3N11A

Crystal stricture of wild-type chitinase from bacillus cereus nctu2
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
325
structure length
325
Chain Sequence
b'LGSKLLVGYWHNFDNGTGIIKLKDVSPKWDVINVSFGETGGDRSTVEFSPVYGTDADFKSDISYLKSKGKKVVLSIGGQNGVVLLPDNAAKDRFINSIQSLIDKYGFDGIDIDLESGIYLNGNDTNFKNPTTPQIVNLISAIRTISDHYGPDFLLSMAPETAYVQGGYSAYGSIWGAYLPIIYGVKDKLTYIHVQHYNAGSGIGMDGNNYNQGTADYEVAMADMLLHGFPVGGNANNIFPALRSDQVMIGLPAAPAAAPSGGYISPTEMKKALNYIIKGVPFGGKYKLSNQSGYPAFRGLMSWSINWDAKNNFEFSNNYRTYFDG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase A
publication title Crystal structures of bacillus cereus NCTU2 chitinase complexes with chitooligomers reveal novel substrate binding for catalysis: a chitinase without chitin-binding and insertion domains
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Hydrolase
total genus 113
structure length 325
sequence length 325
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2010-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3n11A00
3VX1A 2ZUNA 2CKSA 2JFEX 2EBNA 1MFVA 5CLTA 5CZKA 4YN5A 1E71M 3A4WA 2WAGA 4PYSA 4AY1A 1NP2A 1PIGA 2WMKA 1UZ1A 3SCPA 1FHLA 3L2LA 4UCFA 3CMJA 2FDMA 2CITA 1E1FA 3OGSA 4RL3A 3ZR6A 3GDBA 4JFTA 2F61A 1ZBCA 1G1YA 4TTUA 5FKYA 3WDQA 4X0NA 4P7RA 2V3EA 1UQYA 1F4AA 3LPPA 1VFUA 1NQ6A 3WDJA 2JIEA 3AHXA 1ISWA 2WLZA 2XFRA 3AYSA 4XB3A 1JZ4A 3OBAA 2CHNA 1JFHA 4F9JA 4DWSA 1K9EA 1BGGA 1EOKA 4KH2A 4DWSB 4KGLA 3BSHA 3RJYA 4W84A 4W8LA 3VIKA 3WMCA 1LF1A 1ODUA 1IT0A 1DEDA 1KBBA 1E4LA 3WH5A 2JEQA 4ATDA 1LG2A 2OWCA 1IZJA 2PC8A 2J25A 1W2VA 2VC9A 1GCYA 3WNLA 3UETA 2CETA 1HKKA 4FMVA 4P8XA 4JFSA 4IM4A 1V02E 3WUFA 4XZWA 4GI9A 4HA1A 3L4UA 4J3SA 3T0BA 2EPLX 1FH8A 2VR5A 3LPGA 1CECA 4PUDA 4UQ9A 5ABEA 1A3HA 1BVZA 2ESCA 3ZSSA 5A2CA 3OLGA 5A6SA 3CZGA 4CN6A 3VGEA 4S3JA 4J7RA 3SUVA 4M80A 2WVVA 1KR1A 1WKYA 4Z2LA 3ZT5A 1E4MM 2BFGA 2J47A 2WVVB 2XUCA 1V3MA 5BCAA 1NARA 4CD7A 5GNZA 4EK7A 2QF8A 3RM9A 2XPKA 4M24A 5A6MA 1JIBA 2YJQA 3WQVA 2WWCA 3VIIA 2GK1B 4UFHA 1QNSA 1OT1A 3IANA 1WB0A 1OCQA 4NRSA 1EQPA 1HJVA 1TCMA 1RPKA 3MKKA 1LQ0A 4MDOA 2W63A 1JF5A 1VF8A 3HN3A 1EGZA 4QP0A 3FW6A 3WFLA 1JYNA 1JNEA 5JBDA 1LJYA 3VGHA 5IXEA 4V27A 2VX5A 2VVSA 1W1PA 4AZCB 3W24A 3ARZA 2OSYA 5EFFA 1UWQA 2V38A 1VEPA 4ATWA 4HTYA 1KQYA 2EJ1A 1JI1A 3DC0A 1B3YA 1JXJA 3NSMA 2XVGA 4C7GA 5A69A 4PMDA 3VX0A 2WCGA 2WMHA 5ABFB 2WB5A 1CXFA 2WXDM 4W85A 1VJSA 4CU7A 4UQBA 2XG9A 3BAJA 1KXQA 3BMVA 5I3DA 3IJ8A 4UFLA 1ISXA 2YLAA 2A3CA 1JZ2A 3ZJ6A 1KCLA 2WMJA 1B90A 3TTYA 3VGFA 3VTRA 3WF4A 4D6DA 2WNWA 2XVKA 1H1NA 1LWHA 3CGTA 3N11A 4W5UA 1ZL1A 3K4AA 5HOSA 1FFQA 4UNIA 1QI3A 5I77A 2OYMA 3SCVA 1ZJBA 1UQZA 4Y7EA 5CSYA 4ZE5A 4WF7A 1BSIA 5I2UA 3QR3A 3SCOA 3AYRA 4PN2A 1UWRA 4BCEA 3NYDA 5I6SA 1DWHM 1HNYA 2VRQA 3VO0A 4B9YA 5D9NA 1XCWA 4UTFA 2O9TA 3KL5A 1XGZA 1W3LA 2V3DA 1LL6A 1WZAA 1WDSA 1UKOA 4GXPA 4DM1A 5CLWA 1PPIA 3W29A 4UQEA 4P8UA 1OD8A 1CLVA 1H2JA 3VIMA 3W81A 4AZIA 2GFTA 1K9FA 3IK2A 2X0YA 5GNYA 4D6EA 3N12A 2UWFA 2XGIA 4JCLA 3WH9A 4HU8A 3PZ9A 2WMIA 1R85A 2WMIB 4DWSC 5I23A 1P6WA 2XGBA 2JALA 3WF1A 4CD8A 3CUHA 3FY1A 3VGGA 1QHZA 2YLLA 3VVGA 2O9RA 1HKIA 2G41A 4WIWA 3L4TA 3WH8A 1NOWA 2CESA 4ACZB 3BGAA 4E8CA 2DDXA 2WC3A 3VDHA 4W89A 4PRWA 1G9HA 2WKGA 1TVNA 3WF3A 3PZGA 3VD9A 1IZKA 5IFPA 3M6DA 1US2A 5A8QA 5HDRA 3D5HA 1B30A 3WEZA 3GNPA 4JFWA 5A6BA 1QNPA 2PBOA 1EXPA 1E15A 3ZT6A 4AD2A 3PZIA 1J9YA 3MV11 4CVWA 3N15A 1UOKA 4UQCA 2VZOA 2XIIA 3II1A 4N42A 4W88A 1CXKA 3CMGA 4U33A 1X6LA 4CD5A 2XIBA 2E8YA 1D2KA 2BXZA 5CPTA 1MXGA 3VD5A 1EA9C 2G4FA 2Y5EA 1ITCA 2GVYA 2QPSA 2YL8A 1NWSA 1W9PA 4B16A 1J0ZA 2PWFA 1DWGM 4KWUA 1Z32X 1R7AA 2B31A 5A8OA 3CH9A 4H2CA 1H41A 3EDJA 1JZ5A 1XYZA 3SUSA 3A4XA 1MWOA 2VTFA 5EB8A 3AMCA 2FH8A 1PJ9A 3AS3A 5DF0A 3AHTA 2ZX5A 4FLOA 4A4AA 3T09A 1AQMA 3CHCA 2DQXA 4Z2KA 2EXOA 1HVXA 3WQ4A 2WC4A 1ISYA 3AIQA 4W93A 4PMNA 1VFFA 2WVSA 5AY7A 3GZAA 2AMGA 1ODZA 1M04A 3MSGA 3ALGA 1W1VA 1DP0A 1W1TA 1OM0A 1QNOA 1KGXA 3T2OA 3L4XA 4AXNA 1PX4A 3WNOA 2BNJA 3PBGA 5A8MA 1R7OA 3F5JA 4W86A 2DT3A 4JHZA 4JFVA 3MUZ1 3W0KA 3EDKA 4PTVA 1VJZA 1GUVA 2BXYA 1EDQA 3AZRA 4AZ5A 3CIVA 3WQWA 1OGBA 2J7HA 2HVMA 3RILA 1HJQA 1RH9A 3ARPA 6A3HA 5BXSA 1BPLB 5M5DA 1FOBA 3QHOA 5IHRA 4EANA 1VFMA 1C3FA 3TA9A 3AFBA 2DIJA 1XV8A 2VR4A 4D6CA 3RCNA 3M7SA 3SUWA 1QNQA 3GYCA 4QDMA 3VPLA 5FIPA 2D24A 3VIOA 4QFUA 4MB5A 2X05A 2X8RA 1EO7A 1VAHA 4B3LA 3ZO9A 3FNDA 3MV01 2WSKA 4D6IA 5A6JA 3BCDA 1R87A 2J7EA 5I79A 3VNZA 1KXTA 5EFDA 4MNLA 4C7FA 1M7XA 4Z2HA 1BLIA 4UZUA 5I5RA 3WL0A 4M8UA 1BF2A 3K8MA 3AIBA 3WSUA 3CZKA 4UFKA 1J0KA 7CGTA 2WSPA 2D22A 2VT0A 3EMCA 3M07A 1HJXA 3WDRA 4LX4A 4MB4A 3SUTA 1J0IA 1LWJA 1UH3A 1E6ZA 4HMEA 1EHAA 5DFAA 2EPMX 1E73M 4KGJA 2W66A 1V0NA 3AS2A 1JYWA 4Z2GA 2X1IA 2VURA 2C0HA 4AC1X 4BF7A 1KFWA 4GI8A 3SUUA 1UR4A 1V3IA 1I1XA 1E6QM 3AXXA 1H3GA 2OWXA 1HN1A 3PTKA 2YL6A 1CENA 5LA1A 1BYBA 1OB0A 4PSPA 1KWGA 3APGA 3A6OA 3ZR5A 4P7LA 4HMDA 2DEPA 4D71A 1EDGA 4E4PA 1MW3A 2YA2A 4MPKA 3WFZA 5BXTA 2J62A 3OGVA 5C70A 2ZXAA 4CVUA 2F2HA 3FAXA 2C8NA 5D8WA 5E9AA 3PZOA 1BYAA 1GQKA 1JYVA 3K4DA 6TAAA 3E1F1 1CGTA 3WNKA 1G0CA 4NI3A 2YDRA 1QI2A 4MADA 3U7BA 2ZOXA 2UY5A 3QHNA 7TAAA 2YDQA 6CGTA 1XH1A 1MQRA 4W8BA 4QLJA 3A47A 3N17A 1UKQA 1OINA 2XSAA 4PEEA 1KGUA 2ZUTA 1J01A 1OBAA 2CBIA 3T08A 1DWJM 3U57A 1QPKA 1W3HA 3WEMA 3W6LA 4LYRA 2VX4A 1E56A 2X0HA 2YIHA 4B15A 4CCDA 2VJXA 2CBVA 1UA3A 3S2CA 1EDTA 2V5CA 1JDCA 4B3KA 1VENA 2J77A 2ZUUA 3G6MA 4S3KA 3D3AA 4IISA 3L2MA 4GO8A 1NH6A 1BG9A 3PTMA 1V6WA 3VIFA 3W6MA 4TVCA 1XSJA 5JIWA 1OIFA 1BVNP 5FOOA 2BY1A 4MNMA 1WZMA 4LGXA 4JL1A 2XM2A 2A3EA 3WNMA 1CWYA 1X6NA 2BY0A 1UR1A 2IXVA 3K8KA 3ARRA 4AEFA 4J3UA 4JL2A 2GJXA 3SEPA 4Z2JA 2G3JA 1O6IA 3AXHA 1QW8A 3NCOA 2XM1A 4H8HA 2XSBA 2FHBA 2EPKX 2WYSA 3NUKA 2PWDA 3BH4A 1WDPA 3AHVA 3DYMA 4AIEA 2VX6A 2WZIA 1FA2A 9CGTA 1B2YA 4R27A 1UD8A 2Z1KA 1CYGA 1NM9A 2ZX9A 2E4TA 1VB9A 3PHAA 2D0HA 1W91A 2QV4A 4UR9A 4HOZA 2XJ7A 5HPCA 2XYLA 1DHKA 2W4XA 1V0KA 2BHZA 2W67A 5A95A 1WE5A 1E3ZA 3AIEA 1BFNA 3BCFA 4CN1A 5E0FA 1W9BM 2VZUA 5FCZA 2PWGA 1BQCA 4YPJA 3LMYA 1JAKA 3F5KA 3GH5A 3AMDA 1UZ4A 1UUQA 5AYBA 4OUEA 3AQUA 3WD2A 3VGDA 1CGYA 3VD7A 3WQ8A 1E40A 1EQCA 1V3KA 1TMQA 3WF0A 3L4ZA 2Q8XA 2VMFA 4PTWA 5M03A 4U2ZA 4PTXA 3PZTA 1AQ0A 2ZXDA 1WZLA 4HOXA 3UG4A 1V3JA 1M01A 3TONA 3QOKA 1GNXA 2WWDA 1AMYA 3LPFA 4MNKA 1X1NA 3OA5A 5JUVA 1CBGA 2O9OA 3CHDA 1XC6A 2WM0A 1HX0A 3BAWA 2BVYA 2DSZA 3WDPP 3DHUA 4EE9A 4JKKA 4XV0A 1WPCA 1K9TA 1TE1A 1CXLA 4OKDA 1C90A 2VX7A 3O2LA 4GKLA 1WZKA 3TTOA 3VOCA 4WSJA 1L8NA 1RD6A 2OLHA 1C7SA 1V3LA 1MW0A 3GH4A 3FN9A 3W4RA 2D1ZA 3RO8A 4Z2IA 4U2YA 3MS8A 4JKMA 2VRJA 1ZU8A 2ZXQA 1J0YA 1XSIA 2UY3A 3SCTA 3GBDA 3AOFA 1GJWA 2XWDA 1BG4A 5E70A 1B31A 2JF6A 2DT0A 4XZBA 3TTSA 2E9LA 3VD4A 4AEEA 4AZ6A 3PZUA 1E43A 1E6RA 2ZE0A 3GXDA 4WKHA 1VRXA 2WK2A 3GNOA 4JAWA 3T2PA 4J3VA 3N18A 1K6AA 2CERA 1Q6GA 1LL4A 4GPNA 2ZWYA 1C91A 4PSRA 1E3XA 3AZSA 3FHQA 4J27A 2C7FA 3ZJ7A 5ECUA 5CSUA 2EPOA 1R8LA 3LPOA 3MU7A 1J10A 3GXMA 1UWUA 4N0RA 3K46A 3U7VA 5AYIA 2Y8VA 3EMQA 2WVTA 1KWKA 3AHZA 5M3WA 4TXEA 2D20A 1GOIA 3WIJA 7A3HA 1FP8A 1GQIA 4LPCA 2Y8KA 2CKRA 1HIZA 4OBRA 1JAEA 1V6XA 3O9NA 4IPLA 4D6JA 1BAGA 1HF6A 3PZVA 3B9EA 2E40A 2J7BA 1KBKA 5GNXA 5HBFA 1KCKA 1MXDA 3WEOA 4BQ2A 3O6AA 5BWFA 3VDCA 3U5YA 4CUCA 2ZUSA 3VU2A 4HPGA 1QI0A 3BSGA 2WPGA 4F9DA 1BYCA 1O7AA 2YA0A 5E09A 1G94A 2YBUA 1JZ6A 5ABGA 3AJ7A 2WHJA 3BAKA 1FFRA 2D2OA 3KL0A 4P8WA 1U33A 4UQDA 2XVLA 3WN6A 3WBAA 1CEOA 5M17A 4FK9A 5FL1A 1UR9A 4RE3A 1V03A 1ESWA 1ZBWA 4MB3A 4W7UA 1MQPA 3VIJA 3EDEA 1JGIA 1UD2A 4QLKA 4PMUA 4K68A 1UWSA 1MQQA 1OD0A 4TTGA 4W8AA 1W3JA 2G3NA 1OIMA 1K9DA 2DIEA 4XUYA 4FLSA 4UFJA 2EO7A 3W27A 3ZIZA 2CPUA 3CTTA 4JZ5A 4H8UA 1E0WA 4JHOA 1UG6A 1IV8A 2BY2A 1LG1A 2BS9A 1GONA 1ISVA 1CPUA 4D6HA 5HNNA 4DWSD 3F5LA 1M03A 1UWIA 3DECA 4GZEA 4M29A 1GORA 4FLQA 3ZT7A 3WNPA 4J3WA 5LYRA 1PX8A 3VINA 1FH7A 4UQAA 1FP9A 1F4HA 5JBEA 3W37A 1VFOA 1ZJAA 2PB1A 3IAPA 1H09A 2GJPA 3B8SA 3RM8A 1BTCA 1JZ8A 2ZIDA 2WANA 2CBUA 3CZLA 1HKJA 1QVBA 1W1YA 4CGTA 2WBKA 4MJ4A 3CUIA 2W91A 2IXUA 1BYDA 3ARVA 4LQ1A 3AMKA 3KZSA 3OIHA 3UERA 2DSKA 1TG7A 3WY1A 5I78A 4HMCA 4IUGA 2WW5A 1UR8A 3ARYA 1C7TA 1KXVA 3ZSTA 4TX6A 1GVYA 4L4OA 2Y4SA 3DYPA 3VDBA 4M1RA 2WHMA 4HU0A 4W7VA 4PTMA 4TVDA 1CXIA 2DSWA 1XHGA 2HISA 2ZUVA 3GXIA 4OOUA 1TR1A 2WMFA 4A3YA 2BY3A 5A2AA 1ZBKA 2CCRA 3WD0A 4B9ZA 2J7GA 3ARXA 4MTVA 3AMGA 2E0PA 4NZCA 4PMQA 3VIGA 2GDVA 2BHUA 2GSJA 5A6LA 1GZJA 5EBAA 3SCSA 4NSBA 2Z1SA 4GINA 2EPNA 3ZJ8A 4QLLA 4M56A 3UEQA 4J28A 4UZSA 1GOKA 4WKFA 1XD1A 4D6GA 1ITXA 3ZJKA 1VEMA 1FH9A 1NWTA 2VQUA 4H04A 2JIWA 2VNCA 3VGBA 4CN4A 1G5AA 1JZ3A 5BXRA 1H0IA 5AC5A 3IJ9A 1HXJA 3GBEA 1CXHA 5BROA 4BQ4A 4UOZA 1JDAA 2TAAA 5KEZA 4OJYA 2DSVA 3VMPA 1MW2A 3AIWA 1Q4NX 2XFFA 5I24A 4XX6A 2CBJA 2O92A 1PZ3A 2QLYA 3VNYA 5D4YA 4OBSA 4GQRA 4BS0A 3SCRA 5HPOA 2CHOA 1OGGA 5IFTA 2AAAA 3NDYA 4AZGA 2RGLA 3W28A 5JBFA 3VM7A 2WZHA 2FGLA 4GO9A 2FHFA 4Q22A 2QHAA 1JZ7A 1QHOA 3TP4A 3CUFA 3BAXA 3KWXA 2VZVA 3MMWA 2A3HA 1E4IA 1UD3A 1JL8A 3OLEA 2QPUA 4TVUA 4OZOA 2NSXA 2MANA 3N1AA 1LL7A 2YL9A 4PMVA 1GOOA 1VIWA 1EHNA 1QOXA 4TUFA 3CZEA 1GQLA 1RP8A 3FHAA 4W87A 3AS0A 2WKLA 1G01A 3K8LA 3AIVA 1AVAA 3ZMRA 2VUYA 1GHSA 2RGMA 4AIOA 3BXWA 4WJXA 1HVQA 1TUXA 3CBWA 4U31A 3S6TA 3WF2A 5BXPA 1WO2A 4ZFMA 5CPQA 2W61A 1UH4A 3W25A 3MMDA 2J4GA 5CPSA 4UOJA 4JCMA 4U5KA 3W38A 1QNRA 2Y2WA 1WCGA 1V08A 2DGAA 2W62A 4IPNB 4L4PA 3VIPA 1US3A 3NJ3A 1E6XM 3U5UA 1TVPA 1H0GA 3GM8A 1PIFA 3A4AA 1E6PA 4P8VA 4BQ3A 4YHEA 2WHKA 1TA3A 2O9PA 3VILA 4AIUA 3WBEA 2NW0A 5ABHA 3KEHA 8A3HA 1CDGA 3GNRA 5CGTA 2J8FA 2E9BA 1XCXA 4PCTA 2D3NA 2OYKA 1DWFM 1AQHA 3WD3A 1N82A 1XSKA 1DWAM 4DM2A 1MYRA 1PAMA 3AZTA 1SMDA 4H41A 3CUGA 1CGWA 2GJRA 3OZOA 3WH6A 5GQBA 1JDDA 2JE8A 3W53A 3F4VA 1B3VA 3JUGA 4MAZA 3EDFA 2IUZA 3DYOA 4ZXOA 3IAQA 4CKQA 5A6BD 2XVPA 1V0LA 2OWWA 4WK9A 4D72A 4URIA 3KE0A 1KGWA 2E3ZA 2VOTA 3VUPA 4AZ7A 3PZNA 1QBBA 2J7DA 1QI4A 4QCFA 3RPMA 2GUYA 3SCNA 1W9XA 1J0HA 1BHGA 3WUEA 4NF7A 3BLKA 5EMYA 2GJXB 3MMUA 3WH7A 2DSUA 3WQ6A 4CD4A 3T0DA 1WNOA 2D0GA 5A8NA 4QAWA 4UOQA 5A6KA 2UY4A 1UHVA 1ZS2A 4WLCA 1B9ZA 3VKKA 1HP5A 2DT1A 1JD7A 1UYQA 4D6FA 1HT6A 2BVDA 1C8QA 4AISA 5HXMA 2YBTA 2JEPA 3ARWA 2F8QA 3UR8A 4TX8A 1C8XA 3RJXA 3ZQ9A 1B3ZA 4HPHA 4HZ7A 4WSKA 3RMEA 1QI5A 3POCA 3VD3A 2V5DA 4PMOA 3RDKA 3NDZA 3UCQA 3BMWA 4U3CA 1SFSA 4UFIA 4CU6A 2YL5A 2G3MA 4V28A 2PWEA 3WL1A 4OOZA 5FD0A 3QHMA 2D23A 3B9AA 2XHYA 3L4YA 1JYXA 2DT2A 1EIBA 2CXGA 2VRKA 4M81A 3UESA 2VL4A 3WQ5A 3SCUA 2WMGA 5BRPA 3MUIA 2WZEA 1E0VA 3OZPA 4JFUA 2VCAA 1PBGA 1TZ7A 2J75A 4AMCA 1ZBVA 4PMYA 5LA0A 3ARQA 2GK1A 1WAWA 3HMCA 5DEZA 1CGXA 2PI6A 3AROA 4HZ8A 1KR0A 4U3AA 1UD4A 5IDIA 1SYTA 1D3CA 5A1AA 1D7FA 5TD4A 1GOMA 1E70M 3GXFA 4Q7NA 1YQ2A 2X09A 3RM4A 5E0CA 4AZCA 3CUJA 4KRUA 3FXYA 4GIAA 1XD0A 4QCEA 1QBAA 3AIRA 1U2YA 3ARTA 3UR7A 2UY2A 2VVNA 4MNJA 1V02A 4FF5A 4D1JA 2XTKA 1QW9A 5CGMA 4ZE4A 5ABFA 1JD9A 2ZICA 3BAYA 4C7DA 2JF7A 2VCBA 3WUGA 1JF6A 2QMJA 3PZMA 1NWUA 4MAVA 4W5ZA 2GDUA 2J7CA 3EMZA 2OSWA 1PEZA 4U5IA 1A47A 3CHEA 1DTUA 3WNNA 5BYWA 1SR0A 3EYPA 4PMRA 1OSEA 2CEQA 4KMQA 1WDRA 2OYLA 2FGZA 3OLDA 4ZEPA 1GQJA 1S46A 2BV9A 4E8DA 1HL9A 3BLPX 1GHRA 4OIFA 1W3KA 1FHDA 3WMSA 3QGVA 2WC7A 5JIPA 3AS1A 4E2OA 1KXHA 2EEXA 3SURA 4JKLA 5CJ5A 2ZUMA 2J7FA 2QMKA 1I75A 1VEOA 1KB3A 1V6VA 2J8GA 5DT7A 3HU7A 1W9VA 5BRQA 2ZX6A 1W9DM 3G6LA 1W32A 1J12A 5A6AA 1UH2A 5C71A 3NIYA 2V3GA 3IJ7A 3QOMA 1W2PA 4DUXA 1V6YA 3VIHA 4HZ6A 3VMNA 3AHYA 1QHPA 3GTNA 2XFYA 1J0JA 1ZB5A 4AYSA 4WKAA 2ZWZA 3SIMA 2DPEA 1TFVA 1CIUA 1XYFA 4RE2A 5A8PA 3OGRA 1Y7VA 1LLOA 2PWHA 1B3XA 5GPRA 1Q6DA 4FLRA 1WDQA 1PZ2A 2VI0A 1V6UA 3MUAA 2Y24A 8CGTA 1E72M 1Q6EA 3CO4A 4AZBA 5DT5A 1L0PA 3RIKA 4ACZA 4NRRA 1OGSA 5A2BA 3VM5A 2X2YA 4ACYA 3T0AA 4H8VA 1OT2A 2ZXBA 5DO8A 1CNVA 2D3LA 3I3EA 5CG0A 1HKMA 3EDDA 4W7WA 5D9PA 1ISZA 1YHTA 4CCEA 1B0IA 3POHA 5AC4A 4GZIA 1HJUA 5FL0A 3CZJA 3L4WA 1Q6CA 2VZTA 4PMXA 1RP9A 1JG9A 4X0VA 3WUBA 3AICA 1MFUA 1GOQA 4MJ2A 2A3AA 3WDIA 2D0FA 5E6YA 2OSXA 4HA3A 2EQDA 1UR2A 3MANA 1EOMA 4AW7A 2FH6A 1WP6A 4HP5A 3KL3A 4AD5A 5IHSA 1JNDA 3SCWA 1VBUA 1J11A 1PX3A 3M46A 1UD5A 3K1DA 3UG3A 2XVNA 3WENA 4PBGA 4DUWA 1XH2A 1ECEA 1C93A 1H4PA 2W92A 1UKSA 2BHYA 2G3IA 4J3TA 4GI6A 3CPUA 2FHCA 4ZENA 3CZ8A 4F79A 1C8YA 3T2QA 1H49A 1XH0A 1CXEA 3AXIA 4ATLA 3PN8A 1J18A 4X9YA 1BGAA 4RE4A 2WBGA 2PBGA 3AIUA 2WCAA 4HA4A 4UFMA 3FAWA 2WLYA 1V0MA 3ARUA 5F7UA 3OG2A 3W82A 3I3DA 4D1IA 1B1YA 1GVIA 3MSDA 4EKJA 5A94A 1MW1A 2YOCA 3AI0A 4LXFA 3WKZA 1NOUA 1CLXA 3BC9A 4AD3A 2YKKA 1UKPA 4ZXLA 1E1EA 2CYGA 4EAMA 1NOFA 4V2XA 3HJEA 3MUY1 1W9UA 2J78A 3ZM8A 1UR0A 4BZYA 1UA7A 2W5FA 4BA0A 1MVYA 4AD1A 4BQ5A 5D8ZA 1R86A 1HJSA 1E6SM 3J7HA 2ZUWA 3NSXA 4HOWA 5KZ6A 3W26A 3TTQA 3ALFA 1JI2A 3MO4A 3N04A 4PMZA 3OB8A 1H5VA 2WHLA 4KRTA 1SMAA 3L4VA 3CHFA 1DWIM 4ML4A 3PTQA 1HL8A 4GQQA 3AMLA 2E8ZA 1U30A 2CNCA 5LA2A 1E6NA 4YHGA 4CU8A 1CGUA 3GH7A 4P7OA 1M53A 4F66A 1E55A 4J3XA 3PZQA 2ZX8A 1JFXA 2A3BA 2NT0A 3I3BA 1HP4A 5CQ1A 1GJUA 5A3HA 3NSNA 3THDA 2PF0A 3BAIA 3ARSA 1UKTA 2VO5A 2WVUA 4P7QA 1EO5A 5D9OA 4P7NA 1UWTA 3ZOAA 5DMYA 2VZSA 3WELA 1CTNA 1Q6FA 3VDAA 1JXKA 1C92A 3CLWA 3EBVA 2BVTA 3OLIA 2XWEA 3WD4A 2YA1A 1GOWA 4MB1A 5E6ZA 1XRVA 3WMBA 4PUEA 1H11A 5I0DA 2VQTA 4DUVA 3A3HA 4AD0A 1CZ1A 1VBRA 3TOPA 2V3FA 2CIPA 3WD1A 4CCCA 1E9LA 1HJWA 1GPFA 1EH9A 3THCA 4MDPA 2WCSA 4H7VA 5D9MA 2DH3A 1I1WA 5C8BB 2AOSA 1E5NA 2J74A 3VMOA 4A3HA 4F8XA 1CGVA 2VCCA 1E5JA 4R5EA 4AD4A 4LYPA 4GZJA 1UD6A 3ECQA 2J79A 4LYQA 3DHPA 4PCSA 3N9KA 2E9MA 1OWQA 1B3WA 3B9DA 3WDHA 2NT1A 1KQZA 4M82A 4CD6A 1E4NA 4AZHA 4TOQA 5CXPA 2YDSA 4JIEA 2G8ZA 1NP0A 3SCQA 1GW1A 2DH2A 1NWRA 1TA3B 4AWEA 1E0XA 1V3HA 3UG5A 2ZX7A 3AISA 3N13A
chains in the Genus database with same CATH superfamily
3VX1A 4LC6A 4QEEA 1JQXA 3H7RA 2JFEX 3W7LA 1J5TA 2I1OA 1OYBA 1AD4A 1EF2A 4OUIA 2NQ9A 5LZLA 2X42A 5G2HA 1PIGA 3UQNA 1TIMA 1UZ1A 2DZAA 3QW3A 1ICSA 3CMJA 3H21A 1RXOB 3UCDA 3DFQA 3OGSA 1RR2A 3ZR6A 8TIMA 3LZ3A 3R4IA 3WDQA 4X0NA 4NUWA 1FCVA 5HQMA 3M4HA 3LGEA 1Q2RA 3MWAA 2JIEA 3AHXA 3TC6A 1S5WA 2XFRA 1R3WA 4XB3A 2QT3A 1JZ4A 2GUUA 4DWSA 1K9EA 1F07A 3HMJG 4DWSB 3RJYA 3BSHA 3VIKA 3WMCA 1Z42A 4ZVJA 3TWBA 4L1XA 1LF1A 4L9XA 1W5PA 1IT0A 1DEDA 1KBBA 3TQPA 1NFBA 1K8YA 5AN7A 2OWCA 1IZJA 1H7PA 2DP3A 5HNUA 3KVMA 1A3XA 2PC8A 1TIWA 3GDLA 1HKKA 4H9UA 1E9YB 4P8XA 4JFSA 3WUFA 3EXRA 4J3SA 3T0BA 2FZBA 2QXWA 1EJSC 4V33A 4UQ9A 4UXDA 2G3FA 1YNPA 3UW6A 1FWTA 5A6SA 1TWIA 1IXPA 3HPZA 2CLPA 3W1XA 1J93A 4E8GA 4J7RA 2PS2A 1Q65A 1RUSA 3KOXA 5AYYA 4IFOA 1KR1A 3DU0A 4QSHA 4I5RA 2BFGA 4US5A 1NARA 4EK7A 2QF8A 3CLMA 2XU2A 3EZ4A 2QYGA 1B5TA 2GK1B 4UFHA 2F38A 2YPIA 2H90A 3KWSA 4Q4MA 3S42A 1H7XA 1OCQA 5F2MA 2NLYA 4NRSA 3PJUA 2GSEA 1TX2A 3U3HA 3UXAA 3MKKA 4B5SA 1QFEA 4LEFA 5JXQA 2ISDA 3HN3A 1KRCC 1W54A 2YX0A 3IK4A 5IXEA 1X98A 3ARZA 2FTYA 1UWQA 1US0A 2V38A 3M5VA 5KITA 4WCJA 1B3OA 4HTYA 2RDWA 4JIRA 3GC5A 3HTWA 3G0XA 1EX1A 1JI1A 3NSMA 4YWSA 4LBUA 1B4KA 1OF8A 2PCEA 2WMHA 5T9CE 1CXFA 2WXDM 4L64A 1GW9A 4BHYA 2C13A 3IJQA 5KSWA 5K9XA 1KXQA 1R38A 1TPDA 4PRRA 3M0IA 1QOQA 3U2ZA 3IJ8A 1EP3A 3EOOA 2HS8A 1ME9A 3H24A 4YTUA 4IPIA 1JZ2A 3VXGA 1S5NA 1MUMA 4HZMA 3GC4A 4Z1AA 2WMJA 1B90A 3MBDA 3GKFA 1SQ7A 4PB4A 2INFA 2WNWA 2XVKA 5BW6A 1PTGA 2P88A 1ZL1A 4KCUA 3K4AA 5F4XA 3KVKA 3TE9A 3S2JA 1TVLA 1RY0A 3QM3A 2PTDA 1KM6A 4JQ2A 2JGYA 1EPXA 5CSYA 2V9DA 5DRCA 5I2UA 3GLCA 3RX4A 1DVJA 2QR6A 3QR3A 3CIWA 4I6KA 1AW5A 4PN2A 3NYDA 4H9TA 5I6SA 1DWHM 3W7NA 2PTZA 3AUOA 1LLZA 5D9NA 2ACRA 2HRWA 1P43A 1Q63A 5G4EA 2V3DA 1LL6A 1SFJA 1K3UA 1NDWA 1QU4A 4RZ4A 1X7IA 1PPIA 4FHAA 3W29A 3S1UA 2WJEA 1CLVA 3VIMA 4LCSA 3U0HA 4H01A 1K9FA 3N2BA 2DW7A 5IRPA 2Q3OA 4X61A 3EA2A 3N12A 4DO5A 3BLLA 1EX5A 5I7GA 2XGIA 3WH9A 2R14A 4BWLA 4DWSC 4DQWA 2Q09A 1VD6A 1VYRA 1KM0A 4XBKA 2JALA 4OV4A 3FY1A 3UPWA 1EJXC 3VGGA 5C9WA 3WK1A 3N3TA 3GFZA 1Z8AA 1IT8A 4IIHA 4ACZB 3QFEA 3VDHA 3TJIA 4W89A 1XLKA 3W7OA 5BWAA 3DGBA 5HDRA 3D5HA 1RD5A 4I8DA 1MMFA 4TMCA 4Q8OA 1QNPA 3H12A 3SRDA 5HJYA 2I16A 1BRLB 1CW2A 5HAOA 3MV11 3N15A 4KKXA 4R88A 2QKFA 3INPA 1BWKA 2XIIA 4N42A 4W88A 1CXKA 4MZYA 6REQB 2RHGA 1QCWA 2YYTA 3NQBA 4CD5A 4JQ3A 4A35A 4QBXA 1D2KA 3RR1A 2G4FA 3M0XA 3U6WA 5LNWA 2QPSA 1OEPA 5IOBA 2PF8A 4KWUA 4GY0A 1Z32X 2B31A 2ZCGA 1CT5A 3TJ4A 3EDJA 1FDYA 1XKJA 4RNIA 3RX3A 5FJUA 1LDCA 3ABZA 2FH8A 3GTIA 4FLOA 1EZWA 4A4AA 2DQXA 4L6OA 4XIMA 1F73A 2WC4A 1XP3A 2OVLA 2PZNA 1KM3A 4P5UA 3T40A 3JZUA 2AMGA 4BF5A 3AJXA 3RK8A 3ALGA 3ABRA 5C9UA 2E5CA 6TIMA 1OM0A 3T2OA 4GD0A 3WNOA 3F2CA 3F5JA 5H8UA 2A6LA 5FJOA 1BF6A 3FXGA 4YNGA 5DRIA 1UIPA 1TREA 3BTNA 1DPMA 1UWAA 4ZR8A 1TJRA 1Q85A 4GNKB 2D73A 2BXYA 3NQ6A 4CLMA 1ZJIA 3AZRA 4IGHA 2WO5A 3F2DA 2NXHA 1LM1A 4K7YA 1OGBA 3N6QA 1UC5A 3ARPA 4UBPC 1T5AA 2Y62A 3B06A 5BXSA 1BPLB 3PPHA 4OTKA 2IPFA 3G77A 3QHOA 3W1PA 3O3RA 4GWEA 4EANA 2Y8UA 1D7KA 1VFMA 3TA9A 3AFBA 2P0OA 2DIJA 2VR4A 2QGHA 3BLOA 3M7SA 5JQ9A 5D2TA 4ZCWA 2QJNA 5FIPA 3OA3A 4QFUA 2X8RA 5C7HA 5EGRA 1VAHA 4B3LA 4RE0A 1V93A 1R87A 3A3WA 3LK6A 2KAUC 3GQYA 3KS5A 4H6RA 2WZTA 1M7XA 3PWGA 3TOYA 3TNBA 5I5RA 1EF3A 2Z1XA 2OOFA 4LSBA 1QK0A 3CASA 5G4HC 4H9MA 2ABAA 4WXYA 3UWZA 3W02A 4FXJA 1J6PA 3P62A 1XFBA 3EWBX 5GJPA 2P5NA 4LX4A 4MB4A 3SUTA 1J0IA 1LWJA 1E6ZA 3B97A 1NVMA 2PRHA 3GNNA 1EBHA 3DEQA 3TDFA 2EPMX 4GISA 1E73M 4B5XA 4QE5A 1EWEA 2W66A 3W7MA 2Y5SA 3AS2A 4AHOA 1JYWA 2HVOA 4Z2GA 3P8JA 3H8AA 3FKRA 1KFWA 2TPSA 1B9BA 2RAGA 1XLFA 1H3GA 3S1VA 3GDRA 2YL6A 1KKOA 2E28A 3GUWA 2RJGA 3EX1A 2VFDA 4PSPA 3W83A 3A6OA 3WFAA 4P7LA 1YXYA 4B5TA 1TMLA 2Z00A 4MPKA 1A3WA 5BXTA 1PKLA 2GVGA 3GG7A 2ZXAA 2F2HA 3CWOX 1IEWA 1AK5A 3TYEA 3FAXA 2C8NA 2Z7GA 3LM3A 5CZ0A 3PZOA 3K4DA 1SGJA 3MVTA 3W01A 3E1F1 1OX4A 2IKHA 3OO2A 4B4FA 3AYVA 3BURA 2YDRA 4Y9MA 1QI2A 3BJSA 4TIMA 4O54A 7XIMA 1XH1A 4L9ZA 2XISA 4QLJA 3VKBA 3A47A 3N17A 1K8ZA 1EIXA 1BWVA 1KGUA 3CQIA 1Q2SA 1OBAA 1J2BA 1BWLA 5CC6A 2C71A 1NTHA 4IMEA 2X0HA 2YIHA 1Z3NA 5E1QA 4CCDA 3T6CA 2POTA 1UA3A 1EDTA 1F7BA 4S3KA 4PMJA 1NH6A 2ZRUA 4JTUA 1JCTA 4XKMA 1QT1A 4KRZA 4NNAA 1OIFA 1EUAA 5FOOA 2Y6ZA 2BY1A 4MNMA 4S3BA 5AVHA 3NQ2A 4DWDA 3FFSA 3I6EA 2XM2A 4MIMA 4UNKA 1X6NA 2IXVA 1I60A 1S2TA 3AAMA 3FYPA 1GOXA 4EACA 1XIMA 3C5QA 2BWGA 1QW8A 1C8VA 4KFPA 1XQLA 1KTNA 2EPKX 4PODA 3NUKA 2PWDA 5EMKA 3G0UA 4IT1A 4L56A 3WBWA 2PEVA 1DQXA 1UD8A 2Z1KA 3OVGA 3PNUA 3BL3A 3PS7A 3W1AA 1JPKA 2E4TA 4ORIA 4O19A 4B4HA 1V7YA 1LT8A 2VDGA 1R3QA 5HPCA 4KETA 3B9OA 4MFDA 2V5BA 1WE5A 3K2GA 5E0FA 3KHDA 4A8IA 1OFEA 2VZUA 1U1HA 5FCZA 1BQCA 1YTEA 4HNVA 4YPJA 3LMYA 3F5KA 3GH5A 3R0DA 4AX6A 4AWUA 1MO0A 3PC0A 3VGDA 1E40A 4B3ZA 1TMQA 3WF0A 1TWWA 2Q8XA 1K03A 1XRFA 3OYXA 4IG2B 2HPMA 1YDNA 3Q67A 2VYOA 1P7TA 2ZXDA 3I7RA 4FZIA 4LH8A 4HOXA 2FZMA 5HWMA 4F0SA 1O1ZA 1XUUA 1U22A 3VOFA 1XLBA 3RG6A 1RCQA 1BXNA 5JUVA 1XL9A 4O0QA 3F7JA 2ZADA 2JKEA 4XD3A 2WM0A 2GGEA 1WBHA 3Q94A 1AZ2A 2DSZA 3WDPP 1DBTA 3DHUA 4EE9A 1TE1A 4JTQA 2VX7A 1UR3M 4UB9A 2PDCA 3I7QA 2Q02A 2OLHA 4QDPA 1C7SA 2BASA 3NYZA 1V3LA 3W4RA 3RO8A 4JKMA 1XF0A 1WXZA 1JCLA 5AC7A 1D9EA 3NO5A 2VUNA 3BGGA 5BMXA 3DCPA 1LROA 1GJWA 3LCXA 4ICMA 1XRTA 4H00A 1K8CA 4AEEA 3O6CA 3PZUA 4DF2A 3G1AA 2ZE0A 4E0CA 3VE7A 4Z17A 3EKGA 1F6KA 3T2PA 4AVOA 3QV9A 1LL4A 1P1MA 1U5JA 4RKAA 5FF0A 2Q6ZA 4LWWA 4J27A 2PDXA 4L1GA 1IZCA 4AVNA 2E5BA 2F7FA 3MU7A 3GXMA 1UWUA 1MI3A 5AHLA 1XGDA 2DZPA 3U7VA 1EPVA 5M3WA 4GZ7A 3WIJA 4JTDA 1KLZA 2PLCA 1FP8A 1EYWA 4LPCA 1HIZA 4OBRA 1JAEA 3QH2A 1BAGA 2B7PA 2ZZ3A 3PZVA 7TIMA 3NQ7A 1KBKA 4OFCA 5FJIA 1KCKA 3LGDA 2NQ5A 3WEOA 5BWFA 5CBJA 4CUCA 3VU2A 4HPGA 3W7EA 3GAYA 2YA0A 9XIMA 1P0KA 5IM51 4NVTA 3QBUA 3ZVIA 5CEWA 1H62A 4QJ1A 4O15A 3BAKA 1RHCA 3W7CA 2XVLA 1S2WA 3WN6A 2V0TA 1CEOA 1YTKA 1TR9A 1Q66A 4PFHA 4RE3A 1V03A 4MUZA 1QWGA 1M68A 3EDEA 4LB4A 5AZ1A 4XIAA 2ZC8A 3CWNA 4K68A 4RX0A 1Z48A 1OIMA 4C6LA 3V36A 4ZA0A 3G1RA 2DIEA 3HPSA 4XUYA 3W72A 3WLKX 4KESA 1RA5A 2AQOA 4L61A 2CPUA 3CTTA 1SR9A 2ZDSA 1IV8A 1ISVA 1CPUA 1XBYA 1DXEA 4I9TA 4IIEA 4LUTA 1M03A 4M29A 3W2UA 1GORA 4FLQA 1R3YA 4NX5A 4J3WA 3KRUA 1PX8A 2OLSA 3QPYA 1AH0A 1X8FA 2ISVA 1UBPC 4LANA 3EPNA 3IAPA 4KBXA 3I7SA 2ZIDA 2JKPA 2CBUA 8XIAA 1W1YA 3P14A 4CGTA 2WBKA 4MJ4A 4N7QA 3CUIA 4KEMA 3BLIA 1BYDA 3UVAA 2YW3A 1YRRA 3A22A 4Y8EA 1TG7A 1BVWA 1I4NA 3S2MA 1KXVA 4J4KA 1GVYA 4L4OA 1K70A 1OK4A 3EB3A 1Z41A 4MWAE 1GQNA 4QEHA 1ME8A 4CEUC 3AU6A 2HISA 4D2JA 2ZUVA 1MEIA 5FJRA 3MHGA 2CLHA 1R3TA 2BOFX 3B8UA 3NFUA 3VIGA 2GDVA 1ITUA 1WDWA 3MWCA 2HSAA 4WZHA 5EBAA 3RNDA 4XISA 1A80A 4NSBA 1P6BA 4O17A 4QROA 2FJKA 5FF4A 3BQ6A 1P6CA 1K02A 1ITXA 3W7GA 3KBJA 1VEMA 3G8RA 1UP0A 4CN4A 1G5AA 1JZ3A 3QGAC 1H0IA 1MEHA 2Y7DA 1HXJA 1YXDA 3BOXA 3W1NA 2OQYA 3ITCA 2TAAA 4XD4A 1GKQA 2AL1A 4OJYA 3CHVA 3VMPA 4FNUA 2QIIA 2CBJA 1DIOA 2EF9A 5IBXA 4CEXC 4UTLA 2A3LA 3DFTA 5CGQA 4BS0A 3FDGA 5HPOA 3MDWA 1MNZA 2D2JA 3CTLA 2VFFA 4AZGA 1W0MA 3W28A 3H4WA 4PA8A 1HKVA 3HV8A 1IWPA 4Q22A 1E9IA 3DUGA 4J9JA 1TKKA 2Q01A 4NJIA 1G4TA 1Q8JA 4DAIA 3MMWA 1E4IA 1UD3A 1KC7A 4A8NA 1WXYA 4LFYA 3GG8A 5BOEA 2MANA 4PMVA 1GOOA 4KWWA 3RRXA 3MCMA 2Z25A 4AUBA 4TUFA 5AYZA 3M0YA 4Q4PA 2Y70A 5AKQA 2VEIA 1RP8A 3FHAA 4XD5A 4C6PA 4F0RA 3AS0A 3GU1A 3DHFA 4Y9NA 1XIDA 2ACUA 2RGMA 4GHRA 5CC5A 4WJXA 3CBWA 4DHGA 5BXPA 3WF2A 4DBUA 4AG0A 5CPQA 4L6HA 4UOJA 3HG5A 4IZGA 4K8HA 3NZRA 4U5KA 3W38A 1XYCA 1WCGA 3BW4A 3LI0A 2XINA 4Z1YA 1V08A 2W62A 1YXCA 3NJ3A 3H7UA 1TVPA 2Z29A 3KDNA 4QHRA 2V8ZA 4M7TA 4BQ3A 3KRSA 4JS3A 1SZNA 3N29A 5H6HA 4HB7A 4N9CA 4HHMA 3WO8A 2DZXA 5AOUA 5ABHA 2QCLA 1NSJA 3FYYA 3K5XA 2QUMA 3GNRA 1OFPA 3NPVA 2OYKA 1DWFM 2VEPA 1WOAA 3WD3A 4FF7A 1OZMA 3HV9A 3W7HA 1SMDA 4BEUA 4F3HA 4R34A 1OG6A 4IIDA 5CPNA 1CGWA 3WH6A 4C1NB 1PV8A 2QF7A 1KRAC 2G5WA 2JE8A 4FX7A 4WY0F 4JNMA 2ANUA 4HSOA 3R8RA 3DYOA 4ZXOA 5REQA 5A6BD 4GOAA 2XIJA 3RYSA 1A5OC 2QJJA 4D72A 3G8EA 3W76A 2ACSA 2V5LA 1C9WA 1W37A 4JY8A 3NDOA 2NX9A 1QBBA 2P10A 2XFWA 1QI4A 2ONEA 1VS1A 4NU7A 4QCFA 3EKZA 3H2MA 2C16A 3SCNA 1W9XA 3WUEA 3TC7A 3WH7A 2DSUA 3K30A 4CD4A 1WNOA 1IR1A 2D0GA 3IS4A 3QN3A 3RLUA 3UNTA 4GYPA 1Z6KA 3PJTA 4WLCA 1B9ZA 1P48A 1HP5A 3T05A 3B8TA 4PUNA 1C8QA 5HXMA 3SQMA 2F8QA 3UR8A 3RJXA 4HZ7A 4WSKA 3POCA 2DJXA 4QG8A 4XBSA 3T0CA 4PMOA 2PD5A 3C6CA 3UCQA 1YDVA 3QW4B 2FVMA 4RW5A 4TQTA 2G3MA 2PCQA 4J2MA 4I5UA 4OOZA 3B9AA 3QVQA 5C6MA 4CCZA 1Y0EA 3HGOA 3B0PA 4M81A 5GJMA 5DXXA 3E2RA 3UZ5A 2X1RA 1KBIA 2J75A 3QQWA 4QE1A 1DKWA 4AMCA 1RCXB 2DZBA 4F0LA 2PDPA 4WX2A 5DEZA 4DBSA 4A22A 1CGXA 2PI6A 2YCKX 3AROA 4M1BA 3F4DA 2PDIA 3LRKA 1UD4A 5AHIA 5TD4A 4LT9A 1GOMA 1TPUA 3OHMB 1VLWA 1SW7A 2DZUA 4RNJA 3LHVA 4DELA 1YQ2A 2I9UA 1ZALA 5E0CA 3U2CA 1VBGA 4EVZA 4O52A 5I03A 4KRUA 4GIAA 3UR2A 2ZVIA 4WJEA 4IL0A 4UCGA 4G6CA 1K7XA 3KTCA 1A50A 8RUCA 3N4EA 4HSHA 4YU1A 1XIFA 3PANA 4FF5A 1G7VA 2XTKA 1XDLA 4G7EB 5CGMA 4ZE4A 5ABFA 1JD9A 2R24A 3BAYA 1W6TA 1XLCA 4M6VA 2X1SA 2QCDA 4X3ZA 3TLQA 1Q7QA 1I0BA 4O4WA 4MAVA 4W5ZA 3VK5A 3S4TA 1WAUA 4AB4A 4BEQA 2AKMA 2AQVA 3EMZA 2OSWA 1PEZA 1Q6LA 4JTCA 4YTSA 5D30A 3WNNA 4XO7A 1I2NA 5I07A 1RLCL 4PMRA 3A4JA 1WDRA 3GK0A 2FGZA 3VKDA 5BMWA 2GSHA 1S46A 2ZA2A 1HL9A 2OO6A 3CPGA 3WMSA 3TA6A 2WC7A 3IEBA 1XYBA 4LBRA 3W73A 4JTHA 4E2OA 3SURA 3E0LA 3PFRA 1KB3A 2CXEA 1V6VA 2J8GA 3A3XA 2C1IA 5BRQA 4BKNA 1W32A 4DO7A 1Q13A 2XN2A 4EXBA 4OT7A 4IOTA 3GR7A 2GUBA 5J5DA 1W2PA 2E1DA 4OHQA 4OU1A 3MDUA 1EA0A 3I6RA 4KIEA 4LCQA 3WLPA 1Q4WA 3FEMA 1SZRA 2AGTA 2FMOA 1Y7VA 1LLOA 4GYPC 5GPRA 3DXIA 2VI0A 5DY3A 4I7UA 3SRKA 1TV2A 2NXGA 4MYXA 4S39A 4HYVA 1EYEA 1YBQB 5A2BA 3VM5A 2JK2A 4GG9A 3VC5A 1W56A 3T0AA 4HNOA 1N8WA 1A53A 1KCXA 1TV4A 2E5DA 3HA1A 4I6VA 1E0UA 3I3EA 3JU2A 3C2YA 3QQ1A 5D9PA 2PPGA 2WNZA 5I06A 2GVLA 1Q6CA 1RP9A 1WXJA 1POKA 4JHMA 2C14A 2G4JA 3IJ6A 3MP3A 3KOWA 4IL2A 3BARA 1F3EA 3HQOA 5E6YA 4HA3A 1F05A 4NZ1A 4B92A 3COTA 3Q58A 1IF2A 2FH6A 1WP6A 4ZQOA 1HQTA 3DBPA 1XIJA 2OX1A 3THAA 4PBEA 3K4WA 3N25A 1XXXA 3M5YA 2HXTA 3M46A 5D02A 1IGSA 1WKEA 4OECA 1PIIA 3WENA 4PBGA 4UIOA 4QR6A 1LBFA 3SRFA 5F2IA 4MKVA 1DV7A 4GI6A 4L5ZA 4ZENA 3CZ8A 3P61A 1H49A 1XH0A 3AXIA 3SN1A 2ZQ0A 3PN8A 1J18A 4X9YA 3BV7A 2WBGA 1A5SA 4E3TA 1FWWA 3ICJA 4F40A 2GQ3A 3TU9A 1XCFA 4BFAA 4QNEA 5F7UA 1B1YA 4EKJA 1AL8A 4H7ZA 4GABA 2YOCA 3TH6A 3BC9A 3JVAA 3E38A 3HFYA 2CYGA 2FPVA 3ELFA 3M0ZA 4LF2A 2Z6IA 4BA0A 1MVYA 1NEYA 3VNKA 4EWJA 4HPXA 1EJ7L 4N2YA 1S1RA 1B54A 3ZVHB 3L4VA 4X2RA 3WJWA 2E8ZA 4IMGA 4CU8A 1XLHA 4P7OA 3PZQA 4FX8A 1BTMA 3I3BA 3LV6A 3G3MA 1GJUA 5A3HA 3THDA 2PF0A 4DPPA 1UKTA 5HATA 3KZPA 3C3UA 3ZOAA 5CC3A 3LCLA 1Q6FA 4DJFD 3ZLFA 1K77A 3CLWA 3UY8A 5EL1A 2B7NA 2BVTA 3WD4A 1GOWA 2E7FA 2ZC1A 1P5BA 2ISSA 1XRVA 4PUEA 4EPBC 3OZYA 2VQTA 3A3HA 3S3GA 4AD0A 4IPPA 3GR8A 4M0XA 3S5OA 3TOPA 2PDWA 3TKFA 4Y96A 3GX9A 3UU0A 4Q4SA 4DEFA 3NQMA 1L6YA 1GPFA 2WKJA 4DNMA 2P0IA 1EH9A 4Q7BA 2ZZ5A 1DJWA 4H7VA 3QY8A 5D9MA 1I1WA 5DBUA 4GUGA 4J5NA 3A23A 2ZFAA 2OPJA 1H7WA 9XIAA 2RDXA 2VCCA 4C6IA 3CV7A 1E5JA 4R5EA 3TROA 5HJXA 3W75A 1A5UA 3ECQA 4LYQA 1F8IA 1OWQA 1B3WA 4QX4A 4QS6A 3WDHA 4JDBA 2NT1A 1KQZA 3SI9A 4HIBA 3SQSA 1WBJA 4GX9A 4AZHA 3MSYA 5AFDA 4FI4A 4NXKA 1GW1A 1XIEA 4GIRA 3UG5A 3CAQA 3AISA 4GY1A 1GTEA 2WM1A 4RW3A 3P5YA 3LYEA 4LF1A 5CLTA 4PYSA 4RR4A 3WK0A 2O0TA 3E02A 3SCPA 4GYJA 3Q45A 4UCFA 5C2GA 1FCUA 4RL3A 3FA3A 5C9ZA 3LOTA 3ZLHA 2F61A 4HK6A 4AY7A 4HCDA 4I3GA 3NEHA 1F4AA 3PBUA 4HCHA 4BR1A 4UTWC 1NQ6A 3G2GA 1T0OA 2FMNA 1A5NC 2CHNA 1JFHA 1F74A 2A5HA 3BG5A 3N3MA 4QQ3A 2VHLA 4KGLA 3ONBA 4W84A 1Q45A 5DMMA 3EWYA 3P6LA 1WDDA 2Q8ZA 3EKLA 3O07A 5LGZA 2REQA 2VC9A 3WNLA 2R91A 2XN0A 3DHDA 2OX4A 4IM4A 4GI9A 2EPLX 2GWGA 3LTPA 4O8RA 3KP1A 4Q8VA 3MP4A 3FIGA 4PUDA 3QPEA 3PBWA 1A3HA 4LVFA 4RJEA 3UGVA 3ZYZA 2YSWA 3OLGA 4CN6A 3M47A 5H8MA 4BJHA 3VGEA 2VD8A 1XQKA 2QUTA 3VC6A 1OYCA 1T99A 4LRSA 3RR4A 3APTA 3B8DA 5F2GA 1M9HA 2XUCA 3GY1A 3ZXWA 5BCAA 1FWCC 4ZODA 4ADSA 4YMZA 1VHCA 4GVHA 3WQVA 3KTXA 4XSMA 1QNSA 2ACQA 1OT1A 3IANA 1DE5A 1EQPA 4JIIX 4H9ZA 1RPKA 3H55A 2W63A 3B9NA 1UMYA 3Q4DA 1EGZA 1RAKA 4UTTC 1JYNA 1LJYA 2WPBA 3VGHA 3KBNA 4X22A 4O16A 2VVSA 4AZCB 2FB3A 3W24A 1AG1O 3VCCA 3O1NA 1IXQA 3NO3A 2YXGA 4S3FA 3WLTA 5EMLA 4TV5A 3S46A 2F9RA 3DC0A 1JXJA 4L9YA 3R0UA 4LOCA 3R8GA 5A69A 1IIGA 2WCGA 3QC3A 2C3ZA 4ZQNA 1JJKA 2PRMA 3BAJA 1J4EA 1EJUC 5I3DA 4MWAD 1JRBA 1TPEA 2E6DA 3MB9A 1PDYA 4AF0B 2HZGA 2HEJA 4S3DA 5LNRA 3CAWA 4D8ZA 2H8ZA 1KCLA 1P4CA 5A6TC 2BSLA 1RZMA 3QTPA 4XO6A 1H1NA 1LWHA 3CGTA 5HOSA 1FCQA 4UNIA 4E3VA 1QI3A 1S2AA 1S39A 2PU0A 2OYMA 1YE6A 3SCVA 1MRQA 4KWOA 4Y7EA 4WF7A 4ZE5A 4PE8A 5DLCA 1JDFA 4DX3A 1VGAA 2IKJA 3N2XA 3MW7A 4KCWA 1T8XA 4ZSTA 2O9TA 3KL5A 3B0UX 4S2CA 1AMKA 2PTYA 3OPSA 5FEWA 1TV3A 4UQEA 1ADOA 4AZIA 4Y9AA 1AH4A 1ENUA 4AMAA 3MUXA 3WQGA 4HU8A 2WMIA 2VM8A 4NZ5A 3LN3A 1OC6A 1U83A 2WMIB 3TJLA 2PDHA 3GE7A 5I23A 4Q8MA 1P6WA 4DY1A 3EB4A 5CJNA 3CUHA 3URQA 1QPQA 2YLLA 2X40A 1HKIA 2RDTA 2G41A 4WIWA 2GJLA 3L4TA 1NOWA 2CESA 3B8WA 4LS1A 3NNTA 3BGAA 4ZB0A 2DDXA 2WC3A 1VJIA 4C6FA 1TVNA 5ENLA 3T7VA 1US2A 3MO7A 5A8QA 4JQ1A 1EEXA 1KKRA 1R2SA 3WEZA 3GNPA 1XRSA 3W7KA 1A0EA 4GLEA 3LCHA 1EXPA 1ZHAA 3ABXA 2HWGA 4WHBA 2INEA 1SJCA 2E09A 4U33A 1IEIA 2YFNA 2E6AA 3LRLA 3QZAA 1EA9C 3GDTA 2GVYA 1LRTA 4FNTA 2DIKA 1F76A 2PWFA 4NY2A 3S2LA 3HPXA 4NAFA 4NXSA 2A7NA 5C5YA 3H6OA 4O8AA 1JZ5A 4POCA 2IPWA 5F2LA 2VTFA 4Y6GA 4XKYB 1PCKA 4JIQA 4HNLA 2FYMA 5EB8A 3VA8A 3BMXA 3AS3A 3I4EA 5DF0A 1LLWA 4Q32A 3T09A 4RDVA 4Z2KA 1HVXA 3W7QA 3S47A 1ISYA 3M5ZA 2WVSA 3W6YA 4Q4KA 4U4MA 2PE4A 3GZAA 4HD5A 3MSGA 4QNWA 1PKYA 3WLJA 4HVXA 3VFCA 1W1VA 1RY8A 3MVIA 3IV3A 4U28A 1FY6A 1KGXA 3M43A 3N6JA 2EKGA 1YDYA 5FF7A 1PX4A 2QV5A 3PBGA 5A8MA 2CLMA 2DQWA 5ABTA 4B2DD 1FTXA 1G4PA 4JFVA 3MUZ1 5T26A 1J8VA 1PKNA 3WLNA 4IMFA 1S3TC 3F2BA 3M0LA 3FJLA 3WQWA 1MSSA 4FIRA 1RH9A 5LIYX 5M5DA 1FOBA 3JRKA 1XM3A 4NZ3A 3BLEA 5IHRA 1QOPA 1SSDA 3A21A 3E12A 4IP4A 4JTTA 4HN8A 5HK4A 1QNQA 2XN1A 2D24A 4MB5A 1RJRA 1IQ8A 5FEPA 2Z28A 3ZO9A 3ITXA 4IP7A 2XZ9A 3L65A 5I79A 3VNZA 3KFTA 3M64A 1XS2A 4LNYA 4C7FA 4ES4A 3HPAA 4UZUA 3WL0A 4M8UA 3O06A 3WSUA 2ISFA 3CZKA 1UPMB 7CGTA 2D22A 3EMCA 3F4CA 3KAOA 1HJXA 3M07A 5KETA 4MG4A 2PURA 3P2VA 3YPIA 1KD0A 1UH3A 3HF3A 1EKOA 1JPHA 4A3RA 2OELA 3SZ8A 4JN6A 3NQDA 5EMJA 1J79A 3E74A 1QW7A 3R11A 2C0HA 4BF7A 5K9CA 3SUUA 3MTWA 2OWXA 1HN1A 1CENA 1S2CA 4Q8QA 3UGRA 3ZR5A 5BNKA 3W9ZA 4D71A 1VFTA 4GQGA 4E4PA 3ME3A 3EGJA 5HMDA 1MW3A 2H8XA 4CVUA 1FWDC 1UBSA 1M5WA 1JYVA 1QUMA 3UFYA 1VCGA 4DJED 1G0CA 1PVNA 1ZP3A 3KVLA 1B4EA 4FNQA 3HOJA 3U7BA 1JVNA 1N55A 7TAAA 1H1ZA 4KT2A 1DE6A 1HO4A 1UKQA 3AXKA 1NDZA 1OINA 2ZUTA 1OFAA 3GIQA 2CBIA 4H6EA 3M0HA 4MY9A 1W3HA 5I3JA 1O66A 3W6LA 4LYRA 5CSSA 2Z7KA 2OOGA 3GG0A 1J5SA 5BU9A 4RZBA 4YTTA 2V5CA 1JDCA 3G6MA 4GBDA 1ZY9A 1RQEA 2OR2A 3U8GA 4M6PA 3VIFA 1V6WA 1UASA 4GUIA 1RBLA 4NZJA 4GFIA 3LSBA 1MNSA 1WZMA 4JL1A 3WNMA 4N6FA 1XIBA 1AH3A 4J3UA 4O28A 5JVLA 3SEPA 4Z2JA 1JDEA 1SZFA 2G3JA 1O6IA 2VFHA 3BVJA 2XM1A 3BO9A 2YXXA 2XSBA 5LNUA 2FHBA 4PUJA 4Z0JA 3BH4A 2CLFA 1WDPA 3DYMA 2OG9A 2QUNA 1FA2A 2YYUA 2PP0A 1ZGDA 2O7QA 3CQJA 4O0ZA 3REQB 4IMDA 2D69A 1CYGA 2HNHA 4AWTA 4QJ5B 1YPFA 2DY3A 4PBFA 1MUWA 4ADTA 4LC8A 2QV4A 2CLOA 2C6QA 5K7JA 4M6UA 1GEHA 4LUIA 4H9YA 2XYLA 1DHKA 4IPJA 1V0KA 2BHZA 2HK0A 2QAFA 3WJZA 2VEMA 2FB2A 3AIEA 4Z1CA 4J2PA 2CLEA 3BCFA 4CN1A 3V5FA 5FEZA 1D8CA 3S5NA 4HNCA 1ICQA 4OUEA 3EAUA 3AQUA 1CGYA 3QRHA 1FUYA 3UPMA 4TO8A 3L4ZA 2IQTA 3N4FA 4Q8TA 2R1LA 1AQ0A 1T8QA 3IVTA 4J35A 4DB7A 1YTDA 2OT0A 3UG4A 1V3JA 4RK8A 4C6EA 2PDJA 1VC4A 1TUFA 4ZO6A 4MNKA 2WWDA 5J04A 3RLHA 2PP3A 3CHDA 2V81A 4WY0A 4M5PA 1XLMA 2BVYA 4NNCA 3E3HA 1XKYA 4ZO8A 2QJGA 1WZKA 3TTOA 1F3XA 1V6TA 5HUPA 1XIIA 2PSNA 3GZ3A 3GH4A 5FSEC 1K4HA 3CPRA 1XFCA 3W1LA 4Z2IA 1ZU8A 2PGEA 4NIRA 1J0YA 1XSIA 2UY3A 3SCTA 1KFKA 3BZGA 3GBDA 2A1YA 3AOFA 3CAKA 3SECA 4PUWA 2QDHA 4C6CA 5E70A 1AQFA 5LXEA 3VD4A 5F1UA 4WJ8A 1E43A 1E6RA 4WKHA 1VRXA 2WK2A 3N18A 4LCRA 3D46A 1FHUA 2RJHA 4GPNA 1TELA 3BG9A 1G4SA 3ITLA 4PSRA 1A0CA 3AZSA 3MI2A 3ZJ7A 1DIDA 2YW4A 1A4MA 2EPOA 5CSUA 3MKCA 3S1XA 1VLIA 1EB3A 3K46A 5I3IA 4NYYA 1YE4A 3PY2A 5AECA 3AHZA 1EEPA 5JH1A 2HJPA 1UP3A 4IJBA 3TLLA 3S9ZA 1GQIA 1V6XA 4IPLA 4D6JA 3QTGA 5E5CA 2AKZA 3U2OA 1HF6A 5GJNA 1EL3A 3PJXA 5HBFA 4PCPA 3H70A 1SM9A 3OU8A 3RGTA 4C6JA 4IQDA 3R89A 3THQA 2NLIA 3U5YA 4IFRA 1TWDA 4MUPA 3BSGA 2WJDA 1BYCA 1O7AA 1A49A 5E09A 2YBUA 5L6UA 4DJEA 3TYCA 3B0XA 4NT0A 4N6EA 5DCDA 1FFRA 2D2OA 4P8WA 3R79A 4IQEA 4UQDA 3V1HA 1YX1A 5M17A 5H1WA 4LUSA 2PUZA 2X16A 1VYPX 4MB3A 3P74A 4W7UA 3L66A 3VIJA 4C6KA 2RUSA 3W70A 4IFKA 3WK2A 1JGIA 1UWSA 1MQQA 2HBXA 2GGHA 4JD4A 2BZNA 4V1XA 1QR7A 2GLKA 2ISWA 2EO7A 1Q7MA 3R12A 4KPLA 3ZIZA 3P84A 3SW6A 1YADA 4JZ5A 1J6OA 4H8UA 1E0WA 1PHQA 2BY2A 3DG7A 2BS9A 1GONA 4D6HA 3ZR4A 4ICNA 5HNNA 1AW2A 4DWSD 1UWIA 3GDMA 5LYRA 1FH7A 5JBEA 4ERIA 3UWYA 2Z27A 3D0CA 3R8HA 1H09A 1JZ8A 2WANA 1U1JA 4N4QA 4CQ8A 5C7VA 4O50A 3BANA 5E93A 1A0DA 5K9DA 2W91A 2IXUA 3ARVA 3TAKA 5D33A 2NV1A 1SO4A 3OIHA 4IJCA 1OVDA 3WY1A 1A5MC 4HMCA 4IUGA 1D3HA 1UR8A 4MLJA 3W1MA 3ZSTA 4TX6A 4M51A 2Y4SA 3KBVA 4LAOA 5BU6A 1TV7A 2CLIA 4PTMA 3MMTA 2DSWA 1TPC1 5LKYA 4Y9PA 3LEPA 4US5D 3NM3A 2W27A 4NZ4A 4OOUA 1TR1A 2WMFA 3EWWA 4NILA 1ZAHA 5TAOA 1ZBKA 1A5CA 1QO2A 2R94A 4OV9A 3ARXA 2E0PA 4NZCA 2NQHA 1ONXA 2BHUA 2GSJA 5A6LA 3SCSA 4O12A 1X97A 3TZNA 1YLVA 5C54A 1JPMA 1DQWA 1BKHA 4A8LA 5B7ZA 1GOKA 4ZO7A 1XD1A 2B7OA 4D6GA 3NXLA 3VNJA 3TR2A 3VUSA 2HS6A 7ENLA 3LQGA 3PWIA 3IJ9A 5BROA 1XGEA 1JDAA 1KRBC 3STFA 4WDUA 4LNCA 1ITQA 2DSVA 3AIWA 2G50A 1Q4NX 1BXBA 4GJIA 2QLYA 5T9BG 3IGHX 4GQRA 1Q6QA 3SCRA 3QKEA 1ONRA 3FVMA 3NDYA 3U48A 4LAZA 4E4FA 3DENA 5JBFA 3SDOA 2ZTJA 2DFAA 3NL3A 4GO9A 1O1HA 4PULA 4UMAA 3DKLA 2QHAA 2ZRYA 1A5BA 3EA3A 3EWXA 2W6RA 3TP4A 2ZRXA 4GVFA 2VP8A 3KWXA 4J1OA 2QGYA 1VQTA 2HE5A 3D6NA 3N1AA 1FWHC 3VNLA 1QOXA 1VR6A 4HN4A 3TZFA 1QJWA 4L1WA 2IW0A 4W87A 3K8LA 3EWUA 1AVAA 3ZMRA 4ROPA 2OZ3A 2X2GA 4TU1A 1HVQA 1TUXA 3S6TA 5C2CA 2W61A 1UH4A 3QMTA 2J4GA 4JCMA 2VFIA 3P8IA 1O4UA 3KUMA 3OQ8A 1OX6A 1J96A 4IPNB 1V5XA 1SO6A 1H0GA 4IGSA 4XSLA 2X7WA 3B04A 4P8VA 5AHEA 3CT7A 5CZTA 4F48A 2WHKA 1V7AA 1TA3A 3LRMA 2O9PA 2OGYA 3VILA 4A2SA 4AIUA 2YCEA 2PDLA 2J8FA 2E9BA 1XCXA 2GVJA 2NZLA 1CCWB 4DM2A 1MYRA 3ABOA 4MPQA 4GH1A 3UP8A 3G22A 4FX6M 4JNYA 4ZMGA 3AZTA 2J6VA 5LXXA 4Z42C 2ALRA 1TB3A 4H41A 2ASHA 2XH2A 5GQBA 2BX7A 3JUGA 3GTXA 2IUZA 2XIMA 4IUOA 4S3GA 3M0JA 4URIA 2ZA3A 3XISA 1KGWA 2QW5A 3VUPA 4AZ7A 1FWFC 3PFMA 1SZEA 2ZDRA 4GJ1A 2OFJA 1KBLA 4M19A 1KFCA 2C91A 2I56A 2QEZA 1K7EA 2XH0A 3V75A 1BHGA 2J9YA 3CS2A 3DKJA 2GJXB 3MMUA 3T0DA 5A8NA 4QAWA 4MJZA 3AWOA 5D37A 5A6KA 1YNYA 3STCA 1HL2A 3V0UA 3VKKA 3KTSA 2DT1A 1RPXA 4O13A 2Y89A 4R7OA 4AISA 4LVGA 2YBTA 2I5QA 3ARWA 2WSRA 3ZQ9A 3D47A 1GT8A 2H9AB 3RMEA 3VD3A 4E5TA 2V5DA 3OODA 3THUA 3N2TA 3RDKA 3OVRA 4U3CA 1QXLA 1R9ZA 2TMDA 4MY1A 1JYXA 3FSUA 3M7WA 2VL4A 3WQ5A 3ZS4A 2NV2A 1FCBA 3EOUA 3FJ4A 4YWIA 3MUIA 3IIZA 2WZEA 3SGGA 3CWHA 3OZPA 4XZHA 2VCAA 4FS9A 5LA0A 2B7QA 2GK1A 2PDQA 5AYXA 1WAWA 4DXKA 1KBJA 4CNTA 4U3AA 1SYTA 1D3CA 1E1CB 5A1AA 1D7FA 2NVDA 4RPPA 5DMLA 3BJTA 3GXFA 4ADUA 1XPGA 2ABBA 3CMFA 3RO6A 4Q7NA 3WBYA 1ML1A 3RM4A 4JYFA 3N2CA 3GVGA 3VOIA 3E9AA 1P0BA 1RCOB 1S5TA 4IP5A 1JPDX 1JR1A 2UV8G 3ARTA 8XIMA 1I2RA 1YDOA 2VD9A 1LUCB 2GGIA 5BZAA 1THFD 4S3AA 4Z08A 4JTGA 1XLEA 5KTLA 2R1PA 4C7DA 3LG3A 3R5EA 2JF7A 4Z1DA 4XAGA 4AHPA 1T41A 2VCBA 2EKCA 2Z2BA 4V1YA 1JF6A 1H63A 4EOUA 3UD6A 3SY8A 4B5NA 2J24A 4YVVA 4U5IA 3UNDA 4J40A 1DTUA 5BYWA 2WSQA 2CEQA 3G1FA 4GRSA 4AH7A 1IGWA 4KMQA 3UXKA 4KS0A 4A29A 2BV9A 1M6JA 4E8DA 3HFTA 1GHRA 4NL1A 1W5QA 4OIFA 4JICA 1ONEA 3QGVA 1WOBA 3AS1A 2WV8A 4H9XA 4NASA 4JKLA 5PTDA 2ZUMA 2J7FA 1REQA 3NOYA 2PTXA 1VEOA 1Y5VA 3RF9A 1REQB 2E67A 3CNYA 5DT7A 2ZX6A 4CQDA 3O6DA 1DIEA 3ZZ1A 1RVKA 1YPXA 3UXLA 2YZ5A 1J12A 4FALA 3E2VA 3MI3A 4M6QA 1V6YA 3W2MA 3VMNA 5CG7A 3OJGA 3AHYA 1QHPA 2R82A 4GQ0A 4G56A 2NWRA 1H61A 1ZB5A 2ZRWA 4WKAA 2DPEA 3TAOA 4GC3A 5C2XA 3OGRA 1PTAA 4Y9OA 2YCLB 3RU8X 1Q6DA 4FLRA 4WR3A 4C6NA 3TMLA 3ID7A 3MUAA 2BG5A 8CGTA 3KM8A 1L0PA 4QXIA 4ACZA 3GDKA 3JZEA 4NRRA 4WUIA 1OY0A 4ACYA 1UZDA 2ZXBA 1JUEA 5DO8A 1CNVA 2Y7FA 1M65A 1HKMA 5FJJA 3BW2A 1ISZA 4HU3A 1BRLA 4O0KA 3GXNA 3EOLA 4C90A 2V5KA 5SWUA 2PDGA 5FL0A 3CZJA 6REQA 3L4WA 2O4QA 3PWAA 4X0VA 3A5FA 1V77A 3AICA 3MQTA 2A3AA 3WDIA 4C6DA 2D0FA 2OSXA 2FQIA 7PTDA 2XSXA 4UTMA 1LTDA 4ECLA 3NZGA 4AD5A 5IHSA 1JNDA 1EWDA 3L2IA 3HQ1A 3C4UA 5G4WA 4IX0A 1PX3A 5K4ZA 2QCEA 3DIPA 1UD5A 3K1DA 3C61A 3UG3A 2XVNA 1PKMA 1K4GA 1ELSA 2QCCA 1SJAA 1GVEA 1Y5WA 2DORA 3AYTA 3IGSA 4ZB5A 1ECEA 1UKSA 1SJBA 2G3IA 4LALA 2QCHA 2FHCA 4PZVA 2Z1VA 3T2QA 4NAEB 4IXHA 3VNIA 1W17A 3T07A 2G0WA 4RE4A 3RMJA 2PBGA 1O60A 2PC4A 3AIUA 4HA4A 4G9PA 4HMNA 5FJPA 1NY1A 3S5SA 2WLYA 1V0MA 2O4MA 1F2JA 1H50A 3I3DA 3W82A 1GVIA 1H60A 3GNDA 3MSDA 1BSLA 1MW1A 3AI0A 4IQLA 3WKZA 6XIAA 3UJFA 1VCVA 3LHWA 3V0SA 4AD3A 4IGNA 1DTNA 2W3ZA 1JQVA 1OX5A 5KINA 4ZXLA 1TJPA 1NOFA 6PTDA 3LM7A 4V2XA 3HJEA 2GDQA 5LHEA 3GO2A 2KX9A 3CB8A 1UA7A 1GVOA 4BQ5A 5D8ZA 4LV4A 1R86A 1GZGA 1E6SM 2ZUWA 3NSXA 4Q8UA 3EX2A 4ZZ9A 5KZ6A 4JTLA 3TTQA 4DBDA 1O94A 3ALFA 4PMZA 2YGYA 1H5VA 1MUCA 1DWIM 1UUMA 3AMLA 4XQ6A 1ADDA 1U30A 4YHGA 4KEVA 3I6TA 2Z6JA 4HBKA 1CGUA 3STPA 2J13A 3O7UA 3C8NA 3LUTA 4F66A 1E55A 2VR2A 2NT0A 3ITTA 3L0NA 3NSNA 3E0WA 1OF6A 2VO5A 2WVUA 4P7QA 4JEJA 1VPQA 4MWAB 2I14A 3H4GA 4IJRA 4P7NA 5DCEA 3URNA 4UTKA 5DMYA 3WELA 3MBFA 4DJDA 5HMFA 1JXKA 4F2TA 2P8CA 2XWEA 3EWCA 3EPOA 4MB1A 3C0LA 4NJKA 3MA8A 4DUVA 3ABSA 3UA4A 3WZ0E 2I5GA 1G67A 2DW6A 4MDPA 4NG3A 4ALDA 3LY0A 1FBAA 1TE6A 2AAMA 1TZ9A 4QG9A 2J74A 5K4XA 3GB6A 2DU2A 3BCJA 4MZ1A 4KCVA 4Y90A 3KBWA 1FVPA 4ZFCA 4PCSA 4WDWA 2E9MA 3A24A 4DBEA 3LSCA 3C0JA 5JH2A 1TMHA 3B05A 4K6AA 2BGQA 2EHHA 5CXPA 2YDSA 1ZP4A 1OCNA 1NP0A 3SCQA 2NQZA 3W1QA 4DLFA 2Z24A 3N13A 4XZLX 4JN8A 5DBTA 5LNVA 1TPH1 1TTQA 4WGHA 2EBNA 5KZMA 4YN5A 4XZNX 5CZKA 3A4WA 3DG3A 2WAGA 4AY1A 5D2WA 1NP2A 3MYOA 3PBVA 1FHLA 3L2LA 3CL8A 5G1TA 3BG3A 4JQAA 2CITA 3IUDA 4QQUA 2VFEA 1E1FA 3GDBA 4JFTA 1ZBCA 4TTUA 5FKYA 5TF0A 1DJXA 2QQ6A 4YCOA 1Z9AA 3I4KA 1W3IA 5LIXX 1FWSA 1VFUA 2QDDA 2Z2UA 4JIHA 3C2EA 3H2CA 3NGJA 2WLZA 1FWJC 3QSRA 3WLIA 1NF7A 5GVJA 2OU4A 4NKCA 1O5RA 4KH2A 1CX9A 1J2WA 4LAMA 4HHHA 3T55A 3FJNA 1ODUA 3SQLA 3WH5A 3H23A 2JEQA 2QULA 3H26A 4ATDA 1HKWA 1SUXA 3KOFA 1W2VA 1GCYA 1IWBA 1M3UA 3WJSA 2CETA 3CYVA 4FMVA 2IS7A 2FFIA 5AC6A 3LHYA 4OE7A 4U10A 3LPGA 2VR5A 4UMCA 1FQ0A 2WQPA 4ZQMA 1CECA 5ABEA 2J9XA 2ESCA 3ZSSA 2EG6A 4NNBA 3CZGA 3GHUA 2A7RA 5EKYA 3NPUA 4DRSA 3BJFA 4M80A 4HPJA 1WKYA 3IIXA 3Q65A 3QPZA 3ZT5A 4Z2LA 1E4MM 4GNJA 2J47A 3HIJA 4GH3A 5GNZA 3QY6A 1VYSX 2XPKA 5A6MA 1LYXA 2PDUA 2BOGX 1E51A 3VIIA 4DJDC 3W86A 2WOQA 2FTPA 5LNSA 4O1BA 5KZDA 4G7FA 3QV8A 4H7CA 4IG2A 1HJVA 1TCMA 1XC4A 1KM4A 1LQ0A 1PZ0A 3QV7A 4MDOA 5CC7A 1VF8A 2I7GA 5I3HA 2A6NA 3FW6A 4QAIA 3M44A 3LBMA 4GNVA 1JNEA 4PGLA 3SM0A 4C65A 4WXZA 3W3OA 2OEJA 1GG0A 3PUDA 1LBLA 2VWSA 1MZHA 4PRTA 3UYCA 1I45A 1Z89A 4ATWA 2FJUB 1KQYA 3DAQA 3P5ZA 1ZRQA 4JTRA 5I3GA 2EJ1A 4GIYA 3B3DA 2XVGA 2PAJA 4PMDA 3VX0A 4GYFA 2WB5A 3USZA 3ATYA 4UC5A 3WQOA 5FF2A 5CPLA 1GVFA 1SPQA 4NHVA 4HJFA 4UFLA 2YLAA 2A3CA 2QVNA 3ZJ6A 2F6KA 4WEVX 3TTYA 3TC3A 4PUKA 3VTRA 4DZAA 3V5CA 4D6DA 4R7WA 1LT7A 3TCEA 2DUZA 3N11A 2YB1A 2CW6A 5HINA 1FWRA 1XINA 3KHJA 4BCEA 2B4GA 1UWRA 4KFNA 3PR2A 1HTIA 4KF1A 2VEKA 4UTFA 3V4BA 3QZ6A 1W3LA 3S83A 1UKOA 4GXPA 4WD0A 4DM1A 5CLWA 3HM7A 4P8UA 1FWGC 1OD8A 5CBBA 3VYLA 3W81A 4O1CA 2X0YA 5GNYA 4D6EA 4MLRA 4W4QA 3GC2A 1N8IA 1TV8A 2UWFA 2JKAA 2GOUA 3VFLA 4MM1A 1UROA 2C79A 1R85A 3A9IA 4DIAA 2XGBA 4HNUA 3WF1A 4CD8A 4XTDA 3GHSA 4ICCX 3GXTA 2PODA 2C1GA 1VP5A 2L5HA 3VVGA 4C5YA 2PLJA 1VH7A 4E8CA 1SSGA 4PRWA 1G9HA 2WKGA 3WF3A 3VD9A 5HUOA 1IZKA 5IFPA 3NQFA 2ZZ2A 3TYBA 1B30A 4KERA 1TTJA 4N4PA 4JFWA 2PBOA 3VAVA 4REQA 1LOLA 4AD2A 1J9YA 4CVWA 1UJPA 1UOKA 4UQCA 1X38A 4REQB 2Z2AA 3CMGA 1SW3A 4JNZA 1X6LA 2A0NA 1R2TA 1SZGA 1PYFA 3H2FA 5LIUX 2CWXA 3Q37A 2HTMA 2OQHA 2XIBA 2E8YA 3PAOA 3LHUA 5CPTA 1MXGA 3LI1A 1I2PA 3VD5A 1HGYA 2BOEX 2YFOA 2YL8A 1NWSA 4DVOA 4G5DA 3P0WA 4B16A 1J0ZA 4YTQA 1DWGM 1QWKA 4JTJA 2C0AA 2QUUA 5A8OA 3RCYA 3CH9A 1H41A 3WJYA 4V15A 3KCOA 3L5AA 3AMCA 1ZCCA 3PJWA 4EX4A 1PJ9A 1AW1A 4JYDA 4UTHA 1UB3A 3TR9A 3NAVA 1AQMA 1FXPA 2EXOA 3MZNA 4W93A 4PMNA 4Q6JA 4YLWA 2FZDA 3W85A 3L21A 2GYIA 4F0MA 1M04A 1R9YA 3GTFA 3O63A 1GPWA 1QNOA 1F6YA 3LBCA 1N8FA 4AXNA 4N02A 2QNEA 1V79A 4M3PA 4KCTA 4QSFA 3C3NA 4JXCA 3W23A 2LLEA 2DT3A 4JHZA 3EDKA 1A5LC 5CJMA 4LS2A 4DPQA 2J7HA 1HJQA 3QY7A 6A3HA 3V0TA 4NP7A 2NUWA 4DF0A 1XV8A 3BGJA 1JCJA 4KEZA 2ZZ7A 4QDMA 4E4UA 3VPLA 1QNVA 4MVAA 1C9DA 1DXIA 2X7VA 4GGHA 4LU0A 1EO7A 3WK3A 3FNDA 3MV01 2WSKA 2FDSA 5A6JA 1HG3A 3BCDA 4L65A 3W7JA 5MKGB 2J7EA 3GVWA 1KXTA 1XYAA 5EFDA 4Z2HA 4INFA 2HROA 1BLIA 1YKWA 4F0KA 1XW8A 4X9SA 3FA4A 1TRIA 3FCPA 3AIBA 3TYDA 2OTDA 1J0KA 2CLLA 3ITVA 3SB0A 3WDRA 4O57A 3UA3A 3GAKA 1EHAA 2FVLA 1XJBA 1SO5A 3LU2A 5U4NA 1V0NA 4JTFA 1QTWA 2VURA 4N9EA 3UZXA 5XIAA 3E96A 1Y5XA 4GI8A 3QFWA 1TJ2A 1UR4A 4S3CA 3MHFA 1N7KA 1I1XA 3AXXA 1S2VA 1UW9A 2OEKA 5LA1A 1BYBA 1OB0A 4R85A 3DFYA 1TPFA 3AXMA 1S3HA 4HU4A 1ZPTA 4HMDA 1XLJA 2DEPA 2AL2B 1EDGA 4RNHA 4WGXA 1I8JA 2J62A 3OGVA 1UC4A 4I8YA 1TYGA 1TPWA 1NFPA 3LHZA 1O12A 5E9AA 1BYAA 1LRNA 1BXCA 1GQKA 5G1YA 1ZNNA 4FR1A 1CGTA 3B8IA 1A5KC 1KTCA 1W5MA 1EP2A 3CYJA 3HGSA 2ZOXA 2UY5A 3QHNA 4LVDA 2YDQA 2VGGA 1FWAC 2XSAA 4R3UA 3SSJA 3T08A 1DWJM 1EFZA 3T8LA 1QPKA 4YTRA 1Y8BA 4UMBA 3P3BA 1XG3A 4B91A 3LCFA 2VX4A 1E56A 2VJXA 4DO6A 2CBVA 4C1NA 3UJEA 4B5VA 3S2CA 3VCRA 1R0MA 4YXGA 3N2MA 4B3KA 1VENA 2J77A 2XZ7A 2ZUUA 1AA1B 4PFMA 5G2IA 4ROQA 1BG9A 2E68A 5HULA 4TVCA 3P67A 1F6PA 4R9XA 3N6HA 1EC8A 3RRAA 4M7SA 1TV5A 1RV8A 4AY8A 3GVQA 2A3EA 1CWYA 1H7NA 3SFKA 2RKXA 3ARRA 4AEFA 4JL2A 3SN4A 3AXHA 3NCOA 4XBJA 3H2AA 3WCZA 4H8HA 1NF0A 4EPKA 1V4YA 3NWRA 1PYMA 4LTSA 1UOZA 2WYSA 3T1GA 3AHVA 2WZIA 1TTIA 2NUYA 1K8XA 2V82A 1B2YA 2F2KA 5TNVA 5M2FX 4R27A 4WOZA 2VFGA 3TQKA 2ZX9A 3BLFA 1NDVA 2D0HA 4GK8A 2PWVA 4UR9A 4HOZA 2XJ7A 4QE4A 4RZ5A 5JU6A 3JR2A 2W4XA 2W67A 1T40A 4IGMA 4CNSA 2P76A 1EJVC 1BFNA 4NJHA 1W9BM 4GYKA 3TV8A 5HANA 1T96A 4AC7C 2PWGA 1V8EA 3VKAA 2YXOA 1UUQA 3NA8A 1UP2A 3WD2A 3VD7A 3WQ8A 3T81A 4LY8A 2QZRA 2VMFA 3ANUA 4PTWA 3T0TA 5M03A 3M5XA 4U2ZA 4PTXA 3OQEA 4FR6A 1ZQ5A 1IE7C 5I3KA 5DN1A 2Z4GA 4Q4QA 3TONA 4ZOEA 2Y85A 4JPGA 2XDFA 1GNXA 1X1NA 3FGCA 4ZTXA 1AJZA 2O9OA 3FGCB 3BSMA 1XC6A 6ALDA 3BAWA 1JUKA 3MHUA 1FX6A 1WPCA 1AJ0A 1CXLA 4OKDA 1C90A 3O2LA 4GKLA 3VOCA 1VBHA 2NX1A 1H1YA 1XLLA 4WSJA 1L8NA 1RD6A 4GCAA 4WDTA 1KFJA 1MW0A 1YPIA 2BODX 5LIWX 4KWVA 2D1ZA 1OQFA 2VRJA 4G7EA 3BWWA 1P0EA 9RUBA 2D2GA 2IPJA 1B31A 4C6QA 1X1OA 2VGIA 3IJLA 4XZBA 1LQ2A 3ZWSA 4AZ6A 1L6FA 3EWDA 3IACA 4JAWA 2H6RA 4LBSA 1K6AA 2CERA 1Q6GA 1MEWA 3FHQA 1HZYA 1JCXA 4GFSA 1XBXA 5ECUA 1R8LA 2FPYA 3HPFA 3LPOA 1J10A 2ZKMX 1X8CA 4N0RA 4AFYA 3V35A 5AYIA 1IEXA 1TSIA 1KWKA 2WVTA 5G2WA 1GOIA 4NJGA 3NGFA 3ONCA 3QR0A 4O1AA 1IIHA 2Y8KA 2OZ0A 2CKRA 1MZRA 2EG8A 3GFYA 4XAYA 2PDNA 3B9EA 5GNXA 3O6AA 3VDCA 4B5UA 4AQLA 3VABA 1XX1A 5FF3A 2WPGA 4F9DA 3KOYA 3K1GA 4HCLA 1PDZA 4FXFA 5ABGA 3AJ7A 1LQAA 4HT3A 4I7WA 3KL0A 1GVQA 4DAFA 3WBAA 2NQJA 4K8GA 1SVDA 3PUGA 3IPWA 1POJA 5FL1A 1E0TA 3NPXA 1UR9A 2GQ8A 1ESWA 3TSBA 3P0XA 3CU2A 1ZBWA 4JX4A 5E9XA 3T4CA 1YBQA 3A13A 5JMUA 1TWZA 1AUSL 4PMUA 4TTGA 1OD0A 4W8AA 2YB4A 1W3JA 4PC8A 1K9DA 1VPYA 4FNSA 4FLSA 3R58A 5EA9A 4KW2A 3C52A 3DG6A 4KIRA 3DERA 1GYLA 4G8TA 4MMWA 4JHOA 1UG6A 3E6EA 4ZOBA 2PU1A 3CB3A 3TYUA 3TN5A 1SW0A 3F5LA 2XGZA 3DECA 3ZT7A 5G5IA 1YW1A 3WNPA 3VINA 4C1LA 2E1WA 3W84A 1F4HA 3W37A 1VFOA 1ZJAA 2PB1A 1Z7AA 1PB0A 1GJPA 3N34A 3B8SA 3LQLA 5TIMA 5CH9A 5HJLA 2IQDA 1S5MA