3STGA

Crystal structure of a58p, del(n59), and loop 7 truncated mutant of 3-deoxy-d-manno-octulosonate 8-phosphate synthase (kdo8ps) from neisseria meningitidis
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
268
structure length
260
Chain Sequence
MDIKINDITLGNNSPFVLFGGINVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDKPRSSIHSYRGVGLEEGLKIFEKVKAEFGIPVITDVHEPHQCQPVAEVCDVIQLPAFLARQTDLVVAMAKTGNVVNIKKPQFLSPSQMKNIVEKFHEAGNGKLILCERGSSFGYDNLVVDMLGFGVMKQTCGNLPVIFDVTHSLGRRAQALDLALAGMATRLAGLFLESHPDPSALPLHLLEDFLIRIKALDDLIKSQPILTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-dehydro-3-deoxyphosphooctonate aldolase
publication title An Extended (beta)7(alpha)7 Substrate-Binding Loop Is Essential for Efficient Catalysis by 3-Deoxy-D-manno-Octulosonate 8-Phosphate Synthase
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Transferase
total genus 90
structure length 260
sequence length 268
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2011-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3stgA00
4GJ1A 2JBMA 4FB7A 1TTPA 3LERA 5F1VA 3CPRA 3MJYA 3C2VA 3TIMA 4EWND 1W3NA 4MJZA 2ZZ4A 1MEIA 3TA6A 2Y7FA 3R12A 2QCCA 1JULA 2OX1A 5K9DA 1MSSA 1LYXA 5G5IA 4EIVA 3W1TA 1L6SA 3CIWA 3GKAA 1M7OA 5D03A 3MBFA 3NQGA 3EKLA 4IXHA 3KOFA 4BI6A 3NQ2A 4WZHA 1I45A 1TTJA 1K8XA 2ZRZA 1K3UA 1RD5A 5J5RA 4BR1A 1JVNA 2QJIA 4QISA 5FEXA 4UFKA 4IGHA 2CZ5A 1G7VA 3EXRA 3DBPA 5CPLA 3OVPA 2WNNA 3TQVA 4CCCA 3FLUA 1CX9A 1YPIA 5HQEA 1QDSA 2XN0A 1NVMA 2ATSA 3EX4A 1G7UA 3RFAA 5HR6A 1K8YA 3LLDA 1SPQA 4ADSA 4WOZA 4GUGA 1GZGA 1KFCA 2DU2A 3LXCA 1PVNA 2BLEA 4LRTA 3DGRA 4LS0A 1VJIA 4HKPA 3OVQA 3HIJA 4AH7A 3B05A 4BFAA 1A50A 3MHFA 1QCWA 1X7FA 3W2NA 1W5OA 4UXDA 3GDMA 4NJGA 3SGZA 5DCEA 5F1UA 4JYFA 2NXHA 1ME9A 4ZQMA 1SSGA 3E9AA 4OV9A 5LNRA 1RZMA 4DF0A 4LWWA 2KZHA 2E6FA 3P61A 1KA9F 1G69A 3PAJA 3B06A 2H6RA 1M5WA 4IPJA 1T96A 1QOPA 4LTSA 4AWUA 2Y6ZA 1OJXA 2Y7GA 4RXGA 2W6RA 2QEZA 2QF7A 1EA0A 2QJHA 3O15A 3M5VA 2YYUA 1WAUA 5C2XA 5E0KA 2ZFAA 3BLEA 1KBIA 2H8XA 4AHOA 1JCYA 3T40A 3RU6A 4GUIA 3NNTA 1TRDA 1EUAA 4M6VA 3T55A 4UFLA 1P5BA 3T4CA 2YYTA 3S1UA 1OFBA 4E2DA 3PF3A 1LRQA 4CQAA 1NAL1 2J9YA 4LUJA 2A5HA 1FDJA 5CSSA 4X2RA 4J9JA 4FF7A 3W22A 2J9ZA 4FXRA 5CG7A 4XZ9A 4IMDA 1I8JA 1XXXA 3N3MA 3QMTA 5H2ZA 4FNTA 3LHYA 5C5YA 3LXAA 3N2XA 1BWLA 3CWNA 3FYPA 4M7TA 3B0VC 1O5KA 3O6CA 3O8AA 5D09A 2PE4A 1H63A 1UCWA 2A7NA 3TMLA 2V0TA 2QCLA 5F2MA 1BWKA 3BG3A 4O8RA 1BTMA 4I7VA 3V75A 3VCRA 2GOUA 4Q33A 1FDZA 2ZRWA 3W23A 3RF9A 1N7KA 1T0OA 1WX0A 3L66A 2G95A 3SY5A 3GVGA 3P5YA 1LM1A 3DXIA 4IMGA 3G3MA 3A5VA 3GZ3A 3LV6A 1SO3A 3UWZA 1B4EA 3SJ3A 4N4PA 1TV5A 1F5ZA 1OX5A 4FX7A 2BX7A 3CEPA 1JJKA 1OHLA 3DFPA 5K2ZA 1Q6OA 1PIIA 3W7JA 2ZRYA 5FEWA 4GE8A 5G1YA 4HSOA 1R2SA 3AJXA 3HB9A 4AB4A 1Z44A 5I3KA 5IBXC 1PE1A 4PTNA 2FQIA 1SR9A 1EP2A 2H90A 2I9EA 3W3OA 1FQ0A 2C6QA 1M6JA 2YFNA 3PUDA 3NQEA 3GXPA 5CZSA 5HUOA 3W1QA 4Z08A 2V8ZA 3STEA 4A2SA 1EIXA 3CHVA 1JQXA 3EWBX 1FWWA 5FF3A 3V1PA 1JQVA 3G1YA 3GK0A 3K30A 4H6KA 1OFOA 2ISWA 4DELA 3S8HA 1GYNA 4X9SA 1W5QA 4TIMA 4CCDA 4UFMA 2H3DA 3NO5A 3L0NA 4JX6A 4C1LA 3IV3A 4YCOA 2W79A 2Y70A 2ZZ1A 1B9BA 4OE7A 4TU1A 2YDAA 3BPWA 1W37A 3LXBA 3G18A 3OHIA 5L9FA 1P0KA 2EHHA 2Q3RA 3TW6A 3PR2A 3MYPA 3M7WA 3OEXA 1RQHA 1F74A 3QM3A 1OABA 2VENA 3WK2A 1GTHA 5CZJA 5CZ0A 4QNEA 5MHBA 4OWGA 3RMJA 1O95A 4MUZA 2AGKA 1AL8A 4Y9AA 1W8SA 3UQNA 1C8VA 1UUOA 1VLWA 4WY0A 5TIMA 5A8GA 1GG0A 3TE9A 4O15A 3JS3A 4JTTA 8TIMA 3DZ1A 4UNLA 4LS1A 2CLKA 3PY2A 3W1AA 4H4IA 1L9WA 5DBTA 2C19A 1VZWA 1YPFA 4RR4A 3P5ZA 3UXDA 4Z1DA 3FJLA 3W1MA 2HMCA 1F05A 1MEHA 1LTDA 2NZLA 4O1CA 2X16A 3M1ZA 2VFGA 2X1RA 4I7WA 4JS3A 1GT8A 3F4NA 1TMHA 3LTYA 4AWSA 3G1DA 3L21A 2R8WA 4N2YA 4NJIA 3CC1A 3O1NA 1G4TA 2DZSA 2EKCA 3HPSA 1TPDA 4UFHA 1XFBA 4DBEA 4Z1AA 1O60A 3QFEA 3TW7A 3BO9A 5F4XA 3ABRA 3NM1A 2VEPA 4DO4A 4LV4A 1TJPA 4K8HA 1D3HA 3O06A 1Z42A 4UR8A 2CZDA 1I2RA 5LHFA 4N02A 1QOQA 1KFKA 3MI2A 4K39A 1IXNA 4LNYA 1VCVA 3W88A 2ZDRA 4K38A 1XBXA 3B03A 4S2BA 4NJKA 3SR7A 4G1KA 4JTEA 1VGAA 1SZGA 1KM0A 4PCFA 3TMQA 3M5YA 4LRSA 4UC5A 2Y7DA 3GLCA 2OT0A 3DAQA 3SIZA 3W73A 1A5BA 4YL2A 1XDLA 4PC8A 3C8FA 4XTIA 3PBVA 3GDTA 1VRDA 2X1TA 5AC8A 3QSTA 3L5LA 3NOEA 4DF2A 1I4NA 4M7SA 4S2CA 1TPEA 1CW2A 2I1OA 3SI9A 5AC6A 2YZRA 1G6CA 3O16A 4MIMA 1DVJA 1JCNA 3RK8A 1JUKA 1HUVA 3PWAA 3QC3A 1SQ7A 1YXCA 4HIBA 3W1LA 1V7YA 2XN1A 5BMXA 2QCEA 3TV8A 4IOTA 2ZZ2A 3GNNA 3QJAA 3PSVA 4TMCA 3VFLA 4UMBA 4JD4A 1I2NA 1MZHA 1KM2A 4FNPA 1XCFA 2QCNA 2YPIA 3CB8A 3CM4A 1GVRA 5F2LA 5ABTA 5LGZA 3ANYA 3R13A 3NL3A 3SFKA 3DFOA 2Y7EA 4UTTA 2F7FA 3PVFA 3BLFA 1RV8A 5CPNA 4FO4A 1N55A 4W9TA 1GJPA 2BZNA 3C0JA 5HWMA 2JKEA 4QJ1A 3UD6A 2E6DA 4NZFA 5I3HA 1TPC1 5G2WA 3LCFA 3HMJG 3SW6A 3TXZA 3ABSA 3A5FA 1NF0A 3P60A 4A21A 4EVZA 4RCXA 2JGYA 3ZFHA 5GVJA 7TIMA 3JR2A 1PV8A 1S5VA 3VE9A 1ZHAA 4FIQA 3HF3A 3N73A 1SU5A 1S5WA 5D37A 2W0UA 1G4SA 1A5SA 2PRLA 1GQNA 1OF8A 1TPH1 5D2TA 3TQKA 3OBKA 4PODA 5HWJA 2WSQA 1U5JA 2BWGA 3W86A 3A23A 5K4XA 1K7EA 1G4PA 4OU1A 4YCPA 3NQAA 2HTMA 4Y90A 3FYOA 1H5YA 2X2GA 1SO6A 3W2LA 4RKAA 4O16A 5AFDA 1DL3A 3JRKA 2EF9A 3TC7A 5BOOA 3QPYA 3D0CA 2WJZA 4M19A 3KHJA 3EB2A 5EPDA 2GPTA 4LY8A 2Y63A 3NDOA 3LHWA 3TNOA 3LTSA 1EPXA 3C61A 2EPHA 3DHDA 3W1PA 3WJXA 5K9XA 3S42A 5HUPA 3O63A 5TQLA 4QQ3A 4DBDA 3A21A 2CLMA 3N19B 4JNMA 3W7OA 4NT0A 1AG1O 1T8XA 4GUHA 3KVKA 2DZXA 4N6EA 1O5XA 2GVGA 5D2XA 5LZLA 3SSJA 4IX2A 1WBHA 3GB6A 3U8GA 4CCEA 5AYZA 2OJPA 2D73A 1SW0A 1TPWA 3CT7A 3R2GA 4RX0A 2ZRXA 3EWWA 1C29A 5H91A 1JCXA 1UB3A 5AHFA 3KVMA 3MHUA 2DJLA 5BMWA 5J5DA 2QCHA 1TPUA 4GBUA 2O7QA 1P1XA 1YTEA 4O28A 4MZ8A 1H60A 2WNZA 2HSAA 5KSWA 4KWWA 3HJZA 3ATZA 1RPXA 4LT9A 3NQFA 3UNDA 3QF0A 4D2JA 2QDGA 1SZNA 3NL5A 5LNUA 2ISSA 4MZ1A 3CEUA 4K6AA 4WD0A 5HWNA 3QW3A 1VLIA 4R34A 4HHPA 4ZVJA 3TDFA 3W9ZA 3NQ8A 4ZL1A 3W72A 2ZA3A 4O14A 5FF2A 2GQAA 1QFEA 3L5MA 3MBDA 3Q58A 3W7PA 4AWTA 1ICPA 4AF0A 3NQ7A 3KRUA 1Q6RA 4NNAA 4RZ6A 1QR7A 3NPXA 1HFBA 2FPTA 4A29A 2C18A 1W54A 1XM3A 5AHMA 2ALDA 3GR7A 3R8RA 2NUYA 4O53A 5DY2A 1VS1A 1T99A 4M5PA 2LLEA 4C1KA 5LNSA 3MYOA 3W1NA 2WSYA 3DI1A 5D2WA 2DZPA 3PG8A 3W85A 2ATMA 1XBVA 3PBWA 1FCVA 1OYAA 4R7JA 4JICA 2QKFA 3BVJA 3EX1A 1TREA 1G67A 3BG5A 3VKJA 2PC4A 4LV9A 2RDTA 1FCBA 2B7OA 4UIOA 1YDVA 3P8JA 3NZRA 4HT3A 4UMCA 4NJJA 1SZFA 1F76A 2Y61A 3SGUA 1VH7A 3TK7A 4LS2A 4ADTA 4RJEA 2PRMA 3UPBA 4FHAA 5LNWA 2Y89A 3L68A 4DQWA 3C2FA 5BNKA 2OT1A 4JR5A 3BARA 4AXKA 3GXNA 5AB3A 1TRIA 3E0IA 3DENA 4IMEA 4BK9A 1KLYA 3L0GA 2NWRA 4JX4A 1KM4A 4K36A 5IBXA 4XBKA 3OA3A 4YLWA 4YMZA 2ZCGA 3OG3A 3S1VA 1TV7A 1QPOA 1OFPA 3IGSA 3ZWTA 3L5AA 1ME8A 3CWOX 1OFEA 3I68A 1K02A 1FXQA 4M6QA 2I14A 2QUVA 2WKJA 4O57A 1VHNA 1HL2A 2HS6A 3LHVA 2QR6A 3QQ1A 3LLFA 2PRHA 3ABQA 1NEYA 4ZQCA 3P7YA 4KWVA 3KRSA 3I6RA 5HJLA 3W2JA 4KFNA 3HOJA 3ZR4A 3W2UA 1FCQA 3L0KA 4P61A 2FPVA 5EA9A 1UASA 3BW4A 1KM5A 3W7MA 1W5MA 2NX9A 4BI5A 5EY5A 4WXZA 3UWVA 4JEQA 4XBSA 3TJLA 2FLIA 2EGZA 3DKJA 3PUEA 3OIXA 4DO5A 1NFBA 4JTJA 2TRSA 4UTLA 3TJXA 1WV2A 3M16A 3DFTA 3LOTA 3W7NA 3TC6A 3P74A 1X8FA 2R94A 5AHNA 3NAVA 2VFHA 5T26A 4JX5A 2A7RA 4P2VA 4N9DA 1H51A 3GDRA 4OT7A 3BW2A 1QPRA 2NXIA 4IWWA 5D33A 1M7PA 1PCKA 2CLOA 1SO5A 1DBTA 4QITA 3QSRA 4Z0SA 2XN2A 3U6WA 4MY8A 2VEMA 1QNVA 2C13A 3FKKA 3KVJA 4UTJA 1YADA 4WX2A 1WOAA 4O1DA 2A7PA 3W07A 3W7CA 3TKFA 1LORA 2NV1A 1AW5A 1B57A 3HG5A 4UFJA 3GNDA 2DZVA 2P0OA 3S1XA 1TB3A 4DPPA 3IIPA 1A5AA 4JN6A 3BG9A 1AL7A 3G0SA 3TU9A 3DU0A 5AHEA 4A22A 5I3FA 2P10A 4LOCA 4LVBA 3TROA 3TUUA 1RR2A 2YXGA 1I2PA 5I3GA 3LCWA 3MW7A 4RZ4A 4UMAA 2YGYA 1TIMA 2Y62A 1P0NA 3A9IA 1OYCA 3IGUA 1DV7A 3I7RA 4E2BA 3LHTA 4JIQA 5AC7A 3O6YX 2CLHA 3MWAA 3GDKA 3O07A 4JIPA 3FOKA 1PL9A 3NYZA 4IUOA 1FUYA 2V30A 4JXCA 4BWLC 2NX3A 5DCDA 4O12A 3UZJA 3OVRA 4DF1A 2QCDB 1LOLA 1DQWA 3WK0A 3I65A 3E12A 1TO3A 3PBUA 3C56A 3RNDA 1H7NA 4O17A 2B7QA 3GX9A 4MFDA 3IRDA 3NGJA 3QYQA 5HR7A 4NUWA 4UTHA 4GC4A 4CNPA 4NNCA 3S0CA 3P67A 3EXSA 4BI7A 1ZALA 1WXJA 4LVGA 2DZUA 2J24A 3BK0A 4AMAA 1SO4A 5AYXA 1PHWA 1SW3A 3S5YA 2RDWA 1SUXA 2WV8A 5EMUA 3PBYA 2Z6IA 2V2DA 3STCA 4XWUA 4Y8FA 1D9EA 3W1RA 2J27A 2OMAA 4AHQA 1B4KA 2E6YA 3P84A 1GWJA 1V5XA 3GKFA 5SWUA 4UTWC 3H53A 2VC6A 3HGRA 1KTBA 5G4WA 3WJSA 3G1AA 3TH6A 5CPOA 1KM3A 2NV2A 3USBA 3ZS4A 4RZ5A 5HINA 4HNUA 3EEGA 1L6WA 2V5LA 1H7PA 4XKYA 3M5XA 5AHIA 4GNJA 3EWYA 1Q6QA 3IIVA 3N2MA 1GVFA 3Q2DA 1SZEA 5AOUA 4PA8A 4FNRA 2OZ0A 3DKLA 3M47A 3NQVA 4FEZA 3G3DA 4K7YA 3MMTA 2QCMA 1DHPA 3LCXA 4JDBA 5E93A 5F4SA 4U28A 3GAYA 5D02A 3B0UX 1JCJA 2C3ZA 4Q32A 4WOQA 1C9DA 3DFSA 3M43A 2QAPA 1K8ZA 3IVSA 1GVSA 4UFIA 5DXYA 3GR8A 3S5NA 1TTQA 3NPWA 5CPMA 3G1HA 5DCBA 3PULA 4HPJA 4NQ1A 3ABOA 4LU0A 1H7RA 3S5OA 4JY9A 4MLRA 3HG4A 3MUXA 1ALDA 4JGDA 3BW3A 3W87A 5K9CA 1J5TA 3LI1A 4LC6A 2ZBTA 3W74A 1TJRA 4N9EA 4MPQA 3M44A 5K4ZA 3HGOA 2DZTA 4QSHA 4UTUA 3G0UA 4CQ8A 3Q37A 3PC0A 3BGGA 1QMLA 4UTMA 4PL1A 4LVFA 2YCEA 3UXAA 1XI3A 3EXTA 4RXFA 2VEIA 3EWZA 2NWSA 4UCGA 3IIZA 3MP5A 3PUOA 2E68A 4NNBA 3W7QA 5LHEA 2Q3OA 1EX5A 1B3OA 3LX9A 3LGEA 3HGJA 3LRKA 4ML9A 2TSYA 3TSBA 1XBYA 1ADOA 1ZAHA 2ZQ0A 1VYSX 2ZZ5A 2E6AA 4ADUA 4NXSA 3R5EA 1FBAA 3NQCA 2G97A 2DORA 2E5BA 3G24A 4E38A 5DXXA 3NL6A 1ZY9A 3S1WA 4UNKA 4DEFA 4KKXA 1H50A 4MZYA 3QMSA 4MYXA 1W3IA 3QW4B 3TQ0A 3UWQA 2CZEA 1H62A 1EWEA 3ELFA 2ZTJA 5IM51 4MLJA 1FDYA 5CKSA 1VCFA 1OX4A 4HNNA 2JKPA 1K03A 4Y6GA 1PHQA 1OFRA 5FI8A 2AQWA 5LSMA 1SFLA 1Z41A 2C15A 4GUFA 1AK5A 1IGSA 4IJBA 4K37A 1N8FA 4YXGA 2WOQA 3P82A 1LCOA 3W2MA 1K7FA 4XTDA 2ZYFA 3U2OA 2RFGA 4UUIA 2VXNA 1KFJA 1Q3NA 5DY3A 3NR0A 1H61A 3FS2A 3N14A 3HG3A 1FWSA 1AMKA 3UY8A 4JDYA 1XL9A 4ORIA 1A5CA 1ICSA 3B04A 1F7BA 1H1YA 2ZRUA 2VOMA 5AN7A 2UV8G 2WQPA 3UZ5A 1ZJIA 2QJGA 3EX6A 3LB0A 1FXPA 5FF4A 3SECA 3W7KA 3WJZA 2GJNA 3M41A 1EEPA 1XKYA 1JRBA 1HTIA 4AF0B 1EP3A 2FTPA 2G96A 1DORA 4DPQA 1KFEA 3PM6A 2FDSA 3DFNA 4FX8A 3WJWA 4CNOA 1LOSA 1GTEA 1KLZA 4UTTC 3NXFA 3HGSA 2PURA 3LCIA 4QIUA 1ML1A 2AAMA 1OFQA 5DELA 4JTFA 5TBOA 2X1UA 3WFAA 3G1XA 3W7EA 2NXGA 1TQJA 5LNVA 5G4EA 1EUNA 3AO0A 1LRTA 1G4EA 1H7OA 5HULA 2A85A 2J88A 4JTKA 3NM3A 1LBFA 5EL1A 3H54A 4N9BA 1J2WA 6TIMA 1ZENA 4QNWA 1FWRA 3DI0A 1QO5A 4IXXA 3NPVA 2BSLA 3W71A 2CLFA 5C6MA 4O13A 2Y88A 5C54A 1SSDA 1YDNA 3TAKA 3LV5A 2E77A 3G0XA 2VKZG 1TQXA 1WA3A 3UYCA 3LBCA 3KAOA 3I7QA 1JUEA 4Z1BA 1XDMA 3LHZA 2E1DA 4JY8A 1VYPX 3STFA 5FF7A 2DP3A 1F6PA 4POCA 3A22A 3GYEA 3N34A 3WK1A 3MP4A 3W7IA 2QAFA 2F84A 4X22A 3IGXA 1TV8A 3MO7A 1BKSA 3QH2A 2FB2A 3TXVA 3TAOA 1JR1A 2R91A 4Z0JA 1LBMA 1JCLA 3W7HA 3MP3A 2Q8ZA 3RLVA 5KZEA 2NLIA 2J6XA 2E09A 1O4UA 4JTHA 4TR9A 4ZZ9A 1DQXA 4JYDA 1ZAJA 1UJPA 4MFEA 3GIYA 2GQ8A 2FJKA 2RH9A 3FFSA 1VPXA 2O7SA 1QPQA 3DHFA 4FIRA 3T44A 5AHLA 4JYEA 3KRZA 1KW1A 3MHGA 1DJQA 4E0CA 3PSWA 2V81A 1IXPA 3LDVA 2CLEA 2YW3A 4GUJA 3LI0A 2RKXA 3F1QA 2E5DA 5D04C 5D30A 3KXQA 4FNQA 4GXMA 3G22A 4MY1A 3VNDA 1F2JA 4H3DA 3WK3A 2A0NA 4JTSA 3GDLA 1VHCA 3SZ8A 4O11A 1KFBA 4PEKA 1LRNA 3LCGA 4A3UA 4O54A 2A4AA 2FB3A 2NUWA 5I3JA 1KV5A 1DOSA 3C52A 3KVLA 3F4WA 1QO2A 4BF9A 3NQDA 5FEPA 5U7SA 3S5ZA 1R2RA 1ONRA 1FCUA 1X1OA 3BLIA 2V5BA 5DLCA 1LROA 5AYYA 1ZNNA 2G5WA 5CGQA 2IQTA 4WJEA 3G1VA 4JTUA 1W56A 3MI3A 1F73A 1X6UA 2GJLA 1LLZA 3G1SA 2Z1BA 4UTIA 1D3GA 3PG9A 1JRCA 3CU2A 5EKYA 5E1QA 3L9CA 2VFIA 2WPBA 1XBZA 3P80A 2VEKA 4KFOA 1YXDA 1O94A 4O1AA 1OX6A 5BRBA 4O1BA 1QPNA 3Q94A 1IXQA 2DJXA 1ZFJA 2NUXA 1L6YA 3EWXA 2ZZ7A 4NX5A 4AAJA 5FESA 4MOZA 2Z0IA 4ICNA 3DH7A 3PB2A 3DFQA 3M0ZA 4NJHA 2JKAA 1FX6A 2C1HA 2ABBA 3QEZA 3L65A 1WQ5A 1GOXA 1VQTA 3C2RA 3TSMA 6ALDA 2QDHA 2QUTA 1Q45A 4IPIA 3T7VA 1TSIA 3INPA 3N9SA 1R47A 5FF0A 5KMYA 3QMRA 4NXKA 5K7JA 2WSRA 1SW7A 3VE7A 4BWLA 4O50A 4GWEA 3LTPA 3UY7A 4WY0B 4WQ6A 5A5WA 2GUUA 1WDWA 3NEVA 3HG2A 4NZJA 4CNNA 3G8EA 1K7XA 1WYIA 1JCMP 3C4UA 1RQBA 4GRSA 4GFSA 1PS9A 1P4CA 1VR6A 4KFPA 2ABAA 4L4MA 5G2IA 2QUUA 1TPFA 1OYBA 4HSNA 2H8ZA 3FEMA 4K7VA 1W3TA 3CIXA 1H7WA 1ICQA 3KFTA 3W75A 1GG1A 5BW6A 3TSDA 1MEWA 1UBSA 2E5CA 4NU7A 3H55A 4PL2A 5G2HA 1R46A 2V2CA 3THAA 4ORMA 3FA5A 1OFDA 4UTKA 1VC4A 4UTWA 2GVLA 1W31A 3NA8A 4XKYB 4LW7A 3E96A 3M6YA 2C0AA 4OBTA 4O4VA 3S6DA 1KTCA 3E02A 1LOQA 2B0MA 2ISVA 3W7LA 1VCGA 5CSRA 1ZCOA 4O19A 5I3IA 3TCEA 3HBLA 2EAWA 3W7DA 2TYSA 1W5NA 2YFOA 3O05A 5C55A 3THQA 4MJMA 3W1UA 4LUIA 3C2EA 3PB0A 4HPXA 1FWTA 1X1ZA 1TPVA 2P1FA 5U4NA 3UWUA 4R33A 4IMCA 2H3BA 4R53A 3EX3A 5KZMA 1YTDA 3M9YA 4MKNA 2ZTKA 3FKRA 1KBJA 2A6NA 4JTLA 1UUMA 3TFCA 1AW2A 4O4WA 1QAPA 3TX9A 1EB3A 1R30A 5D05A 3W70A 5DBUA 2FPYA 4A2RA 3M5ZA 1THFD 3QZEA 2C16A 4ZMGA 3IEBA 3UWWA 1LDCA 1KV8A 5D2YA 2CFFA 3YPIA 2RDUA 3TFXA 4IMFA 3FJ6A 2X30A 3MI6A 2HS8A 3C3NA 1GVQA 4XUGA 4L4LA 2ZZ6A 4I9AA 1AW1A 1LZOA 1LP6A 3LRLA 1KTNA 1I2QA 5D2VA 1XC4A 4XQ6A 3R89A 2J9XA 3KX6A 3FIGA 5LGXA 3N9RA 4IQLA 1W1ZA 4ONVA 3BGJA 3CTLA 3WJYA 1LLWA 2CU0A 2JGQA 4MY9A 4EF9A 4Q4KA 3HPZA 4NVTA 4AVFA 3P8IA 1A53A 4ZQRA 1DKWA 5KTLA 1U83A 2Z6JA 5KZDA 3S9YA 2A1YA 4RK8A 4QAIA 5KINA 1TPB1 2CLIA 4LVAA 1IIGA 2CZFA 2JK2A 4TO8A 4O10A 2Z2UA 1FWNA 3O6DA 3W7GA 4ALDA 1GEQA 1Z48A 4WY0F 4IX0A 5F2IA 5HMSA 1FY6A 2X1SA 3ATYA 5K3VA 1YDOA 5F4WA 4YWIA 2A2IA 1OX4B 4ZQNA 2Y85A 2CLLA 1RVGA 1E51A 3F03K 2B7NA 1XUUA 4CQ9A 2GQ9A 1CI1A 2B4GA 2DZWA 4AEOA 3LM7A 3G8RA 3CQ0A 4Y96A 4Z1CA 2QCGA 4DXVA 2YX0A 2QCDA 1S3HA 4JTIA 5DN1A 4HNTA 1RQEA 3NPUA 4O52A 4TX9A 4S1FA 3STGA 3GAKA 5LKYA 4JTGA 1KM1A 4N9CA 4NX0A 2BXVA 2YR1A 4QM1A 4O0KA 1OVDA 5HNRA 5D38A 3GXTA 1NF7A 2A6LA 3L67A 2OCZA 3B0PA 4LVDA 3EKZA 4OQVA 4FNSA 1GPWA 4X3ZA 3W83A 3W2KA 3NG3A 2TMDA 4PH6A 1KM6A 3RLUA 3C6CA 3NQ6A 1VYRA 1TYGA 2VFEA 1IF2A 3LCLA 3LHUA 1TCDA 2VELA 1S5TA 3P62A 4N6FA 2RHGA 3NVTA 4FXSA 1WOBA 1I2OA 1WBJA 4UR7A 4N4QA 1GVOA 3CLMA 2ZRVA 2FIQA 1HG3A 4HNVA 4OHQA 5CZTA 1LBLA 3HQ1A 3IIOA 1YYAA 1ZAIA 2V2HA 2WO5A 4ZQOA 1DJNA 4EF8A 4O0ZA 1XUZA 5G1TA 3UPWA 3UWYA 1Q6LA 2YSWA 2CWNA 3TR2A 3VI2A 1QWGA 3LRMA 3IVUA 4RV8A 1OK6A 1NSJA 2ZA1A 4RLIA 4K8EA 1OFAA 3G1FA 2Q8LA 5EYWA 1PCWA 3B4UA 1YXYA 2VFFA 3NL2A 1HO1A 2YW4A 5KITA 1H7XA 3LBMA 4O18A 4WUIA 2VFDA 2C14A 3W76A 2ZZ3A 3BV4A 3W6YA 4TMBA 2XFWA 3I7SA 4PFMA 4HN4A 4M6PA 1IXOA 1OG0A 3NZ1A 3P81A 3QQ0A 3EWUA 2V82A 2CW6A 4OGZA 3HPXA 1HO4A 3W84A 4AHPA 2GVJA 2ZA2A 1Y0EA 3EX2A 3ZWSA 4CLMA 4FX6M 1OF6A 3IVTA 3QRHA 1H1ZA 1W0MA 3C2OA 1EWDA 5EBUA 3LCHA 5F2GA 1BEUA 2QCFA 2R14A 3W7RA 1EP1A 4MYAA 1GYLA 3PS7A 4EOUA 2WNQA 4FNUA 3E49A 1YLVA 1JUBA 2TPSA 2V9DA 3HO8A 3QPZA 4ZQPA 4MVAA 3L2IA 2PCQA 2FFCA 4U4MA 1YTKA 1OK4A 1SFJA 1J4EA 4DO6A 1W5PA 3IIXA 2NX1A 1R2TA 1F6KA 1MXSA 5D32A 2BTMA 3W1XA 3B8DA 1MO0A 1TTIA 4B5NA 1KFLA 3A24A 1L2UA 4WXYA 2B7PA 5L6UA 4LC8A 4OV4A 2A21A 3T78A 3NQMA 1IIHA 5FEZA 1ME7A 4I7UA
chains in the Genus database with same CATH superfamily
1P6WA 4KPLA 4GJ1A 2GL5A 2JBMA 4FB7A 3TNBA 1TTPA 2REQA 3ARXA 4HA3A 3MJYA 3C2VA 4J28A 2X0SA 1MEIA 3MS8A 3NCOA 1V3HA 3EWCA 5G5IA 3W1TA 2PD9A 2PTWA 1AH0A 1M7OA 3NQGA 4OZOA 1I45A 1K8XA 2VD8A 2QPSA 4EP8C 4BR1A 1K6AA 2X0YA 2QJIA 4J27A 4EPEC 5C2GA 1AVAA 5FEXA 4NI8A 2CZ5A 1RPKA 2PTXA 3H2AA 1G7VA 1GHRA 3DBPA 1JFHA 3TQVA 1HW6A 2YL9A 4V33A 4F9JA 3SM0A 2DSWA 1GJUA 1QDSA 4W4QA 3FXYA 3PTDA 3UVAA 3QV6A 2PU1A 3W01A 3AUOA 3RFAA 5HR6A 1JAEA 3PWIA 3BXWA 1SPQA 4MB4A 4WOZA 4C6LA 1LUCA 1V93A 3LXCA 2BLEA 4LRTA 3DGRA 4LS0A 3H8AA 1E6ZA 4HKPA 4IQJA 3OVQA 1HF6A 1ONXA 3EA2A 4R3UA 3VIMA 4AH7A 3B05A 1QCWA 3W2NA 1KWKA 4GA8A 2DW7A 2IPWA 2OKOA 3SGZA 5DCEA 3CAWA 5A95A 4ZQMA 3E9AA 2OPJA 2PEVA 5A6AA 2ZADA 1ZPTA 1FWFC 4ZOEA 1KA9F 2QGYA 1G69A 2H6RA 1UJQA 1PZ3A 5IRPA 4L80A 4IPJA 6XIAA 3WQ8A 3O15A 3M5VA 5T91A 3ARZA 3JVAA 2D0GA 5C2XA 3GFZA 1HVQA 3BAYA 4AHOA 4LEFA 4K2SA 4LEQA 1GKQA 4GUIA 1M3UA 2W66A 3VDBA 3NNTA 3BMVA 4M6VA 3BAKA 4QJ5B 1R5YA 1KXTA 4OIFA 4XZHA 1NH6A 4E2DA 3MUY1 4BZYA 1NM9A 1TZ7A 1FDJA 1QHOA 3GG1A 4FF7A 3ZT7A 4IMDA 1TV2A 3DG7A 4ECLA 1I8JA 1ZS2A 3UXLA 3VINA 2Z1KA 5C5YA 2RGMA 5CZKA 3LXAA 3B0VC 1F9CA 1O5KA 3O6CA 4C7GA 3O8AA 2PE4A 1IZCA 1LWJA 1UCWA 3AYVA 1KCZA 1QNOA 5F2MA 3SRFA 3TTQA 5FAJA 3AZRA 3BG3A 4O8RA 5H8MA 3V75A 2EEXA 1R3WA 1BQCA 1FDZA 3W23A 4KGJA 3RF9A 3GWQA 1T0OA 4GI8A 1WX0A 2PDFA 4WKFA 4PUDA 3WEZA 3SY5A 4DLMA 3EPNA 3LD5A 1TCMA 3P5YA 3AHYA 3OTRA 1LM1A 2AKZA 1HJQA 3LV6A 2CESA 3CMJA 1QT1A 4N4PA 4YVXA 1JJKA 5K2ZA 4LAKA 3S5SA 1PIIA 4GY7A 4QFUA 1VFUA 1UKSA 2OZ8A 3OU8A 5TNVA 2BGSA 2Z1XA 4NF7A 3E3HA 3ITLA 3KLKA 3U5UA 8XIAA 1SMDA 2C6QA 3ARUA 3MO4A 5HUOA 3W1QA 4Z08A 1R0MA 5I06A 4JIHA 4LBRA 5IHRA 3STEA 1A4MA 4RNFA 2IS7A 5IXEA 3GK0A 1BRLB 1OFOA 2X1IA 2B81A 4X9SA 4TIMA 1Q63A 4JX6A 3WNPA 4GZ7A 4J3TA 2BY3A 5CQ1A 2ZZ1A 2VCCA 3W82A 1W37A 1PXGA 3BQ6A 1TVNA 5EGRA 3WN6A 2ZDSA 3PZMA 2CLPA 3BAWA 2EHHA 2GVEA 4GMEA 1EKOA 3M7WA 1AQHA 5JU6A 3ECQA 4UQAA 1OABA 1E0UA 1GTHA 2JIWA 3DYOA 4QNEA 3QQWA 5MHBA 2BVWA 3CL6A 1O95A 1MWOA 3FA3A 4AD2A 2EPMX 4F8XA 4PTXA 4S3KA 5A8GA 4Q8UA 1E40A 4O15A 3TE9A 3NZQA 4Z2HA 1KXHA 4LS1A 2CLKA 1JPMA 5C70A 2J25A 4XD4A 1YPFA 3VDAA 3UXDA 4MJ2A 4ZBCA 1DIKA 2HVMA 1MEHA 1UD3A 2GZXA 4I7WA 1QI3A 3F4NA 2UWFA 1TMHA 4AWSA 4BKNA 5GJMA 2R8WA 4KEVA 1MW0A 1GVEA 1G4TA 1UH2A 1BKHA 4UFHA 1XFBA 3WENA 3TW7A 3NM1A 4I90A 2WSKA 4K8HA 2ZX8A 3S2NA 1KRCC 4D8ZA 1Z42A 1NQKA 4HNCA 2CZDA 5DANA 2YDRA 1EGZA 4N02A 2HV5A 4LNYA 3UJEA 1VCVA 1J01A 4W8LA 2CBVA 3AI0A 7A3HA 1HKWA 4R27A 1QHPA 3GG8A 4IIEA 5LA2A 4DRSA 3RJXA 4J1OA 3GXMA 3H70A 4LRSA 4MKVA 3GLCA 2OT0A 4IFKB 3W73A 1A5BA 1XW8A 2ZUTA 1A3HA 4PC8A 3UG8A 1VRDA 4IFRA 4KETA 1UD6A 1OCBA 3QSTA 4M7SA 1MNSA 1TPEA 5A1AA 5DT5A 1JFXA 3H7VA 3VGHA 2YZRA 2XH4A 2EG8A 4MIMA 2DQWA 1JCNA 1OIMA 3AYSA 5J8LA 3WQPA 4GHRA 1SR0A 4B9YA 4H8UA 5I24A 2QCEA 4IOTA 2ZZ2A 3QJAA 4TMCA 4YJ5A 1KM2A 1F07A 2QCNA 1E3XA 3CB8A 4Z2GA 5BZAA 1B1YA 3ANYA 2Q6ZA 4DI9A 4EPBC 4Y9NA 3EZ4A 4W7WA 1U30A 1OC6A 3PVFA 1SFSA 3CAKA 3CT2A 4D72A 3C0JA 1E6PA 3I6EA 1Z8AA 2JKEA 3H21A 1AJ2A 2V3EA 4JOMA 3CH0A 5A8MA 1T6MA 5I3HA 3F5LA 1TPC1 4BA0A 3QHNA 2ZUVA 4HK7A 4IPNB 5GVJA 2RAGA 2OWXA 3H26A 3AHXA 4P7QA 1ZHAA 1U1JA 4AYSA 2EJ1A 2XH2A 3N73A 3THDA 4CD7A 4R7WA 1PZ1A 1GQNA 2XGZA 1RXOB 3CXOA 1K7EA 5DT7A 4OU1A 4PR4A 4ZGYA 3NQAA 4AY1A 1W32A 2WVVA 2Z1SA 3FYOA 1SO6A 3EEZA 4C6KA 3WLIA 1RA5A 3TC7A 1EJVC 1WKYA 4LB4A 2P3ZA 3UERA 3D0CA 5A8NA 1YQ2A 3WNKA 3W6LA 2GPTA 3NDOA 2OELA 1FWAC 3LTSA 3HPFA 3C61A 1EHNA 4WHBA 4HCDA 3KBSA 5HUPA 2ACQA 4FK9A 3LS9A 4QQ3A 4JNMA 4RUBA 4W84A 1JYNA 2G4FA 4NT0A 3CZLA 4PTVA 3AUJA 1O5XA 2GVGA 3VX0A 2WK2A 4MNMA 3QFWA 4CD6A 4CNTA 4B5UA 5LZLA 4FALA 1WBHA 4JIRA 4I9JA 4CCEA 3MSRA 4MGGA 4D6EA 1UZ1A 3LNPA 3M0YA 5CAHA 2J7BA 1J10A 3KVMA 5BMWA 1CCWB 1L8PA 4QCEA 1TPUA 5DMNA 1GJWA 3L2MA 3GXFA 2GDQA 3CUZA 3RITA 2ZVIA 1KR0A 4KWWA 1UR4A 3UVIA 1ENUA 1W3KA 3TN4A 4QBXA 2OYKA 3ABZA 4LT9A 2QDGA 1SZNA 3AHVA 4AD1A 1NDYA 2ISSA 2PODA 3CEUA 4HJWA 1E43A 3PWGA 2YCIX 3FA4A 4Q6XA 4JTAA 3L2LA 4EPKA 4O14A 1QFEA 3TOYA 3MBDA 4HU8A 3Q58A 2FHFA 4WDWA 4NNAA 3T0TA 2GJXB 3GFXA 3WDQA 2DPEA 1XM3A 4NY2A 3SCSA 3R8RA 1VS1A 4L6OA 4C1KA 2DGAA 2WSYA 5CBIA 4Q3MA 2DZPA 2PWDA 3PBWA 1XBVA 2E3ZA 3ZZ1A 1OC5A 1VPQA 2HVNA 5ABGA 4R7JA 4JICA 4MWAA 2PGWA 1NU5A 2QXWA 3BVJA 2EKGA 3LG3A 3EX1A 1BHGA 3M0VA 3UGVA 3OHMB 2VWTA 1G67A 1JD7A 3V3WA 3BG5A 3M6DA 4LV9A 1FCBA 1WB0A 2B7OA 1W91A 3W6MA 4GH1A 3P8JA 4HT3A 1EPVA 2PDLA 3P14A 2Y61A 1GQIA 1LG2A 1VH7A 4WIWA 5C9ZA 3W26A 2BDQA 3AMCA 3L68A 2Z7KA 4ZE4A 1RBAA 1R86A 2OT1A 4JR5A 4AXKA 3GHSA 4GYKA 5I78A 4IMEA 4XBKA 1C9WA 3OA3A 4YLWA 1TV7A 4J2PA 1QPOA 1PTDA 1XR2A 2J7CA 3L5AA 1FXQA 4M6QA 2HS6A 3E0WA 3LHVA 2QR6A 3LLFA 3ABQA 4KWVA 3KRSA 3RM8A 3ZR4A 2OOGA 4K3ZA 2INEA 5I79A 1FCQA 3L0KA 3RUBL 3DN5A 5EA9A 3BW4A 4AEEA 1KM5A 3W7MA 3H2EA 4BI5A 5EY5A 4NZ3A 4RV3A 3UWVA 4XBSA 1XIEA 4CEXC 3DKJA 3PUEA 4JTJA 4UTLA 4CN1A 4EK7A 3M0XA 4QG8A 4RNHA 2CXEA 3TC6A 4Z2JA 2VFHA 4OT7A 5CJNA 4IWWA 1TUFA 2G41A 4QE1A 4J7RA 3APYA 4HYWA 1Y8BA 1KB3A 5CG0A 2DT2A 4BY3A 2XN2A 3R0KA 1A5NC 1GZJA 2C13A 3FKKA 2VC9A 1YADA 3QOMA 3IJLA 1QBAA 3SQLA 4ZOAA 2DUZA 1Q5MA 2NV1A 4W8BA 3SDOA 4UFJA 1FWJC 3DYMA 1QVBA 1AH4A 3V0UA 1A5AA 3MCOA 4U3CA 1I0DA 4GI4A 4LOCA 4H7VA 4LVBA 3RM4A 1RR2A 2YXGA 5I3GA 3QTGA 4PN2A 3SQSA 2YGYA 3VKKA 3VUPA 3WD4A 4AD4A 1P0NA 4U2YA 2QZRA 4J3VA 2IQ0A 3LHTA 3VGFA 3UYIA 3O6YX 2DSZA 4NAEB 3MWAA 4CEUC 2GK1A 2WHLA 1FUYA 1PPIA 1QK0A 4JXCA 4BWLC 4O12A 2FZMA 3CNYA 5BWAA 4NI3A 2W62A 3I65A 1VAHA 1JNEA 4INFA 3GX9A 3EBVA 4PMZA 5BXRA 5HR7A 3U0HA 3EXSA 4WK9A 2QJJA 3KBWA 2IW0A 4Y9OA 3OZYA 1PTGA 3QLDA 4J3ZA 1EBHA 4F66A 1SUXA 3PBYA 3JZEA 6A3HA 3PZIA 1M7JA 4XWUA 3SCWA 2CNCA 2OMAA 4AHQA 1KQZA 2PDJA 3VZZA 1X97A 4GGBA 2XM1A 1WUEA 1Q6CA 1W17A 1GWJA 4DJFA 3GYCA 4RDWA 3PBMA 4A35A 4WSJA 4UTWC 4TVCA 5AYIA 2RJGA 2VC6A 3HGRA 4W89A 1KTBA 3BLOA 3WJSA 3TH6A 1KM3A 2J62A 6ENLA 3WLQA 3S9IA 3CV6A 2Z27A 1L6WA 2V5LA 4LALA 5I07A 4XKYA 4FAMA 1QBBA 5I3DA 4CD4A 1XLEA 3KRBA 4HMNA 3N2MA 2F6KA 2G3JA 1SZEA 1WZAA 3DKLA 2A3EA 1XH1A 4MJ4A 3GAYA 1NDVA 3B0UX 3ZVHB 3UR7A 1JCJA 3M43A 1GVSA 1J0YA 5DXYA 3FDGA 1Z3NA 1R8LA 5DCBA 2RDXA 1FHUA 4L6DA 1CLKA 4YTQA 2VR2A 1UOKA 2IXVA 1HJUA 4H1ZA 2VZSA 3PPHA 5GNXA 4HB7A 3W74A 4N9EA 4DJEA 3OVGA 3GHRA 1IEIA 2WJDA 1J0JA 2YOCA 1TWSA 3HGOA 1EC9A 1PEZA 3WIJA 2IKIA 4CQ8A 3Q37A 3VD9A 3PC0A 3BGGA 1KKRA 1Q6EA 3FDKA 3ZQ9A 4UTMA 3SO7A 2PU0A 3EXTA 3KCLA 2NWSA 1TX0A 3GNPA 1IR1A 2AOSA 1FWDC 3K8MA 3RR4A 5CAKA 1TJ1A 1EX5A 2NSOA 4K1GA 2ZUSA 3HGJA 1VFHA 4JQ2A 1VYSX 4TUFA 4ADUA 3R5EA 3A9BA 4F4RA 3SCPA 2DORA 2I5GA 4XG1A 1XIHA 2REQB 2E5BA 3G24A 4E38A 1O12A 2Y2WA 3NL6A 4AVNA 4DEFA 4KKXA 3QMSA 1IEVA 3ELFA 2ZTJA 4PMNA 1UR0A 1HKVA 2W4XA 5IM51 3GH7A 2ACUA 3VOCA 1PHQA 1OFRA 1WAWA 4GUFA 2HPMA 1IGSA 4S3GA 5I2UA 4IJBA 2YBUA 5TD4A 4PMUA 2ZYFA 1X7IA 4FLSA 3WUEA 2GJPA 3SUUA 1KFJA 2I5QA 3NR0A 3N14A 3HPAA 3OW1A 3VX1A 7TAAA 4XZMX 2GGGA 3B04A 3GH5A 3PANA 1AUSL 4AZHA 1ZJIA 4P7NA 5FF4A 1F61A 3WJZA 2GJNA 1JZ4A 3UR8A 2G96A 1UD5A 2NT1A 2XHYA 1KFEA 2ZWZA 4FX8A 2BHZA 1FWCC 3ARTA 2ZIDA 1AZ1A 3ZMRA 2PURA 1EDGA 1ML1A 4DYJA 1ONEA 2DVXA 5TBOA 4ML4A 3G1XA 3W7EA 2NXGA 1PDZA 2PWFA 3S9ZA 1H7OA 3EOUA 2A85A 3ERPA 1M03A 3NM3A 1XJBA 3URQA 5FSDC 2HROA 1GUVA 2J7HA 4N9BA 2YIHA 1FWRA 3O0KA 1CLXA 1L6GA 2DZBA 4IXXA 3T81A 1IZJA 2CLFA 3RRAA 1IT0A 1ZZMA 1C3FA 2YB4A 4HA0A 3PZOA 4XAGA 4D1IA 1UD4A 4EXAA 1KD0A 1PX3A 2E77A 3S6OA 2VKZG 1FOBA 3M07A 1UA3A 3VOGA 3UYCA 3KAOA 3PTMA 4CNSA 2WMKA 2FDMA 3SB0A 4L4PA 3NSMA 2NQ5A 3GYEA 1P6CA 3N34A 3VDHA 3MP4A 4Q8TA 4KS0A 2QAFA 1F6YA 3KP1A 4X22A 3NWRA 1BKSA 2CXGA 3AU6A 1JR1A 3GFYA 1NOFA 2R91A 4Z0JA 4D6CA 1V51A 3MP3A 4GJJA 2Q8ZA 3L12A 4A8RA 3ZIZA 5KZEA 2NLIA 4MNKA 2P3EA 4ZZ9A 2TODA 4C6DA 4YIWA 1EGMA 2W27A 3ISIX 1FWGC 4MFEA 3GIYA 2GQ8A 2FJKA 2WVSA 2FH8A 3VOFA 5C9RA 4FMVA 3DHFA 3PJTA 4I5UA 3T44A 5AHLA 1KW1A 3TVAA 4E5TA 2V81A 3GD6A 2WVTA 3OZMA 2CHOA 2CLEA 4G6CA 2YW3A 3RMEA 3WF0A 2RKXA 1N82A 2E5DA 3PN8A 2GYIA 3VPLA 1AODA 3AZSA 3B0YA 3UR5A 3MDUA 1B3ZA 3OIHA 1W9PA 1J0ZA 5A2AA 3WK3A 3M7SA 3GDLA 1OADA 3SZ8A 2X42A 1SGJA 3BUVA 1S2AA 3TTOA 3C52A 3P6LA 1GPFA 1E6RA 1MNZA 1EF2A 2CIPA 4DXKA 1FCUA 1WO2A 5DLCA 5FJUA 1LROA 3PBGA 3A4JA 2Q09A 2QNEA 5CPTA 2YDQA 3MI3A 3AYRA 1C8XA 2POTA 1VPYA 3R10A 2PTYA 2NVCA 3ORWA 2Z1BA 4YWSA 1TJ2A 1RP9A 3AXKA 3M0LA 1ZGDA 2J7DA 1OBAA 1VENA 3CU2A 4D6FA 5EKYA 1Q65A 3L9CA 1XBZA 3P80A 4KFOA 1O94A 4RPPA 1OC7A 1XIGA 4DAFA 5IFTA 2WC4A 1E6SM 1ZFJA 3GUGA 3F4VA 3JZUA 3F5JA 3K1DA 5RUBA 5LIWX 2Z0IA 2HBXA 3M0ZA 1CXIA 1WDPA 2JKAA 2VNCA 1FX6A 3QEZA 3L65A 1WQ5A 3C2RA 4ATLA 2QDHA 4I9MA 4DJDC 2Z29A 3CHEA 2Z24A 3FW6A 4QSFA 3UY7A 4QLJA 4WQ6A 3NEVA 3HG2A 2VGFA 3IS4A 2PWEA 2Z00A 4ACYA 3WLHA 4GFSA 3FK4A 1PS9A 2A3AA 1Q13A 4KFPA 2JF7A 1TPFA 4PTMA 4NZ5A 5LIYX 3OZOA 2R1NA 4L6HA 1H5VA 3R11A 1DXIA 1W3TA 3I3DA 1H7WA 3KFTA 3VGGA 5FACA 2X2YA 1MEWA 1UBSA 2E5CA 1TVPA 4WGXA 3MUZ1 4GYFA 2V2CA 3THAA 2ANUA 1E4LA 2P88A 4UTKA 4HJFA 1XLAA 4IZGA 1J96A 4OBTA 1WDSA 4PYSA 4AX6A 3S6DA 4ACZA 2ISVA 4PSRA 3AIQA 3WQ6A 3W7LA 2V69A 5FJPA 5I3IA 3O0FA 2FMOA 3PPFA 3HBLA 3LNMA 3RAOA 4PCPA 1EXBA 1D8WA 3C2EA 2P1FA 4R53A 2HE8A 1REQA 5E9AA 1YTDA 3M9YA 4MKNA 2ZTKA 2XVLA 4CQCA 2A6NA 4JTLA 1UUMA 4XISA 3ARSA 5DBUA 3EWDA 3M5ZA 1THFD 4H41A 2C16A 3SQMA 3W24A 5D2YA 2CFFA 2PTZA 3TFXA 4FR6A 2XYLA 2X30A 1X6NA 3C3NA 4B5VA 5J04A 4XUGA 5IHSA 2EG7A 2ZZ6A 1RUSA 1LZOA 3QR3A 1KTNA 1LL6A 1XSKA 1IEQA 4B5TA 3HQOA 2WHJA 3N9RA 4IQLA 1KWGA 4F0HA 1LLWA 2E8ZA 3HPZA 3MZ2A 2OEMA 2NQJA 1W2PA 3SCOA 1CXFA 1A53A 1UH3A 4LBUA 1ZRQA 2Z4GA 2YKKA 1HKJA 4PUMA 1VEPA 4N0RA 5KZDA 3S9YA 1YBQA 4QAIA 4FLQA 2CLIA 3UEQA 4LVAA 2CZFA 2JK2A 4TVUA 2Z2UA 1XINA 3W7GA 2GVYA 1E6XM 3SGGA 1JDDA 1S5NA 4C6BA 1F3XA 1R3TA 5F2IA 1OINA 4DI8A 5K3VA 1YDOA 1XRTA 4BJHA 5F4WA 2F2KA 4YWIA 2HVOA 1E51A 2OQLA 3QOKA 3SY8A 4CQ9A 4NL1A 1EC8A 2OVLA 1S38A 2E7FA 4MF4A 4AEOA 4AXNA 3L4XA 1KCXA 2QCDA 2J7GA 2VQUA 4HNTA 4O52A 3NPUA 1A5MC 2WVVB 2EPNA 3ZLFA 5LKYA 1KM1A 1N8IA 4O0KA 3H6OA 5D38A 1P6BA 1NF7A 3WD1A 3ITTA 2ACRA 1W1VA 1I6NA 3EKZA 4OQVA 3N2CA 3WLOA 2VMFA 3W83A 3QYSA 3W2KA 5A2CA 2X41A 1VYRA 3GRIA 3E5BA 1IF2A 2HISA 4N6FA 4PRWA 1HGWA 1A0DA 4X60A 4UR7A 1E1CA 3GQYA 2ZRVA 4H9YA 5CZTA 1LBLA 2WO5A 1DJNA 4O0ZA 3WMLA 1XUZA 3DCPA 3P93A 3EB4A 3CO8A 3UPWA 2VRKA 2YSWA 1AJZA 3DOPA 1QWGA 2AL1A 4RV8A 3WDJA 3KOXA 4S3JA 3H24A 4K8EA 1MRAA 2TAAA 3CV2A 1YXYA 1UBPC 2F6UA 1ODUA 1HO1A 3CWHA 4MDOA 2YW4A 3UCQA 5CC6A 5DF0A 3KTCA 3W76A 2ZZ3A 3BV4A 3VD3A 3ZOAA 1VF8A 1XCXA 3QGKC 3BAJA 4M6UA 4NASA 4LAOA 2ZX9A 2VRJA 1XYFA 5A6KA 1F8IA 1N2VA 1TWDA 3QQ0A 1Q4NX 4MNLA 1HO4A 3ZWSA 1V6TA 1WKDA 1H0GA 3WUFA 3LCHA 2ZUWA 1E56A 1FP8A 3VD5A 1W2VA 1ZJBA 2PZNA 1EP1A 5CJ5A 1HJXA 2X7VA 4W88A 2X7WA 3PS7A 2PF0A 1U22A 1TG7A 1YLVA 4YVVA 3QPZA 2FTWA 4L5ZA 4W93A 3URNA 3KOWA 3G6MA 3L2IA 3HU7A 4JFUA 1OK4A 4YTRA 2O9PA 1QOXA 3IIXA 1R2TA 5MKGA 2INZA 4MWAB 5JQ9A 4I5XA 1LL4A 4DNMA 5D32A 5M3WA 1BXBA 1LQ0A 2C1GA 4C91A 3A24A 4DZIA 3KWXA 3B9OA 5DQPA 1L2UA 3MSYA 2XM2A 3CYJA 1I1WA 1JPIA 1QI4A 1IIHA 3BMXA 1ME7A 4LCQA 3MWCA 3D47A 1C7TA 4Y9MA 2WM0A 3IK2A 3LERA 3K4AA 4JZ5A 4GGHA 4GABA 3CPRA 4MJZA 3QVQA 2Y7FA 3QXBA 1BG9A 3WFZA 2QCCA 1XIFA 3DESA 4P8UA 5K9DA 2MANA 3REQA 3VIHA 1L6SA 3AHTA 3CIWA 3GKAA 1BYCA 3AXMA 2PC8A 5D03A 3VIOA 1XC6A 3EKLA 3KOFA 4BI6A 5LA0A 4WZHA 4MDPA 2E28A 4XKMA 3OQ8A 1RD5A 3VCNA 2PDCA 1JVNA 3ARQA 4QE5A 4UFKA 4IGHA 4WF7A 4IT1A 3OVPA 2WNNA 3FLUA 3EA1A 5E9XA 3WD3A 4H9UA 4QDWA 2BG5A 2ATSA 3E74A 4ZSUA 1FWBC 4IGSA 3N29A 3MA8A 3T0BA 1G7UA 1KGUA 3LGDA 3LLDA 3SN4A 1NIUA 2BNJA 5B7YA 3B40A 3T09A 1ODZA 1VJIA 2PDIA 4HZ7A 1NJJA 3MHFA 1X7FA 4AY8A 1CNVA 1W5OA 3FY1A 4DZ5A 3IGHX 1TKKA 5F1UA 4AG0A 3WZ0E 2NXHA 3WBEA 1ZBWA 1SSGA 4LWWA 2KZHA 3KTSA 5I23A 1RJRA 3PAJA 1ISYA 2Y0FA 5ABFB 5BOEA 4H9TA 4L56A 4A05A 1QOPA 4DUWA 4XD5A 3LLXA 1OJXA 1F3EA 2ISFA 2XIMA 2QEZA 2JEQA 4Q7IA 2ZFAA 1UA7A 1U1HA 1WDRA 2H8XA 1XG4A 1ITUA 3W02A 5I5RA 5E6ZA 4UB9A 3BLLA 3TA9A 4KCUA 1FTXA 3W81A 2PDHA 3KE0A 4HU4A 3U7VA 3T4CA 2FHBA 2DH2A 4ERIA 4KBXA 4CQAA 2J9YA 3EMCA 2GK1B 2VL4A 3W22A 1CENA 3H22A 5A2BA 1WDDA 3GZAA 4H9MA 3CZGA 3I4EA 1XXXA 4JFTA 5H2ZA 4PGLA 4M7TA 5D09A 2CHNA 3NEHA 3R79A 1AJ0A 1PIFA 1XH2A 1M68A 1UMYA 3AMGA 3EKGA 4UWMA 4B15A 5EFFA 3Q65A 1BTMA 4LYQA 1JF6A 4I7VA 3DGBA 4Q33A 1R3SA 2ZRWA 1XLFA 4TTGA 3FSTA 1IWAA 1CIUA 2G95A 3E2RA 1QTWA 1RBLA 3C0SA 3OGRA 3TW9A 3N17A 3A5VA 3II1A 3BTNA 1SO3A 1RP8A 2GWNA 3SJ3A 3VOIA 1F5ZA 1HGYA 1OX5A 1PIGA 2BX7A 2RUSA 3CEPA 4PCNA 4FX7A 1BXCA 1Q6OA 3N12A 1VKFA 2FVKA 3W7JA 4ZXLA 3AC0A 5G1YA 2Y8KA 3MMUA 4HSOA 2V63A 2VO5A 1CZ1A 5IBXC 5E0FA 4JTQA 4GCAA 1BYAA 2J78A 1W3HA 2H90A 2XWEA 4AZCA 5CPQA 1M6JA 3PUDA 4A3RA 2XWDA 1D3CA 2VEFA 3RRXA 4GK8A 3K30A 1OSEA 3VNJA 2WLYA 3S8HA 1GYNA 4H2CA 3TZFA 4UFMA 3BCDA 4P8XA 4LUTA 1DIOA 4TTUA 4C1LA 5EB8A 2J7EA 4YCOA 2G3FA 4QROA 4TU1A 1QNSA 3W4RA 3BPWA 4XZWA 1AQ0A 1XWYA 3LENA 3R1ZA 3LXBA 1XGZA 1E6QM 3G18A 3OHIA 4Z2LA 5T8GA 5L9FA 1MQRA 1JDCA 1XYLA 1JZ6A 1RQHA 1GOIA 1F74A 3CYVA 5CZJA 5CZ0A 4XBJA 3DG3A 5A69A 1AL8A 1UUOA 5TIMA 1E5NA 4JTTA 5AY7A 3DZ1A 1SVDA 3PY2A 3Q67A 3SCUA 1L9WA 2C19A 4RR4A 2VCBA 1C93A 4Z1DA 3T6CA 1V0MA 4Z2IA 1F05A 3TYDA 1XV8A 1LTDA 5HMDA 3TJ4A 2NZLA 2OZ3A 2XSBA 3CUHA 1GK8A 4JS3A 1GT8A 4R9OA 2ODOA 2INFA 4OOZA 3CC1A 2DZSA 4G8TA 3U5YA 3U3HA 1S1PA 3BO9A 4D6JA 5LXXA 2VEPA 4DO4A 3R8GA 4RNJA 2PWHA 2ISDA 3EOOA 4CU6A 4ILSA 1EEXA 1KFKA 4PZVA 4NKCA 2R24A 5E0CA 1XPGA 4P7RA 4G1KA 3XIMA 3CTTA 1VBUA 4D6DA 4PMRA 6REQA 3CHDA 1DJHA 1IR2A 2Y7DA 3BAIA 2WVUA 4DB7A 5C9XA 1QW7A 3L5LA 3NOEA 4DF2A 1I4NA 4S2CA 2V5JA 2UY3A 1CW2A 2QV5A 2I1OA 1JPHA 3SI9A 5AC6A 4HPNA 4QE4A 4PMVA 3RK8A 4AY7A 3WH9A 3WEMA 5AECA 1KXQA 2PFHA 3QC3A 4E4UA 3BMWA 1DWAM 1V7YA 4WSHA 3GNNA 3V0SA 4UMBA 4Z2KA 3CZJA 3ZJ7A 4FNPA 1XCFA 4DVOA 4HU3A 4WCJA 5ABTA 2EJAA 4P5UA 3CGTA 1R9ZA 2Y7EA 5BXSA 3IJQA 4F9DA 1V02E 5CPNA 1CWYA 3BZJA 3KZPA 4E8CA 4W9TA 4ZSTA 2BZNA 3AIVA 3UD6A 1Q6FA 3QY6A 4WDTA 2HEJA 5BRPA 4NZFA 2OLHA 2BVDA 1V6YA 3SW6A 4IPLA 4AUBA 1U2YA 1EJWC 3FN9A 3P60A 3BLKA 4EVZA 3ZFHA 6TAAA 4X63A 5A3HA 1HKMA 3OQEA 3VE9A 4FIQA 4I8YA 3GC5A 1AQFA 4JQ4A 1KCLA 1RBOB 3U7BA 1OF8A 3TQKA 3S3GA 4PODA 4F0LA 4QEEA 2WSQA 3AQUA 2BWGA 3W86A 1FRBA 4DWSA 2HTMA 4QRNA 1H5YA 4O16A 2J75A 4C6IA 4TV5A 1DWGM 3OODA 2EF9A 3BANA 3CUJA 4KWUA 3EMQA 4XB3A 4KEZA 5BOOA 2J7FA 2FZDA 3QPYA 1XLDA 3KHJA 3EB2A 4IHCA 2OXNA 1R3YA 3TNOA 5I6SA 2BY1A 2D23A 2EPHA 2WMJA 4ZTXA 3NDZA 5CXPA 2HK0A 3W1PA 4H9XA 3WJXA 5K9XA 2D2OA 4DBDA 3N19B 1S5MA 3W7OA 4H6QA 3L4YA 2DV0A 1FH7A 1T8XA 4GUHA 2DZXA 4N6EA 3IPWA 1WZMA 1UD8A 4H9VA 3SSJA 1V3KA 5AYZA 1TPWA 3CT7A 4RX0A 4V15A 4CD8A 4DLFA 1JYVA 5AHFA 3MHUA 3FYYA 1W9VA 5HOSA 1X98A 2O7QA 4PBEA 1QNPA 1BVWA 3AU2A 2D2GA 4WDXA 4FOKA 3DUGA 1RPXA 2YCLA 4FXJA 3QF0A 4GKTA 3AISA 4WD0A 1XIBA 3QW3A 1XS2A 4R34A 4B92A 2VEGA 4ZVJA 3NQ8A 4ZL1A 2WC7A 2ZA3A 3DYPA 4YN5A 3O7UA 4AWTA 3NQ7A 3KRUA 4RZ6A 1QR7A 4F48A 2IPJA 3LQLA 2YBTA 1W54A 3I4KA 2ALDA 4GIRA 2NUYA 2IKHA 4L64A 5DY2A 4M5PA 3AIBA 3MYOA 2OOFA 4XIAA 2FVLA 3TN5A 3AYTA 3F5KA 3F2CA 2BASA 5BRQA 1FCVA 1NWRA 5XIAA 2CBUA 4D8LA 3A64A 4O8AA 1TREA 1YEYA 1TELA 3VKJA 2RDTA 1J9YA 3U57A 3DC8A 3L4UA 1YDVA 1FP9A 1PUDA 2YDSA 3FAWA 3NZRA 2QULA 4JBRA 4C90A 2EPKX 3GIPA 1XSJA 1UWSA 4NAFB 2PRMA 3CLWA 4H9ZA 1PAMA 2YJQA 4FHAA 1CGXA 2Y89A 4DQWA 5CH9A 3VC5A 2O0TA 4LFYA 2CEQA 5AB3A 4ZTYA 1TRIA 4KWSA 3W27A 3WDRA 5FIPA 3DENA 4ACZB 1GEHA 1KLYA 2NWRA 4JX4A 3CQIA 3FGCB 4AIOA 3EDJA 4YMZA 3C86A 4C6OA 4CU7A 1C92A 1ME8A 3CWOX 1K02A 2WKJA 1HL2A 3N6JA 4J40A 4P7LA 4AC7C 1PJ9A 3CUXA 3QQ1A 3OGVA 3TN6A 1NEYA 4ZQCA 5HJLA 1REQB 1NFPA 4TX6A 2O92A 2BOEX 5HPOA 1GKPA 2HPIA 1W5MA 3DEQA 4BQ2A 4WJXA 4RE2A 3OIXA 3AS1A 3EDDA 1TV4A 4PE8A 3M16A 1JEZA 4LXFA 2A3HA 5AHNA 3GVWA 4US6A 3OP2A 2A7RA 2QIIA 3LMZA 2F38A 3BOFA 3M0MA 4C5YA 3GDRA 4KESA 1CXEA 1M7PA 4AIBA 1ZL1A 4RE4A 1PCKA 4AD3A 4GPNA 4DNHA 1DBTA 3L4ZA 4QITA 3QSRA 1VEOA 5FJJA 1NDWA 2WHMA 4MY8A 5FL0A 1QNVA 3WQVA 3KVJA 4WX2A 1WOAA 4O1DA 3GW3A 1VFOA 4KGLA 3V16A 1BTCA 2ZKMX 3WF4A 3HG5A 2VJXA 3CHFA 3GNDA 4CQDA 4EWJA 1SM9A 5XIMA 1O6IA 3AMLA 1Q8JA 3IIPA 4B91A 3ARVA 1MVYA 3VDCA 1J11A 3HURA 1A4LA 1LQAA 4KCVA 5JBFA 1P0DA 3T8LA 3VD4A 1ADDA 3P0XA 3TUUA 4N42A 1YDYA 1DJGA 1MFVA 3LCWA 3MW7A 1TIMA 2Y62A 1AMYA 4IL2A 1DV7A 5AC7A 3KW3A 4M1RA 2CC0A 3GDKA 3O07A 4JIPA 3FOKA 3NYZA 1VIWA 2V30A 1LT7A 3OVRA 4DF1A 2QCDB 3PK7A 1LOLA 4UBPC 4AC1X 2CZVA 3PBUA 2Y5JA 5A6BA 3EAUA 4O17A 2B7QA 1NFGA 8RUCA 3NGJA 1E0VA 4KRZA 4CNPA 1T5AA 1QASA 3V1HA 4Y9PA 3F2DA 2DZUA 3BK0A 3K8LA 1SW3A 1US2A 5EMUA 5BXTA 3STCA 1HZYA 1Y5XA 2Q01A 1D9EA 1E1CB 1UWRA 3LGGA 1PO9A 3WD0A 3SADA 1B4KA 4WGHA 1YE4A 4PUJA 1ISWA 4GIYA 4I9TA 7ENLA 3WLSA 3H53A 4BQ4A 4LUSA 2VZTA 2Y8VA 4KEMA 4V1XA 1B30A 3ID7A 3G1AA 4DXXA 3A4XA 9CGTA 2QIWA 4MG4A 3ZS4A 5T9BG 2V67A 1CT5A 2ZUMA 1GOMA 1Z89A 1H7PA 1H0IA 4EE9A 2HE5A 1PBGA 3T05A 1GVYA 4AMCA 1VD6A 1Q6QA 2BXZA 3Q2DA 2EXOA 4FF5A 2OZ0A 2ESCA 3W38A 3NQVA 7XIMA 3ZLHA 4MB3A 5KEZA 4RPQA 5JH1A 4L1GA 5CPSA 4HZMA 4U28A 4H8VA 4WOQA 3DFSA 3QR1A 3WLKX 4UFIA 3SUSA 3NPWA 3ZM8A 5CPMA 3VGEA 3G1HA 1YHTA 3PULA 3VZXA 1JYXA 4LU0A 3S5OA 3KHDA 3HG4A 3MUXA 5A8OA 5GNZA 1ALDA 3VILA 1UWAA 1MUCA 1J5TA 4AIEA 2FJUB 3LI1A 2JALA 4IQDA 4MPQA 4G7EB 2E8YA 2VQTA 3OOQA 3B9DA 4LF1A 5H6HA 2AL2A 1KQYA 5JUVA 1A5LC 2H9AA 4X61A 1WKEA 1XI3A 2I17A 3R7MA 4RXFA 4H7ZA 3EWZA 3T0CA 1JI2A 4GYJA 3R8HA 3PUOA 4Q8NA 4AQLA 3W7QA 5LHEA 4AYGA 1B3OA 3SRHA 1PKYA 4P7OA 3LX9A 3LGEA 2P0IA 2TSYA 1XBYA 1ADOA 3UG3A 3BSMA 3MDWA 2QPXA 2E6AA 4NXSA 3DFYA 3VCCA 1FKWA 3TR9A 4XAFA 4MAZA 4B2DA 1ZY9A 2HBVA 1QI2A 4V1YA 1M7XA 4AISA 2HDJA 3IV8A 1W3IA 3UWQA 1YNYA 4IG2A 5CGMA 4IICA 3IUIA 4AD5A 3TTSA 5LIXX 1G9HA 2JKPA 4BF5A 5ABHA 1X96A 2I57A 2ZX7A 4YYFA 2WMIB 5FI8A 2GGJA 1SZRA 2C15A 1WXZA 1A0EA 1AK5A 1N8FA 2WOQA 1HJSA 1LCOA 1K7FA 2RFGA 2VXNA 3SCNA 1TWWA 1V3LA 4MB1A 1XRFA 1FWSA 1TWZA 4JDYA 7ODCA 3IJ9A 3E0VA 1HXJA 2DVTA 1CGWA 1F7BA 1H1YA 3VIIA 4GQQA 2WQPA 2YB1A 1E3ZA 3EX6A 4C65A 2BP1A 1DYSA 1BVZA 1FXPA 3UJRA 3SECA 1VFSA 3M41A 1EEPA 2PD5A 2XISA 4AF0B 2XDFA 2OO0A 1DORA 4DPQA 3PM6A 4LYPA 1K6WA 4CNOA 5CC7A 1LOSA 4JEJA 4HZ8A 1KLZA 1XYAA 3LPPA 1ISVA 2V5CA 5DELA 4DUVA 3G1RA 4BS0A 2XSAA 2GGIA 1E4MM 1CGTA 5HNNA 5IDIA 1TA3B 5LNVA 5G4EA 1G4EA 3VC6A 4G5DA 1J2WA 6TIMA 1PX8A 2J6VA 3DI0A 2JIEA 1JIBA 5A8PA 2FZNA 4HHMA 3W71A 5LIKX 1WE5A 4O13A 1ZTVA 4HYRA 3S83A 2ZE0A 3B9EA 4YTSA 3TYCA 2W9MA 1TQXA 5FSEC 4GIEA 1UZHA 2JEPA 1Q6DA 3VKAA 2VR5A 1RHCA 3COTA 1JUEA 1XDMA 3LHZA 2E1DA 4JY8A 2OLSA 1VYPX 3STFA 2Q02A 4POCA 3A22A 3WK1A 3VDGA 1PKMA 3GXIA 1MFUA 5H1WA 1OCJA 1B54A 5EMJA 4DWSC 1TV8A 1V79A 3TAOA 4MWAD 1LBMA 4IIBA 3V0TA 2P76A 1O4UA 3GG0A 4TR9A 1DQXA 2R6OA 4B4HA 1ZAJA 1TZZA 1UWIA 1UJPA 1W3JA 3NGFA 2QDDA 3FFSA 1VPXA 2V3DA 4U5IA 4FIRA 1M01A 2XVPA 3CUFA 3PHAA 3IJ6A 1EYWA 2UBPC 5DMLA 3PSWA 3GTFA 1HQTA 1IXPA 3LDVA 4GUJA 2W67A 3LI0A 4Q6JA 1V3JA 1GGOA 1QJWA 1FWIC 5AC5A 1DJYA 5D30A 3KXQA 4FNQA 2EG6A 4GXMA 2JF6A 3G22A 3PJWA 1NELA 3WBYA 1B2YA 1F2JA 4A8LA 1K70A 3S2LA 5CC5A 2A0NA 2G0WA 2E4TA 4O1EA 3VIKA 3SSZA 3EOSA 5BCAA 3WQCA 1JAKA 3MV11 4O54A 2A4AA 4H83A 1KV5A 3EOEA 1DPMA 3KVLA 1QO2A 4BF9A 2PDGA 5U7SA 1XH0A 3RN6A 3S5ZA 3MANA 1ZNNA 4ZB0A 3BZGA 4UOZA 2Y24A 4E3VA 4J5NA 1E6NA 1TV3A 1OWQA 4NRRA 1F73A 4ATWA 4PMDA 1LLZA 4OVXA 3EPOA 1TE6A 3A3WA 1JGMA 1JRCA 3S46A 4GY1A 4PUWA 2QS8A 3N9KA 1CGUA 5E1QA 4GVFA 1IT8A 1YXDA 1OX6A 2PP0A 1UYQA 3Q94A 3RX2A 2NUXA 3FSUA 4MWAE 1BWVA 4CKQA 2ZZ7A 4NX5A 3L4TA 4AAJA 5FESA 4MOZA 3DFQA 3UJ2A 5F7UA 2GDVA 2QGHA 2WB5A 3GW0A 4J35A 1VQTA 4OTKA 3TSMA 4E3TA 2QUTA 3T1GA 3INPA 5FF0A 1R47A 4NXKA 4BWLA 4FOJA 4GWEA 1A5OC 4IF2A 3K13A 4GI9A 3WQGA 4EXBA 5CLWA 4R9XA 4ERAA 4NILA 4X2PA 5EMMA 4NZJA 2NQHA 1W9BM 1JGIA 2FZ9A 3LY0A 3WQFA 2PB1A 3WBWA 3BLDA 4F0RA 3UPMA 4ZB5A 4RNIA 1RD6A 4Q4RA 2H8ZA 3FEMA 5EFDA 2WZHA 1ICQA 3H4XA 1GG1A 3VIPA 5FJOA 1XYBA 2UY4A 1KCKA 1R3RA 3ZO9A 4GFIA 4NU7A 4KF1A 1YRRA 2F2HA 3FA5A 2HXUA 1VC4A 4UTWA 2J8FA 2Q71A 3C3UA 1W31A 3NA8A 2PF8A 4JNYA 3M6YA 1CGYA 3C5QA 4I5RA 1FH8A 1ZCOA 3VMPA 4LF2A 3TCEA 5LA1A 2WZIA 4C1NA 2TYSA 4YHEA 4MJMA 2BB0A 4QLKA 4LUIA 3S2MA 1Q2SA 3UWUA 4R33A 4IMCA 1K8CA 2DIEA 2F61A 6REQB 3EX3A 3O6AA 4XZLX 2XGIA 4KIEA 3WH6A 4DJFD 3WF3A 1Q85A 1E0TA 2OZTA 4AZ5A 1GQKA 3MTWA 3P2VA 4XZBA 3B8VA 1R85A 2X0HA 5HNUA 1RSCA 3QZEA 2GOKA 2AMGA 3IEBA 3ES8A 4NYUA 1KV8A 4FZIA 2WWDA 4I8DA 4YTTA 4ZFCA 2HS8A 1A5KC 4I9AA 5A6LA 1MXGA 1LP6A 4D9PA 2GUYA 4XQ6A 4J3UA 5HAOA 3R89A 3CHCA 3KX6A 1PZ2A 4DUXA 3WQOA 1W1ZA 3EOLA 4ONVA 4AX7A 3VM7A 1MDLA 1G5AA 4ZCWA 1O1ZA 4A6GA 2CKRA 1WCGA 4MY9A 1O5QA 4NVTA 4GX9A 4AVFA 3H2CA 1F8MA 4ZQRA 1HJWA 2VD9A 1RAKA 2Z6JA 2VX4A 2ICSA 5E09A 2A1YA 5KINA 2A3CA 2PBGA 4LYKA 4GVGA 4QHRA 4AZIA 5JVLA 1FWNA 2ASHA 2EQDA 3KP0A 3LPFA 4WY0F 3U48A 4WVXA 4S3BA 1RCXB 4DJED 2DFAA 3ATYA 2BY0A 3AWOA 2QUMA 4HGXA 3RPDA 1GOQA 1OX4B 4ZQNA 1B3XA 1XLJA 4J4KA 2CLLA 4NSBA 2B7NA 3QY7A 1M65A 2OG9A 4HA4A 2DZWA 1J12A 4HN8A 3OLDA 4O1FA 4Z1CA 3AOFA 4DXVA 1R6WA 4S3CA 1S3HA 3TYAA 4TX9A 3R0UA 5ECUA 1TE1A 1TMLA 3RCMA 4JTGA 3RILA 2Q8XA 4QM1A 3KCJA 3VAVA 3SFWA 4R88A 4KCWA 2A6LA 4H6EA 2C71A 3MVIA 2PWUA 1G0CA 4FNSA 1GPWA 4X3ZA 1UP2A 4HCHA 4W86A 2TMDA 2DEPA 4Q8PA 3NQ6A 1P48A 3LCLA 1TCDA 4C6MA 2VELA 3P0WA 3K1GA 3HQNA 1KRBC 2QHAA 1WBJA 4GCXA 5DRCA 4N4QA 2Z1VA 2IKGA 3H2OA 2FIQA 5T9CE 4GOAA 2P5NA 3HQ1A 4GI6A 1YYAA 1ZAIA 2V2HA 2VC5A 1R9XA 3F2BA 3UZWA 3WNOA 3TR2A 3VI2A 3ZR5A 3LRMA 1OK6A 4RLIA 3OO2A 3AS2A 3UWEA 3G1FA 3QTPA 4G2DA 1PCWA 4YPJA 3D5HA 3NL2A 1BPLB 4IQEA 4GBDA 1CXLA 1ECQA 1WZKA 1RCOB 2QT3A 2XFFA 4E4PA 3RO8A 3ARRA 3LBMA 4E8GA 3W6YA 4TMBA 3I7SA 4PFMA 4HN4A 4M6PA 4C60A 1IXOA 3IARA 4IFKA 3H2FA 2V38A 1XLIA 3MMWA 3EWUA 3HPXA 3W28A 1V0NA 3NURA 1MZRA 1Y0EA 4DBSA 1DWHM 1OF6A 1W0MA 1EWDA 5I77A 3OJGA 2GDUA 2WHKA 2QCFA 3W7RA 2D1ZA 4DO7A 3BJFA 9XIMA 1LF1A 4MYAA 4EOUA 2VZVA 3TYUA 1SJBA 4C7DA 3E49A 3N1AA 4QJ4B 3PZQA 2V9DA 4ZQPA 3ICJA 3IAPA 5ECVA 5B80A 1YTKA 3ANUA 1W5PA 4F2UA 3D3AA 4U33A 1JZ3A 1F6KA 3VNMA 3UW6A 2BTMA 1XG3A 1KFLA 1YX1A 5HDRA 3F7JA 4M8UA 3RXZA 3KL5A 4MTVA 3NQMA 2YL8A 5EU9A 2I5IA 2UY5A 4WKAA 3D6NA 5F1VA 3FNDA 1MUMA 1X6LA 1KRMA 1EQCA 3NO3A 3R6IA 3TA6A 3WD2A 2E9MA 3FCPA 3WUBA 4QS6A 3TONA 1UR2A 3CQJA 1V6VA 3C2YA 3QKEA 1LYXA 1FHDA 4JFVA 4ZXOA 1UIPA 3HM7A 5M2FX 3H12A 1M1BA 3B8IA 3PZGA 4JAWA 1DWJM 3MBFA 2PP3A 4RDYA 1H1NA 2ZRZA 1XLBA 4GO9A 4IISA 4HTYA 5J5RA 3AS0A 3H23A 1C90A 3GUWA 1K4GA 1E73M 4D6IA 4CCCA 3WX7A 1MDRA 1CX9A 5HMFA 3QGVA 2WLZA 2YLAA 3EX4A 3MJMA 4CN6A 4IIHA 5HPCA 1K8YA 3QHOA 1KFCA 4XV0A 3O9NA 2DU2A 3LK6A 5C9UA 1PVNA 1M41A 3MMDA 3HIJA 4WEVX 5BU9A 3WKZA 4UXDA 4NJGA 3CAQA 3IWPA 4YNGA 4D6HA 4DJDA 4FXFA 4DF0A 1XQKA 2E6FA 3MV01 4LSBA 3P61A 3HFTA 3I10A 2PBOA 3B06A 1UKOA 4UNIA 3RCNA 1RCQA 2L5HA 4PULA 1T96A 4LTSA 4AWUA 2Y6ZA 4RXGA 2W6RA 4IJRA 4CU8A 1EA0A 1PKNA 1XLCA 2XPKA 2ZUNA 3ALFA 3EMZA 3WCZA 3BLEA 5CC3A 1KBIA 4JN7A 5B7ZA 3T40A 3LZ3A 4M56A 1EUAA 3CQHA 1ZLPA 4UFLA 3TC3A 2NQLA 2OFJA 1XD1A 2YYTA 4PMYA 4ICMA 1NP0A 1LRQA 2HNEA 1YIXA 3B3DA 2A5HA 5CSSA 1ZCCA 1P0EA 4GQ0A 3VKDA 4J9JA 1D7FA 3OBEA 2FGBA 3QMTA 2C91A 4D8AA 3BH4A 3DECA 3QPEA 4FNTA 3NO1A 3LHYA 1BWLA 1PYMA 2GJXA 3VNLA 1J2BA 3BICA 1H63A 3MKVA 2A7NA 3TMLA 1Y65A 2V0TA 2QMJA 1BWKA 4HA1A 1WP6A 1N7KA 3L66A 3DX5A 3GVGA 3GHTA 3VIGA 2DUAA 4IMGA 1M04A 3G3MA 3GZ3A 3GR4A 3TJIA 3UWZA 1OM0A 4UQBA 1TV5A 1EFZA 3DFPA 2ZRYA 3FEQA 1F3TA 1I60A 4GE8A 1XYCA 1DIDA 2ZUUA 4JQ1A 3AJXA 3BCFA 3HB9A 4AB4A 1Z44A 5I3KA 4PTNA 1A80A 1DQUA 1SR9A 1EP2A 5D9PA 1FQ0A 2YFNA 3MB9A 1NWSA 2QUNA 5CZSA 4LQ1A 7CGTA 3N2BA 2QW5A 3CHVA 1JQXA 2WNWA 1Z6KA 4QDMA 1EF3A 2BVTA 3L23A 4JFWA 1CBGA 4G9PA 3CO4A 4GG9A 2YXXA 4R5EA 1K9TA 2H3DA 4H6RA 4EKJA 3L0NA 3KL3A 3IV3A 4AEFA 2QMKA 4M0XA 2W79A 1B9BA 4OE7A 4GZJA 1AA1B 4GH3A 4RW3A 4HSHA 4B3LA 2A3LA 2YL6A 3PPGA 3WLRA 3TW6A 3PR2A 3MYPA 3OEXA 1Y7VA 2VX7A 2VENA 3H4GA 3WK2A 4F79A 4G56A 2Z25A 3RMJA 2AGKA 3WBXA 4Y9AA 1W8SA 1C8VA 1VLWA 1VBRA 3UETA 2XIJA 2BXYA 3CV7A 4UNLA 4WR3A 4LNCA 3UBPC 1D8CA 3W1AA 4H4IA 3P5ZA 4QJ3B 1BAGA 1ITQA 2HMCA 5C7VA 1TR9A 4O1CA 2X16A 3M1ZA 2CETA 2X1RA 3R43A 4XAYA 3LTYA 3G1DA 2BGNE 2Z2BA 4NJIA 2XZ7A 3O1NA 3N4AA 4DBEA 1MW3A 1QI5A 3ABRA 4LV4A 1TJPA 4PRTA 3FHAA 1D3HA 2XZ9A 4Q22A 3N3TA 5LHFA 2BV9A 1DIEA 3MI2A 4K39A 1CEOA 2GFTA 3KEHA 1Q7ZA 2G50A 1WNOA 3W88A 2ZDRA 1XBXA 3B03A 4S2BA 1GW1A 1VFTA 1UOZA 1SZGA 2J13A 3WMBA 3QGAC 3ZVIA 1KM0A 3EDEA 1KR1A 1O68A 3M5YA 3F4CA 3C8FA 3PBVA 3GDTA 2C0HA 4FS9A 1H09A 3TYBA 5AC8A 1JYWA 4IM4A 1PWMA 1U5VA 3UJSA 1IQ8A 3WQ4A 1G6CA 4GVIA 4B3KA 2P53A 3IJDA 5TF0A 3DERA 1YXCA 1ZBCA 1FFQA 4HIBA 3W1LA 2XN1A 1OT1A 2VGGA 1X8CA 4IMAA 1H4PA 3VFLA 4FSAA 4JD4A 1MZHA 2VDHA 4IP5A 3FJNA 2YPIA 2J77A 1GVRA 1DHKA 5F2LA 1E71M 5LGZA 1X38A 3SFKA 2DW6A 3DFOA 4GVHA 3HV9A 3CPGA 2BHUA 3BLFA 3VUSA 4NYYA 4ZR8A 1GJPA 3E2QA 1HNYA 1EQPA 1JL8A 3WELA 4QJ1A 3S2JA 3AXXA 2E6DA 1FFRA 1GKRA 3ME3A 1E4NA 1J8VA 3LCFA 2OLAA 3HMJG 3VNIA 2PPGA 2OO6A 3VXGA 2E40A 4RCXA 2JGYA 3VMNA 2FMNA 1NWUA 1KRAC 4PTWA 2MUCA 3M4HA 3HF3A 3ZVHA 4YYCA 1SU5A 2AGTA 1XYZA 2ADAA 4HP5A 4UR9A 2VUNA 1XGEA 2PRLA 1TPH1 5D2TA 3R25A 1P43A 2XUCA 3MT1A 5FCZA 2HRWA 3A23A 1G4PA 4RKAA 5A6JA 1U33A 2BVYA 4S3DA 2BODX 3JRKA 3SIMA 3AROA 1V6UA 4E8DA 1J79A 3MUAA 4IP7A 5EPDA 4BEUA 2Y63A 4EPDC 4XO6A 3K8KA 3OPSA 3T0DA 1LUCB 1W9DM 2PMQA 2VURA 3A21A 4PB5A 2OB3A 4US5A 2KAUC 1AG1O 3KVKA 3E1F1 2PDWA 3ENLA 3RYSA 1POKA 5D2XA 2YCKX 3V36A 3GB6A 2OJPA 1SW0A 3TYEA 4YTUA 4X0VA 2ZRXA 3EWWA 3ZT6A 1C29A 5H91A 2G37A 4LCRA 1UB3A 1E1FA 2OKTA 3T07A 2QCHA 4RE3A 3P3BA 1P1XA 1YTEA 4O28A 4GXWA 2WCAA 2WNZA 2HSAA 3BURA 3ATZA 3GC2A 1FA2A 2HCVA 1UW9A 3NQFA 3UNDA 4A3HA 1GNXA 2V5DA 1VLIA 4HHPA 4AZ7A 3TDFA 3OYZA 3WH5A 2GQAA 3PNUA 3L5MA 3W7PA 1B9ZA 1ICPA 4BHYA 1QW8A 1HFBA 2FPTA 3VOHA 1V08A 4A29A 3M0KA 4L61A 5AHMA 3ZYZA 4A3QA 1T99A 1OB0A 3W1NA 3R4IA 3DI1A 3AMKA 5D2WA 1MW1A 3PG8A 3WNNA 1B5TA 1AZ2A 2V3FA 1R9YA 1OYAA 4GX8A 2BMBA 1OQFA 2QKFA 3SAZA 3PZNA 1QATA 4EACA 5FAGA 3D46A 2PC4A 5HJYA 3LSCA 4DYKA 5HATA 4O0QA 3GU9A 5CBJA 4UMCA 1SZFA 1E0XA 3OYXA 4LS2A 4RJEA 3B8TA 2WWCA 3BJSA 4CVUA 4MKSA 2OQYA 4NZ1A 2PSNA 2OYLA 5HJXA 2ZC1A 4CD5A 3C2FA 2GWGA 1GOKA 1LJYA 3BARA 1E9LA 4PCTA 4I3GA 3ZR6A 3RG6A 1GORA 3KM8A 3PZ9A 3L0GA 2IMRA 3S4TA 1ZJHA 5IBXA 4OUIA 1E55A 1BVNP 5FA5A 4JIEA 1OFPA 3IGSA 4DHGA 4TOQA 4C1NB 1OFEA 2I14A 1VHNA 3PUGA 2DZAA 2PRHA 3WF1A 3UJFA 5A8QA 4DY1A 2OSYA 3W2JA 3HOJA 4UOQA 3W2UA 1VBJA 3NOYA 2NX9A 3WQWA 4WXZA 1QXLA 4JEQA 3TJLA 2EGZA 1NFBA 2TRSA 2P8BA 3BCJA 3LOTA 2R94A 3NAVA 5IDZA 5T26A 4JX5A 4P2VA 3WNMA 4N9DA 1H51A 3SRKA 3RCYA 3BW2A 5D33A 1R87A 1CTNA 3CMGA 1SO5A 3KOYA 1ZP4A 4PUEA 3B4YA 3KBVA 4HBKA 4C6EA 4DBWA 3BC9A 2R1MA 2CBIA 2A7PA 3VZYA 3W07A 3W7CA 2ZXBA 2O4MA 5FD0A 2DSUA 3CH9A 3A3HA 2P0OA 5FL1A 1DJIA 1TB3A 1AL7A 3VIJA 5AHEA 1TVLA 1W8GA 1U1UA 1EJUC 1TWIA 3TROA 5AVNA 5IFPA 2CBJA 3E6EA 4RZ4A 4UMAA 4H04A 2PLMA 4FLRA 4GZEA 3PJUA 1OIFA 3IGUA 4E2BA 1LG1A 3QV9A 1OY0A 2CLHA 1CLVA 4JFSA 4JHOA 1PL9A <