3VZXA

Crystal structure of pcrb from bacillus subtilis subap. subtilis str. 168
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
227
structure length
227
Chain Sequence
MYDVTEWKHVFKLDPNKDLPDEQLEILCESGTDAVIIGGSDGVTEDNVLRMMSKVRRFLVPCVLEVSAIEAIVPGFDLYFIPSVLNSKNADWIVGMHQKAMKEYGELMSMEEIVAEGYCIANPDCKAAALTEADADLNMDDIVAYARVSELLQLPIFYLEYSGVLGDIEAVKKTKAVLETSTLFYGGGIKDAETAKQYAEHADVIVVGNAVYEDFDRALKTVAAVKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heptaprenylglyceryl phosphate synthase
publication title Insights into TIM-barrel prenyl transferase mechanisms: crystal structures of PcrB from Bacillus subtilis and Staphylococcus aureus
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 78
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature ec 2.5.1.n9: Heptaprenylglyceryl phosphate synthase.
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01884 PcrB PcrB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.390 Alpha Beta Alpha-Beta Barrel TIM Barrel FMN-linked oxidoreductases 3vzxA00
3VKAA 4JEJA 3W00A 1VIZA 4NAFA 4NAFB 4MM1A 3W01A 3VKBA 2F6XA 3VZZA 3W02A 3VKDA 3VZXA 4NAEA 4NAEB 3VKCA 3VK5A 3VZYA 2F6UA
chains in the Genus database with same CATH superfamily
3TW7A 4NYYA 4ERAA 1KV5A 3VNKA 1R46A 4AX7A 1V6UA 4NI8A 1ZU8A 2PWGA 2W4XA 4WDXA 1Z6KA 2JEPA 2UY5A 4KEMA 1XKYA 3WG6A 5B7YA 2DUZA 3ARWA 3HN3A 5HINA 2NXHA 5LNUA 5DMMA 2ONEA 1CXLA 2XGZA 1W9DM 3S5ZA 2E09A 2VC7A 4A2RA 3FA4A 4CD7A 3KVKA 3CYJA 4HK7A 1VJZA 4ICMA 1DXIA 1E4IA 4AIUA 1XLEA 3H22A 2PCEA 3UQNA 3UD6A 5D04C 4DO4A 1JD7A 1G0CA 4MB3A 1LBLA 3AIQA 4WSHA 4XZMX 2Z6IA 5AHFA 1TJ2A 3VA8A 3UT0A 3BICA 1H11A 3SRDA 5A8OA 4XWUA 1Q8JA 4W88A 4GKLA 3WEOA 5CC7A 4O1DA 3OG3A 2QIIA 4GD0A 1CGYA 3FDGA 3UXKA 5D02A 1ZLPA 2GL5A 4UNIA 3O7UA 1SPQA 4UB9A 1GQLA 1JDEA 3SUUA 1TZ9A 4QG6A 4XD3A 1EHNA 1EWDA 4M3PA 4X2PA 4ZO9A 1R3WA 2Y24A 3UXDA 1U1JA 3WO8A 1W9VA 2VJXA 3P61A 2HCVA 2PCQA 1V3KA 2VC6A 1FDZA 3RF9A 3W82A 2E9LA 1KBKA 3M0HA 5DN1A 4UFHA 1WZKA 2F2HA 5H2ZA 5A6BA 3LERA 2ZYFA 1K7FA 3PF3A 3DESA 4WDUA 3BMXA 3W83A 2VDIA 1ZP3A 4GUIA 4MKVA 1GQNA 2QT3A 3MBDA 2YB1A 5HQMA 2ZXBA 4W8AA 2DT1A 2FYMA 3L4ZA 1YW1A 3G1RA 4RE4A 3L66A 2VRQA 4UQBA 4B91A 2WANA 2H8XA 2OZ0A 4HCDA 3LHYA 3E1F1 5AYXA 1E5JA 1JXKA 1XI3A 4PODA 5DO8A 5CAKA 3LN3A 2Y1HA 1PBGA 3EEZA 1V93A 2QVNA 3FSTA 1FX6A 1TMLA 4IFKB 4AG0A 2DUXA 1V4YA 3IPWA 2OCZA 4ICCX 4H7VA 2POTA 4EACA 3NSMA 3LRKA 2NLYA 3W7GA 4X60A 2QV4A 2VD9A 3QMTA 4WDTA 5ABFB 2GVGA 1FWNA 4OV4A 1PHWA 2JKAA 4BS0A 4Z2IA 3PTMA 1AL8A 4O0KA 3PSWA 2CU0A 4QIUA 1ELSA 4LVBA 2FZMA 4DJED 3FN9A 2PTZA 4AYSA 2QDEA 3MHUA 1JZ6A 1GYNA 3V3WA 4HTBA 1O4UA 4J3VA 3ZSSA 2OSXA 1PWLA 3KLLA 2NQHA 1FFRA 3VIFA 3OLGA 1AW5A 4WJ8A 2E0PA 2HS8A 5IBXA 5LIYX 3RLVA 2EBNA 2Q6ZA 3MCMA 4AD2A 3M6YA 2DIKA 2VFDA 4DLFA 5K9XA 3B4YA 3HG5A 3T0TA 4DZIA 4XBKA 4MAZA 4M6UA 4Q8NA 3KTSA 2X09A 1KXTA 4UTFA 3GXNA 4I9MA 1J0HA 4FPSA 4HA3A 1H7WA 2GGIA 5C9WA 4G7FA 3W1LA 2FHCA 2PWDA 4B3LA 5J5DA 1E70M 1V02A 3L9CA 4RE2A 1A5CA 3PPFA 1UUMA 4ZQNA 1JYXA 1KCXA 2EPOA 2CLMA 1F6KA 3T08A 3LV5A 2F9RA 3LBMA 2YDQA 5DF0A 2BG5A 4U10A 2ZC1A 4JYFA 3N13A 1F3WA 4XV0A 4U3AA 1YQ2A 5DELA 8CGTA 4DO7A 1TJ1A 5LGZA 1OCQA 3FYPA 1AQMA 2QPUA 4ONVA 1X7FA 4HSOA 1P6CA 3BAJA 1HL8A 1S5MA 3BAIA 3BAYA 4RLIA 3E2RA 3ABRA 2PLKA 3UW6A 4LVGA 1JDCA 4DF0A 2R9RA 4L64A 4WX2A 3AOFA 3VC5A 3UESA 1JPKA 4JQAA 1E0VA 1L9WA 6ALDA 5G1TA 5EL1A 4JIRA 5I09A 4O53A 4AMAA 2JGYA 4QBXA 1KBLA 4NIRA 1IR2A 3ITLA 1UUQA 4GY0A 2O9OA 2RDWA 3UFYA 3MMUA 1ONEA 1C90A 4S3JA 2NW0A 3CH0A 3CLMA 1UHVA 3HG3A 4QTGA 4UTLA 2O55A 3M46A 3FW6A 2OSWA 3IGHX 5CPQA 4XSMA 3ES7A 1BQCA 2WMJA 1LRTA 2H3DA 3C3NA 5E1QA 1UROA 1GG1A 1QRQA 1GW9A 1Y5WA 2HISA 1ONXA 4ZTYA 4DWSC 3PZTA 2P76A 5FF2A 2VC5A 1XH2A 1GVQA 4H01A 3SY5A 4JFSA 5BOOA 1D8CA 1JGMA 3OBKA 1UUOA 3FX4A 1U5HA 4V27A 4GBDA 1GVOA 1FQ0A 2PBOA 4J1OA 4OZOA 1YX1A 1NF0A 3W71A 4GCAA 1YBQA 4EE9A 1OYBA 3FLUA 1UC5A 5CC3A 3RPDA 3I6RA 5IDZA 3G77A 1RHCA 2BSLA 3R1ZA 1V02E 4K8HA 2V5LA 4IMGA 2VELA 4I3GA 1YXCA 4Z1BA 4B92A 2DV0A 2WZMA 2YL9A 4GQRA 1ONRA 3BJFA 3RPTA 3EYPA 2FDMA 1UD5A 4QLJA 4DLMA 1MDRA 4XO6A 4PCFA 1P0BA 1DKWA 3CQ0A 4D72A 2P88A 2Z7GA 1XC6A 5BOFA 1U33A 1RVGA 1O5QA 2DUAA 3NVTA 3GTIA 4GPNA 1SFLA 3QN3A 3W7IA 2X0SA 1FWCC 2DSZA 3NQAA 2QCMA 3SUSA 4ZODA 3LHVA 4B2DD 1NWSA 3THUA 4F3HA 3LGGA 4V15A 1XBYA 4LUSB 1PYMA 1W9UA 5BWAA 5HBFA 1WXZA 3B9AA 4ZB2A 1LQ2A 3PZGA 2XHYA 4ADUA 4FNPA 4GQQA 1H61A 3MY9A 5JBEA 2WZIA 1G7VA 1GORA 3ZXWA 4JFVA 4HK6A 5C8BB 3GDLA 3HO8A 4HHMA 3AHVA 1BXBA 4O14A 1K8YA 1KM2A 2PWFA 4W7WA 4DJDD 3TWBA 3ZWTA 3VX0A 4OBSA 2A3LA 3B8IA 3TR9A 2A1YA 5FKYA 1OINA 3MYPA 1FXQA 1H62A 1Y8BA 4FK9A 4FR1A 3B8UA 4R53A 5J8LA 4M7TA 4AVOA 1BTCA 1EDQA 4S3KA 1JPIA 1NDVA 4TUFA 4OECA 3VIMA 1JULA 4RZBA 4NJKA 3KTCA 4Y8EA 3MB9A 1V7YA 1KKRA 5A8NA 1YTEA 3I4EA 2E1WA 1PJ9A 5FF3A 4QAWA 3MSRA 2WZEA 4G6CA 4H6RA 4KIRA 4QNWA 1QPNA 3SSJA 1TPEA 4US6A 3LY0A 1C3FA 2H9AB 4LF2A 3M47A 1FWHC 5HMFA 3MWAA 4XKMA 1KCLA 2OVLA 3K30A 3WNOA 4GABA 3WEMA 1B4EA 3P93A 2JIEA 3P80A 4UTKA 3LCWA 4TIMA 1GTEA 2BMBA 3P82A 4E8GA 1OY0A 2C6QA 4LEQA 1AQ0A 1YDVA 2XINA 2WNNA 1I0BA 4HPNA 3TKFA 1PCKA 2V3DA 3VKDA 5EMYA 3WLPA 1WPCA 3N73A 2VFHA 2W9MA 3B04A 5FEXA 3UGVA 4M1RA 4XBJA 2ZRUA 3FOKA 2I9UA 2PC8A 4XB3A 1Z8AA 3GWQA 2VVSA 4PR4A 3WH7A 2J7BA 3COTA 3G24A 4O12A 3RLUA 4DUVA 1IGWA 4UQDA 4B5SA 4DZ5A 3SEPA 3B8VA 2CLEA 4HYWA 1XRFA 4KEZA 2OU4A 3EKGA 5FOOA 1H63A 2HK1A 2VC9A 4LYPA 5DY3A 1W9BM 3DFOA 3W7HA 4FF7A 3KHDA 3L4WA 1YDNA 2NZLA 3MC5A 4O4WA 1G94A 1E9IA 4K2SA 1B31A 3L0KA 5AVNA 2JQXA 3MVTA 3TTYA 2YBTA 2A3EA 3PZIA 1QO5A 3AIBA 1AZ1A 1GKRA 5K3VA 4GNVA 4UOZA 1MXDA 2HVNA 1E55A 3WL0A 3M16A 3WQEA 4PEEA 3F03K 1EYWA 2HVOA 4R88A 3ZR5A 1HXJA 1EC8A 4DXVA 1E56A 3NUKA 3H23A 4X63A 5CBJA 1LLOA 3GH4A 1W1IE 3XIMA 3ZWSA 5CZKA 3AHTA 3H4GA 3LCHA 2GQ9A 3S6TA 4XO7A 2EEXA 2VEMA 1AUSL 4NHVA 3P3BA 4MY9A 3D6NA 2ZZ7A 3M6DA 3BLOA 4PSRA 3SFWA 2O92A 3EX4A 4PMQA 3RXZA 1R7AA 1UPPA 3AS3A 1XDMA 2PWUA 4AISA 1C7SA 3F2CA 1IXQA 5G1YA 3HPAA 1E9YB 3W07A 1DWGM 3AXIA 4IH3A 1SZFA 3NJ3A 4L4LA 3AALA 4CCZA 3TOPA 3KL0A 1KGXA 2EF9A 2WMGA 4LYRA 2PGWA 1EB3A 2QS8A 4D6IA 3LRLA 3XINA 1V7AA 5E5CA 3LU2A 3F2DA 1XLGA 1TTJA 1V5XA 4JGDA 5AC5A 5I3IA 2WLZA 2CHNA 3WLTA 3WMLA 4W86A 3UJFA 3LZ5A 1ALDA 4IJBA 3SZ8A 3VPLA 1I60A 1A0CA 3PBUA 3CPGA 4CD5A 3TE9A 4H9YA 3CJPA 3N3MA 3Q37A 1W1B1 1CX9A 3M43A 2DSUA 2CZFA 3EX3A 4UIOA 3VE9A 2Y6ZA 4P7RA 3KOFA 4DM1A 3GY1A 3RILA 1E40A 2YFOA 2GJRA 1TV3A 2FB2A 4X0NA 1B54A 5GQBA 4IFKA 1F61A 3TTOA 2PTDA 1KBJA 4J3XA 2R24A 4AD5A 3WH6A 4G8TA 1QFEA 1KM0A 1FFQA 5ABFA 2G41A 1TELA 1WCGA 4PE8A 3Q45A 1YLVA 5AN7A 4RW5A 3WMBA 3WNMA 3A4XA 3N6QA 3UZWA 5CJMA 4NZFA 4PMJA 5CZJA 3W74A 2EXOA 4Z0SA 4UBPC 1G9HA 1ISZA 3PG8A 3DDMA 2GOUA 4E2OA 3P60A 1J2WA 3MUAA 5KZEA 3E2SA 2VZOA 4IIBA 4Y7EA 3M9YA 1DORA 1L6SA 4UQEA 3IACA 4P7LA 4FXFA 3A3HA 4IIGA 3SI9A 1J4EA 1XF0A 1EWEA 4IL0A 4JKMA 4GXMA 7ENLA 3GR4A 5A6AA 2CWNA 3VX1A 1QWKA 3W7QA 4C65A 2WMIB 4GLEA 2YFNA 5IFPA 3GVVA 1WKFA 4OJYA 3W1QA 3MWCA 3WNPA 4MNJA 3PB0A 4UZSA 3STEA 2WNZA 3OGSA 3W7JA 1QK2A 2B7QA 1I1WA 3BMWA 1LORA 4GJ1A 2G5WA 3NM1A 4Z1DA 3W1AA 2XH2A 4ORMA 1NFGA 3WNNA 3QSTA 2R82A 3GS6A 3OVGA 4NNAA 3QOMA 3R10A 3UYCA 4HVXA 2WJFA 3NO3A 3G3DA 3UZXA 3STPA 1K9TA 2XSXA 5F2IA 3Q2DA 4O8RA 2VR5A 2W92A 3TV8A 4CCEA 3GYEA 2KAUC 1FH7A 1KM6A 4EIVA 4KCTA 4ES4A 1FY6A 1R9ZA 4M6PA 3KTXA 1UR2A 1W3KA 3CUFA 1Q63A 2QCGA 1R47A 1Q45A 3T1GA 1N7KA 3GKAA 4MSSA 4ZCWA 5DEZA 1SJBA 3IAQA 3O05A 5BU9A 3U7VA 1B3VA 1NJJA 1HJQA 1JF6A 2R6OA 1KTCA 5FESA 5EYWA 1C9WA 3KVLA 3R8GA 3WMSA 4B5NA 3K1DA 1M41A 1OEPA 3B4UA 1BQGA 4REQA 1N8IA 3BGGA 4QAIA 4W7VA 5LNVA 5IRPA 4LUTB 1BLIA 1ITUA 1F4HA 2YCKX 2ZZ3A 1KGWA 3V0SA 2A4AA 1VRXA 1JZ2A 5DXXA 1ISVA 5FF4A 4DJEA 3GIQA 1JD9A 4S3CA 3RX2A 2PDBA 4JTRA 8RUCA 2I16A 2V5JA 4RE0A 1EA9C 4Q4OA 4Q8QA 3K8LA 2Y89A 4B90A 2Y4SA 3K4AA 4LCSA 3H12A 4HMDA 1U83A 3LG3A 4PRWA 4BWLA 4U3CA 3A9BA 2W6RA 4D1IA 2F61A 2AGKA 1BG4A 3T0AA 1UMYA 3WF2A 3PUDA 1N2VA 3S5NA 1M7PA 1WB0A 1XLIA 2PFHA 1JCYA 3KWXA 2ICSA 1ZAJA 5A5WA 3OVRA 3N14A 1ME9A 1XGZA 3OTRA 2ZUVA 3H53A 3HG2A 3RLHA 1JCLA 1WZAA 2P53A 2F6KA 4B9YA 3AIRA 3R0UA 1Z42A 3FYOA 5AKQA 1TIMA 1G1YA 1HO4A 3OLIA 4D6DA 4C7GA 1TO3A 5AYYA 1FWDC 4GYKA 3R2GA 5CSSA 2WKLA 1PDZA 1TA3A 1A0EA 4FNQA 3MKKA 2Y8VA 1K8CA 3CIVA 2XYLA 1RH9A 4Z2JA 2QCFA 3A24A 3NQBA 4DZHA 3MDUA 3FNDA 1QTWA 3NXLA 5FD0A 2RHGA 2QUMA 4AH7A 1VHCA 1PZ0A 3UNDA 5D30A 3GXFA 4JTHA 4Q8WA 3C2FA 1CYGA 1DJQA 1GWJA 1KR1A 6REQB 4QSHA 4LUSA 3BLKA 4WJXA 1OWQA 2ZX6A 2V67A 1B9BA 3SDOA 2Y85A 2ACUA 5EY5A 1B4KA 3OHIA 4AZIA 1L8PA 4GYFA 2OR2A 4J40A 3WJZA 2QHAA 1V51A 4CNOA 3AMKA 2HE8A 3B8TA 2GVJA 4FXJA 4EAMA 1SYTA 3FHQA 3LSBA 4UFJA 4XVDA 3C52A 4GY7A 1HW6A 2SFPA 1MRAA 3CUHA 3W23A 3U6WA 5JH2A 1X98A 3ELFA 1OFQA 3FJNA 3EA2A 3GC5A 1S5VA 3BOLA 4KETA 5H8MA 2DGAA 3FKKA 2FIQA 2E8ZA 4IGNA 2PZ0A 3T7VA 3HIJA 3CQKA 3LTSA 1JZ7A 4DYEA 4D6FA 2HV5A 3QYSA 1VLIA 3PJXA 1MWOA 5GJMA 5TAOA 1EA0A 3BOFA 2H9AA 4I9AA 1KXQA 5EU9A 4BEUA 4ROPA 1BVWA 3S6DA 5DBUA 4GH3A 3TW9A 3VDGA 3PNZA 1UWQA 1PEZA 1M03A 1R86A 4PUDA 4I6VA 1CGVA 2Z1BA 2J78A 1Q6FA 1BXNA 1XH1A 4E8CA 3EWUA 3IJ8A 3F4WA 3KRBA 1GOXA 3QHOA 4UFMA 2HMCA 3SUVA 1NSJA 1TRDA 4RDVA 2VZVA 4RNFA 3HQNA 3ECQA 3WQCA 1V03A 4F40A 1SZGA 4GE8A 3R4IA 1ISYA 4YVPA 4K8EA 3NL3A 3RR1A 4B5VA 5AZ1A 3WD1A 4JIQA 1H09A 4ERIA 3ATYA 1MEHA 2O7SA 3CQHA 1M01A 3LDVA 4H2HA 4NAEA 3CHEA 4E0CA 4GIRA 1WZLA 1RUSA 4JTLA 2DW6A 1JJKA 4RJEA 2PTWA 1E0UA 2WBGA 4JTFA 3KM8A 1V3LA 3U2EA 4OKDA 5CXPA 2V2CA 3ZVHB 3PJWA 4ZQRA 2HXTA 1IQ8A 5HWNA 3WF3A 1E73M 1WO2A 2WQPA 1ZJAA 3JZEA 5LZLA 1W1TA 2PSNA 3BAWA 5CQ1A 2ZWYA 3QVQA 4GH1A 3QGAC 4LY4A 1B5TA 1WDSA 5I3DA 3ARZA 1A5SA 4AHPA 5AY7A 2ZUNA 4MKSA 3N2MA 3B0XA 4ADSA 1IHIA 4YMZA 4DUXA 4HQVA 4MHBA 2JKEA 1H5VA 3TA9A 4XBSA 3CZLA 2QJJA 3TC6A 4BF9A 1SO6A 2ZUMA 3A23A 2NSOA 1DJYA 4E38A 1ZPTA 3BCFA 3WUEA 3IJQA 2J75A 3DZ1A 1OHLA 2JF6A 5C55A 3F4CA 1W17A 4YJ5A 5A6KA 1W54A 1SZNA 2ZC8A 3AJXA 4BZYA 1OF8A 4XIMA 4LV4A 2A2IA 1OADA 2GGJA 3OP2A 3RITA 1XX1A 5C70A 1M3UA 1ZJIA 3CT2A 1MO0A 1F74A 3GAKA 3W76A 4CD4A 2Z26A 1S5NA 2NX3A 3W22A 4AD3A 4M6QA 4GISA 2QJIA 3E2VA 4JTAA 1EP1A 3L4VA 2OTDA 1OZQA 4GI8A 1SQ7A 3DKJA 1CI1A 2INFA 3VD7A 5A8PA 5K4XA 4FMVA 1DVJA 4NSBA 3W6YA 2V82A 2VOMA 3A4WA 2BHYA 5CKSA 2PD5A 5C6MA 4RDWA 1QI0A 1DEDA 3BAKA 3Q4DA 3TTSA 3HZ3A 4UTJA 4OV9A 1XC4A 1OC7A 4O0QA 3SY8A 1GQKA 1W31A 3DFNA 1OIMA 1IXOA 4LY8A 4P8WA 2I5GA 3PUEA 2XFFA 4G1NA 3A6OA 4QLKA 2XU2A 4ZEPA 1BD0A 4N6EA 4YWIA 4O50A 4EVZA 2DZXA 1PIFA 3UXIA 2PDXA 2WSPA 4D6EA 2BP1A 4O18A 3UGRA 3ONCA 2HJPA 4PBFA 2Y62A 4DWSD 5DCDA 4B5XA 3HFTA 2RAGA 3RAOA 2DQWA 1JFXA 1TV2A 2VZSA 1W1A1 3M0YA 1G4EA 3SGZA 1EX5A 2XWEA 3N9RA 2HBVA 4WD0A 4AW7A 1PKLA 2X1RA 4AZ7A 2A7NA 3W37A 5FL0A 2OQLA 4LAMA 1NDZA 2OO6A 8A3HA 4PUEA 4AZGA 3VK5A 2GK1B 3M0VA 3MDWA 4R5EA 1GJPA 1CW2A 5TF0A 5IDIA 2CFFA 2HVMA 3AS2A 2GSHA 4ZE5A 1VYPX 3UWEA 3M5YA 3C86A 1OSEA 4PB5A 3BSGA 1JYNA 2AAAA 6CGTA 1UZHA 4IG2B 4BHYA 1J9YA 3WFZA 3DOPA 4H19A 2E6AA 2OT0A 3JRKA 2CZVA 1LWJA 2POZA 1PTDA 1RBAA 2XVKA 3WEZA 1G67A 2AQOA 4CU8A 3ARPA 4LVAA 4LVFA 2HWGA 4JNZA 3WQFA 1WA3A 3ONBA 1CB7B 4AZ5A 2B0MA 1EC7A 2BZNA 3O06A 1SMAA 3OVQA 3KWSA 3G6LA 3C0SA 3V75A 3W73A 3W9ZA 3HU7A 1X38A 4L1XA 1Q2SA 7TIMA 1IZKA 1DWJM 4RZ6A 3MJYA 1KTBA 4MNMA 4JQ3A 1XPYA 3TP4A 2V9DA 2W3ZA 1V6XA 5FL1A 1Y5XA 5KSWA 1HJUA 3SCOA 3UA4A 1HGWA 1L2UA 4L65A 2X7VA 4UZUA 5I3GA 1XJBA 3T05A 3VILA 2VQTA 3E0IA 3LB0A 3ZLHA 2QJNA 5A8MA 1KCKA 1XGDA 2ZUUA 4GOAA 2DJLA 1O94A 4F79A 3VIIA 3BARA 1J11A 2XZ9A 2RKXA 3K8KA 1HT6A 3AHYA 4PTVA 4MLRA 1XQLA 5CC5A 4ZQCA 3G1VA 5M03A 1NOFA 3B06A 1EF2A 3WDHA 3C4UA 4X2RA 3WH5A 3BANA 4Q22A 4GIAA 3OPSA 4GX8A 2P10A 4US5A 1DQWA 3G2GA 5JBFA 4LUTA 2ESCA 1Q85A 4NXSA 4J7RA 3WDJA 4Y9PA 1V3HA 1QI3A 2G4JA 3WQOA 4XD6A 2PMQA 1K8ZA 1XYCA 1JFHA 3F4VA 1XIGA 1L0PA 2IPWA 3PZUA 1JAEA 4GNKB 3H2EA 3WD0A 1ZS2A 4KWUA 2WVVB 3W87A 1K7EA 3TYCA 5G5IA 3LPGA 3WD3A 4IF2A 3G1YA 3BH4A 4EKJA 4A8LA 3LQGA 4FR6A 3ANYA 1V3IA 1B57A 3S1UA 1QWGA 2DY3A 4KW2A 1RV8A 2E67A 3W27A 2X30A 2CPUA 2C71A 4I5RA 2JIWA 4FOUA 5LXEA 3VD4A 1SJAA 4I8YA 2D73A 3I6TA 3E5PA 1YRRA 5D05A 3AYRA 1TIWA 1PSCA 2XM1A 4HN8A 4FX8A 4W5ZA 1DHKA 3TEVA 3KZSA 4AWSA 3PUGA 1EP2A 3WQGA 1BYBA 4IXHA 2YDAA 4EANA 2WZTA 3LPFA 4XZWA 2V8ZA 1G7UA 3BPWA 1VYRA 3UEQA 2BBFA 3VD9A 2W0UA 3F2BA 3P6LA 1HF6A 1IWPA 4H6QA 1IEWA 2CBJA 2WLYA 3UG8A 3UWWA 1AMYA 2GGGA 3GTFA 3HURA 3SCNA 6REQA 1JQVA 1CIUA 1UWSA 3L7RA 4C6MA 1AG1O 5HDRA 3NDYA 1PL9A 3CUJA 4U5KA 5FJPA 4O17A 4Z08A 4A6GA 3P74A 4LS2A 3TFCA 5TQLA 1H60A 2AOSA 1W2VA 2C14A 3CT7A 3KHJA 4XAZA 3M0MA 1E6XM 4LGXA 3AYVA 1QHPA 4LFYA 4KRUA 1NWRA 1U5VA 3VNYA 4LAUA 5HAOA 3NQEA 1ZL1A 6ENLA 4O54A 1OFPA 3TWAA 4RX0A 4JTCA 1BF2A 1S39A 4RZ4A 3SECA 5AHMA 3RMEA 3OLDA 4AC1X 3SO7A 2PLMA 4N9EA 1XLMA 1YYAA 3N9SA 2CZ5A 4HKPA 1VENA 2RDUA 4JDYA 4XUYA 3MSGA 4Y90A 3MP4A 1VPYA 2DZVA 2G97A 3WLHA 3WK1A 4IIFA 3M44A 3RCNA 3L2MA 3LYEA 2XSAA 3B9DA 1Z44A 5AYZA 5ABHA 4LS0A 4X9YA 2J8TA 5AYBA 4MWAC 1DTUA 5EGRA 3TNBA 4NYUA 4Z2LA 2CLLA 1E5NA 1MI3A 3AMLA 1UJPA 4M7SA 1LL6A 5BXSA 3H4WA 3M0JA 5H8PA 3VABA 2YIHA 1ZHAA 2C0AA 4QQUA 1XICA 3PNUA 2IQDA 2PD9A 3KP0A 4M0XA 4N02A 3VKAA 1JXJA 2BY2A 4J5NA 1GJUA 3SQSA 2BOGX 1W3HA 1BWVA 3BSMA 3T81A 1K7XA 1CBGA 2QIWA 3BLIA 5BCAA 3EDJA 1MSSA 4WGHA 1BTMA 2UY4A 4OVXA 5HPOA 3HQ1A 5H1WA 3CS2A 4C6JA 4PMNA 2VD8A 5CC6A 3IK2A 4QEEA 1XS2A 2X05A 3ZVHA 1KD0A 1RY0A 3RJXA 2PRMA 1VFTA 1QNQA 3PP7A 2Q8XA 3WZ0E 4IPPA 1PX4A 1F8IA 1JI1A 4HPHA 2O7QA 4YYFA 3NQVA 1XLDA 1C8VA 2Z1SA 1RLCL 1MFUA 3A9IA 1EGVA 1QNOA 2QJMA 1MW3A 3GBDA 1ADSA 5T91A 3POHA 2OT1A 3CUIA 3CHVA 4KFNA 3S2CA 4GVGA 2V81A 5PTDA 2PA6A 4FLQA 1EBHA 4PFMA 5G4EA 1XIEA 3TQPA 2QCNA 1A80A 3WDIA 1SZRA 2X7WA 2J7CA 3STCA 2VGIA 4MFEA 2YLAA 1JIBA 3QQWA 4YU1A 1HQTA 1LROA 2NV1A 3DXIA 3R12A 5LIUX 3DGBA 1Q3NA 3UG3A 3EWBX 1P7TB 1XLLA 3NDZA 1GHRA 3KBNA 4KRZA 3TROA 1FTXA 1M53A 2CHRA 3EMZA 1B9ZA 1Q65A 3T42A 3W38A 3W7LA 3DYPA 4IL2A 1VFUA 4DB7A 3KEHA 4PMOA 5XIMA 2J8GA 1X97A 1HIZA 1KFLA 1ZAIA 3AAMA 4OE7A 4QFUA 1J2BA 1WKDA 3KUMA 1UG6A 2ZX9A 3E0LA 1CTNA 1HO1A 4JHOA 1MZRA 3CUGA 1XRVA 3PBGA 5DLCA 4GZJA 3TQ0A 3TK7A 3P0XA 3NZQA 3N12A 1EFZA 5MHBA 3A47A 1Q6CA 4O1EA 3GO2A 3P0WA 4QSFA 1P0EA 3N2OA 4M5PA 3B8DA 3MV01 2ISVA 3BUVA 4WK9A 5JVLA 1Y65A 4TX8A 3TX9A 5D9PA 3QGKC 3ZT5A 4ROQA 2EPHA 2VEGA 1BYDA 2CETA 4TVDA 1FKWA 4IMDA 3C56A 3TMLA 1J6PA 3HA1A 1TR9A 3TJIA 3NXFA 3VIKA 1SW7A 1LOLA 3UG4A 4HK5A 3PVFA 4CNUA 2BFGA 1HFBA 3PG9A 3GU1A 3L65A 4DBUA 3BJSA 1MNZA 3UERA 3SURA 3T2PA 4AIOA 1XIIA 3QW4B 2GUBA 5FCZA 2GK1A 4OU1A 1W5PA 1GW1A 1PV8A 1A3XA 2VFIA 2BX7A 2MANA 2ISFA 4ACZA 2HS6A 3ZYZA 1NOUA 5M3WA 1XYMA 3T6CA 4HZ7A 2QAPA 2VENA 1KBBA 3THDA 3FJ6A 1PUDA 1ZCCA 4CD6A 4DO5A 4F0HA 4XTDA 1EF3A 1V6YA 3IWPA 2ZX8A 5F1UA 2C0HA 3O16A 5IHRA 5A8QA 1JEZA 3G1DA 1G4SA 5F4XA 5L9FA 5KINA 3OHMB 2QKFA 4UQAA 1YDYA 1BWKA 1E6PA 1M7JA 1T40A 3O6YX 2YL8A 3UG5A 3CAQA 1LL7A 1O60A 4DXKA 1QI2A 3SCVA 4JN7A 1SJCA 3CWHA 2D0HA 1BHGA 5G2IA 5JQ9A 3ARVA 3NYZA 1I8JA 1TKKA 3EOEA 4CVUA 9XIAA 1HP5A 2MNRA 1UOZA 2PDMA 1OM0A 3QGVA 3G1HA 3ISIX 1RCQA 1J6OA 2WNQA 2VNCA 1TZ7A 4XAPA 1LF1A 4LF1A 3BSHA 3W29A 4IMAA 1MUWA 2FVKA 4B5UA 1MQQA 3APGA 4NU7A 1EPXA 3T09A 2OEJA 1H1YA 1AJZA 2TRSA 4IOTA 1RR2A 3WQ4A 2RJHA 3D3AA 3UXAA 2V68A 2C15A 2H90A 2VMFA 4WY0A 1VH7A 1T8QA 1JDFA 4S2BA 5HWJA 1SO4A 2ZA3A 3DAQA 3ZLFA 1MUCA 2P0IA 1NY1A 2XVGA 3GG7A 4PSPA 1K9FA 1XL9A 5C2GA 3FEQA 3THAA 3M41A 1JCXA 3H7RA 3MSDA 3TMQA 3FIGA 1YNYA 3M0LA 2P3ZA 2VX6A 2G37A 3GU2A 4F2UA 1BF6A 4TTUA 4GZEA 3TCEA 2VQUA 2DT0A 2PDIA 3U2ZA 1KM3A 2GYIA 2ZZ5A 3OG2A 2XVNA 4IXXA 5C2XA 4WXYA 1XLHA 3SIMA 3AZTA 5D37A 2PDKA 3SUWA 4B4HA 4AX6A 1GG0A 4F0KA 1EIXA 5U7SA 2WVVA 1VFLA 4HCLA 3IGUA 1DWIM 2WK2A 4XX6A 4M81A 4NZCA 3G3MA 5AC7A 2PGEA 3KXQA 1EDTA 4TX9A 5FSDC 3AU6A 1GVEA 3B03A 1XLCA 5BMXA 3TZFA 4HT3A 3B0UX 4IQEA 4JKLA 3RYSA 3L67A 5F4WA 1O5XA 1CLVA 2XGIA 3QY7A 2NVAA 3GHSA 4F9DA 4JTTA 1EJUC 2JKPA 4QQ3A 1TPB1 3DEQA 3EXRA 4ZE4A 4AVFA 4DVOA 4WDWA 4CLMA 3TN6A 3CGTA 3GLCA 4N9DA 3LRMA 2BB0A 2ZZ4A 1VBUA 1H7PA 1H2JA 3ZM8A 4ML4A 1TE6A 1ICQA 1Z32X 4A8IA 4BK9A 3GKFA 2CLIA 4CCCA 1O68A 3BV7A 5AB3A 3L5AA 3GNRA 4A22A 3H4XA 1VJIA 4W89A 5REQB 3A3WA 8XIAA 3QQ0A 4POCA 5D38A 1NWTA 3R43A 2NQ5A 5KMYA 2NWRA 3WY1A 4M19A 3GNNA 3HQOA 4H9TA 3QPEA 5CH9A 2CWXA 1X6LA 4S3GA 2Z1WA 2VHLA 3VIOA 3GTNA 4O10A 1LRQA 3SW6A 4XD5A 1NP0A 5I78A 4I8DA 1DJGA 4HHHA 4XG1A 3A5VA 1B3OA 1RAKA 3FV9A 4NZJA 3VIJA 3NEHA 1LG1A 1H1NA 2DORA 2VCBA 4GG9A 3TDFA 1MXGA 2WVTA 3O0FA 4LPCA 2H8ZA 4PMYA 3I6EA 3KAOA 1TUFA 3WCZA 3WK3A 1TJRA 2D0FA 2CXGA 3PTKA 2XN2A 5I0DA 4ZFCA 2WWCA 3IGXA 1E72M 2OX1A 4MJZA 4OHQA 1AW1A 1EL3A 1Q6RA 2AMGA 3LTYA 2O0TA 5D4YA 1DL3A 4YVXA 1AQHA 4WLCA 4UNLA 4UCFA 1MVYA 4RL3A 3MUCA 3UCCA 5LIXX 1IE7C 4C1NA 3R13A 1DJIA 2AL2B 3GDTA 2PTYA 1KV8A 1R85A 4FNTA 2ALRA 3I4KA 3K46A 4QG9A 4LV9A 3LSCA 2XFRA 4XIAA 2WVUA 4AMCA 4AIEA 2X0HA 3IV8A 5SWUA 3QPZA 4H3DA 2D20A 2PODA 1TWIA 2V69A 3B3DA 3MBFA 1P6WA 3ARQA 2F2KA 3V5FA 3W2KA 3TSMA 4B3KA 3RX3A 2Z00A 1TPWA 4LANA 3GVWA 1E4LA 4O16A 4EK7A 5LNSA 1VEPA 1GVRA 2G0WA 1CXKA 3W7MA 4URIA 5DMYA 4ATLA 1D2KA 1ONWA 2Y5SA 4BI5A 4NJIA 1UB3A 3BG9A 4BI6A 1UBPC 4Z1YA 1B0IA 3GXIA 1KB3A 1OB0A 4MFDA 1UYQA 1WE5A 5FAJA 2ZFAA 1RD5A 4LSBA 4HHPA 5HWMA 3PZMA 4HIBA 4JTUA 1Q4NX 1QI5A 4KESA 1ZJBA 3PSVA 1EXPA 3D46A 1E9ZB 2J74A 4FALA 4FOKA 3ITTA 4H9MA 1FCVA 3LUTA 1UQYA 1ZNNA 2G3NA 1E3ZA 4AU0A 3W6LA 2FDSA 1L6GA 3RX4A 4M6VA 4FB7A 2NSXA 2Y7FA 3HPFA 3EA1A 4FLRA 5I07A 2XWDA 2YGYA 1RK6A 3M7SA 4NRRA 5E9XA 3M0KA 4C1LA 4EXQA 3CNYA 1V08A 3MCNA 4XZBA 2FPYA 3ZT7A 1YKWA 1WDQA 3QHNA 2IPGA 3CC1A 1P7TA 4LAOA 3H8AA 4ZBCA 1IYXA 1HKIA 2VRJA 4IJRA 3TA6A 1U5JA 1E1CB 4AY7A 3VOCA 3CQJA 4UMCA 1BSIA 2DZTA 2R1NA 3A4JA 4IP7A 3LQLA 1WBJA 1XLBA 5C71A 2OZTA 5IFTA 1DHPA 4DM2A 3ABXA 1S1PA 2J7DA 3VCNA 2PTXA 4JN6A 7A3HA 1I2OA 1SO3A 1DP0A 2WVSA 1D3HA 1Z48A 1IXNA 3MVIA 4J2MA 2DZAA 4N4PA 2BGSA 2VX4A 4XAFA 3GUGA 5DMNA 2A85A 2QEZA 3JR2A 5TNVA 4RV3A 3KRUA 1TMHA 4L9ZA 4JOMA 3SCPA 2VVNA 1BYAA 2OLSA 4XSLA 2RDXA 1KCZA 2Y8UA 3CB3A 2PZNA 2C16A 2J88A 3WKZA 4H04A 2NT0A 4XTIA 4C6IA 3H55A 4JR5A 5DCBA 1R3YA 1KRBC 2CKSA 1R8LA 1TRIA 3AI0A 4MWAE 1XXXA 3L4YA 3WFAA 1UMLA 3RM8A 1XR2A 5LIKX 4O4VA 3WJYA 1QR7A 4LNCA 5D2XA 2J13A 2HE5A 4WIWA 3DGRA 3QKEA 1XBVA 1I6NA 1UJQA 2VWSA 4MOZA 2CITA 2VGGA 5TIMA 3EGJA 3KVJA 4DELA 3VZYA 3PS7A 3IK4A 3W1XA 3DG7A 3NQFA 3MMDA 3TXVA 1UCWA 4MPQA 4Q3MA 2BGNE 4R7OA 1LT7A 4GX9A 3VD3A 3TJXA 2CBUA 1GOWA 3C5QA 3PZNA 5AYIA 1U22A 3NOYA 1DWAM 4IGHA 4MY8A 3W6MA 2YW3A 1TX2A 4MJMA 4MUZA 5M1TA 2D0GA 4ZR8A 2VEIA 4HTYA 5A8GA 3KX6A 1O5RA 3PY2A 1LBFA 1E6RA 2V0TA 5D2VA 2ZCGA 3QEZA 1NTHA 1XWYA 5I00A 4AZCB 3P5YA 2WMHA 2A3BA 3PAJA 3NVDA 4CQBA 2A3HA 4JTIA 1PCWA 4NZ1A 3LLFA 4KKXA 5GJPA 1F9CA 1V6TA 1EH9A 3GC2A 4C1KA 1QK0A 2HRWA 3B8SA 3NA8A 4D8LA 5T26A 2VGBA 4Q33A 4AUBA 4JTSA 1M68A 4HU4A 3V5OA 4U28A 1XQKA 3RM4A 2VEPA 1YHTA 3E12A 1NDWA 2FTWA 2HQAA 3HV9A 1BGGA 1E1FA 1OABA 2E9MA 1ZQ5A 3V7PA 5CLWA 2AQVA 1A5AA 5KEZA 3WJWA 1RJPA 4P2VA 3PHAA 5CPTA 3MCOA 2OGYA 3C2OA 1SSGA 4ZOCA 3D5HA 1DWHM 1ZJHA 4LQ1A 3U7BA 3KOXA 2J6XA 3FY1A 3GHTA 1BXCA 1ZP4A 1GVYA 1AQFA 1FUYA 1S5WA 3DHPA 4F0RA 5FEPA 4DO6A 3CWNA 1C9DA 3TN3A 1TV5A 1E43A 4XZHA 4H8VA 1J0ZA 1GYMA 3RO8A 3SM0A 4MWAD 3Q94A 1KM5A 2I7GA 3KW3A 4C6EA 1Q8AA 2QF7A 1OCBA 4C6NA 1RCOB 1AJ0A 4ZGYA 4H8NA 3E49A 4HNCA 3SIZA 4H9VA 1R2TA 3SQLA 4MJ2A 1FP9A 5K9DA 5AFDA 2HPIA 1WZMA 5FJRA 3PTDA 4DUOA 2V3FA 3NPXA 4HJWA 3MW7A 1GVFA 1ZGDA 3WUFA 1XFCA 4O1CA 2XGBA 3APYA 3IGSA 1ZSXA 2OQHA 4KGLA 5C0QA 4W8BA 3L12A 3GU9A 2J7FA 4S3AA 1W6TA 4DY1A 4YLWA 5FEZA 3TCSA 3W7CA 4JTDA 4HJFA 3RU6A 5DT5A 2WAGA 3KBVA 3G6MA 1PIIA 2BHUA 3JUGA 3W88A 4XQ6A 1W1ZA 3WFLA 4QJ1A 2HDJA 5A1AA 2QNEA 2V5CA 2FZ9A 3EZ4A 4WXZA 4CQCA 3GDBA 2FLIA 1DXEA 3AZRA 3CHDA 4G2DA 1AVAA 3G0UA 3B0PA 1Q6OA 4RPQA 3QQ1A 1JZ3A 3NTYA 1A50A 2QF8A 1Q66A 3M4HA 2EJ1A 4GGBA 1Q7MA 5K9CA 2BS9A 3D3FA 1RP8A 3O6DA 4J3UA 1VPXA 4Q7IA 4AFYA 2ZA1A 1GUVA 5REQA 4X22A 4OOUA 1K8XA 3GVQA 1NWUA 3AO0A 2A21A 3IVSA 1GOIA 1SW3A 4JX6A 3C3UA 4GYJA 1J79A 4HNUA 3BG3A 2WSQA 3ANVA 1J93A 5D03A 1ISXA 3T8QA 3FEMA 3AIEA 1A4LA 1T96A 3W2LA 1US0A 2BASA 3DI0A 2VM8A 3H26A 3SCQA 3DHDA 3MKVA 1S38A 2HBXA 3SSZA 4HN4A 1Q13A 3S2JA 3WJXA 1LL4A 4E4FA 4ZA0A 3O8AA 5I7GA 2HPMA 4KGJA 3VMPA 4Q8PA 1LLWA 3UXLA 1B90A 4BY3A 3LA4A 1TMQA 4PN2A 5G4WA 4BI7A 4GYPA 3RM9A 4AB4A 2GDQA 4KF1A 3PR2A 4IP5A 4BKNA 3TC7A 4HNNA 1VCFA 3IIOA 3BLDA 1NM9A 4KCVA 3LPOA 1W32A 5CJNA 5LNWA 1MW0A 4UTUA 1R3VA 2Z2AA 4A29A 4H6KA 2X0YA 1YDOA 2AL2A 9CGTA 4JFTA 4UR7A 3AQUA 1MQRA 3MHGA 4R9OA 3CASA 3L5LA 3P62A 4DYKA 2PDLA 2BXZA 4H2CA 1NDYA 1XBZA 3CK5A 4MVAA 2CW6A 4K7VA 2E7FA 2XUCA 3LCGA 1TTQA 3QV6A 5J5RA 3Q65A 1IEXA 1YTDA 4S3DA 4Y96A 2QYGA 2XM2A 1C93A 2DIJA 1OZMA 1K9EA 2BVWA 1I2NA 3TLQA 3OODA 4FNUA 5A2CA 4PUMA 1FDJA 1SZEA 2YZ5A 3PAOA 5EMKA 5CEWA 4L9YA 6TAAA 4HU8A 2DSWA 3LGEA 3PPHA 4C6LA 3REQA 5C5YA 4NJGA 4NZ5A 4GA8A 4U4MA 3W02A 2QJGA 2FHFA 3S1GA 2GJPA 4O11A 2FFIA 1Q6LA 3WENA 4IZGA 3LXAA 4XAYA 2YA1A 4UTWC 1BRLB 1F8MA 1KKOA 5BOEA 4L1GA 3F7JA 2YCIX 3RCMA 3KP1A 5ECUA 2G3JA 4XZLX 1QOXA 3NO1A 3GQYA 4LBRA 1M9HA 1H7NA 2YR1A 4R3UA 1EGMA 4PMDA 3SRFA 1V77A 3CV2A 5C9XA 4OWGA 1R2RA 2Q01A 3U9IA 3WF4A 3OQEA 1J5TA 2VI0A 3EBVA 3VDHA 4YYCA 3O6CA 1Q6DA 3R0KA 5KZMA 3PZQA 3WK2A 2ZUSA 4Y9AA 1JVNA 2IPFA 5AZ0A 2E4TA 3DFHA 4QJ4B 2I5QA 3POCA 1P1XA 3BZJA 3LI0A 4NX0A 1UW9A 2GSJA 2V3GA 4DXXA 2DZBA 2HNEA 1XFBA 3BO9A 1EUNA 4CUCA 1X1ZA 3OBEA 1TFVA 3N4FA 1J0JA 2E5CA 3HF3A 5JUVA 3FJLA 4ZSUA 4N42A 1WAWA 4J3TA 3CUXA 1E4MM 1SSDA 1EOMA 4H8HA 1E1CA 2XIIA 5FSEC 1ZRQA 3E0FA 1QPRA 3VVGA 4HYVA 3GZAA 4DJEC 4ZB0A 4R27A 5I02A 1YPFA 3DBPA 1YNPA 5HQEA 4DWDA 2DP3A 2A79A 2TPSA 1VPQA 4IUGA 3TQVA 5AHLA 4C60A 4BWLC 1F2JA 1J18A 4GI6A 4IFRA 1RQBA 2F8QA 1F73A 4GZIA 3JS3A 2R91A 1QUMA 2E1DA 3UJ2A 2DVTA 3ABOA 3W24A 1AL7A 1OG6A 4ICNA 1GZJA 5HMEA 1JCNA 2ZX7A 2PURA 3L23A 1K3UA 4REQB 2W61A 2G3FA 2VWTA 1I2RA 3PM6A 1VZWA 2PF8A 2AMXA 3DHFA 3UP8A 3WF1A 1FWRA 1EEXA 4OOZA 1GKQA 2QR6A 3ZR4A 3PWGA 3MV11 4MAVA 2PDPA 2XH4A 4OGZA 2Y7GA 4Z0JA 4JEQA 7CGTA 4P7QA 4QM1A 5IOBA 4FLOA 1VFHA 5HJXA 4TO8A 2Z7KA 3ALFA 4QISA 4DF1A 4NZ3A 1AA1B 2J79A 1S46A 2E5BA 3G8EA 2ZBTA 4NG3A 5CBIA 4AC7C 3HGJA 4EF8A 1HP4A 4XISA 2R1PA 2QULA 3PZOA 4K6AA 1C91A 3VTRA 1F3EA 1QXLA 4I5UA 2DVXA 3TJLA 3H7UA 1RJRA 3TQKA 2FZNA 1KRAC 3ENLA 4QG8A 1UWIA 3PK7A 3AMDA 2CHOA 2QV5A 3K4DA 3MQTA 1IXPA 5A6BD 4YTTA 1LLZA 3MYOA 1HJVA 2A3AA 1TA3B 2WSRA 4GKTA 1VIZA 2WJDA 2X1IA 2IPJA 3NAVA 3D47A 1XLKA 2ATSA 2WSKA 3NIYA 2OXNA 7TAAA 3LHTA 4FIRA 4CQAA 1E0TA 5C9UA 4FOJA 5LA1A 4AZCA 3ANUA 1H0IA 2IKIA 3OYXA 1AH0A 3G1SA 3V0TA 1A5UA 2GJXB 4LC6A 5HMDA 1ECQA 1GOOA 3QXBA 2Y61A 1OC5A 5AC6A 3R11A 4W84A 3GXTA 3LNMA 3F5KA 3VD5A 1CXFA 1OGSA 2JE8A 3S2LA 6PTDA 1GQIA 4RV8A 1KM4A 5I24A 4IX0A 2P5NA 1W8GA 4AZBA 1KFCA 1K6WA 3N29A 3KVMA 2X8RA 5LGXA 1HUVA 4WRHA 3FA5A 3QR3A 2O4QA 1E3XA 3QZ6A 5HNRA 3RCYA 3W00A 1UR1A 4PMVA 4MNLA 1ODUA 2WNWA 1I0DA 2YA0A 2WJEA 4YTRA 2UWFA 2H6RA 2GJNA 3UF9A 1YNQA 4NILA 4K37A 3EX1A 1B3ZA 2V2DA 1NEYA 4IICA 5JXQA 3Q67A 4ACYA 3ZSTA 4LAZA 5BW6A 3HFYA 1LDCA 3HPSA 3EWCA 1GZGA 1TZZA 2P8CA 3DU0A 3N3TA 4UMBA 2QCCA 2G3MA 4YS1A 4D1JA 2FZ8A 1S2CA 4QS5A 3TN5A 3W7DA 3TAKA 2RFGA 2ZDRA 3AMCA 2ACSA 4L1WA 3TR2A 4C7FA 3H24A 2VFFA 3BJTA 3SRKA 3EPOA 5LA0A 2YYUA 3B05A 1V0MA 3PN8A 1TJ0A 3GDKA 4ZOBA 3V1PA 1LWIA 4N7QA 2WMFA 3JW7A 4DJDC 3I10A 4NAEB 3A22A 3LMZA 3DG6A 2EPMX 2VP8A 3DFPA 4E4UA 1L6YA 3ITYA 3QBUA 1S3TC 3HGOA 2OLAA 1EJRC 3S5SA 2V5KA 5TBOA 5I6SA 2NLIA 3GR7A 4I7UA 2WPBA 4ZENA 5E93A 3W2UA 1E1EA 3DBNA 4A8NA 5CAHA 3RU8X 4MZ8A 3WK0A 3SBFA 5T9CE 1RSCA 4C6BA 3EEGA 2WCGA 1JQXA 1CXIA 2CZDA 2VZTA 3ZT6A 1GT8A 4K7YA 5GPRA 3P81A 2YDSA 4NY2A 2BXYA 5DCEA 1UWAA 1A5MC 4NJJA 3TYAA 4HU3A 3YPIA 1EX1A 1OK4A 2QUUA 3NZPA 4JHMA 1ZUAX 1KO0A 1X6UA 1MEIA 4DJFD 4A8RA 3R0DA 4MB1A 1XUZA 2VUYA 4AWTA 3K1GA 6XIMA 5BRPA 2C1GA 1WKYA 4Q8TA 5B80A 3CO8A 3HMJG 5D2WA 4LALA 3EWYA 1THFD 2ASHA 5DT7A 4O15A 2XIMA 3W1PA 2VL4A 3LK6A 3P67A 4J9JA 3WUBA 1G69A 3IJ9A 5FJOA 1RPKA 1ITQA 1TUXA 1KFJA 4NUWA 3W7EA 3RR4A 5CZTA 3TNOA 3GFXA 2VR2A 3AUOA 1OBAA 5ABEA 3G18A 1A5OC 4L56A 1T99A 1XYFA 4WF7A 3QSRA 5FF0A 3H54A 2J7GA 1EDGA 1R9XA 1RBLA 2GGHA 3P2VA 2Y5JA 1NQ6A 5T8GA 3SAZA 3EDEA 3SCSA 4FI4A 3KDNA 3AU2A 4FF5A 1FWBC 1MZHA 1BKSA 1UKQA 4AD1A 3NQ6A 8XIMA 3JU2A 1CECA 1YEYA 3WBYA 4DBEA 3AXHA 4LX4A 5GNYA 3IVUA 4PBGA 3IUIA 5CPOA 4MPKA 2PU1A 3OO2A 3NGJA 3AHZA 3E0WA 1JGIA 3UWQA 2FMOA 3EWWA 3ZMRA 5LHEA 2XIBA 4PB4A 3CMFA 1A47A 2IUZA 1NFPA 4LUJA 1PZ3A 3CL6A 1SUXA 1V3MA 4PCNA 1A3HA 2XH0A 3F5LA 3UPWA 2WQDA 5LKYA 1BRLA 4OTKA 3K13A 2C19A 2YJQA 4JICA 5D9MA 2D3NA 4LC8A 1F6PA 4AZ6A 4JCLA 4JXCA 1JDAA 2PDYA 2FVMA 5A6SA 1IZCA 4H00A 3GW0A 2HEJA 5KETA 5L6UA 4PRRA 4H8UA 3NDOA 4PUWA 4Y9OA 3DX5A 3VNIA 3HG4A 1UD3A 2R1LA 1M6JA 5IM51 3MU7A 5HOSA 1XSKA 4NXKA 4XVEA 3VIGA 4JZ5A 1BEUA 3E0VA 4AD0A 5ENLA 3EWDA 1DIEA 4MB4A 3A5FA 3DERA 3IJ7A 3W1MA 1TX0A 3AHXA 3AS0A 3OA5A 2FTYA 2FPVA 7REQB 1Z9AA 4OUIA 1VBGA 4XUGA 4H9XA 1W9XA 3BMVA 2GDVA 5D33A 4ZO7A 2DZWA 2GQ8A 2YZRA 3VFCA 1LYXA 4JPGA 4ALDA 5EMLA 3DENA 4RCXA 3CWOX 4UTWA 2ZRXA 3N17A 3NOEA 1Z89A 2X41A 1POJA 2PDUA 2UZ9A 3CPUA 1GOQA 1RQHA 3IV3A 3M07A 1DTNA 2EKCA 2PAJA 1QBBA 2VT0A 3G5EA 1WBHA 2QPSA 4YCPA 3PUOA 5CLTA 2YB4A 3KRZA 4GO8A 3ES8A 5F1VA 4JNYA 1FCBA 1TPDA 3BLPX 1YE6A 4IGSA 5DY2A 2YXXA 3LGDA 1LQAA 2W5FA 1UKOA 1WXYA 2TAAA 1LBMA 2A7RA 2BGQA 1W5NA 1OCNA 1QNSA 2CLPA 3OZYA 3UWZA 4KCWA 3UR2A 4F0LA 1K03A 2VDHA 4V28A 4KMQA 3ERPA 1JG9A 4EAYA 3ORWA 3UR8A 3ARSA 3WQ8A 4PCTA 4MADA 4PMXA 4E6MA 3QLDA 2D22A 4MKNA 4PCSA 5A3HA 4CNNA 2PGRA 1VHNA 3N9KA 3OZOA 4PEKA 3BL3A 1DXFA 3QPYA 3H7VA 1J96A 3IIVA 1RD6A 4JX5A 3BDKA 2XISA 1CNVA 3DFTA 1R6WA 1POKA 3ARXA 3SN4A 3S83A 3VAVA 1X7IA 4Z17A 3MI6A 2HROA 2ZXDA 1B3XA 2MUCA 5CSYA 1WOAA 3KS5A 4UR8A 5HUPA 1US3A 3GSMA 4LRTA 2JEQA 1JCJA 2GUUA 5LXXA 2WV8A 1W37A 3KE0A 1EP3A 1N8FA 4JD4A 2NVDA 3IS4A 4E3VA 4DN1A 4LH8A 1BG9A 1KLYA 1X1OA 3LHZA 4XAGA 4L7ZA 5KITA 3UNTA 1CEOA 4JX4A 1GOMA 4GC3A 1ODZA 3VZXA 1SR9A 2ZIDA 1GKPA 3R7MA 5AHNA 1KTNA 3GAYA 1R3SA 1DV7A 1TV8A 2C79A 1IIHA 5AOUA 2PDNA 3PC0A 1JYWA 3S8HA 3WLMA 2XIJA 3L2LA 4KERA 3E2QA 4YVVA 1K70A 4GWEA 1KRMA 2YPIA 4OUEA 2YX0A 5A2BA 3TVAA 1QPKA 1YE4A 3QFEA 4J35A 3R79A 1NQKA 5CJ5A 1UD2A 1QT1A 2DH2A 3EAUA 4FX6M 4A3QA 5GNZA 4GCXA 1TPC1 3NNTA 4BFAA 3AIVA 2GJXA 1BKHA 3GD6A 1XV8A 3RPMA 2ZDSA 3U48A 5E70A 1IT7A 4A35A 3SCWA 2YXOA 1HVXA 1RVKA 1PS9A 3GDMA 4AHOA 3A21A 4EPDC 3W0KA 1W1YA 4LB4A 3NZ1A 2ACQA 3HMCA 4O1FA 4HMCA 1VAHA 4ZL1A 1DQUA 2OMAA 3HV8A 1XCWA 4QXIA 5G2HA 4DIAA 4ADTA 4HSHA 4CKQA 4ZMGA 3WYZA 2Q71A 4NX5A 4QE4A 3GHRA 5F2LA 1SR0A 4P7NA 3LBCA 4KS0A 2NXGA 4AIBA 2FVLA 4PMRA 1IWAA 2D3LA 2D1ZA 1HVQA 5BYWA 2ZA2A 4CN4A 3N04A 3ABSA 3ZO9A 2DT2A 9RUBA 2ALDA 4X9SA 1XRTA 3JZUA 4Y6GA 3O1NA 3TIMA 1XD0A 1AH4A 2OZ3A 4BQ3A 2WB5A 3N2CA 3TH6A 1QNPA 2JF7A 5BRBA 1BVZA 4GK8A 4Z2HA 3MUZ1 2FTPA 3BQ6A 2BODX 4HD5A 2V30A 3GW3A 4JIHA 1XYLA 4J3ZA 1VS1A 2GUYA 1SMDA 1R3RA 1DJZA 5H8UA 2WPGA 4PL1A 4HB7A 3I7SA 3T8LA 2GVEA 4ILSA 5I03A 2WKJA 2Z28A 3II1A 4IT1A 4GFSA 2PLJA 2E6FA 4LRSA 3CMJA 1RLDA 4JIEA 3PTQA 4UOJA 4XZNX 2BVTA 3WH9A 1ML1A 3BZGA 7ODCA 1V6VA 3SCRA 4FP1A 1AW2A 1FWFC 1M5WA 2E77A 3TYEA 1OX4A 1EJWC 1NVMA 4AY8A 1UOKA 1XDLA 2FB3A 1HX0A 1B3WA 3URQA 3V35A 1PXGA 4H6EA 5C9RA 4GVIA 4FLSA 2BXVA 2J7EA 3EKLA 4WSJA 1EJ7L 1GGOA 2PWVA 4PCPA 3N6HA 1DIDA 1MMFA 1E0XA 1PPIA 1X1NA 4B2DA 4MYAA 4LUYA 4YTUA 3OZPA 3QTGA 1F76A 4N2YA 3LOTA 3S5YA 1LP6A 1PKYA 4O19A 3CIXA 4TVUA 4Z2GA 1VF8A 1RY8A 3LENA 3F4NA 4LOCA 1F3XA 4GIEA 4U33A 1H7XA 1C8XA 1M04A 1NF7A 4HGXA 4MDPA 1PKNA 1ZBWA 3CYVA 2NX1A 3QOKA 4DJDA 2WC4A 1W56A 4IHCA 1W8SA 3ITOA 4V1YA 3LCXA 3T44A 1UBSA 3GTXA 2ZRWA 2Y88A 3TZNA 5J04A 1W3NA 3ALGA 3WQ6A 3PBWA 3VKKA 4GHRA 1DE5A 1VLWA 3FA3A 1PVNA 4YXGA 3IANA 3OGVA 4G1KA 3U4FA 3QJAA 5FI8A 5BXRA 3CU2A 3EWXA 3PZVA 4JNMA 1K77A 3W2JA 1W0MA 3BURA 3EPMA 2V2HA 2HNHA 3K5XA 1K6AA 2ANUA 4TU1A 4M8UA 2R1KA 2ZVIA 2OLHA 2DT3A 3AYTA 1HKWA 5A6MA 4MNKA 1SFSA 4GACA 2EQDA 1ADDA 1UIOA 1ZBKA 5BXTA 3F4DA 4JL1A 2UY2A 4D2JA 1RALA 4TR9A 1FA2A 1X8CA 4M1BA 2W66A 2CC0A 4KFPA 2CESA 3DH7A 5F4SA 3FSUA 3W85A 1DBTA 4H9ZA 4PTDA 1XD1A 3OB8A 3EB2A 4HPJA 3UR5A 2QUVA 3GFZA 4J2PA 2G50A 1FRBA 4IPLA 3SUTA 3MP5A 1R0MA 4FHAA 5HNUA 4QGCA 1Q5MA 2AL1A 3WLLA 4LTSA 2PE4A 3CV6A 5F2MA 4C5YA 1FHDA 1GEHA 4QHRA 1I2PA 1TPFA 5ECVA 1OF6A 2OODA 2GJLA 5AHEA 4EPEC 2JGQA 4I6KA 4JYEA 3T2OA 1VFSA 2D2HA 3LZ3A 4FXRA 1F5ZA 2OEKA 2VCAA 4IQJA 4U2YA 2EPKX 3KS6A 5MKGB 4AF0B 1RJQA 4K3ZA 4DYJA 4Z2KA 4RE3A 4L9XA 2PS2A 1NELA 4GI9A 3LM7A 4TMCA 3NM3A 3GDRA 1AZ2A 4YTSA 4WKFA 1I1XA 3WMCA 3R89A 3P8JA 3QZEA 4ACZB 5E0KA 4PMZA 3C2VA 1ISWA 1JI2A 5HK4A 1B30A 2A3CA 2XIQA 3NPUA 1TPUA 5JMUA 3OOQA 4L80A 1IIGA 2INEA 3L0NA 3WNLA 5HUOA 2XN0A 4DJFA 4TQTA 2VOTA 4ZOEA 4Q8MA 3VOGA 1E9LA 2B7NA 3U2CA 3SCTA 1S2AA 3IJIA 1G4PA 3RMJA 7REQA 1GONA 3NQMA 4QROA 3VFLA 1D7KA 4ZZ9A 4JQ2A 2G8ZA 2Y7EA 3W2NA 2REQA 3VNZA 1CGXA 3OEXA 5HQLA 3GXMA 2PDFA 3VYLA 2E6YA 1Q6QA 2AKZA 2AAMA 4AAJA 4NZ4A 4OBTA 3V0UA 4PULA 4F66A 3P8IA 4GQGA 3UR7A 3W4RA 3AROA 1DQXA 3PFRA 5E09A 3LXBA 5AECA 3AISA 4XKYB 4MIMA 5A6LA 5LYRA 1VCGA 2KX9A 3DI1A 3LLXA 3GNDA 3M0IA 2J4GA 1N55A 1EJVC 1TYGA 4JYDA 1RPXA 4UFLA 4MLJA 3MT1A 2O56A 3S1XA 1JUBA 1MW1A 2DDXA 3LD5A 3RDKA 3SR7A 1HJWA 3C0LA 1T41A 2ZRYA 2ZOXA 2WJZA 1O7AA 1JPHA 2YDRA 5G1MA 1ENUA 1ZY9A 3N6JA 1A3WA 3WLRA 4GZ7A 1R30A 4E2BA 3NL2A 3U4AA 4WY0B 4LBSA 2VX7A 1U1HA 1K1DA 1QPQA 4AY1A 1XGEA 4FA3A 2IKJA 3M64A 3MZNA 1WUFA 3V36A 2VFEA 4DWSB 4AWEA 3N34A 2PUZA 3H2FA 3NPVA 3GYCA 4X0VA 3BVJA 4IPJA 1W91A 3MA8A 2EKGA 1ZBVA 4F48A 2GVYA 4NNCA 4Y9MA 2QMJA 3HGSA 1ME7A 1RA5A 2VX5A 4WVXA 3QC3A 3NEVA 3WDRA 4NJHA 1REQB 5CPNA 4UFIA 1HTIA 3NQ8A 4A3HA 1U1UA 2XFYA 1R38A 1W3IA 2HSAA 4E8DA 1OQFA 1FWEC 3ZJ7A 1QHOA 1O1HA 4K8GA 1W5MA 1CDGA 4QLLA 2CZEA 2F6XA 3EMCA 3UETA 2Z2UA 1BAGA 1W2PA 5EPDA 4DNHA 1PO9A 2Z27A 2J7HA 4M82A 4AEFA 3L5MA 3W1TA 3CL7A 1V0LA 4LXFA 3VI2A 2VZUA 1SFTA 5FJJA 5C2CA 4LS1A 2CCRA 1NOWA 3GIPA 1DJNA 1QDSA 5K4ZA 5D09A 4MZ1A 1XM3A 1FWAC 2VUNA 4UTHA 3EOUA 1UZ4A 3C2RA 1K02A 4KWVA 1EEPA 1H51A 1KXHA 2PDCA 3OA3A 1LOQA 2DSKA 1KFWA 3CZGA 5IXEA 2QUTA 1XIJA 5GJNA 3FXGA 2R94A 1D3GA 1HZYA 1XKJA 2Z2BA 1ZCOA 2E3ZA 4GUFA 3I68A 2Y2WA 3NYDA 3WBWA 1HG3A 4C7DA 3T55A 1XLJA 1ZFJA 5HPCA 2VR4A 3TOYA 3EPNA 3DYOA 4LB3A 4AHQA 3MUXA 2Z1VA 5D2YA 1KNWA 3H2OA 3LM3A 4DAFA 2IKGA 4O57A 4D9PA 3GHUA 3NFUA 3WLSA 1EPVA 4GY1A 4TOQA 1XIMA 3ABQA 2QW5A 2W27A 4HPXA 1GOKA 1OG0A 3QF0A 3EDKA 1XH0A 1XIDA 4MGGA 3WJSA 4GUGA 2F38A 4GINA 2W79A 1Z3NA 2OKTA 3VC6A 2YL5A 4QDMA 4YN5A 3OLEA 4EX4A 2RGLA 4OIFA 3QYQA 1YXYA 1HKMA 5A2AA 1YPIA 3DC0A 4K36A 3VCCA 4A21A 1SGJA 2WWDA 1A53A 3H21A 3ZIZA 4HZ6A 5LSMA 4C1NB 4O1AA 1S5TA 3VUSA 4F4RA 3MO7A 5CGMA 5HJLA 5BWFA 2OPJA 3L0GA 4U5IA 3S1VA 1UWRA 1EQCA 4NAFB 3T2QA 1TTIA 3B0VC 2J66A 1F6YA 1O95A 4RZ5A 1UR3M 1A49A 2ZXQA 1YTKA 2I5IA 4R34A 3OQ8A 4L5ZA 1YXDA 1PWMA 3B8WA 3CH9A 2DQXA 4C6FA 3NL6A 4IWWA 2EO7A 2WOQA 3NQCA 1NFBA 1XP3A 1TVPA 3ITCA 1DIKA 2CIPA 5DMLA 1GQJA 3W75A 1RCXB 4GXWA 2P1FA 5HANA 1XSIA 2E40A 1VBHA 2BWGA 2Z0IA 1WOBA 3LHWA 1V6WA 4FNSA 4J4KA 3W7NA 3I65A 2HXUA 3AUJA 2NV2A 2OQYA 2P8BA 2Z25A 2G4FA 1JNEA 4UNKA 3AICA 4B3ZA 1EKOA 4PRTA 4JIPA 3GH7A 3TSBA 1H7RA 4PMUA 2Y0FA 3UPBA 3WBXA 4L6OA 4R7WA 3G22A 3VGEA 1FKXA 5K7JA 1CPUA 9XIMA 4C6PA 2G95A 1LM1A 2J9ZA 2WBKA 2QAFA 5F7UA 3CZJA 1QATA 1WP6A 5CG0A 1C29A 1GJWA 3S2MA 3BW3A 7XIMA 1AD4A 3ARUA 4JTEA 2O9TA 3U2OA 1W3TA 3E96A 4HA4A 3FHAA 1H49A 2B7PA 4UTIA 3B9EA 3S46A 4UQCA 4H7CA 1NAL1 2ADAA 3GG0A 1HGYA 4YTQA 2QDGA 4WHBA 4CCDA 4US5D 2YCLB 3QV7A 2WM1A 2XTKA 3MANA 1UR0A 2WO5A 1JRCA 1HNYA 4RXFA 3OBAA 4H1ZA 3LPPA 5AC4A 1HN1A 2I1OA 2WHMA 1J01A 3IUHA 3GNXA 4JN8A 1DJWA 5G2WA 3ZJ8A 5ABTA 3L2IA 5RUBA 3WF0A 1E6QM 2O9RA 2FPTA 5IHSA 5D9OA 1T8XA 4AXNA 3IUDA 1UZDA 4DX3A 3P5ZA 3DIPA 3AJ7A 4YPJA 3KOZA 3R5EA 4BQ4A 5F2GA 3E02A 5I2UA 3OGRA 3NR0A 1OC6A 2C1HA 1RZMA 3W70A 1BYCA 4S23A 2ACRA 2PWHA 4PC8A 2JALA 2NUYA 2V38A 3C8NA 4O1BA 3VO0A 2UY3A 4IJCA 2PRHA 3WD4A 4S3FA 3VKJA 2J62A 2E8YA 4WGXA 4DUWA 1QOPA 1QW7A 4K68A 4WR3A 1UASA 1E71M 3VKCA 3H2NA 2YA2A 2QCDB 1EUAA 1OGGA 3TJ4A 5BZAA 3HTWA 4AQLA 3VZZA 4ZVJA 3E38A 3ZZ1A 3N19B 1UKTA 5A94A 3FDKA 1QJWA 5A6JA 2WC3A 1XPGA 3WQ5A 2ZRZA 3MUY1 1H41A 1WDDA 5MKGA 3W84A 2CKRA 4AF0A 3THQA 2TSYA 3W81A 1VKFA 1WQ5A 2A5HA 3GFYA 1GTHA 2EG7A 1EBGA 3DFQA 3TSDA 1WDPA 4E2DA 2JK2A 4UTTC 4DBWA 1Q6GA 1QBAA 5ABGA 3N25A 1IWBA 1B1YA 2O4MA 1F3TA 3IIXA 3VNJA 4GUHA 3UYIA 1GPFA 2ZICA 3FKRA 1A4MA 2DU2A 4L6HA 2C3ZA 1S2UA 4PB3A 3EKZA 3FFSA 1TVNA 2QCLA 3PWAA 1ZZMA 4F2TA 1EIBA 2ABAA 3MI3A 4ATWA 4CEUC 2NQZA 1OK6A 4GGHA 3LCFA 3BW2A 1HKVA 2OOFA 5H91A 2FGZA 2CLOA 2DH3A 1EOKA 4AEEA 2QLYA 1HKKA 1KC7A 3A3XA 4RDYA 5JU6A 3KZPA 5CZSA 4NVTA 2FJKA 2EG8A 5I23A 3N2XA 4C6QA 3WX7A 1DJHA 4W93A 4LJ3A 4DF2A 2Z4GA 3HPXA 1OD8A 1OYCA 2ZRVA 1QCWA 4KWWA 3AMGA 1QNRA 5A95A 2VXNA 4JY8A 1UH2A 4PYSA 3FCPA 2ZXAA 4JTQA 1JZ8A 4PUJA 4S3EA 3WQPA 3ABZA 3S9ZA 3B0YA 3N2TA 1PX8A 4XKYA 3B97A 4ZO8A 1IZJA 1X96A 1J12A 1XLFA 1XUUA 1XYZA 1VBRA 2CLHA 4DAIA 1TQXA 1X8FA 1TV4A 2RH9A 1KA9F 1B2YA 3TC3A 3CL8A 1ITCA 3W7PA 2OX4A 4HBKA 2OGJA 3E6EA 2HK0A 3UZYA 1H5YA 5C9ZA 3UZZA 1JUKA 1ZAHA 3FVDA 3PBVA 4PGLA 4W9TA 4YWSA 3GZ3A 4PUUA 4F9JA 2PPGA 4S1FA 3DKLA 1R7OA 4RXGA 1LWHA 5LA2A 1ZBCA 2EHHA 2J9YA 4GBUA 2VURA 3R25A 4RK8A 3SJNA 3W1NA 4DWSA 1UR8A 4CQ8A 3EB3A 3G1AA 3EB4A 1QASA 2CNCA 4UXDA 2GLKA 3DUGA 4D6GA 4C91A 3FGCB 3DYMA 4N6FA 4AWUA 6XIAA 3U8GA 4U31A 2DFAA 2BHZA 5H6HA 3LBOA 2QXWA 4I7WA 2ZZ1A 3IJDA 1ITXA 4ZO6A 1QMLA 3SFKA 1REQA 1VC4A 3ITVA 2C1IA 4AVNA 1HJXA 1H4PA 2PRLA 1PAMA 1SU5A 3W7RA 1FOBA 4HP5A 3EOOA 5LHFA 3K4WA 4IPIA 5E0CA 4F0MA 5FA5A 4BF5A 3H2AA 4TTGA 3BV4A 2PLCA 1UZ1A 1GVSA 3ZS4A 1GNXA 5C7VA 5FEWA 4KIEA 4E2VA 1MW2A 4Q4SA 4IIEA 1DPMA 4CN1A 4MYXA 4R85A 4RPPA 3N4EA 4MUPA 4IGMA 4ZQPA 3S0CA 1GZ1A 3INPA 2X2YA 1JL8A 1AMKA 4DHGA 3NSXA 3PWIA 3NQGA 5I79A 4KH2A 1KM1A 1QVBA 3VIHA 3E74A 3QHMA 2W62A 4W7UA 4GYPC 4JL2A 4IMCA 3GRIA 3A64A 5I3HA 4Q8UA 2Y70A 4QCEA 1DE6A 4W5UA 4NQ1A 3KRSA 5HR6A 5FJIA 3B40A 4W4QA 1J0IA 2E5DA 2XVPA 3LNPA 2YOCA 4HZMA 2W67A 1VFMA 3O6AA 4UQ9A 1UIPA 3CHFA 1Q7QA 2PF0A 3EA3A 1I45A 2NUWA 4MDOA 3MP3A 4WSKA 1TWWA 5EMJA 3W86A 4MY1A 1TPVA 2WZHA 4F2BA 2WKGA 5FACA 1U30A 3EWZA 3ZQ9A 3TW6A 2RGMA 2Q3OA 4QDPA 3APTA 5D8WA 2Q09A 4CN6A 4RDZA 4IPNB 3FXYA 3O0KA 4JS3A 4LBUA 4GQBA 1CGWA 1R3QA 4L4MA 3GK0A 2J77A 1LRNA 4WCJA 5BXPA 1P43A 2OFJA 4HOWA 5D32A 2XIOA 2QCHA 4PA8A 2OYKA 1C92A 3BTNA 1Y0EA 1HKJA 2GWNA 1E15A 1PHQA 1EGZA 4M80A 2BTMA 1S2TA 2WXDM 1JCMP 3EXSA 4Q8VA 5A69A 4NAFA 4L61A 4GIYA 1FCUA 4FX7A 5DXYA 3C8FA 3VGBA 2OSYA 4QJ3B 1SJDA 3M5ZA 4D8ZA 1LG2A 3V18A 2OKOA 4MF4A 2DZUA 5JBDA 5CSRA 2VGFA 2J24A 3C2YA 4R33A 1P4CA 3KCJA 1I75A 3O63A 3G1XA 2D23A 3REQB 1OX6A 2TODA 1W1PA 2DIEA 1AODA 3KL3A 3O2LA 4BQ5A 3V1HA 2FHBA 1KR0A 1P0NA 1EJXC 3CTTA 3BLEA 2OJPA 2WHLA 1TJPA 3HQPA 2B81A 1F05A 4P8VA 4C6KA 4UMAA 2QCEA 8TIMA 3DECA 3CEPA 2PP0A 1S3HA 3KCOA 2ZTKA 2IW0A 3VXGA 4JCMA 5AVHA 1FWJC 4NF7A 3W25A 3KBWA 3T40A 2LLEA 2QJHA 2ZVRA 3CBWA 3GG8A 5CPMA 4PH6A 3MMTA 2CXEA 3LX9A 3OW1A 4LW7A 4GI4A 3U5YA 2C18A 4WJEA 4GMEA 4JFWA 4Q4QA 1OCJA 4ZQOA 3NGFA 3WN6A 3CAWA 1BWLA 2ISDA 1RBOB 1TVLA 3CZ8A 1UP0A 5U4NA 2IQTA 4L6DA 1JPDX 4FZIA 2ISWA 1UP2A 3UJSA 2YL6A 1WNOA 3FJ4A 1E6NA 3HGRA 2JFEX 4UOQA 3WLQA 2QGYA 1QOQA 3CAVA 2YCLA 2Y8KA 1E4NA 3HPZA 3NG3A 2OWXA 3L4TA 5C7HA 5T9BG 4Q7BA 3LHUA 2A6LA 1W5QA 3U3HA 4E3TA 1W9PA 2GZXA 5HMSA 1L6WA 1A5BA 5KTLA 4DZAA 2X40A 1N8WA 5CZ0A 1UKPA 2E25A 2PDJA 3HOJA 1TWDA 5EMMA 3R8HA 3WQVA 4KPLA 2ISSA 1ZB5A 1JAKA 4WEVX 3WLIA 2QMKA 5HR7A 1SO5A 4DRSA 2PDHA 1TWSA 3URAA 2WYSA 4G7EB 5EFDA 5I5RA 1KLZA 4OBRA 1WDWA 2Y63A 3CV1A 2ZZ2A 2YBVA 3UWVA 2Z6JA 4U2ZA 3GBEA 1XIFA 4FO4A 2ZTJA 4D8AA 2BV9A 4A3YA 4S39A 2WMIA 1GCYA 4XK2A 3QY6A 2PC4A 1XISA 3K2GA 4NNBA 4AXKA 3T0DA 4KWSA 4LUIA 3SGUA 3CZKA 2QCDA 3WLJA 1E6ZA 3R8RA 4B15A 3W7OA 1OFDA 1MYRA 4ZOAA 2NWSA 3N15A 5FJUA 4S2CA 2OZ8A 3WELA 1R5YA 1D3CA 1QW9A 2IQ0A 1IEQA 4LT9A 3BC9A 4I9JA 5M17A 1W3LA 3TYZA 4G5DA 3WDQA 3VGFA 2RUSA 3H2CA 5AHIA 2OWWA 2FH6A 3VNLA 1FP8A 4P61A 4M56A 3MI2A 7PTDA 2OO0A 2DSVA 4JKKA 4O28A 4UC5A 4Y8FA 1KFKA 3IRDA 2PBGA 3WQDA 1M1BA 4EP8C 2WM0A 4P8XA 3F5JA 1J8VA 1CENA 2GFTA 3UVAA 2ZUTA 1BSLA 2Z1XA 3KBJA 3VU2A 1G01A 2WHKA 2FZBA 2A0NA 3GVGA 2QQ6A 3VGDA 3SRHA 3KOWA 4Q32A 3UY7A 1XCXA 3S9IA 3G0XA 4B16A 1XBXA 4QRNA 3R94A 1V3JA 1R87A 1RK5A 2NT1A 4LU0A 3ZR6A 4QEHA 1P0KA 2YKKA 5KZDA 3VIPA 2BNJA 2ZZ6A 3UJEA 4M29A 1SM9A 4INFA 1BGAA 3S9YA 1ZENA 4IQDA 3ARTA 4GNJA 2XFWA 1N82A 3USBA 5XINA 1J0YA 1UD6A 4YIWA 4N9CA 3LV6A 4V33A 4CQDA 3U57A 4FAMA 1CB2A 3HJEA 1BVNP 3RG6A 2PWEA 4UTTA 4Q6JA 4QP0A 2D2JA 3DG3A 3C0QA 1GPWA 1TTPA 1MQPA 1XYAA 1OIFA 1DYSA 1P0DA 3PANA 3M5XA 2NQ9A 2QVHA 3EXTA 3AZSA 2F84A 1Z41A 3W53A 3PJTA 1PZ1A 5G4HC 2I14A 3N1AA 3VNDA 5EMUA 4GFIA 1TR1A 2DZPA 2FJUB 5EBUA 3S47A 1PX3A 1T0OA 2PEVA 2DJXA 3UU0A 4FNRA 3SN1A 4F8XA 2F7FA 3ZJKA 4AD4A 2XSBA 1L8NA 3LS9A 4GO9A 3KOYA 1J0KA 3VINA 5MF5A 4ECLA 4KFOA 4A05A 1Q6EA 2G96A 4PTNA 2CERA 1TCMA 5K2ZA 4EXAA 4CVWA 4Z1AA 4S38A 2BVDA 1YMYA 1A5NC 4M51A 3QY8A 3TYDA 1E6SM 4WZHA 4CEXC 1KGUA 4BA0A 4WY0F 2I57A 3FGCA 1QNVA 2PDWA 5HA7A 4LVDA 2A6NA 4J27A 3CMGA 2OYMA 2W91A 3EDFA 4YNGA 3M5VA 2GQAA 2GPTA 4KCUA 4QR6A 3ZVIA 2IMRA 3ZLGA 4HNOA 4RW3A 2FFCA 2FH8A 1KFBA 2FGBA 3KDOA 4WQ6A 2Y7DA 5JIPA 2X42A 1Q4WA 1TG7A 4CNPA 1I9CB 4IMFA 3QMSA 4KEUA 1DWFM 2D24A 5LNRA 2NX9A 1E0WA 4GC4A 4H7ZA 3CB8A 6A3HA 2C91A 1LTDA 3QTPA 1G5AA 4ZQMA 3DFSA 2OB3A 3IIPA 1XG3A 1XSJA 1F07A 3WNKA 1Y7VA 5B7ZA 1FVPA 1YPXA 1UA3A 3IJ6A 5DFAA 3U0HA 2VDGA 4GJJA 5I3JA 3T0CA 4RNJA 3I7RA 3VOJA 3NL5A 1OFOA 3AC0A 3OZMA 1XRSA 3BWWA 1FWIC 3OU8A 2WSYA 3AXKA 2ZE3A 1YADA 2HTMA 4Q6XA 4W87A 1Y5VA 1H50A 3VDAA 4FS9A 3WBAA 3QZAA 4LYKA 2NQJA 3ITGA 3EX2A 4ZSTA 4TV6A 2WHJA 1FBAA 1JUEA 1UP3A 3S1WA 3QR1A 4WOQA 2WCSA 3T07A 3VUPA 1UR4A 1UA7A 3DFYA 3M0ZA 5DANA 1M65A 3N11A 3GVRA 2B4GA 3BLLA 1KXVA 3W1UA 1CXHA 4HNVA 4IISA 4EXBA 1ME8A 1VD6A 4BF7A 3W01A 1FHLA 3AXXA 3GC4A 4HU0A 4DI8A 1H1ZA 3ME3A 2GDUA 4X3ZA 1JDDA 2VTFA 1EJTC 1UWTA 1NP2A 4L4PA 1L6FA 4D6JA 4I5XA 1OFBA 3RLGA 4KBXA 3PBYA 2ON3A 4MWAB 3WH8A 1AD1A 1HL9A 4CU7A 3CTLA 3RRXA 3E9AA 1XLAA 1HJSA 4NI3A 4YL2A 3QMRA 1TE1A 2OOGA 4HMEA 4Q8OA 1FWWA 1YIXA 2J25A 4O52A 5CG7A 1FWSA 3QFWA 1QI4A 1Q2RA 2QDDA 3H2MA 4B9ZA 5A6TC 3WD2A 1RXOB 3W2MA 1CT5A 2CBVA 3VDBA 4JFUA 3W26A 2QGHA 4Y9NA 3GB6A 3IIZA 1NU5A 1F4AA 3MZ2A 4J3SA 3SJ3A 1PDYA 5CGTA 4DBDA 2ZADA 4S3BA 1JF5A 4QITA 1MXSA 3QKZA 1CCWB 3UWYA 4E4PA 1XYBA 2F6UA 4NKCA 3WDPP 2ZE0A 3WLOA 4B5TA 5DQPA 4UWMA 3FVMA 3OVPA 1MNSA 3BQ5A 2PB1A 1VFOA 1EXBA 3QR0A 4UR9A 1KQZA 4H9UA 5BNKA 3T9PA 2UV8G 1EZ2A 3CAKA 2R8WA 1D7FA 1HL2A 4E5TA 4O0ZA 1R2SA 3H70A 2J27A 4EWJA 4NL1A 4DEFA 3T78A 4NRSA 1EO7A 4G9PA 4C90A 2PP3A 1GYLA 3OJGA 5C54A 1ESWA 3BGJA 1AFSA 3QRHA 3RNDA 3WLKX 2NVCA 2YXGA 1XG4A 4QE5A 4GJIA 1WAUA 1FDYA 4HSNA 2AGTA 2PI6A 3QV9A 4MM1A 1B3YA 3DN5A 3VKBA 3WL1A 3HJZA 4AEOA 1CLXA 4JQ1A 2DPEA 2FZDA 3G0SA 1UD4A 3C61A 4A3UA 4X61A 3CEUA 3A4AA 2CLFA 1EO5A 4HNLA 4UFKA 1MUMA 3Q58A 5CBBA 3PJUA 5E6YA 3EX6A 2BY0A 4B5WA 3A12A 3NCOA 1VCVA 3PPCA 3RIKA 5KZ6A 1I4NA 4ENLA 1UPMB 1FHVA 1VEMA 4C6DA 4V2XA 4W85A 3TAOA 3GX9A 5D2TA 1QHZA 3CO4A 3NO5A 4D71A 4PTMA 4BJHA 1UD8A 3PULA 4N4QA 2QPXA 4R7JA 1XDJA 1EQPA 3NZGA 3VM7A 3NQ7A 2C8NA 2J9XA 3WUGA 3UVIA 4A2SA 3FYYA 2D2GA 4TXEA 5EA9A 2NV9A 3SB0A 1JYVA 2QZRA 5JH1A 4G56A 4G7EA 1TREA 3TU9A 3GNPA 5EB8A 4GQ0A 1JCTA 2ABBA 2AKMA 3URNA 4GRSA 4PTXA 4IG2A 4Q4MA 4MB5A 4R9XA 3KBMA 5AC8A 1F7BA 3BAXA 4QDWA 3OYZA 4RUBA 4Z1CA 3M0XA 4C5ZA 5HNTA 2H3BA 1WX0A 2GWGA 2GSEA 2YSWA 1IR1A 4UUIA 3C6CA 3RK8A 5DRIA 5EKYA 1DJXA 3ZFHA 1OFEA 3O3RA 1V0KA 3L21A 1VGAA 4AYGA 5CSUA 4DPQA 2J8FA 2I17A 2X1TA 3UBPC 1FHUA 2IXVA 3HBLA 4D6HA 3KCLA 1O5KA 1T6MA 1MDLA 3D0CA 4CGTA 4MTVA 1W3JA 3DHUA 3AFBA 1W1VA 1RP9A 1GVIA 1LUCB 1LOSA 1JPMA 1X6NA 1EZWA 3MTWA 4XZ9A 2E6DA 3MO4A 1KW1A 1XIBA 4IIHA 3TLLA 2YYTA 4J3WA 4KEVA 4RNIA 3UCDA 2BOEX 2X16A 3TN4A 3GXDA 3BG5A 1ZALA 2XDFA 3CLWA 1GHSA 3WLNA 3NQDA 3FAXA 1QPOA 4HMNA 3MKCA 4KT2A 1VYSX 4PZVA 3W3OA 3LI1A 1RQEA 3BGAA 2DVUA 4QX4A 4FIQA 4QJ5B 4LYQA 2CEQA 4O8AA 5HJYA 3GG1A 3GE7A 3AIWA 1VP5A 2ATMA 3QW3A 1LZOA 2ZWZA 4HZ8A 3I3DA 2VRKA 1R9YA 2XG9A 1FXPA 1OGBA 4PFHA 3NWRA 3BXWA 2R14A 3OIXA 1OT2A 2GOKA 1A5LC 4A4AA 2EGZA 4MG4A 2DW7A 3O15A 3M1ZA 1NH6A 2ZKMX 2NQLA 1S2WA 1XIHA 5BRQA 1VFFA 3O9NA 3OIHA 1BFNA 4WKHA 1TQJA 3IEBA 4H41A 2BY3A 1PIGA 4TX6A 2E68A 3M7WA 3EMQA 4PUKA 3TTQA 5TD4A 3GR8A 3SADA 4EOUA 2XZ7A 3LTPA 2OYLA 3ZOAA 4DBSA 2IS7A 4A3RA 3S4TA 3CM4A 3MHFA 2P0OA 3S3GA 2A7PA 1LJYA 2C7FA 1AJ2A 2VCCA 3LMYA 3V5CA 2P3EA 4ZB5A 3I7QA 4K39A 6TIMA 4NASA 4W8LA 1VEOA 1H7OA 5DBTA 1KWKA 2WCAA 4I7VA 1A5KC 3R58A 2NXIA 1IT8A 3KLKA 4JQ4A 2YLLA 3BOXA 4JBRA 4ASTA 3VDCA 1A0DA 3WIJA 1K9DA 2WC7A 4LNYA 1IEVA 3MS8A 1E51A 3FK4A 4H4IA 4F0SA 2J47A 3LEPA 1CLKA 1U2YA 1P48A 2VKZG 3DC8A 4K38A 2V5BA 3VE7A 3GH5A 3RUBL 2Y5EA 4ORIA 3CQIA 3PZ9A 1TB3A 3GNOA 1FWGC 1ECEA 4K1GA 1P1MA 3I3EA 5GNXA 3VGHA 2D69A 4DNMA 4TMBA 4QS6A 1GK8A 1R3TA 1UC4A 1PE1A 2X1SA 1QO2A 1CZ1A 2XJ7A 4OFCA 4HPGA 3U5UA 4FXSA 4EWND 3AIUA 4PBEA 5I06A 5FJTA 3RO6A 2B31A 5E0FA 3GXPA 1M7OA 3NQ2A 1VJSA 1IEIA 4IIDA 3PPGA 4HOXA 2QUNA 3BCDA 2ZX5A 1AK5A 3J7HA 2JBMA 1J5SA 4Z42C 4I90A 1P5BA 1C8QA 1FCQA 3RFAA 2BY1A 3WSUA 1IGSA 2YW4A 2WMKA 1KFEA 1OX4B 2FMNA 2O9PA 5DX7A 3PBMA 1PZ2A 1ICSA 3CV7A 1XW8A 3HB9A 3SN0A 5FAGA 3WBEA 1CXEA 1KRCC 4KWOA 3W1RA 1K4HA 1QU4A 4JTKA 3TYBA