4LCRA

The crystal structure of di-zn dihydropyrimidinase in complex with ncba
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
485
structure length
484
Chain Sequence
AGEILIKGGKVVNEDCSFFSDVHIRGGKIVEVGPDLRVPPGARVIDATDRLVIPGGIDTHTHMELAFMGTRAVDDFHIGTKAALAGGTTMILDFVMTQKGQSLLEAYDLWRKTADPKVCCDYSLHVAVTWWSDEVKDEMRTLAQERGVNSFMFMAYKGLFMLRDDELYAVFSHCKEVGAIAQVHAENGDLIAEGAKKMLSLGITGPEGHELCRPEAVEAEATQRAITIASAVNCPLYVVHVMSKSAADVVSKARKDGRVVFGEPIAASLGTDGTNYWHKDWAHAAQYVMGPPLRPDPSTPGYLMDLLANDDLTLTGTDNCTFSRCQKALGKDDFTRIPNGVNGVEDRMSVIWEKGVHSGKMDENRFVAVTSSNAAKIFNFYPQKGRIAKDSDADVVIWDPKTTRKISAQTHHQAVDYNIFEGMECHGVPVVTVSRGRVVYEEGRLKVSPGQGRFIHRQPFSEFVYKRIRQRDEVGKPAVVIREP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of vertebrate dihydropyrimidinase and complexes from Tetraodon nigroviridis with lysine carbamylation: metal and structural requirements for post-translational modification and function.
pubmed doi rcsb
source organism Tetraodon nigroviridis
molecule tags Hydrolase activator
molecule keywords Chromosome 8 SCAF14545, whole genome shotgun sequence
total genus 185
structure length 484
sequence length 485
ec nomenclature
pdb deposition date 2013-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4lcrA01
5G4HC 2OGJA 4J35A 1W1IE 3S2LA 2KAUC 3CS2A 4GZ7A 3E3HA 4GY1A 2Z26A 3IPWA 2CZVA 2VC7A 4HK6A 2WJFA 3ID7A 4B3ZA 3A4JA 4LH8A 4EPDC 3LS9A 2R1LA 3PANA 3QGAC 4LFYA 1R9ZA 4KEZA 4LAMA 1V7AA 4IF2A 4BKNA 4RZBA 1FKWA 3B40A 4LEFA 1WXYA 3ICJA 2Z28A 1A5OC 4HJWA 2BGNE 4H9MA 4IGNA 3BE7A 4RDWA 1R9XA 3AU2A 3TN4A 2QS8A 3LGDA 4ERGA 3UBPC 2R1PA 4C6IA 1S3TC 3GIQA 4JOMA 3GU1A 1V4YA 1M7JA 1O12A 3URQA 3CAKA 2W9MA 4B90A 3S2JA 3WYZA 4XD3A 2E25A 2AMXA 4GC3A 3E0FA 4LAOA 1FWCC 3PBMA 4KIRA 1I0DA 2R1NA 4B91A 2ADAA 1GKRA 1WXZA 2Q01A 1YIXA 4C65A 3IGHX 2YB4A 4XAGA 2GZXA 1FWGC 2P53A 4Z42C 3K4WA 3NQBA 4J5NA 4CNTA 4QS6A 4PBFA 4RDZA 5FSEC 1KRMA 4D8LA 1YBQB 1YNYA 3EWCA 4I6VA 3LA4A 2OQLA 4DO7A 1A4LA 2ICSA 1KRAC 2PUZA 3UR5A 3LY0A 3S2NA 1A5KC 5FSDC 4QRNA 2Y1HA 5E5CA 2VM8A 4LANA 3KM8A 1FWDC 2DVUA 4GXWA 3QY8A 1YRRA 4CEXC 2YXOA 3QY6A 4C6JA 3ITCA 1VFLA 4WGXA 1ADDA 3GTFA 3PNZA 3AU6A 1UIOA 3N2CA 4H00A 3UR2A 2QPXA 4QROA 4R85A 3HM7A 3TN5A 2HBVA 2PLMA 1PSCA 3MSRA 4IH3A 1J6PA 4WHBA 3NURA 2GWGA 4B92A 1E9YB 1RA0A 2GSEA 5LXXA 2A3LA 4MUPA 3A3WA 3G77A 4C6FA 2Z7GA 1RAKA 1RJQA 1HZYA 1P6CA 4CQBA 4H9TA 3QGKC 4R7WA 4ERIA 1UIPA 4BJHA 4GX9A 2OB3A 3FEQA 4G7EB 4J2MA 3ORWA 2PGFA 4H9VA 4DIAA 5CH9A 1NDWA 3LU2A 4GY7A 3E2VA 1J6OA 2FFIA 1NDVA 3RCMA 2FTWA 4IG2A 4C5YA 4G2DA 2FVKA 2QT3A 3PNUA 2I9UA 2D2HA 1QXLA 3O7UA 4H9UA 4GYFA 1ONWA 3GU2A 3IRSA 1P6BA 1K70A 1POJA 1O5RA 1V79A 4DNMA 4GX8A 2HQAA 3LSCA 4XAZA 4EPEC 4H9ZA 4EPBC 3GUWA 3OQEA 2EG7A 4DLMA 4C6OA 4V1YA 1V77A 1EJSC 2D2JA 2BB0A 4F0LA 3LNPA 3RYSA 2G3FA 3S2MA 2Q09A 3WMLA 4EPKA 3E38A 3URNA 1PB0A 2FVMA 3UPMA 3T1GA 1A5MC 1RA5A 4INFA 4KETA 4KF1A 1EJVC 4CQDA 1FWAC 3MDUA 4LAKA 1A5NC 1K6WA 1EZ2A 1IE7C 5A6TC 4C5ZA 3URBA 4IGMA 3B0XA 3D6NA 2Z27A 4CEUC 2F6KA 3FDKA 4IFOA 1NFGA 1RK5A 1XGEA 4KQNA 5AKQA 2DVXA 2R1MA 4F0RA 4C6DA 4RDYA 4AQLA 1EJRC 2Z4GA 4RDVA 4C6EA 1GKQA 3LSBA 2UBPC 3HPAA 4H01A 1POKA 2GOKA 1EF2A 1R9YA 4OFCA 4C6NA 2YZ5A 3OOQA 3LGGA 2O4MA 1EJUC 3URAA 3TNBA 4C6QA 4AC7C 3SO7A 3MTWA 3IARA 5HMDA 4BY3A 4DYKA 2FTYA 1UBPC 1P1MA 1A5LC 3F2DA 3GTHA 4C6LA 4IQJA 4CQCA 4M51A 1XRFA 4DI9A 2PGRA 1M65A 2PAJA 1UMLA 2XIOA 5HMEA 4IFKA 4IG2B 4ICMA 4QSFA 3F4CA 1XWYA 3TN3A 1NDYA 1ITQA 3OVGA 2EG6A 2I5GA 3R0DA 1EJXC 4F0SA 2DVTA 2Z29A 1RK6A 2E1WA 4P5UA 2YB1A 2HNHA 3C86A 2UZ9A 2WM1A 2D2GA 4NP7A 4ZSTA 1RJPA 3MKVA 4GK8A 4UB9A 4PCPA 3OU8A 4XD5A 3SFWA 3A3XA 4R88A 4LALA 4XD6A 2EG8A 2GWNA 1FWBC 3IJ6A 3MDWA 3MVIA 1J5SA 1M68A 4C6CA 1EYWA 4DZIA 4KESA 2ZC1A 1FWEC 4GBDA 1FWJC 4C6PA 1ITUA 1J79A 3DCPA 4HK7A 4ERAA 1PO9A 1FWIC 4GY0A 2HPIA 4KEUA 4XAFA 4IFRA 4H9XA 3UF9A 3GIPA 2VUNA 3CJPA 4GOAA 2R1KA 2IMRA 3GTIA 3AUOA 2Z24A 4KERA 4L9XA 2Z00A 2HPMA 4YIWA 3OODA 1PTAA 2AQOA 2Z25A 3OJGA 3T8LA 3S4TA 4L6DA 3B0YA 4XD4A 4PE8A 3IV8A 4CNUA 1A4MA 3WZ0E 2WJEA 3MJMA 4RE0A 1FWHC 1KCXA 4TQTA 3T81A 4CNSA 1K1DA 3EGJA 4I6KA 4C6BA 4H9YA 4C60A 2QVNA 4XAYA 1RJRA 1ZZMA 5HMFA 4ZSUA 1BF6A 3E0LA 3TN6A 1GKPA 2RAGA 3RHGA 2VR2A 1ONXA 2P50A 4V1XA 3GU9A 4E3TA 3K5XA 4QTGA 3IACA 1JGMA 1DPMA 1EJTC 2O4QA 3GRIA 4EP8C 3E74A 3PAOA 1V51A 2OOFA 3ISIX 3HTWA 1XRTA 2VC5A 4C6KA 1FKXA 1FWFC 2Z2AA 3O0FA 1KRBC 3MVTA 2Z2BA 2OODA 4DI8A 3DUGA 4IFKB 4PBEA 3F2BA 3EWDA 3F4DA 1E9ZB 4WVXA 1I0BA 1YBQA 2HBXA 1QW7A 3F2CA 4NG3A 2VHLA 1EJWC 3K2GA 3NEHA 4HA0A 4LCQA 4LCSA 4G7EA 3RN6A 4HK5A 1KRCC 4DZHA 4C6MA 4PCNA 4NI8A 1YMYA 3DC8A 1NDZA 3GTXA 4DLFA 3GG7A 4UBPC 3FDGA 4QS5A 2AQVA 4KEVA 3V7PA 4LCRA 3QY7A 2WJDA 2ANUA 3JZEA 3MPGA
chains in the Genus database with same CATH superfamily
1AUSL 1VH7A 3VIIA 1RD5A 3H4XA 3KUMA 4I5XA 4A21A 2ZZ4A 2J25A 4GPNA 3KOYA 5FKYA 3ABOA 1FTXA 3ZVHA 3C0LA 4NNCA 3ZWTA 4B3ZA 4JTFA 1H60A 1S5NA 1G0CA 4HA3A 1R9ZA 1QDSA 4WXYA 2JE8A 4RV8A 2Z28A 3H24A 4MY9A 1Q6OA 4G9PA 4JQ3A 3E49A 3VIHA 4XX6A 2ON3A 2FPTA 3OHIA 1UP2A 2E5DA 3LGDA 4ONVA 3MS8A 3MI6A 3PB0A 2YL5A 2BNJA 3UXLA 2R24A 3EEZA 2ZYFA 2FIQA 3QZEA 5D02A 2E3ZA 2NW0A 4JL2A 5AZ0A 4C65A 4P2VA 4XAGA 4OT7A 5LYRA 5C2CA 3ITTA 3M0IA 3WQ8A 3KS6A 4ZENA 1F9CA 1RQEA 1JYWA 1YBQB 3UWQA 3MHFA 4RXGA 1XLDA 4DWSB 4ZMGA 4XO6A 5HNNA 3LRMA 3EB4A 5A6LA 1X97A 1LG2A 4D8ZA 1LP6A 3CHVA 3K8LA 4CEXC 1TVLA 1V03A 1PBGA 3EX3A 3ITCA 1VFLA 1SO6A 1GTEA 3P82A 4PRTA 5EBUA 1BLIA 3TCEA 2KX9A 4IPJA 2VCBA 1KXVA 4ATDA 1XLFA 2HBVA 5LA2A 1ISZA 4Q6XA 3W76A 1OFRA 3PJTA 4ML4A 4JTGA 3AISA 2GWGA 2TPSA 1ONRA 3WDIA 1RJQA 1EA0A 1XBYA 1Z44A 3PG8A 3VZXA 4QQ3A 1JNDA 5DY2A 2OB3A 4AAJA 5C7HA 1UWRA 3L21A 3VINA 3C0JA 3AOFA 3BAYA 2PU1A 3GC5A 2RDXA 2BZNA 2J62A 3R11A 3ALFA 1AQMA 4AHOA 5JU6A 1UKOA 3RPTA 2J74A 2CCRA 3EOSA 1A0CA 4L5ZA 4XSLA 1WBHA 3SN1A 1LL7A 2Z1SA 1TREA 3GO2A 1DJIA 2NT0A 3QW4B 4ACZB 4XIAA 1J93A 1IXPA 3UG8A 3DFNA 4Q32A 2ZRVA 3SQSA 5JXQA 1H1YA 4PRRA 1DE5A 1FY6A 1F05A 2FVMA 3DOPA 3WLMA 4KIEA 4ZB0A 2R8WA 5HDRA 4MLJA 4UTLA 1OFQA 4FX7A 4KETA 1XLCA 2XFWA 4PUEA 1DIEA 1N82A 1JDDA 2ODOA 1LJYA 4E4PA 3FDKA 2D0FA 4GINA 5EL1A 1DJWA 2R1MA 5A6KA 2PTZA 1M5WA 1GKQA 3GR8A 2PWGA 1W1YA 1POKA 3LDVA 2JBMA 3NJ3A 2EJAA 1UZ1A 1GVFA 2GSJA 3GHTA 2OX1A 3TYEA 3DHUA 3HQPA 1DORA 4Q7IA 4HTYA 3ES7A 4B16A 1PTDA 2F9RA 1MXGA 3V5CA 7REQB 4QG6A 1O4UA 4WY0A 4UNLA 5FEZA 1JCYA 1NU5A 3P93A 4X2RA 1JCNA 3M46A 3AXKA 4AXKA 3VIFA 3NDYA 1K03A 3EWZA 1ZALA 1S1RA 1TCDA 2XINA 3HV8A 4MDOA 1RK6A 4NU7A 1ISXA 2EPMX 4P5UA 3NQ8A 3QRHA 4QG8A 3ZIZA 3IUDA 4IX2A 2NLYA 4PCPA 4WKFA 4E5TA 4PSPA 5F4WA 1EIXA 4MZ8A 3C2RA 4ZXLA 1QWKA 1CECA 4G56A 1XG3A 3TMQA 2WZIA 3NZPA 1W3KA 4I9JA 3PBYA 2CIPA 5C0QA 3OQ8A 1J5SA 4FF7A 8CGTA 2VZTA 5KMYA 1SFTA 3R0KA 2ZE0A 3AXXA 2Y62A 1CPUA 1FWJC 1HJSA 2J7HA 3CQKA 3QR3A 5CBJA 3H54A 3CH9A 3H6OA 3UXKA 3W1MA 1CXIA 1UD8A 3M41A 1JZ7A 3L12A 3K4AA 5G1MA 2HPMA 3W7NA 2WCAA 1K77A 2OTDA 1PTAA 2Z25A 1DYSA 1MW3A 2EXOA 2G4FA 1LQAA 2ALDA 1MZRA 1UBSA 2WJEA 3B97A 1V6TA 5AN7A 2HVOA 2VGIA 3MZ2A 3NXLA 3DKJA 1AA1B 3RHGA 5LZLA 2SFPA 2VFIA 3MA8A 3VXGA 4EP8C 3RCNA 3IIXA 3A4AA 4NY2A 1IZCA 4DELA 3PC0A 2HROA 2FB2A 1DWJM 1CLKA 1I75A 1YE4A 2D23A 1BTCA 2Z2BA 3L7RA 4XO7A 3M5ZA 1LOQA 1TPUA 3HPSA 3S6TA 1KC7A 1YBQA 3W1RA 1Y0EA 1ICSA 4NILA 4IQLA 3WJWA 3RN6A 3HQ1A 4C6MA 3FSTA 5KETA 1K7XA 2G4JA 1UR0A 5TF0A 3WLJA 1NH6A 1YMYA 1AW5A 1B31A 4PEEA 4PMQA 1E4IA 3BARA 3GIYA 3T78A 3FCPA 3BPWA 3SQMA 4QEHA 4LQ1A 3E3HA 3WDHA 5D32A 3HU7A 2ZUVA 4JFWA 1X1ZA 1V7YA 5DF0A 3ITOA 2FKPA 4UTKA 1ZRQA 3BDKA 1E73M 2VC7A 3W37A 2WJFA 2YDAA 2PGEA 3ID7A 3EXTA 2YIHA 3PZIA 4Z0SA 2I56A 1KXHA 1K3UA 3VPLA 4HJWA 1P7TB 2BBFA 1JPHA 4AWUA 3FVMA 3AU2A 1YLVA 3SN4A 2PBGA 4JOMA 4WKHA 4Q8OA 3EWWA 3UFYA 1TSIA 3G24A 4X3ZA 1B30A 4OECA 4UXDA 4FZIA 3BAWA 2R1NA 4FF5A 1F3XA 4OU1A 5FF3A 1DIOA 1H1ZA 3C8NA 4GJ1A 4ZB2A 1KXQA 2PF0A 4FNRA 3PY2A 3TYUA 4NJJA 1TG7A 2H3BA 4DO7A 3GKFA 1E1CA 1S2TA 2BVYA 5D30A 3ZS4A 1BAGA 4P8UA 3BGGA 5IRPA 1ISVA 3G3MA 4GABA 4C6JA 3V5FA 2WPBA 1GVIA 3WH9A 3PB2A 1JYVA 1UIOA 4E38A 3QYSA 1K7EA 4N4PA 4AUBA 1TVPA 1OEPA 4PRWA 4GO9A 4AY7A 2CEQA 2V5BA 3NURA 4K3ZA 5HQMA 4A6GA 3G77A 4PMRA 1RAKA 4S2CA 3TAKA 4CD5A 3L5LA 3RPMA 1QNRA 1EO5A 4AZ5A 3CUFA 3D46A 2Q71A 3ZR5A 3LTSA 1T96A 3LEPA 2DZBA 5E6ZA 1S2CA 3M5YA 1KCZA 4NX0A 8XIAA 2VQUA 3A5FA 5TNVA 1FWRA 2V3EA 1J0YA 3L4UA 3M0HA 3N9SA 2GL5A 2VZSA 4NKCA 3OGSA 2QT3A 1TR9A 2BHZA 3I65A 3USZA 5A6JA 5HR6A 3OTRA 1WB0A 3KOZA 1HJVA 2FB3A 2BY1A 5FF2A 2V5DA 1C90A 1IIHA 3GSMA 3BXWA 2VX4A 1OD0A 1QI2A 3GNDA 4Q8VA 1LYXA 1EXBA 3UG3A 3RNDA 5AYIA 3S2MA 4X9YA 3EAUA 1SJBA 3PZNA 3GXFA 3GS6A 3T1GA 3CHEA 3OVQA 6A3HA 3TTQA 3WK3A 1JZ6A 1VD6A 3N3MA 1UB3A 1Y5XA 5A6AA 5A8GA 3SCVA 3LM3A 2BXVA 1UD5A 4JTSA 3EX6A 2DQXA 1EWDA 1H7WA 4ZFMA 3BSMA 2UBPC 1T99A 1XIBA 4HNTA 2ESCA 2V2HA 3OBAA 3T7VA 3BLEA 3PZOA 2YZ5A 2ZUNA 3ATZA 4H6EA 1B4EA 4J2PA 1YYAA 1W1A1 3M9YA 3V0UA 3A4XA 2CZDA 4CN4A 3IAPA 5CEWA 1UROA 1P1MA 1KFLA 1V0MA 4HNCA 1UJQA 1RLCL 4O1EA 5ABHA 3GDTA 3W84A 3THUA 4UFHA 3OVGA 5GNZA 4K8EA 3SSJA 4F0SA 2WMJA 3LRKA 1AQ0A 5H8PA 3WX7A 1E4LA 3W2NA 3KP0A 4ZR8A 2V81A 2YB1A 3CNYA 4EF9A 1FWSA 4ZOEA 5A6SA 4GK8A 2JKPA 5LIXX 3IAQA 1KFJA 4AD5A 1EPVA 1SU5A 1W37A 3O6AA 3KWXA 4O1DA 4AIEA 3T0DA 3B8WA 1R3RA 1B3VA 3I6TA 4AF0A 3V3WA 2CETA 2Y88A 3DDMA 4GNVA 1JD9A 1MEIA 3GXMA 3WH8A 2X1UA 3T07A 3HG3A 5G4WA 5ABGA 3WQFA 4BQ2A 1OYBA 3MCOA 1ZPTA 3EMCA 1HJWA 7REQA 1I45A 2W91A 3GIPA 3AIUA 3G18A 3GTIA 3G3DA 3MUXA 1NFPA 3P84A 4XUGA 3NQEA 3GTNA 3R8RA 2WCGA 3ITVA 2X41A 4OJYA 2HWGA 4JFSA 1I2RA 7TIMA 2NT1A 1Q45A 4ZVJA 4ZB5A 4M81A 5TD4A 4WOQA 1SJAA 1LQ2A 1PX8A 1TA3B 2NWRA 3M0KA 4MGGA 3L5AA 2BOFX 1JRBA 2VOMA 4FALA 1KCXA 2WV8A 3THCA 1D3CA 1NQKA 1XYMA 1DOSA 1OCBA 3ARVA 5HQEA 3TW9A 4MSSA 3WQCA 5FL0A 2QDGA 1DWFM 2RKXA 2ABBA 4G7FA 1NOFA 3PPHA 1XGDA 1SW0A 4TUFA 4JNMA 1D7FA 2PTYA 3I7SA 1Q66A 2DSVA 3R7MA 4JD4A 3K2GA 3CZEA 4QAWA 4P7NA 3N2OA 1J9YA 4XZBA 4QISA 4J3SA 2JIEA 1UWAA 4A35A 1AD4A 2GDQA 1MI3A 3P6LA 1F3WA 3G22A 1W32A 1SJDA 4LPCA 3ZM8A 1ZENA 4LUIA 4HGXA 1IEQA 1EZWA 2VYOA 1CI1A 3JZEA 3MPGA 1ZP3A 4AYGA 1W1IE 1DIDA 5LIUX 4NAEB 4DBSA 2RGLA 3JUGA 4UTWC 3PFMA 3SY8A 3FFSA 1RLDA 3WK1A 3SCTA 3LS9A 3QGAC 4QX4A 2VWSA 2VTFA 4Q8TA 4RZBA 3WQEA 1SFJA 2P0OA 1MWOA 2WHKA 1CGVA 3RLGA 1K4GA 3BE7A 2UY4A 1XL9A 4FOKA 1W8GA 2MANA 2E1DA 3WF3A 4DNHA 3H8AA 4RKAA 2WCSA 4IJCA 5HUOA 3NQGA 1TTQA 3KCLA 2DH2A 5FAJA 4MKVA 3E0VA 3LX9A 1AL7A 1I0DA 3F4NA 1LL4A 1W9UA 1XLMA 1GHSA 2P53A 3K4WA 3WL1A 3NQBA 3SM0A 3MY9A 2WMIA 3NQ2A 3AWNA 4F8XA 2HJPA 1W17A 4UTIA 2WM0A 2PWDA 1OCNA 2QUNA 3V16A 4CCDA 3W2MA 4JY8A 1S46A 3STCA 4Z08A 1EUAA 2PGWA 3TTOA 1QNOA 1M41A 2PFHA 4LANA 2ZVRA 2OCZA 3KM8A 5HULA 3H53A 5C9WA 3N25A 3KW3A 4AEOA 3F5JA 1HXJA 2VJXA 3QY6A 2VGGA 3EMQA 4PN2A 1KO0A 4LAZA 4OHQA 3NQCA 3B8IA 1XCXA 3BAIA 4EVZA 5U4NA 2IPFA 1P48A 1XR2A 4LEQA 4L6HA 3A5VA 4FS9A 3MSRA 1R8LA 4DYEA 2CBJA 3U2ZA 2J4GA 2GSEA 2V6AA 4Q6JA 2VD8A 3UWUA 3AI0A 1IYXA 1V6VA 3PBVA 2QULA 4TX8A 4KCWA 2A7PA 3BQ6A 4IUGA 2XH2A 2XN1A 1R47A 3I3EA 4A8IA 1P0DA 2P76A 4BF5A 2CZEA 4U3CA 1TCMA 3WF2A 3GBDA 3NQ6A 2ISFA 4O12A 3HO8A 4GY7A 4JTDA 4MKNA 1SW7A 4UOQA 4IG2A 2OMAA 1A3WA 1QXLA 4O17A 3VOIA 4I90A 1QCWA 1VJZA 1DTNA 3AHVA 5I79A 3E0WA 3WD3A 4H9ZA 4NZ5A 3IANA 3JW7A 4Y9AA 2ZZ1A 2FVLA 3W3OA 3W83A 3GUWA 4UR8A 1N8WA 2YGYA 3RYSA 3QM3A 1KQYA 2Q09A 3E38A 2YBVA 4BHYA 2WWDA 1WBJA 3F5LA 3PZUA 3ME3A 1VBRA 4INFA 4WD0A 4DX3A 4K7VA 4CQDA 1SO3A 2HISA 4JTHA 1YDVA 4E4UA 4F0KA 2BY3A 1L6FA 1EQPA 4HHPA 4Q8PA 3UG4A 2ZX7A 1BD0A 1LLOA 2DVXA 1TE1A 3M0ZA 2ZZ7A 5C9RA 4JTTA 5LIWX 5D2WA 2YL9A 3WQPA 4S3JA 2VMFA 5AC5A 4M6QA 5E9XA 4KRUA 3TNBA 1VEMA 4C6QA 4I8YA 3FJ4A 5LIYX 4Y9PA 3SEPA 3YPIA 3KVMA 2YL8A 1WAWA 3TSMA 2ACRA 3ONCA 3E12A 1GPWA 4CCEA 4IQJA 1RSCA 3HMCA 1UMLA 3FAWA 4KRZA 1C9WA 1KGWA 5HNRA 1BGAA 3TN3A 5A1AA 2EG6A 3R0DA 1EH9A 4CD6A 1YKWA 3NZQA 1W3TA 3V4BA 4IUOA 4H8HA 1W2PA 4ZSTA 1LROA 4RNFA 3KRUA 5E0KA 3A3XA 2VENA 3H2NA 2GJRA 1CEOA 1JL8A 3NL6A 3CV1A 5ECVA 2OLSA 1CLXA 2QUTA 5DMNA 3WQDA 3SB0A 1E4NA 3H21A 3ARZA 2ZCGA 4FLQA 2DSKA 4XAPA 4LRTA 3N14A 4GKTA 2WSQA 3TW7A 4Y9NA 3LZ3A 1B9ZA 1YW1A 2XGBA 3NM1A 3S5NA 4H7VA 1QHPA 1PO9A 3IWPA 4OBSA 1E6XM 4B9YA 4XV0A 4BS0A 3WJXA 1OC7A 3AUOA 1JDAA 5JIPA 4XVEA 2BOEX 4FP1A 2PMQA 1XPYA 1XLJA 4DBWA 4DWSA 1EHAA 1OT2A 3DYPA 1GOQA 1F3EA 4KWVA 3C61A 3B9EA 1Q6QA 3EDJA 2I1OA 4XAYA 4NRSA 2NWSA 4OUEA 5HAOA 3CWNA 1OX5A 3GU9A 4JYEA 1RP8A 3P0XA 3G1XA 4FR1A 4UFKA 2YLAA 4JY9A 1ZAJA 4PTVA 3UZWA 5J04A 1C8YA 2EPLX 3OPSA 2FHFA 1TQJA 3BUVA 3UPWA 4JDYA 1QNPA 1UWIA 1RQBA 3CGTA 1ODUA 1M3UA 5I23A 3W2KA 1KRBC 1V6XA 3SBFA 3ATYA 2PDHA 5GJMA 3MHGA 3L4YA 1V6YA 4O52A 4HOXA 4PUKA 1EC7A 3W7MA 4XBSA 3WMSA 4A22A 3TIMA 3TP4A 1THFD 4C1NA 2E9BA 3DC8A 4J3WA 4GFSA 2R6OA 4OKDA 4DXXA 4PUJA 1XICA 1PS9A 3WNKA 1SZNA 2PCQA 3GG1A 1TV7A 3APYA 2QKFA 2PDXA 5BWFA 3IEBA 4MZYA 5G4HC 3S2LA 1GYLA 2E8YA 4BK9A 3QXBA 3ANVA 1QU4A 2CZVA 3A4JA 1GOIA 3OHMB 4KCUA 4LFYA 1UC4A 3WLHA 1ESWA 1RBAA 3WMBA 3MUCA 5CLWA 1CW2A 3QHOA 1R9XA 4GNKB 3CUZA 3EX1A 4IIGA 3WLTA 3T40A 3DFQA 3WQWA 1M7JA 1PHQA 4YTSA 4GLEA 1YTEA 4MB1A 4WUIA 3GNOA 3KLLA 3WKZA 1P43A 3GDRA 3W7KA 4DJDA 3BAXA 3DX5A 3OW1A 3QPEA 1LOSA 1ECQA 1LBFA 2JKAA 3QFEA 5FSEC 1R0MA 1AVAA 1A5AA 3QKZA 2F6UA 5CZSA 4GGHA 2PDKA 3E2QA 3NIYA 1H7PA 2XGZA 4CD8A 4HNUA 3O15A 1MXDA 3WNPA 2QUVA 3BOFA 1VKFA 3G0SA 3B9NA 3W6MA 3LOTA 3CAWA 1RY8A 2VRQA 5D8ZA 3HM7A 2GJXB 1BG4A 1ZBKA 3LUTA 1DJQA 5I3KA 1ME8A 1J6PA 4WHBA 4ICNA 4B92A 2OEKA 1VHNA 3ARPA 2WYSA 3QN3A 2XH0A 2A21A 1P6CA 3E2RA 1XIHA 3THAA 3W7JA 4GCAA 5FL1A 4D6CA 3BSGA 3O63A 3O0KA 3FW6A 4B5WA 3MANA 1E51A 1SZEA 3ZOAA 1ONWA 5LHFA 4A05A 3GUGA 4FLOA 5IHRA 1V79A 4XTIA 5MF5A 2E67A 5ABFB 2BY2A 3R12A 3VZZA 5FEXA 3ITYA 3W88A 1FVPA 3MUAA 4QJ4B 4GO8A 3TU9A 5FJPA 1QRQA 3FIGA 4H3DA 3BCDA 2CLFA 1ZJIA 1ZB5A 3HOJA 3QV6A 1RD6A 4RNHA 4E0CA 5LKYA 1VJSA 1O60A 5BWAA 4LW7A 4M7TA 4BR1A 2Z27A 4ROPA 2HZGA 1JDEA 1GVEA 4KQNA 4FNQA 1QFEA 3NGJA 3EDDA 3OVRA 5C2XA 1UWTA 2QGYA 1HTIA 1GVOA 4RDVA 1KWGA 2B7OA 4OFCA 3TONA 2OT1A 2DZPA 4BEQA 2D20A 3O6CA 3S0CA 1TTPA 2IKGA 5IOBA 3NNTA 1GZGA 4DYKA 4QSHA 1A5LC 2J7EA 4AY1A 1HL9A 3MMUA 4UZSA 1OJXA 3UPBA 5EY5A 3N2BA 2OPJA 2QJGA 2HNHA 1FWTA 2BFGA 3TOYA 1P7TA 1TFVA 4K68A 2I9EA 2BASA 3TE9A 4EWJA 1XIJA 1CXHA 1XLAA 2HEJA 2XUCA 3TQ0A 2PP1A 3RAOA 5KZ6A 4S3BA 1IEXA 4PMJA 5A69A 3CQJA 4JQ4A 2P10A 2QVHA 4W4QA 3SFKA 4IXHA 3I3BA 4KESA 2YXXA 2E6DA 3WBYA 2QLYA 1XCWA 2PCEA 3ZSSA 2CLMA 3RLHA 1XINA 4QJ3B 4OBRA 4JHZA 1ITUA 2G41A 3DCPA 4ZO7A 2D1ZA 1W3NA 1YDYA 4EAYA 4GBUA 2IUZA 1UQZA 1CGUA 1ZLPA 2G5WA 3CV2A 3TV8A 4DPQA 5JMUA 1H7NA 4TVUA 4FLSA 2PSNA 2FZNA 4DJDD 1GUVA 2GUYA 1HL8A 1SO4A 1JFHA 3V35A 4DM2A 4O57A 3HG2A 1IWAA 5I02A 3VM7A 3WZ0E 5AB3A 3AYRA 1GEQA 5CG7A 2ZX5A 4F9DA 3M7WA 2ZQ0A 4U2ZA 4C60A 2QVNA 2J6XA 2HXTA 2W63A 1UWUA 5CG0A 5DFAA 3BLLA 2Y7FA 3WDQA 3EDEA 3AALA 1R6WA 3E74A 2ZXQA 5CGQA 4ZQPA 1CTNA 1A0EA 2GVEA 2OFJA 1B3YA 4PR4A 1PTGA 1O68A 2VC5A 3VM5A 3EEGA 2H8XA 3KBNA 2BLEA 2YJQA 3M5XA 3F2CA 4XBKA 2NXHA 4LCQA 4XISA 4Y9MA 3W9ZA 5EMMA 1GW1A 3NYDA 4PCNA 3LPGA 4MOZA 2GGHA 3M5VA 4H8UA 3ZYZA 2XIIA 1I60A 3IS4A 3GHSA 4FEZA 2ANUA 5J5RA 2C1IA 3VD5A 4XTDA 4S3CA 2IKIA 1S2UA 1TJ0A 2GLKA 1JCTA 1UC5A 2X2GA 4Z1CA 3C2YA 4GZ7A 4MYAA 5DEZA 4I7WA 2QV5A 1GZ1A 1AZ2A 1XF0A 4X0VA 3VOHA 1RP9A 3MKKA 1R2SA 2WW5A 1FKWA 3G1RA 4A3RA 1GGOA 4B15A 2BGNE 3SRDA 5HNTA 1ODZA 2EPKX 4N9BA 4ERGA 5GJNA 3B04A 2YCKX 4UQAA 1JYXA 4BWLC 2WPGA 4JHOA 2DJXA 4XVDA 3S1XA 3QMSA 1N8FA 3LLDA 4LB3A 3J7HA 4JKKA 1PIFA 2W61A 3N9KA 1WX0A 3HA1A 4S3EA 3M16A 5DO8A 2A3AA 3E0FA 3G5EA 4R33A 4MY8A 3TW6A 1IEWA 3S3GA 2ACSA 3VVGA 2VC9A 4R34A 2H9AA 3AIEA 2QPUA 5CSYA 4JYDA 3DGRA 4H7ZA 1OCJA 4MY1A 3L0GA 3KEHA 1L6YA 1EIBA 2CHRA 2GQ9A 3GDMA 3AHZA 1J01A 3U48A 3PS7A 4LAUA 2A5HA 4ROQA 4W8BA 3NO1A 1O5KA 3AS2A 3QY8A 3M0VA 5H91A 4HA1A 1E1FA 1S5WA 4LC8A 2PDGA 2PP3A 1CXEA 1ADDA 4YU1A 4AVFA 2GSHA 3FJ6A 5FI8A 2WK2A 2RH9A 3TKFA 3OG2A 1E9YB 2A3LA 3N11A 3GDBA 3OYZA 3PZGA 1VYRA 3C2OA 3KLKA 1W6TA 1MW0A 3D3FA 4Y8EA 3IGXA 5M5DA 4FNSA 4CQBA 3P61A 1VP5A 3OIXA 3QGKC 2VT0A 2Z1BA 4PSRA 2WVVA 3VFLA 3HF3A 1OADA 1GT8A 1PCWA 2OJPA 1DJXA 1WV2A 3LENA 1AD1A 4IOTA 4WX2A 2O0TA 2E77A 4QAIA 3RCMA 2VEPA 4IZGA 1R85A 4JTLA 4JIIX 1SQ7A 1XM3A 2FYMA 5AC8A 2FVKA 5H2ZA 3PNUA 2D2HA 3TYZA 5I2UA 4NASA 4YYCA 1GOKA 2NVAA 4F0MA 3TTYA 2DSWA 5KZMA 4WSHA 1AJ0A 3W1LA 1KM2A 4HU3A 3ZR4A 1N8IA 2YPIA 1S5TA 4GUJA 1V77A 2PDNA 1TRIA 4LB4A 1T0OA 5JVLA 1UR8A 2J79A 3BWWA 2EKGA 2F2HA 4IJBA 3RUBL 1OFBA 3OGRA 4U10A 3TNOA 4EACA 2ZZ3A 1XBXA 3NQVA 4MPKA 3RO6A 3SGZA 4W7VA 3UA3A 1UA3A 1EZ2A 1H5VA 3HV9A 4G6CA 1Q7ZA 2WKGA 5I3GA 3FA3A 1NFGA 2BVTA 4HN8A 5RUBA 1U5VA 1UUMA 3HJEA 3RR4A 3V0SA 4IP4A 4TV5A 3ENLA 1FOBA 3Q65A 2WZEA 1EF2A 3REQB 3LGGA 3B8SA 4ZE5A 2QQ6A 5DLCA 1H7XA 2CERA 3GW3A 3VKAA 2OG9A 3WNOA 4Z2JA 3BZJA 2DSZA 5H1WA 3WNLA 3NXFA 4MM1A 5HMDA 1OM0A 1Z32X 1UBPC 4N02A 4J3XA 3SUSA 3HGOA 4HZ8A 3DG6A 2BV9A 3PZ9A 2PAJA 3GHRA 3B05A 2CBUA 5IFPA 4IMFA 1PZ1A 3ZLFA 5HJYA 1NDYA 2NV9A 2YFNA 4QBXA 4HU0A 5E0CA 2DVTA 3HPZA 1MQQA 3RJYA 4EANA 4TOQA 1TZZA 4NP7A 2YDSA 2J27A 3VDHA 4B2DD 1TZ7A 3SFWA 2D0GA 3W25A 3WBXA 1SFLA 4EWND 3NSMA 3C3UA 1LUCB 3TZNA 1WKEA 3SCWA 1TMLA 3N6QA 4QP0A 3W1TA 2CYGA 1JAKA 4HK7A 3NPXA 1Q6EA 4AZ7A 3KCJA 3UJRA 2PDWA 1GJUA 3VO0A 1V3KA 1BWLA 3C4UA 7PTDA 2F6XA 3ZVIA 1T6MA 3QVQA 4UOJA 1BVZA 2JGYA 2AQOA 4O11A 3WEZA 1C8XA 4REQA 1EGZA 4UQBA 1JI1A 4K8GA 5FEWA 3W82A 2L5HA 4MJ2A 3VMNA 3AXHA 3B03A 3EDFA 5BRPA 2B7QA 3MT1A 3LCXA 1NIUA 1I9CB 2D2OA 1CT5A 4H1ZA 4D2JA 1MW2A 3WFZA 3VNZA 1WKYA 4A8NA 3LCIA 1VB9A 3ARYA 5DMLA 1SGJA 3QF0A 3NPUA 5E6YA 5G5IA 4HZMA 1AJ2A 1RH9A 4D6EA 4HU4A 4LWWA 4BZYA 1HKWA 2WKLA 3UJ2A 5A94A 4BF9A 4A8LA 2A79A 4KT2A 4UTHA 2Z7KA 3F4DA 2I17A 4A3UA 5E93A 1BTMA 3S8HA 1BSIA 3IJLA 3N2MA 4B5UA 1C7TA 3MZNA 2UWFA 3PTMA 2G3NA 4AD2A 3OLIA 1NSJA 4B5TA 1HIZA 1OC6A 3QBUA 3EOLA 2E0PA 2QJHA 2C79A 5EMJA 1IEVA 3FDGA 3GX9A 2DT1A 3N29A 3R58A 1U5JA 3G1HA 2OZ0A 3R10A 5LNWA 3UXAA 1QOXA 4PB4A 1OGBA 2OX4A 4ZCWA 3UNTA 1EFZA 5IDZA 1HF6A 4CN1A 1W5PA 5EU9A 1C91A 3FKKA 4H6KA 3IIOA 1WAUA 4XSMA 5KTLA 3A23A 1L6WA 1X1NA 2FPVA 2HVMA 3RCYA 2CLKA 4QDPA 4G5DA 3L5MA 3UYIA 4ALDA 1GOXA 4Z1BA 3LBOA 4RDWA 1E1CB 4S23A 4TX6A 2Y2WA 4IL0A 4D6GA 4GG9A 3ABQA 3CPGA 1ISYA 1OC5A 1FXPA 4UTTC 3CAKA 6ALDA 3HG5A 2J9ZA 3W22A 3AS0A 2C1GA 3AIVA 3N13A 4XD3A 4AFYA 1DP0A 2AMXA 3PM6A 2X16A 3W2JA 4EXBA 5HWNA 1VQTA 2VQTA 5A8NA 4L4PA 4EE9A 1TUFA 5I3DA 3KVLA 3EMZA 1KGUA 1G9HA 4K37A 4RW3A 1QT1A 3W27A 4QS6A 1UWQA 1KKOA 4JTEA 1GVYA 5JUVA 1M01A 3P2VA 2WVUA 1S5VA 3BLOA 3PUOA 4A4AA 3KRZA 2E6FA 1XSIA 2F2KA 4BEUA 3MI3A 1F73A 1EC9A 4JX6A 1W1VA 4RNIA 2C15A 4GWEA 2DZSA 3CTLA 1V3JA 5C5YA 1F74A 3BLPX 2QF7A 1SPQA 4S38A 3N4AA 3DYMA 1W3JA 4QGCA 2IW0A 3VNLA 3DERA 1I2OA 2CFFA 3VNMA 1W3IA 3B8VA 4IMCA 1ZTVA 4IJRA 1RA0A 4UR7A 2PDMA 4GUFA 1V5XA 3FEMA 4RE2A 4CGTA 1E3XA 4LF1A 3WF0A 2IKHA 3QH2A 3N1AA 4LV4A 1XJBA 4YVVA 3CEUA 3DFTA 3N12A 1RZMA 3WDRA 3MWAA 1NDVA 4KGLA 5FF7A 3CLMA 2HXUA 2P3ZA 1B90A 1V08A 3E6EA 3F7JA 4FXJA 3T8QA 1P6BA 3HQOA 1J0HA 4PUWA 2PB1A 1JCMP 4U5KA 4E2DA 1VFSA 5K9DA 1K02A 3SDOA 4GZEA 4ATWA 3R8GA 4NF7A 5DX7A 1R3TA 4V1YA 2BB0A 4F0LA 3S9IA 3INPA 1JCJA 3HGRA 4KMQA 2QUUA 1LUCA 1FWWA 1TV3A 4BQ3A 2ZRXA 4NAEA 4BWLA 4XBJA 1TV4A 2WO5A 1Q7MA 3W7GA 6XIMA 4LYQA 3ZJ6A 3WBEA 1XDLA 3AIBA 1SSDA 3CZGA 1G67A 1W5QA 2WJZA 3MC5A 5D05A 4GI9A 4CEUC 1D3GA 2R9RA 1S2WA 3GZ3A 5J8LA 2O7QA 2BSLA 4Y90A 3UG5A 1FCQA 3B8DA 2QXWA 4RDYA 4DHGA 1Z7AA 1NELA 1RY0A 2VDHA 5DRCA 1DWHM 2BX7A 5F2GA 1EP3A 4AMAA 3URAA 2OSXA 4W7UA 2FDMA 8A3HA 1V02E 1YNQA 3CBWA 2X42A 4BY3A 2I57A 4ACYA 3B9DA 3UESA 2XZ9A 3AAMA 5TIMA 3QKEA 4CQCA 2WHLA 1LRTA 3RU8X 1Y5VA 1UH2A 3KTCA 4ZQNA 4EK7A 4CNNA 2CKSA 4GA8A 4Q4MA 1EJXC 1DWGM 1FHUA 3VKCA 4CUCA 2VEKA 4IX0A 4Z2HA 4AB4A 2Y70A 4DQWA 3W1PA 4Y6GA 3MMDA 5A95A 4AHPA 2A0NA 2WAGA 1I1XA 4WRHA 3GXTA 5EPDA 4DWDA 1US0A 4I8DA 2OGYA 3W85A 1FWEC 1QI0A 2UY2A 4D6DA 4QE5A 2DV0A 4CD7A 2Z1VA 4U31A 2B81A 4M8UA 3GXPA 5BW6A 4DXVA 2XH7A 1PAMA 3N4FA 2V3DA 2HPIA 1FH8A 3C5QA 3SIZA 4UIOA 4H9XA 1U5HA 1B2YA 2RJGA 2XISA 2WHJA 2IMRA 1UD6A 4KERA 3TJXA 4M0XA 3OP2A 3V1PA 2YFOA 1XRVA 5AYZA 1H61A 5EMUA 1H0IA 4NSBA 2X1IA 2ATMA 4NXSA 2DZXA 2TRSA 1K8XA 4Q8QA 3RITA 3LERA 4PA8A 1TIMA 2QMJA 4V28A 3D47A 5EKYA 2QNEA 3TXVA 3A22A 4YXGA 4GISA 4IP5A 2QCHA 1X8FA 4H8VA 5CGTA 3Q94A 2XG9A 4S39A 3M0MA 4ZOBA 3UCQA 4DUWA 2HS6A 2J24A 3WUFA 3GNXA 1V51A 5BMWA 5CKSA 3GLCA 3PBUA 5FJRA 5PTDA 3W6LA 3PWGA 3PJUA 4R7OA 4KWSA 5CPLA 3BL3A 3RK8A 1DTUA 4LF2A 1UW9A 4JNZA 4NXKA 3VMOA 4YS1A 1HJQA 5HPOA 2D69A 2E5CA 1PDZA 3LI1A 3EOOA 4DZAA 2AL2B 4FK9A 2OWCA 1H0GA 1YPXA 4Z2KA 3B0UX 5C7VA 1J96A 1Q5MA 3NSNA 3ONBA 2AQVA 2WJDA 4JXCA 4QJ5B 1HUVA 1PCKA 4S3GA 2IKJA 4J35A 4FI4A 3FOKA 4GFIA 3PZTA 3W1UA 1IT7A 2EKCA 2YW4A 4XKMA 2IQTA 5GNYA 3TYBA 4AZGA 1TV8A 3O3RA 1G4PA 3MJYA 5D9OA 2BGSA 1E70M 3BMVA 1FH7A 1GQJA 4CQ9A 3CWHA 5E1QA 2YZRA 3QTPA 1WXYA 2IXUA 4M80A 4QITA 1RBOB 2UV8G 4JTJA 1HG3A 4LOCA 2QS8A 3PHAA 3F1QA 1Q6FA 2PWHA 2BY0A 1X39A 3BURA 3GU1A 1IWPA 2BXZA 2DZTA 3MV01 1DJZA 3NFUA 1F2JA 3CYVA 4H7CA 3S1GA 3P7YA 3QR0A 1WXJA 3TQKA 1Z3NA 2VCCA 3IUIA 5BRBA 5CPSA 4GUGA 3MUIA 3L2MA 3CAQA 3LGEA 2Z6JA 1GKRA 3PPFA 2PWFA 2D0HA 4S3KA 2GQ8A 4JHMA 4RDZA 2WOQA 3NAVA 1NQ6A 2R82A 2YA0A 1AK5A 3WENA 2PLJA 1Z8AA 4R27A 4NAFB 1O1HA 2H9AB 2GGJA 1WE5A 4JS3A 5ENLA 1A4LA 1GYNA 2PUZA 3B06A 1R5YA 4QCFA 1LL6A 1OFAA 1QK0A 1K8YA 3S5OA 3SW6A 1ZAHA 1R3VA 2FMOA 5I7GA 5ABEA 3QV8A 3NWRA 2ZX6A 2AL1A 1L2UA 3TA6A 1OCQA 2PS2A 1BYCA 2Y24A 3GTFA 4REQB 3GKAA 3EWYA 3I4KA 3LD5A 3QJAA 3HMJG 3UCDA 4IH3A 3DAQA 2O9TA 2Y6ZA 3XISA 4C6FA 1TPWA 3G1SA 1Q85A 3OA5A 4ZEPA 3THQA 3WLIA 4H9TA 4M24A 1HX0A 2G50A 4R7WA 4MPQA 4R9XA 4NJKA 5L9FA 2VEFA 3DG3A 3W4RA 5DCEA 3M47A 4EF8A 4MMWA 3FXYA 3ORWA 1Q8JA 4F79A 2QR6A 4GE8A 5HMSA 5LIKX 3ARTA 2V8ZA 2FDSA 1EGVA 1XD1A 4ZFCA 5EMLA 4K8HA 3O7UA 4H9UA 3L4ZA 2VO5A 3PR2A 1POJA 3DC0A 5IDIA 4XAZA 3VDAA 1W1PA 1KV8A 4FOJA 1GG0A 3K46A 4JTKA 3TLQA 2FQIA 1V93A 3R25A 2BP1A 3MMWA 2QJIA 3ES8A 3CL7A 5AHMA 3D5HA 5DCBA 4FXFA 4UC5A 3WNNA 4EPKA 1I1WA 1PPIA 2YCLB 2Y5SA 3U4FA 1K6AA 1HKVA 4J9JA 1RA5A 4AMCA 4GQ0A 1Z89A 1GOMA 1LG1A 2DORA 3POCA 1OINA 1XXXA 2J6VA 3RM8A 3O16A 5KINA 4KS0A 4NNBA 3QLLA 4LY4A 1WYIA 2A4AA 3CT7A 2A3HA 2F8QA 4OVXA 5AKQA 3LPPA 3G6MA 2WWCA 3V1HA 4DEFA 3R5EA 4C6DA 3ITLA 5CXPA 4LC6A 1TV5A 2OO0A 3MSYA 1NF7A 5I5RA 3LCWA 2YBTA 2CC0A 2TYSA 3C0QA 1CX9A 3PZMA 2G3JA 4C6NA 2CHNA 5M1TA 2PTWA 5LSMA 1EBGA 1B57A 1WCGA 1OZMA 3TUUA 2ZUMA 4PB3A 4OWGA 4QLJA 5G2HA 3TC3A 1N7KA 3VMPA 3H12A 1PE1A 3EB2A 3THDA 2V2CA 3GAYA 2V82A 5AZ1A 4HMEA 2NLIA 1R30A 1VRXA 2QDHA 9XIMA 2ZXBA 4LYPA 3RPDA 3PJWA 2IQDA 3EA3A 3CAVA 4BF7A 4GZJA 3T05A 4FX6M 4QXIA 3H55A 2ASHA 4IIDA 4B4HA 3TEVA 1IWBA 1LRNA 2O92A 4XD6A 2J8FA 2JFEX 4IQEA 3ZXWA 1M04A 3MDWA 4C6CA 1EYWA 2ZC1A 3AHXA 4XKYA 3NQFA 4AF0B 1A3HA 2XGIA 3KAOA 4G8TA 4MAVA 3AC0A 1FHDA 1P0BA 4F4RA 1Y5WA 1JYNA 3WDPP 3BCFA 4JICA 3C6CA 1WDRA 1T40A 5A5WA 3H2FA 4GACA 1KFEA 2Z24A 3L4VA 4N9DA 3SR7A 4O13A 3ECQA 1ISWA 3GK0A 2PC8A 1JGIA 1XIMA 1XX1A 3NQDA 2EPHA 4M6UA 3WG6A 2VX5A 1VFMA 4IMDA 4NUWA 1OX6A 2W4XA 3NZRA 2V68A 4Q7BA 1U83A 4RZ4A 3GNRA 2QDDA 1RALA 5AYBA 3W2UA 1IIGA 1ZSXA 4UR9A 1EEPA 2O4QA 3FVDA 3HJZA 3UWZA 3NO3A 3AICA 4NZ1A 1JPIA 3PAOA 1IGSA 4NZ4A 2AQWA 1GTHA 3K30A 1H51A 1QW7A 3XINA 3K13A 1E0WA 3KBWA 3SRHA 2HK1A 4GVIA 5IBXA 1LOLA 1S1PA 5CSUA 2BWGA 4DZHA 3ARSA 5DT7A 4GNJA 1TVNA 4WY0B 1F61A 1XI3A 1GORA 5JH2A 2NSXA 4UBPC 1VPQA 4QS5A 1EX5A 3W73A 4GYPC 4XWUA 4RUBA 4Q4PA 5CPTA 2KAUC 5K4XA 1W31A 1IHIA 3G1YA 1W1B1 2ISWA 1J11A 1YPFA 3IPWA 4IM4A 1GOWA 3GXDA 3H2EA 3LQLA 4GYJA 3AMCA 3CH0A 3LHVA 8RUCA 1QBBA 3VC5A 4MNJA 1KM5A 1L6SA 3P5ZA 3NL2A 2G3MA 3LN3A 1XYZA 4US5A 4JQ2A 5CAHA 4AZCB 1UR3M 3V36A 2ZRYA 4I7VA 2ZRZA 3GIQA 2DZAA 1JZ5A 4V15A 3GYCA 3AXIA 4US5D 4N4QA 5FJIA 3S6OA 4B90A 3S2JA 3S47A 3EWXA 1UZDA 3W7HA 1S39A 5CZ0A 3UVAA 1WXZA 3FV9A 1UUOA 4WOZA 2GZXA 1FWGC 3BLKA 2DH3A 3H2AA 4DJEA 1XHGA 2QCDA 3LRLA 5HR7A 4DM1A 3KBVA 5G2IA 1ITCA 1YNYA 3EWCA 3UJSA 2WZHA 3LA4A 1OY0A 3H4GA 2FTPA 4QRNA 1UG6A 5F2LA 3KBSA 1V3MA 1XG4A 5FJUA 2GJPA 1JG9A 4N9CA 2JKEA 1IXQA 3VNDA 1RCOB 3FLUA 3WQ6A 3WBAA 1AH4A 3SUVA 3FA4A 1M9HA 1Q4NX 3DI0A 2WMGA 3W75A 2GVYA 3P0WA 2YCIX 1NF0A 4ZO8A 1WKDA 1CLVA 3PTKA 2PODA 2Y61A 3GW0A 4A2SA 1YXDA 4FOUA 3KVKA 4N6EA 3TK7A 3FYYA 3GR4A 3O6DA 4MUPA 4CQAA 3BG5A 2Z7GA 3LB0A 1QASA 1QMLA 3OGVA 2DW7A 5I3FA 4MKSA 3PSVA 1HZYA 1H62A 3WLLA 3P14A 3AO0A 4RLIA 2NV2A 1YDNA 3RILA 2J88A 4Y96A 4UMCA 2I5QA 3JS3A 4G7EB 5F2IA 4M1RA 2UY3A 2Q3OA 4Q3MA 2VWTA 1L6GA 2CU0A 3GM8A 4HT3A 3HQNA 5AECA 4Y7EA 2ZC8A 3UZYA 4E2OA 2PDUA 1X8CA 3FXGA 4YJ5A 3VKJA 1JPDX 2W66A 5HPCA 1E9LA 4LS0A 1OF8A 3RRAA 3MUZ1 2QF8A 3SQLA 3NPVA 2A2IA 4EKJA 4DLMA 1UKQA 4C6OA 1V3LA 3QMRA 3BLIA 2W6RA 1U2YA 4U28A 3LCFA 1SM9A 1AW2A 3TA9A 3U2EA 4D1JA 3OZMA 4UFLA 4QE1A 3GVVA 1Q8AA 5D04C 3KTXA 3H4WA 3MDUA 1OABA 4LS2A 5M17A 6REQB 1BYAA 3VGHA 4P7RA 1DQWA 3E5PA 3KZSA 3D6NA 4KRTA 3AIWA 4JL1A 1XGEA 3TTSA 4WZHA 2FZMA 4I9MA 2IQ0A 4PGLA 1VYPX 2ZFAA 2XIMA 4CKQA 1UD4A 2CBVA 2NX1A 3HPAA 4ZO6A 3M1ZA 1US2A 1F4AA 1M7XA 3ZR6A 4KH2A 4M29A 1GVQA 3OOQA 4IT1A 2CXEA 4AY8A 5HATA 1K9DA 2WVSA 4KGJA 3WLKX 4GD0A 3CUXA 3S1WA 1MQPA 3SCNA 2ISSA 3BSHA 1FBAA 5T9CE 5BXRA 4QSFA 4C1KA 1ITQA 4YNGA 3ITGA 3GXNA 2Z29A 3EPMA 1MW1A 2E1WA 5A2CA 3C86A 2HRWA 5CC3A 2CNCA 3G1AA 4WSKA 1QNVA 1XRSA 2EG8A 2VFFA 2RUSA 3SJNA 3W38A 3W29A 4LUTA 3I4EA 4V33A 3KDOA 3W86A 1M68A 2FJKA 3R89A 4DZIA 3HBLA 4XZHA 2QJMA 3M0YA 3WJSA 4GBDA 1NAL1 1GONA 1XDMA 3GVQA 1DBTA 2P5NA 3W28A 1UP3A 5FACA 2V2DA 3KXQA 2GVLA 5LXEA 4DWSD 4WDWA 1QW8A 1TMQA 3LXCA 2P8CA 3CJPA 1WDDA 2PLCA 2POTA 2R91A 4LUSB 3CM4A 1Q6GA 4HPJA 4HHLA 3AYTA 3NUKA 4PE8A 4A3QA 5XIMA 3VX0A 1G4TA 3CPRA 1XUZA 3BTNA 1W9BM 3HURA 1K1DA 2C16A 1EXPA 4ZA0A 4HSNA 5EA9A 1AH3A 2YYTA 1GW9A 2FHBA 3TN6A 2GDVA 2X7WA 2DDXA 2VR5A 2ZZ2A 3EKLA 4UFMA 5AHNA 4D8AA 1PYMA 3IACA 3WQ4A 1YXCA 3S1UA 3CWOX 2J9YA 1WNOA 2WSRA 1UA7A 4H6QA 4QJ1A 5AY7A 1QK2A 4LVDA 3VNJA 3C2FA 3BMWA 4HPNA 1GG1A 4LBUA 4IIBA 3LZ5A 1DQXA 1UPPA 1FHVA 5F1VA 4D6HA 1W5MA 2X1SA 4O0KA 3BLFA 3TH6A 2HBXA 3R13A 1ZBVA 1KCKA 2F84A 2G95A 3GBEA 4E2VA 1KRCC 1E15A 3MMTA 1UHVA 3QHMA 4H83A 3P62A 4W87A 1V6UA 2V0TA 3UGVA 1JULA 2NQHA 4O53A 3H2MA 3T6CA 4ADUA 4TR9A 3V0TA 4DAFA 4DXKA 5BOEA 1KBIA 5DXXA 4ADTA 4AZBA 1M7PA 3R8HA 1V8EA 2ACUA 2OELA 2Z26A 3AIRA 4GJJA 1D3HA 2VEIA 1J4EA 4J1OA 1E43A 1WKFA 3PP7A 3FHQA 1V02A 5D09A 4P8XA 2CXGA 4G1NA 2CLOA 2VRKA 2V38A 4JFUA 1F76A 4GUIA 2OZTA 3OVPA 1JRCA 5AYYA 5HWJA 2XN0A 4X60A 4L6OA 2PE4A 4P61A 3P60A 4K7YA 4P7QA 3GE7A 3OG3A 2C71A 3WBWA 4LAOA 3VU2A 2ADAA 4TVDA 2WC4A 4L9ZA 1QAPA 3IGHX 4LUTB 4DUXA 1WZMA 1ICQA 4W5ZA 1LZOA 1ZUAX 1VFUA 1OIFA 5LHEA 3VUPA 1YEYA 5L6UA 4GQGA 4Z2GA 1NEYA 4D8LA 1JIBA 1WOBA 3WQGA 4KCTA 4I6VA 4G1KA 5FF0A 2VKZG 3RLUA 3VD4A 3LY0A 1OB0A 5FD0A 1QWGA 4LT9A 2NQJA 4WJ8A 5D2TA 4IP7A 3WD2A 3QPYA 5LGZA 3CUGA 2DVUA 3WK0A 1PWLA 2QW5A 4RV3A 3TYAA 3O6YX 3WLPA 3GAKA 4HMDA 3G8RA 1VIWA 4QG9A 1R87A 1PKYA 3AZRA 2XWEA 6TIMA 3MO7A 4GZIA 4NX5A 3TSBA 1IT8A 3UR2A 4DO5A 1J2BA 3VIPA 4QROA 5A8MA 1RUSA 4WKAA 5DRIA 4JR5A 2QJJA 1Q4WA 2WZMA 2GQAA 1XSKA 1E1EA 1PL9A 1VENA 1TTJA 2DQWA 3QQ1A 5JBEA 1NARA 1B54A 3GHUA 1YE6A 5BU6A 3AMGA 1A5UA 3CIVA 1KFWA 1UQYA 1XCFA 3ZJ7A 3N6HA 2J8TA 2JK2A 4O28A 2Y5EA 3I10A 2TMDA 4IPPA 3C2EA 3U57A 2PRHA 3A21A 4G2DA 2KZHA 5CJ5A 1F7BA 1K70A 5CC5A 1ALDA 1FCBA 1O5RA 2C0HA 4DNMA 1ZGDA 3UXIA 3L2IA 3SAZA 3COTA 2W5FA 1QPRA 3L68A 2VZOA 4JEQA 4OIFA 3T09A 6CGTA 3VNIA 2D2JA 1CGXA 3WD4A 3VGDA 3VC6A 3LBCA 5KZEA 1JQVA 1LRQA 1P4CA 3URNA 2EPNA 1W9PA 1IZKA 4ZBCA 3NEVA 4KPLA 4KF1A 1EYEA 1FWAC 5HINA 2EQDA 1A80A 4XZNX 3MSGA 4ENLA 4DF1A 2C0AA 4Q4RA 3CZLA 1QI3A 4GCXA 3NA8A 4NYYA 4OTKA 4U4MA 4DO4A 7TAAA 4O4VA 1SVDA 4DJEC 1XUUA 3P81A 1BHGA 1XLLA 5BOOA 5A8OA 1EJUC 5FF4A 1XDJA 4DBUA 1TPFA 4JDBA 1WDPA 3BW3A 2GJXA 1Z41A 3O9NA 4CVUA 2C91A 2INZA 3WCZA 2GQ3A 4GI8A 3TAOA 2DJLA 1GPFA 4GIYA 4PMDA 4JKLA 1VPYA 3ZLGA 4BI5A 2XIOA 1VFHA 1V3IA 3SUWA 4BCEA 2V3GA 4PB5A 2VVNA 1V0NA 3W74A 3UETA 4WGHA 1OFDA 2B7NA 3W7CA 5BNKA 1DJHA 5I3IA 3M0XA 3SZ8A 3A64A 3MHUA 4TTUA 3WQVA 4MWAC 4S1FA 3IGUA 2TODA 3QTGA 4FX8A 1TWZA 4MFDA 4JTCA 1Q63A 3IVUA 2OKOA 3L4WA 3WJZA 5GJPA 1Y7VA 3U2OA 1T5AA 2H6RA 3ABZA 3TDFA 2PBOA 3I7RA 1D9EA 5KZDA 2ZXAA 3UWVA 3N15A 4FR6A 2B7PA 3SY5A 4AC1X 1J79A 1LF1A 3C56A 3VGEA 3A6OA 4GY0A 4KEUA 4TMCA 1QI5A 5HOSA 5T9BG 3B4YA 1U1HA 4LUYA 2ZADA 3R79A 3TWBA 2R1KA 1QOQA 3ABSA 3Q67A 5G1TA 3EPNA 4YIWA 3Q2DA 4B5NA 1JJKA 1F3TA 1GQKA 3BANA 4W93A 4A2RA 4PCFA 2A7RA 3NDOA 1OF6A 3L4TA 4MWAE 2XM1A 2QYGA 1VBGA 4YCOA 2W67A 3RF9A 3M44A 3OIHA 3UY7A 2XU2A 1FWHC 2H8ZA 4ZQRA 4CNSA 4I6KA 1SZRA 4TXEA 4W84A 4F2BA 1ZZMA 3QFWA 4ZSUA 5HJXA 3PUEA 3W1AA 2VZUA 2FZDA 1QNSA 3RMJA 2ALRA 4AIUA 1AMYA 4LJ3A 3WFAA 4JYFA 1FFQA 3DN5A 4RR4A 1XYBA 3KRBA 1TX0A 3W72A 2OOFA 3GFXA 1E72M 1FWFC 3BVJA 1MZHA 1ZBWA 3CHDA 4IFKB 3F2BA 2OKTA 1KLZA 3EWDA 4Q8NA 2WBKA 4MG4A 1KXTA 4IPIA 3NVDA 4NG3A 4NNAA 2ZDRA 2VFGA 3VIMA 1KWKA 3T0BA 5D9PA 3VD3A 5G4EA 4DYJA 4NI8A 1G4SA 4MIMA 3UQNA 5DMYA 1KGXA 4DLFA 3A4WA 3H7RA 4I7UA 2ZWYA 3TXZA 3UR7A 4AXNA 1BXBA 4C90A 3VGFA 3QY7A 4AZHA 3UZXA 4N0RA 1E6QM 3KL5A 4M5PA 3P5YA 4JQ1A 4O19A 3U9IA 3BOLA 3REQA 1EC8A 4PUDA 1BVWA 4ADSA 4GY1A 3UP8A 5BXTA 2F7FA 4B4FA 2DU2A 5CBBA 2E7FA 4B9ZA 4PTMA 4LRSA 4NJHA 2V5CA 5HWMA 2JIWA 3ABXA 4IGNA 1VFTA 3IUHA 1VF8A 2VX6A 2DZWA 4IIHA 1CENA 4WEVX 2REQA 1ZBCA 2QV4A 3TJ4A 2V5JA 1O95A 4CCZA 2XFYA 4DF0A 1UD3A 4GUHA 3L0NA 2NUWA 4J40A 1P1XA 5K9XA 1LWHA 4GC3A 1KB3A 4IISA 1HGYA 2CESA 1ZS2A 1W9DM 3BV4A 4PTDA 2A6LA 4Z42C 4IPNB 4J5NA 5FOOA 2VD9A 1SW3A 4UTUA 1A5BA 3OBEA 2E68A 4WSJA 2WNZA 4RE3A 3KTSA 4B5SA 5GPRA 1OSEA 2YBUA 1A5KC 4MAZA 1FDZA 1WUEA 2VM8A 2VRJA 2PPGA 1ADSA 1YRRA 3VOCA 3ABRA 5C71A 4PUMA 4JTRA 4AX7A 3I68A 1E5JA 1TWIA 1QPQA 4GC4A 4JGDA 1PSCA 3U5UA 3NVTA 1GQNA 3CB3A 3IJDA 3NO5A 3WL0A 1DHKA 1S38A 3EOUA 2HE5A 2HVNA 4K2SA 5DBUA 2BOGX 1J10A 1UIPA 2V67A 3GVGA 3KL3A 3T2QA 3FN9A 4WDUA 2DT0A 3H23A 1B3XA 3KBJA 3IV3A 1PZ2A 2VELA 1NDWA 1I6NA 3HGSA 3PZQA 5FA5A 4Q33A 4QR6A 1VLIA 5A2BA 3RRXA 4BQ4A 3MCNA 3EX2A 2WMIB 3CV7A 1FA2A 4LNCA 2HQAA 3CU2A 4V27A 3U6WA 1ONEA 3AYSA 1UKPA 4J4KA 2EG7A 1X7IA 2Z1KA 1JCLA 3ARWA 2GGGA 5AHEA 1H63A 1REQA 2F61A 3GFYA 1QHOA 2QIIA 1PB0A 3R4IA 3L65A 4F48A 2ZA3A 4MYXA 3FY1A 4Z2LA 3WH5A 1E9IA 5LNUA 3BJSA 4HNLA 4YWSA 1F8MA 1IE7C 2QCDB 4IQDA 2WMFA 3OLEA 3B0XA 4QM1A 2V3FA 3W1NA 3APGA 4ICCX 1UKTA 1SYTA 4IFOA 2A1YA 3RDKA 1QVBA 4B2DA 1EQCA 3FNDA 5I24A 3PWAA 5JQ9A 4C6EA 3VIGA 1E6NA 2BODX 4QFUA 2GOKA 4C91A 4S3AA 4KFNA 1CWYA 1ZCOA 1OK4A 1XYAA 4P7OA 3DHFA 1R3WA 2VVSA 1TKKA 3OZYA 7A3HA 4LVBA 3I7QA 3TYCA 2XFRA 4DF2A 4DVOA 3KOFA 3SN0A 1IT0A 3KOXA 3CXOA 3TR9A 4IWWA 4GYPA 4IFKA 2WLZA 3VIOA 3CLWA 1DQUA 3BGAA 2PC4A 4QLKA 2XH4A 2EGZA 4CNOA 3LHZA 1AMKA 2D2GA 4DUVA 2E5BA 4A3YA 4YWIA 3OU8A 5DMMA 3HFYA 4HNOA 1GEHA 2DEPA 1RPKA 1CCWB 3V18A 2FGBA 2XYLA 3B0VC 4NZCA 4PH6A 3N6JA 4X9SA 3C2VA 3LK6A 4YHGA 2E9MA 3VGBA 2BG5A 4QNWA 4KWUA 3NG3A 4UTTA 3WF4A 4EXQA 3B3DA 2H3DA 1G5AA 2J7BA 2ONEA 1FWIC 3PPGA 4PC8A 3G0XA 2OQYA 4GH3A 4EAMA 1WQ5A 4NRRA 3SECA 1E0XA 3WLOA 2BTMA 4GOAA 5A3HA 4GVGA 2X30A 3K1DA 1JXKA 5IFTA 1M53A 4XZLX 1FUYA 1WUFA 4MB5A 5E09A 1Q6DA 5HQLA 1LLZA 1OYCA 3KVJA 3WNMA 3B0YA 3NOYA 3IK4A 4RE0A 4TQTA 3M4HA 3CZJA 4C6BA 2DGAA 3LLXA 1F8IA 3N17A 3QR1A 3E0LA 2XSXA 2DIEA 3CL8A 4E3TA 5I0DA 1EGMA 2WZTA 5K4ZA 3S5ZA 3CMJA 1UOZA 3N9RA 3FYPA 3ERPA 3O06A 4RXFA 3MB9A 4Z17A 2NX3A 2OWWA 3S83A 5M03A 5M3WA 2DUXA 1D2KA 2OODA 1OGSA 1KR1A 2C14A 1XSJA 1YTDA 1DXIA 1AQFA 4A3HA 2GPTA 3U7BA 3QSRA 1GJWA 4WY0F 1JPMA 3W7EA 2J7GA 5B7YA 1A47A 3PFRA 4MZ1A 4GI4A 4HK5A 2WKJA 4AWEA 4URIA 2WHMA 4HVXA 5FJJA 1C9DA 4QDMA 1PEZA 2G3IA 5A8PA 3W7IA 4I9TA 3QPZA 3W02A 2YW3A 2HDJA 4H19A 1HO1A 3T42A 1ECEA 4AG0A 4MJMA 3W7OA 1NY1A 4PMYA 5EFFA 3CIXA 3WY1A 3DFHA 4GIAA 2GGEA 4O14A 1R46A 2QCMA 1HP4A 4IF2A 1WDSA 2JF6A 3WUEA 1IGWA 1G6CA 3STEA 6REQA 1S2AA 2BDQA 1UJPA 1LWIA 3UGRA 3UBPC 4AWTA 4PL1A 5FEPA 2ZZ6A 4J3UA 5C2GA 1NWTA 3IGSA 2HCVA 2HTMA 3EKGA 4HTBA 2DUAA 3NCOA 4PL2A 2PLKA 1FWCC 2WNWA 2W0UA 5DANA 2NUYA 2Q01A 3WELA 1OK6A 4HYVA 1EP1A 2VCAA 3W0KA 1UR4A 1F6YA 3FK4A 5I3JA 5J5DA 4IL2A 2ACQA 5AFDA 2A3BA 3PBGA 3S6DA 4MNLA 3V75A 2OQLA 4K1WA 5CZTA 3CO4A 3TROA 3RX2A 3CL6A 4CU8A 2YDQA 3TSDA 5FJOA 5FSDC 1JF6A 4N2YA 2PDQA 1FWDC 3RR1A 5ECUA 5SWUA 3D3AA 3DECA 5B80A 3EXRA 4HOWA 2YA1A 4W8LA 3AHYA 3TTEA 2V9DA 4J7RA 1SZFA 1GJPA 2E4TA 4HMCA 4HPXA 1TQXA 1Q6LA 3ITXA 3AU6A 4U3AA 4H00A 4E6MA 3TN5A 4D6JA 3UERA 1F6PA 2XVPA 4ZTXA 3TOPA 3UZZA 1R2TA 3S46A 1LT8A 3MCMA 1IR2A 3SCQA 4W8AA 1D7KA 2QCFA 1WZKA 2OEJA 1LM1A 1KFKA 2WVTA 1FFRA 1XV8A 2QCCA 4FIQA 4ACZA 2DIJA 2D3NA 1BEUA 2Y8VA 1JXJA 3NZGA 4BA0A 2W3ZA 4F9JA 3I6RA 2WQDA 5CPNA 2ZTJA 1CBGA 1TWSA 2RGMA 1EOKA 1F4HA 4KCVA 4JEJA 3IRSA 1FQ0A 2X7VA 3N04A 3BG3A 2ATSA 3R2GA 3LSCA 1TWDA 4WR3A 1H4PA 4M1BA 2O9RA 1HKIA 1HVQA 1ZJAA 5CC7A 2NQZA 1B5TA 2XVNA 5F4SA 1AFSA 2NQLA 2Z0IA 1WPCA 3EDKA 3TMLA 3KCOA 2RFGA 4XKYB 3TVAA 3NGFA 3ZJKA 1TJPA 3EPOA 1OX4A 3LM7A 1W8SA 2NXGA 4F3HA 1DWIM 1R7AA 3P67A 4L1WA 3A9BA 5B7ZA 2DT3A 5I03A 1AL8A 4O1AA 1X98A 2CLPA 1J12A 5I07A 3UD6A 1I2PA 3IIZA 1OFPA 1R9YA 2J47A 4CLMA 4WDTA 4HCDA 1ML1A 3CTTA 3A9IA 7CGTA 5A2AA 4MWAB 3EKZA 2QGHA 1OGGA 1M7OA 3N34A 4TO8A 5AOUA 1PIIA 1VS1A 4U2YA 2DPEA 3MP4A 4HBKA 3FGCB 3POHA 3F2DA 1EX1A 4JX5A 3U3HA 2J77A 1GQIA 1XRFA 3LHTA 3NM3A 1CNVA 5HMEA 1GVSA 3ZQ9A 2CITA 2Q02A 3W81A 1RCXB 5FIPA 4Q22A 5REQA 3H2OA 4UTWA 2V5LA 2YCLA 1JQXA 3AYVA 4WIWA 2UZ9A 2WM1A 3LXBA 1YHTA 5D9MA 1VCGA 5EMYA 1QUMA 4HSOA 3CPUA 2X1TA 1E71M 3FJNA 4O8RA 3LTPA 4N9EA 1FWBC 4P7LA 4MF4A 3C3NA 3MVIA 5FAGA 3VKKA 5EGRA 3W7LA 4C7DA 3HPFA 3UVIA 4YLWA 3QMTA 1ZHAA 4AZ6A 3ZLHA 3IJ7A 2QCGA 3W71A 2C18A 1QBAA 4L1XA 2TSYA 4HPHA 5BZAA 4WCJA 1L0PA 2VUNA 3S2CA 3QZ6A 4HIBA 5LNRA 3DENA 2O55A 4LYKA 2Y0FA 2J13A 1EDGA 3U8GA 5GNXA 1L8PA 3PJXA 1TPVA 4GVFA 3SGGA 4XD4A 3ZSTA 3IV8A 3AUJA 1XLIA 1VGAA 4WDXA 2XPKA 1E6RA 2VP8A 3UJFA 2Z2UA 1IXOA 4HNVA 1VEOA 2ZBTA 4LY8A 1PVNA 3S42A 5CZKA 1JUEA 4NT0A 3H70A 1XLBA 3EWUA 3K5XA 2QMKA 4UQDA 9RUBA 4B3KA 3O2LA 2JALA 5A6BD 3AQUA 4Q4OA 1KFBA 3WUGA 1RV8A 3B8TA 4CNPA 5GQBA 2Z2AA 4HCLA 1KA9F 5LNVA 3MVTA 1ZAIA 4ZL1A 3B9OA 1XC4A 1JAEA 2P8BA 1DV7A 4X61A 1RR2A 3GG8A 1VPXA 3GZAA 3BCJA 4IICA 1OT1A 2PRMA 1KM4A 4RJEA 5G1YA 4UNKA 4DRSA 3KL0A 3EWBX 1RXOB 1JZ4A 4A29A 1M6JA 3GG7A 4L4LA 1YXYA 3VX1A 1JD7A 3OLDA 2AKZA 2OSWA 4M6PA 2Y5JA 4B5VA 2D24A 4ZOCA 4PFHA 3MYOA 3WLQA 2PDBA 4L61A 4C1LA 3ARUA 4AD0A 3CMGA 2X0SA 4PCSA 3BV7A 4XZWA 1W3LA 5EMKA 4Z0JA 1PZ0A 3CS2A 1GQLA 4JAWA 4O15A 3MKCA 1VZWA 3KS5A 3UWEA 1HKJA 1SMDA 3WMCA 1TB3A 2GVGA 3I3DA 3OYXA 1XH1A 4EIVA 4H6RA 3MWCA 3B40A 4E4FA 1W54A 3FSUA 2Q8ZA 4H9MA 1E0UA 3SI9A 2Y63A 2OOGA 3CHFA 4MUZA 4NJIA 4X2PA 1S3TC 1EB3A 1E56A 1I2NA 4HHMA 5CSRA 2W9MA 2PI6A 2BS9A 3W24A 1U1JA 4R3UA 5LGXA 3Q45A 2FZBA 4YCPA 3HG4A 2QUMA 4O54A 5KSWA 1E6SM 3CIWA 4RPQA 1IEIA 3VD7A 4LUJA 1Y8BA 2YB4A 5HUPA 1BRLA 5DELA 1E0TA 4HMNA 4QDWA 4KBXA 3DG7A 4MJ4A 4FLRA 4NI3A 4JIRA 4HA4A 5T26A 2PDJA 1QNQA 5JBDA 3P3BA 3L0KA 3DXIA 4RNJA 1JR1A 4W85A 3FKRA 1EJ7L 3BH4A 3T0TA 4E8GA 1Y65A 4GXWA 1UUQA 4ZODA 3DYOA 1YPIA 4HYWA 1H3GA 2OEMA 3WIJA 2NSOA 1FP8A 3KP1A 4IHCA 2FGLA 3ZJ8A 2XN2A 4JTQA 4WK9A 5M2FX 2VFDA 1KFCA 2HV5A 3ZT5A 4WJEA 4R9OA 3DHDA 2VOTA 1FX6A 3RM9A 4Z1YA 1ENUA 3EZ4A 3II1A 3VOJA 1K7FA 4MWAA 3RX3A 1VHCA 4XQ6A 1J5TA 5E70A 3DZ1A 4Z1DA 4I5UA 1JCXA 1JNEA 4UQCA 3FGCA 4H9VA 5CH9A 1KNWA 4E3VA 2EBNA 1MXSA 4D6FA 5HBFA 1JDFA 4FPSA 1KTNA 3B9AA 4AH7A 3IJQA 2XJ7A 3E5BA 4H41A 4GX8A 2OU4A 4HJFA 4AVOA 2DT2A 3IIPA 1B1YA 4DAIA 4JPGA 3H7VA 4AIBA 4U5IA 4YN5A 2WMHA 1EJSC 3CZKA 4FHAA 2BVWA 4L64A 3KRSA 3S5SA 1O94A 3AJ7A 1L9WA 2AL2A 1ZFJA 1KM6A 2AGKA 2NUXA 4FIRA 2FMNA 3KE0A 3LBMA 4PUNA 3QC0A 1B9BA 4D6IA 3DFSA 5AHIA 3HIJA 1A5NC 4Z2IA 1QI4A 1US3A 3URBA 2GK1A 4CCCA 3GH4A 1JVNA 1MNZA 5AC6A 3U7VA 3M6YA 4M7SA 3QQ0A 1GVRA 3G1FA 1T7LA 2PWUA 3L9CA 2VI0A 5A6BA 3LSBA 2AMGA 3KZPA 5C70A 2W79A 3QEZA 2XIJA 2ZA1A 1XYLA 3LCLA 4J3VA 4IGHA 3SCOA 3BK0A 3ANYA 4KEMA 4JFVA 4AC7C 2XSAA 1UYQA 2ZUUA 1A53A 4UTFA 4IPLA 1GCYA 4DUOA 3VCNA 2OLHA 4UUIA 3GTHA 4ZZ9A 4C6LA 2QHAA 4P8WA 4OE7A 3QGVA 1LORA 4M51A 4DI9A 1OBAA 4MWAD 4E8CA 2W92A 3F4CA 1XWYA 3OEXA 3UU0A 3APTA 1CXKA 1XGZA 1DHPA 2EEXA 5EYWA 2PRLA 3FA5A 2Q8LA 1ADOA 2X2YA 2FH8A 2JF7A 2ZOXA 5AC4A 3WQOA 1ZNNA 1KW1A 1XIDA 3U4AA 2CBIA 1PV8A 3SCRA 2C19A 4J27A 5JBFA 2GWNA 1YADA 4RW5A 1DJYA 4FNTA 3UZ5A 1FXQA 3UXDA 1P0EA 3WQ5A 3MBDA 3LI0A 2DIKA 2JEQA 1QPKA 1KM0A 4PUUA 4HKPA 1KLYA 3T2PA 2FFCA 4ERAA 1BFNA 2NXIA 3ARXA 3FJLA 3SIMA 2HNEA 5D37A 2ZA2A 1G94A 1FHLA 3NYZA 2O9OA 3M07A 1CB7B 3LHUA 4JN7A 3E9AA 3BQ5A 4LVGA 3ARRA 4OZOA 1MUCA 2Q8XA 4XZMX 2CLHA 5H8UA 3R0UA 1I8JA 1A0DA 3W87A 3CUIA 3T81A 3WJYA 3MSDA 4JIEA 5EBAA 1QPNA 2WC3A 3T55A 2BMBA 3GNNA 3OBKA 4PODA 4RK8A 2DZVA 2P50A 2ZUTA 2CLEA 1BRLB 1TPDA 2DY3A 1W9VA 1MQRA 3T4WA 3M7SA 1JZ2A 2VURA 5D9NA 3ISIX 3TFXA 2ZX8A 1TPB1 3O0FA 1ICPA 3G2GA 3Q4DA 4PBEA 3TWAA 4KFOA 1I0BA 7ODCA 8TIMA 9XIAA 1CGTA 1CXLA 1GOOA 4YVXA 5AVHA 1MO0A 4LCSA 1A49A 3G8EA 1O7AA 3P8IA 3VE9A 1A5CA 2FHCA 3HGJA 3ZT6A 2WVVB 3F4VA 2OZ3A 1TO3A 1R2RA 3VDGA 1AG1O 4KEVA 4HNNA 1GNXA 2BHYA 4LCRA 4MADA 1DVJA 1W1TA 1DPMA 2PDFA 1XKYA 2G8ZA 1TPC1 1RVKA 3EA2A 3E0IA 2PDIA 3JU2A 4LXFA 1BGGA 5LA0A 3ZFHA 3VAVA 2HK0A 3CT2A 6ENLA 1YTKA 3H22A 3CK5A 3GG0A 1E6PA 1YQ2A 4LAMA 1TYGA 1V7AA 4TVCA 3GDLA 5KITA 1OWQA 4L56A 3FX4A 5CJNA 2YCJA 4GQBA 1BKHA 4F2UA 1TMHA 2XIQA 2NV1A 3KHJA 5FCZA 1KBBA 1T8QA 1XFCA 1LLWA 3U0HA 1V4YA 3LCGA 2VDIA 3URQA 2GUBA 4IIFA 2X40A 5I00A 3BC9A 3JR2A 3G1VA 3O05A 3ZMRA 3R43A 4A8RA 2PF8A 3HPXA 1BWVA 4F66A 1YIXA 1X96A 1Z48A 1X6LA 3H26A 1OQFA 1XP3A 3GC2A 2PA6A 1KTCA 2H90A 4O4WA 3MP5A 3B8UA 5FJTA 4O1BA 4L65A 1CXFA 2PDYA 4GH1A 4NIRA 3KX6A 3OLGA 1TUXA 3M43A 2IS7A 4QHRA 1V0LA 2WMKA 3S2NA 1MDRA 1XIIA 4XZIA 3PTQA 5AHLA 2QAFA 4ILSA 2Q3RA 1O6IA 2RJHA 5T91A 2VX7A 4LV9A 3DKLA 4WJXA 4F40A 1SSGA 1IV8A 1BPLB 1LBMA 1R38A 5I06A 1FCUA 1JI2A 2J7FA 1C93A 2P88A 2LLEA 5D2XA 3T0AA 3RJXA 2VUYA 4WQ6A 4L4OA 4MJZA 2PLMA 1OZQA 3AHTA 1WZLA 4WXZA 1W9XA 4HQVA 3JRKA 5LXXA 3UJEA 1CGYA 1QO2A 3WF1A 5I6SA 3Q37A 4LYRA 3BOXA 3QQWA 4F2TA 4HB7A 4XB3A 4ERIA 4KWOA 2JGQA 3GH5A 1BQGA 2YOCA 4GX9A 4QQUA 1JUKA 2DW6A 3FEQA 1A50A 3LLFA 1GHRA 4J2MA 3O8AA 3RU6A 3BG9A 4NHVA 1NWSA 4DIAA 3RM4A 1MFVA 1N55A 3LU2A 1ZL1A 1HGWA 2FFIA 3VDBA 2GK1B 4RX0A 4MB3A 5T8GA 4IGSA 2PZNA 4JTIA 4AHQA 2PD9A 1I2QA 4GYFA 4UCFA 1ME9A 3V5OA 1QW9A 1JF5A 3W1XA 4J3ZA 3NTYA 1X6UA 1UKSA 4FSAA 3VUSA 4O16A 1Z42A 5CQ1A 2X8RA 5HANA 2POZA 3LNPA 2GGIA 3E2SA 3NQMA 3NZ1A 3DFPA 5E0FA 3LV5A 4Q4QA 1KM1A 1D8WA 2DUZA 3G1DA 3VOGA 3S5YA 3DHPA 3N19B 1P0NA 2QCNA 1SZGA 4FB7A 1VR6A 4YTUA 2TAAA 5TQLA 4IGMA 4R7JA 1QATA 3F5KA 4JN6A 2X0HA 1PX4A 3U2CA 4DN1A 3GXIA 3DFOA 1Q65A 1J0JA 1EJRC 4AQLA 4Y9OA 3VILA 5K7JA 1SR0A 3BLDA 3EXSA 1EPXA 1WO2A 3VYLA 4TU1A 1XD0A 1ME7A 2C13A 2ZTKA 3T44A 5C9XA 3OA3A 1TPEA 2CZ5A 1R7OA 3TQVA 4LS1A 4TIMA 1VFFA 3MP3A 2INFA 1XKJA 5F1UA 1Z69A 1J8VA 4POCA 5C9UA 3BJFA 2D22A 1H1NA 2PGRA 1KQZA 3OO2A 3C0SA 3WN6A 1FP9A 3UNDA 4NVTA 1L8NA 2PDLA 1G01A 2IPWA 4ZE4A 4LSBA 3WLSA 3CYJA 4AYSA 5CBIA 2Z1WA 1XC6A 4DJFD 2D73A 4XG1A 1P5BA 4QIUA 5FESA 4LALA 1EOMA 2VFEA 1W5OA 3GR7A 3IJ6A 1FDYA 3BAKA 4PTXA 1V6WA 2DFAA 1W2VA 3N18A 2HS8A 4HOZA 3A12A 3EX4A 3EOEA 3T0CA 3WEMA 2OSYA 2I16A 1BF2A 1VFOA 3PF3A 4FA3A 3GB6A 4L9XA 4YTRA 1KTBA 4HSHA 2E40A 4S3FA 4NYUA 1T8XA 1UASA 3MBFA 3OJGA 3DH7A 4L6DA 1H2JA 1H11A 3AZTA 4I9AA 4IMEA 5LNSA 2V5KA 3LTYA 2A6NA 5I77A 3CO8A 3QW3A 1MRAA 3QOKA 5TBOA 7ENLA 3R6IA 3VIKA 5HMFA 4ZOAA 1GKPA 4AZCA 2ZZ5A 1WZAA 3KWSA 4JCLA 2NVCA 2VR2A 3L4XA 4AIOA 2OYMA 1U22A 5IHSA 1X7FA 2XTKA 1EDQA 2WANA 3CMFA 4HZ7A 4M6VA 5DY3A 1XRTA 4C6KA 5I3HA 4DZ5A 3NSXA 3DUGA 2ZVIA 1E4MM 4CU6A 1PWMA 1PJ9A 2VHLA 1EJWC 4OBTA 5DQPA 4GXMA 2OLAA 4Z1AA 3SGUA 3RGTA 1TELA 1QO5A 4XUYA 4G7EA 5D8WA 1HN1A 2QDEA 1XYFA 3MUY1 3W70A 4GIRA 3GTXA 3BGJA 4L4MA 3U5YA 4B3LA 3M64A 3LMYA 3PN8A 3CHCA 4YMZA 3PWIA 4YHEA 1PKNA 3BW4A 3TC7A 3STFA 2NQ9A 1FRBA 1DXFA 1RBLA 3WSUA 3L2LA 1C29A 1C8VA 4J3TA 2QEZA 1R3QA 3EA1A 2EPOA 4BFAA 4AD1A 4RE4A 4ORIA 4LVAA 3IIVA 3A47A 2PWEA 1XYCA 4HD5A 2O9PA 3ICJA 1A5OC 1K9EA 2D3LA 4K38A 3TN4A 4QCEA 3RG6A 3WD1A 3PAJA 1E0VA 3S9YA 3W7RA 1M03A 3BMXA 4GRSA 1X1OA 3WLRA 4D71A 1VJIA 2ZDSA 3UYCA 3AFBA 4HPGA 3C8FA 1ZU8A 2FGZA 2PWVA 2OYLA 1VC4A 4KIRA 4B91A 2G37A 1UR1A 2WNNA 3RFAA 8XIMA 4Q8UA 4RCXA 4CNTA 1H49A 1LWJA 1SUXA 1IQ8A 4FNPA 4TTGA 4ORMA 3NL5A 2UY5A 4UFJA 1KRAC 1C3FA 1OIMA 3AWOA 4S2BA 1EEXA 2ZE3A 3ZT7A 1XQLA 3VDCA 3AS3A 5KEZA 3FS2A 3PUDA 1SFSA 3LQGA 5CLTA 1UR2A 4GVHA 1DJNA 2YXOA 2WLYA 4UTMA 2E9LA 1YX1A 4X0NA 5K3VA 4RL3A 1XS2A 3W1QA 4X63A 4CU7A 2E6YA 2RDUA 5D2YA 2FPYA 2QPXA 4R85A 4LUSA 3GDKA 4GGBA 4DBEA 2XVLA 2X05A 2PDCA 3VCCA 2RDTA 1REQB 3DU0A 2C8NA 3E02A 5CCZA 2QJNA 4OOUA 1BSLA 2QAPA 2G97A 1OHLA 3C52A 3RIKA 3SURA 4MTVA 3AJXA 5CC6A 3GY1A 1WP6A 5DCDA 2VEMA 4C1NB 2HE8A 1C7SA 3B4UA 4Q7NA 4PFMA 2GDUA 3PBWA 2CZFA 4C5YA 4HZ6A 3S9ZA 1WOAA 2F38A 1NP2A 4UWMA 3UCCA 1PX3A 1RVGA 3SUTA 4PBGA 1H5YA 1VAHA 2BHUA 4O8AA 2P0IA 4K6AA 3A3HA 4EPBC 5LA1A 4BI6A 4MFEA 1B4KA 1IZJA 2PU0A 4Y2WA 2FZ9A 3JZUA 1S2VA 3T08A 2I14A 1C92A 3PZVA 3WEOA 2J8GA 4D1IA 1X6NA 3UPMA 1EL3A 3KBMA 2Y7GA 5JH1A 1CGWA 4UCGA 2WB5A 1EJVC 4H8NA 2C7FA 4N7QA 5MKGA 4JN8A 5BRQA 2O56A 4C5ZA 3NOEA 4GYKA 4PYSA 3TLLA 4CQ8A 3SRKA 3F4WA 5TAOA 2Z4GA 4UFIA 3SRFA 2J66A 3ANUA 4O1FA 5CPOA 4H01A 3BAJA 2X09A 3M0LA 1H41A 3E96A 1PKMA 3LMZA 3UZJA 3O1NA 4AD4A 2WXDM 1Q7QA 4IXXA 4BQ5A 3QHNA 2QCEA 1RQHA 1MFUA 4AVNA 1CZ1A 1WA3A 2FTYA 3RO8A 3IK2A 1ELSA 2IPGA 3D0CA 2ABAA 3F03K 2B4GA 3CB8A 7XIMA 1M65A 3PG9A 4H04A 5G2WA 4MHBA 1EDTA 4YTQA 1OD8A 4UNIA 5GVJA 3K1GA 5E9AA 4QLLA 3GYEA 3IVTA 4GIEA 4L80A 5DT5A 1TA3A 3SADA 2YL6A 5HK4A 1NOUA 4UB9A