6CGTA

Hoxa complex of cyclodextrin glycosyltransferase mutant
Total Genus 221
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
221
sequence length
684
structure length
684
Chain Sequence
DPDTAVTNKQSFSTDVIYQVFTDRFLDGNPSNNPTGAAYDATCSNLKLYCGGDWQGLINKINDNYFSDLGVTALWISQPVENIFATINYSGVTNTAYHGYWARDFKKTNPYFGTMADFQNLITTAHAKGIKIVIDFAPNHTSPAMETDTSFAENGRLYDNGTLVGGYTNDTNGYFHHNGGSDFSSLENGIYKNTYDLADFNHNNATIDKYFKDAIKLWLDMGVDGIRVDAVKHMPLGWQKSWMSSIYAHKPVFTFGEWFLGSAASDADNTDFANKSGMSLLDFRFNSAVRNVFRDNTSNMYALDSMINSTATDYNQVNDQVTFIDNHDMDRFKTSAVNNRRLEQALAFTLTSRGVPAIYYGTEQYLTGNGDPDNRAKMPSFSKSTTAFNVISKLAPLRKSNPAIAYGSTQQRWINNDVYVYERKFGKSVAVVAVNRNLSTSASITGLSTSLPTGSYTDVLGGVLNGNNITSTNGSINNFTLAAGATAVWQYTTAETTPTIGHVGPVMGKPGNVVTIDGRGFGSTKGTVYFGTTAVTGAAITSWEDTQIKVTIPSVAAGNYAVKVAASGVNSNAYNNFTILTGDQVTVRFVVNNASTTLGQNLYLTGNVAELGNWSTGSTAIGPAFNQVIHQYPTWYYDVSVPAGKQLEFKFFKKNGSTITWESGSNHTFTTPASGTATVTVNWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate binding to a cyclodextrin glycosyltransferase and mutations increasing the gamma-cyclodextrin production.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
total genus 221
structure length 684
sequence length 684
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1998-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 6cgtA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 6cgtA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 6cgtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 6cgtA01
1TIUA 4G43A 1FBIH 5I16A 2XHYA 3QHZL 1HHIA 1H5VA 3OZPA 4FHBD 1SVCP 1TZIB 3CFIC 1MFBH 1G7QB 2J74A 2L4OA 1KGCD 1XGRA 3H9SA 1NCBH 2F19H 2LVCA 3T1WA 1I1AD 2C3WA 3U82B 5D2LB 1U8JA 5JW5A 1UJTA 2VISB 2FB4H 1WBYB 3CVHL 4MMXC 5E1AA 2OTUB 3MOQA 1NC4B 4Q2ZB 2CITA 5BRZE 2WMJA 3MBEC 4FQPA 3OLGA 4P4RA 2HT3D 4ODTL 4B7IA 1FP8A 1US2A 1DLHA 1JWMB 1U8OB 4NRRA 1HKLL 3W28A 3MV9A 3CBWA 4H0GA 5AYUL 2DDQH 4KK6D 1D5MB 2ALWA 1MI5D 3BD5A 5GNZA 5FM8A 4UQDA 1TFVA 3CO4A 5DTFA 5L2KA 2AJVL 2XN0A 4WLCA 2TAAA 3FB8B 2NXYD 3QRGL 3VGGA 2JB6B 3M7SA 4D6GA 1KIPA 4U6XA 3IXTA 1EA9C 2I5YH 2KQMA 1Z3GL 4D1JA 4K7FB 4XP1L 5F7EH 1FV1A 5GSRA 1LLOA 2R9HC 4KV5F 4GMSH 3C6LB 4CADA 4EDXA 3OKMB 5BS0E 2YN5A 4WO4A 1A6UH 4FXLA 4HDIB 2VLME 4H1LH 3VFVB 4R26H 4GBXA 1UKTA 4G8GA 3QQ9C 4KKNA 4O2FB 4NNXB 3KPRE 1SY6L 3ULVF 4Y16A 2X09A 3JTTA 2BSSB 1A7QH 2NX5D 1W1YA 1JK8A 1HIML 4UIKH 1YNTB 2ZSVA 3O8XA 1QFUH 4XNZB 4QHNA 4V1DB 3ZHKA 2DM2A 4O2CA 5IB1A 1Y7VA 3EZJB 1J0ZA 2WHKA 4NSKB 4S1RL 3BCFA 1U2CA 4XNZC 4JFVA 3ABZA 5FYLD 1CICB 1OB0A 3OX8B 3VFOB 4P8VA 4LIQH 1NAMB 3VIJA 3JV0A 2XWDA 2FX9L 2F54A 5IBUG 5ICYB 3KLLA 1H1NA 1ULVA 2R23B 1AIFA 1FPTL 3WDPP 1UCBH 4Y2DB 1OGTA 3WN5C 1GZQA 1VSCA 3D3VA 4ZENA 4Y4KC 3C6LA 4CADB 5FCSH 3LRKA 3SKNA 5HD8D 2NY2D 4YDVA 4LCWD 5IDIA 4IRSD 4U6XB 1XGQB 2BFVL 1NCCL 3MRBA 3GSUA 3WFLA 3O3AB 5ABGA 5IFTA 5F9WC 1HHJB 1KELL 3MRLB 2V5SA 5GGVY 1HNGA 5FYKD 5CZXC 1QBMH 1PEWA 1K8DA 1YY8B 4XP5H 1QNZH 4NZUL 1P4LA 2EQDA 4LSQH 1OD9A 3VXUD 1DBML 3RUGB 2IGTA 3O2WL 3RVTD 4EAMA 4JO1L 4ZXBA 3IDGA 1YEHH 1A14L 5KZCD 3V95A 1N0XH 5KEZA 3GZAA 2G5BB 3G9AB 2EIDA 4PJGF 4JFDB 3EO9L 1GXEA 1U8JB 4R26L 2FGWL 4MNJA 2P44B 3L3KA 5EU4B 5HI3D 2EDOA 5DS8B 5DDHA 5FDWA 3GSVB 3HZVB 3D4ZA 5D7JA 5AUMB 3CLEH 5EWIL 2YOCA 3PZNA 2VE6B 1NOFA 4PLKC 2KH2B 4KKAC 4F3FA 1IC4H 3QSKB 1E4XL 3P4LA 3WFCL 3MRGA 4FXGA 4IMKA 4WKFA 2NLJA 3N1MC 4XPAH 4Y88A 4JN2B 4YX2L 5JOPD 2Z91B 1JHTA 1BHGA 1XCWA 1N4XH 3D5OF 1GHSA 1CDGA 3VFOA 3PZOA 4W6YB 4K55A 3IS1X 1EOMA 2KZWA 3AS0A 4XCEB 4ZSOA 1UOKA 1N2RA 2RGLA 1XYFA 3OPZL 4NKQB 1GIGH 5HHQB 1TJIL 3MGOB 4KAQH 4IHOA 2AXHA 4Y4HB 1E6ZA 2ARWA 4JDZB 3QULB 4JFQA 3WFEH 3L7EB 3BLKA 4J27A 2JELH 1FFNA 3RI5K 4JO3L 5GRJH 3L9RB 1QSFA 3BSZH 1H9VA 4TUOB 4WJ5A 4IOFC 3L2LA 3PV7A 3NFPA 3OGVA 1NGYB 1ZT7A 3ARZA 3W0WB 3SDXA 3EOBB 2HT2C 2R1WA 3E3QE 3P4NA 1SHMA 2ZG2A 3VNYA 2UYLA 1K4CB 3OR7A 4PY7B 4ZO6A 3GKWH 1XH3A 5C0ND 4EBQH 3D6GA 1MNUL 1WLHA 4QF1A 3VXPA 4UTBH 5C9JA 3E6HA 4J3VA 4PGCB 2V5CA 3QDJB 1XIWC 4B5EA 3ARYA 4KZDL 1UZ4A 5A6BD 2WMGA 4CJ1A 1IVLA 5F93C 2VQ1A 5GGTL 2RGMA 5AYUH 1OB1A 4GRWE 4JHAH 1F90H 1I4FB 5J6HA 5ANMA 4WUUD 4XVUC 3O11B 5C2UB 3NCEB 4MAYC 1RJLA 2K7QA 3CDGB 5HDQL 1HSBA 1IGIL 5TPWH 5DJ0B 1E15A 4X9BA 4PN2A 3CLEL 3QUZD 2PTTA 1DLFL 4OLYH 5D4QA 3TBVA 1T0PB 2CMRL 2C7UA 5SX4I 4PRBA 4OLVL 3BVNA 4ZXLA 2YEZB 4KJQD 2H3NA 3IDIB 5H94A 1S5IH 4S1DD 4MDIB 4ZAKC 3B3IB 2EDXA 1DE4A 2DTSA 4NZRL 1E27A 5EUOA 5IV2B 1JPSL 4YUEH 4PJ5B 3B6SA 3RRQA 5HYQB 1A1NB 5EOCL 3BPLB 3DBXB 1FVEB 4KXZI 4MNGE 3RIKA 3TESA 3WUWG 3IU3B 1RUPH 4A4AA 3FHQA 2X2HA 4OZHB 1FG2A 4EN3D 2O9TA 2YKLL 3SO3C 3PWPD 3W29A 4HUWB 1L7IH 1TZIA 1A6TB 4NQVB 4PUEA 1QSFD 4NWTL 1EXUB 3HG4A 4M61A 2JALA 3QDAA 4KKBC 4BQBA 5DRZA 3G9VA 5ID1B 4MJIA 1LNUB 1D5BB 3BO8A 2GJZA 1E0VA 2XNAB 2UY6A 4U6TA 4GG6A 4KTEH 4L9LC 3PHOA 4FFVC 3QWRA 4W6XB 1L4IA 1BFVH 1G7PB 1MJJB 1TJHH 5C0AA 1V5JA 3N0PB 4GPNA 2UZYB 5DHVA 1T89C 1GAFL 5GGUA 1GJWA 4MA1B 1NH6A 5DLML 2OR8A 3B8YA 3D18A 1RUQH 3ARBC 3P0VL 2JB5L 4XMPH 1LE5B 4HW6A 3D69A 4HMCA 3IJYB 3DVFA 1HJQA 1OP9A 5DD6B 3HCVB 32C2A 1V6XA 1EERB 1YPZB 1NM9A 1ISVA 2DKMA 2J62A 2VIRA 1QLRA 4W7WA 2FJGB 1N5AB 3O6KL 1CECA 1P9MA 1HE7A 3L3JB 5JNYA 4RISL 3WHXB 1RU9H 4MNHB 4R5EA 5E99H 12E8H 3IAPA 4FNSA 5HY9B 4MPKA 1HKIA 1EXPA 2BCKA 1TVHB 4E9LA 2F7PA 2DGAA 1A3QA 2WUBH 4LNVA 1PVHA 1P5VA 2FHBA 4MLIA 3WMCA 3D2UA 3ARVA 1P84K 3DX6B 3PHSA 5ID1A 4X5XB 4WV1A 3AHTA 4NNYA 3FN0L 4WF7A 4BH7A 1ITCA 1SBBA 5D6CB 3NTCH 2P47B 3Q1SH 4LCWE 2P8PA 4AH2A 4TQEL 5EUOB 3GMQA 3EYVA 2E7HA 4LGSB 3X3FL 3CUPA 2BOCB 3NSNA 5E0QA 4AZHA 4HFUL 4C56D 4XNYL 2O93L 2ZICA 4MAUH 5ICZA 4JFEB 4PV8A 3GBLA 2BK8A 4I3RH 3K4DA 3BKML 4Z6AT 1DQMH 4MHHG 4D9QE 2PTUA 4QRRE 1S7RA 5SX5K 5CCKH 2HJLA 3B9KB 2XFYA 1F2XK 4K94L 1T5WA 4J8RB 4CBPA 4Q9QH 4OCLC 4WEBL 5CP7B 2EC8A 3SGJC 4HUUA 2X44D 4NDMA 3OG4B 1YMHA 3DOSA 5J57B 4L3AA 3G5XB 2W61A 3D1MC 4GXPA 4ORGB 4Y8AA 5J6HB 2BOCA 1IGYA 2A1WH 1NUNB 1FE8L 2VR5A 4XPBH 5DHXB 5DLMH 4LPUA 4U6HA 4YPJA 3GUTB 4PBGA 5L8KB 1VKXA 2OXGA 1PIGA 5D7IA 1KN2H 3QDJA 5DC0A 3GSWA 1YECH 2VNCA 4F80A 1BLNA 3WXVL 4Q0XH 5L2JA 2ED7A 4XPTL 5HPMA 4O2EB 2EYSA 2OJEB 4QF1B 2PR4H 1TVPA 2OLHA 1PKOA 3EO0A 1LJYA 1AGFA 3RWHA 4DZ8B 2GJ6A 3W6MA 5FGCB 5FKAB 3F58H 1OD7A 3BKJL 2C1PA 2BY2A 3H54A 4ZUTA 4YBLC 3GK8L 1E6NA 4RIRB 4NO0A 4F7EA 3VW3H 3QDGB 1INEL 5GGSY 2VQUA 1CLCA 3VFPB 4KPHL 3WBAA 4NKDA 1HSAA 3L5HA 3IETA 4GUPB 5DRNA 4Z7QE 5BZWB 3RMEA 4HZAA 5FHAL 3ZYJA 4G8EB 1EFXB 1B9ZA 1QFWM 4S1RH 4NZRH 5DD6A 4KKCC 4MCYB 3H55A 4UUJA 5CP3H 2AV1A 2DT0A 3MUJA 4PRDA 4NRZA 2GSIB 5JPMA 2HTKC 3BESR 4GKZA 2O5XL 2ARJA 2FRGP 5KVDH 4OIFA 1HKJA 3DVIA 3S6TA 3VDBA 5IXEA 2XM1A 1AKJD 3LV3A 1GVYA 5GGSA 3SKMA 1EQCA 1KYOJ 4ZUWB 1CFVL 3AIWA 3QUXA 2M26A 1G84A 3N18A 5E7FA 1HJSA 4KUZL 4JFUA 3MV9D 2WBJA 4PG9B 4P2QD 5K9KB 5L2KE 2J75A 3F5WA 3MNZB 1KACB 5EC1B 1MW3A 4IPNB 4OLYL 4G6AC 3TCLA 5J3HD 3CPLA 1TENA 4PRID 4JZJB 4I0KA 3LD8C 3DDFA 4PJFE 1DWFM 1O0VA 2Z0BA 3ULUH 4OF0A 5JLZA 2G5BA 5H35B 3UPRA 3TJEL 5FUZL 1BGAA 1DUZB 2J5LB 5T3XL 1XF4A 1RFDH 3UJIH 3MRCB 5HYIA 1PQZB 1Y6NR 3IDMA 1A1NA 5A2IH 1KR0A 5EUOF 3ETBF 1YJDC 4Y2OA 5E2JA 3ARXA 5JOPE 3LPWA 3GMLA 3V7MA 1WZKA 2UUDK 3MRBB 2CLVA 2FDMA 5HYSB 1BF2A 4QKXB 4M6NL 3FO2A 3WLBA 3ALXA 5I0DA 2XG5A 4NF7A 3VD4A 4JPIA 3JWOH 2N1KA 1GOFA 4P9MH 1J12A 2V5RA 5FYKL 1EEUA 2ZWLT 3O0RH 1I8KA 3DUSA 4MA3B 3QEUB 2VABA 4WNQB 5C0CE 1CPUA 1UKOA 5EFDA 3W53A 3T4YB 3ULUD 4KGJA 3QQ3A 5D4YA 3OWEA 1KGWA 3QNYB 5A94A 4XZUB 1UJ3B 2OYMA 4JVWA 2Z8SA 5I71C 2K9UA 3OPZH 5IESL 4D72A 3CZ8A 4HWUA 5MENB 4NUJB 3O3BA 2VX6A 4HBQA 3MMDA 4U2ZA 3U5UA 3RX8A 4QLRA 2OK0H 1A1MB 3QUMA 3TV8A 4HFUH 3IF1A 1Z9LA 1RVFH 4EXKA 3UTSB 3X11A 1HWGB 1I7RA 3HTLX 4QHNB 1S3KL 1WWBX 3O8XC 2HYMA 5BJTB 1G6RB 4YHOL 5SX4H 3TEUA 2D03L 4GZJA 1IC4L 1NCUA 3L7EA 4RMTA 3WL0A 4Z7VB 5HSFA 4OTXL 3RKPA 1T20B 1CD1A 3MGOA 1LK2B 3FQTB 2XOTA 4OZFA 3UTQB 1WPCA 3MV8D 3WQ5A 5FL0A 1LEIB 1CEOA 5GS0D 3VXNB 3GMPA 3AM8C 3NH7H 5EUKA 3MV8E 5F7YC 1UH2A 3WSQH 5I30H 1V03A 1JI1A 1KIPB 3LMJH 4Y8DC 3BUIA 5IKCB 3S35L 3WFDL 2WCAA 3BPOC 3TA3D 4Z76A 1KB3A 3AS2A 1FO0A 4MNQA 1R7AA 3C08L 1DP0A 4KJPD 3TPUB 1UWIA 4NRYB 4ACYA 1I8KB 4GXVH 3DUSB 4MA3A 4WNQA 3MJ9L 1Z0NA 5IM7B 4K8RD 2XRAH 4AD2A 5T1LA 2Y8VA 5CINH 4WWKD 2D31B 3QWOB 3P3YA 3R1GL 1OT1A 2APBA 2VLKB 3RTQA 4KK6C 3CGTA 3CIVA 3KXFE 3BP4B 3BLBA 2J77A 3FB6A 2NXZD 5E8NB 5DK0A 1A7NL 1T0MB 3GHBH 4LP5A 1FNFA 5FYKU 4HKJA 1IEHA 3OJMB 3ILPB 5IIEB 1XCXA 2BHZA 1ZLWK 2N4IA 2PYEB 3DV4A 3OAYH 1K8DB 3C09C 2Q8BL 3WO4C 3ROOB 5HDRA 4Q22A 2H41A 1EGJH 4Z7VF 1KXHA 3TBYB 1HDMB 2FWOB 7FABH 3GH7A 4D94A 3WNMA 2VXSH 3JWDH 4Z2IA 3GXFA 2X1PA 1G0YR 3CXHK 4WEMB 4AL8H 4H5SA 5ECUA 1MCIA 5CQ1A 3HNVH 5JHDD 1JNNL 4TSAL 4XZWA 3V0WL 4UB0L 1ZJAA 2DWEA 5K59F 5KW9L 5HPCA 4Y7MA 5F7NC 2DSUA 3GNOA 5HDLA 5J1AA 3AB0C 4YXHL 5M17A 3ES6B 4YWGH 1XR9A 3MBXL 1MCWM 1SQ2N 2Q3ZA 3N13A 1SJEA 3REWB 4WCYL 2NY0D 3BP6B 1SR0A 4AMCA 4H20L 1GQKA 3MGTB 1F4WL 4GRLA 2AJYL 1W9BM 1F6AA 4NC2B 3K4AA 4BKLB 2BERA 3SUWA 3A4AA 4WVRA 4RE3A 2VX5A 3MJ8A 1S7WA 4UQ2B 1OGAE 4XXCA 4ZNCD 2PWFA 1IRAY 1KBGL 4MAVA 3SDXF 1PG7W 2VB5A 2F53D 5GS2H 2JKXA 2YC1B 1PJ9A 3VFGH 2WUCL 4KJWD 3WFDH 1X5XA 1V0LA 4R2GC 2YDQA 5EBLB 3G6DH 3V6OA 2NY1C 3ZDZF 1F6LL 5I76B 5GS1B 3UG5A 4EUPH 1V6VA 4OFPA 1FYTD 2NY3C 4JB9L 2R39A 3G04B 3KYOA 4I0PA 1XGUB 1SMDA 1IGML 5CFHA 1GOHA 4KRMB 2J6EA 3IYLW 3WNLA 1FZMA 4LLUB 4EDXB 1IEAA 5ADOH 3PQYE 3BAKA 3FFCA 1MCPH 1XIWA 5F7DA 4D8PB 1DWIM 3ARWA 4DN3L 1KB5L 3Q5OA 2WZPD 1B0RA 4O9HL 2Z1KA 3PWPE 2XUCA 5EN2A 2GTZA 4D0CB 3S3JA 4G42B 2A74B 1J1PL 3MRHA 3I6GB 2NNAB 4U1HB 3FT2A 1IAIM 5INDA 2X9YA 4OGZA 5DRWA 3VH8G 4E41E 1CTNA 5HBFA 1A7PH 2V3DA 2Y36H 3S4SA 1PYWB 5BMFL 1N59A 1MNUH 2Z92A 4N0UB 4CVXA 3EOAB 3BGFB 3QEGH 4Z2LA 3JWDC 3ARGB 5ERWB 5IHUL 3K2MC 2XKNA 4I0PD 3BI9X 1CVSC 2YRZA 3A6OA 4ZFOB 3WH7A 3P11H 1K3IA 1WC7B 1T7VA 5FM5O 5GZND 4PJCA 4JB9H 4UDUB 2FYVA 1BD2E 1CK0H 4Y19D 2Y7QB 1ZHBA 4NOBA 5EC1A 1EZVX 1QSEA 3L3HB 3B8SA 2FLBT 3GIVA 3PDOB 4HIEA 2Y06L 4GQQA 5D8JH 1DQJB 3KLKA 4X6DF 3QBTB 2N7BA 4IRSC 2PO6B 5FOOA 5A8PA 1R3JA 4L9LA 5HD8C 2W5FA 4WJXA 5FAAA 4DUXA 4JG1L 3TT3H 1Q0XL 4X6CB 3RVUD 3LDBB 1P4BL 15C8H 4M5YH 4NN5C 2QHLA 5DUMH 3JZ7A 1IE5A 2APVA 4NKMB 2VZOA 3OKOA 1WISA 1E4LA 2EO7A 2C3XA 2LV4A 1FH5L 4GKSB 4NO5B 1OM0A 2BVYA 1F6FB 4NZJA 3PGFL 1YPZA 1QOXA 5GHWL 2W66A 1G7IA 1UXWA 4P9HC 1GGTA 4JO4H 4R0LB 3WKNA 1HSAB 5DRNB 5HHNB 3F58L 4MAUL 1VGEH 1P9MC 1MLCA 2VCCA 4FQXD 4W68A 1F58H 2ID5A 1LQSR 4XVJL 2RGSA 3LCYA 1ESWA 1A4JA 4N42A 4O00A 4QHLA 5CZVL 4PJ8C 4FZEL 3LSOA 4YN5A 3WKMH 4PBXA 4HXBL 2YS4A 4QRRD 1J8HE 1T1WA 3OB8A 2VUOA 5C09A 5DQJA 1WZLA 5IOPA 4WV1C 1TZGL 4HUVB 3UP1A 5HTSA 5DUBB 2CSPA 1I1AB 3F7RA 1KSRA 2WKLA 3EMZA 4B3LA 5E8DL 5C0GB 3EFFA 3Q5TA 1FOBA 4G8FA 1BMGA 4BSWB 4PJCB 3D9AH 3ALGA 3RWDA 2HRPL 1OAZH 4ZPVA 2P24A 3MRKB 4NJ9L 3NDYA 3DGCR 4L5FL 2A9MH 2ZIDA 4PMRA 3BPCA 4LCUA 3BAJA 1N3NA 4WWKA 1B0GB 2R0WL 1U92B 4C7FA 4IJ3B 3BWUC 3OXRB 4HIXL 4L4VA 4HPOH 4NQUA 1W9DM 4QLJA 1G9HA 5IWLA 3SDCA 2FGZA 3F6IA 2CRMA 5I78A 3MJ9H 2YEZA 4LU5H 1EFQA 1MI5B 1QNRA 4NHCH 5SWSA 4DGVL 1ZT4B 1UT9A 5C1MB 3RPKA 4OZGB 2PXYD 5DJ6B 4OQTL 3HRZA 4IJ3C 1S5HA 1HSBB 1MCOH 4MQ7B 1C5DA 1YPZF 3PIQA 4XWOD 2NPLX 1FH5H 3L5XH 3MBED 4RGOH 2DICA 1TVBA 1K4DB 2CKBA 1KCUH 4AZ6A 2YD7A 1MHEA 4PJ5E 1UYQA 5BXPA 1BZQK 3QXUA 3NCOA 1EJOH 1JNEA 4LPYA 5C2BL 43C9B 3I3BA 4E41D 4YC2C 4WV1B 2YFOA 3DX6A 3KPTA 1AE6L 4Q9CA 3VXQA 1KJMA 4E2OA 4ONHB 3OR7B 4X9FA 2ZUXA 4F66A 2LABA 4YJZL 4HMEA 5EBLA 5GGQH 1CK0L 5E0FA 1VACB 2W60A 3TYFA 5JHLH 2NZ9C 1LQ0A 2D3NA 2OQJB 4EI6B 3GMRB 2W59A 3IKKA 3WFHA 5IQ9B 1T0OA 3E2HB 1INQB 1IAIL 2R56H 4DFHA 2GY5A 1KEMH 3MXWH 1QW8A 2VCAA 1KCVL 1KJ2L 3T0ED 3H9SE 2EXOA 1MREH 3BPNB 4LVHC 3RY6C 3ZR5A 32C2B 3MFFA 3WUEA 2CUHA 2F1AA 4ELMF 4DVRL 1BQHA 3LZFL 1U8MA 1JN6B 3DO3A 4QY8B 3KPRA 1OCQA 4M6OH 4UQCA 3D9AL 1CDBA 1GGCL 2KKQA 3GRWA 3V5HB 4CKVX 4PJHA 2P5EE 3PWJB 5J1AB 2CXKA 1RK0A 3DX8B 4K07A 1WDQA 1G0XA 1FNHA 4LIQE 1B3VA 2PO6C 4OBRA 4GQRA 4KVCL 4PSRA 4D6CA 4X7TB 1G7MA 2V7NB 4MJ6A 1VJZA 4LVEA 3VSVA 4Z18A 2Y5TB 1RHHA 1QSEB 3K74B 2WWDA 2F53B 4O58H 1ISXA 4HEPG 2G3MA 4FFWC 2VDLL 3SCNA 2WHJA 5HVGB 3EJYC 4YZFE 2HFEB 4WW2F 5IB4A 3RHWK 3H0TB 1NCBL 3HHRB 1D5XA 2AQ3A 3HB3D 1CCZA 3DPBA 3AHXA 1OIMA 3ROOA 1ZHNA 2BXYA 5AZEH 3KPOA 4X99A 3DBXA 4CUCA 3ARGA 1HXMA 2PWEA 1KN4L 3Q5YA 5L8JB 2CHNA 1BAFL 4LPWA 2VITA 1GNXA 1I7TB 1RIUL 2DQJH 1A7OH 4OM1L 1QNQA 2X0YA 2R2HA 1A0QH 1RY7B 3FT3A 4P7NA 1MQRA 4DTGL 4JZOB 5F89B 2HFFB 3PL6B 4JFDE 4JY6A 3UJIL 2GJ6E 2WW8A 3KPPB 1NMAH 4Q6IC 3NAAH 1UWXH 1AO7E 1KTCA 5ANMB 2DQHH 5IM7A 3VCLB 4LOUD 1HHKA 4LCWA 2VLRB 4O51B 3GSQB 3G5ZB 3V7AE 4YDVB 2DSWA 1MQKL 1Q1JL 2J7EA 1C5CL 1NGQH 2APFA 4HGWB 4HXAL 1JDAA 2AQ1A 5AWNH 4E0RA 5CJBA 5C70A 3VJ6B 3ARDA 3BZFB 5D71L 5T3XD 3TTQA 1Y18B 5CUSL 2NY3B 4FQXB 3UZEA 3R0MA 1MVYA 3QIUC 2NZ9D 4NI3A 4AL8L 2I9LA 2C1OB 3GMPB 4GINA 4ZE5A 1KFAH 1P2CA 3QNXB 4YR6A 4LYPA 4WU5A 3O2DH 3CXDL 3ZTNL 4UZUA 1CG9A 2A9NL 2MCPH 4YQXL 1H0DB 4YLQT 1IGCL 3KLDA 4AMKL 1ZBCA 2I60L 3C60B 4OAWA 2AXFA 4WFHD 4X6DB 3ZKNC 2JIEA 5AG8A 1P7KB 1FFNB 1CD1B 5A1AA 4FNRA 3U9PH 4N1CA 4LHUG 5ALCH 3HMCA 5CJQL 1WAAF 3AGVA 3R8QA 1VGKB 2DN7A 4G8FB 3EJZC 4TNWK 5BJTA 1A0QL 3SDAC 5C8JA 2B1HL 1T2JA 3BN3B 1HNFA 2R0ZL 2RJMA 4HH9A 4JPWL 1VFFA 3H7BB 2DQIL 1A7NH 4NNXA 2IH3B 1N6VA 1EMTH 1Q9OA 3QCTL 1XRVA 4BQ2A 2BVUA 3T8XA 1TTGA 4E42B 5EZLB 1FHGA 3EAKA 3LSOB 1ZWIA 1KXVC 1NSNL 2AJUL 4H8HA 2QBWA 2ATPA 3PTKA 4P7LA 1NAMH 2DWEB 5JW4N 4MB1A 1VPOH 5LJYH 3HR5B 1T0NA 3DX3A 3T4YA 1PY9A 3REVA 1MLCB 3C5ZD 3QUYA 2V5YA 4XCFL 3DV6A 4AENA 4JE4B 4JVUA 3I50L 4Z77A 1UA3A 4HU0A 4DW2L 4P4KA 1F2QA 4PGZA 5DJCB 1KTLB 3O6LH 2XZAL 3HC0A 5FO7B 5JQ6L 1G7HB 5I74B 4KRPC 1PGRB 3GSOA 4F2MB 3D85B 1JGIA 4P46D 2DJSA 3VXRA 3CFDB 1BQSA 1EEYB 5HJ3B 43CAA 1V3IA 3FY1A 4GG8B 2OX5A 4K94H 3TJHD 3ARGD 4N0RA 2FD6L 1HYSC 3LQZB 2YK1L 1MFEL 3LXAA 5F70A 3BP4A 5E8EB 3DX4A 2DQCL 1JP5A 1IM3B 4KROD 3EOTL 3ZT5A 2ESVE 1OP3H 1CT8A 1N6UA 3VX0A 2NXYB 1VFOA 4J1UA 1JI2A 3QA3B 4ODVH 3TVMD 2HKHH 5JHLL 2P46B 2Z9TA 3CK0L 4CMHB 2ZUQC 1BLIA 1MCRA 1HTYA 1T4KA 1UVQA 5A8QA 4X4XA 4MTVA 2VAAB 1GZPB 4PJ7E 5IKCA 2ATKB 4NN7C 4U7MA 3CZFA 3LEXB 2Z93A 5EPMB 5ITBH 3DURB 3IFPB 3SKMB 1FDLH 1ZWIB 5C0RH 4FLRA 1FH8A 5FUOH 3QOKA 1NFDA 1U6AL 5ICYA 4LSQL 2IJ0C 2FBJH 2GT9B 1RZGA 4PJXB 2WC4A 2FE0A 1W72H 5H8DA 1UYWH 2YD6A 2AS5M 5C07E 4ZFGH 4LDEB 3I3DA 3WUWA 2AV1B 1VENA 5TE4L 3A0OA 5CEZE 1AGDA 3C2AL 3JV5A 4GRLC 4F8TA 2AJ3A 1YMMD 3L1OL 5TF1H 4PJIA 4GUPA 1ZVYA 1DDHB 4MS8C 4YFEA 2CUIA 4YDJA 1BX2B 1NCTA 2DLIA 1BVLA 5F9JA 3RZCA 1C1EL 3FRPG 2D9CA 5HHOB 1HKMA 2ADIA 4S0TD 1JK8B 4Y5YA 5EBMA 4NXSA 4W4NA 1FHDA 2W65B 5E24E 3P73A 2IGFL 3WY1A 3MOAH 4GMSL 1KPRB 4LF3B 3V6OC 5FKAA 1NBZA 3CX5K 3QIUB 3U4AA 5J8OA 5T3ZD 4IM4A 4AZBA 4I0PC 2OM5A 5K9QG 4JAMA 3DHJA 1CD8A 4O2EA 4DKFL 2F7RA 4JFEE 4OJYA 1CE6A 2XTJC 4LHUD 4Y4FD 3ULSA 1IGTB 5IT2H 3MGAA 1KC5H 1CL7H 2Q8AH 2D9QB 4K7FA 2OI9B 5EUOE 4AJ0A 3UETA 3RWGB 3M1BB 4JFED 4NUGL 4KKLC 2V9TA 3PV6B 3FNDA 1X5LA 3FRUB 3DJ9A 1LP9A 3QUZA 1G0DA 2FBJL 3HN3A 4HT1H 3UTOA 4KTDH 1F6AB 3Q6FB 1JNLH 4M81A 4RWHA 2FCBA 4QWWD 2G2RB 5F6IC 4YGAB 4WUUA 1IGJA 5EO1B 2HKFL 3BDXA 3AY4C 3LY6A 1ZA6A 3VWKC 3HMXL 3VU2A 3GMLB 3P77B 3MCKA 4RZCA 1BG9A 3FAXA 1C92A 4BS0A 4AZCB 4ESKA 1RJZA 1KB9J 5CILL 3CUJA 1YMME 5IHUH 2J5LC 4HK0B 3P40A 1E1FA 2GK2A 1NGQL 1DLFH 2XN2A 4JQXC 4QHMB 5GHWH 4MVBD 3WXWH 1IZJA 4JZJC 3RWEB 1W2VA 3VG0H 5LA1A 5FHBH 4PRWA 4MD4A 2P8PB 3LEVL 1IFHH 3HZYA 1WBZA 5ILTL 4GLRI 3U7AA 1LE9B 2FR4A 1QRND 3MNZA 3EYSH 3M45A 1J5OH 5JZ7D 3NDZA 3FO0H 3LRMA 2EEBA 3IDNA 2BSRA 2YL6A 1AQ0A 2I25N 3LEYL 1JCKA 3ZLQC 3BGMB 3ZDXE 1X5JA 3NACH 1HKLH 1YEIH 4I48B 1KQZA 4ZUWA 4HKJB 1J8HA 4I2XE 5IBLD 1AI1L 2KQNA 1VADB 3T77A 3ZKMD 3D85A 3MUY1 4ZPTA 3SCRA 5DVMA 1M6OA 1HIZA 3HE7B 2VDQL 4ALAL 3GB7A 4K23H 5L8LB 4OF6A 1DEEB 5CGYD 3CFBB 1I1YB 3AVEA 1XH0A 4OZHE 5TH2B 5BV7B 3L3DA 1N82A 3HI6L 1WO2A 4X9HA 4UBDD 5HDOA 3RWJA 4Z76B 2DAVA 5E6IC 1D9KD 4U1NA 1W3KA 3VH8B 5IMMA 1HVXA 3WE6A 1Q8MA 1AHWB 1MSPA 3WBEA 2NQCA 2ZNWA 4KH2A 5LQBL 5B3JF 1NC2A 3QHFH 4WENB 4NQEA 1U8IA 5A3IC 2DDXA 1N0XL 3Q1SL 3NTCL 4NQCB 1KLFA 2CLRB 2BNRA 2EABA 1NKRA 4GRWB 1RZ8A 3NIYA 4AM0B 4YWGL 4XWGH 4TRPH 3K3QA 3LN5A 5D7LE 3O4LE 2BJML 5ACZB 1FZOA 4WWKC 5I19H 5IMKB 5FOBB 4UT6L 5T3ZE 2GSJA 4W7UA 2ZKHH 3O4LD 5B3NA 1C16B 4J3UA 4OI9A 4MXWL 4TTGA 1AGBA 4CVWA 4YHMH 3SDCC 2VJXA 2XWTA 4AIXA 5A2LH 1BZ9A 3V6OE 4HG4J 2AP2A 1ZV5A 4BZ2L 1UXSB 3BVVA 5GJTL 4D0BA 3LB6C 3MLXL 3TNMB 5J4MA 2IMNA 1KBGH 5IVZB 3ARDB 4X83A 5C0IB 1A7BA 4U4BA 3PXHA 3RNQA 3MUIA 1A6VH 1K2DA 3X14B 2E9LA 1W32A 1OB1B 4F15B 3Q3GB 5E70A 2R2EB 1IKFL 3VCLA 1E6RA 4X7CC 1A02N 3WN6A 1IBGH 3JV6B 5E2VL 4W89A 4RGMC 5F7MC 2BNRB 1EMTL 4IIQB 3GKZA 3SJVB 1W9VA 3DXAE 3FFDA 3EYOB 3ZHDA 5IHZA 2R1YB 1GW1A 3A6CH 3VIIA 5E5UB 3GM0A 2MMXA 3TA9A 3VIKA 3STLB 2DQTL 1NC2B 3LS4H 1IC7H 3S36L 1KEGH 3HA0A 5CG0A 3QDMA 1WK0A 3RNKB 3SDXB 1U8PA 3C08H 4NN6C 2ICEA 4XTRC 1X44A 3KPOB 4G8GD 4F9LA 1UUQA 5SWZD 1OF2A 3RJYA 4UDTA 3UC0H 3P30L 2DH2A 2FJGA 1DN2A 1X6LA 3OV6A 2BRRL 3WH6A 4F37F 4NCC1 3SDDC 3UJJH 2Z31D 2F7OA 3RY6A 2YD2A 3OHXA 4GRLD 1KLGB 1JHKL 3A67H 2Y5TA 1EAPB 3T0WA 4HJ0C 4H1LG 3PDDA 1Q72H 2Q6WB 1QWUA 1CE1H 4CDGC 5FYLE 4AMWA 4NKMA 3LPPA 3VFRA 1MELA 3QISA 2YL8A 1PDKA 4NN5B 2FL5B 4JRYD 1LL7A 1OGAA 3G6JE 1KLUA 3KAAA 3NCYS 4X6DE 4PD4J 3BWAB 1MREL 5E94B 1C08B 2ERJB 4XPGL 5JHDA 3BIKB 3ZJ8A 1SEQL 5DJXB 2GSIA 5JPMB 3QUML 1WCBB 4OCYL 4UUJB 4K3HA 4OD2B 1UACH 2CPUA 3PABB 1I1WA 4FQ2L 5FYJH 3DMMC 4UTBL 4O5LH 3D0VA 4K7PH 4ETYA 4OFVA 2JEQA 5C6WH 1Z3GH 4UMGA 1PZ3A 5D7KD 3DHPA 3S35H 4XX6A 2J88L 4D9QD 3RM9A 4K9EL 3K0WA 5KSAA 3O6KH 4L29B 2JJSA 2ZJSL 3MLVH 3FQRA 1RJZB 3ARGC 3IDGB 4FQQB 5DSCB 4GLRH 1BECA 4G6JH 2ADJA 3WUGA 3S88L 5KZCB 4U1GB 2QTEA 3DX7A 4C56E 4HBCH 4ZOAA 3THMH 2GJ6B 5I17B 2O9PA 2X10A 3ZR6A 4QTHA 1J05A 2BJMH 1BPLB 1QACA 3QPQC 5I0ZA 4KRPD 4TSBH 1MRCH 5L2JB 3F7YB 2E6PA 3MRLA 4R96B 1QUNA 3LH2L 1XC6A 3ARQA 1YEIL 1RJLB 2W63A 4FQCL 3QDME 3PZIA 2I07B 5HHMB 1HWWA 3LEYH 3S2CA 1UR8A 4R8WL 1RZKL 1UEMA 3M1BA 4B0MM 4X80L 4Y5XA 4HA1A 3X14A 5CEZH 4PG2C 5I24A 1Y0LA 2IPTL 4TNVF 2XWJA 3S96A 3BZDA 1RP8A 3FQXB 2NT0A 2QPSA 3KLHC 3DUUA 5IF0A 2YBUA 1Q9WA 1BQUA 4CD4A 1JGEB 1QSEE 3FN3A 4HWBH 1QR1B 5BVJB 2GTWA 3EKCA 5D1XD 5EOCH 4P2OC 2IFFH 3I9GL 4Y16C 2QADC 1TA3B 1ORQB 1KPUB 5CIPA 1QNSA 4D6DA 1MCLA 2X7LA 2YUVA 3KZSA 4PGJA 5ESQA 2EPOA 2EDBA 3ZE0F 5I1DA 4FTVD 3CHFA 4MXQC 1BX2A 2H8PA 3TNNB 5DJAB 4BSJA 5IMLA 5F9OH 3VINA 1KN2L 3AIBA 1B0WA 3UCRA 2A73A 1LEGB 5KSBE 1YNTA 2ZSVB 3EFDH 3VGDA 3D39B 4PJ9D 3DNKA 3MO4A 4I1NB 1GCFA 2X4UA 4OKVB 2DTMH 3O9WB 3HG1B 2B20A 4YXLL 2ZXBA 2QSVA 3CFEB 1W1VA 3PF2A 3PDGA 4PTXA 1GYAA 3N9KA 1JV5B 3CVIH 1KXVA 2HG5B 1WV7T 3PP4L 1XF5A 2GHWB 5DQDH 5KSUA 3VW3L 3QXWA 4JR9H 1I9JL 1KJ3H 4Y4KA 4OQ1A 3VFGL 4P49A 3DVNA 1ONQB 2R1XB 5D2LE 4QCIA 4H1LB 3JXAA 1BFOA 5CJ8A 3N11A 2PCPB 4Z2KA 2AK1L 1X5ZA 2H26B 4HJ0D 1ADQH 5FGBC 3L5IA 4RMRA 4OFYD 4TULL 3EGSB 1UFUA 2Z31C 5DT7A 3V4PH 3UBXG 2EIBA 3HCVA 2F8QA 5GNYA 5C0FA 4TSAH 4JGMA 1YEJH 1LO5A 4QRPA 3UPCA 2R0LH 3VTRA 5KVEL 6CGTA 1MIML 4YGVB 2YPLA 3C09B 4GRWH 4NNPH 3BW9B 1INDL 2B4CH 5DYOA 4TTDD 4EVNB 1WP6A 4F9DA 1N6QL 2IADA 5F9OL 3X3GL 3SJVD 3U7WL 3BAEH 4XNMB 3ULVC 1T3FA 2YKKA 4ZXBC 3VFTB 1I7ZA 3EBAA 4FK9A 4TYUA 3VXRB 1LG2A 1OT2A 4F2MA 3V0WH 3N1GC 3FO1B 3ARED 3GHEH 2VLKA 4YHZL 4HHAA 1NDMA 4W85A 5D2LA 3QWOA 5JW5B 1CL7I 3DX2A 4PRIA 3BZ4A 5K9JH 2Y7QA 5I23A 1CXEA 2R69L 4C7DA 4YHLH 2BNQE 4MD0B 5F1NA 5SWZB 1FG2B 3T0AA 4MDPA 2WBJD 2WBKA 4MJ5B 5D7JC 1Q9KB 1R3LB 4XVJH 4JGUA 1G9NL 1X5HA 2EYRB 2PO6D 3G08B 5EZOL 4RFOH 2VH5L 3AJ7A 3H42H 3BPOB 4Y2DC 3DDGA 3ROLA 3U7VA 5DJYA 1ADQL 4IMKC 2XVPA 5D9PA 4YXKL 3SGKA 3MLZL 3U4BH 3C5SA 3GHBL 4WW2C 1RV6X 5I73B 1FL3B 4Q0XL 2IQAB 1NJ9B 4YDLC 5EO9A 3ARTA 4LP4A 1OCWL 4IMLB 3KPSB 4PRNB 5E2VH 5EO1A 3KYMB 3PWVB 4DCQA 5HYJA 3D0LB 2XQBH 2UY4A 3V6FB 5IB3A 3CDCA 4D0CA 3QUKB 1LEGA 1V7MH 3NMEA 1II4E 1OTSD 3IRZA 4RAVB 1I4FA 1OL0A 2CO7B 5I1LB 4DGYH 2ADGA 3QHTC 4LXFA 5I8EB 5T1MB 1HKKA 2VQ1B 4OFIA 1IV8A 1P7KA 2F58L 3RA7H 4NO0D 4O2CB 3NPSC 5D70H 1XR8B 3RZCC 5MEQB 3ARFA 1T1YB 4JANA 3C8DA 3BHBB 5BO1L 4WU5B 5KN5B 2EEAA 3IGUA 4U1IA 2YD8A 4LQ1A 2X5PA 4L3ED 3L4XA 4APQD 2W0PA 3BP5A 5GS1A 5J56B 2IAMB 4UU9B 4F7CA 3BHBA 1UH3A 1ZT7B 3HG2A 4S1DC 3EHBD 2CK2A 2UWFA 5KS9A 3BSGA 5E6ID 2VC9A 5HYJE 5E8PB 5F72S 1F5WA 3TV3L 4AZIA 2FX9H 3NFSH 4K7PY 1BD2A 4JCLA 3QUZC 3A3HA 3MLTA 1NGWB 5F9AC 2WP3T 1V0NA 2AJ3B 4MAYA 1YEKH 4JDVB 3BFOA 3A5VA 4BELD 1IGFH 1R3IH 2XFRA 1LD9B 3OXSB 3REWA 2YRPA 3QO1A 1JGLH 4IDLA 1JFHA 4WHTB 1MPAL 3HC4L 3O45B 4WUKL 5BWFA 1V02A 2Z91A 4MADA 4ZAKA 1A64A 4HAGA 4XGZA 2FJFA 5DJ8B 2PKDA 2R69H 4X8XA 4QCEA 1XFPA 3PWNA 1EO7A 3WFBL 1G9EA 3EO1A 5CEYA 5IB2B 5DK3A 3SDYL 2OWXA 1U58A 5CEXA 3BAYA 1N8ZA 3L5WB 5DXWA 5C9KA 4ZO7A 2ZUYA 1WSST 1AGCA 5D2NB 1U3HD 2HH0H 5JW3L 4OZIF 2XJ7A 5I1GH 3SIMA 3MYJB 4ELKA 4JRYE 1KTDB 1PKQE 1OARL 3PZVA 4E41B 1U3ZA 3MUGA 3QEQB 4C55A 4HK3N 5D1QD 4D71A 4P3WA 1T6VN 2AGJL 5DMYA 1F3DJ 2EDFA 4X7TA 2V7HA 2A2QT 5HDQH 5DZLA 1IT9H 3RY5A 1KG0A 3MNWB 1YHTA 1XT5A 5EIVA 4CRPA 4K3GA 4XP9L 3ILPA 4OGAD 2E7CA 3PWJA 1EHXA 1KLUB 3ESVF 3PGDA 4NQEE 4OFKA 2R4SH 5IW6A 2A6DA 1K85A 5AZ2H 4D6IA 2CIKB 2G60L 4O02L 3T0EB 5HPOA 3WQWA 2XZQH 1HT6A 1S46A 3GSOB 5T3XH 1XHGA 4X0VA 1ZS2A 3VFNA 4PRDB 4QDMA 3RAJL 4MCZA 1FNLA 2J8UB 4HV8B 5C0FB 3GKWL 1WNOA 2Z31B 3FAWA 4OD1L 1QEWA 3PP3H 4PRHE 4AIZB 4PYHA 3MV7D 1BAGA 4NKDB 5F7FA 2PWHA 4I8DA 4U05A 3TPUA 5IVXA 1FNGA 4JKMA 3L4YA 2HN7B 1R34A 3SHSA 1UADC 2ZUSA 5E6IA 3NIFF 2HH0L 1WB0A 1VACA 3TYFB 4YHYC 4N0CD 4PLJC 2F1BA 4M43L 3VD3A 4OI8A 1P6AB 5F7HA 4BH8A 1B3WA 4S1SL 4V1DD 1DSFH 2JEPA 5DMKA 1GOMA 4PCSA 3DVGA 2R1YA 3FRPA 3S37H 4RBPH 3EYOA 5EOQL 3HC4H 3UAJC 3B9DA 3DSFL 5B22A 2PF6A 4NO2A 1MRDH 3UG4A 5E6YA 4JY5H 3LKOA 5BOPA 4K3DH 3CMOL 4NSKA 5CZXD 4EN3A 2WMHA 2X6MA 4XMKL 1O7AA 4RA3A 5CJXC 4ZO9A 4KJYB 3TBTA 4X6DA 1CGSH 4U0RB 5MHSE 1QFWL 4HIHA 3T08A 5FYJE 2QADB 4Y16B 1IQDA 1SBSH 4LQFH 2FIKA 2NY2C 4M43H 5CJOL 4MJ2A 3GIZL 4AYFA 5CD3B 5D2LF 2Y2WA 2EIZA 2AJXH 3GFUA 1D5ZA 1VF8A 3J7HA 4PJ5D 2YFNA 1OAQL 4YPGA 1NMCB 1GPFA 3DETC 3VFUB 4CVZA 2NSXA 1GL4B 4JO1H 4I2XA 4XV0A 3ULVE 3DI3B 3CUPB 3VXOA 1FCGA 1B30A 2EZ0C 2ZCLL 2VZVA 1XSIA 4PRPD 5MEND 3JTSB 3HU7A 4N8PA 2C3VB 5I19L 1EJOL 4F57H 1W9PA 1H8SA 1CXLA 2VMFA 5E4EB 3TWCH 3HI1B 1AGEB 2KDGA 2BFVH 4LRIC 4OCSH 4UT9L 1F42A 3C60D 4R2GD 2VDKL 5IW1B 2J4GA 3THCA 4F58L 4S2SB 3HNSH 2BRQA 3VIPA 4XVSL 3QIBB 1GOWA 5I8OL 1AO7D 3MRCA 4F9LC 1XF4B 1JUFB 1T80A 4BQ5A 4PJHE 1BF8A 4OGYL 4WFGD 3QXDB 5B21A 3MV8B 5GS0H 5IJKA 5ABFB 1H3TA 1LK3H 3SDDA 2VZTA 1A47A 5A16B 2W9EH 3VUPA 4PCTA 1HHIB 3C87A 3WFBH 1G0CA 5I1IL 3MRJA 1SYVA 3BEVB 1M05B 1QRNE 5DFTA 1EAJA 2R4RH 3C5ZC 5BO1H 4MQSB 1FFOA 7FABL 1J7VR 3RPIB 4CVUA 2LVEA 5CMAA 5ICXB 2G3NA 4N9GA 2WANA 4X6CA 4F9JA 5IHLB 1AJ7L 3AIQA 2RBLA 2GJPA 3RP1A 1CL7L 2Q8AL 1DVFD 3UJJL 1MYRA 1RURH 3QUXC 1IGFL 3LQMA 1V8HA 2GJZB 5E9DB 5AD0B 2ARJB 3QXVA 2HLAB 4Q58C 3IDNB 3B43A 3B5HA 4QY8A 4LLYB 4M7KL 2DT2A 3H9ZA 3BC9A 4EE9A 3NFSL 5DURB 1RULL 1U8LB 1OM3L 4G80B 2ZOLA 3G6AA 4L8CA 2YUZA 3MYJA 4ELKB 4U1SA 4ZFOA 2XPKA 2WWKO 5GRVK 3MJGX 5IQ7H 4DWSB 2NZIA 5KSAC 1V6UA 4MDJA 4OIAA 1V3MA 2DQDH 2OCFD 5EC2A 4PJ7B 4D3CH 2YMXH 1XSKA 2PWDA 5GGVL 4YBQC 2ZNXA 5HYQA 1CGWA 3QIBC 2NCMA 4KRNA 3MROB 4N0UA 1WBXB 2BNQD 3FO9B 1DWAM 4C59B 4CGTA 2VDMH 2P8MB 4KK5D 5IG7B 3T0BA 2EYSB 2OJEA 3C2AH 3FT2B 4MXVF 5T5NF 1H09A 4Y1AE 1I1FA 1F4AA 4JLRB 1HHHB 6TAAA 4NM8H 3TH3T 1ZLSL 3TVMB 4KJPC 2WXDM 1F8TL 2AJSH 1C12A 1QZ1A 4WHCA 1CI5A 1T66D 1A6ZA 4GRMA 4FTVE 1YYMH 1NOWA 4PYGA 5IVZA 4Z2HA 2FX8L 4NQDB 1A3RH 4PGEB 4BYHA 3H53A 4LL9A 1YY9D 4OGYH 1K4CA 1CLYH 1I9RH 5J11B 5A40E 5LA2A 1RQ5A 4P2OA 2W65A 1C5CH 2D20A 4FNLH 1MFUA 4DKFH 3MC0A 4G7YL 4DGIH 1UASA 5DUPL 3WH5A 2MJWA 4L4TA 3MODH 1XCQA 5ISZB 4C7GA 4L8CB 3O6FA 3VX1A 5IW3A 4TUKL 4X80H 5T5NG 1D6EA 3HAEH 1ZOXA 4P0DA 2OSLB 2O92A 2EH8H 4AZ7A 3SN6N 4K8RL 3QCVL 4FQIH 2D22A 3ZL4H 2APXA 4LAJH 4XAWL 3KYMA 4ORZC 1SJEB 2W9DL 4A2LA 4O4YH 1SFSA 3AM8A 2DYPA 1XF2B 4X6EA 4DW2H 3RVVC 1ETZB 5DWUH 3RIFF 3KPQB 3PWUA 2ESVD 3QDGE 2VKWA 3CUFA 1DANT 2YSSB 1MFAH 1JZ7A 4UV4H 1S7QA 4OZOA 3F12A 5DFVD 5T1KD 3MUHL 1BFSA 2QL1A 2WBWB 2ZE0A 2Z35A 4OGXL 5DA0B 3CNKA 1VEPA 4Z7UA 5FGBA 3GJFK 1X3DA 2B1AL 3ILQD 2WK2A 4M93B 1K9TA 3FQWA 2Z31A 3QZWA 3RWIA 4PRIB 2QQKL 2NW3B 5DVKA 4WHYG 1NQ6A 1B3ZA 5BCAA 2R29H 3BH8A 2B1HH 3D18B 4C83B 1K9EA 2Z4QB 5I6SA 2G75B 3G5VA 4P8XA 1MCSA 2E6QA 4I5BB 1ODZA 4TX8A 1A3RL 3VG9B 1L7IL 3BAWA 3RJDA 2EPMX 5I1EH 4M7ZC 3CH1A 4HS3B 2WHLA 2FLRT 1ZS8A 2YPLB 1YY8A 3RL1A 1QP1A 5DRZB 3G6LA 3MCLH 3MLYH 2QQLH 1GRWA 5B38B 2W9LA 2GSGB 5FO7A 3U83A 5JA9A 5F9WB 5FL1A 1LE9A 4KMTH 5F44A 4P2YA 3HZYB 5DEFB 5E5MA 4GAYA 1KEML 3B2VL 3MUGB 4LSVL 5IK3B 4CD8A 4KI5C 4PJHF 2CERA 2QADD 1GVIA 1KTDA 2DJUA 4ZYKA 4H8WH 3VWJB 1O5DT 2B2XH 1IGMH 1CWYA 5D2NC 2O5YH 3S6CA 4P2RB 1VDGA 2IBBA 3L4VA 4S3JA 1J88A 5E99L 3RY4A 5ERWA 1GZQB 3D3VB 3P0YH 3WN5B 4E4PA 4OLUH 3GMMA 2V9RA 3H3PL 5C08E 4B41A 4GKLA 2XPGA 1R5IA 3MRQB 2JF7A 3BT2H 3ZSSA 1YEFL 5A2KH 3BMVA 1XGZA 2FEDC 2V3FA 2G60H 4O02H 5JUVA 3I6GA 1LD9A 1CICC 3AMKA 3OXSA 2XKUA 3VI3F 3UYOD 2ICWB 4KKCD 4P5TD 3AMGA 1BJ8A 2D7OA 4X4ME 1NCAL 1NGWA 3O11A 1VGKA 3SQOH 2C4FU 5KJRH 5EO0B 2RB8A 2NY0B 4NWUL 2X9XA 1KIQB 1H3WM 4JFPA 1D9KB 4XC1H 4H8VA 5A6LA 4OQTA 2F8VA 5BROA 2IGFH 4KI1A 1CE6B 1ZTXL 1FZKB 2FX7L 1DBAL 2W0FB 4FLSA 1TDQA 5D1ZC 5JPNB 1E0XA 1KR1A 4G6JL 2OWWA 1AFVL 1J1OH 4U6VL 2J7GA 4KXZH 4OCRH 1KENL 5C0RL 4M9PA 4UZGA 5SV4A 4N0YL 2A9NH 5LGJA 1HZHH 3TIEB 3DMMD 3P4OB 4K9EC 4YDKL 3BUBA 2BNUB 4JJ5B 1FYTB 2CR3A 3NPSB 1D7FA 3SGDI 5TDPB 3T2PA 1CD9B 2EDLA 3BAXA 3MRFB 2AVGA 4KK8D 1UB6B 2EAEA 2NX5E 4I0CC 4MQTB 2VUYA 4FP8L 2AKRA 2HWZH 4HMDA 5D93B 3A6CL 5GNXA 1OVZA 3F7YA 2P49B 4BQ6A 1QFWI 1YYLL 4EQ3A 4IMLA 2VLLA 5KSBF 3C9NB 5D8ZA 3FFCE 1R5IB 3MRQA 3MV9B 1UQSA 2LAGB 1VJSA 2NLJB 4AMXA 4U7SA 3BQUD 4W7VA 1IAMA 4Q2ZA 3SCMD 5FKYA 5D7JB 5AUMA 4D9RD 4U49A 1ZT1B 5EBWB 2MOVA 3UTPD 4RE2A 2HTLD 3KXFD 3CPLB 3QEQA 3NJ3A 4OLUL 3QO0B 3HI6H 4QGYA 2YPVL 4X98B 1PFCA 3LAFA 1A5FL 1DFBL 1RHHB 2MPAL 5KVFH 5T3ZH 4OD2A 5IEHB 4ZS7H 1U41A 3U1SH 1MRFL 1MFVA 3BP7A 2FNBA 3T0EE 2FDBP 3RUGA 3ZE1F 3TO4D 2IH1B 5C09E 1JHLL 1TJIH 5F1IB 1WAAE 1AI1H 5DK0B 1DWHM 2ITDA 5IROA 4OM0L 1RJYA 2W9DH 4PRAA 3ZKQD 3QFDA 2VDRH 1A9EB 5I1AB 2FO1A 2D31A 1B4JH 3OHXB 1YN6B 4HIJA 1BYDA 1EFXA 3VD9A 4PGDB 2PW2B 4U1JA 2Z35B 5LAXA 1YUHA 1PKQB 3V52H 1D3CA 2V5DA 3REVB 4JRYB 3AZSA 2BNUA 5TE7H 5D7KE 2X2YA 1LO0L 3IDJB 3AI0A 1BGGA 4LIQL 1G9MC 5I6XC 4IRZL 2ICEB 4MSWA 4AEHL 5C0EB 2B1AH 1RMFL 3L3GB 4QXGL 1EEZB 4PJ8A 2O61B 2JJWA 2GAZA 1MWAB 3OR6A 4P57A 4RNRA 2IH3A 4R3SB 4UV4L 5CSZB 5EULV 1MEXH 4H88L 3AXXA 1NBVL 3LMYA 4LSPL 2ZCHL 4DFIA 3AROA 3JV6A 4XI5D 4FF5A 1WCQA 4CW1B 5EFIA 1T20A 4EN3C 2M2DA 4UI2A 2GCYA 4L4TB 5CJXA 4X6CE 2BS9A 1MJ8L 2EE3A 4V1DA 5ESQB 4HOXA 2AW2A 1NUDA 5HYJB 1AD0B 1I7RB 3FHAA 1S9VB 5D71H 3OKLB 4NGHH 4ERSH 1M03A 8A3HA 2GJXA 1H49A 2YDRA 4P9HH 5IWLC 3ZYIA 1CQKA 4P2RD 4Z7WA 4KHTH 5L7XH 3TZVC 3RVWD 3WD5H 4DO5A 4NP4H 3CTTA 3WIJA 4NCC2 1UJ3A 3FQNA 1G7JB 1X4XA 2AGJH 4D3CL 2PBOA 2X9WA 3B5TA 4XVUD 2BMKA 2NY5H 2WZEA 3RUGE 2OSXA 1HQ4B 3MTRA 2PR4L 2VABB 4WI3A 3SCVA 1AXTL 1L9NA 3UTTD 1UB5A 1WVZA 5LA0A 4Q6IB 3VIFA 2D73A 3ECQA 4J12A 5C0GA 3HZ3A 1E70M 2UY5A 3O2VL 3MA7A 4MNKA 4YAQB 2DSKA 3NPZB 1KCRH 2BVPB 3O41B 1BPVA 2J8HA 1UQYA 5DQJB 1UZ8B 4KDTA 2UZXB 3VFTA 4WKHA 3GJEB 3KYNA 7TAAA 2IFGA 2C9AA 1DLHB 1JWMA 3QG7H 1V02E 1JHKH 1N4XL 3X13B 3FB7B 5BQ7A 5JUEL 3HUJB 3W0KA 2FECL 1WT5C 3BW9A 3ZYOA 5T3ZL 4IOFD 4B9YA 3SKJH 3WJLC 4PJ7A 3BH4A 1RMFH 3O3EA 4XI5C 5E1HB 3MREB 3VG0L 1PSKH 2FSEB 2V2TB 2YUWA 4YBHA 5IJKC 3U0PA 3I6LE 4KY1H 3GGWB 5I66B 3MZGB 3PABA 2QPUA 4X6BB 3MYZA 4WSJA 1KNOA 1BFOB 1N64H 3C5ZA 3OKDA 5ALBL 2FX8H 3OKOB 1U91B 4M7JH 4ETQA 4QRQB 3RDTD 3N1AA 1OGAB 2H32H 4Z7NF 4F7MA 3RILA 3BEWA 2FD6H 4HUXB 1C8QA 3L3IA 4N1HB 4KWUA 4C4KT 3R1GH 2WNWA 5DD0H 4UFJA 1G6RL 4RX4A 1VERA 2AJVH 2I27N 3AC0A 3OAUL 3KPRB 3OKDB 4OZ4B 1AKJB 3H3BC 1NAKH 4Z78A 1DQDL 1NGXA 1QNZL 1S9YA 3KNBB 4QT5B 4K3JH 3D39A 4MCYA 3M46A 1WBZB 4NQCD 5JXEA 4BZ1H 2Q1EA 3HI5H 1MXGA 2YIHA 2I9TB 5I8KH 2E7LA 3EOYG 4MAZA 3U48A 4XRCB 4QHMA 3S5LA 2AABL 3DECA 1AY1H 2OYLA 2H45A 4XCFH 4URIA 3QIBA 4UV7H 5C0CA 5GGVH 3RQ3A 2LU3A 1R0AL 4RZCB 3KR3H 2DT3A 5DD3H 1K9FA 5FEBA 3S4SB 4W4OC 1KTKE 3ARFD 1QQDB 3EO0B 3HI1A 4ZUSA 5K9OB 2XG4A 2YBTA 3E0GA 4HLJA 1CGXA 4F7PA 4NQDA 4Y7EA 1V3LA 4XB8A 1R86A 1U8NB 1BLNB 5DHYA 4LLDA 1KFWA 4PJFA 3TO4B 2J8OA 5DD5L 4ATLA 2V17L 4P8UA 2X05A 1BFTA 4ONOA 2D4FA 4Q6IA 2YR3A 6A3HA 4AXNA 4G3YL 5KSBB 3W4RA 3SCMC 4I4WA 2EDNA 2OYPA 2ILLA 2UWEB 3KPLB 5E08H 3PTQA 3IFNH 1EVTC 3ARDC 2WVSA 4OZGA 1AQHA 1H3PL 1WFOA 2H2PD 4OCXL 5I15H 3WEXB 5HHVL 4D6FA 1BZ9B 1HZHL 3QIUA 3SDCB 4JDTH 3CH9A 1K6QH 3OJDA 1Q94A 3FT4A 3GZKA 4TTUA 1IL1B 1LK3L 2YXMA 4LLMA 3W0WA 5HI4C 2NY6D 2GW5A 1BQHG 3FQUB 2EIEA 3RX7A 1JF1A 4PREA 2B39A 4LHJB 1C7SA 5FK9A 4LSVH 1T5XB 4JQVC 3L3OA 1G9NC 2APTA 1KULA 3O6FC 1VFUA 1UZ6F 1R46A 5DZOA 1TQBB 4UFHA 2V2WB 2COQA 3SDAA 1CU4H 2ZPKH 2GK0B 3KNBA 3TIDB 5EB8A 3BP6A 1MLBB 4NNYB 3RHWF 3ZL4L 4LVOC 3CUGA 2XTKA 1GQIA 2JF6A 1NBYB 4LHUB 4Y4FB 4F9PC 3PGCB 1XGTA 2OSWA 3QH3A 4QOKD 3KPNB 3WL9A 1IEBB 1NGXB 1S9YB 4QT5A 4Z7VE 1UD8A 4PTVA 3BYYA 5E6IB 1J8KA 5AG9A 1UVQB 2BVOA 3MO1A 4DGIL 1I9JH 4EKJA 3L3IB 5F7UA 3QUYC 4AG4L 3UTSE 3KYAA 2FECI 1M4KA 4UTFA 4ODHL 1IQWL 2EC9U 4ERSL 4PUDA 2AI0H 2XA8L 4M5YL 1U91A 1JPSH 4YUEL 4HJJL 1IAII 2WINB 2NY5C 5C0DA 4Y1AA 4KRLB 1XGYL 4PJXF 5MENE 4RMVA 4ZDHA 5DI8B 1L0PA 1HJVA 1RJYB 2E4TA 5AWNL 3IVKA 1HNYA 4TRPL 1I7UA 3OAZH 5AYBA 3HUJA 1KTBA 1BTCA 2NY6C 1MQKH 4KC3B 3PGDB 3QCTH 1H3PH 4PJ9A 1B3YA 2GDVA 1A7RL 4GSDL 4B7LA 1AGEA 5GRYA 3MREA 4XT1C 4HJGB 3RGVD 5I8CA 5I1EL 3BAIA 2NXZB 4MJIB 1NEZG 1GC1L 2FR4B 1QTYT 2OLDA 3TT1L 1VFMA 1LVEA 4P4KB 1UB5B 3RWEA 2IC2A 3BKYH 3QNZA 3V0AC 5EBGA 1AQKL 3P9LA 1CNVA 1NMBL 2ZG1A 4PJDB 4HOZA 4TPRH 3UMTA 2DIAA 2FEEI 3K80A 5ADOL 4HPGA 1OSPH 5LXGH 4LMQI 3IJHA 4PTTB 3TNMA 1GJIA 2P7TA 2EIZB 5FGSA 3G5YB 1H8OA 4PJBE 5K93A 1UQSB 1HQ4A 2VOTA 1ZE3C 1JL8A 25C8L 1A4KA 2XA3A 3WFEL 1LP9F 1Q9OB 2FIKB 1T1ZA 5DJ0A 1R5VA 2XN1A 4HZ8A 3DXAB 5J06A 4N90D 5EN2B 3UX9B 3AHYA 4CMMA 5CGMA 1TZHB 2YZ1A 3MPCA 2XG9A 2AXGA 1JZ4A 4XBPA 3JBG7 1R3HB 1EO8H 4DGYL 4CD6A 1VIWA 5DD1H 1HH6A 4BZYA 1FNSH 1E72M 2C26A 3IGAA 5I1KL 4Y5YC 2XWBA 2PF0A 4K9EH 3UTSA 3FL7A 3VSTA 1WF5A 5C0CD 4P5MA 4YR6B 2QKIA 1UD4A 4O2FA 1QOKA 2XQYK 4NC1C 3WXWL 1MWAA 3AU1A 1A3LH 4G6ML 1MIEH 3WNNA 2VR4A 3AU1B 5FM4A 4QRRA 4WUUE 4YXKH 4DGVH 1RZJL 1FZKA 4G7VH 3ZSTA 1AQMA 1CQYA 4NPYA 4R3SA 5HGAA 2CK0L 2AJYH 1ZVSB 3N9GL 1FNGB 3W6LA 3TBSA 1RULH 1S7WB 1YNLH 1X5FA 3LIZL 1MWOA 2B0SH 3CZNA 3NCYP 3QULA 4JFQB 1S9XA 1YNKH 4LCYB 1OOAA 4GG6F 3O2LA 1R5WA 3L7FA 5D7LB 4Q6YA 3MLSL 4HV8A 1A9EA 1ZVHA 3ZDXF 2ZUUA 4ZTOH 1T1ZB 2NR6D 3BXWA 3MSPA 3AY4A 4EI5A 4S3KA 2CIKA 3HRPA 1T83A 3VWKA 1FZJB 4D0DA 3E3QC 5JMRA 5F1IA 3K7UA 3UJTL 2MWCA 3C5SB 4JN2A 4L3CB 3BAEL 1CF8H 3WH8A 5D2NE 1HIMH 4UIKL 5FIEA 5IR1A 4G3YH 4R90H 1GZPA 1TCRB 4W70A 2VE6A 2IMMA 1KPVB 1UD3A 2ZUQB 4KKBD 3BXNB 4PJEB 3NIGE 4OT1L 1U9KA 4EJ1C 4JZJA 5SWZA 4HZ6A 3V4PL 3SPVB 2HFEA 5HGBA 2GUOA 4QAWA 3VPLA 4P23C 5DD3L 1OW0A 5E5MB 4OZGF 4AEIH 5C3TA 3GXPA 5F7EL 2X4OA 4OUUA 2J7BA 1NDMB 3OG6B 1G9NH 3BT2L 4WI8A 3F5JA 1TCMA 4HIXH 2A6IA 3FO1A 3WO4B 5SWQB 3PZMA 2AK4D 1YA5A 1R87A 1CDUA 4U1MA 2XACC 4X98A 4KHTL 1OAYH 4XNMA 2DLGA 3MRDB 1FE8H 3PNWB 5CINL 4M56A 4OD3L 3TZVD 1AJ7H 1I9EA 5IROC 2E8YA 4EI5B 3ARSA 1NWSA 1XMWA 2VN7A 2G9HA 1AD9A 1RHFA 4NZDA 3ZT7A 3C6SB 3HE6D 5C0DB 2QQQA 5IMOA 1JD9A 2BXZA 2RCSH 5ITBL 2GITA 5D7LA 1CS6A 4UINL 4S1SH 2XTLA 3A4XA 4NX0A 1UR4A 4XAKD 4KUCD 4WTXA 1EJ6A 2IXVA 1XIWD 1OGTB 1ZJBA 4NZCA 2N7AA 5EU6E 4KDWA 2W0LA 3GSXA 2IQ9L 4TOYL 1YPZE 2BY0A 2J6EH 3CAFA 4U3AA 1EVUA 3H7BA 4NYLB 5DMJB 1A7PL 1U42A 4YHIB 1U2YA 2EDEA 2ED8A 4JFPB 3SDAB 4HGMA 4K3DL 5E1QA 2XM2A 4FZ8L 4HP5A 2CPCA 2EH7L 5JPNA 3MRMA 1YEGH 2QKIB 1A7OL 1IGYB 4ZEPA 1T5XA 3B9AA 5EZIL 4LHQB 4DWSD 3P9WB 3SE3C 1AR1C 3DXAA 5HVHC 5IBUB 5ABHA 1XGPB 3BDYH 5DJ6A 2BNQB 5J13B 4YK4C 1MHHA 1T2QL 5M3WA 2XVNA 5EU6A 4JN1H 2UZIL 4FQXC 1E5JA 3TZVA 5GZOC 3G5YA 4XPHL 2V2XB 4DJMA 4X0KA 1MFAL 1EHAA 5I71B 3MXVL 3CJJA 1UJ3C 4PB9H 3PWLB 5LXGL 1DFBH 4JVPA 1M7IA 4NCDA 4MX7B 3KPMB 5JBFA 3HZMA 1NMBH 1SBSL 4W81A 5HHVH 2HFTA 4JFOB 4I4WB 3DX0A 5IHBA 3C5JA 4R4FH 3NCCB 3AIRA 2IQ9H 1SYTA 3CMJA 1WKYA 3STBA 5HGDA 4JRXE 1HHHA 1JGUL 3R06A 4XMKH 3T2NH 2Z1SA 3AZRA 3EMCA 1U95B 1JGLL 5CILH 5DUML 1JYWA 3BZEA 5DC9B 5C6PB 3MSGA 5BS0D 4R7DA 4G9FD 2XYLA 4KDTC 4XP9H 1U8QA 4TQEH 4HS3A 1MVUA 4QXTA 2VITB 1ZANH 4KROB 1AH1A 1W8NA 3SGEH 1QRNA 2ZZUT 5A6JA 4PP2B 3TP4A 1WT5A 2G75A 3G5VB 5DT1L 1NC4A 3LX9A 1KOAA 5GZNC 5A8OA 4D6HA 1DUZA 1NUFA 1AXSA 4UFLA 5DI8A 1W9XA 5IB4B 4FG6D 1S7UB 5L0QC 3D50A 5CIPH 3HG1E 1EDGA 5JHDE 4OLZH 3EYUL 1YC7A 1X9QA 1QI5A 4RGNB 1F3RB 1U93B 3CXHJ 5I16B 1A1OB 4M9OA 3IJ7A 2J88H 3GO1H 1IC5L 2CYGA 5CKGA 4U1KB 5TPWL 2ESVB 3U7YH 5BMFH 1W0VB 5DFVC 1ZXQA 3II1A 5KSUB 1PW3A 4F7MB 3QH3B 1JBJA 2VO5A 1HQRA 5CMAB 4PV9B 2F74A 1LDPH 5B8CA 3MO1B 2HA1A 4GKZB 4WFED 5DGRA 4CKQA 1EDTA 4NRZB 1DN0B 1INEH 1MLBA 1QLEH 5I75C 2IANB 1ZL1A 4GZIA 3QOMA 4WK9A 4D6EA 5ESVA 1O7SA 1CXFA 3EUUA 4N0FB 1SEBA 4OIBA 3BPNC 3DMMA 4XNQB 1NBYA 4LHUA 1UM5L 5L6YH 1GOOA 2E7LC 1QI0A 1J0IA 1X7QA 2FSEA 3UTTE 1UCBL 3LN4B 2VH5H 1N26A 2XKNB 4OGAC 2JJSC 5TQ2H 5IGXH 2B31A 1A21A 3VIMA 1QRKA 1FDLL 3QDMB 1N59B 4N9OB 1JYVA 4RMQA 4J3XA 4W4OA 4ONHA 4MB3A 4XPBL 3FQUA 2W91A 3AMCA 4R6UA 4YC2B 5IHZB 3EJRA 3T1FB 4ZFGL 3FTGA 4IRJD 5J0BA 1TQCC 1R24A 1C8YA 2XWJB 3BE1H 2IEPA 2FATH 2DQTH 1QWNA 2UWEF 3FB5A 3SCMA 2RQ8A 3OF6D 5BRZA 3DGGA 4YDIL 2VDNL 2EDDA 4NQSA 3ALFA 2R2CA 4Y5XC 2F9BT 5TDOB 4PG2A 3VFUA 4CVZB 4F37K 1NQBA 1ACYH 2EYTB 1VFAB 2CGRH 3BKMH 2FO4B 3FQNB 4XC3H 2VSDA 3TM6A 5C9JB 3MR9B 3UCQA 4FS0A 4HTYA 3VXSB 4GXUN 2R2HB 4EIGB 4WW1B 1XGUA 1CD0A 2HJLB 3B9KA 4UFKA 2R56L 4ZUVB 1Q72L 3ZHLA 1TQWA 3X3FH 4ZFMA 2UUDH 2OZ4A 4RCAA 1R24B 5GIRA 1JZ8A 1Q4NX 5AEAA 5JIHA 4HS6B 3U36A 1W2PA 4U5IA 1NGYA 3RVWC 4YEFA 3WF1A 4CN1A 5IVOA 2R0KL 2ZXQA 4ENED 1EHLH 4MZ2A 3MROA 1ZMYA 5EIIA 5FCUL 2Q87A 1K5NB 1UENA 3ALWA 5FA4B 5GGRY 1WUNT 2R2BB 4KQ4H 1OAKL 5ANME 1EX0A 1MH5A 4K23L 1HYRC 5J6GA 4OIIH 2IANA 5I75B 5KSVB 4APQC 1V7ML 3VIHA 5CSZA 1J9CT 4X5XA 4LCCC 1MJ7L 2XFFA 4H25B 1B90A 4F9PA 4XXDA 5F3BB 1MCOL 3I02A 2WV3A 4QRQA 3BJ91 3QIWD 4UOW0 4YO0B 5CPSA 2ADFL 5FYJD 3F65A 2EH8L 4LLAA 2F8OA 1S3KH 1T1XA 2AK4E 4W6WB 1T03L 1U8MB 2J8FA 2F74B 4QRUA 3RVXC 1KNOB 1A1OA 3D5HA 5IFAH 3HZVA 3UDWC 1NWRA 3GSVA 1A6AB 1CVRA 1QFOA 3IDXL 4HPOL 1Y6KR 1BQCA 4L4JA 1IARB 2ESVA 2F53E 2WIIA 3IXAB 2X2IA 1RUPL 3BEVA 4HOWA 4PS4H 2IANE 3ARBB 4ZPTB 2DYPD 5C07D 2DLFL 1RZJC 1S7VA 3QJFB 4M7LH 1PZ2A 4JM2D 5GRWA 4DK6A 4XZBA 1CZ1A 2VVNA 1RIVL 4CU7A 1K8IB 5FYKH 2C8NA 3RCNA 3B9EA 2GJ6D 4P48A 5TF0A 4UCFA 5JIIA 3O2DA 4ELMA 1S7XB 4JKWA 4QRSA 3O2DL 2QQLL 4MNQE 4BQ9A 4JFSA 2CD0A 3QXAA 4P5KA 3RAJH 2FH6A 3A24A 3AREC 3KYNB 2E27H 3THML 4UIMB 2VX4A 2OBGA 5JOEA 2IFFL 3WDIA 1OBAA 3MA7B 2VXQH 2H2PC 2AEWA 3THDA 5FYLL 4Y2DA 5D96C 4OKDA 4G6MH 2X4NA 4RGND 3PE9A 1ZT4A 4EBQL 3SGKC 4NQDD 1KXTA 3PUCA 4WW2A 4KK5C 1CLZH 3HZMB 1V3HA 2XWTB 1V0MA 4IM8A 2G3IA 4XHQA 4AEIL 1OAUH 1G7JA 1NAMA 2GIYA 2X1QA 3TBVB 3AQUA 4WTZA 3RKDC 3AISA 4NC1E 1IMHC 3MRHB 4IOSD 1ZA3A 1ERNA 2AKRB 2GTZB 3VDAA 1W1TA 3Q6FA 5I9QB 3CLWA 2P42B 3FQTA 4Z7WB 4QHUA 2GCYB 3K1DA 4EN3B 3A6BH 4UQ3A 2OWCA 5TDPA 5IB1B 3AXLA 3RWFA 1KWGA 3ARFC 1NLBH 2AEPL 5DEZA 4NQCA 1T22A 5L9DH 1FNEB 2CJUL 2R15A 7CGTA 2EO9A 3ZKXC 3QUMB 5CSYA 3GSXB 3BP5B 5JBDA 5GS1C 4JKLA 2OJZL 3WF4A 5I2UA 1A4JB 5IMMB 3BRFA 1ZHKB 3VD7A 4JAWA 3DVGB 4WFGE 5CHNB 3G6JA 3ZE2F 2Q76A 5BV7L 1BVLB 2UY7A 3WD1A 4D9LL 5DK2A 1UD2A 4H8UA 5IJVA 5KVMC 1W0WA 3QUMH 1E4WH 5DMGD 1IC1A 3EYQD 1N2RB 5CXPA 2G4FA 4B3KA 4J4PD 2OR9H 4LSRH 1AD9B 3M8OL 5E7BA 3VFNB 3OMZA 4HX1A 4EI5C 1HL9A 2ITDB 1WWWX 3C8HA 3W11C 1KIRA 3U30B 3O2WH 3WIIL 4F8XA 1L7TH 1U8OA 5C0AD 1WAAA 3BIAX 1RZIB 5CSGA 3CFKA 3ELAT 5DD1L 3OGOE 1G1YA 1FFRA 3I3EA 5EZJA 3GBMH 3MV11 1CXKA 1IAIH 1BG4A 2CKNA 4DO6A 3T0EA 2D0HA 1OAXL 2QV4A 2ICCA 2RFXA 4CN6A 1YZZA 2X4OB 3MLVL 4NFBA 3WQ8A 4FNPA 4P23B 4PRHA 1ISZA 2YPVH 1QKZH 3IB4A 3QPQD 5JW4M 3GNRA 4UDUA 3I75A 5HI4D 1OW0C 5TGBB 3BZ4B 1MCBA 2CDEB 4NKOA 5ABDE 2ZKHL 1E6SM 2X4TB 2EEDA 2YWZA 1XCTA 1E5NA 4WGVB 5GS3A 3Q0HA 5K9QI 2XN9E 4PUBL 2AXJA 1QBLL 4Z2JA 1ZT1A 1GAFH 2DI7A 1PYWA 5D72L 2GYSA 4BK4A 1FZJA 5E8NA 1J10A 3LRSB 4OTXH 3BH8B 1H3VA 4C83A 1CGSL 1NDGB 3G6JF 1YEEL 1JRHH 3ZJ6A 1HHJA 3CX5J 2YL9A 4R27A 5J9PB 1MFDL 3LPGA 4Z0XA 1KIRB 5DR5L 1X5KA 5CJQH 4PJGA 1UB6A 5LWYH 3QG7L 3DARA 2PCPA 2EXWD 2VRKA 1JNNH 3B83A 2WIMA 1MF2H 3GI8H 5EOQH 5JR1H 1JNHA 3P0GB 1IAOA 4XUYA 5KVGH 3WUBA 4HKBB 1BVZA 3P30H 4Y4KB 3ULSB 4RISH 3AXHA 1MY5A 2YN3A 2GI7A 5DVNA 5EU3A 3SY0B 3UAJD 2LU4A 1CFQA 5IJVB 2VXSL 2IAMA 3JWDL 4Z7WE 1LWHA 3EJSA 4XVTH 4JL1A 5CZVH 1IM9D 1P6FA 5GQBA 1FH7A 4M6AA 5FB8B 4Q7NA 1C8XA 1NBZB 2EE2A 5CHNA 5C07B 3F7VB 2AMGA 3DYMA 2XKSA 2BV9A 2HT4C 2AI0L 4PJAE 2X4UB 1T21A 2VDQH 3IJ8A 1JPGA 4PJXE 1EBAA 5L9DL 1FP9A 3MZTA 2JB5H 2F7QA 4AG4H 5DFWH 3I2CL 1FJ1B 1OTUC 3SGEI 1K3ZA 3NOIA 5CLWA 3KS0J 4AYSA 4FZEH 4NP4L 3ZKXB 5I1LA 1WZ1L 2X4PA 4MNGA 3GI9H 5KJRL 6FABL 3QUKA 3MFGB 4A2MA 2ZX7A 3O8XB 3QCUL 5DMIL 3AIUA 3T4AB 2FHFA 1KPUA 1ORQA 3ARFB 1BVNP 5BYWA 2VLJA 3NZHH 3QG6B 3RDTC 1H0IA 5FIPA 1P2CB 3QNXA 5BS0A 2EXYD 1B3XA 3BMWA 2GT9A 4JO4L 4ACZB 1JGEA 1UA6L 3CSGA 1IGCH 4AMKH 3WD5L 4AC1X 3DIFB 3D25B 4FNLL 5I2IB 5D8WA 4KQ3H 4X7EC 1FAIH 1YY9C 3TTOA 4H88H 1AQDB 4NGHL 2OMBA 2VLMD 3FMGL 5CUSH 5C0JB 3VWJA 1YQ2A 2D2OA 2A83B 4PJBF 4DKEL 1MOEA 3KJ4B 3V5DA 2Y6SC 2UZIH 3W82A 1LG1A 4LYRA 4JM2B 3PN8A 3GSNB 5A8MA 4R96A 2OS7A 2BVQB 4PRHD 1X4ZA 1QVOA 3HPLB 3PHAA 5D1QB 3E1F1 3VXSD 4HHAB 1WFTA 4FFVD 1DQQB 1MCDA 1P1ZB 2PYEA 4GQ9H 3LQZA 4JFHE 4JHBA 4LRIA 4M7ZB 4URTB 5JORB 5TQ0H 2IPTH 2NY6B 4Y19A 3VFMB 4DTGH 1EEYA 4PEEA 2YD4A 2HTLC 4X6FA 2J7CA 4X4YA 1OTUD 1BOYA 1E6OL 1UR1A 5ID0A 1NANH 4O9HH 4PJDE 1D5XB 1T7YA 3GNMH 3HC0B 1NFDE 3LD8B 3KVQA 4X5WA 4LX4A 4YHGA 4R4FL 2IADB 3QIBD 2HT4D 1LO4L 3EW3B 1BWWA 3VMNA 4JM4L 1JYXA 5AZEL 4CDHA 1FORL 4YZFF 2E9JA 3LHPH 3K46A 4GS7C 3UTPE 1T03H 1J1PH 1WITA 4LKXA 3F12B 1C08A 1NGPH 3HAEA 5GRVL 3WV0A 4WDIA 1JWSB 4X9IA 3AS1A 5GRJL 3WL9B 1A6AA 3CCHB 2PYEE 1JV5A 2OL3H 4GKNB 4OV6F 4ATDA 3QDHA 3SUTA 4XXDB 4UNTA 4X6EB 1WIOA 2EECA 4MAYD 1Y6MR 4H1LA 5B8CC 4P7RA 2CBIA 2HLFD 3SKUD 4KK8C 2D3LA 1BBDH 1JN6A 4XP4H 1E3ZA 4NZUH 3NAAL 3A21A 2CBJA 3DHUA 2YZ8A 4OIIL 1EAPA 2CLZB 3DI2B 3VFWA 1KLGA 1QI4A 4ZTPL 5T1DL 2NY4C 2NW2B 1K5NA 2ARJQ 2JIXD 3VXSE 5FUZH 1QNOA 3LZFH 2BC4B 2ZP0T 1OTSC 2BZDA 3R4DA 3BD4A 3TBWB 1NARA 2V2WA 4G7YH 1CG9B 4YBLB 2DBJA 3RGVB 4RMUA 4FN0A 4I77L 2JJTC 2Q20A 5BVJA 5J11C 4L1HA 1XCQB 2OSYA 5BXFA 2P5WE 4POYA 3IDIA 3STLA 2FZ3A 3BSZL 1LO2H 1RI8A 1YYML 5IFJB 4YFLF 3H9HB 1M7DA 1Q94B 1W91A 2UWEA 2DJ4A 3U0TA 5D7IB 5MHSD 2HKFH 5TDOA 2Q7YB 1FNAA 3MOBH 2P45B 2ZCHH 3N15A 5I1CL 3GSQA 1PBYA 1YN7A 2VWEC 3VXSA 4HC1A 4UILH 2QR0A 5C71A 5E08L 1C91A 3WUFA 1PEZA 3TO4C 3ZTJH 3E6HB 5KS9F 4JZOA 2WYSA 2AERT 1LO3L 5MI0B 4ODWA 2CLVB 3B9KC 1WEJL 2UYLB 2IALB 1NCCH 4P2QE 1HILA 3QQ4A 4N0YH 3S98A 1NGZB 5JW4Q 1RUKL 1LO2L 5JDSB 4GAJL 2EDYA 2AJXL 1J05B 1HN1A 5KSAB 2P8MA 2Y07L 5JLZB 3UPRB 3IFOA 5F21B 4HLZG 4X9GA 2IXUA 4IOIB 2Q3AA 4OCNC 5L88H 3D0VB 1HXYA 3QR2A 3H9SD 1R3KA 3U6RB 2RR3A 3TBWA 2P1YA 4APQA 3RX5A 1NCAH 2FJHB 3MS8A 4HCRH 1F4XL 3LKSB 4LCCA 4LVNB 4PMYA 3WF3A 5JHDB 1ES0A 3IS0X 3QUXB 1UWEH 5I5RA 3RA7L 15C8L 1JG9A 1J86A 3DYPA 5DC4B 3OLDA 4G6FD 4LASH 1JF6A 3WMSA 2OW7A 1I1CA 1RH9A 3MRRA 3OKKA 1JWSA 5JQHC 3ULUF 1HEZA 3SE9H 4PLNC 4WEBH 1A6PA 2AAAA 2XQBL 1KCUL 4MNHA 4UTAH 5B8CB 1JAEA 4OOUA 1A7QL 3PG2A 3BRGC 5BZDA 5D5MB 4HPHA 1OD8A 2X4RB 4N0CC 3AIEA 1QLRB 3H8NA 2B0SL 3T09A 4YHOH 3DX1A 1B6UA 5BZWA 2X0HA 2MNUA 5CPTA 1RSFA 3GB7B 4LARL 4EQ2A 4GS7B 4DZBB 3ZQ9A 1INQA 3ZJ7A 4JFFD 3LS5L 2ENSA 3MLRH 1UKSA 5D1ZD 3CZSA 2CDFA 4ZUTB 2BY1A 5BV7H 5KG9A 2E7MA 5BQ7B 3NN8A 4IOIA 2ORBL 2WAGA 3U0WH 1ODUA 1UR0A 2AOSA 3O3EB 3V52L 1EIBA 4Z7UE 5E4EC 1Z9MA 2OR9L 1MFCH 2A0LC 3VXUB 5AYIA 4M24A 3FFDB 4XNUH 1MI5E 2ICWI 1R33A 3ZJKA 1NLDH 1D6VH 3X13A 3GXNA 3HPLA 2WKGA 1Q0XH 4I18B 3K2UH 3QXTA 1A9BB 1U8QB 2WVVA 4JKPH 1MQQA 1P1ZA 5LYRA 1WC7A 1FGNH 1JXJA 5D2NA 3U79A 1SY6H 2BMKB 2CRIA 3N1PC 4LEXH 1T6WA 3KPMA 5D1QC 3SJVA 3N50A 1I3UA 4FFZH 4OZHF 3BPLC 4GI9A 3B6SB 4IRJA 1CIUA 3KJ4C 3QFJA 1F58L 4PJCE 4HQQL 2V2XA 3W39B 2GJRA 1T5WB 4HWZA 2WSPA 1XF1A 3NIFE 4BA8A 5E2WL 1XF3B 4G8IA 4XC1L 3H9HA 2BNQA 3QR3A 3QO1B 2D4DA 3PZUA 1CICA 3V6BR 5FF6A 3DIFA 2WZHA 2G2RA 2A3EA 4PV8B 2FGLA 1MAJA 4M48H 4MAYB 3RVXD 2DMBA 4KTYA 4RFEA 4C4KO 3NACL 5EU6B 3MRMB 4PBVC 4YK4B 5BRQA 4UT7H 1ZB5A 4JY4B 5E8PA 1J5OL 3ZOAA 1UD5A 4J4PA 2BSSA 4YHKH 2JCCB 1ZBVA 4UU9A 3HC3L 4RNRB 3JV4A 1PBGA 5D1ZA 1CZ8H 3DX9A 4L1DA 3AS3A 4K94C 2IF7A 4YDIH 3WY3A 2O61A 2O5XH 3L3GA 4ZS6C 3WSUA 1WTGT 1JPGB 3SE4C 1XD0A 2BDNL 3S7GA 4ENEC 1YJDL 1MJUL 1E56A 4HKBA 4B15A 2GFTA 2WHMA 2ZUWA 5M94B 4UQ2A 3ZMRA 4ODHH 4XVTL 4KMTL 3AAZB 3CCHA 4GKNA 4HWBL 1OQXA 3CFBA 4EOWL 4M8UA 4WTWA 2GITB 3SDDD 1E4IA 3KYKL 1JNLL 4MCZB 3SE9L 1DBBH 3GSNL 3OLEA 3D52A 4Z7OE 1U8KA 4IS6A 1ZEAH 4PJAA 5CZKA 3SEPA 4PJGB 4AIZA 5GGUB 5IW6B 4OD3H 4PJEE 2KUTA 1DUYB 2CBUA 4I48A 3BRDA 1C1EH 1VEOA 2MQCA 2XNAA 4GG6B 3WD4A 3UEZA 2AEQH 4X4XB 4G9FA 5EDXA 1FVDB 3GK8H 5LBSL 2EBNA 3TF7C 2WMFA 3TV3H 2XSAA 2IUZA 5JZ7C 5J89A 5JIPA 4AWEA 4YXHH 4PMNA 5FDWB 2VC2H 3MLWL 5D7SH 2C4XA 4HBCL 3SPVA 5FD0A 3X12A 4GXVL 3VRIA 2VERN 1TMCB 2WMKA 5E09A 5EIQA 1FVDA 3WYRA 3BKCL 4V27A 3PWPB 1OPGH 1TCRA 3I75B 3PWNB 4LGRB 5EZJB 1G01A 2MKLC 1WEJH 1FHLA 4PR5A 1BM3H 1T66C 1N7ML 2VI0A 3UJTH 1RURL 5JIWA 3WO3B 3S34H 2GK1A 2B2XL 4IS6B 4R4ND 3QHMA 1XZ0A 4XNYH 3D48R 4FZ8H 4WUUB 3OAUH 2A74A 5D93C 3DETD 5CD5D