6CGTA

Hoxa complex of cyclodextrin glycosyltransferase mutant
Total Genus 221
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
221
sequence length
684
structure length
684
Chain Sequence
DPDTAVTNKQSFSTDVIYQVFTDRFLDGNPSNNPTGAAYDATCSNLKLYCGGDWQGLINKINDNYFSDLGVTALWISQPVENIFATINYSGVTNTAYHGYWARDFKKTNPYFGTMADFQNLITTAHAKGIKIVIDFAPNHTSPAMETDTSFAENGRLYDNGTLVGGYTNDTNGYFHHNGGSDFSSLENGIYKNTYDLADFNHNNATIDKYFKDAIKLWLDMGVDGIRVDAVKHMPLGWQKSWMSSIYAHKPVFTFGEWFLGSAASDADNTDFANKSGMSLLDFRFNSAVRNVFRDNTSNMYALDSMINSTATDYNQVNDQVTFIDNHDMDRFKTSAVNNRRLEQALAFTLTSRGVPAIYYGTEQYLTGNGDPDNRAKMPSFSKSTTAFNVISKLAPLRKSNPAIAYGSTQQRWINNDVYVYERKFGKSVAVVAVNRNLSTSASITGLSTSLPTGSYTDVLGGVLNGNNITSTNGSINNFTLAAGATAVWQYTTAETTPTIGHVGPVMGKPGNVVTIDGRGFGSTKGTVYFGTTAVTGAAITSWEDTQIKVTIPSVAAGNYAVKVAASGVNSNAYNNFTILTGDQVTVRFVVNNASTTLGQNLYLTGNVAELGNWSTGSTAIGPAFNQVIHQYPTWYYDVSVPAGKQLEFKFFKKNGSTITWESGSNHTFTTPASGTATVTVNWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
publication title Substrate binding to a cyclodextrin glycosyltransferase and mutations increasing the gamma-cyclodextrin production.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
total genus 221
structure length 684
sequence length 684
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1998-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 6cgtA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 6cgtA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 6cgtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 6cgtA01
2GITA 3S34H 2J6EA 3FY1A 4RGMC 5KS9B 2E9JA 4U4BA 2OXHA 1FDLL 2YPKA 5EUOA 3RZCC 4FN0A 5E70A 5ACZA 2DGAA 4UFLA 4HLZG 4XX1E 4AJ0A 1EJ6A 1YMMA 4XNZB 3GTNA 2A3EA 3F7YB 3SUUA 1IKFH 1T4KA 4NBZB 2O9OA 2UY2A 4XH2B 3VH8B 3OZPA 5TFSL 3UG4A 2A6JB 3NTCH 1XH3B 3ARGB 1BFSA 1CU4L 4XPTL 2DDQH 3LKRA 4OCNC 4JG1L 4OV5A 2EXYD 3N11A 1XZ0A 4JFYA 3O6AA 3ARQA 2NMSA 4N5EC 5ESQA 1CWYA 4Q9RH 2EPLX 1DLHB 5C6TL 3OTTA 1N5AA 4WFFE 3JV5A 3HZ3A 4EDWL 1JPGA 5E6ID 4PMRA 2XJ7A 1Z5LA 2XKUA 4QAWA 5L2KD 3TGXA 5HPMB 3QXDA 1DEEB 3E6HA 2X4PB 2OS7A 5EOTB 4H04A 3ECQA 5LA1A 4XVTH 2X1WL 4X4ZA 3IDYB 4WW2B 4WW1B 2YPVL 3VRLE 1KFAL 1M53A 1TVDA 3OG6B 1I7ZB 3BIKB 3QIBA 4KJWD 2AJUL 1MCWM 4XVUD 2UY3A 4AZBA 4OQTL 2H2PD 1PJ9A 2CKNA 1DFBL 4WNQB 4M80A 3W0WE 3ZJKA 3H9ZA 3LN5B 1W0WA 3WF1A 5SWSE 2LVCA 5IROA 1ZV5A 3WSUA 4JFPA 5ID0B 2IQAA 2AJXH 3O3BA 3RX5A 1EHLL 4ZFGL 2A73B 4NQCE 4YIQA 3WJJA 1IJ9A 3V4VL 2VXVH 1KPVA 4JO2L 3D3AA 4AMKL 2EEXA 1GGCL 3JZ7A 2PO6B 3MROB 3PQYA 1VACB 5CJQL 3KPSD 1ZA3B 3DVIA 3I2CH 1LO2L 1S5HA 5GZNC 4I8DA 2AI0L 2Y5EA 3D9AL 2E5EA 3TCLB 5ECUA 4P2RB 3UP1A 3BPNB 4NO3B 5F71A 1KCRL 3BP6B 5EFIB 1I9EA 3IRPX 1VKXB 2AQ1A 3GEWB 2O5YL 3HB3C 1IILE 4RGNB 4XNQA 4ZO7A 1JWSB 4O4YH 3MBEA 3REVB 1RPQA 1A47A 4LLVB 3BH8A 5CUSL 5DD3L 1MUJB 4Z9KB 3WKNA 3PTMA 3C5ZB 1N64H 3VXMD 4XXDB 1YEGL 3LEVL 2VLKD 4CADA 4XRCA 3VFMB 1FG2B 5E2WH 4G6JL 4C83A 4RDQG 1IGTB 1X5XA 4AC1X 4ISVA 4ZENA 5AZEH 3ZE0F 4BQ9A 1PY4A 5LQBH 2O5XH 1G7IA 2YFOA 1FCGA 1MQRA 1OB1A 1ZHNA 3DX9B 4UV7L 3FQXA 1HXKA 1DQLL 1A6WL 4AENB 5ILTH 5BVPH 4AQ1B 4XPGL 4ZO6A 1A8JH 1NCAH 2B5IB 2DBLH 4C56A 1WWBX 4KRTA 1NC4D 4RGOH 4LVOC 4LSUH 1N2RA 5CXPA 4BZYA 1A3RL 4POZC 4L4TA 5CINH 2P8MA 2JIXB 1FP8A 1TFVA 2XA8H 1HQ4A 4OFVA 5E5UB 3TN0C 4ZTOL 2E9MA 2OLHA 1ZE3C 1KCLA 1BM3L 3SE8H 4POYA 1VBRA 5AYUL 1VFBA 2G9HB 3AOFA 5ADPL 1L4IA 4HWEL 3VXPA 5HI3D 2IADA 4DK6A 1KGCD 1DSFH 5ICXB 1S9WA 2F1BA 4NKOB 3QIWD 3WFBL 1W1YA 1F4YH 1YUHB 5L9DH 5AUMB 1MCCA 1HXMB 1IT9H 5FKAB 4D6HA 4ODTH 3QWOA 4I3RL 4B50A 3QXUA 4XCEB 1OAKL 3VXTB 4D6EA 4UIKL 4WI5A 4F9DA 2EQDA 1XGQA 4WTZA 2VE6B 4P57A 2FYVA 4Z7VE 3RTQA 5JW4N 1I7TA 3HG3A 1N59A 3WSQH 1G94A 1EZVY 1XF1A 5I8KL 1E4LA 2Y1VA 3CO4A 5JBDA 2VITB 5I1KH 2BNUA 3RJYA 1CGXA 4X6CE 4ZUWA 3KLSA 2BCKA 4OZHF 4JFEE 5GISL 1AXSA 4ODUA 1JGIA 4L5FH 4PJ9C 3RU8L 1BVNP 2NY2B 4NQDB 3WHE0 4HS3A 2F74B 2XN2A 5IFAH 1KBGL 1A7QH 5JNYA 3S5LB 1TZHA 2FL5A 3BT2L 4R2GB 1UH2A 5C0BD 3MFFB 3S5ZA 3DUUA 3O2DH 1AO7B 3BPOC 4YWGH 2K1MA 4NFCA 4JFQA 1CT8A 3OR6B 4QRPE 2WCAA 1LILA 3DMMC 3HC4H 4AIUA 3THDA 3UCQA 5BRZB 3SPVB 2XIDA 3O2VL 4IRJB 4YXHH 5EO9A 4FTVD 3RNQA 3D25A 1BOGB 3P73B 1RHFA 1XR8A 5L0QC 1QPPA 4D3CH 1PBYA 4Y2DC 2D1ZA 5IESH 3I75A 1NFDE 2PTTA 4OD2B 1D6VL 3ARBC 2X2IA 4E8CA 3MUGA 3MRNA 1S7SA 1WAAA 2GJRA 2B2XL 1N0XH 3WUEA 3FMGL 3LRSB 4Q6IA 1AY1H 3FRPG 3TTQA 1FNLA 2FX9L 1BWMA 3MRJB 4WI3A 2BNRA 2VZOA 3FFDB 4UDTA 1AGDB 4S2SB 3GH5A 2H26A 4AIOA 5JMOC 2VXQH 1OWWA 4ODVH 4TRPH 3LZFL 4XGZB 4BQCA 5IVZA 4LCCC 4FQPA 2A1WH 4KVNH 3FRUB 4HWBA 5GS1C 2XNAB 4NWTH 4PMYA 3RI5K 2YD5A 1JF1A 4AG4L 1IQDA 1DLFH 3F62A 4WFHE 1P2CA 3ULUH 4WHYH 3WXVL 4Y4KA 4G42A 2YC1A 5E03A 3KLKA 3KPMB 4M61B 4BZ2L 2VDML 4JRYA 1S78C 4I5BA 4AYFA 3CZKA 5K9QI 1QFOA 4APQB 1E6QM 1BX2A 3B9VA 3T09A 3SHSA 4B53A 1FL5A 2GKIA 4Z78B 1JRHH 2EBNA 1FNHA 3ARFB 4ODHL 4XTRD 4PTUA 3CSBA 5MEND 4U1IB 1WCBA 2EIBA 3T4AA 1UASA 2BP3A 3DVFA 4P5KB 3VNYA 5F70A 5C07B 1O5DT 1FL3B 5IJVB 1RZIA 2D2OA 1LK2A 4WSJA 4AT6B 2EE9A 1UZ1A 3NN8B 4K9EC 4P4KD 1SY6H 1QI5A 2V7HA 5EIIB 3JWOC 4HA4A 4M8UA 2PBGA 3NFNA 3HNVH 3CHDA 1V3JA 3ALWA 5D96B 3TF7C 1RURH 4I48A 3MCLL 3MGOB 3VI3E 2J25A 3OF6A 4JN2B 3LSOB 1IAOB 4HFWB 4G6AC 1CD1B 2G2RA 1LG2A 2V6HA 5ERWA 1EGJL 5CZVH 3BKCL 1XGTB 5D7JD 3WCYA 4W8LA 1FSKB 1QFWL 4PJIF 1NP2A 4ALAL 3GFUA 3B9KC 1JG9A 1T0NB 5HYIA 1TQSA 1GSMA 1LK3H 1ZWIB 3VRJB 1CZ8L 2GQHA 3NFSH 4LAQH 3IFOB 5LAXB 1XCXA 4B7LA 4NT6B 5B3JF 3A4WA 2R4SL 2ZXDA 4OCYH 1JF6A 4FQ2L 2F53D 3IFNH 3FFCB 5FV1L 4MNQD 4JPKH 1QRNA 2P42B 1V7NH 2I5YL 3ARDB 4U6VL 3AS3A 1IAIL 3GO1H 3T2OA 5DUPL 4Y88A 1IC1A 2VLRD 2CLZA 2XTLA 1MFDL 2J7DA 2BXYA 3VXOA 4HHAB 1MLCB 2W92A 1MOEA 3S36X 4WJ5A 3QDJD 4CD6A 3CDFA 4K71B 1GGUA 2RBLA 4AZ8A 3BE1H 2XZAL 2C7UB 4NC0B 4DVRH 2D24A 5DRWB 4U3HA 5D5ME 1JGVL 1UA7A 4S3KA 2ZUQC 3MREB 5HBBA 5HY9A 4R90H 4GG6A 5SWZA 2A3AA 1T1XA 2AEIT 4XVSL 2OXGA 3D2UB 5D7KD 4W70A 1SR0A 4A6YA 4XPFH 4C7GA 1QR1B 3MV7B 3DIFB 3OLEA 1IZJA 3TLRA 5AG8A 3C8DA 5GRJH 2NY6D 3CBWA 3ZKMC 4HDIB 2WHMA 3VFPB 2F9BT 5I8OH 1OBAA 4FQLH 3SJVB 1Q9KA 1NWTA 3NSXA 3T3ME 4WWID 2XKSA 3U6RB 2OI9C 2ARJB 2L7JA 2YRLA 4OLVL 5J9PB 1DP0A 5FUZL 2AABH 3QIUB 5HHOB 5HVGB 4DGVH 4FQCH 4HWUA 2AS5M 4S1DC 4M7KH 3RIFK 1JJUA 4I13B 5B8CA 4ZXBB 3C09B 5IQ7L 4XCNA 1WAWA 1FC1A 1FFOA 5E8OB 5JHDE 1YJDH 2SEBA 1QWUA 4G6KL 4WENB 2WMIA 5FHBH 5FECB 2W0LA 3QI9A 1P7KA 4LGSB 2Q8XA 4TOQA 4JFFD 3FO0L 1CE1H 4KTEL 2PR4H 3EYPA 4G7VL 1NKRA 1I4FA 5LVEA 5IG7A 2ZCHL 5FUCE 5TDPA 2P44B 2E7LA 5FYKE 1JGUL 3GB7A 1E72M 4LGRB 2ICEB 2R29H 1IFHH 2GT9B 1OWRM 4M43H 1QHOA 1I85A 3FQTB 4XMLL 4EIZC 2VLMD 5JIKA 1QYGL 1OD8A 1X5YA 4H0HB 4R27A 3BDYH 3AHVA 1CG9B 1B4JL 1NAML 4HJ0C 4MJIB 3ZHLA 4D8PB 1J0ZA 2AEQH 4TUJB 1G9NH 3NIFE 4HP5A 1F02I 4FFZL 5BS0D 1T20A 4CMMA 1E4XI 4QWWC 4PJXF 1U8LB 4JJHA 2CKRA 1ZGLM 1WCGA 4W88A 3WLWD 5KANG 4PRHE 5EA0L 3P11L 4IJ3C 4P23C 3QEQE 4R7NB 3KL0A 3HC0B 3UAJD 3HC3H 1CDGA 1UZ6F 3HMWH 3DX8B 4OZGE 4QHNA 2JIEA 1KCVL 4QGTA 4X98B 1NGZA 1ZANH 2D4FA 2IH1A 4R5EA 2FBJH 5T1KA 3PGFL 3JBG7 3HN3A 4XMPL 4Z5RB 3ILPB 3GUTA 1OGAB 3ZO9A 3TYGH 4YDJB 4QOKA 2EIZB 4P7LA 3QXAA 1JD9A 1EVTC 4KRPC 4L8SB 5D72L 5CLWA 4OZIE 1A7NH 4YUEL 5KEZA 2Q8AL 3G6JB 4PJ5E 4AMCA 2ARWA 3GMMB 4S1SL 1H1NA 2PCPB 3MO1B 4FG6D 3LDBC 4HZ8A 1P84K 1XSIA 4DO6A 3EYUH 1A6TB 4U1KB 3UR8A 1A14H 5TDOA 4J3SA 4JFDE 3ZE2E 3QG7H 3GSNL 4PREA 3BGFC 4YHLL 2WC4A 1R3HB 1M03A 1MCPL 2W9EH 4JY6A 1OP3K 1YEJL 5C0DA 5IW3A 1L7IL 1JYNA 3TFKC 1S3KL 3RDKA 5DQDL 1WNOA 3BMWA 3SUWA 1C12A 1KB5H 1CDJA 1NPUA 3WHXB 2HAZA 4MQXC 4TUOA 4OLWL 5JIHA 4V2XA 2R0WL 1TZIA 1TQBC 1MAJA 2WAGA 4LCWB 1FGVL 3S7GA 4JCMA 2ZUWA 1R3JB 3MLXH 3TZVD 1Y6NR 3TBTA 1JN6B 5DHVB 3GBNH 2VDLL 5E8NB 3RBGA 3WD2A 3BX7C 4KJQD 5GGTH 1YDPA 3P9LA 3QUMH 4X9FA 4WI2A 1M7IB 5I76B 2P4AB 1CTNA 1R85A 2CHOA 4RMUA 5C09D 5TF0A 4FZEH 3KAAA 5DD1L 2WCGA 2GSGA 4KMTH 4D0DA 2AK4D 2NXZD 3EO9L 3PZVA 4HKJB 4HUUA 2P8LA 4IPLA 4XX6A 2FHFA 3WKZA 3OAYK 1WJ3A 2NY1C 4K8RD 1RFDH 3HS0A 1YN7B 2GFBB 3GRWH 3VXRD 5CGYC 4HJJL 3R1GH 5CEZH 1Y18A 2PC8A 2J74A 4GRWH 1OD0A 5E00B 4GXUM 1K8IB 3MLVL 3KWXA 1PZUB 4ZO9A 4HQQH 5C0RL 1ZEAL 1QFUL 4HGKC 4XNMA 3S97C 3WFDH 3NZHL 3QDAA 1AHWB 3ZYZA 5J7CC 1J1OH 2QHAA 3LIZL 1FYTD 4HFUL 1J8HB 4UDUB 1AC6A 2YZ1A 1GW1A 1KC5H 1IV8A 4NWUH 2FB4L 4HXBH 3DSNA 5KS9E 1T1WB 4OFPA 4TPRH 5CCKL 1OQOA 5GGRA 4PR5B 3IFLH 1XGPB 3OB8A 4ODSL 4AIZB 4J3OC 2XWDA 4PMXA 3VTRA 1IGIH 4PTTA 2HT3C 5CD3A 1I1AC 3BEWB 1W0VA 1AQ0A 4K7PL 4U1SA 2VT0A 2R1YA 5JXEA 1UD6A 5HNNA 4P59L 5HI4D 3SQOL 4KI5D 1IM9B 1KIQA 1UYWL 1Q0XH 1JPSL 2BY3A 2NYYD 2NZ9D 4XHQA 2HRLA 4MTVA 2IFGA 4Q2ZB 3N9GL 5DURB 4S1RL 4JDVA 2XWTA 1CQYA 3TBSB 1W1VA 1GOIA 3LDBB 3ZM8A 4ONFH 3T08A 3EOAA 2FGZA 5AAMA 1XGYL 3OXSA 3GI8H 4Z2JA 3PBGA 1G6RB 1ETZB 1K6QH 2EEDA 1JI2A 4YDIH 1CIUA 1REIA 1FORH 3MRBA 1TVBA 4JQVC 4UNUA 2IAMB 2XRAH 5FYLH 2CETA 2GDVA 1LO0H 3Q2CA 4C55A 1SMAA 4KZDH 4JFVA 4A3YA 3RWDA 4OI9A 2BVOB 1A6UH 3DGCR 5JPNA 2PW2B 5CS7A 3U0TA 1CGSL 1I9IL 4UAOB 5EB9A 3GXFA 1WTLA 1WISA 3SE9L 1GGBL 2Z92A 5K9OB 3S35L 2B1HH 3ARSA 1I1FA 2Z8WC 1HP4A 2K7QA 3QBTB 3VFTA 1R5VA 4D6CA 4FABL 4WI6A 4NSBA 3NCJH 2BXZA 4NSKB 1TQBB 3BKML 4JRWA 4YDKH 5FUOH 5J6GB 3BZFA 1BEYH 3NACL 4L1HA 1UVQB 2NTSP 1EUTA 2P24A 1MAML 1P4LB 3UC0L 1BIHA 32C2A 3L3OB 4WWKC 5IVXF 4R4BA 3MJ9H 2HISA 1X4XA 4ZNEA 1R75A 1X3DA 4NN5B 1L8NA 4KI5F 2D20A 5IB5B 5F1SA 1X5HA 2VDPL 1RULL 3V5HA 5IBLD 2WINA 1I7RA 4MQ7A 4N9GA 3SKOB 4P2RE 3E6FA 4MS8D 5C2UB 5DJDB 1T04B 4HZLB 3HZVB 3LKQB 2E40A 4KHTL 4K9EL 5DFVD 1EAPA 2JJVA 4KMQA 4RGNE 5I1EL 1ZBWA 2QR0A 3CMOH 3JWOL 5EZOH 3DV4A 4UMGA 1YMMD 1BJMA 1IGJB 4P8WA 2VDNL 5E1AB 1Q1JH 5C7XL 1S7UA 4ELMF 3QCVH 3W27A 3W6LA 1IGCH 1KF9B 2YJQA 3OB0K 2NY0C 4ERSL 3PJSA 4XHJC 3NH7H 1M6OB 5GRWA 3T0EC 2BX5A 5FOOA 5DT5A 1G7JA 3WN5C 2CIKA 4HPOL 2E8YA 3N1PC 4HC1L 3KEHA 3L2MA 3RWEA 4M02A 5T3ZL 3VXUD 3SDCA 4NJAH 4LP4A 2ADJB 4Z7WB 1GJIA 4JREB 1DVFA 1A6VL 4NZRH 2DSZA 2A77H 4JG0H 4OCSL 3G08A 5BQ7B 1S7XB 3VFVB 5IOPA 3AXIA 4OD1H 2FX8H 3EO1A 1W9DM 4C7FA 2XWBA 1JTTA 4WLCA 2C3WA 1H5BA 4WKFA 4NQSA 3V5KA 3ZKNC 1MI5B 4M6NH 4P5MA 3BIAX 3NCMA 4ZUUB 5C9KA 1NUDA 5CHNB 4ZFZB 3ABZA 3O6FA 3QIBD 3S88H 3S37H 3VFNA 1BD2E 2VZUA 4QRTB 2H32B 1UB6B 4RIRB 3DJ9A 4LSRL 4AM0A 4MNGA 1MVUB 5KJRH 3H53A 1X5ZA 1US2A 4FQQA 4LYRA 3MACH 5KAQG 3SE4C 3SDAA 3VWJB 1HILB 1FO0H 1XF4B 5D7LA 4HULB 4MNMA 2MCG1 1KEMH 3SOBL 3MLPA 2IBZX 3QUXA 2JCCB 3Q48A 3E0GA 2E6JA 3FN3A 1HNYA 3DXAB 1Q6DA 4LVHB 4LYPA 5BOZG 2ESVD 1F11A 5E1HB 3F5KA 2EXYC 3VD4A 4X6DA 1JL8A 4YHNA 4WV1A 2DQJL 4IOFC 4XCFH 4X80L 5EORH 4UQBA 1G7PB 2WWMC 4LSVH 5GGSB 3RWJA 4NZUH 2E6QA 1MCRA 4WHCA 1A3LL 2JFEX 5TDNA 3GMPA 4BUHA 1GPFA 3H42H 5JO5B 4TVDA 4NQDE 3O11A 5FF6A 1ZT1A 3EJRA 1AI1H 5A2FA 3IDGB 3PWPE 1N8ZB 1J0YA 4NO0B 4LKXA 1AO7E 4G6FB 3VGHA 1PS3A 4WWKB 1C8QA 4FQ1H 3ILQC 1C91A 2UY4A 1UR9A 5CSGA 4ATWA 1KPRB 3FCTA 2H2PC 3AIWA 3UPRA 5BRZE 2IWGA 5T1LA 3BJ91 3MLWL 5TQ2H 3TM6A 5HYJB 1IGYB 4M7LH 1TPXC 1TCMA 2EXWD 3QRGL 3U7WH 5DMIL 3WIHL 2FIKB 3CX5K 4B9ZA 4KRNA 4C56D 4D1IA 3PZGA 3WEMA 1CD0A 3WIFB 2ZX5A 1AGBA 5DJ6A 3IU3B 1KLGA 2W59A 1HIZA 3RL2B 4L4TD 3CC5A 4YFEA 1MFEH 2RAMA 2C3VB 1KN2L 5GIRB 1C8XA 4PMQA 3P77B 4GMTL 5JW4R 1RH9A 4YBQC 2X4SB 2HTLD 1IL1B 1EEZB 3MRPA 3ZJ6A 4Y16A 2C7FA 3FB6A 4XC3L 3M17A 4Z2KA 4GBXB 1RIUL 1RUQH 3MJ6A 5IMLB 3PWLB 3VIIA 2DIJA 3H8NA 6A3HA 1RHHA 4DO5A 1U8PA 3I3EA 3PWNB 3TA3A 1MHPL 2OYLA 1W2KT 1CIDA 4NRXA 2J88H 2X4UA 3CUPA 1VJSA 5KW9H 3HAEA 3BOVA 3RTQD 4U1HB 4FNSA 4Y5VB 1F4WH 4EUPH 1UT9A 5JUEL 3LXAA 2HT2C 1S5IH 4Y19A 4UTBL 2N4IA 4N8VA 1F3JB 1KV3A 4XC1H 3QNXB 5JQ6L 3SUTA 4ACPA 3PABA 4I18A 1B30A 1A4JA 4YEFA 5MI0C 5I15L 3QPXH 2FDBP 5D9SB 3BDXA 3KXFA 4JN1H 1LQSR 3BKYL 3LD8C 1K3ZA 5C07E 5EO0A 3BP7A 6FABH 2A83A 3MMWA 4HKXB 4E42A 4LU5L 4CD7A 3IF1A 2N56A 4LLQA 4AEHH 4ETQA 1BP3B 5I1CH 2DI8A 4DZ8A 5K59F 3WY3A 2CSPA 2UYLA 2DLFL 3LEXA 3MV9D 2OSLB 3ZTNH 4J6RH 4FLRA 2YPLD 1I3VA 1NUNB 4Y5YA 3ZTJG 2UVFA 3CX5J 4TVPE 4YQXH 2DRUA 2VXTL 3CVHA 3PP4L 4KUCF 4YC2C 3G6DH 1CBVH 3SKJL 4AH2A 3G5ZA 1BLIA 4LCYA 4DVBA 4RISL 1F6AB 1M7DB 2IH3A 2XQYK 2X2JA 4Y1AA 3VXSD 5C86A 1YYLH 4L8CA 5E5RB 1WBZA 5E6IB 4MDIA 3VFSB 3U0PA 5B21A 1V6XA 2CIPA 1GH7A 2IANA 3FFCE 4ZUVB 1KIPA 1P7QA 4XNYH 1TZGL 2MKWA 4F2MB 1QD0A 1AGEB 1T0MA 2F58L 3P9WB 4Z2HA 4M5ZL 1NJ9B 4X7DC 1T5XB 5LGJB 4HOZA 3BKJL 1IMHC 4CW1B 3OKYA 1EUUA 1ES0B 4H25B 3SO3C 3GYCA 4MAYA 3ARXA 2NR6C 3BRFA 1VJZA 3NCOA 3WD4A 5IT2H 5C6WH 1UD3A 4N0YL 5F6HI 5EC1B 4PV9B 4PUBL 2EO9A 4HIHB 4V1DE 1ZVSB 3AYSA 1FVCB 4DN4L 2P49B 4Y4KD 3QUKA 4GRLC 1INEH 1T2QH 5J6HB 2XICA 4JRYD 3OL2A 3TV3L 4Z7OF 5EU4A 3BUDA 2F19H 5EC2B 5E5MB 8FABA 3GDBA 3U30C 4G8FB 5HGBB 2NW3B 1MFAL 3KPSB 3GKZA 1MCDA 1P5VA 5FOJA 4RQQA 2CDFB 1N5YH 4AIEA 2GI7A 3MV7E 1L6XA 5F3HA 5DO2D 4JO1H 2DT2A 4NXSA 1B6UA 3NUKA 2R2EA 2ZNXA 5MEQB 1KELL 5C0AA 4KK8D 1II4E 3SJVE 3ESUF 5TF1H 4PP1C 4ENED 1B3XA 3A24A 2Y7QA 2Z35A 3VXMB 4W93A 5C0IA 4YHGA 2VLKB 3G6AA 2WK2A 1V0KA 5I0ZA 4OD3H 4Z95H 1J9CT 4U5KA 2QHRL 4X4YA 3BQUC 5AY7A 3RO8A 3QEQA 4NBXB 7CGTA 5A6JA 4Y4HC 5B38G 4OZGA 4OLXL 1DUYA 2Q8BL 2QBWA 2VUYA 4IRSC 1MWAH 4OZHB 3VE0A 3UZEA 1WITA 1B0RB 2VRQA 3DVNA 1MFVA 3U5UA 5HDLA 1I3GH 5LGHH 1BJ8A 3RKDC 2GW5A 1G7LA 1NC4B 1NQBA 3LD8B 5FM5M 1TJHL 3H7LA 5GSVB 4KZEL 1KR1A 3VXNB 5F93C 1SEQL 4JZJC 4JFXA 4EKXA 3BAWA 2CDGA 3CFKB 1AQKL 3MRCB 1O6IA 1QRND 2Q7YB 1U3JA 2BSED 2W1NA 4PJ5A 4MB1A 3S8WA 2X7LA 3W28A 1FC2D 1U8NA 1HYSC 3HE6C 3N06B 3QIWB 4MJIE 2OBGA 1E6JL 2R23A 1A1MA 1UWEH 2J3SA 2JB5H 3NCYP 2QQNL 4WU7A 2UWFA 3WE6A 1NSNL 2BRQA 4GS7B 2DQTL 3VDCA 1IC4H 3T0VA 3MOAL 3B2UD 1B2WL 5C8JA 2DI7A 4XI5C 5F8QC 1D9KC 4O2CA 3L3GA 5SWZD 1NDGB 2OP4H 3UTTA 3P0GB 5A6LA 1YMHB 3TNNA 2H3NA 1ODZA 5FGBC 4DKEH 1C16A 2ZUYA 3H7BB 3VFGH 1TMQA 5EU6B 1FV1A 3O3UN 2Y6SC 3KHOA 4FQXA 5DFWH 5D8JH 5HYEA 1CYGA 3MNVB 1OGAE 2AXFA 1UJ3A 1NC2A 3LB6C 25C8H 2CKBL 2Q6WA 1T6VN 2VLJD 2R8SL 1JDCA 4KH2A 5E08H 5HVHC 2EDDA 2KDGA 4X4XB 3G6JE 4LPXA 3C87A 3PWVB 1DWJM 3QAZB 3STZA 3IXAB 1A5FL 2QJDA 5C0BB 1CI5A 2PB1A 2WMFA 4PG2A 4JY5H 4L9LB 1K2DB 3WNNA 3QWQB 5EZIL 5C0FB 4URTB 1VGEL 3BH4A 3C6LC 1CXHA 4NKMA 5MEPA 1RV6X 1PD6A 4QHLB 5DF0A 2ZOXA 3U9PL 1BZ9A 3A6OA 4QNPF 3WEXB 4O00A 3EJQA 3L5WB 3QI9D 4YAQA 1NGPL 1PDKA 2MKLC 1RJZB 5I1AA 5ITBH 1DDHA 4FTVB 4BSVB 1GOFA 3FB5B 4MNHB 1KJ2H 1LEKB 4GXVH 3BVWA 4P7NA 3K80A 3MXWL 3T2QA 5GS3A 5FYJD 1XFPA 2PW1A 1WEJH 4FFYL 4NDMA 4GG6F 4UQ3A 2A6IA 3KPOB 1N3NA 4W7WA 1V3LA 5A2JH 3GK8L 1D5IL 4LCWE 35C8H 3MV8A 3L95B 3QO1B 3EYVA 4X9HA 5D7IA 4NM4H 4H1LA 4P49A 1AQMA 4PJIB 3II1A 3MS8A 3I50L 4PP2B 2J79A 4Y5XB 5M5DA 5A43C 4OZFH 2ZXAA 5E7FA 5CBEA 1WF5A 5T1DH 3MI6A 4FF5A 1W72B 4HCRH 5HPOA 2ZG2A 3GMOB 3DPBA 4WY7L 5I71B 2UZXB 3I6KB 4ONGH 5CPQA 1QG3A 4U2YA 1N7MH 5GGQH 3ZZ1A 3H2WA 5IHSA 2IG2H 4TVSa 5H35B 3BCFA 3MRQB 1ZGLB 1ED3B 2FDMA 2A6JA 4AMWA 5I8CB 5DD5H 5MENB 1XH3A 1K4CA 4F7EB 1F3DH 1ZVYA 4QT5B 3P3YA 4QTHA 2XZQL 4W6XB 4EI5C 5CWSB 1I9RH 2FJFB 2XYCA 2OL3L 3EJZC 3NIDF 1J7VR 2AJVH 4EOWL 4R0LA 3QHZL 4P4KB 1MJ7L 1OPGL 4LSSL 4PBVC 2CBUA 2YWYA 2NCMA 5K9KB 1J8HE 4MB3A 4N90D 3UTZB 5HPMA 5FKPB 3MRKA 1D9KB 1WLHA 3GSXB 4JM4H 5FDYA 1JVKA 1JFXA 5IMOA 4GAJL 4Z7UE 3T1WA 4PJGB 1U8HB 1NGQL 1YEIL 4GQ9H 4KAQL 4PLKC 4H8VA 1TNMA 3D51A 3MA9H 3F5WA 4C54A 1I1YA 3QUYC 5D7JB 1WKYA 4BQ8A 2FJHA 2QSVA 4P2YA 4BFEA 2DPEA 5J12C 3DUSB 1NCUA 4Q0XH 1ZLVK 2GIYA 1D2KA 3C60A 3LH2L 3MV11 5I17A 3KNBB 4QCIA 4JM2C 3V0AC 4QXGL 2E9LA 5EOCL 4YPGA 2CRMA 2F53B 2PF0A 3D85D 3I85A 2D7PA 1FNEB 2OWCA 2A73A 4HA3A 2WXDM 2WUCL 4PJAA 2QMKA 4F79A 1BFVH 2UVEA 5F7KC 3B5GA 3ZDXF 1FG9C 3MROA 1RUAL 4BCEA 5BROA 5ABDE 4M24A 4JGUA 1YNTA 5E56A 5TFSH 4UV4H 2VLRB 1TXKA 4QHMB 5ALBH 4W89A 3WY1A 3L3HB 1MFCL 5DJZB 3E2HB 4XPTH 1FL6B 3QDJB 4F15C 1CF8H 4JG1H 5D7SH 4CVUA 4IIQB 2CLRA 1XD1A 1UKPA 3N1MC 1ZBVA 1VKXA 1QEWA 3EYOB 1SM3H 2FD6L 4GAGH 4LPTA 1NDMA 3REVA 4M3JA 3HJEA 4LLVA 1TR1A 1WFNA 1YPZB 2NNAA 4G80B 1GIGL 1NUFA 4JE4B 4M7JL 1ZU8A 2N1KA 1R3IH 4PLNC 3DX3A 2VAAA 3C5ZA 4YK4B 2BHYA 2OX5A 4XXDA 1ZXQA 2OWWA 2VZSA 1ZLUH 2WC7A 3BLBA 5JHLH 4OCWL 1U92B 5E8DH 4PJXB 1U91A 5CKGA 3VCLA 2LFGA 1HHKA 2C1OB 4UT7H 1KTDB 4W86A 4TXEA 2NY6B 4ZQKB 2R2CA 2BHUA 4R4NC 3GHEL 1EXPA 1KIRB 5GZOC 4U3CA 4CCCA 5EU7C 2V5YA 5IHZA 2BVDA 1DFBH 2D3LA 3RDTA 4ZFMA 5DRXB 3RUGA 5ABFB 5IEKA 4M6AA 4HH9B 3UROR 2VAJA 1LF1A 1FZJB 1J0JA 3BPLB 5GS2H 4AZCB 4YH6A 5FM4A 2J1KA 2J75A 1EHLH 4URIA 3N85L 4KDTC 2EC9T 4KJQC 4U6YB 4NNPH 3WO4B 2LVEA 1KYOJ 4X7CC 1I9JL 4NKOA 2EDTA 5IFHH 5CJQH 4TQEL 4G8IB 1NWRA 2DT0A 2VCCA 5AUMA 2BDNH 5KVDL 3PL6C 5BV7C 4G8GA 1HZHH 3MRMB 2DLGA 2P43B 5FYKH 3TP4A 2H8PA 1KCRH 1CFQA 5KTEL 1F6FB 4U6TA 4JEGB 2Y06H 3HMXA 3N1GC 4ORGB 4L9DA 3L4UA 1QSEA 5CUSH 3BI9X 3IKCB 3U7BA 3VPLA 2ICWI 3OIHA 3W4RA 4Z7WE 4MJ5A 1OINA 3QT2A 4L1DA 5BS0B 1E27B 3OKLB 3VRIA 3SCRA 3LQAH 3PZNA 3RVTC 2QADD 4LX4A 5ANMA 2YKLL 4X5WB 4JQXA 4PCSA 5JBEA 4HT1L 3O6ML 4JLRA 5DEFA 4WI4A 3MBXL 3RQ3A 1DQLH 3NPSB 2VRAA 3QFJD 4UT6L 4L3CA 1BYAA 1NBZA 2W60A 3CVIH 5C0CB 4XPGH 3JXAA 1MI5E 2E6PA 4NQDA 5F7YC 3TBWB 1R87A 1YY9D 1OW0A 2ORBL 3SDDC 1HKIA 3S5LA 3MLRL 5KSUB 3EOTH 3BAYA 1HJSA 5CEXA 2JK5A 2EC9U 3MFFA 3RWIB 4DGIL 2VVSA 4ZE5A 1DL7H 1JHLL 1BTCA 5AYUH 4PB9L 2XFYA 2YZ8A 4HWEH 3QDMD 2HN7A 1ESWA 2DJUA 2H6PA 1VSCA 3INUH 1DBAH 2JCCE 2OJZH 3WFBH 4IRJA 2NZ9C 4JFWA 3DXAE 4MAUL 4GJTB 5IB2A 1HI6A 5B38B 1YNKL 3FO1B 3ULUC 4PS4L 4WTZG 1OAKH 5A16A 3LX9A 1ZL1A 2NXYD 4KV5F 2E7HA 1ISXA 4XXCA 4W68A 3KJ4C 5IJKC 3DBXA 2EDNA 4PG9B 4V2CB 5CILH 1XSKA 1CR9L 4J8RA 2VX6A 1ACYH 1E4WL 3L4ZA 1W9XA 3PP3H 4Z6AT 1FP9A 5JUVA 4GI6A 2X44D 5EBMB 1IZKA 2RQ8A 2M1KA 5FDWB 3HG2A 5GISH 5IM7A 1EV2E 1C5CL 3FKUS 3D3VA 1RP9A 4XZBA 4KJYA 3ROOB 1HN1A 1DUZA 1RZ7L 3SDYL 3ULVD 5AYQA 5LKNA 1UH4A 4LCUA 5HYJE 3TZVB 3BT2H 1N6QL 2Y23A 3WH5A 5F6IC 5CGMA 1AFVL 3FHQA 3V0WL 3HI6L 4WI7A 3LN4A 4PJHA 1A9EB 2EYRB 5T3XL 1I1XA 5MEOA 2BC4B 5HGGS 3AU1A 4HPYL 3P4MB 4JKWA 2J8UE 5C09B 2B1AL 3D5OF 5C07A 2OZ4A 3OWEA 1DANT 1C7SA 5I9QC 1QI3A 1OSZA 1VGKB 5EU5A 3X14A 1FL3A 1GPOL 3WQ6A 2AK4B 2NXZB 1K9DA 3MOBL 1V3IA 4L4VD 4GO6B 4OGZA 3O6FD 3STLA 2IFFH 3DSFL 5F3BB 2WC3A 2DICA 3NA9L 1QR4A 1D6VH 1XMWA 3ZKXB 4JO3H 1G7HB 1KB9K 5DJAB 5HYQB 4P4RA 2OSWA 3FMGH 4NKIH 1FVEA 4RZCB 3WFHA 5IV2B 2FX9H 3FHAA 5D7LD 4HFWA 3VXRB 4EKJA 3L6FB 5BJTA 3QUXD 3NPZB 4N0FB 3G6MA 1XGTA 3LZFH 2EDQA 3OZOA 4IRZL 2AV1A 3LKNA 3V5DA 3BUBA 4RMVA 3PTKA 1Y0LA 3Q5TA 1CD9B 4W4NA 5C0GB 1WUNT 1MAKA 1J12A 3G04B 4JAMA 4AG4H 1FYTB 2L4OA 5L6YH 2QSQA 3X12B 3LQZB 1CXEA 1E28B 1AGFB 4PGDA 2DQUL 3CFCH 4OKDA 3WXVH 1RZKH 4XZUB 3GJFK 4C58B 3MRGB 3ULVF 5DJ8B 4NHCH 3TA9A 4PTVA 5DHYB 4PJ8D 1EBPA 3AM8C 4PRBB 3CMGA 2OK0L 1B0GA 2DT3A 4LVEA 2J7BA 4GAFB 5KSVB 2D03L 2YL6A 5DVMA 2YR3A 4ODHH 1MLCA 4YXLL 3ARZA 3KLAA 5AWNL 1HHJB 3QCTL 3A47A 3ME0A 1DBML 1JWMB 4GUPA 1F5WA 5D2LF 5AYIA 1ERNA 4GQRA 8CGTA 3S34L 5JW5A 4PJCA 4OCXH 3SCMA 3H3BC 3L4TA 1KXVA 2XTJC 5CG0A 1LO3H 1BFOB 5A3HA 5T1LD 5A8MA 3UMTA 2QKIB 2EEAA 4XAWL 1FIGL 5IROC 5TGBB 3U4EA 4KFZC 4YNYB 3D2UA 1YJDC 4HSQA 4K3HA 4EVNB 4QKXB 1IKFL 3MLSH 4K7PY 4ELMB 4RE4A 3KJ4B 3FO2B 4P46A 5AD0B 3GJFB 1JNNH 5C8BB 1QR1A 2GJJA 3DIFA 1EGJH 3DROB 3NTCL 1MPAH 2F54A 4Y16D 4B9YA 4PYSA 3VFPA 3HG1B 1KB9J 4LSDA 4X6DF 1EO7A 1QP1A 2GAZB 4Q9RL 4RBPK 2GK1B 2HFEB 3U6RA 2WWKO 1JD7A 4I0KA 2Z93B 3MBEC 1NANH 3SCPA 4U7MA 5HHOA 3D48R 4FQ2H 3TA3D 3DX4A 1WZKA 4ZXBA 4K07A 3D4ZA 3VDHA 4E41A 5E8OA 1G9NC 4FNRA 4H8WH 4NUGL 4U6VH 1AKJA 4XBPB 3U7YH 4XVTL 1Z6JT 5DUPH 3UJJH 4JHOA 4XP4H 4F7TB 3C9NB 2XSAA 1V5JA 4AEFA 3MJ7A 3WS6A 3QHTC 1XGRA 3KPSE 1A6ZB 4YO0B 2D31B 3VDAA 3QQNA 5ID1B 3GSRA 4ZAKA 3JV4A 5HDQH 2KZ1B 4WUUA 4R8WL 2BOBA 2XZAH 4ZSOB 3T0WA 2VZTA 2V5SA 2ZOKA 3KXFD 3V6FB 2CITA 5JIIA 5A8PA 5EUOB 3ZMRA 2AJXL 3MRHA 1C8PA 3CV5A 4U6XA 3NSNA 1YMMB 2VXVL 4MJIA 2OR9H 5M17A 2X4QA 3OJDA 1Q4NX 1T4KB 2I07A 2VLKE 3GJEA 3I2CL 2Q3AA 2VC9A 5DI8A 4JFHD 4L29A 3LKRB 4LQ1A 2F61A 1FLTX 3HC0A 3PWJB 5TH2A 3EZ8A 4OV5B 1XZ0B 3QDHA 4JFYB 5ESQB 3TC9A 4JHWH 4O4YL 4OGXL 3VXUB 4Y1AD 3CD4A 1HSAB 1R8LA 1N5AB 4PN2A 3T77B 5FUZH 3AREC 5B3NA 1GJUA 2QLVB 5E9DA 2MWCA 4D6IA 1JPGB 1ULVA 1N64L 4Z5RA 1MJ8H 5INDA 2A0LD 3GIVB 3LPWA 2R0KH 4YDJA 2EIZA 1JE6A 2C1PB 3E6HB 2BFVH 4Z7NF 1F58H 4L8SA 5AZEL 1JCKA 3RRQA 2O5XL 3BWUC 4XT1C 3WDHA 3S36L 4ZFOB 3WBAA 2D9QB 3GMMA 3UTSA 4KTEH 1KJVA 1T83A 1KGCE 3GMNA 5K9QG 5ILTL 2L0DA 5BVPL 4YGVA 3QIBB 1CGWA 4HEME 1A6TA 3NABH 4DO4A 1NCAL 4MAYD 3CH1A 4WHTA 1UOKA 1JGUH 3VILA 3CHEA 4RGOL 2NY4C 3R4DA 2OYPA 1W0WB 4U0RB 4LSUL 4ZTPH 4XMLH 3LV3B 3PUCA 1A7RH 1JV5A 1MH5A 1RIVH 2XA8L 1MRCH 4JFPB 2IQAB 3O3BB 3U1SH 2VR9A 3QR3A 4YIQB 1T89A 2VZ3A 5B4MD 3SE8L 1T5WB 1KPVB 4HD9A 4MPKA 4FFZH 2XN0A 4J23A 1DSFL 1U6AH 1T7YA 3H3KA 4FFVC 4MVBC 2ESVB 3U36A 3K1DA 3VG9C 2I9TA 1F4YL 4C57C 3K74B 1S5HB 5EU6E 1IT9L 1U41A 5I1IH 4ODTL 1IM3B 1YNLL 2X2HA 2DOCA 3QFDB 5D93C 3AJ7A 3RCNA 4PGBA 4JFTA 2WMHA 2CDEA 5FHAL 1NGXA 4XNQB 3VM7A 2AJ3B 2EPNA 1VRXA 3DNKA 1BVKA 5C0AD 5SX4H 4WTXA 3TVMA 1WDRA 3BH8B 4KRLB 5DHVA 3W6MA 3HCVA 4KKBC 4J4PD 4XMPH 4KQ4H 4CADB 5IHUH 4XRCB 5C0BE 4QCFA 3HE7A 3WSQL 1HH6A 4C83B 4IMKC 1H49A 4ISVB 5I1KL 1W9PA 5BZDA 5E2JA 1FGNH 3HUJF 2XWJA 2Q8AH 4MDPA 1OB1B 5BV7L 1ZHNB 2D7QA 3FQXB 3T1FB 5D70H 4X0NA 3S98A 4RMTA 4HKJA 4CU6A 3WBDA 2HVJA 3VGFA 3CSGA 2E7MA 4FTVE 2W07A 4GFTB 1BVLA 4LHUA 1KTBA 5IFAL 1OF2A 3BWAA 4C56B 2R69H 1N2RB 5JZ7D 4YHLH 4D1JA 1MIEH 1UR0A 3O2DL 4L4TB 2P8MB 1YN7A 2DQIH 4YWGL 1BQHA 4Z7QE 3QQ4A 1FNSL 1VFBB 3GSQB 3VXPB 1MREH 1E73M 4BSWA 1S9WB 1CGUA 3C8KA 4H41A 1AHWA 1DJSA 4XB8A 4YXHL 2DQFB 1I8KA 5JR1H 2NLJA 4PJIE 5KZCD 4WJXA 3QWOB 2VABB 4QEGA 5HTSA 4UDUA 2R1XA 1JPTH 1OT2A 2BVQB 2BY1A 4U1GB 1QHPA 5D1XD 3RX7A 2NW0A 3OSKA 1AVAA 4ZD3L 2WVSA 2ATKA 4DTGL 4W7VA 1XGQB 1AY1L 1UA6L 4LKCB 4P57B 4MHHI 3RTQB 3BEWA 1I7TB 2VDLH 3UTTD 2DB8A 4OLUL 1N59B 2VXQL 3WL0A 1ZMYA 4TRPL 5FA3A 2CUIA 3J7HA 1Y6MR 1E6SM 2A1WL 1IM9A 4KVNL 3CFIC 4WIQA 1GCFA 5T3XE 2BNUB 4NWTL 1SJHA 5MENE 2JJUA 4Q2ZA 4CMHB 5IBUG 4PLJC 4ZUWB 1B6DA 2BCKB 3DV6A 3GMQA 1GAFH 2CNCA 1AXSB 2HLFD 3EO9H 1DLFL 3QZWA 1KBBA 4FP8L 3ULUL 1MCFA 4XP5H 2JF7A 1S7WA 3WV0A 2DM3A 4HS3B 2NY4B 5JNYB 1TZHB 2UV3A 1W0YT 2HMID 5DK2A 1OM3H 2FL5B 2IAMA 2DLTA 3DUUB 3HHRB 3MV9B 3FOLA 1HWWA 1EZVX 2YPLB 1JRHL 1RK0A 2X40A 3QQ9C 5GHWL 3WUWG 1U8IB 4W5ZA 3MLVH 2P47B 3CLWA 1T3FA 5C0RH 4PJGE 1QFUH 3VG9B 1UWGL 2G5BA 3V8CA 1JZ2A 5FGRA 2XVNA 4FMKA 5E8PA 3QNZB 3O2LA 3AZTA 5F1NA 3D25B 1JIBA 5DGRA 3LIZH 3VXSB 3VD3A 1XR8B 5E2TH 3ZDYE 4DWSC 3W11D 2JE8A 3ZE1F 1R46A 4NSKA 3HRPA 1SY6L 1DQDL 3T0BA 3I75B 5ETUB 1ITCA 2PTTB 5D2NA 3HNVL 3MUGB 1S7SB 2MHAA 5EIVA 4W6YB 3EBVA 1RURL 2GEEA 2MNUA 4Q6IB 1P4LA 3L3OA 4H0IA 5A3IC 1OAQH 3MV8D 1UENA 4UDTB 4X7EC 1XCTA 4IHOA 5CZVL 2H26B 1NLBL 4P59H 4ZE4A 2CR6A 4M9PA 1FFPB 1KJ3H 1JPSH 2VLRE 1LK3L 3NFSL 2J7LA 1JF1B 2Y07L 5DLML 4S1RH 3SKOA 3QDJE 2AKRB 2J6EL 4HZLA 3LKQA 1IQDB 3HI5H 1NCWH 2FRGP 4OCYL 1CICC 3P4NA 4CVZA 3IFNL 4Y4KB 4G42B 2YC1B 1QLEH 5JOEA 4JPKL 4JRYB 5B8CC 3PZOA 4ZXOA 4TTDD 1V7NL 2XQBH 4I5BB 4ZUTB 1YPZE 4X9YA 3D18A 1L0QA 4M62L 3BAEH 3U82B 1BAGA 3KPQA 4HLZH 1H15B 2XFXB 1BX2B 3BAIA 4BQ4A 1FL5B 2Z8SA 4R6UA 3GI9H 4GW5A 4PTUB 1HVQA 1CGSH 1I9IH 3NMEA 1NGWA 1WCBB 3NGBC 1GGBH 5AEAA 3T4AB 1ZB5A 3S35H 3QPQD 1G9EA 4HIXH 3BE1L 4YHZH 3WFEH 2APXA 4DVRL 2E7LC 1RZIB 3KPNA 4R90L 2OR8A 1JZ7A 5E4EC 1VEOA 4ACZA 1I8LA 2X89A 3NFNB 2ENYA 2FATL 1GHSA 1A2YA 5BQ7A 3IXTA 3QXVA 1CDCA 1MAMH 4XPFL 1UH3A 3IGAA 1VFUA 3OKOB 4LCIH 2G2RB 3TV8A 4HV8A 5ERWB 3BVTA 5GJSL 3AMCA 3WF2A 5GRJL 1UKQA 4MZ3A 3VO0A 5I8OL 4FQLL 4M93C 2OYKA 3FT3A 5E6YA 2Q3ZA 1RULH 4QRTA 3C60D 1LEIA 4JR9H 2F5AH 2H32A 4MD4A 1RUPH 4TSAH 3G5VA 3CNKA 4KMLB 1E71M 4OOUA 1HJUA 2AABL 1B1YA 4Q7NA 3VWJA 4DGVL 4FQCL 3NFPA 4ZOCA 2J2ZA 5I1EH 3U0WH 1UWIA 1OTTD 5IDIA 1QRNB 1YJDL 2VLME 2VDNH 4DOHB 3L3DA 2LU4A 5J1SC 5FHBL 3DC0A 1CDUA 1LVEA 3WN6A 4LLMB 1CE1L 4ERSH 2YBTA 3RPKA 2PR4L 2CLZB 3VXOB 3ZYOA 5GS0C 4WJ5B 1HXYA 4AY0A 1Z3GH 5C70A 1QSFA 3IANA 4KHXH 4UU9A 4PRDA 4HJGA 2R29L 1IFHL 3ZT6A 4DEPC 4M43L 1A4KA 3EFFA 3BESR 4HW6A 5F1OB 5HY9B 4RWYH 4GG6B 4OIFA 4OFYA 5C0CE 4QHUA 1RVFH 5SWZB 2ED9A 3BDYL 3LVEA 1AJ7L 1T1XB 3QULA 4OCSH 3IDGA 1G9NL 5C3LD 4A6YB 3MLTA 2BSSA 4N8CH 5DZOA 3TT3H 4XBGA 1W32A 2VLJB 5ENWB 3HU7A 1EO8H 3HC3L 2O5ZL 4X6EA 4PGEA 5HYJA 1SFSA 4PRNA 2UWEF 4LSRH 5E95B 4JFZH 1ODAA 3WIFA 3W5MA 1GOMA 4XV0A 2C3VA 4N8PA 3MRFA 4JZ5A 5B8CB 4KROC 2XY1A 3TYGL 1FFOB 1JNHA 1X5JA 1IL1A 2SEBB 2EPKX 1IKNA 2WMIB 1V02A 3IETA 3QI9B 2DT1A 2WBJC 1A7NL 1TQTA 2V17L 3D52A 3RVVC 5IMLA 4BJLA 3PWLA 3WIJA 2DQJH 4G8GD 4CVXA 4Z77B 1I4FB 4X80H 1SJEB 5IG7B 4V27A 3F65A 3G5YA 4MCYA 3PWNA 3EYUL 5GGUB 1P4IL 4PTWA 4KUZL 1IAKA 1T80A 3GB7B 1A14L 3VIPA 1A3LH 3QG7L 4PJ7A 5E4EB 5EU7E 1TA3A 1QSED 3AAZB 2Z31C 4U1HA 3CPUA 3GXNA 1MXGA 3U79A 3N0PB 1QA9A 4AD2A 1FJ1A 4OQTA 5J0BA 4FK9A 1OP3H 4FA8A 4H7VA 1KB5L 3GBMH 1K5NA 2MCPH 4Q74A 2VXSL 5C09E 5GNYA 1QACA 3CAFA 4UQAA 4HKXA 5I5RA 4QTIH 2XN9A 4QHNB 3I6LD 5HBFA 1EDQA 2AK4E 1NGZB 4KPHH 3RUGF 3SCWA 2CMRL 4WFGD 3MLXL 1D5BB 4CDHA 4F9LA 4X7TB 5HGDA 2IH1B 2OLDA 3N50A 3QNYA 3GBNL 5L8LB 5JORA 2OSLA 5DK0B 2EDHA 4W87A 4KI1A 5JXEC 3UDWA 3QXAB 3VXRE 2ITDB 4FZEL 4IM4A 5FB8A 1O0VA 2NY3D 1MJJA 3H55A 2NW2A 3BD3A 4KKLC 1XGUB 1QQDB 4KMTL 1F6AA 1M7DA 1FFNA 3DUHA 5EOCJ 2ZX7A 5F88A 2D3VA 3W25A 5FYLD 5I8EA 5DVNA 5HD8D 1UG6A 5E6IA 1BVZA 1HKLH 3VVGA 1FYTE 4BH8B 4DEPB 5J57B 2XTKA 5L2KA 5TDOB 5J1AB 4GRWF 4PREB 3HMCA 4N8VG 4JY6B 5CEZL 3U83A 3CLFH 4F2MA 1A02N 5C0DB 1PIFA 3CUJA 3GMRA 4HH8A 5JUEH 2C0HA 3OAYH 1NJ9A 4UTBH 3WL9B 4HQQL 2Q76A 1P4BH 5IB3A 2XVPA 4PJBF 3B2VH 1QSZA 4PLOB 1N4XH 3FT2A 1C12B 3WFDL 2V5TA 2MQ3A 1DE4A 3FZUD 4HWBL 3PZUA 1J1OL 2P48B 4KI5E 4TUOB 3X13B 5A40E 5EC1A 3BKYH 2O93L 2I26N 3D3VD 4QCEA 1ZVSA 1KC5L 3D85B 1TZIB 2XFRA 4HXBL 4CN6A 5J6HA 4TPRL 1G6RH 3AYRA 4LSPH 3LAFA 3IFLL 2YN3A 2YUVA 2NW3A 3TBTB 2H1PL 2BK8A 1HJXA 1QPXA 1F00I 5D4QA 1YDPB 3P9LB 4ELME 1W3KA 5HPCA 3SGKA 1EEQA 1QFWI 3WH7A 4EI6A 2VXTH 1Q0XL 4X6FB 4NQTA 5CLTA 2VX7A 2GSGB 2X8RA 4DN3L 1NANI 1KEGH 4LPVA 2NXYC 3HG1E 1UD2A 4X4ME 2HYMA 4MXVE 1WWAX 3TTYA 1WZLA 4HUUB 3E8UH 5IBUB 2P8LB 4CN1A 3VXMA 4P5TA 3OGVA 2VO5A 5BW7A 4YFLI 1SYSA 1K6AA 1FORL 1LO5A 4OBRA 4PJFF 2XRAL 1IAII 2G4FA 1LO0L 4KZDL 3HS0B 4YDLB 3L1OH 5IB1A 4OAWA 1W91A 1A6UL 1TZGH 1Y18B 2Y8KA 3AHTA 2XKNB 1S9KC 2F58H 2NSXA 4M5ZH 4QGYA 2DJ4A 4OZHA 3PIQA 2B1HL 2HKHH 5T5FH 4XNMB 2QV4A 3WUWB 4P9MH 3UYOD 4YR6A 4KK6C 4N0YH 1HWGB 3SDCC 1OAZH 4NYLA 1Z9LA 4V28A 1LO4H 1NBVH 1RJYA 1DVFC 5FUOL 1XAUA 3OKKA 3RWFB 1EHAA 1IGFL 3TV3H 5DVKA 5EUOE 3ALGA 5GGRB 3HR5A 4RFOH 4PTTB 1V08A 5CD3B 1YMME 1W0VB 3QIWA 5SV4A 4AISA 3MJ9L 2VDOH 4PJHF 4U1SB 2R1YB 1PEWA 5I75C 2DTMH 1H5BC 4HAFA 5CZXD 2EKSB 1KIQB 3RGVC 4MD5A 2A6KA 3ZLQC 4I0PA 2J12B 3AB0C 4OJFH 4JDVB 4P2OC 1UC6A 3SCMD 3THML 5F1IB 1KELH 3UXFA 1YQ2A 3AXLA 2IMMA 3UTQA 3QXWA 3EOAB 3SDAC 1S7QA 2EC8A 2Q1EA 3CMOL 1NDGA 2I9LA 1YMHA 4F58H 2AGJH 3VMOA 3Q6GH 1Q1JL 5HI5D 1GOWA 1HTYA 1TVBB 1QW8A 3MMDA 1IGCL 4WHYG 4P46D 2CYGA 1HKKA 3CZJA 3RWDB 1LDPH 2QADB 5CJOL 1VCAA 3NH7L 3HPLA 4WV1C 2QL1A 2F54D 3SGJA 2WLYA 2Z92B 3OB0H 4EN3C 3B9DA 5JW4M 2CBJA 5F72S 3VFTB 1BQUA 3AXXA 5H37G 2IPTH 3B9AA 1R5VB 4PJEA 1ZS8A 3TONA 4NJAL 1TJHH 3Q6FA 1UWXK 4G43A 3AFBA 4JG0L 4IM8A 3BZFB 1KXHA 3BZEA 3F7QA 2LV4A 4QHLA 4EIGB 2P24B 4OD1L 3QDMB 1J86A 2FX7H 1AKJD 3ECBB 3L5WA 3H6JA 5HVFB 1A3QA 4R4BB 3EAKA 1RJZA 1D5XA 3ISWA 1X5LA 1CZ1A 3VWKA 4M6NL 2EYSA 4YHIA 2COQA 4K3JH 4U49A 2XXCB 3CXHK 3MLUH 4LLWA 3S37L 3GZKA 4HX1A 4B5EA 1H3PH 3V5HB 2WINB 4ZAKD 1EAJA 1I7RB 3PTQA 4N9GB 2NXYB 2XOTA 3MOAH 4G8EB 5SX4I 5KJRL 3E6FB 1UZ4A 3O8XA 3MACL 2ITCA 1CFSA 1FO0L 1V8HA 3VIKA 2QR0B 4TOYH 1KEML 3DV4B 3NIGE 3QO1A 1EPFA 1RPKA 4M7ZB 2HT4C 1S7UB 2J7HA 5M7QA 2XVLA 2ZKHH 2WAHA 3THCA 5D1QA 4ODWA 4DM1A 2QQLL 1T7XA 3WNLA 1L0PA 3OMZA 5FM8A 5I19L 3PJSB 1NMBL 1NLDL 4HS8H 4YDVB 2XV6B 5EORL 3W24A 1G7JB 4W4OA 2DQDL 4M4PA 2CIKB 2Z91A 4LSVL 2GYSA 3VIHA 4NZUL 4ESKA 3EDEA 5EN2B 2EZ0D 3SBWA 3RWEB 3ZJ8A 1OIMA 5HXMA 4YBHA 3SDCB 5HHNA 5DDHA 3WDJA 2E7BA 4HWNA 2YBUA 2MSPA 3HA0A 1MY5A 2X9WA 3S96A 5DXWA 5E9DD 1QOKA 4HKBA 5F9AC 4C56E 5JOFB 3REWB 3BAXA 1AI1L 3SGDI 1SEBA 4BFIA 3G08B 4I77H 1RQ5A 1C1EH 4ZPVA 5MENA 5IOPB 1HJWA 4L4TE 2DYPA 3AICA 5A6AA 3U9PH 4Y4FC 4QT5A 4P8VA 3GBEA 4FQ1L 1QI0A 5D2LB 1OCQA 3QUZD 1LP9F 4I18C 3BAKA 3V8OA 1CCZA 4X9BA 5BCAA 3JV6A 1H5BB 5D1ZD 3UTSD 3V5KB 5L7XH 5I18L 5GS0L 3B8SA 3RPIB 4P5MB 5HOSA 4L4VB 3DDGA 5TQ2L 3O6FB 4P4KA 3ARYA 3VFNB 4M7LL 4PCTA 1HNGA 2AJYH 3U7WL 3V6OA 3W82A 1QSVA 4AM0B 4MNGB 3UTZA 2C4FT 4FQQB 1KBKA 5KSBF 1FLRH 1J87A 5JW4Q 3WMBA 4F37F 3EJYD 5HGHB 4H1LG 5D7LB 5GRUH 3CXHJ 3E3QE 5TE7L 4JJ5B 3GKWL 3QUXB 5C6PB 1Z32X 4TNWK 4Y5YC 1BYDA 2PETA 3VA2C 4CNIB 4U6HA 1T03H 1F11B 3I50H 4X6DB 1RUQL 3OX8B 3FN0L 5CPTA 4YHNB 4N5UA 4WV1B 4Q58C 4HTYA 2FEDD 2H2SC 4H20H 4OBSA 5FM5O 2YA2A 1I1RA 2RFXA 2CJUH 4A3HA 2F53A 4MA8H 4DKAA 1CL7H 3BSZH 3RWJB 4WY7H 1VBUA 1UXSA 1U3HD 4MNQA 4N1CA 4GQQA 1J18A 2A0LC 3FO9A 1U95A 3GMPB 4PJ8B 4TVCA 3MCG1 2A9MH 3O11B 5FF6B 1ZT1B 2VN4A 3EDKA 1F4WL 1Y7VA 4TTUA 2XY2A 1S5IL 5SWSD 4QHMA 4YLQT 3L3JA 4LKXB 3MUAA 3MV9E 3QDJA 4IIQA 2XZQH 4NQCD 3QPXL 4WUKH 1CFTA 3EYOA 4MAYC 3CFDA 3FCTB 2OL3H 3UPRB 1NAMA 6FABL 5T1LB 4LARL 4UZGA 3WDIA 4TSBH 4HXAH 2C4FU 4G9FA 1HEZA 5L88H 1E4KC 4LHUD 4AEHL 5DJXA 4F8TA 5I1CL 1J1PL 2EDJA 4R97B 1AGBB 3N12A 5DJ6B 1U92A 1KLGB 4PJXA 3CIVA 3CC5B 5ABGA 3ZTNL 2JF1A 1JXKA 1WAAE 3SE3C 4KAQH 5CSUA 4W8BA 3O9WD 5FUCC 1CLXA 4AWEA 2DWEA 4Y16B 4KVCH 4ZQKA 5EO1A 2BNRE 2JJSA 3G6DL 2WIMA 3UBXI 5IB4B 4B3LA 3WQ5A 3M17B 4S0SD 5DO8A 1AR1D 1TTUA 4BK4A 3K4AA 3MODH 4HH9A 4L8DB 4QXGH 4MWFA 1RHHB 5GRVL 4K3GA 1U8PB 4AZCA 1MLBB 3TA3B 3H3PH 3LS4H 3HFMH 1QVOA 1V6WA 3DHJA 5HHXH 2WUCH 2V7NA 5A94A 5E94A 5ACLA 3N17A 2X4UB 3KE0A 3CUPB 2VC2H 1LEGA 5DJCA 2BVEA 1E56A 4PB0H 4XNYL 4JRYE 3LQAC 2X1QA 4WCYH 2PWGA 4JFFA 2G41A 3ZSSA 4J12A 4Y19B 4N8VB 3U9UA 3L3IA 3IDIA 4N1HB 1YEFL 4XPAH 3EO0A 2XUCA 3PABB 2HVKB 3GSNA 2W61A 4RMQA 2F8QA 1A4JB 5I66A 5E4IA 2FHBA 5IT2L 3AZSA 3KXFB 3EIFA 1UR1A 5EO0B 3BP7B 2A83B 3BGMA 4E42B 3EJJX 3IF1B 4P8XA 1A7BA 3OXRA 3VD5A 1INEL 1T2QL 2C3GA 1IBGH 3RJXA 4LLQB 1AXTH 1G9MH 4ETQB 3WUBA 2F19L 4TULH 2VDKH 5BS0A 1H11A 4OCWH 1NFIA 4DZ8B 3RJDA 3OKLA 2UYLB 3LEXB 5A6SA 4I3GA 3D50A 4ZUSA 3BN9C 3PGCA 4KKCD 3AMGA 2GSJA 5D6CA 3CVHB 3NZ8B 1KULA 1MCOH 2XGIA 3S3JA 1Q9LA 4AH2B 4JO1L 4ZS6D 4U05A 4DVBB 2V5DA 2DI9A 2HJFA 1ZLWK 1G0DA 3TN0A 5HHMD 5J11C 2IH3B 4Y1AB 5INCA 4BKLA 3PV6A 1HHIA 4L8CB 1KNOA 1WBZB 4J3VA 4U3XA 4N0CD 5F7FA 5IUSA 3S5YA 4MDIB 1LMKA 3N85H 3U0PB 3JUZA 2G5RA 2F8VA 5CP7A 4Z95L 2Z4QA 4FQXC 1P7QB 3B5HA 1QRNE 4DOHE 1OD9A 4GZJA 1K3IA 1UJ3C 1WVZA 4FMFA 4MD0A 4D6GA 5KVDH 4QNPE 1MWAL 4QHKI 5C9JB 3BUYA 2O92A 1I3GL 3MLZH 4MAYB 3NCEB 5J13C 3PHQA 2J8HA 1RUMH 1GORA 4LSTH 3MA7A 5JOPE 1GGIH 3WD5H 1CGVA 4K7FA 5F9DC 4MA3A 1FVDA 3BVNB 2YLLA 1X1NA 1JHKL 5EU4B 3JTSA 3DETC 4GG6E 2AAVA 3M46A 5SWZE 3VIFA 2DWDA 4MSWA 1HVXA 5CIPA 2YKLH 4IS6A 4PJ9A 5F89A 4QLJA 2AEWA 4HT1H 4RQQB 1UWEL 1XF2A 4ZMAT 1RY7B 2JLLA 2G75A 4OOZA 4XBEH 4P2QA 5HDOA 1IC4L 1QNSA 3ALPA 4MXQD 2R2EB 2PUQT 1T2XA 5C0AB 1UJTA 4PY7A 3VIGA 2CQVA 3NAAL 3L4YA 3DMMA 4X6CF 3KLHD 2Y7QB 2Z35B 2GFTA 5C0IB 2X89D 4JFOA 4DKEL 3G6AB 3PV7A 3VFGL 4PB9H 5D8JL 3OLGA 1P9MC 4X4YB 5IFTA 3TYFA 4M82A 3EOBA 5F97E 4F33B 25C8L 1DQML 2O9TA 3LXCA 1DUYB 3ARBA 3VE0B 5DMKB 4KRUA 1VIWA 3LRLA 2P5EA 4PBWD 3DVNB 5C0JA 1RZ8A 2A3CA 1Q38A 1J10A 4PS4H 3VSTA 1RZKC 1I3RA 1KTCA 1HKJA 4WO4D 1G7LB 3BN3B 3WMSA 1G7HA 5I1GH 4XNZC 1UGNA 4H5SA 4LRIC 2D0HA 1FH9A 5IV2A 4JZNA 5FYJE 4JY5L 4LCCA 1CR9H 1RAMA 4Z2LA 4NFDA 4C7DA 2X7LB 1U8NB 1DQQB 3OQ3B 5KZ6A 2V2XA 4O51B 2R23B 1MCIA 4BQBA 1BWWA 3RY5A 2BVPA 5KZCB 1KJ2L 4GXVL 4XWGH 1C5CH 5GNZA 4R0LC 1QRKA 1QSFD 3WE6B 1BMGA 1W72H 2DQEH 4NN6B 5TE6H 4XZUA 1UD5A 5C8JB 1WEJL 2DF3A 3TIEA 4PRBA 4O2CB 1R47A 4OFYD 3L3GB 4NQED 1N6QH 1H3VA 4O58L 4UQ9A 1AFVH 2YD8A 35C8L 3UTTB 2X1OA 5IVXA 5CD5D 5KSVA 3IDYC 3TNNB 2RGLA 3TBYA 5T3XH 1RI8A 4NM4L 2FGLA 1T66D 1FV1B 1HHJA 4LIQE 3KHQA 4FQXB 5CSBA 1OSPL 2VN7A 1JWMA 2AXFB 5IVOA 4HWZA 4QOKE 2DAVA 5L8KB 1YEDA 3C60C 2Q6WB 4CAGA 5T1DL 4PGZA 1H3UA 4HU8A 2QTEA 4HCRL 5E8EA 3QA3B 4EE9A 5A6BA 1E4NA 1QLFA 3STZB 1VADA 1G5AA 4H8WC 5MP6L 2EIDA 5F9WB 5GGQL 1OHQA 5AD0A 3K8MA 2PO6C 4MMZC 2IG2L 3EW3B 4N90E 1QNRA 2DQCH 3DYPA 3O0RL 4NKMB 5DD5L 5MEPB 2WVVA 4HC1A 3QJFA 4CN4A 2J8OA 2KPNA 2FLBT 3EMQA 5LA2A 1I9RL 1UM5H 5I1AB 3NIYA 1DDHB 4RGNC 1PEZA 2Z93A 1CXLA 4LAJH 2AJVL 1KIUA 5KVEH 1J8KA 1INQA 3B3IA 3C5ZC 3C6SB 3TWCH 1YA5A 3SURA 4NDMB 4NN7B 4UQ3B 1WO2A 5DRNA 5I6SA 4GQ9L 1G0CA 2VKWA 3MV8B 1UADC 2LU7A 3EYVB 1S9VA 1NOFA 1FPTH 1WBXA 1ZA6A 4H1LB 5AWNH 3L5JA 2UZYB 5GS2D 2OJEA 4ZSOA 4JFSA 3C5SA 2B5IC 2X4NA 1E3ZA 4E9LA 5CBEB 2CKSA 5F6HJ 3RDTC 3V6FA 4UFIA 4K3EL 1E70M 1PZ3A 2XN9D 1CVRA 4XAWH 1FIGH 1ZLVH 2XM1A 3CGTA 1UR4A 3A0OA 4OM1H 1BFVL 4H8HA 3IFPA 3LMYA 3QYCA 3EYQC 4YZFE 3QQ3A 1GRWA 5FYKD 4UV4L 2IC2A 4HBQA 4OFDA 5ALBL 4JDZA 3VFWA 1X44A 1K4CB 3L5HA 2VH5H 2YUWA 1CLCA 4XNUH 1CF8L 5D7SL 3PWJA 4QTHB 1CGYA 3PZTA 1SM3L 3ZTJH 4GAGL 2ZUTA 5A6MA 3VXUA 3FNDA 1HSAA 5JW3H 4R0LB 3T77A 5KVFL 1R3IL 3MGTA 3OV6A 1MQKH 4YBLB 2W91A 4JKLA 5DWUH 1OTUD 3GIVA 1F6LL 2VR5A 4YGAB 4PJ7F 3ESVF 4TX6A 3L7FA 3MRKB 3IDMA 4QF1A 5JHLL 2C1PA 4NUGH 4Q9QH 5E8DL 5IMOB 1N82A 1HCFX 3T3MF 2OTUB 4ZFOA 2D22A 3F7PC 4UT7L 2BNQA 3F5WB 1I1YB 3T2NH 3WIHA 1WZMA 1ADQH 2EDBA 4ATDA 2FJHB 1NCDH 2VISA 3U46B 3C60B 1F45A 3UTPD 4R8WH 2NY2C 2UWEB 5I17B 2ATPB 4QCIB 3AIQA 4X5XB 4UCFA 1JAKA 2J77A 3LV3A 3OKNA 4JPIA 4YPGB 4R2GC 3PF2A 1TTFA 4JANA 4QLLA 5LYRA 1EQPA 1MCNA 4PJAB 4RNRA 1T5WA 1R0AH 1DTUA 3MRIA 4NNPL 2ESVA 5IFHL 4P23A 1YNTB 4DGYH 1HF6A 5IFJA 2BDNL 4IRJC 1BF8A 1HZHL 2ZWLT 1IM3A 5FYKL 4G6ML 4M03A 3QFDA 4EUPG 2CLRB 2NTFB 3MJ8A 5IW1A 4O02L 1R86A 1QEWB 1Q72H 2YWZA 5DZNA 2AJ3A 1NDMB 3MU7A 2Y06L 4OGXH 1A0QL 4A4AA 3QB7C 3ORJA 2NNAB 3MCKA 4LBEA 1GQIA 2XT1B 2GCYB 2VAAB 1H3WM 4P5TD 5EBWB 1MW0A 4TYUA 2R9HC 1EHXA 2V2WA 2YRPA 3LQAL 1U91B 1G7QA 3S36H 3VCLB 3M6DA 1HHKB 4PUEA 3FZUC 3T1FA 3P4OA 2MPAL 4QRQB 4NZTL 3CVIL 1B31A 4ZNEE 5IHZB 3DI2B 1S8DA 3RDTB 3RUGB 3WDRA 3EOTL 5IEKB 4HF5L 4OZIF 3QUMB 3AUVA 4APQC 1DL7L 5CBAA 4PBGA 2WZEA 3BLKA 5I1JH 5KVGH 3ARFC 2E9BA 3GSQA 4XCYA 3INUL 1DBAL 1T7VA 2OJZL 3ZE2F 2CUMA 2DQFA 5J56B 3DO7A 4G8GB 3S9DB 4OGAD 4BFBD 2VABA 4D9QD 5KANI 4GZEA 5GXBB 1YNLH 4MJ6A 2WANA 2BVQA 1PW3A 2H8PB 1CFQB 2ZUSA 5IEHB 4ATLA 1QTYT 4I0PD 1X5FA 5FHAH 1HIMH 4HIEA 3FQRA 2VERN 4GRWB 5D96C 4DKDC 5SV3A 1QSEB 4LKCA 1J05B 1L0XA 5CILL 3ULVE 4FZ8H 4HIIA 1ACYL 4MJ5B 1H2JA 1A7PL 4AMXA 3QEGL 4RRPA 3CFEA 1FSKC 3VRIB 2HTKD 1GC1H 5ANMB 5F44A 3QXTA 4JLRB 4BQ5A 5BV7H 5I78A 2DLIA 4LHUG 5DEFB 2ED8A 4OZ4A 5FFLA 1FP5A 4L3CB 1NBZB 2W60B 5C0NC 2DMCA 2VLLA 2WZHA 1R3LB 4GZIA 1BQHG 3ARDC 5CEXB 2JK5B 4K8RH 3ELAT 3MV9A 3ARGD 3BXWA 4MNGE 3BUTA 2YPLA 4WFEE 1GGYA 5I1HH 1U8IA 3LRGA 1FNSH 5D7LE 2HN7B 1YN6A 2H6PB 1PY9A 2NY3B 4KK9C 4K71C 3KWWB 2BMKB 3QNZA 2JTDA 4OCMC 3CU7A 2B4CC 3VWKD 3VXSA 3SCMC 5IB2B 1HI6B 4NUJB 1U8KA 1SHMA 1KXVC 4X6DE 2IFFL 1QW9A 5IMMB 5ETUA 5IQ9A 2IPUG 1BF2A 2IBZY 5A16B 1I1AA 4JO3L 3CZLA 4ZD3H 2FH6A 3O8XD 4HZ7A 4DTGH 2ZUUA 4NKIL 1UA6H 2P45B 3EJTA 3DBXB 2VQTA 4CD8A 3CZFA 4J8RB 5E1QA 3ROLA 4OSUH 4OLUH 4BUGA 3ZHDA 4GH7B 1CECA 3MNWA 5D1QD 3EGSA 2WWKT 1CDYA 2EYTA 5KS9F 1FFPA 2LTQC 3QZWG 3N13A 1NBYA 1HX0A 1O7AA 2AKRA 3S3SA 3A67L 5L6YL 5IM7B 2KUTA 3RVXC 1HL8A 3B43A 3D3VB 4HGWA 3PHOA 1WB0A 4FP8H 3K4ZA 3QIUC 1MWOA 3CZSA 3ES6B 4KJYB 1KQYA 3D5HA 3CFCL 3O2WH 1RZKL 1OVZA 4ZXBC 1DUZB 3C09C 4NHCL 4PJEF 4ZUTA 3RVUD 4LCUB 1U3YA 1FZMA 3TIDB 1H15A 2XFXA 1QFPA 5F7MC 4D71A 3SDXA 4Q9BA 1JYXA 3GJFH 3TH3T 4P2RD 3LN4B 2F8XC 4PJHB 3BSGA 5GHWH 5MEOB 3UYRH 1IC5H 2DYPD 3AU1B 3O3EA 1V03A 1J0KA 4OKVB 1UWGH 4KKAD 2ZUVA 1OSZB 5EU5B 3X14B 3IVKA 5CSZB 4OCXL 1N6UA 1LO3L 2KH2B 2W65A 1IQWH 3GZAA 3STLB 4X9GA 1DQDH 1H3GA 1HQRB 3AY4A 4JHZA 5EOQH 4WW2F 3MLSL 4P4RB 2EO7A 2CKBA 1FVEB 3WFHB 1JNNL 2XG5A 1KR0A 3OKOA 3DX2A 2X4RA 1MPAL 4LHJB 5BJTB 4FFWD 3O3DA 4V2BA 4Z7NE 1NLBH 1CLOL 5EUKB 2AV1B 3LKNB 3V5DB 1WTGT 2P46B 1OARH 1Y0LB 2F5BH 3FAWA 1HH9A 5SX5K 2J47A 1DBKH 4Y19E 2A3BA 3RZCD 2UZIL 2ZJSH 1KOAA 1IEBB 2Y07H 2JIXD 4JAMB 5DLMH 1BG4A 2H45A 2J6EH 2RR3A 4YFLF 1T22A 2EE6A 1XF3A 4PGDB 3KXFE 4H8WL 1SMDA 3MLYH 4M62H 1QNPA 3HKFA 3T0EA 3U7YL 4H2CA 1BD2D 4L8SC 1EK3A 3M07A 3BEVB 4FQJL 1B0GB 4LLMA 4OIBA 3UJJL 3SGEH 3IDJB 1D5ZA 4XP4L 5BRPA 4N5ED 3KLAB 4D9RE 3RVWC 4GLRH 4GUPB 4LOUC 4P3CL 5HDQL 2CGRH 3VGAB 4NRRA 4JFHE 5JW5B 4PJCB 3SCMB 1I8MA 4XP9L 1M05A 4MDJB 5K93A 2ICWJ 4G9FD 4OZFG 3U4EB 4Y1AE 2ZUMA 2OR9L 2FATH 1JK8A 1F4HA 3PZ9A 4K2UH 4P46B 4EXPX 5EBGA 2YD3A 2IANE 3M1BB 5GJSH 2VLJA 2VL4A 5ENWA 3BW9A 2F54B 4AZ5A 4O2FB 2LTQB 4MHHG 3UZVB 1MELA 2JJTA 3SE4A 3TH4T 5H8DA 3PWPD 4JHWL 3ARRA 2AXGA 3GNMH 1AO7D 3EZJB 2F18A 3BD4A 4NKDA 3RWGA 3TVMC 4WEMB 1I8IA 1MJ8L 1QI4A 4K7PX 2R0KL 4E41B 2VQ1A 2V2TA 1FH8A 5BRZD 2UY7A 1K4DA 3HE7C 2BFVL 1QFWM 1F58L 5GZND 3GXTA 1AKJB 1S7RA 5CP3A 1TG7A 4M6MH 2CXKA 1LP9B 1RSFA 3WXWH 4KY1L 2P1YA 4ZEPA 4Z77A 2FSEA 3HB3D 1KXTA 3BUPA 1SJEA 3MJ7B 1XGRB 4PRWA 2PWEA 1LNUA 3NABL 5GGUA 2TAAA 3GSRB 4ZAKB 3JV4B 4WUUB 1NAKH 2BOBB 2ZOKB 5I73B 1R7OA 4ZTPL 2VYRE 4PY8I 1IAIM 3WFCH 1A7RL 1RIVL 1MRCL 2G8ZA 3AAZA 1F2QA 4LQFH 3MRHB 3U1SL 1RJLA 4U6XB 1EMTH 1AJ7H 5C0AE 2C9AA 2X4QB 3OJDB 1U2HA 2MMXA 1CXFA 1U93A 1U6AL 2I07B 3LPOA 3GJEB 1FRGL 3F58H 3WDPP 1AHWC 3CZ8A 3QOMA 4J1UA 2XFFA 5I1IL 3IK2A 5DI8B 1YEHL 4L29B 4MDOA 1KCSL 5TH2B 1B0IA 1TNNA 2O5ZH 2ZIDA 4POZD 5C08D 3TN0D 2VXUH 2WUBL 4EUPB 2YD7A 5FO9A 5LCVH 1D5BA 4X7TA 3WF3A 3OGSA 3I9GH 1B3WA 3WF0A 5E9DB 4OCLC 3T65A 5DK0A 1QBBA 2HH0H 4KQ4L 3RNKA 5IHUL 5INDB 4UQ2A 4NOBA 5E99L 4LPUA 1MHEA 1Q8MA 5BO1L 2ITDA 3QCUL 3VGEA 2V5MA 5I23A 1FGNL 5JA9A 1Z0NA 3QUZB 1JGDA 2V17H 2GJXA 1XGUA 1QQDA 3UTSB 1KJVB 5D70L 3GMNB 4WSKA 4WKAA 3ZOAA 3WS3B 4YGVB 3N1QC 2R15A 1P4IH 2J7CA 3JUYA 4WHTB 4KUZH 3CH1B 4BH8A 2R69L 5J1AA 3F6IA 2D23A 1MIEL 1FCCA 2IAMC 2DQIL 1JV5B 1MH5B 4DCQB 3OA5A 1GGTA 4IISA 1QBML 1GYAA 3O3AB 4GAYB 3WL9A 1B3ZA 4UAOC 1MREL 1BSIA 1IGML 3UTTE 3U36B 2O9PA 4UINH 3BUQA 1GQJA 3NYDA 1UM4H 4ZYKA 1NFKA 1HKFA 2I9TB 4M1DH 4PJ9D 1ITBB 5JR1L 1EIBA 5T33H 2BS9A 3W29A 2VXSH 3X13A 1GVIA 3KJ6H 2GDUA 3SIMA 1JPTL 4JDTH 4PGBB 4P2QD 2CDEB 3D85A 1WIOA 2UUDK 1G6VK 2ADFL 4N0CC 4KXZI 1NGXB 3UJTH 1U3HB 4RAUA 3ZO0A 1ISVA 1BVKB 2CMRH 3TVMB 4HKZA 3EHBC 4KK5C 3DMMD 3HCVB 4GW4A 3AISA 1C08B 1EOMA 5LJYH 3DECA 1LQ0A 5SWSB 3QEHA 3HE7B 4YHOL 1HH6B 1KG0A 4V1DD 4NN5C 4XVJH 4NQCB 4X6FA 5BZDB 2RHEA 4Y2DD 2XWJB 1L7TL 1E6OL 3Q5OA 4PRID 4MCZA 1HXJA 1HCVA 1BZ7A 3DURB 4LDLB 1GAFL 3ARBD 3CXDL 2P5ED 2HVJB 4XP5L 3SKNA 2IPUK 5JPMA 1BVLB 4LHUB 4HPGA 1OF2B 3BWAB 3KPRD 1GZJA 1OM3L 2ZG1A 2DM4A 3KYOA 1OGTA 4L3EA 5HVWA 4TVPL 1NL0H 2CH8A 1BQHB 2XKNA 3O9WB 1CS6A 2GTZA 5FK9A 1BPLB 5J3HC 1YY8B 3SJVD 3QQ4B 5HJ3B 3MV8E 1OTSC 4BSWB 3C8KB 3WUWA 5D7IE 2C5DC 1I8KB 4HWBH 5CJXA 2NLJB 2X1PA 4QO1A 4GRLA 3P9MA 1WT5C 4PYGA 3K3QA 5E2TL 1RJCA 1S78D 2ESCA 2R1XB 2YDRA 4JREC 3RWFA 3DRTB 4IDLA 5ITFA 1I8LC 4JZOA 3VJ6A 1B9ZA 1G0YR 2ATKB 3X3GH 1F8TH 4KGLA 4P2CG 2IQ9L 4TVUA 2H1PH 4NJ9H 1OAQL 2ZOLA 4EQ3A 3BHBA 5FA3B 4D6DA 1FNFA 2EKSA 4UBDC 1KJ3L 3IB4A 5DK3A 3RPMA 1SJHB 2B4CL 3VFOA 5GRZA 3OR7A 3GMQB 3DV6B 4DN3H 5F1IA 4UUJB 3WQ4A 3HI5L 3QZWB 1NCWL 2VSCA 3WENA 1MQQA 3MRDA 3VWJC 4PEEA 1S7WB 4HIJA 3T8XA 3TJHC 4UTFA 1QLEL 5A6BD 4QXUH 2XQBL 4G6AD 4Y4HA 3BAEL 5DK2B 4M29A 1H3TA 4LVHC 4WHDA 4XP1H 3FOLB 1AIFA 3GI9L 3B9KD 1RK0B 4WRLA 2J8FA 5E2UL 1ISYA 4LF3A 1XR9A 2FLRT 1T3FB 4HZ6A 1JXJA 3QFJA 2WW5A 1RD6A 1QBLH 5T3ZD 3NSMA 4NP4H 4HIXL 2G5BB 1UZ8A 4YHZL 4JZJA 4X83A 5E8PB 3WFEL 7FABH 5F1NB 3OKMB 5HHMB 3FQWB 2GJZA 2UY6A 4GSDL 1OGAD 2HJKA 1CE6A 4P7QA 4KDVA 1E15A 4F7MA 2XA3A 2DQHH 5D2NB 4LLYA 3HE6A 2DSKA 5ISZA 2MHAB 1IGFH 2Q7NA 1PG7X 3UO1H 1U8OA 1T66C 3QDMA 8A3HA 3ECBA 4ZFFA 4LCIL 4PJAE 4JVWA 2PTVA 5CPSA 1SYVB 1XCTB 4IHOB 1HT6A 5FEBA 1EEUA 2H41A 3QP3A 3EYSH 4EJ1C 4JR9L 2F5AL 5EPMA 1RUPL 1UEMA 3BGAA 4G8EA 4TSAL 1EGZA 3THMH 1H9VA 3I3BA 3P4NB 4CVZB 2NPLX 3QGVA 3DLQR 3U0WL 1CLVA 3RIFF 2NX5A 2E4TA 5IHRA 5EFFA 3D18B 3KPQB 1J9YA 1CTOA 1C7TA 1IKNC 5KSAA 1UYQA 3ZKMD 4A6YH 2LAAA 2HFGL 5CJOH 2VWEE 4GBXC 4GW5B 4Z0BH 5GGVH 3E1F1 4YDVA 4LPCA 4UTAL 4K94C 1NGWB 1Z3GL 2FEEI 3WNPA 2X0HA 3BC9A 4LCWD 2NT0A 4KHXL 3DO3A 4S1DD 5EN2A 4MAVA 2CD0A 2C3HA 1Z0MA 9CGTA 3UEQA 3O45A 3KPNB 2PWFA 3C6LA 4RWYL 2BZDA 1RVFL 4ACYA 3UJIH 5JOFA 1DN0A 5E2VH 3REWA 3U57A 3RUGE 1ZHKB 2DIBA 4ACZB 4D0CA 4Y5VC 1G7MA 1A2YB 2YHGA 4U1JA 4PMNA 1A6AA 4YXKL 2HA1A 4RDQF 4PMDA 3G6JF 3IXTB 4OZFB 1PFCA 4ZOEA 4DW2H 2G3JA 4N8CL 4DQOL 5D2LA 3IGAB 2EKJA 3CFBB 5F7EH 3TT3L 1MW3A 4Y7EA 4HV8B 4O9HL 5A2LH 4D9LL 4UNVA 2BNQD 3ZHKA 3D39A 3SCSA 3RPIA 3BVXA 4L4VA 1EO8L 2BRRL 2FWOA 2E27L 3WFZA 2HKFH 3C5JA 2E3VA 3FT3B 4MXWL 1LEIB 3MMUA 4G8GE 1BQLH 4MD4B 5F96H 3AVEA 3G5VB 4JFZL 2WBGA 2YL5A 4HJ0D 4AD1A 2VIRA 1V05A 3NFPB 5HGHA 4QWWD 2KQNA 4JJ5A 1P69B 3OGOE 5IHBA 1U8JA 3KYKH 3QJHA 1W2VA 1QSEE 3L3DB 5A2IH 4H88H 4EZMA 4CNIA 2EECA 2QQLH 3TPKA 1PAMA 3D0VB 4P23D 1MCJA 1UD4A 3OX8A 5DTFA 5I19H 5IIEA 5EBAA 1NMBH 4IDJL 1NLDH 1YZZA 4U2ZA 1V3KA 2ID5A 1HXYB 1MW2A 4GQPH 2DQDH 5ANME 5LWYL 4I1NB 3CFJA 4JKKA 1P7HL 1QSFB 4NNYA 3MUY1 4UU9B 4PRDB 5E6IC 4HJGB 4LXFA 1CGTA 1OTUC 1A4KB 2YD2A 1X6LA 3EFFB 1WP6A 3IJYA 4N42A 4PJ8A 3I6LE 2DSWA 1R33A 4LVNB 4NQEB 4QHUB 1S46A 4Z0XA 4KRPD 1D5MA 4LIQH 1Z9MA 3QULB 3ZQ9A 3ALFA 1VEMA 2RIKA 4WFGE 4EI5A 4JCLA 3N18A 4JHAL 2MQ0A 1L9NA 1F3DJ 1WFUA 4GIAA 3MNZA 1VFAA 3MLTB 2BSSB 4GRMA 5DFTA 5GSRA 1WDQA 4KJWC 3FQNA 3FOMB 3GBML 4XVUC 2I25N 2MCPL 4P99A 4XBGB 4GMSL 1DWFM 4NO2B 4AEEA 2MQCA 3WIIH 4BK5A 5GS0H 5I18H 2X9YA 1XV8A 4YHKH 4QTIL 1EH9A 1M4KA 4OF0A 4RWHA 4X6EB 4L4OA 4PGEB 3V4UL 1WSST 4PRNB 4KPHL 2PI6A 3K0WA 5FYLE 2DLEA 1QNZH 2DKSA 3P0YH 3TFKD 3H9SA 3QUYA 4FQHB 5H94B 3MRFB 5EG6C 5TE7H 3GKWH 3JTTA 1JNHB 1TQWA 3MR9B 5FO7A 3SGKC 2CBVA 3ARTA 5BVJA 4MQXD 4KUCD 3IETB 5IB4A 5CSYA 2LU3A 1PPIA 4FNQA 4NC1C 3WY4A 2A2QT 1E55A 3FN0H 4YJZL 1DBJH 3EKCA 2W0PA 3BH9A 4CVXB