4NAEA

Pcrb from geobacillus kaustophilus, with bound g1p
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
225
structure length
219
Chain Sequence
EIRAWRHVFKLDPNKPIDDERLERLCESGTDAVIVGVTIDNVLDLLARIRRFSVPCALEVTDVLTPGFDVYLVPIVLNSRQAEWIIGRHHEAVKQYGDMMNWDEIAAEGYCILNPECKAAKLTRADTELDVDDIVAYARLAEHLYKLPIFYLEYSGVYGDPSVVEKVKQALDQTQLFYGGGITTPEQAEHMARYADTVVVGNAIYDAFEQALATVAAVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heptaprenylglyceryl phosphate synthase
publication title A comprehensive analysis of the geranylgeranylglyceryl phosphate synthase enzyme family identifies novel members and reveals mechanisms of substrate specificity and quaternary structure organization.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase
total genus 73
structure length 219
sequence length 225
ec nomenclature ec 2.5.1.n9: Heptaprenylglyceryl phosphate synthase.
pdb deposition date 2013-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.390 Alpha Beta Alpha-Beta Barrel TIM Barrel FMN-linked oxidoreductases 4naeA00
4JEJA 3VKAA 4NAEA 3W01A 3VKDA 2F6UA 2F6XA 3VZXA 3VKCA 1VIZA 4NAFB 3VZYA 4MM1A 4NAFA 3W02A 3VK5A 3W00A 4NAEB 3VKBA 3VZZA
chains in the Genus database with same CATH superfamily
3RUBL 3E0WA 4LJ3A 3UYCA 1K8CA 3K1DA 2HQAA 3M64A 4DB7A 4DAIA 3BICA 3B9DA 1HX0A 2AQWA 1JXKA 1OX5A 2VEKA 4J3ZA 1F7BA 4B92A 3SSZA 2FYMA 3VIJA 1ZLPA 4W93A 4KF1A 4H19A 5HMDA 1W9UA 3IJ7A 2X16A 3SI9A 3GAYA 2NUXA 3A6OA 1S46A 2Y4SA 5HOSA 1ONWA 4QTGA 4C6OA 5L9FA 2QDGA 3VD5A 4GVGA 3ZJ7A 4AZ7A 1FH9A 1A5MC 2UZ9A 3T1GA 4QJ4B 4MKSA 3IGSA 1OSEA 4U2YA 3A4JA 5HQMA 1GPFA 1WKFA 3EXSA 4QG9A 2PD9A 3HPAA 2J79A 2ZZ3A 3SJNA 2OVLA 1VENA 2I9EA 1MWOA 3EYPA 1JCNA 1OFEA 4LC6A 4IFRA 4X2RA 3SRKA 4XO7A 4AMAA 3CLWA 5GVJA 2J88A 4RW3A 4OU1A 3I68A 1WO2A 2V5CA 3IJLA 4QGCA 4WK9A 4F0KA 3QYSA 4DO5A 1OK6A 5DRCA 3E0VA 3NVTA 3VKKA 1J0IA 3DI0A 3ITXA 3QXBA 5LNWA 3LV6A 4G7EA 3B9NA 1VGAA 3WMBA 2GOKA 1O4UA 4S3AA 5AOUA 3AXXA 2X8RA 4U4MA 4MWAD 3VD9A 4DWSB 2DZAA 4US5D 2ON3A 4ZODA 2EG6A 2Y85A 3BTNA 4O0QA 5H8PA 3IGXA 2HISA 3QOKA 1VYPX 3UJFA 2J9ZA 1XINA 3SB0A 3MYOA 2EG8A 4NSBA 4JFTA 1J0JA 2WZHA 1IIHA 1R38A 1S5WA 4FXRA 1TPVA 3HPXA 2F6UA 3BW3A 3MCMA 5A2CA 3CHCA 3NZRA 1QI3A 4WIWA 4YWSA 1BVWA 1WB0A 4J1OA 3TKFA 1EP2A 4DM1A 2DVTA 1Q6LA 3EPNA 1IR2A 2WMIA 4WEVX 3W6YA 3BSMA 4IP5A 1UUQA 3IIVA 4DUVA 5AFDA 4D8AA 1RQEA 1CBGA 4S3CA 3USBA 2JKPA 4O1EA 4R9XA 4ADTA 4GYPC 2VQUA 3SQLA 3VIIA 3CIVA 4WF7A 4IXHA 4JX4A 4G1KA 1TSIA 3SCTA 4M24A 3GG7A 1Z9AA 2EEXA 3CQIA 1LWIA 1DWJM 2PRMA 4K38A 1RPKA 3FKKA 2J7DA 1KKOA 3JZEA 3HBLA 4PCSA 2TPSA 3NGJA 3SCVA 4U5IA 2WQPA 3G5EA 1G4SA 7XIMA 4JHZA 4MNMA 2YLAA 1I60A 2VFIA 2NLIA 4DZHA 3NJ3A 4U3CA 3NUKA 3MSYA 3UXKA 2YBTA 4EF8A 1SFJA 1B30A 3H2OA 4IH3A 4GGBA 1NARA 3ZLHA 2Y5SA 5C9RA 1RR2A 4LYQA 4ZQOA 1B57A 1L6GA 1WBHA 3W37A 5KZDA 1IT8A 3IJDA 5FF0A 2GJNA 3EOLA 4IIEA 4PE8A 1X6UA 4QDPA 1HP4A 1SO3A 3B04A 3DC0A 4TV5A 3S2MA 3W1PA 3ALFA 4C7GA 4YCPA 4AY8A 5DMYA 2XWEA 3LCFA 4XAYA 1FTXA 3BJTA 5HINA 3T40A 1BVNP 5BNKA 2Q8LA 4LQ1A 4MPQA 1QOQA 5FF4A 1AZ1A 4MKVA 1F74A 3E2VA 3B0UX 4MJZA 4AZ6A 1MW2A 4Q6JA 1JXJA 3LM7A 4XWUA 2DQWA 4YMZA 1MW1A 1YE6A 3THUA 2WKGA 5DT7A 4ZO8A 4PFMA 2WMHA 4GINA 1BF6A 4DUOA 1UQZA 3VKAA 3CXOA 3MDUA 3RCYA 5U4NA 1XS2A 3VIMA 2J7GA 3N9KA 5AC7A 2ZOXA 2IPFA 1DJGA 3GM8A 3NZPA 3AWNA 5KSWA 4IT1A 1AQMA 1AUSL 4MAVA 2ZVIA 4AC7C 4GVFA 3VMOA 4AIOA 4AZCA 3SQMA 2YKKA 3TTYA 1VB9A 2X7WA 1ITCA 5IDZA 3GDMA 3RR1A 1QK2A 1HVXA 3UYIA 4LS2A 1E0XA 5I79A 4Q4MA 2C14A 2CHOA 1UOKA 3G1AA 2R24A 4RZ4A 3CMFA 1V7AA 1W91A 4DWDA 3MZ2A 4AF0B 1WXJA 1ECQA 3NQ6A 4Q8QA 3PB2A 4YTSA 2DUZA 1YX1A 1A3WA 3HQ1A 1L8PA 4YIWA 1TJ1A 3P2VA 4LW7A 4QJ3B 1EQCA 2ZRXA 3KWSA 3NDZA 5CLTA 2FTWA 2OYKA 3OP2A 1OZQA 4BA0A 4ZSTA 5FJIA 3W3OA 2F61A 3LMYA 3QTGA 2KZHA 3RPDA 3NQEA 3QZ6A 3UWUA 4LNCA 1TJ2A 2HSAA 3B9AA 2GQ3A 3OZMA 1UP3A 1FRBA 3UJEA 3WQEA 3NIYA 2OGJA 1C8QA 5FJOA 2QUUA 1UR9A 3N9RA 3T6CA 4PMDA 1SZFA 1M03A 3QC3A 1R2TA 2OO0A 1K9EA 4NZCA 4EF9A 3H7RA 4S2BA 5CC7A 1PIGA 4XSMA 4IQEA 1V79A 3Q37A 2WM0A 1R47A 4CCZA 1UPPA 2EPKX 1CB7B 4GE8A 2J9XA 1OC7A 3A9BA 1B3XA 4X9YA 4GC4A 3LX9A 4CQBA 3MKKA 2GSJA 2ZX9A 2QCDB 3S5NA 1F3WA 3GUGA 5BWFA 2ZZ1A 1MXDA 2G95A 4E5TA 3G1XA 4RV3A 1EBHA 4B5VA 2G5WA 4ATWA 3W2UA 3MZNA 4QBXA 4IMAA 2J7EA 3OQ8A 3E96A 1FWTA 2Z28A 4Q4PA 5TQLA 3ES7A 1W3KA 1XLKA 3TWAA 4GABA 3EWBX 2D2HA 7PTDA 3CUJA 3MVTA 5CBIA 1PEZA 3WFAA 1HO1A 2NX1A 4IL0A 4C6QA 2WQDA 1OFQA 3AIVA 2BGNE 1XLBA 3CGTA 3M07A 2J24A 1W2PA 3VDAA 3TLQA 1DIDA 5K4ZA 3GE7A 3KTSA 4CN4A 4IQLA 1XDLA 1ME7A 4GY1A 3WNKA 2GUYA 4B91A 2PWGA 2PBGA 3GDBA 2WANA 3KW3A 5BOEA 3PJWA 3RM4A 2CLFA 5HNNA 4GYFA 4A05A 1LUCA 1IHIA 4LY8A 4UNLA 2YXXA 3R79A 4BF5A 4JR5A 3LHWA 4V2XA 2IKHA 1EH9A 2OWXA 4H9MA 3TU9A 2ZWZA 3W7HA 1JJKA 4C6PA 2VENA 3VNIA 2YDQA 4PZVA 1XYAA 2QJJA 4YLWA 1ICPA 4DI9A 4DO7A 1LM1A 1DJYA 3UWEA 1GKRA 1J0YA 1W1PA 3VFLA 1XYLA 1MEIA 4AEEA 3SM0A 4OKDA 3W84A 2OZ0A 1PTAA 2GDQA 3M5VA 2P88A 2XH0A 3DEQA 3HTWA 2DV0A 2EHHA 1V51A 3H2FA 5CGMA 4UFIA 1ITXA 1M01A 1YKWA 1F8MA 5C9WA 1PAMA 1VFHA 5K9XA 4LBSA 2HXUA 3WDIA 4G7EB 3U5UA 1Q3NA 3B0VC 4BY3A 2YFOA 4EK7A 2W5FA 5JBDA 3L7RA 1JF5A 3KOWA 3PZGA 3RMJA 5BRQA 3W9ZA 3EEGA 3FHAA 3KAOA 2PBOA 2PFHA 2Y5EA 5EU9A 2V9DA 4GYPA 1NAL1 3PP7A 2OQYA 2SFPA 3I3DA 3EAUA 1UWSA 2IKIA 3KS6A 2QXWA 2FJKA 4Q4QA 3IGHX 3VE7A 3WD0A 5JBFA 5LIXX 1DE5A 4TTGA 1XG3A 2DZWA 1HN1A 1HGYA 1KCLA 5BU9A 1TREA 3PG9A 3U0HA 2WMIB 4LV9A 2CLEA 5RUBA 2WJDA 1OX4A 5HK4A 4LUSA 4OOZA 4GRSA 2ICSA 3MUZ1 1VRXA 1XKYA 1LL7A 1X6NA 3SRHA 3VGDA 3I7QA 3C2EA 1S5NA 4NX0A 4AX6A 3BAKA 3KBWA 2Y7DA 2WO5A 4RDWA 1VPYA 4CNNA 4KRUA 3ZT5A 4H9VA 1X1OA 3PTMA 5G2HA 1CLKA 5DEZA 1G7UA 1ZRQA 1GYMA 4YTQA 2OEJA 1A53A 5AHMA 4MOZA 4O16A 3DHUA 4PUDA 3VD3A 3TDFA 3KBMA 4M29A 1L8NA 3LENA 1XBYA 1KM1A 1RSCA 3T0BA 1WDSA 1DKWA 3W1LA 4CN6A 2VDIA 4NXSA 4FNUA 4A35A 3W6MA 3TR2A 5HMSA 4J3XA 2ZRZA 3TSMA 1AK5A 3RDKA 2B0MA 5D2VA 4AUBA 4ZOAA 1SFTA 1VFLA 2PF8A 3RK8A 3LXAA 4I7VA 2RDXA 3APYA 4YVXA 4O8RA 2WBGA 1GVRA 3P74A 2V8ZA 4LVFA 3O07A 4M1RA 3UWVA 4KERA 5HMFA 4U2ZA 4UMAA 1EIBA 3WK2A 2PGEA 4S2CA 3CB3A 3MMDA 2A3CA 1XG4A 4BQ3A 1B9BA 3TA9A 5AHFA 1JCYA 2HVMA 5KZEA 4KBXA 3W25A 3T07A 1Z7AA 1D2KA 1QI2A 1O1HA 2AL2B 1QWKA 3TX9A 2XJ7A 2DT0A 5BXTA 4B2DD 2I56A 1I2RA 1OT1A 4ZMGA 1EJXC 2PDWA 3NL2A 2CKSA 3FXGA 3D3FA 2PE4A 1R9ZA 2DZUA 1JD9A 3P61A 4Q4SA 2BY1A 3B9OA 2W92A 3EX2A 5I3IA 4S1FA 2FJUB 2ZADA 4Z2LA 1EEXA 1GQKA 2V2HA 1K70A 1TZZA 4AD1A 2WHMA 1EUAA 4FI4A 2ZDSA 1W5NA 2X0YA 1QT1A 4UWMA 2J8TA 3FVDA 1J9YA 2WSPA 3UJ2A 3GO2A 1NFBA 2J8GA 6A3HA 4PB4A 4J3VA 1PKYA 1A5LC 3O6DA 4OBTA 5DX7A 3HQOA 4AZCB 4LT9A 1Z3NA 3OGVA 4IOTA 1YDOA 1IEIA 1GYLA 3MO7A 3UERA 2OWWA 3P5YA 4GIRA 1TE6A 2Y61A 2F8QA 5AN7A 1B3YA 4M7TA 2YA0A 1AH0A 1MDRA 1NWSA 2X1IA 1E3XA 5F4XA 3O63A 3TXZA 2A2IA 3WNOA 4C1KA 3CZJA 4CD7A 5HR7A 2ACUA 2DH2A 2ZE0A 1E56A 1B90A 2ZRYA 1Y5WA 3A4XA 3TEVA 2PTXA 4E0CA 2GUUA 1CXEA 3NOYA 4QNEA 2FGLA 3TYBA 1RZMA 3QV7A 4D6FA 3R2GA 3NGFA 1TTJA 4DNHA 1DIKA 3BJFA 1LG2A 4IF2A 4GXPA 4TMBA 4OECA 3S2CA 5HJLA 1H63A 2YCJA 3TW7A 3GHSA 3TE9A 5A6AA 1D3HA 3LXCA 2V6AA 3KRSA 3OEXA 4J27A 4LUYA 4OBSA 4PN2A 3WUEA 5JU6A 4AD2A 2BS9A 2VNCA 2V3DA 2INEA 3D5HA 3QW4B 4UR9A 4CQCA 1DBTA 1S39A 5AC4A 5FD0A 5C6MA 4QQ3A 1H60A 3BG9A 1S5TA 1W9BM 1VBHA 4JNMA 2D2OA 1B4KA 3VD4A 4KIEA 1KM5A 4BI7A 1GOXA 3HG4A 3P84A 3W7JA 3FW6A 1J01A 1Q7MA 1BRLA 3O8AA 3QR0A 4BKNA 2WMJA 4TTUA 2X1SA 3VILA 2VEMA 4XUYA 3IJIA 4HQVA 1FWDC 5D9PA 1CEOA 4HJFA 2QIWA 1PB0A 4EOUA 1M53A 1BXCA 4ZFMA 2Z27A 3CV2A 4OVXA 3LCWA 1A47A 3M46A 1LOSA 3VNDA 5DO8A 1NQ6A 4F79A 1I4NA 4GBUA 4Z2JA 2ZXQA 1CGTA 3QOMA 2WCSA 3WMSA 4WXYA 1C8VA 3VINA 3S5OA 3T55A 4IPPA 4LVGA 3AWOA 2HJPA 3PFRA 4YHGA 3MBDA 1BWVA 2J47A 3DENA 2XPKA 3GKFA 3SCPA 3VVGA 4LUTA 3MDWA 4FF7A 4MY9A 1SSDA 4JIEA 3II1A 1U2YA 1V6UA 1R3SA 1Q6DA 2J8FA 3SEPA 4L4LA 1US0A 1LUCB 4LEFA 3QPYA 3AMGA 5A6LA 1MSSA 5K2ZA 5DN1A 4CUCA 5JBEA 4DXKA 1JGMA 1V0KA 4X63A 5A1AA 4Y8FA 1J2BA 1M3UA 3RU8X 5CPQA 1UJPA 2DQXA 5IRPA 1Q2SA 1W3LA 2ZXDA 4TVUA 1OHLA 4IPLA 2NQ5A 1MRAA 3FJLA 2NQZA 1YRRA 1QNSA 2X2YA 1XCFA 2OODA 4ALDA 3ZO9A 4TR9A 2Z6IA 4O1DA 4GQ0A 4CQDA 1Q2RA 2FTYA 1E6PA 3WDRA 2VZTA 3TOYA 3APGA 3AXHA 3H7UA 1DQWA 1US2A 2C71A 2QV4A 3ZLGA 3VOGA 2V38A 3GXFA 3B4YA 3CPUA 1SPQA 4BFAA 4LEQA 1PE1A 3W70A 4UFJA 3SGUA 1WPCA 4HNNA 3IUHA 3ZJKA 3W4RA 4W7UA 4Q8VA 4UCGA 1BG9A 2IUZA 4TU1A 4P2VA 2QCGA 5CBJA 1QNVA 1XLAA 3NR0A 1M68A 2E3ZA 4EPKA 5T8GA 4Q22A 2TODA 1H1NA 1EOMA 1UR0A 3TH6A 1TMQA 1XYBA 1WZMA 4ZR8A 5CPMA 1QO5A 3AUJA 4KWWA 3LD5A 5FKYA 5ABGA 3VFCA 3PC0A 7TIMA 1OT2A 3WJZA 4LYRA 3GXPA 3QGKC 1ZUAX 3PNUA 2AKMA 3XIMA 4H7CA 4L65A 2H3BA 3HA1A 2J74A 3G1SA 1H1YA 1SO4A 1JFHA 3ITGA 3CUIA 2BVWA 1LQ2A 1FKWA 3PZMA 4WDWA 4LUSB 3DKJA 5D8WA 1K1DA 3WDHA 5FEWA 2INZA 1XBXA 1PDYA 4O12A 4S39A 4LALA 2PLMA 2ZUWA 3BURA 1AW5A 2PU1A 1UKOA 4CNTA 1JNEA 3SJ3A 3BZGA 1JI1A 1UCWA 2XIMA 3C8FA 2WMGA 2HZGA 2ESCA 1F05A 4LTSA 3THCA 3TMQA 1SVDA 2W9MA 4PMXA 2A0NA 4EAYA 4R5EA 2NQJA 2OPJA 4ZQRA 1FWIC 2EAWA 1VFMA 1XSKA 3AHYA 4GUHA 2F84A 1HT6A 1C92A 1WCGA 2VQTA 6PTDA 5HQLA 1EDQA 1RAKA 4XZIA 2OGYA 4RR4A 1QBBA 3BVJA 1YNYA 2W79A 4ZBCA 2QCCA 2E09A 3C2OA 3RO6A 3W7EA 1GZGA 3KS5A 3KHDA 5A6KA 3H4WA 1UD8A 3CIXA 4O0KA 4AD4A 5KTLA 1QI4A 4DJFA 4Z1CA 4ZO6A 3SCSA 1HGWA 1XLIA 1UZHA 5M1TA 1F61A 1ZL1A 4UIOA 4KH2A 4OUIA 4XX6A 2G3IA 2X30A 3NQBA 3FXYA 2RDUA 5LHEA 3KZSA 1XW8A 3B8UA 4NZ3A 3KL5A 3KVMA 3W2MA 1UR8A 2FPTA 2J6VA 1Q85A 4N9DA 5B7ZA 4LAUA 5CZJA 1R2RA 1UPMB 4QITA 2HPIA 5DXYA 1W1YA 2XIQA 2F6KA 1XDMA 3AXMA 3LPFA 3CWNA 2G96A 4MB3A 2EPHA 3PZIA 2OJPA 5DY2A 1XCWA 2WWDA 2P10A 2WVVB 3CJPA 3I7SA 1GCYA 1W5QA 3RJYA 4R7JA 3CPRA 5A5WA 1HF6A 1XRFA 1LG1A 4AXKA 2VL4A 4M51A 2VD8A 4K8GA 4DPQA 4IQJA 1VFSA 4WLCA 4HSOA 3UZYA 3PBVA 4U10A 1KCZA 3P3BA 3O3RA 4PUNA 3CT2A 4RXGA 5AB3A 4MJ4A 4YTUA 3FDGA 1KBJA 3B8SA 3LSCA 1W3JA 3ZMRA 2WNZA 2PRLA 4Z1YA 1BWLA 3V0TA 1W3TA 3B8DA 3Q2DA 4O18A 4CCDA 3PPHA 4HCDA 3DG6A 3WLQA 4UZUA 1U1HA 2ZTKA 3TA6A 2POZA 3GH4A 5I3JA 3PBMA 5FEPA 3H2NA 1GQIA 1TJ0A 4NZ1A 2O55A 1N55A 3T8LA 4LVAA 3DI1A 1GEHA 3IK4A 3BO9A 1WE5A 4WUIA 4C1NA 4MGGA 1I0DA 2QV5A 3P5ZA 3WLJA 1XF0A 1ZY9A 4HN4A 4LY4A 3AYVA 2Y7FA 2B7PA 3NL3A 3A22A 2X7VA 1XL9A 3LG3A 3TYDA 3T9PA 1NP0A 2NUYA 3EXTA 4GX9A 4HT3A 2VEGA 3LA4A 3EA3A 1YEYA 5AC6A 2CETA 4I9JA 3WLRA 5FAJA 1FXPA 4X9SA 3EGJA 3DIPA 4D6JA 2DIJA 3V5CA 2OG9A 2WSKA 2HROA 5LSMA 2VFFA 1JZ5A 3U8GA 3U2OA 4JQ3A 1EJTC 2B7OA 3T09A 4XSLA 4KCUA 3T4WA 5KETA 5IHRA 1WDPA 4I5XA 1TCMA 3WQ6A 1DJQA 1RQBA 5T91A 4ZQPA 1H7PA 1VZWA 1V3LA 2ZTJA 3KZPA 4LBUA 4PMJA 4RNJA 4ONVA 1GVEA 4ATDA 3AIQA 4GYKA 3G1HA 1BVZA 1XX1A 1BRLB 1XH0A 4BCEA 2O92A 2A3AA 2QAPA 1LDCA 4HA4A 1EJ7L 2CU0A 1LYXA 1T99A 2YDRA 3EWCA 3MBFA 4O15A 3UJSA 1HXJA 5I03A 4U33A 3W28A 4L1XA 4JPGA 2Y7EA 4RNIA 4JTGA 3NQDA 4MB5A 1EA9C 1A49A 1XJBA 3CL7A 1O95A 2V63A 4ORIA 1PCKA 1J2WA 6ALDA 5FSDC 5J8LA 2YLLA 1XPGA 3H2EA 5D09A 3OGRA 1X8FA 3CMGA 1VCVA 1NWTA 1EJUC 5FJTA 3SSJA 3TYUA 4LUTB 3MANA 4MJMA 4RXFA 4Q8TA 4CQ8A 1H4PA 2V2DA 1FWBC 1WXZA 3H22A 1XRSA 2PGRA 4IZGA 4EE9A 1M7JA 1UG6A 3PPGA 1UP0A 3F4WA 2FZ9A 3R0KA 1R85A 4ZTYA 2VCBA 1Z41A 4GQGA 4WXZA 2BB0A 3E5PA 3O6CA 4BF7A 4JDBA 2ZC1A 2NX9A 3W2NA 4FNSA 1P0NA 3S2LA 2WXDM 4Q8UA 3T0CA 1NF0A 1SO6A 1KTCA 2PWEA 4DWSD 4DJDC 4ICCX 2R1MA 1KQYA 4ICMA 3VOHA 3VX1A 5CPSA 1SR0A 4WX2A 1JZ4A 3TZFA 4KWVA 2VOTA 5IFTA 4JYFA 4W84A 3GDKA 3GXNA 1E43A 3GX9A 3DN5A 3BJSA 2WVUA 3CV6A 4UTHA 4JX6A 4HPHA 4UUIA 1TELA 3LCGA 3G6MA 1VHCA 1U22A 2GVEA 4GO8A 4KCWA 4AHOA 1J79A 3QF0A 2Z6JA 3DFOA 3F1QA 4MAZA 3TNBA 2QF7A 3W1AA 3PANA 2PDQA 5C54A 2Z7KA 3L0KA 1B0IA 2VRQA 4N02A 1DJHA 3VYLA 2QNEA 3F5LA 4F8XA 4GZ7A 1R46A 1L2UA 4H4IA 1AFSA 3CEPA 3K13A 4M3PA 3ABRA 1AVAA 2OOFA 1DWFM 4E2DA 3A12A 3MW7A 1E40A 3FYPA 1Y8BA 2ISFA 5G4WA 2W27A 3TZNA 1LWJA 2ATMA 1U1UA 1K9FA 2DFAA 1IEWA 4PUJA 3WL0A 3CLMA 5I3FA 4K1WA 4IGNA 3UG3A 1HZYA 5AC5A 1LLOA 3GVGA 2EJAA 4DJEA 4GKLA 3GXIA 2BLEA 1EQPA 1MEHA 3EZ4A 3L4XA 4LFYA 2QDHA 5BXSA 2WHKA 1CCWB 3W7MA 1EIXA 4INFA 4MWAC 1MZRA 1OD0A 4K37A 1EXBA 3L65A 4CNPA 2JALA 2PDUA 3ZVIA 2QS8A 2WB5A 4FAMA 1ZTVA 1CWYA 4WDUA 1G9HA 3WH9A 3IGUA 3NYZA 2XGIA 3QH2A 3ZWSA 3DH7A 4Q6XA 2J75A 5IBXA 1J93A 2XVPA 1WKEA 1PKLA 3T0AA 3C0QA 4WOZA 3VAVA 4F48A 4NZ5A 4AXNA 3QR3A 3FA5A 3KLKA 1KBIA 1W5OA 1P0KA 2PWVA 1Q6QA 4WJXA 3GC5A 4DX3A 3JUGA 2Y8KA 1ZZMA 3G1FA 3PZNA 3SW6A 5HWMA 4AWSA 1TMHA 3P82A 3WK0A 3DGBA 2NW0A 1DXEA 4UTFA 1TWIA 4C6CA 4I90A 4AB4A 4DELA 3NSXA 5HNRA 2GSEA 1R30A 2G4FA 1RY8A 2B7NA 1W1B1 3TN5A 5I06A 5GJMA 1QCWA 2P8CA 3W7DA 2EGZA 4XZ9A 5E9XA 3AS1A 2XFRA 1J10A 4H00A 5HATA 4A2RA 5JIWA 4O52A 4I5UA 3VCRA 1AMYA 4AG0A 5DCBA 3GD6A 3EMZA 1KRMA 2OCZA 1KRCC 3MV11 3EA2A 5T9CE 3U2ZA 3UPBA 1HFBA 3VZYA 1IZKA 1QRQA 4HNTA 2EPMX 3NVDA 4PCPA 3G1VA 3CWOX 1UIPA 1FQ0A 2QQ6A 3SN0A 4WSHA 2DZXA 3MU7A 5BOFA 2WCGA 5LXXA 1TUFA 3V18A 3N2CA 3KEHA 2PCEA 1ITQA 3LCIA 1XYFA 2IPGA 3QY6A 1EL3A 4HBKA 1LBLA 3HPZA 1OABA 3GNOA 1VR6A 4JFUA 4UQEA 1KA9F 4YYCA 3TTEA 2DDXA 3ARRA 1EYEA 4DF1A 3R25A 2PDNA 3PS7A 2QVNA 1J12A 4FOUA 4O1FA 4C1NB 3VABA 2IPWA 3CL6A 1GOQA 2XH2A 4RLIA 3PNZA 1W1IE 4E4FA 2OT0A 3FY1A 4J7RA 2WC3A 3UXDA 1LBFA 3ID7A 4QRNA 1QHZA 5DANA 3A3WA 1BLIA 2BGQA 4FOKA 1XFCA 1AJ0A 4QROA 4QLLA 1SJBA 3QW3A 3MWAA 3R5EA 4PRWA 1WDWA 1YNPA 4A29A 3WZ0E 1DWGM 1VC4A 3H4XA 3EOEA 2FHBA 3OZOA 4DEFA 2AMXA 4CQAA 2XZ9A 5K7JA 5H91A 3MYPA 1JZ3A 5JUVA 3K5XA 1PCWA 2YBVA 3J7HA 1VJZA 1BWKA 1TTIA 2XGZA 3NNTA 3VGFA 4Q8NA 3EX4A 3GW3A 3ZVHA 2R1LA 5H6HA 2AQVA 3FJNA 2OKTA 4FLOA 2RDWA 4RDZA 4J3UA 1ICQA 5HUPA 1JCTA 1HKMA 1N8WA 4FMVA 3MB9A 1HKJA 3G18A 3CUGA 1UC5A 4KPLA 1RBLA 2JF6A 3L12A 4GG9A 3LU2A 3VZXA 5H2ZA 3VDGA 2ABAA 2JEPA 1F73A 1EKOA 3ABOA 5E5CA 3LCXA 2AAAA 1F2JA 1Q8JA 3NG3A 3SCUA 3IVUA 3RJXA 1UR3M 4E4PA 3A3HA 1AH4A 2VZVA 3UBPC 3AZSA 4M56A 1L6YA 4E8DA 4HHPA 3DYPA 2DGAA 3RN6A 3B05A 3C8NA 4QSHA 1ML1A 1GJUA 4YYFA 2WNQA 1LL4A 2DVUA 1LL6A 2KAUC 2J78A 4O1BA 3F2BA 1I2PA 4NXKA 3E0LA 3HQPA 1LT7A 2E77A 2IMRA 3STGA 4OTKA 2XM2A 3H8AA 1CW2A 1GZJA 3P8JA 4XIAA 1Q66A 2GGEA 3LRKA 1RK6A 1JI2A 3ARPA 5CJNA 8RUCA 2VR5A 4NQ1A 4QEHA 1VBRA 4JTFA 3F4CA 3GFYA 1MXGA 2YL9A 5FA5A 1S2CA 3HU7A 1DVJA 3PM6A 2Y62A 3F4NA 2PWFA 3HQNA 3M47A 3B8WA 3OVGA 4QQUA 3W7KA 5AHNA 3QFEA 3SECA 3URNA 3GYCA 1B1YA 1LWHA 3A4WA 4Z2IA 1EX5A 4D9PA 1Z69A 5D32A 4JTJA 3SURA 2A7RA 2QIIA 1TKKA 5I7GA 1M9HA 3HJZA 1SQ7A 1WZKA 1PYMA 2ISVA 3QJAA 3L0GA 1X38A 3E2RA 4JY8A 3TQKA 2XIOA 1LQ0A 2GJLA 3TP4A 1RD5A 5AYIA 4QE1A 3KFTA 1HG3A 4JIRA 1I75A 3D3AA 4D8LA 3RCMA 1E6XM 1XRVA 3STPA 4D6IA 8A3HA 5T26A 4GA8A 3VIHA 3VPLA 4W9TA 4EKJA 2WSRA 3L4TA 2BXZA 4JTQA 4JCLA 2Q6ZA 3GH7A 4AWEA 3L4UA 4GUGA 4UMBA 4G5DA 3M0HA 1S2WA 4CKQA 3ATZA 2VMFA 1P0EA 4DYKA 3O6YX 3AALA 3UPMA 2E4TA 1XUUA 5ECUA 1MEWA 4P7RA 1DJIA 4NZJA 1AD1A 4Z08A 1MQQA 1L9WA 4JX5A 5LNSA 4H9TA 1I9CB 4Y9NA 2FDSA 2ISSA 3S3GA 3WX7A 2ACSA 2J7BA 1TIWA 1E9LA 1F6YA 2VUNA 4KESA 3W27A 4PSRA 2ZZ5A 3TUUA 4IMFA 3NO3A 1R3VA 3TROA 4O1AA 2QEZA 1IWBA 5I3KA 3FYOA 2MNRA 3OIHA 1SW0A 3EWZA 3XINA 5CSYA 3W71A 5DFAA 4UTTC 1CYGA 3S83A 5XIMA 1A3HA 3P62A 1UKTA 1KM3A 5ABFA 1RCXB 4XD3A 1EDTA 2XHYA 2VT0A 4P61A 4DAFA 2FZBA 3LHYA 1EBGA 2CZFA 3W7CA 3LSBA 3M7WA 2QJIA 2WMKA 1KV5A 4JTRA 2UWFA 3HV9A 3GZ3A 1VEOA 1TIMA 5F1VA 1EZ2A 5F1UA 2EKGA 1E4MM 1UZ4A 4F4RA 5I24A 1LP6A 5B7YA 1ONRA 1WP6A 4JHMA 3I7RA 3RRXA 3SGGA 3LN3A 5BMXA 5D9NA 3CK5A 2OEMA 4F66A 2QW5A 3AMDA 1WDRA 5E1QA 2I14A 2VR4A 3EWXA 1R87A 2JBMA 3AS0A 2GWNA 1F8IA 4A8RA 4YXGA 4ZXLA 1B3OA 2JQXA 4L4MA 1E51A 5EMUA 1MUCA 1SMDA 1TMLA 3F2DA 1OEPA 2C19A 2WCAA 4A8LA 3PBUA 3UXAA 2GK1A 1RK5A 2C7FA 1E1CB 1ISVA 4JXCA 3EWDA 1CIUA 3T2OA 3T2PA 3TXVA 2CLMA 5E93A 1SM9A 1V6YA 2UY4A 3MMTA 3AISA 2FVMA 4HHHA 2R1PA 1KCKA 2DSVA 1WV2A 4PTXA 4ZB5A 2AQOA 1E1EA 2V5DA 6ENLA 1NWRA 2DSKA 2OT1A 1O60A 4E3TA 5FACA 2FQIA 2VUYA 1JQXA 4HOZA 3GBEA 1LORA 1AJZA 5FEXA 1FWWA 1G4TA 2OFJA 2G3FA 2Z2AA 3OIXA 5CGTA 3AJ7A 3MI2A 1BKHA 1E6NA 4FEZA 1K8XA 2GZXA 5GPRA 1QW8A 2V67A 3P80A 4PEKA 3ARQA 2G4JA 1XH1A 1YDNA 4H2CA 1UR2A 3PAOA 4L6DA 4PMZA 4TMCA 4H9YA 1DE6A 1GVFA 3MUAA 2PTWA 3UR7A 3VA8A 1GEQA 1IZCA 4KEZA 1J6OA 1TQXA 2GSHA 1JGIA 2HEJA 1PYFA 2BDQA 2HE5A 4AZ5A 5FEZA 1W1TA 2WLYA 1TPC1 1LOQA 2CERA 2JF7A 4TVCA 3OB8A 2XVLA 3GHRA 1X1ZA 3CU2A 4XV0A 1OWQA 3H54A 3AS3A 3DGRA 2YZ5A 1XPYA 3GTIA 1EF3A 1QTWA 2OLAA 4IIDA 2H8XA 1ZBVA 3TWBA 1VYSX 1UJQA 1VCFA 1V08A 1Q4NX 3CHFA 2FZNA 3AC0A 1GORA 2VZOA 5CSSA 3ZR5A 1FH8A 3IS4A 3W72A 1NEYA 3TFCA 2BVDA 1ZAIA 1EGVA 2PP1A 4MM1A 1SJCA 3BSGA 4QXIA 3W87A 1KFJA 3WG6A 3WD1A 3QV6A 1QI5A 3O0KA 4JFWA 3ZVHB 2VC7A 3RLVA 2X1UA 4PL2A 1HKVA 4XAGA 2X41A 1XC4A 2A3LA 5E0FA 2C6QA 4PUUA 4CCCA 1ZENA 4C6MA 1FDYA 1Q45A 4A21A 5AZ0A 4RCXA 1P48A 1F6KA 2QVHA 3BQ6A 1WQ5A 2ISWA 3GB6A 4OJYA 4MHBA 4AHPA 3L2IA 1W9DM 3PBWA 4DNMA 4JKLA 2D24A 1V03A 3WQVA 3S5SA 1QO2A 4GOAA 5AKQA 2FKPA 3KBVA 5ABTA 2B81A 3MJYA 3GTHA 5LIYX 4WOQA 1GW1A 3LV5A 4U31A 5DRIA 2HDJA 4POCA 4A4AA 3U4AA 3IK2A 3MKVA 5H1WA 1W17A 1XDJA 2YB1A 2QPUA 2P53A 4C7FA 3W2JA 1J0HA 3TJXA 4Q7NA 2RHGA 2Q09A 5F2IA 1O94A 5AECA 4XVDA 3FN9A 3SY5A 1IXPA 1G6CA 1QR7A 5K9DA 1LRNA 5F2MA 2I16A 4PRTA 2XN2A 3E2SA 4R7OA 1DP0A 4MFDA 4XUGA 3EB2A 4KETA 1Q7QA 1GKPA 4O10A 5C7HA 2ZUUA 3B0PA 1JZ7A 4OV9A 4KS0A 4MZ8A 4HMNA 3GC2A 1MO0A 3NWRA 3BCFA 1I2QA 3NEHA 1GONA 2E25A 4X60A 2HV5A 3IUIA 3HM7A 3KTCA 3WDJA 4Q8OA 1XLDA 1XLFA 4XZBA 1B31A 4EAMA 1M7PA 3W1QA 1A5NC 4LRSA 4G8TA 2BY2A 1GTHA 3WDQA 1XIFA 5FF2A 4P7NA 3N15A 1WYIA 4N2YA 1KRBC 4HSNA 5A8PA 3P8IA 4O57A 2VEPA 3LRLA 2C0HA 3R1ZA 1OJXA 3UG4A 1Y7VA 3TK7A 3WH7A 3ITOA 1NDYA 4D6EA 2GGGA 4AYGA 1R7OA 3NPVA 3U2EA 1XIIA 4KEUA 4I3GA 4H3DA 2GUBA 1RVGA 1OIFA 1VLWA 3GSMA 3L66A 2XM1A 2F6XA 3C3NA 4D8ZA 3TONA 3GR4A 3ARTA 4GQBA 1V0LA 1FCQA 3AZRA 4O50A 4XZLX 1E0WA 1I45A 3NZQA 1VLIA 5FOOA 4DBDA 1TVNA 2Y0FA 1FDZA 3O15A 3MJMA 2CLKA 1PWLA 2W66A 4WY0A 4C6KA 2WBKA 5G4EA 2YW3A 1TQJA 4DQWA 2YXGA 4K1GA 1P1XA 4JTKA 3N34A 3SUTA 2IXUA 1JD7A 3GG8A 1YTEA 2VFDA 3KDOA 3QV8A 1FCUA 1EDGA 2GWGA 3SN1A 4KGLA 1S38A 4KCVA 3IANA 4HNOA 3W29A 3LQGA 3SFKA 4EPDC 3DZ1A 3PZQA 2ATSA 2BHUA 5LIKX 2NLYA 1L6SA 1WUEA 4ZTXA 2X2GA 1RA0A 4JN8A 4ROPA 3AXKA 4LUJA 4FO4A 1FHVA 4MJ2A 4HZ7A 2QPXA 1W9VA 5BXPA 3QLDA 2R94A 3GNRA 1X96A 1K4GA 4GZJA 5A3HA 1H1ZA 1E3ZA 1XLJA 3WF0A 3DX5A 1B9ZA 1EWDA 3HJEA 3LPOA 1M7XA 4LAKA 1TYGA 4IIHA 4W85A 3EWWA 1I8JA 3LGGA 3NPWA 3KBJA 2DZPA 3WLNA 3CV1A 5CKSA 5I07A 1D3CA 1OZMA 5CH9A 1UUMA 4PBEA 1V7YA 2WC4A 2UBPC 4O53A 4JD4A 3IJ6A 4CGTA 4KWSA 2NVDA 5H8UA 4FF5A 1EZWA 4IIFA 4L80A 3EDKA 1U33A 2A21A 4GLEA 2CHRA 3UA4A 3RYSA 1E73M 4RPQA 2GPTA 1C3FA 3BAIA 5D03A 1JIBA 2ZDRA 3C2RA 3DU0A 2GYIA 1QAPA 1H11A 3DHPA 2XVKA 3GG1A 1K9TA 2RJHA 3NPXA 3FAXA 2Q3OA 1VEMA 3FJ4A 5A2AA 3H12A 3KX6A 5TF0A 1VJSA 2XSBA 3GDRA 3V5OA 1PXGA 1TTPA 3Q67A 1NFGA 1QW7A 1XIHA 2GK1B 3N12A 1V3HA 3OG3A 1FCVA 3H6OA 3I3BA 3K2GA 2PEVA 4OE7A 5HR6A 4BEQA 5LIWX 3CPGA 1O5KA 1PSCA 1SFSA 1H61A 4QG6A 3PN8A 3THQA 2QGYA 2J9YA 4XK2A 5LGXA 1BTMA 1OYCA 1XSJA 3V4BA 1GOOA 4R53A 4CN1A 5A8OA 3HOJA 3KOZA 1ADOA 2WSQA 3B8TA 2ASHA 1X39A 2Z29A 2FH6A 1SJAA 1ME9A 4NYYA 1OBAA 5A8MA 5HNTA 1HO4A 3E0IA 1LTDA 3MV01 1VFFA 3SZ8A 1I2NA 1RA5A 5C8BB 4LVDA 4L4OA 3G77A 3M0LA 4CD8A 3W23A 1G67A 4KW2A 3CIWA 3HPSA 2FGZA 5BMWA 4Z0JA 3EKZA 4MDOA 3MUCA 1TV2A 1THFD 2ZFAA 1H7NA 2YSWA 2QYGA 1AG1O 4HKPA 4WDXA 4Q32A 4JHOA 4W8LA 2WPGA 1OFRA 3N4EA 1MXSA 2XZ7A 2XFFA 1DQXA 4B5XA 1TWZA 3TNOA 1IV8A 2DZVA 3EXRA 3TQPA 2P0OA 2BP1A 1V3MA 4LF2A 1CT5A 5HDRA 2XVGA 3AU6A 4H7ZA 1C7SA 4MB1A 3RMEA 1V0MA 1E5NA 2G3NA 2WHLA 1GJPA 4M0XA 4JQAA 2JKEA 3BOXA 2V2CA 1KC7A 2ZICA 3CUZA 3PBGA 3UZXA 5AHLA 1IZJA 1IIGA 4E2BA 3RNDA 2BNJA 1IGWA 3GY1A 3WIJA 2ZUVA 4HGXA 1R3RA 2C8NA 4C6NA 2P3EA 4LCQA 5EGRA 1DIEA 2BVTA 2WPBA 4ORMA 1GOIA 4ZZ9A 3RU6A 1NFPA 1O68A 1IT0A 3A23A 3SCWA 5DCEA 3S6OA 1BGGA 4K6AA 5DMNA 2VGBA 1UWRA 5CPTA 5I0DA 1BQCA 2E6YA 3R8HA 3C5QA 3UZ5A 4C6IA 1EYWA 1CB2A 2ZE3A 3W1MA 1EJSC 1BG4A 4LCSA 5FI8A 4AY7A 1F9CA 2NQLA 3LDVA 2WZEA 1JCLA 1A0CA 2AGTA 2PI6A 4EIVA 3A5VA 3THDA 3TTSA 4N6EA 4ZXOA 5FESA 4RDYA 1ISYA 4BK9A 1KBLA 1ONXA 3M43A 1J0KA 2VWSA 4E6MA 5EMMA 3FFSA 1A5BA 3A9IA 4GMEA 2B4GA 2FH8A 1O5XA 2NXGA 4LS0A 1NDZA 3H23A 1KM0A 3TYCA 3AMKA 5CAKA 3R6IA 4HTBA 3MCNA 3G8EA 2FPYA 2KX9A 3VOCA 2C0AA 2YX0A 3QEZA 1S3TC 2VCCA 1YE4A 4Z2KA 4D6GA 3P14A 3GXTA 4XD4A 1F4HA 3BAWA 1HKIA 4R3UA 1TRIA 1FP9A 3WUFA 3PK7A 1OYBA 5A8QA 3WQ5A 1TPEA 3S42A 3WFZA 3N18A 2X1RA 3T78A 3U4FA 4ATLA 3H2MA 1VBUA 4UOJA 2Y8UA 4K8EA 3WUBA 3LUTA 1G1YA 1A80A 3ZLFA 2F9RA 1XV8A 1H0GA 3BMWA 1B3WA 1W9XA 1XQLA 1AQHA 1ZCOA 1I1WA 3LLFA 1W5PA 3VK5A 3WYZA 3WEZA 2GGIA 3PULA 4Q3MA 1QPKA 2TSYA 4I9AA 5A95A 2O9PA 2QF8A 3DESA 2CESA 4IIGA 1KLZA 1BYAA 1AQ0A 1H62A 2CKRA 2VD9A 5M5DA 3TN6A 3C3UA 4H8UA 4JTSA 3K1GA 3VKBA 4QFUA 2YBUA 1QXLA 3OLIA 5CZKA 2ALRA 3DBPA 4C91A 5D4YA 4TX8A 6XIMA 5HNUA 1KWKA 4HPJA 3L68A 1C9WA 3MHGA 4IMDA 2CZVA 3KP1A 5I77A 3H7VA 1G5AA 2D0GA 4Q4RA 3BV4A 2A3HA 4WSKA 1OYAA 1W0MA 4UFMA 2VFEA 1XGDA 4MWAE 4G2DA 1C90A 3MCOA 1UD4A 2CYGA 2Z24A 2DP3A 1XUZA 2PS2A 1GJWA 2DJLA 2EPLX 2WJEA 5D33A 3JZUA 3MSGA 2GQ9A 1EHAA 3CHEA 5ABHA 2PDGA 1XI3A 3NA8A 3JW7A 1CX9A 2OYMA 2H8ZA 3HG2A 3C2YA 4LWWA 4F0LA 3GXDA 4M80A 2AL2A 1YADA 1QVBA 1UMYA 1DWHM 3DYMA 4WY0B 3MPGA 3TVAA 4A3UA 1Z8AA 4H1ZA 4RX0A 5LNRA 1YNQA 3KL3A 4GI9A 1S2AA 3VOJA 2VGIA 4ZE5A 2HS8A 5AYXA 3C2FA 4QJ1A 2VX6A 3KTXA 5CLWA 3OPSA 1I6NA 1V3KA 1MYRA 1P7TA 4ZOCA 2Y88A 3G6LA 1JCMP 1SZGA 6TIMA 3WJSA 1P5BA 2H3DA 1OVDA 2BMBA 4M8UA 2D2JA 3RAOA 4KWOA 1OCBA 5C70A 2J13A 1DJZA 3SDOA 3C0LA 3NAVA 2QJNA 3ZFHA 1ZBWA 4HHLA 1Y0EA 5BWAA 3DG3A 3MUXA 4HK7A 3TC3A 4C5ZA 2QUNA 3GUWA 3CTLA 2I17A 3CQKA 4DJFD 1U30A 2WKLA 3BG5A 5GNXA 1Q5MA 1VS1A 3URQA 4XTDA 2GL5A 3MO4A 3ARUA 4IPJA 1K03A 2FDMA 4D1IA 2O4MA 4HOXA 4J3SA 1L6WA 1P0BA 3WDPP 3NEVA 5HUOA 4HA1A 3HPFA 3OTRA 4PH6A 4ERGA 3RR4A 1K77A 3S0CA 4UB9A 5E9AA 3A47A 4JQ2A 1Y5XA 1XLGA 3N29A 1S2UA 3UR5A 4GVHA 4JTUA 5A2BA 3UW6A 5HPOA 5A6BA 3GVRA 2V3EA 4O13A 3SY8A 1VFUA 3GHUA 1PJ9A 5IXEA 1G4PA 4LU0A 1G0CA 3PZOA 4JFSA 4JYDA 3ARWA 3BAJA 1UD2A 3WLOA 5CZ0A 1ADSA 3EA1A 4UQAA 4GIEA 4KWUA 3ME3A 1WZAA 4UQCA 2VR2A 3L2MA 2D69A 1HL2A 3AXIA 2PODA 2WC7A 3UY8A 4QEEA 1FKXA 3MS8A 2HXTA 2E9MA 2YB4A 2PPGA 4RDVA 2A85A 2FMNA 5C0QA 2VGGA 4L61A 3AIUA 3QYQA 1K8YA 3GVQA 3N2XA 3V7PA 5BOOA 4LS1A 1MFUA 4RUBA 3M0MA 2PDYA 4GO9A 2WM1A 2MANA 3WBXA 4D1JA 4TIMA 3PPCA 3W38A 5AYYA 2AAMA 2ZZ2A 3VDBA 1NY1A 1VPXA 1R9XA 3NQCA 3BE7A 4IPNB 4YTRA 3U57A 4NY2A 3WELA 2C1IA 3L67A 1PZ0A 2REQA 3ZR4A 3BGJA 1V3IA 3TN4A 5I23A 3AYTA 1E0UA 4GUFA 3VOIA 4CNUA 4PYSA 3VTRA 5LKYA 1CDGA 4UCFA 4W7VA 1YMYA 4IQDA 3SFWA 1FHUA 4Y8EA 1NOWA 4MB4A 3I4EA 4N9CA 2J62A 1ZCCA 3KVLA 4PRRA 1YXDA 4I9TA 1LROA 1JVNA 1PBGA 4C6EA 1YPXA 1RP9A 3LNPA 4QS6A 4Z2HA 2HVOA 4QDWA 3VKDA 5FL1A 2E6AA 4LNYA 8XIMA 3ICJA 1B3ZA 1KFCA 2J66A 4PTDA 4G1NA 3C56A 1DORA 1EGZA 4YU1A 3COTA 4J5NA 2JKAA 3BSHA 3EOSA 4YVVA 4RE4A 1EJVC 3GNPA 4MDPA 3T8QA 4V33A 3G2GA 3R8RA 2QCEA 4I9MA 5AHEA 5IDIA 3GVVA 2P76A 3I10A 3LM3A 1EP3A 5D2WA 4Y7EA 4BWLC 1U5JA 3R7MA 4DO4A 3NM1A 2VX4A 2X0SA 3WH5A 4QLJA 4U28A 1EB3A 3WLSA 2PZ0A 4JAWA 2PWDA 1SGJA 3C0SA 1F4AA 2WYSA 1V3JA 3M0JA 5C2GA 4RPPA 3A5FA 3CHDA 2DSWA 3UJRA 3C52A 4L7ZA 1OM0A 1PX4A 4NRSA 3PTKA 1AL8A 5G2WA 2UY2A 1JFXA 4D6DA 3QZEA 4HZ6A 3MMUA 5CXPA 3BCDA 2Z26A 1NJJA 1YLVA 5D2YA 4CEUC 1D9EA 2E67A 3VI2A 5CC3A 1MRQA 3ITTA 4KIRA 4B5TA 1D7KA 3OA5A 2PTYA 3VC5A 4P7QA 1JYVA 2A6LA 2V3FA 4TX9A 1W1VA 2Y2WA 3FNDA 2RGMA 1Q6GA 1AQFA 1XD0A 3MY9A 3P93A 2O7QA 4NKCA 3CUXA 1UA3A 2VWTA 4B5WA 3AHZA 3BLEA 5F2GA 3W82A 1LCOA 2XGBA 3PJXA 2XISA 3QM3A 1IXQA 4HYWA 3EWUA 3IWPA 2ZQ0A 2VM8A 3R0DA 3N2BA 3IV3A 1OB0A 3GU9A 1PPIA 3RRAA 1UASA 1O1ZA 4DHGA 4JTTA 3M0YA 1TX2A 1DEDA 2A3BA 3GS6A 4C6DA 5D2TA 4QR6A 1QASA 3A4AA 3LZ5A 4BR1A 3NSMA 2Z2UA 3V36A 4QNWA 1RLCL 4A3YA 1XC6A 2A7NA 1MDLA 1UUOA 2IKJA 3BUVA 4HTYA 1BKSA 1E9YB 1ZS2A 5LXEA 2NUWA 4ML9A 4DXXA 2HBVA 1JULA 4DRSA 3GRIA 1P6CA 1O66A 2OLSA 5KMYA 5E09A 1QHPA 4RZ5A 1TPDA 2ISDA 2Y7GA 1PKNA 1UR1A 3E1F1 1V02E 3URAA 1Q6RA 4LVBA 2G3JA 1TV8A 1O7AA 2BY0A 3M0KA 2NV9A 5GJPA 4QAIA 2NV1A 4CQ9A 4GI6A 4LAOA 1XYMA 4I6KA 2WZIA 2VX7A 3PR2A 5D9MA 4JFVA 1UH3A 1FY6A 3WLIA 3AS2A 4N9EA 3VD7A 4KRTA 4UTUA 2EF9A 1HKKA 1YHTA 2X09A 4FX7A 5EYWA 3HZ3A 3V1PA 2DJXA 3N14A 1DQUA 1BAGA 1S1RA 3P7YA 1QWGA 1GQNA 4DLMA 4GI8A 4FNRA 1YDVA 3EPOA 4Y2WA 4IGMA 1HNYA 1BXNA 4HA0A 3V3WA 1FH7A 1NIUA 3KRBA 3VDCA 2PF0A 4P7OA 5MF5A 2VC6A 4DJED 3WBWA 3E0FA 3PZ9A 1CPUA 3I6TA 2PSNA 4AD3A 1HUVA 4UTMA 3W1XA 3GIQA 4UNIA 1UH4A 1EX1A 1JPDX 1JPIA 3S1VA 2OZTA 2BOFX 3L9CA 3G3DA 3G3MA 4J40A 4IP7A 4O4VA 1C8YA 3RCNA 4B4HA 1LF1A 4H6KA 1IYXA 2WVVA 4BHYA 3FSUA 3GK0A 1F07A 3PAJA 3UVAA 4WR3A 1NWUA 1JDDA 4TV6A 3BLOA 2Z1KA 1P7TB 4WQ6A 5I6SA 4KMQA 1XLLA 3E3HA 3EMCA 1R9YA 3H2AA 1FDJA 3CAWA 4IFKA 4UOZA 2WAGA 3TOPA 2ZZ4A 1PZ2A 2EJ1A 2GVJA 3M6YA 2DSUA 5K9CA 3UETA 1S2TA 3T08A 2Y63A 1OFPA 1VFOA 3OZYA 1HKWA 1OIMA 3JRKA 4GY0A 4J3WA 4U5KA 3KCLA 1G69A 5TBOA 4GQQA 4PTMA 4AD5A 2CXEA 3QKZA 4I8YA 2IQDA 2C3ZA 3CS2A 4K68A 1EJWC 1ODZA 4IICA 4C6JA 4GHRA 2EO7A 3WCZA 4DXVA 2QUTA 2DVXA 2CPUA 1S1PA 5CJMA 3I6RA 3N4FA 4ZB0A 2I7GA 1KM6A 1XIBA 2ZC8A 3QZAA 2YCIX 3AICA 1GHRA 2BBFA 4CCEA 2Z1SA 1XHGA 5A6JA 1KD0A 3ZIZA 1ZHAA 3PF3A 4ZO9A 4J2MA 2OX4A 1TWSA 2PDJA 1QPNA 4BQ4A 1RPXA 4PMQA 3VXGA 4FOJA 1RCQA 2Y89A 3VNLA 3KHJA 1KKRA 4QJ5B 4I5RA 2PP0A 3LI0A 4N4PA 4HNCA 3BW4A 3QC0A 3GZAA 1GTEA 5KZMA 4EP8C 4IMEA 4NJHA 2PDBA 4NJJA 2WVTA 3NURA 1DOSA 2HCVA 2XIIA 4PL1A 4XTIA 4HPXA 2CBIA 1JDEA 3N25A 1EXPA 1J6PA 2OSXA 1E1FA 1ME8A 5LNVA 4OUEA 4RJEA 1OC6A 4NT0A 3S2NA 5HWJA 9XIAA 3R13A 1GHSA 2PWUA 3NO1A 4GBDA 3M41A 4H8HA 1JRCA 3LBCA 3NPUA 3CAQA 3PUGA 4GZIA 3TQVA 3P0XA 1A5KC 3SBFA 4K36A 3N2TA 4MMWA 2CZEA 3DC8A 1A50A 5BXRA 3K8LA 3VMPA 2RFGA 1DWIM 4JTEA 3FVMA 1EOKA 1HL8A 1WAUA 2HWGA 1Y5VA 1YBQA 4FLSA 3DXIA 4O11A 2REQB 1OINA 3WJWA 4ML4A 5M3WA 1R0MA 3CZLA 3LCLA 5I5RA 1M1BA 3SGZA 1ECEA 4NNAA 1VPQA 1GVIA 2PDXA 1F76A 4YTTA 2GQ8A 1YPIA 3S5YA 3SUWA 1BHGA 1TJPA 2QMKA 5AC8A 1M7OA 1NSJA 3T81A 4E3VA 1LRTA 5FL0A 1PHWA 1VIWA 4RKAA 2YR1A 1XD1A 3R43A 5LHFA 1D7FA 1KB3A 1J11A 1AODA 3IJ9A 4UMCA 3NQ2A 4FLQA 3WO8A 2ZRVA 1GK8A 1QNRA 1WOAA 4NYUA 4YWIA 1G7VA 2C18A 1X7IA 4GNJA 4JTCA 3WNNA 1K7EA 1P6WA 4HYVA 2Q8XA 3C61A 4GD0A 1GT8A 2BX7A 2Y8VA 4JGDA 1W8GA 4NAFA 3S46A 1EFZA 2GJPA 1H50A 3CT7A 4PB3A 3ABQA 1JUKA 3GR7A 5CZSA 4E2OA 1MI3A 1T40A 3O05A 3ITYA 4H8NA 1ODUA 3S1GA 3S6DA 3OOQA 1X6LA 1K6AA 3FA4A 3GQYA 3SUVA 4AISA 3STEA 3N3MA 3NQVA 1AZ2A 2XN1A 3CQJA 2ZRUA 1BPLB 3JU2A 4NHVA 1DJNA 5JH1A 4ACZA 3HFTA 4A3QA 4HK6A 2ZA3A 2XFWA 3PUEA 3REQA 2PLJA 4XVEA 1VBGA 3UF9A 2O9RA 2PC8A 1OD8A 4HNVA 5HWNA 4AIEA 3A21A 1TE1A 4IJBA 3TN3A 1N8FA 5E0CA 4V27A 1J4EA 4H9ZA 1BXBA 1RLDA 2VEFA 3ABZA 1ADDA 3W7NA 4AWUA 3AJXA 4FXFA 3GU2A 2H90A 3RX2A 4KGJA 1CENA 2OXNA 4PMNA 3SADA 4F40A 3K8KA 1KTBA 4UOQA 1E0TA 3WEOA 4YPJA 4NAEA 1KFWA 1GOWA 4ICNA 3P67A 3E38A 5E0KA 3R94A 4WZHA 1V6XA 3W07A 1PIIA 1TPWA 2VEIA 3OLDA 3N2OA 2E28A 2Z1VA 4GXWA 2ADAA 9RUBA 3T0DA 4C6FA 4NASA 1CI1A 2WWCA 2BSLA 2Y70A 3M7SA 3DERA 4GNVA 4NI8A 3M0VA 2ZA2A 3TJIA 3RLHA 3U48A 1Q6CA 3BH4A 2FIQA 3GIPA 3PUDA 1HIZA 3IIOA 2CLLA 2D1ZA 4QHRA 3N19B 1JYXA 4ZL1A 2CLOA 3RO8A 1DTNA 5DXXA 3MUY1 4F9JA 3SCNA 2E8YA 3POHA 2F38A 2WW5A 4XZMX 4KFNA 1TV7A 4B5UA 3RFAA 3TTQA 3AO0A 3ZS4A 2DZSA 4A2SA 3B8IA 5GNZA 3RX3A 2O0TA 4BI5A 4FR1A 4X0VA 3VUSA 1VD6A 1UIOA 1KR1A 4ZE4A 1LLZA 4JN7A 3BDKA 3IAQA 4Y9OA 3CBWA 4B15A 2GOUA 2UY5A 1WDQA 4X22A 4GK8A 5F4SA 3VE9A 5A6MA 2TYSA 4GUIA 1CGXA 1GG1A 3KRUA 2FTPA 1HQTA 3CQ0A 4S38A 2YCLA 1UD5A 4MF4A 1XLMA 1TV5A 3CHVA 1EO7A 4ECLA 4HK5A 2X1TA 3GW0A 2ZBTA 3UWQA 3U2CA 2XWDA 4R88A 5DMMA 1RV8A 3NFUA 3QN3A 2OLHA 5LZLA 3UVIA 2RAGA 3HURA 1WKYA 4FX8A 5D30A 2BFGA 3W75A 3KM8A 2BTMA 3EDDA 3CAKA 3VNMA 2EQDA 4V1XA 5KEZA 2QJGA 2W0UA 3DOPA 3NXFA 4B5NA 2J7FA 2DW7A 1GYNA 1RD6A 4Z17A 1YQ2A 3AAMA 3V35A 5EL1A 7CGTA 2ZUTA 3G1RA 3W22A 4PMOA 3VNJA 3FJ6A 1TJRA 3QHOA 5FF7A 3DHDA 4M1BA 4NX5A 2VC9A 1FVPA 6REQA 2P1FA 1VQTA 3GKAA 1TUXA 4PR4A 1X98A 2J77A 1TVLA 4IFKB 3ZXWA 2FGBA 4MSSA 1TR9A 1CLVA 3QMTA 4J4KA 1DYSA 4XZWA 5TD4A 4XZHA 2NWSA 2RH9A 2G8ZA 3MP5A 2RUSA 4FP1A 3AOFA 3DFQA 1PWMA 2YOCA 2BY3A 1FWJC 2YW4A 4MZYA 1DXIA 1UKQA 2CLPA 3IIZA 1ZP3A 1VEPA 3WLMA 4H2HA 1S5VA 1I1XA 1IXNA 2UV8G 5AYBA 2YFNA 4ASTA 3PJUA 3TCSA 1E15A 4YNGA 4JTLA 4F2UA 4QP0A 1QNQA 4XBSA 1FCBA 2MUCA 5MKGA 1D8CA 4W8BA 5EB8A 5IOBA 3APTA 4RK8A 2YPIA 1OQFA 4JNZA 1ZB5A 4C6LA 3THAA 3L4YA 3A64A 3WF2A 3VGBA 2PDIA 1YW1A 1UOZA 4MVAA 5CPLA 4Q7IA 4RL3A 1KXQA 1EC7A 1SUXA 4GISA 2GVLA 3O7UA 3FAWA 3G8RA 1UC4A 2QAFA 2ZYFA 1HJWA 5DELA 2HPMA 4J35A 2HNEA 1Q6FA 1JZ2A 1ZAHA 4QIUA 1CLXA 1RQHA 1ZJBA 4GJ1A 1O6IA 4KEMA 1E4LA 2QMJA 4GFIA 4L1GA 5D37A 1RJPA 1AL7A 3QGAC 4XKYA 2A7PA 4H9UA 4LV4A 1UBSA 5L6UA 3WENA 3LOTA 4GACA 1W3HA 2RJGA 1SSGA 2AOSA 4KCTA 3W76A 5IM51 2GVGA 3ORWA 3NQGA 5E6YA 4QG8A 1MQPA 3MSDA 3LHVA 1GKQA 1OGSA 1O5RA 4HU4A 2E0PA 5HANA 3SCOA 5G4HC 3NTYA 2W6RA 2V5JA 1JG9A 4P7LA 4JEQA 4NJIA 4R9OA 4NJKA 3PPFA 3B8VA 1YBQB 3EMQA 4P5UA 4WD0A 4V15A 3CZEA 2CIPA 3HG5A 4FNTA 4DZAA 1PV8A 1DJXA 4YCOA 1R8LA 3BW2A 4YHEA 3VIOA 3PWGA 4LB4A 1JDFA 5BYWA 4WRHA 1W8SA 1X97A 3UT0A 1A5UA 1T6MA 5FJUA 6CGTA 2LLEA 3N6QA 1K8ZA 4R33A 3K8MA 3TC6A 1OCJA 4AX7A 1RVKA 5JIPA 3MHUA 4B16A 2FZDA 3FV9A 1H0IA 2VXNA 3ITVA 2VP8A 5CC6A 4Y90A 4D6HA 3D0CA 2F2KA 4MLJA 4UXDA 2Z4GA 4GGHA 1Y65A 5FCZA 2XUCA 3NSNA 4JTIA 4ZA0A 1RY0A 3NL6A 5F2LA 3QV9A 1XKJA 5D2XA 2DT1A 4N9BA 4F0HA 4IHCA 1R6WA 1W54A 2ZXAA 3WH6A 2VDHA 2O9OA 1GOKA 2JEQA 4PCFA 3TW6A 5D9OA 2CEQA 3PZVA 1W3NA 4GH3A 2I5QA 1WOBA 1PTDA 1GZ1A 2AMGA 3BL3A 3PWIA 4O28A 3MP3A 4NAFB 4K7VA 3WQPA 2O4QA 1TRDA 2CXGA 3E2QA 1RJRA 3I3EA 3PTQA 3PUOA 4KEVA 1KFEA 4M6QA 1T8XA 3HGSA 1KM2A 3LLXA 1GVQA 1V4YA 4YVPA 2ZUNA 4G6CA 3RM8A 3UQNA 3IACA 1TCDA 5M03A 2PDKA 4KKXA 1GGOA 4UZSA 1XM3A 3K46A 3L21A 1Q6OA 3QRHA 4GWEA 1CGWA 2WJZA 1LRQA 2IQTA 4ACZB 2Z2BA 4HPGA 2TMDA 3DECA 4XQ6A 3REQB 4BF9A 2WSYA 2DU2A 2NX3A 3RGTA 3C6CA 5I3HA 1XLHA 3WEMA 1JUEA 5AYZA 1FWEC 3B0XA 1QBAA 3ARSA 5H8MA 3W26A 4JQ1A 4NZFA 4AVOA 4DIAA 1F3TA 4LANA 4ILSA 5E6ZA 2RKXA 4NUWA 4Y9AA 3ZYZA 3WK1A 3AHXA 1GG0A 4RNFA 4TXEA 4DZ5A 1CNVA 5EFFA 5LA0A 4C6BA 4NAEB 4XIMA 2POTA 1QATA 3D47A 1KFKA 1WBJA 2HMCA 2I5IA 1ENUA 4JTHA 3Q58A 1BYBA 1KLYA 3VUPA 5IFPA 1GVSA 1ZALA 5I09A 1Z44A 1JCXA 4DYJA 3SRFA 1K9DA 3TTOA 1JAKA 4FZIA 2CLHA 4AD0A 3HFYA 4UFHA 2GJXA 2QDDA 2E9LA 1PUDA 2V0TA 4HSHA 3N04A 1A5SA 1UYQA 4HU3A 4UR8A 1TZ9A 3NDYA 1P6BA 1OGBA 3OYXA 2IS7A 1A3XA 3LXBA 2ZWYA 3EEZA 4PMUA 4GH1A 3GFXA 1JDAA 1TVPA 1ZQ5A 1T8QA 4HHMA 2ONEA 4JDYA 3CASA 3HGJA 3SUUA 3QSRA 1QU4A 5J5DA 4WKFA 5M2FX 4J28A 1J96A 2V5LA 2INFA 1R7AA 3OODA 4IGHA 5I3GA 2CBJA 5XINA 4E38A 3ES8A 2GVYA 3UWZA 1R3QA 2BV9A 4CD4A 1XQKA 4H01A 3LHUA 1BEUA 1CGUA 5GQBA 1EPVA 3BLFA 1OFDA 2YIHA 4B3LA 2XSXA 1QI0A 2I5GA 5EMJA 3ERPA 4K2SA 2AKZA 2GDVA 3EX1A 4LUIA 4HD5A 2A79A 4D6CA 3OYZA 1GNXA 2R14A 2YCLB 3GIYA 3W7GA 1CZ1A 1DPMA 3T4CA 5J04A 3S4TA 3HO8A 4O54A 3W00A 4LAZA 2RGLA 3E9AA 3T44A 1SJDA 4JCMA 1O5QA 4K8HA 1ZU8A 3KOYA 2PA6A 4A22A 2WV8A 3QGVA 4V28A 1EC9A 4UTIA 3BXWA 3CNYA 2JGYA 1PZ1A 1EP1A 3RM9A 2PDMA 4AFYA 5C9ZA 1M41A 4ZB2A 2V68A 2Y1HA 1M6JA 1E1CA 4IX0A 1FXQA 4B3KA 3GVWA 4I6VA 5C71A 5FF3A 2ZA1A 4NG3A 4L9XA 4C1LA 3WQDA 3FK4A 4MUPA 3H55A 1AD4A 3MVIA 1LQAA 3STCA 4KFPA 3UEQA 3WD3A 1YYAA 1IWAA 3RLUA 4Y9MA 6REQB 2PRHA 4FLRA 4IGSA 2C1HA 1T7LA 1LBMA 2GGJA 3BLDA 1XBVA 1HTIA 3VCNA 1TWWA 4IM4A 3GH5A 2D23A 3M4HA 2PLCA 1XIJA 3RX4A 1OCNA 2V69A 7ODCA 1D8WA 3NQ8A 4H41A 2ZIDA 5CPOA 4FHAA 1SZEA 1RXOB 1KM4A 1P0DA 3N9SA 3W7OA 1O12A 2GJRA 3CUFA 1QOPA 1K3UA 1W37A 5ECVA 3S47A 9CGTA 4ES4A 1U83A 1CXLA 4HU8A 5U7SA 2IW0A 2W63A 2VO5A 3LS9A 2FFIA 3IAPA 5EPDA 3IRSA 3OHMB 2VURA 5MKGB 4LYPA 3DBNA 1B5TA 1CECA 4M7SA 1HJUA 3UCCA 4MIMA 2BXVA 4F0RA 1DWAM 1IEVA 1XIGA 1UKPA 2YCEA 3ANVA 4O19A 1UWTA 3WLKX 3H53A 5CG0A 1UWQA 2OQHA 2YYTA 2YDAA 4LRTA 2OR2A 1FOBA 3CH9A 2DORA 1XRTA 3C2VA 3WNMA 1W5MA 4KQNA 4PTNA 3W74A 4DJFC 3HV8A 3TJLA 2C1GA 4LOCA 2DPEA 4XKYB 3UWYA 2V30A 5EFDA 1DHPA 4IISA 3LZ3A 4M5PA 3ARZA 1UQYA 5REQA 3LBOA 1UWAA 2YZRA 3WH8A 3MT1A 3S9ZA 2BG5A 3W0KA 1QFEA 3NQAA 1Z89A 1OADA 2E6DA 3MUIA 2R8WA 4D72A 4W7WA 1PS9A 2H9AA 4H04A 4L1WA 4ZVJA 3N11A 1NOFA 1J18A 3QHMA 1TA3A 2FZMA 1HJQA 3IIXA 2ACRA 1JQVA 4S3FA 1M65A 3W1UA 1PHQA 3M1ZA 5K4XA 4DY1A 2PTDA 5CQ1A 3QQ1A 1YPFA 1MVYA 2OSWA 5D38A 3UPWA 1V77A 3IPWA 4PTVA 5KZ6A 5BZAA 4OOUA 3B97A 3FEMA 3UXIA 3VO0A 4W5ZA 1JZ8A 5A94A 2VFHA 5DLCA 3U3HA 4GKTA 4ZQCA 3DUGA 3V75A 5GNYA 1SU5A 4CU6A 4K7YA 3LGDA 2E5CA 2A4AA 1VYRA 3ARXA 4FALA 7ENLA 2UY3A 1MW3A 4OGZA 4D2JA 1YIXA 3T42A 3OO2A 1DTUA 2JIWA 1FWSA 2OWCA 3WNPA 1GPWA 4DJDA 3UY7A 2O7SA 3O16A 3N4AA 5C9UA 3PZTA 4O4WA 3N13A 2BGSA 2Z1XA 1A5OC 4BZYA 2HS6A 3A24A 4PB5A 1TZ7A 4NL1A 5I00A 5C2XA 2V5BA 2WK2A 4IPIA 4MFEA 2R6OA 4O1CA 1OCQA 1JPKA 1IGSA 1A4LA 4R85A 1CXHA 1F3EA 2DT3A 3RXZA 1RUSA 3RF9A 1W32A 5HAOA 4Z2GA 3OLGA 4J2PA 3ONCA 4WGXA 3UZWA 2A5HA 2CC0A 3CMJA 3LERA 1K7XA 1UBPC 1QOXA 3WSUA 1UP2A 2QCLA 2Z0IA 4P8WA 4DI8A 3H4GA 1V5XA 2FHFA 1DIOA 2BASA 2ZXBA 7TAAA 4DPPA 2EPOA 1KGUA 2WNWA 2L5HA 2WVSA 4PA8A 5D8ZA 4CNSA 1J5SA 3MQTA 3IVSA 2VYOA 4N0RA 3UGVA 2ZX8A 2PAJA 1W31A 4R34A 1SFLA 3VNZA 2E7FA 1XYZA 4K39A 1YTKA 2Z1WA 1POKA 4P8XA 4RZBA 4HZMA 4XAFA 3BAXA 2NV2A 2PGFA 4XB3A 4AW7A 2OYLA 1RH9A 2CITA 4LBRA 1NP2A 4WSJA 3DG7A 2PUZA 3A3XA 5BRBA 3CZKA 3IARA 3DAQA 4ACYA 2J7CA 2AL1A 5DBUA 3VGHA 2EBNA 3OU8A 3U6WA 3W01A 4GZEA 4DO6A 2CZ5A 2ZCGA 4MWAA 4C5YA 4EX4A 3RILA 4L4PA 2WNNA 3FX4A 1TPUA 5HJYA 4US5A 3SUSA 3HG3A 4EPBC 2VI0A 2GJXB 3Q4DA 3PZUA 4EACA 2I1OA 4CLMA 3CB8A 2WKJA 3VC6A 4PBGA 5C9XA 2YDSA 4QM1A 1UZ1A 1Q8AA 1Q63A 1VIZA 3OVRA 1GWJA 5G1YA 3HMJG 3EB3A 4LPCA 3W7LA 3S1XA 5CEWA 1TR1A 1A0EA 4YJ5A 4ZO7A 4F9DA 1EGMA 4JTAA 1REQA 3WBYA 4HVXA 3OZPA 1S3HA 4J9JA 3UXLA 4GCXA 1MW0A 2VRJA 3O0FA 3VKCA 3N17A 4CVWA 3URBA 4JKMA 4AH7A 1U5HA 5TIMA 4EXBA 4W4QA 4QE5A 1ZFJA 3GG0A 5I2UA 4ENLA 1ZJIA 4JIHA 1EWEA 1WNOA 4IG2A 4WJEA 3CAVA 4K3ZA 3NM3A 3AI0A 4IUOA 1RJQA 4OHQA 2C16A 1Q65A 2QT3A 3CC1A 4LSBA 1Z42A 3SCQA 3WMCA 1E72M 3NCOA 4JY9A 4Y6GA 3W86A 1VBJA 4DF2A 5T9BG 1WKDA 2OZ3A 3QVQA 1FWRA 1AW2A 3CUHA 4Q4KA 3ZT7A 1WZLA 1C8XA 2WHJA 2NXIA 1BQGA 3WNLA 1SW7A 3K4DA 3DFNA 1E71M 2Q01A 1FFRA 3RHGA 4GIYA 5EKYA 3LTYA 3NQ7A 1UROA 3O1NA 5A8NA 4A8NA 1WAWA 4EANA 1OX4B 1AJ2A 5G1MA 1L0PA 3GTXA 4H7VA 2ZZ6A 1KRAC 5EY5A 4W86A 4HCLA 4LYKA 2Z00A 1TWDA 4UR7A 4WHBA 2QDEA 5FJRA 3HN3A 4YS1A 1UKSA 3W1TA 3W1NA 3LCHA 3VX0A 1OFAA 2WJFA 4AZHA 3PG8A 4E8GA 2ACQA 4Z42C 4Y9PA 4AWTA 5A6BD 1YTDA 2HVNA 3IJQA 4HIBA 4FX6M 3DDMA 3GNDA 1GQJA 2O9TA 3GHTA 5IHSA 4DJEC 1PZ3A 4DN1A 1KV8A 2DZTA 4C7DA 3ABXA 2VRKA 2CNCA 3GFZA 2CWNA 3L2LA 3O06A 4RW5A 5LNUA 4BJHA 2ZUSA 4F3HA 3W73A 2FVLA 1OFOA 3LYEA 3AIBA 4NIRA 4TUFA 4IMGA 2NSXA 1DV7A 3KRZA 5CC5A 4DVOA 1V93A 3POCA 2YL5A 1RALA 4IWWA 4KRZA 4R27A 3DHFA 3FGCA 4NNCA 3LTPA 3P81A 1EPXA 2R1NA 4S3GA 4R7WA 3ZT6A 1VRDA 1ZJHA 3VOFA 1XH2A 4BI6A 4M6VA 3W6LA 5IBXC 3KUMA 4KFOA 4YN5A 2V5KA 5C5YA 3L4WA 3FOKA 1Z32X 2ANUA 2FZ8A 3N1AA 5DCDA 1I0BA 1OGGA 3D6NA 2FB2A 3ONBA 3TR9A 3SN4A 4AHQA 1IWPA 3Q45A 3AFBA 3B4UA 4WDTA 1XSIA 5D02A 5REQB 3DKLA 3GXMA 4PULA 2BODX 3CH0A 3PTDA 4W5UA 1KXTA 1R5YA 2XFYA 3S9IA 4E8CA 1EO5A 3TAOA 3UD6A 3EX3A 4S23A 3F2CA 1PX3A 2H9AB 1IF2A 4NNBA 3TW9A 4KT2A 3ZSTA 4AEOA 4JIIX 1TA3B 4L9YA 4B4FA 3I6EA 5A8GA 3NO5A 1OX6A 1A4MA 1QHOA 3WL1A 3CV7A 1GOMA 3IV8A 1SO5A 2E5BA 3S1UA 3F7JA 3ZR6A 4PUEA 4BQ5A 1X7FA 4TO8A 4PMRA 3VU2A 1ZJAA 5HJXA 2FMOA 2GFTA 2XN0A 5BCAA 4OIFA 3HMCA 4JL1A 3RPMA 3GBDA 4JBRA 4CNOA 1XCXA 4QISA 3UA3A 2VVNA 4QE4A 1QMLA 1Z6KA 5LA2A 3B3DA 3WQ4A 3EX6A 1TTQA 4FPSA 4HOWA 1E9ZB 2PDCA 1DJWA 2QCNA 4OFCA 4NU7A 1QUMA 1EA0A 3UESA 4AEFA 4AVFA 3K30A 3WLTA 4PMVA 1MZHA 4XAPA 1W1A1 3R10A 2D22A 3E02A 5DQPA 2E9BA 4CVUA 1CXFA 1TX0A 3PBYA 1NVMA 4E4UA 2PLKA 4MG4A 5EBUA 1ZPTA 2OMAA 3S9YA 3RG6A 1QPQA 3TSDA 4JNYA 3WJYA 3I4KA 1H7WA 3LNMA 3KOXA 3ZJ6A 4DF0A 4UNKA 4X3ZA 3TYEA 3ARYA 3GU1A 4DBUA 4HJWA 3GR8A 3L5MA 3PSVA 4FK9A 5FSEC 4V1YA 2YYUA 1K7FA 3VDHA 1EF2A 7REQA 4QX4A 3BG3A 2DT2A 4EWND 1ISWA 1R3YA 2YA1A 3GWQA 3BMXA 1XGEA 3T7VA 3WKZA 5G2IA 4W89A 5JVLA 1V02A 1UMLA 3DFTA 1TO3A 2CZDA 5EA9A 2NVAA 3B40A 4X2PA 5FAGA 4LX4A 1IR1A 3RITA 4UTKA 4WCJA 3PB0A 3ALGA 2GGHA 1KR0A 4S3DA 2O56A 1H41A 3BPWA 2VDGA 5ABEA 2HTMA 5HPCA 1D3GA 3LPPA 2HBXA 1BYCA 4I7WA 2FB3A 3OVQA 2OB3A 3LPGA 3FEQA 4ZEPA 4FXSA 1UHVA 3ECQA 4MY8A 1GW9A 3AU2A 3VKJA 3EDJA 4RE2A 4UTTA 3CTTA 3XISA 1FWHC 1LZOA 1AH3A 3B0YA 3N6HA 4MNKA 1LJYA 2P0IA 4DZIA 2NVCA 4PMYA 2Z25A 2CBVA 1B54A 4MWAB 3SRDA 2D3NA 3W7PA 3OVPA 4XO6A 1JR1A 1FUYA 3TLLA 4FNQA 2XU2A 4LH8A 3PHAA 3IRDA 2CWXA 3WQGA 3UR2A 1MNZA 4W88A 3U7VA 2QCMA 2DIEA 2ZUMA 1J5TA 4S3KA 2IKGA 3SAZA 2Z1BA 4W87A 4PCNA 2QJHA 2C13A 2E6FA 1REQB 1JEZA 1H7OA 4GX8A 3DFSA 4UC5A 4US6A 1G4EA 1A0DA 3BLKA 1XIDA 3CYJA 2DUAA 1XYCA 3AUOA 3WFLA 4LF1A 5BU6A 1NH6A 1QNPA 3MTWA 4IG2B 2DSZA 3RLGA 3GAKA 2HE8A 5LGZA 4ZGYA 3H26A 3BV7A 4DM2A 2WOQA 1H5VA 4EVZA 3AYSA 1E0VA 2QKFA 3WJXA 1V6VA 1JAEA 4O14A 3C86A 4M82A 3MHFA 3PFMA 4FIQA 2CW6A 3USZA 3FYYA 2C79A 1KTNA 5CZTA 3QQWA 1EJRC 1VF8A 4GJJA 3V0SA 3W2LA 4C60A 2PD5A 1BF2A 1GUVA 4QAWA 5F4WA 2VZSA 1DHKA 3QKEA 3QY7A 5CJ5A 4CU7A 3TYZA 5AHIA 4Q8MA 1ESWA 4REQA 1T5AA 1ISZA 1MMFA 2IPJA 1VHNA 1UWUA 3G0UA 1TPFA 4L64A 4X0NA 3UP8A 2B31A 2VTFA 2VHLA 3U9IA 3AIWA 1QK0A 2Q3RA 3FHQA 1HP5A 2J6XA 3MA8A 1GVYA 1GVOA 1HJSA 1YDYA 2YCKX 4NJGA 4HNLA 1ONEA 1NDWA 1BYDA 3R58A 4WKHA 1MQRA 4AIUA 5TNVA 2YGYA 4HCHA 4B2DA 1E4NA 1KWGA 4C65A 1E6QM 3ISIX 1ELSA 2XDFA 1UW9A 3JS3A 2X05A 1FWFC 5TAOA 3UFYA 1C93A 1WX0A 5HXMA 3W02A 4YL2A 2GQAA 3SIZA 2XSAA 5A6SA 3ZJ8A 1EHNA 4RE0A 4WVXA 4EXAA 2G41A 4Q33A 3G0XA 4HZ8A 2J25A 1E70M 4XD6A 2BWGA 5HA7A 4XISA 5EMLA 2DW6A 1K6WA 4AVNA 3WQFA 1RBAA 3EWYA 1J8VA 3WQCA 1BSLA 1N82A 4UFLA 2A3EA 2QJMA 5JMUA 1ITUA 3FGCB 1XGZA 1H51A 5LIUX 1P4CA 4GI4A 3GTFA 2QULA 4HYRA 3L5AA 4LC8A 3MI3A 2ODOA 3F4DA 2H6RA 4PFHA 3TFXA 2Y6ZA 1JZ6A 1YXCA 3VZZA 4NVTA 3KCOA 2X42A 2F7FA 3PVFA 4OZOA 4AMCA 1E6SM 1E4IA 5D04C 1VFTA 4TQTA 4N4QA 3OGSA 1N2VA 5EMKA 1V6TA 1FP8A 3VIKA 4HU0A 2W3ZA 4QS5A 2ZRWA 1VKFA 5CSUA 3NQFA 3W81A 3FKRA 3EOUA 2ZX5A 2RDTA 4F2BA 2A6NA 5CGQA 1KFLA 3C0JA 5CBBA 1W56A 1FHLA 2E1DA 3W88A 4PTWA 3VGEA 3WLLA 4UTWC 3OJGA 4WJ8A 3SY1A 1XFBA 3S8HA 3QSTA 1FHDA 5JH2A 4QSFA 4ZOEA 4FS9A 3I65A 2TAAA 3L23A 3STFA 8XIAA 1JYNA 4XBKA 3IVTA 4GCAA 1ZGDA 2GDUA 1V6WA 4GYJA 1FWCC 1KW1A 4MKNA 3HIJA 3G1DA 2G97A 2Y5JA 4G56A 2D20A 3S6TA 4DLFA 3DCPA 2C15A 2PU0A 5AZ1A 4UFKA 1R3WA 2QHAA 3CZGA 4CD6A 3CWHA 4MADA 1IEXA 4ZQNA 2BXYA 4S3JA 4ZFCA 2WZTA 3TQ0A 3W53A 4UQ9A 1XIEA 2ZX6A 4I8DA 2PDHA 2PDLA 4PEEA 4Q8WA 3U5YA 3V1HA 1NTHA 1PO9A 2WMFA 1Q13A 2FVKA 2CCRA 3T05A 1MFVA 4NZ4A 3W85A 2G3MA 4N7QA 3VMNA 3CO8A 3QQ0A 5I02A 4NP7A 5LYRA 5C55A 2G0WA 1XWYA 2EPNA 1FBAA 3WLHA 3CO4A 4JQ4A 5F7UA 1LLWA 1BFNA 3HB9A 3ZZ1A 4L6OA 4HMEA 4RZ6A 1J0ZA 4JYEA 2P8BA 3S5ZA 5JQ9A 4LB3A 1QW9A 4J3TA 2XVNA 1E6RA 3MKCA 4TOQA 4JEJA 1BSIA 4H6QA 1U5VA 3VNKA 2PDFA 2PGWA 3E12A 3VIPA 1KBKA 3KL0A 7REQB 1TB3A 5KINA 3M5YA 4JS3A 1CXIA 3M16A 2CFFA 4HNUA 1C7TA 3E74A 2OOGA 4N42A 3E6EA 1KFBA 5M17A 2VZUA 4ROQA 4IJRA 3ITCA 3H24A 2ZVRA 2BHYA 3CM4A 3DYOA 5CG7A 4Z1DA 1VCGA 4C90A 3SO7A 1FX6A 3W2KA 3IIPA 2PB1A 1WDDA 3TYAA 2NWRA 4AQLA 1T41A 4ZOBA 4H9XA 1JF6A 1RBOB 1Q4WA 4UTLA 1NELA 1I2OA 3O9NA 3FS2A 1WUFA 1BD0A 4NRRA 3RIKA 2WZMA 3UG5A 3OBKA 1E55A 1AMKA 2J7HA 2E8ZA 4JTDA 3AHVA 4Q4OA 3DFPA 3A13A 3NZGA 1M5WA 2QCFA 1RCOB 3AQUA 4DWSC 4CU8A 3CZ8A 3JVAA 4LCRA 2DZBA 2V3GA 3MWCA 1JL8A 1XLEA 4JZ5A 2YL6A 2Y24A 2W67A 1B4EA 3LI1A 4HA3A 2JGQA 4FB7A 1L6FA 3S1WA 4HN8A 2VKZG 5XIAA 3M5XA 3WF4A 1JYWA 2NQ9A 1HJVA 4IXXA 4B90A 3QLLA 1SZNA 5J5RA 2XTKA 4JICA 2PDPA 2YXOA 3EOOA 3O2LA 3WD4A 3UCQA 2IXVA 3BARA 4ERIA 5DF0A 1QPOA 2J4GA 2FFCA 3SR7A 3F03K 3SCRA 4ZCWA 1UD6A 4AU0A 3UNTA 2W62A 1JUBA 3WLPA 3KWXA 3W24A 3M9YA 4IP4A 2VELA 3M6DA 3BGAA 2CHNA 2VGFA 4QCFA 4D71A 3BOFA 2QUVA 3LK6A 4Y96A 2ZZ7A 2EXOA 2OX1A 4ZQMA 3UGRA 3KXQA 2F2HA 2NT1A 1SR9A 5PTDA 1OK4A 3BMVA 3SIMA 2QCHA 3W7RA 3HF3A 3UU0A 4DUXA 5HULA 4F0SA 1X8CA 3IEBA 5DT5A 3OQEA 1OF8A 3BWWA 3MSRA 5D05A 4X61A 4JL2A 2V82A 4URIA 3W7QA 1TV4A 3M5ZA 3GYEA 3CEUA 1KGWA 1NM9A 3ITLA 4PUKA 1PTGA 1OG6A 3QBUA 3V5FA 1IXOA 3SQSA 3W1RA 4AZBA 3V0UA 1US3A 1ZAJA 4REQB 5A6TC 3LGEA 1C9DA 2QLYA 4CD5A 2HK0A 2R91A 4JKKA 2YA2A 1H09A 1XP3A 3MC5A 4TX6A 1W9PA 1WXYA 2EKCA 2OKOA 3NOEA 4LGXA 2DH3A 3NYDA 2BZNA 2OSYA 3NXLA 1F3XA 1N7KA 2E68A 1HW6A 4HP5A 4O8AA 4EPEC 2W61A 3EDFA 2AGKA 2XYLA 1XR2A 1ZBCA 4GUJA 4LXFA 4QCEA 4PSPA 1JDCA 2DY3A 2QUMA 4XKMA 3CQHA 4MNJA 3LEPA 4M81A 1SZRA 4GFSA 3VCCA 3ENLA 5DMLA 8TIMA 4DBWA 3OHIA 1TPH1 5CPNA 1IQ8A 2D3LA 3GNNA 3M0XA 3NL5A 4JIPA 1X1NA 3G24A 3ATYA 3G0SA 3Q94A 4BEUA 1Q7ZA 4NI3A 3YPIA 4MNLA 3GDTA 1XXXA 1Z48A 2V81A 3FCPA 1H5YA 2I9UA 2D0FA 3MMWA 1POJA 3L5LA 3BCJA 2OTDA 2PTZA 4F2TA 1R3TA 1B3VA 3M44A 2BOEX 3IJ8A 4ADUA 2HK1A 1SMAA 3F5JA 1PX8A 4P8UA 1PVNA 1QNOA 4IIBA 2NSOA 3INPA 1C91A 4HPNA 2OU4A 1IEQA 1MUWA 1JCJA 1S5MA 2EG7A 3EBVA 4JIQA 1UB3A 5HMEA 4DBSA 3QMRA 3FSTA 1NDVA 2VX5A 3M0ZA 3KE0A 2XH7A 2PWHA 2XIJA 5CSRA 6XIAA 1UA7A 4UTWA 3V16A 3DFYA 4W8AA 1CGYA 1FWGC 4A6GA 3UCDA 4Z1AA 2ALDA 2R82A 1XISA 1UD3A 3OA3A 3LBMA 4B3ZA 3E5BA 2ABBA 4PCTA 2ZX7A 3N6JA 3QHNA 3TCEA 3P0WA 4AIBA 3T0TA 1LOLA 2QZRA 3WN6A 1CTNA 1L2QA 1HVQA 5C7VA 3O6AA 4OWGA 2BHZA 5EMYA 1EUNA 3KVJA 1F5ZA 1ZP4A 1IT7A 3OBAA 1W1ZA 3ABSA 2QGHA 2VFGA 1UWIA 1UH2A 1FFQA 1NF7A 3BLLA 1KBBA 2QPSA 3KBNA 3QPZA 2OQLA 3W7IA 4PUWA 1H3GA 1IE7C 3NDOA 4FIRA 3IUDA 2Q71A 4AZGA 4EWJA 4IMCA 1H49A 3ZM8A 4AZIA 1FWNA 3QTPA