1PYMA

Phosphoenolpyruvate mutase from mollusk in with bound mg2-oxalate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
291
structure length
291
Chain Sequence
VKKTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRDSNEASWTQVVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNSLHDGRAQPLADIEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADAILMHSKKADPSDIEAFMKAWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASVSAIQQTTKQIYDDQSLVNVEDKIVSVKEIFRLQRDDELVQAEDKYLPKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Phosphotransferase
molecule keywords PROTEIN (PHOSPHOENOLPYRUVATE MUTASE)
publication title Helix swapping between two alpha/beta barrels: crystal structure of phosphoenolpyruvate mutase with bound Mg(2+)-oxalate.
pubmed doi rcsb
source organism Mytilus edulis
total genus 106
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 5.4.2.9: Phosphoenolpyruvate mutase.
pdb deposition date 1999-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 1pymA00
1F3WA 3E5BA 4B5TA 4IQDA 1PKLA 3MA8A 3QQWA 1T5AA 1JDEA 1E0UA 3EOEA 1DIKA 1F61A 1OY0A 4FXFA 3T0TA 3EZ4A 4QG9A 1S2TA 4IQEA 2HROA 4QG8A 2X0SA 2VGIA 3BJFA 4KCVA 2VWSA 3E0VA 4FXJA 1GGOA 1S2UA 3OYZA 2HJPA 2ZE3A 1PKMA 1A3WA 1IZCA 1A5UA 1Z6KA 1O66A 3OYXA 3QZ6A 3HQOA 3U2ZA 3OQ8A 3R4IA 3G2GA 3VAVA 4KCUA 1A49A 4B5UA 3LYEA 1PKNA 5JVLA 3M0JA 4B5WA 2XZ9A 1PKYA 3EOLA 2E28A 3SRKA 3T05A 3EOOA 4RPPA 3I4EA 1PYMA 1DXFA 1O68A 1MUMA 1F8IA 4B5XA 4YJ5A 4B2DA 3FA3A 4KCWA 4YNGA 1M3UA 4TV6A 4DRSA 4ROQA 3FA4A 4L9ZA 2VGFA 5TAOA 4MF4A 3SRHA 3ME3A 1IGWA 3N25A 3QV8A 1A3XA 3GG8A 2QIWA 2XZ7A 3T07A 4B5VA 1U5VA 4L9YA 4QG6A 1F3XA 3E0WA 2G50A 1U5HA 3M0KA 1OQFA 2DUAA 3B8IA 2L5HA 2VGGA 3LG3A 4KRZA 4KS0A 3QTGA 4WJ8A 3SRDA 4HYVA 4L80A 1UJQA 1DXEA 4G1NA 1XG3A 1S2VA 1VBGA 4B5SA 1E0TA 1O5QA 1SGJA 2R82A 2BG5A 3QV7A 3QV6A 4L7ZA 3PUGA 1AQFA 2V5JA 3GQYA 2VWTA 1ZLPA 4TV5A 1S2WA 3GR4A 1KBLA 3HQNA 3P0XA 3HQPA 2HRWA 1DQUA 2XDFA 2OLSA 2DIKA 1F8MA 1KC7A 4LSBA 1XG4A 4MG4A 2HWGA 4KCTA 4JPGA 3SRFA 2VGBA 4IMAA 2KX9A 1VBHA 2WQDA 3PP7A 4B2DD 1M1BA 3BJTA 4IP7A 3H6OA 3IS4A 3KTXA 3QLLA 3KHDA 1ZJHA 4HYWA 2V5KA 4QGCA 3QV9A
chains in the Genus database with same CATH superfamily
3M5YA 4F2UA 1UKQA 2ON3A 4YXGA 1B1YA 3B9DA 4FLQA 3S6DA 4LUIA 1XIGA 1S46A 4Z1YA 2ZVIA 3EB3A 1QVBA 4P7LA 4X9YA 2WMJA 3LOTA 1BAGA 2DW7A 4CU8A 3L66A 3RF9A 3DG6A 4I5UA 1BWLA 1V93A 2E9BA 2YB1A 4AZHA 3W73A 3WBEA 1MDRA 2EKGA 3DECA 2W91A 4UMCA 4NI3A 2BOEX 3BSGA 4JIHA 3B8TA 5EFDA 2HXUA 4GKTA 4QAIA 1EEXA 2FGZA 3GVQA 2WW5A 3ARZA 1XX1A 3WNPA 3NOYA 3TX9A 1UB3A 1GKRA 4XV0A 4Q4OA 1SFLA 4ML9A 3SB0A 1F05A 5I3JA 1M04A 4UXDA 1GCYA 2HV5A 4D6HA 1JQXA 1B0IA 3A3WA 4XBJA 1U1UA 3ARYA 3WUEA 3E5PA 1NJJA 3W7QA 2YXOA 1TPB1 1ZY9A 4KFNA 4US5D 3VFCA 4EX4A 2YL8A 4UFKA 1SW7A 5AZ1A 4PSRA 3GNDA 2Z27A 3EX6A 1HKVA 1TO3A 3ZJKA 2E7FA 5D04C 5ABFA 1BRLB 3UETA 2NUYA 3S83A 4HN4A 4F0HA 5G1MA 5ABGA 3OB8A 1OADA 4PRRA 5JUVA 2P0OA 4I9AA 3K4DA 3G77A 4PUDA 2HE5A 2A5HA 1FUYA 4R9XA 3M5VA 3K13A 4ATWA 2YPIA 5H2ZA 3U5UA 2X1IA 1TRIA 2VOMA 4HZMA 1ZJBA 4AU0A 1GG0A 1SQ7A 2WSQA 4FF5A 1R2SA 3NQFA 4YNGA 4FO4A 3FA4A 2WKJA 3HG3A 3ATYA 1OF8A 3W00A 3QLDA 4R88A 3CEPA 1Q66A 1V02A 4NNCA 2J66A 4WIWA 2G3FA 1W5OA 1W37A 1HN1A 3W29A 1DWAM 3ARVA 3LHVA 1ZNNA 3G5EA 3W7GA 1UA7A 5DBTA 5H8PA 2G3NA 3R11A 3Q2DA 1XHGA 1NAL1 4S39A 4I6KA 3J7HA 2XH4A 4M7TA 1S5WA 1CECA 2PBGA 1WDRA 2P3EA 4MUPA 4XO6A 4JYDA 4MFEA 3R8GA 3BLOA 4HA3A 4KRTA 3ZT5A 4RV8A 1MUWA 1W1PA 5T9CE 2WVTA 1OGSA 3E5BA 2QCHA 5CPMA 3RILA 5H6HA 3KBJA 5GVJA 2I5IA 1OY0A 2ZTJA 3KAOA 4GY0A 3VVGA 1LUCB 4G9PA 1GONA 1XGDA 4IF2A 3OG3A 3NM1A 4UWMA 1K4GA 2VZUA 1OD0A 2RAGA 2X05A 1W9DM 2WPGA 4IG2A 3VKJA 5IHRA 1EF2A 3T05A 1L0PA 3ITGA 5AVHA 3TQ0A 4AZCB 3DHDA 4AEOA 1N55A 2PD5A 3W7IA 4IIHA 2CCRA 3B8VA 2A2IA 2HVNA 2OLHA 4JTSA 3VC5A 4DJFA 3ES7A 3SGUA 4GYPC 2GJLA 4BI5A 6ALDA 4DPPA 4X60A 1RBAA 3N34A 3F4CA 1W9BM 4MB5A 4NRRA 3PB2A 2NQ5A 3RCNA 1QHPA 3ZVHB 3VPLA 1QNSA 1XFBA 1XRFA 1Q6RA 3SBFA 3WLOA 4E3TA 4XK2A 2A3CA 2GGEA 4HOZA 4IWWA 5BOEA 4Y8EA 1MQQA 4Q4KA 3W2UA 1UA3A 3M6DA 4FX7A 4RE4A 1Q6QA 3KHJA 1LLOA 3GVRA 2GUYA 2ABBA 3L23A 4DPQA 1ISVA 4QBXA 3VOIA 5A6JA 2NQLA 4W9TA 1NU5A 4K6AA 2W4XA 3TSDA 1ICQA 4XAZA 1EBGA 4RE0A 3N17A 3SCVA 1JCMP 4QQ3A 4RX0A 3W2MA 5G2IA 4H9MA 1B54A 4UB9A 1HP4A 2E6FA 5J8LA 2HROA 4WSHA 3GIPA 2C14A 5BW6A 4WGXA 3CV1A 5FL1A 4UTWA 4CNTA 4YVXA 1YXYA 1W8GA 1JFXA 1K1DA 1FXQA 4NAFA 4I6VA 4HNCA 1FWNA 3G2GA 4DQWA 4RE3A 4HU4A 1XPGA 4C6EA 1RJPA 1ICSA 3T2PA 3EWBX 3LHTA 2CXGA 4ZXLA 4HIBA 2Z7GA 3LI0A 4KCWA 1QK0A 3H7UA 3VE9A 3WUGA 3UR8A 4XG1A 5BU9A 1IEIA 4JN8A 3TH6A 1UH4A 1YW1A 1B30A 2ACRA 1SZNA 1W1A1 5TD4A 3N25A 1M41A 3GZ3A 4WSJA 5CSYA 4QTGA 1XUUA 1MDLA 1XLIA 1CXHA 3TN4A 5HJXA 1XPYA 1AFSA 2FB2A 1K9DA 3ISIX 3LCHA 3C52A 3DXIA 4B5SA 4UR7A 4JQ4A 3B9EA 4MY9A 3PZVA 4OTKA 4J4KA 1YBQB 3U0HA 3SCWA 1F4AA 1TG7A 3G24A 5CC5A 3MKKA 3S5SA 2QVNA 4XD6A 4MVAA 3MMWA 2QAPA 4MG4A 5D9MA 3F2DA 2DT2A 7PTDA 4EAMA 4F0SA 3TUUA 5HDRA 4LXFA 4ZB2A 3SCSA 2VELA 4WZHA 1Q85A 3VABA 4D6EA 2EG7A 1NTHA 2GDQA 4Q8NA 5CGMA 4XKYB 2CBIA 1XLCA 1L8NA 3CIXA 3LHUA 5EU9A 2G0WA 3RX3A 4QSHA 3NYDA 4DWSD 5F4SA 3QKEA 3E2VA 2CZEA 5BOOA 1RAKA 1FFRA 1QOXA 1ZB5A 1CDGA 3PY2A 4AVNA 2QDGA 4E2VA 3NNTA 1U5JA 1LRQA 1EYEA 2BS9A 3PSWA 2B31A 3AUOA 1V6VA 4KERA 4M51A 4HNOA 4N7QA 4CQCA 3DFTA 4HJWA 5A3HA 3WLKX 4HK5A 4O1BA 1KQYA 1XSJA 3R58A 3QSTA 1BYCA 3MO4A 3UW6A 3H8AA 1PV8A 1S1PA 5A5WA 2G50A 5BMWA 3QY8A 2IPJA 5HNUA 1T40A 3QTGA 3N14A 2YDAA 1OFAA 4HT3A 2WHKA 2FH6A 3PB0A 4YLWA 2P3ZA 4AIOA 1YDOA 4EAYA 3EPMA 5DO8A 2WZHA 2V5CA 2UY3A 3CLMA 5JXQA 2A3HA 5HOSA 4LRSA 1XLKA 3WYZA 5MKGB 4CNPA 1MYRA 2Z6JA 1RALA 2F8QA 1ISYA 2FHCA 4FR6A 1OYCA 4A35A 3GHUA 1FKWA 4QNEA 3UWEA 2DSUA 3G3MA 1US0A 2VZTA 5JH2A 5K4ZA 2YZRA 2VDIA 1R3TA 4FOJA 3HURA 3SN1A 3L0GA 4WY0A 3BLIA 3WLMA 3K8KA 1JR1A 3B97A 3LM3A 4A2RA 4KCVA 1PO9A 1OYBA 3M44A 3WQCA 1Z41A 2FDMA 2J7FA 2WV8A 1N8IA 3OO2A 4N9BA 3WFLA 5CGTA 4S3AA 1OEPA 3RM4A 3LQLA 1DXIA 1IHIA 4YWIA 1AD4A 2JGYA 2VX7A 1R6WA 4FZIA 2YA0A 2O9RA 1IYXA 1P0NA 2YFNA 3EXTA 5LIXX 3VC6A 3OZMA 3W27A 3TAKA 5KEZA 3WNKA 2Y8KA 1TWSA 1MXSA 3L0NA 1ZAJA 3EB2A 1AZ1A 2ZWYA 4KETA 4E0CA 1KQZA 1VFOA 4WCJA 3O07A 4GZJA 4I8YA 4KS0A 2BDQA 1E55A 1PZ2A 5F4XA 4GCXA 2QCMA 2XFRA 4FP1A 3GO2A 3GVGA 3WY1A 3BSHA 4UQBA 4YWSA 1BG4A 3SUUA 4C65A 5JBEA 5LNSA 1SJCA 1AUSL 4X0VA 2GVLA 4L4PA 2PEVA 2NLIA 3QFEA 4D6JA 1D3HA 1ODZA 1FX6A 4GVFA 3VIIA 3BOXA 3NGJA 3I65A 1DE6A 4DF2A 4GQGA 2VEMA 1ZP4A 2PZ0A 3QPYA 5CZ0A 4OECA 4YMZA 3I3EA 4LVAA 3P0WA 2NW0A 3OA5A 4O19A 2BNJA 2FPVA 2V8ZA 1M53A 2VNCA 3HG4A 3UG4A 4GVHA 3W72A 1GPFA 1C91A 1P6WA 3WQGA 4DELA 1G67A 1IWAA 1FWWA 4DVOA 5LHFA 1WCGA 2P50A 3LNPA 4GNKB 1FWAC 4O16A 5D9PA 3VNYA 2TODA 4N9CA 3RITA 5CC3A 5CXPA 3W7MA 3VIHA 3LPOA 3CAWA 3UU0A 3RRXA 1E4LA 2CBVA 1J2BA 1SM9A 4M8UA 3WQ8A 4MADA 2J7HA 3CTLA 3LMZA 9XIMA 3GFYA 2DZUA 4NNAA 3UXIA 1O60A 3T7VA 5C6MA 3FJLA 4V33A 3FXYA 1OJXA 1IXOA 1JPDX 2FH8A 3A4AA 3NL3A 2NVAA 1LG1A 4I7UA 3EOUA 3BMXA 3NZPA 3N29A 5BU6A 5CG7A 4GNVA 4F0KA 2RGLA 4LF2A 1JZ3A 4HSHA 1U1HA 4DO4A 3ANYA 2VZSA 3ANUA 4NF7A 2H9AB 5D38A 1XINA 3W7RA 1REQA 2BY2A 3IIZA 4AD5A 4LNCA 3T0AA 2FQIA 1X8FA 1GWJA 3TYAA 3AU2A 3N6QA 3ARTA 1GVEA 5H1WA 1SZEA 1M9HA 4GO9A 3N4AA 1XIHA 5F4WA 4O50A 3A22A 3CHVA 3KBMA 3KXQA 1TVPA 7ENLA 3H2FA 3PS7A 3PBUA 4PCPA 1XLMA 3M41A 1NQKA 4HHHA 2PDWA 1J2WA 3W28A 2ESCA 1JZ2A 1DQWA 2ACUA 1LP6A 4JTGA 2GOKA 3N9SA 2OZ8A 1BVNP 3CH9A 1ZCOA 2A6NA 1PCKA 1IEWA 1ZFJA 3GHTA 3WMBA 2OJPA 3SN0A 4UTLA 4ERGA 1VIWA 2XDFA 1L6FA 1W5NA 1L2QA 3C56A 4ACYA 1KC7A 5LXEA 4Y9PA 4YVVA 4FIRA 5HMFA 4XAFA 3PP7A 1F76A 2EPLX 3CEUA 2V67A 1AODA 3H55A 1XL9A 2AL2A 1MZHA 2Y24A 4AF0B 3P67A 1DIKA 5TNVA 4Y9MA 2XVGA 3CHEA 2PDKA 1MI3A 2OPJA 4DJDD 1JRCA 4PEEA 1XXXA 3M0MA 3PANA 3WNMA 1TTQA 2PPGA 2Y8UA 3FKRA 4KF1A 1GG1A 2GVEA 5C9WA 4B5WA 2H8XA 3TVAA 1TPEA 3DEQA 4XAPA 4Q8VA 2YX0A 4DAFA 3BAWA 1EO5A 1UD8A 5IRPA 4CD7A 1JYNA 1KM2A 2C7FA 2IKGA 4NVTA 1IQ8A 4BQ5A 2GSEA 1SFSA 1POKA 4XIMA 4HPHA 2GVJA 1J93A 3K5XA 1MSSA 3MUXA 4XBKA 2C91A 2UV8G 4HBKA 2PMQA 3W7CA 3WDPP 1W3NA 2Z1SA 1G7VA 4GI9A 4H9UA 3NEVA 1LBFA 3L5LA 1QHZA 2CLEA 1F3EA 2QCGA 4IPLA 3H12A 4PEKA 3RAOA 3WMCA 3REQB 3U57A 2YFOA 4GFSA 1A0DA 3V1HA 5I7GA 1ZCCA 1D9EA 3NJ3A 4JS3A 3I6TA 3LNMA 2PDUA 4DJFC 2A0NA 2OEMA 1VQTA 1PB0A 2Z2UA 2R1MA 3CO4A 2OOGA 5F2IA 1HKKA 3B05A 4KKXA 4XSLA 2ZUNA 3P81A 3EGJA 1W1VA 2CNCA 3EWXA 4RZBA 1NP0A 3S9ZA 2WHLA 2AGKA 5T9BG 2E8ZA 5EL1A 3VNZA 3R0KA 3UY7A 4ZR8A 4BI6A 3TQVA 2QGHA 3GM8A 4CNUA 5IBXA 1BD0A 3VD9A 4O11A 4EWND 4FI4A 3VNKA 3QQ1A 4B2DA 2XUCA 4FEZA 3WLSA 1E0VA 5D4YA 3NQBA 3NGFA 3M6YA 1NELA 2PTYA 4CN1A 4NP7A 2VFGA 1TTJA 4UTWC 1H11A 3LN3A 2X1TA 1AW5A 1B3YA 3WQEA 4E4FA 1DVJA 1TFVA 1A5SA 1E1FA 3LV5A 5CPTA 4EF9A 1YMYA 3SADA 3LMYA 4UQCA 3TR2A 1JI2A 1CGYA 1TCDA 2Y85A 4AEFA 2RUSA 1DWJM 3O6YX 4AFYA 4LSBA 3MWAA 3PTDA 1FQ0A 5CZSA 3QZAA 3TEVA 5CEWA 1JFHA 4GJ1A 4GJIA 4U28A 4LBUA 3MB9A 5AHLA 3DFSA 3T4CA 1CBGA 3M0IA 3KL0A 4DBSA 4E2OA 2WMIA 1V6TA 2V3GA 4C6FA 3I7SA 4U5IA 3IJ8A 3MJMA 3VDGA 3EYPA 2J9XA 1QPNA 1LT8A 4QLJA 3WF3A 1XF0A 4DLMA 2F6UA 2VC9A 4XD4A 3P74A 3P2VA 3AXXA 3MHFA 1J6OA 2D2JA 2PDLA 4HA1A 5FJTA 1R7OA 3O63A 1PXGA 2ZXDA 3ZJ7A 1FWCC 2BHYA 1BGAA 4GQQA 3RXZA 4DO6A 1XGZA 3W7HA 5BWAA 1JPIA 3PBMA 3AQUA 4MZ8A 1QI4A 3BMWA 1US2A 3SY8A 1OX4B 4LNYA 1W56A 3R7MA 4QE4A 3WO8A 1VCFA 3MS8A 4QSFA 2XH7A 3CV7A 3GAYA 4TUFA 1RJRA 3FIGA 2E3ZA 3CJPA 1JCNA 3ABQA 3WK2A 4GX8A 1R3YA 5DRCA 4WVXA 4Z08A 5FI8A 3TC6A 4CEXC 1YX1A 3FVMA 4E3VA 1WBJA 5FJUA 1EDGA 2DZWA 2QPSA 4NIRA 2EGZA 5IXEA 2TRSA 1RHCA 5C0QA 1M01A 3ARRA 4WXZA 4CD5A 1WE5A 2J9ZA 2VC7A 3W2KA 4H6RA 3LLXA 1E6NA 4KBXA 1QMLA 3GYCA 3EAUA 1QWGA 3OHIA 4CUCA 1OG6A 2GWNA 2PWUA 3B0PA 4R27A 1O66A 1WYIA 1UP3A 1PTAA 3U2ZA 2GDVA 1A5MC 4AHPA 1PKNA 2YXXA 3TXVA 3PZMA 1PKYA 3MUY1 4Q7IA 1ECEA 4L56A 3NURA 1ITQA 3PNUA 3FFSA 2VD8A 4LF1A 3FW6A 2X1SA 1V6UA 3IAPA 5D2TA 5A95A 1WDDA 2D24A 3IGSA 2DH3A 3V35A 1A5KC 1MEHA 4Z2LA 4MF4A 2JKEA 2JALA 3U5YA 3MMTA 2XISA 4U5KA 1W1ZA 4P8WA 1VBUA 1OZMA 2VL4A 3G1DA 4LJ3A 5G2WA 3W71A 1HJVA 1P5BA 2I7GA 3APGA 4C7GA 1FKXA 1JUKA 3WFZA 5I3HA 4GUGA 1H51A 4DUVA 4QS5A 1PTDA 3Q65A 3G1SA 4IMFA 1ODUA 3MANA 1RJQA 2CESA 5BXSA 3B4YA 3EXSA 4GO8A 3W6MA 3HN3A 3PJUA 3TC3A 2VUYA 3NUKA 1UR2A 3EA2A 4MWAB 1KFEA 4IGNA 1W3HA 2FDSA 2HXTA 4H9YA 1S5NA 2E77A 3SIMA 1YDVA 1PDZA 4FF7A 1C92A 4Q8OA 5E70A 3PPFA 3SFWA 2NV2A 4Q4RA 3OVGA 4C6CA 2CEQA 1JZ7A 3OPSA 1XRVA 1MZRA 3TYUA 3FEMA 1GGOA 4L6DA 2BZNA 5CJ5A 4HCHA 4BEQA 1PIFA 2VC5A 1TUFA 4P8UA 1UZDA 5KTLA 1NOUA 3T44A 2W61A 3AXHA 3HU7A 4DZIA 4WX2A 3LPPA 5DCDA 4F2TA 3FAWA 2RJGA 4I3GA 1MEIA 3KVLA 4AWEA 2C1IA 4N9DA 5AZ0A 4RLIA 5D37A 3HM7A 5C55A 2AL1A 2Y61A 3CQIA 4K1GA 2PRMA 5T26A 4JKLA 2J9YA 1W1B1 3HG5A 2QUVA 4WLCA 1KFBA 3QMRA 2GVGA 1NDYA 4YS1A 1JNDA 3LSCA 2O7SA 4AD4A 5AOUA 3NDYA 2OELA 3AYTA 1IXNA 2VVNA 3BE7A 2B4GA 1FH7A 1S5TA 3KL3A 1CNVA 2Z7KA 1T41A 5KZ6A 5I23A 1YKWA 1OZQA 3S1WA 1CXEA 1EO7A 3N6JA 1ZQ5A 3W3OA 1DEDA 1UKPA 1FWJC 2J7BA 1OFEA 1L6WA 1JULA 4K7YA 3GX9A 2XGIA 3R43A 3WK1A 4PMYA 3DYMA 3V18A 3IJQA 2RHGA 5G2HA 1GZGA 2EPOA 2ZTKA 1H49A 2ZZ1A 3KRSA 4GIRA 1S2TA 1JIBA 2PU1A 1TQXA 1ONWA 3BJFA 4LTSA 1LTDA 1ZP3A 4L9XA 2J7DA 1WDSA 2F2HA 4RK8A 3DFYA 3KTSA 3HF3A 3HO8A 4GQ0A 4TTUA 5AHNA 3UVIA 4AMCA 3W2JA 4CEUC 2X8RA 3APTA 3DX5A 2DSZA 5CPLA 2PP0A 1OCNA 3WLJA 3ITTA 1O94A 3NTYA 3AYVA 3CWHA 1HL9A 2WMFA 1UKTA 4OV4A 3ITVA 3LXBA 4LANA 3WJSA 2Y5SA 2O9TA 2YDQA 4U33A 1K7EA 3AUJA 3GBEA 3UEQA 2DUAA 1UWTA 3FAXA 5I0DA 2NQ9A 1HG3A 1Z32X 4HVXA 2WZMA 3MU7A 2VX5A 2ZUTA 1U22A 3BJSA 1GVRA 3MYPA 4JX5A 3PUDA 3K2GA 3CQKA 3QC0A 4D6DA 3EDEA 3UF9A 1J8VA 3OA3A 3W7JA 4EOUA 2QCFA 4PODA 1OC5A 4C5ZA 1NOFA 4CD8A 4IQLA 4M1RA 4P8XA 3KBVA 1R2RA 2QCEA 3G6MA 1RY8A 1XFCA 3BANA 1QDSA 4GUHA 4M6UA 1XH1A 4ATLA 4B92A 2WBGA 1CIUA 3LGEA 1F61A 2GUBA 4PB5A 3TAOA 1EHAA 1KR0A 3OJGA 1XUZA 3I10A 4YHGA 1QPKA 1ADOA 2E5BA 1DJGA 3H2OA 3D0CA 3RJYA 1YYAA 4HN8A 1HTIA 1R3WA 4WUIA 4JFTA 4WOQA 3AS1A 4MWAD 1QBBA 4Z17A 4HMEA 5A6KA 3U48A 2O55A 4B16A 2TSYA 2QV4A 4ZO7A 3UWVA 2Z2BA 4W85A 5AHFA 1EKOA 4UNIA 3ITXA 3OW1A 3GDLA 3M64A 3NXFA 3BG5A 5D2YA 3G18A 3N12A 1NDVA 2VI0A 3M5XA 4KQNA 3KP1A 3OVPA 1P0DA 2OEJA 2V5BA 4IFKB 5HAOA 1OIMA 4EPEC 4A4AA 4E4PA 3AWNA 3ORWA 3IIOA 1V6YA 1XYZA 5DMNA 3H53A 3UGVA 1H1ZA 3VDCA 4G7EA 1Q65A 3AICA 5CLTA 3ZVIA 1TA3B 2FVLA 1ZHAA 1TE6A 5HMDA 3M4HA 1I2RA 3N2BA 1YRRA 2AAAA 1C3FA 3KVJA 1JCXA 3U4AA 2CKSA 4O18A 3URAA 3QPEA 1KGUA 1ML1A 4H19A 3SGGA 3N19B 1GORA 1OD8A 4ZQCA 2A7NA 4D2JA 1R3VA 4LCSA 1FWEC 1F6PA 4S3GA 2XM2A 4E6MA 2W62A 7XIMA 5JQ9A 1TZ7A 5I2UA 3BURA 1WKDA 3HQOA 3A3HA 4NKCA 3STCA 4AZ5A 3CZGA 1XS2A 3BCJA 4MAZA 4A21A 5ENLA 1UWAA 4BZYA 4NHVA 2DZTA 1HX0A 1MW3A 1U83A 2CLMA 1FWBC 5LGXA 3D47A 3NL5A 1U30A 1QBAA 2V5DA 4O1CA 4RNFA 1Q63A 2CWXA 4U2ZA 1N8FA 1UPMB 5LA1A 4AHQA 2CITA 4XZMX 4ZE4A 1LT7A 2YCEA 2VQUA 4UZUA 3AXIA 2CLKA 5JU6A 1OVDA 4O8RA 5IBXC 4JIQA 1KO0A 4S3JA 2CLPA 2IKHA 3PZQA 1H7PA 2WMHA 2VCBA 3LZ5A 4I9MA 1I2NA 2J13A 2Z26A 2VEKA 3AJXA 4LUJA 5HATA 3RPMA 2DQWA 1S5MA 2CZVA 5AECA 2WKGA 1V3LA 1EYWA 3BAXA 4GISA 4K8GA 4LUTA 5K2ZA 4B9YA 3O6DA 3H4XA 4S38A 1FOBA 3H2NA 4IHCA 4ACZA 5ECUA 3BICA 5I3IA 3RIKA 3L0KA 2PFHA 3NA8A 3EOSA 4O4VA 3A4XA 4YYCA 4BKNA 4M6QA 3WH6A 1Q5MA 4LX4A 4DRSA 4GY7A 3GR7A 5FEXA 1SO4A 5I5RA 1KXTA 2D3NA 1UMLA 2PDMA 3GHSA 1KFWA 1K8ZA 2FHBA 5I02A 4MM1A 5A8MA 4DXVA 5HULA 2QLYA 2WVSA 3OU8A 1XDJA 3IEBA 3ALGA 2DZAA 4RKAA 5C9RA 3EMCA 3DG7A 3RGTA 2V3EA 3LRMA 4OQVA 4F2BA 3VKAA 4F3HA 5AFDA 4UOQA 3T42A 1W3JA 3BLPX 4JIPA 3ZS4A 1GHSA 3VZYA 1W9VA 5DRIA 2AMXA 3ECQA 1TRDA 2A7PA 2BX7A 3K8MA 4JQ1A 3IGXA 3Q94A 3BAJA 3RR4A 4C6NA 4BF7A 3ITLA 3NYZA 5M17A 1DWFM 3T78A 3UVAA 1P4CA 3UESA 4L65A 2VWSA 2ISSA 3BLEA 1HJQA 1WA3A 3OQEA 4A29A 2JIWA 4GQRA 5CPSA 3TN6A 3LLFA 3N1AA 2W67A 4INFA 3LCLA 1I4NA 4LAUA 4PMVA 1AJZA 1IR2A 3VKDA 3FX4A 2WBKA 1X1ZA 4GPNA 1AA1B 5TAOA 3ZSTA 2G3MA 4DWDA 1KR1A 1A3XA 4HPGA 2YA2A 1A53A 3AHTA 4DZ5A 4PMJA 4NYYA 1A5NC 1V3JA 3EX1A 4Z2IA 2KZHA 3DKJA 1D3CA 5TIMA 8XIAA 3UNTA 2R1PA 1XG3A 1E6PA 3G0SA 4MNMA 5HK4A 3AOFA 1E43A 3MDWA 2BGQA 3QR1A 2VWTA 4PBFA 5AC7A 1EQPA 1QASA 3W81A 5AKQA 1E1EA 2GQ9A 4DI8A 1UD6A 3A6OA 5U4NA 3G1FA 2XIIA 4KT2A 3GG1A 4F0LA 4X22A 2Y6ZA 2VKZG 3A13A 1TPH1 3FKKA 3WLHA 1H61A 4DY1A 1GTHA 2WVVA 2J27A 3PPGA 1CB7B 4F9DA 3GXDA 2DIJA 3A5FA 3ID7A 2IQDA 3B0UX 2W92A 2XYLA 2ZCGA 3VOJA 4JFUA 1R47A 4AUBA 1GZJA 3THUA 2PGRA 2JGQA 1RK6A 2FVMA 3CC1A 4GIAA 4W8AA 3AI0A 1UR0A 1H09A 1CWYA 2OT0A 2F84A 1CENA 2QF7A 1F07A 1OC6A 3B04A 3NO3A 3O6CA 1LORA 1O5KA 4O54A 3HB9A 4H6QA 6PTDA 4GZIA 4GXWA 4RDZA 3WH9A 4AWTA 3P8JA 3IGUA 1HVQA 3VMNA 1HO1A 1KM0A 4HPXA 2PD9A 4I8DA 2WCGA 4NAFB 5CC6A 1B57A 1N82A 1SPQA 2J8GA 3B9NA 4LS1A 3UZXA 1BXBA 2ATSA 2FMOA 3B9AA 3URNA 1WV2A 3GTXA 1TZ9A 1P0BA 1M7OA 2FTPA 1BPLB 1RXOB 3W1PA 1WKEA 5F7UA 3IUHA 1HJXA 5J04A 1H41A 3S1VA 3M47A 3EB4A 1XD0A 2QJJA 4KEMA 3SCQA 4FNQA 3WN6A 4IIFA 3V36A 1FHLA 4PUMA 5A6AA 4MTVA 2Z29A 1IZJA 1E0UA 2QHAA 1CGUA 1O6IA 3R5EA 4J5NA 4IZGA 4DM1A 3CUFA 1S3HA 3V1PA 2GK1B 1PPIA 4QEHA 1DOSA 2HPIA 3TTYA 4FNUA 1I60A 1J0KA 1Z8AA 1AH3A 3O9NA 3ARUA 3NSMA 5A6TC 3WLLA 1DE5A 3SI9A 3CWOX 5HWMA 4RPQA 3RLHA 5M2FX 3NQEA 1M3UA 1P6BA 3DYPA 2PBOA 3WBYA 4F9JA 3MZNA 4DBEA 1JZ5A 3Q37A 4IMGA 3SCTA 1UWRA 1R46A 4Y90A 3VD4A 3F4DA 4RNIA 3RFAA 4UR8A 2V30A 3QHNA 3LU2A 1PWMA 3WL0A 3CT7A 3AC0A 1XISA 4LC8A 4GC3A 3FOKA 3PUOA 4JTFA 4YTSA 1NWUA 1YHTA 2I14A 5I78A 3N9KA 1PIGA 2YA1A 3R25A 1B3VA 3HOJA 4PCFA 3LLDA 1TIWA 4UNKA 8RUCA 3WLIA 4PMOA 3GU9A 1O95A 1JDFA 3CZ8A 3DI1A 1AL7A 3WH5A 5CKSA 2DJLA 2PWVA 4PCSA 3STFA 3KOYA 2WNQA 4NZJA 4DO7A 1CTNA 1IWBA 2GGJA 3SQMA 2ZOXA 2G4JA 5XIMA 2NLYA 1XCXA 3N2XA 3DC0A 3K1DA 5EFFA 1JVNA 2NX1A 8CGTA 1UUOA 3LBOA 3VAVA 5LKYA 4DJFD 3GNNA 1UOZA 1JQVA 2D2GA 3FLUA 4RXFA 3L4ZA 4ZFCA 3UZWA 3EX2A 3STPA 1UZHA 5FSEC 4WY0B 4Z1AA 2ZRXA 3SRHA 3HGJA 2VEIA 1U5VA 4H9ZA 5I00A 5FJPA 3ITCA 1MW1A 2E67A 2QJGA 4S2CA 4HK6A 2OCZA 3ZLHA 4O12A 3MCMA 2NWRA 4WEVX 1FWRA 2ZUVA 4V27A 1WAUA 1XIBA 2F6KA 4FIQA 5D32A 1PIIA 2A21A 5BXTA 1DWGM 3ONCA 1W17A 4US6A 4JCMA 4ROPA 4QX4A 1TJPA 3NO1A 3W53A 4ZZ9A 1KWKA 4KRUA 1K9EA 2YGYA 1QI3A 4IOTA 4LW7A 1G4TA 3ABZA 3AHXA 2NVDA 1QU4A 2HS6A 2ZBTA 4UZSA 4BA0A 4W93A 3VNLA 2YR1A 3AROA 4WGHA 2QXWA 3QOMA 5F2LA 1Z6KA 3D3FA 1KXHA 4WD0A 1I6NA 1R5YA 3B8UA 4PFHA 1VC4A 1YPIA 1EIXA 4J28A 2DZVA 1WNOA 1JAKA 4LVBA 1GHRA 3PUEA 4GZ7A 5CSRA 2E8YA 1EOMA 4ROQA 1QT1A 4MKNA 3VFLA 3W75A 1GVYA 2QKFA 2X2YA 3TA6A 1SSGA 3BGGA 4ZSTA 3C8FA 3W02A 3MP4A 3CQ0A 1UD5A 5LA0A 1X1NA 1VJSA 4ADUA 2YCIX 1XBYA 3WD2A 2X40A 3FSUA 3DAQA 4QDPA 2OYLA 4V1XA 1BTMA 2P8BA 1EA9C 1TPC1 3AAMA 3NQAA 3PN8A 3T4WA 1AMKA 1L2UA 1AH0A 1A0CA 3NFUA 3LDVA 2POTA 2XFYA 4DNHA 3BO9A 2Z1WA 3NDZA 4QP0A 2ZRUA 3BJTA 1HFBA 5FESA 1O1ZA 4PA8A 2XIMA 3TWAA 5CJMA 1UD4A 4Z1DA 4X3ZA 3CO8A 3FHQA 3IJ9A 2E09A 1MXDA 4GINA 4H8UA 1P0EA 3SY1A 2HSAA 3OVQA 1KWGA 2J6XA 4Z42C 5FKYA 1QPOA 4PTMA 4S3DA 3GSMA 2F2KA 4EIVA 3OBAA 2PC8A 3A4JA 4ZGYA 4GACA 1D7KA 1R3SA 4IMCA 1HO4A 1ELSA 2NXHA 3W1UA 2OU4A 3T9PA 5EBAA 3VI2A 5IM51 3MQTA 1GT8A 2AQVA 2OQYA 1GJWA 3TWBA 5GNYA 3PBGA 1REQB 5I3KA 4U2YA 3LTYA 1X98A 1UPPA 1TQJA 2VHLA 3DGBA 3WL1A 4RXGA 4C6JA 3L65A 3VMOA 1XDMA 3URQA 1QI0A 3DFPA 3PPCA 3S2NA 3T8QA 4U3AA 3R94A 3EKLA 3G8EA 3EPOA 1V08A 3UWZA 1AW1A 3SEPA 2DT1A 3MPGA 3NZGA 1UKSA 5GJNA 4MB3A 4FMVA 4AZ6A 2VX4A 5DELA 4ZQRA 4NI8A 4CQDA 3L5AA 4JHZA 5DN1A 4PE8A 4JY8A 1BRLA 4UFHA 4YPJA 4OBTA 4IMAA 4NXKA 3VX0A 3BPWA 4C6QA 4OKDA 4HYWA 1VYRA 1FBAA 4KWSA 4XZIA 4C7FA 1I1WA 1PTGA 3T1GA 4JHMA 1X8CA 1PX4A 5CCZA 1NF7A 3T55A 2EJAA 3LBMA 1RP8A 4AC1X 1BLIA 1LWIA 2WSRA 1PX3A 3DERA 3ZWSA 3KOWA 5HWNA 4LV4A 3IIVA 5HJLA 5JMUA 3CUZA 4BI7A 1A5UA 1EGVA 3LB0A 1ONRA 2F38A 1QXLA 3UZYA 1GNXA 2GFTA 2C1HA 4J2MA 5BROA 1K77A 3C0SA 4PGLA 3UXDA 3ONBA 4I90A 1LF1A 1X97A 4NZCA 4YTUA 1LWHA 2A7RA 4Q22A 1I75A 4LWWA 1VLIA 3MT1A 5TF0A 3W82A 1WXYA 3ZOAA 1QOPA 1WXZA 1BF6A 1VP5A 3CYJA 1XIMA 2WCSA 4LYRA 1L8PA 2HK1A 3MUAA 3C2RA 2VTFA 2ZUSA 4H8HA 4RDYA 5HANA 4R7OA 4J3SA 2CXEA 2DVTA 4CN4A 4Y2WA 3HGSA 4UTUA 1NY1A 3UJSA 1XRSA 4LQ1A 3MUIA 1RA5A 3NXLA 1PEZA 2DP3A 4XAYA 3B8DA 3UZJA 1RP9A 1XLLA 3SCUA 1HVXA 3L7RA 1BG9A 3KDNA 4Q8MA 2SFPA 3QV9A 3KCJA 1OFBA 4H41A 2ZZ5A 1KCXA 3CT2A 2DV0A 1US3A 4OUEA 3N3TA 3AIVA 3TN5A 3OVRA 4PTVA 4DUWA 2YB4A 4OBRA 1R9ZA 1UR9A 4CCEA 1CXLA 2PC4A 1RCXB 3BL3A 4JTRA 4FA3A 2EXOA 3P3BA 3NZRA 3MV01 4HYRA 1G5AA 1EF3A 1XSKA 4FXRA 7A3HA 4Z2GA 1ITCA 4MJ4A 2Z25A 5HA7A 3S42A 4AQLA 3LZ3A 3NAVA 4N0RA 3LTPA 4KEZA 4Q6XA 3KCLA 4HNNA 2ZXQA 3VNIA 2J6VA 2Z1VA 2ZVRA 3ZVHA 3MMUA 1ME7A 3GW3A 4XIAA 2BXZA 5LSMA 1YXDA 4JKKA 1K9TA 3QQ0A 3E0WA 2J79A 4DO5A 4Q8UA 4UFLA 3PBWA 3ANVA 1MNZA 3MKCA 4GXPA 5EMMA 5I79A 2CPUA 1AQHA 3SQLA 1XM3A 3PULA 1XV8A 2A85A 3HQNA 4JTJA 4X2PA 4UBPC 3QF0A 1XJBA 2WPBA 4Y9AA 3QKZA 1MVYA 2IXUA 3UWUA 2WZTA 1QNOA 2UY5A 3U7VA 1J12A 2R1NA 4JTAA 4HNVA 3MHUA 5RUBA 4ICMA 1Z48A 4W8BA 2QCCA 4Y9NA 3ALFA 4P7RA 2FZMA 4QG8A 4GH3A 1P7TB 1WKYA 4UTJA 2VYOA 2INFA 1V02E 2R24A 1S5VA 3ABRA 2YW4A 1D2KA 5LIWX 2JKAA 1KW1A 3NQ8A 3MY9A 3VINA 1H4PA 4UQ9A 4O1AA 4QJ4B 1W32A 3S47A 4LYKA 3JZUA 1K8YA 2WMIB 3PTKA 4JTLA 1G9HA 1TPFA 4UQEA 1FCBA 3VNJA 3TDFA 1RQHA 3KE0A 4MFDA 3VA8A 3ZR4A 2ISFA 4GYJA 2E68A 3M0KA 1JF5A 1OQFA 2PE4A 4GUJA 4TO8A 1E6RA 1D8WA 2YW3A 3UZZA 1JZ6A 1DIEA 1DXEA 4K39A 2XH0A 2V68A 1OGBA 1VPQA 6TIMA 4CCZA 4C6PA 1SW0A 2J7CA 3IJLA 2O56A 4J3WA 2C8NA 4XD5A 2OGYA 4JKMA 2Z2AA 2DSVA 3FJ4A 2FTWA 1GVOA 4KCTA 3BG3A 1MUCA 2EHHA 3QBUA 4Y8FA 3DHPA 2DT3A 4IIBA 2XN2A 1POJA 3NQ6A 4XKYA 5MHBA 3AMKA 3B40A 3BMVA 3L68A 1E72M 4QHRA 2WLYA 1EJTC 1VPXA 1AW2A 5LGZA 3USZA 5E6ZA 1XLEA 4DLFA 2NT1A 4BJHA 5I24A 3T8LA 1W5MA 2E5DA 2FKPA 3S5OA 3W01A 1OBAA 4TMBA 4E2BA 3C0QA 2OO6A 2XIQA 1DTUA 3WMSA 3R0UA 3L9CA 4LY4A 1VYSX 4MZYA 4XTDA 3WSUA 5CJNA 2E6AA 1EUNA 1BF2A 3EX3A 3OIXA 1JEZA 1BSLA 2VDGA 1E4IA 4UTIA 1H1NA 1GVFA 4ADSA 3W2LA 5GJPA 3RU6A 4YU1A 1YQ2A 2VQTA 3C3NA 5CC7A 4HCLA 3MW7A 2NSXA 1DYSA 1OM0A 2HVMA 4KWVA 5D2WA 4LPCA 3QV7A 1J11A 4OU1A 4CNSA 3VOCA 3WQVA 1KBKA 4PYSA 2BSLA 3HGOA 3ZJ8A 2ONEA 1AQMA 4ZEPA 2W5FA 2CHNA 4UTMA 5AYZA 3WH7A 9RUBA 1R87A 4PBGA 4QNWA 1EP2A 2XGBA 2Y7GA 5BOFA 1FVPA 1J79A 2O4QA 3N6HA 4FX8A 1XKYA 1XIJA 5C71A 2QULA 3TTSA 2QT3A 2RDUA 4OOUA 2BP1A 1DJNA 4BHYA 4L64A 2DZPA 4QFUA 3R8HA 1QPQA 3SSZA 4HU0A 4DYKA 2IS7A 3AS3A 3WCZA 1RLCL 1UG6A 1F9CA 3UCDA 2FZDA 1EJUC 4ES4A 3ES8A 2QEZA 2CLIA 4FLRA 3GBDA 1HGYA 3WQDA 1GYMA 3IK4A 4TVDA 5KETA 4O1DA 2C0HA 3DFQA 4D6GA 1XLJA 1FFQA 1H63A 5A6BA 1M68A 3MI3A 4AX7A 4LEQA 1O5RA 1WBHA 1VFTA 4QEEA 2P5NA 4XZWA 3ELFA 3V5FA 1H3GA 3H2CA 2VGFA 4QLKA 4IIEA 2I9EA 2WWDA 1B3WA 5DANA 3LG3A 4RW5A 1YTKA 1Q2RA 2TMDA 2YSWA 3G1RA 3KTCA 4AWUA 2HBXA 2QUMA 4DXKA 1XC6A 4OWGA 3GG0A 2JF7A 3HIJA 3W1XA 3URBA 3P0XA 1JDCA 1DQUA 1D3GA 1TKKA 1TV2A 3PSVA 4CD6A 1JUBA 1GW1A 2O92A 2DU2A 4CQBA 4IGMA 4MMWA 2PP3A 3WENA 3A12A 4P7NA 1XLHA 1B3ZA 1KRCC 3S8HA 1JF6A 4KGLA 4LUSB 3OZPA 4O52A 4TU1A 1SJDA 1JXJA 1C93A 2V2HA 5BRBA 4G8TA 4Q8WA 3W86A 5D33A 2J62A 4FLSA 3W6YA 3RNDA 4LVFA 3KBSA 1N8WA 1WO2A 4DJEC 3TJIA 1Y0EA 1DIOA 4KCUA 2DY3A 3TW7A 3AIRA 5AHEA 1ZTVA 2XZ9A 4X63A 3EOOA 2IMRA 1H1YA 1CT5A 1ZBCA 2DH2A 3KWSA 3FXGA 1EC9A 1KB3A 1CEOA 3BGJA 4C1NA 1LWJA 2ZRZA 4DWSB 1EJXC 1VAHA 3I6RA 3WLQA 1T7LA 2PF8A 3LUTA 1ECQA 1VZWA 5HXMA 1WZAA 3CAVA 5E0CA 5J5RA 3EBVA 4MPKA 1JD7A 4FOKA 4MJ2A 2XPKA 2G8ZA 5FSDC 1WZLA 1EZWA 3NL6A 5T8GA 4C1LA 2WMKA 2NSOA 3M7SA 2OT1A 3PK7A 1ZLPA 2QCNA 3THAA 5KITA 1KM3A 3WG6A 4K68A 2WQDA 1EX1A 1W3TA 2FHFA 3KOXA 1BXNA 4Q33A 1RCOB 1ZUAX 3EOEA 3T40A 3W38A 1R8LA 3CAKA 1QFEA 3OLGA 1TJ2A 3I68A 2VFFA 3M0YA 5D02A 4PB3A 3KW3A 4G7FA 4JN7A 3WJWA 2ZC8A 3QR0A 1RVGA 3VIFA 2Y88A 1EDTA 3KFTA 1UR3M 4AB4A 3WQ5A 3SRKA 4JQ3A 3TONA 3TMLA 4N42A 3TQKA 4HB7A 3XISA 3A9BA 3GXMA 2X41A 2PGWA 4UOZA 1EP1A 2RH9A 3IACA 1LYXA 3QXBA 4LVDA 1CGVA 2R91A 3KOFA 3ARPA 3GDTA 3C0JA 1OCBA 3Q4DA 3LQGA 3VK5A 1UJQA 4XQ6A 3IJ6A 4EXAA 3O06A 2VRJA 3ICJA 1MFUA 1GVIA 3B06A 4E5TA 3VIGA 2GWGA 2I9UA 3NQMA 4YTTA 3VZXA 3NSXA 3BW3A 1WXJA 3G1VA 3ITOA 1XQKA 4PUJA 4K7VA 4ZQMA 3TYZA 3AMGA 1L6YA 1VFHA 2W27A 4UNLA 4AYSA 1TV5A 2ZA3A 3NQDA 2ISDA 1V3MA 5HPOA 1B4KA 4E8DA 1UD2A 2CZ5A 4NYUA 1DKWA 3C4UA 5HBFA 4WHBA 4Z1CA 3KBNA 4P61A 3P8IA 3VOFA 1EXPA 2B7PA 4H8NA 2VJXA 2Y7EA 1YPFA 3RK8A 3RRAA 4PMDA 1K7XA 2VM8A 1I45A 1O5XA 3WNNA 1UH3A 3WD1A 1AK5A 1A49A 1DTNA 2JQXA 1XIIA 3CM4A 1OG0A 3CS2A 4LAMA 3AYRA 1ZZMA 5FAGA 1TVNA 3K4WA 3P93A 1TIMA 1F74A 3C6CA 4TQTA 1TWWA 4OUIA 1KRAC 3VXGA 3WMLA 3PZNA 1VFMA 4EACA 1DJHA 1W0MA 5F2MA 1HW6A 3ME3A 3PZUA 2WXDM 4C91A 3WDRA 2GSJA 1QI2A 4ZTXA 2FZ9A 1GOKA 3GTNA 3HV9A 4LCRA 1QRQA 4IH3A 1KGWA 5LZLA 3SGZA 2PZNA 4D8ZA 3AHVA 3U7BA 4HOWA 1SW3A 4RZ5A 4D6CA 5EMLA 3P60A 2OLSA 4BQ3A 2H90A 5REQA 1TMHA 1EPVA 4HGXA 1Q13A 3GIQA 1PHQA 1PZ3A 3U9IA 5I07A 5A8OA 5K3VA 2XM1A 1BQCA 2H6RA 1UBSA 4H3DA 2WSKA 1B9ZA 4GIEA 3S1XA 3F4WA 4I5XA 1GTEA 1FWIC 4ILSA 3ARWA 2CLOA 3RR1A 2PWGA 1O1HA 2AQWA 3IPWA 4DNMA 4LS0A 1GQKA 7ODCA 2IUZA 3CIWA 3DIPA 3O2LA 3R4IA 6REQA 3NPVA 4LGXA 3RLVA 5AC8A 5E1QA 2V5LA 1LLWA 5H91A 3Q58A 3BCFA 1XLDA 5M03A 3C2VA 1TSIA 1MUMA 3C61A 2R1LA 4D6FA 2BMBA 2XVNA 3FA3A 4A22A 4BF9A 1ZBWA 3GDMA 4NNBA 1JDDA 2JEPA 1KTBA 4MIMA 5E0FA 2CW6A 1B2YA 5K9CA 3VGHA 1CGXA 5CPNA 1UR8A 3DESA 3SRDA 2ATMA 4ACZB 3GH7A 3W1AA 3S6TA 3TLQA 3EMQA 1HUVA 2QNEA 3CL8A 4TOQA 2GJPA 4JTTA 4J3TA 1UYQA 3LK6A 3SFKA 2IW0A 1TWZA 5M3WA 1RK5A 3BC9A 1NP2A 1KV8A 1ZJIA 3TP4A 2FLIA 2J24A 1UP0A 1VBHA 2GQAA 4ZODA 4MAVA 1SUXA 4F79A 1UOKA 4B4HA 2FPTA 1SFTA 1XLBA 3I6EA 4XZHA 5E09A 2QVHA 5BYWA 2J8TA 4M19A 3XIMA 1IV8A 1XYCA 1N2VA 2J75A 1DJWA 1EC8A 2GQ3A 3VU2A 2C15A 3LM7A 4PMUA 4K3ZA 1KBJA 3M43A 2BY0A 4I9JA 3S46A 1O7AA 4UUIA 1OK4A 2WJFA 3VIPA 4CCDA 3CIVA 4XBSA 4UMBA 5DBUA 1KA9F 1Q8JA 4S2BA 5EMKA 3TYEA 5HQLA 1H0GA 4G6CA 4NT0A 1BWKA 4GYKA 4BF5A 3TIMA 1JL8A 3MJYA 1S2AA 3GFZA 3NOEA 1XCWA 2FJUB 1UWIA 4YL2A 2BFGA 2ZUWA 1OABA 4AX6A 3K1GA 4UFJA 1BSIA 4GD0A 2BTMA 1CGTA 3SAZA 2HS8A 5LNVA 4GVIA 3E6EA 4HYVA 5HQMA 1TTPA 3MI6A 1VHCA 3MDUA 1ITUA 4Y96A 2ACSA 1QCWA 3E0FA 4PMZA 4O1EA 4OHQA 4NZ4A 3R0DA 2X2GA 1TR1A 4FXSA 5A2CA 3CK5A 2GJXA 4ZOBA 4PUWA 4TTGA 2FZBA 4I9TA 4Z1BA 3P82A 3CUGA 1W5QA 3OBEA 5HPCA 4IP7A 2DVUA 3MCOA 4D9PA 1T8XA 3QM3A 3QLLA 4NASA 3LXCA 1DPMA 3WK3A 3ABSA 3W1NA 2KAUC 3WLPA 4N9EA 1WX0A 1CW2A 1EPXA 1M5WA 4R9OA 3BW4A 3OTRA 2GYIA 3EZ4A 2GGHA 2WAGA 4JOMA 4B15A 2NXGA 3SQSA 2QJMA 1X39A 2D2OA 2ZZ2A 2AKZA 4AD1A 4QAWA 1ISWA 1VF8A 5KMYA 3KX6A 5GNZA 3NZQA 2QS8A 5C9ZA 4JIEA 5AYYA 5G4WA 4GYPA 3E9AA 1G0CA 2OQLA 4IMDA 2Q02A 3TOPA 1R2TA 4YJ5A 4IXHA 4IJRA 5BMXA 1J4EA 2WVVB 2ACQA 4Q8TA 1MW2A 3CXOA 3BLDA 1TJRA 1HKWA 1IGWA 4W8LA 3ZJ6A 2Q6ZA 1ZRQA 1XH2A 2XN0A 4MKVA 3KS6A 1H62A 3G1HA 4A8IA 1F5ZA 2HMCA 2QR6A 1Q6DA 4AIUA 1IGSA 4S1FA 4P7OA 4GUFA 2IKIA 1AMYA 4JD4A 2BVWA 2OX4A 3LEPA 4OT7A 2YL5A 3UNDA 2PTXA 2PAJA 3QY7A 4MWAA 1HP5A 1S2WA 1LOLA 4HZ6A 4OZOA 1QR7A 2P10A 4PMQA 2ZADA 3UPMA 4DYEA 5EMJA 3FN9A 3N15A 3LHWA 1J18A 2LLEA 1V0LA 1VJIA 4RL3A 3SUWA 4ECLA 3W70A 4M80A 1VFUA 4XVDA 5AVNA 4IMEA 4EF8A 1XBZA 5B80A 4A05A 5PTDA 3R6IA 5IOBA 4S3FA 4L1XA 4TIMA 4M6PA 1AVAA 5DX7A 1SR9A 1X96A 4F0MA 1UP2A 1Z7AA 1VJZA 3P6LA 4AVOA 1FWGC 1XBVA 1KCLA 3KP0A 5FJRA 5TBOA 4EXBA 3HPXA 5I3GA 1ENUA 5DMLA 1PYMA 4H1ZA 2IXVA 3WFAA 2VEFA 3TTQA 3GWQA 1BWVA 4GHRA 3BVJA 4NAEB 5LYRA 4W7UA 3U3HA 3VDHA 3MSDA 3MP5A 2JBMA 3BLLA 4AVFA 1GKQA 2WJDA 2F61A 2O9PA 4LRTA 1TELA 2PU0A 1W9XA 1U5HA 4EPBC 3ATZA 5K9XA 2BB0A 2VFEA 4JFVA 4XD3A 4ZOCA 5K7JA 5AYBA 3STEA 3B8WA 4GX9A 3QV6A 2OODA 1KFCA 3G1YA 3PUGA 3GAKA 3W85A 2I17A 2Y89A 3KEHA 1RCQA 4A3UA 1R38A 3CAQA 3GD6A 4K38A 2Y8VA 2ZZ6A 4WOZA 3RM8A 4L6HA 3NL2A 4QIUA 4JDBA 1Y5VA 3EWUA 1NVMA 1JRBA 1U1JA 1G1YA 2OSWA 2OYMA 2JK2A 3AZTA 1NWTA 5ABEA 2PGFA 3BV7A 4JAWA 1E0WA 1EH9A 1KTNA 4KESA 4EKJA 3U6WA 3QW4B 1FXPA 2BV9A 1CLKA 2XVPA 5I3DA 3F1QA 1I2QA 3PNZA 2ZX8A 4NUWA 8A3HA 3C2YA 4Q8PA 1EGZA 4YIWA 2DZSA 5A8GA 2FFIA 3CMJA 3RO8A 3GU2A 1QHOA 5I77A 2ZDSA 1SZRA 1BEUA 1T96A 1UMYA 1BHGA 3CPRA 3MBDA 4X0NA 1VB9A 2PCEA 2BODX 2PDIA 3FA5A 3N2OA 1XDLA 5T91A 5A6LA 1J0ZA 3DH7A 4IPNB 2G97A 4LB3A 4XWUA 2OKTA 1J5TA 2X1RA 3S6OA 1OFPA 1UD3A 5I03A 1PWLA 3P80A 2ZRVA 2DDXA 2Y0FA 2ZXAA 3ARXA 4WF7A 3VGBA 4A3RA 3T81A 2NZLA 1O5QA 4KWUA 3BAYA 4IUGA 1KRBC 2C1GA 3LV6A 5D9OA 1GQIA 3FV9A 2J88A 4G1KA 4FB7A 4BEUA 5FACA 4AG0A 3FCPA 4F4RA 5SWUA 3QHMA 3KBWA 1UROA 1VFSA 4W89A 1E6QM 2OB3A 4B5TA 2ZZ3A 3VMPA 3CH0A 2QJNA 4D8AA 2BOFX 1P6CA 4TMCA 2XTKA 3OODA 1PBGA 1WKFA 3WQ4A 3DG3A 4WKAA 3WELA 1DJZA 4CQ8A 3PZ9A 1L6GA 4GK8A 1PKMA 2XVKA 3UPBA 4AXNA 1XGEA 2CBUA 3QHOA 2ICSA 3BQ5A 3S9YA 5DCBA 4EP8C 3WBAA 2V69A 3FK4A 1NFBA 1R7AA 2XSAA 1C7TA 3GU1A 2PDGA 2HDJA 4S23A 4H00A 4PTNA 1IR1A 3GDKA 6XIAA 5A8NA 3HQ1A 1CX9A 1PZ1A 4CKQA 1ISXA 2Z00A 1XW8A 5AB3A 1V6WA 1PUDA 2XG9A 4NJIA 3SURA 4W88A 1G01A 4G2DA 5C54A 1PE1A 5A2AA 3RYSA 2YCLB 3GKFA 1F4HA 2PTZA 3SCNA 1QNRA 4QROA 4Z2HA 1FP9A 2VR2A 1EUAA 4J3UA 1E1CA 3QYQA 3OG2A 4C6BA 3GXTA 1MQPA 2UZ9A 4BCEA 3RO6A 3W76A 3LGDA 4O57A 3NIYA 3QTPA 2VGBA 3LSBA 3O7UA 4HQVA 4M82A 4CNNA 2YBTA 4S3KA 3GTHA 2OTDA 2YJQA 4S3EA 1A5AA 4FXFA 3LCIA 2NXIA 1TE1A 1E5NA 2YLLA 3LERA 4WDUA 2AAMA 4MY8A 1R9YA 4JNMA 4XAGA 1LQAA 2WM1A 3LYEA 4DZHA 3QJAA 1LROA 2CIPA 3CYVA 4PUKA 5FJJA 4DZAA 4UTHA 1VEPA 4C5YA 3VCCA 4JBRA 1ZALA 5LNWA 3C2OA 5BWFA 2WC4A 1VEMA 1TPDA 4Q6JA 2OFJA 3FYOA 1NH6A 2JEQA 3I7RA 4QJ5B 4L9ZA 1LOSA 2BBFA 3IV3A 3UR7A 2C19A 2YOCA 4XZLX 1E71M 3CV6A 1F3XA 1EJWC 2P88A 3TFXA 3WLRA 3AIQA 3DN5A 4Y6GA 4HMCA 4JEJA 1IT7A 1TV4A 3C0LA 3OGRA 1Z44A 4HOXA 3D3AA 3DZ1A 1S1RA 5F2GA 4PMXA 3RJXA 1NM9A 1VPYA 2D69A 2ALDA 2XWEA 1K3UA 2AGTA 4ZL1A 1RZMA 3BQ6A 1VHNA 3UT0A 2CHOA 5DT5A 3LHYA 4MY1A 3DYOA 3AIEA 1P48A 4POCA 2A6LA 3LRLA 4QGCA 3WUBA 4JTHA 3L4YA 1C7SA 4REQB 1XIDA 2WM0A 1A0EA 2HCVA 3ZLGA 3THCA 4GABA 1KFKA 2E1WA 3OZOA 4HNTA 3L2MA 3POCA 4H01A 3GG7A 2IPWA 2QDEA 3JU2A 4QJ1A 1XBXA 2VXNA 3OQ8A 1UKOA 2EQDA 1W6TA 3R10A 1HL8A 2Y7DA 2CETA 2XIOA 3U2OA 1FA2A 3CNYA 1RBOB 5EA9A 1J0YA 2NV9A 5BXRA 2X42A 4GBDA 1W3LA 1EFZA 3PAOA 4HHPA 3CZKA 4HHMA 2ZWZA 3PAJA 4LAZA 2ZZ7A 1DHKA 2A3EA 2G4FA 4JX4A 1WB0A 4J40A 1UCWA 3EA1A 4HNUA 3G22A 3NVDA 1EJRC 1RVKA 3KOZA 5EGRA 4C6KA 4LFYA 3KWXA 4ZVJA 3PZGA 5FL0A 4IM4A 5U7SA 1V3KA 1EIBA 5IFTA 1D8CA 3CHDA 3IARA 3E38A 3QGKC 5CPQA 4Z2KA 3QW3A 1YADA 4NZFA 1M7PA 3S2CA 4D72A 3PVFA 4PCNA 1SMDA 1OC7A 4A3YA 3W1LA 3DBPA 3NVTA 4AXKA 1THFD 3RCMA 3WQ6A 2DEPA 5KINA 5GPRA 1AJ2A 4O10A 3WF0A 3IJIA 1Q7QA 2INZA 3NPWA 4QE1A 3W37A 3VNMA 1SR0A 4W86A 3FJ6A 2WNWA 1KCKA 1RUSA 2Y62A 1DWIM 2WC3A 1FDYA 4OJYA 3AHYA 3W4RA 3M9YA 1X6NA 2EJ1A 1Y5XA 1ZGDA 3BAIA 1M7JA 3QGVA 4GMEA 4PUNA 1ZENA 3AMCA 3RPDA 3BAKA 4NJGA 3GB6A 1DWHM 2UY2A 2YDRA 2ZUMA 4N4PA 4YTQA 2VZOA 2P8CA 5DT7A 1E51A 4ZB0A 4O4WA 2AOSA 4R3UA 1EA0A 3NM3A 3RUBL 3P14A 3T07A 1SJAA 3T2QA 3MI2A 4QLLA 4DJED 1YNYA 2QQ6A 2Y63A 2X16A 4LU0A 2ZX6A 1PS9A 3T0CA 3A24A 3KUMA 5AC4A 1EB3A 5A8QA 4PBEA 1FWDC 3S9IA 1AG1O 2GGIA 3H4WA 4Q4MA 3ZT6A 1V0NA 1JPHA 1ME8A 3VM7A 2I1OA 2V0TA 3AHZA 1E9ZB 3BWWA 5G4HC 1GK8A 3B4UA 4QISA 3IGHX 4BQ2A 4GI8A 1JNEA 3EWCA 3AYSA 2HZGA 4AWSA 2QGYA 2F6XA 3G6LA 1RPXA 3COTA 1Q3NA 3P7YA 1NEYA 3VOGA 2GZXA 3VTRA 4PTDA 3FJNA 4O8AA 4XB3A 4MWAC 3EKGA 4EK7A 3DHUA 6XIMA 5KSWA 4IISA 3A3XA 2PWDA 2XINA 3FSTA 1QW9A 4YCPA 1C8VA 2CFFA 1BKHA 5HQEA 3FGCB 3DC8A 4PRTA 3NPUA 1DXFA 4GOAA 1CXIA 4B4FA 3VD7A 3QOKA 5EMYA 2EO7A 5E9AA 3INPA 4FK9A 1H7OA 2X0YA 3WDJA 1RPKA 3VOHA 1TPVA 3FYPA 2NUWA 4JTEA 2D0HA 1HGWA 1LL7A 2VD9A 1OSEA 4ZSUA 4J7RA 3EPNA 4ZB5A 2PDCA 4HMNA 4KGJA 4PTWA 2VEPA 2ABAA 3L21A 4AC7C 1Z3NA 2C6QA 3K46A 1GQNA 5B7ZA 1S38A 1UUQA 4GI4A 4ZENA 3H4GA 2PLCA 4WK9A 4HD5A 3PBYA 1Q6LA 4CD4A 4X9SA 3GNRA 3POHA 5BZAA 3SUVA 3H6OA 3KTXA 1VRXA 4EPDC 2OZ3A 1R30A 3VKCA 4ZTYA 2EF9A 2JE8A 4IGSA 2GSHA 3GKAA 2GK1A 4FNTA 3CZJA 4NJJA 3HMCA 1MFVA 4LYPA 1GOWA 3OYZA 3UXLA 3WIJA 3R2GA 8XIMA 3R79A 1YTDA 3T08A 3XINA 5I06A 3B8SA 1VFLA 3QC3A 1IE7C 1K6AA 4MDOA 1QPRA 3F5KA 1LQ2A 3WF1A 2R8WA 3S1UA 1GPWA 2VOTA 5G4EA 1K8CA 1UWSA 4AD0A 5XINA 1MRQA 1O68A 5FA5A 4E38A 4HA0A 1L9WA 1EP3A 4NILA 3ZZ1A 3L4XA 3GXPA 3D46A 2R9RA 1SMAA 1TMQA 3ZWTA 4AH7A 5AYIA 4TXEA 1Z9AA 4B91A 1AD1A 4JQ2A 4C6MA 3T0BA 4CU6A 1YE6A 4KWWA 4UTFA 2RDWA 1XR2A 3LX9A 1NQ6A 1AZ2A 2MANA 1SZGA 3KVKA 3GNXA 7REQB 2EPHA 4GZEA 2JIEA 3UG3A 1ZBVA 1DL3A 2QPXA 1EGMA 3W83A 3HPSA 1LZOA 2OSXA 1GJPA 3LCXA 2X09A 3P5ZA 4LVGA 3RMEA 3C3UA 3SY5A 4NL1A 4HK7A 1E73M 1JG9A 4TV5A 3BUVA 2V2CA 1GUVA 1SVDA 4YCOA 4MB4A 2FTYA 2QCDA 2WQPA 4TX8A 8TIMA 3CASA 1KGXA 3HPZA 4K8EA 5HUOA 3LHZA 3H21A 2VO5A 3OHMB 4GFIA 2XGZA 3QQWA 3HPAA 4IIDA 2PDQA 2YL9A 3HTWA 4A2SA 3E3HA 2WJEA 3F03K 3E0VA 3HA1A 5C7HA 3S5YA 1W2VA 1EOKA 2ZZ4A 1RR2A 4IUOA 5EBUA 4R7WA 3VGDA 4H4IA 4UQAA 1NDZA 2DIEA 2PRLA 3VD5A 3QN3A 1KM6A 3F2BA 2WSYA 1FHDA 1R3RA 3IVTA 1YPXA 3DI0A 4HP5A 4RZ4A 4B5XA 2MUCA 1NWSA 4TV6A 2A79A 3S2LA 3R8RA 4IGHA 3VE7A 1BXCA 5HJYA 4JYEA 1I2PA 1VD6A 1XRTA 3L12A 1VBJA 2FVKA 1G69A 1F6KA 4P2VA 4WJ8A 3TXZA 1YLVA 1S2VA 4LB4A 1W3KA 3KRZA 5GQBA 5AC5A 2X0HA 5I3FA 3GTIA 5HR7A 4IPIA 4DBWA 1XYLA 3V5CA 1ALDA 1WZKA 3JW7A 1UUMA 4JXCA 4JYFA 2FFCA 1Z89A 1QW7A 2P1FA 3N2MA 3UZ5A 1J0HA 3NEHA 1O4UA 1JCLA 1MXGA 1BYBA 3E02A 2I16A 5DF0A 4JFWA 1HT6A 3CUIA 3S4TA 3TOYA 2VRQA 1PVNA 4Z0JA 3GUWA 1FDJA 3EMZA 1W31A 2VENA 4XUYA 1LRNA 1TJ1A 5ABFB 3HV8A 1OFQA 4HZ7A 4ZQOA 3CZLA 3GE7A 1UW9A 3ITYA 1LLZA 2H3BA 2OYKA 1B31A 3BGAA 1G7UA 5G1TA 1XICA 1XYFA 4R33A 1I9CB 4H6EA 3TZNA 1T6MA 3ENLA 1DHPA 3GVWA 3I3DA 2Z24A 4EWJA 1P0KA 2RGMA 4NJKA 1K6WA 1VS1A 3CB3A 2GPTA 1OX5A 3BZGA 5FF4A 5GJMA 3H2EA 4JY9A 1M7XA 4PSPA 2VFDA 3WDIA 3KZPA 1KFJA 5TQLA 4O0KA 3UP8A 2QMJA 2PDFA 2R94A 2XIBA 2XWDA 4DX3A 1DIDA 1SO5A 1MMFA 2RFGA 7TAAA 2REQA 3H26A 3C86A 1LJYA 2Y4SA 4XVEA 4X61A 4RR4A 3LS9A 2W9MA 1VR6A 2P0IA 1CB2A 4C1NB 1OGGA 2BGSA 1KXVA 2EPNA 4HTBA 1YXCA 2PDXA 2PWFA 5J5DA 1X1OA 5KZMA 4G56A 5C2CA 3WKZA 3UCQA 3T0TA 1PJ9A 3DFOA 4YTRA 1A5LC 1F2JA 5MF5A 3CV2A 5D8ZA 3WZ0E 4O0QA 4R85A 2CC0A 1FY6A 2CZFA 1A50A 1IIGA 4LY8A 4TR9A 1LDCA 1RQEA 1SFJA 1H60A 3AO0A 4LT9A 2D20A 3KS5A 3U8GA 1OHLA 1VFFA 2TYSA 4IG2B 2PLJA 2B81A 4WXYA 3M0LA 3C2FA 4JX6A 4HU8A 1XCFA 1V3HA 4JTUA 4UOJA 1R86A 1ISZA 4IPPA 1OFRA 4N4QA 4LEFA 3BH4A 3GY1A 3B8IA 4JTCA 5L6UA 3AMDA 3SW6A 3CPUA 3QMSA 5AYXA 2QIIA 1SGJA 1EWEA 4GI6A 2JF6A 2B7QA 4QCFA 4FSAA 4A3HA 3P5YA 5EMUA 3CUHA 3GR8A 2WOQA 3UR2A 3OLIA 4PB4A 4JN6A 3UA3A 4AD2A 1TX2A 1C8QA 2OWWA 1XWYA 3FY1A 4ASTA 2MNRA 3WQPA 2OWCA 1HL2A 2JFEX 1K02A 4LYQA 2FGLA 1MNSA 4Y9OA 2E6DA 2RDXA 1E70M 3SN4A 1Q4NX 4LS2A 3CPGA 3CUXA 5LA2A 5LIYX 1A5OC 4J2PA 3T0DA 5I09A 3CL7A 3DHFA 4RCXA 1HKMA 3WEOA 3IJ7A 4PCTA 1M65A 3BTNA 3W2NA 2DGAA 5A6BD 2DZXA 1E4NA 4ICNA 3TYCA 4H9TA 1VYPX 4MNLA 3UA4A 1MW0A 4NJHA 1S3TC 1Q45A 6A3HA 1PL9A 4V15A 1K4HA 3W22A 4IX2A 3ZO9A 4AHOA 1LL4A 5IDIA 2ZX9A 3RLGA 1K70A 4J3XA 2YBUA 3O0FA 2WCAA 3N73A 3GK0A 4I5RA 3PFRA 1QO5A 2X7WA 1ZAIA 3TROA 1WQ5A 4NU7A 4ZQNA 3QSRA 3A5VA 4V2XA 2HPMA 3EXRA 4KRZA 3TA9A 1V03A 2BASA 5FF2A 4AY1A 3PM6A 4JQAA 4JCLA 3QGAC 2Z1KA 1S39A 4ZBCA 2YYTA 3NQCA 3BCDA 3TC7A 4K2SA 2DIKA 3M0HA 1C29A 5DY2A 1JCJA 4R5EA 2VCAA 1EWDA 3JUGA 2ZA2A 3THDA 5A6SA 3RMJA 4XZBA 1F3WA 1G94A 5A6MA 1XI3A 2INEA 3UWWA 4FX6M 4ZO8A 3D6NA 2PA6A 3WLNA 4IL2A 3M0VA 4R53A 2OZTA 4FNSA 3USBA 3LI1A 2VRKA 4Q8QA 5DXXA 1TJ0A 2OWXA 5REQB 3PFMA 4A8RA 3LD5A 3MSYA 3CUJA 3ZM8A 3E1F1 3EOLA 4MNJA 3EWZA 4P5UA 3PBVA 2Z4GA 1IEQA 2VZVA 1V7YA 1PYFA 2VX6A 2WYSA 3SSJA 2OX1A 4UTTA 1J6PA 1J01A 1V0KA 1J9YA 4PL1A 3V3WA 3TJLA 2DORA 2QIWA 2HNEA 2Q8ZA 4ORMA 2D23A 1M6JA 3O15A 4BWLA 4EVZA 1OFOA 4JTDA 4LV9A 6REQB 1DORA 3FYYA 2QW5A 3WJZA 2R82A 1OB0A 4KEUA 3N9RA 1TCMA 3GS6A 3TW6A 1EJSC 2WHMA 1HJSA 1E6ZA 4GBUA 1JDAA 3NQ7A 4M5PA 4UTKA 2OGJA 2J4GA 4KEVA 3LTSA 1EZ2A 5CG0A 1E40A 5A1AA 4AD3A 1K03A 1OK6A 1SO6A 4P7QA 4F66A 4EANA 3KLLA 3JZEA 1P7TA 3QVQA 5C8BB 4HA4A 4O13A 3QMTA 4CNOA 2OXNA 4ICCX 3HJZA 3TJXA 3DDMA 3R12A 4IL0A 4US5A 1LBMA 3C5QA 3W1MA 1OF6A 3M5ZA 1NFGA 4MDPA 2ZX5A 3IV8A 3V5OA 1B90A 4F0RA 4A3QA 3W74A 1VIZA 2GJRA 4C6IA 4U10A 1C90A 4PUUA 3AALA 2E25A 3THQA 1OT1A 4PMNA 3TQPA 2D0GA 2TPSA 2ZFAA 3CU2A 4H8VA 4FOUA 4V28A 1LG2A 2E9MA 2HVOA 2WC7A 3AXMA 3WF2A 1W9PA 2G3JA 4JTKA 4NXSA 1JPMA 2AKMA 1FWTA 4IPJA 3VDBA 2BGNE 1C9WA 4GA8A 4JFSA 1F73A 4DYJA 3LENA 3ABXA 4PR4A 2QJHA 5DLCA 5HR6A 4IT1A 4KIEA 4MHBA 2R6OA 4MGGA 2IQTA 4GNJA 4DUXA 1Z69A 2E9LA 2ZKMX 2G41A 4IJBA 4R34A 3TNOA 2J77A 4W84A 1FCQA 1GYNA 2FJKA 3PWGA 3GXNA 4AZIA 3TYDA 3VUSA 3PTMA 1H7WA 1S2CA 4O14A 1OWQA 1E15A 3TTEA 2A1YA 4H7VA 5D2VA 1TTIA 1MQRA 3AJ7A 4Q7BA 2CBJA 2EEXA 1Y7VA 4HTYA 2QUNA 1VKFA 1V79A 1XLGA 3W23A 1GOXA 2C13A 2X0SA 4AMAA 4WJXA 4GG9A 4MYAA 3WUFA 4FPSA 3DBNA 2FYMA 3RM9A 2H8ZA 3N3MA 3PJTA 3WJYA 3UXAA 3QZ6A 3VO0A 3VD3A 5JIPA 2GJXB 2YIHA 3W9ZA 2ISWA 4GLEA 2WK2A 4FNRA 4S3BA 1TPWA 1KBBA 4NZ1A 4BY3A 2R1KA 3FDGA 1RLDA 1NIUA 9CGTA 4JL2A 4K8HA 2ZXBA 3E2SA 1X6UA 3NZ1A 3VGGA 4HJFA 3V75A 4ZO6A 2NUXA 4AZ7A 2Q3OA 2C16A 5D03A 2E6YA 4AZGA 2I57A 2YXGA 4OIFA 1LQ0A 1PHWA 1EQCA 3MCNA 2YKKA 1CI1A 3TR9A 2PCQA 2GLKA 5LXXA 4GGHA 4H6KA 1VBGA 4OE7A 4HMDA 2Y2WA 2V3FA 1Q4WA 1H5VA 3G3DA 1YIXA 3R89A 1K7FA 1ZPTA 4DBDA 4WDXA 3MO7A 1RQBA 5CLWA 2NQJA 3Q45A 3LBCA 2YDSA 3OBKA 1XD1A 1U2YA 4O1FA 1OCJA 1E0XA 1CXFA 4JICA 1C8XA 1PKLA 3DFHA 4Y7EA 4O15A 4QG9A 3RPTA 3IUDA 3V0UA 1XP3A 3D5HA 3WNLA 3AZRA 5IFPA 3BDKA 4WRHA 1JD9A 1HNYA 1QK2A 4B5UA 5HWJA 1HIZA 3IWPA 2E28A 3PR2A 1QOQA 3G8RA 5A2BA 1TV3A 2GL5A 3W1QA 1NF0A 2DQXA 4E2DA 3UG5A 1UIOA 1OIFA 1P1XA 3PWAA 4HKPA 3W7PA 4WQ6A 1H7RA 1AQ0A 3VUPA 4C6DA 2Y1HA 3GNOA 4K37A 1WDQA 3ZSSA 1CPUA 4YVPA 3SUSA 4DF1A 1DV7A 1Q7ZA 4W7VA 1BYAA 4YN5A 4QQUA 2J25A 2NV1A 1E9LA 1W91A 4D1IA 1W8SA 5CQ1A 3TE9A 4B5NA 1WP6A 1QUMA 2DSWA 3SCPA 3W7KA 4NZ5A 4C1KA 4RW3A 5E9XA 3LCGA 3GNPA 1ONXA 4GUIA 3BOFA 1QAPA 4UCFA 2YL6A 1HXJA 2PDJA 2WNZA 4RDWA 3VIMA 3O3RA 1XG4A 1XIEA 4IQJA 3F4NA 1YTEA 2CKRA 2ZC1A 4LUSA 2IKJA 4CLMA 1UWQA 2D2HA 1UQZA 2BXYA 4PN2A 4Q4QA 1B4EA 3RLUA 4IQDA 1KD0A 3OLEA 2HQAA 1JDEA 2DJXA 4ZE5A 4L4MA 2PP1A 2GDUA 2AL2B 2OZ0A 3W1RA 4L4OA 3ARSA 4RV3A 5CH9A 1GVQA 1IZCA 1IT8A 2ZRYA 4F8XA 3ZXWA 1TV8A 1XC4A 4R7JA 2QJIA 1E9IA 1AL8A 5D09A 4IFOA 4LUYA 1BTCA 4UFIA 4NG3A 5G1YA 3E12A 4FAMA 3ZFHA 3YPIA 1GEQA 1ZL1A 4DWSA 3W26A 3QH2A 1H2JA 3E0IA 4EXQA 3GFXA 1I0BA 3B9OA 3O1NA 1EBHA 4ADTA 4BK9A 4GJJA 3SJ3A 3WEZA 5CBIA 3PZTA 4X2RA 3N4EA 3VIOA 2QZRA 3FEQA 3BV4A 2L5HA 5CZJA 2CZDA 1CXKA 4NX0A 3W7OA 5DMYA 3AU6A 1IXQA 1TV7A 1LUCA 1JCYA 2VP8A 5E5CA 2R14A 5AC6A 3PG8A 2F7FA 4XX6A 1VRDA 3EEZA 3IIXA 2G96A 2JKPA 1FP8A 1WZMA 4H9VA 2Q09A 4JTQA 2HBVA 5FF3A 4J9JA 3FHAA 1M1BA 3CBWA 3RX2A 2F9RA 4RUBA 3UJFA 4DM2A 4EPKA 1TPUA 2QAFA 4AY7A 4XTIA 5KZDA 4AZCA 3HFYA 4IFRA 1B9BA 1EC7A 1X7IA 3MA8A 5AHMA 4HCDA 2WKLA 1UC4A 1CCWB 2CERA 2UWFA 4ZO9A 1LBLA 4ALDA 4QXIA 3CLWA 3IIPA 2O0TA 4A6GA 2UY4A 3TW9A 2HNHA 5HNRA 1GW9A 2EG6A 5FEZA 2OG9A 4XZNX 2PGEA 4CVUA 4N2YA 1T99A 3DUGA 1PZ0A 3MKVA 1Q2SA 4AIEA 5E93A 1ESWA 3TSBA 4RPPA 3MP3A 5F1VA 1GZ1A 3APYA 3KCOA 1RH9A 3MVTA 4S3CA 3E74A 2NWSA 4J3VA 1UC5A 1RBLA 2ZE0A 2VR4A 3TMQA 1B3XA 3AZSA 2Z0IA 3UXKA 3QFWA 3L2IA 2J7GA 1UASA 1FWHC 1EL3A 3QZEA 1BKSA 4PC8A 4DAIA 4B3ZA 1BQGA 3OOQA 3IUIA 2QMKA 4J3ZA 2PTWA 2RKXA 3E0LA 3WF4A 1NSJA 1BVWA 1GOOA 2EAWA 3PF3A 1PAMA 3LY0A 1QTWA 4WY0F 4Z2JA 4MJMA 3SCRA 3UJ2A 2C18A 3KM8A 5FAJA 3UY8A 4H2CA 4TX6A 3WQFA 1F6YA 3E49A 4GKLA 3AIUA 4ZQPA 1OX6A 3VGEA 2O4MA 3AMLA 4B5VA 1ZBKA 3PTQA 2QPUA 4L5ZA 1LL6A 2BVTA 2XIJA 2GQ8A 3UQNA 3EDJA 3E2RA 1X6LA 3A21A 3UGRA 4JTIA 2OOFA 2CWNA 5HMSA 2XJ7A 3N18A 1E1CB 4OFCA 3O0KA 2Q71A 3EDFA 3H7RA 2Q8XA 1WUFA 1EJ7L 4U3CA 3L2LA 4PH6A 5DXYA 1FWSA 2GVYA 1A5BA 1YBQA 4BS0A 3NQ2A 2ADAA 4ZFMA 3O8AA 1O12A 2FZNA 3KZSA 2C0AA 3NR0A 1C8YA 5BNKA 2XFWA 3FDKA 3S3GA 1WUEA 2QUTA 4WKFA 3V0SA 3G1XA 4WDWA 4ENLA 3HJEA 4O0ZA 4C60A 1XKJA 1ZAHA 4IP4A 4RNJA 3ZT7A 4M1BA 1E0TA 1W2PA 1KM5A 1SYTA 5CZKA 3MUZ1 3GVVA 5C2XA 3V16A 2DPEA 4J35A 2OKOA 2IPGA 3EDKA 4HPJA 2OO0A 4O17A 1Y65A 2NT0A 1J10A 1F3TA 3KDOA 3RG6A 3SCOA 3NQGA 4JEQA 4UTTC 3L67A 2P53A 3B0YA 5C5YA 5C70A 1HJUA 1ZJHA 2QCLA 5FIPA 3IRDA 4BWLC 5LNRA 3N13A 1TUXA 3BG9A 5HINA 2ZA1A 3WDQA 1EJVC 2CU0A 1W1TA 3PJXA 3B3DA 4LAKA 2Y5EA 2BWGA 1E4MM 3NG3A 2UBPC 4MKSA 3GTFA 3JRKA 1DBTA 2EG8A 3E2QA 1KV5A 5FJOA 2OEKA 1SU5A 2WJZA 2VMFA 2G5WA 2PDPA 3HGRA 4AW7A 2ZICA 4WJEA 5A94A 1F8IA 2A3LA 3AFBA 3ARQA 5K4XA 1ICPA 5MKGA 3F4VA 2DUZA 3EEGA 3EX4A 4KMQA 3A47A 3ZMRA 2FZ8A 4B9ZA 2D0FA 5JH1A 5CPOA 5BRQA 3QV8A 3GG8A 1V4YA 1XSIA 2C79A 2HEJA 1V8EA 3ZQ9A 1FCVA 5HNNA 2XSXA 3GDBA 1V7AA 4RZ6A 3WK0A 4L80A 4JR5A 2PODA 1KM4A 4G5DA 3DKLA 2J8FA 2E1DA 4MZ1A 1EX5A 5H8UA 3BK0A 1AJ0A 2Z1BA 5LHEA 3PJWA 2Q3RA 4PZVA 2V3DA 1ME9A 1V5XA 2BLEA 4OV9A 3MYOA 4GH1A 1IIHA 3CHFA 5AN7A 1GOQA 1H50A 3IVSA 4WSKA 5BXPA 5DMMA 4W87A 4B2DD 1QNQA 4GCAA 4WR3A 1MWOA 3L4UA 2Y7FA 1RD6A 2V9DA 2W66A 3P62A 4PL2A 1H0IA 1LOQA 3N04A 4LOCA 1ZS2A 4K36A 3II1A 3W24A 3R13A 1A4MA 2H3DA 2IQ0A 3UERA 4HHLA 4NY2A 4OOZA 5KZEA 1T0OA 2OQHA 3NSNA 4B3LA 3PHAA 4L4LA 3CZEA 1TMLA 2PRHA 3U4FA 1Q6GA 1YNPA 2G3IA 3CMFA 1JCTA 2CLHA 4KH2A 2DVXA 4DJDA 2D22A 1N7KA 3E96A 3I3BA 3UBPC 2O7QA 3TU9A 3T2OA 3VIKA 1H7NA 3M7WA 4JNYA 1Y5WA 1GEHA 6CGTA 1E3ZA 4PFMA 1GVSA 1TYGA 2YBVA 1UJPA 2POZA 3H22A 1W9UA 1I8JA 1FH8A 1BGGA 2VGGA 4W5ZA 2WANA 2V82A 2OVLA 3H23A 4B90A 5E0KA 2VCCA 3WEMA 2FGBA 3R1ZA 3TLLA 1J0JA 3BXWA 2GUUA 3GC5A 2Q01A 3KRBA 1UHVA 4IJCA 4TVCA 1UR4A 1QATA 4KFPA 3WD3A 2IPFA 4AISA 1NWRA 3EKZA 3H2AA 4UQDA 3OLDA 3MBFA 2BY3A 4B3KA 4PUEA 3HZ3A 3GH4A 4XISA 3S2JA 1IT0A 2VFHA 1TR9A 4M6VA 2BVYA 3TZFA 4CCCA 1KXQA 4ERAA 1W3IA 2QYGA 1WOBA 3OGVA 4BFAA 4FXJA 5FOOA 2PDYA 1IZKA 3IJDA 2HK0A 5JBDA 2I5QA 4DUOA 1P1MA 3RHGA 4H2HA 4HNLA 2QUUA 4N6EA 2A4AA 1KCZA 4M29A 1UBPC 1HF6A 1FRBA 1WPCA 3WBWA 1UZ4A 2I56A 1HKIA 5HUPA 1QJWA 2DFAA 4DI9A 3UJRA 4GVGA 3NPXA 1IEXA 3MUCA 4QS6A 1E56A 3DCPA 3M1ZA 3W25A 3UPWA 4JL1A 2E5CA 1A47A 3BW2A 1V6XA 1VBRA 1DJIA 4PULA 3CHCA 4A8LA 1UH2A 4XUGA 2H9AA 1OYAA 4AZBA 1V3IA 2WNNA 4L7ZA 3DENA 1AQFA 5JIWA 3BZJA 1KKOA 1GOMA 4WKHA 5EY5A 2ISVA 3CL6A 5ECVA 2A3BA 3SRFA 2OR2A 1XH0A 1D7FA 3ZYZA 3L4TA 1GQLA 4XKMA 1JZ4A 2QV5A 1R85A 1GKPA 3QY6A 2XFFA 5ABHA 3A9IA 1KRMA 3P84A 4ML4A 4WDTA 1YDYA 1FCUA 4ORIA 4JIRA 2I5GA 2QDHA 3ERPA 4ZXOA 3FNDA 3V7PA 2W3ZA 3K30A 1KM1A 4F48A 5CAHA 2BVDA 1NOWA 3OIHA 3MMDA 2OMAA 1I0DA 2WSPA 2BOGX 2HJPA 3MZ2A 4J1OA 4M56A 4U4MA 2C3ZA 3BSMA 4NAEA 1KFLA 3P61A 3H54A 1K9FA 3VDAA 3W7EA 2ZDRA 3S1GA 2XH2A 3H7VA 3VGFA 3S5ZA 2NQHA 1SJBA 3UR5A 2J47A 3Q67A 4D6IA 4Q3MA 3TNBA 2J7EA 3I7QA 2E4TA 3WLTA 3AIWA 5FEPA 3WDHA 4MJZA 1UWUA 3W6LA 3HBLA 2NVCA 4NZ3A 2FB3A 5EPDA 4NQ1A 3NO5A 1VCVA 4Z0SA 3UWQA 2V2DA 3SR7A 4H04A 4IXXA 3MTWA 1BVZA 2VURA 4C6LA 3B0VC 2VEGA 4AF0A 4ZMGA 1JJKA 3GLCA 3MSGA 2AMGA 4BQ4A 2V5JA 3M0ZA 2ZRWA 3M07A 3VIJA 4DWSC 2WMGA 2Z6IA 1KTCA 1UIPA 5LNUA 3W0KA 5FF0A 3OZYA 2O9OA 4UC5A 4G7EB 1J96A 1G4SA 4M7SA 1Q6CA 4IP5A 3LA4A 4LALA 3RU8X 5DEZA 4H7CA 3S5NA 2W63A 1DQXA 4LC6A 3GC4A 2X30A 4OGZA 1PDYA 1PSCA 4U31A 3QYSA 3BLKA 2WZIA 4YYFA 1VH7A 2YCKX 3FVDA 2AQOA 1MRAA 2P76A 5CAKA 4KPLA 4AEEA 2QCDB 3W1TA 3SM0A 1IEVA 4Q32A 3TV8A 3AISA 3NQVA 4OVXA 2X1UA 3REQA 3A4WA 4MWAE 3ZR6A 1BFNA 3NCOA 4CQAA 1PCWA 2RJHA 2Z1XA 4QDWA 3CTTA 4XO7A 1M03A 3TYBA 1B5TA 3GC2A 2QDDA 3TN3A 1KLZA 3GIYA 3LCFA 3OEXA 4GWEA 3MV11 1VLWA 1EEPA 4QG6A 3M0XA 1G4PA 1RSCA 4NRSA 3UCCA 3IRSA 1TWDA 5A8PA 3QRHA 3OP2A 2VR5A 3TKFA 3GR4A 1LCOA 2B7OA 1R0MA 2PDBA 2ODOA 3MHGA 4MB1A 3VKKA 4F40A 1F8MA 1JI1A 3AS2A 3C2EA 3ABOA 1WAWA 2VC6A 4GRSA 2YYUA 4L1GA