3VZXA

Crystal structure of pcrb from bacillus subtilis subap. subtilis str. 168
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
227
structure length
227
Chain Sequence
MYDVTEWKHVFKLDPNKDLPDEQLEILCESGTDAVIIGGSDGVTEDNVLRMMSKVRRFLVPCVLEVSAIEAIVPGFDLYFIPSVLNSKNADWIVGMHQKAMKEYGELMSMEEIVAEGYCIANPDCKAAALTEADADLNMDDIVAYARVSELLQLPIFYLEYSGVLGDIEAVKKTKAVLETSTLFYGGGIKDAETAKQYAEHADVIVVGNAVYEDFDRALKTVAAVKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Heptaprenylglyceryl phosphate synthase
publication title Insights into TIM-barrel prenyl transferase mechanisms: crystal structures of PcrB from Bacillus subtilis and Staphylococcus aureus
pubmed doi rcsb
source organism Bacillus subtilis
total genus 78
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature ec 2.5.1.n9: Heptaprenylglyceryl phosphate synthase.
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01884 PcrB PcrB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.390 Alpha Beta Alpha-Beta Barrel TIM Barrel FMN-linked oxidoreductases 3vzxA00
3VKDA 3VZXA 4MM1A 3VZZA 3VZYA 1VIZA 4NAEB 3VKAA 2F6XA 3VKBA 3VKCA 4JEJA 2F6UA 4NAFA 3VK5A 3W02A 3W01A 4NAFB 3W00A 4NAEA
chains in the Genus database with same CATH superfamily
2C19A 4DBUA 2V30A 4WLCA 3HPSA 3DI1A 3KOZA 1KLZA 4FK9A 2IKHA 2D0GA 1ITCA 1V02A 4B3KA 3QSTA 4N6EA 3B8DA 3RCYA 1TV4A 2XGBA 2JQXA 1FCQA 4IM4A 5AC4A 1QHOA 2CLHA 3S6DA 3RLVA 3E2SA 4JTAA 1TV7A 2VUYA 3LM7A 1VJZA 3HFYA 1B30A 2CLOA 2X0SA 1DL3A 2RKXA 5CGTA 1EC9A 1A53A 3P8IA 1E43A 2BOGX 3W84A 2QT3A 3NDYA 5A6BA 1ME8A 4IIHA 5BROA 4E2DA 1GK8A 4MZ8A 4EX4A 1K8YA 3DFOA 1O66A 4IIBA 4C1KA 1Y8BA 3G1HA 3OA5A 3P0XA 1GVFA 4W89A 3SRKA 2EG8A 1XUUA 4RPQA 2PCEA 1UIOA 1CPUA 1JPIA 3MUIA 4GY1A 3BZJA 1WO2A 4P8XA 1I1XA 1LOQA 2Y7FA 4L65A 4GD0A 4HK5A 3AIVA 3ZJ6A 3WY1A 3QKEA 2WCAA 4MWAA 4GOAA 1UD4A 1H0GA 2RJHA 3W83A 1W9PA 3TTQA 3IRDA 3GDTA 2J7HA 3LD5A 4RZ5A 1W1TA 4LGXA 1UP3A 4FNRA 3QLLA 1LTDA 2ANUA 2QNEA 1DJIA 1M01A 4P5UA 3FVMA 2WVVB 3MHUA 1EIBA 3CWNA 2BP1A 1A80A 1E73M 1W1VA 4K37A 2BFGA 3TP4A 3WF4A 4NQ1A 3CLWA 1K8XA 1RD6A 3M0IA 3FV9A 3SIZA 4F40A 3O6YX 5LIKX 1EOMA 5H6HA 1N2VA 5CZTA 2Y7GA 4O14A 5LNRA 2RH9A 3NNTA 3UCDA 3APYA 1V3KA 1OX4B 1P0EA 4EK7A 3EDEA 5D9NA 5FA5A 1RZMA 4WKHA 4IG2B 1UWRA 4JIHA 4P2VA 3CUGA 2BGNE 4C7GA 5LGXA 4H8NA 2VELA 3VDBA 3B3DA 3W7LA 1P1MA 3BOLA 1EYEA 1BYDA 1WOAA 3EB3A 1PWMA 3CEPA 5AYYA 5EMKA 4NNCA 2Y8KA 1BGGA 1W9DM 1OCNA 3AWNA 3W7RA 6REQB 4DZHA 1F4AA 1POJA 2PP3A 4ML9A 4UFJA 1FCUA 3QC0A 4JTDA 5CQ1A 2Z26A 1XBXA 1EO5A 3KUMA 4JNYA 1ZJBA 3V35A 5XIAA 3POCA 4D6GA 5ECVA 1XDJA 1AW1A 1JDAA 1PYFA 1KCXA 5HQEA 2A7PA 4C6PA 1JQXA 2PZNA 1L6FA 2V5LA 3B04A 4RLIA 5HATA 1W91A 1DWGM 4GCAA 3ITTA 4B5UA 1QFEA 4K39A 1V3HA 2R6OA 3NG3A 4JIQA 1MZRA 2O9RA 1OIMA 2UY2A 1A0EA 1ADDA 1KFBA 1JRCA 3DENA 4UMAA 3AMCA 2EPOA 3G8EA 3O7UA 4DRSA 1LL4A 5CPMA 1W5QA 1TWDA 3R8GA 5AHFA 2P5NA 2A4AA 3LBMA 2W5FA 2HTMA 2NSOA 2YR1A 2Z4GA 3S5ZA 1W54A 1Z7AA 3TCEA 5HWMA 3SRHA 3H70A 2OYLA 4H9YA 1Q13A 3TZFA 3ZSTA 1DIOA 4L1GA 2VURA 2CC0A 3P5YA 3AZTA 4O54A 4MUPA 1E40A 1W56A 3D46A 2ZUSA 4LS1A 2ISFA 1K9EA 4WCJA 3MKCA 5HJYA 1F3WA 5FF7A 4HPGA 3HN3A 4DLFA 4GE8A 4O0QA 1J0IA 3ZVHB 4QISA 3SY8A 2V9DA 2VFHA 4LBUA 1MQRA 1UR9A 2HVOA 3ZJ7A 3EAUA 3GIYA 1KW1A 1UH4A 3P5ZA 1UASA 5FF2A 4DI9A 4H01A 1QUMA 4NI8A 4ML4A 2DU2A 3RF9A 3STFA 3DHDA 3DYPA 3PVFA 1V6WA 2DZWA 4O10A 1NY1A 2CLFA 5DMLA 2OZ3A 5D2TA 4IPPA 1QHZA 1EJWC 1KBKA 1X96A 4NYUA 1UKOA 3GVVA 2JKPA 5FJTA 5LXXA 2Q3RA 3G1XA 1ISVA 3PS7A 4US5A 4EXBA 2PDKA 4S39A 8TIMA 4GACA 4PMZA 4HMNA 4JTCA 5FJJA 3WF1A 1UR0A 3VKAA 1L2QA 4ONVA 1KFKA 3OVRA 3HB9A 4AZ6A 1LLOA 4GFIA 1E1EA 2OZTA 2Z7KA 1ME7A 1LORA 3LX9A 3TKFA 1ZGDA 4QNWA 2NUXA 4WUIA 3ECQA 3ITCA 4B4HA 1KM5A 2ZWYA 4XIMA 2C79A 3W6MA 3E3HA 3GTNA 1W5PA 2AKMA 3A24A 4KPLA 3MJYA 2DIKA 3GFYA 3ARVA 2HRWA 5LA0A 3E12A 5F1VA 5EMJA 1VD6A 2ZRUA 3OZOA 4B92A 3MCMA 4P8VA 5AYIA 4C1LA 3B8IA 2I5GA 2GSHA 5AC7A 3AI0A 3PBMA 2YGYA 1GOWA 2J7BA 2NQHA 3WBXA 4URIA 4DO4A 2A5HA 4WJEA 2VUNA 4O1DA 4OU1A 5CSUA 2V6AA 4N0RA 3HQPA 2E28A 1LUCB 1LZOA 1W9VA 2VZOA 1L8PA 5DY3A 3ARZA 3HZ3A 3NPXA 3L66A 4GX9A 4UQBA 1XLBA 1VCGA 3EWZA 3W7EA 3NQBA 3ARQA 2ABAA 2UWFA 5KTLA 4E6MA 3UZXA 5T91A 3MSYA 2PDNA 2ZDRA 3S6OA 2CBUA 3QQ0A 2OGYA 3L4WA 5E70A 1UD2A 4HN4A 1S1PA 2VCBA 3TTEA 2PDBA 5LNWA 2P10A 3GZ3A 2YCLA 3O15A 5I2UA 1G67A 1IEQA 2CW6A 4EF9A 2JIEA 4N9BA 4AWEA 4BR1A 1RCQA 3FKKA 1E0TA 2A3BA 2DDXA 5I5RA 2QMJA 3LENA 1US2A 1WA3A 1B54A 5GVJA 3DFYA 4DF1A 3NA8A 3NQFA 1Q8AA 3SY5A 3N9KA 4PFHA 3RRXA 1LQ2A 3LGGA 4D8AA 2YCEA 1CXLA 2XFYA 4B2DA 3UPBA 5J04A 2QDEA 4K8GA 1P48A 1N8FA 4HBKA 4B3ZA 1EP3A 1NOUA 2PDXA 3CZKA 3GK0A 1SSGA 3UA3A 4N9CA 3GFZA 3UPWA 2Y1HA 1F07A 1KCZA 2XM1A 1VKFA 4JX5A 3BSHA 5T8GA 3G24A 1TQJA 3QMRA 2IXVA 3LLXA 1X8FA 1MRQA 3PBYA 2Z0IA 4IL2A 1HL8A 8XIMA 1H50A 2OKOA 2B4GA 1EOKA 4NUWA 1TZ7A 3W85A 2QUVA 5I7GA 1C7SA 3LI0A 4G7EB 3G5EA 1BXCA 1XINA 1DXEA 5HK4A 4Q4PA 5A8NA 4O13A 1JFXA 3A6OA 1SUXA 1IXNA 3QVQA 4DJDA 1SW7A 1WXYA 5LIUX 4YU1A 3WD1A 4HNCA 3VMNA 4ZOCA 5DEZA 5TBOA 5C2XA 1QAPA 3RX4A 1W9XA 4UCFA 3URNA 2RJGA 1MW1A 2OEMA 2NXGA 1DQWA 4JHMA 1GHSA 1DJZA 3B0PA 2VR2A 2AL2B 1Y5XA 3P84A 2F2HA 3KLKA 5C9XA 4H19A 4FMVA 4JTQA 3Q37A 1XYFA 1VFOA 1W1B1 4RNIA 3RCMA 3S2MA 2NZLA 2IW0A 5HMEA 1JCYA 2VEGA 4AVNA 3NZPA 2O56A 5AFDA 1IR2A 2NWSA 2PI6A 3U48A 2OU4A 2E6YA 3VOGA 5I03A 2E9BA 2FYMA 4ZE5A 1XC4A 2GGIA 4LU0A 1A4LA 3VDHA 4XAYA 1JAKA 4M1BA 4JIPA 3CWOX 1IWBA 1QNVA 1ZPTA 4GVHA 4M6UA 2ZRVA 3GZAA 1IEWA 3ANUA 5A2BA 3OJGA 3WJWA 1UMLA 4KESA 1BG4A 1KXHA 1I9CB 4YCOA 2XVGA 4O15A 1YADA 1E1CB 4UTMA 3GC5A 1QPRA 1C7TA 4KIRA 3TONA 4YS1A 1I6NA 2PCQA 3P7YA 3BARA 4JIEA 2QDGA 5FKYA 3PP7A 4W7WA 2VR4A 4DYEA 3UG4A 2WM0A 4GMEA 2GOUA 4MZ1A 3AO0A 1O60A 1F6PA 3K2GA 1OC7A 1V6TA 3PNUA 1XSKA 1IE7C 1EP2A 1OZMA 2GYIA 4RJEA 4F79A 3UXDA 1AW5A 5HMDA 1MUWA 2VX4A 1GTEA 2B7OA 2Y8UA 2NVCA 4JX6A 2CZEA 3WQ5A 4UB9A 2H9AA 1HGYA 1W32A 3TC3A 3VD3A 5BOFA 2OWWA 3CZJA 4WIWA 1NWUA 1N8WA 2A3AA 2NXHA 1WKFA 3H6OA 1N55A 1M6JA 5FESA 2QAPA 3VCRA 4DBSA 1JZ2A 5KETA 1AH3A 2DT3A 4GH3A 3D5HA 1QMLA 4LBSA 4UZSA 2NQLA 3HPAA 4WK9A 3IVUA 2G95A 1K7XA 3E6EA 3FGCB 3L4TA 4GXMA 2FH6A 5D02A 4V15A 4LH8A 1A5SA 2OQHA 5JBFA 3IUHA 2ZTKA 3GC2A 3E9AA 2YW4A 3GG1A 5CBJA 5HR7A 2BY2A 3FA4A 2NQJA 1PZ0A 2WMJA 4HOWA 1UA3A 4NL1A 1P43A 5HOSA 5LHEA 5AYZA 1R5YA 3W6LA 4JN7A 4YXGA 5F2MA 4L6HA 2PDHA 1U1HA 5CAKA 2I9EA 4LJ3A 2Y89A 4LEFA 4B3LA 4C7FA 1CNVA 2WBKA 1O68A 3CPUA 3NEVA 3SW6A 5CC6A 1UJPA 2Y7EA 3GW3A 1GKPA 4HZ7A 4IMAA 1U5JA 1REQB 2QPXA 3W26A 4IP4A 2GJXB 1J0KA 4X0VA 2AL1A 4CNSA 3EOEA 3NQEA 2ZUVA 1E72M 1HKMA 4MIMA 1T8XA 3MO7A 1XPGA 3NUKA 3O05A 3KBVA 1AUSL 1K8ZA 3EMCA 3W81A 5AKQA 5BNKA 3K46A 1V03A 4CD6A 4EAYA 3U5YA 4AHPA 4JTGA 4HU0A 4BI5A 2WHMA 4Q7IA 1G4EA 1GW1A 1O5XA 4L9ZA 1O5KA 5BZAA 4TUFA 3UY8A 2WQDA 3NVDA 5K7JA 2GJPA 1Y65A 2WLZA 4PTMA 5IDIA 4WSKA 4HMDA 1W37A 1K9TA 2YDQA 2R1MA 4MPQA 1QOXA 1GOKA 3R89A 3WLOA 4C5ZA 4R33A 3IK2A 4L9YA 3TN6A 2XIOA 4RE4A 4DNMA 2PDPA 3M6DA 2PLJA 4WKAA 3OG2A 1S46A 1W3TA 3N6QA 3ALGA 1OG6A 3IJIA 1VPQA 3WN6A 4ERIA 2E9LA 2ZC1A 5ENLA 4Z2HA 1MXGA 3CYVA 4W8LA 2I5IA 5DELA 3DN5A 4AXKA 2W91A 4Q8QA 4GISA 3ZM8A 3AU6A 1LG2A 1XIEA 4ACZB 4UQDA 3TU9A 2WC7A 3HU7A 1I4NA 1MEIA 3IS4A 1JDEA 1UKSA 2EJ1A 2GJLA 5KINA 3WZ0E 2EG6A 4QE4A 3SEPA 3GY1A 1FQ0A 3GR8A 4QXIA 3T1GA 4DJFA 3XIMA 3R8RA 3L9CA 5A2AA 1PCWA 3SUTA 3HG5A 1G5AA 3QR0A 4O0KA 3TTSA 3OODA 1OY0A 3LN3A 5K4XA 4IX0A 3A22A 1LWHA 3YPIA 1BF6A 4WZHA 4IMDA 1RH9A 4LAZA 3DYMA 3IUDA 1OFEA 1XYZA 4LNCA 2WW5A 2NV9A 3T42A 4O17A 5TQLA 4NZCA 4X61A 1HNYA 5DMNA 1P5BA 5LZLA 1M03A 4WY0B 2B0MA 4JKMA 3VIKA 4O8RA 4JXCA 4TXEA 2YLAA 3POHA 3L7RA 1G7VA 3OLIA 1JYVA 2QUUA 3AZSA 4UQAA 3W01A 2BVYA 4M7SA 1TPC1 4IJBA 1H49A 1S5TA 5I06A 1V0LA 3FDGA 5DQPA 4WOQA 2GQ8A 4F48A 3VD5A 3B05A 3HURA 1VCFA 1VLIA 4TX6A 5PTDA 1A5LC 2CXGA 1J6PA 4ZQMA 1AQHA 3EOLA 4C5YA 3TSDA 2YL9A 5G1YA 3VM5A 3H24A 2DZUA 5RUBA 3INPA 3V5FA 5F4SA 3SGUA 1QO2A 1XKJA 3MVTA 3ZMRA 4LNYA 1JCXA 1E4MM 3N2TA 4R7JA 4E5TA 2QGYA 1TFVA 5DT5A 2VDGA 4PMUA 4CN1A 1BFNA 3VZYA 4P7NA 3N2CA 5LYRA 3G0UA 1E6QM 1M04A 3PJXA 4IQDA 2DUZA 4MB3A 3WLJA 3LHYA 2E77A 2J8GA 4M0XA 4DUOA 5JVLA 3BLKA 4C1NB 1DEDA 4IP7A 1IXOA 5EBUA 3C0QA 1UZ4A 3A9BA 4QTGA 1FXQA 7PTDA 4P8UA 4KS0A 4O12A 2HEJA 2XU2A 2VC9A 4A8IA 2IKJA 3BG9A 3EXTA 3VGGA 3PFRA 3GUGA 2ADAA 4HCDA 3VXGA 1KCLA 4KW2A 2W67A 4G1KA 3M0ZA 1R2RA 4UTWA 4ATLA 4BJHA 5C7HA 1DYSA 3VIIA 2UZ9A 4DUWA 1ZZMA 4WDUA 4ZOEA 2C14A 3FDKA 3U57A 3FSTA 4NXSA 2ZX8A 1BYBA 1W1YA 3MP3A 2GK1B 2QVNA 5FL0A 4BWLC 4ICNA 1B4KA 1HF6A 3RG6A 5FJPA 4N4QA 2ZWZA 4Q8UA 3N25A 3WJZA 4M5PA 1EHNA 3CH0A 2NX1A 2HNEA 1WDRA 2UY5A 4JKKA 1Q6QA 3HM7A 1VFFA 3O0FA 4KEVA 1X7FA 1KA9F 4R34A 3W7CA 1QNPA 3UWQA 4NJHA 3TYAA 3AQUA 4JNZA 4Z42C 2J7DA 4G9PA 3LXBA 3U4AA 1JIBA 1OFAA 3WQ6A 1UWUA 1IXQA 3THDA 3ABSA 4PCPA 2XFRA 5T9BG 2WLYA 1H5YA 3WK0A 4NRRA 3PBGA 1CXEA 5FAGA 3S2JA 2X16A 5FEPA 2X05A 3LI1A 3ZLFA 4GBUA 3S6TA 3PBUA 3WDQA 5G4EA 5T26A 4WXZA 3G0SA 2A3EA 4HTYA 4PTWA 4C7DA 4H8HA 1RCXB 4Y8FA 1OABA 4F0KA 2QV5A 1LG1A 1ZP3A 3CL6A 3BLEA 5CH9A 1S5MA 2EEXA 4A2RA 3H8AA 4BKNA 4I7WA 3S9IA 4FXJA 2B7QA 3CHEA 3FJ4A 5DFAA 1GVRA 1YHTA 3PB2A 5D9PA 3E49A 1NQKA 3E96A 1X6NA 4PN2A 1HX0A 1W5OA 4PRWA 4HU3A 2GQ3A 1P6CA 3E0VA 5GJNA 3R43A 3WUGA 1RBAA 4A3UA 2GUBA 5ABGA 4KEMA 5CGMA 4O8AA 4JIRA 1SM9A 4DM1A 3QSRA 2EKGA 4G56A 2GWNA 3EA1A 3BOFA 1LLWA 4GYFA 3P82A 4MVAA 2FIQA 2WCSA 4CQCA 1L6WA 1OM0A 4F2TA 4ZVJA 4UTTA 4BY3A 2ZYFA 4RPPA 2E09A 3PR2A 1ITUA 2XIIA 1UC4A 3V0UA 2JF6A 1R7OA 5DANA 1SO5A 1FWTA 5CZJA 3ZFHA 1LBLA 2ODOA 4A3HA 5DCDA 2B31A 4HMEA 3VGHA 3IJ7A 3UQNA 3T44A 1VBUA 3UWEA 2VQUA 3H2OA 3VIFA 4CN4A 4LUTB 4QEHA 4A8LA 3WD3A 5CPNA 3GKFA 1F8MA 3PPGA 3RYSA 4PFMA 3EDJA 2VD9A 4QS5A 4I9AA 4TTGA 4UQ9A 3W6YA 1XR2A 1ZNNA 2G4FA 4Z08A 3AALA 3VMPA 4D72A 2XINA 1JI1A 1EJ7L 4CN6A 4O18A 3GTXA 1R9YA 4IQJA 4DIAA 2JEPA 3R7MA 2WCGA 1TVNA 4Q32A 3QV7A 4H8VA 2Y5SA 3G0XA 5C54A 1RLCL 2XH2A 5EY5A 4R9OA 1CB7B 3FAWA 4F2UA 3FYYA 2VYOA 1M7PA 3F4NA 4K36A 4YTTA 1OZQA 3TLQA 1K7EA 4AF0A 1G9HA 2OEKA 3W1XA 3NQAA 2YCJA 5FSDC 4LPCA 1O5RA 2PBOA 3CPRA 2P88A 3SCQA 2V38A 1C91A 3NXLA 1JAEA 1FUYA 3UETA 4HHPA 2XGZA 2IQDA 3F2DA 3AXIA 4AFYA 3MUZ1 4Q8TA 2ZRWA 1ONRA 2DJLA 3VFCA 9RUBA 4JR5A 3GXDA 2UY3A 2PTWA 1YRRA 4NJIA 1GTHA 1JQVA 1W2VA 4MNJA 2WNQA 4JTIA 1BEUA 3N73A 3CB8A 3SGZA 3SAZA 1WBHA 2EXOA 1YMYA 4XTDA 1R3QA 1P6WA 3B9OA 4D6HA 4X2RA 1MNZA 2DH2A 1B90A 1OYBA 2H8XA 2R9RA 1P0NA 1F2JA 3SBFA 1BTCA 2A85A 4XZIA 1Q6OA 1KFEA 2PDMA 1B5TA 4KETA 4Q7NA 4MB5A 4BK9A 1A0DA 3LZ3A 2XJ7A 1R3YA 4DWSD 1BQCA 3D6NA 1R3SA 4JDBA 2X7WA 1XD0A 1HJQA 4BHYA 3NQCA 1QOPA 3O63A 2R1PA 3TSMA 4REQB 3NURA 3W0KA 3KLLA 5EMYA 5XINA 3R1ZA 1DIDA 5EFDA 3R8HA 5I3IA 1TTJA 3QZEA 3PTMA 1L0PA 2QCLA 3DECA 3UG5A 3BH4A 4J1OA 4QDWA 2DUXA 1CGTA 1O4UA 4NIRA 5A6MA 3EYPA 1WZAA 3QOKA 3ZT7A 3WEZA 4TMBA 1KRCC 1XHGA 1H4PA 3PPCA 3QF0A 3RPDA 2PDYA 1R9XA 2Y7DA 3R5EA 5BXPA 1YPIA 3GTIA 1J12A 1SSDA 3VX0A 1AL7A 3JS3A 3L5AA 2Z24A 2WNNA 1WDWA 3G18A 1PZ2A 2MANA 4FF5A 5E0FA 2IPGA 4M1RA 4MAVA 3FAXA 1H63A 4KCUA 4JGDA 1E0WA 4MNLA 1DTUA 2G50A 1WUFA 3BANA 4H1ZA 2E0PA 4ZTYA 4J35A 5D37A 3V1HA 3LCIA 1TE1A 1W1A1 1TMHA 1GOMA 1A50A 1A5CA 1UD8A 3ZWTA 3W1NA 3L4XA 2FB3A 5BWFA 1O1ZA 3VIMA 4QM1A 1EB3A 4YYFA 3V36A 4CD4A 1NIUA 2HZGA 1DWIM 4RXGA 2VGFA 4LVGA 3BCJA 2X1IA 2YKKA 3WDHA 4FAMA 3EMZA 2H9AB 1JXKA 5C9UA 3P6LA 4MTVA 1R86A 2JF7A 3CIVA 4CCZA 1LWJA 3MI2A 1OWQA 4HNNA 1TKKA 3NL6A 3WCZA 2OYMA 2W9MA 3OEXA 5IRPA 2ATMA 4JFWA 3GXTA 1R9ZA 1UUQA 1H62A 3KRSA 1X38A 4QDMA 2V2CA 2E6FA 5M17A 3CK5A 1LRQA 4UTHA 5FOOA 3DGRA 4IFKA 1MW0A 1F4HA 3TVAA 1MFUA 3RHGA 1LL7A 1YXCA 3LCFA 3LCWA 4LV9A 2WVUA 1VEMA 4DQWA 2Z28A 3H23A 2DJXA 3VE7A 4B91A 3KS5A 5E0CA 1V3LA 3DERA 3LPFA 4HZMA 3T40A 2ISVA 2Q02A 3QRHA 1VPYA 1MXSA 3RMJA 1NAL1 2KAUC 1G7UA 4H2HA 3A4JA 1SZGA 1QPOA 2BV9A 3UZZA 3M4HA 1IGWA 1YQ2A 2WVTA 1UR2A 4W9TA 1ZAJA 3VIHA 4J2PA 4E8GA 1TPUA 3N18A 3K13A 2BY0A 3VKCA 5SWUA 1FKWA 3DCPA 1AH4A 1CB2A 3KBNA 1OK6A 3FOKA 4OHQA 2IPWA 1IEIA 3N11A 3E5BA 3HV9A 3C3UA 4PMOA 5H8MA 5A1AA 3KHJA 6PTDA 3URBA 4LANA 2V3EA 4QHRA 5KEZA 1PSCA 1EZ2A 2GGJA 4WY0F 3PUGA 4UTFA 5H1WA 1KNWA 3NM3A 3QY6A 1D8CA 3GXNA 2Y61A 1HJUA 3H4XA 3GM8A 1BVZA 3UR7A 4OWGA 1XCXA 2PGRA 3W2NA 1B3XA 4AQLA 2J88A 2R8WA 3KCLA 3BDKA 4MOZA 1UPPA 1KBIA 3QR1A 1ICSA 3CV2A 5A6BD 5CBBA 1AH0A 3KOFA 1G4TA 3V4BA 2RDXA 1Q7QA 3LHVA 3W1AA 1POKA 5MHBA 2VXNA 4U2YA 1X39A 3UWWA 2QCDB 2D20A 4GYPC 2RHGA 1GZ1A 3CASA 2WNZA 4J27A 3SN0A 5U4NA 2X41A 3E2QA 3GBDA 3PZOA 1VF8A 3RUBL 4YHEA 3ARRA 4OFCA 3WENA 3ARUA 4BQ2A 4MWAD 2DW7A 2PTXA 4GXPA 4XZWA 1W1ZA 4AD5A 3TN3A 5LSMA 4A2SA 5C9WA 4M82A 3BUVA 4PMDA 5JH2A 3KRBA 3VIJA 3KTXA 4MM1A 1T7LA 1IT8A 3B8WA 3ATZA 3PC0A 2QGHA 1FHLA 4LVBA 1C8VA 3CAWA 7REQA 3A47A 4DZIA 1CX9A 5C9RA 2YA2A 1KM4A 4KCTA 3G6MA 4LAKA 2KZHA 4G5DA 4GRSA 1XDMA 3VAVA 3CMGA 3IJDA 3VK5A 4AMCA 4F0HA 3PULA 1TQXA 4P7QA 3MSGA 2QIIA 4F8XA 4NX5A 3EOUA 4QCFA 3PB0A 3APTA 2POTA 5A8MA 2QHAA 5AC6A 4OIFA 1KKOA 4XD6A 2D1ZA 1EJRC 4Y96A 5CJMA 2QJIA 4QLKA 3QOMA 3RU8X 3U7BA 3CM4A 4HNOA 1C9DA 2PLKA 4KEZA 2ISWA 3EEGA 1XLGA 4MJ4A 4MMWA 4Y90A 3VZXA 1QTWA 3BOXA 3EGJA 3OW1A 4PR4A 3FN9A 1JI2A 2ESCA 1QT1A 1S2TA 4P61A 3MMWA 1FP8A 2X30A 2ZZ6A 3BAJA 4L6OA 2DQWA 1D3HA 4UOZA 4FOJA 5BW6A 4DJEC 3QHOA 3TYEA 4A8NA 1PJ9A 3NOYA 3SN4A 4EPDC 1JVNA 2EQDA 2OJPA 2OMAA 3KVKA 2PPGA 3T07A 3FIGA 3PF3A 5HR6A 2Z2AA 4XBJA 4XKYB 4HSOA 4RE2A 1V3IA 1CXIA 1JF5A 1XLLA 2HNHA 5CPOA 3AJXA 1HJSA 3EA3A 4AZCA 4M19A 3I3DA 4JTHA 5BRQA 3G1AA 3AROA 1YTEA 2XVNA 2OX4A 1OBAA 1YKWA 2OEJA 4MYAA 3GO2A 4CUCA 4H2CA 4PUKA 4PODA 1HW6A 2ZICA 1VFLA 3WDPP 4GFSA 1OCQA 1QW8A 3DDMA 4J40A 1Q65A 3TE9A 1JXJA 2V2HA 2XHYA 1JD9A 3I7SA 2X1TA 4Z2IA 2Z6JA 3N12A 3PSVA 3OBKA 2JKEA 2XWDA 2CHOA 3DG3A 1E70M 1KXTA 3V5CA 2VX5A 3AXHA 3SUUA 3WMBA 4XAFA 1RXOB 4OQVA 4UNKA 1XV8A 4YVVA 2PGFA 4QGCA 2WKJA 1KRAC 2RDTA 4LRTA 1E3ZA 3W7IA 2QCMA 3KRZA 4ROPA 4S2BA 1FWRA 1ADOA 3VX1A 1RA0A 1QW7A 5CJ5A 1H1NA 1XRTA 1MNSA 3D47A 3DFSA 5F1UA 4TU1A 3KDOA 5A6LA 1JCJA 4UTTC 4JBRA 8A3HA 3M7SA 2FVLA 5B7YA 3SJNA 3DI0A 2WVVA 1GONA 3P61A 2H3DA 2ZX5A 4S3FA 2V5KA 1KM1A 4B5SA 3OHIA 4CNOA 1VYPX 1RPKA 4UTIA 3H7RA 1Z41A 2PFHA 3VDGA 1XS2A 2AMXA 1EUAA 4US5D 1M1BA 2POZA 3NYDA 1L6YA 4YIWA 1C90A 2BB0A 1NDVA 1ZQ5A 2PDFA 1OX4A 1ME9A 4JQ3A 2J75A 4HK6A 4D9PA 8CGTA 3NL5A 3QKZA 1LQAA 4IG2A 4JCLA 5L6UA 5A8OA 2Y63A 1AL8A 4QR6A 4U31A 4FALA 3VOCA 4I6VA 4PB4A 1UQZA 4OBTA 3DU0A 5F2IA 1NSJA 4PL1A 3AXMA 4UCGA 4TR9A 3REQB 2Q8ZA 1F76A 4L7ZA 3W88A 6REQA 1QOQA 2OZ8A 1DP0A 4FI4A 4OOZA 3LOTA 4JEJA 2V63A 3VOHA 1WQ5A 2GFTA 1VLWA 2Y8VA 3NR0A 1BPLB 1DORA 4MAZA 1H7PA 5FACA 3BCFA 1PXGA 1EBHA 3H26A 4R9XA 3G1VA 1NF0A 5C71A 3NVTA 1DJQA 3WDRA 1OQFA 4L80A 1R8LA 2OG9A 4X2PA 5FJIA 1HKJA 5CGQA 2HSAA 1WDDA 3H2CA 1E9IA 4PYSA 5D9OA 3IIPA 3PNZA 1E4IA 2OPJA 4QLLA 4PUMA 3ALFA 1OC5A 2YB4A 2A7RA 3BQ6A 3FA3A 2XN1A 1U2YA 4RCXA 3FY1A 3MUAA 2HISA 4MADA 3SUSA 1XSIA 1Y5VA 2PF8A 3Q94A 1WXZA 2O9OA 4UQCA 5BOEA 2VGBA 4XB3A 1H1YA 2CXEA 2E6DA 3UERA 3U9IA 3N6HA 1FH9A 3K1DA 4JY8A 1YBQB 4H41A 2A3CA 1XYBA 3EWYA 3SUVA 3V1PA 2EPLX 4JOMA 2YDSA 1V6XA 1M3UA 1O95A 4S3KA 5DMMA 3UGVA 3BLOA 4RX0A 1XLEA 2GL5A 4B2DD 3URQA 4IISA 3ZVHA 1E1FA 3GR4A 3DG6A 3MCNA 3U0HA 1ONWA 2BGSA 3L2MA 5I3JA 4S38A 1RHCA 1KWGA 4F4RA 4KWVA 5B7ZA 1WB0A 2FMOA 1T5AA 3SZ8A 4O1EA 2E5BA 2ZBTA 1FWIC 2L5HA 1ADSA 2BSLA 3QFEA 3I7RA 5HAOA 3UW6A 1YDNA 6CGTA 2BHZA 4NYYA 3WDIA 2QXWA 4JN8A 2FHCA 5CPQA 4QQUA 3VOFA 2DSUA 1NEYA 3LLDA 1H41A 1GORA 3I68A 2OXNA 4IJRA 3BV7A 5A2CA 4LUYA 3WQGA 1H61A 4S3EA 2Z2UA 2WB5A 4F0LA 5HPOA 1GJUA 2HXTA 5CSRA 3MDUA 3WQ4A 4NVTA 4HJFA 4DJDD 3O3RA 3MBDA 3EKZA 1XC6A 1J18A 5LXEA 3S1GA 3BW2A 3BTNA 1U1UA 3H2EA 1VHCA 3FCPA 1WDSA 1FH8A 4RW5A 3N29A 4UTJA 1OFQA 5D2WA 4CLMA 3GUWA 3A3XA 1XG4A 2IQTA 1ONEA 3A3HA 5BU9A 1S2UA 3N3TA 2WV8A 1V6YA 1OB0A 2CU0A 4MB1A 3WELA 1XYLA 3AOFA 4MYXA 2YDAA 3P93A 4MGGA 4ZCWA 5AN7A 1PTAA 1W8SA 1GQKA 3CQKA 4LFYA 1UKPA 2Y4SA 1UZHA 1AVAA 4MFDA 4FXSA 4LWWA 5AZ1A 3G1YA 1P7TB 2DZXA 2NVAA 1BSIA 5DXYA 3EPMA 4LAUA 1FWAC 2GGGA 2MUCA 1FP9A 3BZGA 1PE1A 1TWIA 1NFPA 4JX4A 5LNSA 1K70A 1LUCA 3Q67A 5DY2A 3RN6A 3QV9A 4Q3MA 1Q3NA 3GH4A 3WUEA 3WG6A 2WMKA 3EMQA 2IS7A 1QK0A 3T09A 4FNUA 2DQXA 1H7XA 4JL1A 1VBRA 3PZQA 2PBGA 4J3VA 1JZ5A 3W7DA 3M5YA 1XFCA 4JD4A 5E93A 1QCWA 1TV2A 1ZBKA 3W9ZA 2QUTA 4GUFA 5FF4A 2YJQA 1GVIA 4AY7A 1GHRA 3S4TA 3BCDA 4H8UA 5C6MA 1SJDA 4JTJA 3R11A 4NZ3A 3DC8A 3UZ5A 1YNPA 1K9FA 3SQLA 1GQNA 4E8CA 2ZVRA 4PMQA 1B9ZA 1XP3A 4XAGA 5AYBA 1FWSA 3CUJA 1TIWA 4MNMA 2ZUWA 1T41A 3W7OA 3RAOA 3TWBA 1NFGA 2J9ZA 3IVSA 3WQCA 2FZDA 1XD1A 1MQPA 3M64A 4IIFA 1EEXA 3Q2DA 2OB3A 2WSRA 2OELA 3K8KA 3R25A 1XSJA 4Q8NA 4A21A 5CPLA 6TIMA 2XVPA 5C8BB 3U4FA 1G4SA 4JHOA 5AECA 1UBPC 1IQ8A 1HVXA 4GVIA 3B4UA 1MYRA 5EMLA 2ZADA 1VB9A 2TODA 3CT2A 3LM3A 1BTMA 4HPNA 3VIGA 4QLJA 5CCZA 2JKAA 1BVNP 2PUZA 1Z69A 2ABBA 3FA5A 3MA8A 2G4JA 4AZIA 2XH4A 4NAFB 3CQHA 2INFA 1P0DA 4G7EA 4UOJA 2Y0FA 2FTPA 3EX1A 3DBPA 4DPPA 1KGXA 3DX5A 2EPKX 3TFCA 3OA3A 2OR2A 4O1CA 5U7SA 3FHQA 1DOSA 6A3HA 3W1RA 3CZ8A 2DVUA 1FHVA 3MYOA 1V7YA 4TX8A 5LKYA 2J13A 2ZX9A 3LLFA 4EPKA 3ZZ1A 2DIJA 4I5RA 1IEXA 5M3WA 2G5WA 3L0KA 4JEQA 5FEWA 1C8XA 1QWKA 1LYXA 2WHKA 3UESA 2NX9A 2PD5A 2ZCGA 1YX1A 4DF0A 3C0SA 4GZIA 1FWFC 2CZFA 2AL2A 3N6JA 1AJ0A 1UWTA 2DGAA 3O0KA 1T96A 3TJXA 2E8ZA 1IWAA 1XRVA 3WLQA 1H2JA 5LNVA 2VEKA 1CDGA 3QQWA 4W84A 4DHGA 5CSYA 4K8HA 2ZKMX 2WBGA 5D05A 5HBFA 1QU4A 1HG3A 4X9YA 3T0DA 1RP8A 2BHYA 4IQEA 4CCDA 4DBDA 4EPBC 4HA0A 3CQJA 4D6DA 3HJZA 4J3SA 4XO7A 4PE8A 2A1YA 2E40A 5HQMA 3UPMA 4GXWA 4I90A 2VENA 2Z1WA 1TWSA 4L61A 3WL0A 3HGRA 4KFOA 2WZHA 2CYGA 2VEMA 4KRUA 4MF4A 3WUBA 2WSKA 3VIOA 1R2TA 2BG5A 1LQ0A 2PDIA 1VYSX 2AAAA 2H90A 3M1ZA 4HQVA 4UOQA 1Z48A 3K4WA 3AYRA 1V3MA 1TYGA 4ZOBA 1E1CA 1KGWA 3DIPA 2A79A 2WMIB 3EXRA 2XSAA 2XH0A 1CGXA 3LG3A 3UR5A 1EZWA 1I0BA 3OLDA 2AKZA 5TAOA 4D1JA 3NSNA 4JFSA 3A9IA 4PCFA 3WLTA 1JCNA 8XIAA 2ZA3A 1M7OA 4GG9A 2P0IA 1EA0A 4JYDA 1OT2A 3BJSA 1VFUA 3ELFA 3C2EA 1SJBA 1GVOA 3QW3A 1XLDA 3B9AA 1NP2A 3AIQA 5REQB 4PRTA 2A3LA 1E51A 2CESA 3OIXA 5CLWA 2TYSA 2W4XA 1KV8A 1VPXA 2VI0A 1BQGA 3G3MA 3A5FA 4XVEA 1TZ9A 3OBAA 3M0XA 5DXXA 3HA1A 1Q6FA 3C2VA 4FIRA 4JN6A 3OU8A 4XZ9A 4AHOA 4LC8A 3IV8A 4DJFD 3PZIA 4MY8A 3PAOA 1G6CA 4RV8A 4ZSUA 4XZHA 1PTGA 2F2KA 3T2OA 3VILA 4OUIA 2NQZA 2YBVA 3T08A 2C0HA 3NL2A 2V8ZA 1FWWA 5A6JA 2CBVA 3MVIA 2GQAA 1EJVC 1L2UA 3W87A 2VEIA 4OGZA 3BMWA 3I4EA 3M0LA 1ZCCA 3FGCA 3N34A 3S83A 1EGZA 1JUKA 1TX0A 1F73A 2YX0A 1RQHA 3E74A 3TSBA 2C8NA 3GDLA 4HOXA 2Z1BA 3SCRA 1UKQA 1SPQA 3TC6A 2WHLA 4GI6A 4XK2A 4KFNA 3H7UA 5HANA 4NJGA 4I7VA 3RITA 3VNIA 1K3UA 4UXDA 3U5UA 4U3AA 3W22A 3LCLA 3ZYZA 1EC7A 3MW7A 1TR1A 3R79A 2DSKA 5GQBA 3TTYA 1PS9A 1US0A 4HK7A 4IXHA 3WJSA 3NPVA 1BVWA 3M0JA 4PBFA 1WXJA 3W00A 2DSVA 3SUWA 2VWTA 3F4VA 3GR7A 5DF0A 4OTKA 1REQA 4AEFA 1HKVA 4H6EA 1SFTA 4NI3A 2GJXA 4DELA 4PGLA 3OLEA 4WOZA 2YA0A 3TMQA 4UFLA 3W7GA 3CHDA 2WJEA 4QE5A 4K7VA 3GYEA 2HVMA 2OO0A 2JEQA 2QF7A 1B3ZA 4ES4A 3DZ1A 1FWBC 2YPIA 1Q4NX 4AZCB 1XLMA 7TAAA 1E0VA 1TTIA 4JTKA 1LDCA 3RO6A 3VFLA 3WK1A 4F3HA 3IGXA 3OTRA 4HMCA 1CT5A 3VABA 1NTHA 1J9YA 3QLDA 1K6AA 3LBCA 4Z1AA 1JUBA 2DZAA 3S9YA 3IJQA 2PRHA 4L4LA 1K02A 1AJ2A 2VD8A 4OJYA 4JHZA 1PEZA 3C52A 4AD3A 4A3QA 3AIBA 3ANVA 4LS2A 2ZUUA 4LUIA 1XLFA 4RKAA 2XFWA 3MKVA 4FOUA 3WIJA 2R91A 4H6KA 2VFEA 4OV9A 4C6CA 2WHJA 3W1TA 1UWSA 3N9SA 5KSWA 3N2OA 3W86A 4FXRA 4QE1A 3TCSA 3W2MA 3WLMA 1UZDA 2PGEA 1OX5A 5A6SA 5I07A 1XLAA 2PB1A 4ACZA 3CZGA 3TN4A 3NQ8A 3PZ9A 1XIHA 1RJQA 2DV0A 1ZCOA 5AY7A 3A12A 4PTNA 3GW0A 4NZFA 4GVFA 4O4VA 3O06A 3HGOA 4GYJA 4XKMA 1TJ0A 2GPTA 2A2IA 4L4PA 4W88A 4W87A 4FLSA 1F6KA 3W2JA 3H2MA 5EL1A 2G3NA 2HQAA 4S1FA 3CQIA 1XGEA 2FDSA 4AY8A 3O2LA 4Z1YA 4RDVA 3TAKA 3H12A 4OUEA 4I3GA 2IPFA 4PUNA 2ZZ2A 3S2CA 1EA9C 4IL0A 2AQWA 4PTVA 3W4RA 1MUCA 4GX8A 1HXJA 3IIZA 3GAYA 3MJMA 4JKLA 3A13A 5FL1A 1BYCA 1OD0A 2DT1A 4GUJA 5EKYA 4AZ7A 1F61A 1W8GA 2PRLA 2FZ8A 2VC5A 2XDFA 4PSRA 4J4KA 1D3GA 1XIFA 2DT0A 4WY0A 3GDBA 1X98A 2XPKA 3E2VA 1LT7A 3C0JA 3WLHA 1VJSA 2DFAA 1HT6A 3AYTA 5G2WA 3M5XA 2GVJA 3AMGA 3K30A 2CFFA 2QCEA 3HTWA 4N6FA 4XD3A 1HZYA 3UJ2A 3WNNA 1F7BA 4C6LA 4NJKA 3UWVA 4FX7A 4Q4SA 3CGTA 3BLFA 1ODUA 3CAQA 3S47A 3CTLA 2ONEA 4WHBA 1P0KA 3HIJA 3MCOA 2Q09A 3VNMA 1YDOA 1FDJA 4ZGYA 4C6QA 3OQ8A 4DF2A 4DX3A 2V5CA 2PC4A 5J5DA 2NT0A 3LS9A 3RLHA 1GEHA 3BE7A 4IWWA 1BD0A 1TPVA 4M6PA 1CCWB 4PUUA 1Z42A 2WWCA 3UJRA 2D2HA 4F0SA 4FIQA 3NZRA 3T2PA 3C2YA 1YIXA 1VCVA 1AZ2A 1DJXA 4WKFA 2CLMA 1HJXA 3NO5A 2ZX6A 5LIXX 1KM0A 2VEFA 2EKCA 3VNZA 4AUBA 2P8CA 3EOOA 4PBGA 5E5CA 2FGLA 4U3CA 3WBAA 3QY7A 2YBUA 1DWAM 1TMLA 1V93A 3W1MA 3CZLA 3ITGA 4C1NA 3KL3A 3IJLA 3BQ5A 1AD1A 2D3NA 2E1WA 2OX1A 2VWSA 3V16A 2WM1A 2OLSA 2E8YA 1OINA 3N17A 3KTSA 1YE6A 2OVLA 4L6DA 1TCDA 1EX1A 3CC1A 4QFUA 2OSXA 2W79A 3BO9A 7CGTA 1A5BA 1LLZA 4K1WA 2PWVA 2NT1A 2C6QA 1TPWA 2VRJA 1PAMA 1A5MC 4AD0A 2JGYA 3RIKA 4A6GA 2GK1A 3HMJG 2C15A 4DN1A 3JVAA 2HPMA 1XICA 3O6DA 3VCNA 2J77A 4C6JA 1J0HA 3KZPA 2AOSA 4QCEA 4E4PA 2P53A 5DLCA 4Z1CA 1ML1A 2XIJA 3HJEA 3LNPA 1E5JA 3LPPA 5E1QA 4UTUA 3MI3A 4BS0A 4OVXA 3O07A 1P0BA 4DEFA 4PMVA 3UCQA 3WLRA 4QAWA 1IZJA 1GJWA 1TELA 3KVLA 2VP8A 1JDCA 4PB3A 4L5ZA 3WF0A 4XQ6A 1UROA 3C8NA 4JTEA 1KFLA 3PTKA 2PE4A 2I9UA 4Q33A 2ZXDA 1WZMA 2O9TA 4M24A 1RD5A 3ABXA 3UG8A 5DCEA 2OLHA 2G3IA 1IT0A 2D2GA 2BLEA 5DBUA 4GBDA 1M5WA 4LBRA 4MNKA 1V7AA 4M80A 1J93A 1M9HA 4GC3A 2J66A 3CZEA 1CLVA 3NGFA 3VGDA 4C6EA 2CKSA 4HPHA 5IM51 3PHAA 3CB3A 2FVMA 4LX4A 3WLLA 1VQTA 4O11A 4HU8A 1CBGA 3JZUA 5CAHA 2VCAA 2VJXA 3P80A 1KXVA 3QQ1A 3ZVIA 1KB3A 4W8AA 4UQEA 3S5NA 4BQ5A 4XUYA 4NT0A 4R85A 1FCVA 2BY1A 1VZWA 4L9XA 3H4WA 2Y88A 1GG1A 1JYXA 4OECA 2DZTA 4XD5A 1EH9A 3QBUA 4HIBA 4DPQA 3BSMA 3GNXA 1RQEA 4QNEA 5HNRA 2WKGA 1MMFA 3BG3A 3I4KA 1RP9A 4TO8A 3WK3A 5LIYX 1DWFM 4XG1A 4U10A 1JZ6A 3BG5A 1JZ3A 3THCA 1PX4A 3A64A 1DJGA 4GJJA 5AVHA 4GIEA 3FXGA 1KQZA 4RL3A 2YZRA 4Y9PA 3K5XA 2R24A 1YW1A 3DUGA 3Q65A 2RDWA 4BWLA 3WBEA 1FOBA 4JFTA 3GXIA 3VUSA 4ADSA 4F66A 2BVTA 2V67A 1F9CA 3L2IA 3BLLA 3R12A 4LUTA 3WNMA 4A35A 4FR1A 2QCHA 2AQVA 3W27A 1I1WA 2GDUA 4RZBA 1J01A 1HL2A 1UW9A 4IMFA 4K7YA 3S5OA 1E4LA 3BLPX 3GIQA 1R3RA 1EWEA 3CAKA 3TYBA 3ARXA 2BODX 3ZS4A 3HQ1A 4TIMA 2QS8A 3TA9A 5FSEC 9XIAA 3P14A 3F5LA 4MZYA 4P7LA 3E38A 2ZZ1A 2EAWA 1S39A 1R6WA 2D2OA 3O16A 1V6VA 3ME3A 4XWUA 5A8PA 1XI3A 3RM4A 1NFBA 2VVNA 2H6RA 3VNKA 4DWDA 3T81A 3MWAA 3RU6A 2X0HA 1TV5A 4GUHA 2J9YA 1U83A 1UP2A 1ZU8A 2WQPA 1UMYA 3RM9A 3BAYA 3NSMA 4JFUA 4YWSA 4QJ1A 3RX3A 2OCZA 2BX7A 3WH5A 2X1RA 4DO7A 1Q6RA 5HMFA 5GPRA 1UH3A 3WNKA 1HKWA 3D3FA 2PP0A 3DHFA 1R85A 3PWGA 3M0KA 1PVNA 3NQ2A 1M7XA 1T0OA 3AIRA 2TMDA 1F3EA 2YIHA 4CEUC 3C2FA 4Q6JA 3NYZA 4UZUA 3WFAA 4XZBA 1E55A 2ZE3A 3N15A 4C6DA 4TQTA 2XVKA 1AMYA 3IRSA 4FLOA 2FMNA 2BXZA 1RVGA 4HNVA 3NGJA 4AX7A 3W7JA 1BXNA 2HE8A 3L67A 4FNPA 1IYXA 3M41A 2QUNA 1UPMB 3APGA 3S8HA 4EWND 1JZ8A 3PUDA 5EB8A 5BMWA 1JJKA 3TROA 4REQA 3ENLA 2DUAA 2Y85A 2IKIA 4H9TA 3CHVA 4FSAA 2J74A 1F6YA 2WXDM 4J5NA 4B5WA 2HE5A 2E9MA 2WWDA 1LROA 4PMNA 3A4WA 3MC5A 3TA6A 5C2GA 2WYSA 3CMJA 3LGEA 3QGKC 2FPTA 4TTUA 3N9RA 1Q5MA 3DFTA 3NL3A 1C93A 1CGYA 2W6RA 3CIWA 3ICJA 3OQEA 4H4IA 4I8DA 2HVNA 4IP5A 3H2AA 3TJ4A 2AGKA 3M43A 3CL7A 3EA2A 1GQJA 2OQYA 4MUZA 3MV11 1NU5A 4XX6A 1L6GA 3FVDA 3TQPA 1GQLA 4KKXA 3QMSA 1RV8A 3W7KA 4WRHA 4UFMA 1BRLA 1J10A 4PEEA 3RMEA 2ZZ7A 2OSWA 2ZUMA 3IJ6A 2I17A 3MMUA 3FHAA 4PB5A 4U2ZA 5CPTA 1TZZA 3NTYA 1ESWA 3VZZA 1QVBA 1DBTA 5I77A 3H22A 4J9JA 4I5XA 2GQ9A 3OLGA 4GWEA 4BEQA 5HINA 5LNUA 1B9BA 2A6NA 1MW3A 2EHHA 3GIPA 2QIWA 4AZBA 2D22A 1JEZA 1LCOA 3F4CA 1LWIA 2GGHA 5M03A 1OSEA 3BAKA 4GY7A 3L68A 3NIYA 3WLNA 4LT9A 1IF2A 3AFBA 3K4AA 3FFSA 3QGAC 2PTZA 3EWBX 3OBEA 1S1RA 2QDHA 2B81A 3UJFA 2O0TA 2QF8A 4H04A 3CUHA 3I6RA 4K6AA 5LHFA 3TNOA 3VM7A 1IZKA 1UKTA 4GNKB 3VUPA 3DOPA 1RQBA 1J0YA 4U5KA 3RR4A 1UR8A 1TRIA 2V0TA 4Y9NA 1DPMA 2TPSA 4B9ZA 1UR1A 2WNWA 1F3TA 3TH6A 2YL8A 1MO0A 3ZR5A 2PMQA 4PBEA 3DGBA 1MRAA 1Y0EA 5HNNA 2C16A 1XLCA 2Y5JA 2PWGA 4GGBA 1GT8A 2AMGA 3W29A 4ICCX 4JTRA 4YPJA 3THQA 3F03K 1UZ1A 2TSYA 2TAAA 2YXOA 4IGSA 3EX3A 5EGRA 4DB7A 1U5HA 3BLDA 3IAQA 3W71A 4M6QA 4YTSA 4GINA 1EJTC 6XIMA 3CL8A 4C6IA 1FHUA 1LBFA 2W62A 3TZNA 4ICMA 5C2CA 3ITXA 1XGZA 4S2CA 3SFKA 4B5XA 4DO5A 3KFTA 1WDPA 3WUFA 3W2UA 2Y2WA 3SGGA 1EP1A 2PDGA 4J3ZA 2CPUA 3DEQA 1C9WA 2PWDA 3ZR4A 1UC5A 4K8EA 3L0GA 4DXXA 3ITVA 2V68A 2ICSA 3FS2A 1HVQA 2Z7GA 1PPIA 3QW4B 3L23A 2XIMA 3F4WA 2DY3A 1EIXA 3NZGA 1XBVA 1KKRA 1RALA 4Y8EA 4UTLA 1GVEA 1GOQA 3GG7A 4LUJA 1QXLA 4K68A 2D69A 4KCVA 2PS2A 4MLRA 5HPCA 3UD6A 2WVSA 2ZA2A 1YE4A 4Q4MA 3NWRA 2E25A 3F5JA 5D09A 3VD9A 2DZVA 1W6TA 4W7UA 5I3KA 1S2WA 4GUIA 3ARYA 2QCDA 4ZTXA 5KZEA 2OQLA 3MSDA 1HP4A 3EB4A 3UY7A 3LRKA 4JQAA 1GVYA 2WMFA 1E9ZB 2P8BA 3T6CA 4AY1A 3IJ9A 1OCBA 1FCBA 2EF9A 4YWIA 1L9WA 4KFPA 1TWWA 4M3PA 2REQB 3E0WA 4J3TA 4RE0A 4UR7A 5D04C 2F9RA 5T9CE 2UV8G 3VOIA 2J7EA 3AIEA 1YTKA 3BL3A 1IV8A 1XYAA 3L5LA 3T05A 3W07A 4FXFA 3LBOA 1X1ZA 2OWXA 3BGJA 3MPGA 3T8LA 3EWXA 4AHQA 2VNCA 3RPMA 5BOOA 4O57A 4Z0JA 3TK7A 3AIWA 3LV6A 5D9MA 1PKNA 1JPMA 3C56A 3BW4A 5CC3A 1UD3A 3WH6A 2LLEA 3OVGA 1D9EA 3BPWA 2X1SA 1EDQA 3AIUA 1N8IA 1BG9A 1NARA 2QUMA 3A21A 1DWJM 3F2CA 1WP6A 4HYRA 4LCSA 2VHLA 1SO4A 3SSZA 2PRMA 4N4PA 2XFFA 3PZNA 4FP1A 3PANA 4FHAA 1GWJA 4ERGA 2NXIA 3VU2A 2J9XA 4M81A 3FW6A 1EXBA 4UFIA 1JPDX 4CU7A 2ZA1A 3EXSA 1XH2A 2YA1A 1KGUA 5A69A 1TB3A 1M41A 4AYSA 1HIZA 3AU2A 4LYRA 2X40A 2ZXQA 3I6EA 2VZUA 3BK0A 2B7NA 1CWYA 2C7FA 3THAA 5LA2A 2NUWA 5J5RA 3U8GA 2GVEA 3VPLA 1K1DA 3V5OA 4H9VA 5FD0A 2G3FA 3CIXA 3SCSA 4QG6A 1JNDA 2PURA 4CU6A 1YTDA 3LY0A 3SN1A 2V5BA 3EDDA 3MV01 2NW0A 2X2GA 1X6UA 3WJXA 4GJ1A 1O1HA 4IUOA 4YMZA 2YDRA 4I8YA 1R3WA 1ZENA 1DQUA 3NZ1A 3RX2A 4RZ6A 4CGTA 2ZZ4A 3GDRA 1PV8A 5JIPA 5E9AA 2SFPA 3TYCA 2VEPA 5J8LA 4XKYA 1NM9A 2PDCA 3WBYA 2V3FA 4GO8A 2OFJA 2CLKA 4GYPA 3PG9A 3GXMA 2WZTA 9XIMA 2F6KA 3WKZA 4AAJA 1E71M 1U22A 1ZALA 3G2GA 1ITQA 4EIVA 3NZQA 3OB8A 1ZB5A 1XPYA 1GOXA 5HULA 4I5UA 4GQGA 3G1RA 2Q01A 2F84A 4A22A 2QKFA 1ISYA 3CT7A 4PL2A 1OVDA 2YL6A 3M0VA 3W7NA 1E15A 3AHXA 4IMCA 1VC4A 4HOZA 2OLAA 1TJRA 3AS0A 1Q2RA 4N02A 1TCMA 4ZO6A 3ONBA 2ISDA 4IUGA 1F3XA 1EF2A 4UWMA 5EFFA 4U4MA 3FEMA 2J47A 2VX7A 3C86A 3SADA 3MANA 5DT7A 1KBBA 1GKQA 4D8LA 2NLIA 2Q8LA 4LUSB 5D30A 4XAZA 4JY9A 4AU0A 3G1SA 1JCLA 4KQNA 1EPVA 2EPMX 1RK6A 3EDKA 3PBVA 1SJCA 2FVKA 4DZ5A 1FVPA 2XN0A 4J3UA 1NJJA 3WD2A 1A5NC 1IHIA 1V79A 2A7NA 4ERAA 3M6YA 4DY1A 4AZ5A 5C0QA 2DW6A 4PMRA 3VKJA 1EO7A 3LHWA 3ZQ9A 1BHGA 3G8RA 4EE9A 4GUGA 3V7PA 3II1A 3I3BA 3UYIA 3GNDA 4E0CA 1TG7A 2BBFA 2DEPA 4QX4A 1S3HA 2YCIX 3MT1A 3SURA 4FNTA 4OT7A 3PZTA 1BWKA 5IBXC 4E3TA 1XRSA 2CBIA 3WMSA 5FJUA 1B1YA 4W85A 5I3GA 2W0UA 3VNLA 1ZS2A 4HZ6A 1BYAA 4AMAA 1GKRA 4LS0A 1KM3A 2Q71A 2G8ZA 1EJXC 4DJEA 2E5CA 4KCWA 7TIMA 4Q4KA 5HJLA 4XO6A 3HOJA 4S3CA 3N2XA 1YDYA 1PX3A 1XFBA 4C6KA 3MU7A 1ISZA 1VS1A 3F5KA 1TO3A 2HWGA 3HG4A 1FTXA 3REQA 1SVDA 4O1AA 2CHRA 1KR1A 2V69A 5CEWA 3GVRA 4I9JA 4XISA 3IGUA 2E4TA 4XUGA 4Z2KA 3THUA 1D7KA 2FGZA 5DBTA 5A5WA 4W93A 4MDOA 4LYQA 3HGJA 1WNOA 4GNJA 2CZVA 1QDSA 1Q2SA 1TJPA 4QAIA 2HK1A 3A4XA 4ZXOA 1HTIA 4TVCA 5CZSA 3TWAA 1YLVA 1CEOA 4V27A 2ALRA 3LMYA 5JMUA 4FZIA 2ZUTA 4QROA 1US3A 5I0DA 2OODA 2HPIA 1CYGA 3GVGA 4FEZA 3BW3A 3JR2A 3B8VA 3RGTA 1FWCC 1A47A 3BVJA 4BQ4A 3MDWA 4UNLA 5FJOA 3P81A 1AD4A 1E0XA 1SW0A 4FLQA 1SR9A 5E6ZA 3T0TA 3USBA 2QVHA 1VBJA 2XSBA 2XWEA 4LB4A 1ZAIA 3LB0A 3A23A 3IGSA 2X0YA 1E0UA 5FI8A 1A49A 1UOKA 2C0AA 4Q8PA 1YBQA 5JBDA 4LV4A 4XV0A 7ENLA 5G1MA 5BXSA 3R10A 4GYKA 1R0MA 4CNNA 1UH2A 4YYCA 3B4YA 3HV8A 1V4YA 4HYVA 1LM1A 1HFBA 2YSWA 1SU5A 3DFQA 4KWSA 5KZDA 1XX1A 4DNHA 4DAIA 1RBOB 4B15A 3SCNA 3STPA 3F7JA 3QFWA 3GAKA 4WDXA 2ZC8A 4HNTA 3IACA 4FB7A 1Q7MA 1WUEA 4Y9AA 3SCUA 4HSNA 5JUVA 3IIVA 1OG0A 4JZ5A 1SYTA 2F38A 4PUWA 4CNTA 2RFGA 4HNLA 4HHLA 3SCVA 4TX9A 1HUVA 5LA1A 1CTNA 1OF6A 2P0OA 3KTCA 1KCKA 5AHIA 3W1QA 4CQ9A 3UG3A 4J3XA 1K03A 3OVPA 4HKPA 4KGJA 4AWTA 1J5TA 5DCBA 4ORMA 4B5VA 4US6A 4MKVA 1IGSA 4ZQPA 4L1WA 2CLLA 2Y24A 3WO8A 4PTXA 2NV2A 4IICA 3W2LA 4ZSTA 3SSJA 3B40A 4W5ZA 4C90A 4YVPA 3DFNA 3LCXA 1UOZA 2Y62A 1DHKA 3AXXA 3M5VA 4IQLA 1KRBC 2Q6ZA 2ZRZA 3N04A 1VH7A 2NQ5A 2QPUA 1NOFA 1EFZA 3GXFA 1S2VA 2DZBA 3M5ZA 2HBVA 5FJRA 3IV3A 1R38A 2QJNA 2EBNA 3ABZA 1Z32X 3VD7A 2Z25A 1MQQA 3LNMA 2C1HA 3WDJA 3LZ5A 1H0IA 3AYVA 1B31A 1FFQA 4N9EA 3AMLA 3ARTA 3UBPC 3N1AA 2EJAA 1QI5A 3MUY1 1K6WA 3NM1A 3EWDA 4HA4A 4D6FA 5ABFB 2XISA 1P7TA 3MS8A 4CU8A 3L4YA 4AD4A 4C91A 5D8WA 3GNPA 2O7QA 2ASHA 4BF7A 2Z27A 1W5NA 1IIHA 1AK5A 1OK4A 6TAAA 1UHVA 1W17A 3H4GA 1JYNA 2WJFA 3S0CA 2Z00A 1XWYA 3VYLA 4A8RA 4HU4A 3QN3A 3W7QA 4KWWA 1WZLA 3HO8A 2PU0A 3WLPA 3HQOA 4ZA0A 1ZLPA 1J8VA 2WC4A 3GTHA 1FX6A 2A6LA 3P0WA 1LRNA 2IQ0A 3E1F1 4LOCA 3AICA 3D0CA 2PWUA 1I2PA 1ODZA 1AW2A 2YCKX 3NO3A 1T8QA 3TW9A 3GU2A 1FWDC 1MDRA 2CIPA 1JCMP 4HZ8A 3WH7A 3VA8A 3U2ZA 3HPXA 3N19B 3PPHA 3WFZA 1G69A 2VZVA 5I78A 2QCCA 1H5VA 3SM0A 2CLPA 1O94A 1OC6A 2DZPA 4O4WA 1GZJA 1NDWA 4R3UA 1E6PA 3N13A 2PLMA 5HQLA 1G0CA 4HB7A 2BZNA 4B5TA 5JBEA 1DIEA 2BY3A 1BRLB 3S42A 3I6TA 3G22A 4Q8MA 3TUUA 3PM6A 1PYMA 3NDZA 4H00A 5MKGB 3SJ3A 1M65A 3K8MA 1QATA 1C3FA 1JNEA 2OOFA 4HPXA 1GPWA 2HV5A 3S2LA 3UXLA 2FZBA 4PMJA 4DWSC 1EKOA 4Z17A 4E4UA 2GGEA 3SRDA 2O4MA 3RK8A 4H6QA 1HO1A 4U28A 2YFOA 1WE5A 1V02E 4M7TA 2D73A 4JL2A 4NAFA 3T8QA 2FKPA 3M0YA 2X7VA 3U2OA 1HP5A 2ZVIA 1ISWA 2HBXA 2R1KA 1TR9A 2P76A 3GH5A 2HK0A 1A3HA 4GIYA 1HO4A 4Q8VA 4MSSA 3MSRA 2DVTA 4M51A 1PWLA 1VBGA 3AAMA 3EB2A 7XIMA 3SQMA 3VTRA 3L5MA 3M47A 1EXPA 3GNNA 3RRAA 5JXQA 2EG7A 3PBWA 1TUFA 5GNZA 1BKSA 4IGNA 3H2FA 4GIRA 2FZNA 3WLSA 4YVXA 2FJUB 3VMOA 3KE0A 3SCTA 1GOOA 4HA3A 3F4DA 3ZLHA 1NELA 4IT1A 2BXYA 3S1WA 1FHDA 2ZIDA 4QBXA 4PULA 3LCHA 5D8ZA 3W02A 2V5DA 1XG3A 3T9PA 1QWGA 1DE5A 4FPSA 4MWAE 3EZ4A 4PMXA 2QMKA 5EBAA 3E0LA 1TWZA 5CBIA 1X8CA 1XW8A 3MUXA 1HGWA 3MZ2A 1J79A 1DJNA 2CLEA 4P7OA 4O1BA 3L4ZA 1WCGA 4IIEA 2GDQA 5C5YA 4Y7EA 2CBJA 3GTFA 2O7SA 2ZOXA 1W3NA 2DIEA 1DJYA 1PX8A 4CD8A 1B2YA 1JUEA 3WQEA 3NFUA 4JYFA 3W7HA 2X42A 4V28A 4C60A 4YTUA 3LHTA 3A4AA 4JQ1A 1BF2A 3QGVA 1XCWA 1GQIA 3B0VC 2FPYA 3GXPA 3AISA 3IEBA 1RY8A 4WDTA 1PZ3A 2ZE0A 1X6LA 2QLYA 2I5QA 3WFLA 1V8EA 1UWQA 1I45A 5I09A 4ZQRA 1UR4A 3ATYA 3PTQA 1MEWA 2XYLA 3A5VA 3XINA 4AG0A 2NVDA 3RJYA 3PJTA 1W3KA 2RAGA 5G5IA 1ZSXA 2ZQ0A 4GC4A 1KRMA 4MDPA 2GWGA 2C71A 2C3ZA 3SFWA 3BICA 3J7HA 2WMIA 4Q4OA 1XCFA 3BLIA 3AHYA 2D2JA 5I23A 4DWSB 3M44A 5E9XA 3N3MA 2DSWA 1B3OA 1OFDA 4NZJA 3NDOA 2J24A 3CHCA 1NDYA 4WX2A 1YNYA 1Q7ZA 3TJLA 3LU2A 2FHFA 5REQA 2FDMA 1GUVA 4WR3A 4RE3A 3EWCA 2R94A 2ZXBA 3JUGA 4NAEB 1XQLA 4ZFCA 2CCRA 5IOBA 3R58A 1VYRA 5G1TA 1UUMA 2J8FA 1JCTA 3KOYA 3EKLA 1EGMA 1BLIA 4V1XA 4HT3A 3CV1A 4ZQOA 3KS6A 3WX7A 4QG9A 1JPKA 4HVXA 1S5WA 2J7FA 3KWSA 3T0CA 4H6RA 3GS6A 1PDYA 5D2VA 4E3VA 5AHEA 2PWFA 5FIPA 2VQTA 4EOUA 3TR9A 1MZHA 3KZSA 1AJZA 1W0MA 2BNJA 3EX2A 4AWSA 1OGGA 4AC1X 4GY0A 3LK6A 3UCCA 5IFPA 1OHLA 5BXTA 3UXIA 1OFPA 4FR6A 1ZHAA 2WMHA 1I75A 1TPH1 2HS8A 4N7QA 3GFXA 3VKBA 5K9DA 1I60A 1NWTA 4PSPA 4PH6A 3AMKA 3KOWA 1NWRA 4Y2WA 1VEPA 1OD8A 4ZO8A 3NSXA 1JFHA 3W1LA 1R2SA 4OOUA 3VNJA 1LJYA 4CKQA 4KIEA 3GLCA 4YHGA 3SECA 5CSSA 1MSSA 1FWNA 1QHPA 1VEOA 1GNXA 1TPEA 4ATDA 1OJXA 3PPFA 4KRZA 4TVDA 1UG6A 4DZAA 3R0DA 2VM8A 4LCQA 1U5VA 1XBYA 1IWPA 4MWAC 3WLKX 4AIBA 4R27A 4AC7C 9CGTA 5A3HA 3JU2A 3DESA 1JZ4A 1X1OA 3FLUA 1FKXA 1QPKA 4DXKA 1ZBWA 3T4WA 4LYPA 1MI3A 1SW3A 4M6VA 2WPGA 4S23A 4DXVA 1A5UA 3QHNA 3B9NA 3LQLA 4PRRA 4E8DA 4K3ZA 1V08A 2PEVA 1IIGA 3CEUA 4E4FA 1KTBA 4PUJA 6XIAA 3QPZA 1SZEA 3ARWA 4BA0A 3LCGA 4HCHA 1HKKA 2I56A 5F2GA 4D2JA 1YPXA 3VKKA 1B3WA 5CG0A 1HKIA 3TN5A 3LDVA 1JF6A 5HWJA 2VX6A 4GCXA 4C6BA 2CZ5A 4Z2LA 4OZOA 1TA3B 1QI0A 3WQVA 1GVQA 3CV6A 1S5VA 1HJVA 1J6OA 3GX9A 1MDLA 3P67A 1K4GA 2WSQA 3K1GA 1TRDA 5JQ9A 4C6OA 1W31A 3MB9A 4D1IA 4AIUA 1EBGA 1XQKA 2EO7A 4WXYA 4ORIA 3WQFA 1R3VA 1T40A 3VD4A 2CWNA 1ICQA 1XH1A 3NPWA 4B9YA 2W3ZA 1MVYA 1CIUA 1LF1A 1TVLA 3SIMA 1R30A 3TYUA 1UQYA 3QM3A 3RFAA 1VRDA 1BKHA 1PO9A 1H60A 1J5SA 3IK4A 4LY8A 3PAJA 5ECUA 5I02A 2E3ZA 1QW9A 3BJFA 2OKTA 4RDZA 2W63A 3KP1A 5EPDA 3DC0A 2R14A 4N42A 4F9JA 4NZ4A 3PG8A 2P50A 1UA7A 1SZRA 2X8RA 3GU1A 3V18A 3BAWA 5IHSA 5G2IA 5CG7A 1NH6A 1ONXA 4GZJA 2ZZ3A 1RY0A 2QCNA 3QHMA 2PDLA 1YYAA 3CLMA 1EDTA 2DSZA 4GJIA 3TW7A 3B0UX 1G1YA 1PB0A 1H3GA 2CEQA 1TREA 5JH1A 3CU2A 4AISA 1DVJA 4RZ4A 3IJ8A 3R0UA 1UR3M 3K4DA 1PUDA 2J6XA 4N2YA 5DO8A 3TYDA 8RUCA 1SJAA 1EF3A 4S3AA 4H9ZA 3KCOA 4Z2GA 3BGAA 2FTWA 1JGMA 1JG9A 1WX0A 1XLKA 4MWAB 1I2OA 3ZLGA 1XIGA 4IPIA 4IHCA 3OZPA 3WYZA 3W25A 2GVYA 3I3EA 3VKDA 4GNVA 3AHZA 1FRBA 3SDOA 4HNUA 3UXKA 1LP6A 3C6CA 2WOQA 1W1PA 3S5YA 1R7AA 4ILSA 3FYPA 4JFVA 4BI7A 3TFXA 4JTLA 3GG8A 4UC5A 3IPWA 2BHUA 3AZRA 3COTA 3TIMA 2JFEX 3B9EA 3ITLA 3W28A 1L8NA 4NKCA 1PDZA 2YW3A 2A0NA 3WH8A 1A5AA 2QJGA 1J0JA 3RJXA 5JU6A 4C6NA 1ZBVA 3EX4A 1PHWA 3AWOA 4X9SA 4HCLA 5K2ZA 4Y6GA 5F4XA 1HQTA 4X0NA 1A0CA 2Z6IA 3T78A 3HGSA 2G37A 3U2EA 2F6UA 1UP0A 1SQ7A 4ROQA 4HD5A 3VI2A 3IIOA 2BTMA 4HP5A 1K77A 3DYOA 3QPYA 2WZIA 4XAPA 4XZLX 1WPCA 5FCZA 4W4QA 2KX9A 3R2GA 4LEQA 3C2OA 3WD4A 1O7AA 5AVNA 1CECA 1BSLA 1CLKA 1OGBA 5CKSA 1UBSA 3C4UA 5FF3A 1OX6A 1KXQA 3LV5A 1I8JA 3MZNA 5CC7A 4NF7A 3AUOA 4GKTA 4P7RA 1E3XA 4ZB2A 5EA9A 2JK2A 1AQ0A 2D3LA 3M9YA 4AWUA 5CZ0A 3B06A 2XIBA 1XM3A 1WKDA 1JPHA 4JPGA 2PTYA 2PD9A 3KHDA 4O0ZA 4FOKA 4X63A 4KERA 1WAUA 1S5NA 4A3YA 4IFOA 4MY9A 3W1PA 2WZEA 3CMFA 4GKLA 2BASA 1QBBA 3QJAA 3L0NA 5IDZA 1VENA 5A6TC 1KFWA 1U33A 4C6MA 2WO5A 3QY8A 3U3HA 2RGMA 3ABRA 1WAWA 4D6IA 3GHTA 2BDQA 4PEKA 4NASA 3L21A 3KDNA 3P62A 4ZB5A 2VDHA 3VGBA 1MUMA 1UWAA 1H51A 4HHMA 4CNUA 1FA2A 3P3BA 4DYKA 4UR9A 2ZTJA 3STEA 5H2ZA 4XSMA 3BAIA 2VVSA 2WC3A 3SCOA 3UJEA 3VVGA 1VFSA 5K9CA 3AXKA 4KRTA 5AB3A 4KGLA 5L9FA 2INEA 1J0ZA 3BV4A 1E6NA 4Q8OA 3GG0A 5B80A 1ZBCA 3ORWA 3B0XA 2BWGA 4QS6A 1D8WA 4BEUA 5G4HC 2VO5A 4V2XA 3LGDA 1QR7A 2J27A 2QYGA 2R1LA 2YZ5A 1L6SA 4EP8C 1IR1A 4UFHA 1VP5A 1JRBA 4LVFA 1VIZA 1PKYA 4W8BA 1Q85A 1WOBA 4YN5A 1JZ7A 4XSLA 4LF2A 3KX6A 5IFTA 2Y6ZA 5HNUA 4EF8A 1NDZA 1A5KC 5MF5A 3MWCA 5IXEA 1TJ1A 2WKLA 3UNDA 3ISIX 1ZL1A 2ZFAA 3L2LA 4IGHA 3ZJ8A 4UBPC 2YOCA 3IGHX 3W3OA 5E09A 3CO8A 3P2VA 3TC7A 3PJUA 2OWCA 1W1IE 2I16A 3HPZA 1E56A 3BSGA 4RDYA 1CGUA 3N4EA 4RNHA 3W24A 4DLMA 5A95A 3NQVA 3MUCA 1FWEC 1I0DA 2CWXA 5A8GA 1YXYA 1E6SM 3UWUA 1J96A 2Z1SA 4O28A 1Y7VA 4JTFA 2BS9A 4WQ6A 1UJQA 3ES8A 1EHAA 4MFEA 1BWVA 5DN1A 4O52A 4ZE4A 4ZXLA 1V3JA 3TQVA 1CI1A 2VC7A 2VKZG 3O6AA 4ENLA 2I14A 3AHVA 1XYMA 3VDCA 2ZRXA 3FKRA 3NOEA 3KWXA 4MKSA 4Q7BA 3KCJA 4WEVX 2AGTA 5K3VA 1OT1A 4DJDC 2NV1A 4Q4QA 3CQ0A 1OYCA 2H3BA 2V3DA 1HJWA 2Z1KA 3LTYA 5GJMA 4LF1A 3WJYA 4AEEA 4GABA 3H7VA 3KVJA 4FA3A 1OYAA 2PGWA 1KM6A 2W66A 2YBTA 5D33A 2HXUA 2X09A 1SR0A 2PP1A 5D38A 1FFRA 2VTFA 4EKJA 4NJJA 3R94A 3UGRA 5KMYA 1PKLA 4RNFA 4AVOA 4CQDA 3GVQA 4ADTA 1Q4WA 2HJPA 2ZZ5A 1IXPA 2PA6A 3UU0A 2QULA 4LVDA 4Z0SA 3C5QA 1XIBA 1CENA 1NOWA 1E5NA 3WQPA 1I2NA 1R47A 1MWOA 1XLIA 2I7GA 3OZMA 4EPEC 2IXUA 5EMMA 3FJNA 2YCLB 1RSCA 3CS2A 2FH8A 4MHBA 4BCEA 3ZSSA 2OT1A 3OGVA 1B3YA 3URAA 1OCJA 4WJ8A 4TV5A 4PCTA 3O9NA 1HN1A 3W1UA 3BGGA 3SR7A 4L1XA 5D2YA 4IIDA 1CW2A 1TSIA 4KWUA 2ACSA 2D24A 3SI9A 4K1GA 4GQBA 2QJHA 4JS3A 4DO6A 2XZ9A 2HMCA 3S46A 1B57A 1RK5A 3U7VA 1LT8A 1V77A 3PK7A 1XRFA 3USZA 5BRPA 4JQ2A 1KQYA 1K7FA 2FTYA 2QEZA 1Q6CA 2QZRA 4OBRA 4PUEA 1V0NA 1C8QA 2XG9A 4LW7A 3DFPA 3LUTA 1EX5A 3B9DA 4Y9OA 3SO7A 3NQMA 3RXZA 2UY4A 5BWAA 1ZY9A 1QK2A 5I79A 2VFDA 3WEMA 4H9UA 2JGQA 1RLDA 3LHUA 1Z8AA 1AODA 3ZO9A 4MB4A 5K4ZA 3L4VA 1M68A 5AHNA 5HNTA 3KBJA 3M0HA 4AD2A 3PZMA 2QW5A 3R4IA 2VFGA 1A3XA 4P8WA 3AS2A 4IZGA 5FF0A 2VMFA 4WJXA 1X97A 2VT0A 1G94A 1O12A 1KD0A 4KMQA 4PMYA 5HMSA 3XISA 1UB3A 3QEZA 4JAWA 2J79A 3U6WA 1A4MA 1CGVA 4GPNA 2QR6A 1ISXA 2OYKA 3LEPA 1ZUAX 2ATSA 1DKWA 1AQFA 3UYCA 1KC7A 4GI4A 3FSUA 5C55A 4DUVA 1YNQA 2VZSA 4QJ3B 2J8TA 3RDKA 3PUOA 1K8CA 2FZ9A 7A3HA 4GQQA 1LOSA 3TV8A 3F2BA 4S3JA 3E0FA 3EWUA 4F0RA 1XIJA 2Y70A 2OSYA 1SFLA 1T6MA 1K4HA 3HMCA 3ABQA 1SZNA 1WBJA 3QYQA 4BF9A 1D2KA 2XSXA 4RW3A 2Q8XA 3UZYA 3OG3A 3SY1A 3UEQA 2QAFA 1R46A 2NLYA 4J7RA 1MFVA 2E5DA 2ALDA 4GA8A 4GI8A 3ZWSA 4I6KA 1Z6KA 4XTIA 1W3LA 4JDYA 3LPGA 2XIQA 2QJJA 1EQCA 2YFNA 5TF0A 1OGSA 3UXAA 3E02A 4HSHA 3CPGA 5I3HA 1S2CA 4IPNB 1ZJHA 3KRUA 4GZ7A 3RM8A 3UF9A 4CQAA 2VOMA 4MY1A 4H83A 5CXPA 3IANA 3SCPA 4CCCA 3AMDA 4AEOA 3Q58A 1AG1O 1VJIA 3GU9A 1DWHM 3RCNA 4ECLA 2PZ0A 1IT7A 5BU6A 3SCWA 1XJBA 1ZJAA 1A5OC 2GUYA 2XZ7A 4DI8A 3MY9A 4B5NA 1KTCA 4CVWA 3CNYA 2F61A 3A3WA 3GE7A 3NPUA 2J7CA 3B8UA 3O8AA 4NNAA 1XIIA 4EXQA 1FWJC 1QJWA 2ZX7A 1IEVA 3DHPA 1UD5A 1DHPA 1EC8A 2BGQA 3NJ3A 3R13A 3VIPA 3OYZA 1QPQA 4O16A 1YPFA 4XVDA 3KXQA 4EAMA 1YEYA 1O5QA 3NAVA 1W5MA 4U33A 5BMXA 3T0BA 2UBPC 3PZVA 3HFTA 1V51A 1J4EA 1O6IA 1H09A 2FLIA 3W7PA 3PZGA 2GVGA 1U30A 1B0IA 1PHQA 1FBAA 2VOTA 4G6CA 2PF0A 3GWQA 3VDAA 1GCYA 2VFFA 4TVUA 4ADUA 2CITA 1DJHA 1AA1B 3UJSA 2VL4A 3WBWA 3ITYA 4UUIA 2NQ9A 3CH9A 4ZO7A 4IXXA 2C1GA 4PTDA 4YJ5A 2WMGA 4TOQA 3LXCA 2WAGA 4BFAA 3RILA 4DJFC 4X60A 1W2PA 1ELSA 2BOFX 3UVAA 4QRNA 4NRSA 3MI6A 3HPFA 3IWPA 4NU7A 4GQRA 1Q66A 2FGBA 3TW6A 2CLIA 3ANYA 3TDFA 3KBWA 1SMDA 3GYCA 3GQYA 5ABHA 4W7VA 4J3WA 3NXFA 5FEXA 5D2XA 3UR2A 4H9MA 2I57A 1PL9A 1UUOA 1EYWA 1B3VA 3HBLA 4UNIA 2D0HA 3D3AA 3MO4A 4B16A 3HQNA 1JYWA 1GEQA 3N2MA 3MHGA 1V0KA 1SFSA 5HWNA 4POCA 4UMBA 3C3NA 3RLUA 1RBLA 3KW3A 3T7VA 3CYJA 5M1TA 4GVGA 2XM2A 4K2SA 1N7KA 2JBMA 2REQA 4LALA 5HDRA 2NUYA 4QP0A 1RAKA 3EEZA 3M7WA 1PIGA 3TNBA 4GLEA 3I10A 1XL9A 1TPDA 2JIWA 3V3WA 3VNDA 2Z29A 3H21A 1Q63A 4LSBA 2PLCA 2Q3OA 1M53A 3FYOA 1KLYA 2DVXA 1ZRQA 4ZBCA 2A3HA 4JICA 4D6CA 4ZEPA 3NCOA 2HCVA 2QPSA 3PY2A 4FNSA 4BF5A 3PZUA 3NQDA 1CXKA 1WKEA 4CEXC 4B90A 2X1UA 4JTUA 3CV7A 4ZQNA 3LRMA 2PDWA 3PN8A 1Y5WA 3GBEA 3CTTA 1J2BA 3QH2A 1PCKA 5GNXA 3VC6A 3ZIZA 4NP7A 5E6YA 1I2QA 2GSEA 2MNRA 3FXYA 4MJZA 4PUDA 3EBVA 2WSPA 3WQ8A 4DYJA 2O9PA 4DJED 2OT0A 1VRXA 4J28A 4J2MA 1OFRA 1S3TC 2J62A 2J4GA 3WEOA 1DXIA 2XH7A 2CETA 2QCGA 3RNDA 4AX6A 4HN8A 3T0AA 3DKJA 4I9TA 3PTDA 4NHVA 2G41A 4WDWA 3S3GA 1F5ZA 3QC3A 4QSHA 2PSNA 1H1ZA 1XH0A 3BMVA 3CWHA 2C13A 3NEHA 1KWKA 1VFHA 4V33A 1ECQA 1CZ1A 1JULA 1JR1A 3M46A 1RJPA 1QPNA 4A4AA 1XIDA 1GYMA 1FWHC 2ZUNA 3KM8A 1EL3A 1DV7A 1S2AA 3GNRA 4GQ0A 4MPKA 4UTWC 2E7FA 3BWWA 2EPNA 4Q4RA 3M16A 4JIIX 2CERA 4M29A 6ENLA 4BQ3A 5I6SA 3GKAA 2GSJA 3R6IA 4AW7A 3VGEA 4F2BA 1B4EA 4O1FA 2CNCA 4PZVA 3QZAA 3RPTA 1JD7A 4UR8A 4Q6XA 1FH7A 1XGDA 1E6XM 3MP5A 3DXIA 3W53A 4HTBA 4RR4A 1EJSC 1Z89A 4MJ2A 4HPJA 2Z2BA 4KEUA 2C18A 3E0IA 1SZFA 1WZKA 4L56A 3AC0A 2ZXAA 3NQ7A 5H8PA 1LOLA 2ISSA 1R3TA 2EPHA 5ABEA 3CO4A 4EANA 4H7CA 1TMQA 3LERA 3H2NA 1XKYA 4X22A 3AJ7A 4E2BA 1AZ1A 4M8UA 3W73A 2YB1A 1G01A 4Y9MA 4LQ1A 4LRSA 5G2HA 4OKDA 5AC8A 3ZOAA 1KO0A 4GH1A 4S3BA 3UWYA 1LL6A 4JTTA 1NQ6A 4CVUA 4UIOA 3STGA 1V6UA 3VE9A 1JDFA 2RUSA 4TMCA 2VRQA 4IMGA 4YTRA 1DXFA 1PIFA 2DT2A 4LTSA 4UTKA 4G2DA 3LSBA 3AS1A 4XBKA 3QV8A 4XIAA 3S1UA 3WNPA 1KBLA 3C8FA 3CAVA 1P4CA 4FO4A 4LUSA 2DH3A 6ALDA 5D32A 2P3EA 1ZP4A 2QCFA 1PIIA 5D4YA 5HA7A 2ZRYA 3VOJA 2O55A 4LYKA 4PCNA 4DBEA 1KR0A 1XISA 5E0KA 3QYSA 4RDWA 3IAPA 1GGOA 4LB3A 4KT2A 3W72A 5G4WA 2PWEA 1TX2A 4XZNX 4OE7A 1H7WA 3GHUA 5EYWA 1XIMA 1TE6A 4DM2A 2BVDA 4JTSA 3VGFA 2XTKA 1QO5A 4AYGA 3JZEA 4H7ZA 4HJWA 3MMTA 3KOXA 2YXGA 1J11A 1QNOA 2W61A 4PC8A 1D3CA 3B97A 4EVZA 1CXFA 2D0FA 2GLKA 3MQTA 1VHNA 5AHLA 3S5SA 4QQ3A 5F7UA 3PSWA 4AVFA 2XN2A 4FLRA 4WSJA 3EX6A 3GRIA 2ACQA 1PKMA 4W5UA 4AH7A 2VGIA 2D23A 3IIXA 3ZT5A 4INFA 3WQWA 4XZMX 1H7OA 4JQ4A 2WZMA 1PTDA 3HF3A 3JRKA 4DAFA 3G3DA 3UR8A 1TPB1 1PBGA 3EOSA 4ZO9A 3UWZA 3RO8A 1QNQA 2V2DA 3TOPA 1MEHA 3CUXA 2OO6A 5H8UA 3BJTA 4D8ZA 2HS6A 3H53A 1J2WA 1R87A 2XGIA 4NZ5A 1VFMA 1ICPA 4CQ8A 4KF1A 1UCWA 4RUBA 1SGJA 1DJWA 2QDDA 3M07A 4Q8WA 1QBAA 3LA4A 4EWJA 4C65A 1I2RA 2I1OA 4Q22A 2Z1VA 3BURA 1XDLA 1GOIA 5AZ0A 1QI4A 1E6ZA 2DORA 3N2BA 3TQ0A 4CD5A 3STCA 1ENUA 3W76A 3ITOA 5C9ZA 5CZKA 5M5DA 3GB6A 3N4FA 1C8YA 5I24A 2DZSA 2V5JA 3FJLA 4QIUA 2OTDA 3C2RA 3W7MA 3DBNA 1AMKA 3LTPA 3TXVA 1ALDA 3G1FA 3LTSA 4AB4A 1JL8A 3UA4A 4IMEA 3DFHA 3OOQA 4QJ5B 4R7OA 3EKGA 5KZMA 4G8TA 1Q45A 1TTQA 3GH7A 2Z1XA 5EU9A 3P74A 2VFIA 1VIWA 3W2KA 1E9LA 3GDKA 5A6KA 2V82A 1EGVA 1W3HA 3W82A 3E2RA 1EQPA 3G6LA 1V5XA 3UP8A 4C6FA 4UFKA 4W86A 4GI9A 1EUNA 2IMRA 3RR1A 3GVWA 3WF2A 2ACRA 4ACYA 4OV4A 1SO6A 3V75A 3WSUA 1U1JA 2IKGA 4ZODA 1YXDA 4XD4A 2VRKA 2G3JA 1KM2A 2GJRA 3CBWA 3L12A 5C70A 1MW2A 4IH3A 5IBXA 3GC4A 4NX0A 3KAOA 4CQBA 4GIAA 2YXXA 1SMAA 1OFBA 1Q6LA 4A05A 4QJ4B 1QRQA 3OVQA 4HHHA 1NP0A 2INZA 4WGXA 3MP4A 2G0WA 2JALA 3LHZA 2ACUA 4GK8A 4UMCA 1N82A 4DVOA 4I7UA 2O4QA 1TJ2A 3WNOA 2O92A 3WH9A 4LAMA 1WKYA 7ODCA 2QJMA 4GHRA 2WK2A 4B4FA 2BXVA 4AZHA 5AHMA 4YNGA 3I65A 3GNOA 5HXMA 4JCMA 2OZ0A 4GGHA 3UNTA 4DBWA 3B8TA 4WF7A 2NSXA 1C29A 4FX8A 4AIEA 5A94A 4D71A 2B7PA 2E6AA 2G96A 4ZMGA 3QZ6A 1K9DA 3WLIA 3GD6A 5BXRA 3EPOA 4X3ZA 3M0MA 2FZMA 3EPNA 5LIWX 3KL5A 1P1XA 2GZXA 5H91A 5CLTA 3WMCA 1QNRA 4V1YA 5DMYA 4YCPA 3ZJKA 1ZFJA 3TTOA 4KH2A 3JW7A 1XLJA 2WPBA 1H7NA 5FAJA 3CXOA 4R88A 2XVLA 4LAOA 3FEQA 3PWIA 1Z44A 2W92A 3SB0A 1QASA 2YYTA 3PFMA 5HUOA 4ZFMA 3MKKA 4O53A 4AF0B 5BYWA 5ABFA 2GUUA 3HG3A 4JYEA 1AQMA 2VZTA 4R5EA 3LSCA 3B03A 3FJ6A 5DX7A 3Q45A 4IX2A 1VR6A 3IUIA 1D7FA 1GW9A 2A21A 5F4WA 1S38A 3KEHA 1BWLA 4DUXA 2V3GA 2PTDA 3LMZA 5KZ6A 2E68A 2TRSA 3B8SA 2AAMA 3ARSA 2IPJA 1NWSA 1XXXA 5GJPA 1GZGA 4R53A 4WVXA 1Q6GA 2XUCA 3BMXA 2EGZA 3AS3A 3OGSA 1GJPA 2BMBA