1PYMA

Phosphoenolpyruvate mutase from mollusk in with bound mg2-oxalate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
291
structure length
291
Chain Sequence
VKKTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRDSNEASWTQVVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNSLHDGRAQPLADIEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADAILMHSKKADPSDIEAFMKAWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASVSAIQQTTKQIYDDQSLVNVEDKIVSVKEIFRLQRDDELVQAEDKYLPKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PHOSPHOENOLPYRUVATE MUTASE)
publication title Helix swapping between two alpha/beta barrels: crystal structure of phosphoenolpyruvate mutase with bound Mg(2+)-oxalate.
pubmed doi rcsb
source organism Mytilus edulis
molecule tags Phosphotransferase
total genus 106
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 5.4.2.9: Phosphoenolpyruvate mutase.
pdb deposition date 1999-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 1pymA00
2V5JA 1F61A 2G50A 2VWTA 4QG8A 4KRZA 4L80A 1S2UA 1A3XA 2HROA 1ZJHA 4IMAA 1A49A 1A5UA 1DIKA 3EZ4A 3GR4A 1KC7A 1UJQA 3T05A 3E0WA 4L9ZA 2BG5A 4KCUA 4IQEA 4JPGA 1MUMA 4YJ5A 1O5QA 1GGOA 3QV6A 3IS4A 1IZCA 3T0TA 4WJ8A 4G1NA 3M0JA 1U5VA 5TAOA 2V5KA 3M0KA 1PKYA 2QIWA 3E0VA 2DIKA 1KBLA 1PYMA 1U5HA 4MG4A 3SRKA 2HRWA 2VGIA 4FXJA 3HQPA 3ME3A 3SRHA 3QQWA 3LG3A 4B5WA 1T5AA 4IQDA 4B5SA 4B5XA 3LYEA 4QGCA 1F8IA 3EOOA 4LSBA 1E0UA 3HQOA 4ROQA 1M1BA 3PP7A 3U2ZA 4KCTA 4DRSA 4IP7A 2ZE3A 1O68A 3KHDA 4KCVA 2DUAA 3FA3A 1SGJA 4L9YA 1DXEA 2X0SA 1PKMA 3P0XA 2VGBA 3HQNA 3QZ6A 3QV8A 3QV9A 1DQUA 1ZLPA 2XDFA 2E28A 3OYXA 4KCWA 3QV7A 1VBGA 4RPPA 4QG6A 3PUGA 3GQYA 3GG8A 2R82A 3QTGA 3I4EA 3R4IA 3OQ8A 1OQFA 2HJPA 3FA4A 4HYVA 2VGGA 1PKLA 1F8MA 4HYWA 1S2WA 3QLLA 4QG9A 2WQDA 4B5UA 1OY0A 3EOLA 4YNGA 1IGWA 1O66A 4B5VA 1A3WA 3B8IA 1XG3A 1F3XA 3OYZA 4MF4A 3KTXA 1JDEA 1AQFA 2HWGA 1PKNA 2VGFA 3MA8A 4KS0A 4B2DA 2XZ9A 1S2TA 3N25A 4B5TA 2KX9A 2OLSA 4TV6A 5JVLA 3H6OA 4B2DD 1F3WA 1DXFA 1XG4A 3SRFA 1E0TA 3BJFA 4TV5A 1M3UA 1Z6KA 1S2VA 3SRDA 3E5BA 2XZ7A 3VAVA 2VWSA 3G2GA 2L5HA 4L7ZA 3T07A 3BJTA 1VBHA 3EOEA 4FXFA
chains in the Genus database with same CATH superfamily
1DHKA 4CEUC 2E6AA 2AQVA 4FEZA 1NDWA 2H3DA 2P3ZA 5ABEA 1I2QA 3PWAA 4LALA 3HGSA 4KGLA 1KGUA 4XZIA 2DH2A 5A8OA 1QPKA 4C6DA 1W8GA 1XLGA 1O5QA 4AD3A 2C19A 4IT1A 3JZEA 4ZQNA 3AIRA 3FS2A 2DIKA 1PYFA 4NU7A 3PJXA 1ICQA 3RJXA 1KRCC 2FHFA 1K03A 2OX4A 3IRDA 1BQGA 4AYSA 2PWVA 3K8KA 3H24A 5CSYA 4JDYA 4UMCA 4E38A 1Q45A 3BCFA 4H41A 2NQ5A 1JRCA 2DT2A 4TVCA 2GVEA 4Z1AA 1S46A 5FF4A 2Y7FA 5TNVA 1I2NA 2J7CA 5PTDA 1S3HA 5DBTA 3Q65A 3VKAA 5B7YA 4PMJA 2ZOXA 3TOPA 2VCBA 1DJXA 2WLZA 3PG8A 1QPOA 3PTQA 1MEWA 4WSJA 4UTFA 1WO2A 2EKGA 1GCYA 2XZ9A 2V9DA 1OFBA 4HK5A 4NZ4A 1ISWA 3WF2A 1W5QA 3JZUA 4GJ1A 1RY0A 4AWEA 3BJTA 3R8RA 2FZNA 5IBXA 1EQCA 1ODZA 3N2CA 2Z1XA 3WQ8A 3CQ0A 1O4UA 4P8XA 2YZRA 3SQLA 1H11A 2Y5JA 2YCIX 3R5EA 4NAEA 3RNDA 3NPXA 4GI6A 4L1XA 1MI3A 1W5NA 1I4NA 3CS2A 4JPGA 1UQYA 4HCDA 3T8QA 4GNVA 4MKSA 3NQAA 3OZMA 1HJQA 3ES8A 3PB0A 2QPUA 1DWJM 1EEPA 1H7WA 1B4EA 2TODA 2ACUA 2PB1A 2ASHA 3ONBA 1UMYA 4XISA 1HKWA 3FV9A 3U2OA 3V0UA 4NNCA 4XBSA 3QQ0A 3TDFA 2H9AB 4X3ZA 3WDQA 5BOOA 4FX7A 4J5NA 3RO8A 6REQA 1Q4NX 2GGHA 1ALDA 3NPWA 3L67A 3A24A 3W24A 2YCLB 2I9EA 3I68A 5LHFA 4NZ1A 3IVUA 4FR6A 3M5ZA 4UQDA 4JTUA 3PZGA 1QPQA 2B31A 1WNOA 2A6NA 4U2ZA 4UTWA 4BEQA 3PB2A 4TMBA 5DCBA 4UWMA 4UTMA 4AZIA 5M03A 2H8XA 3NURA 3NZRA 3OBAA 4JFWA 3UEQA 4KEUA 1YKWA 4IG2B 4NHVA 3B0VC 4HMDA 3PWGA 3WKZA 2A3AA 2GOUA 3R43A 2R8WA 1YBQA 3HGRA 1XINA 3P14A 4ZEPA 1RK5A 1X97A 2MANA 1QBAA 4AAJA 3B9NA 4JTFA 3TYUA 4QQ3A 3DFSA 3P93A 3VK5A 1KGWA 1C92A 3TIMA 1FWWA 1EB3A 3BSGA 2DZVA 2WM1A 1JXJA 2O9OA 5D4YA 4C1LA 3OTRA 1DWAM 3RDKA 1V93A 3SDOA 1UD5A 1E0VA 1QAPA 4K3ZA 3O06A 1EIBA 2RHGA 3HQPA 4J2PA 2JKAA 1UWTA 4MNKA 4ZFMA 2QCFA 1EDTA 4L4OA 2WHJA 3Q45A 3W3OA 3W76A 3R7MA 2WKGA 3MUY1 1RLCL 4RPPA 1QHOA 1G94A 4JYFA 1KFBA 5HINA 2EBNA 4C6LA 5F2GA 2Y61A 3RM4A 3K5XA 2CNCA 5ECUA 2Z6IA 3E38A 4AY8A 3UFYA 1TCMA 3LM3A 3L7RA 1IYXA 3H7RA 1UMLA 1MYRA 1FA2A 4JZ5A 4J3VA 1UUQA 4H2HA 3LV6A 1PDZA 4L61A 4TMCA 4GISA 4WDTA 2GDUA 2W92A 3VU2A 1KBJA 4QM1A 4RL3A 3ZJ8A 3GXFA 1OFOA 3T4CA 1JIBA 1P6WA 1FP9A 4WX2A 4PYSA 4ZQOA 4JIQA 1TR9A 4GINA 3TKFA 1TPC1 2GVJA 3W7MA 1UR2A 3NL5A 3VNMA 3ZT5A 4LB4A 3I3BA 4A22A 3CLWA 3QV6A 1O5XA 4R27A 3CH0A 1GVRA 1RA5A 2V69A 3C0LA 4ZMGA 4FNRA 1VHCA 5C9RA 3XIMA 4PUUA 3H2CA 5D33A 3WQCA 3NEHA 3C5QA 4MY1A 2G4FA 3GHSA 2V5BA 2Z25A 3TZNA 1GVOA 4Y9MA 1H7XA 4IXHA 3W88A 4CQBA 1IT7A 1D3GA 4H7CA 1WV2A 3T2QA 2Y88A 4Q8QA 3LNPA 4QJ1A 3QV8A 4H8VA 3VFLA 1JEZA 3QV7A 2PLJA 1TPEA 4UQBA 3ZO9A 1UROA 3CV7A 1E0WA 4C5YA 1SMDA 4EIVA 4BF9A 4CNTA 4WDUA 2P50A 5FAJA 1TJPA 2Y8KA 5FF3A 4EXQA 1ISYA 2VI0A 1NH6A 2BOEX 3RCMA 3PAOA 5I00A 4XG1A 2BXZA 4C6CA 3L5AA 4HU4A 4DPPA 1UKQA 2W67A 1KQZA 4O12A 3L68A 1QI4A 4AXKA 3VE7A 2R24A 4MKNA 1Q8JA 1PX8A 1S1PA 3QW4B 3L4TA 5DFAA 2VZTA 2Q8LA 1K4HA 1JVNA 3RU6A 3VX1A 1REQB 3S9YA 9XIMA 4KRZA 3RM9A 2G37A 3P3BA 3IJ8A 4GPNA 1YDYA 3E2SA 4CD6A 1D8WA 2WNQA 1OINA 3WLJA 4H8HA 1JPIA 5I09A 1U5VA 4O1CA 1F6KA 1EJVC 4CNOA 3W0KA 3IIZA 2D2OA 1V6XA 1UPPA 2NXHA 5EMKA 1J01A 3MO7A 1Z3NA 1ZL1A 1GYMA 2VOMA 3NIYA 2PCEA 4O1BA 2WC7A 3VIHA 4Q8OA 4UFJA 4J3TA 1Z9AA 5D9NA 3CASA 3STEA 4LUIA 4MJ2A 1DJZA 5F4SA 2Y5SA 1W91A 4FSAA 2DSUA 5FCZA 1TRIA 4HYWA 1H50A 3R79A 3E96A 2Q8XA 4GXPA 5A3HA 2PTWA 1BXBA 2DSKA 3T9PA 4KS0A 3EA1A 2E8YA 1W9VA 1UHVA 2GSJA 4UNKA 3EX1A 1KTBA 3VAVA 5AC4A 1K1DA 4GRSA 4MDPA 1SFSA 1MQPA 1WAUA 3CUHA 3ARTA 5HWNA 3EKLA 1YE6A 3VKKA 4DXVA 3CZLA 3BW2A 2IPFA 1OX6A 1R85A 4NAFB 4K36A 3ID7A 3BXWA 2EPNA 1GKQA 5CPSA 5DRIA 2ZVIA 5D09A 4Y90A 2CPUA 1VCGA 5C0QA 1UZ4A 3PVFA 4PMVA 1CI1A 4ZXOA 4UOZA 4J40A 4TQTA 2OGJA 3VC5A 4B5WA 3BE7A 4J7RA 2AKZA 3DX5A 4UR8A 4JTHA 1AQ0A 3U2ZA 1W56A 3L21A 3CQHA 1WKFA 4DRSA 1CXIA 1W9BM 1VH7A 3ZFHA 3TTOA 4I5UA 4ICMA 3P61A 3TLQA 2X1SA 1MRQA 2ZQ0A 3B8DA 3FSUA 2F61A 1J0IA 1BTCA 2BGNE 2GUYA 3A9BA 2UY3A 1FP8A 2H90A 2IW0A 3FA4A 2QMJA 4GX9A 1XYBA 4JCLA 1B9BA 3RILA 4K6AA 3UD6A 1FWEC 5A6KA 1QUMA 5LNRA 2VURA 5D2TA 1O7AA 3DHPA 4EPEC 3ALFA 4NJJA 1DXFA 5AHEA 1V02A 4MNMA 2C79A 3JW7A 4B3KA 2R1PA 3OVRA 4AB4A 2TSYA 5HUOA 3Q2DA 2FZBA 5FKYA 2ADAA 4BF5A 1SSGA 4IJBA 4L4PA 1NVMA 1OEPA 4PMYA 4NJKA 1WDPA 1JCXA 4ZODA 3CHDA 3TXZA 4MNLA 3UR7A 3PUEA 4WD0A 2QKFA 4EXBA 3DFQA 1LL7A 1R3RA 4M81A 4C60A 4G56A 4IPPA 2J7FA 3CB3A 3WH6A 5BXTA 2QUVA 4O19A 1C9WA 1IZJA 3S1WA 4F9DA 4RNJA 3WLNA 3UERA 1MEIA 2D2HA 1E5JA 1V3LA 3O07A 1Y5VA 4R33A 3W86A 3A9IA 4AWTA 2NVDA 4OIFA 1HNYA 1TTQA 3E2RA 1P7TA 1BRLA 4O15A 5F2IA 1X1OA 3MZ2A 5JQ9A 1J2BA 1PKNA 5FL1A 3V1HA 3R12A 1L8PA 1R6WA 1VFFA 3G1HA 4V2XA 1PZ1A 3A4XA 1X38A 5BXSA 5EB8A 4JD4A 2VNCA 3KRBA 2UY4A 4ADTA 1O5KA 3VD5A 1TKKA 1VF8A 3B8VA 2OEJA 3CL8A 3TC3A 2X40A 4C1KA 3F4NA 1ECQA 4Y7EA 3G1SA 3GR4A 1P0BA 1VFHA 1C93A 2J8TA 1SM9A 3LCLA 1JDAA 1PKYA 2HRWA 4YTQA 3SN1A 3G5EA 1AUSL 4MY9A 2QMKA 1JI2A 3O7UA 1AODA 1DIOA 2G97A 1KWGA 3DKLA 1ZUAX 4MZ1A 5FACA 4NJGA 4KFPA 4Y9AA 2QS8A 3H4XA 3FVDA 3AXMA 1HFBA 4C6QA 1VIWA 3BGJA 1NY1A 1OCNA 1ZBKA 3FFSA 4NZ5A 1TPH1 2WW5A 1QVBA 2ESCA 4PUDA 2G41A 4PB3A 2J27A 3CV2A 4IF2A 4CD5A 3U57A 4EPDC 2CBVA 3QXBA 1S2WA 2YX0A 4MJ4A 3UT0A 1O66A 1QFEA 3NQCA 4F0SA 3WQPA 4PSPA 5D2VA 4QLLA 3K30A 3SCVA 4WEVX 3G6LA 4UUIA 1G9HA 3DYMA 2D2JA 3F2CA 1GVIA 1JL8A 5D2WA 5A8GA 4B3LA 3LHUA 2FZ8A 3CB8A 4HA4A 3C2EA 1W1A1 3CHFA 4BZYA 4Q8MA 4W8AA 4XZHA 4US5D 2ZZ2A 2P8BA 4KRUA 1ZU8A 1OFQA 4Z2IA 4DBWA 1J4EA 1TG7A 4FPSA 4NYYA 4XWUA 4IQEA 3EWXA 4S3AA 4QP0A 3APYA 3EBVA 5D04C 3LPGA 3UBPC 4UC5A 1HKVA 2ZUSA 4DXKA 4DI9A 3PHAA 3T09A 1J5SA 2YBTA 3C0JA 3T2OA 4ERGA 3AMKA 3GWQA 3PS7A 1H7RA 7REQA 3VVGA 4LNYA 3L9CA 4O1EA 3SAZA 3IAPA 2GK1B 3NYZA 3S5YA 3AWOA 3TYDA 1CW2A 3LXAA 3O6DA 4W9TA 5LHEA 1FCBA 3MUIA 1OQFA 3N9RA 4PC8A 1FWJC 3U6WA 1MNZA 4N42A 4RNHA 3MU7A 1QPRA 4MF4A 3TJXA 1SR9A 1XISA 4MLJA 3S42A 1V6YA 1BWKA 1XG4A 3KOZA 4KESA 4W84A 1T8XA 4D6JA 1XIEA 3PM6A 2XIBA 2Z29A 1EYEA 4XAFA 2GGJA 4MFDA 2VD8A 3ZSSA 1KO0A 3R6IA 3GC2A 3FXGA 3WDHA 4PBGA 5BWFA 3KDOA 2I7GA 3W1NA 3TQKA 3LPFA 1P0EA 2BMBA 3HFYA 1EEXA 2VCCA 2YA0A 2G3JA 3GW3A 1J2WA 2GWGA 2V5KA 3UZWA 3FHAA 3CPUA 4G5DA 3UWEA 4PUJA 4QNEA 4QROA 2O4QA 3G8EA 3VCCA 4QDMA 4KQNA 4ROQA 4LYQA 4O1FA 3KHJA 4F79A 3UXLA 3NQFA 1BGGA 3LB0A 5HPCA 2FDMA 3O63A 4NZFA 4Q7BA 3UCCA 3SUUA 2WWDA 3W7JA 1DTUA 1AD1A 1KFJA 3DHFA 2O56A 2J66A 3REQA 2YCEA 1LDCA 5AYBA 1US3A 2W63A 3LMZA 1PV8A 3NWRA 1R3YA 5HA7A 2VFDA 3GG0A 1XFBA 3IK4A 2NWSA 4LBRA 3R11A 2J25A 1CDGA 2EG8A 2E1DA 2DSVA 4DJEA 1LWHA 4TUFA 4JTSA 1WZKA 3G6MA 4MWAD 2NX3A 2OT1A 1LT8A 4UQ9A 3ZLGA 2V5CA 3CUJA 5HULA 1VFTA 3ARZA 4OHQA 4FS9A 4BS0A 2XGIA 4A3YA 4Q4RA 3N3TA 3NZ1A 3LGGA 2ZX5A 1UKSA 1XIIA 2YB4A 3KFTA 4GUFA 1Q6FA 4YVXA 3B0UX 1W3TA 3U3HA 1TA3B 4U3CA 5H8UA 4ZQRA 1C8YA 4QLKA 3LENA 3PSWA 3BLIA 1YXCA 2R6OA 4IGSA 2PP1A 4HN8A 4ALDA 2VVSA 3WX7A 7PTDA 3UZXA 1H1NA 1US2A 1L2UA 2PDIA 2CHNA 1QK2A 2D2GA 3L66A 1P5BA 2QV4A 3W6YA 5ABFA 3K8MA 3VGEA 3OZYA 3H4WA 3UWQA 2QW5A 2VJXA 3ZVHA 3WD0A 4BCEA 3INPA 1J0HA 3JRKA 3CTLA 3CZJA 3N1AA 1ZP4A 3OOQA 3MUXA 6ENLA 2WNWA 3A22A 4JKKA 3EAUA 5A6BD 1V02E 4YNGA 4CD8A 3GDKA 3TC7A 3T2PA 1AQFA 4G1KA 3WZ0E 1WXZA 1BQCA 4R85A 1GK8A 4MWAA 2O9PA 3NEVA 3V36A 3D0CA 2ALDA 2HMCA 4DWSD 1JYVA 1U30A 1K6WA 2CLPA 3A5VA 3H4GA 3QHMA 1XW8A 3G1YA 1XM3A 2XHYA 4BKNA 1TTIA 2PCQA 1ISZA 3W1MA 1IIGA 5D9PA 4CCEA 4X22A 4KEVA 5I5RA 3AHXA 2QCEA 2Y7DA 4IZGA 3BJSA 2FTYA 3L4YA 6XIAA 2X2YA 3TX9A 3WUBA 1MSSA 3S6TA 4B9ZA 2ISFA 1MQRA 4RZBA 3NSMA 4KCUA 3W83A 1Z44A 2QCDA 5KETA 3BICA 5HMSA 1DEDA 5LIWX 3VD9A 1JULA 4MB4A 4PEKA 5DY3A 3DYOA 4D71A 4CU7A 4E4UA 1TJ0A 1OGSA 1HVXA 3P8JA 1R3WA 1I2RA 1SJDA 3H12A 4V33A 1K3UA 4ZOBA 4EK7A 1Q8AA 1LWJA 2QDDA 4FZIA 3VZZA 4UB9A 4ONVA 1YX1A 1R7OA 1ADSA 3VOIA 4UQEA 2PGRA 3WLHA 1M5WA 1XBXA 3BSHA 3QR0A 3VNKA 1TIWA 4X60A 3CMGA 3POCA 5M5DA 3HG5A 1CYGA 3Q4DA 2WMJA 1F8MA 5A1AA 3IGUA 4WY0B 4KH2A 4GUJA 3KOWA 5LYRA 2FVKA 2ABBA 3ZLHA 2GPTA 4CQ8A 1PZ2A 4LUYA 2A0NA 3MQTA 4MM1A 1K70A 4OWGA 3MYPA 1HO1A 3GH7A 1MW3A 5I3GA 1EXBA 2PC4A 2VWSA 3LHVA 4YU1A 3T07A 2AL1A 1BAGA 3THUA 2Z2BA 3TC6A 1UWSA 5C9XA 3N6JA 2NQHA 4MY8A 4B5NA 1CLKA 4PUWA 3OG2A 4L9XA 4HT3A 3C2VA 1O6IA 1XLFA 1KRBC 4DUXA 3B8SA 3PZQA 3I7SA 5AHLA 2PP3A 4PGLA 4DJDA 3FVMA 3IS4A 2NT0A 1DTNA 3AMLA 1AFSA 3CXOA 3VIKA 3WLKX 4AD4A 1B3VA 1RJPA 3E1F1 1KGXA 2PF0A 4RDVA 3GUGA 3UR2A 2HQAA 4IQDA 3GRIA 4LUTA 3GU2A 4IMCA 3WJZA 2C71A 2QCHA 5LNUA 1FDZA 4IFKB 1KCLA 3RXZA 3C8NA 4CU8A 2YKKA 5AHIA 4PL2A 3OO2A 3TN3A 3CT2A 5IBXC 5BZAA 3OLGA 3V18A 4HMEA 1OHLA 1OK6A 1MNSA 4PFMA 2V2DA 2R82A 1Y65A 5EYWA 1IF2A 2I56A 1LORA 2ZICA 3UVAA 1WDSA 3B8IA 5HK4A 1IR1A 4H9XA 2GUBA 4O50A 1AH4A 1UR1A 2R14A 1T41A 2O7QA 2FZ9A 1ESWA 3FJLA 1OB0A 3SRFA 5G4EA 4TV5A 2PA6A 3V7PA 1RZMA 1F4HA 2VHLA 1B3ZA 2Y7EA 1UP3A 1SW7A 2VC6A 2VM8A 4OECA 3QY8A 4GOAA 2GSEA 4L5ZA 3VNYA 4XD4A 4PMUA 2V8ZA 1CB2A 3BQ6A 1X7FA 4XZLX 3BURA 3QPZA 3WNNA 3MKKA 4H8UA 3U2EA 1JGIA 4QX4A 3E0WA 3A3HA 4L64A 5HATA 3TUUA 3WMSA 2EPLX 4G1NA 1FWBC 3WQGA 4FO4A 1H09A 2VR4A 2D3LA 4KF1A 5FA5A 1FUYA 4N0RA 5A6LA 4O17A 4DN1A 4DWSB 1DIEA 2J13A 3OU8A 5KZMA 2CZDA 2OODA 5CZSA 1P4CA 1K77A 3B8TA 1P0NA 2VGBA 2NUWA 3WUGA 2WC3A 5ENLA 3C0QA 1DIDA 4DHGA 3P8IA 3L4WA 3M44A 4U33A 5GJNA 1PWMA 3LBMA 2XVPA 3S8HA 2ZCGA 5A95A 2W9MA 1H51A 4OV4A 5FEZA 2OJPA 2OT0A 3Q94A 1H0GA 1V08A 3ARXA 5T9CE 5E1QA 4GQGA 4IPLA 3NL2A 1KV5A 2BODX 4D6CA 3ITLA 2XIOA 1F61A 3L5LA 2R91A 4YXGA 2PU0A 5AVHA 1RQBA 3LTYA 5KZ6A 4D1IA 2QJIA 2WC4A 5HNNA 2XSXA 3AYSA 3VM5A 5ECVA 1U2YA 5LA0A 4XK2A 4D8AA 3Q37A 1I60A 1A53A 2W79A 3TE9A 3N15A 2XVKA 4HIBA 5A6TC 3UR8A 2WVTA 1GTHA 3UPMA 3E02A 2J75A 3UCDA 1N55A 1K8CA 1SQ7A 1DXEA 1HGYA 2PP0A 3RCNA 3HURA 1T7LA 3RJYA 1NOFA 1PAMA 3B03A 1J0JA 1WAWA 3FJ4A 4MYAA 3ARYA 4A35A 5G2WA 5CAHA 4BWLA 3SCTA 3W4RA 1GYNA 3AMDA 3GDBA 3E74A 4MZYA 1P6BA 2NX9A 1DJNA 1J6PA 4NIRA 1NIUA 3LXCA 2KX9A 4RPQA 5K7JA 1UP2A 3UJSA 3W28A 2HK1A 4JQ4A 1D3CA 3UJRA 3FYPA 4NX0A 1Y7VA 1QO5A 2YL6A 3MWCA 3QJAA 3WUEA 1GW1A 3TZFA 1XR2A 1QI3A 1TPDA 3AJXA 1NFPA 1W3NA 3VYLA 2CFFA 1EC7A 2VDGA 2GSHA 1E6ZA 1KLYA 2BXVA 1KC7A 4H9ZA 4JBRA 4HPJA 3N12A 1MUMA 1N7KA 1B0IA 3IJQA 2JE8A 3AIEA 4PUMA 4RX0A 1XLEA 4A8RA 2C14A 1JJKA 1K8XA 3W70A 3XISA 5I06A 2DT0A 1EDQA 3SCOA 5I77A 4QGCA 2A7RA 8CGTA 3R8GA 1D7FA 2XPKA 4KERA 4CCDA 1UOZA 3SECA 2BOFX 5CG0A 3A64A 2AL2B 2ISDA 3LHTA 4AZCA 3L4XA 1PUDA 2WBGA 3GK0A 1W54A 3G1RA 1PKMA 4FXRA 2REQB 1NQKA 3D5HA 2OPJA 2CETA 4EVZA 4RR4A 3VGGA 4RE2A 1YTKA 4QEEA 4MWAE 4RV8A 4LEFA 4PMXA 3BLPX 2GUUA 3N19B 4GJIA 2CLOA 1RPXA 4AIOA 5A6AA 1LRNA 2WJZA 4F9JA 5GJMA 1AJZA 4UNIA 4S2BA 5FF0A 3BG3A 2NV1A 3LRMA 4WR3A 5D05A 2VEPA 3BVJA 1XLBA 3UYIA 4ZO9A 3BW4A 3SCRA 3LS9A 3VOGA 4U5IA 4UFLA 3QR1A 2GWNA 5GNXA 3AXIA 1FWNA 1K4GA 3TSDA 3P74A 2PWHA 2B0MA 4R3UA 3RX4A 4LAOA 3AI0A 3CTTA 1R3QA 2CERA 4HNOA 1HXJA 2DSWA 3KOXA 3A13A 4H7VA 4QJ5B 5I07A 4JTDA 1DQXA 1GGOA 3GTHA 3NL3A 3TCSA 4ROPA 3KS5A 1FH8A 1EH9A 3SW6A 3CL6A 3NQVA 3KVKA 1YXYA 4GQRA 1KXVA 3G3DA 1W3KA 5B7ZA 1LQ2A 2FJUB 1KM0A 1XIBA 3MPGA 3RLHA 4DVOA 5IFPA 3DFOA 2OYMA 3CWOX 1R5YA 3HPSA 3W75A 4ZO8A 4AYGA 1TUFA 1XIDA 1EYWA 1EJXC 4AHPA 4UOQA 2CLIA 1FOBA 2EJ1A 3WQDA 1DQUA 4KWVA 2Z2AA 2Y5EA 2GDQA 1IWPA 3QTGA 3I4EA 4LY4A 1UR8A 3C3NA 4LCQA 4OE7A 4IPIA 3N18A 4IUOA 1CGUA 4OJYA 4NASA 3W29A 4XO7A 4HOWA 2AQOA 3HU7A 2VGFA 2XJ7A 2Y85A 1H1ZA 1CPUA 2OWXA 4IFRA 4V1XA 2PLMA 1MZRA 3VOHA 4I6KA 1F74A 1F9CA 1VBHA 1H0IA 3LHWA 2PTXA 4D6FA 1JF6A 3VZYA 3WUFA 1XICA 3M0XA 1PDYA 1ML1A 2PI6A 5CSSA 1LBFA 4HMCA 3L5MA 1PE1A 4I8YA 4S3EA 5IHSA 1AW2A 2OQLA 3FSTA 1XDJA 1EOMA 3JR2A 1NU5A 3EPNA 2JK2A 2OX1A 3T42A 2ZZ3A 1RK6A 3QMSA 2E6FA 4ZTXA 1UW9A 4CNUA 4FXJA 1TELA 3MDWA 1EUNA 4HP5A 3GNOA 1H1YA 1OFPA 4HHLA 4LAUA 1WOAA 3EKZA 1QI5A 2ZE3A 4QIUA 3I3DA 1X6UA 3EDDA 3PTMA 1UR0A 4IIBA 1LRQA 3MUCA 2OR2A 3VDBA 1EHAA 4GYJA 3CEPA 2GJPA 4H8NA 1W9PA 7A3HA 3IVTA 3M0YA 4A4AA 4UCGA 3DH7A 3W1TA 4YIWA 1I1WA 1V7AA 3ANVA 3W00A 3GIPA 4DM1A 4P8VA 2OCZA 3GAKA 4J28A 1NF0A 3MO4A 4L7ZA 1UKPA 4LUSB 5FJOA 2WVVA 2PWDA 1FH7A 3V5OA 3HOJA 3TYCA 4XUGA 3L4UA 4ATDA 3I3EA 2PDFA 2V3EA 5K9XA 1H7NA 1M7OA 1BF2A 1ZJHA 2P8CA 1CENA 3T05A 4D1JA 1XJBA 3GTFA 3N2OA 4RUBA 3T0TA 3WSUA 5I3FA 5XINA 2ZX7A 2HV5A 2OSXA 2TPSA 3H23A 2ZXDA 4EPKA 3HF3A 5DANA 3SRHA 4REQA 3NZPA 1DHPA 3RFAA 5BW6A 1PX3A 4C6EA 2XSAA 5LSMA 4Z1YA 5REQA 1HUVA 3FW6A 4HYRA 4QAIA 3W25A 3W1XA 4Z2HA 5A6MA 4CUCA 3ES7A 7CGTA 1GZJA 3KEHA 4ASTA 4AIBA 2EHHA 3R25A 1UUMA 3BPWA 5FAGA 2D0HA 4JY8A 3USBA 3ABOA 3A47A 4M7TA 3T78A 3ARUA 3G3MA 4IL2A 3EOLA 2DZAA 3SY8A 4PUNA 4MLRA 3WQ4A 3L0GA 4CQDA 3UU0A 2KZHA 3FOKA 4IXXA 4PBEA 3WDRA 1IXQA 1F3EA 3MBFA 2FTPA 5CSUA 2W4XA 4AY7A 1X96A 1XRFA 3IGHX 3NL6A 4NX5A 3RO6A 3LGDA 3SUTA 3VUSA 4ICCX 2XM1A 5E09A 4AMAA 4TOQA 2EF9A 1XHGA 3RG6A 1TCDA 1EP2A 1QHZA 4R9OA 1ZENA 3M16A 4DX3A 4UMBA 4WIWA 2QCMA 2CBJA 3QN3A 3UG3A 1EJTC 2ZA2A 1IXOA 4PUEA 4JTLA 3U7VA 3HPZA 4M3PA 2NV9A 3AAMA 3R94A 1X39A 2WQPA 1JCMP 3KCJA 2FKPA 3HBLA 2B81A 3AIWA 4O4WA 1XCXA 4DIAA 3RAOA 5DLCA 3E5PA 3RHGA 2ZC1A 1BLIA 4UFHA 1MRAA 3QW3A 1EJWC 3ZLFA 1N8IA 1OD8A 4KRTA 2X0HA 4A8LA 2J7HA 1E9LA 1JPMA 2X09A 4KEZA 2Q09A 4J3ZA 4DAIA 2BP1A 1HJUA 4QAWA 4BQ2A 1RAKA 4ZOEA 1AH3A 2ZXAA 3W7EA 5MKGA 4JY9A 2V2HA 4Q8VA 1BF6A 4GZIA 2RDUA 5JVLA 1MFUA 2NXGA 3PJWA 4CN1A 3BQ5A 4K8HA 2ICSA 4IJRA 3OGRA 4LX4A 4HPGA 5FI8A 1AW5A 3EKGA 1L6SA 1SU5A 4YTRA 5FD0A 4LB3A 3A23A 3LM7A 5CJMA 5JU6A 3A12A 2GYIA 4L80A 5D03A 3CHEA 1RVGA 1FCQA 4E8CA 1OC6A 5C7HA 1G69A 3GZ3A 2RJHA 4TX8A 3VILA 5DN1A 5XIAA 2XIIA 1V3HA 1J9YA 4NJHA 3W6MA 2VMFA 4JR5A 2ATMA 1VJSA 3BL3A 3IUDA 4NQ1A 3QY7A 2X8RA 3UR5A 4E8DA 2ACRA 2C0HA 4P7OA 1PZ0A 3DIPA 2ATSA 2BHUA 4FR1A 1VFSA 1T0OA 4BFAA 3DHUA 5E0KA 4Y2WA 3HQNA 3HJEA 4DBSA 5FOOA 4LS2A 4YTUA 5LIYX 1B31A 2V5LA 4A3UA 1GOXA 4DJFD 1EOKA 4GVHA 3T08A 3M1ZA 3NZGA 3LZ3A 1BD0A 1OG0A 1LTDA 1ZGDA 3CEUA 1DVJA 1CT5A 1FRBA 1S2TA 1FDYA 3GHRA 3HIJA 1PL9A 4RLIA 3GU9A 2QCNA 1A0CA 3VDGA 2WMIB 4R7WA 4XZBA 3K4AA 5EMYA 3KP1A 4PBFA 4D8LA 4QR6A 2VFIA 2NQJA 2J77A 3F4WA 1E4IA 2XM2A 4KWUA 2NVAA 2RDTA 2PAJA 3ICJA 3DGRA 1T99A 3ZM8A 1GOWA 3NJ3A 4IMGA 3O6CA 4J4KA 4RE3A 1GTEA 3MB9A 5JH1A 3VDHA 5C55A 3LPPA 3KBVA 3TW7A 4M5PA 2VCAA 3W1LA 2BGQA 3VIIA 4GUGA 1QOPA 3W7DA 3PBYA 3GLCA 2VGIA 3IANA 3ME3A 1PIGA 3IJ7A 4DJEC 3QGKC 1VIZA 1AMYA 4Q32A 1FWHC 1PO9A 3NYDA 3ITCA 4IM4A 1IQ8A 1TX2A 4M6UA 3GNPA 2G0WA 3WMCA 3QZ6A 3PZUA 3AJ7A 3FGCA 5AHFA 4CGTA 5CC6A 2UBPC 4Q8UA 3WJYA 1EX1A 1J79A 4JHZA 3NQEA 1BXCA 2XFWA 1IEWA 4H01A 3N4FA 3VI2A 5C7VA 1L6GA 1X7IA 2WNZA 3EPOA 3NCOA 1YLVA 1EGZA 5DBUA 1GQIA 3B0PA 1F6PA 4BJHA 2ZUUA 4YVPA 3MVIA 5I02A 2EG6A 3U5UA 1LROA 4A3HA 4Z1BA 1W3JA 5CZTA 2ZX8A 3WFLA 6PTDA 2WNNA 5CGQA 3D3FA 3RYSA 1JUKA 3OP2A 3MI3A 4GH1A 3IJLA 4WKFA 1TPUA 3AIUA 4QE1A 4AVNA 3GNDA 3W02A 2HSAA 4Q7NA 5I23A 3RGTA 1RPKA 4QLJA 4P7QA 4FLQA 4JOMA 4X0NA 4RDWA 1XYAA 3MTWA 1P43A 1JZ5A 1F8IA 2NUYA 3AQUA 3KWXA 1OX4A 4IIGA 3BUVA 5ABTA 1HTIA 4L6DA 3PJUA 4NJIA 1KV8A 4WZHA 1EC9A 3GB6A 2AGKA 3RK8A 4MIMA 5FEXA 1R38A 2PPGA 1BYBA 3MJYA 2VX6A 5KITA 4PCTA 4W7UA 3BAYA 3WBEA 4HA1A 2C1IA 4NYUA 3IJ6A 3AZRA 2W27A 3S1VA 3G1VA 1K9TA 1WDQA 3BMWA 3P0WA 1L8NA 4S2CA 4HNLA 8TIMA 1OD0A 4XSMA 5LA1A 2FMNA 4LVAA 3H8AA 5F1UA 5CPLA 4IPJA 5A2BA 1UBSA 2YA2A 2I5GA 1LQ0A 1EQPA 4F0LA 2JF6A 3RX2A 1VYRA 3GNXA 3LHYA 4MTVA 5GNZA 5CPNA 3UZ5A 1J5TA 4IX0A 1A5OC 1YTEA 3O6AA 4A3QA 3LTPA 4C6BA 5CKSA 1CXKA 3NNTA 3WH7A 3T44A 1W6TA 4S3BA 3OVGA 4U28A 2IPWA 3HG4A 5AC6A 4I90A 2VEGA 1HJSA 1JD7A 3YPIA 4OTKA 2ZZ4A 2X41A 3AC0A 1VPYA 4LVGA 4GQQA 3FYOA 4GH3A 4JTCA 1UB3A 5BNKA 4UTLA 4RKAA 3UJFA 1QW9A 1VAHA 1JI1A 1UC4A 4O4VA 2PTYA 1V6WA 1X1ZA 3TN6A 2BY1A 1TPB1 1WZAA 1FHLA 4O53A 4XAZA 1QO2A 1NOWA 5K4ZA 2AQWA 4K38A 1OY0A 1V3MA 5IFTA 4ACZB 2XIMA 3FYYA 4U3AA 3T8LA 4Q8TA 4N4QA 1H3GA 3ZOAA 2YIHA 2OLSA 5J04A 3PK7A 1FKXA 5BMXA 4PRTA 2QF8A 5HJLA 5AHMA 1M3UA 4QSHA 4LU0A 3CZKA 4J3XA 4RK8A 4J1OA 4TR9A 4I5XA 1I45A 3M7WA 3S2LA 1RQHA 1Q6RA 3WMLA 1WPCA 3GXIA 1D7KA 3KLKA 3MSDA 4HB7A 5D32A 1XIJA 3JU2A 4E2VA 3NQDA 5EL1A 1EC8A 2GL5A 1E3XA 2POTA 1CGXA 3BLLA 3LG3A 4X0VA 1ONEA 3SEPA 3PR2A 2E77A 3O2LA 2W61A 4FX6M 1B5TA 1UR4A 3E49A 2BY3A 4IOTA 3KRSA 1J93A 3E0IA 1UKTA 4A05A 4G7EB 4PRWA 1PHWA 5HDRA 1RSCA 4LJ3A 4R34A 3K2GA 3VNJA 4ZE5A 2ZKMX 4C6FA 1E71M 1NDYA 2YL9A 4AXNA 3TJIA 1RJQA 1I0BA 1EBGA 1VPXA 1JNDA 2PC8A 3RRXA 3NG3A 1G01A 1E1CB 1WQ5A 2ACSA 2QUTA 2XZ7A 1N82A 3L12A 2IPJA 1Q7MA 4JN6A 3EOEA 4LS1A 4BEUA 2AKMA 3HMCA 1XCWA 1JFXA 1GQJA 1XD1A 4EWND 3KZSA 4O0ZA 1KCXA 2A7PA 1MUCA 1MXGA 4LC6A 3VE9A 4L9ZA 2RGLA 3WD3A 1XIMA 4ECLA 3NSNA 3CPGA 1V79A 1KM2A 1TYGA 2Z7KA 3AO0A 3PSVA 2KAUC 4PMZA 1PEZA 1YDNA 4S38A 4MKVA 1TPVA 1IEQA 2E8ZA 1DPMA 3CZEA 5K9DA 4CQ9A 1G4PA 1LOLA 5CH9A 2ZX9A 1OSEA 1IEXA 1EJRC 3RM8A 4FK9A 5HWJA 3NFUA 3QGAC 2Y63A 1QPNA 2X2GA 4KEMA 4QCEA 3BLDA 2XU2A 3GR7A 1UH2A 2C0AA 1D2KA 3LMYA 2YDAA 2VELA 2WZMA 1OT2A 3AXHA 4C6NA 5XIMA 3GXPA 3GD6A 1B4KA 3KXQA 3LCFA 4KIEA 3GXMA 4B5UA 4IISA 1XKYA 3COTA 2VZVA 4GIEA 1Q2RA 1UWIA 3M4HA 5LIKX 3WH8A 1W8SA 2DVXA 2CWNA 2ISVA 1RQEA 4Y9PA 3DKJA 4IFOA 5G4WA 1UA3A 3GVGA 3N13A 2Y70A 3LRLA 3SCPA 4DUOA 3M47A 3UWUA 2ZXQA 1UWAA 2ZZ6A 1RV8A 1PIFA 8XIMA 1JAKA 4JKLA 4Y9NA 2F6UA 4JFUA 5FF7A 5EGRA 3UPWA 3SJNA 1PTDA 3WD1A 3AZTA 1G4TA 3O05A 1R47A 4HGXA 4QTGA 1C7TA 2W6RA 1QTWA 1F76A 5CBJA 4DAFA 1E4MM 5CPTA 2TMDA 4QBXA 1OX5A 3HV8A 1KCZA 4BWLC 3UXAA 4N7QA 3U48A 1WUEA 1PHQA 2YW4A 3U4FA 3MP4A 4UQAA 2VFFA 4F66A 2O9RA 1E6XM 3IAQA 1ZFJA 2WM0A 1PSCA 5DT5A 3PNZA 1C7SA 5HANA 2BV9A 4S1FA 2H9AA 2EXOA 3WF0A 2XFRA 3DGBA 4QITA 2W62A 1VENA 3UJ2A 1BYCA 4N6FA 2Z1SA 4AW7A 5D30A 2YCLA 4D6IA 1E6RA 1UASA 3N17A 4QSFA 4ZQPA 2DQWA 4HA0A 2Z28A 2YCJA 2Z1KA 2DZSA 3W81A 1Z41A 1OWQA 3GHUA 2GQ3A 3MSGA 3CQIA 2QT3A 3NOEA 2FZMA 4Z0SA 2GVYA 5I3IA 3CZGA 4JTEA 2PFHA 4KPLA 4ZB5A 3GIYA 4IG2A 3C0SA 4LWWA 5LGXA 2BGSA 3AIBA 4W8BA 5GNYA 2INZA 3BCDA 1Z48A 4YMZA 2OQHA 2V82A 4XUYA 3EOUA 5C9WA 4D9PA 4J2MA 4MNJA 1ZAJA 4JS3A 1IGSA 3F4CA 1DIKA 1XSKA 1SO5A 1EIXA 3PF3A 3GVRA 1X8CA 1L9WA 2D23A 3DG6A 1FHUA 3G1DA 4FOJA 1NWUA 4HPNA 2OZ8A 2Y0FA 1J12A 4PA8A 4DBDA 4UZUA 1ZP3A 2F6KA 3AUOA 3RLGA 5AYZA 4HD5A 3H7VA 1NSJA 3MV11 4K8GA 3QHNA 4JNMA 2PDHA 4JTRA 4AZ7A 4M29A 4JGDA 4WLCA 5AB3A 5M1TA 2QULA 1M9HA 1C8VA 1VCFA 3MKVA 2H3BA 2GJXB 1ONXA 4WKHA 5HJXA 3W7CA 5DXYA 3KBMA 3CAWA 4YHEA 1CECA 1E55A 1R3VA 4ZENA 2F2KA 1W32A 4C5ZA 1P6CA 2VZSA 5HQEA 3OLIA 4BR1A 3EXSA 3L23A 1SJAA 3TTQA 2VP8A 3OVQA 3PZIA 3DYPA 5FJUA 3H2FA 3TFXA 1L6WA 1UUOA 3WJWA 3F4DA 1H7OA 3M0HA 3GE7A 4EAMA 3CK5A 1Z69A 2PWUA 2BNJA 4YTSA 5EY5A 2YDQA 2D3NA 1A4MA 3B3DA 5A94A 1TUXA 4F0RA 2WMKA 4YTTA 3N9KA 1XQLA 4ERIA 1YHTA 4GFSA 2J4GA 4LNCA 1X6LA 2BASA 1GKRA 1W2PA 4PUKA 4KBXA 2C3ZA 4MJMA 4E2DA 1NWSA 3KE0A 2PDYA 1UJQA 2F9RA 2VUYA 4HNCA 3SGUA 5E6ZA 3TNOA 2D20A 3UYCA 1C3FA 1DWFM 1IZCA 4HU0A 3ELFA 4WJ8A 2QR6A 1ZBWA 3R8HA 2J9ZA 4AFYA 2ABAA 1AW1A 2E4TA 1RBLA 4EPBC 1JCTA 3LYEA 3R10A 2FVLA 4YN5A 4S3DA 3ONCA 4LBSA 2ZUWA 4L65A 3URNA 4ADUA 4XKYB 2RDWA 1BVNP 4R7OA 3MYOA 3HG3A 1OYAA 3PZMA 1HP5A 3KBJA 1HZYA 7XIMA 5BMWA 1RP8A 3PBGA 3UNDA 1GOKA 4P7LA 3OYXA 1VYSX 1E70M 1XIGA 4WOZA 5G2IA 5HNRA 3QYSA 5DMMA 3PZTA 4PZVA 4HK6A 4B92A 1RH9A 4GI8A 1IGWA 2XIQA 3ERPA 1YDVA 4S3KA 2VT0A 1QNPA 4Y9OA 1IIHA 1MFVA 3P84A 3W27A 1CXLA 4E6MA 2W91A 1H61A 4JTTA 1Q5MA 3QZEA 2QVHA 3LLFA 4ATWA 1ISVA 4F3HA 3WJXA 3KWSA 2QLYA 4XTIA 4Q4PA 2FB2A 1XPGA 3LGEA 3OPSA 4S3JA 2Y4SA 4HSNA 1K9FA 1TV8A 2VVNA 1MW0A 2D0GA 1EUAA 2QXWA 2RFGA 1XRVA 2QDGA 1TMQA 2O7SA 1R0MA 1R3SA 2DGAA 4XBKA 3B40A 1REQA 1UIOA 1LBLA 1WDRA 1NP0A 3WYZA 4O54A 3UWWA 3Q67A 4M51A 3ECQA 3UNTA 3HV9A 4MG4A 4KGJA 3T0CA 4N9CA 2J7EA 4U5KA 3L4ZA 4GI4A 3PTDA 5C6MA 1JUBA 2PBGA 4PRRA 2OGYA 4GKTA 3WELA 1VFOA 5CZKA 2PODA 4RDZA 1QRQA 4C6OA 4GZ7A 1CGWA 4O57A 2OKOA 2Y24A 5I03A 1K8ZA 1TE6A 4DO4A 1ME7A 4JN8A 4Y8FA 3S4TA 3B4UA 1D9EA 3SB0A 1FH9A 3VIJA 1FKWA 2EPKX 5JBDA 5FJPA 1J96A 4LOCA 3VNIA 3THQA 2CW6A 3FEQA 3QGVA 4V1YA 4WSKA 1SFTA 2VC7A 3UWZA 1W1IE 4HHMA 4I9AA 3ZVIA 3FK4A 1R9XA 3E2QA 1B9ZA 3T40A 4PODA 1KNWA 3DC8A 1YDOA 4AEEA 3GKAA 1Y8BA 7TAAA 3QLDA 4HPXA 1OGBA 2X30A 4HK7A 3LY0A 3M0KA 3EDKA 4NAFA 4FF5A 5C2XA 3VMNA 3BLKA 1E73M 4HZ8A 1PPIA 3O9NA 2Z6JA 2WJDA 3WL1A 2WMHA 4P7NA 3ZJ7A 4O0KA 4EF9A 5AC7A 2QJMA 1LL4A 1B30A 1MW1A 1SGJA 1JYWA 2YXGA 3SFKA 2RJGA 3GW0A 1EO5A 3TOYA 2CU0A 2BX7A 1HQTA 2BY2A 2E25A 3QLLA 1EKOA 4Z17A 3WH9A 1BHGA 3TNBA 3UESA 3N14A 3EX2A 4GY7A 1A0DA 1QNVA 2BFGA 1Q6EA 2YPIA 1RY8A 3AU6A 1C8XA 1LZOA 4ZXLA 3SRDA 1JDCA 2D22A 3TVAA 4DF1A 3BAKA 4IPNB 4V15A 4XZNX 3WNPA 3PZ9A 3GUWA 3SI9A 3N4AA 4CQAA 3EWBX 2NQ9A 5BXPA 1NDZA 3BZGA 4QNWA 3SUWA 4HHHA 3T0DA 4Q8WA 2PDLA 2DPEA 5D9OA 5BXRA 2TAAA 2CYGA 3SR7A 1UYQA 4IIHA 2WMGA 4AZHA 3QM3A 4RCXA 5HR7A 4IP5A 1PB0A 2E5CA 4B5SA 4M6QA 1FFRA 3QFWA 2WSYA 4UBPC 1W2VA 1V4YA 2FHCA 2ANUA 2J47A 3GO2A 3S2MA 4XSLA 2J6VA 1GQKA 3BO9A 4GUHA 2ZTJA 1A80A 2F2HA 1YNPA 1BPLB 2GDVA 3LCGA 4GK8A 3PUGA 3NQMA 2ZFAA 2CZFA 1POKA 3VOFA 1OC7A 2PGEA 4YCOA 3CUXA 3GAYA 1PKLA 1YQ2A 2FB3A 4RNIA 5I79A 1SMAA 5DO8A 2G96A 4GCAA 1NELA 1O94A 4I3GA 3E3HA 3MA8A 3O0FA 3CWNA 3EYPA 3W2JA 3N34A 1Y5XA 3ABXA 3C52A 3GDTA 1ONWA 3M0LA 1S1RA 3BOXA 2OLAA 5EBUA 4WXYA 1SW3A 1E4NA 5CLTA 5HPOA 5DELA 3LI1A 2FTWA 4M82A 1TZ7A 3CYVA 2ZE0A 2OWCA 1ME9A 5HR6A 3MCOA 4UOJA 4PTNA 3M41A 4AF0B 2WLYA 1DQWA 3VGHA 1S3TC 2OYLA 2F7FA 3KUMA 4DEFA 3LNMA 2IXVA 4LF1A 3UPBA 4ERAA 3UJEA 3SJ3A 3T81A 1SFLA 1UD6A 1NQ6A 4DB7A 4JYEA 4NVTA 1UD8A 3NM3A 3GTNA 2JGQA 5GQBA 1XV8A 1BVZA 1ZPTA 4DI8A 4M7SA 4Q6JA 2A6LA 1LQAA 2J8FA 2VRKA 1PTGA 4BI5A 1XXXA 1FWSA 1XSIA 4OOZA 4WY0F 5BRQA 4HOXA 1SO4A 3NQ7A 1VBGA 4F8XA 1XYFA 2BXYA 1GZ1A 5TBOA 1XSJA 2X0YA 4KFNA 3W7OA 4Z0JA 1W1PA 1BFNA 4QG9A 5IRPA 1I8JA 5CPQA 4LYRA 4H7ZA 1HN1A 4FHAA 4Z2LA 4GY0A 2CWXA 3QHOA 1Q7ZA 4L1GA 5D8ZA 5CAKA 1ITUA 1A5SA 1UR9A 1WBJA 1XKJA 1ITXA 5H91A 3TN5A 3BJFA 3PC0A 2QHAA 3QYQA 1ELSA 4HZ6A 4XD3A 1E3ZA 5D9MA 3QY6A 2PD9A 2L5HA 3P5YA 3PZVA 2HXUA 1TREA 5AYXA 5EPDA 5I3HA 3TJLA 5K3VA 4JYDA 3H2AA 2I5IA 2I1OA 4X61A 5IHRA 1GQNA 5M3WA 1IV8A 1I0DA 3S5SA 1JD9A 5LNSA 3EB2A 1UBPC 3QSRA 5C2CA 2ISSA 4GHRA 3WF1A 2DORA 2F84A 3O3RA 1QXLA 3M5XA 2I17A 1ODUA 5BYWA 4A8IA 3DBNA 4PCFA 3GYEA 2DZXA 4MPKA 4OUEA 4ICNA 1ZS2A 3BC9A 3KM8A 2HVOA 1OFRA 1JAEA 5HAOA 1SW0A 3EEZA 3BLEA 4KCTA 3TN4A 3NO3A 2XIJA 3MKCA 1LM1A 1VD6A 2ZUTA 4DZIA 3FDGA 2BHZA 1LUCB 4X2RA 3P0XA 4Q33A 4PH6A 4DF0A 1BG4A 7TIMA 2HJPA 3ZR5A 2GK1A 3EA3A 4RZ5A 1TPFA 1VR6A 2DSZA 3W9ZA 1DV7A 2FGBA 2OEMA 3TEVA 1H62A 5I6SA 3U7BA 4YWIA 2RH9A 3H6OA 2Z26A 4L4LA 1UH4A 4QRNA 2X7WA 3L65A 1NEYA 1AJ2A 5KMYA 3ZZ1A 3R0DA 2VWTA 2VX4A 4JIRA 3SGZA 4HCHA 3GDMA 3NO1A 4DM2A 1QT1A 2ZA1A 4GJJA 1Q6OA 3PUDA 1W1ZA 2QCGA 4E0CA 4LRTA 5H1WA 3WH5A 5F7UA 3CUGA 2D24A 4QDWA 1OCJA 3I6RA 5CPOA 3T55A 1YNYA 2HVNA 5LZLA 3BAWA 3TCEA 2Z27A 3LRKA 4JX5A 2XVGA 3SCQA 1MUWA 5D2XA 5U4NA 3EWYA 2FIQA 3BH4A 3OGVA 2V5DA 4IL0A 1CLXA 4L6OA 2VC9A 3VD7A 4LVFA 1GORA 4MGGA 3VIMA 3CNYA 2Q3RA 1XLHA 2CBUA 2GJNA 1FVPA 3FKKA 3S6OA 5I0DA 3VGBA 3FA3A 2ON3A 4WGHA 1C91A 1VFUA 3K4DA 3D46A 3QKEA 3OIHA 1MZHA 4NILA 1AA1B 2UV8G 3QVQA 2RUSA 4W8LA 2OZTA 2HS8A 5EU9A 2V38A 1TVLA 2P0IA 1FHVA 2ZRWA 3PY2A 1TE1A 1LLOA 4KWSA 1E1FA 1YRRA 1BWLA 1C29A 4HNUA 3PUOA 2Z4GA 3EDFA 3P6LA 3M5VA 3RR4A 4QISA 5H6HA 1MWOA 5TIMA 1AZ1A 4EE9A 4M80A 1TR1A 3P82A 2DY3A 3BV4A 3CUFA 2O4MA 4WCJA 5EMLA 1Z8AA 4CN4A 3QOKA 5FJTA 3NQBA 4N9BA 3UZZA 1KR0A 5IM51 4IMAA 3O15A 4LEQA 3DZ1A 5HMDA 3LQGA 7ODCA 1VRXA 4C91A 1XLCA 4FXSA 1O1ZA 3RRAA 4UFKA 4UMAA 4TO8A 3QPEA 2XSBA 3WBYA 5IXEA 1TA3A 1XLLA 1QOQA 5JIWA 2WKLA 4M24A 4U2YA 2SFPA 3F2BA 3O6YX 1PZ3A 2XN0A 2AGTA 3WENA 4K37A 3DFHA 4MADA 4FLRA 1O68A 4I9MA 3H2OA 1SJCA 3NUKA 5GJPA 4LUJA 3OLEA 3TQPA 3PULA 3W22A 2QVNA 4M1RA 3P2VA 3DOPA 2GQAA 1QOXA 3KX6A 2OSYA 3IWPA 4ZQCA 4DBUA 1HL8A 2Y89A 5C9UA 1JPHA 1UZ1A 2VGGA 2O0TA 3UA4A 1R2RA 3TSBA 3WY1A 4YWSA 3C86A 4W93A 2HWGA 4IMDA 3HPXA 4US5A 2VD9A 2FMOA 3N25A 3LSCA 1VP5A 1LRTA 5CC3A 3OBKA 2RKXA 2CZ5A 4CN6A 3HPFA 3BTNA 1I6NA 4OBRA 4B90A 2P5NA 2WJEA 1AZ2A 2EO7A 2WWCA 1OIMA 3KAOA 2R9RA 4DZHA 5C5YA 3MCMA 1CTNA 3P81A 3WQWA 2IKJA 3N2BA 3EWWA 4BQ3A 5ABHA 1E5NA 3KLLA 3PBUA 4H9YA 1SO3A 4GC3A 3W1RA 1Q6LA 3MS8A 3B4YA 2PZNA 3CQJA 2GGEA 4Z08A 4NG3A 3F1QA 1SZGA 2V0TA 3N6QA 2B7QA 2PWFA 3TJ4A 3GVVA 3VA8A 4W5UA 4B5XA 1F05A 2PLKA 3B8UA 3EA2A 1UD2A 1FWRA 1H5VA 4H2CA 3VKBA 1DYSA 5GVJA 2POZA 3LV5A 3W85A 5ABGA 3OZPA 1M6JA 1XIHA 4LRSA 4PMNA 3P62A 5HWMA 4GBUA 4Y6GA 3WLPA 2GGGA 4A21A 4UNLA 2D0FA 4C1NB 3FJNA 3RLVA 2DP3A 4GKLA 4M6PA 2AMXA 1A0EA 2CKSA 4AZ6A 1JZ2A 5A6SA 2NLIA 1E40A 3W74A 1XH2A 4GY1A 1B3XA 4JNZA 4AH7A 5HOSA 4GYPC 2ZBTA 1UA7A 4FOKA 4MJZA 2VO5A 3LLDA 1RA0A 1KXQA 1RBAA 3M9YA 2VR5A 4WY0A 3KTSA 3OA5A 4NNBA 3HA1A 3FLUA 2HE5A 1CWYA 4ORIA 4RXFA 3U5YA 3N2TA 2E40A 4GIYA 3UG4A 1ZY9A 1EWEA 1FHDA 3JS3A 2OEKA 4R7JA 5CJNA 3ZS4A 3VMOA 1WE5A 1K8YA 3N9SA 3UGVA 4WSHA 1GW9A 5CZJA 4M8UA 2WSQA 4H19A 1I2OA 2VEMA 4HNNA 5EA9A 1OYCA 1OFEA 2XH7A 3AROA 3GBEA 4FIQA 5EMJA 4MZ8A 3WMBA 4JCMA 3MY9A 2Q6ZA 2W5FA 2CZEA 1MW2A 1FCVA 1DJYA 1FWCC 1RUSA 3K46A 4HZMA 1SR0A 1KRMA 5CZ0A 1P1MA 4RJEA 3QF0A 1W37A 3V0TA 3SSJA 3F5KA 4LF2A 1Q65A 2ZWZA 3VO0A 1V8EA 1CGYA 5AHNA 4W4QA 5F4WA 3VCNA 2NV2A 6ALDA 1P48A 5DMYA 3CGTA 5TQLA 2XH2A 5K2ZA 4IFKA 4JHMA 4IH3A 1TV4A 2E5BA 4KIRA 3M0VA 3QC0A 4ZO7A 4O14A 3URAA 2PDJA 3PBWA 3TH6A 2CXEA 3O1NA 3WQ5A 2DUXA 4WRHA 5AOUA 1GOMA 5CQ1A 2J88A 4FOUA 2X7VA 1JPKA 3BAIA 1GKPA 2BTMA 3GM8A 4RDYA 2ZZ5A 3H55A 4F0KA 5BWAA 1WXYA 4A29A 3LA4A 1VHNA 3TWAA 4G9PA 1FWDC 5I2UA 1QK0A 2XTKA 1E9IA 1ISXA 2Q02A 3CC1A 2INFA 4E8GA 1C9DA 6A3HA 3LCWA 4LV4A 1Y0EA 2YSWA 1OJXA 3BV7A 1B3OA 5A2CA 5EBAA 1YXDA 3FXYA 1RR2A 1B1YA 5KEZA 2OOFA 2C1HA 1GEQA 4IQLA 3CMFA 1JQXA 5HQLA 4H83A 1XYMA 2HXTA 2I9UA 4JIEA 5DF0A 2V6AA 5A6BA 3EOOA 4K39A 2IPGA 1V03A 1XPYA 4PB4A 3W38A 1OADA 4ZO6A 3KW3A 3JUGA 1AH0A 4LBUA 2D69A 2X0SA 1KW1A 2QV5A 2DDXA 4DWSA 3T0BA 1RBOB 1NFGA 1GOOA 2FPVA 2ZADA 2ZA3A 2E3ZA 4JL2A 5E9AA 3W1AA 3B04A 1XL9A 3KDNA 1JDFA 3ENLA 1VZWA 2A3LA 3VNDA 2VXNA 3QSTA 2YR1A 4ZOCA 3F4VA 3MDUA 4AVOA 3IEBA 2ZC8A 2I5QA 4MYXA 2O55A 3HTWA 2Z1BA 3DESA 2XVNA 3IACA 1EWDA 4GQ0A 1KFCA 3HJZA 5KINA 2HISA 5E93A 3KCLA 3I6EA 1KBIA 4CNSA 1LOQA 3VINA 3PPCA 4E2OA 1W0MA 2DV0A 4DO7A 1W1TA 3RIKA 1FTXA 1WOBA 3CAQA 1RVKA 4Z2JA 2R1MA 2DJXA 1TO3A 1PWLA 5HXMA 1TSIA 1NWRA 2PF8A 1CLVA 2BY0A 4DZ5A 9XIAA 3MI2A 3EZ4A 4D2JA 1QHPA 5CLWA 3NGJA 4IHCA 4AD0A 4QEHA 4P7RA 1GZGA 4H6KA 4OKDA 3DHDA 1CGVA 1HO4A 2IXUA 4RE0A 3UWVA 1Q66A 3DFYA 3FEMA 1TZZA 4Y96A 2VENA 4HU8A 4H00A 3ABSA 3ITTA 1CZ1A 3C2FA 3DUGA 2A3EA 4LAZA 3MCNA 3UP8A 4YYCA 4NI8A 1FCUA 3OW1A 2O92A 2PBOA 1UIPA 3S5ZA 2B7PA 3QPYA 3V35A 1IXPA 2G3NA 1SZEA 5T26A 3GFYA 3VZXA 4RW5A 1VLWA 4L1WA 3B9OA 3B0XA 4KCWA 5D02A 4O10A 1DL3A 1R30A 4X9YA 5D37A 1PBGA 1JZ6A 4UTIA 2B7OA 1JZ8A 1P1XA 1UG6A 3VMPA 4XZ9A 3IIOA 1DJIA 1R2TA 3MSRA 2V81A 2A85A 5BU6A 1JXKA 1WKDA 3F7JA 2VZOA 3DFNA 4KFOA 3E0LA 1KBBA 2EG7A 1F3WA 1O5RA 5BU9A 1OVDA 4JXCA 4UTWC 2G3MA 4GVGA 4MMWA 3G2GA 1K02A 2D73A 4NAEB 2BBFA 4GZJA 2XFFA 2DQXA 2PUZA 3L0KA 3WLLA 4JX4A 1AD4A 3E0FA 1HJVA 2E7FA 1DJGA 1W3HA 4GNJA 6CGTA 3VCRA 1N2VA 3WFZA 2R1KA 4NL1A 4O52A 2J9XA 2OB3A 4UIOA 2PE4A 3P60A 4XZWA 1LT7A 4B16A 1PXGA 4DLFA 6REQB 1YE4A 4CD7A 3HN3A 4LW7A 2OKTA 4ZBCA 1YPIA 2JF7A 3ZJKA 4RE4A 3TR2A 3I7QA 1Z89A 3B9EA 4AWUA 2QDHA 2I14A 3G24A 1EXPA 4F40A 1UH3A 4GE8A 3NVTA 4O8AA 3B0YA 4EANA 1X6NA 5IDIA 1B3YA 1DWGM 4C6PA 3B8WA 1XLIA 3G18A 5TF0A 4DF2A 2AL2A 3LX9A 2FDSA 4PL1A 1XX1A 4GO9A 3OQ8A 2DZWA 2REQA 2I57A 1YBQB 4GX8A 1XLDA 1L6FA 1QW7A 1F07A 3H2MA 1V0KA 1VCVA 2VDIA 3LUTA 2YJQA 3I7RA 3GDLA 4P8UA 1F6YA 3IRSA 4UFMA 1WDDA 2V68A 4I7UA 1V3KA 3AICA 4WVXA 1A47A 3I10A 3MI6A 3N4EA 1D8CA 8XIAA 1G1YA 1KQYA 3WBAA 2A4AA 1MO0A 2EKCA 1IXNA 2JIEA 1Q85A 2CIPA 2QCCA 3E9AA 4CQCA 5HNTA 2NVCA 1UWRA 5G4HC 4GG9A 1KXHA 3OHIA 3Q58A 3W7GA 1XYLA 1S5TA 5EMUA 3AHVA 3NVDA 2DZPA 3M5YA 3LI0A 3TYAA 5J5RA 1XBVA 3IK2A 1ZHAA 2WCSA 3IJ9A 4S3CA 1KM6A 4XAPA 3GBDA 2J7GA 3P5ZA 5J5DA 2ZXBA 4YVVA 3MMUA 4WJEA 1NDVA 3BMXA 3TA9A 1OABA 1ONRA 2DJLA 3MUAA 3OBEA 5RUBA 4V27A 3II1A 1ZJIA 3CO4A 4P5UA 5JBFA 4FX8A 2DU2A 4IGMA 2A79A 1PCWA 4LVBA 3IIVA 2JFEX 1ZBCA 1TIMA 2PURA 1NARA 1G7VA 3U4AA 2HPIA 5F4XA 3OYZA 4YS1A 3W7NA 1RCQA 1TPWA 4I7WA 1VKFA 2X1UA 3TA6A 3LQLA 3WO8A 4JIHA 4PEEA 3K4WA 2V30A 1KTCA 3ALGA 2IUZA 4ATLA 3D3AA 4QXIA 1BGAA 2HK0A 4EACA 4XX6A 3TMQA 3TU9A 3GH5A 2FPYA 2YXOA 4HHPA 2CXGA 2NX1A 3NXLA 4ZE4A 2DIJA 4D6EA 3G1XA 3MMTA 3GNRA 1GVQA 2F38A 2E67A 2YL5A 2NQLA 1M03A 3W7KA 2YBVA 1DP0A 3STCA 5CJ5A 3KOFA 3QMRA 3G1FA 3TAOA 1MEHA 1VLIA 4UR9A 1U83A 4DYJA 3E0VA 4KW2A 2FVMA 2TYSA 3WQFA 1QATA 1AK5A 4RNFA 2FQIA 3UY8A 4Q22A 4IQJA 5E6YA 1E0UA 4FP1A 3DCPA 4DXXA 3DC0A 1SZNA 3P7YA 3RPDA 2GLKA 4J9JA 4E5TA 1FY6A 3ISIX 3HZ3A 1JZ4A 4MB1A 3B9AA 4CVWA 2E1WA 5JIPA 2PWGA 1Y5WA 5T8GA 2WCGA 2WHLA 2IKGA 1RCOB 3STFA 3URQA 3VIFA 3GR8A 4NP7A 3FX4A 5G5IA 4JIIX 2GJRA 3EXTA 3VABA 3V16A 4IJCA 2V2CA 2VRQA 4Z2KA 3QOMA 3XINA 3MUZ1 4AUBA 1VS1A 3SZ8A 1AQHA 1RCXB 4E3TA 3O8AA 3EX3A 3VFCA 2Y1HA 1VYPX 1L2QA 3S9ZA 4H9MA 2IQ0A 1W1YA 3L4VA 4CCZA 4DELA 2VR2A 4XZMX 2DVTA 1Q6CA 3CHVA 1QCWA 5LA2A 3ZYZA 2A21A 1U33A 1I2PA 2FLIA 4IMFA 4HCLA 3TW6A 2VRJA 5U7SA 2R1LA 4Z1DA 4F0MA 5FSDC 4LUSA 3OB8A 1M68A 3R1ZA 1PVNA 4MHBA 2V3GA 3E12A 5CXPA 5AYYA 3TYZA 4WOQA 4QJ4B 3VKCA 2JKEA 4ZGYA 4O13A 3S0CA 2CCRA 3KVJA 1XRTA 1M41A 4CNNA 1XQKA 4NI3A 2WPGA 1XLAA 3AFBA 4QE4A 5K9CA 2XUCA 1KFKA 2E9MA 3TTYA 5A6JA 3DI0A 2HS6A 1WX0A 1J0YA 4PB5A 1R2SA 1Z42A 2DT3A 1J10A 4KCVA 2BVYA 2OQYA 3TV8A 1GQLA 3M0ZA 3G1AA 2HBVA 3QV9A 1QJWA 4KT2A 1N8FA 3SN0A 1AL8A 1UKOA 1KCKA 4Q7IA 1HVQA 3CAVA 2PTZA 2YW3A 1LG2A 4U31A 4JICA 1QU4A 1Q13A 3AIVA 2Y8VA 5AZ1A 1JRBA 1RJRA 4K7VA 3GU1A 3L2IA 4A2SA 1OFDA 1S5VA 1XCFA 3AIQA 3N2MA 4NY2A 1E56A 2AAAA 3EWCA 2CLHA 3EMCA 1TWSA 1E6SM 1V0MA 1ZQ5A 1F2JA 2P10A 2G50A 4JAWA 2BHYA 4UR7A 4CVUA 2ODOA 4K1WA 4LPCA 3A3XA 2WB5A 3AS1A 3KBSA 5DQPA 4EAYA 3N11A 3N73A 1GVEA 4MAZA 3C56A 3LHZA 1NJJA 1JDDA 2IKHA 4PULA 1VFMA 1A5UA 1GG0A 3GNNA 1PS9A 1ADDA 3DI1A 4YJ5A 1HKJA 3S1UA 3GSMA 4UTUA 3WLSA 2YXXA 3GFXA 1KBLA 1PYMA 4CCCA 4MUZA 3S3GA 3EWZA 2YDRA 2GVGA 2FPTA 3A5FA 4C65A 1GYLA 3F03K 1BG9A 1LLWA 4XVEA 1ZCOA 2C18A 2QCLA 1VB9A 4IP7A 3KHDA 2BB0A 5E0FA 2IKIA 3BWWA 4KWOA 2FGZA 3LZ5A 5F2LA 3T7VA 2CEQA 3SCUA 4EXAA 3W6LA 4UTTA 4I7VA 4QS5A 2F6XA 3GX9A 3ZQ9A 3WLMA 2X42A 2G3FA 3WQ6A 3E6EA 3VC6A 2PDKA 1X1NA 2XFYA 3SCNA 3KTXA 3R89A 4LTSA 4Q4QA 3KBWA 4PCNA 2PMQA 2YLAA 5G1MA 2R1NA 4XQ6A 3WEMA 1VC4A 3TXVA 2ZZ7A 1O12A 5FIPA 2QAPA 3SFWA 3FIGA 4O28A 4ZL1A 4MOZA 2Q01A 3LN3A 3TMLA 1XC6A 3A3WA 3SGGA 3OG3A 3VGDA 3EPMA 1V0LA 4JFVA 2DVUA 1LWIA 2WVUA 1O60A 1G5AA 6XIMA 2OU4A 4W89A 3SN4A 1L6YA 3ARVA 1AQMA 1LJYA 3N04A 3UXIA 2BS9A 2C8NA 3HO8A 2HE8A 3WLOA 4K8EA 1KM1A 1CX9A 3W7RA 4W88A 3CIVA 3OGSA 4BHYA 5AC5A 2OO6A 1SSDA 4YPJA 4HU3A 1WXJA 4FA3A 4FNUA 4H9VA 5T9BG 1WUFA 1P7TB 1BRLB 2QPSA 3VM7A 5AN7A 4LXFA 1ZLPA 1KB3A 1TQJA 1EF2A 3QBUA 5BROA 3CT7A 3WNKA 4LANA 3NR0A 3BAXA 5FJRA 4FMVA 4AHQA 4GC4A 5AC8A 1KFEA 2C91A 2IS7A 4M19A 3W07A 1H2JA 1VPQA 4Q4SA 4HJWA 2HDJA 4DYEA 4HNTA 4NXKA 4C7GA 1XC4A 1VBRA 3MHFA 1K6AA 1J0ZA 2CZVA 1V0NA 3A6OA 1TX0A 1KLZA 3KCOA 4PN2A 3W01A 4Q3MA 1S2CA 3OHMB 4OUIA 4H6QA 2WMIA 2E09A 4ML4A 4K7YA 2P0OA 1DWIM 3NXFA 2PSNA 1XWYA 1RLDA 4EP8C 3FNDA 4ZB2A 1M01A 3W2NA 2VYOA 2PDBA 4L6HA 4C6JA 4E3VA 1PJ9A 3IPWA 1KM4A 2EPMX 3MC5A 1B90A 4DJED 1TQXA 3VNZA 3VD3A 1IE7C 1KR1A 3OQEA 4JTGA 2J9YA 2Z7GA 3C2YA 4ADSA 1TJ1A 2PDUA 4ILSA 3UY7A 1GVFA 1JFHA 3FJ6A 1EJ7L 2WXDM 1OIFA 1FWFC 3SCWA 1G67A 2CC0A 3APTA 4ZQMA 5SWUA 1QASA 2WYSA 4AD5A 3TTEA 3RPMA 3OEXA 2NT1A 2E5DA 3RMEA 1NF7A 4FNPA 2A2IA 6TIMA 3KTCA 3UW6A 3B9DA 2Q3OA 1I1XA 2J74A 4N02A 3BARA 3EGJA 2YYUA 2ALRA 3PWIA 5AY7A 3LEPA 2ZYFA 3W7PA 3PPFA 3W7QA 3AWNA 4CD4A 5K4XA 1A5BA 2OYKA 4YLWA 3UWYA 3LU2A 1BKHA 5LXXA 3EOSA 3W82A 3EEGA 3GTIA 1BEUA 4NZJA 2XG9A 3S2NA 3MJMA 4AX6A 3VIOA 1QMLA 3CJPA 1SO6A 2J7DA 3IGSA 4JDBA 3UG8A 1T96A 4HN4A 4OT7A 2VOTA 3APGA 1ZAIA 5FJJA 4D8ZA 2ZRYA 2ZRZA 2NQZA 1E6QM 3ZT6A 1OC5A 4H9UA 1KWKA 1RALA 1YYAA 3PNUA 3MBDA 2PGFA 2B7NA 3DXIA 3J7HA 4AISA 1JYXA 5FSEC 3SUSA 3CV1A 3LK6A 3AS3A 3TQVA 3M7SA 3QKZA 2G95A 1LP6A 4DO5A 2DW6A 3E2VA 3PTKA 2MNRA 3PPHA 4WHBA 2WAGA 2EAWA 3EB4A 2XWDA 2Q8ZA 1EA0A 1HP4A 2J24A 3WF3A 7REQB 1TTJA 5I24A 1OZQA 1CB7B 4NXSA 1VJZA 3RLUA 2G3IA 1S38A 2QJJA 4LYPA 1JR1A 4S39A 5LNVA 2DUAA 4B4FA 1A3HA 4JQ2A 3DERA 3AALA 3HGJA 1JCNA 3CHCA 3VIGA 5D38A 1HKKA 1KD0A 1E0XA 3HM7A 3F5JA 3I65A 1FWAC 3NPVA 5FEPA 2GFTA 2WV8A 3ORWA 1H63A 3W72A 5BOFA 1U1UA 3O16A 3DAQA 3EX4A 3STPA 1NTHA 4B2DD 3B97A 4NZ3A 1E15A 1EHNA 4L4MA 1JQVA 2WK2A 1CGTA 5MF5A 1F7BA 1F4AA 3ZWTA 3AXKA 1OM0A 4TVUA 4XIAA 4IX2A 4IICA 4U4MA 1X8FA 4M0XA 2J62A 2CITA 3S2CA 2PEVA 5I3DA 3HGOA 3KBNA 1FQ0A 3TROA 3C4UA 3CZ8A 5LKYA 1K7FA 5CGMA 1A49A 4JFSA 4R5EA 3SADA 2BG5A 1UWUA 1WKYA 4O0QA 3GXNA 3FAXA 3UZJA 4W7WA 4JTQA 5HQMA 1Q4WA 1IWAA 1DJHA 5TAOA 2IMRA 1M7PA 5HMEA 3SRKA 2W0UA 4HOZA 4WGXA 1QDSA 4F2BA 4WK9A 1XH1A 3AYRA 3W73A 4I9JA 4DJFA 3BW3A 1M1BA 2EJAA 4P8WA 2A7NA 2WKJA 3AMGA 4AC7C 3P80A 3VDCA 4LFYA 3REQB 4DJDD 3ATZA 2BZNA 2OFJA 2F8QA 5FEWA 3PANA 3QFEA 3LCHA 5FF2A 1F3TA 5BRBA 4C90A 2WANA 3NDZA 2NW0A 4EWJA 3FHQA 1V6VA 2V3DA 2FH8A 2PDPA 5H8PA 2EQDA 4AEOA 3MHUA 1XI3A 4R53A 2ZIDA 5C2GA 2FJKA 2HNHA 5DRCA 4B2DA 4FB7A 4HKPA 4B91A 3CV6A 4G2DA 4ACZA 1U1JA 1ICSA 2G8ZA 4W7VA 2QF7A 1PX4A 3SIMA 1Z32X 3K1GA 2J79A 1KRAC 3G8RA 2PDMA 1DBTA 4IGHA 3TONA 2QJNA 3QH2A 4ZR8A 1MDLA 3LCIA 1S2UA 1BSLA 5G2HA 1XDLA 3G0XA 4MWAC 2NLYA 4CEXC 2PDNA 1YEYA 3S5NA 3G22A 4M56A 1G0CA 3PFRA 3DBPA 3HPAA 3IV3A 4ML9A 3H54A 4NF7A 2PU1A 4PTWA 3LXBA 1ZJAA 2QIWA 1MDRA 5ABFB 4GBDA 1UOKA 5I3KA 3QMTA 3IIXA 1UZHA 1AJ0A 4FNSA 4LCRA 1JCYA 3ZVHB 3ABQA 1Q6QA 4O18A 2GOKA 1EFZA 1GEHA 1E1EA 3GG1A 1M65A 3N6HA 3WD2A 4PFHA 5KZDA 3M46A 2YOCA 3GC5A 5F1VA 1VEMA 3UGRA 2VKZG 1XDMA 3N3MA 1QWGA 1V3IA 4MWAB 2NWRA 4HSHA 4GXWA 4ORMA 3CPRA 4G7EA 2J8GA 3V75A 2GQ8A 1GOQA 1U1HA 4Y8EA 3THAA 4XD6A 5A8PA 1E0TA 2LLEA 1ITCA 4H3DA 1UZDA 2E9LA 4B9YA 4P61A 2NSOA 1CIUA 3EB3A 1V6TA 4UTJA 3M43A 1GJUA 1XRSA 1HJXA 4URIA 2PZ0A 3LTSA 2ONEA 1E1CA 4C7DA 1UC5A 2QCDB 3UZYA 3L0NA 4DLMA 3BOLA 1A5NC 2QJGA 3RITA 5FL0A 4DWSC 3DG7A 3KP0A 1ZTVA 1JF5A 1EJUC 4I5RA 3IGXA 3H7UA 4FIRA 3G0SA 3UXDA 3NPUA 2Z00A 5DMLA 4EF8A 1B2YA 1OCQA 2ZUNA 1FX6A 3ZR6A 1IR2A 2XN2A 4XAGA 1W3LA 1TWDA 3KOYA 3ITYA 3LSBA 5G1TA 3PPGA 2FGLA 4DJDC 3RX3A 2QEZA 1Q6DA 4UTKA 2ZDRA 2VX5A 3NZQA 4DPQA 3DFTA 2DT1A 5HJYA 1WB0A 2YFOA 2INEA 1EGMA 1E43A 1A3WA 1ZSXA 3CUIA 1F3XA 3AHYA 3VKJA 1J18A 3VUPA 1WYIA 2ZDSA 3VNLA 1IHIA 2CLLA 4TV6A 3LD5A 1FWTA 2VFHA 1GPFA 1IEVA 3MV01 1DXIA 3N29A 3WQOA 3DG3A 2WO5A 2C7FA 1V77A 4POCA 2XYLA 4E2BA 3ZXWA 2PTDA 1XGEA 1LLZA 2P53A 2HNEA 2VTFA 3IVSA 4AZBA 1OF6A 4LV9A 1VBUA 2OSWA 3VOJA 3ANYA 3JVAA 4XO6A 4A3RA 1V3JA 4WDXA 3SY1A 4L56A 4QS6A 1VGAA 1W1B1 4W5ZA 3TW9A 3VPLA 3I6TA 4LUTB 4Q8NA 1E9YB 4AG0A 2JBMA 2HPMA 1U5HA 3W7HA 5IDZA 4ES4A 4BF7A 3CIXA 2P76A 4UZSA 3VIPA 4UFIA 2AAMA 1FXQA 3L2MA 1QNSA 4AHOA 3F5LA 2ACQA 2ZX6A 4XKMA 3QQ1A 4GVIA 1OCBA 4GGHA 1QI2A 4BI6A 3CMJA 4ZSTA 4ZVJA 3NQ8A 3M6DA 3EX6A 1LCOA 1KKOA 4UTHA 4PR4A 4MB5A 4JTKA 1S2AA 1EA9C 4JX6A 3SY5A 4WF7A 1OYBA 1XGZA 3CLMA 4KWWA 3CO8A 4GACA 1UCWA 4AIUA 2GJLA 4DBEA 3POHA 1I9CB 3NSXA 2WOQA 3GIQA 4AD2A 2WSRA 5EMMA 2IQTA 2Z24A 3KL3A 5L6UA 1PCKA 4F48A 1W9DM 8RUCA 3URBA 1BSIA 3EWUA 1HL2A 1CEOA 3GVQA 3PG9A 1F73A 2WZIA 5MHBA 2XH4A 4PMRA 5TD4A 1U22A 4MSSA 1OG6A 4E4FA 5CG7A 4I9TA 2YDSA 2MUCA 3W2UA 1XLKA 3MSYA 3TTSA 4XIMA 3KL5A 3QR3A 1WDWA 3ZSTA 4NUWA 4LS0A 3ARQA 5A8QA 4DQWA 4N6EA 4O11A 2V67A 3MANA 2R94A 3BK0A 3C2OA 2EPHA 2ZUVA 4PCSA 4XBJA 5CGTA 5A2AA 3ARSA 3EMQA 1JUEA 4ZOAA 1JZ3A 2WHKA 3W23A 3WIJA 3CU2A 3ZT7A 2HEJA 3M64A 2PGWA 1KBKA 2GZXA 1YPFA 4S3FA 4B15A 1ICPA 3RF9A 4N4PA 4QJ3B 5IOBA 5AYIA 4IIDA 4QFUA 1G7UA 1YMYA 2GJXA 2WSPA 1HIZA 1MXSA 4WXZA 2XGBA 2AOSA 1LF1A 4OGZA 4YYFA 5LIXX 1XF0A 4BY3A 2PRLA 1XD0A 3BOFA 4W86A 2VZUA 2DFAA 2TRSA 1LL6A 2BWGA 1XLJA 1W1VA 4BQ4A 2WSKA 2ZZ1A 4HA3A 5EKYA 2E6DA 4GO8A 2ZRXA 3PZOA 4PMQA 2UY5A 4FXFA 1THFD 3S46A 3FDKA 4FALA 5EFFA 4X2PA 1ZJBA 2NUXA 3BAJA 4H9TA 1SFJA 4GYFA 4C6MA 3FKRA 1WA3A 3PJTA 2BVDA 4YHGA 2VEFA 2EEXA 2FZDA 1WP6A 4JEQA 1EDGA 1JCLA 2OELA 1DORA 1OFAA 5C54A 3H70A 3W37A 3GG7A 2DH3A 2CLMA 1HX0A 4H1ZA 1TMLA 3WL0A 1DJQA 2QUMA 5L9FA 2E9BA 4IWWA 5KTLA 3GXTA 3OVPA 4FAMA 3MT1A 1WZLA 5LIUX 3DDMA 4US6A 5E5CA 1DE6A 3W2KA 3MP3A 3LDVA 1TJ2A 3BZJA 4XKYA 1YNQA 1H4PA 2BVTA 2YGYA 1EZWA 3W1QA 3GQYA 2BSLA 2XISA 4WUIA 3UA3A 3M6YA 1EJSC 2PS2A 2WQDA 3TLLA 4AWSA 3I4KA 2OXNA 2UZ9A 5CBIA 1W9XA 3MMDA 3S83A 3W71A 2CLEA 1E72M 3WCZA 2HVMA 3ZWSA 2HTMA 3TAKA 5I7GA 5A8NA 3GHTA 2DZUA 5LXEA 2WZHA 4OFCA 2WMFA 1RHCA 2ISWA 3VX0A 4BK9A 2JALA 1JYNA 3BANA 3M0IA 4DY1A 5CSRA 3CWHA 4Q4KA 1W17A 2H6RA 3UQNA 4OV9A 4Q4OA 4AX7A 4RW3A 1FBAA 1DWHM 3A4WA 3MHGA 2FFCA 3EMZA 3WNOA 4ACYA 3DECA 3A4JA 1A3XA 3H2EA 1W9UA 5HBFA 3OA3A 3ITGA 4QE5A 3NO5A 3AHZA 3AMCA 1S5NA 2JQXA 3KL0A 4NRSA 2NSXA 4DUVA 1EZ2A 3THCA 3W7LA 4GYKA 2WCAA 1G4SA 3QZAA 3WDJA 4AZCB 2J7BA 4LCSA 4MPQA 3IV8A 2E0PA 1BXNA 2OLHA 1QBBA 2FHBA 4MDOA 1I75A 4JIPA 3U2CA 3AYVA 4X63A 3GZAA 3C6CA 3ZMRA 3RUBL 4HPHA 1CXEA 4CLMA 1GWJA 4FI4A 1CXFA 2C1GA 1OGGA 3N2XA 2DEPA 3ITVA 4GNKB 4BQ5A 3CQKA 3WQEA 4INFA 5AZ0A 2RGMA 2G4JA 4R88A 4PE8A 1VEOA 3W1UA 2X1TA 3NM1A 3MVTA 3SM0A 3EDEA 5DMNA 2PDQA 5AFDA 1XLMA 1XS2A 2PRMA 4GUIA 1EPVA 1P0KA 1KFLA 4UXDA 1E6NA 3ARPA 1NWTA 1ENUA 3RPTA 2QIIA 3HQ1A 5C9ZA 4XAYA 3RU8X 3RCYA 3USZA 4ZB0A 3BG5A 1R3TA 4TIMA 2EGZA 5I78A 5T91A 3VTRA 2J6XA 2GGIA 2WHMA 4B4HA 1XH0A 1ZALA 3ZJ6A 5DX7A 4LGXA 4J3UA 3UCQA 4IIFA 4XTDA 3QQWA 3W84A 3FN9A 1GPWA 3TFCA 2VQUA 2IQDA 2ZRVA 1TVNA 4HMNA 4D72A 1V6UA 3AISA 3AHTA 3UETA 2FFIA 4LQ1A 1K7XA 1XBZA 3NQ2A 2QNEA 1IT8A 1MQQA 4F4RA 3BSMA 2QZRA 4HYVA 1O95A 3AZSA 3W7IA 4XB3A 4CNPA 1AVAA 1CXHA 2QYGA 5FJIA 1TWWA 3PBVA 5KSWA 3DFPA 2BOGX 4ZA0A 3WQVA 1UP0A 4PTVA 4QHRA 4MFEA 1B57A 1CCWB 3M0MA 3HFTA 1KTNA 4HJFA 4KMQA 3G77A 3STGA 4C6IA 3CH9A 4UQCA 1HT6A 1AL7A 5CCZA 1FWIC 2FH6A 4MB3A 2OOGA 3S2JA 1J11A 1A5CA 3T1GA 3DU0A 3DENA 1VJIA 1XYZA 2OZ0A 4V28A 3S1GA 2Y8UA 4FF7A 5CEWA 2PDGA 1OK4A 4JTIA 5A5WA 2JEPA 1CNVA 2XWEA 1T8QA 4J3WA 4ZTYA 4UTTC 4PMOA 3ZR4A 3H26A 3CAKA 2DW7A 1SVDA 2WPBA 5H8MA 3UF9A 2E68A 3TP4A 1M53A 3A4AA 5GPRA 3PP7A 4FLSA 2OWWA 4Z2GA 1FXPA 3NTYA 2W66A 2UWFA 3W2LA 3EXRA 1N8WA 4NNAA 3BCJA 3WEZA 3R2GA 3QRHA 2Y2WA 3ATYA 4H6RA 1KFWA 1JCJA 1LOSA 1V7YA 3RR1A 4TTGA 3MP5A 4HQVA 3VXGA 3SBFA 4HTBA 2QQ6A 1EX5A 3SCSA 2JGYA 1NP2A 1E4LA 4O1DA 2NXIA 2P1FA 3C2RA 3ABZA 4G7FA 1EO7A 2WVVB 1S5MA 3E5BA 4AU0A 3ZIZA 5DXXA 3NGFA 1BYAA 3LPOA 1G6CA 2V5JA 3KVMA 1R86A 4WJXA 4EX4A 5BCAA 3WFAA 2DZBA 4OBSA 2HBXA 4N9EA 6TAAA 4GGBA 3WBXA 5JXQA 1GUVA 2XN1A 4AQLA 2VUNA 2ZUMA 2PRHA 3WD4A 1YIXA 4YL2A 1QI0A 3DEQA 1OBAA 3V5CA 4REQB 2BVWA 4XVDA 3WLQA 4JQAA 4AF0A 3M0JA 2ZVRA 5REQB 2PDCA 4ZCWA 3WLIA 5E9XA 1TMHA 2HCVA 5JMUA 4AEFA 3H53A 1XUUA 3EDJA 4ZSUA 1GJPA 2YCKX 4JN7A 3SIZA 2YB1A 1S39A 4PTXA 1BWVA 1M7JA 1NOUA 5C71A 3GS6A 4L9YA 4LH8A 3SURA 3FA5A 1QNRA 1J0KA 3TQ0A 4QG6A 2ZTKA 2Z1VA 2VDHA 1CBGA 3R4IA 3IUIA 5A8MA 5EFDA 4E4PA 1ZCCA 1JZ7A 4LY8A 5KZEA 4B5VA 1XG3A 3GXDA 3AS0A 1HL9A 4GXMA 3ARWA 3KZPA 2CLFA 3GDRA 3NDOA 1TJRA 4PMDA 1ZNNA 3AU2A 1XYCA 1EL3A 2YLLA 4WKAA 4D6DA 1M7XA 3OIXA 3W53A 3H22A 1HG3A 4G8TA 4NSBA 4OBTA 4O1AA 2PDXA 3QTPA 1QW8A 3CUZA 1EBHA 4LC8A 4W85A 1ME8A