3WBXA

Crystal structure of gox0644 at apoform
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
271
structure length
271
Chain Sequence
EAQTVISFHDGHTMPQIGLGVWETPPDETAEVVKEAVKLGYRSVDTARLYKNEEGVGKGLEDHPEIFLTTKLWNDEQGYDSTLRAYEESARLLRRPVLDLYLIHWPMPAQGQYVETWKALVELKKSGRVKSIGVSNFESEHLERIMDATGVVPVVNQIELHPDFQQRALREFHEKHNIRTESWRPLGKGRVLSDERIGKIAEKHSRTPAQVVIRWHLQNGLIVIPKSVNPKRLAENLDVFGFVLDADDMQAIEQMDRKDGRMGADPNTAKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative 2,5-diketo-D-gluconic acid reductase
publication title Crystal structure of Gox0644 at apoform
rcsb
source organism Gluconobacter oxydans
molecule tags Oxidoreductase
total genus 105
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature ec 1.1.1.-:
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3wbxA00
2HVNA 2PDBA 1FRBA 4NKCA 4Q3MA 2R24A 1AH4A 1PWMA 1RALA 3D3FA 4IGSA 3WBWA 3G5EA 3GHUA 4IJRA 4YU1A 1UR3M 1Z3NA 4XZHA 2HE5A 4GA8A 4ASTA 4JTRA 3GHRA 2IQDA 2PDHA 2F2KA 3LQLA 2P5NA 4XVEA 1T40A 2HVOA 3UGRA 3R7MA 3R6IA 4XVDA 4YVXA 3LQGA 4FALA 4ZFCA 2PDUA 3BCJA 2PD5A 3P2VA 4WGHA 3ONCA 4JTAA 4XZLX 2I17A 1IEIA 4EXBA 3R94A 1S1RA 4I5XA 3GUGA 1MI3A 3CAQA 3MB9A 2R9RA 3H7RA 3BURA 4WEVX 3V36A 1QRQA 3FJNA 1ADSA 1ZUAX 3NTYA 2IS7A 1MZRA 1EL3A 4WDTA 3BUVA 1MRQA 2PFHA 2BGSA 2HV5A 1RY8A 1Z9AA 2FZBA 3WCZA 3R8GA 3N2TA 4JIHA 4WDUA 2PDIA 2PD9A 1VP5A 2I16A 2IPJA 1LWIA 2HE8A 1LQAA 4XZIA 1RY0A 3KRBA 2PDKA 2IPWA 3GHSA 3V0SA 2PF8A 4OTKA 3Q65A 2PDMA 4GCAA 4PRRA 3UG8A 2NVCA 2PDJA 2VDGA 2IPGA 3VXGA 4MHBA 4JQAA 1M9HA 1XJBA 3G1RA 4FA3A 2FGBA 3LNMA 3R8HA 5HNUA 4GIEA 3LEPA 5AZ1A 1PZ1A 3F7JA 4DBSA 3U2CA 2PDXA 3N6QA 4XZNX 5LIUX 2PZNA 3UZZA 3WBYA 3ERPA 3R58A 1EKOA 1ZSXA 1C9WA 1S2AA 2ISFA 1AZ1A 3EB4A 4DZ5A 3GHTA 3EB3A 3ONBA 2DV0A 1S2CA 4L1XA 3V35A 2PDFA 3LD5A 2PDGA 4HBKA 3FX4A 3CAVA 2A79A 1Z89A 5M2FX 4XK2A 5HA7A 3MC5A 2PDCA 1QWKA 3H4GA 4ICCX 4FAMA 1OG6A 4XZMX 3COTA 4JTCA 3UYIA 2IKIA 1T41A 2HDJA 1SM9A 1Z8AA 3R43A 4YS1A 3RX2A 2FVLA 1Q13A 1JEZA 4PRTA 3CV7A 3M64A 2BP1A 4PR4A 3LZ5A 1US0A 4AUBA 4L1WA 1AZ2A 2PDYA 1AH0A 1VBJA 3S3GA 2CLPA 4LBSA 2WZTA 4LB4A 2INZA 4YVPA 3H7UA 3CV6A 1GVEA 1ZQ5A 3UZWA 1YE4A 3UWEA 2ACSA 3WBXA 2PDLA 3DOPA 2C91A 4DBWA 4PMJA 1Q5MA 4JQ4A 5DANA 4XAPA 1K8CA 3LBOA 2IKGA 5HNTA 2PDPA 1PZ0A 3CMFA 1J96A 1AH3A 2ALRA 3UP8A 2BGQA 1PYFA 4R9OA 4JIIX 2FZDA 1X98A 4H8NA 2FZ9A 5LIKX 1IHIA 2DUZA 4LB3A 2ACRA 5LIXX 2IKJA 2INEA 3O3RA 4LAUA 5LIYX 3RX4A 2PDWA 4YVVA 1YNPA 1A80A 4HMNA 2PDNA 4JQ1A 4XO7A 4JTQA 3UFYA 3V0TA 2J8TA 1PWLA 4RPQA 4JQ2A 1YNQA 2AGTA 1YE6A 4LAZA 1ZGDA 1XF0A 5C7HA 3DN5A 1EF3A 3C3UA 4XO6A 4PUUA 4WRHA 3BV7A 3UZYA 3B3DA 2NVDA 3M0IA 5LIWX 5AZ0A 4F40A 3O0KA 2DUXA 1X96A 4PUWA 3QKZA 4Q7BA 2PDQA 4JTDA 1EXBA 1HQTA 1S1PA 4G5DA 2WZMA 3EAUA 4QR6A 3V0UA 2IQ0A 4DBUA 4QXIA 4WDWA 4JQ3A 3WG6A 2F38A 5KETA 3T42A 2QXWA 4GQGA 4QX4A 1XGDA 2ACUA 3LENA 3LUTA 4GQ0A 3RX3A 1HW6A 4IJCA 4EXAA 1X97A 4GABA 1AFSA 2IPFA 1R38A 5JH1A 3CASA 4JIRA 2IKHA 4FZIA 4LBRA 5JH2A 3Q67A 4WDXA 2HEJA 4GACA 4QBXA 3LN3A 3UZXA 2FZ8A 4H7CA 2ACQA 3LZ3A 3M4HA 2PEVA
chains in the Genus database with same CATH superfamily
2J4GA 4IGMA 2HVNA 4CNTA 3PZMA 4B4FA 1G7UA 5I09A 2ZTKA 1PWMA 2BMBA 3GVRA 3VOIA 4GY1A 3WDRA 3GO2A 2GJPA 5LHEA 2ZX9A 1CDGA 1H0IA 4GRSA 2OKTA 2QIWA 2KAUC 3F4DA 1DJXA 1F3WA 1TQXA 4M19A 1KBLA 1XFCA 4REQA 3B8SA 1YPIA 1J10A 4ONVA 3W1LA 5CZJA 3BC9A 3M0LA 3CUXA 1OZQA 3LQGA 1KW1A 3FW6A 3BK0A 4JKLA 4WGHA 2QV5A 3OGSA 4C7GA 2YB1A 4KEVA 3MHFA 5KMYA 4QEEA 2I17A 4PE8A 2XWDA 5CGQA 5HATA 4HU3A 1QOQA 4AH7A 3PUGA 2ZZ1A 3N4EA 2B7PA 3R4IA 5MKGB 3CIVA 3PC0A 2QDHA 4ZOCA 3DFHA 3W2MA 4E2OA 3H54A 4HIBA 1O6IA 2YDQA 1CYGA 3HG2A 1UD4A 1EHAA 1ZUAX 3N18A 4CQCA 1RPXA 1XQLA 2ZFAA 2ZZ4A 3T0CA 3AZSA 4JPGA 2CIPA 3WLJA 1L2QA 3TU9A 4AD0A 1T0OA 1EXPA 2BTMA 3MQTA 5E09A 1TFVA 2C71A 3XINA 1B3WA 4MLJA 3AHZA 2WSYA 2GDUA 1NELA 4MDOA 3ES7A 5A6LA 1VPYA 2E8ZA 3DG3A 3NQCA 4FOKA 2V5BA 3TSMA 1SMAA 4W93A 1W9PA 4LVGA 3DFPA 1KCXA 2BG5A 4HNOA 1TQJA 2OG9A 1KGXA 4DBDA 1J0KA 1EX5A 5GJPA 4F4RA 5CPNA 2E9MA 1DE5A 1EPVA 5FA5A 1DP0A 2G3JA 4LAKA 3MMDA 3BJFA 2O7QA 2XDFA 3N2OA 3UPMA 3KLLA 2V8ZA 4O1BA 1FCBA 2GLKA 1OFEA 4RNFA 3ZVHA 1KLZA 2PDXA 2B7OA 2G3NA 3HFTA 2YCLA 1PCKA 2Z00A 3NO3A 1W1B1 5T9CE 1L8PA 5I00A 1XYZA 2YJQA 4U10A 1I0DA 5T91A 2GQ8A 2ISFA 4O0ZA 2PP3A 4LOCA 3ZMRA 1FDZA 3V35A 1XPGA 4WSJA 3FHAA 1EJRC 4DO5A 4JN6A 1MUCA 4U31A 2OX4A 3IVUA 3RLVA 1JCTA 4NZ5A 1Z89A 2D22A 1Q7ZA 4L9ZA 4UFHA 4L80A 3MWCA 3RM8A 1HKIA 1RLDA 4Q4PA 4XKYB 2G50A 2NUXA 2NVAA 3ZO9A 8XIAA 5H2ZA 2D0HA 2GUYA 4JL1A 2PURA 1OYAA 1UPPA 2WLZA 1RLCL 2ZXBA 3NNTA 3AHVA 2XVNA 5HWMA 2QMJA 1MDLA 3MUAA 4GG9A 3ARZA 3ARUA 3T09A 3PBGA 4GHRA 3KOWA 1BKHA 4AB4A 4L1WA 1J0ZA 3IJ8A 1XBXA 4K1GA 2YW3A 2ALDA 4Z08A 2JGQA 2E28A 3H2NA 3ZLHA 1TIWA 2FZMA 4PEEA 2VZVA 5KZEA 4LUJA 1Q2SA 4I7UA 1V0LA 3CUIA 1GVOA 1QW9A 3GDBA 2VX6A 3DHDA 4A4AA 3VVGA 1POJA 4ZQPA 4PB5A 5J8LA 1CW2A 2QV4A 1OCQA 4CLMA 5DMNA 3BW3A 4TVUA 2Y89A 1CXEA 1KTCA 3LI1A 2WWCA 4HHPA 3DBNA 3TLQA 3DFNA 1VCGA 4UQCA 4ZQCA 5CC3A 1ONEA 4O14A 4DLMA 4R9OA 3F5JA 3SW6A 2FZDA 4D1JA 4FMVA 5LIKX 1VLIA 2DIKA 3JUGA 4ATDA 1TV4A 5M17A 3SGZA 2QCGA 3H26A 3STCA 4D1IA 2DIEA 1EBGA 2QS8A 2X0HA 4LAUA 3DAQA 2BASA 1K9EA 1W17A 3BAXA 4Z2KA 4DPPA 2OJPA 5F4XA 3UJFA 1PWLA 3HQPA 3P8IA 3IIVA 4DXKA 1EZWA 1YNQA 2VELA 5D09A 1JYXA 3M9YA 4OWGA 1Q8AA 1CXKA 3HFYA 1EF3A 3UT0A 4K8HA 2QT3A 3PUOA 3HURA 1D2KA 1H4PA 2UY2A 2ZUMA 5LNSA 1B2YA 1XDJA 1DV7A 3M43A 4D6CA 3FY1A 3LA4A 3FVDA 4Z2GA 1E15A 2PDQA 1VRXA 4V28A 4FO4A 4MG4A 3RITA 4MVAA 3SN0A 5FCZA 4IIEA 2IQ0A 3HGRA 2I56A 3EOLA 4B15A 1SU5A 1EFZA 3A3HA 4F0SA 3TW7A 3IUIA 2Z1BA 1ISXA 1PAMA 4LUYA 1S5NA 3G0UA 1X7IA 1JL8A 3WNNA 4LWWA 1S5MA 3LBCA 5FJTA 3PBUA 3CL6A 2QKFA 3QTPA 1AJ0A 1K6WA 3CBWA 4G1NA 5I23A 4DHGA 4DY1A 3B0VC 4ZFMA 2F8QA 2XIQA 5D2YA 1RA0A 3DHPA 3BGAA 2ZZ5A 4Q33A 4D6FA 1RR2A 4GD0A 4GUJA 1GK8A 4RNIA 1X38A 4IPIA 5AECA 3G3MA 4IWWA 4LC6A 2WXDM 3M16A 1W1IE 2CHOA 3UCCA 3GHUA 4ML4A 1E1CB 1IXQA 1F8IA 4X60A 4Q8PA 4H9MA 3E0LA 1BQGA 3L4ZA 5E93A 3AYRA 4HNTA 2PDHA 1WYIA 3LQLA 9CGTA 2QUMA 3AUOA 2H8XA 3WMLA 4ZQOA 5K3VA 1WE5A 4O19A 2BY0A 4NT0A 3LDVA 2PP1A 3GM8A 3AXKA 5AY7A 3A3WA 1IXPA 4J1OA 4B5XA 2P3ZA 4XQ6A 1IEIA 2ADAA 4Q4QA 4D9PA 5A6BD 2C14A 2V5KA 2X8RA 3AWNA 3RR4A 3KBMA 2WBGA 3B9EA 1FXPA 3G22A 1TWIA 2R9RA 4JOMA 2NT0A 1I2OA 1A5MC 1XHGA 5FIPA 3NL6A 2I1OA 3QOKA 2FJUB 3GDMA 2AMGA 4TXEA 2WNZA 3DHUA 6PTDA 1TMLA 1WXZA 1NF0A 4XUGA 3NL2A 1V79A 1TA3B 1U5JA 3ZSTA 2H9AB 1RCQA 1YMYA 2V69A 3FKKA 4FNSA 1TRDA 4GKLA 3WF1A 4EWND 2ZYFA 2VC5A 2DSUA 3MMWA 1TTQA 2PDIA 1AUSL 4MWAE 1H5YA 4JHMA 3W7RA 1P1XA 1EP1A 2JKEA 1CEOA 5ABTA 2D1ZA 1FWEC 3EEZA 1GQLA 2NV2A 5K7JA 1J4EA 1K70A 3A6OA 3O6YX 5CQ1A 3PTQA 6A3HA 3Q65A 2PGFA 3MZNA 5D33A 3TYEA 2DT1A 3DFYA 2XH0A 4IIDA 3ENLA 3EMQA 4XX6A 2VFGA 4LBUA 3TTOA 3ABOA 3DG6A 5HNUA 3ANYA 2TPSA 3O15A 1P6CA 3OG2A 3BWWA 3UXIA 5EFDA 3LOTA 3HA1A 3LEPA 1A4LA 5IFTA 1EOMA 2DU2A 2EJ1A 4P8XA 4DUOA 3CIXA 2TSYA 5BXSA 3H7VA 2X1UA 4P8WA 4M1BA 3WBYA 3R58A 1OC6A 4C6EA 1SPQA 3CUZA 2B7NA 3IVSA 3SRFA 2NLIA 5HQMA 1K03A 4O57A 3EB4A 3W25A 1ZAHA 4P7OA 5DT7A 3M5VA 4I6VA 1IWPA 3BOLA 1IT8A 2QNEA 5FF4A 1TWZA 3V4BA 1CXHA 3ABZA 5EA9A 2XM2A 3W1NA 1EUNA 1Y8BA 5HA7A 1CLKA 5FF0A 2ZX5A 3RM9A 2WVVB 3W9ZA 3KXQA 4ICMA 2B4GA 1I1WA 3PFMA 1Z32X 1FFRA 1CENA 2FTYA 3DCPA 1PBGA 1DWAM 1W2VA 4GXWA 1QXLA 4AAJA 3BSMA 4DF0A 1ZB5A 3B9AA 5FF2A 4OBRA 3VGEA 2QQ6A 3VAVA 4QIUA 3G77A 3G18A 1GGOA 1H7XA 1XICA 4QQ3A 2QZRA 3TYAA 1EBHA 4G6CA 1PL9A 2RAGA 3N6HA 4GQRA 1LOQA 4EANA 2NZLA 1MWOA 4IG2B 3FJ6A 5IBXA 4F48A 4B5WA 1RHCA 4H8UA 4OGZA 1F6PA 4CU8A 1A5LC 4OBTA 4S1FA 1I1XA 1GVYA 4Y6GA 1VF8A 4KH2A 2ZUWA 2C3ZA 5EMUA 1UA7A 2BODX 1PYMA 4GYPA 5G1YA 1EJUC 1V03A 2E77A 3VYLA 3WDJA 1V7YA 4V2XA 4MKVA 3W7LA 1KB3A 3VTRA 2DP3A 4EAMA 3N73A 1GTHA 2WZHA 4PTWA 4QG8A 3K4WA 3R1ZA 5E0FA 3QY7A 4LF1A 3WF0A 1P0DA 3D47A 1XLDA 1E3ZA 1R3WA 3WD3A 4JYEA 5EKYA 4FNUA 3CMJA 2ZC8A 2ZRXA 3QH2A 4LJ3A 3WNOA 1BXCA 3AXIA 1AMKA 4E2VA 1N82A 1O4UA 4G7FA 4JHOA 1IEXA 3ARXA 1Q6LA 4UMCA 1B54A 3AS1A 3H53A 3UR8A 5K4ZA 4X63A 4J3XA 3LHWA 3GG7A 3N9KA 1WAUA 5BXPA 1F3TA 4AVOA 3L68A 2VRQA 1EIBA 4XAFA 1OD0A 3VE9A 2VCAA 4IGHA 3MUZ1 1QT1A 1ZU8A 2O9OA 3LRKA 4QJ4B 4B4HA 2J9YA 2UV8G 4IJBA 3EAUA 1JFXA 4DBUA 2G4FA 4QXIA 4WDWA 4HPNA 2CBJA 5GPRA 4N9CA 1YXDA 3SY8A 5KZ6A 5CC5A 4ZXLA 2FPYA 2X1IA 4RNHA 1XYAA 4GQ0A 3LX9A 4QJ5B 2JIWA 3I10A 2DZPA 3F2BA 1DE6A 4LBRA 1O12A 3G1DA 3PUEA 3KX6A 3N9SA 1UC4A 2VCBA 4FIQA 3OGRA 3OEXA 2XPKA 3K1DA 3BLEA 4C6OA 4Q32A 1TWWA 4RV3A 2VDHA 2OYKA 2CLIA 3M4HA 2ZA2A 3EDEA 3SB0A 2J7CA 3EDDA 3PPGA 3PG8A 3V5OA 4JY8A 2RDTA 3N1AA 4ZTYA 3TQPA 3B8UA 5IDZA 1K7XA 3SI9A 1E3XA 3ZSSA 4C6LA 1V3HA 4OFCA 4ALDA 5DQPA 2QDDA 2R6OA 4NF7A 3W24A 2XIOA 1L6SA 3A5VA 3N3TA 1UOZA 2Y24A 4UQ9A 3GR8A 3MUXA 4M24A 3M46A 1ZBKA 5AB3A 4DVOA 1MEHA 1NY1A 3G1AA 1YTEA 4XTDA 2GQ9A 3W2KA 1JZ7A 2XHYA 1W91A 2WKGA 3R94A 4E38A 1EJVC 4IPJA 1OC5A 4I5XA 3GUGA 3MB9A 2Z28A 7ODCA 2ZUVA 3PJTA 2OZ0A 4WEVX 3UJEA 1W5MA 1HVXA 1Q66A 2FH6A 1LOLA 1PTGA 3T2OA 4O8AA 3C4UA 1FXQA 2ABAA 1YDYA 4UXDA 1IR2A 1UPMB 4HZ6A 3E0WA 2CLMA 5LGZA 3UETA 4M1RA 2XZ7A 1XLEA 4JYFA 1O1ZA 3KTXA 1XBZA 3NGJA 1KQZA 2X30A 5E9AA 1FWCC 4V33A 2FVMA 3L7RA 5D2XA 3PZUA 3FDGA 1ICQA 1GHRA 1P6BA 1LRTA 4CVUA 2OU4A 1GWJA 3DXIA 4XZIA 1TPH1 3EPMA 5DN1A 3UJ2A 1LBMA 3CPRA 3V0SA 1EH9A 1GVQA 4L56A 4GYJA 4WQ6A 1PXGA 4GI9A 4R3UA 5XIAA 2R94A 4Q8NA 1PX8A 1MW0A 2Y8UA 4UTHA 4Z1DA 2VDGA 1JGMA 1OEPA 2CXGA 4MHBA 3C2FA 1LROA 4KWWA 1XIMA 3ECQA 4RX0A 1DIDA 4UMBA 1D9EA 3R8HA 1EA0A 2TODA 5HUPA 2NW0A 1XLGA 2OT0A 3R2GA 3W6LA 3M44A 3WQCA 2D73A 3T4CA 4EP8C 2ATMA 1AW1A 1GVFA 3U5UA 2DJXA 3TYDA 3A4XA 1N8FA 2WK2A 3V7PA 4PBGA 4NI3A 1CIUA 3CHCA 5DCDA 3UZZA 3N13A 4BCEA 4C7DA 1SQ7A 2GZXA 2RGMA 1AQHA 3WH7A 3CQIA 1JCXA 2AQVA 3EPOA 3AJXA 2Z26A 4W4QA 3TN5A 4A05A 3AHYA 3I4EA 3W87A 4X9SA 2DZVA 2DIJA 3SUUA 3OVQA 2CHRA 4WHBA 4H8VA 1XLJA 2PMQA 3GG0A 2A3HA 2PDGA 3CEPA 1JPMA 4FNPA 4BWLA 1KRCC 3O1NA 1ZJHA 2XSBA 3DESA 3EWUA 1JUKA 5GVJA 1F5ZA 2QJIA 2PDCA 3RXZA 1PX3A 5K9XA 4RV8A 1OG6A 5D05A 1V0NA 4XZMX 1Z44A 2GQ3A 4JTCA 2W63A 1RP9A 3LCWA 4L61A 1V51A 4AISA 2HROA 1KLYA 2IKIA 1KR1A 2UWFA 2RDUA 1OT2A 1TPFA 4Y7EA 2HDJA 3GXMA 4GFSA 1WO2A 3ZJ8A 4L6HA 3WQDA 2FVLA 1UZDA 1JEZA 4ACYA 4RLIA 4KWVA 4DWSB 3G1SA 4TQTA 1C9DA 2P0OA 3QV6A 2BP1A 2YCEA 3BE7A 4Z1YA 6TIMA 1UBPC 3GVQA 4S3BA 1TV7A 3IIPA 1Q6GA 4PMYA 3SO7A 1NOFA 4O28A 3H7UA 1LZOA 3CV6A 2VR4A 3UD6A 1OFQA 1GVEA 1ZQ5A 1E71M 1H7OA 4NXKA 2GVEA 4Y9PA 2Z2BA 1R9XA 5BOEA 2MANA 4KWSA 2PLJA 2DZWA 1BHGA 3SM0A 4H6QA 3B9DA 4JQ4A 4DN1A 1M68A 3MW7A 4HN8A 3B4UA 5DXXA 5FF7A 1QI5A 5DMLA 5HMSA 1EGMA 2ZXAA 4BJHA 2VUNA 3RYSA 2J7BA 1GOOA 2A7RA 1RBAA 2VVSA 1BD0A 2HPMA 3FV9A 2WMJA 3N4FA 1XKJA 4PUDA 1JIBA 3BLKA 3TSDA 3R89A 3O3RA 1EHNA 3K30A 3QMRA 3F2DA 2OB3A 3IJDA 1ZRQA 3E38A 2P10A 2PRLA 5A69A 1RQBA 4LUSB 1HT6A 4C91A 2ZVIA 5BU9A 1ICPA 1GOKA 4CN6A 4DWSD 1KXTA 2YLAA 5A6AA 2V38A 3GXTA 1VLWA 1J93A 3LTSA 5D37A 1VFOA 1E6NA 2D24A 2X2YA 4HPXA 4NAEB 5KZDA 3GE7A 1OFPA 3HN3A 1OX6A 4UTJA 1MDRA 4XISA 4JTDA 1G67A 5BNKA 1HQTA 2C0AA 3VIOA 1UJPA 4XUYA 1VGAA 3U7BA 1YPFA 2QULA 3EWWA 4JYDA 1JXKA 4FNQA 4JQ3A 3WG6A 1K9TA 1R47A 2C1IA 2ISSA 4LH8A 3WO8A 4MKSA 1E43A 1GG1A 3HBLA 4C90A 2OT1A 1H1YA 2A7NA 2VZSA 4DZIA 1E70M 4KETA 2A2IA 3LLDA 4NU7A 1X97A 2W9MA 3QMSA 3RMEA 3GQYA 2BV9A 3C5QA 4A6GA 4JIRA 2P0IA 3NEHA 3L4WA 5BXTA 2XFFA 1MXGA 3QY8A 4CU7A 2HEJA 4LY8A 4Z0SA 1M7OA 1T96A 4EIVA 5F2LA 2VFIA 2JEPA 3QV7A 3L4YA 4AWTA 1REQB 4FEZA 3S1WA 3VE7A 1V3LA 4HT3A 3LB0A 1CB2A 3HPSA 1FRBA 3N29A 2Z7GA 5AHNA 1KBIA 2BY2A 3B8IA 2PWDA 3PPCA 3S9YA 2WQPA 4IUGA 4B3ZA 3G6MA 3WBWA 2O92A 3KDOA 1J18A 1O5QA 4AEFA 1DQUA 4V1XA 3NQ8A 1BRLB 4GA8A 3WD0A 4NXSA 4FB7A 1X39A 4N6EA 1W5OA 4XVEA 1KV5A 4MUPA 4D8ZA 1T40A 2YYUA 1M65A 1CNVA 4AF0A 1ZCCA 3O6CA 3T6CA 4EPEC 4S3DA 5CBBA 3QOMA 5F2IA 2EJAA 4MB4A 8CGTA 3WJSA 2J24A 4ZGYA 1S3TC 4QITA 4C6FA 1AL7A 2I57A 1CB7B 1NWUA 2D69A 1FHVA 3URBA 5KINA 4WOZA 1CGXA 4UQAA 4A3RA 4IIFA 4CVWA 1ZAJA 3IJIA 1AODA 1FFQA 1O66A 1TPC1 2QF8A 2R91A 1JD7A 1FWDC 1E1FA 4R53A 4QTGA 2ZUTA 3ZT5A 4CD7A 1VCFA 4HZ8A 1VB9A 2OEJA 3N2TA 1UKTA 3ITXA 2F7FA 1ISWA 4F0HA 1JAKA 3ZIZA 4TUFA 1V3JA 1V6VA 4N2YA 3S9IA 4IOTA 1XLBA 3LI0A 3U6WA 3W2NA 4TV5A 2PZ0A 1XUUA 5L6UA 1PVNA 4Z2HA 1GUVA 1HUVA 4K68A 2IPGA 4L64A 5DY2A 4FXSA 3AIRA 1EUAA 2QR6A 2CBIA 1XIIA 2D20A 3B40A 4E4UA 5G5IA 1CXIA 3GC4A 4IGNA 3NPWA 3MUCA 3L12A 2VZUA 4O11A 4ZL1A 5I3GA 3DG7A 4ZSTA 3CHEA 1TZ7A 8TIMA 2NQ9A 4MZ8A 3KCJA 3TN4A 1I0BA 2QF7A 3NQGA 3OZOA 2E5BA 1H50A 1UYQA 3UPWA 1ZENA 1QK2A 3LCGA 4W5ZA 3CNYA 2O9TA 3WEZA 1OQFA 1SW3A 1DYSA 1XH2A 1K3UA 4IX2A 1PKLA 1V02E 4WCJA 4LW7A 2GJRA 1JPDX 3HQNA 4HBKA 1NWTA 1Z42A 4KMQA 4R88A 1XD1A 3LPOA 1XQKA 2D0GA 2FDMA 4ICCX 1WXJA 1EGVA 2A21A 2XGIA 1TCMA 1A53A 4DUXA 3M6DA 1XSJA 3H23A 3BARA 4DYJA 3COTA 1HJUA 2Z2UA 2J79A 1TTIA 4AZIA 4PN2A 3DYMA 4MM1A 3VD4A 3ABSA 5BW6A 4WK9A 3QW3A 4UFJA 3GNDA 3UG3A 3WK0A 1B4EA 3T81A 3WJXA 4R7OA 1QI3A 1LP6A 5CPSA 4G9PA 3UWYA 3GS6A 2XFRA 5J5RA 1P0BA 3S3GA 1XWYA 1L6GA 1VHCA 4LBSA 3EBVA 3VD7A 4H01A 1XIEA 4YVPA 1Q4WA 2ZKMX 1TSIA 1FWNA 1YDVA 4IP7A 3M07A 5C2GA 3CZLA 4LNCA 3UEQA 1I2RA 3VPLA 4XV0A 3UG4A 4JX4A 1UQYA 2O56A 7ENLA 4PMJA 2VL4A 2AL2B 1CBGA 1CECA 3WIJA 3BLLA 1A0DA 4JX5A 3ZOAA 4FSAA 3W1AA 5HUOA 2WC3A 4RDWA 1VJSA 4B5TA 1UBSA 3V16A 3P5ZA 4HGXA 3ITOA 3W27A 4MF4A 3FSUA 2RH9A 1UWSA 2NQ5A 4UOZA 3W76A 2ACRA 2OSXA 2WC7A 1UG6A 4D6JA 4EPDC 4V27A 4HD5A 3CH9A 1RUSA 3HPXA 2GGIA 2IXUA 2KZHA 7PTDA 2DT3A 1HGWA 3SGUA 1VYPX 3GH4A 1FWWA 2E8YA 2V5LA 2XFYA 1M7JA 4NSBA 5F7UA 3MU7A 3WQEA 4EF9A 1J0YA 4YXGA 1XXXA 5D03A 5A95A 1PKYA 1JZ4A 2ZZ7A 2EPHA 3RU8X 4I5RA 3WUBA 1I2NA 5I79A 1QO2A 5DO8A 4DJFC 1P1MA 6REQA 4LRTA 4QP0A 5CG7A 4E8GA 4Q8QA 4GPNA 3ZZ1A 2BS9A 2EHHA 1E6SM 1TO3A 1LT8A 4J3SA 4US5A 4HJWA 3AQUA 4N6FA 4UTWA 3SQMA 3HPAA 5HOSA 3KWSA 3FJ4A 3AJ7A 1JYWA 2ESCA 4S2BA 1GOXA 3QZ6A 3VMOA 4BEUA 5CBJA 1XCWA 6CGTA 2PSNA 3STEA 3QHNA 4TTUA 1WKDA 4GQGA 3E0VA 1NM9A 1XSIA 1DHPA 3K2GA 1OX5A 1LLOA 4UCGA 5LKYA 4OHQA 3WNPA 4C7FA 2WV8A 3SSZA 1ZBWA 3BW2A 3L4XA 3VUSA 3UZXA 5H8MA 2YB4A 2B31A 4NZCA 1E5JA 2OQLA 3W1PA 2Z0IA 1Q65A 1EP3A 3W7EA 3LM3A 5AYYA 1E40A 1RALA 1GVIA 4P7QA 4UTTC 2QDEA 3V75A 4NHVA 3TNBA 3QQ1A 5D38A 1V6YA 3W85A 2MNRA 3IJQA 3KBNA 3C2OA 2A3EA 1BTCA 3FLUA 3VCRA 5H6HA 2NQLA 1H7RA 1ESWA 1JNDA 3IIOA 3UGRA 4D6DA 3SAZA 1BGGA 4NZJA 3ARWA 4JEJA 2VFFA 3SJ3A 4AZCB 3QGKC 1UKSA 1A3HA 2PDUA 4AD3A 3MI6A 1BVNP 2PD5A 2WOQA 3WD2A 2J75A 1TVPA 3OO2A 1QBBA 3TJ4A 3HPFA 4NNBA 1KNWA 3DC8A 3H22A 2AAAA 4Z1CA 2CLLA 4IFKA 4GBDA 3GNNA 4HOXA 3QBUA 1B9BA 3H7RA 1D3HA 3BURA 1KWKA 1SR9A 1ADSA 4ZENA 2QAFA 3PBYA 2BB0A 3ANVA 4ZB2A 3NOYA 2OPJA 3GFYA 1P5BA 3OP2A 3IV3A 5CPLA 2VGFA 3AS3A 4G2DA 3GD6A 2NXGA 2PFHA 4Z17A 4D6HA 1QK0A 1K4HA 1JGIA 4EX4A 3WUGA 3AROA 3SIMA 1KGWA 3LRLA 4TR9A 1F74A 3TTSA 6TAAA 1MQQA 2A0NA 7REQA 2GGJA 2NXIA 4QCFA 3S6DA 4ES4A 2VMFA 1LBFA 1RD6A 4CQAA 4TO8A 3HIJA 1RA5A 1UP3A 4U4MA 1SZRA 2J78A 2W4XA 3TFXA 2PAJA 4XBKA 4OV4A 5A8QA 4ADUA 4GC3A 5LSMA 3TYCA 4GCAA 2XN2A 3UG8A 4HYWA 1HL8A 3UVAA 7A3HA 3VC5A 1KRAC 1QOXA 2WVUA 1OFDA 4KCVA 1Y5VA 1HGYA 4FNTA 3NJ3A 1R6WA 4GNJA 5H8PA 1ZFJA 1CT5A 2W92A 3W1XA 1LCOA 3ALGA 4A22A 3IUDA 3O7UA 4I7VA 3EA2A 4J3UA 4PBEA 1TWDA 4RCXA 4UR8A 4U2YA 3PN8A 1UR4A 1EC7A 4GI6A 1I45A 4N02A 1JXJA 3GG8A 2W62A 4F2TA 4AY8A 2EQDA 2FTWA 1Q7MA 4RK8A 5GNZA 3APYA 5C7VA 1KQYA 4M6QA 4QNEA 1S2AA 4URIA 4A3UA 1JNEA 1G69A 4QDPA 2FHCA 1TJ1A 3WMBA 3H2MA 3A13A 3U0HA 3P93A 4WY0F 3CUFA 2PPGA 2Y62A 3NDZA 2OWCA 3INPA 1P6WA 4AZ7A 5G4WA 3CV1A 4M82A 3CQKA 1MVYA 1OF8A 1ONWA 2WB5A 3S6TA 4PL2A 4JR5A 1P0NA 4F2BA 4KRZA 3M5XA 3P14A 4ACZB 1F8MA 2NXHA 2WJDA 1V3IA 3SRDA 3CWOX 1BQCA 3W2UA 1HJSA 3SCTA 7TAAA 4MJZA 5HQEA 1KFWA 1W3NA 2JALA 4RKAA 9XIAA 4Q8UA 5AFDA 4GJJA 3KVLA 2HNHA 5HPOA 3KRUA 2PC4A 4YMZA 1D8WA 5AC5A 1TV5A 3VKBA 4AUBA 3OPSA 4Q8MA 2BVWA 2H3DA 2NX1A 3WEOA 3DYPA 3RLGA 5IM51 3MJMA 4Z42C 2Z24A 4X2PA 5REQA 1I6NA 1Y5XA 4KRTA 1UKPA 2NT1A 1FH7A 3BOFA 1FHUA 3C0QA 2DT2A 2WM0A 4DJFD 1DWHM 2PGRA 4KFNA 3YPIA 2A3CA 5E0CA 2FQIA 4OU1A 3MUY1 3ZS4A 3CZ8A 4ZB5A 4GYFA 3LS9A 4WOQA 3K5XA 4EF8A 1SUXA 3ARYA 4QAIA 1LYXA 3RDKA 4UTUA 1RJPA 4QHRA 4NNAA 2YL9A 4Y9MA 3W02A 4RDVA 3ZM8A 3FSTA 3A3XA 5EMKA 1Q3NA 1S2VA 1NFBA 4MADA 1YQ2A 5A6MA 5C8BB 1JZ8A 1GYLA 2J6VA 3Q58A 1BYAA 3TC6A 4JTUA 4AEEA 4H8HA 1KR0A 1PYFA 3WJWA 4XZ9A 3MDWA 3MI2A 4WF7A 1R7OA 1O5KA 4F8XA 2FZ9A 1I8JA 2O4MA 1UB3A 3BZJA 4FP1A 3DDMA 3H2CA 4LB3A 1CWYA 3PR2A 2DW6A 1ZJAA 3SR7A 4YWSA 4JTSA 1IZCA 4MLRA 3QR3A 4E4FA 3PAOA 1DWIM 3MSGA 4REQB 2BNJA 2FPVA 4PMDA 4B91A 1UD8A 3B8WA 5B80A 3RLHA 1ZP4A 2GJLA 3VM7A 1LG2A 3QYQA 4ZOAA 3ARRA 3AO0A 3UY7A 3MCNA 2TYSA 3W1QA 4PUUA 3BV7A 2XU2A 4ML9A 2BVTA 3M0IA 1GQNA 1E0WA 2D2HA 4MIMA 4OBSA 2DUAA 3GTXA 3BLOA 1A5NC 4ZB0A 2PTDA 1MNZA 4B3LA 3GY1A 1K4GA 1DJHA 4NAFA 3PZNA 4S39A 3QLLA 4HCDA 3GBEA 3VD9A 4CQ9A 4W9TA 1EEPA 1UD3A 3H4WA 5DCEA 4HQVA 1Q2RA 2G3MA 1ELSA 2WPBA 2WVTA 4PFHA 2W27A 4AD1A 2GYIA 4CQ8A 1TKKA 2ACUA 4BF5A 3U2ZA 2HWGA 4EXAA 2R1PA 5H8UA 3GH5A 1SZNA 4B5VA 1R0MA 1B5TA 4GYKA 3WLMA 3MSDA 4IUOA 2ZUSA 1SJAA 1GOMA 3OLGA 4GX8A 1WDDA 2EG6A 4N42A 3RNDA 2ZWYA 3W72A 2G8ZA 4L5ZA 4QCEA 1MUMA 1TE6A 4O1EA 4OUIA 2J9XA 2OKOA 2P76A 4WIWA 1EA9C 2GUBA 4XWUA 3ZVHB 2J7DA 2FHFA 3GXPA 1WUEA 3EOOA 2ZX7A 4W5UA 4UCFA 3I4KA 3J7HA 3H12A 4IPNB 2GFTA 2PTYA 1XDLA 1OYBA 1KA9F 5E0KA 2Y7FA 4LNYA 4NZ4A 2QCNA 4LS1A 1PS9A 1TV8A 3MY9A 1E55A 3OZMA 1O94A 4ZE4A 3W1UA 1TCDA 2J8FA 2PWEA 4DPQA 1BVZA 2YXXA 4HMEA 3CL7A 1NH6A 2PGWA 3CQ0A 5JXQA 1LRNA 1BGAA 3E74A 5A8PA 3CT2A 3SADA 4NJHA 3LCXA 4KCUA 8XIMA 2CZDA 1KD0A 3ZR6A 3BPWA 1JPIA 3TN3A 2HV5A 3UU0A 2GJNA 2NLYA 4U33A 1ZHAA 3AS2A 2W67A 3NPXA 4WJ8A 3LYEA 2PD9A 3EKGA 2WSRA 4FXJA 5C2CA 3ORWA 3KRSA 4EOUA 3TW6A 3E2SA 1H09A 3NZRA 3W00A 2J7GA 5I3KA 3AXHA 3B0UX 3O6AA 1XLAA 1IE7C 3K8LA 1DWFM 2VEKA 4MFDA 2I14A 4AHOA 3KL5A 3GWQA 4UTIA 1OCBA 2VR5A 1VJZA 4EWJA 4X0VA 4XIAA 4BI6A 4Q7NA 2ZRWA 3AWOA 4FA3A 4JDBA 1NJJA 2GWGA 4DJEC 2P1FA 5AZ1A 4NY2A 2Y7DA 5K2ZA 2VC6A 3KW3A 1HKMA 3KTCA 4Q4RA 3TROA 4YWIA 3MT1A 4CEUC 3AYTA 1ZSXA 2OYLA 1C9WA 1OIMA 4JN7A 4LU0A 2E1DA 3GTHA 3QF0A 4L1XA 2HJPA 3S4TA 5KTLA 3G24A 1XRSA 4QAWA 3LD5A 3Q4DA 4UTMA 5D2WA 3WLIA 3RUBL 4U3AA 3RAOA 1FDYA 3CLMA 2DSWA 2PTXA 2WHKA 4IISA 1HNYA 5JVLA 1UWIA 2H3BA 3S8HA 4GVIA 4C5ZA 3ALFA 4ECLA 1G0CA 3ZWTA 5A6BA 2OZ3A 4RZ6A 5CSUA 3N2MA 2CBUA 3NQ6A 2P8CA 3KBWA 5C6MA 1WKEA 4BZYA 4MTVA 1KM6A 3WLKX 4YS1A 3ZT7A 3GC2A 2VRKA 1A47A 1SO5A 1UH2A 5EBUA 4NRSA 4D71A 1DQXA 4JTJA 4GUFA 2TRSA 1E9IA 4CEXC 4O0KA 4D2JA 1BAGA 2UZ9A 3FKRA 1V8EA 3CO4A 2XN0A 4L9XA 4UNLA 3BG5A 2J25A 1E9ZB 4O18A 2CLEA 1F05A 5CXPA 1H63A 3UWEA 3MVTA 3DOPA 3TH6A 1U1UA 1BF2A 2DH3A 4AWUA 4YYCA 4NILA 3VGBA 4WXYA 3LBOA 2IKGA 5HNTA 2RJGA 3AIWA 1PZ0A 4D6IA 4KW2A 5IDIA 3DERA 3UP8A 1Y0EA 3DKLA 3OVRA 1LQ0A 1PEZA 1EWEA 3W75A 4HVXA 4O1FA 3AISA 3GNXA 5IHRA 3A12A 1A5SA 1Q8JA 4NUWA 5C9UA 3AYVA 5LIYX 4AD2A 4O0QA 1MFVA 4Z1AA 3P8JA 3WSUA 4B90A 3S1UA 2Z6JA 3BCFA 2OZ8A 2V68A 3NURA 5CSYA 3STGA 4FX7A 1AQ0A 1C8YA 1X1ZA 3FYYA 3A4AA 1T8XA 4O1DA 2H8ZA 5E6ZA 6ALDA 2H90A 4HYVA 5AZ0A 2W79A 1X96A 1HZYA 4R85A 4ZBCA 1ML1A 4AVFA 2AL1A 3RK8A 1J5TA 4BA0A 4HYRA 3T1GA 5XIMA 3L4VA 3HQOA 4CCCA 1H7WA 4LEQA 2RGLA 4ZO8A 3BJSA 2WZMA 2H6RA 3U9IA 2DZTA 4W89A 3EKZA 1U33A 5M03A 3THCA 3NQEA 1M03A 2DH2A 1DWJM 4MWAC 1UJQA 3T42A 3II1A 1XRFA 4PMNA 3AFBA 3LBMA 3LENA 2LLEA 1XISA 1DHKA 2YR1A 1UHVA 1EGZA 1SO6A 3QQ0A 2IPFA 1AA1B 1O60A 3QGAC 3NDOA 3K8KA 5DCBA 3Q67A 1DJYA 2DZUA 2Y7EA 2OGJA 3OTRA 1XLHA 4ERIA 5CAKA 2GVGA 2ACQA 4Y96A 2J47A 2V30A 3K8MA 4KCWA 3NQVA 4DM2A 3U7VA 1XD0A 4F0LA 3N9RA 3M0KA 3PZVA 4MZ1A 3TR2A 1SMDA 3L0GA 3S5SA 1UZ4A 4R5EA 5CCZA 5C9WA 3WDIA 1VIWA 1FUYA 3W07A 3P60A 4KGLA 4LVFA 3I7RA 4BEQA 1ZCOA 3IANA 3L2LA 2EPLX 3CPGA 4FLSA 3S2MA 1HG3A 1MXSA 4MKNA 3MKVA 4GISA 4NASA 2Q8LA 2WHMA 4AY1A 4HSOA 1A5AA 1CX9A 4AX6A 4B2DD 3W3OA 1R2SA 1UR2A 3VDHA 3DYOA 2V3EA 3E9AA 3OYZA 2HBVA 1UUQA 1E51A 2QJHA 3V36A 1WQ5A 4Q8WA 2D3LA 3NQ2A 4B9ZA 3OYXA 3FIGA 4FPSA 3CB3A 1V5XA 2WLYA 3SCSA 1W9BM 4TIMA 4L7ZA 1WV2A 5AC6A 5AHLA 5DBUA 2L5HA 1EPXA 3NPVA 1JQXA 1Q6QA 1TPWA 4MDPA 2AKZA 4X3ZA 5A6KA 3VNZA 3IUHA 4IIHA 4MNLA 4IH3A 1TR9A 5D9NA 3A9BA 3AHXA 3SCOA 3WQWA 1XBYA 4AXKA 3CQHA 3R0DA 3KRBA 4W7VA 1JF5A 2GJXA 4IXHA 4RW5A 4X2RA 3T78A 3P0XA 2FFCA 3C3NA 2V2HA 2GVJA 4H9TA 2EF9A 3CLWA 1KRBC 1U83A 3G1HA 3NQFA 2J62A 3VXGA 3VUPA 2ISVA 5EFFA 5F2GA 4U3CA 2CHNA 4J7RA 1E6RA 5M3WA 2A1YA 4QQUA 1C93A 3R12A 5A8MA 1S2UA 4XBSA 2PTZA 3CTTA 3GKFA 3MDUA 3NEVA 3QY6A 2XWEA 1NDWA 1LG1A 1JUEA 5LIUX 3B9NA 4PULA 2C79A 3ERPA 4CQDA 1SJCA 5I78A 4RE4A 4W87A 4LAOA 1JD9A 3B9OA 2ODOA 1H11A 1KRMA 4ZO9A 1ME8A 3NQDA 3CM4A 3RO6A 1QHPA 1FWHC 5EMYA 4O4WA 3CV2A 3CPUA 2C6QA 4EKJA 5TNVA 3CAVA 2A79A 1JCNA 1SSDA 2CLOA 5I06A 4D6GA 3VOHA 2ZA1A 5DLCA 4LRSA 4R7JA 2J88A 4AZGA 1TMQA 2ATSA 1F6YA 1ZZMA 4AHQA 1T5AA 3W1MA 1B90A 1SM9A 3NVDA 3B4YA 4LCRA 1Z8AA 3NQAA 4N4QA 3QEZA 3ITLA 1DIKA 1K8XA 3VOGA 3I6TA 2AQWA 1KBJA 2CZVA 3MHUA 5T9BG 5AHFA 3LCIA 2C18A 3CZEA 3ZQ9A 1XC4A 2Y7GA 1LLWA 3LZ5A 4QLLA 3REQA 4IL2A 1OABA 2X1SA 4O1CA 1EWDA 4DQWA 2ZDSA 3ELFA 3B06A 1E0UA 2WM1A 4A8IA 3KEHA 4GNVA 4LUTA 2RUSA 1SFLA 4IL0A 1L6YA 1LBLA 4LYPA 4C6QA 1SW0A 1XH1A 1J11A 3GNOA 4JFTA 3QM3A 4HN4A 3IEBA 1Q5MA 4JCMA 2FLIA 3CJPA 2CZEA 3QV8A 2QMKA 3FA4A 3ARQA 4RE0A 1FWRA 4GUGA 2DVUA 1XFBA 3NIYA 4MWAD 3EX2A 3Q45A 4ROQA 4HP5A 1TJPA 3VU2A 3MANA 1XYCA 1O1HA 3EYPA 5G2IA 3O05A 4AD5A 4H9VA 3BLFA 3MV01 4QISA 3PZ9A 3QPEA 2ZE0A 2TAAA 1F3EA 5LIXX 3AXXA 2WHJA 3E5PA 1RXOB 2PBOA 1MXDA 3FEMA 2P88A 1EJXC 4UZSA 3L67A 2PDWA 3F4NA 1J6PA 3TQ0A 1TELA 3GU1A 4HMNA 1B3ZA 5IXEA 2G3IA 5MHBA 5I3IA 4JTQA 2QCDA 1FWSA 3VGGA 1ECQA 1BYCA 3GSMA 2P3EA 3VMNA 2ZRVA 4ZR8A 2P50A 4PCTA 4MGGA 1SZGA 4XO6A 4DAFA 7CGTA 1DOSA 2OO0A 3IGSA 4OUEA 2X7WA 5D9PA 1E9YB 2NVDA 1HIZA 2FZNA 1WDRA 9RUBA 1HP4A 3HZ3A 3NQMA 3KBJA 2CU0A 3NXFA 4HKPA 2PB1A 1P48A 3QFEA 2EAWA 3ZJKA 3JZEA 1TVNA 3VIKA 4LQ1A 4WD0A 1LUCA 2GOUA 1T8QA 5ECUA 4FHAA 2X09A 4K8GA 1NDYA 3WQ8A 3HQ1A 3VINA 4RE2A 1XYMA 2QLYA 3S1XA 3O07A 1QPNA 1PKNA 2E67A 4GABA 1M04A 2XINA 3EOUA 4PFMA 2IKHA 3JW7A 1H3GA 4YCPA 1H51A 2V81A 2GPTA 5FJRA 4IQEA 2C8NA 5FSEC 1MW1A 3UBPC 2FZ8A 4KKXA 5AOUA 4TX9A 3VIFA 4O12A 2YLLA 3L5AA 2PEVA 3KBSA 3T40A 3QW4B 4N4PA 3KOFA 3EDJA 1QASA 2VEPA 3VOFA 5LNWA 2F2HA 1H62A 1OCNA 3EOSA 3KL0A 2ZTJA 3O6DA 1G94A 3I65A 1JYNA 2IQDA 1VBUA 1LM1A 4DF1A 1QU4A 3L21A 4XVDA 1KFBA 5C9ZA 4LCSA 5AYZA 4JTHA 1FP9A 1RCXB 1YYAA 4I3GA 1VFMA 1XLKA 3ONCA 3GU2A 1G1YA 2HSAA 4GY7A 1G5AA 1V4YA 3CO8A 3UERA 4GK8A 5GJMA 3KDNA 1TPEA 3ATYA 1GQKA 5M5DA 2XVLA 2YPIA 1MI3A 4LXFA 1C91A 1UA3A 1U5HA 1V0MA 1JCJA 3P0WA 1NFPA 2WYSA 4D8AA 3WH5A 1PKMA 4UFLA 5FSDC 3LLXA 4DIAA 1OJXA 4ZO7A 1WDQA 4XB3A 2PI6A 2IS7A 2OQHA 3WDQA 2WCAA 1WZMA 4IMFA 2I7GA 3I3EA 4UNKA 1W1A1 2PGEA 3LPPA 3FGCA 4UQBA 4O8RA 1WA3A 3B03A 2NV1A 2YL5A 5CLWA 1B3YA 4C6KA 1E4MM 2J77A 4Z2JA 4YLWA 2IXVA 4L4OA 1EYEA 2IPJA 2OGYA 1HXJA 5TIMA 1JUBA 3PSVA 3SDOA 2HTMA 4JTEA 5FEZA 4UFMA 1FWJC 4H9YA 2PRMA 4GMEA 4QDMA 3POCA 1QNVA 4MYAA 4Q4MA 3LHVA 4CD4A 3OZYA 3MYPA 4MPKA 3CHFA 4WLCA 1NOWA 4Q4KA 1GYMA 1DJIA 3VI2A 3WYZA 2FGBA 4LC8A 4ILSA 3LNMA 4QG6A 3AMKA 4Y9AA 3L5MA 3E12A 2R8WA 4AVNA 3GW0A 3W7PA 3CQJA 3WL0A 4DAIA 1JDDA 4GQQA 1PZ3A 1MQPA 3WF2A 2WJFA 2QW5A 3FJLA 2QCHA 1QI2A 3BSHA 1IIHA 1YDOA 4LALA 4Q4SA 3RLUA 1J79A 5EYWA 4H7VA 2VTFA 2VO5A 2CESA 1S2CA 3PY2A 3PM6A 3PSWA 4E3VA 4PSPA 1K8ZA 3MMTA 3OB8A 3WLOA 4BQ3A 4AYGA 2X05A 3BG9A 3KE0A 3PJWA 3W53A 4JY9A 3UGVA 5M2FX 4IIGA 4XK2A 2PWVA 2X1RA 5E6YA 1US3A 1QWKA 4GZIA 1F2JA 1EX1A 4PUNA 4LTSA 3ITGA 3FAXA 3W6MA 2BOGX 2YDAA 1OC7A 2UY4A 4XSMA 3NSNA 3M7SA 3S5NA 2VGIA 4KQNA 1TWSA 1BG9A 3RX2A 1GVSA 3RR1A 1MMFA 3TAOA 4C6IA 1B3VA 1US0A 2GK1A 4BS0A 2PDYA 2OOGA 3EDKA 4P8UA 3MV11 1G7VA 1J0IA 5CAHA 3E0IA 2OWWA 1YPXA 1H61A 4RR4A 1QTWA 3LSCA 2CZ5A 1UC5A 4KEMA 4F79A 2X0YA 4J3TA 4P7LA 1UR8A 3DEQA 4W84A 4KBXA 4LY4A 1KTNA 1VJIA 3QC0A 3TA9A 5T8GA 3R0KA 4HU8A 1H41A 4DUWA 2Y0FA 4M0XA 2CNCA 4QS5A 3CS2A 3TJLA 2WWDA 5GJNA 3SZ8A 1UIPA 1FHLA 3VA8A 1B3XA 1MUWA 3NQ7A 1ZALA 3LMZA 4KGJA 2OLAA 1UW9A 5DRCA 1IHIA 4PB3A 3TOYA 3AZTA 4GX9A 5HR6A 4JNZA 5CC7A 3OBEA 4G7EA 4Q8VA 3ITTA 3H2OA 3MP5A 2D2GA 3U57A 2V5JA 3W2JA 1KTBA 1X8FA 2QCEA 3A5FA 1YADA 3T2QA 4B5SA 4YTUA 2VWSA 1UMLA 2QPXA 4JTKA 1NTHA 4AF0B 5BZAA 2V5CA 3LXAA 4CCDA 4HZ7A 3S2NA 1A80A 4IPLA 2ZIDA 3IJLA 3W6YA 2HVMA 1IIGA 1KM0A 2AGTA 4LAZA 4QNWA 4XG1A 4C1NA 3GFZA 3NO1A 3QPZA 4OIFA 4RZ5A 4WRHA 1B30A 3KOZA 3L66A 3MVIA 3W84A 2A5HA 4H4IA 3EWBX 1XGZA 3K4AA 3W7QA 1XIFA 2DORA 3HOJA 3O0KA 1XS2A 3M0XA 1QBAA 5DF0A 4XAYA 4YL2A 3TVAA 2XVKA 2OCZA 2O4QA 5FESA 1JI2A 3UR2A 3THDA 5D30A 5CH9A 4C6MA 4MNJA 1AW5A 5BOFA 1UKQA 2OWXA 1EP2A 1P43A 1W56A 4JS3A 2IW0A 3NDYA 1XP3A 4R7WA 3L5LA 3RX3A 3ES8A 3GKAA 3FN9A 1ALDA 3ME3A 2XUCA 4PCFA 3WH9A 4F0MA 5JH2A 5C5YA 4OZOA 5FEXA 4QBXA 5BXRA 5A5WA 2E5CA 4H00A 2EO7A 1WX0A 4JFSA 4Y9OA 5AHEA 1SFSA 3E02A 1FQ0A 3SQSA 4E2DA 3GFXA 2VQTA 3PTKA 5BYWA 5HANA 1UR3M 3RPTA 1H1NA 3VIMA 5CZ0A 3KTSA 3TZFA 4FR1A 3DFTA 3L0NA 5I02A 2F2KA 3TLLA 3W7KA 4DB7A 3H24A 3BH4A 4G1KA 1RJRA 4HMCA 5AYBA 4TTGA 2Y8VA 1M41A 4TMCA 2Q3OA 1ICSA 4BI5A 4UMAA 1K8YA 2VQUA 3SCWA 1YRRA 3HGOA 2WNNA 3N4AA 3KHJA 1XIJA 4Y90A 4JDYA 4D72A 4L1GA 3AMLA 2HISA 3IGHX 3U4FA 4DXVA 3EKLA 3HG4A 1QHOA 4Q6XA 2P8BA 4Q22A 3AXMA 3R10A 1LL6A 3V5CA 3FJNA 4ZO6A 1GCYA 5CGTA 1JFHA 3WFAA 2C16A 1MQRA 1U30A 5ABFA 2CLFA 5CPQA 3M0MA 3JZUA 3L4UA 4AZ6A 1UWRA 3VNKA 3TQKA 4Y8EA 4HOZA 2WBKA 2A3BA 3MP3A 3RO8A 2POTA 4KFOA 2VENA 1U22A 1W54A 4NNCA 1T7LA 1Q6RA 3WJYA 4IIBA 4N0RA 4C65A 1GQIA 4M5PA 4DRSA 4MY1A 2WJZA 1ZPTA 2DT0A 3PP7A 1EQCA 2PDMA 3PNZA 1CXFA 1QPQA 1FWTA 3N3MA 2NVCA 3QSTA 5CPMA 4UTFA 3FFSA 2GL5A 1R9YA 3WK1A 3UJRA 3CC1A 1DVJA 3TP4A 3MUIA 3EXRA 5HMFA 4PL1A 1FH8A 3P84A 5LA1A 4MZYA 5BWAA 2Y5JA 2VD8A 3RN6A 3E1F1 4UQDA 1P7TA 2OTDA 4B92A 5DMYA 3E2VA 3SIZA 4XZNX 1FWIC 4BQ5A 4GIAA 1QOPA 2YL6A 5HWJA 3W83A 4XZWA 5JBEA 1BXNA 3W22A 1TMHA 3UCQA 5C55A 1KKOA 1SW7A 4RZ4A 4JKMA 3M47A 3UWZA 4Q6JA 4ZVJA 4N7QA 3BAJA 1H60A 3ZWSA 1J6OA 1JJKA 3DBPA 1UWAA 1V6XA 1BWLA 3N25A 1S5TA 2Z4GA 4EVZA 3QMTA 3UXLA 1J0HA 2I5IA 1VAHA 3O06A 3PWGA 1GKQA 2ZE3A 3MS8A 2OLHA 1HJXA 6REQB 3OIXA 4ZQNA 1R3RA 3UZ5A 1BTMA 3PULA 2DW7A 3R43A 2DPEA 1K77A 1AQMA 1TV3A 3D0CA 3L2IA 1YX1A 4QS6A 1EQPA 3LK6A 4LYKA 4PRTA 3S46A 3FK4A 1EO5A 4HA4A 4HZMA 1AZ2A 1H1ZA 1AH0A 1TJ0A 4FLRA 4DJDA 2PRHA 3NL5A 5LXEA 2Q02A 1E0VA 4E5TA 1HJQA 2B81A 1FP8A 4QROA 2WSQA 4UQEA 4RXFA 4PCPA 3K46A 3IRSA 3W1RA 4W85A 3IAQA 4AZBA 3CGTA 3UZJA 1AJZA 1E6PA 1H7PA 3CU2A 1K8CA 4IQLA 3L23A 3VIPA 1C7SA 3W70A 4NJKA 1DJGA 4CD6A 1AH3A 2ALRA 2PE4A 3QZEA 3DFQA 3SFKA 2WZIA 4H3DA 4RPPA 2BGQA 3TK7A 2JE8A 2ZRZA 3TCSA 3WD4A 3WH6A 3VNIA 4AG0A 1WNOA 4XD6A 4DWSC 2PCQA 3LGDA 3U4AA 4E0CA 2VURA 4DYEA 4GOAA 4GVHA 3MYOA 2VGGA 1YW1A 2VD9A 3V3WA 4UOJA 1UH4A 3T07A 3PB0A 3UPBA 3IIZA 4S3FA 5I3FA 2JBMA 1TX2A 1BYDA 4OV9A 3H2EA 1SR0A 4ZZ9A 3AUJA 3EWCA 1NU5A 4AXNA 4IFKB 3NVTA 1XG4A 2QDGA 3C2VA 4O54A 3THUA 4MJ4A 2HRWA 1N7KA 1R3VA 1C8XA 3F4VA 3NAVA 3U2OA 1V93A 2ZCGA 1YBQB 1ZY9A 3CZKA 4I7WA 1KBBA 1J0JA 4Q7BA 2OZTA 1O5XA 3T0DA 4CNPA 1HKKA 1R86A 1R85A 1VKFA 1FTXA 1THFD 3A22A 3V0UA 2BXVA 4W7WA 3VNLA 1OCJA 4XD4A 1W5QA 4DLFA 4XIMA 1R3TA 3N17A 1XKYA 5I07A 1V0KA 4M6VA 4IM4A 7REQB 5C0QA 2G5WA 2FJKA 3WX7A 3BXWA 2WSPA 4QRNA 4A3QA 1R46A 4HK5A 1V6TA 1O5RA 5LZLA 2VNCA 4I9JA 1IF2A 1W1ZA 2FB3A 3UR7A 1J12A 1DJNA 1A5CA 4Z2IA 4GH1A 2YSWA 5CLTA 3VX0A 3IWPA 3L4TA 3C0SA 4UFKA 3WLSA 2V63A 4DJFA 3WQPA 1UASA 4ADTA 1S3HA 1FVPA 3KAOA 1UUMA 4DUVA 5JUVA 3D3FA 4IGSA 1GYNA 1H0GA 4H9ZA 3SRKA 1QI0A 5TAOA 3OG3A 3BVJA 3LPGA 1MSSA 3CIWA 3LM7A 2VZTA 4IQDA 4LVDA 5EMJA 1E73M 3R7MA 1OWQA 3EWZA 3HTWA 5FAGA 1Q85A 3DC0A 3O8AA 2YIHA 4W86A 3TZNA 2J8GA 1XRTA 4NP7A 4Q8OA 1WZLA 3VD5A 3M0ZA 3EDFA 4RE3A 5BOOA 1FX6A 2ICSA 2FMOA 3UESA 4A2SA 1M53A 2G0WA 2PS2A 4PTXA 5G4EA 3WLRA 2VR2A 2YFNA 3I6EA 3NTYA 3PWIA 1O7AA 4AHPA 4UTTA 1MRAA 2JFEX 3AMCA 3L65A 3VKDA 3SSJA 1XV8A 3F2CA 3GNRA 2JQXA 1UZHA 1PB0A 2WC4A 1KM3A 4UC5A 3B8TA 3BUVA 3VFCA 3BTNA 1NARA 2A3AA 2DSKA 3TQVA 4Y2WA 2YA1A 4JIHA 4K37A 4J3VA 5FL1A 4C6DA 4QE4A 2VP8A 2QPUA 4IMDA 4Z1BA 4D8LA 3SCUA 3M7WA 4BK9A 3JS3A 2HE8A 3Q2DA 3RF9A 3TC7A 4AMCA 1W1YA 4GXPA 1TZ9A 1DTUA 2HBXA 5REQB 1FBAA 1KFEA 2VC9A 4NJJA 1FDJA 1XLCA 2V2CA 3CAKA 2E0PA 1JYVA 3K4DA 1TUFA 5D9MA 3P62A 4WUIA 3VKAA 1TUXA 3LCHA 1FWBC 3I68A 4M80A 1PTAA 4JQAA 4MAZA 3T9PA 4GJIA 4NX5A 3HMJG 5C9XA 2QIIA 4W8AA 2BX7A 2WPGA 3U2EA 1HVQA 5BMXA 4X0NA 3RGTA 1W3KA 3IARA 4O16A 3GDRA 1LJYA 4JNYA 1KBKA 4DO6A 1EO7A 5J04A 1GG0A 3PVFA 2E1WA 4UUIA 2CLKA 2Z1KA 3AIEA 5FOOA 3KBVA 2PZNA 1ZS2A 3LGGA 1EKOA 2WZEA 3IJ9A 1JI1A 1QNPA 1IWBA 3MJYA 4WJXA 1R5YA 5D4YA 3G1XA 1UP0A 4DZ5A 4E4PA 1BF6A 4JAWA 1E9LA 1QHZA 3GHTA 1HO4A 3U8GA 4YTQA 3BLDA 3UJSA 5I3DA 1I2PA 3VM5A 2QJGA 5HWNA 4KCTA 1V7AA 3BLPX 2ISWA 3MSYA 1WUFA 4JTFA 5JBDA 1AD4A 3AOFA 3NZ1A 1LLZA 2XN1A 2J27A 1XIGA 4BQ2A 5BROA 1ONRA 1FCUA 3MTWA 4FAMA 5LA0A 2P53A 3AU6A 4JTTA 3HV8A 1UD6A 5RUBA 1TR1A 3WUFA 3ARTA 3H4XA 5CZSA 3UQNA 2QUTA 2Y8KA 1I2QA 1O95A 3CTLA 3VNDA 1V08A 5AC8A 1W9DM 1W9XA 3BV4A 3CWHA 4K38A 1JPKA 1RK6A 3CYVA 1VBRA 2JF6A 3OBAA 1ENUA 4NAFB 5CZTA 1ZL1A 5CSSA 2YX0A 5A8NA 4H6RA 3E6EA 3APTA 1KXVA 1VD6A 1UROA 3EXTA 1RH9A 3V18A 3GZ3A 1KCLA 4O1AA 3BAWA 3VZXA 2INZA 1A50A 4LYQA 2VWTA 3R11A 1MEIA 3UXDA 1OM0A 2XFWA 2XG9A 3GZAA 2RDXA 1YE4A 1X8CA 1OIFA 1POKA 1GOIA 2GDVA 4UOQA 4P5UA 3W74A 4PCSA 3OQ8A 4GVGA 5DANA 4XAPA 5DY3A 3WFZA 1DL3A 3ITCA 1XIDA 2XSXA 1GZGA 2ONEA 1JRCA 1Q45A 1U2YA 4PMQA 1ECEA 4FXFA 3ZFHA 1M5WA 3A9IA 5BRQA 4LF2A 1OBAA 1X98A 4H8NA 4S3EA 4KT2A 2FFIA 3LV6A 3ID7A 1AL8A 4JHZA 3QFWA 1VFLA 3SJNA 2OSWA 3HF3A 3F4CA 4QE1A 1GNXA 3UXKA 3N11A 3G3DA 4TOQA 4L4PA 1QATA 3TV8A 3FA3A 3D5HA 2J8TA 3IRDA 2QHAA 1KCZA 1LDCA 5BWFA 3BQ5A 5K4XA 1OX4A 3VIHA 1W31A 1HX0A 1NIUA 3APGA 1IZKA 4CNNA 3A4WA 2FPTA 4GI8A 1R3YA 3UG5A 4TVDA 4QEHA 5LIWX 3VGHA 2OODA 4GWEA 3GTNA 4C6CA 2VC7A 2DQWA 1EDGA 1FCVA 2OMAA 3I7SA 3E3HA 2PA6A 3I7QA 1N55A 4G5DA 4H2CA 4IZGA 1E0TA 1PSCA 1JULA 4WY0A 1SFTA 4ZMGA 1OINA 1NAL1 1KM1A 3FOKA 3TTQA 2GDQA 4ERAA 1BKSA 2O7SA 3NA8A 1IT0A 1ISYA 3OODA 2HZGA 1ADOA 3R79A 3RILA 3RIKA 4P7NA 3T7VA 5D2TA 1DPMA 2R1NA 3UNTA 4EPKA 3CASA 5F4WA 2ZICA 4AY7A 1CLVA 8A3HA 1JVNA 3W7GA 1YLVA 4C6PA 2EPMX 2VKZG 1PIGA 4L4MA 2FVKA 4MNMA 4A8LA 4I8DA 2CKSA 4ERGA 4LCQA 4TX6A 4GQBA 2OOFA 2PDBA 3Q37A 4NKCA 3W38A 2R24A 3DX5A 3SN4A 2CLHA 3VNMA 3NZPA 4EPBC 5EMLA 5E70A 1HL9A 1W3JA 1IEVA 4MY9A 3WNMA 4DWDA 3UA3A 1CGYA 3PTDA 3W7JA 1VEPA 4XZHA 3S5YA 3ZR5A 3RJXA 1KGUA 2FKPA 3P81A 3WLPA 3S5OA 1R30A 1WXYA 3DU0A 1W9UA 3MZ2A 3QXBA 2PLKA 1IQ8A 5LHFA 3P6LA 1HKVA 4IQJA 5JBFA 4JNMA 4JFWA 4S3JA 1JPHA 2RHGA 4S3AA 1PTDA 3VZYA 3NXLA 1RVGA 3QC3A 3WL1A 1JRBA 4DNHA 3SCVA 2G3FA 5C71A 3GU9A 4GZ7A 1CGWA 3WNKA 4HTBA 1EB3A 3PBVA 3TR9A 2ABBA 1PDYA 3IAPA 3DI1A 1RAKA 2GGEA 3KP1A 1Q6EA 4QE5A 3CHVA 3PZGA 4OE7A 1AJ2A 4MOZA 4I9TA 4ROPA 1HO1A 4WXZA 4EAYA 3LTPA 2C0HA 2BGSA 1B31A 4S23A 2OFJA 2QEZA 3R8GA 1TTJA 4B5NA 3STFA 1KFKA 1I60A 4ZEPA 3XISA 3HJZA 1WCGA 4UTLA 1VP5A 1XL9A 3O9NA 1MO0A 2Y4SA 4XD3A 3GXIA 3LNPA 3IV8A 3KCLA 2D23A 4J2MA 5J5DA 3NWRA 2PDKA 4DEFA 3GHSA 3WH8A 2JK2A 4AFYA 4YIWA 4F3HA 1OK4A 1QNSA 4OVXA 1JCMP 2PDJA 4J3ZA 2VOMA 1C3FA 1WOAA 3LHUA 3E5BA 1EJWC 4KWOA 2VUYA 3H2AA 3GX9A 3EX6A 3NSMA 2AMXA 3WLTA 3BQ6A 4XSLA 1YDNA 3V1PA 4OOUA 1OVDA 3WK2A 2PODA 1OK6A 4CUCA 4MJ2A 4IX0A 1XX1A 3N6QA 1XIBA 2E9LA 5C9RA 1PHQA 4YPJA 4N9DA 3TIMA 1G4EA 2XISA 4DELA 4AEOA 3S0CA 1IWAA 2ZOXA 3EB3A 3S1GA 2EPOA 3ONBA 2ZRUA 1G4SA 1OZMA 3EPNA 1MZHA 1UD5A 2NX3A 2I9EA 4DYKA 2R82A 2PDFA 4CNSA 1E56A 1BFNA 2EPKX 3BMWA 3KLKA 1A5UA 2NUYA 3NZQA 1XG3A 4KFPA 1W1TA 1DEDA 1LTDA 2G37A 1Q6FA 1QWGA 4IXXA 3VMPA 2GSEA 4U5IA 2QCFA 6XIAA 5T26A 1Y7VA 4RDYA 5LGXA 4PUMA 1R2TA 3WQVA 3UYIA 4FS9A 4DJEA 4HCLA 4B2DA 2HXTA 3CEUA 3G1VA 5CC6A 1ZP3A 4LV4A 3FVMA 5GQBA 5DBTA 1TTPA 4B3KA 4XAZA 2PP0A 3ZJ7A 5BRPA 1E6QM 4GIYA 3CAWA 3M64A 3TDFA 3NG3A 3WEMA 1XGEA 2VXNA 3TTEA 3CMGA 1KXQA 1VC4A 1ZNNA 3WF4A 2WZTA 5IHSA 3CH0A 3EX4A 5DMMA 3PS7A 4FI4A 3PAJA 4OOZA 2PDLA 4GUHA 5DRIA 3WBXA 1A4MA 2WMGA 4KEZA 4TX8A 4WKHA 4PTVA 5EBAA 1SYTA 2W66A 4QSHA 1G4TA 4KEUA 4WZHA 2V9DA 3OHIA 3TC3A 2PDPA 3RCNA 4NL1A 1J96A 4PYSA 2CZFA 2QJJA 3NGFA 4A3YA 3IJ7A 1KWGA 1BG4A 4PH6A 5DELA 1GOWA 4H7ZA 3FNDA 4POCA 4PMZA 1W1PA 5LNUA 1NWSA 4C6BA 5BCAA 1BEUA 3TTYA 2BXYA 4MPQA 1HN1A 1M1BA 2Z1XA 5C2XA 3T8LA 4IFOA 3WN6A 2AQOA 4GZJA 4FIRA 4RW3A 2HK1A 3RX4A 2JEQA 2I5QA 5G2WA 4UWMA 1F7BA 4XO7A 4JFVA 3M5ZA 3G8EA 4JQ2A 1GQJA 1SSGA 3M0YA 1YE6A 1MNSA 3P61A 5EMMA 4HPHA 1ZGDA 5C7HA 4PSRA 3JVAA 3BLIA 3TUUA 4DI8A 3DFOA 3UZYA 3C86A 1V77A 3FXYA 2QCMA 2Y2WA 2RJHA 3BMXA 3BCDA 3AYSA 1RD5A 1WKYA 1CI1A 2CBVA 4LX4A 4NJGA 3CB8A 1YBQA 3WQ6A 4FX8A 4MSSA 3H2FA 3QKZA 4MAVA 3NR0A 3VK5A 2XH7A 3ABRA 3W1TA 1S1PA 5EGRA 2E40A 1QR7A 4UNIA 2BWGA 7XIMA 5FJIA 2QUUA 3GUWA 4E2BA 1PUDA 3BAKA 2EBNA 4K3ZA 3N14A 4PTDA 3HB9A 1CLXA 2QXWA 1QNRA 4I5UA 3C2EA 1TVLA 5A1AA 1FHDA 1M01A 1L2UA 2CWNA 2GUUA 4K39A 1SGJA 3P3BA 3V1HA 4AD4A 1AFSA 2GJXB 3FS2A 1XW8A 4LPCA 3T05A 1PIIA 2NWRA 1J9YA 4A2RA 5HDRA 2QUVA 1CZ1A 2E5DA 4GACA 3JRKA 1G4PA 3QLDA 4K8EA 2YCKX 1UUOA 2E9BA 1DXFA 2C15A 1Q6DA 4H19A 1H5VA 4GCXA 5I3HA 1UIOA 1BPLB 4E8CA 5A2CA 3HPZA 1KFCA 3TA6A 3WQFA 1UCWA 5PTDA 3M0VA 4P7RA 1AK5A 4DO4A 2DZSA 3TMQA 4YU1A 2CW6A 1XR2A 4GH3A 2FTPA 1CGVA 4JL2A 1JDEA 2BVYA 2AGKA 4AIEA 4MUZA 4MWAA 1C29A 5A8OA 2C19A 2P5NA 1EJTC 2F6UA 3SCNA 1K02A 1EZ2A 2BSLA 3ZYZA 4WKFA 3T0AA 3W4RA 3R6IA 1UWUA 1WOBA 3P7YA 1Q6CA 4FLOA 3M5YA 3QN3A 4F66A 4JIEA 1VBHA 3T55A 2X7VA 4FALA 4ZFCA 3BCJA 3BDKA 3WMSA 3PPHA 4V1YA 3TONA 2RDWA 1AVAA 2PF0A 2DY3A 2G4JA 4FOUA 2HCVA 2FDSA 4TV6A 3P82A 4UIOA 1J2BA 2NX9A 3CAQA 4XKMA 4FOJA 1JDAA 3PBWA 1E6XM 3NCOA 1D3GA 1QRQA 4HNCA 3THQA 4CN1A 2QCCA 5A3HA 3DFSA 4AWEA 1SFJA 1GHSA 3R0UA 1WZAA 2INFA 1E5NA 4F9DA 1VHNA 5G1MA 3NPUA 3TYBA 1EL3A 4WDTA 5H1WA 3SUWA 3QGVA 2XM1A 3U48A 1Z9AA 5JQ9A 1VBGA 4IPPA 1SZFA 1UQZA 3FHQA 2REQB 2ZVRA 2Z27A 4F0KA 2F84A 2I16A 5HNRA 3REQB 3B0XA 4AQLA 4NYYA 3UVIA 3KOXA 4E8DA 2IPWA 2HS8A 1U1HA 4IMGA 4OTKA 2CYGA 4RXGA 4XD5A 1WAWA 4WR3A 5E1QA 5I3JA 4LUTB 4JCLA 2W0UA 4XBJA 1Y5WA 2PLMA 3GVGA 1E6ZA 1W5NA 3LCFA 1RZMA 1XJBA 4H9UA 2XTKA 3A23A 3CUJA 1R3SA 1GZJA 4HJFA 4S3CA 3EMCA 4GIEA 2V3GA 2VEFA 3AC0A 2IMRA 1DIEA 3U5YA 3FAWA 4GY0A 3W29A 3F7JA 4DBSA 3W26A 1ODZA 1PE1A 3SY5A 2C13A 4QJ3B 1ME9A 1MW2A 2HK0A 4JX6A 1W0MA 3MI3A 1A49A 4PMUA 2NQHA 3IVTA 1NQ6A 1DWGM 1QCWA 1AZ1A 4CNUA 1X1OA 3RMJA 3DGBA 3OA5A 2JGYA 3LXCA 3S5ZA 1OB0A 1OADA 2DV0A 1EJSC 3NL3A 2ZUNA 1ITUA 3PZTA 3GDKA 2DFAA 2QVHA 3RJYA 2QCDB 3MMUA 2X2GA 3FX4A 5I5RA 4HHMA 1F4HA 5MKGA 4QSFA 1JCYA 4LSBA 1HP5A 3KZPA 3ITVA 2GSHA 1GVRA 1RQHA 3H21A 3R13A 4UTKA 3BGGA 4HA3A 4NG3A 1WZKA 3VCCA 1GTEA 5A2AA 2OX1A 1W37A 5GNXA 3RRAA 2WW5A 4K2SA 3QVQA 1QW8A 4C6JA 3M0HA 1E4IA 1SJDA 4FF5A 1GJWA 4X61A 1A5OC 1CTNA 3UCDA 2PTWA 3W37A 1UMYA 5C54A 3U3HA 4G8TA 5I7GA 1YXCA 4LT9A 4HA0A 1BVWA 1CCWB 2GOKA 1Z69A 2PWUA 1KXHA 2POZA 6XIMA 3NM1A 3WDPP 1B4KA 4GIRA 2V6AA 1LUCB 3AAMA 2PU0A 4M7TA 4BKNA 1F07A 1FWFC 3LY0A 1KM5A 1YIXA 3QJAA 2DVTA 5EU9A 1G6CA 3WQ4A 1JZ5A 3ZT6A 4LUIA 3TWBA 2VFHA 4AX7A 4O52A 3GYEA 4GE8A 1TE1A 2VX4A 2OELA 3USZA 1E4NA 3GNPA 1GT8A 2D2OA 3QV9A 5E9XA 4AZHA 1ADDA 4HK7A 4F0RA 2YFOA 2E6YA 1L6WA 2R1LA 5F2MA 2X40A 3LRMA 2QYGA 3URQA 5EY5A 3WELA 4KPLA 3TYUA 2WMFA 4HNUA 5L9FA 4JZ5A 5CJ5A 3B8DA 5AN7A 1YNYA 2ZX8A 1AD1A 3T0TA 1QPOA 5IFPA 3ZJ6A 1WBHA 1EJ7L 1DJQA 3OOQA 5JU6A 4J2PA 1FWGC 4CN4A 3KVKA 2MUCA 3WKZA 2PDNA 3WBAA 1KM4A 3TYZA 2R1MA 5MF5A 1GEHA 3V0TA 2YKKA 3T4WA 3NSXA 3W7NA 4S38A 3ABQA 3HM7A 1NVMA 3PJXA 1TJRA 3NO5A 3ARVA 1XF0A 4GKTA 3DN5A 4DZAA 1VCVA 3RRXA 3WY1A 4KRUA 4P2VA 5FJUA 3W2LA 1SVDA 4XKYA 5SWUA 2PLCA 3UWWA 2IUZA 4HNLA 5ABEA 4QJ1A 1FKWA 2DUXA 3E2RA 3L0KA 5CZKA 1VS1A 2BHUA 3EOEA 2VEIA 1BLIA 2WAGA 4Q4OA 1A5BA 2QJMA 5ENLA 2BZNA 2J66A 2D3NA 4O53A 1RBLA 1AMYA 3T8QA 4JTGA 4PCNA 4PZVA 1O68A 5G1TA 3FGCB 4U5KA 4QFUA 3V5FA 1X7FA 3LGEA 3UA4A 4C1LA 1IEWA 3G1YA 3R8RA 2XGBA 4S2CA 3QRHA 1WB0A 3ZXWA 4QM1A 4IJCA 3A64A 4JFUA 1W32A 2FGLA 3M1ZA 4I6KA 4FK9A 4J9JA 2G41A 2YCJA 1UH3A 4JTIA 3GG1A 2ZDRA 3QYSA 4CCEA 2OLSA 3FEQA 2Q6ZA 4H7CA 1XPYA 1DXIA 1W3IA 1VYSX 3LZ3A 4O13A 5AC4A 2BY1A 4FF7A 1QFEA 4FR6A 3FA5A 2ZBTA 3VGDA 1HL2A 3VFLA 3VC6A 2A6NA 3NM3A 3IACA 3G5EA 1V3MA 3GBDA 2YGYA 4HHHA 1QPRA 3FDKA 4NX0A 3RPDA 4J40A 4AMAA 4PMRA 2EG7A 2NUWA 1WKFA 3G0XA 3D46A 2FIQA 4MY8A 3SECA 1K9FA 4HSNA 4MFEA 3GIYA 4HU0A 2GGHA 3KS6A 3ZLGA 1G01A 3PK7A 1LQ2A 1PCWA 2YW4A 1U5VA 1XYFA 5A6TC 3W23A 3BAIA 4XZLX 5D02A 3D3AA 2ZXDA 1VPXA 2HQAA 5EL1A 1K9DA 2A3LA 5HJXA 1XIHA 3GK0A 3GW3A 2XVGA 1P0EA 2ZC1A 5D9OA 2FYMA 3M0JA 3KHDA 3BAYA 5FACA 3TKFA 3MO7A 4MMWA 1T6MA 1I9CB 2I5GA 3NQBA 3UXAA 3L9CA 2E7FA 1F9CA 1LL4A 3BJTA 1JDCA 2QGHA 4MB5A 2XH4A 2EKCA 2QJNA 2JKAA 1BXBA 1OFRA 2ZZ6A 1A3XA 4R33A 1ITXA 2Y61A 3GR4A 5HMDA 4I90A 5TQLA 3MCOA 1EF2A 4MJMA 2Z25A 3WCZA 3HJEA 3RU6A 3LLFA 1NOUA 4QG9A 4OT7A 1RSCA 2GK1B 1NSJA 1K6AA 2FMNA 3LHZA 3WNLA 5G4HC 3KUMA 1V6WA 1IXNA 1F4AA 3F03K 3AZRA 4ICNA 3KP0A 2D2JA 3VKCA 2F61A 2Y70A 2JKPA 4D6EA 4DXXA 4GLEA 1ZAIA 1RBOB 4FNRA 5JMUA 1TREA 2V2DA 3MO4A 2CKRA 2YBTA 4M51A 1VH7A 1DORA 4YYFA 1A3WA 1JZ2A 2O9PA 4CCZA 4GZEA 1E1CA 1DIOA 4A3HA 2CC0A 1KFJA 1E1EA 4INFA 4RL3A 3U2CA 3W7HA 2W6RA 3DH7A 5C70A 3VIGA 1QNOA 3AICA 4Z2LA 3SN1A 1XYLA 3BO9A 3F5LA 3AIQA 3A47A 1ISVA 4L6OA 2ZQ0A 2Y5SA 4G7EB 3TN6A 3S1VA 1U1JA 2YL8A 1QAPA 4HTYA 2VVNA 1KV8A 4B9YA 3W7OA 4A35A 1XH0A 1ZJBA 1A0EA 3DIPA 5IBXC 3WZ0E 3AHTA 2BHZA 4XAGA 2XSAA 1Q63A 3C2YA 1PHWA 2ASHA 4BI7A 2O9RA 3BZGA 4HU4A 3MC5A 2ON3A 4GNKB 2F6KA 4JN8A 4C1NB 3SCRA 3W82A 3GVWA 1C7TA 4GYPC 1ODUA 3VD3A 1S2WA 3RCYA 2DVXA 4HSHA 3WD1A 3LPFA 3PHAA 5FL0A 1TA3A 4AIBA 2H9AA 2DDXA 3P80A 4ZODA 1Q13A 1UOKA 4AIUA 2ZADA 5KZMA 5I03A 4M8UA 2VZOA 3VOCA 3FCPA 1OSEA 5CKSA 1VBJA 3THAA 1BWVA 5LA2A 2NQZA 4M6UA 1G9HA 2W3ZA 1VEOA 2CLPA 4C1KA 3N6JA 1AQFA 2EG8A 5JIWA 4ATLA 4H6KA 5HQLA 1VFSA 3PZQA 4LS2A 4PTNA 1TPB1 3H55A 2OR2A 4AU0A 3W7MA 3LG3A 4DBWA 2BGNE 3MP4A 3T08A 1ZBVA 3LERA 1QPKA 4XTIA 4I9AA 2VX5A 1OD8A 1QJWA 4PGLA 3S2LA 5FKYA 2CERA 5FEPA 3S83A 3WLQA 5ABGA 5A8GA 3G2GA 3PWAA 3SURA 2IKJA 2HPIA 3TOPA 4DJDC 1OGGA 5D8WA 5LNVA 4YVVA 1PX4A 2XYLA 3OIHA 3IK4A 1X6LA 2RFGA 2Z29A 4RPQA 4ZCWA 1ITCA 2DSVA 3MBDA 4DF2A 3QZAA 2WVVA 2BVDA 3AU2A 5FJPA 2Z1VA 2VOTA 2WNQA 5HAOA 2W61A 9XIMA 1VR6A 3KVMA 4H04A 2J7FA 3CZJA 3CUHA 4F40A 1HTIA 3BSGA 4PUWA 5ABFB 2YA0A 1NP0A 1EXBA 4HHLA 1S5WA 3RCMA 3N12A 2ZX6A 1FA2A 1ZLPA 1OT1A 4GI4A 4KERA 1ZBCA 2DQXA 5TD4A 1GJPA 3MKKA 2VT0A 4IG2A 3GVVA 4J28A 4K7VA 2DZAA 3LUTA 2BDQA 2A4AA 1R38A 3VX1A 1J01A 4Q7IA 3VABA 3OQEA 5KITA 3ARSA 2ISDA 3W81A 3SQLA 4IHCA 2PC8A 3TNOA 5U4NA 4BF9A 4JD4A 1Q7QA 2E6DA 3T44A 4E3TA 4JTLA 1P4CA 4Q3MA 4H83A 3OBKA 4QGCA 4RDZA 4HNVA 3OLEA 2DZBA 1P7TB 3NUKA 3GC5A 1YXYA 4IJRA 5BMWA 4L65A 2HE5A 1XLLA 1NDZA 1KO0A 1SZEA 1XI3A 4BFAA 4JTRA 4PRWA 3LMYA 3AALA 2YBUA 3FYPA 4YN5A 2VX7A 4ZQRA 2HVOA 3B97A 4ZXOA 4CU6A 1PZ2A 4CKQA 4MB1A 5HBFA 4J3WA 3EWXA 3B8VA 3OA3A 1VQTA 4QLKA 2Y6ZA 3MHGA 1W3LA 2PWHA 2XH2A 2G97A 4JIPA 4ADSA 1BWKA 1FKXA 4ZQMA 4KESA 2WMIB 4J5NA 1XCXA 3DECA 1N8IA 4GC4A 3DZ1A 3PPFA 1XLFA 2WMHA 4DNMA 3SCPA 4LANA 1XBVA 1D8CA 1J8VA 3OJGA 4HOWA 2VHLA 1MRQA 5CG0A 3XIMA 1R9ZA 1JG9A 1RY8A 1HF6A 1IT7A 4WDUA 2BXZA 2BBFA 4AC7C 3PG9A 2REQA 3W86A 3UWVA 1LWIA 1V02A 4RUBA 4UZUA 4HK6A 4OKDA 4IMEA 1F3XA 4ZA0A 4TVCA 3GYCA 4UBPC 4H9XA 4PRRA 4EE9A 4K1WA 4WKAA 2ZA3A 3UYCA 2XVPA 4BWLC 4FX6M 1QUMA 2J9ZA 2XIBA 1QI4A 3KM8A 4ORMA 4CGTA 1ITQA 4UR7A 4W8LA 5HJLA 3PANA 1UR0A 5HMEA 2CEQA 3K13A 1BYBA 3VDCA 2DJLA 1PZ1A 2OYMA 1EDQA 2GSJA 3W71A 3IPWA 3WJZA 4E6MA 5JIPA 2WKLA 1NEYA 3MPGA 2WMKA 4CD5A 2V5DA 1NDVA 2E3ZA 3AIBA 4LVAA 3I6RA 1GJUA 4DO7A 4OECA 2YZRA 4IMCA 3DUGA 2FB2A 1UP2A 1OGBA 1Z7AA 1R8LA 3IGXA 5K9DA 5B7YA 1MW3A 4P61A 3KL3A 2VEMA 3VDGA 1OY0A 4X9YA 5BRBA 1EIXA 3WLNA 3N15A 4DX3A 2QUNA 2C1HA 3W73A 2EKGA 5IOBA 2VJXA 3KOYA 1YEYA 3DKJA 1GEQA 3NYDA 1PV8A 5B7ZA 2DSZA 1WP6A 3DENA 1S39A 2PWFA 3T0BA 1X1NA 4LVBA 4N9EA 4IP4A 5D04C 3KFTA 1OHLA 1W8SA 2HXUA 3WENA 5HPCA 4NZ1A 5I6SA 4L6DA 2SFPA 4DJDD 4P8VA 2FHBA 2YDRA 1XINA 3NYZA 3CV7A 4B16A 1TX0A 1E0XA 1GW9A 3VKKA 5DT5A 3M6YA 4DBEA 1M7XA 1VPQA 5F1VA 3RFAA 1GKRA 4GXMA 3BW4A 5E5CA 4H1ZA 3OLIA 1TB3A 2Q3RA 2ACSA 3PB2A 5HK4A 1RJQA 1Z41A 3UF9A 5D2VA 3ICJA 4YTRA 5AYXA 1PPIA 4H6EA 3OU8A 3W7DA 4WSHA 3IS4A 2EPNA 4JBRA 4PMOA 4NI8A 4YNGA 3C56A 3G1FA 1J2WA 3HU7A 3GIPA 1LL7A 4R27A 3QQWA 1P0KA 5U7SA 5LYRA 5ABHA 4ENLA 1HKWA 4JIIX 4YHGA 4JICA 4GINA 2YYTA 4LV9A 3VOJA 3HV9A 4Z0JA 2HNEA 4HMDA 4HA1A 3ARPA 5CSRA 5HULA 3QKEA 4UFIA 1DBTA 1KKRA 3VCNA 3EWDA 4ORIA 4PB4A 4NVTA 1D7FA 4M56A 3N34A 1OGSA 3KRZA 3GAYA 1GOQA 2Q09A 2NWSA 3UFYA 2V67A 2OEKA 1AW2A 2VM8A 3WLHA 3WK3A 4H41A 1H2JA 4YJ5A 2ZZ2A 4C6NA 1H7NA 1BSIA 1M6JA 3OZPA 4ZE5A 2J13A 2E68A 4X22A 1M3UA 5IRPA 3EWYA 3CZGA 2ANUA 4JEQA 1PJ9A 4PODA 4HCHA 1WBJA 3OVGA 4IF2A 4DWSA 1SO3A 2PCEA 3LU2A 1W9VA 5A6JA 4QR6A 1VFTA 4C5YA 1FCQA 4BY3A 2GVLA 1UWTA 5FI8A 1LOSA 4NZFA 3STPA 3W7CA 3GXFA 3WDHA 5CPOA 4AYSA 3BL3A 3A24A 5I24A 3TWAA 4WGXA 2YXGA 2VFDA 3TMLA 5HR7A 3E96A 3G8RA 4TU1A 3QR1A 5CJNA 2Q71A 3GIQA 1NWRA 3O16A 3PFRA 4F2UA 1CXLA 3QTGA