1EDGA

Single crystal structure determination of the catalytic domain of celcca carried out at 15 degree c
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
380
structure length
380
Chain Sequence
MYDASLIPNLQIPQKNIPNNDGMNFVKGLRLGWNLGNTFDAFNGTNITNELDYETSWSGIKTTKQMIDAIKQKGFNTVRIPVSWHPHVSGSDYKISDVWMNRVQEVVNYCIDNKMYVILNTHHDVDKVKGYFPSSQYMASSKKYITSVWAQIAARFANYDEHLIFEGMNEPRLVGHANEWWPELTNSDVVDSINCINQLNQDFVNTVRATGGKNASRYLMCPGYVASPDGATNDYFRMPNDISGNNNKIIVSVHAYCPWNFAGLAMADGGTNAWNINDSKDQSEVTWFMDNIYNKYTSRGIPVIIGECGAVDKNNLKTRVEYMSYYVAQAKARGILCILWDNNNFSGTGELFGFFDRRSCQFKFPEIIDGMVKYAFGLIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the catalytic domain of a bacterial cellulase belonging to family 5.
pubmed doi rcsb
molecule keywords ENDOGLUCANASE A
molecule tags Cellulose degradation
source organism Clostridium cellulolyticum
total genus 140
structure length 380
sequence length 380
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 1995-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1edgA00
3VDHA 3A47A 1WZLA 4P8WA 5E0CA 1V6YA 3GXFA 3PZNA 2ZXBA 4PMOA 2WWCA 2Z1KA 4U2YA 1JZ3A 3AISA 3VKKA 1BQCA 2CHOA 2FHFA 5EFDA 3VGGA 1CXKA 3MMDA 1E4MM 1W9VA 2QLYA 3NCOA 3WIJA 3ZJ7A 1BHGA 2CYGA 4UNIA 1G1YA 4GQQA 4W87A 3PZTA 1R7AA 1UKTA 4GINA 4S3JA 2Y24A 1QVBA 4E8DA 1GPFA 1V3LA 4AD0A 4TTGA 3WF0A 1TE1A 2WMGA 1QBAA 1HN1A 4BZYA 2GSJA 1E72M 4GI9A 1UD6A 1XH0A 1LJYA 5HNNA 1JZ2A 2AOSA 3LMYA 3W53A 4M82A 4HA4A 3VNZA 1XH1A 5DEZA 3VIGA 4JAWA 3IK2A 2WVVA 2VZUA 3AHVA 4FMVA 3F4VA 1QI2A 3OLEA 4QLKA 4PUEA 1VBRA 4F8XA 1NWTA 3B9AA 2TAAA 1W1TA 3PBGA 1Q6FA 3RMEA 4W5UA 1E55A 1VEOA 4CN1A 4TTUA 5A6BA 1QI5A 1E4LA 4MTVA 3MMWA 4JKLA 4B16A 4ZEPA 1GQKA 4TVDA 1ISXA 1YHTA 1V0KA 4ATLA 4HZ6A 1RPKA 2ZX8A 4M81A 2D24A 1UQZA 3BAKA 1UH2A 1HX0A 2DSWA 5CGMA 3OLGA 2VURA 2UY5A 3ZT7A 4WF7A 5F7UA 1J10A 1JAKA 4M8UA 1KBKA 5D9PA 1C8YA 1NQ6A 3PZMA 2BHYA 3WL1A 2ZWYA 3CZEA 4UQCA 4J3SA 4J3UA 3DHPA 1W2VA 2UWFA 2EPMX 4GZJA 2CEQA 3WY1A 1VF8A 1C8XA 3VNYA 4PCSA 2VRJA 1RD6A 4HP5A 3CZGA 5CPTA 2VO5A 1C3FA 1UUQA 1W9UA 2ZUUA 1JD9A 4HZ7A 4H7VA 2VVSA 1B3ZA 4A3YA 3VIKA 2D22A 3PZVA 2DT3A 5A6JA 3CGTA 3M7SA 1JDCA 1LG1A 3AZTA 2J7BA 2Y8VA 5BXSA 2B31A 3NSXA 3L4UA 2FDMA 5A8NA 4GZIA 2GFTA 1OIMA 5FIPA 3OB8A 3FXYA 4OUEA 5I79A 4PMVA 3AXIA 2XTKA 2WSPA 1H0IA 5CQ1A 3ZO9A 2YBTA 1UD4A 3BCFA 4F79A 2E9BA 4ZENA 4AD2A 2CITA 2DIEA 3QGVA 2XVNA 2BHZA 1UR0A 1PZ3A 5M03A 1LQ0A 1UQYA 4L4PA 4W85A 4Z2GA 2DT1A 3WUFA 4D6GA 1EDGA 1VEPA 5A94A 2DSVA 3NDZA 3AI0A 2EEXA 2VX5A 4IISA 1UR8A 1NP2A 4V2XA 2YL9A 2BVYA 1OCQA 3RDKA 3N12A 2OSYA 5AY7A 4E2OA 4AYSA 1MQRA 1SR0A 3AMCA 3AYRA 4QAWA 1BFNA 3IAQA 1KXHA 1WCGA 3AS3A 3T0BA 4EK7A 4CGTA 3NSNA 4LXFA 4S3KA 1H5VA 5HOSA 3UEQA 3RPMA 3VOCA 1BAGA 1QNSA 2WVUA 2ZUWA 1KGWA 3FHAA 3BMVA 3MV01 3L4YA 5I77A 2OYKA 4BS0A 4OOZA 5CJ5A 1ESWA 1VFFA 5CPQA 4L4OA 4HOXA 1GHSA 1KR0A 4PTXA 2OWCA 1KXTA 1J0IA 3NDYA 4HMCA 1EQCA 1I1XA 3A3HA 1PX8A 2CXGA 4XZWA 3W37A 1GVIA 5CSUA 3ARVA 1HF6A 3AS1A 4J28A 4UQAA 3SCNA 5DF0A 4EAMA 3AZSA 5DT7A 3WDQA 1GONA 1FA2A 3MS8A 1BVNP 1SFSA 3G6MA 4JCMA 3ARYA 1HJVA 2YA2A 3WENA 4D6JA 2E0PA 1KGUA 2WXDM 4QCFA 2DSZA 4CN6A 3WF2A 4AD4A 4CCCA 3TTOA 3EDKA 3BLPX 5C70A 1ZBKA 2XSAA 3IANA 4CD8A 4ZE5A 3ZR6A 1UKOA 2O9OA 2J47A 3KWXA 4JFWA 1GORA 1UD3A 2MANA 1FOBA 4ACZA 4N0RA 4FK9A 5ECUA 1C7TA 1CGVA 3VIHA 1U2YA 1AVAA 3OIHA 1ODUA 3GBEA 3MUY1 4J3WA 4R27A 4U31A 1BTCA 2WHLA 4MB3A 3VUPA 4D71A 5GNZA 2VUYA 4Z2LA 3CUFA 3WEOA 2ZX9A 5ABFB 5A95A 4GZEA 1UWIA 1CECA 4P7RA 1E6XM 4NI3A 3W29A 4W8LA 3OA5A 1JL8A 5BRQA 1D2KA 1IZKA 3PZUA 3UERA 2PB1A 2ZXDA 2XVKA 1RP8A 3T09A 1OT1A 3ZSSA 1AMYA 5I2UA 3WNLA 3W26A 4BF7A 3SUVA 4UZUA 4CN4A 1HXJA 1CWYA 1H49A 1NWUA 5FL1A 2WHMA 3K4DA 4NZCA 3KL0A 3WDRA 2WMKA 3TTYA 4HTYA 3L4WA 1W91A 2WC7A 1OGBA 1WZAA 1QHZA 4P8VA 4Q22A 3AOFA 4PRWA 3WUGA 1P6WA 1JF5A 3I3DA 1HVXA 2QV4A 1OBAA 4FLRA 1MWOA 5JBFA 1ZBWA 1JNEA 5DT5A 1V08A 1DTUA 1CPUA 2GJXB 4LQ1A 1ISZA 1GNXA 3W81A 3WF4A 4AIEA 2GJRA 1KB3A 2A3BA 1JZ5A 2FGZA 2QPUA 3ARPA 2VR5A 1BPLB 3RIKA 1JXKA 1UOKA 2G3JA 3CMJA 4N42A 3VM7A 1ZJBA 1JYVA 1VAHA 1TG7A 3BAJA 3WELA 1OSEA 2GVYA 4LYQA 1BGGA 1VBUA 2VTFA 3PZIA 3W0KA 1E4IA 3VILA 1EOMA 1KR1A 3WF3A 2VR4A 1MW2A 4GO8A 1GOWA 4BCEA 4AIOA 1B9ZA 3SCPA 3N15A 4AZ5A 1HP5A 2OYMA 4QP0A 5BXPA 3ZJ6A 3T2QA 3UESA 3ZR5A 2XFFA 3QHMA 4KGLA 1D3CA 5BCAA 2GDVA 3VGFA 1MW0A 2XG9A 2YA1A 4OBSA 3MSDA 1E4NA 2CPUA 2YDSA 1RP9A 2ZICA 4NSBA 1KWKA 1J9YA 1GQLA 1BYCA 2D23A 2VX7A 4KWUA 2VT0A 1DEDA 3VD3A 4QLJA 3ARRA 1VJZA 5BYWA 1CLXA 1EHAA 4JFUA 1GQJA 1UWSA 4PBGA 1GUVA 3VD4A 4UR9A 1E71M 2JE8A 5ABEA 3WQ4A 1V3IA 1C92A 4UQEA 1J01A 2CBIA 3VMOA 1WO2A 1Q6CA 3WFZA 4HU8A 1CBGA 4B3KA 2DIJA 1Q6GA 3VM5A 2A3AA 2OLHA 4V28A 4QDMA 2Y4SA 3VIIA 4AZGA 3VGBA 1IZJA 4F66A 3BGAA 7A3HA 3GNOA 2PBGA 4P7NA 3W28A 5A6AA 3ZMRA 4W7UA 1XV8A 1JAEA 5JUVA 3MU7A 4AW7A 4BQ2A 2X2YA 4HMEA 4H8UA 3WNPA 5E6ZA 5GQBA 5A69A 2VMFA 3PZOA 2A3EA 4W89A 4YHEA 4AMCA 3VGHA 4GPNA 4AZHA 4W5ZA 4D6HA 1H0GA 3WH7A 4PMYA 5D4YA 8CGTA 3WNNA 3CUHA 3AIVA 4DWSC 3MMUA 1V02E 2J78A 1H2JA 1VFOA 4PCTA 2XUCA 2VL4A 3ARQA 5KZ6A 1H1NA 2WANA 3DHUA 1TA3A 5CSYA 3ARUA 3PZGA 3BAXA 7CGTA 3TTSA 3WN6A 4CD5A 5C8BB 4WKAA 1I75A 2ZIDA 3UG3A 1XYFA 5BROA 3VGEA 3GNPA 3SUSA 2D0GA 3FAWA 2WBGA 1NH6A 5A2BA 4MADA 2G3NA 3T2PA 4AD5A 4OOUA 2ZXAA 1QI0A 2GK1B 5FD0A 1KCKA 1OIFA 2UY3A 1HNYA 1MW1A 1GJWA 4AD3A 1B3WA 1H4PA 1XCXA 3DYOA 1FHDA 1JZ6A 4P7LA 3AIBA 3UR7A 2YBUA 3VIPA 4YPJA 1GOKA 1EHNA 2E8ZA 3WMCA 3ZT5A 4UFHA 1W3LA 4UFJA 3EMZA 1B2YA 5CXPA 3IAPA 3NSMA 1QNRA 4FF5A 1AQHA 1J0JA 1HVQA 1TVPA 3A4AA 2IXVA 2JFEX 2RGMA 3FY1A 1FH9A 5E0FA 3M6DA 1JIBA 5E9AA 4TX6A 4M29A 2WLZA 5CPSA 2EJ1A 2J62A 4M1RA 1H09A 4AZ7A 1QNOA 3VX0A 1CXFA 5CZKA 2BFGA 1U33A 1G5AA 2E4TA 3MUZ1 4ACYA 2PWHA 2J79A 1TR1A 4C7FA 2CBJA 3LPFA 2DPEA 4HPGA 4W8BA 4ZE4A 3AZRA 1ODZA 1S46A 5I0DA 5A6KA 3AFBA 2XJ7A 5A6MA 4IUGA 2CIPA 5EBAA 3GH4A 3VD7A 5A8QA 4M24A 3U7BA 2X8RA 2YDQA 3VX1A 1XGZA 3AIWA 2JALA 3SIMA 5M5DA 1HL9A 2A3CA 1W9XA 3N11A 2VQUA 5LA1A 4GXPA 1BYAA 3WUEA 2DDXA 3VD5A 3T2OA 2DH3A 1E0VA 1NWSA 1FHLA 1DWJM 2W62A 1UR9A 2HVMA 3W4RA 1GW1A 2O9PA 3GXDA 3VU2A 4JL2A 4LX4A 3VIOA 4HMDA 3VINA 1QNPA 5IFPA 1MXDA 5A2CA 1E0WA 2G3MA 4LYRA 4CU6A 1E9LA 1C93A 3K4AA 3I3BA 4J27A 3PN8A 3ZQ9A 2E40A 1KWGA 4TUFA 1V6XA 3SUWA 1ITCA 3CH9A 2WVVB 3PHAA 1WDPA 2VZOA 1LWHA 1Q4NX 1XH2A 1UWUA 1Y7VA 1CYGA 2BV9A 2D3LA 2BXZA 3SCTA 3SURA 4JZ5A 4F9DA 3N17A 2O9RA 2V3FA 4OIFA 1WB0A 2CBVA 2XM1A 1LLOA 1MVYA 1SMDA 2WW5A 3FHQA 4RE4A 9CGTA 1W9DM 3RM4A 4CUCA 4XV0A 1PPIA 4KH2A 1E3XA 4QFUA 4AD1A 1ISYA 3QOMA 2FGLA 4Y7EA 4HZ8A 3KL3A 2WBKA 1M01A 3DYMA 3K8MA 5LA0A 4IPLA 2JEPA 4BQ4A 2VVNA 3AXHA 1FFRA 3W82A 1HJXA 2J25A 3OBAA 1DP0A 3AYSA 3NUKA 1Q6DA 1E15A 3IJ8A 2XIIA 4B9YA 3WH8A 2WSKA 1UH4A 2D2OA 4FLOA 4TVCA 4UZSA 1EDQA 2J74A 2NSXA 1XD0A 4PMQA 1N82A 1QBBA 2VCCA 3SCUA 3NYDA 3M46A 1CXHA 3FN9A 4P8UA 3ZIZA 5CGTA 3L2MA 4OBRA 2DT0A 3BLKA 3GXIA 1CNVA 1QNQA 2J8GA 3CLWA 4BQ5A 5I78A 3W24A 4QCEA 3WDHA 4R5EA 1ZBVA 4U5IA 3THCA 4AWEA 5ABHA 1B31A 1JFHA 1XRVA 4EE9A 3SEPA 1H3GA 2V5DA 1V6VA 3D5HA 1HJQA 1DWIM 1BVZA 4WKHA 1TCMA 2D3NA 3ALFA 2WPGA 4CD6A 1JDDA 3MV11 4D1IA 4JFVA 3BSGA 3L4ZA 1G94A 1VIWA 4Z2HA 1J0HA 3VDCA 5A1AA 1WDQA 3KEHA 1OWQA 1UWQA 2XWEA 1HJSA 3F5LA 3VDBA 4H2CA 5HPOA 2NW0A 5IFTA 3O9NA 3CHDA 5JIWA 2ZWZA 4GI8A 5D9NA 4CD7A 1NP0A 4X9YA 3UG4A 5BXRA 3FW6A 4IM4A 1FP8A 5KEZA 5M17A 4U3AA 1VEMA 3L2LA 1KFWA 1UKQA 3BSHA 3ECQA 1PX3A 1F4HA 4GKLA 1GOMA 1NOFA 2IXUA 3RM9A 4MJ2A 5D8WA 2X05A 2PC8A 1NM9A 3O6AA 2WCAA 5BXTA 3NJ3A 3IJ7A 4UTFA 3U7VA 2QMKA 2ZXQA 4PEEA 2WCGA 4IPNB 1VFMA 4HOZA 1EQPA 2YIHA 3N04A 3SCVA 2J77A 2ZX7A 1WP6A 2PF0A 4JKMA 3B9EA 2J75A 1RH9A 3GH5A 4DUWA 1WAWA 1GOQA 4WK9A 1J12A 1OB0A 5BRPA 1CGUA 2WC4A 4M80A 2FHBA 3ARXA 1CENA 3LPGA 2WMIA 2CNCA 2ZUMA 2XGBA 2VCBA 4AZCA 1HJWA 2EQDA 3WF1A 1XYZA 1E6NA 3OZOA 4MDPA 2X0HA 1WZMA 1MFVA 3S2CA 1KBBA 1UA3A 1R8LA 3CZKA 5HBFA 4MB4A 1CEOA 3AXXA 4JL1A 3VIMA 4DWSD 3D3AA 3WEZA 1AQMA 1UWRA 1JGIA 1HKJA 3WL0A 2O9TA 2YJQA 2D0HA 2WWDA 1E6PA 2ZUTA 3IJ9A 1JD7A 1E1EA 1C8QA 4PMXA 2PI6A 3PZQA 1UZ1A 3PTMA 4P7OA 3ARSA 3WDJA 1V6UA 1X6LA 3WDIA 5GNYA 5IHSA 4ACZB 2C8NA 5BWFA 3W6LA 5FKYA 3TONA 4MB1A 3CHCA 4E8CA 2YOCA 2GDUA 1BLIA 1E40A 4OZOA 3RILA 2EBNA 1MFUA 3SCQA 4HA1A 2WK2A 2AMGA 4Z2KA 2WHJA 1B3YA 1QI4A 1U30A 1NOWA 2WMFA 4GQRA 3DC0A 4JCLA 1UR4A 3ZSTA 1OINA 4ML4A 4AC1X 4B15A 3BCDA 1C7SA 2ZE0A 2CETA 1VFUA 2C7FA 3WKZA 1US2A 2XFRA 1QHPA 2WVSA 2D1ZA 2VZSA 2A3HA 2J7HA 1B0IA 3AIRA 3PTQA 4PTVA 2EPNA 3F5JA 3BMWA 1BGAA 3WQWA 3CUJA 4AZ6A 1NOUA 3AIEA 4W7VA 3CTTA 5C71A 4DWSA 1BG4A 4M56A 1UD8A 1US3A 1HJUA 1MW3A 1EA9C 1XSIA 3MANA 4UFLA 3EDFA 3SCRA 4CVWA 2FHCA 2QHAA 2XPKA 3HU7A 4JKKA 3WQ6A 3MUAA 3UCQA 1EIBA 2V3DA 5E70A 1DWAM 1V6WA 2AAAA 2DEPA 2BY3A 4PMNA 1LL6A 1ZS2A 4FLSA 3CPUA 3WBEA 1FH8A 4W84A 2HISA 1GQIA 3CIVA 4U3CA 1F4AA 4PUDA 1B1YA 5JBEA 4JFSA 1UHVA 1BYDA 3JUGA 3QR3A 3WNKA 3VMPA 3M07A 1GJUA 3CO4A 1V3HA 5DO8A 2DSUA 1VRXA 4CCDA 3TA9A 3GBDA 2JEQA 1E70M 4TX8A 2X09A 4J3XA 3I3EA 1E6QM 1C90A 1KQYA 4QLLA 1SYTA 2ZUNA 1KCLA 2BY2A 2DH2A 4CU8A 4GI6A 3GNRA 1JF6A 3WUBA 1CXEA 3KL5A 3WMSA 2NT1A 1QI3A 4DUXA 3WD4A 2G3IA 3U5YA 3MUIA 3EDJA 3WNMA 2G41A 2J8FA 5M3WA 3WQ8A 2UY4A 2VX4A 4AZIA 4TVUA 2YKKA 3BC9A 1E1FA 1LF1A 2GUYA 1ITXA 1M7XA 1J18A 3WD0A 3QOKA 3BXWA 2J7DA 2CERA 1VJSA 3VD9A 2XVLA 2YA0A 2YLLA 3OGVA 4UQBA 1EH9A 1XHGA 1PIFA 2BXYA 1CGYA 3VTRA 3WD1A 4U33A 1UD2A 4H8VA 3CUGA 2ZUSA 4UCFA 4ZXOA 2VX6A 1W9PA 3WSUA 4TXEA 1A3HA 3AROA 3WEMA 5AYIA 3ZT6A 2WMHA 1V3MA 3CBWA 3MO4A 3WH5A 1QW9A 3ZJ8A 1EO5A 2WKLA 1OT2A 2WVTA 4XX6A 1MYRA 1J0KA 2X1IA 3S6TA 4UOZA 1UKPA 1PZ2A 1V3JA 1R85A 4PSRA 5FOOA 1K9FA 4WJXA 2D20A 3AJ7A 3W25A 1XSKA 5I6SA 3ARTA 3RCNA 2V38A 2W61A 5DMYA 4K68A 5DFAA 1B3VA 4AZBA 5TD4A 5FCZA 1K9DA 1B90A 3WD2A 3N9KA 2V3EA 4MNJA 4CCEA 3FNDA 1GVYA 2Y2WA 2Z1SA 4GIAA 1WDRA 1DHKA 4OKDA 5GPRA 4D6CA 5I3DA 4WLCA 1TZ7A 4PMUA 1TA3B 1V0NA 2W4XA 1J0ZA 1FFQA 1E43A 3DYPA 3KZSA 1IV8A 4YN5A 6CGTA 3U5UA 1LL7A 2XSBA 4LGXA 3U57A 1W3JA 4MAVA 4AIUA 1XD1A 1JYWA 1E6RA 2QPSA 1W1VA 1OD8A 2NT0A 5A8OA 2J7GA 2G4FA 1HKKA 1ZBCA 1ZU8A 4UFMA 1JI2A 3CUIA 2EPKX 1VENA 2FH8A 2DSKA 2E9MA 5IXEA 1KGXA 2PBOA 3SUTA 3DECA 4XUYA 1JNDA 4UOQA 1ISVA 2ZOXA 3SCOA 4OJYA 4AXNA 4P8XA 4EKJA 4WSKA 1UH3A 1EDTA 3CHFA 3POCA 1EOKA 3AHTA 3B8SA 3MKKA 2CCRA 3QHNA 4A3HA 5I23A 1CTNA 3VIFA 1OD0A 3WQVA 5E6YA 2VRQA 1CLVA 2YLAA 1BG9A 2F8QA 3VGDA 3AS2A 2WCSA 1PBGA 3AMKA 3GXMA 5E09A 1R7OA 3GM8A 4UOJA 1PIGA 4C7GA 3AHXA 1V0MA 4JHZA 4JHOA 4KRTA 3TP4A 1UR2A 2BHUA 4Z2JA 1TVNA 3GDBA 1E3ZA 4KMQA 2FH6A 2VJXA 6A3HA 4H04A 2WMJA 5CLWA 5D9OA 2X0YA 4W86A 2WZEA 4PMDA 5A2AA 1R86A 3T08A 3GTNA 1M04A 3TTQA 1UZ4A 1W1YA 3VIJA 2EXOA 2D0FA 2XWDA 4RE3A 3W38A 1CXLA 4KRUA 5D8ZA 1ZL1A 2BVDA 1JZ8A 3L4XA 3AHYA 3A4WA 3K1DA 4WSJA 5JIPA 3RJXA 1W32A 3PTKA 2E8YA 1MQPA 2F2HA 2W67A 1HIZA 3OGSA 4AY1A 1EXPA 3CZ8A 3A6OA 2J7EA 1ISWA 2V5CA 3OG2A 3VO0A 1GCYA 4P7QA 4JFTA 5ABGA 3T0DA 1BF2A 1UYQA 2V3GA 2EO7A 3AHZA 4MNMA 1LL4A 2BNJA 3ZM8A 4KGJA 4RE2A 4UFIA 1OGSA 1X6NA 4PMZA 1L8NA 1E5NA 5ABFA 1UA7A 1GOOA 3L4TA 4X0VA 3WBAA 1FP9A 1B30A 1E5JA 1Q6EA 3GZAA 4MJ4A 1NWRA 4BQ3A 1QOXA 1AQ0A 2VI0A 1FH7A 1E56A 1GZJA 2PWGA 2IUZA 1CGWA 4NF7A 3ARZA 2ZUVA 3G6LA 2BY1A 1BYBA 4AISA 6TAAA 3LPPA 1E6SM 4PTMA 4PN2A 1KXQA 3W27A 2Y5EA 5AYBA 3EMQA 3O2LA 1XC6A 1JDAA 2ESCA 1G01A 1WKYA 2RGLA 1WNOA 2XYLA 4X0NA 3WH6A 2XGIA 1TFVA 1CIUA 3BAIA 4J3TA 4FLQA 4BA0A 1HP4A 1J11A 1JI1A 3SCWA 3VMNA 4AEEA 2E9LA 2GJXA 3A4XA 5EB8A 2J7CA 2XM2A 3HMCA 2O92A 2PWDA 1C91A 1HKMA 1W3KA 3AMDA 2OSXA 1W1PA 1QW8A 2DT2A 2WYSA 1J0YA 3CZJA 4W8AA 2WZIA 4HPHA 4D72A 2CBUA 3RM8A 1V0LA 3AQUA 3AS0A 1X1NA 1JFXA 5A3HA 1K9TA 5HDRA 3UG5A 5HXMA 1D7FA 1K6AA 4D6DA 2PWFA 2OYLA 2WHKA 2C0HA 2PWEA 1UD5A 2GJPA 3OLIA 3LPOA 4AEFA 3BAWA 3WH9A 2WM0A 1JG9A 3WDPP 3NIYA 1LWJA 4A4AA 1YQ2A 1DWGM 2J7FA 3BH4A 1QHOA 1E0XA 2DQXA 3FAXA 3E1F1 1PJ9A 1WPCA 3EDDA 2VQTA 4MNLA 1CGTA 3CZLA 2F61A 4D1JA 3VPLA 1W9BM 5EMYA 3ZJKA 4MDOA 2VC9A 2Q8XA 2Y8KA 2E3ZA 3EBVA 4XZBA 5D9MA 4LPCA 3RJYA 2DGAA 3EDEA 1XCWA 3OZPA 4MPKA 4NRSA 2G8ZA 1M53A 3ARWA 1GHRA 1JYXA 1G9HA 4UQ9A 4XB3A 2CKRA 2WLYA 5I24A 3RO8A 3OGRA 2VOTA 2BVTA 1Z32X 4ATWA 3QHOA 1UKSA 5A6LA 5CG0A 3AIQA 4HU0A 1NARA 4PMRA 4U2ZA 2VZTA 3CMGA 3K46A 1CXIA 4EANA 1EO7A 2OWWA 4W88A 1WDSA 2CHNA 7TAAA 3F5KA 3TOPA 4TOQA 1BSIA 2VRKA 4ZXLA 3SUUA 5IDIA 1R87A 2CKSA 4J7RA 5JBDA 4V27A 4ZFMA 4F9JA 1JXJA 2WKGA 1GOIA 1I1WA 1OM0A 1XSJA 2XHYA 4UQDA 3WFLA 4NRRA 2BS9A 1UR1A 4HA3A 4C7DA 3UR8A 1SMAA 3PZ9A 1E6ZA 2YL5A 2EPLX 3SCSA 1KXVA 2JF6A 2YL8A 3CHEA 2WNWA 1L0PA 2EPOA 2VNCA 4PYSA 3UETA 1UG6A 2ZX6A 3APGA 3W6MA 5IHRA 5GNXA 2CESA 2W91A 1UWTA 2ZX5A 3WD3A 4J3VA 2JIWA 4HOWA 5AC5A 2XIBA 2WMIB 1ZJAA 1MXGA 4AZCB 5AC4A 3B9DA 3AIUA 1PEZA 2XFYA 3T0AA 4H41A 4PTWA 4WIWA 4W7WA 1M03A 1QPKA 1TUXA 1EGZA 3AICA 4D6FA 1CDGA 1OGGA 1E73M 3ALGA 4UFKA 3HJEA 3ZOAA 3GYCA 5A8PA 1JYNA 4U5KA 3VVGA 2WB5A 5CLTA 4B3LA 1MQQA 1DWHM 1O7AA 4WKFA 3VDAA 1DWFM 2WAGA 3EMCA 2W5FA 1ECEA 2OSWA 1G0CA 1H11A 3J7HA 8A3HA 2VCAA 1H41A 2GK1A 3K8KA 4B9ZA 5LA2A 1CZ1A 2W63A 3N18A 1LG2A 4ATDA 4CKQA 2YDRA 1IT0A 1K9EA 4DM1A 3POHA 5EFFA 3AMGA 4URIA 1HKIA 2UY2A 1CGXA 3N13A 4JIEA 1HT6A 3KE0A 4CU7A 4DUVA 2QF8A 2J4GA 4YHGA 3OLDA 3HN3A 2JF7A 1V3KA 2W66A 1W2PA 4D6EA 4CD4A 4W93A 1JZ4A 3II1A 4RL3A 2JIEA 1W3HA 3THDA 5FL0A 2VZVA 1HL8A 4GO9A 4MNKA 1A47A 2XVGA 2WC3A 3GH7A 2QMJA 1PAMA 4Z2IA 4LYPA 1KQZA 3WNOA 5I5RA 5HPCA 4MAZA 5A8MA 4PSPA 1VB9A 1O6IA 3WQ5A 4DM2A 4CVUA 4D6IA 3L4VA 1JZ7A 1B3XA 4MB5A 4DWSB 2WZHA 1ZB5A 2XVPA 3N1AA 1PX4A 3BAYA 3MSGA 4E4PA 4H8HA 1WE5A 5A6SA 2OWXA 5LYRA 1V03A 4Q7NA 3EYPA 1TMQA 2W92A 3WMBA 5A6BD 3AMLA 1V02A 3K8LA 1WZKA 2YL6A 2BY0A
chains in the Genus database with same CATH superfamily
3UCDA 4AIBA 5E0CA 4PUNA 2PU1A 1Q7QA 4GYFA 4XD5A 3QYSA 4DJFC 1YLVA 1JZ3A 2DV0A 3AUOA 3AISA 3VKKA 4FXSA 1S1RA 3MMDA 5DY2A 1E4MM 4NAFB 2ATSA 3UYIA 1TV2A 2DZWA 3GHUA 3LCLA 4BK9A 1QVBA 5H6HA 4HNLA 4BZYA 4EAYA 2H6RA 4FIQA 4GI9A 1UD6A 1LJYA 1EYWA 4O12A 1UP3A 4L64A 4OECA 4ZOEA 1NDVA 3VNZA 1XH1A 3VIGA 3T8LA 3UJ2A 4FMVA 3VCRA 1QI2A 4QLKA 4L1WA 3NZGA 4F8XA 3JR2A 1HKWA 4DPQA 1NWTA 3B9AA 1JJKA 1W1TA 1XC4A 3PBGA 4GYPA 1O95A 2YCLA 2C1GA 2ATMA 4JD4A 1X8FA 2HK0A 4B90A 1VFLA 3GRIA 2P3ZA 3QFWA 3R5EA 1QI5A 4MTVA 3MMWA 4JKLA 1QR7A 4NKCA 1K8CA 1RXOB 3UVIA 4NAEB 1ISXA 1YHTA 5CPLA 1RCOB 3L0NA 1UQZA 2TMDA 1AW1A 3CTLA 2DSWA 1OC5A 3L0GA 4WF7A 2B81A 1J10A 3VCCA 3NM3A 5D9PA 3OQEA 3GIQA 4CEXC 4XZHA 3RX4A 4GX8A 3GVQA 4PE8A 2ZWYA 2C15A 1T7LA 4LS1A 3DHPA 2UWFA 4HNUA 4YCOA 4GX9A 3SDOA 1EJTC 1MSSA 1LBLA 2VD8A 3A23A 2VRJA 1RD6A 3PFMA 4KPLA 2VVSA 3E2QA 3LCWA 3LRLA 4JTHA 2I5QA 1FWTA 2NXIA 3KOFA 1Q13A 3R79A 3SGZA 2DORA 3E9AA 4K39A 2J7BA 3W73A 2B31A 3NSXA 1KM2A 5DQPA 5DLCA 3EAUA 2QS8A 1PYFA 4GZIA 4QNEA 1OIMA 3OB8A 3R94A 4HK5A 3UJRA 4GBDA 3ZO9A 1EGVA 2P5NA 1YXDA 3IJIA 1CI1A 3BCFA 3W7CA 2CITA 3SQMA 4HYRA 2HPMA 1TPVA 3P8JA 3R11A 1XLCA 2ACSA 3CQ0A 3PVFA 3W3OA 3CEUA 4Z2GA 1DJHA 3FEMA 1TMLA 2FFCA 2QUMA 2XISA 3G1DA 5AVNA 1OC6A 4X60A 3RDKA 3N12A 3AMCA 3FA5A 4US5D 2XN1A 1BFNA 1WCGA 3EKLA 3T0BA 2JKAA 4S3KA 3DFNA 1JCNA 5HOSA 5C2CA 3T9PA 2ZUWA 3QSRA 3BMVA 3L4YA 5I77A 1L6GA 4TV6A 2OYKA 1ESWA 4HHHA 4L4OA 4HOXA 1KR0A 2PGRA 3MI3A 1TVLA 4NX5A 1PB0A 1J0IA 1XDLA 1VR6A 5J5RA 2IPGA 4I5XA 3HO8A 2GOUA 4NP7A 3KVKA 2MNRA 7REQB 2DZBA 1QK2A 4UQAA 1BF6A 4O8RA 3SQLA 2OELA 1KW1A 4FNRA 3DXIA 3SZ8A 1P0EA 2CLMA 3WDQA 4XO7A 1GONA 3CIWA 1BVNP 3G6MA 2INEA 4E2BA 2Q01A 4M3PA 4X63A 3ARYA 4ZODA 1F6KA 1HJVA 1XFCA 2C0AA 2OCZA 1TTJA 4Y9PA 4DJEA 3QR1A 3WF2A 4AD4A 4DY1A 5C9RA 1ME9A 5C70A 3EOOA 1Y0EA 3ITLA 1UKOA 3MP5A 3T4CA 3ZVIA 2J66A 3TFXA 2EG7A 3I4EA 2RDUA 1ODUA 3ABOA 2DZVA 2WKJA 2QJJA 2WHLA 1OF6A 4JS3A 3CUFA 5C7HA 2PP3A 5ABFB 5A95A 4LV9A 4P7RA 4MZYA 3WK1A 3GB6A 1IZKA 3HPZA 1R2RA 2QAFA 1RP8A 4ERIA 3PNUA 5I2UA 4DO7A 4BF7A 1GJPA 3JS3A 4RNFA 1NWUA 5FL1A 1XI3A 2I1OA 2NUWA 1P48A 4HNOA 3UNTA 2YXOA 3L4WA 1Q85A 2NQ9A 3W1QA 4IGHA 2EGZA 4PRWA 4Q8TA 1P6WA 2PDIA 1H61A 3DN5A 5MKGB 3I3DA 1OBAA 4FLRA 3KRZA 5JBFA 3O6DA 5CSRA 1V08A 4IT1A 5I3IA 4ML9A 3W81A 3WF4A 1EP1A 4JTQA 5AYYA 2P3EA 3VNMA 2DUAA 3WO8A 3GC2A 2VR5A 1UPMB 1RK6A 3RIKA 3B05A 1TG7A 2NX3A 3EEGA 4QGCA 4UR7A 4RLIA 5I06A 3S9IA 3NR0A 3M6YA 3T44A 4AYGA 5K3VA 1SJAA 1EP3A 1KR1A 1Z44A 3WF3A 1JPHA 4XBJA 3WCZA 1XWYA 1FKXA 1GOWA 4BCEA 4AIOA 5TF0A 2CZFA 3W7IA 1YPIA 2PS2A 5I3GA 2YCIX 3VZZA 1HW6A 4QP0A 4DXVA 3ZJ6A 3ZXWA 3ZR5A 1P0DA 1PKMA 4FXJA 4O8AA 1E1CB 1KNWA 3BDKA 1P1MA 3N3TA 1YX1A 4MVAA 4A3QA 1XBXA 1Q5MA 1MW0A 4F0SA 2YA1A 4OBSA 3WLNA 2E6FA 1RP9A 2ZICA 5LNRA 1GQLA 4QJ5B 4AAJA 3S9ZA 1BYCA 1M5WA 1WKDA 3VD3A 1PCKA 4QLJA 3GUWA 3P3BA 1XLJA 2HRWA 4B4FA 5BYWA 4ZCWA 1EHAA 2NXGA 3VD4A 4UR9A 4IFKA 4LT9A 3UXLA 4UQEA 2CBIA 1D7KA 1Q6CA 1TRDA 5HNUA 3VOGA 2ZZ4A 4F0LA 4B3KA 2DIJA 1Q6GA 3V75A 3IS4A 1M7JA 3URNA 4V28A 3CASA 3NQGA 4PRRA 4QDMA 2BLEA 3N73A 2FIQA 4AZGA 4C90A 3PUOA 1IZJA 4S1FA 2HWGA 3XIMA 3BGAA 2YXGA 4H2HA 2HNHA 4W7UA 1XV8A 2IPWA 2HS8A 5JUVA 4UMAA 4XZMX 4AW7A 2X2YA 4K7YA 2C1IA 4HMEA 2E28A 2PC4A 4BFAA 2VMFA 4ADUA 1VHNA 4W5ZA 4O1BA 3WH7A 3NOEA 5JVLA 4F2BA 3NEHA 4H8NA 3CUHA 4GACA 3AIVA 1PO9A 2QKFA 3E2RA 4UBPC 5DMLA 1UIPA 2VFFA 5AHMA 3MMUA 5HMSA 3K5XA 1FWFC 1H2JA 5AFDA 2VL4A 3FVMA 3DHUA 3U4FA 4DWDA 3ARUA 3PZGA 3QV7A 1F9CA 3BPWA 4G6CA 1MEHA 2BXVA 4CD5A 4WKAA 4IH3A 4RXGA 1XYFA 1D9EA 3KCJA 3GX9A 5LNWA 3GG8A 3FAWA 3APTA 1AUSL 3UY7A 2WBGA 4QHRA 2Y7DA 4J3ZA 1NIUA 4NNBA 1Y8BA 3P62A 3C61A 4RDVA 4C1NA 5FD0A 5CC5A 3CO8A 1OIFA 1SGJA 3W7EA 2PDFA 3OZMA 3WQEA 4LNCA 4JTSA 1H4PA 4O0KA 4FALA 4XKMA 3RX2A 4P7LA 1TIMA 4NILA 3AIBA 3TMQA 3IGHX 3GNXA 2YBUA 4YPJA 3FEQA 1GOKA 4J35A 4LUIA 4EF9A 1EHNA 4A3UA 3EMZA 5CXPA 1FX6A 3WMLA 1T99A 4DBUA 2ZRXA 1TPFA 1TVPA 3A4AA 2JFEX 3T0TA 3FY1A 1GZ1A 3U2EA 1EUAA 1H1ZA 2H90A 5CPSA 2PRLA 2PTYA 4BJHA 3BG9A 2Y7EA 3LA4A 1H09A 2BOGX 3LI1A 1VYPX 1U33A 4ASTA 1G5AA 2E4TA 2BGSA 1VH7A 4W8BA 1Y5XA 5A6KA 1QW7A 5I0DA 4QEEA 3A3WA 3BO9A 1CB7B 3N3MA 5EBAA 3GH4A 3GTIA 2HE5A 4N9CA 2XH7A 5AHLA 3SSZA 4I90A 4E38A 4R3UA 1HL9A 5LA1A 1W9XA 3W02A 1TPB1 4JTAA 3T2OA 2DH3A 3NPWA 4PFMA 3UF9A 3HGRA 1FHLA 3VKAA 1TPDA 4H19A 1Z9AA 2O9PA 4FNSA 3GXDA 1XFBA 4XK2A 3K13A 4HMDA 1SO4A 3QF0A 3RLGA 1REQB 1GKRA 3MWCA 5FSEC 3PN8A 2I17A 1KWGA 4TMBA 1NVMA 2OPJA 2WVVB 3PHAA 3E0IA 3ITOA 1UP0A 4GYPC 2VZOA 2Z4GA 1LWHA 1XH2A 1CYGA 4JIPA 1MEIA 2JK2A 3PBYA 4QDWA 1AL8A 2NQZA 5EBUA 3FYYA 3AALA 3IJDA 4OIFA 4E2DA 1MVYA 3PR2A 1BRLB 3H6OA 7TIMA 1XF0A 2QUTA 1ISYA 4PODA 1VRDA 3QOMA 2FGLA 4Y7EA 1X6UA 3S8HA 3DI1A 3OVGA 3CQKA 2WBKA 2YFOA 2VVNA 4LCRA 4LALA 4QRNA 1VQTA 1NELA 3GK0A 2PLCA 3O16A 3OBAA 4I9MA 4HHMA 4NX0A 3NUKA 5XINA 2WZMA 3S46A 2PP0A 4GHRA 4GLEA 4Z17A 3NYDA 3TEVA 3AYVA 1CXHA 1W31A 1ZALA 2J8GA 4MWAA 3CV7A 4BQ5A 5I78A 3M0ZA 1PHWA 1YXCA 3C2VA 1ZBVA 4AHPA 4AWEA 1RHCA 4GVGA 3CIXA 1XRVA 4PBFA 1H3GA 2V5DA 1PDZA 3WK3A 1BVZA 1TQJA 4WKHA 4PB5A 2BOFX 4CD6A 1JDDA 3VXGA 1X98A 4IGNA 3TNBA 1J0HA 5A1AA 1WDQA 3I4KA 3KEHA 2G50A 3VDBA 1A5BA 2DVUA 3O9NA 3W71A 4CD7A 1FXPA 1XLKA 4X9YA 1PCWA 3KTCA 2FZ9A 1F8IA 4RPPA 1BWLA 3CV2A 3V0SA 2CU0A 3H2CA 3ECQA 2IXUA 4H9XA 2ZTJA 1F6YA 2KZHA 4JX6A 3GNDA 4MJ2A 2CLFA 4HU4A 4D9PA 4X22A 2X05A 3K30A 1Z89A 3IJ7A 4UTFA 3NGFA 3U7VA 3QLLA 3UP8A 4UUIA 1A5NC 3C2OA 2ZXQA 4MJZA 4GG9A 1I2PA 4PEEA 2WCGA 4HCHA 2FJKA 1VFMA 3LOTA 3PAOA 1EQPA 1U1UA 3CQJA 5K4XA 5KITA 1MZHA 3H12A 3SCVA 4Q4PA 1WP6A 3LCHA 4YTUA 2PTDA 3B9EA 3GH5A 5I03A 1WAWA 1B54A 4FNPA 1K03A 3H23A 1OB0A 5BRPA 2WC4A 1DJGA 2FHBA 1PUDA 3R8GA 3QM3A 1CENA 4YWSA 2XGBA 2VCBA 4BEUA 4NL1A 4I9TA 4HBKA 3GG7A 2EHHA 3OZOA 1HZYA 3KBMA 3SR7A 4REQB 1KBBA 1ML1A 5LXXA 3PPFA 3P80A 3ELFA 3P61A 3D3AA 4B5WA 5FSDC 1JGIA 4DJEC 2QUNA 3OZYA 3SI9A 2QGYA 5EMKA 2D0HA 6REQB 4ICCX 2PI6A 5AKQA 3R13A 3WDIA 4LEQA 3W6LA 2DW7A 2NLIA 1EPVA 4E8CA 2YOCA 4Z1YA 1P6BA 1BLIA 5D05A 1A5KC 4OZOA 4HA1A 2AMGA 4UCGA 2WHJA 1B3YA 3QMSA 1U30A 4JCLA 3GTHA 3SN4A 1KFBA 3ZSTA 2RFGA 4ML4A 4I5RA 1ONWA 4Y6GA 5EMJA 4XZLX 1US2A 2PA6A 1HGWA 1XIHA 2QJMA 1XPYA 3W74A 2J7HA 1KM5A 1T8XA 3W1MA 3SRKA 4AZ6A 3TXZA 3FCPA 4RDZA 5C71A 4DWSA 1C29A 4M56A 1UD8A 1US3A 4KEMA 4G7EA 1HJUA 1P6CA 1XSIA 3TW9A 4MG4A 1S5WA 3EDFA 4R53A 3SCRA 4CVWA 5DCEA 1TTPA 4PC8A 4JKKA 1E9IA 1X1ZA 3LHZA 4HTBA 3UCQA 4A8RA 3U3HA 4PUWA 1UJQA 2AAAA 2BY3A 5ENLA 4FOKA 3OEXA 4UNLA 4HKPA 2HISA 4PUDA 3B0VC 4LU0A 3Q4DA 1Q7MA 3JUGA 3QR3A 3VMPA 4JQ2A 2Z2AA 5DO8A 2Q3OA 1EA0A 4K6AA 4WDXA 2IKIA 2OODA 2YW3A 3URAA 4ZQRA 4C6BA 3PB2A 4BWLA 1C90A 1KQYA 1M6JA 1TREA 1DE5A 2Y7FA 1KCLA 2BY2A 2DH2A 2IPFA 4GI6A 3TYCA 3WUBA 2BVWA 2QVNA 4NJHA 3SN0A 3WMSA 3WQPA 3TFCA 4Q8MA 4E5TA 2G3IA 3E2VA 1EJUC 3EDJA 3WNMA 3EZ4A 3HG5A 1O94A 5M3WA 3WQ8A 4TVUA 2YKKA 3NFUA 4HN4A 1ZP4A 2FPTA 2CLOA 4YTRA 1E1FA 3RG6A 2GUYA 1G7UA 3KTSA 4EP8C 3BXWA 3VUSA 3NZPA 4HVXA 2YA0A 4O28A 2AGTA 3N2MA 6XIMA 4B2DD 3IWPA 3M5ZA 3FA3A 2CZVA 3CUGA 2ZUSA 4UCFA 1YNQA 4NUWA 4Y9OA 3WSUA 3DIPA 3FJ6A 4G9PA 3TA6A 3BJFA 3AROA 1IXNA 3TQVA 3G0UA 3WH5A 3ORWA 4INFA 4R88A 1VFHA 3GR7A 3UU0A 1LT8A 4GFSA 3N6JA 1BTMA 3RCNA 3N29A 2V38A 2VXNA 2W61A 3W7MA 4K68A 4XZIA 5DMYA 2VC7A 1ONEA 1OFEA 3VZYA 1B3VA 3F2BA 3A4JA 1P7TB 5TD4A 2JBMA 2X7VA 2WQPA 2OZTA 2YYTA 1GYMA 1P0BA 1B90A 5CPOA 4G1NA 3N9KA 1YBQB 2Z1VA 5DRIA 1WDRA 1J4EA 4DYEA 5GPRA 4AU0A 3RK8A 3RR4A 3KZSA 1DOSA 6CGTA 2ZA1A 4JY8A 2XSBA 3MUCA 4LGXA 2FYMA 3M44A 2X30A 1W3JA 1E6RA 4FB7A 1W1VA 1W6TA 2NT0A 4LYKA 2J7GA 5A8OA 5F2LA 4MJMA 1AODA 1HKKA 3TAKA 3SFWA 5K7JA 2ISSA 4LUTB 3GY1A 3KP1A 2FH8A 3N14A 1I4NA 4XUYA 1YE6A 3MVIA 1V79A 1VBJA 4EKJA 4M5PA 4LBRA 4P8XA 1I0BA 4YCPA 1N8IA 4L6DA 1R9XA 2ACQA 2CCRA 4H6QA 3VIFA 1FRBA 3WQVA 5B7ZA 5HINA 5F2MA 2VRQA 2YLAA 1BG9A 4S3BA 5LKYA 3IVTA 3AS2A 2ZKMX 4B5SA 2YCLB 4C7GA 2XDFA 4HGXA 4JHOA 3U0HA 4IP7A 4KRTA 2OQHA 1A4LA 2BHUA 1E3ZA 2V2CA 2JKPA 2WMJA 2QDEA 3TAOA 5D9OA 3G1FA 3NVTA 2R82A 3GTNA 1XQLA 2EXOA 5G4HC 2V30A 4JOMA 3L4XA 3V1HA 1LWIA 3A4WA 3S2NA 4DF1A 1EBGA 1EPXA 1Z8AA 3R8RA 2I5GA 2E8YA 1TIWA 4AY1A 2REQB 3CZ8A 2RKXA 2XIMA 2ACUA 2J7EA 5J5DA 3A24A 4UTTA 2Z25A 3MJMA 2ASHA 3G0XA 3VO0A 3CQIA 2DZXA 4JTGA 5ABGA 2J8TA 3QZAA 4IX2A 4FNQA 4MNMA 1SFTA 3LNMA 3GG1A 5BW6A 3DAQA 1X6NA 4PMZA 1L8NA 1F3WA 1UA7A 1GOOA 2ZRVA 3RU6A 1FWAC 4JN7A 3G5EA 1XIEA 4MJ4A 4RZ6A 1LLWA 3R89A 1AZ1A 1QOPA 2PWGA 1EC9A 4O53A 3N2TA 5D09A 4S3GA 1L8PA 4AISA 3EWDA 2QDDA 3BJSA 1E6SM 4O17A 3W7KA 4L9ZA 4PTMA 1U83A 4AHOA 1KXQA 3W86A 1XIFA 1Y5WA 2Y5EA 3GKAA 1CT5A 3NYZA 4DF0A 5D37A 3EMQA 3IGXA 3O2LA 3R0UA 1JDAA 3M5XA 5PTDA 1WKYA 1TQXA 4H6RA 3L68A 1WNOA 3UG8A 1TFVA 2C14A 3UXKA 5C9XA 2Y1HA 1JI1A 3BJTA 1QPOA 3SCWA 3VMNA 1PKLA 3HMCA 1HO4A 1QK0A 1R6WA 3KVJA 1C91A 4EF8A 1NFGA 2OSXA 1W1PA 2YGYA 2WYSA 3CWNA 4KFNA 4Z0SA 4EWND 3MP4A 3MDUA 4Y8EA 3PBUA 4W8AA 2WZIA 3CL6A 3RM8A 3AQUA 5XIMA 3AS0A 3DFPA 1H60A 1YPXA 4N02A 1KV5A 1V93A 4LAKA 4IGSA 4QX4A 5HXMA 1R3QA 2WHKA 3JZEA 2VEPA 3S1GA 3MDWA 3UA3A 2X41A 3LXCA 2VOMA 3OLIA 3BAWA 1LYXA 3KBSA 4AUBA 3DFSA 3MHUA 1M9HA 3PP7A 3NIYA 4RV3A 1OFDA 1JULA 5HR6A 1YQ2A 1E0XA 3QPZA 1BWVA 1GVOA 2PD9A 3E1F1 4GYKA 5FESA 3EDDA 4N9DA 1TE6A 4MNLA 2VHLA 1CGTA 3E96A 1DIOA 4LS2A 4CNUA 3MA8A 3N2BA 1S5TA 5BZAA 3EDEA 1XCWA 3LS9A 2G8ZA 1M53A 4EXAA 3ARWA 3GXNA 1JYXA 2ZQ0A 3TW7A 3OGRA 2VOTA 3JVAA 4N6FA 2H9AA 3FK4A 1IWBA 1EF2A 3TC3A 3DKLA 5CG0A 4JTCA 3AIQA 4HU0A 2DZSA 4J9JA 4PB3A 4U2ZA 5G2HA 1JPIA 4HT3A 1CXIA 2P88A 1M65A 2QQ6A 2WM1A 1EO7A 2ISVA 5CPNA 7TAAA 2ZVIA 4TOQA 4ZXLA 4WUIA 1R87A 4JTLA 1I6NA 1VZWA 2J6XA 1SZEA 4GISA 4ORIA 5JBDA 3TH6A 4F9JA 7PTDA 4TMCA 4UQDA 4NRRA 4JPGA 4DO5A 1IR1A 3MSYA 1FWRA 3B40A 1LBFA 2EPLX 2Z26A 3CAKA 5AHIA 1L0PA 3UETA 3UXAA 4NZ1A 3MCNA 1TWSA 2PGWA 2VC6A 3BTNA 1PE1A 3L5AA 5HMEA 2ZC8A 5GNXA 3WD3A 4OE7A 4JTIA 5AC5A 2XIBA 4CQAA 3LLFA 1MXGA 3GAYA 4GABA 1NDZA 5AZ0A 1AQFA 2YDAA 3LRMA 4W7WA 1S3TC 3RLHA 4RV8A 1CDGA 1OGGA 1GTEA 1EP2A 3HJEA 3ZOAA 1G4PA 4H9YA 4LEFA 5A8PA 1FWHC 4RNIA 4ZFCA 4MKNA 1DWHM 2PP1A 2FB2A 3BG5A 1TV3A 4PMJA 4AFYA 3UT0A 3W1XA 1O5RA 4KWOA 1H41A 5CJMA 2GVEA 4B9ZA 1LOQA 2W63A 5AZ1A 2XH2A 1XJBA 2CZDA 2GOKA 1IT0A 1K9EA 1NDYA 3QMRA 3R12A 5E1QA 1VKFA 1HKIA 2Y88A 3N13A 2WJEA 2QR6A 3HQ1A 1EKOA 4K8EA 2QF8A 2HPIA 2ZDSA 2J4GA 1W3IA 1V3KA 2OEJA 3P81A 1I45A 1PZ1A 4CD4A 3LY0A 2JIEA 5JU6A 1UIOA 4KCUA 1V7AA 1HL8A 5AHFA 4JX5A 3UZWA 1A47A 3L23A 5DXXA 1OFBA 1XQKA 3IIXA 4YIWA 4GOAA 2QCLA 3HGOA 5I5RA 3ATYA 4IHCA 3BGJA 3DOPA 5HPCA 3M43A 4PSPA 1O6IA 4EIVA 4MB5A 3QJAA 1IXPA 1W0MA 2XVPA 3LGEA 1ICSA 4H8HA 3S2LA 1FCQA 2A7PA 2OWXA 1V03A 1YNPA 1ZGDA 3EWCA 3RITA 4UMBA 3WMBA 5A6BD 3AMLA 4GZ7A 2PGEA 4JN8A 4LW7A 2E6YA 4RZ4A 3Q37A 4QE5A 1OG0A 1V6YA 3PZNA 2ZXBA 4W4QA 2WWCA 4C6DA 3PWGA 3IJQA 2G95A 2CHOA 1B57A 5EFDA 3LQLA 1CXKA 3WIJA 2E5BA 4UNIA 3KP0A 4GH3A 1GT8A 4GQBA 1JCXA 1UKTA 4RPQA 1V3LA 3WF0A 4B92A 4LVBA 5D32A 1HN1A 3S2MA 3LM3A 2GSJA 1RBAA 5HNNA 1JZ2A 4H01A 3LMYA 1R3SA 1QWKA 3T8QA 3MWAA 3IK2A 2F84A 3AHVA 2TRSA 4Q8PA 4LV4A 3OLEA 2I14A 3ITCA 3V5FA 3D3FA 4QBXA 1GWJA 1GG0A 2TAAA 3RMEA 1BEUA 1VEOA 1TWWA 4CN1A 1O5QA 4TTUA 4B2DA 3BZJA 4L4MA 1T8QA 1AH0A 3RLVA 4DQWA 4HZ6A 3NQ2A 1J5TA 1IEQA 3H7RA 3N19B 1UH2A 1OADA 2B7PA 5CGMA 2F6KA 4CNTA 2VURA 3OBEA 3ZT7A 1DJYA 3PAJA 2Z24A 1SQ7A 4RZ5A 1XYAA 1LOSA 3ZVHB 2P0IA 3CZEA 2VEMA 4J3SA 2IMRA 2EPMX 4DBSA 4R9OA 2HBVA 5G2IA 3GO2A 3NO5A 4NJIA 4O18A 2Z00A 3HPXA 3T1GA 4K1WA 2V69A 1JD9A 4HZ7A 4A3YA 5B80A 1WUEA 3PZVA 2DT3A 1YPFA 3SN1A 4YWIA 3CGTA 1GKPA 4O1FA 4B5UA 1LG1A 3AZTA 5BXSA 4NNAA 2FDMA 1QXLA 3QZ6A 3CHVA 3FXYA 3E02A 2ZZ7A 5I79A 4NASA 4PMVA 3PUEA 2A4AA 3EPNA 3LB0A 1UP2A 1L2QA 5CQ1A 3CUXA 3V3WA 1H7RA 3VYLA 5EKYA 1UD4A 4GE8A 1XBYA 3GC5A 1XS2A 2DIEA 1TTIA 3VKCA 2NXHA 3CM4A 2XVNA 1I60A 3V0UA 2GQ9A 4FXRA 1UQYA 4W85A 3I7QA 1ZFJA 2V5JA 4X3ZA 1F8MA 3KHDA 3BOXA 4KETA 3TMLA 5REQB 2YXXA 1W5NA 3AI0A 2EEXA 2VX5A 3UWVA 1NP2A 4V2XA 2YL9A 1F74A 1OCQA 1ICPA 3L65A 3L7RA 1S1PA 5AY7A 3TQ0A 4AYSA 2I16A 3NPXA 5F1UA 3EWUA 4EK7A 1GKQA 3NSNA 1FHUA 4LXFA 3UR2A 4MZ8A 2OGJA 3N9SA 2WVUA 5C9ZA 3ITGA 1EYEA 2PWVA 3RCMA 1FCVA 5LZLA 1EJRC 1BD0A 1VFFA 5CPQA 1OCBA 1GHSA 4PTXA 1KXTA 2HSAA 3LK6A 4EXQA 1D8WA 2ZCGA 3EWYA 3NDYA 3S9YA 4DLFA 4LUSB 4XZWA 3DUGA 2EG6A 1GVIA 5CSUA 1AZ2A 4C6LA 1GG1A 1FVPA 2ANUA 3SCNA 1O68A 4AHQA 1ZHAA 5LSMA 1SFSA 4ORMA 5MF5A 5GJMA 1W54A 2X16A 2DSZA 4CN6A 3FSTA 3CUZA 2C91A 2H3DA 4UTTC 3EDKA 3TTOA 3W22A 4I7UA 3SRFA 1ZBKA 3IANA 3KHJA 2A3LA 1YTEA 2BODX 1GORA 1UD3A 3G1XA 3HM7A 4N0RA 1C7TA 3CAWA 2GVGA 1ZAJA 3VIHA 5DBTA 3ANVA 4C1LA 1W37A 4MB3A 3PANA 3VUPA 5GNZA 1ZUAX 3WEOA 2ZX9A 4GZEA 4FOUA 1CECA 3W29A 9RUBA 3LTSA 2NWSA 3HBLA 3M0VA 2PMQA 2PB1A 1OHLA 3ABRA 4H9TA 5EGRA 3ENLA 2XVKA 5CJNA 3ZSSA 1K3UA 3IVSA 4P61A 4ZQOA 4DZ5A 1FY6A 4LF2A 1HXJA 4Q8NA 1CWYA 1UW9A 1H49A 4RW5A 3K4DA 2X1RA 3AO0A 5JXQA 2WMKA 2Y6ZA 2B7NA 1WDWA 3VOJA 4FXFA 1WZAA 3KDOA 4Q22A 4NY2A 1GVRA 1RQBA 3QV9A 1JF5A 4ZB2A 1HVXA 3FKRA 1P5BA 1LBMA 1ZBWA 1JNEA 1ZJIA 4TIMA 1KM4A 1CPUA 3GXPA 4LQ1A 3LCGA 3DC8A 1JEZA 2QIIA 2GJRA 5ECVA 1M7PA 1KB3A 1JZ5A 2FGZA 4QISA 5H2ZA 3RAOA 4IICA 3ARPA 3HQNA 1OEPA 3G24A 2G3JA 3FGCA 2G37A 1NU5A 3NG3A 3VM7A 1VAHA 4Q33A 3CAQA 3WELA 3LV5A 1OX6A 3LHYA 4R7OA 9XIMA 1SVDA 3MZNA 4DUOA 6ENLA 3FA4A 3PZIA 3KM8A 1XYLA 1DORA 1EOMA 3SAZA 3OVRA 2VR4A 3HZ3A 3UWZA 4GO8A 4YVPA 4JIHA 3IIPA 1B9ZA 1RPXA 4TQTA 3SCPA 2VYOA 2VEKA 4KF1A 3HIJA 3WJYA 1UMLA 4WJEA 1MZRA 4EWJA 1XIJA 1G4SA 4KGLA 3STPA 4QS6A 1TJ0A 2INFA 3VGFA 5E9XA 2VWTA 3A5VA 2FZBA 3G18A 2CPUA 1KWKA 2OJPA 2QJIA 3LSBA 1AMKA 3INPA 1VJZA 4BKNA 1XYMA 4JFUA 3R58A 2DY3A 1GUVA 1CX9A 4EVZA 5ABEA 4Q4KA 3HA1A 1YYAA 4GGHA 2RDXA 4GY7A 2ZRZA 3WFZA 4HMNA 4EPDC 2Y4SA 3VIIA 4DJFA 2YCKX 4F66A 3IK4A 1FDJA 2HXTA 1ADSA 5FJOA 4FO4A 3PBMA 3JZUA 4BQ2A 2J9ZA 2XIJA 1IGSA 1S2UA 4H8UA 1WBJA 1FWJC 2W9MA 4C6FA 1F3XA 4XSMA 1XLEA 5GQBA 4C5ZA 1QDSA 3GDRA 4AMCA 3VGHA 1BKSA 4GPNA 2NQLA 2QUUA 2XINA 5AECA 3B0PA 1EJWC 3LXAA 4HCDA 2GQ8A 2J78A 3P93A 1LRTA 2XN2A 3TJ4A 2G96A 1OCNA 4Q8OA 4AH7A 3FDGA 5C8BB 3NQDA 4LSBA 2ZIDA 3GVWA 4DNHA 5LNSA 3LMZA 3QRHA 1YKWA 1JUKA 4CQ9A 2V0TA 1E51A 1NH6A 4GIRA 4DYKA 1I2NA 4MADA 3T2PA 3VK5A 1QI0A 4UTLA 5DBUA 3IIZA 5D02A 5M2FX 1MW1A 4FS9A 1GJWA 3DYOA 1JZ6A 3TNOA 1F2JA 1FKWA 1X38A 4GK8A 5J04A 1XXXA 1PIIA 1RY8A 1EBHA 4JTKA 3EWWA 1LORA 1W3LA 2ADAA 4AB4A 3H4XA 1R47A 1QNRA 3R43A 1HVQA 4QS5A 5FJUA 3LCXA 2RGMA 1FH9A 5E0FA 2E5CA 3M6DA 1JIBA 3L0KA 2OOGA 4M29A 3GDKA 2KX9A 3P74A 3UVAA 1KFEA 4Q8WA 3VI2A 4QSHA 4S23A 3SADA 3NTYA 3GHSA 4G56A 1XG3A 4KWWA 4GCAA 1ODZA 5C55A 4EPBC 2VUNA 3UZZA 4ZMGA 3LBCA 3MI6A 2XJ7A 3PWAA 2VGFA 4WY0A 3ATZA 2P76A 3CL8A 4UTUA 5KINA 3HMJG 2X8RA 1EEXA 4M19A 1WUFA 3AIWA 4TR9A 5M5DA 2A3CA 3N11A 4DAIA 3FOKA 2PDJA 2ZZ2A 1TX0A 3NL6A 2DDXA 3M0IA 4LTSA 3RLUA 3COTA 2W62A 3C6CA 4Q4QA 1L9WA 4JL2A 2BX7A 2BBFA 5A2CA 4ZQMA 2C16A 4WCJA 1E9LA 1C93A 4O4WA 3BW4A 1TSIA 3OG3A 4HK6A 2PRMA 4Z1AA 1V6XA 4NJJA 3STGA 3PSVA 1OX4A 1UWUA 3IGUA 4C65A 5K2ZA 2D3LA 3WLOA 3G2GA 3B4YA 3AAMA 3IARA 4JZ5A 4F9DA 3UW6A 2BOEX 4JYEA 2IQDA 1LLOA 3U2CA 4ILSA 3M0JA 3BE7A 1SMDA 2WW5A 3NEVA 3NO1A 3USZA 4CNPA 3GS6A 1PPIA 1E3XA 4Y9NA 1K7FA 3WQFA 1DQWA 2J88A 4I9JA 4JX4A 4L9XA 4HZ8A 2FTYA 5BMWA 1M01A 4I9AA 3GKFA 4BQ4A 4GWEA 2AKMA 4MY1A 1GQNA 4ZSTA 2J25A 3PB0A 4V15A 3REQB 3TCEA 3P2VA 1E15A 1GVQA 3IJ8A 3CMFA 4EPKA 3VNLA 3HG3A 2WSKA 1YMYA 4B91A 2AL2A 5AC8A 4TVCA 4ZO7A 2NSXA 3ZZ1A 2NUXA 2VCCA 4O1DA 4P8UA 2EKCA 4KFOA 1LRQA 3GXIA 3MI2A 3CLWA 2J24A 1JCTA 1PKYA 4WOZA 3PNZA 3UCCA 1H7OA 3H24A 3WDHA 4FX6M 1JFHA 2DUZA 3NOYA 1V6VA 5GJNA 4GXWA 1DWIM 4HPJA 4M1BA 1TCMA 4JIIX 1OABA 2D3NA 3ALFA 1YW1A 3MV11 4D1IA 2BASA 1J93A 3AXKA 3VDCA 4TX9A 5IOBA 3QW3A 1HJSA 4HU3A 3F5LA 3UZXA 4CCZA 4KWVA 3CHDA 1VIZA 4QE4A 2ZWZA 4K8HA 4OV9A 3QVQA 1TZ9A 2NV2A 3PWIA 4U3AA 2P53A 1VEMA 3L2LA 1KFWA 1WX0A 3CPGA 5FACA 2EF9A 4YXGA 2EJAA 1DQUA 4XZ9A 2VEFA 1PX3A 1F4HA 1FBAA 1GOMA 3QBUA 5I02A 3H7UA 5G5IA 1S5NA 5D8WA 3GVVA 2OR2A 5CZ0A 3TN3A 1IEXA 2WCAA 4HSOA 2FTPA 5HULA 2X40A 4QJ3B 1H51A 3W7OA 4O10A 2OTDA 3TKFA 1VD6A 3FS2A 2X42A 4LUJA 3RX3A 2OQLA 2J77A 3B8WA 2E5DA 4JKMA 1UB3A 2HS6A 2J75A 4IIBA 4DUWA 4WK9A 3QGAC 2X1TA 4NYUA 3B0UX 2XU2A 3QPYA 4E8GA 3ARXA 1SW0A 2WMIA 4AZCA 5FF3A 3QMTA 1UC5A 4GC3A 1XYZA 2J9XA 2VFGA 4S2BA 1A5UA 1FUYA 2P10A 2X0HA 1WZMA 4GNKB 4LAOA 1MFVA 1UA3A 5MHBA 2G5WA 4IXHA 4C60A 4MB4A 1LROA 3C4UA 1CEOA 3LGGA 3WEZA 4A2SA 1HKJA 4LB3A 1F3TA 2O9TA 1TB3A 2CLIA 5CC6A 3DERA 3IJ9A 3R0DA 1LQAA 4H3DA 4PMXA 3SGGA 1AFSA 3PTMA 3ARSA 5F2IA 1DXFA 3BZGA 2WSRA 4ACZB 5BWFA 3THAA 3TONA 2WNNA 3G1AA 1LUCA 4IPPA 4MB1A 3CHCA 4DJDA 2GDUA 3P0XA 1E40A 3SCQA 5HNTA 4DXXA 3HPSA 1H50A 1RR2A 1MRAA 1JRBA 1PWLA 2DZUA 1LT7A 1NOWA 2HDJA 1UR4A 3NDOA 3WFAA 3N34A 1HFBA 2NV1A 3BCDA 5C6MA 2ONEA 3O8AA 1C7SA 1VFUA 3O7UA 3WKZA 3NM1A 2NQJA 3BVJA 2WVSA 3WZ0E 4ZOCA 3PTQA 4PTVA 2DVTA 2EPNA 3BMWA 3QQ1A 5CCZA 3K1GA 1NOUA 3UPBA 1A4MA 4IP5A 2Z0IA 3EX3A 2WO5A 1A5LC 2IQ0A 4S3DA 2HE8A 4Y9AA 1C9WA 1GTHA 2Z28A 3WJWA 3B3DA 1K1DA 1NTHA 4DELA 3HU7A 3VAVA 2Q02A 3WQ6A 3MUAA 4KERA 5FJPA 1J79A 3C3NA 1M1BA 1EIBA 2V3DA 3H2AA 5E70A 1DWAM 4UWMA 5LIXX 2DEPA 4WOQA 4JTEA 5HWMA 1FH8A 4YVVA 4W84A 3CIVA 4U3CA 1B1YA 4JR5A 1BYDA 5CGQA 1C9DA 4NAFA 3CO4A 2YR1A 4H9UA 3QYQA 1VRXA 4CCDA 4L6HA 1E70M 3PJWA 4QDPA 4TX8A 4GXMA 3W7NA 2X09A 1Y5VA 5I00A 3I3EA 4KCTA 1MUCA 3H2NA 2GJLA 3MYOA 3GNRA 3WJZA 1K8XA 1ZY9A 3P14A 3WD4A 5TIMA 1V8EA 3MUIA 3WX7A 2J8FA 2R1KA 4XO6A 2E1DA 4YU1A 4AZIA 3BC9A 3TQPA 3MHFA 1M7XA 1J18A 4LH8A 3WD0A 1EJ7L 2G4JA 4V1YA 3KWSA 1VJSA 3KRUA 2Z29A 4NJKA 5AB3A 2YLLA 4NAEA 1EH9A 1SO6A 1PIFA 4TO8A 5DCBA 1S38A 3WD1A 2ZFAA 2QCDA 1A80A 3N4AA 4H8VA 3NAVA 4ZXOA 1KRAC 3BGGA 2H8XA 3A21A 4JTTA 3VNIA 4YMZA 3WEMA 3ZT6A 4PB4A 3MO4A 4K1GA 2QJGA 1ZSXA 2WKLA 5C2XA 2X1IA 2DIKA 4K36A 4UOZA 1PZ2A 2YB4A 1MUMA 3LI0A 1X7FA 1KV8A 1ZPTA 5FJIA 3W1TA 4LNYA 4X9SA 5CZSA 1FTXA 2Z1BA 3E0LA 5D2YA 1K9FA 2JGYA 3GU2A 4YL2A 3W25A 2GDQA 3AC0A 5A8GA 3TYZA 2I57A 1XKJA 3ONCA 3LU2A 5CZTA 1RCQA 2QIWA 3S1WA 1SW3A 3BV7A 5I3HA 1K8YA 3ABSA 3VCNA 3WD2A 4PCPA 1K02A 2V3EA 4MNJA 4CCEA 4A8LA 4WEVX 2Y2WA 3W76A 4C6EA 2WZTA 1VS1A 3DESA 4OKDA 3MB9A 5I3DA 1S5VA 3ICJA 4WLCA 1TA3B 1V0NA 1FFQA 1IV8A 2FVLA 3E3HA 4YN5A 1VPQA 3U5UA 1NFPA 4DBWA 1RALA 2FB3A 4MAVA 4AIUA 1XD1A 1O1ZA 1JYWA 5IDZA 3PS7A 2PDKA 1SW7A 5FEWA 1ZBCA 1ZU8A 1JI2A 1Q66A 1TV7A 3C2YA 3STFA 1OY0A 2EPKX 4M6UA 4C5YA 3DENA 3N6QA 4LB4A 5IXEA 2PBOA 4GCXA 3SUTA 4UOQA 2QDHA 1V6TA 4WSKA 1EDTA 3CHFA 2IS7A 3AHTA 4ZB0A 4KT2A 3A12A 3F2CA 1TMHA 2TSYA 5I23A 1YE4A 3IGSA 5E6YA 1OCJA 4KESA 1CLVA 2F8QA 2WCSA 1PBGA 2GGJA 4JTJA 3GXMA 4KRZA 3QV6A 3TCSA 1R7OA 4ROQA 2P50A 3QLDA 4JHZA 3W1PA 1AD4A 3BOFA 3M0KA 2UZ9A 3TP4A 1LRNA 1UR2A 3M9YA 3VA8A 2I9UA 1TV5A 2VJXA 2I7GA 3LYEA 2ZA3A 5CLWA 1MRQA 4W86A 1A0CA 1PTDA 1VP5A 4PMDA 5EYWA 5A2AA 1F73A 3B8IA 1UZ4A 2QT3A 1CXLA 1JPDX 2VGIA 3P5ZA 3PTKA 1XIDA 2F2HA 3P0WA 3EXTA 4D8AA 2PDWA 3G1HA 1GCYA 3HGSA 1BF2A 2E67A 1UYQA 2V3GA 4LS0A 3NQVA 1DJIA 2EO7A 4JTRA 3NNTA 1LL4A 3IUIA 3NO3A 3DFTA 4KGJA 2Q71A 4MMWA 5ABFA 3WBAA 1FP9A 1UUMA 3GZAA 4BF9A 4BQ3A 1QOXA 1R9YA 2VI0A 4MF4A 1E56A 1OJXA 3CL7A 2ZUVA 3G6LA 3QN3A 5JH1A 2VDGA 3EWBX 3TDFA 1S5MA 4CNOA 3W27A 4HNCA 1ZENA 3DX5A 4GC4A 2QEZA 1XC6A 1UMYA 3EKZA 3H22A 4GVIA 3EPMA 5MKGA 1VJIA 3M41A 4X0NA 4GJJA 4BA0A 1X96A 1DJWA 5TAOA 3A4XA 5EB8A 2J7CA 3P67A 2Y85A 1RA0A 4IZGA 2O92A 2PWDA 5EMLA 1HKMA 1W3KA 1ALDA 4Q32A 4DO6A 3ISIX 4H00A 4HPHA 4D72A 3DG3A 3UA4A 2C13A 1X1NA 5G1YA 4B5TA 2QCGA 1D7FA 1OZMA 2D69A 2QXWA 3TUUA 1DV7A 2HZGA 2GJPA 3Q58A 3LPOA 4HNVA 4I6KA 1K77A 3KBWA 1WXYA 3C2RA 3L67A 2D2JA 5E5CA 2DZPA 5DX7A 4MGGA 3OPSA 4IIGA 2BP1A 5DELA 1DWGM 3BH4A 1E1CA 3LD5A 1XLLA 1XIGA 3LM7A 1ADDA 3ZWTA 4ZR8A 3CZLA 3NPUA 3VPLA 1W9BM 2OX4A 3G1SA 4AX7A 1IHIA 4LPCA 1TZZA 2JGQA 1YEYA 4HSHA 3OZPA 4PFHA 4JDYA 4H1ZA 5I3FA 2ISFA 3QR0A 1G9HA 1WXJA 3UWUA 2HCVA 4C6JA 3HB9A 3MCMA 1KFCA 3QHOA 1F76A 5A6LA 1ZAHA 2C19A 4LAUA 4PMRA 1W5MA 4IIFA 3CMGA 3B9OA 5DANA 2CHNA 1QO2A 4PL1A 2VRKA 4W9TA 3R25A 5IDIA 1RJPA 4GIYA 4ZFMA 1JQXA 5FAJA 1OM0A 2XHYA 1RZMA 3WFLA 4HA3A 3PBVA 3D47A 2YL5A 2JF6A 2P8CA 3SECA 4R7WA 1ECQA 1OYAA 3E49A 4PYSA 2VNCA 3PUDA 4XVEA 2ZX6A 1OG6A 2PLMA 2W91A 3WLLA 1ZJAA 1PXGA 2B4GA 5G4EA 3E6EA 3AIUA 3T0AA 3VNKA 4WIWA 1QPKA 3AICA 2E7FA 3CT2A 4Q4RA 3W7QA 1MI3A 1QO5A 3VVGA 2WB5A 2XSXA 1XRSA 4B3LA 2ZBTA 1MQQA 2QGHA 3C8NA 2PZ0A 5KZEA 2HNEA 4OHQA 1DWFM 1NF7A 2OSWA 3H54A 4DZIA 1H11A 3OA3A 1H5YA 2VCAA 1O4UA 2PU0A 5CAHA 3L9CA 1KFJA 4N9EA 2Q3RA 5AYZA 4DJDC 3WLIA 3KOWA 4GUHA 2ZZ3A 1ITUA 2OKOA 4CKQA 3OBKA 2YDRA 1G69A 3CWOX 2A0NA 3HQOA 3AMGA 3RRAA 2UY2A 3ZLGA 2G3FA 4E6MA 1HT6A 1OK4A 3HG2A 1Z3NA 4CU7A 2WNQA 5EU9A 3HN3A 4K7VA 4GBUA 2JF7A 4F2TA 1XLBA 4D6EA 1SZFA 4W93A 3WBYA 3EB2A 1W3HA 3V4BA 2GGGA 3HJZA 4GO9A 1AL7A 3G1YA 3SB0A 3JU2A 3GH7A 2QMJA 3DBNA 4Z2IA 3G8EA 4S38A 4LYPA 1KQZA 5G1MA 4MAZA 1VB9A 3S1UA 3WQ5A 1NFBA 1JZ7A 1S2WA 1Q2RA 1PVNA 3N1AA 3FYPA 3F1QA 1Z69A 4IJBA 5LYRA 2XZ9A 3EYPA 4O13A 4Q7NA 1T0OA 3CV6A 3CPRA 3K8LA 5FOOA 2BY0A 3VDHA 3W2LA 3A47A 1WZLA 4P8WA 5HJXA 3GXFA 4JDBA 2X1SA 4PMOA 1UZHA 2PF8A 2Z1KA 3GC4A 4U2YA 4S3CA 3PY2A 5AOUA 1BQCA 4MLJA 2FHFA 3DFQA 1PS9A 4ZL1A 1W9VA 2OQYA 4AF0B 1BHGA 2PCQA 2CYGA 3D0CA 1MDLA 1G1YA 5IBXA 4NG3A 1H7PA 4W87A 4YYCA 2OOFA 3PZTA 1GYLA 1T40A 4DPPA 1R7AA 1D8CA 4S3JA 2Y24A 3C56A 1GPFA 4AD0A 4TTGA 4HYVA 1TTQA 1DL3A 4JTDA 4M6PA 4RZBA 1B5TA 1JQVA 3V5CA 1REQA 2AOSA 4ICNA 4M82A 5GVJA 1LLZA 2WOQA 4JBRA 1B9BA 4HB7A 4JAWA 1PTAA 2WVVA 3TJLA 2VZUA 3F4VA 4PUEA 4LBUA 1VBRA 3EXSA 3I7RA 4QJ4B 5D03A 1E55A 1ZZMA 3FFSA 5DN1A 3SJNA 2BGNE 3B0YA 1E4LA 2YFNA 4MHBA 3LRKA 5DXYA 4G8TA 1BRLA 1VBGA 4ZEPA 1GQKA 4TVDA 4DI8A 1RPKA 3C5QA 2ZX8A 1HX0A 4US6A 3OLGA 2UY5A 1J6OA 3W2NA 4GYJA 4N4PA 2VEGA 1W1ZA 1NQ6A 3YPIA 3PZMA 3WL1A 2PDMA 1J6PA 4NZFA 4UQCA 1W2VA 2HJPA 2X0SA 4GZJA 4XD3A 2CEQA 1J2BA 3WY1A 3RMJA 4RJEA 1C8XA 6PTDA 4HP5A 3CZGA 5CPTA 3W2JA 1C3FA 4AEOA 4AWUA 1W9UA 2ZUUA 3NURA 1B3ZA 3VIKA 4UTKA 3Q65A 3M7SA 5C2GA 2AKZA 4IMGA 4GRSA 1NY1A 3MMTA 2YZRA 2QF7A 4ADTA 1XDMA 3L4UA 1S3HA 3GFYA 1LZOA 5BMXA 1XCFA 3AWNA 4AWTA 2DJLA 3MJYA 1HO1A 4I6VA 4OUEA 3AXIA 2F9RA 3TSMA 1XM3A 1YRRA 3QC3A 1JVNA 2YBTA 1IZCA 3F7JA 4WY0B 4DNMA 1BWKA 3WBWA 4F79A 2E9BA 1ADOA 3UGVA 1EZ2A 4I8DA 3QGVA 1T6MA 1XL9A 3W7HA 2BHZA 2A7NA 3TYAA 1UR0A 2YCEA 5M03A 1LQ0A 3U2ZA 4L4PA 1XG4A 4DZAA 1RK5A 1P0NA 4D6GA 1GGOA 4GFIA 1VEPA 2DSVA 3F4NA 4KEZA 2PEVA 1WXZA 4MY9A 4IISA 1UUOA 2ZRYA 1K4HA 4F0MA 2OSYA 4E2OA 1SR0A 1SJBA 3IAQA 4HNTA 4CGTA 4LWWA 3B06A 5A6TC 3FXGA 1H5VA 4JGDA 1NDWA 1R3RA 3VOCA 1BAGA 2VKZG 1KGWA 1OX4B 2OT1A 3M5YA 3NQ8A 3P5YA 1XLDA 3SW6A 3QY8A 3KUMA 1N55A 3O6YX 3MPGA 3UZJA 4A8NA 2OWCA 4KKXA 4WGHA 3XISA 4U4MA 4YTTA 4E4FA 5AYXA 4HMCA 2HXUA 1I1XA 2CXGA 1M68A 1BKHA 3W37A 1DPMA 3ARVA 3N6HA 4B5XA 3NXLA 4REQA 3B97A 4GUGA 3C86A 3WLQA 3ONBA 5DF0A 4EPEC 4J5NA 4C6CA 4EAMA 3AZSA 2XGZA 4J2PA 3UBPC 3UGRA 1WOBA 1GEHA 4D6JA 4M7SA 1KGUA 2WXDM 4GMEA 4QCFA 3OO2A 6REQA 3JRKA 3BLPX 2XSAA 4XD4A 4WDWA 4ZGYA 3ZR6A 2Y62A 2J47A 1PL9A 4JFWA 2QCCA 4US5A 1FOBA 2YPIA 4IG2B 2SFPA 3I10A 2INZA 2YSWA 4PRTA 4XTIA 3OIHA 1B4EA 4H6EA 2O7SA 4ZQNA 2AQVA 1PTGA 3DFHA 4Z2LA 1RJQA 4OFCA 3GW0A 4H83A 1FCBA 1E6XM 4NI3A 4W8LA 5FJTA 1TPH1 4YTQA 1U1HA 3UERA 5DRCA 3LBMA 5EL1A 2ZXDA 1OT1A 3WG6A 1QNVA 2FFIA 1SM9A 4IMFA 4UB9A 4UZUA 1SO5A 2QZRA 4IFRA 3CYJA 2RH9A 2WHMA 1TJRA 4NZCA 1J96A 5C0QA 3KL0A 3W00A 4DF2A 4NZ4A 1F3EA 1W91A 2OX1A 3H55A 2WC7A 1OGBA 3URBA 3TN5A 1QHZA 4P8VA 3LHTA 4PUJA 1EFZA 4L65A 3FJNA 2QV4A 2NSOA 1JDFA 2V81A 3CB3A 3OVQA 1DTUA 2GJXB 1E9ZB 4HN8A 1ISZA 1GNXA 3T0CA 3IIOA 1POKA 1IXOA 4AIEA 3BW2A 2C3ZA 2O56A 3IUDA 3R4IA 3SY1A 3N25A 3RO6A 1UBSA 9XIAA 3RFAA 4DAFA 1JXKA 5ABTA 3ITYA 3CMJA 5D2XA 1QPNA 2NQ5A 2HROA 1OX5A 3BAJA 4E3TA 4JICA 1OSEA 2AAMA 1K7EA 1XRFA 2GVYA 4GY0A 4Z08A 1BGGA 3BLOA 2WPBA 3W0KA 1E4IA 4G1KA 3WLKX 2CFFA 3KTXA 5F4WA 3PUGA 2B7OA 1MW2A 1XYBA 3BW3A 4DBEA 1F6PA 1D3HA 3AJXA 2OO0A 3N15A 3KZPA 4AZ5A 1HP5A 2OYMA 3GW3A 5BXPA 4A21A 3T2QA 3UESA 3ERPA 2HTMA 2GQAA 2XFFA 1XLIA 3CU2A 3LNPA 4ZO6A 5BCAA 1XICA 4WSHA 4F4RA 2XG9A 3GHRA 2YDSA 3NQCA 3C2EA 3EOSA 1V77A 3DG7A 5FF2A 2VX7A 4XUGA 3MTWA 2ABBA 3ARRA 4FF7A 3QZEA 2HEJA 1CLXA 3THQA 4B3ZA 4JEQA 1UWSA 3QKZA 1E71M 1YIXA 5CG7A 3WQ4A 1FHVA 1C92A 3ZFHA 3IUHA 1ZP3A 3W85A 3TLLA 4HU8A 3DGRA 3PSWA 4D8ZA 2A3AA 2OLHA 3VABA 3M0XA 3VGBA 3W6YA 4J2MA 4ZTYA 7A3HA 4DO4A 4P7NA 4JYDA 5CKSA 3W28A 3V7PA 5A6AA 4WHBA 3ZMRA 1JAEA 3MU7A 2VC5A 1I2QA 3WNPA 5E6ZA 3NQ6A 3GG0A 4IWWA 3TVAA 1EC7A 1P7TA 4W89A 1X8CA 1IF2A 5D4YA 8CGTA 3T4WA 3WNNA 3P84A 2ZVRA 4AQLA 2A5HA 1HTIA 2VDHA 3W83A 1YBQA 1VFOA 4JQ4A 1JDEA 4X61A 3B8UA 4PCTA 4ADSA 5LIYX 3ARQA 3FYOA 5CSYA 1TELA 5F4SA 2A21A 2HMCA 3BWWA 3WN6A 3OIXA 4L7ZA 1W1B1 2P8BA 3UG3A 3TIMA 3BCJA 4WX2A 5BROA 5KMYA 4UR8A 2QUVA 5G1TA 3VGEA 3SUSA 1IR2A 1TRIA 1A0DA 3S4TA 1F5ZA 1OZQA 3QGKC 4LUTA 4AD5A 4OOUA 1XGDA 4O19A 1GOXA 2ZXAA 2GK1B 4ZBCA 1KCKA 3BSMA 2UY3A 1HNYA 1XCXA 4Z1DA 5HNRA 3UPMA 3W72A 1Q6LA 2BZNA 1DJXA 2BG5A 3FKKA 1Q4WA 2OXNA 2E8ZA 2FMNA 3WMCA 1QRQA 3TQKA 1D3GA 4UFJA 4ZOAA 3GHTA 4XAYA 3ITVA 1XLGA 1CLKA 4XIAA 3GNNA 3ITTA 1J0JA 3E5PA 4IIEA 5CBIA 2IXVA 1F7BA 4PUKA 3UWQA 2WSQA 4XKYB 3FV9A 4S3EA 1W8GA 2WLZA 2EJ1A 3M0HA 5D33A 4M1RA 4AZ7A 1QNOA 3GDLA 1CXFA 2BFGA 3CH0A 1R3TA 1SZNA 3MUZ1 1VLIA 2F6XA 4F0KA 2PWHA 1FWSA 1LQ2A 4FI4A 2P0OA 3LPFA 2QCNA 4ZE4A 3AZRA 3LCIA 1S46A 4FNTA 4OQVA 1SSGA 2IKHA 3KCOA 4Y8FA 2PLKA 5A6MA 5U4NA 2QCDB 4QJ1A 3L66A 2CIPA 3VD7A 3FJ4A 2PDBA 3G3MA 4J4KA 1QCWA 1XLAA 3ABXA 3WQGA 4DIAA 3LCFA 2VQUA 3LTPA 2REQA 1EJXC 7XIMA 3W88A 4IGMA 5IBXC 3OTRA 2V67A 3C3UA 3M4HA 3KXQA 4R34A 1XX1A 1E0VA 2RDTA 2IKJA 3M0MA 2HVMA 5C7VA 3W4RA 3RPTA 1GW1A 1UOZA 3MT1A 5AC7A 3VU2A 4LX4A 3GTFA 3VIOA 3L2IA 5LXEA 3E5BA 3QY6A 3PC0A 2R1NA 2G3MA 4CU6A 5EMUA 2RHGA 3K4AA 3WJSA 2VEIA 2W27A 3I3BA 4J27A 3U4AA 4TUFA 1ZJHA 4MWAD 2A6LA 2F2KA 1DJZA 4ZB5A 4O4VA 1Q4NX 3NL5A 4XWUA 1H62A 5H8UA 2BXZA 2PWUA 3SCTA 2DJXA 3ID7A 2ODOA 3LLXA 3PFRA 4GQGA 1M7OA 3S83A 3SURA 3N17A 2O9RA 1A3WA 3H26A 4L1GA 4NVTA 5TQLA 1S39A 3FHQA 5GJPA 9CGTA 1W9DM 2B0MA 3IPWA 3LX9A 3RM4A 3SM0A 4XV0A 4GJ1A 4QFUA 4AD1A 2PURA 2ZZ1A 2UV8G 1OFPA 3KL3A 1XIBA 5LA0A 4IPLA 3R2GA 3AXHA 1FFRA 3CT7A 1HJXA 2Z1XA 4OUIA 3QTPA 4GKTA 4CEUC 3AYSA 2YW4A 4X2PA 3DU0A 2HVNA 1LM1A 1Q6DA 3MQTA 3MC5A 1DIKA 2XIIA 4WY0F 3FSUA 1UH4A 2Q09A 3EOEA 4UZSA 5FEXA 1XD0A 4PMQA 1EGMA 1M41A 1QBBA 4XAZA 3SCUA 8XIAA 3M46A 4IMCA 4MY8A 3FN9A 4O0ZA 4UTJA 5CGTA 3L2MA 4OBRA 2DT0A 3BLKA 5D04C 1A5SA 3KAOA 3BOLA 1LTDA 4R5EA 4Q6XA 4UXDA 5ABHA 5CPMA 2X7WA 3SEPA 3UZ5A 3RYSA 4JTFA 3LHWA 4A29A 4QTGA 2WPGA 4DLMA 4K8GA 1VIWA 3ZYZA 1OFQA 4Z2HA 2NVAA 3MY9A 1THFD 2R14A 2GGEA 2GSEA 2XWEA 4DVOA 4H2CA 2ACRA 4DB7A 2NW0A 3W1UA 5IFTA 5AVHA 5LHFA 4WZHA 1VC4A 3TJXA 5D9NA 3IV3A 4GI8A 1GYNA 4L6OA 1NP0A 3UG4A 2OKTA 4FIRA 4IM4A 2PRHA 1XLFA 3FLUA 1F61A 1UWAA 4V33A 2E25A 3TJIA 1UKQA 3KS5A 3BL3A 2D2GA 3CJPA 1FWWA 3MYPA 1MEWA 1QUMA 2QCEA 2OEKA 3RM9A 3U6WA 4AMAA 3ABQA 1UJPA 1C8VA 1V5XA 4IOTA 3SSJA 2PC8A 1NM9A 2V6AA 5U7SA 3NJ3A 1IT7A 1HQTA 1OVDA 1FWCC 4RNHA 2ZYFA 4O50A 3VOHA 4QEHA 1CB2A 1EIXA 4HK7A 2Z27A 4IPNB 4HOZA 5FJRA 3N04A 3E38A 1EX1A 3UNDA 1RD5A 2HQAA 2PF0A 1MMFA 4P2VA 1RLCL 3V5OA 1RH9A 4N6EA 3N2XA 1MNZA 3NQBA 1MO0A 4M80A 2WNZA 3KRSA 1XIIA 3LPGA 3UJFA 3TTEA 2ZUMA 4LVGA 2FPVA 3CK5A 2EQDA 2NX1A 5L9FA 1E6NA 1XGEA 1V7YA 4MDPA 2OZ8A 1K7XA 3WLMA 1R8LA 2X2GA 1X1OA 3CZKA 1J8VA 2YX0A 3U9IA 1QT1A 4LRTA 3AXXA 3EB4A 5HUPA 4JL1A 4DWSD 1AQMA 1T41A 4S39A 1UWRA 3MUXA 3WL0A 2YJQA 1TYGA 2O4MA 4XTDA 1XLMA 2ZUTA 4K37A 4QROA 2ZZ6A 3GQYA 1EWEA 2QDGA 1UZ1A 2QJNA 1V6UA 1X6LA 1N8FA 3UWYA 3A5FA 4JXCA 2C8NA 4ERAA 5FKYA 5HUOA 1I9CB 2GPTA