3VZXA

Crystal structure of pcrb from bacillus subtilis subap. subtilis str. 168
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
227
structure length
227
Chain Sequence
b'MYDVTEWKHVFKLDPNKDLPDEQLEILCESGTDAVIIGGSDGVTEDNVLRMMSKVRRFLVPCVLEVSAIEAIVPGFDLYFIPSVLNSKNADWIVGMHQKAMKEYGELMSMEEIVAEGYCIANPDCKAAALTEADADLNMDDIVAYARVSELLQLPIFYLEYSGVLGDIEAVKKTKAVLETSTLFYGGGIKDAETAKQYAEHADVIVVGNAVYEDFDRALKTVAAVKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heptaprenylglyceryl phosphate synthase
publication title Insights into TIM-barrel prenyl transferase mechanisms: crystal structures of PcrB from Bacillus subtilis and Staphylococcus aureus
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 78
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature ec 2.5.1.n9: Heptaprenylglyceryl phosphate synthase.
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01884 PcrB PcrB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.390 Alpha Beta Alpha-Beta Barrel TIM Barrel FMN-linked oxidoreductases 3vzxA00
1VIZA 2F6XA 4NAEA 3VZYA 3VKAA 4NAFB 3W02A 3VK5A 4NAEB 3VKDA 3VZXA 4JEJA 3VZZA 3W00A 4MM1A 2F6UA 3VKCA 3W01A 3VKBA 4NAFA
chains in the Genus database with same CATH superfamily
5BCAA 2INFA 4HK7A 2ISFA 3IVTA 3M0YA 5E0FA 5AHMA 3EMZA 1L8PA 4QTGA 3IJ8A 5IDIA 4ASTA 1WZLA 3NXFA 1F05A 1UKQA 4IWWA 4Q4QA 3NDZA 1E70M 4D72A 3CWHA 4C1NB 3EX3A 1GQNA 3CC1A 4CU6A 1XIFA 1OK4A 4QG6A 2AL2B 2WO5A 2VCAA 4ADTA 4MWAE 4ZQMA 1EIBA 4GJIA 3WBYA 4B5UA 5KSWA 4QQUA 5FJJA 3FEMA 4XK2A 2WYSA 1HF6A 3BL3A 4TX8A 4PMDA 3T07A 4YWSA 3ALGA 2WOQA 4LS2A 2VFEA 3GBDA 4U3CA 2R1PA 3RYSA 1UASA 4FA3A 4BWLA 1TWIA 4DBEA 3NSNA 1MQPA 2O55A 3CLMA 1W3LA 5A3HA 2WC7A 4ZFMA 4GPNA 1Y8BA 3C0LA 4PBGA 2D1ZA 4BF9A 3DUGA 1H1NA 3ZJ6A 4MGGA 1NARA 5BOOA 4UFKA 3UWVA 4R5EA 2EQDA 3F4NA 4IUGA 3FGCB 1B90A 4LF2A 4O11A 3QLLA 1QATA 2PBOA 5D9MA 3VIOA 4AHPA 1RY0A 4HK6A 2OVLA 4J28A 1QR7A 4S3AA 4Z1AA 4WJEA 3WEOA 1GHRA 4TX9A 2Q3OA 2YLLA 2Z24A 3KTXA 4GIYA 2HXUA 3LM3A 9RUBA 3SCOA 5K7JA 4WGHA 3N9RA 1OG6A 2VEGA 3Q67A 3RM4A 3CMFA 3W7NA 3P7YA 1TJ0A 1OVDA 1Q8AA 1MUWA 2HROA 4GXWA 3QR0A 3KLKA 1R86A 3CZKA 1TZZA 3KVKA 3KFTA 1XBVA 3W82A 3DIPA 1TE1A 3QPEA 4E8DA 4LEQA 1UMLA 5G2HA 1BEUA 7TAAA 4LRSA 4EE9A 4BQ2A 3PZNA 1VGAA 2WCSA 4N9CA 1F7BA 4PUJA 3UVIA 5IBXA 2PTWA 3AIRA 1K02A 4RE0A 5AHIA 2Q01A 1XSIA 2I9EA 2YDAA 5HA7A 4LUJA 4GISA 4E2VA 5IHSA 4PMYA 1P0BA 1GW9A 3CV7A 1XBZA 4NAFA 3BPWA 2HSAA 2PEVA 2A3AA 4IISA 4TO8A 2DFAA 4MOZA 2ZUVA 5GPRA 1J79A 1XR2A 2ZC1A 2G97A 3AS2A 1J0JA 4UTIA 4CCEA 3W28A 4BHYA 4DUWA 4HJFA 5JXQA 3EEZA 4U10A 4XTIA 5A6TC 1XQLA 4W87A 5H1WA 3IEBA 2I57A 2DU2A 4PBEA 3RRXA 4DJDA 4LANA 3BJFA 3VOJA 1XISA 4K7VA 4RR4A 3MB9A 1HN1A 3ARUA 5AVNA 1FWSA 2VFGA 2VMFA 3VMOA 4IFKA 4ZQCA 1F6KA 1K77A 1HVQA 3I3EA 2R8WA 3W7DA 1IQ8A 3RX4A 1C9WA 3U9IA 4JBRA 4UBPC 4LCQA 2VURA 2X16A 3WD3A 5E1QA 3TR2A 2ZA3A 1J6OA 2J79A 2X2YA 1HKMA 2PDKA 3VDHA 1F3EA 2QUNA 1K7EA 1JEZA 1Z3NA 3TQ0A 3PS7A 3OBAA 3NL3A 3LCFA 5CSUA 4PCSA 9CGTA 1BKHA 3L12A 1F8MA 1S3TC 2RGLA 2V5LA 3GNPA 3NJ3A 2A7RA 3WBAA 2CCRA 4X3ZA 4IPNB 4LAKA 3II1A 2WSQA 3TAKA 5CAKA 1SSDA 4AWTA 1V3IA 1X38A 3A13A 4LAZA 3WDRA 4LVBA 2BASA 4MMWA 3NQMA 3KS5A 1V6UA 4FLOA 1H7PA 3TTYA 3KUMA 1VFOA 1AMKA 3RCYA 6ENLA 3V7PA 4IXHA 1N2VA 3QTGA 1Q6RA 2TSYA 3IGUA 5EA9A 2PDFA 1NEYA 4QSFA 4IMEA 4W86A 4GZEA 1Z32X 3GU2A 2NQ9A 3MU7A 4PEKA 1AQMA 1ZY9A 1VLWA 3DN5A 2Y88A 2NSXA 4R85A 2QCMA 5HINA 4DLMA 1JF5A 3ITVA 3AI0A 4MWAB 5E93A 3SY1A 5D2WA 3W0KA 1GVOA 1LLWA 3VO0A 2PWUA 1MXDA 2PTZA 1J0HA 2XG9A 4KT2A 1YNPA 1ZBKA 2X7WA 1MRQA 3UZXA 1NAL1 3NZPA 3TOYA 1O5QA 5D4YA 3UZYA 3ABRA 1EL3A 3QOMA 1ZALA 3W7HA 3DZ1A 3N18A 4H8NA 3CUIA 2XDFA 4OJYA 4RV8A 2OWWA 1IWPA 3ICJA 4O50A 4GOAA 2DEPA 3GVGA 4GG9A 5D03A 4DJFC 2NQLA 2XSXA 4JOMA 1IZKA 3WF3A 3MHUA 1O7AA 5HNTA 3N9KA 3NPWA 4HPJA 4KIEA 3UG8A 3LS9A 3KDNA 1XX1A 1NSJA 3RMJA 4AC7C 4DHGA 6REQB 3IIXA 4A22A 1AH0A 2ZZ6A 3U2EA 4FO4A 1MZHA 2OO6A 3BZGA 4JYEA 4UIOA 2OFJA 1UD5A 4V33A 3UYCA 3WO8A 2F6KA 2PTXA 2PU0A 1RVGA 1FRBA 2NW0A 5BMWA 4C6OA 3LEPA 3UYIA 3TC7A 3E2QA 4G6CA 3B9AA 4H01A 6XIMA 5A5WA 3AIQA 2A0NA 4GYFA 4Q7BA 3GAKA 4PH6A 5A6BA 3R12A 3WUGA 1GOIA 3NNTA 3QSTA 3W1LA 4B90A 4XAFA 1QOPA 4JTHA 3AXIA 3QV6A 1B57A 1NTHA 1RK6A 3FOKA 3UU0A 2YJQA 5EMMA 1TSIA 4JQAA 4FR1A 1HGYA 2WVVA 4XKYB 4LAMA 2E7FA 1UH2A 4C90A 2GLKA 4O1DA 4OUEA 1EA0A 1LM1A 3OPSA 4MAZA 1A5UA 6TIMA 3A4WA 2P88A 4LGXA 3W37A 4AD4A 4GY0A 1KCKA 1FY6A 1DKWA 2HDJA 4GC4A 1P7TA 5ABFA 1NOFA 1M01A 3ARWA 4F66A 1MRAA 1XLJA 1EJ7L 4XX6A 1IEWA 1RSCA 4MZ8A 5F7UA 3K1DA 4N9DA 3NIYA 4DJFD 1R3WA 3WDJA 4HCHA 2X7VA 1UIOA 1YBQB 2I5GA 1EYWA 4CEUC 2HE5A 2V3FA 4CN4A 3BLOA 1O1ZA 1GUVA 1Q6DA 2OOGA 4H00A 2DQWA 4QHRA 3ZVIA 1E9LA 2W27A 4OZOA 2FGLA 3APGA 3E2VA 3EB4A 4ZODA 4POCA 4HYWA 1B1YA 2X0SA 1RK5A 1SZFA 3GAYA 4Y9NA 5JVLA 3GH7A 3HQOA 4A3QA 3GG1A 3Q37A 1HJSA 4ZB0A 1XH0A 1E4LA 4HZ8A 4JNZA 3EEGA 4QFUA 3VOCA 3M4HA 5FKYA 3SQLA 3W7GA 1JCLA 2WCGA 2V5JA 1HGWA 1MXSA 4ROPA 3VIKA 4PMVA 3PG8A 3HFYA 3PB0A 3W87A 4AZ6A 1CB7B 1V3JA 1WXYA 4D6CA 1YMYA 3H2NA 1H60A 2VEMA 1YPFA 2VD9A 1FWCC 3BOXA 1C9DA 3RITA 1ITXA 1E51A 3OG3A 5IDZA 1KFLA 4DJEC 5AZ0A 3S9YA 1JRCA 2OX4A 2V3DA 4Y9PA 1H0IA 4G7EA 1PS9A 5K4ZA 3U5UA 1VJSA 4HVXA 4ZENA 1Y65A 1JZ7A 1KFWA 3C0SA 4E0CA 2CLKA 3LN3A 1I1WA 4UTKA 5I3DA 5I79A 3W2JA 3O07A 3GH4A 1U5HA 1XUUA 3SN0A 4AZ7A 3HA1A 1FP8A 2EBNA 3PBYA 1GKQA 1U5JA 3QV9A 3O8AA 3ISIX 4UFIA 2FIQA 1EC7A 3IUHA 3FHQA 3FYYA 8CGTA 5ABTA 1UPPA 1KA9F 3OW1A 5JIWA 5LIUX 3HGSA 4B91A 4D8LA 2VGFA 2D22A 2QVNA 4AX7A 3F4VA 1EGMA 3WNMA 3BLKA 4PUDA 4CD4A 2VENA 3TH6A 2E5DA 3QOKA 3V4BA 1I0DA 1RJPA 4NXSA 2VDGA 3DHPA 4JFTA 1TPH1 4M0XA 5DY3A 2DZAA 3WLOA 3CZEA 2UY5A 1A4MA 1TA3B 3S5ZA 1SVDA 3LHUA 1LJYA 3GYEA 2PDQA 5J5DA 1IGSA 3LHWA 4DO6A 4CD6A 4K8HA 3M0JA 1TWZA 2ACSA 2GUBA 3PWGA 3S9ZA 5FD0A 2PLJA 2NLYA 2GQ8A 2W3ZA 3UWYA 2VCCA 1GVEA 4UOJA 4QISA 4Q32A 4EANA 3A21A 5AHEA 2WHJA 4B5WA 2UY4A 3MWCA 1SJBA 5REQA 1GJUA 1XBXA 4Z08A 2PBGA 3R7MA 2CZ5A 2POTA 1TJ2A 2B0MA 3EOOA 3VNIA 3I3DA 3XINA 1VRXA 4JQ3A 4LY8A 1XLBA 3OA5A 3WYZA 3IGHX 1GT8A 3GKAA 3W4RA 3RCNA 3ZWSA 2PLMA 1Q7ZA 2QVHA 3P3BA 3WNLA 2TMDA 1TQJA 2B7NA 4UQDA 3WK1A 2PF0A 2QJJA 5D09A 4LTSA 1LRNA 2B4GA 4IMFA 4RDYA 4Q8VA 3T0CA 3A9BA 1MVYA 3UR7A 3AS0A 3QLDA 2EF9A 4QJ1A 1H41A 4IJBA 1W9BM 2BY0A 2J7BA 4J27A 3NEVA 2ZICA 5G1MA 4WK9A 3EB3A 2FZ8A 1E40A 4A3YA 3H2MA 3ZO9A 3LLDA 1WO2A 5DCEA 3VIMA 3O63A 1XLIA 5FESA 2WAGA 3R10A 4XZ9A 1IXPA 5C2CA 1K9TA 3GVVA 1NWTA 3TA6A 3F5KA 2F7FA 4AZGA 1H1ZA 1KM1A 4MKVA 2CHRA 2F6XA 1R9YA 2JGQA 1FWNA 3W29A 3WQDA 4BQ3A 4JX5A 1MO0A 1TR9A 4Y2WA 3REQA 2RDUA 3BTNA 2DV0A 4YNGA 3TW9A 1PTGA 3KL5A 1OX5A 1VHNA 3OHIA 3ITTA 3R0KA 2CLIA 4JFWA 3N6QA 3B3DA 3QY6A 3NDOA 1EH9A 3P82A 1RXOB 2P50A 3S47A 2DORA 3UZZA 3U6WA 4DM2A 4CN1A 1W1PA 3FNDA 1IE7C 3T0TA 2BXZA 4PA8A 1GVSA 3ZOAA 4F0SA 2I17A 4LU0A 2C79A 1W1IE 1QO2A 1VRDA 5FSEC 4NJKA 1EUAA 1GQKA 1AW2A 4B5TA 1DHPA 1I6NA 3VPLA 1S1PA 1A5AA 3C3NA 3SRKA 2PDMA 1EOKA 4XQ6A 1IIGA 4FS9A 1MFVA 1WAWA 4N6EA 3SUSA 1UR4A 1GOKA 4GGHA 1US2A 2OB3A 3Q4DA 4TMBA 4IPIA 2VEFA 3V75A 3OVRA 3PP7A 3KX6A 4AHOA 3LK6A 2A7NA 4IF2A 1JQXA 2FJKA 2PRHA 3UGRA 1A5CA 4L80A 1KBIA 3KBNA 1JCYA 3P61A 1K7XA 4MFDA 4PMUA 7TIMA 4LX4A 5BU6A 2R1NA 2D2HA 2J13A 1VBHA 2CHOA 1XLCA 2V5CA 3NDYA 3NYDA 2D3LA 2CZFA 1FFQA 1AZ1A 2PUZA 2R91A 1XM3A 1M03A 3A23A 3UZJA 4RUBA 4ZO8A 2HQAA 1QOXA 1QPQA 2JK2A 5D8WA 4WRHA 3C0JA 1MQQA 3UCQA 4IPLA 4I7WA 4PB5A 2DZWA 4GBDA 3NZRA 3LNPA 2HS8A 3I6TA 1OT1A 3RDKA 1EPXA 4XBJA 3ZZ1A 2Q09A 1E9ZB 3QEZA 3MV01 1XQKA 3H7VA 3O9NA 3SN1A 2O7QA 1J11A 3PJUA 4NQ1A 2ASHA 3HG4A 3GB6A 2VEKA 3MDUA 3CT7A 3EB2A 3W1AA 4H41A 3QY8A 4KRTA 3B8DA 3S2MA 1VBUA 4WKFA 1DHKA 4GWEA 2H9AB 5F2IA 2Z25A 4GMEA 1BWVA 4L4PA 3CUZA 5B7ZA 4UFHA 1TPFA 5J5RA 4GUJA 4Z2KA 3N4EA 3SW6A 2PB1A 1BTCA 2NX1A 3NR0A 4B2DA 1W5MA 1M5WA 1RAKA 4OU1A 5KTLA 3TXZA 3TN3A 4TU1A 3GM8A 5EBAA 1D3CA 1WDQA 4M1BA 2D2JA 3MQTA 4DXKA 4D6HA 1DXEA 4HA4A 3WELA 3Q2DA 2QKFA 5HQMA 4LF1A 1OWQA 4DZIA 4REQA 2V3EA 4HJWA 3USZA 4D6FA 1RHCA 4DJDD 1ZGDA 2JF7A 5I06A 2J78A 4PMJA 1SZNA 4ATLA 4DBSA 1AH4A 3M0IA 2XN2A 1QW9A 4GACA 2FZDA 4QNEA 3H2AA 1PEZA 4KESA 4TMCA 3PBUA 2DUZA 4GNJA 3WH6A 3RJYA 1G4PA 3DBNA 4L4MA 1CXHA 4ICNA 1J5TA 1F9CA 1XLGA 4A2SA 1HIZA 1TTPA 3PPGA 1KO0A 2HNEA 2NT0A 1Z42A 1NDYA 3HTWA 3Q58A 1DTUA 5HDRA 4J3SA 3FYOA 1V0KA 3K4DA 3WEMA 3NG3A 4XZNX 1JNDA 2PODA 1BKSA 1EKOA 2JGYA 3TYAA 3HG3A 3DFHA 1V02E 1VCGA 3IWPA 1PKNA 4HPNA 4JPGA 3ZM8A 1EBHA 5A8NA 1BYBA 1K9DA 5AVHA 4PTVA 3EWWA 2V2HA 3C4UA 3ONBA 2YIHA 1MDRA 1W37A 1JZ2A 3P0XA 1YX1A 2D23A 1THFD 4D6DA 4IGMA 1CZ1A 1WV2A 1HFBA 5MF5A 4ZVJA 3QGKC 5HWJA 4RXFA 4ZL1A 4CVWA 5HJXA 3AYRA 3S6TA 4OV4A 4RNHA 3UWUA 4EP8C 4UCGA 3O15A 3KW3A 3VNKA 1R8LA 3KVLA 2A21A 2PLCA 3M41A 3P0WA 1FXQA 3RNDA 3DAQA 4KCWA 1TB3A 4P8XA 2WBGA 3T8QA 1P43A 1A3HA 3O0FA 1ZTVA 3UW6A 1Q13A 2VDIA 5H8UA 5TQLA 1YADA 4UNLA 1AQHA 2OO0A 2F61A 2YL9A 4NHVA 1WB0A 7XIMA 3P5ZA 1U1UA 3VKAA 4Z1YA 2XH0A 1FCUA 4DZHA 2XN0A 3KP1A 2VO5A 5CEWA 2GFTA 3DFNA 3KOFA 1U2YA 3C2RA 1OJXA 3G0SA 2HXTA 3H70A 4ALDA 5CSRA 1NY1A 4JNYA 2F38A 4KS0A 3M43A 2Z29A 5HNRA 2WKLA 4A05A 1XYAA 4ROQA 2XZ7A 3UJRA 3BSMA 3VIIA 4GNKB 4WKAA 4UR9A 4XSMA 4PTXA 4NP7A 1YXDA 3QGAC 4W7VA 4XVEA 5BXRA 3BW4A 4CQ8A 3SIZA 4XIAA 4Y7EA 2CLLA 4EX4A 4ZOEA 4EACA 3WLPA 4AB4A 3RPDA 2HBVA 3WJSA 4XD5A 3NSXA 1OC5A 2E09A 2OZ0A 3KWXA 2XPKA 2O7SA 4UQCA 3CHVA 3PZOA 4UNIA 1LL6A 1GKPA 3A9IA 4AZCB 3UQNA 2YL6A 1RD6A 2FTWA 2PTYA 3QMTA 4JTFA 1J12A 1EO5A 4OVXA 5F2MA 5BRPA 3NM3A 1TJ1A 5M1TA 3WUEA 1W8SA 4EAMA 5T26A 5CXPA 4H7CA 1W1TA 2FKPA 3NQEA 3CZJA 4RZ5A 1Q7MA 4HN8A 4Y9MA 2G3NA 3I6RA 4ZB5A 4NZFA 4JAWA 2A6NA 3VOGA 4LYPA 4MPQA 5GQBA 5A6BD 2QMJA 4FNSA 4M3PA 2QDGA 3MO7A 1VIWA 3PZUA 1YDOA 4RNJA 5AOUA 4XAZA 3ARPA 1VH7A 2V81A 3V1HA 5KZ6A 2YCKX 3JR2A 1V08A 3WMSA 5C54A 1DJWA 2JFEX 3NQ8A 4DNMA 1L2UA 3DEQA 3CMJA 1XH1A 2X1SA 1XGDA 2PDXA 1TELA 3GHUA 4I5XA 2IXVA 5E70A 4MKSA 1RCXB 3DH7A 4AIUA 4R9OA 3IANA 1XYMA 2CPUA 1KXQA 1BF6A 5G1YA 3B4YA 5DXXA 3MMUA 3L5MA 1PPIA 2DGAA 3EWZA 4IX2A 1JULA 3LTPA 5EFFA 3VI2A 3T55A 4HPHA 2POZA 1OEPA 4L6DA 3B9NA 1QI2A 3HOJA 3LCGA 5BMXA 1R3TA 1ZL1A 2G50A 2GVYA 1GWJA 3GFXA 3U4FA 3L2IA 1QNSA 3A6OA 3WMBA 1MNZA 2C1IA 4GJ1A 1W1B1 1J96A 4O1FA 3V5CA 3N2CA 3GE7A 4Q4SA 2I7GA 2INEA 3KBSA 1CGWA 2C0HA 2GJLA 2C8NA 3R11A 4F0MA 4UZSA 3WLLA 2FTYA 4NVTA 4ORIA 3GS6A 2ACUA 1ICSA 2HVMA 1DL3A 3SJ3A 4ZFCA 4AD1A 3M0MA 2D0FA 1XW8A 3N6HA 4LYQA 1HP4A 3UWWA 3R4IA 1C29A 3W7MA 1U1HA 4XD6A 5T9CE 1DWIM 2P8BA 1NQ6A 4AUBA 3VINA 4PZVA 1O4UA 3OEXA 2PSNA 1CX9A 2DZSA 3N4FA 4HA0A 4W85A 3SQSA 1XDMA 4AZIA 4AFYA 1OZQA 2E3ZA 5D32A 3WK3A 3QHMA 1TWWA 4WXZA 1XCXA 2E40A 4GUIA 1W3HA 1LDCA 4I9AA 3STFA 3ITCA 4M80A 1UD8A 2WJEA 4C6EA 5RUBA 3O3RA 2V69A 3CV1A 3VMPA 3E3HA 2GGIA 3WK2A 2FDMA 3TTSA 2G4JA 3DFYA 3W27A 3ATZA 1VJZA 3U2OA 1TIWA 3D46A 1Z69A 2P8CA 4QG9A 3XISA 3KL0A 1OCNA 2BHYA 4HU3A 4FNUA 3EDDA 1XINA 5HQEA 1R38A 3ZR4A 1Y0EA 1EF3A 2H3BA 2WZEA 4O52A 1VFUA 1IWAA 1R7AA 3M6DA 3HJEA 2ZRZA 1D3HA 1MNSA 2DH2A 3DC8A 1G1YA 4FSAA 4S2BA 8XIAA 2OEJA 3DX5A 3M5YA 5BU9A 5AC6A 2QV5A 1VC4A 1BPLB 3URAA 1H2JA 4IFOA 3MSDA 1Q8JA 3OLEA 4AYGA 1MW3A 3UT0A 3STPA 4JTLA 2GQAA 5ABGA 4F2BA 2HMCA 4QCFA 3ZIZA 4QQ3A 2NX3A 1CGYA 4I8DA 1CDGA 4KW2A 5KZMA 4NL1A 3VD4A 3FA4A 4CNNA 4GI8A 3EWYA 1BGGA 1PCWA 5D38A 3BANA 3T81A 5KINA 1GVYA 3GFYA 2CETA 3FJ4A 4JZ5A 1GHSA 4LBUA 3MJMA 2C71A 4W84A 1SFSA 1TMLA 3LPPA 3OBKA 1TKKA 1ZLPA 3CAVA 4KEVA 2WJFA 4DO7A 4HTBA 3W01A 3W9ZA 2A3HA 3SCSA 3O16A 3W1TA 1ECEA 3IS4A 1C91A 3ZSSA 2OPJA 2PDHA 4QJ5B 1XIBA 2NV9A 2G3FA 1P48A 3DG3A 4FR6A 1QK0A 1J4EA 3QZ6A 1VENA 4TVCA 1KKRA 2OJPA 3WD4A 5EFDA 5CH9A 5EL1A 1JCTA 2VUNA 5LNSA 4J3UA 5H6HA 3RM8A 2J74A 4OIFA 1KB3A 4GYKA 4GY7A 3MKCA 4Z1DA 4HNLA 4AEFA 3OB8A 3PBVA 2YCLB 1F4AA 4GQBA 3BO9A 1W9UA 3ARVA 1E1CB 4YTTA 5AECA 1J10A 3AIEA 4WOQA 1D7KA 1H51A 3PTQA 4CD5A 4ZXOA 2PRMA 4Y6GA 1GTHA 3IJ6A 1N55A 1V8EA 1GZ1A 4PMRA 5TAOA 1AW1A 5A8PA 1NDWA 2OSYA 1KLYA 3G5EA 1TV2A 3PJXA 4CVUA 3W7PA 4GRSA 2ZBTA 2WXDM 2QUVA 2I16A 2F9RA 1X96A 4LCRA 4BR1A 2RFGA 3BMXA 1JNEA 3M7WA 2WCAA 4F9DA 4RLIA 3GKFA 3PVFA 1GQIA 5LGZA 3W1PA 1F2JA 5I23A 4A8IA 3NVTA 2WQPA 2C14A 2G4FA 3BSHA 2YXXA 4ACZA 1UOKA 1NELA 5G2IA 4IP7A 1V0MA 2CXEA 3MP5A 3GTNA 1UMYA 2IPWA 5HPCA 2D0GA 1FHLA 1B4KA 1WCGA 3MUY1 5C71A 4PRTA 5MKGA 5CSSA 1QOQA 3EXSA 2XYLA 1TX2A 2GDUA 3W07A 4DBWA 4AX6A 1WZKA 1QT1A 2GOKA 2NVDA 3TQKA 3MJYA 3A22A 3GTIA 1I2NA 3C2VA 3EOEA 3LCXA 3MMDA 1XD1A 3C8NA 3LQLA 1V03A 2NUXA 3RAOA 2HRWA 4E8GA 1Z7AA 3VOFA 1ISXA 5I78A 4Q4PA 3UCCA 5CBBA 2DIKA 3STGA 4BK9A 3V36A 3AIUA 1US3A 4KMQA 5B80A 4NUWA 2C6QA 3CQ0A 4BA0A 4HA1A 3M5VA 4DWSA 1JCNA 2EJAA 2YOCA 3N34A 3SN4A 3L2LA 5AYBA 5C7VA 4M51A 4GYPC 4JGDA 2GVEA 3NYZA 3UP8A 4AVNA 4Q4MA 4JQ2A 2ZYFA 4JEJA 3AS3A 4AY8A 4NY2A 3VUPA 1LROA 4J7RA 4ONVA 3NPVA 3AU2A 3S2NA 3U5YA 4WCJA 5JH2A 1BHGA 4YLWA 2I1OA 2OU4A 5C0QA 4EOUA 3MO4A 3GDLA 4PMOA 3ZJ8A 4TTUA 3VIJA 3WUFA 3ZVHA 1OF8A 3CJPA 3ITYA 4QG8A 2QF8A 3KL3A 3LMYA 3WQ8A 4P61A 4GUFA 4UTTA 1C8XA 1KTNA 2Z7GA 1KQZA 1NM9A 2WLZA 2QJHA 3LX9A 3QMRA 3SY8A 3TC3A 4A29A 4ZOBA 3N3TA 4MB4A 5HAOA 4FAMA 1Q2RA 3QYQA 2X40A 2XN1A 4MWAC 4MYAA 2WVSA 3VNJA 3MA8A 1UZ4A 4KWVA 5LIXX 3CAWA 2RGMA 3VD9A 2QUUA 4B2DD 1HJWA 5HPOA 2WVUA 2GWGA 1KTCA 4JTCA 4AYSA 5DLCA 2QDDA 4M56A 1K4HA 1EYEA 1REQB 3MHFA 1FH9A 1TV7A 3TIMA 2BX7A 4F79A 3B06A 2DSVA 2ZE3A 4H04A 4UTWA 2TAAA 3U0HA 1PCKA 4XWUA 3HQNA 3USBA 2ZKMX 1TRIA 5CPQA 2ISWA 3UETA 5DMYA 4JL1A 3IJ7A 3EPOA 3DHFA 4C1NA 4EF9A 4YS1A 4UFMA 4J3TA 1TV8A 2AL2A 4DRSA 5D9PA 1ISWA 1ZUAX 4J3VA 1OSEA 3WLKX 4PL1A 4QNWA 4DI8A 3ZT6A 1HKWA 4JTEA 1NDZA 4Q8MA 3W38A 4W8LA 9XIAA 1P0EA 1CCWB 4FOKA 4CGTA 1FWBC 4EIVA 3TWBA 2ZIDA 4YIWA 2QV4A 2FH6A 3AWOA 3V1PA 1VJIA 2NXIA 3RM9A 4P7OA 3S1VA 3THDA 4LH8A 3AHYA 3M5ZA 1BVNP 3IUDA 1JYNA 3N2BA 2DIJA 3I65A 4GGBA 5CBIA 5EB8A 3L0KA 3CK5A 2GDVA 1DVJA 1PO9A 2JE8A 5FA5A 3R58A 2JQXA 1AQ0A 2E8YA 2X0YA 3GX9A 2DQXA 3TW6A 2WSYA 3E0VA 5HJLA 3GC4A 3PSVA 3ZSTA 2A3CA 3CB3A 2QJIA 3FS2A 4K39A 5DFAA 3TYUA 4I6KA 3FX4A 4S3FA 1EZWA 4AIEA 4K7YA 1ECQA 4IMGA 4NZJA 3LBMA 3TJLA 3GU9A 1VPXA 2QUTA 1FXPA 3BAJA 3KXQA 1UZDA 2GZXA 4EPEC 1V6TA 3D6NA 3R13A 4Q8NA 2PDJA 1IV8A 2P5NA 3P74A 3GR4A 4OFCA 4W8BA 2Y63A 4AH7A 3SFKA 5GJPA 3TWAA 2QCHA 1AVAA 1JUEA 1H5YA 3ARYA 1H11A 3R89A 1W56A 1RPKA 4RDWA 2JKEA 4LT9A 4CD8A 4DY1A 2XVNA 4IGNA 2XIBA 4I5UA 4G1KA 1TPWA 5J04A 5HXMA 4XISA 4C6MA 3RPMA 3PTMA 2D24A 1XV8A 4FNTA 4LUSB 2QCGA 2TRSA 3UWEA 3TONA 4D1JA 2F2HA 3ZYZA 1UKPA 3TTQA 1EO7A 4Q8TA 3HM7A 4GVIA 3PWIA 5CBJA 3QQWA 3CUGA 3ELFA 1D8WA 1IXOA 1H7NA 1UYQA 3T7VA 1KV5A 5FF0A 1X98A 1RBLA 4AQLA 1O68A 3KBMA 3M0XA 4ZQNA 1C7SA 2DDXA 1H49A 1QTWA 2OGJA 2V5KA 1SZRA 2DY3A 4NRRA 4PUMA 1FA2A 3BV4A 4J9JA 4MLRA 4F3HA 3QHOA 1A3WA 4XVDA 4HMDA 1C93A 1PWMA 3QV7A 4ADSA 1WDPA 1W9XA 4EXBA 4PE8A 2QCDB 2A3EA 4I3GA 3T9PA 1DJIA 1TPB1 4L6HA 1CPUA 2E9MA 4NSBA 3APTA 3WFLA 1NFGA 2RDXA 1VS1A 3NZQA 4RPQA 3B9OA 4LS1A 1E0VA 1RPXA 4F0LA 3VM7A 4U3AA 1EDQA 2Y7FA 1S46A 4MB3A 3JUGA 1CLKA 3IIOA 4V27A 4WVXA 5XIMA 1ZJHA 2D0HA 2EG6A 2VWTA 2QIIA 3ZXWA 2VD8A 2NXHA 1V93A 1H50A 3O6YX 4JN8A 5JMUA 3OZOA 3W73A 3NCOA 3U3HA 4TXEA 3EDKA 3MBDA 4XZHA 3IIVA 1EJVC 3C6CA 4C6LA 2DJLA 1KFBA 3TYDA 1WA3A 4ZXLA 4JIQA 4O8RA 1OFPA 4BKNA 1KRBC 2ZADA 3P93A 1PDZA 1GGOA 3GG0A 4AXNA 3HJZA 5FL1A 2WSPA 2GJRA 3S0CA 3CUHA 4NAFB 4HNUA 4LBSA 1W6TA 2IXUA 3ARZA 4BFAA 1ME8A 3TYBA 4GI4A 5CZSA 4NJHA 3SZ8A 1TQXA 2R14A 4DX3A 4RKAA 3DOPA 4HU8A 4LVAA 3C2EA 2NZLA 1W5PA 2Z6JA 2Z1KA 1MW2A 3T05A 1JI1A 1RBAA 2R6OA 3H2EA 4MWAA 2BB0A 4Z0JA 2QGHA 4H9UA 3SGGA 1UHVA 3D47A 1YNQA 5BOFA 3OIXA 3GW0A 3THCA 2AQVA 3AZSA 2XFFA 4UB9A 3PHAA 3WG6A 4UOQA 3P81A 3P6LA 4EWND 4IFKB 1F74A 4INFA 4PFHA 3CH0A 4AD0A 1ITQA 2D2GA 3LMZA 1SU5A 1HUVA 3G77A 1N7KA 3CPGA 3T78A 3IJLA 5D2XA 2P10A 4C65A 1QK2A 3QH2A 3WL1A 4K36A 1VBGA 2E9LA 2YX0A 4ZQRA 3AJXA 3W86A 2CW6A 3W1RA 1CXEA 5AZ1A 1QCWA 2NQJA 3NZ1A 2QNEA 2ACQA 3DHUA 3CGTA 3IJQA 4X9SA 2PZNA 3E1F1 2DH3A 4Q8OA 4U33A 2WMHA 1M04A 2W92A 1VHCA 3PFRA 4CNSA 2GGEA 4I5RA 3KM8A 1ELSA 5HNNA 1I75A 3C56A 2ZXDA 1V3MA 3CHDA 5I03A 4CCZA 3CTLA 4BCEA 1O12A 3TVAA 2DSKA 4UQAA 3CYVA 1N8IA 4TVDA 6XIAA 4HP5A 1UD6A 4GZ7A 4JCLA 3T2OA 4LWWA 1R3VA 4N9BA 2ZWZA 3EXTA 3GXFA 1HG3A 2QAPA 1IT7A 2OYMA 4PMQA 1RBOB 3CL8A 4G8TA 4IXXA 3IGXA 4XKYA 5I00A 1M7XA 3BH4A 5I3IA 4AD2A 3THUA 4H6KA 1C8QA 1QDSA 1CIUA 1MW1A 1XL9A 4NAEB 1U33A 5DRCA 4FEZA 3WKZA 2UWFA 4Q8QA 1G4EA 1W1VA 1QXLA 3CPRA 3NQ6A 3I7QA 3POCA 3B0UX 3WNPA 2PCQA 2PWVA 3DKLA 4HOWA 1GPWA 1YBQA 4C6CA 3TE9A 1BF2A 4DIAA 4H6EA 3GLCA 1EP1A 1POJA 2NT1A 2OCZA 4JTDA 3S2JA 3EKZA 1DYSA 1WXJA 1GQLA 1GYNA 3W25A 3PZQA 4EF8A 1JIBA 3P5YA 1WKDA 4KGLA 5CC5A 1UUOA 3AZTA 3QW3A 5CZJA 3PNUA 3UA4A 2A3LA 1UP2A 2V5DA 1HTIA 1WQ5A 4CNUA 4QS5A 4GHRA 1XIJA 4BEUA 3RO8A 4HCLA 4I8YA 1VEOA 3GO2A 3LUTA 1T41A 3WL0A 3N17A 1XWYA 3WQGA 3QC0A 1KFJA 4QROA 3WQPA 1JQVA 5FIPA 3W6LA 1Z48A 3CL7A 3RR4A 2CEQA 3MSRA 1ESWA 5FF2A 3BCFA 2R9RA 3BARA 5K9CA 1TVPA 5HMSA 2ANUA 3PAOA 5H2ZA 1UCWA 2QMKA 4H7VA 4PODA 1H7RA 3LM7A 3B05A 4PCFA 4O8AA 1Q65A 1LF1A 3WJWA 3M7SA 1LL4A 5CJ5A 3RU8X 1H61A 1S2UA 3NL2A 4HZ7A 1BG4A 2X2GA 3HF3A 4ZCWA 1PZ2A 1V77A 4HD5A 2WNZA 3QQ1A 1UWAA 3S83A 1WDDA 4GA8A 5GNZA 1NFBA 2WWCA 4FP1A 1KRMA 1W2VA 2I5QA 3S1XA 3VDAA 2FHBA 2MUCA 2VM8A 3EYPA 2OLSA 1V6XA 1X8FA 4GIAA 1L9WA 4DUOA 3M0VA 4KWUA 1M7JA 1V79A 4L7ZA 4DBDA 3THAA 3OU8A 4YN5A 4MNJA 1NP2A 3P62A 2RDTA 2EPMX 4JTRA 5LZLA 3RX2A 1UWRA 4O18A 3SSZA 1JFXA 2PF8A 1TA3A 3OP2A 5A6SA 4NZ4A 2ABBA 1Q6GA 1TMHA 2V0TA 4DM1A 2EJ1A 3I10A 3A64A 1EX5A 3PNZA 3GHSA 3QV8A 1EJXC 1N82A 3DDMA 2E67A 4UQBA 3VKJA 1ADDA 1MEWA 4F8XA 5I5RA 2Z6IA 4JTTA 5AYZA 3PAJA 3HZ3A 2Y8UA 4YCOA 4GIEA 3YPIA 2DT0A 1ODZA 3SBFA 3RLGA 4D8ZA 3F7JA 3TV8A 5B7YA 4LB4A 3G1AA 1TTIA 5I3FA 4Q8WA 3NA8A 4JQ1A 3MYOA 5F2LA 1GVIA 1XLAA 1DE6A 5FEWA 1JAKA 2ZTJA 1JR1A 5A6JA 4WSJA 3LV6A 2GL5A 1E3ZA 4G7EB 4C6BA 4DWSD 3AOFA 3HPSA 2A85A 1POKA 4Y9AA 3DESA 2YCJA 3E5BA 5DT7A 2E1DA 3K4AA 1JPDX 2X42A 1B3XA 4DPPA 4GY1A 5LHEA 5C9UA 3EA3A 4C6JA 1XUZA 2FTPA 4R88A 3MVTA 2CC0A 5BRQA 1L6WA 1NF7A 2XIIA 3WMLA 2HE8A 3G1DA 1AD1A 3OIHA 4XV0A 2ZDRA 3GC2A 1LUCA 1OFOA 1PYMA 3RF9A 3FY1A 5KMYA 5A8GA 3EKLA 4PGLA 4QGCA 2Z1SA 4MDOA 4Y90A 1GKRA 3HV8A 2FLIA 4MJZA 4PTNA 1A5NC 2PS2A 2G0WA 5ECVA 1CEOA 1TPDA 2O9RA 1TWDA 3UY8A 5JQ9A 3BMWA 1CT5A 3H53A 3V3WA 4IGSA 3WY1A 3VGHA 1RP9A 4NJGA 1LORA 3BAXA 3N3MA 4LEFA 4O19A 3WZ0E 3F2DA 4JHMA 3L4XA 1V7YA 4MJMA 4J4KA 1YYAA 2YZ5A 4AD5A 1US0A 1R7OA 2FPYA 1GK8A 3DI1A 1FWJC 1P1MA 1FWDC 3V16A 5TIMA 5D2TA 3LZ5A 3PJWA 2BVDA 2AAAA 5CKSA 3DI0A 2WB5A 2BZNA 2F8QA 4L9ZA 4M29A 2BVWA 3KHDA 4H9ZA 1RALA 2WW5A 4ICCX 4G9PA 3L5AA 3UNDA 1EA9C 3STCA 4KFPA 1E9IA 4UTMA 3SUTA 4Y8FA 1KGUA 5T91A 4P8UA 4DLFA 2HJPA 3DCPA 5HMEA 4BI6A 2O92A 3H22A 1W31A 3TMLA 1LT7A 3RX3A 1AK5A 4B9YA 4J1OA 4R34A 1QW8A 4N4QA 5CPMA 4IIDA 4MY1A 3IVUA 2NWRA 4LVGA 2Y5JA 1FH8A 1GG0A 4AWUA 4P5UA 4ZO7A 3GNRA 4MNMA 3VOIA 3KVMA 1Z89A 4FNPA 1ZAHA 4P7LA 2DVUA 1W3IA 1DWHM 3GIYA 1TE6A 5D8ZA 1MEHA 5M17A 3CL6A 4KETA 2O56A 4BJHA 1PIGA 2Y7EA 4P2VA 1FP9A 1W5QA 2XM1A 3S42A 4LSBA 4C7FA 4WKHA 3EAUA 1V3LA 4DWDA 2ESCA 1A0EA 3MI6A 1UR2A 1G5AA 3K1GA 3FHAA 4HU0A 3IJIA 5LIKX 1ZZMA 3FK4A 3VZYA 1VFFA 2FMNA 2PAJA 1HKJA 4B4FA 4D2JA 3AYVA 3LGDA 3GXDA 5JBDA 1J0IA 4ZEPA 4Z42C 5F1UA 1YEYA 2EO7A 1XYFA 5C9RA 2W9MA 3GXPA 3WD1A 5HR7A 1PZ0A 1UZ1A 2WHMA 5T8GA 1H7WA 5K9DA 1OGBA 2VVNA 2GDQA 1NVMA 4J2MA 4OWGA 1W3KA 4I90A 2OZ3A 1ISZA 3UJFA 2ZOXA 1LYXA 4KCTA 3EA2A 1OX4A 3K5XA 2CXGA 2H9AA 4NIRA 4CCDA 3UPWA 3S2CA 2V6AA 1TUFA 4F0KA 3BURA 3UVAA 4CNTA 1FDJA 3KOYA 5C70A 4WXYA 1I0BA 2X1TA 4X2RA 3W7RA 4LB3A 4ZA0A 7CGTA 3HPZA 1QASA 4S3DA 4MY8A 2Q6ZA 3LXAA 2QR6A 1P6BA 3P14A 3C86A 3L0GA 2ATMA 3EOSA 5TNVA 3ANYA 2PMQA 3W84A 2VOTA 4FXSA 2PP3A 1FX6A 1VYRA 1XLEA 3G1YA 1E72M 1K7FA 2UY2A 3KTCA 3WNKA 3OO2A 2CBIA 1OADA 3THQA 1E3XA 1V0NA 3BAYA 3W81A 3RU6A 1DV7A 2YXGA 3R0UA 3GD6A 2FZ9A 1SW7A 2E6FA 3VMNA 4MZYA 1BSIA 2VOMA 1MUMA 2ABAA 4MFEA 4Q8PA 2W66A 2DT1A 2CKSA 3CMGA 1X6NA 4IQDA 3WLHA 4C7GA 1QNVA 4C6NA 5CC6A 4K2SA 2ZRWA 4K3ZA 3MP4A 3E6EA 4UUIA 3TSBA 1ZQ5A 2XM2A 4MPKA 5BWAA 2BV9A 1LRTA 1CW2A 2DVXA 1W9PA 2NSOA 2I9UA 1H7XA 3T08A 3IAQA 3LHVA 3RGTA 3G0UA 2PGWA 1GNXA 5FJRA 4RNIA 2PLKA 3AQUA 4H4IA 3DFQA 4ZO9A 1TV5A 1ZENA 1P0DA 1ZP4A 1D3GA 4AD3A 4CNOA 2ZUWA 3TC6A 2WJZA 2FGBA 1VCVA 3FVDA 1TIMA 1A5KC 2EHHA 1UP0A 4RJEA 5CC7A 1OCQA 5FEPA 4C6PA 4EXAA 2NUWA 1HL2A 1KM5A 1YPIA 1HT6A 3ATYA 4HKPA 3GH5A 2E25A 1JG9A 2FGZA 4HZMA 2G3IA 3MCMA 3GXTA 1FWHC 4WJXA 3AWNA 4DAFA 3L4YA 3RFAA 4P8WA 3CT2A 1OF6A 2F2KA 3AHVA 3CTTA 4GZIA 4H9MA 3WLJA 3OZYA 3WJZA 3B8WA 4Z2LA 4BF5A 1S2WA 1V6WA 4GZJA 2ZUTA 2YCEA 3BGJA 2Z1VA 3HMJG 2RJHA 3FEQA 4L56A 3VGEA 3TR9A 4U4MA 1WNOA 4UCFA 1HO1A 1XI3A 3I7SA 3CB8A 1XIDA 1LBFA 2BWGA 4A35A 4GCAA 3L2MA 1EOMA 1I1XA 1VR6A 1NOWA 2XISA 1SO5A 5ENLA 1B31A 3SRFA 1U83A 3RN6A 1IR2A 2WBKA 2ZRUA 2WPGA 3BLLA 4EAYA 3GR7A 4OBSA 5D33A 1ZBVA 3EX4A 1E6RA 2PDCA 3BCDA 2QZRA 4JKMA 3HBLA 3UG3A 3CYJA 2GVJA 1RQBA 4ZQOA 2GSHA 3VDGA 1L6FA 1E4NA 1RP8A 3V5FA 1LWIA 4X63A 3OGVA 4V15A 5H91A 1LBMA 4PBFA 4XAGA 4J3ZA 4S3EA 2GK1B 1KWGA 2PTDA 2VFIA 3TROA 2GWNA 1FWTA 3TAOA 3BGAA 3KOWA 4RE2A 4AZCA 3GVQA 2WZTA 4F48A 3A12A 1FCBA 3ERPA 1MUCA 2OG9A 4S23A 3B9DA 3AHZA 4JKLA 1XGEA 4GLEA 1F76A 3OVGA 3AMCA 3TCSA 3JZEA 4S3KA 4DVOA 3EOUA 1GYLA 2W91A 2SFPA 5CAHA 5GVJA 4GBUA 4TTGA 3G3MA 3UR2A 2FMOA 4JHOA 3GNOA 3WMCA 1UWTA 3B03A 5JH1A 1UJPA 1ZBWA 2BVYA 4ATWA 1V4YA 2QPSA 4OKDA 4UMCA 3F5JA 3S1GA 3PPFA 4RL3A 2J25A 5LSMA 2V2CA 4JIEA 5FF4A 3GG7A 5E6ZA 1ML1A 1JAEA 4HNOA 1IGWA 1FCQA 3G1VA 5F4XA 3WQ5A 4GKLA 2YR1A 4ZOAA 4HB7A 3EDEA 3MCNA 1T6MA 2GGJA 2CFFA 2VRKA 1TVLA 1O95A 1OZMA 4R7WA 4O57A 1ZJAA 1Q6LA 5CPNA 4V1YA 1I9CB 5DBTA 3NGJA 2FFIA 3L23A 4GH3A 4AWEA 3ABXA 1E5NA 1W54A 2IKHA 4P8VA 1GOMA 3BOFA 4AVFA 2DIEA 4FPSA 4C7DA 2VRJA 1LBLA 1TMQA 4NNCA 3R43A 4PC8A 1XJBA 5KITA 2QDHA 1S2AA 4FLRA 3WBWA 1P6CA 2NUYA 4H1ZA 3LU2A 2EPHA 3AS1A 3FIGA 2JALA 3PPHA 3W83A 1XRVA 3RR1A 4XZBA 3VIHA 5LYRA 3H55A 1DJXA 1DJQA 2E77A 3R79A 4KEUA 4DI9A 4W4QA 4IHCA 4ZTYA 3PULA 4S3CA 3B0VC 3N14A 3EPMA 3VGGA 3S4TA 3FN9A 2V2DA 3QF0A 1HJXA 3G8RA 4GFIA 2PDIA 1PHWA 5HUPA 3EBVA 1J01A 1AJ0A 2ZX9A 6ALDA 1OX6A 5HMFA 1A5OC 4Z2HA 3LTSA 4J3WA 4QE5A 4DUXA 5D30A 1SMAA 3TEVA 1QBAA 1J6PA 4KCVA 5FJPA 2Z00A 1TR1A 4H2HA 2CESA 3B8VA 3S6OA 1GW1A 3WF0A 1JI2A 2VFDA 1ME7A 2Y2WA 1J18A 2CLHA 4IPJA 3B04A 4YHGA 1OT2A 5LA1A 1U30A 1VPQA 2HISA 1WAUA 2EAWA 2PP1A 1A0DA 2VUYA 4M6VA 5F4SA 1BYAA 4QSHA 4DEFA 5D37A 1J8VA 3E0FA 1FWWA 3OZMA 3V18A 3TFCA 2A3BA 5PTDA 2Y6ZA 1Q45A 1XLFA 2QGYA 4QE4A 3W7QA 5U7SA 1M53A 2TODA 1JXJA 2NQ5A 2V9DA 4MADA 3KLLA 1FVPA 1TPVA 1CGVA 3E0WA 3TP4A 3HV9A 4JDYA 1WBHA 2PCEA 1XCWA 2AMGA 3NQBA 1E1EA 3VXGA 5DBUA 3U8GA 4LRTA 4M82A 2VC7A 4JICA 1G6CA 3C2FA 2VRQA 1PUDA 3EXRA 1EZ2A 5KEZA 4MNLA 3W7OA 3GTFA 1RVKA 2O4MA 4I6VA 1FWEC 1XSKA 3QFEA 1C8YA 3N15A 4O10A 2QHAA 5TF0A 4GQQA 1XS2A 1BAGA 2KZHA 3CQKA 1ZFJA 3QKZA 4XSLA 4D6GA 3VTRA 1G7UA 2A5HA 3WSUA 1AQFA 3IRDA 4Q7IA 1CNVA 3QVQA 3KBWA 5CPSA 3W2LA 2J7DA 2J8GA 2YZRA 1JF6A 1B9BA 2C19A 2J7HA 4GD0A 3SURA 1EGVA 3DC0A 3P80A 1Y5VA 5CQ1A 4D1IA 4YXGA 1OG0A 3SGZA 1VQTA 5A8QA 4PUKA 4OHQA 1TJPA 1DJHA 3ZS4A 3AZRA 2EKCA 4LS0A 1RLDA 2RAGA 4O14A 4XAPA 5HATA 1G4SA 1SFLA 4Z2IA 1XDJA 4JY9A 2Z27A 2FZNA 2I56A 4DYEA 3W24A 2QCCA 5ABHA 1T8XA 2WZIA 1H7OA 2QXWA 3FKRA 1BSLA 3LLFA 3EPNA 1BWKA 3S1WA 3XIMA 4Z1CA 2QAFA 5EMYA 5IFPA 3WIJA 1HO4A 1PKMA 2ZZ1A 1IWBA 1TO3A 2VX4A 1S5WA 3LGGA 1CI1A 3H7RA 5IFTA 1U5VA 3GXIA 1VFLA 3E0IA 1JFHA 5FEZA 3BG5A 2O9OA 4E5TA 3GDMA 3CAKA 1E1CA 3VGBA 2YA0A 2X8RA 1SJAA 3FSUA 4GO9A 2Y89A 1BGAA 2XWEA 1Y7VA 1PYFA 4ZR8A 4HK5A 4QLJA 1CENA 1H09A 5C9XA 4IIFA 2EPKX 4JL2A 1BLIA 5SWUA 5FJIA 1Z9AA 1DORA 4M1RA 3AU6A 4IL2A 1B3YA 1AUSL 3B8SA 4GH1A 3L9CA 4WHBA 1CWYA 3VNMA 3TYEA 3NURA 3WLTA 1HNYA 3E49A 2VNCA 2XFRA 3ITOA 1Q3NA 4DJFA 1Q6EA 4BWLC 1JYWA 3WK0A 3A5FA 4XAYA 3RO6A 3F2BA 4DBUA 2XFWA 3ORWA 4QAIA 2ZXBA 3A4XA 4E8CA 2E1WA 4QX4A 4MUZA 4AG0A 4NJIA 5BXPA 3GTXA 3VCRA 1I2OA 3C52A 3N13A 4XG1A 7PTDA 1Z44A 3P84A 4BQ4A 4AWSA 2G8ZA 4W89A 5AYYA 4PTWA 3QYSA 1E0TA 1R9ZA 3LERA 4P7NA 5DCDA 3N29A 3A5VA 3QN3A 4JD4A 1ZPTA 4UMAA 1PIFA 3NO3A 2WMGA 5EKYA 1GEHA 1A80A 4NZ3A 1F5ZA 1DWAM 2IPJA 2RJGA 4O1AA 5DEZA 1YTKA 3AMLA 3I68A 2YBVA 1KCXA 1SMDA 2HVNA 3AISA 3DYMA 4LYRA 4IQEA 3KWSA 2BBFA 3FW6A 3G8EA 4Z2JA 3W7IA 4D8AA 3WX7A 2OKOA 5A94A 3UCDA 3VNYA 3MCOA 5BZAA 4QM1A 2VR5A 3OLGA 1YE4A 1ICPA 1PZ3A 1RQEA 3OJGA 2REQA 5FACA 2PU1A 4HHPA 3V0SA 3L67A 2WMIA 2PD9A 4OECA 2G5WA 1K1DA 1FWAC 4ECLA 3GXNA 2WZHA 3CBWA 3MI3A 2QQ6A 2C1GA 5IBXC 5EY5A 4RZ4A 2EPOA 2VCBA 4NT0A 1SW3A 3M07A 1B3ZA 1BXNA 2BY2A 4B5NA 3HB9A 3W02A 4JR5A 3R0DA 1WYIA 3HG2A 4R9XA 3WJXA 3VD3A 4C5ZA 1BTMA 2AL1A 2DJXA 1L6GA 3RLVA 2OODA 3MUZ1 3PBWA 1R47A 5FL0A 4GXPA 3H23A 2C15A 4BZYA 3FJLA 4ACZB 1L2QA 4E3VA 2OEKA 1CB2A 2WVTA 1UD2A 3OLIA 1LQAA 5H8MA 1QI3A 1WXZA 3PZGA 4MJ2A 2J8TA 3AMKA 1BG9A 1ICQA 4DJDC 1X97A 4XBSA 3AXKA 3UWZA 2EPNA 3OBEA 2Y8VA 3W23A 3BAWA 3QTPA 3KHJA 5C2GA 1UZHA 4NI8A 4N6FA 2WM1A 3BVJA 3WNNA 1JCMP 1A50A 4AHQA 2J4GA 1Y5WA 1QJWA 5AY7A 2D73A 2BODX 4G7FA 1REQA 3M0ZA 3ITXA 2FB2A 2ZRVA 5DANA 1AJ2A 1KNWA 3SCTA 4HSNA 4CQBA 2FZMA 2H90A 4DJEA 2XIQA 1AFSA 3SRDA 5G2WA 3ABZA 5HNUA 5DMMA 3UF9A 5I02A 2YFNA 2OT0A 2Y7GA 3W1XA 3BE7A 1NIUA 4W8AA 4DELA 1NJJA 1LOSA 4Q22A 3B0XA 5HWMA 5I3GA 4LV9A 1I2RA 3KE0A 1UD4A 3UFYA 1UKOA 2XVPA 4UR8A 1B30A 2P0OA 3MZNA 1EXBA 2W62A 3MUIA 4M8UA 1Q5MA 2B81A 3FAXA 3W7LA 3C0QA 1KWKA 4G2DA 1B2YA 4HSOA 4RXGA 4PYSA 1RA5A 1XYCA 4LALA 3ZJKA 4N42A 3UWQA 3NTYA 3ZVHB 3S5SA 1UBPC 3RILA 3MI2A 3OGSA 3SFWA 2WC3A 2AOSA 4BQ5A 1AMYA 2AQOA 5A6LA 3SUVA 4JCMA 1RCOB 1B0IA 3SECA 4L9XA 5E5CA 3VAVA 3BUVA 4LNCA 1PDYA 2V67A 1BYDA 3CHFA 5FJTA 1D9EA 4B4HA 7REQB 1RJQA 1TYGA 1UR0A 4JNMA 3NO1A 5DRIA 2G96A 4MTVA 4W9TA 3GIQA 2C16A 5ECUA 1E4IA 1EF2A 1QHZA 1XIGA 1XKJA 1PBGA 3CWOX 4IP5A 1W8GA 5EGRA 3M47A 4EPBC 5FJOA 1W1ZA 4NX0A 3LNMA 1E43A 5KZDA 5IOBA 2PWHA 5A2BA 3LOTA 6CGTA 1E9YB 3L66A 3MUCA 3WDPP 3CIWA 3MKVA 4DAIA 4OOZA 1L8NA 3WF1A 3TQVA 3RUBL 1PTDA 1QU4A 3TX9A 1DTNA 2V63A 2QPXA 3BK0A 4YYFA 1VBRA 1NOUA 2P3EA 4HYVA 2HV5A 3DYOA 3VIFA 3N1AA 4GYJA 3VILA 5BRBA 1TUXA 4LUSA 1HP5A 2D20A 4QE1A 1ISVA 1OYBA 1JDEA 5HJYA 1DE5A 1SSGA 2VJXA 3KVJA 1UD3A 5JBFA 1VF8A 4QEEA 3NUKA 1XCFA 1LCOA 4H8UA 2PGEA 4PSPA 2EKGA 1E15A 3BWWA 3UEQA 1K6AA 1BQCA 1BWLA 3KRBA 1BVWA 1TX0A 3B8TA 1X1ZA 1HVXA 2DZTA 4IL0A 4J35A 1UW9A 3CO4A 4L61A 4TV5A 3A4AA 3E96A 3W1MA 1E55A 2QCDA 3LA4A 4PR4A 2WKGA 3TW7A 5BXTA 4KWOA 4FI4A 3C2YA 3LXCA 1NF0A 1YDYA 2LLEA 3NAVA 1GONA 4L65A 4PCPA 5JU6A 3MC5A 3GU1A 3T0BA 3SGUA 1W5NA 4GVHA 4XO7A 3W6YA 1Q7QA 4GUGA 1E6XM 2ATSA 3UR8A 2VYOA 4MKNA 1X8CA 2RHGA 3AAMA 1BFNA 5HQLA 4XUGA 2Z2UA 4UC5A 1QPNA 3IIZA 2V3GA 1DIDA 4V2XA 4X0VA 4YYCA 4EPDC 2DSZA 1HL8A 4C60A 4IQLA 1OM0A 4H8VA 4O0KA 1PXGA 1KCLA 3O1NA 5LA2A 2XHYA 3VU2A 5C9ZA 1V5XA 2MANA 2BY1A 3IRSA 3LHYA 4JHZA 2HTMA 1TFVA 3EX6A 3UPMA 3WN6A 4AMCA 1E71M 1XLMA 1KFKA 1MMFA 1LLOA 2YGYA 5LNUA 4KQNA 4R3UA 2FHFA 1FOBA 4A4AA 3G1RA 3NQAA 4GX8A 2FVLA 2FPVA 3TU9A 3OZPA 3W1NA 4F2TA 2FYMA 4NNBA 1OCJA 1W32A 1KKOA 3NQCA 2YFOA 1UC4A 2BXYA 5FF3A 7ODCA 3DG6A 2WZMA 3H7UA 3PZTA 4MJ4A 4O15A 4KFOA 4DXXA 1G94A 1VKFA 1ITCA 3ZMRA 1YQ2A 4LUYA 1DXIA 3QBUA 2ZZ4A 3Q94A 2P3ZA 1ZP3A 4DF2A 1V3KA 3A3WA 4ZQPA 1AA1B 3E9AA 3CS2A 1ZB5A 1OK6A 4HPGA 1G01A 3DENA 1R3RA 1HXJA 3QW4B 2EEXA 3EDFA 1XLLA 3R8HA 3C8FA 3VKKA 1OB0A 2JEQA 3CO8A 2OR2A 4M6PA 4O0QA 1A5LC 2WMJA 3D3FA 3EKGA 2X1UA 5E0CA 1PJ9A 4ZO6A 3A47A 1SJDA 2OSWA 6A3HA 1K8CA 2Q3RA 1WPCA 5D2YA 1LLZA 3ZJ7A 2NWSA 3I4EA 4HOZA 2KX9A 2VC9A 1B4EA 1CGXA 2J75A 3SCVA 2R1LA 1T40A 3A3XA 3IARA 3T0DA 3NSMA 4D9PA 4FOJA 4JN6A 3BJSA 1R30A 4KIRA 4MZ1A 2CWNA 2XTKA 4FLQA 3CUJA 2JF6A 2BY3A 3WDIA 3ZLGA 4A21A 3N2MA 1UPMB 3RK8A 1EXPA 1ZAJA 4TUFA 4HCDA 5CGMA 2XVGA 1KXTA 4AAJA 3KCOA 1Q6OA 4FIRA 4WGXA 3QMSA 3QR3A 3MSGA 4RCXA 3TQPA 1EC9A 2Q71A 4UQ9A 1EGZA 3BW3A 4B15A 3KBVA 2E5BA 2HCVA 1O66A 5DY2A 3WLIA 2HZGA 5I07A 3TTOA 2YL5A 3QXBA 2ZXAA 3KCLA 5LA0A 3KBJA 1EDGA 3CNYA 3CXOA 3A3HA 2J8FA 3GDTA 2NVCA 4U5IA 4L9YA 4ML9A 2NQHA 1TPEA 2BOGX 2BLEA 2ONEA 4XBKA 1KC7A 5HUOA 3RMEA 3C5QA 3PN8A 3T0AA 1JXKA 5L9FA 2CZVA 4M7TA 3LTYA 1J2BA 3OVPA 1XG4A 3M44A 1DWJM 2VQUA 1LOLA 3F4DA 3O2LA 3JW7A 1GVQA 4C6DA 1JDDA 2J62A 4NAEA 3SCNA 2VL4A 4U2ZA 5DMLA 4G1NA 2ZQ0A 3R25A 3DKJA 1RUSA 1FHUA 1KM4A 2Q8ZA 4GI6A 1GTEA 3URNA 1KBBA 1A53A 4OBTA 1TZ9A 4A8LA 2R94A 1TV3A 4M81A 1BRLB 4BI7A 1LL7A 4AVOA 5F1VA 2I5IA 2BP1A 5I0DA 3GC5A 4RZ6A 3LBOA 1M65A 2Y5SA 7ENLA 1OCBA 4P7RA 1B3OA 1Q4WA 1AD4A 1F6YA 2B7QA 4JKKA 3H2FA 2Y70A 3UJEA 2TYSA 1MXGA 4PUEA 2E5CA 2XIOA 1VD6A 3LPFA 4AMAA 2D2OA 4GCXA 2VZOA 4PFMA 4K1GA 3TN5A 3PM6A 2YW4A 3KDOA 5A1AA 4XIMA 3M9YA 1KM2A 1YHTA 3AHXA 2I14A 4AF0A 5FF7A 2J47A 4K6AA 4PUWA 2QPUA 3EMQA 1BXCA 3BSGA 4FNQA 4FF5A 1B5TA 1E0UA 1VFMA 2JIWA 4J3XA 3LHZA 4UQEA 3B0PA 5G4WA 3UZWA 3UGVA 1YTEA 2NV1A 4DO5A 2GUUA 4A8NA 1IYXA 2PWGA 3WQEA 4K38A 1B9ZA 1VBJA 1TVNA 3TYCA 4YMZA 1OGSA 1SO6A 4FMVA 3PTKA 1NP0A 3NOEA 4Z17A 3IUIA 1W2PA 3EWUA 4IG2B 4ZSUA 3W1QA 4CQCA 3WH8A 2DZUA 3ABOA 3QHNA 2XZ9A 3NQVA 3W71A 3RLHA 4GXMA 3UESA 3UG5A 2VZVA 3QGVA 3BOLA 2DPEA 2XFYA 2PPGA 1S2TA 4RZBA 2E68A 1EEPA 4QDWA 1RD5A 2DSUA 1JUKA 2CERA 1MSSA 1UOZA 3HIJA 2E6YA 3M6YA 4I7UA 4Z2GA 4HMNA 3VC6A 4ZE5A 1M1BA 1GVFA 4FK9A 3UZ5A 1V6VA 4O4VA 3GXMA 1VP5A 2YLAA 1L6YA 2ZUNA 4KGJA 1SW0A 4UFJA 4IM4A 2W0UA 4CKQA 1KXVA 4HMCA 1JDCA 2JBMA 3F5LA 3AYSA 1DBTA 5M03A 1WP6A 1A49A 1A5SA 2GJXA 1VB9A 3TTEA 3AICA 4R7OA 2TPSA 1PHQA 1SPQA 2IKJA 3I7RA 1Q6FA 3NQDA 3GFZA 4U28A 3R6IA 2J7FA 1YXCA 4P7QA 1PWLA 1R6WA 4XD4A 1SZEA 2P53A 3S6DA 5CPOA 1HQTA 3WD2A 2GVGA 1GCYA 3Q65A 4A3RA 1SM9A 3VDBA 2ZWYA 4S39A 1FWFC 1OGGA 1VLIA 3R2GA 2VZTA 4PN2A 2VEPA 2OWXA 5LKYA 3TDFA 2WHKA 2E6AA 4LC6A 1IEQA 3G1SA 4R33A 2A79A 2X05A 1FDYA 4UXDA 3FJNA 2JKPA 1A3XA 4GIRA 2J6XA 2YYUA 2BGNE 4EPKA 5CC3A 4PMZA 3L4VA 2VGGA 5ABEA 2O0TA 2A4AA 4GE8A 1XDLA 4C6FA 3VKDA 2GUYA 3L65A 2BHZA 2C91A 3MS8A 2PGRA 4LAOA 1X6LA 3H4GA 5U4NA 3ZR5A 4RX0A 1EDTA 1PVNA 4O1EA 3T2QA 1YNYA 1JL8A 1QI4A 3M1ZA 3MVIA 2EPLX 2WMKA 3LCLA 4H6QA 3GK0A 3TKFA 1YKWA 1XYBA 3T40A 3LYEA 4GUHA 4Z0SA 4HGXA 1MEIA 2FDSA 1R0MA 3LGEA 3Q45A 3SO7A 3KRSA 1OIFA 4WIWA 3BLIA 1I2QA 4NG3A 3WLRA 3C3UA 3IK2A 1T0OA 2Y7DA 3OOQA 1XFCA 3CLWA 4O17A 1UH4A 3F4CA 1UWIA 4ZSTA 3L21A 1UB3A 4Q4KA 4JTSA 1SO3A 2XSBA 3GDRA 2VT0A 3KZSA 3S2LA 3ZWTA 4QDPA 1OIMA 1H62A 2XIJA 5LNWA 2X30A 1N8WA 4FLSA 3PUEA 3AUJA 1EB3A 3NL5A 2CBJA 1F07A 1XBYA 3T2PA 1A4LA 3W7CA 1Y5XA 2FJUB 1TZ7A 5G4EA 4F9JA 2WNQA 3NEHA 3WQ6A 4JEQA 1UIPA 4GX9A 2DW6A 1EJRC 1O5RA 5FAJA 4ADUA 2BGQA 3QZAA 3NO5A 4B5XA 3VDCA 4W7WA 2AGKA 3WLQA 4AC1X 3E2SA 3OA3A 3GVRA 5DCBA 5HK4A 3AC0A 1XPYA 4ILSA 3BICA 4NJJA 3WBXA 2Z4GA 3LXBA 5CPLA 1IXQA 4K1WA 2BOEX 3RJXA 5E6YA 2CZDA 1EHAA 4PRWA 1W91A 4DJED 2VVSA 3SUWA 2YDSA 1R2SA 2OX1A 3DG7A 1TCDA 3VK5A 3VOHA 1X39A 2VELA 1VYSX 4ZBCA 1QWKA 4LQ1A 1OFQA 4B9ZA 3LHTA 4M19A 3WH5A 1A47A 1E0WA 2MNRA 3MP3A 1A5MC 4JTJA 4IIEA 3V5OA 1XSJA 2VGIA 4WY0B 1R85A 1H3GA 4AU0A 4LUTB 2PRLA 3W74A 1QPKA 4ENLA 1X7FA 4DUVA 4YVXA 1PKLA 3RIKA 4YVVA 1QNRA 1UQZA 2V8ZA 1ZJIA 4QCEA 3KRUA 1VPYA 4WD0A 2R1MA 3CM4A 2OYLA 3F4WA 3BV7A 1FTXA 4B5VA 4M7SA 3VE9A 4YTQA 2NVAA 5I3JA 2C1HA 2VGBA 2UY3A 4WX2A 4JS3A 4L5ZA 3KOZA 1LUCB 3P67A 3VYLA 1Q6CA 1XRFA 2X09A 4LVFA 3WDHA 2O9TA 4ES4A 2B31A 1X7IA 2VR2A 3L7RA 4OE7A 4RDZA 3PUDA 3R1ZA 4ERIA 2ZRXA 4CNPA 1EJUC 5LNRA 2XGZA 1KGWA 3IAPA 3BDKA 4PTMA 3EZ4A 2ZDSA 1VEMA 3LCHA 4O13A 4S3GA 2ZXQA 1T7LA 2QJNA 2ON3A 1C8VA 4G56A 2XH4A 3VCNA 3N73A 3EGJA 3KCJA 3WFZA 2J27A 3ES7A 1GZJA 4XB3A 4I9JA 3VFCA 2J9ZA 2R24A 1QO5A 2C7FA 1AW5A 1ENUA 4QXIA 2VQTA 2Y85A 1OYCA 1FKWA 2DZBA 3WH7A 1UUQA 2OLHA 4B16A 4KEZA 2IKIA 2V38A 4WY0F 1W5OA 5C9WA 5LIYX 1U22A 3E12A 1I8JA 1XHGA 3GBEA 4FHAA 3RPTA 4CQAA 1V3HA 1OY0A 3MW7A 1VEPA 3WF2A 2DW7A 4MNKA 3PBMA 3G0XA 1FHDA 1FFRA 4MG4A 5D9OA 3LLXA 4AIBA 3WLMA 3CUFA 3FGCA 1C90A 4X22A 2PDYA 1I45A 5I7GA 5LXEA 3OLDA 4Y96A 1XIHA 2YDQA 3U2CA 3TUUA 4IX0A 3CIXA 3R94A 1KM3A 1S5VA 1UH3A 4HNVA 4LAUA 3H21A 3WH9A 4MVAA 2YYTA 4U2YA 3S5YA 4IT1A 1UWQA 1GJPA 2PD5A 1R46A 4Z1BA 2DVTA 1EC8A 3ZQ9A 3DFSA 3GNNA 2IQTA 3G22A 5K3VA 3ME3A 4CQDA 2PDBA 1MI3A 3NGFA 3GUGA 4IMDA 2JEPA 4F0RA 4A3HA 3WQOA 1QFEA 5D2VA 3SIMA 3I3BA 3WJYA 5FSDC 2GQ3A 4ZE4A 2A7PA 5MHBA 4HSHA 5HULA 4AIOA 5A6AA 4NF7A 2Y5EA 3EMCA 1DIKA 2WWDA 3N2TA 3OYXA 3W2UA 1JZ5A 3BCJA 1MW0A 1BQGA 1TWSA 4J2PA 1LG2A 1QAPA 4TX6A 1LTDA 3WUBA 5EMKA 2WSRA 2J6VA 1LQ2A 5G1TA 4LXFA 2ZE0A 4Q7NA 3AIVA 4DQWA 2BFGA 1OINA 4QEHA 3ARRA 1NWRA 2CKRA 1G7VA 3W70A 3CU2A 2YCIX 1F8IA 2WSKA 3FVMA 2VC5A 3GW3A 1RA0A 3WLSA 4ACYA 4E4PA 4MB1A 1PV8A 1OX4B 4KWWA 1X1OA 3SAZA 2PWFA 4DYKA 3VD5A 4H9YA 2ISSA 4GJJA 1KFCA 4PMXA 2CLOA 4N9EA 1PX4A 3ONCA 5IM51 2GSEA 4UTHA 3EWCA 4JTGA 4JFVA 1KR0A 3E02A 1LP6A 4GI9A 2OWCA 3P8JA 2CZEA 3RXZA 5I3KA 3QR1A 2OQHA 2ZZ3A 1A5BA 1UQYA 3LQGA 5C2XA 4NX5A 1KCZA 3N2OA 3GVWA 3CHEA 3SB0A 1JPHA 4URIA 3L4WA 3S3GA 2QW5A 4FX6M 1YRRA 4A3UA 2CLFA 4R7JA 1KV8A 3N11A 1MFUA 4LPCA 4C6QA 2AGTA 2E4TA 3CV6A 3TN4A 3GDBA 3M0KA 4KERA 1PX8A 1DJNA 4NKCA 1KD0A 3SUUA 2WPBA 3AO0A 1OFRA 3E74A 4GQRA 2BVTA 1MZRA 3QC3A 3BLFA 1MYRA 1ZRQA 2ZTKA 4GYPA 4LY4A 3GUWA 4O28A 1QUMA 4NZCA 3ZLHA 4FX8A 2BSLA 1UA7A 3WQFA 1EJSC 3WQVA 3VNLA 1Q4NX 1ZCOA 1W17A 3K8KA 1TTJA 3KEHA 1UR3M 3BJTA 3HG5A 3JS3A 1S5MA 3BXWA 4JX4A 1VFSA 1M7OA 2GK1A 2CIPA 3KRZA 5AYIA 1R9XA 2EG8A 1CYGA 4RDVA 3CIVA 1K03A 1T99A 4GQGA 3EA1A 3MSYA 1E56A 4M6QA 4J5NA 1VIZA 2ZX6A 2UV8G 4JFSA 4MUPA 3PUGA 3PUOA 3BLPX 5IRPA 3SADA 3U2ZA 1R3SA 4HU4A 3DFPA 3IV8A 4I9MA 5I2UA 1O6IA 3DFTA 1YPXA 1IEVA 5E09A 3U7BA 4FXJA 3VKCA 1GOOA 4KH2A 1NFPA 9XIMA 1SO4A 1OFAA 3FDGA 4RNFA 1JJKA 3PANA 2XGIA 4X9YA 3O6DA 4OTKA 4WUIA 4YL2A 4ERAA 3MWAA 1R3YA 4IMAA 4GKTA 4GO8A 1M3UA 4O16A 1P0KA 2CYGA 2A1YA 4M5PA 4JX6A 1ZJBA 1QPRA 4JYDA 4WDTA 1D7FA 2Y61A 3QSRA 4PCNA 4GK8A 1GPFA 3G1FA 1H0GA 1J0ZA 6REQA 4QAWA 5EPDA 1SFJA 4C6IA 4MLJA 1JZ8A 1MQRA 3EX1A 1AL8A 4DYJA 3VGDA 2W67A 4ZB2A 4YTUA 2EXOA 1XRSA 5BYWA 1XLDA 1D2KA 5A2AA 3TA9A 2CNCA 2OT1A 4B92A 1HJUA 3NQGA 5XINA 4HTYA 1ODUA 3IGSA 5CLTA 2H8XA 3AXHA 2XJ7A 3GZAA 3INPA 2ZA1A 2BMBA 3TSDA 3N9SA 4ZMGA 5C6MA 1SR9A 2GGGA 4KFNA 4XD3A 1PAMA 4FOUA 4PSRA 2IQ0A 5AHFA 5DN1A 3BMVA 4IQJA 4KPLA 1XPGA 4GNVA 4LOCA 3NPXA 4W7UA 1YW1A 1L6SA 1P5BA 2ZVIA 2QCFA 4N02A 3W22A 1GOWA 4LCSA 3W26A 1U1JA 3IJDA 1WBJA 3GG8A 4KKXA 3MYPA 4ML4A 1ONEA 1Z41A 3CV2A 4N7QA 1QNOA 3VA8A 1WOAA 1L0PA 4H9XA 1F3XA 2O9PA 2YXOA 2G37A 3TN6A 1YE6A 4CLMA 5DX7A 2DSWA 3VM5A 4GVGA 1XLHA 3KTSA 4UWMA 1QNQA 5FJUA 2QT3A 2ZC8A 2ZFAA 3WCZA 1VYPX 1P4CA 4RW3A 3COTA 1S2CA 4QS6A 1DJZA 1OHLA 3VKBA 3WQ4A 3IVSA 3SEPA 3ID7A 1G9HA 2VDHA 2ZUSA 2CU0A 3MKKA 4O1BA 2Z0IA 1QPOA 1JRBA 2HK1A 2RUSA 1PIIA 4RW5A 5GNXA 1K70A 3OODA 4UMBA 5CPTA 1UWSA 2WJDA 3M0HA 4Q4OA 3PJTA 1B54A 5D04C 2CBUA 5CSYA 1JPMA 1CBGA 2E6DA 1XGZA 4MF4A 4E2OA 2WC4A 3OG2A 1WX0A 1W1YA 3GDKA 1Q85A 2PZ0A 1JYVA 3ANUA 1HX0A 2Y4SA 4PCTA 4ZZ9A 3AJ7A 2AMXA 1AH3A 1F61A 2QDEA 4US5A 3NQFA 1HW6A 1JZ6A 2FHCA 5DO8A 3VX0A 4NILA 4MY9A 4AEEA 4BEQA 2J7EA 3B97A 1OFDA 3O06A 3W88A 2BS9A 4C6KA 1UC5A 1TV4A 3UG4A 4HOXA 1RCQA 1JZ4A 3PTDA 4H19A 2QYGA 1E73M 4YTRA 4DWSC 5AYXA 4AXKA 2WVVB 2DUAA 3CZLA 4UR7A 3FA5A 1NWSA 4JIHA 4V28A 1TTQA 1EWEA 4WSKA 2DZVA 4QLKA 3M0LA 2E28A 3ARSA 2QF7A 1UROA 3DXIA 3OQ8A 1BD0A 6PTDA 1KBKA 2QJGA 3O05A 3ZR6A 3W85A 3FAWA 3JZUA 2J7GA 4JDBA 1P7TB 1EP2A 5ABFB 3VFLA 3HGRA 3FXYA 4ICMA 4JTAA 2OOFA 3DYPA 3FKKA 5TBOA 4O53A 5C8BB 4AZ5A 2BG5A 5E9AA 1CLXA 4BY3A 2ALDA 4UTTC 3H54A 4PRRA 4MYXA 4JTIA 4K37A 3UNTA 4XTDA 2PWEA 2QS8A 5C55A 2XU2A 2W63A 4MAVA 4LW7A 1P0NA 4KCUA 2JIEA 4MM1A 3P8IA 2PA6A 1VFHA 4CCCA 3LPGA 3TYZA 3IPWA 4GQ0A 3PFMA 1H1YA 3N6JA 3T09A 3AYTA 1W9VA 4D6IA 3WNOA 1RR2A 3FXGA 5E9XA 4FZIA 3SY5A 1K9FA 1LZOA 2UZ9A 1EX1A 3AMDA 4JIRA 1GORA 1SUXA 4WJ8A 1PKYA 2DP3A 2VTFA 4JN7A 2WHLA 3NQ7A 3GWQA 4UTWC 3O6AA 2Z26A 3PZ9A 1XICA 4YVPA 1F3TA 1RJRA 5G5IA 3H12A 4US6A 3VE7A 3A4JA 2GJPA 2J9YA 3JU2A 4JTKA 3SCRA 4F40A 5DMNA 2HK0A 5I24A 4M24A 3TSMA 3WF4A 4L4LA 4UOZA 1M7PA 2B7OA 4H7ZA 5JBEA 4NYUA 2FZBA 4HNTA 2VX7A 3RLUA 4O12A 1KRCC 4D6JA 1LWHA 3UPBA 1IF2A 3CAQA 4H2CA 2WNWA 1GOQA 3RCMA 4D71A 4FNRA 3B8IA 3CEUA 2HPIA 3H8AA 8XIMA 3LG3A 3LZ3A 4QDMA 5EYWA 3L5LA 5AN7A 4DO4A 1E6PA 1YTDA 2ALRA 3B4UA 3HPFA 1HJQA 2GQ9A 4NASA 3WEZA 5A8MA 4QBXA 2QLYA 2X1IA 3J7HA 5JIPA 3NFUA 5CJNA 4IPPA 5CGQA 3M46A 4YHEA 4S38A 1CXIA 3F2CA 2VX5A 3CQHA 1SYTA 3TOPA 1M41A 1RV8A 2FQIA 4TVUA 3CZGA 1M6JA 2QCLA 1FHVA 3MMWA 4QRNA 3FJ6A 1WZAA 1OFEA 1QRQA 2C18A 2D69A 2V5BA 5AB3A 3MT1A 3BAKA 2HBXA 5REQB 5EMLA 2ZX8A 1WDRA 1DXFA 3H24A 1EP3A 4E2DA 4Q6JA 3VNZA 2Y24A 1CGTA 4HNNA 4IJCA 2BOFX 1BYCA 4AEOA 2XIMA 4BS0A 1ZSXA 3OGRA 2FFCA 4PULA 2CWXA 1PX3A 3LBCA 1BXBA 5D02A 4AW7A 1JCJA 2VHLA 3VZXA 3LV5A 4LV4A 5CCZA 2YW3A 2Z2BA 4LNYA 4Q4RA 5IHRA 4HNCA 3K4WA 2R82A 2YBTA 1W1A1 4H83A 1OYAA 4E38A 1EBGA 1HZYA 4OT7A 4CD7A 3D5HA 4PB3A 2ZZ5A 4C91A 2Y0FA 2ZX5A 1OD8A 3HFTA 1G0CA 5F4WA 3RRAA 1PSCA 2WANA 3FA3A 3UD6A 4PEEA 1J0YA 1QI0A 3TCEA 2J88A 2Z1WA 1CLVA 2PI6A 2BNJA 3MY9A 3FLUA 4XUYA 3SI9A 2YA2A 2IW0A 2Q02A 4Q3MA 3URQA 4UTUA 3GHTA 3SCPA 1YDNA 5DXYA 3IACA 3AIWA 1X1NA 3PBGA 1KR1A 2ZCGA 1XD0A 4XZWA 4DNHA 1ZBCA 2R1KA 2ZA2A 4XZMX 2WKJA 2P76A 4QJ3B 4I7VA 4H9VA 1AJZA 4WDXA 2YSWA 4JFUA 4UTLA 1K4GA 4HHHA 4CUCA 1JCXA 5K2ZA 3UJSA 1FWRA 4O1CA 5GNYA 3G1HA 2PFHA 1J93A 2YB1A 4NI3A 2OKTA 4S1FA 5EMJA 4EK7A 1MWOA 3PB2A 3REQB 1FCVA 1F73A 1HJVA 3POHA 1AODA 4LJ3A 5A69A 2VC6A 1OQFA 1N8FA 5LGXA 3VD7A 4PMNA 2NXGA 1V7AA 4QLLA 1JUBA 1UP3A 3PF3A 4E6MA 4RE4A 3N4AA 3CH9A 1YDVA 4IZGA 4NZ5A 5CG0A 3JRKA 1E1FA 1NQKA 2Z2AA 1DOSA 1V6YA 4PL2A 1FWGC 1RQHA 4WDUA 1DWFM 1W9DM 3R8GA 2DT3A 3LCWA 2IUZA 1XH2A 4H8HA 2REQB 1O5XA 3FDKA 2WMIB 5CZTA 3SM0A 3LCIA 1QVBA 4GFSA 2Q8XA 4KRZA 7A3HA 1E6ZA 1PL9A 1UWUA 1XIEA 1EJTC 3AIBA 1Z8AA 4HIBA 4K8GA 2PDGA 4TR9A 4MDPA 3DU0A 4V1XA 1C7TA 1FQ0A 4IGHA 4QR6A 3WENA 4KBXA 1WKEA 3TJ4A 2AQWA 4B3KA 4OV9A 4JIPA 8RUCA 3KOXA 5CGTA 2Q8LA 4L64A 1F4HA 3HGJA 4UZUA 1VAHA 7REQA 3UXAA 4IFRA 4JIIX 5CLWA 4Y8EA 2WK2A 4DF1A 3TFXA 3GZ3A 4HBKA 5M5DA 3TJXA 1TG7A 3SRHA 4JXCA 3OHMB 3P2VA 1ME9A 1HL9A 4KWSA 3BQ5A 2CHNA 3K30A 2B7PA 1PTAA 1QW7A 1T8QA 4B3ZA 3M16A 4ERGA 2PC4A 2HPMA 1CXKA 5HBFA 1G4TA 3S5OA 1ZNNA 1LWJA 1GG1A 1FDZA 2AKMA 3VC5A 1QMLA 4W5UA 1XC6A 3LRKA 2BDQA 2GVLA 4MIMA 3W76A 3W7EA 3HU7A 2XVKA 1KRAC 4X2PA 2GOUA 1JD7A 5GJNA 4H9TA 3L4TA 4YPJA 3ARXA 4EXQA 5J8LA 1JDAA 3BLEA 3R8RA 4BF7A 1DIOA 2BTMA 2FH8A 3NPUA 5DT5A 5A6KA 2KAUC 1RLCL 4QP0A 4WOZA 4GVFA 1S39A 4L6OA 1VFTA 1B3VA 3V35A 4IJRA 5FEXA 3UR5A 1ZAIA 1UKSA 1J5SA 2QCEA 3BQ6A 1IT8A 2ZUMA 4HN4A 3H4XA 3QM3A 3TK7A 2A6LA 5C7HA 3PZMA 1W3TA 1CXFA 3TXVA 4E3TA 1TPUA 5I09A 1I4NA 4HZ6A 1Q6QA 4DN1A 2ODOA 5BWFA 4MWAD 4OBRA 3E5PA 1D8CA 3MPGA 5KZEA 3L68A 1R2RA 4S2CA 1CECA 3GSMA 1V0LA 1S38A 4RV3A 4REQB 3PY2A 4HA3A 3UXLA 1FBAA 2OZTA 3DFOA 2F6UA 3G24A 3HURA 1XG3A 4X60A 3UXIA 1W3JA 4ZTXA 5I6SA 1OC6A 3VABA 1JZ3A 5C5YA 1K8ZA 4IH3A 2OTDA 5FI8A 5CJMA 1IZJA 2OZ8A 4HQVA 3WQWA 1ITUA 4J40A 2PWDA 3O6CA 3VVGA 1PE1A 3FYPA 1J9YA 1XYZA 2CLPA 1DEDA 1O60A 3KS6A 4IIGA 1XIMA 4MSSA 1EPVA 2ICSA 3PPCA 4UTJA 3HO8A 3LI0A 3DBPA 2CBVA 2FVKA 2OGYA 1TRDA 3WLNA 4Q33A 4FIQA 2J24A 3AHTA 3R5EA 3N19B 1E6QM 1YXYA 4Y9OA 2WQDA 2XSAA 1M68A 2C0AA 1HKIA 3LSBA 1QHOA 1XKYA 1KLZA 2YL8A 1EQCA 3T6CA 1X6UA 3L4UA 3UXKA 3AALA 4RK8A 1J2WA 2BHUA 2IQDA 2PDPA 1A0CA 3LRMA 4K68A 8A3HA 1XF0A 1R2TA 1CXLA 2XH7A 3B9EA 1TCMA 2E9BA 3QPZA 1V51A 3L0NA 4HHMA 2P1FA 1IXNA 1K3UA 3G1XA 3B0YA 3K8LA 1RZMA 1YLVA 3MHGA 2DUXA 2PGFA 4WSHA 1DJGA 3T44A 3W75A 4C1KA 2F84A 2XUCA 3F1QA 3URBA 1JVNA 4OUIA 3E2RA 2D3NA 2J9XA 2Y8KA 4FALA 3TLQA 2VZUA 1IZCA 3TZFA 4F2UA 4UTFA 2RH9A 3ARQA 1CGUA 4EWJA 4DZ5A 3HMCA 3DECA 4RE3A 1EEXA 2PP0A 1KM0A 5D05A 4WEVX 1FWIC 3T1GA 1OD0A 4JTQA 3W72A 3G18A 3KP0A 5KETA 3S1UA 4KEMA 2W6RA 3H4WA 2YB4A 3HPAA 4LUIA 4YWIA 1K8XA 4E4UA 5A8OA 4R53A 1KBLA 1JYXA 4L1XA 6TAAA 3IIPA 3G6LA 3HGOA 4CQ9A 5AHNA 5T9BG 3GNXA 4W5ZA 4X61A 2GSJA 1E0XA 3BZJA 2IMRA 1C92A 2O4QA 2Z1BA 3T42A 4KF1A 3LPOA 8TIMA 1OC7A 3QY7A 1TJRA 3W1UA 1XFBA 1Q66A 3O0KA 1ZU8A 2BGSA 2HS6A 3BG3A 1S1RA 2FB3A 2OMAA 3UJ2A 1S2VA 4MB5A 2PDUA 3TNOA 1B3WA 1DQXA 4WDWA 1UG6A 3W7KA 1RY8A 3NVDA 3NQ2A 3VIGA 3SCQA 4N0RA 1GJWA 3NM1A 3ZFHA 4OGZA 2VWSA 4LYKA 3VGFA 3HN3A 3S5NA 4GABA 4NU7A 4F0HA 4EVZA 4US5D 1V02A 3VUSA 3D0CA 5M2FX 4ATDA 4R27A 1ADSA 1T5AA 3WBEA 1HKVA 1WKYA 3N25A 2OEMA 1WZMA 4IOTA 4FXRA 1K9EA 4JQ4A 1GQJA 3GTHA 1AZ2A 4ZOCA 4N4PA 3AFBA 3PK7A 3VCCA 4Q8UA 3EOLA 4EKJA 4YTSA 3CASA 4U5KA 3TJIA 3WDQA 5LHFA 2INZA 1BRLA 2Y62A 3ABQA 3TMQA 5LIWX 2QIWA 3KAOA 3RHGA 3HQ1A 3QPYA 1M9HA 4GINA 4HHLA 4OOUA 4PUUA 3SDOA 3BG9A 3IJ9A 4WLCA 3JVAA 2IS7A 2GGHA 4Q6XA 1SQ7A 1E4MM 4AISA 1DP0A 5AC4A 3GHRA 2QJMA 3DHDA 3IV3A 3M64A 3NWRA 5CZKA 5LNVA 3QJAA 3W6MA 3AMGA 1IIHA 4JY8A 3ZLFA 1LQ0A 3K13A 2NV2A 2G3JA 3MBFA 3TNBA 1O1HA 3H26A 3ZT7A 4NRSA 3W2KA 1KQYA 5BNKA 1J0KA 5FCZA 3SR7A 3NXLA 4TV6A 2XH2A 4FXFA 4WF7A 4F4RA 2J7CA 3C61A 1DQUA 2WLYA 2L5HA 3B40A 4IICA 4NZ1A 4C1LA 1E6NA 5I77A 3I6EA 3CQJA 3PR2A 5HR6A 3SQMA 4DXVA 4E4FA 2C3ZA 3GNDA 3U57A 3EWBX 5L6UA 1PB0A 1WKFA 2YKKA 1EQPA 1MDLA 2EGZA 1ZS2A 2JKAA 3EWDA 2GPTA 1UJQA 2OXNA 1LRQA 2VZSA 2ZZ7A 2OQYA 3ARTA 4JYFA 5EMUA 4IG2A 2OLAA 4XZIA 1S3HA 2DZXA 2NQZA 2YA1A 4YJ5A 5AKQA 4S3JA 2WNNA 2W79A 5G4HC 3T4WA 2WM0A 5K9XA 2VP8A 3KZPA 5HANA 2PC8A 3EX2A 4U31A 4HYRA 3EDJA 3D3AA 2YDRA