4LCRA

The crystal structure of di-zn dihydropyrimidinase in complex with ncba
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
485
structure length
484
Chain Sequence
AGEILIKGGKVVNEDCSFFSDVHIRGGKIVEVGPDLRVPPGARVIDATDRLVIPGGIDTHTHMELAFMGTRAVDDFHIGTKAALAGGTTMILDFVMTQKGQSLLEAYDLWRKTADPKVCCDYSLHVAVTWWSDEVKDEMRTLAQERGVNSFMFMAYKGLFMLRDDELYAVFSHCKEVGAIAQVHAENGDLIAEGAKKMLSLGITGPEGHELCRPEAVEAEATQRAITIASAVNCPLYVVHVMSKSAADVVSKARKDGRVVFGEPIAASLGTDGTNYWHKDWAHAAQYVMGPPLRPDPSTPGYLMDLLANDDLTLTGTDNCTFSRCQKALGKDDFTRIPNGVNGVEDRMSVIWEKGVHSGKMDENRFVAVTSSNAAKIFNFYPQKGRIAKDSDADVVIWDPKTTRKISAQTHHQAVDYNIFEGMECHGVPVVTVSRGRVVYEEGRLKVSPGQGRFIHRQPFSEFVYKRIRQRDEVGKPAVVIREP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chromosome 8 SCAF14545, whole genome shotgun sequence
publication title Crystal structures of vertebrate dihydropyrimidinase and complexes from Tetraodon nigroviridis with lysine carbamylation: metal and structural requirements for post-translational modification and function.
pubmed doi rcsb
source organism Tetraodon nigroviridis
molecule tags Hydrolase activator
total genus 185
structure length 484
sequence length 485
ec nomenclature
pdb deposition date 2013-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4lcrA01
3UR2A 2ICSA 3MKVA 3OU8A 4HJWA 3MPGA 4C6QA 3OODA 4ZSTA 1POKA 3CAKA 4AC7C 1ONWA 3B0XA 2AMXA 4H9UA 3EWCA 3RYSA 4KESA 3MVIA 4GX9A 3DCPA 3GTFA 2E25A 2BGNE 2PAJA 2VR2A 4LH8A 2GOKA 2OGJA 4H00A 3O0FA 5FSDC 2R1KA 5FSEC 3GRIA 3GU9A 3B0YA 1KRBC 3G77A 3K5XA 4ERGA 3URBA 4LAMA 4C6EA 4OFCA 3PNZA 3HPAA 1FWBC 2Z2AA 2R1NA 2EG8A 1V51A 2R1LA 3DUGA 3GUWA 4GX8A 2VC5A 2Y1HA 3E3HA 4E3TA 4B92A 1K1DA 2WM1A 5CH9A 1NDZA 2AQOA 4IGMA 1O5RA 4IFKA 4INFA 4RDZA 3LY0A 4CQCA 4J2MA 1UBPC 4YIWA 2OQLA 1YRRA 3IGHX 4GBDA 2GWNA 1RJRA 2FTWA 4C6IA 1UMLA 5HMEA 3T81A 4IFOA 3RCMA 2DVTA 3ITCA 3S2MA 1EYWA 2Z29A 4J35A 4LCRA 4KEUA 1FWCC 3GTIA 4XD5A 3OVGA 1A4MA 2PLMA 3WMLA 4CEUC 5HMFA 2Z27A 1P6CA 4NI8A 4LEFA 3QY6A 3EWDA 3A3XA 2EG6A 1DPMA 3S2NA 1FWGC 4QS5A 4C6BA 1FKWA 4QRNA 4C60A 4NG3A 3MJMA 2DVUA 2AQVA 4DI8A 1FWAC 2VM8A 2G3FA 1ONXA 1E9ZB 4AQLA 1I0DA 3A4JA 3K4WA 3UBPC 1NFGA 2VHLA 2PGFA 4EPEC 2UZ9A 1RK5A 1JGMA 4XAFA 2HBVA 1WXZA 2D2JA 2YZ5A 3C86A 4MUPA 3ORWA 5G4HC 1XGEA 4QTGA 2OOFA 3MTWA 3FDKA 2HPIA 4KIRA 2A3LA 3NQBA 4IH3A 2CZVA 2QPXA 2YB4A 2KAUC 2WJDA 3RN6A 2P53A 1KRAC 4KEVA 4IFRA 4XD6A 2F6KA 3UF9A 4RDWA 4V1YA 2QS8A 2Z24A 4DO7A 3SFWA 3S2LA 4H9TA 3AUOA 1RJPA 3IRSA 4HK6A 4GY0A 4CEXC 4HK5A 4DLFA 3RHGA 2GZXA 3BE7A 4HK7A 2BB0A 1FWEC 2OB3A 1W1IE 1P6BA 3URQA 4EPDC 3E0FA 4HA0A 1YMYA 3GIPA 2D2GA 1WXYA 4PCPA 2Z7GA 1J5SA 1E9YB 1GKQA 1EJTC 2HPMA 1YBQA 2I9UA 3OOQA 3UPMA 3KM8A 4EP8C 2PGRA 1QW7A 4DNMA 4M51A 4ERIA 2XIOA 3O7UA 2GSEA 3PANA 4DYKA 4KQNA 4G2DA 4EPKA 4GY1A 1VFLA 1KRCC 4C6OA 4WGXA 3CS2A 1FWDC 4PCNA 3LSCA 1NDWA 3LSBA 2UBPC 1FKXA 4RDYA 2VUNA 1QXLA 4DI9A 2O4QA 5HMDA 4C6LA 1R9YA 4C6PA 4H9YA 4I6VA 1M65A 2I5GA 3GU2A 2FVMA 2EG7A 1FWIC 3WZ0E 3AU6A 1K6WA 1NDVA 1FWJC 4C5YA 1ITUA 4C6CA 1EJSC 4EPBC 4GY7A 4WVXA 3E38A 4KF1A 3TNBA 1POJA 2WJFA 4IGNA 2Z28A 3T1GA 1A5NC 1A5OC 2Z25A 2ADAA 1M7JA 4D8LA 1PTAA 1RJQA 3SO7A 3PAOA 1KRMA 3E74A 3DC8A 2Q01A 2W9MA 3K2GA 4RE0A 2FVKA 4XAGA 1EJWC 3LGDA 1FWFC 3MDWA 2QT3A 4IFKB 1RA5A 1R9ZA 1J6PA 1BF6A 1GKRA 1J79A 2ANUA 4RZBA 2R1MA 1ITQA 4XAZA 3MSRA 2R1PA 4R7WA 1PO9A 4F0RA 3UR5A 4IQJA 3F2BA 4Z42C 4L9XA 4PE8A 3IV8A 3V7PA 4QSFA 4R85A 1V77A 3LGGA 3E2VA 5E5CA 3ISIX 2HNHA 4I6KA 4GC3A 5LXXA 4ZSUA 1A4LA 4LANA 3GIQA 4DZHA 3F4DA 4PBEA 1HZYA 4ICMA 4PBFA 1EJRC 4DIAA 3URNA 1RA0A 3IARA 3WYZA 3HTWA 4GOAA 1J6OA 4F0LA 3NEHA 4XD3A 3R0DA 4KETA 1ADDA 3E0LA 3CJPA 3QY8A 4WHBA 3S4TA 4CNSA 4H9MA 1A5KC 4BY3A 3OJGA 1KCXA 1R9XA 3FDGA 5AKQA 3LU2A 3MVTA 4BKNA 4GXWA 4P5UA 3FEQA 3F4CA 4GK8A 4G7EA 4B90A 4C5ZA 4RDVA 2WJEA 3QGAC 1UIOA 4C65A 3QY7A 4C6FA 1GKPA 4IG2A 4H9ZA 3GTHA 1V79A 2YXOA 2RAGA 4R88A 1A5MC 3D6NA 3MDUA 3ICJA 1YIXA 1V7AA 2HBXA 2Z26A 4C6DA 3PNUA 2VC7A 4JOMA 3F2CA 3GTXA 3S2JA 1EJXC 3QGKC 4C6KA 4LAOA 4C6MA 1V4YA 4QS6A 3LA4A 2D2HA 1PB0A 4J5NA 1I0BA 3OQEA 1RK6A 3LS9A 5A6TC 4BJHA 1YNYA 2DVXA 2Q09A 1IE7C 3PBMA 4UB9A 3ID7A 4UBPC 3IPWA 4TQTA 4NP7A 4C6JA 2E1WA 4LFYA 4F0SA 1EZ2A 1UIPA 2QVNA 1XWYA 1O12A 4LCSA 3IJ6A 2Z2BA 4B3ZA 4CQDA 1EJVC 4GZ7A 2OODA 3URAA 4CNTA 2Z00A 4LALA 2P50A 1K70A 3TN3A 4DZIA 1YBQB 4XAYA 4L6DA 3HM7A 4KEZA 1A5LC 3NURA 1PSCA 2ZC1A 4LCQA 1ZZMA 4LAKA 4XD4A 2Z4GA 4B91A 2IMRA 1P1MA 4G7EB 1FWHC 4H9XA 3TN5A 4C6NA 3F2DA 1XRFA 3A3WA 2FFIA 3GU1A 4IG2B 4QROA 1EJUC 3TN4A 4CQBA 4KERA 2PUZA 3N2CA 3JZEA 4H01A 2FTYA 4IF2A 1XRTA 3IACA 4DLMA 1RAKA 2HQAA 2O4MA 2YB1A 3B40A 1M68A 4CNUA 2GWGA 1NDYA 3LNPA 4V1XA 3EGJA 3TN6A 1EF2A 3T8LA 3AU2A 1S3TC 4H9VA 4ERAA 3GG7A 4GYFA
chains in the Genus database with same CATH superfamily
3OZPA 2BY2A 2ICSA 3PBVA 3RDKA 2V67A 2J74A 3QW4B 2NUXA 3CHCA 3V5OA 3DCPA 2VR2A 2Z7KA 1H7PA 4UTFA 3E5BA 1FH8A 4KCTA 1W1YA 3W7CA 2NX3A 2C3ZA 1SYTA 3HN3A 1CXIA 2JF6A 4A05A 3NQ7A 2EG8A 5C70A 3PTMA 4LEQA 3HJEA 5FESA 1Q8AA 1TPC1 4JIRA 1FA2A 1W32A 2V3GA 3ZLFA 2RDXA 4C7FA 3DKLA 1ZRQA 3GG0A 3AYVA 3V16A 2E8ZA 4MWAC 3F7JA 3KS5A 4PRWA 4S3DA 3WJWA 4DM2A 4YN5A 4ADTA 4JNMA 1UZ4A 2AAAA 1ZBCA 4ZVJA 5CG7A 1O66A 4AZ7A 1B30A 1V03A 4QJ1A 4TV5A 4KEUA 4YU1A 1W2PA 1FDZA 3GXDA 1VH7A 3QQ1A 4GCAA 1C8XA 3WIJA 2CETA 2QKFA 5DXYA 1PCKA 4N9BA 1KO0A 3CXOA 1OADA 3GH4A 2GUUA 2ISDA 5A3HA 5BXPA 1RV8A 2Z1XA 1SZRA 3W6YA 3IJ8A 2I5IA 1QHZA 1XISA 3DGBA 3WF4A 3K4WA 8TIMA 4Z1CA 1UOZA 5H91A 1EWEA 2UZ9A 2DZBA 3N3MA 4CD7A 8CGTA 1WXZA 4A2SA 1LG1A 3N73A 3OW1A 4MUPA 3L68A 3TJ4A 4CD5A 2CBJA 3MMUA 3B4YA 5FF4A 2DZUA 3GH5A 1P43A 2MNRA 3W7EA 2RJHA 1GT8A 1D2KA 4X22A 4GE8A 5BU6A 2VUYA 1FCBA 5ABGA 1AK5A 1A53A 2CYGA 5ECUA 3ZT6A 3HMCA 1TV3A 2JEPA 3N4AA 4GYKA 5HA7A 4AZ6A 1KQZA 3BE7A 3RRAA 7TAAA 4RPQA 1K02A 1FH7A 4AG0A 4D6CA 3BV4A 4J3XA 3KLLA 3KX6A 1JRBA 3RGTA 2A3CA 4JFVA 2BOFX 3DHPA 4F0MA 3N14A 3O2LA 1I9CB 1ZBVA 3G1FA 4GY1A 4L80A 1WCGA 4Q8OA 1ODUA 3S83A 4CCEA 1PE1A 3L4ZA 2CESA 3RX2A 3HGOA 1EL3A 4JHZA 5CQ1A 4QITA 1UD8A 4QE4A 1I6NA 1C92A 5DMNA 1K7XA 4BWLC 1FRBA 2ZX9A 3O6CA 1C7SA 1IXOA 4HU8A 3E2RA 1KCLA 4U10A 1HN1A 3WDQA 1VFSA 5EMJA 4W8BA 4XISA 3LYEA 4D1JA 3LN3A 2VRKA 3RAOA 5I02A 2PGWA 4JDBA 5CGQA 1EP1A 1WA3A 4L4LA 3RPDA 4TX8A 2R9RA 3H53A 4JQAA 1CECA 1E5NA 3ZSTA 3V18A 1EHAA 2PE4A 3NQCA 4IQEA 3C56A 1MYRA 3N6QA 4OV9A 4IXHA 1GQKA 1V6YA 3RO6A 2JKEA 2BMBA 2QUNA 4H2CA 3AFBA 2R1PA 3SB0A 4B4HA 4AMCA 4KWWA 3AIBA 2DZPA 1E0UA 3LB0A 1IZCA 4ZB0A 3GIYA 4PE8A 4C1LA 3IV8A 3KE0A 2D3LA 5JU6A 4GQGA 4P7LA 5CPSA 5FEZA 3SN4A 3BAJA 1EGZA 3P61A 1KFJA 1T8XA 1OYCA 3LX9A 5XIAA 4H6EA 1TKKA 2ISFA 4DO5A 3R25A 2NUYA 4AZHA 4FLRA 2WAGA 4NZFA 4PBGA 4FAMA 3N25A 1IT0A 4KETA 3FYOA 3VUSA 1K7FA 3MV01 1O95A 4CNSA 2IPJA 3O6DA 3JW7A 4AB4A 1XYMA 4B90A 4B5NA 4QE5A 3MBDA 3I3DA 2NQJA 1I8JA 2CERA 4HU4A 3M16A 1MEHA 1GVQA 1A5MC 3JRKA 3QKEA 2WBKA 3CZGA 3PBGA 3WNNA 5A94A 4QS6A 6A3HA 4GJJA 4UFIA 1U33A 4BEUA 4JTJA 3KOYA 4M29A 3VM7A 3TUUA 1G69A 3W28A 3LRKA 1BHGA 1NWUA 5DO8A 3UY8A 4TQTA 5D9NA 2OQYA 2V2HA 3QH2A 4EIVA 4I5RA 1O12A 3NXLA 4DQWA 2HXTA 2JGYA 2QCCA 1G0CA 2NW0A 1KXQA 1K70A 3NQGA 3MSGA 5DCEA 5GJMA 3G22A 3W86A 4QEEA 3WELA 3W23A 4E3VA 3KHJA 4F9DA 3MUZ1 4HPGA 3H22A 3F2DA 2ALRA 5I3KA 4ZB5A 1CXHA 1OM0A 1RHCA 1W3IA 3CQJA 3FX4A 3NQ2A 3FHQA 4UMCA 1EF2A 4F66A 4PMJA 2W62A 3ALFA 1RCQA 1E9IA 1KWKA 2Z1SA 4CNOA 5AHLA 3E5PA 3ZVHA 1LQAA 2HVNA 1C9DA 3AC0A 1UH3A 3NAVA 3ITXA 4ZSTA 5AYZA 3H2EA 3ATZA 5D37A 3D5HA 3VIMA 3BC9A 4GPNA 3PVFA 1OFEA 3BAIA 4GCXA 2I1OA 1GOOA 3H2OA 2OSWA 1V08A 1XBYA 1LWIA 1TX0A 1X8FA 1US3A 4GH1A 1TJRA 4TMBA 3MJYA 3NO5A 3CB8A 3GDKA 2A7RA 1BG4A 2GLKA 4XUGA 1HG3A 2R1NA 5GNZA 1ZHAA 3QXBA 4GC4A 2DIEA 3BMXA 4JX5A 5CEWA 5I24A 3UZJA 2FKPA 1BVZA 4NNCA 1EIBA 1R38A 1XDJA 3T07A 3C2EA 4UTIA 4Z2JA 2G95A 2OQLA 3A6OA 4AD4A 1BF2A 1JEZA 3IGHX 4GBDA 1JFXA 1TWIA 1B4KA 2A3HA 3WK2A 2YL8A 3RLGA 3OLGA 1EYWA 5D2XA 4GABA 1TV8A 4YVPA 4XIAA 4MLRA 5EKYA 2KX9A 1RZMA 4NI8A 1PJ9A 1OGGA 3SQSA 4WSHA 4G8TA 1U2YA 1FKWA 1I2QA 4QRNA 1HP4A 2WHLA 5FJTA 2PURA 1ZCCA 1JJKA 3M0HA 4ZQNA 4YVXA 2ESCA 1WBHA 5BU9A 4E4PA 1E9LA 3FAXA 5T9BG 1ZGDA 2XIBA 4TVUA 1FHUA 3PS7A 5LYRA 1E40A 3UXKA 2YCEA 3WD1A 2OLHA 3MTWA 1P7TA 1S5VA 3SUWA 2ZTKA 6ENLA 4RW5A 5B7YA 3FVMA 3TCEA 4XQ6A 4IIBA 4JQ4A 3STGA 1WE5A 3GXPA 1IEQA 3B0UX 4RE4A 2FZMA 1H7RA 3S5OA 5C9WA 4HNOA 4DXKA 3NA8A 1GG1A 2ZRXA 3E0VA 3EWZA 1KTBA 3HJZA 3NQMA 1YW1A 4GQQA 3W02A 2O9RA 4HNVA 4I9MA 1CX9A 1IEXA 1V7YA 1HKWA 2H6RA 4EP8C 1QW7A 1WDRA 3VZYA 3ZOAA 2GYIA 3VGDA 4OUIA 1H5VA 2P88A 1ZFJA 2FZBA 3SR7A 3V0SA 3ZVHB 3IWPA 4AF0A 2WW5A 4QG9A 1T6MA 4MIMA 4UNKA 1R9YA 5EMYA 2B7NA 3KWSA 1QJWA 3T05A 2E6YA 5DY2A 3C8FA 2VDGA 4LYQA 4NZ4A 1W1TA 4RXGA 3Q67A 2ZUUA 3NGJA 4XIMA 2X41A 3OEXA 1K9EA 3L4TA 2FZNA 2GQ9A 3PUEA 1YADA 2C91A 4A35A 1TV5A 2Z25A 4PULA 5I3IA 1QHOA 4W5UA 3DKJA 1ISVA 4ENLA 2QIWA 1SU5A 2GJRA 1XINA 4AYSA 3KRUA 5DQPA 3T08A 4OECA 1W9VA 2OT0A 4R7WA 1PO9A 5BWAA 2WO5A 3MYPA 1G5AA 4PCTA 3TA9A 1FXPA 3S1WA 1Z6KA 3ITLA 2BVYA 2VFGA 4ZO8A 2HNHA 2EBNA 2W92A 1L8PA 1ISXA 4ZSUA 1PKLA 2VCAA 2Y2WA 4R3UA 4M5PA 2XVKA 3UP8A 3I10A 2P76A 4GYPA 2A79A 1UB3A 4B5VA 1U1JA 4F3HA 3VOCA 3WJSA 1OFOA 2QV4A 3TLLA 3DEQA 4C90A 3CJPA 2G8ZA 4CD6A 2ZCGA 2OMAA 4DBSA 1KFKA 1S1PA 3G3DA 4H9MA 3LV5A 3TTEA 3RNDA 8RUCA 4GXWA 3SQMA 4DAFA 2J7GA 1DE6A 3CWHA 4LRSA 2NX9A 2WJEA 3L21A 1BYDA 1MDRA 4C65A 3LERA 2XVLA 3P80A 1CIUA 2YXOA 4NSBA 2WNQA 4AXNA 2C0HA 3VFLA 5CSUA 2EJ1A 2NQZA 1W91A 1K8YA 2GGGA 3W85A 1UUQA 3TC7A 3UZWA 2GSHA 1E6SM 1C8VA 3HG4A 4F2UA 3BGAA 1I0BA 1N8WA 4JX6A 5A6TC 1KGWA 2OXNA 3K13A 1AQFA 4JGDA 1HX0A 3WNKA 2QF7A 4LF1A 4MWAE 4NP7A 4YTTA 1EZ2A 1JF6A 2CKRA 4FP1A 3SCQA 3THUA 3VKBA 4O1DA 4FNUA 3R13A 3B9AA 3K4DA 4FI4A 2E40A 4GZ7A 2OKOA 3SUVA 4LRTA 3FJ6A 3VA8A 1AA1B 2PPGA 3UWZA 2PSNA 3MMDA 2C19A 1DXIA 1XUUA 4ZXLA 2D73A 1UR4A 3V35A 1B3OA 4H19A 1I60A 1H50A 1XRFA 1KCKA 1AFSA 5IFPA 5E93A 3UPWA 1LQ0A 4IF2A 2BOGX 2YL9A 3KAOA 4YYCA 4MWAD 1BPLB 2PDYA 5HR6A 3SECA 1AODA 5GNYA 4OQVA 2QNEA 1ZLPA 3THDA 1WNOA 3SEPA 2XDFA 2PDJA 3V4BA 4AEOA 3OA3A 1UWRA 3USZA 4W4QA 2AOSA 4GZEA 4UCFA 4R27A 3RCNA 3O9NA 4OE7A 5CPNA 2KZHA 3CAKA 3UYIA 3M0LA 3LPPA 5G2HA 5BMWA 1JXJA 3FOKA 2BGNE 4ILSA 1XLIA 4BF5A 4L9ZA 1WOBA 2PDIA 3W00A 3EZ4A 1E4MM 1VCFA 2V3DA 5EA9A 3DYMA 3C6CA 5A8QA 2X42A 3VU2A 1F3EA 3P5YA 3W9ZA 2PS2A 4FLQA 3PJUA 3WLHA 3W7GA 1XFCA 3IJLA 2YBUA 5F2MA 2PC8A 3OGSA 1SZNA 1NWRA 3M0YA 4H8NA 5FJPA 3CQKA 1K1DA 5FJIA 3VMNA 1KKOA 3S9YA 5FAGA 3LY0A 1SR9A 1DXFA 1L6WA 1K8CA 2WCGA 3LGEA 3G6MA 3MUCA 4CD4A 3MI3A 2VD8A 4H04A 4AHPA 3OA5A 2HTMA 2ISWA 1SMDA 2YFOA 5E6YA 1VS1A 2YSWA 1WO2A 2DZSA 3ONBA 2OEKA 2GK1A 5K7JA 3FK4A 1G6CA 3NXFA 1H41A 4AD2A 2J8TA 4A6GA 5LHFA 1DJXA 3AHTA 6PTDA 3KTSA 3B4UA 4NG3A 4MLJA 2A7NA 4LC8A 2A7PA 3HF3A 4MPQA 1WAUA 1QNPA 2JBMA 3LTYA 2Y63A 1PPIA 1XXXA 3EB3A 2PCQA 1F4HA 2PD9A 1RK5A 4HSNA 2HBVA 3MA8A 1PZ0A 3HFTA 5H2ZA 5CJ5A 1KM4A 2XGIA 5AHIA 2CLHA 5G1MA 3QZ6A 3W7PA 3N4EA 3WLOA 1S38A 1K4GA 4Y9AA 2QLYA 2QPXA 3QMRA 3RN6A 3SCTA 3LPFA 4IFRA 2B31A 2Y8KA 2VEGA 3K8MA 2Z24A 3GX9A 1K3UA 5REQA 3DDMA 4H6KA 1Q85A 3NVTA 3VI2A 2X2YA 3NL5A 2J8GA 4B5TA 1KM0A 1I45A 5BOOA 5CSYA 4XKYA 3ZWTA 1YPFA 5BW6A 3UCCA 5HXMA 4HA0A 3DG7A 1UKOA 1XCWA 2VEIA 3UCQA 2VZSA 2DUZA 3VM5A 3KCOA 1DJGA 2V3EA 4I9TA 5C9RA 3GC5A 3CHVA 3PZVA 1X1ZA 2NQLA 4QCEA 1DV7A 2VNCA 3KLKA 2A1YA 2ISSA 3BLKA 3ABZA 3P8IA 1LBMA 2EXOA 3CWNA 1YLVA 4ZQCA 4F0HA 1KRCC 3BW3A 4WGXA 4O53A 4RDYA 3GZ3A 4GIEA 1F5ZA 1NIUA 4Z2LA 3PZOA 4EF8A 3OLEA 1WZAA 1XH0A 1WDQA 1NVMA 2QDGA 4ZR8A 4K37A 1FWIC 1EOKA 2V3FA 1EJSC 4GY7A 5F4XA 3R8HA 3W84A 1UWIA 3FW6A 4CLMA 4GI6A 4IGNA 4QX4A 4N6FA 1MXSA 4D8LA 1KRMA 2W79A 4L4PA 1Q6LA 3RR4A 4HNCA 1GOXA 3NDYA 5M3WA 2X40A 3GNRA 1SMAA 3QLLA 1JZ8A 4RE0A 4QNEA 4H1ZA 1JNDA 3WQCA 1B3XA 3L4XA 4B16A 1RA5A 1E72M 4BQ2A 1PDYA 1P0KA 3LCXA 2WV8A 3KVJA 4YHEA 4D8ZA 4WF7A 2VI0A 4JN8A 3CWOX 4NIRA 4QHRA 4WDUA 3TH6A 4WY0A 4UFLA 3R1ZA 5DT5A 3DC0A 1RBOB 3OVQA 5LXXA 3GNNA 1DORA 4M80A 3DU0A 2PDNA 4ZEPA 2PB1A 2GK1B 2YCLA 2DSVA 2I16A 3C61A 1XICA 5E9XA 2QAPA 3WNLA 1CDGA 4W9TA 4F0LA 4LAZA 4IP4A 3I65A 1ZQ5A 3BWWA 3WQPA 3E0LA 1G4EA 2GPTA 4DZAA 4WHBA 4PEKA 1XLMA 5BRQA 2W66A 1AW2A 2RFGA 2QDEA 3QTGA 3M44A 1ALDA 3E9AA 5I0DA 1DWHM 5LA0A 5D2WA 3W81A 3UCDA 4BR1A 1F3WA 5C0QA 1MEIA 5EYWA 1GKPA 1DTNA 3FA4A 1UPPA 1AG1O 2XJ7A 3KBNA 4DBUA 4HYRA 1JZ4A 1GPWA 1R3WA 5FEXA 3S5SA 1GJWA 2QJGA 5REQB 2UY3A 3LS9A 3GKAA 2Q09A 2BODX 2Z1BA 5IFTA 3W1MA 3H4WA 4US6A 4JNYA 5T9CE 3LTPA 1XJBA 1I1WA 4HIBA 4XKYB 2REQA 4CQDA 4F0KA 3NOEA 2QW5A 4XAPA 2ODOA 3PZMA 1XUZA 1A5LC 1PL9A 4NU7A 4G7EB 2XPKA 3TEVA 4C6NA 3GR7A 3W7OA 3A3WA 1LWJA 1TCDA 4GG9A 2W4XA 2YB1A 1IEIA 4PMOA 2WZHA 1BEUA 4Z2HA 1YNQA 1REQA 3LHYA 3AYTA 3T0TA 4FNRA 5BROA 4PEEA 2O92A 3B06A 4Q4PA 3W1RA 2J9ZA 4IMEA 3IIOA 3N2OA 2GSJA 3OODA 1AH4A 4DRSA 3C0LA 1GPFA 2E25A 1ECEA 2EGZA 1ME7A 3VD9A 3PUOA 1KCZA 4IX2A 2ZZ7A 3IRDA 1AZ2A 3URBA 2X1IA 1C7TA 1MNZA 3PHAA 1KFCA 1M04A 3CEPA 3PTKA 5D32A 2AMGA 2PWVA 4WKHA 3EKGA 1NEYA 4JYFA 3Q58A 3N19B 4Z0SA 1F74A 1W17A 2YCLB 2H8ZA 1RD5A 1MVYA 2XFFA 1CCWB 3CV6A 3EMZA 1XIBA 1ZS2A 3W24A 2GQ3A 4XUYA 3BQ5A 1GG0A 1TJ1A 3HG2A 1XL9A 1EC8A 5I79A 4JQ2A 3SADA 3DX5A 4AC1X 2WHKA 1WPCA 1A5SA 1V3MA 4GRSA 3UETA 3S5NA 2D23A 1FHDA 3MJMA 2GJXA 2DVUA 1J4EA 2PRMA 4DI8A 3UU0A 1O5KA 2VJXA 3L0GA 1Q13A 3H55A 3B8UA 4TV6A 4AVNA 1RQBA 4DXXA 3UBPC 5I09A 2Q3RA 2WJZA 3N34A 4XAFA 3WO8A 2CZDA 4PUMA 6TAAA 4FALA 4LT9A 1U83A 3IGXA 3BLDA 1G67A 4I8DA 2IPFA 1HKMA 1A0DA 1VBRA 3VCCA 3RX4A 1GJUA 4PC8A 2ZRZA 3FCPA 1XBZA 3H2NA 2ZZ6A 5HPCA 3NQAA 1O7AA 3BOFA 3U3HA 2REQB 1LTDA 1YKWA 3CUXA 3IJ7A 1P48A 1U1UA 3W74A 5DFAA 1EJ7L 3QV7A 1JQVA 2Y88A 3BLLA 5EMKA 1W5QA 3BGJA 4UMBA 2RGLA 1TPVA 4HK7A 3F4WA 4KFNA 4HU3A 4E5TA 2XWEA 3ZXWA 4AEFA 2D2GA 4RX0A 3KZSA 5H1WA 1EJTC 5CZ0A 3CQHA 3UPMA 4FSAA 5A95A 1LYXA 2NX1A 3S1XA 4IT1A 2PRHA 1RD6A 3CUZA 3M0IA 4ADUA 2XIJA 2ZX7A 4M51A 2NT1A 2GSEA 3PANA 4DYEA 4J3ZA 5HR7A 4Q7IA 2TSYA 2I9EA 3F4VA 4CQAA 5LA1A 1C91A 3N6JA 3VO0A 4QQUA 3UJSA 4DI9A 1AQ0A 2CEQA 1F07A 1GVSA 2DJLA 5FD0A 1EGMA 4PZVA 1NAL1 4YVVA 4DZ5A 3BLIA 2VEFA 3DYPA 1KC7A 3P6LA 1US0A 4TVDA 3SCVA 1P1XA 1QOPA 3E38A 2D1ZA 4M82A 2VL4A 3HA1A 3K8LA 1ZALA 1Q3NA 2EPKX 2WJFA 3WQOA 1GCYA 1RPXA 3WLRA 1G9HA 1UYQA 3W6MA 1GOMA 1NOWA 1RJQA 3KL0A 4UOZA 2W9MA 3CB3A 4G9PA 3L2LA 1EJWC 4JTQA 3D47A 2TMDA 3GBEA 1R9ZA 1J6PA 1JF5A 2R94A 4PTVA 1OCQA 1B4EA 1OVDA 2X1TA 1JZ5A 2C1GA 4AMAA 1L6FA 4YWIA 3CL6A 1LLOA 4BFAA 3CZLA 2DGAA 1G7UA 2J9XA 5I2UA 2RUSA 4KS0A 3OO2A 1HZYA 3I7QA 3COTA 1TUFA 2Y7GA 1V6UA 4ML9A 2BP1A 1RA0A 2WMFA 1MXDA 4MTVA 2E1DA 3CM4A 4ZOBA 1LRNA 3STCA 2GJXB 4YPJA 1KGXA 3I3BA 4K3ZA 3WLNA 1QCWA 4E8GA 1HVXA 4X0VA 1NARA 1IWAA 4GGBA 4TXEA 2QIIA 4BWLA 4C7DA 3MC5A 3VUPA 4DWSC 2QCHA 3OGVA 3LU2A 1UQZA 3FEQA 1RSCA 4HP5A 4L1XA 3MMTA 1JG9A 1XKJA 3HG3A 1JYXA 4S39A 3GTHA 4NZ3A 1DHKA 3LK6A 1G01A 2XN0A 3D6NA 1UC4A 3RM9A 5KSWA 3OHMB 2YJQA 4N02A 4F9JA 4O12A 5AZ1A 1QUMA 4IWWA 1J01A 3S2JA 3WQVA 4LNYA 4C6KA 3U8GA 4J5NA 1EBHA 1M9HA 4F40A 2VVNA 4IMGA 4X9YA 3UA4A 3V1HA 4FHAA 3PF3A 3WQFA 1UD2A 3MO4A 3GHTA 3Q94A 4PRTA 4LCSA 4B5UA 3W1QA 5A6MA 3DFQA 2VRQA 3O05A 2XIQA 3FFSA 2ZXQA 3ES7A 3LCLA 4MYXA 2A6NA 3PFMA 4IP5A 4XAYA 4X61A 1GORA 3CPRA 3T0BA 3KVKA 4LYRA 2V30A 3GM8A 1V3HA 4XD4A 5JIPA 2VFHA 2XINA 5F4WA 3VXGA 2GJLA 4BI5A 3TN4A 2OEJA 4HHHA 1XRTA 2BY0A 4ZODA 5DRIA 1UZHA 1J5TA 4Q4OA 3WLMA 2ONEA 3TN6A 5DBTA 1R0MA 1TR1A 1TZ7A 1XR2A 5E6ZA 5BYWA 4YCOA 1W3NA 1E1FA 2D24A 3UZXA 3BARA 2O9OA 5HULA 4H9VA 2Y8VA 3VGBA 3ARSA 3OU8A 4PSPA 4AC7C 1GZJA 2AMXA 2PTYA 3MCMA 5F2LA 1R3QA 4IMDA 1LL4A 2R82A 1UD5A 1UR9A 2GDVA 3O0FA 5IBXC 2IUZA 5FSDC 1VKFA 4R53A 1MQQA 2WZMA 1YPXA 1KBJA 1RY0A 4P8XA 3SRHA 4ERGA 1EDGA 4OFCA 1TPH1 1HL8A 1M7PA 4GO8A 4YWSA 3ANYA 3B8IA 4WKAA 1D3CA 1E4IA 1OC6A 2A6LA 1R86A 3QYQA 3EPNA 1O5RA 4OBSA 3AXMA 3KP1A 2OCZA 9XIMA 1EC7A 4OVXA 3P0XA 4DELA 3TW6A 2V6AA 3NZQA 2CZEA 2GGHA 1V3KA 1EH9A 3JS3A 3K46A 3SJ3A 1V02A 5AOUA 2Q8ZA 2PDBA 4Q8VA 3QBUA 3FIGA 3O3RA 1KKRA 1T7LA 3OVGA 3S2CA 4MMWA 1G4SA 3FHAA 4DX3A 4P8VA 8XIMA 5HNNA 3BUVA 1NM9A 3KUMA 4UFJA 3CUGA 4GVGA 3CV2A 2G3FA 4NF7A 3W2LA 1RCXB 3V5FA 2W67A 3A4JA 3KRZA 4K1WA 2QUVA 2VHLA 5KINA 1W9BM 4WCJA 3KFTA 1AL7A 3H26A 3C86A 3KOFA 4KT2A 3N6HA 3S5YA 1Z48A 3M47A 2C13A 2OOFA 1Q65A 3UJEA 3GDBA 4X3ZA 2A3LA 5KMYA 1GVEA 1JCYA 2XIIA 2YCKX 4W84A 3PY2A 1AL8A 1TMHA 4V1YA 4ZQPA 2BX7A 4S3EA 1TZZA 1ODZA 5IDZA 2X7WA 1QFEA 4FZIA 2WMGA 3C2RA 2HS6A 1FQ0A 3USBA 3VKCA 2QGHA 1FWEC 4S2BA 3P8JA 3URQA 3CEUA 2QULA 4UNLA 5D02A 2Z7GA 1OZQA 3A5FA 3C52A 2TYSA 2GDQA 3AZRA 2VRJA 4HNLA 4OOZA 3WENA 1H1ZA 3LPOA 2ZXBA 3IAPA 1XPGA 1GEHA 2PDUA 4W85A 1VGAA 3MZNA 3VIHA 4I9JA 3BV7A 3WMCA 3PB2A 2BV9A 4HNTA 1W6TA 3UVIA 4WDWA 4B15A 3WMSA 1F2JA 5H8PA 3GY1A 3LM7A 4BQ4A 5C9UA 3UXIA 4N0RA 2FVMA 2YBTA 1CXKA 3H2AA 3BZGA 2YL6A 1I1XA 1A49A 4JS3A 5CJNA 1RQEA 3TXZA 3IJ9A 3R0KA 4WIWA 2CBUA 2BXVA 3S5ZA 2AAMA 4UXDA 1ONRA 4UR7A 1PTAA 1O68A 4FXFA 4JTHA 1QI2A 1XIHA 3DC8A 1SW3A 2G50A 2QUMA 1HNYA 4LF2A 1YDYA 1ZENA 5A1AA 4ATDA 2WPBA 4UTWA 1V5XA 5CZKA 4RNFA 4HSHA 2WC4A 1QRQA 3CO4A 5HMSA 4JN7A 3W7NA 3PBYA 5A6SA 1ZAJA 2WVSA 2DSKA 3PN8A 1LRQA 1JAEA 1O4UA 1Z69A 2YLAA 1IIHA 1KA9F 1QASA 3W1LA 4BQ5A 1VIWA 5C55A 2E68A 1SJBA 2O55A 2WNZA 2YIHA 1I4NA 2Y5EA 4GHRA 2Z0IA 5E0CA 2VKZG 4F2TA 2XVPA 4XG1A 1EWDA 2Y5SA 1MSSA 3BLPX 2F8QA 2A3EA 3CIXA 2PRLA 3BH4A 4A8NA 1GONA 3N4FA 4L1GA 4PMYA 2LLEA 4HSOA 3TMQA 1SSGA 3FEMA 4JNZA 3LCIA 4M8UA 4M6PA 3S4TA 4ZL1A 3OJGA 1XX1A 1OINA 4IM4A 5A6BD 9XIAA 3P84A 4F8XA 3WLKX 2ZXDA 1LORA 4HPHA 3HPXA 3PULA 3QY7A 2E7FA 4DHGA 3KOXA 1UH2A 3H24A 3MDUA 1YIXA 5T8GA 1E55A 4MAZA 1BGGA 2EPMX 4RPPA 2R6OA 2X16A 2FH8A 1GQNA 3VOIA 3VCNA 4HCHA 5HJYA 5LGZA 1BSLA 1R2SA 4WSKA 2DVXA 3UWEA 4DPPA 1BWLA 4S2CA 3U4AA 4YTSA 1LOSA 3AIWA 1R3TA 1B1YA 4AYGA 5JH2A 1XWYA 4MDPA 4FXJA 5ABTA 2PA6A 1EGVA 1W9PA 3R2GA 3TWBA 3CV7A 2BBFA 3HM7A 3UT0A 2BLEA 3RM8A 1PSCA 3W2NA 5HANA 3AUJA 3EWUA 4HU0A 1M5WA 3F03K 1Z42A 1W1A1 3TYUA 3W7RA 1EJUC 3HGSA 1G4TA 1MZRA 4KERA 1C8YA 2UV8G 1E6XM 2GWGA 1PZ1A 3BXWA 4S3CA 1TELA 1AZ1A 3AU2A 2AKZA 3OLDA 1KXTA 4UQ9A 3WQ8A 3A23A 3GG1A 5I3FA 4KEMA 2HVMA 4LUSB 3O1NA 4JCMA 1EPXA 3EWCA 5A8PA 5GJNA 5DT7A 1R8LA 4TX9A 3VKAA 1XM3A 2OGJA 3W7IA 1HO4A 1KM5A 3NFUA 4JCLA 4V15A 4AY7A 3TW9A 1TX2A 4Y9PA 1KV8A 3V5CA 2FPTA 1FBAA 2OELA 3CHFA 1EIXA 3PZIA 5I78A 4OTKA 3P14A 3AZSA 1RP9A 2C1IA 1VEOA 3QZEA 3EAUA 3TTQA 2CKSA 1NDZA 1EHNA 1YE4A 3B8VA 1ME9A 4YIWA 1WKEA 2V5LA 3L5LA 4PCSA 1ADSA 1X6LA 4KPLA 4AX6A 2C71A 3C0JA 2ACQA 4IFOA 3ITCA 2OWCA 4LCRA 1CGTA 4HA1A 5A2CA 1XH2A 3WMLA 1TWDA 1XSIA 2PODA 4DJFC 3IGUA 3WF3A 2DFAA 3L67A 6TIMA 1UWAA 2G37A 3KW3A 5AHMA 2F7FA 2OTDA 8A3HA 1OGBA 1E43A 4LUTA 4KFOA 4IJCA 3SFKA 3IIPA 4JEQA 3CBWA 4YHGA 3BQ6A 1MW0A 1Q4WA 4V2XA 2OZ8A 2P1FA 3OTRA 2E9LA 1EA9C 4JYEA 2J7HA 3RX3A 1XGDA 3PJWA 1MEWA 4AVFA 1CBGA 2J66A 1EEXA 4CGTA 4UMAA 5LNRA 1F3TA 4YTQA 4JEJA 4AWTA 1VQTA 4PTXA 5EBUA 1BRLA 6REQA 3FY1A 3WEZA 3R5EA 4HTBA 1TJ0A 3ZJ8A 4I7WA 3PR2A 4MGGA 1W9DM 1TIMA 1CLXA 2BZNA 3QMTA 1VLIA 1W9UA 3E02A 2DEPA 1NWTA 1SFTA 3W37A 3WNOA 1KBBA 5I7GA 2PWFA 2VQUA 4UUIA 4DLFA 4A3UA 3VMOA 1VRDA 1LROA 2PFHA 4N7QA 3HQOA 4GQ0A 3RO8A 4HNNA 3E0FA 2ZX8A 4RV3A 3EDKA 4J3VA 1GKQA 3O8AA 1HT6A 2ZZ1A 5J5DA 1YBQA 3KM8A 3RFAA 1A3XA 5DMMA 4D6GA 1X6NA 3EWBX 4Q8UA 2XFRA 1UA3A 1ZP3A 4S3FA 1S2TA 3PPFA 4DO4A 4US5D 4PUJA 4KQNA 3U2ZA 1X1NA 4LB4A 3CS2A 4FNQA 4J9JA 3TYCA 4MOZA 2G4JA 5I5RA 3W27A 1DYSA 4QR6A 2QJHA 1K6WA 3UR8A 1RP8A 1J0ZA 2V5KA 3TROA 2CLIA 2ZUSA 4KF1A 1EEPA 3W22A 3BAWA 2A21A 3S42A 3SRDA 1UUMA 2OZ0A 4WOZA 3Q4DA 4DWSD 3AICA 1GGOA 1US2A 5HAOA 5H8UA 3NO3A 1XG3A 3VPLA 4BI6A 3M0XA 3ATYA 1KW1A 1THFD 3UGRA 3RMEA 1YDOA 4JD4A 2NSXA 4PUNA 4DF1A 2H9AA 1WKFA 3GVQA 2OG9A 1GKRA 3HZ3A 2E5BA 4IPIA 4RNHA 3ITTA 2BNJA 3OBAA 2IKJA 3GAKA 3TTYA 3QLDA 3ENLA 1UR3M 4R85A 3AHYA 4GJIA 1BYCA 2JEQA 1WUEA 3UQNA 4FLSA 1FDYA 3ZJ6A 1I2NA 3BCJA 1S46A 4ICMA 3SCPA 3URNA 3L4YA 4GACA 1E0XA 1U30A 1UD4A 2AGTA 4LUTB 4QJ4B 1AW5A 1C9WA 4B3KA 1ZBKA 4OZOA 1F6YA 2VX4A 4ZQRA 4K2SA 4H8VA 2F38A 4BY3A 3BGGA 1W56A 3FDGA 1TTPA 1D3GA 2VFEA 1R47A 1R7AA 4A8IA 4D6DA 4IIFA 5CKSA 1OG0A 3S1UA 3PC0A 4S3BA 2ZBTA 3DHFA 3EPMA 4W86A 1Y5XA 2DU2A 1QT1A 1QI4A 1TR9A 2OEMA 3DESA 3U9IA 5ABFA 3C5QA 1BRLB 2HBXA 6REQB 2CLFA 4KCVA 4AFYA 4HB7A 2O56A 3I4EA 3TWAA 4A8RA 4LAOA 4QG8A 2RGMA 1IZJA 2HWGA 3O0KA 3EX3A 3TTSA 1W1ZA 4IL0A 3VK5A 1O5QA 1SZEA 3GVWA 4UBPC 3B9DA 3IUHA 2G3IA 2QVNA 3M5XA 1V6XA 5BXTA 1T0OA 1UR1A 1H49A 4RNIA 5A8GA 1KFWA 4H7ZA 2OODA 5LKYA 1Q4NX 4LALA 3W0KA 3DFNA 4AHOA 4O54A 1YBQB 4DJED 2VP8A 5C2XA 1M3UA 4L6DA 3W76A 3IUIA 3G1VA 4B91A 2IMRA 1P1MA 4W88A 3IVTA 3TN5A 2ZA1A 3W2MA 3LQLA 3QM3A 1VBHA 1UZDA 1U5VA 3ITGA 4HPJA 3N15A 2WSPA 2G3MA 1TREA 3HG5A 4WLCA 1NDYA 3LNPA 4FO4A 3I3EA 1O94A 1SUXA 5D2VA 5C2GA 3PZ9A 3CAQA 1WBJA 4B9ZA 1Q45A 2VC6A 3A22A 5HK4A 4LBSA 1J0JA 4P7NA 5BOFA 3BJFA 3U2CA 1XFBA 1TMLA 2GJNA 4H9UA 4UFKA 1C8QA 3MVIA 3CIVA 3GTFA 3WJXA 3EOEA 3MB9A 2IW0A 3OLIA 3OPSA 2X0YA 2R1KA 3ZMRA 5FEWA 2H9AB 3E0WA 3P3BA 3G5EA 1R3YA 1UJQA 4JICA 2CBIA 5AC7A 4Y7EA 2PTXA 3EPOA 3WK1A 3WEMA 4QSHA 3DI1A 3H7RA 3SCOA 1ZP4A 2INZA 3AXXA 3LOTA 2GQAA 3VINA 1WDSA 4TTUA 2ISVA 1P0NA 4ECLA 1J9YA 1W0MA 3ZO9A 2FIQA 4U2ZA 4PTNA 4GD0A 3R10A 2YW4A 1BG9A 1PEZA 3GXIA 4GUIA 4O8AA 3UWYA 1UMLA 5HMEA 3T81A 4RLIA 3EOOA 2NSOA 1XIDA 1JULA 3TLQA 4J35A 1S1RA 5I3GA 1FWCC 1A4MA 3GDMA 1RVGA 4OU1A 4YTRA 5CLWA 3WEOA 1S2AA 1UA7A 3EWDA 4QISA 2PI6A 4YJ5A 4V27A 1EXPA 3GB6A 2H90A 4GJ1A 4C60A 4IPPA 3VGHA 3BDKA 1WZMA 4MB3A 1ONXA 3CT2A 3IIVA 1I0DA 4J7RA 2IPWA 3L23A 5ABFB 3G1YA 1M53A 1Q63A 5CSSA 4EPEC 3S9ZA 4EAYA 5LXEA 2IPGA 2D2JA 1E1CA 4AD0A 3S0CA 2CXGA 4H7VA 5AY7A 2J25A 4CD8A 3MU7A 5BRPA 1EP2A 3CK5A 4EKJA 3EXRA 3N1AA 3VOHA 3W07A 1LCOA 2QUTA 2EQDA 2HPIA 4L1WA 4IH3A 3LLDA 3KDNA 3OBKA 3PJTA 2KAUC 2OLSA 2GVYA 1CB7B 1E71M 3KDOA 1D8WA 4G6CA 1K9TA 3STFA 4TR9A 1V3JA 3IRSA 4O13A 1UP2A 2YZRA 3B9NA 4FIRA 1ML1A 5AVHA 4RUBA 4JIIX 4LOCA 3T7VA 3AXIA 2PBOA 3AYSA 3TTOA 3S3GA 3EX1A 4HTYA 1C29A 5I77A 3NZ1A 1HUVA 3XISA 3NZGA 3AHZA 3QOMA 1GJPA 1AUSL 2PDFA 5A2BA 2PTDA 4ZBCA 2XUCA 2H8XA 1E15A 2OJPA 4G2DA 1VFLA 3L4VA 1NELA 3DIPA 1VYPX 1FWDC 3AS2A 1NDWA 1QXLA 4DUWA 3S6TA 3AO0A 1E4LA 4U3AA 2CHRA 3PTDA 1ITUA 2HK1A 1JCXA 4EPBC 1A5CA 1SO3A 2FHCA 3GH7A 1PX4A 3WUGA 3O06A 3G0XA 2J13A 3LDVA 3ITOA 4KRZA 2PDLA 3INPA 4O19A 3VDCA 4GISA 3B3DA 3P74A 6CGTA 2CW6A 3GVGA 1HKJA 3PSVA 5F4SA 1MI3A 2E9MA 3MHGA 4FA3A 1N7KA 4MY1A 3EDFA 3UPBA 3WQWA 5FOOA 4GVFA 3MDWA 2YGYA 1UR2A 5M17A 4U3CA 3MWAA 1BF6A 4DUVA 3KTCA 3F2BA 2FVLA 3WH6A 1OF8A 1TRIA 5FF3A 4Z1BA 3ISIX 2P10A 4B2DA 4GC3A 4YYFA 1TV7A 2B7PA 3RLUA 4LYPA 4PBEA 1PHQA 3M5YA 3FSTA 3BCDA 1XD1A 3IANA 3WQ4A 4WQ6A 1J18A 4DM1A 4V28A 1UUOA 2ON3A 1O5XA 2XHYA 1WX0A 4IPJA 4JFUA 1H7OA 5EGRA 5L6UA 3UJFA 3LHVA 3VDAA 2IXUA 2V5CA 5J04A 2WZTA 1XC6A 1E1CB 3MP4A 3GFYA 2DSZA 1KTCA 2A3AA 1IWPA 1BTCA 2V2CA 2J79A 5SWUA 3EDEA 1K9FA 1GOQA 1N55A 1FWNA 2VWSA 3H23A 2QJIA 4JY9A 3TFXA 1UH4A 3CQIA 2QCFA 2OX4A 2D2HA 4GZIA 1JGIA 5CC3A 3UXAA 4LGXA 2ZWYA 1IE7C 3GWQA 4UB9A 3HB9A 4M6UA 4PL2A 4F0SA 2QCGA 5HWJA 5D8ZA 3KTXA 4US5A 3VILA 2J75A 3IJ6A 3FNDA 2GVGA 3NL2A 2PDWA 5C54A 4MKVA 4IICA 3ARZA 4L4MA 2YKKA 2FPYA 2D3NA 1WOAA 1AJ2A 5EMMA 2XU2A 5AYIA 2J88A 3L65A 3TE9A 1QI0A 4RV8A 3L0NA 3VYLA 3G8RA 3LCHA 1CT5A 1W37A 2D69A 4M6QA 4W87A 1TPWA 4DWSA 2VDIA 3AZTA 1H61A 4RW3A 3CL8A 3GNPA 2GOUA 3XIMA 4XZ9A 4HZ6A 1XIMA 3E12A 2B7QA 2CCRA 4W7UA 4NT0A 3ABSA 4ORMA 1XYBA 1CGVA 1KXHA 3QC3A 2P0OA 2OFJA 4MADA 2BHYA 4P8WA 4DJFD 1UBSA 2WKGA 1POKA 4NX5A 4NYUA 5TNVA 4J3TA 2PAJA 4Y9MA 4IMCA 3LLXA 1TE1A 3WX7A 2XN2A 4LUJA 1BWVA 1PIGA 3MWCA 3STEA 1B90A 1JDAA 3V1PA 3GBDA 4UFHA 4HHLA 2NLYA 4YLWA 2VXNA 1OD0A 3HPFA 3SM0A 2HCVA 4E3TA 4LSBA 3VIKA 2BTMA 2XFWA 2XSBA 4DJDA 3W1PA 2FMOA 4TOQA 3WG6A 4UNIA 4XV0A 3O15A 3WUEA 4IX0A 4QEHA 2VFDA 1YTKA 3R12A 5JBDA 2FTWA 2ABBA 1OF6A 1UR8A 1GTHA 1XV8A 1C3FA 4JTEA 3GTIA 4XD5A 2F6UA 4K7YA 4PUDA 4NHVA 1LF1A 1JDCA 4R7JA 3BICA 4L56A 4FMVA 4CVUA 3TYDA 3H6OA 4IIHA 2DT3A 4LV4A 3QQ0A 4M19A 4W93A 4AHQA 1R2TA 4PUKA 2QPSA 2Y7DA 4JTIA 4REQA 5FF2A 2EO7A 5U4NA 1QPQA 3DI0A 4K8EA 4JL1A 4WZHA 3Q37A 4XSLA 3CQ0A 1OFQA 3G8EA 4N42A 1JPDX 1EBGA 4Q4KA 3ARVA 4EK7A 3IS4A 1S2UA 5D03A 2WMHA 2PD5A 3SUUA 2XIMA 2CZVA 1H1YA 3BOLA 5HUOA 3HQNA 4CN6A 3EOSA 2QJMA 3AYRA 5I23A 4RDWA 1AQMA 4DO7A 3MV11 3AUOA 1QI5A 3W26A 4LJ3A 3SW6A 2Q3OA 3VNJA 4D1IA 4I7VA 3W87A 1JRCA 3N13A 3SCNA 3HV9A 1DWJM 3RJYA 2UY4A 3RM4A 3QEZA 4GY0A 2PWHA 1CGUA 1V0NA 2PLCA 4JTTA 1DIEA 2ZRVA 3B04A 1IIGA 3KVMA 1OWQA 2OZ3A 1JUBA 4PCPA 2NQ9A 5CCZA 2X0SA 3U5UA 2I9UA 3OG3A 3V75A 3OOQA 4MZ8A 2OVLA 5AC8A 1XP3A 3CMFA 3TQPA 2OX1A 1R3SA 3O7UA 5CC5A 1W3LA 2J6VA 4EPKA 5G4EA 3FYPA 5FKYA 2XISA 3CC1A 1YPIA 2VUNA 1XG4A 3IIXA 5CGTA 2WLYA 7TIMA 1ZBWA 3LMYA 2I5GA 2INFA 1EKOA 3TXVA 5FEPA 3R8RA 1BWKA 1T40A 4KGLA 1UD3A 1POJA 2J47A 4UR8A 1EP3A 5CZJA 2O9TA 3SO7A 3EBVA 4MYAA 5HJXA 4FNPA 3SAZA 5K9CA 2Q01A 4PH6A 3VX0A 1BLIA 3WK3A 4HGXA 4O4WA 3GR4A 5H6HA 2PGEA 3LBOA 4UOQA 3HO8A 4Y96A 4NASA 4E8CA 3S46A 1PX8A 4MSSA 1HFBA 1FH9A 3W1NA 1CGYA 3AXHA 4PRRA 3V7PA 1XIEA 3E2VA 4D6FA 2Q6ZA 3BZJA 1H11A 1TZ9A 3ALGA 3G3MA 1JUKA 1K7EA 4XK2A 4OOUA 3IARA 3S47A 3NUKA 4GIYA 3QFWA 2GUYA 3EMCA 3G24A 5CJMA 4MJZA 4REQB 4OT7A 5PTDA 4FX8A 1PUDA 2CLLA 3UYCA 4WEVX 3GW0A 4CQ9A 3LG3A 4BKNA 1V6TA 2MANA 1SO4A 1OC5A 3EKLA 4GK8A 1ZJIA 4GQRA 4ZXOA 1UIOA 2BHUA 3IK4A 4C6FA 3ITVA 1J2BA 3B05A 4AZCA 3M7SA 1VFHA 4GNKB 2C14A 5F1UA 2DT2A 5A8OA 1HIZA 4GYPC 4C6DA 2QYGA 3FXGA 3KRSA 3GTXA 6XIAA 5AFDA 3W83A 3GZAA 1PB0A 1LOLA 3WDIA 3VD5A 2ZX6A 1DWAM 1KB3A 1XYCA 3VKJA 4HHMA 4GKLA 1LLWA 2FGBA 4C6JA 3UJRA 2E3ZA 2PWEA 3W73A 3QN3A 4QIUA 4B9YA 1K8ZA 2XZ7A 4MY8A 2XG9A 2YCJA 1LP6A 3LHTA 2DORA 1VRXA 3QR3A 4S3JA 1J0KA 3EWWA 3PWIA 4JDYA 4FOUA 3UD6A 3WF1A 3P7YA 4I90A 2PU0A 3GAYA 5TIMA 1QW8A 1T96A 4H7CA 3S1VA 1OX6A 2V81A 3TQVA 4DLMA 2RDTA 2Z1VA 1SO6A 3RUBL 3P60A 1UD6A 5KZDA 3ZWSA 1DIDA 1W8SA 2J7EA 4HCLA 3UWWA 1LL6A 1VFMA 3ZR5A 3WLTA 5CC7A 2W61A 4DAIA 2ZADA 3U0HA 1VZWA 2FDMA 2QXWA 4J3UA 3N2BA 3RYSA 4HN8A 1GYNA 5D9MA 4AW7A 4GX9A 3NIYA 2XVGA 1UHVA 4EXAA 2FZ8A 1AMKA 2RDWA 2WSYA 3PZUA 3ANVA 1M6JA 2PC4A 1RQHA 3PWGA 4TX6A 4MB4A 1J12A 2HVOA 3DFOA 1L6SA 2C18A 4LAMA 4HKPA 3CYVA 1Y65A 4QXIA 4GIRA 3C2FA 3SSZA 3C2VA 2Z2AA 3VABA 2UWFA 2J27A 2R1LA 3DUGA 4A21A 2FZ9A 3LXCA 3NSXA 1QO2A 2G96A 2W3ZA 3NQFA 4NUWA 3QW3A 1LBLA 5E1QA 3VD3A 4IFKA 1QWGA 1T41A 4DWDA 1VYRA 1UBPC 2Q8XA 4I9AA 3RF9A 2Y5JA 3VMPA 3BPWA 4EE9A 2GWNA 3QHNA 4NYYA 3AOFA 2FDSA 3ARUA 3WLQA 1KNWA 2VT0A 2WQDA 2RHGA 3NYZA 1FWTA 4IOTA 1E3XA 4MJ2A 3N2TA 4UC5A 5GJPA 1QBAA 4H2HA 3WD0A 3DAQA 3ABOA 3IAQA 1XLLA 2HZGA 3GNOA 4AZCB 4LVGA 3RPTA 4QQ3A 2ZX5A 3A21A 5M03A 4GQBA 1OIFA 4CU7A 3VZXA 1HJXA 3M9YA 1F73A 1JGMA 1GHSA 1L0PA 1ZCOA 4MZ1A 3WBEA 3P93A 1GK8A 1DE5A 1KBIA 1TV4A 2F84A 2J62A 1XGEA 1VBUA 4FOJA 2AL1A 1JDFA 3QSTA 1Z3NA 3VIOA 4R5EA 3T78A 3BVJA 3MBFA 5ABEA 3UXDA 2IKGA 5HQLA 2WJDA 2CITA 1KRAC 1B3ZA 3KZPA 3UWUA 3E2QA 4IQDA 1RXOB 3TZNA 3W2JA 1MUMA 3ZFHA 3SZ8A 3WY1A 4ZMGA 1B31A 1ISWA 4DUOA 3TOPA 2XYLA 3RJXA 1XIGA 1GZ1A 1M7XA 1S2CA 2BY1A 4CN1A 3GG8A 4JIHA 4D72A 2J6XA 2GZXA 1OFDA 1OC7A 5CXPA 3OZMA 5G2IA 3QPEA 1U5HA 2Y6ZA 2IQTA 5F7UA 3ZVIA 2BS9A 1Q6CA 1S2WA 3GIPA 3SQLA 2DT1A 3G0UA 2XZ9A 1J5SA 1LZOA 3LI1A 4LC6A 1VHNA 1VLWA 4AY1A 3DXIA 1KLYA 3Q2DA 3AXKA 4HBKA 3MCNA 1H63A 1XLJA 3BG5A 3AWOA 2XIOA 3VE7A 2AQWA 3DENA 1P7TB 4NQ1A 1OFPA 3PG9A 1M41A 3ZJKA 1P0BA 2UBPC 3GHUA 3BJSA 4C6LA 2XN1A 1UG6A 2UY5A 3NQEA 4H9YA 3M5VA 1FDJA 3CTTA 3W82A 3GU2A 2DQXA 2OOGA 1SZGA 2G41A 4C5YA 1HTIA 2TRSA 1CXLA 5AVNA 4C6CA 1HGWA 3OIXA 1UR0A 3LPGA 2QV5A 1J0HA 4NAFA 2F2HA 2W5FA 4K7VA 2VCBA 3T1GA 3U7VA 1H2JA 1NOFA 3AMKA 5K4ZA 2WSKA 3CUJA 4JTAA 2ZVIA 4NNAA 1IT8A 3TQKA 3EEGA 3W3OA 3NEVA 1XBXA 2FVKA 3B0VC 1QBBA 3T0DA 1XSJA 3L2MA 4IFKB 3BANA 4H41A 2ANUA 4RZBA 2R1MA 5KTLA 1Q6GA 9CGTA 7CGTA 2P5NA 3PUGA 4F0RA 2NUWA 1IYXA 4AF0B 4CCDA 1JCLA 4XZLX 5D09A 2OKTA 3TR2A 1EYEA 4I6KA 2DIKA 3B8SA 3A4WA 1WV2A 2V63A 3TK7A 4GINA 4PBFA 3G18A 1GVFA 3THQA 4NX0A 1W5PA 4PFHA 3R7MA 5U7SA 5F2GA 5H8MA 1WQ5A 1FCQA 5MF5A 3QC0A 4Q7NA 4M6VA 3R6IA 6ALDA 2HXUA 4JPGA 2HSAA 4NAEA 3L7RA 1GW9A 3UNTA 2I57A 2CLEA 3S1GA 3MW7A 1A5AA 1IV8A 1OJXA 2JALA 5HPOA 5G5IA 1GQLA 4KMQA 2HDJA 3LCFA 1V0LA 4IG2A 3TJLA 1OEPA 1EC9A 2VENA 1UP0A 3NQ6A 2QMKA 2PZNA 4EXQA 1Z9AA 2Z26A 4MY9A 3H8AA 3F2CA 4IZGA 2CZ5A 3LBCA 3TYEA 2E67A 5D2YA 1HF6A 4S3AA 3TC3A 2BXZA 3U2OA 4Y9NA 3F4NA 3BLFA 4Q4MA 1YTEA 1DTUA 4XKMA 4UTTA 3UVAA 5RUBA 4QAIA 5JUVA 1GYLA 3GXNA 4UTMA 5CBJA 1E70M 4AZIA 3LXBA 4A29A 1EJVC 3WD3A 2I7GA 4QAWA 3QPYA 1RLDA 2XH4A 5IRPA 3QHOA 1H3GA 1B3YA 2PP3A 2P3ZA 3UG8A 2ZC1A 4QNWA 5D33A 1XC4A 1TPDA 4LNCA 3SCSA 3GTNA 2WLZA 2PP1A 4WJ8A 1FWHC 5FA5A 4DBEA 3TSBA 4AD1A 4W8AA 4D71A 2PUZA 4N4PA 3CT7A 5LHEA 1RAKA 3P67A 1M68A 1PKMA 1X97A 1FUYA 4WKFA 4BF9A 5CPLA 2F2KA 1HL2A 5CG0A 4J3WA 3UZ5A 4WJEA 3RIKA 4XZHA 4G1NA 4PB3A 2J4GA 4KWVA 2EEXA 3QV8A 1Q6FA 4LS1A 4NAFB 3C0SA 3M0MA 3T4CA 3AIVA 1V93A 3MPGA 1TFVA 4BHYA 4LQ1A 4UTLA 1IF2A 3MHUA 4XO7A 3TSDA 4LBUA 4DO6A 1Y8BA 4AVOA 4EOUA 5JBEA 1TWWA 4JTDA 1H1NA 1CGXA 1BQGA 3ARWA 3REQA 1FXQA 1KLZA 3PNZA 3HPAA 4CCCA 3OYZA 1TPUA 4O1AA 1ADOA 5I06A 5EFFA 4QDPA 1PKYA 3GUWA 4TTGA 2QR6A 1W2VA 3NL6A 4MNLA 3GFZA 1F3XA 3CIWA 2WHJA 4X2RA 3O63A 4NXSA 3CUFA 3GUGA 4MJMA 4CQCA 3EOUA 4X9SA 1QAPA 4J2MA 2Q8LA 3QF0A 5D30A 2W0UA 1YRRA 4P2VA 1TG7A 3RXZA 4A3YA 4R33A 4RR4A 5ENLA 4HJFA 4Y2WA 1UWUA 2OZTA 1CTNA 1VFUA 5LNVA 3EYPA 2NQHA 3MSYA 1C90A 3PBUA 5HMFA 4RCXA 3WF2A 1P6CA 4LEFA 3NCOA 4NAEB 4E2BA 1OYAA 3SGUA 4MKNA 1DJQA 3NZRA 4Q8TA 3ME3A 5D8WA 2YOCA 1KD0A 2WVUA 1WZKA 1QPOA 3QFEA 2Y89A 3ARYA 3ARTA 1WZLA 4GI4A 1JAKA 2ZIDA 1VJSA 2OYLA 1DOSA 1HO1A 1Y5VA 1XQLA 3CNYA 3LM3A 2Z6IA 3AJ7A 4FIQA 1NOUA 1UKQA 5L9FA 2QJNA 1Q6EA 4ICNA 2VCCA 4RE3A 4IQLA 3FDKA 1XIIA 3IJIA 4OKDA 4HVXA 1XCFA 4N9CA 3CMGA 1ZY9A 1Z8AA 2OYMA 1UC5A 5I03A 5A8NA 3PWAA 5HATA 1RY8A 1HVQA 3MUXA 4M81A 4WRHA 3ZM8A 2GFTA 3V0UA 2DIJA 3NL3A 1VD6A 1JPMA 1YXCA 1ME8A 1IEVA 3R89A 5BXSA 1PDZA 1W1IE 4W7VA 4UQEA 1E3ZA 3WLPA 4S38A 1FFRA 3ZYZA 4E4UA 3BLOA 1FHVA 4C1NA 5GVJA 3BSMA 3DFTA 1KR0A 3IIZA 3P5ZA 4CCZA 1O1HA 3H7UA 4O10A 1NU5A 3KCJA 1MNSA 2DZAA 4E0CA 4ES4A 2HROA 4ONVA 3ARRA 2JFEX 4ERIA 5BXRA 5BCAA 3IEBA 5ECVA 1YQ2A 1JYNA 1CEOA 1IXQA 4O17A 4D6JA 2I56A 3DH7A 5CBBA 3BOXA 4LV9A 4BZYA 3VNDA 2GGEA 1UROA 4HOWA 3M0ZA 5LA2A 1TCMA 3AROA 3NPVA 1J96A 4EF9A 2EG7A 1A3HA 1ZUAX 2WPGA 3QV9A 4NRRA 1PV8A 4KWSA 3H12A 1YNPA 3REQB 4UWMA 1VEMA 1TB3A 2FPVA 1A5NC 4YMZA 3ES8A 2PTWA 3EMQA 4ZGYA 2ADAA 2VR4A 1F9CA 1BVNP 2ZTJA 4EX4A 4ADSA 3J7HA 1E51A 4GZJA 2VVSA 4XX6A 3AS3A 3K2GA 2NWSA 4ORIA 3JVAA 3UFYA 2PU1A 2J7CA 1XYFA 2QT3A 4PUEA 3G0SA 3FVDA 2ACSA 3E0IA 3SCWA 4FX7A 4XAZA 2NXHA 2ZA2A 2VTFA 4X60A 4IQJA 3W25A 2DUAA 5DRCA 1DVJA 2X09A 5J8LA 4QSFA 3LLFA 5LIWX 2B81A 3QTPA 3W88A 3DOPA 1OD8A 3MANA 2X0HA 2ZKMX 3GSMA 4YS1A 1QTWA 3H70A 2OPJA 3O6AA 3NZPA 3VNIA 2YDRA 3WYZA 1NP2A 1LUCA 4Y8FA 1FP8A 3WD2A 3VIJA 4E8DA 5EY5A 2VZOA 1L8NA 3MUAA 3AI0A 1JZ3A 4ALDA 4HA3A 1LT7A 1E5JA 1KBKA 3MVTA 3F4CA 1K9DA 4GBUA 4GKTA 4FF5A 1SJCA 4GH3A 3QV6A 4XZBA 2A0NA 3BAKA 5BNKA 4WY0B 2HV5A 1XQKA 3W4RA 4TMCA 2VO5A 3DHUA 5D4YA 3KBVA 4MAVA 4HMDA 2CLOA 4CKQA 1MUWA 2YW3A 2VD9A 3L5AA 3R11A 3UWQA 1TA3A 4KWUA 1KM1A 4B3ZA 3OP2A 2VEPA 2IKIA 3P82A 1E6ZA 2X1SA 3GNDA 2Z00A 3AIUA 5K4XA 4PR4A 4C1NB 4Y6GA 4DZIA 3AMCA 1IWBA 3NURA 4KEZA 2Y0FA 3KBSA 2WSRA 4KRUA 4ML4A 1E6QM 4UTKA 4IGHA 4LAKA 3IVSA 3A12A 3NPWA 4BF7A 1WB0A 3II1A 2NXGA 5CGMA 1YXYA 1AW1A 4HMCA 3CZJA 1EUNA 2J77A 4GGHA 4W5ZA 3QPZA 1KM6A 2G3NA 3H2CA 2PMQA 2VOTA 4JKLA 4O0QA 2YDQA 2WQPA 1ZJHA 5FIPA 1ELSA 1R2RA 2J9YA 1SW0A 1RPKA 2GDUA 4KCWA 1ZPTA 3V3WA 3NNTA 3VTRA 1AD1A 4HYVA 3NSMA 3GG7A 1EUAA 3VFCA 2QGYA 4O50A 5IDIA 3MT1A 2ZRWA 3OB8A 1B9ZA 4HJWA 4OV4A 5EFDA 3ZLGA 4NILA 4ZOCA 1ONWA 2QCLA 4QFUA 4MWAA 2R14A 1JCNA 3F1QA 1W5OA 3A47A 3ELFA 2GOKA 3KP0A 4GMEA 5BRBA 3NJ3A 1PTGA 1VFTA 3PFRA 3U7BA 2ZUMA 3GRIA 3VIFA 3IK2A 3G77A 2FZDA 4UTJA 7ODCA 2XWDA 2D20A 1JNEA 1FWRA 1EX1A 1ICQA 4AH7A 2X7VA 3G2GA 3E3HA 2RDUA 2WM1A 4LPCA 1REQB 4LY4A 4PFMA 4RDZA 1JPKA 3EWYA 4PUUA 4RXFA 2A3BA 2D0FA 2HNEA 3V36A 3W7JA 2EPHA 4XZIA 3LBMA 5FJJA 5AHEA 1LUCB 3AMGA 1S5NA 4D2JA 4U4MA 2QJJA 5CAKA 3SIMA 2NVCA 2OO6A 3D3AA 1FX6A 4FLOA 2ALDA 3F5JA 2G5WA 1Z44A 3BG3A 3L4UA 1D9EA 3A3XA 1FHLA 4MB5A 2AKMA 1OCJA 4C6BA 1XPYA 1IXNA 1TE6A 3M1ZA 3U6WA 1SO5A 1E9ZB 1J0YA 5BOEA 4AD5A 3ZR6A 4PMRA 3L5MA 2NVDA 3DFYA 3G1HA 1AJZA 2CLKA 1N8FA 4JTSA 3BSHA 3HGRA 3MZ2A 4AIUA 2GQ8A 2CPUA 5E0KA 1HL9A 1ZJBA 3KBJA 4HT3A 3KRBA 1U5JA 4NJIA 2DH3A 2YB4A 3ZT5A 5C9ZA 1Y7VA 3MMWA 1CI1A 2F6KA 1O60A 1TA3B 2BVWA 4DB7A 3B8DA 1E1EA 3T42A 3WSUA 1OIMA 1DJNA 1QNOA 3CLWA 2R8WA 3LCWA 3SFWA 3KS6A 4H9TA 4K8GA 3TAOA 3FJ4A 4UQAA 4DNHA 3EA3A 3TIMA 4PMVA 1CZ1A 2R91A 1SQ7A 3UXLA 3ZR4A 5M5DA 3RHGA 2DT0A 3OVPA 3TX9A 4EAMA 4MZYA 3QJAA 1V3LA 5JVLA 2XH2A 1U22A 1E9YB 4WXYA 1LRTA 5EL1A 3SGZA 2POZA 7REQA 1UP3A 2QDDA 2BWGA 1VHCA 1D8CA 4Q3MA 2PGRA 1PHWA 1OX5A 1ITXA 4IUGA 3BO9A 3M07A 1JR1A 2DW7A 3N17A 3M5ZA 1B3VA 5HDRA 2J78A 4MPKA 3WQ5A 1E6NA 7A3HA 3WMBA 4DVOA 2FB3A 1XRVA 3M0JA 3VDBA 3BMVA 5CPQA 4ATWA 4MWAB 4KBXA 2QDHA 2BHZA 2Y62A 5KITA 4B5WA 2QQ6A 1TSIA 2VEKA 1AQHA 1J10A 5A6LA 5E09A 3MYOA 1JDDA 1OFAA 3N04A 2A85A 3W1AA 2R24A 2Z28A 2YXGA 3BL3A 2BGSA 5A6JA 1M7JA 1Z41A 4OHQA 1E4NA 2I5QA 3DG6A 3N9SA 1ITCA 2PWUA 3W7HA 3DN5A 3SRKA 3MI6A 3L12A 2BY3A 3N2MA 3LGDA 2WVVA 4MKSA 3F5LA 1AJ0A 1S39A 3DBNA 3WQGA 1J79A 3C2OA 3MSRA 2DUXA 5CLTA 4Z42C 1IR2A 4OBRA 3CZKA 3UZZA 3D0CA 5DY3A 1PX3A 1UPMB 2FQIA 1I2PA 3RCYA 1ZAIA 4J27A 5E5CA 3NM1A 4Q4RA 1WAWA 2TODA 4MNJA 4PODA 1Q5MA 3SGGA 4J3SA 4AZ5A 2J8FA 3FA3A 1QPKA 4UOJA 1F7BA 3A3HA 1SPQA 4Q8WA 2WSQA 4XTIA 3TYZA 3BJTA 1XBVA 3UNDA 4GO9A 4LX4A 3UWVA 1A5BA 3SUTA 3NEHA 2VGGA 4UTWC 3U5YA 5FF7A 1FOBA 2WC3A 5G2WA 4FR6A 3WCZA 3SY1A 2BXYA 1JZ7A 1JFHA 3NWRA 1T99A 5AN7A 2Q71A 3BCFA 3QY8A 4L5ZA 1WDDA 1EOMA 4PL1A 1SW7A 4B3LA 3M46A 1WDWA 1E73M 2FJUB 3DZ1A 4XVDA 1HJWA 4CNPA 4DJEC 4R34A 4RKAA 1S5TA 3VNKA 3A24A 1VC4A 5A69A 5EMLA 1L9WA 4ZTYA 4LVBA 1GYMA 1EXBA 1FWSA 2W63A 2ZUWA 4KW2A 3CL7A 1F6KA 3VVGA 1XYZA 1JCTA 2GVEA 1BXCA 3DHDA 1V4YA 3M43A 1X7FA 5JXQA 3WLSA 1YHTA 1Q6DA 3OQEA 1RK6A 1S5WA 1W54A 5MHBA 3LCGA 3AWNA 3FSUA 3T44A 1JI1A 3VDHA 3R8GA 1N2VA 2VDHA 5A2AA 3TC6A 4JIEA 3G6LA 3WLIA 1RCOB 1Q2RA 2WANA 4AZGA 5A8MA 3A4AA 2P50A 4PN2A 7REQB 4CN4A 4H3DA 1FFQA 4O1BA 3ARXA 2WC7A 2PDHA 3KL3A 4ICCX 4LCQA 1TRDA 3WH8A 3VE9A 1OBAA 1VR6A 3SSJA 3LUTA 2PDQA 1BQCA 2WNWA 3W53A 1TMQA 3IJQA 4QROA 4ZFCA 1A50A 4OBTA 1OT2A 1BXBA 1TQJA 1CYGA 4GUGA 2A4AA 3JZEA 3NYDA 1W9XA 2HQAA 2O4MA 5FJOA 1E0VA 1JZ6A 2V82A 1W8GA 2V68A 3EGJA 2PBGA 2G0WA 4PA8A 1VCGA 5GQBA 2ZRYA 2WVTA 1ENUA 3QYSA 3PPGA 3SN0A 1VIZA 2L5HA 2XH0A 1XYLA 5HQEA 3UR2A 4Z2IA 5KEZA 2CIPA 3NSNA 2XFYA 4H83A 1W5NA 4NJGA 1B54A 5DLCA 3NVDA 3GC2A 3L4WA 3QMSA 4KESA 1SFSA 1BXNA 2WYSA 4A8LA 4RE2A 3PSWA 4HOZA 1V8EA 3N12A 3CASA 2WVVB 2JQXA 2HJPA 5FJUA 4HOXA 3GU9A 3B0YA 3WQEA 4GVHA 3SCRA 1FWBC 3MP5A 4JHMA 3W72A 5DCDA 3N2XA 2P8BA 3STPA 1F8MA 1JI2A 2DSWA 2V2DA 1L2UA 1NF0A 3SI9A 5HWNA 4NRSA 3M64A 2DDXA 1GEQA 4IP7A 1DBTA 1OB0A 4J1OA 2J7FA 1WUFA 3WFAA 1A0EA 5GNXA 1SJDA 4IXXA 1XLCA 3PM6A 4TU1A 1Q66A 4FF7A 3UGVA 1QR7A 2VQTA 3TQ0A 1Q6RA 2G4FA 4B4FA 1RBLA 2Z27A 4E2DA 4ZB2A 5AHNA 1DPMA 1OCBA 4IGSA 3AISA 4A3QA 1IZKA 2AQVA 1WYIA 2EPNA 1FWAC 3SJNA 1SJAA 2VM8A 1LOQA 3MUIA 1QNQA 3VZZA 4PB5A 1FTXA 4O1FA 1JIBA 2ZQ0A 1QDSA 2WKLA 2PGFA 2W91A 2D2OA 4O18A 1ZNNA 4X0NA 1KFEA 3QGVA 4QTGA 2WXDM 3PPCA 3M0VA 4M0XA 4ZA0A 4YNGA 2Y7FA 4C91A 2EPOA 1B5TA 1VPQA 1YDVA 1M7OA 4BI7A 3UA3A 3CUHA 3R79A 4KGJA 1CGWA 3K30A 4XSMA 3T55A 4N4QA 5BWFA 2V8ZA 1WKYA 3POHA 2E9BA 3NO1A 1UKSA 5J5RA 1MDLA 2VWTA 1P6BA 5E70A 2E5CA 1YMYA 3H54A 4WY0F 5AECA 2Y8UA 1LG2A 3JZUA 3W7KA 1PYMA 1XLBA 4AZBA 3WLLA 3NM3A 3RLHA 3OQ8A 1JYWA 4YL2A 4Z1AA 5T26A 4YXGA 2WHMA 4AXKA 1TJPA 2OR2A 3GHRA 1ZSXA 2C8NA 3M6YA 4PYSA 2P0IA 1R6WA 2YL5A 5EU9A 4XO6A 1DJHA 3CMJA 2O4QA 5HMDA 4C6PA 5HBFA 1XLDA 1M65A 1W31A 3B0PA 3A13A 3RK8A 2V5BA 3UG5A 3GDLA 3VIGA 2E4TA 4K68A 1X1OA 3AQUA 1M1BA 3T09A 1ICPA 3WBAA 3PAOA 3A64A 1MW3A 4PSRA 4JN6A 1CW2A 1BSIA 1DJIA 2WMKA 3SCUA 4P7QA 2X1RA 3S6DA 4XWUA 4UTHA 5I3JA 3N29A 2F61A 2QCMA 3CHEA 2NQ5A 5CZSA 1KFLA 4F79A 3FN9A 1UCWA 1ITQA 3QVQA 4ZTXA 4NZJA 3UR5A 3WJYA 4Q8NA 2WZIA 2E6AA 4HPXA 4PB4A 2DZXA 4Z08A 1LJYA 2VX6A 1V77A 3VAVA 4U5KA 4P7OA 4U2YA 4WUIA 4Q8MA 2E0PA 2GGIA 5E0FA 3S9IA 3B97A 1A4LA 4DZHA 4QDMA 3VIPA 2CWXA 1EJRC 4DIAA 2C79A 2TPSA 2YLLA 5G4WA 4QLJA 4WX2A 3CZEA 2ABAA 5LZLA 5D04C 1RH9A 1XRSA 1P6WA 3WLJA 2BVDA 3AHXA 3R0DA 3W70A 2PDPA 1ADDA 4IISA 4FB7A 5I6SA 3EX4A 4I5XA 4BK9A 4XBSA 1MMFA 3ANUA 3EEZA 1OGSA 3O6YX 5JQ9A 1NFPA 4ASTA 3DG3A 5D9OA 4O1CA 4F48A 1J0IA 4G7EA 3T9PA 1TTIA 4HYWA 1YEYA 1TO3A 2Y61A 3P2VA 1TVPA 6XIMA 5DMYA 3GFXA 5DANA 1UW9A 4N2YA 2WM0A 2ZDSA 4L4OA 4FK9A 4Y8EA 3FS2A 3RU8X 3VX1A 3LHWA 4UQBA 1R30A 4O14A 1O6IA 3RLVA 4MFEA 2ZC8A 2NZLA 4G1KA 1X39A 3IPWA 1SVDA 3GDTA 3CAWA 1B9BA 2QPUA 3LZ3A 1JVNA 3N18A 2XTKA 1ECQA 3LD5A 2D22A 3P62A 1B2YA 2V0TA 4PMNA 5LIUX 2HRWA 2I17A 3PK7A 4U31A 4PTMA 3OYXA 1G4PA 1DJZA 3MS8A 3W1TA 4FXSA 1WDPA 4IIGA 4KWOA 2VX5A 4O4VA 1JXKA 3H2MA 4OJYA 4V1XA 5M2FX 4IPNB 1Z7AA 4Q6JA 3W29A 1V02E 3TNOA 4JFTA 4L65A 4ERAA 4UZSA 1HKIA 5AYYA 5HOSA 2B0MA 3MKVA 4HZ8A 1CWYA 1E0TA 2QCDA 4C6QA 3CPUA 4R7OA 3B0XA 3K1GA 3EKZA 1EO5A 4FX6M 4ZOEA 3ZS4A 5JMUA 4WGHA 1L6YA 4LH8A 4H00A 3KOZA 1TPB1 3TAKA 3HV8A 4DN1A 3K5XA 4PMXA 4WXZA 4QBXA 4HPNA 1Q7QA 1PZ3A 4AIOA 1GW1A 2MUCA 4JTKA 1XDLA 3V0TA 2HMCA 2V69A 5B80A 1PAMA 3GYEA 3QSRA 3C2YA 5DX7A 3TJXA 1B0IA 3NDOA 4GA8A 4AIBA 4MHBA 1OG6A 4INFA 3PUDA 5K2ZA 5K3VA 3DFPA 3BG9A 4AIEA 3EOLA 4GYJA 1JPIA 2BDQA 4ZQOA 1KFBA 3NDZA 5I00A 1NTHA 1RJRA 3GVVA 3MCOA 2Y70A 4O57A 3RCMA 5GPRA 1DL3A 2POTA 3DFSA 3S2MA 2VC9A 3RRXA 5JBFA 1KQYA 1GQJA 4NL1A 1DJWA 2JIWA 4JR5A 3NQDA 1MW2A 3BMWA 3QY6A 1H7XA 1R3VA 2XH7A 1H7WA 1HQTA 4KKXA 3I6TA 2FLIA 4ZQMA 2E8YA 3JR2A 1NWSA 5K9XA 4WK9A 1MRAA 2CXEA 1NFGA 1QHPA 4FNTA 3AS0A 3QRHA 3N11A 3GE7A 4U33A 1VP5A 1NP0A 3ITYA 4H8UA 3AS1A 4KCUA 4Z0JA 3ORWA 5LNSA 1MFVA 2YYTA 4LUYA 4MVAA 3PBWA 3BAYA 2PWDA 2A2IA 1CXFA 3AIRA 4KIRA 3GW3A 4C7GA 1SFJA 1K03A 3CYJA 5CPMA 3FJNA 1H0IA 1QMLA 3UZYA 4PMZA 3UESA 2EJAA 3FV9A 4H6QA 1Q6QA 3S2LA 3UG4A 2QMJA 3AMDA 1D3HA 1DWFM 3OHIA 2GGJA 3ZLHA 2ZUNA 4AWEA 5C8BB 4LS2A 1BFNA 4HK5A 2IKHA 4RL3A 3TMLA 3TOYA 3PG8A 4LY8A 1KBLA 1D7KA 1OX4A 3W7MA 1GZGA 5CC6A 2IQ0A 3MSDA 5CPOA 1W3TA 1RALA 3G1AA 4IMFA 2ZZ3A 3EB4A 2HPMA 3LHZA 4R9XA 3TW7A 3JU2A 5EBAA 3IGSA 2BOEX 2H3BA 4M1RA 1UJPA 5LIXX 1HJSA 3WD4A 2V9DA 5T91A 4DUXA 3WQ6A 1PYFA 4J2PA 5XINA 4IPLA 4GVIA 4XZMX 3DECA 1A3WA 1OCNA 1E0WA 4DYKA 4QJ5B 1TPEA 3KOWA 4Z1YA 2PZ0A 3HFYA 2RKXA 1FKXA 3Q65A 2QCDB 4AAJA 4JTRA 2IS7A 3VDGA 1H09A 2PCEA 5XIMA 4ACYA 3L9CA 4E38A 4FR1A 2EAWA 3LQGA 1KM2A 1PWLA 3AAMA 2EHHA 4GXMA 2FFCA 1GNXA 2XSAA 1OZMA 1LLZA 4I8YA 4DF0A 4X2PA 4O0KA 3QHMA 2EKGA 1VFOA 3VNMA 2DQWA 3WF0A 2PDKA 3THCA 3MO7A 3WDJA 1QPRA 2OWWA 1VBGA 1E6PA 3G1SA 3ECQA 5TD4A 3QKZA 3P81A 1XGZA 2P3EA 2VEMA 4L9XA 5M1TA 1X96A 1H0GA 1PWMA 3AJXA 5HQMA 1PXGA 1UKTA 2WWDA 1IR1A 1W3KA 3TA6A 5C2CA 3OG2A 2V5DA 1P4CA 1V3IA 1CLKA 3LZ5A 4PMDA 1AD4A 3UJ2A 2GL5A 4E2OA 4QM1A 1F76A 4YTUA 4HCDA 2XSXA 1V0KA 2HK0A 5F1VA 2TAAA 3E6EA 3ZQ9A 1I2OA 2CHOA 3NQ8A 4NJJA 4O28A 2PLKA 3ARQA 4AD3A 1OK6A 3M41A 1OFRA 1ZAHA 4NKCA 4D8AA 1OYBA 4HQVA 5D9PA 3W7QA 4IL2A 3WDPP 1TQXA 4C5ZA 3CV1A 4AX7A 4OGZA 3CGTA 4H9ZA 2C7FA 2FH6A 1PS9A 3I6EA 4R88A 1DWIM 3GXMA 5DMLA 1Q7MA 3CTLA 1YDNA 3PNUA 4NZ1A 4JOMA 3B9OA 3T6CA 3WFZA 1OHLA 2NV9A 1DWGM 3MY9A 2XGZA 5A6BA 1YTDA 1YNYA 5CBIA 3PBMA 1KGUA 3ID7A 2DH2A 5DF0A 2E1WA 4LFYA 2CC0A 3ARPA 2G3JA 1XLEA 3AIQA 4W7WA 3OZOA 1OX4B 4ZO6A 3WH9A 1JUEA 4CQ8A 3HGJA 2QZRA 1D7FA 2FHBA 1IHIA 4N9EA 2WB5A 3GHSA 3TSMA 1LM1A 1ZZMA 2PDCA 1K77A 5E9AA 1EA0A 4H9XA 1VENA 1XLAA 4L6OA 4QP0A 2ZVRA 3E1F1 3N2CA 2DZWA 4NXKA 5HUPA 4PGLA 3TJIA 3P0WA 3B40A 3A9IA 4NI3A 1QATA 2H3DA 5D2TA 3APYA 3WUBA 1YXDA 7ENLA 4RK8A 3H7VA 1K4HA 1NQKA 4XBJA 4D6EA 2C6QA 2CWNA 4WDTA 5JIWA 1XF0A 4OWGA 5FACA 3EXTA 2C16A 1VEPA 2ZUVA 5TQLA 3WJZA 4JTCA 5AZ0A 3AALA 2YFNA 3GS6A 4WOQA 3HMJG 3WH5A 1X38A 1ZJAA 1BKHA 1CPUA 3CUIA 3TONA 1VAHA 3WQDA 3H4XA 4FOKA 4KFPA 2UY2A 2DW6A 2BGQA 1KRBC 4EWND 3T2OA 3WNPA 3DGRA 3IJDA 1UWQA 3B8WA 1XSKA 4LBRA 4S3KA 5KETA 1DEDA 3DYOA 1GVOA 1N82A 2VZVA 1VYSX 1JCJA 4CVWA 1ISZA 4W8LA 3PPHA 5C5YA 3T0AA 1JZ2A 5I3HA 4QG6A 3K1DA 1EF3A 1VCVA 3FYYA 4HNUA 3KBMA 3HQPA 3UG3A 2X1UA 4G56A 1PIIA 1UWTA 5DBUA 4V33A 4ZO9A 4H4IA 1DKWA 3T8QA 1IEWA 3QR1A 4CEUC 1UZ1A 4P7RA 4NJHA 3EA1A 1UMYA 3I4KA 2YR1A 2EG6A 3S2NA 2YDSA 1FWGC 4QS5A 3WBWA 3NG3A 3PZGA 2QHAA 4DJDC 4GI8A 1W5MA 1J11A 1XYAA 3WKZA 5IXEA 4GFIA 4JFWA 3BW4A 5I07A 2ACUA 3R58A 3WUFA 5HNTA 2VFFA 3L0KA 4KIEA 4GUJA 4LVAA 4JHOA 2FTPA 3W01A 5A6AA 3A4XA 1H60A 1MZHA 1TTQA 2ZOXA 4GLEA 4F4RA 4EXBA 2NLIA 3BW2A 1HKVA 5DCBA 4XD6A 1MQRA 2ZZ2A 3BTNA 4P8UA 2CLPA 2WOQA 4AY8A 3IV3A 1EB3A 4O52A 1VF8A 1RJPA 4JIPA 4HK6A 4EVZA 2FGZA 4GXPA 3SY8A 1GTEA 2PLJA 2PWGA 5ABHA 1LQ2A 3D46A 2BB0A 1MWOA 4M7SA 4L9YA 1FCUA 1WXJA 2IXVA 3QOKA 3W2UA 1Q6OA 3FGCA 1VBJA 2RJGA 4BA0A 1EDQA 2VMFA 1GWJA 2YDAA 1YYAA 2PF8A 4H8HA 4Z2KA 3THAA 2QCNA 4EWJA 1NF7A 4PCFA 4JZ5A 1EO7A 3BLEA 4BEQA 3MP3A 3UERA 3LNMA 4MUZA 3LSCA 2VZUA 2WWCA 2Y4SA 3LENA 2WCSA 5I3DA 2X8RA 3GK0A 4XB3A 3LI0A 3ONCA 3NPXA 3QQWA 1NDVA 1RBAA 4MJ4A 1MW1A 3UR7A 3T4WA 4WVXA 1GOKA 3TNBA 3H4GA 4U28A 5D38A 2HISA 5C7VA 3ERPA 3UEQA 3LHUA 2ZA3A 3W2KA 1Z89A 2WKJA 2ZDRA 2YA1A 3KVLA 4MNMA 4K38A 4XAGA 4O15A 2DPEA 3C3UA 3N3TA 2VFIA 2FYMA 1MRQA 1PVNA 4Q4SA 1JYVA 1PBGA 4EANA 4ACZA 1G1YA 1ICSA 4JTFA 1VJIA 2VURA 1NQ6A 4LWWA 1FCVA 3QZAA 3LGGA 3GYCA 4Q6XA 3HOJA 2C0AA 3U57A 2VYOA 4LVFA 3GIQA 4M1BA