3VZXA

Crystal structure of pcrb from bacillus subtilis subap. subtilis str. 168
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
227
structure length
227
Chain Sequence
MYDVTEWKHVFKLDPNKDLPDEQLEILCESGTDAVIIGGSDGVTEDNVLRMMSKVRRFLVPCVLEVSAIEAIVPGFDLYFIPSVLNSKNADWIVGMHQKAMKEYGELMSMEEIVAEGYCIANPDCKAAALTEADADLNMDDIVAYARVSELLQLPIFYLEYSGVLGDIEAVKKTKAVLETSTLFYGGGIKDAETAKQYAEHADVIVVGNAVYEDFDRALKTVAAVKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into TIM-barrel prenyl transferase mechanisms: crystal structures of PcrB from Bacillus subtilis and Staphylococcus aureus
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords Heptaprenylglyceryl phosphate synthase
total genus 78
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature ec 2.5.1.n9: Heptaprenylglyceryl phosphate synthase.
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01884 PcrB PcrB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.390 Alpha Beta Alpha-Beta Barrel TIM Barrel FMN-linked oxidoreductases 3vzxA00
3W02A 3VKAA 3VZXA 2F6UA 3VKCA 4MM1A 3VZYA 4JEJA 2F6XA 3W00A 3VZZA 3W01A 3VK5A 1VIZA 4NAEA 4NAFA 3VKDA 3VKBA 4NAFB 4NAEB
chains in the Genus database with same CATH superfamily
4WZHA 1ODZA 1EQCA 1AG1O 1W0MA 3NOEA 3T55A 2E0PA 5HXMA 1V02A 4N9CA 1KR0A 1QOQA 3I6RA 3K13A 5I23A 3M0XA 4Z1DA 4HU3A 4QEHA 1EUNA 4G1NA 3Q58A 1NSJA 1CXFA 3C8NA 4C1NB 1VGAA 2PDKA 1XINA 1I9CB 3XISA 4XD4A 3FJ6A 3NSNA 2G50A 1KO0A 3N11A 2FZ9A 2WVVA 1OX4B 5D05A 4DJDC 3KP1A 1V6XA 2DVXA 1DJZA 4PMQA 3WQEA 1B4EA 4L1WA 4R7JA 4ADTA 4S3DA 5CJNA 4MKVA 4TX6A 3R25A 4GYKA 5C70A 1ADOA 3G0XA 3ARRA 2V2DA 5HDRA 3W7MA 2VXNA 3ATZA 3OGRA 2ZC1A 1Y5WA 1HGYA 3UWWA 1QBBA 3IGHX 3A4XA 1UJPA 2BV9A 4LAKA 3N4AA 4GE8A 2QV5A 4GGHA 4F9JA 4C7GA 5FJTA 3VIGA 4LXFA 1GVIA 2WANA 1CTNA 4O16A 3ALFA 3GKAA 2QEZA 3MWAA 3HU7A 4H6KA 1EC8A 3F2DA 4BK9A 3MW7A 3T9PA 5E0KA 3E96A 1W6TA 1M7JA 3OPSA 4H7CA 3MMWA 3UXLA 1QPNA 1TIWA 4HIBA 4YHGA 3MSDA 1OM0A 3N29A 3NXLA 1OGBA 2VHLA 3TX9A 4UFMA 1FVPA 4FS9A 2X1IA 4ZTXA 2FYMA 3HQNA 1JZ4A 4JTTA 1J8VA 2WHLA 4HNVA 2J27A 4PH6A 3LN3A 2B4GA 5I06A 1VBRA 2W0UA 5AYZA 2Q3OA 3ANVA 4ML4A 4MFDA 4URIA 4H3DA 1I2NA 4L9ZA 3O16A 1BD0A 2PGRA 3HJZA 3WFLA 1G4PA 1KNWA 1TWZA 4K1WA 4AEFA 3KAOA 4FF7A 1R5YA 1RV8A 4ACZB 5FF4A 3T08A 3MJMA 2PU0A 3B4UA 1OCBA 1K03A 1CIUA 2PEVA 3H2OA 1DEDA 3E3HA 3AHTA 1FWBC 5BZAA 3W75A 5U7SA 1S2UA 3STFA 2V5LA 5BCAA 4LY8A 4DN1A 3IJ9A 5TBOA 5CG7A 4GQQA 4LVFA 1TV4A 4WDXA 3WNKA 1TR9A 2CEQA 3G3DA 2R82A 3TU9A 3C4UA 4J3XA 1I45A 3B0XA 4DBDA 5CJMA 2YCLA 4L64A 3UETA 2ZRYA 2NVCA 1ODUA 2VZVA 1EJXC 1AH0A 1EIBA 2XISA 2PDNA 3KBNA 3A64A 3M7SA 5F1UA 2Y2WA 2BX7A 2NX3A 2JEQA 2B7QA 1PL9A 3N34A 4QG9A 1PHWA 5DF0A 3MA8A 4C1LA 3B9NA 4HT3A 1TJPA 7TIMA 1PWLA 4GX9A 4ZA0A 2IMRA 5CZTA 4FNPA 2R14A 3WENA 3QTPA 3TFCA 4Z2IA 3BSGA 3SUVA 1FCVA 2PZNA 1B3YA 1V3LA 3VDHA 1WBJA 3WLHA 1J5SA 2OT1A 4DO4A 2IQDA 3I6EA 1R0MA 1TTPA 2FZBA 3GVQA 1XQKA 3LEPA 3WF0A 5D09A 1DWHM 1CI1A 4H9ZA 4NI3A 5A6SA 3B0UX 4LEFA 3QKEA 4GFIA 1GOQA 3T6CA 1PKLA 1A5CA 3ONBA 3EWUA 2ISWA 4L80A 4UTIA 1UASA 4KMQA 4K1GA 1OZMA 3BAIA 3TA9A 1Z44A 3VX0A 4MUPA 1XISA 3HO8A 1R3SA 4WDUA 4RV3A 1XYCA 1PTGA 1ZZMA 1XLMA 4AVNA 1G7UA 2PWHA 3OO2A 1P6WA 3U4AA 3GUGA 1MI3A 1RK5A 3HPZA 4KIRA 4ZQPA 3RILA 2GWNA 3R89A 3IJ8A 3GXDA 3S5OA 2QCNA 3CV7A 4RPPA 3UWQA 4HYRA 1TTQA 4IMCA 5DBTA 2QDEA 3MP3A 1GONA 4B3KA 2CPUA 1VRDA 3FEQA 1R30A 1XC6A 2R9RA 1VYSX 2W67A 1H60A 1D8WA 4C6NA 4PZVA 4UFLA 3ARQA 1AZ1A 1OX5A 2PCQA 5J5DA 3W1UA 5CBBA 1W5NA 5I03A 1XKJA 1TB3A 2Z2BA 3O0KA 1CXKA 1QI4A 5IM51 4GYPA 1EHNA 2WSKA 4OTKA 4EX4A 1BGAA 3WKZA 3GTFA 2R91A 4HZMA 1YIXA 2ISSA 2NT0A 4IPPA 2OWXA 2YCKX 4AZBA 4WY0B 1W5PA 1ZJAA 2CNCA 4GKTA 3TJIA 1N8IA 1ZBVA 2V63A 2ZCGA 3MSRA 1M7OA 1PEZA 2I56A 3H6OA 3U2CA 3E0LA 2KX9A 3RX3A 5C2GA 1KQYA 3LI0A 4BY3A 1O6IA 3EWXA 1XD0A 2A79A 1KM2A 1UD6A 3V75A 3BAWA 1DJHA 2L5HA 4QSFA 1UD5A 1RK6A 5HMDA 4N0RA 4RK8A 2ZZ5A 2OGJA 2I14A 1EEXA 2E28A 3PUEA 4OGZA 2X0SA 3VABA 4CN6A 4NZJA 3NQ2A 3V4BA 4Z2KA 1OY0A 2V0TA 1KB3A 3HGRA 2R1KA 4WF7A 4QTGA 3P8JA 3TMLA 2OKOA 1EOMA 1QI5A 3PTKA 1X97A 3FV9A 1G6CA 3TYDA 1ZFJA 2XH7A 4L5ZA 3SY1A 2CBUA 4DJFC 1QK0A 5JQ9A 3PWGA 1JYVA 1EOKA 3PAOA 5HMEA 2E09A 3W26A 1KM1A 4OE7A 3CGTA 4U3AA 4E5TA 2OYKA 3VGHA 3ABZA 4OBTA 3TTYA 1C9WA 3WLOA 3B0VC 2IXVA 1FY6A 5EPDA 5C0QA 1V03A 3S1UA 3T40A 1O60A 4Q8QA 4IOTA 2ZC8A 4K6AA 1HNYA 4V15A 1S2CA 3TP4A 4F2TA 4KH2A 3R1ZA 3SRDA 3C2FA 3UPBA 5J04A 2BB0A 4E2VA 1YMYA 3DFYA 2IKJA 2DQXA 3NPVA 4P7RA 4ORIA 4I9JA 3UCDA 4DF1A 4HNUA 2RFGA 4Q8NA 4ZR8A 3B8WA 5H2ZA 1Q3NA 3V35A 3FN9A 4NRRA 4JTRA 4Z2JA 2ZADA 1EZWA 1WKDA 5D2TA 1CW2A 3BG3A 2V5DA 1US3A 1PHQA 3PHAA 1VHCA 4Z1YA 1JPMA 1TPDA 3SW6A 3R11A 4QQUA 1LT7A 5LXEA 2YDRA 1UKPA 4D9PA 2ZRVA 1GK8A 1UMLA 3T7VA 4DAFA 3QGVA 3T4WA 1TCDA 1FWIC 5KMYA 3QBUA 1KW1A 1OFDA 3MT1A 4ICMA 5A6BA 4FEZA 3WDPP 2NV2A 4PRWA 2D24A 4DLFA 4XVDA 3GNNA 2CFFA 1QPKA 5AECA 3PS7A 5AZ1A 2NZLA 3PZVA 4N2YA 3THDA 3RF9A 4X9YA 3UW6A 3W7HA 1XIMA 4HNOA 3CYJA 2YYTA 5BXTA 5CG0A 3MBDA 1H7PA 1Y0EA 3ARUA 4WK9A 1DQWA 1KTNA 4LH8A 2G3IA 3EOEA 1VPQA 4MY9A 4QE4A 3GW0A 4X61A 4AD1A 1NFGA 1WDPA 3B06A 3BAXA 1KKRA 4O1DA 4DNMA 3GIPA 3GDBA 4WOQA 2YA1A 5D8ZA 3TSMA 1RD6A 4AY8A 3EAUA 3AS2A 3DN5A 1SR9A 2BOEX 2GJRA 3IGXA 3H53A 4JN6A 1OHLA 2G95A 4PUNA 4H9XA 4W88A 2P10A 4NASA 2Y6ZA 4MJMA 2A0NA 4DI9A 3W7DA 4M0XA 3ABSA 4GIEA 4JQ2A 4JY9A 3B03A 3L7RA 1AZ2A 1BVZA 5HJXA 2HNEA 3N04A 5BXPA 1B3VA 3GH4A 1P0KA 3T8LA 3B97A 3UJEA 4I9MA 3N6QA 1T0OA 2DZWA 3DIPA 4V1YA 3W1NA 2WMIA 1SO3A 1IXOA 4D1JA 1VEMA 6XIMA 3HG2A 1K8XA 2CLOA 1O1HA 1V93A 3UWYA 1XYZA 2XUCA 3HTWA 4LUYA 4Y7EA 5I3GA 1C29A 3UWZA 2YCEA 2BGNE 4GXPA 2X1UA 3CZJA 3KFTA 3TJLA 3UR7A 4JKMA 2D1ZA 4Y9PA 2DUXA 3EX1A 5DT7A 2D2HA 2FH8A 3O05A 1YNQA 5A94A 4NAEA 1RVKA 1P5BA 1NH6A 1ZQ5A 4JL1A 2E1DA 3EDFA 5FKYA 5KTLA 4KQNA 1UD3A 2ZRWA 4D6JA 3MZNA 3NL6A 2DT2A 5AY7A 1RQBA 2BXVA 1JQVA 3LCHA 2PTZA 9XIAA 1ZY9A 2G3FA 1WKEA 2YZRA 1C3FA 3C2VA 1LWJA 4UTWA 4O13A 5HQEA 2ZYFA 2YSWA 3P0XA 1GPFA 4LFYA 1F3EA 3E0FA 3RN6A 2QPUA 4AXKA 1MUMA 4PUMA 3VZZA 4GIYA 5G1YA 1SSGA 2DUZA 4HU4A 2X7VA 2XGIA 2P76A 3WF4A 2GQAA 2ZX6A 1UWUA 5FF0A 2QCLA 2OU4A 1UROA 3M5YA 4XAZA 4B91A 5I5RA 3QPYA 1ZSXA 3W70A 1QOXA 2ATMA 2A3AA 4UFJA 1L2QA 1LWHA 2O9RA 3QQ1A 1TVLA 2VD8A 1SFJA 3N14A 5FAGA 3Q67A 3SUTA 2UY3A 3QYSA 2BSLA 2ATSA 2PMQA 9CGTA 3VUPA 1QAPA 3W3OA 3IJIA 1K7EA 4HP5A 3N25A 4GGBA 1P7TB 3MHUA 1LZOA 4GI4A 3T44A 4O0ZA 5DLCA 1TJ0A 3V7PA 3B8SA 2O7QA 5CZJA 4MSSA 2AGKA 5IBXA 4LF2A 3SSJA 4WDTA 1C8VA 5M3WA 3ALGA 4JAWA 5ABGA 4FNSA 3S2LA 4AYGA 3RG6A 1ESWA 1XIIA 4M1BA 3AIUA 4AHPA 1UQYA 4XIAA 2XFRA 4U28A 1LROA 2O9PA 1DL3A 3MWCA 1EGVA 5GQBA 1PB0A 1W9UA 1UPPA 4EOUA 4IXHA 1GOOA 3IK2A 3M0MA 3KTXA 3NZRA 4KERA 4UMAA 1Z32X 3HGOA 1UH4A 3KL5A 3G0SA 3ZJKA 3VC5A 5HMSA 3M46A 1IR1A 4S3KA 3CZKA 1UWQA 1TA3A 1WA3A 5D02A 1NTHA 3W84A 1JEZA 3NPXA 1EO5A 1A5MC 3GDRA 1K8YA 1UR2A 2CW6A 3M43A 1B9ZA 3I4EA 4MDOA 1MW2A 1KM6A 4E2OA 4TUFA 2BODX 1Q6EA 4WUIA 1GQKA 5C5YA 3E5PA 5LIKX 1KKOA 1E73M 2C1GA 3V18A 2E5BA 3TLLA 3GVVA 3BH4A 3UU0A 1XGEA 3CHEA 1LORA 3TTQA 4Q8VA 3LHWA 1SJDA 2H3DA 1ZAHA 5AYBA 2WNWA 3EOSA 2C14A 3WMBA 1NEYA 1VFSA 3OODA 2QMKA 1PZ2A 3MYOA 2WMKA 1QHOA 4CKQA 3B3DA 3LV5A 4JNZA 4CGTA 1XLDA 3R94A 2ZUVA 3MP5A 1UD2A 2TODA 4PN2A 2VRKA 4ZZ9A 4OQVA 1IQ8A 4M51A 4OU1A 3L66A 4QNEA 3UVAA 3PTDA 2CLPA 1HQTA 3BSMA 5TQLA 3VDAA 3ABQA 5IDIA 1QO2A 3L4WA 2NSOA 3W38A 1YTEA 2WYSA 5E6YA 4XUGA 4K8EA 1JPDX 3YPIA 4IMEA 4YVXA 4DUVA 1EBGA 4FLOA 1ZUAX 3EPMA 1H09A 3WJXA 5XINA 4F3HA 3VIFA 3KOWA 1E0WA 3IIVA 5HNUA 1MYRA 3EMQA 1CXLA 4PTWA 3RJYA 3ARPA 1ICSA 4LS1A 4AZCB 2AMXA 3WDIA 1GJPA 3NO3A 1B3WA 3MUZ1 5CC7A 5D38A 4ZODA 2WCGA 2ZBTA 5T9BG 3WX7A 3U5UA 1SO6A 4QJ1A 1H3GA 4JFUA 2J88A 3BTNA 5G4WA 4DO6A 1LLZA 4JEQA 4V28A 3BVJA 1FXPA 1GKPA 1Q13A 2J75A 1O5QA 2NQZA 3BW4A 3W1TA 4MMWA 3NTYA 5CPOA 5DMMA 3GBDA 1TPEA 3AMDA 4YTSA 3OG3A 2H8ZA 4F0HA 3LI1A 4AEEA 2J7CA 4US5A 6ALDA 2NQJA 3FJLA 1YBQA 2GGEA 1QW9A 3OEXA 4PMJA 3H23A 3R58A 4DZ5A 1BF2A 4CQAA 1A4MA 5IFPA 3FA5A 4DO7A 3AUOA 3BMXA 1XLIA 2QHAA 3AIRA 2WM0A 3PBYA 5LGXA 3VC6A 3P7YA 4GC3A 2PGWA 3VKDA 3BO9A 4ENLA 2R1LA 2DT3A 5RUBA 4ACZA 2AMGA 3EB2A 1V3HA 2BS9A 2C6QA 3O6CA 1EXPA 1JFHA 5EGRA 5A3HA 2ICSA 3AOFA 4NG3A 3N4FA 4B5XA 3FEMA 4JIRA 4UQ9A 1O5RA 1DIKA 4OBRA 1AJZA 1Z8AA 1DXEA 2D73A 3KW3A 4IMDA 3ARTA 4K8GA 4A22A 3W6LA 2D2OA 4TX8A 4MYAA 5T9CE 3W0KA 3TZNA 4LX4A 4PUKA 4O1FA 3E1F1 5J5RA 4UTHA 1AQFA 3WDQA 4DWSD 5F2LA 4HSOA 4HHHA 4IMFA 4IGMA 4ADUA 1S5TA 4RV8A 1ECQA 4R33A 4JFSA 2YDSA 1FWEC 3OQEA 5BOOA 1CGVA 3W53A 3VIKA 4PCTA 3NURA 4YS1A 2AGTA 3H7RA 5C7HA 5BU9A 3AMKA 1M68A 2CERA 1AW5A 3GR4A 2POTA 3N2OA 2WWDA 3F5JA 3QSRA 3RR4A 4GNKB 2YGYA 5FESA 5KETA 3I10A 1ME9A 2AQWA 5CPLA 5C2XA 3IJLA 3NAVA 3PB0A 5LSMA 4O14A 3WLMA 1C91A 2WOQA 2BOGX 2HK1A 4WOZA 3ZM8A 1TG7A 2PP0A 2QV4A 1QNPA 3K1GA 2QNEA 1A5NC 4WJEA 3GFZA 1IIHA 2E77A 3OHIA 2D3NA 4B9YA 3RPDA 1DJIA 2UBPC 4B4FA 2J8FA 4O8RA 1OX4A 3LLDA 4QS5A 1AUSL 3VNJA 4RCXA 3GIYA 2OX1A 2DZSA 4AHQA 2HVOA 1Q7ZA 5C71A 1W17A 3B8DA 3PFMA 4BQ4A 2WPBA 5AHMA 2J8GA 3EA3A 2V5KA 4M7TA 3FKKA 5G4HC 4FNTA 1YXYA 3URNA 2PWFA 3ZLGA 5I6SA 5CSYA 4MJ4A 3NZQA 3HMJG 1DWAM 3P5ZA 2JFEX 1DJYA 4PMVA 5HANA 4XD5A 3EZ4A 4AZ5A 1B90A 2ZDRA 2G8ZA 1TV3A 1SJAA 2Y88A 4LBSA 4C6IA 1W3KA 4AIUA 2PDJA 1H61A 4XB3A 3SCUA 4UC5A 2P88A 4HCHA 4CNNA 2PP3A 4PUDA 5HR7A 2J79A 1SZGA 2WMHA 1XLLA 5M2FX 5KZ6A 4UR9A 1VHNA 1WKYA 3B8TA 3ITLA 3OQ8A 3VNZA 1YE4A 2PC4A 3DFHA 1BFNA 3SCPA 4E4FA 5A69A 1GOXA 3K2GA 3KCOA 1QRQA 2ZRZA 3UD6A 4BWLA 2CLMA 5CC3A 2DIEA 3O63A 1G4SA 1THFD 1A0CA 3WUGA 4GINA 3TOYA 3PUDA 1E3ZA 3POHA 3HOJA 1E3XA 2QW5A 4U33A 2E68A 4DXKA 2YB1A 4O18A 1KM5A 3XIMA 3A21A 3QW3A 4MZ8A 4H6QA 3WFAA 1HL8A 4JX5A 2QUUA 4CNOA 1Z9AA 3AFBA 1ZALA 3O06A 3AROA 5C9ZA 3WQ6A 1Z89A 2ZUUA 2NVDA 2Y61A 3NQFA 2VGIA 3KL0A 4A6GA 3V5CA 3WLTA 3SCNA 4REQB 4GH1A 3E38A 4H2HA 1DJWA 3TYZA 2FGLA 2JKEA 3QHNA 3E2QA 3CHFA 3LSBA 4W5ZA 1A5SA 3RNDA 2SFPA 3E12A 5E9AA 4CQDA 1Q6OA 3CJPA 3ZQ9A 1BGGA 3IJ6A 3ZWTA 3NQGA 1F61A 3KLLA 4XQ6A 1S5NA 2F6XA 4NZ4A 3VX1A 2I5QA 5CLWA 3GHRA 4H8VA 4J35A 3LYEA 1UPMB 4N6EA 2Y1HA 3WBEA 3NZGA 5HBFA 4EP8C 1JDFA 2X0HA 4RDZA 4Y8EA 1XR2A 3H22A 2VFFA 3FCPA 1J79A 4R88A 2QGYA 4A8LA 4O1BA 4LUSB 3BCDA 2G96A 2IPGA 4FX8A 1IEQA 4JNMA 1JGMA 2H3BA 4J27A 4Q4RA 1LL4A 4YU1A 4LCQA 4FX6M 1YNYA 4BI5A 3S47A 2PGFA 2E1WA 4GNVA 4GWEA 2J9YA 4M29A 1E1FA 2QPXA 3GD6A 4AHOA 1TE1A 2G37A 1MRAA 2VD9A 1LL7A 1DIDA 5K3VA 4IZGA 4LSBA 2ZUSA 4Q6XA 3CQHA 3AHXA 3QFEA 1PX4A 2G4JA 2Z25A 3MV01 3M16A 4QR6A 5I3DA 4HN8A 3P5YA 4IJRA 4MWAC 2DY3A 1MEWA 2V2HA 1RBLA 1GYLA 1H4PA 1OB0A 2J74A 4DUOA 2WWCA 2QDGA 1BG9A 3LLXA 4NAFA 4PSPA 1HJUA 3GZ3A 3PBUA 3VDBA 4E2BA 3UCCA 1W1PA 4BQ3A 4PEEA 4XWUA 1MXDA 2Z2AA 3F2BA 3GRIA 1KV8A 1E6QM 1BRLB 3VIHA 1QOPA 5EL1A 3T81A 1TPB1 3NDZA 1RLCL 1VB9A 3CQKA 4IGNA 2FHFA 1S2AA 4W4QA 2PDMA 1TMQA 1SW3A 4FMVA 1AL8A 1GPWA 3RO8A 2HQAA 3UPMA 2DT1A 3CH9A 4Q33A 4WXYA 2BY3A 3LGEA 1NOUA 4D8ZA 4MNKA 4W8LA 3W1PA 4ATLA 1XRVA 5D9NA 3EEZA 3WNMA 4AZHA 4UQCA 2OEJA 5CBJA 3O0FA 4RZ6A 3SUSA 1P0BA 5BNKA 3T42A 3HJEA 2VUYA 3M9YA 1AH4A 3EOOA 3S5YA 3IJQA 1EFZA 4K36A 1PX8A 3LQGA 1XJBA 3MZ2A 3OTRA 1SGJA 4J2MA 1BPLB 2HMCA 2ZRXA 5D2WA 5HK4A 4CVUA 2JGQA 4NAEB 4O19A 4ZFMA 3FX4A 1JPIA 3QV8A 3W23A 3HB9A 4UOQA 1F9CA 4MZYA 3SN4A 4A3UA 4GA8A 4P7OA 3ABOA 1A0DA 4A2RA 5DMLA 1J0JA 2PDFA 3FDKA 1PXGA 2J25A 1RALA 2GDUA 1V6YA 2EJ1A 1KXQA 3M7WA 4E3TA 5D9OA 1QR7A 4J3ZA 2OQLA 2VFHA 3EKZA 4UB9A 4A8IA 3LK6A 1IYXA 3QMRA 2HVMA 2YLAA 1JCMP 3W6YA 2RAGA 1OFQA 4LAOA 4L61A 4UTUA 2VT0A 1CXIA 2X1SA 3QM3A 3DYOA 3PPCA 1VYPX 1TPWA 3CMFA 1WAWA 1FTXA 4ZL1A 3TYCA 1YX1A 2E6AA 1XXXA 3GUWA 5EA9A 3GYCA 1JAKA 1PKNA 2NQ9A 3N3TA 2EBNA 3AMCA 3TN3A 3GXMA 4JQ3A 3ITOA 1W5MA 1V51A 4JICA 3BAKA 1KGXA 4WSKA 4IQLA 3WFZA 2DZUA 1Q6QA 1GNXA 2GSHA 3U7BA 3LENA 4F0KA 1OC5A 1YDYA 1KXVA 2RUSA 3RLGA 3FLUA 3WNPA 1L6YA 3OP2A 2FJUB 4CNTA 4F2BA 1WXYA 3AO0A 2CU0A 1R9YA 3BAJA 3IARA 1Q6LA 1XLBA 1XP3A 5HMFA 3P62A 1FFRA 2J9XA 1V77A 4HN4A 2EPNA 4JCMA 3BJSA 1TQXA 3CLMA 4JXCA 2XWEA 1P1MA 5JU6A 4OV4A 3WJWA 1DJXA 1YW1A 1U22A 4EXBA 2PWGA 5D9PA 1UBSA 1QI2A 4GVGA 3LX9A 2DORA 4HQVA 1IEVA 2E8YA 2IQ0A 2O9TA 5HWNA 2OOFA 3OYXA 1G67A 2BBFA 4LBRA 5ECUA 4ZSTA 4UBPC 4PFHA 7REQA 1IEIA 1CB7B 3QFWA 1OGSA 4GPNA 2QJNA 4KGJA 4WKHA 3HN3A 2I7GA 3ITGA 2XZ9A 4GY1A 4Q8UA 4CN1A 4C1NA 4IX2A 4D6CA 3S0CA 3M0YA 3ZVHA 3W1XA 3BW2A 5XIMA 3KBVA 4PTXA 1E40A 4JTIA 4L4OA 1VJIA 3I3EA 4Z1BA 4BHYA 1CEOA 3NYDA 4DBEA 3LCIA 4G7FA 3F4DA 3GB6A 1TVNA 1CGYA 3TW9A 3K1DA 4MUZA 1M53A 4F48A 4NL1A 1I2QA 5JIWA 4JBRA 2R94A 3TW7A 3R6IA 4DUWA 1BG4A 4Q4KA 1A5BA 3N15A 4I9AA 4S3EA 1MDRA 1B3ZA 2GUUA 4C6BA 2XH0A 1EF2A 2HBVA 5DY2A 4R9XA 2Y89A 5ABEA 1PPIA 4JHZA 1VLIA 5A6MA 4RXFA 3MI2A 2REQA 4O4VA 3OVQA 3BARA 1LOSA 1FWGC 3DENA 3NQCA 1RQHA 2VC6A 3RITA 1H63A 4JTAA 5ECVA 4FXSA 3THCA 3NL3A 1W2PA 3W22A 1QFEA 1JCJA 4MJ2A 1H1YA 2BHZA 4PCNA 1R3WA 1XICA 1BF6A 3STPA 1X1OA 1ZPTA 3FSUA 3WD2A 4LAUA 1M9HA 3SDOA 2VELA 3D5HA 3WJZA 4XBSA 4Q8TA 1V6UA 2YL9A 3BGGA 3H2CA 4O54A 3WBYA 4M3PA 4RZBA 3GU9A 2FH6A 2D69A 5TAOA 3FAWA 3WEZA 4TVCA 2VX7A 3B40A 5CPQA 1WDSA 9XIMA 2IPWA 1QO5A 4QDWA 4QJ3B 2NUYA 4XKYA 4NJHA 1VFUA 5A8MA 2AAMA 2OTDA 3LGDA 4CD7A 3AHVA 3AIWA 1RD5A 4GJ1A 1NOFA 1EB3A 4C6MA 2QIWA 4AYSA 4PB5A 2OWWA 3B8VA 3A9BA 3QGKC 3GXNA 3MI3A 3QJAA 4OECA 3WLLA 3EB4A 2V68A 4UZSA 1GHSA 3NYZA 3TH6A 4HK5A 4AUBA 3K46A 1MZRA 4AZ7A 4LNCA 4YXGA 3A47A 4AF0A 2CHRA 3ITCA 3NA8A 4RUBA 5FL1A 2YZ5A 4XZMX 1UB3A 2FZ8A 1OCJA 5F2MA 1KD0A 2GZXA 1V0KA 3K8MA 1FUYA 2DV0A 3WIJA 1VC4A 3MPGA 4ES4A 3SIZA 3CEUA 4CEUC 5HATA 3UFYA 1RVGA 4D6FA 5T8GA 3QQ0A 3QC0A 1QWKA 2JKAA 5BMXA 3WF3A 1EJTC 1NFPA 4HSHA 1GW9A 4AIEA 2P50A 1P0NA 4US6A 1F3XA 3WNOA 1A49A 1WZKA 2G3NA 4H1ZA 1M3UA 1Z69A 3BDKA 4H9YA 1M41A 1MW0A 4LNYA 3RHGA 3L5LA 3W07A 4JKLA 4QP0A 2D2JA 3RXZA 4DYJA 1GTHA 5DMNA 1W8SA 2OCZA 2WZEA 3KWSA 1DWIM 1F4AA 5G2WA 4CD6A 3A3XA 4RNHA 5FJIA 3DFOA 1E0TA 4DUXA 3I7SA 1UQZA 3U2OA 3ARSA 1W3JA 5CBIA 3E74A 4U31A 4DBWA 2WHMA 3BXWA 3OA5A 3SRKA 1BYCA 4GJJA 4K38A 5CSRA 3CB3A 4M6VA 3V3WA 2CIPA 2VZTA 4PCFA 2XH4A 5BW6A 3NQEA 2CBVA 4JN7A 5JXQA 2OEMA 3GTHA 5GVJA 1SUXA 3RGTA 1H11A 2X09A 2YL8A 4YTTA 3CK5A 3GNOA 4F0LA 2HZGA 3TSDA 1D3HA 1UKSA 3VFCA 4GRSA 3CZ8A 4NI8A 1E1EA 1DORA 3M0KA 5I3JA 3FFSA 4IFRA 1M01A 3VZXA 3MO4A 2HXUA 1JI1A 3LGGA 1OIFA 1P6CA 2W4XA 3UZ5A 1WDRA 2RDXA 4RNIA 1F6KA 1T40A 3KBMA 4O57A 1L8PA 4IT1A 1LM1A 1PCWA 1XBVA 5JH2A 3TQ0A 4FLRA 1U2YA 3M0ZA 1TREA 2EO7A 4Q7NA 3GTIA 5AYXA 4Q22A 3R43A 4IMGA 4YYCA 3DKLA 1HO1A 4DNHA 3S2NA 3LY0A 4DPPA 2ZZ1A 4XTDA 3TV8A 4P5UA 4TVDA 4RW3A 5FL0A 1GQIA 4HPHA 3IWPA 3A4JA 1O95A 3NQDA 3TONA 2QQ6A 3QPZA 3UF9A 4AQLA 4KWWA 3USZA 4GUGA 1H2JA 2AKZA 5GPRA 3K4WA 1FCBA 1JNEA 2ASHA 3JZUA 4P61A 1RY0A 3KTSA 1TKKA 3S2CA 3N18A 1XFCA 1FDYA 3A9IA 4U4MA 1TJRA 1XRTA 1DP0A 2VGBA 4CU7A 2VVSA 3MUIA 1AD4A 4RKAA 1G1YA 1DKWA 1W54A 5CGTA 5REQB 1FWNA 3W7CA 4MOZA 3M1ZA 1KCLA 4Z2LA 4KCVA 3MSGA 1HJXA 1SFLA 4FR1A 2DUAA 2WXDM 4KRTA 3UA3A 2E4TA 3TVAA 3S8HA 3NFUA 3L2IA 1BWKA 2UY5A 1OYAA 1YKWA 5HQLA 4PMZA 3DYMA 2E25A 3V1HA 4AD4A 3B8IA 1L6GA 3SRHA 2QS8A 1G01A 1MXGA 1XYBA 2DZBA 1WXZA 4L1XA 5A6TC 4UR8A 5MKGB 5FAJA 1G7VA 2B7NA 1E0UA 4LVGA 5D37A 4XD3A 3S5NA 5EYWA 1I2PA 1TZ9A 2OG9A 3C0JA 4MHBA 1KBIA 1N8WA 2ZICA 3AYVA 4S39A 1F76A 7PTDA 4NZCA 1BKHA 3PZUA 4HOXA 4C5YA 4OZOA 1VD6A 2GOKA 3LCGA 5H1WA 1GZJA 4HD5A 2OVLA 3ZR6A 6PTDA 1C92A 1UOKA 4J5NA 2EKGA 4LWWA 1IEWA 5H8UA 4A3QA 1ZRQA 5I3HA 2HE5A 1NY1A 4DB7A 4JIHA 1W91A 1JF6A 4XBKA 4V2XA 4AWUA 1MW1A 3AS1A 5LA2A 3RPMA 4A8RA 1FOBA 3MCMA 1F7BA 3DG7A 1K4GA 3VO0A 3WK1A 6XIAA 1Q8AA 2Z1WA 2ZKMX 3DZ1A 3WL1A 3MKVA 3URQA 3R0UA 4Z0SA 2WVVB 5A8QA 4B5UA 2GFTA 2X42A 1EX5A 5HNRA 1NF0A 1WX0A 1S1RA 1FX6A 1JAEA 2IQTA 4U5KA 1ECEA 3BICA 4R34A 3AI0A 1WZMA 4JIPA 3H21A 2PTDA 1M6JA 3K8KA 1XRFA 4PCPA 2DSUA 1HKMA 3TC7A 1KLYA 3ELFA 3JU2A 4FA3A 4X0VA 4L9XA 2DW7A 2NW0A 1H62A 1X98A 4P8VA 2REQB 3CZGA 4TV6A 3GNXA 3LOTA 1XDLA 3APGA 3T1GA 4PMOA 1UUOA 4LF1A 1XFBA 1AQHA 4QQ3A 4E4UA 1VFHA 1WOAA 3VNLA 5BROA 3ONCA 1DPMA 3C52A 4S2CA 3CXOA 4ROPA 1Q6FA 4AD0A 1SMDA 2QAFA 2WW5A 1K6AA 1A3XA 2INZA 1DV7A 2OZ0A 1R85A 5DCEA 2E40A 4QLJA 2V6AA 2F6KA 3DERA 3UESA 3MVIA 4IFOA 1ADDA 4LUIA 1VJZA 3U3HA 1JZ5A 3RPTA 4L6HA 4QX4A 3DU0A 1XLCA 4HU8A 3HV8A 1XH2A 2WPGA 2Z0IA 3QGAC 2VQTA 1CWYA 1XIGA 2EPOA 1ISXA 3L5AA 3WH9A 4LVBA 3AIQA 4IFKA 4KCUA 1LTDA 4BA0A 4G6CA 7REQB 3VE7A 3RMEA 4EIVA 3AALA 3DFQA 5H8MA 2JE8A 3FKRA 4RE2A 3SUUA 3LBCA 1V3IA 3KRSA 1W3TA 2DIKA 1GOWA 3STGA 3I6TA 2VFEA 5HWMA 1AQMA 7A3HA 2CWNA 3GO2A 1KFBA 5AOUA 2J7EA 3SY8A 3SFKA 4WJXA 3M6DA 2ALDA 3LRMA 1EH9A 4BKNA 5D9MA 3AMLA 2VEKA 3G8EA 3FS2A 1BYDA 4HNLA 4NIRA 1C7TA 4Y9MA 3L9CA 2R1PA 3WK0A 3OZPA 2QF7A 3AXXA 5ABFA 4IICA 4RE3A 4MFEA 4AZIA 1ZP4A 1F6YA 1ONEA 1GGOA 3I65A 2O56A 3KZPA 1EJRC 1W56A 1QXLA 3QW4B 2A1YA 2O55A 1J5TA 1TWSA 3AHZA 4JTCA 4YTRA 4J1OA 1E4NA 4BWLC 1QW8A 3N6JA 3QEZA 4PBFA 3AIEA 5DBUA 3G1VA 4FO4A 1W1B1 3C56A 3GNRA 4C6PA 4KIEA 3LLFA 1K8ZA 2VTFA 4YHEA 2GGGA 3U9IA 2EQDA 4QJ5B 3MO7A 3QMTA 2F9RA 2G97A 1TV5A 4P7NA 3ZT5A 1DXIA 5G5IA 1NU5A 2VFGA 4YTUA 5CGQA 4O12A 4XZIA 4LAZA 3WH5A 1K1DA 1VFLA 3TCEA 1M7XA 1P6BA 1HJQA 4C7FA 3W6MA 5TF0A 4HVXA 4JN8A 4LS0A 2QCMA 1K77A 1JRBA 2VEIA 1PJ9A 2I1OA 2B7PA 1GHRA 1QNVA 3CUJA 1VEOA 4KESA 4HNCA 1ZCOA 2TMDA 3QC3A 3KDNA 1G9HA 2VCCA 4B3ZA 3MB9A 3OIXA 1V8EA 1NP2A 2VC5A 3GXIA 3W76A 1ZBWA 1ICQA 2XHYA 4G9PA 4JHMA 4N9BA 3GNPA 3PJUA 6REQB 4OUIA 3OZOA 3SAZA 3CUFA 3LG3A 3PBVA 1XIHA 1R2TA 1IT0A 1RXOB 3GSMA 3GXFA 3TWBA 1W3NA 1BWVA 2PWDA 2VOTA 4IIHA 2C0HA 1X7IA 1KTBA 1XSJA 1Z48A 1HW6A 2PGEA 1PX3A 4I8DA 1VFTA 3GU2A 3M5ZA 2P53A 5K9DA 1KBLA 2WQPA 1NQ6A 2FFIA 1E1CA 1VJSA 4MF4A 3NUKA 3TYBA 4W9TA 3ZXWA 2A21A 3DCPA 2IKGA 4LT9A 4PUUA 3ZZ1A 2X1TA 3W1MA 4LV9A 2PDXA 5DEZA 1RBAA 1YADA 4GQRA 1SPQA 4O1AA 3PWIA 1XIDA 1GJWA 4L7ZA 3E2RA 2ZUWA 3L2LA 5DCDA 1XX1A 3MVTA 1TO3A 3VOHA 1UKQA 2QJMA 3JS3A 3A3HA 3VM7A 4ICNA 3WQCA 1VPXA 1SJBA 3PFRA 4J7RA 3SFWA 1O68A 1DTUA 4W86A 2V38A 2FDSA 4AH7A 5DCBA 3CWOX 2V5BA 2ACUA 2GLKA 3S3GA 2BVDA 1D7KA 5CAKA 1W8GA 3TZFA 1FWDC 4JTLA 3FA4A 1GVRA 4XZNX 4FSAA 3WD0A 2FZNA 4K68A 1Q6RA 3W71A 1XUUA 4GLEA 1MUCA 3TNBA 2QVHA 4CQCA 2YDQA 4N7QA 4QE5A 4EVZA 1JGIA 1B54A 1JDDA 2XINA 1E6RA 2X7WA 1KFWA 1MW3A 4HMNA 2PRHA 4Y9NA 1EYWA 2EAWA 2ALRA 4LC8A 4LUSA 5DXXA 1XH1A 2Z28A 4D71A 5AHNA 3G24A 1O94A 3WUFA 5ABFB 2A4AA 1W3IA 3B9DA 3FW6A 2VZOA 3AAMA 4BCEA 1TCMA 3VVGA 3PULA 4KPLA 2PDIA 5I3KA 4D6DA 1XG3A 3NQ8A 4ERAA 3REQB 1QHPA 2HVNA 3E02A 1EP3A 2VR5A 1L6WA 1YRRA 2B0MA 1OZQA 3THUA 3PTQA 3QZAA 2CXEA 4ZCWA 4GXWA 2ZZ7A 2IW0A 3CTTA 3C3NA 1S2WA 1XKYA 3INPA 1Q6DA 3NCOA 3EWZA 3DESA 5I02A 3F03K 5T91A 2OSWA 1GORA 1ITXA 4HPJA 2VR4A 1LDCA 3S6OA 4IG2A 3ZT6A 2X41A 3VE9A 2FVMA 4G8TA 2PDQA 3POCA 5E1QA 4MB3A 1ZAIA 4D8LA 1L9WA 5KSWA 3F2CA 4O0KA 1Q5MA 5DRCA 1JL8A 3VD9A 3KL3A 1CECA 3HFTA 1P0EA 5TIMA 4PMXA 6TIMA 3W2MA 4IIEA 3HPXA 7XIMA 5CKSA 4HA3A 5I0DA 1W3LA 1B5TA 3GC2A 2PDBA 1F8IA 1SR0A 5GNXA 2NUXA 3MP4A 3DEQA 3U48A 4AC1X 1E9YB 5EBAA 1VENA 1VF8A 2FPVA 3AYSA 3CL6A 4XIMA 6ENLA 3KDOA 4JNYA 3LCFA 1VH7A 1XSKA 3UBPC 1E51A 1NARA 3A4WA 1DHPA 3NDYA 1VZWA 5IBXC 3W27A 2XVGA 1A53A 1XLHA 2DJLA 4IP5A 1YDNA 2PLKA 4IQDA 2FGZA 3DHUA 1K6WA 1PAMA 1B1YA 1ITUA 8CGTA 4WXZA 1X6UA 1NAL1 2ZX9A 1PBGA 1XQLA 4JQ1A 5KEZA 4K3ZA 2OT0A 3KUMA 1TQJA 3A24A 4ADSA 4FOJA 3EX4A 3FA3A 4DF2A 2FZDA 2VWTA 1TPH1 1UP0A 1WE5A 3G1RA 5A6AA 5CLTA 3TTEA 2GK1A 1NDWA 1PTDA 3S1GA 2BHYA 5KITA 3ZFHA 3RU6A 4UQDA 2QCEA 3C5QA 2WV8A 3CV2A 1JZ3A 1T41A 1QK2A 1ZCCA 5JIPA 3APTA 1Y65A 3BCFA 4GBDA 2DT0A 4CN4A 2VC7A 4J3VA 1AA1B 1D3CA 3BLIA 5BRBA 1AVAA 3SCRA 2CZDA 3TOPA 3QV7A 2EXOA 1V6TA 2OR2A 4AX6A 4FNRA 4U5IA 1JD7A 1LQ0A 1V3KA 5M5DA 3TIMA 4M8UA 3Q65A 2WNZA 2YW3A 5KINA 5L9FA 1N82A 4R9OA 4JYEA 4X63A 3W87A 2VKZG 5DX7A 5IFTA 1ISZA 4I3GA 2XWDA 3MCOA 3UXAA 3D3FA 4EWND 1XC4A 3P61A 4J3UA 1YTKA 4Q4MA 3W02A 3LXCA 3MUXA 4HHMA 3N6HA 3V1PA 5E0CA 1D7FA 1TMLA 5C6MA 2HK0A 2YW4A 5JUVA 3QQWA 4LW7A 3OOQA 4K8HA 4JQAA 1R3YA 1UR8A 4Z2GA 2ZDSA 3LPPA 1NDYA 1PYMA 1TSIA 3NQ6A 5A1AA 3VGDA 2A6LA 1JUBA 1JULA 3WEOA 4MZ1A 3VNYA 3DHFA 1MSSA 4HA1A 3CZLA 2W3ZA 3L0GA 3UY8A 3AXIA 2C7FA 3LTPA 5LIWX 1U1UA 3N1AA 2QIIA 1IWBA 1KLZA 3ZT7A 3H2FA 3C3UA 4ZXOA 4MPQA 2GSEA 4K37A 1E5JA 2WB5A 2JKPA 2OPJA 1QUMA 1QNQA 1FHVA 5F4SA 2TRSA 4PYSA 2WC7A 3U4FA 1GVSA 2C1HA 4AXNA 1HG3A 1RZMA 3BUVA 1ONRA 3LBMA 4HPGA 3BLDA 2DSWA 5EY5A 3RLUA 5AVHA 3WQFA 3CUIA 3T8QA 1MUWA 3CTLA 2OXNA 1Q63A 5C55A 1AMKA 4U2ZA 3M4HA 5AHEA 3VK5A 4AIBA 1JG9A 4GD0A 1J0KA 4LYKA 2C16A 1YBQB 3WELA 1R3RA 4ZB0A 3W85A 3L21A 1Q65A 1JCYA 3G3MA 1HL9A 5LNSA 1LLOA 1F74A 3LHVA 2Y5EA 4UR7A 4EAMA 3BANA 4F40A 1O66A 1K9FA 5HULA 3N2MA 3LTYA 3BV7A 4UNKA 1BKSA 4IXXA 5CAHA 1EBHA 3ARYA 1B31A 4OJYA 3SGUA 4B90A 4AU0A 3TW6A 2FHBA 1WUFA 1VBGA 3PBGA 3K30A 4NJGA 2YOCA 4QFUA 2G3JA 2ZTJA 4DWSC 3NGFA 4ZOAA 4GMEA 4ZQMA 2QCDA 2ISFA 3MDWA 4M5PA 1GZGA 3UNTA 3RUBL 1VYRA 1JJKA 4NY2A 2J13A 4LV4A 2GJLA 3LTSA 3MMUA 4NYYA 1X1NA 1XIBA 4KF1A 3G0UA 2YYUA 1UIPA 3F4VA 4ZB5A 5EMMA 5C9XA 3DAQA 3K8LA 1F3TA 1E43A 2D0GA 4UQBA 1R46A 5MF5A 1J11A 3RCNA 3GDKA 1A5OC 4HZ6A 1V0LA 2Y7GA 4LRTA 5LIYX 3WLSA 4ZVJA 2XIMA 3MANA 3BOFA 1DHKA 4RE0A 3UPWA 1UBPC 1WDDA 4QAIA 3G77A 5FEZA 2DSKA 2V3FA 1TZZA 5A6JA 4OOUA 4XV0A 1UWAA 1YXCA 5C9WA 4TIMA 5I78A 1WPCA 3GC5A 4UQAA 2V3DA 2RJHA 5A8NA 3GR8A 3WH8A 1ITCA 2W9MA 4C6QA 4GQBA 1A50A 1AD1A 1YTDA 1V3JA 4D8AA 5PTDA 2HISA 5D33A 1AQ0A 3RM8A 1U1HA 3EMCA 3P93A 3U5YA 2NQLA 4LUJA 1OCNA 3P82A 1RP8A 3E49A 1R2RA 3TR9A 3VGFA 1JYWA 3H2AA 1J6OA 1JF5A 4DJFD 3IIXA 2X2GA 2VP8A 3VD4A 4HMDA 3BLFA 4DHGA 3C61A 3P74A 4NXSA 4C6OA 4CQBA 4F0RA 4HNNA 2J24A 2BDQA 4DO5A 4CD5A 2ZVIA 4ONVA 2QJJA 4NNCA 1HJWA 1KGWA 3UYIA 5A95A 1E6ZA 1HKIA 3FXGA 3TC3A 1OFRA 3KHDA 1J2WA 1WDWA 3NQ7A 1S5MA 2AQOA 3W01A 1R3TA 4CUCA 3UR5A 3S46A 4WY0F 4A2SA 2B7OA 4NJIA 3M0VA 3FYYA 3AHYA 2IPFA 1NWTA 1QATA 3LUTA 4GCAA 3VD7A 4EPDC 3BK0A 4R7OA 3EWWA 1L2UA 1ZB5A 2QF8A 2GGJA 1I2RA 3SI9A 1OF6A 1BYAA 2YBVA 5I77A 1UIOA 1WQ5A 4XSMA 1B57A 3U2ZA 4ERGA 3TQPA 2JQXA 2WJFA 4FLQA 2A6NA 4KEZA 1ADSA 1IXQA 1GYMA 1EC9A 3AS3A 1PO9A 3CC1A 1TV8A 4HPNA 4KEVA 3KZSA 1Z41A 3CO4A 3PK7A 1CENA 3NR0A 4DY1A 3IJDA 4GVFA 1FP9A 1LCOA 1OK6A 2BY1A 2FB2A 1MQPA 5AZ0A 2JBMA 2NXHA 4UXDA 3SSZA 1XLKA 5HJYA 1AMYA 1KV5A 1FHLA 4RW5A 1MWOA 2OSYA 4NXKA 3A22A 2ZVRA 4UNIA 3HM7A 4ZXLA 1Q6CA 2ZA2A 1ZBKA 2YA0A 2XIQA 1SJCA 3E0IA 3R2GA 4KKXA 3MQTA 4F9DA 1NDZA 2QULA 1FWAC 1J96A 1TPC1 4HA4A 4E4PA 3UGVA 4DPQA 1DIEA 1YPXA 1W3HA 5CXPA 4DXXA 3P8IA 1W5QA 3T2QA 4AMCA 5FEWA 3LMYA 4AAJA 1QMLA 1H1ZA 1SW0A 4O11A 2WJZA 1QBAA 2ZE3A 3EWCA 2TYSA 3N13A 4ATWA 5FI8A 4L4MA 2EPLX 3G6LA 4YCPA 2BG5A 4FLSA 3ITVA 2VJXA 4C6KA 4OVXA 1GVOA 4AISA 3DYPA 2HS8A 1XLFA 2GQ3A 3N9RA 2C8NA 3W1LA 3VMOA 4EANA 3C8FA 3FSTA 2CKSA 2J62A 2YKKA 2VL4A 2X1RA 1ZENA 1XD1A 2CLLA 3CQJA 4DZAA 4A29A 4B15A 4LUTA 3EX3A 4JS3A 4WIWA 3GAYA 5L6UA 2HSAA 4FALA 4M81A 3NGJA 1N7KA 5AN7A 4RR4A 3PPFA 4RNFA 3GC4A 4OT7A 3RLHA 1A5UA 2ODOA 2GYIA 4PBGA 2ZZ6A 4RDVA 2QYGA 4OUEA 1MO0A 3KEHA 1K4HA 3S1VA 3EKLA 2UWFA 4YIWA 3CYVA 4IUGA 4PC8A 4UTLA 4NU7A 2I9EA 3F4WA 2ZXDA 4CQ9A 3GG1A 2RDUA 2DVUA 2PS2A 1NFBA 3BAYA 2C15A 4EK7A 6CGTA 5LHFA 5BOFA 4KCWA 1CGUA 3APYA 4OHQA 1JD9A 4MDPA 2Q09A 3FIGA 3LSCA 5LNWA 2NLIA 1TPUA 1WZAA 4GUFA 3W7QA 1TFVA 3COTA 2R6OA 3PNUA 3CUZA 3WQDA 7ENLA 3FJ4A 1E4IA 4GUIA 2RGMA 2HROA 1JYXA 1C7SA 1TWWA 1FH8A 1ZL1A 1ALDA 1QNSA 2WQDA 3OVPA 3UP8A 4E8DA 1V08A 4QHRA 1CGWA 2QGHA 1KRMA 2XTKA 1MQRA 1VAHA 3LXBA 3R8HA 4ZO8A 4YVPA 4YVVA 1IGWA 1TYGA 3UXDA 1JZ2A 3UEQA 5JVLA 3VIMA 3D3AA 1UW9A 5A5WA 4QXIA 3V0UA 4JTEA 2ZQ0A 5HWJA 3ZOAA 3SGGA 2FZMA 4LCRA 1KTCA 3ZR5A 4Q4OA 3GBEA 4FX7A 3BCJA 3HGSA 2Z1KA 3HZ3A 2EPKX 4DYKA 4LBUA 2H9AA 4O17A 4L56A 2PF0A 2HS6A 3H4WA 1B3XA 4XAPA 1T8QA 1OFPA 1TV7A 5EMLA 3OBKA 1WO2A 5D4YA 3SCOA 8A3HA 2VGFA 4TQTA 3K5XA 5AC6A 4QRNA 2YXOA 1SMAA 4K39A 4DLMA 2DGAA 3W2JA 4PB4A 1NM9A 1TMHA 3MU7A 1HJSA 3T2OA 1IT7A 4JTFA 3NQMA 4XG1A 2VDHA 1J0HA 3WDHA 3L5MA 1V7YA 1POJA 2J77A 1R87A 3NL2A 5CC5A 3F1QA 2BXZA 3IPWA 4XX6A 3KX6A 1O5KA 4O8AA 3AU2A 3E0WA 4PTMA 4QISA 2W61A 2E6DA 1AW2A 2VR2A 4Z2HA 3S1WA 4R7WA 4AG0A 2DQWA 1GZ1A 1LOLA 1XG4A 3MJYA 3SURA 2NX1A 3OU8A 1F05A 4O4WA 2DW6A 4JX4A 3PB2A 3M64A 4H6RA 3QRHA 2OYLA 3MUY1 2YJQA 3O2LA 1J93A 4DZIA 3GXTA 1R2SA 2XGBA 1NDVA 5KZMA 3ITTA 1KWGA 3WLRA 1MEIA 4TTGA 1Z42A 2CZFA 3VOCA 2OQYA 3L4YA 1TWDA 3SGZA 1J0IA 1K7FA 4M7SA 2J8TA 1HVQA 1J4EA 3JZEA 1UC4A 1OG6A 4NNBA 2VX4A 3N12A 4JTUA 3CL7A 1OADA 2VURA 4KFOA 1Q85A 3AS0A 4IPIA 1HF6A 2HV5A 3DOPA 2HWGA 1HVXA 4HK6A 1X96A 4PMYA 4QG6A 3LNPA 4B2DA 4DVOA 2VZSA 3VKKA 5A2CA 5AVNA 3GTNA 1G4EA 4PGLA 4EXQA 1OT1A 1X8FA 4JYDA 4QAWA 5E09A 1TRDA 2A7NA 3LA4A 4V27A 4IGHA 2GWGA 1T96A 2ACSA 1XW8A 2RHGA 2CLIA 1RPXA 5M1TA 1V6WA 1T99A 3GU1A 1CNVA 3ES7A 3W73A 5C54A 2YFOA 1GEHA 3OZMA 3IRDA 2HNHA 1SW7A 1GT8A 3W86A 3O9NA 1GW1A 1DJNA 1IEXA 1E70M 2OO6A 4XKYB 3VKAA 2BASA 4PE8A 5CZ0A 4KS0A 3BGAA 4O28A 3MUAA 1BVNP 2KAUC 3M5XA 4Y9AA 3V36A 2OWCA 3IV8A 3RFAA 1UH3A 3AMGA 1HKKA 2Z26A 3FVDA 4S3CA 1E6XM 3LD5A 4UTTA 3ZJ6A 4LEQA 3ERPA 2BLEA 2F6UA 2VCAA 2RJGA 4H9MA 1U33A 1W2VA 4X3ZA 1KGUA 2WCSA 3AJXA 2BNJA 3O6DA 5K4ZA 4WGHA 1G0CA 3DUGA 5DO8A 4I7VA 2DP3A 3GZAA 4HCLA 3GG8A 5EMYA 4Q8PA 2VYOA 2ACRA 1ZJHA 1X38A 1P7TA 2A2IA 3G6MA 5BYWA 2Z7GA 1H5VA 3BJFA 4W7WA 2PDUA 3EOLA 3PTMA 1GG0A 1FH9A 3G1YA 5G1MA 4FF5A 3EBVA 1S2TA 2DVTA 4O15A 4ZOCA 4B2DD 3IUHA 1H41A 4LANA 4GUHA 3MC5A 4WRHA 3ZYZA 2ZIDA 4ERIA 3PWAA 3A12A 1E0XA 5AHLA 3W2LA 3ZLHA 1PZ1A 1VKFA 4GYFA 5CC6A 3CNYA 2AAAA 2BVYA 3GQYA 1UUMA 2FGBA 2OJPA 1GOMA 3HMCA 3H55A 5C7VA 1GVYA 2Z1VA 2BGSA 2A85A 3VNKA 1SSDA 2D22A 5HJLA 1Y5XA 4X0NA 1BTCA 1TPVA 4K7YA 1QCWA 3NIYA 3KRBA 3GH7A 1GVEA 2X30A 2H6RA 3W9ZA 1OVDA 2X05A 3HQPA 1K9DA 2BZNA 4J28A 2V9DA 2Z6IA 1UD8A 1XLAA 1K9EA 4MY8A 3DHDA 4O52A 3IGUA 4EF8A 1BHGA 1PVNA 2X16A 3EWDA 4MIMA 4RDWA 1S39A 4O0QA 2VOMA 2GDVA 4M19A 1UUQA 1GWJA 2WBKA 3GVGA 2PE4A 5EMKA 1ICPA 3L4TA 4I90A 1HL2A 3LB0A 1SZEA 3IAPA 3LHUA 1XYLA 1K3UA 1UKTA 2WLZA 3BPWA 3BWWA 1E6NA 2AQVA 2D20A 1Q4NX 4KEUA 2EGZA 3KVJA 3CZEA 2WSRA 3BLEA 4XZ9A 3IANA 5I3FA 4B5SA 2W79A 1NQKA 3DHPA 5CSSA 3O8AA 3VCNA 4KCTA 4PL1A 1KCZA 4ZEPA 3TKFA 2V2CA 1CB2A 4FOKA 4TVUA 4RXGA 2Y8UA 4DJEA 1J0YA 1TRIA 1J12A 5GJMA 2BY2A 4WKAA 2XDFA 4ZO9A 4IG2B 2IXUA 1HFBA 2OOGA 2VUNA 4IL0A 4F79A 3N2XA 3LM7A 2UV8G 3NDOA 4QS6A 3SEPA 3L12A 3R12A 3SN0A 2VC9A 3VGEA 2FJKA 1E6PA 3KRUA 4O1EA 1EP1A 3VD5A 4J3SA 1WXJA 1LOQA 6A3HA 2VVNA 4AY1A 1PIFA 3SCWA 4LVDA 3UR2A 2PDHA 2OLHA 2VENA 3MTWA 2XSXA 4GI8A 2W6RA 4QNWA 2G4FA 1EDTA 3BOXA 4X60A 3ZVIA 1NELA 3ISIX 4DRSA 3LPGA 4PBEA 1OEPA 1ZTVA 1EO7A 4Z42C 4PRRA 1K8CA 3ARVA 3WNNA 3R79A 1EGMA 1HN1A 4AVFA 1KQZA 3I7QA 5CGMA 5T26A 3VDGA 3W1RA 4HHLA 1UP3A 1TA3B 3PG9A 5LGZA 2GUBA 2GDQA 4GY7A 1ZHAA 5C9UA 2HJPA 2TPSA 1X6NA 4LYQA 1UCWA 3TEVA 2A7PA 1UG6A 2AKMA 1XI3A 3DC8A 3QKZA 4W7UA 5B7ZA 4XAGA 4KWUA 4L1GA 5LA0A 1IV8A 1RSCA 4JIEA 2GUYA 1RUSA 2V3EA 1T8XA 1TX2A 4JTKA 4WSHA 1XYMA 2BMBA 2OMAA 3GVRA 2D0FA 2XVLA 1JCNA 4LUTB 4IISA 1UWRA 2WMFA 4MNLA 2IKIA 4C6DA 3E0VA 1LF1A 2FHCA 3DKJA 3SUWA 3CAWA 4F0MA 2C0AA 1AK5A 2YCJA 3PM6A 2VNCA 3CMJA 3GIQA 2PDCA 1JR1A 1XCFA 4H04A 2VWSA 3S9YA 3C0LA 1QPQA 1YDVA 3T0CA 3WZ0E 1A3HA 3BW3A 3KXQA 3VNMA 3U2EA 1MNSA 4CQ8A 2PDLA 2PC8A 4LRSA 3SJ3A 1FDZA 2NXGA 5EMUA 3GFYA 4S3FA 2ZUTA 5DQPA 3OBEA 1GG1A 4HK7A 5MHBA 1W1TA 1DVJA 3RO6A 1S2VA 3WN6A 3HG3A 1QPOA 2I17A 3II1A 3UG3A 2WSYA 1EPVA 3SR7A 1Q4WA 3ICJA 1BQGA 1KXHA 3R0DA 4UMCA 4IIDA 2J7BA 4AZCA 3AQUA 3W83A 4JEJA 3C2EA 1ISWA 1BAGA 3ORWA 4IGSA 3P84A 1XYFA 1W1ZA 1CLKA 3AXKA 2HRWA 1TUFA 4PSRA 2CETA 3ARWA 3PJWA 4P8XA 1Z6KA 2YCLB 3W29A 1Q7MA 4W85A 1EIXA 4DXVA 2J7HA 2O7SA 3ZIZA 2I9UA 5DELA 1TELA 2ZX8A 3DFTA 4W89A 2PPGA 4C65A 2CLHA 5BMWA 3UWUA 1UJQA 4HMCA 3S9ZA 1XF0A 2F8QA 5CSUA 4A3RA 3EDEA 1V3MA 1EWEA 2Q8XA 1JZ8A 4KW2A 4MAZA 1DWGM 2TAAA 1MNZA 5TD4A 4DF0A 2QJGA 5ABHA 5FA5A 5CJ5A 4NNAA 1HIZA 4GABA 2A3EA 2YCIX 1EC7A 2WBGA 4ML9A 4DM1A 4HU0A 5C2CA 4H7ZA 1UP2A 4B5NA 2PP1A 3EXTA 1KBBA 3ZSSA 2ZWYA 4ZE4A 1VP5A 1C8XA 3U0HA 3GAKA 3L67A 4A35A 2XIIA 4UTTC 2XH2A 1TTIA 4DWSA 3KOFA 4J3TA 4X2PA 3AIVA 4MWAD 4UIOA 4S3GA 2V5CA 1EA9C 3T05A 2JK2A 3VU2A 1DWFM 1T5AA 1I0BA 5IXEA 3THQA 3WMLA 1OINA 4HGXA 2F84A 2MANA 4ZTYA 1R7AA 1U83A 1I2OA 2R24A 1M5WA 4PODA 4DWSB 4Z1AA 3CV6A 1TE6A 1QU4A 3EEGA 3UVIA 4CLMA 5HR6A 1P48A 2E5CA 2VI0A 2ZUNA 4FNUA 3KHJA 3KM8A 2QPSA 4F8XA 4GKLA 5H8PA 4XKMA 4OIFA 2VFIA 4CNPA 3FXYA 3TCSA 4PULA 3VOGA 3PBMA 3H7VA 4KBXA 2E7FA 1JCTA 4BI7A 4ZQNA 3H8AA 3RR1A 2PZ0A 3HBLA 1W9DM 4NQ1A 4IP7A 4JTGA 1VPYA 4Q7IA 2XN1A 5LNUA 3QV6A 1FH7A 3CT7A 1GQJA 3WDJA 5BOEA 2QCCA 3ANYA 5K7JA 2BOFX 2R1NA 2CYGA 4S1FA 5EU9A 3RCMA 3CPGA 3CL8A 1VIZA 3AU6A 3NZ1A 3W1AA 1EX1A 2O9OA 5HAOA 1PKMA 2WZHA 3HQ1A 4QDMA 4MY1A 5IOBA 1FBAA 3MHGA 3M0LA 5JBEA 5LIXX 2WHJA 2O4MA 1XM3A 4AZ6A 4IF2A 3T0BA 3A4AA 1XWYA 2GJXB 4J9JA 1GEQA 4Q8WA 4DBSA 4IWWA 1W9VA 1LBLA 1JIBA 2UY4A 3TN5A 3CAKA 3FDGA 2YDAA 2Y63A 2I5IA 3C86A 2O4QA 2OLSA 1HKJA 2UY2A 3WG6A 3PPHA 2ISDA 4ZQCA 1CBGA 1GKRA 2WSPA 3UG4A 4QLKA 3NZPA 5AYIA 1F5ZA 3BG9A 4FHAA 1S5WA 1WAUA 1X6LA 3MMTA 1EXBA 2WNNA 3KVLA 2D0HA 3AXMA 1OYBA 3BJTA 3DBNA 2OLAA 4AX7A 4LCSA 1PTAA 1PZ0A 1ONXA 1FWJC 1TZ7A 1IXNA 5AC7A 4I9TA 3S6TA 2EG7A 2VEMA 3JR2A 3N19B 3NEHA 3OLGA 1HXJA 5F4XA 2FTWA 3TK7A 4HA0A 1HP5A 3UJSA 3W2KA 4JIQA 2DH2A 2F7FA 1UR0A 2Y7FA 3W24A 4LOCA 3LCLA 1PIGA 1SO4A 2EF9A 3ZSTA 2H8XA 3PANA 2OSXA 3CQ0A 3GNDA 3VKJA 1FWTA 2O0TA 4C60A 3VUSA 3JVAA 4W8AA 3TLQA 1MEHA 1OQFA 4JFVA 4JIIX 1FWFC 1Y8BA 3CAVA 2WLYA 4R85A 1WV2A 3CQIA 1PZ3A 4QCFA 4N9DA 1DOSA 2B81A 1Q6GA 3VNDA 3SCQA 1MZHA 1B3OA 3QHMA 1YEYA 2FPTA 4MJZA 3M07A 3OLDA 4FNQA 4Y9OA 1DJGA 5EFFA 3LQLA 2TSYA 4KFNA 1KM3A 2QUMA 1HT6A 3HIJA 3N9KA 1IR2A 3BSHA 3ZJ7A 2JF6A 2ZXQA 4FXFA 4H2CA 1FA2A 4GI9A 3SZ8A 1EA0A 5G1TA 3WNLA 1UZ4A 2Q71A 1MDLA 4LPCA 3WQOA 1MVYA 1F8MA 2QR6A 2X0YA 1XPYA 3PZOA 1UR4A 3P81A 1RCQA 1V4YA 3W7JA 4D6EA 3V0TA 1UKOA 3C0QA 1PDYA 3FAXA 1EDQA 3A3WA 3FK4A 4PCSA 4Y6GA 2G41A 4A4AA 3RRAA 3WY1A 1QWGA 3QY7A 2J78A 4HSNA 4XAFA 3OB8A 2FDMA 2XM2A 2FTYA 3Q2DA 3ABRA 4MWAB 5A6BD 1SZRA 2NT1A 3W72A 1HP4A 5I79A 2DU2A 1L6SA 1IWAA 4V1XA 3S42A 5CPNA 5IDZA 5LNRA 1A5LC 4QEEA 4Q8MA 4EE9A 2R1MA 2RH9A 2INFA 3GX9A 1P1XA 3HPSA 2ZA3A 3F4CA 3UXIA 1XBYA 1A47A 1NWSA 2XPKA 3BGJA 4CVWA 3EWBX 4UZUA 2DZXA 4FOUA 2PWEA 3NO1A 3WYZA 3U57A 3NQVA 1JI2A 2YX0A 3IS4A 3KVMA 4AD2A 1HJVA 3GHUA 2QDHA 4ZENA 4GBUA 3G8RA 1DTNA 4FXRA 1OD0A 1JCXA 2MUCA 2QUVA 8TIMA 4PUEA 1B9BA 1MQQA 4UCFA 4XZBA 2YBTA 2WVUA 4EKJA 1BXNA 4KWSA 3PPGA 2ZOXA 3KOYA 1OSEA 4ZMGA 3U6WA 4AMAA 1RPKA 3IACA 4FP1A 2OGYA 4FZIA 4IPNB 1OFEA 2XZ7A 5AC8A 4ZFCA 5HUOA 2GK1B 3QLDA 5EFDA 4DM2A 3ANUA 1HX0A 3T0AA 3RLVA 4KWOA 1NWRA 5HPCA 3QZEA 1XBXA 4TO8A 3CIXA 2WKLA 2Q02A 2DZAA 4UCGA 4BEQA 5AC5A 3IVSA 4JOMA 3WH7A 4S38A 3T78A 3PZGA 2V67A 1VBHA 1MFVA 5HINA 4PMDA 5LXXA 4DAIA 1JRCA 1ZU8A 3O3RA 1E1CB 3QOKA 3VXGA 3UWEA 5FJPA 5A8OA 8RUCA 4BQ5A 3UZWA 3NM1A 1GYNA 2WZTA 2E9LA 3P3BA 3GE7A 5LA1A 1WP6A 2WZMA 1VCFA 3KWXA 1PUDA 3PZNA 4UFIA 1U30A 1Y5VA 4UOZA 2GJXA 5F7UA 8XIMA 1XGZA 3E2SA 5DANA 1TJ2A 4CNSA 1J10A 4GVHA 1JCLA 4H7VA 4DI8A 4LC6A 4EWJA 1HZYA 1US0A 3Q37A 2EPMX 1SZFA 4X22A 4M6QA 3CAQA 1EJSC 2RKXA 3CHVA 1P43A 1U5VA 3PUGA 2Z1SA 3FOKA 3IEBA 2V82A 3LHYA 4B92A 4G2DA 3PVFA 3RMJA 1QI0A 2QKFA 1REQA 1W32A 4LJ3A 2EHHA 3OW1A 4POCA 2H90A 3DFNA 1R8LA 3SO7A 1V7AA 2YPIA 3G1DA 3LERA 4GNJA 4GQ0A 5M17A 7ODCA 1XH0A 3BLLA 2Y8VA 1RH9A 2DZTA 2J4GA 2Y7DA 1LJYA 5CZKA 3VIPA 4IQJA 3UJRA 3WLJA 1UHVA 2HTMA 1RJQA 1C8QA 4IIFA 3WCZA 3QH2A 5EB8A 1VQTA 1UR3M 3A13A 1H49A 4BR1A 4UFKA 5G4EA 3RAOA 1H0IA 4MPKA 4PMUA 4I5RA 4CU8A 3GS6A 4QDPA 1O5XA 4TMBA 3BMVA 3L23A 2XN0A 2NXIA 2VEFA 3C0SA 3CPUA 4DJDA 3C2OA 2VDGA 1VEPA 4L9YA 1YXDA 2PBGA 2VMFA 1A80A 3OVRA 2WMGA 1JDEA 4Q4SA 1EQPA 4WR3A 3ECQA 2PURA 2YIHA 5E70A 6TAAA 3DBPA 4QLLA 3VNIA 3GG0A 1IHIA 2HPMA 5D04C 4WHBA 5D2YA 1KRBC 3B05A 3KOZA 3TROA 4H8NA 5D30A 2Z2UA 4AIOA 2CBJA 4GG9A 4MM1A 4X2RA 5CH9A 1YDOA 1IIGA 2PUZA 2PU1A 4FXJA 1UWIA 3BZJA 4NP7A 1W1IE 2FIQA 4FPSA 1XIFA 1W9PA 4R3UA 4G5DA 1DE5A 4PUWA 3TAOA 3VGBA 1FHUA 4IQEA 3TTSA 1RQEA 2ZUMA 4NUWA 4NVTA 2XVKA 3B9AA 4EACA 1OT2A 4IHCA 4I5UA 3GLCA 1F73A 2P8BA 2FLIA 3N17A 4OFCA 4XVEA 3NVTA 1SYTA 3CMGA 1D2KA 4IJCA 4MG4A 4WD0A 2POZA 4H9UA 4OKDA 3DH7A 3HPFA 5BRQA 2CZEA 1OD8A 3W28A 2WKJA 3H4GA 2J7GA 3FYOA 4NRSA 1WDQA 2A3HA 3O6AA 4NHVA 4RPQA 3F7JA 3MKKA 3C6CA 1XLEA 4KWVA 1FWCC 3N73A 3VM5A 3D0CA 2CHNA 5BWFA 3E9AA 3S1XA 5BU6A 4Q6JA 1J9YA 3AJ7A 4LALA 5JMUA 4GXMA 4KGLA 4UTMA 3TXVA 2GVGA 2A3BA 2JGYA 3W2NA 3WK3A 4C6CA 3M0IA 2Y0FA 1XPGA 3ATYA 3PSVA 4E6MA 1O12A 3H70A 3OZYA 5I00A 5E9XA 1F4HA 1EUAA 6REQA 1JYNA 4EXAA 1E71M 1WKFA 5AKQA 2J9ZA 2F2HA 1M03A 3VILA 5HA7A 2CXGA 4B16A 1VFFA 1CGXA 1FWWA 1L8NA 2OFJA 2G5WA 3B9OA 5SWUA 2H9AB 2DPEA 5FJRA 4LY4A 5LIUX 1A3WA 1ZAJA 3P14A 1QT1A 1WZLA 3W00A 1YQ2A 1KFKA 4O53A 1AH3A 3KRZA 2E9MA 2ZX5A 3PP7A 4AWEA 2PWUA 1EWDA 4LTSA 2ZWZA 1EPXA 3VYLA 3S83A 4E2DA 1ENUA 5H91A 3MI6A 1RR2A 3RJXA 3DG3A 4AWSA 4G7EB 3RYSA 2G0WA 5U4NA 1GQNA 3LXAA 4H4IA 1XDJA 4NZFA 3SCSA 2Y4SA 4E8GA 4FAMA 4GACA 4ZB2A 5FJOA 4W84A 1TV2A 1EEPA 3LHZA 1FWHC 4J2PA 2QXWA 2C19A 3M47A 4AWTA 2FKPA 3UZZA 1VRXA 3BURA 1BLIA 5BXRA 2Q6ZA 4L65A 3I68A 2GVEA 2DSVA 3STEA 1OFAA 2NLYA 1LBMA 1WNOA 1VFOA 2JF7A 3TQVA 4BS0A 2CHOA 4TX9A 1BSIA 3KCJA 3NG3A 4UTKA 4IPLA 2XIBA 3PR2A 3QN3A 4GISA 4HCDA 4YLWA 1VR6A 3EX6A 4JX6A 3UY7A 1I0DA 3QPEA 3AISA 4H8UA 1BXCA 2GGHA 3WH6A 3ARZA 2LLEA 2W92A 2EG8A 3ZJ8A 4GX8A 3NVDA 4PR4A 1SM9A 5FIPA 4PTDA 1XL9A 3WO8A 4NF7A 1QVBA 4MKNA 1POKA 5JBDA 2OKTA 4JFWA 3MSYA 4UOJA 1NOWA 4V33A 1OJXA 4EPBC 4XZLX 2NQ5A 1CPUA 4MVAA 3WLNA 5A2BA 2HE8A 5F1VA 2P8CA 5I09A 2I57A 1GUVA 3MCNA 5C9RA 2WVSA 1YHTA 3U8GA 2XFYA 1O4UA 3HA1A 3LPFA 3CLWA 5C8BB 3CASA 3WD3A 4RE4A 2OO0A 1US2A 3DFSA 4GVIA 1V0NA 3PZQA 1H7XA 1LUCB 4YWSA 2OYMA 5E6ZA 2RGLA 4ZO7A 1ISVA 1R6WA 3TAKA 3TN6A 2F38A 4MLRA 4M6UA 4DZHA 5FOOA 4LGXA 4E8CA 8XIAA 3RCYA 1AJ2A 4PEKA 1S1PA 2AL2B 3FHQA 1Q45A 4L4PA 4JDYA 1UZ1A 4M56A 4Z08A 1XDMA 2FFCA 4CNUA 4YN5A 1D8CA 1VLWA 5A8GA 3LM3A 2QCDB 2VZUA 1SU5A 1E9IA 5J8LA 2YL5A 2ZZ2A 3KS5A 3NEVA 4U10A 1YPFA 3RU8X 4MGGA 2BVWA 3R0KA 2PTWA 3V5FA 1KFEA 2PRMA 3HGJA 2CESA 4I5XA 3WUEA 1E4MM 3U7VA 4DJEC 3WF2A 5FJJA 4WSJA 2ZTKA 3SCVA 3WUBA 3NSXA 2GQ9A 2ACQA 4W87A 4RZ4A 3GYEA 3LRLA 2PDYA 3GWQA 2BGQA 4PTVA 4A3YA 5HOSA 2E9BA 9RUBA 2QMJA 1XLGA 1VS1A 3E2VA 1BRLA 3THAA 1OYCA 2XIOA 5K9CA 1B4KA 2QCGA 2INEA 1UD4A 2FVKA 4ZBCA 2ZFAA 1QASA 3NPUA 2NV9A 3ENLA 1RJRA 1W9BM 1RLDA 4OOZA 3W25A 1OWQA 3KE0A 3EXSA 3N2BA 3Q4DA 4HZ7A 3NPWA 3QHOA 1O7AA 3A23A 3PF3A 3DI0A 4HYWA 5AFDA 3MKCA 3F5LA 2GL5A 4YJ5A 4P7LA 2PTXA 2XJ7A 3IIZA 2NQHA 4CD8A 2CLKA 4LVAA 4QG8A 1FKWA 5LYRA 1EF3A 3TWAA 1A4LA 4HTBA 3CWNA 3TDFA 3WD4A 4GO9A 1OC6A 3VMPA 1KRAC 4AW7A 3VIJA 1D9EA 2PLJA 4GO8A 1GOIA 1TWIA 1G4TA 3KCLA 4AY7A 4MWAE 1OABA 4F4RA 3W4RA 1JZ6A 4A8NA 2PRLA 4LAMA 4QIUA 4XTIA 3HF3A 2PSNA 3TYUA 2VFDA 4C90A 1PS9A 2DEPA 3JUGA 5CPTA 1ML1A 4HPXA 2GJNA 2D23A 3K4DA 3IV3A 3G2GA 2Y62A 2Q8ZA 1TPFA 1LBFA 5A8PA 1R3VA 2D2GA 2ZE0A 1CLVA 3W74A 3PJTA 3DI1A 5E5CA 3S9IA 4QROA 1LT8A 1KA9F 2Y7EA 3HQOA 3IJ7A 5LHEA 4ASTA 2HEJA 4ECLA 1BVWA 1JFXA 1AL7A 3A5VA 3UT0A 4C6FA 3WLPA 3IK4A 4Q4PA 5FACA 3I4KA 2V3GA 3LDVA 4NZ3A 4Z1CA 5FF2A 4QBXA 4AD5A 4BJHA 1T6MA 5A2AA 4S3AA 2WMJA 3H2EA 2IUZA 1PYFA 3DGBA 2OQHA 3PAJA 2OEKA 3RM4A 3SIMA 3TQKA 5DMYA 2ZX7A 4LQ1A 1NWUA 3I7RA 2J7FA 4Y8FA 4TMCA 1EKOA 3BLOA 4REQA 3UG8A 3GKFA 4Z0JA 1GQLA 5A6KA 3ES8A 3L2MA 3UZXA 1X8CA 1V02E 1XHGA 2Y85A 1ZS2A 4E3VA 4JR5A 1W1A1 2GQ8A 3P60A 2Y5SA 3IIOA 3G1XA 3VGGA 5HNTA 1J0ZA 5HUPA 2QVNA 4L6OA 4JTQA 5ABTA 2ZA1A 4KETA 1UH2A 2ESCA 4XAYA 3XINA 4O1CA 2X8RA 2OZ3A 3PC0A 4IMAA 4Y90A 3ZO9A 4D1IA 1KFLA 1ME8A 4M1RA 4LB3A 3OLIA 4HNTA 2QDDA 4LYRA 4B3LA 4H00A 1XYAA 3EXRA 1JXKA 5DN1A 5ENLA 4F2UA 2P1FA 2HXTA 5I2UA 2V5JA 1R38A 3W7RA 4GOAA 2XYLA 5CQ1A 3KOXA 1E9ZB 2VEGA 3WD1A 4PRTA 3P0WA 4HBKA 3UWVA 3QR1A 4L4LA 4EPEC 3L4UA 3QY6A 1HGWA 3TUUA 4XSLA 2P5NA 2VM8A 3R4IA 1GOKA 3TYEA 4GHRA 1DQUA 4JTSA 3GW3A 4P8WA 4D6HA 3GR7A 3QR0A 1H7WA 4QE1A 3SB0A 1TTJA 1I75A 1E15A 4KFPA 3QY8A 4CD4A 5DY3A 3WQ5A 5F4WA 1OBAA 2JIEA 1NIUA 1B2YA 4UUIA 2XFFA 4BZYA 4YL2A 5CPSA 1VFMA 1OFOA 2QJHA 2E5DA 2I5GA 5GNZA 2ABAA 4GY0A 3EDKA 5FEPA 3R8GA 3TR2A 3LBOA 2Z24A 2OODA 4UTWC 3S5ZA 4HYVA 2BWGA 3W7IA 1UA3A 1J2BA 2P0IA 3SJNA 3EYPA 2NV1A 1R9ZA 3V16A 2V69A 3VA8A 3CO8A 2C3ZA 5F2IA 1W1YA 2DZVA 4LS2A 3TNOA 1PV8A 4Q8OA 1QW7A 4AF0B 3URAA 3PN8A 1JDCA 3DG6A 3W1QA 3BL3A 1N8FA 4QGCA 2QAPA 1ELSA 3WDRA 1L0PA 3VOFA 1CCWB 3EKGA 1F6PA 2A7RA 3EA1A 1JQXA 3CH0A 4RL3A 4FIRA 3R13A 2QCHA 4OV9A 3RM9A 4BI6A 1IXPA 7CGTA 3REQA 2E6YA 1RA0A 3LU2A 4MADA 4HKPA 4HMEA 1PE1A 3QXBA 3AXHA 3AYRA 4XO6A 1WOBA 2CBIA 4M6PA 3EX2A 1IZCA 2YL6A 1SFSA 3O15A 4RLIA 1ITQA 2EKCA 4ZOEA 4EF9A 1TVPA 2E3ZA 3HFYA 1ZJIA 3AIBA 2W91A 3EWYA 3VIOA 1G69A 1C9DA 4MNJA 1XLJA 3QR3A 1CX9A 3M44A 3FGCA 4QM1A 3P80A 3ZR4A 3UR8A 1S38A 2GOUA 3OYZA 4JTDA 2YXXA 1FRBA 1Z7AA 5FSEC 2OELA 4RDYA 4YMZA 2YFNA 3WQ8A 3RRXA 2Z00A 2HCVA 1WYIA 4GJIA 4N6FA 4JY8A 2WAGA 2DIJA 4YCOA 3BLKA 1RBOB 3MS8A 2JEPA 4YYFA 1XV8A 3W7GA 3Q94A 3BZGA 1UWTA 4I8YA 4XZWA 4UQEA 4PUJA 3H24A 3LPOA 1HKWA 4GZEA 3W82A 1WB0A 1HKVA 2VX6A 5D2VA 4S3BA 3OA3A 1FXQA 2XVPA 3CS2A 3TN4A 3L4VA 3VTRA 2EEXA 1TIMA 4P7QA 1IZKA 1X7FA 3CIWA 2PCEA 3NO5A 3H2MA 3H12A 1P0DA 3T09A 5F2GA 4H9VA 3BE7A 1CYGA 2QUNA 1KCXA 1KFCA 3KS6A 3GTXA 2Z1BA 2WC3A 1LG2A 1EHAA 2FVLA 3WQGA 1GTEA 1A0EA 5E93A 1RCOB 3WEMA 3NQAA 3GY1A 2AOSA 1Q2RA 3ZLFA 1ZLPA 4MTVA 4H83A 1LQ2A 2PDWA 3WLIA 2Q8LA 1LYXA 1RCXB 2FTPA 1JVNA 4DBUA 1NJJA 2ZXBA 1RY8A 2VO5A 3VDCA 2ONEA 2GGIA 2XSBA 2EG6A 3A6OA 1BSLA 3DDMA 4N42A 3V0SA 5D2XA 2CLFA 5M03A 1LL6A 3BG5A 4Y96A 1EJ7L 1BWLA 3VD3A 3DECA 3PZIA 1EP2A 1HUVA 1H7NA 4HTYA 4QCEA 4TR9A 3PBWA 4H8HA 1RJPA 3HURA 2CC0A 1KCKA 4MLJA 1UZHA 1E6SM 3GVWA 1VBJA 4HOZA 3GHTA 2Z6JA 3AUJA 4H19A 4IPJA 1C90A 3LCXA 3Q45A 4UTFA 5DXYA 3SCTA 3WQWA 3CUXA 3B8UA 2Y8KA 1BEUA 2GVJA 2NWRA 2PF8A 2Z7KA 4NAFB 2YLLA 3TMQA 2XU2A 4M24A 3B9EA 1W37A 2R8WA 3G1SA 3UGRA 4D6IA 3GM8A 3ID7A 3NL5A 3SADA 3G18A 4RX0A 3NJ3A 1S5VA 2QZRA 2Z29A 3IVTA 4UTJA 1Z3NA 4F66A 2RDTA 1ZGDA 1EZ2A 2BFGA 1S3TC 5DT5A 4DJED 1HTIA 3ZS4A 3TYAA 5JH1A 5JBFA 5GJNA 3S2JA 4US5D 1DBTA 2YXGA 2G3MA 3BV4A 3K4AA 3T0DA 4MYXA 3PNZA 4GZ7A 2PBOA 4UNLA 2J6VA 1E0VA 3WQVA 4BF9A 2DH3A 2XG9A 2VEPA 1XCWA 1AFSA 1LP6A 2IS7A 3T2PA 1LRQA 5MKGA 2DSZA 2A5HA 4WDWA 2A3LA 3H7UA 2ZZ4A 1JNDA 1V79A 1E56A 1QNOA 4BEUA 1GVQA 4G1KA 4IUOA 2HDJA 3SRFA 2VDIA 3PJXA 4AD3A 3D47A 5BXSA 3GHSA 4C91A 3GH5A 1R9XA 1RHCA 1Q8JA 5CCZA 2DJXA 3LS9A 1R7OA 5K4XA 4JD4A 1RAKA 2NUWA 4Y2WA 1QDSA 5REQA 1TJ1A 3RX4A 3CHDA 4NJKA 3UYCA 3PUOA 1H7OA 1I4NA 3TC6A 4W93A 1FP8A 1A5AA 4RNJA 4W5UA 3VI2A 3IGSA 3UERA 3TXZA 1PKYA 4IIGA 4CCEA 2WHKA 2X2YA 2WJDA 4G7EA 4YWIA 5D8WA 4GK8A 3W81A 4ORMA 3UNDA 1I6NA 1XUZA 5CPMA 3BQ6A 1N2VA 5B80A 1Q2SA 1QPRA 2F61A 2Q01A 2WK2A 1BQCA 5K9XA 5H6HA 2BTMA 4HJFA 4Q7BA 1W5OA 3NXFA 4IM4A 3CEPA 1YE6A 1PSCA 2P3ZA 3T4CA 1KM0A 3MDUA 2I16A 3M5VA 3WBXA 3N2TA 1N55A 4IFKB 4I6KA 4DELA 1R47A 1FKXA 4WKFA 1IZJA 3NQBA 1PWMA 3QVQA 5HNNA 2QUTA 3S4TA 3SQMA 4NSBA 4JHOA 2PD5A 4IH3A 3VKBA 3W2UA 1EJVC 3UJ2A 3WSUA 4A21A 2HPIA 3W7EA 1H1NA 3WBWA 4GIRA 3B04A 4GYPC 3CB8A 4AZGA 5D32A 3L4XA 4OBSA 4DYEA 3LZ3A 1H50A 1EDGA 5HQMA 2FPYA 1ZNNA 2DZPA 3VCCA 2GVYA 2J47A 3OBAA 3EMZA 3OGVA 2CCRA 1OC7A 1GKQA 2ANUA 5LKYA 5I7GA 3WLQA 1T7LA 1SZNA 3OVGA 4IIBA 3FHAA 3TJXA 2Y24A 3OJGA 4S3JA 5FF7A 2XM1A 1GVFA 4DX3A 3C2RA 5BWAA 3PY2A 4CCCA 4AVOA 3KVKA 1ZP3A 2BVTA 1CDGA 2OX4A 4RJEA 3UZYA 1SVDA 2YR1A 3FNDA 3WL0A 3GG7A 5FSDC 1OF8A 2ABBA 5HPOA 3LHTA 4HOWA 1BYBA 1CGTA 1JXJA 3LZ5A 5GNYA 2FMOA 5IHRA 5DFAA 5LZLA 1YYAA 1V5XA 2VQUA 5GJPA 1CXEA 1BXBA 4INFA 2PD9A 4JZ5A 5CZSA 5G2IA 2VGGA 1ONWA 3UCQA 2RDWA 2PAJA 2Q3RA 1KBKA 3M0HA 3USBA 3SN1A 2Z1XA 3S6DA 1QI3A 4WEVX 4BF5A 3AWOA 1JDAA 2WMIB 5I3IA 4PMNA 4GCXA 1J18A 4DJFA 1XBZA 2ISVA 1W31A 2WZIA 5EMJA 4LYPA 3R7MA 3J7HA 4FI4A 3FGCB 1IF2A 2NVAA 1DQXA 2V30A 4UFHA 4O10A 1F3WA 3STCA 3G5EA 3FYPA 4R27A 2D3LA 4NJJA 2DFAA 4ZQOA 4GQGA 2IPJA 2WO5A 3ITYA 4ZGYA 2V8ZA 1IE7C 3AZRA 4ZQRA 1E5NA 4P8UA 2BY0A 3G1HA 2PFHA 4MWAA 2J66A 4C1KA 2XFWA 4MKSA 3SQSA 1VIWA 2ON3A 2WKGA 3VZYA 4CEXC 4W7VA 3JW7A 1XIJA 1DXFA 3EPOA 3LMZA 1KBJA 1NF7A 2ZRUA 1S3HA 4KT2A 4K7VA 3AYTA 4IL2A 3MYPA 4IX0A 3O1NA 1Q7QA 2E6FA 2BP1A 1L6FA 3VKCA 1PCKA 4B4HA 1WUEA 3F4NA 3QYQA 4NT0A 4NYUA 1U5HA 2Y5JA 2WCAA 3O07A 3OLEA 1C93A 1UA7A 3MUCA 3UG5A 4TXEA 1XSIA 2HBXA 4E0CA 4DJDD 5DRIA 4ZO6A 3D46A 1REQB 2AL1A 1FCUA 2WSQA 3VPLA 4MAVA 4AEOA 4LB4A 4BFAA 3PZTA 3EGJA 4C6JA 5KZDA 1CZ1A 4QJ4B 1DIOA 3L0NA 3TJ4A 1MRQA 3WF1A 3G1FA 3ME3A 5TNVA 3EPNA 2KZHA 1JPKA 1K9TA 1RA5A 1QJWA 2W62A 4IP4A 4LU0A 4GFSA 1IT8A 1DYSA 4JGDA 1FCQA 3TFXA 3TE9A 2CLEA 4GI6A 1C8YA 3T0TA 3QV9A 3DFPA 3VFLA 4B5TA 3QLLA 4E38A 3CIVA 1FWRA 4NILA 2QLYA 4N9EA 4PA8A 5FEXA 2PLCA 3MHFA 3PG8A 4N02A 2O92A 3HPAA 4WJ8A 1JUEA 4FB7A 3I3DA 5G2HA 4GYJA 3SY5A 3W88A 1MFUA 2VCBA 3KLKA 4NKCA 3V5OA 3VAVA 1ISYA 4IJBA 1I8JA 3RDKA 4J4KA 3UJFA 3FVMA 1KRCC 4CCDA 4KRZA 2C1IA 3WJSA 3M6YA 1UC5A 3E6EA 1XGDA 4EPKA 2ZXAA 3D6NA 1LUCA 4J3WA 3ZVHB 1AW1A 3UZJA 2PTYA 2CKRA 3AZSA 3N4EA 1F07A 2BHUA 3H4XA 1ME7A 4XUYA 4F0SA 3AICA 1VBUA 3CUHA 3CT2A 3RIKA 3W7KA 4W8BA 3VINA 1KWKA 4ZSUA 1Y7VA 4KRUA 4S23A 2ADAA 1OG0A 2GSJA 4PB3A 2PDPA 4MB5A 2PB1A 3QZ6A 2CITA 5I07A 2GVLA 2J7DA 4ZOBA 5I24A