4LCRA

The crystal structure of di-zn dihydropyrimidinase in complex with ncba
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
485
structure length
484
Chain Sequence
AGEILIKGGKVVNEDCSFFSDVHIRGGKIVEVGPDLRVPPGARVIDATDRLVIPGGIDTHTHMELAFMGTRAVDDFHIGTKAALAGGTTMILDFVMTQKGQSLLEAYDLWRKTADPKVCCDYSLHVAVTWWSDEVKDEMRTLAQERGVNSFMFMAYKGLFMLRDDELYAVFSHCKEVGAIAQVHAENGDLIAEGAKKMLSLGITGPEGHELCRPEAVEAEATQRAITIASAVNCPLYVVHVMSKSAADVVSKARKDGRVVFGEPIAASLGTDGTNYWHKDWAHAAQYVMGPPLRPDPSTPGYLMDLLANDDLTLTGTDNCTFSRCQKALGKDDFTRIPNGVNGVEDRMSVIWEKGVHSGKMDENRFVAVTSSNAAKIFNFYPQKGRIAKDSDADVVIWDPKTTRKISAQTHHQAVDYNIFEGMECHGVPVVTVSRGRVVYEEGRLKVSPGQGRFIHRQPFSEFVYKRIRQRDEVGKPAVVIREP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase activator
molecule keywords Chromosome 8 SCAF14545, whole genome shotgun sequence
publication title Crystal structures of vertebrate dihydropyrimidinase and complexes from Tetraodon nigroviridis with lysine carbamylation: metal and structural requirements for post-translational modification and function.
pubmed doi rcsb
source organism Tetraodon nigroviridis
total genus 185
structure length 484
sequence length 485
ec nomenclature
pdb deposition date 2013-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4lcrA01
2IMRA 4Z42C 1R9ZA 3HPAA 1ONXA 4ZSTA 2Z2BA 4GZ7A 3F2DA 1P1MA 4IFKB 1A5KC 3K2GA 4XAGA 3UPMA 3KM8A 3MDWA 1RK6A 3GU2A 4RDVA 3IACA 2Y1HA 2ZC1A 2WJEA 2Z4GA 4C6FA 1KCXA 3MVTA 4C6MA 1FKXA 4H00A 4RE0A 2GWGA 3GUWA 3AU6A 2E1WA 4CEUC 1UIPA 4CQBA 3GTXA 2R1MA 3S2LA 3LA4A 1A5MC 1YNYA 4DO7A 3GRIA 3S2MA 4IQJA 4RDYA 3AU2A 3F4CA 4NP7A 2GZXA 4V1YA 1HZYA 4UBPC 1A5NC 2F6KA 4DIAA 3A3WA 1PTAA 1V51A 4DLFA 4XD6A 4PBEA 4WVXA 5E5CA 2QVNA 3C86A 2HBVA 3K5XA 3LS9A 2I5GA 5AKQA 3TN6A 1NDZA 1ZZMA 2YB1A 3S4TA 1ONWA 2DVXA 4IGMA 4C65A 1V79A 1FWFC 4J5NA 4CEXC 2GOKA 4RDZA 4CNTA 4ERAA 4LAOA 3URAA 2ICSA 2P53A 1A4MA 1FWGC 1PSCA 1S3TC 1I0DA 1PB0A 3GTFA 1DPMA 4H01A 2HPMA 2UBPC 4F0LA 1E9YB 1GKQA 1FWEC 3URBA 3T1GA 2R1PA 4LCRA 2WJDA 4B90A 2FTYA 2QS8A 5LXXA 1NDVA 1XRFA 1UBPC 3A4JA 3E3HA 2EG7A 4I6KA 4BJHA 2HNHA 3TNBA 3LU2A 3EGJA 3DCPA 1UIOA 4C6EA 3CAKA 1J5SA 1XGEA 2W9MA 5HMFA 4QTGA 3NEHA 3MSRA 1GKRA 4C6CA 4QSFA 3AUOA 1W1IE 4PBFA 1RJRA 4EPEC 3F2BA 4R7WA 4G2DA 2QT3A 4GBDA 4KF1A 1ADDA 1YRRA 4C6LA 1WXZA 4B92A 2EG8A 3WMLA 2KAUC 4KIRA 4CQCA 1RK5A 4GY7A 3E0LA 4LCQA 5HMDA 1EZ2A 1XWYA 3LSCA 4IFKA 3PANA 1JGMA 1J6PA 4YIWA 5FSDC 1J6OA 3DC8A 4C5ZA 4XAZA 3HTWA 1YMYA 3MPGA 4LAMA 2OODA 4DI9A 1XRTA 3GU9A 3UBPC 4H9UA 4GOAA 4J2MA 3ICJA 3FDGA 4AC7C 4GX9A 4C6PA 4INFA 1M68A 4KESA 4PCPA 2XIOA 2AQVA 4C6NA 4HK7A 3QY7A 3FEQA 4QROA 2ADAA 4EPBC 3ISIX 3D6NA 3RCMA 1O5RA 1KRMA 4DZIA 4TQTA 3K4WA 5G4HC 4MUPA 2AQOA 2UZ9A 4IG2B 4QS5A 1RJQA 3OU8A 3LSBA 2R1KA 3DUGA 1EJTC 4LEFA 3OQEA 4E3TA 4ICMA 4DLMA 3UF9A 4EPKA 4M51A 1NDYA 1A4LA 2VC5A 1I0BA 4R88A 4LCSA 5HMEA 1QXLA 4QS6A 4H9ZA 2OQLA 3MJMA 4HK5A 4L6DA 3IJ6A 3TN4A 3B0YA 4AQLA 2Z2AA 4F0SA 4CNSA 4QRNA 4GY0A 2WM1A 3GTHA 4DNMA 1RAKA 3PNZA 3MTWA 4XD5A 4EPDC 3QGAC 3ID7A 3RYSA 4C6IA 3OODA 2YB4A 3GU1A 2OOFA 1POJA 4C6KA 1RA0A 3O0FA 4KEVA 3E74A 2FVMA 1P6CA 2R1NA 2GSEA 1FWBC 4F0RA 4H9MA 3B0XA 4J35A 2R1LA 2PGFA 2GWNA 4LAKA 2Z00A 1J79A 1RJPA 1FKWA 2VR2A 1YIXA 3WYZA 4NG3A 1K1DA 4LALA 1FWIC 4XD4A 3CJPA 3OJGA 1ITQA 2WJFA 3B40A 3JZEA 4PE8A 4LH8A 3R0DA 4CQDA 3E0FA 4H9XA 4DI8A 2FFIA 4OFCA 2Q09A 3T81A 1RA5A 4IF2A 3SO7A 4EP8C 3IARA 4C6JA 4XAYA 1EYWA 4ERGA 3LGGA 2BGNE 4LANA 2PAJA 1POKA 4GYFA 3URQA 1IE7C 2EG6A 1QW7A 3QY8A 1K70A 4HK6A 3E38A 1WXYA 3UR5A 4KERA 4IFRA 4GXWA 4G7EB 3IGHX 4GK8A 2VHLA 3URNA 4UB9A 2ANUA 3G77A 3QY6A 4GX8A 3S2NA 2Z28A 2HBXA 3ITCA 2PGRA 4IFOA 4PCNA 1EJSC 3WZ0E 1FWCC 3PAOA 4GC3A 1YBQB 1NFGA 1YBQA 1VFLA 4DZHA 3NURA 4H9VA 3RHGA 1EF2A 3MVIA 1E9ZB 2PLMA 3F4DA 3IRSA 3S2JA 3BE7A 4V1XA 2Z29A 3E2VA 4C60A 3GIPA 1R9YA 4IG2A 1K6WA 2CZVA 4XD3A 3UR2A 3IV8A 2VM8A 4KEUA 1FWHC 1V4YA 2HPIA 2D2GA 3MKVA 3T8LA 2YXOA 2O4MA 2FVKA 3NQBA 2AMXA 4HJWA 2BB0A 4KEZA 3RN6A 3PNUA 2I9UA 4C6OA 2D2JA 4H9YA 1FWDC 2RAGA 1KRCC 4B91A 3EWDA 3SFWA 4C6BA 3MDUA 5A6TC 4RDWA 3GTIA 2OB3A 4DYKA 2QPXA 1EJRC 1KRBC 3O7UA 1BF6A 1O12A 1EJXC 3OVGA 1M65A 4NI8A 3GIQA 2Q01A 1V77A 2A3LA 4D8LA 5FSEC 1A5LC 4IGNA 4KETA 2Z27A 1EJWC 4C6DA 2VUNA 2G3FA 3V7PA 2FTWA 4LFYA 4H9TA 4C5YA 3ORWA 3FDKA 3TN5A 1FWAC 4WGXA 2DVTA 4HA0A 3CS2A 2Z26A 1NDWA 1EJUC 1ITUA 4B3ZA 3LNPA 1R9XA 1M7JA 4XAFA 4R85A 4ZSUA 1V7AA 1GKPA 4BKNA 2DVUA 1EJVC 2PUZA 4IH3A 5CH9A 2P50A 2Z7GA 2HQAA 1KRAC 2YZ5A 3N2CA 4RZBA 2OGJA 4L9XA 3OOQA 3QGKC 4CNUA 2Z25A 1UMLA 1FWJC 2O4QA 2Z24A 1PO9A 3EWCA 3LGDA 4ERIA 4P5UA 4KQNA 2E25A 3LY0A 3GG7A 4JOMA 3F2CA 3HM7A 4BY3A 1A5OC 4C6QA 4GY1A 2D2HA 3PBMA 4I6VA 4G7EA 3TN3A 2VC7A 1P6BA 3A3XA 3IPWA 4WHBA
chains in the Genus database with same CATH superfamily
1HGYA 3LLDA 4Z42C 3SCPA 2ABAA 5BMWA 5CBIA 3EWBX 4GZ7A 2YCEA 3TAOA 1JQVA 2J25A 3LDVA 5BRBA 3TQVA 1L9WA 5AYYA 4C6MA 4IP4A 4CCDA 3W23A 2XYLA 5HA7A 4H3DA 3S2MA 5CZKA 4GI6A 2YIHA 3LCXA 3AICA 5DMYA 3O07A 1VBJA 3G0XA 3CHEA 2CBJA 2OLAA 4X9YA 4M80A 2I5GA 1QASA 3CHDA 1VENA 3TK7A 1PPIA 4JTRA 3W22A 4LU0A 4DN1A 3O16A 4CNTA 1UC5A 3DEQA 1DV7A 1QOXA 1CLVA 1H7WA 5DT5A 2NWRA 1TQXA 5CCZA 3GFZA 3GFYA 4DJFD 5C9WA 1R3YA 1A0DA 3TC3A 4GZEA 3OBAA 3M07A 3H2AA 2W63A 1VPYA 2FZMA 4LYQA 3POCA 3I7RA 3VFLA 1GQLA 1XKYA 3AZSA 4TUFA 3T40A 2OOGA 3AS3A 1NFPA 3IJ7A 4H8UA 1KGUA 2YL6A 4QAWA 2F6UA 3STPA 3AI0A 4JEQA 4US6A 3WK3A 2OVLA 3VKJA 4M5PA 1TR1A 4XKYB 4AWUA 3MANA 4QXIA 1W3KA 5BNKA 4LVAA 3LMZA 3VILA 4ZE5A 4CQCA 1GVSA 4JL1A 3W75A 3VUPA 1K7XA 5H8UA 4RE2A 1PZ1A 4JIPA 1EX5A 3GO2A 4O57A 3GG0A 3ZJKA 1H63A 1JI2A 1TPFA 2PD5A 2V3DA 1S5VA 2GOUA 4DUVA 3UJRA 4PCPA 4LWWA 1ECEA 4HK7A 4QDPA 2VR4A 2INFA 2XVLA 4W7VA 3C3NA 3H12A 1WZLA 4FIRA 1H60A 4H4IA 4CD6A 2VJXA 3W00A 1VGAA 2ALDA 3BAJA 1AQFA 3KHJA 3B9EA 2H9AB 3WQ8A 3N19B 2G41A 2E4TA 3QMSA 3GW3A 5JMUA 3SRHA 1F05A 3RM4A 2QCDA 2H3DA 3TA6A 1YTEA 3IWPA 4QS6A 1L6SA 3MJMA 3RF9A 1AJ0A 3TFXA 5AHIA 4PC8A 2J8GA 1HKMA 2NX1A 4QRNA 3M0ZA 3ME3A 3QZEA 3FYYA 3L2LA 5CSYA 4PTDA 3P3BA 3QGAC 4EPDC 3A4WA 2JK2A 4EX4A 3BGJA 1HO1A 2DT0A 2Y7DA 3W73A 3WQEA 4FSAA 2XSXA 3E74A 3QKEA 1P6CA 1Q6EA 3O6AA 3DG3A 3WBYA 1AODA 1VH7A 1R46A 2GWNA 3WQCA 4IP5A 3BL3A 4LAKA 3HJZA 2QCGA 4WKHA 4QM1A 1YIXA 4UWMA 2EO7A 2WVUA 1TO3A 7REQB 1O68A 2D3NA 3GXTA 5A8PA 4DAIA 5K9XA 3G1VA 4WJEA 5HQEA 4FAMA 1IQ8A 3STGA 1WKYA 3EWUA 2J7EA 3MKKA 5LIKX 4KMQA 1K8CA 1KM6A 3WDPP 3UESA 4HMNA 3TXZA 4GKLA 3IVTA 3BQ6A 3OG2A 4ORMA 1W5QA 4QG8A 2Z1BA 5G1YA 4DBWA 2D69A 2B7QA 3MKCA 2X09A 1UWAA 1AQHA 1D9EA 1TUXA 5EMLA 2EPMX 4IFOA 2XN0A 1WP6A 5A6AA 4PB5A 1ZHAA 1DWIM 1NFGA 2EHHA 3L0KA 2D24A 1C8XA 2QCNA 4EACA 2OZTA 4D6EA 5EPDA 3MT1A 3VGBA 4Y9PA 5EY5A 1SPQA 1LROA 1IR1A 1EBHA 4MYAA 2HPIA 2FVKA 3NQBA 3E12A 1MZHA 4ZEPA 2EKGA 4LSBA 2OJPA 4PRWA 1UOZA 4GFIA 4H9YA 1HJUA 1VEMA 4C6BA 1F9CA 1G4TA 2BHUA 3VNIA 1O12A 4GIYA 5EBUA 1FRBA 3E6EA 4DVOA 1S2VA 4EK7A 4IGNA 2YSWA 4PSRA 1XQKA 3ZS4A 3PR2A 4LUTB 5LNVA 3LCGA 3ORWA 3RDKA 3P80A 4IIHA 2WZMA 5BU6A 1UPMB 2G4FA 3WJWA 4ZTYA 4M56A 3FYOA 1EJUC 1FQ0A 2V2HA 4R85A 4BKNA 3G1HA 3CEPA 5C7HA 5JH2A 1JZ6A 2VEGA 2VGGA 2E68A 3ARXA 3BMWA 1Y65A 1KRAC 2WZEA 3U2OA 4CNNA 5JUVA 4GNKB 4L4LA 4Q8WA 3NJ3A 5K4ZA 4OTKA 2E09A 4HZ7A 3SFKA 4NYUA 4AYGA 2ZUUA 2W3ZA 4JN7A 3EX2A 3QZ6A 5IM51 5DLCA 4ZB0A 3TYUA 4D9PA 1JXKA 2DP3A 1TZZA 2P3ZA 4UR8A 1L8PA 1RQHA 4UNKA 1QATA 1BKSA 1CXHA 4E4PA 1EDQA 3GNDA 2FGBA 2QDDA 3HU7A 1K77A 1R87A 2J9ZA 1AK5A 2JKEA 4XISA 4K3ZA 3EX1A 5TIMA 3POHA 3ZMRA 1JEZA 2XIIA 1AL7A 4TTUA 4IJCA 3ZLFA 4B5XA 5CSSA 1FFQA 3AWNA 5EFFA 4GBUA 1X39A 2GJNA 3GVVA 2WNZA 3LA4A 5TD4A 3WENA 2WCSA 1GVIA 3FX4A 4DO7A 3GRIA 4PULA 1SW3A 3HQNA 1BGGA 2VTFA 3QOKA 4K39A 1BRLA 5DBTA 5B7ZA 5LHFA 4V1YA 4JIQA 1XFCA 4KIEA 1I9CB 4C90A 5HINA 1ZP4A 5GQBA 4UR7A 5A95A 4X2PA 2WV8A 4AY8A 3S1VA 2CXGA 1DJQA 1VIZA 4C65A 3M7SA 1FWFC 4B9ZA 2BHZA 2CXEA 2VX4A 3B0VC 4ERAA 1OFPA 2ZZ2A 4IXXA 2ZX6A 3P84A 1FWGC 2GK1A 5D9PA 4AY7A 1E1CA 1WZAA 1E9YB 1B3WA 4CUCA 4WLCA 3OYXA 1VHNA 3KL5A 2R1PA 4NZ5A 3VNJA 5HK4A 3NXFA 1Z89A 4MJ4A 4GABA 4WY0F 2R82A 3WDRA 1R86A 1SGJA 1OINA 3G1XA 1V03A 4US5D 1GHSA 1R3SA 4AHOA 2BVYA 2PEVA 4I5RA 4LBRA 1OFBA 4AF0A 4JTCA 1L2UA 5J8LA 4O1BA 3MSRA 4JFVA 2CBIA 3CUGA 1M04A 4QG9A 2PZNA 1P7TB 2Y7EA 4PBFA 2WNQA 4OV4A 3L12A 3VOJA 3LQGA 1KTNA 1NQ6A 4WDXA 2ZRWA 3N2TA 4A2RA 3H7VA 5D9NA 4B92A 2HVMA 3Q94A 2O9TA 4L9ZA 3FGCB 2PDIA 3NCOA 3K1GA 2WCAA 5M03A 4YIWA 3OVQA 5AB3A 1MWOA 4WJXA 1WQ5A 2OODA 1TX2A 1E40A 4CQ8A 4C6PA 4O12A 2YCLA 1KBIA 1QBAA 3LRKA 2X2GA 1VBGA 4C6NA 2WVSA 3HIJA 2ZZ6A 3L67A 2Y4SA 1PIGA 3OLGA 3M5VA 1XIMA 3BH4A 2C19A 1RCOB 4TQTA 2BWGA 4LVGA 3LSBA 3SGUA 2IQDA 4BQ2A 4ICMA 3WQOA 4WSKA 2MUCA 4B5VA 2OXNA 3PFMA 5AN7A 1GOWA 4R88A 1D3GA 3TAKA 4Y90A 1RXOB 3VIOA 3T0DA 2VZVA 3SY1A 4H9ZA 2UY3A 3B0YA 3BGAA 3A5FA 3LMYA 4DO6A 4F2UA 1GYMA 3MBFA 4DY1A 1RY0A 2OLHA 2PGWA 1ZAHA 2QNEA 1LLOA 2WM1A 3BSHA 3PNZA 2P88A 1TRDA 5LHEA 3BG5A 1PZ0A 3O9NA 1ODUA 2PB1A 1V3HA 4C1NA 5LA1A 3QV7A 4AW7A 5CLTA 3WJXA 1B9ZA 3PZMA 2G0WA 4JTQA 1GQKA 3U57A 2FYMA 3CEUA 1E43A 3PWAA 4FALA 1EL3A 5SWUA 4MF4A 2CLIA 1CXLA 2QEZA 2XIBA 3SCVA 4AIBA 5J04A 1JDEA 1JPMA 1DJGA 3PB2A 1QI2A 3H23A 3MV01 3CK5A 1K9DA 5BRPA 1EP3A 4CQDA 5I09A 1KTBA 2JKPA 4ZA0A 1QPOA 3R25A 1X97A 4EP8C 4QLKA 3WJSA 2QUUA 2I17A 3KWSA 3DBNA 4A8NA 1BXNA 2QZRA 2XH4A 1YE6A 3EOOA 4DNHA 1WXYA 4MM1A 4GXWA 2V5CA 4GK8A 1QRQA 2Y8KA 2ANUA 3G77A 3STEA 3G5EA 4GVHA 1EJSC 4LUSB 3VZZA 4MNMA 2WKLA 4DQWA 2XVPA 3QGVA 5KZDA 2CKSA 4JIIX 1E6QM 5DCDA 3SEPA 1KWGA 4HPGA 1YE4A 4IG2A 4GJJA 4M82A 3VNZA 1OK4A 3MKVA 1VP5A 3N6HA 4AIOA 2J7DA 4KWVA 3RM9A 1TTJA 2ZYFA 5DELA 1JVNA 5FACA 2D2JA 4GUIA 4Q7NA 3SCQA 3IV3A 4D6FA 2NV2A 3NXLA 1FY6A 1LG2A 4MB3A 4YWSA 2QPXA 3GH5A 1DHKA 1DKWA 2QCMA 4U2ZA 3KOZA 1GOIA 2QJHA 4OBTA 4BQ4A 2AGKA 2VD9A 3ABSA 4BQ5A 3BAYA 5AFDA 1OC7A 3GC5A 3NSMA 5TNVA 2OT1A 4XG1A 3V36A 2QCLA 3KLKA 5A2AA 2YYUA 5T91A 1J11A 1J2BA 4CQ9A 4Y6GA 4HNNA 3NFUA 3AIEA 3TQKA 4RW5A 2HQAA 1UZDA 1J0HA 2C15A 1L6WA 4AD2A 3B97A 1K9TA 4E4FA 3UEQA 2VC6A 2NT0A 1UMLA 4XVEA 2INEA 4ERIA 3A47A 5I23A 4PCFA 3CT2A 3MUIA 1NU5A 1KM4A 4KRZA 3W4RA 3GG7A 1GGOA 5AHFA 1AW2A 3LXBA 1PDZA 2GSHA 4R34A 2GYIA 3BQ5A 4H7VA 1OCNA 4G7EA 1W32A 3K8LA 3WBAA 3WDHA 2E5DA 1PV8A 1Q4NX 3PSVA 1TVPA 2GUYA 2WPGA 1YYAA 4OOUA 2YXGA 1TWWA 1HQTA 1JYXA 3IVUA 3SCNA 4N9BA 5HULA 1JG9A 5C55A 3WNLA 2WC3A 3FAWA 3Q4DA 3DESA 4L1WA 5DX7A 3RRAA 1J10A 3QTPA 3AIQA 1KBBA 1GOMA 4IUOA 4IGSA 1YTDA 1YDNA 1J18A 3WJZA 1M7PA 1W1A1 1SVDA 1SFLA 4OUIA 2E5BA 2YZRA 1S2CA 1E5JA 4AD0A 2DZAA 3CASA 1PTAA 2PP1A 4WR3A 3KDOA 2G95A 1H11A 5AKQA 4YHGA 5LNRA 1CWYA 4K8EA 4TXEA 2CHOA 2W27A 3EX4A 5AHNA 3AMCA 1LF1A 4KFPA 4D6GA 3S0CA 1H7PA 1H7RA 1XYBA 1R47A 4JHZA 4LAOA 4NNAA 2OZ0A 4BR1A 4DBSA 4U28A 4MAZA 1A4MA 1M6JA 3WNMA 3ONBA 3SSJA 4NYYA 1JUEA 3P5YA 3LTSA 1TTQA 3TR9A 4R9OA 1QNQA 5LXXA 4Y8FA 1UBPC 4N6FA 1UQYA 2HTMA 1IHIA 2D2OA 4IMDA 3DCPA 4NL1A 4WRHA 1CGVA 2D1ZA 3UYCA 4WSHA 3BMVA 3ZLHA 2YFNA 3G3DA 4ZE4A 3L23A 2BV9A 3EYPA 1GKRA 3FEMA 2OYLA 1LT8A 1RJRA 4RXGA 3NQDA 4IX2A 1UR8A 4R7WA 3HF3A 4GBDA 1KGWA 4KF1A 2V3GA 2F38A 1BAGA 2VWSA 2VFDA 4A8RA 1UD8A 2W62A 3V1PA 4KKXA 3MP4A 4JN8A 1EZ2A 2QKFA 3G3MA 1TA3B 3MO4A 3VINA 5JBDA 2UV8G 1BQCA 1A50A 4JHOA 4O10A 2R8WA 4DI9A 5EKYA 1W0MA 2NLYA 1ZGDA 4PB4A 1TKKA 3FDGA 4LC8A 2WBGA 4Q22A 1JYWA 3KXQA 4O1DA 1GVOA 2WMGA 1B9BA 2DZVA 1M68A 2V5JA 3RLVA 4JYDA 1DL3A 3CPRA 3GC4A 2PLKA 3OA5A 2GGHA 4V15A 1OFQA 4S3BA 3WNPA 5A6MA 1Q65A 2PZ0A 2WSRA 1K7FA 1T7LA 1QOPA 1UD3A 2DIEA 3F4WA 3AHTA 4U31A 4REQB 4IMCA 2WHLA 4IWWA 3EMCA 2WQPA 5FKYA 1G7VA 3THDA 4MDPA 3B9OA 4W8AA 3FHQA 1A4LA 2NVAA 2VC5A 1VBHA 3UY8A 4H83A 2I1OA 3ITGA 5U7SA 3IJ6A 1K8XA 3IANA 4N7QA 1MQPA 5LNSA 2QV5A 3LPFA 2BY0A 4X3ZA 1TPEA 4FI4A 2C6QA 3V5FA 3WQPA 2X0SA 3TTSA 4ECLA 3CZKA 3R13A 3AMKA 1TIMA 3NM1A 4S3EA 1ZJHA 4PUWA 3O0FA 5IHSA 3NIYA 3OQ8A 1TREA 2GSEA 1G67A 4J35A 2PURA 2PGFA 2CWXA 4PL1A 3KCLA 4HU3A 4FMVA 4U5KA 1TJ0A 1LRQA 1Q6QA 3P6LA 4DAFA 2PDBA 1M53A 2ZRYA 4QSHA 2XN1A 4J1OA 3SUVA 4V27A 1LZOA 1PS9A 3B40A 2FGZA 2ZZ4A 2YL8A 4F2TA 4PE8A 3G6MA 3C6CA 4NRRA 3D46A 4WDTA 3W0KA 3H2EA 3ZM8A 1XH1A 3WLRA 3HG2A 1SM9A 5JQ9A 4EANA 3V0SA 3WK2A 3P8JA 1O1ZA 5AZ0A 2X0HA 3DGBA 2PTDA 3IUIA 3BCDA 4MY8A 3BLFA 4Y9AA 3GIYA 4DB7A 2CZDA 2WMIB 3URNA 3SADA 1QJWA 1SZGA 1UP2A 1XYLA 1NAL1 3PAOA 3U0HA 1DXEA 2GVYA 3LTPA 1VFLA 4IMGA 2OQYA 1FWRA 4AEFA 2J77A 4M1BA 2FH6A 3GBEA 3HPSA 2TODA 4YYFA 4JQ2A 5I7GA 3CO4A 1LCOA 3W37A 2F2HA 3EXRA 5TF0A 3SY8A 2WW5A 3WELA 4YNGA 1LORA 1ZU8A 1I2RA 1D3CA 3QVQA 4O15A 2QLYA 2VNCA 3W2UA 3PBVA 3R58A 3N1AA 3W2MA 2FB2A 4DYKA 4EWJA 1MRAA 2OEMA 1BF6A 3VGFA 1SJCA 3BLOA 3OVGA 4MLRA 1FDYA 5BYWA 1QI0A 3W1LA 1Z44A 4D8LA 4S2CA 1Q6RA 3OLEA 2FJKA 2ZX8A 4D1IA 3T9PA 4C5YA 1W5OA 3SRKA 3OHIA 3UWZA 1NOWA 1XGZA 4E4UA 1NDWA 1JCNA 3LCHA 1XIGA 1CZ1A 4FXFA 4S3DA 2CERA 5CBJA 1O5KA 3W2KA 3GHRA 4QDWA 2PDKA 1SUXA 3D0CA 4RUBA 4LB3A 4UTTA 1P48A 3QGKC 3O63A 4CNUA 3W2NA 4H7ZA 5G1MA 3S5SA 5AC6A 2E9BA 3M7WA 1SFTA 2YDQA 2CNCA 2C14A 3F1QA 1A3XA 1GORA 5BOOA 1PX4A 4HYRA 3SAZA 2X2YA 3B4UA 3GZAA 1KLZA 5AYBA 2J8TA 4QE5A 4CD4A 4WD0A 4BY3A 2PC4A 1P4CA 3ZQ9A 1EBGA 1FHVA 4U4MA 3GNRA 3LG3A 4ACZA 1WBHA 2ZOXA 3GU2A 4OGZA 1KM5A 2Z4GA 4DXXA 3EBVA 2G8ZA 1OT2A 4UMCA 2QCHA 2W67A 1W1PA 2EPHA 1D7KA 5LZLA 1LBMA 4XZHA 5CPNA 2BGSA 3TTEA 1G01A 2WWDA 3N73A 1UWSA 4ONVA 4HNOA 3GTXA 1WAWA 4GG9A 3PPFA 1E0UA 4L4OA 3OBKA 1V02A 3QW4B 1H0GA 4X61A 3UJEA 4D6JA 1PEZA 2BSLA 2JKAA 2XHYA 1ODZA 2ZZ5A 3HGSA 3MZ2A 3BG3A 1PTGA 3LB0A 4MNKA 1WXJA 3GVRA 2X1SA 3LS9A 3GE7A 3M9YA 3WQWA 1ZZMA 3S4TA 1ONWA 1UWIA 3QXBA 4IGMA 1IWAA 3LLFA 1V79A 1QVBA 2VQUA 1JYNA 4J5NA 2V3EA 3VU2A 2POZA 1HL2A 1ISZA 2HPMA 5TAOA 1GW1A 1REQB 4YHEA 1SO4A 2PF0A 5D8ZA 1EQCA 1RPKA 2FDSA 5E0FA 3VA8A 1NM9A 1FDZA 2B7PA 3TYDA 4GIEA 1B3XA 2PSNA 5DCBA 1MW0A 4ZOEA 1X8FA 3UU0A 3MHUA 2OYKA 1WDPA 4RNFA 4UZUA 3ARWA 3HO8A 3W7OA 4GUFA 2V6AA 3LUTA 4DO4A 3BDKA 2C18A 2PDCA 3B9DA 2O0TA 6REQB 1MYRA 4E2BA 3TQ0A 3FW6A 4PEEA 3VIMA 4BK9A 1MZRA 3WUFA 2X1IA 1R3WA 2VX5A 4I3GA 4LCQA 3ZO9A 3BOXA 2J7HA 3WUGA 3CUZA 3TKFA 4CN6A 1S2UA 3LHZA 2VRJA 3ABOA 3ARTA 4PUJA 3HTWA 4B5SA 3W72A 1QHPA 3W01A 4NNCA 4LUIA 3B0PA 1WO2A 1V3KA 4DJFA 4MMWA 3WDIA 4RX0A 3B0UX 2DH2A 4YPJA 4LGXA 2X40A 4DHGA 3DG6A 3GB6A 4FOJA 3UR7A 3FA3A 1XSKA 3OO2A 4TOQA 2X1RA 1HGWA 1X1NA 5PTDA 1TWZA 3SGZA 5CJ5A 2CLKA 3VNKA 1SMAA 2NVDA 4GPNA 5KITA 3AXHA 4PUKA 3C2YA 1F3WA 4Q3MA 2QR6A 3MU7A 4DWSD 2REQB 2BDQA 3CGTA 4FNQA 3RUBL 3CIWA 4DJDA 5HWMA 3PZUA 4GHRA 1TZ9A 4YTQA 3FS2A 1DWGM 1EO7A 4TO8A 1TTIA 4FX8A 3ANUA 2KX9A 2VZUA 1CNVA 3KWXA 3GVWA 1U83A 4HU8A 2NXHA 3FN9A 3INPA 3L0GA 4JCMA 3DZ1A 1E73M 1WCGA 3B0XA 3FIGA 4ZQOA 3SN1A 3NPUA 3KDNA 3HMCA 4J9JA 2I5QA 4F0HA 5BU9A 4O8RA 1K1DA 5A2CA 4XKYA 4CQAA 3P0WA 1V6VA 3G2GA 1ITQA 2Y88A 1QNOA 3BCFA 1H5YA 2A6NA 4EXAA 2VDHA 3ZT7A 2AOSA 4WSJA 5GJPA 4NJIA 1XXXA 3NM3A 1VF8A 1YXDA 1F73A 3Q2DA 1NVMA 4CGTA 1XCXA 4ZOCA 4ZZ9A 5A1AA 2BY1A 1OBAA 3CAVA 1W1ZA 4U3AA 3TC6A 2PCQA 3M4HA 3M46A 2NX9A 3Q37A 5CJMA 4UOZA 2J27A 2PDLA 2PODA 2ZVRA 1JCTA 4DPPA 3W7LA 1JL8A 2V2DA 4DZHA 4WDWA 3RHGA 1A5SA 5GJNA 4UTWA 2V5DA 1BLIA 1UHVA 2FH8A 3IRSA 5TQLA 1KD0A 3F5LA 4JTLA 3T08A 1EPXA 2O7QA 3CIXA 3NL2A 2H9AA 3GX9A 1NEYA 1ITCA 3H2MA 1EIBA 3PK7A 3PWIA 2Z6IA 3MA8A 3ZR5A 3PS7A 3CXOA 4ZQCA 3GKFA 2NQZA 3W9ZA 2CZEA 4KEZA 3CL7A 4I9JA 1QUMA 3CHVA 2NV9A 1LOLA 4QG6A 3M0MA 2VMFA 5FEWA 3R79A 4NXKA 2EPKX 3EOEA 2I56A 1CGXA 5FEXA 3JU2A 1QT1A 1DIKA 3PTMA 2HS6A 3KBNA 4QE1A 2QF8A 5CSRA 5B80A 4JIHA 1CGYA 5E09A 1BTMA 3WH9A 4MZ1A 3KP1A 4R33A 1T5AA 3THCA 1UH2A 4MAVA 1ENUA 4LPCA 4JEJA 3RU6A 3MUXA 3W81A 3BO9A 5F1VA 1TWSA 2B4GA 2OWWA 2Y7FA 4F9DA 3R5EA 3EWYA 2W6RA 4UTFA 1FWTA 1H4PA 3N3MA 7REQA 1TWDA 1F8MA 2Z7GA 3HBLA 3B8TA 4GRSA 1R3RA 2Z25A 3U48A 2ZX7A 4XUYA 4QHRA 3BSGA 3PUEA 4GJIA 1EEPA 1KQZA 2QDHA 1EDTA 2V5KA 1DWHM 2ISSA 1QI4A 3GDRA 2XIJA 3GYEA 2XVNA 3B06A 3UR8A 4QFUA 4EIVA 4XZNX 5AC7A 5FEZA 4FHAA 3VD9A 3QRHA 4JKKA 3UYIA 3MP5A 4HGXA 5FF3A 5K7JA 3R11A 2XM1A 4JTIA 1P6BA 2ZUWA 5EBAA 3UGRA 8RUCA 3VZXA 4L61A 3FJLA 3NVTA 2DPEA 4M24A 4I9TA 3MHGA 4MHBA 3K2GA 2PTWA 4FZIA 1DQWA 3EB4A 3S8HA 1VFTA 4E3VA 1OX4B 1HKWA 5T9BG 1W3JA 4UOJA 2C0AA 4AIEA 4AZ7A 2D0HA 1NWUA 2OO0A 3TROA 3EAUA 4W8BA 3LK6A 4O1EA 1L6FA 2GGGA 1E0TA 3E2RA 5D2YA 4RZ4A 1K8ZA 2H90A 4FR1A 2O55A 1GVQA 3AYSA 1T8XA 1K03A 2DUXA 2YB1A 2YYTA 3AS0A 2VEPA 1V6TA 1XFBA 4BWLC 4RDZA 2IPGA 4LUTA 4FK9A 1OYCA 2HXTA 3DC0A 4F0LA 3V4BA 1GKQA 4GNVA 3CZGA 4HD5A 1I1WA 3BLEA 5G1TA 2DSVA 1DJHA 1O7AA 3VKAA 5FJTA 4AHQA 3MP3A 4ZQNA 1LL7A 2DSUA 2QGHA 1LDCA 5IFPA 1XYMA 3AUOA 8XIMA 4AZHA 3S2CA 4L6OA 1XHGA 1LLWA 1DJNA 4UTKA 6TAAA 3F4NA 1BYCA 1WKDA 3QBUA 1HFBA 1OX5A 1P0KA 2CLEA 1H09A 3IIOA 3ARRA 4Q8PA 2G4JA 1Y0EA 2WLYA 4CU6A 1ADSA 2YW4A 3F7JA 3I6EA 1UR4A 3BK0A 1ML1A 1YDVA 3BV4A 1US0A 1SZRA 4U3CA 4HOXA 4RNHA 4GC4A 3VX0A 4TX8A 2E9LA 4NILA 2FGLA 2WKJA 4AC7C 3ZWSA 4GX9A 1JULA 1W8GA 4E6MA 4INFA 3IJLA 2YBTA 5BRQA 3ITTA 4LOCA 2AQVA 4ZENA 1WE5A 2PI6A 4QROA 1FUYA 4QCEA 1FCQA 3ZFHA 5FJIA 4GIRA 4J3ZA 4QGCA 2DV0A 2GVJA 4IPLA 2X41A 3TZNA 4WQ6A 3PBGA 3DUGA 3NQAA 4CVUA 4K37A 3NO5A 3GH7A 3GW0A 3TEVA 1O66A 3N4FA 3G8RA 4OQVA 1W5NA 1ZUAX 3VIKA 3TH6A 2OYMA 4O52A 3R0UA 4X0VA 5IBXA 3XINA 2V5BA 4JZ5A 1WV2A 2EJ1A 1AMYA 3KUMA 1AQMA 4PMJA 3RO8A 2AQWA 3O15A 2PBGA 4FB7A 3MMDA 3ABRA 3WBXA 4GQBA 3A64A 3NO1A 2EF9A 5CZJA 3PUOA 1SMDA 4XSLA 1NP0A 2OSYA 2WQDA 2A6LA 4AHPA 1F76A 4JTUA 2Z00A 2A7PA 1FKWA 1X6UA 3W2LA 3IEBA 4UNIA 5HWJA 1W9VA 4F79A 2Y89A 4QP0A 3N9RA 1UBSA 4JX5A 1P7TA 2BOFX 3S9IA 3WH8A 4O0KA 1TPUA 5GVJA 3W1RA 3XISA 2RGMA 3HB9A 3DOPA 4JFTA 1RLDA 4XZ9A 3FGCA 1POKA 4L4PA 2EG6A 4WGHA 1QW7A 4HK6A 2E77A 1QAPA 4Q33A 1GYNA 4IFRA 2BX7A 3K30A 4LY8A 1E5NA 1SQ7A 2ZE0A 3GNNA 4Q4MA 3TU9A 1TYGA 3I3BA 5D4YA 2PWEA 3W1PA 4O18A 4A29A 1EIXA 1OGBA 4CD8A 3TTOA 5I2UA 3GDKA 4HCLA 4EF8A 1XD1A 1EZWA 5DCEA 4PTNA 1K6WA 5L9FA 1O1HA 1PAMA 2QJMA 3AUJA 3A5VA 2OX4A 5E9AA 1UMYA 4TMCA 2BB0A 4CCEA 3SGGA 2Z0IA 3OG3A 3I7QA 2YDSA 3W88A 1UJPA 3BJFA 1G5AA 3MS8A 4FEZA 4AD4A 1VZWA 4H8NA 2QUNA 2WWCA 2O92A 1RCXB 3QHNA 3KLLA 5D32A 3VOIA 3O7UA 1RUSA 2VT0A 3GIQA 3CQHA 2YDAA 1J8VA 2O7SA 1KR0A 1TMHA 1T40A 2J6VA 3WLMA 3KE0A 3U7BA 4MG4A 4B3ZA 1BGAA 3LNPA 3NL6A 4XAFA 3GQYA 3W86A 2R94A 1OF6A 4B3LA 1AFSA 4MKVA 2XGZA 1M1BA 1YXCA 3C8NA 2B81A 4GO9A 3SBFA 2J7FA 1NOUA 3T2QA 4GH1A 1A80A 1T99A 2PE4A 2PC8A 3WLNA 1M7XA 3H4XA 3VXGA 5H8MA 4YYCA 1JDFA 1BEUA 3O8AA 1UWUA 1HKJA 3BAIA 1J0IA 4I6VA 4OV9A 1SSGA 3A3XA 1QCWA 1DJYA 2X1TA 2VFIA 5C8BB 2PDWA 3TJIA 4IFKB 4J40A 4GYPA 1RZMA 4LUSA 1DTUA 1TR9A 2HVNA 1IV8A 3IACA 4OOZA 3QOMA 2WJEA 2VL4A 3GZ3A 5L6UA 1X7FA 2GDUA 1CGWA 2ONEA 3IGSA 3YPIA 1THFD 3AQUA 4F9JA 4IXHA 2GWGA 4CEUC 3AIWA 2OZ8A 1XBZA 1UIPA 1TE1A 5GNYA 2GUUA 3S2LA 4Y7EA 1Q7ZA 3APGA 4JTSA 1H7NA 3HV8A 4ICCX 1ZFJA 4NP7A 1TPH1 2OR2A 3SCUA 4LNYA 2GFTA 1MUWA 1MXSA 3KTCA 5E93A 2EXOA 3OW1A 3M64A 2PMQA 4S3FA 4W7UA 4XD6A 4PBEA 3VDHA 5E70A 1C92A 3BW2A 3QR3A 1YQ2A 1CXIA 5HAOA 4MFDA 1FP9A 3LZ5A 1IF2A 1XDLA 5HPOA 3CUXA 2D0GA 1IT0A 3VGEA 1S3TC 4B4FA 2V69A 1A5BA 3SM0A 3EOUA 4U5IA 1Z6KA 3URBA 3T1GA 5FESA 2RUSA 1NDVA 3EZ4A 4MZYA 2W79A 2CEQA 3VOGA 4ZQMA 3VE9A 2ZUNA 3RLGA 2J62A 3CNYA 3QN3A 5DANA 3L4YA 1JZ2A 3JR2A 1XGEA 3RMJA 2VFGA 4ZOAA 1I45A 3DXIA 3TXVA 1V6XA 1Q8JA 1ICQA 3R7MA 3GYCA 4C6CA 3LCFA 5MKGB 2BVTA 3EMQA 1O6IA 1QMLA 3ANYA 3LHTA 4DPQA 4FNSA 1PKLA 1C8VA 1J0JA 4H6RA 6TIMA 1YEYA 4XO6A 2DH3A 1Z41A 3DC8A 3SJNA 4GGBA 4DWSC 1NH6A 1XRTA 1XYCA 3GU9A 5EMYA 1LWJA 2JIWA 3EOSA 1UD2A 3TC7A 4KESA 5JIWA 5HR6A 2INZA 3BUVA 1FX6A 4C1LA 5HBFA 3QQ0A 4KBXA 1NF0A 3A9BA 4TV6A 3D6NA 2A2IA 3EX6A 5CAKA 1TFVA 4CD7A 4QQUA 2IXUA 2VFHA 1V02E 3GH4A 5BXRA 5I00A 4NF7A 2AQOA 2F8QA 2R1KA 4KGLA 3OQEA 3SN0A 3IIPA 2YR1A 3UF9A 2EAWA 1U5VA 1NDYA 4IPNB 1DJWA 4L9YA 1QXLA 2Q3OA 3UWVA 4IIFA 3EKGA 2BP1A 2J79A 1GJWA 1GEHA 2NXGA 1OM0A 1VFOA 1ZAJA 3ARQA 3G8EA 3VKDA 3GNOA 3SCWA 4Q6JA 4XZWA 1Q6LA 1XH2A 3RYSA 1MNZA 2HV5A 1LM1A 2OOFA 2P10A 2WCGA 1UD5A 5GJMA 2VWTA 2YLAA 2R1NA 5K3VA 1X96A 4JTFA 4N42A 1G7UA 1ZQ5A 1U2YA 4GLEA 1HF6A 1GQIA 3IS4A 2PP3A 1IT7A 1VRDA 4LALA 3TSDA 2JIEA 4Q8NA 3OJGA 3KOFA 2J24A 1UP3A 3TCEA 3DFHA 1UH3A 4LAZA 3TR2A 3EOLA 1TX0A 1JD7A 3W7PA 4DI8A 1RQEA 3NOYA 1EQPA 3OZOA 4IF2A 3OIHA 1VJIA 4ERGA 1SW0A 1ITXA 1TA3A 2PAJA 3QKZA 3Q67A 3DYPA 4HSOA 3O3RA 3U5UA 1TWIA 3QY8A 2ON3A 4GA8A 3R12A 4DXVA 3CU2A 1A3HA 1DYSA 4I7UA 2OSWA 5CGTA 1VC4A 3U2EA 1CW2A 3BOLA 4K1WA 3ZSTA 1QBBA 2V0TA 3MWCA 1YNQA 1LG1A 1YBQA 3RM8A 2QPUA 5A8QA 4DZAA 4E2VA 1DOSA 3V1HA 3OB8A 1E9ZB 3V0UA 3H54A 3S2JA 3BMXA 3E2VA 1X1OA 3RCYA 4UQAA 1XLJA 4REQA 1TPB1 2YXOA 2AMXA 3FAXA 4PN2A 2FLIA 4AX6A 2E1DA 4MTVA 5GNXA 3QW3A 5F2GA 2VFFA 2CLHA 4UTMA 3ARZA 2BVDA 3BJSA 3G1YA 1PX8A 5A6TC 1MSSA 2XVGA 4F8XA 2J78A 3V5CA 2ZXDA 1W9UA 3PZNA 4UTIA 4OU1A 4QJ1A 2ISWA 3SUTA 4LBUA 1XISA 2YCKX 3E5BA 3U2ZA 3KRSA 2LLEA 5LKYA 1WDSA 3CV7A 4A3RA 4GFSA 2QMJA 1NWSA 3LPPA 1FWAC 4XWUA 2HS8A 1OZMA 4FR6A 2E40A 3AXXA 1IGSA 3WLOA 1ITUA 2HROA 3U4AA 1OC6A 4KFNA 4OZOA 2ZA3A 3M47A 3QMRA 1M7JA 3P61A 2ZKMX 3DKLA 4UTJA 3VCNA 1Q6DA 4UMAA 1U1JA 1Y7VA 5CH9A 1W91A 2OPJA 3MYPA 2OGJA 4HHPA 2PLCA 1E55A 4LEQA 1EEXA 2JGQA 1C91A 3IJIA 1NTHA 2XJ7A 3QC0A 3VTRA 3UWEA 4PTVA 2HDJA 2NXIA 4GVFA 3HPFA 4C6QA 4DF0A 1GJPA 1C90A 3V5OA 3SCOA 1M01A 3NSNA 3CLWA 2WMIA 4MGGA 5F4SA 1UKPA 1P1MA 1A5KC 3RNDA 4KGJA 1NELA 1XS2A 4P8XA 4K8GA 1E6ZA 2UY4A 3KW3A 4C6FA 1JZ7A 3A13A 4H00A 2BS9A 4RE0A 1H49A 1PKMA 1WDQA 1E0XA 1TV5A 1A5UA 1EHAA 1KXQA 1YNPA 4IQJA 5ABEA 5AHLA 2GQ8A 3P5ZA 3BCJA 1HJVA 4ADTA 2WC7A 1JCJA 2RKXA 5CPLA 1M7OA 1WYIA 1XSIA 3KRUA 3TJLA 4NJHA 1ZBCA 2QXWA 3MC5A 2OQHA 4PMOA 3URAA 3WUEA 3AYVA 2NV1A 4O11A 1CXKA 3LRLA 5I6SA 1R30A 5EMKA 1OC5A 1XQLA 4PMDA 3MCMA 5LNUA 1FWEC 5I3FA 2KZHA 2OO6A 4ATLA 4AMAA 1OGGA 3R1ZA 2QS8A 1Q45A 4OBSA 3GHTA 4BEQA 1ZB5A 4C6EA 1HVQA 3LHVA 1HG3A 3OTRA 3QEZA 5HMFA 3TOYA 3VOCA 3VVGA 2VURA 2D23A 1W1IE 4NSBA 3VM5A 1UUMA 4O19A 2VP8A 2YFOA 1CDGA 1VBRA 4J4KA 3NQFA 5CKSA 1F07A 1WXZA 4BI6A 1V6YA 4DUXA 3NVDA 5FEPA 2P8BA 5EMJA 5BOEA 4RV3A 3DECA 3GR4A 3UA3A 4KRTA 1GUVA 1XKJA 1JGMA 3F4VA 1TSIA 2X8RA 2PS2A 1XI3A 5I3KA 2YOCA 4IIGA 2XN2A 4AVNA 2FPTA 5BCAA 5C0QA 2DFAA 1U5JA 3FJNA 4ENLA 3FEQA 3I4KA 4EPBC 2HSAA 4Q7IA 3TCSA 2PU1A 1OIMA 3W7KA 4XIMA 4O1CA 2PWDA 2TPSA 3PM6A 3W7EA 2P1FA 3FY1A 2FZNA 1CBGA 3HOJA 3RMEA 1IZJA 2VQTA 2H3BA 3V16A 3LHWA 4RW3A 3CL6A 3SRDA 2J9YA 4DO5A 4AH7A 4UZSA 1PZ2A 1MW2A 2WVTA 1W1VA 3LEPA 4C1KA 2VRKA 4F0SA 1JFHA 4NAFB 2OU4A 2HE8A 1REQA 1VKFA 3MTWA 1OFAA 4CN4A 3WLQA 2QUTA 1MRQA 5BXSA 4QISA 4C6IA 1CCWB 4PMQA 3VD3A 4WDUA 3F5JA 1O95A 1VJZA 4NKCA 3WQ5A 4P8VA 3HQ1A 1VYRA 2PDHA 2HRWA 3AHYA 1AQ0A 4P7RA 1EC9A 4HBKA 2XH7A 4MWAC 4S38A 3CM4A 1W2PA 3LPGA 4DUOA 3QSTA 2QDEA 3MI3A 4FNRA 4E0CA 4FLRA 1GOKA 5JH1A 4F2BA 2E7FA 3AJXA 4H9XA 1VFUA 1TV8A 1IZKA 5HR7A 3M0LA 3M0IA 1P0DA 3C2VA 4O50A 3ECQA 1OFOA 4Z1YA 1A5AA 4MVAA 3WF0A 5J5RA 3VK5A 3N29A 1TVNA 4JBRA 5HJXA 5E6ZA 1V6WA 2ZXAA 6XIMA 2DZWA 4Y8EA 4L64A 1C9DA 2DEPA 1LQAA 3L21A 4O28A 5FOOA 4PMVA 5CPTA 3UWQA 5F2IA 1NWTA 1H7XA 3GR8A 1QHOA 3RCNA 1KFKA 3CB3A 2ZUMA 3W28A 4RJEA 1GG1A 2IQ0A 2OT0A 5G5IA 2GJLA 3ABQA 1QW9A 3KRZA 1F7BA 4UCGA 4ZXLA 3BVJA 1Y5XA 1ZL1A 2HEJA 1TJ2A 3BV7A 3RN6A 1CXEA 1UR1A 2OFJA 1XLEA 2REQA 1YTKA 3DHFA 1UP0A 4MNLA 3GS6A 3SDOA 1XD0A 3PZIA 1HIZA 2BHYA 2RAGA 3LYEA 4UNLA 3NZGA 3MDUA 4E2DA 4NZ1A 3N6QA 3WD2A 4LVBA 4JICA 1N8FA 1E1EA 4EXQA 4PTWA 3LHUA 4O13A 3E0VA 3GG8A 2YKKA 4JQ4A 2V68A 1XV8A 2EKCA 3KVKA 5HWNA 2ALRA 3K1DA 4ZOBA 4G9PA 1GT8A 3FDKA 1AVAA 5F1UA 4AXKA 4J2PA 1JXJA 4B5NA 1P0BA 1PIIA 3CS2A 3W6YA 4XO7A 5MHBA 2FDMA 4BFAA 4O4WA 1VAHA 2NX3A 4KRUA 3CAWA 4AD3A 4LS0A 2I57A 5AHMA 1V7AA 1GKPA 2DVUA 3VKBA 1BTCA 3N15A 1JD9A 4JKLA 3THAA 1XUZA 4PCSA 3NG3A 4L9XA 3KOXA 4B2DD 2ZRZA 4LYRA 3WMCA 4RZ5A 4A4AA 4GKTA 1DJXA 3KTSA 3GDMA 4W88A 4P5UA 2GQ3A 2VDGA 1QFEA 2WSPA 5FCZA 4LF1A 2OZ3A 3UWWA 2GGIA 1XIBA 4C7DA 3UNTA 2XGIA 2W92A 2PGRA 2W66A 1W9DM 2PRLA 2XWDA 4PH6A 2R24A 1IWBA 1FXPA 4PB3A 5I3DA 4P7OA 3W25A 1GVRA 1DWFM 4A6GA 1KCXA 1W56A 1G0CA 1J4EA 3LENA 3OGSA 2J6XA 3WEMA 2E1WA 4RLIA 5H2ZA 1OFDA 1R7AA 2JE8A 4P8WA 2I9EA 3TZFA 4ZGYA 1BRLB 2VEMA 2ZDSA 4NRSA 1ZJIA 4LV9A 1EUNA 2WM0A 4UBPC 3CUFA 3K8KA 4QLJA 1YX1A 1I2OA 1V7YA 4LYPA 1KCKA 1Q7QA 3C86A 3LD5A 2E6AA 3U8GA 2C79A 3A21A 5XINA 3WDQA 4BQ3A 4BF9A 3EWWA 4MSSA 1QI3A 2ZIDA 4PGLA 2H8ZA 2IPWA 1PUDA 3SUWA 2ICSA 2P53A 5C9XA 3RIKA 4P7QA 2XFRA 1KA9F 4HJFA 3TW7A 1EHNA 3NDZA 4RNJA 4L56A 1KKRA 6A3HA 3VOFA 3TSBA 3R8GA 2WXDM 3DGRA 3N9SA 2VCAA 3ENLA 3O6DA 1VYPX 3WK1A 2ISDA 3ARYA 1ZAIA 2Y5SA 4FNPA 1MEHA 1GPFA 4X60A 4W89A 3WEZA 3PULA 4TIMA 1KWKA 5BXPA 2WAGA 4HZ8A 1Q3NA 1Z42A 2CLMA 2D22A 1BVNP 2PDPA 3T07A 4EKJA 3I10A 5AY7A 8TIMA 4EPEC 3FA4A 3CLMA 3AZTA 1LQ0A 3RAOA 1E3ZA 1N7KA 4WY0B 4W84A 2NWSA 3W26A 1GWJA 3NZ1A 4GZIA 2W91A 3DFOA 4WX2A 2Y7GA 4D72A 1Y5VA 2A3CA 2DSWA 5HMDA 3LSCA 4H1ZA 4L1GA 1L6GA 1OD8A 5FSDC 4LS2A 4YTUA 3HA1A 3L5LA 1YMYA 1XP3A 1KLYA 4EVZA 4JDBA 1OX4A 4H9UA 1PJ9A 4S3JA 5HJYA 1TRIA 2VKZG 4IQLA 3MWAA 3AIBA 2VEIA 5D2TA 1IIGA 1ME7A 1YPXA 3RK8A 1OGSA 3QY7A 1C8YA 1IYXA 5C71A 1XX1A 1ZBKA 3ZT6A 1V0LA 3AIRA 1G6CA 2C16A 4LUYA 1FHUA 3K4WA 1H7OA 1W5MA 4HNTA 1OX6A 4FXRA 3D47A 4HSHA 4DJEC 5LA0A 2GUBA 3FKRA 4K68A 3VGDA 1I0BA 1SR0A 5FL0A 4CCCA 4GWEA 4N9EA 2DQXA 2A85A 4LNCA 2XSAA 5F2LA 5JBFA 4CNSA 1HX0A 1PHWA 2ZRVA 3WLPA 2NQHA 3DHPA 4FPSA 3VIIA 2PGEA 1BF2A 2HMCA 5DMNA 3DFQA 3G1AA 3NEVA 3ID7A 4FF5A 1PHQA 1X38A 2XIQA 4JQAA 4HCDA 1QK0A 1XCWA 4JTHA 3EKLA 3HGOA 3MI2A 2VR5A 4RE4A 2OGYA 2R1LA 5AYZA 5HATA 4MWAE 4RXFA 1Z48A 2IXVA 4DELA 4JY8A 2VZTA 1EH9A 1A47A 3W1XA 1DEDA 4UR9A 4BEUA 4XIAA 5A8OA 3JZEA 4YWIA 3WF4A 2AAMA 5HXMA 1XIFA 1B57A 3T81A 3I6TA 1HJSA 2GSJA 4LANA 3RJYA 2Y85A 3MCNA 2G50A 3O0KA 4NJJA 2XSBA 2EEXA 1EA9C 3N2XA 4LS1A 3A4XA 1E6NA 3HQOA 4PUDA 2GPTA 4UMBA 1FHDA 2Y6ZA 1YADA 5I03A 4KWSA 4F66A 1BXCA 3G1SA 4TU1A 4IJBA 1FWWA 1GVFA 3LCIA 2QULA 1ME9A 2DU2A 5HNRA 3KOWA 4L1XA 3WL1A 3ZWTA 4I7WA 1EF2A 5C6MA 1KO0A 3KZPA 1KV8A 4C60A 3DU0A 5HNUA 4JXCA 1AH0A 4MZ8A 4ORIA 3TNOA 1OADA 4S3AA 2O4MA 3A12A 4HQVA 1VD6A 3PNUA 1H62A 5E0CA 5U4NA 1ZCCA 4I8DA 3REQA 4R27A 1W17A 2OB3A 3LN3A 3GDTA 3WUBA 1JJKA 2Q01A 2HVOA 5FSEC 2Z27A 3FJ4A 1CB2A 3DG7A 5D04C 4LFYA 5CZTA 3NSXA 3E2SA 4GCXA 1FA2A 2ISVA 4O1AA 1GOOA 5BWFA 1S39A 3DDMA 4R5EA 2QCCA 1DWAM 3H7UA 2VVNA 1SYTA 3MUY1 4YLWA 4O16A 1QDSA 1XYFA 3KAOA 2OEKA 1FWJC 3MW7A 4E5TA 3AHXA 3W85A 3LGDA 4HNLA 3IJDA 4WJ8A 4JTKA 4JOMA 3S47A 2E0PA 1XCFA 3P62A 3ZIZA 4JQ1A 4D8ZA 1QI5A 3NQGA 4GY1A 1JI1A 4KW2A 5T9CE 2R91A 3WF2A 5KEZA 2FPVA 4ZMGA 4HOWA 4ZQRA 3EX3A 3R6IA 3KM8A 3MDWA 4O8AA 5A6LA 4HZ6A 3RFAA 3QPEA 2BVWA 2MNRA 2XZ9A 1LP6A 2DT2A 1E9LA 1KBJA 3NOEA 4DM1A 1SU5A 3SQMA 3EEGA 3USZA 1JCMP 3N13A 1QR7A 4LVFA 1CGUA 2H8XA 1XINA 2ACRA 1AG1O 3TYEA 4IICA 2ZRUA 4FX7A 5A2BA 5BOFA 2DDXA 3CB8A 1GONA 2I14A 2VOTA 3T8QA 1W3LA 2PDUA 5E5CA 3PHAA 3TN6A 3O1NA 4NIRA 2ZUSA 5AECA 1TTPA 2OEJA 4A3YA 2QIIA 9CGTA 3QR1A 1KB3A 3AHVA 3W07A 5FF0A 3RLHA 1IEWA 2WMFA 3GTFA 3RX3A 3RITA 3U2CA 2ACQA 3UZXA 1IEVA 4UCFA 4HP5A 4LCRA 4ML4A 3TFCA 1MXGA 2HISA 3M43A 2J66A 4BJHA 3LCLA 3MSYA 2J9XA 3KRBA 4OHQA 4GI4A 2CITA 2UWFA 1EX1A 1Q2SA 4H2CA 2VC9A 3TV8A 1SO5A 4ADUA 3NEHA 4MB1A 3WQ4A 3LBCA 1W3TA 4YS1A 1B1YA 4Q4RA 2CLOA 1JPHA 3ZVHB 1J0KA 4CU7A 2ZXBA 1V3MA 3NR0A 1ZCOA 3PPGA 2QCEA 2PWFA 1Q6GA 2V5LA 5C2CA 3T55A 1UW9A 1NY1A 1TCDA 1GZ1A 3EDDA 3VABA 2BG5A 3VDAA 3L65A 4WOQA 3DI0A 3HJEA 1OJXA 1CT5A 2ZZ1A 3NGJA 2GJRA 4IFKA 3ITYA 3SRFA 5MF5A 4V2XA 5ECVA 1KCLA 3BLLA 4BF5A 1KXVA 4AEEA 4AB4A 3P67A 3MPGA 3QHMA 1X6NA 1J0ZA 1O94A 4H19A 3PSWA 4WZHA 1Q6OA 3BWWA 4M8UA 4Z2LA 2MANA 5ABFB 1RCQA 1VEOA 2QYGA 3M5XA 4GVGA 5HUPA 3HV9A 5AC8A 3ISIX 4N4PA 3WX7A 1JRBA 4PZVA 1ME8A 5G2WA 1GTEA 1OHLA 2WO5A 1KRMA 3BC9A 4MB5A 2Y5EA 4B5TA 2X30A 3DH7A 1YHTA 2IUZA 5AYXA 4M3PA 4LEFA 1XM3A 1PBGA 5KZEA 3A6OA 5EA9A 1OD0A 4O54A 4ML9A 1SFSA 1OQFA 3T05A 3VZYA 4DF1A 2ACSA 4LCSA 4N4QA 1HL8A 4Q8UA 2EGZA 2JBMA 1E0WA 4F0KA 5FF4A 2E8YA 3WSUA 4M6UA 3RU8X 4GY0A 2YA2A 1WOAA 5C70A 3BPWA 1X98A 4MFEA 4IUGA 4U2YA 1E71M 1WZKA 4PFHA 4FNTA 3SN4A 4Y9NA 3OODA 5CPQA 1POJA 1RBAA 5ABTA 2JEQA 1SSDA 2POTA 4M19A 1Y8BA 3I3EA 1NQKA 2ZXQA 2ACUA 3RRXA 2VDIA 2DY3A 2J4GA 3G22A 1P0EA 5MKGA 4Q32A 3LCWA 3B8SA 4NXSA 1ZBVA 4GD0A 2DZBA 4YVVA 3M1ZA 4A05A 4N02A 4XKMA 3RX4A 1S2AA 2FFIA 1XIDA 4NAEB 3IARA 2G37A 3FLUA 3UJSA 3RPTA 4HN4A 1EXPA 2WJZA 3NQ8A 2TRSA 1TPVA 2FFCA 1GQJA 4GNJA 1MI3A 2J74A 4M29A 1K9FA 1KQYA 4RE3A 1UOKA 4LQ1A 5C9RA 1T0OA 4FOKA 4ROQA 3IAQA 4YTSA 3VIGA 3UXLA 2TYSA 1S5WA 3GFXA 3PZ9A 2W0UA 1SZFA 1OYAA 1PYMA 3FK4A 3QPZA 5A69A 3MBDA 3T78A 3QQWA 4DEFA 1Q66A 2PLMA 3KEHA 2A1YA 3GKAA 3RLUA 1H61A 2CZVA 2WPBA 5KINA 4BA0A 1HKVA 2ZZ7A 3ARSA 3KCJA 1UG6A 1C93A 3KOYA 4PUEA 1ONRA 1ZJBA 3PBYA 4MJ2A 4Y96A 4HN8A 4XAPA 1G4SA 1JR1A 4HPHA 3SFWA 1LWIA 4P7NA 1EPVA 3HPXA 2Z1XA 1GJUA 4OT7A 1KRBC 3TIMA 1V5XA 3L4TA 4AISA 1Q4WA 1M65A 3DAQA 4Q8VA 3W76A 1YLVA 3TMLA 4LRSA 4O1FA 4ZL1A 1MW3A 4BHYA 4ICNA 3H2CA 2VUNA 4HIBA 3MSGA 1KGXA 3CHFA 3LRMA 2CU0A 3SECA 1A53A 2ZC8A 3NQ2A 3BSMA 4AG0A 1G9HA 5LGXA 2YGYA 4GQ0A 3BJTA 3CTLA 3Q58A 1NWRA 2WNWA 2WKGA 1K6AA 1UZHA 4JR5A 5M2FX 3M6DA 2CHRA 4M7SA 1KCZA 1UR0A 3W02A 3TWAA 3NO3A 2ZTJA 1SZNA 2XH2A 4L7ZA 4AZIA 1K7EA 1S38A 2YJQA 1JPIA 3EWCA 2FHBA 2YBVA 2W4XA 2I7GA 2HZGA 3CYJA 3W1TA 1K02A 3LBMA 4A8LA 2C7FA 1UWTA 3OGRA 2XH0A 2VUYA 4JNYA 1E56A 4BZYA 3K4DA 4YCPA 2C91A 3IPWA 4N0RA 1LRNA 1ONXA 3OA3A 3UW6A 2W5FA 1LT7A 2HCVA 1QPQA 4W9TA 3MVTA 3GVGA 3UETA 3GUWA 5D09A 2O56A 1CB7B 4UFLA 4M1RA 2OMAA 3AAMA 4RDYA 2RJGA 1ZNNA 3ARUA 4MUZA 1XLLA 1LQ2A 3TP4A 5BW6A 2F6KA 4IIEA 4XVDA 3W70A 2AL2B 2OKTA 1KFCA 4AFYA 3WIJA 1NDZA 3QJAA 4GCAA 4NZFA 3SQLA 1PX3A 1K4GA 1RR2A 1H1ZA 4QJ4B 2EJAA 3CWOX 3W1UA 4IISA 4IPIA 1FVPA 2PDYA 5EMMA 1TJPA 1FBAA 4ZCWA 4M6PA 2E6FA 3PTKA 2OSXA 3D3FA 1J5TA 1MNSA 3OGVA 4Z2KA 3MQTA 4FXJA 4NHVA 2HK0A 4S23A 1O4UA 1XG3A 2HNHA 3LU2A 3EGJA 1FCVA 1C7SA 5A6KA 4TR9A 2W9MA 1UD4A 2WANA 4Q4PA 2WZHA 4JNMA 3UJ2A 3QM3A 4HMEA 4QSFA 4HPNA 2YDRA 3P14A 5HANA 4CU8A 3CZJA 4FF7A 1DHPA 4PMZA 2EPLX 3MUZ1 4GUGA 3T0AA 3W7RA 1UCWA 4ZO7A 2Y61A 3JZUA 3STFA 3L9CA 2F6XA 3GY1A 2VEFA 4HOZA 1Z69A 2CYGA 4C6LA 4F3HA 1Q13A 1QWKA 5I5RA 3WMLA 3UQNA 2KAUC 1Q6FA 3T44A 4N9CA 4UFJA 2HWGA 1R6WA 4HU4A 3L5MA 1F8IA 1OF8A 2QV4A 4GACA 3N18A 3D5HA 3EPOA 1CYGA 4QAIA 3VGGA 4Q8QA 3ZR4A 4XZMX 1JNDA 4AZGA 2BLEA 3FOKA 3S5NA 3SB0A 3KL0A 4FS9A 4AX7A 3ICJA 2OTDA 1BG9A 1V0NA 2IW0A 3P81A 2X0YA 4HA3A 3BARA 4DF2A 4MY1A 1U1HA 3NZPA 5AC4A 2E6YA 4J27A 1RLCL 2OX1A 4V33A 2F61A 3IRDA 5G4HC 2HK1A 3TLLA 2CIPA 2V9DA 3N25A 2DZSA 2UZ9A 3H7RA 1GZJA 4POCA 2V63A 2PTYA 3PBWA 1SJBA 3M5YA 2YL5A 4OIFA 4M51A 2AKMA 3I6RA 1ZSXA 3ES7A 2CBVA 4J3TA 3MSDA 4J28A 1ZTVA 5A6BA 1G1YA 3TN4A 3L4WA 1ZJAA 2IPJA 3PG8A 1BSLA 2FZBA 4HTYA 2A3BA 3GAKA 3OYZA 7A3HA 4UXDA 7TIMA 2B7OA 1QNSA 3DFYA 4L5ZA 3UXDA 1Z8AA 5M17A 3LXCA 3GAYA 2X16A 3F03K 4BI7A 3T4CA 2IKHA 3DHUA 4JX6A 1HXJA 1QPNA 3GVQA 5K4XA 5IXEA 3WD4A 1E4LA 1JZ8A 2GLKA 1DTNA 4LJ3A 4RCXA 1HT6A 4HHLA 4RZ6A 3QHOA 2WMKA 3BLIA 4LH8A 5G4WA 4DJDD 1P0NA 3CH0A 2XVKA 5GPRA 1KM0A 3GLCA 1MEIA 2TMDA 1PXGA 4ACYA 1A3WA 3CUIA 4W5UA 1FH8A 2ZA2A 4GXMA 3E38A 3UZZA 4AY1A 4FXSA 3BAKA 4JTTA 2Y63A 3VYLA 3EXTA 3FJ6A 2FZDA 4WXZA 1UPPA 3LERA 3NNTA 3S46A 1TMQA 2HBXA 3ITCA 1FWCC 1E6RA 3E0IA 4NZ4A 4G5DA 4KWOA 2PDXA 3FNDA 3MVIA 2F7FA 2NQLA 3HURA 2Y8VA 3OLIA 3BE7A 4V1XA 3NZQA 3S1UA 3CWHA 4IP7A 4UFMA 4K38A 4ADSA 4NT0A 2E67A 3VDCA 7PTDA 3MMWA 4OKDA 1KBLA 2WYSA 1HVXA 2BMBA 4GINA 3EWDA 5H1WA 3M0VA 3BANA 4GZJA 3GNPA 4RDWA 1DORA 1G69A 3B03A 3SR7A 4UTUA 4NAFA 1EJXC 3H6OA 1S3HA 3KS6A 4IM4A 1P1XA 1F2JA 4LW7A 1G94A 3C4UA 1SW7A 4AWEA 3MY9A 1Q8AA 3HZ3A 3NPVA 1IEIA 3VAVA 3G0SA 1IXNA 5FL1A 1R38A 4LUJA 4IMAA 2YZ5A 1O5XA 3N2CA 4X0NA 5DMMA 3GXFA 4Y9MA 5LA2A 1ECQA 4PTXA 3C0LA 3NTYA 4JFUA 1VFHA 1P43A 5CEWA 4EWND 1JF5A 2CFFA 3U6WA 1G4PA 1I1XA 2GVLA 2JALA 2ZA1A 3MUCA 1RD5A 4JS3A 3TN3A 2RDTA 4DWSB 3CC1A 1QPRA 4PYSA 4YVXA 9XIMA 3SY5A 3WH7A 4LY4A 3R94A 1JF6A 4AZ5A 4PMUA 1I75A 4JIEA 4K7VA 4EOUA 4AD1A 5CC5A 1BWLA 1V3JA 2GL5A 1FH9A 2PTXA 1GVEA 1UQZA 3AU6A 2ZBTA 3S5YA 4JPGA 4H04A 5A5WA 1KFLA 4A21A 5I06A 2VCBA 4I7VA 1KM2A 1DIEA 1FCBA 2O9PA 1DJZA 4Q6XA 1QO5A 2DJXA 4LRTA 4AZBA 4B2DA 5M1TA 5HDRA 4Z17A 1BPLB 2QGYA 3RG6A 3QSRA 5I02A 3A3WA 1HN1A 1XLIA 4F48A 2DT3A 4UQDA 4WVXA 5LYRA 2QVNA 3K5XA 3SCRA 3SCSA 1UD6A 3N34A 3KZSA 1N8IA 2DVXA 1XDMA 1VB9A 3PUGA 1M41A 1EA0A 1X8CA 2GOKA 1FXQA 3W7CA 3S5ZA 1GG0A 1UJQA 3E9AA 2B0MA 2CZFA 3R43A 2Z1KA 3KP0A 1PB0A 1W5PA 3OP2A 1U22A 1YPFA 2VZOA 1D8CA 5DXYA 3STCA 5HMSA 1PIFA 5D9OA 4E8GA 1W6TA 5IFTA 3FYPA 3TNBA 1TPWA 4JL2A 4PA8A 2XG9A 3PG9A 2G96A 3FSTA 1CLKA 3C2OA 1EKOA 3WNNA 1SJAA 3T0CA 2QAFA 2PD9A 4Z1BA 4KT2A 5LNWA 1AW1A 3S6TA 1L6YA 2J88A 1VCVA 1H1YA 1JNEA 4DYEA 8XIAA 1B3ZA 2QVHA 1W37A 3IIZA 4HU0A 3UVAA 4OUEA 3WO8A 3TTYA 1BYDA 4ZBCA 2NQ9A 1S2TA 4IQEA 3W84A 1TB3A 4ZO8A 2VYOA 2NUWA 2WSYA 4YXGA 4G1NA 3PC0A 3KVLA 4XUGA 3EA3A 2A7RA 2F84A 2AGTA 3ERPA 4E38A 3EDKA 3M0JA 2WVVB 1TQJA 1C8QA 3W27A 1FOBA 2Z1VA 1JDAA 3N3TA 2A4AA 3FA5A 2PP0A 2PDQA 3WLHA 3UT0A 2DSZA 2QPSA 1LOQA 1N8WA 2I16A 4PR4A 3SUSA 4HKPA 1BKHA 1R7OA 2WHKA 3K13A 2C8NA 2XTKA 3TYCA 2Q8XA 1OB0A 4QS5A 1RJQA 2WC4A 1XRSA 2XIMA 2BNJA 1Q7MA 3G1RA 1HKKA 4PODA 5EL1A 4A3HA 3EA2A 1OZQA 4A3UA 1UR2A 3VD4A 1QTWA 4IGHA 3BLPX 3VIJA 2XISA 3AFBA 3LM3A 4NU7A 1FTXA 1CTNA 3CAQA 3AMDA 4H7CA 4QE4A 3CQIA 4UQBA 5G2IA 5FA5A 4XD5A 4S2BA 3LOTA 1XLHA 3RGTA 4IPPA 3TDFA 5CQ1A 4A22A 3N12A 1U1UA 1VPQA 3TJ4A 2OCZA 2FVMA 3OHMB 4F0RA 3ITOA 1Z3NA 3NQ6A 2ZQ0A 2VR2A 1T6MA 3PUDA 1F5ZA 4CCZA 2V2CA 4XD4A 3EWXA 3SSZA 5T8GA 1ISYA 3UZYA 4WY0A 3GHSA 4Z2JA 3KX6A 1RSCA 1Q2RA 1JQXA 3AALA 3HG4A 4GI9A 1XPGA 4XTIA 5KZMA 5DN1A 1F4HA 1ELSA 1FH7A 1WDDA 1I2PA 1EO5A 2A21A 1M9HA 4JNZA 2A3EA 4N2YA 1M03A 2CKRA 2PDGA 3B8UA 3KBWA 3UFYA 1AD1A 3UR5A 2VGIA 4MADA 1B3YA 3IGHX 4TV5A 3WMBA 2UY5A 5CC7A 2V82A 3I68A 1ZALA 3CZ8A 1S5TA 1BG4A 1E6XM 3CQ0A 5CLWA 3JUGA 3WDJA 5K9CA 3APYA 4ASTA 3PFRA 4KH2A 1RVGA 2WBKA 5CG7A 3F4DA 1R9YA 1OYBA 4ALDA 3UR2A 2HNEA 4MNJA 3WLLA 1LBFA 1E3XA 3MI6A 4NASA 2ZICA 1AD4A 2D2GA 5EB8A 1PYFA 1ONEA 1YXYA 2WMJA 4Q4SA 1NF7A 4KPLA 4XZIA 4CLMA 4KCVA 3TWBA 4S3CA 2Y0FA 4C6OA 3W38A 1BVWA 2YL9A 3V35A 3CL8A 3C0QA 3DERA 5E6YA 1EJRC 3S83A 5ABGA 1VLWA 7ODCA 1ZBWA 3QPYA 5K9DA 3IIVA 2OWXA 4NZJA 4KETA 1EJWC 4C6DA 4K36A 1ZP3A 2FTWA 4H9TA 3IJ9A 3WLKX 3F5KA 1W3HA 2RJHA 4WGXA 1IZCA 1IXOA 3DN5A 3ITXA 3DFNA 5LIWX 4TVCA 1UH4A 4TMBA 2PPGA 4O4VA 5G4EA 5D38A 2ASHA 3CUJA 4E2OA 1TV7A 3R8RA 1LRTA 1L2QA 1EJ7L 3ITVA 3PN8A 5GNZA 4LBSA 3QTGA 1JCYA 4LB4A 4AC1X 4XV0A 3VNDA 2ATMA 1D7FA 4R3UA 4UTTC 1RP9A 2BODX 4KQNA 1EF3A 2Y70A 6XIAA 3W7IA 3F2CA 3FXGA 3VKKA 1R0MA 4JKMA 4PRRA 3W1NA 3I7SA 3C8FA 1I8JA 4WHBA 3NQEA 3FV9A 3HG3A 3F2DA 1LUCB 3GD6A 3ABXA 4DWDA 3BXWA 3OEXA 4RDVA 4A8IA 3Q65A 1U30A 2ZC1A 1XYZA 1PKNA 3IK4A 3HN3A 3VCRA 3D3AA 1KFJA 3VKCA 3WLSA 4D71A 1R2RA 5CPOA 3TONA 4AWSA 2O9OA 4FIQA 1SR9A 4IJRA 3TTQA 3W29A 1YNYA 1W3IA 4US5A 1JRCA 2WMHA 1PL9A 3BZGA 4G7FA 1KXTA 4LTSA 5DFAA 4GO8A 1XUUA 4ZODA 1J12A 4DIAA 4K1GA 3N2MA 4XZLX 2FQIA 2PRMA 2NLIA 2HBVA 3S6DA 2XM2A 3NYDA 1TPDA 4PBGA 1V3IA 4GQGA 4YL2A 1J01A 5D8WA 4PMNA 7ENLA 1E72M 3VPLA 3CV1A 3M0KA 2DGAA 2XPKA 1EC7A 3RJXA 3IJQA 3E96A 4LT9A 4HMDA 1QPKA 1JAKA 4W85A 3MMUA 2EG7A 4D8AA 1HJWA 4BS0A 5F7UA 3G1FA 4MB4A 4A3QA 2QJJA 4JYFA 1DQUA 3CMJA 1UIOA 2VGFA 3EEZA 1J5SA 4MWAB 4ZQPA 4D6CA 1JUKA 5F4WA 3CH9A 2HXUA 3LI1A 4Z2IA 1F6KA 4O0ZA 4B15A 4W87A 4GIAA 3S5OA 3MB9A 1RH9A 3UGVA 3AXKA 3KL3A 5D9MA 4LV4A 5BWAA 2P76A 1XYAA 2VX6A 3EDJA 2QT3A 5EYWA 5I3IA 3U9IA 2CW6A 3QLDA 1FHLA 1RK5A 2JFEX 2VXNA 4HZMA 1XWYA 2D0FA 3B4YA 1W8SA 4P61A 5ENLA 4H6QA 4MOZA 4HA4A 3M16A 3H24A 1J6OA 4XAZA 1EWDA 4Q8OA 1F3TA 5I3HA 3O6YX 3MCOA 3UZWA 3UBPC 2HE5A 2ZDRA 3USBA 2UY2A 4GUHA 2C1IA 2ZE3A 2CCRA 2XIOA 4MWAD 1AZ2A 4M7TA 2WZTA 3DBPA 5XIAA 4DJFC 3SI9A 4CNOA 1AA1B 1VRXA 4R53A 4HYVA 3HMJG 3GDLA 3TVAA 4ZVJA 4YTRA 1CPUA 1SO3A 3SW6A 3NPWA 4TVUA 1IWPA 1ESWA 1WAUA 3EPNA 4OWGA 4EPKA 3DI1A 3R10A 3EKZA 1FP8A 5I24A 2VEKA 4HK5A 4B16A 4AQLA 1E6PA 4J7RA 4CVWA 3G24A 4GMEA 4Z1DA 4RK8A 4XBSA 3W7HA 4J3XA 4P7LA 4DJDC 1I4NA 3UCCA 3T0TA 1TG7A 1XL9A 1XLDA 2QIWA 5CSUA 1TV3A 1QOQA 3GU1A 2VZSA 4HHMA 4WXYA 3AOFA 2J7GA 4H9MA 1CECA 4U10A 4URIA 1NFBA 1J79A 4FLQA 2FB3A 3TW9A 1DE6A 4W4QA 1VCGA 3ZVHA 3C2EA 1JDDA 4L4MA 2QDGA 2OLSA 4MLJA 2NSXA 2QJGA 3WL0A 1PWMA 2YX0A 3ES8A 1W54A 4WIWA 3WNOA 1UA7A 1RPXA 3B8IA 3UJFA 1T8QA 3K8MA 3HPZA 3LGGA 2P8CA 4I9AA 3CHCA 3IUDA 2DZTA 3ZR6A 3AROA 1BWVA 1R3TA 2PWHA 3VUSA 3MV11 3LNMA 3UERA 3M41A 3VE7A 3MZNA 1N82A 1GCYA 4LF2A 4IPJA 1HP5A 1HW6A 4PFMA 4GUJA 3PBUA 4EAMA 2WK2A 4ZTXA 3PTQA 1BD0A 4WOZA 4GX8A 5AC5A 1KW1A 2PTZA 5ABFA 5CC3A 4PCNA 3W1AA 4YU1A 1YBQB 3H21A 1VBUA 5E9XA 3CIVA 3RPDA 3VO0A 5D30A 4N9DA 3S1XA 5CZ0A 5AZ1A 1EGZA 4FLSA 3VM7A 1GW9A 5KTLA 2YBUA 3UCQA 4IIDA 1RD6A 4KEUA 1XJBA 3WF3A 4UTWC 3L4UA 4HCHA 3ONCA 3T8LA 2Y62A 4L80A 1LL6A 4YCOA 1NIUA 1XLMA 3VMPA 5I79A 1ICPA 3UG3A 3BW4A 2J8FA 1HJQA 1KRCC 3AZRA 1N55A 3W6LA 1WKEA 3C56A 4NVTA 3UXKA 1AW5A 3ARVA 1DP0A 1WDRA 2ZUVA 1WZMA 3MYOA 3O6CA 1V77A 1K9EA 2G3MA 3NDYA 3WH6A 2G3FA 1PDYA 3XIMA 4JHMA 3E5PA 1V6UA 1V0MA 3TN5A 4PEKA 5LIXX 4MJMA 1XBYA 3RR1A 2DZPA 5DY2A 4M0XA 4QITA 1EWEA 1OABA 3M6YA 2A3HA 1Z7AA 1UKSA 3FSUA 4AVOA 1KV5A 4H6KA 3O05A 2VFEA 5I3JA 5CC6A 3IAPA 3OOQA 4RV8A 1B31A 4ZB2A 3N17A 4ILSA 1VQTA 2FMNA 2A79A 4KWUA 3UA4A 3ZJ8A 4NAEA 2VCCA 1OT1A 4MY9A 3OZPA 1MQRA 1Q85A 4LXFA 4HTBA 3BGGA 5D2VA 3NQMA 1CGTA 3M44A 5C2XA 1GNXA 5D2WA 1FWSA 2PA6A 4GISA 4NNBA 1J2WA 4FOUA 3CUHA 3DYMA 4AZCB 4NQ1A 3CZEA 4KCUA 5M3WA 2DSKA 1BYAA 2Q6ZA 4DRSA 3L4ZA 1AZ1A 1R85A 3TA9A 3QFEA 3LXAA 1JPDX 5J5DA 3QC3A 3THUA 1QWGA 3SIMA 3C2RA 1WUEA 2QCFA 4Z2GA 2XZ7A 4NZ3A 1I2NA 3PJUA 4O53A 1W1B1 2JQXA 3W83A 5CZSA 4I8YA 1UA3A 2NW0A 2E28A 2QAPA 1S46A 4XSMA 4F0MA 2G3JA 3ELFA 1TMLA 3WJYA 1V8EA 4XZBA 3CWNA 4Q4OA 2Y5JA 1V51A 1W2VA 4BWLA 4R7OA 2ATSA 1HTIA 2GGJA 5REQB 4KCWA 1PCKA 1MEWA 3T2PA 3S1WA 5HNNA 2CBUA 4QBXA 3FHAA 4EF9A 1DPMA 3WN6A 2QUMA 2PBOA 1LL4A 4NI3A 2WJDA 4B90A 5LIUX 3A4JA 1DXIA 3B04A 1EUAA 1W9BM 1D2KA 2ZFAA 5BXTA 2X7VA 5D33A 1J9YA 1RY8A 4DJED 4X2RA 3A9IA 2CHNA 5FJUA 5I77A 3WD1A 4AUBA 1RHCA 4W7WA 1LOSA 1BQGA 1W1TA 2FMOA 4A2SA 4ZO9A 1K8YA 1CI1A 2D73A 4G2DA 1ADDA 1MMFA 4I5UA 3VCCA 5CJNA 1RBLA 5G2HA 2CPUA 3TQPA 1OG0A 2AKZA 3E49A 2FIQA 3MJYA 4NX5A 3WD3A 2XFFA 1ADOA 1IGWA 3G6LA 3M0YA 4JCLA 1VCFA 1C9WA 2NZLA 4GOAA 4RR4A 3CO8A 3UXIA 1L0PA 2I5IA 4JDYA 3OVRA 3VMOA 5H91A 1J96A 5I3GA 3GNXA 2ADAA 3NA8A 1R2TA 1I60A 2RDUA 1FCUA 4JYEA 1C3FA 1MUCA 1H3GA 5F4XA 4Q8TA 4DZIA 1V93A 4WKAA 1VLIA 3ZSSA 2E3ZA 1ALDA 2DUZA 3CV6A 1UKQA 2AL2A 4JX4A 2J75A 4E3TA 4DLMA 4AXNA 3WKZA 2C1GA 2GJXB 4MYXA 4EE9A 4QX4A 2Q8ZA 1H0IA 2Q71A 4UTLA 4NUWA 4OVXA 2QHAA 3IGUA 5F2MA 4DNMA 3W53A 2VGBA 2P5NA 1KC7A 3PTDA 2XFWA 1GPWA 5IBXC 2WSKA 3QMTA 1WX0A 3SCTA 3KBMA 1JCLA 2YCJA 3H4WA 1JZ4A 1VFSA 6ENLA 1FWBC 4X9SA 4WUIA 1OY0A 1N2VA 4QJ3B 1UYQA 4MPQA 3VIPA 3L68A 1F6YA 4H8VA 4PUUA 3NYZA 2BZNA 3CJPA 3H53A 1OWQA 3PF3A 4UFHA 3LQLA 2AL1A 4PMXA 3PPCA 4UQCA 2YA0A 2ZX9A 3DIPA 3TUUA 3N4AA 3E0FA 3VGHA 2ZRXA 4QDMA 3CYVA 1GK8A 1R3VA 4HSNA 4NZCA 4OFCA 3WD0A 4C6JA 4M6VA 1EYWA 2G3NA 1W9XA 3A23A 5AHEA 2W61A 1B2YA 1IE7C 2BOGX 9RUBA 2VOMA 4YMZA 1F3XA 2G97A 1H1NA 3QY6A 1R2SA 4JGDA 5BZAA 1LJYA 3C0JA 3DYOA 3SZ8A 5CPSA 3NQVA 2JGYA 1XW8A 4GC3A 2GDVA 2B7NA 2AAAA 3H55A 5DRIA 1SFJA 5K2ZA 3VI2A 4A35A 3VC6A 3RILA 3VX1A 1B3OA 2BXYA 4DBUA 3L66A 4CN1A 4FO4A 4JQ3A 3UP8A 1VPXA 1KFEA 3HG5A 1VFFA 3GK0A 2V67A 3PWGA 3QV9A 2FZ8A 3L4XA 3T4WA 3E02A 4FP1A 3C2FA 1BWKA 5FAJA 4CKQA 4DX3A 2Z1WA 3AXIA 1BHGA 3PZGA 4NY2A 1XBVA 1U5HA 1VS1A 3LBOA 4AU0A 4F40A 2ZWZA 2GJPA 2VX7A 2E9MA 2HJPA 3IGXA 4S39A 3S6OA 1F3EA 2PF8A 4TTGA 1UUOA 4Z0SA 4Z2HA 1J93A 3DFPA 4OECA 2DZUA 4I90A 3AMGA 4UTHA 4YTTA 2Z26A 1TIWA 4I5XA 4G6CA 4HNUA 3IUHA 3WQDA 3N04A 1EJVC 4AIUA 2PRHA 4HYWA 4K7YA 4KFOA 4QLLA 3W2JA 1ZY9A 1QK2A 3UVIA 3DHDA 2FVLA 1H2JA 2Z24A 2BY2A 2NQ5A 3P7YA 4J3SA 4RKAA 3AXMA 3N2BA 2P0OA 3W7DA 3GM8A 1K3UA 5HJLA 2IKGA 2E25A 4K6AA 1HJXA 1YW1A 6ALDA 4AYSA 3ATYA 5B7YA 1E4NA 1OFRA 5DO8A 1A5OC 2F2KA 2XWEA 3OVPA 3QH2A 5EU9A 1VEPA 5EGRA 3RR4A 2XFYA 2WLZA 3LX9A 4JY9A 3V0TA 3ZZ1A 1PZ3A 2CZ5A 1EGMA 3IK2A 4XAGA 3LV5A 3OZMA 3OZYA 2DJLA 2GVEA 3B8VA 1Z32X 3GWQA 4HA1A 2WZIA 4JFWA 4ZR8A 4DM2A 4TX6A 5TBOA 3TOPA 4GYPC 4RL3A 3WBEA 1FKXA 1OCBA 2RFGA 2R1MA 3NQCA 2ZX5A 1A5MC 3CMFA 3AU2A 1MO0A 4WK9A 2GZXA 3WFZA 1HZYA 2QMKA 1R5YA 1A5NC 5H8PA 1OG6A 1UZ4A 4H8HA 3E2QA 4DLFA 4AEOA 1ZS2A 5DQPA 2VENA 3WQ6A 4ZB5A 3UG8A 1QHZA 2QCDB 3SQSA 4AVFA 3ZLGA 4GQRA 3NAVA 1RP8A 3T42A 4D1JA 1PSCA 3UWYA 1TCMA 4H01A 2UBPC 3R2GA 4BCEA 4JAWA 5D03A 2G5WA 4GE8A 1XDJA 4Q8MA 2YCIX 2DZXA 3AIVA 4DBDA 3AHZA 1MDLA 1B90A 4XB3A 1PCWA 1ZENA 4PUNA 3TYAA 3QV6A 4C91A 4JIRA 1VIWA 4FX6M 3LLXA 5LSMA 3ALFA 4QTGA 4IL0A 5AVNA 1UWQA 4ATWA 3W1QA 2Z7KA 1JGIA 2EQDA 3GTNA 3WFAA 2TAAA 6REQA 5JBEA 4RNIA 2DIKA 3IJ8A 4GH3A 4GY7A 4LX4A 4DWSA 1H5VA 1TZ7A 2ZCGA 2PWVA 1KNWA 1TPC1 1XLGA 1WB0A 2R6OA 3W3OA 1IEXA 1JPKA 1UR3M 3CPGA 1IR2A 2VI0A 1JUBA 4J2MA 2WSQA 3WG6A 4OBRA 1YDOA 3MHFA 3QYQA 5D37A 3BLDA 1JCXA 5DY3A 1EXBA 3BICA 4ZXOA 1GOXA 1EB3A 5A6SA 3FVDA 4QQ3A 4MUPA 1IXPA 4KCTA 1I6NA 1GOQA 3BTNA 3BURA 3OU8A 4J3WA 4GXPA 4UUIA 1MUMA 1NP2A 2V8ZA 3SURA 4LVDA 4RPQA 1B4KA 2Q8LA 1B54A 3BLKA 1CEOA 1HKIA 5HMEA 4L6DA 4L6HA 4XBJA 3VD7A 4CD5A 2Y24A 2Z2AA 2PWUA 1XIJA 3PP7A 4C7GA 2FHCA 1NSJA 1TUFA 3AISA 3CQJA 3IVSA 3DKJA 1Q63A 4P8UA 3AMLA 2A3AA 4EXBA 1HP4A 1RVKA 2FKPA 3H8AA 2ZWYA 4JTGA 4UC5A 2RDXA 1XGDA 1B3VA 4DXKA 3W7QA 3P60A 3V3WA 4M81A 5CGQA 3C52A 4D6IA 5I78A 4QEEA 1X1ZA 1WUFA 2XDFA 2FZ9A 3WYZA 2Q02A 4NG3A 1LYXA 2QW5A 3IIXA 5KSWA 5AVHA 1V08A 3KBJA 4H41A 2DW7A 2WJFA 3PVFA 1UROA 2Y8UA 5DF0A 3R0DA 1KXHA 4KEMA 1V3LA 1XLKA 2Q09A </