1EDGA

Single crystal structure determination of the catalytic domain of celcca carried out at 15 degree c
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
380
structure length
380
Chain Sequence
MYDASLIPNLQIPQKNIPNNDGMNFVKGLRLGWNLGNTFDAFNGTNITNELDYETSWSGIKTTKQMIDAIKQKGFNTVRIPVSWHPHVSGSDYKISDVWMNRVQEVVNYCIDNKMYVILNTHHDVDKVKGYFPSSQYMASSKKYITSVWAQIAARFANYDEHLIFEGMNEPRLVGHANEWWPELTNSDVVDSINCINQLNQDFVNTVRATGGKNASRYLMCPGYVASPDGATNDYFRMPNDISGNNNKIIVSVHAYCPWNFAGLAMADGGTNAWNINDSKDQSEVTWFMDNIYNKYTSRGIPVIIGECGAVDKNNLKTRVEYMSYYVAQAKARGILCILWDNNNFSGTGELFGFFDRRSCQFKFPEIIDGMVKYAFGLIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE A
publication title Crystal structure of the catalytic domain of a bacterial cellulase belonging to family 5.
pubmed doi rcsb
source organism Clostridium cellulolyticum
molecule tags Cellulose degradation
total genus 140
structure length 380
sequence length 380
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 1995-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1edgA00
3WENA 1K9EA 4V2XA 2YIHA 5D9MA 4CD4A 2EBNA 3ARYA 4U2YA 1VF8A 1UD4A 4C7FA 2BY3A 2GJRA 3CZEA 2E9BA 1B3YA 3WQ4A 3UERA 1CPUA 2YBTA 1XV8A 4GINA 2BY0A 1NP0A 3VNYA 1GOMA 1CLVA 3BMWA 1UH2A 1H4PA 4ACYA 1XYFA 2CHOA 2OSXA 5A6SA 2RGLA 2ZE0A 1CGWA 2CXGA 4H2CA 5FL1A 1UKSA 4DM2A 4PYSA 1XD0A 3OIHA 3L4XA 4A3HA 3U7BA 4YHEA 1W9VA 4V27A 4JL2A 4CUCA 5CXPA 3EDJA 2Z1KA 1QPKA 5I78A 2CKSA 4PMOA 1ECEA 4X0VA 1AQ0A 5BROA 3RM8A 4PMXA 3SUWA 4NI3A 3I3EA 5GQBA 3OB8A 4D71A 5A6BA 4ATDA 5KEZA 2CBUA 2ZXDA 2ZIDA 4AZCB 1BG9A 1H3GA 2W61A 3WNPA 1BYCA 4HZ6A 3VD3A 3DHPA 1EH9A 3IAPA 5BCAA 4E8DA 4PBGA 4PUDA 3CO4A 3AIRA 5AC5A 4LYPA 1E6NA 2IXUA 2PC8A 2GK1A 3CHDA 4OIFA 1B1YA 3VMNA 4WKFA 1UA3A 3WH8A 2DDXA 1XHGA 4DUWA 4AIOA 3WY1A 1J10A 1K9DA 4PMQA 1QHOA 4JCMA 3CHFA 1CYGA 2WHJA 1UD5A 3WUFA 1GONA 3WQVA 4MB1A 4MB3A 1VBRA 3WQ5A 1B31A 1DWJM 4X9YA 1XH1A 1LL4A 2YKKA 2Y24A 1ZBWA 2EPNA 4ZXLA 4E2OA 5BRQA 1CGUA 3N04A 4HU0A 3VD5A 1XCWA 2JEPA 5IFTA 2CEQA 2CBVA 1CXKA 4Z2GA 2XWDA 4P7QA 5IHSA 2ESCA 1LWHA 1PX4A 1IZKA 2JEQA 3RM4A 2WZIA 5C8BB 1BLIA 1EO7A 3WSUA 1JD9A 1V3HA 2VTFA 1FHDA 4MJ2A 3UG4A 5I6SA 1JL8A 4MAZA 1FH9A 2DQXA 2YA2A 3RDKA 4UQBA 2XFYA 2VVSA 1OGGA 1RP9A 4BS0A 1CGYA 3WDQA 4PMNA 3K4AA 1JDAA 1UZ1A 3AMDA 3UEQA 5A8MA 2VZOA 4A3YA 2WVTA 1E4NA 3MSGA 1W9DM 2VX7A 3VMOA 2A3CA 2HVMA 4QP0A 2W92A 1UQYA 4JHZA 3WMBA 4RE3A 4CVUA 5A2CA 3K1DA 2IXVA 1B3WA 3PZUA 4UFKA 5ABFA 1WO2A 1HJWA 1JZ3A 1IT0A 1BF2A 3WD4A 2DT2A 3FXYA 1O7AA 4WJXA 3DYPA 4HZ8A 2DSWA 2V5DA 1J0ZA 2J7GA 3RJXA 4MDOA 1J0JA 1W9XA 3PTMA 2WMIA 2Y8KA 2GJXA 1PPIA 3EMZA 2DSUA 4HP5A 4AD3A 3W53A 1EIBA 2FHBA 2VURA 2ZX5A 3VOCA 3FN9A 1FHLA 1JDDA 1ODUA 1Q6FA 1CDGA 1VEOA 4R5EA 3M7SA 3CZKA 3BAXA 1JAEA 3AIUA 3DHUA 3ARUA 3VDAA 1V3LA 1EXPA 1Q6DA 1HKKA 2BHYA 2D1ZA 2X8RA 1AQHA 4AZGA 1EQCA 4PMVA 2A3HA 1D2KA 3A4WA 3W26A 1HKJA 4JCLA 2PBOA 2CESA 3THCA 1HJVA 1QW9A 3D3AA 3CHEA 3MU7A 1UR8A 1I1WA 1V02E 3WF1A 1OGBA 4S3KA 3GNRA 5A2BA 3WL1A 4HMEA 2E8YA 4JFVA 4OUEA 5GNXA 2XVPA 1GCYA 3PZ9A 4PSRA 5CGMA 2J7DA 4MNMA 4U2ZA 5A8OA 4J7RA 4UTFA 4ZXOA 4HOXA 4OBRA 4CD6A 1E15A 1KXQA 2VR5A 5CSUA 1I75A 3WF3A 2XFFA 3CUJA 5GNYA 4NSBA 5E09A 2EPMX 4ZFMA 1XCXA 3NDYA 4D6CA 5I2UA 2DSZA 3ZMRA 3CUFA 3MSDA 1UD8A 1P6WA 4QAWA 3F5JA 3NYDA 5D8ZA 1AMYA 3KL0A 4U33A 4ATLA 1BFNA 2E9MA 3B9DA 1GOOA 2J62A 1J11A 4JFSA 3BSHA 4J3TA 3ARPA 4IISA 5CSYA 2CNCA 3OZPA 3W6MA 5I77A 1VENA 3SEPA 4ACZA 4N42A 5A94A 3L4VA 2W4XA 4UOJA 3WF0A 2XVLA 1PEZA 1RH9A 1TA3B 3QR3A 5JBDA 1E40A 1EA9C 3PBGA 4UQEA 1QVBA 1E0WA 1XD1A 4F9JA 1CGTA 1ZB5A 2W91A 2ZUSA 4Z2IA 1ISZA 5EFDA 3PN8A 5A1AA 3EDFA 1I1XA 3VKKA 3T0BA 2TAAA 2O92A 1SR0A 2CITA 2ZXAA 1E6XM 2W62A 1PX8A 2Y4SA 3WEOA 1EQPA 2V3FA 4BCEA 4QDMA 1HL8A 2WMGA 2WANA 1SYTA 5C70A 3FAXA 4M80A 1MQRA 5A69A 1V0NA 4TTUA 3VDBA 3APGA 4KRUA 2XGIA 2ZUVA 2DH3A 1VFOA 1TUXA 2AMGA 5HPOA 5IFPA 3CUGA 3RCNA 1B9ZA 3FHQA 1XH0A 1TCMA 4PCTA 4N0RA 1UKOA 1CEOA 4YHGA 3VGFA 2EXOA 1HKIA 1DHKA 1US3A 3WUEA 4PMZA 3WNKA 3ARTA 4IPNB 4DWSD 3AFBA 3WBEA 1QNQA 4HPHA 1WZMA 4EANA 3QHOA 5CQ1A 4EE9A 1KWGA 2O9RA 3W29A 2IUZA 1UWSA 4K68A 3WFLA 1CBGA 3KWXA 3SCVA 1ISXA 1E9LA 5D9PA 5E70A 2RGMA 3AICA 1H0IA 3AI0A 1ZL1A 3SCNA 4TVUA 4QCEA 2VZTA 3GM8A 4PN2A 2XGBA 4S3JA 3BAKA 1HNYA 4KWUA 1VFFA 1EOMA 3AHVA 4LGXA 5DEZA 1V08A 1VB9A 4JZ5A 2UY5A 1WPCA 5ABGA 4CCEA 1K9TA 1UD2A 1G0CA 2GJPA 1UWUA 4J3SA 4W7UA 3POCA 3VDHA 2VVNA 5A8NA 4Q22A 5M03A 1UR0A 4GQQA 3VUPA 2W63A 3HN3A 3WD3A 2BY1A 3K46A 4RL3A 3I3DA 3SCSA 1EHAA 1X6NA 2XFRA 2QMKA 3GXIA 1QNSA 3CPUA 1M53A 3THDA 4UZSA 4W7VA 1W1TA 1GOQA 3T09A 1CXEA 5A6BD 2YDRA 2WZHA 1MW3A 2B31A 3SUUA 1QNRA 2WLYA 2WZEA 3U57A 3GDBA 5E6YA 4DUVA 1UHVA 3KZSA 1UD6A 3N15A 1ZBKA 2WPGA 2NW0A 5HBFA 4PRWA 4H7VA 3ZT7A 1HP5A 3EDKA 1MVYA 1KFWA 2G3MA 5CPTA 2OWXA 5A3HA 1W3LA 3U7VA 1BSIA 3WH9A 2QPSA 2VR4A 1ZBCA 2ZX8A 5I24A 3PZTA 2PWGA 1GQJA 3SIMA 1CZ1A 1BTCA 2PWFA 3ZIZA 2VQUA 2VI0A 1H0GA 3SUVA 2FGZA 4GXPA 1E4IA 1V6VA 4L4PA 3AIBA 2FGLA 1KQZA 1OIFA 4AD0A 4ZE4A 1Z32X 2BVTA 4HOZA 4U5KA 2VT0A 1Q6EA 3AOFA 4WF7A 1B90A 1SMDA 2J4GA 4TX8A 4V28A 2V3GA 4DWSA 2BVDA 2ZXBA 3FW6A 1NWUA 3WEMA 4C7DA 4PMDA 1V0MA 1S46A 1UKPA 4FMVA 1NP2A 3VD9A 4MNKA 4P8VA 3FY1A 4M82A 4PMUA 5BXPA 2UY2A 4J3VA 4NZCA 2WWCA 1PAMA 4OOZA 1QI4A 3A3HA 5ABEA 1PZ2A 3T2OA 1XH2A 3LMYA 3W4RA 3LPOA 4GZJA 3UR8A 1N82A 2ZUWA 4FLQA 4B9ZA 2J25A 3T2PA 4WKAA 3TTSA 1AQMA 2OSWA 3BC9A 3AZSA 3AMCA 1CNVA 1JNDA 5D4YA 3VMPA 2BXYA 3UR7A 3VO0A 3VGEA 4D6JA 1BAGA 2WM0A 4UFIA 3VM5A 3SUSA 3CH9A 3OGVA 3AS0A 1R8LA 1JI2A 4PTMA 3RJYA 2DIEA 1UUQA 2C8NA 1ZJBA 1B3ZA 2G4FA 1GOIA 5CLTA 4F9DA 1W2VA 2DEPA 2J74A 2J8FA 4CN4A 1W3KA 2VX5A 1VJSA 2CERA 5BXSA 3AIEA 2JALA 4P7LA 3N9KA 2A3BA 2G3IA 4Z2LA 4LX4A 1CGXA 4P7OA 4XUYA 1VRXA 1W91A 2J79A 4HA1A 1V3IA 3QHNA 1FA2A 1FP9A 2WXDM 1E56A 3WH5A 3VIPA 3CLWA 3WD0A 5A6AA 3WH7A 1H09A 2GDVA 5IXEA 5DT7A 3CZJA 4M1RA 4AXNA 1C8YA 4MADA 1ZJAA 1BQCA 4P8WA 2DH2A 4M8UA 2AOSA 1JIBA 3WQ6A 3CZLA 3ZR5A 1GVIA 2VCAA 2O9TA 2D3NA 3QGVA 4AEEA 4Q7NA 3OLGA 3GNPA 3NJ3A 3WFZA 2G3JA 1MQPA 2XHYA 4KMQA 2GFTA 1FFQA 1XGZA 4AIUA 3WDHA 2UY3A 3AHZA 1QBBA 1H1NA 3ZO9A 2VMFA 5LA1A 1FOBA 1JI1A 1E4LA 1M04A 4L4OA 2OYMA 1LJYA 4UQAA 4B9YA 4AZ6A 3VGHA 2CIPA 2WBKA 2BHUA 1JZ5A 3WQWA 4Z2KA 3AIVA 2E8ZA 3GH4A 5FIPA 3ZJKA 2PB1A 4MNLA 3VIIA 5E0FA 3WF2A 4W8LA 5CJ5A 4PMYA 1E70M 1D3CA 1NOWA 4W84A 2EPOA 4IM4A 1QHPA 1H11A 3O6AA 1GQIA 4UNIA 2WMFA 2J77A 3BAWA 3AHYA 2ZX7A 1HN1A 4TXEA 2WC3A 1E43A 4P7NA 1W9PA 3OLEA 1K9FA 1V3KA 2V3EA 2O9OA 2XPKA 3DECA 2CYGA 3ZJ8A 4XV0A 3ARQA 5HDRA 3GXDA 2A3EA 3AYSA 1UD3A 1B0IA 1XRVA 4HA3A 2EPLX 3PZGA 2E3ZA 5FL0A 1BPLB 1J01A 3AS3A 4MDPA 1Q6GA 4CD8A 1M7XA 5A6KA 5GNZA 4ZENA 4AZ5A 1U30A 5M17A 2ZUUA 4UCFA 2VRQA 4FK9A 4AD2A 3GH7A 2YA1A 3W81A 2WK2A 1E3XA 1OB0A 1QI5A 5HXMA 3N1AA 4EAMA 2X09A 3VIJA 4XZBA 1PJ9A 1H2JA 3AHTA 1E6ZA 1HIZA 3A47A 1HJQA 3KL5A 4PTXA 1QBAA 1WP6A 4RE4A 5LA2A 1FH7A 3BLKA 1UKTA 1UR4A 3GH5A 4U3CA 1B2YA 1GQKA 1C92A 3ARXA 2CKRA 3ARZA 1WDQA 4H8HA 2J78A 1V6XA 3UG5A 3M6DA 2YL6A 3MUIA 2D23A 3ARVA 1WZAA 2WYSA 5EB8A 1E0VA 2F8QA 1GORA 1JZ8A 3ZT5A 2WHMA 2W66A 1JYWA 1OD8A 2WSPA 2FH8A 4PCSA 1FP8A 3G6LA 1E6RA 3ZJ6A 4MB4A 4ML4A 4UR9A 3TTYA 2D3LA 2J47A 1RD6A 4HTYA 2VO5A 1GJUA 4J3UA 3VGGA 4HZ7A 3WDJA 4WKHA 4AD4A 2OYLA 1LL6A 3O9NA 1CENA 3K8MA 2WLZA 1W3JA 3EBVA 4B16A 1LWJA 1GW1A 1GVYA 2D22A 2WMJA 1M01A 5I3DA 5CGTA 1CXLA 2WVVA 3PHAA 1E5NA 4MPKA 4AZHA 1E5JA 1EDQA 2V3DA 1HP4A 2BS9A 2JFEX 4JKMA 1U33A 3WH6A 7CGTA 1C8XA 1UH4A 1TFVA 1V03A 3VGBA 4CN6A 2MANA 1OCQA 1JZ7A 1WB0A 2WKGA 5ECUA 2W67A 1H5VA 3CMGA 1NWTA 5JIPA 4U31A 4KRTA 4CD5A 3CIVA 2NT1A 2ZUNA 4D6DA 2VZVA 1B30A 4W87A 1UG6A 4AC1X 1BG4A 2PI6A 3ZJ7A 1GQLA 1LL7A 3VVGA 1C7SA 3WUBA 2BXZA 1R87A 1QI3A 1UWQA 5DT5A 2Q8XA 3ARSA 3AMLA 2Y2WA 4MNJA 1JYVA 2YLAA 4CKQA 5IDIA 4WIWA 1NH6A 1G01A 3PZMA 5BXTA 4HMDA 3ZSTA 4LYQA 4HOWA 4FLOA 4PTVA 2VRKA 1C90A 3T0DA 2WAGA 3EMQA 3WNOA 1OM0A 1B3XA 4UFJA 3EDEA 3L4YA 4B3KA 1UR1A 2D24A 3WUGA 3OA5A 4MTVA 4AZIA 6CGTA 3N12A 1MQQA 3PZNA 3AJ7A 1ESWA 4W5UA 2WC4A 3QOKA 4P7RA 2GK1B 2X0HA 4BQ2A 5I5RA 2ZICA 1HJXA 2YJQA 4HU8A 5A8PA 5LA0A 2ZX6A 2XWEA 2OWWA 2VZUA 2W5FA 3MUZ1 1G1YA 5A6MA 5FKYA 1W32A 4GI9A 5CPSA 4E4PA 1NWSA 5I0DA 2C0HA 1WCGA 3ZOAA 2QF8A 1KBBA 4GZIA 1OSEA 5EFFA 3RIKA 1GZJA 4W89A 3WBAA 1L8NA 2F61A 3CZGA 4AZCA 2VJXA 3PTKA 1H41A 3WNLA 1OT2A 3AZRA 3O2LA 2YL9A 3VIKA 1V3MA 3UCQA 2VX6A 2CETA 2EEXA 1PX3A 3MUY1 1Q6CA 1B3VA 2J75A 4JKKA 4KGJA 2QMJA 1AVAA 5C71A 3S2CA 4QLJA 3BMVA 1DWAM 5DO8A 3RILA 1HVXA 2WHKA 3CGTA 2D0GA 1DTUA 4YPJA 3L4UA 1JF6A 1KGXA 3MMWA 1A3HA 1C3FA 4J27A 1JFHA 1E3ZA 2WKLA 3LPFA 2J7BA 3AMKA 5DFAA 5HPCA 4AD5A 1OINA 3LPPA 2DGAA 1OBAA 3IJ9A 1KWKA 3VNZA 4OKDA 3WN6A 1QHZA 1BVNP 4TVCA 3NCOA 4H04A 1C7TA 1NM9A 3WD2A 1TVNA 2FHCA 2WVUA 3ZSSA 1TG7A 5JBFA 5JBEA 3WMSA 4CCCA 4WSKA 2E4TA 3MMDA 5HOSA 3NSMA 3L4ZA 5F7UA 2V38A 4D1IA 1JDCA 2XTKA 3FAWA 3NIYA 2WMIB 4B3LA 2GJXB 1WKYA 1E73M 1CECA 2ZWZA 5AY7A 3VIFA 3ARWA 1MW0A 1DP0A 4QCFA 4P8UA 2Y5EA 1UZ4A 2JIEA 4BZYA 1NQ6A 1KGUA 3PZVA 2XSBA 3N11A 3BGAA 2WC7A 3WNNA 5D8WA 3AROA 3TONA 2X05A 4AYSA 4UOZA 5A6LA 2NSXA 4AZBA 3L4TA 3SCQA 4U3AA 2J7EA 4Z2HA 1NOUA 1WNOA 1TZ7A 2JE8A 4BQ4A 5BRPA 3SCWA 2QV4A 3ZM8A 1KCLA 1VIWA 3OLDA 1XC6A 2EO7A 3A4AA 1V0KA 4CU7A 2CPUA 1XSIA 3VD7A 4BA0A 1MXDA 4HMCA 1DWFM 1GHSA 2YLLA 4F8XA 2O9PA 3VM7A 2XIIA 1DWHM 1PIFA 3F5LA 1D7FA 5E9AA 3W0KA 2VL4A 2WW5A 4LQ1A 1WDRA 2NT0A 4IPLA 5ABHA 3KEHA 1DEDA 2DT3A 1J0KA 1RPKA 1BHGA 4M24A 4B15A 2J7HA 2WHLA 4XX6A 4JFWA 4JFUA 1KBKA 5GPRA 1W3HA 1V0LA 1ITCA 4UFHA 1ZBVA 3UETA 3OBAA 3MV11 1R85A 2D0HA 2EQDA 2JF6A 1CXHA 5E6ZA 1G9HA 3CUHA 1ZS2A 1UR9A 1LQ0A 4JL1A 4ACZB 2C7FA 1JXJA 3AS1A 2X2YA 3AS2A 4ZEPA 1WDSA 4CGTA 3VTRA 3RM9A 4XB3A 4CN1A 3W37A 3AXIA 1VFMA 3II1A 1TE1A 2VCBA 2V5CA 3K8KA 1UWTA 3EDDA 1JAKA 3W25A 1CIUA 1CLXA 3ALGA 1QOXA 2XM1A 1ISVA 3AMGA 3RPMA 1NARA 3FNDA 1CXFA 3E1F1 1HVQA 3DC0A 4PEEA 7A3HA 5BYWA 1BGAA 1E4MM 4MB5A 2FDMA 8A3HA 1NOFA 1E1EA 3MKKA 3BCFA 1KQYA 1CWYA 4TUFA 5DMYA 4JFTA 3VIHA 1WZLA 1SFSA 1CXIA 4H8UA 7TAAA 1TA3A 1HXJA 1MWOA 1R86A 2ZUMA 1J0YA 1UOKA 5KZ6A 3WDIA 2YA0A 2PF0A 4W88A 4JKLA 5DF0A 3TP4A 2A3AA 3CHCA 2EPKX 3BAYA 1KR1A 1H49A 2BV9A 2XVKA 4RE2A 4M81A 1ISWA 1XSJA 2BNJA 3PZQA 5JUVA 3PZIA 1BYAA 4AIEA 5D9NA 1OGSA 1PIGA 4DM1A 1W1PA 4AD1A 2PBGA 1UH3A 1BGGA 1JFXA 4OOUA 4MAVA 1MFVA 1MYRA 2D2OA 2DPEA 4BF7A 4GQRA 1RP8A 3RMEA 1A47A 4W85A 5CPQA 4OBSA 3G6MA 1FFRA 4GZEA 1F4HA 2WB5A 1MFUA 1BYBA 3B9AA 4GI6A 5EBAA 2VUYA 1UWIA 3VX0A 3CZ8A 5A8QA 1HKMA 3B8SA 3DYMA 4F66A 6A3HA 2J8GA 3AQUA 4UQCA 3JUGA 4W93A 3SURA 1W2PA 3VD4A 5AYBA 2VX4A 4GIAA 3A6OA 3AIWA 4WSJA 1HJUA 1VAHA 4YN5A 1MW1A 3ZR6A 5EMYA 3ALFA 1BVZA 1PBGA 3POHA 3AZTA 4PSPA 3J7HA 3ECQA 4Y7EA 4QFUA 1HX0A 2DIJA 3L2MA 3T2QA 5JIWA 3WDRA 1DWIM 3W82A 4A4AA 1LG1A 2DSVA 2JF7A 1EHNA 3SCOA 2Z1SA 2PWDA 2OYKA 3MS8A 3GNOA 4D6EA 4DWSC 4WK9A 1XYZA 1IV8A 1CTNA 1R7AA 1FH8A 2OLHA 4UQDA 4AISA 1Y7VA 3HJEA 3IJ8A 1US2A 1UR2A 2XJ7A 1E6PA 3WMCA 3W6LA 2UY4A 3VINA 3CUIA 1PZ3A 4C7GA 4BQ5A 4BQ3A 2WBGA 3WQ8A 3FHAA 2BFGA 3AXXA 2XUCA 1HF6A 4TTGA 1KXHA 3SCUA 1JZ6A 3VIMA 1J18A 1E6QM 4NRRA 2G3NA 4CD7A 5I79A 2J7CA 4ZE5A 1J0HA 1EDTA 3F5KA 3VDCA 5IHRA 3TA9A 4W8AA 3OGRA 4AZ7A 3NUKA 1NWRA 1QI0A 4D1JA 1V6WA 1QW8A 3HU7A 1HT6A 4HA4A 1VBUA 1EO5A 4AMCA 1GPFA 3B9EA 4GO8A 4EK7A 1C91A 2FH6A 3GTNA 1O6IA 4LYRA 2GSJA 1KCKA 4AY1A 1X6LA 8CGTA 3I3BA 1L0PA 4DWSB 1E0XA 2WCAA 2Y8VA 4URIA 3GBEA 1WDPA 5FOOA 3DYOA 1HJSA 1C8QA 1OT1A 2FHFA 3IANA 3CBWA 4NRSA 1EDGA 4CU6A 1UA7A 2DSKA 2ZWYA 4DUXA 2WMHA 2QPUA 6TAAA 2ZX9A 1E1FA 2ZXQA 5LYRA 3WF4A 3MV01 3EYPA 4KH2A 3MUAA 4WLCA 3ZQ9A 4GO9A 1VEMA 4J3XA 1KB3A 4GI8A 1JNEA 5M3WA 1JYNA 3AYRA 2X0YA 1LF1A 1QI2A 1JZ2A 2WNWA 1KXVA 1LG2A 4JAWA 4OJYA 3EMCA 2HISA 3BSGA 1J12A 3QOMA 2XM2A 4M29A 2D20A 3AHXA 1JXKA 4R27A 3ZT6A 5CZKA 3KL3A 2OSYA 5CLWA 3L2LA 1DWGM 3NSXA 2XSAA 3SUTA 3AIQA 3U5UA 1OD0A 4W8BA 5BWFA 2AAAA 4P8XA 1E55A 2QLYA 3MMUA 3D5HA 3TOPA 1GHRA 1UWRA 3BLPX 2CHNA 2WSKA 4NF7A 3HMCA 1G94A 4D72A 1EGZA 4AWEA 1C93A 2F2HA 1WE5A 4UFLA 2GDUA 3QHMA 4U5IA 1OWQA 4LXFA 3LPGA 3IJ7A 4UFMA 3VILA 2BVYA 4EKJA 3CMJA 1TR1A 1G5AA 2X1IA 4CU8A 5TD4A 5M5DA 2CBIA 1V6UA 3N13A 1OIMA 3NDZA 3VIOA 1U2YA 1GOWA 2CBJA 3GXMA 5A6JA 3VGDA 5CG0A 4ATWA 1VFUA 1JYXA 2VOTA 4XZWA 4CVWA 4F79A 3WL0A 1M03A 2VNCA 2VCCA 4JIEA 4AEFA 4E8CA 5BXRA 2WMKA 1VJZA 3WEZA 1HL9A 2YL5A 1QNPA 1GOKA 1KR0A 4W7WA 1MW2A 1TVPA 4MJ4A 1LLOA 4Z2JA 1GNXA 2XVNA 4J28A 3BCDA 2YBUA 1IZJA 5HNNA 3K4DA 3A4XA 4GKLA 3T0AA 3WELA 3SCPA 2E9LA 2DT1A 1GJWA 3BAJA 1SMAA 1E6SM 3S6TA 3M46A 3OG2A 3U5YA 2XG9A 1W9BM 5E0CA 4TVDA 3PZOA 4AW7A 1KXTA 2E0PA 3VIGA 4D6HA 1JZ4A 2YDSA 4H8VA 2BY2A 2E40A 3T08A 3M07A 3GZAA 2VQTA 2VC9A 1ISYA 3GYCA 3SCTA 2G41A 4TX6A 1GUVA 1TMQA 5ABFB 1K6AA 1JF5A 4OZOA 2DT0A 3WDPP 1E72M 2WWDA 3BH4A 3BAIA 4IUGA 3GXFA 5FCZA 2WVSA 1YQ2A 3AXHA 5FD0A 3W28A 3N17A 3WD1A 2J7FA 3VU2A 1ZU8A 1XSKA 3KE0A 4HPGA 2WCSA 4FF5A 4GPNA 4X0NA 1VEPA 4D6GA 1W1VA 3WIJA 5AYIA 3MANA 2CCRA 1JG9A 2D0FA 3W24A 9CGTA 1KGWA 2VZSA 1R7OA 4PUEA 3VPLA 2YOCA 4TOQA 2EJ1A 4FLRA 1UQZA 3N18A 4W5ZA 2WCGA 1V3JA 3SCRA 2XVGA 5I23A 3UG3A 3TTOA 1ODZA 4LPCA 3IK2A 1X1NA 3GBDA 4D6FA 3IAQA 2QHAA 3W27A 2PWHA 1JD7A 1V02A 2JIWA 1V6YA 5A95A 1MXGA 4D6IA 3RO8A 1J0IA 1ITXA 2WVVB 4W86A 2XIBA 1Q4NX 2UWFA 2OWCA 3NSNA 2BHZA 4FLSA 1YHTA 3AISA 5D9OA 3OLIA 1W1YA 1BYDA 4JHOA 3WNMA 3BXWA 4UOQA 1CGVA 1WZKA 1F4AA 3ARRA 2XYLA 4KGLA 4H41A 4M56A 4UZUA 2YL8A 3K8LA 1EOKA 1QNOA 1UKQA 3UESA 3TTQA 2GVYA 1UYQA 4J3WA 4PMRA 3W38A 3VX1A 4PTWA 2G8ZA 5AC4A 3OZOA 4CCDA 2ZUTA 3OGSA 3WKZA 3F4VA 3CTTA 3MO4A 4QLKA 5A2AA 2PWEA 1E71M 2VRJA 2YDQA 4UQ9A 3PTQA 1W9UA 1WAWA 4QLLA 2ZOXA 1J9YA 3L4WA 1JGIA 2GUYA
chains in the Genus database with same CATH superfamily
4NY2A 5CPNA 3UZWA 2R14A 4HD5A 3W75A 4CD4A 4U2YA 4E3TA 4I9MA 2Z7GA 3PUDA 4C7FA 4KCWA 2GJRA 3CZEA 2E9BA 2FFCA 2YBTA 1XV8A 2RKXA 4XAFA 3U2ZA 3VNYA 3C61A 1H4PA 4ACYA 4GGBA 3APYA 2WNQA 4YTRA 2PD5A 2RGLA 2ZE0A 3R4IA 4J2MA 4B5SA 1MSSA 2I7GA 1XD0A 3L4XA 4ADSA 5E9XA 4A3HA 3U7BA 4YHEA 3B8WA 1W9VA 4C1NB 4UTKA 1RBLA 5CXPA 3EDJA 4NNCA 5I78A 1ADDA 1MEIA 4M7SA 3NL3A 1FBAA 3UXIA 2WKJA 5GQBA 3NZRA 5CPOA 4D71A 5KEZA 4HHHA 2ZIDA 1RVKA 4ES4A 1BYCA 5BCAA 1F74A 4LYPA 2GK1A 4WY0B 3VMNA 2DDXA 3LBMA 4JIIX 3WY1A 1K9DA 4C6KA 1XDMA 4RNHA 2HWGA 5SWUA 4DVOA 4ZMGA 2WHJA 6ENLA 1R38A 4WDTA 2PDPA 4XZIA 3M0ZA 2W6RA 2EPNA 2XIOA 4H2HA 4C90A 2FTYA 1ZCOA 1W3IA 5I3KA 1O5QA 4HU0A 1XCWA 3NPUA 2V67A 4Z2GA 2XWDA 3E0VA 2E67A 4QJ4B 1LWHA 3SRKA 1VCGA 1IZKA 2PP1A 4QG6A 3RM4A 1JD9A 5F4XA 1YTDA 2XIQA 3ZLGA 1DPMA 5I6SA 1JL8A 4MAZA 3UPBA 4UQBA 5DRIA 4C6IA 3HGJA 1SSGA 4BS0A 3UBPC 3OG3A 4PMNA 4REQB 1JDAA 4YLWA 1UZ1A 3AWOA 4QIUA 2VUNA 2W9MA 2VZOA 4F0HA 1FX6A 4L64A 3N2BA 4IMFA 2HNEA 3RK8A 4JHZA 1DIOA 1R3RA 4D8LA 2IXVA 1B3WA 3NM3A 5HJLA 3GXPA 5AC7A 2ZC8A 1HJWA 2G0WA 3LRLA 3QF0A 5G5IA 2FIQA 1EPXA 3VC6A 4WJXA 2DSWA 2V5DA 3MCNA 1J0ZA 3MVTA 1J0JA 1EWDA 3CPRA 2HZGA 1PPIA 3EMZA 2C0AA 5K3VA 1EIBA 3LU2A 2ZX5A 3C0JA 3PWGA 3FN9A 4GVGA 1JDDA 3DOPA 3LM3A 4JTIA 1Q6FA 1VEOA 2F84A 2VELA 4K8EA 2Y70A 2XU2A 3S2JA 3MBDA 4JIHA 2A7NA 4C6BA 1LORA 2HROA 4S3EA 4H9XA 1AQHA 2I16A 3UNTA 3PSWA 3O3RA 1D2KA 3P84A 2O7QA 2AL2B 7XIMA 1BF6A 2ZZ3A 3W26A 4MZ1A 2CESA 3IGHX 3THCA 4HYWA 4G9PA 3CHEA 1V02E 4FX6M 1EGVA 4WJEA 4NX0A 2QYGA 3V1HA 2E8YA 5KITA 1I2QA 2J7DA 3TW9A 4NUWA 3RX2A 4MNMA 4I9TA 3ZS4A 3QYQA 4UTFA 1HL2A 4ZXOA 5CPMA 4OBRA 2FKPA 3WK3A 3QY8A 2FVLA 3WF3A 2XFFA 3UZJA 5FJTA 4IMGA 1RQHA 3NDYA 1GVFA 1J93A 3B0YA 2OG9A 2GUUA 3HFYA 4ENLA 3MSDA 4RNIA 1KCXA 3KVKA 4K38A 3F5JA 5D8ZA 3EWWA 3FIGA 4U33A 2QKFA 3WBXA 5M1TA 3T55A 1GOOA 2J62A 3BSHA 3SSZA 5C5YA 4MG4A 1NJJA 2W3ZA 3W6MA 1OG6A 5I77A 5C9WA 3SEPA 5A94A 3GKAA 5BRBA 5MHBA 2A3LA 3P14A 4UOJA 2NWSA 2PDNA 1JJKA 2Z6JA 1M1BA 4YMZA 1E40A 2AQOA 4IICA 4JR5A 2BASA 1LTDA 2VM8A 3DG6A 2ZZ6A 5A1AA 1FWFC 2VEIA 4Y90A 1I1XA 3VKKA 2SFPA 1SR0A 3TZNA 4YTQA 1PX8A 3LGGA 4BCEA 4QDMA 4DELA 3BLOA 2R91A 4GYFA 3FAXA 4GQ0A 1EJRC 4KKXA 2Y7GA 3DC8A 2RHGA 1Q8AA 4HJFA 3AUJA 3KBMA 2ZUVA 4OBTA 1N8WA 2NQZA 3VNIA 4XSMA 1TPUA 3IUIA 1X1OA 1TCMA 3GHRA 3P60A 3S6OA 1THFD 2FJUB 1MEHA 1UMYA 1IT8A 3WUEA 2X40A 4IPNB 1ZAJA 3BW4A 1KM1A 1WZMA 4QAIA 3QHOA 1CW2A 4YWSA 4K68A 2YCKX 3KWXA 4H6EA 3S2MA 3KOYA 2PTZA 3K2GA 3NL2A 3TYDA 1H0IA 3LRMA 3AI0A 4Y9AA 1IT7A 3WLPA 1PWMA 1O4UA 3QMRA 1E9ZB 2FMNA 3AHVA 2PTWA 1V08A 4B92A 5ABGA 1UD2A 2HE8A 5MKGB 3QMTA 3KCLA 4W7UA 4DWDA 3VK5A 3H26A 3GTIA 4QM1A 1F6YA 3OPSA 4NJHA 2W63A 4X2RA 5FEZA 1YIXA 4G7EA 3HN3A 5D32A 1DJNA 5HWMA 4NASA 3WD3A 2BY1A 3K46A 1XYLA 4RL3A 3VOFA 3SCSA 3E3HA 2A5HA 5T9CE 4LAUA 1ZPTA 2QMKA 3GXIA 1QK0A 3UY8A 3CPUA 1M53A 4MM1A 3THDA 2BVWA 1W1TA 3T09A 3SI9A 5A6BD 1VS1A 2YDRA 1YBQB 1MW3A 2B31A 3GK0A 1QNRA 2E6FA 1DL3A 2WZEA 4RE0A 4AG0A 1UB3A 1KC7A 3N15A 3RO6A 1FCVA 2J6XA 1M65A 2Z28A 5HINA 1P0DA 1L6SA 4O1DA 1LOSA 2DU2A 3MB9A 1KLYA 2PLKA 3CJPA 2PGEA 3U7VA 4N9DA 5K2ZA 3TK7A 2GQ8A 2VR4A 4CQBA 1ZBCA 4AWTA 1QOQA 2PWGA 1VYPX 1VRDA 2QAPA 5LNUA 3SIMA 1TJ0A 1J5SA 4RLIA 3GDKA 2GQ3A 2PWFA 3ZIZA 2VQUA 1DQXA 4AVNA 3GO2A 3N29A 3SUVA 4GXPA 2QCHA 4ZE4A 1KQZA 2OJPA 1F76A 1Z32X 4HOZA 4BKNA 4TX8A 3L23A 4DWSA 2ZXBA 1NWUA 3TH6A 5HNRA 3N6JA 4MNKA 1IYXA 1TWSA 2UY2A 3N25A 2XIMA 1F6PA 4J3VA 4LF2A 3LENA 4X63A 3TWAA 4ZB2A 3NQVA 3T2OA 1XH2A 2YB1A 3EX3A 3AXKA 3LMYA 3LPOA 1KFCA 1SU5A 1N82A 4UWMA 2ZUWA 4GA8A 4WKAA 4UTTC 3P0XA 3BC9A 3AZSA 3IIPA 2OSWA 3XISA 2Q8LA 1D3GA 1CNVA 5D4YA 4NVTA 4LAOA 1QASA 3VO0A 3VGEA 3GSMA 1BAGA 2WM0A 3VM5A 1B54A 4LFYA 4HNUA 3GC5A 7REQA 3WBYA 3PP7A 6PTDA 1QPNA 3CS2A 3QZEA 1ZJBA 7PTDA 1GVQA 1W2VA 3GUGA 3F4WA 4CN4A 1W3KA 4RW3A 3S42A 4RPPA 4P7LA 1K4GA 2JALA 2E1WA 5E5CA 1EJTC 4L6HA 2QF7A 4MHBA 4P7OA 2J79A 3QHNA 1FA2A 1LROA 2QEZA 3CL7A 3CLWA 1S5VA 3WH7A 4BR1A 2BWGA 4FA3A 2GDVA 3W7PA 3A4JA 4O18A 4AXNA 1ZJAA 1TWWA 3FEQA 2AOSA 2F6UA 4GYJA 4DI9A 2O9TA 1YXDA 1AW5A 1A4MA 2D3NA 3QGVA 3RG6A 4TMBA 4LCSA 3OLGA 3GNPA 3NJ3A 3UXAA 2G3JA 4JY8A 3P6LA 1UPPA 2JGYA 4KMQA 1EYEA 4EP8C 1XUUA 3S83A 1XDLA 2ZZ7A 4HIBA 1TZ9A 4AIUA 2UY3A 3H24A 3AHZA 1QBBA 1ZP3A 3NR0A 3ZO9A 2ONEA 2VMFA 1M04A 1LJYA 1E9YB 4UQAA 2DZAA 4AZ6A 1MNSA 2CLMA 4ORMA 3QPEA 4FXFA 4NP7A 2JKEA 5FIPA 2PB1A 4MNLA 3VIIA 3NQCA 1W3NA 4HSNA 2ISVA 4W8LA 3GNXA 1K7FA 1BXNA 4YNGA 1D8CA 5T91A 4Z08A 3B3DA 1XLCA 4L4LA 3TN5A 4CLMA 2YPIA 3CASA 2QCNA 3CEPA 4A2RA 3BAWA 3RCMA 4LRTA 1YNYA 3AHYA 2ZX7A 4A8LA 1V3KA 1A5CA 1OF6A 3DECA 4NZ1A 1TPH1 1FDYA 4XV0A 5KETA 2A3EA 4DJED 1B0IA 5F2LA 1FHVA 1BPLB 4R9XA 3THUA 3F7JA 2AGTA 4TU1A 4X61A 3QTGA 5A6KA 3L66A 3E5PA 4H19A 2ZUUA 4KCVA 5A5WA 3PJTA 4JTFA 2DUZA 4UUIA 3ATZA 1ENUA 2ON3A 3M9YA 3NTYA 4PUMA 5HXMA 3N1AA 1IEIA 5HWJA 2OO6A 2Z6IA 1DXFA 2QVHA 1H2JA 3RITA 1I0DA 4O50A 1I0BA 3A47A 2NQ5A 3I65A 4PTXA 4RE4A 2NXIA 1FH7A 2QUTA 4XO7A 1ZENA 1UR4A 3GH5A 4KEVA 3RX3A 3OJGA 1Q85A 2CKRA 1WDQA 2VGIA 2ZRZA 1FTXA 1WZAA 3S1VA 4MJZA 2F8QA 1JZ8A 2ASHA 1QWGA 2WHMA 3ZT5A 4MWAA 4ZVJA 2Y0FA 4Q8NA 4XIMA 4JHMA 1S1PA 3SN1A 5BOFA 1BSLA 3ZJ6A 1X8CA 3GTHA 4MB4A 4KEUA 1TMHA 4LUTB 2J47A 3KBVA 1U1HA 3UXDA 1GJUA 3GW0A 1JR1A 8TIMA 2YCLA 4WKHA 3WLOA 2RH9A 2E25A 3SO7A 3KP1A 2OYLA 1LL6A 1ML1A 1KTNA 3EBVA 2D22A 4BHYA 5CGTA 3LCFA 1CXLA 2WVVA 3GS6A 4FOKA 4IX2A 2X1SA 4MPKA 1E5JA 1M7PA 4GGHA 4S1FA 1UWAA 1HP4A 3TNOA 3QC0A 1C8XA 1UH4A 1TFVA 2Y7FA 4BK9A 4JNMA 2W67A 1H5VA 2QPXA 3IJLA 3CMGA 4O16A 1F3EA 1Q4WA 2NT1A 4D6DA 4EOUA 3VZXA 3M5ZA 3T9PA 3AC0A 3RR1A 3V5FA 4LRSA 4YL2A 5RUBA 4TIMA 5LIUX 2PDFA 4NZJA 1R9YA 2Y2WA 4S3BA 5G4WA 4C6MA 2YLAA 4B5NA 1RALA 3NGFA 3U8GA 3PZMA 3DAQA 3S47A 3GX9A 3L68A 3P61A 1XLLA 4C6EA 2J27A 4FLOA 4IQEA 1XYMA 3O6CA 3NQBA 4JQ2A 5AZ1A 2BG5A 3FJ6A 3QGKC 4NJIA 1P0EA 1K7EA 3OA5A 1MQQA 3PZNA 4WDXA 4W5UA 2WC4A 3QOKA 4X3ZA 4IGMA 3GR4A 2CZEA 2GK1B 3WQCA 4KW2A 4BQ2A 4Y6GA 1XDJA 3UT0A 4I6VA 2V5JA 4HU8A 5A8PA 2ZX6A 2XWEA 1QMLA 3ANUA 4LAKA 5JQ9A 1KFJA 2OXNA 1LP6A 3EPMA 3CM4A 4QR6A 2PURA 3CL6A 5DRCA 2VOMA 2ZRYA 5H2ZA 1KBBA 2C14A 1QO2A 5EFFA 3RIKA 4IT1A 3B8IA 5T9BG 4JTSA 1OT2A 3AZRA 3FV9A 2YL9A 4J4KA 1XG3A 3S9IA 5CSRA 3H12A 2A0NA 1MUCA 3SIZA 4NXKA 3W7GA 2QMJA 1AVAA 4R9OA 1T8XA 4DBEA 2A7RA 3S2CA 1UZHA 1Q63A 3BMVA 2AGKA 3KAOA 2WHKA 5CZ0A 3M0LA 5C9RA 5LZLA 4YPJA 1T96A 1A3HA 4L1XA 3VZYA 4Q7IA 2E5DA 3RLVA 4BEUA 4DAIA 2H8XA 6REQA 2OZ0A 3LEPA 1OBAA 3IJ9A 2R94A 3VNZA 1FXPA 1TPB1 4OKDA 3A23A 1QWKA 1BVNP 3KTXA 1HFBA 1X39A 3WQFA 4ZQOA 5CBJA 1NM9A 3OVQA 2WVUA 4K1WA 1KTBA 1DXIA 2IKIA 2QUNA 4O17A 2CLOA 4LTSA 3OQ8A 1A0DA 3QV7A 1MO0A 2XTKA 4OUIA 4BFAA 5HNTA 1O1ZA 3L0KA 4S3GA 3C8FA 3P5YA 3WFAA 2BDQA 2BSLA 2Z24A 3RAOA 2C18A 3ARWA 2QDGA 4P8UA 4B90A 1UZ4A 4RUBA 2NXGA 4S2CA 2HBVA 3V36A 5DY3A 4Q7BA 1LCOA 3KHJA 1KTCA 2WC7A 2EHHA 1JDEA 4IGHA 4G7FA 3TONA 4AYSA 2GVEA 4UOZA 4AZBA 3L4TA 1KFLA 2XDFA 4U3AA 3BGGA 2J7EA 1WNOA 3FJLA 5AYXA 5BRPA 3SCWA 2XH4A 2PA6A 1N8FA 1KCLA 3I4KA 3O8AA 1VIWA 1WXYA 3OLDA 3ZXWA 2V5KA 1IE7C 3TJLA 3A4AA 2PLJA 4RV8A 2CPUA 1XS2A 4BA0A 1OG0A 4Z42C 5BZAA 1S3TC 4L5ZA 1F7BA 2FPTA 3HBLA 3F5LA 5E9AA 3BK0A 4WXYA 4ZQMA 3S5OA 4MY1A 2VDGA 4G2DA 4IPLA 1FWSA 2XFWA 1GVOA 5FESA 1NDWA 1O66A 1DEDA 4GISA 2DT3A 3KHDA 1BHGA 3MI3A 3WLIA 2J7HA 1TWDA 2UZ9A 2BGNE 4JFUA 4RKAA 1W3HA 5LNRA 3QFWA 1V0LA 1ZBVA 3QKEA 2GVLA 1ZY9A 2VHLA 6ALDA 1M9HA 3OBAA 2D0HA 1QU4A 2EQDA 2JF6A 2B7QA 1LQ0A 4JL1A 1HUVA 1I6NA 1YMYA 4L61A 2C7FA 4M7TA 3TFCA 3O0FA 1S1RA 1XP3A 3UA4A 4DI8A 2PLMA 1SFJA 4XB3A 1VFMA 4Y9OA 2V5CA 1S5TA 2WJZA 1JAKA 3W25A 1ME8A 2VGGA 1JUKA 1CIUA 3ALGA 4F4RA 3H53A 3QQ1A 3R0UA 3FNDA 3N9SA 4ERAA 3R5EA 4JD4A 4RXGA 2R24A 4QITA 3W1MA 1E4MM 1R2SA 4QTGA 1GEQA 2NV1A 1E1EA 3BCFA 3E74A 3USBA 1CWYA 4JFTA 4POCA 3VKDA 3VIHA 1F73A 1TB3A 2ZVRA 4Z1YA 1OABA 3FSUA 2Y5JA 2DZBA 2BB0A 1CXIA 2VEFA 3LV5A 3UZ5A 1I45A 7TAAA 1J0YA 1T6MA 1DJXA 4EPEC 3SFKA 3CHCA 1US0A 3BAYA 3UCCA 1KR1A 1K4HA 2ZTKA 4P2VA 3PZIA 1OGSA 1PIGA 3NQEA 1FQ0A 4DM1A 3VKAA 2VC5A 1SM9A 4OOUA 1UC4A 1KA9F 4BF7A 5D2YA 1RP8A 4W85A 1AH0A 5CPQA 2XSXA 1HTIA 3B8TA 1GWJA 2VUYA 5KINA 4LBUA 4FX7A 4F66A 2PDGA 3DBNA 3SURA 4NZ3A 2GJLA 1QOPA 3OEXA 4A29A 3FA5A 1AJZA 3POHA 1QPQA 2V81A 1ONWA 4LEQA 2OZTA 4G7EB 3L2MA 5G2HA 5JIWA 4RDWA 1DWIM 4S3AA 4HHPA 4CQ8A 2ZBTA 1G7VA 3H4GA 3IIZA 2OYKA 1TPEA 5HMEA 3QTPA 4DWSC 1XYZA 1PKNA 3URQA 4GHRA 1R7AA 2ZYFA 3BDKA 5CBIA 1UR2A 3CB3A 1E6PA 3NZGA 4LYKA 3G3MA 2UY4A 4F0SA 4O12A 4BQ3A 3S1WA 3AXXA 3G77A 2GGJA 1XIJA 1JZ6A 1FXQA 1E6QM 3OTRA 3TEVA 2G3NA 5C7HA 4WX2A 2NLIA 4WDWA 4NYUA 1EDTA 3F5KA 3VDCA 3O07A 3EX2A 4CCZA 1BTMA 3GAKA 4ZO6A 5DY2A 3BARA 3HU7A 2ACQA 3W74A 3CH0A 3E2VA 4GO8A 2FH6A 1VQTA 3DDMA 2ABBA 4DZAA 3W7EA 2QXWA 2CFFA 4AWSA 4DJFC 3BJFA 4DPQA 4DWSB 3B05A 2Y8VA 4URIA 3DYOA 4NRSA 3FJNA 2FZDA 2P8BA 1RHCA 1PKMA 3XINA 2DSKA 1DQWA 6TAAA 5I3FA 3HA1A 4XZHA 2G5WA 3MV01 3MUAA 3ZQ9A 1TV4A 4FALA 1LF1A 1JZ2A 2WNWA 1XKYA 3HF3A 2VDHA 2YR1A 2Z2UA 3LTPA 4HZMA 3BLFA 3SSJA 3PY2A 3ENLA 2B4GA 4AQLA 1OJXA 2QJGA 7REQB 1K3UA 1I60A 5CZKA 2OSYA 1DJZA 3LYEA 4O1AA 3ONCA 3PJUA 2XSAA 3SUTA 4F0RA 1A0EA 3V35A 1OK6A 2FQIA 4EPDC 4O0ZA 1XIDA 1NFBA 3TOPA 1M5WA 1L6GA 1EGZA 2TMDA 4AWEA 3LA4A 1ZALA 4U5IA 4CQ9A 3LHWA 3NQAA 2F7FA 3TW6A 1OWQA 3L65A 3GVGA 1H63A 4LXFA 4Q8TA 1EJWC 3IJ7A 5IOBA 3STFA 3WLKX 4UFMA 2I9EA 1TR1A 3DUGA 4YU1A 5TD4A 1Q7QA 4F48A 3UJFA 4LNCA 2QJNA 5EA9A 1V6UA 3N13A 1FKXA 3BPWA 2VENA 4ZSTA 3GXMA 3BOXA 4V15A 2PLCA 5CG0A 2J6VA 4GY0A 4FZIA 4XZWA 4S3DA 1YE6A 2I5GA 4H8NA 3TMQA 2EG8A 2VD9A 1QNPA 1Q2RA 1KR0A 1VJIA 3IGUA 4UMBA 1LLOA 4Z2JA 3QC3A 1E0UA 1IZCA 2YBUA 1XLJA 4HNLA 3VE9A 3K4DA 1ITQA 3DFHA 3WELA 3SCPA 2BTMA 1E6SM 3AWNA 3OG2A 3PFMA 4GXWA 4G1NA 1NELA 4QG8A 3PZOA 5D37A 4KBXA 2E0PA 4GACA 3SN4A 4B5WA 2DIKA 1XLKA 3EKLA 2YDSA 4H8VA 3A9BA 2BY2A 4DF2A 2ALRA 1R46A 3H2EA 2VC9A 1ISYA 3SCTA 3LMZA 4O8RA 4B5UA 2G41A 3GIPA 3CQIA 4OZOA 4IFOA 2RJGA 3WDPP 1FCQA 2WWDA 1JCLA 3MWAA 4ERIA 3BAIA 5FCZA 5FD0A 4GIYA 5I3HA 2D2JA 1TWIA 1EGMA 3N17A 3NPWA 3KDOA 4WGXA 1X98A 4EPBC 4YJ5A 1VEPA 2CWNA 1IXOA 1TV7A 3W24A 1ZP4A 2E6YA 3TAKA 2VZSA 3QRHA 3TUUA 2YYTA 3NXLA 4FLRA 1UQZA 4DJDD 2FPVA 3LOTA 3LBOA 2GQ9A 3UG3A 3G3DA 4RW5A 1I2PA 4OU1A 4IIEA 1GTHA 3GBDA 5DMLA 4H6KA 1T99A 4HN4A 2JIWA 1T8QA 1XIFA 5A95A 2WZMA 3E12A 3GDTA 3G8RA 4OHQA 3B0XA 3ITTA 4D6IA 3RO8A 1J0IA 2WVVB 4W86A 3GRIA 2UWFA 2OWCA 1BXBA 1XM3A 3NSNA 3HGRA 1Z69A 3T7VA 2BHZA 3LLXA 1W1YA 1WDWA 4L9ZA 4K37A 3WNMA 1CGVA 1F4AA 1NDVA 2YL8A 5G2IA 1PSCA 1NVMA 4DF1A 3GU2A 3A5VA 3QPZA 4D8ZA 1FDJA 2GVYA 5EYWA 1KBIA 1IGWA 4J3WA 1LBLA 4JN6A 2WPBA 3VX1A 3UP8A 5CEWA 5AN7A 4WD0A 1IXQA 4ZQCA 3F4VA 4FEZA 2Z26A 3P8IA 3LK6A 4UQ9A 1WAWA 3GAYA 1QUMA 3VKJA 4O57A 1K9EA 4V2XA 3SBFA 3MHUA 4J2PA 5D9MA 4AFYA 3ARYA 1UD4A 1XXXA 4GY7A 3H23A 3BV4A 4LUJA 3IIXA 3EOEA 1F8IA 4H9VA 4GINA 1O95A 1TJPA 3ZWTA 5A6SA 4JTLA 3B8DA 4OV9A 4IWWA 3LERA 3BJTA 3GVVA 3R13A 3H7VA 4PYSA 3OIHA 4JTTA 1X1ZA 4MYAA 1J4EA 4V27A 1KRCC 3GHTA 1AL8A 2NUWA 1ECEA 4NI3A 2PDBA 3MCMA 3FLUA 2A7PA 2CBUA 3UA3A 1R5YA 3B8UA 1BG9A 3WNPA 2EG7A 4HZ6A 3DHPA 3F1QA 3H8AA 4E8DA 4PBGA 3CO4A 3G0XA 4KRZA 5HULA 4NQ1A 3CHDA 5C0QA 4WKFA 4LC8A 4PMQA 4GIEA 1PIIA 3VA8A 3G2GA 4DBSA 3WQVA 4YCPA 3UWEA 1OC6A 4NAEA 2YKKA 2G37A 6REQB 1GZGA 2V63A 4ZXLA 5BRQA 3IS4A 1BRLB 1FHUA 4YTUA 3VD5A 3TW7A 2Y7DA 5IFTA 1K70A 1CXKA 4GKTA 5IHSA 1PX4A 2PEVA 4ASTA 1D3HA 3WSUA 3H2CA 2VTFA 1FH9A 4JTRA 3W2NA 2DQXA 2YA2A 2XFYA 2VVSA 4QEHA 4LUSA 1EJVC 1W56A 4MJMA 1TO3A 4PUJA 3VNKA 4LAMA 4US5D 2WVTA 5HR6A 3NDOA 3MSGA 3VMOA 2A3CA 2GYIA 3Q37A 1UQYA 2FDSA 3M4HA 1GKPA 3K1DA 3TQ0A 2OKOA 3EEZA 3S2LA 1UJQA 3NAVA 4F3HA 1WO2A 1S2WA 3WLRA 1QK2A 4IPJA 1Z8AA 2EJAA 3TXVA 4D9PA 3FXYA 4WSHA 3DYPA 4LV9A 3G22A 4MDOA 4ROQA 4AY8A 3QR0A 4H7CA 3TROA 3EKGA 1UR3M 2Y8KA 2GJXA 5F2IA 2OZ3A 3LTSA 4AD3A 4HNOA 2FHBA 3RU6A 1RPXA 1FHLA 2QCDA 1DE6A 5JU6A 3CQHA 3RGTA 3BAXA 3W22A 3H22A 1RA5A 3AIUA 3ARUA 1J6PA 1O60A 1EXPA 2QZRA 1JCJA 4ZA0A 1X7FA 2RJHA 3W7OA 4IP5A 1MI3A 2H3BA 1IXPA 2BHYA 5K7JA 2X8RA 1RBAA 3FYPA 1EQCA 2A3HA 3A4WA 1J8VA 1HKJA 4JCLA 3TR2A 2PBOA 2REQA 1WKDA 3CAWA 1LDCA 5C9UA 4XIAA 1UR8A 3WF1A 3P3BA 1OGBA 3GNRA 5A2BA 4C6LA 1KW1A 3N3TA 2IPWA 4M6QA 1S5WA 1XQLA 3CO8A 5FJUA 1QR7A 4GXMA 1LOQA 1GCYA 1WKFA 3NVTA 4PSRA 3H55A 2PU1A 4U2ZA 1L6FA 1Q6OA 4FIRA 2ZQ0A 1E15A 2XH2A 3EWZA 1OX5A 2VR5A 3EZ4A 1EXBA 2Z00A 2EPMX 3PANA 2CLKA 3C3NA 1W8GA 3LM7A 3WMLA 4DBUA 3TU9A 2POTA 3CUFA 4ILSA 4RK8A 5KTLA 3KOXA 2HV5A 4PCPA 3TFXA 4Q4QA 3N73A 1J11A 4J3TA 1TCDA 3QV8A 1P48A 1OX6A 1VENA 4ACZA 5DXXA 3QLDA 1VC4A 4MYXA 2XVLA 4FXRA 4GC3A 4Y9MA 1PEZA 3MPGA 1QVBA 2NQ9A 1CGTA 2OKTA 4AVFA 3QFEA 1TIWA 5EFDA 5EBUA 2DZXA 3CUXA 2NUYA 1NIUA 5LGXA 5CGQA 3PULA 2ZXAA 2Z1WA 2W62A 1EQPA 2V3FA 1OFRA 1GYNA 2PDUA 1HL8A 4NHVA 4Q8WA 3MT1A 5C70A 1MQRA 3OIXA 5A69A 4B2DA 4TTUA 4N4QA 1GQNA 1VFOA 1FWTA 2VEPA 2AMGA 3CU2A 5HPOA 1WDDA 3W1LA 2PPGA 2BOGX 4YHGA 4C65A 3HG3A 1AW2A 4XD5A 3N2CA 1DHKA 2DP3A 1TPVA 2E7FA 4PMZA 3UQNA 3AFBA 3LXAA 2GWNA 4HPHA 4EANA 1OFAA 3DZ1A 1XIMA 5CQ1A 3VAVA 4EE9A 3W29A 1SUXA 2C3ZA 2IUZA 4NKCA 3A64A 1E9LA 2RGMA 5EGRA 3AICA 5HMFA 4XWUA 1N2VA 4TVUA 4HCLA 3EWCA 3GM8A 4PN2A 2XGBA 3TZFA 3UXLA 1EOMA 5ECVA 2PP3A 1VB9A 4JZ5A 1A5LC 4XVDA 4CCEA 3QYSA 1G0CA 2GJPA 4HYVA 4J3SA 1PS9A 1LQAA 3BSMA 3P93A 1WQ5A 2ZE3A 3URBA 3POCA 3VDHA 3M0XA 1UR0A 4Z1AA 1XINA 3VUPA 4IIFA 3OHIA 1ZLPA 8XIAA 2P3EA 3LXCA 3UWYA 3TOYA 1X6NA 5HA7A 5F1UA 4ZQRA 1QNSA 4REQA 4YXGA 3G1HA 4ZOBA 1M7OA 1Y5VA 2WZHA 5CC5A 2E5BA 2ISFA 4GOAA 2YX0A 2R1KA 2PRMA 1O68A 2HBXA 2WPGA 3ZZ1A 5HBFA 1BEUA 4PRWA 4ICCX 1HKVA 3W1XA 1XG4A 3IJQA 1MVYA 1KFWA 1Y65A 2G3MA 1ADOA 3G8EA 1TPC1 5CPTA 5A3HA 4JS3A 4HYRA 1BSIA 4OTKA 3QH2A 3WH9A 3UGVA 2QPSA 1VD6A 3DI0A 1FCBA 3PZTA 4O14A 1YE4A 4P5UA 4GD0A 3NVDA 5REQB 3UJEA 4LWWA 2VI0A 1H0GA 4GI4A 3EXRA 4AH7A 2BVTA 4U5KA 1W1B1 4WF7A 2GOKA 1B90A 1XYAA 1SMDA 4GZ7A 4UB9A 3FW6A 5HMSA 3DFPA 4C7DA 4PMDA 1NP2A 3VD9A 4P8VA 4LOCA 4M82A 4PMUA 3CWOX 5BXPA 2AL2A 4NZCA 1PZ2A 1F3XA 1RCOB 4A35A 3W7IA 2C6QA 4LH8A 8RUCA 5FAJA 4FLQA 4XKYB 4B9ZA 2J25A 3T2PA 4AX7A 5FJPA 3PAOA 2G3FA 1JNDA 2BXYA 1LBFA 2YCIX 2UV8G 3OGVA 1QT1A 3AS0A 3VOJA 4I3GA 4DLMA 1XISA 2G4FA 3TN6A 4F0MA 2J74A 2J8FA 1LOLA 1VJSA 5TIMA 3AIEA 2G3IA 4Z2LA 1L2QA 1V3IA 1FP9A 1E56A 3KS5A 4DPPA 5A6AA 3NZQA 5DT7A 1V93A 3OYXA 1JIBA 3ZR5A 2VCAA 3OODA 4WUIA 4YWIA 4XD6A 1GVEA 3HPAA 4HHLA 1FWCC 1MQPA 2R8WA 3PJXA 1A4LA 3WJSA 4KFNA 2GFTA 1XGZA 1UCWA 3BWWA 5D03A 1RBOB 2ADAA 1VBHA 3M64A 3R12A 1H1NA 3V7PA 4MSSA 2VEGA 4QBXA 3TCSA 3GXNA 2CIPA 2AMXA 4IMAA 4JEJA 2BHUA 3WQWA 3AIVA 4GG9A 1FVPA 1O94A 4Q4OA 4A3QA 4R3UA 3WF2A 5CJ5A 4PMYA 1E70M 1NOWA 3T0TA 4LV4A 1QHPA 4MZYA 2ZADA 3KRBA 3HO8A 4YIWA 4F2BA 1TQJA 1HN1A 4DEFA 1SJDA 4JN7A 4TXEA 2OZ8A 5FF4A 4BI5A 1TWZA 4O4VA 5DLCA 1HW6A 1SW0A 4LVFA 4I6KA 2XPKA 1ZHAA 2CYGA 1RLDA 3ES8A 5HDRA 2C79A 1LZOA 1EEXA 1H61A 4XZLX 1XRVA 1Q7ZA 3BW3A 2QV5A 2E3ZA 3PZGA 4IGNA 4V1YA 3HIJA 5FL0A 1K8ZA 3AS3A 3OZMA 3N4AA 3W9ZA 2Q6ZA 4O1BA 2DZPA 1HO4A 1Q6GA 1AL7A 4CD8A 1W54A 5GNZA 4ZENA 1F05A 4PUNA 4C6DA 2E09A 3GH7A 2WK2A 1OQFA 1OB0A 1P4CA 3GFZA 1TX2A 3VIJA 4XZBA 1E1CA 3R43A 1TIMA 4IMCA 3UR2A 4JICA 4PFHA 4EF9A 2UBPC 4QE5A 4JTCA 3ID7A 1CB2A 3BLKA 4CNTA 4L7ZA 1GQKA 3KZPA 3ARXA 3ARZA 2J78A 1V6XA 3ERPA 3MUIA 1UUOA 3TYAA 1R6WA 2HXTA 5EU9A 5EB8A 3IGSA 1GORA 4EXAA 1YADA 1EYWA 1YEYA 4PA8A 1YBQA 3CAKA 4C60A 4UTWC 2P10A 1EP3A 1NU5A 5BMWA 4ML4A 1AJ2A 1H7WA 3KW3A 4XKMA 2VO5A 3VGGA 5C7VA 4KQNA 3G1VA 3Q2DA 2ZTJA 4JDYA 3O9NA 3K8MA 2WLZA 3NWRA 4B16A 1LWJA 1GW1A 1M01A 4OWGA 3PHAA 4AZHA 3VKCA 1EDQA 3WZ0E 2V3DA 1P5BA 2JFEX 3NNTA 3W1AA 4JKMA 1SO3A 1JUBA 7CGTA 1V03A 3VGBA 5K9XA 3RPTA 1OCQA 4E2DA 1JZ7A 1WB0A 3R1ZA 2WKGA 2VC6A 4JTUA 3DGRA 4KWOA 3BGJA 4CD5A 1IIGA 5HQLA 2XN0A 1B30A 3PBWA 2GSEA 3B8VA 1UG6A 3ORWA 3S5SA 3ZJ7A 3QGAC 2INFA 3P7YA 3VVGA 1C7SA 3GVRA 3BANA 1QI3A 3FKRA 4DJEA 3ARSA 5EMMA 2GJNA 4WIWA 4C6JA 1SO6A 2AAMA 3T40A 2AQVA 3G1FA 4HB7A 3CUZA 1O5XA 3KS6A 3H2FA 4JQ4A 3V4BA 1NF0A 1XLIA 5LNWA 2VRKA 1C90A 2DVTA 1VFTA 1LRTA 3TQKA 3WNOA 4UFJA 3E6EA 2GOUA 2D24A 4MTVA 6CGTA 1G4PA 2I1OA 1YPIA 3WQGA 3B97A 2C1IA 4P7RA 3DX5A 4GVIA 3WQDA 1M7JA 1OFBA 4MPQA 1EJUC 4H9UA 4FXJA 2W5FA 3VNDA 5A6MA 3ES7A 4IUOA 3DCPA 4PEKA 2V2HA 3WCZA 1U22A 4NAEB 1O12A 3JVAA 2B0MA 2QF8A 3KCJA 4GZIA 3GNNA 4R7WA 4W89A 3WBAA 2F61A 3CZGA 4JDBA 4AZCA 1I2RA 4NZ5A 3M0VA 2V9DA 1RY0A 3LCIA 4LSBA 4JTDA 1KKOA 4HNTA 1PX3A 3MUY1 3NA8A 5CJMA 5G4HC 1XYBA 1IWAA 3SRHA 1XBZA 2J75A 3GTXA 4JOMA 1RK5A 1DJWA 3E2QA 5C71A 4QLJA 1DWAM 5DO8A 1PCWA 3L9CA 3TCEA 3RILA 1HVXA 3CGTA 4KPLA 3LBCA 2OX4A 2WOQA 3L4UA 1KGXA 1AH4A 4J1OA 5DMNA 3W2UA 2OT0A 3MMWA 2H8ZA 4FX8A 3KP0A 1QRQA 4KETA 3VKBA 4J27A 2X7VA 4RNJA 3LPFA 2J7BA 4QJ3B 5DFAA 1ITUA 2DGAA 2E5CA 1L2UA 1W1A1 5M2FX 2C19A 4A21A 1BXCA 4TVCA 4PE8A 3UWWA 3TAOA 5I3JA 3FCPA 4WQ6A 3LI0A 5JBFA 1NF7A 3WMSA 1JVNA 4CCCA 3CPGA 4WSKA 3W1TA 4Q8VA 1CCWB 1V7YA 1R3QA 3FA3A 5F7UA 4PZVA 2GGIA 4D1IA 1ONRA 3NIYA 3FAWA 4B3LA 2GJXB 3OBKA 1LRQA 3TX9A 1EWEA 1V8EA 3OU8A 2NVDA 2QCDB 5AY7A 3UJ2A 1DP0A 3GDRA 2Y5EA 2JIEA 1NQ6A 1ZAIA 2YZ5A 1KGUA 3PZVA 4PTNA 1ZNNA 1VLIA 3R25A 1AODA 3AROA 3Q67A 2REQB 4NXSA 2JE8A 2QV4A 3GYEA 1PB0A 4IJRA 2BX7A 4GCAA 2WJDA 2O0TA 5TBOA 1XC6A 3URNA 4UTUA 5AFDA 1Q45A 4I9AA 1A5NC 1EC7A 4HMCA 3NQGA 3Q45A 4GLEA 3JZEA 5HNUA 5CC7A 4F8XA 5K4ZA 4C1LA 1JPHA 3NQ2A 3MC5A 3TN4A 1D7FA 3TWBA 2PWUA 3IPWA 2VL4A 2WW5A 2RDXA 1MDRA 3A24A 3TE9A 1YRRA 1YDOA 2NT0A 4Y96A 3RUBL 1LT7A 4AHQA 5ABHA 1KM3A 3KEHA 4J35A 1J0KA 1JCMP 4M24A 4FPSA 3UNDA 1SPQA 1HKWA 2WHLA 2QJHA 3DHFA 2TSYA 4UFHA 3UETA 4MOZA 4K2SA 3A3XA 2PTYA 1GT8A 1R85A 1QCWA 1UOZA 4UIOA 3FYOA 1TV2A 3UG8A 1QNVA 3E49A 1Y5XA 4ACZB 4S38A 1OCNA 4MFDA 1B5TA 4V33A 1UP3A 4CGTA 3DG7A 3VTRA 2FB3A 4KEMA 1LRNA 3W37A 3QXBA 2VCBA 2B81A 1UWTA 3DH7A 1AK5A 1F07A 4HT3A 3UWQA 1QOXA 2XM1A 1ISVA 3TVAA 1J2WA 1NARA 1CXFA 1H7XA 1HVQA 4I8YA 4PEEA 7A3HA 2OQLA 2FDMA 8A3HA 1OF8A 4GJ1A 4TV6A 2R1LA 3C0QA 3F4DA 3ZVHA 1KQYA 3EX6A 4LB4A 4HGXA 4MWAD 3SQLA 4DXKA 4TO8A 4DQWA 4Y8FA 1TA3A 1HXJA 1G7UA 3ITOA 5EPDA 5KZ6A 1KFKA 2YA0A 4PL1A 1BWKA 2ATSA 4F2UA 3VE7A 4JKLA 4GH1A 3C0LA 2A3AA 3MKCA 3VCNA 3M41A 4RE2A 3BLLA 1XSJA 3LRKA 3PZQA 5JUVA 1ZRQA 1OCBA 3OW1A 2PBGA 4CNOA 3BLIA 1SZNA 1JFXA 1TQXA 4MAVA 1MFVA 3QM3A 2D2OA 3DEQA 2YYUA 1ECQA 2BP1A 4GZEA 2WB5A 3B9NA 1MFUA 3B9AA 3C2OA 3NO1A 4Q4RA 3INPA 5E0KA 2J8GA 3JUGA 4FP1A 5AYBA 3A6OA 4WSJA 1VAHA 4C6FA 4ZCWA 1Z9AA 5HAOA 1ZQ5A 3ZR6A 3ALFA 5JH1A 4F0KA 1PBGA 3AZTA 3UVAA 1XLFA 2F9RA 5LXEA 2DIJA 3MYOA 5K9CA 1L9WA 3T2QA 1Z42A 5I3IA 4LVBA 2HNHA 4GC4A 4IQJA 1J2BA 3SCOA 2Z1SA 4DAFA 3MS8A 3OYZA 4D6EA 4WK9A 5CZTA 3DBPA 2PCQA 3A9IA 1XLGA 4AISA 3HJEA 3IJ8A 1JPMA 1US2A 5I09A 3T05A 3W6LA 1A5BA 2DFAA 1PZ3A 4C7GA 4BQ5A 1ALDA 2WBGA 3WQ8A 3FHAA 2ZRUA 2IQDA 3GG1A 4HCHA 4TTGA 1JQVA 1J18A 4M5PA 5LIKX 3WJZA 1P6BA 4JIQA 1BWVA 5I79A 3EOLA 2AKMA 2J7CA 1Q5MA 4ZE5A 3N6QA 1EBGA 2IKHA 3OGRA 3NUKA 1NWRA 1QI0A 1TVLA 1V6WA 2QDDA 3TC6A 4Y2WA 1IR1A 1HT6A 4O54A 1VBUA 3B9EA 5LIXX 1I8JA 1EC9A 3GTNA 1O6IA 1KCKA 1X6LA 1SJCA 3W1NA 3QVQA 3UJRA 3I6TA 2TPSA 2WCAA 4DN1A 4IXXA 3DHDA 4XG1A 1C8QA 2FHFA 1EDGA 4KS0A 5JXQA 4E3VA 1ZCCA 2G4JA 1FWAC 2TYSA 2ZWYA 4LVAA 2WMHA 3VCRA 4UMCA 3JU2A 1FRBA 1WXZA 2CU0A 2VFGA 4MGGA 2QNEA 4B4FA 3EYPA 4WLCA 5GJMA 5F4WA 1FKWA 4GUHA 4J3XA 5IBXA 8XIMA 5CKSA 4GI8A 1JNEA 5M3WA 1JYNA 2X0YA 3GDLA 2PGFA 3WK2A 3KBNA 1LG2A 4OJYA 3EMCA 2HISA 3QOMA 5EMKA 1V7AA 5H1WA 4ROPA 3RLUA 1JXKA 2HS8A 1KV5A 2QJIA 4GH3A 3GUWA 3CXOA 5CLWA 3NSXA 5KZMA 3QQ0A 4W8BA 5BWFA 2AAAA 4X2PA 4QDPA 4P8XA 1E55A 5C9XA 3MKVA 4IHCA 3BLPX 2CHNA 1GJPA 4HK7A 5CPLA 3FEMA 3DU0A 4IG2A 3ABZA 3QZ6A 1BKHA 1SZEA 5FEWA 2DZUA 2J8TA 3FK4A 3N34A 4EKJA 4XBKA 3W3OA 2NLYA 5JH2A 4A22A 5M5DA 3EA2A 3TC3A 3L0NA 3VIOA 2ZRWA 4L1GA 1IEQA 3W71A 1GOWA 3C52A 2CBJA 3SFWA 4JNZA 4LS1A 3UY7A 3A21A 2PDQA 4S39A 1JCNA 3R0KA 2FVMA 4F79A 3WL0A 4IMEA 1M03A 3VXGA 2VNCA 1AUSL 4AEFA 3FA4A 1RQEA 1FWWA 3N2OA 2WMKA 3WEZA 2ACSA 2PDCA 2YL5A 3APTA 4W7WA 2O4MA 3EX1A 1TVPA 4OECA 4OE7A 3BJSA 3H21A 5TQLA 4PUUA 1Z44A 4RXFA 2XVNA 4E2BA 5HNNA 2FJKA 2POZA 2DT1A 1GJWA 5AHMA 1ELSA 3F4CA 4M6PA 3U5YA 3PUOA 4TVDA 4JTQA 3P2VA 1VFHA 3PS7A 2P8CA 4AW7A 4DBDA 3WLQA 3OO2A 1WBHA 3VIGA 3R94A 3G0UA 1JZ4A 4UR8A 3GD6A 3LCHA 2ZRXA 1PZ1A 3MP4A 3T08A 4KT2A 3GYCA 4R33A 3W2LA 4LC6A 4TX6A 1F61A 1H7OA 3OHMB 5ABFB 1K6AA 1JF5A 2IPFA 2DT0A 3W73A 3PAJA 3ZWSA 1E72M 2OODA 4IUGA 1E1CB 3GXFA 3SY1A 3W28A 3W83A 3WD1A 1SVDA 4A3UA 3VU2A 5H8MA 3KE0A 4HPGA 3MZ2A 5C9ZA 5HJXA 4GPNA 1P0KA 5D30A 3RRXA 1RCQA 4D6GA 1MRQA 2RAGA 1YPXA 4C91A 3MANA 3O05A 5DANA 4WR3A 1V77A 4O8AA 2V5LA 3HOJA 3H7UA 1OZQA 5FF3A 1R9XA 5L9FA 3YPIA 3M5VA 4DJEC 3N18A 4W5ZA 2WCGA 1VFSA 5FF0A 4XTDA 1EX1A 5HUPA 4RDYA 2XVGA 1QFEA 1AFSA 4WOZA 1V51A 1VP5A 1R30A 1ODZA 3VZZA 3KTSA 2XISA 3FS2A 3PBYA 1X1NA 2F6XA 2Y62A 1OYAA 5J5RA 4E4FA 3CYVA 3W27A 4XAYA 1TPWA 3LHUA 1JD7A 1R3VA 2ODOA 3MJYA 3GIQA 2LLEA 4ZR8A 3SR7A 4Q3MA 1V6YA 2QGYA 2Y89A 3LNMA 1MXGA 3IVTA 4UC5A 2GWGA 2XZ9A 3P74A 4FLSA 3EWDA 3AISA 5D9OA 1BYDA 2HEJA 3V3WA 4HKPA 3BXWA 5HUOA 4DIAA 5A6TC 3PPCA 2OT1A 4UZUA 1QNOA 3LCXA 1LUCB 1Y5WA 4DZ5A 4EIVA 1SZGA 4NJKA 4UBPC 3T78A 2E6DA 1XLEA 4LUIA 2G8ZA 3OZOA 2Y63A 4C5ZA 3UYCA 3FDGA 3MO4A 2PWEA 1W9UA 3PTQA 4QLLA 2ZOXA 1RZMA 2GUYA 3H2OA 3WENA 2FVKA 3NZ1A 2YIHA 2H9AA 6TIMA 2X30A 4WJ8A 4LUYA 1EUAA 1WOBA 2JKAA 3BTNA 1PYMA 3KLLA 1N7KA 1CPUA 1C9DA 4KIEA 5E93A 2W0UA 4IIHA 3SECA 3GG7A 1ONEA 2VD8A 3PK7A 4AC7C 4J3ZA 4JPGA 3EB2A 2GDQA 2CHRA 1CGWA 2V6AA 2NXHA 2FLIA 5FL1A 3K1GA 4DM2A 3EPOA 1FWNA 4BI7A 4ZB5A 2WJEA 4LANA 4JL2A 4LBRA 1YKWA 1TJRA 2PE4A 2B7PA 2CKSA 3GLCA 3H7RA 2E1DA 4UMAA 4DJFA 1Z41A 4PR4A 3SGGA 1AQ0A 5BROA 3RM8A 3SUWA 5HATA 4QNEA 3I3EA 4Q8UA 4GJIA 4DJDA 2X1TA 4ATDA 3LX9A 1LLWA 4AZCB 1H3GA 2W61A 1EJXC 1POKA 2QCEA 3SAZA 4NX5A 3NZPA 2YFNA 3IAPA 4P61A 1KCZA 4QHRA 4O19A 2YCJA 1B1YA 1UA3A 1XHGA 1Q65A 2D69A 3E9AA 2NV2A 4PBFA 3C56A 1S2CA 3GXTA 4QISA 1GONA 5BWAA 4MB3A 1AZ1A 1VBRA 3WQ5A 1DWJM 4FNRA 3FVDA 1XIEA 4DYEA 4X9YA 3NEHA 4FNTA 3O0KA 4JX6A 4E2OA 3IIOA 3KUMA 1NTHA 5MF5A 5I3GA 2JEPA 3HG5A 2ZZ2A 2CBVA 3HGOA 4P7QA 1TTPA 2ESCA 1P1XA 2PDKA 3RXZA 1VLWA 3CYJA 4QNWA 3CWNA 1BLIA 3IARA 4OV4A 1V3HA 3LSCA 4HNVA 3UG4A 3BG5A 1FUYA 4OVXA 3B04A 1DJGA 3BZGA 3RDKA 1UIPA 3T8QA 2C91A 1OGGA 1CGYA 2OO0A 1KBJA 5AHIA 3WDQA 3PNUA 3W85A 2IKJA 3K4AA 3AMDA 2PZ0A 2I17A 3I7QA 3D0CA 3FOKA 1KD0A 1E4NA 3G1DA 2VX7A 4LJ3A 2HVMA 4OFCA 4QP0A 3BLDA 1X96A 2W92A 3WMBA 3OVGA 4I7WA 2Y8UA 3PZUA 4UFKA 3IEBA 5H8UA 1XCFA 3WLSA 4H4IA 1IT0A 1RV8A 5FEXA 3G0SA 1O7AA 1IWBA 3S9ZA 4HZ8A 1KRBC 3RJXA 3R8RA 1W9XA 4LVGA 3PTMA 2BGSA 2WMIA 4EF8A 3Q65A 2DSUA 4HP5A 1H51A 3ATYA 2ZC1A 2OQHA 2HVOA 3AU2A 4DBWA 1KRMA 1ODUA 3HPXA 4WRHA 2CZVA 1CDGA 3BMXA 1POJA 2XH0A 3LDVA 1JAEA 2Q02A 3DHUA 3K13A 1GK8A 1WUEA 4MFEA 1Y8BA 4DY1A 3GB6A 1J5TA 1Q6DA 4YS1A 1HKKA 5KZEA 2XZ7A 4S3CA 4TMCA 1UP2A 1YLVA 2C16A 1VCVA 2V0TA 1G69A 1QW9A 3D3AA 3TSDA 5B80A 4DB7A 1I1WA 4LS2A 1UPMB 1RJRA 4S3KA 3E0LA 3WL1A 3L5AA 2CWXA 4HMEA 1FWEC 3KRZA 3U48A 2XVPA 3IWPA 3PZ9A 2V69A 4IIGA 3JS3A 1W1IE 4HOXA 2P1FA 2DVUA 5CSUA 1I75A 4EVZA 5GNYA 4DF0A 4RZ5A 3MDWA 4ZFMA 1XCXA 4C6NA 4D6CA 1GKRA 5I2UA 1YW1A 2DSZA 3ZMRA 1JRBA 5CBBA 1YXYA 4PGLA 3QY6A 2OMAA 1TYGA 4AX6A 3NYDA 1AMYA 3KL0A 1BFNA 2R82A 1PWLA 3BVJA 2AQWA 5C55A 4JFSA 5DCBA 5D2VA 2ZZ1A 5KZDA 5CSYA 4US5A 1F5ZA 2HXUA 2CNCA 3ZVHB 1SZRA 3B4UA 4K39A 1OZMA 1FWBC 4GQBA 2W4XA 1XJBA 3L7RA 4LW7A 3WF0A 4M6VA 2WQPA 4A8IA 1RH9A 1TA3B 2PAJA 3QR3A 5JBDA 1EA9C 4UQEA 1E0WA 3BV7A 3U2CA 5AHLA 2W91A 4AEOA 2D73A 4Z2IA 1WOAA 1ISZA 3W2MA 3PN8A 2TAAA 2O92A 1E6XM 3STEA 4I8DA 2Y4SA 3WEOA 3R11A 2VFIA 3CK5A 4J5NA 4I5RA 3HG4A 2WMGA 2WANA 5G1MA 4GQGA 1MNZA 4M80A 1V0NA 3VDBA 3APGA 2Y61A 2DH3A 1TUXA 3FJ4A 1OCJA 4XAPA 3QW3A 1B9ZA 1JULA 1UC5A 4N0RA 4PB4A 4MLRA 3VOGA 1CEOA 3VGFA 1HKIA 4I5XA 3UCDA 1TREA 2A4AA 3ABXA 3ARTA 3WBEA 1QNQA 5E1QA 2O9RA 4H6RA 3NO3A 4US6A 1F9CA 4C1KA 1W5QA 3SCVA 5D2TA 2FB2A 3B03A 2IQTA 3ZLFA 4KESA 5E70A 1JUEA 1QPOA 1ZL1A 3SCNA 2VZTA 3HGSA 3C2EA 4Z1DA 2ZA1A 4S3JA 3VFLA 1A0CA 1EZ2A 5GJNA 1HNYA 4KWUA 1VFFA 2DORA 4LGXA 4R7JA 2UY5A 2ACRA 3HG2A 1BRLA 3ELFA 1K9TA 2O4QA 3NG3A 4ZO9A 2F2KA 3ZVIA 4XVEA 5IBXC 3V18A 3DENA 1IEWA 1DORA 3P67A 3E96A 5A8NA 5M03A 4XQ6A 1H50A 3R0DA 2GGEA 1PYFA 1S2UA 3VC5A 3HQPA 4XAZA 1R2RA 4N6FA 3WLHA 3W1RA 5LHFA 1X7IA 4PULA 1T5AA 4UZSA 4PRRA 2X1UA 3WJWA 1CXEA 5D09A 5GJPA 4YTSA 3SUUA 4DNHA 5BOOA 4JX4A 5E6YA 1EEPA 4DUVA 3KZSA 4N4PA 1HGYA 4R85A 1ZBKA 3WLMA 3TN3A 2OVLA 2NW0A 3CB8A 1HP5A 2OEJA 1P7TA 3EDKA 4ZOAA 1AMKA 4ZOEA 2OWXA 1RXOB 3V5CA 3PWIA 3GVWA 4GX9A 4Z0SA 5I24A 4DO4A 1KKRA 1GQJA 5H8PA 1BTCA 2DJLA 2FZNA 3R2GA 3PC0A 1EFZA 2FGZA 4RDVA 1I2NA 4L4PA 3AIBA 3AUOA 4AD0A 1OIFA 2ZA2A 4IFKB 2VT0A 3D3FA 3MW7A 1HZYA 2V3GA 2L5HA 3NXFA 3WEMA 3QSRA 4FR6A 1S46A 1UKPA 4FMVA 1BWLA 1OC7A 2C1HA 4JNYA 3FY1A 4KWWA 1PAMA 4OOZA 3U2EA 3TV8A 1QI4A 3A3HA 5BOEA 2GSHA 3WLLA 3M1ZA 3GC4A 1FWGC 1REQA 3W4RA 4GZJA 2PD9A 4Y8EA 3TTSA 1AQMA 4XD3A 4IG2B 3MP3A 3VOHA 1ZUAX 3T0CA 1XYCA 3VMPA 4GK8A 3EB3A 2YSWA 3CH9A 4EACA 1R8LA 1JI2A 3BOLA 1XLDA 2DIEA 1UUQA 2C8NA 3MWCA 3C2FA 2WZTA 4LCQA 3LGDA 4H1ZA 2VX5A 4ZOCA 2CERA 2R6OA 5BXSA 3NL6A 3BG3A 3N9KA 2A3BA 1CGXA 1FWJC 4XUYA 1W91A 4HA1A 3AALA 4G56A 2WXDM 3LQLA 4C6PA 4FB7A 3WD0A 2NVAA 1H09A 5IXEA 4NILA 1EF2A 1D7KA 2GLKA 4MADA 2ANUA 3LNPA 4P8WA 2PODA 4M8UA 4IX0A 3KTCA 2VFEA 3WQ6A 1GVIA 1JPIA 3C3UA 5D2WA 1CT5A 1BVWA 1BKSA 3GG0A 2D2HA 3R6IA 3TYCA 4QQ3A 2R1NA 3WFZA 5AC6A 4GX8A 3PBUA 3H54A 1OADA 3UZXA 3WDHA 2J66A 5XINA 3S8HA 1PKLA 4GUFA 1JI1A 1E4LA 4L4OA 2HK1A 4F2TA 4B9YA 4RV3A 1P6CA 2WBKA 4ADUA 3W2JA 3ZJKA 2PUZA 4PB5A 4N02A 4AF0B 4IPIA 4MMWA 3WLTA 1Q13A 3PG9A 3G1AA 3N3MA 4O13A 3LCWA 4IM4A 4DX3A 1H11A 2QQ6A 2WMFA 2J77A 3C6CA 3VFCA 2OQYA 4BF5A 1E43A 4P7NA 3FSTA 2RDUA 3OLEA 2QAFA 4FO4A 3VNLA 4ZTXA 4H01A 3W7KA 2QGHA 3I6RA 1UD3A 4HA3A 2EPLX 2OGYA 3S0CA 2ZDSA 4GYKA 3M7WA 4GUJA 3A5FA 4MDPA 2Q8ZA 1NDYA 1M7XA 4RCXA 4AZ5A 1UMLA 1U30A 3SRDA 1AW1A 5M17A 4PFMA 3GC2A 2DZWA 4AD2A 3W81A 1MUWA 3NQFA 4NJGA 4W4QA 1QI5A 3LCGA 2O55A 4YVPA 1VCFA 4EAMA 2X09A 4FNSA 2ISDA 3ICJA 1XWYA 2HRWA 3V0UA 1XIHA 1MMFA 2VC7A 4B5XA 3M43A 4MKSA 2Y1HA 1KM5A 3REQB 1KM2A 1E6ZA 4XBSA 1HIZA 1RQBA 2A85A 1HJQA 2EAWA 4UTHA 1JGMA 4Y9PA 1UKTA 3TLQA 3E2SA 1HG3A 1CB7B 5H91A 4GVHA 1C92A 4HK5A 4B2DD 1S39A 3ITCA 1R47A 2YL6A 1YNPA 3ARVA 5BU9A 2WYSA 3NOYA 1RVGA 1U5HA 1E0VA 3RLGA 4DLFA 1JYWA 4AUBA 3OQEA 2WSPA 2FH8A 1UBPC 2ZA3A 4NAFA 3LS9A 1E6RA 3MI2A 3TTYA 2VKZG 5PTDA 1VPXA 1TR9A 2D3LA 3UF9A 4HTYA 2DQWA 3TR9A 3WDJA 4AD4A 3QR1A 3JRKA 3S9YA 1IWPA 4A6GA 1CENA 2QT3A 4DJDC 3WLJA 3GHSA 3W86A 1ICSA 2OR2A 1E5NA 5G1YA 2BS9A 3NYZA 1U33A 3WH6A 2YB4A 5I02A 2H9AB 1HQTA 4CN6A 3EA1A 4LAZA 4XAGA 2MANA 2HSAA 2CXEA 2QUUA 5ECUA 3RNDA 1JQXA 1V5XA 4OT7A 4KWSA 1NWTA 5REQA 5AB3A 3PWAA 5JIPA 4KRTA 5BU6A 2ZUNA 3T42A 2WJFA 4ZBCA 2VZVA 1EBHA 3JW7A 4W87A 2PDIA 1TZZA 4H6QA 4AC1X 3CEUA 1BG4A 2PI6A 3LTYA 3N2MA 3RPDA 1WXJA 1LL7A 1K03A 4KCTA 1Q6QA 4XISA 3WUBA 2BXZA 1R87A 1UWQA 2Q8XA 1DYSA 7ODCA 1JYVA 3MP5A 5IDIA 2Y7EA 1S5NA 1G01A 1NDZA 2XINA 3I6EA 4XZNX 3ZSTA 3BICA 3NPXA 4LYQA 3WK1A 4HOWA 4PTVA 3T0DA 5L6UA 3HQOA 2OX1A 3I4EA 4BWLC 4XKYA 3NL5A 1D9EA 3L4YA 2QW5A 4B3KA 3RRAA 1UR1A 3ISIX 4H83A 3WUGA 4AZIA 1PXGA 3AJ7A 1SFLA 4N9CA 1YDVA 5I5RA 2ZICA 1TE6A 3IRSA 1HJXA 3KM8A 2YJQA 3RHGA 2GPTA 5LA0A 1K77A 3LHVA 1IR2A 2OWWA 2VZUA 5FACA 2IMRA 3MUZ1 1DOSA 3E0WA 1W32A 3UPMA 1NWSA 3GFYA 3M0JA 4S23A 3GW3A 3AYTA 5JMUA 2Z2BA 3ANVA 4IGSA 5H6HA 6XIMA 4E4UA 3CV2A 3U2OA 1OSEA 1GZJA 2VJXA 3PTKA 1G4TA 1X38A 1XLHA 3GR7A 1V3MA 1DE5A 4JQAA 2EEXA 4B3ZA 1TPFA 3UGRA 2P0IA 1Q6CA 4ZFCA 4LT9A 1B3VA 1XKJA 4JKKA 4KGJA 4TQTA 2BGQA 2Z1BA