3N11A

Crystal stricture of wild-type chitinase from bacillus cereus nctu2
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
325
structure length
325
Chain Sequence
LGSKLLVGYWHNFDNGTGIIKLKDVSPKWDVINVSFGETGGDRSTVEFSPVYGTDADFKSDISYLKSKGKKVVLSIGGQNGVVLLPDNAAKDRFINSIQSLIDKYGFDGIDIDLESGIYLNGNDTNFKNPTTPQIVNLISAIRTISDHYGPDFLLSMAPETAYVQGGYSAYGSIWGAYLPIIYGVKDKLTYIHVQHYNAGSGIGMDGNNYNQGTADYEVAMADMLLHGFPVGGNANNIFPALRSDQVMIGLPAAPAAAPSGGYISPTEMKKALNYIIKGVPFGGKYKLSNQSGYPAFRGLMSWSINWDAKNNFEFSNNYRTYFDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of bacillus cereus NCTU2 chitinase complexes with chitooligomers reveal novel substrate binding for catalysis: a chitinase without chitin-binding and insertion domains
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Hydrolase
molecule keywords Chitinase A
total genus 113
structure length 325
sequence length 325
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2010-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3n11A00
1DTUA 2PBGA 2GVYA 2J74A 3OLEA 5HPOA 1QPKA 3WEMA 1E4LA 2A3HA 1VFUA 4HA4A 2UY5A 1GQKA 3BAKA 1W91A 2WC3A 2WVVA 3ZR6A 2DT2A 4U3AA 3AISA 3IJ8A 4H2CA 3DC0A 4XV0A 4DUVA 2JIEA 3VDAA 1EA9C 5IHRA 2GSJA 2CHOA 3MANA 1XGZA 4F8XA 4CVUA 4P8WA 1CXFA 1GQIA 4PTWA 1BG9A 3G6LA 1JGIA 3ZR5A 3ZT6A 1KXHA 4D6EA 3WBEA 4EK7A 2FHBA 3NIYA 1CGXA 1GHSA 2D2OA 2DGAA 3VU2A 1J0ZA 3MUZ1 4CCEA 1ZL1A 4UCFA 3KEHA 5LA2A 3SUVA 1IT0A 3WDRA 3ARZA 3F5JA 3S2CA 5KEZA 2J7GA 1V3LA 2ZXBA 5FKYA 4W85A 3CGTA 1GQLA 3GNOA 4CGTA 1MQRA 2BNJA 1J11A 5BWFA 1UHVA 3OBAA 1FOBA 2ZXAA 3RO8A 2J47A 2PWHA 2GJPA 4P7QA 4P7LA 4TX6A 1E73M 1KQYA 1IZKA 1W1YA 2YLLA 3DYMA 1US3A 3CMGA 5E0FA 4JCMA 2UY2A 4V27A 1GOKA 3BCFA 1W1VA 2Y4SA 5EMYA 1M04A 1SR0A 2J77A 4OBSA 1G9HA 5FL1A 2VVSA 3MUIA 2XWEA 3WF2A 2A3CA 5CJ5A 1E5JA 2ZICA 3M46A 2ZUWA 2WVSA 4NSBA 3HMCA 2VX7A 3CUHA 5DT7A 4KRTA 1OINA 4JAWA 1BYAA 3L4YA 3AJ7A 4TUFA 1R87A 4H8VA 2WMIA 1E1EA 4OJYA 4DWSC 3GXMA 3L4WA 1AQ0A 4A3YA 1B90A 4F66A 2D0FA 1CDGA 1EH9A 2WZHA 4UQ9A 1NOFA 2G3IA 1LL7A 4AMCA 3PZOA 2YDQA 4AZCB 1OM0A 3ARUA 1M01A 3U7BA 4D6IA 1TR1A 1R86A 1QNSA 4X0VA 5DF0A 4PMXA 2DH3A 1TFVA 2VX5A 4ZXOA 1BYDA 3WF3A 3WL0A 4RE4A 4HZ6A 1V3KA 4Q7NA 3W82A 4MJ2A 4PMYA 4WSJA 1VAHA 3EMCA 1CXLA 2J7HA 2YL6A 1HT6A 1LG1A 1U33A 1FFRA 1NWRA 1U2YA 5ECUA 4N0RA 1B31A 1ECEA 3WD0A 4S3JA 1JF5A 3K4AA 3VGHA 4XB3A 3MMWA 5CQ1A 2WMKA 1OCQA 1I1WA 2JEQA 1GUVA 4HPGA 2XJ7A 2YKKA 3EDFA 2QMKA 1YQ2A 3AHXA 1CGWA 3N17A 1E0XA 2J8GA 1LL4A 2VC9A 3RJXA 1BQCA 4AIOA 1LWHA 4E2OA 3I3DA 3AMDA 3L4ZA 3ZMRA 1HKJA 5JBDA 3K8KA 4HOXA 2DT1A 2ZXDA 3ZJ6A 1E6SM 4W7WA 2D3NA 3DYOA 2GDUA 3WENA 3MU7A 4JKMA 2XGIA 3M07A 4IISA 2D3LA 1BFNA 3GH5A 3LPGA 1BPLB 1MFUA 3VIHA 2WNWA 1CTNA 4HPHA 1NP0A 4HMEA 1R8LA 3AICA 5AC5A 1BLIA 4MAVA 1ESWA 5A8NA 2WXDM 1VEOA 3ARVA 3U5YA 1E0WA 3AIQA 2WC7A 1W2PA 1GOQA 2VOTA 1W9XA 1FA2A 1OT1A 2CKRA 4LXFA 1QNQA 2NSXA 3L2MA 4ZE5A 3WNKA 4K68A 4PEEA 4BS0A 3WMCA 1WZAA 2OWCA 1CPUA 3LPFA 5AYIA 2WMJA 1Z32X 2J7EA 1GJUA 3WMBA 3WQ8A 4AZHA 4J7RA 3AXXA 3WEZA 1UR0A 3T2QA 1LF1A 1DWIM 4KH2A 2JE8A 1E6NA 3PN8A 3A3HA 5I23A 1CWYA 3WF1A 5ABEA 3SCWA 4ZE4A 4HU8A 3GBDA 1JYXA 3AOFA 4W8AA 2WC4A 4CCDA 2XFRA 4F9JA 2CITA 4L4PA 5A2CA 1FFQA 4WKFA 1G0CA 2VO5A 2AMGA 3RM9A 2WKGA 1E6QM 3T08A 2DSWA 1F4HA 2E9LA 2WVVB 4YHGA 4JFUA 1H3GA 1QHPA 1C7TA 4GZJA 3TTSA 5BXPA 2WHLA 1HKMA 2ZUSA 1TMQA 1PEZA 4NRSA 1V0KA 1E3XA 5M17A 1V0MA 4MNMA 3GZAA 3AS0A 3TTQA 1VEMA 2DQXA 1NWTA 1SFSA 3RCNA 2AOSA 2GJXB 1GCYA 5A6SA 2BY1A 3NCOA 4HA1A 3W26A 1CGYA 3PTQA 3PZTA 3DHUA 1FH7A 1BHGA 3K46A 1OSEA 2E3ZA 2YL9A 4QAWA 3W4RA 1R7AA 4JKKA 2VRKA 4V2XA 1CXHA 1E71M 1EDGA 4KRUA 1DWJM 5CSYA 4WKAA 1QHZA 1JL8A 4EANA 2PWEA 1SMDA 1GQJA 1KGXA 1UWTA 5E0CA 3JUGA 1NM9A 1JZ3A 1ZJAA 1EOKA 1H5VA 1QOXA 1VENA 4DUXA 1QNOA 1CLVA 2CPUA 3ZT7A 4UFMA 1GHRA 4PMQA 2VR5A 3SURA 1JAEA 1C8YA 1XCXA 1M03A 4JFVA 1UZ1A 5A8MA 2XVNA 2XWDA 5GQBA 2YBUA 1GOIA 1EIBA 3N9KA 1ZS2A 2J25A 3WIJA 4QFUA 1MWOA 4YHEA 3VILA 2IXVA 2YJQA 1WNOA 3VVGA 2DIEA 4C7FA 3SCVA 4UOZA 5D8WA 4AW7A 5IFPA 2J79A 1OD8A 3L4TA 4PMVA 2D22A 1UH2A 3PTMA 3VGDA 1UKSA 2C0HA 2CCRA 3VNZA 5D9PA 3W27A 4ATWA 4AD3A 1VJZA 4OOZA 1HJQA 3OB8A 1ODZA 2DSKA 4D6JA 2J7DA 1JD9A 1XRVA 3GTNA 3KWXA 1QBAA 1V3HA 3VOCA 1WKYA 1WZLA 2EO7A 4D6DA 5CPSA 2VQUA 2C8NA 1MXDA 1C91A 5CXPA 3WNMA 4M82A 4BZYA 2JALA 2G3NA 1ZU8A 1ITXA 1PX3A 1W1TA 4URIA 1GZJA 3CZLA 1EQPA 3UG4A 2O92A 1EO7A 3T09A 4AZIA 1OGBA 1ZBCA 3NDZA 2ZIDA 2BVTA 1WZKA 2WB5A 4UR9A 1C7SA 1B3WA 3RILA 4CKQA 4DM2A 4CD8A 5A6AA 2DSUA 3BAIA 1FHDA 4PTXA 2XYLA 3L4UA 1Q6EA 1CZ1A 4WK9A 4UOJA 3W38A 3EDKA 4UFJA 2EPLX 1XC6A 1J0IA 1UR2A 4QDMA 5I79A 4PBGA 4GPNA 4MB1A 2XSBA 3W53A 4P7RA 2WHMA 1JZ7A 2CIPA 3MMDA 3CUFA 2ZUNA 1WE5A 1TCMA 2E4TA 3RIKA 2W61A 3MSGA 2ZUVA 2EEXA 1IZJA 5EFDA 2X0HA 1V02A 1Q6DA 3ARYA 1EDQA 2EBNA 3BAWA 3N15A 2YDSA 4AZGA 2VZVA 4CD7A 4LYPA 2ZE0A 5CLTA 1UWRA 5A1AA 2V3DA 3ARPA 1J0KA 1XSIA 3ARTA 2EXOA 4AIEA 4PSRA 5KZ6A 4IM4A 2CESA 4FLOA 2BXZA 1HJUA 3AI0A 3NJ3A 3EYPA 1JZ5A 2Y8VA 3WD1A 1B2YA 2W62A 2WKLA 4TVUA 3SCRA 3PZMA 4Z2HA 4ACYA 1KQZA 4LYQA 4ZXLA 4C7GA 1GNXA 2Q8XA 2WSPA 5CLWA 2WBKA 3W6LA 3GBEA 3BCDA 3WFZA 1Q4NX 2UY3A 3VD4A 3FN9A 1K9DA 2ESCA 3PZVA 2CKSA 2J4GA 4V28A 3N13A 4PMRA 2OWWA 3VDHA 4U2ZA 1LG2A 1JD7A 4JFWA 2BXYA 3PBGA 2NT0A 1BVZA 1LWJA 1VBRA 1PJ9A 4BQ2A 1UKPA 1E3ZA 1EDTA 2B31A 2J75A 1J0HA 3POHA 5BRQA 1UKOA 3F5LA 4U2YA 4FK9A 3BMVA 1YHTA 1EO5A 4GKLA 3WD2A 1CXEA 4PMNA 1VJSA 2D0HA 4DWSB 3WQ4A 4KMQA 1A3HA 2UY4A 2PF0A 1GW1A 3G6MA 2GFTA 2BHUA 4R27A 2WCAA 3SUTA 5I6SA 4AZ6A 4MAZA 1V0NA 1HJWA 1W3LA 4ML4A 4HU0A 2VCCA 4JCLA 4GO8A 3WQWA 4AC1X 3KL0A 4MNJA 1KFWA 1VEPA 5A8PA 1JZ4A 4JFSA 3VKKA 3SIMA 4KWUA 1Q6CA 1SYTA 3B9DA 3WQVA 4Q22A 2O9TA 2VZOA 3CZEA 4AD4A 1QI0A 5EFFA 5BXSA 1BG4A 1WZMA 6A3HA 4OZOA 3TOPA 2WMFA 2GJXA 1H4PA 4GI6A 2F8QA 1B3XA 1JDCA 3VDBA 5D8ZA 9CGTA 2V5DA 4AYSA 1JXJA 3MS8A 3UEQA 1FP8A 4D1IA 1DP0A 2XPKA 3AHZA 4WJXA 1JI1A 1PBGA 1V02E 3BMWA 3CPUA 3CHCA 5I24A 2A3AA 2TAAA 3ZIZA 2Z1KA 3O6AA 1QBBA 5DMYA 4TXEA 2GK1A 1HL8A 1B9ZA 5HBFA 3KL5A 1VFFA 2WBGA 1JXKA 3OGSA 3WUFA 1J9YA 3AFBA 4W5ZA 3GXIA 3I3EA 5E6ZA 4W8LA 4ZFMA 4UNIA 4D1JA 2W67A 4AWEA 5ABHA 4MDOA 1W3JA 1C92A 4W7UA 3ZQ9A 4PTMA 3DHPA 3VINA 2YIHA 4P8XA 4GIAA 2VRQA 1EXPA 3EBVA 1OD0A 1FHLA 1TVPA 1MVYA 1V08A 2W92A 1JI2A 2XFFA 1B3ZA 1JZ6A 3OLGA 4GI9A 1QI3A 1XD1A 3VIOA 5A95A 5CSUA 1BAGA 1ODUA 3VMNA 3CZGA 3A47A 1UG6A 3VX1A 4BQ4A 2ZOXA 1PZ2A 4D72A 2GK1B 1NOWA 1ISXA 5CPQA 2D0GA 1UR1A 4PUDA 5AC4A 4JFTA 1JAKA 2EPNA 5I2UA 2DEPA 3RM4A 5M03A 1UUQA 1QI4A 2G3MA 2YA1A 4PMUA 3N04A 1X6LA 3ZSSA 2CXGA 2WSKA 1WDPA 1MW2A 2ZX7A 3MKKA 1DHKA 2V38A 2YOCA 4LGXA 3TTOA 1JYNA 1MQQA 3O9NA 4CD4A 2VZUA 3CHFA 5AYBA 5GPRA 3CUIA 3EDJA 1DWHM 3WY1A 3BLPX 1RP8A 5A94A 3N1AA 1H49A 1W1PA 5A3HA 1XSKA 4WSKA 4P7NA 4EE9A 1UH3A 3QR3A 2JEPA 4UFHA 3I3BA 4B15A 3AIEA 7TAAA 5I77A 4MNKA 1NH6A 5BCAA 5JIPA 2DH2A 1GVIA 2J7CA 1NARA 5C71A 3BAXA 4P8UA 2VQTA 1D3CA 1KGWA 1GVYA 2QLYA 1UA7A 2BY0A 4DM1A 4RE2A 2ZUUA 2XIBA 2OSYA 1JYWA 4M8UA 1LQ0A 2BY3A 2W63A 3F4VA 3WDQA 3GH7A 1X1NA 1TA3A 3W6MA 1L0PA 1AQMA 4GXPA 1JFXA 2WVTA 1KXVA 1QHOA 2XTKA 3MV11 8CGTA 4FF5A 2BHYA 3FHQA 3WH6A 5HOSA 2EPKX 4M29A 5BRPA 1E5NA 3GH4A 2YL5A 4EAMA 3T0AA 1UH4A 3PTKA 1OGGA 3WDJA 1TE1A 1UZ4A 1VB9A 3PZQA 1J01A 3VMOA 3VIPA 4WKHA 2DT0A 5A8QA 1JFHA 1GORA 2WAGA 2ZX9A 3AIBA 2J8FA 3BAYA 2JIWA 4GQQA 3AIUA 1UR9A 1ISWA 4QLJA 2A3BA 1UD3A 4D6GA 3VUPA 3AXHA 3SCUA 2G8ZA 4W5UA 4B3KA 3BH4A 4AISA 3ARWA 1I75A 4PRWA 1BF2A 1UWUA 4BF7A 4GZIA 2XVLA 2J7BA 2ZWYA 4U5IA 3ALFA 2Y24A 1US2A 4PCSA 4A4AA 1UR4A 4FLQA 1CXKA 1MFVA 2JFEX 4AD5A 1KCKA 5D4YA 4AIUA 4D6CA 4PMOA 4H41A 3CIVA 3W29A 2UWFA 1KWGA 3AZSA 5AY7A 3RDKA 1VIWA 5HDRA 3KL3A 3NYDA 1HJSA 3PZNA 4TTUA 2PI6A 2VCAA 1WAWA 1JNDA 3NDYA 1TZ7A 2JF6A 5F7UA 2XVGA 4XUYA 3OG2A 4AZ5A 1KR0A 2V3FA 2BHZA 2W66A 4Z2JA 1O7AA 1HIZA 2FH8A 2OYKA 1B3YA 1FH8A 3MSDA 1VRXA 4LYRA 4U31A 1CYGA 4MDPA 1MW1A 1IV8A 3GXDA 4XX6A 1KXQA 1H2JA 2BS9A 3VO0A 1K6AA 1SMAA 3ARSA 3IJ9A 1ZBWA 3BSHA 5ABGA 4XZWA 3MV01 5GNZA 2FH6A 2J62A 1J0JA 1J18A 3QOKA 4DWSA 2WW5A 1JDDA 1UKTA 3GDBA 2RGLA 4DWSD 4R5EA 4D71A 1QW9A 1UR8A 4QCFA 5M3WA 2GDVA 4E8DA 3L4XA 3ZJ8A 1E6XM 5GNYA 3EMZA 2VX4A 3J7HA 5M5DA 1S46A 3QGVA 4DUWA 4FMVA 4UTFA 2WYSA 4CU6A 3FY1A 3FW6A 4NI3A 3WH5A 3AQUA 3VD7A 3VTRA 2CETA 2ZUTA 3BSGA 3CLWA 2XG9A 1R7OA 3W37A 1RH9A 1QNPA 1CGUA 1KR1A 2J7FA 3RJYA 4UOQA 3K4DA 2QHAA 1MQPA 4MJ4A 1BYBA 1E0VA 4OUEA 3UETA 1DEDA 2BV9A 3UG5A 4HP5A 2D24A 2VVNA 1WDSA 5HPCA 1CIUA 3N18A 5A6JA 3CZ8A 2BY2A 2CERA 3WDPP 1UWQA 3WBAA 7CGTA 2XIIA 4YPJA 4JKLA 2DIJA 2PWDA 4HOWA 1V3MA 1WDRA 2ZUMA 4PTVA 3BC9A 1AQHA 1KWKA 3BXWA 4JZ5A 3SCTA 1TVNA 4D6HA 4AD2A 4XZBA 4Y7EA 1C8QA 2QMJA 3TONA 1OIFA 1N82A 1M53A 3CZJA 2ZXQA 6TAAA 2V3GA 2HVMA 3KE0A 2WK2A 4HZ7A 2QPUA 1VFOA 1E9LA 4H04A 1ZBVA 1ZB5A 1L8NA 2F61A 3PHAA 1PAMA 1LLOA 1Q6GA 1G94A 4HZ8A 1DWFM 1E43A 3B8SA 3THCA 3WQ6A 4J3UA 4D6FA 4AD1A 4BQ5A 3WUEA 4CCCA 3B9AA 3SUSA 2E40A 1UD5A 4MB5A 3AXIA 5JUVA 3WSUA 1CENA 2X0YA 1XH0A 3ZJKA 1U30A 4UQAA 3WN6A 4B9YA 1MYRA 3ZSTA 5E70A 1CBGA 4EKJA 1V6VA 4ATLA 5TD4A 1GOOA 5FCZA 3IJ7A 1CNVA 3GNPA 3L2LA 3RM8A 3T0DA 4CN1A 4U33A 2X2YA 2RGMA 3VIMA 3AS2A 3VMPA 5D9MA 1CGVA 5JBEA 2X1IA 3EDEA 3UERA 2HISA 1G5AA 3S6TA 2CHNA 1C3FA 1TA3B 3CZKA 1HKKA 4AZ7A 3M6DA 1JF6A 3VM7A 4TVCA 1XH2A 2FDMA 3GM8A 2EPMX 3WH8A 4F79A 1UQZA 1I1XA 2WCSA 2JF7A 5BXTA 4UFLA 3MMUA 4PSPA 1PX8A 1ISYA 1OWQA 3VDCA 4CD6A 3LPPA 1G1YA 4FLRA 2XM1A 1K9EA 1DWGM 3QHNA 3MUAA 3O2LA 3EMQA 1H11A 3APGA 4RE3A 3VM5A 1G01A 2VX6A 3B9EA 1QI5A 3CHDA 1W9UA 1JDAA 2PWFA 1CXIA 1ISZA 1W9BM 2OLHA 3ZJ7A 3RMEA 2O9RA 3UR7A 1VBUA 1V3IA 1J0YA 3CMJA 1UD2A 2OYMA 2XUCA 3EDDA 1C93A 5HNNA 1ZJBA 4OBRA 3FHAA 2EPOA 3W24A 3BLKA 1AMYA 2CBJA 2W4XA 1XV8A 5BROA 3PZ9A 1R85A 4ATDA 3SCQA 1AVAA 4BQ3A 3U7VA 3AMKA 1CGTA 1XCWA 3QOMA 4AEEA 7A3HA 2DSVA 3GYCA 2WWCA 3IAPA 1HVXA 1HN1A 2WWDA 2VR4A 4JL1A 2YL8A 1E15A 3SEPA 4CU8A 4JL2A 1OT2A 3POCA 2XM2A 1ITCA 3A6OA 2GUYA 4W88A 5DO8A 4Z2GA 2D23A 3AHYA 1E6ZA 1B1YA 4CN4A 4NRRA 1F4AA 1M7XA 4BA0A 5I0DA 1HX0A 4GZEA 4M81A 4P7OA 2NT1A 5C70A 3PZGA 2VL4A 2QF8A 1JZ2A 1OGSA 2X8RA 1X6NA 1WPCA 3HU7A 1H41A 4QLLA 5LA1A 4JIEA 1MXGA 5IDIA 4NF7A 3VIFA 1E6RA 3CUJA 3OLDA 5BXRA 5ABFB 3F5KA 2ZX5A 1HJVA 3AS3A 4AY1A 4AXNA 5CZKA 2IXUA 2WZIA 1EHAA 1W9VA 1BVNP 1V6YA 2E0PA 3VD9A 5D9OA 5A6MA 1EHNA 1BYCA 1GJWA 5FOOA 1P6WA 2VT0A 1E72M 1UWIA 1FH9A 4W84A 3AIWA 5JIWA 2D20A 4WF7A 1BGGA 1D7FA 1UD8A 2F2HA 4IPNB 2VZSA 4B16A 2OSXA 4J3VA 3UCQA 3VGGA 5CPTA 1RP9A 2ZWZA 3LPOA 5IFTA 4E4PA 4PYSA 4U3CA 1XH1A 5BYWA 3A4XA 4HA3A 3WFLA 1E4NA 4AD0A 3AIRA 1E4MM 1NOUA 4J3WA 1UOKA 5A6BD 3WDHA 5DEZA 4WIWA 3W0KA 1JG9A 4TOQA 5ABFA 2WHKA 2G41A 3IAQA 1B30A 3AYRA 1PIGA 4L4OA 1CECA 3ZO9A 3SCPA 8A3HA 2VNCA 4LX4A 2E9MA 4QP0A 3VD3A 1FP9A 2EJ1A 4UQBA 3T0BA 1XD0A 3QHMA 2WPGA 2BVDA 1W3KA 3AHTA 4W87A 1ZBKA 2FHFA 4M80A 4MB3A 1OB0A 3QHOA 4ACZB 3OA5A 3FNDA 3WD3A 4C7DA 5E9AA 3WL1A 1DWAM 1Q6FA 3NSXA 4UFKA 3AIVA 4X0NA 4UFIA 2CYGA 4QLKA 3CBWA 5A6KA 1C90A 2G4FA 1E6PA 3LMYA 3WQ5A 3OIHA 1NP2A 1OIMA 4AEFA 1XHGA 4M56A 3SUWA 4W93A 3WNNA 4H8UA 2CBUA 4UZSA 1WDQA 5EBAA 4HOZA 3VNYA 1E4IA 4MNLA 4IPLA 3KZSA 1BGAA 3AMGA 4CU7A 1GPFA 1TG7A 3WMSA 4M24A 4A3HA 2CBVA 2XFYA 5E6YA 3VGEA 1HXJA 3GNRA 3VX0A 2VCBA 2QPSA 2YBTA 4M1RA 5GNXA 3SUUA 3UR8A 1HP4A 4OOUA 3U57A 1QW8A 3FAWA 5FD0A 3ZT5A 1H0IA 2VURA 3DYPA 2VRJA 1KB3A 4P8VA 3THDA 3HJEA 3WF0A 5A69A 4UZUA 5FIPA 4HMCA 3RPMA 3WUGA 4W7VA 4N42A 4AZBA 4YN5A 1H09A 1B0IA 2Z1SA 3WNOA 1V03A 4CVWA 3WUBA 3SCSA 1KBKA 4X9YA 2GJRA 2BVYA 1W9PA 3ECQA 2IUZA 1GONA 4PN2A 2WVUA 1K9FA 3UESA 2E9BA 3D5HA 1VF8A 1W32A 1CLXA 4B3LA 1HJXA 1LJYA 1E1FA 3CUGA 3N12A 2AAAA 3VIJA 5CG0A 3OGRA 1W3HA 1TUXA 1E55A 4PMDA 3SCNA 1CEOA 4UQEA 4NZCA 1W2VA 2QV4A 3BAJA 3VGBA 2WMGA 4ZENA 5I78A 3A4AA 2VUYA 2O9PA 6CGTA 4JHZA 2WLYA 3AYSA 1V6WA 2YDRA 3WNPA 1EQCA 4J3SA 1UWSA 4AZCA 2A3EA 2DSZA 1XYZA 1UYQA 2FGLA 3SCOA 1ISVA 1A47A 4PMZA 4J27A 3W81A 1Y7VA 2E8YA 4ACZA 5LYRA 2D1ZA 1BTCA 3OZPA 3TA9A 1UA3A 3ALGA 3ZOAA 3FAXA 1QI2A 1RD6A 2Y2WA 3BGAA 4W86A 4IUGA 3VD5A 3VIIA 1C8XA 1JIBA 5FL0A 1HVQA 2XSAA 1BSIA 2C7FA 3IK2A 1WP6A 3W28A 2V5CA 2VZTA 1V0LA 1VFMA 4B9ZA 2OWXA 1KBBA 4GQRA 4KGJA 5E09A 4QCEA 2PWGA 1HKIA 3ARXA 4OKDA 1QVBA 4F9DA 1MW3A 5EB8A 5HXMA 3MO4A 3ARQA 2O9OA 3E1F1 4JHOA 4UQCA 2DPEA 1O6IA 2PC8A 3CO4A 1NWSA 3WDIA 3AMLA 5CGMA 3ZM8A 3DECA 5A6LA 1E40A 3WNLA 1GOWA 1V3JA 1HP5A 3N11A 5JBFA 2DT3A 4H7VA 1NQ6A 3TTYA 1XSJA 2X09A 4J28A 5IHSA 3FXYA 3AZTA 5I5RA 2WANA 3AS1A 3WEOA 4Z2KA 3VIKA 3UG3A 2XVKA 3WF4A 1E56A 4GINA 4J3XA 3OLIA 2FGZA 1UD6A 4MB4A 1UQYA 2PB1A 2E8ZA 4TX8A 2DDXA 4OIFA 5A2AA 1OBAA 3NSNA 3TP4A 5C8BB 3WKZA 2YLAA 1MW0A 2BFGA 3K8LA 2J78A 3OZOA 1WCGA 1PZ3A 3CH9A 4CUCA 5DFAA 5A8OA 2VJXA 2EQDA 2CNCA 1PPIA 3OGVA 2VTFA 1GOMA 3HN3A 3VIGA 4BCEA 3K8MA 3CTTA 1WO2A 4MPKA 1KGUA 4CD5A 4W89A 2W91A 3PZIA 1W9DM 4GI8A 1J10A 2VI0A 2VMFA 4MTVA 3CHEA 4KGLA 2WCGA 3MUY1 5DT5A 1WB0A 2CEQA 2WMHA 3AROA 2OSWA 3NUKA 4GO9A 5IXEA 4J3TA 4PUEA 3GXFA 2YA0A 1QNRA 4CN6A 2ZX8A 1PIFA 2WZEA 3VGFA 3WH9A 5LA0A 1V6UA 4U5KA 2XVPA 5I3DA 4FLSA 2FHCA 4ZEPA 2MANA 3AZRA 1E70M 4MADA 3NSMA 1LL6A 3M7SA 1KCLA 3PZUA 1J12A 5CGTA 4W8BA 2WLZA 1XYFA 2XGBA 5A2BA 2WM0A 1HF6A 2X05A 1EGZA 4H8HA 2Y8KA 1JNEA 1UKQA 4UQDA 1B3VA 4LPCA 3W25A 3AMCA 4WLCA 3WELA 1PX4A 4LQ1A 3T2PA 3WH7A 4RL3A 2YA2A 5A6BA 3AHVA 3D3AA 3ARRA 1HNYA 1D2KA 1JYVA 2ZX6A 4HTYA 3II1A 3K1DA 4S3KA 1H1NA 2OYLA 3U5UA 4E8CA 2XHYA 2WHJA 3IANA 3A4WA 1H0GA 2G3JA 4HMDA 1EOMA 1HL9A 3T2OA 2V3EA 2NW0A 4TTGA 1NWUA 2PBOA 1V6XA 4Z2IA 3WD4A 2W5FA 4TVDA 4Z2LA 1K9TA 4PCTA 3VPLA 1UD4A 2CBIA 1RPKA 2Y5EA 2WMIB 5D9NA 1JZ8A 1KXTA 3L4VA
chains in the Genus database with same CATH superfamily
2PBGA 4B90A 1Y8BA 1W1IE 5HPOA 3WEMA 4O57A 1PXGA 1VFUA 4KWWA 2UY5A 3LBCA 3ZR6A 4YTSA 3AISA 1NF0A 3LUTA 3W9ZA 4DUVA 3HA1A 5IHRA 2NQZA 3L9CA 2X40A 1XGZA 5B7ZA 2X41A 3VNLA 2J27A 5LGZA 2BBFA 3H7VA 3G6LA 1JGIA 2Z1VA 5HNTA 2RDWA 3CUZA 4Y9NA 5IBXA 4UCFA 3UA3A 3ARZA 3KM8A 3S2CA 4HK6A 3UJFA 5KEZA 4KQNA 3AC0A 5DCBA 5CKSA 3LBMA 4BWLC 1N8FA 2Z26A 4V1XA 2DZPA 3GR8A 3TWAA 3UXIA 1Q7MA 4CGTA 2BNJA 4DIAA 1UHVA 1FOBA 2ZXAA 2J47A 1XUZA 4WJ8A 2PC4A 4P7LA 4TX6A 1KQYA 1W1YA 1YNYA 4O19A 1KRBC 1A4LA 3S1GA 2Z1BA 4V27A 1W1VA 1DXEA 1EGMA 1M04A 2A79A 4IQLA 3EX4A 3AYTA 5I00A 1G9HA 1R47A 4WDUA 3MUIA 2XWEA 4XWUA 1MNSA 3CAKA 4LAOA 3TDFA 5D30A 3TIMA 2QT3A 2Z2AA 3CM4A 2NQ9A 1RCOB 4F0MA 5KTLA 3HMCA 3TSBA 3MUXA 1BYAA 3NURA 4TUFA 1R87A 4LNYA 2WMIA 1XPGA 1G7UA 5CSSA 3WJWA 4DWSC 3LZ3A 3GXMA 2WOQA 4JIPA 5LNUA 1KKRA 5AHNA 3F2CA 2CZVA 2PTWA 4F66A 4CQ9A 1EH9A 3RR4A 3HG5A 2J8TA 2YDQA 3OJGA 4L64A 3GIPA 3ARUA 1M01A 4DQWA 4H9XA 4I6KA 3SECA 3NAVA 1XDLA 4NZJA 4BKNA 4D6IA 1H7OA 1VP5A 4JTTA 4JTIA 1K8CA 4PMXA 2DH3A 1TFVA 4DJEC 3WF3A 3KBMA 4HB7A 4RE4A 3ITTA 3ABOA 3DG7A 1GVFA 4MJ2A 3VNJA 4WDWA 1VAHA 3S1XA 3EMCA 1LG1A 1U33A 1FFRA 1IR1A 3PPFA 4Q4MA 6REQB 3F4NA 3K4AA 3LGDA 1S5VA 3F7JA 1OCQA 3BOFA 1AJZA 3HG3A 4CQCA 4XKMA 3TMLA 4LTSA 2XJ7A 2DVUA 3HJZA 3FOKA 2YKKA 3EDFA 2V5JA 3SW6A 2FVLA 4QJ4B 5HUOA 1Q45A 3N17A 1E0XA 2J8GA 2PEVA 2VC9A 2DZTA 4E2OA 2BLEA 3ZMRA 5JBDA 3O0FA 3F03K 1XCFA 4W7WA 5BZAA 3DYOA 2GDUA 2GVGA 3OPSA 5JXQA 3WENA 4HYVA 3LPGA 2B7PA 2PDBA 3P8IA 4GUHA 1ESWA 2CLIA 1TIMA 1QPNA 1POJA 2WXDM 5A8NA 3ARVA 3U5YA 4DI8A 3DFTA 3NG3A 2DV0A 5C2XA 3AU6A 4AWSA 1W2PA 2VOTA 1Q66A 1H61A 4JTFA 1QW7A 3TC7A 1R5YA 3OODA 3ZWTA 3WNKA 2ABBA 4BS0A 2H8ZA 2VWTA 4Q8PA 1CPUA 1Z32X 2J7EA 3IEBA 4YXGA 3WMBA 3WQ8A 3FKRA 2Q8ZA 1IR2A 3M43A 1EEXA 5AB3A 3SFKA 5FAJA 5I23A 4GABA 2A7PA 2PWVA 4IPPA 3JVAA 3SGGA 1AD4A 3U48A 4HU8A 3GBDA 4K39A 5LKYA 4Q8TA 5DMNA 4CCDA 2GQ3A 2XFRA 4F9JA 2P0IA 1J96A 1UP3A 3THAA 1G0CA 4AC7C 2VO5A 5T9BG 1S1RA 4DO7A 4C6BA 4J35A 2DSWA 3MP3A 4LVGA 4MJZA 2OZ8A 2E9LA 4IQEA 1H3GA 1QHPA 3OA3A 4TQTA 1Q85A 3PTDA 5BXPA 1EJVC 2WHLA 3URNA 2PF8A 1V0KA 1E3XA 2BDQA 2PTZA 1BRLB 2YCEA 3R94A 3BW2A 1RSCA 3DHUA 4A3UA 1BHGA 3UXAA 3K46A 1XINA 3S5NA 2R1KA 4JKKA 2VRKA 4V2XA 2V81A 5BNKA 5CSYA 1QHZA 3TJXA 4ECLA 2YCLA 4MPQA 5FJOA 1DYSA 3ORWA 1SFLA 1NM9A 3B9NA 2XH7A 1Q65A 1CLVA 2Z7KA 3KTCA 4UFMA 1GHRA 3NOYA 1F5ZA 4XD3A 4PUMA 3DX5A 3OQEA 1MUMA 4JFVA 5A8MA 1Z41A 1OFAA 5HNUA 5GQBA 2YBUA 3MP5A 1TVLA 3WLMA 7XIMA 2PTXA 3N9KA 3BE7A 3WIJA 2ZZ3A 1MWOA 1J8VA 4YHEA 4Q3MA 3R12A 3LXBA 1DORA 2V0TA 1AH0A 3ERPA 5IFPA 4DPQA 3L23A 3A4JA 4MSSA 1OD8A 2J88A 3R25A 1F05A 5FJIA 3STPA 4F3HA 3GHRA 1XIJA 5EMKA 5GJPA 2D22A 3DUGA 2OO0A 2ALRA 1J5SA 2DSKA 2DZSA 1XRVA 3KWXA 2RHGA 3R43A 1UROA 3FA5A 1V3HA 3VOCA 3W1RA 3UWWA 4IHCA 2C8NA 4LOCA 1C91A 1LP6A 4BZYA 1JUKA 4HCLA 2GWGA 1DJNA 1LQ2A 1PX3A 4X60A 4GX8A 4MY9A 1M6JA 3N29A 3VCCA 3CZLA 1VFSA 4KCUA 3T09A 4J1OA 4AZIA 1MZRA 4BR1A 3ONBA 2QJNA 2BVTA 1WZKA 5FSEC 1Q7ZA 3ZFHA 4AMAA 2DSUA 1Z69A 4HK7A 2V2HA 4WK9A 4S3FA 2RJGA 3W38A 1UR2A 3AUJA 1VBJA 4MB1A 4P7RA 4F0RA 1G67A 1JZ7A 1JCMP 3MMDA 2BX7A 3CUFA 2ZUNA 5C9ZA 2ZBTA 3RIKA 5EFDA 1V02A 1DXFA 2QJMA 3VC5A 2NUWA 2G96A 2VZVA 1FWCC 4LYPA 2ZE0A 3T0CA 1UWRA 1J0KA 3ARTA 2EXOA 4QITA 4PSRA 1E9IA 2PRMA 1XIHA 1HJUA 2R1NA 2V68A 1U83A 4TVUA 4RJEA 4Z2HA 1TIWA 2HSAA 4KKXA 1GNXA 1H63A 3G1SA 2NVCA 1DHPA 2WSPA 3M9YA 2Z1XA 3H26A 3V5CA 3GBEA 3GU1A 2YW3A 3VD4A 2CKSA 4R9XA 4V28A 4U4MA 1M5WA 2Z00A 4E2BA 3QLLA 1LG2A 4JFWA 3D6NA 1U1HA 2NT0A 2R8WA 2VUNA 3K13A 4HZMA 5KZEA 1K7FA 3K30A 3G1AA 1VBRA 1BQGA 3UFYA 3DI1A 2B31A 3PSWA 3HPXA 3T81A 2ISDA 1GWJA 4RNJA 2J75A 5BRQA 1JPHA 4P2VA 5G4HC 3IVTA 4FALA 1PVNA 2QCNA 4U2YA 2Z25A 4L1WA 3BQ6A 3BCJA 3WQ4A 1DJHA 3G6MA 1R6WA 3ITXA 2BHUA 1SZFA 5I6SA 2A21A 4IIEA 1SZRA 1TPWA 3A64A 1V0NA 1W3NA 1HJWA 1FWSA 2VDGA 1ZPTA 3JW7A 1KRAC 3FGCB 3KL0A 2HTMA 1TV4A 2ZZ4A 2YYUA 1BXCA 1TO3A 3SIMA 4KWUA 1Z3NA 2VZOA 3CZEA 2QKFA 3L0NA 1BG4A 1FWDC 4OZOA 2VR2A 2D69A 2WMFA 2GJXA 3QR1A 1H4PA 4IIGA 2C79A 2F8QA 4JEJA 8XIMA 1B3XA 1F7BA 2Z28A 5D8ZA 1OJXA 3ITCA 1AA1B 3MS8A 3O07A 4IUOA 5HQMA 4D1IA 3IGSA 4UBPC 3VOGA 2XPKA 4GNKB 1JI1A 1PHWA 3UJRA 1GVEA 2HPMA 3ZIZA 4UTHA 2O4QA 3LHWA 4DI9A 1Q8AA 3W00A 3EPMA 3M0KA 2GK1A 1KM6A 2QPXA 4JY9A 5HBFA 3KL5A 3KXQA 2WBGA 4NNAA 2P8CA 2ANUA 5EMJA 4D1JA 2W67A 4O1BA 1FWRA 1XYLA 4MDOA 1G4EA 4IL2A 4HJWA 3H12A 3PNZA 3DHPA 3VINA 2YIHA 4GIAA 5EMLA 1XIIA 3EBVA 1TVPA 1Q5MA 1XIEA 1DJXA 1TCDA 2Q3OA 4K36A 4KIRA 1I0DA 1VHCA 1K77A 1JZ6A 3KW3A 3VIOA 5CSUA 1BAGA 3CZGA 2EG8A 1UG6A 3K1GA 4BQ4A 2RDXA 2P50A 2QJGA 1UBPC 5CBIA 3WMLA 2GK1B 4JDBA 1NOWA 4DHGA 1ISXA 3PJXA 1Z6KA 1TYGA 3CV1A 3DHDA 3TW7A 4JFTA 5BOOA 4LBRA 3AYVA 3O6DA 3RM4A 4RCXA 2WM1A 3R5EA 4IIBA 2G3MA 2Y0FA 3WX7A 2WSKA 3MKKA 1DHKA 1GZ1A 2V38A 4DELA 4DJDA 1MQQA 3U6WA 4CD4A 1TWDA 4G1KA 4QX4A 3GTXA 1X1ZA 3N1AA 3D46A 2GGGA 4Z1BA 1A5BA 2Z2BA 1UH3A 5M1TA 4UFHA 3TC6A 4E3TA 1I45A 3AIEA 4MNKA 3QFEA 3LD5A 3CH0A 5BCAA 2J7CA 3HQ1A 4P8UA 4HHMA 3GX9A 4RNFA 2E77A 3GTFA 1S38A 3C2OA 2OSYA 1LQ0A 3F4VA 3APTA 2JGYA 2E5DA 1EYEA 3U2ZA 3LSBA 1DJQA 2BHYA 2Y88A 2EPKX 5BRPA 4PRTA 1I2PA 4RZ6A 3GH4A 2QUVA 4GUJA 1WAUA 1NAL1 2LLEA 1UH4A 3PTKA 4S3AA 5F2MA 3PWIA 4FB7A 1TE1A 2HDJA 4O1DA 4YMZA 1VIZA 3RYSA 3H2MA 1GORA 3KOWA 4NY2A 4L6OA 3AIBA 3BAYA 1WYIA 4GQQA 1UR9A 3TR2A 1YE6A 3R7MA 2IW0A 1QK2A 1QT1A 4IX2A 2G8ZA 4HNTA 4MM1A 4AISA 1RY8A 3RK8A 4BF7A 3P2VA 4GZIA 2XVLA 4N9CA 4XZHA 1BKHA 4LBUA 4UIOA 3C3UA 4A4AA 2PSNA 2A1YA 3G1YA 4FLQA 1UMLA 3R6IA 1MFVA 4PMOA 1GPWA 4ML9A 4H41A 4QNWA 3CYVA 2UWFA 3AZSA 4M6VA 3DEQA 3NTYA 1TTPA 3QR0A 2PI6A 4L61A 3JR2A 4PB3A 2XVGA 4CQBA 2DVXA 1YTDA 3OG2A 4AZ5A 1KR0A 3EPNA 4Z2JA 4HPJA 3VNIA 2I17A 1OCBA 4KWVA 1ZAIA 1XRSA 4MDPA 1RPXA 1AW5A 3A23A 2I5QA 3KHDA 3LHTA 1V93A 1KXQA 5CPMA 2BS9A 1X38A 3VO0A 1FWHC 1SMAA 1JR1A 2FTPA 2OZ0A 3BSHA 4L56A 3MV01 2FH6A 1XLEA 4H3DA 4NJIA 1J0JA 5LGXA 1AJ0A 2VOMA 3VYLA 1XS2A 3GDBA 2RGLA 2ZZ2A 2ZKMX 1QW9A 4JTHA 3NQ6A 5K9XA 3NOEA 4E4FA 4PEKA 4BI6A 2A85A 4E8DA 3NDOA 2E25A 1E6XM 5GNYA 1VPYA 3E5PA 3J7HA 4YTRA 3U4AA 4DUWA 4EXQA 3GVVA 3FY1A 2QJJA 3WH5A 3VTRA 2CETA 4C1NA 3RJYA 3K4DA 2QHAA 3HFTA 3UETA 3UG5A 3GW3A 3NQMA 3YPIA 3N18A 5A6JA 1I2NA 2QCDA 5LXXA 3WBAA 2XIIA 2DJXA 4HOWA 2CZEA 3EZ4A 2ZUMA 4PTVA 2FZBA 1KWKA 3W71A 1T8QA 3BXWA 1P1XA 1N8IA 4JTKA 3LK6A 3MSYA 4M7TA 4XZBA 3TONA 1C8QA 1S2UA 2FVMA 1TTIA 5A5WA 2CXEA 1ECQA 3CZJA 1M53A 4BFAA 1BWKA 1XLGA 1Z8AA 2HVMA 4O53A 5FF0A 1XGEA 3ZR4A 7ENLA 2YB4A 1YNPA 2VKZG 5A6TC 3R79A 2P10A 3MQTA 2OXNA 4EPEC 1VFOA 3K5XA 1ZBVA 2PE4A 3KOXA 4BJHA 3DXIA 5AC8A 3UZZA 3IJQA 5FEZA 3ZVHB 1IGSA 1QWGA 4FNUA 1G94A 2V30A 4HZ8A 4IICA 1DWFM 1GVRA 3GFZA 4DO4A 4GGBA 4ZQRA 4J5NA 4J3UA 4AD1A 4WR3A 3O63A 3B9AA 4DBSA 3DH7A 3UT0A 1ADSA 2ZC8A 3Q67A 4R88A 1CENA 1XH0A 3KRBA 4RR4A 2NQ5A 1U30A 2WKJA 3WN6A 4B9YA 1MYRA 1E51A 4YVPA 1NEYA 5K2ZA 4ATLA 5TD4A 3QYQA 4LCQA 3NPVA 1CNVA 3CU2A 4XQ6A 2Q6ZA 1TPB1 2X2YA 3RNDA 4C6DA 2RGMA 3VIMA 3VMPA 4QE5A 1CGVA 3QQWA 5G1TA 2CHNA 1C3FA 2O4MA 1TZZA 3STFA 4NZFA 4AZ7A 3M6DA 4BF5A 1YDYA 1P0NA 5AHIA 1HGWA 4CNOA 3M0LA 4JDYA 3OIXA 4PSPA 1O66A 2XINA 3LPPA 2OQHA 1V6TA 3B8IA 6ENLA 3PNUA 3QHNA 3MUAA 3CQ0A 3EMQA 1H11A 3TUUA 1H1YA 2Q3RA 1XLCA 1G01A 2VX6A 1GEQA 2A2IA 4LEFA 4KWOA 3ZXWA 4XAZA 2B0MA 4LS2A 2PWFA 1EIXA 5ABTA 3ZJ7A 2A6LA 1UIPA 4MZYA 1P6BA 3UR7A 4GKTA 1U1UA 1V3IA 1F6PA 1LBMA 3FHAA 3TN4A 1EX5A 3QW4B 3VOIA 1Y5VA 4WGHA 1XV8A 5LHFA 3NNTA 4AY7A 1W1ZA 4P61A 8RUCA 1TKKA 1KCXA 3AMKA 3GYCA 3MI6A 3WJYA 2VR4A 3QMSA 2ASHA 1E15A 3CEPA 4CU8A 3TJLA 3I4KA 4D9PA 2XM2A 4FNPA 4HNUA 1ITCA 3A6OA 2W0UA 3WQOA 3URQA 2AKZA 5DO8A 2HJPA 1PKLA 3AHYA 4HNOA 3GC5A 3OZYA 1M7XA 3DFYA 4M81A 3PF3A 1G4SA 4P7OA 2Y61A 3LB0A 3MC5A 1KFEA 4ASTA 3RCYA 3PK7A 2PODA 5F1UA 1J93A 3W1MA 3IPWA 3WLPA 2ZZ5A 3WG6A 2X8RA 5HAOA 3SJNA 3TYCA 4LSBA 1WPCA 3HU7A 1H41A 1PE1A 3H2EA 4DO5A 2ZDRA 1GJPA 1PKYA 3VKDA 1F61A 3OG3A 3AXKA 3IIOA 5E1QA 2PDGA 4A6GA 5A8GA 4MOZA 2X30A 2PTDA 1EHAA 1C9DA 1BVNP 2E0PA 1HW6A 5D32A 1K7EA 3WBWA 4RX0A 1EHNA 1BYCA 2ATSA 2VT0A 1VBGA 1LUCA 3AIWA 3W1QA 5JIWA 3W86A 1SQ7A 5DMMA 4WF7A 4ZQMA 4XD6A 3H2OA 2HQAA 4ZSUA 4FI4A 1FCQA 3E0LA 4S3DA 1B4EA 3LPOA 5IFTA 5IOBA 4EWJA 1RD5A 2O7QA 1PKMA 3PUEA 1E4NA 3QMRA 3RGTA 2IQTA 3WDHA 1TSIA 1JG9A 4ILSA 5ABFA 3OHMB 2WHKA 5DLCA 3HG4A 4XIAA 1R3SA 4DN1A 3N6JA 3AYRA 1K8XA 2GWNA 4GY1A 2E6DA 1FDYA 3T0BA 3GG0A 2BVDA 3AHTA 3GY1A 1ZBKA 4M80A 5DBUA 2GGJA 1A5CA 1QK0A 3CJPA 1J79A 1TPC1 4OHQA 1T96A 1RQHA 2Z6IA 3NSXA 4UFKA 4WJEA 1H7WA 3CBWA 1IEQA 1B3OA 3LMYA 4C6MA 1NP2A 4C6NA 5E9XA 1IGWA 3SUWA 1P7TA 2R6OA 4H8UA 4TO8A 2PMQA 2YBVA 3VNYA 4IGSA 3GZ3A 4MNLA 4IJRA 3E5BA 1OF8A 4CU7A 1TG7A 2PDKA 3P5YA 3LQLA 1FRBA 2VCBA 4AX6A 3S6DA 2YBTA 3UR8A 3ANVA 1CB7B 1I8JA 1LOSA 1HP4A 4ZGYA 1QAPA 3TNOA 2YCIX 2PFHA 3ZT5A 3EKLA 2VRJA 1AW1A 3THDA 1R2SA 1XFCA 2C1HA 4N42A 4ADSA 1H09A 3BARA 4OQVA 1YEYA 1UIOA 4MZ8A 1EPXA 3IJLA 3WUBA 1KBKA 1O1HA 2GJRA 4JQ1A 1W9PA 1XLHA 3ECQA 2IUZA 3OU8A 4C6EA 4DVOA 1VH7A 1OZMA 1GONA 1K9FA 3PM6A 1VF8A 5FJRA 2HZGA 3L12A 1A5MC 4DF1A 2V9DA 4L80A 3WQEA 4UB9A 4WY0B 4MLRA 3GXNA 3U3HA 3B40A 2YYTA 1Q2SA 4PMDA 5H8UA 3IIXA 3TN3A 5GJMA 2QCEA 5AOUA 2QV4A 1PYMA 4FOUA 1O5QA 3P62A 4ZENA 5FF2A 2V5KA 3QSTA 4S1FA 3A4AA 3B8UA 2ZA1A 4JHZA 3AYSA 3KFTA 1LBFA 4J3SA 1K70A 1GEHA 2QJHA 1HO4A 3FSTA 3W81A 1Y7VA 3MT1A 1X8FA 1TV2A 4KPLA 3ALGA 3ZOAA 1V79A 3GKAA 4H7ZA 4Q8WA 2J13A 2AKMA 1HO1A 2Y2WA 4W86A 1JIBA 4QS5A 2G97A 3HPAA 3KOYA 1KBJA 3DFPA 3KDOA 3TKFA 4B9ZA 2OWXA 4DWDA 4I8YA 1TTQA 2E6FA 4F9DA 3ABZA 1MW3A 5EB8A 4UQCA 2Y1HA 3E1F1 1O6IA 2PC8A 2ZCGA 1NWSA 3AMLA 4LY4A 5CGMA 3A9IA 2YR1A 2OELA 3EA3A 3O6CA 1TWIA 4IJBA 3N11A 1VYPX 2DT3A 2PGRA 5KZMA 2YZRA 4FR6A 1E0UA 1CLKA 2X09A 5IHSA 4UTLA 3S1UA 5I5RA 2WANA 3AS1A 1ZAHA 4H6KA 5FESA 1HFBA 3WF4A 4MYAA 1Q6LA 3ISIX 3QGAC 3ONCA 5HMFA 4MB4A 4WHBA 4DLFA 4TX8A 3KCOA 4UMBA 1PSCA 3BG5A 4OIFA 3BLLA 5C9RA 3RRXA 3NSNA 2NV2A 1Y0EA 5C8BB 2YLAA 1MW0A 3CH9A 5A8OA 1I2QA 2FMOA 4K8GA 4N9BA 2WSYA 3HN3A 4BCEA 3K8MA 1KGUA 5CC3A 1Q8JA 3S3GA 1UP0A 3L0GA 1W9DM 1J10A 2VMFA 3F1QA 5FF4A 4MTVA 2OEMA 2WCGA 1GYMA 3SJ3A 4IJCA 4FXRA 5DT5A 2WJDA 1V77A 3NVDA 2OSWA 1ZP4A 3NUKA 3E0FA 4BY3A 3W2LA 5G5IA 4CN6A 2ZX8A 2WZEA 4FNTA 3WH9A 1V6UA 3UF9A 2XVPA 3M64A 4DJFA 4F40A 1UB3A 3G8RA 1LL6A 3M7SA 2NUYA 4CNUA 4N9DA 1EWDA 3B0XA 1LUCB 3VZYA 2YSWA 2ISWA 4H8HA 1LOLA 2Y8KA 3BG3A 1UKQA 4QEHA 1DQUA 3AMCA 1PX4A 2X42A 4LQ1A 3T2PA 4YTQA 4HPNA 1H1NA 3U5UA 5RUBA 1CW2A 2WHJA 3B0PA 3A4WA 1H0GA 2G3JA 2V3EA 3GAYA 2NW0A 4TTGA 1E1CA 4Z2IA 3VZZA 3WD4A 2W5FA 3M1ZA 4TVDA 4PCNA 4Z2LA 3P3BA 1QOPA 2WMIB 1JZ8A 3UPWA 1VC4A 4MMWA 5F2LA 1KXTA 4PL1A 4AWUA 3L4VA 1E4LA 2A3HA 1XFBA 4HA4A 2DT2A 2EG7A 3LCGA 4IMAA 1T40A 2NXHA 5DX7A 1VLIA 5LIKX 4S3GA 4YS1A 1EA9C 3KTSA 3MMTA 1LLZA 1XBYA 1WXYA 4PTWA 5C9WA 1WBJA 3SO7A 3ZR5A 4EK7A 2R24A 1UPPA 2FHBA 3FXGA 2DGAA 3QY7A 4CCEA 5FEWA 2A7NA 2PDMA 2XSXA 3BTNA 3MKCA 3SUVA 1IT0A 3WDRA 3W07A 3LA4A 3H8AA 4IH3A 2E09A 2J7GA 4I8DA 2F2KA 1AH4A 3MSRA 5FKYA 4W85A 4ZB2A 3CGTA 2XH4A 2ACUA 2R9RA 2D2JA 1GQLA 3DCPA 1R2TA 3G1XA 4NQ1A 5BWFA 3ICJA 2PWHA 4ZOEA 3FJ4A 2GJPA 3GVQA 3RN6A 4F2UA 2B7NA 4IFOA 5T91A 1PB0A 1OZQA 1E73M 2YLLA 3EB2A 3WLTA 4HU3A 2VFIA 2OU4A 4R7WA 1GOKA 3BCFA 2Y4SA 3GS6A 3NQDA 1LLWA 1OYCA 5FL1A 1U1JA 3NEVA 3WF2A 2QAPA 3R13A 5CJ5A 3B04A 1LM1A 2H9AA 3M46A 2HNEA 4NSBA 3CUHA 3P0XA 4FNSA 4UUIA 4JAWA 3NR0A 3DOPA 2IKHA 4WY0A 4H8VA 4NG3A 2VELA 3LI0A 4LB4A 1TJ0A 3L4WA 2P5NA 4A3YA 4L9YA 2CLOA 1NOFA 1LL7A 3MWCA 1XIFA 1CCWB 5IM51 2XH0A 3G3MA 1TR1A 2VD8A 4DUOA 1N2VA 5DF0A 2NUXA 3LLXA 3P74A 3O0KA 1BYDA 3MBFA 1LT8A 2FJUB 5G4WA 3W82A 4PMYA 3H6OA 1CXLA 2QUUA 1HT6A 4C6OA 4GUIA 1A5SA 3WD0A 2QXWA 3PPHA 3RITA 3VGHA 2OTDA 3CS2A 4XB3A 1Q2RA 5LNWA 5TQLA 1I1WA 2JEQA 4TMBA 1GUVA 2PS2A 3C2RA 4UTWC 1JPDX 3KUMA 3AHXA 3H7RA 1CGWA 1LL4A 1W17A 3RJXA 4ERGA 3LRLA 2NX3A 3AMDA 3L4ZA 3QV9A 2FZ9A 3FDGA 1HKJA 3MI2A 4JEQA 4HOXA 5FJPA 4IP4A 2AL2A 3N4FA 3EOSA 3VFCA 1UZHA 4L1XA 3HQNA 5CZTA 1VCGA 1ZRQA 4PRRA 2NXIA 3B05A 4PUUA 2XGZA 3GHUA 4QBXA 2CZFA 1EB3A 1BPLB 1MFUA 3VIHA 1NSJA 1CTNA 3BWWA 1NP0A 4HMEA 1R8LA 3L67A 2NV1A 5D05A 1AW2A 4MAVA 3H7UA 3BK0A 4LALA 3TYEA 3IVSA 3AIQA 1HKWA 1KLZA 2WC7A 4K1WA 1GOQA 1W9XA 3PPCA 4QTGA 3L5AA 1QNQA 2HK0A 2NSXA 3BLEA 5PTDA 1VZWA 1IXQA 3NQ2A 1RA0A 4JN6A 3W01A 4EAYA 3LPFA 4H8NA 1J2BA 1O95A 3IRSA 2AQWA 3WEZA 3EKZA 1UR0A 4XAPA 3T2QA 4J3ZA 3LBOA 1BD0A 3SR7A 4KH2A 2JE8A 4CQDA 1E6NA 3CQKA 3A3HA 1CWYA 3WF1A 1NJJA 2OX1A 3TW9A 3W02A 3KVLA 3HB9A 4O4WA 5H8PA 4IMGA 2ZRZA 4I9TA 3M0VA 3AOFA 3QV6A 2DP3A 2ZZ7A 2PU0A 2CITA 1NY1A 1R0MA 3EB3A 5A2CA 2IPGA 4E2DA 2V5LA 1IXOA 1EEPA 4GVGA 3T08A 4EXAA 1JVNA 2WVVB 4JFUA 1OK6A 3DERA 3NL2A 4GZJA 3TTSA 2Z0IA 3WQCA 1U5VA 1TMQA 3F4WA 2FB2A 3GNXA 2RKXA 3W1UA 5M17A 5G1YA 1SO3A 3H23A 3AS0A 1VEMA 4GXWA 1EWEA 2BY1A 2HEJA 4MUPA 2ZRUA 4H19A 4XAFA 3STEA 3PTQA 3DFOA 3B03A 1FH7A 2PLJA 2GDQA 3SZ8A 1NFGA 2ZC1A 2GSHA 1OSEA 3E3HA 4GWEA 4QAWA 3W4RA 1R7AA 1E1CB 1CXHA 4GD0A 4KRUA 1DWJM 4WKAA 4EANA 1GQJA 1UWTA 4O15A 5C7HA 3HGJA 5EMMA 3JUGA 4X2PA 1JZ3A 2FYMA 4R7OA 1EOKA 1VENA 3SRHA 1QNOA 2QYGA 3ZT7A 3UNDA 1D3GA 3QC3A 2W6RA 4JYDA 4XTDA 1JAEA 3DFQA 1M03A 1UZ1A 5F2IA 3W7DA 1EIBA 3M5YA 3QY6A 2YJQA 1WNOA 3BW4A 1R3WA 2Q8LA 3NQFA 3FEMA 4NP7A 4AW7A 4O0KA 3TXVA 5AVHA 2J79A 5CZJA 3CIWA 4PMVA 3UCDA 4FX6M 1QU4A 3HFYA 2AQOA 5F4SA 1UH2A 3VGDA 2C0HA 3VNZA 3W27A 4K3ZA 4OOZA 1HJQA 1JCYA 1OX6A 4D6JA 1XLAA 5EY5A 3S8HA 3V16A 3GTNA 4A21A 3QC0A 3UW6A 2B7OA 4XAGA 3KOZA 3COTA 1FVPA 1WKYA 2EO7A 4V1YA 1LOQA 4H9VA 5U4NA 3LG3A 1MXDA 3WNMA 5DXYA 1DOSA 5MF5A 4LAUA 1SVDA 2JALA 5HANA 2KAUC 2G3NA 3TZFA 3FSUA 4XZLX 1R3TA 1ITXA 2Y89A 3UJ2A 3MWAA 4LUSA 4D2JA 5HR7A 4URIA 4EP8C 5FAGA 3UG4A 2O92A 3H22A 1L2QA 2W79A 1ZJHA 2ABAA 2NQHA 1OGBA 1ZBCA 3LHZA 1ONRA 1PYFA 1SJAA 4WOQA 2J24A 5KETA 1B3WA 2BODX 3S1VA 1EX1A 4CKQA 4CD8A 3BAIA 4ADTA 4DJFD 3WQFA 2V6AA 4UFJA 4G7EA 4HU4A 1XC6A 1F8MA 3LRMA 4GPNA 2XSBA 3W53A 1VFTA 2WHMA 2AMXA 2CIPA 4Q32A 2D73A 3O16A 4H9UA 1WE5A 3VDGA 2HWGA 1TELA 5K9CA 1TCMA 1Q3NA 2B81A 2W61A 2H9AB 2PDPA 2V82A 2EEXA 8TIMA 1Q6DA 1EDQA 2EBNA 1EA0A 3BAWA 4E3VA 4GH1A 4CD7A 1I6NA 5CLTA 1DXIA 1JPIA 4ZO9A 3QTGA 1TQJA 4AIEA 5BU9A 2CESA 4FLOA 4WY0F 1JZ5A 3WD1A 3ES8A 3HMJG 3GD6A 1ZSXA 4X61A 1MEHA 4JTLA 3KBVA 1KQZA 1FDJA 9XIMA 3CNYA 1Q4NX 1US0A 2V63A 3FN9A 1K9DA 3BICA 4PMRA 3U2OA 4WZHA 1WUFA 1SJCA 3OBKA 4Y9PA 1XJBA 2EG6A 1PJ9A 1XQLA 4GQGA 4BQ2A 1E3ZA 4GC3A 4Q4PA 5D04C 3TK7A 3A24A 2ICSA 1XIDA 3RRAA 3B8DA 4JTQA 1LQAA 3TQVA 4WVXA 2GGIA 3H4XA 5TBOA 3TC3A 3TLQA 1T7LA 3PBVA 3BMVA 2PLMA 4PMNA 1UJPA 4DWSB 1A3HA 3M0YA 4JYFA 2NXGA 4QJ1A 5CJMA 1OK4A 1P0KA 4I90A 4BEUA 3N2OA 4R27A 3TE9A 4ONVA 1PTGA 4M6QA 2Y7EA 5GVJA 3ATYA 4PFHA 3UZYA 4OECA 4DAIA 4ML4A 4A05A 3WQWA 1MMFA 4GIEA 3BANA 1KFWA 2PZ0A 4JFSA 3H55A 3VKKA 1Q6CA 1SYTA 4Q22A 2O9TA 3LX9A 1QI0A 5BXSA 3THQA 2OEJA 2PGFA 4B91A 1WZMA 4IGHA 3C86A 6A3HA 2R94A 3EWDA 3SRFA 2WNNA 4GI6A 1IZCA 1B54A 5K9DA 1GOXA 1LWIA 2V5DA 4I7VA 1JXJA 3TZNA 2E6YA 3MDWA 2H3DA 1DP0A 1PBGA 3CPUA 4K7VA 5I24A 2A3AA 2TAAA 4PH6A 1OC7A 3C8FA 3QKZA 4B5XA 2Z1KA 3L66A 3KHJA 4IZGA 3QBUA 4IQDA 4NZ5A 4B5TA 1HL8A 5F4WA 3VK5A 1B9ZA 1OVDA 4CQ8A 5C5YA 2XH2A 1JXKA 3WUFA 1J9YA 4GRSA 3WQGA 1XI3A 4L1GA 1OQFA 3IJDA 1C92A 2KZHA 4PTMA 1EXPA 3CQJA 1OF6A 4ZOAA 1MVYA 2IKJA 4MKVA 4DAFA 3MI3A 1B3ZA 4GI9A 1XD1A 1FKWA 5KMYA 2VP8A 1OFOA 3A47A 1P0BA 2OOGA 4R33A 4W4QA 3EA2A 3N6QA 4K6AA 1XLLA 3I4EA 3O8AA 3TSDA 1P0EA 2PPGA 3EWXA 3W74A 1PZ2A 3W85A 4UTTC 4GNJA 1T6MA 4PUDA 3UJSA 1KM0A 3KBWA 4JNZA 1JAKA 4C1KA 1Z89A 5LNVA 1TV5A 2FJKA 1K3UA 3BJSA 5M03A 3T4CA 4C60A 1R9XA 3N04A 2VFFA 1X6LA 3ZSSA 2VEMA 1WDPA 2ZX7A 3A13A 4LUJA 1R3RA 3P60A 3TTOA 1DJIA 3PJTA 1BWLA 5GPRA 2OO6A 3N9RA 3WY1A 3BLPX 4RNHA 1RP8A 4JN8A 1H7PA 4FIQA 3UXDA 1H49A 1IWAA 4ICNA 1XSKA 4TR9A 3NXLA 4LRTA 4JX5A 1JPMA 3I3BA 4B15A 7TAAA 3RX3A 2DH2A 1GVIA 1NARA 2OMAA 4PTDA 4F0KA 3I68A 1VGAA 1SZNA 4HCDA 1GVYA 2QLYA 2PA6A 1UA7A 1OX4A 9RUBA 1F8IA 2XIBA 4C90A 3CV2A 1TA3A 3DGRA 3E0WA 3W6MA 1L0PA 1JDFA 1JFXA 5I03A 2WVTA 1B5TA 2XTKA 4Q8VA 4AF0B 1ICPA 4H4IA 5AZ1A 1F3EA 5TF0A 3WH6A 4GMEA 4GJJA 2PDUA 1E5NA 3DN5A 2Y62A 4EPKA 2YL5A 2VFGA 4RW3A 1UW9A 3T0AA 1GVOA 2OFJA 1E9YB 1TPFA 4UMCA 5LXEA 3VA8A 1TPEA 1TUFA 1J01A 4B5WA 3VZXA 3VIPA 1RALA 3W7IA 2DT0A 3NWRA 4NKCA 1ZZMA 3LM7A 3QQ0A 2ZX9A 4MLJA 4JY8A 4DXXA 3AIUA 4BI5A 3QJAA 4QLJA 4PMJA 3A5FA 2HNHA 3VUPA 3AXHA 3SCUA 3P67A 1UCWA 2G0WA 1I75A 1TJRA 3FGCA 3B0VC 1R30A 5H6HA 3OO2A 3W73A 1XYBA 4US5A 3TLLA 4QIUA 1UR4A 5JU6A 2X2GA 4OT7A 1D8WA 1X7IA 4AD5A 4DB7A 3UWEA 2C3ZA 3CIVA 2QCFA 3W29A 2PGWA 1XR2A 4LB3A 1GGOA 3NZGA 1NDYA 3AUOA 4TTUA 1HJSA 3PZNA 3MZ2A 2VCAA 4N6EA 4J9JA 1TJPA 3M16A 3NDYA 2JF6A 3V4BA 4DBWA 3G1FA 4O17A 2PDCA 2DUZA 4XUYA 2W66A 2BHZA 1HIZA 1XW8A 4I9JA 1SUXA 3TNBA 2OYKA 4PBEA 3MSDA 1R9ZA 4LYRA 4U31A 2Y5SA 2WZMA 3KWSA 3ANUA 5JH2A 1H2JA 3I7QA 3IJ9A 4D8AA 3AALA 2GUUA 3U2CA 2J62A 3CLMA 2ZADA 1RBAA 2BWGA 3C0JA 1UKTA 1REQA 4DWSD 6XIMA 4R5EA 4QCFA 2GDVA 2F9RA 3L4XA 4IGMA 3E2RA 1TX2A 3EMZA 3BGJA 5M5DA 2E1WA 3MCMA 4FR1A 2FTYA 3FW6A 5KSWA 4ZTYA 4MFEA 1RZMA 3MHUA 2ZUTA 3CLWA 1R7OA 1RH9A 1CGUA 5D02A 4UOQA 1MQPA 5K4ZA 4S3BA 2BV9A 1QDSA 4HP5A 1J6OA 2VVNA 3GIQA 2E67A 3OOQA 5J5DA 1BXNA 3CZ8A 4WXYA 3PBWA 3S5OA 3WDPP 1UWQA 1R46A 4LRSA 4AVFA 4YPJA 4F0LA 1AMKA 2DIJA 3C2FA 5HWJA 1GTHA 1WDRA 2IKGA 4PUWA 3ZS4A 5MKGA 5FACA 4K7YA 1PV8A 4JZ5A 5D09A 1H51A 3CEUA 1TVNA 1SSDA 1RV8A 2YCJA 4AD2A 1XP3A 2QMJA 4ZODA 2XDFA 1TWZA 3ITGA 1W8SA 1SM9A 2ZXQA 3F2DA 3KDNA 4BK9A 3MA8A 3KBNA 4C65A 2QPUA 4H9ZA 4AX7A 3I6EA 1E9LA 4IFKB 1UUOA 2F61A 3PHAA 1XISA 3UGVA 3SB0A 5HNRA 4WSHA 1QXLA 2BMBA 1EJTC 4MKNA 2B4GA 3SM0A 3LCIA 1TTJA 3URBA 1RK5A 1PTAA 2G5WA 1FX6A 3BL3A 3FS2A 3NO3A 2C14A 3WLOA 1IF2A 4JTGA 4GFSA 5JUVA 3KCJA 1Q63A 3WSUA 2X0YA 1X8CA 2YCKX 4UQAA 3ZSTA 5EBUA 1VYSX 3OW1A 2QCMA 1V6VA 2BGSA 4JX6A 5KZDA 3GSMA 1RBOB 2OZTA 5EKYA 3N3MA 3GNPA 1YYAA 3LU2A 4CN1A 2QDEA 5JBEA 2TODA 3R89A 3AXMA 2NV9A 3GFYA 3SSZA 3EOEA 2NWRA 2XN0A 3WK1A 1EJ7L 4JHMA 1C8VA 4AU0A 1O12A 2EPMX 1MDRA 3WH8A 4ZBCA 1UQZA 3G77A 3LHYA 5G4EA 1PX8A 3C0LA 2E68A 3EKGA 3QTPA 5TNVA 1XDMA 1RJQA 3BO9A 5LIWX 3VDCA 3IARA 4CD6A 1UJQA 4GCAA 1G1YA 2Y63A 2XM1A 2QGHA 3SDOA 4YL2A 5JH1A 4RE3A 1DKWA 4RZ5A 1CXIA 1PTDA 1W9BM 2OLHA 4JR5A 1M41A 4OTKA 4JNMA 1J0YA 3AWNA 2D2GA 4EF8A 1R2RA 3EDDA 1C93A 4QHRA 2EPOA 2FDSA 2DJLA 1H7XA 3BLKA 5BROA 1XL9A 4DBDA 5I06A 3SCQA 1AVAA 2J9YA 4AEEA 2DSVA 2WWCA 2WWDA 3NPWA 2F6KA 1A50A 5ECVA 3SEPA 1OT2A 3VNMA 3WLSA 2X7VA 4LF2A 3NL5A 2GUYA 4MWAB 5DN1A 4Z2GA 4KFNA 5FJJA 5HATA 2CW6A 3N2BA 1E6ZA 4GNVA 3RX2A 4NRRA 4XZIA 1F4AA 1VS1A 5I0DA 3VOHA 3O1NA 5C70A 2YX0A 3BURA 4Q4OA 2QF8A 2EHHA 4C6PA 1X6NA 3ABQA 3V0TA 1SO5A 3MP4A 3LEPA 5T8GA 3IWPA 1KTNA 4EPDC 4QLLA 3LSCA 4ZL1A 4DZIA 3VIFA 1E6RA 3CUJA 2HE5A 2OLAA 3F5KA 1AFSA 2ZX5A 5F2GA 1HJVA 3HPFA 3GRIA 5CC6A 3UR2A 5J8LA 5CZKA 2IXUA 1TMHA 1RJRA 1OFBA 3TW6A 1W9VA 4KEUA 1V6YA 1TPH1 4CLMA 3HIJA 3W7CA 1GJWA 5FOOA 1P6WA 3IIZA 4AIBA 2D20A 1UD8A 3CAVA 2VZSA 4ZMGA 2PCEA 1W56A 3VGGA 5CPTA 3OVQA 2ZWZA 3W76A 4PYSA 5IBXC 1YNQA 3W2UA 3A4XA 4HA3A 3WFLA 1X96A 1WV2A 3QV7A 1UOKA 3S0CA 3UPMA 2XN2A 2PUZA 3W0KA 1Q7QA 2C0AA 1S2AA 2OOFA 1QUMA 3IAQA 1QWKA 2FZDA 4E8GA 4DJEA 3EOOA 4L4OA 4MJMA 3RU8X 1XLDA 4LUYA 2WO5A 5DRIA 2EJ1A 1XD0A 4IQJA 3QHMA 2WPGA 3PBUA 1W3KA 3RX4A 3N14A 3GKFA 4MB3A 3QHOA 4XBSA 4OVXA 2IPWA 3GFXA 3FNDA 1J2WA 1DWAM 2CLFA 2QQ6A 3GDKA 3QPZA 2Q01A 1K8ZA 1EZ2A 4IXHA 2WQDA 4Q4SA 1QJWA 4QQUA 2VD9A 4QEEA 3HV8A 3MZNA 4HHPA 2G4FA 1RLCL 4ZOCA 3OIHA 1OIMA 1WKEA 4DNHA 1XHGA 1OABA 3KVMA 3EWUA 1OYBA 3WNNA 1GTEA 2CBUA 3CL6A 5D2WA 5C9UA 5EBAA 4KEVA 4G6CA 2RDTA 2FPYA 4EXBA 3KZSA 3AMGA 3NZPA 3OVGA 4ADUA 2CBVA 2XFYA 3T07A 2VC6A 1HXJA 3VX0A 5HINA 5K3VA 4FA3A 5GNXA 3SUUA 1SW3A 4O8RA 4QM1A 3ATZA 4ICCX 3UXLA 4GQ0A 3U57A 4XVEA 5FD0A 2HVOA 1IEXA 4GXMA 1QR7A 4UZUA 5FIPA 4W7VA 4AZBA 4IX0A 4YN5A 3TQ0A 1AL7A 1G4PA 1B0IA 4CVWA 2YXOA 1DQXA 1CX9A 4X9YA 4HVXA 4KERA 2QIIA 3C5QA 4JNYA 3M0IA 2PDHA 1TV8A 2X1RA 2WVUA 1C29A 3D5HA 2POTA 3M0JA 2GOKA 1B9BA 4EF9A 4H6QA 4JQ2A 1YPFA 1CLXA 4TU1A 4K8EA 4ENLA 4GYFA 3N12A 1XYAA 1PL9A 1OEPA 3OGRA 4GVFA 4LT9A 3SCNA 1VCFA 1Z9AA 1AL8A 4UQEA 3GTIA 4NZCA 3VABA 4M6PA 3BAJA 4WCJA 3D0CA 5LNRA 4WGXA 1UPMB 2O9PA 1ZUAX 2WLYA 3OEXA 1HG3A 3G1DA 3W1PA 5EL1A 3WNPA 1UWSA 2A3EA 3SAZA 3SCOA 1A47A 2Y8UA 4PMZA 4DZHA 3G8EA 2E8YA 4IL0A 4ACZA 4LVFA 4YVXA 3RHGA 4O0QA 1ZCOA 2ZA3A 3FAXA 4EVZA 1QI2A 1RCXB 4MWAC 1KRMA 3LXCA 1KRCC 4LUIA 1HVQA 2XSAA 3S5ZA 3IK2A 1WP6A 1LRNA 3JZEA 1VFMA 1KBBA 4QCEA 1HKIA 4OKDA 1FKXA 5AKQA 4DYKA 2I57A 4HPXA 2O9OA 2FIQA 1EBGA 1X98A 4JIIX 4JHOA 2DPEA 3WDIA 3LZ5A 4S3EA 3WJZA 1E40A 3WNLA 1GOWA 2ADAA 1TREA 5JBFA 1NQ6A 3C3NA 4ERIA 3FXYA 3UCCA 3W1AA 3KAOA 1EC7A 5G1MA 2W27A 3VIKA 3UG3A 2XVKA 4B5UA 1PHQA 1REQB 2PDIA 3W7EA 4GINA 2NVDA 1UQYA 4DBEA 1OBAA 3V0UA 2J78A 1YXDA 1WCGA 1PZ3A 4KWSA 4EPBC 2C13A 5DFAA 3WJXA 1PDYA 3DDMA 1S39A 4AXKA 4CNSA 1PPIA 4NAFA 4G1NA 3H4GA 2ISSA 1GOMA 2IS7A 3V3WA 3VIGA 2VEPA 3CTTA 3ITLA 4PODA 3WJSA 1KFLA 3IJ6A 3UR5A 1QASA 4C5YA 4XBKA 1V5XA 1A5AA 2PDNA 5T26A 1RCQA 3H4WA 5HJYA 2BOEX 2WMHA 4H9YA 4GO9A 5IXEA 4J3TA 4RDYA 3R58A 1QNRA 3KP1A 4G5DA 2IKIA 3VGFA 5LA0A 2DZBA 3L7RA 4U5KA 1EUNA 3UYCA 1WA3A 2FHCA 2ISFA 4ZEPA 2QCLA 1E70M 3O05A 2QV5A 2ZVIA 2XGBA 2JK2A 2DQWA 1GVSA 1EGZA 2VEGA 3QRHA 1B3VA 1TPUA 3W88A 4WLCA 3BSMA 4PC8A 4RL3A 3AHVA 3D3AA 2YXXA 5DCEA 2EKCA 4XO7A 3GK0A 2ZX6A 4X9SA 3MHGA 2AGKA 1XIMA 5CZSA 3IANA 1HL9A 1WDWA 2PBOA 3M47A 3O06A 5HJXA 2PP3A 2YCLB 1K9TA 3CQHA 1MUWA 4PCTA 4FOKA 5D9NA 1RPKA 3LDVA 1XC4A 4F2TA 1A53A 1DIOA 1DE5A 2E1DA 3NEHA 2GVYA 3OLEA 1A3XA 3SGUA 3EWWA 1QPKA 3ID7A 4O11A 4D8ZA 2Y7DA 1GQKA 1W91A 2WVVA 3WBYA 4J2MA 2Q02A 3IJ8A 4H2CA 1ZTVA 3WQPA 2JIEA 3VDAA 1WUEA 4K38A 1GG0A 3H2FA 2CHOA 3UVIA 2QF7A 4CVUA 4P8WA 1GQIA 1BG9A 2OB3A 4XISA 4AG0A 1KXHA 4XSLA 3WBEA 4D6EA 3NIYA 1CGXA 1GHSA 3VU2A 1IWPA 3UZ5A 1TWSA 3KEHA 5LA2A 2P8BA 3W2NA 3F5JA 2P76A 2H3BA 4XTIA 3QKEA 4PBFA 3OQ8A 5HULA 3G0SA 3B8VA 2ZXBA 1YBQB 2R82A 3GO2A 1W5QA 3VOJA 3GNOA 1AJ2A 1MQRA 4GYPA 1J11A 3PVFA 4FAMA 1M1BA 4N02A 3RO8A 4GCXA 4C6JA 4K8HA 1F3XA 1UP2A 1JQXA 1IZKA 3DYMA 3SN4A 4J4KA 1US3A 3PBYA 3O7UA 4Q8QA 3W7HA 4AFYA 3V1HA 3G0XA 4Q8OA 1YXYA 4PGLA 1SR0A 2J77A 3C0SA 3UD6A 1KW1A 3L5MA 2A3CA 4NJJA 2G37A 2VEKA 5I09A 1KA9F 3N4AA 4LS1A 2WVSA 2VX7A 1YBQA 3L4YA 4US5D 4HA0A 1E1EA 4OJYA 3NL3A 1PZ0A 4ZO7A 4FNQA 1AQ0A 1SU5A 3T0TA 4O4VA 4Q4QA 3PUDA 5D38A 1CDGA 2WZHA 2QCGA 4UQ9A 2G3IA 1JDEA 3Q65A 4AMCA 3NYZA 4NL1A 3GNNA 3CO8A 1XRTA 1H1ZA 4X3ZA 3U7BA 4A29A 1L8PA 4X0VA 1ZHAA 3H2NA 3DFHA 3QXBA 3ZLGA 4XO6A 1MXSA 3S46A 1EP1A 4JICA 2VX5A 2CC0A 4ZXOA 4NHVA 3WL0A 4MZ1A 2GGHA 4Q7NA 4MVAA 1HKVA 4R85A 3A21A 1VRDA 2YL6A 1NWRA 1EUAA 1U2YA 4LAZA 3BGGA 3TX9A 3U9IA 6TIMA 4N0RA 4S39A 3QN3A 3IUIA 1XG4A 1B31A 1MO0A 1JF5A 1PS9A 1MNZA 5CQ1A 2WMKA 3LLDA 4FS9A 4HPGA 4QSHA 1DVJA 3S83A 1VCVA 5BMXA 3M0ZA 3M5XA 2CLLA 1BQCA 4AIOA 5JVLA 1LWHA 3G24A 4LC6A 2C1GA 3AO0A 2DT1A 1E6SM 2PP0A 1Q4WA 3TMQA 1Q6QA 1EKOA 3MU7A 4QNEA 5AVNA 4JD4A 3TROA 3M07A 1W54A 3PWGA 4IISA 1BFNA 3TYUA 4O1CA 1HL2A 3FFSA 2VC5A 4HPHA 4TV6A 1ZFJA 3MB9A 3CK5A 1VEOA 2V67A 3C0QA 1FA2A 4NVTA 5D03A 2PLKA 2C91A 2CKRA 4NYUA 3WLRA 2C1IA 2QIWA 3L2MA 4JX4A 4ZE5A 4HSOA 3URAA 1WZAA 2OWCA 2HBVA 3FLUA 4LVBA 1GJUA 5I3JA 4J7RA 1BRLA 3AXXA 2V8ZA 3FYYA 1LF1A 1DWIM 1XBZA 3D47A 1QPRA 3NQBA 3L2IA 5ABEA 1XG3A 3SCWA 4ZE4A 1JYXA 4QJ5B 1YX1A 4W8AA 2WC4A 3GTHA 3W1NA 4DYEA 1YW1A 4L4PA 2NWSA 3SY5A 1ZCCA 5LIUX 4GHRA 2WKGA 1E6QM 2WSQA 5JMUA 1EFZA 2ONEA 3LMZA 4YHGA 3RU6A 3CT2A 4O18A 3N2MA 3LI1A 1HKMA 1PEZA 4NRSA 2G50A 4LYKA 2HMCA 4MNMA 3RG6A 3GZAA 3G3DA 3BW3A 1UASA 1KFJA 2DZXA 2DQXA 1NWTA 5D2YA 2GQ8A 3TXZA 2GJXB 1GCYA 1F07A 5A6SA 4OFCA 3CPGA 4MWAA 4LF1A 5TIMA 3W26A 6PTDA 3PZTA 5HK4A 3BOXA 3FVDA 2FGBA 2E3ZA 3W70A 1E71M 5REQA 2RFGA 3DGBA 4YU1A 1SMDA 4KCVA 1KGXA 4YWSA 5E0CA 5JQ9A 1ZJAA 4KFOA 3TQKA 4DUXA 2YZ5A 4TMCA 1T41A 3W2KA 4PMQA 2VR5A 3SURA 1C8YA 3E02A 1DIEA 4ZB0A 2XVNA 4FX8A 2XWDA 4XKYA 3UWQA 1FCUA 3DFNA 7REQA 2HXTA 3VILA 3BLOA 3VVGA 2DIEA 4C7FA 2FQIA 3SCVA 3IV8A 3B06A 3NGJA 3QFWA 1AQFA 4HNCA 3QMTA 4EIVA 1IQ8A 1KBLA 3FKKA 3GR7A 4E2VA 1NQKA 4RUBA 1XF0A 5AHEA 4H01A 2PTYA 2EF9A 3TA6A 1XLKA 3UY7A 1UKSA 2CCRA 1AG1O 4AD3A 3A9BA 4ATWA 3OB8A 1ODZA 2H8XA 1JD9A 2DZVA 2C16A 4B3ZA 3LCHA 2JBMA 4D6DA 3MCNA 5CPSA 4GE8A 5CH9A 2VQUA 5MKGB 4B5NA 3LYEA 3C6CA 3H2CA 4Y9MA 1XLFA 4B5SA 3W72A 4O50A 5DELA 3LQGA 1YTKA 5ENLA 1JRCA 1FWIC 1EQPA 3JZUA 3RLGA 2I5GA 1EO7A 4LH8A 4H6RA 4O1FA 3Q2DA 3NDZA 2ZIDA 2WB5A 4JBRA 5CBBA 3GXTA 1KC7A 4UR9A 1C7SA 2X0SA 3RILA 5A6AA 1ZY9A 1VPXA 4KESA 1FHDA 2XYLA 2O55A 2I56A 1CZ1A 3STCA 1DJWA 3EDKA 3GHTA 2EPLX 1J0IA 4QDMA 1Y65A 3TAKA 4PBGA 3WCZA 3GQYA 3V75A 1YPXA 1SZGA 1WBHA 3DI0A 4UTMA 4IMCA 4ZVJA 3VUSA 1QPOA 3GNDA 2E4TA 4KIEA 5IDZA 2X0HA 3ARYA 4LUSB 2AL1A 1VLWA 2YDSA 4AZGA 4ZQOA 3CUXA 5A1AA 2V3DA 1MRAA 4S38A 4GFIA 1XSIA 3UA4A 3GVRA 1JUBA 3IUDA 3AI0A 3NJ3A 1JEZA 3EYPA 2Z2UA 1O94A 2W62A 2WKLA 4H83A 4IPJA 4ACYA 4GJ1A 2JKEA 4YCPA 4LYQA 4ZXLA 3UZXA 4C7GA 5CLWA 3DU0A 2WBKA 5K7JA 2YFOA 4ES4A 2I5IA 3BCDA 2MNRA 4AVNA 2Z6JA 1M7JA 1PWLA 2ESCA 3SFWA 3GWQA 1KBIA 2XU2A 1XRFA 2OWWA 5FJTA 4U2ZA 1Y5WA 2E5CA 3GDTA 1XICA 4IMDA 1LRQA 1XX1A 4GUFA 4GACA 1BVZA 2DZUA 1UKPA 3PSVA 1EDTA 7ODCA 1IWBA 4N4PA 3W84A 1J0HA 3POHA 4XK2A 4FOJA 4LCSA 4ZQPA 3UYIA 1JCXA 1UKOA 1Q6OA 3UWZA 4POCA 5I7GA 3VC6A 3S9ZA 3R1ZA 1VJIA 5CBJA 4JIRA 3KRUA 1VJSA 3L5LA 2D0HA 2UY4A 4I5XA 1GW1A 2Z24A 4FPSA 4GYPC 2GFTA 2UZ9A 2BASA 4ZOBA 3TYAA 2GL5A 4AZ6A 3E12A 4MAZA 1TRDA 5D33A 5FI8A 3QF0A 3MYOA 4JCLA 4AC1X 4NAEA 1A5LC 1VEPA 2RDUA 3LHVA 2GOUA 1JZ4A 1F2JA 1OC6A 5MHBA 1TMLA 4C1NB 3WQVA 3B9DA 3JU2A 4AD4A 4K1GA 2FMNA 3CAQA 4JOMA 3NVTA 1TR9A 2XIOA 1EJSC 1YDOA 3T7VA 9CGTA 4HNNA 1IEIA 3UEQA 1FP8A 4CEUC 1XLBA 4DF0A 2AGTA 1LBLA 3GYEA 3AHZA 1V02E 2NX1A 4NJHA 4UNKA 4DY1A 4PZVA 3SY8A 5I3KA 3EXRA 3HO8A 5GJNA 1QBBA 1ZAJA 4TXEA 3WYZA 4M1BA 3UVAA 3NQ8A 4NI8A 4W5ZA 4O1AA 3I3EA 5E6ZA 4UNIA 1PKNA 1RJPA 1GYNA 3KLKA 4MY8A 1J5TA 3CHVA 4AWEA 1W3JA 2OQYA 4YTTA 3LCLA 3ZQ9A 4P8XA 3VOFA 1OD0A 4J40A 5HMSA 2W92A 4A8RA 3TYBA 4UR7A 3R8HA 4ZZ9A 5H2ZA 1EL3A 5G2WA 1B57A 1QI3A 5A95A 3VMNA 3TOYA 5CPNA 1EF2A 4Q7BA 2UBPC 4MFDA 5C2GA 3CQIA 5DY2A 4MKSA 1AZ2A 1EXBA 3L65A 4O1EA 3HZ3A 2H6RA 4G8TA 5CPQA 5BW6A 1QTWA 2ACSA 1UR1A 4I7WA 5I02A 4WDXA 2DFAA 2DZAA 1Q13A 2BZNA 2GQ9A 2TPSA 3KBSA 1UUQA 3Q4DA 2CFFA 5DQPA 1D9EA 2CXGA 1FWNA 1OC5A 5DRCA 5HWMA 4JTRA 2YOCA 2ACQA 3UJEA 1KKOA 3DG3A 4HK5A 1BF6A 2MUCA 4D8LA 1YADA 2NLYA 5AYBA 3EDJA 1DWHM 4F0SA 2EAWA 1QMLA 4CCZA 1M65A 3UY8A 4Y8EA 4WSKA 1XKYA 3QR3A 4EX4A 3HPSA 1NH6A 4UTWA 5JIPA 3UBPC 2PDWA 3RAOA 4Q8UA 3BAXA 1D3CA 3V36A 1DTNA 1S2TA 1G6CA 2BY0A 5DY3A 4DM1A 4GVIA 2ZUUA 2BP1A 2VEFA 3WLHA 2INEA 1JYWA 4M8UA 2UV8G 9XIAA 2BY3A 1FHVA 3WDQA 1X1NA 4H7CA 1AQMA 4GXPA 1RVKA 1W8GA 4HKPA 3UWUA 1QHOA 3MV11 4UWMA 3GUGA 2OGJA 8CGTA 1QO2A 3DIPA 2C18A 1MDLA 4NX0A 4OE7A 4M29A 2QUNA 4GIYA 1K8YA 1D3HA 3E6EA 4PA8A 1VKFA 1SFJA 3H53A 3NQVA 3W87A 4Y2WA 3PZQA 4F0HA 4PUNA 1MSSA 4WKHA 4UTTA 4E4UA 5A8QA 7REQB 5HR6A 1M7PA 3B8TA 1FHUA 2WAGA 3QZ6A 4GLEA 2JIWA 1OCJA 1ISWA 4Z1DA 4Z42C 3H70A 1UD3A 4KT2A 4D6GA 3CV7A 3ANYA 4HGXA 4A3RA 4W5UA 3ARWA 5CPLA 4INFA 1JCNA 1BF2A 1UWUA 4I7UA 3SY1A 2ACRA 3ALFA 4KEMA 1QPQA 5XIMA 3PP7A 3P8JA 4AIUA 4D6CA 1RXOB 1A5OC 3RDKA 1LZOA 1CI1A 1H7RA 3KL3A 1FDZA 1Z7AA 4CNNA 3W7KA 1HQTA 3N4EA 3T6CA 5BWAA 1WAWA 3SRDA 4QE4A 2FFIA 1TZ7A 4RPQA 1SJDA 1O7AA 1UZDA 1FCBA 1B3YA 4AHPA 5BRBA 3TWBA 1VRXA 4MHBA 1F3TA 1CYGA 1KLYA 1MW1A 5EPDA 5AHLA 3PB2A 3LXAA 3PFMA 1NU5A 1K6AA 4C5ZA 3KTXA 1ZBWA 1OFEA 4LV4A 5ABGA 4XZWA 4Z0SA 5GNZA 1IHIA 1J18A 3RMJA 3MW7A 4DWSA 1DIKA 2WW5A 3HF3A 1JDDA 3MVIA