3WBXA

Crystal structure of gox0644 at apoform
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
271
structure length
271
Chain Sequence
EAQTVISFHDGHTMPQIGLGVWETPPDETAEVVKEAVKLGYRSVDTARLYKNEEGVGKGLEDHPEIFLTTKLWNDEQGYDSTLRAYEESARLLRRPVLDLYLIHWPMPAQGQYVETWKALVELKKSGRVKSIGVSNFESEHLERIMDATGVVPVVNQIELHPDFQQRALREFHEKHNIRTESWRPLGKGRVLSDERIGKIAEKHSRTPAQVVIRWHLQNGLIVIPKSVNPKRLAENLDVFGFVLDADDMQAIEQMDRKDGRMGADPNTAKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative 2,5-diketo-D-gluconic acid reductase
publication title Crystal structure of Gox0644 at apoform
rcsb
source organism Gluconobacter oxydans
total genus 105
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature ec 1.1.1.-:
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3wbxA00
3RX3A 1LQAA 2PDBA 1Z8AA 4AUBA 4ASTA 2PDYA 3EB4A 2VDGA 2ACRA 2DUZA 1YNPA 2DV0A 2IPJA 3LN3A 1IEIA 4IJRA 2WZTA 2ACSA 2QXWA 4HBKA 2PD9A 3F7JA 4XVDA 4JQ2A 4WRHA 1A80A 4GQ0A 1YE6A 2IKJA 2ACUA 1SM9A 1Z89A 3UWEA 1AH0A 4QXIA 3CV7A 1FRBA 3GHTA 1AH3A 4QR6A 1XGDA 1IHIA 2IPGA 3G1RA 2HE5A 2R24A 4GA8A 4XO6A 2IPFA 3R6IA 4DZ5A 4YVPA 3EB3A 3WG6A 3RX2A 1XF0A 2FZBA 3LENA 4OTKA 2ALRA 2HEJA 3ONCA 4JIRA 4FZIA 3V35A 2FGBA 4DBSA 1ZUAX 4G5DA 3UP8A 3WBXA 1AH4A 3BUVA 2AGTA 2PDHA 3U2CA 3V0SA 1QWKA 1M9HA 2PDUA 3BV7A 4JQ3A 2PDXA 2FZDA 4JIHA 3GUGA 3WCZA 4LAZA 3ERPA 4JQ1A 3LZ3A 3BCJA 4JTRA 1ADSA 4JTCA 3LZ5A 3B3DA 4LBRA 4GABA 4ICCX 1S2AA 4PMJA 1RY8A 3UYIA 4PRRA 1C9WA 3M64A 3CMFA 5HA7A 1T41A 2INZA 4PUUA 5C7HA 2I17A 1R38A 3Q67A 4H7CA 5AZ0A 4RPQA 1MRQA 3T42A 2INEA 2PZNA 2IQDA 4XO7A 4GCAA 4XZMX 1S2CA 3LUTA 4IGSA 3V36A 4JQAA 4XZLX 1PWLA 4EXBA 1J96A 2HE8A 4HMNA 1S1PA 2PDCA 3CV6A 3COTA 1PYFA 2BGSA 1Z9AA 3P2VA 4FA3A 3H7RA 4WDWA 4QX4A 2PDLA 5KETA 1US0A 3QKZA 2IKGA 3D3FA 3NTYA 3RX4A 3GHRA 3UZWA 4FAMA 2HV5A 2PF8A 2C91A 4JTDA 2PDFA 3BURA 3UGRA 3LQLA 4WDTA 2WZMA 4JTQA 5JH2A 4LB4A 3MB9A 3FJNA 2IKIA 4JTAA 3LD5A 2PEVA 4YVVA 1UR3M 2PDJA 4JIIX 1HQTA 1EF3A 1AZ1A 5HNUA 1OG6A 4QBXA 1S1RA 2FZ9A 3LNMA 3ONBA 4L1XA 1MI3A 4XZHA 1YE4A 3H7UA 2IS7A 3O3RA 2CLPA 5LIYX 1X97A 1K8CA 3S3GA 4GACA 2ISFA 3R58A 3CAQA 1Q13A 1GVEA 5HNTA 4XZNX 4DBWA 4NKCA 4WGHA 3O0KA 4L1WA 2PDPA 2FVLA 4I5XA 3DN5A 3LEPA 5LIWX 1ZQ5A 3CAVA 2HVNA 2FZ8A 3UG8A 4XZIA 2PDKA 3V0TA 2PDQA 3M0IA 2NVCA 1PZ1A 2HDJA 4GIEA 3C3UA 1AZ2A 4YVXA 2F2KA 1EL3A 2R9RA 2PFHA 2PDGA 3M4HA 1X98A 2HVOA 5JH1A 4F40A 3V0UA 2P5NA 1ZGDA 5LIXX 3R94A 3R8HA 2BGQA 3LQGA 1PZ0A 1AFSA 3WBYA 2A79A 1EKOA 3UZZA 5AZ1A 1PWMA 4JQ4A 1EXBA 2NVDA 1RY0A 3KRBA 4DBUA 2F38A 5M2FX 4Q7BA 3CASA 1RALA 4FALA 4WEVX 3R8GA 1T40A 3UZXA 4XVEA 2IQ0A 1X96A 2J8TA 2IPWA 3FX4A 4PRTA 2I16A 1XJBA 2ACQA 1Z3NA 4IJCA 3EAUA 4GQGA 1LWIA 3DOPA 1MZRA 4PUWA 5DANA 3R43A 4LAUA 1Q5MA 4H8NA 3GHUA 3N6QA 4MHBA 2PDMA 1HW6A 4Q3MA 1YNQA 2PDIA 3MC5A 3LBOA 5LIUX 2PDWA 4YS1A 4LB3A 3UFYA 3G5EA 4ZFCA 3N2TA 2PD5A 4EXAA 2DUXA 4YU1A 2BP1A 1JEZA 1QRQA 4R9OA 4XAPA 3UZYA 4PR4A 4XK2A 3Q65A 1VBJA 4WDUA 4LBSA 3WBWA 4WDXA 3GHSA 2IKHA 5LIKX 3VXGA 3R7MA 1ZSXA 3H4GA 1VP5A 2PDNA
chains in the Genus database with same CATH superfamily
2Z0IA 4GD0A 4FNRA 4B3ZA 4S3CA 3NURA 5HXMA 4AC1X 1LT7A 4AU0A 1ESWA 2A4AA 4MYXA 3UPMA 2BHUA 1NDYA 3M0KA 3IEBA 3VM5A 1GW9A 1NJJA 4NILA 2VGBA 2IMRA 4RDWA 3AIWA 1GEHA 2CITA 2HVMA 3SCQA 2OJPA 1A5LC 3UESA 1C7SA 4HBKA 3SJNA 5I3DA 3DDMA 4KEZA 1MO0A 2X1SA 1MUMA 4LT9A 1CNVA 1FWIC 3B06A 1CPUA 3EWWA 3F2CA 4BWLA 1XKJA 5FJTA 3M43A 3MYOA 3WMCA 5IFTA 1X1NA 3FXYA 1V08A 1G69A 3LHUA 4R9XA 2B31A 3RU6A 3IIOA 2OPJA 2FB2A 3DG3A 2XDFA 3AMLA 1H62A 3ZT5A 2XH2A 2A7RA 3MZ2A 2Z25A 3AMCA 1QI2A 4PB5A 1I8JA 5KEZA 2TSYA 1B3OA 3QR1A 3TH6A 5T91A 2BNJA 4TVUA 4R27A 4B5XA 3W6YA 1UH3A 4MSSA 5CPNA 4BR1A 2ABBA 1TKKA 1SZGA 3F5KA 4HPJA 2J7BA 2C1GA 2QCCA 4G5DA 3A5FA 1DJNA 1K8YA 1LOQA 3REQA 4JTLA 1BG4A 1E9LA 4ZGYA 1LJYA 1IV8A 1J12A 2YBVA 2PDHA 4GKTA 3WLIA 5I03A 4DPPA 5TIMA 4H9ZA 1QI5A 4MGGA 3QY7A 3S2LA 1OK4A 3TN5A 4ZODA 4CD7A 4JTRA 1AQ0A 1FBAA 1GPWA 1EC9A 1XSKA 3WMLA 3M5XA 3EXRA 3K4AA 1JCXA 3QV7A 3V5CA 4MY1A 4CD5A 4ICCX 1S2AA 3RILA 2ZOXA 2PS2A 4BY3A 3TYUA 2BHZA 4JXCA 4H8VA 4FP1A 1R3VA 1UR2A 1XLMA 1KFBA 4JKLA 3E2VA 3VOCA 4IPIA 1IF2A 1GOWA 3C8FA 2ZTKA 1UZDA 1TA3A 3QPEA 3GLCA 1GVFA 2HXUA 1K8XA 4IG2B 4KIEA 3GNRA 3V36A 2RFGA 3VC6A 1R7OA 4GY7A 2Q02A 1YXDA 3VUSA 1TPC1 1PWLA 3BV4A 1JRCA 1GVYA 1JNEA 3WF3A 4NT0A 3A4AA 3VM7A 3O6CA 1CXLA 5CAKA 3GFYA 1TR9A 1IEQA 9XIAA 3AZTA 4ZBCA 2OYMA 2BGSA 3UWUA 4PMRA 3TC6A 1S5WA 3AIBA 1O1ZA 4D8ZA 3A22A 4RDVA 3GM8A 3WQ5A 2DT1A 1KTCA 2YJQA 2C8NA 2YFOA 1HGWA 3A23A 3UZWA 1IEVA 1KFKA 1IYXA 1RQHA 4B5UA 4JTDA 2GZXA 2OEKA 2XJ7A 1KFLA 1RHCA 3FDGA 4N6FA 3CH0A 3KBSA 5BZAA 2YCLB 3FJNA 3UPBA 1DP0A 3S8HA 1WOAA 4H00A 3TKFA 5C70A 1GQKA 2FPVA 4ZQNA 2E8ZA 1M7JA 1C91A 1WKFA 3BMXA 2C0HA 1S1RA 4Y8EA 2OX4A 3NO1A 2ZC1A 4F8XA 1O94A 5DMMA 3KP0A 4UWMA 4BK9A 1YE4A 1UUQA 1DWJM 4HMCA 3CGTA 4PMXA 3CAQA 3NGFA 1TV8A 4JIEA 4RE3A 5I3GA 2XGIA 3HM7A 4UB9A 2OYLA 1IZKA 2X09A 3PG9A 3IRDA 1XLEA 5K4ZA 1PDYA 1LBMA 4HKPA 2TYSA 2D69A 3MJYA 4M1BA 4CNPA 3OYXA 5AC6A 1GQLA 4JR5A 3CEPA 2D0HA 2CIPA 2PDQA 4A22A 3MMTA 4XZWA 1DQUA 3C56A 1RCOB 3CIXA 4L6OA 1TWZA 2GSEA 3OLGA 4EAYA 3DECA 4H6EA 5FL0A 3K30A 2DZUA 3ES7A 4KQNA 1S38A 3N6HA 3R8HA 1FCVA 4LC8A 3VDBA 3SADA 2BGQA 2J7FA 4ZFMA 4GIYA 3L2IA 3L2LA 4RW3A 2D2JA 3KTXA 4S23A 1BVWA 1HKKA 1AQMA 4UNIA 4JQ4A 4MB1A 4PEKA 1FDZA 3CIWA 4DBUA 3A21A 2XPKA 1CCWB 4MPKA 4S2CA 3BGJA 3GZAA 2HCVA 3NQDA 7REQB 4NAEB 5FF2A 3IVSA 3QFWA 2V6AA 3WLKX 3BPWA 1IEWA 1KTNA 3IRSA 4GQGA 2O9RA 3TTOA 1MSSA 2GFTA 4Z2GA 3CPRA 3QC3A 4O13A 2C19A 3JUGA 2NW0A 4L7ZA 4RUBA 1EPXA 3UZ5A 3W26A 2PP3A 3VX1A 3NL2A 1YDVA 2GK1B 1WCGA 3VD4A 1UASA 4AHQA 2VUNA 3F5LA 1SJAA 3TQPA 4F0SA 4XAPA 5AHFA 1HUVA 4QS6A 3T0AA 1EX5A 4CQDA 2VX7A 3M5ZA 4K8EA 3LTPA 1GOMA 1N8FA 5E0CA 3ZR5A 1B5TA 1LWJA 5A3HA 1A5OC 4UTMA 3HIJA 3OGVA 1F3XA 4H2HA 4TV6A 2HK0A 4AUBA 3IACA 4RNHA 4MIMA 3WK1A 3GYCA 2BZNA 2ZUMA 3Q2DA 3KLKA 4KGJA 1A4LA 1CX9A 2ACRA 4LY4A 4ECLA 3ABZA 1H1ZA 4JTHA 3TW9A 2HRWA 3LN3A 4TTUA 3O06A 3RIKA 1TJ0A 1HJXA 5LNWA 1DJYA 3P3BA 1UB3A 1LL6A 2PU1A 1RK5A 2ZWYA 1QR7A 1JCLA 3NZ1A 4E2DA 1MFUA 1DBTA 4WXZA 1H51A 1JXJA 1LROA 4HTBA 2JALA 3GHTA 1AH3A 3DFNA 2W79A 1PB0A 1VJSA 3PTKA 3LHVA 3ZYZA 3VIJA 1VPQA 4M7TA 4K7YA 4O12A 3FW6A 1WAUA 1M5WA 3WH5A 1OT2A 4NZ3A 1GCYA 2QCMA 1GJWA 5DMNA 1UC5A 1E6NA 2XZ7A 1S5NA 3PULA 4Z1BA 2PGEA 4AZIA 4UZSA 3PS7A 4JEQA 1NOUA 3C2FA 2EPOA 1Y8BA 3TR9A 3ITVA 5CQ1A 3STGA 1RVKA 4AHOA 1WAWA 2R14A 3TUUA 3H2MA 1BVZA 3TE9A 4JTGA 1EUAA 3RPTA 3AJ7A 3LGEA 3STFA 1M9HA 1OFOA 2VFHA 2PGWA 3AFBA 1TPH1 3VD5A 4F0LA 4XAYA 2TAAA 3W38A 3GS6A 3GUGA 3ITCA 1N55A 3MP3A 2ZRYA 3VNJA 1MUWA 3FHAA 4PTXA 2VQUA 4GI4A 2FVMA 3HTWA 4AG0A 2VR5A 4HNVA 4HSHA 4LUIA 4DN1A 2I1OA 3SN1A 1V6WA 2QAPA 3EPNA 5EMJA 4QLLA 5AFDA 3M0JA 3I6TA 5I23A 3ARZA 4XSLA 2J6VA 2PURA 1XC4A 1E4MM 1E6XM 3CMFA 2QCDB 4HPHA 3S42A 4PUUA 5HQMA 3K8MA 1O4UA 4MKNA 5AZ0A 4HZ6A 1LQ2A 4UC5A 4J27A 4CLMA 3SDOA 1SZFA 3SGUA 3W7IA 4AD0A 1LL4A 2VRKA 4IGSA 1Q6CA 4NNAA 3M0YA 3RJXA 3W85A 2OO0A 3KLLA 1LWHA 4BKNA 4TU1A 3VD3A 4Z2JA 1PV8A 1VENA 5LGXA 1OFAA 2CZFA 1IEXA 1IWAA 1V02A 1RJQA 1QI3A 2FLIA 3BDKA 3V3WA 1Z9AA 5CZKA 1YMYA 1UYQA 4GBUA 3AUOA 1KBBA 4KPLA 4AX6A 3TXZA 1D3CA 3OGRA 3N4AA 3TCSA 1ZCCA 2PTWA 1ZBCA 3VIOA 1UA7A 1MZHA 3GXFA 3F2BA 1CBGA 2EJAA 1M6JA 3FKRA 5FJJA 2FZMA 4DYEA 2PLKA 3EYPA 1Q65A 2XH7A 3H22A 1XWYA 1I2PA 4BF5A 3SBFA 4ZL1A 2CYGA 3W4RA 1FY6A 1KFJA 4WSHA 2W4XA 2HROA 3C6CA 2FGLA 3LNMA 3RMJA 3SN0A 3BG3A 2CWXA 2W92A 3B4YA 3PZQA 2J8FA 3ZJKA 1TVPA 3TJIA 4JICA 1GVEA 1CGWA 2GQ8A 3P8JA 3M07A 1XFBA 4HHLA 4QE1A 4Z0JA 1VD6A 4W87A 4AD5A 2A85A 1PDZA 4Q8TA 3TOPA 3TOYA 1H7OA 1DOSA 1P43A 2ZRXA 5IBXC 1E9ZB 1SGJA 3NQ7A 3CHCA 3MHFA 1DJZA 1IIGA 3QTGA 1DWHM 2QMJA 4WCJA 3WK3A 2WCGA 3B8TA 3HPFA 3IJ8A 2PFHA 3FJ4A 4P7RA 3QHOA 3GX9A 1XYBA 3W83A 5HNNA 3HB9A 5C0QA 4C7DA 4PEEA 2FB3A 2OFJA 3P81A 1VYSX 2HISA 1OQFA 1GWJA 4TX8A 4O1DA 3T07A 3B9OA 1WUEA 5BCAA 1EC8A 4CQAA 2DZBA 3KRBA 2SFPA 3VE7A 3QVQA 1VLWA 2AQWA 4PUDA 3CPGA 5JU6A 3AIQA 3DH7A 4G7EB 1ZAIA 1FHDA 4QLJA 5BRBA 4OUIA 2A21A 1VFUA 3KBWA 3M46A 3PFRA 1TPDA 4EIVA 3G18A 4JTFA 4X0NA 2BXZA 1KM0A 5AKQA 1C8XA 3UW6A 3ARXA 1LWIA 3DCPA 1MRAA 3W2NA 1NWSA 2X7VA 1FWHC 1PHWA 7CGTA 1G94A 4MAVA 2ZX5A 2PB1A 1UWRA 1M68A 4GX8A 5CC7A 2DW7A 5DN1A 5DEZA 3LBOA 2CZEA 3IGSA 4JEJA 2VOMA 3LCGA 3G5EA 4R5EA 4HHHA 1GZJA 1OY0A 2EJ1A 4NRSA 1QUMA 3BW2A 2BP1A 2VFDA 4PTNA 2D2HA 3UG4A 3KEHA 1FWNA 4HVXA 2WWDA 1EH9A 4XISA 2DW6A 1TCDA 4XK2A 2V5LA 5I06A 3W74A 1ZSXA 3CYJA 5A2BA 1VP5A 5IHRA 1P0EA 3VMNA 1DJIA 2JE8A 3GUWA 3P84A 4O11A 1UCWA 1JPDX 2DUAA 2CLHA 1EF2A 3P93A 2PPGA 1KBIA 3KOWA 4GZ7A 4UTIA 2WSKA 2XH0A 4DJEC 4LOCA 3KHJA 4RE2A 1G6CA 4JY8A 2DV0A 3TJLA 2PWFA 3MI2A 1OYCA 1IEIA 2YCKX 2QXWA 4W5ZA 3CUJA 3DFOA 3NQEA 4MWAE 3GG0A 2E1WA 3ARTA 5LNUA 1MQPA 3UXLA 3MDWA 5AYYA 6TIMA 2C6QA 5CSYA 3IAPA 2CETA 2X41A 2ACUA 4LS1A 3L68A 3B4UA 3I6EA 5JUVA 1V6XA 2F9RA 3B8UA 1XP3A 2JEQA 3WUBA 1EJWC 3KRSA 4HMDA 4AIUA 1PX8A 3H8AA 3ZIZA 4ZE5A 2Y8KA 3CS2A 5JXQA 4O14A 3M1ZA 3TQ0A 3FSUA 3VI2A 1KM1A 1BTMA 3A9IA 3L67A 4NY2A 3UNDA 3ZZ1A 4LF2A 3VCNA 2Y7GA 2EO7A 1GYMA 1SR9A 1LORA 2V8ZA 1SZNA 1ZUAX 2QR6A 5FF3A 3ITTA 4U10A 1H0GA 4NJIA 2VRQA 4WSJA 1Q85A 2NQHA 4BI6A 3DBPA 4XTDA 5D05A 3V0SA 2V5KA 3E0IA 4GO9A 5G4WA 2J8GA 1BGGA 3L7RA 2ODOA 1XLIA 3UVAA 3BLKA 3INPA 3PZOA 3G1FA 4PE8A 4CN6A 1I1XA 3LLDA 4HNUA 3GDRA 2WPBA 1LOLA 2YGYA 1UD8A 4RNIA 2FZNA 1HJSA 4W85A 2AMGA 4UQAA 4MPQA 3BSGA 2J9ZA 3B9EA 5GJPA 3T0TA 5I09A 1DIDA 3BL3A 2GQ3A 1OFQA 3WD4A 2QHAA 3HQOA 3SY1A 5D38A 3TFXA 4F0KA 2OGJA 2ZCGA 3N11A 1JI1A 4AEOA 3Q4DA 2OOFA 4OHQA 5T8GA 3U5UA 5FAJA 5H8MA 1J93A 4H19A 1O7AA 2PDCA 3H2AA 2WNQA 2FHFA 1EIXA 3W2MA 2DSZA 4RDYA 4Z2HA 4DF0A 5CSRA 3WD0A 3SR7A 3EOOA 4QX4A 3URBA 3T2QA 2CLEA 1Y7VA 4K6AA 2RDXA 1LUCB 3GHRA 3LCHA 3W2KA 1PZ2A 1Z42A 3AS2A 3WQOA 3MKVA 2E9BA 3F5JA 3A3WA 5G4EA 3UGRA 4MZ1A 2DQXA 3W7RA 4IMDA 3SUSA 4S3BA 2GYIA 1C93A 2QCLA 4U5KA 1VRXA 2ZICA 3L4XA 4UMCA 5JMUA 3KBVA 2P8CA 3NDOA 4TIMA 3IUIA 4ROPA 1UP0A 1KRAC 3VGDA 1VB9A 2QCFA 4FX8A 1E0UA 3PWGA 1US2A 2XFYA 3M7SA 4AWEA 3H7UA 2E77A 5H6HA 3W2UA 4GVGA 2NV2A 4OBRA 2ZZ2A 3CBWA 1VBHA 3UXIA 5HNTA 4DI9A 3VOGA 1FWJC 3NFUA 1S46A 3W3OA 1JDEA 3SSZA 2AQVA 1I0DA 4NKCA 4WGHA 1I2QA 5AC5A 3EMQA 5C71A 5CJ5A 5CG7A 2W61A 2YCLA 1Y65A 4FLOA 4C7GA 3UA4A 3W1UA 1JDDA 4ZO6A 4NJKA 1F6YA 3ABOA 4BFAA 2QJGA 4C6DA 2ZX6A 4YYCA 3FK4A 1GYLA 4J3WA 3ES8A 1X98A 4TX9A 3VD9A 3G8RA 3APYA 3QH2A 3PN8A 2P5NA 1KFEA 5TBOA 1BAGA 1QNSA 1QASA 5U7SA 4AY7A 2HPIA 1GTHA 1LYXA 2GVEA 3W6LA 5TQLA 3TEVA 3QYSA 2ZZ5A 5FD0A 4M6VA 1EP1A 4CD4A 1ZLPA 3H6OA 2OKOA 3C5QA 2WNZA 1XIDA 2WVVA 3N6JA 4MB4A 1HT6A 4FXFA 4H7VA 4LGXA 4EX4A 2O7SA 3HBLA 3ZWSA 3JW7A 4M0XA 1Y5VA 4UFMA 1CIUA 5AHIA 3IVUA 1NWRA 3BZJA 1G7VA 4JCLA 5T9CE 4GNJA 1O5RA 1ZJIA 4EVZA 4WJXA 1NFGA 4IJCA 2ZTJA 3ARSA 2BDQA 5CBBA 1NOFA 1THFD 2WMJA 1FWAC 3NWRA 1YDOA 3CL7A 3FN9A 1J8VA 1XDMA 3W24A 2XIIA 4HCHA 1H1NA 1BXNA 2O9PA 2GGEA 3CK5A 3KVLA 5LIUX 5CSSA 4JKKA 3VNIA 2PDWA 4HN8A 2UY5A 1QT1A 4DJDC 1C3FA 1L0PA 4EACA 1HVXA 3H12A 1GKPA 1QNRA 1UG6A 4KWVA 2QPSA 4TV5A 4C7FA 3SCOA 1FVPA 4FK9A 3QBUA 3N17A 1Q8AA 2A3AA 3FYOA 3D6NA 4AD1A 3W7DA 1C8QA 4Q7IA 5DMYA 1YDNA 4QISA 3W1TA 1H7RA 4ZTYA 4PB4A 3PPHA 7REQA 1SJBA 2XISA 4NAEA 1ZBKA 3FA4A 4JAWA 1XD1A 3RLUA 3VGGA 3ABSA 4P2VA 3TK7A 2FH6A 2WZEA 2DUZA 5GPRA 2NX1A 2ZQ0A 3O63A 4PMZA 3QY8A 3NL5A 4HN4A 4M24A 2PD9A 2GGHA 1OFDA 4A29A 1HJWA 3OIXA 2GK1A 1RUSA 1CGVA 1BEUA 3VNMA 3UU0A 3CO4A 1SM9A 1KR1A 2VDHA 4XG1A 1LM1A 3UEQA 3UERA 3AWNA 3SSJA 2QZRA 1TJRA 3S1VA 4IIEA 3HG2A 2WHMA 1QPKA 1F07A 1X1OA 1UP3A 2DZVA 3LS9A 3GXIA 3VZZA 1EDTA 1G7UA 5GJMA 5CC6A 4C6PA 3OQEA 4CQ9A 3MA8A 1B2YA 3WG6A 1L8PA 4RKAA 1QO2A 1V3JA 2WVSA 3Q37A 5K4XA 3LENA 3DYMA 1CDGA 4CU8A 3MMDA 3R1ZA 2Z00A 4C6FA 2V30A 1HL8A 4DBSA 3SEPA 1FWDC 2GVGA 3MKKA 3HZ3A 1I75A 4JX4A 3BUVA 1EZ2A 1M65A 2RDUA 3KZPA 1P1MA 5KMYA 3S9YA 2ZRUA 1AA1B 3NPUA 1ZB5A 2ABAA 1AL8A 2J13A 3KS5A 4MNMA 1CYGA 3WUGA 2VKZG 2WJFA 3C0JA 2HQAA 4UOJA 4LAKA 4BQ3A 3VGBA 3PZUA 3LZ5A 4K2SA 1PJ9A 4R33A 3W76A 3FEQA 3ZVHB 2G37A 4J4KA 1ECEA 3VINA 1XH2A 1ADOA 1B3WA 2B81A 5C2GA 4PRRA 2YKKA 2NSOA 4MVAA 3MP4A 4LCQA 1F4AA 1EOMA 4O1AA 4AWSA 4URIA 1R3QA 5C7HA 3RU8X 4F66A 4RPQA 1XICA 1SW3A 2PZNA 3NOYA 2E4TA 5D2VA 2ON3A 2EG6A 3O8AA 1RCQA 1XLJA 1ADDA 1OC6A 4HPGA 4LCSA 1LBLA 3ZT6A 4KH2A 2PZ0A 1S5TA 4FX7A 2R1PA 3THAA 4HMNA 3T2PA 2UY2A 3HA1A 4LV9A 3WL1A 4IF2A 3ZLHA 1TV2A 3GG1A 1G4SA 2BXVA 5H8UA 1HXJA 5KINA 4XUGA 1Q7ZA 3MJMA 2I57A 3OBKA 3E9AA 1AW2A 2XN0A 3O1NA 5GQBA 1BF6A 2X40A 3CUGA 3THDA 5ABFA 1CTNA 4RCXA 3UF9A 3TAKA 5KZDA 3LCFA 1EBGA 1E55A 3LQLA 3QXBA 4TO8A 4JNYA 2YA1A 1HP4A 3DHUA 4NZ5A 4LPCA 4LAOA 1VR6A 2C1HA 1E51A 1GQJA 2YBUA 1X7IA 1JZ4A 5DFAA 2FMNA 3SJ3A 3VNLA 4CNTA 2AGKA 2BWGA 5M3WA 4U2ZA 3QV9A 1KR0A 3O07A 1HGYA 1SJDA 4NXSA 2B7QA 3HPSA 1EYEA 2IS7A 4NAFB 4ZSTA 3P5ZA 2QPXA 3DYPA 1EFZA 4F0HA 1J5SA 3VILA 3M47A 1DJGA 1JIBA 5I5RA 2OT1A 3BC9A 1B3VA 2XN2A 3P62A 2OYKA 3T6CA 3LEPA 4Y7EA 1YTKA 3LGDA 2PRMA 3PB0A 3IVTA 3GFZA 3NPWA 3S9ZA 2H90A 1JPHA 4L5ZA 1XQLA 2CHNA 4NXKA 4DWSD 4DWSA 4WY0B 5I79A 2Y7FA 3GNNA 3M4HA 4LVFA 5AB3A 3L12A 2VZTA 5DELA 3AZSA 1VEOA 2QDHA 3GVWA 2D0GA 2ISVA 3ICJA 1OFBA 1HJUA 3B0VC 4IFKB 3MWAA 3RYSA 1CXFA 1EKOA 3CUFA 1LG2A 1PWMA 5F2GA 1EXBA 2Z7KA 3GNOA 2G50A 4POCA 4PCFA 2F38A 1UKPA 1UH4A 5HMFA 1WYIA 2ZUTA 4I7WA 2DIJA 1ITUA 4DRSA 2IQ0A 2MUCA 1PPIA 1W17A 3A24A 2PC8A 2Q09A 1AODA 2WNWA 4PRTA 3UJSA 1XJBA 4O1EA 4O10A 1AMYA 3L5AA 1GOQA 3WLRA 1T99A 3NQ8A 3BOFA 4J9JA 2E25A 4CCDA 3N12A 2Q8LA 3NZRA 3IGUA 4GHRA 1Z48A 4DY1A 2PDIA 5F2IA 5C9XA 1T7LA 4EF9A 4EPEC 1MUCA 4ZFCA 4AZBA 1XG4A 2Q01A 3EX6A 1UW9A 1TB3A 2DDXA 2Y89A 4K37A 3N13A 5EKYA 1KWGA 1W56A 2UZ9A 4L9XA 5U4NA 5DXXA 3S5OA 1SFJA 3QY6A 4DM2A 2AKZA 3H2NA 3RDKA 3MS8A 2DSUA 3AMKA 3KS6A 3CL6A 2INFA 4RXGA 3W1RA 4G7EA 3AQUA 1BPLB 2PWUA 1VFLA 4I90A 2P3EA 4QP0A 1DL3A 3HV9A 2A3CA 4C65A 3KDOA 2QVNA 1KC7A 3THCA 2VDGA 1EDQA 1IE7C 2R82A 1K7EA 4N9CA 3ZQ9A 2XZ9A 2JIEA 4D8LA 3GXPA 3R25A 1UWSA 3WEMA 4IJRA 3RLGA 4O0QA 3EDFA 4HA0A 1PE1A 4DJFC 1JZ3A 3AZRA 1J0JA 3EXTA 1Y0EA 1UR4A 3ID7A 1V6YA 1G4TA 2YCEA 5E6ZA 4GUIA 3T4CA 4Z1AA 3E0VA 2NX3A 1FH9A 3LCWA 4FOUA 3G0XA 1W6TA 4IQJA 1BYAA 1RH9A 2C15A 1FWFC 2IPGA 3SM0A 1OGGA 3R6IA 1XRFA 3FCPA 4HGXA 3WFZA 4Q4SA 4GGBA 1RPKA 2D24A 5HPCA 2QEZA 3VGEA 3NQFA 3CZJA 3AWOA 1UD3A 2Q8ZA 1EA9C 3WF2A 4D72A 2CLOA 4H1ZA 2XINA 4H9MA 3RCYA 3TN3A 2GUBA 1KRMA 1JF6A 4ZOBA 1B3ZA 2A7PA 3DESA 3BXWA 3WLMA 1FP9A 4MY8A 2VC7A 3UJFA 3WNOA 1XKYA 5L6UA 2A3LA 4E6MA 3U2CA 5ECUA 2EPLX 1W91A 3TTQA 2OWWA 1D7FA 4ILSA 4MUZA 3AHZA 1UR0A 2YZRA 3BCJA 4UR7A 1KXVA 3PBMA 4J3UA 3ECQA 3UD6A 1V51A 1E1FA 1U5HA 4WK9A 3NJ3A 3KBMA 3LM7A 2QDGA 5HAOA 4PH6A 1FXQA 4F2TA 2OGYA 4ADSA 3W86A 3B9NA 1LL7A 2DZXA 2Z1SA 1H5VA 1Q7MA 1XYMA 3H2OA 1MFVA 3CHFA 4MNKA 3C2OA 1OJXA 3QZ6A 4PFMA 3TMLA 3H55A 4ONVA 1K6WA 2HMCA 4FR1A 1F4HA 4FF5A 5DO8A 3DZ1A 4AZHA 3E0FA 3WLHA 4P8XA 2O9OA 3A13A 1S2CA 2ZA3A 5K9XA 2DEPA 1EJUC 3MUIA 2ZWZA 3LCXA 1ISVA 4WSKA 3POCA 2YIHA 1GK8A 1Z44A 2P76A 3KW3A 1IXNA 3TN6A 4KWOA 3W72A 1H7NA 1HG3A 2HTMA 3WEZA 3MHUA 2Y63A 5EMUA 3PFMA 4GZIA 3KUMA 3BAKA 2J7CA 4FNQA 2HV5A 3L4WA 2PDFA 1J0HA 1VFHA 4P5UA 4KBXA 4CCEA 4E2OA 5I3JA 2WZMA 5BXTA 4HNCA 4Q8OA 1WP6A 3VKCA 1W8SA 2ZZ3A 1GOXA 3OQ8A 4AYSA 2I5IA 4JTAA 2ATMA 3SAZA 3S9IA 3UNTA 3KRUA 1ISZA 2YL9A 1W1TA 3ARRA 4F9DA 1AZ1A 1XIFA 4YTRA 4WVXA 4AEFA 3BOLA 2GOUA 4WLCA 3WEOA 4N2YA 1PCWA 4JTUA 3VKAA 1UZ1A 4R88A 1WB0A 5C55A 3AU6A 2Q8XA 3OO2A 1TZ7A 3R58A 4LYPA 1OT1A 3W1AA 1F61A 4MWAB 3WLOA 1P0NA 3O0KA 5GNYA 1YTEA 3NXFA 4DXVA 3VVGA 1A50A 4AVFA 3TCEA 2NQJA 2WHJA 4U4MA 3JS3A 5JIWA 2WKJA 1O5QA 4W89A 1AK5A 3OZMA 1XS2A 1J4EA 1I2OA 2VXNA 1P0DA 2ANUA 3MUCA 1IZCA 4Q4KA 2ZX8A 4YVXA 1DIKA 1EL3A 2POTA 4JL2A 3O6DA 3HFYA 2W6RA 2RKXA 3LBCA 2GVYA 3UWYA 2JIWA 1PKNA 4MJ4A 1ZGDA 1KCZA 4ZQMA 5A6JA 3GXMA 2A6LA 4B2DA 3WBYA 4PBFA 3N14A 4KCVA 3ZR4A 1W3JA 4MZYA 3WL0A 5LA2A 2ZA1A 5D02A 1ICSA 3APGA 3L66A 2GUYA 4RV3A 4IMEA 1Q6FA 3E5PA 4LRTA 1LLOA 1ZPTA 1VS1A 5KSWA 4Q7BA 1E6QM 5BRPA 4TQTA 5EY5A 4D6DA 1XLCA 1QNOA 1Z7AA 4JNZA 2FHCA 3W53A 1T40A 5J5RA 1KA9F 1I0BA 4YNGA 3KM8A 1QNVA 3U8GA 2D0FA 2VCAA 2NWRA 1QW8A 4UQCA 1Z3NA 1OCQA 3TC3A 3QW3A 3UR7A 4C6LA 4GYKA 1Z32X 4J2PA 3M0ZA 2BTMA 4LFYA 1K4HA 3IIZA 4MHBA 1R2RA 4YTUA 4IQLA 4Q3MA 1NDWA 4H01A 1F6PA 4GO8A 3MCOA 5CPOA 5AHMA 1EX1A 1V79A 4QJ5B 2OLHA 4GPNA 2QIWA 3WLPA 2PODA 5AYBA 4S3GA 3N2TA 3RMEA 2H6RA 3G0UA 2FPYA 2PI6A 4PCTA 2EXOA 2WMGA 3A6OA 5EMKA 1HZYA 3NEVA 2NT0A 5LIKX 1R7AA 4IXXA 2BVWA 3DI1A 3TIMA 2PDNA 2Z1BA 2PF0A 3GTIA 2E0PA 2V67A 1DYSA 4ZMGA 4UFJA 5E0KA 2CBUA 4LV4A 4Y9OA 3C86A 2E28A 1V0KA 3AIEA 2P0OA 2QLYA 1DJQA 1J6PA 1UIPA 3EA3A 3LBMA 1W2PA 4XAZA 3SCVA 3TNOA 3RITA 1PBGA 3IV3A 4W84A 1BSIA 3CLWA 3IS4A 3GG7A 3IV8A 3QOMA 1R0MA 3QZEA 2DVTA 4B3LA 3CC1A 1P6BA 1TTQA 4NI3A 1W3NA 1P0BA 2YL8A 3LYEA 1PKYA 4QXIA 1FCQA 4NZ4A 4IWWA 4WGXA 3SCUA 4JTEA 4WHBA 1W1VA 1J5TA 4RDZA 4MNLA 3C52A 4XKMA 3WD3A 3EB3A 3KBNA 4XAFA 1A3XA 3W7PA 1XLHA 5JBDA 4TMBA 3QHMA 1L2QA 2BHYA 1HX0A 1W3KA 1CGYA 2ALRA 2WMKA 1WUFA 3U57A 2NQZA 2QNEA 1XV8A 4QHRA 2FGBA 5D9MA 1DXFA 4OECA 2NUWA 4CNUA 3CXOA 3GBDA 4XWUA 4B4FA 1BSLA 1XBXA 3THUA 3ZWTA 4B9ZA 2BASA 2YL6A 4ERIA 4UNLA 1GG0A 5F2MA 3BV7A 3ZLGA 2CZ5A 3AS1A 3PZMA 3CL8A 3MV01 4D8AA 2ZRWA 3CQIA 1MW1A 1B31A 4D6GA 2QPUA 3K46A 3B05A 5C7VA 4ERGA 4ACZB 3M0VA 3V7PA 4MZ8A 1E5NA 3IWPA 3RFAA 1KB3A 4NIRA 4JDYA 4P7LA 4NG3A 4S3FA 5LHEA 1OCNA 2QCEA 4CUCA 3BLFA 4IQEA 1V6TA 3HGSA 4X22A 2C3ZA 4PBEA 2ADAA 4UFIA 2DQWA 3TLLA 3NQ2A 3P80A 5A94A 4HNNA 2INZA 1H0IA 2V68A 1V3MA 4RXFA 2I17A 3VNDA 1H49A 1O5KA 3AXMA 3PAOA 2VRJA 1MRQA 3HN3A 3MO4A 5ENLA 4FS9A 1GYNA 3EMCA 1AJ2A 1K4GA 4PFHA 3O15A 2AL1A 4A3RA 1E9YB 3LHWA 1NFBA 4XZLX 3E0WA 4FLQA 1K9TA 4YN5A 2G8ZA 1WDRA 3KVMA 5IBXA 1M7PA 1XLAA 2CNCA 4DELA 5MKGA 4DO7A 3ZVHA 5KETA 4AD3A 1R9YA 4GFSA 4IUGA 1ZBWA 3SQLA 1Z41A 2AAAA 1LBFA 1E3ZA 4QCEA 3F1QA 4IGHA 4N9EA 3FJLA 1HTIA 1W5MA 1GOKA 2Y61A 3TJXA 3DC0A 3FYPA 3NPVA 4AYGA 4ZO9A 1VFFA 1W32A 4JHZA 2QDDA 4Z2KA 4QQ3A 2GSJA 1POKA 5HBFA 3IJ7A 3SUVA 1CW2A 1NELA 3PVFA 5HNUA 4Q8VA 1OG6A 4IX0A 3OVPA 2Y7DA 3C2EA 4A05A 3QTPA 3AHYA 4GJIA 1WKYA 1MI3A 1BRLB 3CM4A 2WOQA 1V3IA 1J0ZA 3BQ6A 5LIYX 5AECA 1K8CA 4KS0A 3POHA 2FKPA 2ISFA 4KRZA 3MSGA 3N1AA 1SVDA 2BVYA 3RHGA 3GSMA 1IXOA 3G22A 3WK2A 2YL5A 4I5XA 3W0KA 2EKGA 3A4XA 3CIVA 3I7QA 4F3HA 4EK7A 2QF8A 1GONA 3MBFA 1PS9A 4Y96A 4X63A 4XV0A 1ITXA 3II1A 4Q8PA 2XVPA 1ME8A 1AJ0A 1KFCA 4H8UA 1AZ2A 2WVTA 1LZOA 2F6KA 2NQ5A 4Z1DA 4O52A 2X0SA 2CHOA 2YB4A 1JL8A 1OFEA 3ALFA 4JFUA 5FACA 1XR2A 3M7WA 1FWGC 4L4OA 4FIRA 4Q4OA 1W3LA 2E8YA 4HOXA 2G3NA 4NAFA 3ITLA 1MXDA 4HU0A 1YXYA 1H2JA 4DJED 3LMZA 4P8WA 1FHUA 1LRTA 2NVDA 3NL6A 5I07A 1OB0A 3I3DA 3NO3A 4XBJA 4XIAA 3VFLA 4PC8A 1JF5A 3I7SA 4YHGA 3H70A 1V7YA 3QEZA 1X96A 1XYCA 1AQHA 3MMWA 6ENLA 1UD6A 3NVTA 2NLIA 3NM1A 1FOBA 3EBVA 4JY9A 5LKYA 1GOOA 1WNOA 1DJHA 3WQEA 5DANA 3R43A 4WY0A 4YWIA 1ONEA 1OEPA 1VGAA 3PZ9A 4DO6A 4IIBA 2ZDRA 1K70A 2FJUB 2DIEA 1R8LA 4CQCA 4JIQA 1W54A 4DLMA 1NWTA 1NVMA 4Q8NA 1OIMA 5A6LA 1FKWA 2VR2A 1E1CB 1HJVA 4FI4A 5FI8A 1JFHA 3LM3A 4ZR8A 2PGFA 4PSRA 5BWAA 3LSCA 1U5JA 2WSPA 5EYWA 2HPMA 3R12A 3VDAA 1OGSA 3VA8A 1L6WA 4ZXLA 4BJHA 2NT1A 1ISYA 4U3AA 4HJWA 1YTDA 1R2TA 4PMUA 4U28A 3UG5A 1EZWA 3TSMA 2REQA 3A47A 3W73A 1KLYA 1SPQA 3CB3A 4PCNA 3GDKA 1GG1A 4EKJA 3PBYA 1MXSA 2J47A 3UQNA 3NAVA 1QU4A 2VEKA 4OV4A 3G1DA 3JVAA 2BVDA 1JULA 1EXPA 1V02E 1ML1A 3Q58A 3ZJ6A 1R9XA 4BQ2A 1AL7A 3MQTA 1JAEA 2GJXB 4A8IA 3LMYA 1KQZA 3PAJA 5D30A 3BARA 1IWPA 3N2BA 4IIFA 3BE7A 3TA6A 1V0LA 3STCA 4ADUA 2BS9A 3FA5A 2DJLA 3AYRA 3W2LA 3BK0A 1GORA 2J7GA 5JVLA 5D9PA 3TU9A 1UKOA 4U2YA 2CLMA 1ZJHA 2C0AA 3CV7A 3OGSA 3R0UA 2UWFA 1IHIA 4IIDA 4D2JA 3G1RA 3W7CA 2BY2A 3G1SA 2F2HA 1ZRQA 1UUMA 1IIHA 4XQ6A 4H6QA 5C9ZA 1FXPA 2OU4A 4UIOA 3IJDA 4Q6XA 4AZ7A 5FA5A 3F4WA 3FHQA 1ZU8A 1NAL1 2NZLA 1DXIA 3FOKA 2BOGX 2E67A 4OOZA 2DT3A 2Y6ZA 2PU0A 4HNOA 8XIAA 4UQDA 4CN4A 4B16A 1HNYA 2V63A 1RV8A 2QGYA 1MEWA 3KRZA 2WJZA 2CEQA 1QMLA 4XD5A 1UBPC 3SURA 3BGGA 1GJPA 3W6MA 4F2BA 1QWKA 2E5CA 2IXUA 7PTDA 2ESCA 4PL1A 1GZ1A 2Y8VA 3VKJA 3TVAA 3VOJA 4LAZA 1PUDA 4RPPA 3W1QA 3BAIA 4JYEA 3LZ3A 1K9FA 1TPB1 3WBEA 3WELA 4NJJA 1R3RA 4WQ6A 4O54A 4LBRA 2G0WA 5E70A 5HWMA 4B4HA 5D8WA 1DJXA 3I4EA 3WH6A 2VD9A 3C0SA 5C9RA 2YYTA 4PMVA 2JF6A 4ORMA 3PPCA 3IAQA 4Q4MA 1H60A 1IWBA 2W27A 4XZBA 1ME9A 3LPPA 1N2VA 1DVJA 5BW6A 1C7TA 4PUKA 4A8NA 1BWKA 3PHAA 4GK8A 3GTHA 1PX3A 1FCBA 4Z42C 3HFTA 5CH9A 4GCAA 1XM3A 1EP3A 2CZDA 1TZ9A 4UMBA 3S6OA 5E9XA 1EEXA 3EGJA 4E8DA 3R10A 4H7ZA 3BAWA 4M29A 1VYPX 2VEGA 3C2YA 1S1PA 3LHYA 2A3HA 1FDYA 1NU5A 4HMEA 4Z1CA 3KOFA 1F76A 4IICA 3IJLA 3S6DA 4QSFA 2JKEA 2EPHA 3DAQA 2G3JA 4XBSA 3BVJA 3H7RA 5I3KA 3D0CA 3V5FA 1E56A 2Y7EA 2PDLA 2WXDM 4G56A 4FNPA 1PVNA 4WZHA 3VE9A 4FAMA 1YBQB 1X7FA 3PTMA 2C91A 2GDUA 4KKXA 1DEDA 4JN8A 1M01A 3H53A 3TQVA 1U1UA 3VK5A 3NQCA 5KZEA 4LB4A 3N2XA 4F79A 4HOWA 1BYBA 1C8VA 3SGZA 4QE5A 1TV5A 3LD5A 2CCRA 5REQB 4UNKA 4C6JA 3XISA 4AEEA 3K2GA 3BLLA 5AVNA 3QV6A 2VL4A 4A3YA 1XSJA 2TRSA 4FOJA 3PNZA 4M7SA 4N0RA 1QPRA 2FZ9A 1LRNA 2E3ZA 4MM1A 2W67A 1ZAHA 5D09A 3S5YA 3QSTA 2WCAA 1WOBA 1J9YA 5A6BD 4K36A 5A6BA 4GACA 3T81A 1JYNA 4D6IA 3GKAA 1DTUA 2CU0A 3L4ZA 4J2MA 1PIFA 1TG7A 4OV9A 3DG6A 4BQ4A 1UC4A 2FZ8A 4DJDD 1RCXB 3KOXA 3WZ0E 2YDQA 4DJDA 2RAGA 1DIOA 4R7OA 5XINA 4KWSA 3RXZA 1UQYA 3NVDA 2NVCA 3TFCA 5G2IA 3T1GA 2G3IA 4DLFA 3T0CA 2PDGA 4C6CA 2OSWA 4NRRA 4HHMA 3O6AA 3MVIA 2HVOA 5CCZA 1C90A 3RG6A 5LIXX 3GIYA 2XN1A 1JDFA 3VABA 4KFPA 2D3NA 2W91A 3M44A 2A79A 1U2YA 3UZZA 4IMAA 3G6MA 1UQZA 3W01A 1H7WA 3PUEA 4EE9A 3AJXA 1OSEA 4H9UA 5AHNA 4MWAA 2JEPA 5MF5A 1KM4A 1ODZA 2VELA 4D6EA 1BXBA 2YX0A 3WMSA 3P6LA 5T9BG 2ICSA 1OX5A 3R8GA 1HKMA 3K1DA 1TX0A 3OYZA 3N19B 4JNMA 4KEVA 1XYAA 1QPQA 5HWNA 5FEXA 2Z28A 1S3HA 1MZRA 2C14A 2YFNA 4A8LA 3RUBL 4G8TA 4UOZA 2VTFA 1GPFA 1WE5A 3VDCA 3S1WA 1VBRA 3KWSA 1GT8A 4DPQA 5HJLA 5D2TA 4KF1A 1GOIA 2D3LA 2J66A 2PP1A 1TVLA 4NZJA 1SSGA 2WJEA 3IUHA 4FXSA 2R1LA 4QG9A 3TW7A 3VMOA 3E49A 4IZGA 1TPUA 4E3TA 2IKHA 4MKVA 4KCWA 3UJ2A 3AOFA 2VFGA 1M03A 4IUOA 3RX3A 1N82A 5LA0A 4WD0A 1WXYA 1E40A 4GH1A 5AOUA 5C9UA 3EB4A 4ZVJA 2V3EA 2J77A 3VCCA 3Q45A 4IL2A 3W71A 3N2OA 4IXHA 4PL2A 1O5XA 3T8QA 1XBVA 5LGZA 2WYSA 3L2MA 1KBLA 3GVQA 3F7JA 4XVDA 4Q4RA 5CZ0A 4UTKA 4C6KA 8TIMA 2VQTA 3XIMA 4W5UA 4IHCA 4GQ0A 4MKSA 3AHVA 5TF0A 5BXPA 4GVHA 9CGTA 3P0WA 3BMWA 3BSMA 5G1YA 3G1HA 3LU2A 4H2CA 3VCRA 5IXEA 4HZ7A 2DFAA 5LXEA 3W22A 3CZKA 3DG7A 4PGLA 2PTXA 1NDZA 2EBNA 4PA8A 4H9VA 2YZ5A 5TD4A 2ALDA 1W0MA 4JTKA 3SUUA 3OZOA 4HT3A 1XF0A 3VGFA 2WCSA 4OTKA 3OLIA 4O4VA 3MSYA 5D04C 4LBUA 4BF7A 4ORIA 1QK2A 3T05A 3FGCB 1EO5A 3CB8A 3N9SA 3UP8A 3S1GA 4HNTA 1EB3A 5HR7A 3T4WA 4NZCA 3CAKA 3H23A 4C6QA 4WOZA 1A3WA 1DWIM 4JQ3A 1HL2A 4DIAA 4E4UA 4JQ1A 1MEIA 4CU7A 2B7PA 1XLKA 3WQPA 3VX0A 5C2XA 5LHFA 4XB3A 1V0NA 4EP8C 2WBKA 3RM9A 4ZSUA 3O16A 1YHTA 1YYAA 3ZM8A 3VIIA 1Q6RA 3T9PA 4NYYA 1E0TA 1W3TA 4KMQA 5I3HA 4ATLA 1OINA 1A5BA 2A5HA 1JR1A 4EAMA 3M0LA 6XIAA 2H8ZA 1G9HA 3VDHA 1P6WA 3PZTA 4B92A 4AVNA 5F1UA 2OZTA 1RPXA 3AS3A 3N2MA 4LXFA 4LEQA 4H7CA 2IQDA 4PRWA 2PP0A 2Z1VA 3WNLA 2NLYA 1KD0A 5FL1A 1FUYA 3GAKA 4HQVA 4AVOA 1REQB 5SWUA 4AF0B 1RVGA 4H6RA 4M82A 5GNXA 4WOQA 4EXBA 1J96A 1KM2A 1TV3A 4CNSA 4LF1A 1CGUA 1R6WA 5K7JA 4H3DA 3WN6A 3TZNA 2VP8A 2V9DA 3NCOA 2FDMA 4I6KA 4V1XA 2HSAA 1UWAA 2OR2A 2W0UA 2TMDA 1JCTA 3GO2A 3QKZA 2C7FA 2ZXAA 4KGLA 4C60A 3R4IA 5FCZA 4UXDA 1LQ0A 1W1PA 2G95A 3IK4A 1NEYA 4JTQA 3H4XA 2YW3A 4I9JA 1TR1A 2ZYFA 1XGZA 3VKBA 2D2OA 1ZAJA 4OU1A 4DQWA 1TTPA 3IPWA 1RBLA 4YJ5A 3KVKA 4FB7A 4GBDA 2FH8A 2CWNA 2PMQA 4JTTA 3YPIA 2QJIA 3B97A 3OG3A 1XLBA 3GB6A 3PZIA 3ONBA 2EPNA 3DKLA 2Z4GA 2WMHA 3SGGA 2YLAA 1T0OA 1A5KC 2GJNA 3BG9A 2VC5A 3G3MA 4FPSA 3GIQA 5F4WA 2VEIA 3KBJA 1RLDA 2DY3A 1JD7A 3DXIA 4M51A 4LYQA 3CWOX 3KCOA 5DRIA 3V18A 4L1WA 1Q6QA 2FVLA 4P8VA 1YXCA 3GQYA 1EQCA 1ZQ5A 2OKTA 4E4FA 3CAVA 3UG8A 3N9RA 3QV8A 4S1FA 1W1ZA 3WDHA 1KGWA 4IOTA 1Q66A 2CESA 9XIMA 5KZ6A 2YBTA 1U30A 3UCQA 4DAFA 3QW4B 1CXHA 2Q6ZA 5M5DA 3SO7A 4O1FA 6CGTA 3VNZA 2OSXA 5FJUA 4DEFA 3NZGA 2QV4A 4MF4A 2O0TA 3PR2A 3VAVA 2I5QA 3KL5A 3LQGA 2CFFA 3EX2A 3WX7A 3NQAA 1E4NA 3W9ZA 1M7OA 4N42A 1VIWA 5AZ1A 2RH9A 1XDJA 2WZHA 3QC0A 1NDVA 3U48A 5G1TA 4JN7A 3OVGA 3C0QA 1B3YA 3UT0A 4B5TA 4O0ZA 2YSWA 2ZRVA 3IARA 1R86A 1AUSL 5M2FX 1QWGA 7XIMA 2H9AB 4HU8A 4DJFA 3VU2A 1BXCA 3ZT7A 1UP2A 1VFOA 4J28A 5A6MA 3RCMA 1ZJAA 4DNHA 3SRKA 4XIMA 1RK6A 5CKSA 3WQDA 3FFSA 2D20A 2EHHA 2Q71A 5DXYA 3HOJA 3NDZA 1PKMA 4GXMA 3DOPA 3LG3A 3NZPA 4O50A 4NQ1A 5F4SA 1TMHA 4RX0A 3GHUA 1QVBA 2J78A 1JGIA 1HW6A 1W3IA 1ZTVA 3CU2A 4HA1A 3DFYA 1A49A 2BY1A 1LG1A 1I4NA 3ANUA 2X1IA 4ATWA 1SO6A 1JQVA 3SW6A 1QFEA 5CJNA 4AXNA 2QT3A 4YU1A 3I65A 1I6NA 3N4FA 2Y70A 4RZ6A 1WDDA 4UQ9A 1SW7A 3NSNA 1GJUA 4WDXA 2PBOA 5HK4A 3BLIA 2VI0A 4PUJA 1HF6A 4QJ3B 1GVRA 1RA0A 3L21A 4QAIA 3CNYA 1Q6GA 1E1EA 1JPMA 4LS2A 4NUWA 2E9LA 4YHEA 1S5VA 4TVDA 4QEEA 1F73A 3PNUA 1OK6A 2R1MA 1A5NC 3C2VA 2F7FA 4PULA 4AD4A 2OOGA 2IPJA 3AROA 2WZTA 3PJTA 1MVYA 4L6HA 3B40A 5FEPA 4YPJA 1VCGA 3K5XA 1K02A 3M0HA 3W1NA 1E1CA 5A6KA 4MDOA 3E6EA 3S83A 1X1ZA 1XIJA 4LVBA 4K8HA 4EPKA 1UKQA 4HB7A 1OC5A 1OFRA 5HNRA 3W37A 4DB7A 4QEHA 1A53A 2KAUC 3GH7A 1JUBA 1NQKA 5HJXA 1F8IA 3W7QA 1W1YA 3PJUA 2O55A 3OZYA 3BLOA 4KWWA 3N4EA 2X8RA 1KNWA 2NV1A 1UOZA 4UTTC 3KDNA 2IUZA 4B5NA 1FX6A 2ZE0A 6A3HA 3H2FA 1MNSA 2XSAA 3N04A 1E6RA 3L0GA 3KP1A 3RX2A 1H5YA 4ADTA 1LDCA 1CENA 5C8BB 5AC7A 2FTYA 1EUNA 1LCOA 4O4WA 2EG7A 2X30A 3HG5A 3B0UX 3BH4A 3WBXA 4S3AA 3WJWA 2QJNA 4ZTXA 3WLJA 3QMRA 1PHQA 3MBDA 4QG8A 5K9CA 1G1YA 2OCZA 3EOUA 4QLKA 3LTSA 3T09A 2VENA 2X16A 4ZXOA 1GHRA 5AYIA 1HFBA 1W2VA 4S2BA 2VFIA 4GINA 4DNMA 2WSRA 4JTCA 3PZNA 4RNJA 2OG9A 3U0HA 3TZFA 2JGYA 2G96A 1A47A 3KL0A 4ZCWA 4X61A 1YDYA 2VZUA 3OVQA 4F0MA 4XX6A 1S2VA 2P88A 5I24A 4GLEA 1W9PA 1NF7A 4P61A 4GI6A 2OWXA 5BWFA 5HINA 4Q8WA 1OHLA 2JBMA 1X39A 2AQOA 3SFKA 4ZB0A 4IMCA 4HCDA 2XVLA 3T42A 2INEA 3UBPC 2JKPA 3QMTA 4QNEA 1A5UA 4LSBA 3TX9A 5F1VA 4G7FA 3SCRA 5H1WA 3ANYA 1EDGA 2YYUA 4F0RA 1EWEA 1KM6A 2NVAA 4R3UA 5LZLA 2DIKA 1J10A 4WKAA 3EXSA 2FIQA 5F4XA 3COTA 1OCJA 4LUJA 2Y85A 3CHVA 1ONXA 2WC7A 3NQMA 3SRFA 3OU8A 5IOBA 3VKDA 1EO7A 3WQFA 1QO5A 4O0KA 3S2JA 3K8KA 4FR6A 4IL0A 2D2GA 2IW0A 4HJFA 2GJRA 3BURA 3FEMA 2X1UA 1V93A 3AISA 5JH2A 4UQBA 3EX1A 1CLVA 1U83A 3EDEA 3UR8A 3UCCA 4MNJA 5H2ZA 3WH7A 4PUNA 5GNZA 4OQVA 2PDJA 1V6UA 3F4VA 3DFQA 2NX9A 4PN2A 3WNKA 2Q3OA 4QBXA 9RUBA 2J74A 3TMQA 1UR9A 3S5SA 5AN7A 2XYLA 1V6VA 4UFKA 3TROA 5HR6A 2E09A 2RGMA 1Q4NX 1C8YA 3QF0A 4LUTA 1EIBA 2CLPA 2JQXA 4KRTA 3V1PA 4Q33A 1OYAA 3QR3A 2MANA 2ZZ4A 3S0CA 5CJMA 1UKSA 1ZFJA 1QHZA 1PTGA 4G1NA 5E6YA 4LC6A 1KO0A 1DIEA 4R53A 3B8IA 1R3WA 3CLMA 3RJYA 1ISXA 5M17A 2CLKA 2YDRA 1XIMA 2PRLA 3HGJA 5HQLA 2V5JA 1WDPA 4C5YA 4QJ4B 2XSBA 5REQA 4JTIA 3MUY1 3PJWA 1PIIA 3C3UA 3VPLA 3GH5A 3HURA 1XH0A 4OBSA 4S3EA 1R9ZA 4ZO7A 3CWHA 1V5XA 1MDRA 3W84A 4Q4QA 1J11A 3CZEA 5IDIA 1TMLA 2H3DA 2YW4A 1Y5XA 2WAGA 1QI0A 3APTA 4CKQA 3B8DA 4FEZA 4D6JA 1AW5A 5K2ZA 3N3TA 3LRLA 4JYDA 1RY0A 4DAIA 4TVCA 3WY1A 2ZIDA 3NR0A 1UUOA 4FALA 3GNXA 4FNTA 5LNVA 4TTGA 3TWBA 1IXQA 1XLGA 4HYVA 3BJFA 3RM4A 3NA8A 2DVUA 4H83A 4G2DA 1JPIA 3LB0A 3GDTA 2I16A 5HPOA 4MUPA 2F6XA 4UR8A 5FJOA 3W88A 4WKFA 1E71M 4W8AA 4IH3A 1HKVA 5CGQA 3HMJG 1Q5MA 4H8NA 4GJ1A 2GL5A 1BYCA 3PK7A 2FVKA 2CZVA 4DWDA 3DERA 2PTYA 3WJXA 3QLDA 4GI9A 4RZ4A 3NQVA 3A4WA 2YXXA 3TONA 2Y5EA 1UZHA 1W9BM 1FQ0A 1U5VA 1VFMA 3EEGA 3TXVA 3UA3A 3DHFA 3OIHA 4R9OA 1XCFA 1PSCA 1WA3A 1XCWA 2V5BA 4L80A 1B1YA 5DY3A 5D4YA 2WHLA 3WJZA 4I7VA 4CCCA 2XWEA 1HO1A 3LLFA 4WX2A 3RR4A 4XUYA 2GJPA 2WLZA 3MTWA 2XVGA 3WKZA 1O66A 2BSLA 3VOFA 1NY1A 4N7QA 2O9TA 2X0YA 2PCQA 1TV4A 5BROA 3UR5A 2WSQA 2PBGA 1T8QA 2I14A 3L5MA 1VC4A 3RLHA 5PTDA 4S39A 2JK2A 2R6OA 4IQDA 1HN1A 1A0CA 1J0YA 4TXEA 3AALA 1B9BA 3RPMA 1A80A 5GJNA 1DWFM 3OB8A 4KERA 4WUIA 1F3WA 3GU1A 3TYBA 3UR2A 2YCJA 2O7QA 4C91A 1CLXA 3IGXA 2E5DA 3BLEA 3D46A 3O05A 5HATA 3R13A 4PMQA 1TJ1A 1OX4B 1JYXA 2OXNA 4W9TA 3U2OA 4HA3A 1FWTA 1TZZA 1P7TB 1R85A 3VC5A 1SFSA 2DORA 3USBA 3G8EA 2HK1A 1WDWA 2Z24A 2QCGA 1IZJA 1RLCL 5K3VA 4IG2A 4ATDA 3MKCA 2AGTA 3ORWA 1T96A 2OMAA 3WNNA 2WO5A 4BS0A 4JTSA 4C1NB 2WK2A 5A8MA 1SQ7A 4JPGA 3TR2A 5TNVA 5CLWA 5G5IA 4MLJA 3F2DA 5A95A 3N34A 3EDDA 2DT0A 4P7OA 3QGVA 4UFHA 2R1NA 1GVQA 3QZAA 3LOTA 2WHKA 1ISWA 5C9WA 1SZRA 2I9UA 3ITOA 1F3TA 3R2GA 3S1UA 3WD1A 1LRQA 5CPMA 3USZA 3G0SA 4E8CA 1RXOB 4L4LA 3VIGA 2E68A 4YIWA 1C9WA 3VIFA 4EPDC 1GGOA 4CVUA 5E09A 1E70M 3ENLA 1SW0A 2E1DA 4DZIA 2VGIA 4RNFA 3FGCA 3Q67A 2V0TA 2QJJA 4K39A 1GQNA 3EPMA 2I56A 2F8QA 2OELA 2WANA 4E2VA 3DHDA 1QHPA 5D9OA 1S2TA 1SR0A 1TE1A 1TMQA 7ODCA 3MUZ1 1CXIA 3LLXA 4RK8A 4BEQA 1E6SM 2RDTA 3C61A 2ZA2A 3B8WA 5BXRA 4JYFA 1ITQA 4M3PA 3CV6A 3E96A 4PZVA 1PYFA 4WXYA 1QPOA 2OVLA 4YCOA 5I3IA 1ENUA 3NM3A 5I00A 3FSTA 4AHPA 1SMDA 3W27A 3UETA 3S2MA 4N02A 4GIRA 1UBSA 4AFYA 3LCLA 5BOFA 3OJGA 2ZXQA 3B9AA 3A3HA 5D03A 3ITXA 2EEXA 1B90A 2O4QA 3WSUA 1CEOA 3W2JA 4ERAA 1OZQA 5CC3A 5CPTA 3ZLFA 1QOPA 4WF7A 2GGGA 3GTFA 2C79A 4EXQA 4JFTA 1OG0A 4QFUA 3XINA 1F7BA 1IGSA 3DYOA 4BI5A 1REQA 3ARWA 4AF0A 1A0DA 3VYLA 1N7KA 1PAMA 3T78A 3ITGA 4GVFA 1QXLA 1UKTA 2CBVA 1CB7B 3LV5A 3CQHA 1T8XA 4MB5A 2IXVA 4PMOA 2VZOA 1FH8A 4JN6A 3KWXA 3FAXA 1XD0A 3UY8A 1ZL1A 1X97A 1RBOB 1B9ZA 5J8LA 4NP7A 1Q13A 3DHPA 2P3ZA 3EKGA 1GKRA 3UCDA 2F6UA 3KTSA 2BXYA 5AYZA 3WO8A 5GVJA 3OHMB 1AMKA 4Q32A 1AVAA 4MG4A 4CGTA 1YPIA 2QDEA 1J79A 1E3XA 2CXEA 3VOHA 1DV7A 1KXQA 4DF2A 3QGAC 1S5MA 2OTDA 3VZYA 3IJQA 2XWDA 1WZMA 1TTIA 1YPXA 2J75A 2BY3A 4AH7A 3L4VA 4MWAC 3LV6A 4F40A 3ISIX 5ABHA 1SYTA 3E5BA 4GJJA 5A1AA 3EWYA 4IP5A 4AY8A 2DJXA 2G3MA 4LCRA 1O60A 3BTNA 1M41A 5IDZA 4FHAA 1SFLA 1UMYA 3OP2A 3GH4A 1E0XA 4EF8A 2FTPA 3P60A 4C90A 3TTYA 2G41A 1XINA 3WQ6A 1TO3A 2VX5A 3G24A 1RALA 4MJZA 2P10A 2L5HA 1Y5WA 2J8TA 1VPXA 1FHLA 3V4BA 5LXXA 1MQRA 2QUUA 3LX9A 1TPEA 2R94A 3DX5A 2X1RA 1RAKA 1GVSA 1XX1A 2PDMA 2FGZA 3TP4A 1XUZA 1WXZA 5E93A 3ZSSA 2QKFA 3EZ4A 5DLCA 5BOEA 4GIAA 4DHGA 1QAPA 4E0CA 3A5VA 4Q8QA 1X6UA 3BAJA 3UZYA 2WVVB 4WDUA 1XSIA 5I6SA 4LBSA 3D5HA 3WBWA 2WNNA 1W37A 2H9AA 3VXGA 1SO3A 4P8UA 2Z29A 1QW9A 1US3A 3AYSA 4Q7NA 1ADSA 4KFOA 1AD1A 5IFPA 5XIMA 4R7JA 1LQAA 3DFHA 1QHOA 5DT7A 2KZHA 3TWAA 4K3ZA 5G2HA 3GZ3A 1J6OA 2WQDA 1M7XA 1SU5A 4QAWA 1ZS2A 3CT2A 1XUUA 2G4FA 2XIJA 4ENLA 3GR4A 5J5DA 2VMFA 2YR1A 2OODA 4KCUA 1TIWA 3WUEA 1TQXA 4MB3A 4QGCA 4L64A 1BHGA 1L6SA 1UOKA 4GVIA 1EJTC 1O12A 4Z1YA 4WRHA 4NJHA 4QSHA 1M1BA 1JD9A 2OLAA 3E02A 2F61A 4PTVA 1D7KA 4ML4A 1YE6A 1UR1A 1B4EA 4E2BA 3UWEA 1KKRA 1YNYA 1IT7A 4NZFA 3LDVA 2EQDA 4HZ8A 3PPFA 3MI3A 2XIBA 1HIZA 4QM1A 3FXGA 3LGGA 5HOSA 3BJSA 4Y2WA 1HL9A 1FWWA 1X38A 4YVPA 3AXXA 3MW7A 5CPLA 4L61A 3K4DA 4UTHA 1SSDA 3NNTA 3M6DA 2DSWA 3ARQA 1RQBA 3CV2A 4HK6A 4JFSA 2QCDA 2X7WA 4C5ZA 1I60A 1UD2A 4ZOAA 1XLLA 1B57A 5DQPA 3NPXA 3NYZA 4NL1A 3VD7A 3K4WA 1CXEA 3GKFA 4GX9A 3AI0A 5EL1A 1O1HA 3VIKA 3C8NA 3HF3A 3MCNA 2V38A 3MMUA 4DBEA 1KLZA 4ML9A 1XGEA 3HQPA 4PTMA 2W63A 4GOAA 3CZ8A 1DQXA 3MDUA 1EA0A 1RP8A 3EPOA 4HYRA 3PF3A 3T0DA 1T5AA 4G9PA 2EGZA 3GR7A 3NQ6A 3B3DA 3DEQA 3DI0A 3R0DA 3UWWA 1RJRA 5AHLA 1J0IA 3R79A 1ITCA 1QBBA 4L9ZA 3UVIA 2VT0A 1KM3A 5IM51 4YMZA 2VNCA 3CEUA 4CNOA 3CUZA 5HA7A 3FKKA 4ZQCA 4LW7A 1TV7A 1VRDA 1B0IA 3CHEA 2WW5A 3BANA 2ISSA 1W1A1 2A7NA 1H61A 3ZFHA 4HA4A 1CECA 1W8GA 1SUXA 1OVDA 3E1F1 2V3FA 3NXLA 5EBUA 4PCSA 4Y9NA 3HGRA 2NUYA 4ICNA 4KEUA 2BODX 2JKAA 2QULA 5DY2A 1XIHA 4PCPA 4OJYA 4IMFA 1VKFA 2QV5A 1JYWA 5CPSA 4WKHA 1CT5A 2PTZA 3B0YA 1F5ZA 1NOWA 4IPJA 4FX6M 2EPMX 3P2VA 1Z69A 4AZ6A 2XVKA 4U33A 1OX6A 3QFEA 4CU6A 4MJMA 4N6EA 4IPLA 1NM9A 3CTTA 1A5AA 4LX4A 3WLNA 1QOQA 3SY8A 4HHPA 4HU3A 3S5NA 2ZFAA 3FV9A 1S2UA 4XD3A 4JX5A 4H9TA 1FWEC 1QI4A 3QPYA 3TC7A 4RR4A 3WFLA 3WF4A 1P4CA 4BZYA 1VQTA 1W1IE 4RZBA 1EF3A 1O95A 2J9YA 3MSDA 4XD6A 2ZBTA 4V15A 2VVSA 3DU0A 1UJQA 4K7VA 1KM5A 4L1XA 1SFTA 5HUPA 4CD6A 1W31A 1LP6A 3QSRA 5CGTA 4E38A 3SRDA 1GHSA 5HUOA 1RP9A 1XYLA 1NP0A 1A5MC 1L6YA 4LUSB 4EPBC 1V4YA 3BWWA 4XZNX 4DBWA 4MFDA 2OB3A 4NZ1A 1EJ7L 5ABFB 3B9DA 4I7UA 2VCBA 5BXSA 2GDQA 5XIAA 4QCFA 4GYPC 4US6A 3NUKA 2PDKA 3PBUA 1RJPA 4BHYA 2E6AA 3VNKA 2WJDA 3PPGA 1E15A 1E5JA 2YB1A 3BICA 1Z6KA 2BBFA 1H11A 4ALDA 4CEXC 2Z2UA 4UBPC 2XFRA 2PA6A 4IGNA 3PSVA 2NXGA 1H7PA 3IUDA 4A2RA 1ONWA 4M6UA 3RM8A 3MT1A 1KRCC 5HQEA 1FP8A 1R46A 3QYQA 1EJVC 3RCNA 1V03A 3IIXA 1BD0A 2YCIX 3MPGA 2HS6A 4AAJA 3KL3A 3JZEA 3O6YX 1KV8A 2Z6IA 3EWZA 1JAKA 1OCBA 5CLTA 1MEHA 3TYDA 5FEWA 1RR2A 3EB2A 2XVNA 4DWSB 4LAUA 2JFEX 3GE7A 5FIPA 4LUYA 1F05A 1WXJA 3MV11 3N6QA 1NF0A 4DZHA 3TN4A 2ZC8A 3IGHX 3GVRA 3M0MA 1PTAA 6REQB 5D37A 3A64A 2BY0A 4LB3A 2NQLA 1XRVA 3UFYA 1UH2A 2QQ6A 3B8SA 2HXTA 3CWNA 2DH2A 5BU9A 3MO7A 3QJAA 4N4PA 1JCJA 3H21A 1H1YA 3PZVA 4E3VA 5HMSA 1VEPA 4PR4A 2ISDA 4N9DA 1RZMA 3R7MA 1WV2A 4QITA 3I10A 3CH9A 2I7GA 4R7WA 3T2OA 2VYOA 3P5YA 1WZAA 3QHNA 3CMJA 1Z8AA 3FDKA 2GWNA 3EWBX 2XGBA 1OD8A 3BW3A 2WQPA 3FIGA 4ASTA 2NXHA 2VX6A 5DCEA 4NF7A 3W1LA 4TR9A 5BNKA 3S2NA 1YNPA 4LQ1A 3W81A 5D9NA 2DZWA 1D3GA 3BLDA 3LPOA 4FXRA 2HZGA 2BOEX 5B7YA 3AYVA 3GVGA 5A8PA 3M5VA 1TYGA 3L4TA 1VLIA 2ASHA 4OZOA 2VZVA 3SQSA 3BMVA 3E2QA 4ZA0A 4I8YA 3TTEA 3M9YA 2IKJA 3R8RA 1OC7A 1BQCA 3GY1A 1BWLA 3W02A 1WX0A 1XYZA 2W9MA 3OA3A 2V2CA 2P0IA 3EDJA 4QG6A 2IQTA 4GA8A 3STPA 3P0XA 1WZKA 2Q3RA 4M6PA 3PC0A 1CB2A 4FIQA 2W3ZA 4M56A 3LCIA 3L65A 3K13A 4W8LA 3W7GA 1Q2RA 1JNDA 3H26A 5H91A 2YOCA 3H2EA 1XH1A 5LYRA 5HMEA 2HEJA 3UXKA 2QJHA 4FF7A 1VEMA 1R87A 4FZIA 7ENLA 3V35A 3BW4A 1PL9A 2Z1XA 3HMCA 1OIFA 3OW1A 3W1MA 3H54A 4YTTA 3P8IA 1XLDA 2CKRA 3CMGA 5DCDA 5MHBA 1XFCA 2GUUA 1DORA 4IGMA 4XKYB 5JIPA 4G1KA 1HVQA 4D6HA 1AD4A 1OD0A 2D1ZA 2VZSA 2C18A 3ATZA 4LS0A 4AIEA 4F9JA 1GZGA 5C54A 3HO8A 3N15A 4TUFA 2J4GA 1R3SA 3RGTA 1AG1O 4CVWA 4PMJA 4ZOCA 1EQPA 3LERA 4JL1A 1LUCA 2XFWA 5G2WA 1OX4A 4UTJA 3WUFA 2XHYA 2ZUNA 3VDGA 2A3BA 4TMCA 1KQYA 1TRDA 1V3HA 1T41A 4J3SA 4RJEA 4N4QA 1P7TA 2V69A 1KTBA 2J25A 2PAJA 2OZ3A 4UOQA 4DM1A 1GVIA 2UV8G 3NDYA 3L4UA 4XO7A 3IANA 3PWAA 2J79A 5IRPA 4RE4A 1NQ6A 4NX5A 3CUIA 4IPPA 4UCGA 2V2DA 3BZGA 3OVRA 2WSYA 4P7QA 1JFXA 4C1NA 3N2CA 1JJKA 4D71A 3W23A 4DUWA 3G1VA 1S39A 3PUDA 4S3JA 3DFPA 2CERA 1TPWA 4J1OA 4B2DD 4OVXA 1L9WA 3GNPA 2J24A 1JRBA 3G77A 4FA3A 2WV8A 2UY4A 1F74A 3UWZA 1JYVA 1Q45A 1H7XA 4L56A 5BYWA 2E6DA 2Y24A 2Z1WA 4HZMA 2Y1HA 2R8WA 4IISA 2V2HA 2G5WA 4IP7A 2VDIA 4W93A 3BAYA 2P53A 3WMBA 3T55A 4J40A 4GUGA 3DIPA 5D32A 4PUMA 4W7UA 1EGZA 2WM0A 2V3DA 1W9UA 4QDPA 2V5DA 1MWOA 2DZPA 1F3EA 1VBGA 2HNEA 3GDMA 4Y9AA 3ZO9A 4EWJA 2GSHA 3LI1A 4RLIA 4J3ZA 3LRMA 4LVAA 3WDIA 2BOFX 4BEUA 5E1QA 1UPMB 3RLVA 4X2PA 1G4EA 1PO9A 5CC5A 3OPSA 1WPCA 4XZHA 2CLLA 1EYWA 4O15A 5DBUA 2V3GA 3OLEA 3ABXA 4I9TA 1R5YA 1TUXA 3EOEA 3MWCA 3NQGA 4UTLA 2YA2A 2BX7A 2B7OA 1KCKA 4WY0F 1K9DA 3UWQA 4ZOEA 4KFNA 2ZVIA 1Q7QA 1JCNA 4GQQA 3WQ4A 1FCUA 2O4MA 2NV9A 2VEPA 4PMYA 3VIMA 4D9PA 3UPWA 1OFPA 2F2KA 3AIUA 3OZPA 1A0EA 3V0UA 2NUXA 4ZENA 3ZMRA 3R94A 4JZ5A 4V1YA 3FS2A 1NIUA 3CPUA 1YX1A 2GQAA 1PZ0A 1TQJA 3RNDA 5CBJA 2GJLA 3EDKA 2VWTA 4M8UA 3WLQA 3MANA 4C6BA 3M6YA 3NG3A 5FJRA 1Q6LA 1EHNA 4OOUA 2EF9A 5DT5A 1OBAA 1L2UA 4PUEA 1K6AA 2GDVA 1Q6OA 3WBAA 2AMXA 2Z6JA 4K38A 4HIBA 3KAOA 4NU7A 5G4HC 4GXWA 4JDBA 3LY0A 4JIPA 4GGHA 4AMAA 2J7DA 5LSMA 3M0XA 1TWIA 2WKGA 3EAUA 3GYEA 4PUWA 1ZENA 5C5YA 1B54A 1H09A 2VCCA 1A5CA 4Y6GA 3U6WA 4UTTA 4AC7C 4J35A 3MC5A 8CGTA 2A3EA 4DUOA 4Q4PA 4BCEA 3R5EA 4I9AA 2E40A 1Q6EA 4OBTA 3TA9A 2VGFA 4UTWC 1QRQA 2GLKA 1V3KA 3QMSA 1JZ7A 2X1TA 4UCFA 2X42A 4Z2LA 5HJYA 1DTNA 1XC6A 2QGHA 5D2WA 1JG9A 2Y5JA 3FVMA 4LH8A 2CW6A 4RZ5A 3NSMA 4QIUA 4A3HA 4YWSA 1V8EA 3V1HA 4QRNA 3T40A 1Q2SA 6ALDA 4GY0A 4ZO8A 3CAWA 1AQFA 4KIRA 4JS3A 5KITA 2O92A 1GQIA 2QAFA 1B4KA 4MAZA 3EA1A 4I9MA 3ZJ7A 1ZCOA 1SO5A 4L9YA 3MCMA 3TYEA 3VGHA 1EJXC 3GW0A 4DYJA 1UZ4A 3WENA 4DXKA 1XLFA 3KOYA 4QR6A 1XXXA 1XGDA 4FLRA 4US5D 2YA0A 4GXPA 3GC4A 1W9VA 1HP5A 2HE5A 3F03K 4US5A 2IPFA 1VYRA 2Y4SA 5JBEA 4AXKA 4DVOA 2RHGA 2J27A 4QS5A 5I0DA 2HWGA 2Y0FA 3UJRA 3EWCA 3CZLA 4GY1A 1P5BA 1JCYA 5C6MA 2Z7GA 3ONCA 2ZADA 3RR1A 4A35A 1MMFA 2W62A 4MFEA 3MHGA 3D47A 4RV8A 2UY3A 5FEZA 2BLEA 4NYUA 2AL2B 3GC2A 4NJGA 2Z27A 1G0CA 2WMFA 2ZXDA 3I6RA 1BYDA 1G01A 1AH4A 3P74A 3GTNA 4FOKA 3WNPA 2QUMA 2EAWA 2VM8A 4DBDA 4BI7A 2DZTA 2CKSA 4AZCB 1G67A 2E7FA 3W7MA 4X0VA 4QE4A 4LANA 2J9XA 3HJZA 1EC7A 1A3HA 5A6SA 3GC5A 3N18A 3RRAA 1JQXA 3BQ5A 1QPNA 1DJWA 4J3XA 3T7VA 5BMXA 1RY8A 3M5YA 1OZMA 3C3NA 1V0MA 3DFSA 3DGRA 4BWLC 2RUSA 2W66A 1XI3A 4X3ZA 2Z2BA 5E5CA 3MYPA 3L5LA 3U2ZA 1F2JA 3OOQA 1WZLA 4KESA 4W7WA 4PMNA 2OX1A 3ARPA 1BG9A 1I2RA 4XTIA 3N73A 4K68A 1BGAA 5AYXA 5I78A 4Y8FA 5T26A 5CZSA 3LSBA 4HNLA 1VZWA 4LALA 2HE8A 4B9YA 1UWQA 3T44A 4K1GA 2OSYA 3U2EA 1CWYA 1D8WA 1DKWA 1I45A 5E9AA 3W1XA 3UWVA 2P8BA 3VNYA 3GW3A 2X2YA 1L6GA 1FFQA 4DO5A 2QCHA 3BCFA 3E38A 4REQB 3NTYA 3UXDA 5EU9A 5ABGA 1XBYA 1BKHA 4KT2A 1F8MA 2QCNA 4LAMA 6PTDA 1PTDA 1ZBVA 4KEMA 4RE0A 3ABQA 4W86A 4B3KA 3U9IA 3VIPA 1TPVA 4JX6A 4C6MA 4E4PA 1NSJA 5B7ZA 4KRUA 1C9DA 4DYKA 4GQRA 3G2GA 1IT0A 1K9EA 1WBJA 3PBGA 2PEVA 3IIPA 4MTVA 4IPNB 3HV8A 1KKOA 1HQTA 4O28A 3ELFA 3W00A 2Y2WA 3A4JA 1NFPA 1EGMA 3OEXA 4AB4A 4C1LA 1BTCA 3IJ6A 4N9BA 2PC4A 4S3KA 1QNPA 1KCLA 1IXPA 1BWVA 2XFFA 3O3RA 3WF1A 5MKGB 4IFKA 1GNXA 5ABEA 1EJSC 4GNVA 3WDJA 3T8LA 3P7YA 3SN4A 1UIOA 4GFIA 3N9KA 2EG8A 3M16A 5EFDA 1JVNA 3PANA 4H9XA 3GWQA 2PLJA 2XM1A 3FVDA 3UGVA 2V5CA 1K7FA 2VURA 1PYMA 3W1PA 3GFXA 4UR9A 1MXGA 5M1TA 3E2RA 3EWXA 3PB2A 3I3EA 5F2LA 5E0FA 1A4MA 2DVXA 4GUJA 4O8RA 1PXGA 2D73A 2YDAA 4M80A 3LXCA 2HDJA 2QMKA 4WJ8A 3C4UA 5A2CA 1D3HA 2QF7A 3HJEA 3DC8A 1D9EA 3TDFA 3F4NA 1G4PA 1MW3A 3UYCA 1QCWA 3TYZA 2A2IA 4H9YA 4DX3A 3I4KA 1K1DA 3AIVA 3LNPA 4L4MA 1C92A 1OGBA 3DBNA 5DX7A 5A2AA 4KCTA 2DP3A 4LUSA 3BG5A 3W29A 5I77A 1UROA 1DPMA 1VAHA 4AIBA 5LNSA 3MSRA 1TJPA 3NSXA 2XH4A 2Y88A 3LI0A 4M81A 3UXAA 1IR1A 3OODA 4EOUA 4H6KA 3CASA 3TAOA 3EOSA 3OG2A 1IQ8A 4HCLA 1E0WA 4IIHA 3VTRA 3GNDA 3HPXA 4JFVA 5L9FA 5A6TC 4XVEA 1JZ8A 5A8GA 3SRHA 3N29A 3C2RA 1TCMA 2ISWA 4QTGA 4OFCA 2ACQA 2VC6A 5HWJA 3AHTA 5CAHA 3NQBA 3ZVIA 3E0LA 1YQ2A 2WM1A 3PUOA 1LLZA 4AWUA 3W7JA 3SQMA 3FY1A 3Q94A 4GISA 3V16A 2JGQA 2OWCA 4O1BA 4D1JA 1BQGA 3G6LA 2C13A 3ZR6A 2V82A 4YS1A 5EMYA 5FOOA 1G5AA 4YLWA 2I5GA 1JUKA 2DSVA 1LOSA 4B91A 4QNWA 4EXAA 3M41A 2I9EA 1V7AA 3GVVA 4D6FA 5DMLA 4PODA 1RSCA 1J0KA 3W7LA 2XIOA 3Q65A 3BOXA 3RF9A 1FA2A 2YXOA 1QJWA 1DWAM 4Y90A 1NTHA 3BGAA 3GK0A 2ZZ6A 1LT8A 4FSAA 4DZAA 3S46A 4J3VA 3LK6A 4IFOA 4F4RA 4XAGA 1K03A 1NH6A 4HK7A 5JBFA 3SCTA 1WDQA 1ICQA 1UMLA 1PCKA 4O18A 1EGVA 4GYFA 1XHGA 2P1FA 2HJPA 1W9XA 2PDYA 4LWWA 4QROA 4W8BA 1S2WA 4QJ1A 3S47A 4YCPA 3GRIA 3ZXWA 4GCXA 2C71A 1E73M 1R2SA 3WNMA 4IIGA 4D1IA 1ELSA 2ACSA 3O0FA 2GQ9A 1R47A 1W5OA 2F84A 3AAMA 3WK0A 6REQA 3QKEA 1GW1A 4G6CA 4JQ2A 2Y5SA 3CO8A 4I5RA 1Q63A 1VFTA 1P6CA 2OZ0A 2ZXBA 1LLWA 2ZX7A 1FHVA 3SFWA 1FWBC 1C29A 1PZ3A 4A2SA 4JOMA 3B0XA 5A8NA 2R24A 4XO6A 4A8RA 4W88A 4DZ5A 2WMIB 3WJSA 3NYDA 2HBXA 2REQB 1R3TA 4IM4A 3WQ8A 3GAYA 4IP4A 4PTWA 1WDSA 3CTLA 2OEMA 1E4IA 4HOZA 3QQWA 1ZP4A 3URNA 3J7HA 2FZBA 3U3HA 1AW1A 2FDSA 1XIBA 4O1CA 4JIRA 3KXQA 3PTQA 4E5TA 1Q4WA 3VOIA 1U22A 5BOOA 3EMZA 1M04A 5EFFA 3FLUA 3L23A 3ARYA 1PIGA 3WDQA 3SB0A 1OYBA 3FYYA 1FWCC 2PDUA 4ROQA 2PWGA 4ICMA 1UJPA 4JIHA 3WCZA 1Q8JA 1W1B1 4PSPA 1A5SA 3A9BA 1VHNA 1NARA 3LPGA 1BFNA 2QYGA 4GWEA 1IR2A 2G3FA 3PBVA 1GVOA 1U1HA 2BVTA 1TX2A 3FAWA 1WBHA 3AO0A 1RQEA 1KGUA 1SO4A 1VIZA 4ZQRA 2GVJA 5AC4A 3HG4A 3M64A 4NSBA 2NWSA 3PP7A 2Y8UA 4GC3A 3QRHA 3RAOA 3HQNA 4Y9PA 1VJZA 1FDJA 1Q3NA 1XPGA 2OZ8A 1TWDA 4X9YA 1HKIA 4FMVA 4O17A 4XZMX 3ATYA 4XKYA 4GUFA 4UQEA 2VO5A 1L6FA 5HULA 3MY9A 1XCXA 3EWUA 2PTDA 3CV1A 1XYFA 4AX7A 3RO6A 4ZEPA 4YTSA 5AVHA 3ARVA 1EWDA 3WD2A 1WO2A 4GH3A 3BAXA 3WLTA 4J7RA 3ZS4A 1XIGA 3WQGA 2QIIA 2EKCA 1TPFA 4WR3A 4MWAD 4O57A 2XGZA 4INFA 1X8FA 3CUHA 1OF8A 2DH3A 5A8OA 4B5SA 1T6MA 1TSIA 3WJYA 2ONEA 3LPFA 4WDTA 4W4QA 3KOZA 1KBJA 2B0MA 1YIXA 2ZUWA 1TJ2A 2IKIA 4HTYA 3GU2A 3I7RA 3WFAA 1JZ6A 1UR3M 1K3UA 3PBWA 4A4AA 4JIIX 3G1YA 1P1XA 2ATSA 3WLSA 4E8GA 4RW5A 4KETA 4XZ9A 2ZUUA 4X60A 1XIEA 1TREA 5CGMA 3QPZA 2GPTA 1YPFA 3TYAA 1JDCA 1KFWA 3ZOAA 1D2KA 1M3UA 3W82A 3QN3A 1TUFA 2ZX9A 4XD4A 1FWRA 5FESA 3SI9A 3W7NA 3EWDA 4I6VA 4AQLA 5KTLA 1DQWA 4OGZA 1RA5A 4LY8A 1K8ZA 1ME7A 1W9DM 2YDSA 2VJXA 2JF7A 5CG0A 2HVNA 3GR8A 2WKLA 3N25A 2CLIA 4UTUA 3JR2A 2AOSA 1ODUA 2BMBA 4Q22A 3KFTA 2BV9A 2FJKA 3TV8A 3JRKA 5AHEA 1W5NA 4Z2IA 4X9SA 2WC4A 6TAAA 4PBGA 4QQUA 5EB8A 3URAA 5CXPA 3GDLA 4PB3A 4UMAA 3LTYA 1QTWA 4D6CA 5ECVA 2PLCA 4V28A 2RDWA 2NXIA 1EP2A 5M03A 3NZQA 3NGJA 3H24A 7TAAA 2CPUA 5FAGA 3QQ1A 5FJIA 3W75A 4ZZ9A 1X8CA 3FNDA 3RO8A 1MYRA 5CZJA 1ZY9A 4QDWA 1O68A 3P14A 1I2NA 3U7VA 4IFRA 3UZXA 4L6DA 4GI8A 3W7OA 2IPWA 3FX4A 2FHBA 3I68A 4GC4A 4IMGA 2XTKA 2Z1KA 3E74A 5FJPA 5I3FA 3A3XA 3G3DA 1XW8A 4O16A 4Q8MA 5A8QA 1ZNNA 4JHOA 4XSMA 1B3XA 1HKWA 3O2LA 4C6NA 4B15A 3VKKA 3PZGA 1ZJBA 3L0NA 2BGNE 4ZQOA 3TTSA 1VHCA 2DUXA 2VD8A 4GNKB 1JEZA 2E5BA 4V27A 1IGWA 4JHMA 5I2UA 4U31A 4OE7A 4B5VA 5B80A 5H8PA 5EGRA 3U4FA 3MU7A 2DPEA 4ES4A 4F2UA 4UTFA 3KTCA 1VFSA 3FA3A 1K7XA 3NEHA 3HPAA 1TIMA