1PYMA

Phosphoenolpyruvate mutase from mollusk in with bound mg2-oxalate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
291
structure length
291
Chain Sequence
VKKTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRDSNEASWTQVVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNSLHDGRAQPLADIEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADAILMHSKKADPSDIEAFMKAWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASVSAIQQTTKQIYDDQSLVNVEDKIVSVKEIFRLQRDDELVQAEDKYLPKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Helix swapping between two alpha/beta barrels: crystal structure of phosphoenolpyruvate mutase with bound Mg(2+)-oxalate.
pubmed doi rcsb
source organism Mytilus edulis
molecule tags Phosphotransferase
molecule keywords PROTEIN (PHOSPHOENOLPYRUVATE MUTASE)
total genus 106
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 5.4.2.9: Phosphoenolpyruvate mutase.
pdb deposition date 1999-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 1pymA00
4B5WA 3P0XA 1GGOA 1A5UA 3GR4A 4FXFA 1PKLA 3FA4A 3SRDA 1DXEA 4JPGA 3EOLA 4G1NA 4IP7A 3B8IA 3EOOA 1JDEA 4LSBA 4B2DD 3E5BA 1A3XA 3QZ6A 2HWGA 1U5HA 1E0TA 2VGBA 1Z6KA 1M1BA 1S2VA 4TV6A 4IQDA 1VBGA 4DRSA 3G2GA 2X0SA 3HQOA 1IGWA 1ZJHA 1O5QA 4B5XA 4YNGA 3QLLA 3LYEA 1OY0A 3EOEA 4KCVA 4FXJA 3QV9A 3T05A 4L7ZA 2VWSA 4RPPA 1MUMA 2L5HA 4QG8A 3T07A 1ZLPA 3OYZA 1F61A 1PKYA 1S2UA 3E0VA 2XZ9A 4KCWA 4MF4A 1A3WA 4QG6A 3QTGA 4B5TA 2KX9A 2V5KA 1O66A 2HRWA 3GG8A 5JVLA 1M3UA 2VGGA 1VBHA 2QIWA 3KTXA 1PYMA 3H6OA 4B5VA 1F3WA 1PKNA 2BG5A 1DQUA 2VGIA 1F8MA 4HYWA 3R4IA 4TV5A 3EZ4A 1U5VA 1XG4A 4WJ8A 3VAVA 2HROA 2ZE3A 3ME3A 4MG4A 4YJ5A 3OQ8A 1KC7A 4L80A 3PP7A 1PKMA 2E28A 1UJQA 2XDFA 2G50A 2DIKA 3SRFA 1DIKA 2WQDA 4QGCA 5TAOA 3T0TA 1S2WA 2V5JA 3HQPA 3IS4A 1OQFA 1F8IA 3SRKA 4L9ZA 3BJTA 1IZCA 1T5AA 1AQFA 1XG3A 2R82A 1S2TA 1DXFA 3FA3A 3QV8A 3OYXA 3E0WA 3M0KA 3QV6A 4KCUA 4KS0A 3QV7A 3QQWA 3SRHA 1E0UA 4IQEA 4IMAA 2DUAA 3HQNA 2OLSA 1O68A 4L9YA 3KHDA 2VWTA 1A49A 1KBLA 2VGFA 4B2DA 3GQYA 3LG3A 3U2ZA 4B5SA 4QG9A 3M0JA 1F3XA 3N25A 3MA8A 2XZ7A 3PUGA 4B5UA 4KCTA 4ROQA 1SGJA 2HJPA 4HYVA 3I4EA 4KRZA 3BJFA
chains in the Genus database with same CATH superfamily
1QU4A 3WBEA 4AIUA 1AH3A 2XIIA 3DBNA 2VEMA 6TAAA 3H54A 5LIUX 3VC6A 4GZ7A 1PZ1A 5XIMA 4QE5A 1BYAA 3MSDA 4H04A 2EHHA 3KFTA 4K1GA 3S9YA 3FSUA 1TR9A 1TPB1 4HPXA 3WEZA 1AMYA 3AMDA 4GE8A 3C0SA 1H2JA 2DSWA 3TTQA 3QV9A 3GXFA 3FLUA 3LBMA 3DYPA 2WLZA 1NOFA 4FX8A 4ZQPA 5HXMA 3GTNA 2QDDA 1LQAA 1TJRA 4GYJA 3GDRA 1JYWA 3HFYA 5CPOA 3TWAA 2RUSA 1OC6A 4FIQA 1S1RA 4AY1A 1DBTA 2WZEA 1Q3NA 3CUXA 2BY1A 3QXBA 3HQPA 4A05A 3U3HA 1M5WA 1N2VA 1E0WA 4F48A 1UQZA 2VC7A 3IV8A 2GJXA 1B3VA 3G22A 2E40A 1T96A 3BAXA 1N7KA 2D23A 4GZEA 4FO4A 3AMGA 4CCEA 2VTFA 1YADA 3RCYA 4GXWA 4K3ZA 3UWWA 1AW5A 1DKWA 1FHLA 1TWWA 2WHJA 2QF8A 4P7NA 2P3ZA 3S5YA 1JYXA 4J3WA 3WNKA 3GX9A 2PU0A 1O5KA 3A3XA 4MB1A 4CLMA 1EP1A 2IKIA 1ONRA 2I9EA 3CXOA 3MPGA 1EUNA 1XC4A 2JGYA 4NZCA 4S3DA 3OLDA 2VGBA 3EWUA 4DB7A 3D0CA 1OG0A 5D05A 2FHBA 2X09A 2RHGA 2PSNA 1E40A 2RDXA 1IIHA 1FWBC 3BL3A 5FJUA 6ENLA 4OHQA 4UTUA 2A3EA 4GUHA 3M6DA 2FZ9A 2OZ0A 1UUQA 2PAJA 2NX1A 3IJQA 5G1TA 2BTMA 3ATYA 4JCMA 3LCFA 1IEVA 5A8QA 3CUHA 1EGVA 3THDA 4QJ4B 4A2RA 1PPIA 4ACYA 3U6WA 1U5JA 4N4PA 1XIEA 1XRSA 4FOKA 4K39A 1FH7A 1K9EA 2AMGA 5D4YA 3THCA 1SO5A 1SJBA 4U33A 3T08A 3G1RA 1RUSA 3NL6A 4CQCA 2OODA 3QQ0A 3W7HA 1V77A 3QPZA 2HBXA 1GVRA 3G3MA 3MV01 6ALDA 5EMKA 3W86A 4BEQA 4PC8A 5ECVA 4ASTA 3NPWA 1VIWA 4URIA 2VZUA 3URNA 1PHWA 1QW9A 3N4EA 3MU7A 2G41A 2CBIA 3THAA 3WQWA 1IEQA 5K2ZA 4GGBA 3EEZA 3BURA 1Q65A 3WMSA 1XRVA 4J3UA 5CSUA 1U83A 3LZ5A 3DESA 3UW6A 4J3SA 3QHNA 1PAMA 3VIJA 3AYVA 1DWAM 3IV3A 4WY0F 3GR8A 2BVDA 2XVKA 1H4PA 4Z2IA 4N42A 2Z6IA 4RNFA 4IICA 3OGSA 3CWNA 1DWHM 3M0XA 3OLEA 3NNTA 4YYCA 3QFEA 1TQJA 2O9PA 3W3OA 3TP4A 3ZR6A 1F07A 3M0LA 2Z29A 3A12A 4CCCA 4N02A 4NJJA 3RRXA 1VEMA 3S9ZA 4WXZA 1GVOA 3GNXA 4WKHA 4XD6A 3VOHA 5CC3A 3E2SA 3HG5A 2VP8A 4HA1A 5BWAA 3PTDA 3SCSA 1MUCA 2CNCA 2F6UA 3AICA 3L0GA 3HMCA 3A24A 2WVSA 1E6NA 3NO3A 2B0MA 1REQA 3S2MA 1DE6A 3KCLA 3WBYA 2OO0A 3GS6A 3BSHA 3PG9A 2J24A 2JE8A 3HO8A 1K4GA 1QRQA 2VOTA 4F0SA 2VCBA 3NQGA 9XIMA 4H9ZA 2QAPA 5BRPA 3B9NA 4LBSA 4UMAA 3UZZA 3C5QA 2V68A 5AFDA 2F8QA 3LS9A 2DSUA 2A3LA 2VUNA 3BLDA 3BQ5A 2J9YA 1WDRA 3A9BA 3MWAA 3OG2A 1PTDA 1MW0A 4H2HA 1UYQA 2BV9A 4NUWA 9XIAA 2V5CA 3GTIA 1YDNA 4PTVA 3AIQA 1QI2A 1V0NA 2XSBA 1F05A 4XIAA 1MWOA 1BPLB 1TPC1 1LWIA 2WHKA 1AD4A 1TVPA 4ZL1A 3WQFA 2XJ7A 3RNDA 3NQDA 1VBHA 3B0VC 1RLCL 3TYZA 3AO0A 3ZLHA 3PNZA 4MWAE 2WPBA 2I5QA 4ZA0A 1VHNA 3M5XA 3VOGA 4F0KA 5I00A 3R8HA 5CEWA 3VIOA 1TSIA 5JIWA 4M1RA 1HKMA 5TAOA 3H21A 2CLFA 4IPJA 3ZJKA 1YX1A 3T0AA 4E8CA 4YWSA 4HCDA 5E70A 1HKJA 3AROA 1KTNA 1L6YA 3DDMA 4K8HA 2OCZA 2PDQA 2JQXA 3MUIA 3EKLA 2VFGA 4V2XA 1CPUA 3LV6A 2WHMA 1PCKA 4ZO7A 4IFKB 3SCOA 1AQHA 2VDGA 4FIRA 5EBAA 1V0LA 4Y9PA 1PKLA 4BFAA 3CAKA 4LVFA 3ZO9A 4UFMA 3SM0A 3WN6A 3II1A 4JPGA 3TCSA 1KTBA 2ZRUA 1OFDA 4UFIA 3W2KA 2PCQA 1V6VA 4RZBA 1FA2A 1Q6QA 4RE0A 3L2IA 3U2CA 4ERGA 3G2GA 3E2VA 4Q7BA 1RA0A 1JD9A 2OSWA 3GY1A 3OZYA 1BTCA 4RZ4A 3AISA 3TJLA 2NUXA 5CZ0A 3RDKA 4LT9A 5D03A 1LQ0A 3UA4A 1DWFM 1R86A 3CV7A 3AXIA 2P76A 3VGEA 2BY3A 2DQWA 2VRJA 2VR4A 3UCDA 3R2GA 1TUXA 3EXSA 4LUYA 5U7SA 4RUBA 4C65A 4JTIA 4DEFA 3AZRA 1GPFA 3LCHA 1DXIA 2YIHA 1EP2A 3GVVA 1AUSL 4DBDA 1UWIA 1YPIA 2CFFA 1R3QA 2QCDA 4M6VA 2XIOA 3PBUA 1CLVA 1WUEA 3GK0A 1K7EA 2PF0A 3HV9A 1W3JA 3U2ZA 3G6LA 4PMXA 1JL8A 1CENA 3MA8A 3UJRA 1R47A 2C6QA 2WCGA 4DPQA 1KQZA 3L65A 1TPWA 5CSRA 5BXTA 3I7RA 2Q3RA 3NM3A 4DYJA 1V0MA 3S83A 2BVTA 3U9IA 3IANA 1I0DA 1TFVA 5AECA 1PBGA 2J7BA 5E5CA 3TSMA 1LORA 4AIBA 2Z0IA 3Q58A 3A4WA 4AD0A 3TLQA 2AKMA 4U10A 2A7RA 3GDKA 4FSAA 2PA6A 1KBKA 1JDFA 4DJFD 4JTGA 3IARA 3E9AA 3H2NA 1P0EA 3AUOA 2WNNA 3TR9A 5AZ1A 2D3NA 5IXEA 3TK7A 4ZXLA 5ABEA 5ENLA 5A8MA 3EPMA 3SFKA 1GOOA 1CGWA 3L4UA 3AYSA 3N2BA 3K8KA 3ARSA 3HGSA 2O7SA 4JYDA 1M03A 4GC3A 3TJIA 3VNZA 2V2HA 3ALGA 3POHA 1WXYA 1GVYA 3G77A 3QMTA 2AOSA 4QM1A 3T0TA 1RK5A 3R8RA 4GVGA 1Y65A 1LUCB 3E1F1 4P61A 2YFNA 1SR9A 1TRDA 1EYEA 4PZVA 1E0UA 3PB2A 4P8XA 2A3BA 1Q6CA 4E2VA 2PGEA 4OBTA 5E9AA 5HJLA 4DIAA 2JIEA 2ZVIA 3EB2A 1BTMA 3QSRA 3S5NA 2OFJA 3IEBA 1KCLA 5HINA 3EGJA 4G7FA 2UY4A 3NDOA 4EPKA 2DU2A 4JTRA 3W81A 1XPGA 5CGQA 1SW7A 3N2CA 3WQ6A 3MMUA 4ZB5A 3M7WA 1MRQA 3K4WA 1C8QA 4JX5A 2O9OA 5CGMA 2I17A 4AF0A 2CETA 3W26A 1OFQA 5H1WA 1F4AA 3UCQA 1GTHA 1LDCA 3CH9A 2WZMA 1YQ2A 1HTIA 4FLRA 3M0YA 3UG8A 2ZICA 3VGFA 1BXCA 2WSPA 3VCNA 2QNEA 5EBUA 4XVEA 4ZE4A 1NDVA 1UOKA 4IL2A 4EXAA 3SN1A 2QMJA 5EA9A 3BAIA 4KMQA 1SSGA 3AMCA 3SSZA 4EPEC 2GGIA 1VIZA 1VF8A 3NQFA 3HG2A 5A94A 2GVJA 2Q6ZA 4GX9A 3TN5A 5IFPA 3W2UA 2R1KA 4Z2LA 4AY7A 2ZRXA 1B2YA 2B31A 4K8GA 2P1FA 5C55A 4JHZA 1MW3A 2OT1A 3B0XA 3EWXA 4BQ5A 3CYJA 4PCPA 4OUIA 1TE6A 4I7WA 3SCRA 2DIJA 4YVXA 3STPA 2QCGA 2CZ5A 3RN6A 3IGSA 3O06A 3PZMA 3MKKA 3WJSA 3EA2A 3WL1A 4D6FA 2FFCA 4UR9A 4X63A 3SY5A 2BHZA 3TYCA 3BPWA 3P6LA 1ISYA 1G4TA 3UZ5A 4RR4A 2Y8KA 3MVIA 4O54A 1NP0A 3T0DA 3GG7A 4LV9A 4AEFA 3VUSA 4C6BA 2R94A 4I8YA 4ONVA 3RCMA 5A6SA 3ZVHA 4X2RA 3VILA 3W72A 2Q8ZA 4DZIA 4ZENA 4UC5A 2P0OA 4WSHA 3ANYA 3QN3A 2WNZA 4KWUA 1HKIA 1R3SA 1EJUC 3VKBA 4GUIA 3IVTA 4W89A 4XKYA 5DT7A 3M5YA 2BASA 1SZGA 1IXNA 4TX6A 4NP7A 4KETA 2ASHA 4MFDA 3V5CA 4JS3A 1OGBA 3SCTA 5AHMA 3LPOA 3HPAA 4IUOA 4RW5A 4LAMA 4ZOAA 4GABA 2DV0A 3W73A 4YTUA 3WG6A 4LS2A 4WK9A 2VD9A 3BJTA 2E8ZA 2J4GA 1NP2A 4DO7A 4Y9NA 1X6UA 1W1YA 3H12A 3W6MA 2QJHA 3SN4A 1LRQA 1P1XA 4H6EA 1O60A 2X7VA 4N6FA 2AAMA 4N2YA 5C9ZA 1QHPA 2XIQA 1DJIA 2ATMA 2QCEA 4UR8A 2J25A 4ZFCA 3WSUA 2PB1A 1A5UA 4L6HA 3W71A 4MDOA 1ISZA 3MYPA 1B0IA 1G69A 3BSMA 2VX6A 1Q6RA 3N6QA 1WOAA 4PRTA 4RDZA 1KV8A 3D3AA 2YSWA 3F1QA 4GZJA 1LCOA 4DVOA 1EHNA 4H6KA 5AHEA 1JPDX 3FGCB 4S2BA 2DZAA 3N29A 3PJXA 3CS2A 4W88A 3N4AA 5IFTA 4FZIA 4MKVA 2YLLA 2YXOA 4Q8WA 3CIVA 3L66A 1T8XA 1V03A 2OZ8A 1XIBA 4ACZA 3LMZA 3O6AA 1PKNA 1MUWA 4O4VA 1GUVA 2XH7A 4TV5A 3QMRA 4KQNA 2V69A 1OCNA 4YJ5A 1OX6A 5G2IA 3MP3A 5JBEA 3BCJA 3W00A 1C9WA 5D32A 4IMEA 1K1DA 4DAIA 3AMKA 2NVCA 2R82A 3UJSA 5I09A 4ICNA 2QF7A 4UQDA 5KZMA 2BODX 3VE7A 1GK8A 5D02A 1W37A 1XUUA 2QUUA 1D8WA 1KM3A 1V08A 2G97A 4UNKA 3SJ3A 1Y7VA 3NQMA 3P61A 1SGJA 1QPNA 2X1TA 4RE4A 4MB5A 4W84A 1ESWA 3KOWA 5EYWA 3ISIX 2JKPA 3SY8A 3EEGA 4ADUA 2WVVB 2CBJA 5E0FA 3GDBA 4ZB2A 1S3TC 3CASA 3BW2A 3QRHA 4GVHA 3EA1A 3PBYA 3CO4A 1C8XA 1TV2A 3PZIA 3A9IA 1AA1B 2ATSA 4HHHA 1V51A 1ZUAX 4YWIA 1OK4A 3KP1A 5U4NA 1RD6A 1RCOB 4H01A 3PPCA 1JGIA 1ENUA 2FIQA 4XIMA 3VGDA 3TC7A 1LUCA 2OG9A 5A3HA 5E9XA 1ZGDA 2VCAA 8RUCA 1IR1A 3G0SA 5JVLA 4KH2A 1F3WA 4V1YA 3SEPA 4HYWA 1IR2A 3L5LA 1B4KA 2FVLA 3WL0A 1G4EA 1KFKA 4I7UA 1TPH1 4K2SA 4NAFA 3V3WA 3AIRA 3U5UA 2A5HA 2WPGA 4WDUA 2R1LA 1OWQA 3DFSA 3QZAA 4LRSA 3CLWA 4U5KA 3H2FA 4YVPA 3G5EA 1S2TA 3LTSA 3VKKA 4S3BA 1VZWA 3ITLA 3RJYA 3LHUA 5F2MA 1TUFA 5HANA 1TJ2A 2NXGA 5FF3A 4QDWA 4M24A 4CQAA 2IW0A 3KOFA 2DVXA 1XS2A 1UROA 1J0IA 2J7DA 3D5HA 3OJGA 2XGZA 5HUPA 3UVIA 3ECQA 3MMTA 2WAGA 2PDCA 1CLKA 4XKMA 1ZJBA 4LBRA 2DDXA 3L4YA 4PEEA 7TIMA 3S1GA 1RY8A 3KDOA 3QMSA 2QZRA 2YBTA 1UD3A 1LLZA 1TIWA 3IUIA 2QULA 5MF5A 2IKJA 1ZB5A 3LLFA 1VJSA 2HS8A 5CC5A 3N1AA 5CZTA 3WF3A 4XUGA 3AALA 1Q6OA 4AZ7A 2I7GA 4IG2A 1IXOA 5KSWA 2QS8A 2WMHA 1WXJA 2DGAA 4FNRA 4Q22A 1FWEC 4A22A 5HR7A 2YCLA 4ML9A 3HIJA 2BXVA 3BMXA 4PMNA 4Q8OA 4IIHA 1VRDA 1QNVA 2HCVA 4GFIA 3TMLA 2AAAA 4O4WA 3WLJA 1JAKA 2R8WA 3ONCA 3CU2A 3PWAA 3YPIA 3LPFA 1JCMP 3NQEA 3P60A 4Z2HA 1W5QA 2PP1A 4PMYA 3RX2A 3GLCA 1ADOA 1WCGA 1RAKA 3CHEA 4B2DA 2Z1BA 4H9VA 1X96A 4US6A 2GJXB 1D8CA 1FY6A 4IGHA 4AZIA 3CB3A 1W1B1 1GNXA 4MJZA 4CD7A 3V7PA 4TMCA 2XVLA 2IPWA 4A6GA 3GYEA 4L1WA 3FNDA 4U3CA 3PBMA 1VFSA 1LROA 2QIIA 4NNBA 5EMYA 3CTTA 3M0VA 4GIEA 4EVZA 1EBHA 4F2UA 2NQJA 4Q8UA 1XH2A 2YGYA 2P50A 1OY0A 1OD0A 4HOXA 1UR9A 3CIXA 1QVBA 3W29A 4LUTA 3U7VA 4Q8PA 3CPUA 3AXMA 3VIGA 1TRIA 1PSCA 1V93A 1XYFA 4FA3A 1FWWA 4XBJA 4PMZA 4Y90A 3MUAA 3GBEA 1AD1A 4LY4A 3HJEA 2WQDA 5LXEA 5LA1A 3NEHA 1PVNA 2F2HA 3VPLA 3W7MA 1IE7C 3RG6A 1HP4A 3QY7A 3UG4A 2GZXA 2PD9A 1OYCA 3QQWA 4FEZA 2IPGA 3S9IA 3S3GA 1KCXA 5I03A 2BWGA 2WQPA 3BW3A 1CXIA 4CQ8A 3UJEA 4Z1AA 3IK4A 3ZFHA 3TONA 1HO1A 1E4MM 4KPLA 3NOYA 5H2ZA 4DX3A 5DT5A 4AZCB 2TODA 3GG1A 3URAA 3PAOA 4MUZA 4KWVA 5HJYA 4GIYA 1KO0A 3LOTA 3SECA 1LRNA 4QR6A 1CGUA 4E4UA 5HA7A 3RU8X 4RJEA 2NXHA 4I5RA 3GU1A 3JVAA 1OFOA 1F4HA 3NGJA 4GQ0A 4DJED 4TIMA 3RRAA 3CUZA 2DZXA 3CIWA 3FA5A 1SZFA 2H8XA 2RH9A 3WDQA 4ZVJA 4B16A 2V5KA 2ZZ2A 1NQ6A 3TTSA 3HM7A 2WKJA 1Q4WA 4UQ9A 2J7GA 2Q8XA 2BNJA 2V8ZA 4O10A 2DJXA 4UQBA 1TPVA 3H23A 4A3HA 1XX1A 1HG3A 1GQLA 2J7FA 1J0JA 4O1EA 3NZGA 1H51A 1OX4A 1VHCA 1IZCA 5JIPA 5EMUA 1Q6FA 5T8GA 3S46A 2W91A 3A21A 3LERA 1J0ZA 3MUCA 1D2KA 3Q45A 1LZOA 4HZ6A 3UR8A 3BDKA 2J13A 3W38A 3UF9A 4DLMA 2J6VA 1V7YA 1RVGA 1RJQA 1P4CA 2ZWYA 3EKZA 2PDHA 3A6OA 1ONWA 4I8DA 1DQWA 1FTXA 3BUVA 6TIMA 3OIHA 1JNDA 2PWFA 2NUWA 2VFIA 3V35A 2GQ8A 4H6RA 3BOFA 4PUNA 3QR3A 3O6DA 1R9XA 2OEMA 2OEKA 1I1XA 4WOQA 4NAEA 2ZXAA 3C2FA 4E8DA 2O0TA 1H09A 3SQSA 2GSEA 1R87A 2VZOA 2NZLA 5JXQA 1FWJC 3PR2A 3T4WA 2EXOA 3VX1A 3P5ZA 1B30A 2OU4A 1JCLA 4CNTA 2R91A 3I7SA 3V16A 2QW5A 1TWSA 1TIMA 3VIIA 4JCLA 3CZKA 4KWOA 1I2OA 3PZVA 1FCQA 5CBJA 1GHSA 4JTAA 1KM0A 5A6JA 4CD6A 2C3ZA 1TMHA 3PJUA 7ENLA 1FOBA 3WK2A 4I90A 1F73A 1WX0A 1LT8A 4ZCWA 3W1QA 4OUEA 2OPJA 4X3ZA 1SYTA 3UXAA 1RD5A 3HF3A 5LKYA 4GI6A 3NUKA 1HO4A 2RFGA 2GQ3A 5TNVA 4Q3MA 3QHMA 5EMLA 4O1BA 4IH3A 3WMBA 4H7ZA 2YB1A 4O50A 2YZ5A 4UZUA 1FWCC 3NPUA 3IJ6A 4G1KA 3OBEA 1EA0A 1IWBA 3CTLA 5EU9A 4GBDA 4P5UA 1EJRC 4MAZA 1KWKA 4RDYA 3LK6A 2I16A 2DJLA 3OA5A 5AHLA 1E56A 2INEA 1VEOA 4YL2A 3M16A 5BXSA 4JIHA 1KD0A 4MDPA 2ZA1A 3N13A 3R58A 4KERA 4QE1A 1XDMA 3PBGA 5FA5A 2F7FA 5JBFA 4JFTA 1IWAA 3TJXA 4AVOA 4W93A 1CW2A 4H9MA 1FH9A 1C3FA 4A3QA 1XFCA 1ZLPA 1D3CA 3KX6A 4US5A 1R8LA 1ZJAA 4I9AA 2VX4A 4MWAD 4DLFA 4J3ZA 1BYDA 2OEJA 2FJKA 1XINA 4MJMA 4CNUA 3M0HA 4D6EA 4U4MA 2DSKA 2YDAA 1Y8BA 2XINA 3B8DA 4ORIA 4DUOA 3V5OA 3BXWA 2VQUA 3SRFA 2NVDA 1S2WA 4A35A 4ZOBA 4Z1YA 5HBFA 1O95A 3LN3A 1C90A 4GY7A 5EY5A 2E1DA 3EDKA 4LV4A 1JPHA 1AMKA 1DORA 2PDNA 1EF2A 4NG3A 3ITCA 2CZFA 3W84A 1UUMA 3LEPA 2WV8A 4JTHA 3UPWA 4OFCA 4JZ5A 2Z4GA 3DFPA 1CXEA 4PTWA 4PUJA 1QW7A 3DX5A 1J5SA 2P8CA 4C6EA 3F4VA 3WF4A 3AS0A 4D2JA 2Z2AA 1H1YA 1ODZA 3AU2A 3JRKA 4NSBA 1NJJA 3BV4A 2YYUA 3SCQA 1XKJA 3DHFA 3S5ZA 4BS0A 3FAXA 2WXDM 3K2GA 5FESA 2J79A 4NRRA 1POJA 3S5SA 3BZJA 2QPXA 4NZ5A 2QCFA 3L0KA 5C7VA 3TYDA 1K77A 3U0HA 3SCPA 1UKOA 2VDHA 2CXEA 1ITXA 1V6XA 1PYMA 2IMRA 1RY0A 3BV7A 2NLYA 3ARWA 4CNPA 3NG3A 3W1UA 2D3LA 2YA2A 1TWDA 2WOQA 2XDFA 4RXGA 4QGCA 1EWDA 2VVSA 5BNKA 1Y5XA 3S6DA 2VOMA 3SAZA 3SRKA 3RX4A 2Z1VA 2NQZA 1XIIA 2W62A 4XQ6A 3ZLFA 4HOWA 2FVKA 4FOUA 3HQNA 4DYEA 4Z1BA 3MWCA 5HNNA 3KHDA 1XIJA 2D0GA 2TPSA 1YBQB 1J10A 1VR6A 4UQEA 3PZQA 2F2KA 4GI4A 3T4CA 3R10A 5DEZA 3CL6A 3LPPA 1PIGA 4LAOA 2C71A 3DAQA 2H6RA 2XGIA 2D1ZA 1E4LA 4QS6A 2OQLA 5LNUA 4MFEA 3H22A 1QASA 1ME7A 2D2JA 3DGRA 4FNSA 3IGXA 1NARA 4MJ4A 3VUPA 2J9XA 4MHBA 1CB2A 2A79A 2ZUVA 4JFSA 4IFRA 3G6MA 2POTA 5GPRA 1VPYA 3DH7A 2Y0FA 3C61A 4QFUA 3LXBA 3UWZA 1E1CB 1AJ0A 4OWGA 3ZJ6A 1OX4B 2EPLX 4AF0B 3DENA 3OA3A 3LENA 1O66A 2HRWA 1GKRA 5D8ZA 3GDTA 2C79A 2QIWA 3E0IA 3QBUA 4PMUA 5AVHA 3W2JA 2PEVA 3VDBA 4R7WA 2VEIA 4O0QA 4JHMA 3AHVA 4GI9A 1OGGA 4WJ8A 1EGZA 2YW3A 1ZCCA 1YTDA 3TW9A 1CGYA 2ZC8A 3FGCA 3L23A 5J5DA 5EFDA 4REQA 4LRTA 1T5AA 3TC6A 3V18A 4Z1DA 4Y9OA 3VD5A 2YX0A 1JZ8A 1GTEA 3WBAA 3F5KA 2XM1A 3ITGA 2QCHA 3CQIA 3FDGA 1VYPX 2QJMA 4B5SA 1XBXA 2FB2A 3GAYA 3EDFA 3B8UA 2B4GA 3KP0A 2XZ7A 5CC6A 3QC3A 4XV0A 5JU6A 1UD6A 2ACUA 3APGA 2G96A 3A4AA 1QPQA 4RE3A 3PBWA 3SGUA 4MWAA 5A1AA 1UPMB 3W01A 4JTQA 3BO9A 4LB3A 1XH1A 1UWQA 1UHVA 2J88A 2YL6A 1GOWA 2PFHA 5D2VA 4XAYA 1XXXA 4PMDA 4C6CA 1IGWA 2OLHA 3IPWA 1R7OA 1RV8A 3W2LA 1A5CA 1XIHA 1XRTA 4JTEA 4GLEA 1UUOA 4ZQOA 3GKAA 1OSEA 4B5TA 4M81A 5AC7A 1ICPA 1J8VA 4PMJA 1TVLA 2TSYA 4W5UA 2R9RA 2Z1WA 2VGIA 3W7OA 3DC0A 3VU2A 4XAPA 5I3KA 1JPMA 4K8EA 4XKYB 4FLOA 3W82A 3D3FA 3VXGA 3DG6A 2IPFA 2IPJA 3T44A 4HP5A 3S2CA 1UBSA 1XG3A 4XAFA 3TR2A 3E2RA 3ZSSA 4UNIA 4C6MA 5JMUA 3PANA 4G8TA 1UP0A 1DIDA 3WY1A 1UKTA 4A2SA 2JF6A 3P74A 3PK7A 3WBWA 4IUGA 3PZGA 4PCNA 2BHUA 3H4WA 4R34A 3STFA 3ANVA 2GJPA 4WDXA 1KR0A 2Z28A 1MVYA 1WQ5A 4JDYA 3VCCA 2PTWA 3MP4A 3WUGA 4DXXA 2TYSA 1IXQA 4GYFA 1HIZA 1PEZA 4D1JA 1EZWA 4DM1A 1EL3A 1OADA 5T9BG 4HCLA 2OX4A 4E3TA 3V0TA 3RYSA 1V3JA 1GZJA 1UP3A 4YIWA 2JF7A 2Y6ZA 3V75A 1TVNA 2QYGA 1G7UA 3QW4B 2QVHA 2EAWA 1ZTVA 2C0AA 4YTTA 3FYYA 2X1RA 1E6PA 2FPVA 4B5VA 2UY5A 2BG5A 3S4TA 3ZT7A 4LEFA 2OGJA 1XR2A 2BMBA 3KLKA 3ZVIA 3EX2A 4RXFA 1UC5A 1K9TA 1IT7A 5DELA 3GU9A 4XZMX 3DYOA 3VKCA 1DOSA 1QBAA 3F2DA 1QNSA 4NAEB 5REQB 4HA0A 5F1UA 5MKGB 3KBVA 3UXDA 1XDJA 3N2OA 2DZTA 4O19A 4M1BA 1XHGA 3QYQA 3GVQA 2CEQA 3K4AA 4EE9A 2E67A 3WDPP 1B1YA 1LRTA 3T9PA 3LHTA 2GQ9A 3WLIA 4N9CA 4PBFA 1GQKA 5LGXA 4PSRA 1JD7A 2G3NA 1JI1A 4MYXA 3SGZA 1QR7A 2INFA 1A3XA 2PS2A 1U5HA 4JTJA 2VFDA 1OC7A 4BQ2A 4Y8EA 1PWMA 1QNPA 2HEJA 3KHJA 3LRKA 4S39A 4JN7A 4L4LA 3O15A 1BVNP 4YNGA 3W1MA 3WLLA 5AHNA 1K03A 4IQJA 2VWSA 3L4WA 2O56A 1G01A 5FF7A 1P6BA 3WCZA 4XZWA 2C1IA 1E9LA 1PZ2A 3MP5A 1SFSA 2YJQA 2A3HA 2PRLA 1ICQA 1I75A 4XAGA 1J11A 3N2XA 3IUHA 1QPKA 3MUXA 4K7YA 1W3NA 2V5LA 3WD0A 4EKJA 1F6KA 4UTFA 1P0KA 1UB3A 1W3IA 3DHUA 3BG9A 1QPOA 1P7TB 1WXZA 5CKSA 3BLIA 1FCBA 2VD8A 1Q6EA 4IIFA 3SBFA 3TQVA 2YXGA 1OFRA 4Y6GA 1S38A 2DPEA 4F66A 2B81A 2WMJA 3G1AA 2DT3A 3LGDA 2G95A 4RNHA 3VGGA 4POCA 3S47A 5BOEA 5CPNA 5I24A 2V63A 3UXLA 1S2AA 2JKAA 4GIAA 4ZB0A 4N7QA 5C9RA 4MY9A 2WVTA 3THUA 1T40A 3R0UA 2GPTA 3WLQA 2AGKA 5K4XA 1SU5A 3B3DA 1H62A 1EGMA 3ZVHB 4AFYA 3B97A 2QDHA 3RAOA 5D8WA 5FF4A 1EB3A 4HZ8A 1ISWA 1SJDA 2CBUA 4HKPA 1MDRA 3NIYA 4ZQNA 1HUVA 3GWQA 3MYOA 4DN1A 3VNIA 2XPKA 1ELSA 1SW0A 1BYBA 3MANA 5K4ZA 1BWVA 4S3GA 3LNPA 3KZPA 1TMQA 3W7LA 3JS3A 3UPBA 1XCWA 3IIXA 3SFWA 2ZADA 2GL5A 4Z0SA 4MGGA 1RQHA 3MHUA 3W7NA 1CX9A 4HNOA 4CNNA 1D3GA 2X0YA 3FHAA 4R33A 2Q01A 1QW8A 2ZX9A 9RUBA 3VYLA 3VD9A 3K5XA 2V3FA 2J77A 3UR2A 2NQHA 3TN3A 5D9OA 1XLKA 2V81A 6PTDA 4GH3A 3LD5A 3TTOA 3Q2DA 3DBPA 4M29A 3UJFA 1FRBA 2FGBA 1YE6A 3NQAA 4GY0A 1A5SA 4MWAC 1P43A 4CNOA 1E70M 4M0XA 4R7OA 5DANA 2AQVA 2XN0A 1MEWA 4BZYA 1FBAA 2VZTA 3B9EA 4YTSA 2Z24A 4C6LA 3DECA 3PZUA 4PMOA 5CPSA 2DZVA 5J04A 3CV1A 4F2TA 2F38A 4O8RA 5DBTA 5B7YA 5KITA 5H91A 5EL1A 1XLLA 2ZBTA 5AC4A 3MHFA 5HNRA 4D71A 2YBVA 3ENLA 1VYRA 3RFAA 4QAIA 1ZCOA 1R3WA 3LXAA 3AHZA 1IZJA 4GG9A 5JBDA 3AIEA 1W9PA 5BOFA 1UWTA 5E6ZA 3WELA 3IAPA 2CERA 2FMNA 4GO9A 1R9ZA 5E0KA 2O9TA 2VHLA 1UD4A 2PE4A 4H41A 3VE9A 1DIEA 2GJLA 2DH2A 4AH7A 3I6EA 2V6AA 1MO0A 2OR2A 4ZSTA 4B9YA 4DWDA 4X60A 3C0QA 3AIUA 1EZ2A 3WK1A 1WDDA 2V67A 3C2RA 3QOMA 3W7KA 1CNVA 1H1ZA 2I9UA 1TJ0A 4MZ1A 3WLHA 1UR8A 3TYAA 3WBXA 3WUBA 3AU6A 1C7TA 1DPMA 3ARUA 3CAQA 1J18A 3UBPC 4HJFA 3O0KA 5A95A 4GYPA 5GNZA 2QUNA 3T2QA 1JXKA 3UFYA 3VDCA 1TPDA 3U7BA 2VX5A 3PFRA 1GGOA 3UERA 2WVVA 3N9KA 1IT0A 5CLTA 4H1ZA 2QDGA 3VZYA 3B8IA 4E5TA 1XC6A 1GYMA 4JKMA 3XIMA 1AFSA 2R14A 3WFZA 4QEHA 3LQGA 4IQDA 1S5VA 3P8IA 3ZT5A 1MI3A 2P3EA 1YXYA 3B0UX 3L67A 3S6OA 1ZJHA 1O5QA 2D2GA 3C2OA 2D0HA 3CZGA 1CCWB 4FXJA 1E6SM 4PN2A 1U1UA 4JNYA 1XPYA 2CWNA 1L2UA 2PTYA 4QP0A 2I57A 3TVAA 4NXKA 3CWHA 3WH7A 2WHLA 1YW1A 1KKOA 3KWXA 4GBUA 5FL1A 1SO6A 1WBJA 5LNRA 4NY2A 2FH6A 3PHAA 4MWAB 1I2RA 5D2WA 2Y70A 1S5WA 4XG1A 4NJHA 3NZRA 1LG1A 1MXGA 1XWYA 5BWFA 4OTKA 4WHBA 1SJCA 4L9ZA 1P6CA 1LF1A 2WSYA 1QCWA 4IMDA 3N15A 1A5BA 2WWDA 4O57A 3OLIA 2VVNA 1O5XA 5C6MA 2EPMX 1VCVA 2YYTA 3HG4A 3S2LA 3P0XA 4HB7A 4FLSA 4IXHA 5A8OA 3I68A 4CGTA 3GR4A 4LUSB 4G5DA 5C9WA 4PTNA 2C8NA 2IQTA 3LY0A 4DJEC 3N18A 4AWTA 1JDEA 3KAOA 3AHXA 3PZTA 3QY6A 1Z6KA 4IQLA 2ISDA 3QKZA 1H5YA 2ZYFA 4M6PA 4D8LA 2NX3A 5F4XA 4WRHA 5M1TA 4AW7A 1LG2A 4JNMA 2PDWA 2GUUA 3W1XA 2WJFA 1QDSA 2YCLB 3H6OA 3CUIA 3GH5A 3W22A 4A3YA 5E93A 2D20A 2OWCA 4P8UA 4NASA 3PPGA 4C90A 2WKLA 4ZQRA 1VB9A 4GISA 1D7FA 1FHVA 4PGLA 2WSQA 3UYIA 1W1TA 1BXNA 3TDFA 1Q5MA 4WUIA 4HN4A 2J7CA 3GXPA 1RCXB 4WY0B 1J2WA 1JYVA 4C6QA 1KBLA 4F40A 2YOCA 4UBPC 4F2BA 3N25A 1T8QA 3LLDA 1M04A 3MJYA 1IV8A 3OO2A 3QZEA 3BLOA 1HVQA 5BCAA 3A64A 3ZWSA 3UZWA 4R53A 4FS9A 4ZE5A 1NEYA 3LDVA 4EWJA 1WA3A 4JN8A 3EOLA 1AL7A 1KM2A 3E5BA 2ZA3A 4Q4KA 4ZTYA 3F2CA 3AXKA 3B9AA 1MFUA 1JG9A 3KW3A 1C8YA 1IEIA 3OQEA 1J6OA 3W7EA 1JPIA 3RLHA 4PUEA 2WM0A 8CGTA 1MUMA 2GSJA 4L4PA 5FSDC 4Q8QA 3B03A 2Y7DA 4JTDA 3E5PA 1FWGC 5LA0A 2PCEA 4O14A 1CEOA 3HG3A 4HTYA 5I78A 1CXFA 3PWGA 3NTYA 5AC8A 3IUDA 2DSZA 3I6TA 4KEUA 1G5AA 3W6YA 1YMYA 3QOKA 1GG1A 5FJTA 4JAWA 4IGMA 3BOLA 5F2IA 1T7LA 2JBMA 2E68A 1OFAA 1MNSA 3OVPA 1DYSA 1EJWC 4M82A 3WD4A 1EO7A 2OB3A 2KAUC 2CZEA 4HYRA 2VI0A 4DPPA 2EGZA 4UIOA 4BWLA 3MHGA 1SVDA 4IPLA 1G4PA 4WIWA 4R5EA 3K46A 1BG4A 5E0CA 4HK5A 3GIYA 2PGFA 4TR9A 4A8LA 1XL9A 1REQB 5C9XA 5C2CA 4KRZA 2XHYA 4HNUA 1F7BA 4AQLA 4REQB 4WDWA 3BJFA 4O52A 2JEQA 3IRSA 1CLXA 4XTDA 1TV4A 1JUEA 1GT8A 1WOBA 4V33A 3CZLA 3M0ZA 1EH9A 3QLDA 4IM4A 2Z1SA 1A0EA 4HMEA 1O4UA 2PU1A 1XCXA 1RJPA 5ECUA 4LUJA 1RPKA 1KQYA 1ONEA 2E77A 2HXTA 3N73A 4UTTA 1ZQ5A 2XSAA 1NTHA 4UMBA 4MNKA 5DRCA 1E1EA 2J75A 4UTKA 1KXQA 5G2WA 1L9WA 3UEQA 3XISA 4TTUA 2EG8A 4CUCA 3HURA 3MSRA 4K1WA 3C3NA 1CGXA 2YKKA 2C0HA 3H53A 4EF8A 3TX9A 3OODA 2WNWA 1EOMA 1BVZA 4QAWA 1ZFJA 3WDRA 3APYA 2PLKA 5FIPA 3GFYA 2PDKA 1X38A 4PTXA 3RO8A 2NV1A 3IK2A 2DSVA 4FMVA 4Q8MA 4KS0A 4M8UA 1LM1A 2H9AA 2NQ5A 3U57A 3VTRA 2J8TA 2VMFA 5HJXA 3S2NA 4A4AA 5LXXA 4C6NA 2F9RA 1PV8A 4JQAA 3N2TA 1XLEA 2VEGA 2FGZA 2J27A 3WD1A 3ES8A 1DHPA 4H6QA 4F8XA 2QQ6A 2EQDA 4TVDA 4AZGA 3T2OA 4IIEA 1YNPA 5M17A 4F3HA 1S3HA 1EDQA 3AYRA 5DCBA 3UWVA 1A0DA 1F6YA 1FWHC 4KFNA 3CGTA 1QXLA 1X1NA 1VBGA 1AW2A 3H55A 4J7RA 2PGWA 3SDOA 4BQ4A 1JQVA 4M5PA 1EDTA 1H5VA 2OT0A 3OHMB 4GUGA 3LCXA 4CNSA 3H2CA 1MZHA 1FFRA 1S5MA 2CLLA 4US5D 1JGMA 1XLJA 1XLCA 1A3HA 3WQGA 4S3CA 3W85A 3B06A 3DXIA 3AFBA 4CN4A 1YRRA 1U22A 3AMLA 2C1GA 3UR7A 1S46A 4JICA 4CD5A 2D22A 3GIQA 3BAKA 3OQ8A 1E71M 2ZX7A 3C0JA 4UZSA 3F4DA 2CW6A 4LW7A 4H8HA 4GMEA 1Q6GA 2G3FA 3WZ0E 2G0WA 2D24A 5DMLA 2ZUMA 3QV8A 3TMQA 1AJ2A 1RHCA 4AZ5A 3R89A 1RBOB 2E6FA 4AZHA 5A8GA 4AMCA 1KM6A 1OD8A 2BXYA 4CQDA 1E4IA 2V3DA 1TREA 1J93A 3DG7A 2OO6A 4KW2A 2XG9A 3FS2A 3H7RA 4GQRA 4IX2A 1C8VA 1S39A 2AL2A 4NAFB 5MKGA 3G1YA 2MNRA 3W75A 3ALFA 5ABFA 5EB8A 2YPIA 5D2YA 1GQIA 2DT0A 1ODUA 1BD0A 2A4AA 3P5YA 1EJTC 5F4SA 3WENA 3VM7A 2Y8VA 3R94A 3L5AA 4B9ZA 1YDYA 4EPDC 3PULA 2H3BA 4Z2JA 1SFTA 1XYAA 2E09A 4QQUA 1BYCA 5CAKA 4Z17A 2ACSA 1K3UA 2JFEX 3RCNA 2C13A 2MUCA 3HN3A 1J96A 1TKKA 4FAMA 1UZ4A 4EK7A 4UCGA 2CWXA 3V0SA 3DUGA 2WK2A 3NEVA 3TXVA 3GM8A 4HNNA 4IX0A 3V1HA 1KFJA 4DUWA 1A80A 3UWUA 3SUUA 1OJXA 3WLNA 1AQFA 3IACA 2E1WA 4NQ1A 5HMFA 4AYSA 3FEMA 1E0XA 5DRIA 1OC5A 2W6RA 1GVSA 3EDEA 4MADA 4M3PA 1UR0A 4DJFC 3PUGA 2ANUA 1OF6A 2F6KA 1C92A 1I1WA 2J9ZA 2AL2B 1E1FA 1UC4A 3EBVA 4DXKA 4WSKA 5TIMA 3VNMA 4KRTA 5I3HA 3PZ9A 2W63A 3P67A 3BLEA 1NH6A 3EOOA 4O16A 5AB3A 3WLRA 5LNVA 4E6MA 2BFGA 4MM1A 2Z26A 1XV8A 2G8ZA 4JKLA 2NT0A 1BQGA 3W7JA 1ZAIA 4L7ZA 5CPLA 2VRQA 4C7GA 3W7GA 4LGXA 1I2PA 1JUBA 4M7SA 1KBIA 4AD4A 2XVNA 3BK0A 3AHTA 2NSXA 3AYTA 1BFNA 1J0YA 6A3HA 1MDLA 5AYIA 3CB8A 3RUBL 1OABA 1QOPA 4O17A 1ADDA 1OB0A 3UXIA 2GQAA 3EXTA 3EXRA 4GCXA 4HOZA 4JTLA 4QJ3B 4LYKA 3EOSA 2C7FA 1EXBA 5FEWA 1WZMA 7CGTA 3O2LA 2Y7GA 4J5NA 3PC0A 1XH0A 3NJ3A 1EIBA 3LLXA 2ZCGA 4G2DA 5DCDA 4R9OA 1VFOA 3A47A 3TA9A 1A49A 4D72A 1ZBVA 3T09A 3LGEA 4DBWA 5REQA 5BW6A 2O4QA 4KCTA 3GVGA 2DORA 4E38A 1I9CB 2Z2UA 5AKQA 3P0WA 3VDAA 5KEZA 5A5WA 4C6IA 2NT1A 2IKHA 1SFJA 2VNCA 5GJMA 3MUY1 3SUWA 4AHOA 1ITUA 1UD8A 1DXEA 1UR3M 3VIPA 2NLIA 3GTXA 3S42A 3GXTA 2QR6A 1XYBA 2XH2A 1AVAA 1KV5A 2OOFA 2GYIA 3SSJA 4BF9A 5BZAA 1RVKA 2ZRVA 3QLLA 2RGMA 2NV9A 4XD4A 5GNXA 1LL6A 3RMJA 4F79A 3T55A 3WD3A 4W8AA 1DE5A 3NDYA 3VKAA 4AY8A 4I7VA 4NJGA 1RR2A 1XP3A 2W9MA 1UJPA 2XN2A 4TVUA 3H7VA 4L6DA 1DQUA 4D6JA 4DI9A 1JQXA 2EKCA 2HROA 3JW7A 1DL3A 1J0HA 4GC4A 3N2MA 3U4AA 1CTNA 2BBFA 3EWYA 2P5NA 5FJPA 5HQLA 5D2XA 4QDMA 1OQFA 3IJIA 3M44A 2PC4A 1VC4A 5DBUA 4PUWA 2E9MA 4ADTA 2OZ3A 1EIXA 3TAKA 4DO6A 3WH6A 3KRSA 2WWCA 2ESCA 1J79A 1JJKA 4NVTA 2ZRWA 2J7HA 4AD3A 3H2AA 2GK1A 2ZDSA 1QTWA 1K02A 3PTMA 1IHIA 2CXGA 3FVDA 2A6NA 4PTDA 4C6JA 2JIWA 3P14A 5LA2A 4B3LA 4ZXOA 5CBBA 5IHSA 3L4TA 3VZXA 3M07A 1SO3A 5L6UA 4RKAA 3UXKA 3BMWA 2VKZG 4JFWA 4B4HA 3NQBA 1KNWA 2ALDA 4QROA 3D46A 3DFYA 4JY8A 4H9XA 4BF5A 3NM1A 4UNLA 4OZOA 1JRBA 1K9DA 1PS9A 4O13A 4HD5A 1B5TA 1VLWA 3AZSA 4QQ3A 1ZBCA 4Q4RA 1FCUA 5C9UA 3W7QA 5DN1A 1E3ZA 1AW1A 3PTQA 3MC5A 3OOQA 3T07A 1Z48A 5HQEA 1QWKA 3T6CA 1CXKA 3WJZA 7ODCA 1XF0A 4Y8FA 3LSBA 1TTQA 1PWLA 3TLLA 1PE1A 4JGDA 4GQQA 1XBZA 1EBGA 2PP0A 1IQ8A 4P8WA 5CH9A 3Q65A 4RDWA 1YXCA 3WF2A 3MI6A 1TJ1A 2GVYA 1JXJA 4EXQA 1FUYA 1Q4NX 3BLLA 2HXUA 1X97A 3CH0A 2OGYA 3L5MA 3ITXA 4TTGA 1CBGA 4UTMA 3T42A 5K3VA 1V02E 3AS1A 5BROA 1ZJIA 3PN8A 5HPOA 4QNEA 3IVUA 2A2IA 5LIWX 3GQYA 3ZIZA 5AYXA 1PYFA 1GVFA 2YL8A 2VJXA 2CPUA 1I60A 1XIMA 3WQCA 4H83A 3KVLA 4JEQA 2IUZA 4Z42C 4NT0A 2Y62A 5CZKA 3M6YA 1QT1A 1L2QA 3B4YA 3CEUA 5LNSA 5XIAA 2E25A 5LNWA 3MBFA 2Y89A 5HQMA 3FAWA 4N9DA 2ZRYA 4R3UA 3W23A 4AISA 3N3TA 1W0MA 2NSOA 3HPSA 5G2HA 1PKYA 2W92A 1OYAA 2DZUA 2ZX6A 1TPUA 3KL3A 4KEVA 1VH7A 2CZDA 4QG6A 4J2MA 3IGHX 1YPFA 3TUUA 1D7KA 1W2VA 3PUDA 3WYZA 1MW1A 1QNQA 1E55A 1P5BA 3NQ2A 5I3JA 1EYWA 1IXPA 4XD3A 2X05A 1UR1A 4HA3A 2VURA 1PTGA 2QCNA 3RXZA 2E9BA 2W61A 4OECA 2CLIA 3I10A 3F7JA 1Q7ZA 2V30A 4HU0A 1F3EA 3V4BA 1I0BA 2WBKA 1W1A1 1R85A 3FKKA 1R3YA 2BOEX 1AZ1A 5I7GA 3C2YA 1EPVA 5E1QA 3TQKA 2VCCA 2YR1A 2DW7A 4UXDA 3M43A 4PBGA 4P2VA 1SJAA 3ARPA 2Q8LA 1S2CA 4Q6XA 1G1YA 4F0RA 1UZDA 4QRNA 3ARRA 3NZQA 2XFFA 1SR0A 4Z08A 1VPQA 2YZRA 1TV5A 2E4TA 1R3RA 4MY1A 4DXVA 3TW7A 4S3JA 1AJZA 4M19A 3CMGA 4AHPA 1K9FA 4MVAA 2D69A 4O28A 2HBVA 4LVDA 1X6LA 4L4MA 1V02A 3LTYA 1NELA 3USZA 2QCCA 3B40A 2D2OA 2CU0A 2WMIA 1H41A 2B7OA 2ONEA 1PXGA 2WMKA 1LL4A 4GA8A 4EP8C 4MF4A 3QC0A 2YCIX 4A8RA 2V2DA 3RX3A 1OFPA 3P7YA 4IJRA 3G1XA 3WEMA 3PS7A 4UOJA 1T6MA 3CHCA 4ROPA 3OGVA 2PODA 4H2CA 4C6PA 1GVQA 4JTTA 4GVIA 1AG1O 3GBDA 3KCJA 1OX5A 3WQDA 1A5KC 5ABHA 4HCHA 3W70A 1VYSX 4WGHA 1IZKA 1SW3A 4IMGA 2LLEA 4I9MA 3W25A 4AAJA 1OHLA 4LPCA 4D6CA 3WUEA 2BGSA 1WDSA 5HK4A 2WSKA 3W02A 4RW3A 1N8FA 4IIGA 1KFCA 3DI0A 3CUJA 3ZJ8A 4DWSC 1PB0A 3BG5A 2H8ZA 1TJPA 2F6XA 2UWFA 2QCLA 4OV4A 2QJNA 3LHYA 4R7JA 3GIPA 4LXFA 1KR1A 1XICA 3QW3A 2A0NA 4C6FA 5I77A 1GJPA 4FHAA 3OPSA 1H3GA 4WSJA 4X9SA 3S1XA 4Q8TA 4WQ6A 1RP9A 4HA4A 3GNNA 3UZYA 3TFXA 3EMZA 1ZALA 2V3EA 2VC5A 4UB9A 4KFPA 4W7WA 2J78A 2G4JA 1E5NA 3ERPA 4NNCA 1NIUA 4KFOA 3KTSA 3BG3A 1EOKA 3QVQA 3L2MA 3GHRA 4KCWA 5HMEA 4K6AA 3S1VA 4NRSA 4QITA 4WKAA 4PYSA 4A21A 1IGSA 1N8WA 3MZNA 5DX7A 3IJ7A 4HN8A 4LUTB 2VZVA 1GOIA 3DG3A 1HJSA 4LYRA 4S3AA 3T2PA 4O0ZA 2ZE3A 3N6HA 4M7TA 2BZNA 2CZVA 4JL2A 3WFLA 4L1GA 2QHAA 3PY2A 3HPXA 3SUVA 4ILSA 2P0IA 4HNCA 4PFHA 3OYXA 5G1YA 3ZT6A 1XFBA 3QQ1A 1GOXA 1JUKA 1KFEA 2FDMA 1EA9C 1OFBA 3QGAC 3UGVA 3VIMA 2VWTA 4GQBA 3GDLA 4D1IA 2ODOA 3M64A 5AY7A 3TWBA 2FQIA 1Y5VA 3LA4A 4OOUA 2QXWA 1Q6LA 1E6XM 1I8JA 2HE8A 3H7UA 2BVYA 3MY9A 3CAWA 2DVUA 1LBLA 3LI0A 4F0MA 3WJXA 4ENLA 2ZKMX 4RK8A 4F9DA 2XFRA 3QH2A 3VOIA 3IGUA 4L61A 1RBLA 1QO2A 2Y8UA 5IOBA 3USBA 1RP8A 4HJWA 5M2FX 4BI5A 3OVQA 3P82A 3NGFA 4AZCA 2Y85A 4TVCA 1VGAA 2UZ9A 5FJIA 2HK0A 1VFUA 1CGTA 1EEXA 1DP0A 1ECEA 1IWPA 1FKXA 4DUVA 2BXZA 1GJUA 1UA7A 1EWEA 1HJXA 1MZRA 4ATDA 3UESA 3DCPA 1BQCA 1EX1A 4AWSA 3S1UA 4MAVA 1HNYA 3W74A 3OW1A 4AU0A 2Z2BA 3B4UA 3KBWA 4V28A 3H4GA 4PMQA 1W91A 1K6WA 4H7VA 4HTBA 1UH3A 1GZ1A 1HFBA 5G1MA 1KXVA 2B7NA 4RV8A 1GONA 3ME3A 1RA5A 2FZBA 2DIKA 1F6PA 3W83A 4NNAA 3AIVA 5HPCA 4PSPA 1XIGA 1WDPA 3C86A 4PFMA 4EF9A 3VM5A 3SRHA 2V82A 4IQEA 1CI1A 4LY8A 2A3CA 2UY3A 2AL1A 4LYPA 1ME8A 1NWRA 3W7RA 4OKDA 5GJNA 1P0BA 2CHOA 3ZMRA 1WP6A 4NX0A 4PUKA 1EQCA 3PJWA 4O15A 4DF2A 4AWUA 3I4EA 1BRLB 4ZO6A 4LAKA 1BEUA 3FYOA 4HNLA 5FL0A 3A5FA 1WZAA 2UV8G 3GH4A 3SO7A 1EKOA 4JIPA 4IXXA 1RPXA 3DOPA 3QPEA 4GQGA 4J35A 3ZSTA 5ABGA 3KWSA 3MS8A 4ZEPA 4A3RA 1WKFA 3EOUA 4LVAA 3SUTA 3L4ZA 5I02A 4DBUA 4PMRA 2Y5EA 4LYQA 3BCFA 4UTWC 3B04A 1U33A 2Y4SA 3O07A 3ZYZA 3DGBA 5H8UA 4NU7A 2GK1B 3TCEA 1A3WA 4W8BA 3VX0A 4QSFA 5ABFB 1XLHA 1GOQA 2XWDA 1TA3A 4MUPA 4Q7IA 2VX7A 3DYMA 4E3VA 2RDTA 1XSJA 3TJ4A 5AN7A 2FPYA 3K13A 1QJWA 2J47A 3GSMA 3UG5A 5FOOA 3R25A 5F1VA 3KBSA 4YCPA 4W9TA 2BOFX 5LIYX 3SGGA 2D0FA 1MMFA 4JIEA 1X7FA 1OBAA 4X0VA 4WXYA 1VQTA 3G0XA 1UH4A 4Q32A 1U1HA 3QEZA 1NWSA 5TF0A 2WLYA 1WKEA 3FOKA 4UFHA 3INPA 5K9DA 1C29A 2GOKA 3BVJA 3G8RA 3MO7A 3NOEA 1XYMA 7REQA 2EKGA 5T26A 3C0LA 1SQ7A 3D47A 3HQ1A 1E9IA 2ICSA 4W7VA 1OEPA 3NQ6A 2XH4A 1TYGA 4CN1A 3VFCA 1BKHA 3WNNA 5HNUA 1ADSA 3KCOA 1W9DM 1HL8A 3I65A 1N8IA 2CC0A 2INZA 1JCNA 2X0SA 4DAFA 3M5VA 1DVJA 1G67A 4GFSA 4RLIA 3MCNA 3OU8A 3UWYA 3VNLA 3TOPA 1TPFA 3BWWA 4JL1A 1A5AA 3IIPA 1F61A 1XBVA 2XM2A 3TNOA 1Z3NA 2KX9A 3PJTA 1G7VA 4FNTA 1KA9F 4HMCA 4S23A 5DXXA 2WW5A 1U5VA 2ZZ3A 3ICJA 4J1OA 3AJXA 1OINA 2QV5A 3CO8A 1UMLA 3CQHA 3CV6A 1ZAHA 2B7PA 2F61A 3BC9A 1FXPA 1DJQA 1TMLA 4PB5A 4HZ7A 3F5LA 4E2OA 5RUBA 1KWGA 3M9YA 2DUAA 1KLZA 3TIMA 8A3HA 5D04C 3L4VA 2OWWA 3MQTA 3HV8A 2A7PA 2CLOA 4UUIA 2WZHA 2XVGA 3TC3A 1T0OA 2YCJA 1VFTA 1OCJA 1EEPA 4WCJA 1JIBA 2VFEA 1B3WA 4UFKA 1US3A 1KFWA 1B3ZA 4CVUA 4BK9A 3MDUA 4OIFA 1CXLA 4HSNA 1QHOA 5CZSA 2CLPA 4FNPA 4HT3A 3Q37A 2A21A 3TYUA 1R3TA 2OMAA 3GTHA 4X9YA 4GHRA 4INFA 2WNQA 1H7RA 3R8GA 3PUEA 3EPOA 2EPOA 5B7ZA 4AC1X 1BF2A 1J12A 5HWNA 1KRAC 2PD5A 3TU9A 4TU1A 2VL4A 3AI0A 3BAWA 4EAYA 2ZTKA 1ECQA 4WZHA 3W28A 4F9JA 3A5VA 1V3IA 2QMKA 1DJYA 3AAMA 2HK1A 1XGEA 3AC0A 3KXQA 4JFVA 4XZBA 4LF2A 4IIDA 4IL0A 5LIXX 3RM8A 3R0DA 4JX4A 2GUBA 3WDIA 3M46A 4LAZA 1HVXA 2DUZA 3MBDA 1DIKA 4DWSB 1GVEA 1JDDA 4PODA 1W9XA 3GG0A 3W24A 4ZMGA 3OG3A 1UW9A 4Q33A 2OYKA 4AG0A 3WIJA 3C52A 4BR1A 4B92A 4DNMA 5C54A 2HDJA 1PHQA 4Z0JA 2P8BA 3GU2A 1GOMA 4OBRA 3DIPA 4K36A 2R24A 1DTUA 4NI3A 2EPHA 2VFFA 4YS1A 3WQ5A 1YBQA 1KW1A 1MQRA 4ADSA 2VC9A 4KF1A 4W85A 3DC8A 3WDJA 3C8FA 4WX2A 5EFFA 3O9NA 1V6UA 3VIKA 1RLDA 2HSAA 3VDHA 5DF0A 3C8NA 4JQ2A 3WK3A 4QEEA 1NFGA 1Y5WA 1LBFA 4MIMA 2ON3A 3LCGA 4EXBA 4PB3A 2HTMA 4QNWA 2AKZA 3KBNA 1VFMA 3WX7A 5L9FA 3R6IA 1HT6A 3ZR5A 5JQ9A 3SCVA 3TFCA 4DJDC 1ZAJA 4JFUA 1XDLA 4RV3A 1XIDA 1IT8A 2GJNA 3WMCA 3RPMA 3TN4A 1UR2A 3TOYA 5I23A 1P48A 4O8AA 4GKLA 2XIMA 3CQJA 3WH9A 5AZ0A 3R79A 4AYGA 2ZZ4A 5D09A 4GO8A 3OBAA 2PWGA 1E43A 4AMAA 5PTDA 4DELA 5D38A 6CGTA 4HHMA 2H9AB 1H7OA 2V2CA 3LM7A 3QY8A 3HA1A 3CZEA 4V1XA 1U2YA 3OIXA 2QV4A 5BRQA 5C71A 3FJNA 3N19B 1A50A 3WDHA 2R1PA 3N9RA 5H8PA 1XGZA 3GHTA 3VOFA 4RDVA 4IT1A 2BX7A 3J7HA 1R2SA 2Z27A 2GWGA 1W3HA 1FP9A 3R1ZA 3SN0A 1SMAA 4GGHA 3UPMA 3OLGA 1TA3B 3GC2A 7XIMA 1US0A 4NHVA 4AC7C 3R5EA 1XLMA 2CKRA 4RCXA 2J7EA 3EWWA 2ISWA 1UP2A 1V3HA 1MQQA 1EPXA 3ABZA 2NVAA 3LYEA 5I3GA 2RDUA 4CCDA 4LCQA 4KCVA 3B0YA 3JR2A 5HR6A 1XM3A 2NWRA 3BTNA 3CMJA 1XKYA 1TX0A 4OE7A 1X39A 5F7UA 1UCWA 4P7OA 2YBUA 4KIEA 2GUYA 3LBCA 1JFHA 4LVBA 1FHUA 1E6RA 3NWRA 3IRDA 3SURA 3VFLA 1VLIA 1Z44A 2J74A 3FA3A 3PAJA 2FZDA 1TZZA 3G18A 2PBOA 5A2BA 4QLKA 2VEKA 1POKA 2ZOXA 3UWEA 3WJWA 1FWSA 2HV5A 1FH8A 4HPJA 3GO2A 2YLAA 2HNHA 3HBLA 5DCEA 3CT2A 2QT3A 1NDZA 3REQA 1XIFA 3SI9A 1Z7AA 4AZBA 4Y9AA 4YTQA 2FDSA 1AZ2A 4GVFA 2HWGA 3LCLA 1W1ZA 2ZUTA 4Y96A 2VZSA 1WB0A 3BAYA 3BOXA 3Q67A 4AB4A 1X7IA 4XZIA 3BANA 2ZX5A 4FNQA 1ZSXA 4H9YA 3RMEA 4DZ5A 1N55A 2WO5A 4D8AA 5DQPA 4HSOA 2AMXA 2OELA 2X40A 3OBKA 1V8EA 1HN1A 5AYZA 3ORWA 4MNLA 1VBRA 2HISA 3MI3A 1XD0A 1F5ZA 1KB3A 3K30A 3CEPA 1OT1A 1FX6A 2BY0A 5KTLA 3CJPA 3WQVA 1LLWA 2AQOA 3S8HA 2GSHA 1J9YA 1QWGA 2WMIB 1F76A 5DFAA 1Y0EA 2BLEA 5DY2A 1KM4A 1B9ZA 1SM9A 4HU8A 7PTDA 2ZWZA 2E5DA 1EJSC 3MT1A 1TV7A 4ZOEA 3O05A 2QGHA 2W0UA 2EBNA 3DKLA 1L8NA 4IMFA 4L4OA 1G6CA 3LB0A 3FJ6A 1UD2A 1YLVA 3UU0A 4YXGA 2Z00A 3LTPA 1QMLA 3M7SA 1RQBA 1UR4A 4JXCA 5BRBA 4DI8A 4ROQA 3WLSA 4MLJA 3ZQ9A 1B3YA 4MZYA 2VDIA 4JKKA 4XZLX 4O11A 4PEKA 1JDAA 3GZ3A 3CQ0A 4S2CA 3TE9A 1UH2A 3PWIA 1XW8A 1KCKA 4OGZA 1GORA 4B2DD 3F2BA 3H2OA 3MJMA 2UBPC 5E09A 1FWIC 3R12A 3WQEA 2IQ0A 5HATA 4MKSA 1GEHA 1OIMA 1HXJA 3SQMA 3P80A 5A8NA 1V3MA 1WUFA 4EPBC 3ZXWA 3IIVA 1K7FA 4DWSA 3E96A 3W88A 3SW6A 3HU7A 1V3KA 2OSYA 3P84A 1ISXA 3P62A 1C93A 2FPTA 3FCPA 3HPZA 3CUFA 3HGOA 3FHQA 4IIBA 4W87A 2Y24A 1FHDA 1LP6A 1PKMA 1XGDA 2G50A 3AHYA 5LZLA 4D6DA 3VD3A 3C2EA 5KZDA 3F5JA 1LQ2A 4FF7A 4BY3A 4G7EB 3GFXA 5KMYA 4I5XA 4LWWA 1GWJA 5FI8A 3M0KA 3QV6A 1KTCA 1XLFA 3W0KA 4M56A 4IPPA 1XLAA 3GRIA 1TX2A 2DP3A 4DYKA 4NI8A 4ES4A 1G94A 4DF1A 2PUZA 4M6UA 1WDQA 1P7TA 3LG3A 3UGRA 2Z1KA 2GDVA 1R38A 1WBHA 3W87A 3NURA 2C19A 4TOQA 3G1HA 3PZNA 3WNLA 4EX4A 4GUFA 2OLAA 4PUUA 2VQTA 4CU8A 4DUXA 2R1MA 4U2ZA 3OGRA 4FXFA 3BLFA 3WEOA 2F84A 2QJIA 5BXRA 2OXNA 5FD0A 2BB0A 3W53A 4FP1A 5H8MA 3B8SA 3VD4A 1FP8A 1XCFA 4U5IA 4G1NA 3WFAA 4LSBA 2E7FA 2EJAA 3V0UA 4O1DA 4L6OA 4J3TA 4HHLA 4RZ6A 3E38A 3AWOA 2WJDA 4MPQA 2PTZA 4D8ZA 4YHEA 3DFQA 3CLMA 4EACA 2WC7A 1R9YA 1T41A 1W2PA 3DFHA 2ZE0A 2YDQA 3A22A 4C6DA 2Z6JA 2HZGA 2Y1HA 3GXMA 3SY1A 4PRRA 3EX1A 4JDBA 1F8MA 1NQKA 3F4CA 4Q7NA 4H7CA 4UWMA 3N34A 1QATA 2X2GA 1W31A 1LOQA 2TMDA 4UFJA 4XO7A 4MPKA 3NO1A 3TZFA 4AWEA 3GXIA 4XTIA 2O92A 3NPXA 1UQYA 4BKNA 1DXFA 4K37A 2XH0A 5FAGA 1A5LC 3LX9A 1NF7A 3EX3A 3NQ8A 4ZODA 5K9CA 1E5JA 3WLMA 2WZIA 4TO8A 5IRPA 4N0RA 3E49A 5FJRA 3O3RA 1BG9A 2XIJA 3T8LA 2C14A 1NVMA 2CBVA 3QM3A 1K70A 1UBPC 3H2MA 2XU2A 3ITVA 2PDGA 4OJYA 3W07A 3PTKA 1L6SA 3LZ3A 4GUJA 3O8AA 4YCOA 3UR5A 1VAHA 1XLDA 1CWYA 1O12A 1P0DA 4YYFA 3POCA 4PL1A 5D9PA 3ABXA 3L68A 2PZ0A 1EHAA 1KGUA 5I2UA 2YDSA 2XGBA 4WLCA 4GYPC 2I1OA 1DV7A 5CZJA 3RJXA 5A69A 1WKDA 4XZ9A 2HNEA 5A6TC 3WLTA 4AUBA 3QTGA 3RPTA 5A8PA 3MVTA 3BLKA 1DQXA 3EB4A 3HB9A 5KETA 3UJ2A 3GDMA 4RPQA 3KRZA 4N4QA 1HJQA 2PF8A 1XD1A 3RLUA 3UD6A 4L80A 3VMPA 3WQOA 3R43A 1XSIA 5AOUA 4E0CA 3RR4A 3T8QA 4DF0A 5FF2A 4HPGA 1UKSA 1AQMA 3WNPA 1NY1A 1LJYA 4BF7A 3LUTA 1JI2A 1ITCA 3ONBA 1IF2A 4LFYA 1ALDA 5FCZA 1E72M 4GNKB 2ZZ7A 2ZA2A 3G3DA 4PB4A 1ZENA 3RITA 1VBUA 1GW9A 5F2LA 3OZMA 2CLKA 3HMJG 2A85A 5JH1A 2NXIA 3K1DA 1SZRA 3GTFA 4ZGYA 2ALRA 1XJBA 3N14A 1W1VA 4IP7A 4FLQA 1D9EA 2PZNA 2RAGA 3ARYA 2AQWA 3STEA 5CLWA 3N11A 2J8GA 1Z41A 3TQ0A 1I2NA 3RM4A 4PCFA 1KFBA 2V3GA 3FKRA 2PI6A 1VBJA 4OBSA 2WANA 3HGRA 3SCWA 5IBXC 3UZJA 4DBSA 2VEFA 1XISA 1S1PA 3DFTA 1B31A 1UZHA 3MCMA 3KRUA 1XYCA 3CUGA 2YXXA 3GW3A 1L0PA 3IWPA 5CSSA 1HKVA 4UTJA 5AVNA 1SUXA 4AIEA 1MRAA 2IXUA 1XG4A 2Z7GA 2HS6A 3K8LA 4NYYA 3L7RA 1TE1A 2CITA 1DJGA 1H50A 1PUDA 4C1KA 1OGSA 4CN6A 2RDWA 1Q8JA 1EC7A 2PWUA 3T0BA 2EPKX 1EC9A 3NZ1A 4RL3A 3NDZA 4UCFA 4G9PA 2PDFA 2PRHA 3LHVA 2QLYA 4Q4PA 1GJWA 4NJIA 4F4RA 4K7VA 3WUFA 4JTKA 3W37A 4QTGA 3A3HA 5KINA 3E02A 1JAEA 2W5FA 1C9DA 1PX8A 1R3VA 4MTVA 3IIZA 4ERIA 1FFQA 1BRLA 1PO9A 1XBYA 1DJZA 3BCDA 3W7DA 4LUSA 3RHGA 5EPDA 4DHGA 3OB8A 1P6WA 4BI6A 3N12A 3WD2A 7TAAA 4Y2WA 4MNMA 2A3AA 4UR7A 3EDJA 1VRXA 5BYWA 1UASA 3OYZA 3TH6A 1AH0A 3TN6A 7A3HA 3KOXA 1KRMA 3BH4A 4MB3A 3PF3A 1XSKA 2W66A 3Q94A 5ABTA 2DW6A 4L56A 4UTTC 2CESA 2W4XA 4JEJA 3QYSA 1DWIM 1R2TA 1J4EA 1M01A 1YPXA 1JRCA 3REQB 1HKKA 2ZVRA 1V7AA 2X1IA 3RU6A 4NZ4A 3W7PA 4NJKA 4EOUA 2PWHA 3W27A 2PC8A 3UP8A 1A4LA 1TTIA 2ADAA 5FF0A 3V36A 4JYEA 3VZZA 2WCAA 3BJSA 3BZGA 3M5ZA 3D6NA 2ZRZA 1PX3A 5FKYA 1R46A 1EJVC 2QUTA 1T99A 3CC1A 3HFTA 4W8LA 6REQB 4LVGA 1RCQA 5J5RA 3ARQA 1H7PA 4C5YA 2PMQA 2HJPA 4WY0A 4X0NA 1OZQA 2G37A 4NX5A 1QK2A 4GINA 3L12A 3M1ZA 4MY8A 3VIFA 5I0DA 1ZU8A 3KL0A 3JZUA 1UKQA 1KXHA 4WGXA 3URQA 3QZ6A 1WZKA 4J3XA 1TWZA 4LU0A 4XUYA 4I3GA 3MMDA 2QGYA 4MYAA 1X1ZA 1GYLA 3RPDA 1MXDA 3DERA 2YDRA 4WR3A 1DTNA 3W1RA 1CT5A 4QCFA 4O0KA 4UOQA 2XSXA 3E74A 4YLWA 1H60A 4S3EA 4JNZA 4O1AA 4ZO8A 2Q09A 3SIZA 3NQ7A 1AK5A 4PRWA 4J9JA 3V1PA 3FEQA 1QI3A 1V6WA 4ZR8A 3GNOA 3CAVA 1V0KA 1O1HA 5C5YA 2FHFA 2ZTJA 4FR6A 3VC5A 2GDQA 4QIUA 3VI2A 3OZOA 2J8FA 5DXYA 1YEYA 2GVLA 2NQLA 5CXPA 3DEQA 1OVDA 1W5MA 1RZMA 4JHOA 1GQNA 2C18A 3A4JA 2FGLA 2J66A 1BSIA 3KVMA 2BGQA 3JU2A 1I2QA 3VOCA 2NWSA 3KLLA 3VOJA 1QBBA 3SCNA 1K6AA 4AZ6A 1R0MA 4DM2A 3BQ6A 3FA4A 4FALA 3GW0A 3UVAA 2R1NA 4GPNA 1QI4A 3MZ2A 4YHGA 3LRLA 1IEWA 2TRSA 1ZP4A 3CYVA 2HMCA 5AHIA 1W3KA 1MFVA 3N04A 4G7EA 2WC3A 2FMOA 4XBKA 4DQWA 1E9ZB 2WKGA 2FTPA 2GVEA 1HGWA 3T7VA 1UMYA 4AD5A 3UQNA 1JZ5A 4AXKA 1VD6A 1TZ9A 2ACRA 5SWUA 2ZXDA 4A29A 4PBEA 4LS1A 3DHDA 3FDKA 5D2TA 1JZ4A 4S38A 1QI0A 4EWND 5A2AA 5FACA 4QLJA 1BAGA 4HHPA 3GYCA 1VEPA 3T81A 1DEDA 1W54A 1UOZA 5EMJA 4D9PA 2ISSA 1H61A 2WJZA 4JBRA 2SFPA 1YE4A 2FFIA 3QGKC 3DI1A 1E0VA 1QOQA 3KRBA 1HL9A 1JR1A 4M6QA 2V5DA 3TTEA 2Y63A 5HNTA 5I06A 3GFZA 1A5MC 2G5WA 4PA8A 4AIOA 4XZHA 5I79A 2CLEA 2PPGA 4M51A 3R0KA 1PCWA 2ZZ1A 4HSHA 1JZ7A 1OYBA 4DJFA 4QX4A 1XYLA 1G0CA 3O16A 1EF3A 3TQPA 5A6AA 3NZPA 2JGQA 2GGHA 5GJPA 2H3DA 1LYXA 1HJVA 3B0PA 4U28A 3HQOA 4QS5A 4ZOCA 1FDYA 1LTDA 1BWKA 3LRMA 1Q63A 1A5NC 4LH8A 1NFBA 3GNPA 1S2UA 4V15A 1ZL1A 1TELA 2DT2A 1BXBA 3GG8A 3MKVA 3LGGA 3T0CA 5FEXA 4H8NA 2OWXA 3AXHA 4BI7A 3DN5A 2YW4A 3U4FA 4CKQA 1KFLA 2YA0A 3ARVA 3EMCA 2DH3A 2Q3OA 4IFOA 2PDXA 2CLHA 4IP4A 2E0PA 2NV2A 4LB4A 4U3AA 1HX0A 1NF0A 4KIRA 4L9XA 2JK2A 3NL3A 2A1YA 4NIRA 4H00A 1HP5A 1EO5A 2Z1XA 1OT2A 2O55A 2ISVA 1NFPA 7REQB 3VNKA 4XBSA 4ATWA 3DHPA 1AH4A 5A6BA 1NM9A 4UTIA 8XIAA 2R6OA 5DMYA 5M5DA 3VKJA 1PDYA 2X42A 3I4KA 3MW7A 1JPKA 3VK5A 1W8SA 1W5PA 4FOJA 4WEVX 1JCTA 1WPCA 3A4XA 3ABRA 4LUIA 2BY2A 3EWCA 1W3LA 1HW6A 3IJ9A 1KRBC 2BHYA 5EKYA 3ANUA 2XIBA 3T05A 1TCDA 5I5RA 4L1XA 1LOLA 1W32A 2YL9A 2X2YA 3MO4A 1U1JA 1X6NA 3E0VA 3TTYA 1Q13A 1EC8A 3CBWA 5GVJA 4CVWA 3CHDA 3O1NA 2EG7A 4MKNA 1JZ2A 1W9UA 3XINA 3WQPA 3NL5A 1M7OA 2OYMA 3KZSA 3BGJA 3CZ8A 6REQA 4NZ3A 1JF6A 3EWDA 2FYMA 3T40A 1EFZA 4PTMA 2C15A 3VINA 5D37A 2AGTA 3LI1A 3GAKA 3ABOA 2YA1A 4IJCA 3FXGA 3PG8A 3AS3A 1UIOA 2PDIA 5FEZA 4NL1A 3UY7A 4XISA 3LV5A 3WLOA 4MOZA 3OTRA 4IZGA 1GPWA 4E8GA 2P10A 1J6PA 4IISA 2HQAA 4I5UA 2ABAA 3UCCA 1F3XA 1OFEA 4K68A 2OSXA 3NO5A 1RSCA 3VKDA 4A8IA 3R7MA 3GB6A 2X1SA 3KVKA 1PL9A 3I3EA 4JTUA 1VKFA 3FV9A 3N6JA 1CIUA 1DJWA 4UMCA 3L4XA 1E4NA 1F2JA 1RBAA 3W9ZA 4QISA 4LCSA 4FXRA 3BGAA 1Z89A 2BP1A 1KM1A 2X30A 5JH2A 3AIWA 1FWDC 1G4SA 2VC6A 4OVXA 4ML4A 4PCTA 3EX6A 3GUWA 1O5RA 1BGGA 4MJ2A 4IFKA 4C1NB 2ZUNA 3KUMA 1EJ7L 1Z9AA 3M47A 4XVDA 3R11A 3CV2A 4IF2A 3TV8A 5LYRA 5LIKX 4PUDA 2I5GA 4KEMA 4YMZA 5CBIA 1HKWA 1OM0A 3B9DA 3HOJA 3MDWA 2D2HA 4W7UA 3B8TA 3E0FA 5M3WA 1K8XA 3IS4A 2ZUSA 5T9CE 1PZ0A 3HTWA 3RF9A 4ZBCA 1PJ9A 2X7WA 1JFXA 5G4EA 4XSLA 3CHVA 2TAAA 3ELFA 3UY8A 4J28A 4CEXC 5T91A 4B5UA 1GKPA 4HIBA 4RZ5A 4AD1A 1W8GA 4CU6A 3VNYA 4G6CA 1SZEA 4B5WA 2E5CA 2WVUA 2YCKX 2HVMA 1M7JA 3AXXA 2ZZ6A 1YKWA 1DWGM 1UWSA 3G1FA 2VELA 4D6HA 4XO6A 3EAUA 1EQPA 3PFMA 1K4HA 1B9BA 2QCDB 3ARZA 1C91A 4N9BA 3RO6A 1W1PA 4AVFA 3IJDA 3VD7A 4FX6M 2PLJA 3QHOA 3N3MA 2Y7EA 4FI4A 1FWAC 5C2GA 3DU0A 2VR5A 3M0MA 1PTAA 4O1CA 4H8VA 2CHRA 2VGGA 3L21A 5CCZA 2O7QA 4N6EA 4LEQA 4Y7EA 2NX9A 3NA8A 1Q7MA 1LT7A 1Q8AA 1UPPA 1BF6A 1Z69A 3MB9A 3KTCA 3EWZA 3PP7A 4L64A 3VIHA 3NSNA 4QLLA 1DIOA 3WMLA 2Y2WA 3UNDA 4NZ1A 3CT7A 1XQKA 1CYGA 5M03A 1PDZA 2X1UA 3C2VA 3QV7A 1M53A 5CGTA 5C7HA 1WO2A 4W5ZA 4H9UA 5TQLA 4XK2A 3ZM8A 3N4FA 3W1TA 3MV11 1KXTA 5LHEA 3Q4DA 3P2VA 1NWUA 1BGAA 3P93A 1YYAA 4D6GA 5TBOA 1MQPA 1HGYA 1KGWA 2OKTA 2G4FA 3S0CA 2EF9A 3ITTA 3SRDA 1W9BM 1VS1A 2GOUA 2OZTA 4JTSA 4C60A 4I6VA 2EG6A 4JY9A 2PDPA 3KOYA 1RXOB 1VENA 4YU1A 1XRFA 1E0TA 4KEZA 4HVXA 5DMMA 3WNMA 4DO5A 1D3HA 2XWEA 2ZX8A 1SO4A 4MLRA 3U48A 1W5NA 4DO4A 4GZIA 4J27A 3LXCA 2HVNA 1UKPA 3ARTA 3WO8A 2QUVA 4CU7A 4HBKA 5AC6A 1JF5A 4Y9MA 4HNTA 2DT1A 3MSGA 4LNCA 4IGSA 3KTXA 1M68A 3QPYA 1MEIA 2ZUUA 4GNVA 2QUMA 1OCQA 3KS6A 3NQCA 4QBXA 2GGEA 1KC7A 4BQ3A 1NDYA 3I7QA 4YN5A 5C70A 2W27A 5BMWA 5A6LA 4GYKA 5HAOA 4DZAA 5A2CA 3IJLA 1F74A 4IOTA 3TKFA 3STCA 3AWNA 4QJ1A 2DZWA 2VGFA 4JYFA 1NOWA 3TSDA 1LL7A 3U8GA 4IPIA 2PBGA 4ECLA 3SZ8A 3G1DA 3O63A 2GLKA 4IJBA 4JD4A 3ZS4A 2OKOA 4CD8A 2PWDA 2ZIDA 4B15A 1OK6A 4UTLA 4JX6A 2PLMA 2QPUA 4WOZA 4LALA 4H8UA 2GDUA 2Y7FA 4HU3A 2PDUA 1LLOA 2WZTA 1JCXA 3EMQA 3FFSA 3JUGA 2V38A 1LBMA 1CECA 4RNJA 1E9YB 2DZPA 1BWLA 2VEPA 1Z32X 5AC5A 1B57A 2E6AA 1THFD 1Z8AA 1K8YA 1YHTA 1HL2A 2XZ9A 1X1OA 4IWWA 4Z1CA 5J8LA 3BGGA 3W6LA 4L65A 4TX9A 3H26A 4PE8A 1BKSA 1YTEA 4Q4OA 4FXSA 1R6WA 1M6JA 2OQHA 3ZZ1A 3UG3A 3I3DA 2OVLA 1K7XA 3TAOA 3QKEA 4UQCA 5I3IA 3CWOX 4JR5A 3KBMA 2VXNA 3PPFA 3OVRA 4AHQA 4NKCA 2PURA 2GJRA 3WLPA 1PIFA 3O7UA 3RM9A 3FJLA 3IJ8A 1QPRA 3NYDA 4KESA 4M80A 4YVVA 1JZ3A 2MANA 2X0HA 1MSSA 4Q4MA 2V9DA 5F4WA 4NZFA 4J2PA 4XB3A 2Z7KA 3GVWA 1ZNNA 3CPGA 2PDLA 4P8VA 3MKCA 2PRMA 3F4WA 3C3UA 2CIPA 4H19A 2FTWA 1MXSA 2NUYA 1N82A 1KBJA 3FW6A 3G24A 5CJNA 5CG0A 1W9VA 3WF0A 4DRSA 1W5OA 1ML1A 5HMDA 1VJIA 1W56A 4N9EA 2PTXA 5HWMA 3ITOA 2PWEA 1TZ7A 1DWJM 2PDYA 5HULA 3PZOA 1H7NA 3BMVA 3RLVA 2NQ9A 4TXEA 4MNJA 3FX4A 1L8PA 3GD6A 5HOSA 2RKXA 2POZA 3CQKA 3URBA 3E6EA 1F9CA 4GJJA 2QDEA 4UQAA 3MCOA 1RK6A 1E3XA 2WYSA 1FWTA 3CM4A 4FX7A 4FF5A 5CQ1A 4C5ZA 3GNDA 1XLGA 4BEUA 2BSLA 2RGLA 3ITYA 3BLPX 2VT0A 1TG7A 3B05A 1V79A 2H90A 4MZ8A 1FVPA 4S1FA 3VGBA 2O4MA 3IVSA 2DZBA 1AQ0A 3H70A 3NCOA 2DFAA 2IXVA 1FCVA 3UT0A 3ABSA 4FNUA 1P0NA 4JOMA 4A3UA 2GFTA 3HZ3A 2ZUWA 2XISA 1GHRA 2EJ1A 2E9LA 2FLIA 4P7QA 1LWJA 4E2DA 4WD0A 1MYRA 4NXSA 4YTRA 3N17A 1ZZMA 5HDRA 2YFOA 3RIKA 3FYPA 4PUMA 1SZNA 5BXPA 4XWUA 1TB3A 1KCZA 2DVTA 2EO7A 4AX7A 3S2JA 4KBXA 2DY3A 4W4QA 2PWVA 3N9SA 3QR0A 4AEOA 3NL2A 3NVDA 4GCAA 3GC4A 4XSMA 1EJXC 4IHCA 5CPMA 5EGRA 3B8WA 4WJXA 5FAJA 4WKFA 5TD4A 1IYXA 3HGJA 4DNHA 2IQDA 4U2YA 1WNOA 3WH8A 2IKGA 3NR0A 2VUYA 3K8MA 1ZY9A 1OIFA 4JQ4A 1E6QM 3GZAA 3VNDA 2B7QA 5IHRA 1GKQA 4KRUA 5GQBA 4B5NA 3E2QA 3BSGA 1B3XA 4Q6JA 4ZFMA 1CDGA 1TO3A 1X98A 2DIEA 5LHFA 4ERAA 3OZPA 1Q66A 3QFWA 4Q8VA 3E0WA 1RH9A 4O18A 5XINA 3WLKX 1DJNA 1RJRA 1CGVA 3I6RA 4GNJA 4RE2A 4DY1A 5GNYA 3EB3A 2WC4A 3BAJA 1QAPA 3VMOA 1H11A 4J4KA 3EYPA 5EMMA 3RK8A 4MMWA 4ZTXA 1L6GA 3PBVA 5FJJA 2I5IA 4P7RA 1ZBKA 3KDNA 3SIMA 3KS5A 1V5XA 1SSDA 1OF8A 1XUZA 4RNIA 4OQVA 1EX5A 1VCGA 1EXPA 2FZ8A 1WE5A 3O6YX 4I9TA 1A53A 5I07A 3VABA 1QFEA 1B54A 5CSYA 3C4UA 4AD2A 4OU1A 1V3LA 2ISFA 1WDWA 4LQ1A 3LCWA 3U2EA 9CGTA 4FPSA 1BVWA 4GJ1A 1E73M 1UWAA 4KGJA 4GH1A 2OYLA 1WZLA 3GNRA 1B4EA 4OV9A 3VAVA 3NVTA 3VNJA 2DUXA 3T1GA 4PCSA 2VFHA 5G5IA 2ZDRA 3GHSA 4KT2A 3M41A 3WNOA 1JCYA 1H0GA 1DJXA 3M4HA 2CCRA 1XQLA 3ZOAA 4CEUC 4LANA 2PLCA 1J0KA 2BVWA 3FSTA 2I14A 5C0QA 4F0LA 1YXDA 3SJNA 1KKRA 3FIGA 1ZHAA 3MSYA 1KGXA 4UTHA 4EIVA 2VRKA 3ZJ7A 1HJWA 2A7NA 1Q6DA 3TW6A 4HNVA 3NSXA 2XYLA 4WF7A 6XIMA 3QTPA 4TMBA 1ZRQA 3EWBX 4XZNX 1WV2A 5I3DA 3W2MA 2A6LA 1QOXA 2CKSA 5DY3A 3GXNA 4GACA 1WAUA 1J01A 1NAL1 4S3FA 1V4YA 4E4PA 5CJ5A 4BWLC 1L6WA 4JN6A 1O94A 4DWSD 4PMVA 3AIBA 3KEHA 3GR7A 1OZMA 1A4MA 1Z42A 3KBJA 2FH8A 3LHWA 1R7AA 2E6YA 4X61A 3TA6A 4Q4QA 1M3UA 4GX8A 3TSBA 1VFHA 3C6CA 4S3KA 3W1NA 3TEVA 3KOZA 5C8BB 2UY2A 4ZZ9A 1JULA 3L0NA 3HPFA 3UA3A 4LF1A 4QE4A 3BICA 2DQXA 3LM3A 3FVMA 1FQ0A 5D30A 3W1AA 2ZXBA 3E12A 4QHRA 1FWRA 1KBBA 2C91A 1F3TA 1A0CA 1E15A 1E51A 4IP5A 1GW1A 3UWQA 3B8VA 1VP5A 1EP3A 1W6TA 1YNYA 3VO0A 3P81A 2P88A 3CNYA 1LWHA 1US2A 2XN1A 3MUZ1 4O12A 2FZMA 1L6FA 5HMSA 4GXMA 4NF7A 1B90A 3STGA 1I6NA 4ZQMA 1VJZA 3F4NA 5A6KA 1MNZA 2Y5JA 4CCZA 4JIQA 4FR1A 3W7IA 4K38A 1UIPA 2GVGA 1GCYA 4RX0A 2PP3A 1H0IA 3OP2A 3AQUA 3UNTA 1UWUA 2WM1A 3AS2A 4R85A 1ZBWA 8TIMA