6CGTA

Hoxa complex of cyclodextrin glycosyltransferase mutant
Total Genus 221
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
221
sequence length
684
structure length
684
Chain Sequence
b'DPDTAVTNKQSFSTDVIYQVFTDRFLDGNPSNNPTGAAYDATCSNLKLYCGGDWQGLINKINDNYFSDLGVTALWISQPVENIFATINYSGVTNTAYHGYWARDFKKTNPYFGTMADFQNLITTAHAKGIKIVIDFAPNHTSPAMETDTSFAENGRLYDNGTLVGGYTNDTNGYFHHNGGSDFSSLENGIYKNTYDLADFNHNNATIDKYFKDAIKLWLDMGVDGIRVDAVKHMPLGWQKSWMSSIYAHKPVFTFGEWFLGSAASDADNTDFANKSGMSLLDFRFNSAVRNVFRDNTSNMYALDSMINSTATDYNQVNDQVTFIDNHDMDRFKTSAVNNRRLEQALAFTLTSRGVPAIYYGTEQYLTGNGDPDNRAKMPSFSKSTTAFNVISKLAPLRKSNPAIAYGSTQQRWINNDVYVYERKFGKSVAVVAVNRNLSTSASITGLSTSLPTGSYTDVLGGVLNGNNITSTNGSINNFTLAAGATAVWQYTTAETTPTIGHVGPVMGKPGNVVTIDGRGFGSTKGTVYFGTTAVTGAAITSWEDTQIKVTIPSVAAGNYAVKVAASGVNSNAYNNFTILTGDQVTVRFVVNNASTTLGQNLYLTGNVAELGNWSTGSTAIGPAFNQVIHQYPTWYYDVSVPAGKQLEFKFFKKNGSTITWESGSNHTFTTPASGTATVTVNWQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
publication title Substrate binding to a cyclodextrin glycosyltransferase and mutations increasing the gamma-cyclodextrin production.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
total genus 221
structure length 684
sequence length 684
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1998-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 6cgtA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 6cgtA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 6cgtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 6cgtA01
2LAGB 2R2BB 3OKKB 1QHOA 4OQ1A 5IVOA 1R3JB 1I8LC 4OGZA 1I9IH 1JYVA 4QCFA 4LPCA 5JHDB 3VXQB 1YUHA 3BQUC 4HJGA 1FP8A 4OOUA 4WUUE 2ENYA 5IW6A 3TN0B 4Y4FD 1SY6H 2X89A 4Z77A 5E9DD 3ULUF 3RX7A 2WW5A 3QO0A 3TJEL 2D20A 4OZOA 5D7JC 4WW2A 3IU4H 1NC2D 2JIXB 2F1AA 4WEMB 5MEOB 3JTSA 1KC5L 1MYRA 4Y4KB 1CLXA 2G41A 5JBDA 2MSPA 1ZHLA 1RZ7H 1GJUA 5DJ6A 2OS7A 3KJ4B 3W39B 1RUKH 2YPVL 4FQQB 2YL5A 3VPLA 4BA0A 2V9QA 1J9YA 4HIIA 4ODUA 1B88A 1FVCA 4WWKC 5E00A 3VFTA 1Q0YH 1A2YA 4G9DA 4PP2B 5I18H 4PRHB 2DM3A 5KAQG 4CMHC 1A7NL 3CZKA 3QIUB 4PRDA 3BUYA 4OV5B 2DS4A 2O92A 4CADA 1JPGA 2DQEL 2ARJQ 3FAWA 1IGCH 3GMPA 5A2FA 4X4XB 4DKEL 2XFXB 2PTTA 5C8JB 3QQNA 4XWOC 2AXFB 4JRXD 2WWMC 1KYOJ 3WF1A 3SQBA 3S5YA 4XCCH 3D25B 2C3VA 1M7IA 4XT1C 3M8OH 1JHTA 5D9SB 4U0QB 5I2IB 4EOWL 4PJ8B 4Y7MA 4KK9D 4YBHA 1AGEA 2G3NA 1ITCA 2BCKB 2Y1VA 4ZSOA 5F7HA 5HYFA 4JZOB 2A83B 2V3EA 4PJHF 3BPNC 2GJJA 1OP5K 3FKUS 4ZXBC 1K85A 3LQAC 2JB6A 1KFWA 3WH6A 1BFOA 5GS0D 1R3KA 5DURD 5J13B 3VWJD 4XMKL 5DK2A 1V03A 4YE4H 4XCYB 2V5SA 4R6UA 2Q86B 4R0LA 4IHOA 1DWIM 3SGKA 2ICWA 1PYWA 1I9JH 2G8ZA 3CFIC 3QPXL 5F8RC 1MVUB 3DX9A 3NAAH 4DO5A 1J5OH 1MH5A 2R2HB 5TF1L 3SPVB 2F5AL 3CSYA 4X9FA 3MRRB 4YK4B 3Q2CA 3LX9A 2AK1L 2PB1A 5D7SH 3UJIL 2C26A 4YDKH 1MWAH 2RFXB 1CFTB 4P46B 4OZGF 1XGUA 3HJEA 1GOGA 4U1MA 1HWWA 5I19H 2OWWA 4HIXL 2Y72A 2ZJSH 4XZWA 3AS1A 2YMXH 2OXHA 2CGRH 3WH5A 1XCQB 2FLRT 5FFLA 1H15A 3FJTA 2PXYD 4PRAB 5ABFA 4OCSH 4NQEB 4Q74A 3BLPX 2OSYA 1CICD 4NO0D 3SCMD 4LIQL 2Z31C 2H6PB 3CLEH 3RVWC 1FH5H 3GH4A 2WYSA 1VKXA 4R8WH 4TNVK 5KEZA 5DRWA 2XI9A 4TUOA 3ROLA 1E0XA 3KPRD 1T3FA 3BKCH 5KS9F 2KBGA 3RY6A 5E08L 1C16A 4HUWA 4ONGL 3I6KA 3T04D 1BYAA 5F7DA 2X4OB 4HS3A 5HPOA 3RY5A 3A47A 1RZFL 4OBRA 2YKKA 4HX1A 2YD4A 1H5BB 4P57B 1V3MA 4TTDD 3TCXA 1FVEB 4G8FB 3LKPA 2W91A 1WDSA 2XYCA 4KKLD 1EBPA 1P7QB 3DX4A 4PMOA 5I78A 4PJGF 3O3UN 5T1MA 2C5DC 1Z32X 4POZD 5C0GB 2VCBA 1QSZA 2F8VA 3OKKA 2R2BA 3OR6B 1R3JA 2ZCHH 4U49A 2YLAA 1TETL 2W66A 3BAYA 1X4YA 5JHDA 2NY4C 1MCEA 3VXQA 2VDKL 1KXQA 4JL2A 1XF4B 4Y8DC 3TN0A 5DD1L 2PYED 4AD5A 2NY6D 4TTUA 4KKAD 3QISA 3GYCA 2E3VA 4Y5YC 5DMJB 5D1XB 2JIXA 3NABL 5CAYB 4R4ND 2ICWI 5DEFB 1A1NB 1YMMD 1FIGH 4I3RL 3RWIB 1HZHH 3BO8B 2APVA 4JDZB 5HHXH 1LGVA 2QPSA 1DSFH 1E4XH 1RUPH 1R3IL 1I1YB 2FHBA 5EU7C 2F53E 3W39A 4M4RA 4FQQA 5I1KH 3MNWB 3H3BC 4LP4A 4MB3A 2VN4A 1MRDH 1FGVL 5I0DA 3H0TB 3RVUD 1ODAA 1S7XB 4PP2A 4FQIL 4PRHA 1NQ6A 4F7EB 3QIUA 4OV5A 4ZXOA 4UT6H 3GBNL 2R0WH 5C09E 4X4XA 4EAMA 2Z9TA 2ZCLL 2XFXA 1TQUA 2AXFA 4XVUC 5A2BA 2WM0A 2XPKA 3D25A 1F8TL 1LP9E 5HI3C 3RVVC 5D9SA 3WBEA 5I2IA 4TUKL 3QFJD 5HHME 3RWDB 4PJ8A 3BC9A 1NCWH 2WBJB 1W9UA 3KPSD 5EIVA 4PYSA 2AQ2A 2BCKA 2GUYA 4D6JA 2B7DT 4JZOA 1IKFH 2A83A 5HGDB 4ODHL 4S1DD 3K8LA 1J86A 1MFAL 5ID0B 5C0CD 5GRYA 1YQ2A 2PO6C 3MJ8B 4JGMA 1UWQA 1Q9WB 1A1MB 5SWSB 1KNOB 5D1QC 5DUPH 4IISA 4EIZC 2J7LA 3D51A 1QRNB 1NGPL 2AXHA 2WWKO 1H3GA 2Q86A 4XCYA 4OSUH 1IQDB 4JKWA 4P2OD 2QV4A 3VXPB 1RZJC 2J8UE 1UG6A 2EC9U 1HK6A 1S7TB 3OZOA 1GSMA 3DARA 2O9OA 4M1DH 1MVUA 2R2HA 2OTWB 4KPHL 3SPVA 3SQOL 3IFLL 3ZO9A 1A1OB 1IC1A 4YZFE 3HPLB 3MRRA 2EPKX 4P9HH 3SDAB 3RL2B 3M7SA 1C5CH 1QQDB 2RFXA 2KH2B 1CFTA 4P46A 1N6QH 1S46A 4B3KA 3WHE0 2YL9A 1LILA 1MRCL 4RDQF 3MUAA 3INUL 1IZKA 1XCQA 3GI9L 3AB0B 3SCPA 3O8XD 3BE1L 4L8CB 4KJPD 3RAJH 4FFYH 5EIIB 4DZ8B 3WN5C 3U30B 4FMVA 4NQEA 4XP4L 2B1AL 2GW5A 1JDAA 1CU4H 1CGUA 5CZVL 1JRHL 1ZBCA 2H6PA 5JOPD 3UBXB 3AICA 1YNKL 2YUXA 4MS8D 5GJSL 1INQB 1E6XM 1IGFL 4G6FB 1UM5L 4HJ0D 3VGGA 3L4WA 3KYMB 4AZGA 2X4OA 1N5YH 4CCCA 4AZ6A 1PX8A 1H5BA 4P57A 1FVEA 3JTTB 4G8FA 1V3KA 2NY2C 5EORH 5IQ7L 1Z9OA 4NQSB 1TVHB 2D3VA 2XQYG 3VW3L 1P7QA 3EDKA 3VIIA 2P8PB 1G7HB 1Z0MA 1FNFA 5C0GA 5EU6B 5I1IL 4I3SH 3BN9D 3ESUF 5BW7C 3OR6A 1AHWC 1EXPA 1W3LA 3N1AA 5I1JH 1JHLH 1NGZB 4WO4B 2F5BH 3EYUH 5DJYB 1XF4A 4LDEB 1WPCA 1NUDA 4V27A 4FQHB 5EU3B 5KVEH 2XN9E 1RHHB 1E6OH 4HK0B 5JBEA 5D1XA 2PETA 5A40E 5IFTA 1KCVL 5DEFA 3CVHH 1A1NA 3L1OH 4TVPD 3RWIA 3FB8B 3BPLB 3MRKB 1CGTA 2H26B 4JDZA 4MDJB 1DBBH 3NIGE 4NBYB 1UR0A 4RWHA 4GRWH 1FE8H 1UC6A 4I2XB 1CDGA 3K1DA 1KLGB 5AC4A 3MNWA 4PCSA 3VI3E 1D6VH 5AYUL 3H0TA 1VHPA 1S7XA 3MLZL 3U7YH 3VD5A 1H49A 4EZMA 4F7EA 4C59B 1SMOA 1OTUD 3MZGB 1L7IL 3SDXE 1KB3A 3PGCB 4GPNA 4IRSC 3OB0K 4HGKC 5C7XL 3AZTA 1WDRA 4QRRE 4DJMA 2AJSL 5D7IE 1F13A 4KMQA 1AKJB 1CXIA 4E8CA 4JKMA 5TE6L 2J7GA 4UMGA 3TYFB 3OIHA 1NFKA 5M3WA 2EDQA 1HINL 3K7UA 1HKMA 3RWDA 2WBJA 1UM6L 3WKZA 4A4AA 3FFCE 5HGDA 1CF8L 2EYRB 3IXTB 3L9RB 1CWVA 1FZOB 2CKBB 3MJ8A 1H2JA 3TJEH 5FOOA 1EH9A 3O6KH 3WIHL 3CUPB 4YPJA 1A1MA 5SWSA 1KNOA 3OGCB 4GAYA 3MUIA 5E4EB 1QRNA 5LXGH 3LS5L 1KC5H 1YEJL 4X83A 1I3GL 3W11C 4PJCE 5LA1A 2EDNA 2FRGP 2W60B 1BIHA 1JBJA 5I23A 4NJ9L 1IQDA 2X89D 5E99L 1OOAA 4JO4L 5C6TL 5HXMA 5C0JB 3VXPA 5BV7B 1LG1A 1WAAA 1S7TA 3ULUC 1T2QL 1S7WB 2D73A 5BO1L 3QSKB 4BQ9A 2OTWA 3O4OC 1FIEA 5JUVA 1A7NH 1A1OA 4HA3A 4YZFF 3HPLA 5AAMA 3HFML 5D8JH 2DQEH 3SDAA 1QQDA 3S88L 5GNYA 4DKEH 5D9NA 1RI8A 4BSVB 3GSQB 3DVNB 1QPPA 3MRQB 1Q4NX 4NFDA 3PV7A 4UCFA 3BD5A 4JM2C 3HMCA 1WQVT 5TE4L 4EOWH 1E6SM 5L6YL 1UEMA 4MMZC 4XXCA 3JWOC 4EE9A 3QHTC 5EIIA 3L3KB 2VLKE 4DZ8A 2XTKA 1FNGB 3A0OA 3C9NB 1W0VB 1GZPB 1UD2A 2HT3D 1U30A 5L8KB 3GH7A 1UR8A 3UBXA 1A9BB 2WMFA 1WIOA 4PJEB 2X1IA 2DEPA 2BVTA 1INQA 1DBKL 5ECUA 5C07B 1X5IA 3KYMA 5ISZB 3PZVA 3HN3A 3RZCC 2FBJL 4NZTL 4PIRF 4MNGE 4A6YB 1A3HA 2IGFL 3JTTA 4P59L 2BXYA 3QPXH 1NCAL 4NQSA 1TVHA 2P8PA 1G7HA 2F5AH 5EU6A 1F42A 5J06A 3KXFA 4J4PC 4S1QL 1MJ7L 3D2UB 4IMKC 3B3IB 4YGVB 3UJIH 1Q6FA 5T3XE 1I75A 4HBCL 2VE6B 4HKJA 1Q6DA 1NGZA 4WO4A 2Y06L 1BM3L 3SUUA 5DJYA 3K74B 1A7RL 3VGEA 1W9VA 4FQHA 5EU3A 3PHSA 5FYJD 5GSVB 1RHHA 3AS2A 3LHPL 4HK0A 2VXTL 4TULL 4HSQA 2HMIC 4M7ZC 4U5KA 2I27N 2AKRB 1OP9A 2A3EA 5A8OA 3FB8A 3MRKA 2H26A 3QUYB 5HYSB 3RGVB 3NIGF 3V4UL 2TAAA 4LIQH 4I2XA 3REVB 1D3CA 3PE9A 1D9KD 1KLGA 4IOIB 3UTQB 2OJEB 4WJ5B 3VWKC 4H0IA 5FECB 3F58L 1UWEL 1I8IB 4PLKC 2WC7A 5E08H 4BYHA 1M4KA 2V7NB 1LK3L 3SDXF 5GRUL 1RZFH 3PGCA 3U0WL 3VGAC 1OTTC 3QA3B 5GRZA 5DQJB 4S0TD 2XVGA 2ICES 4CU8A 3B9KB 3QH3B 2V5DA 2ZUNA 3KZSA 3OX8B 3PHQB 5D7IF 1RFDH 1H9VA 1QFUH 2R0KL 1WICA 1EDTA 4OM0L 7FABL 2XOTA 1KV3A 1K3IA 1XR8B 4M00A 3UBXI 1TETH 5CJ5A 1YEGL 1IC5L 5I71B 2EYRA 2VDKH 3L9RA 1MHPL 3WBAA 2J5LB 1FZOA 5DD1H 4ETQB 2CKBA 1BVNP 2HVMA 3CUPA 3RUGB 3UG4A 1JRHI 1X5FA 5MEPB 3MODL 3NABH 4DQOL 1IC4L 4G80A 4PJCF 1N64L 5JHDD 3I50L 2W60A 1PZUB 1I7RA 5SX4I 1HILB 5F3HB 1JZ5A 4UFIA 5IP4A 4UTBL 1E0OB 3MXWH 1RURH 1S7WA 4XRCB 1FGVH 5B39B 4F7CB 4GRWF 4PY7A 4FQIH 4C7FA 1EERB 3UYRL 1ZT1B 1I3RA 4C54A 3CUJA 4I4WB 1JGUL 3T2NH 3GBNH 4G7YL 2ZCLH 3ILQD 5MI0B 4UV4H 3DDGA 1A3QA 5HYJB 3I3BA 5IVXE 4BSVA 4GOSA 3GSQA 3DVNA 3MRQA 4D9QD 4PRHD 1CLYH 2EDWA 2CBUA 4HMEA 1ISYA 3O41B 4ZUSB 2PWFA 3MREB 1JFXA 3L3KA 3SCTA 1FNGA 3V7MA 3C9NA 1W0VA 1GZPA 4ODHH 1MFAH 3BVVA 5JTWA 3D3AA 4XAWH 4XAKE 4MXQD 3S2CA 4FNLL 2EADA 1A9BA 5JIIA 4CKQA 4PJEA 3QPQC 1NGPH 2JK5B 4JFSA 1LG2A 4K3JL 4JZNB 3IKCB 3KL5A 4NUJB 2APTA 5LYRA 1I1RA 2BNQE 2GYSA 5C07A 2C8NA 2DDQL 5E8OB 4OTXL 5ISZA 3EJYD 2ITCB 3QQ9D 1TZIB 4A6YA 5FCZA 1NMCC 3LXAA 3RILA 5BROA 3VFRB 5DJCB 4QRQB 1LQ0A 3ARDC 1MUJB 3FB6B 1KCRH 4KPHH 4W4NA 5ELIA 3G5VB 2D9QB 1OWRM 1P7HL 3D2UA 1UD5A 3B3IA 1MCKA 4MLIA 1QNRA 1SJHB 3IKKA 1BREA 3ZE2E 2VE6A 4G6AD 3D3VE 4XPFL 1KJVB 1EAPB 1HDMB 4N68A 3TBYB 3V8CA 4G9FA 1F11B 3LD8C 3INUH 4YDIL 5GSVA 1KGXA 2Z1KA 3SDDC 1B2WL 1OP5H 3BE1H 1MY7A 2NW0A 2AKRA 1UQYA 4P46D 2XQYK 4XP4H 2B1AH 5HYSA 3RGVA 2W4XA 4UAOB 5CZVH 3HUJF 4I0CC 3WFEL 4HIEB 3REVA 1GC1L 4IOIA 3UTQA 2OJEA 1YNKH 3MGTB 4WJ5A 1EHAA 1V6UA 3AMCA 1U8MB 2DIBA 3BQUB 5GJSH 1JF1B 1CDBA 3AY4A 4IRJC 5K9JH 1IGFH 3WS6C 4UQ9A 1I8IA 3L3HB 4NQED 3T0EE 3U0PB 2V7NA 4NC2B 3EOTH 2HJFB 3QI9C 2D24A 2JJSC 2EICA 4UI2A 5DQJA 5EWIL 3QH3A 3AIRA 5IQ7H 3OX8A 5A3ID 3PHQA 3CVIL 2E9WA 2D7MA 3VW3H 2NW3B 1SQ2N 4LKCB 3UTTB 1NOFA 3JVGA 5I1IH 1HH9B 4F37F 4MNMA 3DYPA 1I85C 1XR8A 3K81A 2XZZA 1MLCB 1ZMYA 5IF0B 4Z7UF 4AG4L 5ABGA 2H32H 4L4TE 5F70A 4JDVB 4ETQA 1NAML 1OARL 1U93B 2Y4SA 3RUGA 4MQSB 4XZUB 5MEPA 5F1IB 2AJUL 1KCVH 4H2CA 3QUKB 1AH1A 1KTRL 1QLFB 3EOBB 2DQJH 2QHRL 1HILA 5F3HA 2E8ZA 4WLCA 1K9EA 1JJUA 5KSBF 3V6OE 5AYUH 3MJ9H 4XRCA 5B39A 4YHNB 4FNQA 3VIFA 4F7CA 1JNHB 2E7LA 2DQFB 2RGLA 5FYLD 2AEIT 4NM8L 1MNUH 1ZT1A 1T03H 1L7IH 3WY1A 4I4WA 1DUYA 4AD0A 2X4TB 3SE3C 4ZFMA 5C7XH 5KANI 1DQDL 1F00I 2HTLC 5HYJA 1G1YA 1MCBA 4XZBA 4NWUL 5IVXF 4FLQA 3Q3GB 5TE6H 3MANA 3LKSB 4ODVH 4V1DB 1HINH 4U3CA 4LSPL 5IMMB 2GEEA 4O51B 4B50A 3O41A 1KTBA 1GOHA 3MREA 2VUYA 3VFSB 4UFJA 2DD8H 1WIPA 4CKVX 1CGVA 1KGUA 3Q5TA 1OQXA 4U6VL 3WIHH 2F54B 5AZEL 3TFKC 5CD3B 2JK5A 2WBJD 3LS5H 1YEJH 3H53A 1I3GH 4JZNA 1MCPL 3IKCA 4YFLF 4NUJA 2OL3L 5TPWL 3S36X 1LNUA 1XR9B 3EJZC 5E8OA 1KELL 4NJ9H 2H2SD 1EFQA 1BGGA 2ITCA 4JO4H 5C6TH 5I8OH 3ARGC 1XEDA 1TZIA 3T1WA 3MSGA 1T2QH 4LSVH 3VFRA 3UERA 5DJCA 4QRQA 4AH2B 1L0PA 3W9DB 5BO1H 1MUJA 5DVLA 1CFQB 3FB6A 5DC0A 1CGWA 3LH2L 3G5VA 2H2PD 2HVKB 3C5SB 4MYWB 1FL3B 3QJFB 1SJHA 3S88H 3SUWA 3LEXB 1RIUL 3VG9C 2OQJB 3ZE2F 4I8DA 1KJVA 5M5DA 1EAPA 1HDMA 1H0GA 3TBYA 1AR2A 1DQTA 3V95A 1KQZA 1F11A 3MOQA 3WF3A 3A22A 2FJHB 4RMWA 1F6AB 5TE4H 3V79C 3LMYA 3SDAD 3OZPA 3BSHA 5L6YH 2YPLB 4LF3B 1MQQA 4X6CE 1ZBVA 4XNUL 4RWYH 2XFRA 4PY8I 4HIEA 3RKDC 1RZIB 3MGTA 2NY4B 4RGMC 4LLQB 1U8MA 3BQUA 5DJDB 3SJVB 1JF1A 2IBZX 2YL6A 3O3BB 4EK7A 5L88L 3N04A 3CZJA 3L3HA 3U0PA 5IB5B 5C0BE 3R8BB 2XRAH 1RJYB 2HJFA 3V0AC 2H8PB 3MQIA 4NZTH 2VR4A 2Z8SA 4N1EA 3PHOB 4F8XA 4AJ0A 4JHWL 1N7ML 1WWWX 1T04B 5CJBA 1EXUB 2W59A 3Q1SL 4G6FD 4UT9L 2NW3A 4OZFH 4LKCA 5EULV 5SV4A 3UTTA 1HH9A 1KG0B 4N1CA 4S1QH 1MJ7H 3RVXD 5M95B 4JY6B 1VRXA 4GO6B 4HBCH 5IF0A 3UPCA 1B3VA 1WUNT 1BM3H 4YXLL 5E2WL 4W87A 3DMMC 3DSNA 1JDCA 3S37X 3R1GL 1U93A 4YLQT 4LLVB 2GK2A 5EU6D 4PGJA 4LVNB 4ONOA 4QCEA 3LHPH 5A3HA 1NPUA 1XGQB 2VXTH 3KXFD 4M93C 4P49A 1CDUA 4XZUA 5HHOB 5F1IA 2BFVH 3W27A 1K6QL 3BYTA 4KKNA 4MZ3A 5FKPA 4U3HA 1HH6B 2JKXA 3QUKA 5L8JB 4KJYB 5JW4R 2QQKL 1ZVYA 1QLFA 4NWTH 2ALWA 3EOBA 5TQ0L 3V4UH 5IUSA 4WV1C 3IK2A 2DQTL 1KTKE 1WWBX 4C4KT 1FAIL 1CLZL 2AAAA 3FQWB 3ORJA 4YHNA 1VGKA 3VNYA 4OKDA 2PO6B 1JNHA 3BW9B 3F58H 35C8L 4AY0A 2DQFA 1QWUA 2ZUUA 1EOKA 4G8GE 5GRUH 4NSKB 2X4TA 3RJYA 3ZYJA 5D2NB 5I2UA 5M94B 2NY5L 3AI0A 4Z0XB 3OV6A 4X7SH 2R0KH 1A7BA 2QSQA 2ZUQB 1HL8A 1BZ9B 4V1DA 7FABH 4L4OA 4U1KB 4O51A 3IDXH 2A73B 4TSBL 3VFSA 3OA5A 1YEGH 4ZO9A 4ZFGL 1IC5H 4ZTPL 1RJLB 3ECBB 3F7RA 5FDWB 2VDOL 1MHPH 2D7PA 2F54A 4PGZA 1KB5B 1GRWA 1R8LA 1XCTA 2F18A 1JP5A 4U7SA 3MODH 5CD3A 5E9AA 1GORA 2VX7A 4F79A 4DK6A 1IC4H 1OWWA 4HUUB 4YHML 3WJJA 3I50H 1XR9A 3TGXA 1NBZB 2VLJE 2KQNA 1KPUB 2FX7L 4JFDB 4UTBH 4KI5E 4AZ8A 4TNVF 3WN5B 4HCRA 4IIQC 4KJWD 1L0YA 3OB0H 3RNQB 3S5LG 5L2JB 4AH2A 3W9DA 1NGQL 1YC7A 1CFQA 4PP1C 5D6DC 5I6SA 3VOCA 3ARBC 2HVKA 4JFFB 1FL3A 4HZAA 1JGUH 3QJFA 2W38A 3TOPA 5C0FB 4G7YH 5E9DE 3LEXA 2OQJA 5SWZB 2FR4B 2XHYA 1EMTL 1TPXB 1EDQA 4MD5B 3EGSB 2WXDM 2LTQC 5AG8A 2FJHA 1F6AA 3ZLQC 3GEWB 2UZXB 2YPLA 4LF3A 4ZQKB 2J7CA 1GQIA 2YEZB 1HSBB 4UNUA 1G0XA 3A6CL 3GFUA 2XG4A 3KYKH 4OF6A 1ZHKB 4DM1A 1AHWB 3V4VL 4OCNC 4FNLH 1RZIA 2DKMA 1MFDH 3C5ZB 4LLQA 5MHSD 5DJDA 2CUHA 4K3JH 3WLWD 3O3BA 4OD2B 5KANG 4O02L 3TIDB 3O45B 2DDQH 4IOFC 2MKLC 2YD5A 3ZMRA 4OTXH 5C0NC 5IB5A 2FECL 4JRXE 1RJYA 4JFVA 4OF8A 5BCAA 5LJYH 3L7EB 2H8PA 4YXKL 4J1UA 3QUXC 5HYSG 1T04A 4QRUB 1EXUA 4IPNB 1HHKB 3RIAK 5C07D 4FABL 1EGJA 3NZHL 2EEDA 5I15L 5ISZD 1KG0A 1YN7B 4JY6A 3DETC 5E6YA 4XPFH 4FLOA 1EHLL 4JVWA 5EB9A 5D96B 2WW8A 2DBLL 4IRSB 4X9GA 4LLVA 4YDIH 2HTKC 1B2WH 3MV11 1XGQA 5HHOA 3D2UD 5C9KA 1C5BH 3MU7A 4ZOBA 3UR8A 4I0PC 5GGVY 1HH6A 5EA0L 4KJYA 1IAKB 2X09A 3FQUB 2V9RA 4NC1C 1N2RA 4G9FD 1GC1H 3O3DB 4W68A 3FQWA 1CWYA 1IE5A 2PO6A 3BW9A 3SO5A 5JZ7D 3RTQC 1L6XA 1GGIL 2XZCL 4OIFA 3RGVD 3ARPA 5JW4Q 4M8QB 2X10A 4NSKA 4RE4A 1BAFH 2B1HL 5D2NA 2PWDA 4WEBL 3KPTA 5EWIH 1ZBWA 2BNRB 3CVIH 4Z0XA 4R5EA 1BZ9A 4RAVB 2YXMA 5B39G 4TVSa 5CXPA 4JB9L 2WUCL 4ZFFB 2A73A 1BFTA 3WD3A 3CHFA 5HGGS 5T1LB 4DUVA 1RJLA 3ECBA 2JALA 4I13B 4BFBD 2FWOB 4NX0A 1NAMH 1C93A 3KPRE 3J7HA 1KB5A 1I1AB 3BP5B 1VFFA 1FFOB 2IAMC 4XTRD 1JF5A 4HUUA 3H3PL 1WZMA 1UZ8A 1H3VA 4JM2B 2APBA 3CDCA 1NBZA 4M03A 4YHLL 3KR3L 4N0FB 4R4FL 1KPUA 2CPCA 4JFDA 4WTWA 2DN7A 3WN5A 4EI6B 2CIKB 5L2JA 3DUHA 3RNQA 4M1RA 4AEIL 2EPLX 4FQLL 2X1WL 2OZ4A 4LSTH 4NM8H 4KI1A 4OI7A 4JFFA 5ACLA 1LDPH 4JREB 5C0FA 2PYEE 2GCYB 5SWZA 2FR4A 5GGSA 1N82A 1LDSA 4JAMB 5ETUB 4E9LA 4NWUH 4MD5A 3EGSA 5JQ6L 1XF2B 1YMME 4X6DE 4K7PX 4JPIB 4LSPH 5LWYL 1W72L 3GTNA 1LO4H 2NY0D 3R06B 1MELA 2G75B 4ZQKA 2ADJB 5ALBL 3KS0H 5F7LB 5GZNC 3ZQ9A 2YEZA 1HSBA 3GSNH 4RSVA 1NKOA 4Z7WB 1CVSC 1UGNA 1ZHKA 5BW7A 1UEYA 1AHWA 3DRTB 5AZEH 2W9LA 2F8QA 3OWEA 3C5ZA 1FYTD 4LSSL 2ZIDA 3CC5B 3ULSB 1YYLH 4FF5A 5CSZB 4OD2A 4U2ZA 4L8SB 2HT4D 2OL3H 3W6LA 5TPWH 3TIDA 3FTGB 3O45A 1KELH 4OT1H 4XNYH 1B1YA 3L7EA 3MOAL 4LOUC 1QYGH 2NXZB 2WIMA 2VZOA 3EYSH 3VA2C 4HZ8A 3CZSA 4QRUA 1MFUA 3M17B 3E8UL 3QFJE 1HHKA 1NP0A 3KPSE 5CMAB 2WIIB 2XACC 5F9WC 3LH2H 1SMAA 2J62A 4OCLC 3VWKB 2A3HA 1YN7A 2NLJB 5C0CE 1MFVA 4GI8A 4FOMA 1RIUH 3B9AA 1GPOL 1IGML 4K7FB 4UNTA 4MXWL 4DCQB 3U83A 4AYGA 2EZ0C 4HFUL 4KHXL 1KGWA 4JFTA 4B9ZA 4GKZA 1PIFA 2NY3C 5DVOA 4HD9A 4PBVC 3JUZA 1IAKA 1KIRB 5KAQF 5I74C 4GRLC 5HOSA 3FQUA 3HRZB 1GZJA 4HUMB 2VX4A 2P5EB 2DLHA 4QO1A 3MV8B 4NRRA 1UJTA 2NYYD 5GRWA 2CHOA 1UH3A 1CVRA 3WFLA 4F15C 3O9NA 3MSPA 4XNQB 1QEWB 3MTRA 4ZS6C 1DN0B 2DLTA 5EUOF 4M8QA 5AUMB 2DQDL 2G5RA 3SCNA 4N0CD 4XI5C 1VGEH 2GI7A 3BUDA 3HZVB 4JHWH 3U57A 4UBDC 3WHXB 1DP0A 2BNRA 4W70A 3DX7B 1WAWA 2FNBA 5BRQA 3CMGA 4N0YL 1A64A 3BAWA 3AHZA 2VLLB 4WUUB 5GISL 2M2DA 4RAVA 3LXCA 1IM9B 3T0EC 4ZFFA 4Q9RH 4P3CL 2I9LB 5E09A 1F45A 5I66B 1T66C 2WWKT 5T1LA 5JOPE 3P9WB 1FHDA 3T77B 1F58L 4XNXL 5E2WH 4GINA 1UKQA 4J8RB 3POHA 4JZJB 3BUQA 2Q7YB 2FWOA 4WEUD 4LGSB 2JLLA 3R1GH 3UTTD 1LLOA 4GQPH 1I1AA 3L3OB 3BP5A 1XYFA 4WJXA 5DD5L 1FFOA 4L29B 1EO5A 3IAQA 1H09A 1K6QH 4PRBB 1PBYA 4PJ5B 4Q9BA 2QQKH 4JM2A 1CFBA 5TQ0H 4DWSC 3V0WH 4N0FA 2DQTH 4Z7NE 1P7KB 3QXDB 4MSWB 4Q2ZB 5HHQB 4EI6A 1FAIH 2CIKA 4KJQC 3CTTA 5JXAL 3WFCH 3H9HB 7A3HA 4L3EB 1ZGLP 2YD6A 1OGAB 5CSBA 4JG1L 5LGKA 1J18A 1Q9LB 3UYOD 4E42B 3TCLA 4HWUA 2GCYA 2R0LL 2JF6A 4AZBA 2C1PB 4YGAB 1NLBL 2WKGA 2NY5H 4JAMA 5ETUA 4H1LB 2DI9A 4TVPE 3LRGA 4OIIL 1XF2A 2IMNA 3V6OC 3KS0J 1D5MB 2NNAB 4MNLA 4XP1L 4JPIA 4X6DF 1NMCB 1S5IL 4X7FC 3CX5K 1RULL 4RGNB 1NCBL 3R06A 1V6VA 2G75A 5JA8B 2ADJA 3RJQB 2R1WB 4ZFGH 5D9OA 5IBTL 4HXAL 2VDOH 3SDCC 3N9KA 3WDRA 1S9WB 4Z7WA 1ISXA 4NM4L 3HB3D 3DRTA 4QHKJ 4QHLB 4V1DD 1WK0A 3ULSA 5CSZA 2BC4B 3FT4B 1OW0C 4L8SA 2W07A 1AO7B 3GB7B 3SDDB 2H1PL 5DD0L 1CENA 3U7WL 2GY7B 2F54D 2FX7H 1BF2A 2EJ1A 3WNNA 4ISVB 3M17A 4ZO8A 1NGQH 4Q9CA 3MI6A 1AGDB 5CMAA 2XFFA 2WIIA 1QFOA 2QQQA 3VWKA 2CNCA 3SE9L 2NLJA 3ARVA 1V6YA 3OJDB 1WFTA 1JAEA 4JLRB 2D1ZA 5E2JA 5EOTB 1EMTH 3GRWL 1XGRB 4WWID 3MBEB 2C4XA 2CESA 2IXVA 5CFHA 4OFYA 2BOBB 2F7OA 4H88H 4ONHB 4S3JA 1PEZA 2FE0A 1KIRA 2VDPL 3HRZA 1YEKL 1EVTC 4CCDA 4K68A 1JFQL 5BXSA 1TJHL 4LYPA 2CPUA 1BQUA 5T33L 3LPPA 3TYGL 3E6HB 1CECA 2YPLD 4IMLB 1WBXB 1BF8A 4W6XB 4FXKB 3JSSA 4N90D 3STBA 3TNNB 1QEWA 1DN0A 1V3JA 4N5ED 3T8XB 5AUMA 1B90A 1NCNA 4MX7B 4WY7L 4YXKH 4P4KC 4D9RD 4H8WH 3HZVA 3GHEH 3WHXA 2DQCL 2HKFL 3DX7A 3T4YB 3GXTA 1UWXH 3C6LA 1OGSA 2VLLA 3L3DB 4WUUA 3NZHH 1U8LB 2Y6SC 2YWYA 3JZ7A 1IM9A 3LEYL 1MJJB 2JE8A 2I9LA 5I66A 1X9QA 5E7FA 4H8HA 1H3PL 3T77A 2NZIA 1TQCC 3VRLF 1EHLH 1HNYA 4J8RA 2YK1L 4JZJA 2Q7YA 5ITFB 1KJ2B 2DBLH 5I8CB 4K8RC 5I1LA 1WC7B 2X1QA 3L3OA 4L29A 3MMUA 4OQTL 5T3ZH 3OF6A 4HMCA 4AD1A 3V2AR 4PRBA 3DYOA 4JFZL 4PJ5A 3T65A 1CFNB 2X8RA 4OF5A 2YUVA 3UC0H 4LSRL 1P7KA 3QXDA 2R9HD 4MSWA 4Q2ZA 2KPNA 4Z7NF 5HHQA 5A8PA 3QXUA 5J4MA 1M7DB 5C09B 1H3WM 5GPRA 3H9HA 4L3EA 3X12B 5KSAC 4LFHD 5JPNA 5LCVL 1OGAA 4HH9B 5KOVC 3VFOB 3KE0A 4XPAH 3TBSB 5BWFA 1N5AB 1F97A 1Q9LA 1LP9B 4E42A 2EH8L 3I3DA 2B1HH 1Q38A 2ESCA 4HV8B 2C1PA 3BP6B 4WEBH 1R5WB 5FYJE 5HHMB 3AISA 4MLSA 5JBFA 1UXWB 3MR9B 4YEFA 4OFIA 4HA1A 3KYOB 4W5ZA 1D5MA 2A6DB 2NNAA 3DOSA 4NRXB 3P4NB 4Q6YA 2WUCH 1JD7A 2R1WA 6TAAA 5HYQB 1CD9B 1A6ZB 1S9WA 3HLAB 3QIWC 3QAZC 3FB7B 4H0HB 4F8TA 4M7KH 4KUCD 4QHLA 3OAZK 3VG9B 3VXUE 4M6ML 2J8UB 2VNCA 3C60B 4P3DB 5KOMC 3FT4A 2OW6A 1QFHA 3H3PH 1Q9OB 1AO7A 3CSBA 3GMQB 3GB7A 2D0GA 3KR3H 4PB0L 1QNZL 1UWGL 1WVZA 5F93C 4NQCB 4JJ5B 4UZUA 4ISVA 1CK0L 4OFKA 1E27A 1T7YA 1BGAA 1UA7A 3MCKB 1AGDA 3OKOA 4FQLH 5CSGA 4N8PA 2PWEA 2XXCB 3N1PC 2ARWA 3OJDA 4JFDD 4JLRA 1VPOH 4K94C 1ZHBB 1QG3A 4Z0BL 3UG5A 5ADPL 5EOTA 1UQZA 4W8BA 1MRFL 1XGRA 4KI5C 4WHTA 5ERWB 4Q7DA 2YUZA 4FNRA 5JQ6H 3MBEA 4G42B 1LL7A 1TTUA 4QRTB 5JHDE 1KXQE 2BOBA 4JFFD 4ZFOB 3WDIA 1J01A 5LWYH 3SUTA 5F6IB 4Z95L 4ONHA 5ALBH 2V2WB 4JRWA 4LEXL 4P5TB 1I1XA 4WW2F 4Y4FC 3DXAB 3SY0B 3HI5L 2Z93B 4J3XA 4NKIL 2IPTL 3IJ9A 1M7XA 1K9FA 4CD5A 1BMGA 2VT0A 3CMOL 1EQCA 4LSSH 4XNMB 3VSUA 1S9VB 1U9KA 2O5XL 3E6HA 2IXUA 4IMLA 1G7LB 1WBXA 3BKML 1XGZA 4AM0B 4FXKA 5D71L 3TNNA 3T8XA 3MOAH 4MX7A 5DLML 1TXKA 3KHOA 4D9QE 4PRHE 4AMWA 3AMKA 3B2UD 3C5ZD 4IS6B 3T4YA 4QLRA 5T1KB 3EJRA 5FF6B 4H8VA 3BH8B 3L3DA 2W5FA 1MJJA 2XN9B 1C8QA 4LSUL 5EBMA 1GPOH 15C8L 1IGMH 1U8OB 3PWUB 4MNQB 4MXWH 1UASA 5ITFA 1KJ2A 2X42A 3SE3A 5I8CA 4QXGH 4UR9A 1WC7A 4HFUH 1HNFA 5JHLH 4GLRI 4KK9C 4J3UA 4WI4A 3VILA 5E0FA 1T1ZB 1FZJB 3MLVL 2DSWA 5D9MA 4OCYL 2W63A 4MNJA 3N15A 5IR1B 5IMKB 1HVXA 5GS0C 2Z35B 1M7DA 5C09A 4A2MA 1FJ1B 3VWJC 2HVJB 4AD4A 4QRRB 3X12A 2DT1A 4HH9A 1U8NB 3VFOA 1RMFL 4R97C 7TAAA 1N5AA 1KLUB 3E0GA 5DT7A 1LP9A 1KFAL 4ONFL 1IBGH 2RGMA 2O5YL 4J3WA 4AC1X 2E7BA 1T80A 1RUQL 4HV8A 1PJ9A 3BP6A 1NH6A 1QZ1A 1R5WA 3KNBB 1JXKA 3GUTB 2EDOA 4GKNB 1PG7W 1UXWA 1E43A 3ZE1E 4PRWA 4K3DL 4NZRH 3UZQA 3MR9A 3WJLA 3KYOA 4LCIL 2A6DA 3V9FA 4IIQB 4NRXA 1DBMH 3C2AL 5A8NA 3FRPA 3P4NA 4P3CH 4KXZI 1AFVH 1JNLH 3QOKA 3N1MC 5HYQA 3NN8B 5FYLH 2GJRA 4XNXH 1A6ZA 4HC1A 5TDPB 3OGVA 1R3LB 4PD4K 3TTYA 1SHMA 1P6WA 5B3JF 5I1CH 2Y9RT 5DD5H 2J8UA 3C60A 4UV7L 1MF2L 1K8DB 3K1KC 3WS3B 1Q9OA 2UY5A 1CICC 1J8KA 3GMQA 3DHMA 1Q0XL 3O2DA 2J7HA 1QVOB 3SCMC 3PBGA 4WHCA 4NQCA 1KOAA 4JJ5A 2Y23A 4NKOB 1D5IL 4M56A 1I1AD 1NMBL 4AYFA 3MRDB 2GKIA 4YBQD 5KSUB 3U6RB 3P9LB 1US2A 3MCKA 3HE7C 3QZWB 1JGDB 2BVQB 1ISVA 4JG1H 4AY1A 4JM2D 3U4BL 1SEQH 1S8DB 4FFWD 2VDRL 4TTDC 4D6FA 4P7QA 2R0LH 1P9MA 1ZHBA 1E5JA 4NN5C 4KKLC 4GXPA 1O0VA 1WLHA 4M6NL 2FSEA 4OB5L 4XCFL 5ERWA 4POZC 1JGLH 4G42A 4OIIH 1OPGL 4PJBA 4QNPE 1H41A 3LPGA 4QRTA 3U4AA 4ZFOA 4FFVD 1S5IH 1RULH 2LAAA 1NCBH 2D3NA 2V2WA 3KJ6L 3ZTJH 4P5TA 5IBTH 5B3NA 3A4WA 2FEEL 3DXAA 2NY6C 3SY0A 5F9OL 4KKAC 2Z93A 3F7VB 2AMGA 4BQ6A 1Q6GA 1TR1A 3CZGA 1JGIA 4R4NC 1QBLL 4LU5L 1KJMB 1EEUA 4XNMA 3BDBA 1S9VA 1G7LA 2DQHL 2OWXA 2B0SL 4AM0A 3VFPB 1X6LA 1HHHB 3GM0A 4R4BB 1CR9L 4X9HA 2H1PH 1B4JL 4X4MA 3BIBX 1T20B 3SEPA 3ZT7A 3RVUC 1D5ZB 2V2XB 3V5HB 4IS6A 3PZNA 5T1KA 3O0RL 5FF6A 4U1NB 1UZ6E 4LCWB 3W81A 4D6DA 4JM4H 3BH8A 4QLLA 1EOMA 1JYNA 5DHVB 1Q8MA 1JMXA 1DEDA 3SE9H 2XN9A 2UY3A 4YUEL 2QSCL 2NXZD 3N18A 5EN2B 4OFPA 1S9YB 1U8OA 4R9HA 3GRWH 3PWUA 4MNQA 2GDVA 1V02A 1V3HA 3TA3B 1TNMA 3NH7L 5F7FA 5DGQA 1MFEH 1KTLB 4LXFA 1GHFL 1T1ZA 1FZJA 4JO3L 4JRYD 1P53A 4MADA 3WEXB 4S1DC 2VDPH 5F21B 2RBLA 1F4WH 1JFQH 2E8YA 5IR1A 1TJIL 1HCVA 2DWDB 4R90L 5IMKA 3VGHA 3D4ZA 2Q3ZA 4OFYD 2MQ0A 2NSXA 4HU0A 3TYGH 1FHLA 2RR3A 2HT2D 2FGZA 2HVJA 4QTHB 2YKLL 4QRRA 2H3NB 2Q8AL 1U8NA 3RJDA 2QLVB 3ZJ8A 4JFEA 1KLUA 4P2OC 1T6VN 2MCPL 3AQUA 3EKCA 2DQUL 5JLZA 5F3BB 4W85A 5IIEB 1PAMA 3KNBA 3GUTA 1RAMA 2DQCH 3EMZA 4GKNA 5KJRL 1V8HA 3ZE1F 1MEXH 2DL9A 3GM8A 4YAQB 2DT0A 4WIWA 1KT2B 2P8MB 3LEYH 1ZLSL 3MNVA 3POCA 3WEMA 1I3VA 4FTVE 4KC3B 5F88B 3JWNC 1R87A 1H3PH 3NN8A 3EMQA 1L4IA 4WI5A 5EIQA 5TDPA 4OZIB 2YK1H 1R3LA 3C6LD 4XNZC 1KEGL 5GGVH 3WN6A 4IDLA 3O8XC 4WUUD 1RU9L 5IB4B 1IM9D 1WCQA 4TSAL 1W91A 4H1LG 1K8DA 1A3RL 1HQ4B 2X05A 2CMRL 1CG9B 4BJLA 1E3ZA 1MAML 1QVOA 3VD7A 1BQCA 4YC2C 3IDIB 4ZMAT 1GUVA 4NKOA 1QFWL 4LSRH 3SE4A 4MS8C 3FNDA 1PDKA 1ZGLB 1W9DM 1IGIL 3HG1B 3MRDA 5KSUA 3U6RA 2VRAA 1CCZA 4JO2L 1IRAY 4ZUUB 4HJ0C 3AXHA 5EZIH 4P4RB 1JGDA 5LCVH 3CGTA 4PJ5D 2BVQA 5SV3A 1RK0B 3NCOA 2JJTC 1JZ8A 3LN4B 4NO2B 5L0QC 3OLEA 2CEQA 2EH8H 2EDHA 1PZ3A 2J6EA 3BPOC 1HJWA 3H7BB 1AQHA 2FATL 4G43B 5EU6E 3A6BL 3KXFE 5HHVL 3RIAF 4KY1L 4NNYB 5HVGB 4L3ED 3HZMB 3VIHA 2CKBH 1OGAD 3BN9C 4YH6A 5DMGD 2K3TA 1G9EA 3LEVH 4UU9B 2CRMA 4UQAA 1JTPA 1IVLA 1ORQA 3QDGB 5F9WB 2XG5A 3NPSB 1E1EA 2WHKA 5INCB 2F8XC 2EACA 3F7VA 5FGSA 1C92A 2OM5A 1HJVA 5DO2D 4QLKA 4UQBA 4WU7B 4TN9A 4GFTB 5CJXC 2AXJA 3ZIZA 3SOBL 3F7QA 1J12A 4RGND 1W1YA 4I2XE 4BQ4A 3VFPA 1HHHA 4U6XB 3WMBA 2UV3A 4R4BA 4P7LA 1BFVL 5CINL 1QNZH 4M61B 2NY3B 3RI5K 1NDGB 1CK0H 1D5ZA 2V2XA 3B5GA 3V5HA 2A6IB 4RFOL 3D9AL 3ALFA 3BI9X 4LCWA 1UZ6F 1OTUC 1G84A 4M48L 1AO7D 5DHVA 4MDOA 4KKBD 3S36L 5EN2A 1S9YA 1U58A 2BRRL 4ZUVB 5ADPH 2UY6A 3AYRA 2WNGA 1ZLVK 3IRPX 1MRFH 1EZVY 1JPTL 4K2UL 1FO0B 5C8BB 3SCQA 3TA3A 5B8CB 4JQIL 4KDTA 4NO5B 2YPKB 1KTLA 3KYAA 5TDOB 5JW4N 3WSQH 4E41D 3NJ3A 4Z95H 3U7VA 2NT1A 1ONQB 3RCNA 3X14B 4C58B 4LEXH 1JCKA 1UYWL 2WANA 3WEXA 3DRQB 4AIXA 1ZEAH 5H8DA 3HI5H 2N7AA 2DWDA 3MBED 2IPTH 4ZOCA 1CDIA 2VL5B 1MCOL 1AXTL 3CMOH 3GNRA 2VZ1A 4BZ1L 2O9RA 4ZAKD 2O5XH 1C90A 4GAJL 4QTHA 2H3NA 1O7SA 1IGYB 5D71H 3BVXA 1WAAF 4EIGB 2XM1A 2EE9A 1SBBA 2RJMA 4WW2C 5DLMH 4DFHA 5F3BA 5IIEA 3UR7A 1YDPB 1DZBA 3VINA 1VF8A 1C7TA 2VDLL 1W2KT 5ENWB 4EXKA 4YAQA 3I85A 4L4TB 3C2SA 5HVHC 1KT2A 2P8MA 4LSUH 4QGTA 5F88A 5GNZA 3IANA 5JXEA 4OZIA 5MHSE 3PN8A 2IQAB 4M7LL 1W2VA 1EUUA 4RMRA 1R6VA 3QEQA 3TT3L 5IB4A 3AAZB 3MLYH 5CGYD 2J7DA 3E2HC 2AEPL 3MLVH 2F8OA 3B2VL 1HQ4A 4KMTL 2HT3C 3HG3A 3D85B 1CG9A 3FT3B 5GGTA 3TVMD 5A6LA 2WBWB 3FRPG 1IAMA 3IDIA 3BFOA 1TVBB 5CBEB 5C07E 1S7QB 3HG1A 3VIPA 2Q8BH 3ZE0E 3SDCB 5JW3H 5ISZE 2XICA 1V7MH 3S37L 4ZUUA 2V5TA 4P4RA 1E6NA 3H6JA 2PI6A 1RZJL 4HAFA 1RK0A 4NO2A 4KU1A 5H2BB 1R75A 2YJQA 1KFAH 4ONFH 1U36A 2E9LA 2O5YH 3RPKA 2AI0H 4NP4L 3OG2A 3H7BA 4PUEA 4G43A 1S3KL 3K4ZA 3VE0B 2Z1SA 4NNYA 5B38A 3DVGB 1MLBB 4K3DH 3HZMA 4LCIH 4R0LC 1I1WA 3STZB 3SGKC 2NX5B 1KB5L 3ZJKA 3C2AH 2ED9A 3WMSA 2A6JB 4Q58C 1TCMA 4G9FE 4TNWK 4ACYA 5HHMD 2XWDA 3QDGA 4WENB 5C0EB 1BYBA 5INCA 1GOQA 5HDBE 3BH9B 4BF7A 1WKYA 4F2MB 5FO9B 5CP3A 4WU7A 1NL0L 1KIPB 5KVFL 4H8WC 2ORBL 1QP1A 4HWNA 5F1OB 1JNEA 4OGAD 4U6XA 1Q0XH 2CRIA 2MQCA 1D9KC 1JIBA 2J8HA 4HT1H 3JV0A 1D5IH 2PTUA 4ORGA 3UPRB 4F8QA 1NMBH 2XWTB 1S9XB 2A6IA 3C60D 3VGBA 2DM7A 2EIBA 5TDNB 2X1OA 1C3FA 1IT0A 3RVTD 5I17B 1X1NA 1RPKA 2NXYB 5ALCH 1L9NA 4C56B 1MCIA 4NQCD 4LYRA 5CEXB 4ZUVA 1PKQE 5FYKL 1UQSB 3MUJA 4M6NH 2EEXA 2AV1B 4OB5H 4XCFH 5I1EH 1FO0A 1AE6L 4X6CB 3FFDB 4RMSA 3I75B 3GXMA 5B8CA 4NO5A 2X41A 2YPKA 5TDOA 5CJQL 3OAZH 4F7PB 4RMVA 1ONQA 1P69B 3X14A 5ICXB 3EBAA 4UTAH 3H3KA 3RUGE 3QUZD 4GAFB 1EJOH 3DRQA 1W1PA 4V2BA 4JZ5A 3NOIA 5CILH 3LIZL 3F8UB 5F9OH 2CBIA 1ZWIA 4LVOB 2VL5A 4PTTB 2AAVA 4LU5H 2FEDD 1OLLA 1QFWI 1N8ZB 2DQHH 4P5TD 4BZYA 5EC1B 4M5YH 4BUGA 1CR9H 3DXAD 2CO7B 4OLXL 2P42B 1B4JH 4MAYB 2WCAA 2DICA 1U95B 2XN1A 4PMNA 1VEPA 4S0SD 4UQEA 5FA4B 4M4PA 2DRUA 4P23D 5DZOA 4PTWA 3O4LD 2WUBH 5D8ZA 4KRNA 3O0RH 1UR2A 4NI3A 1A7OL 3QULB 4X7EC 1HL9A 1HXYB 4GKSB 2D0HA 1Z9MA 1TFVA 4L4TA 5BRZB 1YNLL 1KCKA 5IFPA 3HMXL 2VDQL 3ILQC 4YUEH 4ODBD 5KSAB 2AJVL 1FYTE 5T1KD 1XYZA 2IQAA 4MD4B 4HQQL 1CDCA 1AQKL 5CCKL 4MA7H 3KPOB 2OJZL 3AAZA 5BJTB 2XN9D 4DN4L 4JO3H 3F62A 4MB4A 2APXA 3UMTA 1AI1H 4NDMB 3TJHD 2AS5M 3D85A 3FT3A 4MNQD 4PJEF 4IJ3C 4MXQC 1TJIH 1LVEA 4LAQL 4R90H 2AJYL 1Y0LB 5CBEA 5MEND 1S7QA 3JWDH 4YWGL 3SDCA 4ZPTB 6FABL 5DDHB 4U6YB 3QIWB 2YKLH 3IAPA 3EJPA 2QPUA 2W9EH 2QJDA 1YYML 3EJYC 5FUCE 3ULUL 3QQ9C 1R0AL 5H2BA 1T21B 1YQVL 1VBRA 1NFDB 4JFQB 5IBUG 4ZNCD 2UY7A 5J13C 3VE0A 4HUNB 5KJRH 3CUHA 3DVGA 4PSPA 1MLBA 4FRWA 3DJ9A 4PB9H 1FRGL 5EB8A 3HC3L 1QWNA 2NX5A 4JFED 3IU3B 6CGTA 2ZNXA 4BSJA 1ZLSH 1P5VA 3HZYB 3QZWG 4G6AC 4BQ5A 4KDVA 5C0EA 2B39A 2EYSB 4I48B 1CL7I 3VSTA 3EDDA 2QL1A 5GGRB 4G6KL 2BSRA 1KEGH 4Q7NA 3HTLX 3BH9A 1NBVH 2UVEA 3JWOL 4F2MA 5FO9A 1RU9H 2VLJB 5FM8A 3ZKQD 4P9ML 4OLYL 1KIPA 2RQ8A 4P46C 2O61B 3V7AE 2ZPKH 2G5BB 3N1FC 2CMRH 4M3JA 4WIQA 1MAMH 5F44A 1QKZL 3LQAH 1A3LL 3SGEH 3UPRA 1U3YA 5HHPA 2XWTA 2CKRA 1S9XA 3FN9A 1N3NA 3KPNB 3D5HA 4JO2H 5TDNA 4LQFL 1TJGL 2UWEE 3THMH 4LL9A 3VM7A 5I17A 2ADIB 2DTMH 2NY1B 4MJ6B 2ZX6A 5CJOL 3CXDL 3DX0A 3DV4B 4C56A 2CK0L 5ICYA 3RL1B 3GBMH 4U1SB 3VFVB 1ITBB 5HHNB 5CEXA 2FATH 3UTTE 5A3IC 3A6BH 1UQSA 5HHVH 4YHYB 4KY1H 1ADQL 2AV1A 1Z3GL 4PJHB 4HK3J 4N1HB 3FFDA 5CZKA 3I75A 1KGCE 1NWUA 5IW3A 1KXHA 4F7PA 3CBWA 4G6ML 4P5KB 4QGYA 1TDQA 5ICXA 1J8HE 1RUAL 5HBFA 3RUGF 5IQ9B 3WQ6A 3G08B 4NQDD 4TX8A 1W1VA 2N1KA 2GITB 2Q20A 5DQDH 1VAHA 3PV6B 5CSYA 2X4SA 4UNVA 2JJUA 4PTTA 3ZL4L 4E5XB 3WIIL 1SM3L 3SOBH 1A02N 4K7PL 1QNPA 5FCUL 5EC1A 5ESQB 4MA3B 3TONA 3DGGB 1QR1B 2FD6L 4MAYA 1H0IA 1BFVH 5CINH 1U95A 1LEGB 4QDMA 5FA4A 4HKZB 4U2YA 4X0KB 1YMHB 5A6JA 4OZGB 4RFOH 3D9AH 4XP9L 2OX5A 1ISWA 3QULA 1FZKB 1HXYA 4M48H 5BRZA 3PGFL 4YHZL 3VA6A 5J1SC 3S7GA 3VWJB 2WK2A 1JZ7A 1J0YA 3S36H 5KSAA 5BRPA 1YN6B 2BRRH 5A6MA 3QXVA 5CWSB 4U5IA 4MD4A 4K2UH 4LCWD 5INDB 5I1DA 5I30L 3WY4A 1E55A 3C6SB 3PXJA 4HEME 5D72L 1E4WL 5BJTA 1T1YB 1T1XB 5E8DH 4F58H 1BPVA 4UNIA 1UYWH 1QRKA 2F54E 2YD8A 3FN3A 5KS9B 3IDMB 3PL6B 1MOEA 2P48B 3TA3D 2BJMH 1OD9A 1Y0LA 3BCFA 4EDXB 3BHBB 1AXTH 3UYPA 4K71B 2WBJC 3QEGL 4ZPTA 4BZ1H 5C08D 5DDHA 4GAJH 4NZUL 3QIWA 2EIEA 4U6YA 4IDJL 3WQVA 1NCDH 5IHZA 2H2SC 4J23A 1GW1A 3ARZA 4NHCL 4CJ0A 5FUOL 2FHFA 1NFDA 4PJDE 1A7QL 1YY9D 3T0VA 1A4JB 4NN7B 4M62L 3OKMB 5D7KD 4JIEA 5HNNA 2VDLH 5CEYB 4WSKA 2FH6A 4RL3A 1DWFM 2H2PC 2MPAL 4AEFA 3IU3A 4HHAB 1EFXB 3KPRB 2Q8XA 2A74B 3HZYA 3HE7B 4U1GC 4L1DA 4K9EC 2EYSA 4I48A 4Z78B 1U8IB 5GGRA 4F9LA 3PWLB 2YPLE 5F7MC 1CZ8L 2I60L 2VLJA 1JD9A 4N90E 3SDAC 4EN3B 4LGRB 4GMTL 1XH2A 1E15A 1ZSDB 5K93A 1TZHB 1O7AA 3IRZA 4GI9A 2WZHA 2O61A 3B2VH 2G5BA 4KMTH 3QUMB 1ZTXL 4D9RE 3O2VL 5JXED 2BSSB 1LL6A 4NRSA 2QEJA 3NDZA 3UJTL 1GYAA 4FNTA 1UD8A 3QEQD 4XXCC 4L8BB 2MQ3A 2NY6B 3KPNA 4OZ4B 5J7CC 4JG0H 3QXTA 1RZJH 2ADIA 4MJ6A 3DV4A 1I9IL 2V3DA 2W0LA 3AFLA 4U1SA 4R27A 4NP4H 3BCDA 4XVTL 5F72S 1RSFA 3HG1D 5CD5D 2WP3O 5H35B 4PJHA 4L4VB 5A8QA 1CIUA 4HP5A 1YA5A 1KB5H 3RVXC 1J88A 1QFWM 1N4XL 1RZ7L 2Z91B 4P5KA 3OG6B 3OGSA 1RJZB 2X5PA 2D03L 3G08A 1ZT4B 1KXTB 1RUKL 2W92A 3PV6A 4NZCA 9CGTA 3I84A 1YJDC 1TQTA 3HR5B 3DUUB 4XX1E 4E5XA 5CSUA 5DMIH 3MRMB 4J28A 2ORBH 4PUBL 1P84K 3QDGD 1ZJAA 4WI7A 4LPWA 5ESQA 4MA3A 4Y2DB 1FLRH 1IGCL 2Y25A 3DGGA 1QR1A 1QR4A 3U7BA 1BEYL 3ZTNL 4ZENA 3ZHKA 3WO4B 2ZKHL 4HKZA 5E1QA 4ZXLA 4X0KA 4V2XA 4XCCL 3EBVA 4AT6B 3BPLC 4OZGA 3GKWH 3ARTA 5A94A 2KZ1B 4Y88A 5D2NE 2VLRA 5C0AB 4U31A 1M03A 4W7WA 4N8CL 4TYUA 5I16B 1ZANL 1WCBB 3VWJA 3UCRA 4DAGL 1AGBB 3L5XL 3B9EA 4E2OA 1YN6A 2ERJB 3QFDB 2GUOA 4PLJD 5FYKH 5CWSA 4P2OB 1U42A 4EQ3A 1DHKA 4R96A 4UDTB 1ZAGA 1AE6H 1W0YT 3QDAA 2MMXA 2K7QA 3IETB 5INDA 5J8OA 3OBAA 3C6SA 1QSEB 1T1XA 1VDGA 2G3JA 2E6JA 3NIDF 4YE4L 5GRXG 1U3HA 5HDQL 3LRSA 5KS9A 4FLRA 1I9JL 3IDMA 2WQRA 3PL6A 1ZLWH 3KWWB 1BZQK 2IANB 2K1MA 3DWTA 3IF1B 4NNXB 3ZSSA 4EDXA 4W8AA 4CD8A 3BHBA 2J7FA 3NAAL 4M81A 1J5OL 2FO4B 3NYDA 4XNZB 2WKLA 4NKDB 4JFDE 3O8XB 1ZKAA 4OLXH 5D7SL 4MHHI 3SGJA 1QI4A 1YY8B 4KJWC 3AMLA 5I19L 5BVPL 4HWBA 1A4JA 4QF1B 3OKMA 2VXQH 2YMXL 4JFFE 2WMKA 2CGRL 3VMOA 5CEYA 1ZLVH 1YNLH 1JHKL 3OPZL 4A3HA 1NOUA 4DVRL 4D6GA 2J8FA 1MWAB 4HHAA 1EFXA 1QFPA 3KPRA 5BV7C 2VDQH 4YX2L 2Z0BA 4M9PA 5GQBA 2A74A 4PUDA 3HE7A 1K4CA 2ZX8A 4BS0A 2AJVH 1MI5B 4KZDL 4Z78A 1U8IA 3UDWC 5L0QB 4HQQH 1FH5L 4AMKL 3GJFH 3ROOB 2X1XR 1AQKH 3BJLA 1SEBB 4R7NA 2EO1A 4R8WL 1I3UA 5IM7A 2YFNA 4EN3A 2OJZH 1TZHA 2X4QB 4B7LA 1R46A 2LE9A 4CD4A 4GJTB 3QUMA 1NGWB 4U3AA 2BSSA 4L3CB 4PGCB 5DI8B 4D6IA 4HW6A 3TBWB 2AJYH 1NLDH 3GSUB 3LCYA 4W4OA 4YWGH 4L8BA 3WLWC 4I18B 1GIGH 2HFTA 6FABH 4OF0A 1TVDA 1YYMH 4P99A 3W24A 1KB9K 4ZO6A 3ULUH 3GH5A 2M26A 3ZR6A 3RGHA 1YQVH 2CETA 4HZLB 2R4RL 2HISA 3L4XA 3CMJA 1KXVA 2YA0A 1B3WA 4HUKB 3N06B 3IS1X 3K0WA 3F7PC 1CQKA 4K23L 5H35A 2E0PA 4L4VA 3O6MH 3A4AA 4O4YH 3HC3H 2BY0A 3O6FB 4M43L 5J9PB 2MCG1 1RIHL 2Z91A 3VFMB 2P45B 2F61A 1E4XL 2AEWA 4Q6IC 4UIKL 1SY6A 5AWNL 1RJZA 1C8YA 1X5GA 2MJWA 4D0BB 2ENSA 2ZXAA 1ZT4A 2FCBA 3RU8L 1P1ZA 4G6KH 5F6HJ 1KXTA 1NCCL 5D4QA 3VXRB 3L4VA 4MB1A 4W7UA 1LHZA 5K9QG 3JWOH 3AROA 2NX5D 3EO1B 3HR5A 4P9MH 1LWHA 2IPUG 5A2IH 4RISH 2NY7H 1BVZA 1QKZH 4Y2DA 4TUJB 4J3TA 3RX5A 1E4NA 1UR4A 2AJXL 1A3LH 1XSKA 1A6UL 1DWAM 3OKEB 3C8KB 2D4DA 2BNUB 2QQLH 4AT6A 3BVWA 3L3GB 5DMKA 5JZ7C 4P8VA 3QR3A 2OLHA 4LQFH 1JTOA 5C0AA 3RGVC 3QNYB 5CJOH 3CXDH 5I16A 3EYFB 3P0VL 2EDKA 1WCBA 4NC0B 1AGBA 1WJ3A 3IJSB 3QFDA 3AY4C 2HLFC 2R4SL 4LHUB 4P2OA 1ADQH 2KQMA 4ZD3L 4UDTA 7CGTA 2PN5A 1T6WA 1OGGA 4J6RL 3MRJB 2DBJA 1HHGB 3IYLW 2NXYD 4C56D 3H55A 1HKJA 1QSEA 1G01A 2R15A 5DRZB 1OIFA 4JJHA 2O5ZL 1DCLA 1RUAH 2CLVB 1HT6A 1UZ1A 5JOFB 3CZEA 2XVKA 3KWWA 5HY9B 2IANA 3IF1A 3JVGC 4NHUB 4NNXA 1FCGA 5DZLA 3ZL4H 4D0DB 2P43B 4XTRC 2A77L 2FLBT 3VFTB 1SM3H 3PUCA 3S97C 2FO4A 1YZZA 3WKNA 5CEZD 2YN5A 4K7PH 3O8XA 1NWRA 2J5LC 5FCUH 1YHTA 1C5CL 1HCFX 4MZ2A 4M7LT 1YY8A 4I77L 4C7DA 2YD9A 2ZXBA 4QF1A 5FIPA 1M7IB 1NUFA 4JGJA 3UESA 3UZVB 2IADB 3GDBA 4XBPB 1MWAA 3WF4A 5M03A 4MAYD 5E8PB 4FA8A 5KG9B 3RZWA 3UZEA 4PJIB 1MI5A 1LE5B 4RGOH 1E56A 2RGSA 4MXVF 3RWHB 2CH8A 2E7LC 4MVBD 3ROOA 1C5DB 5BRZD 1SEBA 4XB3A 4JHBA 5I30H 4HBQA 4Y16B 1AP2B 5D72H 1E4WH 2NY0C 2FO1A 2X4QA 1NFIB 5MI0C 1VEOA 3PZIA 5KSAD 3CXHJ 3Q5YA 1NGWA 1DVFB 4H20H 4L3CA 4PGCA 5DI8A 1PLGH 2CDGB 2OWCA 1CQYA 3TBWA 2BVPB 4FFZH 3SURA 1UA6H 4UINH 3GSUA 1G7QB 4OLUL 1XCWA 2P7TB 4BSWB 4I18A 4CN4A 4BA8A 3V5DB 3CNKA 2HT4C 2IBGA 4NZUH 1A6WL 4IDJH 3CPUA 1GQLA 1EAJA 1V3LA 2VTFA 4HZLA 4M5ZL 5FA3B 3RI5F 4X80L 4OZHB 2F5BL 2JF1A 2XSAA 3FY1A 3TBVB 3T0DA 1H3XA 4M62H 4MAUH 5I79A 4Z2JA 3BEWB 1K5NB 3T3PE 4WKFA 5KVEL 1D9KB 1HXJA 2CO6B 1E6OL 4JRYE 4RRPG 3SN6N 2MPAH 4XUYA 2XTJB 3CVHL 3L1OL 2ICEB 3WFHB 4KUZL 3O6FA 5J9PA 3S3JA 5FUCC 4U4BA 3VFMA 4JQXC 3FO1B 3VXUB 1DBBL 4M24A 3MZTA 4CVXB 5I1GL 4HAGA 1GVIA 2CRZA 3VXRA 4OI9A 2WWCA 3G6DL 1AJ7L 2I60H 1U2CA 3DLQR 4GMTH 4TUOB 3S96B 1YEEL 4B16A 3QDHA 3HS0B 3HG5A 3BISA 1PZ5B 4MJ2A 3O2VH 3D5OF 4HH8A 4MQXD 4TUJA 3BPCB 1FFNB 5CLWA 3MGAA 3UJTH 4POYA 3OKEA 3BLBA 3C8KA 4FP8L 2OR9H 1E4KA 2NYYC 2BNUA 3VXSB 3BH4A 2OW7A 5DVKA 4XC3H 3L3GA 1OD0A 3GNOA 2BVEA 4H1LH 4KQ3H 3G6JE 3QNYA 2FYVA 4UAOC 2X9WA 2OSWA 3OAYK 2HFFB 2C3WA 3EYFA 4N0CC 4MCYB 3W2DL 2I5YL 1MIML 3FN0H 3WXWH 3IJSA 4QWWD 4XVTH 2J4GA 3EOAB 4LLWB 4LHUA 2FJFB 2X9YA 3NCEB 3GGWB 3O6KL 2P46B 4OLWH 5IHBA 1OCQA 2NY1D 3MRJA 4Y8AA 1BVLB 5LXGL 4CVUA 1HHGA 1FVDB 1X5AA 5IMOB 5DRZA 1N4XH 5HPCA 3NFPB 2V6HA 3JWDC 1IILE 1RVFH 2FH8A 2CLVA 3S34L 1FOBA 4K3GA 1INDL 3ZJ6A 2E27L 3EO0B 3OJ2C 2D03H 3C5JA 5JOFA 1UD4A 3AIQA 2VXSL 3VXOB 5HY9A 2ZXDA 4NHUA 3WEOA 4O9HL 4CL7A 4PJ5E 4UOJA 4D0DA 1FQ9C 2VZ3A 3G9AB 4JM2F 1G9MC 3M07A 3MXVH 4PUBH 3PNWB 4B7IA 5D8JL 3SO3B 1KR1A 3ZKMD 4LLAA 2EDXA 3N17A 1BEYH 1MVFA 3ZTNH 4L3EE 4U6HB 4D72A 2ZKHH 1OGAE 2XZAL 3MFFB 5J3HD 4HMDA 3KAAA 3NACL 4YFDB 4IJ3B 1XF5B 3E6FB 1CXHA 4NZJA 2IADA 4N8CH 3BD4A 4XBPA 3P4OB 5E8PA 1N59B 1XGYL 2XN0A 1HHIB 5KG9A 1ZANH 1SMDA 4DAGH 1DL7L 3L5XH 1ULVA 4PJIA 1PZ2A 1LE5A 2EDEA 1HP5A 4LPYA 3RWHA 3BOVA 3LOWA 1E4XI 3W5MA 1NP2A 3PP3K 4RGNE 1C5DA 2VLRD 4KRPC 5IW1B 4XV0A 2RIKA 1KTDB 3ARQA 1WZAA 4Y16A 2O9TA 1AP2A 3GSWB 4ZOEA 5HYIA 1NFIA 4TNWF 4Z7WF 1GOMA 1H3TA 5HDQH 1DVFA 2VOTA 1OB1B 2CDGA 3HB3C 2XWEA 2OMNA 2BVPA 4UIMB 5D1ZD 2D23A 1AO7E 1G7QA 2P7TA 4BSWA 3V5DA 1UXSB 5ACMA 3DVFA 1U3HD 3VDCA 1B3YA 5EC2A 4OUOA 3PL6D 1WZ1H 3DTXB 5FA3A 3VM5A 4OZHA 5BVPH 5BMFH 3TBVA 3ARXA 3FHAA 5CP7B 3WJJC 3BEWA 1K5NA 3DECA 4E41E 5TH2B 1D9KA 2FL5B 3T3PF 3EFFB 4A2LA 1A14H 1JHKH 3OPZH 5IHLB 2B2XH 4DVRH 3P3YA 1CYGA 3AREB 2DQGH 2ICEA 3WFHA 2GDUA 5GGRY 3WNMA 4YX2H 2KKQA 3FO1A 3VXUA 5DS8B 5ICZB 4KZDH 2GTZB 4XBEH 4CVXA 3FO0L 1YEHL 4XBGA 2DT3A 3A23A 2XA3A 4GKOA 4AMKH 3GSOB 5C0DB 2DB8A 3S96A 4B15A 1FV1B 1EFXD 3DO3A 5KSBB 3HE7D 3MV7B 3HS0A 4PCTA 1JWSB 1PZ5A 5IFAH 3KG5A 2WLYA 1M71B 3LKNB 5DWUL 3UTZB 5HI5C 1WP6A 2OBGA 2R2CA 3BPCA 1CEOA 1FFNA 3MLXL 4GAGL 4XXDB 1H1NA 5ABDE 3M46A 1H3UA 5F89A 25C8L 3VXSA 4EN3D 1R7OA 3RM9A 1RFDL 1QFUL 2DLIA 2A1WL 2QSTA 1D7FA 1CXKA 1FH8A 4N5EC 2ZX7A 4UQ2B 3O2WL 2A9ML 3PABA 2HFFA 5C0IB 1J1PL 2R4RH 4DKDC 4MCYA 4ATLA 4EDWL 1DQJB 4JKPL 1AC0A 1OF2B 3EOAA 2IPUK 4LLWA 2FJFA 3DVIA 4K23H 3GGWA 3S9DB 1K9DA 1BVLA 3LV3B 5EPMB 1IEHA 1FVDA 3HMWL 5DUML 1W9BM 1C91A 4M43H 4LLYB 5IMOA 3NFPA 1RIHH 3CPLB 3MGOB 5AWNH 2HJKB 4UIKH 1WZKA 3D48R 2CJUH 1FP5A 2IPKB 3GSXB 1J0ZA 1VCAA 3EO0A 3O2DH 1IAIL 3RU8H 3S4SG 1NCCH 4L4VD 4LVHB 3W25A 3VXOA 3MXWL 2UUDK 4NOBA 1GGBH 1RURL 2GJXB 2J75A 3ABZA 2EYTB 5IJKC 3MMWA 3LKOB 3TLRA 3PNWA 2HN7B 5E0QA 2E6PA 3T2NL 1BQSA 4NUGL 2AJXH 2HH0L 4LVNC 1A6UH 2R9HC 4U6HA 4UV4L 2AP2A 1Z9LA 4QTIH 1T7VA 3MFFA 1VB9A 3LN9A 1XF5A 2BRQA 1CLYL 2PWHA 3JBG7 1EBAA 2ZWLT 5FUZL 3E6FA 4Y2DD 3P4OA 1J7VR 1N59A 1HHIA 3P0VH 3P40A 3T4AB 5DC9B 4EI5B 3L5WB 2R4SH 4HWEL 1CXLA 4XAWL 4ZD3H 5E94B 4GAYB 4J6RH 5C0AD 1AGCB 3HUJA 5IW1A 3ZDZE 4Z8FL 1KTDA 1HP4A 2CBVA 3GSWA 1FBIL 1X5YA 1DFBH 1BD2D 1O7VA 2LVEA 5D2NC 3WD5L 1U2YA 2O5ZH 4PRIB 4AIZB 2EIZB 2FIKB 4N5UA 4BZ2L 3MCLH 3MRNB 1OB1A 2YRPA 2GFBB 1XIWB 2ZUQC 1QLRA 3CC1A 1J1XH 1EO7A 3RWFA 1UZ4A 2XTLA 4U1GB 4UIMA 5I75B 5C71A 2A77H 4CD7A 1QSED 3IDGB 4JPWL 5FHAH 1VJSA 1KCRL 3BGFB 1UXSA 2BS9A 5D4YA 3DHJA 4NQCE 2D0FA 3SIMA 3SKNB 3APGA 2GSJA 1VACB 1MHCA 1AC6A 4W6WB 3DTXA 1PGRB 1XF3B 2IAND 3WF2A 4I77H 3MRGB 1E4JA 1H0DB 3FW6A 5CP7A 4HA4A 3ECQA 4NNPL 2FL5A 4FTVB 3NZ8B 5TH2A 5DT1L 3EFFA 3X3FH 1MPAH 3ZZ1A 2QBWA 1TZGH 3AREA 4X6EB 3NSNA 1X5KA 1Z6JT 4HULB 4PJBE 1UH2A 5DS8A 5ICZA 2GTZA 4PRPE 4XHJD 3GSOA 5C0DA 3PWVB 1T89A 5K9JL 1KIUA 3W6MA 1FV1A 3DXAE 5KSBA 3WV0A 3MV7A 4ALAL 1JWSA 1MI5D 1TPXC 2IG2L 3UO1L 3LKNA 1M71A 2VR5A 3EOTL 3UTZA 1DANT 3O4LE 2DI8A 2DLGA 4XXDA 2EBNA 1T83C 2FBOJ 4OLUH 3LSOB 5I73B 1YPZB 5I3DA 4X4ME 1H8SA 2X40A 1A6WH 1EA9C 3QDJB 4OJYA 3KXFB 3IDJB 2AXGB 1V0KA 4UQ2A 1MVYA 2OR7A 2GSIB 5C0IA 1CN4A 4AZIA 4M5ZH 5T5NG 2R29H 4HKJB 4X80H 1DQJA 1OAUH 3B2UC 3C5ZC 1OF2A 2ZWYA 2FHCA 3U2SB 3QXAB 1GGCL 3LV3A 4OFVA 5EPMA 4HDIB 4KUZH 4MNQE 5F1SA 4LLYA 5FL1A 2QKIB 3CPLA 3MGOA 2C7FA 2H32B 1V02E 2H41A 2HJKA 5MENE 2IPKA 5F9AC 3GSXA 2DQJL 2P24B 5I1GH 3HAEB 1NBYB 12E8H 3GIZL 5JIWA 1QVBA 3TTQA 5AC5A 3G6DH 1AJ7H 4M8UA 2GJXA 3MJ9L 1FFPB 1XRVA 3HG2A 2EYTA 4W86A 1YEEH 5TQ2L 3O6FD 3RIKA 4OM1H 3LKOA 5LGHL 1MNUL 4XVJH 1T03L 2L0DA 3H9SE 2HN7A 5D96C 5A6AA 2DYPB 4KROB 3VXRD 4M1GL 3QCTH 1OAYL 1U92B 4HGWB 1QX1A 5HDOA 1ZVSB 4HLZG 4FP8H 4GO8A 4JFEE 5FKYA 1LP9F 2EDTA 5DD3L 4ODVL 3NTCL 2QSVA 5L7XL 1M01A 5FOBB 3H9YA 4MJ5B 2DJ4A 3T4AA 3W2DH 4EI5A 2I5YH 1MIMH 2DD8L 2QTEA 1GGYA 3L5WA 4HS8H 4WHDA 1JTTA 1KYOK 3AIUA 1T7WA 4ZYKB 2GTWB 3U5YA 5E94A 4G6JH 3DX8B 1A6PA 1AGCA 3ES6B 3ZDZF 4QOKA 4X7DC 1T5XA 4G80B 2V17H 5DUBB 4ZPVB 4PRIA 1X6NA 4ODTL 4K8RL 1IV8A 3S34H 4AIZA 1INDH 1I7RB 2E27H 2EIZA 2FIKA 4LHUD 5I8OL 3MRNA 1HXKA 2D7OA 5LVEA 2GFBA 1XIWA 1MFNA 2VXSH 8A3HA 2J8UF 4I5BB 4LSVL 3B6SB 4O9HH 3A4XA 1PKOA 4OF3A 3IDGA 3BD3A 4PY7B 5K33A 5T3XH 4S1RL 3G5XB 1VERA 1B3XA 3OR7B 1JXJA 1I3RB 3SKNA 3EJSA 1QHPA 2YHGA 4XWGH 1VACA 5DHVH 4OD3L 4YDLC 1XF3A 2WZPD 3EYPA 1CFVL 1I1AC 1QOKA 3MRGA 2XZAH 4YBQC 3WNLA 1H0DA 1MJ8L 3BXNB 3LRKA 3NACH 1G7PB 3TPUB 1UKPA 1NJ9B 2A6KB 4FTVA 3NZ8A 3QNZB 4X5WA 3X13B 4XHQA 1U6AL 4FFWC 4QCIB 1XFPA 3QNXB 2DTSA 4X6EA 4NQDE 1XGYH 4LPXA 4OCMC 4KTDL 1N0XH 1DL7H 1MW2A 5A6KA 5L9DL 4GXVH 4JPKL 4M1CD 3UTSB 4ENED 3S35L 4RWYL 1CGSL 2W61A 2CSPA 1BG9A 4GRMB 5FO7B 3PWVA 1QLEL 3Q0HA 4LNVA 4FFVC 1FSKC 1NUGA 4JREC 3WLBB 5EZLB 2YFOA 3SCUA 4BH7B 1AD9A 1B3ZA 3QHZH 1UCBH 3PZOA 2XRAL 3ALXA 3QXWA 3MLPA 4B9YA 3LDBB 4Q6IB 3FL7A 3MA9L 3WFDL 2VZTA 4Y16D 3LSOA 1YPZA 3NFNB 4JKKA 1B0RB 4XPGL 3QDJA 5J11B 3IDJA 1DVFD 3I2CL 2AXGA 3KEHA 4ACPA 2GSIA 2ZX9A 4LCWE 4IM8A 4AZCB 4KQ4H 3U2SA 3G5YB 4X9YA 3BIKB 3WD1A 4G9FB 4L8SC 3QXAA 2OSXA 3QOMA 3MUHL 2CYGA 4K94L 1IM3B 2GQHA 2BFVL 3P30H 4HDIA 1JI2A 1K6AA 1TLKA 1QPXA 4JCMA 3ULVD 2QKIA 3TZVB 2NXZC 2F7QA 4FLSA 4D1JA 2YR3A 2H32A 2YL8A 4BH8B 4NWTL 2QF8A 2GJPA 2ADFL 1Y7VA 1J1OL 2P24A 3BAKA 4JHZA 3HAEA 1NBYA 2QR0B 3FO0H 1YEHH 3WMCA 4D9LL 5KBNC 5C08E 2VC9A 3A24A 3VI3F 1FFPA 5F8QC 2XTJD 2VVSA 3TBTB 4NF7A 5KVGL 1KB9J 3WD2A 3VXUD 2E40A 3BKYH 3ARFD 3IJHA 3QG6B 1QO3B 4EJ1C 5DWUH 5GS2H 5J12B 5ABHA 1HWHB 2DYPA 5D7KE 3MLXH 4HGWA 1U92A 2G4FA 3BUBA 1T7XA 4GAGH 1ZVSA 4APQB 2B5IC 3NGBC 4H25B 3WO3B 4DTGL 25C8H 1RZ8A 2ZOXA 2HT2C 3MBXL 4MNHB 2IQ9L 1L0XA 4X7SL 5FKAB 5D7LA 1PKQB 2VJXA 2A1WH 2HLAB 1OSPL 3NA9L 3WUWB 5IB3B 5FOBA 3O2WH 4OI8A 2A9MH 1U8JB 3IDXL 3RMEA 1J1PH 4MJ5A 5I76B 4EDWH 4JKPH 4CVZB 3VXSD 2L4OA 1C8PA 3VFNB 5JW4M 1FYHB 3EIFA 4ZYKA 2UY2A 2GTWA 1BWWA 3DX8A 3ES6A 2Z8RA 4WTXA 3LZFH 2W0FB 3U0TB 3HMWH 5DUMH 1BTCA 4OZIE 2ZUWA 4ZPVA 2EXWD 5DUBA 1WITA 1U8HB 3QEQE 3WIHA 1IAIH 3C6LC 1HIZA 3RPMA 4OUUB 3GNPA 3NCJL 4F9JA 2WSPA 1XAUA 4I5BA 3B6SA 2BZDA 4UT7L 4WTZA 3UDWA 3A5VA 3G5XA 3OR7A 4RX4A 2PC8A 4JZJC 1DUYB 2C3XA 3HG1E 5GS0L 4YDJB 4NUGH 2NY0B 2HH0H 3OAYH 2CRYA 2CBJA 2EXYD 3BXNA 3WQ5A 4D8PB 2VO5A 1G7PA 2XIDA 3TPUA 1NJ9A 2A6KA 3QNZA 1GL4B 3X13A 1W9XA 5FUZH 3BVNB 3AGVA 4QCIA 1FYTB 3QNXA 3WNKA 4FNPA 2EE6A 5GS1C 4R7DB 2B4CC 3RO8A 1L7TL 4D3CH 1F3RB 1A6AB 2JCCE 3LRMA 4FQCL 3UTSA 5IDIA 3F7YA 3KYKL 4UB0L 4HWEH 2X70B 1FG2B 3KL0A 3MMDA 4GRMA 2P4AB 5FO7A 4X7CC 1TQWA 1MFDL 5DFVD 3T09A 4DKFL 4Z8FH 3QDGE 4U0RC 4ELKB 3WLBA 5DMGC 5EZLA 4G5ZL 1QNOA 1FBIH 4BH7A 3WD5H 1LNUB 1LWRA 5E7BA 4BZ2H 5ACZB 2HJLB 5CPTA 1I8KA 1MQ8A 3QO1A 1ECEA 3WF0A 5DO2C 4GG8B 1HX0A 3C09C 4Q6IA 1P5UA 2F58H 4RGNC 4JPWH 2WP3T 3NFNA 1B0RA 2D7QA 2Q1EA 2M1KA 1SJVA 4JQVA 2AERT 3MRHB 4JFPB 2P5WA 2D31B 3AM8C 3SKJL 4AZCA 2UYLB 3H42L 3G5YA 3HZKB 3OKDB 3BIKA 1BWMA 4W84A 1A22B 4NNPH 4W7VA 3SBWC 5DT1H 1Q9KB 1TMQA 1NANH 3TT1L 1IM3A 3PZTA 1C5BL 1PIGA 2WWDA 4KKBC 3TZVA 1HTYA 3MJ6A 2GY5A 4BH8A 1X5HA 3CX2A 2CIPA 2DMBA 2QR0A 2FGLA 3CUIA 1RUML 2R8SH 4NCC2 4HOZA 4XPTL 1T2XA 1VFAB 5LQBL 3ARED 1E0VA 1NWSA 3TBTA 1QACA 5HJ3B 2VRKA 4YHPB 4ALAH 4QRPB 2IG2H 3QG6A 3NDYA 3UO1H 1QO3A 3KPPA 2AOSA 3MBEC 1BAFL 2UWEB 3SGDH 4APQA 2R1YA 4H25A 4ZAKC 4MNHA 1OB0A 4MDIB 5FKAA 1Q6CA 1PKQA 3MV7D 3FT2B 2HLAA 3PP4L 5LBSL 3WUWA 5IB3A 2Z8VC 4LKXB 1PG7H 1U8JA 5I76A 3I6GA 1S9KC 2EE3A 5DFAA 3ARWA 4PJ9D 4CVZA 1ZGLM 2ED8A 4L9LB 4YFEA 1J10A 1AQMA 3D52A 5DT5A 3HNSH 3VFNA 2BSTB 3EFDH 3ZYOA 5M17A 1J8HB 4O2EB 1AGFB 3N85L 5FHBL 4PTUB 3FOLB 1GGCH 2W0FA 3U0TA 2CHNA 5FKPB 3PWPD 4OZIF 5H37H 1C1EL 3L5JA 5KN5A 2ZOKB 2JIEA 1N0LA 1U8HA 4YQXL 1NAMB 3GIZH 4OUUA 3MRIB 4AZ7A 2WAHA 1G9NC 1UWTA 1VGKB 5CGYC 2EKSB 5C9JB 1GOWA 2YBRB 5TQ2H 4PGDB 4B41A 3DROB 1X5ZA 1C7SA 3L6FB 4LSTL 1A5FL 5LGHH 2BERA 3TVMC 3QRFM 4J7RA 4KRPB 2RHEA 1LDPL 3QG7L 4YDJA 3T08A 1BZ7B 4M1GH 1OAYH 4Z7OE 1NC4B 43C9B 3ZR5A 4HZ7A 3MYZA 4I9WD 5GGUB 3A67L 1HKLL 4D8PA 5GJTL 1CBGA 4PGBB 5DD3H 1HE7A 1K8IB 3NTCH 2JEQA 3BVNA 4WSJA 5E6IB 3TPKA 4X9BA 1FYTA 1IAIM 4W6YB 5L7XH 1ES0B 4R7DA 3V52H 3BRGC 1LO4L 1A6AA 4ML4A 1UM4L 1MWOA 3GSNL 1E4IA 3CFJB 2NX5E 2DSVA 5FM5O 2X70A 1FG2A 3LS4L 4QY8B 3VG0L 1IFHH 1JL8A 1XCTB 1YYLL 4ELKA 2Y24A 2UUDH 3CK0H 2DM4A 1K2DB 3M1BB 4EI5D 2ZG3A 2FDBP 4ODTH 4K8RH 4OT1L 4XNYL 2Z4QB 3OKLB 2DSUA 5B4MD 3WJLC 5ACZA 1JZ2A 1QYGL 2HJLA 3VIOA 1A7PL 2Y5TB 32C2B 3BIAX 4GG8A 4JQXA 5JIHA 4JHAH 3FAXA 3EYSL 4QOKD 4PJDB 2OL3B 5BVJB 3VH8B 3NSMA 4S1RH 3UBXG 4OGAC 1FA2A 3KLAB 4PRID 4NT6B 3MRHA 1XSIA 1MQRA 3LB6D 4JFPA 4AXNA 3W26A 1XIWD 4J12A 4OD3H 4B53A 1CFVH 2D31A 3GNML 2UYLA 1JNDA 1MJ8H 3C60C 4U1LB 3HZKA 3OKDA 4C56E 3HG4A 3RVTC 3MROB 4KK5D 4GQQA 2XY2A 1Q9KA 4NJAL 5DF0A 1TQBC 1ETZA 1U6AH 5IEKB 4NQXB 2V9TA 2L7UA 1J0JA 2D4FA 2J7BA 3M6DA 3L4ZA 4KTDH 2I9TA 5JO5B 1G7JB 5L9DH 4JPKH 1OAZL 1MCHA 3S35H 4DN3L 3QDMB 5I77A 1CGSH 4FTVD 1I8MB 4GS7C 1OVZA 1QLEH 5CEZE 1VFAA 1GHSA 1FNEB 1IKNA 1P9MC 5HJ3A 1J0HA 2RAMA 2Y8KA 1G7IA 3QUZC 4YHPA 4QRPA 3D4YA 2DDXA 2QADB 5J57B 3EYVB 2UWEA 1VGEL 4J1UB 1RY7B 2CUMA 3UEZA 2BNJA 2FEDC 3MA9H 3WFDH 5L2KD 1JFHA 3PHAA 1DBJL 5F6IC 3HAEG 4Z7VB 5E24E 2WHJA 1JPSL 4P8XA 2CD0A 2ZSWB 1MHHA 4MDIA 1ESWA 4NSBA 2X44D 4P5TC 4XPGH 3ARRA 3FT2A 4S10A 2YRZA 4HK3N 3I2CH 2WHLA 4X6BB 4LKXA 4KTEL 4Q9RL 3LRLA 1Y18B 3UTOA 3ME0A 1EHNA 1HYSD 2NR6D 4P23C 2GHWB 4L9LA 3HKFA 5BRZE 1OAKH 2IF7A 2BSTA 4X98B 1J8HA 4O2EA 2XVLA