3WUEA

The wild type crystal structure of b-1,4-xylanase (xynas9) with xylobiose from streptomyces sp. 9
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
312
structure length
312
Chain Sequence
TATLGELAEAKGRYFGSATDNPELPDTQYTQILGSEFSQITVGNTMKWQYTEPSRGRFDYTAAEEIVDLAESNGQSVRGHTLVWHNQLPSWVDDVPAGELLGVMRDHITHEVDHFKGRLIHWDVVNEAFEEDGSRRQSVFQQKIGDSYIAEAFKAARAADPDVKLYYNDYNIEGIGPKSDAVYEMVKSFKAQGIPIDGVGMQAHLIAGQVPASLQENIRRFADLGVDVALTELDIRMTLPRTAAKDAQQATDYGAVVEACLVVSRCVGITVWDYTDKYSWVPSVFPGQGAALPWDEDFAKKPAYHAIAAALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase A
publication title Structural perspectives of an engineered beta-1,4-xylanase with enhanced thermostability.
pubmed doi rcsb
source organism Streptomyces sp.
molecule tags Hydrolase
total genus 126
structure length 312
sequence length 312
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3wueA00
1GQIA 3BGAA 1J0KA 3DC0A 5FD0A 2WMHA 3N15A 5A2BA 3K8LA 1CBGA 2VCAA 4UOZA 4V2XA 5I24A 1H2JA 1NH6A 3AQUA 3D3AA 4RL3A 3PHAA 2WXDM 2XIIA 4WKAA 1IV8A 2EBNA 3WSUA 2BV9A 4FLQA 4JKLA 3WQ4A 3AMLA 3N9KA 3AZRA 4J3TA 5CJ5A 2X1IA 1GHSA 4BZYA 2FHBA 1JNEA 3ZQ9A 5C8BB 4W7UA 3VIGA 4OOZA 3L4VA 5IDIA 2BXYA 2J62A 1B3VA 1VFFA 5CSYA 1HN1A 4AD3A 1BGGA 1A47A 3MUY1 3NSMA 3OA5A 1CGWA 2WMIA 3OLEA 4OUEA 1UOKA 4C7GA 1TG7A 5M5DA 3WBAA 3WF0A 2V5CA 3CO4A 1US3A 3OLDA 3AYRA 3W53A 2J7CA 1MW1A 3N18A 3VD3A 3WNKA 1RP8A 1WZKA 5LA2A 1WNOA 2O92A 1H41A 1DEDA 2WNWA 1HP4A 1J0IA 1XH2A 1FHDA 4FMVA 1W3HA 1W9UA 3AMKA 4MDPA 3VOCA 1CNVA 2JEQA 1W3KA 1VFMA 1HNYA 4OKDA 1C3FA 3B8SA 3T08A 1QW9A 1CXFA 2A3EA 3ARRA 3FNDA 3AZTA 1EQPA 3GZAA 2J7GA 1QBBA 1M03A 3SCRA 1UD5A 4UQEA 2DSVA 4B9ZA 5M17A 3VMNA 4QP0A 4Z2LA 5JIWA 1PPIA 2VRJA 1OGSA 2CBUA 4DWSB 2VNCA 1DWJM 1TVNA 4MB3A 3VMPA 3CZJA 1TA3A 4D6IA 4FK9A 3WDHA 2YDQA 3AIQA 3WN6A 5EMYA 1E3ZA 4OJYA 3SEPA 1E1FA 1E3XA 4UOQA 4GPNA 1HKIA 2E9MA 2Z1KA 4PMNA 1XHGA 3II1A 4NSBA 3AICA 4DWSD 3WDQA 5JBEA 3DYPA 2DT0A 1KCKA 1OSEA 4ATLA 1FH7A 3W28A 4J3SA 5AYIA 3CGTA 5DEZA 3T2OA 1HJVA 4U5IA 2FHCA 5FIPA 3SCPA 1HJWA 4YPJA 1OINA 5AYBA 4AIEA 3WQ6A 2WMGA 5A8MA 3D5HA 2PB1A 1CDGA 1X1NA 1JYWA 1JG9A 2OSXA 3VIKA 1A3HA 4P7QA 1ISWA 3RMEA 4UQ9A 3DYOA 2DDXA 3QHNA 1SMDA 1W2PA 2WSPA 3VM5A 2ZE0A 4XB3A 2QMKA 3AS0A 4MNJA 1NP2A 3MSGA 3CHDA 3W4RA 3EMZA 1E6PA 4JL2A 1UWSA 1ITCA 3QGVA 1JL8A 3WD1A 4CD4A 5FKYA 1WCGA 2F8QA 1LL4A 2VR4A 3UR8A 1NQ6A 3MU7A 5HDRA 3SUWA 2WK2A 4ZFMA 3CPUA 1Q6FA 1CXEA 5I77A 3EDJA 3O6AA 2XWEA 4AW7A 1UKOA 1DWIM 4DM2A 1K9FA 1AMYA 2D23A 1S46A 4AC1X 1H3GA 1KWGA 1UR8A 4D6JA 4HOZA 4ZE4A 1PZ3A 1BQCA 1M53A 4F66A 5HPOA 2UWFA 1MFVA 1FH8A 1AQ0A 1ODUA 2WVUA 3BCDA 4H8VA 2CYGA 3FW6A 2XJ7A 5ABFB 1KXVA 2A3BA 3AJ7A 3VVGA 2ZUWA 3SUTA 1QNOA 2IUZA 1CPUA 2X0HA 3N13A 1B9ZA 1IZJA 1V3MA 4AD2A 1OD0A 1E43A 1EO7A 5CSUA 2EJ1A 3I3BA 1EDQA 1J10A 1BG9A 1U30A 1KWKA 3A4WA 3WL0A 3ARUA 1GNXA 3CUHA 3IK2A 4JAWA 3UG3A 1NOFA 5IFPA 4F9JA 2E9BA 5A1AA 2WBGA 4PTXA 4HU8A 3SCOA 1C7SA 1ODZA 2XYLA 4QAWA 3WEMA 1CGUA 3MMUA 5BYWA 3WDJA 3OGVA 4IISA 5IXEA 2ZXQA 1LG1A 3OIHA 7TAAA 1HKMA 2AMGA 3AHYA 3T0AA 3EMCA 3WDPP 1J0HA 3VMOA 4OBSA 2BHZA 3TP4A 1XYFA 2VQUA 3OGRA 3WFLA 2AOSA 2BNJA 4JKMA 4AIOA 5I5RA 3RM9A 2DT3A 1VB9A 1VJSA 1TFVA 1GVYA 5JBFA 4PUDA 1CYGA 1JZ8A 2Z1SA 1W1PA 2YL6A 2J79A 1JDAA 6TAAA 1C8XA 1WZAA 1LQ0A 5LA0A 5TD4A 1V3KA 4NZCA 3WNOA 2WB5A 1GORA 3UG4A 4P8VA 1KCLA 3VPLA 4ZENA 2ZXDA 4HMDA 4PMOA 1D7FA 4QLLA 3CZEA 5E70A 4NRSA 1FA2A 1CXHA 3WUBA 1XSKA 4H8HA 1KXQA 3ARPA 4P7NA 3RCNA 4RE3A 3VX1A 3MV11 2BVDA 3ARVA 4TTGA 1MQQA 3SCWA 2VMFA 5BXTA 1FP9A 5A6BA 1K9DA 1OGBA 1MQPA 2GJRA 3WH8A 4Z2GA 3WNPA 1F4AA 1UZ1A 2D22A 1XCXA 1VENA 1LF1A 4AZGA 3UG5A 2WVSA 2ZX9A 2OWCA 3ZSSA 1XC6A 4JHOA 1B3YA 1OIMA 4UFLA 3WUFA 3PZ9A 3G6LA 1BYBA 1JZ3A 1GUVA 4MPKA 4TVDA 2CHNA 2PWHA 1ISZA 2CERA 4F79A 1V6VA 2XIBA 3T0DA 3NJ3A 2WHKA 3WD0A 1DWGM 3VIIA 3AHZA 3U7BA 1WPCA 2G3MA 4AWEA 4D6EA 3WD4A 5CLWA 2ZOXA 1GJUA 5A6MA 2WCSA 1QBAA 3TOPA 2GDVA 1JXJA 2J4GA 3FN9A 3W0KA 3L4TA 1E6XM 5BRQA 2XM1A 3EDDA 4Z2HA 2BY3A 3W37A 1AQMA 2J75A 4AZCA 1JZ5A 2EO7A 3W24A 3WDIA 1B3XA 1UWIA 4W7WA 3VGDA 3BLKA 3CHEA 4AD1A 3WKZA 4ZXOA 3ZM8A 3BSHA 1OM0A 4MB1A 1D2KA 3PZNA 3OLIA 1R87A 1DHKA 5D8WA 1QPKA 5DFAA 4MADA 3K1DA 1BF2A 2X09A 2D2OA 2JALA 1NWTA 3U5YA 3F4VA 2YA1A 1V3LA 1UWUA 1KGUA 3NCOA 3T09A 4B9YA 3WMBA 3GXFA 4Z2IA 4PSRA 1XYZA 1GOMA 1Q6EA 3OLGA 1ZJAA 2XTKA 2JF6A 4J3UA 2W67A 4HPHA 4P7LA 4LYQA 3BMVA 1M04A 4DWSC 3APGA 3W6MA 1KBBA 1XV8A 1HP5A 2FHFA 5F7UA 2DGAA 2CITA 3GH4A 4MNLA 2UY4A 1DWHM 1HVQA 5BCAA 4GI6A 3CUJA 2A3AA 1KGWA 3VGFA 1WDSA 1UR0A 3MV01 4UFHA 3TTOA 2YA0A 1UD2A 1E71M 1QHPA 4W85A 2J74A 4PCTA 3VIOA 1H0IA 5E0FA 1CECA 4P8XA 2Y8VA 2WVVB 1NWUA 1KR0A 4JFVA 5FOOA 2D24A 4J28A 2XVGA 3AIUA 2QMJA 1QNQA 3GNRA 2NW0A 4E8CA 2DT1A 3POHA 1MQRA 5A6SA 3AIBA 1V3IA 1ZBWA 1PBGA 3NYDA 3WIJA 2VOTA 2D3LA 1YQ2A 4PSPA 2W63A 4V28A 1MFUA 1ZBVA 3GXMA 1L8NA 3CH9A 3DHPA 1EGZA 3GNPA 4N42A 4HOWA 1HL8A 3MKKA 2WBKA 3CUIA 1RH9A 4M24A 3VX0A 2VVNA 4Q22A 1V6XA 1R8LA 2BY2A 2ZX8A 3LPGA 3GXDA 1TCMA 3PTMA 1G5AA 3RM4A 2WANA 4TOQA 2VVSA 1E15A 5BXPA 2VZVA 3IAQA 5D4YA 4GZJA 2ZUSA 3OG2A 1E0WA 4D72A 1GJWA 4M56A 2UY2A 3EBVA 3DHUA 1XSIA 2BY0A 3ALFA 5A2AA 2YKKA 3WH7A 1FFRA 2V3GA 2DPEA 1WB0A 5DF0A 2HVMA 3EYPA 1UWRA 1Z32X 3FXYA 4LYRA 1CENA 5ABGA 5E0CA 1WAWA 2OLHA 1SYTA 1CEOA 1B1YA 3O2LA 4MJ4A 3VU2A 4AZBA 1GOKA 4AZ7A 5A8PA 1P6WA 2WYSA 4U31A 1E0XA 4AXNA 4N0RA 2WKGA 2VZUA 4CU8A 4UQDA 1XCWA 4GINA 4IM4A 3PTKA 1UD8A 3IJ9A 1O7AA 5LYRA 4MAZA 1ZBKA 1JXKA 5I3DA 1E70M 1E6SM 4HMCA 2ZX7A 4XZBA 3VNZA 1ESWA 3T2QA 2WC7A 4M29A 3TTSA 3SUSA 1E4IA 4UQCA 2EPLX 2GUYA 3OGSA 1JZ4A 1V03A 3ARYA 4UFJA 3VD9A 1D3CA 2W92A 4WF7A 1UH2A 1JZ2A 2BHYA 1LJYA 2J8GA 1UA3A 1J0YA 2V3DA 3VIJA 2GSJA 4J3WA 1PAMA 1B2YA 1QI2A 1BG4A 4WSKA 2QF8A 1U33A 4P7OA 5M03A 4KGJA 4D6DA 3A3HA 2QPUA 4W84A 3ZMRA 4D1IA 3BAXA 3WF1A 1EOMA 3THCA 3BXWA 3BAYA 3MANA 2WMIB 5ABEA 1WP6A 1ZS2A 5D9MA 1GQJA 4NRRA 4AMCA 1V02A 5EB8A 3BSGA 1E72M 4JFWA 3ZJ6A 2PBOA 2VZOA 4JFSA 1F4HA 3K4AA 1BVNP 3N12A 1W1VA 4QFUA 5AC4A 2XGIA 3AYSA 4BQ4A 3KL5A 4PBGA 2C0HA 3GH5A 4PUEA 5CGTA 3OBAA 1DP0A 2IXVA 3VGHA 1E6QM 3N1AA 3AHXA 3VGGA 3L4ZA 1UA7A 3ARWA 4QDMA 8A3HA 3HU7A 5I0DA 1XSJA 3WF4A 5A69A 1JI2A 1LLOA 3S6TA 4CD6A 1UR1A 3W27A 2WCAA 4H7VA 3KWXA 2VX7A 2NT0A 3SCSA 2C8NA 4X0NA 2Q8XA 1NOWA 3GBEA 1OCQA 1VJZA 1K9EA 2DSZA 2ZUTA 1GVIA 1W9VA 1WZMA 4JHZA 4XUYA 2ZUVA 4JZ5A 2XVKA 4GXPA 4X9YA 3E1F1 1VEOA 5IHRA 3MS8A 1X6NA 4AZ5A 1JD7A 1O6IA 1TMQA 1EO5A 3VIPA 1UKSA 1J11A 1R7AA 4U3CA 5A6KA 4JCMA 3SIMA 7CGTA 3UEQA 2BS9A 4AY1A 4ZXLA 3DYMA 3AROA 4TX6A 1CGTA 4DUWA 1UD3A 3B9EA 4LGXA 5CLTA 3F5LA 3NSXA 4LPCA 2WWDA 2WWCA 3VIHA 4K68A 3AIVA 3NSNA 1QNRA 1JAEA 4KGLA 5CQ1A 3CTTA 4UOJA 3IAPA 4WKHA 5ABFA 3AS1A 2VCBA 3DECA 4DM1A 3L4XA 4W8AA 2GK1B 4D1JA 4M82A 4ACZB 1UKPA 1BYAA 2W91A 1ZJBA 4R27A 2CKSA 4XZWA 3MMDA 1Q6CA 2BHUA 4M1RA 5GPRA 5BXSA 2O9TA 8CGTA 4CGTA 3I3EA 1EHAA 5AC5A 4CU6A 1PZ2A 1XGZA 5E9AA 1JZ7A 1E5JA 3WQWA 2CNCA 1GPFA 5A8QA 1GW1A 1UG6A 3T2PA 2A3CA 5HBFA 4W89A 2QHAA 4P7RA 5A6JA 2CPUA 4PTWA 3HJEA 3W6LA 4CU7A 4KRUA 1PIFA 1U2YA 2J7FA 1EHNA 1UKQA 2WMKA 3AIRA 4EANA 3A4AA 2VI0A 1UH4A 2VX4A 5GNYA 3ARSA 4HZ7A 2X05A 2OSYA 5C71A 1W1YA 4AIUA 1Q6DA 2XG9A 2WC3A 1VEMA 3CIVA 3ZSTA 4YN5A 2ZUNA 3CHFA 3WQ8A 4HPGA 3AZSA 4AZ6A 3ARQA 1RPKA 1JDCA 2VRKA 4GQQA 4GZEA 3AMGA 4J27A 4MB4A 1MXDA 2G4FA 2JEPA 1BHGA 5FCZA 2WAGA 3WMCA 4LYPA 3VGEA 3BAWA 4MDOA 1GZJA 1QHOA 3M46A 5GNZA 3CMJA 4NF7A 2HISA 1XRVA 3ZJ7A 4NI3A 4CVUA 4DUVA 1UUQA 2VJXA 1C92A 1GHRA 1ISYA 2YL5A 4MTVA 4AD0A 1UWQA 3WH9A 2NT1A 2VC9A 1KXHA 1HL9A 3AS3A 1GOQA 5IFTA 4P8WA 1HX0A 2XGBA 3SCUA 4HA4A 4J3VA 1GOIA 3CZGA 3RJXA 4W88A 4Y7EA 2DEPA 3VD7A 4CD8A 2WHJA 2DSKA 3BAJA 4JKKA 5CPQA 3WFZA 1VF8A 1UYQA 4CKQA 3ZIZA 3AISA 1H1NA 4C7FA 2XSAA 1EH9A 3PZGA 3CZLA 1CWYA 3WMSA 1EIBA 1W9PA 3POCA 3WEOA 5FL0A 3ALGA 1EXPA 4UZUA 1IT0A 4J7RA 3VIFA 3CUGA 4GO9A 2OWXA 1HKKA 4AD5A 3KEHA 5BRPA 3AXXA 3UESA 5A95A 3LPOA 4X0VA 1J9YA 2AAAA 3WUGA 3SCVA 2WCGA 1K9TA 5BXRA 1ITXA 3OZPA 5HXMA 3SCQA 1PX3A 5EBAA 2PC8A 3A6OA 2WLYA 1H0GA 2JIWA 1JYNA 4HA1A 4W93A 2O9PA 3UR7A 5FL1A 3O9NA 5DT7A 3EDEA 1OT1A 1E1EA 3ZT6A 5E6ZA 2J77A 2XFFA 4JFUA 2YJQA 2YOCA 2TAAA 5A6BD 4L4OA 5GNXA 1V6WA 1JIBA 4CN4A 5KZ6A 3WDRA 5ECUA 1XH1A 2ZWZA 3GM8A 1JGIA 1GQLA 2DH3A 4PTVA 1FP8A 5BWFA 4UFMA 1VAHA 2PWDA 3CMGA 4D6CA 1V02E 4W5UA 3TTYA 1UR2A 3SUUA 5JIPA 1XD0A 2UY3A 1UWTA 3MO4A 2VTFA 4F8XA 2E9LA 5E09A 1EOKA 1W3JA 4ML4A 1C91A 4H2CA 1C90A 1E6ZA 2GJXB 1JAKA 4H41A 1HJSA 4WLCA 4R5EA 3PZTA 1UZ4A 2WSKA 2DQXA 3L2LA 4GI8A 4W8BA 3AIEA 3BC9A 1ISXA 4B3KA 4OZOA 3KL0A 3VM7A 1LG2A 5CG0A 2BVTA 4Q7NA 1W32A 6A3HA 1CIUA 1GCYA 2WZIA 5I2UA 4PMUA 4CN1A 1WE5A 1V0MA 1CLVA 2WVVA 4UFIA 1LWHA 4TUFA 3RIKA 1NWRA 4A3HA 3ZT5A 4CD7A 2CXGA 1V3HA 4UFKA 1G01A 4IPLA 3KL3A 2BY1A 4FLSA 2OWWA 4CCCA 4PMVA 1JF6A 2D3NA 2FGLA 3WD3A 4UTFA 5JUVA 3W26A 3SCNA 1IZKA 3MUAA 4RE4A 3WL1A 3CHCA 1LL6A 3NDZA 1BAGA 4FF5A 1KR1A 2O9OA 2Y24A 4TVCA 3AXIA 2D0FA 2BFGA 2E8ZA 1JFHA 3WH6A 2D0HA 1W9BM 4IPNB 4WJXA 5HPCA 2J7DA 4PMDA 4S3JA 1NARA 1QNSA 5A8OA 2PI6A 3AS2A 1R7OA 3K4DA 1UQYA 4UR9A 4BQ3A 2GFTA 1DTUA 1E56A 2E3ZA 2A3HA 4HMEA 4ZEPA 2PWGA 2QPSA 1V0KA 2YLAA 2WW5A 2GJPA 1VBRA 2D20A 3GNOA 3QOKA 1WZLA 1ZB5A 1B3WA 1I75A 2V5DA 5A94A 3SURA 1BSIA 3VTRA 5M3WA 2YLLA 1JFXA 1QI4A 1MWOA 1V08A 2WZHA 3WQ5A 1WO2A 3PZIA 2W4XA 3SCTA 1HJUA 4AZIA 3RJYA 2CKRA 3J7HA 2ZWYA 3FY1A 2NSXA 5CPSA 2Y8KA 2F2HA 2J7HA 4Z2JA 5EFFA 2E0PA 3NDYA 2JE8A 4W7VA 1L0PA 1V0LA 1OT2A 1E9LA 5A8NA 1BGAA 1UD4A 3HN3A 3K46A 3NUKA 3WENA 1GOWA 3EDKA 4LX4A 4KMQA 2VQTA 4ACYA 3EMQA 4HZ8A 3MMWA 3QHOA 2EQDA 4OOUA 3T0BA 4P8UA 4WIWA 2W5FA 1W91A 2ZUUA 3I3DA 3CZKA 1E4LA 1WDQA 1OGGA 4D6GA 1Q6GA 3F5KA 1SMAA 4ATWA 1PX8A 3L2MA 3WH5A 4AZHA 2CCRA 4JIEA 1UR9A 1J01A 3QR3A 4HOXA 3M7SA 2XVNA 3ARTA 4CN6A 5DMYA 1J18A 3IJ8A 2X8RA 3ARXA 9CGTA 4DWSA 3VO0A 4B16A 5GQBA 2Y2WA 1FOBA 5KEZA 4LQ1A 1G9HA 2O9RA 2EPOA 4PMRA 1RD6A 1BFNA 1ZU8A 3ZJ8A 3PZVA 3PZQA 1J0JA 1KFWA 3VNYA 1MW3A 4Z2KA 1QI0A 4QLKA 3WEZA 2XHYA 4AEEA 1QW8A 4AD4A 3U57A 3GTNA 5A6AA 1FHLA 3WNMA 2G3JA 4QCFA 1MXGA 1C93A 5CZKA 3UERA 3SUVA 3U7VA 4MNMA 2Y4SA 3LMYA 5E6YA 1KQZA 3LPFA 4CVWA 5A6LA 3AHTA 5EFDA 2XUCA 4E4PA 3B9DA 3GBDA 2VX6A 3W38A 1TE1A 5C70A 1W3LA 4KH2A 4HTYA 4AEFA 2PBGA 3ARZA 4PEEA 4H04A 5LA1A 1FH9A 3AMCA 3LPPA 4B3LA 5D9NA 3U5UA 1OWQA 1JZ6A 1EDGA 2JIEA 5CGMA 1TA3B 4MAVA 2VUYA 1OIFA 3ZR6A 1KQYA 4UZSA 2PWFA 3PBGA 1Q4NX 2X0YA 1QI3A 2XWDA 2DSWA 3MSDA 1UKTA 3WUEA 4L4PA 2E40A 2ZUMA 3FAWA 2J7EA 3CLWA 1BTCA 2RGLA 4EE9A 2BXZA 3G6MA 4S3KA 2QV4A 4PN2A 4AISA 1MW0A 2GK1A 4GIAA 3WNNA 4ACZA 1HJQA 2D1ZA 3CZ8A 2XSBA 3UCQA 3FHAA 2J47A 1C8YA 1VBUA 2FDMA 4AYSA 1E55A 3JUGA 4PRWA 3HMCA 4WKFA 2WHMA 1LL7A 2WMJA 1HKJA 2VURA 2XFYA 1G94A 4FLRA 3PZMA 5AY7A 3WY1A 1V0NA 3PZOA 1G0CA 2G41A 1I1WA 3IJ7A 1W9DM 5D8ZA 4PMQA 4EAMA 4PYSA 1QVBA 3QOMA 1SR0A 2GDUA 2YDSA 2PWEA 2XVPA 2YBTA 2WKLA 5A3HA 1DWAM 4MB5A 3EDFA 4E2OA 1E40A 2EPKX 4GI9A 1QI5A 2DH2A 2VZTA 2J7BA 2UY5A 1KBKA 3OZOA 4U3AA 1JDDA 1BYDA 1QHZA 3M6DA 3WF2A 3N17A 1WKYA 2Y5EA 2C7FA 4UNIA 1OD8A 4CD5A 6CGTA 1MYRA 4HP5A 3VKKA 2DT2A 5D9PA 3W81A 3W25A 3TA9A 3FAXA 1QNPA 5HNNA 1J0ZA 4TXEA 3WBEA 1B31A 1H5VA 3PZUA 1CLXA 4IUGA 1CZ1A 2FH6A 3RO8A 2VX5A 3QHMA 2YA2A 2YL9A 3VINA 2V3EA 4W8LA 2VO5A 3MUZ1 4YHEA 3N11A 2YL8A 2ZICA 1PIGA 1PJ9A 3B9AA 1WDPA 1JI1A 2VZSA 3AFBA 1CTNA 5HOSA 3CUFA 1NWSA 1ISVA 2OYKA 3BCFA 2WZEA 4KWUA 2WVTA 1EQCA 3BLPX 3RM8A 4D6FA 4D71A 2EXOA 1H09A 3KE0A 3VD4A 1US2A 4A3YA 1VIWA 3F5JA 3WNLA 4JL1A 1CGYA 1J12A 1C8QA 5BROA 5D9OA 3WELA 4M81A 4UQBA 2WPGA 3RILA 1W1TA 2ZXAA 3ZOAA 4U2YA 1LWJA 2J78A 1VRXA 1DWFM 1E6RA 1RP9A 2XPKA 4PMXA 4E8DA 1HXJA 1VFUA 4TTUA 1E4NA 4H8UA 1I1XA 2OSWA 1H49A 4HZ6A 3ZJKA 2W66A 1UD6A 3MUIA 2CESA 4PTMA 4MNKA 1B30A 3AHVA 4GQRA 1Y7VA 4YHGA 1UQZA 4BF7A 4WSJA 1VFOA 1W2VA 1CGXA 3AI0A 1NP0A 1CGVA 3ZT7A 1UH3A 2FH8A 1GQKA 1TR1A 5I23A 2ESCA 1BVZA 1GONA 1MVYA 1JYVA 2EPNA 1C7TA 2X2YA 3GXIA 3L4UA 3VDCA 3GH7A 1W9XA 1ZBCA 4M8UA 2CEQA 1R85A 3WQVA 1XD1A 4BQ2A 3KZSA 3L4WA 2VRQA 4W5ZA 1TUXA 4A4AA 2YBUA 4LXFA 2D0GA 3GYCA 2JF7A 2E8YA 3TTQA 1WDRA 1B0IA 2WM0A 2DIEA 4GKLA 3BAKA 5IHSA 3VDAA 3VDBA 3AMDA 1YHTA 4RE2A 1BLIA 4B15A 1KGXA 2EEXA 5CPTA 5CXPA 5JBDA 3VGBA 3W29A 3AXHA 1HVXA 1PX4A 1TZ7A 1NOUA 1UHVA 2W61A 4QLJA 2GJXA 1PEZA 2OYLA 4HU0A 1JYXA 4PMYA 3RDKA 4GO8A 4W87A 3ZR5A 1AQHA 2ZIDA 1CXIA 2WMFA 1HT6A 1KXTA 2CBVA 1K6AA 3N04A 3VILA 1V3JA 2WC4A 1B90A 4PMZA 2V38A 3RPMA 4CCDA 2CBJA 4OBRA 3L4YA 1VEPA 1CXKA 4AZCB 4ZE5A 1GOOA 2BVYA 5A2CA 4FLOA 5DT5A 4F9DA 2W62A 2F61A 3AIWA 1BYCA 2YDRA 5DO8A 2FGZA 1ECEA 1HJXA 2XVLA 1E73M 4MJ2A 4UQAA 3VUPA 4C7DA 5I78A 1MW2A 3VD5A 3GDBA 4XX6A 3ECQA 4TVUA 2WHLA 2WLZA 1HF6A 2B31A 1XH0A 3BH4A 1OB0A 4BCEA 3UETA 2G8ZA 4UCFA 3A47A 1EDTA 2V3FA 3IANA 1JF5A 4U33A 3BMWA 1KB3A 2PF0A 2GVYA 2VCCA 1X6LA 2ZXBA 3PTQA 1FFQA 3FHQA 3WD2A 3VDHA 1BPLB 4PCSA 2CBIA 1E5NA 3W82A 4M80A 1JD9A 3S2CA 4EKJA 1E4MM 4EK7A 5ABHA 2ZX6A 4CCEA 1CXLA 1UR4A 3AOFA 2XFRA 1R86A 4D6HA 2QLYA 4OIFA 2IXUA 3ZO9A 4KRTA 4V27A 4JCLA 4HA3A 2MANA 1ZL1A 3K8KA 2EPMX 1B3ZA 4U2ZA 3WF3A 4XV0A 1E6NA 4ATDA 2CHOA 4JFTA 2OYMA 2YIHA 3M07A 2E4TA 1M7XA 4J3XA 3K8MA 3CBWA 4BQ5A 2JFEX 4U5KA 4URIA 1G1YA 3THDA 3TONA 3PN8A 3BAIA 2J25A 1NM9A 3A4XA 7A3HA 4QCEA 1TVPA 5I79A 1E0VA 4W86A 2DSUA 4DUXA 4GZIA 2VL4A 1V6YA 4BA0A 1QOXA 1H4PA 2VR5A 1H11A 3NIYA 2CIPA 5I6SA 2G3NA 2VT0A 2ZX5A 2RGMA 1AVAA 1OBAA 4WK9A 4TX8A 3OB8A 2XM2A 2CETA 1JNDA 1V6UA 1M01A 2G3IA 1HIZA 2DIJA 1SFSA 1N82A 2J8FA 4BS0A 3VIMA 4CUCA 1EA9C
chains in the Genus database with same CATH superfamily
3EPOA 4K37A 1ALDA 4DO4A 3N15A 5A2BA 3S9YA 3K8LA 2NQHA 3QXBA 5AECA 3DFYA 3QZ6A 1R3VA 5I24A 4V2XA 1H2JA 4RKAA 4RL3A 1VGAA 1WKEA 4QEEA 1LTDA 1S2VA 3N9KA 1S2TA 4J3TA 3A9IA 1DJNA 1GHSA 3MP4A 4BZYA 4DZIA 3EWYA 3QY6A 1ZAIA 4OE7A 3P7YA 1SJCA 4EWND 4XSLA 1VFFA 1PXGA 5CSYA 1HN1A 4AD3A 3N3TA 4OV4A 4DIAA 1DJHA 3C2VA 3E2RA 4WY0A 3TAOA 3OLEA 3IV3A 1TG7A 5M5DA 2ZRVA 4YTUA 2V5CA 3NZRA 3OLDA 3W53A 2J7CA 3VD3A 5DCDA 1I9CB 3VKDA 3KRSA 1XIFA 2PF8A 1ML1A 1DEDA 3M0YA 3UWWA 4FMVA 3SSZA 2DVUA 1T8QA 1TWDA 3HV9A 3VOCA 2JEQA 1W3KA 1RJQA 4GCXA 1C3FA 3T08A 5K3VA 1XDLA 3RYSA 3ARRA 1ITQA 1V93A 2CZDA 3P5YA 3AZTA 3E74A 2OLAA 3W1AA 3MP5A 3SCRA 1EJUC 4F2UA 1IGSA 4XD4A 3I6TA 2DSVA 5M17A 4X9SA 3LG3A 1UBPC 3R79A 2VRJA 2CBUA 5REQA 1Y65A 2VNCA 4ORIA 1VBJA 4NX5A 3CEUA 4D6IA 2NLIA 4LV4A 3WDHA 4PE8A 5FF7A 4Q8OA 4I9AA 1E1FA 2Z1KA 1BVWA 1XHGA 3G1VA 4NSBA 4DWSD 2YCJA 3DFNA 2FVLA 1KTNA 1KCKA 2HEJA 4BKNA 4C6MA 3NYZA 3BICA 1RQBA 2FHCA 2BSLA 3EXSA 2PDKA 4IP7A 4YPJA 4TR9A 5AYBA 1T99A 3UP8A 1OFRA 4ZA0A 3SECA 1DOSA 1XIHA 3D5HA 3LOTA 3W76A 1S3TC 2GL5A 3NG3A 2VR2A 1SM9A 4UQ9A 4PUUA 4RZ5A 3DYOA 2DDXA 1R38A 4H3DA 1PKLA 2HBVA 1BKSA 5C5YA 4JL2A 4QQUA 3QTPA 4Q4OA 2J27A 3QGVA 3PJXA 3VZZA 5FKYA 1LL4A 2QJMA 1NQ6A 2G0WA 2CWNA 1MUMA 4E4UA 3TUUA 3SM0A 2AL1A 2PWVA 1CW2A 4RDVA 3EDJA 3P82A 5LHFA 4DM2A 4U28A 4LCSA 1AMYA 1FWTA 1S46A 1KWGA 4HOZA 1PZ3A 5H8UA 3KZPA 1R0MA 4F66A 4IPJA 2VFDA 3BW4A 1AQ0A 2WVUA 4LUSB 3BCDA 1KV8A 4A8RA 2Z24A 2VEIA 4PTDA 2UV8G 1W1IE 4GWEA 3VDGA 1KXVA 3IVTA 2GGHA 2W79A 1QNOA 1TV8A 1V77A 1DXEA 3N13A 2OKOA 4G2DA 1IZJA 1UIPA 2GVJA 3UWQA 3MT1A 5CSUA 3E5BA 2VD9A 2W9MA 1LDCA 2Z26A 3I3BA 2VUNA 4H6QA 4JPGA 1KWKA 3ARUA 3ZLFA 5L6UA 1HO1A 2OKTA 3V36A 1K8XA 3F2DA 3M0VA 3UXKA 4F9JA 2KZHA 5A1AA 2WBGA 4Q8QA 1SR9A 1XLJA 1C7SA 3WEMA 5MKGA 5KZMA 2A2IA 4NJKA 1Q65A 3O63A 1EJXC 1CGUA 1OCJA 2DZAA 3MMUA 4C6LA 2FFCA 1X98A 4GIRA 3W01A 1OX6A 1TTPA 4MY1A 5HNUA 4R9XA 2BOFX 3DFHA 1Q8JA 4F0RA 3EMCA 5KTLA 4GJJA 4IQEA 1WOBA 4LBSA 5DBTA 3H22A 3TP4A 2VQUA 3W2UA 2WPBA 3WFLA 2BNJA 4AIOA 2DT3A 1ZALA 3EKGA 2QUVA 3H2MA 3SR7A 4JEJA 1TFVA 1X97A 5TIMA 4PUDA 4FXSA 4S2BA 3VCCA 2Z1SA 6TAAA 4EPKA 1LQ0A 2G5WA 6XIAA 3W75A 3UA4A 2WB5A 5HATA 1A5SA 1VYRA 1OG0A 3KRBA 2BDQA 4G9PA 1WUEA 1JEZA 2ZXDA 4S1FA 4PMOA 1D8WA 1ZTVA 5E70A 4NRSA 1FA2A 3WUBA 1PV8A 3JRKA 1RCXB 3OQEA 6REQB 5HWMA 4ZMGA 1NFPA 2BVDA 2VMFA 5C2CA 1MQPA 8XIAA 3WNPA 3UZJA 3LHWA 1XCXA 5D02A 3A3XA 5J5RA 2OOFA 1XC6A 3FYYA 1QPQA 4UFLA 3PZ9A 1K4GA 2F84A 4DY1A 5KMYA 4TVDA 5FJOA 2CHNA 3IUHA 1I4NA 1PDZA 2PWHA 1FDJA 4KFPA 5AHIA 5D2VA 4IH3A 2C91A 2ZA2A 4FX8A 3PR2A 3MI2A 2A7NA 3NJ3A 4FPSA 3ZVIA 4FALA 3UGVA 4FF7A 5LGXA 3TOPA 1DYSA 2GDVA 2ICSA 4H2HA 1W1A1 3EDDA 3RX2A 1UCWA 1X39A 3W37A 4IFKA 1AQMA 1JZ5A 3WDIA 4AHQA 4DF0A 1UWIA 4W7WA 4B5NA 3VGDA 1OFDA 3O8AA 3CHEA 3WKZA 2Q02A 1QPOA 3BSHA 4FZIA 1W5NA 1XPYA 2VDHA 5FAGA 3RRXA 1IIHA 3TC6A 2AKMA 3T8LA 1OCBA 4HK5A 2X09A 3GX9A 1J4EA 3URBA 1Q8AA 4LCRA 3F4VA 2RJHA 4FEZA 1XLLA 1UWUA 3TLLA 3NCOA 2C1GA 1OYAA 4H6RA 3RLUA 4DJEC 4Z2IA 2VFIA 4M1BA 4LVFA 1IE7C 1EUAA 2PEVA 2JF6A 4DYJA 4HPHA 1V8EA 2OZ0A 3GU2A 2DY3A 1M04A 4GISA 1H63A 4I8YA 2NXGA 3ZR4A 3O6YX 1HP5A 2PURA 3C0JA 5BCAA 1JJKA 2ZZ3A 4R53A 3CPGA 5BU9A 2A3AA 1KGWA 3C3NA 4C6PA 4JOMA 3EWWA 4DLFA 1P4CA 1QHPA 3WQEA 4W85A 1MEWA 3ZVHB 4PCTA 4XBSA 3VIOA 3GR8A 4YCOA 1H0IA 4KBXA 3DFOA 4F0LA 2Y8VA 3ANVA 4IX0A 3LRKA 3N6QA 3WX7A 3H4WA 2EKGA 1NWUA 2D24A 2PRMA 4J28A 3D0CA 2QMJA 1XBVA 2YCIX 3QQ0A 3F4CA 2VFEA 3QEZA 1V3IA 1ZBWA 4LW7A 5K4ZA 5LIWX 3NYDA 2D3LA 2Z25A 2PRLA 4PSPA 3MYPA 2VEFA 3S1GA 5H1WA 2PLMA 1HL8A 1KRMA 3P8IA 2WBKA 3CUIA 4M24A 3VX0A 2V81A 1R6WA 1XJBA 4JNZA 2Y5SA 4XO6A 3HBLA 4S3FA 5U7SA 1XBXA 2WANA 3NQAA 3PNUA 3C8NA 3UZYA 3B40A 4GZJA 4R88A 3CWNA 3G24A 3EBVA 3DHUA 1XSIA 2BY0A 2QCCA 4QQ3A 4GHRA 3WH7A 1RZMA 1R9YA 2Z0IA 3EYPA 1Y5WA 3W7RA 1S5NA 5ABGA 3SN4A 3WLQA 2QDEA 1SYTA 4FR6A 3BOLA 3F03K 3IGUA 2EPHA 3O2LA 4AZBA 4AZ7A 4ZQOA 1SQ7A 5A8PA 2VFHA 1P6WA 3CC1A 3R2GA 2WYSA 5JMUA 2WKGA 3PBVA 4UQDA 4GINA 3GTFA 3TEVA 3IJ9A 5LYRA 2I9EA 5I3DA 1K3UA 1E6SM 3VNZA 1ESWA 3NEHA 2FZMA 2WC7A 3UNTA 1GGOA 2NV1A 1HGYA 2GUYA 4D2JA 3VD9A 1D3CA 3SW6A 3CLMA 4GUHA 4WF7A 3PUOA 1CT5A 2J8GA 3BW2A 5EA9A 3Q37A 4GFSA 1UPPA 3B97A 2GSJA 2PDJA 1QI2A 2QF8A 3I68A 3CL6A 2A6NA 5DN1A 3THCA 2PGEA 1EL3A 4CCZA 3LQLA 4IJRA 3MANA 1TWZA 3V35A 4NRRA 4AMCA 4BI5A 5EB8A 3ZJ6A 2PBOA 1W5OA 2LLEA 3O3RA 2XGIA 1JQVA 4H6EA 3GH5A 1DP0A 3VABA 3UVAA 2IXVA 3N1AA 3EOUA 1UA7A 3QPZA 4LF2A 3HFYA 8A3HA 4JQ2A 3L5LA 1FCQA 1UR1A 4O53A 3KWXA 2C8NA 4X0NA 1NOWA 1L6FA 1W9VA 1MEHA 4CNUA 2XVKA 2PDQA 3E1F1 3PSWA 1J2BA 3KVJA 3N6JA 4IMGA 5HMEA 1JD7A 3EOEA 1J11A 4IICA 1UJPA 3W1UA 5F2LA 3UEQA 1ECQA 3VCRA 2BS9A 3CPRA 4E38A 3DYMA 3H55A 2DVTA 4NVTA 1CGTA 1EC9A 3NL5A 4E2DA 1UD3A 3NSXA 3SJNA 3W7HA 4DJFA 2J6VA 3GYEA 3VIHA 3TXZA 4L7ZA 3KUMA 4XSMA 1X1ZA 4LUSA 1KLYA 1ZHAA 4UOJA 4L9XA 1JQXA 3IAPA 3UZ5A 3C0SA 2D2GA 1MNSA 2FTPA 4UCGA 4C6FA 3EWCA 4EX4A 1UKPA 1BYAA 4KWSA 1ZJBA 4R27A 3P61A 4Q8MA 5AZ1A 3MMDA 1K8YA 2BHUA 5BU6A 1FDZA 3W7DA 2O9TA 1NAL1 1PZ2A 1LYXA 4Y9NA 4LY8A 2YCKX 3WQWA 2CNCA 2GUBA 2OFJA 3SGZA 3LB0A 2CXEA 4HIBA 3PJUA 3BPWA 3SI9A 4IMEA 1DIDA 5HQEA 1YE6A 2GQ8A 4JN8A 1UC5A 1U2YA 2J7FA 3TC7A 2H8XA 4AF0B 3G8RA 9RUBA 1UH4A 1DL3A 5GNYA 2V5JA 4AC7C 2X05A 2OSYA 4TU1A 1ITUA 3TMQA 3SIZA 1WUFA 1G7UA 3CIVA 4E2VA 3WQ8A 4IJCA 4HB7A 1OFOA 5DELA 1O4UA 3WLIA 3QZAA 4HNNA 5D2WA 4J27A 2R82A 1R3QA 4S3DA 3LZ3A 2YR1A 3G5EA 3FJ6A 3R7MA 1KRAC 5FCZA 4LYPA 3VGEA 4MDOA 3EOSA 1J5TA 3FCPA 3M46A 6REQA 4C6NA 4NF7A 2ZDRA 4X63A 3W02A 2HISA 1XRVA 2HDJA 2QYGA 1LRQA 4QJ5B 2HCVA 4DUVA 1UUQA 1GHRA 3EX1A 5HWJA 2ZTJA 3ABOA 3BZJA 4NXKA 5CH9A 3AS3A 5IFTA 3TDFA 2XGBA 4J3VA 1LBFA 4O52A 3MCNA 3H12A 1ME8A 3TW7A 4U4MA 2VM8A 3ZXWA 3AISA 2QAFA 3PZGA 1OF6A 3B8VA 3O1NA 1LCOA 2IMRA 3SFWA 1W9PA 3POCA 3IJQA 2XH4A 2E1WA 1EXPA 4UZUA 4QIUA 3LK6A 3WJSA 4ZTXA 3VIFA 3CUGA 1HKKA 4L4LA 5BOEA 1NEYA 3NQBA 2PZ0A 3V5CA 2AAAA 3WUGA 3ICJA 5BXRA 2ZZ4A 1TIWA 4PL2A 1PX3A 4TQTA 2WLYA 1JYNA 4EXAA 5TF0A 1DBTA 2O9PA 3LDVA 4LUJA 2NQLA 2GQAA 5IRPA 1EJWC 2VFFA 5DT7A 3EDEA 4F2BA 3MPGA 3W1RA 3G8EA 3PBWA 4ZB0A 3AALA 2PODA 3EKLA 3HG5A 4H9XA 3S1XA 3LN3A 4X60A 2TYSA 4A29A 1RCOB 1W0MA 3H7UA 5ECUA 1XH1A 1JGIA 1YNQA 5BWFA 3LZ5A 3TTYA 4W5UA 4UTKA 1UR2A 3IWPA 1B4EA 1N2VA 2E9LA 4F40A 2IS7A 2B7QA 1C90A 2GJXB 4FR1A 3ITXA 1HJSA 3MYOA 1XLDA 1PCWA 4R5EA 3PZTA 1UZ4A 2WSKA 2PUZA 3L2LA 4W8BA 1ISXA 1BWKA 4B3KA 1FXPA 3KL0A 3VM7A 3ZVHA 5TNVA 1GCYA 2WZIA 3VOFA 5I2UA 1Q6QA 3MKVA 2YBVA 3MMTA 4IFRA 4UFIA 4XBJA 3GG8A 2RUSA 2YFOA 3FJ4A 1XI3A 1ME9A 1TRIA 3S9IA 2V5KA 4B5WA 2BGSA 2GVLA 1NWRA 4A3HA 2HS8A 3I4EA 4TO8A 1G01A 4Z08A 3R12A 4IPLA 4FLSA 3CS2A 2OB3A 4NNCA 2NQ9A 1WKDA 2FGLA 3NO5A 2VEPA 3S2LA 1KFEA 3ABZA 3W26A 4M19A 1Q4WA 5HINA 2ZZ2A 3MUAA 3WL1A 2PC4A 2QCHA 3PUEA 3KRZA 2GOUA 2NZLA 1ZQ5A 4TVCA 1YDNA 3AXIA 5TAOA 3UJEA 1O1ZA 2D0FA 3NR0A 2QIWA 2E8ZA 4J5NA 2X7VA 4WR3A 5HPCA 3NDOA 3TYZA 4PMDA 1TPFA 5J8LA 1QNSA 2O56A 3AS2A 4LAOA 2V2HA 4M7TA 4UR9A 4BQ3A 4V1YA 5CGQA 3ORWA 2A3HA 3UBPC 1JUBA 2DFAA 4HMEA 4I6VA 5D37A 4ZEPA 2YLAA 2B7OA 2A4AA 3GNOA 1DPMA 1PWLA 3EOOA 1WZLA 4K1GA 4QTGA 1HFBA 2BWGA 4PBEA 5M3WA 1VBGA 1MWOA 1XLHA 3WQ5A 3PZIA 1EPXA 4AZIA 1ONRA 4IGNA 3UZZA 3J7HA 4R3UA 5TBOA 2ZWYA 1OZMA 2NSXA 3FYOA 3WLRA 2J7HA 1VHCA 5EFFA 2CZEA 2E6FA 2ZBTA 3TJXA 1E9LA 2VEKA 2E1DA 2J66A 3GW3A 3I7RA 4HZ8A 3LSBA 3T0BA 1FCUA 4S38A 1HGWA 3ZLGA 3CZKA 4LVDA 4D6GA 3K13A 4LB4A 3ZS4A 1D9EA 1F3TA 2RAGA 3BWWA 4Y9MA 4HOXA 4PUNA 3LTPA 4S39A 1FCBA 1F2JA 2X8RA 4JICA 1ZP3A 4DWSA 3DENA 4B16A 2I5GA 2Y2WA 4JN6A 3PSVA 3HGOA 3TU9A 2O9RA 4KRZA 2YX0A 2PSNA 4F2TA 1K8CA 1XIDA 3P8JA 2X16A 3UT0A 2C0AA 3TX9A 4AEEA 1QW8A 2OZTA 3U57A 3GTNA 1FHLA 4XZNX 3BG9A 3PG8A 5CZKA 4ZQNA 4J4KA 2Y4SA 4UTWA 3LMYA 1VH7A 2GLKA 2VGGA 3OTRA 1HG3A 3QRHA 4TMBA 4H9MA 2PS2A 1WKFA 3B9DA 3GBDA 1TE1A 2FMNA 3TJIA 2H90A 2BOGX 2EG6A 4NT0A 3DZ1A 4KH2A 2C14A 2PBGA 3ARZA 3IIVA 3CAWA 3UD6A 4B3LA 1R2RA 1TA3B 1H60A 4FX7A 4FSAA 3TQ0A 4GYJA 1Q4NX 5JH1A 3R8RA 2ISSA 3ONBA 3IPWA 2DSWA 1BQGA 1O12A 2PAJA 3FFSA 4O1CA 2E40A 2ZUMA 3RPDA 3FAWA 3DBNA 5FF2A 2FZ9A 2J7EA 5D2XA 2RGLA 3MVTA 2BXZA 3TYBA 4MFDA 4XK2A 1XP3A 4PN2A 3M0KA 1TWWA 3B8DA 1LOQA 1JGMA 4AYSA 4WKFA 1ADDA 1G7VA 3GQYA 3AO0A 2WMJA 2VURA 1G94A 4A3RA 4KEMA 1V0NA 2G41A 1I1WA 4ZOCA 1W9DM 3TYCA 1W17A 3SY1A 4PRRA 4PMQA 4JDYA 3GW0A 1OX5A 2GDUA 1BWLA 1S1PA 1EZWA 2WKLA 4B5TA 2VD8A 1BRLB 4NU7A 3M43A 4XVDA 1YXCA 3AXKA 1RALA 2DH2A 3THQA 3VYLA 2J7BA 1HQTA 4AF0A 3M5VA 3O05A 1E0TA 1JR1A 3GSMA 3QMSA 3WF2A 4QG6A 2A21A 1OD8A 5ENLA 1U5VA 5T9CE 4WXYA 2I56A 2OR2A 3W70A 3W81A 3S9ZA 3W72A 1TPH1 4YWIA 3REQB 1OG6A 1H5VA 1DQXA 1WX0A 3PZUA 3TR9A 3WJXA 2C15A 3CNYA 2FH6A 1MZHA 3G1XA 3QHMA 2YA2A 5DXXA 3UZXA 2YL9A 5FF3A 2V3EA 4TX9A 3NPXA 2VO5A 3NTYA 1PKMA 4Q6JA 4YHEA 2YL8A 2XIJA 1CTNA 3BJTA 1VQTA 2WZEA 3RM8A 1I2OA 4DPPA 2QULA 1YIXA 2QAPA 5EGRA 1TIMA 1VIWA 3F5JA 3WNLA 3O0KA 3NM3A 4PFMA 3KTSA 4HN8A 3M9YA 2WPGA 3LQGA 4H9YA 3HFTA 5DLCA 1OFAA 2A3LA 1E6RA 2Z1XA 4JGDA 2V5BA 3DFTA 3W85A 1XINA 5LHEA 4AVOA 4NASA 1TTIA 4YMZA 1FCVA 4K7VA 4HZ6A 3IJDA 1WXYA 3MUIA 3K4WA 3W1XA 4WQ6A 4LB3A 1UQZA 1WQ5A 2P50A 2FGBA 3VNIA 1A5LC 1VFOA 1W2VA 3U2OA 3AI0A 1CGVA 4HN4A 3ZT7A 4YIWA 4ICMA 4C6DA 2ESCA 1BVZA 1C7TA 5DCEA 4FO4A 1TPUA 3L4UA 3L4WA 5HJYA 4W5ZA 1XKYA 1E9YB 2DUAA 1W3TA 2FVKA 1V79A 4IGHA 3GYCA 1UP0A 4D8ZA 2EAWA 2DIEA 4GKLA 3VDBA 3OHIA 3M5ZA 1KRCC 4K39A 1BLIA 3G0UA 5JVLA 1NOUA 1MO0A 3NL3A 3QY7A 2GJXA 1PEZA 1H7OA 1O1HA 3QLDA 3WLLA 3Q65A 2NWSA 1I0BA 4W87A 2ZIDA 3SADA 2WMFA 2PMQA 3KCJA 1K6AA 1B90A 4C1KA 4PMZA 1XLFA 3RPMA 4CQBA 3TC3A 1CXKA 1SO4A 4N7QA 2BVYA 3HGJA 4NZJA 5DT5A 1VP5A 3B4YA 3IVUA 4L6HA 4FS9A 2ZA1A 4Y2WA 3SN1A 7PTDA 1DJXA 1KCZA 4MJ2A 1RV8A 3RR1A 3TN4A 5I78A 1IEXA 3BUVA 1WOAA 2QVHA 3GDBA 3L9CA 4TVUA 2A7RA 3VNDA 3GNXA 2B31A 1XH0A 2Y6ZA 1R5YA 3BH4A 3U4FA 2G8ZA 2OG9A 2YPIA 3A47A 4WOZA 1JF5A 4I3GA 3DHDA 3FK4A 3DKLA 1X6LA 3VDHA 4PCSA 1A5AA 1TJ2A 1KFBA 3EX6A 3QQ1A 3DG6A 4CCEA 4JX6A 1UR4A 3EWUA 3AOFA 2XFRA 3QBUA 1R86A 4I5XA 4D6HA 2QLYA 2X2GA 4OIFA 3S4TA 4PA8A 4G1KA 4V27A 4HA3A 2REQA 1ZL1A 2EPMX 4XV0A 4ATDA 4LUTB 2CHOA 2ATSA 1H7WA 5KITA 3BG3A 1AH4A 1FWNA 3CBWA 4OUIA 2ZQ0A 3M0JA 4U5KA 2OCZA 4FNPA 1Q5MA 4JTSA 3THDA 3TSMA 1UB3A 3TXVA 4K2SA 3LS9A 2OO0A 3A4XA 4BHYA 4PUMA 4UTTC 4GZIA 4XBKA 2VL4A 1EBHA 4AMAA 2GSHA 2GWGA 3OODA 1DTNA 1UZDA 1R3TA 2WJEA 3KS6A 1AVAA 4WK9A 1HKWA 2CETA 1QU4A 1JNDA 1XG4A 3GXTA 3L66A 2DIJA 3IJ6A 3D6NA 1N82A 2WJDA 3QW4B 4CUCA 4RNFA 4C1NA 4GJIA 4GYPA 2QT3A 1GQIA 3BGAA 1V6TA 4I7VA 5FD0A 4GXMA 3GIPA 1GKRA 3BTNA 2VCAA 3CAQA 3V16A 3I7QA 3AQUA 3D3AA 3PHAA 2WXDM 4WKAA 3V4BA 2PP1A 3WSUA 2BV9A 4FLQA 2WNNA 1YTDA 3U2CA 5AYXA 5CJ5A 3EA3A 3VNLA 3N4FA 4H9UA 3ZQ9A 2HXTA 4W7UA 3L5MA 4YXGA 4OOZA 3L4VA 3MKCA 5IDIA 3NQDA 4DVOA 2J62A 1AJZA 1F07A 1FY6A 1FUYA 1MSSA 1A47A 3PB2A 2DW6A 1XGDA 3OA5A 3W7QA 4OUEA 4C7GA 1UOKA 1NIUA 3ITTA 3WBAA 2PZNA 3U2EA 3KVMA 2VENA 2PA6A 4Q4QA 5D33A 1FKWA 3W1TA 5D30A 5LA2A 4PUKA 2O92A 1GG0A 4EF9A 1KTBA 1JCYA 1XH2A 3AU6A 3RNDA 1NTHA 1FHDA 4QSFA 3BARA 4N4QA 3DAQA 5PTDA 1CNVA 3L7RA 4B3ZA 1VFMA 1HNYA 4OKDA 1MDLA 1FWRA 3B8SA 2CLMA 1RAKA 4GQBA 4ADSA 1S2AA 3NQ6A 3S5ZA 4YYCA 4S2CA 4JX4A 1EQPA 1X8CA 2J7GA 1M03A 3NZ1A 1VC4A 1UD5A 4M6QA 2XDFA 4J9JA 1AH3A 4QP0A 3BANA 3KBJA 4GUJA 4H9TA 5EMLA 3W7LA 4AEOA 4MB3A 3VMPA 1TA3A 1OCNA 2YCEA 2YDQA 3AIQA 5EMYA 4FB7A 1RHCA 4OJYA 2QR6A 4MFEA 1SSGA 3L2IA 3R5EA 3OVPA 3GTHA 3MUCA 3AICA 5AZ0A 2ZKMX 1OSEA 3W28A 4J3SA 5AYIA 3CGTA 5DEZA 3T2OA 2V8ZA 3MDUA 4U5IA 3F2CA 2GVGA 3CUZA 5F4WA 2WMGA 2P5NA 1FKXA 2Z27A 3H4XA 4LVBA 1SZGA 4RJEA 1JYWA 3UY7A 2OSXA 3VIKA 3CYJA 4P7QA 3M64A 3V0SA 1EUNA 3QHNA 2WSPA 1W2PA 3QR0A 3VM5A 2XZ9A 2ZE0A 2QMKA 3AS0A 4MNJA 3MSGA 1BRLA 2ZRUA 1E6PA 4RV3A 1M9HA 2QPXA 1M1BA 3B8UA 1KKRA 1MNZA 1AW5A 2VR4A 5D03A 4BWLA 3CEPA 1OFQA 3WG6A 3BLEA 1QTWA 2WK2A 3KTXA 3P14A 4KETA 5CZSA 3AUJA 5LKYA 1Q6FA 5I77A 1GVQA 1JUKA 3OZMA 2XWEA 1UKOA 1IXOA 3F4NA 4AC1X 1UR8A 4ZE4A 1BQCA 4IIDA 4G8TA 3VOGA 5HPOA 2UWFA 1BF6A 3REQA 2C71A 4QM1A 3MBFA 5CC5A 1FWDC 2Y7DA 1TJRA 3FIGA 3HMJG 3CQJA 3BGJA 3AJ7A 4GQGA 3RPTA 1DVJA 3PPHA 4I6KA 1B9ZA 1L9WA 2YZRA 1V3MA 4AD2A 1OD0A 2EJ1A 2Y70A 3OQ8A 1LM1A 3A4WA 3WL0A 1G6CA 3MQTA 3NEVA 2TPSA 3WK1A 1NOFA 3R4IA 2E9BA 1ZNNA 3W7CA 2I5IA 5FEWA 4QAWA 3R0KA 5DXYA 4XISA 3WDJA 3OGVA 4IISA 5BWAA 4JQ4A 2QCDB 1K03A 4C6BA 3GS6A 2NUWA 5AOUA 3LHTA 3OIHA 3N73A 1U1UA 4OHQA 4LAZA 2I5QA 4A6GA 1J0HA 1RY8A 3BJFA 2BHZA 3KW3A 3QC3A 1XYFA 3R43A 2AMXA 2AOSA 3NNTA 2I57A 1UMLA 4PR4A 1VB9A 1VJSA 3FV9A 3PJTA 4MWAE 1CYGA 2VGBA 4F3HA 5G2IA 2Q3OA 4IIBA 1C8XA 4C5YA 1FQ0A 5LA0A 3TA6A 1P43A 4O17A 4DPQA 4M6PA 1H1YA 1VCVA 4HMDA 2DZSA 4O1AA 4I5UA 4H8HA 3IGHX 2GJLA 4P7NA 4REQB 3WLJA 4TTGA 5F1VA 3SCWA 5F1UA 1A5MC 4QAIA 1K9DA 1OGBA 3PWIA 2HXUA 3WH8A 3E6EA 1UZ1A 3VAVA 1LF1A 4AZGA 3E0LA 4HJFA 3UVIA 1B3YA 1TYGA 3G6LA 2PDYA 1EC8A 3P84A 1BYBA 1GUVA 4MPKA 4GGHA 2PDUA 1ISZA 6TIMA 1YBQB 2CERA 1EP2A 2DQWA 3T0DA 3VIIA 3AHZA 1S38A 3QPYA 4D6EA 3WD4A 4O12A 4JTTA 1QBAA 3L0GA 2ZCGA 1XYAA 2XM1A 4JR5A 4Z2HA 2J75A 5BRBA 4L6OA 3BLKA 4AD1A 5BZAA 4LEQA 4QEHA 3LBCA 3KFTA 5CPLA 3ZM8A 1OM0A 4MB1A 1D2KA 5D8WA 3DX5A 4JTRA 1YPIA 1H5YA 1BF2A 1M6JA 2RDXA 3MVIA 3U5YA 4CQDA 2YA1A 3R58A 3B9NA 1S5WA 1SW7A 1IR1A 3T09A 3M16A 4B9YA 1XYZA 1XS2A 2VFGA 4OVXA 3OLGA 4S3BA 2AGKA 1FWJC 3H24A 4RCXA 3UJRA 2WV8A 1UPMB 3LENA 3BMVA 3APGA 1OFBA 3W6MA 3MWCA 4IIFA 4WJEA 2FHFA 1SJBA 3MCMA 5F7UA 1QASA 2CITA 3QLLA 4HKPA 3T81A 4MVAA 3GDKA 1DWHM 1HVQA 4GI6A 1TX0A 3LCGA 4L56A 3M0MA 3RLHA 4GA8A 4LUTA 3CIXA 2X1RA 1F76A 1G4PA 1UR0A 3MV01 4UFHA 2P3EA 5E5CA 2O7SA 1U83A 4GH3A 3GDLA 4KCVA 2J74A 3URQA 4UB9A 2INEA 1DE6A 1B57A 4MM1A 4N02A 1DJIA 4QRNA 5CZ0A 3W7NA 2CZFA 2WVVB 3E0VA 2GYIA 5K9XA 5AKQA 3AIUA 4IWWA 2HK0A 4YCPA 5CC6A 1QNQA 4NY2A 4JTGA 2C16A 2DT1A 3POHA 1MQRA 1OYCA 2HRWA 1TV7A 2QF7A 2VOTA 3HGSA 3DKJA 1EGZA 2GDQA 1EXBA 4IXXA 4Q8TA 1RH9A 2VVNA 1V6XA 4NUWA 3T7VA 2ZX8A 5C9XA 3RM4A 1JRBA 4H83A 1MUCA 2VVSA 1E15A 4JYDA 5BXPA 1TUFA 4D72A 2QIIA 1DJQA 2EJAA 4RNIA 1I0DA 2UY2A 4HPJA 2AAMA 2YKKA 4JIHA 3FX4A 1GJPA 3QQWA 3TW6A 2E6DA 1UWRA 2DZBA 4C6JA 5I3HA 4C6EA 4Y9AA 5FACA 1OYBA 3SFKA 1B1YA 1Z41A 3VU2A 2XH0A 3O0FA 4QE1A 4NJGA 4U31A 5BNKA 1E0XA 1Q6OA 4AXNA 2G95A 2VZUA 1I60A 1DIEA 4OGZA 1CLKA 5LNWA 1KM2A 4DJDC 3LLDA 5GJMA 1JXKA 4HMCA 2ZX7A 3BLIA 3H2EA 1E4IA 2EPLX 1Q2SA 1X6UA 1OK4A 5DMLA 1BXNA 3GWQA 4IX2A 4GXWA 3MI3A 1UH2A 5G1MA 5LGZA 1B5TA 1YX1A 4AWTA 1LJYA 1UA3A 1J0YA 3VIJA 4JTCA 4IIEA 1B2YA 4LAUA 1QO5A 1BG4A 1RK5A 5GVJA 1HZYA 3E12A 4J2PA 1PKYA 2GGIA 4WSKA 3IEBA 3GNNA 3H54A 4KGJA 3TNBA 3E49A 4PULA 4F0HA 3ABQA 2HE8A 2O4QA 3BXWA 4Q8UA 2Z2AA 3NOEA 4JNMA 5G4HC 1FTXA 1ZS2A 5D9MA 1H61A 2BB0A 3RHGA 4E8GA 1F4HA 2TRSA 3K4AA 3CQIA 5C55A 4PBFA 4KFOA 3S5NA 3SGGA 4BQ4A 2WNZA 2X42A 4PBGA 5I3FA 4DWDA 4PUEA 3HQ1A 5CGTA 3IIOA 2NXHA 1JPIA 3W1NA 3VGGA 3L4ZA 2WJFA 4GUGA 4A21A 4GZ7A 3WF4A 3S6TA 4CD6A 3PF3A 3A22A 2WCAA 4H7VA 4WCJA 4GCAA 2NT0A 1POJA 5DQPA 3GBEA 1OCQA 3N25A 2E5BA 3TZNA 4O57A 2PFHA 4JHZA 1WZMA 4XUYA 1E9IA 3GKAA 5G4WA 2JGYA 4O0ZA 1O6IA 3VIPA 1UKSA 4U3CA 4IL0A 6ALDA 4DX3A 5KZDA 3H2OA 4JCMA 7CGTA 4OTKA 1OFEA 1EC7A 4ZXLA 3AROA 1TKKA 5CAHA 4QX4A 3TQKA 5LNRA 3B9EA 4LGXA 3F5LA 3WJWA 4ZR8A 3HG3A 4LPCA 2OTDA 4MJMA 1UC4A 4JYFA 4K68A 2X7WA 1XDJA 2A7PA 2H6RA 3OYZA 4K8EA 5CAKA 2XFWA 5CQ1A 3V0TA 3DI1A 3R8HA 2PDPA 5LIUX 2VCBA 2A1YA 1E51A 1NFBA 1W1B1 3DECA 4DM1A 5MF5A 3L4XA 4W8AA 1CI1A 1W8SA 2GK1B 3OHMB 4D1JA 4ACZB 2QDDA 3FGCB 4XZWA 3N34A 5DCBA 3WK0A 3UWYA 1Q6CA 3ITOA 4B2DA 3LBOA 3W7JA 1ONWA 2P3ZA 1MRQA 3UCCA 4CGTA 3CJPA 3OBEA 4CU6A 2J6XA 3OG3A 1LBMA 4FI4A 1XGZA 5E9AA 1JZ7A 2PDCA 2A79A 3S2JA 1OC7A 2PCQA 1GW1A 1UG6A 4YVPA 3T2PA 4PL1A 4IG2B 5A6JA 4B90A 2QCLA 4PTWA 4O10A 1R3RA 3QPEA 1JPDX 4CU7A 4KRUA 1PIFA 3PM6A 4N6EA 1EHNA 2QCDA 1S5VA 4DZHA 3TWAA 3A4AA 3OVQA 2VI0A 3CV1A 4HPXA 4BEQA 4PGLA 1IEQA 4Q7IA 3ANUA 4IFOA 5C71A 3W1PA 2ZYFA 2WC3A 4HGXA 3VA8A 1VEMA 1GEQA 3ENLA 4GVHA 4GACA 2ZUNA 3CHFA 3JR2A 4NZ4A 1ZJHA 4ZO9A 1OQFA 2QQ6A 4HPGA 3AZSA 4CNPA 3ARQA 4FNRA 1M5WA 4AX6A 2BTMA 1SVDA 3WK3A 3KLLA 4MB4A 5FAJA 1IEWA 4O4VA 3WMCA 3IVSA 3BAWA 3W88A 2DVXA 1GZJA 1QHOA 3CWOX 3E2QA 4FP1A 4GH1A 1XIJA 4O28A 4REQA 4FOKA 5HA7A 4XTDA 4NI3A 3VOIA 4FIRA 3P2VA 4Q8NA 3C5QA 3CTLA 2VJXA 3NQGA 3LM3A 1ISYA 1UWQA 1FWFC 1KXHA 3KTCA 1IIGA 3NZQA 4AWUA 3SCUA 3SZ8A 4J1OA 1AW2A 3IS4A 4Y7EA 3VD7A 2DSKA 2HK1A 3TMLA 4ROPA 4LAKA 2H3DA 1VF8A 1IEIA 2V69A 1UYQA 1HW6A 4C7FA 1MDRA 2OEMA 3HF3A 3WMSA 4LBRA 5FL0A 1RK6A 3RGTA 4IHCA 1UASA 3GZ3A 4MWAC 2AQWA 4AD5A 3CAVA 4RX0A 3UESA 2NVDA 5C2XA 4GLEA 4X0VA 5DX7A 3PTDA 1KM3A 5BMXA 2WCGA 4MZ1A 3VK5A 3OVGA 1HTIA 3H2CA 4LH8A 5KSWA 3C2OA 4YTSA 5F2GA 2VP8A 1LP6A 2PC8A 4QXIA 4GX8A 2XH2A 4JTEA 1R46A 4W93A 5D09A 1US0A 1IXNA 4S3EA 3UR7A 2D69A 1P6BA 1OT1A 5CBIA 1E1EA 5GJPA 3ZT6A 5E6ZA 1A3XA 3S0CA 2YJQA 2YOCA 2PRHA 2NV9A 3G18A 4L4OA 1SJAA 1JIBA 4CN4A 3NQ7A 5KZ6A 3GLCA 4FIQA 2ZWZA 5AYZA 1FWIC 4PTVA 1FP8A 4BI6A 3CMGA 1IYXA 3SUUA 3WQOA 3S3GA 1XD0A 3GHUA 4EPDC 4XAFA 4FXRA 1KM5A 1KKOA 1W3JA 1JAKA 2BP1A 4LNYA 4IFKB 4NX0A 1XCFA 3SRHA 4DF1A 2DQXA 4IT1A 2WSRA 5ABTA 3I10A 3TQPA 4MY9A 1LG2A 2BVTA 4Q7NA 1W32A 6A3HA 3D46A 1CIUA 4POCA 4CN1A 5E1QA 1RD5A 4H19A 1V0MA 1CLVA 2WVVA 4BY3A 1LWHA 1SFLA 1P48A 1BD0A 2OX4A 3EAUA 4A2SA 4HQVA 3W7GA 2CXGA 4UFKA 3E2SA 4M0XA 3DC8A 1J8VA 1JF6A 2D3NA 3TH6A 4DBSA 1OC5A 3W9ZA 3AWOA 3XIMA 4IXHA 1IZKA 3CL8A 4KFNA 1RA5A 3NDZA 2O9OA 1RQHA 3GR7A 2AKZA 4N9DA 4R7WA 4BF9A 1VHNA 3QM3A 2BFGA 1JFHA 2H3BA 1W9BM 2PP0A 3GAKA 3FEQA 3HG4A 1A5BA 4MGGA 5A8OA 3ISIX 2QCGA 3K4DA 4WSHA 1F3EA 2GFTA 1DTUA 1E56A 1NDWA 2E3ZA 3O7UA 4ROQA 2QPSA 7TIMA 4UNLA 1OEPA 1XLIA 4IMCA 3V5OA 1B3WA 2V5DA 1QATA 3SURA 4ERIA 1F74A 1MMFA 1V08A 3G1AA 4Y9OA 4P2VA 2CKRA 1XPGA 1A0EA 9XIMA 1EBGA 2HTMA 2PDGA 4V15A 3QMTA 4GJ1A 5GJNA 3QSRA 4XKYB 4W7VA 1UOZA 3GU1A 4CQAA 4JTJA 1Z7AA 5A8NA 1J96A 1UD4A 3HN3A 3KRUA 1ME7A 1TPC1 3KHDA 3H53A 3M7WA 3W23A 2VQTA 3EMQA 1EYWA 1TWSA 4PMJA 3BJSA 4WIWA 2W5FA 3NL2A 2ZUUA 2R8WA 4HSNA 3FDKA 1OGGA 1Q6GA 3F5KA 3W22A 4IMAA 2AGTA 4HBKA 4UNKA 3WH5A 3LGDA 2CCRA 4GYFA 4NZ1A 4JIEA 3S5OA 4UTMA 4JIIX 3HA1A 4HHLA 3M7SA 2XVNA 4D8LA 1TPVA 4QG9A 4CN6A 1J18A 5HK4A 4AH7A 9CGTA 4QDWA 3VO0A 1TTQA 1XLKA 3EA1A 3F7JA 2HPMA 2V30A 4LQ1A 2I14A 1G9HA 4GIYA 3QV9A 1RD6A 5DRIA 1BFNA 3EX4A 1ZU8A 1M65A 5LIKX 3PZVA 4IP4A 1AFSA 1KFWA 3VNYA 2J13A 1MW3A 2XSXA 1RJRA 2YCLB 3TQVA 3WEZA 4KWWA 3OP2A 4AD4A 3ATYA 2W6RA 3WNMA 3HO8A 1SSDA 1MXGA 3EX2A 1K6WA 1W3IA 3SUVA 3U7VA 2FKPA 3CXOA 1QWKA 3PAOA 3LPFA 1PCKA 5JQ9A 1B4KA 1KNWA 3AHTA 4O0KA 1T7LA 1PTGA 2TSYA 4GD0A 2Z4GA 3W73A 3L67A 2ZA3A 2EG8A 1W3LA 3GVVA 1PS9A 1PL9A 3LMZA 4XG1A 3NVDA 4H04A 1FH9A 3AMCA 4FXJA 2HSAA 3U5UA 1JZ6A 1EDGA 5HJXA 5CGMA 4Z0SA 2PLKA 2VUYA 4XAGA 3V7PA 3PBGA 2X0YA 3GFXA 1QI3A 2IKGA 5AHLA 3WUEA 1DKWA 2IPJA 4Z42C 1T40A 3CLWA 4EE9A 1TV5A 3G6MA 2QV4A 3GE7A 2GK1A 3WNNA 4ACZA 1NFGA 2J47A 2FDMA 4H9VA 4PRWA 2WHMA 3FGCA 3K1GA 3GAYA 4K38A 3B0XA 1NDVA 3PZMA 5AY7A 1AH0A 1I2RA 1Z6KA 1OC6A 4NG3A 2VEGA 1R9XA 5E0KA 3BOFA 3QOMA 1SR0A 2HS6A 2C1IA 2YBTA 4IG2A 1T5AA 3NPUA 2OMAA 3P0WA 5A3HA 4GI9A 4LSBA 2UY5A 1WAUA 3OZOA 3LM7A 1EWDA 5CKSA 3T8QA 3M6DA 1IQ8A 1AD4A 3IUDA 3RCYA 2VWSA 2HMCA 4IGMA 2Q8ZA 4HP5A 4RR4A 2B7NA 2PTDA 5HNTA 2NX9A 3XINA 2EG7A 1VFSA 5C7HA 2QUNA 1VKFA 1I45A 3APTA 5XIAA 1B31A 1K77A 1WV2A 5FEXA 2J24A 1HL2A 1CZ1A 4IUGA 3L68A 3H21A 4FX6M 3RO8A 4WD0A 4ALDA 2JKAA 5J04A 2PDIA 2INFA 3G22A 1VZWA 2WKJA 4W8LA 4LEFA 4XZ9A 4AY7A 3MUZ1 1M7OA 5EYWA 3B9AA 1WDPA 3R10A 3AFBA 2Y7EA 3CUFA 1TQJA 3PAJA 2J9YA 1ISVA 4DI8A 3TNOA 3ZWTA 1MUWA 4KWUA 3BLPX 1UUMA 4D6FA 2PDWA 2D2JA 5A6TC 3RLGA 3VD4A 4KWOA 1N8IA 5BMWA 1CGYA 3LLXA 3T42A 3NQMA 3RILA 1W1TA 1Z3NA 1I8JA 3UPBA 4RW5A 1RP9A 2BX7A 4O1EA 2NQZA 1E4NA 4OT7A 4GBDA 1A5NC 1I1XA 1QJWA 1H49A 1W3NA 4FNUA 1B30A 2Y89A 4GQRA 1H7RA 1Y7VA 4NZ5A 2HVNA 1EJ7L 3UNDA 3H7VA 3F4WA 1C9DA 4BFAA 2VYOA 3UQNA 1SZRA 1A50A 4AXKA 1NP0A 1GQKA 1EJRC 4O14A 3KBVA 5I23A 4EWJA 3CWHA 4LS0A 4BK9A 2EPNA 2YSWA 4NP7A 4L6DA 3VDCA 4DEFA 1W9XA 4M8UA 2X30A 1XD1A 4BQ2A 3KZSA 5H8MA 1TUXA 1EX1A 2DP3A 4OFCA 4Q8PA 1GWJA 2CLPA 2IPGA 3S1WA 1R30A 3B4UA 4X2RA 3AMDA 4XAPA 2DUZA 1TMLA 5EMMA 4LUIA 1G4TA 1BSLA 4RE2A 4B15A 1W8GA 3VGBA 3AXHA 2ABBA 1O5XA 4C6QA 1ONEA 3Q45A 3ZLHA 2CLOA 5EKYA 4Y8FA 1JUEA 4ZOBA 2E5DA 2NQJA 3N04A 1F73A 2NWRA 3N6HA 3VILA 2WC4A 4OBRA 3L4YA 3B0YA 1VS1A 4DF2A 3N9RA 4RNHA 4HCLA 4FLOA 2W62A 1PHQA 2L5HA 3TVAA 1XF0A 3GO2A 4ES4A 2ZTKA 4AHOA 2F61A 3GHRA 2YDRA 5EMJA 3PC0A 4N9BA 1ECEA 2XVLA 1NVMA 3PPCA 3R11A 4AFYA 2BLEA 3VFLA 3FSTA 3VD5A 3ECQA 1AL7A 1HF6A 1KO0A 4Q4KA 3M41A 3T07A 4K8GA 3G1RA 4B4HA 5HMFA 2PF0A 2VCCA 1FFQA 3FHQA 1BPLB 1O60A 1JD9A 3S2CA 1LUCB 3CASA 1LT8A 2NVAA 5ABHA 4PB3A 2PLCA 3E38A 5I06A 5F2MA 2IXUA 5RUBA 2PTWA 4AVFA 4GK8A 4KRTA 3ABRA 3K8KA 1S2WA 2PGWA 4B5VA 4DHGA 3IJIA 4O1BA 2OYMA 3M07A 1M7XA 3EWZA 4BQ5A 3K8MA 1L2QA 1XRTA 1YDYA 4J40A 3BAIA 2J25A 2BMBA 7A3HA 3LHZA 3PP7A 3FXGA 1E0VA 1U5JA 4H4IA 3RLVA 4BA0A 1H4PA 3BQ5A 1Z48A 3UXDA 1H11A 1TCDA 1GW9A 1TQXA 3NIYA 3ES7A 3HQOA 7ODCA 1F61A 3S83A 2CIPA 2CZVA 2YXGA 3QKZA 4O0QA 3TLQA 2VT0A 4DO5A 4NYUA 1EA0A 1OBAA 2XM2A 4XKYA 4IQDA 2G3IA 4GRSA 3B0VC 1HIZA 1SZFA 3NURA 3RK8A 1NDYA 3LEPA 1XYLA 3VIMA 1XIMA 3CQ0A 3CYVA 5G2WA 3BDKA 8RUCA 2JQXA 3P3BA 2WMHA 4DJFC 3L0KA 1IWPA 1CBGA 1DIOA 1QFEA 1T8XA 2DZWA 4CNOA 4UOZA 4FA3A 2Z1BA 1NH6A 1IV8A 4FNSA 2EBNA 2OJPA 2FZNA 3WQ4A 3AMLA 3ATZA 3AZRA 2X1IA 2G50A 1Y5VA 3UR2A 3BZGA 4K1WA 1JNEA 4UUIA 1LOLA 5C8BB 3VIGA 3H70A 8TIMA 1Q13A 3AAMA 5EPDA 1PE1A 4MLJA 5HMDA 3MUY1 1CGWA 5T8GA 4C1LA 2E28A 2WMIA 3G1DA 4O1DA 1P0KA 1ZAHA 3TIMA 3CO4A 3DERA 1TJ1A 4YL2A 1MW1A 3N18A 1WZKA 1UMYA 3R8GA 3WBYA 1H41A 2PGFA 2YCLA 3KOZA 1HP4A 1J0IA 4A35A 3WQDA 1SO5A 3NQFA 1MI3A 3A64A 2HNEA 5HMSA 5HQLA 1F6PA 2OQYA 4JTAA 2UBPC 1W3HA 3OU8A 1N8FA 3AMKA 3STPA 4MSSA 4NHVA 1M3UA 1CXFA 1VD6A 1XQLA 3KX6A 4JTHA 1A4MA 1XL9A 1QBBA 3SRFA 2VWTA 3SRKA 3U2ZA 4DRSA 4E2BA 4Q7BA 4UQEA 2QV5A 3VMNA 3W2KA 5HR6A 1S2UA 3C0QA 1TTJA 4WDUA 1OGSA 4XIAA 1X1OA 3I65A 4XUGA 4DWSB 1NSJA 2BOEX 4JTLA 4WZHA 1JPKA 1DWJM 4AB4A 4L5ZA 4ADTA 4M6UA 4FK9A 4XVEA 4LS2A 4DJED 1XYCA 3PANA 1E3ZA 3U3HA 4HVXA 4N2YA 3SEPA 1E3XA 4NAFB 1ZFJA 2TMDA 1KTCA 4HK6A 4UOQA 4GPNA 1HKIA 2E9MA 5DANA 1AUSL 1T96A 3WDQA 3DYPA 2DT0A 3MZNA 4ILSA 3MZ2A 3RF9A 4UC5A 3TN5A 4ADUA 1HJVA 3PWAA 3SCPA 3TTEA 4Z1AA 1HJWA 1ADOA 4WVXA 3WQ6A 1L2UA 1JCTA 4QJ1A 3S47A 2PB1A 1CDGA 1X1NA 1PIIA 1A3HA 3GKFA 2ZZ1A 4JYEA 3RMEA 1SMDA 4XIMA 3GG1A 4XB3A 1NP2A 5D32A 3CHDA 3W4RA 4MJZA 3EMZA 3DCPA 1QPRA 2DIKA 4B92A 1JL8A 4CD4A 3BLOA 2F8QA 3UR8A 3PUGA 3QGAC 3MU7A 4MPQA 3SUWA 3CPUA 3I4KA 1CXEA 4CNNA 1QXLA 1Q66A 4HYRA 4CLMA 1SFTA 2D23A 3UXAA 3T40A 1H3GA 2P10A 4LJ3A 2V67A 3W7IA 1M53A 3A12A 4PCFA 1R2TA 1A80A 4RLIA 4KEUA 1MFVA 1ODUA 4H8VA 2CC0A 5LSMA 1ZUAX 2E09A 4S3GA 4EPBC 4PB5A 5ABFB 2A3BA 4I90A 1AODA 2ZUWA 3SUTA 1HO4A 1FWEC 2X0HA 3DESA 4YTTA 5K7JA 1TV3A 3KVLA 4LS1A 5KETA 4LVAA 5IBXA 3IGSA 4Q4PA 3GR4A 1E43A 1TO3A 2GWNA 4EACA 3SQLA 1J10A 1ADSA 1KW1A 1BG9A 2DV0A 3N14A 5HUOA 4X3ZA 1XBZA 1GNXA 3T0TA 3CUHA 1XBYA 4OQVA 3KDOA 3MDWA 2QJHA 5AN7A 3O15A 3UG3A 5IFPA 4AU0A 3DFSA 3LLFA 3NXFA 3W2NA 4PTXA 4HU8A 1N8WA 3QW3A 1ODZA 3KCLA 3W7OA 3W84A 2GPTA 4DNMA 1N55A 4N9EA 1SJDA 3WQPA 3KCOA 4NNAA 5IXEA 1LG1A 7TAAA 1IWBA 3EWXA 3LTYA 2ZVRA 2VDIA 3P80A 4JD4A 3VMOA 3GG7A 3MA8A 4JX5A 1KFJA 3FS2A 3GD6A 4V1XA 3FVDA 3HIJA 4O18A 4JKMA 5I5RA 4ZQPA 1B9BA 1D3GA 3H2FA 2X0SA 3EB3A 6XIMA 1GVYA 5JBFA 4HYWA 3KP0A 2ZADA 1JZ8A 3W2JA 1W1PA 4DXVA 2YL6A 1JDAA 1Q2RA 4V33A 1DQUA 1L6WA 5TD4A 3WNOA 4C65A 3DIPA 3UG4A 1XLCA 5CSSA 1KCLA 3GY1A 4QLLA 3CZEA 1CXHA 3QJAA 1KXQA 2HJPA 3CHVA 3GFZA 3VX1A 4RE3A 1MZRA 1Z89A 3MV11 3ARVA 4I9TA 3M0IA 1MQQA 2Z6JA 1G4EA 3C8FA 3R0DA 1XFCA 3VZXA 2R1PA 4MYAA 2QJNA 2FPVA 2GVEA 3UG5A 2WVSA 1K70A 2OWCA 2ATMA 4JHOA 1FHUA 3ANYA 3DXIA 3KHJA 1TZZA 3FSUA 1SO3A 3OEXA 3S5YA 4HHMA 3W6YA 4IUOA 4KQNA 2XIBA 4YU1A 1JULA 2WHKA 1DE5A 1WPCA 2G3MA 1P0BA 4NJHA 5CLWA 2ZOXA 5A6MA 2WCSA 2YB4A 3DUGA 2G96A 3FN9A 3W0KA 3L4TA 1E6XM 3O6DA 3GHSA 2BY3A 3A24A 1VLWA 2ZRZA 3W24A 1B3XA 3ITGA 3S6DA 1MEIA 5IOBA 3WFAA 4IGSA 2PDHA 4IIHA 2DZVA 3OLIA 1EWEA 1R87A 1DHKA 3GIQA 1QPKA 5DFAA 3K1DA 2QCNA 1F9CA 1NWTA 4B5SA 3TN6A 1F7BA 1V3LA 4PH6A 1KGUA 3R0UA 1WBJA 1REQB 2BVWA 2XN1A 3WMBA 3MSRA 2F6UA 2Q71A 2V5LA 3GXFA 4PSRA 1AL8A 1XWYA 3KLKA 1GOMA 1Q6EA 1ZJAA 4NIRA 3AUOA 2V0TA 3KBWA 2XTKA 4J3UA 5C9WA 2W67A 2Z28A 3U6WA 1P6CA 4LYQA 1LUCA 4DWSC 2DUXA 4G6CA 4JHMA 5E93A 1KBBA 1XV8A 3FJLA 2DGAA 4MNLA 3WBXA 2UY4A 3N9SA 1VYSX 3TFXA 4JTDA 4LC8A 4HU4A 1D7KA 5C54A 2RH9A 4UR8A 4MMWA 3VGFA 1WDSA 3R25A 2DU2A 2YA0A 4IL2A 3TTOA 4GKTA 5CJMA 3PY2A 2Y62A 3DG7A 1UWAA 3PPFA 3Q94A 3H26A 4KCTA 4G56A 3CQHA 4RXGA 5E0FA 4Q4RA 1CECA 1WXJA 4ZO7A 1JRCA 5I03A 5CBBA 4IIGA 4NJJA 4EPEC 4UTIA 3UF9A 4UTWC 3BLDA 1KR0A 4JFVA 5FOOA 3T44A 4E3TA 2XVGA 3RCMA 2NW0A 3RRAA 4S3CA 2G4JA 4E8CA 3N4EA 4ERAA 1XICA 3WIJA 1YQ2A 2W63A 2ZC8A 1ZBVA 3GXMA 4HCDA 2V68A 3CH9A 4N42A 3W74A 2CLHA 1W1ZA 3TN3A 3MUXA 1R8LA 2BY2A 2REQB 3GXDA 3ID7A 1TCMA 3RX4A 3PTMA 1Y8BA 4UTLA 3L0NA 1ZJIA 3S1VA 2VZVA 5D4YA 3AC0A 2ZUSA 4NAEA 3OG2A 3U4AA 2VC7A 4M56A 3WQGA 3ALFA 1EFZA 4NNBA 4A8IA 2V3GA 4D9PA 2HVMA 5HJLA 3TSDA 4DZAA 1X8FA 2CFFA 3ME3A 1UP3A 1CENA 4CQ9A 1WAWA 3SBFA 2ACQA 4L80A 5FJTA 1ONXA 2IKJA 4Z0JA 1GOXA 4N0RA 3E2VA 4CU8A 4IM4A 1UD8A 3UW6A 1O7AA 1E70M 3PNZA 5EU9A 5LXEA 4C1NB 1OX4B 4XZBA 3T2QA 3E9AA 4M29A 3TTSA 3KDNA 3SUSA 1R3YA 4UQCA 3OGSA 1VFLA 3ARYA 1QMLA 1XYBA 3QH2A 2BHYA 7ENLA 2GSEA 3A5FA 4MZ8A 3TZFA 5F4XA 2HPIA 4J3WA 3KWSA 1OABA 3B03A 3OO2A 1EX5A 5CC7A 2CW6A 1U33A 4YVXA 3FEMA 4D6DA 3A3HA 2ACSA 3CB3A 3ZMRA 1FWHC 4D1IA 3BAXA 2PDLA 1EOMA 3LU2A 2P53A 4QNEA 1WP6A 3H2NA 3W87A 1V02A 3BSGA 1E72M 1BXBA 4JFWA 3LUTA 7XIMA 4GABA 3B0PA 4NAFA 1BVNP 2Z1WA 2HV5A 4QFUA 2RDWA 3AYSA 1BWVA 3D47A 2RKXA 3W7MA 1RVKA 3HURA 3KL5A 2C0HA 4C60A 3EKZA 4DNHA 3OBAA 3KOFA 1POKA 2QCFA 1W5QA 3W07A 1E6QM 3AHXA 4NJIA 3STFA 3N29A 4WGXA 3HU7A 3GVWA 1GG1A 1WDDA 5I0DA 3EGJA 1XSJA 4OBTA 1LLOA 4RZ6A 5FJJA 2VX7A 3A13A 3UR5A 2Q8XA 1PYMA 3HJZA 3GUWA 3L65A 1G4SA 2BODX 1VJZA 4UMBA 3WLPA 1ICPA 2DSZA 4Q4SA 1GVIA 4ORMA 3DG3A 2NQ5A 2ZUVA 4JZ5A 4GXPA 5FI8A 2J9XA 5IHRA 1Y0EA 2F9RA 4R34A 2QKFA 1X6NA 1F3XA 4E0CA 4DI9A 3LXBA 1EO5A 4WX2A 4RXFA 3LI0A 1R7AA 4HNTA 3IIZA 3BL3A 3N2MA 3DBPA 3SIMA 3BVJA 3W3OA 4L61A 4WDTA 3N2BA 3QFWA 4E3VA 4S23A 4LNCA 1JCLA 2D73A 1LLZA 3G2GA 3IIXA 4X22A 4PB4A 3DI0A 1QNRA 1JAEA 3Q2DA 5B80A 4KGLA 1TJ0A 2HE5A 1QOQA 3CTTA 3UJSA 3A4JA 5A8GA 1TE6A 3I7SA 5ABFA 3ZZ1A 3R1ZA 2H8ZA 3B06A 2YXOA 3RFAA 2W91A 1P0NA 2XU2A 1YRRA 2X1SA 2CKSA 2OZ8A 3AYVA 1SZEA 4RDZA 3GUGA 3B3DA 3TR2A 2ISWA 2B4GA 5EL1A 5BXSA 8CGTA 4YTQA 5AHFA 1IHIA 1E5JA 1GPFA 5A8QA 2A3CA 4XAYA 5HBFA 1YDOA 3TK7A 4IF2A 1KM0A 2X1TA 4P7RA 8XIMA 1XRSA 3QY8A 4R85A 2JGQA 4DXXA 2WSQA 1KFKA 2BXVA 2R9RA 3C3UA 1UUOA 1UKQA 3WBWA 3AIRA 3E0WA 4EANA 4DN1A 2VX4A 3ARSA 2VEMA 3EEZA 2EHHA 3THUA 1Q6DA 2XG9A 4ZQCA 4KCUA 3NQCA 4UR7A 1U22A 4HNUA 3MBDA 3UYIA 2VGIA 2VRKA 5I3IA 4GQQA 1IWAA 2ZDSA 1MXDA 2G4FA 4PUJA 1BHGA 2OU4A 4BI7A 3TW9A 3ES8A 1RLCL 1J6PA 1F5ZA 4E4FA 2R1LA 5GNZA 4L9ZA 3ZJ7A 4I7UA 1N7KA 1M68A 1R3WA 3T05A 1C92A 2GUUA 1GKQA 1WA3A 2YL5A 1QK2A 4AD0A 2VC9A 5KZEA 1OFPA 1GOQA 4P8WA 3LY0A 2EF9A 4XZMX 3WK2A 2YW3A 2G97A 3CZGA 3RJXA 3W7EA 4CD8A 4DQWA 4JKKA 5CPQA 1JDEA 1DJZA 1OADA 5H6HA 3ZIZA 1H1NA 3PBMA 4Q33A 1VPYA 2JKEA 1EIBA 1GTEA 2PGRA 2NV2A 1OVDA 3IRDA 2QVNA 3B05A 4L65A 2BBFA 3NO3A 4J7RA 2OWXA 3KEHA 5BRPA 4B4FA 3AXXA 5A95A 3MW7A 1RBLA 4HSOA 3SCVA 3OZPA 5HXMA 3SCQA 4EVZA 1KA9F 4HNOA 1PB0A 1YPFA 5EBAA 4KS0A 2JIWA 4GYPC 4Q6XA 3PK7A 2PDMA 5EBUA 5D2YA 5CPMA 4GY1A 9XIAA 3LNMA 1YNYA 1Z42A