1KXHA

Crystal structure of the complex between an inactive mutant of psychrophilic alpha-amylase (d174n) and acarbose
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
448
structure length
448
Chain Sequence
b'TPTTFVHLFEWNWQDVAQECEQYLGPKGYAAVQVSPPNEHITGSQWWTRYQPVSYELQSRGGNRAQFIDMVNRCSAAGVDIYVDTLINHMAAGSGTGTAGNSFGNKSFPIYSPQDFHESCTINNSDYGNDRYRVQNCELVGLADLDTASNYVQNTIAAYINDLQAIGVKGFRFNASKHVAASDIQSLMAKVNGSPVVFQEVIDQGGEAVGASEYLSTGLVTEFKYSTELGNTFRNGSLAWLSNFGEGWGFMPSSSAVVFVDNHDNQRGHGGAGNVITFEDGRLYDLANVFMLAYPYGYPKVMSSYDFHGDTDAGGPNVPVHNNGNLECFASNWKCEHRWSYIAGGVDFRNNTADNWAVTNWWDNTNNQISFGRGSSGHMAINKEDSTLTATVQTDMASGQYCNVLKGELSADAKSCSGEVITVNSDGTINLNIGAWDAMAIHKNAKLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-amylase
publication title Crystallographic evidence of a transglycosylation reaction: ternary complexes of a psychrophilic alpha-amylase.
pubmed doi rcsb
source organism Pseudoalteromonas haloplanktis
molecule tags Hydrolase
total genus 159
structure length 448
sequence length 448
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1kxhA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kxhA01
1HJUA 3D4YA 3B9DA 3BMVA 1C92A 1DEDA 4FNRA 1GVIA 3WQ5A 4PRWA 3I3BA 1UD8A 2EEXA 1US2A 2O92A 4FF5A 2XJ7A 4E8CA 4GI8A 1R7AA 1QBAA 5E6ZA 3BLKA 3QR3A 1JYNA 4NZFA 1GHSA 3F4VA 1LF1A 3ARQA 1H41A 5JIPA 2EAEA 2E9LA 1E0XA 1UWUA 2XIBA 3A3HA 1R46A 4DO6A 2AAAA 5E9AA 3EBVA 4UFHA 5GPRA 1UG6A 1RH9A 1LWHA 3DX1A 4WIWA 3T0BA 2XVGA 4CU8A 3T2OA 3VINA 3MANA 1DP0A 3HG3A 3GXDA 1EQPA 1JZ2A 2XSBA 4JCLA 5ABFA 5I5RA 3UR7A 4PCSA 3BSHA 4CCDA 2XM2A 1J9YA 3U5UA 5CLWA 4PN2A 1QWUA 3W4RA 5AYBA 1E1FA 4P7OA 2IGTA 2WC3A 3NJ3A 2D23A 1XH1A 4GKLA 5FL1A 1TUXA 1TFVA 3LRMA 4M80A 2F8QA 4UTFA 1B1YA 2WKLA 1X6NA 1JYWA 1SFSA 4U5IA 1W9VA 3B9EA 1WP6A 2F61A 3VM7A 4B15A 1W2VA 3DX3A 1JYXA 3AJ7A 1WDQA 5JBDA 2CBUA 2VT0A 5FKYA 4WK9A 3SUTA 4CU6A 3AYRA 4LQ1A 3ALGA 3AHYA 4W93A 3EDFA 4W8LA 5C71A 4KH2A 1CXKA 1QNQA 2AMGA 4DUWA 2VX4A 1UKSA 5D9MA 3RM8A 3BSGA 4GO8A 3OGVA 4UOQA 1G0CA 1OGGA 2E3ZA 3GXMA 4Z2IA 1E72M 3CZNA 2J74A 4GZJA 1RP8A 2A3AA 3VDHA 4J7RA 1PAMA 1UKOA 1UWTA 1E43A 4KRUA 4YN5A 2BVDA 1QI2A 1HX0A 1K9FA 3LPFA 3W82A 1H3GA 3VSTA 2J7EA 3HG5A 2VOTA 2OW6A 1B30A 2VZUA 5D9NA 4TXEA 4CD7A 4GPNA 1OGSA 2WBGA 3MUAA 4JKKA 3ZT6A 4BF7A 3VIFA 1FH8A 3AI0A 3WUEA 1Y7VA 3BVVA 2O9TA 1C93A 4N0RA 4P7QA 2WVVB 2J7CA 1W3KA 3VDCA 1TQTA 1UWIA 1HKIA 1P6WA 2FE0A 1MFUA 3ARXA 2BHYA 2WZIA 4TUFA 4H04A 1K6AA 5TD4A 3VMNA 3ZMRA 3HMCA 2UY2A 4MAZA 2NSXA 3AMLA 1ITXA 3PZOA 5I78A 1OD0A 4EE9A 1JD9A 7CGTA 4GZIA 2VZSA 2WMIB 2W66A 4AIEA 1YHTA 3CZ8A 5D8ZA 1VEMA 1BTCA 3LXBA 1W9BM 2CETA 3ZJ6A 1JL8A 3SEPA 4B9ZA 4UQCA 3S5YA 6TAAA 2Y2WA 1E6SM 4NZCA 2D2OA 1VEPA 1KCKA 3VVGA 3BUBA 3WBAA 5CQ1A 3K4DA 1B2YA 1BF2A 4CUCA 1UH3A 2V5DA 3UEQA 2Y4SA 3G6MA 4ACZB 1XD1A 2CBIA 4KMQA 4QCEA 1GOOA 4W87A 1YQ2A 2D24A 1IV8A 4CVUA 5JIWA 4PTWA 1ITCA 4UFMA 4D71A 3I3EA 1TQSA 1F4HA 5LA1A 3WNNA 5AC4A 3S5ZA 1LG2A 3K8LA 2XGIA 1BG9A 3AIQA 2VJXA 2BHUA 1S46A 4ZEPA 3WEOA 5BXRA 4GO9A 3PZTA 3VIPA 3PTQA 3U57A 3HG4A 3BLPX 1EO7A 1GCYA 1OT2A 5E6YA 4HZ7A 3CMGA 4CCCA 4GQRA 2ZX6A 3W6LA 3F5JA 3CIVA 2DSZA 3MMWA 2GVYA 3WEMA 1SMDA 2BS9A 1QI3A 2Q8XA 4W88A 4CD8A 4J3UA 1V6WA 3FAWA 2ZOXA 3NDYA 3O6AA 4JIEA 1JNDA 4M24A 2DSUA 1XC6A 4YPJA 5A1AA 3W81A 2EPNA 4M8UA 5GQBA 4MTVA 1XGZA 3OLEA 4UQ9A 3AHTA 4U2ZA 3O9NA 5D4YA 5C8BB 2G3NA 4XUYA 2WSPA 4DO4A 1DWHM 2WHMA 4E2OA 1W3LA 2WVVA 4HMDA 1ZJAA 4AIOA 4DWSD 2VR4A 1SZNA 2XN2A 8CGTA 3GNRA 3WFLA 3NSNA 1I1WA 4W7VA 3SCTA 3VD5A 2JIWA 1KR0A 3F5KA 1ISXA 3CO4A 1QX1A 4PMXA 2DIEA 4AW7A 2GJXB 3D52A 2XM1A 4NF7A 5FD0A 3VUPA 1OM0A 4MAVA 1E9LA 1HF6A 2QLYA 2XFYA 2WHKA 3AIRA 4ATDA 1M04A 4P8UA 4BQ5A 2CITA 4JL2A 3M6DA 3N15A 4DUVA 1H09A 2GK1B 1JNEA 1UD4A 4AWEA 1BGAA 6CGTA 1L8NA 4AZCB 4UQBA 3IJ8A 2ZUVA 1R7OA 3IANA 3EDJA 4TTUA 2PF0A 1JDAA 5E70A 4U5KA 1CLVA 1J01A 2GJPA 2PWEA 1A47A 1HWWA 1UA3A 3WD4A 1BGGA 2PWDA 1R85A 1PZ2A 4AD4A 4M29A 3PZVA 4YHEA 5EBAA 5CSUA 1F4AA 5EB8A 1PJ9A 3FXYA 1NWUA 3W26A 1G94A 4HPHA 1MQQA 1UR1A 1QHPA 4S3KA 5BXSA 5A6SA 2W67A 3H53A 1Q6EA 3PHAA 1CNVA 4DWSA 5ABHA 2OSYA 2FGLA 2VZTA 1HL8A 3THDA 2XWDA 4N42A 5E0CA 3AFBA 4PMZA 3T09A 3RO8A 1CGXA 4H41A 1E6ZA 4ZENA 5ABGA 3OB8A 1WAWA 3DECA 1E5NA 2UWFA 1QNRA 4GZEA 5BXTA 3KZSA 1E70M 6A3HA 3WQ4A 1D2KA 2OW7A 3LPGA 4EAMA 1U30A 4J28A 4P8VA 3U7VA 1TCMA 1V6XA 2F7QA 4ACYA 1V08A 3ARYA 4Z2LA 3BAYA 1E6NA 1J12A 4HA4A 1E6PA 3FHAA 2WW5A 3MUZ1 1XYFA 2J47A 2VQTA 1HJSA 2D20A 4BQ2A 5FOOA 1EGZA 4PMVA 3T2PA 3VSUA 4WKFA 3L4VA 1LG1A 3BGAA 3DHUA 3TTYA 1KWGA 4CD4A 1R47A 1R33A 1V0MA 2E9MA 2EACA 1VEOA 3AIVA 1OINA 1E4IA 3GZAA 1AQMA 1FHDA 4URIA 3SUVA 4V27A 1QW9A 2WMFA 4UZUA 3CPUA 1BPLB 3CUIA 3K46A 3ARWA 2YA2A 2GK1A 2BVYA 1JF6A 3WY1A 2QMKA 1GJUA 1FOBA 4AZHA 1CXHA 1WZLA 4QP0A 3MKKA 3W38A 5DFAA 4JL1A 4U33A 3AZTA 3CUJA 3BCFA 1GOMA 4UFIA 4CCEA 2G8ZA 3RMEA 5M03A 4NZJA 1L0PA 3HU7A 5BXPA 3VNYA 3AHVA 2VCBA 4FNQA 4CD5A 1GHRA 4D1JA 3EJUA 2F2HA 4WLCA 2YL5A 1UYQA 2XVKA 3RILA 4WJXA 4D6IA 4DUXA 1UKPA 1W3HA 2RGMA 4B3LA 1UKQA 4AY1A 1JFHA 2YA1A 2XVLA 1AQHA 1ZL1A 5A94A 5IHSA 1C8QA 5A6MA 5IXEA 1HJVA 1QWNA 1GUVA 3ZR6A 2DSKA 3GH7A 1EO5A 2A3BA 1UH4A 3BAJA 3N11A 1DWFM 1BYCA 1VJSA 5IHRA 1QNOA 1XYZA 3CMJA 1QPKA 1OT1A 1V3MA 4KRTA 3VDAA 1EH9A 1GQIA 3D51A 3QHMA 4AD5A 1ODUA 1V3JA 5IDIA 2DT0A 1JZ4A 1CGVA 1ISVA 3A4XA 2YIHA 1G01A 3J7HA 3GH5A 2O9PA 1TMQA 2CXGA 1O7AA 1WNOA 1V3KA 3B8SA 4RE3A 4F79A 4AZ6A 2VURA 3APGA 3T0AA 3W29A 3EMQA 3WD3A 3D3AA 1R87A 4J3WA 1B3WA 4WKHA 3SUUA 3WNOA 5EFDA 1MXGA 2Y8KA 1I1XA 3VIMA 4D6GA 5HPCA 4EKJA 3AIWA 3HJEA 1X1NA 2EPKX 2W63A 3BXWA 3T0DA 1KXVA 3GDBA 3CHDA 1QNPA 5CGTA 2VVSA 5DEZA 2XN1A 2YJQA 4HZ6A 1MW0A 1ISZA 2D22A 2X0HA 2CCRA 3WF2A 4HP5A 2D3LA 1KGXA 1Q6FA 1M03A 2FDMA 3BAIA 4UQEA 3ZSSA 3NDZA 1WE5A 1D7FA 3BLBA 3AQUA 3DC0A 2WYSA 2OSWA 2EADA 2ZUSA 2DH2A 3MO4A 3PZ9A 5D9OA 3RJXA 2Y24A 3WSUA 3MSDA 1CGUA 4PUDA 5KZ6A 1GJWA 3WNLA 2W91A 3VIJA 3DDFA 1CYGA 3PZMA 1E15A 3NIYA 1TVPA 2YLLA 1B90A 1CEOA 1FH7A 3VGEA 3CBWA 4FLOA 3M07A 2X0YA 3AISA 2XFFA 1FFQA 3VO0A 5AYIA 2WPGA 5I24A 2ZUUA 3DX2A 3AYSA 4D6DA 1JI1A 3A47A 3VSVA 3VGBA 1ODZA 2W92A 2ZIDA 5KEZA 1C90A 5DT7A 2FYVA 1VJZA 7TAAA 3K1DA 1R75A 5FIPA 3DDGA 3RM9A 1MW3A 1DHKA 1JXKA 1XH0A 1KWKA 4MNMA 2X1IA 5IFTA 2YA0A 2X2JA 1QI0A 3SUWA 4S3JA 1U33A 4NXSA 4UFLA 1HJWA 3GXTA 5ABEA 2ZUMA 1TA3A 2W61A 1C7SA 3WY2A 1UR8A 1EXPA 1BSIA 3A24A 4H8VA 4WSJA 4Y7EA 1BAGA 4W5ZA 2RGLA 2E9BA 3KWXA 1C8YA 2E4TA 5I77A 1NOFA 4U3AA 3TP4A 2Y5EA 5A6AA 2V3GA 4MNKA 3VDBA 1BFNA 4HMEA 4TX6A 1WZKA 2XIIA 3CZSA 1UOKA 5I0DA 2EBNA 1Q6DA 3FN9A 3K4AA 1M7XA 1JIBA 1HIZA 3LPOA 1RPKA 4PBGA 4NXKA 3EMCA 3WNKA 3PZUA 3N1AA 3IAPA 3LRLA 3LPPA 3VD7A 4NRSA 1HXJA 2QF8A 5GNXA 3BAWA 3DYOA 2E8YA 4F9JA 2WANA 4RL3A 3CZKA 2X2IA 3CTTA 3GTNA 3OG2A 4GI9A 2BY0A 1E0VA 5M17A 1TG7A 4V28A 1PX8A 2WCAA 2DT2A 3GXPA 2F1BA 1NWRA 1W32A 3S6TA 2WVUA 2PWFA 4F8XA 2E8ZA 1NWTA 2FH6A 4BQ3A 2OWXA 1BYAA 3W0KA 1BLIA 4TX8A 5HOSA 3NSMA 1E73M 3TV8A 3MUY1 4OUEA 1M53A 1VFOA 2HISA 4RE2A 2O9OA 5LA2A 2XYLA 1TQVA 4H8UA 4ML4A 2WLZA 1CECA 1TQUA 2CKRA 3T08A 1HNYA 3UG5A 2X05A 1KFWA 1ISWA 2ZICA 4P7LA 2GDVA 2PBGA 4M81A 4FNPA 2A3EA 2CBJA 2EPLX 2J7GA 1AQ0A 1D3CA 3VU2A 2ZUTA 2D1ZA 3VD3A 2DEPA 3WDJA 3WH9A 3WQVA 1FA2A 1JDCA 1US3A 1V3LA 4MADA 3WH5A 2XUCA 3AIUA 2J77A 3N18A 3ZJ7A 2F7RA 2IXUA 2JFEX 2FHCA 1E4LA 3WUGA 5HPOA 3EJSA 2E0PA 2YDSA 4HOZA 2WZHA 1WKYA 2VUYA 4JFVA 4ZXOA 1V3HA 1HP4A 4DO5A 2VI0A 1GZJA 4PTVA 4UOJA 4C7DA 4W84A 3KLKA 4BZYA 3MMUA 3L2MA 2BXYA 1KXQA 3WKZA 5A6BD 3IAQA 4D1IA 2IUZA 1NARA 2VTFA 1V03A 5HBFA 1PX3A 3GXFA 1KTCA 3ZR5A 1NQ6A 2CESA 4BA0A 3SCUA 3HN3A 3ZT7A 1DWGM 4MDPA 4PTXA 4ZFMA 2BV9A 3II1A 1UKTA 4A3HA 3VTRA 3PZQA 2W4XA 3BAKA 2HVMA 4AIUA 3CUHA 1UH2A 1V02A 1TVNA 1OWQA 4P8XA 4MPKA 1W9PA 4UZSA 2A3CA 5HXMA 2X2YA 4MJ2A 1HP5A 2CHNA 2WMIA 1UQYA 3CUGA 4GINA 4FK9A 3WMCA 1NOWA 2VNCA 4FNSA 3KEHA 2ESCA 4PMNA 2J62A 2NW0A 4PMRA 3NYDA 3WD1A 3FHQA 4JHZA 3LXCA 2JIEA 1KGUA 3BUPA 2VC9A 3UR8A 1JG9A 1HVXA 1V6UA 2CKSA 1HN1A 2GDUA 1B3YA 2MANA 4HA3A 2G3JA 3ZJKA 4QAWA 1CXFA 1E1EA 1ZBVA 4OZOA 5HDRA 4ACZA 2EQDA 3KL3A 4C7FA 1XCXA 4IISA 3L4XA 3BVUA 1CZ1A 1NWSA 1J18A 1WB0A 1WDRA 2W62A 1UR0A 1DWIM 3WQWA 4FLRA 1MXDA 3AMDA 5I6SA 3VIIA 4WSKA 4D6CA 5A8NA 3TONA 4JKMA 3WQ6A 5A2AA 3L4ZA 1U2YA 4UNIA 4P7RA 3O2LA 4LYRA 2XSAA 4E8DA 4A3YA 5A8QA 1KTBA 2DH3A 1E55A 1CENA 3TTQA 4MB4A 3UG4A 2OWWA 3AMCA 2ZX8A 3CUFA 3BUQA 3ZM8A 2FGZA 4FMVA 1VFUA 1VBUA 4GQQA 1H1NA 1QHZA 1CWYA 1MQPA 4W7WA 1W1PA 3SURA 1CPUA 3FAXA 1MW2A 1JAEA 2BY3A 1MFVA 2WHJA 1WPCA 3N13A 2VO5A 3A23A 2YLAA 5A2BA 4PMQA 3GBEA 4JFTA 4UR9A 1ZB5A 1OGBA 3VMOA 5BWFA 4UQAA 4LGXA 3GM8A 2F1AA 3WNMA 3L4WA 3WF1A 1NP2A 2YFOA 1M01A 4RE4A 1E5JA 4AZ5A 2XVNA 1BVNP 1E4NA 4XX6A 4CN6A 3VGHA 4B16A 4DM1A 1VF8A 2B31A 2ZXBA 1CGYA 3SCOA 4MJ4A 2WCGA 4OGZA 1ZU8A 2UY5A 3EJTA 2GJXA 5C70A 3VILA 3WDRA 4OBRA 2G3IA 5A8MA 4FLQA 3A5VA 2ZUNA 2XFRA 1VIWA 3CLWA 2OLHA 4M82A 2NT0A 3EDDA 1JZ8A 3TA9A 3BAXA 4F66A 4JFUA 3PN8A 1J0ZA 1UWQA 5DO8A 3VIGA 1ECEA 3WY4A 1FHLA 3H55A 1E6RA 4ZE4A 1HJXA 3AXHA 3OGSA 2EJ1A 2XWEA 1IT0A 2VX7A 2QMJA 4J3VA 1V0LA 3VIKA 4AZCA 2WLYA 4HMCA 1E56A 1NM9A 3WY3A 4F9DA 1GOWA 1WDSA 1PIGA 1HKKA 2DIJA 2JE8A 1ZBCA 3MU7A 2V3EA 4GIAA 1E6XM 4PMDA 3NSXA 1KBKA 5A69A 2F18A 4OIFA 3BVTA 4MB1A 3CZEA 4QLJA 3WF4A 3IK2A 3SIMA 5IFPA 4PEEA 5M5DA 1VB9A 7A3HA 2V5CA 4AD1A 2VQUA 5CPQA 4PSRA 2PC8A 1E0WA 1H5VA 3LX9A 1UR2A 4C7GA 5JBFA 4H7VA 4MNJA 2WK2A 3AROA 1EDGA 1EIBA 4DM2A 1UUQA 2FHFA 3MV01 2ZXQA 4FNTA 2CYGA 5CSYA 1W1VA 2PWGA 1LWJA 3GXIA 4FNUA 1J0JA 2DQXA 4AZIA 2WBKA 1G1YA 5ABFB 1JFXA 5E1QA 1W1TA 3WD0A 1JDDA 4PCTA 3CHEA 3AMKA 1O6IA 3FW6A 4WKAA 1FP9A 1HT6A 5BRPA 1W1YA 3CH9A 4W8AA 2YBUA 2Y8VA 1KR1A 3PZNA 3N9KA 1GNXA 2V3FA 1JGIA 2XN0A 3BH4A 1LQ0A 3OGRA 1V6YA 4HPGA 4D6FA 5A8PA 2EXOA 3CGTA 3W53A 4PSPA 4UCFA 3WEZA 1KBBA 4TOQA 3GBDA 5BRQA 3PZIA 4IM4A 1GPFA 4U2YA 1X6LA 4JAWA 4H2CA 3WF3A 1AMYA 3LMYA 5DF0A 3IJ9A 4CGTA 1GOKA 1BVZA 2CPUA 4UFJA 5E09A 1GOQA 3ZSTA 2GSJA 1MVYA 1J0KA 3KLLA 2ZX7A 3WD2A 1NP0A 1XH2A 2ZWZA 1VFFA 5HNNA 1R8LA 3ZJ8A 3ARZA 1GQJA 1GVYA 2DT3A 3EDKA 3VOCA 1PBGA 1NOUA 4CD6A 2VRQA 1PEZA 3TOPA 4PYSA 3UERA 3WMSA 2WVTA 4AZBA 3SCSA 4L4OA 3GNPA 2J4GA 2A3HA 4Q7NA 2O9RA 3FNDA 3K8MA 2VX5A 2X09A 3WQ8A 1JF5A 3AS0A 1EOMA 4J3XA 4CVWA 2J7DA 1V0NA 5BROA 1PPIA 4B9YA 2OYKA 1DTUA 1H4PA 2UY4A 1VAHA 5JBEA 3A21A 2WWCA 2XPKA 1LJYA 2WMGA 4NRRA 2NT1A 4LXFA 1KXHA 1UZ4A 5E0FA 1O7DC 3VD9A 1OD8A 4AMCA 4AYSA 2CERA 3AXIA 4EK7A 4Z2JA 2DT1A 3OZPA 1J0IA 2C7FA 1UR4A 4V2XA 5GNZA 1VFMA 5CXPA 1UWSA 2EABA 5JUVA 1E6QM 3SUSA 4AMXA 2GFTA 3LXAA 2J79A 3QOMA 2VMFA 3JUGA 3RJYA 4AYGA 1UD2A 2GUYA 1J11A 2WVSA 4PMOA 2YFNA 4TVCA 3PTMA 1I75A 1OIMA 4QFUA 1RP9A 2CBVA 4CN4A 1RD6A 3WIJA 4HU0A 4HZ8A 4QCFA 3NCOA 3RDKA 3VD4A 2EO7A 4UOZA 1R86A 3ARVA 1TE1A 2BFGA 1XSJA 4W86A 5EMYA 1QVBA 4YHGA 2BVTA 4W5UA 1E40A 2J7FA 1W3JA 3CZJA 5A95A 1GONA 2JALA 3SCQA 3VX1A 3VKKA 5LA0A 3HG2A 1N82A 2CHOA 1WDPA 2DSWA 1BG4A 3VIHA 4ATWA 1W9UA 1ZBKA 3EJRA 4JFSA 2ALWA 1HTYA 2CEQA 3W25A 3DYPA 3OIHA 1UWRA 3EYPA 3IGUA 3EJPA 4W85A 3WH7A 1JZ6A 4LX4A 1J0HA 3RCNA 3LRKA 3DYMA 3F5LA 3EJQA 3WUFA 3AIEA 3U5YA 4HOWA 4MB3A 4XZBA 2WXDM 3OLIA 1BYDA 1XSIA 4PMYA 3AS2A 4AXNA 1HKMA 4HA1A 4GI6A 4XB3A 1R34A 3L2LA 4LYPA 3HZ3A 2J75A 2QV4A 1E4MM 4AD0A 2WMKA 1LL4A 3ZO9A 1KQYA 2X8RA 1QHOA 4UQDA 5I79A 2PI6A 1ZBWA 3WDQA 1QW8A 3OZOA 2YL6A 4D72A 1G5AA 2ZE0A 1JYVA 2WMHA 1C3FA 1CGWA 1FP8A 2W5FA 3RM4A 4AD3A 2JF7A 1CTNA 3W37A 5A6LA 3VX0A 4K68A 4R27A 3SCPA 2D0HA 1MYRA 3N17A 3UESA 1K9TA 2CNCA 2XTKA 3L4UA 1B9ZA 4P7NA 4B3KA 4D6HA 3UETA 3ARPA 1QI4A 4BS0A 2YDQA 1XV8A 2ZUWA 2Z1KA 4AMWA 3AMGA 3POHA 2E40A 1GQLA 2J25A 1V02E 2D73A 1OCQA 1BQCA 4TVUA 2F7OA 2YL9A 3UCQA 4AEFA 2QPSA 4IPLA 3D50A 1XSKA 1IZKA 1JD7A 4LPCA 1TR1A 5I3DA 1BHGA 2QHAA 2D3NA 2EPOA 2C0HA 2OWCA 1QBBA 3BC9A 3QGVA 1JI2A 5GNYA 2BXZA 2OYLA 1J0YA 4WF7A 1HJQA 4ZE5A 4QLKA 1SR0A 3N04A 1PX4A 3NUKA 4X0NA 4ZXLA 3AS1A 1CGTA 1SYTA 2OYMA 3TTSA 3B9AA 3ARSA 1TQWA 3WF0A 1PS3A 3WN6A 1CIUA 3MMDA 2VX6A 3WL1A 1OSEA 4AD2A 2VRKA 1FH9A 2IXVA 1JXJA 4JHOA 1UA7A 3K8KA 3M7SA 5D9PA 4KGJA 1NH6A 1GOIA 1XCWA 1OIFA 1DWJM 1PIFA 9CGTA 4NSBA 1KGWA 2XHYA 3A6OA 3QHOA 3BMWA 1B3VA 1G9HA 3ZOAA 1HL9A 4CN1A 1J10A 4NI3A 4LYQA 3ZIZA 2WC4A 4DWSB 2ZX9A 3WDHA 2VVNA 4PUEA 3KL0A 5D8WA 4AEEA 3RIKA 3L4YA 1JAKA 1H0IA 5A6JA 4MDOA 1LL6A 1QNSA 5CLTA 5FL0A 3WBEA 3M46A 2XVPA 4M1RA 1H11A 3WH6A 3DX0A 2DDXA 3W27A 1K9EA 3CZGA 1KXTA 4X9YA 2AOSA 4JZ5A 1PZ3A 4W89A 3KE0A 3W24A 4W7UA 5A6KA 2Z1SA 3QOKA 1A3HA 3CC1A 2FHBA 3AHZA 1E3XA 1WZMA 2YKKA 2ZXDA 3AZRA 4QLLA 3AOFA 3QHNA 4X0VA 1CBGA 1UR9A 1QI5A 3WDIA 3VGFA 3AICA 3ALFA 1OBAA 1ZS2A 1Q6GA 4J3TA 1C8XA 2D0GA 4Q22A 3SCWA 4UFKA 3G6LA 4KGLA 3WH8A 2VL4A 3GYCA 1Z32X 2YDRA 1JZ7A 1V0KA 2VRJA 3I3DA 5BCAA 1W9DM 1EHNA 1EQCA 2WZEA 4XV0A 1VENA 3AS3A 3OBAA 4AZ7A 4J3SA 3TTOA 1MWOA 3AXXA 3CV5A 5DMYA 1GORA 4AISA 4P8WA 3MI6A 3BCDA 1Q6CA 3MUIA 1XRVA 3WMBA 3CZLA 2J7HA 2YL8A 4BQ4A 4EANA 1CXLA 5I23A 4W8BA 3SCVA 5AC5A 2TAAA 4L4PA 4M56A 5A6BA 1SMAA 2BY1A 2J8FA 3FY1A 4ATLA 3MV11 2PBOA 4CKQA 5CZKA 2DSVA 3A4WA 1CLXA 3MS8A 1DWAM 4E4PA 5A3HA 2XGBA 2VCAA 3VGGA 4OKDA 2ZX5A 2BY2A 3ZQ9A 3H54A 2C8NA 3KL5A 3UG3A 4JKLA 3WFZA 1E3ZA 3PZGA 5M3WA 1XHGA 2V38A 3ZT5A 2GJRA 4OJYA 3WNPA 3T2QA 5CPSA 1UASA 4JFWA 3IJ7A 5FCZA 4TVDA 1KCLA 1MW1A 3ARRA 2J7BA 1H0GA 1E71M 3PTKA 5CG0A 1IZJA 4KWUA 3OLDA 3SCNA 4D6EA 2ZWYA 4OOUA 2V3DA 1GW1A 3SCRA 3CHCA 1V6VA 3L4TA 4GXPA 2WC7A 2VZVA 2WMJA 4XZWA 1FFRA 1T0OA 2WSKA 2WB5A 2PB1A 2ZXAA 1XD0A 1OB0A 1W91A 4MB5A 4Z2KA 1W9XA 2VR5A 1EDQA 2X2HA 5EFFA 4AZGA 3VM5A 3W28A 4HOXA 2WNWA 2VZOA 3U7BA 3EDEA 3DX4A 3AHXA 2G41A 1CXIA 3BUDA 1VBRA 3PBGA 1UZ1A 1B3ZA 1HXKA 5CGMA 1UD5A 5BYWA 3WENA 2UY3A 1WCGA 1WZAA 3VPLA 5I2UA 2YBTA 4OBSA 1C91A 1CDGA 4HU8A 1AVAA 2F7PA 2XG9A 3AZSA 4DWSC 2YOCA 1UQZA 1CXEA 1Q4NX 3ARTA 1JZ5A 3GNOA 3EMZA 3OLGA 3VGDA 4J27A 4MNLA 4TTGA 1QOXA 1H2JA 4HTYA 3OA5A 5F7UA 3BUIA 2QPUA 2WWDA 2PWHA 3A22A 1V3IA 2JEPA 3D4ZA 4H8HA 1UD6A 4OOZA 5A2CA 1GQKA 3VNZA 3ECQA 1ESWA 2JEQA 1WO2A 5ECUA 1KQZA 2J8GA 1UHVA 4PMUA 2DGAA 4Z2GA 1HKJA 3DHPA 2BHZA 2WCSA 1ZJBA 1LLOA 2BNJA 3WUBA 4IUGA 4U3CA 1EOKA 2OSXA 1UD3A 3S2CA 3THCA 5CJ5A 2G4FA 4BCEA 1B0IA 1BYBA 2JF6A 5LYRA 3RPMA 3CHFA 1K9DA 1TZ7A 2FH8A 1B31A 5CPTA 2VCCA 1VRXA 1EDTA 3N12A 2WAGA 1C7TA 1HVQA 3AIBA 2DPEA 8A3HA 1KB3A 1H49A 4JCMA 3VIOA 3WELA 4U31A 1EHAA 4NX0A 2EPMX 3W6MA 2G3MA 4AC1X 5A8OA 3BVWA 2CIPA 3GH4A 2D0FA 3E1F1 4CU7A 1JZ3A 2WM0A 3MSGA 3GXNA 1MQRA 4FLSA 3BVXA 4PTMA 3A4AA 1ISYA 4R5EA 1EA9C 4A4AA 1B3XA 3D5HA 2WHLA 4QDMA 2J78A 2WKGA 1TA3B 3VMPA 4IPNB 3WL0A 5AY7A 3POCA 1LL7A 5DT5A 4Z2HA 4D6JA 3WDPP 3ARUA 1W2PA
chains in the Genus database with same CATH superfamily
4K3ZA 4H88H 3UG8A 1A5FH 4B9PA 3WKYA 4HNNA 3GSNB 2V2XA 3QEGL 1RZJC 3HPLB 1AS8A 4NZFA 2YYUA 4UAHA 2DQDH 2OS7A 1MAKA 3MDUA 1FWRA 3EOEA 2ZUQC 3A3HA 4MFDA 1A0EA 1Z9PA 3DX1A 2D69A 4S0HA 3T1GA 3H21A 5DZ9A 4EPDC 4P0DA 1N5YH 4P4RA 2ZOOA 4A6GA 1RUML 4GQ0A 1N26A 3WHXB 1YUHA 3RIAK 2Y22A 4Y1AA 1QWGA 1I8KB 1X7TA 3BLLA 4U5IA 2LQRA 3EF7A 3N5AA 3IFOB 2VABA 3E5PA 4ODSH 4NJJA 3QQXA 4WV1B 2QFRA 4ADJA 1WDQA 1MJUH 2VT0A 4NQXB 3UZXA 4KKRA 3ALGA 3AU6A 4KH2A 1HJBC 4K9EH 2FT8A 4HIEB 3GMRA 2AMGA 2X4RA 1QNQA 4XXCA 3BK0A 5EZIL 4M0XA 1U8HB 5HJLA 3WNIA 3RM8A 1UPPA 2HPMA 2ZYHA 3U4BL 5FJJA 5GJNA 1G0CA 3G5XB 4Z2IA 3UXFA 2YC1B 4GZJA 4BR1A 3RA7L 3FFCE 4WTZG 1M6OA 4NP7A 1MF2L 1HDMB 3KOFA 5FYKH 5LXXA 2QV2A 5DJ6B 3NQVA 2HG5A 1M71A 4H9ZA 3L66A 3VD1A 2OO0A 1FH8A 4WK0B 4P7QA 1H5YA 1LYXA 4DOHE 1AIFB 3I02B 1A0DA 4JFQA 1BQHB 3V0VB 3UDWC 4L4LA 2AFNA 4OY9A 1K8DB 3HURA 2A83A 3CFKB 3C8HA 1OD0A 1EMTL 3USBA 2OLDA 3SDXB 2VZSA 2J6WA 4CMHB 3WKNA 4Q9CA 3WFDH 2C4FU 2OXNA 1URZA 2K7QA 5CZJA 3H9ZA 4PGDB 3TYCA 3WQOA 1SOKA 3URNA 4R5VA 4FA7B 3MAWA 3DFPA 4XZIA 4O1BA 5CSSA 2V5SA 4OLYL 5HYJE 1XWVA 1A4JB 2JKXA 4ACZB 2P9RA 4GP4B 3TCEA 1U3JA 3RN6A 4CVUA 1ITCA 1BZEA 3FS9A 2EIKB 1TQSA 2YXWA 1JNLH 2D31B 3AG3B 2WWNA 4M7TA 4KFZC 1ZK5A 4WGWB 4L8SB 4YHZH 2XG4A 4K8HA 5J9PB 3IS4A 3BLPX 3DCPA 4W4NA 4PJGB 5IREA 4XVSH 3CIVA 3S6OA 1I1AA 3LD8B 3SCMD 1H7NA 5DD6A 1EJ6A 3V5HB 4N0YH 3E0FA 3KM2A 4P57B 2EPNA 1I9EA 4NN6B 1T7VA 2ADYA 1LO0H 4W9ZA 1W5MA 5HJ3A 3AHTA 3O9NA 2Y1AA 3WBDA 1OQFA 2YXXA 1OD9A 5DURD 1BXNA 4YVNA 5C9JB 2DQUL 2WXRA 1FJ1A 1QLRB 1SW7A 2R9HC 4E5XG 2ZSWB 5C08D 3LGGA 4HPYL 3NYKA 4Y4KC 3L23A 4BJHA 4L9LC 4UT9H 3QEHB 3L7FA 1KC5L 4ATDA 4P8UA 2EVIA 3PHOA 4YFEA 1LQ2A 1H09A 4AWEA 1BOYA 5EU4B 5AVQB 5DMKB 1M7UA 4WEBH 4QCIB 4QT5A 5HGHB 1IGIH 4A6YA 4I7UA 1EEUA 1ZHNB 4U7SA 1G4TA 3D46A 3ES7A 1OP4A 2GJ6B 1Q9LB 3SCMA 2PWDA 4E36A 3IARA 4M29A 2BSTA 5HI5D 2WPBA 3FDWA 1FO0B 2YPLE 1VESA 2OM5A 4KHXL 5A6SA 3AAZB 3THDA 3NA9H 3AFBA 2VJ0A 2HG0A 2RKXA 2BSBA 3QN3A 4AMKH 2OQLA 5GS0C 1DZBA 5KBKA 2ZYSA 3WQ4A 2WWKO 5IHZA 4WWNA 4O4YH 5LGJA 1H7PA 3SQOL 5CGBA 4YHNA 5C07E 3EX3A 3ULSB 2A38A 2PGRA 3KRSA 4G9DA 3TBSA 3C08H 3TTYA 2Y62A 1YYLH 3GJFH 5E4AA 1T1YB 3K74B 5ITFB 4V1YA 3QO1B 5T1KB 3MSRA 3EXLA 5EG6C 3GZAA 4RK8A 1FHDA 4FG2A 2OZ3A 3S37L 2E67A 3KLHD 4NSKB 4L29B 2PRMA 1JF6A 2Z00A 3AM8A 2H32A 1NFBA 1T6VN 5E56A 1TVBB 4POCA 3FUNA 1Y5XA 5IJVB 1IGJA 4MA1C 2VCBA 3TNNB 1E42A 2J1WA 4M5YL 4DUXA 3FCTB 1QLFB 3A6BL 3PULA 3R79A 4Y5VC 3S48A 4PR5A 3Q06A 3JTBA 1HS6A 1LE9A 3BAJA 5M95B 1QPKA 3DUSA 2X87A 2YZ1A 4CBZA 2I1OA 3NK3A 5DJDB 1JZ4A 2FEDD 1KN4L 2O9PA 4DF1A 2PLKA 1O7AA 1S5WA 3THAA 3IE4A 1F86A 3RWJB 3T0AA 5FOJA 1BJMA 3WD3A 3VI4A 1Y0LB 1R87A 4L0ZA 2PR9A 3OMIB 4NFCA 1G7IB 3BX7C 3GSVA 3W2MA 4QEHA 4TKWA 4XRCB 3CFCL 1YJDL 4AV5A 3VIMA 3DK0A 3V4PL 2K6ZA 3LCHA 1VBJA 3O2DH 4HU3A 1P7TB 3VJ6B 1YPZF 1GYAA 5IB5A 4K5OA 3GDBA 3PAOA 1KFBA 4YGVB 3VNDA 1CD1A 3A6CH 5TQ2H 1YMMB 3L5IA 3CFIC 5GZND 3QA3B 4R9HA 4XNAA 2GOUA 4QRPE 2I16A 4GXFA 5FECB 3DC0A 4XNXH 3ENEA 3IMRA 3G04B 4Z7UB 4CRPA 5D04C 1CC3A 2XN9E 4XNDA 4PUDA 1MRCL 2OMUA 4LUSA 4HUKB 4KEUA 1B90A 3ZHFA 1YXDA 3CBWA 1N8FA 4RMRA 3VFOB 2WPGA 2DUXA 3T5WA 3VSVA 4I9TA 3VOJA 5SWQB 3HRPA 3V6OE 5K9QI 3CASA 2HVBA 4AQEB 4US5D 2R23A 2AK1L 1YBQB 4BCYA 1U95B 4UYPA 2DLEA 1MI5B 4C56B 3LSOA 5IKCA 2NW3A 5GGUA 1RIVL 1R5YA 3O9WB 4N1CA 1GTEA 4UNVA 3D4GA 4YQXL 3ZWTA 2ICWA 1FGNH 5ESQA 4UOW1 5I1IH 3FT3B 2DYPB 5D1XB 4KO7A 3K6NA 4G6CA 4O2CA 4WGKA 4Q8OA 4KCTA 4IQDA 1M7XA 1DQQA 2SEBB 4NXKA 3Q48A 1QSFB 3MRKB 4EQ2A 2QR0B 1Q45A 3CL8A 1HXJA 2QF8A 3IJHA 1XLFA 4JUTA 3VYNA 1M57B 5M17A 2AQQA 3UZYA 1TQCC 1A8ZA 1NWRA 2ZWSA 2JH2A 5IQNA 1W32A 3VUAA 1F4XH 4RMVA 4YXGA 2E8ZA 1MZRA 4Z7NE 3BHBB 2AV1A 1A9BA 4JJOA 4IQLA 1RJLA 1TZGH 4DI9A 2BW4A 1XBZA 1D3GA 5LA2A 3D39D 3QULA 3F7VA 2IDTA 5LGZA 2VDML 3V4BA 5CD5D 3OG3A 3VOFA 4X42A 4KK5C 2X1XR 3W11D 3BLEA 4ZOCA 6PTDA 3QJRB 3FO1B 3DRTA 5F1NA 3CU1A 2P5WE 5DDHA 3H3BC 2IXUA 2JFEX 2YRPA 1UEYA 1E4LA 5HPOA 4GGBA 3K5RA 4JBSA 4OWGA 4UT6H 4MWFB 3K5SA 4YEEA 4C7DA 3UOAB 4NO0D 3OZKA 2WB7A 5AW8B 1NCNA 3TV3L 2C79A 3ECBA 1KTCA 3RU8L 2HRWA 1TTBA 2ZCKH 4EOWL 1IKFL 4HU2A 4A3HA 4GKZB 1QO2A 3CQKA 2WV8A 4GW5B 3CUHA 2EG8A 3M8OH 1ME7A 3PL6D 3HBPA 4MPKA 2F5AL 4IQHA 3BZ5A 2Z3FA 1PSKH 3HG1E 4DKEH 4LAMA 1XYMA 3WEBA 3ZKXB 4PMNA 1F4WH 2J62A 2NW0A 1OAKL 5CJOL 3QPQC 4G1EB 4O2FB 1HN1A 2LAAA 4HA3A 4L1WA 2VC5A 2HPTA 2IBBA 4FQPA 5CJBA 2QQNL 4LZKA 3BVUA 3V0EA 1WB0A 2IANA 2FZ3B 2H2SC 4JDVB 3ZDXF 3WK1A 2AQRA 4JKMA 1CB7B 2ADAA 3OAYH 2XI9A 4XNBA 1SFHA 2K9UA 1KTBA 2DH3A 1BXVA 4H00A 5FYKD 1T5WB 2FLIA 3T6ZA 2PPEA 1P6FA 2HXAA 4F7PA 4GQQA 2F74A 1CDCA 1BFTA 3W73A 2I9TB 3BH9A 3K6DA 3O3RA 5AUMB 4UBDD 1RPXA 3MC0A 4Z0JA 3VMOA 3QXUA 3P9MA 4JPIB 1GL4B 4A66A 3QJUB 1NAKL 2EIZB 5HHVH 3NM1A 4F2FA 1D5IH 2APWA 4TX9A 4B16A 1BAWA 5E4EB 2Q1EA 4AKPA 3SCOA 4KCVA 4OIBA 2EDRA 4P2OC 3PWJA 1SMOA 1G7QB 1AY1L 1T41A 2GVJA 3K13A 3AXHA 5FO9B 4Q9BA 4HMCA 4ZS7H 3H42H 1NM9A 4KKLC 1XIIA 4C1NB 2BSCA 1P9MA 1EGJA 3MU7A 4PJHF 4OQVA 3GAYA 4MNQB 4UYQA 3OVQA 4OVUA 3L3OC 1IXNA 1DO6A 3KWWA 4WNQA 1W1VA 3GXIA 1IQ8A 1MAML 2FT7A 2NYYC 3MB9A 5LKYA 2WBKA 4NJ9L 2B0MA 2A6JB 1EJWC 3ES6B 1X1ZA 1NDWA 3MT1A 5J8LA 3MHGA 1QR4A 3CH9A 1FSKB 1N67A 2VMDA 3P4OA 4EXBA 4WDIA 1JGIA 3EZJB 5C0BA 5EZJB 2P80D 3PF2A 4HDIB 3ESNA 1ZVHA 5CIPB 3C8FA 3QR0A 3QF0A 1ZVSA 1AMYA 4HZMA 4L1DA 1CDBA 1YJDC 2RDUA 3V0WL 1GOQA 1TCRB 2OJZH 3CDZB 1WZ1H 1M7OA 3HB3D 1MREH 1BOGB 2HTLC 1NDGA 1EV2E 3Q6FB 3VOCA 1YN6A 2LABA 2L5HA 1OM3L 1EJUC 3EEGA 4XXWA 4IGBD 2AL2B 4LEXH 4AZBA 4I0PA 5BZAA 4HNOA 5H8UA 1MJJB 2WXFA 4K7FA 4OUUB 5DX7A 4IFKA 2B77A 3HC4L 3AS0A 3LYEA 4J3XA 4MGGA 5H8DA 1PPIA 1B3OA 2XZ7A 2F53E 3W7LA 1H7WA 4LCSA 3PWLB 2XJKA 5FA4B 3TBYB 1UZ4A 1QAPA 1NL0H 1OD8A 3HV9A 3SYAA 4KNQA 1BGXH 4XPAH 3KDPB 5DVOA 1E8XA 2J5LB 3CUPA 1PO9A 1DQLH 1NAML 1RERA 1J11A 4WHCA 4UT9A 3N85L 4CQ8A 4MYXA 5LIYX 2X9XA 3DPBA 2HXUA 1PUDA 4K23L 1S6NA 2O6DA 5EMYA 1XIFA 5A95A 5AZ1A 2Q02A 2ZRUA 4BFOA 3RVXC 4AUUA 4E38A 1ICQA 1ZGDA 1R3HA 4JFSA 1BIIB 4RLDA 4XPFH 3F4CA 3OAZH 3L4CA 2D03L 5I66A 1CFNB 2PGEA 2AK4E 4RETB 5EF3A 2VLMD 4K8RL 4WDXA 3QDME 3QUMH 4U6TA 4DOHB 3IDXL 1FFTB 1KNOA 1JRHH 1Q0YH 2QV4A 2WYHA 5AD0B 1WKEA 3K72B 3NDOA 3TIMA 1NFAA 1G5AA 3W72A 4AUJA 2W5FA 3STEA 2O4QA 3EHBD 2JF7A 4GA8A 5CC3A 3GSOA 2SFPA 1DLFL 2QEJA 3PAUA 4W9GC 4D6HA 2GJLA 3KCPA 1A64A 2OULB 5MENE 2MQGA 4S11A 3QGAC 1ACYH 2E40A 1GYMA 1RI8A 3GJFA 3WJWA 1H9VA 2P76A 2DD8H 3LCYA 2P8BA 4UZGA 2C0HA 4L64A 3Q37A 2LW3A 5FM4A 3PSVA 4ZE5A 3DV6B 3UZWA 4IQEA 1CIUA 4JG5A 2X9WA 1U1HA 1IEAA 4CSPA 3VWJD 1T3FB 1W8GA 2ZWKA 3FTXA 3M0YA 3KTSA 2CGRL 2ICSA 3CK0H 1MNZA 1J9QA 2WM1A 1NF7A 5J1AB 1PV8A 4AENB 4N4QA 4GS7C 4O2EB 1QOKA 3UPRB 4EF3A 3WFAA 1QNSA 3IJLA 3DX0A 2YQBA 1RIHH 4ZMLA 3GDKA 4OR1A 1UM4L 4Z7WF 2ZZ4A 4IBVA 7REQA 1MRFL 3K6IA 1PKQA 5L7XL 3KG5A 3EW3B 4WKZA 1SVZA 2GDQA 2FECI 5F88A 3SKMB 4IOIB 3ABMB 3ALFA 1OBAA 1G7JB 1ZRQA 1GGIL 1FBIL 1OXYA 2ZDSA 3MMEA 3WH8A 3V0JA 1WWAX 3S88H 3CSTA 2I25N 4AC4A 4IJTA 1HO1A 1LOLA 1F45A 2EXYC 3O2DA 3MI6A 2XHNA 4LASH 4BQ4A 4XCFL 4HISA 2YPLB 5I23A 3SCVA 5TE6H 4NJAH 2TAAA 3F65A 5EN2A 5LCVH 1KZQA 4PJHA 5IQMA 3DG6A 4HT3A 5A3HA 2AZUA 4FQIL 1A3LL 1BJ1H 5H4YA 1H8NA 1AJ2A 2C8NA 1L7IL 3STZA 2ZOUA 2Y8UA 2EICA 1S5HB 1M5WA 2VIRA 2PU0A 5EC1B 2HKAA 3L3HA 3OPZH 5AW9B 3S1WA 2QHRL 3B0YA 4YOKA 1I7RA 3P8IA 1MG2C 3ABGA 2VZVA 4JZNB 3WN5A 3LNIA 4U6XB 2R0ZH 1JNJA 3C60C 1ZA6B 1M42A 4ODTL 1IR1A 4PG2A 3PBGA 1K02A 3MNZA 3DFNA 2HTKD 4JQIH 4IOSD 3IJEA 1I1CA 4OV5B 5AYQA 1FLTX 3F58H 1POJA 1IE4A 2QPEB 4RNIA 4LKCA 4P2RD 4GIPD 1HXYA 3N42B 1CFSB 2BZDA 3WOVA 3EMZA 3IGAB 5T3ZD 1DEEA 4U0RB 3VXNB 1TEGA 4OV9A 2DORA 1W0YT 2R1YA 2IAMB 5EBWB 3R10A 3EBGA 1PZDA 4K3HA 2JELL 3RDTC 5DHYA 2AV7B 7ENLA 3THCA 4G6AD 4QGTA 1XGPB 4K07A 4P49A 4TL4A 4WEMB 3RWFA 4UTWA 5B39B 4MRBA 4E0CA 4MSWB 2J8UB 4HKZA 2YGYA 4JPQA 3F01A 5I26A 3O7UA 1OP3H 4RGNE 1O5KA 3DZ1A 3U4KA 4IOSA 4OCSL 4ZMPA 4DAIA 4A7UA 3HI5H 5JR1L 3WHE0 3DURB 4JIRA 1NIFA 1AR2A 3NG5A 2XACC 4TQPA 2P43B 1FDLL 1WXYA 4FR1A 4WK4B 3P0XA 2YXOA 1ZLSH 4PUWA 4QRPB 2OTPA 2HQAA 5E6ZA 2X12A 1BWLA 1QFWL 1KLGB 4Y8AA 2PGFA 3UZQA 2XN9B 4I6KA 2YD9A 5CEYA 3ZRCC 5KYWB 3EX4A 1LD9B 4M1DH 1NDVA 3M4HA 3GHSA 3QZBA 3MANA 3NR0A 3V16A 2H6PA 3O41A 3VVWA 5CD3A 5CZTA 4PJBF 4KWWA 4RX0A 2HFFA 3VKDA 4HAGA 5IHLB 3GDLA 4GYJA 1RMFL 4QRUB 2PCFA 3WSQH 1JYWA 4AXWA 3CQ0A 1MCLA 5DY3A 2OGYA 2J12B 1WH0A 3OKEA 3VQ2C 4DVOA 4UMCA 3DLQR 4CJ0A 1N7KA 2EXWC 5EO9B 5E9DE 3GMQA 5JTWA 4G80A 2NXYD 4YDJA 3EOBA 2VSCA 1UKSA 5E6IB 4K8RC 4RMQA 4G6KL 1QZ1A 4GO8A 5HGAB 3C2RA 2HMID 1I9CB 5EV7A 5AW6B 2K7PA 5GJTL 3MCLH 5HGDA 3QI9C 4J7RA 1UKOA 4MWAD 4M8VA 4N9BA 5IV2A 4HKPA 3GVQA 4OTXH 1ZP3A 4NUGH 5CEZE 3P0YL 3U48A 3DEQA 2ESVD 2IW0A 4LAKA 5T3XL 3ZT6A 2BP0A 1EGMA 4WCJA 4NO2A 5T1MB 4ZODA 4Z7NB 4NENB 2FE0A 2UBPC 1MFUA 1R3JA 3ARXA 2JCWA 3EX1A 3VMNA 5IVXE 3U2IA 1ITXA 1AS6A 5I78A 1W6TA 4Z7WA 3TSMA 2G0KA 5J3HC 1BKSA 3DENA 3HMXA 5BXFB 5IWLA 1QFWM 4UQCA 3Q65A 2BPBA 1S1PA 3GHEL 4C4UA 3GKZA 4L3ED 3BW3A 1DJYA 3B9KC 3ARBC 1RJQA 3UGRA 3RR1A 4U1LA 2V5DA 2GWGA 3UEQA 2CUMA 1TJGL 3TKFA 1XD1A 3KPOB 3QPKA 1J9CT 1R3SA 2D24A 1REIA 1C5DB 2ZUXA 3AIQA 1R5WA 4KROB 1BZ7A 3WEOA 2Q8LA 5EC2A 4HZ7A 4CCCA 1JGUL 3WEMA 3RPIB 2DICA 4J3UA 3CE1A 4KQ3L 4LS1A 4PWKA 4ODBD 4YPJA 4LCIH 3HUJF 5CUSL 3PBYA 5BQ7A 5D4YA 4TQEH 5D37A 3HG1B 4X6DE 1H1ZA 3IU4H 4HMDA 4KT2A 2K0RA 3SN6N 2XN2A 4JJHA 4KK6D 3E0IA 1O95A 2HKFH 1FF5A 1GHFH 3FO9A 4PRDB 5T1JA 4GRLC 1ITBB 2CIKA 4FD0A 1MRDH 1KD0A 1F11A 2IGFH 3FUKA 5F3BA 1PNDA 4GFTB 2XFYA 1BM3H 2BCMA 3N15A 3QUZA 2OZ0A 5CJXC 1JNEA 2R7EA 2BOFX 2Z7GA 3KJ4B 3SKOB 3TN0D 2L4OA 5M94B 5B1JC 3W7EA 1XS2A 1UC6A 2V5TA 3U9UB 2GJPA 2PWEA 1HWWA 1UA3A 2Y06H 4ENED 4GYPA 4ICWA 4M6NL 3H4XA 2V9QA 2C7UA 5IVOA 3SDDB 5I6KA 3H53A 3L7RA 1NAL1 4UTJA 2FATL 4KFMA 5DBUA 2Q7NA 3VI3A 4PMZA 2QKIC 3D3VE 1CGXA 2YMXL 3NM3A 2NX5A 3CU7A 3SPHA 2NY0D 1CFTA 1UM5H 1WAWA 3W7KA 4C54A 1JPEA 1DN0B 1USQA 3FCSA 1RU9L 3BW9B 1EPVA 4EAMA 1DSFL 2LOEA 4ZUUA 4LHUB 4KKAC 1IEBA 3QIBB 5KANI 3NCEB 4HJGB 4XNYH 1S78D 3IJSA 3FPYA 2DY3A 3S5NA 4FHAA 2P52A 3HS9A 5ACLA 2HYMA 2F1EA 4EMZA 4IRJC 4U1JA 3EOYG 4YUEL 1U8MA 4AH2B 1AQMA 2UX6A 3VOHA 3BZDA 4BV1A 2IADB 3EZ4A 3MODH 3QUMA 3PPFA 1XB3A 4PJ9A 1UWAA 2IKIA 2FWOB 1HKLH 3GD1C 1RK6A 3MWAA 2DUZA 2J6EA 4PLKC 3V0AC 3CPGA 4DP6X 4X7DC 4U6VL 3M17A 1K4HA 2A6KB 2MMXA 4ZTOH 3SKNB 2NQJA 3AWFA 3UYIA 1G7MB 5F9WC 5FC9A 2XWZA 3NAVA 3HG0A 4NKIL 5I15H 1XLJA 2A5UA 3A3XA 1B0GA 1S3RA 3EYQC 1UXMA 2ZE3A 1NCWL 1WUNT 1KJVB 3QEQB 2NLIA 3OKDA 4PJBA 4JJ5B 4QF1A 4PRHD 5DRXA 4L4TA 3L08A 2PCEA 3U9PH 2QVFB 3LZRA 1JPSL 4QR7A 1P4LB 3PUGA 3JSSA 1TU2A 4NAFB 1Q6QA 4WHBA 3VFMA 3QDGE 4R5XA 1SBSL 1TJRA 4POZC 3UZZA 3EKLA 4HWBH 1FORL 3BANA 2AVGA 2YMOA 1I1XA 1VBGA 3GMLB 5JYLA 2PTYA 1WFUA 1DLHB 5GRXG 1GYLA 3RZCB 3UFYA 2EPKX 4JYEA 1H50A 3H7VA 4I7VA 5D7LE 3PQYE 1LM1A 3ZKND 5ESAA 2VVSA 4HZ6A 2KERA 4NQCE 4C65A 4HUVA 1B4RA 3I6LD 3GKFA 4TVPH 4BDVB 2YLHA 4MJ5B 3D25B 2DZSA 5ALCH 2CXKA 2QGEA 4UIKL 3L7EB 1BXXA 1F07A 3O6FD 1ZE3H 3BAEL 3PZMA 2Y2TA 3OR6A 5C0AD 4DIXA 4UV7H 4FLOA 2ADIB 2X0YA 3AISA 2DRUA 4FZ8H 4HEPG 2BC4A 4O51B 4JO2L 3AYSA 3FB7A 2PLMA 3PWAA 5DMGC 5CEXA 3VGBA 2W92A 2ZIDA 5GHWL 4CQ9A 2FYVA 2Z92B 1XG4A 1MW3A 1JXKA 2DZXA 4MNMA 1NEZG 1D5BB 1R3KA 2AK4B 5KG9A 4KJWC 1N18A 1ZT4B 4C83B 1W5OA 1GIGL 1C7SA 1XR9A 2Y6SD 4WUIA 1AO7B 4WSJA 4Y7EA 3FS2A 1A5UA 2E5DA 5LCVA 5AWNL 2JKEA 4N4PA 4JAMB 4RRPM 1NOFA 3DUUB 4XVOA 2ZVRA 4M3PA 1B4EA 1HL2A 1XIHA 4HX1B 1G43A 1AE6H 3ZYIA 5SX4I 4NUQA 1AGFB 2QJDA 1LT7A 4HYTB 4PBGA 5BMFL 3UO1L 4EPKA 3VD7A 1GW9A 3BEWB 5C0AA 4RAVB 5MENB 1NUNB 1NC4B 5C2BH 5J6HA 1A3WA 3OG2A 2P42B 3DGBA 1TG7A 5DWUL 4NGHL 1OZMA 4P5KB 3T3MB 3RVUC 3TIDB 4MKVA 3KPSE 5DK0A 2KLRA 4F8XA 1YNKH 1NWTA 2XKSA 1GC1H 4HVXA 4U1MB 1TPXB 2PPAA 4JQIA 2N7AA 3TV8A 1OFBA 3EWXA 3HN5A 2HISA 2V7NB 3T8MA 1YAZA 4O58H 4ML4A 3VNLA 3T08A 4ELMA 3QNFA 1X6UA 1BMWA 2YUVA 3B1TA 3D85B 1AMXA 3I74A 4PGEB 3QCUL 2X9YA 3H7LA 4YVXA 3WH9A 3WQVA 4GQPH 4KUCF 2YUWA 3MGOA 5DUJA 1ETA1 3V0TA 3PJUA 1S7VB 4TPRL 1L7TH 3NSYA 1SXBA 2R15A 2WZHA 2VUYA 2XZQL 5JLZB 4PTVA 3W2NA 2AJUL 4Z18A 3BW4A 1THCA 3S36X 4OKVB 4XK2A 5IR1B 2GB2A 4U1KA 3GXFA 1XB8A 4NWTH 4AYFB 4ORGA 3C2VA 4WO0A 4JQXC 2CLFA 3QSTA 1FE8H 4BUQA 2EG7A 4PVMA 1KYOJ 3TJIA 1UH2A 4QY8A 3EOAB 5JVLA 2A3CA 2HK0A 3VG9B 3HW7A 5LBGA 3BGFC 3I6SA 1T20A 5AB0A 2AEQL 4ZI8A 1MCPL 1R5VA 3HQOA 4XGZB 1KACB 2EC8A 5F0MB 3P2TA 5KOVC 4N2OA 4LVDA 4DP8X 3GNXA 1ZFJA 1B3YA 2MANA 4M4RB 3FQ2A 4OZOA 4MX7B 1IWAA 2ON3A 5DCCA 3S6CA 4KNUA 4FLRA 1GGBH 3PNUA 2NQZA 1XCTA 3HPJB 3WQ6A 3JWDC 5HR6A 2OI9C 1G4MA 3FRUB 4AVFA 3ORWA 4E8DA 2LE9A 1CICD 1ZLWH 4MB4A 1A7QH 3Q6GL 3L5MA 5KS9A 3TN6A 4ZOAA 2OWWA 2FGZA 4ONOA 5BZWB 1QHZA 3HO8A 4DHLA 1JAEA 3FB8B 1X9RA 2BY3A 1MFVA 2A6IB 3N13A 4PMQA 4I3RL 3V1PA 4N9EA 4NQVA 2L7EA 1MVUA 3VNJA 1ORSA 2QQKL 4XX5A 5KVGE 4P2CG 4Y1TA 3BQUB 2FLMA 3NSJA 5ENLA 3GIZH 3FJTA 2OJEA 2R56L 4M82A 1BRLA 3VE9A 3MLZL 4LBSA 2N0MA 1ECEA 1HJXA 5DRNB 3S97C 2QMJA 5DJAB 3US1A 4GQ9L 3LZOA 1FWWA 3QKZA 5I6NA 4R4ND 1XGTA 3QYCA 3O1NA 1EF3A 2BFVH 5EIIA 4AD1A 2XA3A 1AR1B 2VDNH 4KKPA 3LX9A 1WIUA 2X0WA 2WK2A 5FA5A 1DVZA 1Y1DA 4AZIA 3WQPA 1H6FA 1B57A 2PDUA 4RGNB 2F54E 3GEWB 4HQQL 5B3JE 4WKAA 4L1HA 1W0VA 2XIJA 4GIOA 3CYJA 3QORD 4BK5C 3H3KA 5CBAA 4OZGA 4Z1YA 3NRQA 3RVWD 3UTTE 2Z4QA 3FQNA 1J86A 5F1SA 5IBXA 4X4XB 3TBWB 3MJ8B 4PJ8A 1GOKA 2CPUA 5E09A 1QLEL 1XBDA 4Y2WA 2KDGA 3AUVA 4LSSL 1EAOA 4DW2H 4OSUL 4MCZA 4YBQD 2I60L 3LN5A 4LSRH 3ISWA 3CU2A 3HVDA 2NX9A 1PAZA 3MPCA 3AXMA 5E5RB 2VX5A 2D2CC 1JF5A 2KH2B 4IOFD 4M9PA 2X4PA 4K3EL 2EH8H 3I75B 2NY4C 4XB7A 2A21A 3MZ2A 5CLYA 3U1QA 2Q3XA 4KUCD 5E0FA 2WQDA 3QORA 4I87A 5LXEA 4AYSA 3LCFA 3NJKA 4EK7A 2NR6C 1MJ8H 1INQB 4ZUSA 4NAJA 4DP5X 1RK1B 3JUGA 2UZXA 2CIIA 5E9DB 3RY4A 3BVNB 2PYED 2EECA 4DGVL 3RDKA 1FZKA 2V69A 1WISA 5BVPH 2NXGA 1OCBA 1TWZA 4ZW3A 2ACUA 3C5JB 4HC1H 1E40A 3SGJA 3VI4F 3TA3A 2IDUA 3TVMB 1WDPA 1ECYA 1QW7A 1EJRC 6XIMA 3IGUA 5AVYB 4YCOA 3NNTA 2ITEA 4HOWA 4JFFA 1J8HA 3Q2VA 1QR1A 3SD5A 5HQMA 1FYTA 4OCYH 5HY9B 1GZQB 4DKAA 3KXFE 3ZO9A 2R8WA 4KO5A 4WW1B 4U1HB 2GWNA 3WDQA 4YO0B 3NFSL 4C8XA 1ZNNA 2NLJA 4TNEA 4O02B 4B9KC 2R83A 2PYEA 1SU5A 4AD3A 5KAQF 2AEIT 1J5TA 2APSA 3CCHA 1A1MB 3K2MC 3CQJA 3NSDA 1M7DB 4XAPA 1GZPA 4JVWA 1I1AD 1Z66A 3SQBA 4KKCD 3MUUA 3WUWA 4MZIA 2Y69B 2IFGA 3Q2NA 1ZD6A 3MRBA 2XZZA 1BWKA 4ZPTB 3AMGA 3F7PC 3IUDA 3MRRA 4NIKB 4PODA 1B2WL 2K8MA 5INCA 1EP3A 3D50A 1XSKA 2LAGB 3BDYL 5DVNA 3SIKA 1BEUA 2XG5A 1MRQA 1JVLA 2HFGH 3LENA 1OCJA 3W5MA 2X44D 1IM3A 4C6IA 1DPMA 3O6YX 5E2VL 3Q5TA 2HUEA 4F9PC 3DOSB 4RX4A 3ARSA 3WF0A 4LPVA 4UM9D 2RACA 4ZOEA 1OEZW 3MYZA 3QHOA 3R94A 4R3SB 5AHNA 3H2QA 1M1XA 1HZLA 1PS9A 4X6DB 1WAEA 4WEVX 2G75A 3M6YA 3K6SB 4WGVB 2LTQB 2CRIA 3CXHJ 3DFSA 4WDWA 4B9CA 2NY6D 4YTRA 2XH7A 3L1GA 2A9CA 3PTDA 3O2WH 4PV8B 2WNGA 4W89A 4AK2A 4LVOB 4GC4A 2H9GA 4ERSL 2FQDA 2WIIA 3AZRA 3RNQB 5ERWB 5E8OB 1JWUA 4K7PH 3VXRE 3MA7B 1IL1A 5I82A 4HWBA 1JZHA 1Z9SA 1W0WA 2YD4A 1WQ5A 4WI2A 4UM9A 2BX5A 2MCAA 1A5CA 1O12A 3L3IA 1NINA 4XMLH 1VS1A 5TJWK 3MBFA 2J7HA 1PYFA 1ECZA 3U46B 1T66C 3WI9A 1KEGH 2DJMA 3KPLA 2V7HA 4JTKA 4YHIA 1NGXB 4FXGB 3KJ6H 4XCYB 4RWHA 4TMPA 4KO9A 4S38A 1QR7A 3F05A 1Q0XH 4OKDA 3APYA 7FABL 3H54A 3QQ1A 1MO0A 4NZ5A 3MY9A 3T2QA 4E42A 4ROQA 3IJ7A 1CBJA 1R24B 2J7BA 5EU7E 5IBUB 1A3RH 5JQ6L 2GGEA 1GW1A 4LSTH 1NFDE 1JE6A 2O5ZH 4XZWA 1FGVH 2RJMA 1ZALA 4YDNA 2ODHA 1EJXC 2DQCH 4Z3FA 3W7DA 3BDBA 1ZKAA 1B9KA 4MVBD 4KHTL 1TVLA 3MXWL 2VUOA 4N2NA 4JR5A 3T0ED 1J1PH 4OF0A 4E2BA 4XO8A 5K9KB 3JYBA 4OBSA 2AEPH 3QXVA 5BJTA 2Q87A 5FW6A 1J88A 4Z8FH 1IFGA 1I85C 2A4EA 3ES8A 2NNXA 3QR1A 4TTGA 4Z95L 4JIIX 1EJVC 4F37F 4L5FE 4JDZA 4LEEA 2EO9A 4O8AA 2COQA 1Z3GL 3ZE0E 2G30A 2JEPA 4H8HA 2P1YA 4A7GA 4F1ZA 1OT4A 3V5KB 4QXGH 3AW5A 3TLLA 1V55B 3LKRB 3GSRA 1RZ7L 1X5MA 3DHPA 4S2CA 5TE7L 2VZ1A 4YBLB 1BBJA 5CJQH 1QRKA 4GFIA 1B0IA 2ARWA 3MI3A 4L4MA 4I8DA 3RPMA 4NRYB 4EPSA 1KCRH 1TNMA 3M5YA 3X2QB 4D8ZA 2DPEA 1KB3A 1H49A 2EPMX 2VLRD 5D5MA 1P7QB 2VM3A 3QDGB 2GEQA 3T0EA 3DHFA 4Z7AA 2H9AB 1EZLA 3VFWA 4L4VD 3L12A 3T4AA 3GXNA 2NZ9D 3A0OA 2JK5A 1QFUH 3GLEA 4LVEA 3BG9A 2PS2A 1KYDA 1TZHB 3QDJD 2H26B 4KVPA 2ERJC 4J4PA 4A2LA 3ISRA 2Q5BA 5H2BB 4Z2HA 4HIIA 4BK8A 1EYWA 1E4XL 5D55A 3UJIH 3ID7A 1MDLA 3KOWA 5BOPA 4NQCB 3I3BA 2VR6A 2R1KA 1L6WA 1IT9H 4DQWA 3UJSA 3OXRB 1JYNA 3N4FA 2MNWA 2ZCLL 5KZCB 4FKHA 3M45A 1S2UA 3S46A 3OZ9L 4HHPA 5F4SA 4CA4A 4F7TA 4L37A 5JIIA 2ZP0T 3TH3T 1KRBC 1IBFA 4BFIB 2VLRA 4XR8C 3FCUB 4PWJA 2E7FA 1OTUC 4JCLA 4OQTL 2Z1WA 4L4VA 3HFML 3VFNA 5CCKH 2YHGA 1ZXQA 3MRNB 1FFOB 4M80A 3MLSL 4UTFA 3QDJA 3PABB 2WKLA 3D0AA 3OB0H 4IMGA 1LBFA 1QTPA 2F15A 3VM7A 3V55A 3ZPDA 4FFZL 1Q6RA 4M7LL 4BEIA 3RRAA 5SV3A 2X1QA 2EXSA 2R1WB 3GJEA 4G2AA 5KSBE 4Z0XA 3S98A 1UBSA 4GCXA 1OC7A 4R2GC 5KSUB 1YYCA 1EHXA 4F80A 2BVDA 2X1SA 3PUCA 1FNEB 3IIOA 1B30A 4AEHH 4QXIA 4JPVH 3KPSB 5BOEA 3E3QC 5C0RH 1VDGA 3PUUA 2ZRWA 5C6TL 4PQXA 4KJQC 2AMXA 4JPKL 5CWSB 3EJZD 1PKYA 4GUOA 4OECA 4YDZA 4ZMQA 3EYUH 5SWZA 1UGKA 4TUFA 4L1TA 2Z8VC 5IFJB 3T0TA 2UY2A 2YCEA 3W83A 4LKXB 3IVUA 3ABZA 2V9UA 1OAXL 2QELA 4WAFA 1E6JH 4XZHA 3MU3A 3HRZC 5CN3A 3P9LB 4JY6B 3FIGA 1EPFA 4ODHH 3JTTB 2TPSA 3DIDA 2HJFB 1FZJB 1N0LB 4HD5A 4H26A 4YC2C 3GG8A 4BH8B 4ANUA 4Y9EA 2JKPA 1FWGC 4QCEA 1ET5A 1IV8A 3V2AR 2R0WL 1IC5L 1DQVA 5I18L 4QHUB 2BHUA 3PTQA 3M5XA 3X3FL 1DQMH 2VN6A 3OL2A 3GC2A 1KCUL 4DFHA 3NN8B 5AYUH 1LO4L 2NUPA 2QVKA 2IAND 3CB8A 4Q14A 3TH4T 5F6HJ 1RY0A 3FAWA 3S3DB 3QEZA 4M03A 1CI3M 1DE4B 1K8XA 1RUKL 1XLGA 4ZFFB 4KBPA 2CZFA 2C18A 4OI8A 4B4FA 3E9TA 2WSPA 3CFEB 4DO4A 2WHMA 3ONBA 3QARA 3CV6A 2PYFA 1W3LA 3WS3A 3WFLA 1E0UA 1ONQA 1WFIA 3VD5A 4YX2H 1OX4A 1PLBA 1QX1A 5I8EA 1BVNT 2Z7KA 1UPMB 4FQLH 3N2MA 3P14A 1NCHA 5ECGA 3WLTA 2VDKL 3VUPA 3BP7B 3QJFA 5HHQB 4B27A 3MPGA 2Q6WB 1KIUA 4PTTB 3NPWA 1IIGA 4MKMA 4ZNEE 4UQBA 3ARFB 4IUOA 4AWSA 5HYIA 4S1RH 2GJNA 5D93C 2CDFA 4R4FL 3P7YA 1EHKB 3AUWB 5E70A 4NQEE 3AUJA 1XGYH 1QAWA 2GSGB 3VAEA 4PLJD 1MCRA 3R1GL 2D7MA 3DAQA 2VDPH 5F89B 3TAOA 1F4AA 3GQFA 3TCXA 3LQMA 2OQJA 2E27H 4YFDB 3DX9B 3NZRA 4PB9L 1HWHB 3PHAA 3P8JA 1KJ3L 3IU3A 2MKWA 4X6CB 5MEOB 4WSHA 4NNPL 1NFIA 1N0XH 4YR6A 1LK3H 3MJ9H 4JNXA 1QNVA 4G6JH 2CLPA 2PF8A 1QRNE 4GEIA 1X4XA 4YBHA 2QF7A 1U30A 3LDBC 4ETQA 1YZZA 4P8VA 1TCMA 1KM1A 3DI3B 4BQ2A 3BARA 4X4KA 3ZIMA 5C0BD 4G7EB 2AABH 5TF1H 4I9WE 4GKTA 3MLTB 2BVYA 4G7FA 4UQ2A 4FJ6A 1GJUA 3NQ2A 4HKJA 5DFAA 1A4LA 2JTYA 3BCFA 4LL1A 4WWKC 3SBWC 2G8ZA 1P2CA 4FQ1H 3HU7A 5I6OA 3IPFA 2ZA1A 4IPJA 1E9OA 3WZ0E 3T42A 4D1JA 1I8UA 3QNZB 4I0PD 2F6AA 3C6EA 4B3LA 2W65B 3UTTB 4GVGA 2I85A 1HNFA 2KS0A 5E6UB 5TFSH 1KM3A 4EZLA 5HD8D 4ES4A 3DX7B 5IZ7A 4B9IA 1T80A 2J43A 3EFOA 3CHRA 3ITTA 5FHBH 1EH9A 4NYUA 4RDZA 1S3KL 3GDTA 1JV2A 1JHLH 5HWMA 1BD2B 1UOZA 3J7HA 4ADSA 4QTIL 1X3DA 2EP6A 1F8TH 4Q8QA 5ADPL 4AZ6A 4YLQT 2VURA 3BPLC 2VERA 1CD9B 5AKVA 2VDLL 5FJPA 2LU7A 1T7WA 1MCKA 3H9HB 3T6QC 3QRGH 4IRZH 3T0VA 2NY3C 4H4NA 4WWID 1DJZA 3QJVB 4K3DH 1R3WA 3JT2A 4NO3B 5KTEL 1UBPC 4XXDA 5HHPA 1GY1A 2PKDA 5E2JA 2DBLH 3RFZB 4CL7A 3BKML 1GS6X 2Y5TA 3GRBA 2W95A 4O1EA 4G1NA 3LK6A 2ZOTA 3AGWA 2FDMA 5AVVB 4IJBA 3PZ9A 3A13A 4WUUE 1QSEE 4AJVA 2VN5A 2W91A 3PPSA 1F8MA 1CYGA 1B4LA 3JWNG 1LGVA 5I1AB 3N43F 4LUIA 5AVSB 2MWCA 4IIGA 5DC2A 3DX2A 4UNUA 1KBJA 3NGBC 2X3CA 3M0LA 2YEQA 4WHDA 1BVOA 4MQXC 3K1DA 1K8IB 3HR6A 1ZSXA 4UTBL 1HFUA 2OMYA 3K71B 1M7PA 3VFTA 1TA3A 2E7LA 2WBWB 3V4LA 1RA5A 2TSBA 3A24A 4KTDH 3TTEA 3FFCB 3GNNA 5CZRA 3AAMA 1U3HC 2DQFA 3L5WA 3K4AA 3ULVE 2J4WH 5IM51 3N1PC 3REVB 1X9UA 3BZEB 4R33A 4XTIA 4RPQA 4O28A 2PUZA 5GNXA 3BAWA 4N8VB 1MELA 4YE0A 3B9OA 4NQ1A 2A3LA 5LNWA 2ROYA 2V9RA 4JEJA 1PZAA 2CUAA 3NRFA 2FR4A 4XPHH 5F7MC 3SRDA 3GXPA 3U0PB 4JEGB 1X7FA 1E67A 1F2XK 3ABRA 4KI1A 2VEKA 2J6VA 2OWXA 2R69H 1E73M 4EXKA 3PSWA 5HYJB 4ENLA 3BQ5A 2IWKA 3BIKA 1JNHA 1HGWA 1TQUA 4LMQE 4XPGH 4KS0A 2ODOA 1F3DJ 2ZG3A 4N5ED 2DLGA 1OB1A 3CXOA 1IEXA 5L6YL 1FA2A 3AU1B 2PDHA 4LVHC 2FEEI 1QPRA 1IEWA 2JKTM 3I9PA 1ADQL 1WKYA 3DETC 4DO5A 4DJDC 2V0TA 3Q1SH 3RGVA 3L2MA 2Y7OA 3HZMB 1ZSDA 3DI0A 1KT2A 3FQYA 2A74A 3P4MA 4JFZH 3SCUA 1XF1A 4HCRL 1SPQA 3WS6A 4JFDE 5TGBB 1IXOA 3BAKA 3VXRB 8FABB 4PG9B 2K3HA 1MCOL 2HRLA 5HBBA 2WUCL 1HP5A 5E1HB 5C2UB 1A3XA 1T83C 4M6QA 2ATAA 3TZVB 1UACL 4PMRA 4QRTA 4GFXA 3CVBA 3BN3B 5JXAL 2GVEA 1JHKL 4O0KA 4HWEH 1RAKA 1EXHA 2PLTA 2EQDA 4Q4MA 3PUEA 1Q85A 4S3FA 4MXVF 3TNOA 1DWIM 1MH5B 5FS5A 2J9XA 1YQVL 2NMSA 3WUWG 1GSMA 4LYRA 4WD0A 5LDUA 3W7CA 1CENA 1I53A 5DRCA 1SXSA 4UAOC 4TV6A 1WEJL 2Q8AL 3ZM8A 5FCUH 3UX9B 3GW3A 1W1PA 4IIQC 3LG3A 1R1CA 5KJ7E 1FC2D 2VO5A 5I6LA 2UY6B 4QI3A 2GYSA 4D0DB 1EHLH 3NACL 3RTQA 4FZEH 3ASNB 4LVNC 3P2BA 3O06A 5C07B 3SDOA 4AL8H 3GBNL 2OX1A 4HU4A 3NGFA 4XVUC 1HAWA 2XFWA 3SKJL 3EGJA 1Y07A 3D48R 3T2NH 5I74B 3EJTA 1QKZH 1MZYA 1IGYA 4FLQA 4G5AA 3L9RA 4J3OC 5FA3A 1JMXA 4FRWA 4KKNA 4JN2B 5BUPA 3VIGA 1J6PA 1N3NB 1O7VA 3BWUF 2M8XA 1IGWA 2DYRB 2WLYA 4HIJB 5I07A 5HHXL 5EULV 3QK0A 1HKKA 4Z1DA 1KBPA 3CZEA 5CPLA 4YNYA 1VB9A 4FA6A 1DQUA 2Y07L 5LG6A 5K93A 2PXYC 2HLAB 1URIA 4QKXB 1EIBA 4WI6A 3MV01 4FNTA 4DPCX 5CLZA 2P8MB 4WCYH 4KTEL 5B8CC 2YX0A 5I6XC 4DJFC 2IQ9L 5JPNC 3VI3F 4OLWL 4HGWB 4HKXB 1NBYA 4LOEA 1P5VB 2R2EB 5FJIA 3V4VH 3ISYA 5H35A 1YYAA 4WO4A 4TSAL 2Y36H 2W0FB 4TLTA 3BH4A 1YY8A 4CQDA 1JGEA 1F02I 2MPAL 4Z08A 1S8DB 1PSCA 5D2XA 1RFDL 3W0WA 3ZK0A 4HUNB 3WFHA 3UPWA 3LH8A 1Q8MA 4G7YH 3WFCH 4Q58C 2ZZ3A 4EI5A 4I9XA 4U05A 1PLGL 3ARDA 2MQ0A 2OEMA 3NO1A 4GAGH 4Y16B 2HROA 4QHLB 4DCQA 3IFNL 4ZMNA 3FCGA 5I1JH 4FL4B 4UT6A 3KZPA 5C7HA 1VPOH 3Q9PA 5F9OL 2OYKA 3M1BA 2Z29A 4IFOA 5LNEA 2XWXA 4MASA 3S0PA 4Z3HA 1ZGLB 3FFSA 1X4YA 4A2DA 3M43A 5XIAA 3MZNA 3VD9A 2R1MA 5E94B 2FPVA 4MPQA 2CHRA 3LBMA 3LQAH 1BVKB 4ICCX 3CHOA 4IDLA 2NZ1A 2EDXA 4TUOA 1LUCB 1UD2A 4FI6A 4MRCA 3LEPA 4LW7A 1L6FA 3IBOA 1CMOA 3E12A 1AXTH 1U92A 4AY0A 4XBJA 4NC2B 3SOTA 4UDUB 2FGWL 5ACZA 2P3EA 4CNNA 3FA3A 1EBGA 5KSBB 4L18A 5HWJA 1GRWA 3HS0C 1EXUA 3FTGA 1SY6H 4RZ5A 4BKLA 3W9EA 3QS3A 3EJRA 2ALWA 1PG7L 3C52A 3ZHKA 1FNAA 5GGVH 3BP6B 3NPVA 3WUFA 4P23B 1CBVH 1VR6A 5I1HL 2HZGA 4W4QA 1E51A 2FO4B 4HA1A 1R34A 1XFCA 4LYPA 3GLCA 1SRDA 1QXLA 4A3QA 1TWIA 2EE0A 4Z78A 5LXVA 1TJIL 1QW8A 5J11C 1HILB 4Q0XL 1V8EA 3MJ9A 4O9HH 1L5GA 2J7LA 1TPB1 3GFXA 4MAUL 4WTXA 3GZPA 1A0QL 4IX0A 1DBJH 3ZLHA 4GRMA 3D33A 1Q9KB 1UCBL 3F4DA 1XV8A 5EUKB 2I5YL 4BFAA 2W0KA 4AEFA 1BQLL 2RMNA 4REQA 2VJ8A 2QHAA 2D3NA 2AJYH 3BC9A 2QAPA 2BXZA 4F57L 1YY9C 2P5WB 4MFHA 2BCKB 1DQJB 2APVA 3QUKA 3NUKA 5IQ7L 3HCVA 3KBHE 2APFA 3TTSA 3WJMA 2PMZA 1KM5A 2AAVA 1C9WA 4AB4A 1OSEA 3N34A 4P4KC 2ZP9A 3K8KA 3CL6A 1UXSA 4AG0A 5D9PA 3TJEL 1XBRA 2A6LA 3QUZD 2ZKMX 5KAQG 1BQUA 3LN3A 3EO1B 2HA1A 2IDFA 2GG1A 5IMMA 5HUPA 1E5AA 4NCC2 4PJ6A 5E51A 3IMVA 4FF7A 3T9PA 1NMBH 2NNAA 3C3NA 2O30A 1W72B 4HGXA 1L9RA 2NY5L 4X4MA 4B92A 4F0RA 2JMRA 1S9KC 1EO8L 1TYGA 5FL0A 1SFJA 3Q2LA 4YSTA 3L1OL 1G9EA 1IKNA 4GEJA 2VW7A 3D30A 4MJIA 4TOYL 3FJ6A 5E6SB 1KIRA 4AJ0A 3D9AL 1R5IB 2GT9B 2NUTA 4XHQA 4JOMA 2NX5D 3PWIA 2CLEA 5K9CA 3SCWA 1WFTA 3NTYA 4MHHI 4NQEB 4J8RA 3J27A 6PAZA 4GUIA 3ZIYA 4IPPA 4JTEA 1OP9A 4ELMF 4E2VA 4J3SA 2ZG2A 4JY9A 1ZIBA 4TRPH 5CZVH 4YVUA 2WO2B 3QW9A 5IB3B 1JR1A 3C6LB 1YG9A 4I0CC 2VC2B 4KDTA 2DEWX 5I1GH 4JG0H 2YD8A 3T8XA 3H7UA 4DZIA 2VOMA 2DQIH 1DVUA 1LT8A 5A43C 5L8JB 5LNVA 2RCSL 4PJ9D 3WCZA 1S7RA 1QRNB 2P8PB 1DJNA 2XNAA 2X5PA 4ORZC 4KY1L 3SDCA 2X4OB 4N85A 1EZWA 4MNHA 3JWOH 3NZUA 4GKOA 2CKBL 3WKML 2HN7A 3TEYA 4W4OC 1JTPA 4DZHA 3L4TA 2WC7A 3GFYA 2B9AA 1I4FB 4LDCA 4ZXBB 5K39A 1ZA3B 4OGXL 4ZW5A 5AVTB 3GUTB 3KD4A 3KOZA 4B7LA 3P3SA 1KELH 4HK0A 2A7BA 3HMJG 3EDEA 1LVEA 4XOAA 3BUDA 1IXPA 5FGBC 1VBRA 2YAQA 3NQCA 4XO5A 1FVPA 4N2LA 1YEIL 3B04A 5I76B 3H7RA 2VFEA 4DTGH 1FBAA 2G60L 1C91A 1SO6A 4KITB 3V6FA 4L4TD 4JB9H 4DWSC 4EIZC 2FEJA 1YA5A 5BPPA 2AKZA 1N7MH 2LR4A 2WJ7A 4HK3N 5JW3H 4E9LA 3ALXA 3CH0A 1HUVA 1GT8A 3OSVA 4JZJA 3ZFHA 3SPVB 3S8WA 4U1NA 4Z1PA 1LQAA 4QITA 5KS9F 4D3CH 2DGAA 5TDOB 5ILTL 1YSOA 2BHZA 3AREA 1VRSA 4F4RA 2JCCA 4U3CA 5I73B 2CAKA 2DJUA 4LY8A 2JKJA 4LAZA 1XICA 5LYRA 2CGZA 3JV4B 1Z3NA 1ZHKB 2Q20A 1PZCA 2VGLM 1NZRA 1US0A 2VCCA 3DVGA 2R69A 8A3HA 2NV1A 3SBPA 4PJXF 5AVUB 3UXIA 4MGXA 2IWFA 3E1F1 5JIKA 4RGMC 1SLXA 2YR1A 1IC0A 2Y7GA 4WW2C 3NVDA 2FJHB 5FKAB 3INOA 2BGSA 3O6ML 4OCWL 3C0SA 4C58B 1J9RA 2AXHA 4U7KA 4GCAA 4S3CA 4D0CB 4D6JA 1T1WB 5K1NA 3FO0L 2QADB 3W39A 5J56B 4FNRA 2VM9A 2R2BA 4PUKA 1BREA 2GQ8A 3EOTH 2EEXA 3B6SB 5DT1L 2F53B 4RESB 5T1DH 3BLKA 2GFBA 4K71C 3EYFB 5I3FA 1H7RA 1U8QA 4HV8A 4NZ8A 1X9LA 1EUNA 2X2GA 4WUUB 3STLB 4RXGA 1QSEB 3F7RA 4XBPA 4M5ZL 1RH9A 5DUML 3LCLA 5F1KC 3FHEA 1PWMA 1QYGH 1UOVA 1D7KA 2NW2A 3BGJA 5AZ0A 1MSPA 1UWXK 1A6AB 4I0KA 1FRGL 4OZGF 1TUXA 1XEUA 3M7FB 2UUDH 1AJ0A 1G67A 4R83A 1IWPA 1KXVC 3HZYA 1OAUH 5DHEA 3AJ7A 2X4TA 3MNWA 3KH3A 1DJQA 4B5VA 1YLBB 3AHYA 5C71A 1CXKA 3EOOA 3C6CA 5D9MA 3MP3A 2DLTA 5HDWA 5J1TC 1E1CB 2X42A 1P5UA 2XTJC 1L2UA 2YQ3A 3GK8H 3QDMB 4DK3A 2PLCA 1U91B 2E3ZA 3QUXA 4WFGD 1E72M 1VADB 3RX3A 3MTRA 2DVUA 1C1EL 3UZEC 3BP5B 4I5BA 5IEKA 4KRUA 3VGAB 1QI2A 1HX0A 1K9FA 2OW6A 1VKXB 1ZTXL 3MUAA 4JTSA 4UIOA 2O9TA 2HEJA 1WBZB 2I32A 1GGOA 1VD6A 4KRMB 4YN3A 3HMCA 1OK0A 2A1WL 5KINA 2EDEA 4G3YL 4U1IA 2EH7H 7CGTA 5K5YA 4GRWH 2FB2A 5BVJB 1E9YB 4XT1C 2R1XB 1D5ZB 2BWDA 2FUTA 2ZCGA 3C5ZB 3KHQA 3QUYB 5C9UA 4I2XE 3V7MA 4KZDL 3K4DA 3R7QA 3RY6A 3LBOA 4XAZA 3S3PA 1WCBA 2VAJA 3K30A 1SN2A 3FU0A 3GRWL 3RK8A 2ATPB 1F4HA 3NFNA 3IJQA 2EYSA 3K8LA 4HG4J 2W0LA 4ZEPA 2XQYA 1KCXA 3VIPA 1T7ZA 2NY5C 1EO7A 1SUJA 2DWEB 1I9RL 3WYRA 4JFDB 2DJXA 1ACZA 3L6FA 3MKCA 4WGXA 1H15A 2IWEA 2Y6TE 3V4VA 1XF2B 1T1ZA 4AGLA 3BT0A 4AGNA 4N4YB 3WXVL 4MTVA 5U4NA 1LLWA 1XGZA 3SDAC 2R4SL 5KZMA 2C91A 4XP5H 3S4TA 2F7IA 5D03A 4W7VA 2QDHA 5AB2A 5C0IB 1F6PA 4JN1L 4YDKL 2YD2A 4ZO7A 5MKGB 2YB1A 3ABLB 1T2XA 3NCWA 5HYSB 1BG1A 1HF6A 3NIFF 2YAPA 4HHMA 3ATDA 2E75C 4GI4A 1SZRA 2WLJA 4RQQA 2H1XA 2B5IB 1UFUA 1L0XA 2YRBA 2E5BA 1SEBA 2ZWLT 3LS9A 3VXUA 4OFQA 3U3HA 2YEVB 3LH2L 1R7OA 3I9GH 2M2DA 3HC0A 3IXAA 2QJMA 1TG8A 2XKNA 3CVHL 4XMWA 4Y4HD 1V54B 3SQLA 1BGGA 2E6JA 4KRPC 4XE5B 1CURA 4K3JH 2QR6A 4JFEA 4PCYA 1EC7A 3X14A 1S7SB 4FYTA 4HPHA 1MQQA 1M2OA 5K9DA 1K6QL 3VA2C 3WLWC 5D7SL 3M5ZA 3IM1A 5DLCA 5LWYL 2A7NA 2GI7A 1P7HL 5LIKX 4RNFA 5T33H 4QHKI 1QNRA 2VLJA 2OXGA 3U9IA 2CLZB 2XUWA 5K9XA 3QXDB 4PJXA 4D2NA 1BMZA 4APQD 2IALA 2NY7H 2GTZA 4BXVA 4UCGA 4D8AA 5DC0A 4Y7MA 1PW3A 4FFTA 4ELKA 4NDMB 2E6YA 1YEEH 4WFHE 4JM4L 1VEOA 4Y4HA 4LP5A 1I1FA 2V2TB 2BSSA 4G8AC 4P05A 1OLZA 4PJ8D 3GMPB 2AXGB 1FZOA 3WY1A 1FOBA 3KW8A 2BVPA 4FKKA 1N10A 1CS6A 3CDFA 3Q13A 1L0PA 5CHNA 1E5YA 5F2FA 3M7OA 3NYZA 4JM0A 2F2HA 4PY7B 4TL5A 1X5JA 4MJHA 4FI4A 3TWBA 1JFHA 2HKHL 1P1ZA 4HF5H 4JDTL 4L6OA 4BWTA 4KU1A 1E7VA 4H6RA 1A65A 4DQOL 1FWNA 5F8RC 2Z31C 4APQA 4DQAA 1UH4A 3EOUA 2GBUA 3N11A 5LHDA 3ABQA 1V3MA 3T6VA 2FSEB 1A0CA 2IMNA 3II2A 1VLXA 2XWTB 4FDWA 3BRDA 5E2UL 3AT0A 4EAEA 2WJDA 1LRQA