3STGA

Crystal structure of a58p, del(n59), and loop 7 truncated mutant of 3-deoxy-d-manno-octulosonate 8-phosphate synthase (kdo8ps) from neisseria meningitidis
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
268
structure length
260
Chain Sequence
MDIKINDITLGNNSPFVLFGGINVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDKPRSSIHSYRGVGLEEGLKIFEKVKAEFGIPVITDVHEPHQCQPVAEVCDVIQLPAFLARQTDLVVAMAKTGNVVNIKKPQFLSPSQMKNIVEKFHEAGNGKLILCERGSSFGYDNLVVDMLGFGVMKQTCGNLPVIFDVTHSLGRRAQALDLALAGMATRLAGLFLESHPDPSALPLHLLEDFLIRIKALDDLIKSQPILTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-dehydro-3-deoxyphosphooctonate aldolase
publication title An Extended (beta)7(alpha)7 Substrate-Binding Loop Is Essential for Efficient Catalysis by 3-Deoxy-D-manno-Octulosonate 8-Phosphate Synthase
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Transferase
total genus 90
structure length 260
sequence length 268
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2011-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3stgA00
1TRDA 1ZAHA 2H6RA 2ZRVA 1FWTA 4M6QA 4Z0SA 1EWDA 2D73A 3NZRA 4LY8A 4JYFA 3OHIA 5LSMA 4K7YA 2TRSA 3SJ3A 4DF0A 1WBJA 4UTIA 3W86A 2Z2UA 4O0ZA 4D2JA 2B7PA 1F7BA 1J5TA 3O06A 3HG2A 2A85A 1TREA 1EA0A 3GVGA 4TMBA 1QOPA 2YYUA 5AYYA 1F74A 2C13A 2TMDA 1C29A 4XQ6A 3W23A 3NQEA 3C2FA 4I9AA 2ATMA 4JTIA 3W7DA 5DN1A 3LV5A 3FKRA 2X16A 4JTHA 4LRSA 4AEOA 3GIYA 1OABA 1QPRA 4XTIA 4HNUA 3G1AA 1ZNNA 5AYZA 1W5NA 3IIXA 2CLHA 5DLCA 3DBPA 1NF7A 3GK0A 3E0IA 2ABBA 2RDTA 3P5YA 3PG8A 1XKYA 3P60A 3LCXA 2Q3OA 4ADUA 1KLZA 1OFQA 2Y7EA 4GUFA 2ZRUA 2QCNA 3TFCA 4O57A 4XTDA 3SY5A 3W74A 1EX5A 3M6YA 2DZSA 3MI3A 1IXOA 1N55A 1DHPA 2NX9A 1DBTA 1R2SA 3NQMA 1MZHA 5K9CA 2OCZA 1WX0A 1GYLA 1EP2A 1TPFA 3N73A 4JGDA 4Y6GA 1A5AA 2J9YA 4JD4A 1F76A 3HGRA 1K8ZA 3LRLA 1LP6A 4MZYA 5D03A 4ADTA 5CPOA 4LS1A 3PAJA 3WK0A 4OV9A 1LOQA 2E09A 2OX1A 1TIMA 1SW3A 3MYOA 4GWEA 5C6MA 3PBUA 3EKLA 2VFEA 3W76A 2YCEA 1LBMA 1PS9A 3NPVA 1MSSA 3ATZA 1G7VA 1Q3NA 2V2CA 4MZ1A 1UUMA 1KTBA 1F2JA 4QNEA 3B4UA 1RQEA 1P1XA 3L0GA 4M7SA 1L2UA 3JRKA 2FLIA 4FX8A 4DBEA 4O4VA 1ME7A 3GNDA 4LRTA 5IM51 3HPZA 3A22A 1PV8A 1AK5A 3WJXA 3BW4A 2P0OA 1SFJA 1OK6A 3G8RA 3JR2A 1GOXA 1XBVA 1UB3A 1OF8A 3TMQA 1AG1O 3NEVA 1KTCA 4AF0A 1HO4A 5D2WA 4CCEA 1VJIA 2VELA 4FNSA 5E0KA 4UMCA 2ATSA 2QCGA 1RD5A 4OWGA 4QAIA 1TCDA 4LOCA 3TW7A 2C14A 4FHAA 3VKJA 5U4NA 4JEQA 4ORIA 2Y88A 5T26A 1XFBA 2GOUA 4Y96A 4GC4A 1TV8A 3MJYA 2NXIA 1H7OA 4IMCA 1XUZA 2LLEA 1W31A 4FIRA 3GDTA 2RHGA 3HPSA 1FCQA 2WOQA 3L5MA 2VC6A 1A5BA 3CEPA 3USBA 2PE4A 1VC4A 4A29A 1DQXA 3GKAA 3IEBA 3HMJG 2F84A 3NQVA 4DQWA 3FJ6A 3TAOA 3MBFA 2E5CA 1BWKA 4IMEA 4A21A 2WKJA 2P1FA 3BO9A 1KA9F 3P62A 4UFHA 4Y9AA 3UWYA 2V5BA 3KVKA 4LUJA 4MY8A 4OV4A 3THQA 5GVJA 5HMSA 3NPXA 2ZFAA 3K30A 1KTNA 3CWNA 3NGJA 2J24A 3GLCA 1XBXA 1TQXA 1WBHA 1B3OA 3ATYA 2XN2A 3PC0A 3L21A 1GG0A 2C0AA 3LBCA 4Q33A 1C8VA 1ICQA 1F6PA 2E5BA 3P5ZA 4NJKA 4NNBA 2C15A 3QJAA 1H5YA 1KLYA 3OVRA 3LLDA 3UY7A 3EXTA 1R2RA 4X9SA 3PUOA 1DORA 4ZQPA 4BI6A 5K9XA 1F5ZA 1SSDA 4M5PA 2X30A 4DPPA 3M47A 1TQJA 4CNOA 1F05A 4QJ1A 3KHJA 3QQ1A 4UNLA 4A2SA 3IIZA 3KVMA 1SUXA 4LTSA 3ABRA 3FYPA 5LNVA 4GUJA 2JBMA 1LLWA 2NX3A 3INPA 3NL3A 3NQAA 2J27A 1KFJA 3MBDA 5I3FA 3IGSA 1Z48A 2G97A 3G8EA 3QQ0A 3W22A 3W1NA 1S5TA 2FFCA 3W2JA 3TSBA 1H7WA 1QDSA 4JTFA 2W79A 1W54A 4JNMA 1OFBA 5DY3A 3MHUA 4DEFA 2V81A 3S8HA 4NQ1A 4M6VA 1SO3A 2VEKA 3E9AA 2ZZ4A 1K7EA 3VE9A 1U83A 3RLVA 1SW0A 3QW3A 4WOZA 4A2RA 2HTMA 4MJZA 1TYGA 2Y61A 4IPIA 4RLIA 4NX5A 5K4XA 4UTTA 3I68A 1W8SA 1TPUA 3EXSA 2QDHA 4UTLA 5K7JA 5HULA 3W1TA 4DELA 4KKXA 4LU0A 3VNDA 3EWBX 4MY9A 2QKFA 3G1DA 4JDYA 3TAKA 3A5FA 5G1TA 2Z1BA 1RR2A 3TJLA 2YW4A 3W2UA 1MEHA 1ME8A 1QPOA 3DU0A 1FXQA 4R34A 4UTMA 1LTDA 5AHMA 5BRBA 3F1QA 5D2VA 5D09A 4P61A 2Y85A 5EY5A 5G2HA 1X7FA 2ZBTA 2ABAA 5EKYA 1JCJA 1K02A 1W3IA 3L66A 1KW1A 4YMZA 2V5LA 3MI6A 1VZWA 4KWVA 2X1UA 5BMWA 3LERA 5K9DA 3RLUA 1QFEA 4RJEA 1K8YA 4MY1A 1H60A 3EKZA 1O4UA 2A0NA 4OQVA 2XFWA 2GJNA 1R2TA 4JTKA 3R13A 4E38A 1CX9A 3O05A 2BTMA 3P74A 1Z44A 4OHQA 3RNDA 3OA3A 1G4PA 4YWIA 6TIMA 4AXKA 4L4MA 3TMLA 3P81A 2J88A 3B06A 3IRDA 4NNAA 1VS1A 1IXNA 1I2QA 3NA8A 4JS3A 1P0KA 3PSVA 3QPYA 4JIQA 1JQVA 1OJXA 3ZWSA 2X1TA 4L4LA 3W07A 3MWAA 4MKNA 1FWWA 4ONVA 5D04C 1GVRA 1TSIA 4PFMA 4DO5A 1G4TA 1EP1A 3L65A 4TR9A 4P2VA 3LV6A 2WNQA 4Z1CA 4FNPA 4UFLA 4UXDA 1UBSA 1VHNA 2QUVA 2ZA2A 1N7KA 3TKFA 4IXXA 4GRSA 3T44A 4NJJA 3TQKA 3HG3A 2GQ9A 3GR7A 4AHQA 2CZDA 4JN6A 2ZZ3A 1XBZA 1O60A 5DY2A 1VRDA 4N9DA 1TMHA 5KZDA 5AOUA 4XUGA 4JIPA 5H91A 2CLLA 4GFSA 4UTUA 5DELA 4UC5A 3HBLA 3CIWA 1TPWA 4S2CA 4H6KA 1F6KA 4M19A 5CSSA 1SFLA 2ISSA 4JY8A 5HUOA 4UTKA 2H3BA 4NUWA 3Q37A 3UXAA 1OFAA 3BG5A 5EMUA 3TC6A 2V8ZA 4XBSA 4WQ6A 4HIBA 4LVBA 3RF9A 2W6RA 2NV2A 2JK2A 4NXKA 2J9XA 5HNRA 3G3DA 3BG3A 2V82A 5K2ZA 3UXDA 2CLFA 3TR2A 3KRSA 1EIXA 5I3GA 2YDAA 1SZNA 3LI1A 3LHVA 3C2EA 2TPSA 2C1HA 3CQ0A 1YDOA 3QMTA 1ZJIA 4GNJA 1LOSA 3A9IA 3W1LA 1R47A 3BLEA 2WV8A 3UWWA 2O7SA 1K03A 5HWJA 2ZZ2A 2A6NA 1UJPA 2AQWA 1XDLA 5J5DA 3DI1A 3HIJA 5J5RA 1O95A 3ANYA 2B4GA 3L0NA 3UZ5A 2YSWA 4NX0A 3CU2A 4UR7A 1QOQA 2FPVA 5FF7A 1XDMA 2FJKA 5I3IA 1ME9A 3IGUA 4O12A 1W5MA 3DFQA 4DPQA 4FB7A 1BEUA 2ISVA 4K7VA 4MYXA 1SW7A 4AWTA 3S1WA 3SZ8A 3HO8A 5F1VA 1TPVA 2VKZG 3KFTA 1UUOA 1PVNA 3TROA 2OT1A 1XM3A 2V2HA 2H8XA 5E1QA 4U4MA 1RVGA 3N2XA 2FIQA 1FCUA 3MHGA 1GVQA 2B0MA 3DFOA 3IV3A 3KX6A 3BW3A 5EYWA 4ML9A 2Y89A 4N9BA 1D9EA 3HG5A 1OYCA 4N9CA 3O6DA 5AC7A 1SQ7A 3L0KA 3B0VC 4IXHA 3E49A 2QEZA 4K37A 3Q94A 1KFKA 1QWGA 4UTHA 3I7RA 5HWMA 3FYOA 1W56A 1JJKA 3LI0A 1P5BA 4FXSA 5I3JA 4JX5A 5CPMA 4RXGA 1ZHAA 1O5XA 2E6DA 2ALDA 4K8EA 4DO6A 4GJ1A 3C2OA 3UPWA 4Y90A 4RV8A 4WY0F 1VLIA 3NQCA 1B4KA 1MXSA 3WJSA 4AHPA 7TIMA 2YFNA 4JDBA 3DFPA 3W72A 4A3UA 3DGRA 3WK1A 4M7TA 3TFXA 4Z08A 3M16A 2ZDRA 4UTWA 3BGGA 2B7QA 3B03A 3P67A 1TJPA 4J9JA 3NQFA 3LGEA 3ELFA 3TUUA 3LTPA 3W1MA 4YL2A 3PS7A 3NYZA 5LGZA 5AFDA 5H2ZA 5CZTA 1DJNA 2H3DA 2ZCGA 2DU2A 1JQXA 5AHEA 2WSQA 1JCMP 1H7PA 1YTEA 4LW7A 3DAQA 2A2IA 4ZQOA 5D30A 3G1FA 3A21A 1SZEA 3FLUA 2NXHA 1XC4A 3W7OA 3QYQA 4AAJA 2NZLA 4NXSA 3LCFA 3NL6A 1Q45A 1E51A 2QJHA 3G1YA 1JULA 2I1OA 4LVDA 4DF1A 3PUEA 1H51A 4YCPA 4OT7A 2J6XA 4X3ZA 3GKFA 3W7GA 4H4IA 1IXPA 1VQTA 3EX4A 4O19A 4R53A 5AC8A 3CB8A 4EF9A 3W2MA 1Q6RA 4DXVA 4TO8A 4S2BA 3A23A 3KVJA 4Q4KA 3SGUA 3GDKA 2QDGA 3OVPA 1QPQA 1OK4A 3LB0A 1W0MA 2VEIA 3KOFA 3GDMA 2WNNA 2ZTJA 3ABOA 4PA8A 3EXRA 2ZA3A 2FDSA 3F03K 5EBUA 4NVTA 2GJLA 4X2RA 4K36A 2BLEA 3F4NA 4I7UA 3MHFA 3QRHA 1DV7A 3A5VA 1JCNA 5AHIA 4EOUA 2XN1A 3LTYA 2ZQ0A 2C18A 3UYCA 3C56A 4NNCA 1G6CA 3M44A 3UWZA 1AW5A 1VYSX 1FCBA 4K38A 1VPXA 1AW2A 5FESA 4CCCA 1KFBA 1NEYA 2ZYFA 3W7PA 2Y63A 4LS0A 1SO4A 4WXZA 4HPXA 3W70A 5AHFA 5HUPA 5CSRA 4CQ8A 1PIIA 4AHOA 4JTSA 4QNWA 1CW2A 4LC8A 1TTQA 1X6UA 5BW6A 1G4EA 1H50A 1DOSA 4UNKA 3N3MA 3T78A 4CQ9A 2QF7A 3LDVA 5AHLA 3H55A 2NUYA 3P84A 2OZ0A 3R12A 2ZA1A 2QUUA 1TTIA 4HKPA 1BTMA 3O15A 1GT8A 1OG0A 3HF3A 3UY8A 3OG3A 2A4AA 3NQ2A 3W85A 4O4WA 4LVAA 1P0NA 4XZ9A 3W7IA 3MW7A 2HMCA 3IVSA 3W1AA 3W7MA 1KM1A 2CLMA 1W5QA 2IQTA 1IIHA 2A7RA 5SWUA 4LV9A 1LORA 3G0SA 4UCGA 3HGOA 1EUNA 3LBMA 3LM7A 1VGAA 4UMBA 2RDWA 4LVFA 1TJRA 3W7RA 2EKCA 2EGZA 2RDUA 3FEMA 4N9EA 3DFTA 3TCEA 2PRMA 3GNNA 4PC8A 2XN0A 4KWWA 3NNTA 3W7JA 1VLWA 1LBFA 3PR2A 1OYAA 2WPBA 2V0TA 3W7EA 3EEGA 4MLJA 4TIMA 1AL8A 2ISWA 3S1UA 5KMYA 1KFLA 2CZEA 4FNQA 1X1ZA 5DXYA 3W84A 4UTTC 2E1DA 5A5WA 3VI2A 1ONRA 3C2VA 2KZHA 1PCKA 2Q8ZA 4MJMA 3U2OA 3S5YA 1NFBA 1X1OA 4O53A 3ZWTA 4HT3A 3WJZA 1TV7A 1WOBA 1VR6A 1ZALA 3GYEA 1LRTA 1YXDA 1LRNA 4UFKA 4QSHA 1H7XA 5KTLA 1VCGA 3O1NA 4BI5A 3C2RA 2DJXA 3UPBA 2VFHA 2C6QA 1ZFJA 2NUXA 3P7YA 3E12A 4WXYA 1SO5A 1T96A 1KM2A 5KINA 4K6AA 1Q6QA 2UV8G 2BSLA 5FI8A 2V9DA 3NM3A 2CLEA 1SZFA 2DJLA 3A24A 3IVTA 1LROA 3EB2A 4JICA 4MZ8A 1OFOA 3EX2A 4O1AA 2QCEA 3C52A 1EUAA 1H7NA 5FEPA 4YXGA 3B0UX 3NZ1A 3GXNA 4OE7A 5L6UA 1ZCOA 3LCGA 2J9ZA 2F7FA 4IGHA 3B0PA 4MIMA 4MVAA 1U5JA 4Z0JA 3MP4A 1NAL1 4G1KA 3DFNA 5AN7A 3WJYA 1TO3A 4JTLA 1LM1A 5FEXA 3W7NA 2QCDB 2Q3RA 4O8RA 4QISA 1LCOA 1FBAA 1OYBA 1YTKA 4UFJA 4O28A 4IX0A 4K8HA 3F4WA 4M6PA 4LWWA 4O15A 1OX5A 1TB3A 4R7JA 2G96A 1H1YA 2EAWA 3PWAA 3EWXA 2O7QA 4UR8A 2WO5A 3ABQA 2BWGA 3W73A 1C9DA 3QH2A 4LC6A 2BXVA 2RKXA 3HQ1A 3IIOA 5K4ZA 1WA3A 1ZAIA 4JTJA 3T4CA 2GUUA 3LXAA 2Q8LA 1LZOA 1RQHA 1JCYA 3PUDA 5DBTA 3C61A 4FX6M 4U28A 3HG4A 3S1XA 2QAFA 5LNRA 1DKWA 2WQPA 2VFIA 1TPB1 2B7NA 3O16A 3ABSA 3NL2A 3PM6A 2CWNA 2Y7GA 2X1RA 1FX6A 4B5NA 3CEUA 1G67A 1L6WA 2E6YA 3PBWA 4O11A 1SPQA 1FUYA 1HUVA 1T99A 1EP3A 2WSRA 5KSWA 4O54A 4LVGA 3TSMA 3M5XA 3HJZA 1A5CA 5HR6A 3BV4A 3W7KA 1HL2A 2A7PA 3N9SA 5D2XA 4GBUA 4EIVA 4ORMA 1JRCA 3BW2A 3TV8A 1JUKA 1AL7A 3GDLA 4S1FA 3HGSA 3QM3A 2P10A 2A21A 4WX2A 1QNVA 1KFEA 3NXFA 2BX7A 2YYTA 4ALDA 3R2GA 3C6CA 4C1KA 4BFAA 3EX3A 4RZ4A 3W2NA 4HSNA 3STCA 4NJHA 5CKSA 3NQ7A 4HHPA 5G5IA 4N6EA 4XBKA 1LOLA 1KV5A 1VYRA 1S5WA 2VOMA 1Z41A 4WY0B 4WD0A 3U8GA 3IVUA 3OIXA 1CI1A 4MPQA 1H63A 4RX0A 5HINA 3V1PA 2ZRZA 1OX4B 1Y0EA 3O07A 2NX1A 4N02A 3W7HA 1IF2A 3NM1A 3U6WA 3TJXA 4O18A 4PL1A 2CLIA 2QCFA 3STEA 2I14A 5F1UA 4EWND 5G2IA 3TXZA 3WK3A 3FS2A 4POCA 2AGKA 4KFOA 3GXTA 3LHTA 2WNZA 1KFCA 2E5DA 2V2DA 2FPYA 4TU1A 3VE7A 2PCQA 1FWRA 1H7RA 4IX2A 3W1RA 3PB0A 4GUGA 3W1UA 2TYSA 2OJPA 3R89A 3V75A 3RMJA 5AC6A 4RKAA 4JTTA 1SZGA 2Z6JA 2QJGA 3M1ZA 3WFAA 1KBJA 4O14A 1FCVA 3G0UA 1I45A 1TTPA 4I7VA 5D2TA 4WUIA 1PE1A 4N2YA 1P4CA 3W7QA 3FA5A 3W1QA 1YTDA 5BOOA 4NJGA 1V5XA 3G1XA 3BK0A 3G1HA 2E77A 3SR7A 3D0CA 2ZZ7A 2V30A 3LCWA 1W1ZA 4JX6A 1JCLA 3O6YX 1XUUA 3MMTA 4XKYB 4NZJA 4AWUA 2A6LA 3G22A 3NQDA 1OFPA 2DZXA 1HO1A 1S3HA 5LHEA 3ZS4A 3TQVA 3WJWA 3M5YA 2X2GA 3CTLA 3QEZA 1JUBA 3SGZA 4NZFA 3SECA 3LHYA 1FWNA 5F2GA 5CG7A 4C1LA 1G7UA 4KFNA 5G4EA 3MO7A 5FF2A 3SFKA 1GTHA 4LNYA 5IBXA 8TIMA 5BNKA 4UTWC 3FKKA 3M0ZA 2H90A 3LHZA 1VCFA 3C3NA 1PHWA 1QO5A 2PURA 3E02A 3G1SA 3TX9A 2CLKA 3H53A 1TRIA 1KM0A 3UWVA 1L6YA 3L67A 1KM4A 3DKLA 1DQWA 1KV8A 1QR7A 4IJBA 5EL1A 3KAOA 5A8GA 2Z0IA 3CM4A 2DZWA 3GXPA 1EB3A 1GEQA 3CLMA 1M7OA 1RPXA 3JS3A 4I7WA 4O13A 5I3HA 1EEPA 4UFMA 5ABTA 3TH6A 1V7YA 4GXMA 1OFEA 3GAKA 4IMDA 3MP5A 1A50A 3OBKA 3SSJA 3P82A 2ZRXA 5CZSA 1IGSA 2R14A 4H3DA 4UFIA 5HJLA 2VFDA 1B4EA 2Y6ZA 3W9ZA 3MP3A 1VH7A 4O0KA 2R91A 3FJLA 2GPTA 4JYEA 3KRUA 3KRZA 3OVQA 4BWLA 1MO0A 4QITA 2FB3A 3QFEA 4RR4A 3GDRA 5KZEA 2CFFA 1XL9A 5DCDA 4LT9A 3TSDA 1X8FA 3B05A 4JTEA 5AHNA 4WOQA 2GVJA 2BZNA 3L68A 3BVJA 1TPEA 4Y8FA 4N4QA 4LS2A 3L5AA 5F2IA 5G4WA 3GB6A 3LHWA 5DCBA 3I7SA 4CLMA 2Y7DA 5LZLA 2HS6A 3IIVA 3EWYA 3NPWA 1FDZA 1VCVA 4DO4A 3TK7A 4HNVA 4MFEA 4FNTA 4IPJA 2A5HA 5G2WA 4RK8A 1K8XA 1OFDA 3DI0A 2C16A 5AB3A 3TNOA 4Q32A 1D3HA 1WQ5A 1R46A 2CZ5A 2YR1A 3Q2DA 3SW6A 1J4EA 4BF9A 1GJPA 1YDVA 3DZ1A 4LUIA 4IOTA 3UZJA 5DCEA 3W87A 1T0OA 4Z1AA 3B04A 1OHLA 2E68A 3CT7A 5CGQA 3W88A 3STFA 1I2PA 4UMAA 4PTNA 3CHVA 4EF8A 3DENA 3M41A 5TBOA 4ZL1A 1FQ0A 3TIMA 1QCWA 2QCCA 2CLOA 4PL2A 5CZJA 5C5YA 3S5NA 1XCFA 4OU1A 3S42A 2EHHA 3I65A 4RXFA 3G0XA 3G24A 1OVDA 2JKEA 2YGYA 4Z1DA 2GVGA 1LRQA 3M43A 1W5PA 2NWSA 5D33A 2ZZ6A 4FIQA 4XWUA 3QC3A 1WDWA 5D02A 1GYNA 4QQ3A 2ZRYA 5EPDA 3ZFHA 4MLRA 3RU6A 1M5WA 3W6YA 3QPZA 3P61A 2HS8A 2DP3A 3NG3A 4O17A 3S0CA 1ML1A 4GUIA 5F4SA 1YXYA 3M5VA 2W0UA 4Z1BA 1GVSA 3QF0A 4ZMGA 3LTSA 4RZ6A 1XXXA 3LOTA 3HGJA 5CZ0A 2QCMA 4JXCA 5DBUA 4AF0B 4NU7A 2NWRA 3FOKA 4MYAA 3TA6A 4HSOA 3TXVA 5LHFA 2E6FA 2JGQA 4O10A 3QSRA 4CCDA 3LLFA 4FX7A 5TIMA 1WYIA 4ZQCA 3O63A 2NXGA 1GPWA 1RQBA 4DBDA 1JCXA 4O1CA 4JTUA 3NO5A 4MOZA 2YPIA 3EX1A 3R8RA 1K7XA 5F2MA 4IUOA 1W37A 2NLIA 3GX9A 5MHBA 1YDNA 3M9YA 3W2KA 1YADA 3NQGA 1GZGA 5C2XA 3W1XA 3BARA 4N4PA 1GWJA 3C8FA 3W71A 4ZQRA 2YXGA 5BMXA 3L5LA 3PF3A 3NPUA 3W75A 1BWLA 4BK9A 4WJEA 3LHUA 5LGXA 5LKYA 1M7PA 5LNSA 3I7QA 1B9BA 3FFSA 4QIUA 5KZMA 1Q6LA 4ZZ9A 1OF6A 4FXRA 1A5SA 5CPNA 3W83A 2JKPA 2CW6A 3OEXA 4AVFA 1THFD 4AMAA 2VEMA 3P8IA 3TC7A 4HN4A 4BI7A 3RK8A 2VEPA 3HB9A 5KITA 5FF4A 4GUHA 5D37A 1XBYA 3M7WA 1TV5A 4JX4A 1DJQA 2QJIA 3W7CA 2PRLA 3GAYA 3STGA 3NR0A 1UCWA 1FDYA 1K3UA 2HSAA 1GG1A 1NVMA 3IIPA 5U7SA 3DKJA 5LNWA 2OMAA 3DFSA 3SI9A 3TDFA 1OFRA 3LX9A 5DXXA 5D2YA 3C0JA 4N6FA 1SSGA 4PODA 4CNPA 3QMRA 3TE9A 1YYAA 3MUXA 5D05A 3N19B 4O1BA 5AYXA 4E2DA 1H1ZA 2ZZ5A 1B57A 5F2LA 1LBLA 4R33A 1G69A 1KM5A 2FPTA 5D32A 3NL5A 2FQIA 1OX6A 2VFFA 3DH7A 1HFBA 3LXCA 2PRHA 1ICPA 5FF0A 4FEZA 2VENA 3CPRA 5D38A 1Z42A 1S5VA 1QAPA 1FDJA 3MYPA 3W7LA 4X22A 5I3KA 4FNUA 2Z6IA 4IMGA 1BKSA 4FNRA 2Y62A 4NT0A 4ICNA 4K39A 2NUWA 4O16A 2EPHA 1TPDA 3BG9A 1GQNA 3UQNA 5TQLA 3VFLA 3C4UA 1PHQA 2A1YA 2DORA 4HNTA 2QCDA 4OBTA 1JR1A 2GQAA 2FTPA 3PULA 2ZZ1A 3W1PA 4LV4A 1KM6A 4PCFA 5FEZA 3S5OA 3T40A 3DXIA 1QPNA 1EPXA 1TPC1 2B7OA 3PBYA 4FF7A 2JGYA 3QW4B 4A22A 2R8WA 2R94A 5G1YA 3THAA 4O50A 2WSYA 4PEKA 2OT0A 3UWQA 5L9FA 2DZUA 3G18A 3TW6A 2DZTA 1PL9A 5K3VA 3TQ0A 2WJZA 4FO4A 3PB2A 3NQ6A 3DHDA 4CQAA 4DF2A 1TPH1 3B8DA 1RZMA 3BLFA 3EWUA 3N34A 1KM3A 3QMSA 2GQ8A 4IQLA 5LNUA 1ICSA 2FB2A 1W3TA 1JUEA 2X1SA 1I8JA 1FWSA 3PY2A 1G4SA 3YPIA 3N14A 3HPXA 3W2LA 1NF0A 2AAMA 4AB4A 1XI3A 1MEWA 4E2BA 1PCWA 1QO2A 3EWZA 4O52A 2C19A 3I6RA 3P80A 3UNDA 2DZPA 2QR6A 4ZQNA 2JKAA 2NV1A 1W5OA 1YLVA 1DVJA 1M6JA 4QM1A 3FIGA 1ADOA 2TSYA 2EF9A 2CU0A 1FXPA 3QSTA 4E0CA 2RH9A 3TU9A 4OGZA 2VXNA 2YFOA 2QAPA 1D3GA 3N2MA 2QCLA 3NDOA 5F4WA 2PC4A 2QCHA 3NOEA 1L9WA 4RCXA 1YXCA 3G3MA 4ZQMA 4UUIA 4IWWA 1I2RA 1HG3A 3LRKA 2YW3A 1EWEA 4BR1A 3E96A 1KBIA 1JVNA 4HPJA 4ZVJA 3PBVA 4MFDA 4WY0A 3O8AA 5C54A 4WZHA 1H62A 1I2NA 1T8XA 3PVFA 1GVOA 1R30A 3LXBA 3IGXA 1OX4A 4RZ5A 3LCHA 1YPFA 3BPWA 1ALDA 4UIOA 2YZRA 4JTGA 5EA9A 1O94A 2A7NA 4KFPA 3GR8A 1AW1A 5IBXC 1NSJA 1LYXA 1QMLA 3SIZA 1GVFA 3HOJA 1VYPX 3H54A 3UD6A 4HNNA 3PSWA 2QUTA 3T7VA 3KVLA 3W3OA 4TMCA 1A53A 1FY6A 1WXJA 2VFGA 3CWOX 3G1VA 1MEIA 1VHCA 3LCIA 1W3NA 2RFGA 4PH6A 3S6DA 1TTJA 1N8FA 1ZY9A 3NAVA 1K7FA 3NVTA 2G95A 4EVZA 3Q58A 1IXQA 1WOAA 2ZTKA 3LRMA 1H61A 1O5KA 3R5EA 2DZVA 5HR7A 4CNNA 4YLWA 3AJXA 3CC1A 3NQ8A 1HTIA 4JY9A 3QZEA 1GTEA 3EWWA 5FF3A 3T55A 1RV8A 4XKYA 3S1VA 6ALDA 1ZAJA 1WAUA 1SO6A 3CIXA 5F4XA 3RFAA 4AWSA 5E93A 2H8ZA 1LLZA 5C55A 5HWNA 4IMFA 5CPLA 1UASA 3EX6A 1L6SA 1Q6OA 1I4NA 1J2WA 2G5WA 4JYDA 2C3ZA 1DL3A 3LCLA 2CZFA 2YX0A 1F73A 1SU5A 2ZRWA 2GVLA 3PG9A 1LDCA 4W9TA 3WK2A 4BWLC 3L2IA 1SR9A 3KXQA 4GE8A 3VCRA 1JRBA 4JR5A 3GZ3A 3ZR4A 4YCOA 3BLIA 3S5ZA 2I9EA 3M5ZA 1ZENA 4NJIA 1IIGA 3P8JA 3N9RA 1I2OA 2Y7FA 1WV2A 4MUZA 3S9YA 3AO0A 2Y70A 4AH7A 3MI2A 1YPIA 3UWUA 3BGJA 4O1DA 5FEWA 2E6AA 4ADSA 3DHFA 1AMKA 5HQEA 3L9CA 3O6CA 4UTJA 4TX9A
chains in the Genus database with same CATH superfamily
1U1UA 1Q7MA 1BPLB 2H6RA 1FWTA 5G1MA 2GK1A 4PGLA 1XSKA 4JYFA 3NXLA 3K8MA 1QOXA 1BRLA 1MNSA 3WLNA 2CXGA 2TRSA 3HJEA 3IJ9A 4DF0A 1WO2A 4UTIA 2PLMA 4C7FA 1J0JA 3HG2A 2WK2A 1W6TA 3WF3A 1XFCA 4P7QA 1QOPA 1F74A 3W4RA 4JQAA 3VK5A 2PDUA 2VX6A 2VUYA 5A6BD 1CXFA 3NQEA 1MFUA 3KP0A 1DP0A 4XX6A 3LV5A 3UJRA 1UR1A 4AEOA 1W5NA 1ZJAA 5DLCA 3GK0A 4IG2A 1J5SA 3U2ZA 4AD5A 3AS2A 7XIMA 2ABBA 1MI3A 1W3JA 3OODA 1XKYA 2OG9A 3QHOA 3CNYA 5ABHA 3TZNA 2ZRUA 3KZSA 2OODA 3SY5A 3W74A 4W7UA 3MI3A 1N55A 2Q71A 1K9EA 4GI8A 4V28A 3Q45A 4UOJA 4HMDA 3NQMA 3VIFA 2D0GA 4JGDA 3N73A 4Y6GA 6XIAA 1F76A 4EXQA 4IGSA 4CU7A 2YBTA 1NWSA 4ADTA 3HA1A 4WCJA 4LS1A 5CPOA 3WK0A 3PTMA 1LOQA 1ELSA 2OX1A 1TIMA 1SW3A 2GGJA 2OYMA 4M1RA 5BRPA 4QEHA 4ZTXA 1JDEA 3S5SA 5E9AA 4MDPA 1KTBA 4BF7A 1WDDA 1RY0A 3B4UA 1RQEA 3T2QA 1OD8A 2WWCA 2WC7A 3MS8A 4DBEA 1ME7A 3GNDA 4RNHA 2HK0A 2XGZA 1AQ0A 3MSDA 4UOZA 3WJXA 3WD4A 4GIEA 3WL1A 3MDWA 5E9XA 3JR2A 5C9RA 2VQTA 3VYLA 1JYNA 1OF8A 1WZMA 1KTCA 4AF0A 1HO4A 4WSKA 4Q6XA 1VJIA 2OKTA 4QAIA 4M82A 3TW7A 4JCMA 2C14A 4FHAA 3CHFA 4LB4A 5U4NA 1XC6A 4PMQA 2FZMA 5H1WA 4ICMA 1TV8A 2XISA 1OY0A 3PPGA 4ZR8A 4HD5A 1JDDA 1XUZA 5HQLA 2CHNA 2FZBA 1W31A 3IJ6A 4WLCA 2ODOA 2VC6A 2PE4A 4GD0A 3DG7A 1DQXA 2F84A 4WHBA 2E5CA 3PJUA 3M0MA 4A21A 4EK7A 2WKJA 2NSOA 2V5BA 2P53A 1DHKA 2YB1A 5GVJA 1NM9A 3CWNA 1XJBA 5I6SA 4I8DA 4JKLA 1QW8A 1XBXA 1TQXA 3ATYA 1B3OA 3L21A 1GG0A 2CCRA 4Z2JA 4HHLA 3BH4A 1ICQA 4M8UA 2E5BA 1B30A 1CZ1A 1XIMA 8RUCA 2FTWA 3UY7A 4GQBA 2EPLX 5LYRA 4ZBCA 4G9PA 5K9XA 2AAAA 4M5PA 1QASA 3KOZA 1TJ1A 3CAVA 3OZOA 4CNOA 3XIMA 3QQ1A 3T8QA 1B3YA 4UNLA 3MUAA 4AYGA 3UJSA 1AJ0A 3KVMA 1SUXA 4TX8A 3FYPA 5LNVA 1A0CA 2GSJA 4QE5A 2JBMA 1LLWA 2FJUB 3W26A 2NX3A 3NQAA 1Y5VA 2VTFA 4S3JA 3QQ0A 3W2JA 3UR8A 1E9ZB 4ZENA 1QDSA 2CHOA 4JTFA 3A47A 1W54A 4GI4A 5DY3A 3H7RA 2V81A 1WE5A 3S8HA 4MJ4A 4DUXA 2VEKA 1DPMA 1TX0A 4F9DA 1J79A 1E6NA 1M1BA 1U83A 4X60A 1SW0A 3SDOA 3E0WA 3S9IA 4NL1A 4ZOEA 1J2BA 1DWHM 1P0EA 2Z2BA 2ACRA 2Y61A 4FAMA 2UY2A 4XIAA 1OG6A 1NOFA 4HGXA 4UTTA 3POCA 3WLLA 3L2LA 2D1ZA 3AHXA 2OZ3A 3PPHA 4DELA 4LU0A 3G1DA 5I0DA 3A5FA 2HBXA 1A49A 2V63A 3TJLA 2YW4A 1ME8A 1QPOA 3DU0A 4UTMA 1E6PA 5A6JA 3GC2A 5D2VA 5JIPA 4FLQA 1Q6FA 5EKYA 2INZA 3LG3A 4GABA 4YMZA 4XD4A 2OX4A 1ZCCA 1CLVA 2X1UA 1H2JA 3CWHA 5BMWA 1B1YA 2DFAA 3L4XA 4PULA 2C8NA 4MY1A 2A0NA 4YU1A 3GWQA 4HCDA 3R13A 4LUYA 4OHQA 3HN3A 4QCEA 2X42A 1XGZA 1ECQA 4AXKA 4ERAA 3TMLA 2XIJA 1GHRA 3ZZ1A 4JS3A 4TTUA 4EX4A 3WLPA 3KDNA 2ACSA 1JQVA 2ZKMX 4L4LA 4A35A 4MKNA 4RE0A 3H2OA 4ONVA 4PFMA 1EP1A 4E8GA 4TR9A 3R79A 1ZB5A 3GQYA 4JZ5A 4F2BA 2R6OA 3GYCA 4TV5A 1LWHA 4UFLA 3VIJA 2XGIA 2ZA2A 1HJSA 3KS5A 2G3FA 1OT1A 2O9TA 4B9ZA 3CV7A 3TQKA 4C5ZA 4FZIA 3IS4A 2CZDA 1O60A 1LT7A 5DY2A 1VRDA 1OD0A 4N9DA 4C6PA 1LJYA 3H21A 4GFSA 5H6HA 3WD2A 4UC5A 3B9AA 3CIWA 4S2CA 4F2UA 4JY8A 5HUOA 3U2EA 3ITXA 3ITGA 4B3KA 2W6RA 1US3A 2JK2A 2BY2A 4NXKA 1KRMA 5HNRA 3BG3A 4GVIA 2XIQA 4XK2A 4O0QA 2CLFA 3ONCA 3TR2A 2J75A 1V3JA 2QGHA 2YDAA 3LHVA 2C1HA 3CHCA 3QMTA 1ZJIA 4GNJA 2W4XA 1R47A 3UWWA 4CKQA 2O7SA 1TA3A 2ZZ2A 5H8PA 5TF0A 2AL2B 2AQWA 1XDLA 2B4GA 3UZ5A 1O68A 2KX9A 5FJOA 1CGYA 5I24A 4AZGA 1L6GA 5FF7A 1OM0A 4YJ5A 1TWSA 4MAVA 3ARTA 4PUWA 4DPQA 1BEUA 4MYXA 1SW7A 4H6RA 2A3AA 3HO8A 4TTGA 3AMDA 3ZSTA 5CBBA 4A05A 1NWUA 1PVNA 2VD8A 5H8UA 4DJDD 3CT2A 2H8XA 2FH8A 1RVGA 4DWSD 3L4YA 3VZZA 1GVQA 4M56A 3WQCA 3AIWA 4H19A 2CPUA 3N2CA 4N9CA 2W27A 3OW1A 3PZVA 3L23A 4CUCA 4Y9MA 3Q94A 2R1LA 1BF6A 3I7RA 3FYOA 2W5FA 4MB4A 3LI0A 4JX5A 5I78A 3PK7A 1GHSA 3AROA 4YVVA 1KWGA 1MRQA 3DHUA 4DWDA 4PEEA 5KZ6A 4ML4A 3NZQA 3H4XA 3CZEA 3PZQA 4EAYA 5JVLA 2Q6ZA 4K8EA 3VIOA 2WCAA 4GJ1A 3CUFA 3N15A 3MB9A 3IARA 4GLEA 2Z24A 2OFJA 4RV8A 1LUCB 2QUNA 4WY0F 4LNCA 1P7TA 3WJSA 2PDWA 2BY0A 4GX9A 2OEMA 2IMRA 1DTNA 3KBWA 4INFA 3W72A 4GY7A 1G1YA 3MJMA 3LMYA 1R0MA 4MG4A 4E4PA 4Z2KA 3EDDA 4HYVA 1E73M 4UTWA 4B91A 4HPNA 3NQFA 3HMCA 3LGEA 2XVKA 4GZIA 3K13A 3W1MA 5AFDA 5AHEA 4NAEB 2WSQA 2QS8A 3TR9A 4HA4A 5D30A 5E70A 1M9HA 2WVVA 2NXHA 1CGUA 1XC4A 3N6HA 2I9UA 5I5RA 3ARQA 5D8ZA 3NWRA 3AYRA 2PLCA 2C1IA 5BROA 1Q45A 4GCAA 4LVDA 3PUEA 2FTYA 4DYJA 3WLOA 1US0A 4YCPA 2HPMA 3BE7A 4U5IA 5DT7A 1EH9A 3W7GA 3TYZA 3EX4A 1DWGM 3FHQA 1V79A 4EF9A 1FOBA 3EBVA 3AAMA 5DFAA 1PB0A 2IKHA 3EWCA 3GUWA 3SGUA 3OVPA 3WUBA 2JF7A 3EGJA 1XLIA 3KOFA 2ZTJA 4LSBA 1P0BA 2ZA3A 3NSXA 3S1GA 2ALRA 2GJLA 4YPJA 4K36A 2ON3A 4I7UA 1DV7A 4C7DA 3N6JA 4HZ7A 2ZQ0A 3NTYA 3GBDA 2Z1XA 1JPIA 2OSYA 3BOFA 3ANUA 2I5GA 1Q2RA 1IT0A 1FCBA 1G5AA 4K38A 1J0HA 1VPXA 5FESA 4CCCA 1JI2A 1KFBA 4CVWA 3W7PA 2GQ3A 4IQDA 4MDOA 4WXZA 1HP5A 3KL5A 4HPXA 1EFZA 3RMEA 1NTHA 1PIIA 4ZO8A 3VGGA 1RK5A 5JQ9A 1RAKA 3UA3A 4U2ZA 1DOSA 2WANA 3T78A 1X38A 4IIBA 3LDVA 2YIHA 3FGCA 2FZ8A 3UCCA 3H55A 3P84A 3R12A 4C1NA 1Q7QA 3EB4A 2I5QA 2XFFA 4HKPA 3HF3A 4XKMA 4OBSA 4DBSA 3FSTA 1V4YA 5D9OA 4XZ9A 1P0NA 2Z1SA 1V93A 4M80A 1F3TA 1NDZA 3IVSA 3W7MA 1Q6CA 3QGKC 1R86A 4BY3A 1W5QA 4G5DA 3PP7A 4QXIA 3VABA 2O9OA 4U3AA 3PZTA 1EUNA 2O56A 1VGAA 4LVFA 2GZXA 2IKJA 1W1B1 2EKCA 5D9PA 3BXWA 2OOGA 3N2BA 2WJDA 9XIMA 4AMCA 1VLWA 1QHPA 3OZPA 4L80A 3HPFA 4CD5A 2V0TA 2OOFA 3OHMB 3S1UA 1KFLA 1BF2A 3MZ2A 3FAWA 3UVIA 1CB7B 2CZEA 2VYOA 1Z7AA 5IDZA 1KXHA 5DXYA 1DJIA 3ZJ7A 3VI2A 2KZHA 2Q8ZA 1QBAA 1X1OA 4HT3A 2A3LA 1ZALA 1LRTA 3TTQA 4UFKA 4QSHA 3UXLA 1E0TA 3S4TA 1YMYA 3O1NA 3AS3A 3WF1A 1T5AA 2C6QA 2NUXA 5CC3A 1SO5A 3CHEA 3DX5A 5BWFA 1MQRA 3ZR5A 3AQUA 1FWBC 2WMGA 5FI8A 1CLKA 2CLEA 4QJ3B 3IVTA 4MZ8A 3EB2A 5HOSA 1OFOA 3EX2A 3THUA 1BHGA 3MDUA 1VBJA 1H7NA 2WLYA 4NHVA 1TE6A 1ONEA 4DNHA 3GUGA 2J9ZA 1UYQA 2F7FA 3B0PA 1NAL1 2GJXA 2YBVA 1TO3A 5ENLA 1FBAA 3QV9A 3LS9A 3EMCA 4UFJA 3SRDA 4IX0A 5FAJA 4E8CA 1TFVA 2QPXA 4ZB0A 5EMKA 1OX5A 2FMNA 1UH3A 2G96A 1H1YA 3B0XA 2PZ0A 3PNUA 2EAWA 3EWXA 3NDZA 2J74A 1CXIA 2OO6A 4OKDA 4LC6A 1ONXA 2HE8A 1ZAIA 4P7RA 4W7WA 3LXAA 2A3EA 1VIZA 4W4QA 5IOBA 3BANA 2PD9A 3VU2A 3HG4A 1GQJA 3OJGA 1UKOA 4QP0A 4AISA 3PM6A 2BP1A 2CBVA 2DZAA 2X1RA 2DUXA 1XS2A 6A3HA 1L6WA 4PMYA 1KD0A 3PBWA 1FUYA 1T99A 1EYWA 5G4HC 5CAKA 1JAEA 2R24A 2ZXQA 4O54A 2PLKA 3SCOA 3TSMA 4C90A 2OLAA 3LPPA 1A5CA 1FHDA 5HR6A 3AOFA 4ORMA 4JFWA 1AL7A 4A8IA 6REQA 1C8QA 4WX2A 2BX7A 3V5FA 4ALDA 1IR1A 1JXKA 3R2GA 1EGZA 3EX3A 3ARZA 3CPUA 1NARA 3K46A 3STCA 5G5IA 2PP0A 4XBKA 1S5WA 3R58A 3ECQA 4WD0A 3U8GA 4MPQA 1H63A 3GG1A 4RX0A 1IEVA 3A3HA 2NQHA 1Y0EA 3O07A 3W7HA 1IF2A 4GINA 4KH2A 5LA2A 3UGVA 3GG0A 3NM1A 2I7GA 4O18A 4LPCA 4PL1A 3PJWA 3QHNA 1YBQB 4EWND 4GKLA 3Q4DA 3WK3A 4GH3A 2CHRA 3S6TA 1ISZA 3RHGA 3FS2A 4POCA 3LNMA 2VX7A 2WNZA 1E0XA 3WDHA 1TZ9A 2V2DA 2FPYA 2EXOA 3W1UA 2OJPA 1Y5XA 3R89A 1Q7ZA 3H2AA 1JL8A 1W1PA 1EZ2A 3G0UA 3S9ZA 1TTPA 4I7VA 5D2TA 3W7QA 1O12A 2WB5A 3FA5A 4Q4OA 3W1QA 4FXJA 4NJGA 3ITTA 3G1XA 3GD6A 3G1HA 3SR7A 1R85A 1QBBA 1W1ZA 2HQAA 1JCLA 4IIHA 2A6LA 1EF2A 5LHEA 3ZS4A 1OZQA 3WJWA 2OEKA 3M5YA 4QG9A 3QEZA 1UOZA 3WQ5A 1JUBA 3SGZA 4LBSA 5F2GA 2O4QA 4GG9A 3UR7A 5G4EA 1JZ3A 3MO7A 1JYXA 5FF2A 5A8MA 3DBNA 3M0JA 1KBBA 1GTHA 5IBXA 1B2YA 2HZGA 1QU4A 3FKKA 3GIQA 3M0ZA 3KRBA 3LHZA 1VCFA 4EE9A 1PHWA 1JDCA 3KLLA 3G1SA 3H53A 4WEVX 3F2DA 1BWVA 5CC7A 3LENA 4NAFA 1AFSA 3L67A 3OYZA 3DKLA 1DQWA 4QEEA 4NSBA 4HNOA 2R82A 4IJBA 5EL1A 1L6FA 1ZZMA 1R9ZA 1BQCA 2XGBA 1YIXA 3M0YA 2PDHA 2D24A 2WBKA 1KGWA 5I3HA 1RSCA 2PP3A 4IL2A 3FJNA 3TH6A 2P8BA 1V7YA 4WK9A 4DJEC 3KEHA 2ZUUA 2GK1B 3WLHA 4JPGA 3MP5A 1JG9A 3WDJA 1BRLB 1IGSA 5HJLA 2WZTA 2ZUNA 2HWGA 3MP3A 3UF9A 3TC3A 2PUZA 2GPTA 1U5HA 2ZX9A 2E9MA 4QITA 3CQKA 5C7VA 2V68A 2FB3A 2PBOA 4RR4A 3GDRA 5KZEA 5DCDA 1X8FA 3IPWA 4L1GA 4S3BA 4ZB2A 4RE2A 4DX3A 4WOQA 2E4TA 3L68A 2NV9A 4KEUA 1TPEA 4LS2A 5BXTA 4L9XA 1TVPA 3L5AA 1UP2A 2AKZA 1B3XA 4IG2B 3RDKA 3B8TA 1XG3A 3CPGA 3CV2A 1AZ1A 1OCJA 4GNVA 4UQCA 1GZ1A 4PUEA 1KRBC 4H83A 4US5A 3T8LA 3RPTA 5G2WA 4B5VA 4XSLA 3MVTA 4MTVA 4EXBA 1HKMA 2QPSA 3NO1A 4S38A 3W53A 4ACZA 4G7EA 3PZIA 1ZBVA 2BODX 4I3GA 2IPJA 3W87A 4AD1A 4Z1AA 3B04A 3T05A 2BHUA 4KBXA 4DHGA 3BURA 3EPNA 1ZTVA 4ZL1A 1FQ0A 2QCCA 1XLEA 3S5NA 4ZE5A 2QV4A 5A95A 3I3BA 3I65A 4PMDA 3G0XA 2VDHA 2JKEA 1LRQA 3PZOA 1W5PA 4LXFA 2FMOA 2VX5A 4D71A 3UXKA 4DZAA 4FIQA 2F2HA 1H4PA 5E6ZA 1UMYA 2PGEA 1Y7VA 3QVQA 1I9CB 3ZFHA 1CDGA 4MLRA 3RU6A 3T0CA 3ZOAA 4FK9A 2C1GA 4O17A 1A5LC 2W91A 1HZYA 2W0UA 1E55A 3QF0A 2DVUA 3LTSA 4GVGA 2YDRA 4RZ6A 1XXXA 5CZ0A 1SZRA 4JXCA 4AF0B 3FOKA 2V3GA 3CLWA 4HSOA 1GJUA 5LHFA 9XIAA 2PDYA 1E9YB 1GQIA 3QSRA 3UBPC 3LLFA 5TIMA 1WYIA 1RQBA 2X7WA 3DN5A 4NASA 3NO5A 3JW7A 2J47A 2Q8XA 3I10A 2IQ0A 2IPFA 3M9YA 3D3FA 1T41A 2QNEA 3R94A 4N4PA 3SM0A 1AQHA 1IEQA 1UWQA 1W8GA 4ZQRA 2PU0A 4PCPA 3W75A 2IW0A 1F6YA 4QG6A 4BK9A 1C8XA 1Z9AA 1MUMA 2X41A 3FDKA 3UNTA 1UMLA 4QIUA 1OCNA 3NEHA 3APGA 4ZZ9A 3FJ4A 4W5ZA 1A3HA 4FXRA 5CPNA 3RILA 3OEXA 3CAKA 3W6MA 2UY4A 4BS0A 2VEMA 1K1DA 5I79A 4HN4A 4BI7A 4GVHA 1DWFM 3GAYA 3NR0A 2VWTA 4FOKA 1KWKA 3RR1A 5M2FX 3TCSA 3GTXA 1FDYA 1QI2A 5U7SA 2BG5A 2HNEA 1RJRA 2G3NA 2CESA 1PZ2A 1FFQA 4V27A 2YL6A 4HU8A 8XIAA 1YYAA 3MUXA 2JE8A 5D05A 3VGEA 1NWTA 3AIEA 3VDCA 1E5JA 4O1BA 1IZJA 3VNYA 1D2KA 1ZL1A 4F0MA 2ZZ5A 1GOOA 3TA9A 1G69A 2DSZA 4DUVA 1NY1A 3DH7A 1OX6A 1HFBA 2PRHA 1FDJA 4FNUA 3NZPA 3TN5A 2SFPA 2NUWA 3THCA 3QY7A 2IPGA 2EPHA 4CNUA 1BVWA 3BG9A 4S39A 4F3HA 3VFLA 3CGTA 5LIWX 1VPQA 1V6XA 2DORA 3W6LA 1CGWA 3V4BA 1X6NA 3W25A 3CL7A 2GQAA 2FTPA 3PULA 2ZZ1A 4H7ZA 4LV4A 5FIPA 2G41A 1QUMA 1R7OA 4PCFA 1WDSA 3IAPA 1F8MA 5FEZA 3DXIA 1QPNA 4PMVA 1EPXA 2VGFA 2B7OA 1CYGA 2Z00A 3M0XA 1FHUA 4RUBA 4FF7A 4A22A 1GK8A 2R8WA 1NDVA 1B3ZA 1YNQA 2WSYA 5L9FA 2CETA 2GUYA 3G18A 4GQRA 4WJ8A 3ITLA 3G6MA 4QCFA 2WJZA 3P3BA 3QTPA 3FDGA 1GKPA 3QMSA 3GFXA 4IQLA 2FB2A 5BCAA 1W3TA 1E6XM 3YPIA 3N14A 3SCSA 5AC5A 3RN6A 1XI3A 1DYSA 1MEWA 4E2BA 1QO2A 5HPOA 4PRTA 2VD9A 4R85A 2NV1A 3FN9A 1XLGA 1R3RA 4BZYA 1DVJA 4QM1A 2TSYA 2FYMA 4W7VA 1EOKA 3WNOA 3N29A 3EEZA 3U7BA 5F4WA 3NDOA 3G3MA 2QW5A 4PB3A 2GYIA 3R8GA 5KEZA 4E8DA 1J0ZA 1EJRC 3IUHA 1M68A 2W3ZA 2VMFA 2YW3A 1EWEA 4BQ3A 4HPJA 2P3EA 3IWPA 4MFDA 3O8AA 5REQA 2OPJA 4Q7NA 1H62A 1T8XA 1QATA 3NSMA 3WEMA 4NZCA 1YPFA 4UIOA 4GH1A 1ODUA 1IE7C 1QW9A 1O94A 2OWWA 1R7AA 1NSJA 1LYXA 1DXFA 1GVFA 1VYPX 4HNNA 1TMLA 4Q8MA 3SUSA 3W3OA 7CGTA 1X39A 3OA5A 2BGNE 3AISA 1WXJA 3BLDA 4A8LA 4PH6A 3S6DA 3IJIA 3CASA 3WLQA 3UP8A 3GW0A 3BDKA 2G95A 4D6DA 1FWIC 1JD7A 2PF0A 3Q58A 2ZTKA 1KRCC 2ACQA 3LRMA 2DSKA 2OELA 3URAA 2VRQA 4ZB5A 4CNNA 1HKKA 1TA3B 3OLGA 4E2VA 4QJ5B 1UD2A 1HTIA 4EWJA 3NURA 3ZMRA 3QZEA 3EWWA 5CLWA 4XKYA 1KBKA 2PDBA 3S1VA 4LYRA 1QVBA 4IMFA 1I4NA 1J2WA 2G5WA 3ARUA 3LBOA 1F73A 1ZLPA 1XICA 2R1NA 3L7RA 3GR4A 4H7VA 3GZ3A 4UCFA 3MV11 4YCOA 3G5EA 3MQTA 1ZENA 4I9JA 1I2OA 2P0IA 2C7FA 2VZTA 4GIRA 3N3TA 4ZSUA 5LIXX 2Y7FA 5FKYA 4MUZA 3MA8A 3ZLFA 4AH7A 4XB3A 5CLTA 1YPIA 5A8PA 3BGJA 4O1DA 4DJFA 3T0BA 1CENA 4ADSA 5HQEA 3O6CA 4CD7A 2J6VA 3KCOA 4UTJA 4C6EA 4TX9A 1UC5A 4PN2A 3VNJA 1RJQA 4F0LA 3HV8A 2CITA 4BHYA 4M6QA 4HTYA 4Z0SA 3S2JA 3OHIA 2YB4A 3GTFA 2AKMA 4K7YA 1XYBA 5ECVA 1UWTA 3WBWA 4LF2A 4C6FA 3SJ3A 2C71A 3LY0A 2PGWA 3H7UA 4D2JA 1P7TB 4JHMA 2A85A 2HK1A 1EA0A 3GVGA 4TMBA 3WF2A 2YYUA 2C13A 2TMDA 3CMFA 2NQJA 3BL3A 4XQ6A 3W23A 4LH8A 4JTAA 4JFVA 3F5KA 4AIOA 1MWOA 5DN1A 1V6VA 3UERA 4IGNA 4JTHA 4LRSA 3P2VA 2ZIDA 1QPRA 1PZ3A 4XTIA 2NQZA 1ZNNA 1A3XA 3IIXA 2CLHA 4PUNA 4J3SA 1WCGA 2X2YA 1P6BA 4GK8A 1YE4A 5B7YA 2WMKA 4F4RA 2D0HA 2WVVB 3LGGA 1BYDA 1HVXA 3PG8A 1GKQA 3P60A 3LCXA 2Q3OA 4LY4A 1JZ4A 3WX7A 1OFQA 2Y7EA 3QKZA 2EJ1A 3KDOA 1RBLA 3COTA 1W91A 1QW7A 4XTDA 3U4FA 1EX5A 3BAXA 4NZ1A 1EF3A 2WLZA 4IISA 1P48A 4WF7A 3AMGA 5K9CA 1E40A 4ZFMA 1WX0A 4HTBA 1A5AA 4JD4A 3HGRA 4UOQA 4AFYA 3Q65A 2ZOXA 1EXBA 5C71A 1TVLA 3WQFA 4OV9A 2EO7A 4FOUA 2I56A 5C6MA 3B8WA 4ZTYA 3C0SA 3ATZA 4FLRA 4ATWA 2HROA 5AY7A 1V08A 3UCDA 2J8FA 2O4MA 1JZ6A 4LRTA 3A22A 2I16A 1W9XA 1NOUA 2CNCA 3M46A 3LSCA 1WDQA 1YX1A 2P0OA 1SFJA 4JTDA 3LNPA 3XINA 1UB3A 3BQ6A 1SR0A 3FGCB 1LWIA 4A3QA 3GM8A 4C1NB 2EQDA 4QBXA 4X0VA 1MW2A 5IHSA 2ZC8A 2PTZA 3WH8A 4KT2A 2GOUA 1GQKA 1QNQA 1REQA 4DJDC 4RPPA 2G3MA 2ZUSA 4NI3A 3CAQA 5B7ZA 2J66A 2WWDA 3AYVA 4GNKB 3GDTA 4JFTA 3HPSA 3EDEA 2QVHA 1VC4A 4M29A 3HMJG 2PDQA 4DQWA 3MBFA 1BWKA 1FWJC 1PDZA 1H09A 3ES8A 1QJWA 2P1FA 3BO9A 1KA9F 3P62A 4UFHA 4Y9AA 5JUVA 2ZXDA 3KVKA 1D3CA 3IK2A 4OV4A 5HMSA 1BVZA 4XO6A 3NPXA 2ZFAA 3DDMA 3RM4A 3NGJA 3GLCA 4MMWA 1EX1A 1J0KA 2XN2A 4F48A 1WUFA 4Q33A 4AD2A 2WQDA 1AMYA 2YDQA 1C8VA 1F6PA 1UPPA 4NJKA 2HVMA 4NNBA 2XIIA 4C6MA 4E4UA 1JAKA 1XLLA 3LZ3A 2FDMA 3OVRA 3BLPX 3W29A 4KGJA 3KL3A 4W89A 1SSDA 5EU9A 1UROA 1OSEA 3WFLA 4BF5A 3N11A 1F05A 4HMNA 2PDLA 3RJXA 1UD8A 2VR5A 1POKA 1UPMB 4LTSA 4GUJA 3INPA 1W9VA 1KFJA 4NILA 1E3XA 3MBDA 3IGSA 1Z48A 5TD4A 3G8EA 3W22A 3W1NA 5CC6A 3TSBA 4PCTA 4JNMA 3CUGA 1KGUA 4AZCA 4M6VA 5AZ1A 5I06A 1SO3A 2PODA 3N6QA 2CBJA 2ZZ4A 2DEPA 4ASTA 4WIWA 2GJXB 3U7VA 1POJA 3QW3A 5A94A 1QNSA 3SN4A 2HTMA 1NOWA 4NX5A 3DYPA 4FOJA 3P0WA 1X98A 3I68A 3ZQ9A 1W8SA 2VC5A 4UTLA 2JFEX 4B15A 1MUCA 4JDYA 1JXJA 1OWQA 1XIIA 4LGXA 2DUZA 1MDLA 4LCQA 4IFKA 3QPEA 3EOUA 3SY8A 5G2HA 1W3IA 3L66A 3SCVA 1QNOA 2IKIA 1FWAC 1RA0A 3AXMA 3W38A 3CL8A 1CNVA 1K8YA 4ATLA 4D6GA 1FTXA 3KL0A 4OQVA 1JDAA 2GJNA 1R2TA 4JTKA 4UWMA 4E38A 2ZICA 1GONA 2QLYA 3OA3A 1DJHA 3NIYA 2YCIX 4KIRA 4NNAA 3SUTA 1I2QA 3NA8A 3VC5A 1P0KA 1XF0A 4JIQA 6REQB 2XVGA 2ZWZA 5FACA 3EDFA 2GJRA 1FWWA 2GDQA 2AQVA 3WZ0E 4DO5A 5T8GA 1K6AA 3EPOA 2D69A 2WNQA 4C60A 5ECUA 5FL0A 1UBSA 2WCSA 3AWOA 5C9XA 4GRSA 2I57A 5I23A 4JN6A 3KBSA 5KZDA 5AOUA 5GJNA 4JIPA 1MDRA 3K1GA 1CPUA 1XX1A 1PIFA 4AG0A 3OOQA 4UTUA 1O6IA 1TPWA 2XINA 4M19A 1A47A 1LL7A 4UTKA 7TAAA 3Q37A 5FJRA 2V8ZA 1A5MC 4WQ6A 4Y8EA 2WZIA 2XG9A 2E9LA 1ZU8A 4LAKA 4PTWA 5EMMA 3SRKA 2PB1A 3DC8A 3KP1A 1MYRA 2BB0A 1UW9A 1S2VA 3VOGA 4BQ2A 3B9NA 1Q6DA 2PS2A 1SZNA 3C2EA 3BLLA 1YDOA 3H26A 3W1LA 3BLEA 2CWXA 2WV8A 2VEFA 1IZCA 1UJPA 1BXNA 1AJZA 3L0NA 4HJWA 1M41A 3CH0A 5FSEC 3RX4A 4LUTA 4H9MA 3CU2A 3C3UA 1QOQA 1PDYA 4ZGYA 1D8CA 5I3IA 1W5MA 2PZNA 3DFQA 4FB7A 2ISVA 4LUSA 3S1WA 4JFSA 3QLLA 5F1VA 1KFWA 3HTWA 4AD4A 3KFTA 5F7UA 4CD4A 1XM3A 3WKZA 4DNMA 2GLKA 3EA1A 5E1QA 3JUGA 4U4MA 2P88A 3KX6A 1J6OA 4N9BA 1BGGA 1D9EA 2A79A 5AC7A 4NAFB 1SQ7A 1AODA 4Q8WA 3UZZA 3L0KA 1PTAA 1UJQA 2PTWA 4IXHA 1UA3A 1QXLA 4WVXA 1JF6A 4UTHA 1DTUA 1P5BA 1M01A 5D8WA 1C8YA 4RXGA 4C6CA 2E6DA 1ZPTA 3ZIZA 5FJTA 4UB9A 4Y9OA 1JIBA 4MWAD 2QPUA 1VLIA 3ITOA 4IJRA 3BCDA 2PA6A 3QLDA 1HKVA 3WDQA 1PYFA 3A12A 3SQLA 4A3UA 3BV7A 3TFXA 5H8MA 3VKDA 3B03A 3P67A 3ZXWA 1TJPA 3ELFA 3RJYA 1CT5A 4HOXA 3PS7A 5CZTA 1DJNA 4LB3A 2J78A 1P0DA 2BHYA 2XVNA 1JCMP 2PWUA 3VCNA 2UY5A 4URIA 2OB3A 3O2LA 4EPEC 1SZEA 1JPHA 3QOKA 3N4AA 2OXNA 4AAJA 2NZLA 3NQBA 2YOCA 1VENA 3LCFA 3N4EA 3EZ4A 3KZPA 1U2YA 2QJHA 2I1OA 4EPKA 3AS1A 3VD7A 3RUBL 4OT7A 3DERA 4GI9A 3RCMA 4X3ZA 4ACZB 4G7EB 3GKFA 1JPDX 4B2DA 1TZ7A 3VGDA 1IXPA 1VQTA 1K6WA 4M81A 4RNJA 1EPVA 2FHCA 2ACUA 2GGEA 2BVDA 4S2BA 4C6BA 3A23A 3KVJA 4HA3A 2PWEA 2WMIA 3MCNA 2B31A 3GG8A 4Z2IA 3MY9A 9CGTA 1DJGA 3CXOA 4NVTA 3BJSA 4YNGA 2DV0A 1J10A 2BLEA 1KB3A 3F4NA 3CS2A 3OQEA 3A5VA 1JCNA 1V3LA 3QZAA 4XV0A 3LTYA 3UYCA 4FXFA 2QF8A 3WQWA 4NNCA 1G6CA 1WNOA 3H4GA 1E43A 3R11A 2E8ZA 2E0PA 1AW2A 1NEYA 2ZYFA 2PLJA 3W24A 1SO4A 5CC5A 5CSRA 4ZOBA 3CBWA 1JYWA 4JTSA 3EOSA 4K1WA 1CW2A 3N25A 2VT0A 1TTQA 3ARWA 5BW6A 1G4EA 1PWLA 3N3MA 1NQKA 2JEQA 3B8IA 2MNRA 2OZ0A 2QUUA 4HQVA 1NELA 3O15A 1GT8A 3UY8A 3T6CA 4C7GA 1NH6A 3OG3A 2CBUA 3NQ2A 4LVAA 3GC5A 1I1WA 3MW7A 1NIUA 1E4LA 1E70M 3W1AA 4Q8NA 1KM1A 5HA7A 2OYKA 4H9XA 1IIHA 2A7RA 5SWUA 4YIWA 4FI4A 1LORA 4UCGA 2P76A 4RDYA 3BJFA 4UQ9A 3GIPA 3CH9A 1B0IA 4S23A 1SJBA 3WH7A 2RDUA 3FEMA 4N9EA 3BMVA 3T09A 2XN0A 1W17A 3SSZA 3OP2A 3NNTA 3W7JA 6ENLA 3PR2A 2TAAA 4GZJA 1IZKA 1JEZA 3W7EA 4AX7A 4MLJA 3Q67A 4QG8A 3WNKA 4IHCA 2WJEA 3TN6A 4CQDA 2XVLA 1G0CA 3SCWA 3A4JA 3W84A 4UTTC 3URQA 4C6OA 3U2OA 1X1NA 3ZWTA 2YLLA 3ARSA 4V15A 1PBGA 3AWNA 2V3FA 1OBAA 1LRNA 4A6GA 1H7XA 1V51A 3ES7A 2DJXA 5A6TC 1TV4A 4DWSA 2X0HA 4GY1A 4J5NA 4DYEA 1JPMA 3WLRA 1MMFA 1ZJBA 2WMFA 4GQ0A 1Q6EA 1IGWA 4YN5A 1SZFA 3A24A 2D0FA 1CWYA 4JICA 3GBEA 4YVPA 1EJXC 3ITVA 1EUAA 2WZHA 1BGAA 4YXGA 2WVSA 3KS6A 3B0UX 3NZ1A 2POTA 3GXNA 3APYA 3T42A 1ZCOA 1XLAA 1OGBA 3VINA 1U5JA 1Q63A 4Z0JA 1XD1A 3QGAC 1LM1A 4WGXA 4O8RA 4QISA 1LCOA 5BU6A 1OYBA 2ZX5A 1EJVC 4M6PA 4FR1A 5HNTA 4O15A 2VCBA 4JKKA 2UY3A 4R7JA 3UR2A 4LYKA 4IM4A 2E28A 2O7QA 3UU0A 1XLJA 1TE1A 3BOLA 3VKBA 2BWGA 3W73A 1C9DA 3QH2A 3MWCA 2E40A 2RKXA 3HQ1A 4J40A 4JTJA 1EBGA 4J1OA 1LZOA 4CEUC 1RQHA 2VDGA 1JCYA 3PUDA 5DBTA 3WQGA 4ZSTA 4FX6M 3RIKA 4U28A 3EMZA 2QAFA 5LNRA 3WBXA 2WQPA 2ZDSA 3O16A 5HXMA 3MZNA 3M64A 2CWNA 1XDJA 1RY8A 1GOKA 3UG5A 2NLYA 4E5TA 4YTTA 1O5RA 4O11A 4A8NA 1CTNA 3SQSA 1HUVA 1EP3A 3WNNA 3M5XA 2Q01A 3S6OA 2V67A 3BV4A 1HL2A 4XG1A 1JZ5A 3N9SA 4EIVA 3QN3A 1JRCA 1UA7A 1TELA 4DUOA 2RAGA 3MO4A 3HGSA 2O9PA 2A21A 3H6OA 1QNVA 1KFEA 1R3SA 2YYTA 1A80A 2F9RA 4EXAA 2BMBA 3UETA 4HZ6A 4ZCWA 1PEZA 4RZ4A 1XG4A 3VDBA 3FA3A 4HSNA 1H11A 2J7CA 4N6EA 1LOLA 2VOMA 1Z41A 5REQB 3IVUA 3SY1A 1E5NA 3AICA 5HINA 3T2PA 3VNIA 1Z8AA 1RHCA 2ZRZA 3CJPA 5IFPA 4N02A 3PHAA 3C5QA 1PKLA 3U6WA 3TJXA 4TVCA 4QGCA 3CQJA 3AHZA 6PTDA 3TXZA 4Q8UA 5I07A 2FGLA 4Q8TA 3GXTA 3WY1A 3KCJA 2XWEA 2DH3A 1YNYA 3GSMA 3SAZA 3V36A 1H7RA 3ANVA 1A4LA 4R9OA 1YRRA 3UG3A 5A2CA 2VP8A 3LYEA 4H8VA 4H9YA 1FCVA 1DEDA 3CZGA 1E4MM 1PE1A 3FEQA 1P4CA 1YTDA 2XH4A 2EPMX 5DO8A 2E77A 4Y7EA 4XISA 1SFTA 1W1TA 4JX6A 4B5UA 3KTSA 1GEHA 4XKYB 4NZJA 1JF5A 2I17A 1NFGA 4AWUA 1UC4A 5FL1A 5MKGA 1OFPA 1S3HA 4N7QA 3DFYA 4KEMA 3WO8A 4UTFA 3LHYA 5CJ5A 4W85A 1BD0A 1W9DM 1XIDA 3BSHA 3SEPA 2GL5A 3TLQA 4UTWC 2DQXA 1UH2A 5AVNA 2VC9A 2DIJA 2J13A 1QO5A 3A13A 3E02A 4M0XA 2DT2A 2Y2WA 2O55A 1L0PA 3U9IA 1IEIA 3UWVA 2Z26A 1KM4A 2BS9A 3FVDA 3KAOA 3EB3A 1C93A 4Q8PA 1EC9A 1RPXA 3JS3A 4LBUA 4BQ4A 2Z7GA 1O1ZA 1UBPC 5ABTA 1MXGA 4GXMA 5BYWA 3GAKA 4IMDA 3WFZA 3C86A 1RPKA 3K8LA 2QDDA 3H2NA 1EKOA 2ZRXA 5CZSA 4GA8A 3VDAA 4UFIA 3BSGA 1CECA 2Y6ZA 1XPGA 1V6YA 2ASHA 1UIPA 1VH7A 1J6PA 3QY8A 3WELA 1WKYA 3PJTA 4GZ7A 2WXDM 3S2LA 1BQGA 2QGYA 2R91A 2YL8A 1MQQA 2ZUWA 4G2DA 4QDMA 1MO0A 4LT9A 4GHRA 3TSDA 2D2OA 2E1WA 2VM8A 3URNA 5CEWA 3FXYA 4G1NA 4F66A 4JTEA 2BZNA 5LXEA 1UQZA 4Y8FA 4N4QA 4Q8OA 3XISA 1XRFA 3REQA 5DT5A 4KWSA 5G4WA 5FJIA 2WKGA 1K9TA 3QGVA 4CLMA 1IQ8A 4HOZA 3ZJ6A 4HOWA 3IIVA 1TMQA 3SUWA 2ONEA 2RGMA 1VCVA 4FNTA 5C2CA 4RK8A 3DI0A 3U5YA 5AB3A 3TNOA 3MUZ1 1D3HA 2XSXA 1G01A 2CZ5A 4CD8A 1WXYA 4LAMA 2DW6A 2J7HA 4MJ2A 1GJPA 3DGBA 4GQGA 1YDVA 3DZ1A 4E6MA 3UZJA 4PYSA 4XUYA 4J28A 3CT7A 5CGQA 3W88A 1EO5A 3STFA 1AH3A 4UMAA 3UEQA 4DLFA 3M41A 2D22A 4S3AA 3QC0A 1QCWA 4PL2A 3A6OA 1GW1A 1EQPA 2FZDA 4RXFA 3LPFA 3WH6A 4Z1DA 2OZ8A 4KGLA 2WSKA 5D4YA 2B81A 1VJZA 5D33A 2ZZ6A 3BLOA 4XWUA 2FVMA 5D02A 3VGFA 5EPDA 5CSYA 4QFUA 1U30A 2DP3A 4HCLA 4KS0A 1XYCA 2WPGA 3S0CA 1ML1A 4GUIA 1YXYA 2VURA 2OEJA 3MKCA 4H6EA 4JFUA 5GNXA 3WMBA 2PSNA 7ENLA 4X63A 4NU7A 4AVOA 2NWRA 3T81A 2R1MA 1W9PA 2QJMA 3ZSSA 4WGHA 2E6FA 3M0VA 5LXXA 4WSHA 1YDYA 3L12A 4FX7A 4LALA 4ZQCA 4GCXA 4JHOA 4DBDA 1JCXA 2HBVA 4O1CA 2R1KA 4MOZA 3AJ7A 1EA9C 2QHAA 3EX1A 4Q3MA 1REQB 2OWCA 2F8QA 4IUOA 5E09A 1RCXB 5MHBA 4TV6A 1YADA 5C2XA 4MNLA 1XYAA 1ZRQA 2D23A 3BARA 3AU6A 1GWJA 1PWMA 3C8FA 3BZGA 3W71A 4PUUA 4Q4PA 1EIBA 5BMXA 3R1ZA 5IRPA 1BWLA 2WM0A 2BGQA 4H6QA 5TNVA 5LKYA 1VP5A 3LGDA 4FF5A 2PDJA 4PBGA 3GS6A 4HJFA 4NZ5A 1Y8BA 3ABXA 1H5VA 4EPBC 4N0RA 3RM8A 4WJXA 4J3TA 3SCQA 2JALA 4Q22A 2Y5EA 4TVDA 5CQ1A 1RXOB 4AZIA 3HB9A 1A3WA 5KITA 3AYSA 4JX4A 3M7WA 2W9MA 4PMNA 3T0AA 1XIBA 4KCUA 2V6AA 3M6DA 4ZFCA 3VKCA 1V3IA 1K3UA 3MMDA 1MFVA 1NVMA 1P1MA 3IIPA 3DKJA 4FALA 4L65A 1BKHA 1AQMA 1J12A 3EOOA 4WDWA 4AC1X 2VEGA 3DFSA 3UR5A 3TDFA 1JZ8A 3LX9A 4UBPC 3AMCA 5DXXA 1PO9A 3U4AA 1UWAA 4PODA 5EFDA 4CNPA 2HISA 3TE9A 3T0TA 2G0WA 1UWSA 3VOCA 3EDKA 1RLCL 4E2DA 4JKMA 1H1ZA 3PNZA 3UCQA 1LBLA 1KM5A 3NL5A 1DXIA 4D6HA 2VFFA 3LXCA 2EG8A 1UR8A 4DY1A 2VENA 5D38A 1Z42A 1TWIA 2OQYA 1GOWA 4X22A 1ZBWA 2VRJA 3VD3A 4GIYA 4IMGA 1UZ1A 2RDXA 1BFNA 4AZCB 4NT0A 3KBMA 4ICNA 3RU8X 1RD6A 3IJDA 2F2KA 3UQNA 5TQLA 3RYSA 3C4UA 5M1TA 2VC7A 3QZ6A 4C6NA 3P0XA 2XZ7A 2XWDA 4QLKA 3T40A 3EOLA 1UP3A 2JQXA 3OIHA 3QW4B 3H12A 4ES4A 4IJCA 4FSAA 2OT0A 1PXGA 4IFKB 2OKOA 3TW6A 5K3VA 4CQAA 3HM7A 3B9OA 3BLFA 3EWUA 3N34A 2E9BA 2GQ8A 3UPMA 3K4AA 3TQPA 5C9ZA 5E6YA 4B2DD 1V6WA 3CQIA 4LCRA 4J3XA 3OLDA 4US6A 1G4SA 3R25A 4F8XA 4P8VA 1YEYA 3N18A 1LG1A 3GNOA 4GO8A 4KETA 3ABZA 1HJWA 1UR3M 3TONA 3UVAA 1PCWA 3EWZA 4O52A 1M65A 1CXKA 3I6RA 3UNDA 2QR6A 2BGSA 2XHYA 3N4FA 1ISVA 1YLVA 1XQLA 1ADOA 1W9BM 1Q13A 1XP3A 1FXPA 4E0CA 1HVQA 3B8SA 3TU9A 4OGZA 2VXNA 3BLKA 2QAPA 1YPXA 1TIWA 2QCLA 3OBAA 4WKAA 3RM9A 4XZNX 2IXVA 2VR4A 2GDVA 1LQAA 1HG3A 3UA4A 3ISIX 5JH1A 3B40A 1KBIA 2J25A 3M0IA 3KE0A 4UQAA 4WY0A 1HJQA 5GJMA 1RVKA 1I2NA 1GYMA 1XR2A 3GFYA 3LXBA 1OGSA 1XIEA 3FV9A 3E2VA 2YZRA 3TWBA 4JTGA 1TR9A 4J2MA 2A3HA 3IK4A 5EA9A 1N8WA 4KFPA 3GR8A 3GHUA 5IBXC 2QT3A 4XAPA 4F0HA 3UD6A 3H2FA 5BWAA 3PSWA 2E25A 2DVTA 4IL0A 1FY6A 2VFGA 4PBFA 4AEFA 1MEIA 1VHCA 3BAJA 4IZGA 2HVOA 3F4DA 3B9DA 2IS7A 3OG2A 5E0FA 1ZY9A 4TUFA 4DZIA 3GHSA 3CO8A 3PUGA 2J7DA 5GPRA 3TTOA 4S3GA 4AZBA 4LEQA 1J96A 3KM8A 1DJZA 1QNRA 1LQ0A 1GTEA 3KBVA 1VEOA 1J18A 1FWGC 1ZAJA 1W9UA 1KQZA 4LUTB 1XISA 4C6JA 1EQCA 1LLZA 1OEPA 2DVXA 1EDTA 1XIGA 3EX6A 1L6SA 1Q6OA 3TWAA 3LCLA 2CZFA 4IPLA 4R7WA 4LUSB 3W28A 1FWFC 4W9TA 1C9WA 3L2IA 1SR9A 4OECA 1JRBA 3K4DA 3AI0A 2YA1A 3ZR4A 4C6LA 3UG8A 3LD5A 3BLIA 5C8BB 4LAZA 3JZEA 2X8RA 3M0LA 3WH9A 3AIVA 1DE6A 2GVEA 1ZP4A 3N9RA 3PBMA 3R7MA 4WKHA 1O5QA 3W00A 4PMUA 2V38A 3S9YA 2Y70A 3CUIA 1RK6A 3CB3A 4X2PA 3MI2A 3DG3A 3UWUA 1VJSA 3WH5A 1TR1A 2FFIA 1TVNA 1AMKA 3L9CA 4LAOA 4PUJA 4B5WA 1ESWA 3S46A 4AY1A 3UJFA 1EWDA 3NZRA 3O3RA 5EFFA 5LSMA 1S2WA 3WQ4A 1TUXA 2Z4GA 3H24A 1XH1A 4FR6A 3KCLA 3W86A 4K8GA 4O0ZA 3G1RA 1AD1A 3QXBA 1EJ7L 1TREA 4HB7A 3VAVA 1K4HA 2JF6A 3WG6A 5AYYA 4V1XA 1B5TA 3AIUA 4JNYA 3QV7A 2J77A 4H7CA 1UKSA 3FKRA 3I6TA 1PKYA 1KXVA 2WC4A 1WZKA 5AYZA 3IJ8A 3DBPA 2ZC1A 3E0IA 4JEJA 2RDTA 3VIHA 1JD9A 2Y4SA 4H9UA 4LYQA 3FXGA 4IFOA 1KLZA 3MTWA 4P7LA 5HATA 4GIAA 4O57A 1V8EA 4AZ7A 3M6YA 2DZSA 3WUFA 1RP9A 2GDUA 1DE5A 4S3FA 1DBTA 3C0QA 1UR2A 3LPOA 1MZHA 2OCZA 1W1A1 1EP2A 1M7XA 3AU2A 1TPFA 3E74A 2J9YA 3WNPA 3CYJA 3LPGA 1CGVA 4ERIA 1K8ZA 2WMIB 1LP6A 4HK5A 5D03A 3PAJA 3NGFA 3MSRA 3MYOA 3OZYA 4L7ZA 1E6RA 3EKLA 2IPWA 3W37A 3ARRA 3W76A 1VFUA 1U1JA 1PS9A 2OSXA 1G7VA 4MAZA 2V2CA 1UUMA 4QS6A 1BVNP 1MZRA 1HGWA 4Y9NA 1FP8A 3JRKA 2FLIA 4FX8A 3BICA 1EEXA 1Z69A 2WMJA 5IM51 3HPZA 4PCSA 1PV8A 1J0IA 3U2CA 4IH3A 3QTGA 4V33A 1OK6A 3VM5A 3G8RA 3APTA 1GOXA 3G2GA 1AG1O 3A3XA 1OZMA 4QR6A 5E0KA 4Q4MA 3ID7A 1RD5A 5IFTA 3GC4A 3M7SA 4JTCA 5A6AA 3OQ8A 1K70A 4C91A 4JEQA 3TOPA 1UUQA 2Y88A 1XFBA 3P6LA 4Y96A 4GC4A 2FKPA 3MT1A 1N8IA 5LIYX 2VNCA 2WZEA 4IMCA 2BXYA 1TG7A 5T9CE 4I6KA 4FIRA 3QY6A 2RHGA 3IRSA 3D47A 1FCQA 2WOQA 2ZVIA 3CEPA 3L5MA 3USBA 4EP8C 2EJAA 3IEBA 4GYPA 3E0LA 3AMKA 1HL9A 2ESCA 2XU2A 1V0MA 3EKGA 3UWYA 5C9UA 1I60A 1X8CA 1YKWA 4KCWA 1ADSA 3EPMA 3D3AA 4Q7BA 3ZYZA 1S5NA 3GH5A 4IPNB 1MQPA 1WBHA 4MNMA 1S1RA 3P93A 4FP1A 3FSUA 2C0AA 5CH9A 3LBCA 4KEZA 5CAHA 3GG7A 3DEQA 3QJAA 2BBFA 1H5YA 4I9MA 4IFRA 1QK0A 2NSXA 2MANA 1KLYA 3LLDA 4XZHA 4W87A 3MMUA 1Z32X 4V2XA 3VVGA 4ZQPA 4BI6A 2GGIA 3HV9A 3WENA 1V3MA 3M47A 1TQJA 4YYFA 1EL3A 1IHIA 4KIEA 4DO7A 4L9YA 4RW5A 1GZJA 3L4UA 3AUOA 1N2VA 3NO3A 3IIZA 4DWSB 1XIHA 4KRTA 3WMCA 3ABRA 5EB8A 4D6CA 1V02E 2PC8A 3NL3A 3UZWA 3VILA 4J3WA 2G97A 1HXJA 2FFCA 1VFTA 1H7WA 4BA0A 3ALFA 2W79A 3PPFA 1IWBA 1DWAM 1OFBA 2E8YA 3BUVA 3MHUA 4NQ1A 2YA2A 3F2CA 3F2BA 4B90A 3VE9A 3RLVA 3CL6A 1FH7A 2QJNA 5J8LA 3QV8A 1LF1A 4MJZA 4AIEA 2GWNA 1TYGA 1FP9A 1S1PA 4IPIA 4ZOCA 3TYEA 1QTWA 3VO0A 3WN6A 3N2OA 5E0CA 1TPUA 1VEPA 1ITCA 3EXSA 5IXEA 4DAFA 1OCBA 5K7JA 5HULA 3W1TA 1R9XA 3KOYA 3EWBX 4MWAE 2QKFA 5G1TA 3FNDA 3H2CA 2W67A 4JOMA 2PI6A 1WDPA 3W2UA 1B54A 1MEHA 1UR9A 1FXQA 1P43A 4EKJA 4R34A 1OC6A 4LYPA 5AHMA 5BRBA 4DJED 5D09A 4DZHA 2Y85A 4PSRA 2ABAA 1EHNA 4ILSA 1E6SM 4CVUA 2V5LA 3MI6A 3SUVA 1VZWA 4KWVA 4KQNA 3UJEA 5LA0A 5B80A 3LERA 3RLUA 1QFEA 3R10A 4RJEA 1V0LA 1O4UA 4RPQA 3V5OA 1SM9A 2XFWA 3NFUA 4IP7A 4X0NA 3TW9A 2BTMA 2XFRA 4YTQA 1Z44A 4GVFA 1BG4A 3RNDA 3GNRA 1G4PA 4YWIA 4HVXA 4R5EA 6TIMA 2HV5A 4C6IA 4L4MA 3P81A 4REQA 2J88A 1E6QM 2WYSA 3B06A 3IRDA 1VS1A 4AIBA 8A3HA 3MSYA 3S3GA 4HPGA 3PSVA 3QPYA 1OJXA 1UZDA 4HU3A 4YTUA 3R0DA 4L64A 1IEXA 1GVRA 1TSIA 4DN1A 1HJVA 3WUEA 1G4TA 4UQEA 4JN7A 3V0TA 3LV6A 4Z1CA 1F61A 4UXDA 2QUVA 1VHNA 3TTSA 1N7KA 3A64A 4IXXA 2BVYA 3DYMA 2GQ9A 2ZZ3A 1FKXA 4NG3A 1TMHA 4GBDA 5HANA 5H91A 2CLLA 5JMUA 2GVYA 5C2GA 4JAWA 5DELA 2VVNA 2DUAA 3HBLA 3GY1A 5CSSA 1SFLA 1HQTA 2YXOA 2YJQA 1EGVA 3UXAA 1OFAA 2A3CA 2HNHA 4QE1A 5EMUA 3TC6A 4XBSA 1F3EA 3GU1A 4NZ3A 3UT0A 3PTDA 4F2TA 3BAWA 3IACA 2GWGA 5I2UA 2J9XA 3BSMA 3G3DA 3VFCA 5K2ZA 2QJJA 4AD3A 2HXUA 3VX0A 3VIMA 1E1CB 4NI8A 4DJFC 2ISDA 3KOWA 3CQ0A 5DRIA 3WDPP 3A9IA 2E67A 1J01A 1KCXA 5CGTA 3OBEA 4RL3A 3WDRA 4ROQA 3CQHA 2A6NA 3WQDA 1XRVA 3DI1A 3HIJA 1DJXA 2Q02A 3UXIA 3ZJKA 5MKGB 2YSWA 1TX2A 4D9PA 4UR7A 4QHRA 3SRFA 1JFHA 2FJKA 2JEPA 3AZTA 3RX3A 3H8AA 2PWHA 4AWTA 3SZ8A 4CEXC 1TPVA 4DBUA 4IP5A 4OVXA 4Z2LA 3R0UA 4GO9A 4NYYA 3V35A 4Y2WA 3N2XA 4KRUA 2FIQA 1FCUA 3MHGA 4JNZA 3N12A 4ML9A 3HG5A 4QTGA 7A3HA 5D9MA 3CZKA 4MKSA 2BASA 3E49A 4MGGA 1XH0A 1JNEA 1C7TA 5AYIA 1JPKA 4R9XA 4K37A 3R8HA 2O92A 2DY3A 1W56A 1JJKA 2WHKA 4FXSA 4LCSA 4M3PA 4RNFA 4S3EA 4X61A 3GHRA 4PZVA 1BXCA 5CPMA 1O5XA 2ALDA 5DF0A 4DO6A 3W02A 1RCQA 3C2OA 3FA4A 4L4PA 2Y8VA 3UPWA 3VMPA 4N42A 4AHPA 7TIMA 4JDBA 2DQWA 1FWEC 3DFPA 4NF7A 4GXPA 3WK1A 4M7TA 1LL4A 3BCJA 1CIUA 2VOTA 3M16A 2ZDRA 2Y8KA 4TXEA 3BGGA 2B7QA 4J9JA 4H04A 3LTPA 3NYZA 5LGZA 5H2ZA 5HJXA 2DU2A 1JQXA 4XZLX 1VRXA 3REQB 3IANA 1UWIA 4LW7A 3DAQA 3MV01 3GVVA 3VD4A 3H2MA 3ME3A 1GJWA 1E0UA 1GOMA 4JQ3A 1AZ2A 3W7OA 4OJYA 1HKJA 2RJGA 5CJNA 1HX0A 2POZA 1R3VA 3G1YA 3E2SA 4K68A 1JULA 1EJUC 4DF1A 2P50A 1H51A 3M07A 1S2AA 4BJHA 3WL0A 1V3HA 4J35A 3BWWA 2V5JA 1KCKA 5GNZA 3VX1A 3PWIA 3CB8A 1DXEA 3W2MA 5JBFA 1BSLA 1UKQA 4EANA 4TO8A 2V5DA 3NZGA 1UZ4A 2BOGX 3MUIA 1QPQA 5DRCA 3AHVA 1W0MA 2J7EA 1CLXA 2VEIA 3GDMA 1SYTA 3AHTA 4AUBA 3I4KA 2FDSA 4L4OA 4X2RA 5KETA 4AU0A 3QRHA 2BDQA 2CZVA 4EOUA 3GVQA 2C18A 4AEEA 1H0GA 3C56A 4BQ5A 4B9YA 3M44A 1AW5A 1VYSX 4GACA 2Y63A 4LS0A 3WCZA 4W86A 3LUTA 5MF5A 5HUPA 1K9FA 4BEQA 4CQ8A 1TJ0A 4M1BA 2HXTA 5HNNA 3JVAA 3GU2A 1GVIA 4LC8A 1X6UA 2P3ZA 4UNKA 4I8YA 4CQ9A 3AYTA 2QF7A 4HHMA 1VFMA 1BTMA 1Q4WA 1SFSA 4S3CA 1AH0A 3M0KA 2A4AA 2PDFA 4O4WA 3RLHA 3ZLHA 2G3IA 3SCUA 4A8RA 2VDIA 2IQTA 3LEPA 4LV9A 3NUKA 3HGOA 3LU2A 3DFHA 3WLTA 3LBMA 4MM1A 4UMBA 4WSJA 2RDWA 1TJRA 4QSFA 1S2TA 3DFTA 1M04A 1EBHA 3QR0A 4PTVA 3GNNA 4W5UA 1XH2A 4DUWA 4GMEA 7PTDA 4KWWA 2OSWA 2G4FA 1LBFA 3MCMA 1HJXA 3ICJA 2WPBA 1AQFA 3TZFA 1O7AA 1AL8A 3GXMA 3U57A 2ISWA 2NW0A 3KTXA 6XIMA 5CPSA <