6CGTA

Hoxa complex of cyclodextrin glycosyltransferase mutant
Total Genus 221
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
221
sequence length
684
structure length
684
Chain Sequence
DPDTAVTNKQSFSTDVIYQVFTDRFLDGNPSNNPTGAAYDATCSNLKLYCGGDWQGLINKINDNYFSDLGVTALWISQPVENIFATINYSGVTNTAYHGYWARDFKKTNPYFGTMADFQNLITTAHAKGIKIVIDFAPNHTSPAMETDTSFAENGRLYDNGTLVGGYTNDTNGYFHHNGGSDFSSLENGIYKNTYDLADFNHNNATIDKYFKDAIKLWLDMGVDGIRVDAVKHMPLGWQKSWMSSIYAHKPVFTFGEWFLGSAASDADNTDFANKSGMSLLDFRFNSAVRNVFRDNTSNMYALDSMINSTATDYNQVNDQVTFIDNHDMDRFKTSAVNNRRLEQALAFTLTSRGVPAIYYGTEQYLTGNGDPDNRAKMPSFSKSTTAFNVISKLAPLRKSNPAIAYGSTQQRWINNDVYVYERKFGKSVAVVAVNRNLSTSASITGLSTSLPTGSYTDVLGGVLNGNNITSTNGSINNFTLAAGATAVWQYTTAETTPTIGHVGPVMGKPGNVVTIDGRGFGSTKGTVYFGTTAVTGAAITSWEDTQIKVTIPSVAAGNYAVKVAASGVNSNAYNNFTILTGDQVTVRFVVNNASTTLGQNLYLTGNVAELGNWSTGSTAIGPAFNQVIHQYPTWYYDVSVPAGKQLEFKFFKKNGSTITWESGSNHTFTTPASGTATVTVNWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Glycosyltransferase
molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
publication title Substrate binding to a cyclodextrin glycosyltransferase and mutations increasing the gamma-cyclodextrin production.
pubmed doi rcsb
source organism Bacillus circulans
total genus 221
structure length 684
sequence length 684
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1998-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 6cgtA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 6cgtA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 6cgtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 6cgtA01
1DE4B 1R3HA 1N64L 2E27H 3OKNA 3O6FA 3PL6A 3GSOB 1BLNA 4R7NA 1ISWA 5DD6B 1R0AL 2CH8A 1NANI 3QQ9C 4I48B 1A3RL 5C07B 5CSUA 3L95A 3GI9H 4NRZA 4ZTOH 1FZOB 1JGUL 4PRIE 5C3TA 4KRNA 1U8KB 1X5KA 1UA7A 1JGLL 4F37F 4YNYA 1WAAA 3KPMB 3F7QA 3CIQA 3KPRA 1RFDH 5DMKA 4RGMB 1XGPB 2FH8A 3O3EA 4ZUSB 3L3IA 1BG9A 4ZS6D 3EDEA 3WDPP 5LVEA 2J88L 3P77B 1W9BM 3HA0A 4HA4A 4L9DA 4ZPVB 2AAAA 3SE4A 1UQYA 2CUIA 2UZXB 4FLOA 3WLBA 5DMGC 5BW7A 3NPZB 4R4ND 5H94A 1DQLL 4MAYA 2NCMA 4OF8A 2RCSH 3QNXA 2EEBA 1JGEB 1ZANL 1ZSDA 3VUPA 5CJQH 4Q22A 4CD6A 2VURA 2GUYA 2K1MA 1WT5C 3QCVH 5FYKE 5E8EB 1BJ1H 1CQKA 4PREA 1INEL 3FQTA 4RGNC 2BVTA 2XFYA 2XNAB 1LEGA 3HNVL 4W4OA 3GHEH 4PB9L 4XP5L 2GK0A 4ZUVA 4WUKH 5BZWA 3L1OL 1I4FB 1PSKH 1I3VA 5DEFA 5J6GB 4HGWA 3MRBA 2VQUA 3H55A 2X10A 2VZOA 3QUZB 1BJMA 5HHMB 1P2CB 1OAUL 4WHDA 4BA8A 3HC4L 3RTQC 1QFWM 1T2QH 5IJVB 2GJXA 4N68A 5FCSH 2D03L 5TQ2H 4KTDH 2OJEA 2X40A 3A67L 5CSZB 3GJFH 1C5CL 4OD3H 4ZUUA 1C5BH 3ARSA 4FG6D 2WNWA 2A77H 3L3GB 3EYSL 4KC3B 2XN9D 4X4YA 4LPWA 1ZLVK 2VXUL 3VFSB 4UT9L 4GQ9L 4LASH 4Y5VC 1PPIA 1JNHB 1RJZA 4AM0B 4GXVH 2IGTA 3JWOL 2Z31C 4P59L 4Z0XB 1J0ZA 2HMIC 3BD5A 3H8NA 2DSKA 3FT3B 4MPKA 2AGJH 2IAND 4BKLA 4XNYH 4JN1H 5BV7H 1S9VB 3KPQA 3OF6D 2ZXBA 1MNUL 5DFVD 1NUNB 1FQ9C 1KPRB 1UR9A 2DM3A 4JZJC 2ZIDA 5BRQA 3WY4A 4QHLA 5J11B 2I24N 4KQ4H 4H0GA 2W0FB 3LKOA 5HHNB 1GZQA 2Y4SA 1HJSA 1JI1A 4HJJL 5I8OL 1T83A 4RFOH 3P9LB 4K9EL 5KAQG 2P8LA 4ETQA 1U30A 2ADGB 1OLZA 4P46B 1AGEA 2XKNA 1HNYA 4B5EA 3F5KA 4R3SA 4HW6A 5E6IB 4JM2A 1E0XA 1SJEB 5SV4A 4E41B 1DQJA 1JRHI 1B4JH 4WI4A 1ACYH 4W87A 1XIWA 3HLAB 3VJ6A 2YL9A 1XSIA 1V6XA 4Y1AE 4P2OC 4ZTOL 5ICZA 5EU6B 4Z7UE 4BZ2H 2ESVE 5AZEH 1FNFA 1NCAH 5BVPH 2D4DA 4M7ZC 5IIEA 3MACL 1KNOB 3D85A 3CZSA 1UA6H 4XC1H 4XNQA 2VT0A 4JHAH 4DVBA 2ZZUT 2R1WB 2NR6C 1IAII 3CZKA 1IC1A 4E9LA 4LQFL 3SE3C 3SDCB 3PQYA 5HHOE 4M1RA 1MHEA 3ARWA 4RAHA 1NKRA 4JEGB 5D7LD 1CDCA 3RVXC 3QULA 5BROA 2X6MA 4P7RA 3GKZA 3GSXB 2Y8KA 2VQ1B 3CC1A 1JPSL 2ZCHH 2VDLL 3FQWA 4KDTC 3U7YH 1EAPA 3CFKB 4GI9A 4XHJC 2PKDA 3WF4A 3BESR 5CJQL 3F7RA 4JRYD 4PBWD 5ILTL 1WWWX 3CVIL 1E6JH 1MIEH 3T3PF 2R9HD 1Y6NR 4FABH 4Y19B 3UPRA 3SPVB 4PMOA 5FL0A 4UTFA 2GJZB 2GUOB 3GHEL 3OPZL 1J9CT 4DZBB 5DQDH 1PSKL 4PRHE 4AC1X 1GOQA 3L7EB 3QIUA 2JF1A 4JY4B 3MFGB 4YFDB 4C56E 2FJHB 2O5YH 4BK5A 5EC2B 2WHJA 3RPIB 2YFNA 2PYEA 3MXVL 5D93C 1E1FA 1FNGA 4R2GB 1ZHBA 4YJZL 4NNYB 4HWNA 2D24A 4KTDL 1AC0A 4HF5H 3WXVH 5HI4C 3MRIB 4ZXBA 4MD0A 1C5BL 4XBPA 3WJJC 3GBDA 3CDGB 2X4QA 3MPCA 2YDRA 1GH7A 2W65A 4S1RH 4ODUB 4U6VL 3AHXA 1UXSA 3HG1B 5DD3L 1W0VA 2NY4D 3TZVA 1RUMH 1KF9B 2R0LH 1IKNC 3LKQA 2DKUA 3AHTA 2VLKB 4GAYB 4YWGH 3IDGA 4GXVL 4X83A 1M1SA 3MRQB 3PZOA 3IJ7A 4LSQL 1ND0A 3IKKA 4PPTA 4GRMB 3VXMB 2W0PA 3WQWA 3ARFA 4XNYL 4JN1L 5BV7L 1VSCA 4P7OA 3M46A 5JXEC 3HPLB 4DN3H 3ZTJG 5DI8B 1Z9LA 5HY9B 4LVEA 1FH8A 1MEXH 2GTZB 4NM4L 5D9PA 2LU3A 4H1LB 4OLZH 1T21A 3T8XA 5D8WA 4PRPE 3FQNB 5I77A 1UWXH 3F5LA 2FEDD 2YPLA 5CJ8A 4KQ4L 3KL0A 3WH8A 4U1IB 3OJMB 1AXSB 1GGUA 1IM9D 2VE6B 3I50L 3RAJH 1MPAH 2BX5A 4Q9BA 1IC7H 3V0WL 1C16B 1BYCA 1BJ1J 4KVCL 5HNNA 2Z93A 4Y8DC 5D7IF 3G08B 4V28A 4IDJH 5JQHC 4KK5C 2ZX5A 4WGVB 5HSFA 5CD5C 1AO7A 1B4JL 3HNSL 1QI4A 1ACYL 4N1EA 2J2ZA 3K3QA 4R97C 4LHQB 3O2DA 2EDBA 1Q72L 4XMLL 1DWFM 1AR1C 2MTPA 1P53A 3NTCH 5FGRA 1HJVA 1LO0L 4G7YL 2Y9RT 5AZEL 1S7XA 2MOVA 4KZDH 4A6YH 1NCAL 3IAPA 5IVOA 4YE4H 5DEZA 4D3CL 4XPGL 1CNVA 4XC1L 2A74B 5K33A 1CGUA 1QFWH 3GSOA 2Q6WA 5DD6A 5EUOE 4AZCB 3QYCA 3ILPA 4IRJB 5F1NA 1CGWA 4I48A 2VZTA 4M6AA 3QNZA 3QUMH 5FM8A 1JNNH 1G7HA 4AXNA 1INQB 4U1KB 5C6TH 5DMGD 2X0HA 4XVUD 3RNKB 1MRFL 1FVCA 5HBBA 3L3DB 4OKVB 2APWA 1U8KA 4LSVL 3C09C 4DKEH 3RUGA 5T1MA 1DLFH 2ZCHL 1D5XB 1TJHH 3U7YL 5J4MA 5CD3A 1K2DB 4M8QA 4F58H 2X2HA 3O9NA 5J57B 3QO1B 3FHQA 1E6JL 5DZLA 5A2FA 1XGPA 2BS9A 2FATH 4FABL 4HZ6A 4LQ1A 3S34L 3WEOA 3MLTB 4P3DB 3ZE0E 1F5WA 4Q0XH 4WJ5A 2APBA 3RVVD 4ZPVA 4EANA 4MJIE 3HPJA 2EZ0D 4I3SL 4OV5B 5DQDL 1A6VL 3GMLB 4AZ7A 1ITBB 3GB7B 1OLLA 2IUZA 4K7PX 1AR2A 1VENA 1LMKA 5ISZB 1KXQA 2VWEC 1DBAH 2FL5A 1R5WB 4OV6F 2DQFA 3WNNA 5BMFH 1QSZA 4KKBD 4Z2HA 4HF5L 3WXVL 3CZGA 2XNAA 3ISWA 5C0RH 1R7AA 1EFXB 1I4FA 2H26B 2C1PA 2YKLL 4S1RL 4AD4A 1JIBA 2VZSA 3QUZA 1RUML 4GBXC 1K8IA 2Z31D 3VXRD 3KPPA 3VX1A 1P2CA 4WRLA 4G9FE 5IVXB 5F7LB 2BDNH 2YXMA 2KH2B 4R27A 1B0GB 1QBML 1FCGA 2B7DT 3I6LE 4YHYC 5LGJB 1QPXA 3FZUC 3AS0A 2BERA 3OJDB 5DK0B 2DQGH 2R4SH 2XTKA 3L3GA 1UB6A 2DLFL 4K71C 1O7AA 4DWSC 1FSKC 3IETB 4M4PA 5A43C 2FYVA 1KXVC 4QOKD 4CCDA 4FMKA 2FE0A 1J1OL 3VFSA 4OLZL 1IAMA 1JNHA 2ZSWB 4AM0A 4E4PA 4UDTB 4Z0XA 3QEUA 1IE5A 3H9HB 3TCXA 1EBAA 5JPMB 5GGTH 4OIFA 3OLDA 1A7BA 3FT3A 1H41A 3MV01 3V7AE 1IC7L 5CBEB 2C7UA 4YZFE 2VCAA 1PG7W 2YPVH 3O3AA 4HZLB 5DJCA 2AV1A 5D8JL 1YUHB 1S9VA 3HMXL 1YPZA 2B2XH 3QCUH 3N9GL 4JFSA 1P9MA 4IDJL 1QNQA 2Y24A 1YDPA 2BY0A 1QI5A 1C91A 2DLGA 5IFJA 5ID0A 1QFPA 3QQ4B 3WFBH 4KK9C 2WUBH 2AQ3A 5HHNA 3UJJH 4PY8J 1A6UL 5IM7B 4F9PA 5IFHL 5EOCH 1G7IA 1HJQA 4KZDL 5HI3C 2EH8L 4YE4L 2X2IA 4ZO8A 4M8VA 2NR6D 2IPUK 4P46A 5JZ7D 2P43B 4CU7A 4HSQA 4HZAA 4OTXH 2I5YH 2Q20A 3VI3F 4AIZB 4W70A 4WU7B 1B3YA 1IGJA 4E41A 4AEIL 1QLEH 3T1WA 4MXVE 2OTPA 1A21A 3JSSA 3HLAA 4TSAH 3CH8A 3GBNL 5C6TL 4UU9B 1UJ3C 3VGDA 5EU6A 1FRGL 4JZ5A 3LRHA 3CLFL 1P4BH 4AT6A 1KNOA 4MA7H 1PEWA 3EDJA 3VFGL 3WN5B 3VPLA 3HG4A 5K9OB 5F7EH 2UWEE 2VXTH 3KDMB 2IAMC 5FO8A 5AG8A 2NW0A 1IZJA 1RZIB 5HDQH 2Q8AH 4IRZL 4HMEA 3GSXA 5ANME 3INUH 3HZKA 2W9DH 1MCOL 3SDYL 4UQ3B 1T4KA 3QIBC 4UFHA 1Q94A 2GFBB 2C3VA 5LWYL 5FM5M 3LSOB 1MCDA 4PGEB 2WZIA 4XWGH 3RDKA 4KRPD 4X7EC 3ALGA 1LEKA 4NN6C 3VXOB 2V7NB 5HI4D 4WW2B 1QSFB 3QWOA 5FYLD 3BP7B 5GNXA 2HG5B 4Y19A 1TVPA 1U2CA 3ZJ7A 3KYMA 3R4DA 3HZYB 3NDYA 2YMXH 3BKYH 1QVBA 3LS4L 3O8XC 4GRWE 4MXQC 1KGCE 2GUOA 4TUKH 1MOEA 5EPMB 1HXMB 4DZBA 2DQEL 1J01A 4LMQI 4JY4A 1S7UA 3KJ6H 2FECL 3VI4E 5GRYA 2AV7A 2HFFA 4M3JA 2A9NH 1U6AH 2OLHA 3KS0H 3RPIA 4PCTA 5AG9A 5AWNL 2NY5H 5BV7B 4U3AA 4KI5F 3BPNC 1J8HB 1IAIM 2LTQB 2HFEB 2DQGL 3CDGA 1BAGA 2R4SL 2I27N 1NSNL 3QEHB 4ODUA 4YH6A 4UUJB 3HG1A 3VDHA 3SDXE 3JUZA 5FGBA 1ZEAH 5IG7B 4HBCH 4U5KA 1TZIA 1LD9B 4KI5D 5D72L 7CGTA 3NCJL 2EE6A 4ZFGL 3NIDF 2VLKA 3MBEB 1GL4B 1KGUA 3MRQA 5DJ0B 3E2HB 2HTLD 1DWAM 2R2BB 1MJ8L 5LXGH 4F7PB 1KB5L 3BUYA 4NO2B 3VXMA 4GRMA 5K9KA 3GBEA 4ZTPL 4YHMH 3WFDH 1YEGH 3HPLA 5HY9A 1XHGA 5DI8A 5HYSB 3QRFM 1F11A 3SDAB 3MCKB 1B4RA 1DBJL 3RZWA 4OZHE 2A9MH 3ULVE 3HZMB 4F3FB 4GUPA 4J7RA 5EZLB 2WUBL 2VE6A 4PJIB 3UJJL 3V52L 1QW8A 3TNNA 2XG9A 1C16A 4JM4H 3CX2A 3BP5B 4LEXL 3UCRA 1U8LA 1KN4H 1P1ZB 3LQAH 2HFTA 1BYBA 2YL5A 3DX1A 4OTXL 4YDIH 3ARGC 3QFJE 4R96B 3S96B 4J3XA 1PX3A 3IJHB 3MNZA 2ARJB 2FH6A 4HIHA 3HUJB 1JPGB 5HGBB 4TSAL 4FNUA 3C60C 5DEGA 4MB1A 1CD9B 3ECQA 3QPQC 1RJLB 4NZUL 1FNHA 2J8OA 2BVDA 5F96L 1P4BL 2WHMA 3QXAB 3KWXA 2IG2H 1I8LC 3A4WA 2Q86A 1S7WB 4HWEL 4UIMB 4LCWA 1U3HB 3RP1A 2A74A 1QVOB 4LLUA 4OM1H 3AY4A 1PX4A 5F7EL 5ACMA 1VACA 4RIRB 5MENB 4IRJA 1NWUA 4URIA 4XB3A 2H1PH 4GW4B 5SWSB 3EBVA 1V6YA 1INQA 2P24B 4U1KA 1FZJA 1R85A 3ALXA 5FGSA 2Q8AL 5CINH 3RZCC 3L3DA 4L4JA 4HH9A 3INUL 5CEXA 4MS8D 5C08B 2ZUNA 2LE9A 5I1JH 2DSZA 1ZBCA 1WV7T 4JR9H 5JOPE 3RPMA 3QJHA 1E3XA 1DDHA 1K2DA 4XWGL 5IW3A 1CF8L 4Y4FC 4XX1G 4PJHF 2HISA 1E4WH 1YEHL 1J0KA 2WVSA 3MBXH 2OWCA 5LA2A 2YMXL 4P2QD 5C6WH 3I02B 4CN4A 5D9MA 3P73B 4OV5A 4GH7B 3OX8B 1QUNA 4RE3A 1ZHLA 3NA9H 4IOFD 4O2CB 1NCNA 5ABFA 3OR7B 4I0PC 2G41A 4RGNB 5J1SC 4WCYH 5EOCJ 3M45A 4J27A 1U6AL 3IF1B 3AXHA 2AJXL 4WHYG 1YEEL 3TH2T 4KHTL 1R5WA 4Q2ZA 3QOKA 1A9EB 3NCYS 5KSBF 3U9PL 5C9JA 2VDRL 1PQZB 4HIEB 3ZKSD 4JAWA 5AD0A 3L4VA 3BDYH 3PE9A 3AS2A 5E5UB 4FHBD 4W89A 1TITA 1PKQB 1EFXA 5K9JH 3RBGA 2H26A 1LO4H 4YPJA 5JIHA 1OWWA 1E28B 1KIRA 1EZVX 2V2TB 1M05B 4D0DB 3T65B 1XCTB 3BW9A 2E7CA 3DIFA 2E7LA 1KBGH 5C0AD 3VTRA 1A4JA 5A2LH 5LGJA 4JKWA 3G5ZB 4JLRA 1QI3A 3G5VA 4PIRF 3QUXB 1F3JA 4HPOL 5M95B 2RBLA 5DK0A 2CLZA 4Z95L 3T3ME 3S98A 1IQWL 4P8XA 3WFDL 4LKCB 1N2RA 4U0RC 3ZQ9A 1R34A 1UEMA 3IETA 5ESQB 1NLDH 3RILA 1UWEH 3TC9A 3VG0H 4XCFL 2YD8A 4OUUA 3AICA 2HJKB 2WUCH 3SCWA 4ONGH 3DURB 3H3PL 1XCQB 3H9HA 5JPMA 5B8CB 4JZJB 5MHSD 2JK5A 5A8MA 4KWUA 1U58B 4MQSB 1WFTA 2CQVA 4TNWK 1MRCH 2XN9A 2LV4A 4KJPC 5CBEA 1O7DC 5L8LB 1K9FA 4O02H 3OR6A 4HZLA 4O5LL 2PBOA 2NYYC 4KROC 1YUHA 5E5RB 1C08B 3QA3B 3LQAL 4L1HA 1YNKH 5DC4B 2ZWYA 4OZIE 5B3NA 2CIPA 2GTWB 5L7XH 4OLYL 3WL0A 3CX5K 3WXWH 3L9RB 5HD8D 4S1SL 4PYHA 3T1FB 1FH5H 4ZAKC 3CZNA 1TR1A 1XH3B 2R15A 1XF5B 3OLEA 3KLDA 4ATLA 5D2NA 4K7PH 3GKWH 4K2UL 4XNXH 1LDSA 3QHMA 4NFDA 2OSWA 1S9XB 3BN9D 3G9VA 4P2OB 3UTZA 1R3LB 4GIAA 3ZE2E 2IAMD 3V4PL 4Q9CA 3OQ3B 2R0WH 2QSCH 4V1DB 3TWCH 5C07D 4AIZA 5HTSA 4M7ZB 3BUDA 1IAIH 2B4CH 1IGFH 3N0PB 2H1PL 4L29B 4ELKB 1W8NA 4U1NB 4M7LH 2OYKA 1HHHB 5JQ6L 3RHWK 4JR9L 2QSTA 2EDYA 3KLLA 3WN5A 2D9QB 5TDPB 4WY7H 4DWHA 1MY7A 3KDMA 1E4WL 2V3GA 1UUQA 4NC1E 1WITA 3MBXL 1H0GA 1CFQB 1KFAH 4WUUB 1XCXA 4KH2A 2QF8A 5BJTB 4U1HB 2CRZA 3H7LA 5TE6L 1QBLH 4NRXB 1H3PL 3NA9L 4DO5A 5CMAA 5GSVB 1N0XH 3LEXA 4CVWA 4TNWF 4WFEE 4OLVH 4BQ9A 3BZEB 1MCFA 1CENA 2V7NA 1QSFA 3WD5L 3BP7A 5KG9B 1RZ8B 5CEZE 3BDYL 1BREA 2A6IA 1FP5A 4N0UE 5D93B 2B5IC 5EPMA 5C0JB 3RKPA 5GIRB 1N8ZB 4EI5C 2FX9H 4LLVB 1OTUC 4G6AC 1KB5B 1TDQA 4Q58C 4HP5A 2NQCA 4LL9A 5F6IC 2YD1A 4XPFL 1DQQB 1U36A 4JFXA 3LD8C 4GS7B 1CU4H 5B4MD 1J12A 1FVDB 5CZXC 3QG6B 1B30A 1FNEB 3LZFH 4Q6YA 5KS9A 1KIQB 5LCVH 3FXYA 3MROB 4JDVB 3QEHA 5ABDE 1CT8B 4UOW0 1UWEL 5I66B 4XVTL 1LD9A 5I19H 3PDDA 4FTVD 3RRQA 1RAMA 2D20A 3UZVB 3MBEA 3VIKA 4QRPB 1EEUA 2R2BA 3RHWF 4F7PA 2E8ZA 2I60H 3G6JB 4HU8A 3L4UA 4M5ZH 4NO2A 1WE5A 4KMTL 5EOQL 3WNOA 5JORA 3NGBC 3QH3A 1G0YR 3DUHA 3R0NA 3ARGD 4ELMB 1YNKL 3MNWA 2ZUYA 1GIGL 3Q5YA 1MFUA 2DT3A 3MCKA 1GGCL 4XNZC 2QLVB 3HZ3A 2VRJA 2H9GA 3MOBH 3T09A 5C09D 4F3FA 2BP3A 5EZLA 2GCYA 3EYUL 3TVMC 5HPOA 3BMVA 4MZ2A 5D6DA 5C3LD 5IQ7L 4C7GA 1OGBA 1GQKA 1IEBA 5IB4B 3OKOA 2XXMB 3GKWL 4OCRH 4XNXL 1Y18B 4OZFH 4NF7A 4R97B 2XZCH 3KE0A 2BHUA 2QSVA 1A1MA 1UXWB 5IMMB 5A2IH 3NSNA 1FG2A 4NWUH 3TWCL 1HXJA 1TXKA 4R96A 3S96A 2QMKA 3IJHA 1YYMH 2B4CL 3EJZD 1IGFL 2DDQH 1YECH 5T1DH 1KJ2L 2ARJA 4D0CB 2OW7A 3U0TB 5HGBA 4ISVB 2VYRE 3RI5K 5F7DA 4MNQB 4GKNB 4IMLB 3N9KA 3H3KA 4ZE4A 2DQIL 3QXAA 3V6FB 3RO8A 3VKKA 1X5GA 3AFBA 4Y8AA 3IJYB 1OP3H 1DZBA 3O45A 3CK0H 4B16A 3K4DA 4OBSA 4M5YH 5KVFH 5AUMA 2A3EA 3MZTA 5I1KL 4I2XB 1IGCH 2QADC 1Q8MA 2QR0B 3C09B 4PRNA 4WY7L 1ODZA 4RIRA 3LN9A 5MENA 3BGMB 4NJ9H 3VIJA 4GW4A 5SWSA 2C4XA 4ZOAA 2P24A 5D1ZC 4JPKH 1Z9OA 1SJHA 3DYPA 4L4TE 3QUYC 3A0OA 5C7XH 3U5UA 2EH7H 5GS0C 3MSGA 1MLCB 2Q76B 4PGCA 5CJXA 3VU2A 4PJ5B 2K7PA 1XEDA 4M6NL 1N0XL 4NN7C 1U95B 3OIHA 4OBRA 4OLVL 5FV1L 1TJGL 2OLDA 4N0FB 1HKIA 3MV8D 3LPOA 3TYFB 5GRUH 2X4NA 3C5SB 1XGRB 2V2XA 3VDBA 3QRGL 1QPPA 3U6RA 4L4VE 5IHSA 2P42B 4XMPH 1E6PA 4CMHB 4LFHD 2EDJA 4G42B 1WT5A 4D1JA 2H6PB 4HK3N 1K4DA 3OR7A 5D9SB 2FX9L 3TBYA 2E8YA 3MV9B 1KOAA 4LKXB 3CU1A 4ZFZB 4YHKL 1W2PA 5CZVH 2CKBH 1M7IA 4L3AA 4BFEA 3PHSA 4M7LT 4KK8D 1ZK9A 4GBXB 5FYKH 1BBJB 4W6YB 1A9EA 2X1XR 3T0AA 1KJ3H 3ZE1E 4HIEA 3RTQA 3WBDA 2XN2A 5A6AA 1TQSA 4LSUL 3MGTB 1VBUA 4DAGH 4Z5RB 1PKQA 2GJRA 3UG5A 4YHYB 4XRCB 2XI9A 3JUYA 5JHDE 1DWJM 3QEQB 1E28A 3RI5F 2V2TA 4D0DA 1XCTA 1W0WB 1LQSR 1OAKL 2MQ3A 4DWSB 3I75B 5EH1A 5E8DH 3TT3H 3HMXA 5H35A 4D6HA 3SCMC 2NYYD 1HOCB 5EU3A 3G5ZA 4Y5VA 3ARBD 4FN0A 4M5ZL 2V5DA 2WMFA 2Z31A 1C90A 2NY3D 4B50A 4PJAE 4LKCA 5KOMC 3HE7B 1FL5B 5FYJH 2ATKA 2CMRL 3HFMH 2APTA 4JKLA 3D39E 1RZFL 3FRPG 3BI9X 5HOSA 1HINL 3QDGD 5KSVB 4KJYA 5CKAA 1J0IA 5J3HC 2HT3D 4QNPE 5DRXB 2UYLA 1XCQA 1V0LA 4JZJA 3P11H 4PJXB 1UACL 3BISA 4XCCL 4Q6IC 2ZUUA 2EDQA 3MR9B 3V6ZA 4GZEA 2Y23A 2XZCL 1C08A 3LRGA 4NPYB 3V8CA 2WCGA 1NOUA 3X11A 5I75C 3C87A 4I18C 3VO0A 2ZUVA 2DJUA 1GJIA 4NWUL 1UR1A 2KUTA 1KC5H 2GTWA 2CRYA 4PYGA 4X99B 3BZFB 1HVQA 2YA2A 3RVUD 2DDQL 1YECL 3L9RA 4M1DL 4JFZL 1V05A 1IAOA 2CKSA 1NFDA 1NGZB 1CXIA 2VDKL 2AW2A 1XF5A 2VDOL 1BWWA 5DUPH 4HWUA 2IMMA 1SY6H 1UJ3B 4JZOB 4P2OA 1D5MA 3CK0L 1NWTA 1MFAH 4LRNL 4V1DA 1B3VA 1HWGB 1IGCL 1TQWA 3PV6A 1MFCH 5DT7A 4YHEA 2YA0A 4L29A 4JPKL 2MMXA 5C7XL 1RQ5A 5T5NG 4HA3A 2EH7L 3SE3A 4HX1A 1ZT4B 3V5KA 3WS3B 1S8DA 3V5HB 3NZHH 1TCMA 5I6SA 4CADA 3IDIB 3QI9C 2VO5A 3UR7A 2BXZA 4IIQB 4Y5XC 5TDPA 1BZ9B 1WAWA 3L3JB 5GRUL 2CIIB 3RDTC 3VFPB 4TOYH 4XHQA 3EYVB 1MAKA 3QIBB 1KCSH 3QO0A 4KDTA 2Y06H 4MAZA 2NY7L 3VA2C 2WP3O 1CFQA 4WUUA 4EI5D 4NN6B 1GGBH 1IEAA 4U1HA 2NY0B 3EO0B 5F1IA 2AK4D 3KYKH 3PG2A 4HLJA 5I24A 1WAAE 1CFNA 4ONHB 5GSVA 2PI6A 3BPOC 1T0NB 35C8H 3KPRE 3O8XB 2YL8A 2EICA 2EDWA 2CKBL 3FL7A 2D7PA 2FDBP 3BZEA 4WI6A 3JZ7A 1P69B 5IVXF 2XG5A 3AXLA 2XV6B 2VN7A 1L7IH 5C0ND 3BE1L 3QCTL 3FQUA 3P30H 3MJ9H 1PZUB 1I1YB 4DAGL 4PJFB 3C6LC 1NC4B 5C0JA 1CN4A 1N8ZA 3V6OC 4LLVA 1NBZB 3K2UH 1KB5A 2DKMA 5DDHA 3BEVB 5HGAB 3QZWB 3WJJA 4GPNA 1AIFB 3FQRB 2VC9A 3N04A 4OJFH 1DQQA 3OKDB 5E8DL 1XF2B 2AOSA 5JDSA 4F15B 2GK2A 1R3KB 1IKNA 1VGKB 2V7HB 4RAVA 4NQCB 4TVPD 3VWJC 4KRLB 4RWYL 1FNEA 3GJFK 1NL0H 4X7CC 5I73C 2X42A 4DUVA 1KEGL 5A1AA 1Q0YL 1B3XA 4OZOA 3HFML 4HOZA 1G9NH 4HV8B 5DVNA 1UZ8B 3SJVB 2YC1A 2HLFC 3UAJD 3P3YA 5SWZD 5JXEA 3ROLB 1W2KT 1Z2KA 4NO3B 5JIPA 3CFEA 1S7QB 3G5XB 3PWLB 4NJAL 5KSUB 3WD2A 1YEIL 2DQJH 3IDJB 3WHXB 1E4XL 1WFNA 4HS3B 3LXCA 3NAAH 3SO5A 1KJ2B 1B6UA 1EHXA 2A1WH 4UOZA 2PBGA 5DMJB 5J7CC 1SFSA 3MS8A 5A8NA 4B15A 2QHAA 4E2OA 1QQDA 4QGYA 1NCDH 2VX5A 3MCLH 4Z7QE 3P9WB 5EBWB 1QRNB 3WFEL 5FA4A 3GXPA 1MELA 1Y18A 5DUPL 3VRLE 1R3IL 3C60B 4B9ZA 5HHVL 1GW1A 1RZKC 1MFAL 5KZ6A 1K3ZA 1C7TA 3TIEA 4MNKA 3IYLW 3PABB 1CICC 2D7TH 4D0CA 1MFCL 3FRPA 4J3UA 3T04D 3MGAA 5GS0D 1I1AD 4ISVA 3QJFA 1OVZA 4K3EL 1P7QB 2J4GA 4FFYH 3MTRA 4MNQA 2QL1A 5D7KE 4GKNA 1HEZA 3F5WB 4IMLA 1NUDA 4MJ4A 1CECA 2A6DA 2IGFH 3CUPB 1BIIA 3IJYA 3STZA 1QLRB 1HHJB 1N3NB 3RJXA 3D9AL 3RZCB 1MH5A 1DBML 4HJGA 4GG8A 4NZJA 3PBGA 4TOYL 4POYA 4WLCA 4WKFA 1KCSL 3WDJA 4WW2F 1H3GA 5FUCE 3UDWC 3S3SA 1E4LA 1JFXA 4Y4FB 3RKDD 2ORBH 4BQCA 3PNWB 3FJTA 4EDXA 4MCZB 3KYKL 1XF3B 1Z9MA 5HYJB 3OAZH 2OJZH 1QNZH 1U95A 1QW9A 3Q2CA 1PIFA 4NRSA 2NXYC 5E8PA 2H8PB 3PQYE 2XWJB 3HE6D 3IAGC 1P6AB 1CWVA 3GI8H 2J1KA 3TYFA 3C5SA 1GQIA 1HI6B 5DO2D 5FGCE 1L7IL 3CZJA 3WD4A 1NM9A 4WFFE 1UG9A 3MJ9L 4G42A 3DRTA 1JZ7A 1G7JB 1MLBA 1A6ZB 2H6PA 4J8RB 1O7SA 5FB8B 5AYBA 4PJ7B 2GSGB 1EXUB 1F2XK 2PYFB 2C3HA 4LKXA 4ZFZA 1D7FA 4GMTL 3W0WB 3W81A 1JDDA 3LQZB 4P2RD 3A4XA 3GNML 2XKSA 4Z8FL 2F53D 1BBJA 1GVIA 4I3GA 3X17A 5LKNA 2QSQA 3K46A 4O4YH 4U1MB 4QTIL 1R47A 1IFHH 4PJHA 3PGDA 2WBKA 4R90H 2CNCA 4AD3A 4Z5RA 3MLRH 2H2PC 2HVKB 1N6QL 1BFVH 1LILA 3BPCB 4XRCA 3D3VB 1VFOA 3DO7B 4MNGA 5DQ9A 2J8UF 1G9NL 2V9QA 4GAJL 4KTEH 2PYEE 4NCDA 4HC1H 4RFNB 1MAJA 4F2MB 1PS3A 1NDGB 4U0RB 5FCZA 4DWSA 3DX7A 3ZDXE 3PWPD 3NABH 1ZLWK 3GMNA 1KXVA 3BVTA 3MA9L 4Y5YA 1BIHA 2FJGB 2IPKB 3WEXB 1KTLB 3W82A 3RX8A 4XCNB 1I8KB 2QV2A 3FO0H 1OTSC 5DO8A 1VFFA 3NAAL 2ZSVA 3VD5A 3VW3H 2XTJB 3UBXI 1FL5A 4DK6A 3UG4A 4UQ2A 2A1WL 8FABA 1G0CA 4R7DB 1LO5B 1FPTH 2FWOA 4KROB 5KSVA 3ARXA 3MUY1 3G6LA 4X6EA 2GIYA 2ICEB 2GK1A 4FFWD 4PJXA 2G3NA 2R56H 4M7JH 4L8BB 1MFEH 3TCLA 1UQSA 4KAQL 4ZAKB 3W2DL 4M62H 4QHUB 4MSWB 1IMHC 2YPLE 4EVNB 4Y4HD 2AJ3B 2D7TL 3B9DA 4MA3B 2C8NA 1RK0A 3MJ6A 3AIEA 3TNMB 4JIEA 4HAGA 1XGTB 4O51B 5MI0C 1NGZA 3GJEB 6TAAA 4FFYL 3PZGA 1LL7A 4I9WE 5A40E 2VX4A 1U3HD 5DUMH 4YBLC 3A4AA 4JZOA 1X5XA 3CSYB 2NXZC 5L2KE 1YA5A 3ULUE 4ZDHA 4X5LA 3C8KA 3RVWC 1AKJD 3K8KA 5I18L 3MUHL 4PLKC 3SEPA 4TTUA 1GVYA 4F79A 4PTWA 4YUEL 5C08D 2ORBL 1GHRA 2IAMA 4M81A 2CKBB 3C5ZD 2XPGB 3HRZB 1EVTC 2PO6D 4LEOB 2K7QA 4N1CA 1WWAX 1KBBA 3BLPX 1XRVA 5A8QA 2X70A 4P9HC 5M03A 1RK1A 1QNZL 4GSDH 1V6UA 2A3CA 3IDIA 1NGWB 4W93A 2WMJA 2OZ4H 4EE9A 4HDIA 2HT2C 1HSAB 2IH3B 3CMOL 1TMQA 4LF3B 4X98B 3L3JA 2CIIA 1M01A 3QIBA 5LA0A 1PLGH 1S7TB 5KANI 4Z76A 3VA6A 1SM3H 1JFQL 3SOBH 1T0PB 2DYPD 3KLHC 3RUGE 2FZ3B 1F3DH 5E24E 4UQEA 1YEKH 1IBGL 3EO0A 4DKAA 1F90L 5A3ID 1S7SB 2D7QA 4ONHA 2NY5C 3OSKA 4AIOA 4QDMA 3O8XA 1V7ML 5M7QA 1VEMA 1L7TH 5IEKB 1YY9C 2DICA 4B9YA 1VFUA 4HKBB 1DN2A 5D96C 3DBXA 4M6ML 5DK2A 3JV5A 3TONA 1FLRH 4GRWH 5E9DD 1NC4A 3AZRA 3TBSB 3VH8B 1BFVL 1G0DA 1AD0B 3CFCH 4D0BB 32C2B 4K3HA 3PZQA 4PLJD 4OQTH 5HGAA 1G7QB 1EDTA 3FQRA 4L3ED 4AIUA 4UT6H 3CHEA 1MCJA 5CQ1A 4F7EB 3APGA 1FL6B 1L8NA 2IQ9L 2V7HA 1VGKA 1NP0A 1JE6A 5INDB 2DOCA 1KFWA 3MA7B 2E9IA 3FO0L 1FYTD 4YBHA 3MLXL 1BBDH 2AJYL 4AEHL 1U8PB 2IH1B 3UP1A 3SCTA 4PJ8D 3ZTNL 2BHYA 3RIKA 4NKMB 5FOOA 1MY5A 3TO4C 5JOEA 3NGBB 5CP3H 1HHGB 4GKOA 4HV8A 1TVBB 3LKPA 3PUCA 3K1KC 3SJVA 1H0DB 1RZJC 3ROLA 1RIUH 3GMQB 4MYWB 2ED9A 2WIIB 4WI2A 4XTRC 4XNZB 3QIWD 3BAEH 3DETC 3WHXA 5HHQA 3IS0X 5DHXB 4HS3A 4C83B 1IM3A 4FTVA 1CQYA 4M7JL 5K9QG 1LE5B 3TVMB 4AH2B 1NUFA 5E4EB 1CICD 3W24A 4CCCA 4M62L 4EUPA 3EJSA 1HKLL 4Y1AB 1OW0C 4NYLA 4ODXB 2ESVB 3RVTD 2WQRA 5T3ZH 2WCSA 3ULVH 1A1OA 2HT4C 1X44A 4G6MH 1C5DB 4PFEA 3ARGA 1W9UA 1AQ0A 4P57A 5EBWA 1QRNA 1JYXA 4NNXB 2AJVH 2OTUB 3UTPD 3HR5B 2D73A 4NQUA 1YPZE 2YD2A 1CR9L 3O9WD 2EDNA 5GNYA 5J8OA 3ZSSA 3C60A 3RJDA 1I1FA 4NI3A 3O41B 2DSUA 1HJUA 1YN7B 5D1QD 2A38A 2QKIB 3S5YA 1I8LA 4JFYB 3MMWA 2VDQH 1RSFA 4NSKB 3MRMA 3U48A 1IEHA 5IBLD 1LGVA 1P7QA 4XNUH 1DN0A 4NC1C 4HS8H 1TQCC 4LGSB 2BSTB 1DVFD 5IUSA 4C7DA 4JVPA 3MLUL 1RZKL 1GOKA 5D1ZB 1A6TB 3CUPA 3QUYB 4PSRA 1HHJA 3MFFB 1N3NA 3FMGH 1NLBH 3ARVA 3RZCA 4E41E 1FDLH 3NCOA 4KQ3H 4DCQB 3G6DH 1BZQK 1W32A 2OS7A 4NN7B 4PRHB 3EKCA 3BHBB 3EFFB 3KHOA 2WHLA 5EU6E 1U8JB 1SM3L 4C56B 3VH8G 1FNSL 2Z9TA 4HMDA 4Y4FA 3OBAA 4G8GD 3FOMA 1FGNH 4MCZA 3UEZA 1XF3A 3MC0A 1OT1A 1LK2B 2FIRT 4X6FB 1EHAA 1BOYA 4N5UA 4PBGA 4XPBH 3CFJA 5DUBB 2AJSH 2IBBA 1JPFA 4I0PA 2ENYA 1D2KA 5IK3A 2ZUQC 4A3HA 4GRLD 1CDUA 3SCVA 4PJBF 3FOLA 3B3IB 3VFOB 1A6ZA 2LVEA 5FB8A 5I5RA 1D6VH 3MV8A 1T0MB 3CFCL 2WW5A 4PJ7A 2GSGA 3GSNA 1F4WH 4TPRH 2PYFA 4OQTL 2YRPA 2J12B 2VLMD 5GZNC 4PMXA 2JIXB 2VC2L 3MRHB 1KG0B 2KBGA 4RSVA 4Y19E 4J23A 2K3TA 3KPSD 5C8JB 1AY1H 2A3BA 3LKRB 2V5YA 5BVJB 2P5WE 2WINB 3BGAA 3AIRA 3L2MA 1QKZH 4HXAL 5DD5L 1YY8A 1BBDL 4PRPB 4HUNB 1OAZL 3SCMB 3SCSA 3MLPA 4ELMF 2XWBB 5DT1H 4L8SC 3MYZA 4LARL 3VNZA 5DVMA 3WIIL 4XBEL 3QNYA 4F2MA 4Q9QH 1HXYB 5KSAC 4UV4L 4JY5L 1CD8A 3KGRA 4LPYA 3ARRA 2YUZA 1RIUL 1VRXA 4PMZA 2FJGA 5E00B 5EN2B 3BAEL 4NO0D 4XCNA 2Q8XA 4K8RH 3VDCA 4BFIB 3HG1E 4BH7B 3LS5L 5DRNB 1M71B 4QWWC 2J77A 3B8SA 3T2NL 1NBVH 4R7DA 2VLKE 4Q6IB 4Z7OF 2JF6A 1F3DJ 4HMCA 4U1SB 3SGEH 2R2HA 3EYOB 5C92A 1W3JA 3ULVL 2Q3AA 2HKFL 4I18B 1U9KA 1NCCH 2EDRA 2ICEA 1BQLH 3ULSB 4M1CD 1FFPB 3KZSA 2HLAB 1ROWA 1KTDB 2X9XA 5HPMB 3Q6GH 3JBG7 4PLNC 4UBDD 1A5FH 5EUOB 4L8BA 4MXWL 3QDGA 4F8QA 4XX6A 1XF4B 4ZAKA 3EIFA 1QP1A 5FCUL 2BXYA 5FYKU 1N82A 4N0CC 5IDIA 1UYQA 4QHUA 3GSUA 1GNXA 4OLXH 5AYIA 5E1HB 2X5PA 5FHBH 4EVNA 2BOCA 1TJIH 4KGLA 4MA3A 2VDQL 2VNCA 4Z7WA 2PTVA 3TNMA 2IFFL 4O51A 3QXDB 4H8WH 4O2EB 4LP4A 4HS8L 1JTTA 5D8ZA 1BOGA 4X9IA 1S5IH 3MRNB 5HGDB 5F3BB 5L6YL 1ZL1A 3KXFB 3CSYA 4DQOL 4H88L 4OSUH 3EYPA 4FXKA 4FMVA 4NQEE 1RU9H 1TZGH 4OM0H 2XA8H 3CGTA 2VUOA 3TBWB 1H09A 4KQ3L 4WF7A 3G6DL 5CIPH 3JVGC 4MJIB 7FABH 1S7RB 3KLHD 4C4KO 3QI9B 4KDVA 4TUFA 2BMKB 1S5HB 4Y5XB 1MYRA 1TZ7A 4XVSH 4LBEA 3RDTB 4PJ5D 1G01A 1ZU8A 5EB8A 5CGMA 2CBJA 1TQBB 4LEOA 1Q9WB 4LCWE 1N5YH 4OAWB 3WNPA 4UOQA 4FQXD 5DJYB 3FFCE 3CDFA 1FFQA 1NP2A 4U31A 1XH0A 2IH3A 3MLSH 1ZT1B 3BPOB 4PN2A 2HP4A 1WQVT 4NHUB 1BECA 4N90D 3ARDC 4ZUTA 5HGHB 5GRWA 3SQOL 2UVEA 3OAUL 4XPTH 1QSEA 4P9HL 2FZ3A 1GGIL 3MLYL 4PB0H 4G9FB 4I77H 4MJ6B 5FV2A 2JCCF 1NCBH 3MJ8B 4UTAL 1F4WL 3B9KC 4TPRL 1S7VA 1W1TA 3C6LB 2C3XA 5DJ6A 5IEKA 1BQSA 3D5HA 1UVQB 4FNLH 4EI5A 3ZJ6A 3CFDA 3T0XA 2X4UB 2DL2A 2AK4A 3WLWC 5CEZH 3O2WH 3NH7H 1KJVB 1U8IB 4QRRD 2XIDA 5F9OH 3TBSA 3VH8A 3ZDYE 4BELD 1PZ2A 1R5IA 3ZHKA 32C2A 3BAWA 4GG6A 1ZJAA 1BX2B 1OD9A 2X4SA 4RE4A 3UTSD 2UUDK 4Q9QL 3WEZA 5DF0A 3WFHB 5C0CD 4JFVA 5E4IA 4AG4H 3GGWA 3HTLX 5DK3A 5LGKA 4GAFB 4WW1B 5ERWB 4PJ9C 5BRPA 1OB1A 4JFEB 4YHIA 3VIFA 2CIKB 2VLJD 3GM8A 3MA7A 5DVLA 3PWNA 1GUVA 1N59A 4K3JL 1UC6A 2IH1A 1GOMA 4Y2OA 3BJ91 5TDNA 4NKMA 1NBVL 4P5TC 3NCMA 1HHGA 1MQPA 3OZOA 1J5OH 3H0TB 1MI5D 4IRSC 5J1TC 3Q6GL 4C83A 2N4IA 3TVMA 4AH2A 5I15H 4FNQA 4TUOA 2ZX7A 4ZD3L 5SWZA 1KUMA 4OLXL 1BFSA 5FHBL 1RZJL 2BOBA 3T4AB 3NUKA 4ODXA 1FORL 1V7NH 5HI5D 3LPPA 1JHTB 4JCMA 1ADQL 1C5DA 5J13C 1I3RA 1W2VA 2XN9E 1WBZA 2XA3A 1V3HA 2ZJSL 4NNXA 3U2SB 1NDMB 2OTUA 1H9VA 1KCUL 4ONOA 2MCPL 3THML 3PXJA 3IFLL 1CL7I 1ZKAA 3RA7H 3ZT5A 2CHNA 5A69A 4JO3L 1TZGL 4OM0L 2XA8L 4OKDA 1EO8H 3PL6C 3JUGA 2IANE 2QKIA 2J79A 4JFYA 3GO1H 4WI3A 2DT1A 3QISA 4PJDA 5ANMB 1MCQA 2L7UA 4NSKA 1QWUA 1VEOA 2EDTA 5D2NE 2Q7YB 5ESVA 1ZBVA 2BSTA 2CPUA 4ENED 1HWHB 3ZKND 1LP9F 3QQNA 4TVUA 2J7HA 5D1ZA 1A6TA 3QUYA 1CXHA 3ES6B 3BWAA 3WDHA 3AIBA 2VZ1A 1I1AA 1MWAH 1ITCA 3O6LL 2BVPB 1SJVA 4TNVK 4DCQA 4BZ1L 4LSTH 1TCRB 4IS6B 4R4BB 3EFFA 5FEBA 3SKOA 1U91A 4GKSB 5GQBA 1ED3B 3EDKA 4FZEH 4CW1B 3RGVC 5JBFA 2YJQA 3TA3D 3WQ5A 3DLQR 2UZIH 3U30B 4I77L 4BH8A 4PJFF 1NCBL 1CFTB 3BQUD 4JPVH 3WEMA 2XGIA 4X6FA 5H37H 1YEDA 3HJEA 5MEPB 5EFDA 4U33A 2UY4A 2Y6SC 3HC3L 2H3NA 2GSIB 2OR8A 5JW5B 1NOFA 3AREC 3CZFA 2LQRA 2W5FA 1T20A 3GJFA 5EFFA 3SDXB 3H42H 3BUQA 4QTHB 3RIAK 1P6WA 3NH7L 5CUSH 1J8KA 3VFOA 5JMOC 2OSXA 2NY6C 3BP6B 5K93A 2ZG3A 1T0MA 2YWZA 4YFLF 1KPUB 2WSPA 4PD4J 4MHHG 2P44B 1QSFE 5D71L 4K94C 2WHKA 5F9JA 3TJEH 3LIZL 5C8JA 3LKRA 4C57C 4OCMC 4G6KH 3U46B 5BVJA 2Z8VC 2WINA 3TN0C 4OGAD 2Y72A 4QWWD 1F6AB 1JWSB 4NP4H 5CFHA 5I76B 1WPCA 1VCAA 4Z6AT 5BO1H 3CO4A 3UCQA 4OZHB 5CILH 4MD4B 4P2RA 2XWBA 3DV4B 4R9HA 4MDIA 3OTTA 1HXYA 1XR8B 1J5OL 2EXOA 3MNVB 4IHOB 3P2TA 3MRCB 4XX1E 2JB5H 3P9MB 5T1KD 3T3PE 2PXYD 2NNAB 3IDYB 5I2IA 5KS9E 2GEEA 1RVFL 2NTSP 1KPVB 4N0CD 3AQUA 3QFJB 4TNVF 5C0BB 1H2JA 1I3GH 3HZVA 2EXYC 2PW2B 2R0ZH 3BPLC 5DRNA 1W3HA 3PWPA 2PCPB 2YKKA 1JYVA 4Q6IA 2FSEB 2MQ0A 1KQYA 4JDZA 3TBTA 4ZYKB 1V7NL 3EYOA 1NFIA 2PTTA 3UZQA 1HH9B 4I18A 5I71B 1UZ1A 3QDAA 4OIIL 2DQXA 4XI5C 2JTDA 5JNYB 3L4YA 1YMMD 4D6EA 3ULSA 5CP7B 1TLKA 2AEPL 2W9EH 1WC7A 4KGJA 5HPMA 3AYSA 5IR1B 1RZ7L 4HGMA 3VG9C 1AGFA 5MI0B 1WNOA 5ADOH 1XF4A 4X80H 3N12A 1CYGA 3I6KB 3RIAF 1E4NA 1HIMH 4YBLB 2MPAH 1QOXA 4JM2C 1A1NB 1P4LA 2HN7B 2NXZB 1OAXL 3QXDA 4O2EA 5FUCC 3AMDA 1UR8A 1GC1C 1GPFA 1KCVH 3PIQB 4Y4HA 4POZC 5HGDA 4WEMB 5F3BA 3KXFA 1TTGA 3PWUA 1OP3K 1K9TA 2WANA 2YBRB 3VILA 4OCYH 1KQZA 4MA8L 4LSTL 5CSYA 3QI9A 2PTUA 2IXVA 1A7RL 4J28A 2BMKA 3GIZH 1JJUA 2YSSA 1B0IA 2DSVA 5HYJD 4N0YL 4N8CH 1HHIA 2UZIL 2CYGA 4DKDC 4FXLA 1Q9WA 3EO9L 1PG7H 4UT7H 2F5BL 4FMFA 5LA1A 3HN3A 5KJRH 4WWKD 4XVJH 4D8PB 5IOPB 4ZPTA 2AJUL 4NQVB 2EACA 2P5EB 4KY1L 1QWNA 2UVFA 5SWSE 4X6DB 2D3VA 2XRAH 1UGNA 3C5ZA 3KWWB 3OJ2C 5EO9A 3VXNB 2XM1A 5HGHA 4XH2B 1ZBWA 4YHPA 5JPNA 2XWTB 3K8MA 1AC6A 1CWYA 4QRQB 3LRSB 4MJ6A 5D96B 5E8NB 1MCSA 3W9EB 3DX3A 2A73B 1HQ4B 5CCKL 3MUGA 4MDJA 5A6KA 4CVUA 1CDHA 3C6LA 4J3OC 1JL8A 3K80A 3MRDA 3QGVA 3NFPB 4YC2C 3TJEL 3V6OA 3VD7A 2AXFB 2EDLA 1HH6A 3IGUA 3GSQB 3VSVA 1HXKA 4G6KL 5ID1B 4G8IB 1B88A 1KJVA 4FLSA 3W26A 3FRUB 5I16A 1NEZG 4RGNE 3ZOAA 5BO1L 5C9KA 4U1GB 5E2VH 5CILL 1A7QH 2OMNA 3QDJD 4MB5A 1NGQH 1UASA 3MU7A 2OSYA 1W8OA 3VWJA 3D0VB 1HNGA 1BX2A 1TNMA 3BH8B 4YEFA 4HULB 1MW3A 1DL7L 2YXFA 3BKML 3AISA 1QACA 5E9DA 2P48B 3TO4B 5EFIA 2WWKT 4KRMB 4WW1A 3WFZA 4U2YA 4JFEA 1PKQE 3MOAL 2CIKA 3NN8A 4CU8A 4G3YL 2FX8L 2XTJD 4ORZC 4AD1A 5DWUH 5D7JD 1I3GL 2NY1C 4L3EA 1CLYL 3GYCA 1BAFL 3S3PA 4Y89A 3O4LD 4M7KL 5M94B 1IGYB 5FUZL 5IB3B 1MIMH 2CO6B 4R4FL 1V3IA 2VR4A 5A6MA 1D5ZB 1FYTA 3OHXB 1IGTB 5IQ9A 3L7FB 4FQLL 3U0PA 3LN4B 1C8YA 1UYWL 3UC0L 4DJMA 2W9EL 1OSEA 1XR9A 2DF3A 3IXTB 2A6KB 4GMSH 4A6YA 2E6JA 1VFMA 5KW9L 3ZO9A 3BVVA 3RWEB 2P1YA 4X80L 3NYDA 5GJSL 1W0YT 2R1XB 1BGXL 3K74B 2EPOA 2YD6A 4DGVH 4PRID 3OLIA 3QPXH 3TTYA 3U7WH 2UZYB 5DJDB 1WZ1H 4HLZG 2X4OA 3SGDH 5HJ3B 3ULUC 3CD4A 3QUMA 1E72M 4QOKE 4OD1H 4YIQA 1CICA 1ZLSH 4GKZB 1FCCA 2IADB 4QRUB 3AIQA 1DWIM 2IWGA 1KCVL 1JHKH 5DZNA 1TA3B 3WCYA 4KRTA 1A3HA 1EEQA 5FOBB 4IEFB 3CXHJ 1TQCB 2ADIB 3MJ7B 3CUGA 5KOVC 4P4KD 1BHGA 3V0VA 5E70A 4FQCH 3SDDC 1UD4A 1UWSA 3WNLA 2WVVA 1AQKL 1NFDE 2V38A 2HA1A 2XZQH 3PWVA 4N8CL 1NQBA 5D5MF 4DGIH 4WFGD 3U79A 5FYKD 4GOSA 1I8IB 1PG7L 3E3QC 4UT7L 5EZJA 3UDWA 2C4FT 1PGRB 1OPGH 5DRWB 4V1DE 4XVJL 3ES6A 3T77A 5J56B 4Z7VB 1MQRA 2BVPA 3DHUA 1Q9OB 4NX0A 1WBXB 1A14L 4IOIB 5MEOB 3BVWA 1TCRA 3ILQC 4R4BA 4GINA 1RULH 2R69H 4XWOC 2NY6D 4GKSA 4CW1A 1UR0A 5E6ZA 3VXPA 4LHUD 1YYLL 3LDBC 3W53A 2ZUQB 1CFTA 3OB8A 3FTGB 5LAXB 2Y7QB 4U7MA 5SX5H 2VVSA 2F61A 5FUOH 5FYJD 3CFBA 2GSIA 4G8GA 3ZZ1A 2BRRL 4WUUE 2WBJB 3RM9A 4I3RH 4TSCH 3JV6B 4X7SH 3S97C 4JL1A 4BSVA 3KR3H 1SYTA 1D5IH 2CERA 3L2LA 4OLWH 2EKJA 1H4PA 5DJXB 1KPUA 4J4PC 1LO3L 1E9LA 2MNUA 5GS3A 1QFUL 3IU4L 3OGRA 4L8SB 1KEML 3MRGB 3VFNB 1E6RA 3CXDL 2IBZY 2QQKH 3FN3A 4H7VA 1DHKA 5KSAB 4GT7A 5B22A 4APQB 4YX2L 4EI6B 5DWUL 2XWEA 1V0KA 1JWSA 2RR3A 5I76A 4NQSA 5GISH 3WDIA 4U0QB 1CZ8L 4MD4A 3S37L 4NZCA 4PJBA 2W92A 3DV4A 1WTLA 4K94L 4S0SD 1OOAA 4AIXA 5DJZB 3R06B 4TTDC 1XR8A 3CVHH 1NMBL 4KHXH 4HWBA 4OZGB 3MNVA 4IHOA 4Z7UF 3MRCA 1PJ9A 1QEWB 1E6NA 3KPOA 2NNAA 4FNTA 3QWRA 4D9LL 2YHGA 3EO1B 1KPVA 4GMSL 5C0BA 1L6ZA 4G6JH 3LB6D 3MMEA 4K3DH 1A02N 1Z32X 5HDRA 2PW2A 2VX6A 3L5XL 4Y1AD 3DGCR 3L5JA 1JBJA 4RMUA 2WZPD 1NEZA 2ESVD 2PCPA 4DGVL 2IPTL 3N1PC 2FSEA 3EUUA 1AXIB 3KYOB 4I5BA 4GLRH 2F19L 1UD5A 1WZ1L 3IJSB 4JO4L 3O6KH 4NO0A 4Y4KD 3S4SB 5HVFB 4UILL 5FIEA 4OD1L 1CG9A 3QEGH 4KI5E 5CP7A 4YXHH 3QSKB 5E2JA 5HHOD 4G80B 1JHKL 1WEJH 3BO8B 5M3WA 3D48R 3Q48A 1DR9A 1KT2B 1M7DB 3CCHB 3CMGA 2AEIT 3JWDH 3SY0B 5KVGH 4L4TB 2B1HH 3BEWB 4P9ML 2N7AA 3Q0HA 4XC3H 4JFHD 1A1NA 2HN7A 1SEBA 3NIDE 1D9KC 4PP1C 5GZOC 1R87A 2FHCA 4MVBC 2R4RH 2OXHA 5IFAH 3UESA 5A94A 3EOTL 4NZTH 1LVEA 2VITB 3BYTA 5JA9A 4O58H 1UKSA 3MMDA 1PD6A 3SUTA 1T04B 2NX5A 3ZL4H 2DBLH 2EO1A 3LV3A 4Z77B 4CJ1A 1U93A 4L4VB 3UPAA 3LRLA 4Q7NA 5FDWB 2YBRA 4ACZB 4LLMB 3EOYG 3F58L 3O2DH 5EB9A 4PUEA 4MNQE 1JXJA 4QAWA 4XZWA 2Q8BL 1ONQB 3MRFB 3TBVA 1GC1L 5KTEL 3DHPA 1ZHNA 3VWKD 1QBBA 3M8OH 1JPTH 1R6VA 1F2QA 3ARDB 1CXKA 1FFRA 3NFSL 3OAZK 5FUOL 1ULVA 5JW4R 3SN6N 5I1CH 4QY8A 1VGEH 2P5EA 2MHAA 2R8SH 4P4RA 2WWCA 4X6DA 4X9FA 3NCEB 3B9KB 3KWWA 5E08H 3CH9A 1F4YH 1EMTL 4X7SL 5JHDB 2XWTA 3QT2A 4FQXA 2NY2C 1RURH 4F7TB 3GBMH 1MJJB 4QRQA 3LRSA 5E8NA 2PETA 1HQ4A 5DURD 1MCIA 4OLWL 2JIXD 4M48L 5E1QA 1WGOA 2QHRL 3GZKA 1B0RA 3E6FB 3P0VL 3VGGA 4MAUH 4F33B 3V95A 3NFPA 3GNOA 1RP9A 3GSQA 4PJAB 2BJMH 2VRAA 4YEEA 3QDMB 4GKLA 4PY8I 1AHWC 2QQKL 4UOJA 4ACPA 3UYRH 1UA3A 4JG1L 1RMFH 2YK1L 4NGHL 2G2RA 3QFDA 4EN3D 5DC0A 1ZLUH 5GISL 4PYSA 4PJ9B 3AYRA 1AGDB 4QHMB 5F1SA 1AD9B 1HKJA 3JV4A 1V5JA 4QHNA 3D0VA 1NARA 4P2QE 4L4PA 4L8CB 5E0FA 1I1XA 2JCCA 1A0QL 5EIIB 5GRJH 5AYUH 3X3GH 1UWGH 2CLVA 3TO4A 4P5TB 4HIXH 4PJHE 1US3A 1WFUA 1LWJA 3L6FA 3GEWB 3KNBB 5JUEH 4MNGE 1VFBA 4G6JL 4IRSB 4NM8L 1LEIB 2ICWA 3DUSB 3CC5B 1JN6A 5C0CA 1NC2D 4JFDD 5I1GH 1MVFA 1E55A 3KEHA 5A16A 1IGYA 1JYNA 1Q6FA 3QHTC 2Z35B 5IVZA 4BSWA 4AK1A 2VDPL 1NJ9A 3AROA 4J12A 1IGTA 3RWIB 3FB6B 2GJPA 1JI2A 5JR1H 3IDXL 3U7VA 2YD3A 2EE2A 1GZJA 3D2UB 2A6KA 1A64A 2VL4A 1EEYA 3GMPA 5J13B 1LG2A 1MUJA 1NWSA 2R1XA 4RCAA 3JWDL 4AYGA 2RGSA 1IKFH 1OGAB 3ZE0F 5DJDA 2CBIA 3WV0A 5T1LD 4XC3L 2NT0A 1R3HB 1QZ1A 2FX7L 3S88H 3OKNB 1VHPA 4OZ4A 3O6FB 4PJXE 1UADC 1KIPA 3PL6B 4P7QA 3O3DA 5BS0B 2R4RL 4R7NB 5IFAL 4GKZA 2R1YA 4R26H 1P5VA 4JO1H 2IADA 4QRUA 5A2KH 4NQDA 3BD3A 1TA3A 4O58L 3BP4A 3ZL4L 4Y2DC 2F7OA 3OB0K 5FOBA 4PUBL 5MHSE 2ADIA 2VB5A 3QHZL 3ILQD 4GO9A 3ULUL 4OT1H 5AAWA 1CD0A 3C2AH 4UCFA 2BHZA 4GO6B 4OLUH 3O2DL 1DWGM 3G5YA 5I74C 3ZKXC 2IALA 2JJTC 3CSGA 4LLQB 5FXCH 4NXKA 1T1WA 3O3EB 1FE8L 5DRWA 3RGVB 3V5DB 2ERJC 4PGBB 4RISL 4NNPL 3W25A 3C9NA 5I1CL 4Z7VA 3ZTJH 5I1EH 2R0KH 3SE9H 2R8SL 3CJJA 2AABH 3WLBB 2X7LA 4IOIA 5MEOA 3OG6B 5H94B 3DI2B 4NOBA 1A4KA 3QHFH 2VXSH 1ERNA 2YA1A 4GW1B 4PRWA 2YLLA 1RURL 1ZSDB 1QHPA 1LE9B 3Q6FA 1RUKH 3AREB 1Y7VA 5D6CA 3I6LD 2ZUSA 1K9EA 2F8QA 3FTGA 4ODSL 4PREB 3HU7A 3FQTB 1NCUA 5C1MB 2CDFA 3FCTB 4OF6A 1TZHA 4ERSL 2J7GA 1QYGH 2FD6H 3IDMB 4MX7B 1EGJL 3RFZC 4ZUVB 4ZS6C 3RWCA 1EERB 4HGWB 2EEXA 2FHFA 1NGPH 2BJML 4XBGA 2P47B 1EHNA 3W11D 4R4NC 4OIBA 3S36L 3UYRL 1RMFL 3MRJB 3BKJL 1GPOL 4RDQF 3OZ9H 1MCBA 2GJXB 3CHFA 2Z91A 4TTDD 1NCWH 2OJEB 1HYSD 4CD8A 4I4WA 3TN0B 5D70H 3DNKA 2XQBL 3TV3H 5L0QC 4D9QD 3QXWA 4ZUUB 1EBPA 1KSRA 1QD0A 1CTNA 1I9JH 5BOZG 2G3MA 1JCKA 3UTTD 4X6CB 4HOWA 3WH9A 1P84J 2PNDA 5AC5A 2ZPKL 3BXNA 3MRGA 4HIXL 3TP4A 4HIIB 1RJZB 5JUEL 4HXBH 1T22B 5F7HA 3CLEL 2FBJH 4BKLB 5JW4M 3R06A 2WV3A 1PEZA 4HUKB 4OZGA 3BPLB 5J9PA 5DR5L 4XPAL 4FG6C 4YQXH 5KVEH 5JR1L 4XAWH 4X5WB 5C6PB 5BWFA 4QHLB 2V3FA 4YHGA 5JOFA 5K59F 1ESWA 4YHLH 3VXUD 3LKOB 2UWEF 1GZQB 4Z18A 5BRZD 2N7BA 1IKFL 3SJVE 3TT1L 5T1KA 2P8LB 1D9KD 3VG9B 3VFRA 4ETQB 5F7FA 1JF5A 4MVBD 4QCEA 1DQMH 1HE7A 3BOVA 4PRAB 4JQVC 5FHAH 2F5AH 1AGEB 3RU8L 3FFDA 1TIUA 2CBVA 2XKNB 4R3SB 4FTVE 1ZGLB 4JM2B 2OL3B 5DFVC 5C2BL 4KUZL 5JMRA 5D2NC 4G80A 4Z2LA 3T2PA 1XIWB 3BO8A 1EPFA 3GDBA 3VJ6B 3UTQA 3B43A 5ICZB 3I85A 3CCHA 3SY0A 1YMMA 2AXHA 4OFKA 1I9RH 1XC6A 3C2AL 4GRWF 4PUDA 3D85B 1N64H 1QRNE 3W28A 4DVBB 1ZAGA 1R8LA 1R0AH 1LDPL 3JVGA 2VITA 3PQYB 5EBGA 1UD8A 3EOBB 2AQ2A 5C09E 3AXXA 4R0LC 5ADPH 1UM6H 4QXWA 5IB2A 4HUMB 1CPUA 1KGCD 1JGUH 5F3HB 5EA0H 4QRTA 3QULB 2R0KL 1U8NA 5E94B 1ZJBA 2AABL 3U7AA 1MAML 4OOUA 1H8NA 5HHXL 1OIMA 4P8VA 4ZS7L 3BUTA 1JGLH 2CHOA 3QHFL 3O3UN 3FQWB 2VXSL 1ONQA 3MRFA 1V3MA 5I0DA 4ZNEA 1RUKL 2X4TB 3AB0B 1EO5A 1MVYA 2P4AB 3ARDA 3LHPH 1GXEA 3QR2A 3POCA 1V3JA 3PGFL 1QYGL 2FD6L 4OFYD 3VD9A 2C3GA 4WV1C 5EU5B 2LAGB 2Q3ZA 4PY7B 3B9KA 4LXFA 1DQLH 3ZHDA 4MA1C 3TIDA 5JHDA 4N9OB 4YC2B 4F7TA 2PYEB 1MJJA 4XB7A 1ZHBB 2FO1A 1QNOA 2X89A 4AL8L 2Z4QA 1INEH 4OZHF 2WMIB 4M6OL 3ULVF 4PJCF 2R9HC 4NIKB 1CIUA 1W72L 4MD0B 4ZXBB 3EMCA 4LNVA 3RL2B 3HNVH 1CS6A 3VGBA 2G75B 3E6FA 2X4QB 3AU1B 3MGOB 4PB9H 4XP5H 3DX4A 4F33A 2V17H 5D1XD 1W0VB 3TZVB 3QDMA 1JNLL 1B31A 1OAUH 3UJTL 5T3ZD 3ULVD 3MV8E 3IDGB 4HXBL 2DMCA 4PJ7E 5DHVB 4EZMA 1CBVL 4HOXA 4PJ9A 1RUPH 2D03H 4OOZA 1AGDA 1WZMA 3CDYA 4JL2A 1ND0B 3A67H 2BSSB 2VAAA 1C5CH 4UTBL 4PMVA 2OR9L 1QFOA 3DX8A 3ARFB 4QXTA 1U92B 2NY1B 3IB4A 1G9MC 3GXTA 2C5DC 1OM3L 3EYSH 4QLLA 3I2CH 4P5TA 2BNRA 3QFJD 1EUTA 3TF7C 2XVGA 2VXUH 1I7RA 3T8XB 1T21B 4UT9H 4GQ9H 2NY4C 4LCCC 1H1NA 3JWOH 4RBPH 1J7VR 4IRSA 3VD4A 2W60B 1LEIA 3CC5A 3KLSA 2EIZB 2E7HA 5E2UL 5KZCB 3U82B 2XWDA 3GFUA 1HP5A 3GUTB 2DWDA 2BCKA 2Z35A 2E6PA 5EWIL 15C8L 5F8RC 3RWIA 5IBTL 4HK3J 3FB6A 2XSBA 4Y2DD 3B83A 3KPNA 4UV7H 1T2XA 4NN5C 5L2KB 3DMMD 4AMWA 3D2UA 1J88A 3O4LA 1OY3B 1F4XH 2DL9A 4JRXD 4P49A 1V0MA 3KPLB 2J6EA 2C3WA 2XQYK 5INCB 5I8OH 1U42A 4WVRA 1NAKL 1OGAA 1GOWA 1I9RL 4X8JA 5DJ2A 4AMKL 3H9SD 1VPOH 4PMDA 2WPGA 4L9LC 5JOPD 3AJ7A 3BIAX 3ZDZF 5BS0A 2YFOA 2Q6WB 3QDGE 3ILPB 5F1NB 4PD4K 3C8HA 1IVLA 3QNZB 1KCRH 1G7HB 3X3FL 5ADPL 1UM6L 4UZGA 3AVEA 3HHRB 3U4EB 4UQ9A 4WIWA 5EA0L 2ADJB 1FVCB 1ZV5A 4Z7WE 1ZA3B 3SGKC 3RUGB 3MACH 5T1MB 2F8OA 1INDL 2WIMA 4WFHD 4LLQA 1UFUA 2WW8A 1AGCA 1HILA 4M8QB 4QF1B 5CD3B 3BVUA 5HHPB 5HDLA 3BXWA 3G6AB 4LQFH 4P4KA 5CJXC 3LHPL 4P8WA 1DQDH 3F7YB 1ZB5A 3RGVA 3V5DA 1T6WA 4PGBA 2NW2A 4WJ5B 1G7MB 5EIQA 2UY5A 3LDBB 1E15A 4U1JA 4LLDA 3HPJB 2PWDA 4W68A 3OAYH 4N5ED 4XVUC 1JPSH 2XIIA 3CZEA 1JMZA 2VDLH 1IC5H 1IC4L 4GW1A 2HJLB 3I3BA 1LE9A 5ILTH 5ICXB 3CVIH 1DJSA 3AREA 2DAVA 2FL5B 4XP4H 1MWOA 2DQFB 2F54B 4E5XA 1SBSL 3FCTA 4K8RD 5D5MA 4S1QH 5HYQB 4TX6A 1RIVL 3IDMA 1TQUA 4MX7A 2YUWA 5A3HA 3OPZH 4GW5A 3FY1A 5A6BD 2C1PB 2V17L 3RVVC 4LCYA 4YDVA 1K8IB 2EZ0C 3KPPB 1QSEE 1SVZA 3GH4A 3IFNH 3LEVL 3MRJA 4OZIF 3MXVH 1NMCC 4M93C 2WZHA 4AMCA 1RUPL 1TFHA 3T0EC 2QPUA 3PDOA 3TN0A 5SWQA 4JFFA 5C86A 1G7PA 4RZCB 2DS4A 3AS3A 1RIHL 3W39B 3K7UA 4Z0BH 3ZJKA 4KKBC 2AK4E 4X6CA 1UB6B 4U6VH 3N85L 5DD3H 4J3VA 2BVEA 2J78A 2CDGB 3WSQL 3I2CL 5L8KB 5FKYA 4XUYA 1QR4A 4HIIA 2AAVA 3L4WA 3RL1A 1T22A 3HNTL 3K4ZA 3QEUB 4GG6E 4CNIA 1TVHB 4LSQH 1CE6A 3L4TA 4FP8H 3FO1A 2C7UB 1CFSB 3O3AB 5DJCB 5BQ7A 2AV1B 4QT5A 2OK0L 3WKML 5ALBL 2XY2A 1FV1B 1UM4L 1YPZB 4X0NA 1Q1JL 2Z8WC 4URTB 3HAEG 4LCUB 4NM4H 3WN6A 3WL1A 2FO4A 4UV7L 1K9DA 4M02A 4X5WA 4UDUA 1YDPB 1F4XL 5IFJB 1MFDL 5ID0B 4DO6A 4QCFA 4DN4L 2A3HA 4QLJA 5AC4A 2NPLX 3I50H 1G7IB 1X5YA 4TVPE 2WMHA 3V0WH 3VD3A 3E6HB 3GHBH 3LMJL 1VPOL 4KVCH 1AI1L 4PRAA 3J8F7 1QG3A 2OX5A 3FO2A 1DUZB 1BPVA 2YOCA 3HCVA 1OT2A 3EJRA 1ZGLA 4PJEF 1IGJB 2OL3A 4YFLI 1FVEB 3BRGC 3HNSH 4NXSA 1KCRL 3DJ9A 5SWZE 4WO4D 4W81A 4XMLH 5I30H 1Q72H 1B9ZA 1WO2A 1KV3A 4LIQE 1S9YA 3DV6B 3WMBA 4JFPB 3SKUD 1LO0H 4G7YH 3VXSD 4PTVA 3AAZA 4HUXA 3WFCL 4D3CH 1IL1B 4AT6B 4P8UA 4XPGH 3OMZA 1BD2D 1ZE3C 4NO5A 2J25A 4OUEA 3HKFA 4D6FA 5JZ7C 4J2XA 5FO8B 3P0YH 3RBSA 3WUWB 5IB5B 3EOBA 2YPKB 3MV7B 5CEZD 1DQDL 3G9AB 3JV0A 3PDGA 1XH2A 5F3HA 4CJ0A 1MRFH 5IWLA 2PR4L 4E42B 4PJDE 5E94A 3HZKB 4LSVH 4FNSA 1T4KB 1MHHB 1CXEA 3BGFC 1Q94B 1IGMH 1IC5L 1OD0A 2C3VB 2IFGA 5TF1H 1W72B 2X4TA 1LEKB 3WMCA 1EEZB 1U8OA 3QWOB 4XP4L 4P5KB 3S34H 3KYMB 2MKWA 4YDJA 4CCEA 1HNFA 5GGUA 1DP0A 2ATPB 4U6HA 4S1QL 3WIFA 2P5WB 4I3SH 2WBJD 5EU5A 2NMSA 1A6VH 4PY7A 3M07A 1S7UB 4HFWA 3DVFA 4HG4J 2AV7B 2HFFB 3IFNL 1K6QL 4ZEPA 2COQA 2W07A 1T2JA 2YZ8A 1IQDA 4XCEB 5IKCB 1AHWB 4D94A 5CKGA 1WCBB 4KRPC 1NAML 4UNUA 2C0HA 2WMIA 3ALFA 1YEJH 1TETH 2G9HA 3RL2A 2G75A 3AU1A 3MGOA 4Z0BL 2YKLH 1DBKH 4Y16D 2GJ6B 4PRDA 5FO7A 1OGGA 2D7OA 1TZIB 4DKFL 4JJ5A 3WS6C 5F6HJ 1TQVA 2F18A 3UJIL 1KLFA 1T1XB 1QBMH 4NDMA 5DHVA 1FAIL 4X6BA 3W27A 1JPST 3AI0A 3BUYB 2BSSA 2DQDL 4FP8L 5K9KB 4XP9L 1U92A 3AHVA 2DLFH 3MXWH 4P3WA 1F11B 1J1OH 5CPSA 1X9QA 4P2RE 4KI5C 1OSPH 2EYTB 2C26A 2W60A 4GUPB 2F53E 2XACC 2EIZA 1Q0XH 2WVTA 2XVPA 3TNNB 5A6JA 3K81A 1HZHL 1UB5A 2HTLC 2R29L 1G9ML 1SMAA 3B5TA 3GUTA 3GHBL 1J0YA 1U8LB 2FGZA 5D8JH 3HMXH 5ENWB 4PMYA 4TQEL 4WDIA 4GAGL 1WDQA 3WUWG 3N9GH 1ORSB 1NC2A 4FS0A 2QQNL 4JFDA 4ODTL 5H8DA 4NQEB 3MRRB 5L2KA 5BCAA 3A6BL 3MNZB 4J1UA 4HIHB 3PWPE 4XPHL 3KPLA 5I30L 5DEGB 5IROC 1A6UH 5IFHH 5INCA 1X3DA 2EH8H 1T1ZA 2J8UE 2Q86B 4HK0A 4LCWB 3TH4T 4H20H 1I1CA 1SR0A 3SDDA 2BVQB 4GXUN 4LLUB 4H8HA 3FFCB 1UR4A 1VACB 2X9WA 2EDXA 3HAEA 3P0YL 5I74B 4AEIH 4NOFA 1J05B 3ZKXB 4MQTB 3ZT6A 4D2NA 5CLWA 1CI5A 2VERN 3C5JA 1FZJB 3GBNH 3U4EA 4H8UA 2ADJA 3IFPA 5TFSL 4BM7A 1FRGH 3ZE1F 4LLWA 2E40A 1ZA3A 4HH9B 5EOTA 3CLFH 5J1AA 5CEXB 1SYVA 5TE7L 2JEQA 1N7MH 2J75A 5CPQA 4XXCC 5LJYH 5A2JH 2QMJA 1IGML 4LAQL 3UMTA 3NSXA 2V9TA 3QJHB 5TF1L 1DDHB 2FR4B 3VFGH 4FQ1H 4QF1A 1X6NA 2L0DA 3VIMA 5HHPA 4X4XB 1A6AA 1PVHA 1BEYL 3G6AA 1EGJA 4CN1A 3REVB 1AXTL 3KXFE 4K68A 4W8BA 3F7YA 5IHRA 1E4MM 1MVUA 5IHUL 1G7MA 3FQXA 1P4IL 4IRZH 4BQ2A 3QQ3A 1ZHLB 1G5AA 1MCOH 5ABFB 3SDYH 4IJ3C 4KVNH 4EXPX 2ESCA 1H5BA 4PJAF 1MF2L 5LWYH 3BRDA 4MS8C 4XAKD 1OGTB 3T0ED 2HJLA 4ZOCA 4JPIB 5ICXA 3UETA 5JLZA 4Q2ZB 5C9JB 2F54A 4V2BA 2WVUA 1YEJL 1JV5B 3GRWL 1B1YA 3MCG1 5AD0B 3LS4H 1TETL 5HYQA 3O2VL 5I8KH 1FIEA 2BSRB 1BFOA 2XICA 1VDGA 1DBKL 2DQEH 1RUQL 5L0QB 1KIRB 3LRMA 3D39D 4J4PA 4NWTL 5A8PA 5IFPA 3EOAB 3BW9B 3SQBA 2GHWB 1HP4A 3DIFB 4BS0A 4IOFC 1W9DM 1UENA 1WBYA 1DBBL 5AWNH 1BQHG 1GYAA 1A4JB 4JQIL 1SMOA 4HT1L 3BDXA 5SX4H 4JLRB 4PJGF 5GGSB 3G5VB 1F3JB 2CLZB 3LPFA 4RZCA 3V6OE 4LLYA 4P23D 3E8UL 3W39A 1N2RB 1NSNH 3RJQB 3MXWL 3OKLA 3PZVA 2CDGA 3REWA 5I1LA 4Y5YC 4ALAL 2UV3A 3PWJB 1V02A 3CHDA 5D72H 2O9PA 1FNAA 5FIPA 3IAQA 4OUUB 3NCJH 4ZFGH 3EJTA 4YAQB 3V4UH 2DJSA 4CKQA 2FB4L 3BAIA 4MDOA 1OSPL 4L8DB 1MJ8H 1TVHA 1KB5H 1Q0XL 1WLHA 2FIKA 5HVGB 2JK5B 3UTTA 3WKNA 2J62A 5EUKA 4DK3A 1AFVL 2XN9B 4ZTPH 1CFSA 2HRPL 3OR6B 5E9DE 3DXAD 3QP3A 1LK3H 1OD8A 2I07A 1FV1A 4JFEE 4TN9A 3U1SL 4LCUA 3H54A 3HI1B 1DBJH 1BPLB 4L3EE 2V5MA 2ZCLH 3RY4A 1YHTA 2IANB 1FL3B 3L5HA 1K8DA 1JK8A 4D6JA 3V52H 2DLIA 1WZAA 5D2NB 4UNVA 3E6HA 3NOIA 1FYTE 4LEXH 4QO1A 8CGTA 1XGYH 3FONA 3UTZB 3WELA 5GRXG 1DUZA 4H20L 4JGMA 1WAAF 4LVHC 3VXUA 2Y5EA 3S8WA 4K3GA 1MCKA 5BRZA 5FF6A 1FVEA 4N8PA 1D9KA 5I8CA 5E03A 3DV6A 1OP9A 4JFPA 4HWZA 2AXGA 5HD8C 1YMHA 2GFTA 2OZ4A 4NZUH 2EQDA 2GAZB 3B2UD 5F96H 4R0LB 1IL1A 1A9BB 1N7ML 4PSPA 1EA9C 3SCOA 4HWEH 3KPRD 3IVKA 4UQBA 1VESA 5DQJB 4FQ1L 2V5TA 2VZ3A 3BN9C 3TPUA 4LOUC 4XB8A 3WUWA 2VI0A 5IB5A 4WU5A 2YPKA 3MV7A 2GY7B 4WEUD 2GDVA 1T7WA 2VABA 5GGVH 4UZSA 4E42A 3UTPE 4MAYD 1CLCA 5CMAB 3V7MA 2BNQD 3CZLA 5D2LF 5D4YA 4KVNL 1MHHA 3GMRB 3LEXB 5EULV 1NAMB 3U36B 2RGLA 1W72A 5ETUA 3U4BL 1CF8H 1KTCA 5D7LB 4BQ6A 1EEZA 1FJ1B 3L3KA 1NBQA 4RGMC 2VSCA 5GRVK 1YEHH 4P5KA 4CDHA 4MA1B 1E6SM 4MAVA 4POUB 3VRIA 2ATPA 5JHLH 3HI5L 3WIHA 2A6IB 5SX5K 2P5WA 3FB7B 1T66C 1M7XA 5MEQB 5I8KL 2WLZA 4YBQD 2DQCL 1W1PA 2ZX9A 3DHJA 1E5NA 1NMAL 1O6IA 3F7PC 1XV8A 2BVUA 5IGXH 3IT8D 2XQYG 3KYAA 1JWMA 2AJXH 4OFYA 1YEEH 4XCEA 5IKCA 4KHTH 1AHWA 1ZTXH 4JFXB 5GGVY 3U9PH 2VDRH 1WCBA 1YJDC 3VFUA 1BVKB 1R3JA 5KS9B 3OKMB 4G8GE 3KYNB 2GY5A 3AIVA 1UWTA 4RGOH 4PR5B 3BDBA 3UR8A 3MYJB 2GJ6A 1FH7A 4CL7A 3VRLF 2EDHA 3PGCA 1DEDA 4U2ZA 2Z0BA 1X5LA 4MZ3A 4HUWB 3V4UL 1T1XA 3KLAA 3PP4H 3BC9A 5DTFA 1BLIA 4YXLL 2Y5TB 1FLTX 5D1XA 2NY4B 4HPOH 4ZODA 5F7NC 5JORB 4Z95H 5BXFA 1IQWH 2OMBA 3QH3B 4MNHA 5E56A 1EVUA 2FLRT 5B4MC 1B3ZA 1LK3L 2ZOKA 1KLUA 5F89A 3MNWB 2AEQL 5E6YA 2XVNA 3F6LA 4XCFH 3EJUA 2ZCLL 2H9GB 3QDHA 3W9DA 3VIPA 4PJBE 5E2WH 4LK4A 2EYTA 2GCYB 3H3PH 3TM6A 1E6OH 4OF3A 5D7KD 1A3QA 3BVXA 2ZG1A 1BQHA 1PKOA 2OSLA 1IEBB 3OKOB 4O5LH 2WC4A 3DVGA 3VMPA 1XGYL 3P4NA 3DC0A 5ENWA 2KQNA 4G6FD 4FXGB 1A1MB 1FG2B 3O6ML 1ORSA 5C0BE 4OLYH 4TVDA 1IM9B 5KN5A 3WNKA 3HB3D 3MRRA 4NQEA 4NUJB 2EYRA 4OCWL 1WISA 3LAFA 4S1SH 5J11C 4EQ3A 1AQDB 5F7DB 2D4FA 3DX6A 4K2UH 2GJJA 3T0DA 4Y2DA 2C1OA 2VSDA 2WBGA 3DMMA 1W9XA 3O45B 1B6DA 4JRXA 2W91A 2X4RA 3V4PH 2BVQA 5AUMB 3FFCA 5L9DL 4C54A 4L4OA 4PRNB 3CPUA 4A2MA 3IU3B 5D7IB 3V79C 1J05A 5DC9B 3O3BB 4TULL 2JJTA 1XZ0B 3H9SA 5GPRA 1Q6GA 1SJHB 1SEQL 5GGVL 1P84K 3EJZC 2E4TA 4LNRA 4PGCB 2VDNH 1DUYA 3EJJX 5JQ6H 2X8RA 1XH1A 2FR4A 1D5BB 3V8OA 4X4XA 2X4NB 2NX5E 2V2XB 2H45A 3REVA 4BQ8A 3SDCC 1NCTA 3U6RB 2C7FA 4P2YA 1HKKA 4LYPA 1C1EL 2OP4H 1E1EA 1V0NA 4P7LA 2WKLA 3ZDXF 5JHLL 3LEYL 2N56A 3F7VA 3QIUD 1CDIA 5DVOA 4CVZA 5TE6H 1H3PH 1K4DB 2BY2A 3TBYB 1NFKA 1AMYA 2VLLB 3O0RH 1JZ8A 5IGXL 2UY6A 1OGTA 1M7IB 1U8QB 4JPIA 2YIHA 5ESAA 5EU4B 4ZXBD 3WD5H 1ZTXL 1JD9A 3UBXB 3RTQB 4MNLA 2P5EE 1JV5A 3MUZ1 4NC2B 4UQAA 1T7ZA 4X6DE 3R8BB 5FECB 1NMCB 1JG9A 4TVCA 3FO9B 4RGOL 1HCVA 2BSRA 5IP4A 1KTBA 4M8UA 5BZDA 1QBAA 5GS2H 2JEPA 3EOAA 2O61A 4KU1A 5EIVA 3DOSA 4XPFH 3P4OB 1MCWW 3PP4L 3OA5A 4X0KA 4ZFOB 5H35B 1T1YA 4AZ8A 5EU3B 4Y5VB 4KK8C 5GGSA 3POHA 5J6HA 2O5ZL 2Z31B 3VXRB 1NPUA 4KI1A 2ATKB 5BYWA 2VH5L 2F74A 4XVTH 3PWJA 3NA4A 2YPLD 2P7TA 3N15A 4C7FA 4B7LA 1ISVA 4KJYB 4YAQA 2OI9C 2WMGA 1IJ9A 1DCLA 5E2WL 4L8DA 4P48A 4PTTA 2UYLB 3MMUA 2Y07H 3PF2A 1E6OL 3ALPA 4I9WD 1UQZA 5GHWH 2JCCE 2RAMA 4KMTH 4QOKB 1BFNA 3THCA 5EOQH 1HJWA 4OFDA 1Y6MR 3V6ZB 1CDJA 1OF2A 2VLRD 2DIAA 3ARBC 1PZ5B 3X11B 4FNRA 1JZ5A 2NY3C 1AO7D 1GIGH 2F8VA 3UTSE 1GGCH 3HI1A 3N13A 5C0CE 4JQVA 5H37G 1OIFA 2IANA 1TNNA 1JF1B 3GSVA 1FL3A 1IAOB 1MQKL 1NFDB 3EYUH 1IGIL 5FK9A 5IQ7H 3OF6A 2HYMA 3LQMA 2HT3C 2MSPA 1I1RA 2CBUA 4ODVL 4M1GL 2D7MA 2JB6B 4LOUD 1D5MB 5KAQF 1C92A 5IXEA 3QWQB 5DA0B 3PV6B 5JDJA 1KJ2H 4UINL 1I7TB 2R23A 1MI5E 1QHZA 4PGZA 3WF3A 3RVUC 1OTTD 4HX1B 4FZ8H 2GAZA 2VDNL 2DQIH 4HKZB 3V5KB 4R0LA 1A9BA 1XYZA 2WK2A 1S8DB 3X12A 4CADB 4LHJB 5FA3A 1KELL 5DQJA 4NQDE 5I17A 4GQRA 3VCLA 5I1KH 3UBXG 2HJFB 3VXSA 5JW3H 1FP9A 3QO0B 1T66D 2OP4L 2XFXB 1F6LL 5B38B 4PJEA 2FJFA 5IMLA 1NWRA 1MJ7L 1BD2A 1IEAB 5F1IB 3D69A 1UEYA 3DWTA 3B6SA 3WQ8A 1CFNB 3L3HA 4M6NH 2AEWA 2L4OA 3GMRA 4JFQA 3O0RL 5E5MA 1NAMA 4WV1A 5C0DB 1TJGH 3U36A 2XM2A 1UH4A 2B20A 2FNBA 3AXLB 5D7LA 2NZ9D 4CMMA 2GVYA 2FGWL 1FJ1A 1J9YA 4GI8A 3QRGH 3R1GL 2AJZA 1VJSA 2D0HA 4Z7VE 3FQUB 3FB8B 3SUWA 4Z78A 3QUZD 3FB7A 3WMSA 5MEQA 4W85A 3DECA 1GZPA 5CGYD 3O81A 5HHMD 4KRPB 4JRYA 3RY6C 4S3KA 5DDHB 5IJKC 4YHKH 4UNIA 3MO4A 3RJYA 1BQUA 4IDLA 4EXKA 5JDSB 4RAVB 1VA9A 1BVKA 1JTOA 4F7CA 4LSUH 3IJ8A 1REIA 2I25N 3OKMA 5C0NC 3VMOA 3KYNA 4DW2L 4PR5A 1QSVA 2X1QA 3MYJA 1CE1L 1YPZF 3W6MA 4LSSL 3T4YA 4B7IA 1OAKH 4CKVX 4RMQA 4HUWA 2YC1B 1YJDL 1OAQL 3Q1SH 2Y07L 2Y5TA 3CFEB 5GXBB 5GHWL 4Y16A 1C8PA 4LCCA 2CLRA 1E4IA 1EOMA 1X5ZA 2E3VA 3LMYA 5KANG 3TO2A 3EJPA 3A5VA 2NZIA 3L4XA 4S11A 2CMRH 4RMVA 3W5NA 2RFXA 1B0WA 1I85A 1RZFH 2M1KA 1SYSB 4EDWH 1HINH 2EO9A 4E8CA 5C8BB 1R46A 4HCRA 1ODUA 1QQDB 4K9EC 2FHBA 3EYFA 1C8QA 1A2YB 2NTFB 2DTML 3AZSA 1SBBA 1JZ4A 1QNSA 3C8DA 4NZRL 3UAJC