1KXHA

Crystal structure of the complex between an inactive mutant of psychrophilic alpha-amylase (d174n) and acarbose
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
448
structure length
448
Chain Sequence
TPTTFVHLFEWNWQDVAQECEQYLGPKGYAAVQVSPPNEHITGSQWWTRYQPVSYELQSRGGNRAQFIDMVNRCSAAGVDIYVDTLINHMAAGSGTGTAGNSFGNKSFPIYSPQDFHESCTINNSDYGNDRYRVQNCELVGLADLDTASNYVQNTIAAYINDLQAIGVKGFRFNASKHVAASDIQSLMAKVNGSPVVFQEVIDQGGEAVGASEYLSTGLVTEFKYSTELGNTFRNGSLAWLSNFGEGWGFMPSSSAVVFVDNHDNQRGHGGAGNVITFEDGRLYDLANVFMLAYPYGYPKVMSSYDFHGDTDAGGPNVPVHNNGNLECFASNWKCEHRWSYIAGGVDFRNNTADNWAVTNWWDNTNNQISFGRGSSGHMAINKEDSTLTATVQTDMASGQYCNVLKGELSADAKSCSGEVITVNSDGTINLNIGAWDAMAIHKNAKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallographic evidence of a transglycosylation reaction: ternary complexes of a psychrophilic alpha-amylase.
pubmed doi rcsb
source organism Pseudoalteromonas haloplanktis
molecule tags Hydrolase
molecule keywords alpha-amylase
total genus 159
structure length 448
sequence length 448
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1kxhA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kxhA01
2XIIA 3AIWA 1UD4A 1JI2A 3BAXA 4W5ZA 1FH9A 1EHNA 3ARTA 1E72M 1KCLA 1TVNA 4J3SA 3KLKA 3EDJA 1KFWA 2X2JA 2GSJA 1CGWA 2X2IA 5FOOA 1PIFA 1NOFA 4WSJA 1W9UA 2DIJA 2XUCA 1GOKA 4GZIA 1ZBVA 2X0YA 1XH1A 1ITCA 3TA9A 4JIEA 1N82A 5M17A 3U57A 3VTRA 1E1EA 3BUPA 1JZ7A 3DC0A 3ALGA 2YDRA 2UY4A 3WDIA 1PX4A 4FNUA 1GCYA 4UOJA 4MB3A 3DDFA 3W26A 4OIFA 5LA1A 1C92A 3IJ8A 2WXDM 3O2LA 5TD4A 3EMQA 3GNPA 1DWAM 1KQZA 1UR0A 1UA7A 1GPFA 1JZ5A 3IJ9A 2EPOA 4BCEA 1HJVA 4M81A 3WBEA 2F61A 1AQMA 4R27A 4CVWA 4CU6A 1HN1A 2VRKA 3VNYA 3CO4A 1BLIA 3PZUA 4Z2JA 2ALWA 2ZXDA 1E56A 2JFEX 2PB1A 1CIUA 3EJTA 5E09A 1JZ8A 1VFUA 3W27A 1BQCA 5A2CA 1MYRA 4AY1A 3M07A 4AMWA 4RE4A 3CTTA 4C7GA 1J01A 2J7GA 4W88A 2JE8A 3TTSA 2CBIA 3VIKA 4CVUA 1JGIA 2EQDA 1MFVA 2UY2A 5D8WA 1K9TA 1SYTA 2ZOXA 3LRLA 4LYRA 2OWCA 3AQUA 2UY5A 5BROA 1TFVA 2CKSA 3W82A 4YPJA 4M80A 2W61A 4AW7A 2GUYA 4UCFA 2WKGA 1DWFM 2O9TA 1E5JA 1J0HA 4FLSA 1BYDA 2WC3A 4W87A 1JYWA 1J0IA 4D1JA 2E3ZA 3CZGA 1KXTA 2PWEA 4JL1A 3K46A 2EBNA 5CSYA 3ZT5A 2GK1B 3QOKA 5FIPA 3K8KA 5CGTA 1E70M 3BAIA 4XX6A 6CGTA 3WSUA 3NDYA 1G1YA 2QPSA 5A6BD 2ZXBA 4HA1A 1TE1A 1JDCA 2FHCA 4AZGA 3F5LA 2VZSA 1QHOA 2DIEA 2XVKA 1F4HA 1E6SM 2J7BA 5EMYA 3LPFA 5A69A 4OKDA 4MB1A 5ABFA 4H2CA 1DEDA 4UTFA 3WMCA 2VOTA 1S46A 4AEEA 1TQSA 2XFFA 2ZX5A 1V3JA 2Y8VA 3L4YA 3AXXA 4DO6A 1KQYA 2J7EA 1LL6A 2UWFA 4U2ZA 2CHOA 1BF2A 3LXBA 4YHEA 3CZ8A 4PTVA 1GQIA 5LA0A 5BXRA 1DWHM 2VCAA 1W9VA 3ZJ6A 3PZOA 1K6AA 5CLTA 2BVYA 2WC4A 4DM2A 3VGFA 1NM9A 3K8LA 4BQ4A 1H49A 3CZSA 4ZEPA 4LGXA 4CD5A 4DM1A 4ZXOA 4YN5A 5BXSA 3L4WA 2NSXA 1EDQA 2WCGA 3U5UA 4PMOA 1KTBA 1NWRA 1J11A 3L2LA 4FNRA 4Y7EA 3OB8A 3NDZA 1PPIA 2BXYA 1HKJA 1QWUA 1HVQA 4H41A 2X2YA 1KB3A 2CXGA 2D0GA 1GOIA 1E4LA 3EBVA 3VD7A 3WQVA 3KWXA 2EPNA 4PUEA 2OLHA 4DWSA 4NZCA 3U5YA 3WKZA 3EJQA 1R87A 2XTKA 2YL5A 3ZJKA 3BVUA 1J0JA 5HPOA 3CUJA 3UG3A 3T08A 6A3HA 1HKMA 1X6LA 2DSVA 2DSUA 2A3AA 4AD4A 1ZB5A 2A3EA 5A2BA 4EAMA 1UKSA 2J7FA 2JALA 3DHUA 4D6CA 4CGTA 3S2CA 1C8YA 1E6ZA 1NOUA 1KXHA 3BVTA 2FHBA 2WM0A 3GNOA 2EO7A 4A3HA 3A47A 2QF8A 3WDJA 1C3FA 1MFUA 3GDBA 2VZUA 3TTQA 1SZNA 4N0RA 3T0BA 4KMQA 2V3GA 3BVVA 1KXVA 4QCFA 2DT3A 1B3ZA 1D2KA 1HJQA 3WUBA 5BWFA 1V0LA 2J79A 3W28A 4ZE4A 1OSEA 3VMNA 3ZJ7A 4NRSA 2V5DA 4MAVA 3QHOA 4B9YA 4GI6A 1ISYA 4D6EA 2AOSA 4JAWA 4AZ6A 1C91A 4Z2LA 1EXPA 2W62A 1T0OA 3N1AA 3N17A 4JHZA 2Z1KA 2D22A 4IM4A 2YIHA 2QPUA 5GNYA 2YKKA 4FMVA 5ABFB 4QFUA 1QNRA 4W8BA 5BXPA 1JF6A 5FD0A 3W0KA 2D24A 4PYSA 3E1F1 5DMYA 2BHUA 3D50A 1E71M 4AYGA 1GVIA 2J74A 1MQQA 3I3EA 3HU7A 5E0FA 2EXOA 1QBAA 1FFQA 2WMFA 4BQ3A 3VMOA 4HPGA 1VEMA 1I1XA 3BXWA 1R33A 3EYPA 2WVSA 3OLIA 1TQTA 3TONA 1FH7A 1VRXA 4JZ5A 3VVGA 1XRVA 4UFKA 1CECA 3NIYA 1MXDA 3L4UA 4QLLA 3WD2A 5I2UA 4GXPA 4HZ6A 4EE9A 1GUVA 1BGGA 4W8LA 1UKOA 4HOZA 1EQCA 3VNZA 1XSKA 1BVNP 1JI1A 3WFZA 3H55A 1XD0A 1QNSA 3TV8A 3ZQ9A 1VBRA 1R47A 1B3WA 1C90A 1H41A 3W53A 3BSHA 4GO8A 1B0IA 4HP5A 1LJYA 3WF4A 1F4AA 4KH2A 1UQZA 1H0GA 3CHDA 3BAWA 3IGUA 4W84A 4QP0A 3N9KA 1I1WA 1UR4A 2O9RA 3PZQA 1YQ2A 3M7SA 2DT2A 5FL1A 2D3LA 1MW0A 2J25A 1LWJA 1KBKA 4AZCA 4AD1A 1QOXA 4URIA 3LPPA 1AVAA 3IK2A 1R86A 2DT0A 2J47A 3T09A 3KZSA 3AIBA 1ISXA 1HWWA 2D3NA 1EIBA 2YLAA 1B31A 1ZJAA 2WNWA 1US2A 4UZUA 1XD1A 3VD3A 4YHGA 4W89A 2XN2A 3AROA 1R7OA 7TAAA 3VIPA 1W9BM 4FK9A 1HJUA 3QHNA 1VJZA 2EPMX 3AIRA 1ZJBA 1VEOA 3RM4A 4D6IA 1J0ZA 2WZIA 3OIHA 1V03A 3VOCA 1XH0A 3WDPP 1FFRA 4MJ2A 1KGXA 4V28A 4AD2A 3VDHA 3VSTA 3DHPA 1BYCA 1CZ1A 1VENA 4Z2GA 1OT2A 1VIWA 3CLWA 3LMYA 3RMEA 3O9NA 4DUVA 1WDQA 3WH6A 1QI4A 2J4GA 1QX1A 1VAHA 4FLQA 1QNQA 1M03A 1QWNA 3ARWA 3AMDA 3KL5A 1E9LA 1EDGA 2WSPA 3II1A 3CMJA 3CIVA 2VX4A 4PMRA 5A6LA 2WHMA 1UA3A 3VGGA 2BFGA 3WMBA 2AMGA 1CPUA 2FE0A 4BA0A 2Y24A 4M8UA 1BFNA 4M29A 3MSGA 2WLYA 1BYAA 3AHYA 2QHAA 2O92A 1E15A 1V6VA 4UQCA 3NUKA 4R5EA 1JZ2A 2VCBA 3UG4A 2VL4A 4W85A 3FNDA 3WY2A 4C7FA 1VF8A 3SUSA 3SEPA 5LA2A 1OD0A 1WP6A 5A8NA 1GQJA 3OGSA 1QW9A 1JAEA 1W3LA 4RL3A 1TR1A 1TZ7A 1CDGA 1QBBA 3MSDA 1EHAA 4AC1X 5I3DA 1OGBA 4S3KA 3T2PA 2CPUA 1CXIA 1TA3A 1V0KA 1CXFA 3MO4A 1ZS2A 2GJPA 2YL9A 5E1QA 5E6ZA 2JF7A 3EDFA 2YFOA 2ZXQA 2JEPA 1W3JA 5GQBA 2VC9A 3CV5A 1CXHA 2XFRA 2G3JA 1U2YA 5ABHA 1KR1A 3U7VA 3CZNA 4J27A 2V3DA 1UYQA 1ODZA 2W91A 1XHGA 4B15A 1IZJA 1GVYA 5HNNA 2FDMA 5IDIA 3WQ6A 2O9PA 3AHZA 1BG4A 1J9YA 2XPKA 4JFSA 4CKQA 3VM5A 1UD3A 3GXIA 2VR4A 5A6KA 2Y4SA 4W7VA 2DSZA 5CZKA 1XSJA 4QCEA 4UNIA 1GONA 3ZOAA 1GOWA 3VUPA 4M1RA 5AYIA 2VJXA 4V27A 1Y7VA 1UUQA 5D9MA 2G41A 1UWRA 2CBJA 1GJWA 2NT0A 4NSBA 4P8VA 1Q6EA 3MUIA 3AIQA 3QHMA 1WDSA 3NYDA 5EFFA 1HT6A 5KEZA 2YDSA 1JYVA 4W8AA 4B16A 2XSAA 4P7OA 1OGGA 2EAEA 2TAAA 2Z1SA 2OWWA 3SUUA 3WL1A 2VZTA 2E4TA 1O7DC 1E6RA 3W38A 1A47A 4PCSA 3VIMA 1OB0A 3S5ZA 3WEZA 1UHVA 3ECQA 3AOFA 2A3HA 5ABEA 2QMKA 3HG5A 5D9PA 3PZ9A 4D1IA 3GH5A 4HMEA 2PBOA 1J0KA 4MTVA 5F7UA 1UD6A 3A6OA 1MQRA 4TXEA 1HJWA 3L2MA 1W1VA 3THDA 4AZHA 3T2OA 3L4TA 1W9XA 1VFFA 3BCFA 2GJXB 3NSXA 2JEQA 4JL2A 5CXPA 2VMFA 3K8MA 3HG4A 3OLGA 3IAQA 3WIJA 3FHAA 1EOMA 1GHSA 1LG2A 1RP9A 2ZUUA 4D6HA 2ZUVA 1SMAA 1I75A 1W2PA 1UQYA 4TTGA 4AD0A 2XHYA 3GZAA 3MMDA 4NF7A 3SUWA 5C8BB 1YHTA 5A6AA 4BF7A 3FY1A 2PWHA 4E8CA 3MU7A 1QNPA 5FL0A 1E4IA 3GBDA 1OM0A 4RE2A 4AMCA 3WNLA 3BLKA 3PHAA 3PN8A 3PTQA 3WNOA 3SURA 2BY0A 3CUIA 1TG7A 2WCSA 5DFAA 2BY2A 1GQLA 3ZSTA 1KGWA 5M3WA 4MPKA 4OBRA 1H11A 5BRQA 4PTXA 3WENA 4FNTA 2D2OA 4GZJA 1CGVA 1V02E 1Q6CA 5HDRA 4JCLA 2BXZA 4KRUA 3VIFA 3VDBA 2BY1A 2OYKA 1BSIA 2IGTA 4HOWA 2F8QA 4HMDA 1QI5A 2WPGA 3VIJA 2D20A 1JXJA 4PTWA 1EO5A 3VINA 1SR0A 2FH6A 3WF1A 4Z2IA 3HJEA 1QHZA 2YLLA 3CZKA 3VU2A 3UR7A 1ESWA 1GORA 1E43A 4LXFA 4MNLA 5I78A 2E8YA 3AMKA 5IFPA 3TOPA 1VB9A 4PN2A 1JDAA 3VIIA 1UR8A 3SCTA 1CYGA 5A2AA 2YL6A 1HVXA 8CGTA 4ATLA 2J8FA 3OA5A 1DTUA 2WC7A 2DSWA 2ZX8A 2C8NA 1JD9A 3BGAA 3GNRA 1PX8A 3WH7A 1PBGA 2XGIA 4UR9A 2EADA 1FP9A 3WH5A 3NSMA 1W91A 1ZBWA 3LPOA 1IV8A 1E73M 1CLXA 1D3CA 4OOZA 3WN6A 3GXFA 3CH9A 4F9JA 4J7RA 2F2HA 2XN1A 3WEOA 2C7FA 1LQ0A 2EEXA 3BMVA 1OIFA 2DH3A 1PZ2A 4NX0A 1RP8A 2XVGA 3VIGA 4DUWA 4M56A 2CESA 3W25A 5IHRA 4ACYA 2DDXA 3BUDA 3WF0A 4UOQA 4E8DA 1WDPA 3OGRA 3W4RA 3SUVA 4U3CA 3AMLA 4TX8A 4EK7A 2ZUNA 1HP4A 1M53A 3SCSA 3RJYA 3N15A 2Q8XA 3KE0A 2WZEA 4PTMA 2XFYA 4WKAA 1NP2A 1W9PA 4JFTA 1HKIA 4PEEA 2J77A 3WL0A 2OYLA 1W1TA 3MV01 4GZEA 2PI6A 3ARPA 3A24A 1GJUA 2V5CA 4CD4A 1UD2A 3VGDA 3NSNA 1W1PA 2E40A 3GXMA 2G3NA 3IANA 1XH2A 5BYWA 2YDQA 2ZX7A 2FGLA 1QI0A 1TQWA 1E3ZA 4K68A 3PZNA 3VIOA 4X0NA 2G4FA 3WQ5A 3AFBA 1FH8A 1WZLA 1C93A 3BLBA 1GNXA 3OZOA 1JZ3A 3WD4A 3AS0A 1E55A 2A3BA 1ITXA 5EB8A 3MV11 1EA9C 1FOBA 1MW2A 4B9ZA 3PZMA 2BY3A 2J7CA 4N42A 3HZ3A 3WNKA 2WMJA 5AY7A 5CGMA 1E6QM 4AYSA 4PMYA 3CBWA 4W86A 3DDGA 4PMXA 3DYMA 3RJXA 3M46A 4PMVA 1C8QA 4TTUA 4XB3A 4AZBA 2VX7A 1VEPA 1E6PA 3AIUA 4GQRA 1NOWA 3G6MA 5BCAA 3ARVA 3OBAA 2JIWA 3ZR5A 4TVUA 1CGXA 3CC1A 3HG2A 4AISA 1UWTA 2XVPA 4XV0A 2YA1A 3WEMA 1JZ4A 4JFWA 4AIEA 3D52A 1B90A 2V38A 1OWQA 3FN9A 1JD7A 1LLOA 1TVPA 3W6LA 4TVDA 4CUCA 2VZOA 4TVCA 3MANA 5I5RA 3N11A 1EDTA 3VO0A 1HJXA 1W1YA 3AHXA 5ABGA 1X6NA 1MXGA 1G94A 3CZEA 1W3HA 1K9DA 2CERA 3BAYA 4WIWA 3ZM8A 5GPRA 1ECEA 1BHGA 4E4PA 2ZWYA 1CXKA 4CN6A 4DO5A 2WMIB 4M24A 4S3JA 3GXNA 4GPNA 1GOQA 2J8GA 5CJ5A 4W5UA 4KGJA 1JF5A 4W93A 2ZXAA 1UZ4A 3I3BA 2EPKX 4UFIA 2WHLA 2BS9A 3NJ3A 3W29A 1WAWA 1LL4A 3HMCA 1QI3A 1L0PA 3GM8A 2PBGA 7CGTA 4WLCA 1JFXA 2FHFA 4M82A 2VURA 2VRJA 1M04A 3WQ4A 3FXYA 4DWSC 2VVNA 4J3WA 3WMSA 2VQUA 4OUEA 2XVLA 2Y8KA 7A3HA 1QHPA 2D0HA 1UG6A 1V3KA 4J3UA 2QV4A 3WD3A 1M7XA 1EO7A 2G8ZA 2XGBA 2W4XA 1NWUA 3AMCA 1PEZA 4PMZA 3VGBA 2DEPA 1V0MA 2PWFA 2E0PA 3CHCA 5IXEA 2WVUA 3BVWA 2J75A 1E6NA 1CXLA 3J7HA 3AS3A 4J3VA 2F7PA 3WF3A 4HPHA 3ARYA 5D8ZA 2DPEA 4JCMA 2WWCA 3H54A 4NZJA 2D1ZA 2ZUTA 3FAXA 3DX3A 5BXTA 2PF0A 3BSGA 4IISA 3OGVA 1JYNA 4GQQA 4D72A 1HL8A 2VUYA 3AHVA 4TOQA 4BS0A 1LWHA 1E5NA 5CSUA 5JBFA 1ZBCA 2GJXA 3UR8A 2OWXA 3POHA 4X0VA 3AJ7A 3WDQA 3ARZA 1WPCA 5JBDA 4PCTA 5FKYA 3EDKA 4JKKA 3D3AA 4QLJA 4U3AA 1H4PA 2XM2A 4PBGA 3U7BA 1E3XA 1BG9A 3CGTA 3A23A 3IAPA 1HXKA 1TA3B 4PSPA 2BHYA 5BRPA 1V3HA 3KLLA 1TUXA 2WCAA 4PMUA 4MADA 2NT1A 3UESA 1B3YA 4W7WA 3VDAA 2XG9A 2JIEA 1DWGM 3DX2A 1HF6A 3WELA 4EKJA 4UFHA 1BVZA 3LXCA 2ZICA 3PTKA 3TTOA 4E2OA 1CGUA 3L4XA 3MKKA 2F7OA 2WMKA 2F7QA 1OIMA 2O9OA 3DYOA 1HIZA 1H5VA 1UWQA 3M6DA 1J18A 4MNJA 1XGZA 1O7AA 3F4VA 2WANA 5AC4A 3EDDA 2X0HA 3T0DA 2OSWA 4WJXA 3T2QA 4MNKA 1W3KA 1CWYA 1WDRA 3EMZA 5C70A 3H53A 3ZJ8A 1H3GA 3BLPX 3BAJA 4D6DA 2NW0A 3SCQA 3CHFA 3AZTA 3GH4A 1C7TA 5DT5A 3D5HA 3IJ7A 4P8UA 4J28A 1G5AA 1C7SA 1Q6FA 1HJSA 3VKKA 3EJSA 1BTCA 3HN3A 1QNOA 4UOZA 2CYGA 2ZIDA 3VMPA 2XVNA 3ZT6A 5HBFA 3AISA 2WVTA 1K9EA 2XWEA 5D4YA 3QR3A 3GYCA 1C8XA 4LPCA 4AIUA 1HNYA 2XSBA 3SCUA 5I0DA 1RH9A 1UR9A 4AIOA 4AEFA 4LYQA 1EOKA 2ESCA 4UQEA 4ZE5A 2FYVA 3T0AA 2X09A 1L8NA 1UKTA 1VBUA 5A6JA 3K4AA 4V2XA 5A6MA 2CITA 3I3DA 9CGTA 4AZ7A 4P7NA 1U30A 3WY3A 2WYSA 1JL8A 2X2HA 3MMWA 1AMYA 1HKKA 1ZBKA 1MVYA 1JDDA 2WBGA 4JKLA 3LXAA 3PZTA 1UWIA 1DWJM 5FCZA 2J62A 3N04A 2EABA 1V6XA 1J12A 4KRTA 1GOMA 4MB4A 4DWSB 2WMGA 4QLKA 3KEHA 4FNSA 3VIHA 3A4WA 5DO8A 1WNOA 5GNXA 1V3IA 3UETA 3VSVA 3A3HA 2DQXA 5AC5A 3W81A 1KXQA 2QLYA 4U5IA 3DX1A 4X9YA 3MUAA 4MAZA 4AD5A 2XJ7A 4P7QA 2CBVA 2CETA 3WH9A 1OT1A 4PRWA 3OG2A 3SCRA 2V3FA 2FH8A 1Z32X 3BUBA 3WY1A 2DGAA 1XCXA 3N12A 5JIPA 4JFUA 1R85A 3LX9A 4H04A 4D71A 1E40A 2XM1A 3AS1A 4GIAA 4P7RA 2Y2WA 3VPLA 4D6JA 4PMQA 5I23A 4RE3A 3ARQA 4ZENA 1BGAA 3B9EA 2ZX6A 1XC6A 1AQHA 2AAAA 1UR2A 3F5JA 5DF0A 1UH2A 1GHRA 1V02A 1WZKA 2QMJA 3WBAA 1TCMA 4OJYA 1KCKA 3WUGA 4ACZB 4FF5A 1BYBA 3DYPA 2CHNA 3D4YA 3PZGA 2WKLA 1WZMA 1US3A 2G3MA 1JNEA 4U33A 4H8VA 1TMQA 2B31A 5E6YA 1CGYA 1W2VA 1RPKA 3WD1A 1HP5A 1VFOA 1Q4NX 3WD0A 3ZIZA 3UERA 3GXDA 4UQAA 1UD8A 4IUGA 2YL8A 1ODUA 1FP8A 4NZFA 4FNPA 3K4DA 1J10A 3BCDA 1MQPA 3KL0A 1OGSA 2WW5A 3GXTA 2XWDA 1JG9A 4LYPA 4UFLA 2BHZA 3VD5A 2EACA 5CLWA 4AWEA 5E70A 1J0YA 4CU7A 2YOCA 1KWKA 2WB5A 1JNDA 4XZWA 4WSKA 4ZXLA 5A3HA 2RGMA 4OBSA 1KWGA 4DWSD 2ZE0A 3UG5A 1V08A 3A4AA 5I79A 1GQKA 1GOOA 4CD7A 4A3YA 3MS8A 2XYLA 2WHJA 4IPNB 2PC8A 4GI9A 1R46A 1E0XA 1H2JA 1QI2A 3ARUA 4Z2KA 3TTYA 4HU8A 4HA4A 1LL7A 1B1YA 2IUZA 4Q22A 4UFMA 5I6SA 4P8XA 4PUDA 2BVDA 2E9MA 4JKMA 1IT0A 1PS3A 4OOUA 2VT0A 1XYFA 2VVSA 3QOMA 3APGA 4PMNA 1G9HA 2F1BA 2D23A 4GO9A 3CZJA 2C0HA 1P6WA 3BVXA 4LX4A 4BZYA 4CD8A 2A3CA 3W37A 3A4XA 3VILA 2E8ZA 1AQ0A 3AHTA 1DWIM 3SCNA 2YJQA 3ALFA 2X8RA 4CCDA 5HOSA 3MUY1 4ML4A 3POCA 3PTMA 1XYZA 3N18A 5HXMA 1WB0A 2F18A 4FLOA 2CNCA 1KBBA 3PZVA 3ARSA 2GK1A 5CPQA 3RM8A 5DEZA 1G0CA 4NXKA 1OD8A 2GDVA 3D4ZA 3WQWA 3VDCA 2WVVB 3O6AA 3SCWA 1LF1A 2DT1A 4IPLA 2W5FA 5M5DA 4WK9A 3CPUA 3MI6A 1RD6A 4GKLA 5GNZA 1QW8A 4FNQA 3SCOA 1NH6A 3AYSA 1QVBA 2G3IA 3AZRA 2VCCA 1JYXA 2E9LA 3RIKA 3B9DA 4BQ5A 1UH3A 5A95A 1A3HA 1HL9A 2EJ1A 2W92A 4FLRA 3W24A 3RCNA 2WK2A 4BQ2A 3FAWA 2OSYA 1E1FA 4NRRA 4UQBA 2XN0A 2PWDA 4QDMA 3KL3A 4EANA 5A6SA 1H0IA 2IXUA 1TQUA 4UZSA 1BAGA 1CNVA 4HOXA 2PWGA 4C7DA 1E0WA 1B3VA 3WDHA 4H8UA 3ARRA 1OBAA 1UR1A 1UH4A 3WUEA 3L4ZA 3RDKA 2Y5EA 4U31A 3EJUA 4MDPA 4KGLA 1B3XA 1NQ6A 2W63A 2J78A 4HU0A 3S6TA 2GVYA 4WKHA 4DUXA 5EFDA 3PBGA 4DO4A 3BAKA 4WKFA 1HX0A 3MUZ1 4UFJA 1ISZA 3JUGA 3BUQA 1W32A 4MJ4A 4A4AA 3WQ8A 4Z2HA 2WVVA 3B9AA 1PX3A 4B3LA 1KGUA 3RILA 1Q6DA 1PIGA 1SFSA 1NP0A 2V3EA 2HVMA 1JAKA 3ZSSA 1ISWA 3A21A 2ZX9A 2X05A 4L4OA 1PZ3A 1CEOA 3DX0A 1H1NA 5E0CA 1E6XM 1E0VA 4QAWA 2W66A 4ATWA 1O6IA 1UASA 1WCGA 1V6WA 4D6FA 1DHKA 4HA3A 3AICA 5A94A 3OLEA 1UD5A 4GI8A 4H8HA 3UEQA 2CCRA 1VJSA 1R75A 2GJRA 2VQTA 3LRKA 1X1NA 2WWDA 1H09A 3RM9A 2VNCA 2MANA 3AIEA 2JF6A 3SCVA 1JFHA 1NWTA 3WUFA 2F1AA 1BPLB 4ZFMA 4MDOA 1HXJA 2WSKA 2GDUA 2YFNA 1ZL1A 2OYMA 2WHKA 4MB5A 2D73A 2WMIA 4PMDA 2E9BA 3CZLA 2F7RA 5CPTA 5LYRA 3ZMRA 4AD3A 1B9ZA 5CPSA 3EMCA 3VX0A 2J7DA 4P7LA 1CXEA 1JXKA 2RGLA 2VX5A 1GZJA 3N13A 3RO8A 1HTYA 2XIBA 3LPGA 1LG1A 5I24A 1XV8A 3BH4A 1NARA 4J3XA 2HISA 2IXVA 3BC9A 3ZO9A 3AXIA 1CTNA 2WBKA 4ATDA 3SIMA 3EJRA 3TP4A 3VD9A 4OGZA 4CCEA 3WY4A 3FW6A 3CUFA 1V6YA 1KTCA 5AYBA 1V3LA 3GXPA 1FHLA 5A8PA 5JIWA 1WE5A 3GBEA 3GTNA 2VX6A 1E4NA 4NI3A 2VO5A 3HG3A 1KR0A 5JBEA 2VRQA 4PSRA 1MWOA 1ISVA 3G6LA 4XUYA 2DH2A 3DX4A 1DP0A 5E9AA 5CQ1A 5M03A 1UKQA 3BMWA 3QGVA 4L4PA 4TX6A 3EJPA 3OZPA 3ZT7A 3VSUA 3CUHA 2W67A 2VZVA 5ECUA 1K9FA 3VX1A 2ZUWA 3CMGA 3B8SA 3AI0A 3CHEA 5D9NA 4U2YA 3FHQA 2X1IA 4HZ8A 2D0FA 1TQVA 1JIBA 2ZWZA 4AZIA 1UWUA 2ZUMA 3WH8A 2DSKA 5JUVA 2CKRA 1IZKA 1PAMA 2OW7A 3VM7A 3S5YA 1JZ6A 4P8WA 3K1DA 3OLDA 3BUIA 2BV9A 5CG0A 2YA0A 1D7FA 4OZOA 1SMDA 3THCA 2WAGA 3W6MA 4UQDA 1PJ9A 2OSXA 4GINA 3SUTA 1UZ1A 4TUFA 5IHSA 4JFVA 3WFLA 4HMCA 4CN1A 3F5KA 3EDEA 3SCPA 1M01A 3WNPA 1EQPA 1OCQA 5A6BA 4CD6A 1WO2A 2VR5A 1R7AA 4Q7NA 3RPMA 4W7UA 1R34A 4HZ7A 1Q6GA 3WNNA 5C71A 1MW1A 4NXSA 3D51A 1CLVA 3AS2A 4AZCB 2J7HA 4B3KA 2ZUSA 1NWSA 1WKYA 1XSIA 4CN4A 2EPLX 2VI0A 3MMUA 6TAAA 5KZ6A 3DECA 3A22A 1E4MM 2WLZA 1EH9A 2WMHA 3CUGA 3ZR6A 1UWSA 1UOKA 3ARXA 3WDRA 2CBUA 5IFTA 4F8XA 1EGZA 4KWUA 4HTYA 5D9OA 1QPKA 1CENA 1V3MA 2YA2A 3LRMA 4F9DA 1CGTA 2UY3A 1FA2A 3AZSA 2VTFA 1FHDA 3WNMA 4AZ5A 5A8QA 2WZHA 4AXNA 4AMXA 4D6GA 3WF2A 1XCWA 2YBUA 1CBGA 3AYRA 3GH7A 5I77A 4JHOA 1UKPA 2BNJA 3AMGA 4LQ1A 5HPCA 1WZAA 3PZIA 1U33A 5EBAA 1GW1A 1ZU8A 5DT7A 2CEQA 3VGEA 4F79A 2GFTA 4J3TA 4F66A 1G01A 4MNMA 2OW6A 3A5VA 1VFMA 2BVTA 5A8MA 4ACZA 3VD4A 3L4VA 4WF7A 4H7VA 3NCOA 5A1AA 1V6UA 4XZBA 4UQ9A 2YBTA 3AXHA 8A3HA 2CIPA 1B2YA 3VGHA 1W9DM 4U5KA 5A8OA 4CCCA 1V0NA 4CU8A 2FGZA 1B30A 1OINA 1MW3A 3AIVA 1R8LA 3UCQA
chains in the Genus database with same CATH superfamily
1UWGL 4NQCB 1W72A 4IU3A 1CFQA 3K13A 3PNZA 4OQTH 3ARGB 4CDHA 3TYBA 2EE0A 4ZX5A 5AOKA 1PKNA 3NAAH 1BEYL 3IE9A 3B06A 3KYKL 1MNUH 4PCPA 3HC3L 3KNBA 4RPQA 1I1YA 2E5CA 4DXXA 1XIWC 4AITA 1WBZA 1KCLA 2DKSA 1F90L 4KI1A 1GCFA 1LMKA 3FVDA 5DQJA 3GDRA 2N0MA 5TFSL 2H0EA 2XHNA 4RWYL 3GLCA 3EDJA 1KFWA 4KZ0A 4F5CA 2GSJA 4IMLA 2JNZA 3QCUL 4ADSA 3ZKXB 2Q8AL 4UT6A 2X2IA 4QRRE 5EMMA 2E7DA 3W7QA 4NPJA 3WXWH 1YC7A 1UOVA 5FO9A 5C0EA 4P23D 6REQB 3FLUA 2AEOA 2E56A 1N55A 2IBGA 3MBEA 5EPMA 3TA6A 1S1PA 1ASOA 1PXGA 2UUDH 3UAJC 1ZBVA 2X0YA 1XH1A 1ITCA 2AQQA 1A4BA 1N82A 1R3QA 5M17A 3VTRA 1Q9KB 4LCWD 4XNZB 3MQTA 3W22A 2OMZA 1GZHA 4X6DE 5DJDB 4JG9A 1J6PA 1D3GA 4L29B 1JFQH 2C79A 2YDRA 4ZOBA 4OQ1A 2BNQB 4OLVL 1T5XB 5DURD 3UXDA 3N9GH 4MMYB 3Q45A 4GBXC 3ESNA 4TU1A 1AG1O 3KBSA 3CSYA 1AOHA 3U9PL 3PE9A 1XF5B 2ZKXA 3MHZA 1TJ0A 1G7MA 1MCQA 4N1HB 3NESA 5HHOE 1V7MH 2WBWB 4XNXL 5DJAA 4UNTA 2WJZA 1QSFA 5CCGE 2O72A 3LV6A 3E5PA 4QAIA 4M9OA 1YYLH 5LA1A 2Y8UA 3RKPA 1I45A 1RHHB 4F58H 1KQZA 3R43A 3C56A 2W9EH 3IGXA 1P7QD 1EUUA 1JZ5A 5JA9A 5EBUA 2EPOA 3ATAA 5DD0H 4DKFH 2PTWA 4JFEA 1HJVA 4LUJA 2EIJB 2OSLB 3QIBC 4CVWA 4U3HA 2OMYA 1HN1A 1S7QB 4K5LA 2ZCHH 1AZ1A 4MA8L 3VNYA 3G8EA 4XD5A 1UZ8A 4G8EB 1CLOL 5T5FA 2ALWA 2DTSA 3S35H 3UACA 4AH2A 2VEIA 1CIUA 5DCBA 3EJTA 4Q8QA 5E09A 3UF9A 3WG6A 3LQLA 1HZHH 1KCVL 5IQLA 1SEBB 4NAMA 5JIKA 3GBLA 5CSBA 4J3OC 5DD5H 3MODH 2OJPA 1BQCA 4X22A 4PY7B 3SGUA 5EUKB 3LKRB 4YE4H 4F2MB 1U92A 4AMWA 2ZC8A 4MJMA 4GIOA 2XTJB 5B1JA 3RKDD 3S8WA 1J01A 2WN2A 1O5QA 1S5NA 3WLRA 1BJ8A 3EG9A 2RD0A 1MCRA 4TULH 3G5XB 3TTSA 3VIKA 1YUKB 1T03H 1OD7A 4MCYA 4CVUA 2P3ZA 2R1KA 4HVBA 2DMCA 1F6PA 3ANUA 1OTUC 2E7BA 4KMLB 4QSHA 2EQDA 3VXOA 4NQSB 4RXFA 3VOJA 4HLZG 3P81A 5DMKA 4ZO6A 1E5YA 1JK9A 3L95B 1K9TA 1J1XH 1SYTA 3N42F 4XIMA 4ZMAT 3BYYA 1HFUA 1QBLH 1Y6MR 4Y5VA 3FSZA 1IEWA 1A9VA 4ZMOA 2YD7A 3MZ2A 1G9EA 5DS2A 4IOFD 1YYCA 4GAYA 1H8LA 4LNRA 1XF2A 4GMSH 1YLBB 3W82A 1EBAA 1TQBC 3BJSA 2E4FA 4XBEH 1Y6NR 5EG6C 3OAZH 3P6LA 2G9HB 3UJ2A 1BQHG 3W72A 3MNZB 1F86A 1SJXA 2W61A 1MIMH 4UCFA 3UZEC 1AIFB 3P0YL 4NILA 2WKGA 3C0LA 1AANA 2FZDA 1IGTA 1E5JA 1IILE 4M6VA 3L7EA 5PCYA 5HHXL 3MV9D 4Y90A 2DQHL 1OHZA 2VXVL 3WSQL 4UBPC 2X30A 2J72A 2E3ZA 5LN4A 2PWEA 3D09A 5FAGA 2EKSA 3O2WH 5CSYA 4XGZA 3TW9A 2B59A 5FF2A 3IIPA 3QOKA 1N0LB 1JUFA 2H8PB 1SOXA 5CGTA 4YHKL 5E6ID 1WA2X 1DO5A 3PP7A 3QDHA 1WEJL 4TUOB 4GSQA 4Q97A 1OAQH 1DN0A 5GGUA 4Z18A 3SDAC 3SIKA 3KPMB 4WFGD 4RSVA 3PPEA 4XNUH 1WOAA 2ZXBA 3MCNA 4HA1A 1TE1A 5SWUA 1JDCA 4UYPA 4Z7UF 4OKVA 3KLDA 1A5KC 4AQEB 2W65A 4P5RA 2NY3D 2FJHA 3PWNB 4OCRH 4F7EB 1QHOA 4LCWA 2FZ8A 1RA5A 4OZHB 1I82A 1N26A 4BIKA 3ZMEA 1PZUB 2J7BA 1K70A 2G30A 2HT3D 3D12B 4CADB 3U36B 3TOYA 4ZDHA 4BH8B 5ABFA 4H2CA 4PJEF 1ID5I 1BP3B 4O1AA 1FLRL 4AEEA 3MUGB 1F07A 2GSMB 1MCHA 2YAEA 1DBBL 4JHAL 4LEEA 2D2JA 1E6JL 2Y8VA 1OYBA 5KSAB 2P7TA 4UNLA 4AI7A 2F7IA 3CNYA 3VZXA 4C4UA 2BSRA 2D7QA 3CLFL 3MRQB 4WI2A 2J7EA 5T1JA 5I6XC 2CXKA 5CWSA 4LIQH 4N22A 1ADOA 1J5TA 4UT9A 1UTDA 3IDGA 1KJ2A 4O02A 2FSDA 4HCRL 2DMBA 5T1LB 2JJVA 5I1GH 4XP1H 5EOCJ 3UYPA 5EFIA 1XLDA 3V6FB 5IMMB 1ETA1 1FNEA 1CICA 1EFXB 2VUKA 3DXAA 3GHSA 5CC3A 4PTVA 3PAVA 1A8JH 1T04B 3ZTNH 1TMLA 3BPWA 5HGGS 4L0ZA 4YN3A 1BFVH 3QNYA 5FKAB 2X4PA 5DCCA 2CHWA 2VCAA 3SKNB 1CF1A 4XCNB 4ZNEE 1A2YB 2N0KA 1U6AL 2VEFA 3B05A 3ZJ6A 4LRNH 1K6AA 3WFEH 4HHWA 2WC4A 3QQ3B 4MX7A 4M43L 2PCFB 3IU4L 1BZ7B 1MJ7L 3K8LA 3V95A 4GFXA 4LRSA 4UV4L 4N4QA 3WJXA 2VISA 8FABA 1M41A 1OHQA 4KAQH 4KO7A 3CYVA 5I6PA 2WLJA 2E25A 3DFSA 2WCGA 4HIQA 2BVPA 5M95B 1OABA 4JRYB 1MPAH 3TA3B 1GIGL 4G6FB 3CN0A 4LCCC 3R7RA 4GD0A 3K3QA 1O0VA 3SRHA 1RIHH 1DLFH 1RZ7L 4C56A 3OB8A 4ZUSB 2J6VA 2OKMA 1PPIA 1UWEL 3ABKB 4XMPL 1T4KA 2BLFA 4KPHL 5EN2A 4LEOB 3CB3A 1FVCA 4YDIH 2L4OA 5CZVH 3UC2A 3JW7A 1XX9C 2IWEA 3GI8H 4FEMA 4JRLA 4DPBX 1XLEA 2VC5A 4L9LA 2HWZH 3AACA 4JPQA 3P9LB 4K73A 4Y88A 3EBVA 3LS5H 4FFVC 2GJ6B 3KWXA 4PJAA 2EPNA 4PUEA 1TWWA 2V8LA 3HS0C 1AW1A 2AKZA 1DIOA 1KY6A 3SCMA 2H2SD 4MVAA 4XPBL 2ZZ6A 3U46A 5A40E 3G5VA 4RFNC 4N2MA 5ITFA 2R1WA 5KG9B 4HC1L 1ADQL 4UC5A 2A85A 5K9XA 3VRLE 4JTSA 4N8VA 1W15A 2FB4L 3NG3A 1LOLA 4X6EB 3P11H 2HRWA 4DNMA 5CZSA 1SBBA 4QE5A 1VFBB 1XVSA 4BK4A 3WIHA 3WLTA 2CDEB 2QT3A 3HA0A 2GUUA 2CLMA 1SY6H 2YPIA 1ZB5A 2AJYL 4EAMA 5AWNL 1GYAA 3T8QA 1S78C 3MJ9H 2J7FA 3EYOA 3FUHA 4OQVA 1LORA 4K8RH 4XVJH 1JERA 3MLZL 3S34L 5DFTA 5JW4M 1KXHA 4OIAA 4BZ1L 3LG3A 5E9NA 5EEYA 4AV0A 2FHBA 1NGYB 2WM0A 3GNOA 3W9ZA 4M3JA 4A3HA 1G67A 1X5FA 3EO9H 4N2HA 4R97C 1DVSA 3A47A 1FGVH 3HNSL 4HXAL 3WDJA 4GQ9L 4NJIA 3IDMB 4X6BA 4FFZH 4MA8H 3HI1A 3EUDA 1BQHB 1VYSX 4KMQA 4MAUL 5DEGA 1IM9A 2NLYA 3K72A 2V3GA 4EZLA 2ZRUA 3BVVA 3ZDYB 3APYA 3FDKA 4U6XB 2YXOA 3HQNA 4HHPA 1F00I 5FX3A 4Y89A 1PG7L 1WKFA 1ERNA 2NYKA 4LT7A 3C2SA 3FU7A 3PF2A 4RMVA 2I26N 4B41A 1J6OA 1NSJA 3C6LA 1AE6H 1HJQA 1EXUA 2UWEB 1E4JA 1NCCL 1NCHA 1LRTA 4OV4A 1JCJA 2R69H 1ZRQA 4DNHA 1ICQA 2KZKA 4H83A 4RZ4A 1TPB1 1OSEA 3OKMA 5F7AA 3HB3D 1LJYA 3WKNA 3ZE2E 2NQHA 3K6IA 4K94C 3VMNA 2OELA 3B9OA 4NRSA 2J56A 1EBPA 2V17L 3CTLA 1EPXA 1DLHB 3UBXG 3U9UA 2OMTB 3CV2A 4GVIA 3QHOA 1U21A 1S3RA 3J27A 4YSDA 3N42B 2HZHA 5C92A 4IM8A 1S3TC 4LOFA 2JMRA 2FNBA 2OG9A 1LBFA 1A14L 1CS6A 1C91A 4AZ6A 1KKRA 1FUYA 3UJSA 3WLHA 1PLGH 1EXPA 5C6MA 4HKJA 4JXCA 1TZOA 3CXDH 1G0XA 5EORL 5DJ8A 2FTPA 2W62A 2G2RA 3N1AA 3N17A 1TO4A 2VDNH 5D1ZD 4S39A 4FI7A 4XN5A 1N5YH 3HE7C 4D8PB 5KN5B 3W1MA 4BSWB 2VDKH 2XFXB 5J8OA 4DJEA 2LHAA 4KKAD 1QR1B 2GQ9A 5GNYA 4OR1A 1QNRA 5HYEA 4XP9L 3FN3A 3K1KC 4C59B 4Z7QF 4W8BA 4BFGA 4ZQPA 3GFUA 2P5WA 4HCLA 2OL3H 4G3YH 4R34A 5AVSB 4MMZA 3E1F1 3B34A 4Z0SA 5GJTH 3B6SB 3QRGL 3VFSB 1TWSA 2Y7NA 1ZWIA 1EEYB 3H21A 4BGLA 3V0WL 2J74A 3G5EA 5RUBA 5HULA 3DARA 2EXOA 1QBAA 2NY5H 3VXGA 3NIFE 3T3ME 1KCSH 2E68A 4R4ND 3CQIA 2DQJL 3TA3D 4X5QA 4AUJA 4V1XA 1IBZA 4BQ3A 4X61A 3QSKB 4K2UL 4QHPA 5HVWA 1KCRH 2C15A 1V8EA 5DQ9A 4EACA 1WAEA 2WW8A 4KDVA 5HSFA 3MRMA 5E99H 2CR6A 2HSIA 4TNFA 2ATAA 1HSAA 3LV3B 3NZ8A 4LL9A 3BXWA 1E7VA 4UB9A 5I76B 3W7IA 2NNAA 4H0LC 3EYPA 2B4CL 3TONA 1TQTA 1FH7A 4HUWA 4NBYB 1G7UA 2QCMA 1K8CA 1TX0A 4LBSA 4UTWA 3C6CA 1MXDA 1XLHA 3B8DA 4QLLA 5K1VA 5I2UA 4GXPA 4X7TB 2K78A 1GUVA 5HHOB 1ET8A 2YWYA 2DPKA 4CJ1A 1NC2D 1PZBA 4G8FA 2BWDA 4P9HC 3W01A 4F1SA 4UTKA 5FLVA 1JI1A 3WFZA 4BY3A 2A1WH 3EX4A 2R51A 4ZPTA 1O7SA 4Z8FH 2R8SL 5HYJD 2X1XR 4X8XA 5I0WA 5MP6L 4XP1L 2H32A 3A6CH 4J4PD 1ZSHA 4A7QA 1R47A 4Q33A 1VPXA 1ZLWH 3NSDA 1Z9LA 4U1NB 3W53A 4Q7BA 5TAOA 5EU5B 2OO6A 5KZCD 4I90A 3ES8A 3WBWA 1ZLWK 1GY2A 2GSGA 2VE6A 3PJSB 1D8WA 1JCMP 1OF6A 4HN8A 3BP4A 1EFQA 1S7XB 3HMWH 1DCLA 4YFEA 3FTZA 5TF1L 5K9OA 1AH4A 4LSUL 5DEJA 3K2KA 4JLRB 5ABAA 2QSCH 3ERPA 4HGXA 3ETBF 3OF6A 4OZFH 4JN7A 4KH2A 5IDIA 3ZLHA 3WBXA 2ZRXA 4AYMC 2NV9A 2DQWA 3UH8A 3CHDA 5C07A 3A5FA 4PJCA 3VC6A 2UUDK 3PWVA 3FTXA 1JCXA 3QW3A 3O6FC 3F7LA 4MA3A 2CO7A 4UR8A 1IC5H 4PLKD 2HLAB 5DMIL 4O13A 3FF8A 4GQPH 4QP0A 4W84A 2PR4H 2VM9A 3TFBA 5IOBA 1WUNT 5FSEC 1YQ2A 4PP1C 3RL1B 4JQIA 2A6DB 4FHBD 4J2PA 2EYRB 4S0HA 4M8QA 3H6AA 2PPCA 5DTFA 1E4XI 3S3DB 2OEJA 5G4NA 2QDEA 4NNYA 4UTAH 5I0VA 1QACA 1GK8A 1ONEA 2GVEA 4IIQC 1NFAA 4KCVA 4AZCA 4PUBH 4CBPA 4D9LL 1AXSA 1RULH 3TAKA 5DANA 3DO7A 3B7SA 3SE3C 3HPJB 1FWBC 3P0VH 3CFNA 4YHNB 2ESVA 5GS0D 1ISXA 2DZUA 3AIBA 5B80A 4TSCH 3ZDZB 2D3NA 4REQA 2IPUK 1H1YA 4J2QA 1MG3C 3LS5L 4HWUA 3UBHA 5G4MA 1J5HA 2DV6A 3D9AL 1B31A 4ZFGH 4EJ1C 2WNWA 3RMJA 5IMOA 2G0WA 4Y5VC 5IJBC 1HO4A 4Q4QA 5AVQB 4H1LB 1QCWA 7ENLA 4QRNA 1GGCH 4O53A 3VE9A 3QTPA 3TC3A 4AVNA 3VD3A 4Y9AA 1OK0A 3WUWA 4EI6B 1BKSA 3TVMD 1U42A 2GGHA 1S9YA 1BX2B 3AROA 1Q1PA 1J9QA 3FKUS 5H8DA 4Z77B 7TAAA 5IFHL 4A8LA 1YJDH 1OX4B 4WUUB 3KNBB 2EDKA 3HPZA 4HIEA 2NQLA 3PSWA 1IC4H 3JWDC 5CEXA 1SZGA 2K6YA 3RPBA 4Y9CA 2VEMA 4XZMX 2WQSA 3BQUA 4ZXBD 3KX6A 1VJZA 3GRBA 3U1SH 3M5XA 3X12B 3EKGA 3BZDA 3W71A 3FYOA 1CTOA 3EH5B 3IJYA 4YHZH 4BZ2H 2EF9A 3AQZA 2N1KA 3VXNA 1POJA 4DJEC 3K6NA 3ILQD 5EF0A 3VOCA 2AFNA 5DHEA 3DGGA 1K5NA 1FPTL 2WKJA 4V28A 1ILUA 1KGIA 2P24A 1BXNA 2IAMB 1TPXC 4H8QA 5FXCH 3TZVB 2OB3A 2E86A 1T0NB 1ZT1B 2XZAL 4PWKA 4B5UA 1MJUH 1VIWA 1X5KA 3CLWA 2C4XA 4J6RL 1HK6A 1G4MA 3V0GA 2PD9A 2NY3C 4XHJC 1RSFA 4I48B 4DUVA 3P8IA 3I4EA 3D48R 3WIIH 3DFPA 3IMWA 1I1AC 2AQSA 3WH6A 3TNOA 2J4GA 1UB5A 1DYZA 1MLCB 2X7LA 2SEBB 1QX1A 1THFD 2PYEE 1VAHA 2FEEL 3QUYB 4ENZA 3RX8A 1M03A 4QTHB 4X98A 1T7WA 3PP4L 1ZCOA 2PETA 3CFEA 3I9AA 3KL5A 1E9LA 4JY4B 3L1GA 3LK6A 5FJOA 4Z3FA 2PNDA 2V2WA 1GVRA 3CMJA 3MBXL 2QCCA 3BW4A 3HCVA 5B7FA 1ZK5A 4C90A 1WSST 5HR6A 4Y19D 2IQDA 3O3AA 1YNLL 3G1DA 1SW0A 2OT0A 3VGGA 1QASA 1ZLVH 3N4EA 4QX4A 3KHOA 5IQ7H 3L6FB 1YEKL 3WMBA 4BEUA 4E38A 1V5JA 4B0MM 4BGDA 4O15A 2H47C 3F05A 4BQ8A 4WK2B 2GK0A 3H24A 4XKYA 3CK5A 2Z24A 3WLIA 4BA0A 1PLCA 1W8EA 2Y24A 2YEVB 4G6JL 4K7PH 4M8UA 4J5VA 1UP3A 5GS1B 3R8RA 3QZOA 3LEYL 1UXWA 4JZJC 4N5UA 2UZYB 1BYAA 2BG5A 1YPZF 4PY7A 2O92A 1SHMA 2CZFA 2VCOA 1F4WL 5A7BA 1ZAIA 4UQCA 3O4LE 1YNPA 5JH2A 1JWUA 1IL1B 3VFLA 4PG9B 1JZ2A 4XTIA 1N64H 5J6HA 2JQMA 1KA9F 3UG4A 5I1LB 4DPCX 2J88L 3QZNA 4IICA 2Z6IA 3MLPA 2YYTA 1N9PA 2IANA 4KKLD 4KKNA 4TSAL 3H42H 3WY2A 4UT9L 5JR1L 4HNCA 4C7FA 4ACTA 1TJMA 2X1OA 3D85D 4P46A 1SJEB 1FUNA 5I1HL 1X8CA 5GJTL 1QPQA 4K8RD 3RBGA 3LB6D 4HALA 1UBSA 2Z7ZA 1GGOA 1PQZA 5LIKX 4H4NA 5A8NA 1QRNA 9RUBA 1K4GA 3KWVA 2VLMD 5DEFA 3UQNA 2ZC1A 1C08A 5AN7A 3SY1A 1QBBA 3IFPA 5J13C 2AAMA 1WK0A 1AACA 5J5RA 4P48A 2VRAA 2NTSP 2XG5B 3ZE1B 2CLIA 1A80A 5ADOL 2HRLA 3AJXA 1OGBA 3GJFB 1FH5H 1SXBA 5SX4H 1BF6A 1TA3A 5A2JH 5JNYB 5DRZA 1C29A 1VC4A 1AGEA 4WFHD 1BXCA 5C0JA 1ZAHA 1KBGL 1S5WA 4DBSA 3PJXA 2GQHA 2XYBA 4Q4EA 4Z7OE 2CCWA 1VZHA 5MHSD 1NQKA 1T7YA 3P5ZA 2JI1A 1ZLUK 4I7UA 4Z7VE 5ETUB 3DENA 3BW2A 4IUOA 4ONGL 4TL4A 4DP7X 5E2TH 1CDCA 3EDFA 2ZXQA 1ECYA 2XFGB 2JFCA 3E7JA 3LQZA 1W3JA 1F7BA 1E65A 3FTSA 1DN0B 4Y2OB 5GGUB 3GDLA 4F80A 3ANVA 1FZOB 2HCZX 2CM6A 4EUPA 1CXHA 3GSUB 1RV6X 4LIQE 4GUOA 3MCLH 1ORQA 3TASA 1O5KA 2G3JA 4HPOL 1DE4A 1Q63A 3OKKA 1M7IB 2VDMH 3CZNA 4O0ZA 4RDWA 3V7AE 4MJ6A 1ES0A 4RGOL 1NPUA 2Q8BH 1GZPA 5IJKC 4FXKC 2W91A 4FJZA 4R5TA 4YL4A 3EOOA 3CDZB 3TN3A 4B15A 4JO3L 4W9DC 1GVYA 3EOUA 3INPA 2JWYA 2Z31D 1EBGA 1T41A 2P8PB 4GO6B 3MUGA 3EYVA 1RK7A 1MDAA 4KRNA 4MDRA 4NHCL 2OVLA 4HPNA 1Q9OB 1DSYA 4UTUA 2EILB 5C0ND 3VM5A 1U8LA 2AJZB 2CLRA 2VN6A 2VR4A 2Y1AA 3CJJA 3GXIA 1JVOA 4WHYG 5C0RH 5A6KA 5CZKA 5FHAH 3X3GH 2CJTA 4Z5RB 4UNIA 3LA4A 2BSRB 1ICTA 4HF5L 5HGBB 2LU4A 3M1BA 1F4XH 1U2HA 3V7MA 3STPA 4A8NA 1PCKA 5AYYA 4BI7A 3M17A 4OV5B 3RZCD 5JBFA 1CTMA 5HYFA 1HHIA 2P8BA 4NAEA 1JF1A 2VJXA 1MSPA 5I1IH 4V27A 3VE0A 4LDOB 3QG6B 3V0SA 3FH7A 2E7FA 1P43A 1CICB 1O60A 2NUYA 2G41A 1KFAL 2PDMA 1PEWA 1GJWA 2CGRH 4JFHE 4OT7A 4F92B 4IFKB 3KM8A 1XAUA 2L7UA 5DYFA 3MUIA 4GHRA 1RFDL 1W0WA 3NYDA 4GAJH 4QY8A 2FKPA 3DURA 3V4PA 4MHHI 1CR9L 2XN9E 5E94B 1K4DA 3I6LE 2YDSA 1KN4L 8RUCA 5LB1A 4O02H 2XSAA 3L7FA 5CPLA 1PBYA 5SWSD 3R1GL 1YLVA 1Q94A 4HS3B 1KG0B 3VXSB 3KCOA 1BF5A 3NQ2A 4PJHF 4XX1G 5DJ0B 1YMME 4JIRA 4BI6A 4D9RD 3PB0A 3V4UH 1S2EA 1O7DC 3KGRA 4OQTA 5K59F 3W38A 1A47A 1JE6A 3CVHB 5D2LE 5GRWA 3OJ2C 4QG8A 3VIMA 1XJBA 2I9UA 3QEHB 2J1KA 4Z7UA 5EDSA 4TIMA 3STEA 1M3IA 3B5TA 1ZENA 1FCQA 1OAXL 1UHVA 3NL2A 1MQKH 1T83C 2QVTA 4E2BA 3C5XA 5HHVL 3CHQA 4BH7B 2BMBA 1FYTE 2AAVA 3OG6B 4TLUA 4BI5A 2BINA 5ABEA 1KYOK 1PMYA 1FVPA 4KKAC 3RZCA 5F7YC 1BFOA 2JCWA 3L3OA 4XN7A 1C5CH 2QDDA 3BURA 5DFVC 4WI0B 2OZ4H 4XTRD 4A2EA 3K6DA 1MCPL 3S37H 4AIXA 1RA0A 2DORA 1RZJH 2QCLA 4HT1L 3CQ0A 3CV6A 4X4KA 5D7LA 5B3JF 1W1VA 3PCYA 1U3HD 2KH2B 2HWGA 3RAOA 3T2OA 3JVAA 1LUCB 4XP4H 3T65B 3B8WA 4WW2C 4DELA 5KVGL 3FX4A 3W23A 1YY8B 2QPFA 2MMXA 2VITA 3L5WA 4J3OD 4G11A 5HI3C 1IWPA 2JEQA 3KOXA 3T55A 1FFNA 1EAJA 5DJ2B 3N0AA 2TSAA 4JDBA 3K8MA 3R18A 2ATMA 4JFQB 5D33A 1V79A 3BRFA 2JQAA 2YUXA 3CSYB 3WHE0 4DK5A 3M8OL 2P80D 5CC7A 2GWNA 1FNGB 3BI9X 4KX7A 5DMJB 2OMAA 5C8JB 4D6HA 1SMAA 2B8OT 1I8UA 3ZY7A 1A7QL 3HC0A 2IIJA 4UT7H 1W2PA 5AKTA 1XQKA 4L37B 4TTGA 1BVOA 4GRSA 1R5IB 4AD0A 3IS0X 1PJWA 2GAZB 2GTQA 3WO4B 3FTGB 1PUDA 1YPXA 2DQMA 1RHFA 4KROD 4N24A 4R7DA 4V11A 2BGSA 4NM4H 3FY1A 4JFEB 2QEJA 1XT5A 3EYSL 2GLKA 2Z00A 1QLRB 2QTVA 2NY6C 1OAZL 3MU7A 5JXAH 4NO0D 1QNPA 4HPJA 5FL0A 1K4CB 1FWJC 1P7QB 1D7CA 3F64A 1L0YA 3RVVC 4RFNB 3P77B 5J3HD 1H3PH 3DMMD 1AD9B 1I8IA 2WLLA 1OARL 2FJFB 3FT3B 3NIDB 3Q5YA 4IMKC 4M9PA 4ALAC 3OZKA 4NKMA 4RMUA 3HFMH 1NGWB 2PGEA 4JQAA 3SURA 2P76A 2R2BB 3QDJA 2ZKWA 3BH8B 4FQLH 3TT1H 3VB8A 3ULUF 5MEQB 2Z31C 1TG7A 5L4FA 2L5HA 1EQWA 3GBNH 1VKXA 3ARFA 3QRLA 4HK3J 1GQLA 3ZSTA 2HX8A 1Z41A 4AL8C 3TJHD 5IMKB 4OBRA 1OAKH 4OJFH 6TIMA 1J9RA 1NCJA 4HHAB 5HVHC 4FQPA 1CGVA 4AENA 4GZJA 1S3HA 2XTJD 4XAWH 2E9WA 5HDRA 3GLDA 3L1OH 5LN8A 2G4JA 5DXWA 4LLVB 3TC7A 3DG3A 2E9GA 1H15A 3V4VL 4CQDA 4E36A 4YIQA 1BZEA 5I8KL 5AZ0A 5JO5B 3B4UA 3HAEB 1BSIA 3SDXB 4HOWA 5BO1H 3ABXA 2VD8A 2IH3A 1T7XA 3FFCB 2JV6A 5ABTA 3MBWB 3PBMA 1QI5A 2HJLA 1AFVH 5DJ8B 1D7DA 2V2HA 4PWIA 2VQ4A 3L5JA 1T5AA 4ECLA 3NL5A 4PTWA 1EO5A 4KKBD 5KN5A 1AW2A 1G9MC 4UM9A 2EXYD 4QHUB 1KTLA 2Y6TE 4WO4C 1ZHNA 1SR0A 2FH6A 3IARA 4RXGA 3IFOA 4LTSA 1OSPL 2WYIA 3LQAL 1EJOL 3QZWB 5FF0A 2H4EA 1A4MA 2OJ1A 1FL6A 3GIZH 1NMBL 4NJ9L 3TLRA 3OQEA 3S4SG 1E43A 1FE8L 4YUEL 3T4AB 2O7QA 3ICJA 2RJHA 1N0LA 1UZ6E 3QUKB 4JFDA 3HIJA 3BRDA 4JYEA 3WK0A 2W9MA 1QEWA 3L0NA 1SJHA 3P02A 1ULVA 1IKNA 2K6WA 4XNYH 5A2FA 2I5YH 1GVOA 1KV3A 2BNRE 1VB9A 4IKJA 4LANA 3LYEA 3T6CA 1BFTA 4YMZA 1L7IH 3PGDB 1UR8A 3SCTA 1CYGA 1T1WA 3UYRL 4FQ2H 4DJFC 4WEBH 1HC1A 2REQA 2GABA 2IDCA 1BZ9B 4JO3H 5IBTH 3ZVHA 4PRNA 4ZS6D 1JCKA 1CL7L 1L4IA 2WO3B 3VFPA 4DY1A 4K3JH 3BE7A 1JD9A 5FI8A 4WEVX 3GNRA 1PX8A 2B08A 1OY0A 3WH5A 2RCSL 5CILH 4FQXB 4PMEA 2GUOA 3F2BA 1E73M 4KWSA 4PJHE 1A1MB 1D3CA 4GRLA 4M7TA 4F9JA 3SPGA 2HS8A 4CCZA 4HIIB 2HG5A 2Y5JA 3D39D 2DH3A 5KYYB 3NQ6A 4NX0A 1NMAL 3KVPA 4NM8L 2HT4C 5ANMB 3GSNA 4WU5B 3OODA 3W25A 2ZZ2A 4H8WC 1EHLH 2GHZA 4JN1L 3RWCB 5JA8B 4RDYA 3KVDD 1A9BA 3M0IA 1RVGA 4N90D 5FB8B 1RUAL 2G2NA 2GSGB 2VE6B 4LSBA 4Q8MA 3TSDA 5LNSA 3BP4B 1ZTXH 3KBEA 4N9OB 3TIDA 1SHWA 4BQCA 1WDPA 4TV3A 3HA1A 1L5GB 3ATDA 3SUVA 3TNNA 4CVXB 1YA5A 3L3HB 1ZVSA 1F58L 4EK7A 1CR9H 2WQUA 3FO2B 1X97A 3NQCA 3WK3A 1G6VK 1T03L 4C58B 1E4HA 2ZQ0A 3KTSA 1HNGA 4N6QA 3SCSA 2R2HB 2ZRYA 2A38A 3ZE0E 3OVUB 4LVFA 1RURH 1P1VA 4XZ4A 5F72S 3KE0A 4PTMA 4S2SB 3SO3B 4X8JA 3P30L 3NXFA 4B5XA 1EZ2A 4B90A 1R5VA 4PRBB 3W7OA 4XMLH 7REQA 2AJUL 2J1YA 4MZYA 3W1XA 2GC4C 1HKIA 2YMTA 4PJ5A 4IOFC 2J77A 4Y4KC 3G5XA 4XO8A 2WQDA 4E3TA 1Q9WB 1FLTX 3WMPA 3G0SA 4HWEH 2PFHA 1CFQB 4NOBA 4NYUA 3UWWA 3U2SA 2NXYC 2VXQA 1XR9B 2A0LD 2KLRA 4NP4H 4FIRA 5I07A 3KJ6L 3NQGA 3QLDA 4KEZA 3TJHC 1X9UA 3U2OA 5K2ZA 4AJWA 2C1PA 1SU5A 3D4CA 3LMJH 1AGBA 2G3NA 4BRJA 3NFPA 3RPIB 1G7QB 2ATSA 4DIAA 3DJSA 4GCXA 1OZTG 5I19H 2AJVL 3XIMA 5DMGD 1WKEA 5K9JH 1AR1D 1SW3A 2BX5A 2ICWB 4NASA 1JNHB 3FCSA 5AAWA 4MWAB 4PREA 3B0PA 3HHRB 4OM0L 1F61A 1DE5A 3C5JB 4YGVB 4DEWA 2OLDA 5IHUL 1IGCH 5JHLL 1FYTB 5GGRA 1DTNA 2DJLA 1NANH 4A35A 5D1ZI 1Q9KA 1F9CA 4N9CA 4H26A 2VABA 2G4FA 2V8ZA 4DHGA 2CAKA 1XF3A 3UAEA 2FZ3A 4OCWL 3AUOA 1M05A 3EO0A 4M1DH 5EO0B 3HLAA 1TR9A 3FSUA 3KVKA 5J8LA 4P57B 4FC3E 1OE3A 3N41F 1TQJA 2A7BA 3RPMA 3LPWA 2AEQL 3DH7A 5DJYB 5IG7B 3TU6A 5DX7A 1H6UA 4GLRH 5HJXA 1FOBA 4C1NB 4UIKL 4DGVH 4X4YA 2DM4A 3EYQD 4B9ZA 1K3IA 4NIKB 2OI9C 4LBEB 3PZMA 2Q2EB 4OZHA 2IAMA 2F6UA 1FGNL 3RYMA 3RWGA 4JUTA 2EUVA 1NDTA 2D9CA 4LIQL 4N9BA 5I75B 2CALA 1NEYA 4AH7A 3ABGA 3GIQA 2D03L 2AV7A 4PJFE 5E9DB 4JVWA 3H7BA 5LGHL 3QIWB 1C8QA 1YUHB 3QIUB 1ZTVA 2FX8H 1XTLA 1DVJA 5ID0A 2LFGA 4CQ8A 3NQMA 2E75C 5CSZA 1S7RA 2DL2A 1C5DB 1T7VA 3A67L 3U8GA 4GQRA 2VWEE 3ETTA 4U6VL 1RLDA 3ARVA 2XSKA 2FWOA 4Z95H 3LNMA 4H6EA 1FXPA 2KDYA 3OBAA 1JMXA 4RGNE 2EIMB 4TVPD 1UC5A 4GNVA 2JIWA 3DUSB 3ZR5A 3HKZA 3DJ9A 1ZT7B 4Q6IB 4RBPK 1VF5C 3WN5B 5AENA 1I60A 5CZXD 1SM9A 3O9WB 3CC1A 3TKFA 3GQFA 5IP4A 2RFGA 4AZGA 4PJ8B 3BEVB 3L0GA 2OMNA 3FYEB 3O3AB 3DTXB 5H37A 3U0TA 1OWRM 1VFTA 5KSVB 3AG1B 4KJQC 3T0XA 3PV7A 2YAFA 3VXRE 4JKWA 4JY9A 2E5BA 3NL6A 1CGSH 4Y5VB 3HN5A 3M5VA 1AZ2A 4PV1C 1I3RA 4OFDA 1F6AA 4LL1A 1TVPA 5D7JD 4LESA 4AWJC 3SYOA 2QSVA 1QO3A 2W60A 4CUCA 4U1IB 4FP8H 4BE6A 4F3FB 5A2KH 4OSUL 1T99A 4TVCA 1LD9A 3IJEA 2YCJA 4HZMA 2JIXD 1V93A 3RGHA 4QAMB 5I1LA 1NL0H 1QG3A 3I9GL 4Z17A 1EJOH 1MAJA 4L4VB 3N11A 1QSEB 4HX1B 4P06A 4ECNA 1QFOA 4QO1B 3RVTD 5C1MB 1A5LC 4NQXB 1SYSA 3UA3A 3FJLA 4PB9H 3T0TA 5ABGA 1X6NA 5F88B 5LHEA 4NKIL 2Y1YA 4R90H 3CZEA 2HBVA 3TE9A 1G7PB 5IWLA 3RX3A 3NZGA 3S1UA 2HMID 1A5MC 1FHNA 4AQ8A 2P8MB 4JVPA 5H94B 2ZWYA 3DRQA 3SZ6A 1CXKA 3QC5X 4F9PA 2Y36H 2HKAA 4JCWA 1G9MH 1TX2A 4GPNA 1QKZH 3CFQA 3ZRCC 1GOQA 5IJVB 1ZPTA 4DK3A 5AD0B 3MBEB 2X10A 5EPMB 1LP9F 1V7NL 2J8GA 5KSUB 2OZNA 3U2IA 4CNPA 5JLZB 3UCDA 3UJRA 3SB0A 4W5UA 1L9PA 5I3IA 4YLQT 4W93A 2QJHA 3BVDB 1QFWL 5AOZA 2PP7A 2ADGB 4XX1E 3REVB 4Y5XB 5EC2A 3ILDA 2BS9A 4EF8A 2D7TH 4AB4A 1D9KA 1JRHL 3GHBL 3BFQG 4P2QE 4WNSA 2P7TB 4WZ9A 5KVMC 2WXFA 4FNLL 2PBGA 1QK2A 3S3GA 1AR1B 4DJFA 1NBZB 3TGXA 1VD6A 2K45A 2FHFA 4M82A 5C0BA 5HHOD 4R53A 5DC9B 1XFBA 5IQNA 2VURA 3AG2B 1T1XB 3ZFHA 1CBVL 3QGAC 1IBYA 2W95A 3LZOA 3HR5B 3FZUD 2V63A 2B3IA 1FNEB 1ADQA 3MRPB 4QYOB 2XN9A 2WXMA 4UIMB 3WMSA 3DXAB 2VVNA 2MJWA 4K2SA 4PUKA 2BZ7A 5INDB 3MX0A 1CD1A 1DVYA 3GO1L 4G7RB 2Y8KA 1Q9OA 4DJED 3V5KA 1RK0B 1NCUA 3MLXL 3DOSA 3C2FA 2VXTL 3BKCH 1OALA 5T1KD 2A6JB 1UG6A 4PJCB 4N2DA 1V3KA 5TK4A 3UPRA 4G71B 3ESUF 4LGPB 1NTHA 3GHTA 4OLUL 2F54A 1I4FA 1NFDF 4NZUL 4YEEA 4QBXA 4RDQF 4UI2A 1OOAA 3UNTA 5LHFA 2MQ0A 1BD2D 4OV5A 4BSVB 3BSMA 3QORC 1D5IH 2GJZA 4M4RB 4RMQA 4XCCL 5DUBB 3VXMD 3FUKA 3ZTCC 5CKAA 3MRGB 1MEHA 4L0PB 3ZLQC 2W4XA 1LNUA 2A4CA 3OHIA 1TSIA 5FYJE 1NWUA 1QPNA 4ZQRA 4LSSH 4Q4IA 1PEZA 4G8GD 5G2WA 5B39A 4YK4B 4PMZA 4PS4L 1K72A 1KRCC 4GXUM 3HS0A 2AV1B 2DEPA 1V0MA 4M1BA 2PWFA 2FVMA 4DVBB 5BJTB 3VXRA 2UV3A 1MF2H 1B2WH 3DO7B 3RFAA 2YD5A 3FN0H 5D7IE 5FESA 3GYRA 3T1WA 1KJ3H 1Q6OA 1CXLA 5CC5A 4Z3IA 3WF3A 4G7SB 4JJ5A 3W2UA 3PBWA 1KPRA 4F20A 4JCMA 2R59A 2W9DH 1NLDH 2FQFA 2ROYA 2DPEA 3D2UD 2A3TA 1Y5XA 4ZQMA 3LH2H 2CLOA 3UWUA 4NUGL 5JW5A 2BASA 1QLFB 2N56A 3BJTA 2G9HA 4X99A 5LNRA 1EEQA 4KK5D 3EWZA 2YW3A 3MGTB 5ACMA 3ARGD 3B9KB 1BAWA 4JDEB 1OZQA 4D72A 1HL8A 2DQJH 4TOQA 4BS0A 1M4KA 1PKQE 3SKJL 5JOEA 5CSUA 5KSAC 5LDUA 4ZQTA 3GWQA 1Z3GH 3PG9A 4BH7A 3P3TA 2GFBB 4OZ4B 3TJPA 4LLWB 1ZAJA 4WUKL 4NQED 1H9VA 4UV7H 5DUPH 4M1GL 1QTWA 2B20A 5FKYA 1RUKL 3EDKA 4JKKA 1Z5LA 1HJBC 3D3AA 4U3AA 2AABH 4JIIX 4WI0A 3SQBA 1OKEA 5IB5A 3I6KB 4MMXB 4WV1A 2NW3A 2YEQA 1FWSA 3ME3A 2BPBA 4PJBE 3EYOB 4QRPE 4WI9A 5D7LB 3WIFA 5LXGH 1HXKA 4M5SA 3UBGA 3I84A 2XU2A 1EERB 3PUUA 5GVJA 3WAKA 3JTBA 4MADA 3LKPB 3W9EB 4WFED 4YHYC 3ATZA 3R0UA 2BNQD 3K2MC 4PTNA 2JKAA 1AG6A 2XBDA 1FFNB 3NA8A 4OF7A 4K1WA 2WXNA 3R25A 1DWGM 3OMNB 2JKPA 2FO4B 2D69A 2OMUA 2YAOA 4KK6D 4LLYA 1FG9C 4I5XA 1GPOL 4EKJA 3LU2A 2YCLB 3HGJA 3CN3A 2YBGA 4QTGA 1FVDB 1P0EA 1OX5A 2V81A 2ZZ1A 5T5FH 4NL1A 4IBYA 3QPEA 2DMKA 4JGUA 4WJ5B 1FWGC 4RDVA 4K8GA 4EIBA 3K30A 2EG7A 1UCBL 3W11C 3CIWA 5DI8A 3MKKA 2E6AA 2ADFL 1UT2A 2H1LM 1DBKH 4OTXL 3RJDA 2F7QA 4PRIA 1OIMA 3VI2A 2LV4A 3DYOA 4DZ8B 4ODWA 1E27B 1H5VA 3QIUC 3QKZA 3F2DA 3M6DA 4MZ2A 3NO3A 1J18A 2LQRA 3KPRB 3ZW3A 3WTVA 1KM0A 3UJFA 3S1WA 5GS0L 4DZ5A 1XGZA 4JG1L 1FZKB 4MNHB 3L54A 3TPKA 3NOEA 2DM7A 5J12B 4XTDA 1FWWA 3S2MA 2FCBA 2J6XA 4M7LH 3SKNA 3B43A 4PJ9C 5DUJA 4P5TD 2DD8H 2VR9A 4P46C 5IFJB 4L0YA 5GXBB 2PDUA 4RGND 1NGWA 2J13A 4KRZA 4RSYA 3EJCA 3RVTC 1W3KA 3H2AA 2DIKA 4W9FC 3W70A 4TNWK 4EVNA 4HKJB 5CBAA 1CWYA 5E4IA 5KW9L 3NJVA 5FLUA 3F01A 3ZIYA 4HUVB 3LOTA 1L6PA 4M8RA 4NKDA 4ZFFB 3LEVH 4S0TD 5CIPA 5KJRL 5LWYL 3BAJA 1ETB1 1K4HA 4HHAA 4XX5A 2NW0A 3PWJB 3FB6B 3AZTA 4XZIA 4NZTL 4OGQC 3WZ0E 1C7TA 43CAA 4PJDE 4X5XB 1H15B 4GMTH 1YNTA 2AKRB 3QUXA 4OF0A 5I9QB 1S7SB 3M9YA 5DT5A 3U2ZA 4P8UA 3CHVA 4HAGA 1W2KT 2HB0A 1C7SA 2EIZA 5J04A 5FKPA 1XYBA 3LEXA 1XBRA 3C86A 1QVOB 5HJBA 1QNOA 4M3HA 3VQ2C 2XG5A 3VMPA 3GI9H 4WVRA 5CLZA 3EOAB 1ZV5A 2XVNA 1JGEA 3L5XL 3N6HA 2YXGA 4O4VA 3R5EA 5HBFA 1IM3D 4N26A 5CGBA 3BVNA 4X6CE 1UWYA 3MV9B 5DRZB 3U4EA 3VRLF 5A5WA 5DRXA 2XWEA 3P0WA 4BZ2L 5B1JC 3QR3A 3FBQA 1RZIB 3G5VB 3UZQB 3WL9A 4Z76B 2R14A 3LHTA 4K23L 4AKOA 1GYUA 3TIEB 2BCMA 4P8QA 1AW5A 1P4CA 1IGSA 4PBXA 3OQRA 4DF9A 2YC1A 2EDJA 4AEFA 5CKSA 1EOKA 2WXLA 2ESCA 3HGRA 4KBXA 3X1EA 2AL2B 4LUSB 5E0QA 1EHKB 4QRPA 25C8H 1AY1H 3IFLL 3B83A 2W0FA 3C8KA 1EEZA 3K4AA 4OI9A 1OTSD 5A6MA 2CITA 5E5LA 3ZKNC 9CGTA 5BPPA 3NQ7A 1U30A 1K1DA 4BZ1A 1KJ2H 5BQ7A 1WXJA 5DLCA 5I66A 4IQJA 3ARDC 4Q4SA 3CK0H 4LHQB 2AQNA 1RZGB 1S8DA 6ENLA 6REQA 3T8LA 1SUJA 3BGFC 3Q3GA 2Z93A 3RTQB 3SZKC 4DNLA 3IGHX 4AG0A 2I27N 5DEGB 4K5OA 1VFLA 1B4JL 3F00A 4YWGH 1JDDA 2QLVB 3IJSA 4I3RL 4XO3A 2IKHA 1SJMA 2Z31B 2RA1A 3HZKB 1NBVL 4XXWA 4J1OA 2KX9A 3PZTA 3G3LA 1IBGL 1AHMA 3KUMA 3N04A 2EABA 4GSRA 1NFIB 4NN5B 3CBJB 2FATH 4AUUA 1IEHA 1RI8A 4RZCB 2DZSA 3EOLA 4WNQA 5AHFA 2JTYA 4QLKA 4DWSB 1EFXD 5E5RB 4R3UA 1T3FB 4XWGL 3LKOB 3LEYH 1DFBH 4OGYH 5DO8A 1UB3A 5FW6A 1WGVA 3QI9D 3RGVA 5IW6B 2Y1ZA 4OFQA 3S96A 5J9PA 3A3HA 1JWMB 1ONRA 2ZKMX 5GRYA 3AQXA 3R19A 1IMHC 3OVRA 3W7GA 3KTCA 4X9YA 1CFVH 5BU6A 1KN2L 4EN3D 1E2WA 2I69A 1NAKL 4P7QA 2AEPL 3ZL4L 4Z0BH 4AEHH 5HDOA 2X4UB 4LSPH 3IDNA 2CBVA 3HG1D 2CETA 5BW6A 2GEEA 2QV5A 3WH9A 4TXVB 4Z7NF 4JRYD 1OT1A 2BOBA 4PRWA 3OWRA 1ETZB 2WLNA 3BKJH 2Z8WC 1MQ8A 3GU2A 4N0UA 1Z32X 1EJWC 4JQXA 4LE8A 4QNEA 1JS4A 1NFBA 4M62L 3P69A 3MV7A 5FYJH 4BSWA 1LBLA 2DIBA 2NY2C 4JO1L 2KZWA 4JFUA 1VKFA 3N12A 3GHEL 3LX9A 1SHXA 1T1ZA 4N8CL 4NKOA 4ZZKA 4RZKA 3AS1A 4RV3A 4GIAA 3VG0L 4FX5A 4NWUH 3CLMA 5LNGA 4P7RA 3JWDH 2Y7MA 1ODAA 1TELA 4MZ1A 1HOEA 3MJ8A 3NK4A 1MRCL 1KJVB 3OAUL 4RMTA 3ARQA 4Y9EA 2FO1A 3BN9C 2GT9A 1VS1A 4RE3A 5HMSA 2A73B 4ZENA 2PRMA 3DGBA 3E74A 1BA9A 4YHIB 1KLFB 4WWKC 2YMXL 2YD4A 4EDWL 1LO2H 4RNFA 5IFAH 2ONEA 1RJCA 3W88A 1KC5H 2KT6A 2Q3XA 3DBSA 4PREB 4YDJB 1J1OL 1X3DA 2B7DT 3II3A 1KFGA 2BXVA 4ZR8A 4C6OA 4FXGB 2XA8L 3FH5A 1IJ9A 1GHRA 4FQXC 1GGIH 1UP2A 3QNZA 2XQBL 3LZPA 5EOCH 3T0EC 4Q9BA 4Z42C 1CFMA 2NZLA 2WO5A 4RIRA 1IGIL 4QT5A 5F3FA 5ETUA 5EU7E 1KCKA 1SXNA 1TQBB 1FL3A 1DZBA 4GSXA 3VH8G 4J8RB 3LBCA 2NDFA 2B7NA 4BFIB 3DYPA 2MWCA 4QI3A 1QAWA 1AH1A 3H2WA 5DJYA 4C1NA 5B38B 1US3A 2NQJA 2G3MA 5C0RL 1EO8L 2GSIA 4U33A 1A21A 3WQCA 1SLUA 1BQGA 1MHEB 1GZPB 1RUPH 2NMSA 5E6YA 1EB3A 4MRCA 1CGYA 4JTEA 2WQPA 3GGWB 1ONWA 1A6ZA 1ZY9A 2A83B 2GEQA 2R56L 2YDAA 3EA3A 4IHBA 4L80A 3USZA 1RPKA 4RWHA 5B22A 3S42A 3WD1A 2YGOA 3OKEA 2F1EA 4JLRA 3I85A 4KROB 1FTXA 1Q66A 5G1YA 2X9XA 4DZBB 4ZD3H 3HC3H 2BVWA 4YHLH 4HV8A 3QJRB 4UQAA 3GSXA 3VAVA 3LH9A 5H2ZA 2WGNB 4HCHA 3K4DA 4NZFA 3VRIA 5GS1A 3KZ8A 4ZMXA 4JGMA 1XAKA 4W4NA 5EB9A 1KLGA 3GIPA 4BFRA 3DAQA 1HHJA 1IL1A 3GXTA 5F1IA 3N25A 2XWDA 5JDJA 3P7YA 2E27H 2CIKB 2O6PA 3QHZH 3VD5A 4J2XA 5J12C 3NPZB 5CLWA 1H60A 2OTWA 4L8SB 4PBDA 3U7WL 3UFIA 2IKJA 2VLRE 5IQ9B 3FCTB 2Z0IA 1QT1A 1ET7A 5C9RA 2AXGA 5TIMA 5HWNA 3VQ1C 4KWVA 4U1GB 2DTML 3HZYA 1KCWA 3SIZA 1NGQL 3MKCA 2WB5A 1PQZB 2Y9RT 4MZ3A 4WSKA 3SJVA 5JOPD 2BOGX 2RGMA 5A3HA 2ZA1A 3WLKX 2HJLB 4U1IA 1V08A 1NOAA 1P53A 2WTOA 3ZDZE 5CJXA 4MA7L 1BIIA 4KZEH 1E5UI 4N3UA 3MV8A 1GKRA 2DQEL 4FA8A 4X6DF 3LNGA 4YXLH 1FZJA 4GB9A 5IBXC 1A6AB 1XGRA 3IIOA 1IQDB 2PDCA 2C9XA 4EI5C 1R6WA 1NMCB 4XK2A 2CBQA 4XP5L 4X4XA 1HKLL 5ALCH 4JFFB 4GI9A 1QEWB 4TLSA 2HNHA 3OHMB 4G8EA 4A2MA 1Q7ZA 4NRYB 5MEPB 4M6QA 4AH2B 4BXSV 4NZDA 4NQDA 5ENWA 4ZCWA 5LNWA 5F7NC 1UR3M 2AP2A 2G5UA 1WRFA 1Q7QA 2O5XH 1X7QA 1ETJA 1FFPA 2ARJB 2K6ZA 5HI3D 2E59A 3ZZSA 3OVPA 4ATTA 1RJYB 4FXKA 4HZ1A 1ME8A 3QIBD 1TV2A 3NM1A 1OT4A 2EVJA 1FKWA 4DP0X 4XZ9A 2F0CA 4PUDA 3I6GB 4JKMA 5TE7L 2NXZC 1JGUH 3E0GA 1LO0L 4CMHC 3APGA 2X44D 3TEZA 1G9HA 5AC8A 4ICXA 4QHRA 4IIHA 2F1BA 4GO9A 7PCYA 1DFXA 1SQ2N 4CQ9A 4ZS7L 3W37A 3A4XA 2X1SA 3AHTA 3SKMA 5FR3A 1BYOA 5JXAL 3QUGA 3NJHA 3RNQB 1XFCA 5EZOH 5D1XE 5GGTL 4H1LH 2Q86B 2HX7A 2GGIA 3ALFA 3SCNA 1HH9A 4CCDA 4H8PA 2KKQA 5SX4I 2RJMA 5MHSE 2YB1A 5EYWA 3UROR 2PYEB 1GRWA 3PTMA 3OL2A 3UBPC 3LQAC 4A6YB 3DIVA 1NAML 4DJDD 1ID2A 1YEDA 2MNJB 2R94A 1WAUA 4QNWA 3FTWA 5HXMA 4IGHA 4J4PA 3S3JA 3LSBA 4X9SA 4RNRB 1I7UB 4FLOA 1D5ZB 1R5WA 3N0PB 3ERXA 4O51B 3MA9L 3WKQA 1FCBA 3F4DA 1NAKH 3R11A 4H9YA 4OFCA 2LU3A 4IFRA 1ZA6A 2UYLB 3UXFA 3FT3A 1AD9A 1E28B 1I8IB 1P4IL 1EEPA 1PKLA 5E2UH 1OD8A 1DQLL 2PCPA 2CNYA 2PXYA 2QTEA 5I8EB 4HETA 4B53A 4JFDD 2B0MA 2WVVB 1SFHA 1ZRUA 2GJJA 4XPGH 3ABQA 3LCLA 4HWBH 3OZLA 4NLAA 3DUUB 4PB0L 3F4NA 4IPLA 5M5DA 2NX5B 1U3NA 3SGZA 3C6LD 5GSVA 2PPEA 4GKLA 3IS1X 5GISL 5F9DC 5C0CB 5JMRA 1NH6A 2HS6A 4UIOA 3I50H 4TOYH 2E5EA 4DVRH 3CSPA 2UZ9A 1BWKA 3B9DA 1RJZB 5D71L 3BZ4B 2B14A 2XWZA 1ZE3C 4GUPA 3CFBB 1GZHC 3GTXA 2EJ1A 3QORA 4PGLA 2BS8A 4XH2A 1WFOA 3IXTB 3C5ZD 4I87A 3RZCB 3W2KA 4XQ6A 4L2YA 3HI6L 3MBEC 1HXYA 1E1FA 4M93C 3C0SA 1EGJL 4H20H 4NSKA 1MY5A 4DQOH 1MEXH 5LAXA 3E2QA 2H3NB 1R3LA 4HIPA 4O58H 4JDEA 3UAFA 3DI0A 5DY2A 4LKXB 1N68A 1NU5A 5T33L 3KL3A 1JPST 2N3JA 2EEDA 3W0WD 3ML9A 4A8RA 3P3BA 5A6SA 1INEH 2UWEF 1BQUA 3C12A 4ODHL 3GLZA 3G1YA 3TYCA 3CFTA 2DJSA 4CSSA 2IXUA 2DUZA 1FNSL 1IT9H 1Z3RA 4UZSA 1N67A 5D1QB 4HOXA 1CNVA 3O6LH 1E0WA 2TRSA 3E0FA 2ZYIA 1OBAA 2I9TA 2PU1A 2N1TE 5HDQH 1J1PH 2FWLB 4R26H 4YSAA 4PRAB 4M61A 1SJAA 4W6YB 1TTQA 3NVDA 1FIGL 2W59A 3P93A 1QUPA 1M2VB 2DOCA 2EXSA 2XUWA 5ALBL 1JP5A 4F33A 5BV7H 4APXB 5IG7A 1P6BA 1PZ0A 1XG3A 2X42A 5FA4A 3CUXA 4DCQA 5C6TL 1PL3A 4KGLA 1KF9B 4PW3A 5F9WB 3DOIA 1B3XA 2GVYA 3T0EB 2XIOA 3FSTA 1X4ZA 3FSAA 5EEUA 1H8SA 2RGSA 3BO8A 1TTFA 3S3CB 2UXGA 1E0TA 1MCNA 4QXGH 4WKFA 4WOZA 1HX0A 1TLMA 1GOHA 2J4WL 2XGZA 3WO8A 2KZ1B 2V5YA 3N3EA 5CJOH 3FCUB 2VMJA 2XJLA 2QZRA 3QO0A 3CU7A 3SKUD 4AFYA 4C6PA 1U1HA 4G43B 2EKGA 1BWMA 4KJPD 1QSFD 3EBHA 4ANXA 1JRHI 2CLZA 4JHVA 1DSWA 2HG5B 3IDXH 4KUZH 2NLJA 1EPVA 5FM4A 1AC0A 3PJUA 2R2BA 3QDJB 3WEBA 3H2PA 4AVFA 4GBUA 3OR7B 3O3EA 4PJAB 1UYWL 4EDXB 2V68A 4HLEA 4OU3A 1CG9A 3DKLA 1G69A 2O61B 3R79A 5AHMA 3TROA 3QG6A 1J8RA 3V4LA 2CCLA 5BV7B 3IACA 1ISWA 1FSKC 1RURL 2R2EB 3CSTA 1IQWH 2AVFA 3U7WH 4L4OA 4P61A 1PZ3A 3ZZQA 2EE9A 4C4KO 3EPNA 2QQKH 4Y16A 3MRLA 1MHHB 4X4MA 4N0FB 2Y2YA 1IAKA 3FQUA 4HIHA 2X4OB 3V5DB 5D1ZC 3P1VA 1E0VA 3GMLA 3MMTA 3BDBA 1H7XA 3MVSA 3VAEA 2EDLA 3MHUA 2ZP8A 1UASA 3RWFB 2GBVA 5CD3B 3VWKB 3WLBB 1I8KB 1Q6RA 4W81A 4C6NA 1WTLA 5FYKL 5DZOA 4HPXA 3QUML 3OXRB 2DKUA 4O8RA 3KPQA 1X44A 4YDVB 5JU6A 1L9SA 1IC7H 2F5AL 5AZ2H 4EKXA 5EWIL 4LCIH 4EF3A 4LHUA 4YXLL 1FKXA 1OCBA 2AJYH 4GI8A 2WGXA 3OJVC 3LI1A 3PAUA 2C4FT 4HCRA 5EKYA 5BRZB 2VLJE 3GMNA 5IROC 1DZ0A 2WWOA 1JEZA 4V1DE 1PZAA 3BZ5A 4JO4L 1QEXA 2Z65C 3FRUA 3Q5OA 1DHPA 1JFHA 1KXTB 2JF6A 3KJ4B 4K5PA 3GMMB 3H3PH 3OP2A 2A77L 4G7EB 4NJAL 3LD8B 3C2RA 1BPLB 2VDQH 4ZFMA 1QATA 4IYKA 5DHYB 4MCZA 5HDLA 2YPVH 1I0BA 3FT0A 5EEXA 2IG2L 3BGGA 5HA7A 4X9IA 5FJRA 4JQVA 3LZRA 4HIJA 2WHKA 2YR1A 2D73A 3C6LB 7ODCA 4PGBB 1I3GH 1RUQH 3B5GA 4N8VG 3UWZA 5J06A 5IJVA 3MRBB 5KTEH 2EXWD 1D5BB 1JPTL 4M4PA 3DX8A 1XF4B 3BP5A