3WBXA

Crystal structure of gox0644 at apoform
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
271
structure length
271
Chain Sequence
b'EAQTVISFHDGHTMPQIGLGVWETPPDETAEVVKEAVKLGYRSVDTARLYKNEEGVGKGLEDHPEIFLTTKLWNDEQGYDSTLRAYEESARLLRRPVLDLYLIHWPMPAQGQYVETWKALVELKKSGRVKSIGVSNFESEHLERIMDATGVVPVVNQIELHPDFQQRALREFHEKHNIRTESWRPLGKGRVLSDERIGKIAEKHSRTPAQVVIRWHLQNGLIVIPKSVNPKRLAENLDVFGFVLDADDMQAIEQMDRKDGRMGADPNTAKF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative 2,5-diketo-D-gluconic acid reductase
publication title Crystal structure of Gox0644 at apoform
rcsb
source organism Gluconobacter oxydans
molecule tags Oxidoreductase
total genus 105
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature ec 1.1.1.-:
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3wbxA00
3QKZA 4JTRA 1PZ1A 3N6QA 3Q67A 4IJCA 2PDMA 4LBRA 4MHBA 3LD5A 2J8TA 2F38A 2PD9A 1LQAA 3V0SA 3UG8A 1ZGDA 3WBXA 3R7MA 1SM9A 2PZNA 4OTKA 2ACUA 2WZMA 4YS1A 2PDHA 1S1RA 2DV0A 3H4GA 2BGQA 1FRBA 2PDNA 3T42A 4JTCA 1Z3NA 5KETA 1S2CA 4ZFCA 1VBJA 1ZSXA 1YE4A 3LZ3A 1QWKA 3LEPA 3UYIA 3KRBA 3VXGA 3UP8A 3FX4A 4YU1A 4JTDA 4JIIX 2HVOA 2HVNA 5HNUA 5C7HA 2ACRA 4WDTA 2FZDA 2NVDA 1PWMA 4XZLX 1Q13A 4EXBA 4R9OA 2IPJA 4JTQA 3V0TA 3LQGA 3UFYA 3B3DA 5LIKX 4ASTA 3GHUA 4JQ1A 4YVVA 3UGRA 4GABA 2IKGA 4JIRA 5LIYX 1ADSA 2C91A 1XGDA 4FA3A 3LBOA 3UZWA 3R43A 2PDFA 4WEVX 1X98A 3N2TA 3WCZA 4NKCA 1ZQ5A 3BCJA 3M0IA 1YE6A 2A79A 3GUGA 1EL3A 1J96A 5HA7A 4DBWA 3LN3A 2NVCA 3DN5A 2PDQA 4FZIA 1M9HA 2HEJA 4YVXA 1AH4A 4XVEA 2HE5A 1VP5A 2HDJA 3UZZA 2FGBA 1X97A 3CV7A 3UZXA 1RALA 2IPGA 2IPFA 3GHSA 4DZ5A 4JIHA 4RPQA 2BP1A 5LIUX 4WGHA 4G5DA 1MI3A 3DOPA 1ZUAX 2ISFA 1AH3A 1T41A 1YNQA 3CAQA 4F40A 3Q65A 4PR4A 3F7JA 2PFHA 2QXWA 3LNMA 2DUXA 2FVLA 1IEIA 3R8HA 3U2CA 2ALRA 4JQAA 4PUWA 1C9WA 1S1PA 4PRTA 2IS7A 4WDWA 4WRHA 3M4HA 2IQDA 1IHIA 4PMJA 3ONCA 4DBSA 1MRQA 3UZYA 1S2AA 4XZHA 1JEZA 5AZ1A 3C3UA 4YVPA 3O0KA 4QR6A 3D3FA 1PYFA 1AZ2A 4HMNA 2IKHA 2I17A 3GHTA 1UR3M 1AH0A 1Q5MA 2PEVA 4H8NA 1XF0A 2I16A 1AFSA 1EXBA 3CAVA 3BUVA 1Z89A 2PD5A 2PDGA 5M2FX 4IGSA 4AUBA 4I5XA 3COTA 4WDUA 1HW6A 4LB3A 3R94A 4EXAA 1PZ0A 5LIXX 2PDJA 4XVDA 5DANA 5JH2A 1HQTA 3WG6A 2PDIA 2INEA 4GQ0A 3LUTA 4XZMX 1RY8A 3BURA 1RY0A 2IQ0A 2P5NA 2PDYA 2PDLA 3H7RA 4XO7A 4JTAA 1A80A 4JQ2A 2PF8A 4XZNX 3LENA 2BGSA 2INZA 4PUUA 3EB3A 5LIWX 3ERPA 2HE8A 2ACSA 3RX4A 4HBKA 1AZ1A 2IKJA 1QRQA 2HV5A 2PDKA 4ICCX 3S3GA 2PDUA 1EKOA 4WDXA 4QX4A 3WBWA 3R58A 3G1RA 3O3RA 1X96A 2FZBA 3EAUA 4FAMA 3CMFA 2PDXA 4LAZA 4GA8A 4FALA 2CLPA 3RX2A 2VDGA 1Z9AA 1K8CA 3BV7A 1R38A 4XK2A 1YNPA 2R9RA 2FZ9A 1Z8AA 1OG6A 3WBYA 3V35A 2FZ8A 3CV6A 4Q3MA 1T40A 1GVEA 3R8GA 3RX3A 4JQ4A 1EF3A 4XZIA 4LBSA 4QBXA 4L1WA 1LWIA 2PDBA 2R24A 4Q7BA 3P2VA 4GQGA 2AGTA 1MZRA 3R6IA 3EB4A 3GHRA 3H7UA 3V0UA 4GCAA 3V36A 4LAUA 1US0A 4XAPA 3LQLA 2PDPA 3LZ5A 2IKIA 3ONBA 2WZTA 2PDCA 2DUZA 3UWEA 4DBUA 4QXIA 3CASA 4JQ3A 4PRRA 4H7CA 5HNTA 2ACQA 3NTYA 2IPWA 4XO6A 1PWLA 1XJBA 2PDWA 2F2KA 4L1XA 3FJNA 3M64A 3MB9A 4LB4A 4GACA 4IJRA 5JH1A 3G5EA 4GIEA 5AZ0A 3MC5A
chains in the Genus database with same CATH superfamily
3SECA 3V5FA 4HPNA 1AVAA 1S3HA 2V5LA 2W6RA 1PE1A 4WUIA 5AFDA 3O15A 3BAJA 4NG3A 3BLLA 1MFVA 4O54A 3I6TA 4QE5A 1NARA 4DY1A 3RO6A 1OK6A 3A3HA 4AD1A 2X16A 1Z7AA 3QH2A 2ACUA 1HZYA 3WQOA 2PDHA 1L6WA 4O11A 1KV8A 3GNOA 2EAWA 3BH4A 3CHDA 2A5HA 3SCWA 1ZBKA 4LS2A 4YL2A 1Q2SA 3ZZ1A 1ITQA 1S2CA 3LX9A 4U4MA 1S38A 3UJFA 3TYZA 3G24A 1LBMA 4P8VA 4X3ZA 4B91A 1ZSXA 3LZ3A 4HHMA 1E70M 4Q4PA 4UWMA 4IMAA 2D24A 3EA1A 3WK2A 3U7BA 4S2BA 3PS7A 3N15A 1VCGA 3ME3A 1W3IA 4GY7A 3S46A 1Q3NA 3AWOA 2GVYA 3VGFA 1WDRA 1GVFA 2QCGA 4Y96A 1R0MA 3FVMA 1MRAA 1RV8A 1YMYA 4IX2A 1GYMA 4JXCA 1EB3A 2VR4A 1V6YA 4R85A 2NV1A 3M0KA 3R0DA 2CCRA 3B3DA 5CPSA 3L5AA 4YVVA 4UTWA 4B4FA 2WV8A 4UNKA 4IWWA 2V9DA 1GONA 2ISVA 2XVLA 1B2YA 4URIA 2GVEA 4TIMA 4PE8A 3PANA 3GWQA 1RD5A 1TWSA 1ITCA 4KGLA 1KM2A 1ZBWA 4LF1A 3AMLA 4NAEB 4GRSA 4O16A 1C8VA 5IDIA 5CGQA 3V1HA 2C0AA 1YE6A 1VRDA 1VAHA 3S8HA 4X0NA 1QTWA 2BX7A 1O94A 2WCGA 1Y7VA 7XIMA 3DCPA 1M9HA 4MOZA 5CJ5A 1O5KA 1U83A 3AJXA 1JAKA 3M5VA 1FHLA 2FGBA 3ATYA 3O06A 4W88A 1TUFA 3T09A 1IIGA 3K4WA 2BP1A 1XV8A 1KM1A 3L4WA 3CTLA 5CPLA 2ZUNA 2WSYA 2X1UA 2WM0A 1XCWA 3Q58A 4XTDA 4RKAA 5I3JA 1E40A 1LRQA 5DT5A 4E3VA 3TLQA 3PNUA 2RAGA 2DZPA 1XIIA 1DL3A 4O10A 4KRTA 4DUOA 2QJIA 3H2AA 1O66A 1WOAA 1V6TA 3WQPA 1EA9C 1MXDA 2JKEA 4PMJA 1XS2A 3LHVA 2Y6ZA 3KS5A 1M5WA 3D3FA 4LWWA 4HMNA 4Q8OA 3IVUA 5GJNA 3GFXA 3UJ2A 2E28A 3TA6A 1RP8A 2GSHA 3G3DA 3TN3A 3W7NA 4CQCA 5H8MA 3HGJA 4PA8A 3V5CA 5DY3A 1ZNNA 2QCHA 3B8DA 3COTA 4WKFA 3NDOA 1GQKA 1AMKA 2CETA 2PRMA 2ZC1A 3C0SA 4UFMA 3PR2A 4CCCA 2Z25A 3BJSA 2DSKA 1OGSA 1UH3A 3H2OA 4C6LA 4J3XA 2V5KA 2J27A 1RQBA 5AC8A 2FMNA 4R34A 5E0KA 3PWAA 3WD4A 2QUUA 3H7RA 3L5MA 2BVTA 5CQ1A 1XM3A 3OZPA 4M29A 3N19B 1PHQA 1GUVA 1ZCCA 4HCDA 2OZ0A 3AS2A 1BLIA 4ALDA 1KRMA 1W3HA 2BY1A 1GVSA 3CGTA 1TJ2A 1SZNA 3VU2A 2V5CA 1PAMA 2EPHA 2BXYA 1ZJIA 1LUCB 2EJAA 3WQ4A 4K8HA 2EBNA 2VZVA 5CSSA 5KZ6A 1TIMA 5G1YA 4QX4A 4PL2A 1S5VA 1JZ5A 3R58A 4ACYA 2DUAA 2PP1A 3SSJA 5EMUA 2J9XA 1K1DA 2NXHA 3TC6A 2J6XA 2VC9A 5ABGA 2J7GA 4NYUA 5CXPA 3UA4A 1X38A 4WX2A 3STCA 2ALDA 2ESCA 4AZBA 3DIPA 1W2VA 2VGBA 3PAOA 5K9CA 4S2CA 5F4SA 1Z9AA 3GR4A 3TXVA 2G4FA 3LV6A 4AVNA 3TW6A 5D9OA 3S6OA 1LG1A 3BLKA 1UP0A 2YL6A 5A6MA 5EKYA 3GLCA 4AXKA 4N42A 4AYSA 1XLDA 5H91A 4D2JA 4LCRA 1MEHA 3AHZA 2ZTJA 5SWUA 2J7EA 3IGXA 4CNOA 4R5EA 1T40A 1IXPA 2IXUA 1SJBA 2JBMA 3E0WA 2HISA 1PEZA 4OKDA 4GJ1A 1Q6LA 2EG7A 1A5KC 4JNZA 3A24A 5BXTA 3NYDA 2Y7DA 4DXKA 1LWIA 4E6MA 4Z1AA 3FDGA 3WNMA 1CDGA 4NILA 4Q7BA 3BZJA 3IPWA 4MYXA 4ZQMA 2E7FA 2NUXA 3EB4A 5E0FA 5I3IA 2F7FA 3ABZA 4GNKB 3STFA 3KP1A 1DJNA 2W27A 1V3KA 3LQLA 2O55A 3BSGA 4UTWC 5JBFA 3NCOA 4L6DA 4FX7A 1PDZA 2D3NA 4YWIA 2NX3A 4XD5A 4GBDA 3C2EA 1XLEA 4D9PA 2WMHA 3HB9A 2WHJA 4U2ZA 1ICPA 5D04C 1W5MA 2DGAA 1N8IA 4OIFA 1TB3A 2YLAA 3PBWA 3SQMA 3QLLA 1KW1A 4O18A 5D8WA 4DVOA 3FA3A 4RE2A 5A1AA 3G5EA 3VDBA 2VEIA 2WNNA 2F8QA 4QM1A 3VILA 2GGEA 1GORA 5DT7A 4AEOA 3ID7A 1P6CA 3W7EA 3QN3A 2OEKA 2HVMA 2FTPA 3Q67A 2WKLA 4MHBA 2WC7A 4UTJA 3ANUA 5BRBA 4PULA 4TVUA 3PBMA 4IMFA 3WNLA 2A7NA 1GQNA 2WB5A 5H8UA 4LALA 3RLGA 3QF0A 5HJXA 1SM9A 4OTKA 3ATZA 4A2RA 4XB3A 3AZTA 5F2LA 1T6MA 4KBXA 2BGQA 1IEQA 1KCLA 3KRZA 1QPOA 3EBVA 4J3SA 3RCNA 4QE1A 1PSCA 3LHUA 3C2YA 2QCFA 1TZZA 2RDUA 1YXCA 4K1WA 4JEJA 3WJXA 3W1XA 5G4HC 1QNPA 1DXEA 4TVCA 5C9WA 4WD0A 3NAVA 1V0LA 4ZOEA 3GD6A 2OPJA 1PCWA 4POCA 3ZM8A 3KDNA 1F3WA 3AZRA 2WMIA 1KM5A 3NQ8A 2OFJA 1T0OA 3IRSA 2QMJA 4AWTA 4AIBA 2X05A 1G1YA 2OOGA 4PMOA 1DJIA 3CU2A 5AB3A 1J5SA 1H49A 1LBLA 3VNZA 1E0TA 3H23A 4NU7A 4MB1A 2OXNA 4JQ1A 1DIKA 2CZEA 3UGRA 1KWKA 4H41A 2WSKA 3SCUA 2AQWA 5B80A 1A5SA 1EF2A 4ERGA 1KR0A 1MW3A 1QDSA 1AUSL 2D1ZA 3EA2A 2PAJA 3ANVA 3VIKA 1XW8A 5I06A 4DWSD 1PYMA 3GUGA 1RBLA 3O6AA 4CD6A 4H01A 1EYWA 1N55A 4Q8NA 3KLLA 4QSHA 4DJED 2VC6A 3BV4A 4WJ8A 1DWJM 1TV3A 2GJLA 1X7IA 1DJXA 4L6OA 1RALA 1XC4A 5ABHA 5DELA 1CB2A 1K6AA 4D1JA 2ZX9A 1U30A 5D02A 2CLKA 4FLRA 5I23A 1DJWA 3UY7A 1EOKA 1WAWA 2GGHA 2WPBA 3NQCA 1JYWA 3S9YA 3HPSA 1KBIA 1PKMA 2AL1A 2YKKA 8XIAA 1AJZA 3DAQA 3WD3A 4MM1A 1YXYA 1D2KA 2Z1VA 1EP3A 2VGGA 5HBFA 2Z26A 3P81A 1SW7A 1WXJA 1W1TA 1CECA 2WXDM 5C70A 1DXIA 3M9YA 1Z41A 4M6VA 5EPDA 4FNPA 3SCSA 4FB7A 3RMEA 1KXTA 1UR3M 3WNOA 3DFHA 3WBAA 5I03A 1WO2A 1MMFA 1UH2A 3F5JA 3FLUA 3MUXA 1AFSA 3IAQA 3UR2A 3WF2A 3EDDA 1ZP3A 1VJZA 9CGTA 1R9ZA 1JIBA 3BOFA 1GG1A 3DH7A 5D03A 5CPTA 5FL0A 1MVYA 3B8TA 5C9RA 3HQPA 5EFDA 2GWNA 4ZVJA 1UP2A 4CCZA 1J9YA 4L56A 4NJIA 3W7KA 5BMXA 3V75A 3P84A 1ONRA 3AISA 3XINA 1GJWA 1ZS2A 4LS0A 5D2YA 4UOJA 1WZKA 2PF8A 1TCDA 2WANA 4HNCA 4UQEA 4G1NA 3B05A 4FXRA 2ANUA 3POCA 1AK5A 1W5OA 3UG5A 4LC8A 1I0DA 5A6JA 1G4EA 1PX4A 1Q6CA 2QVNA 3CAKA 3KTCA 4DJFA 1AZ1A 4AC7C 2HK1A 2NLYA 1LWJA 2EEXA 5BZAA 3VX1A 3NVTA 1TMLA 4ACZA 4JTKA 4JL1A 1KFCA 1PHWA 3HV9A 4FX6M 5D2XA 3BMWA 4XKMA 1UD3A 1SJDA 2FZBA 2OWXA 4HMDA 1MQQA 4XKYA 5REQA 4AMAA 3ICJA 5I3FA 1KA9F 1ODUA 5XINA 4NHVA 1DP0A 3QGKC 4WZHA 4LH8A 4ZXOA 1XH2A 4HMCA 2FB3A 1X6LA 2HCVA 3L0NA 1BXCA 1WAUA 3W1AA 3DHFA 3CZJA 1FDJA 1GVEA 4S23A 2V82A 3CL6A 4BQ5A 1XBYA 2D20A 1UD8A 4FR1A 1SPQA 3TQPA 3S4TA 4MJZA 4BI6A 4FF7A 3AHVA 5I7GA 3PTDA 3DC0A 1Q4NX 1TX0A 5A2AA 4ZO8A 5E9AA 1UWTA 3GVRA 4H8UA 4O0KA 1C91A 2QGYA 2REQB 4MUZA 1E6SM 4OVXA 2J7BA 1HT6A 3GIQA 4KCVA 3APYA 3AFBA 4A05A 2TPSA 4QS6A 5A94A 4PL1A 3VDAA 4QROA 4H7CA 4M51A 2CPUA 2YA0A 2HSAA 4CCDA 1GQLA 1SR0A 3HG4A 3DFYA 4UC5A 4IPLA 4C1LA 2Y7FA 3E2VA 2XSBA 2Z2UA 4BQ4A 3GFZA 3BARA 1M7OA 2O4QA 3KOXA 4NRRA 3NQEA 3V18A 1NOFA 3OA3A 1F8MA 1NEYA 2C79A 4HCHA 1GZ1A 3WLHA 4DHGA 2BSLA 2YBTA 2J7HA 1FWJC 2X2YA 3PPCA 3QV6A 2W61A 4TQTA 4AZHA 1LJYA 3W07A 3PZIA 2QCEA 4ZOAA 3P0WA 1DIDA 1MYRA 2I57A 1RJPA 2QCCA 5C2XA 3FV9A 1UJPA 3AIRA 1CXIA 1BAGA 3B40A 1DIEA 4JN6A 3WJZA 4NNCA 2ZRUA 2BLEA 4E2DA 3NEVA 2VGIA 2PB1A 7TIMA 4HPXA 3NG3A 2F9RA 4HNVA 4G6CA 2PTWA 1FWCC 3FEMA 4B2DA 4I7VA 1NTHA 1E4LA 3RPDA 1YADA 3OGSA 4BI7A 1YDVA 1XXXA 1K4GA 3HG3A 2E6FA 1B3OA 4KFOA 2H3BA 3GTNA 3UGVA 1DOSA 5AN7A 2QAPA 2ZZ5A 1FBAA 4H6RA 4TXEA 4UFLA 2CXEA 1TWIA 3CQKA 3NJ3A 2Z6JA 3C86A 4MNLA 4JIEA 7A3HA 1TPDA 1HX0A 3V0TA 1ADOA 4FK9A 1V02E 2PWFA 4JIRA 1H7XA 1TQXA 1ADSA 4OUIA 2YZ5A 3SM0A 4FA3A 2ZRXA 3MA8A 2FMOA 1DTUA 1TJ0A 2XM2A 3W37A 1V0KA 2C3ZA 4CNPA 3MMUA 1XINA 4F9JA 3GZ3A 4HOWA 1XIDA 1G94A 1SGJA 3Q37A 1OYBA 1GWJA 3APTA 1TVLA 3PG8A 4GUJA 4FZIA 2DP3A 3EMQA 3K4AA 1R9YA 4DJFC 2HDJA 1DXFA 3M7SA 2I1OA 1RQEA 4UCFA 1X97A 1VHNA 2ZX6A 2IPGA 4O8RA 3WLPA 4PMRA 5KINA 2OSYA 2PWEA 1OT2A 3N9KA 5AHNA 3LXBA 4LVDA 3THUA 2WJEA 4DXVA 4JFVA 1KFWA 1XBXA 1M7PA 2VOMA 4JQAA 1C7SA 3FA5A 3GAYA 1O12A 3FHQA 4HU3A 1KQZA 2KAUC 4RNFA 3EGJA 3BOXA 1KBJA 2ZUSA 1Y5VA 4UXDA 2VEKA 3BO9A 4IPPA 1TELA 4L4PA 3W27A 1BPLB 5H2ZA 1EX5A 2IKHA 3GHTA 1AH0A 2PEVA 1F5ZA 3DG6A 4OHQA 3PULA 5I79A 4MB3A 5C5YA 4GZJA 2PDGA 3CO8A 1SO5A 3WD2A 3ZJKA 4AG0A 3AYTA 4FOKA 4IGNA 3RYSA 3H6OA 2A0NA 2V3FA 1XLJA 3MHFA 3G1AA 3DYMA 3UXIA 4CNNA 3E2SA 3R5EA 4P7OA 3HPXA 3W0KA 4LSBA 1IEVA 4H04A 4HJWA 1FWRA 4NZCA 1AODA 4HYRA 5DX7A 3VFCA 3B8VA 2HK0A 1FKWA 4GKTA 3TROA 4A3YA 1GQJA 4GVGA 1QI5A 2PDYA 5GNZA 1HJUA 2ZXBA 3PSWA 5FJRA 4ZTYA 4QE4A 2ZZ6A 1E15A 2QDDA 2G0WA 4GC4A 3QR3A 2DVUA 2ZDRA 1LLOA 5LNRA 1U1HA 3VCRA 3ES8A 2HE8A 3SJNA 1R3TA 4HBKA 4UOQA 4H9ZA 4ES4A 1KRAC 4S1FA 4N2YA 5A6TC 2Y4SA 1TR1A 2XISA 3ALFA 3KHDA 2OKTA 3EX4A 1D8CA 3MANA 3O6CA 3MZNA 3NVDA 4YCOA 2QYGA 4F8XA 5RUBA 1JPHA 4QITA 1KFKA 1L2QA 1V08A 4AAJA 4EACA 3OZMA 3IS4A 4V2XA 1H3GA 1KNWA 3GZAA 4LVGA 4GYKA 5B7YA 3VKCA 4NJKA 5M3WA 3TKFA 3TTYA 4CN1A 4GA8A 2DT3A 2FFIA 3RLHA 5A8PA 1RQHA 3CT7A 1TV5A 2QZRA 5HMEA 4U5IA 3NOYA 1BQGA 3ISIX 1T99A 3S83A 1HF6A 1TIWA 2DY3A 3EDJA 1K02A 4ZQOA 4W8LA 4XD6A 2FYMA 3R1ZA 3L7RA 3VINA 3S9ZA 3DERA 3EZ4A 3PZQA 1FH9A 5FEPA 2WAGA 3W02A 5BOOA 2XGZA 1EF3A 1UR4A 1JRBA 2WZEA 1SUXA 3K2GA 1EJRC 3VKDA 3I7QA 4NAEA 3NIYA 4AZ5A 1AL7A 1PIGA 2R82A 3V36A 2PTZA 4ADSA 3VX0A 1JZ4A 5EFFA 5DCDA 3CZKA 3H2NA 2ICSA 3DKJA 5TQLA 4W89A 3A23A 3UNTA 3CASA 4C6FA 3LI0A 2XH4A 2CKSA 3RAOA 4JL2A 2QLYA 1VKFA 1DWAM 5IM51 5HQLA 1HKWA 2OKOA 2DZXA 2GVLA 3CWHA 3N9RA 1VS1A 1W5NA 1E9ZB 3BW3A 2DIKA 3C2FA 2YGYA 5BNKA 2PCQA 4YJ5A 5LSMA 1MQRA 1HKJA 4Y7EA 3TJXA 1PZ1A 3GG8A 2J8TA 2HNHA 1T96A 4HPJA 4RCXA 1YW1A 5CLTA 4GMEA 3ZT6A 3PZOA 3AYSA 3V0SA 1O5RA 3I4EA 2I5IA 1BWVA 3EDEA 2BV9A 2DVTA 1VFSA 4ATLA 1W9BM 1CGXA 1XUZA 3WH5A 4HMEA 1R87A 3UPMA 4CGTA 1KBKA 3U2OA 4JBRA 2MANA 1FWHC 4L4OA 4PFMA 4JTCA 3RCMA 2WVSA 4A6GA 1IXOA 1CTNA 5G5IA 4YPJA 1UR2A 3HIJA 4XSLA 3RM4A 3GH5A 4PUNA 1YE4A 1Y8BA 4PH6A 1WCGA 3AAMA 4GK8A 2TAAA 3GG1A 2VVNA 3FIGA 2V0TA 1KRCC 5D9MA 3VPLA 4IF2A 2HVOA 4PEEA 2JKAA 3MTWA 5MF5A 4HVXA 4HK5A 3H22A 3L4ZA 3M0XA 1PV8A 1X7FA 3T0BA 4ZQCA 2CHNA 3A3WA 3VM5A 3KE0A 2PSNA 4O1FA 4UMBA 1DJZA 5HR6A 4PODA 1HJSA 2XINA 2YW3A 5GJPA 4M7TA 3EWZA 3CHCA 5BU6A 3TWBA 3RJYA 1NDWA 3NL5A 3G1SA 5K9XA 1LUCA 1ZQ5A 3EXSA 3VGHA 5HMFA 2AMXA 3M0IA 5JBEA 4X9SA 3G6MA 4PTWA 2CZDA 2EG8A 1OCQA 5HA7A 1B3WA 1JZ2A 2DQXA 3MMTA 2EG6A 3CIWA 2FJKA 5ECVA 4AMCA 1I2OA 3KBJA 2HE5A 1M04A 3AIEA 4KF1A 2R1NA 3H12A 3KVKA 2OX1A 3OO2A 1YDOA 2NXIA 3EEZA 5U7SA 3GDRA 2PRLA 1N8FA 4Y6GA 3WLTA 2XVKA 1PXGA 3DOPA 1V0MA 4DZIA 4GUIA 1WZMA 2GUYA 3EOSA 1MUCA 2DZVA 4OQVA 3I7SA 2PWGA 4IQEA 3UXKA 1KFEA 3QEZA 3DHDA 2QV4A 3ABQA 1LZOA 4PUWA 4PRTA 2IS7A 3ZR5A 1V3IA 1KFJA 1VIWA 4IISA 1OD0A 1O4UA 4GI9A 3URBA 3WF0A 2PTYA 3MQTA 4BZYA 1XIMA 4R7JA 3CQHA 1K9EA 1DWGM 1F76A 2HPMA 3CWOX 3I3DA 5I07A 4AIEA 1UIPA 2E4TA 1KBLA 1QNSA 1MFUA 4GO9A 3TU9A 2DQWA 4JNYA 2WNZA 1P7TB 3W2UA 3DC8A 1QAPA 3CUHA 4AYGA 2AQOA 1ZBVA 1V3JA 1WXYA 1XLIA 1UOKA 4YHEA 1OY0A 4WDUA 1B3ZA 1A5AA 4EXAA 3I3BA 3L2IA 3NZQA 1GCYA 1UZ1A 3CUZA 4LUTB 3QPYA 3ITTA 1K3UA 1U5JA 2AQVA 2PDLA 4RNJA 1ZLPA 4LTSA 1G69A 4XZNX 2VX7A 3H4WA 4GIAA 4M7SA 3CNYA 5DF0A 1NAL1 2FIQA 2J74A 3WEOA 2CBIA 1LL7A 1SMAA 2DFAA 3A12A 3ZLFA 1E51A 4CD5A 3FGCB 4WSKA 1R3QA 3ZLGA 1QRQA 4YYFA 1FCVA 1O60A 4RPPA 5PTDA 6REQB 3VIOA 3CL8A 2NSOA 2TMDA 1DJYA 5D9PA 4P61A 1SO6A 3OQEA 1XIBA 1SYTA 3RUBL 3HU7A 1C92A 2A1YA 3O3RA 3GVVA 4K7YA 3MUCA 3MVIA 2X2GA 3OW1A 1GOQA 1XFBA 3B8UA 3GTIA 4UQAA 3BQ5A 5C71A 4DUXA 4FIQA 5E6ZA 3SGUA 1GW9A 2ZRZA 1TTJA 1EXPA 1JXKA 3V35A 2XWDA 1ZAJA 4Z1CA 5HNNA 4IUOA 2OQYA 1B9BA 3GUWA 1O5XA 4HNTA 3TSDA 1KCKA 2XG9A 3WUEA 1UD5A 2XM1A 3RK8A 2NUYA 1E5NA 2WWCA 1A50A 2R1PA 4GNJA 3HA1A 4G7FA 3WMSA 5C9XA 4KETA 4AD4A 3PZGA 2Q6ZA 1AG1O 3MJYA 5LA2A 3S42A 3W9ZA 2WO5A 1S2VA 3PZNA 4ZL1A 2XN0A 4XD3A 3WYZA 5EMLA 1NWUA 4BFAA 3R2GA 3LZ5A 1GT8A 2G3MA 4HYWA 4XZWA 4OGZA 4H9MA 4YCPA 1H4PA 1UJQA 3O6YX 4MFEA 4KMQA 2DSUA 4JQ3A 5J04A 2E67A 4JFWA 1NJJA 4DBDA 3ARQA 4HZMA 3TYAA 5BXSA 1E0WA 1KQYA 3K8KA 2IMRA 1HN1A 1HTIA 4H1ZA 1TPB1 1V93A 2QV5A 3P93A 1NDYA 2B0MA 3AC0A 1QW7A 5TNVA 1JDEA 4GIEA 3LRMA 2Y89A 1MNZA 2BOGX 1WOBA 3ELFA 3UWYA 4GKLA 4NXKA 1EJTC 2FPYA 1OD8A 3CV1A 2OSWA 2PDMA 1BTCA 3N2OA 1XH1A 2E25A 1UD6A 2RGLA 4ZODA 2JGQA 2A2IA 3V16A 1W37A 4M19A 3SY8A 4KEVA 4M1RA 4Z2GA 1R7AA 2A3LA 1F07A 1PVNA 4RE4A 4C6DA 3LCIA 1XSKA 1S1RA 3BWWA 5DFAA 1XFCA 1VFUA 2CWNA 1OB0A 1B0IA 3VCNA 1JGIA 1HJXA 2Y61A 3DBPA 3CAWA 1HP5A 4PB5A 3N14A 4L65A 2Y70A 3B9NA 1FDZA 1FXQA 3V3WA 1ECQA 1VBJA 1YBQB 3LM7A 5JBDA 5A6KA 3C61A 2ISWA 3W7GA 2WOQA 1SFTA 7PTDA 1XRFA 2NX1A 3VXGA 5BYWA 3S2NA 4QDMA 5C7HA 1M03A 4DWSB 2ZUWA 2VTFA 4DWDA 2OR2A 2W0UA 2WMKA 4LVAA 4LCQA 5FSDC 4GUHA 1E4NA 3H24A 4JFTA 4JD4A 3E74A 1KKRA 4JTQA 1H51A 3FOKA 4WSHA 3DECA 3T07A 3NPXA 1DJGA 2F2HA 1W1IE 4IGHA 1PJ9A 1I8JA 4GABA 1AQHA 2IKGA 1UASA 3ITYA 1UKSA 4RE3A 3M0LA 3KCOA 4C6IA 1I75A 5HWMA 1OCBA 2HBXA 2DPEA 3UWWA 4PUDA 5GNYA 3ZSSA 2HS8A 2RH9A 4I9TA 2QJNA 2ZZ2A 3KEHA 5HMSA 3B8IA 2E6DA 3GB6A 1HGYA 1PDYA 2VC5A 3WDIA 1K9DA 4ZOCA 1UR9A 3IEBA 3MBFA 5A8NA 1KFBA 3EWXA 4LV4A 5TBOA 4C6JA 5HNRA 3AXHA 4LW7A 2A4AA 2PUZA 3T2PA 4C6EA 3G2GA 4RPQA 4GIYA 1WBHA 5KTLA 3ITXA 1A4LA 1KCZA 3W6MA 1XIFA 3P7YA 2E9MA 1LQ0A 3LA4A 4F48A 4FP1A 2E77A 5LA0A 3TN6A 4PUKA 3TYBA 3MS8A 3HF3A 3VDHA 1XSJA 2OEJA 3PTQA 3R8RA 4NNAA 1HL9A 2PPGA 2FVLA 1DTNA 2WZIA 3R8HA 5AYZA 3P0XA 1JYVA 2QPXA 2RGMA 1E56A 1VBUA 1S1PA 4OFCA 4W87A 2FB2A 5G1TA 2V5DA 1MRQA 2REQA 3GVGA 1S2AA 3A3XA 4D8LA 4E2BA 1QHPA 4PGLA 5FF4A 2I14A 3OGRA 5BRPA 4JYEA 3RR4A 3RILA 1V02A 3TH6A 1M68A 3DENA 1D9EA 3W2LA 3QZAA 1XF0A 3W26A 2GSEA 3W01A 1XL9A 4KIEA 4RDYA 3TJ4A 2FH8A 4D8AA 1VF8A 4F3HA 4FNUA 4XAFA 3CLMA 3DI1A 5JH2A 3IJDA 2INEA 3WUBA 4ZZ9A 4H6QA 3AQUA 4R33A 4ERIA 5KSWA 1U1JA 2ZVRA 1VFFA 2C14A 4LU0A 5AYYA 3W28A 1UMLA 3LCWA 3TSMA 3WFZA 1YXDA 3FY1A 4NZFA 3NOEA 1CXFA 2AOSA 3LENA 4LYPA 3RG6A 1TTQA 3QV7A 2V63A 3UXDA 1VFOA 3CPRA 4V15A 1XYMA 1OCNA 3DZ1A 1ITXA 1MSSA 4S3BA 1WQ5A 4LFYA 4XTIA 4GFSA 2ZWYA 3U2ZA 1SU5A 3LCFA 1KKOA 5T26A 4N4QA 2PDKA 4I9JA 3PFRA 4L4LA 1VGAA 1ZY9A 3O16A 4J35A 4XUYA 5GQBA 1DIOA 1HP4A 5AHMA 2NV9A 4WDXA 3ARRA 3RRAA 1U33A 2OZ3A 3NUKA 3NGFA 5FJJA 3OGVA 3O0FA 3S2CA 5DXYA 3HFTA 2VELA 3GW3A 4AY1A 4LAZA 1YTKA 3DHPA 4QISA 2DH2A 1M7JA 3A9BA 4B5XA 1QI4A 4OBSA 1V8EA 3JVAA 1H1NA 1YKWA 1SVDA 3AIWA 4ATWA 1EJSC 2Y0FA 2QEZA 1I2RA 3E0IA 3SZ8A 4ZCWA 4Y8EA 3S5OA 4CN4A 3QRHA 4K39A 1J01A 1LWHA 3BPWA 1QU4A 3CS2A 1KGXA 3R8GA 1TJPA 3ZVIA 3RX3A 3WENA 5T9CE 5D4YA 1US3A 4TO8A 4L1WA 2R24A 2FLIA 1X8CA 2NT0A 3FYOA 2CZ5A 1XR2A 4E4FA 1GTEA 3FVDA 4GQGA 4Q6JA 5AYIA 4Y8FA 3NWRA 4W9TA 3PK7A 1W9DM 3THCA 4C5ZA 4Q4KA 3ALGA 4E5TA 4ICNA 4UTUA 4A29A 1I2PA 2WYSA 1JYNA 2PLKA 1OFDA 2X7VA 3QY7A 1ODZA 3W1MA 5CLWA 2F6KA 3WDQA 2RFGA 4DBUA 4FMVA 2VZOA 4DXXA 3BW4A 4EWND 1P0NA 2YOCA 3BCDA 2J9YA 2YCLB 4ZQRA 3VNYA 1P1XA 2XVPA 4F66A 3AIVA 3LPOA 3OP2A 5AECA 3CIVA 3EWWA 1SO3A 1QNOA 4E3TA 1JCTA 4YWSA 3B9EA 3SUUA 3GBDA 3QKZA 1W8GA 2CLFA 5LZLA 2GJNA 3G1HA 3N11A 1TMQA 3GDKA 1KXHA 2OWCA 4NAFB 4S3GA 1VEOA 1VJIA 1SW3A 4PUJA 1QPQA 1XKYA 6TIMA 2CLLA 2DZTA 1OINA 1RSCA 2BZNA 3TTQA 1JUBA 1J2BA 2DW7A 3CQJA 2VX5A 5AHIA 1UD2A 1CEOA 4E8DA 2D22A 2RJGA 1PKYA 1KC7A 4OECA 1FWAC 2ZUVA 2J7CA 2WCAA 4LYQA 1PL9A 4O14A 3U7VA 3BAKA 4ZFCA 1FOBA 4J3VA 1EDGA 1ME7A 1PBGA 3IJ6A 2WK2A 2ZRVA 4F0KA 1QWKA 1X1NA 4O13A 3WDHA 1C9DA 4JY8A 4JTDA 4UCGA 1JG9A 2W5FA 5HNUA 2H6RA 4ZMGA 1PTDA 1BVWA 1LCOA 4MIMA 3PWGA 2UWFA 1MDLA 3K8MA 4PTMA 1R3WA 1EC8A 4LYKA 2VCAA 1KBBA 3MMWA 5IOBA 6XIMA 3PJTA 4EXBA 3HQOA 2WM1A 3PG9A 4EOUA 1FKXA 2BMBA 5CGMA 3EEGA 1I0BA 3MCMA 1LRNA 3GK0A 2PMQA 3DI0A 3I68A 3GRIA 1K8YA 3TMLA 3WDRA 5B7ZA 2Y62A 4YTUA 3ZJ7A 1EDTA 1RZMA 3NPUA 4DI8A 1XGDA 4MY9A 4OUEA 1LG2A 2W63A 3KHJA 2PDFA 3VYLA 4A2SA 3GVWA 4XIMA 5IRPA 3NQAA 3TC3A 4NKCA 3ENLA 3EX2A 1GTHA 1IR2A 3VE7A 4XZ9A 3UWZA 5HULA 1F4HA 3HJEA 2KZHA 2W67A 3LN3A 2C15A 1DE6A 4NYYA 4WOZA 2DT0A 2BTMA 1IWBA 3OVQA 3TAKA 1UROA 3URAA 3UZZA 2VP8A 3M6YA 3LM3A 4I90A 4PCFA 4DZ5A 4DELA 2PP3A 4A8NA 5CH9A 2VHLA 5LIUX 3M16A 3PPFA 2DSVA 2WLZA 4HHPA 1MW2A 3G0UA 4AD2A 1T41A 2R1LA 2ZYFA 1EFZA 3IVTA 4NY2A 3WQ8A 1R2TA 1XBVA 4L80A 4C6MA 1KM6A 1RXOB 2Z2AA 1S46A 1RPXA 4JS3A 5EYWA 1UR0A 3P8IA 1MXSA 1LT8A 4LVFA 2XSXA 2ALRA 3GH7A 3CH9A 1I6NA 3MT1A 1FHDA 2YA1A 4IMCA 1J18A 4NZ4A 4DB7A 2FHBA 3OZOA 4BF7A 1AJ0A 2J9ZA 3U0HA 1UKOA 3B03A 2JGYA 1F74A 3RXZA 4HOZA 1HGWA 1RLCL 2I17A 4LVBA 1XLFA 4OT7A 4WK9A 2OJPA 4TX6A 1XLKA 5HQMA 1QPRA 3W70A 2YL8A 4KT2A 4PSRA 3BUVA 5MHBA 3B0YA 4AUBA 4XQ6A 2VRJA 3O9NA 5E9XA 3L66A 4AISA 3W4RA 1OT1A 2G8ZA 2AL2B 2P8BA 1J10A 1R5YA 1RY8A 5HPOA 2DZWA 3KZSA 5CSRA 3U48A 2Y5SA 1B1YA 3N25A 2YB4A 2QIIA 1QK0A 1Q85A 1OHLA 4MUPA 1Q6OA 1OZQA 1XKJA 2GGJA 4GH1A 5FF7A 3VD5A 2ZBTA 1L6GA 1DEDA 5H8PA 3RPTA 3I6RA 4JHOA 4C6PA 3MWCA 4LS1A 3VOIA 4ZB0A 2ACSA 4AZ7A 2Y63A 2XFRA 2ZADA 1TYGA 2WKGA 4JTTA 1FQ0A 4KEMA 5CBBA 1V77A 1H7OA 4K2SA 3TONA 4LUYA 4XD4A 3UNDA 2E1WA 4QJ3B 7REQB 2X1SA 1PZ2A 4UR9A 4GXWA 4C7DA 3N2MA 3WK3A 2P8CA 4RW5A 1CLXA 3E0LA 2EPLX 2DT1A 1FCUA 4GI8A 4PZVA 3CXOA 3AJ7A 1E72M 3RX2A 3S5ZA 3D5HA 4AZCB 1W8SA 3CO4A 3LXCA 1KTCA 5CJNA 2GDQA 1KWGA 2OG9A 4PMQA 3TW7A 1XD1A 2R9RA 3DU0A 3QJAA 2HWGA 5D09A 1CXLA 2JF6A 4IPIA 3E0FA 3SR7A 3OBEA 3IJIA 3W3OA 1X39A 3W29A 2DU2A 3IJ8A 2XIBA 2JE8A 4YTSA 1KLZA 1RAKA 3SCNA 2VQUA 3G22A 1YYAA 2WBGA 3OEXA 1I9CB 2GFTA 2WHKA 2J66A 1L9WA 5KZMA 3QW3A 3GXFA 3KM8A 1ISXA 4RR4A 4XISA 2W4XA 3T05A 1FWEC 1US0A 3VK5A 2ZRYA 2Y2WA 3MHUA 2J47A 2NUWA 2IKIA 2FVMA 2FZNA 3N2CA 1YIXA 1W5PA 2XH0A 5BCAA 1GOOA 1EO5A 4FXSA 1E9YB 3W1NA 3PP7A 1QO5A 4OU1A 1B30A 4IZGA 1HJVA 5K4XA 5M1TA 3MP5A 4DF1A 2VX6A 2W9MA 1A4MA 4XO6A 4JCLA 2PDWA 5CZSA 1MNSA 3WD0A 3NDYA 3OOQA 3SGGA 4U31A 3TVAA 2P53A 5AC7A 5FJPA 4B2DD 1PTAA 2YA2A 4YMZA 4HKPA 1IT8A 4IQDA 1YTEA 4CQBA 4UFHA 2GWGA 3VE9A 3TX9A 1UWQA 4P8XA 5HJLA 4LBRA 4MPKA 1V3MA 1OFQA 4HNOA 3OBKA 2RDXA 3HPFA 2QDEA 2ZX5A 1F4AA 3SURA 1R30A 1FWBC 2PD9A 2KX9A 1RJRA 1LQAA 3BANA 2QULA 1K8ZA 3CLWA 1FX6A 3RNDA 4R9XA 3H2MA 1WKDA 1NU5A 3PZ9A 1OCJA 2ZUUA 3S1GA 4X22A 3F5LA 1R2SA 3R13A 3LRKA 1I1WA 3MI2A 3GNDA 2EPOA 3L21A 4QS5A 3E1F1 1QW9A 1P7TA 3WLLA 2FGLA 4Y90A 1RLDA 4LAMA 1SQ7A 4B90A 4QTGA 3FSUA 3T8QA 4QG8A 3W7HA 1Q8AA 3C0JA 3Q4DA 5CC3A 1JPDX 1IV8A 3UP8A 3FX4A 4MPQA 1RCOB 4IUGA 2YSWA 2ZA3A 4QFUA 4LC6A 2VRKA 4KWSA 1I2QA 4HU0A 4P2VA 1G01A 3G1FA 1VLWA 2QCDB 4LUTA 4K36A 3S6TA 1KV5A 2AKZA 4C7GA 2D2HA 1OVDA 3QSRA 1ISVA 1QATA 1THFD 1V0NA 1XWYA 2P0IA 3HG2A 2Z2BA 5HWJA 2E8YA 2ZICA 3N12A 4DYEA 3VOCA 4MSSA 3SQLA 2WSPA 2TODA 5CJMA 3WIJA 3TTSA 1W5QA 4C65A 3LCLA 4KEZA 3FGCA 4U5KA 3N4AA 1E1EA 2CYGA 3AWNA 1E6QM 3CPGA 1NDVA 6REQA 1A0CA 1BYAA 2ZRWA 1R47A 1NVMA 3I65A 1S5NA 3BCJA 1EYEA 2JKPA 1FDYA 1PZ3A 4GINA 3HQ1A 2QGHA 3CEPA 1RJQA 1CX9A 4GFIA 5F2MA 4K6AA 4QJ4B 3T44A 1SZGA 3Q2DA 4K1GA 5LKYA 3GKAA 4DNHA 3IIOA 4Q8UA 3CV7A 4FNRA 4L61A 3NQBA 1WYIA 2Y8UA 4AD0A 3L0KA 3HM7A 1UQYA 2QUMA 2ZXDA 4GX8A 1CGWA 3W2JA 3VOGA 3HPZA 3E49A 3CAQA 5G4EA 4V1YA 3IGUA 2EKGA 1XLBA 2HQAA 4UR8A 5CPMA 4LUSB 1M1BA 4KFNA 4MZYA 1IEIA 4MY8A 3U2CA 4KEUA 5FEZA 4HA0A 3DG7A 4BF9A 4QJ1A 1QBBA 4ZGYA 3ITCA 1S39A 3U6WA 2WQDA 5BXRA 5KEZA 2E5BA 2XH2A 1XIJA 1HVXA 1FVPA 2XPKA 4IP7A 4BHYA 1IWPA 4D8ZA 2G50A 4E2VA 3WLQA 2ATMA 2X0SA 2VXNA 4HNUA 1UD4A 2RJHA 1FY6A 5GVJA 4BY3A 3T4CA 1U5HA 4OOUA 1VBHA 3ARTA 4PC8A 2CW6A 1RA5A 3GG0A 2WQPA 1HW6A 2J6VA 3W1UA 3W2KA 4LAOA 1UPMB 1WXZA 3BLIA 2P88A 4XVDA 5I77A 3AXMA 3FA4A 5F4WA 1VIZA 4L9YA 1TRDA 1JPIA 1KTBA 5C0QA 4UFJA 1B57A 2XVNA 5U4NA 3M5XA 1HL8A 3QY6A 4JTAA 1A80A 3VMOA 3SIMA 3BLEA 1OF6A 4JX5A 1R85A 4B15A 1JD9A 2FPVA 4A3QA 2G97A 4JN8A 4IG2B 2Y88A 2ASHA 2OODA 4Z1BA 1CENA 3M5ZA 4YLWA 4HTBA 4ADTA 3W53A 2MUCA 3IARA 2QJMA 3KL0A 2V2CA 3QXBA 5C2GA 4C1KA 1VPYA 3AS0A 3E02A 4E4UA 5BU9A 1YQ2A 4IOTA 2OVLA 2O0TA 4MFDA 1EKOA 4O4VA 3GNNA 4WVXA 2MNRA 2E8ZA 1YBQA 3LHYA 5CBIA 1JCNA 3UWQA 1H50A 1NFBA 4UR7A 4JX4A 1SZRA 4EAMA 3UY8A 4W8BA 4ZO7A 4DWSA 4QCEA 3LMZA 5EBAA 4FXFA 4GPNA 2DH3A 3KVLA 3K13A 3NQ2A 4DLFA 3LCGA 3L2LA 3VNIA 1REQB 4US5A 4R53A 2XYLA 4O0ZA 3TV8A 3C0LA 2YCKX 3UWUA 2OZ8A 3DESA 3IK4A 4P8WA 3ZR4A 2FZ8A 3GE7A 1RR2A 3CV6A 1MW0A 4Q3MA 5LNSA 3CZGA 2BY3A 5CEWA 3VZYA 1S2TA 3CQ0A 1SSDA 1J6OA 1QK2A 1RBAA 1XRTA 1FUYA 4E8CA 3OLEA 2LLEA 1IEXA 1C90A 3ECQA 3TYUA 4O15A 1E0VA 1ENUA 4QAIA 3VTRA 3ZMRA 2BDQA 1GK8A 4GCAA 1O95A 4B5TA 1ZPTA 3CTTA 3KCJA 4BF5A 1XX1A 2ABAA 1GVIA 3AUOA 1W1VA 3IGSA 1L0PA 4LUJA 5D33A 3UWEA 4DUWA 3EKLA 3F4WA 3E12A 4PRRA 4S3DA 3CJPA 3R11A 1K9FA 4L1XA 4AF0B 3VIFA 1OX6A 3BICA 4GACA 1MXGA 2DEPA 4IJRA 3ORWA 2QCNA 3WSUA 2FVKA 4HPHA 3B4UA 3OU8A 3G18A 5AHEA 3W83A 4XX6A 3IJ9A 1AD1A 3SCRA 1NOWA 3WELA 1V4YA 5D05A 4PFHA 4NX0A 3VNKA 4JNMA 3EDFA 4M8UA 4IJCA 3GU1A 4P7NA 1E3ZA 3WDPP 1TE6A 4WKHA 1O1ZA 1EUNA 3URQA 4D6IA 1FFQA 2OYLA 3EWCA 3NQDA 4HOXA 1B4KA 3NR0A 2CBUA 4C6QA 2XWEA 5FJTA 4ILSA 4JYFA 3AHYA 3WQ5A 3CHVA 2I5GA 2WZMA 3AHTA 2OYMA 1EP2A 3OIHA 1R6WA 4G7EB 4MLJA 4PMUA 3K8LA 4XAZA 4HA3A 1OADA 3KRSA 3E2QA 3OLGA 3TTOA 5KETA 1HKIA 2E3ZA 3GXDA 1GOKA 4BR1A 2GUUA 1NELA 2V8ZA 3P62A 4HN4A 4JFSA 3H54A 3OTRA 3FKKA 1TA3B 2VFEA 3C0QA 4WR3A 2NVDA 3GH4A 4UNLA 1A47A 4BWLA 3N13A 4MNKA 1SJCA 1T7LA 4K38A 1JPKA 1QOPA 1E71M 3SUWA 3NQGA 3PUOA 1LDCA 1LL6A 3GBEA 4DX3A 3QHNA 5JVLA 3GW0A 3WF1A 3QYQA 3AIBA 3EMCA 2QIWA 3UFYA 1E9LA 3GHUA 4QAWA 5DRCA 4N9EA 4Z17A 5IBXA 1GJUA 3ZLHA 3VIGA 3Q94A 2EPNA 4ZA0A 5EGRA 4Q8QA 2RDWA 3JZUA 1P4CA 3PBVA 2QDHA 2VUYA 1GZJA 3WNKA 4JFUA 4V27A 5D37A 2UY2A 4PTVA 4XV0A 4QJ5B 4FHAA 1T8QA 2FTYA 2CEQA 1GVOA 3P80A 2OGJA 2ZDSA 2B4GA 1A5NC 1WKFA 2E6YA 3AS3A 4HA1A 4UTKA 3BGAA 1RD6A 5HQEA 1UC5A 4DQWA 4L7ZA 4FF5A 5AC6A 3CZLA 4ZFMA 1GOXA 2YCJA 4EAYA 2DIJA 3CK5A 2YX0A 1ZUAX 1AH3A 1EHAA 1XYZA 1OFPA 4HB7A 1QNVA 2C18A 3UCDA 1EOMA 3F7JA 1PIIA 4AVOA 3ZIZA 1Q6FA 3I7RA 3M43A 3UZ5A 5G2IA 5FACA 4RZ6A 3FEQA 3LBCA 2WW5A 2DUXA 5FF3A 4DWSC 2FH6A 3KBSA 3SCOA 2GQ9A 4DM1A 3EPNA 4BI5A 5CGTA 1C9WA 2BASA 4AHOA 3VABA 2C71A 2V69A 3E0VA 4WDWA 3WLSA 4CU6A 5JU6A 4F2BA 1GGOA 3M4HA 4MMWA 3HPAA 3ONCA 4ADUA 1C8YA 1UUOA 2QNEA 5FCZA 5H1WA 5LXXA 4IT1A 4O0QA 2VM8A 5I00A 3BK0A 1PYFA 2QPSA 3L4TA 3GIYA 1UR1A 2JFEX 3FDKA 4LPCA 2VFDA 3WMBA 5F2IA 2VCBA 1GKPA 3L4UA 4V33A 4XSMA 2WLYA 2WZHA 3MV01 2YCLA 3SO7A 1Z89A 3QZ6A 4O57A 4PBGA 3NZGA 3ES7A 4NZ3A 4MVAA 2OB3A 2ZX8A 3U5UA 3MUIA 4JDBA 3NM3A 1TKKA 2PU0A 6ENLA 2XTKA 4H6EA 2XIJA 1CXEA 2PGRA 2IW0A 3L9CA 4OBTA 2GOKA 3N4EA 2IQ0A 4ZO6A 3CMGA 2BG5A 2QF8A 4NAFA 3C6CA 1FTXA 2Y5JA 1NP0A 1EEPA 4X0VA 4MWAB 5J5RA 4Z2KA 1XD0A 4WSJA 4WXYA 3VKBA 1G4TA 1OC7A 3EXRA 4DRSA 2X0YA 3S5SA 3EA3A 1LL4A 3AIQA 3RX4A 3STGA 3W7JA 3HGSA 5FESA 2QMKA 4K8GA 2HV5A 1QT1A 4GY1A 1EBGA 3BAWA 3P67A 2QR6A 3E96A 5LXEA 3IIXA 3PPGA 3GNPA 1OIMA 1DWFM 3W2NA 3TCSA 4QDWA 1P6WA 3WF3A 2GDVA 3CZ8A 5LHEA 3S2LA 3QSTA 8TIMA 3T0CA 1VCFA 4RXFA 1LLWA 4FPSA 4KKXA 1Q6RA 2EKCA 1EZ2A 2OQHA 2PDXA 5HR7A 1OQFA 4E4PA 4IPNB 4HZ6A 1J0IA 1FWSA 1GYLA 3WBEA 2CBVA 2GQAA 7CGTA 3KWSA 1BHGA 1BYDA 4DO4A 3G6LA 3BV7A 1GNXA 3TYCA 3S2JA 4DO7A 3IK2A 4NI3A 3IV3A 1JDAA 2J8GA 2I5QA 3EMZA 3QKEA 1WZAA 4PMNA 2X09A 3AMKA 4DI9A 2W79A 5A69A 4XZIA 4A8IA 3SY5A 1DE5A 3WDJA 4BWLC 3N34A 2BVDA 2H9AB 3W7CA 3OVPA 1W91A 3V0UA 1JZ6A 4ZXLA 2Z0IA 3DFTA 2PP0A 4RNIA 2PWUA 4A4AA 1E6ZA 2FPTA 1QPNA 5IBXC 1UWRA 1J0ZA 4AWUA 4F4RA 4L1GA 3WF4A 2QDGA 1UB3A 3PB2A 4IP4A 2QJHA 6CGTA 6XIAA 3LHWA 1XBZA 4HJFA 3XIMA 4MWAE 3P60A 1XJBA 1U5VA 3HGRA 1OG0A 4PB4A 1C3FA 4LB4A 2BB0A 4FO4A 3W1RA 4N02A 2YCEA 1ME8A 2HXUA 2X8RA 1FA2A 2ZXAA 2H3DA 5LGXA 3PJWA 2CFFA 4G9PA 3ZVHB 1DQXA 3GXPA 3L65A 2HNEA 1A49A 5K7JA 4CU8A 3LD5A 4C7FA 1F6YA 2BXVA 4BJHA 3W1PA 2BY0A 5KZEA 2YXXA 3T78A 1TPVA 2NLIA 2CHOA 1RVGA 1YRRA 4D72A 2JF7A 3KBNA 1RCQA 1QNRA 1WUFA 5L9FA 5KZDA 2A3EA 3T42A 2PWVA 2V38A 3APGA 3B04A 4O1BA 4JR5A 2CLMA 4CEUC 4IMDA 4FLQA 3A4JA 3LEPA 3PAJA 3LLFA 3T9PA 2YFOA 3WEZA 2AL2A 2VEMA 4YU1A 4AVFA 1LORA 1H7WA 2HXTA 4IIBA 2D69A 1G5AA 5C6MA 3MZ2A 4EPBC 3FXYA 2VL4A 3F4VA 4IL0A 2D23A 3VMPA 2GUBA 2YXOA 5A6BA 1JD7A 5CAKA 8RUCA 5I0DA 3VD3A 2O7SA 4Y9MA 1R3RA 4LF2A 1MUWA 3BDKA 1PO9A 3JR2A 4JDYA 4ICMA 2VNCA 4F0RA 4MJMA 5ABEA 2PLCA 1A5MC 3C8NA 3UXLA 1UKTA 1CBGA 1W32A 3M0YA 3USZA 2WKJA 4CD8A 1EO7A 5F1UA 1ZL1A 4AHPA 7REQA 3QPZA 1TR9A 1XDMA 3S5NA 1TV2A 2VX4A 1NWSA 1LYXA 5FJOA 2PDQA 5LYRA 1Z69A 5D9NA 4YVXA 1H7RA 1TPEA 4IMGA 4HNLA 2OLSA 3D47A 3NSMA 1FCBA 4TX9A 2PC4A 3K1DA 2BHYA 4AZCA 2DSWA 3TAOA 1A0DA 4Y9AA 2OO0A 1O7AA 1EGVA 4M1BA 1B3YA 4GGBA 4J27A 4JIQA 1KXQA 2E1DA 5L6UA 4Q4OA 2PLMA 3F5KA 4WOQA 2JIWA 2XIOA 1H09A 3KAOA 1IZKA 1T5AA 2Y8KA 3O7UA 6ALDA 3UERA 4INFA 4N6EA 3LBMA 3B0UX 3FAXA 3EX6A 2XUCA 3ZT5A 4LY8A 1A0EA 1BYBA 1JEZA 4Q7IA 3GKFA 1KD0A 5EU9A 1KLYA 2NWSA 3KW3A 4NIRA 3B9OA 2WPGA 1TUXA 2J13A 2GJXB 3ARPA 3M0JA 4H8NA 5CC7A 4JOMA 4GGHA 1KGWA 3TW9A 4PCSA 3F03K 3NQMA 4J5NA 1EP1A 3DDMA 1H60A 4KCUA 2ODOA 4LBUA 4J7RA 4TTUA 3RR1A 3VI2A 1X6UA 4B4HA 1TSIA 2DDXA 3CWNA 4B5SA 5A2CA 4UTIA 1ML1A 1WDDA 3VC6A 4MLRA 1AQFA 1RY0A 5DMLA 3OHIA 4WIWA 4M6UA 3UG4A 3O6DA 3C2RA 2WVUA 3G1YA 5FL1A 3BTNA 4IL2A 4CNTA 1Y5XA 1SJAA 4WJEA 2Y7EA 3UZJA 1AQ0A 2VZTA 4P5UA 2VD9A 1Q7MA 2G3JA 5M17A 1R7OA 5D32A 5CBJA 1RP9A 3M0HA 3W22A 1NIUA 2E5DA 4R27A 2VI0A 4K3ZA 4IIEA 3IIVA 3RU8X 1M3UA 3UPWA 4M0XA 4KRUA 2BGNE 3P5YA 1TWWA 1LF1A 1Q6EA 2YIHA 4OZOA 1K9TA 2ZZ4A 4YYCA 3GXMA 4ZB5A 1GKRA 2C19A 3FFSA 3UEQA 1LP6A 3D0CA 1TWDA 1Q6QA 3F4DA 4JEQA 1NQKA 2QCDA 3M1ZA 3F4CA 1VFTA 2OU4A 4FNQA 3UVAA 2C8NA 1C8QA 2VEPA 3E38A 1O6IA 3OVRA 1YX1A 1W9UA 4S38A 3N9SA 2P3ZA 4RZBA 4XK2A 4XUGA 4DLMA 5HINA 4PCPA 4YIWA 4BCEA 3WBYA 3QYSA 1W0MA 2O9OA 4GBUA 4WCJA 1EHNA 1BYCA 4U10A 4RL3A 3UF9A 2OX4A 1GYNA 3LSCA 3QQ0A 2ZZ3A 5FKYA 3AMDA 1BTMA 4QBXA 4KGJA 3NQ6A 4JICA 4KWOA 3GHRA 4RE0A 3IJLA 4H4IA 3G3MA 3MSYA 1B3VA 2Z1KA 2VUNA 4MAVA 2YDRA 3ZJ8A 3II1A 1JVNA 4QEHA 3ITOA 4C90A 3GVQA 1Q6GA 3GTFA 2Z27A 3T08A 1JDDA 3QPEA 4UFIA 1FP9A 3TK7A 2X40A 3CB8A 3V4BA 4AY8A 1B90A 2ACQA 1U22A 1PWLA 3EOEA 3BXWA 4F0MA 2NQ5A 1OYAA 5F1VA 1W1A1 3EYPA 3RLVA 4UBPC 3O05A 5CZKA 4I5UA 1S2WA 4BK9A 4O19A 2VWTA 3B4YA 3FJ6A 2ZE3A 1CZ1A 4LOCA 3TIMA 4LUSA 5HMDA 4QNEA 1W3JA 1JCJA 3SB0A 3VKAA 1RK6A 3VNDA 2GJPA 3T2QA 4HD5A 3RM8A 1MQPA 2QUVA 3W1QA 3LCXA 4KIRA 3IV8A 1D7FA 1TJ1A 3VIJA 1W1PA 4OBRA 4ORIA 4L4MA 4BQ2A 5HUOA 1F61A 3VZZA 1BRLB 5AHLA 3GYCA 3PUDA 1CGUA 2UY3A 3K5XA 1ZGDA 4MJ2A 4HNNA 1SZEA 1ONXA 1S5WA 3G1DA 1BG4A 3ZSTA 3A5VA 3R4IA 1Z3NA 1CPUA 1E73M 2Y7GA 5E1QA 1J4EA 3UA3A 1POJA 3L2MA 3QMSA 5I02A 1FHUA 4V28A 1FP8A 2X30A 4DJDD 4GE8A 4IGMA 5A6AA 1XLHA 3AHXA 3L67A 5IHSA 3WUGA 3NXFA 4ZSUA 3NGJA 4H9UA 3MPGA 4HYVA 1QXLA 1KXVA 1JULA 2YPIA 4JX6A 1ZHAA 1HNYA 3LS9A 1T8XA 2RKXA 1W9XA 3JRKA 3DEQA 3W72A 4IG2A 1J0KA 3KX6A 4QSFA 3NXLA 5LIKX 3W6YA 3QOMA 2C1GA 1EX1A 3LERA 2W91A 3MWAA 4P8UA 3QBUA 1EA0A 1WPCA 2VD8A 2A79A 2Z6IA 1J96A 3WUFA 1M7XA 3D46A 3VGBA 3KWXA 4M82A 3N04A 2E40A 5AHFA 1TO3A 3VIIA 3CB3A 4MKNA 3GHSA 3KXQA 5A8QA 1W17A 4NT0A 3C52A 1REQA 3K4DA 1VYRA 4AFYA 1EIXA 5FI8A 3HMCA 6A3HA 3W88A 3NO5A 4QLLA 3AU6A 1WDSA 1U1UA 4B3LA 1X8FA 2XGIA 3Q65A 4KCWA 3QZEA 1GZGA 1BGGA 1Q7QA 3DFOA 3RCYA 1G9HA 1EBHA 3PPHA 2Q8XA 1A5LC 4O50A 5JUVA 4BKNA 3GU2A 5BOFA 1IHIA 1CXKA 3V5OA 4DBSA 3B06A 4CEXC 4IHCA 1MO0A 2CBJA 3RJXA 1H1ZA 4AWSA 3LTSA 4S3KA 3MKVA 5G4WA 2PA6A 4JTEA 4AU0A 1CWYA 4GVHA 2Z7GA 4U3CA 1F6PA 3OVGA 2I16A 3STEA 3LLDA 4LV9A 3C5QA 4CQAA 2CWXA 3WQCA 4AF0A 4D6DA 3ABXA 1K7EA 3W87A 1H2JA 5A6SA 3VNJA 3OHMB 2CNCA 3MCNA 3U2EA 4MB5A 3SFKA 1X1ZA 1CLVA 3V7PA 3WD1A 3EPMA 2D2OA 1VFLA 4NI8A 3GS6A 4GJJA 4LXFA 3K46A 2VT0A 4H9YA 4A3HA 4JQ2A 1PX8A 3W38A 1EJWC 4P7LA 1VZWA 2ZQ0A 5LNUA 5BROA 4P7QA 1LROA 3BLDA 4XBJA 4TUFA 3UU0A 1Q6DA 2Z1BA 4G7EA 4GD0A 3GC4A 4N0RA 4HT3A 1ZZMA 3VD9A 3S3GA 3W1LA 1DJQA 5EA9A 2B7PA 2YDQA 1B4EA 1BXBA 1FFRA 1GEQA 2YYTA 2XSAA 2X1RA 3WQWA 1J93A 3BE7A 1OYCA 1UC4A 4DN1A 1I2NA 5F4XA 3DGBA 4IIFA 3EWYA 4GI4A 4FAMA 3CMFA 4CQ8A 4GVIA 1TA3A 4Z1YA 3GNRA 2OLAA 2CLPA 3AOFA 4TOQA 1JDFA 2IUZA 5C9UA 4TX8A 4HIBA 3P74A 4MB4A 4IJBA 3SRKA 3CZEA 2RUSA 2J88A 4EK7A 3R0KA 3U4AA 3NL6A 1JCLA 4L9XA 1TQJA 2OT0A 1EDQA 2VENA 1JCXA 1XGEA 2V6AA 5LGZA 4JGDA 1SW0A 1ISWA 1GEHA 3UJSA 2WHLA 5E93A 4MZ8A 3AXXA 1AW5A 4QHRA 2GQ8A 3H7UA 2XIQA 4S3AA 5K3VA 1F3EA 4LY4A 1AL8A 2GK1B 2GGGA 3LTYA 2O7QA 2Q02A 2PDCA 4NF7A 2DIEA 1O68A 1ZB5A 2A3AA 3M47A 3U4FA 2G5WA 5EMJA 3N73A 1IZCA 1W2PA 3H21A 1YDYA 5EL1A 5JMUA 4NUWA 4JTIA 3G77A 3IJQA 1ZBCA 3QFWA 5A8GA 3FK4A 1XLCA 2G95A 3M5YA 2GLKA 4EVZA 4UQCA 4Z1DA 2J7FA 2NZLA 4C6OA 1GOWA 2P0OA 1K03A 3M6DA 3MVTA 4Q8PA 3WH6A 5J8LA 1GVRA 2F38A 4ZOBA 4E2OA 2OTDA 1JF6A 4JTGA 3LU2A 2GYIA 5IXEA 1G0CA 3S47A 2DJLA 1JZ3A 3ZOAA 3L5LA 3OB8A 2Q8ZA 1L6SA 4IXXA 3WBXA 2DZUA 1AJ2A 3AALA 3O63A 1K6WA 2V3GA 5E09A 4PUEA 4Z0JA 3WQEA 2NQZA 2P3EA 3AS1A 1J6PA 2C1IA 1POKA 3NSNA 3LGDA 5D2TA 3HO8A 5TIMA 3M0MA 2YDAA 1XRVA 1FRBA 3ZXWA 1H5YA 1F7BA 1MDRA 3E5PA 5ABFB 3GAKA 4AH7A 4RDWA 4LX4A 3PM6A 1HG3A 4M80A 2V67A 4C5YA 1ISYA 1C7TA 1XRSA 3UYIA 3MJMA 1VH7A 4FXJA 1CGYA 5GJMA 3THDA 4NNBA 4FNSA 5G1MA 3LHZA 3TTEA 5D8ZA 1F73A 4W8AA 1I1XA 1EC9A 4FIRA 4AXNA 3MI3A 1LLZA 4NRSA 2Q09A 4E8GA 1KR1A 5AC5A 3BJFA 4N7QA 3R79A 4XZLX 4MWAA 3SBFA 2CHRA 4QP0A 2IPJA 4GUGA 1KTNA 4EPDC 4NQ1A 1OJXA 1X6NA 2PRHA 1WA3A 3HQNA 2BHUA 1UR8A 2VFGA 5LIYX 1TWZA 5ENLA 3VGDA 3IIPA 2DT2A 1QBAA 1P0DA 1SSGA 3LBOA 1L6YA 3RITA 4HCLA 2D3LA 2P1FA 3EKGA 2A6NA 4EPKA 1QOQA 1E1FA 4LYRA 5FAGA 1BF6A 1AW2A 4CUCA 1EL3A 3HZ3A 4X2PA 1E4IA 5CAHA 3LMYA 3WJYA 5DO8A 3PBUA 3H2EA 1G4SA 2FDSA 4J3TA 3TFCA 3NFUA 3HMJG 3SN0A 3MCOA 3OQ8A 3N17A 3FHAA 2JK2A 4DF2A 4NZJA 3OBAA 1L6FA 2XU2A 2CLEA 1EGMA 4HQVA 4XIAA 4ZR8A 8A3HA 1TRIA 2CESA 3MSRA 3W75A 1K77A 1QHOA 1XIGA 4Y9OA 1RPKA 4AB4A 1TMHA 1MW1A 3IUHA 1F3XA 2R94A 3W7PA 1D7KA 3RM9A 1K8XA 3USBA 4DM2A 1DPMA 2F61A 1XCXA 3GTHA 1D3HA 4NSBA 4QQUA 1DHPA 4HHHA 1OWQA 4M24A 2FJUB 3QC3A 4H2CA 1VR6A 2H9AA 5AVNA 4J3ZA 3SFWA 1QVBA 3UXAA 1EPVA 3TA9A 4MDOA 3MI6A 1Y0EA 1WE5A 4YTTA 4XZHA 2BS9A 4I9MA 1GQIA 4Z2IA 3MSDA 3LPGA 4CD7A 4YVPA 4WKAA 3O0KA 4NJGA 2VMFA 3B8WA 4WJXA 1DHKA 3PVFA 1C29A 3OYZA 3CHEA 1GJPA 1Q5MA 1XPGA 4IM4A 3WQVA 2E9BA 4IFKB 2ZUMA 4MY1A 5CZ0A 3CT2A 4B9ZA 3WLOA 4RXGA 2Z00A 3MO4A 2PD5A 1NY1A 3GDTA 1OEPA 2NX9A 4IIHA 2C6QA 1SFJA 1AW1A 3R94A 4ML4A 1VBRA 2X1IA 4EXQA 3DFNA 1E0UA 4BEQA 4KERA 1HQTA 1W3NA 4GQ0A 1CNVA 3PJXA 3ZVHA 3TR2A 4MDPA 3BURA 1M53A 4DZAA 3WKZA 1TFVA 1V6WA 3JZEA 3QHOA 1V6VA 3G8EA 1WDWA 3E9AA 1W1ZA 1WZLA 2VZUA 3BL3A 3QQ1A 1UKQA 2PF0A 4HGXA 4US5D 4G1KA 3I6EA 2GZXA 2ZVIA 4O28A 3C4UA 3MO7A 4CKQA 1ZCOA 4N9DA 3KLKA 1XG3A 3WLIA 4B16A 4W7WA 1VYPX 4R88A 3VD4A 1S3TC 5IFTA 1QOXA 2P76A 2POTA 3BC9A 3W6LA 3VNMA 1E4MM 1V5XA 3PZUA 3HBLA 2TYSA 3LSBA 4X61A 1HJWA 3ZT7A 3QGAC 3TE9A 1JJKA 1XICA 2QVHA 1XYBA 3U57A 4HZ7A 2OELA 1DWIM 4PBFA 2NT1A 3P5ZA 5DCBA 4GHRA 4PYSA 4EKJA 1ADDA 3P6LA 2VDGA 1A5BA 3OZYA 1DJHA 2FHCA 4R3UA 2L5HA 1OC5A 2TSYA 4GXPA 5HJYA 1Z8AA 4R7OA 1UBSA 2VOTA 4O8AA 4FLSA 4MNMA 2AMGA 3U3HA 1QW8A 4WY0B 3RO8A 4B5VA 3S1XA 1BWKA 4S39A 4BEUA 5TD4A 1UYQA 2XVGA 3GDLA 2R1KA 3P2VA 3MSGA 4H6KA 2VWSA 5I3KA 5CG7A 2AGTA 4MWAC 3BAIA 2NQ9A 3HV8A 1BG9A 5I5RA 4OWGA 1YEYA 1QI3A 3W73A 2B7NA 5DRIA 1JNDA 1TVPA 3RU6A 3SW6A 4JZ5A 6TAAA 2HTMA 2QAFA 1IZJA 3ONBA 3H2FA 5C9ZA 4Y9NA 3REQB 4UQBA 2WJFA 1UMYA 4K8EA 2CZVA 4HZ8A 3ARYA 4PSPA 1HVQA 3S2MA 4EP8C 2CU0A 3O8AA 4UTFA 1W54A 3W82A 1DWHM 1H7NA 2BOEX 2FDMA 2C16A 2PGWA 1W3TA 1B3XA 1B9ZA 3GTXA 2WC4A 2O56A 1JFXA 1UUQA 1VRXA 3EOLA 4S3FA 1DV7A 2D73A 1KGUA 1IIHA 4OV9A 4N6FA 4U3AA 4JKLA 3QW4B 2QUTA 3UG8A 4CU7A 4RDVA 2WMGA 3ABOA 4M6QA 3VDGA 2PWDA 2YLLA 1YNYA 3QTGA 1K4HA 4ML9A 3H4XA 4WHBA 4YNGA 3R10A 2A7RA 4DO6A 1RCXB 1E6NA 2GJXA 4REQB 3WLNA 2YZRA 1GW1A 2OMAA 2PDNA 4EF9A 4J2PA 3T4WA 1EJ7L 1H7PA 2FQIA 1KB3A 3CUIA 4DIAA 3CH0A 4QIUA 1XLAA 5HOSA 4NX5A 5E5CA 1OX4B 3A4XA 3TJLA 3QOKA 3CUXA 4AQLA 5EBUA 4CD4A 5LNWA 3WEMA 1UWSA 4UTMA 1R3SA 3MP3A 3TJIA 1BKSA 3LV5A 1VFMA 1TZ7A 4QLKA 1BQCA 2HVNA 3G1VA 1SFSA 4S3EA 2VEFA 2FZDA 2BOFX 2J79A 2QHAA 2YDSA 3BJTA 4RNHA 1EC7A 3SN4A 3CQIA 4JTUA 3VUSA 1VCVA 1XDLA 2H8XA 1R46A 1XIHA 2A3BA 3ARWA 4DPPA 1WUEA 4ASTA 4EPEC 3FYPA 5CSYA 4M6PA 2XN2A 1TV8A 3OLDA 4A3RA 1UWIA 4QG6A 4AW7A 4BQ3A 3E5BA 1A53A 1PPIA 1Z6KA 1XDJA 3R43A 5HUPA 2ZWZA 1HO4A 5IFPA 4L64A 2Q3OA 3ZFHA 3MHGA 8CGTA 2BY2A 2NQJA 1UPPA 1Z32X 3M07A 3SI9A 5FOOA 4AIOA 1FXPA 1JZ7A 3TOPA 1J0HA 1GHRA 4F9DA 2XFYA 4AWEA 2NVAA 1EGZA 1JI2A 3W86A 4L6HA 2OT1A 3AYRA 2A3HA 3EPOA 4WXZA 1JNEA 5I6SA 2IPFA 2ZTKA 9XIMA 4B3ZA 2HMCA 2GVJA 4OJYA 4LRTA 1XH0A 3GNXA 4WGHA 3TCEA 1P1MA 1ZAIA 4HN8A 3SRDA 4JTJA 4BS0A 4F40A 2Z24A 1EJXC 1V03A 2QXWA 1H5VA 4JKKA 3R0UA 1EQPA 2HZGA 4TU1A 5H6HA 2ZA2A 3VDCA 4JTLA 2YW4A 3NO1A 5K4ZA 3S1VA 3ZR6A 3ABRA 1KM0A 1TPWA 4AC1X 1OFRA 4LRSA 2X1TA 3KTSA 1OGGA 3GDBA 2V30A 2C0HA 3G0XA 1RUSA 4A3UA 3PC0A 3AXIA 4KESA 4QNWA 5AYBA 1F05A 4UZSA 3S5YA 4QRNA 1O5QA 3PHAA 3LRLA 1DVJA 3BG3A 4EX4A 4JTSA 2NW0A 3MUAA 2E5CA 3CAVA 3H8AA 3M0ZA 1H41A 3W1TA 1LBFA 3DX5A 2AGKA 2HPIA 4HU8A 3TNBA 4DYJA 2YYUA 4A22A 3DKLA 3N3TA 3TQ0A 4JYDA 3SGZA 1H1YA 4G2DA 3BLFA 3HGOA 1FWNA 3WH9A 1W9VA 3ARXA 3XISA 2BXZA 1IYXA 3KOWA 4J40A 3TSBA 3VKKA 3C2VA 1CLKA 4JPGA 1DBTA 3JW7A 2R1MA 1PUDA 1I45A 3VA8A 1EQCA 1OBAA 4H00A 3TYEA 4CQ9A 3TZFA 2VDHA 4I3GA 5BRQA 1BRLA 4GUFA 4PMYA 5LIWX 4AZGA 5C54A 4GO8A 3ERPA 4ZENA 2VRQA 3MY9A 4PMVA 2Y85A 3R89A 3TFXA 1NQ6A 4JKMA 2D2JA 3P3BA 2QJJA 3B9AA 2YJQA 4F2UA 1TG7A 1JDCA 3VZXA 1P5BA 3UETA 3L4VA 2XZ7A 1IQ8A 1ESWA 4D6CA 3GO2A 3M41A 1NM9A 1E6XM 4FS9A 3TEVA 3ZO9A 3SUVA 1UA3A 4J4KA 1X96A 2NSXA 2J25A 1VENA 3WO8A 1LOLA 3A21A 3SRHA 4Q33A 1QUMA 4LQ1A 1WDQA 4FALA 1TZ9A 2Z4GA 3KVMA 4NL1A 4RV8A 1UQZA 1J79A 1Q2RA 3SRFA 4B9YA 3QQWA 4MGGA 3R12A 3OA5A 1MUMA 1G67A 1ICSA 1CXHA 2Y5EA 4RJEA 3POHA 5D38A 3VM7A 1WX0A 4LNCA 3A22A 1TE1A 4Y9PA 5DMMA 1V6UA 2PURA 1ZP4A 3IUDA 3KL5A 4W4QA 1XLMA 1E55A 5AC4A 3WX7A 1HKKA 1YPIA 3MV11 1EWEA 1D3CA 1I60A 5DY2A 1YHTA 1VJSA 2EPMX 3A6OA 1XLGA 4LAUA 4XAPA 3NQVA 3QV9A 2OQLA 9RUBA 3CUFA 1Q8JA 2VR5A 3BSHA 1YLVA 1XISA 4A8RA 5E0CA 4RW3A 1FH8A 4FSAA 1IF2A 4EIVA 4HA4A 3S1UA 3U9IA 1BVZA 3E2RA 4Z2LA 5HNTA 4YTRA 4D6JA 1Q63A 1LQ2A 1R3VA 2WSQA 3WLKX 5HAOA 4JHZA 1IT0A 3HJZA 5I3HA 2IXVA 3LG3A 3WLJA 5E6YA 5A2BA 2J75A 2QCLA 3HG5A 2TRSA 1XQLA 1GVQA 3MYPA 3S9IA 3PB0A 3STPA 2PTDA 1Z42A 1M6JA 3GC2A 3B0XA 2P50A 1UOZA 4NZ1A 3B9DA 3WLRA 5DQPA 3LPPA 1FWGC 4M5PA 5A6BD 1E5JA 5EB8A 1TVNA 1N2VA 1QI2A 2Q8LA 4HSOA 4V1XA 1WBJA 3CIXA 3BMVA 3CYJA 5DXXA 1CCWB 1L8PA 1OX5A 4KPLA 5AVHA 2W3ZA 2DV0A 1Q65A 5T8GA 1VFHA 4D6HA 3W2MA 1IWAA 2G37A 4O17A 3UVIA 3T0DA 4RK8A 2DZSA 2VYOA 3GG7A 4GY0A 1JRCA 3N2XA 3TN4A 3RIKA 1ICQA 3SDOA 5ECUA 1VD6A 2Y8VA 3ABSA 3KRBA 1JQXA 1BGAA 1FWIC 1OIFA 4AY7A 4JIIX 3RFAA 2CERA 2QPUA 3BZGA 4S3JA 2ABBA 4JCMA 4MJ4A 1QI0A 4U2YA 4C91A 2CLOA 2X0HA 4DJFD 1Q13A 4R9OA 2FZMA 1SFLA 3AZSA 4DYKA 3EX1A 4H9VA 3I10A 4PMZA 2I9UA 1LOSA 3INPA 4I7WA 3W7RA 1RA0A 2HJPA 2XH7A 5HXMA 1QJWA 2W92A 4JHMA 3JU2A 2D0GA 1ZALA 2J24A 2JALA 4Q8VA 3UZWA 4QEEA 3IRDA 4HU4A 1CYGA 3WCZA 1A5CA 4ECLA 3EKZA 3PY2A 3WMCA 4D71A 3F4NA 4Z2JA 3QR0A 3SY1A 2D0FA 4DBWA 3T8LA 5EMYA 4W84A 3WH7A 1MWOA 5I2UA 1EPXA 1WNOA 1VP5A 1FWDC 5T9BG 1IGSA 3B0VC 7ODCA 1HKVA 1KRBC 4JIPA 4JIHA 2FKPA 3PTKA 1UH4A 2VFIA 1EUAA 4G5DA 3DG3A 5ABTA 4GZ7A 2D0HA 3KBVA 2V5JA 3TC7A 3WL1A 4ONVA 1CT5A 1QASA 4HTYA 3WL0A 1QWGA 1BSIA 3AICA 3LGGA 4WGXA 1XYAA 3U8GA 1PKNA 2WMFA 2E9LA 4IH3A 2QUNA 4GIRA 4CNSA 4JAWA 3SCQA 3LK6A 3VIPA 1JF5A 1G7UA 2HS6A 4I5RA 1X1OA 1H0IA 5MKGB 3H53A 3UZYA 3FCPA 3WNPA 2G96A 3C3UA 4K68A 3GQYA 2GK1A 4QR6A 1AZ2A 1SMDA 3MUY1 3WZ0E 3BLOA 5A5WA 3WJWA 1CI1A 3BQ6A 4GX9A 4CVWA 1JUKA 3T1GA 2O4MA 2UV8G 3TNOA 1OSEA 4I5XA 2P10A 2YBVA 3W85A 2PZ0A 3DYOA 3FW6A 1XI3A 5DANA 3TR9A 3KL3A 3WG6A 1EH9A 2QT3A 1CGTA 3T0AA 3LHTA 3F2CA 1FH7A 2AAMA 3U5YA 3SSZA 4C6NA 4LANA 5FD0A 4XO7A 3NA8A 3AUJA 3ARUA 4G8TA 1JZ8A 5FEXA 2R14A 4B5UA 2QW5A 1UKPA 4PEKA 1EEXA 3GDMA 4MG4A 2JQXA 4TVDA 2EQDA 3ITVA 2SFPA 1XCFA 3AXKA 3DGRA 1UZHA 1M65A 3CPUA 2YB1A 1UHVA 4AEEA 3KOZA 1ITUA 3D3AA 2E09A 2EJ1A 2PDUA 2C13A 3LOTA 3AYVA 3SCVA 3IVSA 5ABFA 4PMDA 2PS2A 1PTGA 1XQKA 2V5BA 4CQDA 1E6RA 1UG6A 2VR2A 7ENLA 1H0GA 4L9ZA 3PWIA 2PBOA 4XWUA 1NH6A 1ZRQA 3ITLA 4AD3A 4F0SA 2ZFAA 3OPSA 4GCXA 1UCWA 4YN5A 1K8CA 1C8XA 1UUMA 1QCWA 2PTXA 3KOFA 1PX3A 2Z28A 2G41A 1US2A 1YNPA 5D2WA 3N2BA 4ZSTA 3B8SA 2XFFA 2YR1A 5FIPA 4O4WA 1EJUC 1D8WA 4GC3A 1W1YA 1IR1A 3T6CA 4IIDA 1JQVA 1BWLA 3SADA 3UJRA 5I3DA 3UWVA 2WJDA 1XUUA 4KWWA 5T91A 1HUVA 3QV8A 4BA0A 1B5TA 1UP3A 4HK6A 4FX8A 4N9BA 4I8YA 1MZRA 3C3NA 5K9DA 4U28A 1ZU8A 2GJRA 2W62A 1Q4WA 2OO6A 4AIUA 4LEQA 4XAGA 4FOJA 3IIZA 5C7VA 3IANA 2WZTA 1VC4A 1JCYA 1L2UA 4KQNA 3NZPA 4ZQPA 3LLXA 4IIGA 1QR7A 4UUIA 4GNVA 1SO4A 1W6TA 4MF4A 2F2KA 2XFWA 2EPKX 2OZTA 4FLOA 5JH1A 3NO3A 1IXNA 3KS6A 1RVKA 2GVGA 2QJGA 4H7ZA 1UBPC 3Q45A 2A7PA 5A3HA 1IEWA 4JTRA 2O9TA 4X2RA 3AI0A 3GX9A 3UCQA 1TTIA 3BW2A 4LT9A 8XIMA 1TPH1 1XGZA 4JY9A 3DFPA 3T2OA 1ZJHA 4C6KA 3UQNA 4ROQA 4J28A 3MDWA 2OWWA 1TTPA 1PIFA 4GQRA 4Z2HA 4ATDA 1ALDA 4YS1A 3UESA 2PLJA 4ZBCA 1GVYA 4GZIA 1DKWA 4TV5A 3BGGA 2O92A 4IFKA 1H62A 4H8VA 5I78A 3MYOA 5DN1A 2ATSA 1H63A 1VEMA 4U33A 2I9EA 1QO2A 3IACA 3EWDA 3C2OA 1VYSX 4GH3A 1FWTA 3P14A 2GL5A 3QGVA 3UR7A 1AQMA 4C1NB 3URNA 4Z08A 3W84A 3UG3A 5F2GA 3WN6A 4Q4MA 5F7UA 3KDOA 2PBGA 2WBKA 1GKQA 3S0CA 1OFOA 1E9IA 3TMQA 4PCTA 5CPOA 2H8ZA 4H83A 3OG3A 4Y2WA 3TQKA 3GR7A 3ZQ9A 3IUIA 2PCEA 4YXGA 1QNQA 3WQDA 4O12A 2BBFA 3RDKA 1B54A 3QMRA 3DYPA 4L5ZA 3WQFA 2PGEA 3WK1A 1UWAA 3PZVA 2R6OA 3N2TA 5JQ9A 1JXJA 2HRWA 4PUMA 4PCNA 3L12A 5K2ZA 3CHFA 2B7QA 4TMBA 2OGYA 3DXIA 2NVCA 2X7WA 4UZUA 4XVEA 3TOYA 4J2MA 5A6LA 1UW9A 4H19A 4A21A 4AHQA 2OSXA 1JGMA 3SN1A 1E1CB 5CZJA 3MUZ1 1OGBA 3W7MA 4O1EA 1ZFJA 3A47A 2WVVB 2ISFA 3UPBA 1TX2A 1M41A 4IICA 3W74A 3WK0A 4H3DA 3VIHA 2I56A 4D6EA 1ISZA 4UTTA 3A5FA 3L68A 3GSMA 2XHYA 4WY0A 3CMJA 5HWNA 3EX3A 1EWDA 2V2DA 4W86A 1XYLA 3UD6A 2PC8A 1P0BA 3OLIA 4ZE4A 3WJSA 4GG9A 3TZNA 2G4JA 3FN9A 4O52A 1V3HA 4WRHA 2QQ6A 2Z1WA 5DBUA 3PBYA 1R2RA 1XIEA 3UJEA 4M56A 4PMXA 4DJEA 5AZ1A 3CBWA 3C56A 3RPMA 3RHGA 1UIOA 1KM3A 1QHZA 1OF8A 3PUGA 4UFKA 4H7VA 4I7UA 3REQA 3PZTA 1OFBA 2ZKMX 3A9IA 4LAKA 3WMLA 1P43A 4N9CA 4XG1A 4DPQA 3EB2A 4Q6XA 4ORMA 2DZBA 4E0CA 5M2FX 4DEFA 3SCTA 4IGSA 4FOUA 1Q7ZA 2NQHA 3MW7A 3VIMA 2PDJA 3F2BA 2PE4A 5EMMA 1ONWA 3AIUA 2BHZA 2I7GA 1P0KA 3H26A 3LUTA 4XAYA 3SQSA 3E6EA 3L0GA 4OV4A 3MBDA 4KRZA 2ZX7A 4MADA 1J11A 4UTLA 3GIPA 2INFA 3NM1A 3EDKA 3OYXA 2P5NA 1S5MA 3KRUA 3T81A 4Q22A 3LB0A 1TPUA 1K7XA 2CXGA 3EXTA 1OZMA 4IMEA 4KW2A 2Z1SA 2BGSA 3ZYZA 1JUEA 2OEMA 3W7IA 3FXGA 4WQ6A 5EMKA 2BODX 4FEZA 1TPC1 4LEFA 2W66A 3FJ4A 3WH8A 1DORA 5CKSA 4REQA 1HKMA 3JUGA 1VLIA 3EWUA 3VOJA 3LCHA 5M03A 4W85A 3KVJA 4ICCX 1YTDA 1AA1B 3PSVA 4GYFA 2PGFA 1OX4A 4FI4A 3WQGA 3IGHX 2GQ3A 3WQ6A 4TV6A 4IXHA 2NXGA 4JTHA 1NOUA 4PB3A 1SR9A 4TTGA 2CLHA 3TDFA 3W24A 1UA7A 3EAUA 2YFNA 3QC0A 3L4XA 5EY5A 2EGZA 1WV2A 1DYSA 2WVTA 1NF0A 1JR1A 1FWWA 3GM8A 4JTFA 4B3KA 4B5WA 3WFLA 1J0JA 4F0LA 4R7WA 4MNJA 3FJLA 3T55A 1OG6A 3SUSA 3UR8A 4GI6A 1FWFC 1F2JA 2WJZA 1TV7A 3HOJA 2EF9A 4HSHA 1V7YA 2VCCA 3WFAA 3M44A 4LBSA 3THAA 2O9PA 1R9XA 1WP6A 2J77A 4DBEA 1EJVC 1ELSA 1NFGA 3VO0A 1RBOB 4K37A 3VOFA 4DUVA 3WY1A 3TYDA 3OJGA 5D30A 2VDIA 2PDPA 4D6FA 1XG4A 3IWPA 2QCMA 4DNMA 1KO0A 4MZ1A 4UOZA 4H2HA 1Y65A 3BGJA 4X9YA 1FHVA 4RV3A 4RDZA 3BOLA 5DLCA 4W5ZA 4WF7A 1VPQA 3QY8A 4J3UA 3BAXA 2DVXA 1XLLA 2ZXQA 5J5DA 4D1IA 4NVTA 2X42A 3BSMA 2E6AA 2ZA1A 1Q45A 5AZ0A 4DAIA 3OIXA 3D6NA 3V1PA 4NJJA 5FSEC 3T0TA 2OOFA 1IE7C 4C6BA 1K70A 3N6QA 4KCTA 3N1AA 2O9RA 1AMYA 3KUMA