3TP4A

Crystal structure of engineered protein at the resolution 1.98a, northeast structural genomics consortium target or128
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
465
structure length
454
Chain Sequence
DETIAIVDADATAETRSLLSYLDGVRGEGILFGHHGTTSSGLTTGPTDGTTSDVKNVTGDFPAVFGWSTSIIEGNQRPGLAENTRDENIALFADYIRKADAIGGVNTVGAGVENFVTGGSFYDDTLRAVLPGGSHHAELVAYLDDIAELADASRRDDGTLIPIVFRPWHENAGSWFWWGAAYGSPGEYQELYRFTVEYLRDVKGVSNFLYAWGPGGGFGGNRDVYLRTYPGDAFVDVLGLDTYDSTGSDAFLAGLVADLRMIAEIADEKGKVSAFTRFGVSGGVGTNGSSPAQWFTKVLAAIKADPVASRNAYMETGENADAGQHFVPVPGDALLEDFQAYAADPFTLFASEVTGAFDRTVAAAPAQPVVHIASPADGARVASAPTTVRVRVGGTDVQSVTVEVAQGGTVVDTLDLAYDGALWWTAPWSPTYTVTATATTAAGTLDVTNEVAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of activated serine-containing catalytic triads with atomic-level accuracy.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Structural genomics, unknown function
molecule keywords computational Design of Enzyme
total genus 153
structure length 454
sequence length 465
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tp4A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3tp4A01
4HSQA 5HJ3A 3BAIA 1UWUA 1YA5A 3BDBA 3F12A 3W0KA 4ZUWB 3TA3D 4M48H 1ZHBB 1MWOA 3MXWL 3NCYP 3ARGC 2NXYB 3GGWB 4BKLA 1W3JA 3AFBA 5HGDA 3VXMA 3HAEG 3FHAA 2DSZA 3AIBA 1EO8H 1T80A 1W72B 4ONHB 4WFHD 4P4KB 3KNBB 4M6NL 2FEDD 5A3ID 4Y7EA 3MV8E 4R9HA 2V3FA 1LWHA 4U1MB 4AD4A 2YK1H 2HKFH 1MJ7H 4Q2ZA 5DJ2A 3MLWL 3PZQA 4ELKA 1LO2H 4KTEL 3EJYD 3OGOE 5EN2A 4AIUA 3N1GC 2I5YL 1HHIA 5EU5B 3G6MA 1RK0B 2WB5A 4QLJA 1IAIM 4PV8B 2AJZB 1T20B 1CDYA 4ESKA 1QBLL 5E03A 1S7SB 3CFEB 4UIMB 4AYSA 4Z78B 4KY1H 4NSKA 1JZ4A 2EXYD 3GSUA 5T1DH 5D6CA 2DQCL 3F58L 2EDYA 1HH6B 3H2WA 2FLRT 2XIDA 5D2LB 1YNKL 4X0VA 4M9PA 2AJSL 3O8XC 2W63A 5I0ZA 2RGSA 4GMTH 4PRHB 4U1IA 2YMXH 3A6OA 5ADOH 4WY7L 3ARBC 3PWUA 1LEIA 3TJEH 2I9TA 3AJ7A 3WLBA 5L0QB 4FQQA 4Y4KC 3ROOB 2DM3A 3NFSL 5LGHL 5T3XH 3FT2A 1I1CA 1HINH 1QR4A 5GSVA 1BBDL 3DYPA 3RWGA 2DLIA 4G6JH 5B21A 1KJ2A 2NY4D 3HS0B 3A47A 2FX8H 4G9FA 4L5FL 4DZBB 4RWYH 2QMJA 5J13C 4NWUL 1WDPA 1AXSA 1HYSC 1H3VA 1YC8A 2CRYA 4Q97A 3VFSB 4JDTH 1UKQA 1J8KA 1FIEA 4LBEA 4OCLC 2LTQC 4LEXH 4WHDA 4FP8L 2IFGA 2G75B 2IF7A 4UCFA 4FF5A 2Z0BA 2I9TB 5DEGB 2O92A 1MJ8L 1PX8A 2A6DA 1GORA 5D96C 5L2JA 3BZEA 4PRHD 1PKQA 3FB5A 2VXTH 2FIRT 2CUHA 2YWYA 4Q9RL 2X9YA 5DMIL 1BM3H 2NXZD 3LEVL 4GI6A 2A6KB 5EULV 3WXVL 3KPSE 3PBGA 3T0XA 1XR9A 1GCFA 2X41A 1FIGH 4LLWB 4AZCB 2XN9B 3JWOC 4JFEA 4ZXBC 5AEAA 1KPVB 5IB5B 2WLZA 5IM7B 1NFIB 4LHJB 4EUPH 2B8OT 4Z78A 4LSRH 3LMYA 1BLNB 1GHFL 3CXDH 4NYLA 4G42A 4QLRA 1AGEB 1YPZF 4P99A 4RMVA 1EXUA 1CF8H 4NUGH 3TCLA 2I27N 4UDUB 3TVMB 2ENSA 1I8IA 3KS0H 2BHUA 3B8SA 2ORBH 3BSZH 1SEQH 1J86A 1R3IL 1S7WA 4XB7A 2VLRA 5E5RB 4RFOL 3FB8B 1G0YR 6CGTA 2KBGA 4UT7L 4JL1A 4IRSB 3GJFH 2X09A 4QRPA 4OI8A 1B3JA 3VFUB 4OT1H 3BXWA 5I1AB 3MO4A 5IVXE 2VC9A 3WHXB 2YDRA 4UQCA 3A6CL 3PP4L 3CX5J 2B1AH 3FQWA 3VPLA 1LDSA 3FN0L 1PZ5A 1T4KB 4YHYC 5E6YA 1W72A 2FDBP 2YS4A 2WSPA 3WMCA 4C55A 2DJUA 1Q4NX 5E8NB 1QFOA 3CFJB 5A6KA 4KTYA 3L3DB 1FFRA 2HN7A 5JXED 1RZFL 2Y06L 4HCRA 3KPNB 2Q6WB 1WJ3A 4HXAH 4PP1D 5MERA 2B20A 5IMMA 2PCPA 1T04A 1GPOL 2GJJA 4Y4FC 2BXZA 3L5WA 1KCKA 3U46B 4XNMA 5C08B 3MV11 4JPIB 2V2WA 3V5HA 2RGLA 5F7FA 4OCWH 1JK8A 1Q0XH 2J5LC 3WXWL 2EQDA 1H3PH 4JG1H 1KPUA 2QQKH 3F5WB 1AO7D 5KSBF 4MQ7A 3RVWC 5D7LA 5HHPB 1NGXA 1QZ1A 5K93A 4PJ7F 1S5IH 1LE5A 3VWJD 2CIIB 1T5WB 5DD6A 1R0AH 3HPJB 5DD1L 5JORB 4AT6A 3EMZA 5GGRA 4CCEA 3QUZC 5DEGA 5HGAB 4XCCH 4RE4A 3RDTB 1QP1A 1HXMA 3H42L 5KSAB 1K8IA 4DVBA 3BZ4B 1AJ7H 3D0VA 4JY6B 4L3EA 4LSUH 5DMGC 3O3DB 1JF5A 5HGGS 4AEHH 4RL3A 4XC3H 3DMMC 4JO2H 4GO8A 4NRSA 3KPLA 4YHMH 4W88A 2E7HA 4WI9A 2ZXBA 4FN0A 2W62A 1UD2A 3WDQA 1P5VA 3S88L 5HYJA 3MU7A 4I0PC 3L3GB 3EOYG 4I18C 4YIQA 5D1QD 3UZVB 4PTMA 3WBAA 4X99B 4ODHH 4MNGE 2XVGA 3ZE2E 4GXUN 1U95B 3SPVA 5EB9A 4OOZA 1XC6A 5D8ZA 1WSST 4KKLD 1U3HA 3UX9B 3LZFL 4ZUVA 1XZ0A 1F4XL 4KMLB 5JHDD 2BY2A 5ABHA 3V6FB 2WUCH 3CC5A 4JM2D 1HXJA 3MX0A 5E2TL 3WKMH 1OTUC 4RZCB 1GONA 4U6HA 1ZWIA 4X7FC 3MJ9A 1BD2B 1YYLL 1HJSA 1MFBL 3SCTA 2WW5A 3QXAB 1R5IB 2YZ1A 3OKDA 1T0PB 3E0GA 3PV7A 3T0EE 4UV7H 1BEYH 1DVFB 5HYEA 3AY4C 4M93B 1MH5B 4U1LA 3MYJA 3U30B 1QQDB 3U7VA 1LEGB 4KAQH 5IT2L 1S9VB 4PJXB 1BFOB 1QD0A 4OI9A 4P2RD 2WMJA 3RZCC 2WMIA 2DD8H 3FQNA 3RQ3A 1PG7L 3DPBA 2X4RB 5SWZA 3QXDB 4GKSB 4P5KA 2Z35B 5A6JA 2IXVA 1L7TL 1FBIH 1NMCB 1IAKA 3CVIH 1MUJB 5FHAL 4PJ8D 1B30A 3KE0A 1CICC 5ANMB 3OKKB 3RGVB 1R3LA 1NCAH 2F5AL 3DO7B 1H8OA 2YR3A 4WW2C 1NLDL 5ICXA 1FJ1B 5BOPA 5D7JA 4HX1B 3DVNA 3MCKB 4ODTH 4XZWA 3HUJE 3PGFL 3RWJA 1GSMA 1TETL 2I07A 5F6IC 3F5LA 3GI9L 4RMTA 2OR8A 3NABL 1I8LA 3BD5A 1HXMB 4HXBL 4LU5L 4RMSA 1JN6B 3WIHL 1J1XL 1FL5A 3S3JA 1B3VA 1TVBB 4Y4HC 4YHIB 5T3ZL 2ZX5A 3VXSE 4M1DL 5KSAD 3RDTD 2BDNH 1X6NA 3DVNB 2LV4A 2EZ0C 3AIQA 3JWDL 5I66B 4W85A 3LSOB 3VXUD 3E6FA 1MCSA 5IQ7L 3IF1A 2GUOA 4S0SD 3W2DL 3VGAB 3LS4L 3QDME 4LSQL 1EHXA 1WAWA 1CG9A 3B4NA 2Z92A 5FGBC 1BMGA 2QJDA 3EO1B 2XFYA 5A2IH 2FBJH 4OZIF 3S97C 1HH9B 2LVEA 4X8JB 3LS5L 4NHCH 1MQQA 4MGXA 2CXKA 2FD6L 3NCFB 4FZ8H 2B39A 4DQOH 4LAJH 4Z2KA 4G6AD 1F4HA 4RFEB 1V0NA 1CS6A 1XYFA 4NJAH 5CIPA 3BKML 3LQAH 2NNAA 4RQQA 4W8AA 2IH1A 2NYYD 2Q7NA 4YHPA 3UEZA 2F53B 5FB8A 1HT6A 5JOEA 2H2SD 4JFPA 5SX5H 3IDMA 4HKBB 1KULA 3OZ9H 1R5IA 3OKDB 4R2GC 3VM7A 4JB9L 3WJJC 4HUKB 1H2JA 3I50L 2CBJA 2J6EA 1C7SA 1CD1B 5IXEA 1IBGH 4I48B 4LP4A 2XKNB 4OGXL 4OQTA 1V3JA 5ABEA 4XXCC 5I8KH 3KPPA 4PJXE 3V4UH 1EHLL 2APTA 4PD4K 4KKNA 2V5RA 3DYMA 4MXWH 3CMJA 5E1AB 1IZJA 1NBZA 2IGFL 3BP6A 2G60L 1DQQB 1FSKB 3RIFK 1SVZA 1KXHA 2RJMA 1CXLA 1T3FA 2B5IB 2YD6A 5CZXC 5LBSH 4PJCF 3S96B 2BNRA 3CSGA 2KQNA 3AAZA 3WEXA 3BYYA 5LQBL 4ZFOA 4X9BA 4TVPH 2ADGA 3GB7B 3TM6A 4BQ9A 4ATDA 1P7KA 3D3VA 2H3NB 4OCXH 3QUMH 4HZ6A 1X5IA 5IF0A 1I1WA 4J28A 1Q1JL 3W5MA 3SJVA 1PG7X 1LQ0A 1ZHKA 4FABH 4HK3N 3WIFA 1WBXA 5DURD 4AD3A 1H8SA 3GK8H 5JNYA 1ACZA 1T1WB 4BH8B 3FO1B 3RI5K 5I1EL 2ZOLA 5EN2B 4HG4K 3GXIA 5D4QA 1JPTH 3NMEA 4AL8L 3QB7C 5SWQB 5JLZA 3B43A 3J8F7 1KFAH 4GRLA 3OG4B 4PJCB 5IG7A 4FQHA 5CAYB 4R26H 4L29A 2A73A 4DVRH 5EO9B 3FXYA 1TR1A 5ERWA 4OM0L 2CRMA 1KUMA 2B2XH 2CDGB 3QEQB 2WHKA 1P4LA 3IAPA 5E2VH 4S1RL 1UWRA 1Z32X 4E4PA 3UCQA 1FFNB 1ORQA 1NP0A 3U4BL 2R2EB 1EO8L 4NQDD 4Z95H 3CBWA 3SCRA 1D5BB 2YC1B 3RNKA 4N0UE 1JZ3A 3KWWA 2VVNA 4KXZH 3QFJE 3RA7L 5IFAH 3WQ6A 5EG6C 1VDGA 4DGVL 5JIKA 2X5PA 5IB4A 3PUCA 2FB4H 2C4XA 5EU6B 3LCYA 2G41A 3W27A 1T22A 1N26A 4I48A 1ACYH 2NYYC 5IIEB 4H26B 2K9UA 4ZO8A 4YHLH 1SMDA 4TRPL 3TO2A 3P4MA 3TJHD 3U7BA 2JCCF 4MPKA 4MNQB 4M6OH 3MUAA 2H2PC 1WP6A 4PV9A 3WQWA 2OL3A 4L4OA 1Q6GA 2VZ1A 5BMFH 2DQCH 3F58H 4X9HA 3VWJA 2GDVA 3TIDB 1LJYA 1KBKA 4IM8A 3U79A 4P46A 4HWEL 1ZANH 4PMNA 2BNQB 3UJJH 4F9PA 4WWKB 2IC2A 4HIXH 2AJZA 3IU4L 4XAKE 2PWFA 4OJFL 5CBEB 3EO9L 1L0PA 3EO1A 1BQHA 1OB0A 3TONA 2ITDA 4DGIH 4QWWC 1CVRA 4ZFGL 2WMFA 3AZRA 1IL1A 3E6FB 4AZCA 2XIBA 1GGCH 2XQBL 1ZXQA 4NC1C 4DEPB 3GJFB 1SYVA 4EZMA 1FGVL 1WKYA 4NZRL 5T3XL 2W9DH 4ONHA 5HI4C 3BRGC 1HL8A 4JFFB 5TDPB 1MSPA 2GYSA 2MHAB 1JDAA 4MNMA 3SGDH 5AYQA 1JK8B 3HE6C 3GUTA 2RHEA 2DQGH 4H8WC 1G7QA 2AJVL 2CCRA 3E1F1 4RWYL 3OMZA 5FM4A 5JO5A 1S3KH 4QRTA 4CVUA 2D23A 1TJGH 5LCVH 3QULA 3MNZA 3L2LA 3TA3B 4JKMA 2VLRD 3P4NA 4MAZA 3RWFB 4K3HA 3U36B 4XX1E 3KPSA 3TYFB 3TESA 5BV7H 4E0RB 3WL0A 2EEXA 3GXFA 2JALA 4NRRA 1XF5A 1WCGA 4H41A 3C2AH 1JPGB 4XTRD 5DA4A 4NGHL 3ZT6A 4LHUG 4P46C 4MWFB 1EOKA 3V0VB 5C70A 2CKNA 2UUDK 3AYSA 5ISZB 4AQOA 3MRMB 2EIEA 2CMRL 1I1FB 3WKNA 5E08H 1JPST 4X9IA 1ISZA 4N8VA 4MDJA 4NUGL 2QSQA 1UQZA 3QXAA 4N42A 4HHAB 4V1DA 1UQYA 4HOWA 1KXQE 3VXSB 2JCCE 2XM2A 5ID0B 1KLFA 1FHLA 2R4RL 4HMEA 5L2KB 5HNNA 3SQBA 2AVGA 3GJEA 1M7IA 5ISZD 1KXVC 4K8RL 4JFEB 4M03A 3CHEA 3B9KA 2R29L 4ZUVB 2IQAA 2HLFC 1E40A 2AJXL 2WBKA 1BVNP 1AO7B 5TDOB 1FH5H 4HC1A 3QCVH 4V1DE 1UR0A 1HHIB 4MJID 3BDYH 1PYWB 2XA3A 4F7EA 4HKZA 4GUPB 2O61B 3B9AA 1IAII 4OD3H 3QEHA 3IDNA 5JW5B 3GSXB 1A6VH 2AERT 25C8H 2P45B 3A67H 3HE7B 3V7AE 1RI8A 4Y2DD 3MV9D 3O4LE 4XB3A 5C07D 4F8QA 3PWPB 5DRNB 3PP3K 5HI4D 1LO3H 3MLPA 4HH9B 1CENA 1W72L 4MA1C 3QH3B 5FYLL 2RR3A 1QPPA 3D25B 3QDGD 1GQKA 1GOWA 3T3MF 1J8HA 2NLJA 5IBLD 1HYSD 2D03H 1I8LC 2HFTA 3EGSB 4POUB 3HI6H 4H5SB 4MQSB 4YFDB 4Q0XL 1R7AA 1DN0A 1DUYA 5D7LB 3MTRA 1E4WL 5FUZH 2RAMA 1Q9KB 4LSPL 4K23L 1IKFH 1J7VR 3OJDB 3RDKA 3T77B 5EBWB 1MI5D 1N5AA 1TVDA 1K2DB 2R1XA 1MQKH 1WC7A 3WKZA 3IJ9A 4L4JA 4CJ1A 5CBAB 2YBRA 4FXLA 2EYTB 2JJSC 3QQ4B 4PGEA 5I8CA 3VRIA 1CDUA 2BNQA 3MLUH 5EWIL 2H9GA 4EI5A 3UBXI 4EQ3A 1DQLL 5DLML 1NKOA 5D9SA 5EUKB 5K59E 3BPLB 3MROB 1XGRB 1R8LA 1EMTL 4HKJA 5L7XL 2EC8A 1VJZA 4UTBH 4Q7NA 5K59F 3TVMC 1HIZA 1E6OH 2VL5A 1U92A 1BJMA 3GKWH 1G84A 1CN4A 5DGRA 3LAFA 5FO8B 5LWYH 1A21A 1RIUH 4HUVA 3ZKMD 3FFDA 2R1XB 1NWUA 3NAAL 1XMWA 1JYVA 4GKLA 5T5NF 1UWIA 3DXAD 5DJCA 2EDNA 3LD8C 1MFBH 4BJLA 5E00B 4HWBA 1HI6A 1IQDB 4EN3A 3OHXB 3O6FB 2PR4L 4NIKB 4I2XA 1K9DA 1ADQA 2PTUA 3VFGH 1F6AA 4XNUL 2D7NA 3OLDA 2H32H 2C1PB 4KRPB 2PYEB 2FEEL 1JN6A 3K46A 4HAFA 1LL4A 1MF2L 2P1YA 4M5ZL 1P4LB 3M6DA 3QH3A 1QW8A 2XZZA 4H88H 4HUUA 1I8KA 5F9WC 5IB1A 1EUUA 3Q5TA 4ODWA 3KPQA 4ZS7H 2EO7A 1CR9H 3W9EA 4LP5A 4JE4B 1W3KA 1DWJM 4Y5XB 3AQUA 1IGTB 5FM5M 1OAXH 5GGUB 3L7FA 1V0LA 3R8BB 1MVYA 4TUKL 1FFPA 3UPCA 3REWA 5KS9B 1J87A 4KI5E 5FHBL 4ETQA 1TFVA 2C7UA 1KIQA 3QPXL 3BIBX 1JNJA 1RUPH 2AJUH 2WCAA 2P8LA 5D7LE 1MCRA 1T2XA 1C8QA 1E56A 5FYKL 1C08A 4EOWL 3QIUC 5DHXB 4XPHL 4P7QA 4AWEA 1KG0A 2X10A 3NBNA 2ZNWA 1KB3A 3D3VB 4B3KA 4LU5H 1ZGLM 4XXCA 4WUUD 1SJHA 3SCVA 1KGCE 3RDTC 5KSAC 3LB6C 1J1PL 3OXSA 2HWZH 5EO1A 3L3IB 3P9MA 2IFFH 5HYFA 2FRGP 1B3XA 4GSDH 3N1AA 1XAUA 1NCBL 1KENL 1TTGA 2ZUTA 4OLVH 2IALA 3SKUD 5CEYA 5M94B 3TBYB 4P2OB 3EYQD 3MSPA 4PJXF 1EERB 4ATLA 5IW1B 5IQ7H 3QT2A 1BFVL 5HYJE 1OAUH 2ZPKH 3IETB 2AAAA 3V6FA 4JQVA 3CSYA 2RCSL 2LVCA 3VG0H 1XH1A 2DH3A 4GAGH 3WEZA 1X7QB 1LGVA 4F9JA 4NQCA 5DMKB 2WWMC 2E9MA 5TGBB 5IB2A 3MRBA 4GAJH 4X6BA 5EORL 1MFDL 3BAWA 2WZIA 3TZVB 2UY7A 4Y0GA 2QKIA 4LRNH 4QHLA 4MS8C 3VINA 3LHPH 3ULVE 1RFDH 2VDLL 5DVNA 3WDRA 3BXNA 1MCIA 1UC6A 4KK8D 4WFFE 3RWHA 1OARL 3Q3GA 1UZ6E 4GXVL 1FZKA 1E0XA 2CPUA 2Q86A 1X5HA 1ZE3C 3RKDC 4J4PD 1C16B 3V0WH 1VFAA 2VLME 1EEYA 4J4PA 3T0EA 3QFJD 1OD8A 4P0DA 5BRZD 1PPIA 1KCLA 4H0HB 4FXKB 4GRMB 4ELKB 2B4CC 3FO0L 1KGUA 3KPOA 4J3WA 4X0KB 1EHLH 3T77A 4JANB 4M5YH 2UVEA 1B9ZA 4MADA 5DJXB 3KPTA 2Q76B 1EV2E 4AT6B 2CKSA 4U1NB 3JWOL 3KNBA 3W9EB 1G7PA 5LBSL 4M3KB 4JO4L 5IHZA 2ICES 3D6GA 3UJIL 3RPKA 3QUXA 2VWEC 4KKLC 4KK8C 4L3CA 4BKLB 1GHSA 1MFUA 2UZIL 2VN4A 4EK7A 1NC4D 4LPCA 3L3KB 3KPOB 3BQUC 4PLJC 1A14L 1JF6A 2VB5A 3Q5YA 1Q1JH 1KCUL 2QQNL 1P2CA 4HZ8A 2OLHA 3HC0B 2ICEB 3E8UH 4Y2DA 2AJ3A 5JHLH 4TQEL 3T0EB 3L9RB 5HJ3B 2V3DA 3NYDA 3HUJF 4G3YL 1SBSH 3S4SB 3QXVA 1TCMA 2J4WH 3SOBH 5E8NA 3DX6A 2R1YB 1MHCA 1IAIL 3KZSA 2VISA 3D39B 3AY4A 3FZUC 4LCWA 2V6HA 3BCFA 4XP5L 4XAWH 3NDZA 2G9HA 5DWUH 3TO2B 1ZT4A 4ZODA 2IQAB 3W29A 3HI5H 1VEPA 4MX7A 2AMGA 3GBDA 2WCSA 4JPVH 2WAHA 3SCOA 1XGRA 2M1KA 1PW3A 3QNZB 3SE8H 1U8KA 5TE4L 5C0CB 3HUJB 1YY8B 4CNIA 2YD5A 1XT5A 2XZQH 3V4VL 4N0YL 5SWSA 3NZHL 1WDQA 4U05A 1UWGL 3G5YA 1AE6H 1PIGA 3BMVA 3MGOB 3D85A 4GT7A 4ZPTB 3CK0L 2J6EL 2XWTA 1IGCH 3WFEL 2OZ4L 3VW3H 4HV8B 1HX0A 3G5ZB 3IT8D 4WVRA 4F58H 1SM3L 3G04B 3U6RA 5KG9A 3BPCA 1I7ZA 2JF1A 2V17L 5T3ZD 1M05B 4ORGB 4XMKH 3EHBD 4L4TA 2UYLA 5CJBA 3VFNB 5T1LA 3MA7B 5DR5L 4HQQL 5EZIL 4D72A 3EOTL 2CDEA 4M48L 5CEZL 1N64H 3KJ6L 5T33L 1QBBA 4ODUB 4J8RB 4F37F 1G5AA 1OAQH 3PGDB 1VBRA 1U9KA 3FB7B 4P23C 2VR4A 3SJVD 1IC5L 4CN6A 2EO9A 5E2WL 3UPAA 5FL0A 4BUHA 3KGRA 1B4JH 1MJUH 4UIKH 2XFRA 4XPBH 2VT0A 4GW5B 4HUMB 2ESVD 4JREB 4HS3B 5KW9L 4X7EC 3IFPA 5FA3A 1E6NA 4FTVB 5CPTA 1AY1L 1UWEL 2JE8A 2YK1L 2JF6A 1DSFL 4IRJC 3CXHJ 5IGXH 1GGCL 4PJ5A 4RISL 3FB7A 2EE3A 1XCTA 1GHRA 2D7TL 1S9YB 4UR9A 2P5WD 3LMJL 4EXKA 4H1LG 2FCBA 3DUHA 3C6LD 3NCMA 2PTTA 3FOMA 4LF3A 2N1KA 1CD8A 1GUVA 1A6UH 2MQCA 2OJEB 2E9LA 4PGDA 3BP6B 5EC2A 3PZUA 4Z7VF 4QOKA 4OFYD 3L4VA 3BKCH 4PRIA 4FQJH 1FN4B 3BHBA 1QFWH 2DMBA 4U4BA 1F11A 1GQIA 4MXQD 5CJQH 1E9LA 5I1CH 1NGZB 1BWWA 5A16A 3KYMA 2OSXA 1XYZA 4W89A 3K3QA 2NW2A 1GAFH 1E4KC 3OSKA 4FQCL 4UI2A 1AKJA 3SCMA 2G3NA 1ISXA 4UFJA 2ZOKA 5L2KD 2H32B 3O45B 4WO4B 5EBMA 2Q1EA 3IGAB 3KL3A 1IM3A 3UR7A 2P5WE 5DRZB 1IFHL 2CJUH 2FJGA 2O5XL 3FMGH 1BAGA 1J8HE 1XHGA 2GAZB 1MW3A 1M04A 5ALCH 1X44A 3TPKA 3U9UB 4XP4H 1GC1H 4G6FD 2E27L 2VE6A 4PCTA 4I4WB 4Q9QH 1C90A 1BBDH 2NY0B 3H7BA 1EK3A 3NPZB 1MEXH 2DDXA 3BWAA 3L3HA 2F54D 3GH5A 1NLBH 1ONQA 4GS7B 5DJ2B 4OLWL 1A5FL 1U58A 3MRNB 3B3IA 4FQ2H 3OX8A 1DQDL 4LIQH 4M6ML 2C3HA 1IKNA 1E71M 5GZND 4JFZL 1EXUB 4PJ9C 4TVDA 3BAYA 2WUBL 1NAMH 3OTTA 2NXZC 3DETD 5KSUB 3AHXA 2FH8A 3CZGA 2E6QA 4ENEC 1MFVA 1JVKA 5EBMB 1KT2A 4C57C 1D5XB 2A1WH 3MUGA 4HT1H 4QCIB 2ICCA 5I5RA 4YHKH 1H3UA 1IAMA 4N8PA 1IEBB 2D24A 4JY5H 6TAAA 4DWSB 3K7UA 1MRDH 1BJ1J 4M7KH 4Y1AD 3PHQB 4YDJB 3LEVH 3R8QA 5ILTH 4LGXA 2YKKA 3PIQA 4AD0A 2EYSA 4QTHA 4ZQKB 5FECB 1DQML 3DC0A 1YQVH 3UBXB 5EZLA 3HMXL 3RU8L 4M8UA 1FN4A 2BY0A 3U9PH 4GUPA 1CL7H 4HIJA 4PS4L 4YNYB 1NCNA 3D5HA 5GGTL 3JWNC 4RX4D 1TVPA 3WNOA 1VADA 1H9VA 3MOBH 1TZHA 4Z7QF 3RVWD 4ZUUB 3R0MA 5GGQH 4G6MH 4I77L 4LHQB 2OL3L 1AFVL 3FFCD 3P2TA 4G6KL 4HKJB 3GBML 1AMYA 4MDOA 3H3PL 3MROA 3RWGB 5F93C 1MCOL 3HAEA 1CLZH 2AK4A 4NCDA 4ZSOB 1U8OB 3D3VD 5AZEH 4DOHB 3ARUA 5E0CA 4Q22A 1T03H 2DIJA 2B1HH 2YPKA 5D2LF 1DBBL 4M81A 4K3JH 4HHAA 3RAJH 1FVDA 4EI6B 5IMLA 4ZOCA 3P30L 5DUMH 5ACLA 4HOZA 5F9DC 1DWIM 3NSMA 2H8PA 1JXJA 3VXQA 2XUCA 3NIDF 1M71B 1RZ8A 4ZS6D 1HQRB 1QNZH 3PZ9A 4HXAL 4AH2A 5IWLA 4OIFA 3WFHB 3OA5A 3UTTD 3VD5A 1WEJH 2ZUUA 3SPVB 3UG4A 4PJIB 4R3SA 4ZAKB 2HT2D 1BYDA 1CE6B 5AWNH 4HC1H 1W1YA 1QUNA 2BRRL 1WZKA 2AS5M 3BDXA 4UIMA 5M7QA 1RP8A 5BVPL 1RJCA 3X14A 2WIIA 1FQ9C 1A6ZB 2D0GA 5C9KA 1WGOA 4UZUA 4Z7NE 5JW4Q 3VIGA 4OSUL 4OUOA 3MRGA 4FMKA 2HVMA 1AGCB 4B53A 3MO1A 2V2XB 1VACA 3ARPA 4QWWD 5B39G 2CO6B 3IF1B 1ES0B 1FZJB 4V28A 2XICA 4ZS6C 4M61A 4P8XA 3PL6B 3OJMB 43C9A 4HPOH 4AEHL 3O2WL 1TPXC 1NGXB 4LCWB 5I15H 3IXAB 2DJSA 3ZM8A 4K94L 2O5ZL 4OZIB 4DM1A 1NJ9B 3AIUA 5CCKL 3GJFK 3QUZA 4IOFD 2XTLA 2YPLE 3D9AH 2EXYC 4PJBE 3GJEB 1T83C 3MLTB 4ZS7L 5F9AC 1HP4A 2J78A 5EZOL 3OGSA 5DD3H 3CDGB 3SIMA 4WHTB 1FDLH 1FJ1A 1AGFA 1OWRM 4KJQC 3C6SA 3GMRB 1MHEB 3AIVA 3FONB 3FRPA 1RUQL 2VLLB 3VXNB 3O9NA 1TMQA 1NGYA 5JHDB 3IDGB 4FXGA 4LLVB 2F19L 4BYHA 3QHMA 2GK0B 3QI9A 5TDNB 4EOWH 4PRDB 1PSKL 2EIZA 3S8WA 5HPCA 1E15A 5F3HA 3M17A 2UY5A 3AS3A 1I9IL 5C8JB 2VZTA 1W2KT 2C5DC 1XF5B 4JKLA 5J11C 2W0KA 1XGPA 3C5ZB 3WE6A 4LHUD 5FYLD 5KJRL 4PBXA 5SV4A 2WYSA 1NGYB 4C4KO 2VH5L 1NGQL 3EYVB 3MRDB 2CYGA 4ONGH 1ND0A 2J8HA 4MNHA 3FN3A 3QEGL 4LSSL 4G9DA 2DEPA 1VFAB 2AGJH 1YNTB 3ARTA 1B0GB 1FRGL 1J1OH 3SDDB 1VBUA 3MRJA 1D5BA 2BZDA 2W59A 2YC1A 1UB5B 4NYLB 3RNKB 4J2XA 1ESWA 4R4FL 5IFHH 3MNVB 1GOMA 3WBEA 3HNVH 4XX1G 5JDJA 3WS6C 3ARVA 1OAYH 1MFDH 1JNEA 1L7IL 4HGWB 1UACL 2FBOJ 5FOJA 5DK2A 3SCPA 4DKFH 2WBJC 1V8HA 2FX7H 2R1WB 2APBA 4HLJA 3MV9A 1UH4A 3VFVB 5C0CD 5F7YC 4UUJA 1UQSA 3ARBB 5CJXA 2FJHA 4AW7A 1JHKH 1DEDA 5F7HA 2TAAA 1HZHL 5SWQA 4ZXBA 2PBGA 4F3FB 5DS8A 5GQBA 1CFQA 3PZIA 3P0VL 4KROC 1JV5A 1RHFA 1NGPH 4QYOB 3TLRA 2VXQH 3IFPB 5IEKB 5CJ5A 2GJ6A 5D7JC 5DQ9B 4P2QE 3SQOH 1RK1B 2NY3B 3OAUH 3P0YH 1CEOA 3RHWF 4DFHA 3PZTA 2EIBA 4FFYL 1Q8MA 1DFBH 4G8FA 3GMOA 3BJ91 5EU3B 4U3AA 4YXLH 3W9DA 4WKFA 5EZJA 1CE6A 1WTLA 5F1NB 3CO4A 5FYJL 5GZOC 4UILH 4Y5YC 4HJ0D 4JPKL 4LNRB 5IOPB 1KPUB 1F4YH 3QZWB 2WVVB 1GW1A 1KTDB 3RX5A 3K2UL 1SJVA 1OF2A 3UTZB 3VIJA 2FGWH 5TF0A 3CU7A 3EAKA 1KR1A 2Y8VA 5GRXG 4MMXC 2APFA 3TBTA 5I6XB 3BVNA 3QDMA 5TQ2H 5CJ8A 5F21B 5I1JH 2RFXB 1D6EA 4YQXL 4OCMC 4H8UA 1LK3L 2J8FA 3KPQB 3OLGA 2DQEH 3DSFL 2H41A 2J4WL 2WM0A 1YEIH 2R0WH 3CFKA 2Y7QB 2V9TA 1KPRA 1MFCL 2N7AA 3E3QC 1PZ3A 1NWRA 3ZDZE 1Z9MA 5D9NA 4RGNB 4TUFA 1XZ0B 1IM9B 4L1DA 1KN4L 3ULUF 4O4YH 5JUEH 4NQEB 1XF4B 4LAQH 5DSCB 2Y07L 4M82A 1C08B 1MIMH 1KIRA 2K7PA 3ZO9A 2DJ4A 5B3JE 1ODZA 3SCWA 4OGZA 1ONQB 2IANE 3WNLA 5HVFB 3MRQB 3SE8L 4H25B 1T21A 3CSPA 3WF0A 2E8ZA 1R5WA 3HZVA 1WIUA 1GIGL 2ZSVA 5J6HA 4HKXA 4FABL 1CFVH 1V03A 3TZVD 3H9ZA 3DX7A 3I6GB 2G4FA 2EECA 4KTDL 4WGVB 2VABA 1A7RL 1JMZA 4D6FA 1SM3H 4F9DA 1P9MC 5I17B 4LFHD 5INDB 1NOFA 1GC1C 4JRXE 2ADGB 4NN7C 5ADPH 5ID1B 2CBUA 5ITFB 3QFDA 3VILA 4GINA 1S7QA 2Y5TB 4JZJA 3MA9L 1MWAA 4JFFA 5DR5H 4UTAH 1Z2KA 4PJDF 4WEMB 4EDXB 4ODVH 3EUUA 3DX7B 1IGIL 3O2DL 4ZNEA 5T33H 3BZEB 5B22A 3ARQA 4EBQL 4LQFH 3NUKA 5EO0A 3GSVA 1F11B 5E2VL 2FHFA 1RJLB 1LNUB 1QSEA 3WFLA 4K8RD 3VFWA 4X6DB 1DE4A 1UB6A 3ZSSA 3GNOA 4P3CH 4GKSA 1JTPA 1A6TA 1I7TA 4XVTH 4YLQT 3ALWA 2EDXA 4CKVX 5ITBH 5AAWA 4IRZH 1B0WA 1A7PL 1H3GA 1M4KA 2D9QB 4OIAA 1JP5A 4JQIL 3U9UA 5FGCE 5D9PA 2YIHA 1H15B 2V3EA 3W26A 3QNXB 1FV1B 2HFGL 1RULL 2NY5L 5HSFA 4TVPD 5IFPA 4JRXD 2FHBA 3W24A 4MLIA 2VXVH 2EE6A 3FT2B 2YL9A 4D6DA 1VFBB 3TO4D 4ZD3L 1MRFH 2DQTL 4WCYH 4XWGL 3O2VH 2P44B 3C9NA 4JFFE 1A64A 4P8WA 4OV5B 5BRQA 1KFWA 3OZOA 1W9BM 2O61A 3IS1X 3VXQB 3DGCR 5E8DH 3IDXH 1EFQA 5GGSA 2HFFA 1IGJA 2ZSWA 5HHVH 4EI6A 1FA2A 4EI5C 3CHCA 1HNYA 5GPRA 3WF1A 3TCLB 1M6OA 1XCWA 1CXEA 1JWUB 1V6YA 1TUXA 1UFUA 2ATKB 1OPGH 3QG6A 4PPTA 4NO3A 3CFIC 4MAYC 1RURH 3MLWH 4HV8A 4QNPE 3MS8A 1IFHH 2QQLH 2A83A 2W91A 4WU5B 5IJKC 1OTSC 4YBQD 3EHBC 3HG1B 3X12A 5I1DB 2VCCA 3SDAC 1XSJA 4YPGB 1CLXA 1C1EL 1GC1L 4UFMA 4CDGC 5GGRY 4U31A 4D8PA 5D2NB 5C0AE 3OJVC 2ZG1A 2E9IA 3VXRB 4LGPB 1MPAH 1T1XB 3WFCH 3OJ2C 2BVOB 2LU7A 1H49A 1C5CH 4KQ4L 1RH9A 4X5LA 4OLWH 2X2YA 4XBPA 2VLKE 3QSKB 3PNWB 2IPTL 4Q2ZB 1CFTA 4TSBH 4FQ2L 3VFRB 4P2YA 2W67A 4EUPB 5D72H 5CJOL 2ZE0A 2IQ9L 3OF6D 1JG9A 4PP2A 5D2NA 1E1EA 4WRLA 1A6AB 1J0ZA 1GQJA 4QRUB 1XR8B 3MXVL 4GBXC 4GRLC 4XVSL 1LQSR 4G8IA 3RZCD 1CDHA 4AZ8A 2HMIC 1L9MA 3QUYC 3KPRB 3TNMB 3ULUH 3DHPA 4JY5L 1YEHL 3KR3H 2WMHA 1KOAA 1S78C 2AI0L 2BSSA 4L8CA 8FABB 1C93A 3VNZA 4E41A 4ZFMA 3P4OA 3UC0H 2G5BA 1Q94B 3NFSH 4M6NH 1N5YL 4UU9B 4NZTL 4O58H 5TF1L 1AIFB 1R5VB 5E8EB 4PG9B 1BQHG 1GGIL 3U9PL 1RZ8B 3QDGB 4QXWA 3V79C 1S9WA 4KDWA 4I0CC 1H0DB 5IHSA 1OGAD 3M1BA 3BKJL 2VLKD 5HDRA 2L7JA 3VMNA 2DS4A 4HMDA 5DVOA 4OV5A 3KG5A 1J10A 3RPIB 4OB5L 1LK2A 3LN4A 1X5AA 5FYJU 4KJPC 2BVDA 5A40E 2AKRB 4HKBA 1JYNA 2J8UF 1HHKB 1T7XA 2MMXA 2CHNA 1WDRA 2X8RA 5KEZA 4Z2LA 4ALAL 3G6JE 1V6XA 1LD9A 3HMCA 1LL7A 2V2XA 1V02E 1MJ8H 4WI2A 2ADJB 4GW1A 4MB5A 3VFOB 2NSXA 2UZYB 3KPLB 1UYWL 2CK0H 3QCVL 4XP9H 4PV8A 3U57A 2GJXA 3P30H 4WY7H 4N8CL 1G7MB 2W60A 3TJEL 1IT0A 3GMPA 3EO0B 5GS2H 2VERN 2PWEA 1QNZL 3TBSA 2V7HA 1EAPA 3ZJ6A 3C60C 3GSNH 1BZ7B 2P24A 5DEFA 3NFPB 2Y23A 2Z1SA 1R3IH 1TVHA 3O3BB 5ECJE 4YDKH 1HNGA 1ZGLA 5FGSA 3TT1L 4E2OA 1DP0A 3ZKXC 3VRLE 2OR9H 2AXFB 5IBTL 3LKOB 1NWSA 1BX2B 4JFTA 4KHTL 4GQQA 3MV7E 4ZO9A 4R4BB 3WL1A 4E41B 4P2QA 2YRPA 3C2SA 4JZJC 3NCEB 4HU8A 1P5UA 4WW2F 4OLZH 3WL9B 1MUJA 4X4YA 5DMGD 3G9VA 1NSNH 5IMOA 2DLFL 1F02I 2AXJA 4NI3A 4Q9RH 3VIKA 3NIFF 3WEMA 1HWGB 1AO7E 4D1IA 3HE6D 4FG6D 2X4SA 2DQJH 4NKMB 1MLBA 3BIAX 5GRVK 3MBXL 4X7SH 3W9DB 4LPUA 1HJWA 3D39D 5EUOB 4Z7VA 2B31A 5K9KB 1QVOB 2D7QA 1OP3K 4PJ5E 4ZOEA 5DVLA 1LEIB 4N1CA 1RK1A 2I25N 5JXAH 1ZU8A 4XC1L 3TBYA 2YOCA 4H2CA 4OLEA 3MSGA 1XF2A 2JF7A 4BFIB 3LIZH 4S1SH 2CLZA 1NCTA 4LCCC 5C0NC 3CZFA 5FM8A 4LLMA 4NQCD 1SY6A 4XRCB 5DXWA 1QVOA 3IDUA 1G0CA 2AEQL 2VABB 4ORZC 1OTTD 5D5ME 3VXOA 43CAA 3V0VA 5DZNA 3PZOA 1OGTB 1YPZB 1KJVB 1TQCB 4JO2L 1CLVA 2E5EA 4XNUH 5FUCE 5JW3H 3QI9C 4RAHA 3MMEA 2WMKA 4QO1A 4XP6H 1OGBA 5E6IB 4H25A 2EDRA 3L5XL 2W66A 3WH8A 5DYOB 4MNQD 4G8FB 2A2QT 4I4WA 3IDIB 1R87A 4XNYH 1CR9L 1W0WA 5DJ0A 5I76A 3TO4A 3IFLL 5C6PB 2F54A 3TEUA 4KFZC 4JN1L 1ZTXH 4LMQE 1CQYA 4M1CD 4ZXBD 5B3NA 3IDYB 1RUPL 1EFXA 1CNVA 1AKJD 1AXTL 3J7HA 3MACH 2OSWA 3VCLA 1RZJL 3EIFA 4OOUA 1HXYB 5T1KA 4GRLD 2Y6SC 3K4AA 1BEYL 1IC1A 2UYLB 4IS6B 4V1DD 5C1MB 1IC7L 3PGCB 1G9ML 5KAQG 3AMLA 1CGTA 4D6IA 1PDKA 3P0VH 4ZXOA 4LSUL 2XTJE 3BD4A 3PWUB 4PLKC 5CJXC 1FZOB 5DI8A 1JHLH 1I1XA 4ZFFA 4XC3L 3NIYA 5CXPA 4KV5E 5GRUL 1S7VB 2BVQA 2NX5A 2AQ1A 2APVA 3W37A 4M24A 5ITFA 3PZNA 4PY7A 3RUGA 3MLXH 4EJ1C 1YMHB 3HUJA 3L3OB 2P46B 4J1UB 1JGVH 3O6MH 1HOCA 1U2CA 1QSVA 1QSFD 1N6VA 4XNXH 4P5MB 5DD5H 1GVYA 4MVBD 1N8ZA 4Y1AE 2QLVB 4J3UA 1OAKL 3HHRB 3ZKMC 4XWOD 5DTFB 1JNHA 1I9JH 1R3KA 2E9WA 4PGEB 1LG2A 3QCTH 3B6SA 5FKPA 3ZQ9A 1NAMA 2CLVB 5E6ZA 2UY3A 4NKDA 1M03A 3ZDYF 1OD7A 5FCUL 3IETA 1NQBA 4RFNC 2FO4A 3DVGB 2YJQA 4UQ2B 3V52L 3FY1A 1U8HB 1RUKH 1UOKA 3GFUA 5A8QA 4RMUA 3H6JA 4OZHA 2QR0B 4LLUB 2IJ0C 4A6YH 3POHA 3EGSA 2Y9RT 3VGDA 3PTKA 4PMOA 2O9OA 5A95A 3OLEA 2PYED 2HVKA 5E4EB 2C3XA 1SJHB 3ILQC 5A2LH 5TPWL 4ZAKA 1TXKA 3MQIA 4YR6A 5EFDA 5ICZB 5FCZA 1U8HA 3EOAB 4NHCL 5ABGA 3INUL 1I1RA 5SWSB 3F12B 4OTXL 5E99H 4D6GA 3C5SA 5GGSB 5M17A 1JZ8A 5TQ0L 1A14H 3GRWA 2AV1A 3R1GH 4IMKC 2NY4C 1UZ8B 2F5AH 1FVEB 1W9DM 2P5EE 3QRGL 5E2JA 2HRLA 4F7MB 1FO0B 4FA8A 2V5YA 4ODTL 5TDOA 3TN0C 3U0WH 1QI0A 3MA7A 4C4KT 4D3CL 2BFGA 3FL7A 4PRNB 1CICA 3AREC 1YMHA 1DANT 4WI5A 2YUZA 4OF0A 4I3SL 4L8BB 2A9ML 3GMRA 3CVHB 4M7JH 4L4VA 4R5EA 4W87A 4Y19A 3BW9B 4XPGH 4PMDA 4NO2A 2GJ6D 2VZSA 5EIVA 1Q9WB 5HDBF 5J57B 1VGEL 3FAXA 4X5XB 3O8XD 1NH6A 3JWDH 4Z77B 4G8GE 2X0HA 3WELA 3U2SA 5D71H 4R4ND 1CDJA 1L6ZA 2HFFB 3VM5A 3NCBB 1I1FA 2XACC 1LNUA 1I85A 2NXYC 5DQJB 5HGBA 2CIIA 5DD6B 5ISZA 3QUML 1A4KB 5BOZG 2EYRB 4ZTPH 4YEFA 3QWQB 1N0LA 2P5EB 1QHZA 4P4KC 5D7LD 4D9LL 4FQ1L 1V0KA 3WFBH 1F3DJ 1I9RH 2XA8H 4U0RC 4NKOB 1BZ7A 2WWMD 5SX4I 1ZT7B 5LAXA 3DYOA 5C0ND 3EOBA 3P9MB 1KC5L 2L0DA 1NMAH 1ZA3A 3QHOA 1AH1A 4YXHL 4NRZB 4BQ2A 1JPTL 3ARWA 3GSOA 2Q87A 4XMLH 5A1AA 5I71C 1G6RH 3T4AA 5E8PA 5D1ZA 2RGMA 4XMKL 2D7MA 4R26L 3PWPD 3BGMA 2JB5L 5K9OB 5AYBA 3K8LA 1MFAH 5FYJD 2P8PB 3BKYL 5CEZH 4WW1A 3KJ6H 1N64L 4M7LL 2UWFA 3QHZL 3MV01 2ADJA 4PRPE 1KIQB 1IBGL 1FVCA 1KB5B 3VXMD 3LVEA 2YA2A 3C5ZA 4XCEB 2IEPA 5I3DA 3T3PE 4QRSB 1U30A 5HBFA 3GSRB 5FO9A 1ETZA 2EYSB 5DRWB 3RA7H 1BGAA 2EJ1A 1AY1H 4QRPD 3OPZL 1A3LL 1KXQA 1X5KA 5FF6A 1U8NA 3ULVL 3RWDA 2E7CA 1NDGA 3PWLB 4NN5B 4FQXB 3AOFA 2XG4A 3FB8A 3HC3H 4KI5F 3N9GL 4WHYH 1D6VL 4NNXB 4GRMA 2OCFD 2HT4C 2O93L 1C1EH 1UJ3B 3WF4A 2J8UE 4R7DA 2R69L 5FYJE 3CXHK 4RGMB 2Z1KA 2EDDA 1C16A 4I5BA 5F96L 4FQJL 4ZNCD 2CQVA 4TOQA 2IPTH 4TSBL 5A6LA 2XN9A 3KLDA 2KPNA 4ATWA 2VDOH 4O02H 1W2PA 4PB9L 2J88H 2IQ9H 4DVRL 1B88A 1U8JA 4JM4L 1AO7A 4KMTH 1WK0A 4H0IA 3RRQA 3RY4A 3RTQC 3VU2A 4OV6F 4YUEL 3O9WB 3SUWA 4DGIL 1EBPA 1U3JA 1F97A 4P9HH 4XCNA 1XGTB 3K4ZA 2CLRA 4U5KA 3KL0A 2AI0H 4OM1H 1P4BH 4F2MA 1NQ6A 4P2QB 2BMKB 3TO4C 5KSVA 1P4IH 5DVMA 1ZKAA 4J4PC 1HHJB 1MHPH 4DZ8A 1I8IB 5IFAL 1N5YH 4V2XA 1KCSL 4LCWE 2R0KL 1OINA 3O4OC 4G9FB 3N1PC 4CU7A 5A8PA 1RVFL 1GGIH 3C8KA 4HLZH 3RIFF 3QCUH 3AMDA 4C58B 1A7BA 4PJBF 3OXSB 3QXTA 1K2DA 4KJPD 2R8SH 3WUBA 4PSRA 3OBAA 4PRID 2OSLA 4ZOBA 5DEFB 1TJIH 1G9NL 3RX7A 3GSRA 5FO9B 1KR0A 3CPUA 1CZ8L 4P2OC 1FNHA 3I9GL 2FLBT 3BSHA 3OZPA 3FB5B 3OKLA 5HHNA 4HWZA 2FSEB 5BMFL 5JHDE 3WHE1 4NN6B 1T0NB 2XWTB 4H1LB 1CXHA 1F5WA 3MREA 4OBSA 5D7KD 5BZDA 3L7EA 4PFEA 4PMYA 1J9YA 5ECUA 2JTDA 4R4BA 3VGFA 5FGCB 4OJFH 5D2LA 2FGLA 4MNHB 4N8CH 5D1ZB 2DGAA 3QO1A 1WZMA 3W53A 2W92A 3W6MA 3G9AB 3T0VA 1LD9B 2IADB 3DGGB 1KWGA 1U6AL 2CMRH 3AI0A 3EOBB 4L8DA 5DJDB 4JEGB 3V7MA 1QR1B 5CWSB 1O7SA 2X4QA 5ABFA 5HDQH 2F2HA 5DQDL 3D39A 4HEME 3C6LC 4BCEA 5DFVC 3GBMH 4R0LC 4D6HA 4NQUA 1OLLA 2J7LA 5I75C 4NFBA 4GBXA 1CD1A 1MCDA 3CDCA 1D2KA 1AGFB 4B5EA 5T1KB 3D85B 1DUYB 3NIDE 1REIA 1B2WH 3JV4B 5DD0L 3SDDA 1WCBB 1ZOXA 3FQRA 1BM3L 3BH8A 2YMXL 3QQNA 4G7YL 3ET9F 3G6JF 2VZVA 4OZGF 4MNKA 3GMLA 3L3KA 4PBWD 2R2CA 4PMZA 1JWMA 1KTLA 2CO7B 3EYVA 3MRDA 3QUYB 2BNUB 2F53A 5DMYA 1MYRA 3L4YA 4OZIA 4PV9B 3ARFC 4FQLH 5HBBA 2J8UB 3VG9B 1CD0A 4ODXA 2ITCB 1JXKA 3MCKA 2H26B 1K3IA 3A0OA 3WENA 2VLJD 2V2TA 4FLRA 5BVJA 1WISA 1G9NC 5AWNL 1DEEA 5LGJB 2QV4A 5C6WH 4LVEA 4BSWB 4Y4KD 4L9LC 1MW2A 1YEDA 3SEPA 2G2RA 1HE7A 1CFBA 1EEYB 2NZ9C 4NWUH 3WH6A 3DURB 3RGHA 1IEAA 2B1AL 2Y72A 1M05A 1Q94A 1AGEA 1E4WH 3MODL 4N1HB 3IAGC 5J3HC 5FUZL 1K9EA 4WI3A 1WNOA 3ARFA 4P4RB 1E4XH 3X13B 3VIIA 4U1LB 4Z2HA 4MB3A 1MH5A 4LLMB 3CFKB 2ZOKB 1NC2D 4JGMA 1BSIA 2PO6B 2XWBB 3TYGL 2MHAA 3KXFE 3BFOA 2KH2B 4DAGH 3WSUA 5C6TL 5GNZA 5GRZA 2WMGA 5T5FH 3QHFL 1WITA 3UG5A 3BDYL 1DQLH 4WJ5B 2YWZA 1J0KA 2DQDH 2LU3A 2OI9B 1E0OB 2EKSA 1SJEB 4QHNA 4UFLA 4U7MA 1V08A 5KTEL 1U2HA 3GH4A 5EUOF 1Q0XL 2A74A 4MA7H 2IALB 4PJEB 5EZOH 4QOKD 1R3HB 2QQKL 1K6AA 4RDQF 1NBYA 2F58L 3S35H 1V3HA 3RWCB 3L6FB 2OSYA 4MCYA 1F3DH 5LWYL 4B15A 2BJMH 4FQIL 2EE9A 1AQKL 4QLLA 2N4IA 4RAVA 3TA3A 4QGYA 1AGBA 2ZOXA 4N9GB 1BYAA 1JFHA 4QHLB 4HS3A 4P48A 3ALGA 1FG2A 3F7VB 3VA2C 3I75A 3VFGL 5CZVL 4HJJL 5BZDB 3AZSA 2OWWA 1KEMH 4MDJB 3VWKD 3LEYH 3MUY1 4NNPL 1XCQB 1A1MB 2QHAA 4U1HA 1M7DB 5EO0B 2WXDM 5IHBA 5E5UB 1T0MA 3W4RA 1G7IA 2X4PA 5KOVC 2VX7A 4PJ9A 4JHZA 1FRGH 4P2RA 5BQ7B 2BV9A 1VGKA 2YPKB 2FJFB 3QUZD 2VXSL 4L4TD 5I9QB 5HHXL 4JANA 3DHUA 3RKDD 3G5ZA 3VGAC 4JFSA 3MV7A 1TQBB 3VUPA 2DMKA 4J6RL 4K3EH 2CXGA 1WFOA 4WSKA 3QNXA 3AXIA 1AQDA 3PHOB 5HGHA 4FTVD 3WN5B 4WWKA 3MOAH 4HW6A 4Z2IA 2DQUL 2LABA 5AAMA 3RM9A 2JJVA 2MWCA 4ZYKB 4LK4A 4Q9BA 4AIOA 4YNYA 1JZ5A 2A9NL 1CBVL 4Y4FD 4LCIL 1EJ6A 1FFQA 4N0CD 4YGVB 4KPHL 1ZT7A 1XIWB 1KBGH 2D0HA 2GFBB 4EVNA 3Q2CA 3L4XA 1KENH 2XZAH 1B31A 3ES6A 2WP3O 4AZ5A 4OLVL 3WIFB 1JBJA 3DETC 4YHML 3K8MA 2DD8L 1T83A 3WNPA 2IH3A 1BFVH 7FABH 3MRIB 1WWBX 3ARYA 1KPRB 4O2FA 5GZNC 1IT9L 4PJFE 3GYCA 3GMLB 5GS2D 4OFYA 2PYEA 4TTDC 2BHYA 4CMHC 3F6IA 4X5XA 5IROC 3R06B 3HZYA 3GZAA 1KN2L 5CKAA 5E99L 3QDJA 3QQ4A 2FYYB 4ONFL 3DUUA 5HVHC 1EOMA 3MJGX 1YZZA 2Q6WA 1DLFL 4RIRB 5EOQL 3GI9H 2FGWL 5IM7A 5CIPH 2DLHA 3CZ8A 3M46A 3QUKA 1MW0A 4DGYL 5I2IB 4TUJB 3WIHH 5TQ2L 3BEWA 1G0DA 1J1XH 1YEEH 1UA7A 3D18A 3MJ6A 2OK0H 2F61A 2GITB 3GHBH 4MA8L 5HHOA 5JPNA 4IEFB 4JFQA 4JY4B 4D0CA 4CL7A 2P8LB 3SURA 2V7NA 3LKRB 3VJ6B 4AY0A 1B3ZA 3DV4B 1P84K 3MFFB 2V5SA 1MFCH 4PJBB 4IRSA 4NNYA 4TNVF 1QSFA 1IM3B 1H0GA 1V3LA 1FC2D 3MRFB 4XTRC 5GGUA 3PTQA 3AIWA 1RZJC 4G43B 4M7JL 4M5YL 3RX8A 2YD9A 2H32A 5IT2H 4S1DC 3GXDA 1S9XA 2WSKA 5JUEL 3ARZA 1CK0H 1NCBH 4WTZA 5D70L 5A69A 1WVZA 5GS3A 3T0ED 4RNRB 3ECQA 2X4OA 1X5JA 2CR3A 2ZPKL 1ZGLB 4TOYH 3LQAL 3CVIL 2ZUYA 5DJ6A 3CIQA 4ZFOB 5FAAA 1NGWA 1X5YA 2UWEB 3REVB 1KCUH 4HLZG 1ZHNB 4I0KA 1CFVL 4CADB 5E2UL 1CT8A 2XA8L 2NY7H 1TCRA 5FO7A 3JTTB 1EPFA 4GFTB 5B38A 1JF1A 1G7IB 1TZGH 3CFCH 4PMRA 3SOBL 3CLEH 2DAVA 1FNSL 3GMOB 3ME0A 1X5GA 3X3GL 1U92B 1ZHLA 2VITA 5DC4B 4IIQB 3RTQA 4PRWA 3NFNA 3IJYB 4NM4L 5EIIB 4LCWD 3IDMB 3QHZH 4HX1A 3HI5L 1P84J 3WSQL 4KZEH 3VDHA 3B9DA 4YZFE 3KDMA 4ACYA 5KZCD 3IFNH 3W82A 4X4XB 5J3HD 3U0PB 3LS4H 4LSQH 1Z6JT 3SDYH 4DN4H 5K9QG 1KF9B 5IUSA 3N12A 3UTPE 4PMQA 3WEOA 4DW2H 4JFQB 4JY4A 3T3ME 4DQOL 3QQ9C 5KSBA 2DIBA 1NBZB 2G5RA 4J3VA 1E70M 4IMLB 2UZIH 3M1BB 2J6EH 4Z76B 1W0VA 1A47A 3B2VH 4W7VA 1QSEB 3IB4A 4GOSA 5GIRA 2GQHA 3L95A 4R0LA 2W38A 4AD1A 4OIIL 3E2HC 1OT2A 4ZAKD 3TN0B 5FFLA 1GGYA 3PHQA 3EJYC 1FL3A 2OLDA 3I85A 3O4LD 1I7RA 2J47A 2AXFA 4YR6B 4HA1A 1G7QB 2EIDA 4NJ9H 2J88L 5E2WH 4KQ3H 3NTCH 4HUXA 5IVXB 4PD4J 3QUMA 3QFJA 4L9DA 4WHYG 2XXCB 3OG6B 2H2PD 3ARGD 3KYOB 2NY1C 3BIKA 2UY4A 2FNBA 1PQZA 4IDLA 1N2RA 4NO0D 5JW5A 4PY8I 5D7SH 5I19H 5ESAA 4PCSA 5EDXA 1R7OA 5BS0E 5GS0D 1MHHB 1UXWA 1OCWL 4ZNEE 1Z9LA 4Z7QE 2QQLL 2R1YA 4Y8AA 2YSSB 1JTOA 4H8WH 4N0YH 3NZHH 5BVJB 1KCSH 2FATL 3QIBC 4MD5A 2R4SL 4K2UH 4GRWF 3BIKB 3CH8A 5I74C 1AE6L 1OHQA 3L3JB 3MCLH 4I0PD 1RSFA 5A2FA 3KJ4C 4OKVB 1WF5A 3GIZH 4H20L 3FAWA 2GK1A 4X5WA 1B0IA 3TFKD 2HJFA 3FTGA 5D72L 4WV1C 4HWEH 1G9NH 5D1ZD 5FYKU 4ZSOE 3ARED 2VLJE 2OQJA 1JPSL 4JDZB 4K9EL 1B3WA 4FFZL 1X9QA 4CN1A 3KYNB 1CQKA 4U1NA 3ZT5A 4R2GD 3F4VA 2ERJC 2H8PB 4JVUA 2W9EH 3JSSA 4GLRI 2EEAA 1PY4A 3LPGA 3HFML 4Z76A 3CDYA 1WBYB 1DDHB 1W3HA 4NKMA 1WIOA 5E7BA 5I8OH 4QTIL 3W0WD 5BJTA 1QRND 1ZS8A 3BGFB 1ODUA 5F1NA 3IU3A 4PJGB 2YRLA 4YO0B 4D71A 3ZYOA 4M80A 3STBA 1KB5L 4WUUE 1NCWL 3TH4T 2ZX6A 1A1NA 3MYJB 2DQGL 1A9BA 3PQYE 2F54B 1A5FH 4WUKL 1H3WM 1A6PA 4CW1B 4JFXA 5GZOD 2H2SC 4DFIA 3Q0HA 5EU7E 4KDVA 3V2AR 3TPUB 4LCYA 3WJLA 4M6OL 4JY6A 4L3EB 1M01A 2DL2A 3M07A 1BVLA 4BM7A 1WFUA 4WI7A 3D87B 1HVQA 2A1WL 3NH7L 5JBFA 3MXWH 5CJQL 1I1AA 1OGGA 2C0HA 1U8MA 3ZKND 5JNYB 3CZJA 1B2WL 1AHWA 3ZE0F 1NL0L 5JQ6H 1YEKH 4NC2B 4Y1AB 1U91B 3PQYB 4HUUB 1DQMH 2H3NA 4XCYB 5F7MC 2MCG1 3ULVD 1KBBA 2A3EA 2VN7A 4HWUA 4X99A 1G7JB 1GOHA 3H9YA 3VFPB 1IRAY 4FQLL 1CL7L 1Q6CA 2VIRB 3BYTA 4KTEH 2DYPD 1MCNA 3ULUE 4ZPTA 1UADC 4LLWA 1E27B 4JFOA 3FFCA 1HVXA 5BYWA 2P4AB 3CUIA 4PRAB 1KJ2L 3OKOA 1BTCA 3MUZ1 4MXQC 1IQDA 4HF5H 4EN3B 1EO7A 8CGTA 3Q6FB 4U6YB 1RK0A 2R4RH 5CPSA 4GG6B 4G6ML 4I77H 2JB6B 1SHMA 2R2HB 2MQ0A 4PJIE 4YDKL 3FFDB 5I0DA 1BF2A 4CJ0A 1FNGA 2VAAA 1CLZL 3B6SB 5FKPB 5FDWA 1URLA 2R29H 2VL5B 4ZDHB 5DJYA 3M17B 1DBBH 1LMKA 1WZ1L 5C2BL 5ELIA 3WO3B 1F2XK 5I1AA 4POYA 3TNNB 3I84A 1LLOA 2GSJA 1F58L 2VJXA 4HS8H 5DUML 1S9KC 3KLHD 2H1PH 1TG7A 3QDGA 1A1NB 1F00I 1DWHM 3ALPA 1KT2B 4OD3L 3QUXC 3LN9A 3MBEB 25C8L 4X6CF 3QDJB 3A67L 1XGQA 4DKDC 1XF3B 1UM5H 3KPNA 4HK0A 3L95B 3RVXD 1X1NA 1E6ZA 1L0XA 5IKCB 1XH3B 4F9LA 4U0QB 1PLGH 3NA4A 4QOKB 5BXSA 1WQVT 5EU4B 2VUOA 4OJYA 3MGTB 3PHAA 1G6VK 3WBDA 1OWQA 3K0WA 4DOHE 5LVEA 3BQUD 4PLJD 4EUPA 5KVMC 4PJAF 1FL5B 4YC2B 5GGQL 3VFMB 1S9YA 2BC4A 2FJGB 4MJ2A 4JZOA 5EBAA 4MD0B 4X0KA 4K7PH 3OXRA 5D6CB 2DDQH 3MLRH 4U6TA 1GOFA 3GSQB 3QO1B 4EQ2A 1GGBL 2VLRB 4JL2A 1V6VA 1FCCA 3V6BR 2R9HD 5IEKA 2JEPA 4QXGH 3NCYS 5CZVH 3CCHB 3GSWB 3MV7D 1BZQK 4F66A 4R8WH 3CZEA 3MLUL 5F88B 1Y7VA 3RKPA 4XP6L 2Z92B 4CVZA 1FIGL 4PRPA 4PG2C 4WGWB 3T65A 4F8TA 1F3JB 1OTUD 4K07A 3WIIL 1MRCH 3I6KA 3VXUA 1UR9A 5D7IA 3A6BL 1BG4A 3B5GA 2IBZY 3JTTA 4WSJA 1UUQA 3V6ZA 1KJVA 1RIHL 2VXSH 1FDLL 4HGWA 4L3EE 2CPCA 4OLXH 3GO1L 2XWEA 3P0GB 3U1SH 1W72H 1SEQL 3O11A 1UZ6F 1OB1A 2QADB 3GMNB 1DVFA 1NBQA 2XGIA 2JIXA 2X4OB 1T7ZA 1D3CA 2FHCA 1S7RA 2BOBA 2ESVE 2D31A 3RWJB 4CCDA 3KWWB 1E4KA 1BVKB 1WV7T 3LN5A 2PR4H 5FA3B 3VXRE 5D9OA 5BWFA 1PKOA 3ILQD 1INQB 3FN0H 2BSSB 4Y4HA 3TBTB 4UT6H 4L8BA 3SO3B 1SMAA 1VHPA 5JBEA 3JV6A 4KDTC 5K9KA 1AD9A 1A7NH 5GNXA 3WD5L 2VH5H 1UXSA 4P49A 2VCBA 2PWDA 3QXDA 4P5KB 1ZLSL 3KL5A 2RQ8A 1EVUA 2B5IC 1NUGA 1INDH 2EIZB 3F7YB 5EWIH 4D0BB 1A6TB 3UP1A 4PJXA 4CD5A 3HPLB 7FABL 5I16A 4E0RA 4OCRL 4XPTH 2C3GA 2XY1A 3MJ9H 5HPMB 4XBPB 2LE9A 2Y5EA 2NX5D 1WICA 4HFUH 4QTHB 4ZQKA 1OWWA 3L9RA 1NC2A 2AXGB 3ABZA 4NHUA 4W4OC 3LN5B 4S3KA 2X44D 4UOJA 4XI5D 4XPHH 4XNZC 1TVBA 3I3DA 2I60H 3D69A 4OFVA 5I2UA 1Y18B 4MS8D 5ID1A 4DGYH 4PMUA 4LEOB 4O2FB 4QXUH 1FAKT 1OVZA 4M43L 1DWGM 3GHBL 1LP9A 4MA8H 4IHOB 3DX9A 3AGVA 3BPNC 1RUKL 3RJXA 1T1ZB 4Y1AA 1XD0A 4GRWB 4OFKA 3QP3A 1ZT4B 1I9IH 3BO8B 2Q76A 3SCUA 3PJSB 5KN5B 2NY2C 1J11A 4XCEA 3N1MC 1F3JA 1BWMA 1U8PB 4QRRE 1OW0C 1CECA 2IWGA 4QDMA 4WW1B 1Q9LB 5IMMB 4JRXA 2NZ9D 3NPSB 4G9DB 1KNOA 4YHEA 3WDJA 2W4XA 2ICEA 4TOYL 4J3OC 4HUXB 2DWEA 1US2A 4HWBH 1DZBA 2VDLH 4K7PY 1A2YA 3SDCC 4W70A 5GISH 2QLYA 1LEKB 4J27A 3L3OA 1VA9A 4HCRH 5CIPB 3TN0D 4HUWA 1SY6L 3QRGH 2PB1A 1DCLA 3K1KC 1YYLH 2CD0A 4U1GC 4U2YA 1A7OL 3FRPG 5FA4B 5L88L 5TFSH 4D3CH 5EMYA 6FABH 1M71A 5JW4M 4C7FA 1HZHH 4S10A 2ZXAA 4RRPG 1E4XI 2F54E 3AREA 4F33A 3UTOA 1NGPL 5AG8A 1MHEA 4XPGL 1RIVL 5CG0A 1LL6A 4BH7B 4LAQL 3O41B 3WHE0 3WSQH 4JFDB 1CGUA 8FABA 1EFXB 3P77B 2BXYA 4K3DL 1K4DA 3WD2A 1RV6X 3AHVA 1CBGA 3S2CA 2YDSA 4D9QE 4W81A 4PJ5B 1LEKA 1CICB 2PYEE 4GAGL 5J1TC 4F57H 5EOTA 1D5IL 4AZGA 1PZ5B 3UDWA 1WCQA 1XRVA 1I9RL 2YKLL 5JPMB 3CSBA 2AV7A 3CUPB 1GOQA 3U48A 1R3HA 4FQHB 3TZVA 3D0VB 1NMAL 4W7UA 4FMFA 4Z18A 2X89D 2WW8A 3QIWC 4UINL 4HXBH 4PJHE 5C92A 3GTNA 1QPKA 3L5IA 1NFDF 2Z35A 2IPUK 3FO1A 1MCJA 3MO1B 2YD4A 4YQXH 3BP5B 3WUWB 4YDJA 3BO8A 5T3XD 3F5JA 3O8XA 5T1LB 3VKKA 5KVGL 1WWCA 4M7LH 1OGTA 2VYRE 2R0WL 3JUGA 3THMH 1AQDB 2WWDA 3RO8A 3NACL 1JGEA 4L4VD 1YN7A 2FEDC 4ZTOH 4KQ3L 2RIKA 2VNCA 4QCEA 5KOMC 1IGFL 1U91A 3PQYA 4RMRA 4XCYA 2VLMD 4IRZL 4JJHA 3LS5H 3GI8L 4V1DB 1W9VA 5FV1L 4MJ5A 4MQTB 4B41A 3RGVD 3DXAB 3BPOC 3MLYL 4MNGB 4G7VH 3L3HB 2VC2L 4N5UA 4U1KA 3SUTA 3VW3L 4Z0XA 4H8WL 4NNYB 1G7HB 4PY8J 4GQRA 1Y6NR 4Z2JA 1FG2B 3F7VA 3LDBC 4BS0A 4NM8H 1AI1L 2GK0A 3QI9B 3V95A 1YNLL 2HH0L 2OYPA 2B0SH 2JJTC 2ARJQ 4WIQA 2Q8AL 4H20H 2F5BH 1K4CA 3N1QC 4GS7C 1T5XB 4M7ZC 2YEZA 1IC5H 3V6OE 3G6JB 4KWUA 3RTQD 1UWSA 4ZENA 3BP7B 5F7DA 5E6ID 4XP5H 4JFDE 5FUOL 1FSKC 1WCBA 4KMTL 4XPBL 3CDGA 4FNLH 5DUBA 4F37K 5E0FA 1C8PA 3KPMB 5AYUL 3WMBA 5E1AA 1QSZA 4WEUD 4JPVL 2ENYA 3PE9A 3RIAF 2GUOB 2VTFA 5ACZB 3RWIB 5HGAA 4P3CL 2MQ3A 4I18B 5I66A 2E3ZA 1WBZA 4XV0A 4OCYH 4OCXL 1LE5B 3PIQB 1VPOL 1PVHA 4PJ7A 1BECA 1UWGH 5EA0L 1E4NA 4I8DA 3AROA 1RHHA 4LLYA 3WQVA 3ZJKA 3SCQA 4JR9L 1ISWA 3FT3A 1W8NA 3QEQE 5ACZA 1V6WA 2OTPA 1EAJA 3S5LA 4WUKH 2VDPH 1RZIA 4OQ1A 1WZLA 4UTFA 2DTMH 3EDKA 4UOZA 3CFBB 4LYPA 1TJIL 3OKYA 1QNRA 1T66C 4XAKD 1TZIB 3FQTB 3I9GH 3G08A 3ZHDA 5HD8C 1KACB 3BEVB 4PJAA 1P1ZB 1EGJA 1J88A 4CGTA 3S34L 2EYTA 3HRPA 3NH7H 1L8NA 4G5ZH 1LVEA 3KS0J 5E8DL 4HKZB 4ODUA 4PG2A 3RVVD 1ZV5A 3SCSA 1JCKA 3MUIA 3ARBD 5D4YA 2DBJA 1PBGA 5AD0A 3KLAA 3ZKSD 3L1OH 4ELMB 5E70A 4L4TB 3MRPA 4B50A 1OPGL 4TVCA 1QRKA 3BSGA 2XTJB 2I26N 4OKDA 2OM5A 5JHDA 5A6BD 4PJHF 3GBLA 3GRWL 1IC4L 3PWVA 1KJ2H 3RGVC 2YPVH 2GKIA 3CUGA 5EPMB 2E7MA 4YHLL 1XF2B 5HDQL 3MUHL 4PRAA 1HEZA 1XGQB 4UNTA 5BO1L 1O7AA 1MELA 4EDWL 4AMKH 4N8VB 2XG9A 2RFXA 3RMEA 4HK3J 3CVHA 4P2CG 2BVUA 4NO0A 1K9TA 3RM4A 2MTPA 1E4IA 4R4NC 3UTQA 3VXME 4YHKL 1CGVA 3AU1B 3QQ3A 1XR9B 2AJYH 1PYWA 4C83A 4KROD 1WZ1H 1ZANL 4PTUB 4QHMB 3UZEA 3F7YA 5MENB 5ABFB 4PJHB 1PKQB 4L8SC 2WC4A 4XVSH 3QRFM 5HI3C 1GOIA 1PY9A 2H1PL 4PRBB 5DHVA 2HG5A 4X4YB 5HPOA 1J12A 3HMXH 3RU8H 5A2JH 1PJ9A 4ZFGH 1KIPB 3KR3L 1OD9A 5F6HJ 5ICYA 4TSCL 2O5XH 2GHWB 5GGTH 1HHHB 1IJ9A 1V05A 3H9SE 2EPOA 3BGFC 4NZTH 2W9DL 4OCSL 1UJ3A 5GGVL 4Q9QL 4LVOC 4U7SA 5HYQA 5C9JA 2X40A 5LA2A 4NQCE 4U6HB 2C9AA 3GB7A 4F15C 1ZSDA 4GKNA 4F3FA 3CMOL 5L8LB 2MJWA 3R0NA 2DSKA 4KK9D 3VFPA 1CDCA 5D96B 4J23A 2AJVH 3GNPA 1LDPH 5IBUG 2OR9L 1CL7I 3QG6B 3UROR 4W84A 1UYQA 4LIQL 3UYOD 4FRWA 3V6ZB 1JDDA 1TJGL 2IAMD 2O5YL 4TULL 2NY0D 4C56A 4IPNB 1JD7A 3HNSH 5F6HI 2OJZH 1U8LB 3G04A 3U6RB 5JOFB 4J7RA 4OLZL 2XY2A 2HFEA 2MSPA 4KV5F 1A1OA 4MNQE 4OF5A 5BV7L 5CQ1A 2YUWA 5TE7H 1BIHA 4HZAA 4ELME 1RAMA 3AICA 4QXGL 5DFTA 5E8OB 2LU4A 1B0GA 1BFTA 5ILTL 5A6BA 2P42B 3T0WA 2FDMA 5ANME 4P46B 5JOPD 1WZAA 3AHZA 4M1CC 5LKNA 4LSDA 3GSOB 2RB8A 2G3JA 2HJLA 5D1XD 5F1KC 1OIMA 5IW6B 4W6XB 4YK4C 1W1TA 5GGRB 3TZVC 2M8XA 2EDTA 4D0CB 3MOBL 4UZGA 4HUNB 1MCKA 4MQ7B 4PTUA 4QHMA 4RA3A 5A16B 2XRAL 5D2LE 2VISB 1UR2A 1GJUA 3ILPA 4GG6F 1ZVHA 1YN6A 4E41E 2IAND 4X6DA 4F33B 4FP8H 1O0VA 3FB6A 2AEQH 4QHNB 4PG9A 5H94B 2D3VA 1NEZA 4N90E 2C7FA 3B2UC 5EC2B 1KWKA 2W0LA 4HPOL 2PW2B 3BN9C 3MNWA 5SX5K 1YY9C 1T89C 2G3MA 4PLKD 4L8CB 5CSBA 5JW4R 5MEPB 5L6YL 1T2QL 2JELL 3QIUD 4LEOA 3V8CA 3BAKA 3PTMA 1E6JL 2J5LB 5C9JB 1PZ2A 2IH3B 5HHOD 4FMVA 4AZBA 3QUXB 3STLB 1A6VL 3ARDB 1BFNA 1F4WH 3PZMA 4YDIL 3I6GA 1JRHH 3EDEA 4X80H 5EC1A 5D7JB 4RGMC 3QA3B 1QACA 1WUNT 2NY3C 5DJYB 4HU0A 3MBXH 4JM2C 3OGCB 4P57A 4WV1A 3KWXA 2ZSVB 3B3IB 4MA1B 3VFRA 3DI3B 3H9HB 4X8XA 5FYLH 1R24B 4JO1H 1B90A 5IR1B 3PGDA 4FXKA 4RFOH 3OGVA 1JL8A 3B8YA 4B7IA 3V5DB 2J7HA 4LKCB 1AXTH 3MACL 1VENA 1TENA 4QXTB 1YMMA 1NFDB 4P4KD 1ZBKA 1UKTA 3WDIA 3A6CH 3PP4H 2XFXA 1CLYL 3CD4A 1QTYT 3M8OH 4TUOA 1E27A 3HS0A 3Q3GB 1ADQL 2BOCB 4TVPE 4NCC2 2ZNXA 5C0BA 4Q6IA 4ZMAT 1KXTA 5L2KA 3QGVA 3SY0A 5FIEA 1G1YA 3DIFA 3MUJA 2JKXA 2PXYB 1ZLWK 2ADFL 2WZPD 3S36L 3R4DA 5CSUA 3VH8A 3EYOB 1IZKA 2C3WA 5CMAA 4BK5A 5I79A 1MLCB 5TGBA 1TDQA 1OTTC 5E95B 4MD4B 5DLMH 2V3GA 1IT9H 2Y2WA 4RGNC 4JGUA 5GSRA 3IJHB 5DD5L 2J74A 3AXLB 2E7LA 3WXWH 4BH8A 3EFDH 4JG1L 4OF8A 5IFJB 2NY6B 4ETYA 5JMRA 2XNAB 3HRZB 2P8MA 2IG2H 2J25A 2J8OA 4JVPA 2IH1B 4YHPB 4JFWA 2KUTA 3MRHA 4E5XB 2E4TA 3S98A 5E9DA 2F19H 3ULUD 2OK0L 3LD8B 4GAYB 4NQDA 2CH8A 5DK0B 3L4UA 2JJUA 2A3CA 4Y5YA 2VZ3A 2WZEA 1KGXA 5FL1A 5BV7C 2VXQL 3RZCB 1DQQA 1IC7H 4FHBD 3DVFA 3TA3C 3OAUL 4QKXB 1J01A 1IAOB 1DE4B 1ZK9A 3WFDL 3PGCA 5TPWH 1Q9KA 2YBTA 2ZCHL 3LKPB 1UA6H 5ALBH 5DFAA 1Z0NA 5CZKA 1DVFD 4JREC 1K6QL 1MY7A 1JGDA 4Y5VA 2BVTA 4IOSD 5HHOB 3SGEH 2XYCA 2ZJSL 1Y6KR 1Z5LB 4EIGB 4IRJB 2DLEA 2YD8A 1ITXA 4QRRB 2F74B 1D5XA 3VWJC 3HNVL 1FHGA 3R1GL 4BZ2L 2CUMA 4YXKH 1D5IH 2NNAB 2YD1A 1AP2A 4M1GL 2YPLD 2DI9A 5E2UH 3JZ7A 1KJMA 4NKIL 5DJAB 1TVNA 1OAKH 1TZIA 3G08B 5FYKH 4NRXB 2DQEL 3BGMB 3CH9A 2NY2D 4OZGA 2KKQA 3CFJA 4G8GD 1GH7A 4UINH 2BVEA 1U8PA 1EFXD 3ILPB 4NRZA 1BVZA 2NMSA 1FZMA 1OGAE 4MD0A 5H8DA 3MMEB 2A9MH 3VG9C 1ZEAL 4M1RA 3V52H 4O4YL 2OWCA 4U6VL 5ESQA 5D1QC 3TP4A 4O5LL 2BRQA 1MIML 2NY2B 5DRZA 4QT5A 3ULUC 5MHSE 2HJLB 4GH7B 4ZTOL 4LOUC 3QJFA 3EJZC 1H0DA 5GS1C 3SJVE 1FBIL 1FNFA 1NDMB 3KXFB 4DN4L 1ZHBA 2FR4B 5EORH 2W9LA 5FYJH 5C3LD 3BH4A 3HE7C 2K3TA 2NW2B 2VDML 3O41A 4HIEA 4B3LA 5ICXB 1UCBH 2VDKL 3RVUC 5JIPA 1US3A 5H94A 5E56A 3LKNB 4XMLL 1WAAE 4TUOB 3MRIA 3ARGB 3OF6A 3BT2H 3T2NH 3WQ4A 1VGKB 3QOKA 5A94A 4JPWH 3Q48A 4FLSA 3PHSA 2GY7B 1YDPB 2A6KA 2A77L 2OJEA 2VXUH 4GXUM 1MFAL 5E7FA 2BFVL 4CKQA 4QXTA 1CI5A 1OAZH 3ETBF 1ZMYA 4GPNA 1UZ4A 4YBHA 4GG8A 1CFTB 4IMKA 1EUTA 2EH8L 4NJ9L 2IADA 2MCPL 2UWEF 2OTUB 3P9WB 5TH2B 3TPUA 1KN4H 3B5HA 3PWPA 5DRNA 1BFSA 1WFNA 5JPMA 2YHGA 3AC0A 1W0YT 1KIPA 3AFLA 3ESUF 2EEBA 4FFVC 1NP2A 4DTGH 3HC3L 2NY5H 2W07A 1YN7B 4LMQI 5DO8A 4YHZH 1OM3L 4I2XE 4UUJB 4ZTPL 5KN5A 1ZS8B 3TH2T 4MXVF 1QNQA 4K2UL 1R6VA 1U3HB 3WJJA 2APWA 3OZ9L 3AUVA 3O8XB 4TQEH 1I1AD 4P46D 3UTTB 1QBMH 3DVGA 3LQMA 2DQTH 3MRBB 3QIWB 4X6BB 5CKGA 2J77A 5C71A 1A7RH 4FG6C 1YECH 2EDHA 5C08A 5A3IC 4AM0A 2JIXD 1Q38A 4GG6E 4LYRA 3EZJB 5KS9E 1BQHB 4WTXA 1ZLVK 4P2OA 2PCPB 3VH8B 1J0YA 1S7XB 4ODVL 3O6FC 5C07E 3S34H 5HDLA 4K71C 2FX9H 1U8QB 1JZ6A 4F7PA 4MZ2A 1QLRB 2GW5A 3MRMA 3RL1A 2XVKA 4OM1L 2EXWD 3RUGB 2X4NA 2QF8A 3WJLC 5ITBL 4XMPH 1Q9OA 1T5WA 4HBCH 2DF3A 3VXPA 1MHPL 3DURA 5J13B 3SUUA 1VADB 2J7BA 2XGBA 5EU5A 3MV8D 3RPIA 5FDYA 2YBUA 3BPOB 4PJFB 4NQTA 5F7UA 3T2OA 2R8SL 4F58L 5IB4B 4OZGB 2A3HA 3IAQA 2XPGA 3QUXD 3FQUA 1TJHL 1OSPH 1Z3GL 4JHAL 2F53E 3FO2B 1V3MA 3LQAC 1NM9A 1CZ8H 2YA0A 4Q74A 5MERB 1MRFL 1I8MB 1JFQH 1FL6B 1KIUA 1T2JA 3IXTB 4Z9KB 4K8RC 3ZL4H 3IDXL 4ZUTA 1XEDA 1CCZA 3BP4A 2VLKA 1UEMA 2EC9T 5DF0A 5ABDE 4PJ7B 5DJ0B 1TPXB 3FO2A 4BFGA 3PXHA 1TA3A 5KW9H 5ESQB 5EUOE 1FH7A 3SCNA 4LSVH 4YDLB 4NZJA 2WWCA 1DSFH 3T4YB 2HG5B 1U6AH 5CINL 4V2BA 1WAAF 1FVCB 2VX5A 1ACYL 1DEEB 5LGJA 4GMSH 1P4IL 4F7CB 3LMJH 5D6DC 3WLWC 2V2TB 4UDUA 3TVMA 4UT9L 3G6JA 1BYCA 1RVFH 3N15A 4ODSH 3PHOA 5HGHB 3B9KB 4BQ4A 5D1XC 4NDMB 5E1HB 4PJ8A 2AAVA 3ZHKA 2Y36L 3WFCL 3PDOB 1BYBA 1UKOA 3MKKA 4ZG1A 1G7JA 3I3EA 5C0BE 3UAJD 2LQRA 4K7PX 1UZ1A 3KXFD 3MRCB 1GZQA 4WDIB 3BZFA 1ITBB 1GAFL 4DKAA 4PBGA 1ED3A 1MCPL 2QSTA 2PTVA 4Y4FB 5F71A 3IU4H 4LCCB 5DI8B 3OR7A 3BRDA 3MANA 1OQXA 5JA8B 1NUNB 3DX8A 1E43A 2EDBA 2FSEA 1JIBA 4PRIB 3C9NB 3ZE1F 1YEJH 3QIWA 4NRYA 2VX6A 4PRHE 4IMLA 2D0FA 4TTGA 1FGVH 3N85H 3I75B 1FNEB 3LRHA 1TCRB 5FO7B 1OLZA 4A2MA 3BZFB 3T0AA 1SYSB 4LDLB 1FP8A 2OXHA 2UUDH 5D7IB 5C0BB 3HTLX 3CVHL 3FFCE 4LARL 5CFHA 4D9RE 3BKJH 2WQ8A 5C0BD 1HQ4B 4HH9A 4NQDE 4HJ0C 1U2YA 1IILE 1X3DA 1NBYB 2DBLH 2BMKA 4OF6A 2V9QA 1RZKC 3X3FH 2ICWJ 1JV5B 3IJHA 5HYJD 1PG7W 1OM0A 3GMNA 4N5ED 4JIEA 4PB0L 5HY9A 5M5DA 1GGBH 3O3BA 4UNUA 5E6IA 2YL6A 2DLFH 1HILA 1TA3B 4PJCE 4DAGL 5DD0H 4PJEE 4CD6A 1DANU 1QHPA 1UYWH 2CK0L 4QAWA 3ZR5A 2HRPH 4LRIA 4AZIA 3S6TA 5L6YH 2OSLB 1NOUA 5I77A 4XZUB 4EKJA 2J4GA 5KG9B 3G5XB 1B3YA 1QNPA 4Q6IB 2E6PA 4QHKI 4W5ZA 1NGWB 4WIWA 3HLAA 4PS4H 1TMCB 4FTVE 4KVCH 2NQCA 2ATKA 1VJSA 3LY6A 2XN9E 1P7QA 2F58H 1CDGA 3CAFA 4OLXL 3IDJB 4HPYL 5GS0C 4WEBL 1CXKA 1TNNA 1AFVH 3WNKA 3T04D 4K8RH 5IR1A 2D9CA 5FO8A 5I1GH 3M7SA 2C26A 1FAIL 2VKWA 3F6LA 3HG1D 2V7NB 4LASH 4KHTH 2R56L 4HD9A 4GJTB 4RAUA 5DSCA 1S9VA 5EC1B 2H26A 4QHKJ 1LG1A 1LK2B 5TDNA 1FH5L 3IRZA 4BSVB 5I24A 1ADQH 4L9LA 3T2QA 3QDAA 3BPLC 4RQQB 4W86A 4P23B 1CFSA 1JAEA 3I2CL 3FNDA 1FP9A 2CKRA 2ADFH 3S36H 1PFCA 5C6TH 1ZVYA 3MNZB 4X6CB 3IFOB 4JFDA 2EO1A 5E09A 1QSEE 4ZFFB 5J1AB 2UZXB 3FFCB 1BX2A 2DQDL 4OCRH 3KHOA 4XPTL 3KJ4B 3AB0B 3S5LB 1HCFX 1GXEA 5CP3A 5JOFA 4J6RH 4K3EL 5KTEH 4EAMA 2BRRH 3LSOA 5LAXB 4C56E 4RX4A 4X4MA 1J9CT 1KLGB 5BS0A 3E3QE 5F44A 3ARDD 1OBAA 4WENB 1RZJH 4YN5A 4X7CC 5FOOA 2FH6A 4L3ED 1U8MB 5JBDA 4PREB 2V7HB 5L8KB 1LP9E 4XHJC 1IKFL 2G75A 1DQJB 1P9MA 4HZ7A 5B4MD 2E0PA 1E1FA 1PD6A 5I30H 4MA3B 4FTVA 1JFXA 4I9WE 2XSAA 4NSBA 4LIQE 4OQTH 4AEFA 5HHMD 2DLTA 4MAVA 1W91A 4KKCD 2R0ZL 3BP7A 5GRUH 3VIMA 2OTUA 2HLAB 4M62H 4NNPH 2O5ZH 5MEOB 2Q20A 1F90H 3MV8A 3D2UA 3QXUA 3ZLQC 4WO4C 3MRQA 4XVJH 2XKUA 5IHLB 5F8RC 1JGVL 2XFFA 2X4RA 5SWZB 5I8EA 1BGGA 3FQNB 1PKQE 1MHHA 1UXWB 5DA0B 4HA4A 1QLEL 2ZKHL 5AY7A 1V7NL 3T1WA 5C0RL 3JVGC 4NZDA 2D3NA 4R2GB 1RPQA 3NCCB 3S3PA 5IB2B 4HWBL 4Q58C 1G7HA 5DHYA 1KGWA 3VD3A 4BZ2H 2DI8A 1I1AB 3W6LA 1CZ1A 4MQXD 4IJ3C 1N6QH 5M03A 4OFDA 1ZSDB 2EC9U 2HT2C 3GMMB 4GKNB 2F8XC 4PJ8C 4PJ5D 2BVPA 4Z7WA 3BLKA 4JCMA 3OL2A 1I7RB 5HYIA 3ZO0A 1A7OH 3K80A 1S7UA 2PO6A 4TVUA 4Y19B 3GIVB 5D7JD 1KQZA 2Z4QB 2FWOB 3JWDC 1W8OA 1JGIA 2XJ7A 3O6LH 1CIDA 1FPTL 4KRPD 4IRSC 1DBAH 4KPHH 3OR6B 3STZA 1RIVH 4NQED 4MCYB 5CHNB 4DJMA 3QEGH 2X1IA 3THCA 5JPNB 4PRDA 3I6KB 3VXUB 3V5DA 3P73B 1CG9B 5F9OL 1LO0H 3HZKB 4QGTA 4KJQD 3OKEA 3U0TA 4MAYB 1YYML 2WANA 1S46A 1A4JA 1OAXL 2X1XR 3KPSB 4M7LT 3EYPA 1DJSA 3HE6A 2MOVA 3UO1L 3OLIA 3VXTA 4B7LA 2NY7L 1T1ZA 3UDWC 1RMFH 3HC0A 4MA3A 1I9JL 5ICZA 4LPTA 3MLTA 4ODWB 4UB0H 4KU1A 1E0WA 4N0UA 3ARFD 3JV0A 3O9WD 4PBVC 1JWMB 4PJDE 3KHQA 2F74A 4OD2A 2YN5A 2BC4B 1N0XH 4I3SH 1PIFA 1FYHB