6CGTA

Hoxa complex of cyclodextrin glycosyltransferase mutant
Total Genus 221
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
221
sequence length
684
structure length
684
Chain Sequence
DPDTAVTNKQSFSTDVIYQVFTDRFLDGNPSNNPTGAAYDATCSNLKLYCGGDWQGLINKINDNYFSDLGVTALWISQPVENIFATINYSGVTNTAYHGYWARDFKKTNPYFGTMADFQNLITTAHAKGIKIVIDFAPNHTSPAMETDTSFAENGRLYDNGTLVGGYTNDTNGYFHHNGGSDFSSLENGIYKNTYDLADFNHNNATIDKYFKDAIKLWLDMGVDGIRVDAVKHMPLGWQKSWMSSIYAHKPVFTFGEWFLGSAASDADNTDFANKSGMSLLDFRFNSAVRNVFRDNTSNMYALDSMINSTATDYNQVNDQVTFIDNHDMDRFKTSAVNNRRLEQALAFTLTSRGVPAIYYGTEQYLTGNGDPDNRAKMPSFSKSTTAFNVISKLAPLRKSNPAIAYGSTQQRWINNDVYVYERKFGKSVAVVAVNRNLSTSASITGLSTSLPTGSYTDVLGGVLNGNNITSTNGSINNFTLAAGATAVWQYTTAETTPTIGHVGPVMGKPGNVVTIDGRGFGSTKGTVYFGTTAVTGAAITSWEDTQIKVTIPSVAAGNYAVKVAASGVNSNAYNNFTILTGDQVTVRFVVNNASTTLGQNLYLTGNVAELGNWSTGSTAIGPAFNQVIHQYPTWYYDVSVPAGKQLEFKFFKKNGSTITWESGSNHTFTTPASGTATVTVNWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate binding to a cyclodextrin glycosyltransferase and mutations increasing the gamma-cyclodextrin production.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
total genus 221
structure length 684
sequence length 684
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1998-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 6cgtA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 6cgtA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 6cgtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 6cgtA01
2LABA 1U92B 4XCCL 1FFRA 4G42A 1RI8A 4JLRB 1MF2H 4DO6A 1QWUA 4OCWH 5D7IB 4XGZA 5C3TA 4OOZA 3IJ8A 4B15A 1MCFA 3LHPL 4LASH 4ZPVB 4YXKL 4F7MA 3DBXB 1A0QL 1GJIA 1OSZB 3TNNA 3CFKB 2HG5A 1CK0H 5IK3B 2YD9A 1YY8A 4GAFB 4A4AA 3NGBB 1PEWA 3GJEB 1AIFB 1GGUA 4MZ2A 5IBUB 5FECB 3WY3A 3CUJA 2ADGB 2DQUH 2GKIA 3L3IB 4H8WC 2GJXB 1ZJAA 1N4XL 3PZIA 4H1LB 4MNQB 4RNRA 4NC0B 2G9HA 3BXNA 2VH5L 4JHOA 2IBZY 4HZAA 4G80A 1NEZA 3VU2A 1BYBA 3U57A 3CH9A 3TBYA 1FH5L 4FQCL 1UM4L 2BOBA 5DR5H 3L4YA 1KCRH 1PW3A 5F6HJ 2R15A 3PZQA 5I1GH 4QDMA 2NW3B 5HI4D 2VERN 4XAKD 3ZDXE 5DR5L 2H45A 2IPKA 4GKLA 4Y0GA 1OGTA 4HS6B 3BISA 3LKSB 3UX9B 3BAJA 2FLRT 4R4BB 3V5DA 2R2BB 1UWQA 1PZ5B 3GM8A 3U4AA 2QLYA 2BVOA 3KPRE 3QFJE 4PG9B 5DJYB 4XPFL 5ECUA 1LJYA 1E4WL 1Q6DA 4FTVD 3LPGA 2D31A 2UY5A 4GG6E 2EABA 1HINH 4TULL 3EDJA 4HWUA 1UM5L 3RPIA 2ZUUA 4HK0A 3MXVH 5ADPL 3OG2A 5FOJA 2A6JA 3LAFA 4MCYA 2BNJA 4QYOB 4Z76B 1LLOA 1MCLA 1QLRA 2HVKA 4GBXA 2P49B 4ODUB 5IBUG 4U7SA 3GMOA 2HA1A 3B5TA 1QP1A 2CIKB 4YZFE 3ZR5A 3CK0H 2ZG1A 5ANMB 2DDXA 5DVOA 4PB0L 2X10A 1X4ZA 3QUZA 4DFIA 1KCVH 1SJVA 1W0YT 2WIIA 2VDNL 3VFOB 2OMNA 5EU4B 3PN8A 2W66A 1F3DH 5A40E 4S3JA 1NGZA 2G3NA 5IB2A 2OR7A 1KCVL 4QOKD 5EWIL 1HH6A 4QKXB 5KW9L 2W0KA 5A8OA 1S7VA 4FA8A 1EGJA 1CLZL 1XCQA 2ZG3A 4QHLB 2X9XA 4RWYL 2F54A 1M7DA 1ZTXH 3DGCR 5ESQA 3L3OB 4X6EB 3MA7B 5GRUH 5EU6B 1I1CA 5AG8A 4X8XA 1JPFA 4K7PL 1MI5D 3ZT5A 4GKOA 1ZBWA 4YHNA 2A38A 3CFIC 3KXFD 5D6DA 4A6YH 2LTQB 4MQTB 4EAMA 1MJUH 3PGFH 2AV1B 5DFTA 1NLDH 3FB6A 1E72M 5I16B 3HTLX 5IB1A 4U1KB 4QGYA 1WTLA 1KCUL 1JBJA 1U3JA 3VXUE 5F9WC 3ARED 4O02L 5D2NA 1UJ3A 4Y4FB 1R5WA 3DMMD 1FZOA 4KPHH 4XCNB 4EK7A 4RA0C 2XOTA 3MR9B 5D2NB 3GMQA 5L9DL 4KI5E 5AG9A 4M6NH 1CPUA 2CHNA 5A2IH 5TDPB 1MRCH 3RNKB 3VM7A 2JCCE 2J7CA 3G6JE 2ESVE 3RVTC 5HI3D 4MJIA 1A6TA 5FHAH 5HGGS 3VSTA 3TO2A 3ZKXB 1T0NB 2XKNB 2IANA 4XC3H 1RZJL 2VDPL 5FHAL 4HFUL 3HC0A 4MQXC 5JDSB 2E4TA 5DFAA 5I6XC 1J05A 1WK0A 2X6MA 3U7YL 2VRQA 4RISH 3PWUA 5IOPB 5C9JB 1CGUA 1P4BL 4HUNB 2JJVA 2EDQA 4JFYB 4LCYA 3U7YH 3KL3A 2VE6A 4PJDF 2J75A 2GSGA 1CFSA 1LK2A 4OFYA 4EI5C 1JPSL 4ZOAA 2ZPKL 5C0AA 5LA2A 4ODUA 1ZHLA 3MV9E 5T3ZE 5C1MB 3TYFB 2JLLA 1YEJH 8FABA 1XSJA 1ONQA 1L9MA 3RVWC 2QQQA 3WUWG 1U58A 3VXMA 1H5BC 4IBLT 4Y5YB 4JO1L 1KLUA 1KBGL 3MA9L 2O26U 3OZPA 4E41B 5EZIH 2BVQB 4OD2B 1R3IL 3RTQD 4QTIH 5J1TC 3CUFA 4ZSOE 2ZOLA 4YHOH 3TIEB 4X4XA 3RWFB 1G7LA 3FB5A 2QLVB 3TF7C 5T1DL 3T3MF 2J8UA 3EW3B 1EXPA 2LVEA 4HLJA 1UKPA 4KY1L 4G5ZH 5M17A 1U2YA 2F53D 3MUY1 1B3XA 4QXGH 4AT6B 4XWGH 1TQCB 1EHAA 3HI5H 3WQ5A 4I0PC 4K8RD 1BLNB 1ZT7A 2F8VA 2P5ED 3MRMB 4FXKB 4KY1H 1XV8A 1M7XA 4BELD 2FX9H 3MV9A 3RI5K 4NCDA 2DYPB 4PRIE 2DM3A 4GRMB 5GHWH 1G9EA 4M48L 1KIPA 3SKOA 1TCMA 3GK8H 4YPGA 1HL9A 1OSEA 1C92A 2E5EA 1YZZA 1INQA 3RL1A 3RGVC 4X6CF 1A4KA 3WLWC 5L8LB 3OLGA 2ADIA 1K8IA 3T1FA 3MQIA 1AQMA 1CGSL 4W88A 3N9GL 3JVGA 3QIWA 1LNUB 1FG9C 5E08L 3VXUB 2X1OA 4JREB 5MENA 2FNBA 3TJHD 1H8SA 4YEFA 1KTKE 3IJYB 4M9OA 3FO1B 5FHBL 2X9WA 5DLML 3OGSA 4QHUA 3RWFA 1OSPH 1CR9L 2WC4A 1CE1H 4ZSOA 5JW4R 4P2CG 5T1KB 1KLUB 2WWMD 1Z5LA 4HLZH 4HEME 1SYVB 3DMMC 1P4LA 4QOKB 4F7EB 2O5ZL 3JSSA 1D6EA 5A3IC 3STLA 3MMUA 3SDCD 1IQWH 1I7TA 4QHMA 1U95A 4P2OB 3W38A 4XCFL 3CVHB 3THML 5F88B 2HVJA 1WLHA 3WIIH 4LSVL 4KHXH 2YSSB 3X11B 1RZKL 5TQ2L 4P23D 4LSQL 4UZUA 5JBDA 1IGMH 1FNFA 3WD1A 3RDTA 1DQTA 5ECJE 5F7DA 3TO4B 5GGSA 1A7OL 2CGRL 3WEOA 1ES0A 2JELL 4S1SL 1JWMB 1UA6H 3DNKA 4X7TA 3KEHA 3BKMH 4UQ3A 3O2DL 4NZTL 4XP4L 3RWCB 4UOW1 3UTPE 5C2UB 4URTB 3D39E 4JAWA 1JPGA 1JRHL 1G7QA 3U9UA 1LEKA 3QIUD 1BSIA 4EE9A 4WO4B 2ITCA 3QRFM 2ZUTA 1UWIA 1QNSA 2NYYD 5HOSA 1SMOA 4QRPE 4KTEH 1IGTA 4IRSB 1X5AA 5FGBA 2YKKA 2NY5L 4Y4HB 1T03H 4GIAA 2F18A 5JORB 2VC2L 3FFDA 5TGBB 4DZBA 1EDTA 4EI6A 3GNRA 5D5MF 5IKCB 4XBGB 3MLZL 5C07B 5D2NE 3CMJA 4PJ9A 3GIZL 1XH3A 1T6WA 3N04A 3IJSA 4WI2A 3ULVF 4EUPB 3WFDH 5GGTA 4NUJB 2XY1A 3ZKMC 3SUUA 1TITA 3OBAA 1QFWH 1YN7B 2WM0A 3DGGB 3U1SL 1TVHB 4L4JA 3BVUA 5AC4A 2K9UA 3MRJB 4O00A 1OD8A 4UV4L 4H20H 1N3NB 3VXPA 1TVBA 1M7DB 4NHCL 2L7UA 3SCPA 4OFVA 3UTOA 2XNAB 4QCEA 1J1XL 2F1AA 5FUZL 2Q3AA 4PRAA 3REWA 3RWGA 5I1JL 5CEXB 3I6GA 3DVGA 3KJ6H 1TNNA 4KROD 1WCBA 4GAYA 2GVYA 3O6LL 1YJDL 5EC2A 5D9MA 5FYJD 5HYSG 1I9IH 4CVWA 2QSCH 2QQNL 1A7RH 3IDYC 1JN6B 4ZFOB 4YBQC 1YQ2A 3O6KH 5FYJL 1CS6A 4CKVX 3VIIA 1A6VH 3CX2A 3UG4A 4BFBD 5HGDB 4D6JA 2J8UF 3GB7A 4DW2L 3CMOH 3MV7D 4QEGA 3DX6A 3HE7B 1VF8A 1CLCA 1UC6A 3OAZH 4ESKA 2IADA 2BSSA 2KH2B 3B3IA 3BESR 5FM8A 4A2MA 3APGA 3BIAX 1XMWA 3TCLA 3EFDH 4PJAF 4M82A 5A6KA 3QHFL 1A64A 3JBG7 1KFAL 1TIUA 4Z7VA 2X89D 2PR4H 4JFFA 3EMZA 2FGZA 3WUBA 3DWTA 1C16A 3JWDL 4KUCD 1G6RA 1KT2A 3MNVB 2PXYD 1CGWA 3OPZL 2PWGA 1HDMB 4IDLA 3L3GA 4IOFC 4TN9A 5JUEL 1UD3A 3FQWA 2NY1C 2WW8A 3D2UA 2IPUK 5FO8A 3C09C 1WITA 4U1LB 1IAKB 1AGDB 2P7TB 4QNPF 3T1WA 2VLKB 1QYGL 3P73A 3VXNA 5DT7A 3KPSB 3BO8B 5INDB 1NOWA 1GSMA 3QEUB 3RA7H 3KWXA 1GXEA 4Z7WF 2VQ1B 2VO5A 5CINH 1LDPH 2VDML 5IW1B 2G4FA 2J8FA 4HWNA 4KRPC 1WICA 2OK0H 4ODWB 4F8XA 1ZMYA 1GZQA 3E2HC 2IMMA 3UTZB 15C8H 5CILH 5HHQA 3RNKA 3W28A 3TV3H 2EC8A 3FQUB 3KPQA 4NPYA 4WW2F 4N8CH 1S7TB 4ZUWA 2QPSA 1NCDL 2NY3D 3P2TA 3HNTH 3CC5B 4OCSL 1FPTL 5HHXH 4F57L 4FQIL 1Q9LB 3HNTL 4WI6A 4E4PA 3PIQA 5F7EL 3O41A 4KK8D 1GPFA 4FZEH 3OAYH 1HIMH 1KJMA 3WJJA 5E2JA 3LKRA 3CZNA 2DQGL 5AAMA 3IGAA 3PZNA 2XZQH 2PBGA 4Z2IA 1UXSA 3CH1A 4U05A 4B53A 2XVGA 1EEUA 4PGZA 1DVFC 1T04B 4LEXH 2VKXA 4R97C 3TA9A 3MRCB 4HS8H 1WFOA 2IMNA 3DO7B 2VN7A 4QP0A 1KFWA 1RURL 4PY8I 3D2UD 3GKWL 3ZL4L 1L6ZA 2ZCLH 3AQUA 5EO0A 5D1ZC 2Z1KA 4HUXB 1RZ7L 1RURH 4Y5VB 5HVWA 2DT2A 3UPRB 4LP4A 2JF1A 2AV7B 1E0XA 3MJ9A 5FKAA 4J12A 1YEEL 5F9JB 3EDKA 4JG0H 1MOEA 1NL0L 4WI3A 1PIFA 4M61B 3I9GL 3VFOA 4LKXA 4LAQL 1YEEH 5M95B 4PJBA 3U6RA 3BKJL 5EBLB 5I8CA 4ODWA 4CJ0A 5D5ME 2L4OA 2WW5A 1J8HB 1NFDF 3B83A 2VLRB 1DL7L 3ISWA 4NQEB 2ZX6A 5AZ2L 2WSPA 4YHGA 3ARGD 1DUZA 3MGOB 2XIDA 4JHZA 1JDAA 1MRFL 3GHBL 4GAGH 2BRRH 3NACL 4HWZA 1QSEB 4CJ1A 1I3UA 3BVWA 2Y07L 4UTFA 2GSJA 4YQXH 3WF4A 1V0MA 4M7ZB 1FRGH 5HHNA 3LS5L 1HH9A 4L4TB 3U7WL 2QHRH 1BBJA 4X98A 1WBXA 2DKUA 4K71B 1SJEB 1JGEB 3AXHA 1OCQA 4NBZB 5DEZA 1ERNA 4RDQG 2CRMA 1EEZB 5E0FA 3QULA 1MUJB 3BEWA 5DD1L 1ZLUK 4AMXA 3T3PE 4P5MA 4K9EC 3I6KB 2C1OA 3NIYA 1WGOA 4AIZB 2IH1B 3WFHA 4AG4H 3DX6B 3HE7A 2YC1B 2NY1D 1Y18A 3EJUA 1B30A 1RJLB 1CGVA 1W9UA 2GJXA 1WZAA 3VIPA 1RK1A 1WIPA 1QPKA 4Q0XL 1BD2E 5KSVB 4PSRA 5BRQA 2AJSH 4NZJA 1HNYA 4JN1H 2VZVA 4MXVE 3OKLA 4LLDB 1N2RA 1CFQB 4EI5A 1HHKA 1U8NB 1WSST 4JN1L 1U30A 4Y8AA 4PBXA 4PGEB 4AEEA 1Q1JH 5HYSB 1ZXQA 4NO5B 3P9LA 4Y89A 3FO2B 2FBOJ 1Q1JL 4L4TE 3MNWB 3AHYA 4XRCB 4MAUH 4HT1H 2D7NA 1PY4A 2MMXA 1JF1A 3I3EA 3X12B 4TTDD 2W60B 3QDGB 3MUZ1 3ZYJA 4A3YA 3EOYG 1QO3A 5F7LB 5FV1L 4L4PA 5JW4M 1PS3A 5FK9A 3AHXA 2AQ1A 2XN2A 3X14A 2FJGA 3QUYD 1QFUL 4XNXL 3WL1A 2AJYH 2DJ4A 2RR3A 4WTWA 1FNGA 4D6GA 1JPTH 4NQEE 3DMMB 5IEKB 4OTXH 3D6GA 4MCZB 5KSAD 1D5MA 4XAKE 4XNMA 4UDUA 4LCWA 3WYRA 2H2PD 5KSVA 3OKOA 1ZEAH 2CBUA 1RK1B 5AAWA 3MA9H 3UTSB 2YA1A 3ZSTA 4F3FB 1P84K 2C1PB 4HUWA 3SDAD 4PYSA 1T21A 5I9QC 2DLTA 1V7NH 4EDWH 3A4XA 4KXZI 3WD2A 1BF8A 4P5MB 4JL1A 3EO9H 5I73B 2DLIA 1X5HA 5BOPA 1JNHA 2VVNA 5IVNA 1MUJA 4KKCD 1L7IL 5CIPB 4EKXA 3QQ4B 3S3SA 1MCHA 5HTSA 4MD0B 4FRWA 4L3CB 1OTUC 1DQLH 4CVXA 5IHLB 1F2XK 4CD6A 1IEAB 5I6XB 5BXRA 5BRPA 1NEZG 3VMOA 4HJ0C 3QCVL 5IB4A 1CLVA 3S37X 3ZKND 1U95B 2BZDA 1KJ2H 4EQ3A 4Z2GA 1QSEA 3TBSB 2VT0A 3OKMB 1CEOA 1URLA 1CNVA 5E2VH 1QWNA 3PGCB 4Y4KA 4LIQL 4PJ8A 4WJ5A 1BJMA 1QSVA 3G5XA 3ULUH 1YQVL 2YPLE 5I24A 3OV6A 1TPXC 1LO2H 5T1KA 5E08H 4NM4L 1E9LA 1OIFA 4EN3A 2AK4D 3HG1A 4CW1A 2YD4A 4E8DA 1S9XA 5TH2A 5F7UA 3MRLA 4UFIA 3MZGB 5EU6E 5DVMA 2ID5A 5I8OL 3S5LG 5CJXC 2V5TA 1W8NA 4LNRA 3OTTA 4TOYL 2EAEA 1IC4H 3PV6A 2WZPD 5C92A 4FG6D 5D7SL 3MV7B 4ISVB 3RDTD 4OLEA 1SFSA 4OLUL 3FQTB 1A7QH 4LOUC 2VLKE 4Z0XB 3W82A 4N1EA 4F7PB 4Z6AT 1CE6B 2J78A 1UR8A 1EUTA 1LE5A 1C12A 3EFFB 3PZMA 1Y0LB 1HWWA 4N0UA 4R7NB 4OZFA 1RQ5A 3OAUL 3BQUA 4GPNA 3GHEH 4KK8C 1NCUA 2CHOA 2OTWA 2ZE0A 3LX9A 1ISZA 2VLLA 3RWHA 1N7MH 1F58L 1YEGH 3VFGL 1QSEE 3IDMB 2A9NH 3HMWH 3V8OA 3BIKB 3PTQA 4RGNE 4TRPL 1X4YA 3ZSSA 1BG4A 4DGIH 1F58H 1YEGL 2J8UB 3VFGH 2W65A 3KYOB 1B1YA 2XG5A 3QO0A 1KXVA 4P0DA 3TIEA 5DD3L 3W26A 4UU9B 3WUFA 4U6YB 3WY4A 4M1RA 3L3HA 4TVPD 2YLLA 3RWIB 4IRJD 4D2NA 2AXFB 4G8FB 1VESA 3HE7D 4M1CC 1U3HD 4N8VA 4HIIA 4M43L 4P2RE 1ZLVK 2FJHB 4PREB 4X9GA 3HPJB 4Z7QE 1ZLVH 4PJFF 5DK0B 3BVVA 3VMNA 2IQ9H 3CDFA 5E8NB 4FHBD 4LIQE 1Q6CA 1DBKL 4FNLL 1WTGT 1CCZA 3KR3H 3IDNB 5LJYH 1CDIA 1X3DA 3OX8B 1MEXH 3CJJA 1NWUA 4DUVA 1U8PB 4QRRB 3LPOA 1AO7D 4MD4A 5DZOA 2YD3A 1HJUA 3KG5A 4S0SD 2HFEA 3CVHH 4WFED 4YWGL 5CKGA 3L3DA 1FFNB 1J05B 2EDBA 3CFDB 5E94A 5FGCE 1WNOA 1XGQB 4WTXA 2EICA 4TSCL 4WHCA 1MNUH 1P4BH 2G75A 1CYGA 3JV0A 1RK0B 5E6IC 5EIQA 4ELMA 4LX4A 2P8LA 3TA3B 3WNLA 4H20L 1YEDB 3WF2A 2APWA 4NJAL 4UDTB 4UT9L 4K3DL 4Y19B 5FYKE 4DVBA 5EC1B 2FEDD 2CK0H 2FYYA 2IADB 3K3QA 1ED3B 2UUDH 4FNUA 4NC2B 1H15B 3RWIA 1KQYA 5BS0E 3WH5A 4YGVA 4LHUB 5HPMA 3VD5A 1BOYA 1CICD 2H9GA 5CP3A 4PRWA 2FBJL 4ZUSA 1NH6A 4YUEH 3FJTA 2DMCA 1FYHB 3M7SA 5A16A 2PYEA 4YAQB 3DSFH 4UFKA 1LEIB 1DWIM 4XMLL 3NFSH 1KULA 1U8IB 2X1WL 3ARYA 4YUEL 5I16A 1OLLA 1MREH 5J6GA 3NBNA 5BO1L 5KJRH 4F58H 2GEEA 3I85A 3O4LE 1E6OL 3SKJH 3RHWF 4JB9L 3PWJB 1E28B 5I74B 3WE6B 3D0LA 3DX3A 1T4KB 3RJDA 3P4LA 3ZT7A 5JHDB 1JZ5A 1KENL 3IFNH 1GYAA 3OGCB 1E28A 3L3KA 2IWGA 5F8RC 1B0RB 4P2QE 4GRWE 5DUPH 1FP5A 5JPNA 1OW0A 5IESL 3D3AA 1JP5A 4PJEA 5I71C 3EJQA 1K4CA 1KJVB 3OKKB 5DD5L 5A6MA 1CDGA 1S7WA 5DHXB 4UOJA 2QADB 5IESH 1OTSC 3A67L 3QXUA 3S36L 2WYSA 5BVJB 2BFVL 5DD5H 4P7NA 2J7DA 3WL9B 1QQDB 5LGJB 1V02A 3V5HA 2H9GB 3VDBA 3KPRA 2Z93B 4P9HL 4JVWA 4JAMA 4AIEA 3BFOA 3F6IA 2XN1A 2IAMC 4XVJH 2NLJB 5T1KD 1TNMA 4FQXA 2GAZA 4NQCA 3M8OH 2A3CA 4X5WB 3AHTA 5BRZB 1MJ7H 1KACB 4DKDC 5LAXA 2O5ZH 3WHXA 1JIBA 1CFTB 1TTGA 3O8XC 4OFKA 5E5UB 4WDIA 1FIGH 3VFPB 4UQ2A 1EEQA 1T80A 4X7TB 4HZLB 3UMTA 2JK5A 3HUJB 2C0HA 3IETB 1QZ1A 1IFHH 5IFAL 2CR6A 1A9BB 1I1RA 1BQHG 4I3GA 4L9LC 3O3AA 3QQ4A 2ZXAA 3K1DA 5HVGB 4TTGA 4PB9L 3VGBA 2V7HA 4PJ5D 1WAAE 5FF6A 5C8JA 4Y1AB 3PQYD 2YSSA 3QIBA 4UB0L 3WEZA 2DYPD 3RZCB 2EIDA 3MCG1 3R4DA 3ZDXF 3GKWH 3HI6L 1ZS8A 1FQ9C 4KU1A 2A77H 1IKFH 3AU1A 1D6EB 3TBTB 4ATWA 1H3XA 5J13B 3A4AA 4ZAKB 5IHZB 5GIRA 3RGVD 1OP5H 1V02E 3MJ7A 1UYWH 5KSAA 5FA4A 2HT3C 3DIFA 4JFEA 3B8SA 1A9EB 3H9SA 2XPGA 1ZGLA 1B4RA 4MNLA 5B39A 3MJ7B 1GPOL 5KSAB 4M7KL 1WWCA 4JLRA 1OGSA 1PLGL 2KPNA 5GGUB 1AP2A 4I18A 3CHEA 1JL8A 4ZQKB 3GMLB 4S10A 1D5XB 3WXVH 3KS0H 4FLQA 4HXAH 3PABA 2QR0A 1JI2A 4NWUH 4UTAH 4PMRA 3N85L 3BI9X 4LLMA 4OCWL 3TN0D 2Y9RT 1YN6A 4X4YB 4R7NA 1OM3L 1M01A 3L2LA 4XT1C 3IDJA 1UH4A 5GRZA 1DVFB 5A3ID 3KXFB 3ALFA 2OSWA 4PUBH 4AISA 1YDPA 3A24A 3SCVA 4LDEB 1PG7X 5K59F 5A94A 3QFDB 4AMWA 3F7YB 1UM4H 5GGQH 5IW3A 2MQCA 2VX4A 3ARXA 3FT2B 3MRBA 3W6LA 4HMDA 3RMEA 4JM4H 5IBLC 4R8WH 5FGCB 5SX5K 3C9NB 5I1AB 3MLWH 4JE4B 4WDIB 1ZWIA 2NYYC 4B0MM 3PZTA 2NY6D 1S9XB 4MJ2A 3W27A 3WD0A 1OTSD 4DWSC 2D0HA 3HMXA 3RTQC 3U7AA 1F90L 4ACZB 1NOUA 3VXMB 4I4WB 4P7QA 1QFHA 1I8LA 4J27A 1HXJA 2MQ0A 2WBJD 3CIQA 1E0OB 2BJMH 4KI5C 3DUHA 4Z7NE 1WWWX 2FJFA 1U3HC 2D03H 5JOEA 5DFVC 1FORL 4X6DB 3GO1H 5CKAA 3VXSA 2NY0D 4HWBL 5HD8D 4L3EA 3WL9A 4AQ1B 2P5WE 3WO4B 4WI9A 2XIBA 4LSUH 4K3JH 2BS9A 5C07D 2OP4H 4X0NA 4O4YL 3QG6A 5CEZH 4AZCB 4YHIB 1ND0A 2DT1A 3C8KA 2A74A 4LSUL 5T5FH 3CZFB 1WDSA 4P46D 2VYRE 4ETQB 1B0RA 5SWQB 2LFGA 4YLQT 1KIQB 4P3DA 5HVHC 4HUVA 4YN5A 2D2OA 3FTGA 4D9RE 4NQEA 4NYLA 1NC4D 3ZJKA 1DLHB 4PJCA 4ZUTA 4Q9QH 3TA3D 1BX2B 2E0PA 1HKIA 5KTEH 3SUTA 3B5GA 4U1MB 5C07E 1ZTXL 2WWKT 5I6SA 3KLHC 1V7MH 3K1KC 3MV8D 4BK5A 3HRZA 2JIXB 4PLOB 4LMQI 2CITA 2X44D 3GFUA 1RZ8B 3QWOA 4LHQB 1KELH 4PJHB 5KZ6A 2D0FA 2AEPL 4ZXBB 1NCBL 4JJHA 1RIHH 2FEDC 4IMLA 3VFTA 3TVMB 4XCNA 3RL2B 5CAYB 3UYOD 3OXSA 4K7PH 1T83C 4FQIH 1W9VA 5E99H 4P7OA 4AD5A 1OM0A 1SBSH 1QVOA 4TUJA 4DCQB 3D85A 4ORGB 4P2QD 4UTBH 2AXGB 4L5FH 3DO7A 4JFDB 2F19H 5H35B 5TF1H 1NSNH 4NBYB 1TMCB 4RZCB 4LLUB 5DUBA 1BQLL 4LLYA 2ZNXA 1P7KB 1I1YA 3WDQA 3FO0H 3P77B 1GW1A 2EQDA 1BQLH 3LRLA 1OL0A 1OP3K 3RX7A 2A6DB 1WWAX 4HXBH 1Q9OA 2PW1A 3P9MA 5JQHC 4WV1B 2ZCLL 5I74C 5KAQG 1HH6B 4OV5B 2Z9TA 4IRSC 1MRCL 5ISZE 1NGZB 2O9OA 5JBEA 2IAMA 4OQTH 1ORSB 4PPTA 2E9JA 5FYKU 1UD2A 3KPQB 4PV9B 1Q0XH 4WRLA 3O4LB 4YHPB 3DUSA 3PHSA 3VGHA 4A6YA 1HXKA 4XNQB 3RVVC 5E8NA 1FBIL 3WHE1 3QCUH 1UKTA 5CZXD 1JHKL 3OAZK 1MHEB 4YHZL 1I3VA 4D6CA 4GW4A 4GQ9H 3RPIB 5CQ1A 1QSFA 1JHTB 2GTZA 4GMTL 3I02A 4WENB 2JALA 3MJ6A 2BVPA 4JY6B 3VRJA 2VUOA 1W2KT 4P2QA 4MAYA 4ACYA 3U0WH 1RZGB 1RUAL 1KBGH 4AD2A 2HP4A 5DI8A 4LSTL 2KQMA 3AB0C 3MBEC 5D71L 2VDQL 4M93B 4TYUA 4WUUE 5CD5D 3LCYA 5CHNB 5DURD 4JGMA 4MB4A 3U4BH 5D71H 1NCAL 1ACYH 5DA0B 3ULUF 4OLYL 1HWHB 32C2A 3MV8A 4L4VE 5C08E 5HD8C 5L6YH 3TBYB 1DDHA 1FFOB 1GOFA 4I4WA 5DO2C 2ZWZA 1J9YA 4DKFL 4LXFA 4KKAD 4ZS7H 5ACMA 5FUCC 1T0MA 4K8RL 1HHGA 1WZLA 1XGRB 1DLFH 5ERWA 2B1HH 1K2DB 1D9KB 5GHWL 2ICWI 1EGJL 5IEHA 2I9LB 4KKBD 5DGQA 1DUYB 1FFPA 4W4OA 5L2KD 5I30H 1SYSA 1OHQA 5CMAB 4PGBA 4PP1D 4Z95H 5F97E 2YPKB 1J1PL 4P48A 1MQKL 1HHHA 1TJGL 5J56B 1C91A 4X9FA 4IJ3C 3KLHD 4MQ7B 4WV1A 5DFWH 3BPLB 3WD5H 3FQRA 2YD8A 2JJSC 2VZUA 3DVFA 3BHBA 2R4RL 1LD9A 1IM3A 2WINB 1CR9H 3A6OA 4F7EA 2ITDB 2WBJA 3MRPB 3CZKA 4H0GA 3H0TA 1ECEA 3DI3B 2D4DA 5J3HC 5DRNB 1DTUA 4JFDA 5FHBH 5H35A 2X1PA 4MJ5A 1HCFX 1Z3GL 3SY0B 1OTTC 1K8DB 1KPVA 3UTSE 4HGMA 5B39B 3HUJF 3O9WA 1T5WB 2VDLH 5E2TH 5KAQF 1BFOB 2ZUMA 2EACA 1PKOA 1JYNA 1OGAB 1CFBA 5FUOH 3BEVB 5FL0A 5E2TL 3AREB 4Z2HA 3WIHL 1RV6X 4X0KB 5F89A 3CLWA 2GJJA 3FQNA 5EO1B 4JG1H 3V6ZA 1KCKA 3P0VL 3OB0K 3CHDA 1RZJC 3DPBA 2UUDK 3QCTH 4YXLL 1UR9A 3ARFA 1QEWB 3AMGA 1CIUA 3O2DH 4NZTH 1B0WA 2HT2D 1MWOA 1R7OA 4Y1AA 2DDQL 3PWPA 3S37L 5K59E 3BSZH 4HIEB 1BVLB 1J10A 1INEH 4EDWL 4W87A 3BEVA 4BFIA 4DWSB 1XCTA 3CC1A 3NABL 1INEL 1HDMA 4G8IB 1WBYB 2FR4B 3LIZL 4MVBC 4P23A 4Q9RL 2FX9L 3BDYH 2C3HA 4L3EB 3KPLB 5CSGA 5HVFB 5K9QI 1E4XL 5HYFA 1XGZA 5D7JA 5E09A 5D1XC 5DFVD 4NFBA 2HJLB 5C0BE 4Z7QF 1G9NH 1Q9WA 3QG7H 3FFCA 1FL3B 1GGBL 3NPSC 4WFFD 4BH7B 4ZS6C 5DQDH 4FMKA 5F1NA 4OD1H 3SDCB 3LH2H 3MNWA 3C08L 2AVGA 5KSAC 4A2LA 5D7LD 5ADOH 1FG2B 2IXUA 2DQTH 3EYFA 1OAQH 5J11B 4NF7A 1IC7H 2BNRB 3MRGA 3CHCA 3WFDL 2YL9A 3QUKB 2ZUQB 3IS1X 3HB3C 5EU7E 2JB6B 2KQNA 3ZMRA 4GBXC 4LLQB 1AY1H 2ESVB 4DOHB 1GGTA 3NFPB 3LKPA 1SMAA 1TTUA 2JJSA 3S5YA 1Q6FA 1QFWI 1B0GA 4QXUH 1QOXA 3WLBA 4NNPL 4RA3A 4ALAL 4M1DH 3VI4E 3U30C 3WUZA 1ORQB 4ODSL 1ZT1A 4YFLF 1W2PA 4ZFGH 4X83A 3QUXB 1X6NA 4KKCC 4ZXBC 1KB9J 3VXPB 4CADB 1FZMA 4POUB 4TUKL 2UWFA 2H2PC 2ED8A 2C1OB 1QI5A 4NN6B 2XTJC 4DW2H 4X6BB 4LQFL 3R8QA 2APVA 4AH2A 1JAEA 3ZE2E 1Q9WB 2ARWA 1R3HA 5CHNA 3TN0B 1GGYA 1SEQH 5D7JB 5E4EB 4ELKB 1N64L 3NCOA 4XBGA 5GSRB 5L2JA 2JELH 1ROWA 3LKNB 3MLUL 3HFML 2JE8A 3TYGL 2GYSA 2PO6C 2DQJL 1UHVA 1P5UA 3HMCA 1IM9D 3O2WL 5CBEA 4OD3L 5I18H 2E9MA 3BJ91 1K3ZA 2LU3A 3GXMA 3VGDA 4KHTH 3MACH 5JUEH 4UZSA 8FABB 3MLTA 2F58H 2LE9A 2V2WB 4LFHD 3U0PB 3WBEA 5GGRY 4FG6C 4PD4K 4QTHB 3UESA 3RBGA 4I2XA 1FL6B 3RA7L 4G6ML 5EBLA 5I8CB 2BFGA 1BVKB 4WWKB 2XN0A 1V6YA 1AR2A 4AEFA 1P69B 1Q94B 3AIBA 4YFLI 1U8QB 1FVCB 4XPAL 2DIBA 2ZCHH 3PWUB 4KVNH 2R9HD 4PJXF 4XNYH 1CZ1A 1HHIA 4MAYD 3NIFE 1U8QA 3RDTB 5GGVL 5EUKB 3KYKH 3EHBD 5GGVY 2GFBA 1E6ZA 1I4FA 2JK5B 3HUJA 4PIRF 3T0EB 2OK0L 1V0KA 3GMNB 4HKJA 4LSSH 1JTTA 2ARJQ 3GBEA 3T77A 4ZYKB 1HIML 1CL7L 1FGVL 2R4SL 4K23L 4H8VA 2DQGH 3K4ZA 3MO4A 2XFXB 4X5LA 5F6IC 5I1LA 4N0CD 4BSVA 3MI6A 4JZ5A 4YHLH 4X5WA 5EZOH 3WQWA 1XGTB 1QBBA 4UT9H 1EV2E 5IFTA 4NQSB 1IC5L 4RAUB 3FT4B 5GJTH 2YBTA 3QT2A 3VXRE 4JHWH 1DQQB 3IRPX 1R5VB 4ZS6D 2ZKHH 3QOMA 1WB0A 3BPOC 3OJDB 3ARUA 1C5BL 2QQNH 1UR0A 1A22B 4WI7A 1B31A 3WFLA 5BVJA 5K9QG 3KHOA 3O3BB 3LRSA 1RZ8A 3UJTH 2RHEA 3ZDYE 1IAII 2J4GA 4J3VA 4WO4C 4DGYH 2NCMA 3S4SB 4NO2A 4M62H 2AABL 3C6SB 4M56A 3GXIA 5HYQA 1GZQB 4O58L 1IGIH 3QNZB 3VX0A 2P24A 1GOIA 2AOSA 4WEUD 2NW2B 1DLHA 2BJML 1N59A 3SKOB 3RQ3A 2XGIA 3BO8A 5INDA 2IQAA 2GJZA 3RX5A 5T3ZL 3WNNA 4QRSA 1DSFH 2PR4L 3HHRB 1RJCA 3CIVA 4LAQH 1JG9A 1EQCA 4KJYB 5HGHA 1R5IB 2I24N 3KPMA 2AP2A 1WZKA 2QSTA 3GSQA 1BZ9B 4AEHH 1RAMA 2DLGA 3MRGB 1HF6A 3MBXH 2VSDA 1US2A 4JFFB 4HOWA 3VFNA 3RNQB 2BVDA 2XKSA 3EYFB 1JF5A 4X4XB 4B9ZA 2BNQD 1DQQA 3ARFC 3MLSH 3FT4A 2IH3B 3ZTNH 4E41A 2ZUVA 5KTEL 2VL5B 3LRMA 1PGRB 3AFLA 4LNVA 4RQQA 1MCOL 1DQML 4GOSA 2PXYC 2V7NB 2WV3A 4WUKL 5JQ6L 4CN4A 2XHYA 3E6FA 4IOFD 4UDTA 4HEPG 4ZD3L 4GKNB 2GJ6D 2ICWJ 4M93C 1DN2A 3V4PL 3VFRB 3NFNA 1M53A 2OTUA 3CPLB 5DMJB 3WIHA 1KCUH 3RDTC 4LHUD 2YA0A 3IDIA 3VXRA 3PZUA 3NZHH 4AG4L 5IG7A 4ZFOA 3OGVA 1A6UH 2VR4A 1XSKA 5E8OA 1FIGL 1FNAA 4F7TA 5DD1H 1WAAF 3QFDA 5IOPA 4TVUA 4WUUD 4J23A 2HYMA 2CUIA 4UOQA 4JHAL 4JKMA 3AM8C 4UTBL 2EYSA 5J1AB 3JV5A 1DBMH 2ESCA 1I9EA 1IGCL 2E9WA 1XF2A 4XVTL 2XQBH 2XWJA 4XBEH 3PZVA 2QQLL 2HFGL 1BVKA 5GPRA 2O5XL 3ES6B 3BP5B 1RZFL 3RVUD 3WHE0 3GSRA 3ZJ6A 1XGPB 3MCLH 4U33A 1U36A 2YUVA 2DPEA 1CXFA 3MV01 5JZ7D 4MSWB 4CMHC 3ELAT 1U6AL 5HBFA 1U2CA 3RVXC 5I75B 3MYZA 4I3RH 2FYVA 2Z31B 4HWEH 2EDTA 2HG5B 1NC2A 1HSAB 5JXEA 4ZQKA 3D85D 3D85B 4RISL 1FGNH 1NFDB 1NGWB 7TAAA 4M8VA 5K9OA 4UNIA 3GMQB 5FM5O 3VFSA 2AI0L 5JORA 1ZLSH 2W65B 1CGTA 2Q8AH 4G8GD 2CXKA 4ZXBA 3SY0A 2EDKA 2OL3L 1JGLL 1HXMB 3O6ML 4JY4B 1IGYB 3TN0A 2Q8AL 4YHZH 3GMMA 3K0WA 3BLPX 1WV7T 1KBBA 1JF1B 1CG9B 1QACA 3HB3D 1CK0L 3MRRB 4KZEH 5D70H 4G6JL 4HXAL 2CKBA 3QJFA 4HF5L 1PFCA 5BW7A 3SKNA 1HQRA 2X7LB 5JLZA 3GSRB 4NQED 3RKDD 1TQCC 1ISVA 1ZHBA 3SE8H 4B5EA 1KXVC 4GI8A 4L1DA 1ETZA 4UCFA 3NIFF 4ONGL 2OLDA 2RJMA 1RP9A 4HPOL 1H0GA 3HAEH 3RIAK 4RGNB 1BQUA 3WF3A 2VIRB 2DQHL 1OBAA 4U6HA 1KTBA 3S35H 3PWLB 2CKSA 1AHWB 3CXHK 1YECL 3WFCL 3VH8B 3A5VA 3SE9L 3KDMB 4LCUA 3EYVA 5BS0B 4ONFL 4D8PB 1OD0A 4FLOA 4Z5RB 5D7JC 5E4EC 3BMWA 3U2SA 4K8RH 3EZ8A 5A69A 4G8EA 3SURA 1KSRA 2A3BA 1L0PA 4NRRA 3WMSA 3I6KA 3PWPD 4Y5VC 1JGUL 4XVSH 4RQQB 2B4CH 1P4LB 1AE6H 2BY3A 1W1YA 1P6FA 5TJWK 2XFFA 3SE4C 3ARFD 4WI5A 3VGEA 3II1A 1J86A 2EIBA 5TFSL 3SDDD 3RGVB 2BVOB 5FKYA 4BQ4A 3B9VA 1MCQA 3LKOB 1BIIA 4QHNB 3MCKB 3UP1A 5MEQA 3KDMA 4LCUB 4R4BA 5B3JE 2QKIB 2R0ZL 1FC2D 1MW1A 2EPKX 3SCUA 1E40A 1KTDB 3G5VB 1EK3A 5GS1B 1A14L 4FQXC 1CE1L 1KJVA 1IBGL 3ARSA 4HZ8A 3UDWC 5GS0L 3P30H 2Y5EA 5ADPH 2W61A 1KGUA 2D3LA 1ETZB 3AB0B 3MBEB 4OCXL 1A4KB 5GS2D 1J5OH 5T5FL 1ZHBB 3RL1B 2PWDA 3ZOAA 2FRGP 3W29A 4AZBA 1T1YB 5JHDA 2G9HB 4GW4B 4H1LA 4RNRB 1XC6A 1TA3A 4HD9A 3PWJA 1Z3GH 5B8CA 4DFHA 4AZGA 5BWFA 1TTFA 3ZKSD 1BWWA 4YO0A 1NLBL 5HSFA 1VEMA 1CG9A 4ZG1A 3VM5A 3THCA 4PUDA 3PWPE 2A6KB 3DOSA 3ULUD 3BZEB 4JZJA 1AP2B 5HI5C 3HAEB 1T7WA 1N7ML 5D1QD 1GQLA 2GDVA 1VGEH 4XI5D 5F93C 4BQ8A 5C0CA 4PJ5E 3OJDA 3M17A 2VDRH 5FGSA 3HJEA 1RZIB 2ZIDA 4O5LL 2JB5H 4LVOB 5C09A 4H88L 4TPRH 5HI4C 4Z7WB 2LAGB 1U92A 5IBTH 2YXMA 2WMPA 3QCTL 4HLZG 4Y5YA 4LLUA 4OIIL 1HN1A 5LBSL 1K6QH 1T04A 4C7FA 5A6BA 3SDXA 2YMXL 4NJ9L 3JXAA 1Q72L 2CIPA 4CVUA 3WN6A 1CN4A 1BYCA 3SQBA 4KV5E 3B9DA 4BM7A 4ZUUB 2E8YA 3O45A 2PW2B 4A3HA 1L9NA 2GSIB 1KLGB 3CSGA 1UXWA 1LO3H 1QLFB 2C26A 2HWZL 4JFYA 3FO0L 4Y2DB 5D6DC 3VJ6B 4U31A 4BA0A 2HFEB 2FDMA 4ZAKC 1INDL 3T0XA 1DBJH 3TC9A 3QWOB 5MEND 5DO8A 1BREA 1JHLH 4MD4B 5FYLD 1RUPL 4NQUA 4CVZB 4PRPE 2F5AL 5CMAA 1A9BA 2JIXA 3SCSA 1BD2D 2FGWH 1DBJL 5E1AB 5E8OB 5BVPL 1TMQA 1I8LC 5EIIA 5E2VL 3V4UH 3IDXH 1F4YL 2R23B 1U8KB 3CLFL 4JM2A 1H3VA 2FECL 2V3GA 1QNZL 3VI4F 4D0CB 3LEYL 3SCRA 5ADOL 3AY4A 3ZJ7A 2DQDL 1M05B 2E7LC 1GIGH 5I8EA 3IFLH 5EFIB 1QRND 2I07A 4LRIC 2WPGA 1HVXA 5JBFA 1EA9C 4NNYB 3ARTA 4QRPB 2AK1L 5DDHB 5GS1C 3RBSA 3QNXA 4XP6H 4LPTA 3DXAE 3BUBA 2OCFD 1QLEL 2W38A 4D3CH 3O6LH 3SJVB 3W37A 1P2CA 1EAPB 3FAWA 5L2JB 5GSRA 1HH9B 5E9AA 4UNVA 2EXWD 3SJVA 4P5KA 4J3TA 2WC3A 3EKCA 4TSAL 1T89A 4KJQD 4JO4L 1WP6A 1AGEA 2CKRA 1IEBB 2J3SA 4GH7B 4GZEA 4WCYH 1GOOA 2ZNWA 4H8UA 4LPYA 4TNVK 3LPWA 1ACYL 2XICA 1UD5A 2IALB 2EEAA 3T0VA 4W85A 1KN4L 3UTTB 3HG4A 5ESAB 1U8KA 4G5ZL 1HEZB 1MCWM 2J88H 5E95B 3AXIA 3WL0A 3PNWA 4P57B 1XF4B 4Z7WE 5HYQB 2VZ1A 4ACPA 4GW5A 1DLFL 4ZO6A 1MREL 2CDGB 5E1AA 5EC2B 1AO7B 3F7YA 4ISVA 1NARA 3DX2A 2V5RA 5FCUH 1ORSA 4TVPE 1YDPB 5ALBH 4PY8J 4ZUVA 1WZ1H 3RVXD 1NMBL 2WSKA 1T7ZA 3BMVA 4PJEE 2PYFB 4M43H 3L3JB 1XF5A 3W11C 2E7CA 1ZKAA 2WBJC 3SGJA 1TJGH 3FN0H 5E9DE 5T33H 4JFWA 1EDQA 4LSPL 1TENA 2NY4C 1OARH 4E0RA 1BTCA 1RH9A 1DQJB 4OIFA 2MCPL 4LLMB 4Y19D 1YNKH 4NZDA 4PJAE 3MUAA 2BNUB 1E6JH 4K9EL 4U6XB 2B2XL 1EMTL 2KDGA 3A67H 3S36H 3W39A 5JNYA 4AZHA 1BWMA 4PMOA 2ZXBA 1EVUA 3MV8E 4L4VA 5C08A 3HR6A 4E42A 5FOBA 1ZL1A 4V28A 1Y6NR 4OCSH 3WN5A 4OV6F 1JK8A 3VG9C 5J7CC 4YWGH 5A8NA 4NKOB 4RE3A 4U1NA 4IDJH 4XCEA 1E4JA 4P46A 4QRRD 2HKFL 4XCYB 3C6LB 5D1ZA 2HTKC 3IT8D 3TPUA 1EFQA 1E4NA 4MDJA 4NSKA 1BD2B 4FQHB 1WF5A 1B4JL 4G80B 5LGKA 1S5IL 2XXCB 5I5RA 4BQ3A 2XN9E 3KS0J 3Q1SH 4GKSA 2OI9B 4KZDL 5HHOA 3I3BA 2E6PA 1G0YR 4FTVE 1MLCA 5L8KB 5C0AE 2FL5A 3NA4A 1F5WA 4H26A 1QHPA 3SDYL 4O2FA 1VJZA 2I5YL 1C3FA 4JG0L 2VDOL 1WUNT 1NL0H 4NO3A 2AK4B 5I76A 3L3GB 3SDYH 1X6LA 2NMSA 4JFXA 3BSHA 1TQSA 4OGXH 3PGDA 1AVAA 1Q6EA 3O9WB 5BO1H 3BYTA 4V2XA 2ZXDA 1HJSA 3R1GL 1FO0L 5MEQB 2C8NA 1IT9H 2VAAA 4AYSA 2HKHH 3OA5A 2UYLA 3QA3A 5EORL 3S97C 3RAJL 4QXTA 4PJXB 1QX1A 3G6DH 4YDLB 4KTEL 1M71A 4KQ3H 3E8UH 4OCNC 4PJ7F 5ELIA 5FO9B 1B2YA 5AY7A 1F4HA 3L5JA 1R3JA 3VWJC 5F7HA 1UYWL 4FQXB 4N68A 2APFA 3WEXA 1TETH 2EYRA 4X4ZA 2GK2A 2ZWYA 2P46B 2JIWA 2CERA 3KXFE 4PSPA 2BXYA 4MWFA 2V17L 4QHUB 4PTTA 4MA8L 4BQ5A 3QQ3B 1D5ZB 5CEZD 3MRBB 1N2RB 3QXAB 5IMMA 3BAXA 3EYSH 1R8LA 3GSOB 1C5CL 2C5DC 5DGRA 3T2NL 2CDGA 1ZHKA 1XR9A 3FKUS 3O4LD 4BQ2A 1A4JB 1T1XB 5IEHB 3QI9A 5D9NA 1YJDH 3K7UA 1H5BB 4P4RA 5DHVH 1RJLA 2R0KH 1BM3L 4PFEA 3WS6C 3Q6FB 3MX0A 4RAVA 3CSBA 3W9DA 3UBXA 5MEOA 4Q2ZA 1RIUL 2CDEA 3BN9C 3PWVB 4J7RA 4GLRI 5GGQL 4K3EH 2DSZA 4TUKH 1IFHL 3C60C 1W3KA 1FL3A 1C5DA 3L7EB 3MGTA 1Z9SA 4U6VH 4JM4L 4UV7L 2IG2L 5B22A 4PJXA 4U1HB 4D9QD 4MNHA 4HJGA 4JFVA 1V3HA 4ZTOH 4PS4L 5DI8B 5JDJA 3BUQA 1CICA 1E4WH 2P5WB 3KJ4B 5FA4B 1F13A 1BJ1J 4XNZC 3SPVA 5ITBH 2OP4L 2W0LA 4C83A 4HKXB 5L88L 3BT2H 4KDVA 3KNBA 5FUCE 3X17A 3AZTA 1QNRA 1DUZB 3MGOA 3BPLC 1JFQL 3GO1L 1UB6A 2FB4L 3D87B 4PRBB 4ZFMA 2CXGA 2FIRT 4HWBH 1G9MH 4AL8H 3PHQB 5I0ZA 4OKDA 1KB5L 4XNXH 3OPZH 4LEOA 4GO8A 1LK2B 3HC3H 2H6PA 3ES6A 3W2DH 5F96L 3JVGC 3QIWC 5IW6B 3NGBC 3MJ8A 4LCWD 1T0OA 1G84A 3FMGH 4UR9A 4UDUB 1CXHA 4EXKA 2MWCA 2Y8KA 3FRPA 5D1ZD 3EAKA 3P4NA 3B9KA 3GKZA 4XCEB 3ALGA 1ZSDB 4Q6IA 5D5MB 5DJ2A 1FPTH 1KLGA 5JDSA 2V2XB 4F57H 1FL5B 4QHKJ 5KVMC 4U5IA 5C6TH 4D6HA 4CU8A 3MRKA 1YPZE 4HF5H 4XWOD 4JO3L 4JZOB 1QPPA 1AKJD 5E99L 1H11A 4CD4A 1N8ZA 5DRNA 4KTDH 1MJ8L 1B3JA 2GT9B 4I48B 2YUZA 1AD9B 3UC0H 5L0QC 5TDPA 3VVGA 1FGVH 1CL7H 4N8VB 2APTA 1CZ8H 5DJDA 1DBBL 1K9TA 4P9MH 4EUPG 4WFEE 2I9TB 4P2RB 3ZHDA 1M04A 3RWEA 4U6YA 1M6OA 4B7LA 4JKKA 2QV2A 1EBPA 3GIVA 2EDJA 5GRJH 1GHSA 3HPLA 3FOMB 1A6ZA 4L5FL 1V6XA 2WVUA 5C0ND 5CJ5A 4NWTH 4JZJB 1TJIL 5E4IA 3V52H 1TPXB 1T1ZA 1HHJB 1DUYA 1FFPB 4KJYA 5HGHB 1BQSA 1ODAA 2BY1A 3F62A 4QLRA 4HFUH 1A3HA 1BYDA 2IQAB 1A7PL 4AZ5A 5DEFB 5TD4A 3UJIL 3MOBH 1CFVL 4NM4H 1Y0LA 2BVUA 3SCMD 2VR9A 3EGSA 4XPFH 1FBIH 2OZ4A 5I1KH 5KVEH 4PCTA 4ML4A 1V5JA 3HC4H 5DQ9B 2PO6A 3G6MA 1SEBB 3EHBC 3H6JA 1Q0XL 5IB2B 2Y4SA 4LLVA 1W0WA 1WAAA 1JV5A 5C0BA 3FQWB 3MXVL 1L7TL 3NCJH 5HNNA 2GIYA 3SJVD 5SWSA 1HI6A 3VXSB 3F12A 5FFLA 1H3UA 3HZYA 1PZ2A 1YEJL 2WNWA 3WY1A 2YDQA 1JF6A 4AEHL 1FNSH 1F3RB 5E8DH 5GISH 4ZE4A 3TCLB 3TV8A 2VRJA 3RI5F 1H0DB 4HK0B 1HX0A 4I77L 5EFDA 1H15A 4HOZA 3ARGB 1QRNA 5F9WB 1GGIL 2EDDA 2PYEE 3G08B 2NR6D 3I02B 3UTPD 4YHOL 3ARGA 1NGQL 2P42B 4LSTH 5DJYA 4X6CB 4IIQC 1CBVH 3SKMB 5D8ZA 2A9NL 3HMWL 4D8PA 3TYFA 4HC1A 1J8HA 3V5DB 4WW2C 2WAHA 2DICA 3A22A 4OUOA 1CBVL 2BSED 3VCLA 1RIHL 2W9DH 3RJYA 4CVXB 5EH1A 2YUWA 1HNFA 2XQYG 5L6YL 4LKXB 3DX9A 4D6FA 4TPRL 1MRDL 3O3UN 3WV0A 2K1MA 2FH8A 4GRWF 4IMKC 1WDQA 4OCRH 3ZKXC 2F19L 3FFCE 1KOAA 2PO6B 4ELME 5D9SA 3KPSD 3MYJA 4YHKL 1U8LA 3GUTA 1T21B 4V2CB 1CDJA 5ENWB 4R0LB 4N0YH 3WO3B 3PDGA 5IGXL 3BCFA 1P7QA 3CFJA 3TFKD 4XAWL 3VE0B 3WD5L 3RP1A 2R2HB 4JDZA 1MHHB 3VI3E 4ZFOL 1AGFA 4HXBL 1A2YA 3GXNA 1MWAA 4P7RA 4WIWA 1Q4NX 5TF0A 3DX0A 4PRNA 1IGYA 1R7AA 1QOKA 4YDLC 1XH3B 1BZQK 1AXTH 4J28A 4PJ9B 3GYCA 1MFUA 4UQBA 4MLIA 3RHWK 3ARBB 1JE6A 5T3XE 1LL4A 3BZ4A 1ZGLB 3VFTB 43CAA 4PGDB 1JZ4A 4XMPH 1GGCH 3MLYH 2WQRA 5FIPA 4FFVC 1H5VA 1IGTB 1MCSA 4HUUB 1I7RB 1QFWM 1S8DB 5DK2B 5TE4L 4R4FH 3O0RL 2VRAA 3X13B 4I48A 4J4PD 3X3FH 2WHJA 5C2BL 1KPUB 2FSEA 3BVXA 3AS3A 4LSVH 1V08A 1GAFL 5HDRA 3WNKA 3G9AB 3JTTA 2D0GA 1BGXL 3QUXA 2V2XA 2D73A 1CLOH 1WEJH 5FF6B 1S7VB 1GJUA 4R9HA 2W0FB 1OLZA 4RE2A 1RUMH 4Z2JA 4TSAH 3A6BL 3H3BC 5DSCA 2VB5A 3G5VA 2F1BA 2HTLD 5F9DC 1VCAA 3BN9D 4GAJL 5LYRA 3P3YA 5ANMA 5CSZB 1EDGA 3IFPB 2CBVA 3V0AC 1IARB 4M7JH 1DQLL 2HVJB 5AYUH 1F6FB 4X6FA 4OF5A 2OQJB 3MRQA 1L7IH 1K5NA 2NX5E 3L7FA 1KEML 2WK2A 1CGSH 5F1NB 3SE3A 1A1MA 1KPRB 3ZJ8A 43C9B 5GS0C 4FXGB 1E5NA 5L7XH 1VADB 3U2SB 4NKQB 1IGFH 3LH2L 3HKFA 2K7QA 1OD9A 2Z8VC 2G2RA 1ADQA 2BNRE 2D7MA 3IFPA 1G7MA 1LO5B 3QG7L 1DZBA 1GGBH 4QLLA 5DJXA 4KROB 3RJQB 3BP4B 4QCIB 4BUGA 4HHAB 2YPLD 5JIWA 3B9EA 3CLEL 1FVDA 2YHGA 1LO2L 3Q48A 2WMFA 3GXFA 1H09A 2OLHA 4PJDA 3H53A 1J1XH 5IIEA 3NOIA 1N59B 1S9WA 4HUWB 3U48A 3W6MA 4JEGB 4X0VA 1MFBH 3C5SA 4MMXC 5D72H 1X1NA 1S7QB 1FYTB 2P24B 3UTSA 1WBZB 2ENYA 3QWQB 3QSKB 1QTYT 2DYPA 3MRRA 3QUMH 3DHJA 3QI9B 3WIIL 3FO9B 5ISZD 1A4JA 1T1XA 12E8H 2NT0A 1AIFA 2E6JA 4Q58C 2PUQT 1XR9B 1BLNA 5IK3A 4K7PX 1PY9A 4EUPA 4Y2OA 3SDAC 4P8XA 3DHMA 4NCC1 2XZAH 1VFBB 1DR9A 1BFOA 2EDHA 4GXVL 2ILLA 4RBPH 2GK0B 5KSUA 2ZSWA 5JIKA 4TTUA 1A9EA 3H9SB 5I19H 2WUCH 4L9LB 4PJFB 2J6EH 1P9MA 2JJUA 5LWYH 2J12B 1PDKA 3WEXB 3O3DA 1OTUD 5I19L 4HCRL 4ORZC 4X8JB 3RFZC 1LQ0A 5FO9A 1IZJA 4S2SB 2YRZA 2WBJB 3MRPA 5DT1L 5C0EA 4ZYKA 3T77B 3UO1L 3VE0A 3QZWB 3TGXA 2AQ3A 1XGPA 4OB5L 5CXPA 1EEYB 4S3KA 1ADQL 3MXWL 5HYSA 3BP6B 3UO1H 4D0BA 5I75C 1SZNA 4RMUA 3QIBB 2VC2H 3CFDA 3OR7A 3L3DB 5E94B 2CNCA 4FFZH 5JR1H 3QHZH 1NGPH 4ETYA 2CRYA 4WGWB 1DBKH 1OCWH 3MACL 3SOBH 2R29H 3WJLA 1RPKA 1B2WL 1OCWL 4G9DB 1DP0A 4L8BB 4FQJL 1MHPL 2FD6H 2PTVA 2DIJA 3VNYA 1NKRA 3O3EA 2WZHA 4G7VL 3KLLA 1R87A 4JFHD 4XV0A 3DX7A 2X4OB 1CD1A 5EZLB 5F1IA 1RIVL 3FAXA 4Y4HC 2C7FA 5HYEA 2FX8L 3WHXB 3DURB 4NC1E 1D5IL 4LSSL 2GW5A 4OLVH 3DV6A 2BY2A 1IC7L 4LRNL 1AGDA 1QNZH 2P7TA 3BUPA 5GGVH 5SX5H 4AIUA 1SYVA 3D2UB 1U42A 3KYKL 3KWWA 4JM2D 4DZ8B 5EZOL 4AW7A 4TNVF 5D1QB 4JJ5A 4IEFB 4GI9A 1CXKA 3HE7C 3QO0B 3FONB 3MRFB 4QXUL 5LGJA 5EO9A 2X42A 5ABGA 4ELKA 3NH7L 1QW8A 4NN7B 3ILPB 3WXWL 3MV7E 4U1KA 5TQ0H 2X1XR 5EPMB 3DROB 5HJ3B 5MI0B 3GDBA 3O81A 4RAHA 3O9WC 4PJ7B 2DWDB 5ISZA 3AYSA 2GUYA 5D2NC 3ARDB 4WCYL 4UQAA 4X6EA 2HLAB 4U6VL 5ESQB 5ABDE 2WMIA 1CT8A 2D03L 3DHPA 3FB7A 1FNEB 3UETA 4KRNA 4L8CA 2WNGA 4U3CA 3MLUH 1C7SA 3QDMD 1SHMA 2HFFA 4YHPA 3VXME 4DGYL 1JZ3A 4NRXB 2VITB 5JOPE 1U8IA 4X5XB 4PTUA 1OF2A 5EBWB 1QSFE 1PKQE 4OI8A 1TQBB 1AO7A 1NAMB 4LGRB 4GW5B 3MUHL 5T5NG 3G04A 4B41A 2BOCB 3N1PC 1MFVA 3HPLB 3CU7A 3HZ3A 2VX7A 3HNVH 3CTTA 2EKSB 2MSPA 2BFVH 5E24E 3Q3GB 5HYJA 1X5XA 3OGOE 4PG2A 1ED3A 5DUBB 1XGTA 2E3ZA 4RZCA 4PJ8B 4WJ5B 4QNPE 1HZHH 1XR8B 1AD9A 4R6UA 1FO0B 3GJFA 4UFMA 1MY7A 5EC1A 4PLNC 3DROA 5HJ3A 2EE2A 1BQHB 1KNOB 2Y6SC 2OSYA 5CINL 4LF3B 5GGRB 2YIHA 2BNQE 4P9HC 1ZLUH 5KG9B 4CAGA 3FCTB 4YHML 1WFUA 2J4WH 1BBDH 3BVNA 1ZA6B 1NJ9B 3I6LD 2DEPA 5DJ0B 3GRWL 3BKCH 4G8IA 3AZSA 2XVKA 1FFNA 4W8AA 2Z8SA 2B8OT 5BV7L 1J01A 3GI8L 3UYRH 1SBSL 2F8OA 3BDXA 4JO3H 4N1HB 4UUJB 3AUVA 5C0DA 4MDIB 4LDLB 1VFAA 4BH8B 5F6HI 2MKLC 5CPQA 4ODHL 3EOBA 3OJVC 2YFOA 4LEXL 3U46B 3ZO0A 5IVZA 3RILA 1C8YA 3CZJA 2C1PA 1ZVYA 3QUXD 1CZ8L 4BZ1H 5ID1A 4MAYC 2WKLA 1CD1B 5EZLA 2XZQL 1GQJA 2MHAA 5IJVB 2QQLH 2P45B 1I8KA 2O5XH 1SY6L 4XP1L 4TOQA 1FLTX 2MQ3A 5EBGA 1PX4A 1MAML 2XVLA 3N1GC 3QGVA 5EOQH 2J77A 5EN2A 5DMYA 1S78D 4RMTA 4OJFH 5EOQL 3CX5K 4MCZA 3UZVB 3KLSA 3QO1B 1I1AC 3DC0A 1CICB 1E70M 2MANA 4ZFFB 3KE0A 2XWDA 1UXWB 3V2AR 5BOZG 4RL3A 4MAUL 1MFDL 4QWWC 5F88A 5GGRA 2OR9H 3DETC 3MOBL 3O8XD 1I7TB 4QHMB 2VL4A 1E3ZA 2ED7A 2PC8A 4KK9C 3HNSL 1FAIH 1HSBB 4KC3B 4Y4KD 1CWVA 3G6DL 1IM3B 1Z0NA 4PBGA 1O0VA 1T2QH 3UEQA 2NY4D 4EEEA 3FW6A 1DL7H 4WO4D 2F54D 3BKYH 2F54B 3C87A 5ABFA 3ZKQD 5IFHL 5T1LD 2V3FA 4PMZA 2E6QA 5DZNA 1HKJA 5DTFA 4JRXA 2XWTB 3A4WA 4KI5D 3EO1B 2AEWA 3FQTA 4POZD 3MLXH 3RIFK 3VXUA 5F3BA 5EBWA 1SYSB 4LLQA 2AS5M 2OBGA 2QEJA 1SM3H 4MDPA 4NRXA 4YDKL 3P4MA 2D4FA 3L6FB 1JDDA 2NSXA 2BC4A 3D51A 1FYTA 4EDXB 1QLRB 1XGRA 3MODL 1NGQH 2W63A 2CQVA 3OB8A 1DEEA 1AGBA 3EO0B 4PUBL 3T4YB 3DX4A 5GNYA 3LMYA 3OZOA 4ONFH 2UY3A 3L5WA 4QLKA 1R3JB 3MV11 3KVQA 4XBPB 4HAFA 3MV9D 5T3ZD 1G94A 3AHVA 3LEXA 3LEVL 4GRLC 4LGPB 1FHLA 4OZHE 1ZT7B 4X7SL 4YBQD 4FMFA 3S35L 1M71B 3VWKC 1F42A 1MPAH 4C59B 5I1IH 5MEPA 2BP3A 1SJEA 4UQEA 1UEMA 1RSFA 4FNSA 1KN2H 3VFMB 3I84A 3WUEA 2Z8RA 5DMKA 2YZ8A 3CVIH 3VD7A 1J18A 2WWCA 4R26H 5IVXE 4JFXB 1GQKA 2VC9A 4JJ5B 3OLEA 1E4KA 1ZLWH 3BP7B 3CCHB 4DZ8A 3CVIL 1UM5H 4ODXA 3LEXB 4NGHH 5D2LB 2NX5D 2FL5B 4D9QE 2AEIT 4XC1L 5IDIA 4Q74A 5ITBL 2E27L 5I71B 5L88H 2GITA 1MHEA 2P5EE 5ETUB 4YDVA 3QOKA 5A95A 1JPGB 2J8UE 4OCXH 1J5OL 5JW5A 5IMOB 2F9BT 3KYAA 2GCYB 1RJZA 1CL7I 3WFEH 5ILTH 2CUHA 2Y36H 1T20B 2AI0H 3P30L 1N5AB 3HC3L 4UQDA 1ZT4B 2R2EB 2UWEB 4L8SB 5FYLH 1JTOA 4B7IA 1V3MA 3EUUA 3K2UL 4F7MB 3MTRA 1U8HB 2F8QA 5IHSA 5GZOD 4RWYH 5HXMA 3P0YL 2C3VA 5DD0H 3ZTJG 1KXTA 1NUFA 5CJOL 5DEGB 2A83B 4MNKA 3C6LC 4GKZA 1ZEAL 1T1WB 2A73A 1LO0H 1FHDA 1EJOL 1GOGA 1EHLL 3R0MA 3NSNA 1HOCB 5H37G 1V7ML 1AR1D 1C1EH 3CDGB 3HI1B 3TBVA 4WNQB 3BUYB 5LAXB 5CSYA 2EDFA 1BPLB 5KSBE 3QJHA 1V7NL 5JNYB 1BOGB 1OAYL 2W60A 3SE8L 4LCCC 4NN7C 2BNUA 3RGHA 4C55A 2J5LB 1MFCL 3T8XA 3NCCB 4ODVL 5BQ7A 3O3DB 4HTYA 2EC9T 1CDCA 4NO0D 1G7HB 1Q72H 1T0PB 4Q97A 4NP4H 3RL2A 3IU4H 3QB7C 4HMEA 4ZFFA 4UQCA 5DJCB 4JCMA 1XYFA 4IS6B 3TTQA 5FL1A 2N7BA 1M4KA 1MW2A 4BF7A 1UACL 3K74B 2HJFB 4P49A 4WFFE 2NY0C 4ENED 2WZIA 2A6IA 3CFEA 3MBED 3MC0A 4WU5B 4K7FB 1FH7A 4XPHL 2NY2B 3D52A 3VIOA 2H26B 1FNHA 3KR3L 3CFJB 5BYWA 3QH3B 4YFDB 1KJ2L 1UVQA 3V4UL 3MFGB 3IDXL 2Q86A 4ONHA 3GBNH 5BMFL 4X9IA 5IMKB 3ZDZF 3CVHL 3ETBF 5I1KL 2FGWL 2AJXL 5I8KL 2HMID 1AY1L 3L95B 4PTMA 5A16B 4D1IA 3PXHA 1WDPA 3AJ7A 4K55A 3FCTA 3LEYH 2DLHA 3N12A 3IK2A 5L8JB 3HUJE 4GBXB 4GS7B 5JHDE 5KOVC 5DMIL 4H5SA 4KRLB 5HGBA 1VADA 4OZIA 4LLWA 4FFWD 5D72L 4P2QB 3GJFB 2JJTC 4MYWB 1PYWA 1VHPA 4WWKD 5D8JH 4HBCH 2PNDA 2V7NA 3WENA 2ZJSL 1A1OB 3GSXB 4OLYH 4MJ4A 4IRSD 1FLRH 4OT1H 4J3UA 3WQ4A 4RGND 4JCLA 3Q3GA 5HYJB 4DJMA 1MIEH 1BVNP 3OAUH 5EOCL 5I1AA 1ZHLB 4JVPA 4OT1L 5DA4A 1W8OA 2GK1B 5HI3C 2R1YB 4N5UA 2VDRL 4PJBB 1BZ9A 1I9RH 5CIPH 4OCYH 1JNLH 1XFPA 3WQ6A 2X0HA 4RGMC 4RMSA 1X5IA 3BH4A 4ZS7L 2W0FA 4OGYH 4JRWA 3DVGB 5DF0A 1JNLL 1QUNA 3TIDA 4L8CB 1HK6A 4EANA 5IMKA 3REWB 1CGXA 4DN4H 4G9FE 3IFNL 1J1PH 1AQHA 4ONHB 3FB7B 3V7MA 4S11A 2R0WL 4XHJD 4JZNB 4X9YA 5DEFA 5IB5B 2W4XA 1YUHA 5JXEC 4HMCA 5KS9A 4K2UL 2YKLL 3I3DA 3ET9F 2A6IB 3CFEB 3K8KA 3UBXG 2VXQH 3FB8B 4QY8B 2VNCA 1KXQA 4AJ0A 4NFDA 3TT3L 3CH1B 5DHVB 4EQ2A 1AR1C 4HSQA 4ORGA 3L4WA 1NP2A 2ZCHL 4XNYL 5H37H 1FYTD 5HHMB 3T3ME 2FHFA 2NY0B 3LSOA 3UYPA 3MRFA 3A47A 1XD1A 3BZ4B 3KYNA 3LSOB 5MP6H 2JJTA 4FXLA 1UYQA 4HGWB 4MX7A 5JIPA 3QUYC 1U8JA 1DWJM 1Q9KB 1S7TA 2XIIA 3ALXA 5F7MC 4P4KD 1HXYA 4OUUB 2ITCB 4HUMB 4POZC 4N9OB 5TE4H 1C8PA 3MRKB 2GHWB 3L3OA 1H3GA 3RZCA 4JZNA 4JHWL 1AGCA 1T1WA 2A73B 4G9FA 2IBBA 5JMOC 1ODUA 4U0RC 2NR6C 4FQ1L 3KPNA 2PF0A 4I8DA 1MCPH 2LQRA 2VSCA 4AM0B 4JFPB 5E6IB 4JO2H 2EIZB 1JD7A 1K3IA 3RWJB 1ND0B 3WS3B 3ZDZE 2GUOB 2DQIL 2FO1A 1MH5B 3MJ8B 3FOLA 2YBUA 3TFKC 4AENB 3Q5YA 4JO2L 4FQQA 1W0VA 3X11A 2X4UB 1KCLA 1Y7VA 1GCYA 3O6FD 1BLIA 3NABH 3ULVC 5AWNL 3DYMA 4AMKH 2HVKB 4CW1B 3BSZL 1QG3A 5AWNH 2HKHL 4PMUA 3REVB 4EBQL 5I1HL 1R86A 2D7OA 1E4LA 3ULVE 1E6QM 2ADFH 5J12C 2HLFD 1IAOB 4MS8D 1Z5LB 1KEMH 1DFBH 5IVOA 3VXSE 4P5TA 3W4RA 4TXEA 3S8WA 3SJVE 4FNTA 1N0XH 5KZCB 4CU7A 1DFBL 1FZKA 2EDWA 3VSVA 3LKNA 1AHWA 1CD9B 1HYSC 4I0PA 5A6LA 35C8H 2NW3A 3MLSL 3TNMA 4NQXA 5IHUL 1ZBVA 3IB4A 3QRGL 3ZYOA 5T5NF 1Q38A 5DT5A 1WQVT 5CEXA 2XZZA 3BCDA 1JNDA 4NZFA 3Q6FA 4RAVB 1WBZA 4AD1A 2VI0A 5TE7L 3MREB 5E2WL 2LU7A 4JFOA 5DVLA 1EFXA 4MA1B 3S3JA 2F54E 4RGOL 5KN5A 4HJJH 2B0SL 3SO3C 5LA1A 1U0QA 4WU5A 2DWEB 1LL6A 1QSZA 1K4DB 4GQQA 4YJZL 1D5XA 1W72A 3NIDE 1E6RA 1OGBA 5C0JA 5IMMB 2OX5A 4NQVB 1NDGB 2HRLA 3MOAH 4HKBB 2W9EL 4WW2B 4BQCA 3OHXB 3RU8L 4KQ4L 4KMQA 3D39D 5HDQH 1UZ8B 4LRIA 1G7LB 3H3PH 4OZIE 3VFSB 1UWRA 3CGTA 3K8LA 1F6AA 3SCMA 3R06A 1W72H 5L2KA 4IRSA 5ESVB 3QNYB 3SDCA 1JCKA 1BF2A 2DLEA 3SDXE 2Z31A 2A77L 4JN2B 4BH7A 3BW9A 1R6VA 4NCC2 3O2DA 3RZCD 4OLZH 3UR7A 4LYQA 1GC1H 4PBWD 1RK0A 1QPXA 4OF8A 3VA6A 1FGNL 4G6KH 1NAMH 2H32B 3QUZC 2GSGB 1MI5B 1XGQA 4R4ND 4PJ8C 4W70A 4N0CC 4PGEA 4OB5H 4G6MH 3BT2L 1BZ7B 1GL4B 2QJDA 4PJAB 5IB3A 1WC7B 4UT7L 3T65B 1PBYA 3O3AB 5IR1A 2OR9L 1XH2A 5E7BA 4AM0A 1OB1B 5CLWA 3E8UL 3PWPB 5EU7C 1T20A 3K4DA 3VXOA 3GXDA 4G9FB 1Q8MA 2YUXA 1OP9A 3H9ZA 4NWUL 4HDIA 1B2WH 1LO4L 3KL0A 2WMKA 4P3WA 1KTLA 4MJ6B 1SYTA 4NXKA 1T2QL 4MB5A 2Y06L 3MO1B 3MROB 1A0QH 1CFTA 1JGDB 3PHQA 3D0VA 1OY3B 2CJUL 4GKSB 3VFRA 4M24A 3FT3A 1LO4H 5E5MA 4XPAH 5J6HB 1DWFM 2WZEA 4GXUM 3U46A 4AQOA 1YEHL 1PVHA 4IOSD 2FX8H 4NT6B 4BH8A 1V0NA 3AI0A 5F1OB 2DJSA 1NCCH 2O92A 1U8JB 4NN5B 1OD7A 4OLVL 3MKKA 4F2MA 3TPUB 1NCCL 4RFEA 3PZ9A 2P5WA 1FZJA 5DMKB 5IM7A 3KJ6L 2ZKHL 3IJYA 4MNHB 5TF1L 4U6TA 1TVNA 3WCYA 3BIKA 4H1LH 4OM0H 2QMJA 4CDGC 3MODH 2BVYA 5D4QA 5I1GL 1AD0B 1HQ4B 3RWHB 1L0XA 1R47A 5FCZA 1PKQB 1I9IL 4NM8L 4NWTL 1LG2A 4W7VA 4ATDA 1TQTA 2PO6D 1WT5A 5CZVH 2ICWA 3QDGE 1HYSD 4PTWA 3BJLA 4TVDA 4OAWA 3OGCA 1UWEH 1OB0A 4C56A 1DQJA 1AJ7L 4HUKB 4NDMA 3EJZD 4ZDHB 3WE6A 4EDXA 3C8DA 1CE6A 1A7PH 3EDEA 4MQ7A 1E15A 4HV8B 3D9AH 4H0IA 5DRWB 3IVKB 1JFHA 1GZJA 3F7RA 2YPKA 4JQXA 4RRPA 2PN5A 5D1XB 5D1XD 3NCEB 4HIHA 3MU7A 1IBGH 3VH8G 2OYLA 5SWZA 1A5FH 1E1EA 4JRXB 3AICA 4KI5F 4UNUA 4NQDD 3SGEH 3KHQA 1GZPA 4MNGA 5TH2B 3S36X 3IKCA 2XA8H 2J47A 4R96A 5IXEA 1H2JA 3G6JF 3BDBA 4YXHL 3MMWA 5E8DL 5GISL 5ISZB 3CK0L 2NW0A 3C5JB 1DHKA 1RUAH 3H42L 2NXYD 4V1DD 3LRKA 1RMFH 4Y16C 4PYGA 4KVCL 1NC4B 6FABH 1YEDA 4RDQF 4Q9QL 3OL2A 1RZKC 4PEEA 2V5DA 3V5KB 3QAZC 4KVCH 3RUGA 3AFBA 2ARJB 5A2KH 1HI6B 5CILL 3FN9A 3JV6A 5EUKA 4PYHA 2NZ9C 4YIQA 4JM2C 5C9JA 7CGTA 2X4PA 2CKBH 2AK4A 2H2SC 3HG1D 1J0YA 5CIPA 1U91B 4FZ8H 1H0IA 4FNRA 2OWWA 1UH3A 4ZD3H 2UY6A 2BVPB 3F7VB 4JY6A 3V4PH 5CEZE 1SBBA 4A6YL 1TR1A 2HT4C 1FHGA 3V6OA 1IL1B 2X8RA 5LVEA 3I2CL 3W5NA 3VA2C 4P5TC 2OJZH 1P4IL 1R34A 2DL2A 2R23A 3L3IA 3GSNB 2XG9A 1A6TB 3QEQA 3DUSB 2A3HA 2AJZB 4DKAA 2NXYB 1NANH 1SY6H 4PV9A 4OCRL 5C0RH 4PJBE 1U6AH 2ATKA 1R3KB 1RZFH 2BERA 3W81A 5C0RL 4G8GA 4ZNEA 4FMVA 3QIBC 4JRXD 3KPTA 1EERB 2ED9A 1RZ7H 4MGXA 3NCYP 5D7IA 1JD9A 4XAWH 1ZA6A 3BVNB 4D0BB 1R5WB 1AC0A 4PJDE 2X2IA 3WSUA 5FD0A 1Q6GA 1MQRA 4JFHE 5BQ7B 1B6UA 4OQTL 4JL2A 4J3OC 2X4SA 4LCIL 1NC2D 4PR5A 4JREC 5EDXA 4D94A 5E56A 1GGCL 3MLYL 3UEZA 2HT3D 4GMTH 3HZMA 2DLFL 5L2KB 3FFCD 3TBVB 4ERSH 1NDMA 3QCUL 1S7UB 4AZ7A 1JHKH 1IQDA 1UQSB 4H1LG 5IB5A 3V6BR 4N0UB 1W3HA 3OXSB 3IKCB 4DKEL 1VA9A 2DH3A 5HHME 5D4YA 4Z0BH 5JXAH 3WFBH 3GHBH 4GAGL 3GZKA 3TIDB 3WIHH 4ONOA 4WHDA 4ZUVB 1V3IA 5EZIL 3SDDC 1A3RH 4Z8FH 3BGFB 2UWEA 3NSXA 2VLME 4KZEL 5D70L 3HRZB 3HE6C 5JZ7C 2X4TB 3S35X 2D9QB 2IC2A 1GGIH 3ULSA 4XZBA 2DQHH 1BAFL 2BCKA 2EYTA 1KG0A 3VDHA 3QXDB 3LN5A 1YMHA 5ESAA 1Y18B 3ZO9A 1DANU 1YEFH 3U4BL 5JOFB 1E6PA 3ZR6A 5AYUL 4F7CA 4ATLA 4PJDB 2ICWB 1RVFH 4HP5A 2BVEA 1F2QA 4IJ3B 3N18A 1F3JB 3B6SB 4LVHB 3GH7A 4NQXB 3C8KB 4XHQA 4EI5D 4UIKH 1CXEA 5HGBB 3QCVH 4XXCC 4G7YH 5E8EA 1VB9A 2ADJB 1E6SM 2VLJE 4NUGL 1YNLH 2OM5A 2ZCKL 4EI6B 1OGTB 5TGBA 4DZBB 3VFMA 4PMYA 2VLRE 2ADJA 2QPUA 5BS0D 4P2YA 2G5RA 4Z77A 3G6AA 4P5TB 4W6YB 2Y72A 4GFTB 2WVVA 2Z1SA 3S7GA 2BOBB 2Q1EA 3AMDA 2NTFB 4CRPA 5F72S 5T3XH 2R1WA 1OAQL 2V9QA 1NBZB 4GS7C 2OL3A 2YD7A 4WO4A 3MO1A 2R4RH 2X4OA 1XCXA 1UQZA 3AISA 4P46C 3TWCL 1NEUA 4LU5L 5DLMH 5D7KE 1KTCA 3CLEH 3LOWA 1NMCB 3QXTA 4W6WB 4DO4A 5TPWH 3O8XA 4PJHF 2Z92A 4X99A 4E2OA 1DEDA 5DD6A 3MRHA 4YDIH 5E8PA 1GOQA 5D7JD 1KJ2B 4OZFG 4NQCE 5K9KA 5IHRA 1T83A 5TPWL 2FEEI 1A7NH 1LP9A 2P8MB 2VCCA 4MHHG 3ME0A 1H1NA 2CCRA 1JPTL 3X3FL 5AZEH 4BK4A 3SO3B 5B3JF 4Y1AE 1VGEL 4LQFH 4U0QB 4HIXH 1HQRB 2X7LA 3GBML 5JLZB 1E5JA 1FVEA 4HBQA 2V5CA 4KZDH 1IE5A 3GSVB 5AZEL 5C0BD 1UCTA 1SVZA 1KPUA 4KHXL 4CN1A 2QR0B 1HKKA 4KAQH 2YDSA 1GUVA 1TVPA 3WKZA 1Q9KA 4QRUB 4PR5B 5D7KD 3GMLA 1T7VA 2JIXD 5B4MC 3CDGA 3HI1A 1HXMA 1HOCA 3FO2A 5DT1H 3GJFK 1OW0C 5BXFA 3MMEB 4B16A 3NUKA 4GAJH 2ZSWB 4X6DF 1OT1A 2GK0A 3EO9L 5DJAB 1NUDA 3VD9A 4AMCA 3SDCC 1U8HA 3CC5A 3JWOH 3RAJH 5C0JB 3LV3B 4FN0A 4NPYB 4ZUWB 1CICC 1K4DA 1KEGH 4PP2B 4JGUA 1G1YA 2AJZA 4H41A 3FZUD 2H3NA 2F5AH 4JDZB 5LCVH 4F9JA 1YUHB 3WMBA 3VDAA 5B8CB 2VQ1A 4KJQC 4YDVB 1GONA 3A3HA 2VXVL 4QT5B 4FFYL 3WFHB 4DGVH 1FDLH 3RWDB 5FYJU 2HRPL 1MI5E 2EH7L 4LIQH 3CNKA 3EJJX 5ACZA 1P5VA 2VAJA 3CSPA 2W0PA 1G7PB 1WO2A 1MHPH 5C71A 1GHFL 4UBDC 4U5KA 3EYSL 5FEBA 5IWLA 3NMEA 5I66B 1IM9A 3MNVA 1WBXB 5DJXB 4J2XA 1YMMA 4KRPB 4U1NB 2XFRA 1JNJA 3M1BB 4D3CL 4UQ2B 4K23H 2XSAA 4APQA 4Z7VB 4HULB 1D5IH 4GXPA 3ULUC 5C7XL 3SQOH 3TO4C 5E2WH 4NSBA 1MQ8A 5I78A 4OZHA 5KS9F 2QMKA 2Z35B 5IQ7H 3T0WA 3G08A 4U6XA 4CUCA 2LV4A 12E8L 4WF7A 4JO4H 1R3LA 4P8UA 2H2SD 1RJYA 4ZAKD 4OZIB 2NQCA 1H9VA 1SQ2N 3S5LB 2E7MA 1S5HB 4JRYB 2VLJD 1PZUB 1KG0B 5HY9A 5I77A 3N50A 4WHTA 4BKLA 4ENEC 1MIEL 2VE6B 5LKNA 1NAMA 3VWKB 3SUSA 1NQBA 1MH5A 3PZGA 1V03A 3EFDL 4KXZH 4M61A 2F53B 1WCBB 1K4CB 1US3A 1GORA 3EO1A 4NN6C 4JDTH 1A1NB 4MB1A 3DUUB 3HRPA 4UILL 3DRQB 4ODTH 2CRIA 4PJGB 4PJ5B 4M7LT 1V05A 5F9OH 5JPNB 3PP3K 5DQ9A 3PNWB 4P57A 1NAKH 1MAKA 4NKDA 5ALBL 4OGYL 2A6DA 1NMBH 5KANG 2F2HA 4NRYB 5D7LB 4AC1X 3SKNB 2L7JA 2WMHA 2H26A 4NOBA 2DM2A 1WISA 3QQ9D 5CBAA 2FSEB 3NDZA 2YWYA 1IEBA 3LMJH 2KL6A 1IKNA 4PMNA 2CMRH 3QDME 1UG9A 2MPAH 4OZGF 3FMGL 4JY4A 1UKOA 4JFUA 4TVSa 5T33L 1E55A 1SJXA 1A6ZB 3QI9D 3SGDI 2ZX5A 3GH5A 1PSKL 2WQ8A 4KGJA 3DVIA 5E70A 1DN0A 4Y4FA 1E73M 5D1QA 5JA9A 2WMJA 1NCDH 2F7RA 1CECA 4JPIA 2D24A 1MCWW 1X4XA 3GMPA 3EMCA 5JOPD 1NPUA 1IILE 2AAAA 5BV7H 1LP9F 4F15C 1R33A 4Y1AD 3G5YB 2UWEE 3QAZB 5ICYA 3BPOB 3NZHL 4MSWA 4EN3D 3SGEI 3K4AA 3SCTA 3AS2A 1BFVH 3DX7B 2ZUYA 1OAZH 3U4EA 1KWKA 4JZJC 2FCBA 1GVIA 4HUVB 5D5MA 5DJ2B 4HA3A 1ZAGA 3DRQA 3C6LD 3F7VA 4PJGA 1JGIA 1KCSH 1B3YA 4OCLC 2FATH 5HDOA 4WSKA 1XF3A 2VISB 4HA1A 1OGAD 1FJ1A 3F7QA 2DM7A 4PGJA 1ZT4A 4L8SA 2O61B 3IGUA 5JXED 3SE4A 3CH8A 3WNOA 1UH2A 1LEGB 1CF8L 3IDNA 5HDBF 4W8LA 4LBEA 4OGXL 1I8MA 2IPTL 1CFNA 4H8WL 2RCSL 4M81A 1UWEL 2OTUB 3HN3A 2VXTL 3JZ7A 4KKNA 1O7VA 4U1SB 4GKNA 2I5YH 4N8VG 1WE5A 5D96C 2WBWB 3C5JA 1CVRA 2WBGA 1OWQA 4HIIB 2DQFB 3RO8A 3EYUL 4Z7UF 4WU7B 4JFFE 2IH3A 2WLYA 2Z4QA 4WUUA 5FAAA 3O4OC 3DYOA 1SJHB 4KRMB 3HZYB 2YD2A 5DUPL 4HS6A 1U8OB 3FT2A 1MVUB 2ATPB 3DTXB 4U49A 4MA8H 1FSKC 3V95A 5E9DD 2F7OA 1R3HB 4PTUB 1GJWA 4N42A 1MRFH 5MEOB 4HV8A 1C5CH 3T2NH 3VFWB 1AXSA 4KUZH 4QRSB 5IHUH 4MAVA 3ZQ9A 2RGMA 4W89A 3IAPA 1S9WB 3DX8A 1I1WA 1N3NA 1M7IB 2DBJA 4J3SA 1W9PA 3ARDA 3CD4A 4OOUA 4F9LA 1OAUH 1OPGL 5LXGH 3IAQA 4YHMH 1HNGA 6CGTA 2J4WL 1MCCA 1YY8B 2W67A 1SM3L 3AY4C 2CD0A 5DYOA 5E2UL 3B2VL 5ALCL 2X05A 2YOCA 2JIEA 4BQ6A 3PJSB 5EG6C 3E6HA 3LEVH 4ZXBD 5HHPA 4R0LC 3ILPA 1GVYA 5C0IB 3SE3C 1BJ8A 5HHOE 3RY4A 4KFZC 2V2TA 2NXZB 5IM7B 3AIUA 2GDUA 4M3JA 5T1LB 1DBML 4O51B 4OI7A 1SJHA 4CMHB 3LKOA 2P47B 5IFAH 2XQBL 3MRLB 4XBEL 1EXUB 5I73C 1EQPA 3NAAH 2Z4QB 1FG2A 1C93A 3I2CH 1I7UB 1CGYA 2OJZL 5KEZA 4TVPH 1WZMA 4JHAH 4ZAKA 4APQC 2ZX8A 5DS8A 1MFNA 4LYRA 4IOIA 4QRUA 4XUYA 2OWXA 3PGCA 4Y4KB 4I3RL 1Z9MA 2OQJA 4C7GA 5CP7B 2Y5TA 3KPPA 3VIFA 4OQTA 3H9SE 1ZS8B 2HJLA 4YDJB 4P2RD 3WH7A 2E27H 5H94B 3TZVD 3EYQC 2V9TA 5DUMH 3NPSB 3OKDB 5EZJB 3U5YA 1Z9LA 5GQBA 3QWRD 1OB1A 2NT1A 3WH6A 1RFDL 4LAJH 4XHJC 2VISA 1QFUH 2YA2A 5EN2B 3VSUA 2VCAA 1UKSA 2FB4H 4L4VD 4M7ZC 5C08D 5BV7C 2G3IA 8A3HA 4H26B 3RCNA 1FCCA 2FEEL 4JPKH 4K71C 4V1DB 1WDRA 3SN6N 1ZU8A 2ZUQC 1FL6A 3L1OH 1RU9L 3FHAA 2NY6B 2UY2A 4F79A 1HJVA 5ETUA 1TZGH 1I1AD 2AJ3A 3WEMA 3G5YA 5ICYB 2EIEA 4EKJA 4NKIL 4YPJA 3BGMB 5EBMA 1LWJA 2R1WB 1WIUA 1RD6A 2CJUH 5L2KE 2F15A 5CJOH 3V79C 1BAGA 4ZO7A 4DM2A 4G6JH 2MTPA 1FSKB 4JPIB 2CESA 3LQAC 4W4NA 3UZEA 4PGDA 4PJFA 4Z77B 5C6TL 5CEYA 2BRQA 4S1QL 4U0RB 2VH5H 3PQYA