3STGA

Crystal structure of a58p, del(n59), and loop 7 truncated mutant of 3-deoxy-d-manno-octulosonate 8-phosphate synthase (kdo8ps) from neisseria meningitidis
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
268
structure length
260
Chain Sequence
b'MDIKINDITLGNNSPFVLFGGINVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDKPRSSIHSYRGVGLEEGLKIFEKVKAEFGIPVITDVHEPHQCQPVAEVCDVIQLPAFLARQTDLVVAMAKTGNVVNIKKPQFLSPSQMKNIVEKFHEAGNGKLILCERGSSFGYDNLVVDMLGFGVMKQTCGNLPVIFDVTHSLGRRAQALDLALAGMATRLAGLFLESHPDPSALPLHLLEDFLIRIKALDDLIKSQPILTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-dehydro-3-deoxyphosphooctonate aldolase
molecule tags Transferase
source organism Neisseria meningitidis
publication title An Extended (beta)7(alpha)7 Substrate-Binding Loop Is Essential for Efficient Catalysis by 3-Deoxy-D-manno-Octulosonate 8-Phosphate Synthase
pubmed doi rcsb
total genus 90
structure length 260
sequence length 268
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2011-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3stgA00
1M6JA 4K7VA 1TTIA 2E1DA 4WX2A 1MEHA 4UMAA 3OBKA 3T55A 3ANYA 3W1QA 5BNKA 2B7NA 3TDFA 1EB3A 2Z6JA 3M5XA 3L0NA 1P0NA 3BG9A 1DV7A 4IXXA 1KM1A 4N9CA 1F76A 4UNKA 1XUZA 3PSWA 5D04C 1IXNA 4JTGA 3HO8A 4RX0A 1SO3A 4LC6A 5E0KA 3DBPA 1EUNA 1W5QA 1JRCA 5G4WA 2R91A 2QCDB 1Q6RA 4K6AA 4ML9A 1LZOA 5DBTA 4DPQA 1JCNA 2ZA3A 4NNCA 2FB2A 3GYEA 3MHUA 1A53A 2ZTJA 1FXQA 2CZ5A 3OG3A 3QPZA 4O18A 4UIOA 3BG5A 3N19B 2QUTA 3C61A 3EX3A 3FLUA 1LM1A 4YCPA 2CLKA 5LNVA 4BWLC 3CPRA 4HSOA 1O94A 4MIMA 5BMWA 1VS1A 4LS0A 5I3JA 2C3ZA 2EF9A 4K8EA 2YYTA 3SGZA 3TW6A 3TAOA 1YDOA 4JTHA 4KFOA 2J9YA 4NX0A 4KWWA 4RXGA 5HUOA 1KLZA 1K7FA 5LNUA 3IIOA 3JRKA 4AF0B 2P10A 2E5CA 4DBDA 4OBTA 4A2RA 1TQXA 4TIMA 1HFBA 4O0ZA 4GWEA 4IUOA 2H8ZA 4I7UA 3QC3A 3NQCA 4XWUA 1L6WA 2A85A 2E77A 3NVTA 3GNNA 3CLMA 1C29A 1N55A 3G1VA 1C8VA 2QJGA 2ZRWA 5AHLA 3TW7A 3QMTA 3G1HA 3L9CA 1IIHA 4UTWC 1Z41A 1VCGA 3B8DA 4NT0A 3GB6A 4FX6M 2YW3A 1FDZA 4HNVA 2E6AA 3EXRA 4QIUA 1K03A 3W7HA 4GUFA 1TJRA 5KITA 3OA3A 4LUIA 2W0UA 2QR6A 1K02A 3NPVA 4GBUA 3N34A 3SGUA 4BI7A 5D05A 2FPYA 4YWIA 1WA3A 1PCKA 2JKEA 5FF0A 3TMLA 1CI1A 1F05A 2G5WA 3LRKA 2EGZA 3LTYA 3LGEA 1NF7A 3N9SA 3KRUA 2Q8ZA 5I3IA 2H8XA 4B5NA 4NZJA 5HJLA 4A2SA 3HJZA 4FNTA 2Y7GA 2Y62A 3W74A 3MI2A 5CGQA 5I3HA 1X1ZA 2V82A 3S5OA 2A0NA 3W7GA 3IEBA 2EPHA 3KHJA 2JKPA 4DF0A 2ZCGA 3QH2A 4RZ6A 1H7RA 4O13A 5KMYA 4IMCA 5DY2A 3DFNA 3I7RA 3LXCA 3PBUA 3SJ3A 1SQ7A 3Q37A 3L0KA 3G18A 3LRLA 1HL2A 2ISWA 4IPJA 4UTIA 1YPIA 2HS6A 3AJXA 1XCFA 1E51A 4P61A 1WDWA 2QCMA 4N6FA 1PHWA 3BW3A 5HULA 2Y7EA 4CCDA 5L6UA 2NLIA 5IBXA 2FJKA 2CLFA 5L9FA 3FA5A 2WV8A 1QFEA 3FFSA 3LERA 5T26A 2ZZ1A 4LVGA 3W73A 4XBSA 3W7PA 1OFAA 3W1UA 4UC5A 2VFFA 3M43A 5LKYA 2B7QA 4QNEA 2Q8LA 3GNDA 4O10A 1IIGA 3W1PA 2W6RA 3IIZA 1KA9F 3IIPA 3BO9A 1XDLA 3UWQA 1OJXA 2WJZA 3TSDA 4RCXA 3FJLA 4H3DA 1GWJA 4TX9A 3WK0A 2F7FA 4CCCA 5I3GA 3GR8A 1LRNA 1LDCA 1Q3NA 2I9EA 2VFGA 3I6RA 1ADOA 5AHEA 3UNDA 1PIIA 4MY9A 2IQTA 2NXHA 2XN1A 3HMJG 3IIVA 2R14A 3W7QA 2VKZG 5DLCA 3ATZA 2GPTA 4LUJA 4K36A 1XBYA 1LOSA 3DXIA 3R8RA 4RZ4A 3S0CA 2C0AA 4ALDA 3TQ0A 4EVZA 1XC4A 4MUZA 3TQKA 2OZ0A 5AB3A 4TU1A 1Y0EA 3OVRA 1H7XA 3NQAA 4JY9A 3N14A 4YXGA 2BSLA 3M5VA 2VC6A 3MYPA 5EPDA 3P7YA 5U7SA 2Q3RA 3NQ8A 1DBTA 4RZ5A 2E5BA 1W31A 1GPWA 4UFMA 4PODA 1ZFJA 4UXDA 5EBUA 3W07A 2QF7A 4OV9A 5KINA 3AO0A 1VC4A 1WOBA 2V2DA 3W2MA 3VNDA 1KFKA 3OVQA 2V30A 1OX5A 1EWEA 3HGJA 4IWWA 2QCCA 1S5WA 3GKAA 4JY8A 1I2OA 1WV2A 3PUDA 3ZS4A 4BFAA 2CFFA 3BG3A 3R12A 3NAVA 2QJHA 3KRSA 3OVPA 3CEPA 1O5XA 3TCEA 4UFJA 1SU5A 1EWDA 1FWNA 1GYLA 5A8GA 4JYDA 4DXVA 7TIMA 3V1PA 3H53A 3A24A 1V5XA 3LCHA 1I2PA 2ZZ7A 2PRHA 1AL8A 1WOAA 2YFOA 4U4MA 4Z1AA 2Z6IA 2J88A 4FIRA 3NM3A 1Q6LA 5FI8A 2X30A 1SZNA 1IGSA 2RDWA 4X22A 5K9CA 3PUEA 1NVMA 1YYAA 5AYZA 4XTDA 5DELA 3S9YA 1SW3A 1QDSA 3QF0A 2E6FA 1JRBA 1VJIA 3UZ5A 1MSSA 4HSNA 2V8ZA 1LORA 2Y7DA 3EX6A 5K4ZA 1IXPA 4MZ8A 2NUYA 4WQ6A 3EWBX 1TPEA 3EXSA 3SECA 3M44A 1GJPA 4MJZA 1GG0A 1LOQA 2C15A 3C6CA 4JX6A 3R89A 3E0IA 1FQ0A 4GUGA 1IF2A 1OK4A 3EWYA 2A7RA 2A6NA 1O5KA 5AYYA 4O8RA 3STFA 1QO5A 4M7TA 4Z1BA 4ZVJA 4PEKA 5DN1A 1K7XA 3PG8A 1SSDA 2AAMA 1FDJA 3RNDA 2YSWA 4WZHA 1KFEA 1FBAA 1I8JA 3W76A 2A7NA 4W9TA 1ALDA 2Y6ZA 1B57A 5C55A 3EWUA 5HWJA 3NZ1A 5I3FA 3HOJA 2QEZA 4A22A 3BW4A 4ORIA 1VPXA 3NL3A 5CSSA 2HSAA 1HUVA 3W83A 1LBMA 2QKFA 1FDYA 1D3HA 2CLOA 5DBUA 5K7JA 1M7PA 4LV9A 3FYOA 1T8XA 3E12A 1FX6A 4O50A 1SFJA 4AHQA 1TO3A 3B4UA 1G69A 3L21A 5KTLA 2WNQA 1JCYA 2G95A 3P60A 1W8SA 3GXPA 3P74A 1A5BA 3USBA 1EEPA 1JUEA 2H3BA 2WQPA 2BZNA 3L67A 3FJ6A 4K39A 4O53A 1MEIA 4OV4A 1A50A 1RV8A 3CIXA 3W72A 1A5SA 4FXRA 1I45A 5FF3A 3CEUA 3O6YX 2ZQ0A 2QCGA 4UFLA 2QUVA 3LHZA 4CQAA 4HPXA 3LTSA 3C52A 1ZALA 2RFGA 3IVSA 2DU2A 2F84A 4ZQRA 2DZUA 3TSMA 4IX0A 2YDAA 2V0TA 4RLIA 1SO4A 1SUXA 3M5YA 3FEMA 5HR6A 4N9EA 3LV6A 4MJMA 3GDTA 4UTJA 3TSBA 4UFIA 3NOEA 1TSIA 4O12A 4K37A 5HQEA 2QUUA 4WOQA 3MWAA 4QITA 1F2JA 2CLHA 2GJLA 1QPQA 1XL9A 4N9BA 4N9DA 4Z1DA 2H90A 3CQ0A 4RJEA 3UZJA 3MP3A 4LS1A 4O17A 4FB7A 4LVBA 3CHVA 3EWWA 3LB0A 4JXCA 1PHQA 2R8WA 1DOSA 3I7QA 3O15A 1NSJA 4HNUA 3W9ZA 3T4CA 4JICA 3PS7A 1R47A 3EWXA 1FCBA 3WK3A 4OHQA 4PFMA 2YXGA 1DORA 2HS8A 3TQVA 4BK9A 2GUUA 3U6WA 4E0CA 1DJNA 3PBVA 4FO4A 3BGJA 2CZDA 4M7SA 3QSTA 4CNNA 2YCEA 3NO5A 5FEPA 4K38A 3W7CA 2NV2A 3G1YA 1PV8A 3W85A 5K9DA 1W3TA 3W71A 3LXAA 1UCWA 3CC1A 1TQJA 1EX5A 3O16A 3W84A 3PG9A 1KBIA 1JCMP 1FWTA 3KOFA 2VELA 3LOTA 2Z1BA 3PVFA 1ZJIA 1GQNA 3W6YA 1XI3A 1YDVA 4E38A 3GKFA 4O57A 3TXZA 4GJ1A 1KTCA 3P5ZA 1U83A 3O06A 1KM2A 4CNOA 3NXFA 1J5TA 3SFKA 1LROA 2NX3A 4LS2A 1AMKA 3G1DA 4AH7A 4BR1A 3NL5A 3NM1A 1OYBA 3G8RA 1H50A 1KLYA 2FTPA 2YYUA 3KVKA 3T40A 3WK2A 3IGXA 3NQDA 5CKSA 2X16A 4Z0JA 3WK1A 2A5HA 3W7RA 5AFDA 3BW2A 4WOZA 1MO0A 3S5YA 4ADUA 4EIVA 1PCWA 3LXBA 4LU0A 3FS2A 4O52A 5D02A 3TV8A 4MYAA 4WXZA 4JTLA 3A9IA 4LW7A 5HUPA 2ATSA 5G4EA 1W0MA 3TC7A 2QCEA 1OFQA 3SI9A 1GVRA 4RR4A 3TAKA 1DQXA 4JYEA 3BLFA 5BMXA 1JVNA 4TO8A 5C6MA 3PBYA 4GUIA 2Y61A 3H54A 4KFPA 5FF2A 3LHYA 4GNJA 3R13A 4IMEA 2E5DA 3W7DA 1EP2A 3W1RA 1B4EA 1OFPA 3JR2A 3DI0A 3Q94A 3LHTA 3HPSA 4OGZA 3G1XA 2OJPA 3PSVA 4JTKA 2DP3A 4NXSA 3CIWA 2PRMA 1EPXA 1H7NA 1W5OA 3ATYA 3GX9A 1GOXA 4JDBA 1LBLA 2C14A 1FCQA 3L2IA 3C2RA 3C56A 1HG3A 1XXXA 5DXXA 2ZRXA 3IVUA 1G4PA 3QW3A 5LGXA 5K2ZA 1NF0A 2DZXA 4OE7A 4YMZA 2EKCA 1TV8A 1TTPA 4O28A 3CWNA 3TROA 3Q58A 3MYOA 3KFTA 3KAOA 3C4UA 2ZRUA 2DZPA 2FLIA 5E1QA 3C2VA 4FNQA 1UUMA 4FNSA 3INPA 4ZQPA 2WPBA 3GDKA 1L6YA 5HNRA 2XFWA 4HNNA 3LCXA 4R33A 3DFTA 1RQEA 4NJIA 1VLWA 4OQVA 4MYXA 2WNNA 1P0KA 5LHFA 1TREA 3QSRA 4FF7A 4OU1A 4YLWA 4N4QA 5AC7A 3MUXA 5G2HA 3L5MA 3LM7A 4NXKA 4LNYA 3W3OA 2YW4A 1WAUA 2QAPA 2ZZ5A 4WY0F 1LYXA 1Z42A 1R30A 2EAWA 3G1FA 2YX0A 4O1CA 1LLWA 1CW2A 2WSRA 2X2GA 4ZMGA 1XFBA 1OK6A 4CQ9A 4O19A 3ZWTA 3RLUA 4LC8A 4PL1A 3HIJA 1TIMA 2X1RA 1SW7A 4AB4A 1XBZA 1XM3A 1K8XA 3QMRA 4IGHA 1ONRA 4MVAA 4RXFA 3SSJA 4AWSA 5D32A 2O7SA 1FCUA 2V2HA 4Y9AA 1ZAIA 5CPLA 3NPXA 3QM3A 3NQVA 3LCIA 1PE1A 2Y85A 2VFDA 1IXQA 3PC0A 1OABA 3C8FA 3QQ0A 4EF9A 3P82A 3IGUA 1S3HA 2BTMA 2RDTA 1RZMA 1GVSA 1OYAA 5K4XA 3O8AA 1ME7A 4NNBA 4HN4A 4IJBA 3DFSA 5IM51 1G7UA 1RQBA 1EIXA 2J9ZA 4J9JA 2A2IA 1H63A 2JKAA 1OFDA 2ISSA 5K3VA 4O14A 5KSWA 1B9BA 1OX4A 4X3ZA 1YDNA 4UTKA 4FX8A 3P61A 1DL3A 3NNTA 1VHCA 1GVFA 5A5WA 3MW7A 1JULA 4WD0A 1K8ZA 4IMFA 4HIBA 1LOLA 2ZRYA 2CZFA 3UWZA 3RLVA 3QFEA 4ZQMA 1F73A 5J5DA 1SZFA 3UD6A 3GAYA 1R46A 4POCA 3OEXA 5GVJA 2PURA 4AVFA 4EF8A 4MLRA 1ML1A 2FQIA 4M6VA 1F74A 3BGGA 2X1SA 3QPYA 1W5NA 1QPRA 3N9RA 2ABAA 2YFNA 4N6EA 4JTJA 3A21A 5FF7A 4Q33A 2NXIA 1L6SA 3TJXA 4DEFA 1K3UA 1OYCA 3IVTA 1RD5A 5G5IA 4PC8A 2JGYA 4UFHA 4JX5A 2VEKA 5D03A 5CSRA 1IXOA 3GXNA 3O1NA 2OX1A 4Q4KA 2X1UA 1H7WA 1BTMA 3EB2A 1W54A 5EL1A 4OT7A 1J4EA 2PCQA 3MP4A 4JTEA 2VFIA 3S5NA 3R2GA 2VOMA 3GLCA 4AEOA 4AF0A 1OG0A 3TX9A 2GJNA 4JEQA 3P81A 4LOCA 5LHEA 4Y8FA 2TYSA 3M16A 3STGA 4XUGA 1BWKA 5LNWA 5AHMA 1YADA 4IMDA 4RV8A 5DCBA 1YXYA 4L4MA 1UB3A 1X8FA 1I2QA 5BOOA 3TK7A 1LCOA 4WXYA 1QPNA 3W7EA 3WJXA 1H60A 1ZAJA 1XBVA 1KM0A 3ABOA 3C3NA 4JDYA 4QAIA 4MFEA 3WJWA 1OFOA 1SW0A 1P5BA 3G1AA 5EKYA 4DO5A 5CG7A 5AHFA 3S8HA 4HKPA 3YPIA 3P84A 1QNVA 1LTDA 3HQ1A 4K7YA 2DJXA 2QDGA 5HR7A 4ONVA 1F6KA 4O0KA 3LHVA 1Q45A 3W7LA 4NJJA 4NX5A 3TXVA 3C2EA 5TIMA 4QJ1A 3W7MA 4CNPA 1KFJA 3FIGA 2G97A 3W7JA 4HHPA 3M6YA 3PB2A 4O4VA 4QM1A 2C16A 3DZ1A 3KVJA 4QSHA 2Z0IA 3SIZA 2UV8G 3PR2A 3LDVA 1UASA 2TSYA 3L66A 4DO6A 2OT1A 1QPOA 3HG4A 3O05A 2W79A 1F7BA 4QNWA 2VFHA 3EWZA 3HG5A 1TRIA 1U5JA 3UXAA 5DCEA 4LWWA 3GZ3A 5FEZA 5TBOA 3S6DA 1W1ZA 3TKFA 2DZSA 1RVGA 3EX1A 4AWUA 4JD4A 2VEPA 3GDLA 1QAPA 3M47A 1T0OA 1MEWA 3NA8A 2QCFA 3TC6A 3BLIA 3TJLA 5F2GA 2RHGA 1VRDA 4M5PA 1AW5A 1ME8A 6ALDA 3M7WA 1YXCA 1KV8A 3KVLA 3TFCA 2Q3OA 3L0GA 5J5RA 1N8FA 1KFLA 1AW1A 2O7QA 2WKJA 4XKYB 3SR7A 2H6RA 1G4TA 1Z48A 2GVGA 2NWSA 2ZRZA 4AXKA 4MY8A 3T78A 1OF6A 2C18A 3DFPA 2RDUA 3G0UA 4IXHA 4BI6A 1TYGA 1W56A 2Z2UA 1NFBA 4QISA 1G6CA 2PRLA 3SW6A 1YPFA 3I7SA 1TPVA 1A5AA 3W1XA 1QWGA 2E68A 3CU2A 1FWSA 3MBFA 2FFCA 2NWRA 5HWNA 1P1XA 3UWUA 4N02A 4ZL1A 2WSYA 4Y6GA 3W7OA 1TB3A 3EX2A 2YGYA 4UUIA 5D2WA 3DAQA 4I9AA 2E6YA 3THQA 1NEYA 3CB8A 4I7WA 1GTEA 1THFD 3P62A 4BI5A 4ICNA 4C1KA 2V5BA 3PBWA 3DKLA 3C2OA 3W1MA 2FIQA 3DI1A 1ZHAA 3W7KA 3OHIA 4P2VA 4UTLA 3N73A 3QZEA 4XBKA 1VZWA 1Q6OA 4MPQA 3KVMA 1W3IA 3TUUA 2ZZ3A 3H55A 4JIQA 2A7PA 2P0OA 4MKNA 2A21A 1ICSA 4KKXA 5F1VA 4AHPA 4CQ8A 3M41A 3KRZA 3EKLA 2FB3A 1BKSA 1KM5A 3NGJA 1NAL1 1TTQA 4RK8A 4FEZA 4FX7A 4KFNA 3TE9A 4KWVA 3UXDA 2A6LA 2WSQA 4N2YA 3QQ1A 1GEQA 4L4LA 1VYSX 5DCDA 1W5PA 2YR1A 3UY7A 1Z44A 1LLZA 5AC8A 2A1YA 4ZQOA 3QEZA 1LRQA 2ZTKA 5F2MA 1CX9A 3MBDA 3HGSA 1OFBA 1SFLA 1HO4A 5EYWA 2CLLA 3ABQA 3THAA 1JUBA 3G3DA 4IOTA 4JTFA 1FY6A 4HPJA 1WYIA 3HPXA 2GOUA 1G4EA 1VGAA 1H51A 3E9AA 4H6KA 3TNOA 1ZAHA 5G1YA 2ZA2A 3CM4A 3DHDA 3HGOA 4H4IA 1XKYA 2TPSA 5D2YA 3S1WA 2JGQA 4LRSA 3IRDA 2ALDA 5D2VA 3VFLA 1BWLA 2GVJA 3FKRA 3MMTA 3NEVA 2QCLA 3S1XA 3M9YA 3UWVA 3D0CA 3B0VC 2XN2A 2WNZA 3BLEA 2HMCA 1F5ZA 5TQLA 3NPWA 4U28A 1Q6QA 3LLDA 3F03K 4E2DA 5LSMA 2QCHA 4M19A 3QMSA 3W2NA 1ICQA 3B0PA 3I68A 3M1ZA 4M6PA 1MZHA 4ADTA 4FIQA 4HNTA 2V2CA 1H62A 1BEUA 1YTEA 5FEWA 4NZFA 4E2BA 3S1VA 3SZ8A 3NQ6A 3L5AA 3MHFA 2R94A 1ZY9A 1B3OA 2ZDRA 3W23A 2B0MA 1RR2A 3BARA 5EY5A 2ZZ6A 4LV4A 2TRSA 4NU7A 3UPWA 3LHUA 1GG1A 2A4AA 2DORA 1VH7A 1C9DA 4AAJA 5CZJA 1QMLA 3WJSA 2QDHA 5D30A 2EHHA 4R53A 2ZFAA 2J24A 3QW4B 2C13A 1DQWA 2VEIA 2CZEA 1FXPA 1SPQA 2NZLA 3QJAA 3W22A 1VYRA 5F4SA 1OX4B 3U8GA 4S2BA 4WJEA 5CPOA 5MHBA 3E96A 3GVGA 3STEA 3OIXA 2VEMA 2OMAA 1SSGA 3FYPA 3A5VA 4FNPA 3B04A 3LBMA 2ABBA 2ATMA 4JTSA 3G0XA 1TPB1 5F2LA 3NDOA 3UWYA 4FXSA 1RPXA 1L9WA 3EXTA 2PE4A 2NUWA 3PAJA 4O15A 3PF3A 3PY2A 1FWWA 3E49A 4YCOA 4D2JA 1JJKA 2ZYFA 4UR8A 1R2RA 1FCVA 1H5YA 3LRMA 3LLFA 3B05A 1MXSA 1FWRA 4Y96A 4R34A 4X9SA 4JYFA 3N3MA 4MZ1A 5F4WA 2Y7FA 3TU9A 5EMUA 4AWTA 4LY8A 1PS9A 3VCRA 2JBMA 3LBCA 4HT3A 1LP6A 4FNUA 1VYPX 1W3NA 5D2TA 1AK5A 2QAFA 1KM3A 1WX0A 1UUOA 5FF4A 4UTUA 2Y89A 1VLIA 4JTUA 3GIYA 2QCDA 5F2IA 5HINA 4XTIA 5LGZA 1GVOA 2P1FA 1DVJA 3LTPA 4UCGA 4QQ3A 3LI1A 2NV1A 1SR9A 3O6DA 4MOZA 4LVFA 2C19A 1QO2A 4BF9A 5F1UA 5ABTA 1R2TA 4LRTA 4EOUA 3UY8A 3ABRA 3NQ2A 5AYXA 2DZTA 4S2CA 1S5VA 3N2XA 3DENA 1EUAA 1TPH1 4K8HA 1TV5A 4DQWA 3TFXA 3VI2A 3GAKA 3CWOX 5D2XA 3G8EA 2KZHA 1I2RA 3G3MA 1WBHA 3LCWA 1TRDA 2J6XA 5CZTA 2ZZ2A 2G96A 1JQVA 1ZENA 3TA6A 3W7IA 5FEXA 2CLMA 1KM6A 4TR9A 1K8YA 3NR0A 1H7PA 3UQNA 4GXMA 3CTLA 2OT0A 4UTMA 3BVJA 3VE9A 3N2MA 3LCLA 1T96A 1O4UA 3UWWA 4UMBA 1ZCOA 3JS3A 1KV5A 2J9XA 2CLIA 1GYNA 1T99A 1QR7A 5AN7A 1XBXA 3S5ZA 2C1HA 1JR1A 4YL2A 4MLJA 3NPUA 2ZRVA 1J2WA 3STCA 5LNRA 4MZYA 3HPZA 4I7VA 1EP1A 3B03A 2QCNA 4NJKA 4GUHA 1QOQA 3IGSA 4XQ6A 3C0JA 3T44A 3W70A 3P8IA 1WQ5A 4Y90A 1KTBA 3RMJA 2BXVA 3W88A 2GVLA 3W2JA 5DXYA 3CT7A 3G1SA 1QCWA 4JTTA 3B0UX 5D38A 3LHWA 4IMGA 4DO4A 1DJQA 2V9DA 3HB9A 2BX7A 3EEGA 1SO6A 2H3DA 1JCXA 4UTTA 3IIXA 3P5YA 4O11A 4Q32A 5KZMA 1SZGA 5K9XA 2BLEA 4O1AA 1I4NA 4PCFA 1S5TA 4ORMA 1I2NA 3O07A 4IQLA 1WBJA 3P67A 5FESA 1YXDA 1X7FA 2Y88A 3WJYA 4DBEA 4A3UA 4NVTA 2D73A 3GDMA 4O54A 4LVDA 3NQ7A 5D37A 1G4SA 1UBSA 1QOPA 2CW6A 5CZ0A 3DH7A 3RU6A 1XUUA 2DZVA 2GQAA 1W5MA 3WJZA 1G67A 1JQXA 2VFEA 3K30A 3NL6A 4LVAA 1H61A 5KZDA 4O4WA 4A21A 5LNSA 3HGRA 1H1YA 3DFOA 3GDRA 5EA9A 1N7KA 2V5LA 3GXTA 3S42A 2B7OA 1GZGA 3W1LA 1F6PA 1TJPA 4UTHA 1A5CA 2Y70A 3EKZA 1X6UA 4ZZ9A 3RFAA 4WY0B 3A5FA 2DZWA 4XZ9A 4TMBA 2FPVA 5G2IA 4UR7A 3E02A 3SY5A 1DHPA 3QYQA 4N4PA 2C6QA 4JR5A 1KM4A 4RKAA 4PH6A 4NJHA 1M7OA 1OF8A 4OWGA 5AC6A 4NJGA 3DFQA 3M0ZA 3M5ZA 4JX4A 3G0SA 2B7PA 1KW1A 2I1OA 2YZRA 2LLEA 4IPIA 1FUYA 3G22A 4O16A 4JIPA 3PM6A 1TTJA 3NQFA 1HTIA 3NYZA 3DKJA 3ABSA 1TCDA 4WUIA 2DJLA 3A23A 5CZSA 3VKJA 3L68A 2RKXA 1K7EA 2VENA 3ELFA 2E09A 4DPPA 4S1FA 4DF2A 4PL2A 2GQ8A 2ISVA 5C54A 4LT9A 2NUXA 3PULA 1KBJA 6TIMA 1G7VA 1V7YA 1GTHA 4PA8A 2JK2A 5C5YA 3MHGA 2I14A 5D33A 3PUOA 3T7VA 3IV3A 1OX6A 3MI3A 4UMCA 3UYCA 1DKWA 1VR6A 3W87A 4AHOA 1EA0A 3HG3A 2RH9A 3C2FA 3DGRA 3ZWSA 3W2KA 5DY3A 3BK0A 1EP3A 4FHAA 4JN6A 3W1TA 2BWGA 1KFBA 5AOUA 3NQGA 2FDSA 5G1TA 4GUJA 4Z0SA 4UTWA 4M6QA 5AHNA 1P4CA 2XN0A 3LV5A 4PTNA 5BRBA 3EX4A 3MO7A 3FOKA 3KX6A 3B06A 4ADSA 1TPUA 1TPFA 1LRTA 2B4GA 1VHNA 4DELA 1ME9A 4UNLA 3HG2A 4BWLA 2V81A 4UFKA 1L2UA 4NNAA 3LCFA 3PWAA 2TMDA 5AHIA 4GC4A 4JS3A 1GVQA 3F1QA 3RF9A 4EWND 1GT8A 2X1TA 2ZBTA 1UJPA 1H1ZA 1OVDA 1D3GA 1RQHA 3O63A 5CPNA 3F4WA 3DHFA 4WY0A 3L5LA 1TPDA 4GRSA 2ZA1A 3NQEA 4GE8A 1R2SA 3WFAA 3W1AA 2AQWA 3KXQA 2QJIA 2NX1A 4O1BA 3NL2A 3LI0A 2HTMA 2OCZA 5CPMA 1H7OA 1SZEA 3A22A 5BW6A 3VE7A 3ZFHA 3W86A 4JNMA 4CCEA 1TMHA 3TIMA 2NXGA 1WXJA 1HO1A 4TMCA 4IX2A 5C2XA 4G1KA 3DU0A 1JCJA 2FPTA 2Y63A 3MP5A 3MI6A 1AL7A 3FKKA 3HF3A 3W2UA 8TIMA 3W7NA 1ICPA 1TPWA 3W75A 5H91A 4UTTC 4JTIA 1O95A 2J27A 3Q2DA 1VCVA 1VCFA 1D9EA 4C1LA 3R5EA 5G2WA 4AMAA 5LZLA 1ZNNA 1OHLA 2E6DA 2CWNA 3NZRA 2YPIA 1X1OA 4MY1A 4NUWA 4O1DA 3P8JA 1JUKA 5I3KA 3PB0A 5E93A 3ZR4A 3LX9A 5KZEA 3TMQA 5F4XA 1JCLA 1PL9A 2CLEA 4MFDA 4NQ1A 1W37A 2PC4A 1M5WA 3F4NA 4CLMA 2VXNA 3GK0A 1OFEA 5HMSA 3O6CA 3BV4A 1OFRA 4Z08A 3BPWA 1SO5A 4FNRA 3S1UA 2GQ9A 3W1NA 4R7JA 1LBFA 5HWMA 3U2OA 4LTSA 4Z1CA 5SWUA 1VQTA 3QRHA 3I65A 3UPBA 3NQMA 4JGDA 3G24A 2AGKA 1KTNA 1PVNA 4XKYA 2WOQA 1B4KA 1KFCA 1XDMA 4X2RA 3W2LA 4ZQCA 3P80A 1TV7A 3L65A 3LCGA 1YTKA 2NX9A 4GFSA 1O60A 5H2ZA 3TH6A 4ZQNA 5D09A 1YLVA 1YTDA 3HBLA 3NG3A 4A29A 2CU0A 1AW2A 3GR7A 4DF1A 1AG1O 5U4NA 2WO5A 5IBXC 2ZZ4A 3V75A 3MJYA 3TR2A 3RK8A 1TPC1
chains in the Genus database with same CATH superfamily
1M6JA 4C6PA 1LL7A 1TTIA 2E1DA 4Q4PA 4WX2A 1MEHA 4OFCA 2B7NA 1UZDA 1H3GA 2WC3A 3LQLA 4GPNA 4Z17A 4AX6A 1Z32X 4ATLA 4RL3A 3SCSA 1P0NA 1DV7A 1MDRA 4Q4OA 2PDKA 3VIMA 3P2VA 4JTGA 1REQB 5E0KA 5BZAA 4L6OA 4ATDA 3PJUA 4YHGA 3FDKA 2R91A 3GNXA 4NASA 3AU2A 1VIZA 1Q6RA 2YDQA 2J7CA 1P0DA 4DPQA 1TKKA 1DE6A 3TWAA 3MHUA 3PZTA 4FR6A 4O18A 3BG5A 2QUTA 1OM0A 3FLUA 2WVTA 2CLKA 5LNVA 2E40A 4JN7A 4MIMA 5BMWA 3QTPA 1R9XA 3K13A 3W37A 3EA3A 2BHYA 1EBHA 4K8EA 3RGTA 5EMKA 4JTHA 5JBFA 3FJ4A 4J7RA 3SO7A 4KWWA 4L61A 4MAVA 4RXGA 5HUOA 1K7FA 3JRKA 1BLIA 5RUBA 2UY4A 1TQXA 3IS4A 1DWHM 4O0ZA 1EF2A 3VOIA 1BTCA 1C92A 3H2FA 3QC3A 4I7UA 1KWGA 1L6WA 3ALFA 3MANA 1QJWA 4RNHA 3EDEA 1N55A 2DSWA 2ZRWA 5AHLA 3WBXA 1QI3A 3QMTA 3TW7A 2E1WA 1IIHA 3L9CA 5HJXA 1EYWA 1VCGA 3GB6A 3H7RA 1W3JA 4HNVA 1E0WA 2GYIA 1U5HA 3VNJA 1TJRA 1ODUA 1EJXC 2W0UA 3BWWA 4QCFA 2GVEA 3NPVA 4IG2B 3ABXA 4GBUA 3N34A 5D05A 4JQ1A 4YWIA 1WA3A 2YL5A 4LH8A 3QV6A 2W63A 1CI1A 3RRAA 4RPQA 4QJ5B 3NJ3A 2BBFA 3GVWA 1XC6A 3LTYA 1TE1A 1FWCC 4UQCA 1FWBC 3M46A 2UY5A 1E9LA 2OSYA 3BCJA 3U5YA 7TAAA 5JIWA 2G8ZA 4PB4A 5HJLA 4A2SA 4XZMX 4QLLA 3MVTA 4UZUA 2E4TA 3HJZA 1M65A 4FNTA 3BGAA 5CGQA 5D8ZA 5I3HA 1YNPA 3QOKA 3CTTA 1X1ZA 1AJ0A 3W7GA 1GONA 3OGSA 1XIJA 3NXLA 1H7RA 5A6MA 2VX5A 3VOFA 2QULA 3PBUA 1RAKA 3Q37A 3G18A 4DI9A 5I5RA 1E4LA 3S1GA 5C2GA 4B16A 2ISWA 4U2YA 3IK2A 4D6DA 3AJXA 1ISWA 3GHUA 4HU0A 3BW3A 1CXHA 1NDWA 2NLIA 1Y5VA 3TWBA 3FA5A 1IZCA 4ZR8A 1AQHA 5FD0A 1SJAA 1T8QA 3WLRA 2POZA 3EWDA 1YKWA 1UKPA 3VGBA 4GY1A 3EMCA 6A3HA 3ZLGA 5CJ5A 3W7PA 1XIEA 3L4XA 6PTDA 2D2HA 2VFFA 5LKYA 2VR5A 4QNEA 3GNDA 3VK5A 3W1PA 2W6RA 3IIZA 4YVXA 1TIWA 4F2TA 1UH3A 3BO9A 3H23A 2F6UA 5LIWX 4XZIA 1JYXA 2YBUA 4RCXA 3FJLA 1GWJA 2OOFA 1BYDA 5I3GA 3GR8A 4KS0A 2VFGA 2D3NA 4A05A 4QFUA 1E0TA 3C3UA 2WKGA 4R27A 4H9UA 3MUAA 4H8VA 5T9BG 3RR4A 4LUJA 4K36A 4CNTA 4F0HA 1LOSA 2VEFA 4RZ4A 3S0CA 3LS9A 3F4VA 5EMJA 4EVZA 1XC4A 4MUZA 3KUMA 1ZJAA 3NQAA 4JY9A 2Z28A 4TVUA 4GY7A 3P7YA 3WH6A 4EPBC 3NQ8A 4CD5A 2E5BA 1W31A 4UXDA 2QQ6A 3IUDA 1OCNA 5KINA 4JQ3A 3AU6A 2J25A 1E40A 1VC4A 2V2DA 2XIMA 4KCVA 2VO5A 1KFKA 3PWGA 3DG6A 1EWEA 4IWWA 4N0RA 2QCCA 1S5WA 1MW3A 1RALA 4JY8A 1I2OA 3L4WA 1E4NA 3R94A 3OVPA 3TCEA 2OXNA 4HA4A 4OBRA 5A8GA 2PDIA 3MUZ1 1AL8A 2YB4A 1WOAA 4Z1AA 2Z6IA 1E9IA 3NM3A 3S2CA 4GYJA 4GZ7A 4CD8A 1IGSA 4DLMA 4AZ5A 1UUQA 3GG0A 1W6TA 1UW9A 4RE0A 1QDSA 2PDNA 3T2OA 3WDHA 1WKFA 2Y0FA 3HM7A 4A3HA 2ZVRA 2PBGA 1BYBA 1IXPA 4WQ6A 3EPOA 3EWBX 5G4HC 3EXSA 4QLKA 2J7DA 3M44A 4JFUA 1GG0A 2P0IA 4WR3A 4Q3MA 1RY8A 4UBPC 5JVLA 1FQ0A 1OK4A 5AC4A 2BGNE 2ZUNA 4O8RA 3NSMA 1RHCA 4M7TA 5AZ0A 4PEKA 1HKKA 3ARVA 3RCYA 2XUCA 1NDVA 3RNDA 1B31A 2YSWA 3BLPX 1KFEA 2A7NA 3B9DA 1OD8A 1FWEC 1W1TA 3EWUA 3VX0A 3HOJA 4W7VA 4ORIA 4M80A 3NEHA 3W83A 4CD7A 2P88A 8RUCA 4IJRA 3ENLA 1FDYA 2TODA 1DJXA 1R5YA 2V5KA 3PZ9A 4LYQA 2XIJA 4QE5A 4AHQA 4RNFA 1TO3A 3OGVA 2G95A 3P14A 1K4HA 3IACA 1E5JA 1A5BA 4Q4SA 1TWSA 1FH9A 5M3WA 3MSGA 1BD0A 1K9TA 2BZNA 5FACA 4OV4A 1V0LA 3O3RA 3W72A 1BVNP 1A5SA 2GOKA 1I45A 4Q8WA 3CEUA 3O6YX 1U1UA 4MNLA 3AMDA 4CQAA 4A3RA 4HPXA 2RFGA 3IVSA 3CASA 4ZQRA 3TSMA 1A80A 4IX0A 1ITQA 2QV4A 4TXEA 3A4XA 3DDMA 3KCJA 3ITVA 3VDCA 1SUXA 3FEMA 4N9EA 3LV6A 1WDPA 2PTWA 3V35A 3AWOA 4LY4A 5HQEA 4MGGA 4MSSA 3I6EA 3VIOA 3COTA 4MWAC 3BOFA 2CLHA 1S2WA 5D8WA 1OZMA 1XL9A 5C9WA 4N9DA 1MW0A 3PBGA 2WSPA 3GW3A 4O17A 3ORWA 4LVBA 4JXCA 1DOSA 3O15A 3MDUA 1BG9A 1NSJA 4HNUA 1AUSL 3APGA 3T4CA 2VWSA 2A3LA 3WK3A 4OHQA 5H1WA 4L5ZA 3E2VA 4BK9A 3TLLA 2XGZA 3CHCA 3UERA 4E0CA 1DJNA 1M3UA 4M7SA 3QSTA 1XV8A 2YCEA 1XYCA 2CCRA 4ZOAA 3A3WA 1V4YA 3NIYA 3O7UA 4D6HA 3O16A 4BA0A 3U7BA 1KBIA 2FZMA 1E0VA 1Q6GA 3LOTA 1GKPA 4H7CA 1ZJIA 4IM4A 4E38A 1XI3A 1FFQA 4O57A 1KTCA 3WQ4A 1PZ0A 3FHQA 1XIGA 1PB0A 4LCSA 3CV1A 3GH7A 3NVDA 1VFFA 4BR1A 4LYPA 1TVNA 5CEWA 3G8RA 3VMOA 1KLYA 1IEQA 2FTPA 3WBEA 3T40A 3KVKA 1T41A 2X16A 4BF7A 1MO0A 1W3LA 3T0DA 5REQA 3OHMB 2W61A 5EFFA 4S3BA 5D02A 1XD0A 4JTLA 3GXFA 1HJXA 4LW7A 5HUPA 5A6SA 5G4EA 1W0MA 4FSAA 3TC7A 1OFQA 3SI9A 4XISA 1RJPA 2OSXA 1DQXA 4JYEA 5BMXA 3LLXA 4U3AA 3CHDA 2OKTA 3IRSA 2Y61A 3WLQA 5FF2A 1K6WA 3LHYA 4GNJA 2J62A 1B4EA 4KH2A 4JKMA 3DI0A 3CAKA 3GYCA 4OGZA 3BLOA 3V36A 2FYMA 4F9JA 1IZKA 4AFYA 2WZHA 3WSUA 4MKSA 1LLOA 4Z1YA 4H2CA 5BRPA 3W00A 1W5OA 1B30A 3SCTA 2BNJA 2GUYA 2GLKA 4UQ9A 5DXXA 1XXXA 3R0UA 1KRCC 2Z4GA 2NVCA 3CYVA 1AFSA 2X8RA 3N13A 4GCAA 5A6BA 2XTKA 2PDJA 4A35A 4GISA 4C6QA 4YMZA 1TTPA 4E6MA 3MYOA 4XO6A 4AEFA 4GYPC 4C6KA 2EXOA 2VVNA 5E1QA 1PSCA 3VIFA 1EGVA 4FNQA 9XIAA 4S3KA 1UUMA 3INPA 3NSXA 2BY3A 3I10A 4WGXA 4MDPA 4LAMA 4WKHA 2XFWA 5I2UA 4R33A 3CZJA 1GYMA 1RQEA 4PZVA 1W3KA 4QEHA 4IL2A 4MYXA 1CGWA 2O56A 5FKYA 4OU1A 3S3GA 5AC7A 1S1RA 3MUXA 2NLYA 4F0LA 3W3OA 1WAUA 3MMWA 2WHJA 1R9ZA 4PRWA 4ZFMA 2V6AA 2PDWA 1CDGA 4GYFA 5I79A 3VD5A 2PF0A 3FW6A 3AUOA 2X2GA 1PKYA 2EQDA 4O19A 1DJZA 1W1PA 3RLUA 3KZPA 3HIJA 1TIMA 2X1RA 5HNTA 1CB2A 3WDIA 4MVAA 4HBKA 3JUGA 1FCUA 1XIMA 4Y9AA 1HKWA 4Q4QA 4S3DA 3UPMA 4GKLA 3QM3A 2Y85A 1IXQA 2PDQA 3KTXA 2XH7A 3IGUA 4XZNX 2ZUVA 3WD3A 3VGFA 4EAMA 3HQPA 4NNBA 4HN4A 4WLCA 4MKVA 4NAEA 2XIQA 3ARXA 5IM51 3DFSA 1G7UA 5A8PA 1EIXA 1TVLA 1H63A 2PUZA 1OFDA 3TTOA 5LIUX 1JZ2A 3ITCA 3N17A 2ISSA 2ZUUA 1B9BA 4GIRA 1VFTA 4XAFA 4UTKA 1OCQA 3A12A 3PANA 1W91A 1XRTA 4DJFA 2V38A 2C71A 1GW1A 2CZFA 3PJWA 3QFEA 3REQB 3GAYA 4POCA 4ZO6A 2YA1A 5FAJA 4M6VA 2X1SA 5ABFB 1GEHA 1J96A 5LIXX 4Q33A 2NXIA 3IVTA 1OG6A 5G5IA 4PC8A 2JGYA 4AIEA 3TTSA 4JX5A 5IDZA 5CSRA 1GVEA 2ZX7A 3O1NA 4O1EA 2QT3A 5JQ9A 1EXBA 2XM1A 2XU2A 1BVZA 4ZO9A 1IT0A 3R2GA 3GLCA 2GJNA 1UZ4A 4JEQA 2IPFA 4JTCA 3F2CA 5DMYA 1BWKA 1YADA 5DCBA 1UOKA 3UZWA 5BOOA 4EANA 3TK7A 4H9XA 4WXYA 4C6NA 3WJXA 1ZAJA 3EOSA 4YTSA 1XBVA 1KM0A 3ABOA 4JIRA 1VKFA 2WZMA 3DFYA 1X1NA 3ES8A 1YX1A 4HMEA 1SW0A 3CUJA 5EKYA 4U3CA 5HMEA 2WSKA 3YPIA 3OLIA 1QNVA 1LTDA 1XGDA 1D7FA 3QV7A 4Z2HA 2PFHA 4GGHA 1WKDA 1XLKA 3D5HA 1Q45A 1PUDA 3RX4A 3TXVA 2J7EA 4AMCA 1E3ZA 2ZUMA 4QJ1A 1EPVA 1KFJA 4C60A 3FIGA 2G97A 3W7JA 2I16A 3M6YA 3PB2A 3CNYA 3L4UA 4OTKA 4DUOA 3WLKX 3FV9A 1R3WA 2DH3A 4QSHA 3PR2A 1V6TA 3RIKA 2TSYA 1MWOA 4XZHA 4P8UA 2V3GA 3WUGA 2PP3A 3GFZA 1F7BA 1OSEA 4FZIA 1SGJA 2JIEA 2R1NA 4E2VA 4FLRA 3EWZA 5HA7A 1KCKA 1ZBVA 3WLJA 1UBPC 3S6DA 1W1ZA 2QGYA 3A13A 3WX7A 3RO6A 1JPDX 2PS2A 1XLFA 3GDLA 1QAPA 3M47A 3NA8A 3UA3A 3TC6A 3AHXA 3BLIA 4X63A 5DMLA 4IUGA 1YDYA 4I9TA 1WPCA 3EPMA 4M5PA 4W89A 5CC7A 1L6GA 2WLYA 1QI4A 1YXCA 3TFCA 3UZZA 1KWKA 3K8KA 3L0GA 5J5RA 4PR4A 1OQFA 4XKYB 4D71A 4DZIA 3WQOA 1G4TA 4ZODA 2CEQA 4AC1X 3GIPA 2PLKA 4F66A 3T78A 2YIHA 4NZ3A 2C18A 4C6IA 2RDUA 4BI6A 1TYGA 2Z2UA 2PRLA 3TVAA 2XWDA 2OZTA 4IFRA 4GIAA 1A5AA 5E9AA 3NQBA 2YL6A 3W1XA 2E68A 1FWSA 5HQLA 2NWRA 3IUIA 3UWUA 2WSYA 3K4DA 4Y6GA 4WHBA 1ISXA 1XSIA 3H7UA 2AMXA 3WMBA 3AXIA 3XINA 4I9AA 2E6YA 2OG9A 1XINA 3THQA 3CB8A 4I7WA 3KOXA 3QR1A 3EB3A 1GTEA 1THFD 4HCLA 5D9OA 3P62A 3BZGA 3MCMA 3WNOA 3KS5A 4CQDA 1KXQA 4XO7A 2GL5A 3C2OA 4AZCB 1DQUA 2FIQA 3BTNA 4DWSB 1UH4A 1L8NA 3QLDA 1OZQA 3OA5A 3N73A 4BEUA 1IEIA 3KVMA 3B97A 3ZSSA 2D69A 2A21A 3TOPA 2HISA 3CV2A 3EKLA 3QGKC 1J12A 4RK8A 1Q66A 4C6EA 1NJJA 2EG7A 4FX7A 2ZVIA 2J75A 3UXDA 2QNEA 2V67A 3A47A 4ZQOA 1T5AA 3WNMA 4WDXA 1OFBA 5CJMA 4PMOA 3CUGA 3THAA 5ENLA 1CGVA 3UXKA 3HPXA 1WUEA 1W17A 2WCSA 1HZYA 4H6KA 1EJUC 2AL1A 1TV2A 4J3SA 4QE1A 1ZAHA 4GQ0A 1E4MM 3GSMA 3QOMA 3S1WA 4C6CA 2JGQA 4LRSA 4B5TA 6TAAA 2WZEA 4ERGA 3VFLA 2GVJA 5HBFA 3FKRA 3NZQA 1U30A 2IQDA 3M9YA 5H8UA 3LEPA 1L2QA 2PEVA 3B0VC 2XN2A 2HE5A 2HMCA 3NPWA 1Q6QA 4W8AA 3F03K 4E2DA 5AZ1A 1QI5A 6REQA 1NQ6A 8A3HA 4M19A 1MQRA 4E8GA 4YPJA 1V03A 4CUCA 3I68A 3M1ZA 4M6PA 4FIQA 4OUEA 3PTKA 3NO1A 3R43A 1FHUA 4H8UA 1YE4A 3WLLA 4HHMA 1W9VA 1B3OA 5F7UA 3B9NA 1CWYA 5EY5A 3KEHA 3H4GA 3TN3A 1PKNA 3HURA 3LZ3A 4Y9OA 4GIYA 2A4AA 1VH7A 4AAJA 1QMLA 1WDDA 2C13A 3W6MA 2VWTA 4REQB 2X42A 1FXPA 2VC9A 2EJAA 1OX4B 4S2BA 2GWNA 1POJA 1DP0A 3OIXA 2VEMA 1XH2A 3BQ5A 1MW2A 1LWIA 3LENA 1TPB1 4N7QA 3BUVA 1RPXA 1L9WA 1Q8JA 4RE3A 2PE4A 5CLTA 2OLAA 4PMXA 4O15A 3HV8A 1FWWA 3ZYZA 2OQLA 2ZYFA 4UR8A 3WZ0E 3LRMA 2FJUB 3JVAA 5HANA 4AY7A 4X9SA 1Q85A 3TU9A 3PTQA 1PS9A 3VCRA 2CERA 2OGYA 2FDMA 2FZ9A 1VYPX 2FMNA 2IS7A 3H70A 3M0LA 4C5ZA 2PF8A 3PN8A 4MB1A 3CUXA 2CLPA 3QLLA 5T9CE 3GH4A 5LGZA 2FFIA 2P1FA 3EDJA 2VC5A 1HVQA 4J2PA 2NV1A 3BOLA 3HTWA 4MJ4A 4MOZA 2YA2A 2VCCA 1DJWA 3LK6A 4YTRA 5AYXA 1S5VA 2CWXA 1C8QA 2PU0A 3OLGA 3UFYA 4GHRA 4C6FA 4AG0A 4IP5A 4DQWA 4Q8QA 3VUSA 1XICA 3GAKA 1XLCA 5D2XA 1I1XA 3G8EA 2KZHA 2DUZA 1CEOA 1WO2A 5CZTA 2XHYA 3TYAA 1JQVA 3PZIA 1ZJBA 3CWHA 1ZENA 3H2CA 5FEXA 4ZSTA 4WDTA 3RM4A 1XSJA 2JIWA 2OVLA 1K8YA 3NR0A 1H7PA 2OPJA 3ZVIA 3TQPA 1QATA 4AZCA 1BRLA 4UTMA 3BVJA 4XAGA 3VE9A 3UWWA 4LEFA 3BAWA 4UMBA 1ZCOA 4JFVA 1EH9A 1AVAA 3JS3A 3H8AA 4LJ3A 1KV5A 5A2AA 5I23A 3AZTA 4LX4A 3AROA 3OGRA 4MLJA 3FY1A 2VJXA 4P7RA 4AZHA 2AOSA 3B03A 2QCNA 4GUHA 1OBAA 2PP0A 1HKIA 3FDGA 3C0JA 4CU7A 2OB3A 1WDRA 3W70A 4Y90A 1WQ5A 3ARRA 1GQJA 3W88A 2HZGA 3W2JA 1EA9C 2EPLX 4DBUA 5DXYA 3CT7A 4HSHA 3G1SA 3LHWA 3T42A 1DJQA 2BX7A 3EEGA 2H3DA 4O1FA 1BAGA 4UTTA 3IIXA 1PX8A 3P5YA 4B91A 3MUY1 5KZMA 3LPOA 2BLEA 4PCFA 4ORMA 4MHBA 2FKPA 4IQLA 3UR7A 4ZEPA 1YXDA 2WWDA 2IUZA 1S5NA 4Y8EA 3WL0A 4JTAA 5D37A 1F8MA 3RU6A 4UTFA 2DZVA 3WJZA 1VEOA 1A3HA 4KIRA 5D4YA 1G67A 4J3TA 1JQXA 3KCLA 3BMWA 1WXZA 3NL6A 2PDXA 4LVAA 5A8QA 5LNSA 1UZHA 1UIOA 3GDRA 1N7KA 4B4FA 1X6UA 2WXDM 3TLQA 4XZ9A 1AZ1A 5G2IA 2FPVA 3MA8A 2XIOA 3E02A 3DGBA 1LL4A 3UGRA 1UWSA 1SMAA 5BU6A 1KM4A 4AD4A 4CN1A 4RKAA 3LNPA 4MM1A 2V5JA 1JGIA 1E0XA 1S5MA 5AC6A 1LQ2A 4J4KA 3DFQA 4DM2A 3RX3A 3AHZA 3G0SA 2B7PA 2EJ1A 4AEEA 2WJDA 4JHOA 1TA3A 1V02E 5CSYA 1F3TA 1HF6A 2DJLA 3VKJA 2E09A 1U5VA 2GQ3A 2RUSA 2V69A 2Y5SA 2VEGA 1NOWA 1KBJA 4W93A 4D6EA 1G7VA 5D33A 3NCOA 1PDZA 2WK2A 4JTRA 1J8VA 1A47A 3B8UA 1TZZA 5JH2A 3W87A 3SAZA 5C7VA 1D8WA 3CYJA 3U5UA 5D9PA 3ZWSA 3T0TA 3SCQA 2XVLA 2J7HA 3BK0A 1IHIA 3SM0A 3N1AA 4FHAA 2BWGA 5AOUA 2DUXA 3NQGA 2FDSA 4ZBCA 4M6QA 4PTNA 5BRBA 1MI3A 3EX4A 3QVQA 2DT2A 2QJJA 2PODA 3KX6A 2CZVA 1TPUA 1LRTA 2D2JA 4DELA 3G1RA 5FL1A 3SCNA 2WBGA 1SZRA 1JNDA 1RSCA 4UFKA 4GNVA 2C79A 3TTQA 3QHOA 5AHIA 1JDFA 1GVQA 4EWND 1UJPA 1VRXA 3UW6A 3AQUA 1V3HA 1AH0A 1D3GA 1RA5A 4B15A 4Z2JA 4ZB5A 3IPWA 2HWGA 3HPFA 3KXQA 2IPWA 3DYPA 4MDOA 2HQAA 2E9LA 3E0LA 2BP1A 4O1BA 4RW5A 3TOYA 3NL2A 3LI0A 4ATWA 2PA6A 1J11A 2OCZA 1WKEA 1V3JA 3A22A 4DYJA 4JNMA 3KL3A 2IPJA 1TMHA 3TIMA 2NXGA 3VVGA 4JEJA 1F3XA 4G1KA 2FPTA 1CLXA 1AL7A 4EXBA 1IWAA 1TPWA 2WANA 1OIFA 1XS2A 2WMJA 5I24A 1A0EA 1VCVA 4TV5A 4AMAA 4US5A 5LZLA 1XKJA 1OHLA 3C8NA 5I3KA 4FOUA 3PB0A 5E93A 1LJYA 1WDSA 2C1GA 3ZVHA 4GZEA 1ISZA 5XIMA 2QUMA 1FHVA 3BLDA 4NQ1A 1J2BA 2FZBA 4L1XA 3O6AA 4GGBA 3LN3A 1W37A 4CLMA 4PYSA 3CXOA 3PAOA 2WNWA 4QHRA 4H9TA 1OFEA 4G7EA 5HMSA 1E5NA 3BV4A 3MS8A 3UCCA 5JXQA 1ONWA 1IYXA 1UC5A 2GQ9A 3W1NA 2J7BA 1LBFA 1N8WA 1XDJA 3U2OA 4DWSD 1UD6A 4LTSA 2WKLA 5SWUA 2W92A 2PTXA 4AVNA 4GYPA 1WDQA 3G24A 1FOBA 3SQLA 1PVNA 5BWAA 4XKYA 4F3HA 1B4KA 3W2LA 1CIUA 4ZQCA 2GSHA 5E5CA 2BY0A 4G6CA 2PGFA 4GFSA 3RU8X 4QLJA 5D09A 3V5CA 3HBLA 4B92A 1NU5A 1AW2A 1AG1O 2ZZ4A 3CZGA 1Z3NA 4AQLA 4JQAA 4N42A 3MJYA 1PEZA 3NZGA 2VDGA 1PDYA 2XYLA 2A3BA 1NM9A 2WMKA 3OBKA 3ANYA 3H21A 2YZ5A 3TDFA 1CXIA 3ARYA 5ABGA 2Z6JA 3FA3A 4HHLA 3L0NA 3I3BA 1GW9A 2BOEX 1KM1A 4UNKA 4GXPA 4IJCA 2D2GA 3RUBL 1XYFA 4KWOA 2QCDB 4ML9A 3GNPA 5DBTA 2UY3A 3I6TA 1JCNA 2Z7GA 1VBHA 2FB2A 2ZTJA 1OD0A 2CZ5A 3OG3A 4LBUA 3EX3A 4YVPA 4DM1A 3GE7A 3H24A 1S2AA 4EKJA 3T05A 4YCPA 4Z2KA 3EDKA 2J4GA 5IFPA 1VS1A 5LXEA 1J6OA 3O2LA 3AS3A 2ZX6A 5I3JA 3NUKA 2EF9A 4D6IA 3TAOA 1YDOA 2YCKX 3P93A 2DIEA 3RLHA 1ZCCA 3ZR5A 1KLZA 7XIMA 4BEQA 4L9YA 4C6MA 4D1IA 4OBTA 1TV4A 1R3RA 4TIMA 4XAPA 2Q09A 4D8AA 4XWUA 4G9PA 5A6JA 4V15A 2HK1A 3NVTA 2FVKA 2FH8A 3GNNA 5REQB 3CLMA 2Z26A 1C8VA 3B8SA 3POCA 3WNKA 4NT0A 3P0WA 4FX6M 1P6WA 4E3TA 4ECLA 4QIUA 3GIQA 4IISA 3OA3A 1ZZMA 3F4CA 4NZ5A 2QR6A 3V0SA 3SGUA 1XLBA 2FPYA 3RITA 3WLPA 2JKEA 3HQNA 3WQGA 3TMLA 3LRKA 4WF7A 3LGEA 1NF7A 3N9SA 4GVFA 3KRUA 3GR4A 3VUPA 4IHCA 1MQPA 2W66A 3WBYA 3CLWA 4NZJA 4J35A 2NQLA 3WLTA 4KW2A 4PRTA 1MUCA 1VIWA 2XVPA 1EHAA 1E0UA 1IR1A 3VMNA 2GFTA 2QMKA 3QH2A 4RZ6A 1S46A 5KMYA 1LG2A 4IMCA 3LRLA 3PHAA 7CGTA 1YPIA 2FZDA 1FFRA 4P61A 1E51A 1GHSA 2DVTA 1CLVA 4NSBA 3R6IA 3WDQA 3VC5A 1C91A 2FJKA 2CLFA 5L9FA 1QFEA 3LERA 5T26A 4ICMA 4LVGA 2J7GA 2XIBA 4XSMA 3WCZA 3ZJ7A 2VRQA 2ICSA 4XBSA 2PTDA 3M43A 1FP8A 1KBLA 2B7QA 4DHGA 2G4FA 4B90A 1KA9F 4A3QA 3IIPA 1XDLA 2BB0A 3UWQA 4C7DA 2WJZA 4TX9A 2F7FA 2VCBA 5IFTA 8XIMA 9XIMA 1Q3NA 1MDLA 3VCCA 1CGYA 3I6RA 5AHEA 1OY0A 3UNDA 1PIIA 2BS9A 3HMJG 2J8FA 1XWYA 4PUUA 2VKZG 1WAWA 3KZSA 4FI4A 2Z24A 4WSHA 4EPDC 3A9BA 3S6TA 4I6KA 1Y7VA 1EFZA 3E5PA 1R86A 1WXYA 1BWVA 4YXGA 1HVXA 3PTDA 2BSLA 3R11A 2Q3RA 4BCEA 1DBTA 3M4HA 4L9ZA 3W4RA 1HXJA 1ZFJA 4LUYA 1BQGA 3VZYA 4OV9A 3AO0A 1W1YA 3CIVA 1PIGA 3VOJA 2DT3A 4TUFA 1HJVA 2INZA 3H6OA 5I78A 1OX5A 2CITA 3GKAA 3PUDA 5A8MA 3FX4A 1XLGA 1F3EA 2CFFA 3BG3A 3BOXA 2BHZA 3R12A 2WVUA 3NAVA 2VGBA 4TOQA 3N15A 4H1ZA 3CEPA 1FWIC 1O5XA 1IQ8A 1SU5A 4Y7EA 1GYLA 3H53A 3A24A 1V5XA 3LCHA 4F8XA 4F40A 2G37A 4R5EA 4FIRA 1Q6LA 5CPQA 4P5UA 5BXSA 4X22A 5K9CA 3PUEA 3MUIA 2CYGA 4DAIA 5DELA 2OEMA 4QG6A 4K68A 2E6FA 1MSSA 2ACUA 3EOEA 4PBGA 1DXEA 4MZ8A 1V79A 4PCTA 1TPEA 1GJPA 3TW9A 1GCYA 2C15A 3C6CA 1OINA 3G77A 3ZMRA 1PX3A 1BXCA 3WF0A 1TFVA 2IW0A 2YLAA 1O5KA 3QFWA 4JBRA 3SCPA 2QV5A 4XK2A 4AU0A 5DN1A 2V68A 1SSDA 1X97A 5E09A 2I5GA 1XYZA 1E1CA 1FBAA 4Q7BA 4W9TA 4TV6A 2Y6ZA 1GJUA 1SYTA 5I3FA 4M1RA 1V02A 4W85A 1VPXA 4QJ3B 2HSAA 4S39A 1D3HA 1MYRA 5DBUA 1UIPA 4LV9A 1RP9A 3VD3A 6ENLA 1FX6A 1SFJA 3LYEA 1ZS2A 4CD4A 3P0XA 3WFZA 3B4UA 5A6LA 2Y4SA 2WNQA 2OOGA 1JCYA 2AL2A 2NT1A 3STPA 1AQMA 4OKDA 3USZA 3WKZA 2WQPA 4ILSA 1FWFC 1MEIA 1A50A 4PUKA 1NP0A 1RV8A 3CL6A 4Q4RA 1XLAA 1A49A 3CB3A 3MU7A 1NELA 1ZALA 4AD5A 4B5XA 3APTA 3C86A 4PCSA 3CHEA 2EO7A 3H7VA 3M5YA 1MFVA 4MJMA 1R8LA 2G3MA 1OGGA 3GDTA 2ANUA 4KEUA 4V1YA 4DXXA 4S3CA 1HGYA 1TSIA 1EJ7L 4FXJA 4MMWA 3LMZA 1Q4WA 1HIZA 1QPQA 3LPGA 5HNNA 4Z1DA 4KWUA 1XLEA 4GI6A 1R3VA 3CQ0A 4JPGA 1KB3A 1M7JA 4LS1A 4FB7A 4AD0A 2R8WA 3I7QA 5ECVA 1O68A 4KEMA 5A6AA 4NYUA 2X05A 4ZSUA 3W9ZA 4JICA 3PS7A 3EWXA 1FCBA 4PFMA 2YXGA 1DORA 2HS8A 4WDWA 2PTYA 2D3LA 1QNSA 3SUUA 1TZ9A 4MG4A 3GTNA 3PBVA 3IUHA 2H9AA 4HNOA 2G50A 4HA3A 2IXUA 3CZEA 3G1YA 5K9DA 1W3TA 2WMFA 3W71A 3CC1A 1GPFA 3W84A 4KBXA 1FWTA 2I7GA 1Q6DA 3GC2A 2SFPA 3PVFA 3W6YA 1YDVA 3GKFA 3VOGA 2WWCA 4GJ1A 3P5ZA 4EWJA 3GDBA 1X6NA 2Z1XA 5DO8A 1WP6A 2B81A 4LS2A 1AMKA 3G1DA 4K1GA 2EG8A 3Q4DA 1QU4A 3NM1A 4Q8PA 1OYBA 4AD1A 3RPTA 2A3CA 4PE8A 3AOFA 4HMCA 3AMCA 2YYUA 3NSNA 3OQ8A 3ANUA 3IGXA 5CKSA 1CLKA 2A5HA 3I4EA 3R25A 3CH9A 5AFDA 3N18A 4WOZA 3S5YA 4EIVA 4LU0A 4AWEA 3FS2A 5CSUA 3NFUA 3TV8A 4UQEA 3GTFA 4WXZA 1CYGA 2OWXA 3ARPA 4LBSA 2QCEA 5A6KA 3XIMA 1GVRA 3QY6A 2WPGA 3BLFA 3RN6A 4IGNA 5FAGA 5CLWA 5C6MA 3PBYA 2A79A 3TZFA 3B9OA 4DXKA 4GUIA 3SEPA 3IV8A 5IOBA 3DN5A 1W1IE 4U2ZA 5A3HA 3R13A 2E5DA 3W7DA 2I56A 4E8DA 1OFPA 3JR2A 5LXXA 3RCNA 3WMCA 4Q8MA 3TYZA 3LHTA 3HPSA 4EACA 2GWGA 3G1XA 3QPEA 3CO4A 3PSVA 3WFLA 4QXIA 1SR0A 1EPXA 2PWVA 3EA2A 3N2CA 3GXIA 4YNGA 3ATYA 3GFXA 4ZXLA 1KBKA 3EPNA 4JDBA 4YS1A 4L65A 3C56A 3GS6A 2ZRXA 3VM7A 1VAHA 2ACQA 4PB5A 1OGSA 3QW3A 4TVDA 1YPXA 3V4BA 3KLLA 4OE7A 1M03A 4QEEA 1E6NA 3R79A 3PZGA 1VP5A 3TROA 3Q58A 3C4UA 2PWGA 3M6DA 3SQMA 2DZPA 3DC8A 1FTXA 1C93A 5TAOA 2NV9A 2O55A 5KZ6A 3LCXA 4KRZA 4D72A 4AZIA 2NW0A 3RPDA 2XGIA 1VLWA 2WM1A 1W2VA 5LHFA 4F2BA 1Z7AA 4FF7A 2XGBA 4XIMA 1L6FA 4YLWA 4N4QA 3UJEA 1KO0A 2RAGA 5G2HA 3IAQA 3LM7A 4LNYA 2VX4A 3AI0A 3THDA 3WD4A 4GIEA 1PO9A 3UGVA 2BFGA 4O1CA 3U9IA 3ZQ9A 3KTSA 1LLWA 2HJPA 4NKCA 1E15A 2O0TA 1XFBA 4C6JA 1OK6A 3TEVA 1RJRA 2ZWYA 3NDZA 3ZWTA 3VKCA 4IMAA 4LC8A 4PL1A 3DUGA 4GH1A 3TYCA 3UR8A 2OU4A 2ZICA 1K8XA 3QMRA 1PYMA 4QS6A 1ONRA 3ME3A 3IJIA 2P50A 2MANA 2O7SA 5I07A 2MUCA 4WDUA 4H7ZA 4BQ3A 3HV9A 3NQVA 3LCIA 1P0EA 1PE1A 2CBIA 2W67A 4XB3A 1OABA 3C8FA 1HKVA 2PDLA 4EF9A 1RA0A 3SCWA 1S3HA 2F6XA 1UP3A 1WUFA 1RZMA 1SJCA 2YDSA 5K4XA 1ME7A 3AXKA 4I5RA 5T8GA 4IJBA 1Q7QA 4HB7A 4PUMA 4PSRA 3GVQA 1NP2A 5D9MA 2JKAA 1NWRA 1CECA 4IF2A 4O14A 3UNTA 1VPYA 1XH0A 3T4WA 1YDNA 1UWRA 3S46A 2DQWA 3U4AA 3M07A 1DL3A 3NNTA 3QXBA 4MF4A 1GVFA 1K8ZA 3WH7A 4HIBA 3RLVA 4ZQMA 1F73A 3N2OA 5J5DA 1R46A 3QHMA 4RDVA 5HATA 2PURA 3BLKA 3LD5A 1ML1A 3EGJA 4BQ2A 4C7FA 4J3XA 1W5NA 3TC3A 2YFNA 4N6EA 2UZ9A 4NAEB 1U22A 1R87A 4P7QA 4DEFA 3K46A 1OYCA 3VM5A 3CS2A 1XPYA 2HRWA 3PNZA 1EO7A 1BTMA 2CKSA 5I06A 1U1JA 3EB2A 2PCQA 4GX9A 2X40A 3TX9A 3MMUA 4LOCA 5CGMA 1UD5A 1UP0A 4JFSA 4AISA 1I75A 3WBWA 4XUGA 1R38A 4DAFA 5AHMA 1MMFA 4IMDA 2ZUTA 1YXYA 4L4MA 5MF5A 1GKRA 1UB3A 4HZMA 4MB4A 4LUTB 4KERA 3WH5A 2WYSA 3WJWA 3G1AA 4DO5A 4LPCA 2C91A 4LFYA 2GVYA 1HJUA 4HKPA 3P84A 4DBSA 1J0YA 3N3TA 1ZBCA 3HQ1A 2ISFA 4K7YA 3IANA 4YTUA 4IPPA 4LSBA 4ONVA 3MZ2A 3U0HA 5ECUA 1EC7A 1PPIA 2XZ9A 3GTXA 2XFFA 3QV8A 1EJWC 2JALA 4AY8A 1OWQA 2ZXQA 4UNIA 4P8VA 1R6WA 3WIJA 1XJBA 3H2OA 4KPLA 4URIA 5AVHA 1EDGA 1UYQA 4M56A 2AQVA 2YL9A 3T0AA 3LNMA 2UV8G 2VX7A 3GRIA 3L66A 1O5QA 3W26A 1MRAA 1XGZA 4DO6A 2OT1A 5JH1A 3QY7A 2W79A 3O05A 1XCWA 1TE6A 4QTGA 2XH4A 1U5JA 3UXAA 1ISVA 5DCEA 4LWWA 3ZJ8A 1UD8A 1KC7A 4IQEA 4L6HA 1BYAA 1QWKA 1NIUA 2DZSA 3ZSTA 2VEPA 2J8TA 3T08A 1T0OA 1MEWA 5HMDA 2QCFA 3TJLA 4QQUA 1VEPA 4AY1A 4QG9A 4IIDA 4GBDA 4PN2A 3KVLA 2Q3OA 4HOZA 4DJFD 2BY2A 1UMLA 1PWLA 1N8FA 4CVWA 3SR7A 1UA3A 4HNLA 4PCNA 4C91A 3R1ZA 2GVGA 1FKWA 3H12A 2BVYA 3N6JA 2E9BA 1BXNA 4RZBA 4GC3A 1NFBA 3DC0A 4YVVA 4QISA 3KBVA 3I7SA 1TPVA 2RGMA 3TA9A 5CG0A 1O1ZA 1OT2A 3CU2A 1C7SA 1IEXA 4ZL1A 1K6AA 2DSKA 3WQ8A 3W7OA 1TB3A 3EX2A 4BF5A 3JW7A 5D2WA 3DAQA 1NEYA 4B3ZA 2WLZA 2ONEA 4X60A 3W82A 4C1KA 3D46A 2J6VA 3ZLFA 2Z1KA 3LMYA 2G3IA 1FH7A 3KBSA 3W1MA 2ACRA 3QQWA 1ZHAA 3GC5A 2W27A 3GBEA 5CPTA 3B3DA 1JG9A 1DHKA 2PWUA 5E0CA 1OCBA 2Z1SA 1OC6A 5JIPA 4H00A 3H55A 2A7PA 4KKXA 5F1VA 5BWFA 5LA1A 3M41A 3KRZA 2FB3A 1XRSA 1BKSA 1KM5A 2VDIA 3BV7A 1M9HA 2FTWA 1Z8AA 1RY0A 3KL0A 3S9ZA 2DIJA 2WSQA 3QQ1A 3KHDA 4W88A 5DCDA 2YR1A 2WM0A 1Z44A 2W4XA 4GI8A 5AC8A 2A1YA 3QEZA 2ZTKA 2BASA 3CK5A 2CLLA 1ZUAX 3ABQA 2F2KA 3G3DA 1B0IA 4IOTA 2NVAA 4L80A 1G4EA 3SB0A 4EXQA 1DYSA 4M8UA 5G1YA 2ZA2A 3CM4A 1CXFA 3HGOA 3FSUA 3PZUA 1JGMA 1IR2A 3FHAA 2VM8A 1DXIA 1R3YA 1XQKA 2PDMA 4ZB0A 1SM9A 4UOJA 2QCLA 3ISIX 3T0CA 3UWVA 4G2DA 2WVVA 2WNZA 1OCJA 3WYZA 4Y9MA 2XH0A 2IKHA 5LSMA 3SCRA 3C0SA 2BY1A 2QVNA 3QMSA 2NT0A 3B0PA 3Q67A 5ABEA 1MNZA 1MZHA 4ADTA 1UWUA 1H62A 2A3EA 2E8YA 3M0IA 4ZE4A 1BEUA 2DSUA 1YW1A 2NSXA 3ARZA 2G3JA 2WHLA 2R9RA 3NQ6A 3L5AA 1ZY9A 2ZDRA 3ECQA 4CNUA 4ES4A 3F5LA 2BGSA 1WZMA 4LV4A 4NU7A 3KOZA 4M51A 3DEQA 4Y2WA 2Z29A 3SCUA 5B7ZA 4G7FA 5HJYA 2QDHA 4PEEA 4OOUA 4R53A 3QW4B 3SN0A 4XZBA 2VEIA 3T0BA 2CZEA 3QJAA 3KTCA 2W91A 4MTVA 1Q6EA 5I7GA 4V33A 3MKCA 3AIUA 4AD3A 1U33A 4IFKB 4AVOA 1XIIA 2NSOA 1BSLA 3B9AA 3PPFA 1NTHA 1NDYA 3FYPA 2OMAA 1W1VA 3A5VA 5DQPA 3B04A 4JTSA 1RLDA 3WF1A 4DLFA 4GH3A 4DJDC 2X41A 1KR1A 3UWYA 3OTRA 2V5CA 3M0XA 2NUWA 1N82A 3PY2A 3URAA 4YCOA 4XUYA 1JJKA 1R2RA 1FCVA 1H5YA 3RO8A 1IEVA 4GOAA 4A6GA 3B05A 4S3GA 1JFXA 1FWRA 3RHGA 4A8LA 3AS2A 4KESA 2VGGA 4C6DA 1D8CA 1J93A 4JYFA 2Y7FA 2ON3A 4R85A 4IP7A 3CT2A 4K3ZA 4GG9A 2JBMA 3LBCA 4HA0A 1RJQA 1Q65A 4NAFB 3N25A 1WX0A 1YMYA 5DMMA 1VLIA 4YTQA 4JTUA 1JYVA 3E6EA 2EPMX 5F2IA 5HINA 4PULA 3HFYA 4XTIA 4XD5A 1POKA 1GVOA 4CQBA 1R3TA 4IT1A 3GNOA 4QQ3A 3FN9A 4H9VA 1GK8A 3OLDA 3ITXA 3O6DA 1KXHA 2DW6A 4B3LA 1UP2A 2WBKA 5F1UA 1R2TA 1JXKA 5J8LA 4DIAA 3ITTA 4D8LA 4M29A 3DENA 1TPH1 2VGIA 4K8HA 1D3CA 3TFXA 4J5NA 3VI2A 3CWOX 2WCGA 1NWSA 4A4AA 4JQ4A 4IGMA 1I2RA 1JL8A 3G3MA 5HOSA 3WLNA 2J6XA 2ZZ2A 2ZIDA 2CBUA 4GMEA 3OZOA 5CQ1A 1PTGA 3ES7A 1R85A 4DZHA 4KQNA 4UR9A 3WQPA 4P7LA 1Q13A 1G01A 5I0DA 1RH9A 1P48A 1JZ6A 4JCLA 2J9XA 1ECQA 2XFRA 4OECA 1GYNA 4D8ZA 2C1HA 2JFEX 3NPUA 2QYGA 1J2WA 5LNRA 2J13A 1DIDA 5BYWA 2VR2A 3LU2A 2PDPA 1GOOA 3IGSA 3KRBA 3WELA 1O1HA 3T44A 1JI1A 3P8IA 2GVLA 3M0HA 1QCWA 4JTTA 3GG7A 5AY7A 5DFAA 3PP7A 1JCXA 4OVXA 1Y65A 4JL1A 3PFMA 4F4RA 1VJZA 4HK6A 4LBRA 5LYRA 1I2NA 3O07A 2F38A 3RCMA 4QDPA 1GHRA 1QNPA 4MWAD 2XISA 4D1JA 4Q8VA 3U3HA 3GDMA 3RRXA 4LVDA 1G4SA 1MFUA 2CW6A 4PMZA 1XUUA 1W5MA 1F61A 3R0DA 5BOEA 4AW7A 3U2EA 3R58A 4REQA 1H61A 4A21A 2YCJA 3HGRA 5EA9A 3BAKA 3GXTA 4V1XA 4ENLA 4OIFA 2CETA 1F6PA 1M7XA 1ZTVA 2DZBA 1S1PA 1HKJA 4ZZ9A 3TTEA 4GKTA 4TMBA 2EPKX 1UKSA 4UR7A 4JNZA 1I0DA 1DHPA 3QYQA 4N4PA 4JR5A 1AH3A 4NJHA 1BSIA 5HMFA 1E72M 2X7VA 2VYOA 3TYDA 4GVGA 1J18A 1V6XA 4NJGA 4W8BA 1H09A 3DCPA 3M5ZA 4JX4A 2I1OA 3LG3A 1KCXA 2LLEA 4IPIA 1FUYA 3GU9A 4JIPA 1W9XA 5EFDA 3EDFA 3NYZA 3ABSA 4WUIA 5CZSA 1Z9AA 3ELFA 4C5YA 4BKNA 4H6QA 5HNUA 1V7YA 1GTHA 2JK2A 3H2AA 3UBPC 2I14A 1IE7C 3PUOA 4J28A 4KRTA 1QTWA 4C65A 4DUWA 3MI3A 1DKWA 1GOIA 1EA0A 3HG3A 4I9MA 1LF1A 1VB9A 2RH9A 2EPOA 3C2FA 3BH4A 3AYVA 3TP4A 3UG3A 4JN6A 3W1TA 1JNEA 5G1TA 1CBGA 4Z0SA 4AIOA 5AHNA 1P4CA 1NQKA 2PPGA 4KMQA 1ITXA 2AL2B 5DT7A 3N4EA 1DIEA 2POTA 1TPFA 4CQCA 1MUWA 2OQHA 1REQA 3PWAA 2TMDA 4JS3A 3WLHA 2HNEA 3VO0A 3CAVA 3F1QA 3UCQA 2X1TA 2BODX 5EMMA 1J0ZA 5FCZA 3N12A 3O63A 4HOWA 3F4WA 4KETA 2O92A 4GRSA 4GE8A 3QY8A 3MJMA 1G0CA 2AQWA 5I6SA 4D6CA 2NX1A 1SVDA 1KQZA 4JHZA 5DRCA 3Q45A 3BICA 1H7OA 3THUA 4DJDA 3T81A 4C7GA 4LAOA 1VD6A 4JNYA 4IX2A 4ZO8A 4DY1A 4GQRA 4QDMA 1PIFA 3MP5A 4OOZA 1TR1A 3MI6A 8TIMA 3HF3A 3W7NA 3AIBA 3W75A 3B8TA 1FA2A 4C90A 4TX6A 2J27A 3Q2DA 2HPIA 3CPGA 2E6DA 1ZU8A 4QP0A 4MY1A 1JUKA 2BDQA 2WB5A 3ZR4A 3TMQA 3WH9A 3H4WA 2CLEA 4JZ5A 3NZPA 1HJWA 2GDUA 1O6IA 1M5WA 3FNDA 3S2JA 2VXNA 3IJ7A 4Z08A 4PMQA 4FNRA 4BS0A 5DF0A 5DANA 4LCQA 2YJQA 4Z1CA 2L5HA 3QRHA 3NQMA 2AGKA 3E5BA 1KTNA 4Q8NA 3LUTA 1AQFA 4X2RA 1XDMA 1UR0A 2QS8A 4EPKA 2VUNA 4PMVA 3L65A 4HPHA 2WC4A 4EX4A 3BDKA 4V2XA 2REQB 1EBGA 4DF1A 1DIOA 3IARA 1BKHA 5A8NA 4AX7A 1G5AA 3GHTA 3TR2A 1K1DA 3RK8A 4K1WA 1KQYA 1TPC1 3VC6A 1RPKA 1R3QA 1IT7A 4K7VA 2CXEA 4GVIA 4ZFCA 3T55A 2PC8A 5BNKA 3QYSA 1P43A 2KAUC 1Y5WA 3PJXA 1EB3A 4KEZA 4BQ4A 1V3LA 3M5XA 2GZXA 3MKVA 3VA8A 2OLHA 4IXXA 3UR2A 1F76A 1XUZA 3PSWA 1IXNA 3HO8A 1SO3A 4GABA 4CU6A 1JRCA 3KP0A 3DHUA 2DV0A 1LZOA 3CUIA 4ZTXA 2XDFA 2ZA3A 4LEQA 3GYEA 4B5UA 1A53A 1A5UA 3V0UA 2INEA 3QPZA 2XJ7A 3WUBA 4UIOA 1V77A 1PTDA 3N19B 2ZX9A 3F2DA 3OZMA 3GG1A 2EPNA 4P7OA 1LM1A 3FJNA 5HPOA 4BWLC 3CPRA 3CZKA 5XINA 4XBJA 1O94A 3GBDA 4LS0A 3HZ3A 3WLSA 4PTMA 1TJ2A 3MV11 3L2MA 2YYTA 3SGZA 3CJPA 2HE8A 4KFOA 2J9YA 2J7FA 3UCDA 4JQ2A 2EBNA 4KF1A 2P10A 2FGZA 2E5CA 4A2RA 4DRSA 2V3FA 4F79A 1HFBA 4IUOA 1PZ2A 2H8ZA 4HMNA 3DG7A 1DIKA 3VIGA 3NQCA 1JPKA 2HCVA 4KGLA 1VFMA 4JHMA 4R88A 2E77A 3MPGA 4ZXOA 1C29A 4J3ZA 4FMVA 3G1VA 4WIWA 2QJGA 4J40A 3EOLA 3G1HA 4O8AA 1Z41A 1GVIA 2YW3A 1FDZA 1FKXA 1J6PA 3EXRA 1K03A 2X0YA 4LUIA 1KD0A 1K02A 1EO5A 1PCKA 5FF0A 2INFA 3E38A 1F05A 3SRDA 1DJIA 2G5WA 3AC0A 2EGZA 1RK5A 2E9MA 3ABZA 1EJVC 3F4DA 3M0JA 3TJIA 3AISA 1EOKA 2H8XA 4LF2A 4B5NA 2VMFA 3U48A 2IKIA 4Q8UA 1RBOB 3GM8A 2GDVA 2Y7GA 1MNSA 3W74A 3MI2A 2V82A 2YBTA 5CH9A 3VDAA 2JKPA 4ZOBA 2QJNA 2YCLB 2Z7KA 3O0FA 1CB7B 4ZO7A 5DY2A 3LXCA 3I7RA 3FSTA 1E6XM 3L0KA 3WEMA 3OO2A 4IPJA 4UTIA 3VTRA 3AICA 4EXAA 1XCFA 4N6FA 5C9ZA 3ANVA 4W4QA 1FWGC 2Y7EA 5J04A 3OJGA 3R0KA 5BRQA 5L6UA 1GOKA 4PBEA 4DN1A 5IBXA 2JF6A 1QVBA 2R1MA 4HD5A 3W73A 1EYEA 3DERA 1BPLB 1XLDA 1O12A 1V93A 1OFAA 3W24A 2Q8LA 4O10A 3B8WA 3HMCA 3WD1A 4C6LA 3TSDA 3AMKA 4PMRA 3WK0A 1R9YA 1T40A 4H3DA 5GNXA 4CCCA 5A6BD 3UT0A 2QPSA 1LDCA 2PSNA 4UOQA 1ADOA 3BJFA 1TJ1A 3IGHX 2XN1A 2JF7A 3LZ5A 4M81A 3IIVA 4TQTA 2QHAA 2R14A 4DNHA 4MJ2A 4ZE5A 4YTTA 1Q7MA 2XVNA 5DLCA 2GPTA 1D7KA 3DX5A 2I17A 5MKGB 1XBYA 1DJGA 4H41A 3DXIA 1EC8A 1E56A 2C0AA 2VRKA 4PMYA 3AIQA 5HK4A 4TU1A 2PTZA 1H7XA 2JQXA 1PKMA 5FJPA 5EB8A 4JIEA 3D3AA 3M5VA 2VC6A 4KGJA 1H5VA 3S6OA 2XG9A 3EEZA 7ODCA 1VFUA 4RZ5A 3KCOA 4AYSA 2F9RA 3PFRA 4J3VA 4UFMA 3U57A 1E1CB 3EZ4A 4KCWA 4RW3A 5GJMA 3V18A 1X96A 3TYEA 1DJHA 3W2MA 2V30A 3VDHA 1DWGM 2P76A 3WF3A 2VDHA 3SRHA 1HX0A 3B4YA 3M0YA 2R24A 2EG6A 3KE0A 3KRSA 3VXGA 4GQGA 4AZGA 1J0HA 2QIIA 4JYDA 3WF4A 4MNKA 7TIMA 3V1PA 1XISA 3B40A 1I2PA 1B9ZA 2PRHA 2ZZ7A 1J9YA 1EDQA 5M1TA 3DHPA 2YFOA 4U4MA 1TELA 5FI8A 3AUJA 1XPGA 4HZ6A 3AHYA 1XSKA 3AMLA 2X30A 1SZNA 3IJQA 1F07A 3BC9A 3WLMA 3CAWA 5AYZA 3URBA 2BOGX 3I3EA 3G6MA 3S9YA 3QGVA 1JRBA 3UZ5A 1U2YA 2GGIA 4HSNA 5C7HA 2V8ZA 1LORA 2Y7DA 2NUYA 2OLSA 4ML4A 3WD2A 3SECA 1BQCA 2ODOA 1K8CA 3L4TA 3E0IA 1KXTA 3W02A 4GUGA 3EWYA 2A7RA 2ZDSA 5AYYA 3PZOA 1QBAA 3STFA 1JZ7A 4Z1BA 4E8CA 2OQYA 2TAAA 3PG8A 2D0FA 1FDJA 3NWRA 2DEPA 3OP2A 4GJJA 3W76A 1YNQA 4MWAB 5C55A 4W86A 5HWJA 3NZ1A 3FA4A 4XAZA 3P6LA 2OO6A 2QEZA 3BW4A 3OLEA 1YE6A 1KGUA 1LBMA 1GUVA 4RE4A 3K1GA 1QNQA 2CLOA 5K7JA 4WCJA 4W7WA 4ROPA 1JZ3A 1M7PA 4K2SA 4EP8C 2OFJA 3AHVA 1LT8A 2IQ0A 2H9AB 2FMOA 5KTLA 3AAMA 1IWBA 3P60A 5AKQA 3GXPA 3P74A 4PTDA 2ZXBA 4HOXA 1JZ4A 3USBA 1EEPA 1JUEA 4ERIA 1TG7A 2H3BA 3V0TA 1YBQA 2QDDA 4O53A 2FZNA 2J77A 4FXRA 5FF3A 2QCGA 3CMFA 3LTSA 1E6SM 1MW1A 2DU2A 2F84A 2DZUA 4HA1A 5A69A 4WRHA 1JYNA 1XYMA 5HQMA 2PDFA 1SO4A 3SY1A 3ZXWA 1KKOA 3GC4A 2ACSA 5E9XA 3GW0A 2WZIA 2HBVA 2P8BA 3ARSA 4H8HA 1F4HA 4UFIA 3TSBA 3UZYA 3ONCA 2YL8A 3UETA 2PDCA 3SGGA 2YCIX 4Z2LA 4A8NA 2ZUSA 3CL8A 3MWAA 1EKOA 1ITCA 3MCOA 2PCEA 4QS5A 1F2JA 2GJLA 4RDWA 3BMVA 4N9BA 1GOMA 1FWJC 3BJTA 3UZJA 3KBJA 3EWWA 1PHQA 1CTNA 3L4VA 5T91A 1GOWA 3TQVA 1VFSA 4US5D 1TVPA 3KDNA 3NYDA 3U6WA 1J79A 2CZDA 3JZEA 2HROA 3NO5A 4K38A 1RD6A 2NV2A 1PV8A 3W85A 2DVXA 3LXAA 1UCWA 1TQJA 2OWWA 1EX5A 3QC0A 3VFCA 1XR2A 3VGGA 4US6A 1E3XA 3PG9A 4EPEC 1ADSA 1JCMP 1UJQA 3KOFA 2Z1BA 1UKOA 1XX1A 4XD3A 5C8BB 1KM2A 1AJ2A 3NXFA 1J5TA 1LROA 4XD4A 4IL0A 1AODA 1EZ2A 1C7TA 3VNLA 3NL5A 2F8QA 2YKKA 3WK2A 4JIHA 3LQGA 4ASTA 4DJFC 3WK1A 2O9OA 3AS0A 4ADUA 5DT5A 1UD3A 6XIAA 4E4PA 4KIEA 2E25A 4MYAA 4LAUA 3A9IA 4EE9A 4I90A 4XIAA 5C70A 3GNRA 3FYYA 5PTDA 2PMQA 4RR4A 4EK7A 4QROA 2RDXA 4TO8A 3F2BA 4LGXA 2X1IA 4H2HA 4KFPA 1S2UA 3V5FA 1VBRA 1V0MA 3FGCB 4IMEA 5E70A 3W1RA 3L12A 1LT7A 5M17A 4FLOA 2VT0A 2OJPA 3AIVA 3V16A 4JTKA 1ESWA 2DP3A 4NXSA 1QBBA 2BV9A 3T1GA 4HGXA 4Q8OA 4S38A 3VILA 1LWHA 1X7IA 1H7NA 4GO9A 1UHVA 3GX9A 1GOXA 1LBLA 4S3JA 1FCQA 1MUMA 2VD9A 3IJLA 3VOCA 1HG3A 3AIWA 3IVUA 3PZNA 1Q6CA 1G4PA 4B5SA 2BVDA 1NH6A 4W8LA 4F0RA 1PJ9A 4S3EA 1NF0A 3BE7A 2EKCA 1TV8A 4O28A 1JD7A 4NY2A 4JN8A 3R10A 3MSYA 3LGDA 2ZRUA 1HGWA 2C1IA 3C2VA 4NI8A 1R7OA 3N4AA 4FNSA 2PZNA 3K4AA 4ZQPA 5EMYA 4I8DA 3WQDA 2WPBA 3T07A 3UXIA 5HNRA 3OODA 4HNNA 4NJIA 3UU0A 8CGTA 1DPMA 3C0QA 1R3SA 4DVOA 1P0KA 3QSRA 3GH5A 2QUNA 1UPPA 2X7WA 3VDBA 3K5XA 4XVDA 4V28A 1AH4A 3EB4A 3L5MA 4NXKA 4PUNA 3I3DA 4B9YA 1W9DM 4B3KA 1HL9A 1HL8A 4CN6A 1LYXA 1Z42A 3UESA 2VHLA 4NZ1A 1R30A 2EAWA 2YX0A 3VIPA 1QUMA 4JOMA 4ZMGA 2OO0A 4PCPA 1E4IA 4CQ9A 4NAFA 1RBLA 3PJTA 4G7EB 4QAWA 4AB4A 1XBZA 3WMLA 4H04A