3TP4A

Crystal structure of engineered protein at the resolution 1.98a, northeast structural genomics consortium target or128
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
465
structure length
454
Chain Sequence
DETIAIVDADATAETRSLLSYLDGVRGEGILFGHHGTTSSGLTTGPTDGTTSDVKNVTGDFPAVFGWSTSIIEGNQRPGLAENTRDENIALFADYIRKADAIGGVNTVGAGVENFVTGGSFYDDTLRAVLPGGSHHAELVAYLDDIAELADASRRDDGTLIPIVFRPWHENAGSWFWWGAAYGSPGEYQELYRFTVEYLRDVKGVSNFLYAWGPGGGFGGNRDVYLRTYPGDAFVDVLGLDTYDSTGSDAFLAGLVADLRMIAEIADEKGKVSAFTRFGVSGGVGTNGSSPAQWFTKVLAAIKADPVASRNAYMETGENADAGQHFVPVPGDALLEDFQAYAADPFTLFASEVTGAFDRTVAAAPAQPVVHIASPADGARVASAPTTVRVRVGGTDVQSVTVEVAQGGTVVDTLDLAYDGALWWTAPWSPTYTVTATATTAAGTLDVTNEVAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords computational Design of Enzyme
publication title Design of activated serine-containing catalytic triads with atomic-level accuracy.
pubmed doi rcsb
source organism Synthetic construct
total genus 153
structure length 454
sequence length 465
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tp4A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3tp4A01
3G6DL 3E6HA 3SCPA 1PVHA 4M43L 1GHSA 2AEPH 1GZQA 4ZEPA 3SKMA 3IDMB 1CGTA 2IGFH 4WIQA 3WJJA 3RL1B 1HOCB 5CD3B 4OI8A 4LPVA 4NFDA 4JREC 4HWEH 2DQXA 2DRUA 3ZKNC 4DTGH 2GTZA 2E8ZA 4EOWL 4Y16C 1IBGH 2OYPA 1MI5D 1BQLH 5EO1B 1Q9OA 3GNMH 2UUDH 5AUMA 1ZHNB 3AIRA 4MQSB 5IEHB 3QCUL 4Z7UE 1M01A 4OF6A 5DMIH 1T1YB 4ZENA 1I7UA 2XVNA 1KTLA 3C2SA 1A6TA 3QEQB 1VACA 3WFBH 1JWSA 3IDNA 3TO2B 3BPNC 1KCSH 1E3XA 3BHBB 3DRTA 1AKJA 1DBAL 5L9DH 1T7VA 5C0EA 4XMKL 1G1YA 1XGTB 2P42B 2W91A 4XNXL 5H94A 3AU1B 5C0CE 3CZLA 2DQEH 2E9MA 2YBUA 3EOBB 1CBGA 5JMOC 2ZPKL 4XPFH 5ESAA 5SWZB 5ISZD 5IVXE 4FFVD 3B9AA 4D6GA 3L3JA 3FTGA 4MXWH 4LCCA 1T7WA 4OUEA 1TCRA 2FCBA 3QDAA 2X1QA 4UMGA 2B7DT 4P2CG 1WWWX 3RTQB 4MZ2A 3JUGA 4UZSA 1BZ9B 4ISVA 4TSAL 1FL3B 2H26B 2VRQA 5IIEA 5JMRA 3ZKMC 3AAZB 4K3EL 2AI0H 4FP8H 4OKVA 3ZZ1A 2WMIB 4RGMC 1LF1A 6CGTA 1RK0A 4M62L 2EYTA 3ULVD 4J6RH 4QRSB 4JPWL 3JTSA 4Z2LA 1Q72L 4TSCL 1UQSA 3MJ8A 4OZIB 1WCGA 3FQUA 3TF7C 3EYOB 3D1MC 3DLQR 4HBQA 5GGSA 1T83A 5D7IB 4NQCB 32C2A 4ZAKB 5GISL 3QEGH 3R1GH 3JV6A 2PWHA 4E41D 5ICZB 4UNUA 5TJWK 4ELKB 3QIUD 1QD0A 1M7DA 1UM6L 3PXHA 5IMOB 2BERA 1NBZA 5MEQA 5FHAL 2VISA 4PJFF 5I0DA 4W4OA 1DEDA 1AGFB 4PJBE 3WUWG 1QSFE 3S35L 4L4VA 1LD9B 1EVUA 5MP6H 2VITA 1NOUA 2F5BH 4CKVX 5BWFA 2IPKA 1L6ZA 4JPIB 3VXME 1UACH 4OV5B 1P6WA 2ARJB 4M7KH 2FR4B 1CF8L 4URTB 5C0RL 2FHBA 2PXYA 2O5YL 3PP3H 1EJ6A 1L0XA 5EOTA 3QUKA 4X9FA 1OAZL 3LPPA 3EDKA 5C6PB 1UA3A 1G7JA 2WM0A 4EVNB 3MCKA 5F9WC 3KJ6H 4PGDB 2FGWH 4Y7EA 3D3VB 4NHCL 5F7DA 2WAGA 4B5EA 4ZYKA 3PBGA 1W72B 3H8NA 4QNPF 4OUOA 4GRLA 2NXYC 1CFNA 5JHLL 1AQMA 1QR1A 2QQKL 2EXYD 4MB3A 4DW2L 5F7UA 3VD5A 5CQ1A 1MCSA 3WUWA 3MV8D 5I19L 1BP3B 3G5XB 4XPTH 5FUZH 4C83B 1H49A 2JIWA 1U93B 1CXEA 4HXBH 2FX8H 3A6CH 4YHLL 4BQ6A 4NO0B 5C08A 5E9DB 4Q0XH 4W4NA 4GBXB 1MIML 1F6AA 4U6VL 5JLZA 5FB8B 2N7BA 1AQ0A 5DA0B 1J12A 3EJYD 1JRHI 1T20B 3ARFD 2JCCA 3BE1L 2XPGB 4JHZA 3WIHH 4NZCA 3VH8G 2WINB 5ADPL 1FGNL 3Q6FB 3D39E 5E5UB 2XM2A 3VKKA 4LIQH 4Z7NE 3VGHA 1XCXA 1HZHL 3PWPD 5BVPL 1ES0A 2ZX6A 4QLKA 1R3JB 3LS5H 3OKEB 3BWAA 3V9FA 4JY6A 4POZD 4HCRH 2PW1A 5B8CA 2CHOA 2X41A 1T03L 3BPLB 1CE1H 2DH2A 4MJID 3GSXB 4EQ2A 5GS2H 1IAOA 4W7UA 5F89A 2UY2A 3QDMB 1C8QA 1QNZH 4NQTA 3T0DA 2DT2A 2BSRA 2H8PB 4CMMB 5D7JD 1FIEA 1V5JA 5B39B 3PDDA 3QO1A 5SX5H 1QOKA 1QBLH 4AD0A 2IQAB 4YNYA 1HNFA 4HS8H 2ZCLL 5HGAA 3QUXB 4I18A 4E0RB 4OFKA 5AWNH 3NA9H 1H3XA 2FJHB 3GZAA 4ZTOH 3JWNC 1EAJA 5DC4B 2WLZA 4FLOA 1F4XL 2CLVA 3TIDA 1NGXB 2EYRB 2PCPB 4R26L 4P9ML 2UY4A 3SIMA 5A2JH 2BHZA 5HHME 3FJTA 2OR9L 5KSUB 5KSBB 3HFML 4OD1L 5BVJA 3G6JF 4NO5A 4HH9B 1T2JA 5DD6B 4CN6A 4HK3N 3CFBA 4XPBH 4KXZI 4OIFA 3BP6A 3VFUB 1B30A 4Q6YA 2G60L 3KLDA 2BMKA 4XAKE 1LK3H 1GOWA 5IFJA 1YYLH 3T0EC 2IXVA 3ARBC 3WEOA 4CW1A 4X4ME 5E8PB 1RVFL 1QFHA 4UQCA 2NXZC 1EXPA 2C4FU 1BFOB 4Y19B 1G7IA 1DLFL 4G8GD 5ACZB 5A1AA 1WEJH 2JJTC 3KYNA 3PZVA 4OM0L 1SYVA 3PNWA 4LLQB 4G7YL 4UU9B 4GINA 4NI3A 4X7SL 5CEYB 5GJTH 2MQ3A 3V7MA 1AFVL 4S1SH 3N04A 1A1NB 2CDFA 4UOZA 4H0IA 3QG7H 3O2VH 4Z7VE 2VMFA 3ZDYE 3OKDB 3IFPB 3LB6D 3EO0B 1JWUA 3MLZH 3C8HA 2B20A 1ZVYA 4PJAF 5CXPA 3ZYIA 4EDXA 1R3HA 4ZTPH 2AAVA 1VFBB 2R1WB 1A9EB 1B3WA 1ITXA 1H11A 3SCWA 2GFTA 4NC0B 1MXGA 1NCBH 5LGHH 3QEHB 1GGYA 1OAUH 4JDZB 4NQVA 1RFDL 2HVKB 3HCVA 3AS1A 5L2KA 3MGAA 5CZVL 1Y0LA 3RVXC 3IJ8A 4L4TB 4YC2B 2R56H 3BZ4B 5MENA 5DUPL 3MO1B 4XC1H 5DD1H 1IAII 4M6ML 2X4RB 3HMXL 4MGXA 1RH9A 1FE8H 1KJ2L 2V3EA 3MOBL 5HI4C 5J6GB 1RHFA 2J47A 2QKIA 5DLML 4YDIL 3TJHC 2GSIB 1UM4H 2CUIA 3H9SA 4YK4B 1U58B 1M7IB 3J7HA 1MXDA 2YKKA 3GUTB 2WP3O 3UERA 1GXEA 3D0VB 2DQCH 3AHYA 1NAKH 1I9RL 1NFDB 5E4EB 5ESVA 3CFIC 3RDTB 3C2AL 3MXWH 1FL5B 5FYKD 2CMRL 4TNWF 1GGBH 3GHEH 1JPFA 4OZOA 2B0SH 1PKQE 2IUZA 5BXSA 1WICA 2B4CC 4PRIA 5IMKA 1Z9MA 3LKNB 4KKAC 3ZJ8A 4TTDD 2J8HA 5JPMB 1HSBA 3L5JA 4YHPB 1IAMA 2BXYA 3KS0J 1NGYA 1AXTH 1EJOH 3PWLA 4R4FL 3SCVA 1J9CT 4ZUUA 5CUSL 3RL2B 1OM0A 3W4RA 1F4YL 2J5LC 4F8QA 2OI9C 1VF8A 4U6HB 5FECB 4GKSB 2XG5A 4J23A 4ONHA 1P84K 3UBXB 4U2YA 1UWGH 4QYOB 1GHFH 4PJXE 4XVUC 4OOUA 2WVVB 3TT1H 4L3EB 4CCDA 3EYUH 3A4WA 5I1GH 1SY6H 3HS0A 1QA9A 4WU7A 3UG3A 4U6XA 4OAWB 2YDSA 4EXPX 3IXAB 4DGYH 3WIHA 4NKMA 2H3NA 3RZCD 3QQ9C 1YEHH 1ONQA 5D1QD 1XYZA 2J88H 4KDTC 4OLVL 3D69A 1FP9A 2P8PA 3C87A 4KMQA 2W5FA 3GI8L 3WBAA 4XP4L 1B31A 2VDPH 4U0QB 4U31A 5I74C 3S34L 1J0JA 3KPQB 4LKCB 4JLRB 2VXUL 3NIFE 4HCRA 3DWTA 2V5TA 4PRDB 1S7XB 5EO0A 5CEXA 3DGGA 2DJSA 1P7KB 4OLUL 3FN0L 3DVIA 1TNNA 1D5XB 4JM4L 1O6IA 1HCFX 1KC5L 5EZLA 1ZHBA 3O81A 1QHZA 3KWXA 5D1ZB 3Q0HA 1XGUB 4O5LL 4WV1C 2Z92B 3CVHH 4LLDB 5EUOF 1F5WA 3C6LA 4HUMB 4Q9QL 3SGJC 3WNOA 3G6MA 5SV3A 3BD5A 3WD5H 5IB2B 1QI0A 2XIDA 1XCTB 2ADGB 5GS1A 5DYOA 4WJ5A 5FCSH 2DIAA 1MAKA 4X9BA 3IDIB 4NO2B 2UVEA 4YFLF 1B88A 4NKDA 1G9MH 5DJYB 1E5NA 1KN2H 4DK3A 4X98B 4HU0A 1DTUA 3T0BA 4ZNEA 4RCAA 1MHPH 1JE6A 1FYHB 2OQJB 2BDNH 3LKOA 4UDUA 3ZKND 4Y16D 1BG9A 3VXRD 2J7BA 4IMKC 1CFTA 4FZ8L 3S2CA 1GL4B 4LPTA 3V5DB 4YHKL 4FXGB 3TZVB 3RM9A 3VIMA 3VIIA 4W86A 4XHQA 1KLGA 2RFXB 3SKJH 5DFTA 5K93A 2A6KB 4UDTB 3VGAC 1E28A 4KQ4H 2N1KA 3QI9B 4NM8H 4ZUSB 3GSNB 1A0QL 5TE6H 5IESL 3TN0A 4RMTA 2Z91B 4AZHA 3K8LA 2WMFA 1BEYL 1P5VA 2Q86A 2NY6C 4PJGF 1D5MB 1ORSB 3LDBC 5KS9F 1ZT1A 3BSGA 3NA4A 2YEZA 4U1IA 1UJTA 3W24A 1DVFB 4EIZC 5EU7C 2Q3AA 3WFLA 4JG1L 1R8LA 4UCFA 1L7TH 3MRNB 1F02I 3O9WC 4G6KL 4PLKC 5I17B 3BEWB 1IZJA 4WU5B 2BJML 1EHLL 3MV8E 4IRSB 1HXJA 4LEXH 1CPUA 4IISA 5T3XD 3VXNA 1X4YA 2DI8A 5E6IC 1BREA 3ZKMD 5IB1B 2JB5H 2ORBL 2ZKHH 2G3JA 2CLRB 4CDHA 1KJMA 2DQFA 3P40A 1UWEL 4W6XB 3CPUA 4PJEA 5D2LF 4DN3L 3W0KA 4L8CB 4H7VA 3JWOH 3LH2L 3CZFB 4CL7A 3VI4F 5E2VH 4HPOH 3ALFA 4JHAH 1MCDA 3C5SB 3MCG1 2J6EH 3K74B 4RAUA 3UPCA 1ACZA 4EI5A 3HNSH 2V17H 2VUYA 1WT5A 1GOKA 5AC4A 2LFGA 2XICA 3U36B 3CLWA 2FECI 4FQ2L 2AS5M 5A8NA 4NKIH 4TX8A 4LHJB 4DVRH 3MC0A 1CGSH 4QOKA 1Q9WB 2AVGA 5ENWB 4F7EA 1I1WA 1CLCA 5GS0H 2AJSL 1J10A 1T5XB 4GG6B 1SYTA 3C60D 4N8VG 1QBAA 5KZCD 2EE2A 3S5LA 1T4KB 3DOSA 1EA9C 4TYUA 2DWEA 3W81A 5E6ZA 1MAMH 4OTXL 4MHHI 2BVOB 4NRZB 4O51A 1T0PB 2BK8A 1IGFH 1QYGH 3RWGB 5IB4B 2DDXA 4JRWA 5DHYB 4XC3L 5E5MA 4FTVD 5KVGH 1RZJL 3PZNA 4R4BB 4BZYA 1WKYA 2GJRA 4EKJA 5M94B 4WW2C 2NXYD 2QHRL 2D7QA 4N0RA 2VX5A 1AXSA 3IXTB 3QJFA 5DD5H 3K7UA 3MJ9L 2X8RA 3TBWB 1XD1A 1JV5A 4Y1AA 2OR7A 1SY6A 4BELD 5J13B 1QFWM 4NKQB 5B3JE 3BPCB 1BECA 4PR5B 3WHE0 4LRIC 5F9DC 1EEZB 3NACL 4K7FA 1W2KT 1ETZA 5IQ7L 5K9KB 4HKZA 3L4XA 3U79A 4JFZH 3WKML 3WY1A 4K71C 1JK8A 1AGEA 3FO2B 2FSEA 5EU5A 7FABH 1G0CA 5LJYH 1ZEAL 1KGWA 1P2CA 2NY3B 1E4XL 5CHNB 3RNKB 4KK9C 3KYOB 3L3HA 2HT4C 3EYVB 5E1HB 5K9JH 2GFBB 1JNJA 4X80H 4X6BB 5BXFB 2XXCB 3PABA 2WBKA 4UIMB 3U7YL 4G6JL 2GSJA 2WC7A 2KDGA 5GGQL 4PMDA 5F9JB 2R2CA 4WUUD 4FK9A 2C1PB 4GAYA 1KJVB 3QR3A 4U2ZA 3ZIZA 2R1YB 4P59H 4UFKA 4Z0BL 2EE9A 1VFFA 4M7LH 1T2XA 1HH9A 3IETA 4ALAH 5EBMB 3SDCB 5K9OA 4WI9A 5GGRA 1P4IH 1C08A 2PC8A 2XM1A 2Y36H 4AG4L 1EH9A 2Q76B 4AZ6A 4OCWL 3TNMB 1RIUH 5I16A 2R0WL 2YMXH 2R8SH 4JQVC 1OSZB 4MJ2A 3LHPH 3B9KC 1JTTA 3SKOB 4LYQA 2VAAB 1OB1B 4M7LT 3QHMA 4WRLA 1IEAB 1KG0B 1MCEA 3GZKA 3STZB 4NZTH 4C7GA 3LKSA 1TMCB 5F1NA 3FMGH 4C7FA 5DVLA 4D9RE 4JVPA 4LBEA 1T22B 1DWGM 4GSDL 3V6OE 1IC1A 3VXQB 4H41A 1FYTE 4P23B 4UUJA 3RWHB 3OB0H 2WWKO 5LCVH 2EE6A 3KPRA 4PIRF 4P3WA 5D96B 4HU8A 4RISH 3Q48A 1J0IA 4JFQB 1RUKH 4DUWA 1IBGL 1BLNA 4LSPH 1BQLL 5L0QB 5TDOA 3MMUA 3T0ED 2F74B 1GC1H 3ARBD 1TZGL 2XVGA 1UYWL 2D31A 1J7VR 4F7MB 2TAAA 2NXZD 4HJ0C 4ONGH 4XH2B 2E27H 1A21A 5CBEB 4N8PA 2O5ZH 5L9DL 4WWKA 4M61A 2VXSL 1IAIL 4CD4A 4KRPB 4U1LB 4PUBH 3DBXA 3HUJB 5L8LB 1IILE 1HX0A 4JKLA 1H0DA 4WFFE 2AJVH 5C9KA 4JFED 1HL9A 1WBXB 5T1DL 4F57H 4XXCA 3L95B 3U0PB 3V0AC 5HNNA 3QXAB 2GSGB 3PZIA 4UV4L 4WLCA 1FSKB 1DWFM 4B9ZA 4U1KA 4OZHF 3DYMA 3MV7D 3SCMA 3CJJA 4FS0A 2BVTA 4ELMB 2AXGB 5HGBA 4HIIA 2DMKA 3FB5B 4RIRB 4NRRA 1ZHNA 4JM2A 4RFOH 4BJLA 2X89D 1K4DB 1PX3A 3KJ4B 3TBVA 1B3ZA 5FDWA 2OLHA 4AL8H 2OYKA 5BJTB 3FO9A 3QEQA 3VM5A 3TO2A 5T1KD 2WCGA 1KF9B 1ZS8B 5D7KE 3RVXD 1U8HB 1CGXA 3QNYB 5A6KA 3P77A 3ZKSD 5HDLA 2OX5A 3AS2A 1XGTA 3MRPB 4YDLB 5IW6B 2OZ4H 1BQCA 4U4BA 2Z8WC 4Q2ZB 4MNHA 3UTQB 2VL5B 5SWZA 4AD4A 5HI4D 3W0WB 2R4RH 4NN6C 3O6LL 3TJHD 3BJ91 2P5ED 1H8NA 1EHNA 3IRPX 5I8CA 5LG1A 3U2SA 4NRSA 4JFHE 3P9LA 2L0DA 5C2UB 1ODUA 3FFCB 1U9KA 3HC3H 1GGTA 4MLIA 3VW3L 2NY0C 1OIMA 3LQAC 5DEFB 3BAXA 4RZCB 1FORL 4TVPD 1OAYH 3AGVA 2Q3ZA 3ULUC 3MZGB 3QFDB 2X70B 2Y07H 4TUFA 4M7KL 3EYOA 1CWYA 1WCBB 4KKAD 1D5BB 5I1AB 1AGDB 4LARH 5D7IA 1ZBCA 3QCVH 5F71A 3FQWA 1A2YA 4PMVA 1KNOA 5FEBA 5DRWA 1A8JH 5C9JB 5IEKA 3TIEA 2G5BB 2EZ0C 3HMWL 4YDKL 4PREA 4U1NA 1FRGL 2ZOLB 3VXRE 1N2RA 4TN9A 1A9BA 2GJ6B 3O4LB 5CIPH 3T0WA 4LLWA 4F15C 1ZV5A 1S7TB 2UWEA 5JHDE 1X5IA 2E9JA 2MTPA 3LV3A 1GYAA 3U7BA 1NC4D 3GMLA 4XVUD 3V8OA 1AGFA 1CK0H 1EO5A 4O9HH 5K59E 3BW9B 5DMJB 1ISZA 1ESWA 2B1AH 3NFNA 4ESKA 4HXAH 4ODXA 3TONA 5CWSB 5FUZL 1CTOA 1A4KA 4JPIA 3DX9A 1B9ZA 4JO1H 1UZ6E 3ZDZF 2FR4A 2YSSA 3T2OA 1GIGH 4R96B 1I8LA 3ETBF 1Y6NR 4G42B 1FV1A 3QQ9D 4KWUA 1RURH 2EYSA 5JPNB 4CVXB 3B3IA 3B8YA 4YGVA 4GT7A 4PTUA 3A6OA 4Z95H 2MKWA 3QUZB 3SGDH 1NQ6A 1KCVL 2R0LL 1YQVH 2GT9B 4U5IA 1XIWB 3TA9A 4QF1B 4Z0XB 4Y5YB 2FL5B 1MLCA 4AYFA 5FM5O 3BP4A 5E2UL 1P4LA 1KB9K 3W9DA 1TZHB 1CG9B 4PRHE 3MMEB 1JFQL 3MLXH 3BH9B 1U8JA 3VXUB 1EGZA 1GSMA 5EBLA 1JHLH 1NAMB 4X6DE 4PJEF 3OKNB 1BBDL 2J25A 3WD4A 1G9HA 4OZGB 4WI5A 3UO1H 3A4XA 5KSAA 4X6CE 1P7QB 2WIIB 5FB8A 3IYLW 5C07E 2FH6A 3I9GH 4NJ9L 1T1WA 1WWCA 1MFBH 1R3KA 2EDEA 4Z7UA 3SE4C 3DHJA 4Z77B 3C9NA 3HZKB 1K3ZA 2VIRA 1U8NA 2NLJA 3S35X 1QO3A 2WINA 4OD3H 2ATPB 3QDJB 4XVSL 2G4FA 1JDCA 4UR9A 3MRKB 5AWNL 1ISVA 3M17B 4MJ4A 3MLSL 5A6BA 4WI2A 1R3JA 4UFMA 3OKEA 3ROOA 3BGFB 5GIRA 3M8OH 2ID5A 1UG6A 1V02E 5IVXA 1F90L 2MHAB 4AIXA 1KCKA 2VDKH 2VDMH 5IJKA 3SY0A 3BQUA 3OBAA 2XKNB 4X5XB 4XPBL 3LEXA 4UT9H 2JEQA 1UWXH 3PDGA 2WMHA 3IU4L 3MUJA 5CINL 5BRPA 4OQTL 3GFUA 5E8EA 2H8PA 1Y6MR 4XCFL 1NM9A 4K94L 5FIEA 2NY6D 5ADOH 1NOWA 3ZTNH 1W9DM 2LTQC 1R5VB 2C7UB 3D9AL 4UQAA 1CYGA 3GRWL 3O9WD 1A1MB 5A6AA 4BFBD 4PLKD 1E0XA 2AXHA 1WEJL 1A47A 3AFBA 1TQBB 2WV3A 2OSYA 1KWGA 1HNGA 4EUPB 3VXSB 5E6ID 2DAVA 4XI5C 5GZOC 4ZFGL 1N0XH 1PSKL 4K68A 4LVOC 4JFDD 1NKRA 3IFLL 1HJUA 3F7PC 4PJ9C 3DMMC 1CFQB 5TQ0H 4HC1L 2IADB 2ZUVA 4MAVA 1KOAA 1DUZA 2B39A 3BZFA 2ESVE 2R39A 2COQA 3VI3F 3W11C 2EQDA 1MCOH 3I3BA 2OZ4A 4Z78B 2BVUA 5JXAL 2NX5E 3QXUA 4PJBA 5HGHA 3VFMB 1QSFA 3WSUA 2DTMH 3ZR5A 1WBYA 3CXHJ 3MNVA 1OAUL 2V9TA 3GSVB 1QSEB 4M02A 5JOPE 1E9LA 1BFOA 5JZ7C 1CLYH 4R2GC 3GSNH 5BW7C 3VXMA 1XF1A 3BKCL 2RQ8A 2WKLA 4XC1L 1OGAD 4F7CB 4GRWB 4ONFH 2VR5A 1MUJB 1VPOL 5C0IB 2V7NA 4C7DA 1XGYL 4GG8B 5IXEA 3T2QA 1K4CA 4D8PB 2Y9RT 5IB5A 4OB5L 3OKDA 4BSVB 2JJSA 5IFHL 1DLHB 2X5PA 3AXLA 3OHXA 4HKXB 5BV7B 5I1LB 5KJRH 1QSZA 4MSWA 3GSWA 5M03A 3VDAA 4J3SA 4YAQB 2CPUA 4LCUA 3IAGC 1J8HD 5T3ZD 4KAQH 4JDZA 2VWEE 2PN5A 5D5MF 1U92A 5GRUL 3VA2C 1AP2A 3ZE2F 1AI1L 1MFCH 4RWYL 3U9UB 1IC4L 4L8DB 2FATL 5CIPA 1IARB 4CU8A 2IMMA 4UT6H 5C0JB 3PQYD 4ZXBC 2ZG1A 5TE4H 1S7UA 3RVVC 1CICA 4Y88A 1AO7B 3IJYB 1UVQA 4WGWB 1URLA 3PJSA 2GIYA 3N85H 4M5YH 1AXTL 2YWZA 1V7NH 1VGEL 5D7LB 2JB6B 3RGVC 1A7NH 3PGFH 1IGML 5IV2B 4WFGD 1XSIA 3NPSB 4GO8A 3UBXG 4M24A 1HJWA 5FXCH 3D39A 2OL3B 4KVNL 4YO0A 2GUOB 2IBBA 4JVWA 4JY5L 4QHKJ 3JBG7 1C91A 2O93L 3CLEL 2ERJB 4PTTB 4X8JA 1LLOA 4ZO8A 1E6OH 4GO9A 4UV7H 2YPLD 4DGYL 4XP9H 4F8TA 3LKNA 5T5FH 1GOHA 1A3RH 2W9DH 2RAMA 3RI5K 4V28A 1K6QH 2UV3A 4J1UA 2J88L 4KK9D 4LSVH 4OLXL 4K7PH 2HT4D 1HJVA 2VDPL 4L9LA 1NUGA 3MREA 2FEDC 4HTYA 1VESA 1HHHA 1RHHB 4X8XA 5DURB 1F2QA 2XWBA 3U83A 4U6HA 8FABB 4GKSA 2A6IB 3ZM8A 3KPNB 5CEZD 3CLFL 5C0BD 3OF6A 3UBXA 2QSQA 1E4WL 2EDHA 1DANU 4XNUH 4AZIA 5DVMA 1E3ZA 4PJ8C 3OLEA 1YECH 4NFCA 4NN7C 3T3MF 4HGMA 4S2SB 1LE9A 3F12A 3IXAA 1T0NB 3W82A 1FHDA 2VKXA 2XT1B 3DETC 4EBQL 2NW2A 4MDOA 4OLYH 2UY7A 3B9KD 3K4AA 1ZGLP 4OM1H 2P5EE 1LEIB 3KPQA 1S9VA 4MAUH 3S97C 1YEFH 5ALBH 3FHQA 2QADC 4X4MA 1J11A 3V2AR 3MOAH 1S7XA 4DZ8B 1KN2L 3ARRA 3T3PE 1SMDA 4BKLB 4Z2KA 1SMAA 4CNIA 1K8DA 4KJWC 1P9MC 1I1YB 3T4AA 4BA0A 1SYSA 3O0RH 5DJ2B 3TA3A 4CD7A 2J7CA 4NOBA 5A3IC 3BH8B 4H04A 1MWAH 3GB7A 3H9ZA 4LLDA 4OZIF 3U0TB 1XGPA 1IM9A 4HJ0D 3AIUA 2X4UB 4RGNC 3PL6A 4Z7VA 2D1ZA 1NEZB 5D71H 3AIBA 1E56A 5D7IF 5EUKA 1RUML 4JL2A 4GOSA 4JQXA 4NN5B 3BVNA 1WC7A 4KZDH 3SDAB 4MADA 2V3DA 5JOFB 4XHJC 2PBOA 4NO2A 2ZUQC 5I71C 5CBAB 3ZT7A 3ECBB 1AD9B 2Q1EA 4QTHA 3UPAA 1BFTA 4LCWB 1YJDC 5JNYA 3EOTL 3CZ8A 5HVFB 4AIOA 1VEOA 2V3FA 3HRZB 3AIQA 4LEXL 1ZT4B 1EBPA 5I1EL 1E4IA 1IFHH 2Z31B 4NQDD 3U1SL 5I76A 4ODHH 1TJGH 5EOCL 5EIIA 3E6FA 2NY2C 2ZKHL 1T21B 5KSVA 5BCAA 3QI9A 5EOCJ 4TX6A 3WXVH 4ZUSA 3I3DA 2VLRD 5L2JA 4O00A 1G0XA 4DKEH 1LDPH 4OGXL 1FHGA 3A6BL 1OAXH 5F9OH 4NNXA 4MLSA 3D2UB 2GCYB 1D5MA 3P3YA 4U6YB 2O5XL 4HPOL 5FA4A 1KBGH 2X6MA 4KROC 1FZMB 1HT6A 3A4AA 3RUGB 3WJLC 3D6GA 1QFOA 2J6EL 1IC7L 5HGGS 4Y2DC 4PGBB 2XUCA 1PKQA 2BFVL 3U5YA 3FB7A 1NBVH 3SDXE 3HC4L 4NUJB 1LO3H 1YA5A 1MCQA 3U30B 2PYED 2AABH 3CFEA 4NQED 2NY0D 3GSRB 3HZMB 1JMZA 2GJPA 1WIPA 3QXWA 1F8TL 4D0BA 3F5WA 3ULUD 1HKIA 3TTYA 3WH7A 1MCHA 5GNXA 5HGDA 4U05A 4MD5A 1OP3H 2WYSA 1KLUB 3NOIA 3WL9A 1IEBA 1T7XA 4L8CA 3WN5A 3W9EB 3CCHB 4UFHA 1A6VL 2Y1VA 1IGFL 2CBJA 2HJKB 1W8NA 2J12B 4HQQL 4PJXA 5F70A 2W9EL 5A2IH 3GBMH 5C1MB 5KVGL 4O58H 1V0LA 5HYJB 3GMQB 2EZ0D 1I1FA 3VD9A 5A16A 1Q9KB 1V08A 1JNHB 2ZUMA 4NNYB 4XPAH 1MYRA 1Q9WA 1QI4A 3BO8A 2X4OB 4IOSD 5DD5L 2ZX7A 2P7TA 3X12A 3REWB 1T0MB 3CIQA 3LZFH 1FZJB 1F97A 2CKBH 4AEIH 4BS0A 2XFXA 1KR1A 1JUFB 3CX5K 4M93C 1GRWA 3PWVB 4HS6A 3L7FB 3VFGH 3DO7B 3DTXA 5EU7E 2VLLB 1XFPA 3CUGA 1S7SA 5J6HB 3S96A 3L3DB 5CGYC 4YH6A 4JFZL 1YEIH 4MMXC 3W6MA 1R5WA 2HVMA 3LD8C 1EFXA 3QYCA 3WJJC 2GJXA 2PYFB 3Q5YA 5BQ7A 3C09C 1VADB 3KNBA 1A6ZA 2HLFC 2R29H 4BCEA 3D5OF 4JFDE 1RZFL 2ZE0A 1N4XH 2R2HA 1KV3A 4LCIL 5KSBF 2IJ0C 1LHZA 5FCUH 2DT3A 1W72L 4Z2IA 4Q6IB 1DR9A 5IVZB 2OBGA 2B8OT 2EDDA 5HPOA 1J1OL 1N59B 4WI4A 1J9YA 3CZJA 2WIMA 3KYKH 3SJVB 3WEXA 3PP4H 4O2CB 4XB7A 1EQCA 4PG9B 1FN4A 1OPGL 2PWDA 5EU6E 2AEWA 1ZOXA 5JXEA 2J77A 1FPTH 3BAJA 4XZWA 4CMHB 3PV7A 1MW0A 4JFWA 1WAAE 2Z4QA 3IVKA 4LRNL 3PHAA 3BMWA 4W87A 4ORZC 1E6QM 4LCCC 1LMKA 2W66A 2YMXL 4GXUM 4G5ZH 4YPGB 3UTSE 2R8SL 1MVFA 3TM6A 2ZXBA 1FJ1A 3JZ7A 3Q3GB 3ARDB 3KXFD 3QCTL 3EYVA 2GFBA 1IM3B 1KXTB 1MWAA 4UIMA 1HDMB 1QEWA 4A6YH 5F96H 1PIFA 5A2BA 5ICXB 2C1PA 1KJVA 2Q8BL 1FNHA 4BQBA 5T3ZE 5F9AC 1S8DA 3SKNA 4HAFA 1KENH 1T83C 2YRZA 5DQ9B 4LSPL 1UUQA 5FIPA 5EBMA 5SWSB 2NY7H 1OM3H 2DKSA 4LVNC 2WMJA 5SWQA 5EZJB 3EHBC 1YPZE 2A73A 3QHZH 4ONGL 2CLZB 3ALWA 4DUVA 2D7NA 2E27L 4GKZA 1PZ3A 1TVNA 5F8QC 1W91A 1J86A 4BFGA 5EPMA 4ZD3H 2V5DA 2WKGA 4AMKH 4DZBA 5A94A 3FT4A 3T0XA 4GW5A 5D2NB 2W0KA 4W4OC 3L3GB 1FZKB 4XI5D 2YLLA 2LAGB 5GZOD 2J8FA 3EJZC 3AISA 3MBEB 3T1FA 3ZLQC 1FVCB 1MRDH 5C86A 4XVTH 7A3HA 1HE7A 2O9TA 1ISXA 4PJ9D 4W6YB 3DMMD 3VWJB 5ERWB 3ARSA 4F9PA 4KRTA 3QULB 1NFDF 4ZOCA 4Z7NF 4PRPB 4AEEA 4UFIA 4A3YA 2FD6L 2ICEB 2HT3C 4QRPD 5FYJH 1MRCH 2E7CA 3W11D 2PXYC 1I7RA 2V5MA 1CU4H 2BSED 4JRYD 2YPLE 4RFOL 1JN6A 1N3NA 5CCKH 4OD2B 1T6WA 4RFEA 3ORJA 3CDCA 1E6ZA 1LJYA 1AY1H 1Q0YH 4I2XB 4JAMA 5JZ7D 3AS0A 1KPRA 2FB4L 4R2GD 2EKSB 1XH2A 1BTCA 1FNSH 3VILA 2DM3A 2NSXA 4HJJH 4JFFE 2D4DA 2NY1B 4GRLC 2H2SC 1FVDB 3FB8A 4IMLB 1JWMA 4XPHL 5IW1B 3VIOA 1WTLA 3TTSA 3ZT6A 2LV4A 3LQZA 1DQJA 3NJ3A 1UH3A 3U0PA 3MV9D 2BNRB 1KGUA 3O2LA 5IR1A 4P8WA 3BT2H 3TJEH 5FGCE 4RIRA 3RY5A 1H3VA 15C8L 3HC3L 4P2QE 4LHUA 3EO1B 4HFUH 1NCAH 2BNQB 4JR9H 2DYPD 4JFUA 1L6XA 1JIBA 3NMEA 4G9DB 5KVDL 4YHOH 3FCTA 1G7MA 5EC1B 1CD1B 2YD9A 1Q6GA 4M48H 5DEGA 3BDYH 4ZE4A 4ZXBD 2VKWA 3RVVD 3RWFB 1U6AL 2YKLL 5FKYA 4G7VL 2DMBA 2CO7B 4Y4FB 3MSPA 3UTQA 5TPWH 1IZKA 1AHWB 3BCFA 5E2WL 2CRYA 5B8CC 1W0WB 4PV8A 1U3HA 2VDOL 2CKBA 4H8WH 4W5UA 1WZKA 4QRRE 4TPRH 4QRQB 2CKSA 4M56A 2ITDB 1JVKA 2VQTA 2QSCL 1E43A 1CZ8H 3RA7L 4HG4J 4KRUA 3GXIA 4BZ2L 5E7FA 1FGVH 2B1AL 2P8MB 1H15A 1E0OB 4RX4A 2Y7QB 1R5IB 2P1YA 3MRFA 5ESQA 4I18C 3MANA 2Y25A 5F7LB 3OA5A 4LASH 4Y8DC 5MI0C 2ADIB 5DJZB 3UMTA 2Q8AL 2VC2H 1MFVA 5C9JA 4MA7H 2DIEA 4P4RA 4XCCL 3PWNA 4ZXLA 3TCLB 2HFTA 2FEDD 2QHLA 1RJZA 4JRXB 4NQDE 1H0IA 3U46A 4LEOB 5HDRA 4G9FB 3HR6A 3SQOH 4PTXA 1FAIL 2VLRE 1OL0A 1YEJH 4D6DA 1EOKA 3MRJB 1YMMD 3WLBB 4W5ZA 2HJFB 3RBGA 1KT2B 3T08A 4MA3A 4PJ8D 2ZZUT 3HI5L 4XNZB 4W8LA 3QDGB 1ZGLB 5EC2B 3F58L 3V6OA 5DT7A 2VZVA 2DQGL 1EFQA 1TETL 4DWSA 3DETD 1FYTA 5M17A 3K2UL 2F58L 1D6VL 1M71B 2OTWB 1ZA6B 2OJEB 1U8LB 3I9GL 1R86A 3DIFB 5E0FA 3EO9L 4PJ7B 3IDXH 1O7VA 3OG6B 1FBIH 4WY7L 2OK0H 2GT9A 2QADD 1B3XA 3CC5B 1Z9OA 1PD6A 2PYEE 4A6YA 4Y5YA 4HDIB 2F54D 4KRMB 3LN5A 4MCZB 2XRAL 1OTSC 4N0FA 3CU1A 3MNZA 2BVQA 2CD0A 2WUCH 2E40A 4KJWD 3MMEA 1NP2A 1XR8B 4AD1A 1HXMA 3NDYA 5A3ID 5T1MB 4KDWA 4RA0C 2L7UA 1QI2A 3DX6B 2VDML 3UZQA 3NZHL 2YJQA 4RGND 4D3CH 1U8MA 2WIIA 3EYSL 4YBQC 1Q6CA 1ZWIA 2XZCH 2NY5H 3SO3B 4Z7WE 2OTUB 4FQPA 4BK5A 3FQNA 1WP6A 1MNUL 4FXLA 1A1OA 2YPKB 1ED3B 4OLZH 3OGCB 4XHJD 1FLRL 3BP7B 4P5TB 3LEYL 3T0AA 2IH1B 2EIBA 1EMTH 2W65B 1UQYA 2HA1A 1MJUH 3ZMRA 5TQ2H 2ATPA 1JHTA 4EXKA 2UWFA 2AKRB 3TWCL 3HAEB 1BD2B 3FOMB 2YD8A 3V52H 2PR4L 2NTFA 1H3PL 1BJMA 5DQJB 3M17A 4EUPG 3BUTA 1NWUA 2DSUA 3LMYA 4ODWB 3U7VA 4J3OC 4GG6F 2XNAB 4XCEB 1CDGA 1OT2A 2XN9B 5J3HC 3Q1SH 2CDGB 2VUOA 4MD0A 2RIKA 4XNMA 4BYHA 2NY2D 1JI1A 2Y06H 3HG1B 3UTZB 2OP4L 2XKNA 2YUVA 3IFOA 4X5XA 5TQ0L 1LP9B 3QRFM 1RZIA 1NKOA 1I1AB 1OWQA 4JDVB 3U4AA 4JZJA 5F97E 4PJIE 1MCOL 4GW4B 1FNGA 4QHLB 3GTNA 1R5VA 4KROD 4HJGA 4Y89A 3CVIH 2PNDA 4K55A 5T1LD 5F7HA 4I8DA 4V1DE 2XWEA 1H5BB 4Y2DD 4DGVL 4AY1A 1DE4A 3BEVB 4NQSA 3TP4A 4OZ4B 1HKFA 1OARL 2VCCA 2R0ZL 1BFVL 5HHVL 4WI8A 4XX1E 3CMGA 2ZJSH 5E2TH 1KTRL 5GSVB 1MI5B 3BKML 3QH3B 4HUXB 2IMNA 3A67L 2XA3A 4Z78A 3TC9A 1CLOH 2AJ3B 2EDBA 5JHDA 3SE8H 2HG5B 1HHJA 4N68A 2XZQH 4PD4K 5DRXA 3WMSA 2DT0A 2DM2A 4FQJH 2D3VA 2DD8L 1HINL 5FV1L 5FYLL 3SDDA 4UT6L 4WO4A 5BMFL 5ISZB 4R3SA 5TE4L 4W88A 5C0IA 3V5KA 3N85L 1J18A 1IKNA 1LO5A 1GOQA 1PLGL 5DMKA 5C09D 4FQCH 4NSKB 3RIKA 1EO8H 4BSVA 5GXBB 3C6LC 1S9WA 3HB3C 2YDRA 2EDKA 3DPBA 3BZDA 2EH8H 5I8OH 2A3AA 5DI8A 4K3JH 4PY7B 1R3IL 4PRHA 5GS1C 5CGYD 5A8OA 3U4EA 1UZ8A 1FNEA 2AV1A 3BKYH 3IU3A 1C8XA 3CPLB 2VLKD 4ZMAT 3WIFA 2MOVA 2JELL 2HLFD 5FAAA 2P8LB 4P46B 5T5FL 3ARQA 4U1SB 3QQNA 3CMOH 3L5IA 4X6CA 1A3HA 5C07A 2BSSA 4E41B 2F53B 1JYVA 3S88L 1CVSC 1QI3A 2W59A 4AISA 3GMNB 2WZIA 3F7QA 2XJ7A 5IFPA 3DECA 1ITBB 4HT1H 4LDOB 1U8KB 1UJ3B 1AKJD 3HI1A 3H7BA 35C8H 4WFHE 2A9MH 3TN0C 2GUOA 1UADC 3C60A 3VX1A 3TVMC 4FFYL 2YD7A 4I0PA 1I9JL 3B2VH 4XNYH 2SEBB 5LGKA 2C9AA 4OSUL 5GSRA 1V02A 1G7PB 1LQ0A 2YL6A 3TH4T 3RCNA 3IJSB 4QHNB 2KBGA 5GGTH 1UA6L 2AEQH 5C71A 1JZ5A 2EDYA 4OLYL 3HUJF 1BF2A 5EFIB 4L3CA 4DFIA 3N1AA 3MV9E 5CP7A 4NQXB 4MNLA 4IS6A 2HN7B 2XPKA 3OAZK 2Y2WA 2YXFA 2AAAA 5ECJE 1FFOB 3KG5A 3WS3A 3IDGA 2YWYA 4Q9CA 5KVFL 4X0KB 2Z1SA 5ABHA 1LEKB 2BVEA 1KEGH 2WUBH 3H3PH 1MCCA 4QWWC 1MLBB 2ESCA 5EO9A 3D85A 4LHQB 3MO4A 5I1CH 4G6MH 2JE8A 3ARGA 3EHBD 1T0NA 4EI5C 5TFSL 1NEZG 1WT5C 1BSIA 2A1WH 4H25A 3S4SA 4PJFE 1OLLA 1T89A 3QIBB 4WTWA 2ESVA 43C9B 1V03A 1VDGA 1IGCL 2IH3A 3ARFB 4M1DH 3IS1X 3KPSD 4PSRA 2NX5A 3QJHB 3EJZD 4L4VD 1NP0A 1JNNH 4KHTL 4OF7A 2DIBA 4HZLB 3EBVA 4OIBA 4DKFL 4DZ8A 1JF1A 3PWPB 5DD3L 2PWEA 2CIKB 4JDTH 1JGVH 4J12A 4WI7A 5EU4A 2PXYD 5D70L 4Y4HA 3H9HA 4MJIB 1NLDL 5IHZB 3GNPA 4AW7A 1T3FA 4NZJA 3DVFA 3O11A 3V4UH 1G6RB 3ZKXB 1JXJA 2J78A 4QNPE 5LGJB 3LSOB 5J8OA 1MEXH 4WW1B 3W2DL 1U41A 4LVHC 2X4UA 1NEZA 4FNLH 1AQDA 2EO9A 3C5JB 1LDPL 4KI5F 2HRLA 4P2OB 4L29B 5EZOH 3APGA 1G84A 5F3HB 5H35A 1ZVSA 4GRLD 3WE6B 4TUOB 3V6FB 1RJYB 1UCTA 2H2SD 2ZG2A 1BIIA 3MA7B 25C8H 4M1CC 2G2RB 1KLFA 2OWWA 3JV5A 4P5MB 4HD9A 2J7FA 1YNKL 5C08D 3ARPA 3FQXA 1RU9L 5D8JH 3VFVB 5IMMB 3WEZA 1M53A 3WUBA 4K8RH 3B6SA 1Q6EA 1FDLH 1B2YA 1QFUL 2DLIA 1YY8A 2GAZB 2XTJC 2AABL 1VHPA 2YK1H 4UILH 3MU7A 4H88H 4QHMB 4C56E 5AD0B 1MQRA 4RNRA 2ARJQ 3P0YH 1P1ZB 2C3VB 2QJDA 1OGGA 1FOBA 4ZFFA 1QKZH 4MAZA 3UP1A 3X11A 1MHHA 2YA0A 4OF0A 4X4YA 3WDHA 1YQ2A 4U6YA 1G9EA 2F54E 5TH2B 4LQFL 1DQMH 2AGJH 2FBJL 3FN3A 1Q0XL 4JJ5A 1TVHB 4G8GB 5FA3A 1UKPA 4JO4H 3BRFA 4JFVA 5BRZE 4PGBA 2D9QB 1A6WL 3JVGC 5HVGB 3MROB 5FUCE 2CPCA 1KIPB 4HV8B 3ABZA 4UINH 2R9HC 2WWDA 3BAKA 5I23A 3HPLB 4M7JL 2AJYL 5I9QC 4ZUTA 5I1JL 4ODTH 4PMOA 3L5WB 1YEGL 4OZGF 3BRGC 4AEIL 2C4FT 4WUKH 3OG4B 3O6KL 2UZIH 1G9MC 3PZTA 1KLUA 3PHQB 4JZOB 1CT8B 3V0VA 4LLYB 3W9EA 2NW3A 3MLRH 4NPYB 4FLSA 4PCSA 3U0WL 3ILQC 3Q5OA 2WBJA 5E56A 4AEFA 3SURA 5ITFA 3G6JE 4U1GB 1B0IA 3MACL 4TVUA 3ZSTA 5M3WA 4U3XA 1IQWH 2P5WB 4MWFA 1CGWA 5F6IC 1O7AA 1M6OA 1OTUC 3P73A 1RZ8B 5IQ9B 1OAQL 3VJ6A 5CD5C 3EMQA 3NSXA 2MMXA 1S7VB 3QUML 2RBLA 4MJ5B 5FCUL 4G8EA 2JF6A 3GSUB 3EYFB 4NNPH 5ILTH 3QFJE 2Q7YA 4O02L 4XGZA 5EIVA 2AQ2A 3L7FA 2EEAA 4ODUB 2WSKA 2Y5EA 4LFHG 1ECEA 1Q9LB 4Y5XA 3ILPB 5GGTA 4F3FA 1ADQL 1TZ7A 5T33H 2KKQA 3PP4L 4OCSH 5DD0H 2DQIL 1OVZA 1ZTXL 1JDAA 4YEFA 5JW4N 1AQHA 1KPUB 4MAYB 1HXYB 2QF8A 3Q5TA 2DOCA 1QRNE 1BYBA 3JWDL 2QQNH 2I07A 3WSQH 1IT9L 3TBYA 1DBMH 3VDHA 1DUYB 1EGJH 2AJZB 3PZMA 4S3KA 3OLGA 1OTSD 3SCMC 2OS7A 4CU7A 1B6DA 5I1KH 3W28A 5EN2B 2R4SL 3ARUA 3JWOC 4NWUH 4JM2C 5DJAB 3WNKA 1H4PA 1W8OA 4B53A 1UR2A 2JIXB 2LAAA 3RZWA 5L2KD 4Q6IA 3KPPA 3KZSA 1KBKA 1R7AA 2FJFB 3KPTA 5MEND 4YBQD 1FO0B 3REVB 1KENL 5FOOA 1YEKL 4ZG1A 5JIPA 1OM3L 1DQLH 3DXAE 1OSPH 3BYTA 5CP3A 5GS0C 1S3KH 3IKKA 1NAML 2R2EB 3RZCB 2C0HA 3MYZA 3K4DA 2H9GA 4D6HA 1V6YA 3PUCA 5D1QB 2VXVL 3GJEB 3H9SD 1UXSB 2A9NL 4GRWF 2WVTA 4LLVB 2BOCA 2V2WB 2VDQL 3ARDA 5LWYH 5C09E 3SHSA 3SE9H 4IM4A 2C26A 5EZIH 1J88A 2XV6B 4EDWH 1BVKA 1F11B 5J3HD 3GSQA 1ZT7B 3VD3A 1A7PH 2DQJH 4XVTL 3L7EB 4N0YL 5JOEA 1WBZB 1A7QH 3OPZL 1C8YA 3PWUA 3MRBB 3DGCR 1UR0A 1WZLA 4NSBA 4JFYA 1PBYA 4ZQKA 3SPVA 4EAMA 3E8UL 4PRID 4P9HH 2VLKE 4LNRA 1H3UA 1KJ2B 3N1FC 5E1AB 5LBSH 3NTCH 3LKRB 4PB9L 5FF6B 1V8HA 2BVPA 5F7MC 3TBTA 3GMRB 5IM7B 2J3SA 1FFPB 3MLUH 1HL8A 4PTMA 1YDPB 4LAQH 2CLZA 4WDIB 5KVEL 4PYSA 1UQZA 3IFNL 1RJCA 4GMTL 4H20H 4OJFL 1RIHL 1MF2L 1WZ1H 3SUWA 6TAAA 1UCBL 4A2LA 3O2DA 2RB8A 1DSFL 3HLAB 1TDQA 2HWZL 1G9NL 5JW3H 3OX8B 3O6FB 3DSFL 4JREB 1P84J 3HAEH 3BSHA 1W0VA 4JFXB 2V5CA 3D25B 3BRDA 2BOBB 4IRJB 5CPQA 1I8LC 3IJHA 1GOGA 2K7PA 3C5ZA 5A95A 1WDSA 1LNUB 1PFCA 3I75A 1SHMA 3M6DA 3NSNA 4P8UA 3D48R 1V3JA 5LXGH 1X7QB 5DTFB 1BF8A 2CK2A 4Z6AT 5GS2D 3NH7H 2BSTB 5ALCH 4S0SD 4PLOB 3O2WH 1JGDB 1KCLA 3BZEB 1ORQA 2XOTA 3KPLB 1W2PA 5EUOE 5I73C 2ZP0T 4HWBH 1AE6H 3TCXA 3LS4H 3C6LD 1I7TA 3MRHB 5D4YA 1T2QL 4TPRL 5KSAC 4RGMB 4KU1A 2E8YA 3OMZA 4JFDA 2C1OB 2XFRA 2I27N 1N8ZB 4RRPA 4GZIA 5GRJL 1LEGB 2GI7A 4EN3A 5D8WA 4HEME 5I2IB 3DUSA 5L88L 1CN4A 3KPSE 5EC1A 1GGCL 5BV7L 1X5AA 3WO4C 4FLQA 2VH5L 2OJZH 1FH5L 4CVZB 5JW5B 2UY3A 2YL5A 2D9CA 3CUPB 4JB9H 4M6NH 1H5VA 1NOFA 5TE7H 3LAFA 1MQKH 4ACZB 3TYGL 5C0FB 5EU6A 1UENA 4ZDHB 1GC1C 1OAKL 1QFWL 3BPLC 3UZVB 3OTTA 1WAAA 4RA3A 4V2XA 3DO3A 3BDBA 4WCYL 2V9QA 4FXKB 5JW4Q 4QCIB 3MODH 5IJKC 3BQUC 3MLVL 4DAGH 3CDGA 2VAJA 5JQ6H 3UTSA 4PJGE 5KS9E 3TN0D 2A6JB 3OKOA 3TVMD 3V7AG 1RULH 1JZ2A 1TUXA 3PWJB 1R5IA 3EZ8A 3UETA 3RP1A 1IQDA 4X9IA 2AXJA 1RK1A 5HHPA 2VRKA 1LO4H 2OL3L 3QHFL 4FTVB 2AXFA 2V9RA 4GLRH 1WCQA 4I4WA 3PGCA 5F9WB 3QEUB 3FOLA 1JFHA 3NDZA 4KMLB 3CK0H 3D87B 2DM7A 3ROLA 3QSKB 2X4QB 4R90H 4XTRC 3BWUC 2B5IC 4LEOA 1YPZA 2NXYB 5D2LE 2KPNA 4D9LL 3RU8L 2UYLA 1VRXA 2MPAH 4YQXL 2J8OA 3VGDA 4O2FB 3VI4E 3MBXL 1SJEB 4QWWD 4WHTA 3FO0L 1VBUA 1KN4H 2CXGA 1CL7H 3QZWB 1HILB 5J9PA 1MELA 1AH1A 3INUL 1GZJA 1KCUL 5I1DA 4WHYG 5EC2A 2N56A 1N7ML 4X7TB 4EI5D 1MJJB 3G6DH 2YN3A 1KIQB 2R1XA 4UNIA 4EIGB 1DBKL 2FGLA 5DUBB 4M43H 2ZXAA 2Z8RA 1IRAY 3LCYA 4ZSOB 1FH9A 3DIFA 3RUGF 5KVMC 4QOKD 5I6SA 2YPLA 4AM0B 4JG0L 3MRLB 2R69L 2DGAA 3T77A 1W9UA 3SGDI 3HAEG 4MA8L 4EOWH 5CSYA 4FOMA 2JJSC 4YR6B 2WLYA 3E2HC 1KB5A 1HSAA 1NMBL 3QCUH 4JFFA 3DHUA 5FKPB 1X5HA 5AY7A 5CAYB 3Q1SL 4JE4B 2XHYA 3HKFA 3NFPB 4WUUB 1DBAH 4XMKH 3UPRB 3FB6A 4XNXH 2HVJB 4M8VA 4PJCB 3UBXI 2ZPKH 4OIIL 1CICC 1H3WM 2YPKA 2QQLL 3QWRA 4KK5C 4M6OL 3ZYOA 4P2QA 3IF1A 4M1CD 2P4AB 4KUCF 5F88A 3BN3B 5FM8A 4Z5RB 3ECQA 4CCCA 3OAYK 1RUAL 2AKRA 4Y1AD 4PTVA 2D20A 3HAEA 4TSAH 3FOMA 2M1KA 4OUUA 5C0AE 4K3EH 4L1DA 8CGTA 1RY7B 4CCEA 4HZAA 4M62H 1I9IL 2XNAA 4XCEA 5E4EC 4YHGA 5F44A 1HIZA 2XTJD 2CRZA 4JPWH 1ZVHA 3KDMB 3BXNB 4TSCH 3ZKQD 3X13A 1WITA 5E2TL 1DP0A 4EE9A 4MNGE 3IS0X 5CMAA 2X09A 3B4NA 3F7YB 1LP9A 3SE3A 4P2RE 1EDGA 4QRRA 3T0EB 1FA2A 3ARBB 5GISH 1CLOL 3GSOA 2NXZB 1BAFL 2GW5A 2XZQL 4XMPL 5DK0B 4C4KO 2H32A 4L9LC 3L2LA 4P7RA 2CSPA 1T1ZB 5DK2B 1XZ0A 2IPUK 4QY8A 1UM6H 4FQJL 4WEUD 4X5WB 5K33A 1W1YA 1OT1A 5IK3B 4HWBA 1G7QB 1HI6B 1SJHA 3HZVA 5FHAH 4R27A 1AMYA 4CADB 1J5OH 4OLWL 3S35H 2R9HD 1PZUB 3DV6B 4JFEB 3RNQB 1NWSA 5DS8A 1E1EA 1YEEH 4W89A 1V3IA 2D7TL 3QWOA 3MV7B 3BAIA 4H26A 1CF8H 3I2CL 1QW8A 5C0RH 3SUSA 2O5YH 3QH3A 1A6AB 1OAZH 2HG5A 3ILQD 1N6UA 5T1KB 2VLRA 4ORGA 2O61B 2VQUA 4OFIA 1SR0A 4TUKL 4YX2L 5D9OA 1YY9C 4WVRA 3WNNA 3GK8L 2QL1A 3NCMA 5JHLH 2QSVA 3FAWA 2DICA 2QQKH 1OTUD 4DW2H 4PRNA 3MRMB 1W0YT 2ED8A 3HE7A 3RWEA 1QACA 5DJDB 3BP5A 3TA3C 5CD5D 4YHLH 5JA8B 3IK2A 3KWWB 2FJGA 1MIMH 4GKNB 4CKQA 3C8KA 4U6VH 4NCC1 3CGTA 4GI6A 4AIUA 3PL6C 1H1NA 4NBYB 5A43C 35C8L 2DWDA 4JQXC 1MHCA 3BE1H 1C90A 3B2VL 4L8SB 5ADPH 2YL9A 4XNYL 5F21B 3QHOA 1KIRB 1TVDA 2QR0B 1FGNH 4PB0L 4OZHE 5TDNB 1ZLSL 1HH6B 1T5WA 3ULSA 1KACB 3V4PH 2NT0A 1QLFB 1R85A 1HKLH 3DX8A 3QA3A 1HZHH 2VL4A 5BVPH 1KWKA 4TUJB 4P46A 3QNXA 1ZLWK 4ODSH 3L2MA 5I2UA 2AEQL 3SCMD 1HJQA 5DJCB 4ZFOL 2D23A 3S6CA 2F53A 1T03H 3G5ZA 2HMIC 4Z7WA 1IL1B 1XH3B 4JM2D 2J5LB 2VLMD 4D9QD 1HHIB 2OI9B 5C8BB 3RIAK 2ZUXA 1B0RB 7CGTA 3N0PB 5C7XL 3FRPG 3QEQD 4LIQE 3QI9C 4CBPA 2VDLL 4AIZA 3CFJB 1NC4B 3X14A 1XGQA 4FF5A 5GJSL 5AYQA 1HEZA 1TZIA 5GPRA 3OKKB 4R4ND 4JZ5A 3CBWA 2RGSA 5BZWB 1WFUA 2ZCLH 4X6FB 1PX4A 5I1CL 4WFEE 4KTEL 4N5UA 5SWZD 5GS0D 5J0BA 4N0UE 1E6PA 5CJ8A 3S36L 3B2UC 2R23B 3IJSA 1F4XH 4HUVB 4R26H 1ND0B 4P9MH 3O9NA 5EFIA 1QPPA 5I74B 3V5HA 4E42B 4YFEA 1N5YH 1GQKA 3MGTB 4M1DL 4LSSH 1HWHB 1FL6A 2OR9H 3HFMH 3MRRB 1C5DA 2E9WA 1TJIL 3GH4A 1A6UL 1F3DH 1V6UA 4V1DA 1IGTB 5FO9B 1LEKA 1F4AA 4OCXL 1PPIA 2F15A 1FP5A 1TFHA 4MTVA 3QPQC 3WN5C 5E94B 3W29A 1RVFH 4FQ1L 4WV1B 4AENA 3SCRA 3FT3A 3V4UL 1DLFH 1UWQA 1X5LA 2YLAA 4TVCA 3WBEA 4OM0H 1MEXL 1N5AA 4MB5A 4UI2A 4X7SH 1PQZB 3QIBA 1FO0H 1KELL 43C9A 4G8FB 1AFVH 5ANMB 1FH7A 4B9YA 1HP5A 3NCFB 2EDOA 4ODVH 3HR5A 2YXMA 4H5SA 5E8DL 3P30L 3RVTC 3ZDZE 4HZLA 1S5IL 1RZKH 1JGEB 3Q2CA 3UTPE 2EPLX 2ZOXA 2Z93A 1MCBA 3BSZH 4AH2B 4CN4A 3BUYB 4YBLC 1ZU8A 1L0YA 1RFDH 2DJ4A 1I8KB 4TSBH 5CZVH 4UILL 3VGAB 2XACC 1KGXA 4H88L 4R0LA 4GAGL 1NANI 1GAFH 3ES6B 1S7WA 4LDEB 3UTTB 2HFEB 5DUPH 5IVOA 3WH5A 4J3TA 2BC4B 4WKHA 1NCCL 1ISYA 4M6MH 3WDRA 3HMXH 2BVDA 1QKZL 2NY6B 2XWTB 4L29A 5F3HA 3LDBB 4EI6B 1KJ2H 4BA8A 1WIOA 3MOBH 5TGBB 4EQ3A 5DLMH 4D6FA 2VOTA 3V6ZB 4YDIH 1CDUA 1UEMA 3O9WB 3S3JA 2G2RA 4PJEE 1LO0L 3ZDXF 1BVLB 2VVNA 2GITA 5FHBL 4BH7B 4FFZL 2AK1L 1E6JH 5BROA 1KB9J 2KQNA 5CILH 4YWGL 1H2JA 4QRTB 5E6IB 1DEEA 3C2AH 1D5IL 3I02B 1I8IA 4UINL 5HPMB 5KSAD 3B9DA 4XP1L 4CAGA 3O3DB 5EBWA 3IGAB 5DJXB 5JXEC 1P1ZA 1L7IL 2WQRA 3KS0H 5HHXL 3L4VA 4UQ3A 2VZ1A 2D4FA 3VGEA 4R4FH 4PJ7F 1YYMH 2I60H 4LSUL 1J01A 3LKPA 2WZPD 5A6BD 4KKBC 4BSWA 4JPVL 5CUSH 5DSCB 4WHDA 4NGHH 1F4YH 4GJTB 1BYCA 3SGKA 1T6VN 4KPHL 1CR9L 1AQKL 2YUXA 1AD0A 5E2JA 1CXLA 1C3FA 4OQ1A 4H1LH 1OGAB 1A4JB 4M9PA 3BQUD 4K9EL 4TTGA 5DJ0B 5I6XC 5DRNB 3LKQB 1DQQA 1BYDA 3VNYA 2A74A 3TGXA 4DK6A 2C3WA 2XZAL 4O4YL 2WCAA 3CFKB 4U33A 1D6EB 1U0QA 4U7KA 1RJLA 3FFDA 1UHVA 1IAKB 5ILTL 1SM3L 4QCFA 4OLVH 4MNQE 4C55A 1DN0B 5LAXA 3O3EB 3GI8H 2I9TA 1B3JA 4XP4H 1J8HB 1GOIA 4LQ1A 3S34H 2AK4E 1Q8MA 3W5MA 2VXUH 2VX7A 1LDSA 1VJSA 3QR2A 1VJZA 4ZOEA 1UKSA 5JO5B 5F3BA 4YHNA 1T66C 4XTRD 4OLUH 1HQRB 2QQNL 3TPUB 4WW2B 1BBJB 3PQYB 1I4FA 3FN0H 4XVJL 3VI3E 1EGJL 5BS0B 4F9PC 4JM4H 2ICWB 2IFGA 1KC5H 3AROA 4PJFA 1IGYB 1RZ8A 1V3MA 1JZ7A 4O5LH 4NYLB 5L0QC 4M3JA 4BH8A 4UOQA 3ARYA 3RI5F 5CPSA 1QSFD 3BGMB 3EYFA 1LP9F 2KUTA 3WBDA 1PYWB 4MDPA 5DRZA 4P3CL 3WIJA 5C0DA 3VXMD 3OR7B 1X1NA 1J1PL 3EOAB 4K71B 4JO2L 1U2YA 1TPXC 3DUUA 5DC9B 1I3RA 3B5TA 2XFFA 1VIWA 5EB9A 1KPVB 3HNVL 3QQ3A 2Y8KA 1OSPL 3IDYC 2PWGA 1S3KL 2ZSVB 1N64L 4DEPC 2Y5TA 3BJLA 2AJZA 1F2XK 4LF3B 4FZ8H 3MMDA 4LK4A 5BOPA 1W9XA 5C6WH 5CGTA 3AHTA 5LWYL 1ZJBA 2J8UB 5DUMH 5I8KL 2D2OA 5D5ME 2MNUA 3RWDB 5E0CA 3MNWB 3CFCL 4EDWL 3ZE2E 3KJ4C 1OHQA 2JIXA 1I7ZA 2DQJL 1A0QH 4BFIB 5C0BB 1KXQE 3F7VB 5DDHA 4I9WE 5DMGC 43CAB 2HFFA 1BEYH 4F66A 4IPNB 1U8IB 1KBBA 3FAXA 3IDJA 1G7HB 3KYMB 4JG1H 4NDMB 3EGSA 1CICD 2X4NA 3DVGA 1R7OA 5IOPB 4FZEH 4G6KH 3T8XB 4LVEA 4C56A 4XXDB 4IDJL 1EHLH 2R2BB 2V2XB 5HYQB 1QVOA 1U3HC 3B9KB 4KUZL 2VDRL 3VFOB 4LAQL 3BLPX 5C70A 4LCYA 1TNMA 3DVNB 4IM8A 1WZ1L 3R06B 3D39D 3CFDA 1DANT 2ORBH 4DM1A 2F19H 2VZTA 2IANE 5DGRA 4GQ9H 4JY4A 5GNYA 3GXMA 4KHXL 2LABA 4UOW0 2F2HA 5HHOE 1UWEH 4JGJA 3OR6B 2XZZA 5JW3L 3L7EA 4NCDA 1EXUB 1WBZA 3L3IB 3VFRB 1ZLUK 4DN3H 1M05B 5BRZA 5FCZA 5E8NB 4XWGL 4KRNA 3LH2H 1MAJA 3WFEL 3HMXA 3ULVF 1QSVA 4FABL 4ZFMA 4AZ7A 1BX2A 4KI5C 1OP5H 2FEEI 2DEPA 3MRCB 4DCQB 1U8OB 4FQ2H 5EFFA 2Z35B 3L3KB 2I9LB 4M9OA 4POUB 2YRPA 4RAVB 4D9QE 5HHNA 2AJSH 3QO0B 2O26U 3OF6D 4IOIB 4Z7WF 4HGWA 4KJYA 3QEQE 3O2WL 3LEVL 3SCOA 3V0WL 4GUPB 2EEXA 5JIHA 3T3ME 3RWJA 1NC2A 3KLAB 3VFTB 4OTXH 3O6FA 3HZYA 1K2DA 5HHMD 1E27A 3TBSB 5DJ8A 1HN1A 3V6OC 4JFXA 4ZXOA 3D25A 3MFFA 5GRVK 3RY6A 1OTTC 4DWSC 1NH6A 4XC3H 5IUSA 5SWZE 1E73M 1RZJH 3LN4B 3C6SB 4I77L 4XAKD 3WD2A 1NDGA 3W39A 1LK2B 4U1JA 1YY9D 2HLAB 1X7QA 1Q6FA 2P48B 4MYWB 2QHRH 3QFJA 4Y5YC 5B4MC 2XWJA 4H1LA 5E00A 3QUYA 1SEBA 5I78A 1NFKA 4HA1A 2OJZL 4B15A 3MJ9H 1UXWB 3CX2A 1DBJL 3AREB 1Y18A 1T1XB 2YD3A 3KPLA 3TA3D 4OZIE 2DBJA 3T4YB 4HIXL 1VGKB 3SCNA 3IJ9A 3NACH 2EE3A 1DBBL 5D7IE 1QRNA 4P5KB 4ZS7L 1IM9D 4NQCE 3MODL 1XR9A 5GGVH 4G8IB 1B3YA 1TQCB 4NQEB 3PL6D 2NY0B 3WKMH 3HNTL 5IJVA 1EHXA 3AIVA 2NTSP 2QPSA 3GKWL 4WNQB 5GRYA 3DHPA 4RQQA 5HVHC 2OSLB 1OGTA 2FZ3A 1FIGH 3OJ2C 1E4XH 1BJ1J 2XXMB 1S9XA 3VE0A 1BFSA 1UKQA 5ID0B 5JW5A 4KGLA 4OFYA 3ULVL 2G9HB 1FAKT 5HDQH 3U7YH 2HMID 2YL8A 4G6JH 5GGQH 3ZSSA 5DFAA 1UD5A 3DXAA 3OJDB 5IB3B 4PRBB 3P4OB 4FXKA 4Z0BH 1QOXA 4LU5L 4F15B 3QI9D 1HHGB 2I24N 3C08H 1B4JL 2A3CA 2X4TB 1AR2A 2MPAL 2X9XA 2IXUA 1EEYA 2GJZA 3FRUB 1MCPL 4JZJC 4PV9A 2FIRT 3QZWG 1CVRA 2A6JA 4F33B 3D3VE 5C09A 1UB6A 5HHQA 4E8DA 4OCWH 3M7SA 2R0WH 2YD2A 4EKXA 4J2XA 1E6SM 3MRIB 2W61A 1DJSA 2BY0A 3B2UD 3QB7C 3HE6A 5DHVB 3A0OA 3I3EA 3DURB 2VXQH 5ITBL 3VMNA 2VLKA 4GSDH 3LY6A 5E9DE 2D03L 3GGWB 5JORB 1A5FL 3O3AA 2GYSA 2CO6B 1E55A 4XZUA 5IF0B 1LL4A 3PDOB 4LSTH 3FQTB 1UWSA 3O4OB 1U91B 1SJEA 1CE6A 1TZGH 3QPQD 1J05B 5D93B 4XAWL 5H2BB 1R3LB 2V5RA 1UYWH 3QZWA 4MNMA 3EZJB 1S9YB 4HUNB 4NOFA 2X1IA 3VRJB 5DQDL 2VXSH 1MJJA 2WP3T 1IAIH 2BRRL 3G6AB 4LKXB 5INDA 1WWAX 1KIQA 4H8WC 1AGCB 4XBGA 3SDDC 4XMLH 4WO4C 4AT6A 2BCKB 4NRYB 4PP2B 2QMJA 5T1DH 3MRLA 3S3PA 3VXPA 2X7LA 3QDME 4UV4H 1IKNC 4Y5VA 3RVTD 1NGWA 3CH9A 5ABFB 3QIWA 4Y0GA 4JKPL 2D0HA 3DHMA 3KXFB 3WH6A 1QZ1A 3NFSH 3ZJKA 1MVUB 4OF8A 5D4QA 5FKPA 1E70M 3B5HA 3OKMB 4MDIB 5I1IL 3VWKA 3NABL 1S7RB 1HCVA 3CX5J 5EUOA 3UX9B 3AHXA 4GQQA 1AGBB 3NN8B 1EFXD 3O3BA 3WIIL 3MRQB 3BFOA 2K3TA 1T04B 2DQDH 1R0AL 3BPOC 2VX6A 4ZFZB 1YEDA 4M7ZC 1B0WA 1NSNL 1WB0A 1GQJA 5KSBE 3WQ5A 1GZPA 4OCMC 4OBRA 3PGDA 1CECA 1G6RL 3O6LH 4UOJA 5E8OB 1A64A 1YZZA 2XKSA 1Q94B 4HUUA 5ETUA 1H3GA 5DFWH 4N9OB 3GDBA 4RMSA 2XIIA 1U33A 2V2TA 3RWCB 1ZSDA 4R7NA 5B21A 3KPSA 3ZO9A 1J5OL 4HULB 3VW3H 1NGZB 1FORH 1ZHLA 3C60C 3FO1B 4ZUVB 4Y19E 2AJUL 3KDMA 3VFNA 4I0PC 1YEEL 3DMMB 5CJOL 3LQMA 4HK0B 4PGZA 5JXED 3WQ8A 2UUDK 3S8WA 2ERJC 4I48A 1QNSA 1NFIA 4QRPB 4P57A 1C16B 4M8QA 1WDPA 2RCSL 4JRYB 3LRSA 1G7LA 4B41A 4HPYL 4XP6L 4LNVA 1YN7B 4XRCB 5TDPA 1VFOA 4PJGA 5I8EB 3VXOB 5KS9A 3HMWH 4YDKH 4KKBD 2JK5A 1FRGH 4D0CB 2MFNA 3K0WA 3L1OL 1E4LA 5EU3B 1B4RA 3B9VA 3MRGB 5DK2A 3T0VA 1XCWA 3VCLB 4MQ7B 1YMHA 2DBLL 2E9LA 2F5AL 1BQUA 1I9EA 4IIQA 4UTAL 1QLRB 3UEQA 4YHML 2NY5C 2G75A 4L4TE 9CGTA 3MRDA 4KK8C 2NY4C 4MB4A 4UQEA 1BQHB 3ARGC 2APFA 5K9QI 5L6YL 4PMQA 5D2LA 3QXDA 1TG7A 3G5YB 2YBRB 1T89C 4NT6B 5CSZB 2B31A 2MQCA 4RFNC 1TTUA 4HKJB 1IGJB 1KCVH 2R0LH 3WV0A 2O61A 1ZB5A 2EC9U 4IRZL 3GMOA 4L4PA 1L0QA 4AZCA 1JZ3A 2JJWA 5KANI 1NFDE 1L9MA 1T66D 3MLTA 4HX1A 3V4PL 5IGXL 3PZUA 5E2UH 1HKLL 3QG6A 4ZXBB 4QDMA 1JFQH 2FWOB 3DJ9A 4ODSL 1C1EH 1XGRB 2J62A 1RZ7H 5HJ3A 1AC6A 2EIZA 3G5VB 3RGVB 2NT1A 5IBUB 4NM4L 3PIQB 4Y4HC 4DN4L 1BBDH 4UNVA 3KWWA 4QKXB 3I6GA 5MERA 4P8VA 3IRZA 4D6IA 2ZNXA 3WHE1 3SUTA 2ZUYA 5TF1L 3AYSA 2XSBA 5L7XL 4NJ9H 1RSFA 4IHOA 3WFHA 3WNLA 5F1IB 1DCLA 4NRXB 4L8SA 2A0LC 4HMEA 4XVSH 5A2FA 4JQIL 3HI6L 3VH8A 2VWEC 4YHZH 4HIJB 2H2PC 3QQ4B 3TO4A 4KMTL 3WKZA 3MLSH 3WD0A 2YD4A 3N50A 4L3EE 5FYKL 5GGUA 2A3EA 1A7RL 2A83B 4HKBA 4K2UL 1N5YL 4MJ6A 1F90H 4LSSL 2QSTA 1XH3A 1NJ9B 3HC0B 4LHUD 1LE5B 5D8ZA 3JSSA 3IU4H 5CINH 4OQTH 4XZBA 5DMGD 4M6AA 5AYUL 4XCFH 4K94H 1F3DJ 3MJ6A 1YUHB 3DV4B 2LVCA 1YMMB 5C0AA 2NNAA 5C0GA 1GORA 2APXA 4J8RB 1D5ZA 1IJ9A 4PJ8B 4AQ1B 4GS7C 6A3HA 1U8QA 3D9AH 4NN7B 4LPYA 3ZE0F 1XCQB 5BZDA 3GRWH 1S7QA 1AR1C 3RHWK 1MREL 4G43A 1FP8A 2V6HA 2VLJB 3W0WD 1XF4B 4MNGA 1U3HD 3L6FA 1V0MA 3AS3A 1OCWL 3HRPA 4D6JA 3UYRL 2CIPA 3SQBA 1FO0L 4P2RA 5ICYA 4E42A 4ZFGH 1PSKH 4NUGL 3MGTA 3TTQA 2BHUA 1AIFA 1HHKB 3IFLH 1FCGA 4MS8C 2W60A 4W81A 5MHSE 1JZ8A 4ODVL 4HC1H 2WC4A 3STBA 5FK9B 3TH3T 1NLBL 4RX4D 1UB5B 1RZKL 5FFLA 4JZNB 2ZUNA 3BH4A 5JXAH 3BSZL 1V3KA 3HPJA 1KTDB 4KI5D 1XF3A 1K5NA 3N1GC 1NBQA 2A77L 4TSBL 1IEHA 2WBJC 1GJUA 1GAFL 5IWLA 1F42A 4RGNB 3BKCH 4Y8AA 6FABL 4KJQC 5SX5K 2ZSWB 2PTVA 2W0FB 4H8UA 3P4NA 5HDOA 1PQZA 2GJ6D 2B1HL 1VPOH 4B50A 3OQ3B 1X6NA 1NGQL 3RPKA 5ECUA 5JBFA 2ZUQB 5I71B 2DPEA 1XGYH 1Z5LB 4S1DC 4OV6F 5ID1A 4OB5H 5E6YA 4XNQB 3UROR 2F8OA 1XYFA 5IFHH 4PJHB 1CWVA 4U49A 3T65B 4D9RD 5E4IA 3JUZA 4Q97A 4YDVA 1E6JL 5CILL 5E24E 1I85A 4MD4B 2E6PA 1OTTD 4AH2A 4LAJH 5FKAB 4DWSD 1FYTD 2CK0L 3S36X 4ZUWA 4N90D 4Y5XC 3VXTA 1FC1A 2EBNA 3UR7A 1L4IA 3IT8D 2NY2B 3MXVH 3QBTB 4YIQB 2IG2L 5GRUH 5D6CA 1AI1H 1MRFL 5E95B 4RWYH 4ZPVA 1IC4H 3UTTA 2FATH 2ITCB 1JXKA 1RQ5A 5B4MD 2PTTB 4GRMB 4FN0A 3MCLL 2GK0B 5IG7B 5MEOB 3VFPA 2HH0H 4KROB 1VGEH 3OKLA 5FV2A 4F58L 4Z76A 2X05A 1YYML 2I60L 3TV3L 1X9QA 3V6ZA 5T1LB 4FG6C 1IGMH 4NGHL 2CIIB 4GKOA 4Y2DB 4PGCA 3VDBA 1BVLA 3SEPA 3O41A 4WFFD 3OZOA 4OZHA 5E99L 4I5BB 3BIKB 4KVNH 5HDBF 4Q6IC 4QRTA 4JY5H 1BZ7A 3LPOA 3DSNA 1ZHKB 4RBPH 4PJAB 5EBAA 4PP1C 3LRHA 5HYSB 3P9MA 5MEPA 3CLEH 1U95B 4HUKB 1BPVA 3THDA 3NZ8A 3O3DA 3VG0L 1B0GB 5DJXA 4S1QH 3D18B 2GK2A 3MYJB 5D72L 5A8PA 2WWKT 5T3XL 4HWZB 5I75B 3FW6A 2M8XA 4E5XA 4XBPA 1OF2A 1BOGB 1F3JB 1K9DA 5D7KD 3L5XL 4OLXH 4WI6A 4GG6E 3EFFA 1UEYA 4LLUB 3KR3H 4F2MB 1MCNA 3ARDC 3THML 4QXWA 5DSCA 5FYJD 4N9GB 4GXUN 3GJFH 1M03A 4FA8A 5JDSB 1S5HB 2X1XR 2UZXB 3CLFH 4BQ9A 3O8XA 1E4WH 4APQA 4N0UA 4U3CA 4U1MA 2BY2A 4FQXA 3PHSA 1JJUA 4PMNA 4JFHD 3RMEA 4UIKL 3KL5A 4PSPA 4M1GL 4KVCL 3CH1B 4KFZC 4PRAB 4JFPA 4M93B 4EBQH 3T04D 2VQ1B 4QGYA 2YD5A 4PJCF 1SVZA 1ZA3A 5HBFA 4UZUA 1C12A 4TULL 5F93C 4NP4L 4LGXA 2ICCA 3I6KA 3DYOA 1GZQB 3SKMB 4K8RC 3LD8B 4MNKA 2OXHA 3MJGX 2DKUA 2FIKA 5F8RC 3C09B 3DRQB 4MHHG 4TRPL 1QUNA 3TESA 4AC1X 2GTZB 4OQTA 2ICWA 4PY8I 5B38G 1SFSA 1Q9OB 5AUMB 4YXHL 3N12A 2VSCA 5A8QA 5DUML 2X10A 1NCDL 5JHDD 3C5ZC 1KTLB 3OIHA 3RAJL 1ROWA 5INCB 1ZS2A 1VACB 2VZOA 1JWSB 3GRWA 3IDNB 2CCRA 1CZ1A 3DRTB 1PYWA 4D6CA 4X7EC 1RUMH 5C0EB 3E0GA 4E2OA 3TVMA 1EAPA 5H94B 2NW0A 4QEGA 3SDDD 5EDXA 5ESAB 2DQTL 4WO4D 4PD4J 5CFHA 4Y2OA 2YUZA 3ARZA 3G08B 3L3JB 3GMMA 5CKGA 4FZEL 3GM0A 4LCCB 4HC1A 3EOTH 3NIYA 1TCRB 3ISWA 1A3QA 5I1EH 3OGSA 3U1SH 5IIEB 5B38A 1V6XA 2W67A 5EOCH 4OIAA 7TAAA 1V0NA 1RK0B 2EYTB 2F19L 2Z8VC 3MUIA 4GQ9L 2Q7NA 4PRHD 5E70A 3VFWB 1CDCA 1W3HA 3JTSB 2FX7H 4EN3C 1UQSB 4BFIA 3MJ8B 4OGXH 4YDJA 1Q1JL 3A6BH 2J7LA 3RGHA 3JV4A 3UCQA 2O5XH 32C2B 1UC6A 4IJ3B 3MA9L 2VABA 4LVNB 1XF2A 1IC7H 2L7JA 3JV6B 5C07D 4HFWA 2GVYA 3P9WB 1ZANL 4Q22A 4NKOA 2BFVH 2XA8H 4RSVA 3HC4H 5CJQH 1M7DB 3ZYZA 2GKIA 1KIUA 4BQ5A 1NBZB 5MEQB 5FO8A 1GGIL 2VISB 3KHQA 3AXHA 1R24A 3WDPP 3F6LA 5EOQL 4L4VB 2AV7A 2L4OA 4S1RL 1F8TH 2VITB 1CCZA 1CQYA 3OB8A 4I0PD 1WFOA 2A3BA 3OZ9L 4CD6A 1PZ5A 3VM7A 4MXVF 3MKKA 4JPKL 4LSQL 1A6VH 1IKFL 3H0TA 3HUJE 2PXYB 3L9RA 4HMDA 2WXDM 4HQQH 2PWFA 3UAJC 3GMPA 2W9EH 5EOTB 3QUKB 1JRHL 3GH5A 1VCAA 5I1HL 4G3YH 2G3IA 4KV5F 1G7JB 3MCKB 3MRCA 1ZLWH 5I18L 3JTTA 4DCQA 5JR1L 3VG9C 5F7DB 3U48A 3AMKA 4FQHA 4ELME 3CHFA 4B3KA 4ZYKB 2PBGA 1CLZH 2YC1A 1OB0A 1SMOA 1FFRA 2Q8XA 2HKFL 4GRLB 3THCA 3IDUA 1CFNB 5FM4A 1NBYA 4N0CC 4MNQA 3RWIA 3EDEA 1XMWA 2NZIA 2AK4A 3FQRA 3N17A 3M45A 1X5GA 4N8VA 2NPLX 2LE9A 2W0LA 3D85D 1OY3B 3GXFA 2DL9A 4KK8D 2NY4D 5C08B 4X6EA 1NCWH 2VNCA 3ARGD 1F6AB 5JLZB 2ZCHL 5GGVL 4TQEL 1XHGA 1XH1A 3W0WE 2ESVD 4PPTA 2JCCB 2BNUA 3GJFA 4KDVA 2NX5D 5KEZA 1FIGL 5C92A 2PO6A 3FFCE 4R7DB 5JOPD 1RZFH 1K9TA 3D3AA 1VKXA 2IAMB 1ES0B 4QAWA 5FD0A 4QXUH 4BZ1L 4LCIH 1TR1A 3TYFA 5DJ6A 4JY6B 4UT7L 2A6DA 1MCJA 3GIVB 2ADJA 2PW1B 4P9HC 5HDQL 4NO3A 5KW9L 1W72H 3JVGA 4Y4HD 3T4YA 3CVHA 2RJMA 1PY4A 5F89B 2QV2A 4KI5E 1H9VA 1J1OH 4YHEA 3C08L 3MR9A 2BSRB 1OPGH 4OF5A 2IPUG 2XGBA 1AJ7L 4ZO9A 3QO1B 4HIHA 2ADFL 1CFSB 3P11L 5H37H 4LRNH 4YNYB 3SDAD 5D5MA 2GJ6E 1F58H 2A0LD 3O4LE 5HGAB 5HY9A 4I18B 1AC0A 1KXVA 2QTEA 4DOHB 4OGAC 1FZOA 1NDMA 2H2PD 4KQ3H 4Z7QF 1KXQA 5F7FA 5MI0B 2JLLA 1MH5A 4L8BA 5ID0A 2CLVB 3QCTH 4X7FC 4DVBB 2G9HA 4TVPL 2VXQL 1INQB 3X3GL 4CN1A 1US3A 2OSXA 4X4XA 1HVQA 2HFGL 3DX7A 2B4CL 5BVJB 4LPUA 4NO5B 3SBWA 2Q8BH 3CFBB 5IFTA 3P4OA 4N90E 1G5AA 2EDTA 3BP6B 4RWHA 1UA7A 4LSTL 2BMKB 3QXVA 2I26N 3L3OB 4Y4KA 3VD7A 3SE3C 2ZX8A 3I85A 5IFJB 2QMKA 3EDFA 4F33A 4CW1B 1NCUA 2Z1KA 2IANA 1AR1D 1G7IB 5LA1A 4MX7A 5HHOA 5HVWA 2CKRA 1MCRA 3KYNB 2C4XA 1SYVB 4J27A 3EW3B 3PNWB 4KI1A 3P2TA 4BQ4A 3DURA 3VXUE 4NJAH 3IDMA 4XMLL 2YS4A 1JHKL 2VXTH 2CDFB 4GLRI 1KULA 3RVUC 2VSDA 3RJXA 2AQ3A 4MQTB 1HOCA 4MS8D 4OZGE 3RL1A 4D0DB 5CD3A 4GFTB 1K85A 2FD6H 3PDOA 1CXIA 3FQTA 2EECA 5EO1A 4EDXB 1P6FA 1R3HB 4QHUB 5IEHA 5FO7B 1T1YA 1DL7L 3NFSL 4PJ5B 4Q58C 3V8CA 1S9YA 3QDJE 4NQVB 2J6EA 4S3JA 1X3DA 2HTKC 3NCEB 3O45B 1FFQA 2WBJD 5L2KB 1CL7I 4YEEA 1Y0LB 2FB4H 3BHBA 3VRJA 2H45A 4URIA 1GGUA 4KJQD 2YA2A 12E8L 5MENB 5FYJE 2E3ZA 2EPKX 3AU1A 2DQDL 3EOBA 4XPHH 3P4MB 2WZEA 3CDYA 3OAUL 3HE7C 4S1DD 3H6JA 2QKIB 3H9SB 3VPLA 2WPGA 3RTQA 5ABFA 4LYRA 3WNMA 1MVYA 1EQPA 5D9PA 1BZ9A 1FL3A 2H26A 3WL0A 4U1HB 1MFEL 1EK3A 3AAZA 15C8H 5ESVB 1ZLVK 2WMIA 3OZPA 2AEIT 5D9MA 1PZ2A 1QHOA 3O2DL 4QRSA 4LMQE 1JPFB 1S7RA 4OZIA 5KVDH 3PTKA 4PRIB 5IMKB 4B0MM 3VXSE 5ACLA 3GH7A 3UJIL 1U6AH 2YKLH 4NQCA 4G7VH 4P46C 4ZAKA 3W53A 3DUHA 3QXTA 4NIKB 1NGYB 3PWLB 3QDHA 4FLRA 4HZ8A 5E2WH 3QUMB 4ZUUB 5ICZA 4FG6D 2VDOH 1Q94A 4JO3L 4JGMA 4WW2F 4ELKA 5GQBA 3UJJL 1HYSC 5IMOA 1MJ8L 4ONHB 2QSCH 8A3HA 4PBGA 1CD8A 3RA7H 1IMHC 4MPKA 4BZ2H 2DH3A 3AB0C 4PP1D 1LD9A 1QSEE 4LGPB 5BOZG 4HOWA 5H37G 3HS0B 1QA9B 4WU7B 4EK7A 4OV5A 4XB3A 1YJDH 2ARJA 1BQHG 2CJUL 5FYKU 4NKMB 2H3NB 4GRWE 3VIHA 1JPGB 1UM5H 1ONQB 1GHRA 2OXGA 2Q8AH 3D69B 1C5BH 2P8PB 1KR0A 3GHBH 4XCCH 4EVNA 3WENA 3ARDD 2MCG1 4Z2GA 4PGDA 1MPAL 1K8IB 3D3VA 1JGIA 3BESR 1W72A 5EO0B 5CEXB 3DGGB 4MQ7A 1FAIH 3OLDA 2J8UF 4UQ2B 1C1EL 2E7BA 4M29A 1D9KB 5IBUG 2XWDA 1RZ7L 3G5XA 3F4VA 1ZHBB 4C83A 1U93A 4RE2A 3PF2A 3HI5H 4NO0A 3F58H 4QLLA 5E9DA 2DQGH 3C6LB 4GBXA 4AZGA 1TETH 2H6PB 3K2UH 2F58H 1D6VH 1AO7E 1NMCC 4YE4L 4OI7A 5B39G 1J1XL 1BLIA 3MMWA 3BCDA 3EO9H 1WUNT 2OMNA 3QIBC 5D7LE 5DYOB 5GS1B 4P4KB 4WJ5B 5I24A 1T20A 2MCPH 4WY7H 3MUHL 5IKCB 4K8RD 2XPGA 4F8XA 1QLEL 2IFFL 1ZK9A 4NKDB 2WW5A 2XRAH 3Q6FA 1CXKA 4YHZL 5DMYA 2FHCA 4UDUB 3E3QE 3LKOB 2UZYB 3VWJD 5T3ZL 2P49B 1E4NA 1CFTB 2W9LA 2D0GA 4PRPD 2I25N 2Z0BA 1ZLUH 5C8JB 3K46A 4AD3A 3ZYJA 1LL6A 3CSPA 1KLGB 3AZRA 3PIQA 3GSXA 3C5ZD 1BHGA 1QBML 4R0LC 3QDMA 3NZHH 1WTGT 5I30L 3TOPA 3EYSH 3TN0B 4CMMA 1MCWM 1QTYT 5B39A 2Q86B 1MNUH 4P2OC 2YBTA 2ICWJ 1W9PA 1ZT1B 1FLRH 5KTEL 2YEZB 3LEYH 2IQAA 4U1IB 3QUXA 4E0RA 1LWJA 5I79A 3TWCH 2VE6B 4QTIL 1UWIA 3WNPA 2FECL 3SCQA 2VT0A 4HIJA 2PR4H 2FJHA 1H3PH 4DFHA 3GIZH 3WFZA 2WHMA 2VRAA 1MJ7L 1NGXA 3VXNB 2EYRA 2PCPA 4CVWA 5I77A 4LPXA 1JYNA 2FH8A 3BOVA 2EDFA 1IV8A 4X0VA 5KSUA 5KSBA 5DD6A 4HH9A 3MLYL 4W7VA 1KJMB 2DQFB 3AMLA 2OP4H 1XAUA 4EN3D 3VFUA 2YZ1A 2D24A 5J11B 1KB5L 3K2MC 4E4PA 1CTNA 4J8RA 5E8PA 3EFDL 2QHAA 4RAUB 4Y19A 3BYYA 5ACZA