3VZXA

Crystal structure of pcrb from bacillus subtilis subap. subtilis str. 168
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
227
structure length
227
Chain Sequence
MYDVTEWKHVFKLDPNKDLPDEQLEILCESGTDAVIIGGSDGVTEDNVLRMMSKVRRFLVPCVLEVSAIEAIVPGFDLYFIPSVLNSKNADWIVGMHQKAMKEYGELMSMEEIVAEGYCIANPDCKAAALTEADADLNMDDIVAYARVSELLQLPIFYLEYSGVLGDIEAVKKTKAVLETSTLFYGGGIKDAETAKQYAEHADVIVVGNAVYEDFDRALKTVAAVKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into TIM-barrel prenyl transferase mechanisms: crystal structures of PcrB from Bacillus subtilis and Staphylococcus aureus
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords Heptaprenylglyceryl phosphate synthase
total genus 78
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature ec 2.5.1.n9: Heptaprenylglyceryl phosphate synthase.
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01884 PcrB PcrB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.390 Alpha Beta Alpha-Beta Barrel TIM Barrel FMN-linked oxidoreductases 3vzxA00
2F6XA 3VKAA 3VZYA 4MM1A 4NAEB 3VKBA 4NAFB 4JEJA 3W01A 3W02A 1VIZA 4NAEA 3VZZA 3VKCA 3W00A 3VZXA 4NAFA 3VK5A 2F6UA 3VKDA
chains in the Genus database with same CATH superfamily
3STFA 2C79A 5GVJA 4XG1A 2QEZA 4GVIA 3NVDA 2R1NA 3M0ZA 1PZ2A 5EPDA 1UMYA 1LLZA 5A2BA 5C8BB 4H9ZA 3WNKA 1B3VA 4Y9AA 5DMLA 3MTWA 3TE9A 5T26A 3OBKA 3BWWA 3AUJA 4IMDA 3ZT7A 3BVJA 2UY3A 5CZ0A 4YTTA 1XBVA 3ARPA 3THAA 1OFQA 1GT8A 3W74A 2O9RA 3NSMA 1RR2A 1XLHA 4FMVA 3V3WA 4EAMA 1UUQA 2UY2A 2EG8A 2J7CA 4JICA 2TYSA 2F6UA 2WB5A 1LJYA 1WA3A 1JXKA 2DSZA 4MFEA 1O1HA 4JQ4A 2RJGA 3O6AA 1JFHA 4E3VA 1K1DA 3WUEA 1EC9A 3WJWA 4LC8A 4ZFCA 5BRPA 4Q22A 1J2WA 5AC7A 3UGRA 3GW3A 4DF0A 4LUJA 4MB5A 2XZ9A 2Y1HA 4S3GA 4S3JA 1YEYA 1UA7A 5DBTA 5EMKA 1Q8JA 4AHQA 3Q45A 1C90A 4HGXA 1HVXA 3ZWTA 3VIMA 3ZFHA 3KTCA 1G4EA 1Q7ZA 5C7VA 3K4WA 3S1VA 3N2BA 2CETA 1K6WA 4IJRA 4PTWA 5I6SA 4PL2A 4K8EA 1FRBA 1K70A 1CGWA 2QCFA 2YGYA 3RX3A 4B90A 3W6MA 2BFGA 1J5TA 4DAIA 4FNUA 5TD4A 3ITLA 2TAAA 1KFJA 1FA2A 3NZGA 4AD5A 5C7HA 3OVPA 3MUCA 3AIRA 2DJXA 1ZJHA 4LCSA 3WLKX 1JCXA 4X2RA 2CCRA 4M8UA 5I3KA 3MJYA 1REQA 3EMQA 3WEMA 3CIWA 4QE4A 3T40A 2VCAA 1TJPA 3MYOA 3G1VA 1SZRA 4MSSA 1YKWA 2AKZA 2Y5EA 3ITVA 3ITTA 3VKBA 1ZPTA 4GYKA 3NQBA 2RDTA 3EWWA 4AZHA 2Q71A 3WF4A 1K9FA 4JX6A 3FXYA 1R8LA 4GBDA 4U5IA 3FEQA 1U30A 2WCAA 3KUMA 4HA1A 1IHIA 1XYZA 1N2VA 3Q58A 2WVTA 1T0OA 1RD5A 3GU9A 4OV9A 1ZS2A 1BKSA 4JKLA 5I5RA 1XLAA 4M29A 1Q6EA 4IMFA 5GNYA 4DJDC 1MSSA 1LT7A 3BMXA 3OJGA 1VQTA 3S2MA 3S9YA 4CD6A 3WMLA 1A3HA 4FOUA 2L5HA 1AK5A 4B5WA 4IGSA 4NJIA 1J0IA 3W1NA 4UFKA 3M6YA 1XR2A 3VKJA 1WXZA 4YTQA 4RV3A 1G4TA 3SCQA 1NOUA 1JGMA 3DKLA 4N9BA 1Z69A 1WOAA 3E38A 1O5QA 1K7XA 1Q66A 4BR1A 1XDLA 4BF9A 4W5ZA 2XSXA 2QDEA 1C7TA 3NQDA 2HDJA 1ADDA 4S2BA 2NVDA 2X7VA 1P5BA 3CL6A 1EEPA 3WZ0E 1AW1A 1RCQA 4RE3A 2DT0A 2QMKA 2YCJA 3CZGA 3HA1A 4G6CA 3OW1A 1S1PA 1B3YA 3PWGA 4QS5A 5PTDA 3H2FA 2GLKA 1BRLB 2ZUTA 3VKKA 5MKGB 2VEMA 5F2MA 4WXZA 2W5FA 2WHKA 2YX0A 3N1AA 4RNFA 4JGDA 4H19A 4BY3A 1MQPA 4DJEC 2ISSA 3VGHA 3AIVA 2FZDA 5LXEA 3D5HA 3AICA 2QLYA 3WUFA 4YPJA 3DU0A 4DWSB 3VD9A 1KC7A 2CLPA 2YIHA 1ITXA 4ZBCA 2IPGA 3KDOA 3FHAA 3TEVA 1EO5A 1N8FA 4JTGA 1V02A 3R43A 4XBJA 2AQOA 1E73M 4PR4A 5F1UA 1EHNA 4JFVA 3TTEA 4L64A 3O63A 4HSHA 4DUXA 4GVFA 4C1NB 3LSBA 3CJPA 4GFSA 4JFUA 4X61A 1I8JA 2ALDA 4NUWA 2I16A 1MQQA 5D33A 4C6MA 4X22A 1R5YA 3P81A 2CEQA 4IQLA 3DBPA 4UOQA 3EAUA 2B0MA 1Y8BA 3LCHA 3MMDA 1V79A 4QR6A 2UY5A 3TH6A 3AS2A 4NZ4A 4GFIA 1CI1A 1JCYA 1W2VA 1XGDA 2OEKA 2GVGA 4IGMA 2WWDA 2Q3OA 2X1IA 3DC8A 3LCFA 2WNNA 2W92A 4AVNA 3R8GA 2DSWA 3FY1A 1VBJA 3SDOA 1ECEA 1RH9A 5DN1A 2VENA 1W5NA 2FMOA 5JMUA 3DCPA 1QO5A 2A2IA 3O3RA 3S8HA 3UA4A 3TYAA 4S3AA 2HS6A 3R8HA 1V6YA 3WLJA 4C6BA 2QCDA 3W00A 2D2HA 1FXPA 1TRDA 3GFXA 3S5NA 1PKLA 1RD6A 4O0QA 1GHRA 3W3OA 3W7QA 3MP3A 1F3WA 3LM7A 1KXQA 4WGHA 4H9TA 3OQ8A 4FNTA 1RHCA 2YBVA 1US3A 4Y8EA 2PF8A 1AQMA 5FI8A 2QS8A 2X2YA 2ABBA 3UXAA 4XZ9A 1TIMA 3GNPA 1PL9A 1JRCA 3I68A 2F8QA 4QGCA 3KL0A 4NG3A 3HPZA 3PBVA 3NVTA 3OP2A 4ACZB 1BG4A 2XPKA 4ZGYA 2XJ7A 3UXIA 2QIIA 4KW2A 5K9XA 5HNRA 2WSPA 4NZ3A 4RJEA 4UQEA 1S5NA 2JALA 3HGRA 2Y88A 1KO0A 3WBYA 1SPQA 4O19A 3CHCA 1JXJA 2RFGA 2NQLA 4ZTYA 3S5OA 1WBJA 3SECA 1UC5A 5FSEC 2JBMA 3GUGA 3W23A 1ISVA 1ZBWA 4XISA 1JDDA 4JFTA 3GNXA 2ASHA 4G9PA 2PTYA 2I9EA 5EMUA 1DTUA 3N3MA 3WMSA 1RPKA 1E6QM 3ZO9A 1FHLA 4QLKA 3WK3A 3HZ3A 1C3FA 2Q8XA 3QY8A 4NJJA 1KWKA 4H8HA 3CC1A 4YIWA 1QI3A 4WY0B 4JEJA 4EXAA 1F8MA 4UR7A 3BLOA 2VUNA 4J7RA 3KTSA 4CCDA 1IT0A 3TN6A 4KRUA 1XGEA 1BXBA 3GTHA 3MSDA 3PHAA 2QDHA 1OK6A 4QITA 4EP8C 2G95A 3JUGA 4K2SA 4WJEA 1W1PA 3CHEA 1MW1A 2H6RA 2IUZA 1H1ZA 2W67A 2WPBA 4BJHA 4UNIA 3L4YA 4MMWA 2TODA 1TPVA 5EB8A 1WE5A 2FJKA 4QQ3A 3W73A 3GKFA 3VNYA 4MF4A 1V8EA 1Z3NA 4OFCA 3OLGA 3W1MA 1UYQA 2CFFA 4XAFA 1J79A 3GG8A 2HE8A 1LQAA 5EMJA 2DIKA 4LANA 1VHNA 4CCCA 1IXNA 2XU2A 1EH9A 5FJOA 9RUBA 1XLDA 2V5DA 3WJYA 1RBLA 4KRTA 1KR0A 2ZUMA 1V3KA 4AYSA 3QV7A 3LDVA 2QJIA 3VU2A 3MP5A 4ATWA 4L4OA 1Y0EA 1GVSA 1LOQA 3UT0A 4RXGA 4NZFA 1Q6FA 4UQBA 3KOZA 3P14A 1OG0A 4RDZA 5LSMA 2OX1A 3V5FA 5A5WA 1QO2A 2DVTA 3GBDA 3WBEA 4B91A 3NQFA 4H7CA 1OZMA 5IOBA 3ZJKA 2Q02A 3TWAA 1PJ9A 2BHZA 5D37A 4WDUA 3NPUA 2O4MA 1QT1A 4R7OA 3TWBA 5EFFA 1L6FA 5GJMA 3UVIA 5CZJA 4G8TA 5JVLA 1RALA 3MCNA 3XISA 3V36A 1TELA 4HNCA 1QNSA 1KTCA 3IJQA 1QAPA 2WC4A 1V0NA 4I5RA 3ARTA 4M1RA 3CEUA 1K6AA 2XH7A 2F2KA 2QT3A 3WQ5A 3H2OA 3WF0A 4QJ4B 1F9CA 3H2AA 1E9ZB 1OGSA 4EAYA 2QVNA 4O15A 3T9PA 3GWQA 1MEIA 3IGSA 3OIXA 4CLMA 3TC3A 3POCA 1QUMA 3NDZA 3OU8A 4HZMA 1UZ1A 2D0GA 4YYFA 4PBEA 4CQ8A 1GK8A 3TYEA 4BF7A 1EZWA 4QG8A 4GZIA 3CB8A 1UR9A 2W9MA 1D8WA 3C2EA 4K8GA 3M47A 2WQPA 3U4FA 1EGMA 1TTIA 4K68A 1JG9A 1QPOA 3WUGA 2NQZA 2ON3A 1B31A 4HPXA 4P7OA 4JFSA 4Z42C 1NP2A 4YS1A 4XKMA 2GYIA 2XTKA 4E2DA 3RPDA 3WUBA 3UWYA 1QWGA 4D8LA 2QCNA 4JTAA 1W9VA 2WNQA 2CU0A 3W6YA 5DMYA 5I78A 5KINA 2HPMA 2FGLA 3A6OA 3LV6A 2HXTA 5LZLA 2OKTA 2OU4A 2PDFA 4BFAA 1XLLA 2DZXA 4JNZA 4K6AA 1TYGA 4O17A 3AU6A 2ZZ5A 1GQNA 1M41A 2DZAA 3VIFA 3T0DA 4U28A 2G3JA 1HT6A 3G3DA 1H09A 2QPSA 1NY1A 3FOKA 3VZYA 4YTUA 1TPFA 3MSGA 4FSAA 3W7DA 3VILA 1SMAA 1YNYA 3HIJA 3VE7A 3UWEA 2DZPA 1DJIA 4HA0A 3T2PA 4BQ4A 3AIQA 1ISXA 1HJWA 1ZBVA 4GNJA 3R8RA 1J01A 3PBMA 2Z00A 5CGQA 2IXUA 3MPGA 5BRQA 1PWLA 3AHYA 3KVMA 3AS0A 3AMGA 1DQUA 4FX6M 1TPUA 2AL2A 1XKJA 3LHYA 3FS2A 4LX4A 3W02A 2GDVA 1V5XA 3CUHA 3W1PA 1GHSA 1AJ2A 1F73A 4FOKA 2CIPA 3W81A 3CV6A 1S38A 2GJPA 1YBQB 3QKEA 1XIHA 3SI9A 4RR4A 5AOUA 3C4UA 2BZNA 3W87A 4C6IA 3NWRA 6ENLA 3GHUA 1MWOA 5CSUA 3Q37A 4CU6A 2NZLA 3PY2A 3R12A 2PRHA 3TR9A 3WELA 3QGVA 2X8RA 3VIJA 4GI6A 2IPJA 3ATYA 4LUYA 1OYBA 4QAIA 4GQQA 2CKRA 3FYPA 4X0NA 4FXFA 2PDCA 3OTRA 3TQPA 3B9NA 1VEPA 4JQAA 3W7GA 2VDHA 5EA9A 2NUXA 2GPTA 4S2CA 3GG7A 3UR7A 1ZQ5A 1UWTA 3DFQA 4YVXA 4E4UA 4RXFA 4EWND 4MGGA 9XIAA 2HISA 3NL5A 2EPKX 2BDQA 3QTGA 1WUFA 3VZZA 3M0JA 1QFEA 1LDCA 4ENLA 2R1MA 3F5JA 2G41A 3LG3A 4MADA 3RFAA 3VGEA 2YB4A 5BU6A 1UD5A 2PDJA 3P2VA 2CZDA 4F0RA 2BTMA 1U5VA 5H91A 1E6XM 1FH8A 2X1SA 4D72A 1HJUA 3R89A 3RNDA 3UA3A 4MYXA 2VZOA 3GIQA 1DIDA 1BVZA 1Q8AA 1MW3A 4W7UA 2J9YA 4FX8A 3WQ8A 5HMSA 1VFTA 2J75A 5BCAA 1W5OA 1MXGA 4HIBA 5LGXA 3P67A 3S1XA 3LCLA 4NF7A 5AKQA 3PPGA 6REQA 2DUXA 4GIEA 3L12A 1OK4A 3G1AA 1CTNA 3Q67A 2PBGA 3FX4A 1XRFA 4TVUA 2UY4A 3IACA 3LXAA 3SO7A 1HL9A 2WMFA 5G1TA 4CD5A 3M0VA 4HB7A 1QOQA 1JYVA 2ZUVA 4A29A 3NTYA 1EO7A 4B3LA 3RCMA 2X42A 3BW4A 3CEPA 1AD4A 7TIMA 1DIOA 4LUSA 4DWSC 1WYIA 1U1HA 3WEOA 1BKHA 3TFCA 2ZX9A 1KBLA 1EJRC 5JUVA 3H7RA 4NAEA 5M2FX 2RGMA 4YVPA 6TAAA 1QBBA 5FAJA 5BXPA 4XB3A 1OZQA 4O54A 3N6JA 1TJ0A 2FHBA 2J88A 3NAVA 1Q6GA 2VEIA 4QAWA 2BG5A 1IXOA 4ROPA 3AIBA 4FP1A 4AWEA 4O53A 1FWJC 1LLWA 2A6LA 1QMLA 4JTSA 5A94A 2G97A 1S3TC 1D3CA 3HG4A 3ERPA 1UROA 3W7KA 1DWJM 3HJZA 1EDTA 3M46A 2QGYA 5LIXX 3C0SA 1QXLA 2BSLA 4X0VA 3FSUA 3QMRA 4AAJA 1SFSA 2EJ1A 3D6NA 1OF6A 2C16A 4X2PA 1XIBA 2CLHA 1EIBA 4RCXA 4IPLA 3W71A 4GKLA 3URBA 1HKJA 4FHAA 3V5CA 4A22A 4NQ1A 4DAFA 4JAWA 3GZAA 1X6UA 4L6OA 1YDVA 3MSYA 3AISA 3GHSA 4QSFA 4AF0B 3KRBA 4BS0A 3CGTA 1Y65A 4PCPA 1IZJA 1PKMA 4PN2A 3OBAA 5BNKA 4F3HA 3N2MA 2F38A 3N12A 3NGFA 1PV8A 2EG7A 3E2QA 3L4WA 4GXMA 4LC6A 3K46A 2QJHA 4JTUA 4KCVA 1XIIA 1L8NA 3N73A 4ZVJA 2ZXQA 4MDOA 5CG7A 3OLDA 5G2WA 3G6MA 2V69A 1W3JA 3T1GA 4R85A 4B5XA 2WK2A 3N4EA 2YL5A 2QJJA 4AY1A 1VJIA 3O6DA 3OVRA 4IP7A 4O1CA 2OYMA 2CHRA 4AU0A 1BWVA 4ZR8A 1KCLA 3WQPA 2J7FA 3HG2A 1EJVC 4H8UA 4MZYA 3P80A 5AYZA 4Y7EA 3W1UA 3KRUA 2VZUA 3OHIA 5CSSA 3A4JA 4C6NA 3S0CA 4J3XA 3EKZA 1H49A 3HURA 4ZOCA 1WKYA 3W7EA 3N34A 4HTYA 1O60A 1AW2A 5IXEA 4PODA 4G7EA 4QG6A 1E0TA 1FWNA 3NOYA 1L2UA 1LL7A 1TTPA 3H8AA 4LUTA 4U2YA 3TJIA 3EOEA 3E0VA 3IGHX 3LSCA 3PB0A 5LNSA 3NZ1A 3RMEA 3NYDA 2VYOA 1NWUA 4TTGA 1JZ3A 2QDGA 2FFIA 3RHGA 5I07A 2CBUA 2WVSA 2X1RA 4DHGA 3ZVIA 2VC9A 1XFCA 3PB2A 3P6LA 2OR2A 4KF1A 3BZJA 3MBFA 4ACZA 2IQ0A 4C1NA 4LAZA 2DH3A 2CKSA 3AYVA 4X60A 3LCIA 1ALDA 1WKDA 2ACUA 3W25A 3EZ4A 3NDOA 1W1B1 3T09A 4PEKA 1OD0A 4L61A 2PDNA 3BLKA 4YHEA 4M6UA 3OYXA 2QF8A 4ZQRA 5CC3A 2BLEA 4M6QA 3BANA 3TSBA 1WO2A 4KS0A 1EQPA 1RCXB 4GH1A 2VFEA 3W1TA 4GY0A 3SQSA 1UP3A 2G3NA 2C0HA 1P0BA 3PUEA 4A8LA 4TMCA 2ZBTA 4D6EA 3OLIA 3SEPA 2INZA 2OJPA 3IJ8A 4JYFA 4E5TA 5ENLA 2ZXAA 4QDPA 2XH0A 1W5MA 3OQEA 1YDOA 4GE8A 1U5JA 4S1FA 2WJDA 3UR2A 2DIJA 2YPIA 2ZZ7A 4JQ2A 4Q8NA 3HOJA 3H24A 5HQEA 3RGTA 3U2ZA 4K1GA 3QHOA 1FKWA 1JCJA 3AYRA 3EWCA 3PP7A 4UBPC 1EA9C 3NA8A 1KM0A 5H1WA 3QMTA 1EJ7L 4DZ5A 3SB0A 3FA3A 3OVQA 3UWWA 4HCHA 3KVKA 4DWSD 2Z7GA 3W1QA 5KZDA 3EOOA 3PUOA 3BAIA 3QQWA 2NLYA 1PE1A 2VRJA 3P60A 1JUKA 4IPPA 3W82A 2GJXA 2BGQA 2ABAA 4KEVA 4Q8TA 3AQUA 3HV8A 3WKZA 3BDKA 3ARVA 3WBXA 2ACRA 1HKVA 3WNPA 3II1A 4IXXA 4E3TA 4IFRA 4JTRA 3N2OA 2BGSA 2BB0A 4YTSA 1KD0A 3VABA 4O1BA 2ZX8A 1EQCA 4F4RA 2YR1A 4HYRA 5CAKA 4F8XA 3IIOA 1VYRA 3CXOA 1V6VA 1UPMB 3QHMA 2ZXDA 2OEMA 2WBGA 5C71A 1XG3A 2XVGA 1A47A 2D22A 5L9FA 3HTWA 4GXPA 4AHOA 4QHRA 3UYCA 2FFCA 3G1RA 3GTIA 3TDFA 3DG6A 4D6IA 3NUKA 2VUYA 2FVMA 4RE0A 3WO8A 1DE6A 2Z1WA 1QI2A 2Q3RA 2MNRA 1RQEA 1XPGA 1KFCA 2G5WA 3W1AA 4I8DA 4YMZA 3VNZA 1M7OA 1UR3M 4ZQCA 3KBSA 5D09A 5I3FA 1GJWA 3BE7A 4Q32A 1KKRA 5F7UA 2J47A 1QCWA 2CZVA 5T9BG 3GR4A 3H2NA 3ANYA 1JL8A 4LAKA 4QP0A 4ZO9A 3G6LA 4GC3A 2GSHA 2QJGA 3BAKA 5AYIA 3FK4A 3KDNA 1W3KA 3WH8A 3W83A 2EEXA 2V5BA 1W3NA 3OGSA 5EBAA 1OBAA 2ADAA 4TU1A 5B7ZA 3CQJA 3BJTA 2GL5A 5G1MA 1VENA 4RNHA 1YLVA 3I6TA 3M43A 1E71M 2PGRA 1N7KA 2VC7A 1RQHA 2EXOA 4WLCA 2FGZA 3DFSA 5HXMA 3WDPP 4MNMA 2E7FA 3S6OA 1DTNA 3W88A 2OSWA 3GNRA 1PX8A 2W62A 1XDMA 3QY7A 2NUYA 4G1KA 3BLFA 1KCKA 3REQB 4F0KA 2Q09A 4V33A 1PDYA 2G96A 2HQAA 4HU0A 1F05A 2GK1A 3HQ1A 4EE9A 3DGRA 1CYGA 1FHVA 3CASA 6CGTA 1XUZA 3N17A 1SFTA 1VFHA 4GY7A 3LA4A 4BEUA 1V3JA 3KXQA 5KTLA 3GHTA 2PAJA 4MDPA 1UJQA 1W3TA 5C2CA 3NZPA 2H8XA 1JEZA 2Z2UA 4HZ6A 3IJ7A 3F4VA 1F6KA 4BA0A 1CXKA 2GZXA 3O06A 2CW6A 1SR0A 2ZRVA 2A3LA 5CJ5A 3B9OA 1TA3B 3NL6A 4A2RA 1JCLA 1PDZA 3LGGA 1WNOA 3ABXA 1WQ5A 1VFMA 2QPUA 2PCEA 5K3VA 3L2LA 3BLLA 4DO4A 3SFKA 2IKIA 3TROA 4IQEA 2VP8A 1MUMA 2XWDA 3PWIA 3E6EA 4Q8OA 2PWUA 1FBAA 1D2KA 2PDQA 2HPIA 1AVAA 4JR5A 1OFAA 2PDLA 4XD4A 3RR4A 4IG2B 4M56A 1R9XA 2OG9A 3SGGA 4RZ5A 4WEVX 1EEXA 2GGGA 4FIQA 4DQWA 2HNEA 3SRKA 4F66A 3STEA 2VO5A 4GUFA 5HUOA 3E1F1 1P4CA 5JU6A 4B3KA 1UJPA 2YFOA 2UWFA 3UGVA 2GVEA 2WHMA 2CWXA 1YADA 8XIAA 2W3ZA 4I90A 1V51A 2BWGA 3JS3A 8XIMA 1OYAA 1T7LA 2VCCA 3AUOA 1JDFA 3L9CA 3QFWA 4PSPA 5JH2A 2DUAA 4DRSA 3WNLA 4HPHA 3MUIA 1ODZA 3BCFA 6TIMA 1E0UA 3VIIA 4B5TA 4JD4A 2JEQA 1JPHA 1ICPA 2C71A 2J7GA 3I4EA 2D23A 3B97A 1JF5A 3CWHA 3VTRA 3BLDA 2GUUA 3HMJG 1B54A 4M5PA 3K5XA 2OWXA 4I3GA 4O4WA 3FGCA 2R82A 1RBOB 4JHOA 2FDMA 3UD6A 3CS2A 5E70A 3NSNA 1CDGA 1U1JA 3V35A 2FMNA 3LLDA 5D4YA 3EA2A 3PWAA 3NZRA 2E28A 4CQAA 1Z89A 5BW6A 1XSKA 1ONXA 4GQ0A 1PHWA 4C65A 1GZ1A 3B4UA 3KCLA 2DW7A 2CXGA 3C8FA 1A5SA 1AFSA 1QNOA 1EGZA 1VRDA 3LRLA 1P6BA 4UZSA 1PZ1A 4LS0A 1VFSA 2J79A 1XH1A 4EPKA 1DWGM 3QY6A 4OTKA 4PMNA 4UCFA 1XJBA 1ZAHA 4PBFA 3H7VA 3G24A 5FEWA 2J7BA 1P6CA 1DEDA 3ZLHA 1A3WA 1TCMA 4OECA 5LYRA 5HOSA 5BWAA 1PYFA 1JZ2A 5CC5A 3IANA 3N14A 2I7GA 1ZAJA 4UFIA 5AHNA 2E0PA 5AHFA 3W76A 3TYBA 1V0MA 4NAFA 5D02A 4HPNA 1HO4A 1G69A 4L9XA 1E15A 1M68A 1BFNA 1EWEA 4QDWA 3QQ0A 3NG3A 4HK6A 1ITQA 2CLFA 3QPEA 4KMQA 4I9TA 1GVIA 5MHBA 2PWEA 4NY2A 1TWDA 4ICCX 1SMDA 1XIDA 3GXIA 4QRNA 4LS2A 1LL6A 4GD0A 4GQGA 1LL4A 4KWWA 1BXNA 3WF1A 4ADTA 2W79A 3BURA 5JBFA 3TLQA 4HZ7A 1L0PA 2V0TA 1ZCCA 1S39A 4AD0A 3ZJ6A 1E4IA 4TOQA 1OFRA 2VX4A 4MPQA 3TVAA 2QJNA 4LAUA 1AH0A 4NKCA 1OJXA 3AMKA 3U9IA 1VPXA 3UY7A 4AD3A 4HSNA 3C3UA 2HEJA 1E6NA 3G8EA 1Q45A 3ITXA 4IGNA 3KVLA 3SSZA 3TAKA 3OPSA 1KM1A 1TR9A 3FJLA 5HWMA 2Z1VA 4HJWA 3FYOA 3QMSA 3H4XA 4V28A 1OC6A 3C2RA 3GRIA 3CHFA 3PZTA 3VOHA 1I6NA 4M1BA 3UNDA 2J8TA 1FFRA 5E9XA 1DJWA 3WD3A 4YWSA 1OWQA 2VFFA 3QYSA 2ZRXA 2RDUA 2FB2A 5E6ZA 1BWLA 4XIMA 4O0ZA 3ABOA 3W1RA 3CQHA 4Z0SA 2ZQ0A 1FVPA 3IIZA 2ATSA 4O57A 1R9YA 1VBRA 4IJCA 5TF0A 1DJYA 1MEHA 3QZEA 1BPLB 4JIRA 3QW4B 2YB1A 4HZ8A 4Y96A 4GGHA 4Q8QA 3PJUA 3GXFA 4PMVA 3UNTA 3WLHA 5HA7A 3WH7A 3N3TA 4MLJA 5E6YA 4MVAA 4DJFA 1S1RA 1TPEA 1JULA 4W4QA 1XIEA 1FHUA 3GTXA 4K8HA 1GYMA 3DHDA 4WD0A 3RLHA 2ISWA 5CJMA 4GX8A 4XO6A 1YTDA 4PRRA 3GLCA 3B0XA 3E02A 2A6NA 3L21A 2DZWA 1N8WA 2PDGA 3H53A 3F7JA 1YXCA 3G1YA 3QV8A 4KESA 1LORA 1E1FA 1TCDA 4TQTA 3RX4A 1EDGA 4ROQA 3STPA 4GOAA 1X98A 3I65A 1LWIA 2DT3A 1OIFA 3TP4A 3GXNA 3GK0A 4NZCA 4ZO7A 3TQKA 4CD8A 4N42A 4DY1A 3N6QA 1Q4WA 4FLQA 4EKJA 4LV9A 2DFAA 4AEFA 4UTTA 2TRSA 1JUBA 2PTZA 3U57A 2ZZ3A 2WJZA 2RJHA 3WLRA 1OSEA 3WG6A 2ICSA 1O7AA 5HPCA 2GWNA 1RK6A 1UD4A 3AHTA 1C92A 4PTVA 4OJYA 2NW0A 1F07A 4FK9A 1TG7A 2Z27A 2Y89A 4GHRA 3LN3A 3ZJ8A 5HWJA 1UZ4A 5G4EA 1QI0A 4PULA 3BV7A 1NWSA 1PPIA 3LMYA 1EB3A 3EB2A 1JDEA 3VD3A 1VHCA 4AC7C 5AC5A 2BS9A 1TV3A 1UHVA 2WZTA 2FTYA 4FI4A 3CPGA 2Y8UA 1EOMA 1KQYA 4C1KA 2Y8VA 1K03A 4J3WA 2P0OA 1YTKA 2C3ZA 3FA5A 4JTJA 1PX3A 2ODOA 4J5NA 1CZ1A 2HROA 2QV4A 2D2OA 4MAVA 3LUTA 5A8MA 1YE4A 3VIHA 3C0LA 3QC0A 1H5VA 1DL3A 3HJEA 3WQ6A 4ZSUA 1I1WA 1DXFA 2J7EA 5CZTA 1NTHA 3S6DA 3UZYA 3CB3A 4FO4A 7ODCA 3EX2A 1G94A 3BAJA 4QJ3B 2V30A 4NIRA 4GIYA 4B5UA 1W8GA 3CV2A 4R27A 3OODA 3PM6A 4UFJA 4ES4A 3K13A 3WLQA 2F9RA 2FGBA 4C91A 4QNEA 4AIOA 3TZFA 4KFPA 3PK7A 3L2MA 2F6KA 4QROA 3PG9A 4WY0A 2FPVA 1FTXA 1XICA 5BWFA 3DG3A 3TXVA 1HF6A 3TC7A 1UWSA 2YDRA 4Q7NA 1UH2A 4UTTC 4INFA 5HNUA 1UWIA 1WBHA 1TFVA 4M19A 4Y90A 1TMQA 5C54A 1TKKA 1HL2A 4O8AA 1XLEA 1JZ8A 1XC4A 3SY5A 2P1FA 1AH3A 4L7ZA 3EDKA 2EF9A 4JTIA 1X96A 3PNUA 4P8UA 4C7FA 3TR2A 1J0KA 2XVNA 1W9BM 4GC4A 4CD4A 1GKQA 1P1XA 2G4JA 5CSRA 1MNZA 1GTEA 3VFCA 3I3BA 3AO0A 3VOFA 4WF7A 4KEMA 1WZKA 1ZNNA 2GGIA 4JKMA 4NNBA 1EA0A 3IK4A 4JNYA 2BNJA 4MUZA 2WPGA 3QBUA 3VGBA 1ZHAA 4KRZA 3T0CA 1WDPA 5HQMA 3SUSA 4Q6XA 2YL8A 1DP0A 1I2NA 4C5YA 2C13A 1NF7A 3GM8A 2J78A 3PPHA 2HVMA 2E6AA 3GSMA 1YX1A 1A5CA 1BGGA 3AWOA 2YBTA 3VIPA 3NYZA 4F0HA 1U83A 1F6PA 2F61A 4K1WA 3MVTA 4KWVA 5BU9A 5LA1A 3MVIA 8TIMA 4FXJA 3IAQA 4ERIA 2VRQA 1WPCA 3ZT5A 4CQDA 1GKRA 1XGZA 3O9NA 4Q4MA 3VIOA 2V63A 4EF8A 4AZBA 3KRSA 3P3BA 3LEPA 3W2NA 1PO9A 2J6VA 9XIMA 4PZVA 1XQKA 3NPWA 4HPGA 1F61A 2BXVA 1NF0A 2BVWA 1KXVA 2XGIA 3WFAA 3SADA 3VX0A 3TSDA 4UMCA 3STGA 1FCUA 3W37A 2QAFA 5FESA 4D71A 5HNNA 1QU4A 2ATMA 3S3GA 5LGZA 3AXXA 3HM7A 5CGTA 1T96A 3AZTA 4LF2A 3P93A 2BOGX 4RL3A 2W61A 1J12A 3MWAA 3FJ6A 1ITUA 2VR5A 1W3LA 1DJXA 4K37A 1X8FA 3W7OA 1UZHA 2HE5A 4DXVA 1E72M 3DFPA 4ATLA 1QR7A 1Z8AA 4Z2KA 5AECA 1W0MA 2WKGA 4RZBA 1ZB5A 1Y5XA 3B9DA 3RU6A 1M5WA 3LLXA 2BVDA 2Z25A 1GWJA 4KFOA 1KM5A 4AXKA 2V67A 1L8PA 1TTJA 1NP0A 3L0KA 3FYYA 5CG0A 3P8IA 4UTHA 5J5RA 1Q2SA 1FCVA 3E5PA 5EGRA 2O9PA 2QUVA 3OG3A 3OLEA 4D2JA 3N29A 4RZ6A 5CPSA 4DWDA 5BZAA 4PMJA 1JUEA 1IGWA 4HNTA 3ZR6A 3KL3A 3WLNA 2YLLA 3VMPA 2Z7KA 4N9EA 4UMAA 4NI3A 3AOFA 5HNTA 4GYPC 4RDWA 1QW8A 1S2WA 3L7RA 4WKAA 5G5IA 3FDGA 3AC0A 1I60A 2C1IA 1R3WA 3TU9A 1E0VA 3GR8A 1T8QA 1VPYA 4HN8A 2CNCA 3N25A 3H12A 4PUJA 5EKYA 3WQEA 1G01A 3ZR4A 3VE9A 3D46A 5A6BA 3L5AA 3LXBA 1I4NA 1TV2A 3CO8A 4AFYA 1JPIA 1L6GA 4C6KA 2NUWA 2XGBA 3XINA 4CVUA 3VDAA 4W9TA 1KR1A 1UH3A 2E6FA 4NI8A 4R7WA 1CT5A 1SW7A 4LY8A 5DRIA 3BSHA 3NNTA 5FL0A 1NFBA 4DBUA 4OHQA 4MWAA 1KV8A 3F2CA 1JI2A 1GTHA 1ZJIA 1LQ2A 4M81A 1MFVA 2CLIA 3ORWA 1NDYA 1W3HA 2VURA 1A5BA 5I03A 4FNSA 1AW5A 3G22A 4H6QA 4Q4SA 2D2JA 3EDEA 1BWKA 2HJPA 2WKLA 2ZCGA 1TX2A 3VNKA 4DJFD 3L4UA 4JDBA 3EBVA 1NARA 1Y5VA 1C9WA 3ELFA 2FIQA 3M4HA 3CAVA 3KCOA 2TMDA 3OZMA 1IIHA 3GDBA 3LRKA 1R86A 2JF6A 3N9KA 3VD4A 4DNMA 3WDIA 1E0XA 4Q6JA 3SN1A 3KHJA 2PC8A 1BVWA 2E5CA 2IKHA 1FQ0A 1VIZA 4IWWA 1R87A 4O1FA 1AZ2A 2GJRA 5H6HA 3PR2A 4HMNA 4LBRA 3VK5A 4U4MA 4TX9A 3WLTA 2VJXA 1YIXA 3XIMA 2HNHA 2BBFA 5JH1A 5DY2A 5ABTA 4AWTA 4MAZA 4FNQA 3LMZA 4LVDA 2V2CA 3EWXA 1KGXA 1U1UA 2X16A 3W26A 2OTDA 4V27A 3OO2A 5LA0A 1POJA 5I3DA 2E8YA 1YBQA 3NEHA 4O4VA 4XX6A 3BG9A 1UWRA 3LM3A 4MWAB 3A22A 1SU5A 3KWXA 5BMWA 4AX6A 3E12A 3GUWA 4HTBA 3K30A 3TTOA 1S2UA 3UF9A 5BOOA 3AMDA 1B0IA 3IV3A 1HW6A 2H8ZA 4U33A 3PBYA 1EC8A 4PC8A 5IHSA 3C2FA 4H8VA 1YQ2A 3QLLA 1XX1A 5I7GA 3RXZA 4F48A 1RXOB 4N0RA 5EYWA 4RX0A 1PCKA 4HKPA 4IISA 2OZ0A 4TXEA 4MB3A 4M80A 2OODA 5A1AA 5IBXC 1EZ2A 1WB0A 4E8CA 5LNUA 5HR7A 4B4FA 1XYMA 1GCYA 2D0HA 1ME9A 2A3AA 3UJSA 4PMDA 3FA4A 5CZSA 1FWTA 3USZA 3MT1A 3G1DA 1SW3A 3LV5A 1DE5A 4F9DA 3OG2A 2V5LA 1KNWA 1OFDA 1VCFA 4PMUA 4UOZA 3GG0A 1MZHA 1CXIA 3C8NA 1XDJA 2WCSA 4D6HA 1BSLA 4PCTA 4PMXA 3WH5A 2W91A 1FWIC 4FXRA 3LPPA 5FF3A 4AWSA 1UQZA 2CITA 5AC4A 1V3LA 3KLKA 1XWYA 3K4DA 3W2UA 1FKXA 2BVYA 4GO8A 1K4HA 2CZ5A 4PTNA 6REQB 5AZ1A 1SUXA 1A0DA 3ZWSA 1IT7A 2GK1B 3QZAA 2JE8A 2X0YA 1MUCA 2XH4A 1US2A 2Y7DA 4XTIA 3M5VA 1GGOA 2FJUB 4QEEA 4PRWA 3UZXA 3GXTA 2XN1A 3E74A 1JCTA 4AIEA 1LZOA 4H8NA 2TPSA 2W63A 3E0IA 3QEZA 4KT2A 4Z08A 3THDA 3MHUA 3GVGA 4W87A 2I17A 3CO4A 2R1KA 1XM3A 2V2DA 2ZE0A 4KCTA 5JXQA 2WC7A 2QIWA 2QW5A 4ACYA 2OFJA 1EJTC 2H9AA 4DXKA 1LM1A 4LRTA 3D3FA 4L1XA 4MNKA 4ML4A 3N18A 1GOXA 4DN1A 4LTSA 4QLLA 3E96A 1BYDA 3FJNA 1UUOA 5B80A 3MW7A 3VM7A 2JIWA 1I2RA 4IOTA 3GAYA 4J2MA 4MIMA 4X3ZA 2NT1A 1S5WA 3W24A 2F7FA 4IMEA 2A85A 3T07A 1F4HA 1G4SA 3QKZA 5CXPA 3T7VA 1GZJA 3IGUA 1G7VA 2DGAA 3URQA 3U4AA 4LNCA 4MWAD 3CZEA 3ONBA 1UKQA 3M0XA 1JIBA 4XV0A 1IV8A 3ABSA 3ZZ1A 3GH7A 1H4PA 1OCBA 1VFOA 3EDJA 4RE4A 3SUWA 1SQ7A 2EJAA 1E3XA 3UR5A 4CN4A 1UUMA 1MEWA 4D1JA 3CT2A 3V1HA 1TUXA 3EB4A 3G1FA 3LK6A 4A3YA 3V4BA 1XP3A 3RPMA 4Q7IA 1WKEA 1QOXA 1FWCC 4PH6A 4UC5A 1PIGA 2J9ZA 1FCBA 2OSXA 2WHLA 5SWUA 1GVEA 1XYCA 4LUSB 3UEQA 1S2TA 2IKGA 2ZVRA 4EXQA 2PTXA 2FDSA 4ZO6A 1AG1O 3POHA 3M0IA 4GCXA 4Z2GA 4LAMA 1OT2A 1SJDA 4HHLA 3SIZA 2V3DA 1RP8A 4XSLA 1NH6A 1R3TA 3ANVA 3S2JA 2D69A 1VFFA 2PLCA 4PMOA 1G0CA 1KRAC 4PMRA 4DJEA 4EPDC 4HOXA 3WK1A 4QE5A 4B5NA 1NDZA 5FEPA 1W5PA 2GJXB 4PUEA 2XM2A 1LTDA 2LLEA 4BI7A 4FOJA 3HPAA 1BSIA 4P8WA 4B5SA 4LQ1A 2G37A 2Y70A 4KGJA 4DM1A 3WFLA 3GNNA 1V6XA 2QCHA 4KEZA 4BI5A 4RNJA 4WZHA 4GISA 2WQDA 4A4AA 4IIFA 4OOZA 4QE1A 5A6JA 1FXQA 5C0QA 3HGSA 2V3GA 3W27A 3C2VA 1AQFA 1RBAA 1R6WA 1V6UA 4J3VA 2P3ZA 3THUA 1EP1A 3N9RA 1OM0A 1TV4A 3AHZA 3WLIA 4QNWA 2PMQA 4DF1A 3W7RA 1ADSA 2QUNA 2EPNA 3L23A 1E1CB 4O1EA 3W22A 1R46A 4JIQA 3N2TA 1XUUA 5G2HA 4Z17A 5FA5A 3IJ9A 3LZ5A 2WHJA 5D8WA 4Z2LA 2OZTA 1EIXA 4HYWA 1TIWA 4JX5A 1D3HA 1W1TA 1V03A 3BGJA 2C18A 3VDCA 1QRQA 1ONWA 4DJDD 3A4XA 3UFYA 2ZUWA 4H9UA 2CLOA 3RLGA 4CNTA 3KOXA 3LS9A 1W9UA 2PF0A 3AS1A 3UXKA 4M24A 3U8GA 3VOIA 3H2EA 2E6YA 3ABQA 3W7MA 4ZEPA 4FS9A 3KS6A 3T8LA 4DI8A 1R3VA 4MB4A 3CQIA 1B3WA 1JZ7A 1WP6A 3KS5A 3QH2A 1VBUA 1I75A 3LPGA 4L6HA 1EPXA 2ZRZA 3MU7A 2WBKA 4Q8VA 3TSMA 1Q6DA 5DT5A 5EFDA 5LA2A 5G4WA 2FLIA 1M1BA 5ABGA 2KZHA 3DKJA 3GVQA 2FPTA 3OVGA 5U4NA 3ZIZA 3IV8A 1TWWA 3HQNA 3VKCA 1LYXA 1TQXA 5EL1A 1IIGA 1JZ5A 1VFUA 5T8GA 1ZTVA 3DX5A 1NQ6A 5C9WA 3GHRA 3VNJA 1XD1A 1A5LC 1W37A 1EGVA 3FFSA 4ZOAA 4H01A 4YTRA 3HMCA 4NYUA 1QATA 1FWAC 1HKWA 3PULA 5FF2A 2H90A 2PFHA 2CHNA 1GVFA 3TKFA 3D0CA 3MYPA 1GZGA 4JFWA 3PN8A 4H2CA 1H7RA 2A3HA 2DZTA 2HS8A 1OC5A 2OT0A 1U33A 2GGEA 3V5OA 5BOFA 3CK5A 3LERA 3M41A 4QLJA 4NT0A 2EO7A 1UOZA 1R7AA 1BF6A 4E2VA 1HJVA 4I9JA 5M3WA 1R2TA 2NVAA 3TW9A 3TTSA 4DNHA 1JDAA 4D8ZA 4A6GA 1CGUA 3TN3A 1G67A 3APTA 4H6RA 3JZUA 1J6OA 1V93A 4O14A 3CZKA 5AHEA 3TIMA 2PDHA 3GDLA 1WXYA 4GYJA 1BGAA 2QV5A 2ZRWA 5DCEA 1UOKA 3UG3A 4GO9A 4H6KA 5KZEA 2YCKX 5IBXA 3AIUA 3HPXA 3NPXA 4QIUA 4KPLA 3AYSA 2FKPA 3T2OA 1CXHA 1GOKA 2ZC1A 1IWAA 3EWYA 7REQA 1W2PA 4MY9A 1EUNA 3F1QA 3M64A 2O7SA 1VLIA 3AYTA 1VC4A 4ZE5A 3LB0A 3ITGA 1XLIA 3IWPA 1XC6A 5E0CA 3WLSA 3C0QA 1WDDA 3H4GA 3ZMRA 4IPNB 3VD7A 1KTBA 2A7RA 1TWZA 3G0SA 4QM1A 4XUGA 3PJXA 2E9BA 4GYFA 1RVGA 3BC9A 1O95A 1OGBA 3DOPA 1I9CB 4FPSA 3EEZA 1E1EA 3BTNA 1ICQA 2VEFA 4LY4A 1H7NA 3KTXA 2ZA3A 2D20A 2WZMA 2ONEA 4W8BA 3NQ7A 3UG5A 1A0CA 1TZ7A 1R38A 5D03A 1LOLA 4J27A 1UD8A 4NAEB 3IJIA 2JEPA 3JZEA 1HJXA 4PCSA 5E1QA 3G5EA 4CUCA 1DJNA 2XN0A 4JQ3A 2O0TA 3SUUA 3S4TA 3KBWA 3KOFA 1GVRA 1WAWA 1FH9A 2IKJA 1UCWA 1NM9A 1JAKA 4RE2A 1B1YA 2PDIA 2EGZA 4XAGA 4S23A 3BGGA 4DELA 2BY1A 2C7FA 3N4FA 4DBWA 1L6SA 6ALDA 3PBWA 1KFBA 2EPOA 3OZPA 4FNRA 2OX4A 5EY5A 1PEZA 4GNKB 3WYZA 1GPFA 2SFPA 4HK5A 3IS4A 1CXFA 3GZ3A 4ZENA 4EXBA 4LB3A 1TV5A 1NELA 4L5ZA 1XW8A 1VCGA 2ZDSA 2XZ7A 4OWGA 3CTLA 3PZUA 3WD1A 2Q8ZA 3JR2A 3PZGA 4W86A 4DBSA 5A6TC 2UBPC 1OFOA 2PS2A 1W54A 3PZMA 2YYTA 2BHUA 5K9CA 5HATA 2I5IA 1IR1A 4ZB5A 3SBFA 1SW0A 1Z41A 5DELA 1X6NA 1GVQA 5DCBA 3WBWA 5U7SA 1DOSA 1H61A 2Z1BA 4PMYA 4ADUA 3MDWA 5HULA 2ZE3A 4H1ZA 5F2IA 2BY2A 1XQLA 1UA3A 3TYDA 3KZPA 4ERGA 3GD6A 2CYGA 4S39A 5A2AA 4V1XA 1NDWA 2YXGA 3VUSA 1PX4A 4US6A 4DM2A 3KEHA 4O11A 5F4SA 4DPQA 4GYPA 3FVDA 4OZOA 3KX6A 2VQUA 3RLUA 3WD2A 3QGAC 3NO3A 3ALGA 4C1LA 3LY0A 4HT3A 1GOOA 1BVNP 4O0KA 5A6LA 3TFXA 2O9OA 2P3EA 2R6OA 3R10A 3HGJA 3UZWA 5ABFB 1ECQA 2VNCA 2DSKA 4U3AA 3A21A 3PG8A 3ZXWA 2DJLA 3DAQA 5FJJA 2Y5JA 4M7SA 1WDQA 4YLWA 4PL1A 3LCXA 3BICA 5A3HA 2QULA 1O4UA 2GVYA 3RLVA 3VPLA 2DT2A 4HA3A 3L4XA 3TJ4A 1R3RA 3MZ2A 4OBRA 4NJHA 3UY8A 4JIHA 2X40A 3B4YA 3PVFA 3TCEA 5CBIA 3T78A 2ZICA 3W0KA 3B3DA 2FTWA 2QKFA 1HO1A 4S38A 4IICA 3V18A 2JQXA 4AD1A 4DO5A 3G3MA 2W4XA 3JVAA 1Q6OA 1X1NA 1XI3A 4D6DA 4PFMA 3BG5A 4WKHA 2BHYA 1XXXA 1KA9F 4BWLC 5EMMA 2X2GA 3ONCA 3NEVA 2YCEA 2QUMA 3N11A 1K7EA 1MVYA 2YA1A 3VXGA 3SSJA 3MI2A 3BG3A 3P7YA 3IJLA 2DU2A 3O7UA 3CWNA 5GJNA 3E0LA 3AXIA 3MO7A 3DFHA 1IEVA 2PWDA 1I1XA 2CZFA 1QK0A 4I7WA 4ZOEA 2OEJA 1VYSX 1DWHM 1GQIA 1XKYA 5IHRA 1XCFA 1DIKA 2XUCA 4AX7A 1TVNA 1FWRA 2HWGA 3O8AA 3AZRA 1W1YA 4JTDA 2GGJA 4DWSA 1NSJA 4E6MA 5KEZA 1ME7A 2VQTA 3WLLA 5D9PA 1QBAA 2OCZA 4ZFMA 3S47A 2ZC8A 3NXLA 2HK0A 1J96A 3W38A 3Q94A 1R85A 3QSTA 3HFYA 1Q13A 3L65A 3ARXA 4DBDA 4FLOA 4XUYA 4L80A 4YWIA 4N7QA 1OX4B 1H0IA 1AODA 5IRPA 1W17A 4R53A 1ZLPA 4FNPA 3NFUA 3EOLA 4MLRA 3F4WA 1C8YA 2HZGA 4NX0A 3N19B 4HNLA 3UP8A 2NLIA 4ZB2A 1EP3A 3C86A 4L1WA 2NSOA 2WMKA 1GQLA 4JIPA 1GPWA 2F2HA 1GOIA 3VNDA 1T5AA 4RZ4A 3QZ6A 4HHPA 1ONRA 3R25A 3RUBL 1VS1A 5T91A 4WDTA 3CMJA 3W29A 4AZ6A 1BTMA 4JDYA 2E25A 4D6CA 5TQLA 3OA5A 4B92A 1GONA 1MXDA 1R0MA 4P61A 4US5D 5C2GA 4IIEA 3OGRA 1I45A 2H3BA 3UBPC 4KCWA 4Q3MA 1CWYA 5HK4A 2J13A 1NWRA 4CKQA 2BODX 4IIHA 4NNCA 3GYEA 4POCA 3PUDA 4UIOA 5FJRA 3AMLA 4J3TA 4WXYA 1PIFA 4TR9A 1BTCA 2PGEA 2XDFA 5FJIA 3B9AA 1V3MA 4XKYB 1UMLA 2FYMA 1PXGA 3NXFA 4GZEA 3WNOA 3DH7A 4TV6A 5IFPA 4JTKA 2XFWA 5TIMA 2YA0A 1POKA 4XWUA 4EX4A 2ZADA 4JTQA 2OO6A 1UR1A 2PTDA 2ZVIA 3SRHA 2X1TA 5GJPA 1YXYA 3GDMA 2GOUA 4KERA 2AMGA 5C9RA 2R24A 3LQGA 2QPXA 2OYKA 5F1VA 4H9XA 1RLCL 3EX6A 3V0TA 6PTDA 4WOZA 1FWFC 1JQXA 3FKRA 1KM3A 2R94A 3UWUA 3TNBA 4ZQPA 2C1GA 5EBUA 5FJPA 3PNZA 1VLWA 5F4WA 2WZHA 4B9YA 4WOQA 3MKKA 3GY1A 4B16A 3UG4A 2VM8A 4XZBA 4EVZA 3SRFA 1W31A 1P48A 2PURA 2V3EA 2ZA1A 4PCNA 3RITA 4V2XA 2A79A 3BL3A 1VBHA 1EX5A 4XTDA 2GFTA 3H23A 1X1ZA 3WMCA 3WDHA 1F5ZA 1S2AA 3S83A 4PE8A 2FVKA 5E0KA 2PDWA 3K4AA 4W93A 3AXKA 2CPUA 4H41A 3KCJA 3OEXA 1JNDA 1FOBA 2XYLA 2P10A 4GINA 5I77A 1H7WA 1WDRA 2XIBA 2E9MA 2VC5A 4ADSA 1E4LA 2A3CA 1JR1A 1ZBCA 4JQ1A 1RP9A 3LGEA 3ECQA 3NQCA 4AZGA 3JRKA 4X63A 3CZ8A 5LIYX 3HG5A 2HK1A 3B0PA 1QPRA 1H7PA 3NQEA 1JF6A 4AUBA 1KBKA 4QEHA 3H6OA 4F2TA 5JBEA 4AISA 3DFNA 4HA4A 1FCQA 4JX4A 1CXEA 1P1MA 2VFDA 2G3FA 3NOEA 4OKDA 2EQDA 1S5TA 5I0DA 4XKYA 4FLSA 3P5YA 3C2OA 4LWWA 1OCQA 1I2PA 1FY6A 4WDXA 3M0LA 3VZXA 4LSBA 1G4PA 2EBNA 3GTNA 2XFFA 2XWEA 4Z2IA 1OINA 4LCQA 3NURA 4FB7A 3CBWA 2OYLA 4AG0A 1H60A 4A05A 3U2CA 2QCMA 3DIPA 2WLYA 1VYPX 3NDYA 5FOOA 3DESA 3PFMA 3K2GA 3GO2A 3AIEA 4UTWA 4DB7A 4W5UA 2YZRA 1EL3A 3A5VA 3BOXA 2PC4A 1KB3A 1EJXC 3AAMA 2PDMA 1TTQA 2CESA 2IXVA 3DUGA 5CPLA 3KOWA 4UTWC 1T40A 2IW0A 1W8SA 1FWGC 5LNRA 1EF3A 4J1OA 1DV7A 1TQJA 4GJJA 1CECA 1YW1A 4WGXA 4PUMA 1CW2A 1RV8A 1FX6A 1E56A 1YNQA 3EMZA 5M17A 4PMZA 6XIAA 1SJCA 2XM1A 1TV7A 4R5EA 1KW1A 2Z6IA 3A9IA 3RJYA 3D47A 5TAOA 4N4QA 3B8IA 3MWCA 2R1PA 2NSXA 2EKGA 1WKFA 3BJFA 1GOMA 3O05A 4PCFA 3E49A 5GNZA 1B2YA 1J9YA 3AXHA 2Z0IA 3PPCA 4P7NA 3VUPA 1E43A 4DIAA 3SCOA 2IMRA 3FXGA 1M7XA 3CZLA 2CHOA 5D9NA 2A3BA 2V3FA 5FEXA 1S2CA 4C6OA 2J7DA 4G5DA 3TNOA 1I2OA 4DJDA 4Q8MA 2DEPA 2BGNE 5HINA 1CCWB 2WVVB 1V02E 1Q4NX 3G1HA 4Y9NA 1ODUA 4PRTA 4Q4KA 3RN6A 3MV01 4GK8A 1HL8A 2OELA 4P7RA 4PUWA 5ABEA 3R11A 2C8NA 1JVNA 3S5SA 3AMCA 4NNAA 1E4NA 2VC6A 3N4AA 3NQ8A 4Z1AA 4LOCA 3DBNA 4BHYA 1QW9A 4NX5A 2VZTA 1P0EA 5I3IA 5HJXA 4DF2A 3BUVA 2VELA 3SCVA 2I1OA 2INFA 1O12A 3PUGA 4A3HA 1PVNA 4UOJA 3A24A 4MHBA 4TMBA 3CU2A 4C6DA 2WM0A 4L6DA 3NQMA 5DBUA 1TPWA 4MWAE 1SSDA 4L1GA 4Q8UA 4LALA 2QXWA 3M5XA 4J35A 3VMOA 4Y9PA 3U6WA 2ZZ4A 3ZLGA 3QV9A 4L9ZA 4DJED 4QBXA 3RM8A 4K7YA 2Y5SA 3VIKA 4PMQA 5FJTA 2AGKA 3C0JA 4I8YA 4L4PA 2YZ5A 1Q65A 2VOTA 3FSTA 1CLKA 4RW3A 3S5YA 1E70M 4C6JA 4Z1DA 3UJFA 4WHBA 2BVTA 1MUWA 2AOSA 4JY9A 4WJXA 2VKZG 1SO6A 3TQ0A 2PRMA 3TLLA 3C6CA 1XYBA 5EU9A 1B3XA 4ML9A 1XLMA 4R3UA 4XD5A 1SJBA 2V6AA 4J40A 3TOPA 1P7TA 1C7SA 4Y9OA 3GFYA 5HANA 1JYXA 4QX4A 3GS6A 3F4CA 1C91A 1V7AA 5E9AA 1S2VA 3W4RA 3WDQA 1IEIA 1J2BA 1DBTA 2BXZA 4S3BA 1PKYA 3DYOA 1TUFA 3LYEA 3BSGA 4S3FA 3M0HA 1DJQA 3AFBA 2DV0A 4HNNA 1V0LA 2PWVA 2XVKA 3FIGA 4Y8FA 1OG6A 3CNYA 4IXHA 3TOYA 1ZU8A 3ATZA 1S5VA 3NM1A 1T99A 1LF1A 1GJUA 1LBMA 5ECUA 3S2LA 4MM1A 1RA0A 3L0NA 4GY1A 5J5DA 3BQ6A 4JYDA 5I23A 2ISVA 3BMWA 1XIFA 1E55A 3BPWA 3F5LA 2J8GA 2PP1A 1XLFA 3INPA 3W7JA 2Y4SA 4MZ8A 4HBKA 1ISWA 3K8LA 4R33A 4MY1A 4JL1A 3W84A 5XIAA 2RHGA 4IZGA 2V5CA 4LB4A 1L6YA 4C5ZA 1U22A 1H7XA 3PSVA 3TUUA 1TB3A 3LGDA 1KKOA 4D6GA 3CAQA 1KRMA 3PTQA 4UQCA 1SGJA 1W56A 5D9OA 3TCSA 3WQCA 3VKAA 4AIBA 3EKLA 4LFYA 3UXDA 1MO0A 3NJ3A 2WLZA 2GSEA 3RPTA 2WJEA 1B3ZA 1BLIA 3DERA 4NRSA 1KWGA 3RF9A 5H8MA 1ZCOA 3MMWA 2PBOA 1VBGA 4Y2WA 3CL8A 1UG6A 4CCZA 1EPVA 4JHZA 4AC1X 3EMCA 3VC6A 1BRLA 1KCXA 1OCJA 1C8VA 3DEQA 1H51A 5MKGA 2WKJA 2HMCA 3CZJA 4G2DA 4DPPA 1C29A 3LOTA 3MANA 5J04A 4HCDA 3CMFA 3CUJA 1ENUA 3U7VA 2C14A 3MHFA 4ZCWA 3PFRA 3QR3A 2VR4A 4XZLX 2F6XA 2YW3A 3WN6A 1IEWA 1B4KA 1E6SM 2AL2B 1LRTA 5LNWA 1QDSA 4A8NA 4ZQNA 3O0KA 3S1GA 2FTPA 3VOJA 1A5MC 4HYVA 3B8UA 1UPPA 2XIMA 3RAOA 1THFD 1XISA 4UTMA 2P8CA 4KKXA 2VCBA 3NL2A 3E0FA 5E09A 3RO6A 4IP4A 1C93A 2V5JA 3IGXA 4CGTA 4PYSA 3GVVA 1UZDA 3DYPA 2NX1A 3LBCA 4YNGA 4HJFA 2J62A 3APGA 1W9XA 4JN7A 1EWDA 4FR6A 1SSGA 2DVUA 1XSJA 3MKCA 1DWFM 1SFLA 2F84A 3LZ3A 4NILA 1IT8A 4TVDA 3CL7A 1ZZMA 4U31A 2QUTA 7XIMA 1GG0A 5I24A 3U48A 3B0VC 2D1ZA 2PI6A 2VT0A 1X7FA 4WQ6A 1QI5A 3S1UA 4LEQA 4JZ5A 1SFJA 2XINA 1SZNA 2PD9A 2RAGA 2I14A 3GC2A 4Q4RA 2I5QA 2V81A 5C6MA 1YE6A 1HGWA 3MKVA 4UQDA 4H7ZA 2XIQA 4AMAA 4G1NA 2GJLA 3K8KA 1X39A 4BZYA 5CPNA 1B90A 2O56A 3HO8A 4ZTXA 1Z7AA 2WANA 4H2HA 3W7IA 4H6EA 3WL0A 3EX1A 2HBVA 5RUBA 3EXTA 3R0KA 5F2LA 2WWCA 3GXDA 1VZWA 1X8CA 4OIFA 5CC6A 1V08A 1LP6A 3EOSA 3DHPA 2OB3A 3WLOA 4AIUA 4BQ5A 4GMEA 3EA3A 1HNYA 3IRSA 4G7EB 3H70A 4GABA 5I06A 2FHFA 4E2BA 3LHWA 3RCNA 4RPPA 4RDVA 1G1YA 4UFHA 1KQZA 1AMKA 1E1CA 3T2QA 2FB3A 3VIGA 4FAMA 2H3DA 1O94A 1VB9A 4CQCA 4QTGA 4GUJA 1KXHA 1Q7MA 3MDUA 3PJTA 4LBUA 1DXEA 4OVXA 3BOLA 1IXQA 5HWNA 1VD6A 1F3TA 1UASA 4P7LA 4RV8A 3P5ZA 2QNEA 4IPJA 1TE6A 1KM4A 5AZ0A 1EUAA 4PFHA 1ZJAA 3TN5A 1L6WA 2W6RA 3U2OA 1C8QA 3ITYA 3EPMA 4IMAA 1HN1A 3TV8A 2HSAA 1HZYA 4LNYA 2YCIX 4AXNA 4TX6A 2WMJA 2DW6A 2J6XA 4M6VA 4W7WA 3BH4A 3R13A 3N9SA 3QQ1A 2Z24A 4R34A 1TR1A 4IFKA 1B9BA 4QQUA 4E4PA 1XS2A 1NFGA 3WIJA 2X1UA 4RLIA 3DGBA 1M03A 1IWPA 2PB1A 2REQA 2NWSA 3GNDA 4L9YA 3M07A 3NQ6A 2X05A 4ICNA 4JY8A 2D3NA 3W6LA 1R2SA 3ARWA 3A5FA 4RPQA 2J77A 2XFRA 1KGUA 5ABFA 1XLBA 2ZRYA 2E5DA 1UR2A 1LRNA 2PP3A 1TV8A 3P84A 4A3RA 4BK9A 1AQHA 1XLKA 1EKOA 3F5KA 4IFOA 4EOUA 2HVOA 2NQJA 4ZQMA 3R2GA 2ZUSA 2XIIA 2OZ3A 1RUSA 1UBSA 5L6UA 3GXMA 3K8MA 1LOSA 4N6EA 4ORMA 1JDCA 1C8XA 1TVLA 3HFTA 3KFTA 3UPBA 3AJ7A 5D2VA 3TA9A 4LVFA 1RA5A 1WXJA 3HB9A 3WH9A 3WDJA 3M7WA 1EOKA 4PUKA 1E4MM 2B7OA 1YNPA 3EWZA 2DSUA 1TO3A 4R88A 3UZZA 4XQ6A 3FDKA 3WF3A 3KLLA 3QTPA 3A13A 3WD0A 5CSYA 4G7FA 1AA1B 2YXXA 1GVOA 4MYAA 1YPIA 3ITOA 4LW7A 4AD4A 3W1LA 3LPOA 1VEMA 2NXIA 3UZJA 1DQXA 2ZZ2A 2PE4A 1XV8A 2WC3A 4HN4A 4UNLA 3UJ2A 3VM5A 2PU1A 1WOBA 1F7BA 1PTAA 3EXRA 3MSRA 3PZ9A 4B2DA 3UPWA 5D2YA 4EWJA 1ML1A 2E40A 3H4WA 1OHLA 1PAMA 4N02A 4L56A 3ARSA 3ARRA 5CBJA 1NEYA 3B8VA 1KBBA 4XBSA 2O7QA 4IUGA 4AEEA 4HNOA 4J28A 4MJ4A 4PB5A 1XF0A 2XIOA 1Z9AA 1XPYA 4HNVA 4MG4A 5D2TA 3U7BA 2VGFA 2A21A 4ZA0A 1GKPA 1Z32X 2ZZ1A 2OWCA 2WV8A 3ENLA 3HU7A 4C6FA 3LENA 1E40A 1TWIA 2QMJA 3WMBA 2WOQA 1RVKA 1QNQA 1Q6RA 1DWIM 4TTUA 1L9WA 3W1XA 3C52A 1JYNA 4H00A 5D38A 4XAZA 1E6ZA 2OLHA 4HHMA 3AXMA 3UZ5A 5I3GA 1JRBA 2XHYA 4UQAA 3WCZA 4DZAA 2DT1A 2W0UA 4LU0A 3PZVA 4IGHA 2ZTJA 1LWJA 2HBXA 2ACQA 1LCOA 5JIWA 1W9DM 1ZY9A 4MKSA 1OQFA 5DT7A 3KHDA 1E51A 2O92A 1QPKA 2XSAA 3A12A 3PZQA 4C6EA 4YXGA 1FWSA 5JBDA 2D2GA 2OQLA 1QK2A 3WFZA 1D7KA 1Q5MA 3URNA 2WNWA 1PWMA 3W72A 1UP2A 3TONA 1CBGA 5D8ZA 1KTNA 1UB3A 3M0KA 4N4PA 3O6CA 1DQWA 3TYUA 4IT1A 4JOMA 1MW0A 3IJ6A 2WO5A 1Q6CA 4GX9A 1VR6A 4F0SA 4Q7BA 3CLWA 6XIMA 1GJPA 4IL2A 1EJUC 1A4MA 1MNSA 1MRAA 2OPJA 3MCOA 2IQTA 1UKPA 1HG3A 1OX5A 3VNMA 5AHMA 3OOQA 5CCZA 4CNUA 3F2DA 2PDUA 1JPKA 2AAMA 1NJJA 1W6TA 3O1NA 4EPBC 4GA8A 1Y7VA 1ONEA 5AC6A 5CPTA 4AQLA 4E2OA 3BW2A 1AMYA 4AZIA 3HG3A 5A69A 4CVWA 1R9ZA 3K1GA 1QPQA 4PTDA 1J10A 3I7QA 1W5QA 2YSWA 3TC6A 1XRSA 5A8QA 4Q4OA 2A1YA 3W7NA 2W27A 4ECLA 5ECVA 1H41A 3K1DA 3MQTA 3JW7A 3UW6A 2EPMX 5T9CE 1LLOA 2FZ9A 1PUDA 3NSXA 4HOZA 3VCNA 3ZR5A 3W70A 3IVTA 4REQA 4M0XA 3U2EA 2OSYA 4DLFA 3R0UA 4CD7A 2WZEA 3HGOA 3N04A 3QLDA 3PBGA 2VFGA 3C5QA 4IM4A 1HX0A 3A4AA 4O52A 4TUFA 1YDNA 4KETA 4MB1A 3O16A 1FH7A 3U5UA 1OF8A 3NZQA 2PGWA 5K7JA 3WQVA 4HSOA 4N9CA 1K3UA 1HKMA 3V16A 4JN6A 3MUXA 1RJPA 1X97A 5I3JA 3NIYA 3RJXA 3TW6A 2PU0A 2PDBA 1UR4A 2Y2WA 1T41A 2BX7A 2E5BA 3TYCA 4IJBA 4LVGA 1HGYA 4XZWA 4O18A 4I9AA 4FEZA 1RY0A 4XD6A 3USBA 4UFLA 3GB6A 1X7IA 3SCTA 4CNNA 4NZ5A 2OZ8A 4Q4PA 1WV2A 4H7VA 4WIWA 3I7SA 4PB3A 5REQA 3IIVA 2V5KA 3ES8A 3V1PA 2J74A 3PTMA 3M5ZA 3L67A 2I9UA 2VEGA 4GJIA 2XN2A 2IQDA 2I56A 3A3HA 3FN9A 1FDJA 4NZ1A 3SN4A 3MJMA 1BEUA 4XVDA 1QNRA 2GJNA 4W85A 2QQ6A 1QTWA 3OZYA 1UWUA 1EHAA 1SO3A 3IVSA 3RDKA 4RKAA 1LBLA 3W7CA 2ZX5A 3WL1A 3IIPA 2XFYA 3ABZA 4M82A 4GRSA 1GQKA 4UTFA 4U2ZA 3TN4A 3QJAA 2X0HA 3T05A 3VYLA 4Z1YA 3P61A 3EWBX 1A49A 4HU8A 3ZSSA 3R58A 3WK2A 4ZSTA 1FP9A 3LX9A 2NT0A 1DJGA 3UU0A 5H2ZA 4DZIA 1H63A 3CM4A 3WJXA 4ALDA 1G7UA 2WJFA 3V0SA 3MO4A 4AZCA 1J0ZA 4H3DA 1O66A 3UWZA 3A47A 1IEXA 2VMFA 1MZRA 5CLWA 1ZGDA 3N15A 3R6IA 4IUOA 4DZHA 5C9XA 5I02A 4CCEA 1Y5WA 2BXYA 1GNXA 5D30A 2ZUNA 3E3HA 5JIPA 2OVLA 1JAEA 2BY3A 3GDTA 2HCVA 2CC0A 4H4IA 1KRBC 3E0WA 5FEZA 3SQMA 4IH3A 3VINA 1YDYA 3A23A 1DJHA 4CQ9A 1UH4A 2CXEA 3L4ZA 2QCCA 4OE7A 5KETA 2GUBA 1SZFA 2KAUC 1WX0A 1H3GA 2X0SA 3TJLA 1K77A 4F2BA 1V3HA 2NX3A 2DZVA 2Y85A 3KVJA 1BF2A 5HJLA 1U5HA 4JYEA 3F4NA 3OYZA 1E5JA 4NASA 4KWSA 5D2WA 4DXXA 4W84A 2D73A 4HU3A 5E5CA 1J93A 3VCRA 4CNPA 3B8DA 3KL5A 2E4TA 4RW5A 1QW7A 2C19A 1K9EA 3W7HA 1P43A 3BO9A 3KBJA 4WVXA 4GWEA 1RPXA 3GVWA 4ZQOA 1ITCA 2I5GA 4UXDA 3CTTA 4GUGA 4LYRA 2GGHA 3EGJA 4J9JA 2Y24A 1XYAA 5ABHA 1H5YA 3UETA 4OBSA 5M1TA 4H9YA 1XYFA 2VFIA 3AHXA 3N13A 1UW9A 4M6PA 3B40A 1J11A 1TRIA 5A2CA 5BMXA 2WW5A 1PBGA 3NGJA 4E0CA 1OYCA 1F2JA 3TX9A 2OLAA 1YPXA 3S2NA 8A3HA 1T8XA 1UD6A 1WZMA 3CYVA 3S2CA 2W66A 4WRHA 3RO8A 3I4KA 3FW6A 4BI6A 1LUCB 4JBRA 4XZNX 3DYMA 5CQ1A 3LHZA 4UMBA 1C9DA 3SCSA 3WQOA 3HQOA 4A35A 1XSIA 3SM0A 1W9PA 4W8AA 1L2QA 3ISIX 4EIVA 3L5LA 3BOFA 2P88A 4ZMGA 3IUIA 3B0UX 2CLLA 5AB3A 3DHFA 2YXOA 3AIWA 3UXLA 5CPMA 4NRRA 4W8LA 2QCGA 4UWMA 3G0UA 3NQAA 2R8WA 4IP5A 4OUEA 3RU8X 3E9AA 2QYGA 1J0YA 1XLGA 1MQRA 3I6EA 5DF0A 3QHNA 4ATDA 2GQ9A 2E6DA 1D9EA 2PP0A 2CLKA 1KGWA 5LHEA 4LV4A 5A95A 3SY1A 4LVBA 1KBJA 3HBLA 1VF8A 4F79A 4I7UA 4V1YA 5KITA 2A5HA 2DORA 4WJ8A 3WJSA 1K9DA 4L4LA 1KBIA 2YYUA 3QXBA 3H2MA 2Y62A 4BCEA 2QF7A 2JK2A 4WY0F 5DRCA 1PZ0A 1Z48A 1MRQA 4UTLA 3KP0A 3WX7A 2PA6A 1TMHA 1MDRA 3PAOA 3VCCA 2G3IA 4JCMA 1JZ4A 1JGIA 5LXXA 5C2XA 1PZ3A 3T55A 1XIGA 2OMAA 1JFXA 2DVXA 3CUZA 3FVMA 2GQ8A 3COTA 3W85A 2YBUA 5LHFA 2ALRA 1SZGA 1XLJA 5DFAA 2NX9A 5HUPA 3BLIA 1GUVA 2ZUUA 3QM3A 2E1WA 2ZOXA 3M7SA 1BYBA 1ZAIA 3S5ZA 1A5AA 2XGZA 2E67A 3V7PA 1QI4A 3SJNA 4D6JA 3PTKA 3R0DA 3N6HA 3BAYA 2YKKA 4TO8A 3H55A 2QZRA 4UTIA 3SGZA 3A4WA 2QDDA 1OADA 4P2VA 4HU4A 1F8IA 1RK5A 1UWAA 2AQVA 4GG9A 2GQ3A 2BV9A 1GYNA 4XO7A 1Q63A 3RM4A 1ZENA 4QCFA 4V15A 3L68A 1GW1A 4B5VA 2EHHA 5CGMA 2AKMA 2DDXA 2VEKA 3LRMA 5I09A 1BXCA 4E8DA 1IWBA 1M3UA 4B2DD 1OFPA 3REQA 3MUY1 5HMEA 3SCRA 5CBBA 3F4DA 3G18A 3DZ1A 4S3CA 4D6FA 3W07A 4IF2A 3BK0A 1JQVA 4HPJA 3M9YA 3SN0A 1UKSA 1PTDA 1Q3NA 4D1IA 1OABA 1AD1A 3WY1A 3YPIA 1A5UA 5B7YA 2WZIA 4O16A 4AHPA 1N8IA 1F6YA 2TSYA 5AYYA 4ZXOA 2EG6A 3BAXA 1W91A 4H83A 2YDSA 5DANA 1CGXA 5GPRA 3B03A 1P0KA 4JPGA 2G4FA 3AALA 1AL7A 4F40A 1BQGA 1TA3A 4C60A 3WEZA 1LROA 1SM9A 1XHGA 3QC3A 4XSMA 1PIIA 3WNMA 1TJ1A 4AZ5A 4A21A 3UCDA 5FSDC 1PS9A 4LYKA 3AWNA 9CGTA 4JS3A 1SO4A 4KH2A 3LTYA 1V3IA 1WUEA 2J66A 3R4IA 1UR0A 4F0LA 4B4HA 1IZCA 5BRBA 3BLPX 4DYEA 4PSRA 2PWFA 2XSBA 4P7QA 4C6CA 2A7NA 4NSBA 3P82A 6A3HA 2UV8G 1OEPA 4MJ2A 5FJUA 4LVAA 1O5RA 1KCZA 1EC7A 3BJSA 1F3XA 4TIMA 4J3SA 4H04A 4HP5A 4W88A 4A8RA 4Z1CA 3S46A 3MA8A 2DZUA 2ZWZA 3MCMA 3DG7A 3O07A 4LJ3A 3VDHA 5I79A 5D04C 4C7DA 1AUSL 3QV6A 4AY7A 2Z2BA 4NXSA 3VA8A 5GNXA 1UD3A 2Y8KA 3HPFA 5DO8A 4W7VA 2DSVA 1H50A 2PGFA 4HVXA 3EWUA 4MZ1A 1TZZA 1XYLA 3T81A 3KW3A 2QAPA 1W1VA 1DHPA 1B5TA 2NWRA 2CZEA 2VHLA 2VL4A 3C56A 1B3OA 3GX9A 3RIKA 3QSRA 4WDWA 4AMCA 3U5YA 4WK9A 4WSHA 3A3WA 5BYWA 4IX2A 4DYKA 1DIEA 1HKKA 3RMJA 2YJQA 3C2YA 3DXIA 2Z29A 1Z42A 4LEFA 2ZXBA 1H2JA 4R9XA 3WLMA 1ME8A 2ZZ6A 1J6PA 2E09A 4AZ7A 3VMNA 1NWTA 3G1SA 2FZBA 4UB9A 2Z6JA 3T0TA 2GDUA 5C9ZA 4N2YA 1R3QA 3GIPA 2O9TA 3SAZA 2WM1A 2PRLA 4GJ1A 1VJZA 3SQLA 1M9HA 2VDIA 1PCWA 1DPMA 4L65A 1EYWA 4Q4QA 1J5SA 4JN8A 2JKEA 1H62A 2OKOA 2VD9A 4S3DA 3LLFA 3VO0A 3WJZA 3KP1A 4KFNA 3SR7A 4CQBA 3PZNA 2O55A 2HXUA 2PDXA 3RRAA 2EAWA 3DFTA 1JI1A 1QHPA 3UCQA 1XIMA 1IR2A 2VXNA 1FFQA 5DXYA 1NQKA 3PJWA 4IIDA 1XBYA 3C3NA 4IHCA 2R1LA 3M1ZA 1JPDX 3I3EA 3O6YX 1TVPA 5CC7A 4FALA 1BAGA 1XL9A 1OC7A 1ZFJA 2WMIA 2Z2AA 4FR1A 2P76A 4DUWA 2Y7GA 4DO6A 1KM6A 4BQ2A 4NXKA 4OU1A 3RR1A 4O12A 4XAYA 3STCA 4BWLA 4Q8PA 1NVMA 4RUBA 1E6PA 3MUAA 4CN1A 1YRRA 1UWQA 4IIBA 4FF5A 4IFKB 3VX1A 3ARZA 4WKFA 2V68A 3LXCA 3WQDA 1KFLA 4C6LA 5E0FA 3VFLA 3LU2A 1MW2A 1QNVA 4ASTA 1UBPC 3WNNA 4D9PA 4MUPA 1E6RA 5D05A 4GIRA 3I7RA 3MBDA 3GC5A 2B31A 1E9LA 4REQB 5FF4A 2PEVA 3FV9A 2FZMA 4O10A 1CXLA 3A9BA 2BP1A 4IMCA 3LI0A 2VWTA 4E8GA 1ELSA 3BV4A 4QJ1A 1CLXA 4ZE4A 5AYBA 4HOWA 1CIUA 1SR9A 3ZJ7A 1QWKA 3FHQA 4GBUA 3WLPA 1FWWA 2XIJA 3H7UA 2AL1A 3CIVA 1QHOA 1EJSC 2FZNA 4MNJA 5FKYA 3AROA 3ID7A 4OT7A 3SCNA 1XIJA 3U3HA 1GEQA 4AB4A 3UJRA 1JD7A 3DDMA 4GKTA 4AH7A 2EKCA 2GVJA 4KGLA 1IE7C 2VX5A 4NP7A 4UTUA 2BOEX 4PBGA 2NV9A 2PSNA 4MJMA 3TK7A 4P8VA 1XINA 3F03K 4AW7A 1TWSA 3LHVA 1K4GA 5CLTA 5AC8A 2Y61A 4NJKA 2Z1SA 4JEQA 3MI3A 5DCDA 4GZJA 1NU5A 3WENA 4HQVA 4AY8A 4LYPA 3VI2A 1WZLA 1FUYA 1IF2A 2Y7FA 1J0HA 3SZ8A 4RK8A 4I7VA 1Q7QA 4XBKA 4NU7A 1FWEC 5HDRA 2GQAA 3L4VA 3WQ4A 1LG2A 1VP5A 4XAPA 2ZTKA 1TSIA 4I6VA 5CAHA 4XD3A 1XRVA 2GVLA 5I3HA 2C1HA 3EKGA 4JTTA 1CB7B 4GI4A 1I2QA 4PUDA 3VDBA 7PTDA 2YA2A 3GH5A 1V7YA 1A50A 3NQGA 1TPC1 4DO7A 1W32A 1NIUA 2E9LA 1ICSA 4QS6A 1KRCC 4S3KA 3VC5A 4YHGA 3IRDA 2YOCA 1JYWA 2JGQA 1E5NA 2DIEA 1KXTA 4MKNA 4YU1A 1EFZA 4XZHA 1NFPA 4LF1A 4US5A 1FWBC 3BZGA 4FF7A 3BARA 3LD5A 1B30A 1ZL1A 3CAKA 5KZ6A 4NAFB 3M16A 3V0UA 5DMMA 4A8IA 4UNKA 1JCMP 2PWGA 3GXPA 3FLUA 3I10A 2BOFX 5DQPA 2PLKA 3IVUA 3B8SA 2YW4A 3CLMA 5AVHA 3KWSA 2R14A 3P8JA 3MP4A 3ALFA 4FX7A 3VDGA 4CU8A 2VGIA 3GTFA 4MTVA 2REQB 3O15A 3PBUA 4RDYA 1OT1A 1J4EA 7REQB 4JTEA 2FHCA 4M51A 1XBZA 1HFBA 3ARYA 3ZQ9A 2YDQA 1BYCA 3NR0A 2ZRUA 3KE0A 2Y6ZA 1QPNA 3BCDA 2Z26A 2RGLA 3Q65A 3VKDA 1HXJA 1HJSA 1XD0A 3W7LA 1G5AA 3VD5A 3UPMA 2DY3A 2JKAA 4GQBA 3CH9A 5AN7A 5DEZA 4I5XA 1KFWA 5KSWA 2XG9A 3ZT6A 4LRSA 4L4MA 4FZIA 3EB3A 4XK2A 4CN6A 5AVNA 2OOFA 3M6DA 4NHVA 3SCPA 2HVNA 7TAAA 4RNIA 4EPEC 4X9SA 2B4GA 2VDGA 3CMGA 1SJAA 2ZIDA 2FPYA 2XVPA 4TV5A 1JD9A 3IUDA 1V4YA 2I57A 4OQVA 1WZAA 1LG1A 5I2UA 3W2MA 3MY9A 1RJQA 4FXSA 4LUTB 3I3DA 2VZVA 3WBAA 1TREA 3M0MA 4GIAA 1HKIA 3GDRA 2JKPA 3ZM8A 5J8LA 2R91A 1XH2A 3T6CA 1WDWA 2DP3A 3PTDA 3V75A 3P0WA 4KBXA 3QYQA 4LT9A 5BROA 2PTWA 5CJNA 2QUUA 4PTMA 2QHAA 3B05A 3KBMA 4QDMA 4DUVA 1RJRA 3R5EA 3UWVA 1EX1A 2RDWA 5K4ZA 1WAUA 3W53A 1IZKA 4H9VA 4DUOA 2WAGA 3G2GA 4OV4A 1RCOB 3PAJA 2Y7EA 4NVTA 3B06A 4URIA 3DECA 2QR6A 4ZOBA 1CGVA 3BCJA 1GVYA 2INEA 3HV9A 2CERA 1RLDA 4AVFA 3MC5A 5BXTA 3LHTA 1SYTA 1YYAA 3UJEA 1X1OA 4NZJA 3QR0A 1Z44A 1EDQA 2B81A 5HPOA 3J7HA 2PODA 2D3LA 3QGKC 1NOFA 3FCPA 5JQ9A 1JNEA 5E93A 5D2XA 4LGXA 3VAVA 4GVGA 2A3EA 3QPZA 1VCVA 4K38A 2Q01A 1ZUAX 1V6TA 3FAXA 3DI0A 3EX4A 4CEXC 5DX7A 2WVVA 4FLRA 3QVQA 4F2UA 2PZNA 2DH2A 5AYXA 5A8GA 1DORA 3MZNA 1CNVA 3GG1A 3G0XA 4ORIA 1UP0A 1F3EA 4ZO8A 3F2BA 1R7OA 1M7JA 4AEOA 1GG1A 2V2HA 3PF3A 2G8ZA 3GC4A 2OGJA 4NL1A 1S5MA 2MUCA 4H9MA 3CPRA 3WSUA 3VGDA 4AWUA 3L4TA 4WUIA 3TMLA 1D3GA 2ISFA 3RG6A 3SCUA 3CQKA 1KV5A 1XG4A 3KZSA 5A6SA 1BQCA 4Z2JA 4JTFA 1I0DA 1OVDA 4DJFC 3E2RA 3RCYA 3SJ3A 2J4GA 2VGGA 2Q8LA 2PDKA 1U2YA 3OZOA 4GCAA 5IDIA 3TXZA 4I5UA 3W01A 3TAOA 3EPNA 1PYMA 1YXDA 2EPLX 2JGYA 3GDKA 3P62A 3GFZA 1K02A 5G2IA 2VRKA 1ZBKA 3QFEA 4F0MA 5AY7A 5XINA 1VGAA 3DFYA 4WSKA 1OX4A 1O5KA 1MDLA 1ZJBA 1K7FA 2VI0A 1XCWA 3PZIA 3HQPA 2VD8A 1B9ZA 1TPH1 4KEUA 4ZODA 3Q2DA 2E1DA 3IAPA 3WD4A 1G6CA 4MJZA 4EF9A 2FH6A 2YLAA 1CB2A 4KIEA 1EBHA 5H8PA 1CX9A 1A0EA 1PSCA 2RDXA 1B4EA 2D24A 1UIOA 1HJQA 1XBXA 5M03A 3LCWA 4CU7A 2OWWA 3B8TA 5LIWX 2UZ9A 4WSJA 1A4LA 4PUNA 3NO5A 4QXIA 2V38A 5G4HC 2ANUA 1GYLA 5CPQA 4P8XA 5HAOA 1J8VA 2C6QA 3ZLFA 2NXGA 4UR9A 1NAL1 4BKNA 1H1YA 2CBJA 1RZMA 4WR3A 2PPGA 2OO0A 1PB0A 3GVRA 1BYAA 2OQHA 2ZFAA 3H2CA 4O8RA 2J9XA 2E8ZA 1E9YB 1F76A 3BQ5A 4GUHA 4GNVA 1US0A 3ME3A 4DVOA 5BOEA 3IJDA 4TX8A 3RYSA 3CIXA 5BXSA 1ZALA 3MI6A 1DKWA 1GW9A 3CV1A 4O13A 1Q2RA 3SUVA 3ABRA 3FKKA 2J8FA 3DENA 1K8ZA 4YVVA 1UIPA 5K4XA 4IQJA 5XIMA 1TE1A 3LHUA 3MHGA 7A3HA 4LBSA 3VVGA 2KX9A 2OXNA 4GGBA 2J27A 2GUYA 1V77A 5AFDA 1FDYA 5LNVA 2WSKA 5MF5A 2H9AB 3FNDA 3OB8A 4AF0A 2HV5A 3VOCA 5FCZA 1GORA 2Y63A 1A5KC 1Q6QA 1OFEA 4M7TA 4YCOA 4K3ZA 4JIIX 1NDVA 3MMTA 3S42A 3PS7A 2GOKA 1TZ9A 4MWAC 3AI0A 1LT8A 3SGUA 1VIWA 4GI9A 1W1A1 3FJ4A 4X9YA 1O68A 3GU2A 1UR8A 3HF3A 3ZVHA 1K9TA 2CLEA 4JTLA 3RM9A 4JTCA 2V8ZA 4O1DA 4BQ3A 1AJ0A 4U3CA 4IMGA 1GQJA 2EPHA 2BMBA 4C7GA 3RX2A 1I0BA 4LYQA 2ACSA 4UCGA 1FWHC 3EWDA 2V9DA 2DQWA 2G0WA 2VVSA 1ZSXA 4ERAA 1X38A 4W89A 1ESWA 3M0YA 3W7PA 1VH7A 3SW6A 1TX0A 1WCGA 3PC0A 4C90A 5CH9A 2BY0A 1VEOA 1G9HA 3KOYA 1UD2A 5CZKA 1IXPA 3CPUA 4UTJA 4MFDA 3M5YA 3W9ZA 5C5YA 4NYYA 1M6JA 2DQXA 2XISA 1EYEA 2Z1XA 2VOMA 3CT7A 3NO1A 2GWGA 1HP5A 4MOZA 2NV2A 7CGTA 1LRQA 1HTIA 4MKVA 1TPB1 3NQVA 2ZX6A 1KM2A 3EPOA 4EK7A 1O5XA 2ISDA 3H26A 3G77A 2NQHA 2PD5A 2MANA 2D0FA 1QHZA 3R1ZA 3GYCA 5EMYA 2B7NA 4I6KA 2DUZA 1N82A 3LPFA 4HCLA 4YJ5A 4J2PA 3SRDA 4IQDA 3T4WA 3QOKA 3ZS4A 5HQLA 3GIYA 1K8XA 1VJSA 5BXRA 1A3XA 3R7MA 1RAKA 2PZ0A 2ZKMX 2NVCA 3CYJA 3GR7A 3NCOA 3EX3A 2PLJA 1CEOA 1W1IE 3DC0A 1R2RA 4B3ZA 2WMHA 1ISZA 3GW0A 2E3ZA 3EEGA 2VFHA 1UKTA 2VWSA 3A64A 1VAHA 3DFOA 3UR8A 2P5NA 1DWAM 2POTA 2CBVA 4R7JA 2VTFA 5A6KA 4DLMA 3BLEA 1BG9A 1A53A 2VGBA 3AJXA 1D7FA 1YTEA 3G1XA 3UERA 1VKFA 2JIEA 1JPMA 4JIEA 3GBEA 4NJGA 1IGSA 4IPIA 5CKSA 2VVNA 3RK8A 2VX6A 4KCUA 1DHKA 2YFNA 2X09A 3LNPA 2DPEA 3OGVA 2IPWA 4OUIA 1T6MA 3UWQA 1EBGA 5CEWA 2CBIA 3NL3A 2VX7A 2P50A 1RQBA 4O28A 5KZMA 3GKAA 3NQ2A 3AZSA 4J3UA 5K9DA 3OHMB 5CPOA 3S1WA 4DBEA 2JF7A 4YCPA 1ZRQA 5FACA 4JTHA 2NXHA 1SO5A 3IEBA 4JNMA 5A8NA 4C6PA 1NOWA 3OBEA 1LUCA 3PANA 5IM51 5F4XA 1JZ6A 3LTSA 3WF2A 1KLYA 4M3PA 1H11A 2WSYA 3T8QA 3SUTA 1QOPA 2VZSA 1GEHA 1GOQA 1MXSA 3AU2A 3ZYZA 4K36A 2Z28A 3ITCA 3W28A 3VNIA 2J25A 3SURA 2J7HA 1FP8A 1FWDC 4KQNA 3B0YA 3CUXA 4N9DA 3WQGA 1XFBA 2HRWA 3MS8A 4IL0A 5IFTA 4IIGA 1TJ2A 4HHHA 3KM8A 3CWOX 2P8BA 4C6QA 1IQ8A 1TPDA 2DZSA 1OY0A 3URAA 1OD8A 1WDSA 3MV11 5DMNA 4ZL1A 3ES7A 8RUCA 2PLMA 1Q85A 3WQWA 3WDRA 2QVHA 3B04A 5DLCA 2X30A 1EXBA 3UESA 3MMUA 5D32A 1OFBA 5DY3A 1OGGA 4LUIA 4S3EA 1EP2A 5FAGA 3KBVA 3L66A 4J4KA 1DYSA 2X7WA 5A8PA 1QVBA 3THQA 4P5UA 3SFWA 5LIUX 1CGYA 2XH2A 2AAAA 2Z1KA 3ZVHB 1REQB 5A6AA 3I6RA 4WX2A 3RRXA 3TMQA 3O0FA 2C15A 3LNMA 2XVLA 1IEQA 3FAWA 3LCGA 3AS3A 2WMIB 1SZEA 1DJZA 3NM3A 5HMFA