4LCRA

The crystal structure of di-zn dihydropyrimidinase in complex with ncba
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
485
structure length
484
Chain Sequence
b'AGEILIKGGKVVNEDCSFFSDVHIRGGKIVEVGPDLRVPPGARVIDATDRLVIPGGIDTHTHMELAFMGTRAVDDFHIGTKAALAGGTTMILDFVMTQKGQSLLEAYDLWRKTADPKVCCDYSLHVAVTWWSDEVKDEMRTLAQERGVNSFMFMAYKGLFMLRDDELYAVFSHCKEVGAIAQVHAENGDLIAEGAKKMLSLGITGPEGHELCRPEAVEAEATQRAITIASAVNCPLYVVHVMSKSAADVVSKARKDGRVVFGEPIAASLGTDGTNYWHKDWAHAAQYVMGPPLRPDPSTPGYLMDLLANDDLTLTGTDNCTFSRCQKALGKDDFTRIPNGVNGVEDRMSVIWEKGVHSGKMDENRFVAVTSSNAAKIFNFYPQKGRIAKDSDADVVIWDPKTTRKISAQTHHQAVDYNIFEGMECHGVPVVTVSRGRVVYEEGRLKVSPGQGRFIHRQPFSEFVYKRIRQRDEVGKPAVVIREP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chromosome 8 SCAF14545, whole genome shotgun sequence
publication title Crystal structures of vertebrate dihydropyrimidinase and complexes from Tetraodon nigroviridis with lysine carbamylation: metal and structural requirements for post-translational modification and function.
pubmed doi rcsb
source organism Tetraodon nigroviridis
molecule tags Hydrolase activator
total genus 185
structure length 484
sequence length 485
ec nomenclature
pdb deposition date 2013-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4lcrA01
3URAA 3NQBA 1FWGC 4LH8A 2YZ5A 4QRNA 3EGJA 4KETA 2GOKA 4XAYA 1NDWA 1O12A 3GIPA 2VHLA 4LFYA 4UB9A 4G2DA 3GTIA 3A3XA 3TN3A 1NDZA 1QXLA 4L9XA 4WVXA 3R0DA 4GY0A 3PNZA 2DVXA 4B3ZA 4F0LA 3OVGA 5HMDA 1FWHC 3MVTA 4J35A 5HMEA 3GTHA 4DNMA 1QW7A 2E1WA 3UPMA 4EPKA 1P6BA 2YB1A 1I0BA 4C6PA 4CNSA 1EJSC 2GZXA 4H9XA 4IGMA 4CNTA 2ANUA 3ITCA 3LY0A 3WMLA 3T1GA 4C65A 1POJA 4H9YA 4HK5A 4DLFA 3MDUA 4IG2A 4LAOA 2OOFA 5AKQA 4Z42C 5G4HC 4C5YA 1RA0A 4C5ZA 2BB0A 4GC3A 2AMXA 2I9UA 2VC7A 2HBXA 4M51A 2F6KA 5A6TC 1EZ2A 3KM8A 4C6OA 4BKNA 1FWAC 3E0FA 3E2VA 4QTGA 4DIAA 3RYSA 2HPMA 3E0LA 3GG7A 4C6LA 2VUNA 2AQOA 2HQAA 4C6FA 2DVUA 3IARA 1A5NC 1UBPC 1J6OA 3TN4A 4F0SA 1EJRC 3A3WA 4QS5A 1FWFC 1V51A 4ICMA 4C60A 4R85A 1A5LC 3SFWA 4GK8A 3IJ6A 4RDWA 2Y1HA 3PAOA 1BF6A 2ICSA 4C6MA 4NI8A 4IFRA 3AU2A 4HA0A 1EJVC 2Z2AA 4XD6A 1ITUA 4EPDC 4G7EA 1J5SA 4GX9A 3CJPA 3E38A 3GTFA 1EYWA 2FFIA 1FKWA 1NDYA 1FWJC 3V7PA 4IH3A 4C6NA 1RJRA 3FDKA 3S2LA 4C6QA 2YXOA 3LGGA 3TN6A 3RN6A 3CAKA 2EG8A 3MJMA 3C86A 3K5XA 3MSRA 4ZSUA 3OU8A 3F2BA 3B40A 3LGDA 4WHBA 2PGRA 5LXXA 3WYZA 4RDZA 4CQBA 2OGJA 4RDVA 4H01A 4QSFA 4CEXC 3TN5A 4KEUA 2FVKA 3DC8A 1FWBC 3G77A 4I6KA 4R88A 2XIOA 4GZ7A 4TQTA 3DCPA 3O0FA 1K70A 3S2MA 2R1PA 4IFKA 2OB3A 2PAJA 3QY6A 4EPBC 4R7WA 1ZZMA 3ISIX 2BGNE 4EP8C 3NEHA 4LANA 2PGFA 2A3LA 1WXYA 4INFA 3GTXA 5E5CA 2IMRA 2QVNA 3WZ0E 3GU1A 3F2DA 4LCSA 4YIWA 4BY3A 4J2MA 1EF2A 2QPXA 1A4LA 1NFGA 4PCPA 4AQLA 1ONXA 4XD3A 1NDVA 2Z26A 3LSBA 3GIQA 1ITQA 2VC5A 1XWYA 1VFLA 3IV8A 4ERAA 4C6IA 4WGXA 3HTWA 1S3TC 3A4JA 4H9ZA 1UMLA 2Z28A 1R9XA 2Z29A 4H9VA 4IQJA 1V79A 4DI9A 1IE7C 3N2CA 1YMYA 1YBQB 3T8LA 4DI8A 4C6JA 4C6DA 4XAZA 2E25A 1V7AA 1PSCA 3UBPC 1A5KC 3F2CA 2EG6A 3F4DA 2FVMA 3AUOA 3PNUA 3MPGA 1FWIC 2PLMA 2Z7GA 3LU2A 2G3FA 3LA4A 3UR5A 2R1LA 3QGAC 3AU6A 1K6WA 2GSEA 4GYFA 4KF1A 1KRAC 4H9MA 3URNA 1PB0A 1JGMA 3BE7A 4NG3A 4CQCA 1P1MA 4EPEC 3DUGA 1ADDA 2VR2A 3IGHX 4CQDA 2D2HA 2WJFA 4KEVA 1I0DA 4GOAA 2ADAA 4KQNA 2HBVA 2R1MA 4PE8A 3MVIA 4KEZA 1RJQA 2FTWA 4KERA 4GXWA 2QT3A 1GKPA 2Q09A 2HPIA 4KESA 2FTYA 3PANA 2UBPC 1FWEC 2Z2BA 2EG7A 4C6KA 2Z27A 5FSEC 3GU2A 1O5RA 2D2GA 1R9ZA 2R1KA 3F4CA 3PBMA 3JZEA 4GY1A 1FWCC 4IGNA 3SO7A 5HMFA 1FWDC 3IACA 4LALA 1W1IE 2Z25A 3D6NA 4LCRA 2Z24A 3QY8A 1P6CA 1XRFA 3ICJA 3EWCA 1KRMA 1E9YB 4IG2B 4CNUA 1KRCC 1FKXA 4DYKA 4XAGA 4PBEA 4D8LA 3E3HA 1WXZA 4J5NA 4RDYA 4JOMA 4LAMA 1RAKA 1YNYA 3LS9A 4HK6A 4HJWA 3NURA 2R1NA 3RHGA 3QGKC 3B0YA 1A5OC 1J6PA 1DPMA 1R9YA 2KAUC 2Z00A 4NP7A 1PTAA 3UF9A 2VM8A 4KIRA 4ERIA 1E9ZB 3TNBA 4C6EA 1A5MC 2ZC1A 2PUZA 3MDWA 2OQLA 3OQEA 4RE0A 4F0RA 2O4QA 3GRIA 3ORWA 4B91A 1EJTC 1HZYA 2GWNA 3K2GA 4C6CA 2Q01A 4CEUC 4PBFA 1RK5A 2WJEA 2WJDA 4C6BA 1V77A 4GBDA 3FDGA 4DLMA 2CZVA 3LNPA 3B0XA 3HPAA 3S2NA 4H00A 2RAGA 1UIPA 1M65A 1A4MA 3T81A 4XD4A 3URBA 1YIXA 3S2JA 4BJHA 2WM1A 4G7EB 4GY7A 3E74A 5FSDC 1RK6A 5CH9A 1PO9A 1ONWA 2P50A 4QS6A 4QROA 3MTWA 2HNHA 1EJUC 1RJPA 4L6DA 4XAFA 4HK7A 3IPWA 2YB4A 2AQVA 4XD5A 3IRSA 1EJWC 4ZSTA 4B92A 4V1XA 4AC7C 2Z4GA 1RA5A 4MUPA 3ID7A 4E3TA 4IFOA 1POKA 2P53A 3HM7A 3OOQA 2DVTA 1XRTA 3QY7A 4OFCA 4LEFA 2D2JA 4B90A 4IF2A 2UZ9A 4UBPC 4RZBA 3LSCA 4DO7A 3OJGA 4PCNA 1M7JA 3O7UA 3S4TA 1YBQA 1GKQA 2GWGA 1XGEA 4P5UA 1J79A 4V1YA 4IFKB 4ERGA 3GU9A 3OODA 2QS8A 2O4MA 3FEQA 1K1DA 4GX8A 4LCQA 1V4YA 3UR2A 1GKRA 1UIOA 3CS2A 4DZIA 4H9TA 3URQA 2OODA 3GUWA 1EJXC 3MKVA 4H9UA 4DZHA 1YRRA 1KRBC 1M68A 1KCXA 4I6VA 3K4WA 4LAKA 3EWDA 2I5GA 2W9MA 3RCMA
chains in the Genus database with same CATH superfamily
3VOCA 1UP2A 4MZYA 1KXVA 5GNYA 3U0HA 1XINA 1BXCA 2R82A 1E56A 1C92A 4H7ZA 4KEMA 4Q6JA 1O12A 3PN8A 4Z0JA 2ACRA 3ZWSA 3DHUA 3QQWA 3GG1A 5TNVA 3P2VA 2F2KA 2HXTA 4L9XA 4P8WA 1DJYA 1ZUAX 3HN3A 4LEQA 4GH3A 4LBUA 3R43A 4JTAA 5A6BD 3MW7A 3MI6A 1FCUA 2PU1A 2J7CA 4NRSA 1QW7A 3AMGA 1P6BA 4AZHA 3BLEA 1HJVA 3OO2A 4XG1A 4GIYA 2YDSA 1NY1A 4Q8NA 4QCEA 1I45A 1JDCA 4GH1A 3MDUA 5AVNA 3TA9A 3MSYA 4M1RA 2DEPA 4NJIA 1PHWA 2YSWA 3VMPA 4C5ZA 4KWWA 2DU2A 3M5VA 2NQ9A 3NSMA 3TV8A 2XIQA 2ZUNA 4U33A 2E67A 5FF4A 5MKGB 4I7UA 3QSRA 1DTUA 1UBPC 3TC3A 2PBGA 4A3QA 1H0GA 3WH6A 1Q65A 5HUOA 2CZEA 1VGAA 1HNYA 4K38A 2PDKA 5E6YA 3GKFA 2ICSA 3PBVA 1P43A 3M6DA 3MT1A 5BU6A 1TQXA 4H2CA 5DCDA 2QCCA 2VZTA 2GK1B 3UZ5A 4HYVA 3BV4A 1NDYA 1OC7A 1SVDA 3S2LA 3G1AA 3TN6A 4NNCA 2EG8A 2D73A 4JTGA 3K5XA 3FJ6A 1OT2A 1REQB 1KB3A 3QR0A 3WYZA 3VGDA 4GVFA 4Q4OA 4LUIA 3OLIA 4PUNA 2Y8VA 3M0KA 3W02A 5AC6A 3CIWA 4OQVA 1UD4A 1Q4NX 4L7ZA 3GH4A 4Y9PA 1FWBC 5D9OA 4ZO8A 3ITLA 1ADOA 1NM9A 1G1YA 3SCQA 4EOUA 3G3DA 3W83A 3QY6A 2WW5A 1CW2A 4PTDA 2CBIA 1SJDA 3M07A 4WKAA 3ZZ1A 3WLJA 3RCYA 4TX8A 4AXNA 3GC4A 1E55A 2OR2A 4IGHA 1XDMA 1NFGA 4XD3A 3AXIA 1J18A 1VFLA 3FSTA 2QJMA 1SFLA 2WC7A 2XGIA 4DJDC 3P82A 3KOWA 2NX3A 3OYXA 2OCZA 4B16A 1E0UA 2BASA 3L66A 1ODUA 2ZDSA 2IQTA 1VZWA 4O15A 1SJCA 3GWQA 3CZLA 3DFHA 1VPYA 1JFXA 4MY9A 4DI8A 4P7RA 4UMCA 1GWJA 4ZMGA 1JPHA 4RZ6A 3CL8A 3PBYA 3KOYA 3L4UA 3SEPA 1JF6A 2VD8A 4F2BA 1FWIC 2PLMA 2VGBA 4O8RA 2R1LA 1D3CA 1TPDA 2YCLB 2VX5A 2QIWA 1UZ4A 1MUCA 3PJWA 4AD5A 1OM0A 3UYCA 3G2GA 3WLQA 4GYPA 1I0DA 3W7HA 4UR9A 1PE1A 3A6OA 1YLVA 3VU2A 1Z3NA 3G1SA 3VOFA 2C1HA 2WBKA 5AFDA 3IGXA 2W61A 5KEZA 1E9LA 3IJDA 4Y96A 4HSNA 5A8MA 3NEVA 4KESA 4HPJA 3TQKA 3AWOA 3BICA 3QR3A 1AVAA 1MEIA 4LGXA 4MHBA 4WJ8A 2E6YA 3QJAA 1HFBA 4DXVA 1PYMA 3I4KA 2V8ZA 3WDRA 3NL3A 3VDHA 3H21A 2DUAA 4FAMA 2TYSA 3HPXA 1M7PA 2QJJA 3EA1A 3SCSA 1SM9A 4YWIA 3STGA 2PZ0A 3LUTA 2BXYA 5C9RA 1H1YA 3NQGA 2CWNA 3I65A 2V0TA 2QGYA 4AAJA 3RR4A 4KCTA 5F2MA 3QGKC 4LUTA 1IT8A 3ZSSA 5AZ1A 3H55A 1JDFA 5LIKX 1FOBA 4A29A 2XH0A 1JYVA 5EMMA 3LNMA 3OQ8A 4RE0A 2DFAA 3EB3A 4KFNA 1UYQA 4JGDA 3V18A 4FEZA 4JY9A 1R3SA 5H6HA 1UD3A 3BJSA 3M16A 3HV8A 1JQXA 5AHMA 1WNOA 3SI9A 4KRTA 1UA7A 4JFVA 5FJJA 4XK2A 5CH9A 1PO9A 3N04A 3WNMA 2PCEA 3DH7A 3N73A 3EPMA 3DENA 2HNHA 4HK7A 2AQWA 1VFOA 3MHFA 2O56A 4B5VA 1H60A 3BAWA 2VR5A 5I23A 1EO7A 4NAFA 1U30A 4W5UA 1KC7A 2A5HA 2PE4A 3PPHA 4O14A 3KTSA 3OLEA 3WX7A 4WKHA 5M2FX 2D2JA 4KKXA 5DN1A 4WSKA 3QHMA 4GLEA 2XM1A 3PG9A 3OJGA 5F4WA 2OTDA 5T26A 4RW5A 1O60A 3GUGA 2BSLA 3LXBA 5CC7A 3MI2A 3TYDA 1CWYA 3WLRA 1U22A 2E8YA 5IFPA 3S0CA 3PBGA 2PC4A 3WG6A 1H5YA 4Z2JA 1RQEA 1F07A 2YGYA 1G9HA 1PKMA 4GACA 1C93A 2H6RA 1HKKA 1V4YA 3PJXA 1VIZA 1GKRA 4ZVJA 3NXLA 2OODA 1U5VA 2WNZA 4H9UA 3LQGA 3KBWA 4JQ4A 1M68A 3VKJA 3W74A 3E0VA 2WB5A 2YJQA 1P48A 3W82A 5LIWX 4A2RA 4BA0A 3W7IA 2Y85A 1E73M 4US6A 1JAEA 3D3FA 2BXVA 5DXYA 4W89A 2NQ5A 2G96A 2YCIX 2PC8A 4EXBA 1RQHA 4AZ5A 4ZOBA 4YXGA 3GDLA 2AOSA 1KFEA 3RRAA 1CCWB 1Q6QA 1DWJM 3FAWA 4B3ZA 1B4KA 1FCVA 2ZUWA 3UZXA 1Z7AA 4MFDA 4UZUA 4ATWA 4DVOA 3PAJA 1HGYA 4FIRA 3WD0A 2E1WA 4PR4A 1V02A 1C7SA 3VIHA 4GZEA 4UQEA 2FLIA 3NG3A 4H9XA 4GC4A 3CV7A 4DN1A 3ITCA 4NYYA 3PSWA 3UZYA 1US2A 3QMTA 1SMDA 4Q4KA 3LCGA 3SGGA 4LYPA 1AD1A 4DWSD 3LPFA 2PTXA 3B8IA 1ISWA 3O2LA 4S3CA 4E0CA 1OYBA 4JFTA 4DWDA 3SADA 1O5KA 3KP0A 1C3FA 1XIJA 4DRSA 1TTIA 1KR1A 1TWWA 1PKLA 4DY1A 5AY7A 2KZHA 3PJTA 1V51A 4NX0A 1LWJA 4BEUA 3WLIA 5FJIA 1XLBA 3LXAA 2SFPA 3W1LA 3DXIA 4HA0A 3PJUA 2ODOA 1JIBA 4XD6A 1XIFA 2WPGA 2JF6A 3I7RA 2OPJA 4AEFA 2FZDA 1XW8A 2INFA 2NVCA 5E70A 2J75A 2QAFA 2FGBA 1DQXA 4DJDD 3EOUA 3VUPA 3VKBA 2ZX5A 1A3WA 4IH3A 3FDKA 2GJXA 3ZJ7A 3ATYA 1X6LA 5H1WA 3W1TA 1TUFA 1OGSA 2P3ZA 2P1FA 4S3AA 5HBFA 4JD4A 5ABGA 4HPXA 4HSOA 2XVGA 2R24A 3GNNA 5JMUA 3QPEA 1N8IA 3HB9A 3NQ6A 1VEOA 4GVIA 1E6NA 2CZDA 1XISA 3BUVA 3W84A 3ALGA 3P3BA 5MF5A 1WA3A 1OX6A 4MB1A 2IPJA 4ZO9A 4I6KA 1TV5A 2A79A 4EANA 3QYSA 1K70A 4CQAA 4PBGA 1Z32X 3OBKA 5LGZA 5C2GA 4K1WA 3M0HA 1CGUA 3UXKA 5FJUA 3H8AA 2CC0A 4Q8UA 3WZ0E 3N13A 1VFFA 1YXYA 3TMQA 3ATZA 1F9CA 3EOSA 1S46A 3PVFA 3VE7A 1ITQA 2PLCA 5BNKA 3VDCA 4OZOA 4N6EA 1W9BM 4PUMA 5I3IA 2HV5A 1ALDA 4HZ7A 1HGWA 4MOZA 1ZTVA 2IPWA 4H9VA 3O05A 4GI8A 3QOMA 4ZO7A 9XIAA 5CBJA 1TX0A 1TV3A 4ILSA 4QLKA 1XUUA 2PGWA 4QE4A 4GI6A 4D1IA 2BOEX 5DFAA 4J3SA 1RUSA 3LG3A 1XD0A 2HMCA 3OIXA 2V9DA 1JZ4A 3TFXA 1BSLA 4MWAA 2ZX8A 4Y8FA 3W2JA 3AYVA 4Y90A 4W87A 4E4PA 3POHA 4GNVA 2XGZA 5HQLA 4KEVA 2WHLA 3ZJ8A 2O9PA 1ZAHA 2V30A 1RVKA 4DUWA 4KBXA 2R1MA 4PE8A 2PWEA 1HKIA 1RJQA 2FTWA 1B0IA 4E4UA 3LLXA 1GVOA 1MNZA 1S5WA 4PL1A 1OEPA 2J7GA 3TROA 1TPH1 1QRQA 3BC9A 2BMBA 1KKOA 3P80A 4IPIA 2Z27A 2CWXA 2D2GA 3USBA 1W31A 3NYZA 2PTWA 2WC3A 4R34A 4L56A 2ACSA 1FH7A 1KFWA 1IEWA 3AMLA 2CZFA 1TA3A 2GL5A 2C0HA 5CJNA 1MO0A 5FIPA 1WXZA 5LA2A 4RDYA 3WLOA 3QSTA 3EA2A 1CLXA 3BGJA 1W32A 2ZUSA 3UA4A 4NP7A 4CCDA 3EB2A 3TNBA 3IK4A 1ESWA 1QK0A 4KGLA 4CCEA 4N9BA 5KETA 4N7QA 3ARSA 3H2CA 4HA4A 1EUNA 3A5VA 1X7FA 2J7HA 1PKYA 3LCXA 4L6OA 1EBGA 3ONBA 3B9EA 3W7LA 1OG0A 2FZMA 3M0ZA 4I9JA 4RE3A 4QROA 4A21A 2CIPA 1KBBA 1BG4A 2WKJA 1LRNA 1V3IA 4S3KA 5F7UA 1YXCA 4XBSA 3GY1A 3GR8A 2E4TA 4Q8TA 3TC6A 4DF0A 1GQKA 3C52A 2NZLA 3ID7A 1EC7A 1SQ7A 2DSWA 1GW9A 1T0OA 4QJ3B 5HNTA 3HM7A 2FDSA 3LV5A 4GISA 1VCVA 1EDTA 1OGBA 2DUZA 4G5DA 3WBYA 4H2HA 2FTPA 2HROA 3N1AA 3MWAA 2HDJA 1LG2A 4TMCA 3EWXA 4H1ZA 1L6FA 1VR6A 1KLYA 4H41A 3NSXA 3T8QA 3MJYA 3FKKA 3CHFA 1DIOA 3HZ3A 4I9MA 3HFTA 4JIQA 5CC5A 1AJZA 1DVJA 5FF2A 3GFXA 3LM3A 3GDBA 4ZQRA 2GJRA 3BQ6A 3FVMA 3SCVA 1H62A 1SFJA 3WJWA 1V3MA 3GDTA 3TDFA 4GIEA 3E1F1 1VCFA 4F0KA 4JKKA 4LVBA 1EJ7L 3E2QA 2ATMA 2E8ZA 1LT8A 5TD4A 3IIOA 3VIGA 3A24A 1TTPA 5HXMA 4RE4A 4XZ9A 4B5NA 4NU7A 1ICQA 2C3ZA 3R11A 3UESA 2VQUA 4LC8A 1NDWA 3QR1A 3ZT7A 2BY3A 1CGWA 2VOMA 4KT2A 3R5EA 1W1PA 2IPGA 1UR0A 3HJZA 3A3XA 3WNNA 1TVNA 3W28A 5DLCA 3N34A 4E2DA 1DXIA 1T41A 3H2MA 2UY5A 3MVTA 3SSJA 3PBWA 3WQVA 3O07A 4MYXA 1TRIA 2W91A 3E5PA 3THQA 1GOKA 4HK5A 3PZQA 3ME3A 3L2MA 4DYEA 3TXZA 4FZIA 2X1IA 4GMEA 4ADTA 2NW0A 1C8YA 4CN1A 4J4KA 3BPWA 4DIAA 1TTQA 1V03A 2YA1A 5F2IA 3UZWA 2DJLA 2WZIA 3SM0A 1XSKA 3WQFA 3BMVA 4JPGA 3UWZA 2WKLA 4FLSA 1EJRC 4UCFA 1OC6A 4ICMA 3WQ4A 3UPWA 2J7DA 1QT1A 1OIFA 4F3HA 3OZOA 3I4EA 1XBXA 5HPCA 2VI0A 4UFKA 4CVWA 1IEVA 4KFOA 1TWZA 3TTEA 4L4MA 4H4IA 4QFUA 4EPDC 2RGMA 2J25A 1GJWA 2UY3A 4MNJA 3RM9A 5FF7A 2ZZ2A 2VELA 1IWBA 3TEVA 4JTDA 3BJFA 3MP3A 3QV9A 4LUTB 5D8ZA 4C6QA 3ARWA 1FXQA 1IT0A 2X0HA 1YDOA 3AC0A 3BAJA 5FI8A 3BG9A 3NQEA 4XZBA 4C90A 3SCRA 4JCMA 1VHNA 2P3EA 4H04A 1LBFA 3MWCA 2DP3A 3KTXA 2ISWA 3NL6A 3VZXA 1DWAM 4H01A 4QSFA 1M5WA 2FPYA 1E5JA 1WB0A 3NDZA 1IZJA 3P8JA 1WAWA 3AXMA 3AICA 3AI0A 4GYPC 4A8NA 2PCQA 2GQ3A 3HQNA 3DCPA 3WEOA 3H24A 5BOOA 4QE5A 1EIBA 2IMRA 3F2DA 3BTNA 5LZLA 1RALA 2V38A 2W5FA 4RV8A 5AC7A 8TIMA 1B1YA 4NAFB 1CGXA 4KWSA 5I6SA 3VC5A 1XYZA 3E2SA 5MHBA 1BXBA 5ABEA 1J93A 1IZCA 1W5PA 1WDRA 1WBJA 3A4JA 1Q7ZA 2BWGA 2F6XA 3E0IA 2VD9A 4N9EA 3W2LA 3GVRA 4URIA 1KFJA 1PZ2A 2WANA 3LYEA 1XUZA 4BQ3A 1SW0A 1Q66A 4QISA 2AKMA 1B90A 4UFMA 4MF4A 2G3FA 3UR5A 1YPFA 3ZLHA 3FW6A 1P5BA 3UERA 3W7QA 5KMYA 4YVPA 1JPIA 5IHSA 4K36A 1Q6LA 4MM1A 3VIIA 4E3VA 1XBVA 2J7BA 4KQNA 2YBTA 2A3HA 3ARTA 2QT3A 1CXHA 1PTGA 4E2BA 5A8PA 2Q09A 3R94A 4JX4A 4Y9OA 4X22A 3UWVA 5CZ0A 1S5VA 1C29A 2D0HA 3NUKA 2Y7EA 2XVPA 1UWIA 3KE0A 4DBEA 3N6HA 3H2OA 3NJ3A 1H7RA 1JDDA 4S23A 2ZXQA 3RDKA 3D6NA 5EA9A 3CQHA 1VENA 3GXNA 4OUEA 2WQDA 3QY8A 2Z1WA 2XN0A 4QDWA 1ITXA 2QJNA 1KRMA 1E9YB 4UQDA 4YYFA 3EWYA 5BMWA 1GTHA 4J5NA 4PUEA 5I3FA 2V3EA 1H4PA 1F4AA 4OECA 4AC1X 4E38A 4TOQA 3E49A 4UTTA 3SQMA 1A5MC 4PC8A 4REQA 2B4GA 4PMJA 4C1KA 4I5RA 3C3NA 2O9RA 1NEYA 5DX7A 3MMWA 1RK5A 2WJDA 4Q7BA 3SN4A 4GE8A 1DXEA 3B8UA 1UA3A 3W7DA 3TLQA 4JNYA 4Q7IA 4EVZA 1QPRA 3M9YA 1FWTA 1KBIA 2QJHA 3URBA 3GH5A 3N14A 1H7XA 3DEQA 1HO1A 1NWTA 5JVLA 3VIMA 2P50A 4QS6A 1QI2A 2F84A 3NQ2A 1O1HA 4LBRA 2QEZA 4Y9MA 3EX6A 2HTMA 3RM4A 2GJXB 1WZKA 4GD0A 3CQ0A 4ZENA 2ESCA 3FXYA 4CCZA 3CZ8A 1I1WA 1RBOB 2DVTA 4LEFA 2NQJA 3S6OA 1FP9A 3VOJA 1O68A 3CQKA 4QP0A 2OKOA 3WNKA 2O7SA 1ZHAA 1N8WA 4D6HA 1M7XA 2VZOA 2WZMA 2GWGA 1GVFA 4B3KA 3PBUA 5GPRA 2PDGA 4GI9A 4I8DA 2UY4A 2DDXA 1AJ2A 3WCZA 1AQ0A 1K8XA 4GX8A 4W93A 5HUPA 3QYQA 1CXKA 1BG9A 1EJXC 4ACYA 1KV5A 4S2CA 5BWFA 1XLMA 4NXSA 3WLNA 2RDWA 2A4AA 3NQBA 4FNRA 1PL9A 4XKMA 3M7SA 4OE7A 3U4FA 1AW1A 3HG5A 4XZWA 1TPB1 2GQAA 3PWGA 1BLIA 3EA3A 3TN3A 4JHMA 5XINA 5GJPA 1OCNA 3DIPA 1V0KA 5H8UA 1W3TA 3MP4A 1YDYA 2ZZ3A 2YIHA 3W81A 2ZIDA 3WSUA 3V36A 1MUMA 4CNSA 3WH8A 4MWAB 3G3MA 1KXHA 2F38A 4XZLX 4IM4A 5A6JA 4IG2A 3QFEA 5JBEA 4E4FA 1FDYA 3BAXA 4MDPA 4DQWA 3NL5A 1VFUA 3EKLA 4M51A 3N4FA 3LRMA 3D46A 1N82A 4AY7A 4QTGA 5CPTA 5C8BB 3F5JA 4C6LA 2ZA3A 1GNXA 4ALDA 4W86A 1W9DM 2CHRA 1VJZA 3G1VA 3A3WA 4HVXA 1XLCA 1E72M 4NQ1A 2AKZA 2D69A 4UNKA 2BY1A 3KCLA 4XV0A 4LVAA 1SJBA 3RLGA 3GFYA 4XZIA 2YYTA 4ROPA 1GOIA 2DSVA 3EEGA 4HCDA 2VEFA 2FGLA 3WFAA 3IANA 4IFRA 3W7OA 3SAZA 1K8YA 3UWWA 2JEQA 1H7WA 1TA3B 1XYLA 1B2YA 3ZIZA 1GOWA 2HRWA 5FL1A 3AHYA 1PWLA 2Y7GA 1KWKA 1BWKA 1JCMP 3GXTA 3NVDA 3GTFA 3HURA 3IVUA 2YCEA 3WBAA 4HMEA 3DESA 3FGCA 3LHTA 3AZTA 4OHQA 3F1QA 1XLFA 2QULA 3BSHA 1W5NA 2QNEA 3H4WA 4JTLA 1L6SA 4RDZA 1VLIA 1R30A 1UWQA 1GQLA 4RDVA 4PMRA 3TSDA 3UJ2A 2DZAA 2YZRA 4GNJA 2JFEX 1PDZA 1BKHA 4F0MA 4E8DA 2VDHA 1R3RA 4JX5A 2R1PA 5D02A 1PIIA 4ES4A 2QR6A 3GD6A 3TJLA 1E1EA 3MI3A 5CGTA 3SQLA 3LCHA 2C14A 2CEQA 4EIVA 3DBNA 3W6LA 4JS3A 3U2EA 3UT0A 4K68A 4LUYA 4Q33A 4PMDA 3NO1A 3WQOA 1XIBA 2RGLA 4G9PA 4ZZ9A 4ERAA 2Z0IA 3MB9A 5LA1A 4IQJA 4IMAA 1YMYA 3MYOA 1W2PA 1K4HA 1Q85A 5HNRA 4R53A 3THCA 4PMZA 3SY1A 1V93A 3A3HA 1AL8A 3F4DA 1H61A 2C79A 4LX4A 2A1YA 2XSXA 2XFYA 2VFHA 3QGAC 4UQAA 4QSHA 1NU5A 1P1MA 4JQ1A 2ZICA 1JXKA 4TTUA 3BG5A 1OK4A 2ADAA 3OGRA 3AQUA 1VQTA 3TCEA 3RJXA 5AHNA 2QPSA 1FX6A 2G95A 1FH8A 4KERA 1NF7A 1O5XA 4ZFCA 3KBSA 1E9IA 1QNPA 5G2HA 1SFTA 4LNYA 4H6RA 4R7JA 4EKJA 1DJGA 4LJ3A 4XVDA 1I1XA 2E9MA 3PZIA 3MUAA 1E6PA 2VR4A 3RX3A 5CCZA 1ZP4A 2V3FA 2C15A 1ZS2A 1U5HA 3ES8A 4MZ8A 4PODA 1RPKA 2VOTA 4FX8A 1FWDC 3IACA 1GEHA 2YL5A 4LCRA 1Y5VA 4JEQA 4PULA 1NP2A 2NXIA 3W0KA 1QWGA 3UG4A 2G0WA 5XIMA 2B7OA 1I8JA 1SJAA 1YNYA 1VB9A 3V0TA 2YKKA 3VPLA 1MXGA 4M56A 3IVSA 1Q7QA 3DOPA 4H6EA 1DPMA 2QUNA 3DHFA 4CUCA 3GS6A 2R91A 3M64A 2QQ6A 4PEKA 3G1RA 3GB6A 3AJXA 3CUZA 3MY9A 3ORWA 2D2OA 1DKWA 1ISXA 1R2RA 3D0CA 2J78A 3ANYA 3FDGA 2DZSA 3QF0A 1OY0A 2XYLA 6XIMA 5E6ZA 3LPOA 2XU2A 2TPSA 1W8GA 2QZRA 3NQMA 3S83A 3R0UA 4ZQPA 3RF9A 3P8IA 1OD0A 3MTWA 3KCJA 3NPWA 2VUYA 1L8PA 1W9VA 1PUDA 4Z2GA 4B92A 4WJXA 3PF3A 5AN7A 5JH1A 4D6GA 5IM51 4E3TA 3O6CA 3OOQA 2J4GA 5HATA 3T0AA 4UQ9A 1B31A 4B90A 2UZ9A 3EKGA 4RZBA 3BSGA 1RSCA 3FX4A 3VFCA 2ZZ6A 5IRPA 1G6CA 4PCNA 1G94A 3ZYZA 4AWEA 3EOLA 2NV9A 5JIWA 3T42A 2QW5A 1YBQA 5DQPA 1VBRA 3QPZA 1RHCA 3H6OA 4V1YA 2HWGA 3GDRA 4MG4A 3WUGA 5A94A 5HPOA 1KLZA 5EMKA 3MV11 3WN6A 1G4EA 4IMGA 3R0KA 3O6YX 1UC5A 1I60A 2Q71A 1SGJA 4MPQA 3TX9A 2V68A 2Y5SA 1FHDA 3K4WA 3VAVA 3LN3A 2W9MA 2RDXA 4HU8A 1TRDA 3WH7A 1ICPA 4QRNA 3LTPA 1J8VA 4HHMA 3QH2A 3NOYA 3SECA 4BHYA 2Y88A 1XD1A 2EPNA 1CGTA 1WKYA 4YTTA 3W7GA 3CQJA 2CLOA 3NPVA 3GTIA 1C90A 4UTJA 3K4DA 2PD5A 3UWUA 1SSGA 2YBVA 4EK7A 3P5ZA 1PV8A 1QHOA 2J9ZA 4JAWA 3CC1A 4GBUA 4W8LA 1EJSC 1XBYA 4G6CA 1TV4A 3LXCA 4GKLA 3C2EA 1G4TA 3NM3A 4D6JA 3UPBA 3NQDA 4S2BA 1N7KA 2DPEA 3QVQA 5H8MA 4MWAD 2HBXA 1VIWA 4LVFA 4FLRA 1YPIA 4AEOA 3A23A 4BKNA 3RYSA 2PURA 3E0LA 1IHIA 1QDSA 3CHVA 2AQOA 2A2IA 3FCPA 5LXEA 4FR6A 2FDMA 2TRSA 2TMDA 3PPFA 3L5MA 4FI4A 3ITGA 2WV8A 1HTIA 1M6JA 1R3VA 1J0JA 3CYVA 4UTWA 2WJZA 1KWGA 2OX4A 4IP7A 3CO4A 1KCLA 3MHUA 1IXQA 4JR5A 2YL8A 3AHVA 2I17A 3GNRA 4GX9A 4X2RA 3TUUA 1VBGA 4FNTA 3WL0A 1FWJC 4Z1CA 1XPGA 4WR3A 1V6UA 4EXQA 2QMJA 3HQ1A 3TYAA 1YXDA 2I5QA 5BZAA 5GJNA 3OU8A 3S6TA 4REQB 3MS8A 4UNLA 1JPKA 3ARRA 3CWOX 4C1LA 3VIKA 1RP9A 3FJNA 4CQBA 2I9EA 5M1TA 2VX4A 3VX1A 4LNCA 1E6XM 4Y9NA 5EBAA 1CX9A 3CB3A 1A5UA 5DCEA 1QUMA 4UXDA 1GK8A 2YXGA 4MLRA 1US3A 3TYZA 2ZWZA 1ZRQA 5D9MA 5CJ5A 2ZC8A 3NZQA 2GJPA 1C8XA 5I00A 2PZNA 3QHNA 3CZKA 3PS7A 3K13A 4Z2IA 3WQCA 1JEZA 4R7WA 2Y5EA 4DJEA 3ISIX 3PZ9A 3OGSA 3S5NA 3LCWA 4MB5A 2AAMA 1FBAA 4M7SA 4Q4SA 2INEA 1X6NA 5CSYA 3N9KA 5BU9A 5I07A 3UJFA 1X1OA 3G1HA 2GUBA 2BHYA 2VC5A 3IV8A 1A0EA 5EY5A 4O1EA 7A3HA 4QLJA 5EKYA 1X97A 3ITXA 3IWPA 1XF0A 2ZUVA 2QMKA 1E40A 2Q02A 3HBLA 3WQGA 1J10A 4D9PA 1F73A 2P88A 5C9UA 1V3JA 3XIMA 5A1AA 2ZQ0A 2J74A 4LPCA 1TCDA 4NZ1A 4RXGA 4RPPA 5HINA 2QV5A 1BVZA 3VTRA 1UBSA 3UBPC 2ASHA 3NGJA 1EGVA 3O0KA 5GNXA 4J2PA 1RH9A 1VFSA 4UTTC 4GRSA 3WLKX 4WCJA 3VYLA 4X3ZA 4HYWA 2C1IA 3L4YA 1Z48A 2H8XA 3VO0A 5LKYA 1CDGA 5F1VA 3DUGA 3TJ4A 4UIOA 1B57A 1JZ8A 2ZVIA 3SJNA 3MVIA 4LF1A 3L65A 5CPSA 3D5HA 1ZAIA 3CH9A 1LQAA 1Y8BA 2XN2A 1E43A 1ZENA 1XLHA 2J27A 1XQLA 1KM6A 2CETA 3RRXA 4WY0A 3LB0A 3N2BA 2EG7A 1HVXA 3HQOA 1JCYA 3AS1A 1GZGA 1ZFJA 3AUJA 4GY1A 2NQHA 4FIQA 3SO7A 1UR4A 1W1IE 1J0HA 3VUSA 4UFLA 6PTDA 3W6MA 3LLFA 3LBCA 1EX5A 3R4IA 4IG2B 4CNUA 1I2OA 4ZB2A 3ANUA 1LLWA 4F2TA 3W73A 2WZTA 5C5YA 2B81A 2R1NA 4XTDA 2WM0A 3SZ8A 4IQEA 3M0JA 4B2DA 1AK5A 2R94A 3V5OA 5HNUA 4J40A 1EA9C 3OQEA 3ERPA 5CXPA 4MNMA 1OJXA 3P84A 3K2GA 2NXHA 3TAOA 2J9YA 1QPKA 1WZLA 4LW7A 1UROA 2VC6A 4JTTA 2V5DA 4PMVA 2GVYA 1YHTA 3P14A 2P8CA 5DO8A 2INZA 2BOFX 2QJIA 2PD9A 3ZLFA 3HG3A 4BF7A 1L0PA 4L5ZA 1PYFA 2Y5JA 4R9XA 4OV4A 4I5XA 4DYJA 3LBMA 3WJYA 2BG5A 2Z4GA 3NDOA 1QNOA 2ZFAA 4UC5A 1TIMA 5CAHA 3DFTA 1G4PA 1HL9A 3SB0A 2GGJA 3RAOA 2ZYFA 1YNQA 2ZE0A 3VKCA 2XFWA 3K8LA 4PUWA 3TU9A 3G1FA 3ARZA 3QOKA 3OHIA 2UWFA 2JKAA 3W23A 3WBEA 3W7EA 2BY2A 1M7JA 3LHUA 5C71A 4ICCX 4IP4A 1QASA 1PWMA 1U1HA 1L6GA 3JR2A 3K30A 4J7RA 2IKJA 4ERGA 4DXXA 3P6LA 4MZ1A 3TW6A 1UKPA 2CXGA 1GOOA 3G0UA 1RLDA 2WK2A 4XKYA 1K7XA 3EBVA 3N2OA 2GGEA 1XICA 4GVHA 4L1XA 4V28A 1TPUA 5JUVA 3H23A 3JU2A 2CLMA 5GJMA 5HA7A 2J79A 3WJZA 1KTNA 2X2YA 1TELA 2ZRWA 3VXGA 4IHCA 2OSXA 4QNEA 5A8GA 1EP3A 3T2OA 2QF8A 4NJGA 3OA5A 4P2VA 1CXLA 5F2GA 1S2UA 3O15A 1W3JA 3OVGA 1EEXA 1S5NA 4HCHA 1OFQA 5LSMA 5HMDA 2EPOA 3N4EA 5AC8A 5CBBA 4PMOA 3CL6A 4FOKA 3LY0A 3MCNA 5HJYA 2YCKX 3U7VA 2V81A 4QJ5B 2OOFA 4AZCA 2PRHA 4LV4A 5AKQA 1ZP3A 5HR6A 3QN3A 5KZEA 3WQEA 2DJXA 2OKTA 4F9JA 1ME7A 4MAVA 4QG8A 2H9AA 4OGZA 3CUXA 4CNPA 1S2TA 2DZUA 4CLMA 2B7PA 5M3WA 1QWKA 4RXFA 1BEUA 4H8UA 2XG9A 1UJPA 1TREA 3TN4A 3EWWA 1I2NA 1YYAA 7XIMA 1FWFC 4ZB5A 2FFCA 1SMAA 4OV9A 3BDKA 3IJ6A 3KAOA 4KWOA 5M17A 2JBMA 1PHQA 2XZ7A 4NI8A 2V5LA 3TC7A 1EA0A 4D8AA 4AUBA 3KL0A 3KHDA 4B9YA 1O5QA 5JIPA 2FHCA 3GYCA 3E02A 4NHVA 3MMTA 2DZPA 1BAGA 3CJPA 2EEXA 3XISA 2A21A 3GQYA 1XI3A 2QCHA 2J62A 6REQA 2YW4A 3S8HA 3VNJA 4DB7A 4JIRA 4W7WA 1QVBA 5E9XA 1Q2SA 3C86A 3MSRA 3TWAA 1YDVA 4Z1AA 1I2PA 5LNUA 1V6TA 3CTLA 4FA3A 4N6FA 1JJKA 4U10A 1GEQA 4ENLA 2FZNA 3EXTA 4M6PA 2RKXA 4IXXA 3VINA 1NOWA 1LLOA 1RZMA 1OC5A 2EHHA 2V3GA 1NF0A 5JBFA 1HW6A 2J8GA 1H11A 1R47A 2BGNE 3VVGA 4M0XA 4XWUA 3V16A 2VWTA 1JR1A 3KRUA 4RNJA 3FYOA 1F74A 1REQA 3GIQA 4D72A 4RNFA 3LI0A 5K9XA 4DNHA 4P8VA 1DHPA 2JK2A 2X1RA 1UB3A 4IX2A 3LHWA 2VXNA 1VYSX 2Z29A 2EPHA 3TFCA 3G8RA 1V79A 1WDSA 3H7VA 3N2CA 3B97A 1YBQB 1M01A 1UW9A 3T44A 4A3HA 3WNPA 1WP6A 1W9UA 5E0CA 1TZ7A 1XKJA 3ARXA 4HGXA 3VKDA 4GWEA 1M7OA 1R8LA 2OGYA 1T96A 1AMYA 2E6FA 3LCIA 2GSEA 4U2YA 5DBTA 3S1VA 1SSDA 1VRXA 3B03A 4TVCA 5LIUX 4Z1DA 5I03A 5CBIA 1D2KA 4NI3A 4CQDA 5ENLA 3NTYA 2WJFA 4O0KA 3RK8A 3THAA 3W7CA 2E9LA 2WNNA 2J8FA 3SFKA 5EL1A 1FHUA 4Q8OA 5FKYA 1GKPA 5K4XA 3SY8A 4JDBA 2Z2BA 3PUDA 1K77A 1EXPA 3Q67A 1FHLA 1O1ZA 2Y7DA 3PZUA 1FWCC 4GQGA 2PMQA 1DWIM 2D22A 4K39A 5HMFA 3TTYA 3CMFA 4LALA 4FXFA 2BLEA 4LOCA 3TJIA 1Z6KA 1PPIA 5FD0A 1XRFA 1QNSA 3VFLA 1CTNA 3C8NA 1F05A 4IQLA 5I79A 3PB2A 4UTHA 2F6UA 4ATLA 3EB4A 5HAOA 1BTCA 4M6QA 3LZ5A 5LIYX 2A7RA 3KVLA 5AECA 2NT1A 2QPUA 4G7FA 4FLQA 3K46A 1MRQA 1RV8A 3WELA 4YTRA 1XCWA 2A85A 1E3XA 4O0QA 3FV9A 2CLLA 2NV1A 3RPDA 3UXAA 3VCCA 3FFSA 2WNQA 3W1RA 2QCFA 1JPDX 2E1DA 3VDBA 4OBRA 1UD6A 1F3WA 1JRBA 2PDUA 1EOKA 1KM2A 1PX8A 2RAGA 1F76A 3IJQA 2DUXA 4TV6A 2HNEA 4L9ZA 3DGRA 4PGLA 3TVAA 1VD6A 3O06A 3KCOA 1ONWA 4W9TA 3VGHA 3RLUA 3IRSA 4GFIA 1CLVA 4AWTA 1CIUA 4AWSA 4W84A 2V2DA 2Y89A 4YVVA 4B5TA 4AIOA 2PFHA 1EDQA 4AYGA 2NLYA 2ISFA 3M47A 3L2LA 4ATDA 1YEYA 2VFGA 4WSJA 2Z1KA 1CENA 1XYFA 2XJ7A 2HK1A 3AHZA 4OOUA 2ZXDA 1G67A 5A69A 3DG3A 3FAXA 2CBVA 1RXOB 3DKLA 3UXLA 2ISSA 4QJ1A 4ADUA 3S5OA 3VD9A 3G0XA 5DRIA 3H12A 3M0MA 1UJQA 3ITVA 4KFPA 3TJXA 3URQA 2DQWA 5FJPA 4OTKA 3MKVA 1UZDA 6A3HA 2HVOA 5BXPA 5I3GA 1F3EA 2RDTA 5K3VA 3O3RA 4U2ZA 4B3LA 2QCEA 4P7OA 4UTWC 2DSUA 3FXGA 4LQ1A 3W2KA 3DYPA 3Q37A 4AB4A 4MIMA 2HEJA 1E6QM 2P10A 5BCAA 5DCBA 1LWHA 2QVHA 1ME9A 4BK9A 3VK5A 4UZSA 1WV2A 3AALA 3CPGA 4F0LA 2RJHA 3L0KA 4J35A 4AYSA 3W71A 2Q3RA 3NO5A 3DGBA 1IXPA 1Z42A 1EGZA 2E6AA 4O4VA 5CG7A 3MMUA 2GJNA 3L5AA 2JIEA 3II1A 3ZJ6A 4HSHA 5A8QA 1HKVA 4QGCA 3GC2A 4ZO6A 4C5YA 2IW0A 1V08A 4OWGA 3VMNA 3COTA 2E7FA 1EO5A 3E0FA 1VKFA 3TCSA 1D3HA 4WY0B 4DJEC 2PDBA 2AL2A 1H51A 1TYGA 4JL2A 1WDWA 4U5IA 3ZR6A 4AHOA 1BF2A 1AG1O 3WMBA 1J2WA 4F66A 3TQPA 3RX2A 1PDYA 5E9AA 3ZVHA 2VZSA 3I3BA 4C6MA 2XFRA 2XISA 3PFMA 4DBWA 5KZMA 1O4UA 2EQDA 2Z2AA 4HB7A 2CU0A 2DW6A 2Z1BA 3QQ1A 5ABFA 4HU4A 4LB4A 1A0CA 4G7EA 1J5SA 3UCCA 4DEFA 4IIEA 3AIEA 1WKDA 1T8XA 1FKWA 3WF2A 3W87A 3BMWA 4H8NA 4YU1A 4JIPA 3WBWA 5D2XA 1KGXA 2VEMA 7ODCA 4WHBA 3UWYA 7REQA 1H0IA 1F6YA 1EHNA 4EAYA 2E40A 1XG4A 1WOAA 1MQRA 4HN8A 5HULA 1L2QA 1DWGM 4XZNX 3H2EA 4LVDA 3QQ0A 2G37A 1K9FA 4ZEPA 3MKKA 2Y7FA 4GHRA 3A9IA 4IFKA 4TX9A 5DT7A 3SRFA 1XLIA 2VEIA 1BVWA 2YXXA 4UOQA 3PP7A 4RV3A 3CGTA 3HGOA 2BXZA 1V6YA 2QVNA 3GU1A 2Y6ZA 2JIWA 2GDVA 4GQQA 1ONXA 4ADSA 1F3XA 3WDJA 1FFQA 2E28A 3OZYA 4ICNA 3LI1A 4C7FA 3HA1A 4KPLA 2OXNA 3HPSA 4M6UA 3PB0A 3EXRA 3PSVA 3DC0A 1G69A 2EBNA 3L21A 3G1DA 2A3AA 3Q45A 2XFFA 3ZR5A 3AHTA 4C6DA 2E25A 3PHAA 2V5KA 2Y0FA 1QI3A 3BMXA 6ENLA 5FJTA 1BQCA 3C0SA 4LUJA 4ZQCA 3PNUA 4XKYB 4HYRA 3LA4A 1GCYA 2NV2A 3DU0A 1XV8A 3M5ZA 3URNA 1PB0A 3MUXA 1JDEA 1ADSA 1PJ9A 3DFYA 4PRRA 4GOAA 4IXHA 2HBVA 5I3KA 3T55A 3VOGA 1UPPA 1XSIA 1YX1A 1TPVA 3A4XA 2EXOA 1J0IA 1KXQA 1E4MM 4O1BA 4I9AA 2YBUA 4AVNA 3TLLA 3NR0A 4JIIX 1RCXB 2CW6A 2FYMA 2OEKA 1QNQA 4MKNA 1KFLA 3MZNA 5CPNA 1GQJA 1DBTA 3IS4A 3IAQA 2B0MA 3M0LA 1W3HA 1JD7A 3GDKA 3NNTA 4H8HA 3T4WA 3OG2A 1YTDA 2VRQA 1A5SA 2ACUA 2X1SA 3WKZA 4AZCB 3LK6A 3QV6A 1UKTA 3IAPA 4HNCA 1Q63A 3N2MA 2V5CA 3QLDA 2QUVA 2OT1A 4XIMA 4HZ6A 3OA3A 2H9AB 2KAUC 1ML1A 4KWUA 4ERIA 1TV2A 3RMEA 1ZCCA 1E4NA 1GVYA 1T5AA 1FFRA 5DBUA 4J3VA 4OVXA 4WEVX 3LCFA 5FAGA 1M1BA 3I6EA 1DL3A 1RD5A 4B4HA 4XO6A 1EBHA 1TE6A 2QDDA 3S2NA 4ML4A 3SCPA 4D1JA 3VDAA 1PCKA 4QQUA 4XD4A 5CPQA 3AIVA 3NYDA 2XH4A 3ANVA 2DH2A 4BJHA 4ZCWA 2PI6A 3G22A 2O7QA 3TNOA 1UD8A 3PZVA 3CT7A 4RNHA 1AH3A 4GKTA 3E12A 2HE8A 4CNNA 2XINA 5D4YA 6REQB 1DQUA 4Y9AA 3DFNA 4HA3A 4RJEA 3IGUA 1ONEA 2CZ5A 5TQLA 4AU0A 4XUGA 2OO0A 2VENA 5C9WA 3H26A 4PA8A 1NP0A 4F40A 1T7LA 4AD0A 1H49A 2DSKA 4UBPC 3QKEA 1AJ0A 4XO7A 1ISZA 4J9JA 2DY3A 2W79A 1H7PA 5FOOA 1LL7A 2XDFA 4KS0A 5J5DA 2VVSA 2CPUA 5A6LA 5CZKA 3RXZA 1UR1A 4AZBA 1XGEA 4W4QA 5BWAA 4S3DA 4YS1A 3GXDA 2V82A 5HNNA 4E2OA 4LCQA 3EDFA 5BW6A 3MC5A 1OZMA 2J47A 4EF8A 1OB0A 4M8UA 5T8GA 5A2BA 3BOLA 1P1XA 4UTLA 2EPKX 4ZXOA 3VD3A 1C9DA 2FQIA 3SCTA 4CNOA 3WJXA 3UZZA 1EH9A 4S1FA 3UW6A 3EWDA 4F0HA 3GVGA 2BZNA 3URAA 4LH8A 4XUYA 3V4BA 1T6MA 2G41A 2WYSA 3HGJA 2PP0A 1XYAA 2VHLA 1J2BA 4NZFA 1QXLA 4PTWA 1R2SA 5K9DA 2O55A 3LMZA 4O54A 4D6IA 2D3NA 3L68A 1A0DA 1XLEA 2YDRA 2RHGA 3GTHA 4DNMA 2DV0A 3NQCA 3SBFA 1VFTA 3AYTA 3LERA 3K8KA 4QG6A 4CNTA 3AXHA 2J9XA 3L5LA 5EGRA 2PTDA 1P0NA 4R9OA 4EF9A 1NWUA 1SW7A 2XIIA 4IOTA 4W88A 3VILA 4QHRA 2DIKA 1TZ9A 1E1CA 4GC3A 3BVJA 4WSHA 2VC7A 4C91A 2F6KA 1XBZA 1XLGA 1YNPA 3CH0A 2OEMA 4LU0A 4L9YA 1EOMA 3GG7A 5A3HA 4LWWA 2GYIA 5GVJA 1QW8A 2OQHA 1ZNNA 3F5KA 4M6VA 2JKEA 4F0SA 3WQWA 1MWOA 5I24A 4JN6A 2DQXA 3C2VA 5C2CA 2MNRA 5G1YA 4HNLA 1UASA 3AFBA 3SUUA 1BF6A 4GQ0A 3R8GA 1UKQA 3VNIA 5LNSA 4HP5A 1TX2A 2VURA 1OFBA 4ONVA 1BXNA 4P8UA 1XX1A 2VC9A 3HGRA 3AROA 2WMJA 5CG0A 2YFNA 1XYBA 2AGKA 3BQ5A 3L9CA 1ZALA 3AMCA 4K7VA 3B40A 5LXXA 4YHEA 1X38A 3ES7A 3O16A 3PK7A 2DSZA 3QFWA 3GVVA 5AYXA 3RFAA 1CT5A 4H6QA 2PLKA 4B2DD 2YOCA 4MNLA 3HPZA 4KEUA 5HJXA 1X98A 3EMZA 4GPNA 2I56A 4GZ7A 4JYEA 2NUWA 3BJTA 1BQGA 2IQ0A 1XL9A 2FGZA 4LRSA 2ZE3A 2VGIA 1T40A 4WXZA 3CHCA 3PZGA 3N2TA 4TXEA 3WDQA 3ONCA 1GVEA 1FHVA 1EQCA 3C0JA 3RGTA 2WSQA 3S46A 2E5BA 3SCUA 3KRSA 3T0BA 3QW4B 5AZ0A 1MVYA 1W3NA 4ZOAA 1SR9A 1JQVA 1UMLA 4DUOA 2EPLX 1RY0A 2V6AA 1BKSA 4FX6M 4TVDA 1UR9A 1QR7A 3AYSA 4CQ9A 1TTJA 3GE7A 4PMNA 5IOBA 2GUUA 1BYDA 3W88A 3IGSA 1A5KC 1JI1A 4JN7A 2DT3A 3F2CA 3PWAA 1GYNA 1KBKA 3MPGA 5D2VA 3CUIA 4GABA 5EYWA 4HNUA 3REQA 4JBRA 1A5BA 1AD4A 5CSUA 3RLHA 2BV9A 4AIBA 4O12A 1HP5A 3VIOA 3MSGA 2PGEA 1LP6A 3IIXA 3HOJA 1EWDA 3ABZA 3DFPA 2O92A 4NNBA 5U7SA 5KSWA 1YE6A 3VA8A 2XWEA 3O6AA 1XH1A 4QLLA 3C4UA 2Y63A 1MEHA 4KRUA 4PRWA 2R1KA 3NQVA 4QITA 5C2XA 4H6KA 5CSSA 1SUXA 5D9PA 3MQTA 2Y4SA 3CLWA 4QR6A 3OIHA 2A3EA 4U3CA 3AMDA 3VGGA 4Y7EA 3ZM8A 1OG6A 1TZZA 1TMHA 3QV7A 2RFGA 3BSMA 3QTGA 3W22A 2OJPA 5AVHA 1XHGA 1GVRA 1TFVA 2VRJA 3W7NA 3KBVA 1Q6FA 3OZPA 4IJBA 5AHEA 2NSXA 4L1WA 4QIUA 3CQIA 5CGQA 3AISA 3TE9A 1ZLPA 1AQHA 2PDMA 1DORA 3I10A 4O1DA 1QAPA 2AL2B 2OQLA 2IKGA 5CLWA 1GJUA 3CUJA 4RNIA 3WY1A 3HPFA 1ZJIA 1M9HA 3LD5A 3DYOA 3ZVHB 1VHCA 3GNXA 5CJMA 2OFJA 4UR8A 3T81A 5ABFB 4G7EB 4NJKA 1KM1A 5CPMA 3STFA 2E3ZA 3PTMA 3A5FA 3LMYA 3UGVA 1IEXA 2YA0A 1NOFA 4L6DA 2JGQA 4TUFA 4WRHA 3SSZA 4YVXA 1GHRA 5HWMA 1RA5A 2WXDM 1B3YA 4PH6A 4O1FA 1CNVA 2VFFA 4JKLA 4IFOA 2OYKA 4TR9A 2P53A 1W1VA 4O1AA 3CZJA 3C3UA 7REQB 1P7TA 4ZA0A 3O9NA 3NQFA 4MJ4A 2XVNA 1W1ZA 3N6QA 5XIAA 1LORA 2C6QA 2H3BA 1OYAA 2HCVA 3PFRA 5BRPA 4WD0A 5EMYA 3R7MA 1QPNA 4HNNA 1JXJA 9CGTA 1P0DA 4IFKB 3GNOA 1UH4A 3FEQA 3FHAA 1TSIA 3ITOA 3R12A 3IK2A 4PTMA 1U83A 1WUFA 4XISA 4JHZA 4H9TA 4UR7A 3EOOA 1R3WA 3TSMA 4DZHA 1D9EA 1QFEA 3T9PA 1ZCOA 1A49A 4M82A 4I6VA 3QC0A 4B5XA 2WCAA 2ALDA 3ABXA 3CPUA 2YZ5A 2ATSA 3W7PA 3CAQA 1PX4A 1IIGA 3W00A 2FZ8A 3GIPA 1XGZA 1UCWA 1DJXA 2HXUA 3CK5A 1CPUA 2DIEA 1UPMB 3R13A 2DVXA 2QKFA 4L4PA 2WMFA 1QI5A 1WQ5A 1XC6A 4GUHA 2Z1XA 4MVAA 4WXYA 4RZ4A 4C6PA 5IDIA 2W0UA 2GZXA 4A3YA 2AL1A 5A6SA 2ANUA 3FHQA 5AC5A 1QTWA 4AX6A 1O95A 4I90A 1QO2A 4LAOA 2XTKA 1WKFA 1OFAA 3UG5A 4RUBA 1TPFA 4X61A 4D6CA 5DEZA 9XIMA 3TK7A 2QDHA 1SZGA 3GXMA 2WMHA 4JYDA 5L9FA 2FJKA 5F4XA 1XH0A 4C6FA 3LM7A 2P76A 1A3XA 1U1JA 3OP2A 4JTCA 3SGZA 3PPCA 2X8RA 2VO5A 3W27A 3SFWA 5HWNA 1L8NA 4U4MA 4DXKA 1DEDA 2ZRVA 4PMUA 2WNWA 2CCRA 4EACA 2ZX6A 4ZE4A 3JVAA 1LJYA 1W17A 1B3VA 3MA8A 1WYIA 1Q6DA 1W6TA 5A5WA 1E0WA 3NPUA 4UFIA 4GJJA 1XG3A 4JTIA 1DJNA 1V3KA 4YYCA 2X42A 3NPXA 3BLFA 3WH9A 1KFKA 4GFSA 3LGDA 2OWXA 1NIUA 3WUEA 2RUSA 1GHSA 3RPTA 2TODA 1O6IA 3E9AA 5FAJA 3C2OA 1XIIA 4A6GA 4DBUA 1A5AA 4MB3A 5E93A 4FNSA 1EPVA 1L2UA 2UV8G 4KCUA 4S3GA 2XSBA 4JXCA 2PAJA 1K6AA 4HMDA 3NCOA 4LANA 3TYBA 5EFFA 1Q6GA 4HZMA 1OBAA 1XCXA 3GTXA 1GQIA 4BFAA 2C18A 5LHFA 5I09A 4IIGA 3R2GA 1WUEA 2WLZA 4J3ZA 3GHUA 5D03A 4AHQA 1HN1A 3MZ2A 1K9EA 4F48A 4MUZA 4PMYA 3MCMA 1EQPA 1R9XA 3VM5A 4QXIA 3T40A 1QOQA 3NFUA 5BROA 1CZ1A 3WD4A 1JYWA 2F9RA 1B3OA 1Z89A 2VGFA 3GH7A 4L64A 5ABTA 1XGDA 4C6JA 4HKPA 3W2MA 3WL1A 4YWSA 3MHGA 3P60A 3RCMA 2WVTA 2BDQA 4AIEA 1PSCA 2PLJA 1X6UA 3OPSA 2NVDA 1TWSA 1AZ2A 8XIMA 4O8AA 2GVGA 4WOZA 1OX4A 3U9IA 1JI2A 3AU6A 5I3JA 3GO2A 2ZX7A 2PBOA 2E0PA 5D09A 3ABRA 4R33A 3Q58A 3V5FA 4HCLA 4UMAA 2BVYA 3GK0A 4X63A 4KEZA 3RU8X 4WX2A 3DZ1A 3KVJA 2HE5A 3GSMA 2PTZA 5TF0A 3UEQA 4AD2A 1J01A 3KZSA 4NJJA 1HG3A 4CD5A 1P0KA 1GVIA 1KFBA 3PBMA 4Q8MA 4FNPA 2XUCA 3VZYA 4JQAA 4QAWA 3N18A 5D2YA 4LY8A 5CPLA 1PZ3A 4LF2A 2DT0A 3P81A 1JL8A 8A3HA 1V0LA 4PBEA 3E3HA 1E1CB 4L4LA 1Z9AA 4DAIA 1OQFA 4US5A 2PPGA 2GGGA 5LA0A 2IUZA 3TWBA 1UD5A 4WIWA 5D8WA 4KIRA 4Q22A 3GTNA 1QOPA 4IPLA 3B8TA 4F0RA 3GRIA 3VGBA 1EJTC 1HZYA 2Q01A 2ONEA 4PBFA 4C6BA 1V77A 3A64A 3W1UA 2G97A 1SZFA 1VBUA 3GW0A 5HQEA 5J5RA 2QCNA 2WVSA 4O19A 2QLYA 1DJQA 2YYUA 3S2JA 1PVNA 3OLDA 5FSDC 1RK6A 2DZVA 3GW3A 1ZBCA 3A21A 1UD2A 3LDVA 3W7MA 2JEPA 1HKJA 4QJ4B 4OUIA 4HOWA 2EJAA 5LNRA 1HKMA 2NXGA 4GZIA 5BMXA 1ZJBA 2J24A 4GCXA 4MUPA 3WK2A 1I2RA 4I5UA 1MSSA 4PYSA 2VT0A 4JZ5A 1IT7A 3VD5A 4WY0F 1XRTA 3QY7A 5H91A 1UP0A 2PDYA 4DO7A 3QXBA 2XSAA 4QEHA 4IMFA 4NZJA 4D8ZA 1BSIA 1H2JA 1GKQA 4P5UA 3AZSA 1GPWA 1Q7MA 4NJHA 4ZB0A 1J79A 2POZA 2WCGA 1UH2A 3GU9A 1MXDA 1LTDA 2F61A 3SRDA 1DE5A 3GYEA 3GZAA 4LAZA 3I3DA 3W72A 4UTIA 4AVFA 3T09A 8XIAA 3OW1A 1ENUA 3OVQA 2XHYA 1M53A 2HS8A 2OELA 1Y5WA 1IV8A 2VZUA 3V7PA 5D04C 2C7FA 1GVSA 5BXRA 1A50A 2V2CA 4HPGA 4D2JA 5CLTA 2EKCA 4P7QA 4L4OA 3VNDA 1KTBA 4UB9A 5CQ1A 3VCRA 1UH3A 1QCWA 2VVNA 1VRDA 2H90A 1BWLA 3Q2DA 3V1HA 2QXWA 1JD9A 4I9TA 1K7EA 1EP1A 5EMUA 2W6RA 4JTHA 1G7VA 1O94A 1PEZA 2E77A 1QHZA 4MSSA 4M7TA 3REQB 4A22A 3Q94A 3EPOA 3W1PA 3UA3A 1SO3A 3UJSA 4FNQA 4Z42C 2WSPA 1VPXA 1I4NA 3P0WA 1MXSA 4Q32A 1WZAA 1OFDA 3NIYA 3OZMA 3RJYA 2PF0A 3IIZA 3UR8A 5FA5A 1XFBA 4EWND 1H7NA 2VUNA 1Y65A 2OWWA 1XR2A 4K6AA 2DVUA 2QDGA 4UQCA 5K2ZA 3QHOA 1W91A 4GGHA 3QW3A 4IZGA 3EZ4A 1GGOA 1ZB5A 3UWQA 2DZBA 1JZ2A 1SZNA 3W1AA 1XIEA 1I6NA 2XZ9A 5F4SA 1LM1A 1OD8A 3UXDA 4Q4PA 1TJ2A 3PG8A 1GOXA 2J6XA 5F1UA 1W3KA 1WDPA 4PMQA 2XH2A 4C6NA 1ZL1A 4NNAA 3RN6A 3WENA 2VTFA 1JZ7A 4MAZA 2Z7KA 2ZUTA 1XYCA 1Q5MA 1HJUA 5HK4A 3B06A 4TIMA 4K3ZA 4DJFA 3NA8A 2PB1A 4HU0A 3N9SA 4JL1A 2WHKA 4DPPA 1W9XA 4AZGA 2FVLA 1UWAA 4PRTA 3G77A 1GYLA 3SW6A 1FCQA 2PDFA 1BVNP 3O0FA 4NY2A 1LOLA 3AS3A 2OB3A 2B7NA 2F2HA 2VKZG 2D20A 4EP8C 2G4JA 3U57A 4GINA 4DWSB 2ZKMX 1TMLA 5EPDA 3U48A 5ABHA 4Q7NA 3SIMA 4JFUA 3KFTA 3CEPA 3DAQA 4PCPA 4FP1A 1V6VA 3CPRA 4XSMA 4JEJA 4K8GA 4EAMA 1P7TB 3M44A 3T0CA 4H9ZA 1MRAA 3TONA 3W7JA 3B8SA 1XIMA 1S38A 4HOXA 4A3RA 3T8LA 1E51A 1ZU8A 5B7YA 3LHZA 4HZ8A 2GDQA 3S9IA 1J11A 1S2CA 3U8GA 3ZS4A 4KGJA 4UQBA 3QGVA 3A9BA 1G5AA 3KBJA 1M3UA 3TZFA 4U31A 4QG9A 3GAYA 7ENLA 4RKAA 1TWIA 1L6WA 3LHYA 4LUSA 4CN4A 4CVUA 1BTMA 3I6RA 4KF1A 4H9MA 4DPQA 4NG3A 4CQCA 4JNZA 3IIPA 3B0VC 3MBDA 4WDWA 2G5WA 3UJEA 3BAYA 1XRVA 1WKEA 2R9RA 4ACZA 1LRTA 1PZ0A 3DYMA 5A6AA 3WBXA 3MANA 1Q2RA 1XM3A 1IQ8A 3HF3A 4TO8A 1N8FA 1TVPA 1FWEC 1UWSA 4J28A 4JTRA 4DWSC 1NARA 2NUYA 5G4EA 2WCSA 3L4TA 3ZVIA 1TCMA 5BRBA 1UUQA 5HJLA 2YLLA 4LT9A 4MJZA 3DG6A 2POTA 1W1YA 1S2AA 1RBAA 1D8WA 1JUEA 3AO0A 1AW2A 3E96A 1EKOA 2V3DA 2FZBA 1GW1A 2WO5A 1JAKA 4QEEA 4JIEA 2CKSA 3IEBA 1LBLA 3C2YA 1OCJA 1UR2A 4GQRA 4LY4A 4DF1A 2Z2UA 3NURA 2OO6A 2ZZ4A 5D9NA 3UF9A 5A6MA 5K9CA 2VM8A 1ZAJA 4O18A 2ZC1A 1CEOA 3LV6A 4K2SA 1W1A1 3P61A 4BI7A 3ZQ9A 1VAHA 5AOUA 3B3DA 2DZTA 3KS5A 5G1MA 3IUDA 4O17A 4Y6GA 3PY2A 4Q8PA 3B0XA 4F9DA 2DGAA 1KBJA 3UNTA 4JDYA 1P0BA 4K8HA 2OZTA 1DJHA 3UU0A 2VFEA 3Q65A 3PZOA 3HIJA 3SQSA 2OLHA 4IT1A 1H1ZA 4LSBA 2OLSA 3BG3A 2XM2A 4IPPA 1VH7A 3NOEA 2QUMA 3KDNA 1BYAA 1PCWA 2FB3A 1KNWA 5I78A 3M46A 4FK9A 2ISDA 4MMWA 3RX4A 2Z1SA 1HJQA 4CKQA 4MY1A 4IF2A 3W2NA 2JQXA 4A8LA 4IIHA 4Z1BA 3IJ7A 4KIEA 5JXQA 1H50A 3N2XA 3O7UA 4IISA 1U5JA 3DX5A 2D24A 3BCJA 2TSYA 4LRTA 4RK8A 1Y7VA 1VF8A 4DBSA 3AIRA 1ICSA 1VLWA 5H2ZA 1J5TA 3QRHA 3QTPA 3U7BA 4Z2HA 5FACA 3RNDA 3OBEA 1XLLA 4DF2A 3SCNA 5BYWA 4IICA 5KINA 4P7LA 1KRBC 4CQ8A 2A6LA 4W7VA 4FF5A 4ORMA 1OVDA 4PL2A 1W5QA 2A6NA 3TSBA 3HV9A 4AISA 1MW2A 2IQDA 1GUVA 2FJUB 3G8EA 4GI4A 1MYRA 1R85A 1H63A 2HS6A 1A5CA 3TZNA 4LFYA 4ZQMA 3KOFA 2WQPA 1DWHM 1X1NA 4GXPA 4X2PA 5JQ9A 3W7RA 2I57A 3PNZA 3CHEA 3BK0A 1DIEA 2WWCA 1Z8AA 3BCFA 5IXEA 3BL3A 3UPMA 1OX4B 4EPKA 2ZRXA 1UZ1A 3MUIA 3FVDA 1XS2A 3BH4A 2XPKA 1Q13A 5C55A 5HQMA 5I77A 4DELA 3BLKA 1TV8A 4BF9A 3C0QA 3HMCA 3BURA 4DUXA 2AMXA 3KM8A 1JULA 4PEEA 1UOZA 2WPBA 1ZBWA 3RITA 3DI1A 4V33A 4RLIA 1F6PA 2WVVA 1GTEA 1OX5A 1KM4A 1BGAA 3W1XA 5A8OA 1EUAA 1OADA 2D3LA 4M3PA 1JG9A 3U4AA 1WE5A 3KWSA 2FHBA 1A5LC 3M5YA 5I02A 4IL2A 2X0SA 2XVLA 3IIVA 1KFCA 2GJLA 4WQ6A 2PDJA 3AIWA 3RLVA 1THFD 1EYWA 1B54A 1PTDA 1TQJA 1Z44A 3CAVA 4Y8EA 3N29A 2VCBA 4HHLA 4LV9A 3E5BA 3O63A 1V02E 4QX4A 4OU1A 1H5VA 3WDHA 1LF1A 1DWFM 3AS2A 3CV6A 4AZ7A 1KGWA 1FWSA 2ZUMA 3BO9A 8CGTA 4MB4A 3EOEA 2Y2WA 5REQA 2WOQA 1JCXA 1VYRA 3QZ6A 1XKYA 3WNOA 3KBNA 1QBBA 3TYUA 5D2WA 3S5YA 1EPXA 1U33A 2J8TA 3QC3A 3SIZA 3VOHA 1MW1A 4LB3A 4TV5A 2PGFA 3S1GA 3U2ZA 4E6MA 2WMKA 3SN0A 3WO8A 3DERA 4LCSA 3I7QA 2X41A 3WLHA 1BHGA 4POCA 3PR2A 5CZSA 1EEPA 4OJYA 1UP3A 3M5XA 4MKSA 4IWWA 3W2UA 3WD3A 2O9TA 4UTMA 3KS6A 1VFMA 1XDLA 4HTBA 1RP8A 3KP1A 2WSKA 5TIMA 3QMSA 5HR7A 5DANA 3MV01 3WLLA 1V0MA 3BGAA 1TPWA 4A2SA 3ARQA 2QUUA 3WLPA 2PDCA 4UOJA 1V3HA 1FY6A 1XLKA 1O7AA 2CNCA 3RO6A 2VDIA 2OEJA 4O0ZA 2Z6IA 3N3MA 1X8FA 1TB3A 2W67A 1JGMA 3W38A 1N55A 2I1OA 3WK1A 1S5TA 2ZTJA 4NUWA 4Y2WA 4CD8A 4W8AA 3W25A 4GQBA 3UZJA 4DZ5A 3IUHA 7TIMA 1F8IA 4KCVA 3F5LA 4WOQA 2QCMA 4MPKA 1Q4WA 3WMSA 3NQ8A 3INPA 1KXTA 3RR1A 4GUIA 3E0WA 3QBUA 5D30A 5AYZA 5BXSA 4LS0A 1R9ZA 1B3WA 3AXXA 3OBAA 1Q6OA 3WQ6A 3M6YA 1FXPA 1PAMA 2CLEA 2Z25A 5D38A 2CLHA 2Q3OA 2BP1A 3A4WA 3N17A 2YX0A 2GQ8A 3EX4A 3FKRA 4X60A 1GOMA 5H8PA 4IIDA 1DP0A 7TAAA 4FXJA 3LS9A 3MUCA 1KV8A 5T91A 4M5PA 2ZADA 2I16A 1EGMA 5B7ZA 1QATA 1E9ZB 3STPA 3ITYA 4AD1A 1ZGDA 4E8CA 4MWAE 3MSDA 1QMLA 2X0YA 4O57A 4W8BA 3NM1A 1EYEA 3W85A 4GA8A 2CERA 3WLMA 4JTFA 3MKCA 5AYIA 4Q4RA 5FJOA 1QK2A 3P74A 1OK6A 2QYGA 3B04A 4CU6A 3N9RA 4PSRA 3HU7A 1VBHA 1DJZA 1IXNA 3MU7A 4UWMA 1X39A 4O13A 5A2CA 4XAFA 5GQBA 1IEIA 4GNKB 1S1RA 3KLLA 4XD5A 4GUFA 4V1XA 3LEPA 1IXOA 2X2GA 3DG7A 3GM8A 1UWUA 2DIJA 3UP8A 1LLZA 4ECLA 1KW1A 4UTUA 3WUBA 1LL6A 4MJMA 3T2PA 1XC4A 4GO9A 4RPQA 3TMLA 3LLDA 1LYXA 1J4EA 2WBGA 4YN5A 5DXXA 5DY2A 5IDZA 5FJRA 2OWCA 1A3HA 1FWRA 4Q6XA 2EJ1A 2YL9A 2X40A 1F61A 5C6MA 1EX1A 2G3IA 4XZMX 1VEPA 1XRSA 1IEQA 3OODA 3EWBX 2GLKA 3CU2A 1XIDA 1ZPTA 4X9YA 3H7RA 3FY1A 3GUWA 3LX9A 2E6DA 3CIXA 3DFQA 3LQLA 3GVQA 1R38A 1WX0A 2BODX 4H7CA 1JCNA 2FPVA 1KCXA 3V3WA 3R8RA 3BLIA 3EWUA 4CEXC 3WNLA 2NQLA 3UY8A 1ZJAA 1FWGC 3GAKA 4B5WA 2D0GA 1S2WA 2X7VA 3B8WA 4KETA 5FEPA 5BRQA 3NWRA 1JUBA 4ORIA 3NZ1A 4JX6A 3KLKA 3CUGA 4PB3A 1X8CA 3T78A 5E0FA 1XSJA 4OIFA 4ASTA 3V0UA 3KVKA 3B9OA 4UCGA 4LUSB 3W3OA 1ODZA 4XBKA 3FYYA 3VGFA 2GDUA 3IJ9A 1EZWA 4DJFC 1US0A 4H9YA 1FRBA 3UYIA 2JF7A 4W85A 5G4HC 3VNKA 2G3JA 1E1FA 4OOZA 4KRZA 4C7GA 2BB0A 4BR1A 4ACZB 5BXTA 1VC4A 2CESA 3KZPA 4WUIA 4H83A 2WZHA 2HPMA 1RBLA 2Y8KA 3IARA 2V67A 3D47A 1KM5A 4AHPA 3GXFA 3JW7A 3NSNA 1K03A 1OABA 4R85A 4XSLA 5C9ZA 2G50A 2YL6A 2Y1HA 1E71M 3TTSA 4BEQA 1EJVC 2HZGA 3DKJA 3UCDA 4QAIA 5J04A 4EX4A 2TAAA 3P62A 5EB8A 4Z1YA 5SWUA 4WDXA 1ISVA 3BWWA 2FIQA 3T08A 4PTVA 1C7TA 2BX7A 4ZTYA 5IFTA 2V69A 3L2IA 1FQ0A 3NZGA 3SUSA 2QJGA 1UWRA 1JNEA 3F2BA 3A47A 3T07A 3ZWTA 3VM7A 4US5D 2OGJA 1NWSA 4PSPA 2L5HA 4LC6A 4AXKA 2C19A 4DUVA 3LENA 6XIAA 4FR1A 3UD6A 2FVKA 3THUA 4YHGA 2NX1A 4H8VA 4R88A 3EPNA 2XIOA 2O0TA 1IIHA 3S1XA 4S38A 3UJRA 4J3WA 4WDUA 3L4ZA 4NYUA 1G4SA 4Q4MA 1UUOA 4LVGA 3LZ3A 1M04A 3CTTA 4LTSA 2A3LA 1Y5XA 1QI0A 5TAOA 3NO3A 1AODA 5FEWA 3M7WA 1QPOA 2QPXA 3U2CA 4AQLA 4AMCA 3P0XA 1LRQA 3VNYA 4QQ3A 3LSBA 3P67A 4P7NA 4AZ6A 4DAFA 1R7OA 4Q8WA 1IGWA 5E09A 1KM0A 4HPNA 4WGXA 3SUTA 1UOKA 2EAWA 1LG1A 4GZJA 1LZOA 3NL2A 4HQVA 5I7GA 1BRLA 4ZTXA 1ZQ5A 4R5EA 2X09A 3VIPA 1P6WA 2GGIA 2Q8ZA 3WFLA 1A47A 2Q6ZA 3H2FA 3S9ZA 4IUOA 3DECA 4F4RA 1W5MA 2DW7A 4WJEA 1B3XA 2C91A 3T4CA 5I06A 4HA1A 4PUDA 1FDZA 3FA4A 3AUOA 4UFHA 2VDGA 2JE8A 4RR4A 2BVTA 3S42A 4HMCA 2DT1A 4NRRA 3T05A 1AH0A 3R58A 3SCWA 4KCWA 1ADDA 3WF1A 3VKKA 3ZLGA 3KDOA 3FS2A 3NXFA 4G56A 4AG0A 2OU4A 3GG8A 3TYEA 3BW2A 3W29A 2CXEA 2ZRYA 1GPFA 3C61A 2G3MA 1OT1A 3AJ7A 1Z41A 3N6JA 3TAKA 1BPLB 3B4UA 1UHVA 1SYTA 2FTYA 2IS7A 4ZFMA 1I9CB 3EMQA 3L0GA 4NX5A 2BHZA 1R3YA 3ALFA 2CITA 3JZEA 3CEUA 5FEZA 3TKFA 2REQA 3NZRA 2OVLA 1NTHA 1MZRA 2HISA 4RW3A 1KR0A 3HG2A 1QNVA 2BVDA 1N2VA 2W3ZA 1GG0A 3RCNA 4BQ2A 1P6CA 1RCQA 5D37A 5C0QA 1D3GA 2BFGA 2QGHA 5I5RA 1FKXA 4ZL1A 2KX9A 4LAMA 2R8WA 1E5NA 4O11A 6ALDA 4HK6A 3B0YA 4A05A 5TBOA 4IGSA 4D71A 2YA2A 4CGTA 3THDA 1KA9F 1Z69A 4JN8A 2WVVB 2H3DA 3UXIA 3R1ZA 2CBJA 3WQ5A 1CBGA 3MYPA 3G1XA 4FF7A 3NAVA 1KTCA 1R3QA 3UWEA 4WF7A 3HPAA 4NSBA 3KUMA 5RUBA 3CZEA 1HJWA 5C7VA 4JFWA 3ZXWA 5LHEA 2WVUA 1MFVA 1G7UA 4QM1A 1XIHA 1Q8AA 4I8YA 3AAMA 3L0NA 5K4ZA 3IPWA 2DZXA 1JUKA 5LYRA 2QAPA 3H22A 1YQ2A 3GC5A 4GUJA 1XLAA 4IX0A 4UOZA 2ZBTA 3WEMA 3H2NA 3GR7A 3FA3A 4TVUA 4C7DA 1KCKA 3NQAA 1NOUA 4HN4A 3EDEA 2JALA 4V2XA 5REQB 3FA5A 3T2QA 1AUSL 4DJFD 1EXBA 3VNMA 3L23A 1HUVA 3U5UA 1XYMA 1RY8A 3QZEA 4PTNA 5CKSA 1A53A 2BHUA 5D05A 3KRBA 1J0KA 2BBFA 2VJXA 4HNTA 4J3TA 2VEGA 2FH8A 1VPQA 3EYPA 3L4VA 4HIBA 4QDPA 1YRRA 1QHPA 2PDNA 4LAKA 3TQVA 3VZZA 3R79A 2YR1A 1MW3A 4N9CA 2YW3A 1LL4A 1W56A 4O28A 4AD3A 1GYMA 4FXRA 3FEMA 3FN9A 1CXIA 2GOKA 1PBGA 4XAYA 4BQ5A 5BOEA 3C5QA 2NX9A 1XLJA 3BLPX 4P61A 4AMAA 4AD4A 3M4HA 4AW7A 3DBPA 1D8CA 3OHMB 1MQPA 1DJIA 3FJLA 1XP3A 2P0IA 1CYGA 2Q8LA 5HMEA 1OSEA 3KBMA 1S39A 1LUCA 3J7HA 4O1CA 2WWDA 1UUMA 1C9WA 1VS1A 3VX0A 4C65A 3GHRA 4MY8A 4PMXA 3H4XA 4XB3A 2GVEA 2NQZA 3H2AA 1E6ZA 1YTKA 3TTOA 1U1UA 4CN6A 3C2FA 4FB7A 3UCQA 2BGSA 3O8AA 2NT0A 1XQKA 2PRMA 4JNMA 5G1TA 5EMLA 1HKWA 2GVLA 1BYCA 1LOSA 4IIFA 1FH9A 4N42A 3EEZA 3RG6A 4ZBCA 5LIXX 4QS5A 4A8RA 3ARVA 5DMYA 3WD1A 4NT0A 4J27A 4W7UA 2OQYA 4A8IA 1ECEA 3KEHA 1QU4A 3AS0A 3W37A 2WAGA 3AU2A 3G18A 1ME8A 2FH6A 1NH6A 3ZT6A 4PUUA 3HGSA 1OGGA 2CYGA 1ITCA 4AZIA 1V7YA 2PS2A 3EX2A 3QKZA 3E38A 3G1YA 3TIMA 1RJRA 1E15A 3FOKA 1M41A 3F4WA 1J0YA 3VMOA 3WQDA 5A6KA 4DHGA 1OCQA 2YDQA 3Q4DA 2G8ZA 1QOXA 1D7KA 3EMCA 1NSJA 2ISVA 1BGGA 1KBLA 1AL7A 3A13A 1HIZA 1MMFA 2FMNA 1DYSA 4AY1A 1CXFA 4XQ6A 1JPMA 1B9ZA 3S2MA 5I3HA 2XGBA 1UR3M 4EPBC 1Y0EA 4GGBA 1KGUA 1KO0A 4FO4A 1DIKA 4MADA 1LBMA 1RVGA 3E2RA 1OCBA 2IXVA 2Z1VA 1A4LA 2PTYA 2HK0A 2Z26A 1GVQA 3DHPA 1IWAA 3AWNA 3VCNA 4AY8A 3CB8A 3GXIA 5E1QA 3UG8A 2X7WA 3BW4A 1JGIA 1AA1B 3K1DA 4AVOA 1J96A 2WHMA 1E6SM 3OTRA 1AMKA 4PFMA 2Q8XA 2PWHA 1I2QA 2YDAA 3G24A 2Y8UA 4K8EA 3GVWA 4OT7A 5G2IA 4HTYA 4PCTA 2AMGA 5HANA 3ELFA 4JIHA 3WH5A 4UFJA 4Q8QA 3MUZ1 4GG9A 1E4IA 3GBEA 2FHFA 1B5TA 3AZRA 3HG4A 1NJJA 3HFYA 4GCAA 1WDDA 4ZQNA 2VR2A 2G3NA 2NUXA 3QLLA 1VJIA 5DRCA 2WHJA 1GORA 1H7OA 3VABA 4NILA 1XPYA 2W63A 5BOFA 1ELSA 1RQBA 1TUXA 4GXWA 3EXSA 2HJPA 2QIIA 5PTDA 5FEXA 1OIMA 3N12A 1WXJA 1GZJA 2GUYA 3PANA 3VNLA 2VP8A 1R2TA 4C6KA 3QMRA 5ECUA 3GU2A 4NVTA 1YKWA 4IMEA 2PSNA 1EL3A 3B0UX 1WO2A 4MWAC 3JS3A 2OT0A 3SUWA 3N11A 3BOFA 3M1ZA 3HO8A 4A35A 4B9ZA 2JGYA 4JY8A 5LNVA 1EFZA 3KOXA 1W1B1 3UQNA 4AIUA 1S2VA 3V0SA 3CWNA 4N4PA 2JKPA 3JZUA 3GFZA 4E2VA 3PC0A 4YL2A 1MUWA 1UKSA 4NZ3A 3S9YA 4QE1A 3H4GA 4U5KA 4PZVA 3AYRA 4M24A 2C1GA 1A5OC 2YPIA 2A7PA 4IPJA 2Z00A 1XLDA 3SRHA 1E3ZA 1F6KA 3NZPA 3BXWA 3QEZA 3C2RA 4E5TA 3VD7A 4I7VA 4C6CA 4CEUC 4RE2A 3PUEA 4XBJA 1Q6RA 3M41A 4XIAA 4J1OA 3O6DA 2PDPA 2P5NA 3LNPA 4ZXLA 5FESA 1M65A 2PF8A 4YPJA 1YIXA 2WM1A 1UKOA 3E74A 1TPEA 1QJWA 3USZA 1UWTA 2R14A 3RU6A 1H3GA 2VX6A 1IR2A 4S39A 4AC7C 2I7GA 1LQ0A 2CFFA 5T9BG 4TMBA 4W5ZA 4LBSA 5AYBA 2X05A 1LWIA 4OFCA 4HNOA 2RDUA 3W53A 4CD4A 4JTKA 1BFNA 4JTQA 2GVJA 3M0YA 5F2LA 3AXKA 3I3EA 1OF6A 3W1NA 3W70A 2QDEA 3BOXA 3M43A 1TIWA 1PIFA 1HQTA 2ZCGA 4NZ4A 3W01A 3V75A 1VCGA 2O4MA 3GR4A 4O50A 3AOFA 4DZAA 2W4XA 1UIOA 3UVAA 4ZE5A 5B80A 3CS2A 1LQ2A 2ABBA 4Z08A 4DZIA 3PTQA 2BVWA 1SO4A 2J66A 3EAUA 1KQZA 4GJIA 3RIKA 5DMNA 4LXFA 4L1GA 4NF7A 5JU6A 3EGJA 4IMDA 1BRLB 1NVMA 3PUGA 1OYCA 1KD0A 4JQ3A 4N2YA 3N4AA 1GG1A 4PUKA 3U2OA 1TO3A 2GQ9A 1F8MA 3GLCA 4GIAA 4G2DA 4Z0SA 1F7BA 1YE4A 4F2UA 4AWUA 2GPTA 1CECA 4GY0A 4JTUA 3T0DA 2IXUA 1W1TA 1ZJHA 1K8ZA 3T6CA 1FWHC 4G8TA 2CHOA 4OBTA 1TJ1A 4YMZA 1UMYA 4JKMA 2GSHA 3WQPA 2E5CA 1KQYA 4PB5A 2C13A 2V2HA 5CEWA 1OZQA 2PP3A 1CGYA 3FYPA 1KKRA 1RA0A 4I7WA 1RCOB 4K7YA 1NQKA 4FOJA 1EZ2A 4IJRA 1W5OA 1Q6EA 1R3TA 1FWAC 4AFYA 5U4NA 1L6YA 2C71A 2HQAA 1GJPA 1A5NC 5IBXA 4GUGA 4N0RA 4X9SA 1J6OA 4HU3A 4D6DA 1QO5A 1IZKA 3S5ZA 4XX6A 3WK3A 2OSWA 4N9DA 1HT6A 3TH6A 2LLEA 2REQB 1KM3A 2OG9A 4UMBA 2B7QA 1R0MA 3L7RA 4F79A 4HPHA 1HL2A 3SUVA 1T99A 1JNDA 2EF9A 4C1NA 2WMIA 4PTXA 1UZHA 4YNGA 5E0KA 2VRKA 3AMKA 3N15A 2FFIA 3S3GA 1K02A 4MGGA 3APYA 4IQDA 1YW1A 4CD7A 3T0TA 3CAKA 3MJMA 1X96A 4ZSUA 4R7OA 3S1UA 1VP5A 3F4VA 2PGRA 3WK0A 2PODA 1SZRA 3K1GA 1MDRA 1ONRA 3NDYA 1E0VA 2W66A 3TN5A 1S1PA 2FZ9A 4LS2A 2FKPA 3AIBA 1UR8A 1FUYA 1W3LA 4UTFA 1XJBA 2OYMA 3W1QA 1HX0A 3PTKA 1JF5A 2E9BA 1JCLA 2VCAA 5DF0A 1WXYA 2GGHA 3CO8A 3TW9A 4S3BA 4YIWA 5I0DA 1W0MA 2YLAA 2VCCA 3WDIA 1LCOA 2OSYA 3L4WA 2D23A 3GKAA 4K1GA 1LOQA 2WSRA 3H53A 2VQTA 4GO8A 3C6CA 2QF7A 1UC4A 1XWYA 2R6OA 3W07A 4C6IA 1NELA 5AHFA 1C91A 1S3TC 2Z28A 3M0IA 4N02A 3M0VA 2NWRA 5A6BA 1IE7C 5C54A 3GHSA 4H7VA 1S3HA 4XAZA 1H41A 7CGTA 2DORA 4J3XA 3VIJA 2ZUUA 3EDJA 4F8XA 4S3FA 1PXGA 1VJSA 4M19A 3ZOAA 1JZ3A 1M03A 1K6WA 1KRAC 5CZTA 2QHAA 1DTNA 4BWLA 4EPEC 2QCDA 3KX6A 4YTUA 3BZGA 3VD4A 3I6TA 3GNPA 2GOUA 5G5IA 1FWWA 1MEWA 2NSOA 3UG3A 1E70M 1R6WA 5L6UA 4HJFA 4ML9A 1YDNA 2FPTA 1GOQA 2ZDRA 3W24A 1OWQA 1B9BA 2PWFA 4ROQA 4Q4QA 3GIYA 2HPIA 2X1UA 2IKHA