1KXHA

Crystal structure of the complex between an inactive mutant of psychrophilic alpha-amylase (d174n) and acarbose
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
448
structure length
448
Chain Sequence
TPTTFVHLFEWNWQDVAQECEQYLGPKGYAAVQVSPPNEHITGSQWWTRYQPVSYELQSRGGNRAQFIDMVNRCSAAGVDIYVDTLINHMAAGSGTGTAGNSFGNKSFPIYSPQDFHESCTINNSDYGNDRYRVQNCELVGLADLDTASNYVQNTIAAYINDLQAIGVKGFRFNASKHVAASDIQSLMAKVNGSPVVFQEVIDQGGEAVGASEYLSTGLVTEFKYSTELGNTFRNGSLAWLSNFGEGWGFMPSSSAVVFVDNHDNQRGHGGAGNVITFEDGRLYDLANVFMLAYPYGYPKVMSSYDFHGDTDAGGPNVPVHNNGNLECFASNWKCEHRWSYIAGGVDFRNNTADNWAVTNWWDNTNNQISFGRGSSGHMAINKEDSTLTATVQTDMASGQYCNVLKGELSADAKSCSGEVITVNSDGTINLNIGAWDAMAIHKNAKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallographic evidence of a transglycosylation reaction: ternary complexes of a psychrophilic alpha-amylase.
pubmed doi rcsb
source organism Pseudoalteromonas haloplanktis
molecule tags Hydrolase
molecule keywords alpha-amylase
total genus 159
structure length 448
sequence length 448
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1kxhA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kxhA01
5LA1A 1S46A 4WKHA 3L4YA 4ZXOA 3AIVA 1GZJA 4P8WA 2HVMA 4E8CA 3RMEA 2E9BA 1E6QM 5A95A 3AYRA 4KMQA 2F1BA 1OIMA 1R85A 3OGRA 2WZHA 1K6AA 2CETA 1UYQA 5ABFB 1CXEA 3VGBA 3KE0A 4TUFA 4ATWA 3MUZ1 1C8YA 4U5KA 1GJUA 2GSJA 4BQ2A 5I78A 1Q6GA 1J18A 1QHOA 4HZ8A 1UWTA 1NM9A 1EIBA 3VU2A 1EQPA 5DFAA 4NZJA 3GZAA 3CZGA 4PMOA 3GNPA 3W28A 3SCRA 1KR1A 2CHOA 1GUVA 1OSEA 2ZICA 1EOKA 2WKGA 4CUCA 1V3MA 1J01A 3HMCA 3UETA 3HU7A 1ECEA 1J0KA 2WBKA 1VFMA 3SCTA 2Y24A 2D22A 3RDKA 2DH2A 1UR0A 3NJ3A 1K9FA 4AZCA 1Q6CA 3WEZA 5AY7A 2WANA 3KZSA 4DUVA 3THCA 4DWSB 2CXGA 2F2HA 3A4XA 1HJWA 1HX0A 1ZBWA 3UESA 3WD0A 2WLYA 1XCWA 3TA9A 2WCSA 4V2XA 1M01A 1VFOA 4FLQA 3WY3A 4AIOA 2DSZA 5I23A 2EEXA 4PCTA 2DSKA 4P8VA 3VGGA 3L4UA 2BFGA 1GOKA 2AOSA 2WLZA 2VMFA 3TP4A 3O9NA 1DWGM 4GZEA 1ZBKA 2GDVA 1JYNA 1QI4A 1UD6A 2WVUA 3DECA 1E56A 1JZ3A 2ESCA 3IAPA 2OSXA 2G3MA 1HJXA 4RE4A 5JBFA 3N15A 4ML4A 4CU6A 1QX1A 4M82A 3ARPA 1KQYA 5FD0A 4LPCA 1W1PA 2CBVA 2XSAA 4BQ3A 4D6EA 7A3HA 3GNOA 3BVTA 2ZUNA 7TAAA 5A2CA 3WKZA 3CHFA 2XUCA 3RO8A 2BY0A 2YL8A 3NSXA 5BXRA 1HKMA 3LXBA 2ZUWA 1DWIM 4MNKA 2DEPA 2BY2A 1G94A 2VVSA 1HJQA 1C3FA 1CTNA 1C7SA 1HTYA 5ECUA 1CGTA 3VMNA 1EHNA 3K8LA 1V08A 1JD9A 3WELA 2XVGA 3SCSA 4MB5A 3EJQA 1Q6FA 3RM9A 4NXSA 3VIGA 3I3EA 4FLOA 3CHDA 3AS0A 4CD8A 1OM0A 2QPSA 1B0IA 1XRVA 3W27A 7CGTA 1E5JA 2J62A 1GQJA 2FDMA 3K4DA 3T08A 2ZX8A 5HXMA 1TFVA 3MKKA 1H0GA 3UR7A 3VD9A 1WE5A 1GHSA 4PYSA 4CCEA 3WFLA 1OT1A 2YIHA 3A3HA 4DWSD 4URIA 3D51A 4GZJA 1JFXA 3NIYA 1ISVA 3WDHA 2JIEA 4UQBA 2DPEA 4ATDA 1US2A 4DWSC 4WKFA 1CZ1A 2OWWA 1W9UA 1BG9A 3G6LA 3GXPA 1UR2A 3U7BA 1LL4A 1CGVA 3WH6A 2EBNA 4AY1A 3EDFA 3GXMA 2VTFA 1EDGA 2VRKA 3VIKA 2X0HA 3UERA 3LRKA 4YHGA 1TQUA 4FF5A 1EDQA 4JKKA 3JUGA 2CBJA 3U7VA 1Q6EA 1BAGA 1PX8A 3VO0A 2Y5EA 3BAIA 4JL1A 3TONA 1YQ2A 3WNLA 5M3WA 1ZS2A 3B9EA 5I79A 3TOPA 3QOMA 4HOZA 1B9ZA 1UASA 4AMXA 1NOWA 3QGVA 2WMIA 3AMCA 3GXFA 4UZUA 3BUIA 3W82A 2FHBA 1HJUA 4HP5A 1TCMA 3SCUA 4M8UA 2W92A 1E4NA 1QWUA 1XYZA 1HNYA 3WDRA 1CLVA 1OIFA 1KGWA 1ZBCA 3AOFA 2WSPA 4Z2GA 5I2UA 5JBDA 3IJ9A 4P7OA 2XVKA 1TQTA 1JFHA 5A6JA 2WZIA 5JBEA 4XZWA 5CZKA 3B9DA 1QW8A 1E6ZA 3IAQA 2CITA 3D4ZA 1BGAA 3PZQA 3SCOA 3W25A 4U3AA 4UQEA 4B16A 2V38A 1R34A 1X1NA 4W8AA 4M56A 4W8BA 3T2PA 1BYAA 1EO7A 2X2IA 1ITXA 2WKLA 4X0VA 3W24A 1XSIA 1H09A 4YPJA 3FAXA 3APGA 4XB3A 1XSJA 2DT0A 1R87A 1MW1A 4B9ZA 2BHYA 3AZSA 1LG1A 1B1YA 3ZMRA 2NT1A 4J3XA 2E9MA 3ZR6A 3VIJA 1D7FA 2CPUA 9CGTA 4AMWA 1I1XA 1BLIA 1X6NA 1H11A 5C71A 1ZBVA 3RM8A 3BXWA 1BSIA 2ZX5A 3N11A 4AD3A 2O9TA 4P7RA 3DX2A 4UFJA 1E3ZA 1GOQA 5CGMA 1KGUA 1CGWA 3BUBA 4DM1A 4LYQA 5TD4A 1TQWA 2WC3A 3BH4A 1CXIA 1UZ1A 3AIRA 3EBVA 1UUQA 1V0MA 1X6LA 4QLKA 3VIIA 1ITCA 2PWHA 4H41A 2GK1A 3SUVA 5JUVA 1MXDA 3VUPA 3WQWA 2GJRA 2JF7A 3GXDA 4GKLA 1VAHA 1VFFA 4D6GA 4KWUA 4EAMA 3SCQA 5A3HA 4HMEA 5KEZA 1W9PA 4RE2A 1PZ2A 1MQQA 4NZCA 4JHZA 1HL8A 5CPTA 4AZHA 4MNMA 2XWDA 5FOOA 2X8RA 4GQRA 4LYRA 1OBAA 3MMDA 5BYWA 4PTMA 4UOQA 4D6JA 4JCMA 3DDFA 1QNRA 3AYSA 4B3KA 3WQVA 1LWHA 4NX0A 3WDJA 3SEPA 4EE9A 3TV8A 1UA3A 4JKMA 4W87A 3WIJA 5DO8A 1JDDA 4HPHA 5I6SA 3IGUA 2XN2A 2XM2A 1D3CA 1E1EA 2J7GA 2PC8A 3EJUA 3BVVA 3DX4A 1JZ8A 2XN1A 2G41A 2CBIA 3K4AA 3A23A 2VCAA 5AYBA 3AHXA 4ACZB 4H8UA 5C8BB 5EFDA 5D9OA 2EQDA 1Q4NX 3W37A 2FGLA 3MV11 3DDGA 1J0YA 2VO5A 4K68A 1R7AA 1WP6A 3J7HA 2W61A 5GPRA 4QAWA 3CIVA 1Z32X 4W7WA 2J7BA 3W6MA 4GI9A 3PN8A 2YFNA 2VI0A 5C70A 3PZGA 2X0YA 1V3KA 1I1WA 3VVGA 4W5ZA 4R27A 3MMUA 2BNJA 2DIEA 4OIFA 1W3JA 2X2YA 5A94A 1UH4A 3B8SA 4FK9A 2BXZA 1KFWA 1F4AA 1KCLA 2YLAA 5CPSA 4CD4A 3CLWA 1WDRA 3DHPA 1EDTA 1OINA 3EMZA 3K8KA 2D24A 3ARYA 4W5UA 2F7OA 1XSKA 3TTSA 3QR3A 1VENA 4JIEA 4M1RA 2WHMA 5IFTA 1FH9A 4XZBA 1E4LA 1DP0A 2G8ZA 3N04A 2XVNA 1AVAA 3EDEA 2D20A 4Q7NA 1BG4A 2EPOA 3WY2A 1UKOA 4DWSA 2GK1B 2WXDM 3VMOA 1E71M 4B15A 2XWEA 2F61A 3POCA 2QF8A 3FHQA 4PUEA 3KLKA 1WZKA 1BTCA 2RGLA 1V0KA 3LXAA 1U30A 1TR1A 2J75A 2WAGA 5FKYA 4LX4A 2J7DA 1EHAA 1XH1A 1FH8A 3OZOA 3AMKA 3CH9A 2D2OA 3WFZA 5BRPA 4LQ1A 2WYSA 2AAAA 4Q22A 3H55A 2WMKA 1ZL1A 1W32A 1CXFA 4UOZA 1TG7A 3SCWA 4XUYA 4C7GA 2PF0A 4EANA 3NSMA 4NRSA 5LA2A 4J3SA 4GI6A 4AYGA 4J27A 1A3HA 2UWFA 1HJSA 3VM5A 5CPQA 3VIOA 3AHYA 1JI2A 1U2YA 1WB0A 1UR1A 1WZMA 2ZUMA 3DHUA 1J0ZA 3LX9A 1LWJA 1UD3A 1CECA 2FH8A 1KWKA 4MB1A 4Z2HA 4AD2A 3AS1A 1C90A 3GNRA 3SCPA 1QI2A 2WM0A 4FNPA 3ARXA 3T0BA 4H8HA 2W66A 3VX0A 2VUYA 2W67A 2A3EA 4WJXA 3GH4A 4CVUA 6CGTA 5IFPA 3WF1A 4U3CA 1J0IA 5A8MA 3EJTA 1UWIA 3AIQA 3WENA 5EB8A 5DT5A 3L2MA 2J78A 2CEQA 2VJXA 3CHCA 3NDYA 3PTQA 4GO9A 1V6YA 5FL1A 3DYPA 2ZOXA 3SCNA 1C8QA 2ZUTA 2YLLA 4P8UA 3D3AA 4KGJA 2V5DA 3WN6A 3D5HA 1JIBA 4FNUA 2WBGA 1KGXA 4UFIA 3A6OA 1KCKA 5D4YA 3CZNA 4IM4A 3VKKA 1ESWA 1CXLA 1BGGA 3PZUA 1VEMA 1CLXA 5IXEA 4HMDA 4AIEA 4TVDA 3AHTA 3ZSTA 3EJSA 4CN6A 4A3HA 3UG4A 1LJYA 3OGSA 3VGDA 1XYFA 3CC1A 1UR9A 1IZJA 2OYLA 4C7DA 3DC0A 4J3VA 2J4GA 4Y7EA 1RPKA 3QHOA 3VNZA 3BLKA 2J7EA 3BUDA 1OGBA 3VIFA 2VT0A 4NXKA 2AMGA 2F8QA 3VDBA 4GZIA 2OSYA 1HVQA 2OYKA 1VEOA 3WNNA 1NWRA 3WBAA 1KQZA 3WD2A 1GQKA 1W1VA 3OIHA 3MS8A 4CKQA 4H2CA 5D8ZA 1TMQA 3POHA 2ZXAA 2E8YA 4S3KA 3D52A 1QNOA 3PZMA 2WVTA 4D71A 1UOKA 6TAAA 2BVYA 1W9DM 4FMVA 1JXJA 3L4VA 1D2KA 1V6XA 1OGSA 3BSGA 4JHOA 4EKJA 3PZVA 3O2LA 3OLIA 2PWGA 3ZT6A 5LA0A 3RILA 1UH3A 1MVYA 3M07A 2JIWA 4WF7A 5A1AA 2BV9A 3E1F1 2QHAA 4PTVA 4BQ4A 1KBKA 3RM4A 1FHDA 3WQ5A 1V3JA 1KXVA 1C91A 3TTOA 3AIWA 4MB4A 3VOCA 3M46A 4P7LA 2J7FA 2WMJA 3F5LA 4AZ7A 4P7NA 1HKIA 3AQUA 5ABHA 3LPFA 4PMNA 1JD7A 1GVYA 1GJWA 1PZ3A 3WY1A 1VBUA 1GVIA 1TA3B 4KRTA 2WCGA 2BY1A 2OWXA 3VD5A 4NI3A 3QOKA 2EPKX 3GH7A 1HIZA 1EA9C 5M17A 5A6BD 4OBSA 3BAJA 2EABA 1CBGA 2W63A 5BRQA 3BVXA 2O9OA 5A6KA 3FHAA 1RD6A 4Z2KA 2C0HA 1UWRA 4A3YA 4HOWA 1E43A 5D9NA 4PSPA 4UR9A 1BYBA 4F8XA 1HJVA 2FGZA 3ARSA 3VGHA 2A3AA 2JEPA 2FYVA 4GO8A 6A3HA 4PEEA 4AZCB 1C7TA 4W93A 1GQIA 1OGGA 2D73A 3WEMA 1CNVA 4PMVA 2VCCA 1OB0A 2E8ZA 3WNKA 1LQ0A 1UD8A 2ZUSA 3EDDA 1KR0A 2XJ7A 2QMJA 4KGLA 3SURA 2PI6A 3VSTA 2HISA 1WKYA 2J7HA 2YL9A 2GVYA 2X2JA 3T09A 2XVLA 4MADA 3WDPP 3BUPA 1FA2A 4JL2A 3H53A 1E15A 1G9HA 2YBTA 2E9LA 5FL0A 2ZXQA 4OOUA 5I3DA 3ARVA 3SIMA 1W2VA 4AD5A 4UOJA 1FFQA 3RJYA 3MUY1 5HOSA 5ABFA 2E0PA 3WL0A 3OLGA 4UZSA 4ATLA 1MFUA 3I3BA 2VCBA 1M04A 1GOMA 3L4WA 4J3UA 1B90A 2O92A 4FNQA 1XCXA 3QHNA 3WH8A 1LG2A 2V3GA 1JNEA 4P7QA 3II1A 3L4TA 4NSBA 2VX4A 3MI6A 5HDRA 2X05A 2BHUA 3AS2A 1EH9A 5A2BA 3VTRA 3LPOA 3TTYA 1OWQA 3AHVA 3VM7A 4OKDA 2CKRA 3MMWA 3D4YA 1UD5A 3WBEA 1UH2A 3ALFA 4QCFA 1E73M 1UG6A 5LYRA 3IANA 4MTVA 5CXPA 3ZO9A 1CDGA 1H5VA 3LXCA 1H0IA 3EYPA 2GJXA 3SUSA 1PIFA 3AIBA 1QI5A 1H49A 1NARA 1QBAA 4HA3A 5CQ1A 3HG2A 2J7CA 2J8GA 4M80A 3RCNA 2VRJA 3MUIA 3LPGA 3L4XA 2C8NA 2QLYA 2VQTA 2VZOA 3GM8A 2ZUUA 4FNTA 3WL1A 4CN4A 1R8LA 1MW2A 1E9LA 1W3HA 3GDBA 1PAMA 2F1AA 3AHZA 2FE0A 3BGAA 2WC4A 3BMWA 2VC9A 1NWSA 1J0JA 3THDA 3ZSSA 1WCGA 3AISA 3EDKA 4NF7A 4HA4A 5DMYA 3WUGA 5JIWA 3MUAA 3WD4A 5E1QA 4BCEA 1XGZA 1MW3A 3CUHA 1H1NA 2B31A 4D6HA 1W9XA 2BXYA 4NRRA 3OZPA 1JXKA 4HMCA 3BCFA 4OGZA 2CYGA 3AMGA 1EO5A 2WNWA 1E4IA 1WAWA 4E8DA 3CPUA 4JAWA 2DSVA 1XD1A 2F18A 1ISZA 4HZ6A 3CO4A 1WDSA 1JYXA 4CD7A 2A3HA 2ALWA 1VFUA 3WQ8A 4U2YA 1V3LA 3W81A 1CYGA 3KEHA 4OOZA 3PZIA 4GXPA 3S5YA 4MB3A 1B30A 2YBUA 2YA2A 3EMCA 1E3XA 1NOUA 1VJSA 3CUFA 1E6PA 3WUFA 3HG3A 4MNLA 1JF6A 4A4AA 3AXIA 2VX7A 3PZOA 1ZJBA 5E0FA 4PMZA 3AXHA 3A22A 2EXOA 2XYLA 1RP9A 1V6VA 5A8NA 1PIGA 3BMVA 3H54A 4UQ9A 3S6TA 3ECQA 2BS9A 4JFUA 3W53A 4BF7A 4RL3A 1H2JA 4D6DA 3GXTA 4D6IA 2PWFA 3M6DA 4PSRA 2A3CA 3VD3A 3MSGA 1PPIA 4F79A 1FFRA 4ZFMA 2WVVB 4NZFA 2VVNA 1W1YA 2VZUA 4TXEA 1BFNA 3ARRA 3CBWA 1WZAA 3AICA 4M81A 3WF4A 1XV8A 4YHEA 1GONA 3AROA 4AEFA 5I24A 4ZE5A 3ZJKA 1K9EA 2OW6A 4CCDA 2X09A 1I75A 1ISWA 4TVUA 3GTNA 1QI3A 3LMYA 4FNSA 2WWDA 4HU8A 3WY4A 3W26A 3EJRA 1BVNP 2JE8A 2Z1KA 1J11A 2YDRA 1HKKA 1E4MM 3VIPA 1Q6DA 4JZ5A 1VF8A 1HXJA 1O7DC 5E70A 3CUGA 4DO5A 1LLOA 1VEPA 3BAKA 1CXHA 3ZT7A 3N13A 3AMDA 1UWSA 5M5DA 1DWJM 4CGTA 4WKAA 1JZ7A 3DX1A 2VX6A 3A47A 2ZXDA 4AW7A 5CGTA 1PX4A 2VR5A 4CVWA 1NP2A 2ZUVA 4PMDA 3ZR5A 3T2QA 3CZEA 1GHRA 4IPNB 3WNOA 2YL5A 5BROA 2DGAA 2ZX9A 3F5JA 5HNNA 2D0GA 1KXTA 3VIMA 3A5VA 2JFEX 2XIIA 3WEOA 1V3IA 2XFRA 5A6SA 2G3JA 4DO6A 1QI0A 3KLLA 1K9DA 4W85A 2VZTA 2DDXA 3N9KA 3UR8A 2O9RA 2WMFA 4OZOA 2WHLA 3WMBA 3M7SA 2V3EA 4PUDA 3UEQA 3DYOA 2BY3A 2J25A 3RJXA 2PWEA 5I5RA 4XX6A 1LF1A 4RE3A 1DHKA 4AD1A 4J28A 2WMHA 3AI0A 5A6LA 1V03A 4WK9A 2G3NA 1EOMA 1L8NA 2E3ZA 4DO4A 3SUWA 3GBEA 1IV8A 1JI1A 1OT2A 4OJYA 4KH2A 2WW5A 4LYPA 2CIPA 1E6XM 4PN2A 2VRQA 4FLRA 2D23A 3CTTA 1DWFM 1MQPA 5HPCA 2FHFA 1SR0A 1XH2A 2GFTA 4HOXA 1E5NA 4C7FA 3WNPA 4BQ5A 2D3LA 2CCRA 2BHZA 4ACYA 4CU7A 1V0NA 1R75A 2MANA 1XHGA 4CCCA 2XFYA 1GOWA 1V02E 1UKSA 3CZ8A 3DX3A 4OUEA 1JNDA 2WVSA 3U5YA 1PJ9A 2DSWA 4V27A 3I3DA 4WLCA 4OBRA 2X1IA 2IUZA 4D6CA 1E6SM 1E40A 1W3LA 4N0RA 4WIWA 3WMCA 1CEOA 2DQXA 3PZ9A 4AYSA 2VZVA 2YJQA 1JZ5A 1BPLB 1JDCA 3VDCA 3N12A 2Y8KA 5CG0A 1BYCA 4KRUA 2NW0A 1E0WA 5D9MA 4F9JA 2CBUA 1G0CA 1DWAM 4QP0A 1F4HA 1O6IA 3A4WA 3K8MA 3AMLA 8A3HA 1GNXA 2J47A 4GI8A 2WPGA 2WWCA 2OYMA 1B3WA 1UQZA 1E6NA 4DUWA 1PEZA 4UNIA 2VQUA 3A4AA 2YKKA 3CUJA 1NQ6A 1H41A 2YA0A 3W6LA 2XSBA 1CIUA 2XGBA 2IXUA 3BVWA 4LXFA 4UFKA 3ZJ8A 1UKPA 3IJ7A 1A47A 3HG4A 1AQHA 3MO4A 1R33A 4Z2LA 4AD0A 2ZX6A 1US3A 1WDPA 3CHEA 2V3DA 2W91A 3BAYA 4LGXA 5GNYA 3CZJA 4AD4A 3WH5A 1KTBA 4AC1X 3CMGA 3WQ6A 4HU0A 4TX8A 4JFWA 1SZNA 1FOBA 2VURA 1BHGA 3AIEA 2QMKA 4BS0A 4WSKA 2J77A 4QFUA 1QNQA 1JDAA 1C92A 5A6BA 5FIPA 3L2LA 2J79A 2F7QA 3IJ8A 3FAWA 1N82A 4F9DA 4W7UA 4E4PA 5I77A 3WMSA 1UQYA 4ZE4A 3S5ZA 3O6AA 3BSHA 1V6WA 4UFHA 3PHAA 3WDQA 4UTFA 3T0DA 4CU8A 1SFSA 2F7RA 5A8PA 1B3ZA 2UY3A 3ARUA 4W86A 3VX1A 3CZLA 2ZXBA 4U5IA 1WO2A 1FHLA 1IZKA 4AEEA 3ARQA 1EXPA 2WMIB 3HN3A 4IPLA 2WHKA 1K9TA 3UG3A 2CKSA 2QPUA 1NH6A 5E0CA 3VILA 3W0KA 3WF2A 1W9VA 4AZBA 4R5EA 1CGUA 2EO7A 2EADA 1ISXA 1UD2A 1W3KA 3SCVA 3BVUA 3LRMA 4TOQA 5GNXA 1AQ0A 2EAEA 3LPPA 2F7PA 1FH7A 3ZQ9A 4U2ZA 3VGEA 1HXKA 2YDQA 2YA1A 2PBOA 3VIHA 3BUQA 3OLDA 2XIBA 1QHZA 5DF0A 5EBAA 1HP5A 2OSWA 3CUIA 1Y7VA 3WSUA 1ODZA 4DUXA 3CGTA 3CZSA 1WZLA 4HTYA 2DT1A 1GOIA 1R7OA 4MJ4A 1HL9A 2FH6A 3U57A 5DEZA 4AWEA 4ZENA 1XC6A 4MDOA 5KZ6A 1C8XA 4V28A 3WF3A 1E1FA 3WF0A 2IXVA 4MJ2A 4X9YA 3VD7A 3GH5A 1L0PA 2VNCA 4L4OA 1JAEA 3KL3A 1VIWA 4PBGA 4PMQA 3F5KA 4UQCA 2Y8VA 2EPMX 1GW1A 3S2CA 2PB1A 1IT0A 4AZ5A 5IHRA 1PX3A 1LL7A 1JZ4A 1E55A 1B3XA 2XGIA 2E4TA 2Z1SA 1BYDA 4QDMA 4U33A 2WZEA 3CMJA 2WHJA 1R46A 2J8FA 4JFTA 2CESA 2W5FA 3FY1A 3WNMA 3VDAA 2NSXA 4L4PA 3ALGA 4W7VA 1UZ4A 2W4XA 4UCFA 2D0HA 2CHNA 1M7XA 5IDIA 1JZ2A 2YL6A 4DM2A 3GYCA 1E0XA 4PMRA 1RP8A 4W8LA 3AXXA 4ACZA 4CD6A 4GQQA 1B31A 4FNRA 3MSDA 3W4RA 2VX5A 1WPCA 3IK2A 4PMXA 3BLBA 3KL0A 1UD4A 5CLWA 3ZM8A 2OW7A 3AJ7A 2VOTA 1O7AA 1TE1A 4JKLA 1MQRA 3AS3A 2C7FA 4BZYA 2D3NA 1C93A 1XD0A 2EPLX 2Q8XA 1FP8A 5CLTA 2PWDA 2ZX7A 3RIKA 2Y4SA 2V3FA 4UQAA 4UQDA 1JGIA 1XH0A 2G4FA 1TVNA 3K46A 1MXGA 3T0AA 2JALA 3AFBA 5F7UA 1UKQA 5DT7A 2E40A 3ZIZA 2G3IA 1E70M 5AC4A 1B2YA 3FW6A 1MW0A 3FN9A 4AZIA 2EJ1A 4J3WA 1ZB5A 3NYDA 5E9AA 1E6RA 1WDQA 1KXQA 1H3GA 3CV5A 1QNSA 3VPLA 1UWUA 8CGTA 5A69A 4JFSA 5AYIA 4CD5A 2XPKA 1QWNA 2WMGA 1GCYA 1H4PA 4MNJA 5GQBA 1QBBA 4MAZA 3WQ4A 3NUKA 3GXNA 2XFFA 1VRXA 5ABEA 2RGMA 3B9AA 3BAXA 2DSUA 2GJXB 2GDUA 2UY4A 1G01A 4WSJA 2DIJA 4H04A 3BLPX 1CPUA 3OLEA 1GPFA 4IUGA 1HVXA 2FHCA 4D72A 5JIPA 3ARTA 1TVPA 2XM1A 3N1AA 4M29A 3CZKA 4PMYA 2JF6A 1GQLA 3DX0A 1UR4A 2BVTA 4B3LA 2DT2A 4X0NA 3NDZA 5BXPA 4CN1A 3N18A 1OD0A 3NCOA 3WD1A 3WH7A 2PBGA 3D50A 1JYWA 1CGYA 2OLHA 1FP9A 3L4ZA 3KL5A 4Z2JA 3BCDA 1CWYA 4GIAA 4PMUA 5E6ZA 3PBGA 3VSUA 1BF2A 4QLLA 2D0FA 3A24A 3VDHA 4TX6A 3OGVA 4QCEA 4PTXA 3HJEA 1B3YA 3DYMA 4AMCA 2WK2A 3GXIA 2WB5A 3WDIA 1JZ6A 5D9PA 3NSNA 4TTUA 3HG5A 1NOFA 1SYTA 3PZTA 3BC9A 5BXSA 1M03A 4QLJA 3WUEA 5A8OA 5EFFA 1B3VA 1CENA 1BVZA 5M03A 1ODUA 2UY2A 1HF6A 2GJPA 3VSVA 3QHMA 4HA1A 2WCAA 5BCAA 1PS3A 3UG5A 4TVCA 1DWHM 3WH9A 1PBGA 5IHSA 4PCSA 3ZJ7A 1UWQA 1VB9A 1J0HA 2BVDA 3N17A 5GNZA 2CNCA 3UCQA 1GORA 1DEDA 2DH3A 4UFMA 1W9BM 3LRLA 1HP4A 3T2OA 2YOCA 4FLSA 3SUUA 4ZXLA 5HPOA 2EPNA 4AXNA 1WNOA 1MWOA 1QW9A 1KWGA 3HZ3A 1ISYA 3ARWA 3VD4A 3MU7A 1TUXA 1M53A 2WVVA 1TZ7A 1UHVA 4W84A 3ARZA 4M24A 5I0DA 1W1TA 2VR4A 4YN5A 4EK7A 3WD3A 4UFLA 1NWTA 5E09A 1SMAA 3ZJ6A 1TA3A 5BXTA 1OCQA 1BQCA 3K1DA 5FCZA 5A6MA 3W29A 1UR8A 3BAWA 2EACA 1VJZA 4ZEPA 5CSUA 3FXYA 1DTUA 2V5CA 3F4VA 2ZE0A 3GBDA 4F66A 1T0OA 1EGZA 2Y2WA 2ZWYA 1JG9A 2NT0A 1MYRA 1V02A 4P8XA 1R86A 4HPGA 3VNYA 1ZJAA 4D6FA 2QV4A 4W89A 1CGXA 1GOOA 1E0VA 3AZTA 3EDJA 1G5AA 1YHTA 2ZIDA 1AMYA 1CXKA 1SMDA 1ZU8A 1TQSA 1QPKA 1P6WA 1JF5A 3PZNA 5E6YA 2GUYA 1QOXA 2VZSA 2VL4A 1QNPA 2XHYA 1MFVA 4IISA 1NWUA 4JFVA 2XVPA 4AIUA 1E72M 1KB3A 2W62A 2J74A 3PTMA 1HKJA 2D1ZA 2TAAA 3A21A 3FNDA 3OG2A 4D1IA 4PRWA 1V6UA 3OA5A 4U31A 2XTKA 4W88A 3W38A 4MPKA 3PTKA 4AZ6A 4N42A 3EJPA 4J7RA 3RPMA 3VGFA 2XG9A 4B9YA 1V0LA 1W2PA 2ZWZA 2YDSA 4E2OA 1J10A 1W91A 1QVBA 1EQCA 3MANA 1LL6A 1HT6A 2A3BA 2WSKA 1U33A 3EMQA 1KTCA 1HN1A 3G6MA 4Z2IA 1R47A 1JAKA 5D8WA 3AZRA 5CJ5A 4H8VA 3U5UA 4GINA 3VMPA 1JL8A 1VBRA 3VINA 5A6AA 5A8QA 1G1YA 4MAVA 4GPNA 3MV01 1V3HA 3SUTA 1J9YA 5ABGA 5CSYA 1KXHA 5AC5A 2DT3A 1RH9A 3AIUA 3OBAA 3TTQA 3WUBA 4JCLA 2WC7A 1NP0A 4J3TA 4HZ7A 4TTGA 2UY5A 1TQVA 1UKTA 4AISA 5EMYA 1HWWA 5BWFA 1QHPA 3KWXA 3ZT5A 1J12A 4D1JA 2CERA 2JEQA 3OB8A 2O9PA 2IGTA 2OWCA 2X2HA 4AZGA 5HBFA 5A2AA 1OD8A 4XV0A 4BA0A 1KBBA 4H7VA 2YFOA 1AQMA 4S3JA 2XN0A 1JYVA 4MDPA 4PTWA 1UA7A 3ZOAA
chains in the Genus database with same CATH superfamily
4P3DA 5E94B 4FQXC 3H2NA 5LA1A 3PABB 1GZQB 1MCRA 3SDYL 2YPVA 4JHVA 1N59B 4W9HC 3ZDZF 4OCYL 2DZSA 2E9BA 3W7NA 1E6QM 1KIPA 2EEDA 4PJXE 3US1A 1XLEA 2BOCB 3S2NA 2WP3O 3RO6A 1OARL 3LEPA 1WXYA 1NJ9A 3TA3D 2XN9A 4DNMA 2JKTM 1LLWA 3HC2A 4TUFA 4XAPA 1DVJA 1U4FA 1VF5C 2QCGA 4XNYL 4DKAA 1NKGA 1SDAB 4XRCA 2HA1A 5ECGA 2QAPA 4PJEF 3JS3A 1JCMP 5E4OA 5LNWA 4DTGL 1E4JA 3EAKA 4LIQH 2WKJA 3V75A 1M7OA 2ZRYA 1V7ML 4FJZA 2DI9A 5T3XE 4YVPA 1IC4L 4ICXA 1M5WA 3N44F 5DJXA 1X1ZA 4UTIA 5KVDE 3PR2A 4H1ZA 2BNRB 5D37A 4I48B 4NZJA 1LP9B 3GZAA 4PMOA 2A6JB 2UZXA 4IRJC 2EIDA 1A6AB 3L1FA 2QCCA 1X7SA 3T5WA 1ZP4A 4YDJA 3TLQA 1RK1A 5IP4A 5JNYA 5L9FA 2ZICA 3IS1X 3W5NA 3CZUB 4NP4L 5LBSA 1RIUH 4LALA 5C8JB 5HYSB 4K3DH 4PJIB 3EJJX 3SCMC 3HMCA 5HWNA 1J5HA 1O95A 2C9VA 1V6TA 3CPGA 4QYOA 4JTDA 5IT2H 4B5SA 4YHKL 3ZKND 4BH8B 4FOUA 3D09A 2CAKA 5CMAA 1Z69A 3UXDA 2P45B 3O45B 5FYLD 3HE6A 1YMHA 1VFMA 2FK9A 3N40P 1X44A 3MR9A 3QULA 3SCTA 3UU0A 3RDKA 5ID0B 5I8OH 1KM1A 4LT9A 3L3GA 4HIQA 2OXNA 2DH2A 1WIPA 4XWUA 1XF2B 2KS0A 4GAGL 1AZZC 1DEEA 1K9FA 4B2DD 1UW9A 1YEKL 1WAPA 2GIYA 3PHQB 2P50A 4MZYA 5IR1B 3M0VA 4OZ4B 3RGVD 3HC0A 3EO9L 3K6FA 1S9VB 4GBXA 1MRDH 2VUKA 2WANA 3VXRD 1UXWA 1ZT7B 3OB0H 1E5ZA 3A4XA 3MRDB 1LE5B 3GI9H 5C86A 3FQ2A 1OP3H 2CO4A 3HF3A 3C9NB 4L5FE 1FH5L 3R7MA 4NC2B 3IJYB 4M19A 4JKPL 3UTTA 1J05A 1P4IL 5D1XA 3Q8BA 1M7IA 1VFOA 3NYKA 5JW5B 3I7SA 3PJUA 3QJTB 3WY3A 5EYWA 1OYBA 1SSGA 3TYFA 3HEIB 3W39B 2PPGA 1A7QL 4POUB 2NY1D 3S37H 1YN7B 1ZA3B 3MN8A 5E8EA 1HFUA 1V7MH 3RL1B 4WEVX 1EGJH 3OKOA 4N2GA 4XZUA 5AQ0A 2DSKA 4WU5B 1KTDB 5AG8A 4O18A 3HRZC 3L3DA 1P7TB 2WZMA 4TPRH 2UUDH 2J6EH 4APQC 1HKLH 4YHIA 1LQSR 4UCGA 5A3ID 4X99A 3UD6A 1NEPA 2Z2UA 2EIJB 2F08A 3NEEA 4YNYB 5C0NC 2CA4A 4QHMB 4ZBJA 5IJKC 1ZBKA 2OQLA 3I65A 4RW5A 1JV2B 2H7WA 2VLMD 3MUHL 4EOWH 1A7PL 1ASPA 1XL6A 4NAEB 3UXKA 1LO3H 1QI4A 4JQIA 2LVCA 1VPYA 3L5XH 4ERSL 5D2LB 4JPVL 4QDPA 3GSRB 4YC2C 5EEYA 3N1MC 5BZAA 4G2DA 1TPXC 1CL7H 3TXAA 2C71A 4JG0H 3LXUX 4RE4A 1MMFA 4YLBA 4DHGA 3TVMB 2BMKA 3N15A 4ML4A 1G6RH 4QXGH 5LCVH 2VEGA 1QX1A 3L5AA 3S46A 3TQVA 4E5TA 1JRBA 2BCKB 2CBVA 3B3IA 5ABFB 3GI9L 4E41B 1JVKA 3CSGA 5BQ7A 7A3HA 4HVXA 2IWKA 5GS1C 1BOGA 4PI2A 4I13B 3QIWC 1EAPA 2MQ3A 3QIUB 3UG8A 5HJDA 3UMTA 1G5GA 1S7WB 1G6CA 2EDOA 4DP4X 2XUCA 1A5BA 2G50A 3O3BA 3NIFF 3NSXA 4JFFD 2P8PB 1E7UA 1MRCL 2R8SL 1IQWH 4PV1C 4CQCA 3LXBA 2ZUWA 1BFOA 1WCBA 2FB4L 4M3HA 1RJPA 2DEPA 1BEUA 3PM6A 2VVSA 4RZ4A 4F3FA 4MZ2A 3LTYA 3GK8H 1HTYA 5I0ZA 4YXHH 5ECUA 3VXRE 4L9DA 3NCEB 2NCMA 2CGRH 2UZYB 3MBWA 3MV9B 3STPA 1JD9A 2J5LB 5JQ9A 3FO1B 3G1SA 4Q6XA 4MB5A 4XPGL 3IGLA 4K8EA 3N85H 1F90L 5J1SC 1EIXA 1QK0A 4XKMA 2FWOB 1Q6FA 1TRDA 3Q4DA 4NXSA 5L6UA 4PJ8C 4G5AA 3VIGA 4OGXL 3CHDA 4OQTL 1FWRA 4ERIA 3NIDF 3IFLL 1MCHA 2EH8H 3D4GA 3QZPA 2XETA 4PIBA 4DQOH 5CD5D 5K33A 5I6XB 1OM0A 3W27A 4RGOH 5BUAA 5C0IA 1I7ZA 3FT0A 2J62A 3OVGA 5SWQA 4YHLH 3N3TA 3K4DA 2FDMA 2G5UA 4OT7A 1BP3B 2HP4A 1VBHA 3RWDB 1TFVA 3FT4A 4CSZA 1H0GA 3UR7A 4ZCWA 1WE5A 3HFFA 5KG9B 1IZCA 3WFLA 4UTHA 1E0TA 4XD3A 4G1NA 3A3HA 5LZLA 4DWSD 4WGKA 4FX8A 4LSSL 1ZCRA 5A2KH 4OJAA 4Z7NF 3WLOA 4JJHA 1F7BA 3ATAA 4GZJA 3QEHA 1GPOH 2J43A 4U1MB 1SUXA 2F19H 4CQAA 3KM1A 4AENB 3R1ZA 3NSYA 1RULL 3BWAA 3HI5H 3NIYA 3M0KA 3BD5A 4S2CA 3NQCA 2VXQL 3BQ6A 3G6JE 2CFFA 4F7PB 4NAMA 3US9A 2NQJA 2BBFA 4N26A 4OZHB 5HHMB 1TIWA 2JIEA 5BMFL 2REQB 1N6VA 2ZJSL 4Q7DA 1ZAJA 5ESAA 5C09A 3VXTB 5FHBH 4ATDA 4Z1AA 1US2A 3JTSB 2J12B 5I18L 3B4UA 3SDDA 1JTPA 4KDWA 1UR2A 3G6LA 3PG2A 4TQHA 1K4CA 4G8GE 3C6LA 5E8DH 3STLB 2PRHA 4YSTA 3BPWA 1LDCA 4PUUA 3C09C 4JM0A 1E28A 4ZUTB 3C52A 5MEPB 5CZTA 1SY6A 3IJHA 1GGUA 1FA4A 2CXEA 4AY1A 4DGYH 2YW3A 1IC5H 1LP9E 2HKHH 3HZYA 4YHOL 5I7GA 1E5UI 3TT3H 3UWQA 5K9DA 1EDQA 4HS3A 3JUGA 3GHPA 1UXLA 1I8KB 2MPVA 3FFCE 3P4MA 3KW7A 4HCRA 1NJJA 4UTTA 2PFHA 1LE9B 3NQEA 4G3YL 4R26L 4J1UB 2OCCB 1ICQA 3K2GA 1PQZB 5I1JL 1KPUB 3T77A 4HWZB 1JGDA 4R88A 2NR6C 3WLLA 4DRSA 5MHBA 4DW2H 1OYAA 1JUFB 1I3GL 3TONA 4JL1A 5I6NA 3R1GH 4Q33A 2PO6C 1JGLL 3EFOB 3NJMA 1CFBA 1HHHB 1PAZA 3GRGA 1GPOL 4FQ1L 1FYTD 1ZS2A 2AK4E 3FB6B 3H9SE 4MX7B 5HTSA 5JUEH 4PV8A 3TOPA 3CT2A 2AF2A 1S7VA 2WWOA 4OZGA 1FVEB 2R0ZH 3GMRA 3II3A 3MKVA 3KTSA 1TVBB 4G1MB 4HH9A 3FCGA 5HDWA 4H88H 5CM1A 2Z25A 3LNPA 4H00A 3A4FA 4EUPA 3BP4A 1M6OA 2MOGA 3MRPB 5D1QC 3BQUA 2NTSP 4AYMC 1MRFH 3RAOA 5DD0L 4JTCA 1WLHA 2NY3D 3G5YA 1ZMYA 4M6OH 1OF0A 2FHBA 3RDTB 1VHCA 3UW6A 5JHMA 2V4LA 4HP5A 3H22A 2CBQA 4X7SL 5C0RH 2PPAA 3NQ7A 4HUCA 1QWUA 1E42A 1P1VA 3WTWA 3GSWB 4O58L 2JJTC 1HNYA 3U1PA 3A4JA 1W8EA 2VDMH 1A3LL 4GXUM 4AY8A 4HS6A 4PJXB 1KRAC 2CK0L 3IDMA 3BD3A 1T22A 5GISH 1ZBCA 4GK8A 4U1JA 1F76A 5JBDA 3LEVL 4M7JL 5DHVH 3MI3A 4P7OA 2BASA 5FJOA 2XVKA 2X1UA 4NBYB 1DZ0A 4MWAC 2FLBT 5M1TA 1JFHA 3FOLB 5A6JA 3WBYA 1EZVY 5JBEA 1DIEA 4KJQD 5CZKA 5HYJA 4MJMA 1R3IH 1X5FA 3PQYB 4IFRA 4QRUA 4XD6A 4LKXA 4YDLB 3QI9C 3D4ZA 5DJAA 4HLJA 3SCOA 3VNLA 1JWSA 1JWSB 4UQEA 4U3AA 2TODA 4B16A 4L37B 2O6PA 4JFPB 4W8AA 3PQYA 2KZBA 4PWGA 4W9IC 4HWEH 3C0SA 2VDLB 5FAJA 1FO0A 1LM8V 4BXSV 4YMPA 3DOPA 3P93A 3HNVH 1S1RA 1I7UA 4M5ZL 5MERB 4PUKA 4KQ4H 1XPYA 1ITXA 2DWTA 5HI3C 5B1CA 3LH9A 2BZDA 1KPVA 4KMTH 1OGAD 5EOCJ 5C9UA 4PJXA 4QQUA 1AXTH 3CWNA 3H4HA 3NSJA 4OJFH 4XB3A 3GUGA 3NCWA 1R87A 1MW1A 2IOIA 2DBLL 4Y5XA 5AYTA 1ULVA 3VYPA 4TM9A 3B05A 2BHYA 5C9JB 3AU2A 1X5IA 3W3BA 2GQAA 1OHQA 1UM5H 5FOBB 4LAUA 4OF8A 4AY0A 3MRMB 4MSWA 3VXUA 2JI2A 5KW9L 3C12A 2WWMD 1R5WA 2Q3AA 1BLIA 1M71A 3MJ7A 2FTPA 3T1FA 4A7TA 5IJCC 2ZSVB 3G1FA 4ADUA 2BOBA 4FC3E 1FVEA 1YCSA 1T7WA 4GLRH 2OYPA 4XN2A 3BXWA 1BSIA 4MX7A 3H8NA 3QJHA 5FF6B 5FUZH 4AD3A 4Y16C 3EFOA 4AEIL 3DX2A 1RHCA 4PUMA 1MHHB 2OZ4A 1SSDA 4LQFH 2QZ5A 5CGMA 5JH2A 1JGDB 1CGWA 1CQKA 5HHOE 4JLRA 4NQCB 1R3RA 5LIKX 3UWUA 4DM1A 4N9DA 4ZSUA 1N8IA 3RR1A 5PCYA 4I1RA 4LPTA 4P46C 4Y4KC 3HPJA 4LYQA 3OB0K 2E9JA 1LE9A 4B95C 1LXMA 1H1ZA 5C0BE 3B9NA 1C9SA 3V6ZB 5C0CA 4BFIB 1UUQA 4HS3B 1V0MA 1RUAH 3OJDB 4KO6A 4X83A 3BSMA 2CKBA 4H41A 5K69A 2GK1A 5I00A 2HVJB 2BIMA 4A7GF 3VFPA 3ZE2E 4C6KA 2CLMA 1FI8C 2JF7A 3GXDA 4GKLA 4JX4A 3ESNA 4BK9A 3S47A 4D6GA 1JK9B 1IAIM 4BFJA 5EC1B 4C83B 5J4MA 5EU7E 1K4CB 3U8GA 1NGZA 4KH9A 1SMOA 3SCQA 4YXGA 4R2GD 3D39A 5J9PA 3C5QA 3JWOL 1ZSDB 2XA8H 5ESAB 5XIMA 4RE2A 4B9CA 5IGXL 1FDYA 5BOOA 1YRKA 5HPMB 4N6FA 1ZA6A 3UWZA 4RPPA 3ZUCA 1YYCA 2LFEA 5AVXB 3CFQA 2AAVA 3NJGA 4AENA 4K5NA 3HUJE 1OBAA 3MMDA 4AUUA 1RPUA 4PRBA 5HYSG 4V2CB 4KCUA 5F72S 1KYUA 1G4EA 1VKXB 4M4RA 3QEHB 5DI8B 5LHEA 1H5BC 3ZR4A 4HJFA 1DFBH 6FABL 3PUOA 3KYNB 4HGWB 4JCMA 4FA8A 4MXQD 3MRLB 4AQ8C 4QKTA 4F7TB 3DI3B 1T1YA 3FT4B 4FFZL 5JHAA 3QDAA 4JX5A 4F7KA 4ADJA 2GUOB 2DTMH 5HI5D 4LOUD 2C3ZA 5J1TC 3U36B 3KVPA 3EOBA 5SWQB 3SOTA 2X7WA 1UA3A 2VERN 4G8AC 5D70L 4EIUA 2QDDA 2F2KA 4XBEH 2CRYA 4B5EA 5DK0A 1FN4A 4UNTA 5DO8A 1XGYL 3MGTB 4FQPA 3L66A 1DQML 4H5SB 3T2LA 5G5DA 4JFED 4ZA0A 2VDLL 1RZKH 3CXHJ 3PGFH 2FWOA 4I18C 1RJCA 2IPKB 1U9KA 3KRSA 3IGUA 1AH0A 5C6WH 2QCFA 3BP6A 3O6FB 2FEJA 2XN2A 3FO1A 4HPXA 2Y1VA 1ZXQA 2J7GA 3SCMD 1JZ8A 4KFPA 2UZYA 3MV9A 2ZSWA 1NCCH 3S0PA 3IYLW 4Z7UA 5KSVA 1MFCL 4X0KB 1TJRA 2XN1A 4PRIE 4PCYA 2A77H 1ZLSH 3K4AA 1DPMA 3B2UC 3NVDA 2VCAA 1YYML 1OZQA 3HMWL 4DP8X 2EVGA 5G4NA 5GGRY 3AHXA 3RGVB 3HMWH 1L6WA 2DJXA 4GCAA 4PYGA 3U4EA 5C8BB 2E6AA 2YRPA 5EFDA 2ENPA 1RFDH 3OV6A 4OECA 4WOQA 1WZ1L 2Z24A 4OF7A 4PJIF 3RYMA 2QR0A 1S7WA 2GYSA 1DUYA 2EH7L 5CP3A 1JULA 2DWDB 3BKJH 3SFWA 2IMRA 4GVGA 3HURA 4J6RL 5GPRA 4LLVA 4NO3B 4QOKA 5KS9F 4HF5H 4QAWA 3CIVA 4MLRA 2YUWA 2J7BA 3W6MA 3N9SA 1ID5I 4FG0A 2CO2A 1NAMA 4XXWC 1QAWA 1WD8A 1YEHH 3RKDD 3QO0B 1QO2A 1AHWB 2VI0A 3ULAB 3QV7A 1MZZA 2XPZA 3T2NH 1S2VA 3E2VA 3T0EA 1AXSA 4GJ1A 4HS8H 3DI1A 4M5SA 5I1JH 3PCYA 4JTQA 4NYUA 1N68A 3L17A 3VFOA 1VLXA 4QRSB 3MMUA 4OIFA 1CFNA 3QFJE 4QBXA 5I71B 4W9GC 5LGKA 4FFZH 1UH4A 1VGKA 3SPIA 4QWWC 1OK6A 4PJCB 3QDMD 1F4AA 4LU5H 2GI0A 1KCLA 1XW8A 2ZOTA 4PCKA 4H8WC 2A6IA 4YNYA 5CPSA 4CD4A 2DQJL 4G8FB 5FM8A 4J4PA 5T3XD 1AQ8A 5B39A 4HKZA 4JFHE 4QRBA 1HZHL 3WOVA 3EMZA 4P05A 1Q6OA 4W5UA 4DHLA 1NMAH 2DYPB 1Y8BA 2PS2A 4XZLX 1LO4H 4FGMA 1RXLA 4XZUB 1PVNA 3OZYA 3PPHA 3I9IA 3MP5A 1YN7A 4JO4H 5E8EB 5ENWB 4R0LA 3C2OA 2VH5L 3O63A 3EEZA 1NFDF 1ZRUA 2HPOA 3D8MA 3DV4B 3HMXA 1HINL 1R3JA 4GKOA 3GSQB 3RI5K 4C57C 4PRPA 5EUOE 4NDMB 2AK4B 2L3BA 4NKIH 2G8ZA 2XVNA 1TPDA 1D9KB 3EDEA 4HCIA 1PKLA 3BJLA 4Q7NA 5TQ2H 1BG4A 2EPOA 4JQ4A 1G1KA 4A8IA 3MRDA 3WY2A 1XF0A 3AXMA 1FFTB 1IXNA 3LK6A 3IRSA 5T3ZH 5FYKH 2Y7QB 3C8KA 1BJ8A 3MACH 4NZDA 4TQEH 5B7YA 4GBXB 1AH3A 3QCUH 1C8VA 3TEVA 4XMTA 5AHLA 4QRPE 4MMZC 1X7IA 4S1DC 1XRSA 3PHQA 3QIWD 2VR6A 4M1CD 2XWEA 3ZY7A 1Q9WA 4AKOA 4O4VA 1TYJA 3DOHA 3UPRA 1PG7X 1IX2A 4HQQL 4N4YB 4W9DC 1WOBA 4XNAA 5EZOL 1XH3A 1MCQA 4JRXE 1KJVB 4KMLB 4Q8OA 2P8LA 1ZRQA 2WKOA 4ADSA 2PGEA 2X7LB 3HE6B 2G4EA 3O45A 3UCRA 3H42H 5D7LB 4IQHA 4M1GH 1U30A 2CPCA 1TR1A 1MY5A 3QRHA 3AU6A 1UPMB 5FKYA 1IKFL 4BE5A 3DBNA 4I89A 4F5CA 3DJSA 1Q8JA 3F6LA 1F61A 3OZOA 3P4LA 2D2OA 1KEGL 4GIOA 5A43C 3GQFA 4Q22A 5LGYA 5E8OB 2J9YA 3H55A 2WMKA 1B4EA 1NBZB 1CXFA 5B4MC 1RK1B 2E7BA 5JNYB 2WSRA 3TCEA 2NYYC 3B7RL 4YDJB 5JA8B 4C7GA 4OI7A 4XUYA 2PF0A 5U4NA 4AVFA 1TXKA 1VCGA 4JZJA 2GBVA 3NSMA 5BS0D 1LP9A 5LHFA 2VLKB 1I9JL 2B0SL 3MJ9H 4DGIL 1KFKA 2A7NA 2OWCA 3SAZA 2V0TA 1MCOL 3KOYA 3UBGA 2R59A 4J27A 3T0TA 3BAEH 2MPAH 3RY6C 1MCKA 1UZHA 5DCBA 1AHMA 3EO9H 4K8RD 4LDOB 2OAAA 2B3IA 1WZMA 4JFEA 2X16A 4N02A 3DHUA 3VWKA 4HZLA 3D3FA 1BF6A 4JG9A 5FEBA 1LWJA 5GS0H 4WO4B 3GU9A 2FWUA 3O6FC 3AY4C 35C8L 4BWWA 3F1QA 1U95A 4KWWA 3GZOA 2AQ2A 1JCNA 3V6OA 2BOCA 3UWVA 4UIKL 4JGDA 3OM3B 4EO5A 1QI2A 1L7IL 1U3JA 4HNNA 2J2ZA 2P5PA 1OFPA 3FYYA 4I9AA 3VOGA 1N59A 2WV3A 3GDKA 2DZBA 4H8HA 3MUGA 4K9JA 3MJMA 4HD5A 1ES0B 1XIWA 1O5QA 4U28A 4WJXA 2R83A 5FGBA 5F2MA 1S5VA 1X3DA 4HJUA 4U3CA 1H62A 3E0VA 1KGIA 1J0IA 5D7SL 3LHAA 4XHJC 3H7UA 1FE8L 4MDJB 1OSPL 4HETA 4X7TA 1UZ6F 3SE9H 4HUUA 4XI5C 1O6TA 5C55A 3CFIC 1BV8A 3L2MA 3QG6A 1X5YA 4PV9A 3OPZL 5F3BB 3PNRB 1G7IB 3ZTDC 2UVFA 1SDDB 3QCTL 3IETB 3OJVC 3DIVA 3CK5A 1I4NA 4N3TA 5B7ZA 1SN2A 1HOCA 3CC5A 2GJLA 1MIEL 1XQ4A 1JGUH 2CU9A 2Y5TA 4NKDB 5IK3A 3PC0A 5D7IE 4IFKB 4B5ZA 4PH6A 3FQ1A 4FFYL 5C9ZA 1MELA 1L9NA 5DMGD 3SCNA 4P2OD 3MCG1 2C1OA 5EDXA 1NCUA 4BSVA 1C8QA 2FBRA 2ZUTA 4HWBH 2MKWA 1DV7A 2YLLA 4YTTA 1D7BA 2HZHA 1KBPA 5I15H 1EC7A 3W2LA 3O8XD 3ME0B 4PCNA 2VWTA 4WNQA 4X7DC 3DKJA 3G2GA 1T1XB 1OPOA 2DQFB 4GYPA 1UURA 4LV4A 5I18H 1F8IA 1WUNT 1YMMA 2TSYA 4F4RA 3TEYA 3S4TA 4PJHB 3R19A 4PY7B 1AQFA 4JVPA 1EHLL 4KWVA 4N2MA 3FT2B 3Q5YA 4WUUA 1MEXL 2DZAA 1C08A 4IJ3C 3C61A 5EPMA 1CZ8H 2JI1A 3V10A 3IPFA 3Q6GL 5IROD 2R82A 4PS4L 4LVOB 4AE1A 4ZQKB 3EJSA 2AJZB 2P5ED 1M1SA 4QRPA 3UG4A 4HYVA 1TUPA 3VXUD 1Q0EA 4F7CB 3RG1C 3GX9A 4O15A 1QFWI 1UR9A 5AYUH 4L4TA 1DHPA 5AW6B 4FYSA 1OP5K 2OKOA 3OHXA 3LZ5A 5E24E 5HJ3A 2E1DA 3EXTA 4C7DA 1YEDA 1N18A 4KI5F 1A7OL 1EEZA 4J3VA 5IVZA 2XA3A 2XV3A 3L3OA 1BXUA 3BVNA 3VAEA 5DR5L 1HHIB 5DJ2A 2XKNB 2VLJB 1TR7A 2WBXA 1IEVA 5GS2D 4YHPA 2J7EA 3CCHB 2VJ8A 2YZ8A 2CLRA 3BUDA 3H2QA 4KJYB 4O51B 1JVNA 4PRDB 1OGBA 2QKIC 1G7MB 2F5BL 1MJ8H 1HHGA 2ZOWA 5B22A 2MQGA 1OADA 5KTEL 1SJAA 2OOGA 2ED8A 2V5LA 1Q38A 1XCQA 2WCPA 1QU4A 4Q6YA 1NSJA 4QM1A 4AJ0A 3W2MA 1INQA 2OSYA 4UV7H 3UO1L 2J56A 4D94A 4PI0A 1VR6A 1FJ1A 4HHWA 4Z7QF 1EGVA 1PKQE 5LNDA 2WWKO 4KZEH 4ZPVB 4DP2X 3RNDA 3BZJA 3P9MB 4MCZA 4PJ7F 4ZNEA 4XCFL 1GQKA 5DJYB 3M44A 4RZCB 3W1UA 1EEPA 2JCCE 5FEWA 1P6FA 3KRBA 3FGCA 1QSED 1K3IA 1TMQA 3POHA 4P23A 4YHKH 4NQED 2H4EA 3N44B 4FFYA 3OODA 5AKQA 4AQEB 2NUWA 5E8NB 2O0TA 4LMQE 4YWGH 2H9AB 4FYRA 3K5XA 2E6JA 1FG2B 2ZXAA 1CLYL 3UBFA 3D52A 3KYOB 4A2GA 3QUHA 3DENA 1I9RL 5F93C 5LAPA 5JHDE 1QNOA 1W1ZA 2WVTA 5DX7A 4AXKA 3CVCA 3DUUA 4MQ7B 3GUFA 4PJGE 1J6OA 4KJWD 3W1RA 2R2CA 1ESOA 5HHOA 1EHKB 1JNLH 5D4QA 5JZ7D 1SFTA 3CLFH 3LNEA 4DF9A 5TF1L 3K4WA 3TOYA 2YD2A 5G1YA 1L9WA 5DLML 5A7BA 5IM7A 4OCXH 2IALA 2IAMA 5F6HI 1JXJA 3QFJB 2OFJA 1W0VB 1R38A 1O0VA 3BSGA 4LSRL 1GC1L 1MUJB 1X38A 3IVUA 4RBPK 3WEXA 1L9OA 4TQPA 4BFEA 2EIEA 3AW5A 2PWGA 5I8KH 5DMGC 1T3FA 1RCOB 3HAEH 3ILPA 4XO6A 4DJDC 1DN0A 3JWDL 4DW2L 2NVAA 3HIZA 4P2OC 2ZG1A 3RFRA 1VZWA 2UYLB 1HE7A 2VXTL 2WQDA 2BV9A 4OQ1A 2E27H 4I8YA 1QSVA 1RZGA 4ZFFA 3L5WA 1ETB1 1JZEA 2CO7B 4DZBB 2XTJE 4X4ZA 5L4IA 2EUVA 3WQ5A 1JRHI 2GB2A 3S9DB 3ULUF 2BVOA 1LWIA 3FBKA 4M6QA 3GVGA 2DLEA 4EPSA 1KJMB 3IFPA 1G9ML 3ISIX 3MRKA 3R7QA 1EF3A 2NVDA 4JFOB 3OMAB 4WY0B 4CMMA 5GGVY 2J7FA 2WMJA 4LF1A 4LPUA 5D7JA 5AL8A 5FB8A 4EOWL 2O5NA 2VFHA 4PODA 4F0LA 4KK5D 2CQVA 5IKCA 3LZ3A 4H19A 3BDYH 3S35X 3HS9A 1X7FA 3ANVA 4XOBA 4AQOA 2M26A 1WKFA 1FCCA 1VBUA 1NGPH 2GK0B 5J0BA 5HULA 1N6QL 1GZPA 4L3FA 2GGGA 4KRTA 2WCGA 4PJ8D 4WVRA 5DGRA 1OGAE 5KYUA 2OU4A 3FIGA 2Q8BH 2EPKX 5DLMH 1HIZA 2ACQA 3PJSA 3UWEA 5H8PA 3DKLA 3I2CL 1H7XA 1IRAY 1PB0A 5A6BD 4EN3A 3F04A 3QDGB 4W6YB 4HWUA 3UACA 2OK0L 2EABA 1M7JA 4NZ1A 1U91B 3VA6A 5MP6L 1K6WA 1E3FA 5MP6H 3QGKC 5EU6E 1OCNA 3R06B 3NT0A 1NDVA 4FCAA 2JCCB 3R13A 3F2BA 5D2LF 1QLEB 4OCXL 1UWRA 2AC0A 3T9PA 4A3YA 2OJZL 4XO9A 1WRFA 4GP4B 4HJTA 4OLWL 1BYBA 2Z31D 5JR1L 5BW6A 4OGYH 3KW3A 3D0VB 3Q13A 2J88L 1HJVA 3KBVA 1HI6B 1GYAA 2Q1EA 1IEBA 1I3UA 3LCGA 2A3AA 1W1IE 4Y9CA 1ZHLB 2Z64C 4Z95H 4IPIA 2XNAB 5B80A 4OWGA 1SXZA 2QPFA 3FCUB 3MU3A 3O9WD 3P0GB 4HIHA 4K4KA 4PEEA 5L2KD 3CXHK 4PLKC 5LDUA 4K0OA 5E6IC 1CNVA 1GQIA 3LG3A 3NTYA 4PMVA 3MBEB 5IFAL 3RURA 4Q7BA 3NJKA 5HY9B 2G96A 2IDUA 1EGJL 1ZHBB 2W1NA 3N55A 3BPLB 4CMHC 2QMJA 5IQ7L 5FCUH 3Q05A 1U22A 2V2WB 4FXRA 3CHOA 1UM5L 1CDIA 3QJXA 4EBQH 1SN5A 4RX0A 3DPDA 3ZYOA 2CHZA 1WKYA 3MBXL 4AIBA 4KJWC 3KNBB 1KMGA 5AKSA 2X2JA 3FRUB 3T09A 5SX5K 3Q37A 4C6IA 1BKHA 4NFCA 5JZ7C 1FA2A 4MGXA 4IJBA 1OCZB 2B1HH 1FAIL 4JQ1A 1RUSA 3I2CH 2LW3A 1BPVA 4C6BA 1G9HA 3SGUA 1I1CA 3EYQD 5EMKA 1KCBA 3JWNG 2YBTA 4WGXA 5HQEA 2C26A 4JMXA 5I3DA 3KPMA 5FGCB 3MFFB 2PURA 2MCAA 3T4YA 1SVBA 2IADB 1H8SA 3SIMA 1EYEA 1VFHA 5KBDA 1HEZB 2CBPA 4MCYA 1WGVA 4UTCA 3VXSB 1S5HA 3B9KB 3QNYA 1B5TA 3NIDB 3MUJA 4OZFB 3IJEB 4X5WB 3GUWA 3KDPB 4PP2A 1W2VA 3DESA 1L6PA 3GHUA 5CSRA 4NENA 2FATL 4Q14A 2V0AA 3B2MA 2PW2A 2CW6A 1JZGA 4GW1B 1P4BH 4P4KA 5K39B 3X11A 1YBQA 3O6MH 4XNZC 1HKWA 4RSYA 4GY0A 1FGNL 3SE4A 3QUYD 3BHBB 4AT6A 3D85D 5FDWA 5ABFA 4KROC 3TUUA 5J56B 5HYIA 1K8IB 5IW1B 1CF1A 3W84A 4PY8I 1HILB 1RZ7L 5C0EB 1WOAA 1H8OA 3E6HB 5IFAH 1ML0A 2X6BA 3ZDXE 4Z7NB 4PRHA 2GJ6B 3QR1A 4Z3IA 3KPQA 3NQGA 4ATLA 3I3BA 2XZZA 3Q8FA 1HHKA 4RGMB 3VVWA 4DSYA 4F5CE 2VCBA 3V0IA 3G24A 3EG9A 3IF1B 3L7EB 3RWCB 1LDSA 3DV6A 3W9DA 1GOMA 3CIWA 4M0XA 3ZFHA 3LNHA 3U0HA 2V9QA 4WEUD 4EUPG 3MO1A 3AGWA 3K6NA 4Z95L 5DWUL 1BM3L 4PJAE 1Q8AA 5D09A 4UI2A 3OR7A 1R3KA 2QEJA 4GQPH 2E46A 4ODWB 3TBBA 3TWCL 3C86A 4P7QA 4Q6IC 2AXGB 4OLUH 1E0OB 2DJLA 2I85A 5D8JH 2RH0A 2A6LA 5ISZE 4HG4J 1YPIA 3ONBA 3RLUA 3X12A 4X5LA 4G9FB 43C9B 4ELKB 3H2EA 4NSBA 4GQGA 3MO7A 5DBUA 3RHWF 5MEND 1R0AH 2FSEA 2BHUA 3OAZH 1DQQA 1FFOA 3CDYA 2IF7A 4GUCA 5CBEB 3MHGA 3TIEA 2VQ1A 1OOAA 3WS6A 1D7CA 4PA8A 5E2UL 4KFOA 3LPOA 1K2DB 2KDYA 2VE6A 2B1HL 1U58B 1UOWA 4L2YA 4XP1H 5B1AB 5B38G 2HTLD 3PXJA 4ESKA 4JDBA 1VCAA 4N9BA 1M9HA 1I2QA 2BVPB 4L0ZA 3RFZC 2BP1A 4Q4OA 4BQBA 5BJTB 5EU4A 3ZZSA 3V52H 4OLVL 2WZPA 3VE0A 4PG9B 4PRHD 4N25A 5H94B 1ECQA 1G0DA 3AQXA 4XZNX 2C9SA 4Y5VA 3WLWD 3BZ4A 5LBGA 4YHML 2AJXH 3VH8B 4UQ2A 1XLLA 3ABZA 4CMHB 3ALFA 3GVRA 2B59A 3P84A 1DBMH 3NPUA 5J5DA 2CO6A 1YNLL 1VBGA 1GMIA 1NCBH 4KT2A 3WLPA 4NNXB 1BSLA 3EYPA 4YJZL 3SUSA 4XPTH 2PRMA 4DJFC 4LL9A 5F1IB 3BWWA 4KKLC 2CALA 3A6BL 4UT9A 4K2SA 1M68A 3DXAB 1NARA 4MAYA 1RZKC 3BWZA 1BXCA 3OBKA 4FMKA 4F24A 1WIOA 3F6JA 2HG5A 5IQ9B 3M86A 2A1YA 1OAZL 3RHWK 3FQYA 4U6VH 5T8GA 1EX5A 3SJVE 4BGDA 2VEMA 3OW1A 3HG2A 4M80A 2VRJA 3MUIA 4IOTA 5CBAB 2C8NA 2QLYA 2WQXA 2RCSL 1SXNA 4KIRA 3BE1H 2HTKD 4Y16D 2YZ1A 1SHMA 4LLWB 1KKRA 1KCRH 3G5VA 3GM8A 4U1SA 2H6PB 1DBTA 1SRDA 1A3WA 1MWAL 3PP4H 3WL1A 4CN4A 3RJQB 1BAWA 1MW2A 2VN3A 5HYEA 1JP5A 3MODL 5KN5A 2F1AA 1V4YA 1D2OA 3QFGA 1IM9D 4PR5A 3BGAA 4Z7WB 2LLGA 5F1NA 3N6YA 3KPTA 3A64A 4RMTA 3G6DH 4MSSA 1XISA 2J1ZA 3AZUA 4K23H 4RDQF 4S38A 4MA1C 5D02A 1DCLA 4EIVA 2NX5A 3E1ZA 1SJBA 1FKWA 5L2KA 1Q90A 1UA6H 1MLBA 4LU5L 4DEPB 1VYRA 2YCJA 3U79A 4TVPD 1IT9L 1KLGA 3AU1B 4BZ2L 5JIWA 3MUAA 1SGJA 4X6EA 4NRYA 2DY3A 5T9CE 4BCEA 1Z9NA 1KG0A 2P8MA 3K81A 4MJJA 2YS4A 4PJAF 1H1NA 2B31A 3M17B 3L95A 5CCHE 3SKMB 1L6FA 3CH1B 5SWSA 4PLJC 3DXIA 4LC6A 3QDJD 2A4CA 4H9XA 1EEYA 5AVUB 1YEGL 5BOZG 4YTUA 3BCFA 3O3EB 3Q3GA 4OGZA 2CYGA 2I14A 2ANUA 3AMGA 1U8JB 2MPAL 1D5BA 1YJDL 2LVEA 3GRWL 3RGBA 3EZ4A 1WAWA 1JZJA 4C6DA 4HK7A 4C6EA 2IG2L 3L7FB 1MFBH 3U0WH 4GC3A 3IBEA 1FYTA 4JJ5A 3K30A 4Y5YA 2DSVA 4NKIL 1FSKC 1ISZA 4WDIA 1JYXA 3IWPA 1A5OC 4CD7A 2AJ3B 4G9DA 1V7AA 2IAND 1ETA1 5MI0C 2J8HA 1HL2A 1IM9A 1JVOA 3VYNA 1VFUA 5T3ZL 2NY6D 4XBGA 2LLNA 2FO1A 4GABA 4GXWA 4BKLB 2VDRH 3JVAA 4Y1SA 1CT8B 1O75A 1CYGA 3MV7E 3WLNA 5F21B 4HJEA 1TYEB 4K8RH 1RZ8A 1ADQA 3H9SB 3QDMA 1HSAB 1YKWA 1AODA 1ZPTA 5AHEA 4R84A 3KPSB 3FKUS 4JFDA 5D38A 1WS7A 2C3WA 4YAQB 3HG3A 4IF2A 4MYPA 4ZUWA 1JF6A 4PRPD 4YHYC 3I4EA 4MNLA 1HWGB 4QTFA 5JHLL 4TSAH 2R24A 2VX7A 3PZOA 2D7TH 1T4KA 4G7SB 4Z8FH 2MNJB 4BZ1H 4HB7A 4PMZA 8PAZA 3SQOL 3VFUB 3QMRA 1IKFH 1RA5A 3IIXA 2XYLA 2ATPB 4C8XA 1V6VA 4NAFA 4IIQB 1FWFC 3BMVA 1PTAA 3VI3A 3ECQA 2WTRB 3EYOB 5G1TA 4OD1L 3RY5A 5IMMA 4GUFA 3DROA 1UB5B 4JFUA 3ULUC 4N85A 1JGUL 4TNEA 1XBVA 4F20A 1MFBL 3P9LA 2E77A 2EXWD 2WM1A 6A3HA 3N43F 3TA3A 4ZTOH 1K8CA 3H6OA 4QS6A 2Z7ZA 5IMLB 3L4CA 2P9RA 3BGJA 3GINA 3HGOA 3L3KB 1MG3C 1R5VB 4R9OA 2QZQA 4XNUH 4H1LA 3G9AB 4WEMB 2PTDA 3LHVA 1XX9C 4NYLA 1KT2B 1MF2L 3UVAA 1FZJA 4O0KA 1F4XH 1V7NL 1LK3L 2JLLA 1P0BA 3JWNE 1XBYA 3NABL 1F3RB 3VFNB 4A6YH 3KOFA 3G08A 3VTMA 2W9EL 1WSST 4RZ5A 4ZFMA 3IGKA 2VVNA 4G6MH 3WAKA 2JKRM 3ARRA 3CBWA 1WZAA 3BH8A 1ZT1B 3L3IA 4ZUVA 4TYUA 5KYXA 1P9MC 3MNZA 3WLRA 2P3YA 3M64A 3E80A 4X80H 4ZE5A 3W9EB 4PS4H 1VDGA 1CFSA 1DQJB 4MDIA 2VD9A 2OW6A 3ZJKA 4CCDA 3JV6B 1CD1A 1M9WA 3ZHLA 4BWTA 4M6AA 1T89C 1NUNB 5AVWB 5FO8A 1T1WA 1CTOA 4KX7A 1CE1H 3QUYC 1UM6L 4TSBL 2VFFA 4IEFA 3INPA 1W8NA 3EJRA 3HZVB 1Q7ZA 5D04C 2OZ8A 3HA1A 2B16A 4UOW0 1BXBA 4OZGE 2QLVB 3MTXA 4RISH 4JO8A 5DRXB 3JT0A 4I8DA 3MRHA 5HAOA 2HSAA 5E5RB 1KFAL 1NCGA 1E4MM 3V95A 3ANYA 4LSUH 1AIFB 3VIPA 4ZTOL 2Y1HA 5EORL 3R0NA 4PBVC 3NO3A 1KC5H 4E9XA 1LLOA 4ADIA 2CLEA 1VEPA 3LYEA 4JY4B 1XL4A 3IDJA 4HHHA 7REQA 1NDGA 2NDGA 2Y7SA 3P3YA 5FV2A 1NLBL 1JPEA 3T2NL 1NCJA 3LMJH 3H1ZA 3V4PA 2IWEA 1UWXH 4RWYL 1UWSA 5IOKA 2O72A 1JZ7A 4KZEL 1IC4H 4MGGA 4LBEB 4QRNA 2LAAA 1NFAA 5C07E 1NTDA 2ZXDA 3Q06A 5JXAH 3KCPB 1KB9J 2Z7UA 3FUNA 1PX4A 4KI5C 4KK8C 4GYBA 4CVWA 1MAMH 4JTJA 3PQYD 4U49A 5F9OL 1FWNA 4NI8A 2Z4TA 25C8L 1MAML 1ED3B 2F7IA 2P52A 3T2QA 2BIOA 3ZR5A 1TVLA 4PMDA 1OL0A 2R6OA 4Z3FA 1EEXA 5HGBB 1A0DA 2OSLB 4TUKL 4HU4A 4DH2A 3F7RA 5DC2A 3WNOA 1OQFA 4MNHA 2VLRE 3EOEA 1JRHH 4O52A 4GFIA 1W1A1 4WR3A 3F5JA 4NO5B 5HNNA 3AWNA 4UTBL 2VC2L 2JIXA 5LIUX 2OFQA 5L8LB 1QPPA 3VIMA 4YBLB 4DKEH 3DGGA 1KZQA 2Y72A 3A5VA 5J3HC 3FQ4A 4H44C 1RI8A 2X4SA 2XKSA 3RTQC 2JFEX 1XBDA 2G75B 2WJDA 4AC2A 1DJSA 3H7RA 3GLAA 4PJDB 3G6AB 3IAGC 4RNHA 4LUIA 1EHXA 4ABQA 1GJPA 4UBPC 4PGEA 4E3VA 4YDKL 2VZTA 4UINL 5TIMA 3CMOH 1INDH 1MI5A 1AZBA 1ZXKA 4XWGL 5KZCB 1HQTA 2I5QA 4MZ1A 4WY0F 4HUXB 2GJZA 5CIPH 4AK1A 2J57A 3WLTA 3H24A 4XNMA 1DE5A 4WO4C 2O9RA 2WMFA 4RK8A 3ZLFA 2QUVA 3M88A 4XXCA 3KVMA 4XSLA 1P2CA 5ICYB 5E5CA 3NR0A 5G4OA 3FFDA 4L8BA 4Q8BA 4XVSL 1HC1A 5TQ0H 5I5RA 1LF1A 2QADD 4XX6A 2NQDA 3W57A 4RLIA 4ZOAA 2PLJA 3TAKA 3FJLA 2WV8A 4LCQA 1BFVH 3MV8E 4R96B 4E3TA 2G3NA 3UADA 1EOMA 5JO5A 1S38A 2XH2A 2DLTA 4K3EL 2VQ4A 3VXPA 4K3EH 4LO9A 5C6TH 3KXFB 4C6CA 2OTUA 1E4XL 2W9LA 5T1DL 3TFKD 1QT1A 4CNSA 2W94A 3OKMA 5T3XH 4CNIB 2R56L 4KXDA 1MHPL 2B5IC 1OT2A 3J27A 3UBXB 3W71A 3T3PB 2GWNA 2WQUA 1IAMA 4L3EA 4JPSA 4KITB 4DZAA 1T21B 3SZKC 2D7OA 3IKCB 5HGAA 1JERA 2AITA 4FXGA 3LIUA 4MA3B 4Z0XA 3WFEH 1BWWA 2APSA 3MJ6A 1E6XM 5F2IA 5IB2A 2DQJH 4NQSA 3CTTA 1BWLA 1VFTA 1H5BB 1I9RH 1SVZA 1HW6A 5D7HA 4R5TA 5DEGB 3FCTA 2O5XL 5K9QG 3DFNA 1QFHA 4K37A 3IDNB 4MKNA 4OV9A 4CBZA 1QFEA 4RNRA 2QV2A 4X6CB 1ZAHA 2HS6A 4MMWA 1E5NA 4JDVB 1H60A 3CHSA 2YD4A 3C0LA 1E9OA 2P44B 4TULL 3DTXB 2D3LA 5DTFA 2CCRA 5T26A 4BHYA 1DDTA 5DO2D 1ZHNA 4CU7A 2XWTB 1HH9B 4XMKH 4BRVA 5HVWA 3HPAA 4L7ZA 2P49B 1EXUA 2DM2A 3GAYA 1BREA 3DBXA 1K4DA 3TBTB 1BBDL 4UV4H 5E5LA 3SQRA 5ACZA 3MT1A 4JIPA 3CZ8A 1GYCA 4OE7A 1BXXA 2FTWA 4OD2B 3FLUA 3UJRA 5D2NE 1YEIH 4N2KA 4HH8A 3FH8A 4UINH 1E0UA 5K9OA 4RPQA 3RRXA 4KRPD 2DQEL 2OR9L 3MHZA 3W85A 4UIKH 2DSWA 2UZ9A 2CLZB 2X89D 3I3DA 1QNZL 1WVZA 1Z2KA 1MHEB 4WLCA 4PGJA 3MUCA 4D6CA 5F2LA 1S7QB 2W38A 2IO5A 3BT2H 4UYPA 1AJ2A 1H3PL 2PDUA 5JOFB 2W07B 4FEIA 2KLTA 5I5MA 1T7VA 1DTNA 1L5GA 2DQXA 2OKMA 3WUWA 3PZ9A 2OMZA 4J40A 3IU4L 4H0HB 1VFLA 4DEUA 3NFPB 4XO5A 2R4SH 3RUGE 1NA8A 1AIZA 2F1EA 3FPYA 1AK5A 3DSFH 1S2TA 1JDCA 2HJKB 1U2CA 2RFXB 4XP4H 1FWWA 4QGTA 3WFEL 4MWAE 4KRUA 3VOIA 3LZLA 4L8SC 2Y7NA 3LV3B 5GZNA 5LG6A 2CBUA 1G0CA 2VM9A 1TWWA 4IDJL 4HG4K 5EOTB 4K8RC 4K5OA 4V1DB 3TH4T 1RIVH 2DQGL 3FRPB 3P4OB 3ZPDA 5I71C 1ZLVK 1F4HA 5I06A 3SKNA 1P5UA 2WO4A 8A3HA 1TFPA 1YEFH 4RDZA 1SJHB 4GI8A 4DEFA 5DSCB 4ODSH 5DVNA 2WPGA 5EOCH 2V30A 2IPJA 4JAMB 4RRPM 2H0JA 3WS3A 4AGOA 1AHWC 1Q9LA 1ZALA 2WZ5A 1E6NA 4M6ML 3H0TB 4DZ5A 1QP1A 1PY9A 2IMNA 4UNIA 2WYZA 4ZFGL 4G7EA 1LWRA 5CZXD 2ZRWA 3A4AA 2YKKA 3S2AA 5IV2B 1NQ6A 4PJBB 1H41A 1ZSXA 3PWGA 2NUPB 5I15L 3S9YA 5BRBA 3DMMB 2NV2A 1ONEA 3I75B 1LQAA 4JM2B 4HC1L 4LXFA 4EKXA 1HHJB 2RB8A 1UKPA 2Y36H 3GFUA 5K9QI 3HG4A 3V4VA 1EGMA 4C1KA 6XIAA 3MCMA 2NYKA 3PL6C 5ANHA 5J5RA 1GVFA 5EULV 2BP0B 1SYSB 5JR1H 1KCSL 1OTSD 1XGUB 4TLKA 2V6AA 5LGJB 3CHEA 2X3AA 1Z66A 5I03A 5F2FA 2A0LD 1M56B 2FIKB 3ETBJ 3H23A 2AFNA 2EKCA 4QGCA 1F58H 4JN2B 3WH5A 1AQDB 3LA4A 5I09A 5F7YC 4MS8C 3TWYA 2ADJA 4LHQB 3V8CA 3GD1C 1CK0H 2Z35A 2J44A 3NO1A 1KXTB 1N8ZA 2CM5A 5GZND 2HPTA 2E6FA 4PULA 3IDYC 4QFUA 4A63A 4G6CA 4MKVA 1RK0B 1S7SA 4NQQA 1RURH 5E99L 4DJED 2PLCA 5A6BA 5FIPA 1XO8A 1ZVSA 3L2LA 4RGMC 2KQMA 3IJ8A 4QRFA 4F9DA 1JOIA 3CFDB 4UDUA 4W7UA 1DXFA 1MREL 2WNKA 4G42B 3SGKC 1E9QB 1YSOA 3SE8L 1UQYA 3EPOA 3N1PC 3REWB 3JZYA 4QEGA 1QOQA 1SO5A 1TKWB 2E74C 1D5ZA 4KROB 4MJ5B 2ZZ4A 5CG7A 3K7UA 4UTFA 2YBRA 4GXUN 2UX6A 1QFWH 3TIDB 3T0DA 4CU8A 2ZZ2A 4LB8A 4L9LB 4UV7L 2A1WH 1G7JB 2ZOLB 2A6NA 3KS6A 1YPZB 5FK9B 1P53A 1VACA 4P9MH 4ZPTA 5G4HC 1EMTL 3P5ZA 1K8ZA 3NJIA 3VX1A 3HG1D 4IP4A 4XCYA 4LEFA 3CZLA 2AJYL 5DHVB 3FU6A 1FHLA 3P61A 4U5IA 5DURD 1Z3RA 3BEWB 4WK2B 4AEEA 3D7PA 1NIAA 1WA2X 1N5AB 4FS0A 4ZT1A 4IM8A 5FW7A 1LBMA 1P6CA 1YE4A 2WHKA 5MENE 3QH3A 4LE8A 3KJ6L 1YEEH 3R25A 1R19A 2FGWL 2IANB 5GS0C 3WF2A 3A4EA 2ZXWB 2EO7A 3QZWA 2EADA 2IQAA 3IXAB 1WQ5A 1IT7A 2WXGA 3BVUA 3LRMA 3QJAA 3LNDA 4V1YA 3WJJC 3Q5TA 4QTIH 2H0EA 4ZMTA 4LHUD 1SBSH 1S9YB 1BQRA 2R69H 2B1AH 1NAKL 4U2ZA 1XF5B 1FRGH 2YDQA 4LGPB 4EZJA 1CI5A 2Z92B 1CLZH 2ISWA 4WO0A 4ELME 4U10A 3PJTA 2PLTA 1F5ZA 1ZTVA 4UMBA 2BH0A 3STCA 3QNXB 3CUIA 2EJAA 1SHXA 4MD5A 4KQ4L 1Y7VA 4QD2E 3WSUA 2PP8A 1ODZA 4KY1H 3CGTA 3M5YA 2OO6A 4Y4KB 1MCEA 3VCLB 2DAVA 2IQAB 2BP5M 2OQJB 3IXAA 3QPQC 3QZWB 3KPRA 4OGXH 4WI4A 2RTTA 2DT1A 1GOIA 4ONVA 4XN8A 4UIMB 4FTVB 4TO8A 3EZJB 4S1QH 2V2TA 1O9VA 2N3JA 2FH6A 1E7VA 2OMYA 4GSDH 4EWND 3P73A 4IMKC 4MTMA 1N5AA 2QT6A 4MA7L 4P4KD 4B5XA 3AXLB 3QORC 3U9WA 3NCYS 4V28A 3QZAA 3QJFB 1CE6B 4EMZA 1YN6B 2VDQL 1E1FA 1YADA 2BSLA 4G9PA 5DZLA 3W6YA 4ZPTB 2GSGB 5HUOA 3SSJA 3PL6D 1YPZA 3VK5A 5C0GA 3B2UD 5HYQA 3QJZA 4X9YA 2Q2EB 3QDJA 2MKLC 1HDMA 4JB9L 4ZK8A 3TIDA 2FKPA 3TA6A 2IV8A 3CQHA 1GH7A 1QKZH 4PMQA 2WMPA 2ZP8A 3XIMA 4GRLB 3F5KA 4HHAB 2PCQA 2CZNA 2UY6B 4FHKA 2EPMX 2OR2A 1U8IA 3V5HB 1IT0A 4OCSH 3BZGA 5EMMA 4AZ5A 2CKBL 3H9YA 3CXDH 3O9WC 4MWFB 3CFDA 1TMCB 4UDUB 3S35L 3LD5A 1EBPA 4RX4A 4QHUB 4FEZA 3BW9A 2HCVA 1YMYA 1NGWB 3OAZK 2HH0H 4QDMA 1RK0A 1S7SB 1TVHA 2XRAL 4U33A 2AK1H 4D7BA 3EYQC 3UL4A 4Z7AA 1GA2A 3P8JA 5LAXA 2QDVA 4Y8EA 15C8L 2WHJA 3T3MB 1R46A 1XYCA 2DRUA 3K72B 2J8UE 4D8PA 4B5WA 4JM4L 8TIMA 4L4VE 1BD2B 2W5FA 4ZYKB 3U2JA 4Q52A 3VDAA 2NSXA 4B3ZA 3QZLA 1U8LA 3BN9D 4NNPH 3O8AA 2X1XR 4M61A 4I9MA 3BURA 4UCFA 4WENB 1YECL 2FIKA 2JJSA 3FTUA 3PF2A 4MY1A 1OSZA 5D5ME 4AGNA 5KSAA 2BNUA 5IDIA 5LGJA 1BWKA 2A9AA 1XGUA 1IE4A 4DM2A 1OGPA 3GYCA 3LHTA 3G5XA 5ETUA 1EL3A 4LANA 3WUEA 2J88H 4GHRA 4H20H 1FV1A 1QRNE 1RP8A 3MLZL 1J9QA 2VDNB 3QUGA 4Y1AA 4U7KA 4CA4A 2FJFB 1NANI 4QRQA 2IKHA 2F6AA 4QCIA 5C2GA 5GS1B 1X7TA 4FXKC 2VXTH 4F8TA 1OANA 2Z34A 2ZYHA 3QISA 5G2IA 2BP3A 3IK2A 4HWNA 4MJIE 5KOVC 5I6OA 3DRQB 4AQ1A 4LPYA 4G7EB 4YNGA 3CX2A 1RHFA 3ZM8A 3GB6A 5F1UA 1KM3A 2VOTA 1DVZA 2D4DA 3MRNA 3S2MA 1EP3A 4DBWA 4JKLA 3V0JA 4XC3L 5DK3A 1T41A 1MQRA 4UOW1 2C7FA 5T5FA 5KVEH 2Y70A 1C93A 1SJHA 1XD0A 1KFEA 3Q8AA 1QUNB 5JLZA 1KPRA 2PWDA 1B88A 4JHBA 1MFNA 4WW2C 3ZL1A 4N8VB 1NF7A 1VGAA 1IWAA 2YXGA 4QE1A 5CJXC 4V1DA 5B8CC 5AZEL 4IG2B 3OGOE 3C60C 4AG4L 2WBJD 1FNHA 1MAKA 4LVNC 3MMEB 4W9KC 2ISDA 3U30B 4AJVA 2G4FA 2XQYG 3K46A 3CXDL 3DNKA 1QASA 2C9XA 1DJHA 1WS8A 4QT5A 5KSUB 1UT9A 4B97A 2HJKA 3SY0B 4GEJA 4OCRH 1ADWA 3VFMB 1TQCB 4QDGA 4OKVA 3D5OF 2B8OT 2Q8BL 5HI3D 4C55A 3NIDE 4L5FH 1PCKA 3QHFH 3RJOA 1X98A 1MW0A 2EP6A 4LSQL 2EJ1A 4J3WA 4LARL 2AVGA 4FN0A 4TV3A 3KW8A 4L4TE 2WQ8A 4N2AA 3BRGC 1UTDA 2XIOA 3LMZA 5ACMA 4HA0A 3WK0A 4IMLB 4XE0A 4DF0A 3HAEG 3VPLA 3O6ML 2GSIB 4AEHL 2D3VA 3VQ1C 4W6XB 5EN2A 3ZHNA 3PB2A 3C09B 5GZOC 4J23A 1TYRA 3JU2A 1CF8H 2J21A 4S3EA 4UR8A 3LBMA 5B1KA 2ICCA 4O2EA 5EIQA 3MA9L 4X9SA 5GJTH 5JHLH 4O2FB 2ZP9A 3TBTA 1ZWIA 2MNWA 3M1CA 4JRLA 2MCPL 3WQ4A 5ABAA 1GAFL 3NUKA 4EPKA 3CE1A 1Y18A 4N6EA 4YYCA 5E00B 3FU7A 4M7SA 3T6CA 1VRXA 2OEJA 5DTFB 4JRYD 4C90A 4NQ1A 2H3BA 4KKNA 5TQ2L 5CC3A 1DVSA 1QA9A 4P5TB 4X6CA 1J79A 4I7WA 4J2PA 3W7PA 3IDNA 1TB3A 1YDOA 5IB3B 1UCBL 2ZKHL 2V7HA 2X3BA 1CPUA 3A67H 3OLEA 1M3UA 1WH0A 1L3WA 1TX0A 2FHCA 3ID7A 5HGGS 3R2GA 4Z0XB 3T8QA 4D72A 4YSSA 5CBBA 3UYRH 1RUML 5JIPA 4LTSA 3IKCA 4E4UA 2BRRL 1TVPA 4OCNC 3B43A 1UJQA 4FSAA 3SGDI 4NQTA 4ZB5A 4M29A 2X4UB 2YR3A 1FAIH 3CZKA 1S3HA 1MF2H 3F00A 5L8KB 3DHFA 5FW8A 4DWHA 2BVTA 3B8YA 4B3LA 2VXVH 2IV9A 1OW0A 2OTUB 4F8OA 3KXFA 3VXPB 4ZMLA 2VITA 1SXCA 3S6DA 5DJZB 5FLVA 3FTXA 4X0NA 4M7LL 5EZIL 1JJKA 2MH4A 4W9TA 1H3VA 3LB6D 2GGHA 2NW3B 5D7LD 3OR6A 1CF8L 4HTBA 4L5FL 1M7UA 4CJ1A 3RPKA 5JQHC 3UTPD 1HTIA 2NY3C 1I7RB 3FFDB 4L8BB 2L4OA 2X88A 3SDYH 4P59H 2WXIA 3VI4A 1A6ZA 1P2CB 5ICYA 1YC7A 1KGCE 4HBKA 1HL5A 1OCOB 2N7AA 3EFDH 3L5LA 3PJNA 3RGTA 2X6CA 4AM0A 1GGTA 1CGYA 4KRNA 1AW5A 3OD3A 1XGDA 2OLHA 1D6EB 4YHNA 3CWOX 1U6AL 3BESR 4HUXA 3TM6A 3LQZB 3BCDA 1UM6H 3PQYE 4H8PA 4TSBH 1MI5B 4GIAA 3QUMA 1KIQA 4CW1A 1ONXA 4KAQH 4W4OA 5JIQA 1RZ7H 4PGEB 1JPIA 3HBQA 4D8ZA 2DD8H 1T7YA 2OMXB 3WCZA 1AC0A 1KNOB 5EIIG 2WO3B 2C18A 4ZQMA 1HINH 3PBGA 3WQEA 2G75A 5C97A 1BAFL 5DRWB 2UY7A 3IVKA 5CWSB 2OG9A 5I73C 2NOYA 3AY2A 2X1WL 2XQBH 2NXYC 2JIXB 1RUKH 2FX8L 2R1MA 4JICA 1GGIH 3QYCA 1YIXA 4JD4A 1CL7I 5I8CB 3ATEA 4ZL1A 5I19L 1S7XA 3O16A