3TP4A

Crystal structure of engineered protein at the resolution 1.98a, northeast structural genomics consortium target or128
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
465
structure length
454
Chain Sequence
DETIAIVDADATAETRSLLSYLDGVRGEGILFGHHGTTSSGLTTGPTDGTTSDVKNVTGDFPAVFGWSTSIIEGNQRPGLAENTRDENIALFADYIRKADAIGGVNTVGAGVENFVTGGSFYDDTLRAVLPGGSHHAELVAYLDDIAELADASRRDDGTLIPIVFRPWHENAGSWFWWGAAYGSPGEYQELYRFTVEYLRDVKGVSNFLYAWGPGGGFGGNRDVYLRTYPGDAFVDVLGLDTYDSTGSDAFLAGLVADLRMIAEIADEKGKVSAFTRFGVSGGVGTNGSSPAQWFTKVLAAIKADPVASRNAYMETGENADAGQHFVPVPGDALLEDFQAYAADPFTLFASEVTGAFDRTVAAAPAQPVVHIASPADGARVASAPTTVRVRVGGTDVQSVTVEVAQGGTVVDTLDLAYDGALWWTAPWSPTYTVTATATTAAGTLDVTNEVAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords computational Design of Enzyme
publication title Design of activated serine-containing catalytic triads with atomic-level accuracy.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Structural genomics, unknown function
total genus 153
structure length 454
sequence length 465
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tp4A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3tp4A01
4C56B 3JWDL 2NXYB 4CVWA 1TR1A 3ARDD 3RL1A 1K8IB 4W6XB 2B4CC 5BMFL 1ZA3A 1E4KA 2VCCA 3ILQC 2BSRA 4L4TD 4LEXH 4R2GC 5D1QD 1FH5H 4N0UA 2YK1L 4M8QB 2PTUA 4OM1L 1HKKA 3WHXB 1BG4A 4MJ5A 2D7QA 2O61A 1BFSA 4XVUC 4Q7DA 4JFWA 4Y4FC 3VFWA 2GSIA 4N1HB 2B0SH 5I75C 1OCQA 5MHSD 4L4JA 3RWDA 3O11B 4N9OB 1OB0A 3KPSA 5D2LA 4WFGD 4UV7H 4PJ9C 1NFKA 3BCDA 2AAVA 3SE8H 2O9OA 5E2JA 1NL0L 5EWIL 5I5RA 1WSST 4KXZI 2B39A 1KT2A 4NYLA 3VWJB 1K9EA 1FCCA 4P5TD 4Z7NE 1RZ7L 5I73C 3TM6A 3PWLB 3QHNA 1UCTA 2X41A 1DQLH 1WCGA 3H9SD 3QG6A 1UWXH 2FO1A 1WFNA 3ULUC 1FG2A 2WHKA 1RUML 4JLRB 4YGVA 2Z35B 3HKFA 1ZLWK 1F4YH 4G6KH 1GOWA 4HPHA 5IB3B 5LXGL 1A3RL 1MF2L 5CEZH 4U2ZA 3PV7A 2XKUA 4PG2C 3ZT5A 4MJ2A 1VJZA 5IHZB 2FJFA 4L3AA 1OL0A 1XCTB 1YEJL 4GZJA 3F4VA 1WQVT 4X7FC 1KXHA 5J6GA 4TX6A 1H3GA 2G2RA 1MCHA 3THCA 1HIZA 1X1NA 3P4OB 4MSWB 1YC7A 4HKZA 3RDTD 1JI2A 3D25A 4LDEB 4PJDE 1WZMA 4QCIA 4BSJA 4JO3L 1KN2L 4OBRA 3FQWA 4M1CD 3SDDC 5MENA 4PJAB 4IBLT 3MFFB 4XNXH 3SDAD 4AY1A 3O2DH 4KJPC 1WTLA 1L7TH 3RL2B 3L4WA 5IFPA 2RHEA 5IB5A 2VN7A 2WBJD 4LGPB 4YNYB 4PY8J 3S37X 2NT0A 2X70A 4HGWB 4JFUA 4H26B 5I15L 4MD0A 1AXTL 1GGIH 4M8VA 1W72A 3B9KA 3BO8A 3MRGB 2WVUA 5F7UA 2UVFA 2XG4A 4OCXH 5GGTH 1BOGB 4KK5C 2YPKB 3QUXA 3UG4A 3MR9B 4PJCA 1ZV5A 1F4WH 5CINH 5IFHL 3A4XA 5HPCA 1XIWC 4FQ2L 4JAMB 2FECI 1YNKH 5E6IB 5SV3A 5KSAA 1BQSA 1PAMA 1K4CB 3VH8G 3W39A 1W8NA 1VRXA 1Y18B 1CE1H 2X9XA 5CWSB 4OZIB 4IRSC 3V4PL 4OD3H 3DNKA 3WFDL 4FQLL 2DQXA 2NY3C 1S9YB 3GMQA 4JFSA 2HTLD 2W65B 2XKNA 1HNYA 2W92A 2FD6L 3WCYA 4OF7A 4U49A 1KPUA 2HTKC 4RBPK 4BQ3A 4R0LB 2FIKB 3M1BB 4FS0A 5FA4B 1UXWB 2OZ4H 1S7VA 3MZGB 4JFDE 3MUIA 1SVZA 2W59A 5E00B 3I3BA 1ZHBB 4YE4H 1FLRL 3WE6B 4Y16D 1UUQA 3WDQA 5EBWA 5FYKE 3GSOB 4EAMA 2Z4QB 4R5EA 4LVOC 3ZR5A 4WEBL 2ZUSA 4XZWA 2VJXA 4EIZC 3ZJ7A 4MWFB 1UG9A 4APQD 4CRPA 3HI6L 2VR4A 2ARJQ 4HZ7A 1MVUB 3D18B 4WU5B 5CEXA 4HK3J 3SKJH 2VZ3A 4KMQA 1JPSH 2NYYD 3REWA 3HAEG 4NSKA 3BXNB 2XVPA 1KFAL 3B6SA 5EZIL 4PJBB 2A73B 5GS3A 4D1IA 1IAIM 3GBNL 3JWNC 2YRZA 1EZVX 4WWKA 3GSRB 4PP2B 4XP9H 2AV1B 3GNMH 3C8KA 3QHZL 1Z9MA 3C5SB 1XR9B 2OR9H 4PJXE 3C5JB 1MY7A 5IMMA 5ESAA 3WQ4A 4MJ6A 3MLTA 3SGEI 4DK6A 5I8EA 1F8TH 3HZYA 3KXFB 5DA0B 4OGXH 3B9DA 4YQXL 4XH2B 3AXHA 1DUYA 4JFEE 3LH2H 1QBML 3FB8B 1RJZA 4QP0A 1KTDB 1XSJA 3GSNB 4RDQF 1P1ZA 3D9AL 3WN5B 1G9HA 1DQJB 3MLYL 1JTPA 3Q1SH 3MQIA 1ZT7A 4EN3A 3FO0L 5CJOH 2C4XA 3HMXL 3OAZH 2BDNH 2RB8A 2J2ZA 4FQIL 1JHTB 2AJUH 2OYMA 3N1GC 2K7PA 2ENSA 3LPWA 1Q9OA 1QR4A 1E40A 1BLNA 1LO5B 1S7TB 1U8MA 1D5BB 3JWDC 1XH0A 3C08L 4XXDA 5K93A 4XBEH 4P3CH 4CMHB 1FBIL 1MI5A 3ELAT 1W3LA 1IM3B 3OXRA 2AXGA 5FAAA 1UA6H 5DRZA 3R8QA 1CGTA 1HH9A 3QIUB 3VFTB 4Z95L 1C93A 2VH5L 4FNLH 2YD9A 3MLZL 4KY1H 4XGZB 1M71A 3IU3B 3O0RH 3S3SA 4ZFFB 3IDGA 3S9DB 3REVA 4ZS7H 4M03A 2V5SA 1G9NL 3PQYB 3ZLQC 5DRWB 1UQZA 4MJIB 5F9WC 3W5NA 1BD2A 5JORA 4HWBH 4KTEH 3MRFA 1R8LA 1YEGL 1CDYA 2L7UA 4Y4FA 5AUMA 5C07D 5LG1A 2PR4H 2J8FA 1NC4A 2QQNL 4Y8AA 5FL0A 1IM9B 5JW5B 3TIDA 4JFDD 3ARFC 1A14H 1KGUA 3GBEA 2J5LB 4PJ9A 4JM4H 1V05A 3RTQB 3VFPB 3L5HA 5E2UH 1U58B 2BX5A 2VZUA 1DEEB 4KAQL 3U1SH 1NCDL 5FYKD 1TVNA 4QXWA 1HIMH 5GRUH 2CETA 3IFNH 4X8JB 3EMCA 2DQUL 5C0BB 3PWJA 4OV5A 5C0IA 3N12A 4OIIH 4K94H 1OAYL 4RWYL 4GQPH 3ROOB 5CZVL 4J8RA 3HG1B 2XY1A 3U0TA 4AZBA 2ED7A 3QA3B 1KLGA 4WI7A 2R8SH 2AV7A 3EOAB 4XB8A 4U6YA 1X5IA 3PP4H 4Y7EA 5FUCE 5J06A 1X4ZA 4XPFH 4Q58C 2FLRT 4A3HA 3B3IB 5SV4A 4MNKA 2LU3A 2PYEB 2UV3A 4YK4C 1PZ5B 1YJDH 5DUBB 4MVBD 4X6CE 5GRYA 5C71A 1AVAA 3FO9A 3T2NH 2NY5L 4QRUB 3H42L 1H41A 4PG2A 1S78C 4AIEA 1RPKA 1CXHA 1RJLA 4MCYB 2C3GA 4WI2A 1J1OH 1QRNB 1OM3L 3VJ6B 2NY4C 4XI5D 5BQ7A 4JO1H 1LNUB 4ODXB 4BZ1L 4EIGB 5IF0B 5C0JA 3HNTH 2ENYA 3WO3B 5IVZA 5AWNL 5H37H 3TA3D 2CO7B 4QRRE 3KYMA 5SWZA 3SDDA 5LVEA 2VDML 1UXSB 4NUJB 5ACZA 2DIEA 5I1GL 4K7FA 4IISA 1Q4NX 1FGVH 3TBYA 2J7CA 3GJFB 2MCG1 4NF7A 5A2LH 4G7VH 5GGUB 5L88L 1FYTA 3HE7D 4K7PH 1SHMA 4TOYL 5IB1B 4O2EA 3U9PH 1KELL 3L3HB 1YQVH 1QFWL 4ELMF 4XZUB 5F3BB 1IGCL 1MCCA 4QYOA 5F7NC 3S98A 3WUWG 1F11A 2EDBA 2Q6WB 3U46A 4PRWA 4PYGA 1IC5H 1SJVA 1XIWA 3HUJA 3QEQE 1YPZE 2ZCHL 5IMLB 2VLKA 1NMAL 4I4WB 5D1XC 1E27A 1FFNB 3CC5B 3LN5A 3O6AA 1EK3A 5BXTA 2AJYH 4IRSA 5C6WH 1FORL 4I3RH 2FBOJ 4PRHE 1Q6EA 4JY4B 5MEPA 1CDUA 4F7EB 3ULSB 4KDVA 4YPGA 5IVXB 1OAZL 3RGVD 3QQ4A 5GRZA 2ICWJ 4ZFZB 1BOYA 4OZFH 2ESCA 1MLBA 3WF0A 3MGTA 1JGEB 3G6JE 3PJSB 1G6RA 3X14A 4AZ8A 1FAIL 1KIQA 2WMIA 2YMXH 1IQWL 1KB9K 4RFOL 3QRGL 3QUYB 1OBAA 5E2VL 1AE6H 4MXVE 1CIDA 1FO0L 3LKNA 1DN2A 4PJAF 2XA3A 3EJYD 1JNLH 3SJVD 2JELH 1LK3H 5DQDH 4CDGC 4BKLB 1NGXB 1V3HA 1GH7A 2IAMD 2GFBA 3EYQC 1I3GL 2YS4A 3TYGH 3DARA 1JUFB 2XPGB 5HOSA 5F71A 4U3XA 5TDPB 4JY6B 1HXYA 1NGPL 3G5VA 3EOYG 1FHDA 4KZDL 4XVSL 3SCPA 1OWRM 3Q2CA 2G9HA 4U1KB 5D2LE 3ARBB 4RMSA 4DZBB 2ZX8A 2P24A 1J7VR 1JHLL 4JY5H 3TO4D 2P5EE 1OGGA 2A6KA 5B22A 3I3EA 5CILH 3ROLA 1QHPA 3FQRB 3LS4H 4HZLA 3WS3A 3GMOA 1QG3A 3FT4B 4MA1B 1X5KA 4LSTL 4PJ8A 1IAIH 2ICWB 3NABH 5DYOB 5C0EA 1UYWH 5DJCA 1H0IA 4J3SA 4RGNE 3BN3B 3RPIA 4MAYD 4F9LC 3I50H 5AD0B 3DI2B 3EFDH 2H45A 4XNQA 1HH6A 3WIJA 4PG9A 1CICB 4WHCA 1FH8A 2WWDA 1OW0A 2WMFA 2UWFA 1N64L 2YC1A 5DK0B 4Z7VF 2Y5TB 1RSFA 2P46B 5E03A 3DROB 4G80B 3KPRD 1A4JA 1AIFA 5D7IB 4G5ZL 4W93A 3P11L 5C0DB 1YNLH 3MA9H 3JTSB 3HNVL 3S6CA 3X3GL 2Y2WA 4TUFA 3QXAA 5FM5O 3QHOA 1QA9B 1RIUH 4I1NB 4G6ML 1GGUA 3IJSA 2X4OA 2PXYC 2GJPA 2CUHA 4BZYA 3UZQA 4NKIL 1UKSA 1E6QM 2IANA 3R0NA 1HN1A 1CK0L 5F1IA 3ZHLA 1UZ6E 4ZMAT 4NHCL 1G9NC 4RA0C 1A0QH 4OZ4B 4PJBF 5MENE 5LGHH 5LQBH 3I6KA 4YHNB 1SEBA 2DDQL 3GMLA 4ZTOL 5C09E 1TQBB 2R23A 1JVKA 2JK5A 5CEYB 4JN1L 4OQ1A 2CSPA 1RY7B 4URTB 3VH8A 3ARZA 3KYAA 2X8RA 3QEQD 2XVKA 2FJHA 2FLBT 4LSPL 2WUBL 3ISWA 5C0CD 3RWIA 3BSZL 3H2WA 4JZOB 5T1KA 3MLUL 4LFHD 1B4JL 1BGAA 3OAYH 4GO6B 3CD4A 3S34L 5DMKB 5AZ2H 4PRID 2J79A 3LRSB 4PRHD 2BVOA 3UDWC 1B0RB 5B4MD 3RHWK 4PJCE 3WXVH 1PKQE 4PLKC 1FGNL 1A2YB 4YXHH 4GLRI 4HHAA 3W6LA 1N8ZB 1J9YA 3FT3B 3QXDA 5D72L 2CLRA 1DL7L 4UBDD 2WWMD 4YUEH 4EE9A 3KWXA 2G3IA 4JFFB 4U0QB 4A4AA 2DQGL 3UPAA 3ARFA 1ZANL 5F7EH 3W5MA 3C60D 1AI1H 4J3UA 4OB5L 4YX2H 1DQDL 5GGVL 2FB4H 1TXKA 5JIIA 5IIEB 4PGBB 2WVSA 1BBDL 3KPTA 3CX5K 4OLWH 2NY5C 1B0GB 4PP1D 3ULVF 4BQ2A 4XBPB 5FHAL 3KPLB 3JV4A 2NY7L 4X7CC 5GNZA 1C7SA 3HAEA 1BTCA 4N8CL 2A9ML 2FHBA 2X1WL 5DD6B 5FYKH 3W25A 1EBAA 4PS4L 2JJVA 1YMMA 1BFNA 1ZWIB 4LNVA 1LGVA 4S1SH 2IC2A 2P5ED 2VLLB 3RVXC 4D71A 1HXMA 5FYLE 1P4IH 3HE6B 3OKLA 4G42B 3EOBA 4XPAL 4TSAH 4UIKH 2WQRA 4PMQA 3RPMA 4PJEB 5TF1L 2GT9B 2OSLA 3O2LA 4HBQA 3RKPA 1KENH 1U3HC 2CUMA 2XZCH 2NZ9C 1XF4A 4R27A 5EB9A 3AMKA 1XGYH 4R4BB 2C1OA 4Y89A 5JR1H 3RU8H 4S1QH 4XWGH 5C0AD 3UBXG 3AGVA 4CJ0A 3GH7A 2X4UA 3ZKXC 1ZJBA 1DDHB 1WBZB 5ABFA 1Z2KA 4GG6F 2GTZB 1ZB5A 1UHVA 4BA8A 2CHOA 3TNNB 2BSTA 5EU4B 3O3EA 1LEGA 4FXLA 4ODUB 4DTGH 3QWRD 5DJZA 2WNWA 3NZ8A 3CFDB 5IV2A 4GRLD 1J87A 4LSSL 4HJJH 2A77H 4PJHB 5CSYA 3DUUB 4NM4L 5DJAA 5CPTA 3KS0H 1WEJL 5HHMD 4N42A 1QPKA 4X5XA 3EYUL 3P4NB 2RGSA 4G3YH 2B2XH 3BH8A 5F44A 2XICA 2NY6D 4P2QB 4QHUA 1C5BL 1PY9A 3CBWA 1UZ8B 2Y7QA 1M03A 3EBVA 4MX7B 5KTEH 5L2KA 4Y2DC 5C09D 1BM3H 3GSVA 5CFHA 1TVPA 2XWBA 3BP6A 3MOAH 1QFPA 4OZGE 4P2RD 5JDSA 5D1XA 3RVVC 2CIIB 1H3PL 2DIJA 4NNPH 1QEWB 4PRNB 2DSKA 3IGAA 4UAOB 3DC0A 3ESVF 1Z3GL 1EAPA 1XT5A 2P5WB 1U92A 4KJYA 2VDNL 2VLME 2D22A 3L7FA 1MREL 4TSCL 4YDLC 3MJ6A 7FABL 1TZGH 4OLVL 3BP5A 5BJTA 2W9EL 5SX5K 5DQJB 1MCJA 3R06B 5EH1A 1EFXB 1HQ4A 1HXJA 4LRNH 4KDTC 2MWCA 3P77A 3BAEL 3CH1B 3V0WL 1HT6A 1M7IB 4X7SH 3MUHL 2N7AA 1KYOJ 1QI2A 2AEIT 1PFCA 1IL1A 3UTZA 1F3DH 3CUHA 3BKCH 5DR5L 2D9QB 2C7UA 3NIGE 1JV5B 4WHYH 3CXDH 4BSVA 1XGPB 2EO1A 2W0LA 1NFDB 2KZ1B 4G6AD 4WFED 1HHIB 3MBXH 5CJBA 3BKJL 1OT2A 1YY9D 3IDXH 1JWSA 2HT2D 2R0WL 4LGRB 4OT1H 3MRRA 2EJ1A 2AKRA 1R24B 3PTQA 1DQMH 3DURA 2E7HA 2DWDA 3ET9F 4Z5RB 1HSBA 3GRWL 2NLJB 3HB3D 5GISH 3GXMA 1PYWB 2R4SL 2MHAB 3H9HA 2XSBA 2ORBL 3GIZH 4HUUA 1QHOA 1YYMH 4U1HA 3ZQ9A 1JWUB 1R3JB 2V5TA 4N90D 3IFOB 4F9LA 3O41B 3B5GA 1TITA 3FMGL 3HMXA 5D7LA 1G6VK 3ULUE 3TJEH 1JZ4A 4F15C 1SEQL 2VTFA 1DE4A 4PRBA 1UACL 4N0FA 3SGKC 4TXEA 3FFDA 4O51A 4KGLA 3RNKB 4GH7B 5INDA 1MW2A 4WO4C 5IW1A 1ZVSB 5D4QA 3MRIA 1C12B 4QRPB 5EORH 1FLTX 3VGBA 4YEEA 2GJXB 4DCQB 3LKSA 3FO1A 2H8PB 3D2UD 1QVBA 4DZ8A 2R0ZH 2J74A 4KGJA 5GRJH 1J0ZA 5EBLB 6TAAA 4MCZA 4I5BA 2PXYA 1GHSA 4L5FH 1E4XI 5CSZA 5KN5A 2Y36L 3MA7B 2BCKB 1AJ7H 1IAOA 3F8UB 1AXIB 2EKJA 4HMCA 1IZKA 4AWEA 4P46C 4LAQH 4GXUM 5FCUH 2PF0A 5F9JB 5D70H 3S8WA 2G75B 2CR3A 3WUWA 1HJQA 2E6QA 4WI5A 4OLZL 3U7YH 1BIIB 3OGVA 3VGEA 3DMMC 2J78A 5HBBA 4PLNC 3VFVB 3OKNA 4ZDHA 2W38A 1ZSDB 5BXPA 3WL9B 3B9AA 4GAJL 1WCBB 3RWJB 3CSBA 5KSBE 4LNRB 1RZ8B 3ARDB 4Z8FH 3BFOA 5HI4D 3ZE0E 5JUVA 3HC4L 4F2MA 1JNHA 4HPOH 2VLMD 1ND0A 5M94B 3UDWA 1MH5B 4L4TB 4CN6A 5D1QB 4WUUB 4RMTA 4XVJL 1GQLA 3HUJE 3K2UH 3WMBA 4PB0L 3U7VA 3QUZB 3EUUA 4IHOA 5EUKA 3WF2A 5DRXA 5DLML 3S37H 5I1KH 1BLIA 5D7IF 4I2XA 3UZEA 4HIIB 4XV0A 1A6AB 3GKZA 4KV5E 4NDMB 1MJJA 1QQDA 3KJ4B 5D5MA 4PJGE 3WF4A 5M95B 3KYOB 3L3GB 1Q1JH 4IOFD 4PGEA 1LO3H 3PWPE 3FQTA 1HEZA 4F7TB 1BGXH 3I9GL 4X0NA 1CU4H 4ZXBB 3VRJA 3QI9D 5F6HJ 5GJTH 2AJ3A 1B3ZA 1BSIA 4P5TB 2ZPKL 2EYRA 2JFEX 4K07A 3TVMD 4E5XB 2YXFA 1N5YH 3VDHA 1KJ2H 1GONA 1NDMB 3IFPB 3V0AC 5JNYA 3FQXA 1FNLA 3QOMA 5FYJE 3H9SB 3MV8D 1X5HA 3EOTH 1HJXA 4QOKD 2CGRL 1EO7A 5E8PB 2HFEA 4RWHA 2Y8VA 2NR6C 4FQPA 2WVVB 2XXCB 4EI5D 4F8TA 4TSBL 4GMTL 1XF5A 4JFOA 3CU7A 2WCGA 3BH4A 1DFBH 3CVHH 5IVNA 1BQUA 4KZEH 5GQBA 3U0PB 1FP9A 3L9RB 3LIZL 1UOKA 1OSPH 1U3HA 3EYFA 4NRZA 3P30L 4D3CL 5IFTA 5D9OA 4ONGH 5I30H 3MNWA 5IDIA 2QPUA 2QQKL 3EO0B 1NFIA 2IH1B 3VXSA 1IGTA 3N18A 3RDTB 1ZVYA 4U1GB 4ZD3H 1Q38A 3GGWB 1RFDH 2WWKT 3ZDYF 5BRPA 2D3NA 2FR4A 1MFBH 2OJEA 1U2HA 3DTXB 3G08A 4UT6L 1JK8A 5ESVB 1KPVA 2PW2B 4U3CA 1E6RA 4K2UH 3X3FH 4Y5YB 2C7FA 1XCWA 2YL8A 3VFSB 3GYCA 2LVCA 4N0CD 2WIIA 4EUPG 2WBJB 4N0RA 3QCUL 1QACA 2ID5A 4C83B 1YEFL 4UIMA 3O8XC 2PO6D 2D7TL 5MEQB 3RGHA 4KQ3L 1S8DA 4QXTA 4IEFB 1QNZH 1Y0LB 4HAGA 2P43B 5F96H 1ZLUH 2E27L 3WEXA 3I75A 3QFJE 1YEDA 1OP3H 4HJGA 4PBGA 5A8QA 3RVTC 2BC4A 4OF0A 1T0MB 4KI5F 4Y2DA 1M05B 2C3HA 2CYGA 4OZFB 3BEWB 5H2BB 1R85A 4YHPB 4HXBL 3W28A 3RIFF 4M48L 4HT1L 4QTHA 3N0PB 4NOBA 1FO0A 4BJLA 2X44D 2DICA 3STZA 4Q7NA 3VD9A 3NTCH 5SWSA 5L2JB 1XH1A 3O2WL 1E3ZA 2VX4A 4KKNA 4Z7UA 1IAKA 1C5CH 4KDTA 5I2IB 3HR5A 1RMFL 1OVZA 3O9WD 2AEQH 4OBSA 1NGWA 1ODAA 3BPOC 4K3GA 5D2NC 5L8KB 1E56A 2ZE0A 5ECUA 4LKXB 3MPCA 3WIHH 3VFNA 4MQXD 3L6FA 1P7QA 1IQDA 4FG6D 4Y16B 3DPBA 4U3AA 2FWOA 5E94A 1PJ9A 5IMKB 3EFFA 3AJ7A 3PWPD 4PJHF 1DANT 1CGUA 4OTXL 5CPQA 2P45B 3PZUA 3DX7B 4GBXC 3MJ9A 3L2MA 1MLCA 1LK2B 3O4LA 4APQB 4UQ9A 2HRPL 3SIMA 4BQ5A 5ALBL 1CFVL 1AXSA 4KROD 3VM5A 2BVQA 5JA9A 5IT2H 5GNXA 4X5LA 2DTMH 1IMHC 1MRFL 2E9LA 3SCTA 1O5DT 3CPLA 3OG6B 1KFWA 2J47A 3FRPA 1RZGA 4LSRH 3AS2A 3V8OA 3WKMH 3FCTA 2AXFB 3H7LA 3IDJB 3WD5H 2JF1A 3IDNB 3UCQA 4IMKA 1XR8A 3C6SB 4IOIA 5ALCH 2D24A 3DX8A 4Z0BL 2B31A 3TTYA 4QAWA 3CSYA 3BT2L 1EEZB 1UJ3B 4JVWA 3WDJA 4CDHA 1NCCL 5AYQA 3RBSA 4YHLL 3CUIA 3DJ9A 1YMME 4RAUA 2I5YL 4YDJA 3SGKA 4MXQD 2BNQA 5IW6B 1S7XB 3WXWL 1C8XA 3UBXA 3OSKA 4QHLA 2XJ7A 4WO4A 3UTPE 4LIQL 4HEPG 1A6WL 4Z7WA 4B7IA 3BMVA 1JGUH 1IAMA 2F19L 4NN5B 4X6DB 1OWWA 5JW4M 2EDEA 2OMNA 2ZCLH 3GBLA 2AJSL 4PUDA 1HP5A 2VXVL 4XTRC 2H41A 1JTOA 3QEHB 4OI8A 2VX7A 2MKLC 1TA3A 3LV3B 5D4YA 2XWEA 4B41A 1MIEL 2FX7H 3O6KL 1SFSA 2J62A 1UVQA 3DLQR 4P46A 2CCRA 1CS6A 4NC1C 5C3LD 1TZIA 3QUKA 4FFVC 4M6NL 1FNSH 2NX5A 1JFQL 4O2CB 3MRMB 1TJIH 2FDMA 3BPLB 3DMMA 2XM2A 1SR0A 4FQ1H 4P57A 3WFEH 3UX9B 4L8CA 4TTDD 5IQ7L 3MRLA 2ZX9A 2VLRE 3QFJD 2OL3B 1AGDB 1NLBL 3DHJA 1ESWA 2C4FT 4OKDA 1RZJL 1TETH 4KUZL 3VWKC 4MAVA 1MJ7L 3HI5L 4OM0L 4HIXH 3CDCA 1EGJL 4J3TA 1AGEA 1RZFL 5HYJE 1U3JA 2EXOA 1RAMA 5F1NA 1J05B 1GSMA 1KEML 1QVOA 3I2CL 1T89C 5L2KE 2UY5A 2Y06H 1Q6GA 5C07B 3WQ6A 3KDMA 4JDZA 1I7ZA 3HZKA 3NAAH 3ZKMD 3QEGL 4UQ3A 4HLZG 2JKXA 3SE3C 2IFFH 1T0PB 3EHBD 4GW1A 3AZRA 4MADA 1BQHB 2MJWA 3K8LA 4HIJB 4NKDB 5CCKL 3O9NA 2EDOA 1QSFA 4PRDB 5HHPA 5BRZE 1EBPA 3CPUA 3UJJL 1ES0A 4EDWL 4Z2KA 4NQDA 4E41D 3NCEB 1JPTL 3WLBA 3KLHC 4CCDA 1N5AB 3CUJA 4H88H 2Y5EA 3ABZA 1JPFB 4AL8H 2J6EH 1CF8H 2ZWLT 4Y1AE 3O6FC 1GJIA 4XX6A 1LD9A 4RQQB 5C6TH 3DGCR 1T5WA 2E9WA 2ZOXA 3OHXB 3V52H 3TN0D 1QFOA 4BQ8A 2MQCA 3OKDB 3MV9A 8FABB 4E2OA 5E08L 2NXZC 5C0RL 4HUNB 5IBLC 1F97A 1MCPH 5AAMA 4XP4L 1WFOA 4MB4A 3FOLB 1FC1A 2HVJA 4X6EA 3LOWA 1I8KB 5IEHA 1BAGA 4KJWC 5DVLA 3UERA 4PV8B 2D20A 5HDQL 1MCOH 3U9UA 1U8PB 1R3HA 4RAHA 2VUYA 3B8YA 2DT1A 4K3DH 1CTOA 1F3DJ 1XGRA 4XP6L 1CGVA 1KCSL 3TA3B 1EHLH 3MRPB 3BGFC 1ZHKA 3BZFB 3K7UA 4M93B 2DT0A 3WQVA 4PJFE 3LSOA 2OTPA 5FM8A 3PZOA 2PF6A 3PG2A 3QXTA 4GRWE 2W9DL 3CAFA 2W66A 1XGZA 3KPMA 1CR9H 2OWXA 2NXYC 2M26A 3INUL 3ULVL 3HE7B 5HY9A 2HT3C 1PQZB 2XWJB 5TQ0H 3W2DH 1L6ZA 1JYNA 5DGRA 1J11A 2P8MA 3O4OB 1CPUA 1XGUA 4P8XA 2DT2A 1G7QA 1U8IA 3DXAA 5GS0L 3RZCD 4JGMA 5CP7A 1DBAL 1JP5A 3CFBA 5CAYB 2ADJB 2WP3T 1YEHL 3ARGD 1HJUA 5A16A 2BNUB 5K9JH 3QFDB 3UESA 3WUGA 3BIBX 4M02A 3U0WH 3WQ5A 2EDXA 4L29A 4PJ7F 4FABH 4FA8A 2CK0H 4OZOA 3GMMA 2H2PD 4YHYB 3V4UL 1GC1H 2QKIA 2OI9B 1H5BC 1QNQA 3RGVB 5IW3A 3BWAA 5KOVC 1U93B 4JZJB 3WO4C 3NH7L 3L3OB 3LN9A 5D96B 4WJXA 4YH6A 1DCLA 2X2YA 2X89D 4U1JB 3GNPA 3GKWL 4GAFB 1LG1A 4BELD 4QCEA 4J6RL 2H26B 5CKAA 1UWSA 5GSRA 3KPNB 5D2NA 1ODZA 4DKDC 2D0FA 1N3NA 3NA9H 1QKZH 5FB8B 4DEPC 3VDBA 3LKRA 3SJVB 3HN3A 2IAMB 3C9NB 3GRWA 4Y8DC 3RZWA 1LF1A 4UTBL 3L1OL 1TZHA 2PB1A 4EI6A 4MNJA 2J25A 4E42A 2AJXL 5EUOB 5C0FB 3U6RB 2HT4C 5GGVY 4GBXA 4I2XE 3BH9A 4DKFH 1R5IA 4CKVX 4JM2F 5JW4R 5JIPA 1P5UA 3WFZA 4E4PA 1GOGA 1NMCB 5A6AA 4OI7A 4DGVH 5CZXC 5A3IC 1EO8L 4M7JH 1WUNT 1E0XA 2I60L 1KWKA 5AZEL 2KKQA 4Y1AD 3P9LB 1E6PA 1W0WB 4K3JL 5J3HD 4QRQB 4MAYB 1XD0A 2R1WA 5KOMC 1WWBX 3Q6GL 3HC3L 2A0LD 2DTSA 5J11B 4PUBH 3ARVA 1RU9H 1ETZB 4YHGA 2WHJA 3MMWA 2J7EA 4D0BA 3BE1L 4OCWL 4EBQH 1UB6B 4FFWD 3ALFA 5ID1B 5BVPH 1FV1A 1E6SM 3VUPA 5KSVA 3KPRB 3AXLB 4UDTB 1T7ZA 1ORSA 1U8NA 2ZSVA 2DBLL 5I9QB 5T3XD 2GAZB 1WPCA 3PWVA 5DHVA 1M7DA 5TQ2L 2X6MA 2HJFA 2CQVA 4Z2HA 2DM7A 2E5EA 5EBAA 3D39D 1EMTL 4JO2L 3OLDA 1V5JA 4EUPA 4HA1A 1FRGH 3U4AA 3VXSE 5FCZA 1RZJC 3GBML 2V3DA 2UYLB 1PX4A 4Z7NF 1E4NA 1DHKA 4NP4L 1SYTA 3FONA 1XEDA 4R0LC 1I8MB 4U31A 1WJ3A 4JDVB 4P23D 3QG7L 1QBLL 1HHHA 2DWEB 1G94A 3ES6B 4R3SB 2BVDA 3LKQA 3DI3B 3WV0A 3UG3A 3NFNA 5C0CB 1EXUA 1U8QB 3VWKA 1Z32X 1CDCA 1RVFL 4LPWA 1D6EA 2PW1A 1RZKL 2NPLX 4PRIB 4ZE4A 4JREB 1ECEA 2Z91B 4PRHB 3QR2A 1HHJB 4S1DD 5TE4H 1XD1A 4F7MA 1Z0NA 5KVEH 1NWUA 1KSRA 1G7IA 3DVIA 2P8PB 2EYTA 5I1JH 1OARL 3P73B 1V8HA 3G6JB 4RISL 5EZJA 5DMGC 4U4BA 4AMKL 1AO7B 1MHEA 2ZUWA 1YEIL 4X4ME 4Q9RL 3SOBL 3GHBL 5JUEH 1K6QL 4NO5A 3SE3A 1GNXA 3C60B 3EO9L 3S96A 1KJ2B 4Z76B 1B2YA 1MCBA 3DHUA 4WV1B 2IG2L 4NRXA 4O02H 4NOFA 4F80A 4Z7UE 1EA9C 4ZSOE 1CYGA 3QHTC 1E43A 1SMAA 5D9SB 1A3LL 5ILTH 4RGMB 1Q6DA 4ZXOA 1KBGL 4UV4H 3BYTA 3L4UA 1T03H 1NCAL 1U3ZA 3QP3A 4GW4A 3NIDE 3CVHB 2X40A 2YA2A 3T3PF 3PGDB 3QPXH 1H0GA 4MNQE 3ZJ6A 4PJ5E 2A83B 3NDZA 2NY1C 5A94A 1S9VB 1FFPA 4WDIA 2P5EB 2RFXB 3O6FA 3AHXA 3CZ8A 3MLVH 3WN5C 1WWCA 3O4LE 5LCVL 1T22B 2ESVE 5EFIA 3SDXE 3ZHKA 3IJ8A 4NFBA 2ZXAA 5KZCD 3TNMA 4H8WH 4GIAA 2UUDK 3SE9L 4JO4L 4YAQA 2DDXA 3QULA 4YHEA 1NAMH 4D8PA 1F58H 3SKNA 1S7WA 2F74B 2Y07L 2AK4D 2QQLH 4OUUB 1MFCL 4I18C 4O00A 5TDOA 3BQUC 3VGFA 1BEYL 3PABB 3ULVC 4ZOBA 3G6MA 1SJEA 5GGQL 1ZTXH 2J8HA 1A7QH 5C0AB 2VIRB 4HU8A 1AD9B 3ZOAA 4AQOA 5ENWB 3RWCB 5JPMB 1VFBB 3OR7B 2EQDA 4P5MA 4FTVB 1WZ1L 1I1FA 2VITA 4ALAH 4OQTH 1G1CA 1BQCA 2JEQA 4OFYD 2EXWC 2BRQA 4GRLB 1LWRA 4PLJC 4YHZL 1OAQL 1H4PA 4P8UA 2BNQE 4J2XA 1FNHA 1I9IL 1XGTA 2DMKA 3V4VH 5HHMB 4NO3B 15C8H 2W0PA 5CP3H 4AD3A 4M8QA 2NNAB 1QBAA 1W9BM 4P9HH 4KQ4H 4W89A 4LOUD 3SKMB 5DURD 1CN4A 4H1LB 2NY6B 3VXUE 4LEXL 1T2XA 4QGYA 4ENED 1FH5L 2Z1SA 1HCVA 4P2RB 5EC2A 2BJMH 3DYOA 5IUSA 2J5LC 2B0SL 1F4AA 3QDGA 4PJXF 5FUOH 5HYSA 1E4MM 4LU5H 2NY2D 3MU7A 4UV7L 1H5BA 5C2UB 1CL7H 3VWJA 3ZO9A 1V02A 3ZKND 3SE8L 2CRYA 2WVTA 1T20B 1K9TA 1K6AA 3QDMD 3A4AA 4CD6A 4PTXA 2VAAB 4U7MA 3SCSA 1KTRL 1RHFA 1GQKA 1NKRA 4ELMA 3H3PH 3T8XA 3OWEA 3CU1A 3W81A 4LCCB 5J13B 5ITFB 3BN9D 4JLRA 3CDFA 5A6LA 1DQLL 4P5KB 2Z31D 2FHFA 4M5ZH 1CGWA 4R9HA 4F8XA 4TN9A 4OKVA 4ZO9A 1T0NA 4M61B 4V1DA 1F4YL 4G6KL 2CBVA 3T0EE 2B7DT 5DJXB 3AFLA 5GIRB 5DO2C 5IFJA 4P3DB 1XCTA 12E8H 5CEZL 1UR0A 1GPOL 1MCQA 2GKIA 4QNPE 1A5FH 1ZLVH 4HWUA 4JFYA 5INCB 4AT6A 3P4OA 4AM0A 1NEUA 2LAAA 2XIDA 5DFVC 5DMJB 4P4RB 3VNYA 2ARWA 4MNQD 2HLAB 1J10A 2H1PH 4PJ5D 4RX4D 5D7JD 1J8HD 5DFTA 3BW9A 3I6GB 1MFUA 4PJAA 3MFFA 5MP6H 3ARPA 2ESVD 4Q97A 3FN3A 3RL2A 3VA6A 1I1AC 3GI9H 3CFJB 3IETB 2NY0D 3O2DL 3OKOB 5E9DA 1PBGA 3MRKA 1L7TL 2GUOB 3DV6B 4H26A 3U83A 3V5KB 4L3EA 3MRGA 5FHBH 4FXGA 4G8GD 2YPKA 1YEKH 1IV8A 2IPUK 1KJVB 3MR9A 4LMQE 2QPSA 2IF7A 3D2UB 4YXKH 4JAMA 2Z8VC 4OCXL 5GGTL 3T0WA 5F21B 3D85A 5HGBB 1K4CA 5EU3B 1F4WL 5CINL 5EUOF 8CGTA 3E6HA 2UZYB 1KQYA 1I3RB 4DVBB 4LSVH 1YNKL 3AISA 3ZE2E 3GDBA 3U7AA 1QW9A 4KPHH 1S9YA 2W65A 1PIGA 4OGAD 3RX7A 5T3XH 1XF1A 3VG0H 1RZKC 1AY1H 4OD3L 5E2WL 3ZYZA 5AAWA 1JAKA 3ALGA 5JBFA 1EGJA 3NUKA 4R0LA 2FIKA 2VR9A 3M1BA 3PP3K 3BUYB 1JYVA 4PMDA 2LABA 5FA4A 1UXWA 5JQ6H 4L3CB 4BUGA 4NT6B 3UC0H 2DD8H 4Z7VA 3BESR 3QUYC 3VXUD 1AH1A 1A8JH 3WNLA 5HYEA 1JF6A 4X6CF 3SEPA 2OZ4L 1O7AA 2QSTA 4JRXB 2ED9A 3WE6A 4E0RB 4OZHB 1OAKL 4DOHB 1R3LB 3GSOA 1LL6A 2Z4QA 3ARWA 3WDPP 3CVIH 4F9PC 4YE4L 1NLDL 4K71B 5FCSH 1E5JA 5HDRA 3DXAE 5TFSH 3CIVA 1MUJA 2O5XH 5IGXH 1JZ3A 1U95B 3D18A 3OKMB 4S11A 4TNVF 4WU5A 1F5WA 1IGYB 4BCEA 5FKYA 1DQQA 2JIXD 1HJVA 5DTFB 5D8JH 4PB9H 3DUSB 3I6LE 5GSVB 1PKOA 1JGVH 3BXNA 4K23H 2YSSB 2GJ6B 3IDIB 4KK6D 4PJBA 4CD7A 2A73A 3SKJL 2X0HA 3B5TA 1NGYB 2IJ0C 4JHWL 1KEGH 1FFOB 1IKFH 4MA1C 1TJHH 3GSRA 4PP2A 1X44A 5AY7A 4UFKA 3QI9B 5FV2A 3C5JA 4Y5XB 4MA7H 2EIZB 5B3NA 1QFWI 3GBDA 1W0YT 4ZPVA 5LYRA 2QF8A 5A8PA 2MCPH 5A2AA 1J0YA 3GNML 1D5XA 4XP9L 1NKOA 2VX5A 1RK1B 4JN2B 1OAUH 1CFTB 2OR9L 3KXFA 3T0ED 4QLRA 1IGJB 2CEQA 1GGBH 2DQHH 1VAHA 5A6BA 2Y4SA 4FQXD 3MV8B 5I1AA 4XH2A 1E72M 1J8KA 4IMLB 1VSCA 4QOKB 1F8TL 2GEEA 3PIQA 4LSUH 1EOKA 1YPZF 1QNRA 4EI5B 1T2JA 2VL5B 2YD3A 3WN5A 4WJ5B 1WBXA 2HLFC 1OP5H 5F70A 2A6JB 4D9QE 3VE0B 2E6JA 3SE4C 4DWSC 2V9QA 3BZEB 4PD4J 3SPVB 3FTGB 1UM4H 1JHTA 3Q1SL 4V27A 4F7CA 1AC0A 5DDHB 5HDBE 2P7TB 1LO5A 5CJOL 1D5BA 3BQUA 1WT5C 2BDNL 3G6JF 2AJUL 3LRHA 4ORGB 3VMPA 3LEVH 4MJ4A 5I8OH 2ZZUT 1DEDA 3QH3A 2ZUQB 2Z0BA 2VDKH 1OSZB 1IM3A 4MXVF 5DRNA 4LLYB 1ZOXA 3ZZ1A 5KSUB 1KGWA 4XBEL 4P3CL 1WKYA 5DJ8A 5C08E 3K1KC 3B43A 3DSFL 2WC4A 1MVFA 4XGZA 2GSJA 1UA6L 2XIIA 3CUPB 3AFBA 2QSVA 3ZE1E 2WZEA 1F3JB 3U4EB 4JJ5B 1I9JH 5FEBA 4FNLL 3PQYA 3O0RL 2PO6B 1JZ7A 5DRWA 5IHRA 1UQSB 2EZ0D 6A3HA 3MLRH 3N17A 3QIBD 4ZS7L 4LVNB 1FPTH 3G6AA 4MLIA 4OCLC 5HJ3A 4QLLA 1ZXQA 1ZAGA 2Q20A 5CMAA 3MO1B 1X3DA 2H9GB 4GI8A 3OJ2C 4HWBL 3TIEA 1IM9A 1G7HA 1T1XB 4WHTB 5A2CA 2YUZA 4GG6A 4W68A 3WNPA 2E7BA 2PR4L 2J1KA 3T4YA 3VFPA 2W07A 4AEHH 3GXIA 5DJYB 2PETA 1DEEA 4N8VB 5GGRB 1QFUH 1CENA 3VXMA 4JM4L 4MQSB 4X8JA 5EU5A 5C0BA 1FP5A 5E2UL 3U7WH 3AM8A 5I1EH 3U1SL 3ROOA 4EZMA 1UD2A 1HIML 5GRUL 3HG1A 3IFNL 4HX1B 3QA3A 4H25B 3LKOB 3O9WB 4U5IA 4KMTL 3EOAA 4OIIL 1N2RB 1IE5A 4QLJA 2HJKB 3FB7A 4K94L 5BZWA 2R8SL 3AMGA 3B3IA 4HMEA 4HWZB 3PP4L 4NBYB 5DUBA 4KI5C 3HE6C 4XPFL 3PXHA 1QLFB 4QRUA 3SDCC 4H5SB 2XV6B 3UBXI 5T3ZE 4LXFA 3WFBH 5HD8C 3T2NL 4CAGA 5L0QC 5IBTH 3QEUB 4MCYA 4EANA 4QWWD 4J7RA 4GKNB 3VJ6A 3BAYA 5I16A 1NP2A 5I3DA 2V2TB 3NJ3A 3QNZA 3SN6N 1LNUA 3ZSTA 3VDCA 3G6LA 3JZ7A 5IF0A 3CK0H 1J1OL 1HSAB 2FEDC 1B3VA 2XRAH 4JO1L 2V38A 3H0TB 3CFEB 1TTGA 4LKCB 3K46A 3HNTL 3GMPA 1QOKA 2YD6A 5JQHC 1Q8MA 1X5YA 4HUVB 4D9QD 1HK6A 3GJFA 4JZNB 1WDSA 1JBJA 1I1AA 5GGUA 1HHGB 2V9TA 3F58H 4QTIH 4PJCF 4BK5A 3MYJA 2GITB 4X7TB 4XXCC 1FGVL 4L9LB 3L3HA 3WL0A 4G7VL 4XZUA 2Z8WC 4KH2A 2VL4A 4YEFA 4K7PL 2O92A 3DGGB 4KKCC 4F66A 1D5ZB 3F5LA 3U9PL 5FD0A 1NCBL 2Q6WA 1YQVL 4NQSA 5I17A 1NUGA 1OGAE 1DTUA 1CDHA 4OFVA 1P9MC 2EIBA 3GIVB 1LEIB 3AHVA 2VQ1B 2PTTB 4W84A 4N9GA 2VXSL 2DKUA 1IC5L 3T4AB 2J4WH 1CFSB 2WYSA 3BYYA 4FFYH 2WC3A 3GJEA 4IRJD 4UTAH 4JY4A 3QNXB 4F7EA 3ULSA 1MW3A 4QKXB 4UFHA 4NBXB 5IVXA 2AJYL 4JR9H 4ZFZA 4I3RL 5KVMC 2V17H 1LWHA 3FN9A 1LL4A 1OD8A 2DQCH 5J57B 1EX0A 3AYRA 4HP5A 4PN2A 3ZMRA 1IT0A 2GCYB 1HE7A 1O0VA 3KYKH 3QUYA 4C56E 2I07A 3FZUC 4M00A 3B4NA 1E6XM 2KPNA 5DD1L 3X12A 4OD2A 3F5KA 5DSCA 1G7PB 2MQ0A 3V6OC 4F33B 2X42A 3FHAA 1NGXA 3ZDZE 1UJTA 5B39A 1AE6L 3QDAA 4M80A 4W5ZA 4NZJA 4XHJC 4F9PA 1JUFA 2XPGA 1JNLL 2JELL 1LK3L 1IEAB 2JJTC 5DQDL 2OTWB 2ZCKH 3U4BH 3V6FA 1TNNA 3TYGL 5T1MB 1NBQA 1CI5A 4GFTB 4N5ED 1PVHA 4U1KA 2DQDH 4D72A 3M8OH 2CLZB 4DZBA 2FSEB 1NGZB 3BHBA 1OY3B 1INDH 4LMQI 3B83A 1RUKH 1U8HB 4R4ND 5C6PB 2XZQH 2E3ZA 3BZDA 1K4DB 3D69B 3FQRA 3VXNA 3T08A 4GQQA 2PUQT 4Z9KB 3NBNA 2Q76A 4F3FA 3FT4A 1N26A 3BKYH 3S3JA 4WUKH 5CILL 1D5IH 1LMKA 5MI0C 3LS4L 2YN3A 1CCZA 1TJGH 1EOMA 4P4KD 1OCWH 5AD0A 2ICES 3C8HA 3WBAA 5T3ZD 1IAIL 2V5CA 2F54D 2EE9A 5D8WA 2V5RA 25C8L 2QADD 4L1HA 3NABL 5H37G 3SBWC 4E41B 5HI5D 1UYWL 5IKCB 4B3KA 1Q9KB 1CICA 1IARB 5BOPA 2VWEC 3I50L 1KXTB 4HG4J 5MEOA 5DK0A 5C1MB 3B8SA 3MV11 3NCBB 2Y5TA 4Z2JA 3SQOH 2DLFH 4B16A 1ONQB 3DROA 5D7IA 1NAMB 5C0DA 4W85A 2XN9E 4RFEA 1XSIA 5BYWA 3JTSA 4OZGF 4NKOB 3TN0B 1Q9LB 4JGUA 4HS3B 3SE4A 5TPWH 4DWSA 2OJZL 3ILQD 3OB0K 4XCYB 1AGBA 1YNLL 3KLAB 4R2GD 3A0OA 5JOPE 1DLHB 1TMCB 4M6OH 4JQIH 2H2SD 4OUOA 1B9ZA 4TULH 1RJYB 2FO4B 1RIUL 1AC6A 3GM8A 1UR1A 1F6FB 3T0BA 4AIUA 1WT5A 4EOWH 1BX2A 1PGRB 1NC4D 1EAJA 4D9LH 5BV7H 2ZWZA 3TBSB 1T66C 4LIQE 3BZ4B 1G7LA 4AZ6A 3TF7C 5J6HB 4OZ4A 4PJAE 3MOBH 2AJVH 3WLWD 4EXPX 4Q9BA 4WK9A 5CEYA 5JHLH 1EEYB 1A0QL 5E09A 1OGAD 4DWHA 5LGHL 5LQBL 2RJMA 3NIGF 1RULH 4OZFG 2P42B 4NO2A 3KZSA 1NH6A 5DJ6B 4JZOA 5AYUH 4C59B 2DB8A 4NZUH 3OJDB 1V6UA 3ARDC 1ZMYA 3EO1B 1AR2A 2WQ8A 2QMJA 1BFTA 4DFIA 3LRSA 1JI1A 4NHUA 1B0RA 2VABB 5D1QC 1BJ1J 1FL6B 4MD5B 1A2YA 1QSED 4KRTA 2HG5B 3OIHA 5AZ2L 1N8ZA 3A3HA 3FT3A 4CN1A 5DXWA 3RZCB 1E3XA 1DBJH 1C5DB 4KRUA 3ARGB 4PLOB 1UWXK 1IBGH 4FZEL 4OZIE 4YXHL 1QI0A 2QLYA 4KRPC 4MB3A 5ID0B 1MQRA 1GIGH 1OIMA 4FHBD 4JPVL 3KJ4C 4JPIB 1JPGB 4K94C 4LVHB 2PNDA 3NPSC 4X8XA 4YUEL 1Q72H 1L7IH 4MHHG 1TPXB 5T1DH 2VRKA 2A9NH 5IIEA 4PGBA 1AI1L 2EE3A 4D6HA 1OQXA 4F7PB 4YX2L 5H94B 5TDNB 4KKBD 4P5TC 1B0GA 1LP9B 2FB4L 2FNBA 4XBPA 3TCXA 5HDOA 3KPLA 1MAMH 2V9RA 3VIHA 2XTJD 4NC2B 1GHRA 3ZIZA 4OLEA 4XNMB 4OLWL 1KXVC 1WITA 5DD6A 4WGWB 1ZLWH 3RIFK 1F3RB 1R3IL 4OV6F 2Q7YB 2NW3B 4MB5A 3DO7B 4NNYB 5DVOA 4MA8H 4U1LB 2PWHA 3X17A 5FYKL 1UEYA 4RAVB 2VDPH 3CTTA 3HE6A 1MFAH 4G42A 4U1NB 4WENB 2UZIH 3D0LB 3UJIH 1CBVH 1JHKH 4PJEA 4S1SL 2GT9A 3SDCA 4Y7MA 5CBEB 2R0KH 2WHMA 3DX6B 3IS1X 4JFXA 4Q0XH 1LEKB 1P4IL 2QSCH 2W0KA 4JFTA 1WAAE 4TSAL 2ZUTA 4UIKL 2QJDA 2HVKB 3VIJA 2X0YA 1FFQA 1KENL 1KTLB 5E6YA 3O2DA 1CD1B 1N59B 3RDTC 4U1GC 1XGYL 3HMWL 4HEME 1AP2B 2EH7H 5JR1L 1DDHA 1FVEB 3RU8L 2LVEA 4IRSD 2GTZA 1OTTC 4M1CC 4S1QL 3NDYA 4Y1AB 4MNHB 1CD9B 4XWGL 3IK2A 1A7OH 2XN9D 5KSBF 2UVEA 4Z77A 3SDAC 3CFDA 1KCKA 1YYLH 5T5NG 4L8BB 1JGIA 5GGTA 3ZE0F 2HTKD 4NPYB 1AGFA 5F7MC 1W1VA 3DV4B 4PJHA 4DTGL 2WBJC 5E24E 2VDLH 3F7QA 4XXCA 4PRPD 2D4DA 3HUJF 3E3QC 3SCNA 2A77L 1QNPA 4JM2C 4CW1A 1E28B 5LWYH 3WUZA 3P4NA 5E8DH 4KV5F 1TQCC 4GKLA 3RCNA 1JG9A 4O2FB 3NGBC 3IJYB 4WRLA 1VGKA 3VTRA 1XGQB 2IEPA 4PJGF 1H3VA 4G3YL 2B2XL 1QI3A 1UH2A 4PJFB 4AZIA 5LA1A 3MS8A 4HK0B 2F8XC 1FL5A 3D39B 2G5BA 4ERSH 1JDAA 3MC0A 2P5WA 5KTEL 3GNOA 1BM3L 2OZ4A 4NUGH 3MOAL 4YWGH 1V3KA 2AVGA 3K3QA 35C8H 3UTOA 1LO2H 2QSQA 4QHNB 5IB2A 5DQJA 5HVGB 3CUFA 1KCLA 1P2CB 4C4KT 1EFXA 3QXVA 2XWDA 1TZGL 4P23B 1I1XA 2C3VA 2FYYB 3Q6FB 5E6ID 4DN4H 2XWTA 4N0YH 4PGDA 4LRNL 1M53A 3HS0B 4FMVA 4GXPA 3AB0B 3PQYE 4X7SL 3V6OA 4Y16C 6FABH 2DOCA 2FH8A 4G7YH 4MJIE 5FDWB 1MWOA 1JV5A 3CFKA 1CGSH 1XGPA 3QIWD 1BQHG 3BKCL 2A6DB 2ZXQA 5F89A 2JJTA 1NJ9B 1HHIA 1I9RH 2QHLA 1B0WA 1JPST 2Z9TA 1WDRA 4J3WA 4BF7A 5F8RC 5KVDH 3SUTA 1DBKH 1R24A 2NYYC 1NGQH 2VQUA 3MBXL 3MRHB 5GXBB 2VCAA 3IF1A 3IDXL 3KPQA 1I7UB 3MSPA 4Z5RA 1KIRA 1PYWA 1DQML 5CJ5A 2XACC 2KBGA 4NBZB 2MHAA 5C0BE 2UWEB 3UJTH 4XB7A 2BVTA 4NN7C 3U57A 3SUVA 4JG1H 1JWUA 2IAND 5GISL 4MD4A 1G9MH 3HG1E 3ILPB 4XMPL 1U2CA 3RX5A 3GIZL 3MODH 3O41A 2LQRA 3MRDB 5F9OH 1YYML 1PY4A 4ZPTB 1LDPH 1MOEA 1DVFC 3SBWA 4LLUA 1SJHB 5E8OA 4XC3H 3TOPA 2D3LA 4JGJA 2XSAA 1P6AB 2PYEE 1E71M 2CDFA 2ICCA 1J9CT 1X5LA 1ZVSA 3TJEL 1XF2B 1IT9H 3WY1A 4QRPA 3PDGA 1YMHB 5T3ZH 5E0FA 1OTUD 3EBAA 5E0CA 5DD5H 2GJXA 3WD0A 4DCQA 1H49A 2R9HD 4NN5C 3WJLC 4TUKH 5EORL 5KZCB 3UG5A 1H1NA 4YBHA 1DWGM 2C1PB 1QRNE 2J8UE 4JHAH 5EBLA 3RFZC 2J4GA 2YR3A 4YFLI 2R0ZL 2AK4B 4IIQB 4U1SA 1U8JB 3WHE0 5GRJL 5I6XB 2B4CH 2JLLA 2YBRA 1Q6CA 1AKJD 5A2JH 5IEKB 4A6YH 5KG9A 3ARFD 2IBZY 1AJ7L 5EN2B 2QEJA 1J01A 2UZXB 2ZG3A 4LAQL 5FCUL 5JW3H 5D70L 1JL8A 2AI0H 1ZSDA 3U7YL 4I9WE 4ZUUA 3BLPX 2JCCB 2RGMA 3N9GH 2BY0A 1WCBA 3VXTB 4D9RE 5JHDA 3RRQA 3RWJA 4HWBA 3CH8A 4LNRA 1RZ8A 3ARDA 1H2JA 5E1AA 1HDMB 5JXAH 4Y88A 2EPLX 3GSXB 3SHSA 1IGMH 2YN5A 3PWNB 3L3KB 4BQ4A 5D1QA 1HZHH 4Z8FL 5FKPB 4AIXA 2G8ZA 1AQDB 2DT3A 4HPOL 5DURB 2H32H 1Z6JT 3L7EA 2IADB 4RFNB 1T1ZB 4WHYG 3QIUD 4HIIA 4OCSH 1CXIA 1A6AA 2BVUA 3K2UL 4ACZA 5I8CB 4NDMA 4UDUB 5KZ6A 2GK1B 5I1KL 3S37L 1GJWA 2X4QA 1S7SA 5I71C 1C90A 5IVXE 1S78D 2CIKB 3KYOA 3V79C 2VI0A 4F7TA 2HISA 4HIEB 4ZUTB 4X98B 2NY2B 1W9DM 4MJID 2NY4D 3O3AB 1Q1JL 1LO3L 2V7HB 4P5TA 3QDMB 5C0ND 2VISA 4HDIB 1CU4L 4E5XA 1J0KA 5GJTL 1FN4B 3IFPA 1NSNH 4WEMB 5E70A 3LDBC 1W0VB 1KXVA 3K8KA 3H9SA 3F5WB 1N5YL 1KJ2L 4HZ8A 1KJMB 3RTQD 1M6OB 3VGAC 1N6QH 5HHOA 2VOTA 2Z31B 3UPRB 2B20A 2WVVA 3ZTJH 3EOTL 3OX8B 4MVBC 3BP4A 4YHML 2IALA 1G7JB 2A3HA 5BZDB 1ZBCA 3N1PC 4QCFA 3DX9B 4ZSOB 2IBGA 4PJ7A 3LAFA 3T1FB 3U0PA 3L9RA 5BXRA 4G8IA 2A2QT 3CVHL 2FZ3B 3QJFB 1BYAA 3QHMA 4UOW1 4NQCD 4KZEL 4ODVH 2R69H 4XI5C 3EO0A 1HKJA 1VF8A 5DK2A 4YBLB 1OSPL 3NSNA 3C2AH 3RDTA 5I30L 4HH9B 4MNQB 5D1XD 5EBMA 3TA3C 5JXED 4HKJB 4JPKH 4MAUH 5D7JB 2F53E 1J8HB 3WNNA 1H8NA 3DTXA 3O3DA 5CPSA 5ESVA 2PW2A 3SDAA 2DI7A 2M2DA 2ESVB 2YRLA 4Y5YA 1RFDL 3UYPA 3VFSA 5IJVB 1MFBL 1QRND 1MNUH 2X1OA 1E1FA 4M3KB 3HE7C 2AQ1A 4QFUA 2NY0B 2WBJA 1NOFA 4K2UL 3X3FL 2VT0A 4C83A 1JGLH 4JKPH 3QWOA 4DGYH 2UY7A 3O4OC 4JM2A 1UD3A 2NT1A 4JFHE 1A9BB 1F6LL 3CXHK 1R3KB 4G8GB 2CKSA 4PY8I 1Y0LA 2X7LA 3RVWD 1QI4A 1PPIA 2AAAA 5HDLA 1T0MA 4DAGH 2X4SB 4UZUA 4I48B 2WZHA 1M05A 1ZBVA 1QNZL 5DS8B 5F96L 5ISZD 1KXQA 2JIEA 3EYVA 4I9WD 4AG4H 3QXWA 2WM0A 4JRYA 4LFHG 5HNNA 4G9FD 4ISVB 2OI9C 3EJZD 2VXUH 1IEBA 4OF3A 2WK2A 2ZUMA 2B5IC 5L2JA 2D2OA 1BWMA 3PHSA 4F9JA 3M17B 2YBTA 3NTCL 4OLYH 5I2IA 1A6TB 1UR9A 1IFHH 2W63A 3MGOA 3HRZB 4NNXB 1C5CL 1RJCA 4UFMA 3MRQB 4U6HA 5A43C 3EJYC 3QUML 2J7DA 1P4LA 2AEQL 4XHQA 4Y16A 3BRGC 5IMKA 2VXTH 2ILLA 3WIHL 2QL1A 5C8JB 3X13A 1VKXB 2VRJA 4K9EH 3AQUA 1KB5A 3DX7A 1JFXA 3GSWB 4K3HA 1LK2A 1LJYA 4APQA 4TUOB 3PHQB 3NFSH 3ARRA 4JFFE 3QYCA 2E9MA 2JIXB 2VLJD 5DJDA 4HS6A 1A02N 1NMCC 1LQSR 1RUQH 3HLAA 3QDJB 5EOQH 3TO4C 3C5ZB 3TCLB 3QT2A 4J3XA 3IJ7A 3THMH 5I79A 1JIBA 5FUCC 3IDJA 5IT2L 4PJFF 2OCFD 2DTML 3IXAB 4YPJA 3IDNA 4GRWF 4WI6A 1W9UA 4LSRL 1UD4A 4EK7A 3WKML 1BZ9B 2ZSWA 3BIKB 5DUMH 4HFUH 3WD5L 2JEPA 4LYPA 4KVNH 3DBXB 4DUWA 4AH2B 5E5RB 5LBSH 2VO5A 4ML4A 5ALCL 1EEZA 2R0LH 5CEZE 2DIAA 1VGEH 1DVFA 3T0EB 3MROB 3ZDXE 1HCFX 2APXA 4Z2LA 2GJZA 1W2PA 3JWDH 1JZ6A 1S7XA 3ZYJA 3DVNB 2UY6A 2P49B 4AIZB 4Q9QH 3P0VH 4FQQA 4PJEE 1J5OH 3GB7A 3SUSA 4GQ9H 3OLIA 2W67A 3L2LA 4L8SB 3WJLA 5I9QC 2F53D 4J12A 2BSRB 4HAFA 3R8BB 1SM3H 4N0UB 5DJ0A 4PLKD 1JGUL 4TVUA 1YECH 4D6CA 2WWKO 2ZOKA 1KG0A 2ZCLL 3ALXA 2O61B 4OCYH 2GSIB 3RNQA 4GPNA 5ERWA 2HYMA 5C0GB 1EQCA 3MUJA 1TE1A 1J86A 1NL0H 2AQ2A 3JV5A 4O2CA 1YUHA 3EYSH 3MRMA 2FX7L 5F6IC 4MNGB 4H1LG 4K7PY 2EC9U 2FX9H 5EO1B 4GKZB 4MDJB 3VI3E 1FNSL 3RM9A 1KT2B 1AGDA 2OXGA 4X4YB 1NC2D 4FQ1L 3GSNH 1GW1A 3WFEL 4UOZA 4X9FA 4LLVB 2F9BT 4LCYA 3C6LD 2WSPA 4WLCA 4CCCA 2DI9A 5IMOA 1AFVH 4JREC 4OJFH 2Z92B 1TETL 5B4MC 3T77B 5A8MA 2DBJA 4HIXL 4P2QE 3NSXA 1J1XH 4OOUA 3QDHA 3AIBA 1NEZA 5CUSH 3KEHA 5C07A 4UBDC 5ECJE 3CJJA 3TBVB 2P5WE 5KJRH 2BV9A 1YEJH 4JFDA 2Y06L 4XX1E 1O7SA 3C60C 1JZ2A 2YIHA 4DK3A 4LVEA 4B0MM 3NAAL 5KS9B 5GGSA 2YHGA 1T80A 1UD8A 4NKDA 1AR1C 2IFFL 5J6GB 4PRDA 3S6TA 3HZMB 1YHTA 5FDYA 4PP1C 2JB6B 4RGMC 5E0QA 4YR6B 2YUVA 4QCIB 3MRJB 1OINA 5DA4A 4EKXA 5EULV 1T21A 1DWAM 5IVOA 3IKCA 1H0DA 2XPKA 3MBEC 3F6LA 2EDRA 1UYQA 2JCCF 5A6JA 1NFDE 4HJ0D 1P6WA 4H88L 4AL8L 3FN0H 3OHXA 2J6EL 4DGIH 3BJ91 1BIHA 3QQ3B 1E6JH 5MERA 4M5YL 2YD7A 5C6TL 8FABA 4POUB 3KR3H 3B9KB 3BO8B 4PJXA 2IUZA 3DOSA 3VINA 4RGNC 3V52L 2VXQH 1FAKT 2PBGA 4C7GA 3FOLA 4WHDA 1ISZA 4WFHE 2GY7B 5DVMA 1MCPL 3RILA 3V4PH 4ZO8A 4PV8A 1HL9A 2WMJA 1Y6NR 4Y2DD 3WFDH 4ONFH 1U8PA 3RVVD 3ZHDA 1CLOL 3MO4A 5GS2D 3L5IA 3TA3A 3MRPA 4ZQKB 4XB3A 1MCOL 3BZFA 1DWHM 2EPKX 1MWAH 3GMQB 4K3DL 3RI5K 4P9MH 4F57H 1EHLL 2XKNB 1QUNA 1S7QA 3BDXA 1U8OB 1KUMA 1AHWB 1KPUB 5JBEA 1KN4H 3OGSA 1TMQA 3P3YA 4EXKA 3HE7A 3FXYA 3FFCE 2ATPB 1PQZA 1FLRH 4GAYA 4QRPE 4U6TA 4KUCF 3VMOA 1CR9L 4RMVA 1R5WA 1D6VH 1VERA 5TQ0L 3W2DL 6CGTA 2NY6C 2ADJA 1OM0A 4LLDB 2VC9A 3HI6H 4RRPA 2BNUA 1UR4A 4P0DA 3PV6B 3QFDA 4OOZA 1MIMH 2EPMX 2DQJH 3UTTD 1K3IA 4XPTH 2W0FB 5K9JL 2HKFH 5SX5H 4FFZL 4IRJB 4W88A 1QOXA 2H3NB 4GSDL 1N6VA 3U0WL 3REWB 2WANA 2W62A 4LSDA 4NSKB 4R96A 3RGVA 1T4KB 2GYSA 4FABL 4LLAA 1U93A 2CK0L 32C2A 5BROA 3NIDF 5E6ZA 2AGJH 2BXYA 3X11B 3R0MA 3VIIA 3PF2A 1L9NA 2BFVH 2ICWI 4WWKB 4LLMA 3S4SA 3KPNA 2R1XA 3FO2A 2CDGA 4LCCC 2H6PB 1Q0YH 1FZOA 5FB8A 5J13C 1BPLB 1ZHLB 5ESAB 3SJVA 2D7OA 4HIHB 4MJ6B 2X4RA 3MLTB 3SDXF 1SBSH 2IAMA 1C1EL 4L4TE 5IQ9B 5JZ7C 5I8EB 4WUUE 1GRWA 3NA9L 1QKZL 3HPJA 2DKMA 2VZTA 5EUOA 3U6RA 4G6AC 1DUYB 1YY9C 5GZOD 5MHSE 2HT2C 4EDXA 1HX0A 4MNMA 4AYSA 1P1ZB 5J12B 2OSYA 3WSUA 4WFGE 3KL0A 2E9BA 3MLSH 4DKFL 4YIQA 1ZT7B 4QXUH 3TO4A 1VEPA 4UOQA 3C08H 5HI3C 5A6SA 1X7QB 1Q9OB 4DGVL 3P9LA 4AIOA 4TNVK 2YPVH 4XXDB 5AYIA 1A6UH 4QRQA 2W60A 1HKIA 2VC2H 3QO1A 3OQ3B 3RWGB 2F54B 2W61A 5L7XH 3H9SE 2QADB 4WY7H 4PREA 1MI5B 1U6AH 3OXRB 4FLOA 5DRZB 4ZYKB 1UB6A 4S3KA 3JUZA 4PUBL 1XMWA 2LFGA 1RU9L 2HFTA 3KPRA 2XTKA 3C2SA 1MCRA 4D0CA 1CT8A 4EBQL 5IESH 1C08A 3IDGB 4UDTA 5BVPL 4XAKD 2GAZA 3ZTNH 4R2GB 1G0DA 3JUGA 2R29H 1BD2B 5JORB 5HVHB 2UYLA 3MACL 4GMSH 4MGXA 5I75B 1BHGA 2PWDA 4XWOD 1NC4B 3FFCD 1FRGL 2WAGA 4BSWA 2BVYA 3L5XH 4LPTA 4X99B 3TIDB 1B1YA 1U36A 1I8MA 4UZSA 2YKLH 4JDVA 1EH9A 5FYJU 5H35B 1EDGA 3ES6A 3UTSD 5IHBA 2EDLA 1C7TA 2DQTH 3TH2T 5T1LD 4P7OA 1T04A 3QEQA 1YPZA 3VIOA 5C0CA 5C0IB 1U8QA 3LQZB 2Q1EA 1FVCA 2H32B 1W1PA 4J8RB 4Y19E 2DM2A 2WP3O 3BP7B 2YD1A 4PRIA 4JQXC 4K71C 4PRHA 2AV7B 4N8VG 1JF5A 3MCKA 3PUCA 5I19H 2Q86B 1BP3B 1QSEB 3WDHA 4JFVA 1X5FA 3OZ9L 3T04D 4U1MA 3P73A 5TE4L 1OT1A 5B3JE 3G6JA 4S2SB 5B38B 1KXQE 1VDGA 1AD0A 3JV6B 5KVEL 2CPCA 3C09C 5I1JL 2DQFB 3U5UA 3C60A 5CHNB 3V8CA 3N9KA 4Z76A 4WV1A 1NDGA 5FGCB 3QCVL 5JUEL 1P84K 4PMUA 4WUUD 4L1DA 5BQ7B 4KKAC 4Y5XC 2VUOA 4K8RD 5D9SA 1DZBA 1P4BL 3QUZD 4O02L 2L4OA 2DEPA 1HYRC 5IVZB 3TVMC 2VDMH 3TWCL 2XTJB 1AQMA 3CVHA 5ILTL 3KYMB 4UV4L 3PGDA 4X6FA 1G9EA 5SWZB 3SDDB 1T03L 2IPKA 1IC4H 2A83A 1E0WA 3MBEA 3LPFA 4RMRA 3BLKA 3RVUD 1JRHH 5ACZB 1S9VA 1ULVA 1YNTA 2ZUNA 2P5EA 2RFXA 4R7NA 3S36X 3TBYB 1N4XH 3QPXL 4S10A 2XZAH 4ZXBD 1A3QA 4LCWD 4B5EA 1T22A 1E6ZA 3O6LH 3O8XD 1WISA 3ZE2F 3MLVL 4TQEH 3WDIA 3CIQA 1KB9J 4ZOAA 1CGXA 4GS7C 3U46B 2E40A 2F74A 5I18H 3MGAA 3TA9A 3QAZC 2YBUA 3PABA 4MAZA 3RVTD 1F4XH 1F58L 3I85A 3JVGC 5C0AA 2VIRA 1AD9A 5ENWA 1E27B 2QQLL 5CJQH 3RWCA 3II1A 2GFTA 4IDLA 1VFBA 3AYSA 3BMWA 4IRSB 1ZTXL 1A7QL 5MEPB 2EDDA 2XN9B 1TTUA 1BYCA 2JB5L 4R97C 3QWRA 3U82B 3MCLH 3MXWH 1MCEA 4PTMA 2VX6A 3QQ4B 3VIKA 3GTNA 1Z0MA 1TTFA 2Q8XA 3SCQA 1MLBB 1TLKA 4ALAL 3MGTB 3CMOH 5GS2H 3LEXB 4N0CC 1G6RB 4OQTL 4WIWA 5FOJA 4PRPB 3G5YA 2WINA 4NO3A 5E5UB 2X9WA 3QZWB 2RBLA 2NNAA 1I3GH 2P48B 4EQ2A 4X6DE 4L4PA 3F7RA 4RSVA 3BI9X 3SKMA 4FQCH 3V4VL 2GFBB 15C8L 2P1YA 1NGPH 3EZJB 4QHKJ 3PZIA 4LVOB 2YL9A 4LPXA 4P9HL 2EXYD 1B3WA 4KQ4L 5C09A 5TE7H 4TVSa 2HFFB 1HXYB 5D93B 1WBYB 3G5VB 1D2KA 3K2MC 5HVWA 4CU7A 1GL4B 1LHZA 1A6ZA 3QUMA 2BJML 4Y19D 1CLVA 3RP1A 3T3PE 1UH3A 3WIHA 4LASH 1T20A 4TVPD 3MJ9H 3AY4C 2A6KB 5FUOL 2E6PA 1MFEL 4LU5L 3T0XA 1YN7A 1PKQA 2C9AA 3GZAA 4M1GH 3D0VB 3GMRB 4HTYA 3R1GH 4HWEH 2O9PA 3O9WC 3L4TA 3UPCA 3U48A 3FNDA 5C0EB 1JF1A 4GUPB 1RZIA 4EKJA 4LCCA 5ITFA 4CGTA 4MQXC 3BVNB 3LPGA 2BVEA 2EO9A 3H3PL 4FG6C 4XNQB 5DO8A 1HH6B 1MHPH 3QIWB 2O5YH 4OJYA 3P11H 3WNKA 1QNOA 4YN5A 3KYNB 2YC1B 4CN4A 4RGOL 5AYBA 4M61A 3E6FA 4M5ZL 4PPTA 5C07E 5HDBF 1WC7A 2OSWA 5DJXA 4YDKH 1A4JB 4P2OD 3RWEA 4KROC 2XQYG 3H7BB 3W11C 4XC1H 1CE6B 5INCA 4J23A 3M45A 4NKIH 12E8L 2OP4H 3MJ7B 3STBA 1A7NH 3UROR 2VCBA 3IJSB 2CR6A 1A5FL 2X4OB 2F2HA 3WJJC 5DJ2A 3I6GA 5FOBB 1S3KH 1F45A 2IANB 1YY8A 2H1PL 3TV3H 3ZE1F 1P6FA 3LS5H 1W1TA 3CFJA 3IETA 4XNZB 3OKOA 1B2WH 1FCGA 3IJHB 5E8NA 1UM5H 4MXQC 3VD3A 2GUOA 4WIQA 2DLTA 3V5KA 1B4JH 3GI9L 1GCFA 1H8SA 2FJHB 4H8VA 1KF9B 2YEZA 3RWIB 4PJ8C 4L8DB 5T1KB 3VXRD 4DUVA 3CX5J 2XA8H 5FHBL 4M82A 1YEKL 5HGBA 4HBCH 4LPCA 5HPMA 2GUYA 5F9WB 4YXKL 5BO1H 4DVBA 3WKZA 1VACB 5E5MB 1OW0C 5JOEA 5BXFA 1MQKH 4YDIH 4D6JA 1AKJB 4NN6B 3AU1A 5GGVH 3VFRB 3UYRH 4KPHL 3ARFB 4BZ2H 1NARA 3BUYA 1FNFA 4UQ2B 1EZVY 3CLEH 4L3CA 3VG0L 3PDOA 1AY1L 2LTQC 2MOVA 4TTDC 2YLLA 3HU7A 5IK3B 4Y0GA 5JQ6L 4YC2B 3UC0L 2DD8L 1VADA 4MA3A 4E0RA 4OZGA 5JPNB 3EYPA 4AD5A 1R3LA 3JV4B 1HKLL 5J4MA 3BX7C 4P49A 4NJ9H 5IR1A 1KCRH 4W4OC 4JQXA 5ETUA 2ERJC 3CZGA 4WKAA 1A1NA 2OBGA 3C87A 1KCVH 3EGSA 3CVIL 3WSQH 4UB0L 1IGYA 1ORQB 4FRWA 4RZCA 4YK4B 5DTFA 2O5XL 2PN5A 5IGXL 3DUSA 5HGDA 5GSVA 2UY4A 2YSSA 3ZKMC 4DQOH 4FQJH 3MMEA 1MXGA 1NGYA 2D0HA 2NXZD 5D8JL 4PB9L 3VOCA 3IJ9A 5FGBC 3EHBC 3ZL4H 1JGVL 1W2VA 1TVHB 3ESUF 4K23L 5A2BA 1ZA6B 4AK1A 3KG5A 4W8LA 1EHXA 5M5DA 2NY4B 3MV7D 2O93L 4Y5XA 1KEGL 2OWCA 2J6EA 2EIZA 1XCQB 1IKFL 4MMXC 4OGYH 1TJHL 3TVMA 5ICYA 3WF1A 3MUAA 2X4UB 1RK1A 4JN2A 5F6HI 4QDMA 1HNGA 1QI5A 1CDBA 4MA7L 1IGJA 3SJVE 4HD9A 2MCPL 3MV8A 1QLRA 3PNWB 5DJZB 3P40A 4K8RH 5I1CH 1VPOH 1NBYA 5EIVA 3BJLA 3K81A 5EUOE 1GGBL 1N0XH 4LHUD 3TT1H 2DQHL 4EI5A 1KV3A 4PJIE 4WJ5A 1F13A 3TN0C 4LSUL 5ITBH 2A6JA 1UD6A 5TD4A 3VE0A 5DJAB 2FCBA 2CKNA 5F1OB 3SPVA 3FTGA 3AIVA 1CBGA 1B6UA 3AS3A 5DD3H 5EO9B 5DDHA 4NQCB 2P7TA 3TJHD 4QHUB 1MWAB 2F8VA 1UM4L 2AABH 3J7HA 3JVGA 2A3CA 3ORJA 2N56A 3GSVB 5JDSB 4FZ8H 5D1XB 7FABH 3IGAB 2W9EH 2WB5A 4AMCA 1U92B 3LEVL 4JL1A 5D71H 5I8OL 4LLYA 4BFGA 2EPNA 4UILH 3RY6C 5EZOL 4Y4KD 5KSUA 3CMGA 1CFNB 2VDKL 3ZDZF 3BAEH 3V0WH 4P9HC 4RMQA 3OF6D 1CIUA 5EIIA 2J8UB 5F7DB 3BC9A 3P77B 3PL6C 3U4EA 4JJ5A 4YFLF 3KPRE 4LYQA 3DETD 1GQJA 3WFHB 4WTXA 1UQSA 1TFVA 2HFGH 3RDKA 4NQUA 4MHHI 1QRKA 2C7UB 3RZCC 3BGAA 3BGMB 1JNNH 2MPAH 3ARGC 3MLRL 1FZMA 1WNOA 1FPTL 5ISZB 4HZAA 3CCHB 4LARL 3W53A 4V1DD 5F88B 1JWSB 2GJRA 2EPOA 2H2PC 5KSBA 1IAII 2E3VA 4G9FB 2YD8A 4N8VA 3DURB 1MRDH 1PSKH 2HP4A 2DWDB 5CD5C 2ORBH 2R4RH 4AEHL 1HSBB 3AY4A 3E0GA 1V6XA 1CZ8H 5I8KH 1QFUL 1WIPA 3H9HB 4HX1A 2Q8AH 5C0CE 2COQA 4H25A 1KNOB 3LKOA 3O9WA 3U7WL 1N2RA 2FL5B 2A3AA 5I1EL 4U1HB 1MXDA 4HUXA 4TVPH 4WNQB 4PRIE 2GIYA 2I27N 4HWZA 4ZG1A 4U6VH 4PJGA 3PZVA 5D7LB 5E9DD 2CRMA 2PCPA 3PWPA 5AG9A 2VRQA 1QLFA 1YC8A 2ATKA 4PRBB 4H5SA 1B3XA 4L3ED 1SJXA 2MMXA 5F7HA 1AO7E 4JEGB 3MRIB 2Y24A 3QEUA 3HC0B 2J88H 2VLJB 3BAWA 4GKNA 4ZAKC 3FO1B 1KPRA 5CIPH 1ROWA 4DZ8B 2V2TA 4MB1A 4WCYH 5IBTL 4UQBA 3D85D 1RPQA 4K55A 3EIFA 1BREA 5IJKC 3A6BH 4XCEB 4I5BB 2PXYB 3H0TA 3CFEA 4FXKB 3WJJA 3WD4A 4LKCA 4AQ1B 1BWWA 3CK0L 1A1MB 4TYUA 5F7YC 3VO0A 2XRAL 4HUVA 1OD7A 4BFEA 3KPPA 2CKBH 3PHOB 4POZD 1UWUA 1UWGH 2A0LC 2MSPA 1HHGA 3MNVB 3EKCA 4NC0B 4LAJH 2GITA 1MHCB 3OKNB 4X7TA 3RKDD 2QHAA 3DSNA 3AIWA 5DEGA 4GQRA 2V2WB 4FFWC 4C55A 1OB1A 2DLHA 3F58L 4QTIL 2WKLA 5ABGA 3GSQB 3DGGA 4OZIF 2Y23A 3VD7A 4W6WB 4L9DA 3J8F7 1CLXA 4GRMB 3V7AG 4ZUSA 1EJOH 1DLFH 1CLZH 1K2DB 3GIVA 1IGFL 2F53B 4F2MB 1T1YB 2VQ1A 2PTTA 1ND0B 1SMDA 4NM8H 2X1QA 3T4AA 1CFSA 1TCRB 5A2IH 1DP0A 4WTZG 4EVNB 4IHOB 5FO7B 2ZX7A 5C0AE 1NBZB 5C3TA 2FJGB 3VGDA 5FK9A 2XY2A 1QP1A 3PZNA 5ESQB 4FTVE 3MV01 4UTAL 2V3GA 3AMDA 3AHZA 3NACH 5EU6D 3CGTA 4GKOA 4ORZC 5D5MB 1N7MH 2A1WH 4HKBB 2OR7A 1ZL1A 3RUGE 5J7CC 1RIVH 4PGEB 4JR9L 4ZO6A 2IBZX 3FQTB 2V17L 3WHE1 2OSXA 3QFJA 2DQCL 4HKXA 1NC2B 2W9LA 4W8AA 5FUZH 1G7PA 3GO1H 3C6LB 3KYKL 5HHME 3KL5A 1HINH 4JANA 3QO0B 4W4OA 2J77A 2O9TA 1WAAF 1S9WB 5C2BH 4HV8B 4XPBH 5DI8B 2UY2A 1XRVA 1UCBH 4ELKA 2HFEB 4OLUH 4P2RE 2ZCKL 3U4BL 2V6HA 1XF5B 2FSEA 1NGZA 4DM2A 2BNRD 1U8HA 2E7CA 2CBJA 3W0WD 1JDDA 2CDEB 1K4DA 2DKSA 2DQDL 3D69A 3M8OL 5FGBA 3S35X 3W4RA 4AZ5A 4NRZB 3L95A 1INDL 1RUKL 2R2CA 2E7MA 4F37F 3MNWB 2OL3H 3OLEA 2XZQL 5IBUB 4IS6A 3BQUD 5EDXA 1NFIB 5IHSA 3V5DB 4BUHA 1PDKA 1TZ7A 3BISA 1S5HB 4R26H 3BKYL 4GKSB 1A7BA 4GXVH 4WUKL 4WVRA 1D5IL 1WV7T 5IKCA 1AO7D 1Q9KA 3OAUH 2WW8A 1TJGL 3EMZA 1OCWL 3CZFA 2OJEB 3TT3H 1V7NL 4HS8H 5HHQB 5IOPB 5H8DA 4HCRL 1ONQA 2EXWD 4KI1A 4JFQB 3D3AA 3SCVA 2UUDH 3IYLW 4WFEE 2WIIB 3SQOL 2DLFL 3TN0A 2JALA 1Q9LA 4XMKH 4HS3A 3MLPA 5FM5M 1F6AB 3KLAA 4PRAA 4CADB 4I0PC 1DLHA 3VPLA 4UUJA 1S8DB 4XPHL 3CZLA 5TPWL 2YZ1A 2ADFH 2FO4A 3WEXB 4OQTA 4R90H 1ZT4B 5M03A 4M6OL 4JQIL 3SUWA 3TBSA 4Y2DB 1RV6X 2DI8A 3G04B 3BZ4A 4NCC2 5J6HA 1Q94B 1WVZA 5C9JA 4QTHB 4EOWL 4N90E 1GHFH 3AREC 5BV7L 1FO0B 1KOAA 5ADPH 5IHUL 1T7XA 1EEYA 3RY6A 3STZB 4YDLB 5FO8A 3VFUB 1II4E 4XBGB 1BVLB 5CP3A 3VXMD 3MOBL 2AJVL 1RMFH 3H9ZA 5I1HH 5JHLL 1IAKB 4Q6IB 3OJDA 2RCSH 3PL6A 4U0RB 3EO1A 3HR5B 3OV6A 3T2QA 1RULL 4KK8C 1ACYH 1W1YA 1IC7H 3CHDA 5AYUL 1MCLA 3G6DH 4NZUL 4WI4A 1FL6A 3VFNB 3L6FB 4FMKA 4FTVD 5DZNA 3RZCA 4WI3A 2WUCH 5E7FA 3QCTH 4RFNC 4ENEC 4C58B 5DHXB 3ARGA 3SGDH 3GSUA 2EEAA 3EFFB 2HRPH 3UTTB 2BERA 5ID0A 1YDPB 2VLRA 1DBJL 3O3BA 4JPIA 5ANMB 2WC7A 3B9VA 1IBGL 1W2KT 4UT7H 1PZUB 2Q8BH 3SCRA 1GIGL 2NY2C 4AXNA 2M8XA 3RWHB 3ZKNC 2GTWB 1Q72L 1ED3B 1L7IL 4D6DA 5DFVD 1RZGB 43CAB 1MCKA 5T1DL 5HYJA 2A9NL 2X89A 2E4TA 2G3NA 1W3JA 1NANH 2BY2A 4X4XA 1ZE3C 4JRXE 4XVTH 4OZHE 3CO4A 2Q7YA 4DOHE 2NW3A 1MAML 1U30A 3MSGA 3WEOA 3RIKA 3BN9C 2OK0H 4F8QA 4QT5A 2ZJSH 4RAVA 4PGCB 4J28A 4LCUA 5SWQA 4MA8L 2J8UF 4RAUB 1HF6A 4MS8D 4F15B 5F7WC 1A6WH 5CBEA 3DX6A 2VDPL 4QHLB 4S1RH 2UZIL 5BRZA 5BWFA 3UJIL 1CBVL 4POYA 2GJ6E 4WWID 2BXZA 2R0KL 4Z7WB 2WPGA 4H2CA 2ITDB 3BD5A 4RA3A 4ZAKA 4Q0XL 2QSCL 2P8LB 4YBLC 5F72S 3JWOL 1T5XB 1BAFH 4KTYA 1CD1A 4TPRL 5IJKA 1P7HL 1AP2A 2QTEA 2FATH 4N8PA 1XCXA 1HHKA 3L3JA 5D7JC 4Y1AA 4MNHA 1BPVA 1TA3B 4G6FD 1A7RH 5I2UA 4X0KB 3VRLE 3TBTA 2EH7L 1JMZA 3D3VD 4L8BA 1FZKA 1ADQH 4OIBA 3MV8E 5J1AB 2R2BA 3DV4A 4U1IB 3VGGA 1R7AA 1BFOB 4QOKE 2NY0C 1YYLL 3AS1A 2EBNA 3N1MC 1ERNA 3SKUD 2EEXA 1XH3A 2GK0A 2PTVA 4OSUH 4R7DB 2WLYA 1E28A 3D48R 5B21A 1BVNP 3Q5OA 2VDLL 4IMKC 1GAFH 2ZUVA 4TRPH 4X6BB 4O2FA 1A47A 3BPNC 4PFEA 1XGQA 1KEMH 5LWYL 1RQ5A 5IVXF 4CVXA 3ARTA 5E8DL 4PJFA 3S36H 1AGEB 3GMNB 4HK0A 4HOZA 5FECA 1PX8A 2F61A 2E9JA 1QVOB 4NQXB 1Y7VA 5HHVL 4PIRF 4MPKA 3PP3H 1H15A 3IDMA 3QQ9D 2XVGA 4OGAC 2FDBP 3FFCB 1VFMA 4ERSL 1I7ZB 3HZKB 4QHNA 3SDYH 5ABHA 3OG2A 4NUGL 4UQ3B 4YWGL 3LQAH 35C8L 1LO2L 2EYSA 4PCSA 3Q6FA 4RNRB 3A67H 2WZIA 3UTSB 4BA0A 1OF2B 3VIPA 1ZK9A 4Y4HD 5T1LB 1Q0XH 5HHPB 2IGFL 2YWZA 3HS0A 4WU7A 4DN4L 3QSKB 4N0YL 3OGCA 1ES0B 5GNYA 2V2XB 4NQDB 5FDWA 2A6IB 1UM6L 3WLBB 2A6DA 3KHOA 2DQIL 2X4TB 1NJ9A 3TTOA 1TVDA 4G7YL 1K9DA 1CGSL 4OAWB 5IB4A 4L4VD 1GVYA 5C7XH 4RMUA 1I9RL 1T5WB 3MRHA 4LP4A 2HKHH 1MFDH 4O58H 4LBEB 3NZHH 3BWUC 4J3VA 3P4MA 4DWSD 3W24A 4JRXD 4G9DB 4FK9A 3MXVH 1BJMA 1DBKL 3QJHB 1NGQL 4WKFA 3TYFA 3IAQA 3T0DA 4HLJA 1FNGA 2WCAA 1W3HA 1K8DA 4RIRB 4GO8A 3U9UB 3UJTL 3L3DA 3MRDA 4O9HH 2ITCA 5EC1B 1FE8H 4ZPTA 4JG1L 4CVUA 5M3WA 3T0EC 1FIGH 1BZ7A 1G9ML 1SJHA 2GJ6D 3MODL 4FQXC 5F9OL 3W9DA 3KVQA 2VE6B 4GG8B 4XC3L 3QR3A 1FJ1B 1U8LA 4HF5H 3SQBA 4M81A 4LCWB 1V0NA 3RAJH 5K9KB 3HI1B 2Y6SD 3IB4A 1EEUA 4L8SC 1UD5A 1IT9L 5BV7C 4UNTA 5T3ZL 1VJSA 2C8NA 3O8XB 2C1PA 5DD5L 1MEXH 1I8IA 2NTSP 1DBAH 1U91B 2P8MB 5BW7C 4I0PA 4PEEA 2YKKA 1G7QB 4BH8A 4JB9H 4TUKL 4CUCA 4HWNA 2AK4A 5CP7B 3NOIA 2IPTL 3W26A 5DK3A 4JHAL 3L4ZA 3MMDA 5A16B 4CMMB 2XYCA 3UTQB 1HQRB 2CBUA 2IBBA 4L29B 5EN2A 1J0HA 4PR5A 5DFAA 1M1SA 4LLWB 2G5RA 3AREA 2ICEA 5AC5A 1WFUA 4A6YL 1G7MB 4NKQB 1PZ2A 3MLWH 1CFBA 2J7FA 3IT8D 4OFYA 3GKWH 2JCCA 3BWAB 3VXTA 1AQHA 1XZ0A 4XNYH 3CDGA 4HQQL 5JW3L 1BJ8A 3ZR6A 4U5KA 2AI0L 3CNKA