CNSA 4TU1A 3A21A 4IFOA 3W7PA 3GQYA 3MKCA 4IMFA 4LYPA 4PTDA 2GGEA 1YW1A 4E2DA 4E3VA 4Q8QA 3ZIZA 3L66A 4KESA 2QIIA 2GUUA 3BAJA 1FH9A 1LG2A 3FA3A 1UBSA 2P3EA 1C7TA 2QCDA 1EQCA 2PTXA 4JX4A 2J9YA 3BAIA 2PDXA 3DIPA 2PDWA 4PCFA 2X0SA 2QCNA 1PX4A 3GFZA 4DXKA 3ZT6A 3NZGA 3WJWA 5XIAA 3LX9A 2ZE0A 1EF2A 1GVQA 2C71A 3REQB 1ECQA 3WQFA 2YLLA 1EKOA 3W27A 3TU9A 2HXTA 1AVAA 3V5CA 5JMUA 4K7YA 1QOQA 1BG9A 3HPFA 1WP6A 2P8CA 1SZFA 1V6VA 3W7MA 3FEQA 5I2UA 4GFIA 7PTDA 3K8LA 1KCZA 3PC0A 1V6XA 4IGHA 3W9ZA 5A5WA 4BWLA 2NQJA 4EXAA 1UG6A 1AW2A 4ERIA 1I45A 4UTKA 3HGOA 3W2MA 4P7NA 1BQCA 1PBGA 1CGUA 1YPFA 2V5LA 1ISYA 2GUBA 2VCAA 3HG3A 3DYMA 2A6NA 2BY3A 1J0ZA 4OT7A 4MNMA 1XLCA 4KW2A 3W1UA 5K3VA 4XAPA 2P0IA 3MKVA 2VEFA 1LRNA 3K4AA 3CHFA 1J0JA 3TA9A 4TOQA 3SGZA 2IS7A 1N8FA 2Z0IA 2GJNA 3GXDA 3QSRA 3NPUA 2VMFA 3LCFA 3DFNA 4MVAA 3SSZA 2W6RA 1E73M 5F2LA 2XH0A 1XH2A 3TYBA 4L6HA 2GQ3A 3FY1A 3QZEA 4TV5A 2G95A 1OQFA 1H3GA 4UTUA 3FVMA 1XG4A 3AU6A 4EPEC 3OGVA 3CHDA 5HMEA 3IACA 3A5VA 4IIEA 3KWSA 2EPHA 1QWKA 4M80A 5CZ0A 3WF1A 1UR8A 1X1NA 3VNDA 3EWWA 5I78A 3KL5A 1MDRA 4RE4A 3B8TA 5KZEA 3MV01 3PNUA 3ISIX 3W07A 4R9OA 1EC7A 1QO2A 1S3HA 4PMQA 3E96A 1ITQA 3BGAA 3UNDA 3L65A 1XXXA 3P2VA 4U31A 5M17A 3RN6A 4U5IA 2ATSA 3H23A 2JF6A 4K1GA 2G3MA 3W2KA 1S46A 4AB4A 3NPVA 3CQJA 4IL2A 3WDQA 3F1QA 1CX9A 3DN5A 1E6ZA 3BOLA 2YL9A 3VCCA 1EYWA 1JZ5A 3PWIA 3B9EA 1E0UA 5CPLA 4EPBC 3CAWA 1EUAA 1RJPA 5LHEA 1BXCA 4GX8A 1XIGA 1MQQA 4MM1A 3TTOA 3IGHX 4FXFA 5U4NA 1ENUA 2OZ3A 4LXFA 4QHRA 1J5SA 1YPXA 5DY2A 2DEPA 2QW5A 1IEQA 6ALDA 1LM1A 2FH6A 2QCDB 2B0MA 4I8YA 4DF2A 1Y5WA 4DM2A 4HNTA 4XVEA 2IQDA 2W9MA 2WVVA 4BS0A 2NX1A 2FGZA 3LXAA 3KDNA 3GUGA 1U30A 4WDTA 4KRTA 3EX1A 3GXPA 1JDDA 4NUWA 2QHAA 1TX2A 1UBPC 1XSIA 4FXSA 4IP7A 3CHEA 4ROPA 2BOFX 2J7HA 1WZMA 4B5WA 1XG3A 5T26A 4O10A 1TJ1A 3HB9A 1SO6A 4BI6A 2EJAA 4OZOA 1FWRA 3GAKA 2SFPA 9XIMA 3SCRA 5U7SA 3W24A 1EIXA 4AX6A 3T05A 4MYAA 3G18A 3DDMA 3B8VA 2XG9A 1SYTA 3C2YA 1G0CA 2Z7GA 4TQTA 4C6FA 2WLZA 4FNRA 1KFWA 3TYDA 1NVMA 3SJ3A 4OUIA 1OIFA 1BVWA 2YCJA 3NL5A 3MVTA 4GWEA 3RCNA 1G7VA 3IVSA 2FDMA 1FDYA 1WXJA 1QO5A 3GM8A 1PTGA 4JTCA 4UB9A 1GOIA 1K9TA 3EXRA 3T0TA 1FWSA 1T7LA 3M0LA 4L4PA 4DIAA 4Q8WA 5DFAA 2G3NA 3HTWA 3T1GA 1V0LA 3VIPA 3MHFA 2YW4A 3W1MA 1KFKA 4H8UA 4EE9A 4XTIA 1TQJA 4AUBA 2PTDA 2I5IA 2DH2A 3WD1A 2F6XA 3BMXA 5A6TC 3P60A 3WLNA 1V77A 2PUZA 3OBKA 1M7XA 1NDZA 4UXDA 2EPNA 2VRQA 1HL8A 4W87A 5KZDA 2V2DA 1E15A 3VKDA 4KFNA 3ARWA 4W8AA 1ZU8A 2OEKA 4GGBA 3UF9A 3NO5A 9XIAA 2E4TA 4LV4A 1ZUAX 5J5RA 5I02A 1S5WA 5HNUA 5FJOA 2ZXAA 1NDYA 2J6VA 4O0KA 4OKDA 1TTQA 1RBAA 3BXWA 5G2IA 3W1NA 1KBIA 4X60A 2VC7A 1EJ7L 3H6OA 2CNCA 1TWWA 2I57A 3KXQA 1G4PA 2QDEA 3S1UA 5E0KA 1X6UA 3S9IA 2HISA 5BWFA 1U5VA 2YBTA 2QKFA 2WHKA 1WKDA 3W2LA 4A8IA 3ARYA 3MYPA 4DAIA 1J0KA 2J62A 1IXNA 1M3UA 2XFYA 1X1OA 2QPUA 1Q7ZA 3D3AA 2NQHA 4P7LA 3QKEA 3RXZA 1JI2A 4P8VA 2PWGA 5A8NA 5JBDA 8TIMA 1KRBC 5HUOA 2GZXA 2CLEA 4PB4A 2EG8A 4XAYA 5AHLA 3WQEA 2YX0A 3OBAA 2CZEA 2J8TA 4HPGA 2E9MA 1R2TA 1YLVA 1KTCA 4US5D 2PWHA 3N6JA 2EBNA 2HDJA 2IPGA 3G0SA 1S2UA 1VEOA 5AC5A 3GVRA 5M1TA 3DXIA 4JQ4A 4AHPA 1ESWA 1UWTA 4H9VA 5HMSA 4BZYA 1UR9A 2DT2A 4AMAA 3M46A 2BOGX 1HP4A 1MQPA 2IPJA 1W5OA 4IQJA 1KNWA 1S1PA 2BS9A 3GDKA 1X6LA 3TYUA 3A23A 4A35A 3LTPA 3DG7A 5AB3A 2WVVB 3VC5A 2VQTA 2GLKA 5CSSA 1G01A 3OVGA 2C1HA 1FCVA 2V2CA 5EBUA 3W7OA 4ZBCA 3UZXA 3TC6A 3QPZA 1UWIA 1J0IA 3TXVA 1TJ0A 1E0WA 1C92A 4UCGA 1WDQA 3BDKA 1IEIA 4N2YA 4XUYA 3W38A 2C18A 1J8VA 3EX3A 3G1SA 3R13A 4U3AA 4MB5A 4LUYA 2QDDA 5FESA 4C6JA 4O16A 3AC0A 1U1HA 2NSOA 3ITXA 2D3LA 1XL9A 1MDLA 4F0MA 3STCA 1Q65A 3N2MA 2NT1A 2VD8A 2PTYA 1CBGA 2ONEA 1JPKA 1PZ1A 4PB5A 3PB0A 4A3HA 1EPXA 1FDJA 4KFOA 1P4CA 3OG3A 2ZXBA 1D8WA 2UY4A 3H24A 3XINA 2YFNA 3NL6A 4KEMA 5CGTA 3EWDA 4AH7A 4MPKA 3ANUA 3VFLA 4PBGA 1FWBC 4H6EA 4BQ2A 2OLHA 3QSTA 1IE7C 2QF7A 1VYSX 1MUCA 3BQ6A 1GPFA 4XZLX 4OV9A 4KIEA 4AFYA 1RK5A 3GIQA 2JEPA 4PTWA 3VM7A 3N2OA 4GX9A 1UR2A 2MANA 3Q58A 3UR8A 4OFCA 2JGYA 4Z1BA 5D2XA 1BYBA 3DOPA 1OFOA 3AHYA 1XFCA 1E4LA 1W37A 2INFA 3BJSA 3VNYA 1XYZA 1CDGA 2WVUA 3DECA 2BWGA 1V7AA 4CUCA 3O15A 3SQLA 1QBBA 2C19A 4HU3A 3W6MA 1TJRA 2DZAA 2NXIA 1WZLA 3KOXA 3BMWA 3IJ6A 5H2ZA 1RXOB 4O1DA 3BV4A 1F6YA 3GTIA 4TXEA 3THAA 1QWGA 4WKHA 4DZAA 3TYZA 3N4FA 4MWAA 5K9XA 4AXKA 4Z1DA 2I5GA 4Z2JA 3UY7A 3PK7A 4QEEA 2EO7A 2QJHA 1EO5A 4QITA 4UTTA 4XAGA 1NP2A 1SSDA 2X16A 4XO7A 1JULA 1NOFA 4D71A 4ATDA 3H26A 2VQUA 1QK0A 3I4EA 2ON3A 3O05A 2P88A 4DUOA 5F4SA 5FJIA 2DVXA 4R34A 2XFWA 4S39A 1QHPA 5LA1A 1EFZA 4G8TA 2IXVA 1J6PA 2G41A 1E1CA 3QW3A 4MG4A 2CEQA 3STGA 4GIAA 1JRCA 4FEZA 1XBXA 1WOAA 2PAJA 1L6GA 5H8UA 1PSCA 2Z26A 2B81A 1R3QA 4NZ4A 4IFKA 3S1GA 1EL3A 3MY9A 2C7FA 2XIQA 3PTMA 3T2PA 2VZVA 4MDPA 1FXPA 5CQ1A 2XINA 4QJ3B 3MSGA 5DBUA 1OF8A 3W87A 3W74A 2RJGA 3S2CA 3E0IA 3QW4B 7REQA 3BAXA 3OODA 1B3ZA 3ZLFA 3V4BA 2RGMA 1V51A 2JEQA 3P8IA 1K77A 1C91A 4A21A 4N4PA 3VGFA 4AD1A 4KQNA 4MF4A 1OYCA 1SGJA 5CAKA 2OO0A 1UKPA 5HQEA 1E5NA 5I23A 3HGRA 1BPLB 1XLFA 4NNBA 1R87A 4HNUA 4TX6A 1KQZA 3VOGA 1DOSA 3WF2A 2FPYA 3M9YA 1XLIA 1GKRA 2Z1VA 5IDIA 4PMNA 5BOFA 2QMKA 2E5BA 3EAUA 5BOOA 1KD0A 1TPUA 4ML4A 3FGCA 4YCOA 3CYJA 5C0QA 3HZ3A 2VDIA 3WQVA 3AS1A 3S5NA 1N7KA 3RO8A 4AC1X 4UFJA 4B5TA 1RCXB 1ZFJA 3AUJA 4QG9A 4HZ6A 5D33A 1RSCA 3EKLA 1GOKA 1W31A 2OEMA 2WZHA 3MANA 1QHZA 2I14A 1FHDA 4WJXA 4XZWA 4CN6A 3PBMA 1F4AA 1XD0A 3DBPA 4I5XA 4Z1CA 5A8MA 1XIDA 4H6RA 3G2GA 2H9AA 5LNSA 1RPXA 1GOMA 3B8DA 1R3RA 3NCOA 4HNOA 2F2HA 3H7UA 4DO4A 1OADA 3WK3A 4M19A 2VGGA 3LNPA 4XIMA 1JCXA 1VD6A 4O12A 4MKNA 4ZOBA 2A1YA 2HV5A 3SB0A 3O07A 5F2IA 4DO7A 1F2JA 4KERA 1E6PA 3U7VA 4M3PA 1W1PA 1EBGA 1G9HA 3C3NA 1EJWC 1E3ZA 1JF6A 3KWXA 3GFXA 1Z9AA 2WNZA 1EJSC 1GGOA 5JIWA 2R1PA 1XICA 4YTQA 5HDRA 3P81A 3NSXA 1JZ8A 5C2GA 1TUXA 1K3UA 4JL2A 4A22A 2C0HA 4MWAB 1N8WA 5CPSA 2RDUA 3M0HA 1HP5A 1KM0A 3EMCA 4TMCA 2YKKA 3MZNA 5CG7A 3WJZA 2BGNE 4P8XA 3L9CA 1UD3A 3U48A 1E9YB 2FJKA 3Q45A 3PFMA 3BLOA 3LI1A 4LW7A 1RP9A 5A6JA 4PUUA 1JYWA 3PZQA 4R5EA 1ICPA 4LVFA 3ZMRA 4IL0A 4HA3A 4P7RA 2WSYA 4MB4A 1K7EA 3ARSA 1E1CB 1TTJA 3VABA 1TV7A 1CGXA 4LYKA 1PZ3A 3PF3A 4IFKB 3CH9A 5A8PA 1DIDA 3FDGA 1TV8A 3H22A 3T2OA 4PCNA 4D6IA 1S5NA 1U1JA 1J2WA 1PIIA 3WUEA 1H7WA 4A05A 1VP5A 2ZA1A 3LD5A 2BXZA 5G1MA 1FY6A 2Y5JA 7REQB 5I3GA 1HO1A 1RALA 1GZGA 3T2QA 4O1FA 3H7RA 1DWAM 5BRPA 3SCOA 4JKMA 3CLWA 2HJPA 4K8EA 1Q6CA 4UTWC 3AXKA 1E55A 3RUBL 2NVCA 3C56A 4WDXA 1ZBCA 5TIMA 3E2SA 3KBWA 3HMCA 1P1XA 2HNHA 3RCYA 3ZSSA 5AC8A 3TYAA 1M04A 3N29A 4JS3A 1RJRA 2PCQA 3VOHA 8XIAA 4ZMGA 3O6CA 1A5CA 1D7KA 4CQDA 3OLGA 3LQGA 3W2NA 4DJED 4DPQA 3B9AA 3JVAA 3NXLA 3TUUA 2A3CA 4HNNA 4HVXA 6ENLA 5H8PA 5BU6A 3N12A 1BSLA 2QJNA 5CZKA 2ZXDA 1XD1A 3LZ5A 3FGCB 3B4UA 3DKLA 1VAHA 2F84A 2PDQA 3RDKA 3WKZA 1JG9A 3UGVA 3OPSA 2CXGA 5HANA 1XR2A 3NEVA 3W23A 4JICA 1LWIA 3KCOA 4RXFA 2V2HA 1IEXA 4MAZA 4O1AA 4CQCA 3DAQA 5F2MA 4CCDA 5MHBA 3POCA 3CXOA 3B0YA 1VFTA 1JDCA 3O6YX 1PWMA 4JZ5A 2ZRWA 1V3LA 1KBLA 1SFLA 4S3DA 1CGVA 1KFJA 1YDYA 1FX6A 2E77A 4RDWA 2H9AB 1O95A 2WNWA 1BWKA 2Z1BA 4G7EA 2OOFA 3AOFA 3RHGA 5TD4A 2NUYA 4AYSA 1QMLA 4KCUA 1ZAJA 2POZA 4WSHA 3TN4A 3LCLA 1CEOA 4IMGA 4MGGA 2O4MA 4EAMA 2E8ZA 2J7CA 2FQIA 4DY1A 3QHNA 1JZ2A 4J7RA 2C6QA 2QUVA 4RNFA 1I75A 1TCMA 3N19B 4EIVA 2A85A 3BLEA 2PWEA 1YTKA 1MZHA 1I2PA 2Y7GA 1VHNA 2YA0A 3G6LA 2O0TA 4LYRA 1NELA 1QOPA 2E5DA 3KRUA 4AW7A 1EC8A 3LU2A 4O0ZA 2QIWA 3S2NA 4AX7A 4D6EA 3I7SA 1VFLA 4OBTA 4MJ4A 3CHVA 4PBFA 1JCNA 4CLMA 3WH8A 3PUGA 1JCJA 5BW6A 1W91A 4Q22A 3PJWA 2BASA 2PLJA 5AVHA 1MMFA 1TCDA 1WA3A 4F9JA 2ACQA 4XG1A 3VIMA 5LNUA 3UY8A 1L8NA 1V4YA 1UQZA 1YMYA 2UY5A 2DP3A 4GE8A 2GGHA 4KIRA 2WJZA 4NU7A 3OGSA 4W85A 1SZNA 4MADA 3UYCA 3CUFA 1TVPA 1FHLA 2VRKA 3GKAA 3AQUA 2P53A 5JQ9A 4JTQA 4CN4A 3HJEA 2FPVA 1JXJA 2P50A 4S23A 1ONXA 2HE8A 2VT0A 3SCNA 4U4MA 3WD2A 1JDEA 4GO8A 3WUGA 3EA1A 3BO9A 1W3KA 1L8PA 1DL3A 3NO3A 4MJZA 4JEQA 1GOOA 4PL1A 3URNA 3PFRA 3WNLA 4GO9A 3SADA 1CGYA 4MJ2A 4R33A 2NUWA 1CW2A 3IARA 3VIHA 1H7OA 5CZSA 2CESA 1UR1A 1PEZA 1K02A 3QJAA 5EFDA 1L9WA 1V02A 4TX8A 2ZZ1A 3O2LA 3RK8A 3RX4A 3HQPA 2QGYA 3GKFA 4GOAA 3UZ5A 4MY8A 2I56A 4WJEA 3QV8A 4GG9A 3AMKA 4LB3A 1HIZA 4GYFA 1M9HA 3LZ3A 4PTNA 3HA1A 1ODZA 3IIXA 2HPIA 6TIMA 3LENA 1DORA 4DJDD 4PUDA 3LYEA 4NP7A 1D9EA 1MQRA 4ADUA 3G6MA 3GHTA 1HJXA 2FGBA 3AS2A 5G4HC 4PN2A 4KS0A 4D6JA 2PTWA 2RUSA 1HFBA 2D22A 2VUNA 2AKMA 2GDVA 4KGLA 2WMFA 1PZ2A 1UC5A 3NM3A 3QOKA 3SCWA 5C54A 3VI2A 4UUIA 5JH1A 3MMUA 1CLKA 3WDPP 3EKGA 4JDBA 5FJPA 3VYLA 4NIRA 4ZE5A 4IQEA 1BGAA 4XQ6A 3EEGA 2ZX6A 4HHPA 2W63A 3CIXA 4M0XA 4B4HA 1DTUA 3F4DA 4D1JA 2P0OA 3N15A 4F48A 5EMMA 3ICJA 2O9TA 3NURA 1Q4NX 3M5ZA 4G7EB 3PZOA 4AWSA 2PDFA 1XPGA 3C0SA 3GAYA 2PDJA 3M5YA 3P80A 4GGHA 1UPMB 1JR1A 3PTKA 4NYUA 5LSMA 4F9DA 1HGYA 1UMLA 3A47A 3PG9A 1EPVA 4UIOA 1EXPA 2AQVA 4NF7A 2VX7A 3CL8A 3GC4A 1KA9F 3SJNA 1H0GA 3OVRA 5E6ZA 1XLHA 4H9YA 4NZ1A 1LLZA 4UFIA 5E93A 2GGJA 2OU4A 5D05A 4UC5A 3N34A 1W1ZA 2CBIA 1BVZA 1Q5MA 2PP1A 1KR1A 2Z4GA 1CTNA 5HWJA 3QY6A 4Z2HA 2F8QA 5CBBA 1V3HA 2FTYA 1LBFA 2P5NA 1EJVC 4UR9A 2W92A 4WX2A 3F2CA 3BG3A 2CU0A 3L4ZA 4J40A 4H04A 3QGVA 4XUGA 3FX4A 3M0VA 4NNAA 3OBEA 3VNMA 2CERA 4M7SA 3KL0A 2XVLA 5MKGA 1A0DA 4B92A 4EANA 3AIEA 4UQCA 1W6TA 2VFIA 3VD7A 3TFXA 4JYEA 2VEPA 3AJ7A 3VM5A 3TAOA 4TO8A 4GH1A 2AAAA 3GRIA 2G4FA 1V08A 5A1AA 1J18A 4EAYA 1F05A 1E4IA 2EPMX 4CD8A 1W1YA 3BICA 2J8GA 1AD1A 2EEXA 1UD2A 3THQA 2HS8A 1NP0A 4DB7A 5DXXA 1CWYA 5AHFA 3V7PA 4ZB2A 3AAMA 3EOOA 1NFBA 3KW3A 1NAL1 2RAGA 1OWQA 3QR1A 4DQWA 2OYKA 4HU0A 4C1KA 3VKCA 3CPRA 2VZSA 4L9ZA 3N9SA 2GFTA 3QM3A 2OYLA 7ENLA 4NAEA 1Q6QA 2OJPA 2P76A 2OT0A 3PZNA 2OMAA 1MVYA 1X97A 2PZ0A 4BQ4A 4A3UA 4XZBA 3SSJA 1OFDA 3SUVA 5E09A 1KCXA 3SZ8A 1K7XA 1R3WA 2ISSA 3N25A 2R9RA 3VIOA 2WMKA 3USZA 4Z2LA 1I9CB 3RJYA 4QNEA 3ZWTA 4O15A 4B4FA 4MUZA 2WC3A 3WH6A 5AY7A 2VR4A 1OFAA 1LL6A 1XSKA 1B31A 2B7NA 3CAVA 3OG2A 3EXTA 3CZKA 2DGAA 3M1ZA 1XC4A 1TPH1 7TIMA 4DJEC 3NOEA 2FHFA 3C6CA 2WZTA 3HOJA 1W3HA 1YIXA 4KWUA 4HZ8A 5DMYA 3MUAA 4JTAA 2J75A 2YR1A 1E9IA 2X1IA 3ZFHA 3N3TA 3S0CA 1V6YA 4MWAE 5T9CE 1GG1A 1F8IA 4QJ4B 1R8LA 4DUWA 2PP0A 4NJGA 2WAGA 2VO5A 2WC4A 3DCPA 1JCLA 1NJJA 4RV8A 4LT9A 4TVCA 4LAMA 2WSPA 1XIIA 3LLFA 1SJCA 2HVNA 1PKMA 5CCZA 1KW1A 4S3BA 1I2OA 3RFAA 3VINA 3APYA 2EAWA 3TC7A 2Y85A 1E4NA 4PSPA 4QAWA 2E6FA 3V1HA 5AC6A 3S2LA 4GUJA 5EU9A 3W0KA 3WZ0E 3HURA 1O1HA 1UP2A 4C5ZA 5C2XA 3CGTA 5HK4A 2F6UA 5G2WA 1VR6A 4DUVA 2R1KA 1UC4A 3HM7A 1R3SA 2X0YA 4GHRA 1ZNNA 1JRBA 4HA4A 2XDFA 1JQVA 1BVNP 3ITGA 1YNYA 2ISVA 2XIIA 4X9YA 3W1XA 2VEKA 5MKGB 5C9UA 4U2YA 2RJHA 3OOQA 3B97A 3QBUA 2WSKA 1FWGC 1M01A 4B5SA 1OB0A 3CAQA 4UQ9A 5CLWA 3MDUA 4FHAA 4XIAA 1W3JA 5SWUA 3S3GA 2DT3A 3WQOA 4CQ9A 4JXCA 3N2CA 3VPLA 1Y65A 5DCDA 1JDFA 1YTEA 2V5DA 3WK1A 1OCJA 3GNRA 2B7PA 3I6RA 3L4TA 1KM5A 1H41A 2ZBTA 2HVMA 4ONVA 4WVXA 4RPQA 1MEWA 4LEQA 1FCUA 3ZR6A 4IX2A 1PTAA 4EVZA 3W22A 3LPOA 2ISWA 1BSIA 4UNKA 2BV9A 2FVLA 1H0IA 4JTGA 3THUA 1W1TA 1W5PA 1K7FA 4W7UA 1QR7A 4RZ6A 5DT7A 1LQAA 2CLPA 2WCSA 1E5JA 2QUNA 2Z6JA 3TIMA 1D3CA 2OPJA 2X09A 1A0EA 1OFEA 1G94A 3CEPA 3QC3A 4F2TA 3LCWA 4JIIX 4NAEB 2V6AA 3LV6A 1O68A 2FMOA 3HQNA 3WENA 2XZ9A 4QDWA 2PE4A 4TVDA 3W84A 4EPDC 4HNCA 5FJTA 3BAKA 3WJXA 3M0XA 3T0CA 4XKMA 1PYMA 2PWFA 3MO4A 3R79A 2UZ9A 3P6LA 2H3BA 2YDRA 3NTYA 1UKTA 3MI3A 3W88A 4ZB0A 4Y8EA 3LTYA 2DSZA 4GJ1A 4ZGYA 3VGDA 2JQXA 3QTPA 1I2RA 4MY1A 1A53A 2RGLA 1UW9A 3QR0A 1AQMA 1UD4A 3DFTA 3PZUA 1QPKA 1R7AA 4AISA 4MHBA 2GSEA 1QPNA 3C8FA 3GH5A 1IT7A 3MMTA 5CGQA 3W1TA 1OGGA 2YLAA 3ONCA 2E68A 3NUKA 1TB3A 1NF7A 4HYWA 4DJDC 3PUDA 4OUEA 1CXHA 3BCDA 1XLBA 2V8ZA 1LRTA 2ACRA 5FF4A 4QSHA 2E09A 2ZWZA 1M6JA 1Z89A 4BQ3A 4XD3A 3EZ4A 1KXVA 2VGIA 4Q4RA 5FD0A 1KFCA 1NIUA 1OBAA 1UWSA 2ANUA 4OJYA 3GW3A 1JCMP 3W71A 3NQMA 1ELSA 1RQEA 1MW3A 1OCQA 1H5VA 4HPHA 3GXFA 1AQ0A 2FKPA 1ZRQA 1NQ6A 1IZKA 5D30A 1W9UA 3HO8A 2D0HA 1I60A 2ZRYA 1DWGM 1Q8AA 4PMJA 5DCBA 1VIZA 4JTSA 2YCKX 3C52A 5KITA 2PLKA 4N9CA 5AHMA 1QJWA 4HYVA 2ZADA 4QM1A 1RP8A 2Z2UA 3M6YA 5CG0A 3EDKA 1XC6A 1BXBA 1CXEA 2BX7A 2OXNA 1DIOA 1EYEA 3TONA 1UWAA 3MCMA 2PGRA 3FSTA 2ZZ5A 3MSRA 1MNZA 1NQKA 1POJA 3AZSA 1GKPA 1BGGA 4L56A 4H2HA 5BWAA 4O1BA 1V0MA 3B8SA 3GYEA 3WLJA 1CIUA 5FACA 1GNXA 3ZQ9A 4UMBA 1N82A 5LXEA 1VPXA 1DXFA 5I79A 1A80A 4Z42C 4YVXA 1DJXA 3DG3A 3GDLA 3VZXA 1AUSL 3P67A 5E0CA 1TG7A 2GUYA 2Z27A 1PYFA 4C7GA 3OA5A 3FIGA 4EF9A 1QTWA 3P3BA 4C7DA 5DRIA 4FF7A 1W5QA 1EHAA 2AMGA 1PWLA 2Q8ZA 4WOZA 1GW9A 1DWFM 3F2BA 3APGA 4CNPA 4ORIA 2Q3OA 4AZCA 4IMDA 9RUBA 4LFYA 3CZEA 3N11A 1KTBA 4MFDA 3OIHA 2VEGA 2NV1A 2XVPA 2ZTKA 4QBXA 3AU2A 3DKJA 3LRLA 3O0FA 1M7JA 4WLCA 2TAAA 2VX5A 1W1A1 4GISA 3VDAA 3FLUA 1F6PA 4ZSUA 3P8JA 3SN1A 2NVDA 3V1PA 3RG6A 1BYDA 4QDPA 3SUTA 1UH4A 2HK1A 1XH0A 1R3VA 4ZZ9A 2OWWA 1BWLA 1LF1A 1WDRA 3CLMA 5IXEA 4E4FA 2X42A 4GD0A 4UQEA 2DZSA 1NH6A 1WDDA 1OEPA 2JKPA 4V15A 2GGIA 2DUXA 4YJ5A 1ZJHA 4JTKA 3MBDA 4ZB5A 2H3DA 2CZ5A 1R9ZA 3H2AA 5C9RA 1TYGA 4LC6A 1ZBWA 3DGBA 1XINA 3TYEA 4F3HA 4J2MA 3LI0A 3FYYA 3H55A 1HKKA 4URIA 3KEHA 1AMYA 4HA0A 4D6GA 4GQGA 4LF2A 4TV6A 3CT2A 1OF6A 1DEDA 4Y7EA 1L0PA 1H5YA 3N6HA 1RZMA 5C9WA 3TWAA 4PFMA 4IPLA 4WSJA 1VRDA 3WBEA 1EC9A 3ES8A 1QT1A 3D0CA 2UV8G 4DVOA 4OIFA 4B9YA 4NVTA 3HPSA 4IX0A 1VFMA 2PCEA 2WANA 3WBAA 4AC7C 1OD8A 5DF0A 4B16A 3CZLA 4NSBA 3TEVA 4DF0A 5FAJA 1C7SA 3EDEA 4FIRA 4REQA 2R91A 2NLIA 2WKJA 3G1RA 3R7MA 4KBXA 3NVDA 2XIBA 3WNPA 4AY8A 1XUZA 4GIEA 3UWYA 4RKAA 3WSUA 4PSRA 1R2RA 3AZTA 1AJ2A 1HJVA 2R94A 1YEYA 4HP5A 4A6GA 2TYSA 2AL2A 4FXJA 4M8UA 3EA2A 1EQPA 2FZMA 2ZZ7A 1XLJA 2VYOA 4XZNX 3I6TA 3H2FA 3WF4A 1ZALA 1IQ8A 1UD5A 4RZBA 1K6AA 4RK8A 3L0NA 3H54A 4Q6JA 2YDSA 2ISDA 5EPDA 5T9BG 2PDCA 3GR8A 4XTDA 3SUUA 5HMDA 2A3BA 4H7CA 2Y5SA 2BZNA 4N0RA 1TMQA 3E0LA 3FS2A 4AQLA 2PA6A 1UKQA 2QQ6A 1DQXA 5ABEA 2W27A 1DHPA 4W8LA 3MS8A 4YHEA 1MEHA 1W17A 3VOIA 5D09A 5A69A 2J66A 1V02E 1H11A 1GVSA 2P3ZA 3PS7A 1KWKA 1UJPA 4W9TA 5IDZA 4CKQA 3S42A 3STFA 2EKCA 2OGYA 4AZ5A 3LOTA 4AAJA 2ZUWA 1LL4A 3GTFA 5D8ZA 2CZVA 3QPEA 3W02A 2BOEX 3MA8A 1R2SA 2ZA2A 3GDMA 2QV4A 3QQWA 2I5QA 4EX4A 4GC3A 4AZCB 4EPKA 2QVNA 4RDZA 1LBLA 2A3HA 5J8LA 3IIZA 4MNJA 3SY8A 1X96A 3GHUA 2X1RA 5EKYA 3UU0A 1H7XA 2PGEA 4GUFA 2QR6A 1H62A 2DT0A 4MNKA 1XM3A 2Z2AA 2ZRZA 4TTUA 2UY3A 1B3OA 3S6DA 1LJYA 5KZMA 3FKKA 4HK7A 2DIEA 3RU8X 3EWCA 3UR7A 4MAVA 1KTNA 1BG4A 5A6LA 3KVJA 2YIHA 5M5DA 3I7QA 5LIXX 2QUMA 4LUJA 1N8IA 2CETA 3KOWA 3KCLA 1FP8A 5H6HA 1KGWA 3LCGA 3CC1A 3PZGA 1A5KC 1P0NA 3QMRA 5F4WA 2WZEA 4H6KA 2A3LA 2VFEA 3BJTA 4TIMA 4JGDA 3VTRA 3CTTA 2WNQA 1R3TA 3EPNA 4PTMA 2WNNA 3BW2A 3LRKA 2YOCA 2LLEA 1O1ZA 4JTDA 3PUEA 2BMBA 1UH2A 5LA2A 5F1UA 2O56A 4AZBA 4L4MA 4FR1A 1XRSA 3W1RA 4RXGA 2DZTA 3ZO9A 3LBMA 4UFHA 3PANA 1SQ7A 2VDGA 4CNOA 4HBKA 2PDNA 4NJJA 4NNCA 3TLQA 1EJUC 1CXIA 4H19A 3SEPA 3FSUA 3ECQA 1T5AA 2J47A 3N4EA 1XV8A 3NQEA 3TYCA 4JFWA 3CTLA 4XZIA 2X7VA 4REQB 2ZUSA 2Y24A 3GU1A 2NWSA 3HG4A 2RFGA 1JGIA 2Q01A 1ODUA 4GBUA 3ZR4A 4YS1A 3ZR5A 1IWPA 3MJMA 4PUMA 5IHRA 3TNOA 3MWCA 1E0VA 3O6DA 3GG0A 1KFLA 1SW0A 2AL2B 3ZOAA 3WK2A 1PX3A 1NFPA 3U0HA 2QCHA 2YL8A 3S1XA 2FJUB 1GYNA 3SIZA 3T55A 4C6EA 2Y7DA 4GQBA 1DV7A 1O5XA 1ZS2A 2PFHA 3SO7A 3AUOA 4W7WA 1Y5VA 3H4GA 3PR2A 1JUBA 3GNXA 4CU8A 3R8HA 1B9BA 3L2MA 3U4AA 4YTSA 4XKYA 4JTUA 3VCNA 3AS0A 3VUSA 1YDOA 1B5TA 4GUGA 3OLEA 3AXIA 2G3JA 2VFHA 3KE0A 1XIMA 4JAWA 3WQ6A 2CIPA 1TA3A 5HPOA 2RKXA 4FOJA 5GNYA 1KXHA 4H9ZA 4H4IA 1SFTA 2WCAA 1PZ0A 3CV1A 1H1NA 1DQUA 4NHVA 5FJJA 3PP7A 4FI4A 1TPFA 3E49A 3GS6A 2W79A 3M0JA 1QATA 2FZBA 5C2CA 1HJWA 5DY3A 2Y8VA 4ZL1A 4Q7BA 3N17A 1TE1A 4DLFA 4IJCA 4J2PA 3QGKC 2X2YA 4GH3A 1EBHA 4DNHA 3KTSA 4GY1A 3VE9A 3T9PA 3ABXA 1FHVA 3LXCA 4NL1A 5FIPA 1TZZA 3NDOA 3ANYA 1UR3M 1QK2A 1VCFA 3T8LA 1W3TA 1N55A 2VP8A 3LLDA 4HOZA 2EPLX 2Y2WA 6XIMA 1EGMA 3BG5A 3A9BA 3IGSA 3HQ1A 1UZDA 3U2EA 3Q94A 3BURA 1UA7A 1DKWA 1QPQA 3FXYA 2ZX5A 5AHNA 4GJIA 4UFKA 1S2WA 3LLXA 3CQIA 4UTWA 3KHJA 3NQBA 1QNSA 1JZ6A 2ZRXA 3LHVA 4ZO9A 4HHLA 2C15A 4WQ6A 5C71A 1EJRC 2CLHA 4ROQA 3UCQA 5HQLA 3A12A 5FEPA 1TWSA 3ME3A 4U3CA 1A5BA 3ARPA 4IJBA 4ATWA 3R10A 3NR0A 1K4GA 5K9DA 1NWUA 3CMGA 1VBHA 1CB7B 1XW8A 1F8MA 3NZQA 4Q4PA 4LAZA 5AKQA 4XAFA 1UZ4A 3GVVA 3WLPA 4ZQNA 3L5MA 3C8NA 3GFYA 3UESA 1RA5A 2ACSA 1AZ1A 4JN8A 4ADSA 3HG5A 4N6FA 2GJLA 1TWZA 3KBJA 3GXIA 4NI8A 2DIJA 1FWNA 2OSWA 2XN0A 3AALA 1HL9A 3N14A 1OABA 3SM0A 2WSRA 3I10A 4A3RA 1B3VA 4ZXOA 3OYXA 4W93A 4BF9A 3W7DA 5AZ1A 5BU9A 4UWMA 1JNEA 2RDXA 4Y9NA 3LB0A 2FB2A 2Z7KA 2DZBA 1K03A 2J13A 4F8XA 1GW1A 1QPRA 3SQMA 2OFJA 1QI3A 3TH6A 3ID7A 4UZSA 1BLIA 1Q4WA 3DHPA 3D6NA 1BYCA 4XKYB 3QH2A 2WKLA 3ONBA 4ZQMA 3A4XA 5ECVA 2JE8A 2IUZA 3N2BA 3R0UA 4ICCX 1XLGA 1GORA 1S2CA 2Y63A 3LEPA 4P7OA 5E0FA 3CV7A 1TA3B 3UXIA 1S5TA 4XZ9A 1UB3A 4RZ4A 2OQLA 3P0WA 2VGFA 2V3DA 1KFBA 4HZ7A 4QFUA 1UIPA 1J11A 1PX8A 3WLLA 4B5XA 5D03A 3VC6A 1SUXA 4MDOA 4PUEA 3AYTA 3M07A 4GVIA 3KOYA 2NX3A 2WHJA 3PAOA 4Q8OA 4JYDA 1XCWA 3T7VA 2QF8A 1PPIA 3W4RA 4GQQA 3C4UA 2O9OA 4PODA 5FJRA 4O54A 1UWRA 4L80A 3H2EA 4CNTA 4AZ6A 4QXIA 4JCLA 2VOMA 1Q13A 1R7OA 3TW6A 1VJIA 2ABBA 1G4SA 3LHTA 4ZTYA 4C91A 1FQ0A 3LHUA 4FSAA 1J0YA 2YB4A 2UY2A 4AG0A 1JF5A 1HKWA 4ZOEA 4JQ1A 3VMPA 2D24A 3ZXWA 1QU4A 4GPNA 1CECA 1HVXA 3K5XA 4TUFA 5XINA 3P93A 5GJMA 3W7IA 3G1FA 1TPWA 1F4HA 3C0QA 3KHDA 3T07A 2ZCGA 2DIKA 2V5JA 3NSMA 4KCWA 3UETA 4HSOA 1WX0A 3QY7A 2BNJA 4ZA0A 1MW0A 3LSCA 1RPKA 4GXWA 4EXBA 2XFFA 1RCOB 4X63A 1VYPX 1EH9A 2CLIA 3ZYZA 3W7JA 3UJFA 2PLCA 9CGTA 4X0VA 2OGJA 3H7VA 5HNRA 1KV5A 3IJIA 3PZMA 4RE0A 5BMWA 4JBRA 1I0BA 4AMCA 4GVHA 3HMJG 4G2DA 4UZUA 3II1A 4FNSA 3UEQA 4DAFA 3E2QA 1LRQA 1P43A 3HF3A 2ZUUA 1CNVA 2DY3A 1XQKA 2PC8A 1MZRA 3E38A 5K7JA 1ZP3A 4UQDA 4CU7A 2EGZA 3GR7A 1L6YA 2Z1XA 4RNIA 5JXQA 2CPUA 3LTSA 1OK6A 3TQKA 4HHHA 4HHMA 3UZZA 2BHZA 2G50A 1QI2A 5HR6A 4EK7A 3MSDA 4N9DA 1QUMA 1E1FA 1A5UA 3VX0A 2WB5A 1J5TA 3KVMA 3FA4A 2PI6A 3W83A 3WQGA 4I90A 1YHTA 2ISFA 4KWVA 4P2VA 4AVNA 4H7ZA 4X61A 3PNZA 1M65A 3D3FA 4ASTA 3WDHA 1WZKA 3WLOA 1P7TA 1BRLA 4ZQCA 3ZJ7A 2FZNA 4JEJA 5JIPA 2DVTA 1DJQA 2Y89A 1JZ3A 4S2CA 3OIXA 2ZVIA 1BHGA 3PB2A 2PSNA 2EQDA 3A64A 3S1WA 4B3ZA 2XSBA 2A6LA 4HN8A 4LRSA 3BANA 5TBOA 1DXIA 4ZVJA 1UUQA 3SIMA 1B3XA 1M7PA 4O4VA 4GI4A 1DWHM 4EP8C 4E5TA 5HMFA 4JN7A 1VFHA 3C2OA 3UWVA 4WK9A 3WY1A 4GYPC 4PEKA 5L6UA 3R12A 3R4IA 3K8KA 3G0UA 4GIRA 5GNZA 3SN4A 1F6KA 3VFCA 4DWSD 1EX1A 5HJLA 3E2VA 3QZAA 4JTJA 4M82A 6REQA 4XISA 3A24A 4IQDA 5CC3A 3BW3A 3CUHA 3I4KA 2X0HA 1DIKA 1VPYA 5EMLA 1EWEA 3VIIA 3DX5A 2X1SA 4V28A 3SURA 1LQ2A 2Y70A 5G4EA 1RK6A 1POKA 2PBGA 3CUIA 4N9EA 1YTDA 4PGLA 3WMLA 4N4QA 3EA3A 1CXKA 3QFEA 4WKFA 4UTJA 4AZ7A 5ENLA 4H41A 3GK0A 3W37A 3V18A 3DFSA 3L5AA 3VNJA 5FEWA 1UKSA 1WV2A 3NPXA 2PDKA 1C8QA 1H61A 3EYPA 1IZJA 3V5FA 3MW7A 1AW1A 3URBA 4JTTA 3C0JA 4M6QA 3GY1A 4RJEA 1KLYA 5A2BA 1ITCA 2Z24A 3KS6A 2FFIA 3EOUA 3DZ1A 1F3EA 5LGXA 1RVGA 4R3UA 4IP5A 1Q45A 3NO1A 2XWEA 3GW0A 2HWGA 3C5QA 4LUTA 2PWDA 3AS3A 4LH8A 1U1UA 3NQVA 4CNUA 4DYJA 1QI4A 3I68A 4KETA 1UCWA 3U2OA 2D1ZA 3ITCA 3GDBA 2YZRA 3P84A 5AYZA 2TMDA 1IR2A 4FX8A 5C9XA 4A8LA 3DEQA 3CZJA 2VC9A