1KXHA

Crystal structure of the complex between an inactive mutant of psychrophilic alpha-amylase (d174n) and acarbose
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
448
structure length
448
Chain Sequence
TPTTFVHLFEWNWQDVAQECEQYLGPKGYAAVQVSPPNEHITGSQWWTRYQPVSYELQSRGGNRAQFIDMVNRCSAAGVDIYVDTLINHMAAGSGTGTAGNSFGNKSFPIYSPQDFHESCTINNSDYGNDRYRVQNCELVGLADLDTASNYVQNTIAAYINDLQAIGVKGFRFNASKHVAASDIQSLMAKVNGSPVVFQEVIDQGGEAVGASEYLSTGLVTEFKYSTELGNTFRNGSLAWLSNFGEGWGFMPSSSAVVFVDNHDNQRGHGGAGNVITFEDGRLYDLANVFMLAYPYGYPKVMSSYDFHGDTDAGGPNVPVHNNGNLECFASNWKCEHRWSYIAGGVDFRNNTADNWAVTNWWDNTNNQISFGRGSSGHMAINKEDSTLTATVQTDMASGQYCNVLKGELSADAKSCSGEVITVNSDGTINLNIGAWDAMAIHKNAKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-amylase
publication title Crystallographic evidence of a transglycosylation reaction: ternary complexes of a psychrophilic alpha-amylase.
pubmed doi rcsb
source organism Pseudoalteromonas haloplanktis
molecule tags Hydrolase
total genus 159
structure length 448
sequence length 448
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1kxhA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kxhA01
3HG3A 3AYSA 5HBFA 3VNYA 1ODUA 1W1PA 4PYSA 3UG3A 4WSJA 3CIVA 4PSRA 3RMEA 2Z1SA 1E6XM 1B3VA 1MW2A 4FNTA 4U3CA 1FA2A 2QLYA 4FLOA 2VQUA 2WZEA 1XD1A 1V0KA 1BAGA 1EOMA 1GOIA 1ZBCA 4NF7A 2J7BA 3AIUA 4HA4A 2VL4A 3OLDA 4E4PA 4PUDA 3WD0A 2CNCA 1KGXA 3WY1A 1DHKA 3THCA 4MADA 3NSNA 1JNEA 4LYQA 1E0WA 4NX0A 3CHEA 2NT0A 4CKQA 5DO8A 2VRJA 1XV8A 2XN0A 4H04A 2WB5A 3B9DA 1AMYA 4OBSA 1WO2A 3VSVA 3WDHA 1MW1A 1TR1A 2YDSA 3QR3A 4TUFA 4JIEA 4P7NA 1HL8A 2W63A 3ZSSA 2D2OA 3EJSA 1XSKA 3FNDA 3PZ9A 2QMKA 3OGSA 5CGTA 2V38A 2ZX5A 2FDMA 4P7RA 3GXFA 1PZ2A 4AXNA 1UHVA 3WF2A 2D3LA 5A6BA 4FLQA 3KE0A 4HU0A 2E9BA 3HJEA 1BYCA 4QCEA 3VSTA 4K68A 4ACYA 1B3ZA 1PS3A 5BXRA 2VZOA 4PN2A 3WF1A 1E4IA 1MQPA 1ZU8A 1ZBKA 1QWNA 2BHUA 5DT7A 3U5UA 3LMYA 1BSIA 5A69A 1HNYA 4D6JA 1JZ3A 5HPOA 1KFWA 3SCWA 3N18A 3APGA 3WUBA 5JUVA 4W7UA 4AMXA 1DWIM 1HJQA 5A6BD 2JF6A 2GJXA 4ACZA 2YL6A 3DHUA 1DWGM 4EE9A 1KTCA 2BY2A 1E73M 2W67A 5EB8A 1B0IA 1UD2A 1ISXA 4L4OA 5I2UA 1KTBA 3II1A 5A8OA 1NWTA 4W93A 2X8RA 3BLPX 4HMDA 4AEFA 1H1NA 4JL2A 1TVNA 4HPGA 7A3HA 3W24A 3EYPA 3ARTA 5I24A 3GNOA 3FY1A 1E9LA 3MUAA 1VFUA 1LL6A 1JXKA 3TV8A 3BAKA 4HA3A 4E8DA 1WZAA 3VMPA 4ATWA 1QBAA 1ZJAA 2QMJA 2DSWA 2G3NA 1QBBA 1QI0A 1HXKA 5E0CA 3BAYA 5CPSA 1WB0A 3GBEA 4OIFA 1GZJA 4MB3A 1R75A 2VVNA 5CJ5A 1JAEA 1BHGA 4JFUA 4HPHA 3B9AA 1ISYA 2ZUVA 1JYNA 3VDAA 1BF2A 4NRSA 2CKSA 2FGZA 3H54A 3W29A 1JYVA 2F61A 1UKOA 3W37A 1H0GA 1SMAA 3PBGA 1UD5A 3SCOA 2Y5EA 3QOMA 2VR4A 1XSJA 1H3GA 1CXEA 3BUBA 3WF4A 4AW7A 3LXCA 3AI0A 2GVYA 2DPEA 2G8ZA 4AY1A 4UNIA 6A3HA 3T2PA 2D3NA 2WW5A 1GCYA 1ISZA 2WMHA 1TQSA 5EFDA 4AZBA 1HIZA 1KCKA 3EJTA 3MANA 3EJQA 1OINA 3GNRA 2XIBA 3CTTA 1KWGA 5FD0A 4NRRA 3AIQA 1JDDA 1FP8A 1R8LA 1WDRA 4W89A 3ARXA 3CBWA 1QNOA 3N04A 2OW6A 1HF6A 1W2VA 3WDPP 3VIFA 3WH6A 1OBAA 2CBIA 3A23A 1UR2A 3AJ7A 1VEPA 1BYAA 2WANA 4J28A 3ECQA 2HVMA 1PEZA 3ZQ9A 2BVYA 3EDKA 1VBRA 3K4DA 4D72A 2CETA 4M81A 2OYMA 1PBGA 1W3JA 1KR1A 1V3MA 4V2XA 1MWOA 1XD0A 1GVYA 1C8QA 4XZWA 4UZSA 1W3KA 3RPMA 4WIWA 1R85A 5BRPA 1DP0A 3WFZA 2JALA 2J7EA 4LGXA 3TTSA 2WLZA 3ZJKA 2BY3A 3CZ8A 3U7VA 1OT1A 3AIBA 3IJ9A 2DH3A 4B9ZA 1UWIA 4QP0A 5JBFA 2ZIDA 3A47A 3KEHA 2XVGA 3EJPA 2VCBA 3ALFA 4QDMA 3CZEA 1OD8A 3AMCA 3FXYA 2D73A 3EDJA 2YA0A 2OSYA 1EDGA 4MB5A 4HOXA 4HZ8A 1M03A 1KGWA 5ABFB 1DWFM 2ZUWA 5F7UA 4BCEA 4JFTA 4AYGA 2ZUUA 1E55A 4D1JA 3VMNA 3SUVA 3AROA 3IAQA 3CV5A 3F5JA 4CUCA 1XGZA 3VX0A 3DDGA 2VI0A 4AYSA 3GZAA 3AS3A 5M3WA 2CIPA 4DO4A 5LA1A 2O9PA 2ZWZA 2BS9A 3W0KA 3RJXA 1UR8A 1TQVA 5ECUA 2J25A 3MUY1 3SCPA 1B30A 1E56A 4DUWA 2VQTA 4AEEA 3HMCA 4D6EA 1B31A 4P7QA 1IZKA 3HZ3A 1ZJBA 4CD6A 3ARYA 4W5UA 3SUWA 4F66A 5CG0A 4H8HA 1PZ3A 1AQMA 2XVPA 4H7VA 1OGBA 3K8MA 4AD0A 2UWFA 1R7OA 4TX6A 3ZT6A 2FGLA 1HJWA 5A6SA 1QNPA 4MDOA 3WY4A 5CLTA 3ZJ7A 5IFPA 1BYBA 1GW1A 1JZ6A 4GXPA 2BXYA 3T0DA 3EMZA 2AMGA 1GQJA 3E1F1 2WMKA 3IJ8A 4LQ1A 2WCSA 2W62A 2DQXA 4BF7A 4AMCA 3EJUA 4D6IA 5E9AA 4QLKA 3K1DA 1WE5A 4ZXOA 1NM9A 1A3HA 4W84A 3WDJA 1LWHA 1TA3A 2DSZA 1O7AA 5IFTA 3BUDA 1E4MM 3O9NA 2JEPA 1I1WA 3UR8A 3EDDA 1HVXA 1NWRA 3N9KA 3CHFA 1R7AA 3PTKA 2BY1A 3J7HA 1C8XA 2YBUA 1JD7A 4U5IA 4HMCA 4AZCB 2WC3A 3BLBA 3CPUA 1HJSA 5LA0A 1XH1A 4AD1A 4GPNA 4UQ9A 1UA3A 4CN1A 2EO7A 3GTNA 2Y8KA 2GK1B 3UESA 4PMOA 3GXTA 1NP2A 2XN2A 3ZR5A 1JDCA 5FCZA 4ZENA 1Q6EA 1FOBA 4KRUA 2ZX9A 1J0YA 3MMUA 1HTYA 2FHCA 3GYCA 1UASA 3EDEA 2WKGA 2G3JA 3WUEA 1UWTA 4F9DA 4UQBA 1RPKA 2OYKA 1LJYA 3WQ4A 1NARA 4DO5A 4E2OA 2WZIA 1MFUA 2PB1A 4U2YA 1V03A 3VIIA 3WIJA 3S5YA 3IJ7A 1JD9A 2WAGA 2DT1A 3L4VA 5CSUA 3BCDA 3O2LA 5IHSA 3RM4A 3CLWA 4NZCA 1HJXA 3GXNA 1E1EA 1V6WA 5GPRA 4HZ6A 3LPOA 3AMLA 1HJVA 2WWCA 5AC5A 1MXDA 2VCCA 3WNMA 2CHOA 1US2A 5I78A 2YKKA 1E15A 2ZXDA 4U3AA 5A94A 1W9VA 2WHKA 3VD7A 2FHBA 1UOKA 2X2IA 1SZNA 3SCRA 2QPSA 1U30A 2YFNA 1M53A 2EPLX 8A3HA 1QW9A 4LYPA 1JZ5A 1NOFA 1KBBA 1J0HA 4M80A 4PTMA 4TVDA 3VIMA 4JKLA 2A3CA 3W25A 4H2CA 2QV4A 1KWKA 2XSBA 3WD1A 1CGUA 3DYOA 4CCDA 3OA5A 2G3MA 1WZKA 4GZIA 4AZIA 1EH9A 1JXJA 2ZX7A 7TAAA 1WZMA 1FH9A 2VX5A 3L2LA 2E8YA 4P8UA 1ESWA 1PIFA 3UG5A 1E4LA 3A21A 4FNRA 4PMDA 3VIKA 2F7PA 5A8QA 4GINA 2OYLA 3BGAA 2GFTA 1JF5A 2YDRA 4R5EA 3ZSTA 1B3XA 3CUIA 1PJ9A 4WKFA 3WEMA 1JIBA 1ECEA 4CCEA 4UOQA 1BYDA 5HNNA 5LYRA 1RH9A 4URIA 3AIWA 1E40A 1UKPA 1CDGA 4AZGA 2FH6A 2X2HA 1GQKA 4D6CA 1CENA 4XZBA 3AOFA 1V0MA 3AS1A 1FFQA 1LG2A 4J3XA 3AYRA 4YPJA 2GJPA 1B3YA 1FFRA 4GI9A 3BCFA 5AYBA 2QF8A 3MS8A 2W92A 3VIOA 7CGTA 1KXQA 2YIHA 2ZUSA 4UQEA 2WCAA 2XFRA 4JCLA 1DWJM 2WMJA 3ARVA 2Y4SA 1J9YA 3OIHA 3BAJA 2J79A 3A3HA 3GH7A 2J8FA 2PWGA 4HA1A 3L4TA 3F5LA 3WDRA 2DH2A 4A3YA 4JL1A 3BVUA 3SEPA 4Z2JA 3WN6A 1GPFA 4D6HA 4JHZA 2D22A 2CKRA 2D23A 1CXIA 2WMFA 4HOWA 4NI3A 1E5JA 1K9TA 4LX4A 3DX3A 3POHA 3EMQA 4GI6A 4B3LA 2EABA 4CN4A 4IPNB 1CYGA 2OSWA 1QNRA 1XYZA 2ZXBA 3AFBA 3FAWA 2XFYA 1GVIA 5FL1A 1M04A 1AVAA 3WENA 1TQUA 1QI4A 1VAHA 4XB3A 5ABEA 2F8QA 3F5KA 4IISA 4V27A 5DEZA 2VTFA 3D5HA 2DEPA 2E0PA 5I0DA 1B3WA 4TOQA 4XX6A 5JBEA 1Z32X 2ZE0A 5CQ1A 2XGIA 1W3LA 3W26A 5I23A 3BUPA 3K4AA 1C7TA 3AXXA 1VFMA 3L4ZA 3L4WA 1V6YA 2RGMA 1VEOA 2UY3A 3NIYA 1JI1A 4D6FA 4UFLA 1Q6CA 2XUCA 1DWHM 4UZUA 4AZ6A 1UD4A 4GKLA 1W1VA 1JNDA 1L0PA 1MXGA 1HKKA 2EAEA 3UETA 2J7FA 2ESCA 4IM4A 1JAKA 1CGWA 3KWXA 2D0HA 2WHJA 1SYTA 2ZX6A 4ZE5A 2WVUA 3KL0A 2BNJA 3WL1A 4EKJA 1YHTA 1UD6A 2V5CA 1M7XA 2OW7A 4JKKA 3MMDA 1H11A 3AMGA 4JKMA 4WSKA 4ZXLA 2J75A 5E09A 3DC0A 2WVTA 2WVVB 1HKJA 4HP5A 1C7SA 2MANA 4M1RA 5D9OA 1UR0A 5JBDA 2EACA 4AIEA 2J7CA 3UG4A 2ZXQA 3VDHA 1V3JA 2VCAA 1X6LA 4FNUA 2YFOA 3KZSA 2XHYA 4LPCA 4J3SA 1GQIA 5A6KA 6CGTA 3ZT7A 2XWEA 3LXAA 1OT2A 1R34A 4D6DA 4DWSC 5BRQA 3NJ3A 3N11A 4CD7A 3A4WA 4J3VA 3IAPA 4Z2GA 1FH7A 2OSXA 4ML4A 3ZOAA 1VENA 4AC1X 3BVXA 3RDKA 2OWCA 1YQ2A 1Q6GA 4BZYA 4IPLA 2VZTA 2X0YA 4MNMA 1SMDA 1R87A 4GIAA 1GOWA 1OGGA 4P8XA 5A8NA 1JFHA 4PMVA 3CZNA 1J11A 1H4PA 2BHYA 4QCFA 4W7WA 4W5ZA 2VUYA 3VNZA 4Z2HA 1UWRA 3OGRA 1XCWA 4QFUA 2D20A 4PEEA 4MDPA 4PTVA 1CNVA 1X1NA 2D24A 2DSVA 5CXPA 2WPGA 1J12A 5IDIA 3VD3A 3BVVA 5HDRA 1B9ZA 4MTVA 1UR1A 5EBAA 3SCNA 4MAZA 4KH2A 1OB0A 3WD3A 1MYRA 2A3BA 3TTOA 1QI3A 2F1AA 1CLVA 2X2JA 3BSGA 4WK9A 1XSIA 3WEZA 1E4NA 3CGTA 1PPIA 3UEQA 4EK7A 2J7GA 1ODZA 4KRTA 1E6PA 1RP8A 4PMQA 1JI2A 3PZIA 3IANA 2PWEA 4ATDA 3VGHA 5I5RA 4XUYA 3GXIA 3GBDA 3PZGA 1US3A 3AHVA 3JUGA 2GUYA 5E1QA 4PRWA 5ABFA 3N17A 2DSUA 1CGTA 1BFNA 1WDQA 5HOSA 1JFXA 1HP5A 4LYRA 4AWEA 4H41A 3T0AA 5E0FA 1R46A 4GO8A 1BVNP 3WH5A 1JF6A 1UD3A 3HU7A 5KZ6A 3SCUA 1VF8A 2F1BA 1HKIA 2DSKA 2YA2A 3PZVA 2W5FA 3WNOA 2YJQA 3DDFA 2O9TA 3OG2A 4DM1A 4MNLA 4X0NA 3PZOA 3ALGA 1UH4A 4FK9A 1EQCA 5A6AA 1E6NA 3CO4A 1NQ6A 3ARQA 1E0VA 2D0GA 3GH4A 1FP9A 1UG6A 3OLEA 1I75A 5FIPA 1BPLB 5BYWA 1GNXA 1QOXA 4TTGA 1NOUA 3NCOA 4MNKA 4CD5A 4CGTA 3AISA 1UWSA 4YHEA 4MNJA 5FL0A 4UQDA 3CUJA 2XGBA 1UR4A 1E70M 3UCQA 5GNYA 2BVTA 3I3DA 1VB9A 1TVPA 1PX3A 4UOZA 1VEMA 4UFJA 4AZ7A 3TONA 3NYDA 3PZUA 1WDSA 1HVQA 1WCGA 1QX1A 2PWFA 4DWSB 1UWUA 5ABHA 1E1FA 1TUXA 3QOKA 4AD5A 3WMSA 4PMYA 1A47A 4BA0A 1JGIA 1ZBWA 4WJXA 3RM8A 2J47A 3DHPA 2V3GA 3LRKA 2YLAA 1WKYA 4TTUA 4JFVA 4F9JA 5A2AA 3NSXA 1RD6A 1BLIA 1E0XA 2XN1A 5A8PA 2WVSA 3A22A 3CZSA 3SIMA 2WXDM 4X9YA 3VM7A 3D4YA 2PBGA 2VX4A 4AZCA 1HT6A 1ISVA 2W91A 2WWDA 4NSBA 1V6XA 5D9NA 1QW8A 1U2YA 4TVCA 3VD9A 3EDFA 2GK1A 3N15A 1DEDA 2WCGA 5E6ZA 1KR0A 3CZJA 2UY2A 5DFAA 2E9MA 4UFMA 3CZLA 1C8YA 4W8LA 4CU6A 1JG9A 3AZSA 3WMCA 2VRKA 1HP4A 1B1YA 3LRMA 2DIJA 1NOWA 1BGGA 1V0LA 3U7BA 5M03A 2XVLA 4BQ3A 3BMVA 4PMRA 4PMUA 4PSPA 2EBNA 4J3UA 1EOKA 5C71A 1BVZA 3AHTA 4PMNA 1ZBVA 5AY7A 3NDZA 3WEOA 2IGTA 1Q6FA 2F7RA 1VRXA 3W27A 2JIWA 1JYWA 4JFWA 3AIRA 2VZVA 2J8GA 4KMQA 2VR5A 4DM2A 4HTYA 4UFIA 3HG2A 5GNZA 1JYXA 2F7OA 3HG5A 1V3HA 4OJYA 1LL7A 3VIPA 1EHAA 5E70A 4JFSA 3CZKA 2G4FA 4QLJA 1W1TA 4U2ZA 3WDIA 3ARPA 1WDPA 2WBKA 1V02E 2BHZA 2G3IA 1TQTA 4OOUA 1HJUA 3H53A 4RE3A 1HN1A 4DUVA 4PMZA 2VRQA 3L4XA 1OGSA 2CITA 1C90A 1EDQA 5A2BA 2PBOA 5CZKA 5I79A 3PZQA 4EAMA 1G94A 4UFHA 3ARZA 1PX8A 1C91A 3DX0A 2W61A 1LL4A 3T08A 1EIBA 4PTWA 2WNWA 4UQCA 1UQZA 2XTKA 3VKKA 5DF0A 2XPKA 3PN8A 1W3HA 5I6SA 1TZ7A 4J3WA 3MKKA 1I1XA 3VTRA 3WQ8A 1CLXA 1H49A 3VSUA 3WNKA 1C3FA 4MJ2A 4D6GA 3OGVA 1JZ2A 3PTMA 3EJRA 2WYSA 3OZOA 3GXDA 3HG4A 3S2CA 3L2MA 3N13A 2JE8A 3KLKA 4TVUA 4DUXA 3WFLA 1BGAA 1CTNA 1GJUA 2JIEA 4UOJA 1HKMA 4H8UA 3MI6A 1H5VA 1VJZA 3KLLA 3DX4A 2Q8XA 4U5KA 1P6WA 3I3BA 1RP9A 2EEXA 1JDAA 4LXFA 3H55A 3ARUA 2E9LA 4W8BA 2XM1A 4QAWA 3RO8A 4JZ5A 4A3HA 4MAVA 4UTFA 4TXEA 1OWQA 3VGEA 4W85A 1UYQA 2X09A 2PWDA 1LLOA 5D8WA 2CCRA 1KXHA 3A24A 1R47A 5HPCA 1G1YA 4J3TA 1E5NA 4MJ4A 1G0CA 4OBRA 1VJSA 1J01A 1GJWA 2ZUMA 4W86A 3T2OA 3DECA 3PZMA 3MUIA 4AISA 4Z2IA 3W82A 2IXVA 9CGTA 3WNPA 1GHSA 3AHXA 3D50A 1EHNA 4W88A 1ZS2A 2WMGA 3KL5A 3DX2A 1F4AA 1G5AA 3W28A 1OCQA 2ZUNA 3VMOA 1G9HA 3WF3A 3WQ5A 3K46A 2E4TA 2YLLA 4NXKA 2WMIB 2G41A 4A4AA 2XVKA 2C0HA 3VU2A 2W66A 4UFKA 1QHOA 2PI6A 4V28A 1UH2A 4WKAA 4HMEA 1FHLA 1BTCA 3AZRA 2AAAA 4E8CA 5JIWA 1BG4A 5A2CA 4JHOA 4WLCA 5A6MA 6TAAA 2VZUA 3VOCA 3NDYA 1G01A 4Z2LA 4GI8A 4CCCA 4M8UA 4BQ5A 4P7LA 2HISA 3L4YA 2PC8A 1F4HA 2CHNA 3S6TA 4Q7NA 1LWJA 2NT1A 2GDVA 2WK2A 5GNXA 1XCXA 3VX1A 3BUQA 2CESA 3T2QA 4FNPA 3EBVA 1BG9A 3ZMRA 3WNNA 2ZWYA 1TE1A 1X6NA 2Y8VA 1ITXA 1UKTA 3AIEA 2QHAA 3HN3A 3VD4A 1TG7A 3FHAA 3W4RA 1WPCA 4CN6A 8CGTA 3UR7A 2A3EA 2YL8A 1UZ1A 3BAIA 5BROA 3D3AA 2CXGA 2DDXA 3TOPA 4AD2A 1BQCA 1CWYA 3CH9A 4AIOA 2F2HA 4W7VA 3OLIA 4GZEA 3QGVA 5AYIA 4M56A 1ITCA 3AICA 5BWFA 1TFVA 3VIGA 5ABGA 3WH9A 2BVDA 3SCTA 2J74A 5A1AA 2NW0A 4PUEA 1O7DC 3WNLA 3VGDA 5D9MA 1E72M 2WVVA 1UQYA 1GOQA 5CPTA 1IT0A 4EANA 2CBVA 4AZHA 1ZB5A 1KBKA 2ZXAA 2CYGA 3BLKA 3WL0A 2OWXA 4F79A 3SCVA 2F18A 1EO7A 3GXPA 1EA9C 3VO0A 3AMDA 3GNPA 3RCNA 4C7GA 5I77A 1UR9A 1J10A 2VX7A 1JZ8A 4HU8A 4ZE4A 3A4AA 1LQ0A 1V08A 1UWQA 2PF0A 3OZPA 2VX6A 2XG9A 2BFGA 2E8ZA 1GOMA 4XV0A 4NZFA 5EFFA 3A6OA 1U33A 1HL9A 3ZM8A 5I3DA 5CLWA 3WKZA 1EDTA 2VVSA 3DYPA 3B9EA 3BVTA 4AD4A 4H8VA 1QPKA 3WQ6A 3BMWA 3AXHA 4Z2KA 3CUGA 3NUKA 1GONA 5BCAA 3BUIA 4MPKA 2XYLA 3ARWA 3VINA 2F7QA 2FH8A 5A3HA 4PTXA 3MSDA 1WZLA 4N42A 1QNQA 1AQHA 4YHGA 4MB4A 1V3IA 1PIGA 1TCMA 4D1IA 1TQWA 4P7OA 3VIJA 3BC9A 1GQLA 5CSYA 5HXMA 1K9DA 1VBUA 1MW3A 1S46A 1V6VA 4GQRA 2XFFA 1KXVA 5C8BB 4J27A 1QWUA 4OOZA 2GJXB 1CZ1A 4ACZB 1KQYA 3M46A 3ZJ6A 3AS2A 5A6LA 4M24A 2GDUA 4PMXA 3CZGA 1E6RA 4U33A 3WDQA 2EXOA 2B31A 1KXTA 5D4YA 3MMWA 2IXUA 3AIVA 1OIMA 4RE4A 2V3EA 2DT0A 2VO5A 2OLHA 2VNCA 3B8SA 3SUSA 4BQ2A 1KGUA 5D9PA 1CGVA 4YN5A 1JZ7A 1QI5A 1JL8A 3M6DA 4D71A 3IK2A 2V5DA 3VILA 5A6JA 1DWAM 3D52A 3AZTA 3ARSA 4Q22A 4C7FA 4UQAA 4PBGA 3WBAA 2O9RA 3ZR6A 1DTUA 3MV11 2CBUA 3SCQA 2YOCA 2J4GA 1H41A 2WLYA 1GHRA 3WD2A 3G6LA 1T0OA 3VM5A 1JZ4A 2WBGA 3WF0A 5DMYA 1GOKA 4RL3A 1GUVA 5AC4A 2BY0A 3WSUA 4PCTA 2D0FA 1Y7VA 3I3EA 3VPLA 2J62A 1K9FA 2E40A 5A95A 1W9DM 2J7HA 1CXKA 5BXPA 1E3ZA 1OIFA 5EMYA 2YDQA 2YL9A 1XH2A 2WSPA 1GOOA 3FN9A 4OKDA 1E6SM 4N0RA 1MVYA 3ZO9A 1K6AA 3ZIZA 2ALWA 3VIHA 4X0VA 4OUEA 1IZJA 2UY4A 2BV9A 3THDA 4DWSA 4FNSA 2EPNA 3CHDA 1OM0A 1W32A 1XC6A 2A3HA 1VFOA 4RE2A 5CGMA 1C93A 1IV8A 4FF5A 2WZHA 1W9BM 5M17A 3D51A 2VC9A 3WBEA 1EXPA 4WF7A 3LRLA 2YA1A 2J78A 1CECA 2VZSA 2ZOXA 1ZL1A 1V6UA 1QI2A 2EPOA 3MUZ1 1M01A 4BQ4A 3WUGA 2WKLA 5BXSA 1HWWA 4DWSD 4CU7A 5A8MA 2D1ZA 2PWHA 1OSEA 1CIUA 3RJYA 2Z1KA 1EQPA 3PTQA 3LPPA 3VGFA 5GQBA 1NH6A 3RM9A 3AXIA 1L8NA 1MQRA 3KL3A 3WD4A 2NSXA 3AHZA 2DT3A 3W53A 2X2YA 1N82A 1W91A 1MFVA 2WHLA 3AHYA 1E43A 4JCMA 3BAWA 3BH4A 3LPGA 1CGXA 1SFSA 3OB8A 2E3ZA 3TP4A 2EPMX 4CD8A 5IHRA 3CUFA 2JEQA 3W81A 1J0JA 5DT5A 2Y2WA 2J7DA 1CGYA 2ZICA 1W1YA 1W9UA 3N1AA 2V3FA 4GZJA 3LXBA 4CD4A 4BS0A 4TX8A 2RGLA 1CEOA 4M29A 3WH7A 1GORA 2TAAA 2EJ1A 2XSAA 2XVNA 2FE0A 3MV01 3QHMA 3VGBA 3GH5A 1E3XA 4KGJA 4ZEPA 1J0KA 3CUHA 1PAMA 4B9YA 1AQ0A 4S3JA 2VOTA 2VJXA 4P8WA 3OBAA 3ZJ8A 3QHNA 3WELA 4Y7EA 1UKSA 2UY5A 1XYFA 3AS0A 1LG1A 2IUZA 2XIIA 5C70A 5FOOA 4KGLA 1MW0A 1QVBA 2CBJA 2DT2A 1CXFA 1D7FA 3L4UA 4CVWA 3A5VA 1OD0A 1KQZA 3WUFA 3CC1A 3D4ZA 4HZ7A 2YL5A 2V3DA 1QHZA 1VIWA 2W4XA 2EADA 3EMCA 4ZFMA 2EQDA 5TD4A 1ISWA 4OGZA 3SUTA 3FW6A 3CMGA 1W2PA 2J77A 2XJ7A 3W6LA 1UKQA 3T09A 5M5DA 3W6MA 2WC4A 2X0HA 3ARRA 1R86A 3AQUA 4U31A 4CVUA 3DYMA 5JIPA 1O6IA 3RILA 4J7RA 3GM8A 2C8NA 1KB3A 3K8LA 4QLLA 4HOZA 2WM0A 3BAXA 4DO6A 1H2JA 5CPQA 4AZ5A 3TA9A 1E6QM 4FNQA 1EO5A 3U5YA 1E6ZA 2DIEA 2CPUA 4AIUA 3LPFA 4B16A 2WC7A 3CMJA 3WMBA 2A3AA 2QPUA 3VD5A 1LF1A 1XHGA 1QHPA 3F4VA 2XM2A 2WHMA 3M07A 2FHFA 2CEQA 4B15A 1KCLA 4KWUA 1UD8A 4C7DA 1PX4A 1TA3B 3U57A 3VVGA 1UZ4A 2ZUTA 3GDBA 3IGUA 3WH8A 3ZT5A 3BVWA 1TMQA 2O9OA 5FKYA 2O92A 4JAWA 1FH8A 1J0ZA 1XRVA 3TTQA 2VT0A 3O6AA 2XWDA 1K9EA 1E71M 1EGZA 4W87A 3SUUA 2ZX8A 1XH0A 4W8AA 3VUPA 4R27A 5LA2A 1WP6A 2CERA 1D3CA 2WSKA 1HX0A 2AOSA 2GSJA 1V0NA 4M82A 2VURA 4GQQA 4B3KA 1CXLA 3CHCA 3PZNA 3FHQA 3DX1A 3SCSA 1WAWA 3BXWA 1J18A 3VDCA 2X05A 3WY3A 4MB1A 2BXZA 3T0BA 3VDBA 2Y24A 2GJRA 3GXMA 1V02A 3S5ZA 1NWSA 1H09A 2VMFA 2YBTA 4FLRA 3G6MA 4CU8A 4NXSA 1UUQA 3RIKA 4P8VA 1H0IA 1W9XA 2WMIA 4F8XA 2JF7A 4PCSA 3UERA 3WY2A 3SURA 3OLGA 3MO4A 1NWUA 1V3LA 4IUGA 1FHDA 1VFFA 3N12A 3VGGA 3WQWA 1C92A 3LX9A 1Q6DA 1SR0A 3A4XA 4FLSA 3QHOA 1CXHA 4WKHA 3W38A 2X1IA 1V3KA 5IXEA 5BXTA 4L4PA 3BSHA 4NZJA 1D2KA 4AD3A 3TTYA 3PZTA 3POCA 4UCFA 2DGAA 3M7SA 1UH3A 1CBGA 3K8KA 4GO9A 3MSGA 3FAXA 1MQQA 2OWWA 1B90A 5KEZA 3NSMA 5D8ZA 4S3KA 2EPKX 1R33A 1WNOA 4ATLA 1W9PA 3MU7A 5E6YA 1NP0A 4OZOA 4FMVA 4AMWA 4UR9A 2FYVA 1HXJA 3AMKA 1B2YA 3PHAA 1QNSA 1J0IA 1UA7A 1CPUA 3WQVA 2JFEX 1Q4NX 2C7FA
chains in the Genus database with same CATH superfamily
1M7DA 2YJLA 1TJHH 4N4PA 5HBFA 3FUJA 3C8KB 1L6ZA 1MH5B 4WI0A 1O66A 5I19L 1B3VA 3BWAA 1CIDA 4AYEC 1YMYA 2CIIB 1F3JA 3K2KA 2J7BA 1C5DA 2Q6WB 3HR5A 2CE6A 2XN9A 5FJPA 3WD0A 5K39A 4JPKL 5DVPA 1KFCA 4WJ5A 4MADA 3EHBD 4G8IB 3H4WA 3SDAB 3VOJA 4X6BA 5FJUA 1SYSA 2FX7L 3GR7A 3ZQXA 5E4OA 4QOKE 1VBGA 2F7IA 4HN4A 4TUFA 4JIEA 2YB4A 5EMJA 1T40A 2I16A 4XH2A 5FF0A 4K9EH 4XO8A 2XQYA 4GQ0A 1UHVA 4B41A 1F3EA 4NRYA 2E7CA 5AAWA 2LVCA 1A4JA 5D7LB 2VZOA 2CKBA 3UTTE 4YNYB 1IO4C 4DPQA 3U5UA 4B92A 2XTJD 5I06A 5JUVA 4B50A 4K0OA 2VDHA 5I8CA 1LYXA 1P5UB 1JPIA 3GVRA 3MPCA 1E4HA 1ES0A 2NW2B 2HT4C 4LSPL 3FZUD 1HC1A 5I30H 4XNQB 2Y25A 5LIUX 1EL3A 4HUCA 4UMAA 1D2PA 3CSYB 3MMEB 3DG7A 5ACMA 2HRHA 4MDRA 1AO7E 2P5ED 5A6TC 3VMPA 5HJYA 4U1NA 1NCWL 1LXMA 4H20L 3FGCB 1CVSC 2ISWA 2BASA 5KYWB 4JFUA 1E67A 2J1ZA 4O57A 1WAEA 1UKOA 1NTHA 3VA2C 2VISA 4EZMA 2GVYA 2B0SL 4PJ7E 4LLMB 2JB6A 2PDGA 3T2PA 3X1FA 1IKFL 2OTPA 2GW5A 2YQ3A 4M48L 3MJ9L 1VBHA 3GDTA 3UJTH 5E7FA 3RKDD 3MLRL 5JW4N 4E3VA 5I75B 1N7MH 4HCHA 3D46A 4AGQA 1YSOA 1WTGT 4KK6D 2WANA 4Z23A 4KWVA 2QUUA 1W3JA 3LZPA 3QEQE 1MWOA 5D1ZC 4LFHD 1R85A 2B20A 4LGXA 2DUAA 2WLZA 4M6QA 3A12A 5KVEL 2NY6D 3WXWL 4U4IA 4XMVA 43CAA 4P9HH 2NY1D 4MCYA 4AQEB 4ONGH 5CCHE 3CFJB 4TPRH 1AYRA 2MNUA 3NPWA 3M4HA 1XG4A 3HB3C 2P47B 3ILQC 3GK0A 3KPOB 1Y0LB 2Q8LA 5J8LA 4NZ1A 5AHLA 5IFHL 3HV9A 2AK1H 2R2BA 2WLMA 4PWKA 1TPXC 1PDKB 2LLLA 1A5BA 2Q8BL 1BWLA 3KR3H 1TQVA 4AV5A 1H1YA 3L17A 5FW8A 9RUBA 2VQTA 3ANVA 4FFVC 4D6EA 3HCVB 3O2DA 3HZ3A 4I1RA 1HFBA 2A74B 2DU2A 3UYRL 2XTSA 1FYTA 4NZRH 3WHE0 3NFNA 3VWJD 5I74B 5IVOA 1V5JA 5A6SA 5IFPA 1TV2A 2AMGA 1HZHL 1X39A 1U8PB 1BFOA 3S3PA 1XFPA 3K1DA 2ZZ1A 3NURA 2UY7B 2JEPA 4PJXF 3ABSA 4XN2A 2YARA 1M7JA 4XPAL 5JO5A 5TDNA 1JFQL 4HCDA 4HMCA 3HUJB 5LA0A 4YHZL 1Y18B 3LV3B 3QCTH 4OIAA 4PRRA 2YPVA 2NY2C 4GUQA 4PGDA 1AKJB 2XN2A 4EDWL 1OAQL 5BRZE 3ZLQC 2W0KA 4KY1L 3UJRA 3TZVC 1I1RA 1W8OA 1OQFA 2P8MB 4NJIA 3QUZD 3MP5A 1GTEA 1UT1A 4RRPA 5B7YA 5SWSB 2CXEA 4EN3A 1MOEA 3OKLB 1TV3A 2QPFA 1T6MA 4EI5B 3GSWA 3MACH 3S5YA 1KM5A 1C1EH 3V95A 1L2QA 3RJDA 3D7PA 4E9LA 2HRGA 3W7OA 1A7QH 2AJXH 3EGSB 3VFPB 4XNDA 2EYSB 5AC5A 5D96B 2BH0A 5CO1A 3K2GA 2YKKA 1E15A 4CNUA 4EP8C 3PF3A 4HWUA 4WXYA 1RZGA 4RMTA 4AC7C 2BVUA 1PZSA 2KHAA 5EO9A 1OAZH 4M80A 4PUMA 4AZUA 1FWIC 2XSBA 4GQ9H 1XGPA 2DEWX 3ABQA 2EECA 3THQA 5IVNA 4UAOC 2BOBA 4ZUUB 2PE4A 4R5EA 3KM2A 4NJAL 1BX2A 3V4PL 3PPFA 3AIWA 1OYAA 4FG2A 4HHAB 3ZTNH 4DCQA 4AZGA 4L8BA 3WFDH 3GMQA 3WLTA 1Q2RA 3KTCA 4Y5XB 1P84J 2D7OA 4NYYA 4AVNA 3LH8A 4UWMA 3F00A 3R79A 4Z1AA 2XWJB 1L2UA 4MVBC 2CHDA 1R9FA 3A3HA 2ZVRA 4HA1A 3F5LA 2ZZ3A 4MLJA 5C08D 4S11A 1BVLB 4E9TA 4M6NL 4KRNA 5GSVA 2GGGA 3MUUA 3W88A 3W2DH 1K9TA 4HOWA 2ZPKH 4KTEL 1J8HB 3CVIL 1IKNA 1GZ1A 1FZOB 2R2CA 7FABH 1SUHA 3O9WA 1YHPA 3AREB 5IDZA 3GGWA 2IH3A 2F8QA 5SWZB 2RDXA 1B3WA 4XX6A 4RNJA 3SDDB 2PDIA 5I23A 4MAUH 4X5XA 1VEOA 5EEYA 2YBVA 3RNQB 1O5RA 4LK4A 4RGOL 3MLXL 2BIIA 5DQPA 1WCQA 5BV7L 3KJ4C 5DD6A 5IVXB 1MXGA 1FORL 5C0FA 4CSSA 3SO3B 4MSWB 3IMUA 3KL0A 1PWLA 3GINA 1OXYA 5T3XE 1T2QH 4OH2A 3W71A 5T3ZL 3UA4A 1QLEB 3TT3L 1T5WA 1T2JA 3QARA 4EUPB 5ADOH 3V3WA 3KM8A 3WFEH 3G1VA 4QHUB 3S4SG 2I57A 1GYNA 2GK0A 4G8EA 1LQ2A 5C0AD 3UJFA 1V3JA 5L2KA 3QZAA 4KTDH 4OIIH 5AL8A 2VEKA 4WW2F 3WJJC 3VCLA 1D6EB 5E2JA 4IICA 4JFEE 4FXGA 4KK8D 2WXMA 4Y5VC 4DKTA 4YIQB 2CLLA 2Y7QA 4ZMYA 1LEKA 3W87A 4FKHA 3S3JA 4PWFA 4C1LA 2QVFB 3MWAA 5EU3B 1R24B 2XIJA 4WD0A 4G59C 5A6IA 4JQ3A 2E6FA 2YEQA 4Q3MA 3URBA 5C0DB 3BUTA 4K71C 3OGRA 4IGNA 1XCWA 2WLNA 4DKFL 2JFCA 2ZXCA 1QPPA 1P0EA 4Q7BA 5EZLA 1M1SA 4Y9NA 3P3BA 2QW5A 2Y07L 1BEXA 1PXGA 4AFYA 3BVVA 1UR1A 4DKEL 3F7RA 1R6WA 4PFMA 4ZSOA 4XX1E 1UM4H 2B59A 4IT1A 3O45A 2YD8A 3ARBD 5T1LA 4TX9A 1MZRA 2DKUA 5KVDL 3HNVH 4LAMA 1KBIA 3IXAA 4F37K 3NPUA 5F0MB 1BVNP 3T81A 3Q1SH 1UD3A 4PJHB 3L5XL 3L3GA 2O7QA 3SCUA 2DW5A 3KLAA 3ZDXB 2DSKA 3IJHB 2XKUA 2HP4A 4MNLA 3EOAA 5A6AA 1WFTA 3MV8B 3CO4A 5DK0A 3SYQA 3BZJA 4HCRH 4YWGL 4PWIA 3SRKA 1UG6A 2G3XA 3L65A 4MNKA 4XT1C 3PLYA 3KOZA 2X2GA 1KNOA 4X7FC 1ZGLM 4FADA 1QR1A 3QS3A 1ZPTA 3F8UB 4QRRA 1ZBWA 1YEEL 2IC2A 3DHPA 4NNBA 4Q32A 2VXSL 3QV8A 3BAEH 4M1GL 2BZ7A 1LMKA 4F7CB 5HSFA 4X9YA 3ULVH 2WXDM 3VH8G 1HT6A 4LHUG 1H5BB 5G2NA 3W7MA 1IQDA 2FJHA 3VD9A 3WFHA 3FONA 5E8EB 5JDSB 4KK9D 1XF5B 3ABGA 4IPJA 2I85A 1AGBB 1LO3H 1NOWA 1AQDB 1QVOA 5JHBA 1AR1B 6FABH 3QZ6A 4P04A 5I3HA 5EN2A 1ZEAL 1A9BA 2YLHA 1LNUA 3TA3C 5IHWA 4ADTA 1ADWA 4MAYB 4JN2A 1EV2E 4UUIA 3F65A 2G5RA 2CKBH 5EWIH 3FB8A 2DP3A 1DVJA 2DQCH 3TJIA 2SEBA 2Z7GA 5IHZA 5DHDA 4OJYA 4PS4H 5AW3B 5D8JH 4NVTA 2WWOA 4AL8H 4YDJA 4ALDA 4QITA 1XXFC 5GJTH 1FVPA 1YYMH 5T1DL 1DHPA 2QKFA 3Q3GB 3VXTA 5IK3B 3T0ED 4N2HA 3N0AA 2EO1A 3GU1A 4D0BB 4X60A 1UQZA 1CFVH 3CSBA 5DF0A 4TUJA 4O13A 1OP3H 3VE0A 1IIKA 1F2JA 4RZCA 3QDHA 5FFGA 2XH2A 4M6UA 3UFIA 1NMCB 4NZTH 3RCYA 1EEYB 1VJZA 3BWUC 4LBAA 2NUYA 3U4KA 2A6NA 4HYTB 2GTQA 1CL7L 1BFSA 2XZQL 1M3IA 2NQJA 4A6YB 2CZNA 3RXZA 1K8YA 3RO8A 1ORSB 4MAVA 8XIAA 4Z0XA 2PWDA 1Q9OB 3IS1X 3UDWA 4OFQA 4QRBA 3SOTA 1NIEA 4J3TA 4JDVA 2H2SD 1G0CA 5CINL 3DX5A 4JKNA 1RSYA 4Z2IA 1R2SA 5KUKA 2QNEA 1MMFA 1SSDA 4YTUA 3WKMH 3SY8A 4FN0A 1G9HA 3QQDA 3RHWK 3EBHA 4A4AA 3STBA 1X5AA 1TYJA 4ORGA 1L9SA 2UWEB 1SLVA 2AZUA 1ZALA 1S7RA 1SPDA 4WKAA 3R4RA 2WXLA 3D0VB 4WLCA 5EUOB 1F45A 2ZADA 1K02A 4M8UA 3B9KC 4P7LA 4OZFA 3AW5A 5JOEA 3BUQA 1KYUA 4NN7B 2AEWA 5DVOA 5DS8A 3NCMA 1TTBA 4PLJD 2J9ZA 1X6NA 1NKRA 4JFFA 1ITXA 4K94H 3B8WA 2FL5B 5KSBA 4G7YL 2EIZB 3T2NH 3BAIA 3D3AA 4FYQA 5FYJE 5ID1A 4PULA 4JY8A 3LN5B 3VNKA 4YUEH 4JTQA 2YS4A 4OZGF 1LORA 4NO0D 4LPVA 1OOAA 3V4BA 1XYAA 3VGDA 5D9MA 1GC1H 4IMLB 1GOQA 1RQHA 4QSHA 4CSTA 4U7KA 1EZWA 4FIQA 4LUIA 1AAJA 2RAGA 5CEYB 2V2TA 4Y16D 3AMDA 5T1KA 1UR9A 2GHZA 5EC2A 3VXMB 2PF0A 2XG9A 4QTFA 4OGXL 4LSSH 1U33A 4PM1A 2OMYA 2H1PL 1FFNA 3N44F 3FDGA 4O15A 3VTMA 4BSJA 4MPQA 3F4NA 4QKTA 3OC8A 2C9QA 3UZYA 1RA0A 1QSEE 2GQ9A 4MPKA 4MFEA 2XJKA 2XYLA 3AYTA 4RFEB 3S3DB 3ARWA 2FH8A 2HJPA 4C5YA 4N42A 1AQHA 5I5IA 3T4AC 1KXVA 4PP1C 5C8BB 2NXZC 3CFEB 2YPVH 4L4TD 4RGNB 1QG3A 4H5SB 3QIUA 1OIMA 1CT5A 1Y07A 2VO5A 4YSTA 3LEYL 4K9JA 3SUSA 1K5WA 1JZ7A 2HLAA 2Y22A 1I8KA 3IFPB 4LVGA 4P06A 4UM9D 3BGMB 1U93A 4H1LH 3JTTB 3WMPA 5FJOA 1JZ4A 4EOUA 4KPHL 3RU6A 3MRMB 4YS4A 4BFAA 1PDYA 4GLEA 1WDDA 5IESL 1XBZA 1HWHB 2ODIA 2XKNB 4LVDA 2BERA 3OZKA 2O6FA 3UCCA 2MQCA 3JV5A 1CL7I 4XBEL 2JKPA 2JI3A 1RAMA 1JHLH 5DJXA 2X0SA 3WNJA 4MHHG 3SKJH 3K80A 5T5NG 4MMWA 1KFAH 2VDOL 4PD4J 3H9SA 4WTZG 3FSUA 1EQWA 3C60C 5BXSA 5LWYH 4N1EA 4REQA 3O4LE 3SRHA 2DM2A 3SJVA 1V05A 4DFIA 3SBWA 5CCKH 3V0VB 2UBPC 2DT3A 2BP3A 3T1WA 4X6DE 3T05A 1MFVA 4MKMA 1IWPA 4FA6A 1PG7H 4JS3A 3U9UA 3U7WH 4Z76A 2OOFA 2YBRB 4I7UA 3IN2A 4JZNA 1MFCH 3FT3B 4OSUL 2NQDA 4FS9A 3VYOA 1M7UA 1O1ZA 4MIMA 1TV8A 3HPXA 4LSUL 4I8YA 2E7LA 3DVNA 2OXNA 3OR7A 2YXWA 2QKIA 3SBRA 3SN4A 2CLVB 2LT9A 2AJVL 3KM1A 4RDQG 3O2VH 4IOFC 3OAUL 3T4YB 3TR9A 1VIWA 2QVMA 3MV7A 3VWKC 1I9JL 1ISWA 1W2PA 2IQTA 2XJ7A 1ZLUK 1ONXA 3QKZA 5K9XA 3BRFA 3UTSB 2WM0A 4MXWL 4JRYA 1C12B 1DVFA 4FNQA 5FAJA 1BRLA 3S34H 3UJ2A 2RDTA 3CUXA 1BZ9A 1N0LB 2WHMA 1V51A 1P0NA 4MZ2A 4C7DA 1QRNE 5F7HA 2AQPA 1M56B 1UZ4A 4LVBA 2F6AA 4JUTA 3O81A 2H0PA 2MTPA 5FB8A 1NCUA 2V37A 1DXFA 4APQD 4D8OA 5FGBA 4UTBA 1SLUA 3BHBA 3KPNB 1XH0A 2OO6A 1KLUB 4YU1A 4BSWB 4PJDB 1IGCH 1Q8JA 3HFTA 2ADJA 4KUZH 2VURA 2E5CA 5FEPA 1TJXA 1YVLA 2APSA 3CDZB 1VC4A 1J18A 3PQYE 4NFBA 1FZKB 3BEVA 2FIQA 4MF4A 3KLDA 4N2DA 4JRFA 1NCHA 5E6IC 3H2QA 2E76C 1O9ZA 4A7QA 3QPKA 3LM7A 3MO4A 3NABL 1HINL 3F2CA 4PFHA 4B9GA 1VD6A 3LX9A 3GS6A 4HJTA 1HKVA 1KFJA 2L8AA 1EFXB 4YJZL 1VYPX 1UGKA 3POCA 1WK0A 4GBXD 2EPHA 1W72L 1IEXA 3MA9H 5LN8A 3MU7A 5KG9B 4PW9A 2OZ8A 4NQSA 5C0CA 3KBMA 4X61A 4AIZA 7ODCA 5CEZE 2ENSA 4K3EL 1UA7A 1W2KT 4MOZA 1WDWA 1AP2B 5IMMB 4LVNB 4PYSA 1I1FA 3LKPA 3HAEG 2P5WB 3U4FA 3OKEB 4FLOA 1QFWM 3VKAA 1AE6H 3LHWA 3S2LA 3FT2A 5B4MC 4HSAC 1FPTL 1DJSA 3RG6A 5DRNA 3B9OA 2HMID 2ADFH 2O5XH 5IB4A 2AV7A 5BV7C 4FPSA 2DVXA 2CAKA 3NSNA 1JNEA 3MNVB 4AEHL 3OW1A 5FYLD 2VRJA 1DE4A 4DF0A 3KPTA 4OBSA 4A7SA 3KLHC 4HB7A 3N9GH 4O52A 2EVHA 5CGTA 2V38A 3VRIA 2WBWB 3EYUL 2VWEC 1HL5A 1G4EA 4O2EA 3SKUD 1UOZA 4PN2A 2OMXA 1ZU8A 1ZBKA 2Y8UA 5A69A 4XMTA 1R2TA 1SVDA 3REWA 2ATPB 4Z7UE 2XH0A 4ETQA 3W39A 1R0AH 4H9XA 4HKBB 1VQTA 5EPDA 3VD2A 2WV8A 1FAIL 1KB9J 4DETA 1MFAL 2XIOA 1NQKA 3FOMA 1AH3A 2PC4A 1XKYA 4PJEB 3BLPX 3X1NA 2VGFA 3BLDA 3EYVA 1Z69A 3BZEA 3K2MC 3W24A 1WD9A 4FMKA 5I2IB 1A65A 4O14A 2I9LB 4H01A 3AVEA 3QZNA 2BXVA 3W3OA 5I17A 4GT7A 5AHEA 4AQ1B 4TNWF 3BAYA 2YD2A 4PJFB 1T4KA 1ZT7B 2XA8H 4PJCF 1I8LC 4LSTH 1OW0C 2KQNA 4PYHA 5AVSB 2ZUVA 3C86A 5DRWA 4ABUA 4JDYA 1Q9KA 4LCWD 4XK2A 4CAGA 1D5IH 1Y65A 4X9SA 3B37A 5SWUA 1MI3A 1CXEA 2DPEA 2DWYA 3ZYIA 4OF0A 1INQB 3C08L 1NC2D 2XFXA 4HK3N 2VR8A 1R3JB 3II2A 2X4UB 1OHLA 4AMKL 3BTNA 1XMEB 4U6HB 2VFEA 2V2WB 4LZKA 1TTIA 3ZVIA 3QDMB 2YD5A 2OW6A 5AFAA 3NFPA 1IGYB 1LP9F 3BD3A 1ECYA 3V4UH 5KETA 1OV8A 2CETA 4DQWA 1U8JB 4M81A 3S8WA 5LGJA 4GWEA 4KXDA 2AABL 1VRDA 1XIWA 3HGOA 3HVDA 3RIAF 1CI5A 1UURA 3WFZA 4HBKA 4B2DA 2IH1B 3ZL4L 3T9WA 1DN0B 4LOEA 2VGGA 3RGHA 3MRPA 3WYRA 4PH8A 1KO0A 2YA0A 1TQCC 4JM2B 3BJ91 2PRMA 1MAKA 4HOXA 3VXRD 3FCTB 3TXZA 2VXUL 3SDCC 4ZX5A 3M8OL 3R12A 1IC0A 3SUVA 1WJ3A 3WMQA 3ZJAA 3BG9A 3H85A 3M1CA 5KVFH 3U0HA 1KN2L 5A2KH 2H32A 4OFYA 2GBAA 3V0WL 2XY1A 4OZFH 1HCFX 1PLGH 3N4FA 4QRPE 4HJJL 3FS2A 5ACZB 1RZKH 3PJNA 4UTJA 3VVVA 4HGMA 1BYBA 2NVCA 4GXPA 3W7NA 4HNCA 3WEAA 1PL3A 1LRTA 3PUCA 3UZWA 4LQ1A 5KTEH 3KOWA 1RZ7H 3EJUA 1XF2B 3IUIA 5E9AA 1S1RA 1DL7L 1FNSL 2J8UF 4BFEA 4QF1B 2FO1A 3LG3A 4X7SH 5FXCH 4B5WA 2O5YH 4F3HA 4F0LA 1A3LH 4NT0A 2J9YA 1R7AA 2WOBA 2Y62A 3JV0A 5C3IA 5ANME 3DV4B 3TWAA 2EE6A 4IGBA 3ALXA 2X4PB 2ICEA 3N40F 1XH1A 4M1DH 4HH9B 3KJ6H 3GXTA 3OWRA 1ICTA 2OA9A 1I85C 3FL7A 4A7GF 5FCZA 5BOEA 4N0CC 1ROCA 2FEEL 2QGBA 4CMMB 1MNUH 3NT0A 2K1MA 1UASA 4ZNEE 4H3DA 4QHMA 4F9DA 2OYKA 4FE9A 4CEUC 1U8QA 3AY4C 3OYZA 3WK0A 4NQQA 5C2BL 1I3UA 3F62A 2R29L 1LOLA 2PB1A 2Y5TB 3H9HA 2JF1A 1NL0H 4P4KA 3P4MA 5TBOA 2A6JB 3SE8L 1NEUA 4DQAA 1U8MB 1Q45A 1CD1A 3RYSA 5EDXA 4ZQMA 5FF6A 5HHMB 3RDJA 1VGAA 3HLKA 3AMLA 1HS6A 4E0RB 4L9ZA 4X42A 1W9VA 1JJKA 1J6OA 4QNPE 5CM1A 1UOKA 3L3OA 4KROC 3UTPE 2QPSA 1M53A 5I1JH 1HFUA 3OKDA 1ICQA 4P5TA 4NG3A 3GLEA 4Q0XH 3TNMB 2JI1A 1NGQL 2GPZA 5FK9A 3WLQA 1GSMA 2AQ3A 1IJ9A 2LAGB 3TO2A 1YDVA 3RGBA 3S0CA 3X1GA 3DYOA 1YYCA 3T6VA 2YAOA 2JB5L 3JTSA 3UGXA 2AQWA 3RG1C 3M41A 1FH9A 1YIXA 4GINA 2V63A 3BN9C 2VLKB 4YIWA 5JORA 3NA9L 4Y19E 2IWFA 3NOIA 5D9SB 5D1QE 3GPEA 3UC0H 3V6FA 3E6EA 3NRFA 4XKYB 4LPWA 4MLRA 7CGTA 1QFHA 1ODAA 2FYYA 3FRPA 1VR6A 1EP3A 3GH7A 4ZXBD 3R1GH 3VFUB 1T4WA 3EOBA 1AK5A 3DK2A 2P7TA 2HH0H 1UTDA 1U92A 1GY1A 1AZZC 4R53A 4PIBA 1GOXA 3P7YA 4Q8PA 2OSWA 2VHLA 3CLEL 1TO4A 4HKXB 1M42A 2BWGA 4GD0A 1SFJA 3O8XA 4WTQA 2AVFA 3NCWA 2VTFA 2JIXD 1X5FA 2XGIA 3D18A 4ZTYA 1YMHA 1T96A 3BUPA 7PCYA 1SW3A 1RULH 1Q0XH 5FHAH 1V6YA 5JMRA 2EKSB 1VGKB 3ZTJG 1CB4A 1ZHLB 1AQKL 3BO8A 4HG4J 2XNAB 4LUTB 1TVBA 4G3YH 1X1ZA 2C1PB 1NEZG 4H6KA 3MUGB 4UYQA 3KPLA 2ZDRA 3TNOA 3WTTA 2HWZH 3WL1A 1ZTVA 2P5EA 2G2PA 1DJIA 2OMTA 4F7TB 1ML1A 1B0GA 3E2VA 2DZAA 1S7WB 4KVPA 4J1UA 5F2MA 2EEDA 2X28A 1FQ9C 1U3HD 5JHLL 5JBDA 4MZYA 4DVRH 1YY9C 4L5FE 3FU7B 4QPEA 2CM6A 6CGTA 1AUSL 5H91A 2N56A 4D6DA 5EU6B 3RUGA 3N11A 4CD7A 4WDUA 1KV8A 1FH5L 3GMMA 4ML4A 2A9ML 4O9HH 1NCNA 2FEEI 2PXYA 3RPKA 3LHYA 2YUXA 4Q33A 3SAZA 5T1MB 1BKHA 4I6KA 3WYZA 3S8FB 3C5ZB 4RE0A 1BF6A 4GFTB 4K2SA 4E9SA 5BQ7A 5TQ2H 4PQXA 1P4UA 1L9NA 2YEZB 3VNZA 1UWRA 2ED9A 3G1HA 4FF7A 1NGXB 3DPDA 4HPYL 3WNIA 4UTBH 2WPGA 4EXKA 4NP4H 4YYCA 1O60A 4KMTH 1AODA 1D6VL 3KVJA 4HS3A 4JO4H 3WD3A 3EOTL 2JKXA 3LM3A 1OT4A 5IJDC 3MZTA 2YMTA 5I6XC 4WW2A 5L2JB 4WU5B 3U82B 4QCIA 4XO4A 5AW6B 4BEQA 1J5CA 3QMTA 3ZHKA 3QPXH 1UEMA 3T78A 5C9JA 1X1OA 4FQIL 5CJOL 3LVEA 4D9LL 1CGTA 4LEOB 3N41F 5SV4A 4AWEA 4P46A 2G4JA 3KTXA 2HT4D 3FQYA 4UI2A 4XBSA 1FIGH 1P1VA 3GD1C 3APMA 3AWOA 1ONQB 1ZDSA 2ERJC 1QLFB 3LQAH 4X0NA 3FFCE 4HYWA 4G1MB 4Z7NB 2DPKA 1E0VA 2AK4E 4RAUB 2RCSL 1RUPH 3SSGA 1XGTB 1U8HB 1EZVX 3MREB 2BGQA 2XV2A 5IW1B 1TVPA 3VXUA 4GW4B 4NRXA 5IJVB 1KEGH 4IMKA 3FQNA 4N7QA 1VGEL 2B7OA 1JNHB 1UWUA 1MEIA 5LGHL 3ZYZA 1QWGA 4BA0A 5FECA 1KJ2L 1TX2A 1NF7A 3C8DA 1WG3A 5A2AA 4JRXB 3A22A 3ZVVA 3LNEA 4XAPA 2XWTB 1ANUA 3EGDB 4BJHA 4GK8A 3U1SL 1QW8A 5CWSA 5F7NC 4XODA 3N15A 3S9IA 1XR9B 2WCGA 3BGFB 3ARFB 4UFMA 4DN3L 3GIZH 4F2EA 3WMCA 1MF2H 1G69A 3SQBB 1OIOA 1BGGA 1ALDA 3O3BB 1IGML 1BXAA 3VI4F 2VWTA 5D1ZD 3TS8A 1LWIA 4ZUVB 2QHRL 5DUMH 3MBXH 4PMNA 4PJGB 1ZBVA 2HBXA 1OCWL 2P80A 2AJSH 1Q6FA 3QUZA 3SDXA 1E0UA 1DLFH 4PJ9C 4I5RA 4DM2A 3IE4A 3QBUA 2DYRB 3NIFE 2CWXA 2I27N 4Y1AE 4NDMA 3IDNB 4QLJA 3ILQD 4O2CA 4X99B 5I0WA 4XAGA 4NO5B 2DQGL 4ZI8A 4DUVA 4E4UA 2AXWA 2X4OB 1W6TA 3Q48A 5FEWA 2NZ9C 4ZUSB 2AC0A 1V7ML 4LIQL 4HEMA 1LL4A 2VD9A 5EU9A 4UR7A 6REQA 1N64H 3BPCB 1E5AA 3CFBA 4U05A 4P2QB 2XPKA 5FKPB 4J3WA 5J9PA 4FFVD 3VSUA 3JZYA 2AL2A 1Q7MA 1BA9A 2GUOA 1FP5A 1GZHC 4QNWA 5B3NA 5SV3A 3OJDB 4YHPB 5CILH 5LGZA 1AS8A 3U2ZA 4WY7H 4LL4A 1MFDL 4G7QB 2A1WH 4PTTA 1FH2A 2XM1A 2ENYA 2VAAB 2WTOA 3V75A 3VA8A 1KXHA 5ESAB 1VFBB 1TQBC 3CL8A 2Q3RA 5F1NB 2IXVA 4F20A 2OCFD 1PW3A 4Q8WA 5MP6L 1DBML 1XR8B 2NY2D 4DAGL 3OB0K 3ITLA 3Q6GH 1ZCCA 2NW3A 5GZOA 4HMEA 3HZMB 1JHKH 1FHLA 1UUNA 4NM8H 4GIRA 4HZLB 5JIWA 3G5VB 3TZVD 4JHOA 1BYOA 8FABB 4LMQI 3PAVA 4PJBE 5TF0A 2NZIA 4FQHA 4JG1L 5TNVA 4JS7A 5EN3A 4C83A 3NPXA 4FTVA 1IAIM 1BF5A 5CSRA 1QNZH 4LQFH 1T20B 2K78A 3ZX1A 2YL8A 3RU8X 5CC6A 4F1SA 1OTUC 1RPXA 1CU4H 3TL5A 4WU7B 4XMZA 3CH9A 4QYOA 3QGVA 2C71A 4GFIA 3N5AA 4K8GA 4CJ0A 4QTHA 4O12A 1NTDA 4YHIB 1F58L 5DFWH 3RA7L 1MCLA 4XNZB 1PZUB 1WYIA 3WQGA 3AUJA 2DQDL 2R51A 1OP5H 4KFOA 2H32H 1Z9MA 4EANA 3G04A 3CFKA 1G7JA 2D9QB 1C9DA 4MWAB 4IRZL 2OCCB 5IOPB 4KDTC 4OLWH 5I77A 1J10A 4RZ4A 4FB7A 4FMFA 5BVJB 5F88B 2ADGB 2WOQA 5J6HA 1KBPA 3DKJA 4N6RB 3A6OA 2ZSWA 4JHAH 3V5HB 1HGYA 4XX5A 4P9MH 3FC8A 3FB7A 2WHVA 4IIQB 2VC2B 4N26A 3TCTA 1SM9A 1SJAA 3Q44A 4JFDD 3MZGB 3FB6A 1FWHC 3MOQA 1K70A 4FEMA 3AUWB 3PTDA 4G9FA 2Z4QB 4MVBD 4PI0A 1RZ8B 3LKNB 1G4PA 3WX7A 2PDPA 4LLUB 3BWZA 1TCMA 4FFYL 4O51B 5HXMA 3DSFH 3SGDI 2VDPL 3FO0L 4AT6B 5DVMA 1B3IA 1NLBL 5J6SA 3KRZA 3NCYP 1P1ZB 3CZGA 1E6RA 1LQBC 4HIEB 1O68A 3MMWA 2MRYA 5JU6A 3RGVB 2J1WA 1XBYA 5C7XL 2AGJL 3ZXAC 1KIPB 4C7FA 3WK1A 2J4GA 3HI1B 3QIWC 1EWDA 4NM4L 5DJZB 1KG0B 5I1CL 4ICMA 1LHZA 3J27A 4RL3A 5DJ0B 5DZAA 4NAEB 2NUPB 3QDGE 4KI5E 3FJNA 1SXZA 3LDBB 3HC0A 3VKBA 1P5BA 2EVIA 1ZS8A 3QUYC 2FCBA 2FECL 1Q7QA 1LOQA 1U91A 4Y9OA 3W1PA 4OKDA 1G9NC 2OR9L 3QFDB 3TVMB 4BFJA 2BCKB 4G8GA 2E68A 5K69A 1RLBA 1XAKA 2B1AL 4QD2E 3THMH 3SQSA 2ED6A 1VFOA 3N6QA 2QGDA 3DX7A 4HJFA 2DZUA 3UPMA 2AXFA 4DN1A 3P3UA 2VOMA 2JKEA 4BWUA 3ZE0B 3KDPB 1A0QH 5I02A 4NQDD 1VCVA 3B03A 3W74A 3VXOB 1TSIA 3RM9A 4F4RA 3AHZA 1RUQH 4YHYB 2WQAA 2NY7L 3OO2A 5CN1A 3H1ZA 4MZ1A 1SFSA 1ZWIB 2F9BT 4OTXH 1XRSA 3B40A 4ZAKB 1W9UA 3L95B 4CD4A 3CIXA 3BPOB 2TAAA 3U2EA 3VGBA 2QCCA 3BYTA 3H8AA 3HBLA 1TPC1 3GYRA 2AITA 2XQBL 4UILL 4JHWH 4M1BA 4OB5H 4TLTA 2VR3A 3K13A 1XDTT 4H7ZA 1IKOP 1QVBA 2HPMA 2VDLL 1T3FA 4CVWA 1L9PA 2RFXB 5B38A 2V3DA 2FPYA 4OR1A 1FSKB 2EQDA 3FW6A 2OJEB 4W9EC 3T09A 4ADSA 5FEXA 4ODSH 1H3UA 4PL1A 5D2LB 1E4JA 1MLCB 3WQPA 4W9LC 1JJUA 4UIMA 2FLBT 2RJMA 5EOCH 4NYLA 4AIUA 2X4RA 3PV6B 3FQWA 3STCA 4F0HA 4N8CH 3QNXB 2DW7A 1NGZB 3JWNC 3L3JA 4RDBA 2ZNWA 2J6EA 1AD4A 5HQLA 1T0MA 3CUPA 5GJMA 2FDSA 5AOUA 2EVFA 2F0CA 2XFGB 4K1GA 4OZIE 3TZFA 3FH5A 4JIQA 1K03A 4JX5A 2XA3A 4H1LA 1HSAB 3GMPB 4U4MA 1KLGB 4HNNA 3X1BA 2HFGH 4H9YA 4XMPH 3OQEA 3CAVA 5EORH 1EO8H 1M05B 4IRSD 3S35L 3X13A 3TROA 3WY3A 5C07E 2GJRA 1ZHKA 4JDEB 5F2GA 2ZF8A 5HDQH 3Q9PA 1REIA 1NWSA 4I9WE 3T7VA 3UT0A 3DFNA 2GJJA 3RIKA 1NFPA 3NCXA 4PVLA 3LEXB 4W9TA 4X4MA 2VLJE 4ZQKB 1UWGH 1S3HA 3OLGA 2YR1A 3QNYB 2OXGB 5SX5K 1SF5A 1IFGA 1NJJA 5I16A 3EPNA 3IBEA 1MHEA 1X5XA 5AW7B 4FLSA 2EDRA 2PCFA 1MIMH 1UZHA 5JZ7C 3V6OC 5IXEA 4Q4EA 3TA3D 3UAJC 1I8JA 3D39B 3P4OB 3UP6A 2NZ1A 4OWGA 4LUSB 1OSZB 4OZHE 4XOCA 5GGVL 4HNVA 3M0YA 3S6OA 2JKIS 3TBBA 4NQTA 4G1EB 4IBTA 1PE1A 4O2FA 2NV2A 4WSJA 5HHVH 4CC4A 5FCSH 2R7EB 3SPGA 1BAGA 3IKCB 5DLML 2UUDK 1QFEA 5IEHB 1JBJA 2CNCA 1KGXA 4X6CB 3THCA 3ULAB 4IS6B 2QIIA 3UO8B 1MWAH 3K6DA 1H6TA 5D2NC 4C1KA 4DERA 3IFOA 4IP5A 4EE2A 1MEXL 4H04A 5GVJA 1TR1A 1MCPL 3RB5A 1OVDA 4ABVA 3A5FA 4OV6F 1RQBA 2BVEA 3NBNA 4AGMA 5LNGA 2NXYD 1J9RA 1YN7B 2A7PA 4F33B 4GW1A 3MNMA 3VSTA 2JGYA 2G3ZA 5K5YA 5FA5A 2FMOA 1AIFA 5DRZA 5E93A 1R3LB 1BSIA 1OWWA 2GAZA 1NGWA 1BXUA 1WWBX 4AMXA 2Z91B 3V0FA 3TQPA 2J71A 2DTMH 3OX8B 2X9ZA 1YUHB 4IPPA 3MYPA 4FCAA 1OP9A 4F2FA 5HYIA 1TTFA 3QDJD 3VXSD 2QADB 2J2ZA 2I7GA 4HPGA 3D08A 4HZ1A 4JFHE 3ARDC 3FY1A 1KGIA 3HRZA 4Z3EA 3B9KD 3S9YA 3VYLA 3NL2A 1XYBA 4DZIA 5C92A 1IGTA 4NQ1A 1GAFH 3ZLFA 3CDFA 4KXBA 4BKTC 1YEFH 4POZC 3LQLA 3ML9A 1AOZA 5I8KL 5GS1B 1ULVA 4WCJA 5CIPA 4S2BA 4YR6B 3BQUA 5EH1A 5B1JC 1QUNB 4QNEA 1F3WA 3BW9A 3L5WA 2ZZUT 5TF1L 3T77B 4XPGH 5I00A 2BLFA 3CBWA 5I76A 1W2VA 4HUXA 5CN3A 2UYLA 4XCEB 4DP6X 4WI5A 5JDJA 2Y06H 1PHWA 4KFMA 3W84A 4GRWE 1OEPA 4GGBA 2H45A 5BRPA 5FYJU 4L3ED 1N3NB 4RV3A 3DJTA 1XZ0B 3ZJKA 3MRBB 5E1GA 4XZMX 3NCCB 1TWIA 1OT1A 4O16A 3KPSB 4ZZFA 3UZJA 2ZIDA 3MHUA 4FXKA 1BMZA 3CZEA 1WBYA 1WFNA 1OD8A 4E5TA 4E8GA 3W00A 2CHWA 1S3RA 5E0QA 2AJYH 4H9TA 3V4VB 1E5CA 4FQXB 3QSKB 4XOEA 1XXXA 4HPOH 1T1XA 2EEBA 3F05A 3MV9D 4NN5C 2WJEA 4PP1D 1WXJA 1LP9A 4KT2A 1B9BA 1RZJL 5B7FA 4J4PC 5AW1B 2H3DA 2P48B 2CBOA 2FEJA 1XYMA 3M1OA 4Q89A 4UTKA 2EDKA 3NIDF 3WL9A 2QJMA 1ZTXH 3DKHA 2WGNB 3QO1B 3TTEA 1NELA 5A16A 4PZVA 2XZCL 5KJRH 3CIWA 2EUXA 1R3SA 2C6QA 1VESA 3WE6A 4HT1L 2X9YA 1GW1A 4QX4A 3D05A 2BXYA 1AD9B 3QEGH 5IJCC 5DT1L 3H7BA 2R9HC 2VLLB 3O05A 2QCFA 4IWWA 5FGCB 4K38A 4UDUB 2DSZA 4HEPA 1XWVA 1ECQA 4ZFGL 1IAKA 4FQLH 3MBFA 4U5IA 1YC7A 2AJUL 5C2XA 5IR1A 4Q9RH 4QGYA 3LBMA 1UA3A 2B3RA 1RHHA 4NLHA 1E9OA 3LQGA 2PDKA 1FBIH 1G7HB 3QXAB 3ZR5A 1JDCA 3PGFL 5D7HA 1FOBA 3T4WA 4EIZC 5EZJA 3C60D 3PIQA 5IV2A 3P5YA 3E0FA 4NPJA 4ORZC 4OCSH 4RWHA 4XX1G 3Q01A 5JLZB 2J7LA 3L9RA 1SM3H 4Q4OA 1QK0A 3BP4A 4GUOA 3FRUA 5KW9H 1MCOL 3TFBA 4EI6A 4JQIL 3LKRB 3CV2A 4H88L 3A9IA 4LPUA 2GBUA 4UANA 4OCWH 3WJMB 2AXJA 3Q45A 4E2VA 2WHKA 1GR7A 4JO3H 2UY6B 1LEGA 3IDIB 3WO8A 1U30A 4AJVA 4MQ7A 1KBBA 1A3ZA 4GJJA 2OG9A 1TG8A 3DVIA 5IQ7H 1HU8A 3AT9A 1DCEA 1DE6A 4H8WL 3ITXA 1OX6A 4I7WA 1GMIA 4F40A 4IOFD 3FUIA 3BWUF 3HVNA 3IACA 3VWKD 2Q10A 2K9FB 2VX5A 4D9RD 2KI6A 1ESWA 3XIMA 1KPUA 3CC5B 3MTWA 2ATAA 3CUIA 5FF2A 4YHOL 3QUHA 1ECEA 1QU4A 1RCQA 4AEIL 1RH9A 1KEMH 2PGFA 4HAFA 2FH6A 5G4NA 2J6WA 3KBSA 4ODBD 2A77H 1T04B 3D2UA 5GGUA 4ODXB 3TYFB 1LYQA 4GI9A 4Y4FB 4EDXB 3D69A 2YIHA 3MCLH 4OKVA 1PKMA 1IT9H 3ETTA 3QG7L 4JFXA 4Z1YA 5MEQB 1O6VA 3H3KA 1YN6B 1E27B 3FYYA 3U4BH 3FF8A 3W7CA 2D23A 4WWKA 3CQHA 4WJ8A 1KIQA 3JWOL 3EMQA 1YBQA 1KTDA 2CNYA 5DJYB 1HILB 4IIDA 3VRJA 2NTFA 3NAAH 2J6VA 1TTRA 3IVSA 4WHTA 1VAHA 1HEZB 4P57B 2QVHA 1JGLL 4CVZA 3L9CA 3IEAA 2E47A 2E0PA 5E6ID 1IWBA 2JLLA 5HPMA 2H0JA 4Y9AA 5AKSA 1I9RL 1W3LA 4BZ1L 1M9HA 3M86A 3ARGB 5L2KE 4XPHL 3NIYA 4FS0A 3H6JA 3BSZH 4XC3H 5C6TL 1F4WH 3RFAA 3BFOA 3WTUA 1TJRA 3FUHA 3PBUA 1W1VA 3IDGA 3WJXA 3G5ZA 1XW8A 2CJTA 5IB5B 3UETA 1PTAA 2R0WH 2PGWA 1SYTA 3RWGB 4UQ3A 1PTZA 2YPLA 4DTGL 2KDGA 2PP7A 4ZR8A 3MMDA 1ITQA 2V6HA 4DO7A 2QEJA 1XR2A 3RF9A 4KI1A 4AIEA 1NAMB 1OAYL 1X6LA 2J43A 1CG9A 5A6KA 1WV2A 1KJMB 4ZSOE 1QNIA 5GJPA 4KDVA 2VSKB 3MDWA 2E6JA 1TR9A 1QBML 3AGWA 5B4MD 4Z2GA 2DMKA 3NL6A 3VG0L 1XLJA 5I1GH 4K7FA 5C9UA 1GT8A 2J6EH 5E9NA 1TETL 1TPDA 3UJIH 3I50L 3X12A 5LHDA 1T66C 2A9CA 3KLHD 1IFHH 1OTTC 4F7EA 3MCMA 1PZ5B 1JZEA 4N0YH 4PV9A 2A3BA 2A73A 2EH7L 1XX1A 3CWNA 2FJGB 1AW1A 5AVWB 1P5VA 2J21A 3FSAA 3HW7A 3PZGA 5FPIA 4PRAA 1PYWA 3JUGA 2DV6A 5IROA 1H9VA 3SGZA 2Y6SC 2ZQKA 3SQOL 4L4VD 4I48B 4HH8A 1S9YA 1QRKA 4PJAB 4I0PB 3BKMH 5EU5A 3RVUC 4K7PX 5HDBF 5KYXA 2DQEH 3WK3A 4N0FB 1F61A 4Y4HA 1QOQA 3ARQA 1NBVL 1U8KB 4WTWA 4P23B 1MO0A 4S1SH 3AZUA 2FD6H 3DRTB 4CD5A 3KVMA 1GCFA 1ZVYA 5HJXA 3QJSB 4NQVB 2FJSA 2X1SA 1A6UL 3W0WD 3U6XS 1YEIL 3WK2A 5LIWX 1HVQA 4F2BA 3F2LA 1X6UA 1EBGA 1CT8B 3STLB 4CNIB 1RIUH 1WKYA 2WQVA 4GMSL 4K8RL 3D85A 3VC5A 2XZ7A 5HJ3A 3E74A 2MNJB 2PDCA 3UXDA 5EF1A 5D7KE 4YHNB 5D9NA 4A3RA 4C47A 1ZHBA 3CK0H 5HYQA 3N2XA 2VLMD 4Y2LA 5L9FA 4N90E 3ASNB 1CX9A 7TIMA 1A9EA 3P4NB 2JCCF 5IHUH 4R0LC 4PSPA 4Z3TA 3GBML 5FWRA 4O18A 3NDZA 3QR2A 3PP7A 5JNYA 2ZWNA 1GGBH 2IXQB 1WWCA 1SZGA 4PJIB 3C5XA 3KBWA 5FUOL 1FNEB 2J8GA 3TKFA 1DLHA 3KPQA 1R5WB 4R3SB 4DLMA 1XCTB 3J2PA 3UFYA 4F2MA 5A3IC 1Z0MA 3RZCC 2WBJC 2RUSA 1FO0A 2G4FA 2CW6A 3K4ZA 4AF0B 4HYRA 4U1SB 3SDCD 1RMFH 5E6RB 3OEXA 4YHMH 1SLWA 4WGHA 2NNAA 7PTDA 3QZPA 2BW5A 3T6QC 2FBRA 1FV1A 4Z42C 3VACA 4ZO8A 4UFHA 3ARZA 4G8FB 3VFMB 4Q9QL 3NZHH 1TWZA 1X7QB 4Z18A 2YPKA 1OFBA 4ZW7A 4GYFA 3WNKA 4LVOB 2BWIA 3CAQA 3ZBMA 4JGDA 1CGSL 1X9RA 1YJDL 1NOLA 4MDJB 5JR1H 2CUHA 4CBZA 1WICA 3CDYA 3GTVA 4H8UA 3RL1B 4K5PA 4A39A 4M6OL 2Z35A 4JY4B 4ELMF 4N25A 2HRPL 3SQLA 4QAWA 2C9RA 3R89A 5CIPH 2JK2A 3MRDB 3JQOB 4QHLB 3SKOB 2FFCA 4BFRA 4TXEA 4AX6A 3AM8A 3KAAA 3KFTA 4JM4L 1S2WA 2CRMA 2CCRA 5GSRA 2V7NA 2QCMA 4HCLA 1T6VN 3MROA 4K3DH 2X1TA 4TKWA 3B5GA 5FA4A 3W82A 3WTYA 3WNPA 3KL5A 1FXQA 3QJHA 4DBWA 3W28A 3U6RA 1A4MA 2WMIB 4OF8A 3NVTA 4ZTEA 1RK6A 4HQQH 3L1OL 2E56A 5HGBA 4H6QA 4PCFA 3AZRA 1DE5A 4E8CA 2FTWA 1WX0A 4HC1L 1I1AC 1J1XH 4RQQA 3V5CA 3VI3E 2H3XC 3F7PC 1LBLA 1TTQA 2F53A 3QYMA 3NRQA 4MMZC 1TCDA 12E8L 2NT1A 1TMLA 1UOLA 2DJUA 5D7IB 1UB6B 2ZKHH 3WNNA 2GJ6E 4OZ4B 3T3MF 3LTYA 2A3EA 3MRJA 3TOPA 3U1PA 1HQ4B 5EU4A 3F04A 2IANA 4F93B 1KF9B 1H7XA 1ZLPA 4KROD 4BELD 4N2IA 5IG7B 4NKOA 4Q8UA 4ML9A 1F7BA 1LUCA 5HD8C 4B9KC 1JN6B 1S5NA 3RKPA 1K72A 4ZO9A 3GSVA 1BBJB 1R6VA 1NLDL 4NJ9H 4GRLD 2GQHA 4TSCH 2ZA1A 2CXKA 5JQ9A 4P2RE 4XCYA 3KWVA 1FDYA 3BN9D 4GG6B 1PG7W 5E95B 1EDTA 5CU9A 1YMMD 5JIMA 3WUWA 4AUYA 2AXGA 4G6ML 4Z7VF 4HA0A 5JMOC 3PG2A 5ADPL 3LS5L 3SRDA 5JHDE 1MDLA 4OM1H 3V7PA 5REQA 5F96L 2DQUH 4R9XA 5I1HL 3N4AA 1I1CA 1VJIA 2O6EA 2ROXA 4HWEL 1ITUA 1T1WA 1IE7C 4YK4B 1VFTA 2BOCA 3N1QC 3GJFA 4ALAL 4KNTA 1EBHA 2P8LB 4KQ0A 1AZ2A 4YN5A 5LXEA 3LRGA 1JL8A 2XV0A 3IK2A 3FTYA 3WJLA 4R7JA 3ARSA 2Y9RT 4UQAA 5GHWL 1ESOA 4JQXC 1Q1PA 4JN6A 5DC4B 2R4RL 2ITCB 1KA9F 1ZGLB 4FA8A 3H9SE 3SCMA 4UUJA 1AGDA 4QRFA 4UIKH 5SWQA 1DQTA 4WHBA 4AZ8A 4YHKH 1ZANL 3ATAA 3VNLA 3TYAA 3SJVE 2YCJA 2VDKH 2VR7A 1EX0A 3I6TA 3C5JB 1RZJC 1RJLA 1LMIA 3CXHJ 5BVPH 3MRGA 3CSGA 4LSVL 3MRIB 3M7WA 2H6RA 1BD2A 2FWOB 4JO2L 3SSZA 3MRKB 4JREB 2GITA 1CECA 4OF5A 1UCWA 1OAJA 2X88A 4NCC2 4S10A 2PYEA 4YFEA 2F08A 4DI9A 2VDNL 4NQCB 1XISA 1EC9A 1WYJA 3RFZA 4X83A 3MV7E 2FZMA 3G6JB 2OMNA 4J5NA 5FYLH 1NDVA 3BQ5A 3KOYA 3CX5J 3AACA 2NX5B 1M6JA 2COVD 3MKGA 3QTGA 3MLTA 3LXBA 4RX4A 3K3QA 3WH7A 2ROYA 3QRBA 5ISZA 4ZJ9A 1FCUA 4Z7WF 2UXTA 5K9KB 3WLWD 4JIRA 4LAKA 1F2QA 3NJIA 1XYFA 3UY7A 4QHKI 5DEFA 4Z7QB 4OT7A 4FQJL 5JPNA 4JQ2A 5AC6A 2EAWA 4JNMA 5C6WH 2CZDA 5E5MB 4FXRA 3MZNA 3P0XA 5BUAA 4HAGA 3CC1A 5FM8A 4HZ7A 3ZR4A 3MJ7B 5TD4A 1ZVSB 2VLRA 2GTZB 5HGAB 4LLYB 1TZAA 4FG6C 4QJ5B 2LLEA 4HOZA 5CPQA 4JRWA 1VERA 3GB7B 2G0KA 3ATZA 2YZ8A 1E6OH 3HPLB 4UM8A 4GEIA 4Y4KB 4YTQA 5C8JA 1TA3B 3PL6C 2ZUTA 5B8CB 5E0KA 1KCSL 4L2LA 1XRVA 2GJZA 2NX3A 4H8WC 2WKJA 4R27A 5TE6H 4N28A 3L3IB 4PJXA 4GQQA 8TIMA 1W0VA 2IFGA 1WBHA 4Z7IA 3P1VA 1Q2SA 4JGUA 2ISVA 4PA8A 4ZS7L 1DVSA 4HS6B 3UNDA 1V02A 3T3PB 2P45B 5TPWL 4JE0A 4OFIA 2KBGA 2VXTH 3PHOA 2IPUG 1AGEB 1ET5A 5ITFB 3UYPB 1NFDE 5LQBH 3LLDA 2GY7B 3Q67A 4HUMB 5FJTA 4WSGA 4TSAH 6ALDA 3I7RA 3SE4A 1FHDA 1E4WL 3WIFA 3N12A 4P2OB 3ZRFC 1JPEA 3W38A 4AM0B 1YNLL 4GCAA 4NZJA 3P3SA 1U6AL 3LY6A 4XMXA 2YMXL 3EKZA 3IRSA 1DEEB 3B4UA 2H9AA 4JN7A 1P6AB 3A4FA 2EG8A 1W9PA 3V0EA 3O3AB 4Y96A 1LT8A 3RWIB 3N2MA 2A2QT 2QQNH 3IIOA 3TN6A 4OGYH 1QPQA 3QSRA 3IFNL 1BQKA 1VRSA 2OPCA 4R5TA 5DJ2A 2Z1SA 4FNTA 4OUUA 2IPJA 2NZ9D 1RSCA 4LBRA 1LRNA 4I0CC 2ZTBA 2R0LH 3NEXA 2BSDA 1D5ZA 4OLXL 2Q86A 4QT5B 2PLMA 5DD5H 5DMIH 1EJ8A 1H3PL 4IP7A 1I9CB 2Y2TA 1M7IB 5BS0D 3W01A 3NIGF 1E7VA 3SPVA 2R2EB 1TZ9A 4BY3A 1ZZMA 2E77A 5FACA 4YSPA 1PMYA 5EF3A 2HVJA 3AWNA 1XCQA 1MQPA 4TQEH 1WC7A 1CMOA 1P6BA 1HNYA 5F3BA 4GX8A 3EUDA 3WUBA 2CR6A 1HQRB 4IJBA 4HETA 3T8XB 3NJVA 1I7ZA 1O7DE 2IBGA 4PJ8B 3BKYL 5EB8A 4QBXA 4E42A 3TN4A 2FT8A 4DN4H 1ISXA 1YTKA 1GL4B 3HJ0A 2BSSB 3HC2A 4HWZB 3T1GA 1UBPC 4DK6A 5JQIB 4H2AA 2FX9L 1DJQA 4UT9L 4F1ZA 3CPLA 2FO8A 4ATWA 4PGZA 1QBBA 1PD0A 4U1HA 4QOKB 1FVDA 3A6BL 2D7MA 1Q7ZA 4MB3A 2J1XA 4PW4A 3H22A 3RL2B 3BE7A 2OTWB 3G18A 4R26L 3OTRA 1FO0H 3BVNA 1WCBB 1OTUD 3SCOA 3W85A 3C2AL 5JPMC 4Z8FL 6A3HA 4FO4A 1ISZA 4J3OC 5BPPA 2LLGA 5E1AB 3S96A 4FI7A 3U0PA 3QRFM 2VDMH 5CBEB 4DF1A 4ORIA 3QI9C 3C6LC 1HIML 2X6UA 4TOYL 1QNOA 3OKKA 3WH6A 5E2WH 5H2BB 2IWKA 4C1NB 5C0RL 3DVFA 4F8QA 4HHMA 4XMUA 4C8XA 1U8OA 3CHVA 2EYTB 3RPMA 3L0KA 4W9JC 2JALA 3OGCB 1AO7B 4S3FA 5IKCB 2EH8L 2Q3XA 4L4JA 4BFNA 4B9ZA 2XVGA 1UZ8B 3MRNA 2HXUA 3EOYG 2HSAA 3GHBL 5ICXA 4G56A 4K3JL 4K8RC 1JPKA 4F9LC 1AGCA 3GZQA 1XS2A 5D7EA 3S1UA 5CPOA 5LIYX 2HVNA 1WRFA 1MWAA 3D47A 5D70H 2R1YA 3BUYB 4O11A 1EAJA 4OCYL 1F00I 2Z65C 3TFKC 1IGFH 3G3MA 4CDHA 1T1YA 1MFEH 3FSVA 2BS9A 3VWJA 1TIMA 4DUWA 1GXEA 3HI6L 4MZIA 1QKZH 1PDZA 4QDPA 1IR2A 3WFBL 2C1OB 3UF9A 3QEQB 3HI5H 3BZFA 2PD9A 3X14A 1QNPA 3ABZA 3G6DH 2AQSA 1MJJB 4GRSA 4FA3A 1WE5A 4NZDA 1ETA1 3QUYD 4S23A 5E8DL 4EQ2A 3GZOA 2VXVH 5FKAB 3IVKB 1YLBB 2NQ9A 4A6YL 1C8XA 2PO6C 2WLLB 4J3ZA 2WTRB 4WSHA 2Z7UA 1RZMA 5HWNA 4Q6IA 3K81A 3WEXA 3F1QA 5AC8A 1PZDA 2A4EA 3GTNA 3GUTB 4ZODA 1UJ3C 4FXTA 1YJDC 2QQQA 3NCEB 3D3VD 4LVEA 1XF4B 2V5LA 3N2BA 3HMWL 3HB3D 2V7HA 3CFDA 3EDEA 4IRSA 1K2DB 1O5KA 5DMJB 2EDWA 4Z0BL 2AEQH 4XD3A 1KPVA 4N22A 5U7SA 3IJ7A 3RPTA 4HJGB 2WAGA 4JN1H 3QC0A 5TE4H 1HXMB 4HK3J 4A3UA 3MRQB 2XWCA 4S3CA 4JKPL 2HLFC 3UADA 2KMWA 3CLWA 5FYKD 4NUPA 3GXNA 1V6WA 1JK8A 4WEBH 3AB0B 4J6RH 2CDFB 1CCZA 4M6MH 4RGMB 5TK2A 3LNHA 1AY1H 1NEPA 4NJJA 3GJFH 1BOYA 4NO3B 4K3GA 3QUML 4DGVH 5BOZG 2WQSA 5I3FA 1JXJA 1UC4A 4YPGB 5E23A 1J5OL 4KTGA 5BRZB 2A3TA 1E9PA 5A8QA 1OX4B 3LGDA 3I6LE 4H26A 5CPLA 3VJ6A 5HNNA 2JTYA 4URIA 3IWVA 1NCGA 3QWOB 5C08A 4BK4A 3PP4H 1H7WA 1KSRA 2XFRA 3VFNA 3O6LH 5DTFA 2J8FA 1RL1A 4OF6A 1PEWA 1E51A 3BVUA 1HL2A 4J2MA 3S4SB 2APWA 4XUGA 4JHZA 2QVKA 3U2SB 1GZQB 3LNGA 2N01B 2TRSA 4G7VL 3AU1B 1YNTB 2ZXBA 3ROOB 2ZRZA 5I6PA 4XB3A 2BVPA 2XICA 2OK0L 1LLWA 1RUKL 3RLSA 1A7OH 2UV3A 3O1NA 4MXQC 1DBJL 3ONCA 3ZDYF 4GUCA 3ITYA 1FZMA 1MJ7L 3ZUCA 3LSCA 3EPOA 4WW1A 1IEBA 1N8WA 1CGWA 1Z5HA 4O02B 1TYRA 3UAJD 5C0AA 2CA4A 5LDSA 4MQTB 1M41A 3APNA 43C9A 1SGJA 3S2NA 4ALAC 1VSCA 5FLVA 5E8OA 3ESVF 5FJJA 3GO1H 3M0VA 3MJ8A 2EACA 4MD0B 4AY7A 1PZCA 3SBPA 4NQXA 1QTWA 1VHNA 4XCNB 4OZGA 2PD5A 2B1HL 2PP8A 1FWRA 2WP3T 1ZXQA 5GJNA 1XBXA 1JGUL 2F58H 4LCCA 1F41A 2PDMA 4J4KA 1MRFL 4XZ9A 5KN5A 1P2CA 1RPQA 3LKSB 4NBXB 2A83A 1A6TB 4OQVA 3N6YA 2HBVA 3CVHB 1R5VA 2VZTA 1SZFA 1SMDA 4O19A 1JZJA 4H8PA