4NAEA

Pcrb from geobacillus kaustophilus, with bound g1p
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
225
structure length
219
Chain Sequence
EIRAWRHVFKLDPNKPIDDERLERLCESGTDAVIVGVTIDNVLDLLARIRRFSVPCALEVTDVLTPGFDVYLVPIVLNSRQAEWIIGRHHEAVKQYGDMMNWDEIAAEGYCILNPECKAAKLTRADTELDVDDIVAYARLAEHLYKLPIFYLEYSGVYGDPSVVEKVKQALDQTQLFYGGGITTPEQAEHMARYADTVVVGNAIYDAFEQALATVAAVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Heptaprenylglyceryl phosphate synthase
publication title A comprehensive analysis of the geranylgeranylglyceryl phosphate synthase enzyme family identifies novel members and reveals mechanisms of substrate specificity and quaternary structure organization.
pubmed doi rcsb
source organism Geobacillus kaustophilus
total genus 73
structure length 219
sequence length 225
ec nomenclature ec 2.5.1.n9: Heptaprenylglyceryl phosphate synthase.
pdb deposition date 2013-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.390 Alpha Beta Alpha-Beta Barrel TIM Barrel FMN-linked oxidoreductases 4naeA00
4NAEB 1VIZA 3W01A 3VKAA 4MM1A 3VKDA 4JEJA 4NAFA 3VKCA 4NAFB 2F6XA 3VKBA 3W00A 3VZZA 3VZYA 3W02A 3VK5A 3VZXA 4NAEA 2F6UA
chains in the Genus database with same CATH superfamily
1JF6A 1BTMA 1QI4A 3O05A 3W1UA 3FYPA 4NP7A 4PSPA 3AZRA 2QHAA 1DPMA 1T96A 3WBEA 1TWIA 4IH3A 1A5UA 3H53A 4GJJA 1EA9C 3UG5A 4NL1A 3AMLA 4IL0A 4OV4A 3VDBA 1V93A 1W9XA 3PBYA 5HJYA 3II1A 3UZZA 3NG3A 4IQDA 1KC7A 3VNMA 5K3VA 1MUWA 1G6CA 2C71A 4AZCB 1RJQA 5CAKA 3NSMA 4UTHA 3QY6A 1W3LA 1K8XA 3WH6A 4B92A 4DRSA 5LXEA 1VCGA 7REQB 4HNVA 5I09A 2OG9A 3DFHA 3MUIA 4O54A 3E96A 4LF1A 4GI9A 4H7VA 3M64A 1PX8A 4HA3A 2OSWA 1K9FA 4RNJA 1OFEA 3G1DA 3WD4A 3NQAA 1EDQA 4ES4A 1R3SA 1HIZA 2VX4A 3UEQA 3M0YA 2QJIA 3DG6A 3SJ3A 3QGKC 4DNMA 5JH1A 4PCFA 3KVJA 3UPWA 1R9ZA 3SCTA 3SRFA 7CGTA 3CMFA 3RU8X 4J3VA 1BVZA 5D9MA 5HNUA 2FZ9A 4MB1A 3BE7A 1VGAA 5F2LA 4MZ8A 1YDNA 4Q7IA 4ZENA 4WSHA 2R1PA 3LGDA 4JR5A 4TV5A 3LCWA 1PEZA 2VR4A 4DBWA 2YXGA 2W61A 1QFEA 3F03K 3S4TA 1W3TA 3GTXA 1J9YA 1BEUA 3UWYA 4ENLA 2ZRYA 4P8WA 1KQYA 3BPWA 1TIWA 3UJ2A 3AXMA 4CNTA 2V9DA 3IIZA 2W63A 2IQTA 4JY8A 1R38A 1HP4A 1EO5A 4LAZA 1B30A 3GXTA 3VIGA 3TP4A 2VQTA 3ZO9A 3PK7A 4J7RA 1VJIA 2YDRA 3STCA 3QMRA 5MHBA 4ERAA 2DU2A 2G95A 3V36A 1R2TA 3W38A 3HGOA 4HBKA 2TSYA 3W7NA 4YN5A 3U4AA 1Z32X 3UJRA 3R11A 4Y9PA 1GYMA 4Q7NA 1UBPC 3SM0A 2OLSA 4NSBA 1WXJA 3I4EA 2ASHA 4OIFA 3B8UA 3G5EA 2JIEA 1UKPA 2D3LA 2OT1A 3NQ2A 4HPHA 1OD8A 1RP9A 3NQGA 1DEDA 3I3EA 1GHSA 1R5YA 4LUTA 2AGTA 4M0XA 3CU2A 3AHXA 1F3XA 1JDCA 5KZMA 3DFTA 3W1AA 1V0MA 3B9DA 1EL3A 3GDRA 1LQAA 3G1XA 4AHQA 4LY8A 3UBPC 4F79A 5AC7A 5A8MA 3BC9A 4RE2A 3AJXA 4FNSA 3DENA 2AQWA 3ITCA 2NT1A 4PC8A 1RBLA 1ONRA 2E40A 2ZE3A 3MW7A 1IT7A 4RUBA 4A8RA 5HULA 2YXXA 3AUJA 1JGMA 1PKLA 2VT0A 3W75A 1M3UA 3N34A 2NUWA 2CKSA 1H51A 4FOKA 2OJPA 2A7PA 2IKGA 1IXPA 3FAXA 1UR8A 2WCAA 4ATDA 1ADDA 1O66A 4RDVA 5ABHA 4FPSA 1P6BA 2IS7A 2WK2A 5C9WA 3RLHA 4KRUA 2A4AA 3EEGA 2J6VA 4FZIA 1R7OA 3PANA 4JTDA 1AJZA 2GDQA 4UTWA 3UYCA 3KBMA 3ARYA 4LANA 4R7OA 5BYWA 2DEPA 4Y7EA 3LXAA 3O15A 2J7GA 4XZHA 3M9YA 5ABEA 3A4XA 3ZJ6A 4A8IA 1JI2A 4H6KA 1W1A1 1IXNA 3M44A 4MNJA 1I1XA 4H4IA 1VLIA 5GPRA 4I3GA 5GJPA 1ZP3A 3HM7A 4GFSA 2JBMA 3GYEA 1W9DM 3UR7A 1BWLA 1VKFA 4GZIA 4QS6A 2V0TA 4AVNA 1BSIA 4UOJA 1H7NA 4DWSA 2VX7A 3V35A 1ZY9A 3EWDA 2ZXBA 3OLIA 3GO2A 3SQSA 5CEWA 4JTQA 2DH3A 4D72A 3QQWA 1RLDA 3VO0A 3HPZA 1PWMA 2DUAA 2YL9A 1JUKA 5IRPA 5B7YA 3RLVA 2VKZG 5C6MA 3GR4A 3LD5A 3G6LA 4OJYA 1VBUA 2BHUA 3H70A 4PMDA 5JUVA 2FHCA 3KOXA 4JCLA 2CLKA 3PPFA 3DI0A 1M7PA 5JIWA 3FS2A 3WLTA 2VD9A 1CYGA 1JAKA 2YLAA 3WQCA 1L8NA 4TVUA 1F6PA 4O57A 5H8UA 4JTTA 3DBPA 4JQ4A 4H6QA 3EA2A 2E1WA 1UMLA 5A6TC 4GUGA 3LXCA 5E9AA 3NSXA 3L7RA 3DC0A 1W5PA 2C91A 4XK2A 3PSWA 4NUWA 3H2FA 3KBWA 1B2YA 3ANVA 4CNPA 3BW2A 2PDQA 2R94A 3EX3A 3MSYA 1J0JA 4JIHA 4A3QA 3PPGA 4YYFA 3N04A 2C18A 5K4XA 1UKSA 3F7JA 3S1WA 4YHGA 4OE7A 3VU2A 1HKMA 4AZIA 4CUCA 4AF0B 2J7FA 1K1DA 3C2EA 4QE5A 2Y61A 3O16A 5U7SA 1HJQA 1TREA 5DN1A 2X30A 4CQ9A 1XR2A 3S1UA 2W6RA 5LNRA 4XQ6A 5LKYA 4NAFA 5DMNA 5EYWA 4IIHA 5A6MA 3EWZA 8A3HA 3UNTA 2F84A 1GW1A 1F3TA 7PTDA 3AIWA 1MFUA 1QNOA 2GGGA 2Y6ZA 1NIUA 3GSMA 4NX5A 4TUFA 3EX1A 3GWQA 2DV0A 1R30A 5HWJA 3BWWA 2HROA 4YL2A 2PBOA 1SO6A 1TMQA 3A24A 3BMWA 4X61A 1OBAA 3L2IA 4PCPA 3WNNA 3K8MA 1OC5A 4BKNA 2Y85A 1P7TB 5KZEA 3O1NA 3M5XA 4NHVA 2MUCA 2P50A 1OHLA 1UQYA 5EBAA 2CERA 4GYPC 3UXIA 2CHRA 4Q8WA 4MMWA 3M6DA 5HR6A 1CW2A 1WOBA 1VYRA 1QNPA 4CQBA 5A8OA 4NNCA 3GKFA 4UNKA 1XYLA 2ACQA 5A6BA 3JZEA 3IV8A 4C6LA 2J79A 2VCAA 3W81A 1EPVA 3LSCA 1L6GA 2NX1A 1OK4A 1N7KA 4S2CA 4FP1A 3GXDA 4JY9A 1W17A 3ITLA 2E67A 3KW3A 5T9CE 3SN1A 4AYSA 4DBDA 2BZNA 1J93A 1GUVA 1C7SA 1TA3B 4JQ1A 4LW7A 5D9NA 4X0VA 2XVLA 2TODA 3UXAA 1OVDA 1WUEA 4MJ2A 1RH9A 3UZYA 4JHOA 4ERIA 4FNQA 1PV8A 1Q2RA 4GZ7A 2OGYA 4KRTA 3RCMA 1GEQA 3FW6A 2BXVA 2B7OA 3URAA 1RY0A 2E9LA 1DTUA 4GIYA 4JN6A 2NVCA 1GONA 3GX9A 3REQB 3OBKA 1A5MC 1PBGA 4ZBCA 3CQ0A 1F3EA 3AZSA 1AK5A 3SSJA 1SZRA 3WD0A 2H9AB 1QUMA 3MUZ1 4ZXOA 5AHFA 3GZ3A 2X16A 1I4NA 4NASA 2CZVA 1A49A 3S9IA 1LOSA 2Y5JA 1TPUA 2QDEA 3A3WA 4BR1A 3N13A 1M7OA 5PTDA 4IZGA 4DI9A 1PYMA 3L12A 3WQVA 3WDJA 4LAOA 3ARZA 1BTCA 3GVRA 1R9XA 1C90A 4FOJA 3G3MA 3TYAA 4CD8A 4W89A 3AROA 4BQ4A 1KM2A 3RX3A 3WMLA 1RY8A 4H8VA 3WF2A 1GTHA 1JFXA 2E6AA 3UCQA 4HU3A 3M0KA 3TFCA 2I56A 3D46A 4U5KA 1RCXB 2VEGA 4DO7A 2CFFA 1MW2A 2DZSA 4FLRA 1F05A 4NJHA 3NZQA 4DAFA 1GOWA 1KD0A 4IXXA 2QV5A 4JKLA 1FKXA 1F4HA 2CW6A 5H6HA 2E28A 3JVAA 2QLYA 5I06A 4GBUA 4QLLA 4GIRA 3N6QA 3FKRA 1JYWA 3SADA 1UW9A 4LY4A 5REQB 1V6XA 2VQUA 4S38A 3GXIA 3MP5A 3GUWA 3KS5A 3C2RA 3MMUA 5I77A 4WDXA 4GXWA 4V2XA 4D2JA 4XAZA 1YDVA 4GNVA 3MSRA 5FF4A 3GHRA 4M8UA 1G0CA 1Q45A 4M1RA 2ZADA 1RR2A 4O1FA 3G77A 4YHEA 2CEQA 3KTCA 2X1RA 1PUDA 3H4GA 1TE6A 3E0FA 4US5A 3W7PA 2QCDB 2QJGA 3R0KA 5JVLA 1RZMA 3V16A 2DP3A 3MKKA 1SJCA 4H2CA 3R5EA 2D22A 4ML9A 3ZVHA 4H9MA 1EHAA 5EMLA 4AWTA 4LAKA 1FXQA 4XAPA 2WC4A 1XGZA 1KGXA 1OSEA 1WDQA 3FX4A 1KM6A 3VE9A 2NUXA 4ZB5A 3WLJA 4LEQA 4FXSA 4M5PA 3MJMA 3P62A 5LA0A 1YYAA 1V4YA 3RDKA 3M0IA 1TELA 4C91A 3MYOA 3CYJA 3LPPA 4RR4A 4ROPA 3MVTA 4IX2A 3SUVA 2REQB 3W7DA 4JKKA 4D6GA 3VD4A 3W7QA 2YL5A 3CUFA 4MWAA 3RU6A 3L66A 4HSHA 1WCGA 4CN1A 3WK2A 3UWVA 1F3WA 3NL5A 3YPIA 4U28A 1BKSA 5CXPA 1MW3A 3OVRA 4LUSB 2WMKA 4BQ2A 3WJWA 5LIKX 4ZODA 3WUFA 3QFEA 3MKVA 4JTFA 3LRMA 3C2OA 3KTXA 3PBVA 3LBMA 2PF8A 5EKYA 4LC6A 3GC2A 3BJTA 4R85A 1Z7AA 3NQ6A 2DIKA 3L5LA 1ZSXA 2DUXA 1QW9A 1FWFC 1ZJHA 3QMSA 1H60A 5M3WA 2VNCA 5A95A 1I0DA 4DXXA 1UA3A 2CZEA 2Z25A 3HGRA 1YADA 5BCAA 1LBLA 4AY1A 2X0YA 1JNDA 4DZIA 2PE4A 3W1PA 1UQZA 4Q6JA 5AB3A 5E6ZA 3DZ1A 3I3DA 4D1JA 3RHGA 1RHCA 3VDHA 4DXVA 4UTMA 1EX5A 4R88A 4OBRA 4AVFA 4AUBA 1TQJA 1ZNNA 2ISSA 5I3FA 4GO9A 5DCBA 4AYGA 3HBLA 3KZPA 2H3BA 1DV7A 2VXNA 4FNPA 3OVQA 4PRWA 1O5QA 2RGMA 3LQLA 2HXUA 3UGRA 1HKIA 5JIPA 2VEKA 1XI3A 3AMCA 4H8UA 1ITCA 5ABGA 2BS9A 1KFKA 4RE3A 4UR9A 3WNMA 3AFBA 3MWAA 4TO8A 2XGBA 1QHZA 3M0ZA 4MFEA 1KM3A 1K8CA 2RJHA 3WJYA 3OIXA 5LA2A 3BMVA 3BUVA 1RXOB 4P8VA 5HQLA 1H1YA 3P80A 5FAGA 1JDEA 5LXXA 1PYFA 2WZEA 2DFAA 2OKOA 2BVDA 3SFWA 4RNFA 1M68A 4N4QA 1CDGA 1FH7A 5LNVA 1EHNA 5BXTA 1QO2A 3R4IA 2BB0A 2YXOA 2GFTA 1E1CB 5I7GA 2Q02A 5FEWA 3WZ0E 1GT8A 2FZ8A 3LCXA 3W00A 4H7CA 2QCNA 3NQMA 4L4MA 1NWRA 5ECUA 1U5VA 4UQ9A 1KR0A 2JGYA 4IG2A 4JX6A 5M2FX 4OTKA 4DVOA 1YNQA 1EF3A 4GBDA 2F6KA 2FVKA 1XLCA 3H23A 3ARSA 3W53A 3BAWA 4YYCA 1ZAJA 1ZTVA 4U3CA 3GDBA 3S5OA 4X2PA 2YCLB 2WAGA 3VYLA 3HGJA 4Z42C 3ARPA 2HCVA 4UR7A 3NDYA 1LUCB 2OKTA 3STFA 1QHPA 4UMAA 3I6EA 4DI8A 3GIQA 2VCCA 1W31A 6REQB 3VKBA 4DJDC 3WEMA 2W27A 1F76A 2CBIA 4XTDA 1U5HA 4X63A 4HQVA 4ERGA 4HD5A 2EAWA 2ZUMA 4AMCA 3AOFA 2YX0A 2YCKX 1CGTA 2CLFA 2ZC8A 3LV5A 4C65A 2NQ5A 4PUUA 2BASA 3PZIA 3MQTA 5M1TA 2WBGA 1VB9A 2WVVA 3IIXA 2G3NA 1QMLA 4Z2GA 4YS1A 1XIMA 4WR3A 3VUPA 3T05A 1J79A 2CZ5A 3EB4A 4MLRA 3EKLA 1REQB 2ZE0A 4PN2A 3VCCA 4EWJA 1JCYA 1E4MM 1FCUA 2A6LA 2PP0A 3ALGA 1W1VA 5D32A 1E56A 2ZZ7A 1ZBCA 1AQ0A 4WKAA 5DQPA 3M4HA 1Q6OA 4DHGA 2ZTJA 1ZGDA 1L2UA 2YKKA 1DJHA 3AISA 1MI3A 3B4UA 1WKFA 4O13A 2BXZA 1JG9A 2VRKA 1PIGA 3BG5A 3WQWA 3NQEA 3S5YA 2NVDA 3CZEA 5FACA 3C6CA 2PB1A 2PBGA 1S2CA 3RLUA 4Q8TA 1AG1O 3GZAA 3W76A 5E0KA 3CMGA 4JL2A 3E1F1 3PFRA 5B80A 2X7VA 1FBAA 5LYRA 1XG4A 4QQUA 2J47A 4CNUA 4LQ1A 3GVWA 4DZAA 4LEFA 1IIHA 2GGHA 3M47A 5FF3A 3PBMA 4LVFA 2OZ0A 5LHEA 2E5DA 3HIJA 1HT6A 4H04A 4KCVA 1V51A 3QYQA 2P8BA 5CQ1A 1VYPX 3C56A 1H0GA 6ALDA 2O92A 3N2OA 2VR2A 3MKCA 2DVUA 1UWSA 4AAJA 1CXFA 3QTGA 3L4ZA 3NL2A 3VIIA 2XFFA 2B4GA 2XVPA 4KEMA 3M0VA 1YMYA 1I2QA 4D1IA 3CXOA 4IGNA 1WYIA 1OG6A 1OIMA 2YYUA 4HSOA 2Y7FA 3NYZA 1YHTA 4MJMA 1RJRA 3UWUA 3OO2A 2VENA 3G8EA 1M65A 2FQIA 1JCXA 5FF7A 4IQJA 1M7XA 2GVEA 2YYTA 1NFBA 5GJMA 1CLKA 1QCWA 4WDWA 3AS2A 5TQLA 4XVEA 2R9RA 4HYRA 4O53A 2OX4A 1LQ0A 5DCEA 4NZCA 1P4CA 3KOFA 2PGEA 2CITA 3MI6A 3POCA 2LLEA 5A8GA 4C1NA 4K68A 2VWTA 3GM8A 3DYOA 1PWLA 3LLDA 3HPSA 1O1HA 5HK4A 3IRDA 3VKKA 2FTPA 3R43A 5FOOA 1A5KC 4J3XA 3VILA 3WG6A 5LHFA 2UBPC 3M0MA 1VLWA 4IFOA 3L4XA 1DXIA 4GVHA 4MADA 1FDYA 3GTNA 1EIBA 1R47A 1XSKA 3MO7A 4HPJA 4ORIA 2A7NA 4F2TA 1GZ1A 1F8MA 2HPMA 1GJPA 2FH8A 3QPYA 2RH9A 5MKGB 2QW5A 4C6CA 3WNKA 2CETA 3U7BA 5BWAA 2XVKA 4FLQA 5LNSA 3VIHA 3T42A 2OSYA 3FNDA 5LIUX 1JCJA 4ZB2A 1US2A 4AH7A 3A3XA 1MVYA 1I6NA 1W91A 2HTMA 1U2YA 1Q6EA 1EJXC 2OX1A 4JYFA 3SY1A 1ALDA 3TDFA 3W71A 1HJVA 2E5CA 3KVMA 2X0SA 2ATMA 3D47A 4S3GA 2KAUC 3BG3A 1TTJA 2BY0A 4UTWC 5CCZA 4IFRA 3PWIA 3XIMA 2EQDA 3OLDA 2ALDA 1JXKA 3WJSA 2QJJA 4F4RA 2X41A 1H3GA 1O5RA 1O7AA 2CLOA 4H3DA 1V0LA 4IMEA 2O9PA 3T4CA 2AKMA 3RR4A 3W02A 4YMZA 1CPUA 2EPOA 2WHKA 4DWSC 3DYPA 4UMCA 3O2LA 4DJFA 2FYMA 4BHYA 1I0BA 1FH8A 1OADA 4KGLA 1QASA 2GVJA 3P0WA 4J2PA 4H8HA 3VUSA 1V02A 3W7JA 2W79A 4HP5A 2ZX9A 2FZDA 4WHBA 1UUQA 2E9BA 3DHFA 2DVTA 4IPNB 3CZ8A 2CLIA 1QI2A 3M0HA 3T0CA 3BK0A 4XIMA 4IP5A 2HNHA 1H1NA 1L6SA 4TMCA 2XPKA 2BBFA 1UZ4A 3QQ1A 4FX8A 2XH2A 3BLFA 1RP8A 1PZ1A 3E5BA 3F4WA 3HG2A 3FEQA 4JAWA 2XG9A 4E8DA 2FH6A 2PCQA 2Y7GA 4I90A 5IDZA 2WNQA 3QY7A 3VDAA 3FVDA 3LPFA 1LRTA 2Z2AA 5H1WA 1XFCA 4Q4RA 2BV9A 4KRZA 5A69A 4C7DA 1BGGA 3RM9A 2OXNA 2DT2A 4HTBA 1TJPA 4RPPA 1XLBA 1S39A 3KBJA 4PA8A 2VFGA 4DLMA 2VWSA 3USZA 4KFNA 2F7FA 5F2IA 3RPMA 4EOUA 4BI7A 3POHA 4QEEA 1R3QA 1G4PA 4J5NA 3GG0A 1PX4A 3E0IA 3Q94A 2PRMA 3SIMA 4AW7A 1UH2A 4LPCA 2AL1A 2V38A 1P0EA 4Z2LA 1GKPA 1TV5A 3VINA 5CC3A 4CQ8A 5TBOA 1ENUA 5D4YA 3W1TA 4KWOA 1OCBA 4NZ4A 1VENA 2NXIA 1QI3A 3LNPA 3HQPA 5B7ZA 1LJYA 3CQHA 3WYZA 3WDHA 4NQ1A 2GGEA 4XD4A 2J8TA 4GVFA 4AZCA 2J8GA 3QVQA 1WZLA 3QFWA 4F8XA 3IUDA 4PMJA 4RPQA 3T9PA 5KZ6A 3S0CA 1OIFA 1V8EA 4Q32A 3N9SA 1B90A 1XINA 1W1B1 3U4FA 5F2GA 3S5SA 1GVFA 4N9EA 7REQA 1LLZA 1AQMA 1K03A 3MMTA 1IT0A 3ERPA 3EPMA 5DBTA 4OWGA 3W82A 3UY7A 3WLQA 2C6QA 4JNMA 4BY3A 2INZA 4RW3A 2FGLA 4E8CA 1HJSA 3C5QA 3T2QA 2OOFA 3MT1A 2PD9A 3SFKA 1X1NA 3HG4A 1K7EA 3PZ9A 4ATWA 3EGJA 3VGFA 3HG5A 5D8ZA 3LRLA 3H55A 4R53A 1A4LA 5FF0A 3KDNA 4O11A 3IJQA 4OGZA 3GBEA 4IQLA 1H0IA 3QMTA 2V5LA 3WMBA 3V7PA 3BAIA 1UOZA 2PEVA 3MUXA 1BYAA 2PC8A 3CHDA 3KRSA 4RJEA 1AD1A 3QR3A 3ZM8A 2ZVRA 3NTYA 3DHUA 3O63A 1WZMA 2UV8G 4GX8A 3IWPA 3BH4A 2WSQA 1JF5A 1PCWA 3W7HA 2FHBA 2D2OA 3UJSA 4WRHA 3SSZA 1SFTA 3TQPA 3TNOA 2PDNA 1VJSA 5HINA 5FJIA 2Z6IA 3GNRA 1KKOA 4FSAA 4KWUA 1TZ7A 1S5VA 4LS2A 1LYXA 1U1UA 4HHPA 2VUNA 4DJEA 1SMDA 1Q85A 1CLVA 4M6QA 4M19A 4D8AA 1JVNA 1QR7A 3GU9A 3H21A 1GQLA 3SUSA 3BZGA 3TSMA 4QBXA 2QPXA 4IMFA 1H61A 1J6PA 4GYFA 4M6PA 1XD0A 3HPFA 1XD1A 4HYVA 1HGWA 4P7QA 1DORA 3TK7A 3ARVA 2A85A 2HV5A 3T78A 4ZZ9A 1T7LA 3ZSTA 3SRKA 1KFEA 4IQEA 5JBFA 1JRCA 4WSKA 3G2GA 1TKKA 3BJFA 5C8BB 5DMYA 3K5XA 3SDOA 2VEFA 6XIMA 4QCFA 2EF9A 3LI1A 3DGBA 4E4UA 3TN6A 4XD3A 4YIWA 2X40A 1J0HA 3S2JA 1ZFJA 1PB0A 3L4UA 1ZS2A 1EH9A 1RCQA 2Y24A 4NG3A 2FPVA 1KRBC 3WQ8A 2XH7A 4S1FA 3GW3A 3IK4A 4BI6A 4GUIA 1FTXA 1M01A 3R2GA 4NZFA 2FGZA 2GWNA 2XH0A 3WBAA 3ARWA 3WLNA 3ITVA 1Z8AA 1PO9A 1Q66A 3B0YA 1CGUA 4TX9A 4AD0A 2ZUTA 1YDYA 3BGJA 3E0WA 3A47A 1WAWA 4XUYA 1A47A 1Q6GA 4A6GA 3R0DA 2ZWYA 1K9TA 1J4EA 3BAYA 2ZUNA 1X7IA 4Y9NA 4HN8A 4H00A 3PJWA 2QULA 3N9RA 4HU8A 2ISDA 1XLEA 2Q8XA 2H8XA 5JBDA 1JPDX 4W8AA 1FRBA 3M43A 2CXEA 2ZKMX 3CLMA 3G8RA 1XHGA 2VC7A 3WK1A 5BW6A 1EJRC 5G1YA 1XC6A 3KTSA 1XYAA 1TX2A 4N02A 1HNYA 1SJAA 4F3HA 1J96A 4ILSA 5EMKA 2DSVA 2WPGA 1N2VA 3PF3A 2ZUUA 1GVOA 3DOPA 3GB6A 3N6JA 3GTHA 1BVNP 3ZS4A 5F2MA 5D04C 1WDPA 2D0GA 2ZX7A 1UASA 4LF2A 1QPNA 3TQVA 4PUWA 3SCOA 1ZZMA 3ECQA 2WC7A 3R1ZA 2R14A 1NF0A 2VC9A 3MHGA 4WK9A 5ECVA 3GS6A 4JQAA 5TNVA 3S83A 1Q2SA 4UQEA 1Q6DA 4A4AA 2BSLA 1UPPA 4AD1A 1FWJC 2QUTA 2DZAA 4MKNA 3AMKA 3URQA 3RJYA 5C9XA 3GHSA 4M56A 2QCEA 2PRHA 4H6EA 5DRIA 5L9FA 1EP3A 2DZTA 5K7JA 2DZWA 5GNXA 1YXYA 2HBVA 2OT0A 4Z2JA 4AZ6A 1KCKA 3GAKA 4CVUA 4WOZA 4HNTA 3ME3A 2GVGA 5G1MA 1IYXA 3CHEA 2XIBA 2JEQA 3PB0A 3R58A 4FF7A 3EWXA 3BMXA 1BYCA 1EQPA 1H7XA 4L7ZA 2Y7DA 4GACA 2XM1A 2PWGA 4Q8QA 3WNLA 2V69A 3UWWA 2PODA 4DELA 2Q8ZA 1TVLA 3CIXA 2ZYFA 3OHIA 1GKRA 3UY8A 1AVAA 3M5ZA 4GI6A 2GL5A 1EB3A 3TQKA 4GQRA 2O55A 2QUUA 4JTEA 2OYLA 3WD3A 4C6IA 1XJBA 3F2DA 1DXFA 1PCKA 1FWGC 1O1ZA 3TCSA 3EDKA 2H90A 1TPB1 4YCPA 1X1ZA 1BWKA 1Y0EA 4A3YA 1EJUC 4A29A 4DAIA 1V3KA 2WQPA 4CQDA 2BFGA 5FSEC 3FEMA 4Z0JA 1CGXA 5EPDA 4W7VA 5E6YA 4AF0A 4E38A 4H9YA 3D5HA 4S2BA 3QJAA 4FXJA 3MA8A 2EPLX 4Q4KA 3M6YA 1XCFA 4DYEA 1AW1A 1WQ5A 2OZTA 3TUUA 3W27A 1SZEA 2GQ8A 1QOXA 4HIBA 1HGYA 3H6OA 4B5SA 1SW7A 2VDHA 1RA0A 3AYRA 3FXYA 3UR5A 3RRXA 2ACSA 3MPGA 2VDGA 3B9OA 2WMIB 1OYCA 1OGGA 4GKTA 4FIQA 4INFA 5G4EA 3CJPA 3IGHX 5ENLA 1X8FA 4W86A 4PTNA 4H9ZA 5I3IA 4K37A 1LWHA 2I17A 3FA4A 2R1KA 1N8IA 3ES7A 4UQBA 4MJ4A 1KKRA 5XIMA 1VAHA 2FMOA 4UFLA 3AYSA 4B3KA 2WCGA 1OC7A 5KITA 4DZHA 4KPLA 1ZHAA 5IFPA 1Y65A 1KCLA 2A3HA 3SN4A 4ACZB 2A1YA 2VVSA 5E0CA 3GVGA 1E6NA 3TU9A 1KGWA 3RO6A 1AW5A 4O1AA 1QWKA 3CH9A 3CUGA 3R89A 3TOYA 1PXGA 5D8WA 1W5QA 3UCCA 1C92A 2PI6A 1Q3NA 4QDPA 1IIGA 1BQGA 4HNNA 1VQTA 4BF5A 1Q7QA 4X0NA 4JFSA 2XHYA 7XIMA 4PFMA 1JCMP 4GNJA 4PULA 1KBLA 3ANYA 3A12A 1TA3A 1A4MA 3N2CA 1U30A 2NUYA 1PDYA 3VMNA 1G67A 3EOOA 3VGGA 1IQ8A 1P0BA 1VH7A 2VGBA 3CBWA 5FD0A 2YL6A 4O1BA 1ZRQA 1IWPA 4PZVA 4FA3A 2XIIA 1M1BA 1DJXA 4Q33A 3OTRA 1RBAA 3W1NA 3OG3A 1H09A 1PX3A 1E4IA 4JTSA 1RA5A 2QCHA 1D9EA 3FJLA 3QZ6A 3WLRA 4NIRA 3QM3A 3UESA 1YLVA 3DGRA 2CLEA 3SCVA 2I5GA 4PGLA 6TAAA 1RQHA 4WKFA 4XWUA 4YVPA 2XIJA 2H9AA 3UZ5A 3VKJA 2O0TA 1JD9A 1VFLA 3QOMA 2J88A 1JPIA 1WX0A 4GGHA 1NARA 3L2LA 1J12A 3CLWA 4AD3A 3S1XA 4XKYB 5G1TA 4O15A 4DUOA 4AD4A 4M7TA 4UQDA 2P10A 4BJHA 1IHIA 4I9MA 4FXRA 4A21A 1W8GA 4A22A 1Z69A 3D3FA 4WLCA 4GH1A 4O1EA 3DI1A 5ABFA 3W86A 3IUIA 3LYEA 1SW3A 2NW0A 4QHRA 2BODX 1BYBA 1ISZA 2UWFA 5D9OA 4GZEA 3WQ6A 4MDPA 2V30A 2PDUA 3I10A 1E6QM 1XM3A 3K2GA 1SM9A 3WNPA 4S23A 4FLOA 1S2AA 4Z1AA 2EJAA 3W1XA 1OEPA 2VR5A 3SR7A 3EOLA 4Y9AA 5F4WA 5T91A 4Z2HA 4KCUA 5DANA 3OVGA 2P53A 3KWSA 5M5DA 1W0MA 2QV4A 3TCEA 2XN0A 4RKAA 3O3RA 2FJKA 5CZSA 4QE4A 4UXDA 3WD1A 1L9WA 5REQA 1BXCA 1XC4A 5J5RA 1UR1A 2J13A 3O6YX 5EMMA 1V6YA 1FP9A 2BLEA 2ZRZA 3NDOA 5G4WA 5CZTA 2HZGA 4RNHA 1UKQA 1B0IA 2UY2A 2X2YA 3W88A 5BXRA 3WK3A 2QCDA 4F2UA 1TO3A 1FWDC 5F1UA 4MB4A 2Z2UA 1UC4A 1TQXA 2QJMA 5AYZA 3WQ5A 1V7AA 2YZ5A 4P7NA 1XLIA 3CUJA 1WDDA 1GTEA 1PAMA 2I14A 1BHGA 3A5FA 3LHYA 2GJLA 5CSSA 2ZOXA 5EB8A 4UFHA 1CGYA 6ENLA 4L9ZA 3TC7A 1J01A 3PWAA 2GOKA 5D09A 1OD0A 1V5XA 2ZA1A 3W7OA 3VNKA 1EGZA 3CAQA 1ML1A 4KIEA 1CEOA 4IISA 3E6EA 2Y8UA 2NVAA 2XZ7A 5M17A 3UW6A 3S8HA 4S3AA 1XRVA 4Y9MA 1S5MA 4PTMA 3WQEA 4URIA 1LQ2A 3AMGA 3F4VA 1XH1A 2HRWA 2VTFA 1KFLA 3ZZ1A 1QNSA 3SECA 2FKPA 2EXOA 1EZWA 3IJ9A 2D3NA 2D1ZA 4ZQNA 2NV9A 2QKFA 2A7RA 1YW1A 1UWUA 3ZJ8A 1HUVA 1F6KA 2Y0FA 3HQ1A 5T26A 4L4OA 3KVLA 4LUSA 2J75A 3CYVA 2YA2A 1GVIA 1TJ1A 4HMNA 4GLEA 2V3EA 4FR1A 1E6SM 1G94A 3FJ6A 1TPDA 3DECA 5DX7A 4D8ZA 2PDFA 3VXGA 1J0IA 4EXQA 2YDQA 3ZSSA 3HN3A 2XN1A 1TZ9A 4AIEA 2ZXAA 4KWSA 4LFYA 2IQ0A 5I3KA 2A2IA 4PTXA 1GEHA 2NLIA 1KRAC 4LVAA 4JIRA 3PJXA 4QNEA 5H8PA 3CT2A 1FWRA 4M1BA 4PTWA 1SJBA 4C6KA 2HBXA 4RLIA 4XZLX 1QWGA 1JZ5A 2D2HA 4YJ5A 3W73A 1B3VA 3CHFA 3SBFA 1XCXA 1FDJA 3BVJA 1TWWA 4XO7A 1E40A 2WYSA 2QUVA 4TR9A 4Q4PA 2X1UA 1HKVA 1UZ1A 2W62A 3BLKA 3T1GA 4IIGA 4H2HA 1SUXA 5FAJA 1CXEA 4Q4MA 2QIWA 1UZHA 1Z41A 3BLDA 5AZ0A 4XD6A 4QROA 3TMQA 3TJ4A 3WEOA 3VGBA 5AYYA 3KFTA 3CB3A 3NM3A 1V6TA 3GXNA 1KV5A 5DT7A 1OJXA 5HQEA 2V3DA 4HNLA 3WEZA 1QRQA 1AH0A 1M6JA 2X1TA 1A5NC 4NYUA 2JKEA 2QVHA 3ONCA 3EYPA 5CG0A 1OM0A 3QXBA 3TJLA 1GYLA 3CZGA 3VMOA 4R9OA 1EKOA 2V5JA 3SQLA 3UWZA 4LB3A 3LX9A 1XIEA 3MJYA 1JQVA 3AYVA 3HV8A 3RO8A 3BOFA 2GUBA 1SO3A 4FR6A 1TPH1 2CPUA 5AHEA 4DJFC 4FI4A 4QGCA 4AY7A 1E1CA 5FEZA 4XZWA 2X1SA 3A9IA 4HA0A 4K1GA 1QHOA 4MKVA 4EANA 4MUZA 4HZ6A 9XIMA 4I5XA 4RV8A 3G24A 4XBJA 2BVWA 3TC6A 1I9CB 3NZRA 2OWXA 4Z08A 5IHRA 4OKDA 2WHLA 5BXPA 3KCOA 1ZBVA 1PKYA 2GDUA 2J66A 2XSAA 4UTKA 5FJTA 3UXLA 3E38A 3JW7A 3WLPA 4ACYA 3MSDA 2E4TA 2J9ZA 3S42A 5A6AA 4GINA 2YCLA 3VIOA 2OB3A 1Q6FA 3ELFA 1GOOA 1A5OC 1K77A 5KSWA 3T09A 1LUCA 2EO7A 1UB3A 4JGDA 4ORMA 1GJUA 3TEVA 1V3MA 2J4GA 3VCRA 5C9UA 3NJ3A 4WF7A 4F0LA 6REQA 4EPDC 4XISA 2ON3A 3MZ2A 2CNCA 4FLSA 3MP3A 4YXGA 4P7RA 3ZFHA 2VCBA 2CLMA 1EZ2A 3KLLA 3LHZA 2WJZA 2P5NA 3NCOA 2E1DA 2B7PA 3FV9A 4HTYA 1FWSA 4JNZA 2NWRA 1ITQA 1H5VA 4JTLA 2HS8A 4JYEA 4PMRA 2OQYA 2WHJA 2NV2A 2Z7GA 5EGRA 1KW1A 4MY8A 3U2CA 2F6XA 2CLLA 4O8AA 3E12A 4IPIA 4C6QA 4OOUA 4XD5A 2QGYA 2AL2A 1FWNA 3SCRA 4DX3A 1LTDA 3ENLA 5CLWA 1JYXA 5E5CA 2V2DA 4NZ3A 2WSPA 1ZJAA 3NGJA 3UT0A 2VVNA 1REQA 1T41A 3N15A 4JCMA 1W3IA 4AC1X 4ICNA 2CXGA 2G0WA 3NPUA 3ARRA 1G4SA 1NFGA 1UWQA 1WBHA 1KB3A 1Q6CA 3RUBL 3GG1A 1CCWB 1XDMA 2FPTA 1BXBA 1W1ZA 3KDOA 4DF1A 2AMGA 4JIQA 4IIDA 1I45A 2PWHA 4GE8A 3UF9A 4TU1A 5K2ZA 1CGVA 4XSMA 4WX2A 2CIPA 2R91A 1YE6A 1TV3A 3B0XA 3R79A 3VZYA 2PS2A 1EYEA 4E2VA 4J4KA 1W2PA 3LK6A 4HA4A 3KXQA 1S2WA 3DBNA 1AODA 1ICSA 3E2SA 3LRKA 2X2GA 1EDTA 1KRMA 1L6FA 1DJGA 4Z0SA 4UTFA 1YKWA 4LBRA 5CG7A 2GWGA 2Z4GA 3WDRA 1W9UA 4WQ6A 5F4XA 3A4AA 3IK2A 2O9OA 2E7FA 1R3TA 3F5JA 3VC5A 1R9YA 3FA3A 1YNYA 1TMLA 4LX4A 1F9CA 1S3TC 4A35A 2QEZA 4UIOA 3ABSA 1PZ3A 1BPLB 4JX4A 3OGVA 3AIEA 1ZAHA 1XBZA 3EA1A 3H2EA 3DFQA 1OFAA 2HE8A 4GUJA 4JICA 1ME8A 4X3ZA 2PZNA 3W83A 1G69A 4LRTA 1K02A 2YDSA 1OGSA 2IPJA 3LNMA 1MQPA 4IJRA 2B31A 1P1XA 3FGCB 4QP0A 2EHHA 2P88A 3M0JA 4Q8MA 2Y2WA 3H22A 3L68A 3QYSA 1JPKA 2GJXB 1E5NA 3MV01 2J7BA 4Z1BA 4W8BA 1OX5A 4AY8A 3OZYA 5HJLA 1NY1A 3ZLGA 1WO2A 3TTSA 1B3OA 4HNUA 1XBVA 1MO0A 2TYSA 4HK7A 2ACRA 1K8ZA 4M6VA 3EA3A 1PL9A 1E5JA 2WC3A 4HPXA 5LNUA 3S2LA 4IX0A 1TPFA 2X7WA 1H1ZA 4UTJA 1YRRA 3W26A 5ABTA 3QQ0A 4AG0A 4LV4A 4XKMA 5C2CA 3KE0A 3TV8A 3G0SA 3STEA 5LIWX 1TTIA 2OTDA 1Y5WA 4XZ9A 1H4PA 4JNYA 2WNNA 5FKYA 4TMBA 2OO0A 4LAUA 4WEVX 1DL3A 5MKGA 3QBUA 4WVXA 4AHPA 3MY9A 5K9CA 1J6OA 2VEPA 3EXTA 5AYBA 3IAQA 1DHKA 4G5DA 3B8DA 3OLGA 3STPA 3NQ7A 3BSMA 1B3XA 3TYUA 1QO5A 3NGFA 1P0DA 1VIZA 2QNEA 3LCLA 2EJ1A 2XINA 1V0NA 4QJ3B 4V27A 2NXHA 4HPNA 3LN3A 1QI5A 1LRNA 1U1JA 3B4YA 4B4FA 3LLXA 1EXPA 2J74A 4B4HA 4PB5A 1MEHA 3OA5A 2WO5A 2V68A 2P1FA 1DXEA 3C0SA 2PDXA 2ZZ1A 1ZQ5A 1XLKA 1EF2A 4CCEA 4L1XA 4MLJA 4FNTA 1YIXA 4GD0A 2WKJA 1DQUA 1TFVA 1GHRA 1S1RA 4EXBA 1RUSA 2OEJA 3THDA 4B15A 3K4AA 2XFYA 3B04A 5FJOA 1X6NA 2RKXA 3NQBA 1AQFA 3IPWA 1HJXA 2BGSA 2XVNA 2Z00A 1XFBA 2BHZA 6PTDA 4JEJA 2ZZ4A 3CPGA 1NDVA 1C29A 1Q4NX 1A5CA 1YX1A 2PTZA 1ZPTA 3G1RA 3NZPA 3QGVA 3VIKA 3SJNA 3N2XA 2W3ZA 4FX7A 3UQNA 3NEHA 4RV3A 3VNYA 3CQKA 4A05A 5IBXA 1BKHA 1IGWA 4K7YA 4GY0A 3AXHA 1KRCC 1DWIM 3FK4A 3E2RA 2C79A 3WIJA 4KETA 2Z1BA 4BK9A 2W0UA 4XB3A 5A6KA 2NQZA 2YCJA 3U5YA 1K6AA 4C6OA 1E4LA 5EL1A 1V3HA 4BEQA 4NI3A 1QBAA 3WLIA 5FJUA 2C15A 3W2KA 4A8LA 4K38A 1GKQA 4C6NA 2IPFA 4K1WA 1SO4A 2CKRA 2C8NA 3FYOA 1IF2A 4DWSB 4LTSA 1WV2A 4B5TA 2V2CA 4N42A 3CC1A 2VX5A 1FWWA 1NOUA 1U1HA 5E1QA 5E93A 4HOWA 3GG8A 3V1HA 5DRCA 3AUOA 3GC5A 3QRHA 3BURA 1XRSA 4ZSTA 1GPFA 3A23A 3QOKA 1DJWA 1XKJA 4O1DA 2A3EA 2VP8A 2Z28A 1KA9F 1LG2A 3DC8A 1XIDA 2FLIA 5H2ZA 1KTCA 3NOEA 1I75A 3B8VA 3MMDA 3P93A 2FTWA 1D8WA 3HFTA 4A3RA 4C6BA 1SMAA 3VKAA 1JZ3A 4DQWA 2D2GA 3VC6A 5AHMA 4EP8C 1OGBA 3RXZA 4E3TA 4L80A 3QHNA 3XISA 1ITUA 2ZTKA 2QPUA 3MYPA 5FEPA 5KETA 1LORA 4P8XA 3HFYA 8XIAA 3KCLA 4QM1A 4MPKA 2C16A 5LIYX 2ISVA 3Q65A 4GCXA 2NQHA 4PMYA 4ZEPA 3B9NA 3UR2A 4W7WA 3BANA 2KX9A 5L6UA 2J77A 3TC3A 4WSJA 4UFKA 4IUOA 1R8LA 2P3EA 4PFHA 3DHDA 4H41A 1J2BA 3R25A 4H9UA 2QCLA 5XIAA 1W5NA 5CBJA 1P48A 3ISIX 1V6VA 3K4DA 3F5LA 5E0FA 3E5PA 4LNYA 1R3WA 3THUA 4GISA 1YTKA 4WZHA 1NEYA 4MGGA 4J35A 2C3ZA 1XRTA 1JCTA 2DJLA 1KM0A 1DJYA 4JFUA 3LERA 1NM9A 2BOGX 2ZICA 1EOKA 2GJNA 1VRXA 1M5WA 4N9CA 3P2VA 1HG3A 2PFHA 5MF5A 4MNLA 4W88A 1E73M 5AHIA 3TTQA 1YPXA 1EJWC 1TB3A 4DPPA 1TIMA 5A5WA 5C9ZA 3WLHA 4Z2IA 2BGQA 4K36A 3MS8A 3TE9A 2GVYA 2QJNA 4Y8FA 4REQB 2DY3A 1I2NA 3W2JA 2YR1A 3G1HA 3BG9A 1NWTA 3UZWA 2VJXA 3IJ8A 5CSUA 1TR1A 4XZBA 3W9ZA 2XTKA 3GNNA 4GI4A 4QTGA 1WPCA 4D6IA 1NDWA 4HB7A 4RZ5A 3A13A 1EJ7L 5FJJA 4QISA 5I5RA 1ZALA 2AQOA 2ZZ6A 2PZ0A 5CAHA 3VIPA 3VZXA 5HR7A 2R1MA 4EPKA 3AC0A 2RDWA 5D33A 3RRAA 1C93A 2NZLA 7TIMA 2GDVA 4HCDA 4WY0A 3W1QA 4LCSA 3OVPA 1MXGA 3DESA 4ASTA 4R3UA 4AZ5A 4W5UA 1I2RA 2VFFA 1FDZA 1UJPA 5I6SA 5KEZA 4PL2A 3AALA 5CSRA 2G3JA 4W93A 4S39A 3EAUA 3THQA 3KVKA 3LM3A 4R7WA 3S9YA 1XYFA 1XLHA 1GVEA 2QDDA 3PFMA 3RLGA 2XJ7A 3R8RA 3W37A 3PJTA 3MCMA 4US6A 4F0HA 4ML4A 4X22A 4Z1DA 4UZUA 3M1ZA 1N82A 1R85A 1U83A 3V3WA 1NWUA 1PDZA 3PBUA 4LCRA 3BDKA 3ABXA 4J3ZA 1F7BA 4GXMA 2VZUA 1XIGA 2ZA2A 3AU6A 3HO8A 3IVUA 3K8KA 1RQBA 2QDGA 4UTTC 3H2NA 1DE5A 4MNKA 4QEHA 3KRBA 5E09A 4CKQA 4DF0A 1HJWA 4GNKB 5D30A 5G2HA 1UJQA 4IOTA 4B91A 2EG8A 4KT2A 4HVXA 3VE7A 4AZBA 4PE8A 2CCRA 2J25A 5DLCA 1JUBA 5G5IA 3W0KA 3OZMA 2E6DA 3M7WA 1OG0A 4HOXA 3I6RA 2WOQA 3UA4A 2GYIA 2IPWA 4DYJA 3AIUA 4PMUA 2VEIA 3SCWA 4RXGA 1IZJA 1W5OA 2FZNA 3S47A 4L1WA 2B81A 1EDGA 1IWAA 3AXIA 2W67A 3SGGA 3VIMA 5D2WA 1MUMA 3H4WA 4UNIA 5FJRA 1L0PA 1TUFA 2PDPA 3MWCA 1W3JA 2W91A 2HQAA 2ANUA 1J8VA 4O17A 4BI5A 2BVTA 2RDUA 1YNPA 1XYZA 2OELA 3D3AA 4O28A 3P74A 4LUYA 5E9XA 2E8YA 3TN5A 3KRZA 2WNWA 3ARXA 3B05A 1GVQA 3A22A 3GNXA 3T8LA 4F9JA 4S3FA 2IXUA 4ZOBA 1S5TA 4NJKA 3W6YA 1ISXA 2DGAA 3PAOA 1A50A 3R10A 3DU0A 3BLIA 2G5WA 2GK1A 3LCIA 3ZQ9A 2YOCA 1LWJA 1UH3A 3NPVA 1KM5A 1XLGA 3S2NA 3T0BA 4JFVA 4V1YA 4RXFA 2XFRA 2UY3A 4LXFA 3TAOA 4AZ7A 4PTVA 1Q4WA 5D03A 4J2MA 3BZJA 4KH2A 3GXMA 4HNOA 2Z1VA 3FVMA 3D6NA 4M51A 2BY2A 4FXFA 4GOAA 2E6YA 6A3HA 3VI2A 3TN3A 4M29A 4W9TA 3LMZA 1VEPA 4ZFCA 3RFAA 3RPDA 1SR9A 1L6YA 2F6UA 3KL0A 1WZAA 4O19A 2VI0A 3TH6A 1UMYA 4AISA 5C9RA 2BHYA 4WY0F 2L5HA 1B31A 3SCNA 2G96A 3H8AA 1XPGA 3ZMRA 1LL6A 3C4UA 2VD8A 4CU8A 4MWAB 4WGXA 2ZIDA 1D7KA 3QPEA 1UOKA 4YNGA 3O0FA 3ZT6A 2D24A 2V63A 2ZRUA 3GY1A 1MZRA 3NQFA 1JZ7A 5D38A 1L6WA 3LMYA 4S3BA 4MYAA 4ZOEA 2OEKA 2WMIA 3OEXA 5HWNA 5J8LA 3P5ZA 1U5JA 3P67A 4UB9A 2YFNA 2AGKA 4O1CA 1V79A 1LP6A 4JIEA 3QC0A 5HXMA 3OGSA 2QPSA 4E8GA 1WAUA 6XIAA 2GGIA 4O52A 5FF2A 1QJWA 3G1AA 2XYLA 1CB2A 2TRSA 1IR1A 3O06A 1W37A 3THAA 2RFGA 1IV8A 3M7SA 2F61A 3GH7A 2OQHA 8CGTA 3W29A 3PZGA 1E0TA 1RPKA 1NF7A 2J62A 1Q63A 5G2WA 3TLQA 1C8XA 2XWEA 1JQXA 2OMAA 2XGIA 4U2ZA 1TPC1 4G1KA 4XX6A 3DUGA 1V77A 1WKEA 4FMVA 2V5BA 3CUXA 4GXPA 3U6WA 3KBSA 3C2VA 3OP2A 3MVIA 5J04A 1EFZA 2D69A 4DWDA 2EPNA 3MTWA 3SQMA 1JPMA 3VD5A 1CLXA 1DWFM 1TG7A 4N4PA 3UPBA 3PVFA 3UVAA 2HXTA 4IP7A 1U33A 1C3FA 4Z2KA 3HURA 2PF0A 2W5FA 3SURA 3OPSA 1FWIC 1HQTA 4PUMA 2OYKA 1XL9A 1VFMA 4O4WA 1VPYA 1LLWA 4ZOCA 4GYJA 3UXDA 4C6EA 3MUY1 4V33A 5I0DA 1A0CA 1IXQA 4ZO9A 3Q58A 2PWFA 2O56A 4CGTA 3I65A 3CL6A 3QW3A 3P3BA 3IJDA 4G7FA 4QFUA 3ARTA 1F07A 2D20A 1UWRA 4TV6A 3KS6A 3LZ3A 3RX4A 3TA6A 1EJTC 1O12A 1OFOA 3AIQA 2G3MA 2E3ZA 4TOQA 4NZ1A 1JAEA 5LSMA 2WZMA 2VURA 1JZ8A 1B9BA 4IG2B 1KNWA 3FSUA 4LUIA 4G7EB 3G18A 2C1GA 1H5YA 1FA2A 1DVJA 4KIRA 3EKGA 3VD3A 1GPWA 1NAL1 1AMYA 5GNYA 3BW3A 4KWVA 1VBGA 2YDAA 3IGSA 4GY1A 5C5YA 3VPLA 4Q8UA 1QTWA 1OQFA 3ABQA 3TTEA 3L23A 4BS0A 3P0XA 3S2CA 3W1MA 3HPXA 4JTHA 1JXJA 2ZRVA 4KEVA 5FL1A 2QF8A 3EWWA 1A5SA 3GH4A 4AWUA 1FWAC 4HK6A 4JDBA 2Y62A 4B5NA 4KCWA 3RN6A 2Z1KA 4ONVA 2DPEA 2DSKA 3GD6A 2V3FA 3BQ5A 5HAOA 3LM7A 1TWSA 3U7VA 3H2CA 4O0KA 3HTWA 2HMCA 5CPTA 5BWFA 2RHGA 3CHCA 3B0PA 4JX5A 3MHFA 2WVVB 1T5AA 1J5TA 3R8HA 4NT0A 3U57A 4ZCWA 4DF2A 1PVNA 3WQPA 1PTDA 5C7VA 4BF7A 1LG1A 3RILA 2O7QA 1GW9A 2EGZA 4IPPA 3PHAA 2OQLA 5FI8A 4BWLC 1MRAA 3AWNA 3DG3A 2PWVA 3PG9A 2J6XA 1F2JA 3WQDA 1RBOB 4P7OA 3TNBA 1MUCA 1US0A 3I7RA 2ODOA 4FNUA 5CPMA 3L9CA 2RGLA 2GVLA 4C1KA 4O0ZA 1DJZA 3T0DA 3CWHA 4IJCA 5A8NA 5AC6A 1YPIA 4JTUA 4XSLA 1IEWA 4OZOA 4ADSA 2VM8A 3E02A 4CQAA 4IMGA 1BVWA 2PSNA 3MV11 2B0MA 2WVSA 1ICQA 3FHQA 4GJIA 1B5TA 1IWBA 4RE4A 3SUWA 3W87A 3T6CA 3R12A 2VDIA 2VOTA 3DFPA 1US3A 1HVXA 3WQGA 2V5DA 5BOFA 3N1AA 1TE1A 1W3NA 3QW4B 4RW5A 1UCWA 4V1XA 3DCPA 1NP0A 4BFAA 2HEJA 2PAJA 1D3HA 1TCDA 4HU0A 1CXIA 1HF6A 4ZTXA 3TJXA 2JF7A 1E6PA 3BICA 3LOTA 3TFXA 1GYNA 1DOSA 3KP0A 3IS4A 1Z44A 4UQAA 3I6TA 2QZRA 3IACA 3CWOX 4JD4A 1WE5A 1Z89A 1GQJA 3QF0A 3GTIA 4EXAA 1A80A 4DUXA 1MNSA 4B5UA 4L6DA 1CWYA 1UP0A 2FHFA 3LUTA 1JULA 1E1FA 3SRHA 3CT7A 1RK6A 1TPVA 4PMVA 2YB1A 2R8WA 1I2PA 2PMQA 9RUBA 4DZ5A 1UWTA 4LRSA 3O8AA 2P0OA 1G4TA 3UVIA 3UR8A 5BU6A 1B4KA 1DWAM 5DY2A 4PB4A 2YPIA 2VFEA 1YTEA 1E9IA 4YPJA 5CC5A 4M82A 1NSJA 2BGNE 3SY5A 5AC4A 1Z48A 1GZGA 4HZ7A 3PPHA 1VFFA 2XVGA 1XLFA 2OZ8A 2NV1A 3WBYA 5HMSA 2FJUB 1E43A 2YIHA 3RIKA 5T8GA 3RM8A 2V3GA 1CNVA 3WF4A 1YXCA 5LGZA 2C0AA 3LG3A 2IW0A 4Q8PA 4GJ1A 4WOQA 4E4PA 1XPYA 3HZ3A 1G01A 4AFYA 4YTRA 3SCSA 1FWTA 1H49A 3BJSA 1DWJM 5KMYA 3TZNA 1DTNA 3UGVA 3CZKA 2I7GA 2VRQA 3VD7A 3W7GA 1IR2A 1H2JA 5I23A 5IFTA 1XIBA 2PD5A 4NX0A 4TTUA 2NX9A 3F4DA 1EC7A 2NSOA 2VC6A 4S3JA 2PDHA 3LGEA 1ZU8A 3NZGA 3PG8A 1XICA 4AXNA 3EX2A 4ZR8A 5C2GA 3DFNA 3TONA 1V03A 3HV9A 5AKQA 1XGDA 5DCDA 3AS0A 4YWIA 3TYEA 1EC9A 3QZAA 2A3LA 4DUWA 4NNAA 3OLEA 5CJ5A 2WM1A 1M04A 5AHLA 4Z1YA 3VA8A 5BZAA 3VM5A 2PWUA 5FEXA 4GIAA 8RUCA 3B8TA 3DG7A 4H1ZA 4AIOA 1FCBA 4I6KA 3G6MA 4NJIA 2BNJA 4K7VA 3NNTA 1HP5A 1H7WA 3FOKA 3MMWA 2ZA3A 4JEQA 1KO0A 3IIOA 4I5RA 3R8GA 4CLMA 1QDSA 1H7PA 3CS2A 1RQEA 4W85A 2W66A 5CH9A 3ATZA 3S46A 4F66A 3GC4A 1CIUA 1UD4A 2F2HA 2R6OA 5A6SA 1ME9A 3CV6A 2QDHA 3DEQA 3CK5A 3GTFA 4LH8A 4XAYA 3SY8A 4NAEB 3BGAA 1EP1A 3CTTA 2JE8A 3I68A 5F4SA 3NOYA 3HQOA 5I00A 4S3CA 2OLAA 4PODA 3NQVA 5FSDC 5D2VA 4MTVA 1KBBA 4QX4A 3VNJA 5KINA 1PTGA 1TVPA 3CIWA 1H62A 3ABZA 5AECA 3IGXA 1L8PA 5D2YA 2ZZ2A 2J7DA 1P5BA 1A5BA 2R1LA 4K3ZA 4DJDA 4EAYA 2Z1WA 1XDLA 1KFJA 4DEFA 5DMLA 3EZ4A 3IIVA 3TW7A 1FWEC 4PMQA 4ZQPA 4QSFA 2EPHA 3IJLA 5CPLA 2P8CA 4H9TA 4J3SA 3NO3A 3NIYA 1H11A 3WO8A 3VAVA 4Z1CA 2Y5SA 3N14A 2C19A 3UERA 4UFMA 2GSJA 2OPJA 1QBBA 3LHVA 1K6WA 1SW0A 3VD9A 3NO5A 1CZ1A 5HDRA 1U22A 2SFPA 1AL8A 2GQ3A 5EA9A 5HNTA 3AICA 2RDXA 4QQ3A 2HE5A 5EMJA 3EPNA 1WNOA 4G8TA 1BG4A 3VDCA 3FDGA 4CD5A 1A53A 2I5IA 1YBQA 5LNWA 2AOSA 1C8YA 4PCSA 2ZWZA 2P0IA 3S5NA 2J27A 2PWEA 1SGJA 3QZEA 4C90A 3CMJA 1NOWA 1ODUA 4O14A 1WKYA 1IZKA 3H4XA 2PPGA 1Q13A 3PULA 2VC5A 1KQZA 2O7SA 2WZTA 1RAKA 2QMJA 3FGCA 4KW2A 1G4EA 1OT2A 1QATA 1VHCA 3E9AA 1YXDA 1A5AA 2GJXA 3WFZA 4KERA 4F0RA 2O9RA 1IGSA 4O50A 4HZ8A 2A3CA 4XVDA 4RZ4A 3W7MA 4MHBA 1VCVA 2OZ3A 3F2CA 5K9DA 3KX6A 3C52A 3IEBA 4AEEA 3K13A 1OY0A 3F4CA 4FIRA 1OX4B 3ZOAA 4J40A 4H9VA 4CEXC 3QY8A 5DY3A 4ZO6A 2FDMA 3GAYA 1X8CA 1EO7A 3GNPA 4EVZA 3EKZA 4S3KA 3LCHA 3THCA 3O0KA 2O4QA 3N4EA 4AZHA 4E2DA 4JBRA 2C7FA 3LY0A 5A94A 3BL3A 4A3UA 3SZ8A 1FH9A 4NJJA 5A2CA 1E1EA 1WDRA 3PBGA 1W9PA 3ZJKA 1IEXA 1X7FA 2ICSA 3TTYA 3T7VA 4D6JA 1I60A 3WENA 2I9EA 1EP2A 4LOCA 1HO4A 4GVGA 3ONBA 1JEZA 2NQJA 3WF1A 4B5XA 2PTYA 3DX5A 5HANA 4WJEA 1SU5A 5HMEA 3QR0A 3GH5A 1UKOA 4XZIA 2PCEA 4G9PA 4XIAA 4EPEC 3NVDA 3LA4A 1WDSA 2X1IA 4PYSA 4LUJA 4ZOAA 1T0OA 3TSBA 4UNLA 5BOEA 1XKYA 2R1NA 2XISA 1EIXA 3W7CA 5DF0A 1Q65A 2PUZA 3SGUA 4QS5A 1E6XM 1PPIA 2YGYA 4GA8A 4GFIA 4IMCA 2IXVA 1ODZA 4C5YA 4JPGA 3VOJA 1N55A 3AHYA 1W8SA 4PTDA 4PMNA 2DUZA 3UG8A 1OCJA 3AI0A 5CKSA 3PUEA 4NNBA 2ZX5A 3WL1A 3AZTA 1XIJA 1DKWA 2YCIX 4P8UA 3CO8A 1OINA 2E68A 3IRSA 1KXHA 4UC5A 3C8FA 2VMFA 3TQ0A 3BLPX 3TYZA 3GVVA 1HTIA 1X6LA 4KEZA 3IJ7A 2E6FA 4HNCA 3LEPA 1W6TA 1VF8A 5BROA 3F1QA 3S1GA 3CHVA 3PZVA 1G7VA 2WNZA 3W85A 4NZJA 3W7EA 2XWDA 4S3DA 4B3LA 4UZSA 3FHAA 4O12A 2GUYA 1XS2A 5A8PA 5IHSA 2E77A 4WGHA 2JGQA 1A0EA 1G7UA 1Y7VA 3A4WA 1VIWA 2HS6A 2A79A 3OZPA 2ZZ5A 4CNOA 3W23A 5FESA 1E3XA 2W92A 2ZCGA 1VFSA 2PA6A 4GVIA 2ZC1A 1QI0A 2PLMA 3N19B 1EXBA 4M7SA 3G1SA 3GKAA 4I8YA 1DIDA 3NXFA 1TV4A 1ONWA 2H8ZA 7TAAA 1PTAA 1K3UA 1ZBWA 1BFNA 1E9ZB 5CGMA 5H8MA 1GOKA 4PBFA 2FB2A 4FALA 4NJGA 4AC7C 1DE6A 4DBEA 1TR9A 3KUMA 1F4AA 3PPCA 3TKFA 1JFHA 4J27A 3IARA 4GWEA 1T8XA 4N9DA 4RDZA 4Q3MA 2OFJA 1QU4A 1LCOA 4QG8A 3V5CA 2EKGA 2HK0A 4L9XA 3NDZA 4JZ5A 2PLCA 1EWEA 4UMBA 3PB2A 2QUMA 4MKSA 4W87A 3QR1A 3L5AA 3TW9A 2C0HA 3ITOA 3B8WA 1KGUA 5T9BG 3T44A 3RNDA 1CX9A 1Z3NA 2GSHA 1AH4A 2CLPA 3BCFA 1XYMA 4C60A 4O8RA 1SYTA 1TV2A 2DZBA 3B97A 1K4HA 5I3GA 3ID7A 1W32A 5HATA 4HKPA 1LL7A 1MDLA 2PWDA 3L4YA 3SCQA 4HPGA 1SJDA 2PRLA 3CIVA 5HWMA 2Z6JA 1M53A 2CBJA 1GGOA 4W4QA 2V6AA 4ZQOA 1UR0A 4ZE4A 3H7RA 4HMDA 1O94A 3MDUA 4C6PA 5LGXA 4E6MA 5BMWA 3MUAA 3W2UA 4UR8A 2XU2A 4UFIA 1FHVA 4KFPA 3WMSA 2OVLA 1JDAA 3NO1A 3EX4A 3DYMA 1TZZA 3PN8A 3BAJA 3TLLA 3NUKA 4GO8A 1Y5XA 4PUNA 1S38A 3MSGA 4QXIA 5AYIA 1OT1A 1BAGA 3HU7A 1PS9A 4D9PA 1RVGA 3NYDA 3HJZA 3EWCA 3GW0A 5J5DA 1HXJA 3O6CA 3WQOA 4IM4A 1KM1A 4LVGA 3WELA 5C55A 1E71M 2PDIA 4QLJA 3L67A 2WBKA 4KCTA 1ZCCA 2J7CA 4MB3A 4OHQA 2ISFA 1ICPA 3VTRA 4WCJA 3OB8A 1TRIA 2HVOA 3NA8A 3GUGA 3FCPA 3U2OA 1TYGA 3PZNA 1GQNA 1XW8A 1F73A 1B9ZA 1NH6A 3CUZA 2EPKX 4DO5A 3RM4A 1CI1A 4J3UA 2FTYA 1J5SA 1UD3A 5KZDA 1RCOB 1NFPA 5I3HA 3TZFA 3ITYA 1C8QA 1MYRA 4AWEA 5I79A 3P8IA 4B2DD 5HPOA 1H50A 3R0UA 4REQA 4WJ8A 4MYXA 1JZ6A 1GOQA 3HMJG 2TAAA 3VKCA 1UUOA 4NU7A 4CVWA 1B3ZA 5CBIA 1FVPA 4Y2WA 5DBUA 2I5QA 4JFTA 4N6FA 3BCDA 4DIAA 3ZJ7A 2ADAA 1KBKA 3WFLA 1KCXA 3FLUA 2VX6A 4ZGYA 1MNZA 4U31A 3LPGA 4ZMGA 4ZO7A 4YTSA 5HBFA 4ZQMA 3CO4A 4J3TA 3CH0A 2ABBA 2EG7A 1OX6A 1Z42A 3UJFA 5A8QA 4AVOA 1OF8A 2VELA 3N25A 4MPQA 3W7IA 4L1GA 4JYDA 4I6VA 1X38A 3O07A 4NKCA 4JHZA 3UETA 3C0LA 1SR0A 3EMQA 3GIPA 3G1YA 1UYQA 3HA1A 1C9DA 4D6EA 4GCAA 3EDEA 3V0TA 1QXLA 3KLKA 2CWNA 4OFCA 2XH4A 5CBBA 4PEEA 4F2BA 2Y7EA 3CZLA 1QPRA 1V08A 1UD8A 3V0SA 1AD4A 3G0UA 1E3ZA 5CSYA 2ZRWA 5XINA 4YU1A 3UFYA 5AFDA 2VZVA 3ITTA 4DN1A 2OYMA 1XUZA 3PZOA 1UWIA 3BQ6A 3I7SA 1RVKA 1XIFA 1DWGM 2JQXA 3R13A 4W8LA 2YLLA 1XQKA 2NXGA 1EGVA 3EBVA 3H26A 4JIIX 1C91A 4R5EA 2WHMA 2XIOA 3WUBA 3VGHA 4LGXA 4RNIA 2GPTA 3CB8A 2VZTA 1MSSA 4YCOA 4UCGA 2WMHA 1UR2A 5ABFB 1KFWA 2BXYA 2G97A 4GQ0A 1GJWA 1AL7A 2H6RA 3SCUA 4QIUA 5I07A 4AIUA 3O7UA 4OQVA 1E4NA 1FHDA 1VPXA 2ACUA 5DXYA 3B8SA 4QITA 2OO6A 4HHHA 2DT3A 3D0CA 4PCNA 3ZT5A 4HCHA 1TRDA 3DFOA 4CD6A 2BDQA 4OUEA 4H8NA 5AVNA 3V5OA 1QW7A 3ORWA 1YTDA 2YA1A 2V8ZA 3ARQA 1TV8A 2ESCA 4UTIA 1FWHC 1OB0A 4IMAA 1TJ0A 4L6HA 3A3HA 4MWAC 1UP3A 3GHTA 1C8VA 1XXXA 5CC7A 3KHJA 3W25A 3KBNA 1EGMA 2ZQ0A 3UWQA 3B3DA 3B8IA 2QJHA 3CV2A 1J0ZA 1T6MA 2FZBA 3PUDA 2Z0IA 1FY6A 1B3WA 3EWYA 5AY7A 2R24A 8XIMA 3L0KA 2BOFX 2GGJA 3MZNA 3DFYA 3AS1A 4LALA 3M46A 5D2XA 5AVHA 4C7FA 4EIVA 1NDZA 3APTA 1A3WA 3IVTA 4D8LA 2NSXA 1J2WA 3KRUA 3K1DA 3WF3A 3WH5A 4PUEA 2CESA 4ZVJA 1DIKA 3Q2DA 2OR2A 4Q4SA 4R9XA 1G1YA 3NAVA 4KEUA 1S5NA 2VL4A 4AQLA 3BAKA 1Q6QA 1FP8A 4IHCA 1WP6A 4LAMA 4ZE5A 2BMBA 4NXKA 1I1WA 3O6AA 1RPXA 2CBVA 5U4NA 2FPYA 4V15A 5JQ9A 4IGSA 4LYPA 3RYSA 4K2SA 2XUCA 1VYSX 4YVXA 3UXKA 2A0NA 2UY5A 1FKWA 4LSBA 1JCNA 4JL1A 4Z17A 3W4RA 1MQQA 4FX6M 1K8YA 4MG4A 3VZZA 2PDWA 3RGTA 1PHWA 5A2BA 3Q4DA 3PTKA 1KWGA 1JYNA 1JYVA 3BGGA 4GI8A 5FA5A 4WDUA 3PJUA 1V0KA 1H7RA 3TYDA 3W7LA 4W84A 5DO8A 4MNMA 1UD6A 5EFFA 1MRQA 1K4GA 3EPOA 4CQCA 4QJ4B 1FFRA 2AMXA 2OODA 1W3KA 1P7TA 1OFDA 5I3JA 3N2TA 1EWDA 4IXHA 4IFKB 4HN4A 2WPBA 1VP5A 3T40A 1SFLA 2OOGA 4F48A 3EDJA 1Q8AA 3WN6A 4MY9A 2Y5EA 4B9YA 2DJXA 1GQIA 2F38A 1BRLB 1ADSA 3INPA 2JEPA 1HL2A 2PGRA 4R7JA 5I02A 3LHWA 1DWHM 4TVDA 5HJXA 5EU9A 1O5KA 3H12A 2V5CA 5H91A 4UTLA 1HVQA 3LBCA 2NLYA 4XV0A 5D02A 1UKTA 2WXDM 3IGUA 5HUPA 4J28A 3GFYA 2QR6A 5IM51 1K7FA 3JS3A 2Y8KA 2Z1SA 3W24A 1K70A 2ZXDA 4GQQA 1DJNA 1RV8A 4XBSA 1QOPA 4PMXA 1WB0A 2V2HA 3WDIA 5JMUA 4LBUA 3L2MA 1AZ1A 3H2MA 2QCCA 3V0UA 1F6YA 2QYGA 4XAFA 3OW1A 4JTKA 1VRDA 4P5UA 2E8ZA 2X09A 5EY5A 3NZ1A 3CQIA 5G4HC 4K8GA 3REQA 2INEA 5I78A 3OYXA 2GZXA 3EEZA 3JZUA 4WJXA 1DIOA 2DIJA 4GG9A 3WH9A 3RMEA 3OU8A 3LHTA 3SAZA 4IIFA 4UUIA 1UUMA 1T99A 1LWIA 3W01A 4GYKA 1XX1A 2Y89A 1M7JA 1EBGA 3TX9A 1KCZA 1RJPA 1HX0A 1QT1A 3QV6A 2ALRA 3MCNA 3LI0A 3RCYA 4K39A 1WOAA 1W1IE 2JF6A 3RF9A 4HJFA 4TTGA 3QGAC 4JTCA 3BW4A 4CCZA 1VS1A 5I3DA 2OGJA 1JI1A 1XLMA 3NXLA 2YCEA 4RDWA 1LBFA 3LCFA 3SN0A 2P3ZA 3W2NA 7ODCA 3WSUA 3CZJA 1IXOA 1KFCA 4G7EA 4JTIA 4IIBA 5CPOA 1MEIA 1P6WA 1NVMA 3FYYA 1S46A 1TSIA 3FJNA 4RK8A 1Y8BA 2HDJA 2WLZA 3DKLA 3WLLA 2ZDSA 3L4TA 3EWUA 3OJGA 2D23A 4AX7A 1MXSA 3USBA 5CGTA 3W3OA 4DJDD 1WXYA 1NDYA 1R3YA 5CPNA 3U2EA 1BSLA 3WLOA 2I16A 3OA3A 4AMAA 2JFEX 1P1MA 1E6ZA 4RL3A 2QT3A 3WQ4A 1ISVA 3RR1A 4IPJA 4EF9A 3PZTA 3G3DA 1R86A 3KP1A 4N7QA 3ZIZA 2QXWA 2NQ9A 3V18A 1GOIA 4PB3A 3ZR4A 5JU6A 4C5ZA 3VABA 3G0XA 1R2SA 1GWJA 4UCFA 1AA1B 3OQEA 1FQ0A 1OFPA 4GUHA 2KZHA 4N6EA 3N11A 4M80A 1QPOA 1OF6A 1H41A 1LT8A 4E5TA 1SFSA 1UIOA 3OBEA 2OCZA 2Z2BA 5GQBA 2VFHA 1IZCA 3TR9A 4U4MA 1YQ2A 2YBTA 3JR2A 4ZSUA 1HJUA 1XG3A 2AL2B 1EJSC 3O9NA 2D0HA 4O10A 2W4XA 4KF1A 3A4JA 3NL6A 4U10A 3EDDA 1EEXA 1JR1A 2VZOA 2DZPA 4I9AA 4PL1A 1UR3M 3FN9A 2H3DA 3TSDA 1W3HA 1ZCOA 3RCNA 3QN3A 1H63A 2VZSA 3FJ4A 1JDDA 2OSXA 1ZP4A 3IIPA 1BF6A 2REQA 4QNWA 1P0NA 3ITGA 4XTIA 3BV7A 3KCJA 4V28A 1XIIA 1E9YB 3B03A 1EPXA 4WXYA 3QSRA 1YE4A 3U0HA 3UWEA 3EDFA 1TWDA 5JBEA 1ECQA 2Q09A 3CV1A 4J3WA 1NTHA 1EUAA 4M6UA 3WMCA 4L4PA 3N2BA 1CENA 4LS0A 2V81A 1X1OA 1EJVC 2WZIA 1UHVA 1GVRA 1FOBA 4OECA 3STGA 1OFRA 4KBXA 1MFVA 1SO5A 2IKIA 2Z7KA 3AS3A 3EXRA 2ZX6A 2AKZA 4G6CA 3VGDA 1ZLPA 4MWAE 4YWSA 1N8FA 1HKKA 2BP1A 4C6FA 4UBPC 4JN7A 5BU9A 5FCZA 1CECA 4U33A 2MANA 1A0DA 5JXQA 4LVDA 4EACA 1ISYA 2Y8VA 2YW4A 3K8LA 3CAWA 1KXQA 1WUFA 4ICCX 2ONEA 3PUOA 1XRFA 1SSDA 3S6DA 4FAMA 2D2JA 1FX6A 3JRKA 5FL0A 4JTJA 2PTWA 4PH6A 3JU2A 2VEMA 3S2MA 1MMFA 1CXHA 3S6OA 1W9VA 2Z1XA 2PDKA 1TTQA 4NILA 2CZDA 4FB7A 1O60A 1EOMA 4S3EA 3GXFA 3TIMA 3MBFA 1KWKA 4KESA 3IVSA 4MF4A 4GY7A 4CU7A 3L4WA 4JTGA 4Q22A 3UZJA 2BG5A 1BG9A 5EBUA 4PEKA 1JZ4A 4H19A 5TF0A 5F1VA 1O68A 1LF1A 1UPMB 1ECEA 2GJRA 3N3TA 4AZGA 4B9ZA 2WMJA 3BO9A 4DLFA 2PDLA 3RJXA 1PZ0A 5DFAA 1HL9A 3DDMA 4Q8NA 2ZBTA 2W9MA 3MI2A 1XBYA 2HVNA 1TMHA 2QVNA 3HMCA 5BRPA 4TQTA 4IGMA 3W22A 3PR2A 4PUDA 4I7WA 3TOPA 4ATLA 1R3RA 3ICJA 4PSRA 4B5WA 1UIPA 1AFSA 4CEUC 5RUBA 4CN4A 2X05A 1PJ9A 1VC4A 3F2BA 3W7RA 4CCDA 1CT5A 3NM1A 1GZJA 2VFDA 3N29A 4WXZA 3W07A 3U3HA 3AIBA 1QPQA 1KTBA 1XLAA 2FZMA 1IEVA 5EMUA 3LU2A 2YBVA 3LDVA 4ADUA 1VD6A 2RJGA 3V75A 2QCMA 3ARUA 1A3HA 1K7XA 2QAFA 4DYKA 4GX9A 4K6AA 4MY1A 1XIHA 3CUHA 2DZUA 1E51A 4H83A 4DWSD 1QW8A 4HGXA 4NVTA 3Q45A 1CGWA 3CAKA 2ZUSA 3E0VA 1NELA 3GNDA 3UP8A 4JQ3A 3QC3A 3AXKA 3MI3A 4JQ2A 3E3HA 3OG2A 3WDPP 1XLJA 3IUHA 3UCDA 1JGIA 1GG0A 1DQXA 3IJ6A 2GQ9A 1EBHA 4DO4A 1T8QA 4PMZA 2VFIA 1VBJA 4NY2A 4A8NA 1QPKA 3PZMA 4Y6GA 3SO7A 3P7YA 3TW6A 1WXZA 3W7KA 3AIRA 3P82A 4PBEA 2PGWA 2DSUA 1GORA 1OABA 4BQ3A 1K9DA 2JKAA 1R0MA 3CUIA 5KTLA 4NAEA 6TIMA 4FOUA 3SB0A 1TPWA 3HF3A 1PIIA 3EMZA 4HMCA 3H7VA 1JZ2A 3U2ZA 4AD5A 3CV7A 1VZWA 5C54A 3E2VA 4KWWA 2PDJA 1TX0A 2FFCA 3A9BA 4CNSA 4QAIA 4EPBC 1XLLA 2GJPA 4MZ1A 4QG9A 3ANUA 4KFOA 4D6FA 4Y9OA 3LQGA 4EE9A 3UG3A 3BOLA 3DFSA 1WA3A 2ZVIA 4IICA 2I9UA 5BNKA 1SQ7A 1V3LA 4C1LA 3WK0A 3JUGA 3OZOA 1SPQA 4JDYA 3GU2A 1WZKA 3VX1A 4IUGA 3C2YA 3PUGA 4N2YA 1GVYA 2E25A 4MZYA 4TX8A 2POTA 4L64A 1ONXA 1TPEA 3APYA 2PDYA 4XZMX 3K1GA 2PP1A 5A1AA 2FGBA 3MCOA 3TJIA 1UROA 3C61A 1VPQA 3RITA 3QV8A 3WCZA 2ZX8A 1M03A 2WLYA 1N8WA 1B3YA 5GJNA 1DJIA 4LV9A 3L0NA 3VIJA 3H2AA 1Q7MA 3DN5A 3FFSA 2PDCA 1R3VA 2C13A 4MJZA 3OGRA 3OOQA 2V67A 4ZQRA 1Q8JA 4DBSA 2NX3A 2WM0A 4POCA 1UG6A 4GHRA 3L21A 3DHPA 3RG6A 4QJ1A 3WBXA 3MP4A 4CCCA 3QLLA 4DJEC 1GK8A 1X39A 1JD7A 4K8HA 1LM1A 3CM4A 4YTUA 1XH2A 1MZHA 3OHMB 4MAVA 3W2MA 1D8CA 4UQCA 3FDKA 3UPMA 4E2OA 4JHMA 5CPQA 1LRQA 3WUEA 2YW3A 2Z29A 2YBUA 5A6BD 2VGFA 3I7QA 1AQHA 5CGQA 1X97A 4PCTA 3HPAA 3VCNA 3VMPA 3S1VA 1PE1A 3M5VA 3T55A 1ZENA 3DERA 3MB9A 3VOHA 5HNNA 4KQNA 1ISWA 3TYBA 1OX4A 3GHUA 2XSXA 3BAXA 4YTQA 1CBGA 4OOZA 3CL8A 4DO6A 3EOUA 3PWGA 1CXKA 2INFA 4A3HA 1XCWA 5DELA 4QCEA 2G50A 1KBJA 3P60A 3N12A 1HW6A 3WJZA 2JK2A 3KOZA 3T0AA 3DH7A 1LL4A 1JL8A 2RUSA 3H2OA 3Q37A 1OYBA 1RSCA 4X9SA 1OCNA 2ZDRA 2NQLA 3GR7A 2Y70A 4QRNA 3MU7A 3N9KA 4ROQA 2QS8A 3FY1A 2QAPA 2MNRA 3LTSA 1EX1A 4AD2A 4LUTB 3GR8A 3TWAA 1QNVA 3A64A 4HU4A 2JALA 1PZ2A 1EQCA 3MBDA 3S6TA 4UOQA 3GNOA 3UD6A 1X6UA 4XG1A 3J7HA 3UNDA 4LBSA 4HCLA 5DMMA 3N73A 3NQ8A 2DIEA 4RCXA 3M5YA 1P43A 2WSRA 2WZHA 2G37A 2WVUA 3W28A 3TROA 1XGEA 1AH3A 3T0TA 3CPRA 2XZ9A 3CPUA 3MHUA 2EEXA 2PDGA 3W6LA 3P6LA 1OC6A 1VFUA 1NU5A 1BQCA 4WY0B 4EX4A 4GIEA 3ZT7A 2DQWA 4AB4A 2ABAA 1R46A 1V3IA 4B16A 1GVSA 3GIYA 4L6OA 5C70A 2IKHA 1Z9AA 3LS9A 3VNZA 3WF0A 2PDBA 3UJEA 1T40A 3N17A 3CQJA 2XIQA 2A3BA 1LLOA 5HUOA 5DT5A 3VX0A 1THFD 5FJPA 5A6JA 4WDTA 2WSYA 3G1FA 4I8DA 2QUNA 2G4FA 2IQDA 1MWOA 2CU0A 3SUUA 3QV7A 4GUFA 5GNZA 4F0MA 1MW1A 1RLCL 3W72A 2A21A 2VRJA 2NT0A 4HZMA 4L61A 4AHOA 3KOYA 4AXKA 4US5D 4PUJA 4UFJA 3T4WA 3M41A 3B40A 4OVXA 1V02E 1KV8A 3P8JA 3PC0A 1FHLA 3MANA 4HHLA 3W70A 4Q6XA 4NZ5A 3M0LA 4R33A 2E5BA 3C2FA 4YVVA 3N2MA 3TTOA 4WUIA 1Q6LA 1VEMA 3AMDA 1SVDA 3WBWA 5HNRA 8TIMA 4UTUA 4R27A 1BD0A 2WANA 1O5XA 3LV6A 3WH8A 3H7UA 1LZOA 3M16A 1O95A 4NI8A 4C6MA 1W5MA 1D2KA 2DT0A 1B4EA 2XN2A 2XIMA 4RDYA 2WKGA 1SFJA 2DZVA 5AYXA 2VHLA 4MSSA 3MO4A 4XUGA 2FIQA 1IE7C 2J78A 4X60A 3U8GA 4MWAD 1QOQA 2WB5A 4O18A 2BY1A 4XZNX 3W74A 2P76A 3FSTA 4DPQA 3V5FA 1IEIA 2UZ9A 3EXSA 4GGBA 4EWND 1XYBA 2CLHA 4QE1A 1ADOA 4M3PA 3C8NA 4PR4A 4R34A 1J0KA 3L0GA 2X42A 4P61A 2DT1A 2BVYA 4NRRA 2HSAA 5IXEA 2QIIA 2GK1B 1FXPA 3G22A 2WMGA 1LT7A 7A3HA 4WKHA 1UA7A 2ZFAA 4JN8A 5CC6A 3SW6A 2E0PA 5C7HA 2ZRXA 5C2XA 3M07A 3W6MA 4U2YA 1GG1A 4Y96A 1Y5VA 1DIEA 5IOBA 3LTPA 3P84A 4D6DA 3KOWA 3W1LA 1QNQA 2V5KA 1CTNA 1JNEA 3H24A 3QPZA 5BRBA 4OUIA 1NP2A 2HJPA 3PZUA 3BLLA 3DXIA 4NAFB 2DZXA 4QLKA 1ZUAX 2C1HA 6CGTA 1XQLA 2G4JA 3BOXA 1E9LA 1TV7A 3VOIA 2J9YA 1FUYA 2J9XA 3KBVA 1XLDA 3FA5A 1DP0A 4LYKA 1S2VA 1TUXA 2WVTA 1XSIA 2AQVA 4LT9A 3DIPA 1LOQA 3HB9A 1D3GA 4QJ5B 1W1TA 4TXEA 3G1VA 3RPTA 4LYRA 1O4UA 4O4VA 4DBUA 1JUEA 3AQUA 1TTPA 4LS1A 3ATYA 3MC5A 2UY4A 3ITXA 1GOXA 5TAOA 3N4FA 1XISA 2O9TA 2RDTA 1AJ0A 3K30A 3NQDA 2OLHA 2WCSA 1UBSA 3GDTA 4ZA0A 1JCLA 1OZMA 4F0KA 4ZO8A 3WNOA 1V7YA 4EAMA 3ZLFA 1RK5A 5TIMA 2JKPA 1NQ6A 3EOEA 5CLTA 5C0QA 4H6RA 3AO0A 2G3IA 4HYWA 3VIFA 4U5IA 2A6NA 3PTDA 4NYYA 4DB7A 2IMRA 3CWNA 4LU0A 2GUUA 4EK7A 3URBA 3TXVA 2HPIA 4LCQA 3AJ7A 1PIFA 4LNCA 3B9EA 1FCVA 3WFAA 4N9BA 3NURA 3W1RA 3OBAA 1Z6KA 3CTLA 1VJZA 1L2QA 3VGEA 3CAVA 3W2LA 3SCPA 4JTAA 1AJ2A 1K9EA 3XINA 1W1PA 3QKZA 1MEWA 3EOSA 1G9HA 3QHOA 1HFBA 4O0QA 2WV8A 1JDFA 4ZTYA 2FVLA 3NVTA 2BOEX 2I57A 3P5YA 1Q5MA 1OWQA 3B06A 4I9JA 4PRRA 3FIGA 3WJXA 3KAOA 3WLKX 3CL7A 4JIPA 4MDOA 1WBJA 4KS0A 3QHMA 3OODA 3BLOA 1MXDA 2V82A 1OYAA 5G2IA 3URNA 3EB3A 1FFQA 3VKDA 4ADTA 5HMDA 3WQFA 4LWWA 1OCQA 3RMJA 3VM7A 1LROA 4GKLA 3T2OA 4F0SA 3LENA 4B90A 4Q7BA 4F9DA 3S9ZA 5I03A 1VFTA 3VFCA 4G56A 4MFDA 4AX6A 5EMYA 3M0XA 3WY1A 2XSBA 1B54A 2DH2A 4HOZA 1ESWA 3N6HA 2FMNA 4KGJA 3NQCA 1R87A 5DXXA 3PNZA 1XP3A 4IT1A 4CD7A 1C9WA 3AXXA 4ZXLA 1XSJA 1KXVA 3TR2A 3ZYZA 1VHNA 2HWGA 2YFOA 3CEUA 5I24A 1GOMA 1RD5A 3GBDA 1QVBA 4M81A 2Y88A 3SI9A 4J9JA 1YEYA 2WJEA 3ABRA 1VFHA 1E15A 3MDWA 1HZYA 1ZBKA 5A6LA 1TVNA 1UR4A 4D6HA 1LBMA 3GG7A 4RX0A 1D7FA 3HQNA 4OU1A 2Q8LA 1TCMA 3QH2A 3PTQA 4JTRA 2QCGA 4FEZA 3GRIA 4UTTA 4Q4QA 3ZVHB 3L65A 3VNIA 3B0UX 1S2TA 1UWAA 2IPGA 3VFLA 4AU0A 2VGIA 3HJEA 5BMXA 2IUZA 3BSHA 4MOZA 4MUPA 4H7ZA 3TYCA 2CHOA 1KLYA 2WW5A 3NL3A 1RALA 5A3HA 2BY3A 4GMEA 2GOUA 2Y63A 2WWDA 1B57A 4Q8OA 2I1OA 4XAGA 1ME7A 2IKJA 3P61A 4QR6A 3N4AA 7ENLA 4E4FA 1OZQA 3PP7A 1ZJIA 1TJRA 1O6IA 1UZDA 3SRDA 4E0CA 1XV8A 1A3XA 3UG4A 1GNXA 2VUYA 3COTA 4IIEA 1J10A 4PBGA 3HGSA 2HNEA 5BRQA 3HG3A 3KL3A 2TMDA 3ZXWA 3WD2A 3R6IA 1W56A 3C86A 1BGAA 2PTXA 2QF7A 1DYSA 4GC3A 3FXGA 3WKZA 3WLMA 3L4VA 4I7UA 3UZXA 4BQ5A 3U5UA 4Q4OA 4B3ZA 3NWRA 3WH7A 1DHPA 5BOOA 1HL8A 2PDMA 1E0VA 3R7MA 2EPMX 5D2TA 2WSKA 1LOLA 4D71A 3NR0A 4JS3A 3QTPA 5CZJA 4I7VA 4DUVA 2VGGA 4IJBA 4AIBA 3LB0A 4IWWA 3BCJA 4DNHA 4RZBA 2Q01A 1NQKA 3B9AA 3GDLA 5D37A 3ZVIA 3B0VC 3KZSA 4IFKA 3GU1A 1WDWA 3TXZA 3NSNA 4ACZA 1OFQA 1E0WA 4PUKA 1EYWA 3ZR5A 4G1NA 4D6CA 2YB4A 4UWMA 3VK5A 1AZ2A 4P7LA 4H01A 3RAOA 2AAAA 3WL0A 1PSCA 3A6OA 5GVJA 2YL8A 1J0YA 2Y4SA 1BRLA 3A21A 1POJA 3SEPA 1KR1A 1S2UA 1G5AA 1LDCA 3GYCA 1HO1A 1R2RA 2D0FA 4PMOA 5SWUA 1E0UA 4IPLA 1QK2A 4FHAA 2WJDA 3LHUA 2EBNA 3T08A 1W9BM 4L65A 3OQ8A 4L9YA 2B7QA 3QLDA 3GXPA 4ZFMA 4GQBA 1KTNA 5LZLA 4OV9A 3VOGA 2ATSA 5CJNA 2A5HA 4FK9A 1ZJBA 4LC8A 5CZ0A 1BF2A 5E70A 3TA9A 4DY1A 3RX2A 4NRSA 2GSEA 4GYPA 3VDGA 3ABOA 1UC5A 2J7HA 4JOMA 3S5ZA 3TN4A 3L5MA 4W5ZA 4L4LA 2E09A 4B2DA 4CNNA 4IL2A 4IF2A 4DJFD 5FIPA 2DSZA 2JIWA 1F61A 2RAGA 2ZUWA 4MVAA 1BWVA 3GE7A 3VNLA 2XFWA 5HQMA 4XBKA 4GC4A 3LTYA 2NWSA 1UD2A 3BV4A 1XWYA 1W2VA 4A2RA 3U48A 3VNDA 4X2RA 4PRTA 4XKYA 1E6RA 3P81A 3LLFA 1R6WA 4ZQCA 1XDJA 2QCFA