3N11A

Crystal stricture of wild-type chitinase from bacillus cereus nctu2
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
325
structure length
325
Chain Sequence
LGSKLLVGYWHNFDNGTGIIKLKDVSPKWDVINVSFGETGGDRSTVEFSPVYGTDADFKSDISYLKSKGKKVVLSIGGQNGVVLLPDNAAKDRFINSIQSLIDKYGFDGIDIDLESGIYLNGNDTNFKNPTTPQIVNLISAIRTISDHYGPDFLLSMAPETAYVQGGYSAYGSIWGAYLPIIYGVKDKLTYIHVQHYNAGSGIGMDGNNYNQGTADYEVAMADMLLHGFPVGGNANNIFPALRSDQVMIGLPAAPAAAPSGGYISPTEMKKALNYIIKGVPFGGKYKLSNQSGYPAFRGLMSWSINWDAKNNFEFSNNYRTYFDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of bacillus cereus NCTU2 chitinase complexes with chitooligomers reveal novel substrate binding for catalysis: a chitinase without chitin-binding and insertion domains
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Hydrolase
molecule keywords Chitinase A
total genus 113
structure length 325
sequence length 325
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2010-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3n11A00
3ZT5A 1GOIA 3AS2A 4FK9A 2CCRA 3D5HA 4WJXA 3VILA 3BXWA 1B0IA 3OIHA 3OGVA 5IXEA 1NWTA 1E5JA 1M53A 3AYSA 9CGTA 3APGA 2XM1A 4UQDA 3SUWA 1JZ8A 3AIBA 4OKDA 4PMNA 4UQCA 4M29A 2YOCA 4DUWA 4GZIA 5M5DA 3TOPA 1KQYA 4DWSC 2J79A 3KL0A 3NJ3A 3UG3A 5C71A 2X0YA 4R27A 5FL0A 1BF2A 5BYWA 1LJYA 3QHNA 2ZUSA 3VMNA 3UCQA 1E73M 3PZQA 4CUCA 2WMFA 1CLVA 2B31A 3VDBA 5D9NA 5A2AA 1HP4A 4JFTA 2O9OA 3PBGA 3EMQA 7TAAA 4UFJA 2BY1A 2VL4A 3WIJA 4AZBA 1JZ3A 4GQRA 1J10A 1E0XA 3WF4A 4JCMA 5HOSA 1JZ7A 1QI4A 1QHZA 1MFVA 2XTKA 1KGWA 1HJWA 4Z2KA 1LQ0A 1E4LA 3CZGA 2ZWYA 3ARZA 3ARRA 2IXUA 2WVTA 1O7AA 1V0LA 4Z2LA 3LPGA 2UY5A 4BA0A 4DWSD 1XH2A 3A4AA 3D3AA 1C92A 1SMDA 4H04A 2EPOA 2RGLA 4E4PA 3GYCA 1XD0A 1EOKA 3DC0A 3T0AA 4AD0A 2VTFA 2DH2A 4KMQA 4DM1A 1KXQA 1R8LA 3G6LA 1UWIA 3AISA 2G3NA 3QOMA 4K68A 1E70M 1DHKA 3SUTA 5IHRA 2Y4SA 3VIIA 1BYDA 2XVPA 2WXDM 5A94A 2VZTA 1HVXA 3O2LA 4CVUA 1OSEA 4CCEA 3WF3A 1AQHA 4W86A 1EDQA 3W6LA 1DWAM 1VFMA 4XZBA 4KRTA 1VB9A 3LMYA 1UG6A 4WIWA 1AMYA 3VMOA 5ECUA 3F5JA 2VURA 4D6DA 1HJXA 2YBUA 2QPSA 2BNJA 2DSUA 2D20A 5I77A 2GK1A 4V27A 3LPOA 3UG5A 1E9LA 4AMCA 4J27A 4F66A 1ZBCA 4MB1A 2W92A 3PZGA 4HZ7A 1KCLA 3NYDA 1WKYA 2CKRA 5FD0A 2WLZA 3W24A 4WLCA 1CTNA 4X0NA 2EXOA 2A3EA 1UWRA 3GTNA 2FH6A 3GXIA 5AC5A 3N1AA 2CHNA 1JI2A 1E3ZA 4P7QA 1I75A 5HNNA 1JIBA 4JZ5A 2ZX7A 1JXJA 1TA3B 3M7SA 4U33A 1QHOA 3PZUA 2GFTA 4CCCA 3CHFA 2E9MA 3WUGA 1BPLB 1V02E 2PWHA 5TD4A 1E72M 1X1NA 3OG2A 4PSPA 4A4AA 5GNXA 4EE9A 2VCCA 4WSKA 1Y7VA 3CUFA 3SCNA 2VMFA 1BG9A 2JE8A 4P8UA 2VRJA 1TFVA 1V3IA 2VZOA 4JKLA 2WCSA 3L4TA 2O9TA 1MW3A 3E1F1 3WFZA 4D1IA 2EPNA 3MANA 4CD4A 4YN5A 5GPRA 1W2PA 1Q6EA 4JL1A 4EK7A 3ZIZA 1OWQA 1IZKA 4HMCA 4IISA 3RDKA 2VQUA 1PZ3A 3T09A 3AS0A 3VX1A 3OZPA 3WDPP 1UKQA 1ZU8A 2DT3A 2WSKA 3WQ5A 1NP0A 4HPHA 3KEHA 1H0GA 1KBBA 1KR1A 3WFLA 4AZ7A 3AXXA 2D22A 1GOQA 1MYRA 2OSYA 5A8NA 2BHUA 1HP5A 3W4RA 3RCNA 3AIRA 1S46A 4AEFA 1CGTA 1KQZA 1VFOA 2CIPA 2PF0A 3WH7A 3AHXA 1JNDA 3WD2A 2V5DA 1UKSA 1M03A 1H5VA 4UR9A 2NT1A 3W38A 4LPCA 3VDHA 3CGTA 3MKKA 5C70A 3VM5A 3GBEA 2F8QA 1KXVA 4CVWA 5HBFA 3AIQA 1JZ6A 2WANA 1EIBA 3VDAA 3WELA 3AS3A 3AHTA 1HVQA 3CZ8A 2X05A 2W61A 4UQAA 1QW9A 1LWJA 2WC7A 3CBWA 2VX4A 2FHBA 1GQKA 4XZWA 1JF6A 5D4YA 5GNYA 1WB0A 2Y8KA 2E9BA 5I78A 2VX5A 5A6KA 3WMCA 2ZWZA 1JXKA 4ZE5A 1UD4A 4F8XA 2X8RA 5CSUA 4D6EA 3J7HA 2OSWA 2VZSA 2VQTA 2WC3A 1XGZA 1GOWA 3GH5A 1WCGA 1DWIM 3ARSA 2VCBA 2YL5A 4BS0A 1E71M 1BYCA 4C7FA 1QNQA 1QNPA 2G3MA 4P7LA 1HNYA 5EFFA 3O9NA 5CPTA 3QOKA 2JF6A 3FAXA 2WM0A 2BXYA 3EMZA 3DHUA 3VGBA 4UFKA 4AY1A 4KH2A 3WF2A 1HF6A 4HOXA 2Y5EA 3ZOAA 3W25A 4TX8A 2ZUWA 1XSJA 4GZJA 4QFUA 1J0ZA 1HL9A 3T0DA 3AOFA 3BAWA 3M6DA 4E8CA 1H1NA 4MNKA 1J01A 4E8DA 4ATWA 2E4TA 3FHQA 4GI9A 3O6AA 1E6QM 5CG0A 3TTOA 1AQMA 4J3UA 4W8LA 2X1IA 4GZEA 5I0DA 4H8VA 4J28A 1ZL1A 3UG4A 1LG2A 3CPUA 5KZ6A 1B9ZA 1CXHA 1CYGA 3ARTA 4CD8A 4PBGA 1CECA 3BGAA 2XVKA 4YHGA 3F5LA 1EDGA 1NWUA 5E09A 1QI0A 4MTVA 4AD1A 2NW0A 4LYQA 3IJ8A 1ZBWA 3VTRA 2WBKA 1JGIA 1PX8A 4B15A 4M1RA 1RD6A 3NUKA 3RIKA 1V3LA 1HKMA 3WNLA 4DUXA 2D3NA 4MNJA 2WBGA 4PTVA 2UWFA 2AAAA 5I24A 2VVSA 3TP4A 4AZCB 3AJ7A 1UA7A 5I79A 1O6IA 1Q6DA 1OD0A 1B3XA 1PJ9A 5AYBA 1LL7A 4M24A 4TVUA 4QLLA 4HOZA 1J18A 1NWRA 4TX6A 1PBGA 4GI6A 1QHPA 2OWCA 1EXPA 1NARA 3THDA 4CN6A 2XHYA 2PWGA 4B3KA 8A3HA 1BYAA 2GSJA 4HMEA 4NF7A 4AIUA 1HKKA 5KEZA 4UTFA 1V3HA 2XVLA 5IFPA 2O9RA 2Z1SA 3WDHA 3WEOA 1XYZA 4LQ1A 1XC6A 5I6SA 1KWGA 1W9BM 1E6XM 1X6NA 1GZJA 1HKJA 4PUEA 4DM2A 1UD5A 5DF0A 3THCA 1KB3A 1NOUA 4WKFA 1CPUA 3A4WA 1G01A 5DMYA 1UUQA 1K9TA 4U5KA 2QMKA 3I3DA 4FLOA 1V0KA 3VIOA 1FH8A 4L4PA 2YJQA 4PSRA 3ARQA 1KGUA 3DYMA 3WNKA 4KGLA 1ITCA 1C8XA 4PMUA 1H4PA 5A6BD 1JG9A 3W29A 1F4AA 3CMGA 3L4WA 1P6WA 3ZT7A 3SIMA 4KRUA 1V0NA 4PCSA 4W87A 2XJ7A 4L4OA 2DSKA 2J7FA 4W8AA 1PIFA 3MO4A 4JKKA 2BV9A 3OLIA 3WH9A 3K8KA 3IAQA 1XV8A 2ZX6A 2YL8A 1HX0A 2CBJA 3ARVA 4B9ZA 1UHVA 4PMXA 4J3WA 3W37A 3WUBA 4D1JA 1G9HA 1MVYA 4TTUA 1CXLA 4J3TA 3WF0A 4MJ2A 2QF8A 3CUGA 5FIPA 5JIPA 2AMGA 5BXPA 1BYBA 1WZMA 1F4HA 4BF7A 3WL0A 4ZENA 1ISYA 1QW8A 2W67A 2XSBA 3PZVA 1IV8A 1Q4NX 5AY7A 1EQPA 3AMLA 4WKAA 1HKIA 3VGHA 4JFUA 1ZJBA 3AI0A 4M82A 3W6MA 4AEEA 3EDJA 2CHOA 3UR7A 3EDKA 3PZMA 2J8FA 1H11A 2J7HA 4HTYA 1C93A 4X9YA 3GXDA 1NH6A 1LLOA 3FY1A 4W7UA 1E0VA 1UR0A 4MNLA 4MB3A 4Z2HA 4CGTA 4HPGA 2CESA 3BAXA 2TAAA 1TVPA 3K1DA 3U5YA 3MV11 4UNIA 2J25A 2GJXA 1I1WA 3MMDA 2BY2A 2V5CA 4BQ2A 1NM9A 1E4IA 3PHAA 2YBTA 1VJSA 3ARXA 4H2CA 2Z1KA 1FH9A 1MW2A 2VX7A 4OIFA 3KL3A 4UFLA 1TVNA 3IANA 3VDCA 2WVSA 2V3EA 4HA1A 4WF7A 3GZAA 4AYSA 3KZSA 1DTUA 2EO7A 1E6SM 3VM7A 2Y2WA 4Z2JA 3IAPA 2FHFA 3ARWA 1J0HA 2YDSA 3OZOA 1UOKA 3WNNA 1CGXA 1UR1A 2O92A 2WKLA 4F9JA 1HN1A 4LX4A 1TA3A 3B9EA 1XSKA 4M80A 2XIBA 3CZLA 1G0CA 2CNCA 1J12A 2W4XA 1R87A 3CHCA 4D72A 1I1XA 4CN4A 2XVGA 1J0KA 1B3VA 1WDPA 3TTYA 3ZJ8A 5EFDA 4ACZB 3CZKA 3LPFA 2ESCA 2D3LA 2VZUA 1E55A 4S3KA 5HDRA 2QLYA 3FAWA 3WD0A 4P8XA 5CGMA 2JIEA 1G5AA 4HU8A 1HJVA 3WKZA 1UKOA 2VX6A 1PZ2A 2W62A 1RPKA 3VGDA 2XSAA 3AMCA 3HJEA 1U2YA 1BVZA 1XYFA 4TXEA 2CBIA 4WK9A 3GNOA 1VEPA 3WL1A 1W2VA 4AZ5A 3NDZA 2D0HA 1DWJM 2YDRA 1UR9A 5M17A 1TUXA 2WLYA 3AHZA 3PZ9A 4TTGA 4J3VA 1RP9A 1CGYA 2ZXQA 1LL4A 3CZEA 2CITA 1FFRA 3RILA 5ABFB 1LL6A 1JAKA 3N12A 1A3HA 4MJ4A 3WH6A 2YDQA 4AZ6A 3PZOA 5A1AA 3K4DA 5DT7A 1OIMA 3FHAA 1UH4A 2J62A 2XM2A 1NOWA 5CJ5A 2J7GA 2WSPA 1HIZA 5HXMA 1WP6A 3DECA 1VBUA 4JKMA 3LPPA 1GOOA 4D71A 2W5FA 1KGXA 5M03A 1E15A 2D24A 4PMVA 3IJ9A 2WAGA 1V6XA 4N42A 4W93A 3SUVA 1ECEA 5EBAA 3ALGA 3I3EA 4FLSA 1ZBVA 1VIWA 5LYRA 1CGUA 5LA0A 1V6WA 3SEPA 7A3HA 3WD3A 4URIA 1TG7A 1H09A 1UWUA 3BMWA 1PPIA 3CTTA 1KXHA 1NP2A 1EOMA 4XB3A 3AHYA 1EGZA 1JDDA 3RJYA 1DWFM 3VNYA 3BAJA 4NI3A 3UR8A 2GJPA 3MV01 3BAYA 1V6UA 5E0FA 1GOMA 1LF1A 1K9DA 2VC9A 3PZTA 4H7VA 1XSIA 3B9DA 1JYVA 4C7DA 1J0YA 5BCAA 2WPGA 1B30A 1EA9C 5A6AA 3AIEA 3SCOA 1DWHM 5AC4A 4R5EA 1B3WA 1V3MA 1OT2A 3GNPA 4XUYA 2J8GA 4Q22A 3OBAA 2UY3A 1ZS2A 4ZXLA 2D23A 3RO8A 3U7BA 2VI0A 1JYXA 2XFRA 1W9VA 4UCFA 2VRQA 3SUUA 1W1YA 1JF5A 1V08A 1UR8A 2E3ZA 1K6AA 2YL6A 1W9UA 3DYOA 1CXEA 4W89A 4U2ZA 1HT6A 4S3JA 2XIIA 4QCEA 2ZUVA 3AMKA 4D6GA 1YHTA 5BROA 1UZ4A 4ACYA 1MWOA 1XH1A 1K9FA 1M7XA 1C8QA 1V02A 1NQ6A 3WH8A 2C0HA 2VUYA 4YHEA 1EQCA 5I3DA 1OB0A 2G4FA 1J0IA 3ZR6A 4GXPA 4QLJA 1GHRA 2WWDA 2V3FA 4ZXOA 3SCQA 2OYKA 4H41A 2J7BA 3WDQA 1KR0A 3GH7A 3POCA 2PWDA 1J0JA 3W81A 3CUJA 4P8VA 4M81A 2WHMA 1ZJAA 2QMJA 1QI3A 4UZSA 5E6ZA 2EQDA 3UERA 3OA5A 3N18A 4BZYA 3AIVA 1E6NA 3L4YA 1H49A 4D6IA 4WSJA 2FH8A 5CGTA 4B16A 4HMDA 3NSXA 5D9PA 1VF8A 1QNOA 2ZX9A 3GM8A 1CEOA 3BMVA 1E6RA 3N04A 4TOQA 1UR2A 3U57A 4PMQA 1K9EA 3HN3A 4PMDA 3T2PA 3VVGA 4YPJA 1JD9A 2YA2A 2PB1A 3ZM8A 6A3HA 4MNMA 2DPEA 3IJ7A 2J7CA 1UKTA 1FP8A 3IK2A 1VFFA 2GJXB 1ESWA 3NSMA 3N9KA 4PTWA 4QLKA 6TAAA 1GW1A 4PMOA 2C8NA 3BC9A 2BY3A 2DIEA 2WHLA 1XRVA 2HISA 1VJZA 4J3XA 2DT1A 2DT2A 2WK2A 2ZICA 5I2UA 1TE1A 1V03A 2WMGA 4P8WA 1UD8A 3VOCA 2JIWA 4TVCA 4AZIA 2YA0A 3AMGA 3PTKA 2NSXA 3ZR5A 4EAMA 3CMJA 2J47A 1X6LA 1NWSA 4D6HA 2IXVA 4JFSA 4HP5A 1XCXA 1A47A 2DT0A 1EDTA 1JZ4A 4GO9A 4DUVA 4PMZA 2WMKA 3MSDA 1BVNP 3VD7A 1KBKA 4NRRA 2OYLA 2WB5A 1MXGA 2V3DA 3ZQ9A 2WMIB 1EO5A 1CGWA 4F79A 4UOQA 3WNPA 2BVYA 1E6ZA 3K4AA 1BGAA 4ACZA 4AD2A 4RE4A 2JEQA 3TA9A 1OBAA 1JAEA 1MQQA 1BGGA 3L4XA 1J11A 1RH9A 2X09A 1US3A 3VD4A 3VIHA 4P7RA 4MDOA 4UZUA 1VAHA 3WQWA 2GK1B 3VIPA 5CQ1A 2UY2A 1QBBA 3NSNA 5BRQA 2EPMX 4PMYA 2E8ZA 2CERA 2C7FA 3WDRA 3EYPA 1EHAA 3KL5A 2WVVB 2CBVA 4AZHA 1IT0A 3OGRA 1N82A 5FKYA 3UEQA 1TCMA 1E6PA 1H41A 1XD1A 4H8HA 5IFTA 2EPKX 4JAWA 2FGZA 3RMEA 1VENA 1Q6GA 3I3BA 5E9AA 4FF5A 3VX0A 1ODUA 2YL9A 1B3ZA 1E56A 3ZJKA 2DSVA 2Y8VA 1WZLA 2EJ1A 2PC8A 1UWSA 1BHGA 1E4NA 4CU7A 3QHMA 4QAWA 2CEQA 3MUIA 3WDJA 4V2XA 3WSUA 1NOFA 1CWYA 5DFAA 4D6JA 3KE0A 4GO8A 1FFQA 3WENA 4AXNA 1XHGA 2IUZA 2ZUNA 3GBDA 4AD5A 1FHLA 1QNRA 2J7EA 2F61A 3CIVA 3CO4A 5ABFA 1UA3A 3ZO9A 4TVDA 3CH9A 1JI1A 2WYSA 2OWWA 3BSGA 3SCPA 2E8YA 1OGGA 3FN9A 4U31A 3W28A 1BAGA 2Y24A 3W82A 1US2A 4ATLA 3GXFA 1W9PA 2QHAA 1CXFA 1C7TA 3S2CA 2G41A 2ZUUA 3WUFA 1LWHA 1E0WA 3ZT6A 1VBRA 2CBUA 2A3AA 1ITXA 1WPCA 2YLAA 4CCDA 3W26A 4HU0A 2G8ZA 3GDBA 1B90A 3UESA 3NDYA 2DSZA 3AZTA 3WQ6A 1WDRA 4B3LA 3QGVA 3DHPA 5A3HA 2BY0A 1UQZA 3AXIA 5A6LA 2JALA 1OT1A 2XFFA 2ZX8A 4GINA 1R86A 5A8MA 2FHCA 1MQPA 2WMHA 1B2YA 2YA1A 1DP0A 1WDSA 2GVYA 3OLEA 1Q6FA 1GVYA 3HU7A 4P7OA 5DT5A 1GNXA 1UZ1A 4BQ3A 4OZOA 1WNOA 1WZAA 4MDPA 3RM9A 2DH3A 3N11A 3RM4A 2WCGA 2OWXA 2VO5A 1UH2A 1GJUA 1CZ1A 3VGEA 4GPNA 4Z2GA 4JHOA 1E43A 3N13A 3CUIA 5ABEA 1GORA 4HA4A 4GIAA 6CGTA 2YLLA 3POHA 2ZIDA 2BHZA 4Q7NA 4U3AA 3WN6A 4CD6A 2G3IA 3W53A 3WQ8A 1CBGA 4DWSB 4U5IA 4V28A 4WKHA 4KGJA 1C91A 4UQEA 3ZSTA 1M01A 3AZRA 2EEXA 5JBFA 1W9DM 4D6CA 2A3BA 1JDAA 1GHSA 2VZVA 4JIEA 1UR4A 1OCQA 5BXSA 1FP9A 2J74A 4QDMA 1KCKA 1JZ2A 5HPOA 5JUVA 4IPLA 2XWEA 3QHOA 5LA1A 5C8BB 4UQ9A 3BSHA 4JHZA 4B9YA 1W1VA 4M56A 4NRSA 3ALFA 3FW6A 5CPSA 5A6BA 1BQCA 1W32A 5BXTA 1C8YA 5A6MA 2VNCA 3T0BA 4UFMA 4NSBA 3BAIA 5FOOA 2WHJA 2WCAA 4AZGA 5FL1A 2VOTA 5DO8A 1SR0A 2YIHA 1BLIA 3G6MA 4QP0A 4AW7A 4FLQA 4IPNB 3VUPA 3W0KA 3WNOA 4P7NA 2FGLA 3A6OA 2ZUMA 2VCAA 1TMQA 5DEZA 3VIMA 4EANA 1V3KA 2XWDA 1PAMA 1YQ2A 5BWFA 4GKLA 5GQBA 1B1YA 4AD3A 4X0VA 2A3HA 3RM8A 1CXKA 1TZ7A 2WC4A 2DDXA 3WD1A 2GJRA 2VR4A 1DEDA 3WMSA 3NCOA 1EH9A 4JL2A 2D2OA 3M07A 1WDQA 2WKGA 2BHYA 4W84A 4ML4A 5M3WA 4CD5A 1UD3A 1CIUA 1E1EA 1GQJA 4OBSA 3OGSA 1GJWA 1HJUA 3WQVA 3T08A 5CXPA 2J75A 3ZMRA 3MUAA 2CXGA 1PIGA 3RJXA 5CLTA 5A2CA 4UOJA 4D6FA 1HJSA 1QOXA 1VEMA 3VD3A 1GPFA 4CD7A 3PN8A 4OUEA 2VJXA 2PWFA 1H0IA 5A6JA 1JZ5A 1L8NA 2RGMA 4Y7EA 2UY4A 1ISVA 1QI2A 1FHDA 3AXHA 3ZJ6A 7CGTA 2BVTA 3ARUA 5CZKA 2V3GA 3WDIA 3S6TA 5I5RA 3VU2A 3HMCA 3PTMA 3SUSA 4UQBA 1G1YA 5I23A 1UD2A 1B31A 2XFYA 4EKJA 3WEMA 1D3CA 3EDDA 1C7SA 4CKQA 3BLPX 5A8QA 1HJQA 1CXIA 2GUYA 1Z32X 2VR5A 2PWEA 2PI6A 3L4UA 3AYRA 4CN1A 4CU6A 1V6YA 3BLKA 1KWKA 1L0PA 1PEZA 2XYLA 1W9XA 3ZSSA 4H8UA 1BFNA 1VEOA 4M8UA 4W85A 5IHSA 1IZJA 1KFWA 4RL3A 4W5UA 1DWGM 2WVVA 1R7AA 3WQ4A 2V38A 4JFVA 2JEPA 2PBGA 2ZXDA 1V6VA 3AIWA 4ATDA 2J78A 3T2OA 2VRKA 4W5ZA 2VVNA 3VO0A 5AYIA 4HA3A 1BTCA 2E40A 4IUGA 3AFBA 3BCFA 2ZXBA 2XPKA 4RE2A 1QBAA 4U3CA 1R85A 5BRPA 1W3LA 3EDEA 3MS8A 2MANA 2EBNA 1V0MA 4GI8A 1BSIA 4ZE4A 3VD5A 3A3HA 3CHDA 3VD9A 2WWCA 4UOZA 1SMAA 2WMJA 5D9OA 3MSGA 1ODZA 2XUCA 3MU7A 4MAVA 2WHKA 5FCZA 1Q6CA 2AOSA 5LA2A 4BCEA 1GOKA 1PX3A 4QCFA 1GQIA 4MB4A 3VNZA 5A95A 4OOZA 1AQ0A 3DYPA 3AMDA 1FH7A 5D9MA 5D8WA 3SCSA 1W91A 3QR3A 1CLXA 1KXTA 1EHNA 5JIWA 1OGSA 4MB5A 2ZE0A 4LYPA 4HZ8A 2CKSA 3AROA 4JCLA 4OOUA 4ZEPA 3OB8A 3CHEA 4PEEA 3MUY1 2EPLX 1OM0A 1SYTA 1GQLA 2ZUTA 5EB8A 1W3HA 3VMPA 4LGXA 5JBDA 2DGAA 2WZEA 1XH0A 2QV4A 1TR1A 2OYMA 1SFSA 2J4GA 2PBOA 4BQ4A 3FNDA 1UWQA 3RPMA 4LXFA 4PRWA 3VPLA 3NIYA 1H2JA 2A3CA 3N17A 2ZX5A 4W7VA 4NZCA 4OJYA 3EMCA 1AVAA 4DWSA 4MADA 3F5KA 3M46A 5F7UA 3VIJA 1JDCA 2CETA 3VGGA 1M04A 3W27A 4W7WA 4J7RA 3CZJA 1QPKA 1UKPA 2O9PA 3AICA 1CDGA 3MUZ1 4C7GA 1JD7A 1VFUA 4GQQA 1ISXA 4PYSA 5D8ZA 2WMIA 5CLWA 4MPKA 1UQYA 4JFWA 4UFHA 1GCYA 2FDMA 1UYQA 3SCUA 2E0PA 2DSWA 3U7VA 1E5NA 1MW1A 1PX4A 2XGIA 1ZBKA 1EO7A 1W3JA 4J3SA 4HZ6A 4AISA 2XVNA 3TTQA 1UH3A 2ZOXA 5CPQA 1GVIA 2XG9A 3II1A 5A6SA 4Z2IA 2GDVA 3EDFA 3VIKA 3SCWA 4PTXA 3SURA 2YKKA 1OINA 2Q8XA 3SCTA 3B9AA 5BXRA 1U30A 3WEZA 3WBEA 4PUDA 2JF7A 4LYRA 1JYWA 2X2YA 3PZNA 3WMBA 4PMRA 1OIFA 1JFHA 1HL8A 4OBRA 4FMVA 3UETA 2BXZA 1HXJA 1FA2A 3EBVA 3GH4A 4XX6A 3L4ZA 3AHVA 2X0HA 2XGBA 1ISZA 1UWTA 2BFGA 5CSYA 4KWUA 1U33A 3AIUA 5IDIA 4IM4A 2BS9A 3BCDA 5A8OA 1B3YA 1ZB5A 3WH5A 1E40A 1JL8A 1MQRA 2OSXA 2DEPA 4UFIA 5EMYA 2HVMA 1OGBA 3ZJ7A 2CPUA 3CUHA 3BH4A 1UD6A 1RP8A 4XV0A 2DQXA 4W88A 3KWXA 2WZIA 2VT0A 3OLGA 1QI5A 3VIGA 4AIOA 5ABGA 4A3HA 1VRXA 2G3JA 3CLWA 1C90A 2F2HA 3L4VA 3WF1A 1CENA 2WNWA 3JUGA 3F4VA 3PTQA 1W1TA 4AZCA 3AQUA 1QNSA 4A3YA 4CU8A 1G94A 1D2KA 5E6YA 5A69A 2E9LA 2WVUA 4TUFA 8CGTA 1ISWA 5JBEA 4N0RA 3TONA 1OD8A 3FXYA 1E3XA 1XCWA 2DIJA 5E0CA 3MMWA 3ARPA 3BAKA 2WW5A 1E4MM 2W91A 1WAWA 3ARYA 2J77A 3AS1A 3L2MA 4PN2A 2ZXAA 1J9YA 3GNRA 3OLDA 2W66A 3TTSA 3MMUA 3A47A 1D7FA 1MW0A 3AZSA 5A8PA 1JNEA 4FLRA 1GUVA 4AWEA 3WUEA 4F9DA 3WY1A 3WD4A 5HPCA 2D1ZA 4AC1X 1C3FA 4PCTA 3SCVA 3N15A 5E70A 3U5UA 3VKKA 3VGFA 2J7DA 2OLHA 3K8LA 4RE3A 4PTMA 1E1FA 4E2OA 2QPUA 1CGVA 4ZFMA 3K8MA 2D0GA 3GXMA 1W3KA 2GDUA 4W8BA 2D0FA 1W1PA 1WE5A 1JYNA 3B8SA 4U2YA 2JFEX 3SCRA 1WZKA 3PZIA 1V3JA 2BVDA 2WZHA 1QVBA 1R7OA 3T2QA 1FOBA 4HOWA 1MXDA 3VINA 1MFUA 3K46A 1GONA 4BQ5A 4MAZA 5GNZA 1CNVA 3L2LA 1H3GA 4AIEA 2CYGA 1JFXA 2NT0A 3ECQA 1BG4A 1WO2A 3VIFA 3WBAA 3A4XA 1LG1A 4AD4A 2W63A 3WNMA 5ABHA 5A2BA
chains in the Genus database with same CATH superfamily
1W0MA 3OBEA 2OEMA 4YWIA 4HGXA 2VWTA 4J9JA 1E0UA 1K1DA 4D9PA 1E5JA 1M53A 9CGTA 3B97A 3P3BA 4S3BA 3E0WA 1ICQA 4PMNA 4UQCA 4FO4A 4M29A 2YOCA 2X1RA 1EC9A 1H7XA 3STPA 3OJGA 3ABSA 3EOEA 2C1HA 5MHBA 1E73M 3C0QA 5FJPA 3T55A 1MNZA 3RCYA 4IP4A 2B31A 3VDBA 4Q8NA 5D9NA 1KFEA 4M6UA 4C5ZA 4JFTA 1SZGA 1I6NA 4HSOA 3LD5A 5M2FX 2VL4A 4GUJA 2IQ0A 1JZ3A 4Y9AA 3RN6A 1J10A 3QH2A 5HOSA 2PDBA 4KS0A 3EKLA 1MFVA 2XTKA 4Z2KA 1HJWA 3VNJA 4C65A 1E4LA 3CZGA 3DX5A 3ARZA 3ARRA 2WVTA 1FCQA 1SO3A 1O7AA 5LIUX 4NG3A 1TV3A 1V0LA 5TF0A 3GVVA 5C2XA 2GQAA 1FWCC 2C79A 4BA0A 1XH2A 3D3AA 2BASA 4H04A 4C6FA 2RGLA 3GYCA 4MHBA 5AN7A 3F2CA 4YVVA 1UJPA 1OFEA 1KXQA 1MZHA 1UWIA 3VABA 1W5NA 4RDWA 3QOMA 3SUTA 3VIIA 1F3EA 2XVPA 5A94A 1ZJIA 1SZRA 3AU2A 1R3TA 1V8EA 4CVUA 1OSEA 2ZVRA 5HWNA 2H8XA 2CWXA 2R1PA 1VFMA 4LVAA 2R82A 2WJZA 2CLMA 2GJNA 1UG6A 3TE9A 3WQDA 1Y8BA 5I77A 4PL2A 2GK1A 4V27A 4PB5A 1XPYA 5HQMA 4AHPA 3ZLFA 4LNYA 4AMCA 3H24A 1Z41A 5ECVA 3S1VA 2W92A 3PZGA 4QX4A 1VCVA 1KCLA 3CK5A 5CZSA 1Q2SA 2P3ZA 4WLCA 3HGJA 3K1GA 1FVPA 3KBNA 4RDVA 3VA8A 4HNVA 3G0XA 4P7QA 1W8SA 4IGNA 1OYAA 4C6JA 4JZ5A 1T7LA 3B8TA 1JCXA 3S1WA 2GZXA 4LJ3A 1CX9A 2QIWA 1FDZA 5TD4A 1IEIA 4HNOA 5D38A 2VCCA 3M16A 3CUFA 1UP0A 1EJVC 3OIXA 3SCNA 4N4QA 2VZOA 1V3IA 3IK4A 4GFIA 1MW3A 3DU0A 4NJHA 3WFZA 4ZO8A 4CD4A 4EK7A 5AZ0A 1DL3A 1PZ3A 5DXXA 3W87A 1KBBA 4LUTB 4MYAA 1GOQA 5A8NA 1HP5A 3W4RA 2ZA2A 2NQ9A 4JYDA 1W6TA 1P6BA 5AC8A 3PNUA 3SY5A 4UBPC 4Q3MA 1A5BA 4GRSA 4KBXA 3VKJA 2OCZA 3AHXA 1FWSA 2V5DA 1XWYA 3KP0A 2YZ5A 1H5VA 5HAOA 1VJIA 5D05A 3W38A 1OABA 1P7TB 4LPCA 1LTDA 4FA3A 1F5ZA 3CGTA 4LYKA 5KETA 1Q7MA 2F6UA 3VM5A 1TPC1 2XH4A 3V3WA 4A2SA 4CVWA 1EXBA 4PRTA 1A0EA 2WANA 1UZHA 2J27A 4LVGA 3CIWA 2Y63A 3AHTA 1HVQA 3CZ8A 3KBMA 2X05A 1XLFA 1MRQA 4UQAA 1YPFA 4NIRA 2C14A 4IQDA 1JUBA 3LOTA 4JTSA 3IUDA 2WC7A 3G1FA 2VX4A 1GG1A 4XZWA 2PDMA 5GNYA 4DBSA 3EB2A 3LENA 1M41A 4O19A 3D3FA 2VX5A 5A6KA 3WMCA 4IT1A 3IIZA 2VEMA 4ZFCA 2OMAA 1EJRC 1UD4A 2Y8UA 1T0OA 1UB3A 2OSWA 2V9DA 4MKVA 1POKA 2OLSA 2WC3A 5CG7A 3PBVA 3GH5A 3DH7A 1PL9A 2VCBA 2Z27A 1E71M 1WYIA 2PLMA 3QV9A 2JKAA 4C7FA 1QNPA 2C91A 3IGSA 5CPTA 2BXYA 1UBSA 1OADA 2QF7A 3VGBA 2ODOA 3IIXA 3NWRA 4HOXA 3V7PA 4ZBCA 2AMXA 1U5HA 1LBMA 1XSJA 3SGZA 2HK1A 5KMYA 2CLPA 4IGSA 3TCEA 1H62A 2WPBA 1W8GA 5CZ0A 3AOFA 4N9BA 1L6WA 4MJZA 4E8CA 1H1NA 4NZJA 1KKRA 4O57A 2E4TA 3GDMA 1YADA 3GO2A 1MO0A 3NG3A 1EGVA 3MSYA 4M6VA 3NQGA 3WLPA 5T91A 5KSWA 1FWDC 3TTOA 2X1IA 2H3BA 1GZGA 1LG2A 2INEA 3R0DA 3HFYA 1P1XA 4MMWA 2DQWA 2A4AA 3BGAA 3DFQA 3ZZ1A 1TB3A 3W2NA 1NWUA 3CWHA 4MTVA 4MZYA 1BRLA 2H9AB 3CB3A 2WBKA 2A3LA 3EWYA 4D8AA 4H9MA 4DYJA 1V3LA 1HKMA 1DQUA 3OODA 1ME7A 4DUXA 2D3NA 4MNJA 2UWFA 1MDLA 2ZRXA 3W7DA 3M5YA 1O6IA 5C6MA 5AYBA 1PJ9A 3AALA 4ZO7A 3NQ8A 4M24A 4MIMA 4B5XA 1NWRA 1PBGA 2A5HA 3CXOA 4GI6A 1QHPA 2GSJA 3B06A 4HMEA 1V3HA 2XVLA 2OX1A 2O9RA 2Z1SA 3NQEA 3OVRA 1TPB1 4LQ1A 1XC6A 1KWGA 1GZJA 3G8RA 1QPOA 1VFHA 3WYZA 5MKGB 5DF0A 3THCA 5FJIA 2QJIA 3U2OA 1UUQA 3TJXA 2QMKA 4EXBA 1W54A 1JR1A 3F4WA 2YJQA 2WJFA 1KGUA 4LH8A 4QJ3B 4TX9A 3NZQA 4KGLA 2QVNA 4PMUA 1VLIA 1EEPA 1JG9A 4ZB5A 3STGA 3W29A 1F4AA 3CYJA 1RXOB 2RDUA 2FPVA 3ZT7A 4NVTA 3MP4A 4MWAE 4PCSA 1F3WA 2J7FA 4XAGA 1DXIA 1PIFA 3MO4A 1YLVA 1HQTA 5F1UA 1BXBA 3K8KA 1GYLA 1A5OC 3OO2A 4LUSB 4R85A 4LTSA 1HX0A 4B9ZA 2Z6JA 1SZEA 1U5JA 4F0SA 2PDNA 4IFKB 1WQ5A 4GMEA 3H7VA 4EPEC 4JIRA 3T42A 1CXLA 1P43A 3OOQA 5DCBA 3W7JA 4QHRA 3CUGA 5FIPA 1IF2A 3RLUA 1R3WA 1WZMA 1FWHC 5HINA 2W67A 1JCYA 3MKVA 1MZRA 1WXYA 2PD9A 1Q4NX 1TO3A 4IQJA 4WKAA 3IVSA 3VGHA 4JFUA 3SADA 4AIBA 3VAVA 1TRIA 1DJXA 2OEJA 2HE5A 3UR7A 3MP3A 1RSCA 3EDKA 1ZHAA 3PZMA 2J8FA 1H11A 2DUAA 2J7HA 4Q6XA 4REQA 3MVTA 3C3NA 3RXZA 4W7UA 4UC5A 1OEPA 4CGTA 4DB7A 3GLCA 3MV11 2GJXA 2PDUA 4RW5A 1EPVA 4A8LA 2QEZA 2Z1KA 4JY9A 4CQDA 1XR2A 3B8DA 4UFLA 5JH1A 1X97A 2YFNA 3MC5A 2V3EA 4HA1A 2PWVA 4LCQA 3ARWA 2A6NA 5BOEA 1FKXA 1CGXA 3T8QA 4F9JA 3LXCA 3EWWA 4ICNA 2AQOA 3B9EA 3OVPA 2E5CA 3UPBA 1EP3A 2Y7DA 2BDQA 1OC7A 2FJUB 3BV4A 5HMSA 1QOQA 2CNCA 1J12A 4G56A 3N73A 3CHCA 3NO3A 4RZ5A 1I1XA 4YTQA 1FY6A 3A12A 4HSHA 1WDPA 3EEGA 4ACZB 4GCXA 3TXZA 2DJXA 4IP7A 3GZ3A 5G2HA 3W76A 2JIEA 1PE1A 3RF9A 5C9XA 1HJVA 1UKOA 1RAKA 5T9BG 1KNWA 5CPMA 2XSAA 4PUUA 3HJEA 4HJWA 2CBIA 2PU1A 1BSLA 4BWLC 3JVAA 4R9OA 2VR2A 4WQ6A 4UMAA 1J6OA 4KCWA 2GGEA 3PZ9A 2V81A 1RP9A 1CGYA 1LL4A 4LS1A 3RILA 1RBLA 1A3HA 4TMCA 4LY4A 2CLEA 3UNTA 1UH4A 2J62A 2Y1HA 2VFFA 1F3TA 1NOWA 4MFEA 2VKZG 4JTJA 1WP6A 3M5XA 4FPSA 4GG9A 1VBUA 3LPPA 4D71A 2E6YA 2HSAA 3BLEA 4XKYA 5M03A 5HK4A 4RR4A 1A5MC 3M9YA 1BTMA 4FOUA 3KXQA 4IGMA 4FSAA 3FDGA 1ZBVA 1GKPA 5LA0A 1CGUA 3A9BA 1VP5A 1JQXA 3OHIA 1TG7A 1GGOA 1H09A 1UWUA 4XK2A 2DORA 1QRQA 5I3FA 6PTDA 4JHMA 1X7IA 2EKCA 1JDDA 5FI8A 4X60A 3WLRA 1QNVA 3UR8A 4GVIA 3BAYA 1J2BA 1LF1A 1K9DA 2WZMA 3WLTA 5HMEA 2HXTA 3B9DA 4PULA 3UVAA 3SCOA 3F03K 4I8YA 4R5EA 2QAPA 3L5LA 4JS3A 3H6OA 1N8FA 2GUBA 2UY3A 3DENA 3HG4A 2V2CA 1K8CA 1W9VA 4UCFA 2VRQA 3SUUA 1W1YA 1V08A 1B57A 3T40A 4DZAA 4B5NA 2XIIA 3AMKA 2QUMA 3UD6A 1OFDA 2CLHA 2LLEA 4Y9PA 1K9FA 1MDRA 4DUOA 1C8QA 5DRIA 1LP6A 1NQ6A 3WH8A 4J3ZA 2PLJA 4XWUA 4AY7A 1S2CA 5I7GA 1A49A 4ZXOA 3BW4A 2X2GA 2J7BA 2ATSA 1BKHA 3R10A 4FHAA 3BK0A 1R0MA 1RCXB 1J0JA 1YE6A 4M81A 3PSWA 2WHMA 5TNVA 3KLKA 3UERA 3N18A 3W7OA 2CZVA 3AIVA 1E6NA 3L4YA 1EIXA 3S9ZA 3GVGA 3C5QA 1UW9A 1NEYA 5CGTA 4GJIA 4XBKA 1VF8A 1QNOA 1XGDA 1J5TA 2VC6A 1E6RA 4S3GA 4TOQA 1SM9A 1W5MA 2F6XA 5FESA 3R13A 3U57A 3BTNA 1QDSA 4GYPA 3SB0A 1R9ZA 5JQ9A 3T2PA 1JD9A 3R1ZA 2YA2A 3DBPA 4MNMA 5AHNA 2J7CA 2GJLA 3REQB 5G2WA 1KW1A 4LNCA 4QBXA 2VGIA 2GJXB 2VENA 4JX5A 5HUOA 7ENLA 6TAAA 2XZ9A 2C19A 3BC9A 1PIIA 2BY3A 2DIEA 3W1NA 3USZA 3EGJA 1VJZA 4J3XA 4ERIA 2P76A 2ZICA 5I2UA 3GG0A 4L7ZA 4HK6A 3U9IA 1HUVA 2NV9A 3ISIX 4AZIA 2YA0A 3PUEA 3FVDA 2NSXA 3CMJA 4Q32A 3I68A 1X6LA 1NWSA 3PPFA 1TX2A 4JQ1A 5E0KA 5C7VA 3CO8A 1U22A 4LUTA 1P48A 1BVNP 3EXRA 2OYLA 4OWGA 4JPGA 3KRZA 1CGWA 5AYYA 3WNPA 1BGAA 2Y89A 5DXYA 2O4QA 3T0CA 3BG5A 1MQQA 3ENLA 3T07A 4A3RA 1BGGA 2BOFX 1J11A 3B9NA 4IPPA 1U1JA 3DFPA 2V82A 2OOGA 1VFLA 2GK1B 4ZOEA 3PUGA 2UY2A 1R3YA 1QBBA 3PG9A 3APYA 5LIYX 2E09A 4HK7A 1K7FA 5BW6A 3KL5A 2CBVA 3WK3A 5FKYA 1N82A 1Q6LA 1TCMA 5SWUA 4H8HA 2FZ9A 5G1YA 2ZCGA 4BI5A 3RMEA 5E9AA 3PBYA 1ODUA 2G97A 1E56A 2DSVA 3PM6A 1WZLA 4D2JA 4E0CA 2EJ1A 4Z1AA 3MYPA 3NPXA 1E4NA 4UTUA 1Q85A 3NO1A 3MUIA 4V2XA 1PDZA 5F2LA 4GY1A 2R1NA 2Q8LA 2J9XA 4KWVA 3VCNA 2CLFA 2ZA3A 1XHGA 3V36A 1FWBC 1OG0A 4GCAA 2ZUNA 1VYRA 1A4LA 4M19A 1BXCA 3LDVA 4F2UA 2J7EA 2F61A 4H2HA 2Z25A 3CH9A 1JI1A 2PDFA 3DGBA 5JXQA 3W1LA 2H90A 3QC3A 4RXFA 3E49A 3VDGA 4JTDA 3MZNA 3GXFA 1W9PA 2V30A 4XZMX 2G41A 1TYGA 3NQFA 2ZUUA 5FSDC 2INFA 3WUFA 1LWHA 1E0WA 5CJNA 3ZT6A 2CBUA 4L1GA 2B7OA 4HU0A 4QISA 4Q6JA 1NFGA 3I7SA 4HHMA 3QBUA 2XIJA 1LBLA 2OGYA 3DHPA 2BY0A 4BK9A 3MDWA 2POZA 4S2CA 3B05A 3VNKA 4WZHA 1FCUA 5LIKX 4GINA 3S6DA 3DBNA 3GSMA 3N25A 2WMHA 2YPIA 4YMZA 1KC7A 3OLEA 1Q6FA 4UWMA 4H6RA 4BQ3A 1WNOA 3BOFA 2OWXA 4JNMA 3PNZA 1UH2A 4O1BA 1GJUA 2V8ZA 5D2YA 3IGHX 1JQVA 4GACA 1CZ1A 4ZQNA 4Z2GA 3OQEA 1TTIA 1OFQA 1XG3A 2BHZA 3QC0A 4QG9A 2BVWA 4CD6A 2G3IA 3UR2A 4LAOA 1CBGA 3W84A 4DWSB 4H01A 4WKHA 3LCWA 3P5YA 4UQEA 3ZSTA 1Y5VA 3E96A 3VE7A 4GK8A 2OX4A 2WJDA 3EXTA 1W9DM 1BWVA 3CL7A 3V1PA 5LGZA 4JIEA 1OCQA 5BXSA 4LV4A 5F4WA 4GUIA 2J74A 1BRLB 4QM1A 1XDJA 1JZ2A 1QJWA 2V2DA 4CQ9A 1OVDA 4KFOA 1EYWA 4F0HA 1M68A 4WOQA 5EGRA 1NF0A 3NXLA 4US5A 4B9YA 4M56A 1A5KC 2BGQA 2D2GA 4XD5A 5CPSA 1BQCA 4FIRA 3TV8A 4O12A 5A6MA 1XRSA 4GVHA 4GZ7A 4DPQA 4HJFA 1SFJA 1Z44A 3LYEA 3ITGA 4MVAA 1S5NA 3S9IA 2D2HA 5FL1A 4QEEA 4HU3A 1BLIA 4IPNB 4UTHA 4X22A 2AL2B 2NLIA 4IZGA 5BRBA 2VCAA 3VIMA 1OZQA 4GKLA 5GQBA 4X0VA 1TZ7A 2WC4A 4L1WA 2DDXA 2UV8G 3GHTA 2GJRA 4QE4A 3KTSA 1XCFA 3SRHA 3WQGA 2D2OA 5H8UA 3F7JA 4OFCA 1XUUA 4DELA 2R6OA 5DN1A 4GKTA 3OGSA 1KFJA 5ABTA 5LGXA 3MUAA 3LGGA 3KVMA 5BMWA 5LXEA 1XIMA 3TN6A 3TMLA 3PN8A 4OUEA 2XIOA 1H0IA 4A22A 5BOFA 5FJOA 1JZ5A 3TFCA 1ITUA 4Y7EA 1NDZA 1US0A 3AXHA 1T41A 4R9XA 4QGCA 1O5KA 2V3GA 1D3HA 3ORWA 3KCOA 1OX4B 3VU2A 1W1IE 3PTMA 3EWDA 2BBFA 4N2YA 5HULA 3QTGA 4ADUA 1B31A 4LFYA 2QW5A 4L6DA 3WEMA 1D3CA 5G1TA 4C6CA 1CXIA 2GUYA 5EMUA 1Z32X 1ML1A 2VFGA 5A8GA 3BCJA 5DY2A 3P14A 1V6YA 4CU6A 1KWKA 4DRSA 5KZDA 4M8UA 5IHSA 1IZJA 3LM7A 2E68A 4UR7A 1EF3A 1KFWA 1Y65A 3R5EA 1TPVA 3WQ4A 2V38A 2Y7FA 3U48A 1IT7A 4XO6A 2VVNA 1BTCA 2E40A 4OV9A 4QRNA 4C6NA 4RE2A 3C2FA 3APTA 3TYZA 4C6LA 4XISA 5BRPA 1W3LA 2GVEA 4YCPA 5CSSA 4E3VA 2MANA 3THQA 4XSLA 1NFPA 1VZWA 2PA6A 1BVWA 4MGGA 2WMJA 5D9OA 2NXHA 3MSGA 2GQ9A 3M43A 3MU7A 5BMXA 5T8GA 1W5OA 4DNMA 3W1PA 1ZY9A 3G1XA 1I0DA 1EA0A 1JCMP 1PYMA 1FH7A 5D9MA 2W79A 5D8WA 3D6NA 3ZWSA 4NX0A 3SCSA 3UYIA 2RUSA 3UZJA 3QR3A 5JIWA 3FS2A 3GHRA 1FKWA 4M51A 3GD6A 4BI7A 4XKYB 1VQTA 4Y9NA 1W31A 4ZEPA 3PJTA 3IV3A 1TVLA 3G1VA 1ONEA 3MUY1 2ZUTA 2CC0A 2A6LA 3UBPC 1AW1A 3VMPA 3KAOA 4G5DA 1TWSA 2WZEA 1Q6RA 4GA8A 4IFRA 4JQ3A 4BKNA 1UWQA 3RPMA 1V5XA 5H1WA 3VPLA 3TSMA 3NIYA 5D2TA 3S47A 4W7VA 3GG1A 4OJYA 5HNRA 3EMCA 3O63A 2BSLA 4DWSA 3TQPA 4XO7A 4PCFA 3M46A 1DE5A 3CV6A 5F7UA 4LUYA 1JDCA 3LCLA 3MJYA 5EMJA 3W73A 4NP7A 2J9YA 3H2FA 4J7RA 1XL9A 2PPGA 1RK6A 1QPKA 3SAZA 2Y5SA 2IKGA 3AICA 3EOOA 2VEFA 1CDGA 3L5AA 5BOOA 3MUZ1 4C7GA 1JD7A 3NL6A 4PYSA 5D8ZA 3PAOA 3P8IA 3IRDA 3C8NA 2FDMA 4NILA 2E0PA 2DSWA 1PV8A 3A21A 1MW1A 1PX4A 2QS8A 2XGIA 1XI3A 3SFWA 3M0LA 4HVXA 4M6PA 1LBFA 3TTQA 4KRZA 3II1A 5LKYA 4M0XA 3GRIA 4GIEA 2OG9A 1R2RA 4MWAA 1TREA 3VZZA 1AD4A 5HJXA 3SFKA 4PUDA 4US6A 3PZNA 2ISSA 4NXKA 3CV7A 4MJMA 3TR9A 3B0UX 1M7PA 3VE9A 5XIMA 2PDYA 1HXJA 4CEUC 4E2BA 3L4ZA 3AHVA 4E38A 1UWTA 5CSYA 1ZRQA 5IDIA 4IM4A 1TTQA 1A5SA 3FV9A 2J6XA 2Y6ZA 2E1DA 2VDHA 4UXDA 3JZEA 3C2EA 2ZRVA 1WBHA 5EMLA 2DEPA 1IIGA 4UMBA 2EGZA 2FQIA 2IS7A 3ZJ7A 3REQA 3WLIA 3IVTA 4S3DA 1ME9A 3ZFHA 2VT0A 4BJHA 1G4TA 3VIGA 4AIOA 5ABGA 3GNDA 3CLWA 3H4XA 1C90A 2Z26A 4RNHA 4PMJA 4LAKA 3AQUA 1TJ1A 1AODA 3C52A 2ZFAA 3QZEA 3EPOA 4IX2A 2WVUA 4TUFA 2W6RA 1E9YB 1ISWA 2RJHA 3MCOA 5LIWX 4WUIA 3RNDA 3B0XA 4LBSA 1Q5MA 3WQEA 1P1MA 4RXGA 3DC8A 3ARPA 1YXYA 3ARYA 2D73A 3H54A 3GNRA 3OLDA 4ZOAA 3MMUA 5A8PA 1JNEA 3W71A 2GWGA 3WD4A 5HPCA 1D7KA 1OCJA 3N15A 4S3FA 4HCHA 1GQNA 3VKKA 3WLLA 3UY7A 2DY3A 3V35A 1UPPA 4NYYA 3VKBA 4FX8A 1E1FA 5KITA 1CGVA 2G4JA 4HNCA 4ZFMA 3WJZA 3K8MA 3GXMA 3P8JA 1VBHA 2D0FA 1GYNA 2OOFA 1QTWA 3W23A 2H3DA 3LCGA 2BVDA 3C4UA 3VINA 3GR4A 2XDFA 1GONA 4NYUA 3BG9A 1K4HA 3DKJA 4BQ5A 4MAZA 4F40A 4DXVA 1F73A 1PTDA 4AIEA 3STCA 4NZ3A 2PTWA 2H6RA 4LWWA 4PA8A 4DJFC 2W63A 3KW3A 2HNHA 1XIDA 4YS1A 1J96A 4F3HA 5AHMA 3ZT5A 4LVFA 3OZMA 2CCRA 3D5HA 2IQDA 3BXWA 1B0IA 3JW7A 3OIHA 2I17A 3H2NA 3M0HA 5IXEA 4WRHA 4QJ1A 4HNTA 4MZ8A 3NQAA 3SUWA 3FIGA 4LUIA 4YU1A 4O10A 4DUWA 2PS2A 1UC4A 4LRTA 1KQYA 2Y70A 2J79A 4O0ZA 1KV8A 3KL0A 1EJUC 3UG3A 4Y90A 2AAMA 5FL0A 1LJYA 2VEIA 4WY0A 3WZ0E 3VMNA 4POCA 3PZQA 3B4YA 2Z2AA 5JU6A 4DQWA 3AXKA 1YYAA 5K4XA 3ZXWA 4IPJA 1XIBA 4TO8A 1UIPA 7TAAA 3MP5A 3S5YA 3ITTA 3WIJA 4GQRA 4ZTXA 1E0XA 3WF4A 4JCMA 1QHZA 1A5NC 4IJBA 1KGWA 1LQ0A 2ZWYA 3EOSA 2YFOA 1F6PA 4DWSD 2QUUA 4UTLA 4RZ4A 2P53A 4E3TA 3WMLA 2DH2A 4NAFA 1RPXA 1W1A1 2C1IA 1ZAHA 3LLFA 4N4PA 5AVHA 3AISA 1JPDX 2RH9A 5IHRA 2Y4SA 3GG8A 3E12A 2WXDM 1N8IA 3O2LA 4LUJA 1W3NA 3GNXA 4KW2A 2I16A 2Y88A 1AQHA 4W86A 1EDQA 1GVFA 3GFZA 3PF3A 4QROA 3PR2A 2WNNA 2R14A 3ES8A 3VMOA 3H8AA 5ECUA 3F5JA 2QPSA 5D32A 2BNJA 3S3GA 1UBPC 3UG5A 3IVUA 4J27A 2GOUA 1ZBCA 4MB1A 4H4IA 2B7NA 1QXLA 1O66A 2GL5A 3NL5A 5CZTA 4O11A 2YR1A 2PTYA 4O15A 4PH6A 4AX7A 2EXOA 2A3EA 8XIMA 3BDKA 2VP8A 3G5EA 4QTGA 4F0MA 3N34A 1JDFA 4WDXA 3FA4A 1RK5A 3QTPA 1SVDA 1I75A 3LN3A 1XBXA 2B81A 1DVJA 3SQLA 4BY3A 1QHOA 4AX6A 2FZBA 3TKFA 4H6QA 4LB3A 2UBPC 3CHFA 1LZOA 3WUGA 1A4MA 1X1NA 3HGRA 4R33A 3C2OA 4A4AA 1TELA 2DZUA 3PTDA 3G18A 2VRJA 4FNUA 3IACA 3QMSA 4JKLA 3SSZA 3CC1A 5CBBA 4XSMA 4D1IA 1IWAA 4QS5A 1W2PA 1Q6EA 1ICSA 1XLLA 3ZIZA 2QZRA 4IFKA 1RUSA 2VQUA 3AS0A 3VX1A 1Q8JA 1UCWA 4LBRA 1UKQA 1ZU8A 2DT3A 4LANA 1NP0A 3CAWA 3T9PA 4AZ7A 1KFBA 2PAJA 2HK0A 3AXXA 3O1NA 4E8GA 1Q2RA 1LQAA 2GOKA 3U8GA 2PDKA 3P61A 3KFTA 4AEFA 3TZFA 3BPWA 1KQZA 3LTYA 3L65A 2NZLA 3OHMB 2OXNA 3AWNA 1JNDA 3KBVA 1M03A 4REQB 3H4WA 2VC5A 2E5DA 3VDHA 4X3ZA 1X39A 2ISDA 3URAA 2VEKA 5HBFA 3AIQA 1O5RA 1AMKA 4JYFA 2GWNA 3VDAA 3ATZA 3WQOA 4YTTA 4YYCA 3ABOA 1TWZA 2W61A 3HFTA 4EXAA 3GXPA 1LWJA 2L5HA 2DU2A 3HIJA 3PS7A 3PP7A 1V6TA 1GQKA 3LGDA 1I2QA 1YDYA 2NWRA 5D4YA 1XYMA 1WB0A 2Y8KA 2PGWA 4FP1A 2E9BA 2X41A 1RY8A 2JK2A 2HDJA 5G4WA 4IIGA 3GX9A 5EU9A 2OTDA 5FJUA 1TIMA 4ECLA 1JPKA 3L5MA 3RCMA 4L64A 3KBWA 4D6EA 2ALRA 3FK4A 3GVRA 3J7HA 1YNPA 3HPFA 1XGZA 3M41A 1LOSA 1IEVA 1WCGA 1F61A 4GUHA 1HNYA 5EFFA 3O9NA 1NFBA 4UFKA 1TPEA 4AY1A 3B03A 3LCXA 1KRCC 4A8NA 2Y5EA 1PCKA 1XLBA 5I3KA 4QFUA 1S2AA 3A4JA 3RR1A 3T0DA 3NPUA 3EWUA 4E8DA 2Q6ZA 2Q3RA 2WSYA 3PJWA 4M5PA 3KHDA 2QCNA 4LCSA 3VZXA 1AQMA 5I0DA 5DBTA 3NL3A 1NSJA 4H8VA 4J28A 3UG4A 2P50A 3GR8A 1XLAA 2CZDA 1A5AA 4UR8A 3BLFA 2DZTA 1BEUA 1O12A 1R3VA 1CXHA 3N19B 1CYGA 3URNA 1O5QA 3T44A 4O0KA 1EDGA 3KVKA 5E09A 1QI0A 3GU2A 2NW0A 4MY8A 3XIMA 5HATA 1ZBWA 2O4MA 3BO9A 3GIYA 4QSHA 1PX8A 1KFCA 2ZZ1A 2I57A 4YTSA 3TW7A 4DO7A 2FPTA 3BSMA 3WLKX 4DI9A 3GS6A 2FTYA 3VKCA 5I24A 2SFPA 3NZPA 1TRDA 3G3MA 4AZCB 5D2VA 1YIXA 1B3XA 4J4KA 3MWCA 3R89A 5DANA 4TVUA 2R24A 4QLLA 4DAIA 1VHCA 1A50A 2PDXA 1J18A 4C6QA 2OWCA 1EXPA 1NARA 2BZNA 4AIUA 2VHLA 2IQTA 4NAEA 4DJDD 4E4FA 5IFPA 4GX9A 9RUBA 4KT2A 4UUIA 4YTUA 4PB3A 3MB9A 5I6SA 2FB3A 1W9BM 3ZVIA 5F1VA 1OX5A 3S2JA 2VWSA 1HKJA 4PUEA 1K8ZA 4DM2A 5FA5A 3GY1A 3O8AA 1UD5A 1KB3A 1KBJA 3L21A 4QR6A 3RLVA 1ENUA 3GDTA 3A4WA 1XYLA 3U0HA 3PBWA 4FLOA 1K8YA 4P5UA 3NDOA 4KPLA 3VIOA 3BLOA 3A5VA 2FVMA 3DYMA 1ITCA 3QYSA 5A6BD 1S2VA 4XD3A 3UU0A 5E5CA 1EF2A 3TK7A 3V5FA 3SIMA 5FSEC 5KTLA 3RO6A 4L4OA 3FKRA 2A0NA 4JIQA 2JGYA 5AVNA 3W7RA 4Y2WA 3U2EA 3WH9A 3JR2A 2ATMA 2YCEA 1JJKA 4IX0A 1AG1O 2CBJA 3ARVA 4GBUA 4J3WA 3W37A 3WUBA 1FWIC 4Q8VA 4J3TA 4R3UA 3WF0A 1GW9A 5JIPA 2AMGA 3SRDA 4I5UA 3T81A 2G95A 1R2TA 1IV8A 3AMLA 3G1HA 1FWRA 1Z89A 1HKIA 1LOQA 2PUZA 3L9CA 3W6MA 3QGKC 4AEEA 3OG3A 3N3TA 3OW1A 4DJFA 3ABZA 3K4WA 1C93A 3MDUA 4MWAB 4K7YA 3GXDA 1XG4A 4LVDA 1REQB 4NZ5A 4DVOA 3FY1A 3RUBL 3TJIA 4OVXA 1DJQA 3VXGA 3CUZA 4MB3A 4Z2HA 3FEQA 5H8MA 1J79A 3BVJA 2OKTA 3RRXA 3BAXA 4G1KA 2TAAA 2PC4A 1TVPA 3K1DA 2O56A 3M0ZA 4DXKA 4BQ2A 1NM9A 3KDNA 4H2CA 1IXNA 3NO5A 4JN7A 1FH9A 3KL3A 3CT7A 4F0LA 1FWAC 3QSRA 3INPA 3CJPA 4WF7A 1S1RA 1M9HA 3KZSA 1BXNA 5HMDA 3SIZA 2Y2WA 4HB7A 2YDSA 4UTKA 1TMHA 2O92A 2TRSA 3EPNA 1KBIA 4I9MA 3QW3A 1AW2A 1DJNA 2PWUA 3Q94A 4PUMA 2EF9A 1NVMA 2QUNA 1G0CA 4D72A 3N6JA 1XPGA 5EBUA 1B3VA 3ZJ8A 3UJSA 4ZGYA 3CZKA 1XICA 4ZOBA 3GHSA 2D3LA 5LNRA 2YZRA 3M5ZA 4JIIX 2VZUA 2QLYA 1EYEA 3NQ7A 5CGMA 4M6QA 3QPYA 1Q63A 1PZ2A 2DZXA 1RPKA 1U2YA 4W4QA 4TXEA 5K4ZA 4DY1A 3PBUA 1I2PA 3ITVA 1O95A 3G77A 5JVLA 1UR9A 5M17A 1TUXA 1SJAA 2WLYA 4EWJA 4J3VA 1S2WA 3CZEA 1EUAA 3UCCA 4BEQA 3QPZA 5ABFB 5D33A 4GLEA 2YDQA 5A1AA 2XM2A 1DJZA 1FWWA 5HXMA 4B4FA 4IWWA 2OODA 1UMLA 4AFYA 2ACQA 2WAGA 5EMMA 3R58A 3SUVA 1ECEA 2GQ8A 5EBAA 3ALGA 3I3EA 3QN3A 4WY0B 2A7NA 1TV4A 2YGYA 1EEXA 5CKSA 7A3HA 2OGJA 1RQEA 3WD3A 3KOWA 4N9CA 4MFDA 3LHWA 1NP2A 2EG6A 1H7NA 1LYXA 3AHYA 1EPXA 4RZ6A 2ZZ3A 1DWFM 4NJJA 3DESA 1M65A 1FWFC 7XIMA 5AYZA 3MV01 4YTRA 3L12A 1OK6A 4TV6A 2GDQA 2YB1A 4H7VA 5I03A 1XSIA 3GYEA 2Q71A 5B80A 1JYVA 4PBFA 4BF9A 4C7DA 5BCAA 4KKXA 1EA9C 1B3OA 3UPWA 2AQWA 1DWHM 5AC4A 1B3WA 1J8VA 2WJEA 4HTBA 1V3MA 4PTNA 2EG8A 4XUYA 3GNPA 4A3UA 1ZS2A 3UG8A 2VGGA 2PRLA 4GX8A 2DW7A 1A3WA 3WO8A 3CAKA 4L6HA 4UTWA 4S3JA 4UIOA 4D6GA 4CQCA 2PZ0A 3S46A 5BROA 4JR5A 5DCEA 2ASHA 3AUOA 3FVMA 2ISVA 3LI0A 1SZFA 2Z00A 4NJIA 2VUYA 1DJHA 3BL3A 1VS1A 1XIGA 2G4FA 3ZR6A 4QLJA 5HWJA 2V3FA 2FPYA 2IPGA 3WCZA 1DIOA 3CM4A 3QQWA 1EP1A 4H41A 1R38A 3WDQA 3R8GA 1KR0A 3POCA 3BWWA 2PWDA 2QJJA 4O0QA 3W81A 2JGQA 4P8VA 3KM8A 3KUMA 1D8WA 1ZJAA 2ALDA 2NV2A 3S5OA 1C8VA 4IH3A 5C9UA 2F38A 4FXSA 4GOAA 1H49A 4D6IA 1IYXA 1SQ7A 5K9XA 3GM8A 3UGRA 3BMVA 3GDLA 3CHVA 1UR2A 4AWSA 2PP3A 4PMDA 5LHFA 4F2BA 3MO7A 3ZM8A 3M0MA 4A3QA 4AVFA 1LM1A 2R91A 2V5BA 1KLYA 1FP8A 4QSFA 3IIPA 4DLFA 3IK2A 1VFFA 1ESWA 3KZPA 4N9EA 3N9KA 4QLKA 4DWDA 1GW1A 2RDXA 1V93A 4PMOA 2C8NA 1HGWA 2OO0A 2WHLA 3G0UA 5HQLA 2TSYA 4FNRA 4O50A 3OU8A 4C6KA 2IKIA 1AH0A 4P8WA 2VELA 3PULA 2JIWA 1DPMA 3PTKA 4GQ0A 3QZAA 3ZR5A 1XLCA 1ZCOA 1VBJA 3QLDA 2FYMA 3DFTA 1XCXA 1A47A 1OCBA 5FEPA 4PMZA 2F2KA 3FA3A 3MSDA 1KKOA 3T4CA 3EX2A 4EX4A 1KBKA 4NRRA 3IARA 1O5XA 1MXGA 3FXGA 2V3DA 1KTCA 2DZBA 4O16A 1LUCB 4AD2A 1L8PA 4RE4A 2JEQA 3QF0A 3V75A 3TA9A 1OBAA 3HF3A 1JAEA 4HHLA 3PG8A 3L4XA 3TIMA 2X09A 5EYWA 1US3A 3VIHA 4P7RA 3I7QA 4MDOA 3QY7A 3VIPA 4MYXA 4JTKA 3NSNA 2EPMX 1H1ZA 1ZCCA 3WG6A 4PMYA 4KESA 3WDRA 5I07A 1S5MA 1W1B1 4AZHA 5CEWA 5BZAA 4X2RA 1E6PA 2XH0A 1H41A 1XD1A 4S3CA 2EPKX 2HS6A 4HT3A 4ROPA 4FF5A 3DCPA 1G7UA 2YL9A 2FZDA 3ITYA 5AHIA 3ZJKA 2PC8A 1RQBA 4I90A 1XINA 4LAUA 1BHGA 3WLQA 5D2XA 4RE0A 3Q45A 5EPDA 3QHMA 4CU7A 4JTIA 2BOGX 3WDJA 3WSUA 4FXRA 5DFAA 4D6JA 3VOGA 3MQTA 2ZDRA 1FFQA 4AXNA 4HNNA 1OFRA 3V16A 2IUZA 3W2KA 1FHLA 1QNRA 2NQZA 3BUVA 4YJ5A 5ABFA 3C86A 4TVDA 3FJNA 3F2BA 1JGMA 2WYSA 4QG8A 3SCPA 2Q8ZA 1OGGA 2A1YA 1BAGA 2UZ9A 1UUOA 3KBJA 3PY2A 2Y24A 3W82A 2I9EA 5CC7A 2HBXA 2Y85A 3W86A 4B2DA 5AYXA 1VYSX 1CXFA 3HGOA 2VXNA 5E1QA 1TKKA 2Q3OA 4AWTA 3QFWA 4WR3A 4AB4A 3NEVA 1TPDA 5CH9A 3GG7A 2XSXA 2YDAA 1UQZA 5D09A 4Z1DA 4DJEA 2JALA 5HMFA 3VKAA 2XFFA 2E7FA 1Q45A 1QCWA 1XBZA 2ZX8A 3CB8A 3R4IA 1R86A 1CI1A 2VM8A 1QO2A 3MHGA 1JUEA 2NQJA 3CS2A 4Y6GA 5DT5A 1GVYA 3HU7A 4P7OA 4KWSA 1GNXA 1UZ1A 3H21A 4OZOA 4MDPA 3RM9A 3N11A 3RM4A 2PD5A 4Z0JA 3W7EA 2WCGA 2C15A 1ZP3A 3OVQA 1G69A 4YVPA 4JQ2A 1SUXA 3CAVA 3RAOA 2XIMA 3VGEA 1GWJA 1KCZA 4FEZA 4QIUA 1XYAA 3WX7A 5F2GA 3N13A 4V1YA 4AH7A 4GIAA 4FAMA 3MYOA 6CGTA 3QEZA 3W2MA 4L6OA 1OYBA 1I2RA 3TC7A 4Q7NA 4NT0A 4JDBA 1RBOB 4H1ZA 3GE7A 5DMLA 1XBYA 4NNCA 3JU2A 4KGJA 5JMUA 1C91A 2DUZA 3K5XA 1P0KA 3LI1A 2TPSA 3PVFA 3NR0A 3SY1A 2EEXA 1XLDA 1BF6A 5DLCA 4WXYA 5JBFA 1YBQA 1TIWA 1GHSA 4DEFA 1RQHA 4H7ZA 3DGRA 2E6AA 2FVKA 4O28A 1BQGA 3R43A 4FB7A 5HPOA 5H2ZA 4GVFA 3CQIA 4MWAD 4FX7A 5C8BB 4C1NB 3FW6A 3SJNA 1FRBA 2D2JA 5A6BA 3W01A 4QEHA 1C8YA 1TJPA 1RVGA 3T0BA 3ANUA 1IWBA 2J24A 2P3EA 1ME8A 3W3OA 2XFWA 1SR0A 1SW7A 3G6MA 5CGQA 3UR5A 3W0KA 4XBSA 1G4SA 4P7NA 5DEZA 3NYZA 4EANA 1V3KA 4NAEB 2XWDA 1YQ2A 5F4SA 4AD3A 1B1YA 3RM8A 3TSBA 1ADOA 4EF8A 4EP8C 3WMSA 3E5PA 1TV7A 4JL2A 2QPXA 1WDQA 4XD4A 3A24A 4CD5A 3P74A 3BMXA 1GQJA 1HFBA 4OBSA 1HJUA 3WQVA 3T08A 2P0IA 2J75A 1IE7C 3ZMRA 2CXGA 2CHRA 3DG3A 4IP5A 3N2TA 4UOJA 7ODCA 4X9SA 5FACA 3VD3A 4Z0SA 2VJXA 2Z1BA 4I9TA 1SW3A 2V0TA 5CCZA 2QJNA 2TMDA 2UY4A 4KEVA 3B8WA 7CGTA 3QR0A 1EX1A 1ZAIA 4I5XA 4LBUA 3S6TA 4US5D 4WSHA 3HMCA 2HVOA 4QJ4B 4UQBA 4I8DA 1G1YA 3FDKA 5I23A 5AHEA 5FF0A 1UD2A 2XFYA 4Q7IA 3Q2DA 4EKJA 3DIPA 3A22A 3HZ3A 4O17A 1S38A 4K38A 4XZ9A 4HPJA 3LM3A 2VR5A 3L4UA 3E3HA 3PANA 1PEZA 4Q8PA 1L6SA 1VEOA 4UNLA 3GUWA 1GYMA 5FJRA 3UJEA 1TZZA 2GGGA 4W5UA 5HNUA 2B4GA 2PBGA 3VZYA 4ATDA 2J78A 1YEYA 2VRKA 2YCKX 4W5ZA 5AYIA 1QAPA 4HHHA 4IUGA 3OTRA 2OZTA 1QBAA 3DN5A 1REQA 3M0IA 2CLKA 2DJLA 3L23A 4QDWA 4HU4A 3P62A 3MZ2A 4ZE4A 5K7JA 3VD5A 3CHDA 3SN0A 2WWCA 4UOZA 1ONWA 2XUCA 1F3XA 4MAVA 4CLMA 4GXWA 1Q6CA 2AOSA 5LA2A 2X40A 4HSNA 3ICJA 5A95A 4OOZA 4PRRA 1AQ0A 4I7WA 3UFYA 4K3ZA 1VRDA 4ZQCA 4EAYA 4RJEA 1V79A 2J88A 3LHVA 3F2DA 2FMNA 4AY8A 1KXTA 4ZO6A 2WZTA 4MB5A 4NASA 2CKSA 1Z48A 4CNOA 2PGEA 3HPZA 2AGTA 3GTXA 1SYTA 5EB8A 1XQKA 2GVLA 4XG1A 1W3HA 5G4EA 3YPIA 2HE8A 4LGXA 1A5LC 2OYMA 1Q4WA 2PBOA 3FNDA 4Y9MA 2HROA 3VC5A 3P0WA 1SPQA 2A3CA 1A0DA 5DCDA 1GT8A 4K8GA 1AVAA 3B0VC 4OU1A 4GWEA 4MADA 1DHPA 1GTEA 2X16A 4I5RA 4XD6A 3VIJA 4NQ1A 3VGGA 5F4XA 3GTFA 3M4HA 4UB9A 1IQ8A 1LLWA 5EL1A 2XISA 3HPAA 4GIYA 1ISXA 5CLWA 1UQYA 1GCYA 4H6EA 1PTAA 1J5SA 2Y61A 3DG6A 1EO7A 4J3SA 3DKLA 3PWIA 3DFNA 4AISA 4K8EA 2PCEA 4ZOCA 1GVIA 1DIDA 1Q3NA 3CYVA 3IJ6A 2GDVA 3EDFA 2GSEA 4GC3A 4O1EA 5IOBA 3B9AA 1L6FA 1P5BA 3WEZA 1TZ9A 3WBEA 3O07A 3LNPA 2JF7A 1EP2A 3QLLA 1YDNA 1JFHA 3CEUA 1YPIA 4K2SA 3LLXA 4J35A 1XIEA 1CB7B 3TEVA 1W17A 3MHFA 1XLKA 2FKPA 2XGBA 3RYSA 4KWUA 2P88A 6TIMA 2EPHA 2CWNA 3TQ0A 1VHNA 3HPSA 1ZB5A 1X98A 2RKXA 1JL8A 4XAPA 2OSXA 2PEVA 5DRCA 4UFIA 5EMYA 4CNSA 1JCTA 2P0OA 1GG0A 3NM3A 1RP8A 5AECA 1D9EA 2QVHA 4W88A 4MZ1A 3KWXA 2EHHA 2A85A 3OLGA 4E4UA 2E67A 4A3HA 3L4VA 4OGZA 3F4VA 3PTQA 5LIXX 1W1TA 4H6KA 3FYOA 3UW6A 3BV7A 6ALDA 1LWIA 1D2KA 4B4HA 1RCQA 2JQXA 3HQPA 3E02A 4JBRA 4G6CA 1OG6A 4JTLA 1T40A 4L65A 4Y8FA 5TQLA 3FXYA 1X8CA 1XCWA 2HV5A 4HA0A 4TR9A 1DJIA 2DIJA 1NDYA 1MEIA 5C7HA 3NOYA 3MMWA 2WW5A 1DBTA 2J77A 3WBYA 3AS1A 3L2MA 1J9YA 1OQFA 1UP3A 1D7FA 1MW0A 2YBVA 3AZSA 3N4AA 4FLRA 4AWEA 1GVSA 1C3FA 2CZEA 4PCTA 2ZRYA 4LEQA 4K7VA 2AGKA 3GKAA 4RE3A 1B4EA 2HNEA 2QPUA 3QV7A 1SJBA 3EB3A 1FHVA 2D0GA 2GDUA 4MLJA 5K3VA 3SCRA 4ZQRA 1WZKA 3PZIA 1R7OA 1FOBA 1W3TA 1VH7A 3IRSA 4ZZ9A 3K46A 3QYQA 5BU6A 1HG3A 2GQ3A 2NT0A 1BG4A 1WO2A 3NFUA 3KRUA 1LG1A 3BLIA 2FZNA 5HR7A 1NTHA 5ABHA 3C2RA 5A2BA 1IEWA 2W9MA 1AW5A 3PFRA 1GOIA 3AS2A 3VOIA 4FK9A 1L6GA 3PUOA 2DVXA 2Z1VA 3VILA 1R47A 4ZSTA 3OGVA 1NWTA 1FQ0A 4BWLA 2XM1A 4UQDA 1JZ8A 3L0GA 1OF8A 2QCHA 3B0YA 3HPXA 3WQFA 5M5DA 3VUSA 4GD0A 4DWSC 4OE7A 4LF2A 4GYPC 3NJ3A 1OK4A 2X0YA 1AK5A 2FZ8A 4DAFA 4IIFA 1OFOA 3W1AA 4B5SA 1HP4A 2O9OA 3PBGA 3TNBA 2AL2A 4UFJA 4AZBA 2PURA 3L68A 5HJLA 3PAJA 2NUXA 1QI4A 4B5TA 3G3DA 3R94A 4FF7A 2XZ7A 4H9VA 2IXUA 3DOPA 3MTWA 4CNNA 4X61A 1XBVA 1YDVA 3QGAC 3NGFA 4Z2LA 1WKDA 1EKOA 3N9RA 3GIPA 3NQDA 3GDKA 3A4AA 1WX0A 1C92A 1SMDA 3LS9A 2EPOA 3KX6A 1EOKA 4GFSA 1RV8A 3HJZA 2VTFA 4FXJA 4I6VA 2QR6A 1R8LA 1B9BA 2FTPA 4MUPA 3UP8A 5CPLA 4KCTA 4K68A 3QKZA 5D02A 1BYDA 3F4DA 4QE5A 5I02A 2PDPA 1T5AA 3HG3A 2YXGA 4DJFD 4CCEA 3WF3A 3W6LA 2QCCA 2V68A 3GR7A 1XLHA 1EJSC 1VB9A 4K1WA 3LMYA 3MVIA 1AMYA 4IIHA 4AHQA 2VURA 3BGJA 1HJXA 2YBUA 4D6DA 3KLLA 3MI3A 2DSUA 5DELA 2D20A 2HBVA 3FCPA 1XP3A 1E9LA 2ZVIA 1KFKA 3KBSA 4F66A 2OZ3A 3DDMA 4HZ7A 1SSGA 5DBUA 4IMEA 4H9TA 3NYDA 2CKRA 2Q09A 4FNTA 1TJ0A 4UTWC 4P61A 4X0NA 4AF0B 3I4KA 3TYEA 1YBQB 3GXIA 1V7YA 4KIRA 3N1AA 1W56A 1JI2A 3D46A 4UTTC 3UYCA 1E3ZA 4Q4KA 2PMQA 4JTEA 5HNNA 4LAMA 1YW1A 4U33A 3PZUA 4CCCA 2NXIA 2PWHA 5FF7A 3OG2A 4B2DD 3KS6A 5G1MA 3UWZA 5GNXA 4EE9A 1Y7VA 2RAGA 2VMFA 1BG9A 2JE8A 2WCSA 4GYJA 3RLGA 3E1F1 1M6JA 3ITXA 1H7PA 1PZ1A 2EPNA 1XW8A 3MANA 5GPRA 3FKKA 4JL1A 4PUWA 1D8CA 1OWQA 3K2GA 4F0RA 1NIUA 3EA2A 5U4NA 4IISA 4DJED 3T09A 4TMBA 3IGUA 2QDHA 3A9IA 3OZPA 4OHQA 3LHZA 2KZHA 2WSKA 3UA3A 3AAMA 2AQVA 3WQ5A 3SI9A 1OFBA 4HPHA 3C6CA 1H0GA 1OFAA 1TV8A 3WFLA 1P4CA 4ZQMA 2D22A 4D8LA 3UA4A 1MYRA 1JVNA 1SR9A 2OSYA 4ERAA 3SW6A 1JCNA 3AIRA 2VD9A 3CQKA 3TH6A 2NX1A 1CGTA 1VPYA 1RLCL 2CIPA 2PF0A 4A8RA 3BQ5A 4GY0A 1FX6A 1JPHA 4HN8A 2WOQA 2NT1A 1O94A 3SSJA 1OX4A 2MUCA 4JD4A 4Q8WA 5IRPA 3GBEA 4AWUA 2F8QA 2Z2BA 1KXVA 3QVQA 4H9XA 1Q7QA 1JZ6A 3P80A 4R7OA 3N2CA 4DYKA 3AS3A 1T6MA 4WEVX 1L2QA 1LRQA 4INFA 2NVDA 3LRLA 4AYGA 1FDJA 2B0MA 3RU8X 2R8WA 3M0VA 2Q01A 1WXJA 2PLCA 3R79A 4I6KA 5I78A 3CLMA 1AL7A 1EB3A 1IXPA 4JY8A 3Q37A 3T0TA 2ZWZA 1JXKA 4ZE5A 2ONEA 1CT5A 4XZIA 3TLLA 4F8XA 4PB4A 5CSUA 4BEUA 4QNEA 2C71A 1QUMA 1DKWA 2R94A 3SR7A 1DWIM 5LHEA 1SU5A 3L2IA 2YL5A 4BS0A 4I3GA 3QOKA 2JF6A 3FAXA 1R46A 4NL1A 2DUXA 3U2ZA 3SN1A 3HQOA 3BICA 1W1ZA 1YXCA 4KH2A 3WF2A 1HF6A 4M1BA 3KOFA 1A5UA 4WHBA 4DBEA 3ZOAA 3W25A 1FWEC 2XGZA 2VYOA 3NZ1A 1J0ZA 1HL9A 3RR4A 1AZ2A 1Q65A 4Y9OA 1CCWB 1W37A 8RUCA 1J01A 4GH1A 3U6WA 3VKDA 4GI9A 1XJBA 3O6AA 4DZ5A 4JXCA 1E6QM 3O6DA 4J3UA 4W8LA 4GZEA 1A3XA 4O4VA 3VOFA 4B92A 3V4BA 3CPUA 4ORIA 1B9ZA 1Z6KA 1CECA 3S5SA 3S0CA 4R53A 3P60A 4IIEA 3F5LA 1KTNA 4D8ZA 1JCJA 3LHUA 4AD1A 4LYQA 3IJ8A 4Q8OA 3CQJA 1JGIA 2OR2A 4UNKA 3H7UA 1RD6A 3NUKA 5C55A 3I10A 2YB4A 3LCHA 2GGIA 3NPWA 3RK8A 3WNLA 3W00A 2AAAA 2VVSA 3N14A 3VOHA 3GVQA 1UA7A 1Q6DA 1OD0A 3LHTA 4JTRA 1R3QA 1IWPA 3RLHA 3L67A 1UWAA 4CN6A 5F2MA 1HL2A 2XHYA 1XLJA 2PWGA 4B3KA 2OT0A 3LV5A 2ANUA 4JTTA 4NF7A 2QJGA 1WKEA 1HKKA 5KEZA 3IIVA 4UTFA 3JZUA 3WJXA 2OPJA 4DHGA 2PDLA 1F07A 3W1RA 1G4EA 4PEKA 3WDHA 1DQXA 2O7QA 2NV1A 1VYPX 1X6NA 1YXDA 4OBTA 2ZRZA 4IIBA 3U2CA 2I1OA 1FXQA 4G2DA 3NGJA 1NOUA 3KP1A 1G01A 1KTBA 4U5KA 1HO4A 1V0KA 4RCXA 1FH8A 4RV3A 3WLHA 4BI6A 4L4PA 4QAIA 4PSRA 1Q6QA 4DI8A 3ARQA 3M6YA 3QQ1A 4WOZA 2A79A 3UXLA 2C0AA 1C8XA 3IUHA 4QQ3A 1LQ2A 1M3UA 3HTWA 1XLIA 4C6DA 2OT1A 1GVQA 3T6CA 3CMGA 3L4WA 3O7UA 1C9DA 2F6KA 5XIAA 1V0NA 4W87A 2XJ7A 4LF1A 1M7OA 1JRBA 4JTHA 4Y8EA 3LSBA 4JKKA 2BV9A 5AHLA 1DJGA 3ONBA 2HVNA 4C60A 7PTDA 1XV8A 2ZX6A 1UHVA 2V5LA 2G5WA 4D1JA 1G9HA 3TYDA 1A80A 4MJ2A 3FYYA 2QF8A 3IGXA 3OEXA 1BYBA 2QT3A 1HO1A 4BF7A 4ZENA 1F7BA 3LBOA 1QW8A 2XSBA 3LY0A 3PZVA 3UGVA 9XIAA 4O18A 3W2LA 2RDWA 3IJDA 5G4HC 1N55A 3ANYA 3AI0A 4M82A 3L0KA 2CHOA 3NURA 1ADDA 1OJXA 1JRCA 4LB4A 3W72A 3W1UA 3T05A 2P5NA 4X9YA 1NH6A 3MCNA 4GGHA 3G1SA 2X30A 1S1PA 3NEHA 5CJMA 1V4YA 3UNDA 4HPGA 2YCIX 2CESA 2VFIA 3I7RA 3U5YA 1TCDA 3R12A 4UNIA 1ICPA 2BY2A 6REQB 1IZCA 2WSQA 3PHAA 4AEOA 1IR1A 1ZNNA 4WX2A 3TYBA 2VX7A 1OHLA 5GVJA 4OIFA 4QNWA 1AD1A 3S8HA 1TVNA 3PBMA 3NQCA 1AJ2A 2WVSA 1F6KA 1DTUA 3W22A 4GGBA 5D30A 3TQVA 3STFA 2IKJA 3LA4A 5C9ZA 3KDOA 3QRHA 3OZOA 4CNPA 3WNNA 3WLJA 2ZYFA 1I2OA 2WKLA 1HN1A 4LX4A 1TA3A 3CV2A 1XSKA 4DJDC 4M80A 3S42A 3CZLA 2PCQA 1MUWA 3AUJA 4K36A 3WJYA 5K9DA 3M0KA 1TSIA 3TTYA 5EFDA 1SJDA 1LUCA 5C54A 2ESCA 3N2BA 3LK6A 3UY8A 3TDFA 2ZQ0A 4JN8A 4LT9A 1EC7A 3BARA 4P8XA 4LC6A 2YCJA 3WKZA 3G1DA 1RVKA 3H12A 1HGYA 2XU2A 5J8LA 3ZVHB 4H7CA 3VK5A 4I7UA 1FCVA 4WK9A 3NZRA 1VEPA 2F7FA 3WL1A 3HG5A 2FLIA 4AZ5A 4IXHA 3N4FA 3GAYA 3NDZA 2D0HA 1XISA 3HG2A 3V0TA 1TMLA 3A3WA 3AHZA 4TTGA 2ZXQA 3V0SA 1XC4A 1FFRA 3EA1A 4MJ4A 5FAJA 2Y7EA 1XFCA 3E0LA 3EWBX 3PZOA 4GE8A 3K4DA 1OIMA 3FHAA 5CJ5A 1HIZA 4ALDA 4DPPA 3DECA 4JKMA 1GOOA 2W5FA 1KGXA 4ZTYA 1E15A 2D24A 5KINA 4PMVA 3IJ9A 1V6XA 3LNMA 2EJAA 4W93A 2PDGA 1E0TA 2BWGA 3ABQA 2BLEA 2FFCA 5XINA 1XDMA 3SEPA 3P67A 1XKYA 3W7IA 1WOBA 2XN1A 1VCGA 3P2VA 3BMWA 1MUMA 2C3ZA 1PPIA 1KXHA 4XB3A 2YW3A 1EGZA 3RJYA 2D69A 3VNYA 1IXQA 1AA1B 3BAJA 4NI3A 5AC6A 4S38A 1TJRA 5E0FA 2VC9A 1MMFA 3PSVA 1B30A 1H63A 5A6AA 4NY2A 4H9YA 3TROA 3AIEA 4A35A 2Z24A 3OA3A 1OT2A 4Q22A 3OBAA 3SQSA 3GNNA 4ZXLA 3RO8A 1HKWA 2AKMA 3U7BA 2XFRA 1LOLA 3R6IA 1JF5A 3WLSA 2YL6A 3C3UA 1W9UA 1CXEA 4L4MA 1GZ1A 4WDWA 4U2ZA 2YW4A 4QCEA 2ZUVA 3DXIA 1YHTA 3NL2A 4MOZA 3LTPA 1UZ4A 2WNZA 3KTCA 3T78A 4ACYA 3CQHA 1MWOA 1XH1A 4L4LA 1M7XA 1V02A 1S5WA 2C0HA 4YHEA 1OB0A 3SRKA 1J0IA 3HOJA 4GXPA 3WQPA 3A3XA 1KFLA 4IPIA 4RUBA 1Q66A 2NWSA 2OYKA 2DFAA 4HZMA 4PBEA 4ERGA 3O3RA 2OKOA 3CUJA 4O1AA 4S39A 3KRBA 1ALDA 1EJWC 2QMJA 4UZSA 1R5YA 3OA5A 3BJFA 5KZMA 4NZ1A 1I2NA 5C9WA 4YVXA 1GEHA 1JUKA 3FFSA 4HMDA 4IMDA 4B16A 1PSCA 2AL1A 5CSRA 1CEOA 2OZ8A 4PR4A 2GGHA 4PMQA 3URBA 1E9IA 2BXVA 1K02A 4GYKA 3VVGA 1V7AA 4YPJA 4EIVA 1DYSA 4BFAA 2PB1A 2DPEA 2G96A 1WUFA 3NSMA 3BGGA 3RFAA 3QR1A 4A21A 4M7SA 4OTKA 4JTFA 1QPQA 3W7QA 5J5RA 3GW3A 2HISA 3C2VA 2DT2A 2WK2A 4MG4A 2ZZ6A 1W5QA 4I9AA 1Z69A 1V03A 4XUGA 1TV2A 4PE8A 1I45A 1UD8A 3CAQA 3VOCA 3W7HA 1R6WA 3G1RA 3G2GA 3AMGA 4ZO9A 3N4EA 3UXAA 4GVGA 3QMRA 1XLMA 4AHOA 3RRAA 1F76A 3IJQA 2IXVA 3W2UA 4HIBA 1A0CA 3MBDA 2DT0A 2H8ZA 3M1ZA 4ZMGA 1L9WA 1JZ4A 3PWGA 4DUVA 1QWKA 2C16A 3UWEA 2X0SA 2FMOA 3DFYA 3LCIA 4C6PA 4IF2A 3HGSA 2VC7A 3WK0A 3NTYA 2WMIB 1EO5A 4K39A 2I7GA 4F79A 1E6ZA 3GVWA 3K4AA 3CU2A 2MNRA 4EWND 1TWWA 5A5WA 3CUXA 1QASA 1AH3A 2IKHA 3VD4A 4XVEA 4Q4RA 3P6LA 3WQWA 2EKGA 1GKQA 4Q4SA 5CQ1A 1R3SA 3KOXA 3P5ZA 3HO8A 2C7FA 5J04A 3TLQA 3EYPA 2WVVB 1ZENA 1IT0A 1XDLA 4GC4A 4JTAA 1YMYA 2QCDB 3ABRA 2QUVA 1QPNA 5IFTA 2OU4A 4JAWA 4AQLA 1T8XA 2FGZA 1VENA