3TP4A

Crystal structure of engineered protein at the resolution 1.98a, northeast structural genomics consortium target or128
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
465
structure length
454
Chain Sequence
DETIAIVDADATAETRSLLSYLDGVRGEGILFGHHGTTSSGLTTGPTDGTTSDVKNVTGDFPAVFGWSTSIIEGNQRPGLAENTRDENIALFADYIRKADAIGGVNTVGAGVENFVTGGSFYDDTLRAVLPGGSHHAELVAYLDDIAELADASRRDDGTLIPIVFRPWHENAGSWFWWGAAYGSPGEYQELYRFTVEYLRDVKGVSNFLYAWGPGGGFGGNRDVYLRTYPGDAFVDVLGLDTYDSTGSDAFLAGLVADLRMIAEIADEKGKVSAFTRFGVSGGVGTNGSSPAQWFTKVLAAIKADPVASRNAYMETGENADAGQHFVPVPGDALLEDFQAYAADPFTLFASEVTGAFDRTVAAAPAQPVVHIASPADGARVASAPTTVRVRVGGTDVQSVTVEVAQGGTVVDTLDLAYDGALWWTAPWSPTYTVTATATTAAGTLDVTNEVAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of activated serine-containing catalytic triads with atomic-level accuracy.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Structural genomics, unknown function
molecule keywords computational Design of Enzyme
total genus 153
structure length 454
sequence length 465
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tp4A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3tp4A01
3HI5H 4M93C 4NWTH 4FMVA 4X0VA 1N4XH 4AIZB 5I8OH 1MI5D 2IQAA 5EUKB 1NWTA 1A22B 4PJCE 5D6DA 3SE4C 5D9NA 4JN1H 3C9NA 1UYWL 4W89A 1XF3B 1R8LA 2PXYD 1QOKA 3TBTA 3AIWA 3IFNL 4M1GL 5CHNB 3CJJA 3QUMH 4NO3B 1A6ZA 2APXA 3GZKA 2WM0A 3K46A 2CLRB 2G60L 3LIZL 5CIPH 3CIVA 1R0AH 3ZTNH 4LDOB 1ZBVA 4JLRA 2HFFA 4HKBB 3C2SA 4P5MA 4N8VA 3BDYL 4R26H 1MJ7H 2IALB 2OR9H 4H04A 1KPUB 1IM3B 4MNQE 5DO2C 4NKDA 2Q8XA 3G5YA 1T20A 4MAVA 2PXYC 1I8KA 4XNZC 1RZGB 4IBLT 3O2DH 4RGND 4U6YA 2OWCA 2V2XB 4FG6C 1CGWA 4Z77B 4B0MM 1FZOA 5INCB 1QR1A 4N1CA 2VRAA 1U3ZA 2XM1A 1PY4A 1I1AD 2E7MA 4FQCH 4EK7A 3ELAT 2BHUA 1KTLB 4XNQA 4KKNA 4A2LA 4ODUA 1NGZA 4JAMA 1FNSL 2VDKL 4JQVC 3CC5B 5FO9A 1IBGL 5DHVH 3AAZA 5D7LE 3RAJH 3PWVA 2WIIA 3WUBA 3GSRA 3TTOA 1UH3A 1IQDA 4MX7B 2A2QT 4CW1A 4AQ1B 3H2WA 1UM5L 2W0LA 2X10A 3GJEA 2CR6A 1YMHB 1JYNA 2EZ0D 2A3BA 2B0SL 1GONA 1U8QB 4GS7B 5A6BD 3GB7B 2DQCH 2YEZB 2XY2A 1MEXL 3MLUL 3QISA 4JFDA 1HSBA 1EH9A 3CVHA 1YUHB 3E8UL 1KEGL 1T80A 2W61A 4R27A 1OL0A 5IFAL 1EO8H 1V8HA 5FIEA 5SX5H 4LASL 4PRAB 5HY9B 1A3RH 4GRMA 2R1YB 3W39B 1A14L 3SKMB 1TTUA 2XWJA 3OKOA 3BSHA 4HA4A 4PP2A 3B9VA 1GPOH 2NYYD 4TUFA 2AW2A 4JB9H 3QHTC 1VGEL 2H6PA 4E42A 5C07B 1WFOA 3DX9B 2DLEA 4QLRA 3KLHD 1BGAA 2HP4A 2YEZA 2O9RA 2V7HA 3WLBA 4H20L 1LEGB 1MCQA 5BYWA 4BFIB 2Y4SA 4QTHB 1BYBA 3MROA 12E8L 1OSPL 1QKZL 3GMNB 5LGHL 3NGBB 4X99A 3GHBL 3ROOB 3RWGB 1GSMA 1MUJA 2LV4A 4GFTB 1IKFL 1MCBA 3IVKB 1DUZB 4HMCA 2XGBA 5CWSA 5E7BA 1KXQA 3UAJD 1L7IL 1U93B 4LQ1A 4DGIH 3QBTB 1LL4A 2F9BT 3B4NA 5BVPL 1F4WH 1J8HE 3EBAA 1KF9B 4GXUM 3IFPB 4PJFA 2NNAB 3CXDL 3G6AA 4NKQB 1T89A 1G9MH 3W0KA 4LSSH 4ELKB 4OBRA 3FRPA 4TN9A 1C5CL 1SY6H 3C5ZD 3AXIA 4WUUE 1KUMA 4JDZA 5DO2D 4UB0H 2OWWA 4QTHA 3NCJL 2HRPH 3EYPA 1KTRL 3AS0A 4OI9A 3QDME 5LBSH 5JHLH 4X99B 1A7OL 1B90A 3CZEA 3SKOB 4PV8A 2HH0H 3CLWA 4XVUD 4XWOC 4M6NL 3GSVB 5CJXC 3SGKC 2XVPA 4JRXE 1NGYB 3WDPP 2B4CL 1UADC 2QR0B 4OFPA 4POZD 5DLML 1AIFB 1KPVA 2I9TA 4UNVA 5DJZB 4FXGA 5FECA 3OZPA 4QRQA 3GBMH 3L3IA 3IXTA 1KENL 1BFTA 1OAKL 3ZO0A 3FQNB 5E9DE 4WHDA 4Z7WA 2I26N 2Y07L 1R7OA 4PJ8A 3WFDL 5D2LA 3O41A 5I6XB 1YYLL 5JA9A 2JJSC 2P7TB 1ITCA 2WINB 4OLEA 3T3ME 2E9JA 3UYPA 3SN6N 3JVGA 4AXNA 1UENA 4Z7NE 4PJBF 3WNMA 1IEHA 1MFCH 1WEJL 4J4PA 4V27A 5HD8C 1SR0A 4OOUA 3LKOB 3V5HA 3BPLC 1T3FA 4Q6YA 3F58L 5F89A 5CD5D 4G5ZL 1FL3B 3TCLA 5ICZA 4JRYE 4OLVH 3QH3B 4AEHH 1XFPA 3NSXA 1IGFH 1P84J 3FONA 4PJEF 3G9AB 4ZAKA 3IAGC 3QHOA 4J8RA 4UOW1 1NMCB 3O6AA 2P42B 5INDB 3WJLA 3P4NB 5BW7C 4FF5A 4Z0XB 4IISA 3PGFH 4N0CD 1H0GA 4Z7VF 3BAXA 2AEQH 3UJIH 1WLHA 5DVMA 4HZ7A 2G4FA 4NP4H 3EMCA 1U36A 1VEPA 4HUKB 1Q9LB 4MAYB 4GQ9H 5IW3A 1CIUA 2VL5B 3MGTB 1JWSA 5IESL 3EOAB 3HRZB 1NLDL 2WBJD 4OGAC 1MPAL 1CDYA 2OP4H 5B3NA 2J74A 1I8IA 4JFDE 4L5FL 2R29H 1NGZB 3BW9A 2FHBA 4FFZL 4U1NA 4UINH 2RIKA 2JF6A 3OZ9L 1S9YB 5FO8B 5SX5K 3NZ8A 5GGTH 3ULVE 1MCKA 2J6EL 1PEWA 3H9SA 3OJDB 3CZ8A 3SJVE 3U7YL 4ZODA 4NOBA 1KCRL 3S8WA 1NFDB 4JCLA 5FDYA 3W81A 3D2UA 4PY8J 5IVXF 1YMMA 5D5MA 1ZE3C 1P2CA 1NCBH 3LD8C 1CU4H 4BZ1H 5FL0A 4JHOA 5H37H 5TFSL 1C3FA 1K2DA 5F1OB 1VRXA 5DMKB 3PTKA 1J0IA 2DLFL 2VL5A 4LLMA 2V17H 1KG0B 4PRHD 2WV3A 3TFKC 1HILA 4Z78B 3VXUA 3U4BH 5LKNA 4YGAB 1N8ZB 1UKTA 1RHHA 1FYHB 4AL8H 2C3VB 1QLRA 1NBYB 4K8RC 3H9SB 4R2GC 2EIDA 3TPUB 5B8CC 1S7QB 4QF1B 5D7SL 3WSUA 1NMBL 1HCVA 3IKCA 4E8CA 5DT1H 4M4RA 4LSDA 4AMCA 2WZEA 1A7PH 3PZGA 3BEVB 5GNZA 3WMBA 1WIUA 3VXSD 1V02A 4M6MH 4TUKH 1TVBA 5DMKA 2DDQH 3OKEA 1F4AA 1M05A 3Q6GH 1JDCA 4U3HA 1KFAH 2FX8H 3PIQA 5F9WC 4BQ3A 3C09C 5E4EC 3THML 1JHKH 5MEPA 1JHKL 4BA0A 4QHMB 2R2BA 3AIBA 2W0FB 2WVTA 3KPRA 1KJ3H 1RUPH 2BVPB 2WHKA 2VO5A 1E0WA 4RFEA 4O2EA 3PQYA 1K6AA 5KANG 1JGIA 4GAGL 4HWBA 4PJFB 4KKAC 3P9MB 1TJGH 5E8PB 4U5KA 3WF3A 1WCGA 1UUQA 2DOCA 1FV1A 1Z3GL 4HDIB 4G8EA 2GJ6A 4LSRH 3STZA 3CX5J 1ZLVK 1GL4B 4MA8L 4Z7UF 5A3HA 1GQIA 2YLLA 1CE1L 1J9CT 1LK2A 3GSQB 1R3JB 1EVUA 1ACZA 5ICXB 1A1MA 1YN7B 3FQXB 1S3KL 4DFHA 1H1NA 4FQ2L 1PD6A 1Q0XH 3L2MA 2WMIB 2B2XL 4LLYB 4N68A 1ACYL 2XKNB 3NTCH 5I1AB 5DTFB 5D8WA 1YQVH 5D7IB 3SCPA 3FOLA 4MHHI 4LYRA 2DJSA 2FCBA 3S6TA 2XTJC 4LCCA 4CD5A 4P23A 1ZOXA 2VKWA 2EE2A 4JO4L 5DJ2B 3JTSB 3VH8G 2UVEA 3ZR5A 1CQYA 4XPTL 4XCYA 2BSTA 1QSED 4BQ6A 3PZVA 5JIHA 1AH1A 2X4UB 3A0OA 4L1HA 4AIEA 4V28A 3OV6A 3RY5A 1GC1C 4MCYA 4XNMB 1EHLL 5I66A 2AJ3B 4LCWE 4EQ3A 3RVVC 3NPZB 1K9TA 3OLGA 2JB5L 5AG9A 5T1LD 1FRGL 1NJ9B 1R85A 3DHMA 3SDXF 4EQ2A 4OFDA 4NDMA 5DT5A 5BRPA 3OL2A 4R0LC 2DM2A 4ZXOA 1P7KA 3QJFA 5AYQA 4OZHB 4WFHD 2D3LA 3SDDA 1T0MB 1NEZB 3QH3A 4D9LH 3P4MB 4WI4A 5FF6B 1I7RB 4Y5YB 1B30A 4LCCB 3KPOA 3T0EB 3U7YH 4GRLB 4I4WA 4A2MA 3E3QE 4R9HA 5DD0L 1M71A 1AFVL 2J8UF 4H0GA 5D4YA 3ULUE 2Z31D 3ZKQD 4L8CA 1HYSD 2O9TA 1XF2B 5E4EB 2EKJA 1RUKH 5F97E 1OF2B 1NGPL 2CIKA 3BT2H 3G08A 4PYHA 2VISB 3VA2C 5I66B 3OXRB 1MJ8H 3HG1A 5FXCH 2VDQH 4YUEH 2YOCA 3UDWA 4B7LA 3I75A 5F6HJ 1CLXA 5M3WA 3T4YB 3VMNA 1IGFL 5ENWB 5EBMB 3MGTA 4OQTL 3KYAA 1OGBA 4P2RA 4UT9H 4CMMA 3SKNB 4YQXL 3VFNB 4PLJC 2AV7A 1OGAE 3D85B 4UQ3A 4S0SD 4J6RL 1E4KC 3NCEB 3BIAX 1AKJD 5E99H 1FOBA 4TXEA 3KPNB 1QUNA 3BKJH 2X4SB 5F7LB 1M6OB 1AXIB 3T3MF 1BD2B 3ULUD 1PJ9A 5GRUL 5BV7H 5I1JH 1C90A 1I3RA 1UR0A 3DPBA 4YZFF 2XNAA 3UYOD 5C7XL 1YYLH 4JRYB 3VXRD 2BVDA 4QY8A 5T1KA 2Y8VA 2DD8L 3HC0B 1RK1B 4D0CB 1QRNE 4OGYH 3CFCL 2QL1A 4JR9H 2HJFA 4UINL 3EGSA 3QI9B 4GG6B 5C09A 1PSKH 5BXFB 2CBJA 1FSKC 3HCVB 3ZKXC 1K4DA 3WFCH 2E3VA 4P2RB 3PV7A 1FO0L 2F19H 1T03H 3S35L 1LO4L 3WXVL 3T77B 4XXCC 4OV6F 4GLRH 3F5WB 3O81A 3BESR 3BH8A 3NIDE 2BNRA 2G5BA 4KUCD 4RRPA 2DT2A 2VR4A 1HT6A 3VXQA 1W1YA 1KCVL 1LO5B 4KRLB 4OM0H 3AYRA 3DX8B 5I18H 3LN4B 3KXFB 3M07A 4MADA 4W84A 1S9WB 5CILL 3KPSE 2ESVA 5TQ2L 4JFDB 4G80A 2XWDA 2CUHA 4J3OC 4S1SH 4WFFD 4D0CA 1E4NA 3LEXB 2XTLA 5HDBF 5J1SC 4LGXA 1YNTB 3PL6D 2HH0L 3DSNA 4OLVL 4MJ4A 5D71H 1PX4A 4KJPC 4PRAA 4RMUA 2J77A 3O2WH 3DJ9A 3AREC 3DUUA 3NFPA 1JZ3A 4FFWD 5BJTB 3BSGA 3TF7C 4JM2F 5JIKA 1D5BB 2AABL 4YAQB 5BZDA 2BNRB 5F3BA 4JRWA 4UZGA 3S3PA 3RTQB 4W7VA 4W7UA 2YA1A 1RUMH 3IU4H 4HK3J 2N56A 1U30A 4APQD 3R8BB 2GJJA 4DWSA 2X4PA 3LN4A 3MBXL 1I1AC 1JV5A 3P9MA 4U7KA 4Y1AE 1FVDA 5GSRB 4TOYL 2UVFA 3ISWA 2D7QA 3T65A 4CDGC 3RWFB 1ES0A 3L7EB 3BPOC 2NQCA 2H1PH 2AKRB 1A3LL 4K9EH 1BVNP 2ZX7A 1AHWA 1QHPA 1A7RH 5BRZB 1MRDH 3MCKB 4L29A 3HUJB 4U6XB 5IEHA 4JY6A 4QWWC 3U1SH 2BOBA 2BC4B 4BQCA 1U93A 1IGTA 1R5IA 8CGTA 3TA9A 2NY0D 5IG7B 3Q3GB 2CERA 4EANA 5DRWB 1XIWD 2NZ9D 4LCWA 5IBUB 5GGVH 4PGDB 1EX0A 5C0GB 4P8UA 4F9PA 1QFUH 2EBNA 5SWZD 4OAWB 1QYGH 3BHBB 4D1IA 1ZL1A 3QULA 2MCPH 5HI5C 4Y4HC 4S11A 2UYLB 4PS4H 5FYKD 4FQXB 4NC1E 2GJ6E 1DE4A 4LIQH 5GS0L 4LNRA 3EOTH 3BKCL 4RBPK 2R2EB 1KNOB 4KTDH 2GSGA 3QUZD 3A67L 1DWHM 3V0WL 4I3SH 2PR4L 3OPZH 1P69B 4RMWA 5DJ6B 4Z76A 3EFFB 2XN9E 3PTMA 3QEUA 3RVUC 4F9JA 4NIKB 2OSYA 5L88H 5ALCL 3QI9C 2DT3A 1JCKA 3UTTA 3UYRL 1MFNA 3QIUA 1YEGH 4QRQB 2FYYA 2EDYA 3RM4A 3OZOA 1MHCA 5FF6A 5EZLA 1HXYA 1B3WA 2JJTC 3IXAB 2QQLH 3V4PH 3SO3B 5I1GL 4LPWA 4TVSa 2HJLA 4WWKA 4HWZA 4XNZB 4D6CA 4YHZH 5GRVL 3A6BL 3QIWA 3PGDB 1A7NL 5GHWL 4B41A 2EDTA 2AV1B 4I77L 3MV9B 1WBYB 4DCQA 4LVHC 1KNOA 1F4HA 4MJIE 1DQTA 3WF0A 5ANMA 4M8VA 2IPTL 1KV3A 3JV5A 4RSVA 5EZJB 4ERSL 4X4YA 4KK5D 4ZO9A 1JNLH 2R56L 3BQUD 1Z5LA 1FFPA 4LVEA 2DWDB 4I18C 2W63A 1A6VH 4X4XB 4AZHA 1CXKA 3IGAA 2YD2A 3VWKD 4DKEL 4FQLH 4HIJA 4N1HB 4N90E 2NY4D 3E8UH 1UD6A 1CD1A 1KB5B 2EICA 5B8CA 4K3GA 4KRTA 4GBXD 3IDGA 4JN1L 4MJID 4BH7A 1DSFL 1U92A 4X0KA 1N4XL 5A2JH 3MPCA 3LPWA 1HOCA 2OS7A 1MXGA 5KVMC 1TVDA 3OJMB 1PIFA 4NHUA 2BSRA 1RVFH 1HK6A 2HG5A 4UV7L 4ZFFA 5C0CD 1Q9LA 1JWSB 2APBA 4ZO8A 2VITB 2L0DA 4K94H 5JW5B 1OAQH 3MXVL 4XWGH 1KT2A 4KROC 1U3HA 4C59B 2CLRA 4LAJH 2Z8WC 3ARZA 4KFZC 2C1PA 3B3IA 2Q3ZA 4AC1X 2F54D 5HGDB 3BZ4B 4YHIB 3IDIA 3HE6C 3MRQB 3Q48A 4LLAA 3TONA 1U8NB 4G6KL 1V5JA 1PZ3A 3ROLA 2VDNH 4BQ8A 4DOHE 5JMRA 3NIFE 1R5VB 1CK0L 4JFFA 3LKNA 2EEDA 1S9WA 1BREA 5ANME 4LVOB 2XZQH 5JOFA 3ZE1E 5F96L 1TQCC 2QADB 2NR6C 2HN7A 1A3LH 5EG6C 2NY1D 5MP6H 2OMNA 3OKKB 5AAMA 4EKXA 3BEWB 4MLIA 3ZKMC 2A6JA 1QI4A 3LVEA 1FCCA 1IGCH 1SJEA 4M80A 1OLLA 5T3XH 1YEFL 4PJEA 3TM6A 3V52H 5EMYA 3CUPB 3KPRE 1INDH 2QEJA 3UR8A 1BF8A 3QNZA 4LPTA 5ACZB 1G9NL 2IAND 3IFNH 4M1GH 4UT7H 3SBWA 1CVRA 1MCFA 4DVRL 5JUVA 3GSRB 5EZOL 1DBMH 3PABB 2X6MA 4XXDA 3AHYA 8FABA 4F57L 4UAOC 1TG7A 4Y16B 3DO3A 5AC5A 3G6JF 5C0ND 3TH2T 4DWSB 4JN2B 3UESA 3ES6A 9CGTA 4LYPA 4DVBB 1JTOA 1GOFA 1V6XA 4IMKA 2DQUH 4QLKA 2HJKA 2BOCB 4PJHF 2VXTH 5IEKB 2EDJA 2D03H 5E8EA 5CGMA 3LEVL 4H8WL 3TVMA 2XQBL 4A3HA 4M93B 4JAWA 3KJ6L 4W7WA 5I19L 5GRXG 2YSSA 4PP2B 4PJDF 3ULUH 1YY8B 4MA1C 3QQ3B 3D3VD 4G3YH 3RVXD 2BY2A 1BLIA 3HB3C 1AGFA 1HH9B 1KBBA 4JKKA 4R4ND 4HC1H 1OAYL 3GK8H 4JN2A 3N13A 4I18A 1LE9B 4OUEA 1NC2B 2XA8H 1ZS8A 3LKPA 3MGOB 3RKDC 5DQJA 5A6SA 4FFYH 4HWBH 4U1JA 4C83A 1TZ7A 4NF7A 2ZX8A 4BF7A 3AB0C 1LK2B 1G7PA 1E5NA 1JMZA 3STLA 1AD0B 4X8JA 4TOYH 1E6ZA 1DWAM 1R5WB 3U0PA 2G3JA 5C2BL 1V05A 2J7EA 4F9DA 3QUKB 5I75B 3QEUB 4Q58C 2DM3A 2XZAH 3Q6FA 4S1QH 1HX0A 4HK0B 3T0BA 3ZR6A 1G6RL 3HMWH 4Z18A 3WIFB 3W0WA 3GEWB 3IFPA 4M1DL 1ESWA 5MEQA 4V1DA 1HEZB 2WBWB 2QSVA 1KN4H 2XVLA 5FL1A 4YPJA 1F58H 1WBXA 1T22B 3DI3B 4QRTA 1RUAH 1YDPA 3VGEA 4ODSL 5HYJB 2E0PA 5DQJB 4L4VD 3AOFA 4UZUA 1UM6H 5D70H 4J12A 3OR7A 1WDPA 2OLDA 4R5EA 1BEYH 2DQHL 5ALBL 3FB5A 2C4FT 1A4KA 2ADGA 3S88L 4K68A 5HSFA 3NA9H 1R3HA 3GK8L 3VI4F 1JD9A 5CJQH 4HLZH 4TYUA 3O6KL 4FQIL 5EU3B 3VW3H 1GVYA 2FJGA 3L5JA 4XNUL 2AS5M 3TH3T 2GVYA 3G6LA 3GO1H 4PJAF 2AXHA 5EORL 5JOPD 3C2AH 1MY5A 4AD3A 2D20A 1BQCA 1FO0H 2F19L 4PR5B 5K9QG 3UTZA 2XHYA 4BFGA 1GUVA 4QRTB 1FZMA 1W72L 2WINA 1U8OB 4ONHA 4JZJA 3DXAE 3C5JA 4F2MB 4N0UA 4N9OB 1BTCA 4E2OA 5FUCE 3T4YA 2EEXA 4JO3H 4RGOH 5F7HA 1UG9A 2B5IB 2CLZB 3WFBH 2NXYB 1NCTA 1Q6GA 1ZEAH 4YBHA 1YMMD 4P5KA 2FR4A 5JLZA 1I1XA 3MRGA 5TDOA 5E8NB 1UKQA 5JXAL 3AQUA 3TIDA 3PJSA 4GRWF 4PGJA 5DUBB 2CMRH 3IDIB 4PTTB 1KIPB 5E6ZA 1NFIA 5J3HD 3UTSE 3S5LA 4I8DA 4CDHA 4PJ9B 1NCAH 4HULB 2CSPA 4HPHA 2CBUA 3VCLB 1T1XB 4OI8A 1F90H 1FZMB 1ORQA 1P84K 4H0HB 2W92A 4J23A 3C5JB 4F2MA 4L8BA 2Z91A 1J8KA 3RP1A 2PKDA 5JOFB 1IM9B 2UY3A 5EWIL 5FEBA 5HVHB 1CR9H 3RWEB 2NY2C 3FOMB 2IPUG 3G6DH 4DKFH 5EDXA 5KN5A 4JJ5A 3PWPE 1OTTD 2ATPB 2NX5E 5DJAA 2HFEB 1XR9B 2VURA 1D5ZB 4G42B 4PJEB 1G7HA 4D8PB 2ADJA 3D39E 3NZ8B 2MJWA 3VFPB 2ZUQB 4XX1E 4JFWA 4OLYH 4PJ9A 4R3SB 3TJEH 3WF2A 1W9DM 5CJ8A 5C08B 1QRND 1XV8A 1HJUA 3WENA 2PO6B 2YK1L 3SUUA 3HMXA 2XG5A 2HFGL 1HHGA 2PWEA 2W9LA 2DDQL 1FGVH 5CD5C 3ZKMD 3B83A 1AY1H 5J11C 3GMPA 3B2UD 4DGYH 4HMEA 4H8WC 4PYSA 1MREL 2XA3A 4FRWA 2O5XH 2VZOA 3OHXA 1HILB 3T3PE 1I7ZB 2CEQA 2VN4A 1G7HB 1ZT7A 2VL4A 2IPUK 4M48L 5ESVB 1XGRB 1DSFH 3BKYH 5D2NB 5AD0A 1QSVA 1CD9B 3M17B 1BZ7B 2F54E 4MQTB 1BZQK 5A69A 2XKUA 6FABH 4UFMA 2BV9A 4FQLL 5EC1B 2B2XH 1H15A 2AJSL 1RK0A 1MF2L 5FGBC 4OFVA 3V52L 5F1IA 1AR1C 4M43L 3ARDB 3RZCD 3LKRB 3WBDA 5TE4L 2VR9A 3B2UC 4GIAA 3MOBL 4OKDA 3MRLA 3LKPB 1I75A 1UJ3B 3LV3A 4L4VE 2ZUTA 5IFHH 4K3EH 2RJMA 1KEML 1YEDA 4ONFL 5CGYC 2EIEA 1OM3L 3UDWC 5TFSH 2YR3A 3V7AG 4KJYA 1CDCA 5TQ0H 1EGJL 1FCGA 4J2XA 3QCVL 5TPWL 3U5YA 4GMSH 3Q3GA 2X40A 5DC9B 1S9XB 5EPMA 4NT6B 2JK5A 1NGQH 5TH2A 4HJJH 5D2NA 5HYQA 4DZ8A 5SWSB 5MEND 4Q97A 1QI5A 3GJFK 3PN8A 1BECA 1PQZB 2P8PA 3D9AH 3KYNA 1UKPA 4V1DB 1QR4A 5L88L 1DTUA 1HE7A 1UCBL 3RIFF 5DJYB 3A4AA 1S78D 1MQRA 4ZS7H 1QSFA 4GSDH 3WIJA 3RKDD 4NRXA 1YJDC 2Z35B 4M03A 4WU5B 4R97B 1QSZA 1GORA 5D4QA 2R4SH 7TAAA 1A6UL 2ADGB 1NMBH 4JZNA 4S1SL 3ARBA 1G1CA 5IBTH 1GZQB 4BK4A 3EMQA 3U82B 3L1OL 4K2UH 4XBPB 1H8SA 4KKLC 4XHJD 4KUCF 1QFUL 1P53A 5DJXA 1B3YA 2O5ZH 3U4BL 4GRMB 3KYNB 4MD5B 1MLCA 1CPUA 4Y19B 4ZUUA 3V4UL 2V5YA 3F58H 4HCRA 2X4UA 5IBLC 4CGTA 2BHZA 1JPFA 2IBBA 2ITCB 1T1WB 4F58H 4PTWA 4P46C 3WH8A 1GHFH 1I85A 5C0DA 1T5WB 1U8PB 3C08H 5GIRB 1DQMH 3EYVA 2NY2B 3MXWH 5GISL 4OF8A 2WVVA 2BSSB 1BZ9B 1TNNA 5BROA 4JFQB 2KUTA 2AQ3A 4WHCA 5I74C 2XOTA 1W9VA 3CH1B 4PJDA 4ZPTB 1F6AA 43CAA 2OM5A 4R4FL 1DN0A 5ACLA 1NC4D 2AEWA 5LJYH 3N15A 3RPIB 2F5AH 5IVXA 5EOQL 4Y2DA 4IIQB 4HIIB 1UH2A 1UR1A 4AEFA 4S1DD 3G04B 2CNCA 1EFQA 1VCAA 1FAIH 1UKSA 1CZ1A 1VFMA 2OTUA 1WK0A 4X5WB 3MACH 2V3EA 4NWUL 2NPLX 5JW5A 3AGVA 4HEPG 2WVVB 3V5DB 3LRGA 2C26A 5M94B 1HQRA 1OGAD 4K94C 3THDA 1WWBX 5HHQA 4WUUD 2H8PB 3IDJB 5IBUG 5ABFB 2ZUNA 3F5LA 1T7XA 3OGSA 4PGBA 5ID1A 2LAAA 2OSXA 1N82A 1E6XM 2E9IA 4L3AA 1KB9J 5ETUA 1UXWA 5T1LB 2YD7A 5J0BA 1AO7E 3ARPA 1D5IL 5BXTA 3RIFK 5F9OH 3VFPA 3GM0A 5C0FA 4OZIB 3BP7B 5IHLB 4DM2A 1D6VL 3CH9A 2WLZA 2ZCKL 2DLIA 4Y7EA 4OCLC 4BSVA 3E6HB 4LIQE 4K71C 3JXAA 1X5HA 3KS0H 3ZYZA 3LQAC 3QXTA 5I71C 4GRLD 4Y5VB 3ALGA 3B8YA 1JPSH 4LFHD 3RWJB 2DJUA 2YD9A 1IEAB 5IKCA 1SJEB 5HHVL 4EEEA 4JPIA 3WNPA 3C6LD 5K9OA 1ORSB 4TSAH 4YDLC 4GBXC 4TSAL 4EUPH 4JE4B 4PJIA 3VRJB 5A8QA 1T66D 5ABFA 2CIIB 2GJZB 3V5KA 2VXSL 3JV4A 5TPWH 1G0CA 2XXCB 3U57A 1VGKB 2NXZB 3QDMB 5ESVA 1B2WH 3O8XA 4N5EC 5AY7A 3O9WA 4YC2C 3KPSD 2DYPA 4QYOA 3NCMA 4ONFH 5GRVK 1VERA 1GHFL 2XV6B 2ZWZA 4Y4KB 2X4TB 2ED9A 4L9LA 4OUUB 3RGVD 2A1WH 3S96B 1RK0B 3I6GB 5J6HB 4XH2A 1JNNH 1PYWA 1EHNA 2XTJE 1FORH 2WPGA 3DLQR 2Y06L 4Z0XA 5C09E 5E5UB 1KGXA 4XPBL 1ZGLA 3C5SB 4NJ9L 2UWEB 2FGZA 3NPSB 4NM4L 3JWOL 4ZG1A 2C5DC 4O9HH 3RIAK 4OM0L 1QBLL 1KBGL 4BCEA 2DM4A 4ALAL 2J7BA 5I1CL 2O9PA 3MREA 4YAQA 3KXFE 2O5XL 4G9DA 5FGBA 3OGCB 3HN3A 4H1LG 1F4WL 2WMPA 3TPKA 1ETZB 1GOWA 3ALFA 4KKCD 4NO3A 2V6HA 2VIRA 3UC0H 4Y4KA 4OLXL 2I5YL 1CL7H 2X4PB 4ELME 5C08D 2GJRA 5IROC 1BP3B 3C8KB 4UTAL 4D6DA 4L4TD 2DM7A 3EMZA 4HT1H 3H6JA 3P0VH 2EH8H 4JR9L 1H0DB 1QKZH 4GG6F 3SCTA 1RJYA 5HHNB 2ITDB 1IL1B 4M6ML 4TUKL 4UOZA 4NSBA 1WNOA 3IB4A 4X6DE 1JGUL 4WHTB 2ZE0A 1XGZA 2W1NA 5I0ZA 4JHWL 2LTQC 3DYMA 3PL6B 1NCDL 1W72A 2M8XA 1UEYA 3MREB 3G5XA 1CN4A 5JHDB 3QG7L 3NSNA 3CHFA 3EZ8A 5AUMA 1CXHA 1FL5A 3QDHA 4N0FB 3NN8B 1HEZA 1RIHH 3RJDA 4NKOA 1FNEA 4QLLA 4N9GA 4O02L 4UT9L 1BVLA 4YXHH 2IPKB 3VOCA 4CKQA 1DE4B 5CMAA 1ZU8A 2JF7A 5IJKC 5FYKH 5A6AA 3RTQC 5HYIA 1VPOL 5T3ZE 3GH5A 4OLZL 3HUJF 2ITDA 2P8LB 2V9RA 2V5TA 1KLGB 1A7QL 2D4DA 4F15B 1BX2B 4FXGB 3KJ4C 3WD4A 4ZFOA 3WMSA 5IB1A 1OQXA 2W65B 1US2A 1YEHL 5C0EB 4XT1C 3FO0H 4JREB 4O5LH 3JTTB 3HZYB 1GGCL 2E7HA 1KQYA 4P7LA 1AQMA 2CKBH 2D9QB 1JNJA 3RAJL 1QNSA 2WWMD 4U1GB 5GGTL 1ZHKB 2BS9A 3QAZC 2H9GB 4KJPD 3ZJ8A 3GSWA 1MRCH 2FX7L 3ARWA 1JFQH 3DOSA 3P9LA 3V5HB 2A6DA 2NW3A 5LCVH 1I1RA 5E56A 2WCSA 4R96A 1AQDA 2WBJA 3E3QC 4KROB 4YE4L 5C0AA 5DUMH 1I9IL 2CRZA 3LEYH 3O4LB 3OKLB 2A6IA 3ULSA 3FO1A 4KQ3L 3DVNB 4RWYL 1CLOL 3V5DA 5ELIA 2GITA 4XB3A 1A7PL 1FYTD 2NY3B 3SOBL 3WKMH 2V2TA 5DD1L 4O58H 3LH2L 2OR8A 5TF1L 1FSKB 1A6AA 2VZTA 4X6BA 3NUKA 4DKFL 1AXTL 2MKLC 3IETB 5CPTA 5FAAA 1GZPB 1BJMA 5BOZG 3IVKA 1WFUA 1NKOA 1YEIH 2VH5L 3RHWK 3TA3B 3U4AA 5TDNA 1UM6L 3HNTH 3THCA 5L6YL 1FNHA 4M62L 4MAYA 5T3XE 3PHQB 2Z8RA 5D7IA 4BZ2L 3VIMA 3GGWB 4G6AC 5C0JA 1NCAL 3MOQA 3OG6B 4M56A 1J01A 3VM7A 4ACYA 2RGLA 3N1FC 1U0QA 1I4FB 4D0BA 3BKYL 4XCYB 2Z31A 3RNQA 5HI5D 1JNEA 2YBRA 2YBUA 1WITA 1C16A 5E0CA 3B9KD 4HIEB 3REWB 1E71M 2FATL 3DGCR 1RURH 3S9DB 4WEBH 4XZWA 1AY1L 1WVZA 2ED8A 4NZRL 4QCFA 2FIRT 4YXLL 3KLSA 4BH8B 3SE9H 2VZVA 3QHZH 3CUIA 5IHSA 3LKNB 4Q6IA 4YHLL 4YNYB 1OGTB 3AUVA 4U1LB 2H32B 5EA0L 3BGFB 2IWGA 3T0EA 3MRIB 3PXHA 4K3JH 3RBSA 4GRLC 3K2MC 3C2AL 3VH8B 4CADB 5EORH 1RH9A 3L4VA 2P24B 4YIQA 3WL9B 5I17B 3JWOC 4J3TA 3I6KA 1OAZH 3OHXB 4MMXC 5DHYA 3UROR 1U42A 4Q6IC 1AXSB 4NM8H 3I2CH 1CIDA 3DHJA 1NAKL 3F12A 2ENSA 1FZKB 2DS4A 2VB5A 1XGRA 2VISA 3VI4E 2X1IA 2BHYA 3PDOB 2CKNA 3S88H 5EU4B 3DXAD 4EN3B 3W37A 5IUSA 3MFFA 1PGRB 3UZEA 5EBMA 1FH5L 4LLQA 3MJ9L 3BN9D 2N7AA 3BH9B 3WLWC 3VNYA 4FFWC 1UWTA 3TTQA 5FYJL 3CVIH 4ENED 1WC7B 5I73B 1OAXL 4L3CA 1HHIA 1M05B 5EOCJ 5IT2H 4R8WL 3TWCH 3MV01 1QTYT 1P9MA 2NY7L 2QLVB 1E43A 3VXNB 4QHMA 2QBWA 2PF0A 1J7VR 1YEDB 1CICB 2Q6WA 4IRSA 1WEJH 1Q1JL 1B6UA 1KCUH 3SKJH 5LGHH 3RA7H 5E8EB 1NCBL 2CK0L 4DAGH 1AQHA 1S9XA 4WHTA 2GAZB 1CLZL 4KGLA 5DHVA 5DVNA 5I78A 3QEQA 4GO6B 1KB9K 2ZUXA 1YEFH 5EU4A 1BHGA 2ZXAA 3QDMD 2NXZD 3BCDA 3NCCB 1OW0A 1KCKA 2JLLA 4KK8D 4HH9A 4HF5H 5CEZE 2CPUA 1YJDL 4K8RD 1Q9KB 3QB7C 4F7EB 3S6CA 2Z8VC 4UFHA 1XCTA 3TCXA 1X4YA 4OIIH 4AT6A 1CICA 2WMIA 4NP4L 4BQ5A 5J9PB 3BZEA 3ARTA 4X9HA 1EO8L 3L3OA 2GK1A 4I2XA 4DWSD 3KNBB 1DVFD 1V0MA 4UUJA 5CLWA 5HYSB 4W81A 3ZQ9A 5GRJL 2GUYA 2QV4A 3OAYH 4QO1A 4M29A 2IXUA 1S5IH 4L9LC 1RFDL 3ULUF 4UZSA 3LKQB 3RL1B 2JCCA 5J89A 3PHAA 5GGSB 1MH5A 3DRQB 3FJTA 3GSUA 2YC1B 1S9KC 1RVFL 3GKZA 2WIIB 1FIGH 4G5ZH 4N90D 4ONGL 2BERA 3SGJA 5DK3A 2D31A 3VFMB 1VFAB 1OGSA 3QIBD 4K7PH 2AEIT 5IOPB 2HT2C 3QUMB 3ORJA 5IHUH 2AGJL 1NCWL 4R2GB 1JHTA 3BXWA 4LCIH 5L7XH 1BVZA 3KNBA 2XZCL 2Q7NA 5AAWA 3BVNA 3SKUD 2O93L 2ARJA 5IM7B 4M5ZL 1IEBA 3AJ7A 3MUGA 4LNVA 5FUOH 1F4XH 4OCNC 5IVZB 5ITBH 1RPKA 2QQNL 1GHRA 4FLSA 4OKVA 3FFCD 4MB5A 1UD4A 5HY9A 4EAMA 4IIQA 4N5UA 4RWHA 4JZ5A 4ML4A 1NDGA 3MNVA 3NH7H 4J3XA 3VWJD 1S7SA 3VXMB 4E41E 3VFOA 1R0AL 1GOOA 1U8OA 2HVKA 1HZHH 2ICWI 4HFWA 4MDIA 4X9GA 1ZXQA 4ZOCA 1J1PL 1ULVA 3G6MA 3UG3A 1ADQH 5D7LD 5FO7B 2E7LA 1HH6B 1TENA 2HMIC 4U6HB 4XVSH 4ZPVA 3GI8H 3TEUA 5IR1B 2X4SA 1B4JL 3CFBB 1DUYB 3DYOA 1JG9A 3HI5L 2GYSA 4NWTL 1X6NA 4JFED 4HPYH 5E94B 3CXDH 1RZJC 2M2DA 3O6FC 2VQ1A 3H0TA 2WXDM 1YNKH 4S2SA 1DBKH 5CSUA 2BCKB 3CFJB 4G8GA 4F80A 5IHZA 5B39A 5BOPA 1XF3A 5GGRA 4U4BA 1CLYH 4WENB 3B9AA 3HE6D 3DGGB 4J4PD 3UTTB 1QLFA 2Z92A 4LLWA 1NL0H 4C56B 2WMFA 1OCWH 4DK6A 5DTFA 1YPZB 2XN9D 4NI3A 4LSQH 3DV4B 4E9LA 1CG9B 4X8XA 1IM9A 2H32A 4B15A 3K7UA 1SQ2N 3L3HA 3FOMA 3U7VA 3V7MA 4P9HH 2VZSA 4KZEL 5J1AA 5TGBB 4F7CA 1UWEH 1A6VL 1KPUA 4GI6A 3W4RA 3VIOA 1IKNA 1AXSA 1CXFA 3TO4D 4XX1G 2BVQB 2VZ1A 4GQPH 1HHJB 4IRJD 4Y8DC 1AR2A 3TO2A 4CU7A 4JDTL 1C91A 2DYPB 4C55A 5KG9A 3A6CH 3B6SB 3WQ5A 4MXWH 2UY4A 1W0VB 3KR3L 5A2CA 3UBXB 4G6JH 1WT5C 2J8UE 4HV8B 1FLRL 1HKJA 4G8FA 1A1NA 4XH2B 3VD7A 5FK9A 1EXUA 1B3ZA 5C8JB 1YPZA 1S7VB 3WUEA 1GIGH 5KSBF 2EDWA 4PTUB 3PV6A 4QRPA 4HJGB 1T1YB 1DBKL 4EI5D 2WKLA 3EJZC 5HI3C 5KBNC 4BUHA 2OQJA 3PP3H 3PWVB 5BXSA 2Q6WB 2ADFH 5IVNA 1ZANL 4TVDA 1S5IL 4L8CB 4NHUB 1OB1B 3CD4A 3RU8L 3BAJA 4ACZB 4P3CH 2A73B 5BS0E 1YEKL 3ESVF 5AZEL 2P46B 4KDTC 2AXGA 3OTTA 5D7KE 35C8H 4HS8L 2FO4B 1ISWA 5D71L 1US3A 1FFNA 3T4AB 3WS6A 5DC4B 4AENB 3QUZA 4LIQL 5CSZA 1P1ZA 2AJVH 1W9XA 4S10A 3MRQA 1QHZA 1K4CA 1GNXA 3VXPB 1Z2KA 2R1YA 4FZEH 3E6FA 4I0PC 5FKYA 5HHNA 1VBUA 4B9ZA 1MHPL 5T5FL 3VGBA 3UERA 3D2UD 5E2WH 1MIMH 1F4XL 4OF5A 2XNAB 4YO0B 2DSUA 3CUJA 2GY7B 3BCFA 5D1XD 1XYZA 4OJYA 5JPNA 1EV2E 1UGNA 2FB4H 3T08A 5EPMB 2HYMA 5DRNB 2R69H 3EOAA 1PSKL 4LSQL 1M04A 4NKOB 1KQZA 5C09B 3WHE0 4G9FB 5T3ZH 3F4VA 5H94A 5IF0B 1EJOH 3LIZH 5LYRA 1TZGL 2ZNXA 1P1ZB 2GSIB 4MB4A 1QD0A 1UQSB 4URIA 2DWEA 3U36B 3E6FB 4M61B 1WCBB 3MJ9H 1I85C 4U0RC 3WD0A 1W1TA 3ZSSA 4L9DA 3KPRD 4PMDA 1RFDH 3QR3A 3IANA 2PWFA 5DS8B 1EUTA 4ODXB 2W65A 2MPAL 5KJRL 2VLKB 3QHNA 4G43B 5JPNB 3WH5A 2DRUA 5LXGH 4Z77A 1A6WL 1NWRA 3FQWB 3F7PC 5CS7A 4YQXH 1I8LC 1K9DA 2V9QA 3MUGB 4CN1A 5BO1L 4ZDHA 2XRAH 4OZGF 5EULV 3F6LA 4KTDL 1MI5B 1OVZA 4IDLA 4AQOA 5DT7A 1I3GL 1HXJA 4LEOA 1N8ZA 3BMWA 5IF0A 2FEEL 4PBXA 4QRUA 5EFFA 5ANMB 4AZ8A 5C86A 1B2YA 5AYUL 1U2HA 1EGZA 5CILH 2GJXB 4R96B 5I9QC 4UQDA 1PBGA 4XPHL 1HXMA 3MYJA 2DQIH 2QQNH 1F8TL 1E4MM 3L9RA 2Y23A 1J0ZA 1U8QA 5JHDE 1IC5L 3GSNA 1WUNT 1NANI 2PF6A 4XGZB 5JIPA 1RURL 4LCUB 1Y6NR 1HH6A 2DF3A 4I18B 1Z9LA 3V2AR 1BSIA 3VFUA 1E6OH 1SMOA 4KHXL 3D5OF 4MD0B 1I7UA 2YA2A 5EUOB 3VFVB 4M82A 4P23D 1A8JH 4OOZA 5M5DA 1H3PH 3I02A 1NQBA 1MRDL 3AU1A 1Q9OA 5CP3H 3HC3L 2KL6A 1MCWM 2UV3A 4K9EL 3MJ8B 3LPPA 3CFCH 2A83A 4EI5C 5B39B 4U3CA 2DQXA 1S7RB 4NQCD 2NY6C 2XZZA 3QSKB 5D2NE 4RFEB 1RMFL 4HK0A 3SO3C 1H3TA 3BSZH 5L6YH 5DK0B 4HUWA 3RGHA 4FQJH 3WD1A 3BPLB 4GG8A 2W59A 1CG9A 2YUWA 3UP1A 1V0NA 4BM7A 3NFNA 3OAZH 5F1KC 1E4KA 2J6EA 1VFBA 3MV7A 3QJHA 4P4KB 1C5BL 3FMGH 5CD3B 5MI0C 1WZ1L 3EAKA 4F3FA 3QA3A 2H8PA 3IDJA 5T1MA 4LGPB 4L8DA 5IVXE 3OR7B 4FTVE 1MUJB 5ETUB 4BSJA 5CP7B 4NYLB 1ITBB 1IJ9A 3MJ8A 5DJ6A 3FO9B 4PJ5A 5AC4A 1ZLSH 3MCLH 2QHAA 1J05A 4K3DH 4KZDH 2AEPL 2XG9A 3D69A 2BXZA 2A6JB 3QCTH 4LQFL 1KCVH 4TTDC 4XP9L 5ECJE 1WDRA 4KI5F 1PZUB 4UDUB 5FM4A 1MQKH 3R1GH 5KS9F 3TZVB 1IAKB 4LRNL 2DTMH 4QRSA 4PG2C 2HJLB 4WWKB 2OQJB 4XCNB 4PJCB 1GOIA 1GCFA 4UOW0 4Z8FL 4MA7L 1DBBH 2DLGA 5HHMB 5JW4M 5LGJA 4J3VA 5ISZA 1QNZH 2CKRA 3N9GL 4I3RH 1OP5K 1WC7A 3NABL 5DFVD 3VXSA 3H7BA 1EBPA 2R0LH 2VXQH 3EOBB 2DL9A 1KJMB 4FP8H 4PMUA 4NKIL 2YD8A 5C7XH 2EH7H 4K07A 3LPOA 3NDYA 2V5CA 1KIPA 2D0HA 3FB7B 5A2KH 1IGYB 1QLEL 4UDUA 1KC5H 4LVNB 2BDNL 1OSZB 5D1QD 1RHHB 1TE1A 3DHPA 5DFTA 3QRGL 4HPOH 1RV6X 1ZA6B 2XPGB 2YSSB 4QRSB 4YC2B 3QEGL 5E8OB 1E1EA 3S37L 1P7QD 1JPGA 4NQDB 3TO4B 3IKCB 4HQQH 3TFKD 2EO7A 4JFZL 5L0QB 1T83C 1FNAA 1CLVA 2V17L 3DC0A 1VSCA 2ESVD 1MJ8L 5DUML 3O6FB 4LCYA 1C5DA 5ICYB 3P0VL 4BZYA 4PGCA 4Z7UE 2QJDA 5GGTA 4F7EA 5ID0A 4LDEB 4MA7H 2FGLA 4Z8FH 2CLVA 1M6OA 3HB3D 1Y6MR 1TLKA 2X42A 1TJGL 5AG8A 3OGRA 1B3VA 2CQVA 4AT6B 5INDA 3MJ7A 3WS3B 4PCTA 1T4KB 5D5MF 1QO3B 4M61A 2X4RB 4NZTH 5J12C 5E0FA 4X7TA 2ZXBA 4JZJC 1A3QA 1V3KA 5DC0A 2QMKA 3GMMB 1QBBA 1BFVH 3W0WB 1PIGA 4QT5B 2A0LC 5C07D 4MMZC 1D5MA 3HS0B 4MDJB 1WBZA 4CN4A 5EN2A 5IGXL 1VJSA 4D9QE 2Y06H 4U0QB 1SBSH 1HKKA 1LQSR 4PGCB 1AD9A 2OTWB 1ZT7B 3ARXA 5AZ2H 4Z5RB 3TJHC 4HS6B 4ZTOL 1CFSB 1B9ZA 4PLJD 5CMAB 2EE6A 3MJ7B 1TPXB 1PEZA 2XVGA 4RA3A 5DEZA 1D6EA 4PPTA 3PNWA 2O61A 1CF8H 3GH4A 3IDYC 4XXCA 3ZZ1A 5C6PB 4IMLA 2JKXA 5EO1B 3GSNB 4XGZA 4BYHA 1HJVA 1UHVA 1Q0XL 3EO0A 4PJXB 4ZSOB 4HZAA 2R0LL 1SBSL 4PMQA 4ZNCD 3OAZK 1EFXA 4W6WB 3C5ZB 3I02B 2RFXB 5BV7B 2BZDA 3SE3C 4D6GA 5CQ1A 2EH8L 4I0PB 2PW2B 5CBEA 2GTWB 3WN5B 1KN2L 5HGHB 1A02N 1AVAA 3HAEA 3MLVL 1ZJBA 1RZKC 2H9GA 3MUZ1 5FHAL 2GJPA 3SCUA 4EE9A 4BZ1L 4B50A 1X3DA 2I5YH 3P9LB 5LQBL 5CKGA 3VPLA 3GKWL 1E6OL 2YS4A 3RTQA 3PXJA 3VO0A 5BS0D 5FOOA 3II1A 5D1ZD 5E9DD 2R23A 4J3SA 4OZHA 2D7TH 3O4LA 2HT3C 5I6SA 1H09A 2PWGA 1EO7A 4QCIA 5FV1L 3P4MA 4JM4L 5I1CH 4WTXA 5I1EL 3QIUD 3RVVD 1RZFH 5MENE 3DVGB 3FQUB 3PWLA 4I4WB 2AEPH 3THMH 1UWSA 5C2UB 5CD3A 1F6FB 3SCMA 3FKUS 5CEZL 2GHWB 3MCLL 1A6AB 3CZJA 2JIWA 4HZLB 2E8YA 2VDMH 3L3JA 3QEQE 3EBVA 1FORL 1B0RB 3O2LA 3LZFL 1E4XL 5DI8A 4PD4K 4AZGA 1JNNL 5GSVB 3VMPA 3T2NH 3WNNA 4KV5F 3ZMRA 1WZ1H 1JL8A 4KY1L 4UB0L 4KHTL 4NQEB 4KMTL 4ZYKB 2ATPA 5D7SH 4HPOL 1FG2A 3SKNA 5H2BB 5EBLB 1TMCB 1MCOL 3X17A 4WFEE 4Q9QH 4OQ1A 5E2TH 1SJHB 4MNGE 1QLEH 1E6QM 3MU7A 4BUGA 1FHGA 4JKPL 4KDTA 2ZPKH 1HP5A 3FTGA 4XVJH 4KMQA 4R7DA 4AD2A 4FFVD 3QIWC 3ULVL 5IB5B 1HF6A 2Y36L 5FYJE 2ICWB 4LMQI 2DLFH 3B5TA 4Z76B 2ZX9A 3B6SA 2E7CA 1ZLWK 2ARWA 5BQ7B 2JB6A 5JOEA 1XGPB 3HU7A 3DURB 3CDYA 2BNRE 5GPRA 1CGSH 2R69L 5BRQA 4ZPTA 2H2PC 4DN4H 3WQ6A 1KYOJ 4MAYD 1XF4B 5I1HH 3F6IA 4GG6A 5I77A 1D6VH 5JBFA 3L6FB 1DQJB 3HCVA 3ARDC 5IVXB 1FDLH 4PMZA 1QZ1A 4WGVB 1E6JL 2XI9A 2AJYH 1DZBA 4H41A 1MLBA 4JPWL 1BGGA 4JFPA 1KXQE 2AV1A 4P4KD 1SEBA 3K0WA 3TBYA 2O5YL 1IFHH 5D6CB 1JFXA 3FAXA 1P7HL 5JTWA 4KMTH 3QG6A 4KHTH 1NLDH 3OF6A 1IILE 3FY1A 5F1NA 1BG9A 4Q9BA 2EIZA 2H2PD 3EDJA 1A7OH 2JTDA 4HXAH 1FFPB 4KXZH 4U2ZA 3DNKA 4ZUSB 1L0XA 1SVCP 3AIEA 3UJIL 1HHIB 2FIKA 3RGVC 4PJFF 4CRPA 5B8CB 1C93A 3PZUA 1OP3H 3OLEA 1TVHA 3KPOB 4ZXLA 5EOQH 1K8IB 1Y18B 5BZDB 3D5HA 3OLDA 1ZWIA 4G6FD 5SWSA 1QFWL 1PKQB 3GKWH 1A6ZB 4GMSL 4M7JH 3MRBA 1NEUA 1D7FA 1JV5B 1T0PB 1F02I 5D93C 5JZ7C 4XMPL 5CEYA 4JLRB 4IHOB 5TJWK 4OUOA 4EUPB 4HAFA 1DFBH 1KXTA 3B2VH 3SDXE 4FQCL 4ZUTB 1GVIA 4XB7A 5IFHL 1KGCE 3ARUA 3GBLA 2PWDA 4PMNA 3MRRB 2O92A 3PWJB 1Q9KA 2GJZA 1N64L 4M81A 1FZJB 4UIMA 5JXEC 4HC1A 5KSBA 1HINH 5KSAD 1HIML 3B9KC 3I6LE 4MXQD 4XVJL 2O5ZL 1WCBA 2J8OA 2X4QA 4JGUA 4LL9A 3REVB 5D2LF 2C7UB 3P73B 1R5VA 1NDMB 2OL3H 2VXVH 1N3NA 5FOJA 4JFFB 1LJYA 4GRWB 1I3UA 2C3WA 3O3EB 4L9LB 4OUUA 3BZFA 4OIFA 1AC0A 1UZ6E 4UUJB 4XPFH 2COQA 1T1ZB 3FB8A 1URLA 1E72M 2EYSB 3EHBD 5EIIA 5AZ2L 4OTXL 1GZJA 4JANA 5D7LA 2H2SD 1VF8A 1KGCD 3MACL 2WZIA 3MV8E 3QNYB 1LDSA 4OLUL 1JN6B 5JW4R 3OB8A 1P6AB 4GOSA 3RY4A 1DBAL 1QFHA 3EUUA 3PHSA 3QWRA 4HPGA 5A6JA 4M7ZC 4Y4HD 4JFQA 4KRNA 3TJEL 4CVZA 2FGWL 5IOPA 1NMCC 2WUBH 2P5WB 5BWFA 1UM5H 5EU5A 1C92A 2ZJSL 3QO1A 5DSCA 2X1XR 3ARFD 2TAAA 3O3EA 1MHCB 4NCC2 4P8WA 2NY0C 1FNSH 1A9EB 4CJ1A 2GUOA 4H8HA 4QWWD 1IM9D 1V08A 2J7CA 1RJYB 3ARGD 4YFDB 1G0XA 3C08L 3E0GA 4M5YH 2ZSVA 4JRYD 1ROWA 4K3EL 3VXRB 1PG7X 4TNVK 1GGIL 4JDTH 2XVKA 2VR5A 1SJXA 2P8MA 5DEGA 4HIHB 1F6LL 4LK4A 3VFOB 3WL0A 2ICES 1TCRA 3G5XB 2AK1H 1JWUB 3VFGH 1UVQB 4Q7DA 3ZM8A 3BP5A 5HHQB 4LEXH 3GMOA 2JELH 2EC9U 3AIUA 2K7PA 4FN0A 4I13B 2P8PB 4WI5A 5DMIH 5I8KL 3DMMB 1QRNB 3BPCB 3HC4H 4OCWH 3O8XD 1CTOA 4YHPB 3ZTNL 4U1JB 4L4VA 5E6IB 2VLJE 2ZCHL 4GLRI 2H26B 3U5UA 3MSPA 2WMHA 1AD0A 1VADA 5EC2B 3G5VB 4YHEA 1E40A 1YN6B 3IFLH 2GK2A 1FGVL 4KRUA 4M6OL 2JB6B 2NY4C 1KTKE 3MLUH 4WLCA 3HMXL 1WCQA 2GCYB 4WI8A 1B4JH 4YK4B 1KXVC 4OM1L 2EPNA 1WAWA 2J88L 2J5LB 1OINA 4NQTA 3RRQA 1JGLL 5D1ZB 2CH8A 4FTVA 5DYOB 4HJJL 2IANA 3IK2A 3LDBB 1X5YA 3WE6B 2IH3A 4XNUH 3CZFB 1UACH 3DX6B 2ZUMA 3LPFA 1L0PA 1H3VA 3V6BR 3S36X 5C0AB 1IGMH 2BVOA 3FRUB 3O3UN 4KC3B 2PWHA 3L95A 4CL7A 4NQXA 5E08L 4EI6B 1KPVB 2I9TB 5GIRA 3OBAA 5D70L 5ITBL 3UBXA 2GITB 4YHOH 1U95A 4AISA 1J12A 4KUZL 2V2TB 1WO2A 2JF1A 5IB4A 3BIKB 3E2HB 1F6AB 1RQ5A 4KZEH 3WNLA 3VG9B 3IJSA 2W9EH 4NQED 4YBLB 4YDJB 1H11A 4X6BB 3WFEL 1C5BH 5I1LB 3SJVA 4LCIL 1FYTE 3RL2B 3L4UA 1RZ8A 4WFFE 3O9WC 2IEPA 1CDIA 3MUIA 2C4XA 1X5ZA 5KOVC 3ZHKA 3PABA 4TSCH 3VFWB 5CPQA 1RIVL 2ZSWA 5LA2A 4LP4A 2MNUA 2HA1A 1KB5H 2WAHA 5EU7E 3TO4A 4MWFA 5SWZB 1UD3A 1E0OB 5GJSH 3X11B 5ERWB 4KQ4H 5M17A 4HFUH 2J12B 2DIAA 4IOSD 1C1EH 4UI2A 3UO1H 5EZJA 1CENA 2APWA 3PWPA 5GZND 2R9HC 5A95A 3BE1L 3ARYA 3RVTC 1JZ2A 1V3HA 4KWUA 5JBDA 4M7LT 3QUZB 5ID0B 1OP9A 5HPCA 4NBZB 3VXOA 3AZRA 2Q87A 1OLZA 4RMTA 4NNXB 1T4KA 3GI9L 4J27A 5JO5A 3GRWH 2R4RL 1WAAA 4U3XA 3RL2A 1NFDE 2V2WB 3VX0A 2BFVH 2CRYA 5C0BA 4A6YB 5SWSE 4RAVA 4GO9A 2UUDK 2CGRL 5D8ZA 1F2QA 5I2IA 3TJHD 1BIHA 3O6LL 4TRPL 4N0FA 3QCTL 4LQFH 4XP9H 3W38A 4OCSL 4JKMA 4APQB 4PJGF 3SE9L 5DUPL 3QUYA 3BDXA 4DTGH 2VITA 5E8DL 2HFEA 1JRHI 1UCTA 4HKBA 2HFFB 4C83B 3N12A 3QNYA 1KT2B 4YBQC 3UG5A 2OJZH 4DWHA 3BD5A 1G7PB 3AHZA 1KYOK 5KSBE 1ZTXH 1QI3A 3GRWL 4W87A 5GS0D 4P5TB 3QXDB 1VB9A 4LF3A 4XBGB 4YHIA 5I74B 5A2IH 3RWIB 4KI5D 2XTKA 4XWOD 5JXED 3PZOA 3RMEA 1K9EA 1EEZB 2VWEC 3U36A 1C08A 1CD8A 2YPKA 1I8KB 5ADPL 4AZBA 1DANU 2AAVA 3FCTB 2R0ZL 1XCQB 2R0ZH 1GAFL 4LU5L 1T2QL 1G94A 3BE1H 5H37G 5FIPA 4P3DB 1QBMH 2X4TA 5GGSY 4XPGH 3C5ZC 1H9VA 5MENA 1U8HA 2F8VA 4JQIH 3E2HC 1HHGB 4WCYH 2YDRA 4Y19E 3CK0L 2HN7B 2OJZL 3DTXB 5A2FA 3FN0L 4DM1A 2OSWA 4TSCL 3CC5A 1BBDL 5FO9B 4MJ2A 1UWGL 1OGAB 2UWEA 3TNMB 4IM8A 1LD9A 3W82A 5F44A 2XZQL 4WUUB 5CSYA 4D6FA 3O6LH 1P4LB 1PZ5A 2BNQD 3ULSB 3S5LG 3WV0A 4F37F 4DW2L 1K85A 3HNSH 3GB7A 5D72H 1EEZA 2NY5C 3MLWH 4V2CB 4G9DB 1ZBCA 2VLKE 4GAJL 2VABB 1LDPH 1Q94B 3L9RB 1ETZA 3SCQA 5E2WL 2J5LC 3W25A 1G7JA 5E1AB 2ZUSA 4G7VL 3ABZA 3U46A 3O0RL 4U3AA 3PWLB 2M1KA 1MHEB 3OR6A 5DZNA 4YDKH 1F3JB 2WKGA 2XWTA 1T5XA 3N1AA 3LEVH 4H8WH 3VFVA 3ZDXF 1UWUA 4RBPH 3DTXA 3TA3A 1K3IA 2D03L 2VLRE 2HTKC 2DQHH 2H3NA 5D2LE 2HWZH 5ALBH 4EVNA 1U91B 4PJEE 4NO0A 1UD8A 4UQBA 1KIUA 2C0HA 4AZ7A 3GRWA 4WEBL 2VLKD 1O7VA 5D6DC 3SE4A 2CRMA 2KQMA 1Q72L 3C6LB 2XRAL 3N1QC 4UV7H 1X5IA 3UMTA 2NW2A 2ORBH 3QPXL 1GGCH 3N9KA 2F8OA 1F3DH 3HI6L 5HYQB 4OM1H 3HRPA 5ISZD 1YEHH 1ZHNA 4K7FA 4OV5A 1ND0A 4H1LB 5TDOB 3KPSB 3H8NA 3PJSB 4NUGL 1Q94A 1ZANH 5CIPB 1VIWA 4DVRH 2PYEE 4M6OH 3WIHL 1OARH 4L4OA 1G9NH 3SE8L 4WNQB 2FDMA 1BLNA 1HSAA 4HFUL 3ROOA 4BZ2H 1OAXH 1L9NA 4RGNE 4Z2LA 4YZFE 4MJIB 3DX6A 3NFSL 5C0CE 2GSJA 2WLYA 4XC1H 1T1XA 4ZOAA 4ETYA 5EBWB 4WU5A 3ARGB 2XKNA 4XP4L 1N0XL 5I1AA 3WF4A 5IMOB 3AS2A 2B1AL 5F96H 4K7PY 4H7VA 4J28A 1IEBB 5DD1H 3MRJA 4LKCB 4RMQA 1WIPA 4YIQB 1NC4A 4MS8D 1DQJA 3SOBH 3D0VB 1HHHA 4O51A 4WI6A 5ILTL 1ND0B 2QPSA 1NUDA 5GJTL 2E27H 5ITFB 5MEQB 2F54B 2V5MA 3CX5K 3O8XC 3IFOA 2P45B 4JG1L 1KULA 1B0GA 4NO5A 1NOWA 5KOMC 2RQ8A 5LCVL 3UYRH 3SGJC 1JPFB 4POZC 4LARH 2Z93A 1LEKB 4M1CD 2FX7H 4F7PB 5MHSD 3X3GL 3HI1B 1QPXA 1OAQL 1IZJA 3MXVH 5F1NB 2ZUQC 4LOUD 3RZCA 1IARB 2BXYA 4YHKH 4WW1A 4I3SL 1D3CA 3WYRA 4OF6A 3BYYA 4ZE4A 1GJWA 5D1ZC 2Z4QA 2QTEA 43CAB 5A1AA 4QOKB 2NY1B 4M7LL 5EU3A 5FKAA 4OI7A 1E70M 1MW1A 2CBIA 3D0VA 1NGXB 4O9HL 2DQDL 2ICCA 5BRZE 3O11B 4S2SB 5DMIL 5JHDD 1DVFA 1MHHB 2R0WL 4PJGE 2PYEA 2P7TA 2BRQA 4MNQA 3TGXA 5IIEB 2DPEA 2CIKB 2FSEA 1UWQA 2F54A 3M8OH 3VG0L 4XPAL 2R0KH 5AD0B 4HHAA 1B88A 2YMXH 3P0GB 2EDOA 2WW5A 5DA0B 3EYFB 1JGVL 4X6CB 3KYMB 2X4OB 1HZHL 5JORB 3QZWB 1TETH 4G8IB 2VJXA 1LK3H 5MI0B 1FL3A 5F1IB 5IV2A 3GXIA 4PP1C 3SCSA 1HQRB 4QFUA 4UOQA 4G6JL 3PGCB 3INUH 4BA8A 2YPLE 5JLZB 1E73M 3PWJA 3CU1A 2EYRA 2VCCA 2VWEE 3OJ2C 2VDPH 1CK0H 1VACB 2EO1A 2DGAA 2LU4A 5FKAB 3WL1A 3VFGL 4AK1A 2C7FA 1LMKA 5KS9B 5I1GH 1F4YL 1YQ2A 2MKWA 4QRRE 5E95B 5A94A 1I9IH 3T04D 5TH2B 4HK3N 4JL2A 5HVGB 1OAUL 4W4NA 5CCKH 2OZ4L 2ZOXA 2HJFB 4PRNA 4OJFL 3KYMA 3ULUC 1T1ZA 1ED3A 4PJ8C 4WI9A 25C8H 4R97C 1AGDA 4P5MB 3O4LD 2GIYA 5JR1L 4PRHE 4PMYA 1BIIA 2VSDA 5E00A 2CUIA 5KANI 1IM3A 1KCSL 2XXMB 4IRZH 4OGXL 1M1SA 4HPYL 3F12B 4BK5A 4WUKL 2NY5L 2QSTA 1U3YA 4JZOA 4NFCA 4PUBH 3ZDXE 5CJXA 3SCRA 1R3KA 5JXEA 2ESVB 1F11A 4CAGA 5ISZE 2FBOJ 1NCUA 5GS1A 1HNYA 3WEOA 2J8UB 1NMAL 3MO4A 2W38A 15C8L 3ILPB 4HBCL 3VXSE 4R3SA 3MZTA 1YNTA 3QHMA 4LCCC 4NWUH 1UC6A 3K3QA 5C08A 4IMLB 3VJ6B 3ECQA 3WUFA 1L6ZA 5E1AA 1E0VA 3PF2A 3KEHA 2XWTB 5J57B 3NFPB 1NDGB 3MNVB 2NSXA 1P4BL 3RPMA 1X7QA 4UTBL 3O4OC 5IFJA 1DWFM 4WJ5B 3EIFA 3QIUC 4EVNB 4OF7A 3P2TA 3QG7H 3MLTA 3TBSA 5K9JL 4X7CC 4P59H 1ZLVH 1JGEB 3KPMA 1WV7T 2YZ1A 4HIHA 2R2CA 5I75C 4CD8A 3BRGC 3MMEB 4P5TD 3VINA 1E56A 1D9KB 3SUSA 2F5BL 2X7LA 2HISA 3N18A 4UQ2B 3QWQB 1YEEH 5IBLD 4AYFA 3BEVA 3SKJL 1SYVA 5GISH 5D2NC 5CIPA 3CDGA 3X14B 3OG2A 4PJBA 3LKRA 1BAFL 2AK4A 3OKEB 1XRVA 3RO8A 4PB9H 1KJVB 1H8NA 3MRCA 3LV3B 1O5DT 4GAFB 4EUPG 3OPZL 1EFXD 1X7QB 2MANA 2L7JA 1QPKA 3EDFA 2EXWC 5FYJH 4D6HA 2F8XC 3NCYP 3QFJD 2CYGA 4NQSA 4P2OC 1IAIL 1KBGH 2W5FA 5GSVA 2AAAA 1X5GA 1AGBA 4HXBH 4Z9KB 5K9KB 4U1SB 3CFIC 3UZVB 4WV1C 2MQCA 1CGVA 3TYFB 1CECA 2E9LA 5I23A 4I9WE 5H2BA 5E9DA 1I9EA 4G8EB 1FYTA 1X4XA 4HKJA 4C4KT 4CJ0A 4P46D 5EH1A 2GSGB 4YX2H 1UR8A 2ID5A 1AR1D 2VDML 3CZFA 1RZJL 3I9GH 3RZCC 4M1RA 1YC7A 2YC1A 4B3KA 4XC3L 4Y16C 4X6EB 3SCMD 5J6GA 1IFHL 3WH9A 3OXSB 2VC2L 1YEEL 2DQTL 1B2WL 1CGUA 5TF0A 4XV0A 3SCWA 3NACH 5I2UA 1PY9A 5MEOB 5EZLB 3JTTA 1VFFA 5EUOA 4CKVX 3KAAA 1X5LA 3H42L 4OD2B 4XCEA 5CZVH 4U6TA 3WD5L 1UFUA 2N4IA 4FMKA 3UTQA 2YRZA 1EGJH 2ZG3A 5IK3A 1M7XA 2D9CA 5EUKA 4AH2B 3V6OE 1RZ8B 5F7YC 2DIBA 3HE7A 2OSLB 3JV4B 4WKAA 1JF1A 1WIOA 1TQCB 2QADC 4MCYB 3SKOA 5F9JB 2AXGB 3O3AA 4PB0L 2FO4A 2YPVH 2ZKHH 2ZXQA 1Y0LA 1J0KA 3GTNA 2HT4C 4NC1C 5F9OL 4ZE5A 3WUZA 1IC4H 1L4IA 1Q9WB 2WNGA 4PRPE 5IV2B 2W66A 5I3DA 2YKLL 3O4LE 3MV7B 4N8VB 4DUWA 4L4TA 3H3KA 3CPUA 1JI2A 1K4CB 5E2TL 3L1OH 4K2UL 2DIEA 4GG6E 4Z7WB 6CGTA 1DQLL 1ISZA 3QWOA 5EBAA 4HKXA 4ZUWA 1KXVA 1U92B 1RZ7L 5A6BA 3IJYB 1KCSH 3BAEH 4HGKC 3W28A 2OJEA 2FNBA 1LP9B 4OFIA 1HI6B 1LNUB 3WHXA 5I30L 2W67A 5J12B 4XUYA 5C0BB 4A6YA 3S97C 3RCNA 4MD4B 5I8EB 25C8L 5C6TL 4JPVL 3VFRB 3LKOA 2LQRA 4B53A 3VIGA 3GGWA 5IDIA 1AQKH 4ZAKC 4YE4H 3HG1E 2P5ED 3QWRD 3BGAA 3WIIH 2JEPA 2EECA 4EDXB 3D9AL 3CFDB 4JDVB 3GSOA 2D4FA 3H3PL 3FONB 4ZAKB 4ZFGH 1NCCH 3L3HB 3CGTA 3DO7A 4Z0BH 4TULH 2BVUA 3L7FA 4R4FH 3P4NA 3KPNA 3KL5A 1H0DA 4HIEA 3GBDA 2CKBL 1V3JA 4KAQH 2NY2D 4WTWA 4X80L 5A2LH 5GS1B 3UXFA 1JFHA 1S5HA 2B31A 1NEZG 2MHAA 2WZPD 3WN5C 4FNLL 1G7LA 5SWSD 3FHQA 4WW2F 1NWUA 3PZQA 3NN8A 4PJHE 5JPMB 4PY7A 4Z7QE 3TTYA 4HKZB 4D9RE 1JF6A 2CDEB 5F72S 2FX9H 3PWUA 2I60H 4NJAL 4Z2KA 5FUZH 3SDCD 1H3XA 4PTUA 4QRPB 4XPAH 2VDQL 1J1OH 2YPVL 2ZKHL 4NQCA 4YUEL 4QRRB 3WDJA 3AB0B 1LP9E 3BAKA 2AJZA 1V0KA 3TBSB 2XFRA 2ZWLT 4W8BA 5I24A 3ZKSD 2G5BB 5E0QA 4X80H 3RVXC 2CIIA 3RPKA 1VENA 4AM0B 2YIHA 1LO5A 4Y1AD 1BVKB 4UNTA 1BFSA 4WWKC 3NIYA 3RDTD 4NZTL 1JGUH 3H42H 2Y2WA 4RWYH 4M1CC 1B6DA 4Z0BL 4MQXD 3AU1B 4HSQA 2EQDA 4F8XA 3P4OB 3UJJL 3UTTD 4F7MA 4HT1L 1BAGA 4RMVA 3ZE0F 4ENEC 4M9PA 1RJCA 1E4XI 3NYDA 2UY2A 3VXUB 4O00A 3ZYJA 4N8PA 1KFAL 2FX8L 5C0IA 1JZ7A 3WCYA 3ZDZE 3I85A 1EZVY 1UXSB 1FJ1A 3CSGA 4YX2L 3JBG7 4MX7A 4CW1B 1E4JA 5BXRA 3BOVA 1T7WA 1QSEE 3FO1B 4L3EB 4XNYH 3MRPB 4YPGB 4RL3A 2AEQL 2BNQE 2GT9B 3I50H 5C07E 5DRNA 4OZIF 4UAOB 3OGCA 5CUSL 1LE9A 5L2KA 4PMVA 3QOKA 4WW2C 1FVDB 4K3DL 3SGEI 3QA3B 5EB8A 2QQQA 4XVTL 1DWIM 1DLHB 1GOHA 4AYSA 3QPQD 3UR7A 1CDGA 1MAMH 3FN9A 3D39B 1GGBH 4KVCH 3U83A 4M43H 5L0QC 4YHPA 4GZEA 3LSOA 1VDGA 1IC7L 4ODSH 3F5JA 5HXMA 3SE8H 1Q0YL 2CESA 3S37H 3WKZA 2ZOLA 3GSNH 1VADB 2XWEA 3RWHB 4EI5B 4P0DA 3Q1SL 3OKOB 1OWWA 3MLXH 4MA8H 5DWUH 4WF7A 4QHLB 1R3LA 1DBBL 3GNRA 1BPVA 5FM5O 4Z7NF 3FQNA 2Y72A 3FQWA 4XCEB 3OIHA 2G9HA 3BPNC 3IDMA 3N1MC 5D9OA 5IJVB 1MCLA 5C0RH 2W60A 5DZOA 2YN3A 3W6MA 2J6EH 1RHFA 1MQKL 3P0YL 1AI1H 4YHGA 3N17A 4P46A 2OSLA 4N9GB 1H3UA 2QPUA 2WUCH 3N9GH 4TVPD 5FCUH 5ICXA 3WJJA 3CDCA 5I9QB 1TXKA 5D7JA 2R29L 4FFZH 2E9MA 3O3AB 3LN5A 3MRFA 5FGCB 2B4CH 2DT1A 1WZKA 2HLAB 1HYRC 2UWEE 4MJ6A 3EOBA 4Q6IB 4YFEA 2FEEI 5B22A 4ODWB 2NY6D 2ZWYA 3BVNB 1KGWA 1R3LB 1QVOB 3L5HA 1YYMH 4NC2B 4AZ6A 5IB1B 3VFUB 2RHEA 1U8KB 15C8H 3FQTB 3NCJH 4PJDE 4N0YH 4LPYA 2WCAA 4RCAA 2G9HB 4HXBL 1A5FL 1MOEA 2CIPA 2WSPA 1JDDA 4L8SC 1CI5A 3RJYA 3WFHB 3PGDA 4Y89A 1ZLSL 2XQYG 4WEMB 1E4LA 2WMKA 4HHAB 5B38G 1WBYA 2EDDA 4EN3A 2LU7A 4KK5C 3U7AA 3RUGB 3HAEG 5F7UA 2FWOA 2E6PA 4WCYL 2J4WL 2A6DB 2NW3B 3RZWA 4D0DB 3TESA 2ZICA 2FR4B 4EXPX 3O6MH 4ZFMA 1HKFA 1A6WH 5FFLA 4DN3L 2JJWA 3GSOB 4KJQC 3IGAB 5FO8A 3T3PF 1H3PL 2PBOA 4LGRB 4UIKL 3TOPA 3BSZL 2FLBT 4Z7WE 3VCLA 1CFQB 1AO7A 1KR0A 3M6DA 2CETA 1OF2A 5CP7A 3T2PA 3LQZA 2BSRB 3QEQB 5CINH 4JFYA 4NNYA 2XICA 2CHNA 3DGGA 1CBVL 4Z2JA 2DKSA 1S7WA 3F7QA 4YDVB 5B39G 4DEPB 1QA9B 4QOKE 3VRIA 2A6KA 2YD5A 3D3VA 5KZCD 4UQ3B 2EKSA 2IANE 4D0BB 2BFVL 3CCHB 4JHBA 3RKPA 3X12B 1CFSA 4FHBD 4QRRA 2L7UA 5EUOF 3Q0HA 1NKRA 3CUHA 4KTEH 4NZUL 5BS0A 2FHCA 4W5UA 3HE7C 1DHKA 2VSCA 1Z9MA 3REWA 3EJJX 1BQHB 2MPAH 2G3NA 3MCG1 1LP9F 4W5ZA 4AM0A 3BFOA 4YHMH 2CDGA 1BYAA 3IJ7A 5KSUB 2NY1C 4NHCH 5D1XA 3G6JB 3OGOE 2ICWJ 4ZUSA 2E3ZA 2K1MA 5AWNH 2R8SH 4OLWL 4BH8A 2F2HA 2BJMH 3HKFA 4P3DA 4Z7QF 5EBGA 3BPNB 4MQXC 35C8L 4PRDB 2X05A 4JEGB 4QNPF 3PV6B 4PB0H 2A6KB 4POYA 3IJ8A 1I7ZA 3ZOAA 3VFTA 3AICA 1XGQB 3V6ZB 3DSFL 4U1NB 5EU6B 3ZE0E 4LLUB 4QCEA 2GKIA 2JIXA 1MCWW 1FZKA 3VDCA 4XXDB 1P4LA 1PZ5B 1YECH 5ILTH 4YJZL 3MFFB 1FFNB 1OT1A 5DURD 3T4AA 4JB9L 3CZGA 1SYVB 5HGGS 4DVBA 4FFYL 4GQRA 5IVZA 2Q8AL 4MB3A 2AK4B 4PUDA 2I07A 2UZIL 1OW0C 2EC8A 4XP4H 4PJGB 2ENYA 2HJKB 4I77H 5CAYB 3AISA 3AREB 3EHBC 1ZGLP 1RUQL 4XC1L 5HYJE 5BJTA 1NP2A 3QOMA 3WN6A 1NFDF 4P99A 1JGVH 4D9RD 1WDQA 5HYFA 4LLYA 2IG2H 3ARFA 3BZFB 3SDDD 1H5VA 1L7TL 2HRPL 4TVPL 4KH2A 1OARL 4I48A 2H45A 2UUDH 5DR5H 4CMHB 3EFDL 4MNHB 1BM3H 1C5CH 2DQDH 3QDGA 5F9WB 3W27A 4PJFE 5GSRA 1UEMA 3RY6A 4U49A 5HI4D 4I5BA 1ES0B 3L7EA 2BMKB 3ZLQC 5H94B 2F61A 4ODVL 4JFXB 1L7IH 4HU0A 3D0LB 5GS0C 4X8JB 3VNZA 1ZSDB 3GBNL 2YK1H 4MNQD 4P3CL 4TUOA 1LWRA 2B7DT 3EFDH 2BVPA 1J1XL 1YNLL 3NA4A 4X4MA 4KXZI 3P4LA 4U1KA 3F8UB 5D9SB 2B20A 4Y5YA 5D7IE 5CBAB 1ZS2A 2E27L 5F88A 2AK1L 2YL8A 1JHLH 4PJXA 4ZSOA 3RILA 3KPLA 1JNLL 4I5BB 5TQ0L 3K2UH 2OR9L 3BWAB 2ITCA 1VA9A 1OM3H 4LKXA 2PW2A 1MJ7L 3NMEA 1T5WA 1U8PA 2H1PL 1JBJA 1BBJA 1WKYA 1OCWL 3BJ91 2EIZB 1FP5A 5JNYA 3EJYD 1QI0A 3A6BH 2YWYA 5EIVA 4EOWH 5EOTB 2EPLX 4S1RL 5IMKB 3V6OC 1RUML 4ISVA 3VG0H 7FABL 2D23A 4AZ5A 5T1KD 1S7VA 1AKJB 5KSAA 1IRAY 3RPIA 1WWAX 1I7UB 4JQVA 1QOXA 4GO8A 1T2JA 1QACA 2KPNA 1BQSA 5I71B 4QOKA 4Z7UB 4PTVA 4K7PL 2C8NA 5KEZA 2VLME 2H2SC 4U6VH 3T8XA 4BFEA 3P40A 4LSUH 4QY8B 5I1DA 1AO7B 4MAYC 4DCQB 2Q1EA 4PLOB 1Q72H 1D2KA 3BLPX 2WWMC 4XNMA 5AWNL 2R8SL 3LQZB 3HLAB 1NUNB 5KTEH 1U8MA 2AJUH 2ZG1A 5GS0H 1EHXA 1I7TA 4XMKL 4AY1A 2OWXA 2PC8A 4KGJA 2HVKB 4PJHA 3QZWA 4APQC 3QIBC 3N06B 3X13B 2APVA 1BM3L 2DMCA 2MCPL 4WEUD 4UFLA 3AY4C 4ZO7A 5E8NA 5CXPA 3QJHB 1SJHA 2YHGA 2XYLA 3R06A 4NPYB 1CDBA 2B4CC 2PI6A 4GW4B 4X9FA 3GMRA 1R87A 5DQDH 2EYRB 1CWVA 4WI7A 3VFSB 2C7UA 2Y5EA 1DDHB 1HOCB 2GK0B 1K3ZA 5FCZA 3TVMC 3VW3L 1KJ2A 4UQEA 3KXFA 4BSVB 5GZOC 1XF2A 3GMQA 3J8F7 1VHPA 4JFDD 3B2VL 3TT1L 5IHUL 2HRLA 3C60C 3G08B 1T6WA 1AQ0A 3DUSB 4KPHL 4P9MH 1ZB5A 2E9WA 4Y8AA 1E4WH 3LMYA 1BBDH 3MV8A 3SDDC 1A7NH 5GHWH 1AI1L 1TJIL 4HKZA 2J7LA 3QQ4A 4W8LA 4PRDA 4ORGB 3B5GA 5B38A 4OZFB 5HGDA 3CO4A 3VXMD 4MNGA 4PD4J 4PGEB 1QBML 5FGSA 3WXWL 1WAAE 3OMZA 1YEGL 4GW5B 1KLUA 3GJFH 4JFPB 3GJEB 1JPST 3PZ9A 2BRRL 1MAJA 3BUYA 4NQUA 5LGJB 5D7JC 1KELL 1OTUD 4WV1A 4R8WH 2JIEA 4GXUN 4ODXA 1ONQB 2IAMB 4LSTL 5L9DL 1OD9A 5I1KL 1S7UA 3WF1A 3QEQD 3RDTC 3EOTL 1AC6A 1EK3A 2D7OA 4JM2C 4YHML 1W3KA 1M7IB 4K23L 5DDHB 3C5SA 1NARA 1KGUA 1I8LA 2MSPA 5ACMA 1K4DB 1A0QL 1G7QA 4D2NA 1DP0A 3SGKA 4WJ5A 4TVPH 1KWGA 5DRWA 1B3XA 4HUXB 3LS4H 4KK9D 3F5WA 2F58H 3LDBC 5I16B 3M17A 5C0GA 3QQ9C 5HYSG 2XFYA 4HLJA 4PRPB 3IDXH 3MMEA 4OCMC 3QULB 5EO0A 5SWZE 3D18B 4WV1B 4L1DA 3RI5F 1KCUL 3BLKA 1XZ0A 3L4TA 3HHRB 2WMJA 3MROB 5EZIL 2WZHA 4UQ2A 2JB5H 4RAHA 2H26A 3NSMA 1AGCB 3KPQB 3OAUH 3MRDA 5D8JH 1EOKA 2D2OA 1FZJA 4UIMB 1YECL 3EFFA 3BD4A 4HS3A 4X7EC 4PJ5D 1MWAH 1H8OA 2KH2B 3KPTA 5IMMB 1EQPA 2Y6SC 1DEDA 1G9HA 3R0NA 3RVWC 1NDMA 3MA9L 4Y88A 3UEZA 1QEWA 1FL5B 4OIBA 5A6LA 1A1OB 3LD8B 2FJHA 4YGVA 4DN3H 1D5MB 5CG0A 4JVUA 1U8IA 2W9EL 5FDWB 1MFVA 2NY3C 2I60L 1NC2A 1MCPH 3MLYL 2F8QA 3D6GA 2BJML 3UTPE 1H5BC 4F3FB 5DURB 2EYTA 4XB8A 3HPJB 3MRNB 4L8DB 3WSQL 4OCRL 1ZKAA 4XI5C 3L95B 4NRXB 1NGPH 3BT2L 2GSIA 3Q5OA 2AK4D 4UTFA 5TQ2H 4XRCB 3D48R 1A5FH 1EXPA 2J75A 3SJVD 3MLZH 4NZUH 4AD5A 2NY0B 4KTYA 4NM8L 5IB4B 4JZNB 2CKSA 2P5WA 1XIWB 3KLHC 4G3YL 1EA9C 1G9MC 4H8VA 4PGDA 4YDJA 2ZJSH 4PEEA 3WQVA 1JGLH 1OIMA 3MRKB 3BHBA 5I19H 4RNRB 4PJ8B 1QW8A 3H3PH 4LPXA 4OCXL 4QHKJ 3MC0A 3QHZL 4U33A 3VVGA 5KZ6A 3WN5A 1MRCL 4XMKH 5DK2B 2CR3A 5ESAB 5KTEL 5C6TH 3W5MA 1LO2H 2DQUL 4IRJB 2NX5D 2ARJQ 2OYLA 5GJSL 1T3FB 1ZHNB 4K7FB 4G7YL 1QQDB 2BSSA 3LRSB 3MMWA 4H1LA 3GBEA 1CVSC 2NR6D 4E5XA 4G9FD 5SWQA 1Q9WA 1OWQA 2OK0H 4KJWC 4JFFD 4UR9A 4FQ1H 3FQUA 3DMMA 5TF1H 2W91A 2VXVL 2DN7A 1ACYH 1ISYA 1G84A 4Y2DB 1CGYA 4BKLB 5FUZL 3KWWA 1QSFE 1CDUA 4OZGB 1ZTXL 2EO9A 1IC4L 3HNVH 4MLSA 2Y8KA 5EC2A 1CFTA 5FGCE 3G04A 5KVDH 4XHQA 3MV9D 3GMQB 4OZHE 3LEYL 4JHAL 5D9MA 4ERSH 5JIWA 1ZK9A 1L9MA 3OF6D 2AXFA 4M5YL 2EEBA 4KVNH 4OCSH 1CLCA 1GC1L 3V4VH 4TRPH 5DQ9B 1VKXB 3PHOA 4YHZL 2GEEA 5SWQB 1HJQA 3KHQA 1BQUA 3IFOB 1MQQA 3VWKB 1W3LA 1VFBB 2LFGA 3GI9H 3SQBA 1FNGB 4GW5A 1ADQA 5T1LA 1QO3A 4P7NA 4KRPB 3PG2A 1II4E 3WEXA 1A7QH 1ERNA 4WFGD 1ODAA 3UJJH 1RIUL 4WSJA 1FL6B 3ZYOA 1U8HB 4AEIH 3QXVA 4QT5A 4AMKH 1TA3A 3UO1L 5ABDE 1H41A 3UC0L 1RZJH 3MRIA 4U1GC 2VOTA 3CBWA 3BDBA 3V0WH 5KAQG 3BIKA 4NKMA 4NO0D 3SDAC 2BNUA 4OCYH 1MHHA 5C09D 2UWFA 2UY6A 4BSWA 1LD9B 2FSEB 4WU7A 5ABEA 2OXGA 3KJ4B 3U6RA 4G6AD 4M8UA 3BZ4A 3PGFL 4NQCB 5DXWA 1E9LA 3NGBC 3O45B 4X6DB 3GHEH 1OTSC 4X9YA 4TSBL 2JFEX 1WZAA 4TOQA 4PJCA 5D6CA 4HZ8A 2AP2A 3W5NA 1TMQA 5FYKL 3P11L 3U4EB 1TQBB 3VFWA 3ZE2F 3JV0A 1LEIA 1AGFB 1HH9A 2WYSA 4PRPA 4K9EC 5EO1A 3D3AA 1INEL 1G6RA 5EO0B 3DIFA 4PRIB 1IQWH 2FJFB 5FYJD 5FYKE 4XVTH 1CGSL 1Y7VA 3ZDYE 3RWDB 4E41D 4IJ3B 2H3NB 1V6UA 3W2DH 1XGYH 4PMXA 2YKKA 4F7MB 3U9PL 1TVHB 2V5RA 1O6IA 3KYOB 1V7MH 4RGMC 3N1PC 1OIFA 1JI1A 3NDZA 4WU7B 5IMMA 4RDQF 5E6YA 3MYZA 1BZ7A 3VIPA 4CUCA 3AHVA 3GBML 4ODBD 2Z1KA 1EEQA 1E0XA 2VC2H 3FL7A 2IFFH 3QGVA 3OKMB 5I76B 4AIOA 5ICZB 2IADB 1SMDA 3CUGA 2A74B 2OP4L 5GGRY 4NJ9H 3UCRA 4EUPA 1GQKA 5IVOA 3MV7E 3STZB 2ZCKH 3C8KA 4JM2D 3BP6A 4LCYB 3VI3E 4IEFB 1R3JA 3HZKA 5DD3H 1ZT1B 2BOCA 4P5TA 4PG9A 4I2XB 5IMOA 1E1FA 3WEMA 2WQRA 1ZSDA 3U7WL 4Y5XA 5GGUB 5KW9L 3A6OA 1UQZA 4ZEPA 3PUCA 4D3CL 4U1IB 2NYYC 2D7MA 1G9ML 2OZ4A 4HGWA 1R3IH 5D9SA 2GFBB 3CHEA 1HHHB 1C12B 2VXSH 4JKWA 2D0GA 3FT2A 4HOWA 4TVCA 5ITFA 1FNFA 2OX5A 3DRQA 3GSUB 4N8CL 2N1KA 1SYTA 5IJVA 1NC2D 1WWCA 4R7DB 3N85L 4LXFA 1X5KA 1BGXL 2YBTA 5FHAH 3VFMA 1TTFA 4I0CC 3HZKB 1ZVSA 5KVGL 5JDJA 4KAQL 4WO4D 2EZ0C 1MVYA 1F4YH 4JKLA 4Y5XB 2X8RA 1IKNC 1P2CB 3H9YA 1NBZA 2XKSA 4PJ5E 3PNWB 4MJ6B 4ISVB 4TULL 4UIKH 2WUBL 2J8HA 4WY7L 5DGQA 2BY3A 1DQML 4D71A 4Y5VC 2AABH 4KDVA 3PZMA 1P4BH 3T8XB 4PJ9D 2A3AA 3LQMA 3C5ZA 1K5NB 1X5AA 1U91A 2RB8A 4LCWD 3CH8A 3JUYA 3AROA 1TVNA 5I1IH 5HHMD 4MJ5A 1ZVSB 3SDXB 1Z32X 5KVFL 3O2DA 4ZPVB 1A4KB 3PGCA 1Q4NX 3X13A 1A6PA 1U6AL 5JDSB 2R0WH 4H25B 3ZHDA 3M46A