6CGTA

Hoxa complex of cyclodextrin glycosyltransferase mutant
Total Genus 221
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
221
sequence length
684
structure length
684
Chain Sequence
DPDTAVTNKQSFSTDVIYQVFTDRFLDGNPSNNPTGAAYDATCSNLKLYCGGDWQGLINKINDNYFSDLGVTALWISQPVENIFATINYSGVTNTAYHGYWARDFKKTNPYFGTMADFQNLITTAHAKGIKIVIDFAPNHTSPAMETDTSFAENGRLYDNGTLVGGYTNDTNGYFHHNGGSDFSSLENGIYKNTYDLADFNHNNATIDKYFKDAIKLWLDMGVDGIRVDAVKHMPLGWQKSWMSSIYAHKPVFTFGEWFLGSAASDADNTDFANKSGMSLLDFRFNSAVRNVFRDNTSNMYALDSMINSTATDYNQVNDQVTFIDNHDMDRFKTSAVNNRRLEQALAFTLTSRGVPAIYYGTEQYLTGNGDPDNRAKMPSFSKSTTAFNVISKLAPLRKSNPAIAYGSTQQRWINNDVYVYERKFGKSVAVVAVNRNLSTSASITGLSTSLPTGSYTDVLGGVLNGNNITSTNGSINNFTLAAGATAVWQYTTAETTPTIGHVGPVMGKPGNVVTIDGRGFGSTKGTVYFGTTAVTGAAITSWEDTQIKVTIPSVAAGNYAVKVAASGVNSNAYNNFTILTGDQVTVRFVVNNASTTLGQNLYLTGNVAELGNWSTGSTAIGPAFNQVIHQYPTWYYDVSVPAGKQLEFKFFKKNGSTITWESGSNHTFTTPASGTATVTVNWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate binding to a cyclodextrin glycosyltransferase and mutations increasing the gamma-cyclodextrin production.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
total genus 221
structure length 684
sequence length 684
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1998-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 6cgtA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 6cgtA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 6cgtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 6cgtA01
2GSIA 3BPOB 4CAGA 1HDMA 3Q5OA 5BZDA 1LE9B 3OBAA 1NWTA 2EIZA 1DR9A 3EYSL 2XN9B 4YXHL 3MCG1 4FXLA 2CPUA 1MRDH 4OSUL 4JPIA 2G60L 3IFPA 5K9KB 3BC9A 3FOMA 3RMEA 3BP4A 3C5ZD 1YEDA 5C3LD 1QSFE 4L4PA 2ARJB 4HS6A 3AZSA 1A2YB 5IF0A 3STZA 1LWHA 1F13A 1BTCA 3M1BA 5KJRH 4WLCA 1PIGA 5D9SA 1GRWA 4N0FB 3HC0A 5ITBL 1GHFH 3MO1A 5I78A 3DV6B 3VXMB 1A3RH 5FHBH 5HHOA 3L3HB 1H8NA 4O58L 4OOUA 3MSDA 4KVCL 4DQOH 1T20B 1YYMH 3NUKA 2CLVA 2W67A 5CJ5A 4MA3B 1UWQA 2EIZB 3MJ9A 1ISWA 2XRAL 1KBKA 1SEQL 3T3PF 1A3RL 3UTTD 3T2NH 5FIEA 2W0KA 3RNQA 2XACC 3QDJE 4DQOL 3CDGA 2AXGB 1CECA 5EOTA 4HUNB 1F02I 4H20H 5ENWB 3BPLB 4G7YL 4RZCB 4KY1H 2G4FA 3VFNB 4BM7A 4JN2B 1FG2A 2EE2A 3O2VH 1FH5H 1GOQA 5D6CB 1KGXA 4TSCL 4PSRA 1ZS2A 5C9JB 3UCQA 2WLYA 4U1GC 1RIVL 2XYCA 5JPNB 1E5NA 3CFCL 4EUPB 1EXUB 2OL3H 2H9GB 4LCUA 5CJBA 3IFOB 3MRBB 4LSDA 2B4CL 5FO7A 4QRQA 5M3WA 4K7PY 4AIZA 2XWDA 4DVBB 5FDWA 3OKLB 5HJ3A 3VFTA 5FYJE 1R3HA 4K3EL 3APGA 2BNRE 5CMAB 3MUJA 1JAKA 4R0LC 2BNRB 1C5CL 3DWTA 3RWFB 4TOYH 2PYED 3KEHA 3A67L 3PP4H 4TSAH 4WKHA 3GSXA 5E2WL 1P1ZB 5CJOL 2R29L 1C08A 3MRNA 3SCMD 1RZJC 5C0AB 4PV8A 1KXQE 1CD8A 2P49B 3VE0B 5EOCL 3MUGA 4ML4A 5ACZB 1US2A 1WKYA 4ZQKB 2P46B 1FYTB 3RWHA 4HGMA 3WL0A 3D87B 5F44A 2XN0A 3Q3GA 4P2QB 1UH2A 3NMEA 5LGJA 4QHKJ 1FQ9C 4X6DA 5BS0E 1QEWA 2DT0A 1EAJA 1I9RL 1QR4A 4NNPL 2FATL 1FRGH 1JGDB 4JCMA 4MAYA 5JUVA 4CD6A 3U4EB 1M03A 4KI5C 3VXSD 3WMSA 5C0NC 2XQYK 3PF2A 1KJ2H 3VWJB 4WJXA 4NN6C 1QSFD 4G6FD 1SJVA 2O61B 4S0SD 2H1PL 4UQ3B 4CNIB 1AD9A 3RTQD 3HZMA 4G6MH 1KJ3H 3H9YA 4WCYL 2ZUUA 4WF7A 4OAWB 2GK1A 5CPSA 2R69L 5DJZB 2UZIL 4P5TD 4P7OA 2WPGA 5HYJB 1CFTB 4BZ2L 2RAMA 1KR0A 2VIRA 2YBRB 1TZIB 4PFEA 2YD1A 1LILA 1JZ7A 3MFFA 5D7JB 4ZNEE 4LVNC 4L8BB 1B6UA 3IJHB 2Y72A 2ESVD 3SGDI 2APBA 2BNRD 1KPUB 2M1KA 4TVUA 3ZR6A 3WF0A 1LK3H 4PJFF 5FUZH 1ZEAH 1LEIB 3W9DA 3ZL4L 1KULA 3OXRA 3NA9H 1CFVH 1BAFL 4ZXBA 3Q6FA 3GRWL 4Z2GA 3DYPA 1R24A 1TFVA 2JIXA 4BUHA 2A6DA 2V7NB 3KPLB 2PWGA 1B0IA 4MNHB 3P77B 4ELKA 3IVKB 1GW1A 3U5YA 2I9TA 1BX2B 3AU1A 5EUKB 4AIUA 3HNTH 3H9HA 4YHKH 1S7QB 1YY8A 1YQ2A 4Y19D 5C09A 2NR6D 3HFML 4OUUA 1H3WM 1X6NA 2W9DL 4IOFD 4QNPF 4FNRA 4KTEH 1I8MB 5GRJL 3PIQB 3WH9A 4YHPB 1Q6DA 3ZJKA 5LQBL 1CDIA 1YPZB 2DMBA 5IP4A 3D39B 4GXVL 1ZHBB 3S97C 1EEZA 2EEAA 4NM4L 1P2CA 1J8HE 3MBXH 1ZLVK 5J3HC 5FCUL 3UEQA 4ELMF 5CLTA 4MHHG 2NQCA 4W93A 5KEZA 4MNQA 4NGHL 3SKMB 2PO6D 2BVPB 3GH5A 2MKLC 4HK3N 4KJPD 3DGGB 2PNDA 4NRZB 3P0GB 1U8KA 4TTGA 2DH2A 2WINA 1GHSA 5F88B 5D7KE 4XC3L 4EQ3A 2MCPL 4K9EH 4PJFB 3S88L 1W8OA 4XNQA 5DFTA 2X9WA 5D6CA 4P2RA 1S9YA 2J8OA 4HIJB 5JXAL 2VDRL 4XP1L 4XPTH 5JW4R 5CXPA 2GTWB 5I8EA 3MV8E 1L7IL 1VESA 2VLKE 2VQ1B 4X5WA 1BVKA 4OM0L 3CUHA 5DFVC 3BVNA 2IGFL 5EZIH 4L29A 4JPVH 2ARJA 4HS6B 4XMKL 4X6FB 4AEFA 3P4OB 1UHVA 3IK2A 2ZUMA 1MQQA 4GLRI 1MCBA 2NY5C 1AVAA 1E9LA 4DK3A 1WZMA 2GK2A 4PJIA 4F7CA 3OKOA 3WEOA 3U7WH 2DIJA 1BJ1J 2AQ2A 4R96B 2E9WA 5DRWB 4RDQG 4ZAKC 2C8NA 5MEQA 3GB7A 4S1DC 1OL0A 2Q3AA 5GRXG 5C1MB 4JG1L 1NCDL 3VXPB 1YNKH 1BGGA 3LPWA 4YHOL 4F8QA 1I9JL 1T0PB 3SGJC 3N12A 5FXCH 1A7NL 1KB3A 4NRYA 4QRRD 3CVHB 3RL2B 3R8QA 5JMRA 2NY3B 1EHNA 3BH8B 1WISA 1GPOH 2DQTH 4J2XA 2DM4A 5GIRB 4XMLH 3AHZA 1W2VA 3V52L 4OCYH 4PJ7F 3SDDB 2V9TA 2WBJB 5GGUA 4Q9QL 3LV3B 1U8NB 3VDBA 2C5DC 2BNUA 3PQYE 4HWZB 3MNZB 4KDTC 3TNNA 3CLWA 3M7SA 4GRMB 1U3ZA 1AO7B 1AJ7H 1QR1A 4FXGA 3NDZA 2BVDA 2XFXA 2AEQL 2VLKD 3M8OL 1ZHNA 4WHCA 5T1KD 1YJDL 4KQ3L 5CJQL 1NC4B 2VE6A 3UDWA 3CVHL 3FCTB 2R23B 9CGTA 1D5MB 4LHQB 5A2FA 4XPAH 4NQXA 3U36A 1RMFL 4MLIA 5C7XH 1T22A 4G9DA 3WJJA 4JHOA 3O2DA 4JCLA 4MTVA 3TVMD 3RVWD 3N06B 3H3BC 4G8IB 3I6LD 4ZE5A 2WHLA 3NFSH 4U2YA 2NX5B 4XI5D 4G7VL 3VW3L 3R4DA 5IESL 2OTUA 1CE1H 4WHYG 3T0WA 3TBVA 2YJQA 2Y6SD 5C9KA 3GUTA 2ATPA 1D5MA 3D3VD 1WAAF 5F1NB 5F96H 1ZGLA 5DUMH 3QXDB 1GGCH 2J2ZA 1YN6A 1JYNA 2AGJL 3O3BB 4IIQB 4RMQA 2BY1A 1FBIH 4Z7VB 4D0CB 4PLKC 3BN3B 4P23A 1OCQA 4OF3A 5DZOA 3SCUA 1IAIL 3S8WA 1NFDA 1F6AA 1FJ1A 5E08L 2WAGA 4X99A 3X3FH 5FD0A 2NXYC 5HVFB 4PY8J 5J57B 1UD3A 3RJDA 2CBIA 3BW9B 4J3VA 4DWSA 1HH9B 1Z9SA 2ZJSL 1A7OH 3GBLA 2GAZB 3CUIA 2X1XR 3A47A 4QYOA 1NUFA 1VDGA 3MJ9L 3SKOA 2IAMD 3KXFA 2EYTA 5ALCH 3UTQB 1NPUA 3O6MH 1AO7D 4YC2B 1UD8A 3MV11 4XPFL 3F7VA 2FBJH 4OFPA 1E4KA 1FIGL 2ICWB 1QSVA 1LD9B 3ARTA 4ZXBD 1FNGA 3WFCH 3SY0B 1TTGA 4LOUD 4HFUL 3EOTL 3LKSB 4CU8A 1DZBA 3BWAB 1UH4A 3KLDA 2DI7A 1RJZA 2W60A 3R1GL 4KDVA 4OF8A 2VAAB 3R0MA 2Y23A 2FGWL 5FUCE 3FMGL 4NUGH 1B3WA 1E6NA 3AFBA 1NFDF 2OWCA 4KROD 5I1EL 1WZKA 4AJ0A 5I75B 3AMGA 5C09E 5EC1B 2V2TB 2ICWA 2NY3C 4OLYL 4C83B 2J3SA 4C7FA 5TFSH 4ELKB 4OUUB 4GMSH 4Z2HA 2CKBL 4NM8H 3SQOH 4R97C 2X1WL 4TNVF 2OP4L 4U0RC 1J88A 5DXWA 4V27A 2UY2A 3V0VA 3VXNA 3G6JB 4MNQE 1KQYA 5HHXH 3SKNA 1QWUA 4Y5VA 4NKIL 1DLHA 4HJJL 5C07D 1U8MB 3PTMA 2R0KL 4I0CC 3UYRH 4PRIE 5MEPA 1KJ3L 2D20A 5CWSA 1G1YA 2ZG3A 1KB5H 4NRRA 1AR1D 4WCYH 2RFXB 1BQSA 4CDHA 3RI5K 1XIWA 1QKZL 5KSBE 3GXDA 1XZ0B 4I0PC 5AUMB 4JEGB 1RAMA 1XH1A 3QZWB 1PJ9A 3QISA 5I71C 3IU4H 3HE7B 5DD0L 1CZ8H 3U9PH 3QGVA 5CSUA 3MV8A 4KMTH 4L9LA 4E42B 1MREL 4DOHE 1KV3A 1GJIA 4OFVA 4XCNB 5ANMB 1Q1JH 3NTCH 1WDPA 3MXVH 4YZFF 3MODH 3KLLA 4KRPC 3QA3A 3QDGA 1JZ4A 3IS1X 1B2WL 1MAJA 4YO0A 3W39A 4JHAH 5C86A 3T1FB 4HXAH 4J8RA 2ATKA 2X6MA 1C1EL 2B4CC 2AABH 4Z7WB 1DVFD 3PE9A 4NKMA 1KENH 2XT1B 3IFNL 3GH4A 4NBYB 3KE0A 2R23A 4PJAF 3D3AA 1FDLL 5FKYA 2NZIA 1WWAX 5GISH 1ITCA 1HYRC 1W0YT 4UR9A 3MRQA 1NDGB 3TZVA 1LEGA 2IBZY 4ONGL 2BCKB 4ODTH 2D31A 4IOFC 1KCRH 2GITB 3HPLB 1B30A 2BOCB 4YO0B 3RIFK 4U6HB 1JPGB 4LBEB 2F1BA 4F58L 2FGLA 3AS2A 5CBAA 3P9LB 4JVPA 2DSUA 3JV6B 3MLXL 4QRPD 4AD4A 4KV5E 3T04D 3V5DB 3BD5A 3L95A 3U4AA 1A3LH 5FL1A 1N64L 3IDYC 3QFJD 3OGVA 4U6YB 3WEZA 1IGFH 4HUUA 3TP4A 3PUCA 1U8LB 1T1YA 3QJHB 1KGCD 1A14H 3O41A 5D2LB 5E8DH 5E1AB 4U6TA 5I15H 4BUGA 5IROC 3F65A 1BFOA 1QVOB 2GJZA 4HWEH 3QIUA 4PJ9A 5E5UB 4YFLF 5EOQL 1B1YA 1ZBCA 3ES6B 2IH3A 5BXPA 2VLRE 2HKHH 3KLAB 3MBEB 1P7HL 2XPKA 1MHHB 4U1JA 1O7AA 5C3TA 3X12B 2I07A 4JM2B 1DE4B 3U7YH 4QCFA 4CW1A 4NWTH 2FO4A 3TTSA 1D5IH 3EYPA 1E0WA 1Z3GH 1K9TA 4RQQA 4QOKD 4NQDE 1HKFA 4LLVB 3S96B 4D6EA 1DL7L 3LN5B 1GGTA 2G5BA 4O51B 3TA3C 3I6KB 4Y4FA 3BIKB 1UJ3C 4R97B 4H0HB 1AXIB 1BD2B 1RJLA 4Q9CA 1MIEL 1YY8B 2OZ4H 3GKZA 3HJEA 4PTTA 5DWUL 1IGCH 2GJ6B 2Y24A 1OAYH 4TNWK 3TH4T 4M5ZH 4KPHL 1DANT 2CDGB 3LKPB 3PWPA 4WO4A 3PWJB 1UM4L 2YBTA 5DVMA 2X1QA 1M71A 4PRPA 6CGTA 3IAGC 3EYUL 1UZ8A 2W92A 3NIDF 5D7SH 1LL6A 1A7NH 3HPJB 4X4YB 5A2KH 3O9NA 4BQ6A 1IGCL 5L2KD 1CDBA 3LKQA 1G0DA 1EGZA 5GGSB 1V3IA 2Q8AH 2VR4A 4UAOC 5CBEB 4B16A 4JG0L 5D7LB 3HU7A 3MOBH 3DSFH 5I8OL 4KHXL 2F54D 1KT2A 3GIVA 1NGYB 3EOYG 3FQTB 1Z9MA 1JI2A 2DSKA 2W5FA 3MS8A 4K94H 1UJ3A 2EJ1A 5B39B 3PWPB 1IEBB 1UKTA 3H2WA 3UZQA 4L4VE 4OKVB 3T0AA 3FO0L 4QRUA 4KRPB 1A6WH 4UTFA 1SYVB 4V2BA 2EPMX 5E1HB 3AMKA 4E5XA 4OLXH 3QNYB 1ZT7A 2V5YA 1YEGL 2VQ1A 2AXGA 1LL7A 5ISZB 3WKZA 3SPVA 5D5MB 1ZAGA 3IDJA 3FL7A 2EECA 5EU4B 2V17H 3CPLA 1QFWL 3BAKA 4AXNA 4OD2B 4G43A 1FAIL 4M1DL 1DWJM 1S9XB 1XFPA 4IDLA 4WWKB 2NNAA 4HEPG 3VFGL 1DHKA 2DM7A 1JNHA 1BFOB 1HHHB 3MLYH 4NRXB 4RAUA 3GXFA 1UWEL 2X1PA 1WBZB 4WFHD 1V7MH 2UY5A 5IMOB 3RDTA 4JQVC 2EBNA 3QUKA 3GJFB 4WW2B 3U30B 1TA3A 3RGVB 1II4E 4TQEL 2VVSA 2HLFC 5BRQA 3EZJB 5DK2A 4B9ZA 1UA6H 5D71L 1MVFA 2MFNA 4NZDA 3IFPB 4FMFA 1HP4A 3GMRA 3I9GH 3L9RB 1P7QA 3TGXA 5FM4A 2NX5D 1UD2A 1LG2A 3JWDL 2DRUA 4Y2DA 5CJXA 1F4XL 4M1GL 1S9XA 2YRPA 2MNUA 4Y7EA 3QUMA 3ROLB 5DD1L 4LK4A 4YHOH 2VCCA 1CTOA 4IRJC 2EKSA 4XNMA 4P5TB 1L0PA 4UV7H 1R5VB 2ZUSA 1EPFA 4HKXA 4MX7B 1JF6A 3WLWC 3NIGE 4Y4KA 1X44A 2Y5TB 3UZEA 3VRIA 2J4GA 3WDJA 4XPBL 1P5UA 4Z7QF 3VGEA 3MUZ1 2HH0H 3P9MA 4XPFH 4LIQH 3ULUH 4DO5A 1X5YA 3BMWA 1A6PA 1KIQB 3ILPB 1LD9A 2WZHA 4GRLC 4JRYD 1R5IA 4QDMA 5BRZE 5D2LF 1U3HD 3BPLC 2WWCA 3W26A 4XB8A 5A16A 2BCKA 2G9HA 1IM9D 3MLRL 3K8KA 2JJSC 3G5VA 3WL9B 3VDCA 4DFIA 5IOPB 1A6TB 3FMGH 4GKSA 4S1QL 4PJCA 4N1CA 5DK0B 3MV7E 5EWIL 5C6TL 5KS9A 4GAJL 1OGGA 4GOSA 2Y2WA 1DANU 3RTQC 1WZLA 2B0SH 4XPGL 1G9MH 3HZKB 5IQ7L 5DA4A 1R3JA 1ZGLB 3F12A 2EDFA 4OQTH 1KCVL 1Q6FA 2UVEA 2BY3A 4JY6B 4POUB 2VRAA 3O9WC 1GXEA 2HVKA 3QOMA 3FO1B 3SCPA 3SCTA 2OP4H 3CFEA 1ZLUK 4QLJA 4R0LB 4XBEH 4XHQA 5IIEB 3LV3A 4O4YL 4UFMA 2Y7QA 15C8L 4JHWH 4LHJB 3C5ZB 3W0WE 2GTWA 4OQTL 2ZWLT 5E9DA 3BSZL 3S5YA 4GKNB 5K9QG 1S7UB 5E8EA 4AENB 1RHHA 2DD8L 2ERJB 5EA0H 1FHLA 3LRKA 3MRIB 2LAGB 2XQBL 3KPTA 5I19L 4HUWA 4ACZB 4X8JA 4R4BB 3KPMA 1H3UA 4X83A 2WVTA 2R39A 1N59A 2BMKA 1LHZA 3BSZH 2AOSA 4N5EC 5I1AA 2LVEA 3EAKA 1E4MM 1CVRA 3KJ4C 4ZO8A 3F5JA 5KOMC 3I2CH 3SE8L 1FL3B 4P8VA 1G6RH 1ZSDA 5AC5A 4YFDB 3QIBD 1OLLA 1B2WH 3UR7A 1YEHH 1NOWA 5GGVY 1I85C 3VXTB 4GZEA 4Y1AE 4P2OA 4HXAL 2EDBA 4PGZA 4GW1A 1RUPL 4J1UA 3E8UH 1HH6B 3P4MB 4KUZH 5J13B 2JKXA 3BIAX 4X6CA 3B5GA 3LSOA 5FO7B 3QNYA 3CFJA 1C5DB 3JV0A 3MRPB 2F19L 4HKJB 5F93C 2W9EH 3NVQA 3AJ7A 1DBAH 1FNLA 1KELH 1MAML 1FVEA 4PG2C 5D1ZD 5SWSA 5JLZB 5J3HD 1G7LA 2FDBP 3BP6B 3C5SA 4HUKB 5F7KC 2R1WA 5C0BA 4KQ4H 5LGHL 1V7NH 5J11B 1G6RB 3OKKA 4PD4J 3MLVL 3RFZC 2X2IA 4GPNA 5E00A 2GYSA 4OZHA 1T0MA 2GUOA 3DX4A 4RGOL 4I18B 1ZHKB 1QOKA 2D9QB 2HMIC 2YR3A 2FNBA 1AI1L 2Z31C 1AGFA 3TBWA 4QWWC 4Q9RH 2PUQT 1A3LL 2P24B 5HYJE 3BXWA 3IANA 4YHML 4PV9A 5AG8A 3NIDE 3V5KA 1OB1A 4JN2A 3O3EB 5D1QD 3T77A 1YEJH 4Z7NE 3CLFL 3KZSA 1WTGT 2XY2A 4N9GA 3I3BA 8A3HA 5CP3A 4MXQD 2A83B 1AE6L 4WV1C 3SE3C 3UROR 3GSQB 4U1SB 5IBUB 4CDGC 4UQCA 1NCCH 4MD5B 3EO1B 5KVFH 4V2XA 4U6XB 1U8PB 2XTJB 2UUDK 5TQ0L 2A3BA 4B5EA 8FABB 4JJHA 1R3KA 4DFHA 1WZ1L 5ICYB 3CX5K 2F61A 4GUPA 1MREH 4XP6H 5BS0B 2I5YH 1CWVA 1QPKA 4H5SB 1P5VA 4N0UE 1NANI 2ZICA 4P2QE 2YL6A 2BNQA 4X0NA 2YPKB 2WNGA 4Q9BA 2FD6L 4OCXL 4GLRH 1TQSA 1TCRB 1BZ9A 3BD4A 1WZ1H 4PRDB 3D39A 4RAVB 1P7QD 2XVPA 3LH2H 5CIPA 4UV4L 4FS0A 1P2CB 1L9MA 1QLFA 5ERWA 5HHQB 1NWSA 4TULL 3DMMC 1BSIA 3MCLH 4GKZA 1RH9A 1VCAA 1XV8A 1FOBA 6FABL 3ULUE 2VZSA 4D2NA 4AD0A 5E4IA 2DQXA 3NFNB 4FNLH 3KJ4B 3VXUD 4N0YH 2RGLA 4IUGA 4PG9B 2NY0B 4XUYA 1OAXH 3LCYA 5BJTA 1RU9H 1GVIA 4HGKC 4R96A 5TE6H 4F66A 3KL3A 4N8VG 5ILTH 3MJ8A 3TYGH 3OMZA 3OKDA 2PI6A 1R75A 3RO8A 3QUYA 3L4XA 4C56E 4HPOH 1L6ZA 3OB8A 4UINH 5C0CB 3C2SA 3T1FA 3RVWC 2X1IA 3MFGB 1OAXL 3GSOB 1I1AB 2CRIA 3RPKA 3UPRA 4PGCA 3T0VA 3ZMRA 3OKMB 5DEFB 1A14L 1S9WB 4U31A 4PMOA 3TTYA 1D9KA 4AEHH 2A3CA 5CSGA 2NYYD 2NY7H 2PW2B 4PG9A 4XZUB 4HWEL 3UBXA 3MV7A 4CGTA 5T1DH 1K6QL 1UM5H 5ICZA 1NLBH 3ARZA 2FB4L 1JHTB 2XZAH 4H1LA 3UO1H 2PBGA 4G42B 1VKXB 3W27A 1T7ZA 4TQEH 4LLDA 4I18C 1X4ZA 1FLRH 3QHZL 3VWJA 2WMFA 4TVPE 3X3GH 1RUAL 5IB4A 3OR6A 1Q0YH 5MHSE 1P7QB 4R7DB 2YD9A 1BAGA 4Z5RB 3OAYK 1ZVHA 1RULH 1UR4A 4Y2DB 4U5KA 4ZPTB 4HIEB 3AMDA 1FO0B 3LMJL 4D6GA 2WIIB 3EW3B 3H9SD 4P3CL 4OI7A 3EYQC 3OG2A 5GS1B 4GG6F 3MNZA 3SJVA 1QG3A 3MA7B 3O2DL 1EEZB 5D7KD 4GXUM 2XN9E 1OT2A 3D18B 1PBGA 2DT2A 3OL2A 1HDMB 1RK1B 4OZGA 4G7YH 4IOIA 4WTWA 2VXQH 5LCVH 3LMJH 3VFVA 5KSAD 2Q8XA 3CXHJ 5F9WC 1S9VA 4W7UA 3CZFB 2FX7H 3QXUA 3V0WH 3W11C 3BYTA 5C0RL 4G9FD 3AM8C 1BVZA 1CF8H 3VIJA 4AW7A 1QQDA 3MRQB 1RIUL 4M8QA 1OSPL 4LEOA 2HFGH 5SWZE 1O6IA 3VI4F 2JE8A 3B9KC 4K2UL 4EN3D 3L5WA 2R1WB 4S10A 5C0BB 5DQ9B 1LQSR 4PRBA 4M4PA 4OLVL 5DVKA 4HWUA 4HUVA 4RRPA 3WELA 5JUEL 4UB0L 3HCVA 1TITA 4CN6A 2GT9B 3DUUA 4Z2IA 4FQXD 4IMKA 4LPTA 4XPGH 1KIRA 4KUCD 4QKXB 2IG2H 3HI5H 3WMBA 2C3HA 3ARDA 2AMGA 1YMHB 5FYLH 4H0GA 5TGBA 4W6YB 2J7FA 1IM9B 5FYJH 4RCAA 4YC2C 5IJVA 1B3XA 3GMPA 4M6MH 3S36L 2CXKA 1YC7A 4B3KA 1FNGB 5E8OA 2W0PA 1NFDB 1PD6A 1I7RA 2JELL 3OKKB 2CH8A 3KWWA 3CH9A 3KG5A 3CZJA 5DJYB 3RWDB 4P23D 2DL9A 3DURA 4NHUB 3CFDA 4BQCA 2CUHA 4H26B 2P5WD 1QBLL 2AJZA 2A6JA 2ICEB 4X9HA 4ELMA 3T3PE 4JKPL 4DN3H 2J6EL 3DX1A 4LF3A 5IHRA 1GGUA 4JR9L 4QTIL 2NY4C 3QQ3B 4PCSA 1HSBA 1QO3B 1OB1B 3MROB 3MYZA 4LCIH 1C92A 4NC1C 4PB9H 5E4EC 5F72S 2JF6A 5A2CA 4X9BA 4JKPH 4DN3L 4EDWH 5HHME 3PABA 1TQBC 1HHJB 1I7TA 4W6WB 2FECL 3AMLA 1QSEE 4GQ9L 5DMGC 3GNMH 3HE6B 5DDHA 3SKNB 5HVWA 4LLUA 4FLSA 1BF2A 2ICWJ 4YDKH 1XRVA 1DDHB 2VX6A 4JFWA 4P2QA 2WQRA 1UKPA 3WH6A 3TLRA 1ZHLB 4FFZH 3HNVL 1EJOH 4FF5A 4ZNCD 2FJHA 2C3VB 5E2TH 4G6FB 1JDDA 3G9VA 1DEDA 3IJSA 3KPRD 5GS1C 3WS3B 4OFYD 2CKNA 2IAMB 3SKJL 2HVJB 5GRUL 2ZCKL 1JRHI 2ZG2A 3D9AL 1TJHH 5DC0A 1F45A 3MV9E 3BISA 4L8SB 3QUYB 5DK3A 2YPLA 4YXLL 5I18L 4LLYA 3DYOA 2Z1KA 5GRZA 4Z6AT 3Q0HA 4MWFA 1JL8A 5I74C 4ZENA 4WENB 4MD4B 3L3KA 3ESVF 4HJ0D 3AXLA 1HQRA 3LRHA 2ADGB 3PGCA 2ESVB 4S0TD 1A4KA 3SDDA 2FWOA 3EGSB 3MGTB 4MB1A 5LXGH 4GG8B 1OCWH 4MA8H 4YXLH 3VD5A 1BZ7B 3MNVB 4YNYA 4PGBB 2BSED 3PWJA 5I1CL 3ELAT 3WQVA 3GXPA 5KVFL 1LK2B 4UT7L 1N5AB 1MCLA 3KWXA 43CAA 3C08L 1YEKL 1EO8H 5T1LB 1BD2E 1OGAA 3CLEH 3HG3A 2OYKA 1T66D 5I76B 2UWFA 3GXNA 4AZHA 1AGBB 5FGBC 4DJMA 4U1GB 4IDJL 4NQDB 4DGYL 4W8AA 4JZOA 2YL5A 5GHWL 2ESVA 4FP8H 5CILL 4MNLA 1XZ0A 2FD6H 4G9DB 1UB5B 4YBLB 3ROLA 3CSGA 4JFXB 1IC5H 3EJTA 2VDOH 3E8UL 5E6IA 2XG9A 3T65B 3ZHKA 4JPVL 2XG5A 2E5EA 4Y5YB 4I4WA 2Q8BH 4BSVB 5IMMB 1ULVA 4H25B 4NO0B 1HOCB 4WKAA 2IMMA 2CGRL 5ESVB 3NACL 2NY5H 3KLKA 5DD6B 5JBFA 1CBVH 3B9KD 2I9LA 3GIZL 5FFLA 4KQ4L 3BZFA 3RWIA 4PBXA 4QHKI 4TRPL 3T8XB 1A9EA 5F6HI 3V4PL 1NCDH 3BGAA 1UQSA 4MDOA 2IEPA 3RWFA 3QRGL 2HFFB 3ET9F 4HPYL 2UY7A 3WFBL 1HJVA 2XKUA 3D3VE 4QEGA 2D24A 2IANE 3HZYA 1ZSDB 2AXHA 3L3GB 5E2UH 2OWWA 1U3HB 1JK8A 2OS7A 3QP3A 5DJCB 3PZ9A 4FXGB 1UG9A 1E6JL 4Q9QH 3M45A 1R24B 3QEQD 2E40A 3N1MC 4PJDA 1OM0A 3VXUB 1G1CA 5D93C 2ZZUT 4NJ9L 1GHRA 4Z2KA 3AMCA 4NNYA 1KJMA 4M80A 5I16B 2UWEE 3FKUS 3N85L 1ZLSH 3WFEH 5AYUH 4Q97A 5T1LD 1AE6H 4UAOB 2FIKA 4R6UA 2W38A 3REWA 3QUZA 1YUHA 1HKJA 3IF1A 5IHZA 3Q1SL 3VFNA 3VFWB 4N42A 4PTTB 5H37G 3RWEB 5JOEA 5IBTL 3SCWA 3TN0D 3OF6A 4PUBH 1RMFH 1QNRA 1R0AL 4QRRB 2E9MA 1T04A 2D2OA 3QUYC 3HN3A 5LAXA 3OR6B 3N50A 5T33L 4K7FA 2SEBB 4L3CA 3HPJA 4WU5A 2A0LD 2CIKA 2GDVA 1UWXK 4QCIA 5GGSA 4ZE4A 5I8KL 5D8WA 3SCMB 2YL8A 5A2BA 1RZKH 3LKNB 4J3TA 2YFNA 2FX8L 4PY8I 5DT1H 2NMSA 1NM9A 4JDZA 4IIQA 5FHBL 3F4VA 1ZGLM 1MCWW 3T1WA 4JQXA 3DDFA 2IXVA 1YYML 4NN5B 3N9KA 3QFDA 3WUBA 2HTKD 2QHRL 4QRRA 2O5XH 2J8GA 1U92A 2Z1SA 2VLKB 1FNSL 3P11H 3MV8B 5HGHB 2ZUWA 2VXQL 1NKRA 3DMMA 3OXSA 1N5YL 1B88A 5D2NA 2PYEE 2R1XB 1AD9B 4LLMA 3WY1A 3VWKD 1BBJA 5IT2H 5KAQG 2QJDA 1H8SA 3HMXA 4RE4A 2YZ1A 4KUCF 3EJYC 4PJHB 1D5XB 4NKOB 3T8XA 1E15A 1EFXA 3W0WD 1EO5A 1JGUL 5FYJD 3IGAA 2VDQH 3GMOB 2QF8A 4O9HH 3QCUH 4OV5A 4TOYL 3VXUE 4JJ5A 3NCYS 3ARSA 1QLRB 1AGEB 1JWSB 4APQA 3L4YA 4M8VA 4YDJB 3H3PL 2CDEA 1A7PH 3MLSL 1Q94B 4UQDA 1JGUH 3EOAB 1DTUA 3WH7A 1T3FA 2IADB 4HK0B 5M95B 4M6OL 4YFLI 2DBJA 2VH5L 3W9EB 4PGEA 3QQ4A 2PKDA 7TAAA 2A0LC 4M56A 2CPCA 1N26A 4L1HA 4LBEA 4JRXD 3ZE2E 4F3FA 2N7AA 4U1HA 4GAYA 2G5BB 4O51A 2C3VA 2QQLL 2H2PC 4L8DA 1CXLA 2FECI 1GNXA 5EUKA 4X6BB 1M05A 3DUSB 5T1MA 4OJFL 4XGZA 5DJZA 3I02B 1EHLL 5C07E 2VDPH 1A1NB 3B9AA 1KOAA 1J0ZA 1NARA 4XCFH 1A6UH 2JJUA 3LQAH 5I1DB 3HB3D 4QLKA 5BV7L 1CK0H 4NO2B 1M6OA 1M7XA 4LQFL 4WI6A 4H26A 4K7PH 1CVSC 1QNQA 1PKQE 4AZ7A 2G3NA 2R0ZH 1IFHL 3MYJA 2WC4A 1ZA3A 2JEQA 3H6JA 2MCG1 3QHFH 4LSVH 1NGWB 4P3CH 1C5BH 1N0XL 4YIQA 1U8JB 4BELD 1KFAH 5DEZA 2XKNB 1JGDA 4MAYB 1LP9F 4ODBD 3V5DA 4HZLB 4EI5A 1QTYT 4NDMA 1UB6B 4OIAA 1ZWIB 5F7MC 2ZX7A 1ITXA 7CGTA 4EI6A 1SEQH 3GGWB 1IILE 1OD7A 1A47A 3ZO0A 3CX2A 1WAAA 5TF0A 3SE4A 2NTSP 4KROB 1S9YB 2NX5E 4XRCB 3OGRA 1K4CB 1TVBA 3BCDA 2CKBA 2DDQH 4NCC2 3BH4A 2WBJC 3MA9L 5C0IA 3WJLA 4JVWA 3BHBB 4ORGA 3HCVB 2ESVE 3KR3L 5D1ZC 4ALAH 4JDVA 1PZ5A 1BVLB 3SCMC 2APXA 4I3RL 2D3VA 4W88A 3MODL 2AEWA 2HT3C 1ADQH 2DJ4A 3WFDL 2BV9A 5TQ2L 4GRWB 5HGDA 3V6ZA 1I8IB 4RFEA 5TPWH 5GRUH 1FYHB 5C07B 1LWJA 4W70A 2HFFA 2W9LA 3H53A 2PETA 1FPTH 3KS0H 3BQUC 4U1SA 3OKEA 1KCKA 1XH3A 3JWOC 3WUEA 2DS4A 3IDMA 4G80A 1NAMA 5IW1A 3QDGB 2OJZH 1FCGA 3CCHB 3EHBD 4HIXL 4XP5L 4F9LC 1UR0A 4IOIB 2DN7A 4P7RA 4G3YH 2VCBA 1C5CH 3ORJA 1CL7I 4GSDL 3U4BH 4JFFB 3P77A 1WBXB 2DB8A 3BZFB 1NC4A 1VGEL 4LHUD 4NKQB 1YHTA 5C0DB 4U1IB 1UYWL 1J7VR 5JO5A 1KUMA 4E0RA 1LL4A 4HGWB 3LKSA 4L3EA 5DI8B 2LFGA 5I5RA 3AB0C 5A1AA 3VIPA 4GSDH 2FR4B 1QBBA 3WKML 4PJDE 1I8LC 5GSRA 2XA3A 2BSRB 4XP4H 1JZ3A 3FFCB 4XPTL 3V8CA 2WMGA 5E1AA 1OTSC 1EO8L 3REVB 1GJUA 5JHDB 5HHMB 2DKSA 2UWEA 1XGPA 5EN2B 1ZE3C 3VXRD 3MYJB 2JLLA 3IJHA 1QUNA 2M8XA 3VFSA 4JFSA 5TD4A 5ABDE 2PCPA 4NF7A 2VUYA 3HRZB 3MRGA 3AOFA 3NPSB 3DX6B 1V3KA 4K3HA 3ZKNC 1H8OA 3QUMH 3OF6D 2EXOA 1EMTH 1EEYA 3RX7A 4POZC 3AI0A 1HEZA 2HLAA 2RR3A 4LSRL 5MP6H 4JFDE 3WLBA 1J01A 4NDMB 2EYRA 2Q87A 1A3HA 4OIIL 5C0AD 2CNCA 4IEFB 3L5XH 1IC5L 5CEXB 4Y16B 3GGWA 3BAEH 1DN0B 3ZM8A 3WE6B 1SMAA 4K3JL 4HBCL 2BOCA 2Q8BL 3VFWA 4HIJA 5AAWA 1QVBA 5HPCA 3GSNH 4O00A 1D5IL 4LSRH 4WEMB 2VISB 4ZUSA 5I30L 2DBLL 1CFNB 1ZS8A 2O5ZH 3KPPA 1DL7H 5DJ6A 1MNUH 1YY9C 2IGFH 4G5ZH 4HK0A 3B2UD 3MUY1 3QFJB 4WW1A 2RHEA 2X4SA 1AFVH 1CLOH 2XZCL 5ABHA 2QHLA 4QRRE 2UWEF 1Z32X 1UQZA 1JNLL 4AT6A 1VPOL 4PJEA 1UADC 1U2CA 3TESA 4QRSB 2WCSA 1KFWA 5DEGA 4CVXB 3IDXH 3D3VB 1W91A 5L6YH 4D8PB 1TCMA 1F97A 1CZ1A 1J8HB 3GRWH 3FN9A 3FT3A 1BZ7A 4G8IA 1JTPA 2MQCA 4JVUA 1I1RA 2X4QB 3QWQB 4U05A 4YEEA 5JQHC 4Z7UF 4RA3A 3BKMH 3UPAA 3VE0A 5E70A 3C2AL 1CLVA 4IJ3C 3QHNA 2Z4QA 1L7TH 2Q7NA 5MI0B 5IXEA 1LVEA 1MFDL 2ZP0T 3UTOA 2EDRA 4M82A 4HULB 1D5ZB 1E4WL 5J4MA 5GRJH 5E5RB 1E0XA 3HZKA 4MXVF 2Y25A 3HUJF 5BMFL 3FB7A 1HWGB 1E6SM 2CDEB 4FQLL 2H26B 4NQCD 1MFDH 3ZE0F 1AO7A 1PZUB 4UIMB 1G01A 1LDSA 4J4PD 1IJ9A 4I0PB 1OAKH 5K33A 4Q74A 5ERWB 2D0GA 1AQMA 5J9PA 3ZE0E 3BXNA 1YPZF 2A77L 1P69B 4MD5A 5HYJD 5CILH 4IRSA 5FO9A 2JF1A 3SKOB 1KXTB 2IFGA 1W9DM 1WWWX 4NQTA 3MROA 1W9PA 3K1KC 1BYAA 4JFZL 1T5WA 4HMEA 1V7ML 3U48A 2DWDA 4LQ1A 5ALBL 2J5LB 1WP6A 5GRYA 4EI5B 1AD0B 2A77H 4JY6A 2IAND 2A38A 2XTJD 4ZUUB 4FK9A 4ODXB 1XR9B 2XFFA 5DO2D 2XUCA 2IBGA 3A5VA 5ISZD 1N5YH 2OQJB 3SEPA 2OMBA 5AY7A 4K3DH 4YDLC 1FNEA 5C0IB 4NQEA 1F4AA 3IETB 1MVYA 3H54A 4J27A 1RURH 4M9PA 1GGCL 3QULB 1KN2L 2X89D 1U9KA 4JO3H 3G6LA 2E4TA 1UYQA 4HPYH 3W81A 4AYSA 3O3EA 4QXWA 1DUZB 1BPLB 3D50A 5C0GA 4OOZA 5A40E 2WKLA 1EZVX 5EO9B 1R3IL 1A7PL 1KB9J 2DAVA 3FW6A 1TG7A 1Q0XH 4GMTL 4WUUD 3QDMB 4PV8B 4ZOCA 1AQKH 1N3NA 3MJ9H 1A1OB 2H8PB 3WMCA 3WFEL 2Y6SC 3RIAK 3BCFA 4ZXLA 3V8OA 1U91B 3ARYA 2HN7B 2ITDA 4QGTA 1PX3A 2G60H 5EU6D 3QPXH 4EAMA 4LCYB 4PJXA 4H8WH 4S1QH 1GONA 1EEQA 4HKJA 1QRNE 1WGOA 4ISVA 2NW2A 1KJ2A 3TPUA 3G5ZA 4G80B 2VWEC 4GAGH 2FATH 1KG0B 2AERT 4HCRH 2AK4E 1YMMB 4YHGA 3DUHA 5DQDH 1RZ8B 4RMUA 5I6XC 3FQWA 3QNZA 2WLZA 1PY4A 3BT2L 1XT5A 3TJHC 1CEOA 3WFHA 4GKNA 1N82A 1FFQA 1JZ5A 4MMZC 2DMKA 1YNTA 1TQCC 1I4FA 2YD8A 3P2TA 1XMWA 4WI9A 2QSCL 4S3KA 1M01A 5IM7B 2BOBB 3SOBH 1V6XA 1QFHA 3TZVC 1UB5A 3SDXA 1BQCA 5BXTA 2E7MA 2HVKB 1M7IB 1DVFA 3CFKA 4GFTB 4YHLL 5ADOL 5LWYL 1U33A 4YE4H 4ODUB 2OR7A 1VJSA 3GBML 3U46A 4GZIA 1UACH 3CVIH 4YDVB 5DUML 4OZIE 4Y2DD 5KS9B 5ETUA 3D6GA 3RDKA 2IWGA 4G9FE 4M29A 3LRLA 4E2OA 1FORH 3GKWH 4WY7L 3QCUL 1TDQA 3DVGB 3SO5A 5A6MA 4YUEH 3HA0A 3MRDB 3ZL4H 4N90E 2QQKL 2YMXL 3HUJB 2A6KB 4KVNH 2NY4B 1XEDA 4XPHH 1HHKA 2WBWB 1FH9A 2HT3D 4B3LA 5A8NA 2EEDA 3VM5A 4NXSA 1UC6A 6A3HA 2X05A 2Z9TA 2OLHA 3VDAA 1OW0C 4XCEA 5D70L 3OKYA 5M03A 5EMYA 3L7FB 2WXDM 1BWWA 4Y5VC 3RWHB 2OWXA 4PJEE 1VGEH 1KENL 3IFNH 2F7QA 5DRNA 5D9MA 1BLNB 2OJEB 3WNLA 3V6OA 4C55A 1UUQA 3MMEA 5D1XA 5ITFB 2NY2D 2P48B 4G8GE 4OAWA 2OX5A 4ODSL 2KL6A 3L2MA 4JKKA 2FJHB 4LQFH 4QXTA 1AR1C 1JGEB 1KTLB 2CKRA 3DX7B 5DSCA 1MLCA 5JW3L 4TUFA 3GSXB 5LVEA 4C54A 2WBGA 1A6ZA 3I75B 4DZ8A 5HDOA 4NO3B 1KWKA 4LLUB 3ULVC 4HWBL 4JRXE 4HQQL 5I1KL 1M53A 1OY3B 5JXAH 1NBVH 3F5WB 2VABB 3WHXB 1RUQH 4Q6IB 4R4FH 4MJIB 5SX5K 4CCDA 2VDML 1YEIL 3N0PB 1CQKA 2X7LB 1CE6A 4U6YA 4X6DB 1INDH 4M7ZC 5HI5C 4MQTB 3N17A 3SDAA 3GJFH 2O92A 4QT5B 5FV2A 4XAWL 3T4YA 4JM4L 4L1DA 3VFOA 3TBYB 5EOQH 1J18A 2CXGA 5A2AA 4BQ2A 3VA2C 1XGUA 4N8CL 3IETA 4OM1L 2EACA 4HIIB 1R34A 1Z9LA 4WWKD 3A4AA 2BVYA 5F1IB 2J88L 1H0GA 1MFBH 3MV8D 5KAQF 1H09A 1U8HA 3RWJB 1S5HA 3MLUH 4ZPVB 4BZYA 1VPOH 1KIQA 1R5WB 2EKJA 3PG2A 4TUKH 3G6AA 4UBDD 4KK6D 2JB5L 1V05A 5BOZG 5DQJA 4NQEE 2DQUH 1UENA 3BZEB 5ABFA 4NJAL 3BUDA 4AY0A 5HPMB 3ZHDA 1Z2KA 4EVNA 5FCZA 2XVNA 3NJ3A 4F57L 5A6BD 1FG9C 1SVCP 3DETC 1FL6B 3I6GA 4XNYH 4XHJD 4X4XA 5BW7A 3EUUA 4IRJD 3VXMD 5EUOB 4XVUC 1HQ4A 4NJAH 5J12C 2VZ3A 4HX1A 3TFKD 4R8WL 1H5BC 4L8DB 3RZWA 3S98A 4ONGH 4X6FA 2V17L 3UEZA 5EO0B 3IXAB 1C12B 2HA1A 3L9RA 1KCRL 2AKRA 4Z18A 4M8QB 3GK8H 1OAZH 4DAGL 2NW3A 4DW2L 1U8IA 3UTTA 3JWDC 3BRDA 1JE6A 5HGBB 2IBBA 1T2QL 3MGAA 3U0TA 4FMVA 1MELA 3RPIA 5J6HB 4P9MH 4P8XA 3GSNA 1ZJAA 1U8MA 3OXRB 3K46A 1MJUH 1IT0A 5HYSB 3RUGB 4MJIA 3C8KA 3IKCB 2NY2C 2FEDD 4NHCH 3RZCD 25C8H 3TBSB 5JHLL 4OIFA 1S78D 1BQHG 3GMQB 3QEHA 3FT4B 3SUSA 4M1DH 1MPAH 5F9AC 5IEHA 2XWTB 4XZUA 4LU5H 3UBXB 1KTDA 3HAEG 5FECA 4DUXA 4MB5A 2VLRD 2HKHL 5EFDA 5T5FH 3UCRA 3CMOL 4RFOL 3NFPA 3RUGE 3LX9A 4YDVA 4QRPB 5IK3A 2ZX9A 4E41E 5JW4Q 1JF5A 3TVMB 4EI5D 4U2ZA 4ZOBA 4XCEB 2VB5A 3D69B 3PHQB 5J11C 1NGZB 3LHPH 4S1SL 3C6SB 1I3VA 5GGRB 3EMZA 4CKQA 2MQ3A 3CMOH 3CZKA 4Z76A 3WS6A 3SCMA 1SY6H 5F1NA 3CZNA 1F3DH 5KSUB 3U0PB 1KLGA 4OIBA 3BGMA 3NIGF 1ZT4B 4HMCA 2EYRB 3BKML 2VXTL 3QDMA 1A5FL 3LHPL 1C8YA 4UNTA 1JP5A 3WD0A 4UV7L 4LRIA 1LK2A 5IB2A 1MUJA 1BYBA 2Y7QB 2APVA 4HTYA 4P2QD 3ARFD 3O4LE 3CFIC 2E9BA 5IVXB 4X7EC 3QQ9D 4KTDL 4X4XB 3O3UN 3UTSD 1ACYH 1NBZA 3PDOB 5DD3H 5J9PB 5I8OH 5B38A 1EOKA 3OR7A 2E7LC 4OGAD 1SJEA 4W7WA 4FA8A 3PZQA 4OLVH 4NUGL 5ECJE 4UBDC 4WVRA 2YEZB 4JHZA 2GJ6D 5JUEH 5TH2B 4LLYB 4LSSL 3HG1B 3EDKA 4W84A 4L3EB 4Y1AB 4FQHB 2C7FA 1RZGA 1B3VA 5HOSA 2BNRA 2YA1A 3MX0A 3F7QA 4O4YH 4XBPB 5HYIA 2BFVL 4LPXA 4B53A 1Z6JT 3WSUA 3ARRA 3ILQC 2X42A 4B7IA 4JHWL 4Z78B 4HCRL 1YEGH 1FVDB 4LARL 2CKBH 4NM8L 2GJZB 3SGEH 1N2RB 3TT1L 5EBGA 5JOPE 3IFOA 5SWSD 3ULVH 1T04B 2B0SL 1BFNA 4OZ4B 3FNDA 4LPUA 3H9SA 2DIAA 3O3AB 4RBPH 1RZFH 3ZTNL 4Y19A 1MQPA 1T83C 3E6HA 1VFOA 4LARH 2WHKA 4MNMA 2Y36H 3L4VA 1JYXA 5D72L 3VXQA 2OI9C 5DHVA 5DMKA 1FHGA 5HGDB 5CAYB 5DT7A 2QPSA 1TVPA 1TVDA 3VWKA 1KTLA 3INUH 4H5SA 4O2FA 4X6DE 3DGCR 3B9DA 3EFDL 3U9UA 3ALGA 2I27N 1ROWA 1E55A 4JR9H 3UR8A 1RUMH 2H26A 5J1AA 3D1MC 3QFDB 3RY6C 5MEQB 1CD1B 4R3SB 1ZLVH 1I1FA 2P5WE 2XNAB 5D72H 2X9XA 4XVTL 1FORL 4AD1A 2F15A 4P5MB 2PWEA 2J62A 3R8BB 1HJSA 4OCRH 5DS8A 2E7HA 3V79C 5EORL 3MXVL 1QOXA 5IBLC 2E9LA 4UILL 4H0IA 3JV4B 1CNVA 4C7DA 1BQLL 4X6EB 1IAKB 1U0QA 3BH9B 3SE8H 2G3MA 2R0LH 5FHAL 2CJUL 1JGIA 1VJZA 3ALFA 5ECUA 1YEFH 3T0EC 3ZTJH 2PO6A 2VVNA 3L7EB 5TE7L 1DLFH 3RBGA 3RWDA 3VH8B 4CVWA 1UWRA 5EBWA 4A3HA 1JZ8A 3HG1D 3ZDZE 1DEEB 1PQZB 3O4LB 3MJ7A 1IGMH 1LLOA 2D4DA 3I6GB 1QNOA 4JQXC 3HAEA 5IB1B 4M62H 3GB7B 3GJEA 1FGNH 2DLIA 1MJ7H 1V0MA 4P5TC 1NCNA 4LRNL 1G7QA 1JXKA 3GMNA 5D5MA 2X2YA 4XBGB 1JPTH 3ARBD 2DEPA 3PJSA 5TFSL 5SWSB 4PRAB 5JLZA 1W0VB 4HHAB 3HHRB 1I3RA 4ODVH 2CIIB 3DX2A 1DVFB 3STLA 3HR5A 3HUJE 3DVIA 3LIZH 2WV3A 2X4RA 5L2KA 1K4CA 3QUXA 4NO5A 3C6LC 1AQDA 3ARPA 4OCWH 3VIHA 4AD5A 3EJJX 1BOYA 1HZHL 2BXYA 1FNFA 1GZPA 1UXWB 4OZFB 1X7QB 1KB5L 3BD3A 3LIZL 3AAZA 5KSBB 1C93A 5A95A 4V2CB 3MGOB 4OLUL 2J78A 4AY1A 3C87A 4M4RA 4WRLA 1WCBA 3BI9X 1CFQA 4HV8A 2IQAB 1NSNH 1T03L 1XR9A 5B38G 1E3XA 1TPXC 3KYAA 4N5UA 3POHA 1CZ8L 1KJVB 1UXSA 2GW5A 2H6PB 3VRLF 3T0DA 1ZU8A 3IDUA 1MI5D 2PF0A 5EB8A 3GSNB 5DMIL 4E8CA 4FTVE 4OLUH 1K3IA 1V6UA 2WW8A 3G5YA 2DWEA 4PJ5D 1XD1A 3OGSA 3O45A 3OXSB 5IHUL 1KEGH 2PF6A 5ISZE 3DC0A 3ZJ8A 1F6FB 1J0KA 2VDKH 4E9LA 4Z5RA 2E3VA 4YK4C 1I1YB 4DO4A 4OD1H 2CDFB 3FO2B 3O2LA 4IISA 2V5CA 3OPZH 3CIVA 3TO2A 3D0LB 4JDZB 5C08E 1UXSB 1HVQA 4FQ2H 1SQ2N 1IEBA 1PG7L 4Y16C 2DYPD 5KOVC 1T66C 3FRPG 5D2LA 5K9OB 4X8XA 3BGFB 4NQDD 3HC3L 2JALA 3OLDA 3NSXA 3WF4A 2YPVH 3S5LG 1PKOA 3KPRA 5BWFA 4ODSH 3II1A 4OKDA 1MJ8H 4MXQC 4PB0H 4ZS7H 5ID0A 2APTA 2F7PA 2CMRH 2VQUA 3EJRA 3QDME 1NEUA 4MNJA 4ZEPA 4BKLB 3MLXH 1WC7A 4HPHA 4Z7VF 4D6JA 2ZUQB 1BG9A 2HTLD 1OGTA 4PCTA 2ILLA 4F7CB 5CEZH 1MAKA 3MRMB 4DW2H 2YOCA 4LGRB 1CR9L 3MLTB 5IQ9A 1EVTC 3OWEA 2YD7A 2F5AH 4S1RL 4DGIH 3F6LA 4HWBH 4L9LB 4JZJB 5DEGB 4CVXA 4D0DB 1NGQH 1PBYA 5E8DL 3KXFD 1UKQA 4XCNA 5ANMA 5TDOB 2XWBA 3O6LH 4MS8D 1RUQL 3U5UA 4MMXC 3VFOB 1XF2B 2EC9T 2VSDA 5DK2B 3SDDC 4FNTA 2CLRB 1KTBA 3X12A 2I60H 3HI1B 1WVZA 4F37F 5HHPA 2HWZH 1IZKA 3MRGB 1WDSA 2UZXB 3TJHD 3HNSH 4P3DB 4BA8A 4D0BB 4FQXC 4KAQL 4MNGA 1IGIH 1UA6L 5I1AB 2YD6A 5HY9B 2KPNA 5BQ7A 4O58H 1NLBL 3TBTB 4Y16A 3ULUC 1XGTA 2X70A 4PS4L 4RFOH 2VDNH 1BEYH 2YD4A 3RVUD 4Y19E 3V6BR 4M1GH 3B43A 4UFHA 4MDJA 1IGTB 4GBXB 4U1LB 3RVXC 2IJ0C 4P2OB 2DWEB 4PBVC 3MRCB 3MRKA 1I9IL 4W8BA 2DLEA 5FKAA 2EPNA 5CP7B 5D7SL 4LLWB 1HJXA 4TUKL 3C60C 4UT9L 4D9RE 2VLRB 2P4AB 5INDA 1JHKH 2WK2A 4X6DF 4G8GB 1RIUH 2WINB 1X6LA 2BHZA 1PY9A 2R9HD 3VXSA 4U5IA 3T4AA 1P6WA 2YHGA 4WO4D 2P5WA 5EFIB 1KTCA 4KHXH 3L3OA 1KF9B 3LN9A 5CEZE 3PN8A 2I9TB 2VL5A 4PJ5E 4PJEB 4XNYL 1FGVL 2MOVA 3O11B 1LF1A 1MCOL 1AY1H 4DZBA 3V6ZB 4M7KH 4FFVC 3SGEI 3S6TA 1H1NA 5E00B 5HHNA 3SE9H 4DEPB 3L1OL 4P59H 4K7FB 4L3CB 4PMVA 4PJ8A 3V0WL 3GJEB 2Z91B 1K9DA 4PTVA 4Z7WE 5FYLD 4UU9A 5DF0A 3KXFB 4N0YL 4RBPK 4TUOA 4WDIB 2ATKB 1ORQA 1I7ZA 3PZUA 1ISYA 3QHTC 5BVPL 1BP3B 4P59L 3S3SA 3VG0H 1QSFA 1X5KA 1I3RB 1DN0A 1MQKL 4PUDA 1RJLB 5BO1H 3QUXC 4ZPTA 1H0DB 3OV6A 3RDTD 2VZUA 2IPKB 4H88H 4GRWH 4DKEH 5K9QI 4V1DD 2GSJA 3TJEH 1XR8B 1DCLA 3QFJE 1UWEH 2OQJA 5EH1A 3FONB 1LE5B 1CU4H 1UZ8B 1Q9KB 5DLML 3OHXA 3AISA 5LBSH 1JN6A 4GS7C 3WN6A 4B50A 4TTUA 5B8CA 4QHLB 5INCA 1NGZA 4I77H 1QBAA 1D6VL 1UZ6E 4LKXA 4NQED 3VMNA 5IG7A 5A8OA 5DTFB 4ZFOB 5A6JA 4DGVL 1OTUC 2D03L 3ALPA 4JFDB 3WDQA 4UZSA 4PP2B 2PO6C 3TIDB 3BUYA 2HJKB 1IM3A 5B22A 1YZZA 4TN9A 5A8PA 3EJPA 3UJJL 3Q48A 2YL9A 5IFAL 2EE9A 4NN7B 4JZNB 3AIWA 1J11A 2O61A 5I8CB 1KG0A 3JXAA 3ZDXF 1OTSD 1RULL 3QQ4B 3IS0X 4CD5A 1BFTA 3IDNA 4HWNA 3K74B 3S5LB 3FCTA 3VXOA 1NMBL 4PRIB 1HXMA 3HAEH 2Z35B 3TO4A 2NSXA 3KLAA 3MBEA 1T22B 1MF2H 1BQLH 4NFCA 5DJDB 2XQYG 4U1KB 3AM8A 4PB9L 4ACZA 5AD0B 3BKYL 4BZ2H 1YQVL 1TJIL 4GQPH 4NP4H 4XNUL 5I23A 1A4JA 2ITCB 3MV9D 1A1MB 3ZT7A 1F90L 5TE7H 4UOW1 1PSKH 1TJHL 2BXZA 1DBAL 1ODAA 2Q76A 3CX5J 1YPZA 1FO0H 3PGFH 1JWMB 4BFBD 4GRMA 4LHUG 4ZMAT 1ZT7B 3PL6D 3QO1A 1FZJB 5TQ2H 1KXQA 3KYNB 3QDGE 2E27L 2HFGL 4HC1L 4X7CC 1T83A 2CEQA 4F9PA 1PG7X 3S4SG 3IRPX 4BK4A 4L4VB 4FXKA 1R3JB 4BK5A 1E4XH 4PRAA 4HG4J 5KVDH 3CO4A 2DLHA 3ILPA 1A4JB 5F9WB 4B7LA 2D3LA 3O4LD 2BDNL 5IHBA 4Q9RL 4UTAL 3TT1H 4HUXB 4WI4A 5ENWA 3VWJC 1OTTC 1ZT4A 1RV6X 2PTTB 4CVZB 1FCCA 1QW9A 2IG2L 4AL8L 4TTDD 1FNEB 1U3HA 2KZ1B 5FCUH 3AIEA 5HDLA 2DSVA 4Z7UA 3W39B 3KYOB 3OLGA 1U2YA 3CZEA 4M6ML 3S36H 5C0EB 2XICA 2XQBH 4KHTH 4Z2JA 3U7BA 1G7PA 2G75B 2EYSA 2W65A 2GCYB 1IMHC 2PXYD 3DX9B 5FO8B 1JRHH 4XC3H 4LEOB 4LVNB 2MHAA 4JO1L 4KK9D 4PRDA 5HVHC 4RRPG 3RWCB 1FL5A 5DMIH 1E28B 1G6RL 3WUWG 4Z7VE 4J23A 1KB5B 1WUNT 4JFFD 2N7BA 5D1QB 3BP7B 1G9NH 3VOCA 2O5YH 4ONFH 3K2MC 4NRXA 4RAUB 3WS6C 3QIUB 4PJ9B 1F4HA 5A69A 1IKNC 5F9DC 4YFEA 1R85A 2VE6B 4XNZB 2VLRA 4P3DA 3MPCA 4OI9A 5EC2A 4U1IA 3VH8G 4KRTA 1P4LB 4LOUC 5EDXA 4KRPD 4PTUA 1MEXL 4U1NB 4RQQB 1FVEB 4GH7B 4YHZL 3V0VB 1D3CA 2FRGP 2ORBL 5F3BB 3DPBA 1MLCB 2BNUB 4N9GB 2XFYA 3CH1B 2ENYA 3AROA 4YHPA 2X4QA 5FGRA 1QBMH 3GI8H 4IPNB 4EOWH 5DR5H 4MQ7B 5IR1B 2AV1A 1KLUA 4IS6A 2C4FT 4R27A 2BZDA 5J7CC 5FEBA 5EC2B 1WC7B 4UIKH 4FHBD 5HD8C 3SKMA 1T7VA 3KHQA 4ZUVB 1TETH 5JQ6L 2ARWA 4M7JH 4EOWL 3KYKH 4RAHA 5C0JB 1QRND 3FO9B 3ZDYE 4UFKA 1OM3H 5ID1A 3R0NA 4OV6F 1NGQL 5FA3A 2YPLD 4NN6B 3TH3T 3QQNA 4HBQA 5A2LH 3JVGA 3SUUA 3MRJB 1NDMB 2ZUNA 3QEGL 2CITA 1RZ7H 2OR9H 3MFFB 3DVNB 2G9HB 5D7JA 3KL5A 4P2RE 2V3GA 1YNLL 2C1OB 4UOQA 2ZSWB 1NMAH 2QR0B 3T0XA 4JHBA 2PR4L 3CVHH 2P5ED 4WDIA 1TE1A 4KROC 1G7PB 5MHSD 1R6VA 1NEZB 4W4OA 5EOTB 3DETD 4F15C 5BW7C 2ZXQA 3WFLA 4TVPD 3X3GL 1E70M 2AP2A 5EU3A 1WQVT 5H2BA 5LA1A 5IHZB 1KR1A 4PREA 2BVUA 2ZWYA 5IBTH 3GI9H 1OP9A 2J7GA 1TZGL 5KW9H 3SCOA 4G6AC 5I74B 1R0AH 4LDOB 1R86A 2DQEH 1XGPB 5EN2A 2AQ3A 1JTTA 3N9GL 2VYRE 3HMXH 3P3YA 5DHYB 2QKIB 3GNRA 1S9VB 4PRNA 1R87A 5EU5B 1LNUA 3WSQH 5K59E 1XGUB 4KJWC 3VFUA 3S5LA 3AVEA 3VIGA 3DRTA 4QHMB 5KW9L 4DN4L 4WWKC 4OGAC 1AXSB 5FOBA 4K3GA 3SGKA 1OF2A 3UPRB 1S8DA 3POCA 4Y88A 4GAYB 4N68A 3GZKA 3HMCA 1LDPH 4I0PD 4P4RA 4Z8FH 5A3HA 4JFFE 3OZOA 3H9ZA 2OR8A 3KPOB 1JD9A 3MLSH 4AMXA 1QVOA 1DWFM 2VKXA 2ZCHH 2HT2C 4JO3L 3PQYA 3A22A 3SDAC 1JWMA 3E3QE 4ENEC 5BVJA 4M5YL 4TNWF 3DIFA 2AAAA 1JBJA 5C0ND 5EZJA 4OT1H 1CGWA 3CFCH 3RVTD 5DJDA 3P9WB 1CR9H 3RHWK 3Q3GB 3D69A 3PHQA 2OSWA 2PC8A 3VIMA 2Z35A 1YPZE 2P8LA 3LZFL 3VSVA 4NO0D 2AKRB 5IW3A 4CD8A 1WFUA 2P5EB 3WXWL 1BQHB 5EZOH 1A6UL 3TJEL 5F7NC 3IDGA 1HI6B 3DECA 4NFDA 4PJCF 2D23A 1FL5B 2EDHA 4TUJA 1YA5A 2E6PA 4HIHB 5KZ6A 5IVXE 1K5NB 1ZT1B 5IGXH 3A67H 5FK9A 5CQ1A 4P2CG 4YH6A 5MEOB 1IFHH 4W68A 5D1XC 2G8ZA 3OKDB 5I76A 4PJCE 4KAQH 5DZNA 4G6KH 3O9WA 4Y8DC 3CZ8A 2KZWA 1FC2D 4J4PA 1U3HC 1R5WA 4DVBA 1BBDH 2XGIA 3VRJB 3N11A 1NJ9B 4JDTH 1OW0A 4WGVB 1EBAA 5DQJB 2VDPL 3D48R 3PABB 5AZ2H 1VIWA 3UERA 1T4KA 3WY3A 1TZIA 5C8JB 1I9IH 3GMPB 1MHEB 4FABL 4ZAKB 5JORA 1IQWL 5GGVH 1PKQB 2JJSA 3W38A 2FEDC 4K7PL 35C8L 2F9BT 1VA9A 2XGBA 1CGXA 1D5BB 4E5XB 3D2UA 2OMNA 2R0ZL 3NCFB 3W0WA 3KR3H 3MREA 4DWSB 2CERA 1N7MH 1U42A 1MF2L 1VEOA 4JFUA 2XKNA 2WVUA 3VU2A 1W1YA 2NXZC 1BAFH 1FFOA 1YEDB 5HHMD 3WBAA 4N90D 2Q6WB 1TJIH 1N6QL 1H5VA 1H3GA 3BO8B 3I3DA 5IHLB 1KC5L 2WSKA 1KJ2B 2OI9B 3F58L 1RQ5A 2M2DA 1CXFA 2DTMH 3GKWL 2ERJC 3QEQB 4KMTL 4WY7H 5DA0B 1HHHA 3O2VL 3PV7A 1JWUB 5FGSA 2JTDA 3EDDA 2J4WH 3NABH 1C7TA 1S3KL 1MWAH 3BMVA 2Z92A 1Q9WB 5L2JA 3ARDD 4DUVA 3TO4C 4K71C 2DTML 5IR1A 2DYPB 1O7DC 2BFGA 2CBJA 1FYTE 1JAEA 1F4YH 1KLFA 2IH1A 3HI5L 3V95A 3U57A 4W6XB 5CGMA 1P6AB 2BDNH 5EC1A 3I6KA 4Y4FB 1QFOA 2AXJA 3SDCA 3PL6B 3UTSB 4MNQD 1MFUA 1W9BM 4NRSA 3O8XC 2RQ8A 3AREA 2VQTA 1I8MA 4X4ZA 1YYLH 1W3LA 2MPAL 4PRPD 2P45B 4CMMB 2A73A 1YEEH 3BUYB 4EI6B 4S2SB 3MRFB 2EDWA 2F53A 5EPMA 4TXEA 2W9DH 2HRPL 3VFPB 3MJ6A 5B8CC 5I73B 5IB4B 2F8OA 5DDHB 1IEAA 4DUWA 2AJZB 3LKRA 4OZHE 1CXIA 5IVNA 3ZKQD 3QR3A 3RIAF 3QDJB 4Z76B 5JXED 5A94A 4PRIA 3SIMA 3AUVA 3JTSB 1M7DA 1D5XA 4MSWA 5DVNA 4ZDHB 4FLOA 1HXYA 1J0YA 2B1AL 3THCA 4NT6A 4TVPH 4K3JH 4DCQB 1GZQB 3G6DH 3KJ6L 5DUBB 3GSNL 1B4RA 5HPOA 1TTUA 4Y5XC 4WK9A 1U8QA 5GZOC 3EYVA 2IPTH 4U4BA 1U41A 4BS0A 4NHUA 4NBXB 3LN4B 3MUGB 5I2UA 1BJ1H 3U7YL 1EMTL 2VCAA 2I07B 4JM2A 5F9JB 5I1JL 2X2JA 1BVNP 2P8PB 4JFYA 1WJ3A 3I85A 3QH3B 5F1OB 4IRZH 5HI4C 3SDXB 1YNKL 5I1GL 4KJQD 1X4YA 3AZTA 4KXZI 4PREB 1GC1H 4NCDA 1PZ3A 1CDHA 1XCWA 3L4WA 2FDMA 5EU3B 3TV3L 3BWUC 4ZFFA 4RIRB 1LJYA 2IQAA 4N0UA 4JQIH 1Q8MA 4BH7A 3K4AA 5GGTA 2IFFL 5L8KB 2YZ8A 4YZFE 3OGCA 4NYLB 3VXNB 1JV5A 3U7WL 3MU7A 5CSYA 5BRZD 1MNUL 3EJSA 3DIFB 4M7LT 4J6RH 4JB9H 3MOQA 4LVHB 4URIA 3TTQA 1HWWA 1NFIA 4G6JH 1GZPB 4YPJA 2AW2A 4LKCB 5L0QB 4GG6B 1GOGA 4M7LL 4PEEA 1P4BH 1FFPA 5CGYC 4X7TB 3PQYD 3P9LA 4P46C 4Y2OA 4OZFG 4UQ2B 3V4VL 4GG6E 4PJAB 2D0HA 4N0RA 4RMWA 5CZKA 5ACMA 1S7QA 3BUIA 3FT2B 3ARUA 1WF5A 5CCKH 4JFHE 1U6AH 1YN7B 4KKLD 1UKSA 1E43A 1RZJL 3VMPA 5EOCJ 2XA8L 3ZE1F 3BE1H 4OCYL 3LMYA 4XNXL 3PZOA 1I1CA 3VGFA 5IROA 5DMJB 1EFXD 3ZJ6A 4PGJA 4BSVA 3Q1SH 1MRCH 1T80A 2GJPA 4W81A 5HDQL 4IBLT 3FB5A 3WO4B 1V6VA 4NC1E 1N4XH 3BE1L 4C56A 1G5AA 3LKNA 2X4TB 3RWJA 4K8RC 4BQ9A 3GO1L 1BZQK 4JFZH 4ZUWB 4MQSB 4LIQE 3DMMD 2WMPA 2I9LB 3BUQA 4XXDB 1MQ8A 2OBGA 1UD6A 4HLZG 1W2KT 1TVHB 2R9HC 3E6HB 1CFTA 4D1JA 3DDGA 3B2VL 1OGBA 3VFGH 5CIPH 1NL0H 5EU6A 2LU7A 2XRAH 3C60D 2D7TH 3CGTA 3P0YL 3KLHC 4GO6B 3GSWA 3DX3A 2K7QA 3QUML 1D5BA 3MUIA 1I1XA 1G0CA 2HG5A 3X3FL 1GSMA 1OSZA 1L7IH 2X4TA 1UJTA 2ZKHL 3SO3C 3ZHLA 5C2UB 1X5ZA 5IFHL 3QCTL 4K7PX 1IAII 1W0VA 1ETZA 3JWDH 4HHAA 5HBFA 3L3KB 3ZKMC 3GDBA 4FQ1L 4QRTB 3BOVA 2DBLH 2R2EB 4FQXB 3O6ML 5F3HB 2EDXA 4RA0C 5KVMC 1L6XA 4O2FB 3N1AA 1FIGH 1UWUA 1H3PL 1KBGL 3ZOAA 4W86A 1EXPA 1BIHA 4KKBC 4XZBA 1ZL1A 4P2RB 2APFA 3QIBC 4NPYB 4NWUL 1OGSA 1RURL 4MCYB 4PR5A 5EBWB 4XPBH 2C4XA 5AZEH 3WHE0 4NNYB 4P57B 5TJWK 3QQ9C 3AYSA 5ID0B 1VBUA 2VLJA 4LSPL 1XIWC 1IAIM 3QG7L 4OQ1A 4ZYKA 5A8QA 3JV4A 1OP3K 4XV0A 1ZHLA 1ADQA 4HGWA 4PTUB 5A6KA 3P0VL 2G3IA 1ZTXL 3UG4A 2BSTB 2CD0A 5IVOA 1J1PH 1HHGB 4F2MB 2XHYA 1X9QA 3OJDB 2BVQB 4HIHA 4K94C 12E8L 3RY4A 3UX9B 4HZAA 1N3NB 5GGTL 1P7KA 3U7VA 3EOTH 3BEWB 2XVKA 5FB8B 2GQHA 4NNXA 5A8MA 4XCFL 3ZSSA 4AENA 4HKBA 4Y16D 5IQ7H 5D1XD 1OB0A 3WXVL 1CK0L 4TSBL 5DRNB 2BJML 4MVBC 2TAAA 1V3JA 5DUPL 1BLIA 2YLAA 1J8HD 4C58B 5F7LB 4O2CA 1XCQB 1VFBA 1ZB5A 2L7UA 3W0KA 2ITCA 2CKSA 3X14A 2IBZX 1IQWH 5HY9A 2CK0H 5DUBA 1QKZH 3AFLA 1AGEA 1NGPH 2PXYB 2Q86A 1S7VA 3MLWH 1A6VH 1DQJB 2EEXA 2JCCE 4FQPA 4H20L 4XT1C 5F1KC 1QI0A 3QAZC 4AH2B 5DMYA 2H9GA 1KTRL 3RL1A 4HD9A 2EQDA 4P5TA 1HYSC 1MHPH 1KCUL 1XSIA 3LN4A 2GFTA 2CRZA 1F2XK 5IM7A 4JREB 3GSVB 3GEWB 32C2B 1GVYA 4FQHA 4PJGE 2EADA 5EIIB 1NQBA 4Y89A 2F7OA 3WJLC 3NCMA 2WBJA 1PDKA 2AXFB 4UI2A 2N56A 4BQ3A 3KPQA 4XGZB 3U46B 1R5IB 3LS4H 1KGUA 4M8UA 1PX8A 1OD0A 1DSFH 3EIFA 5GISL 4LGPB 3HPLA 3L7EA 3RL1B 5I6SA 3OGCB 4EI5C 4XNQB 2DSZA 2F74B 3CSYB 3BAIA 4F8XA 5DRZA 3ZYOA 1HINL 2R0LL 5FHAH 3W28A 4X98B 3MJ8B 2LTQC 1HVXA 3BKJL 4P23C 4H8VA 3LQZB 1DSFL 1YECH 4D9LH 4YEFA 2ZXAA 5FIPA 3O9WB 4CMHB 1JPFB 5KG9A 4MCZA 3EYOA 2HISA 1B6DA 4MJ6B 5HI3D 3EMQA 1KCLA 3QG6B 3QR2A 3AHVA 3U4BL 3LDBC 1NUDA 3IXTA 4U3XA 4NM4H 2PYFA 4WFGD 2IAMA 2BC4B 3PNWA 1I7TB 1GIGL 4ZG1A 1NMCC 4RGOH 2QV4A 2CETA 1I9RH 4K07A 2Y9RT 3NCJH 2EDDA 4GG6A 1IGJA 1CYGA 2OJEA 4ZTPH 4HP5A 5KTEL 3U2SA 2IAMC 3FAXA 2EDKA 4Q6YA 2OSYA 1C5BL 3PDGA 1KN4L 1W72B 3QG6A 3S88H 4LCWA 4GUPB 4Y7MA 3ZE1E 3N15A 3VIOA 2CRYA 3L6FB 4LKXB 4I8DA 2BVOA 4G43B 5FGCB 2V3DA 4IRJB 3FHAA 1HZHH 4G6ML 1PLGL 5GJTH 4ONHA 4C56D 1JNHB 3CSPA 3ULSA 4LX4A 3P30H 3VI4E 5HGBA 3RJYA 1OARL 2CCRA 1QW8A 3L5XL 4PLKD 5J13C 4XHJC 3WN5C 2XPGA 4UOW0 3MA9H 2HYMA 2EZ0D 2DJUA 4KRNA 1ZVYA 5C92A 5H94B 1RJYB 1AXSA 5DK0A 3QULA 2WP3T 5A6BA 2P42B 4CU7A 5K59F 2IF7A 4HAFA 5KANI 4TVDA 4IOSD 4GW5B 4QY8A 3CDGB 1J5OH 3VSUA 2FGZA 2R1YA 5A6AA 2YN3A 2X44D 5F7YC 1ADQL 3T4YB 3GIVB 1TQCB 1CDJA 1M1SA 4MNGB 1AFVL 4FZEL 4OGYH 3BP5A 4HU0A 4H8WC 5HYQB 4JG1H 2EDLA 3QPQC 3PHSA 4OLWL 4ZAKA 2XVGA 5HVHB 4P49A 1D6EB 4NO2A 1SYTA 5JHDE 3IT8D 1AGCB 3GSWB 1WWCA 1TFHA 1R7AA 2FIRT 5D7LD 3VRIB 5SX5H 3MMDA 4OZHB 5E09A 3RPMA 1IEAB 2NW0A 1U8HB 4JREC 4LNVA 1KIRB 1M05B 1SJXA 2EYSB 3CTTA 1UZ6F 4PGCB 3H42L 1FFOB 3TNMA 5HYJA 5CINH 1BIIB 2DQUL 3DTXB 1SM3H 3KXFE 3ARGA 2HT4D 1EAPA 3LEYH 3L4UA 5D70H 1SEBB 1MY7A 3Q5YA 4L8CB 4UUJA 4FZ8H 4I3SL 3VGBA 5C6WH 3WN5A 4LNRB 4NFBA 2VRQA 4NZCA 4RMTA 3IDMB 4PUEA 3FRUB 2IANA 4WKFA 1J9YA 1CD9B 2EZ0C 5FV1L 1H0IA 2JK5A 4PY7A 3EOAA 1KB9K 4S1RH 2DQJL 2UY3A 2VR9A 4U1KA 4BA0A 1LO4H 3QOKA 3AC0A 4R90L 2X0HA 1VACA 2FZ3A 3FN3A 4EN3A 5A43C 2W61A 1N59B 4OCMC 4ZODA 3TWCL 1NEZG 4D6CA 5SV4A 4RMRA 3GH7A 3IJYA 5SWZD 3UG5A 4Z7NF 2D7TL 3QEQE 1TXKA 4M6NH 3WEMA 1HK6A 5FA4B 2I60L 3U0TB 3HG2A 3VRLE 3HNSL 1QFWH 3N1GC 3QA3B 4L3ED 4M00A 4R4FL 1KXVC 3UYOD 4ODWB 3TWCH 1MH5B 2ADIB 2VC9A 3RAJH 2YSSA 2F8QA 1J87A 4WEBL 2A1WL 3L5IA 1FBIL 2V5RA 4XH2B 3FQUA 2V2WB 4YPGA 2ID5A 5HHVL 1ORSB 4DWSD 4QRTA 5DHXB 4ZFGL 4J3SA 2NZ9C 2K9UA 4F15B 4YIQB 3V9FA 1I9JH 2J8UA 2J25A 1HXYB 4PMXA 1NDGA 3ULUL 4XCCL 4ZXBC 2XSAA 5FA3B 4MDIA 5J6GA 1OPGH 5KBNC 1VFMA 1JHKL 4MA3A 4KU1A 1XF2A 1W0WB 1S7VB 1E72M 3STBA 1Z0NA 1R3LB 2ZX8A 5DMGD 5DRZB 4GKLA 4CD4A 2QQNL 5LAXB 2FBJL 4XCCH 1OPGL 2PYEA 2Y8VA 1LP9E 5DC4B 3ARDB 3W37A 1SY6L 5C0CA 1IEHA 2B1HL 3C6LB 4TUOB 2K3TA 1WEJH 1U8OA 2YBUA 4GBXD 5GS0D 4CD7A 4FNSA 1FVCA 1B0RB 3DO7A 1W3JA 5DYOB 1GCYA 5CJQH 5C0JA 2BSRA 4WV1B 5E8OB 5ACLA 2BVEA 4XPAL 4JFPB 2EIBA 3KHOA 1IE5A 2NY6D 1TCRA 2RCSH 5DD3L 3RKDD 2BNJA 2WVVB 2EKSB 2AQ1A 4XNMB 2C4FU 4GW4B 1TPXB 4JPKH 2QSVA 3IKKA 4RE3A 2AJ3B 3WXVH 2BRRL 3KDMB 1ZGLP 1E6XM 4M93B 5DUPH 3WIIL 3SQOL 4NOFA 5I66A 3M17A 1I7ZB 2M26A 2RCSL 1TR1A 4JY5L 2J1KA 4ZFZB 4UQ2A 3L6FA 1G9ML 2BFVH 3BIKA 5F3BA 3VNYA 3PWLB 5FUOL 5L9DH 4QNPE 1XF4B 3IAPA 4P46A 3F5KA 4GKOA 2RBLA 1GGIL 5T5NF 3CNKA 3WD1A 2R8SH 4BCEA 5GS1A 4BFIB 2HJKA 2XOTA 5F6IC 2VL4A 1S7TA 5B3NA 3T2NL 5JHLH 1S7RA 3RY5A 2R2BB 3EBAA 5ADPL 2ICEA 4Q0XH 2LABA 3WO3B 1HOCA 4MAUH 1F5WA 4LU5L 1IAOA 2B8OT 1JTOA 3K2UL 4HDIA 4HA3A 3QJFB 2YWZA 4A4AA 3QI9B 3PBGA 4W5UA 1H15B 3DSNA 3GXMA 1FLTX 3LXBA 4V1DB 2YC1B 2DM2A 3LRSA 1BFVL 1DWGM 4PBWD 4U7KA 4NWUH 5GS0C 5A2IH 1QSZA 1E1FA 3CXDH 5DVOA 4CKVX 4UUJB 1QFWI 4Y0GA 2HFEA 4NO5B 4IPLA 1OWRM 4Y5XA 2BHUA 1T1XB 4PMQA 3MCKA 1NGWA 1ZTXH 5E2JA 1UR9A 5T3ZD 5BRZB 3QPXL 3UBXI 2A6DB 1DWIM 4ERSH 2FGWH 4M48H 1JCKA 1AI1H 2NXZB 1E5JA 1HQRB 4HF5H 5IHSA 3LVEA 2ED7A 4OCLC 3T65A 5F8RC 3K81A 1JDCA 1OIMA 4OI8A 3ZO9A 2PTTA 3WH8A 3MJ7B 3OAUL 4L8SA 1NCWH 1Q9LB 2H2PD 5KSVB 1OIFA 4KI1A 4JY4B 4TUJB 3FFDA 4RGMB 4UTAH 1AQ0A 2H3NB 2DI8A 4HF5L 3RM4A 1LGVA 3TO4B 2EYTB 3UTQA 4MQ7A 3VFVB 1B3JA 3VIFA 1EFXB 4L4VA 3ARDC 3EJZD 4POZD 3BQUB 1FZKB 1OP5K 1XYZA 2X4OB 3CHFA 4X5XA 3DTXA 5I15L 2VZTA 4H04A 3U0PA 4MA8L 4EEEA 3ZT5A 2VDLH 1KJ2L 3PL6C 4U3CA 5SV3A 3MNVA 2DQIH 1NCBL 5FYKU 2RGMA 3QI9D 1X5XA 4MDIB 3B9KA 5H35A 3HS0B 3G5ZB 1HE7A 1WT5C 2A2QT 2IUZA 2BSSA 4Z77B 5IMMA 3MLZH 3SUTA 1PG7W 5BS0D 5FGCE 2IALA 1QSEA 1S7SA 4JM4H 4EANA 4Y1AD 4DGYH 5I3DA 3HE7D 3FN0L 3MGOA 3TBVB 3E3QC 5SX4H 1VFAA 2DLGA 1SY6A 2HTLC 3U6RB 4OD1L 5B21A 3FT2A 4OB5H 2FSEB 1VBRA 5JR1L 5A3ID 2EXWD 3TN0A 5JNYB 3HG1A 4Z0BH 1BM3L 1T5XA 1UM4H 4P9HL 1CG9B 1CL7H 2AABL 2P7TB 4JRWA 3BZDA 3EYUH 1XGTB 5DYOA 1NBYB 4P4KB 2HTKC 3NCCB 1U8NA 2DT3A 1ZLUH 4WWID 1UVQA 4U6HA 3VG9C 2AJVH 5BZWB 4L4TD 2CGRH 4BYHA 4OCXH 3NPZB 3RQ3A 1T6VN 3QUXB 3MV9A 3KPNA 4P9HH 4D6HA 1ZHNB 3DURB 2XZQL 2J8UE 4RMVA 1YEFL 3GM8A 3FOLA 3RJQB 3WIFB 1XF5B 2D3NA 4N0CD 4HU8A 5TH2A 4YHEA 3HG4A 3CMJA 4JN1H 3ZTJG 5F6HJ 4ZUVA 3OKOB 4R26L 4ZD3H 3NGBC 6FABH 1FVCB 3DO7B 2DIEA 4AD2A 4LSQH 3QWOA 3UJIL 4GI9A 4J4PC 5C0CD 1ACZA 3UETA 1ES0B 3O2WL 2B2XH 4C7GA 5JMOC 4NCC1 5C08B 4KKNA 4TNVK 2GJ6E 2Z91A 5E94B 3TBWB 5LKNA 2Y07H 3AXHA 3RUGF 1AKJB 3MNWA 1CWYA 1Y0LA 3QHZH 4UINL 3S96A 4QXUL 4K9EL 4P3WA 1MRDL 3QIWB 1EDGA 4ZDHA 4V1DA 4S1DD 2E7CA 3G6AB 1INQA 4Y5YC 1BREA 4WUKH 1F42A 3ZZ1A 3C5JA 1U95B 3EFFB 3HE6C 2CDGA 2NNAB 5E6IB 1H11A 1GHFL 5HDRA 1S7SB 4RGMC 1NCCL 3HLAA 5F7DB 1AHWC 4HIIA 1QHZA 4PPTA 2XFXB 4XMKH 5HHPB 1DLHB 1HKLL 3LSOB 3L2LA 2YXFA 2VXSL 2ADJB 2F58H 4FQJL 5FO9B 3AREC 2BNQD 5DD6A 3SDCC 5JO5B 5L7XH 4E0RB 3HMXL 3P40A 3UTSA 3OA5A 2AXFA 4KZEL 4AEIL 1MJJB 2NZ9D 3SGKC 2A9MH 3T77B 4PD4K 1CF8L 3BX7C 5DQ9A 5E8NB 1A6AA 1MCFA 5IHUH 1KEGL 1OSPH 1KIPA 1VGKB 2VAAA 3LH2L 4IMLA 2EC8A 3DVFA 43C9A 3BDXA 2QLVB 1V8HA 5IT2L 1JV5B 4JY4A 4JAMB 1Y6KR 5KZCD 3OHXB 4YHIA 3VFTB 1M04A 5E8PB 2PTVA 4MCZB 1K8DA 1BOGB 5LCVL 2AI0L 5H2BB 1HILB 3IGAB 5IJVB 1RVFH 5JZ7C 4FZ8L 1JI1A 1HHIB 3OAYH 3IU3B 2CR3A 4X0KA 5IVZA 4AMWA 4PTWA 4WV1A 1MFAH 4JFHD 5EUOE 2EEBA 1UWSA 1O7SA 2WUCL 3SQBA 4ZS7L 1N2RA 5JIIA 3MTRA 4YN5A 1G9NC 1AQHA 3IDGB 1RU9L 4K2UH 5JIKA 3KNBA 4AM0A 2ZXDA 4P5KB 1K8IB 5LBSL 1JGLL 2AS5M 4HPOL 4PGEB 1VRXA 5C0BE 1LO3H 4AEEA 1CLZL 3DROB 4PRHB 2O9RA 2GI7A 1X1NA 2Z31A 2ZE0A 1VFUA 4NHCL 4F80A 1OD8A 1W1PA 5GS2D 4MLSA 4NN5C 2WBKA 4Q58C 1XIWB 4QXGL 2NY7L 5AD0A 2EE3A 3G9AB 2X4PB 3NFNA 2VLME 4PJ5B 3FRPA 1LEKA 3RAJL 3NCBB 1JUFA 3O6FB 2EE6A 2P5WB 1MCSA 3L3HA 3WCYA 1WICA 1TENA 5IFAH 5JDJA 4FRWA 2EIDA 4KKAC 3IRZA 4PG2A 5IK3B 5GZNC 3DX8A 3T3ME 2R2BA 4LXFA 4KZDL 5JPNA 3FXYA 1QYGH 2NYYC 1KNOA 1A9BA 3I75A 4YR6B 4DZ8B 1T89C 4F9LA 2AGJH 4HKBB 3NAAL 1MHHA 4U1JB 4ORZC 1OHQA 1BFVH 4NP4L 4XNUH 5JW4M 1CS6A 1SBBA 1US3A 3AIVA 3PWVB 5IKCA 1YEHL 3GSUB 4M61B 3W5MA 2GFBA 2YK1H 1VADA 1BPVA 2QQNH 4MD0B 4F9DA 1JNEA 3NAAH 3VXRA 5FDYA 4JRXB 4LVEA 4P7LA 1FE8L 1IKNA 4FNPA 1D7FA 3BKCH 5JIWA 5ALCL 3QAZB 4EKXA 5D1ZA 1ACYL 4OZIA 1KELL 2CLRA 3HG1E 3D39E 4UT6H 2JIWA 5FDWB 4ZFMA 2B31A 4NUJA 5CBAB 4ELMB 4NKMB 1W32A 1CFVL 4ZAKD 3TBSA 3TM6A 1AKJA 4KKBD 5CJ8A 1AY1L 2AV7A 4HFUH 3IJSB 5C2BL 4XP9H 1IVLA 1L4IA 3HG5A 3STLB 1SEBA 5CFHA 1IL1B 1FZOB 5AAMA 2VXUH 3A0OA 4MQXC 5C9JA 4PGBA 3KPQB 5I77A 1ZANL 2GSGB 3RPIB 2XN1A 3MRJA 4PJ7E 3DXAA 2C7UA 1A64A 2J8UF 4XP9L 2AJYL 1KSRA 4G3YL 4EKJA 4XBEL 1MW2A 4GXVH 4DKFL 1T0MB 1JFQL 2CK2A 1ETZB 5KVDL 4LDEB 5CEYA 1RJCA 4HX1B 3VUPA 4JFQB 3T4AB 3V6OE 1TMCB 5HYQA 3LDBB 2O93L 4XP4L 2GJ6A 3BVWA 1G7HA 3EDFA 3V2AR 4G9FB 2W63A 2R0KH 1B90A 5D7JC 1WAAE 3OB0K 4H2CA 4WFFE 3CFDB 4HH9A 1HH6A 2Q76B 1UEYA 2FYYB 4ZQKA 5DS8B 3JVGC 5IB3A 4Q7NA 3ISWA 5EORH 5EZLB 3KL0A 2CHNA 3ALWA 4UZGA 1KCSH 3VXSB 3VD9A 3PWVA 4OM0H 1CBVL 2X7LA 4JO1H 4PRWA 1J1XL 1P4IH 3IXTB 1MXDA 3NN8A 1TIUA 3AY4C 5GRVL 4IRJA 4XVUD 3S34L 2X2HA 1PFCA 1CFQB 1MCIA 1F58L 4I2XA 3WD4A 2H2SD 5I30H 2CYGA 2FEEL 3TT3L 5FECB 3FQWB 1KCSL