3WUEA

The wild type crystal structure of b-1,4-xylanase (xynas9) with xylobiose from streptomyces sp. 9
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
312
structure length
312
Chain Sequence
TATLGELAEAKGRYFGSATDNPELPDTQYTQILGSEFSQITVGNTMKWQYTEPSRGRFDYTAAEEIVDLAESNGQSVRGHTLVWHNQLPSWVDDVPAGELLGVMRDHITHEVDHFKGRLIHWDVVNEAFEEDGSRRQSVFQQKIGDSYIAEAFKAARAADPDVKLYYNDYNIEGIGPKSDAVYEMVKSFKAQGIPIDGVGMQAHLIAGQVPASLQENIRRFADLGVDVALTELDIRMTLPRTAAKDAQQATDYGAVVEACLVVSRCVGITVWDYTDKYSWVPSVFPGQGAALPWDEDFAKKPAYHAIAAALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase A
publication title Structural perspectives of an engineered beta-1,4-xylanase with enhanced thermostability.
pubmed doi rcsb
source organism Streptomyces sp.
total genus 126
structure length 312
sequence length 312
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3wueA00
1V03A 3BSGA 4A3HA 1GVIA 2WWCA 1HKIA 4JKKA 4D71A 4AW7A 3WDQA 2WCAA 4UQ9A 4CN6A 5ABFB 4UOZA 5IXEA 1E6XM 3EDEA 4NI3A 4B9YA 1FHLA 2EEXA 4PMXA 1S46A 1JI1A 1X6NA 1UYQA 1WB0A 3BMWA 2WANA 2A3CA 1XYFA 3OZPA 4IM4A 4D1IA 3S2CA 1E15A 1UD3A 2FGZA 1WDRA 1LJYA 5E09A 4P7OA 2J77A 2D0GA 4MAZA 1E0VA 3SEPA 1KQZA 2D3LA 1JNEA 3FXYA 1JF6A 5CLWA 1K9EA 2YL8A 3WBAA 2Z1SA 4UTFA 1V6YA 4J3UA 3CZEA 3CHFA 5IHSA 3EMQA 1WZLA 4P7RA 4J3TA 5AC5A 2VVNA 1PZ3A 3BAWA 3WSUA 3GYCA 4HZ8A 1ISVA 3U5UA 5I6SA 2O9TA 3K8MA 2X1IA 5HPCA 2E8YA 2G3MA 2PBGA 3W26A 1PX4A 2VUYA 4WJXA 4XX6A 3CMGA 4ZE4A 1X6LA 4R27A 3VX1A 4MNLA 2ZUSA 1JZ5A 3AHZA 1GNXA 1C3FA 1M7XA 1R87A 2OWWA 2WZHA 1FFRA 3SUTA 3SCQA 1J0KA 3ZT6A 4PCTA 3SCVA 3PZGA 6CGTA 4QAWA 4AZ7A 4EKJA 2WC7A 4GI9A 4XV0A 4W88A 3GM8A 4HOXA 2XVNA 1EQCA 4K68A 1O7AA 1H4PA 5DFAA 1D7FA 3GXDA 5HPOA 3KL3A 4Z2HA 3TTQA 4M24A 3NJ3A 4BCEA 3WH9A 1K6AA 2WLYA 5A6SA 4KRUA 4NSBA 2BVTA 3WF1A 1B31A 3AS0A 1QW8A 4AZ6A 1R85A 1K9TA 1X1NA 2W4XA 4XB3A 4BF7A 2E9MA 2JIWA 1E6RA 5FL0A 3VUPA 1ODZA 3WKZA 2ZWYA 4FK9A 4U2YA 1CLXA 4HA4A 3CPUA 1BYAA 2ZXDA 1OB0A 1NARA 3NSXA 2W63A 1EO7A 2D22A 3GH5A 2CYGA 4AD3A 4H2CA 1E6NA 1H3GA 4H8UA 1JI2A 1XCWA 4B9ZA 4D6CA 2RGLA 5M3WA 3BCFA 2J47A 5BXTA 3WNLA 2A3HA 2UY4A 2CHOA 2EJ1A 4AXNA 5JBDA 2BHUA 2JALA 3VDBA 4CUCA 3DC0A 4H8VA 2VI0A 1KR1A 3W27A 2J8FA 3WDPP 2DIEA 3AOFA 3PZTA 1DWFM 1FH8A 2VQUA 4YHGA 1GUVA 3A3HA 1SMAA 2GFTA 4AEEA 4BQ4A 2PWHA 1QI0A 2YLLA 2DH2A 4ZXOA 2X2YA 3VIIA 1OINA 2EQDA 3OGRA 7A3HA 2V5CA 1MW2A 3W6LA 2HVMA 1HP5A 5KEZA 3SCRA 1J9YA 3CGTA 3AZRA 3UG3A 4Z2JA 3AHXA 3WNMA 1HP4A 1PPIA 2C8NA 3AMKA 1XH2A 1H0IA 3QOMA 1XH1A 2V3FA 2Y5EA 3OG2A 5E9AA 3B8SA 2E9BA 2YBTA 2WMFA 3BAYA 2VZSA 2XFFA 4F79A 4PMQA 5AYBA 4PMNA 3T0BA 3UERA 4HMDA 1CEOA 1GOIA 2CBUA 2E3ZA 1BF2A 4XUYA 2J7BA 4TTGA 3NYDA 2VURA 2Y8VA 1YQ2A 2VTFA 3VGFA 5A6AA 1UWQA 2VZUA 4V27A 3GXFA 1XD0A 2E40A 2QMKA 1JYNA 5E0FA 3VOCA 1GVYA 3OGSA 2XM2A 4MTVA 5LYRA 1K9DA 4DWSC 4OKDA 1CWYA 1LL7A 1H2JA 3CZGA 3U7VA 3IAPA 3WEMA 3WUEA 3GBDA 1ZBWA 2XWDA 1H5VA 2QMJA 3N11A 2PC8A 4P8XA 4PYSA 4NZCA 4R5EA 1NP2A 1DP0A 1WZKA 5FOOA 3II1A 1H1NA 1BTCA 1CZ1A 1XRVA 1HL9A 2PWGA 3VIHA 1BYCA 1EDQA 3AS2A 2W61A 1E1FA 2E0PA 2WLZA 3BCDA 3QGVA 4D1JA 2XVGA 3BAJA 2J7DA 1E4MM 4B16A 4W89A 1CGUA 1WKYA 3LPFA 1FOBA 1W9PA 1UWRA 3SCOA 2UY2A 4KRTA 5TD4A 3TTYA 3WDRA 1UR0A 4OBRA 3NSNA 3CUIA 4GO8A 1UQZA 2G3IA 3VGEA 3DYMA 4QP0A 3W4RA 1K9FA 3CZLA 1V0NA 3AIBA 1UWSA 4P8WA 1C7SA 4KGLA 1NQ6A 1RP9A 4EK7A 5DEZA 4JCLA 3VO0A 4TTUA 2CKSA 3NUKA 2BXYA 5A6MA 2FHCA 4AISA 5KZ6A 4MB3A 2ZWZA 1RPKA 1CIUA 3ALGA 2O92A 3FW6A 4UZUA 2WPGA 1UD2A 4MNKA 3K8LA 4J28A 5A95A 3EDKA 4E8DA 2XVLA 3CUJA 4W5UA 1PIFA 4JKMA 5A6LA 5GNZA 1UH2A 3VD3A 3K8KA 2Y2WA 1JL8A 1NWUA 5D8WA 3VIOA 5A2BA 1V0KA 2WVUA 3ZO9A 4L4PA 3DHUA 2A3EA 1LQ0A 1VFUA 4J3WA 3NDZA 1WPCA 4NRSA 3TP4A 2DQXA 4BA0A 3QHNA 4Z2GA 2XM1A 4TVCA 3ZSTA 1B0IA 1IZJA 1GOWA 1GQLA 1DWGM 3VPLA 1QBBA 3G6MA 2W62A 3EMZA 2GUYA 1O6IA 1WDQA 1EDGA 3AS3A 5DF0A 2CIPA 3WNKA 4UQDA 3HN3A 1W3JA 5EFFA 5CG0A 1E55A 3PZOA 4U3AA 3WF2A 3UG4A 4J3VA 3A4AA 2QV4A 3I3DA 5BXRA 2DT1A 1PIGA 1HJXA 3ZJ6A 4AD4A 4JFWA 1E6PA 3AYRA 1GJWA 4TX6A 4HOWA 3AIWA 3UCQA 1ESWA 1EDTA 1E1EA 1UZ4A 4CKQA 1LWHA 4D6IA 2NW0A 2CHNA 4JFTA 1XYZA 2BY1A 4X0VA 4Z2IA 3ARRA 2JIEA 4P7QA 1RH9A 1G0CA 2BHYA 1FP9A 1BFNA 1H41A 1DWJM 2YDQA 3T0DA 5CZKA 7TAAA 4CD4A 3CO4A 2ZXQA 2EPMX 1EQPA 4LYQA 1B90A 3PZIA 2YDSA 3QHMA 1HVQA 3AMCA 1W3HA 4PMRA 4EAMA 5M5DA 1W9BM 1HKJA 1UZ1A 1V3KA 3MV01 2UY3A 3VKKA 1WDSA 4AZ5A 3WQ5A 2VNCA 5IFTA 1EGZA 1UD8A 1W1YA 1Q6EA 3KE0A 1N82A 3VD7A 3A4WA 1UD6A 5E6ZA 1ZS2A 4JZ5A 3RIKA 1G94A 4GO9A 2RGMA 3T0AA 4FMVA 1E73M 1QNOA 5D4YA 1MVYA 3WD3A 1JFHA 4AD1A 2UWFA 4AMCA 1KB3A 2PWFA 4D6DA 2ZXAA 4P7LA 4UQBA 4Z2KA 2FHBA 2X8RA 1JZ2A 2CBVA 4E4PA 5HXMA 1JD9A 3VINA 4KWUA 4BS0A 1UWUA 4UZSA 2WCGA 1EHAA 1FHDA 3WDHA 1PEZA 1TFVA 3MMWA 2NT0A 3FNDA 3AIQA 4IUGA 1Q6GA 1W1TA 1W91A 1JXJA 2X09A 1OIFA 3TTSA 1UR9A 1F4AA 1NH6A 1KBBA 2XSBA 4MDPA 2EPLX 3ZT7A 1KXHA 5D9MA 1WCGA 1VEMA 3RM8A 3OLDA 2G3NA 3QHOA 1ISZA 1HXJA 4M82A 1VFMA 4NRRA 2ZUUA 4FLOA 1UKPA 3K4AA 2PF0A 2YL9A 4DUVA 1LL4A 1V02E 4Y7EA 2VZOA 1FFQA 1JZ4A 1KR0A 2IXUA 4D6FA 3WH6A 2WZEA 4TUFA 2VT0A 4ACZB 1E71M 5E6YA 1W3KA 3E1F1 3W0KA 1UWTA 2BNJA 3WENA 1E5NA 1TVPA 1PJ9A 4UFKA 5CGTA 3DHPA 3WNPA 1JIBA 5E70A 2F2HA 1WAWA 3SURA 2ZUMA 1JZ6A 4WKFA 2DSWA 4KH2A 1TE1A 3OA5A 4F66A 1EIBA 3L4ZA 2DSUA 1J01A 3RO8A 3ZR6A 4P7NA 3L4TA 3OLEA 2HISA 3SCNA 4WIWA 2QF8A 3WDJA 1E3ZA 2XTKA 5CPTA 3K46A 1WZAA 3BH4A 2ZX7A 1DHKA 1GW1A 4W8LA 4CVWA 4JHZA 3VX0A 4WSJA 2GJXA 2VX5A 2WBGA 2CXGA 3B9AA 5DT7A 3T08A 1UR2A 1P6WA 4PBGA 1OGGA 2WMGA 4LYPA 1CGXA 3EDDA 4LGXA 2PWDA 4ZEPA 4RL3A 1UA7A 5JIWA 4LYRA 2EBNA 5GPRA 2CPUA 3OIHA 2Z1KA 1BG4A 5BWFA 1GOQA 3O6AA 3AHYA 1KGWA 1A47A 2WSKA 1UH4A 1FP8A 5JIPA 1AQMA 1SMDA 1Y7VA 2CERA 5GNXA 1MQQA 4AIOA 1BGAA 4HA1A 4PTMA 3VM5A 3MMDA 1E4IA 1V3JA 1BYBA 1W9VA 2JFEX 4JFUA 4PUDA 3APGA 5A6KA 3RJYA 3HJEA 1QNPA 5AYIA 5EB8A 2XVKA 4HMCA 4ZENA 1W1VA 1E4LA 2WB5A 3MSDA 3BGAA 2FGLA 2D3NA 2WMJA 4CCCA 4URIA 1CGTA 2PWEA 2VO5A 1XCXA 1GOKA 5CQ1A 2ZE0A 2X0HA 3F5JA 4S3KA 3SCSA 3PZQA 1WNOA 4UFJA 5A8MA 4QLLA 1FH7A 4OUEA 2WMHA 1C8XA 1CLVA 3BSHA 2OYMA 1OBAA 2G41A 3CIVA 4LQ1A 3ZQ9A 2BVDA 1CXHA 5IHRA 4M81A 2G3JA 2YA0A 2JE8A 1MXGA 4ACYA 4JFVA 4PCSA 2JF7A 1GORA 1QHOA 4RE4A 3M7SA 2J7GA 3RMEA 3M46A 3BAXA 1L8NA 3ALFA 1VEPA 1C93A 3N17A 3VIMA 3W28A 3D3AA 1ISWA 4UQCA 5I5RA 3ARWA 2WCSA 1VRXA 3QR3A 1ITXA 4F8XA 5I2UA 1QI5A 1ZBCA 1LG2A 1US3A 2J7HA 3HMCA 5A69A 5IDIA 1UR1A 1ZJAA 4FLRA 1U33A 2DPEA 3PZVA 4Z2LA 3GNOA 2AOSA 2E8ZA 2ZX5A 1CXFA 2XVPA 3BLPX 1HNYA 2XIBA 1XGZA 1SYTA 1OGBA 3ZT5A 4BQ2A 4W85A 1ZBKA 2YA1A 1MXDA 4QCFA 4LPCA 5CSUA 4FF5A 1ISYA 2DSKA 1BVNP 1WDPA 4HPGA 1DWHM 1OIMA 1MFUA 3TTOA 1E70M 1OSEA 3SUUA 1UQYA 3GZAA 2GSJA 2YDRA 1R86A 1D3CA 1C8YA 4P8UA 3SUSA 3ZJ8A 2D24A 4PMZA 1BG9A 1C92A 2FH6A 3WQVA 5FD0A 1E0WA 3W81A 2EPOA 2J79A 1AQ0A 1MQPA 3MV11 4X0NA 5C71A 4ATWA 3GXMA 3GH4A 1E5JA 3GNPA 3VU2A 2GJXB 1W9XA 3L4VA 4YN5A 2W92A 4E8CA 3SCPA 2UY5A 2VCBA 1U2YA 1UOKA 3ARSA 1MYRA 2J78A 1UR8A 5BRPA 3RM4A 1M01A 1M03A 5BYWA 3WF4A 3DYPA 5CGMA 2X0YA 1AMYA 1Q4NX 1XV8A 3GH7A 3LPPA 4CD7A 2ZUWA 1Q6CA 4PMVA 1LF1A 1W9UA 2XGIA 3MMUA 3WMBA 4B15A 5I78A 1UD5A 5CLTA 2IXVA 4AZBA 5I3DA 2VX4A 3WUFA 1EO5A 4UFMA 1QBAA 3TOPA 4WSKA 4CGTA 1UKTA 5A8PA 1CENA 3SCTA 4W93A 3SCWA 2CETA 4MJ2A 4CCDA 1M53A 1BVZA 4U5KA 4MB1A 4FLQA 2X05A 2IUZA 3WF0A 2J8GA 1KWKA 4D6HA 1EXPA 1QNRA 2AAAA 1Q6DA 1RD6A 1NOUA 1TUXA 1NWRA 3AS1A 3MKKA 3GNRA 6A3HA 2WVSA 1JDCA 3MUZ1 3WH8A 8A3HA 2DSVA 2NT1A 5EBAA 1W2VA 1JF5A 1GZJA 5CPSA 4CU6A 2JF6A 4EE9A 3PZ9A 2VRQA 4GI8A 4J7RA 4D6GA 3WL1A 2V3DA 2VL4A 3EDFA 3FAXA 4IPLA 4QFUA 3BLKA 3W37A 4U33A 5ECUA 1OT1A 1EH9A 3F5LA 1VEOA 1GCYA 1SFSA 3SCUA 1XD1A 3PBGA 4GI6A 3THCA 2WNWA 5D9OA 2J74A 3WF3A 1UKQA 1J0HA 4UQAA 1E72M 2VOTA 2D23A 2BY0A 4QCEA 2V38A 1JYXA 1HKMA 3AICA 3WFZA 1LG1A 5CPQA 2VQTA 2WMIA 1V0MA 4ZFMA 4PMOA 1OT2A 3MANA 4QDMA 1JAKA 3VILA 2WKGA 2DH3A 1HJVA 3AXHA 3WNOA 3CZKA 3FN9A 3PZNA 2OSYA 4HOZA 2XFRA 2PBOA 1DWAM 1CYGA 1C7TA 5BROA 3WH5A 4C7DA 2BHZA 3N13A 5DMYA 4ATLA 3ZIZA 2WXDM 1UH3A 2WVVA 3AXIA 4CN4A 5LA1A 2XFYA 4DM2A 1TR1A 4M56A 4AEFA 2WC3A 1NOWA 2VX6A 4DWSA 4HP5A 3WUGA 4V2XA 2QPSA 3VMOA 1BGGA 4JL1A 3AIRA 3KL5A 1C90A 1PZ2A 1JDDA 4AIEA 2VVSA 1B3WA 2XGBA 2NSXA 4CN1A 2XIIA 3WD1A 3W82A 4H8HA 2WAGA 4AD2A 4OIFA 2BFGA 3OGVA 3ZJ7A 4W7VA 1BSIA 3UETA 3GDBA 4LX4A 1UHVA 3UEQA 1MFVA 5ABFA 3UG5A 3MUIA 1KGUA 4MPKA 4W5ZA 1J12A 1W9DM 3SUVA 2XG9A 1UKOA 4D6JA 4TVUA 5I0DA 1B3ZA 4E2OA 4KGJA 2J7CA 5LA2A 1JYWA 3ZM8A 1KXTA 1J0IA 1DWIM 1B3XA 2FDMA 2BVYA 4PEEA 1KXQA 1OD0A 4PRWA 4DM1A 1HF6A 2OSWA 1D2KA 5A8OA 4CD5A 2J4GA 5CSYA 2OWCA 4HA3A 2EO7A 5HOSA 4S3JA 3MO4A 2DEPA 4HTYA 3WD0A 3ARYA 1B3VA 1TZ7A 4UQEA 1HVXA 2BV9A 2MANA 1E56A 4PUEA 4TXEA 2ESCA 1G5AA 4P8VA 1OGSA 1ZB5A 3UESA 2CBJA 2Q8XA 4PTVA 3O2LA 1ITCA 3K1DA 2D0HA 4UFLA 3IK2A 5LA0A 4ZXLA 3U5YA 3WY1A 3WEOA 1JZ8A 3J7HA 1V0LA 3W29A 4PMDA 2CEQA 1NOFA 1ZU8A 1CBGA 3OBAA 3THDA 1IZKA 3RJXA 3U57A 1KQYA 3L4YA 1J0ZA 1UR4A 1OWQA 2OLHA 4F9DA 1W2PA 3VGHA 3T2OA 5A2AA 2DT3A 4W87A 1MW1A 4CD8A 3TA9A 1J0YA 5HDRA 1VIWA 2WHLA 3IJ8A 4W86A 3WMSA 1AVAA 7CGTA 1PAMA 1W1PA 3CHDA 1XSKA 1I75A 3WNNA 3VGGA 1ZJBA 2WMIB 4W8BA 2DT2A 3N04A 2Y8KA 4GQQA 1KWGA 1UUQA 4GZIA 1KFWA 5D9PA 3WQ6A 2WW5A 4HMEA 2YBUA 1HIZA 3GTNA 1HL8A 3PZMA 3ZSSA 1V3HA 4CU7A 4DWSD 3BMVA 4RE2A 3AJ7A 1HX0A 3AZTA 3KL0A 2WVVB 3NIYA 3OLIA 3W25A 2W5FA 4GZEA 4KMQA 4CU8A 1B2YA 2J75A 5M17A 3WQ4A 3O9NA 4MB4A 3ECQA 2XJ7A 1TG7A 1QNSA 1GQJA 5C8BB 1E0XA 4OOUA 2YL6A 4AZIA 1JDAA 3T2QA 3AISA 2VJXA 3NDYA 1QHPA 1VBRA 5GNYA 1XSJA 1US2A 3KWXA 3CLWA 3VIJA 4J27A 3AMDA 3VIGA 4L4OA 3CUGA 4OZOA 1GJUA 2YJQA 3RCNA 2V5DA 5HBFA 1W3LA 4ATDA 1IV8A 3L4WA 4OBSA 2DDXA 1PBGA 4U5IA 1VB9A 5I79A 2BS9A 3WUBA 5A8QA 1LWJA 2DT0A 4XZBA 4WKHA 5AC4A 4C7GA 5D8ZA 3CZJA 1BPLB 2VZTA 1TA3A 1JNDA 4AIUA 2A3BA 3VM7A 3LPOA 5JUVA 3VD5A 2CBIA 2D0FA 3PTQA 4AC1X 1H09A 2ZUTA 1G01A 1V02A 2VC9A 4U3CA 4A4AA 5AY7A 4JHOA 1QVBA 3VD9A 1E4NA 1VENA 3LMYA 2WYSA 2QLYA 4N0RA 4QLJA 4EANA 4WK9A 2WZIA 4MB5A 4X9YA 4AZHA 3I3BA 6TAAA 1GHRA 4HZ7A 2VX7A 1V3LA 2ZOXA 3ZOAA 1J10A 1E6QM 4W8AA 4PTXA 1QNQA 4N42A 4U31A 4M29A 3CHEA 2JEQA 3RILA 1NWTA 3POHA 2QPUA 2EPNA 5A6BD 2DSZA 1VFOA 1E3XA 1HJUA 4IPNB 5A6JA 2FH8A 4JFSA 2WBKA 5D9NA 3AFBA 1GPFA 1EA9C 3IANA 2YA2A 1MW3A 1V3MA 4LXFA 1HJQA 5ABEA 3D5HA 4JCMA 2VR4A 4GKLA 1B30A 2A3AA 3AXXA 4JL2A 3PHAA 3CTTA 2OSXA 4AWEA 3VMNA 1U30A 4FLSA 1PX8A 2GJPA 1H49A 2W91A 1L0PA 3RDKA 1JXKA 3POCA 5ABHA 3JUGA 3FHQA 2QHAA 1H11A 1HN1A 4AYSA 1XHGA 3ARPA 1H0GA 4V28A 2GDUA 3WL0A 1CDGA 3EYPA 4UNIA 2FHFA 3F4VA 1CXIA 2YKKA 4UFIA 4M1RA 3WFLA 4HU0A 5A8NA 3F5KA 4CCEA 3ARZA 4W84A 3PN8A 4J3SA 1JFXA 1V6UA 5E0CA 4WF7A 4Q22A 3T2PA 1TMQA 1R8LA 3A47A 5A94A 1LLOA 2DGAA 3VNZA 1UKSA 3KZSA 4GINA 1Q6FA 2O9OA 4PN2A 3ARUA 3S6TA 4TOQA 5DT5A 4MNMA 2VMFA 1B1YA 2VRJA 3VIFA 3AZSA 4AZGA 4GQRA 1QW9A 4QLKA 1HJSA 4MNJA 3WELA 2C0HA 5F7UA 3SIMA 4GZJA 1WE5A 3W38A 2J7FA 4A3YA 1G9HA 1B9ZA 5BCAA 3W6MA 1QI4A 1C91A 3PTKA 4YHEA 1TA3B 3DECA 8CGTA 4AD5A 1ISXA 1DTUA 3VIKA 1CPUA 2GJRA 2WSPA 3GXIA 4XZWA 3FAWA 2OYKA 1XC6A 4MJ4A 3EBVA 3RM9A 3QOKA 5BXSA 2WHMA 2GK1A 1ODUA 2YIHA 3VNYA 3B9EA 4M8UA 1BQCA 2ZX6A 2XPKA 1CTNA 1EOKA 4UOQA 3WBEA 1I1XA 1GONA 1SR0A 1GQIA 5CJ5A 5I77A 3M07A 3WN6A 1JD7A 1ECEA 3WMCA 2G4FA 1VAHA 1RP8A 4H04A 5EFDA 2D20A 1VF8A 2CCRA 3CUFA 3VDAA 3AIVA 1J0JA 2E4TA 3T09A 4UR9A 2YLAA 3MS8A 5BXPA 5A2CA 1GQKA 3AQUA 4ML4A 1V3IA 1MWOA 3AMGA 2XUCA 1JYVA 4BQ3A 4UCFA 1CGYA 3EMCA 5A3HA 3UR8A 1QPKA 2OYLA 2GVYA 2WM0A 1EOMA 1AQHA 1TCMA 1J11A 4GPNA 1JG9A 3NSMA 4MAVA 3W53A 1MW0A 1OM0A 3L4UA 1E6ZA 3BAIA 4DUXA 4Q7NA 1FA2A 1LL6A 1XH0A 2VCAA 4PSRA 3FY1A 4HZ6A 2Y4SA 4IISA 2E9LA 1R7OA 2XSAA 3AIEA 5EMYA 5ABGA 4AZCA 4BZYA 4OJYA 3WIJA 3IJ7A 1QHZA 3MUAA 1KCKA 4MADA 3A6OA 3VTRA 3UR7A 1CXKA 1CXEA 1ZBVA 3M6DA 3MU7A 2J7EA 5CXPA 1KBKA 3WH7A 2WHKA 4ZE5A 2BY3A 3LPGA 1QI3A 1WO2A 1HKKA 4TVDA 4AY1A 4UOJA 4JKLA 4JAWA 3G6LA 4JIEA 1PX3A 2VZVA 3ARTA 4ACZA 1UWIA 3U7BA 2J25A 3HU7A 2VRKA 3N9KA 3BC9A 1JGIA 2ZICA 5HNNA 5BRQA 4HPHA 3FHAA 4GIAA 1V6VA 1FH9A 1CXLA 1YHTA 2D2OA 1NP0A 2YL5A 2W67A 4RE3A 2WHJA 3ARVA 4TX8A 2GDVA 1R7AA 4U2ZA 3WD2A 3W24A 3BAKA 1BLIA 2WVTA 4PMYA 2CNCA 2F8QA 3VDCA 4H41A 2ZUVA 4HU8A 2ZUNA 2JEPA 4WLCA 5I23A 1HJWA 2O9RA 2WWDA 3A4XA 4B3KA 3SUWA 1CGVA 2V3EA 1OD8A 3AHTA 3VGDA 1QI2A 3VDHA 1BAGA 2OWXA 1CGWA 2WC4A 2ZIDA 1GOMA 9CGTA 4CD6A 2BY2A 2XHYA 5GQBA 4YPJA 1UD4A 1CNVA 3CH9A 3EDJA 3MSGA 1JAEA 4NF7A 4UFHA 1VJSA 2TAAA 5A1AA 1NM9A 1A3HA 3RPMA 3N18A 3CBWA 2WKLA 1W32A 4AD0A 3VMPA 4W7UA 4OOZA 5DO8A 2CKRA 2WMKA 2G8ZA 1BYDA 2VR5A 1V6WA 3ARQA 2GK1B 1Z32X 4PSPA 4B3LA 3L2MA 2J62A 5JBFA 3OZOA 3IAQA 1VFFA 2Y24A 3N15A 3AYSA 3CMJA 1UA3A 3OLGA 1KCLA 1G1YA 2C7FA 2F61A 2VCCA 1KXVA 3K4DA 1QOXA 1GOOA 3CHCA 2WK2A 1B3YA 3L4XA 1NWSA 2EPKX 3AI0A 3L2LA 3TONA 3B9DA 4BQ5A 1C8QA 3ARXA 1WZMA 5A6BA 3DYOA 3OB8A 4GXPA 2EXOA 1ZL1A 2W66A 3BXWA 1GHSA 4H7VA 4F9JA 5FL1A 2AMGA 4DUWA 1WP6A 3GBEA 2ZX8A 3PTMA 1VBUA 3WDIA 4J3XA 2PI6A 3WQWA 5I24A 3NCOA 1DEDA 5JBEA 1IT0A 1HT6A 3AIUA 1MQRA 1JZ7A 3CUHA 1BHGA 3VGBA 4AZCB 3AHVA 3PZUA 1J18A 4MDOA 2ZXBA 2O9PA 3I3EA 5IFPA 3N12A 5FIPA 5FCZA 4PMUA 3AROA 4WKAA 2BXZA 1JZ3A 1E40A 3ZR5A 4D6EA 3MUY1 3IJ9A 3WD4A 3VD4A 2PB1A 1UG6A 1XSIA 1V6XA 3WQ8A 1F4HA 1OCQA 3CZ8A 1E9LA 1VJZA 1CECA 1TVNA 3N1AA 3KEHA 3VIPA 2YOCA 1V08A 3ZJKA 4DWSB 5FKYA 4CVUA 2CESA 5M03A 3ZMRA 1EHNA 5C70A 2XWEA 1KGXA 2B31A 2V3GA 4PTWA 2XYLA 3VVGA 4D72A 4C7FA 4W7WA 3WEZA 1M04A 2D1ZA 2ZX9A 2CITA 4M80A 1I1WA 3AMLA 1E6SM 2DIJA 1E43A
chains in the Genus database with same CATH superfamily
3BSGA 4A3HA 4JKKA 1JPKA 4AW7A 3TVAA 3RLVA 4UQ9A 4HU4A 5CPMA 4CN6A 5IXEA 5H1WA 1XUUA 1FHLA 3W07A 1HKWA 3A24A 1IXQA 2HCVA 1PZ1A 1Z3NA 4IX0A 3D0CA 2A3CA 4D1IA 1E15A 2WKJA 3CWOX 2CZEA 2Z6IA 1GG0A 2I5QA 3UPBA 3SB0A 1DXIA 2NZLA 4RDZA 3SEPA 3XIMA 1JF6A 2YL8A 3E96A 1ZCOA 1H7OA 3W7OA 1V6YA 4J3UA 4E0CA 3TC6A 5IHSA 3ATYA 3S9YA 1PZ3A 3MC5A 4LVAA 3GYCA 3HA1A 3NOEA 4B5VA 4PRRA 5I6SA 1CW2A 3YPIA 3R43A 4TIMA 2DW7A 1K4GA 5A6TC 2Z7GA 3FJLA 3UPWA 4RUBA 4QITA 3SIZA 3VC5A 3W2NA 2OWWA 1FFRA 3A9BA 1J0KA 3KFTA 1UBPC 3DFYA 3SCVA 6CGTA 4QAWA 4AZ7A 5HATA 2CLPA 2Y63A 4FF7A 4GI9A 3F4WA 3PWIA 3TJXA 4GFSA 5HJXA 4X63A 3ZS4A 3WQEA 4BCEA 1W0MA 3WH9A 1K6AA 2NUXA 2EF9A 5I09A 3VCNA 4GZ7A 2WSRA 2W4XA 2E9MA 3QGKC 1E6RA 5D02A 5FJOA 5HMDA 1P0KA 5FL0A 4L9ZA 2ZWYA 3PUDA 1OB0A 1NARA 1ZJHA 3NSXA 2FVLA 1OF6A 2X1RA 1UR3M 2QAPA 2D22A 4MUZA 3SM0A 1E6NA 3C0JA 3SY8A 4H8UA 1R3QA 3SRFA 2CLHA 1XCWA 5I7GA 4B9ZA 3PF3A 3BCFA 3LQGA 2Z7KA 1YX1A 3ZLHA 3WNLA 3GXPA 3VOFA 3DI0A 4C1NB 2UY4A 1XRSA 4OUIA 2CHOA 3R8GA 4NVTA 3TH6A 5JBDA 2JALA 2P0OA 3IIOA 4ZO6A 2OCZA 3W27A 1BEUA 2DIEA 3UCCA 3PZTA 4YHGA 2QZRA 2XGZA 3T7VA 1R3RA 2GFTA 3BZJA 2FZDA 4BQ4A 4FB7A 1NY1A 1JPMA 4ZXOA 4GFIA 3S2JA 3VIIA 7A3HA 1MW2A 1LORA 1DPMA 3P7YA 4H9YA 3AZRA 3UG3A 2C8NA 4HJWA 1XH2A 2Y5EA 1XBZA 3GNNA 5AHNA 5CZSA 2E9BA 4MF4A 4DJFA 2QCNA 2PWUA 4ZBCA 4I8YA 4F79A 5BMXA 3T0BA 4PMNA 2CBUA 1Y5VA 1RBLA 4NNBA 4DBUA 3WQOA 3B0UX 2KZHA 1YQ2A 3N4EA 3VGFA 3GXFA 1GKQA 2E40A 2QMKA 3I7QA 1L6SA 3VOCA 2HVOA 3D6NA 3RR4A 3LCXA 4ADTA 2WZTA 3W72A 1R9ZA 1X6UA 1DIEA 1GKRA 4PR4A 3CZGA 3IAPA 1N2VA 1QK2A 5LIKX 3XINA 3NM3A 4C6QA 1PTDA 5DXXA 1H5VA 3C3NA 3P2VA 2PC8A 1YXYA 4ZQPA 4Z42C 3GK0A 5DRCA 5XINA 3RLUA 1DP0A 3C2EA 1OFPA 1TV2A 2VENA 2ZZ3A 2PWGA 1BYCA 3AS2A 3LSCA 3EX6A 2W61A 1BF6A 3DFOA 3QGVA 2J7DA 3F4DA 2Y70A 3VKBA 3HGSA 1UWRA 3RCMA 5TD4A 3WDRA 2CWXA 1FVPA 3QYQA 1UR0A 2RDTA 4E38A 2QAFA 4CQ8A 3NSNA 4HNUA 3CUIA 3AYVA 2DUAA 4ZQMA 3T4WA 2RAGA 3T9PA 2WOQA 2OFJA 5DBUA 1V0NA 3CL6A 1YXDA 4US5D 4WZHA 3M0LA 1RP9A 4XKYB 3FYOA 5CBIA 2FHCA 4GVHA 3T81A 4KCVA 2Y89A 1I2PA 1R47A 2ZWZA 3RITA 5F1UA 3FW6A 2WPGA 1MUCA 3O8AA 4HU3A 3CYJA 4J28A 1PV8A 5D05A 3C52A 1XIIA 4K7VA 2CHRA 2DVUA 1MEWA 4UC5A 5GNZA 1UMYA 3TUUA 4D8AA 1JL8A 4AU0A 2ALRA 4ZVJA 5D8WA 1Y5XA 4B5UA 2WVUA 2P1FA 3OPSA 5ENLA 1KCZA 1I2NA 1VFUA 1UROA 4M1BA 3E3HA 1GGOA 2XM1A 1YADA 1TRIA 1TSIA 3P82A 1Q2RA 2HQAA 1V7YA 2FJUB 1EDGA 3N14A 9XIAA 2XZ9A 2CIPA 3H2CA 1RQHA 4UQDA 4GY7A 3W2LA 1Z89A 4GJIA 1W1B1 5EFFA 1X7IA 3PZOA 2F6XA 3G3DA 5EPDA 3A4AA 4Q8QA 1YTKA 3THQA 1TVLA 1GJWA 4TX6A 3AIWA 4FXJA 1I8JA 1LWHA 5G4EA 1DIDA 5HK4A 4D6IA 2NW0A 4A8NA 2CHNA 3HQ1A 3NQFA 4JFTA 4M5PA 1AW5A 3VA8A 4H2HA 1VFHA 3KVLA 1BFNA 2QQ6A 1DWJM 7TAAA 3I7RA 2EPMX 1EQPA 2P76A 3PM6A 3AMCA 4I8DA 4EAMA 2NLIA 2Y6ZA 3VKKA 1WDSA 4Y8EA 4N9DA 3S9IA 1Q6EA 1N82A 3VFCA 4Y9NA 1ZS2A 4JZ5A 2P3ZA 2RGMA 1E73M 1QNOA 3WD3A 1A5OC 4AD1A 4D6DA 2ZXAA 4P7LA 3HPSA 1ADDA 1K8YA 2YZ5A 4Z2KA 3OW1A 2FHBA 4K8HA 1TJ2A 3N2MA 4X61A 4JN8A 1KFLA 2NX3A 1Q65A 5LIXX 1VHNA 3FNDA 3AIQA 3AXMA 4I5RA 1W1TA 2V5LA 1OIFA 4QJ1A 2YYUA 4CQAA 1F4AA 1RY8A 4JTRA 4MUPA 1GVQA 5D9MA 3DG6A 3ZXWA 2E6AA 2G3NA 1LWIA 4M82A 1VFMA 3S5OA 6XIAA 4NQ1A 2XSXA 2BX7A 3QKZA 3G8EA 1V02E 3RLGA 4DO7A 3P3BA 3WH6A 2WZEA 2VD8A 1F9CA 3UYCA 1W3KA 3E1F1 4N4QA 1UWTA 2R1LA 3W0KA 4FOUA 2BNJA 3WENA 3HGRA 1SGJA 4B92A 1PJ9A 4YNGA 4C6KA 1UC4A 4LH8A 5IRPA 5F2GA 4CLMA 4S2CA 5BU6A 1WAWA 3PBUA 1FBAA 2PZNA 1FUYA 4WKFA 4GA8A 4KH2A 4LW7A 1TE1A 5CPNA 4F66A 2EG7A 4YVVA 1O66A 5CPLA 1J01A 3R2GA 3OLEA 5K4XA 1NDZA 2QCDB 3LRLA 3GVQA 1RA0A 4CEUC 1WZAA 2WJFA 3C61A 3ABXA 3HO8A 2VWSA 2VX5A 1TQJA 1F76A 3CNYA 3T08A 5HQMA 1X97A 3BW4A 3N34A 1KRAC 2POZA 1RJPA 1E9YB 4LB4A 4LGXA 3EWUA 1QO5A 3OTRA 5LNSA 4YWSA 4RL3A 4GWEA 2VXNA 3TN4A 2EBNA 5GPRA 3OIHA 3UWEA 3LBMA 3O0FA 5C55A 3GY1A 1Z6KA 2V5BA 1XPGA 1A47A 1YE6A 3UNDA 4ERAA 4S3BA 4PUWA 4HNVA 1MZHA 2FFCA 3PBVA 3S4TA 1VR6A 4IMCA 1OFRA 3PPHA 5GNXA 4REQA 1MQQA 1BGAA 4HA1A 3VM5A 3MMDA 3MI3A 1V3JA 3W7KA 1BYBA 3LCGA 4JFUA 4O15A 5A6KA 3W7CA 3ZWTA 3IWPA 4ZENA 3UF9A 4JYDA 2WB5A 2FGLA 3GG0A 1L6GA 2VO5A 1XCXA 4GGBA 2X0HA 3BLDA 3H7VA 3PZQA 4UFJA 4QLLA 1KM0A 2R14A 4OUEA 4JTHA 4CNUA 3BSHA 3FA4A 1SZRA 1OBAA 4GOAA 2G41A 3VNMA 3F03K 4A3UA 4O10A 1CXHA 4M81A 3E2VA 4XVEA 2G3JA 1IIHA 3DU0A 2OO0A 3CTLA 4LAKA 1QHOA 2OQLA 3RMEA 2J7GA 1ZENA 1VEPA 4O8AA 1YMYA 1P0DA 3GFXA 1ISWA 4Q4PA 4DPQA 3OOQA 1RCXB 3QXBA 3GR7A 5AYXA 2I57A 4F8XA 5CBBA 1LG2A 1L2QA 4FLRA 4QDWA 3GNOA 4C6OA 4XO7A 3DGBA 1NDYA 1LCOA 3KRZA 1TPC1 4XUGA 4ADUA 1SYTA 2YFNA 3AWNA 1V77A 3VNIA 4V33A 3LQLA 1ISYA 3EEGA 3NGJA 3GUGA 4HPGA 1DWHM 2PU0A 3PJWA 3G1SA 3SUUA 3C0LA 2GSJA 3URBA 2A79A 1H7RA 1R86A 1KFBA 3NWRA 5L9FA 4WDTA 3TQPA 4PMZA 3RMJA 3C8NA 3MT1A 4LEQA 1E0WA 2A7NA 2B7QA 5JH1A 4X0NA 4HK7A 3KBWA 3S5YA 4HCLA 1O4UA 3W83A 3H2NA 4IMEA 4G9PA 5M1TA 3SCPA 4NZFA 2ZRZA 2RH9A 5HANA 2F84A 3M9YA 1MYRA 2BG5A 1TIMA 3RM4A 1M01A 1M03A 5BYWA 4Q8TA 5CGMA 5G2IA 1EC9A 3LPPA 4LTSA 3VFLA 4CD7A 1Q6CA 4C1KA 2XGIA 5I78A 5CLTA 2IXVA 5I3DA 3FLUA 3UZJA 2CLEA 4DX3A 5A8PA 3E5PA 3NXLA 4LVFA 1IEQA 4JYEA 2NQJA 3LRKA 3SCTA 3KW3A 3SCWA 3GFZA 2F6UA 1WBJA 1M53A 5K9CA 2VDHA 3ITVA 3LLDA 2V30A 1YBQA 4RKAA 3B0XA 2CW6A 4D6HA 4FHAA 4AF0B 4EAYA 1FWIC 1SJBA 3BICA 3P81A 2AAAA 3PWAA 3TTEA 1Q6DA 3QEZA 1Y0EA 1RD6A 2R94A 4LCRA 3UVAA 4L9YA 4AYGA 1J79A 1PYFA 1G6CA 4NJHA 1DIKA 3AS1A 4F2TA 1UW9A 3GNRA 3L5MA 8A3HA 2WNNA 5CPSA 2JF6A 3R7MA 4EE9A 5LGXA 2BWGA 2OU4A 3EDFA 5BU9A 1IXOA 4QFUA 3BLKA 1F6KA 4MFEA 3DESA 3V7PA 3JS3A 5KZEA 4JY8A 1XD1A 1AW2A 4ZQOA 1A0EA 3WLNA 1E72M 3BDKA 3LB0A 2NWSA 1F7BA 4RXFA 2VOTA 2DZXA 2Q09A 2V38A 1LG1A 4PMOA 1FWGC 4NYUA 3MANA 4IGSA 4QDMA 5HWMA 2P88A 1W3TA 2WO5A 3QLLA 4DJEA 1HJVA 3ICJA 1TPUA 3FN9A 1HO1A 3FSTA 3TCSA 4A3QA 1CYGA 2R9RA 3GD6A 1XLAA 3V35A 2QGYA 3KVJA 1QWGA 3JZUA 4ATLA 2GPTA 3H2FA 5BNKA 4GC3A 3SQLA 5HR6A 4CN4A 2WC3A 1NOWA 3BG5A 4DWSA 3VKJA 2C1GA 3HG2A 1LT8A 4L61A 3WUGA 1H62A 1U22A 1BGGA 4JL1A 4XBKA 1FTXA 4XZNX 4CN1A 2RFGA 2XIIA 2WAGA 4AD2A 5AB3A 3TSMA 1F07A 1PWLA 4OIFA 3OGVA 3EXTA 1BSIA 3LYEA 3C5QA 2ZE3A 1UHVA 5D33A 3UEQA 4QEEA 1K8CA 1FCUA 3MUIA 1KGUA 1SO4A 4MPKA 3SGGA 3EKZA 2XG9A 4S3EA 5I0DA 4E2OA 3BV4A 3TFXA 1C8VA 4G1NA 3EX2A 1J0IA 4ZSUA 3NYZA 1ONXA 2QULA 4LWWA 4PEEA 1KXQA 3L68A 1DJXA 3LBOA 2PP0A 1D2KA 1PYMA 4C6NA 3AYTA 2A5HA 5DY2A 2BV9A 2X7VA 3W7IA 2MANA 3RPDA 3LI1A 2ESCA 3QFEA 1T6MA 4UTWC 1F05A 1ZB5A 3BJTA 5AZ1A 2Q8XA 3LRMA 3O2LA 3PS7A 2HJPA 3PUGA 4UFLA 1PCWA 1XLIA 1YDOA 1H7NA 4JNMA 3U5YA 1N7KA 4QS5A 1SR9A 3J7HA 1JDFA 2IKIA 4PMDA 3DFHA 3EX3A 2Y8UA 3MHGA 4G1KA 3THDA 1IZKA 3FYYA 1KQYA 3CWHA 2W0UA 1UR4A 5I00A 4PTDA 4A35A 4F9DA 3LHYA 2EAWA 3VGHA 4DVOA 1XLKA 2DZUA 2Z1VA 6ALDA 5I03A 4GXWA 4LFYA 2MNRA 4CD8A 4LAOA 3TA9A 5HDRA 3IJ8A 2A4AA 3I10A 4LUTA 1W1PA 1P6BA 3CHDA 1XSKA 1R2SA 1PZ0A 3PC0A 4TMCA 3U4AA 1W1ZA 2WMIB 1TV8A 4Q8WA 4NT0A 4C6MA 5DCEA 1IWAA 2Y8KA 3BW2A 4FP1A 3VOGA 4D2JA 1XLCA 1UUQA 3UR2A 3ONCA 3CQJA 4WY0B 3WMLA 5D9PA 3WQ6A 4HMEA 1YDNA 3PZMA 2ISDA 4CU7A 4DWSD 4RE2A 3AZTA 5D37A 2WVVB 1X98A 1V4YA 4EWJA 4GZEA 3GVGA 4JR5A 4KMQA 2VFDA 1VQTA 1TWSA 2J75A 5M17A 3UA3A 3O9NA 2POTA 3LY0A 1UPMB 4IQDA 2RJHA 4NXSA 5C8BB 1DJZA 3A9IA 1GZGA 2V2DA 3T2QA 5HJYA 1FWTA 1VBRA 5GNYA 3DOPA 4HHHA 3KWXA 4C5ZA 3MBDA 1H63A 3ITLA 3VC6A 3AMDA 3IJ6A 1FXQA 5AZ0A 1W3LA 1VB9A 1LWJA 3FGCA 1TIWA 2YFOA 3G24A 1BPLB 2HEJA 1A5MC 3NL2A 3ELFA 5DELA 1RY0A 4G6CA 3DAQA 3QVQA 3VM7A 4LNYA 1BWKA 3PTQA 1XICA 2XU2A 2FJKA 2ZUTA 4ZO8A 2VC9A 2ADAA 4JHOA 5HNUA 4BWLA 4EANA 4TQTA 1PXGA 2ZKMX 4FR6A 4X9YA 3S1UA 1YNQA 4HNNA 3GHSA 4JTEA 4N42A 4U31A 2OEMA 3EOLA 2JEQA 4XZMX 3JZEA 3RILA 5D2YA 3SADA 1VPXA 1E3XA 4C5YA 4H7ZA 4DYKA 4IPNB 3IJLA 2PDWA 3HV9A 1W5MA 2OMAA 5D9NA 3AJXA 2I5IA 2WNZA 3L5AA 2YA2A 1ZNNA 2G50A 2EPHA 2A6NA 1TWZA 3GLCA 4GKLA 2J6XA 3CEPA 3UXDA 4JL2A 3CTTA 2OSXA 2PUZA 4HIBA 3A5VA 3VMNA 3VE7A 1LT7A 3IUIA 5LXXA 1H5YA 2OVLA 4IUOA 4NAFB 3QV9A 3FHQA 5REQB 1NSJA 1HN1A 5H2ZA 1H61A 1XF0A 1H0GA 3LK6A 3NG3A 3OYZA 3VDGA 2Q3RA 2GDUA 3RF9A 4UNIA 4GYPC 1OJXA 2FHFA 1A5NC 4UCGA 4HU0A 3MP4A 2BB0A 5A8NA 1L2UA 2IPGA 3CU2A 1H51A 1K6WA 5HWJA 4LB3A 1SSGA 2DZTA 4LUSB 1VHCA 4NP7A 4WF7A 2PTZA 3W2MA 4HNCA 1TMQA 4HPXA 3H2MA 3CB3A 4NAEB 3S8HA 1OC7A 2W6RA 3A47A 1SW7A 5A94A 3FKKA 3KZSA 5C7HA 1H1YA 1I45A 2HNEA 2V5KA 5FF0A 3ARUA 1J2WA 1UPPA 2H8ZA 3ENLA 5T9BG 4TOQA 3VNLA 3SN0A 3MMTA 4MZ8A 4N4PA 2YYTA 3VIFA 4E2BA 4IWWA 4QG6A 1QW9A 3MCOA 4QLKA 4YYFA 3BJSA 1XBYA 5F7UA 2QDDA 1TV5A 4PGLA 3UXAA 2YB1A 3BJFA 1G9HA 2PDPA 5BCAA 3W6MA 1FCVA 2HE5A 4MY8A 1Q4WA 3COTA 4KWOA 4IFKA 1ISXA 1CPUA 1EIXA 2GJRA 2WSPA 2OYKA 3RM9A 3QOKA 4N6EA 5BXSA 4R7JA 3WX7A 1W6TA 4ZSTA 5C6MA 2ICSA 3AAMA 1EOKA 3WBEA 2L5HA 1P6CA 1F3TA 1SR0A 1UIOA 3S2NA 4IP7A 5CJ5A 3M07A 4ZMGA 4N02A 3S0CA 2FZNA 3NO3A 2D20A 1VF8A 1K7FA 3ITTA 3VDAA 4A21A 2QKFA 4MWAC 4XD3A 2H9AA 1GQKA 2C3ZA 1JCJA 4K8GA 3N4AA 3AMGA 2VKZG 1XKJA 1V79A 3DG7A 3SGUA 3N6HA 3NM1A 1EJSC 1JQXA 1TCMA 3WYZA 3ORWA 1JG9A 2IPWA 3NSMA 5IM51 1E6ZA 2Z1BA 3KHDA 3IGSA 1BKHA 1DQUA 3LBCA 1I2RA 4CNTA 4A8IA 2HZGA 2HRWA 4HVXA 5ABGA 4OJYA 4AWTA 1EF3A 1KCKA 4MADA 1WDDA 3RUBL 1WBHA 3A6OA 3QW3A 4RXGA 1SJCA 3UR7A 1CXEA 1G7VA 1ZBVA 4JQ2A 3MU7A 4HN4A 2JGQA 2WHKA 1S3HA 1E9IA 3UW6A 1QI3A 1TMHA 4AY1A 4JKLA 3T40A 3G6LA 4CCZA 3U7BA 2J25A 1X1ZA 1YTEA 3M0MA 5BRQA 4XVDA 3FHAA 4GBDA 5D04C 1FH9A 2D2OA 3P0XA 4JIIX 4GVGA 4XAPA 2KAUC 3WD2A 1QFEA 3W24A 1XIBA 4AH7A 4DI8A 1R6WA 4HTBA 1BRLB 4IJCA 3IARA 3QC0A 3C86A 3VDCA 4HU8A 2FZBA 1OC6A 4WLCA 5DANA 1U5HA 2Z0IA 3R8RA 5EMLA 3SUWA 3VGDA 1LOLA 1QI2A 1F3EA 1AL7A 1JCYA 2WC4A 3H24A 2ZIDA 4Y9PA 4LRTA 4CD6A 3E2SA 2XHYA 1UD4A 1H1ZA 2NVCA 5AHEA 4ZFCA 1BKSA 4LOCA 4GCXA 4FXRA 1EYEA 3TC7A 1EEPA 3IVSA 5A1AA 4NG3A 1NM9A 4QRNA 2NQZA 1HGYA 2WKLA 1VYPX 2V2CA 3VMPA 4W7UA 3TEVA 1MSSA 6TIMA 2FVMA 3G1FA 5FJJA 2VR5A 2PF8A 4B3LA 5JH2A 3L2MA 3V0SA 3OZOA 4JHMA 3NQAA 3IAQA 4J9JA 1KTCA 3VZXA 4DJDC 2GQAA 3URQA 3TE9A 1K8XA 3KOFA 4NUWA 3GKAA 1UA3A 4P5UA 3VOIA 4ZQCA 1KCLA 4PCPA 5DMNA 2F61A 2QXWA 3N6JA 2VCCA 5E93A 5G2WA 4EVZA 3CHVA 2XH7A 5A8GA 3L2LA 1JPHA 1ZFJA 3D3FA 1QU4A 3ARXA 5A6BA 4DYEA 2P3EA 2ZADA 4LAUA 4MLJA 4GXPA 4GISA 1ZL1A 2W66A 1MO0A 2ZCGA 2J6VA 1GHSA 3P6LA 5AVNA 2G97A 1UJQA 1PS9A 5HR7A 1WP6A 3PTMA 2PDYA 1IT0A 3C3UA 1HT6A 1XISA 2VUNA 4ZOCA 2X42A 3VGBA 1XRFA 5CC5A 5I3HA 3E0IA 1J4EA 3AHVA 4EX4A 4JICA 4X2RA 3B9OA 4IPJA 3KRSA 3I3EA 5IFPA 1RA5A 2G0WA 3GQYA 2C1IA 4D6EA 3MUY1 3WD4A 2P50A 2PB1A 1SQ7A 1V6XA 3ES8A 4RNFA 2IPJA 1CECA 1TVNA 3U9IA 3C2FA 3N1AA 4KQNA 1KBJA 4PCFA 1YW1A 3IGUA 3KEHA 1RHCA 4AWUA 3ZJKA 2YXOA 4H6EA 1I0DA 3A23A 3M1ZA 1WYIA 4A22A 1EBGA 5F4XA 3H4WA 1KGXA 1VKFA 1VPYA 4C91A 4EXBA 3AMLA 1XFBA 1C93A 3UZZA 1V03A 1F73A 1YDVA 2WWCA 4FI4A 3VNDA 4KEMA 5ABFB 1E6XM 4XWUA 4NI3A 3NQVA 4BEQA 2EEXA 3MYOA 5BW6A 1R5YA 1TX2A 1FDZA 3UQNA 1XYFA 1OYBA 4O19A 3MVTA 4QTGA 1WDRA 1LJYA 5CSRA 4P7OA 1E0VA 1KQZA 2W9MA 3ITOA 2D3LA 4UTFA 4NJGA 2OLSA 5TIMA 4WXYA 5DCDA 3T4CA 3CHFA 1O5XA 1WZLA 4A3RA 2NXHA 5AC5A 2C16A 4KBXA 4AC7C 4UTTC 3BAWA 4HZ8A 2YDAA 2OX4A 3K8MA 2X1IA 5HPCA 3IV3A 1TREA 1PX4A 4WJXA 4XX6A 4INFA 4R27A 4MNLA 1HTIA 2ZUSA 1JZ5A 1C3FA 1J6PA 1R87A 4E6MA 2WZHA 3SCQA 3TYDA 3WLMA 4AF0A 3LHUA 3ZVHB 2DIKA 1ITUA 2VC7A 1OFOA 4XV0A 3PG8A 1TTJA 4K68A 1O7AA 5DFAA 1D7FA 5HPOA 3KL3A 4Z2HA 4J2PA 4M24A 3NJ3A 1UZDA 3W74A 2GWGA 4JDYA 2J13A 5A6SA 4NSBA 3WF1A 1B31A 1S38A 3AS0A 4AZ6A 4J3ZA 1R85A 1EXBA 5RUBA 4BF7A 2JIWA 1SJDA 5TQLA 1ZLPA 1O95A 3VUPA 3KLKA 4R88A 3PSWA 4FK9A 1XFCA 3BE7A 4HA4A 3CPUA 4HNOA 1ZRQA 3QR0A 4YS1A 1LQ2A 2OPJA 2QCMA 1OX5A 2CYGA 2QDGA 4YTUA 4AD3A 4H2CA 4F2BA 2B81A 3OZYA 4RZ6A 2ALDA 3NZRA 1VLWA 3B05A 1BXCA 3CYVA 3LZ5A 3A64A 4A2SA 5T9CE 2EJ1A 3QZEA 4LEFA 1L6WA 3CEUA 4H83A 2NV9A 2XN2A 3F2BA 4S3DA 3W1RA 3VDBA 1QXLA 4KCUA 1W1IE 3AOFA 3GC2A 1OEPA 1FH8A 3RU6A 3MZ2A 4GX8A 4IFRA 1XG3A 2PWHA 3GE7A 1QI0A 1A50A 3FIGA 1OINA 2F6KA 2NSOA 2OEJA 2HVMA 1JRCA 2FZMA 5KEZA 3SCRA 3B9NA 2GGIA 1HP4A 1PPIA 1DJHA 2CZDA 4RK8A 1XH1A 3LCLA 2YBTA 1F6PA 2QCLA 2WMFA 1JCNA 1PDYA 2VZSA 4PMQA 2Q71A 4HMDA 3UERA 1CEOA 4QHRA 3GVVA 2PLMA 5BWAA 1FCQA 2E7FA 4BEUA 3B04A 2J7BA 3KTXA 1OFBA 1TJRA 2Y8VA 3BWWA 4DBDA 1EWDA 2VZUA 4V27A 5E5CA 4DEFA 4IPIA 4IF2A 3DHFA 3P62A 2BGNE 4MTVA 3TFCA 3TWAA 5LYRA 3N2BA 4LAMA 3WQDA 4OKDA 1QNVA 2C71A 4I6VA 3IS4A 1LL7A 1H2JA 3HFTA 3UU0A 1P1XA 1S39A 3WUEA 3GBDA 3PB0A 1A3XA 2PDNA 3V5CA 3MQTA 3APTA 4NZCA 1YKWA 2BZNA 3MY9A 3II1A 5FOOA 3EEZA 4KCTA 4CNPA 1XRVA 3IUHA 3KZPA 4Q7IA 1XIEA 2PGEA 4KIEA 3IVUA 3PSVA 3NL3A 5FF3A 3H12A 3GHUA 4D1JA 3BAJA 4LSBA 3APYA 1S5NA 4JTCA 4MSSA 3OVQA 5U4NA 1FOBA 3SCOA 3HFYA 2F38A 3IIXA 4HPJA 5TAOA 4XIMA 4ZTXA 1FKXA 1NVMA 3FVMA 1JUKA 3H7RA 5A5WA 4I7VA 2BP1A 3TN6A 3TTYA 1XXXA 4RV8A 4E5TA 4GO8A 1L8PA 1UQZA 2G3IA 4KS0A 1HQTA 1K9FA 4JTFA 3H2OA 2HK0A 1UWSA 1C7SA 1R46A 5KETA 1EC8A 4EK7A 4JCLA 3VO0A 4Q4RA 2CKSA 3NUKA 1F8IA 5A6MA 4AISA 3NPWA 4N9CA 3H22A 3W00A 1XYBA 2O92A 3N2OA 3TU9A 3LNMA 4AY7A 4FSAA 4UZUA 4MNKA 3K8LA 3JRKA 4ROPA 5A95A 3EDKA 4MYAA 1A5UA 3P5ZA 4XQ6A 4DYJA 1R3WA 1J8VA 1IE7C 2Y2WA 1AD4A 3LERA 3VIOA 3QJAA 5A2BA 3B8WA 2RDWA 4B5TA 1KCXA 1GEQA 3ZO9A 2YW4A 4L4PA 1OYAA 1KV5A 3VZZA 3DHUA 2A7RA 2QUTA 1LQ0A 2WJZA 4J3WA 3NDZA 3TP4A 4NZ3A 2DQXA 2FZ8A 3GAKA 4TVCA 5KINA 3V3WA 1GOWA 1DWGM 1YXCA 3VPLA 1KC7A 1EP3A 2ZBTA 4HJFA 2X1SA 2W62A 1E1CA 3EMZA 3SSZA 3W02A 3WK0A 2GUYA 1WDQA 3H6OA 4MG4A 3I6TA 3WNKA 3OIXA 2BGQA 1E55A 3CC1A 2PDJA 4NNCA 1PB0A 1HJXA 2R6OA 1E0UA 4JFWA 1DV7A 1E6PA 3AYRA 4HOWA 3PY2A 1ESWA 1NFBA 1DL3A 3NL5A 1EDTA 1E1EA 1JEZA 5LKYA 1HL2A 2BY1A 3WBYA 3ARRA 2DZPA 2QUUA 7REQB 2YSWA 3P0WA 5B7ZA 1G0CA 1FWCC 3C0SA 3UPMA 4PODA 4LT9A 4CD4A 1S2CA 2I1OA 3G1AA 2R8WA 1HVQA 2Z24A 1RJQA 3GU2A 3R4IA 3G1HA 1W3HA 4PMRA 3OHIA 1UZ1A 1V3KA 2X40A 2FMOA 1MEHA 3WQ5A 1TYGA 3K1GA 1EGZA 1AJZA 3BK0A 3VD7A 3WJXA 1UD6A 1AH4A 4FAMA 3CUZA 4IG2B 3RIKA 4GO9A 4AHOA 1XGEA 3T0AA 1XQKA 4FMVA 4GUJA 4WX2A 3EB4A 3KWSA 1ZCCA 1JFHA 3TQ0A 2UWFA 4AMCA 3U2CA 4JTKA 1FWWA 4KEVA 1ZUAX 2X8RA 2CBVA 1LBMA 4KWUA 4ZGYA 4BS0A 2VEPA 5BZAA 5D2VA 1SPQA 2ZRUA 3WDHA 2NT0A 4PMJA 4XO6A 3P67A 1JXJA 2FB2A 2X09A 4FXFA 1UR9A 3UWVA 3CH0A 3REQA 2NQ9A 3N9SA 1KXHA 1VEMA 1YTDA 2OJPA 4DBEA 1YPXA 4ADSA 3URAA 3WLHA 4Q8MA 4FLOA 4UWMA 5EMJA 4IGMA 5KMYA 4K8EA 3LI0A 3JU2A 1QASA 4D6FA 3NOYA 1T99A 1RPXA 4ACZB 4XAYA 2V9DA 1E71M 4LBSA 5DQPA 1IXNA 4RPQA 3EOUA 4PUJA 2E25A 3L0KA 4N9BA 2YCIX 4RNJA 1VGAA 4NNAA 2F2HA 3SURA 3TXVA 4LUSA 2CLLA 3TCEA 4UTWA 3LGEA 4LU0A 4LANA 1POJA 3IJDA 2DSUA 3RO8A 2B4GA 1TRDA 3M0KA 3DKJA 3SJ3A 3WDJA 4LY8A 4WIWA 4Q8VA 1E3ZA 5CPTA 3S5NA 2QDEA 1XBVA 1V8EA 1DHKA 1GW1A 1XIJA 4JHZA 4MVAA 2WBGA 2CXGA 3M43A 4EF9A 3CT7A 4MKVA 2Z25A 1DJQA 4JIHA 3E0VA 4H9UA 4LYPA 1K02A 1CGXA 3EDDA 1AMKA 1QO2A 1CT5A 1UA7A 2CPUA 1WQ5A 4OECA 3RXZA 5F1VA 4PUUA 3O6AA 3AHYA 2ZZ5A 1KGWA 4K37A 1UH4A 4DI9A 1TJ0A 2YW3A 1DORA 1YYAA 1XLBA 4OWGA 3AUJA 3SW6A 3WQGA 2XN1A 2PGRA 1VP5A 3RJYA 5AYIA 2CU0A 5BOEA 1FWDC 1W1VA 4A05A 7TIMA 1E4LA 4XBJA 3C2VA 3MVIA 1F3XA 3BGAA 2WMJA 4CCCA 4URIA 2HPIA 2PWEA 2RUSA 1GOKA 4H19A 5CQ1A 1XI3A 3F5JA 1M6JA 2REQA 3ABSA 1EJ7L 1FH7A 5AHIA 2WMHA 1CLVA 1QDSA 4LQ1A 3ATZA 3DFNA 3ZQ9A 2BVDA 2CLFA 3LV6A 1X7FA 2JQXA 3A22A 3LHZA 2YA0A 3KBSA 1MXGA 4Q4MA 3HTWA 4ACYA 2A3LA 3D47A 4PCSA 1XS2A 3BAXA 1L8NA 3ALFA 3VIMA 3V4BA 3D3AA 2HTMA 5CZ0A 3GVWA 2ODOA 4FR1A 2WCSA 2D73A 3QR3A 1A5CA 1YLVA 1JPDX 2ON3A 1US3A 2J7HA 3PNUA 2VFGA 3W7RA 2DPEA 2PP3A 1ZAJA 2AOSA 2EG8A 3S2MA 1P48A 3BLPX 1HNYA 2XIMA 2O4MA 3C6CA 1XGZA 2NLYA 3B40A 3ZT5A 4BQ2A 3ES7A 4GHRA 4QCFA 3O3RA 3NO1A 4Q8NA 2Y7GA 2Z27A 3E0LA 2DSKA 3RYSA 4OV4A 2G5WA 4H8NA 1YPIA 1OIMA 5AHFA 1MFUA 2ACSA 2FPTA 4MFDA 3CM4A 4UUIA 3BPWA 1R3TA 4LV9A 2YDRA 1IEXA 1S2UA 3SUSA 1UUMA 2ZA1A 3H4XA 4WR3A 1BG9A 1XKYA 3WQVA 5LHFA 4DB7A 3W81A 4M7SA 2J79A 4EPDC 4J40A 4BY3A 1AQ0A 1MQPA 3MV11 1BRLA 5C71A 4ATWA 4I7WA 3VU2A 2ABBA 5CC7A 1RALA 3L4VA 4YN5A 4OBTA 1KLZA 2UY5A 1B57A 3LM7A 4V15A 3B97A 4MIMA 1U2YA 1AL8A 1T0OA 2GQ9A 2ISVA 2I17A 3WBWA 1AJ0A 1I60A 3S2LA 3W85A 3MMUA 3WMBA 1UD5A 5F4SA 2VX4A 3WUFA 1EO5A 4FZIA 2Y85A 3UY8A 3UT0A 1PSCA 2Z2AA 2FQIA 3CXOA 1IWPA 3QQ0A 4ZODA 5HMSA 1CENA 3Q4DA 4W93A 4B5SA 4MJ2A 1XQLA 3RLHA 4CCDA 4GYPA 2FTWA 4DO6A 3UVIA 4BF5A 2QJIA 2IUZA 1PTGA 3ITCA 4L6DA 3M0ZA 1QNRA 1E0TA 4IP4A 2AL2B 1VFLA 5TF0A 1TUXA 2Z00A 4GC4A 1NWRA 3MJMA 3MKKA 4EPBC 6A3HA 4DELA 3WH8A 2FMNA 3TQKA 2DSVA 1JF5A 1GYNA 2EGZA 4CU6A 4RNIA 3GHTA 3WL1A 2VL4A 4Q7BA 4IPLA 3XISA 3P14A 2FDSA 3MHFA 1XDMA 1OT1A 3W87A 2OEKA 2VDGA 3THCA 4LALA 2QW5A 3FA3A 2R1MA 1GYLA 3R12A 3TYZA 2C19A 2GGEA 2QUMA 5C9WA 1HKMA 4FXSA 2KX9A 3TJIA 3WFZA 5CPQA 5HAOA 1Q13A 3CIWA 1OT2A 3BUVA 3R79A 1S2AA 4DWDA 2I9EA 4QG8A 2WKGA 3W1PA 3AU2A 1MNZA 3SY5A 4GYKA 1P5BA 1XC4A 2OSYA 3W1NA 3TYUA 1DWAM 5JVLA 2OT0A 4J1OA 5J5RA 4UR8A 3LCHA 4H7CA 5BROA 3WH5A 4C7DA 4QSHA 4HCHA 1QPOA 5IBXC 2QCGA 3LSBA 1XR2A 3USBA 4ONVA 3AC0A 4DM2A 4M56A 4GQGA 4AEFA 5HJLA 4K6AA 4HP5A 2PDCA 3ABQA 4GIRA 4V2XA 2QPSA 4ZZ9A 4WOQA 1D8CA 3MP3A 4ILSA 1AW1A 1JDDA 1TQXA 1QUMA 5I3IA 1B3WA 4B5WA 1X96A 3B8IA 4MWAA 3PFMA 4HHPA 3WD1A 4H8HA 3AU6A 3KXQA 5IOBA 1H60A 4P2VA 3TNOA 4KIRA 3ZJ7A 3PAOA 4MM1A 4A2RA 3UETA 2G3FA 4UMBA 3V0UA 1CB2A 1T7LA 5ABFA 4EXQA 4NI8A 5CPOA 1PIIA 3H7UA 4NZ4A 4W5ZA 1J12A 1W9DM 3RGTA 3SUVA 1N8FA 1UKOA 1B3ZA 4KGJA 2J7CA 4AFYA 2BOFX 4PFHA 2HMCA 5FEPA 2XN0A 3ZM8A 2OX1A 3M47A 1DWIM 4WD0A 1FCBA 1J96A 4D8ZA 3MI2A 4F48A 4L9XA 3UWUA 1OD0A 4P61A 4PRWA 3IV8A 2VD9A 1HF6A 3W7PA 4LC8A 4C60A 4CD5A 3SR7A 2OWCA 5CAHA 2QJHA 4S3JA 3WK1A 3MO4A 1SW3A 1AODA 1TZ7A 3MYPA 1HVXA 3HOJA 1E56A 1EPVA 4HSNA 4PUEA 1G5AA 4R9OA 1OGSA 3UESA 1YBQB 3CO8A 3MO7A 3V75A 3ERPA 5C5YA 5LA0A 3WY1A 1F8MA 3DG3A 4QROA 4LVDA 2R1KA 3G1DA 3ZVHA 3RJXA 2VOMA 1TJ1A 2ZTKA 1FDYA 2PRHA 1ZHAA 2OLHA 1H50A 2PTDA 1OABA 1EGMA 4JIRA 3LHVA 3AALA 3G0SA 3QPEA 1PDZA 1VIZA 2DQWA 3FOKA 1J0YA 4N9EA 4E3VA 1VIWA 2WHLA 4OT7A 4DBWA 1D8WA 4E8GA 4AG0A 1I75A 3LCFA 3UR5A 4W8BA 4YMZA 2DT2A 2O7QA 2RJGA 1KM1A 1KWGA 5FEXA 3GIYA 1OCJA 3P8IA 5CCZA 1B5TA 4CQ9A 2E28A 2I7GA 4CEXC 1KFWA 3PNZA 2YBUA 1HIZA 4O0QA 3GTNA 1R3YA 1EGVA 2OT1A 4HT3A 1HL8A 3LX9A 3LXAA 1V3HA 2Y1HA 3BMVA 1OX4A 2B7PA 3AJ7A 1IYXA 3NIYA 3G1YA 4DJDA 1Q6LA 3WQ4A 4MB4A 1WXZA 3BSMA 1TG7A 3FEQA 1QNSA 1GQJA 2A6LA 4PZVA 3GRIA 4NIRA 4R7OA 4AZIA 3AISA 3NDYA 2JBMA 4JTGA 3W1AA 2YXGA 3UGVA 3CLWA 4W4QA 3VIJA 2UBPC 3NQGA 3HBLA 1ME7A 2E6YA 1E51A 2YJQA 4ATDA 1IV8A 3L4WA 1P0NA 4OBSA 1P1MA 1PBGA 5A8QA 2PDHA 1DJNA 4WKHA 3S1GA 4XSLA 5AC4A 3Q65A 2QCHA 3GNXA 1K4HA 8XIAA 5HNTA 1W31A 1X39A 4Z1CA 2XZ7A 4H6QA 1LOQA 1TJPA 5I07A 1FWBC 3GWQA 3QPYA 4AC1X 1G01A 5DXYA 4U3CA 4O57A 1E4NA 2QLYA 4N0RA 4QLJA 2WZIA 4AZHA 3KVKA 6TAAA 4HZ7A 3ME3A 2ZOXA 4C1LA 1J10A 1E6QM 4PTXA 1DTNA 3N6QA 3WLRA 3CHEA 3RK8A 4AEOA 1Q5MA 1QPRA 2DSZA 1VFOA 1XL9A 2A7PA 5A6JA 3WLIA 5EMKA 3MBFA 2PSNA 4DJFC 2O55A 3FXGA 4GACA 4HYVA 1KNWA 2YR1A 4H9ZA 3B3DA 1V3MA 4HGXA 4F0RA 2Q01A 2PZ0A 3D5HA 4PRTA 2VR4A 1B30A 4US6A 1TV3A 2A3AA 3PHAA 1NEYA 5LSMA 3TC3A 5JXQA 4HNTA 3W1LA 4LUTB 1ME8A 4J35A 3FX4A 2WNQA 4ZR8A 4JN6A 3VKCA 1RR2A 1L0PA 3EGJA 2JK2A 3JUGA 1IT7A 3GS6A 3EKGA 2PURA 1TPVA 2QHAA 5FAJA 1H11A 4ORIA 4AYSA 3UGRA 1QRQA 4DXXA 1RLDA 1FHVA 1XUZA 4V28A 2VFIA 4FOKA 1CDGA 2AGTA 1TO3A 4ZTYA 4GXMA 4KCWA 2QIIA 1EFZA 4UFIA 2Z2BA 3GUWA 1A0CA 3PJUA 2X41A 3OBKA 3ANVA 4M1RA 4I7UA 2JKPA 4UTTA 3WFLA 1BTMA 1JPIA 3ARZA 4W84A 1JFXA 4Q22A 1RCOB 3CQHA 3T2PA 1R8LA 1QWKA 3RHGA 1O5QA 1EC7A 3N9RA 1UIPA 2Y7EA 4B2DA 3VABA 1F61A 1LLOA 7XIMA 1LDCA 1HGWA 1UKSA 4GINA 2VWTA 3MWCA 4AAJA 1DQWA 1CCWB 3S6TA 1EUAA 1ICPA 4MNMA 2VMFA 3PK7A 1VLIA 1W1A1 2QJGA 1VCGA 4GQRA 3N25A 1HJSA 4MNJA 3V1HA 3LDVA 3UY7A 1WXYA 3ISIX 1A4MA 1WE5A 3W38A 3QH2A 1YRRA 2V67A 2D69A 3FGCB 5XIMA 3TJLA 3PTKA 1TPEA 4EOUA 1J93A 8CGTA 4ICNA 7REQA 3FCPA 3VIKA 1TPB1 4J2MA 3CT2A 3EZ4A 4M6UA 1ODUA 2YIHA 4O53A 3UXKA 1BQCA 2ZX6A 4HK5A 4XAZA 4NYYA 1KFJA 5FJPA 4ZOEA 4QS6A 1GONA 1FWSA 4KF1A 1QPNA 1VAHA 4C90A 3V18A 4H04A 5EFDA 2CCRA 4KFPA 1J0JA 4KEZA 3RU8X 2TODA 4UR9A 4IG2A 2YLAA 1PE1A 3C0QA 1V3IA 3E49A 4LS0A 1MWOA 2XUCA 3V36A 4BQ3A 4UCFA 3P60A 4HZMA 3EMCA 3HPAA 4Z1DA 3UR8A 1FXPA 2CZ5A 1G4SA 1EP2A 1AQHA 3W1QA 5MF5A 3NNTA 4GPNA 3TYAA 1NJJA 2A2IA 1MW0A 4IX2A 4FNQA 3BL3A 4Y2WA 1LL6A 3FS2A 4CQDA 3QTGA 2QPXA 4JNZA 2V2HA 1F5ZA 1R7OA 2XSAA 5EMYA 4BZYA 4Z1YA 3IJ7A 1JRBA 3N2XA 1QHZA 3M0YA 3MUAA 2IKHA 3HURA 3T42A 1NU5A 3VTRA 1CXKA 1ICSA 1THFD 3V0TA 1WO2A 1HKKA 4ERIA 4TVDA 3HM7A 4B4HA 4UOJA 2VZVA 4ACZA 1UWIA 1R2TA 3W73A 4GI4A 3BC9A 1JGIA 1X1OA 2ZICA 2PE4A 4ZOBA 5HNNA 1UJPA 4B91A 1VCFA 4M6VA 2PGFA 5EY5A 1HO4A 2YL5A 3FDKA 4RE3A 2GDVA 3R5EA 1J2BA 4U2ZA 1R0MA 1B4EA 4JQ3A 2WVTA 3G77A 3S46A 3CJPA 1K1DA 5JQ9A 3KTCA 4H41A 2ZUVA 5CBJA 1ALDA 4YYCA 4HB7A 1K7EA 3R1ZA 5I23A 2O9RA 3MUXA 3A4XA 4DJFD 1AUSL 2PDUA 1Z44A 3BOFA 1CGWA 3DUGA 3M6YA 4DLFA 4XD6A 1PUDA 1QTWA 2BY2A 4H01A 4YPJA 3CH9A 1K3UA 4IZGA 3EDJA 1DE6A 1JAEA 4NF7A 1QT1A 4WJEA 3KVMA 1VJSA 2TAAA 3MW7A 1IEWA 2GWNA 3LGDA 3TMLA 3TDFA 4IFKB 3N18A 3QMTA 3CBWA 3N3TA 2OELA 5DO8A 3GC4A 4J5NA 1S2VA 1MI3A 3NXFA 1ZALA 2QCFA 3WJYA 2X16A 4NXKA 4QJ5B 1VFFA 3R89A 3BZGA 4UTHA 4C6JA 1RCQA 4QNWA 3AYSA 3CMJA 4NZ5A 2ZZ7A 3VE9A 3K4DA 4LCSA 1XM3A 2VFFA 1QOXA 3PUEA 1GOOA 3CHCA 3FV9A 1PKMA 1B54A 1W17A 1GJPA 3NZPA 3B9DA 2H9AB 5CZTA 1WZMA 4S23A 4TX9A 4IPPA 2EXOA 1M68A 3BXWA 3G8RA 4YVXA 3WLSA 4F9JA 4DUWA 3ZWSA 2ZX8A 4EWND 2G96A 3WDIA 1VBHA 3NCOA 3KBJA 1JQVA 2PD5A 3L0NA 1DHPA 2NXGA 3NGFA 4GE8A 3GVRA 3PVFA 4QE1A 2PDQA 1QATA 3LS9A 3M0XA 2ACRA 4HCDA 2LLEA 2R24A 3DBNA 3LNPA 3I65A 1U5JA 1VYRA 3R58A 3MDUA 3N12A 5FIPA 3AROA 2BXZA 4IMDA 1QMLA 1E40A 3D46A 3DX5A 1UG6A 2QVNA 4ERGA 5G1TA 3QBUA 2DV0A 1F4HA 2J9ZA 3KBNA 4E4UA 1E9LA 2Q8LA 1VJZA 3G1RA 4JX4A 5I3KA 2YOCA 2NV1A 5HULA 3VOJA 1W3NA 4HHMA 2CESA 5DMMA 1EHNA 1G4EA 1VC4A 2XWEA 3GIQA 3LA4A 3VUSA 3INPA 3VVGA 4E3TA 2WPBA 4C7FA 3WEZA 1KTNA 5FESA 1AA1B 2ZX9A 4M80A 1E6SM 1E43A 1YNYA 1GVIA 2H90A 3C2RA 3BARA 3FVDA 3WDQA 5LIYX 2ZRWA 1SUXA 3O07A 1XLGA 4O1FA 4UOZA 3T78A 5HMEA 4B9YA 2BGSA 3NAVA 5AVHA 1S46A 2X2GA 4LS2A 2P5NA 5E0KA 4YJ5A 5I3JA 1X6NA 3BMWA 2WANA 3OZPA 4IM4A 3S2CA 2FGZA 2GDQA 2PDIA 2F2KA 3BLIA 1KRBC 2FVKA 2D0GA 1IIGA 1XW8A 1OFDA 2GSEA 1WDWA 5G4WA 3RN6A 3WBAA 4RW3A 3U2OA 2I5GA 4JTUA 3NVDA 3CZEA 1A5BA 3EMQA 2TYSA 4J3TA 2VVNA 2WQPA 3WSUA 5JU6A 1REQB 2WSYA 4LY4A 3U5UA 5AYYA 3ZZ1A 5H8UA 2E8YA 1TTIA 4QSFA 3O1NA 2G3MA 3LOTA 3W26A 1BSLA 1RZMA 3CMGA 4ASTA 1O5RA 4ZE4A 1GT8A 3VX1A 3U2ZA 2D2JA 3AHZA 1GNXA 1M7XA 3TZNA 3SUTA 4A29A 3ZT6A 4DXKA 4FX6M 2ACUA 4Q8UA 5FF4A 3SQSA 2AL2A 4PCTA 2I56A 3PZGA 3GTIA 1N8IA 2WC7A 4B5XA 4HN8A 3CPRA 3GM8A 3F2CA 3QFWA 2XVNA 4Q4QA 2RHGA 4Z0JA 3TTQA 3QRHA 2WLYA 2ISSA 2BVTA 3AO0A 1QW8A 3A13A 4OV9A 1MDLA 1X1NA 3QR1A 1JCLA 2FIQA 1ODZA 2E5CA 4R85A 1R30A 2YCLA 1KRCC 1CLXA 3T6CA 1BYAA 2ZXDA 1P0BA 2Y61A 4WEVX 3GH5A 3OODA 2XH4A 4ZB0A 1H3GA 1VD6A 1JI2A 4QR6A 4HSOA 1W8GA 3L65A 4GMEA 1XLMA 2RGLA 5M3WA 1NFPA 3KRBA 3NPXA 4RZBA 2V0TA 1DXEA 4UB9A 2BHUA 2AQVA 5GJMA 4CUCA 3DC0A 2VI0A 1KR1A 3W1UA 4IQLA 2ZZ1A 3WDPP 5CG7A 4GNJA 1DWFM 2X0SA 5D30A 1Q7MA 2VQUA 1Q3NA 1GUVA 3RRAA 3R8HA 3SAZA 1SMAA 3OP2A 4AEEA 4FO4A 3BOXA 3W1TA 4O1DA 2CLOA 2WJDA 3GKFA 4N2YA 3A5FA 2GGGA 3OGRA 4F0SA 1UOZA 2VEKA 3MPGA 2VP8A 3W6LA 5F2MA 1F6YA 1HP5A 5GVJA 4GNVA 2O56A 3WJZA 3QF0A 3CGTA 5F4WA 3EB3A 3SGZA 2ASHA 4GRSA 1KV8A 4RE0A 4JNYA 4Z2JA 3MSRA 4UTIA 5U7SA 2TRSA 5DBTA 3AMKA 5DMLA 2V3FA 4F0KA 3BAYA 5EA9A 4Y90A 3EA2A 2XFFA 5HWNA 1S5WA 4DJEC 3RO6A 1QCWA 2E6FA 1LUCB 5DCBA 2NWRA 1JGMA 4U10A 2VURA 1EJRC 4NL1A 1A80A 3EXRA 5A6AA 1UWQA 4JXCA 1JYNA 5C9ZA 5E0FA 1W5PA 1GVYA 2CWNA 3P61A 3OGSA 3MA8A 2XM2A 1OY0A 4DWSC 1CWYA 3OG3A 2QJMA 3U7VA 4MMWA 1L6YA 3FJ4A 3WZ0E 4KEUA 1ZBWA 1IEIA 3B4UA 2IKGA 2HSAA 3N11A 2HNHA 4P8XA 4PYSA 3G5EA 1NP2A 1WZKA 4HA0A 2VDIA 1JULA 1CZ1A 2ZZ6A 3VK5A 4KFOA 2O7SA 1EDQA 3ONBA 1E1FA 4GABA 3OVRA 4LUJA 1LRQA 2XVGA 4W89A 4ZOAA 5T91A 3LPFA 1W5OA 4XTDA 2UY2A 2XFWA 4ZL1A 4KRTA 3TX9A 4OBRA 4XSMA 1EJUC 2PDGA 2FTYA 3VGEA 4QP0A 3NQEA 1OFQA 3CZLA 3LLXA 1A4LA 1RAKA 2NUYA 4PA8A 4Z17A 5XIAA 4TTUA 3DKLA 1EJWC 2Y7FA 4RDVA 4RR4A 5KZ6A 3GSMA 3UZXA 1IHIA 4JOMA 1M5WA 1MDRA 3QTPA 1CIUA 3ALGA 1SM9A 1UD2A 4IL2A 2DORA 2J88A 1RBAA 4E8DA 3OBEA 2XVLA 3CUJA 4W5UA 3EWXA 3ZLFA 5A6LA 1LRTA 1UH2A 5LHEA 3H54A 4YTRA 1V0KA 3OJGA 3IEBA 1EJTC 3V5FA 2R1NA 3GW3A 3LTYA 3FJ6A 4BA0A 3EWBX 3QHNA 2FPYA 1Q85A 1GVSA 3ZSTA 1NQKA 1GQLA 1O60A 3G6MA 3WLTA 2A1YA 4DNMA 3HN3A 1W3JA 4U3AA 3UG4A 4J3VA 2ISWA 2QV4A 3I3DA 5BXRA 3T05A 4XZIA 1BQGA 3NZ1A 3L21A 4AD4A 4M3PA 4JN7A 3DFTA 4FALA 1XYZA 1YDYA 4Z2IA 2JIEA 4P7QA 1RH9A 2BHYA 3PPFA 3T0DA 4KRZA 5CZKA 1T8QA 1I9CB 4ICMA 2HE8A 3VNJA 3BGJA 4LYQA 4YTQA 3QHMA 1AZ2A 3LUTA 4KWVA 5M5DA 4UBPC 1W9BM 1HKJA 1MEIA 3SECA 1CX9A 2VNCA 3IGHX 4JEJA 4O18A 5IFTA 5D2TA 5K4ZA 1UD8A 3FYPA 2BBFA 4PUNA 3KE0A 3KCOA 3A4WA 4YIWA 5E6ZA 1VZWA 4GUIA 4GNKB 2EG6A 1U5VA 4XISA 2HXTA 1MVYA 3QY6A 1F2JA 4EXAA 2PWFA 3I68A 4CQBA 2PMQA 3O05A 3P8JA 1S1RA 3QC3A 2FKPA 2GJLA 1JZ2A 3QV6A 2WQDA 4E4PA 5HXMA 3VINA 2NXIA 1UWUA 3PR2A 4C6DA 4UZSA 2VGBA 3GAYA 1EHAA 2Y62A 1WOAA 4L65A 4ZA0A 1FHDA 1PEZA 3E2RA 1TFVA 4BI5A 5TBOA 4IUGA 2QJNA 4C6BA 1Q6GA 1Z7AA 2OQHA 1W91A 3TTSA 2P0IA 2A85A 1NH6A 3M5YA 1OCBA 2DW6A 1KM3A 3TYBA 2XSBA 4MDPA 3ZT7A 5CJMA 3W9ZA 4O1CA 3RM8A 1U1UA 3QHOA 1ISZA 3KOWA 1HXJA 1IEVA 5EMUA 3WLPA 2ZUUA 1UKPA 1RVKA 4DJED 4BWLC 1NFGA 4IT1A 2YL9A 4DUVA 2Q8ZA 2VZOA 1FFQA 2PDLA 3PJXA 4TUFA 3P93A 4R34A 2E5DA 1W5NA 3KS6A 5KITA 4L6OA 3H55A 4HMNA 1E5NA 5CGTA 3IACA 3DHPA 5CAKA 3IPWA 3WNPA 3WQFA 5E70A 5FEZA 1YE4A 1ZAIA 5F2LA 2ZUMA 3GG1A 1JZ6A 2YCJA 2DSWA 3F1QA 4CQCA 3L4ZA 4QIUA 2ZYFA 2PODA 3O6YX 4FA3A 4FIRA 1E1CB 2BDQA 2HISA 3IJQA 1Q45A 3SCNA 3TR9A 1RJRA 3K46A 3UZ5A 3BH4A 3TJ4A 1QAPA 1FQ0A 2XIQA 2R91A 4CVWA 4YL2A 2GJXA 3E02A 1K77A 3B9AA 5CGQA 3RG6A 4PEKA 1UR2A 4QISA 1P6WA 3UA4A 2HXUA 2PWDA 3LEPA 4ZEPA 4E2DA 3UP8A 2AL1A 4GQBA 3KM8A 5G1YA 4S3FA 2Z1KA 4Y96A 3GR4A 5BWFA 1P7TA 3M4HA 4LBRA 3U3HA 1GOQA 2OZ3A 5JIPA 4LJ3A 1B9BA 4NU7A 1SMDA 2GVJA 1Y7VA 4PCNA 3RX4A 4AHPA 2BMBA 3RCYA 1E4IA 4PUDA 3APGA 4OU1A 3HJEA 2AKMA 3OHMB 3MSDA 1X8CA 2D3NA 4H6KA 1CGTA 5G2HA 1SFTA 4X9SA 1ME9A 2ZE0A 3WQPA 3WK3A 4S3KA 4NY2A 1AG1O 5A8MA 1K03A 1XP3A 3WBXA 1C8XA 2P53A 3CIVA 2VM8A 3BCJA 1TE6A 3CWNA 4N7QA 3S5SA 4HKPA 1GWJA 5FSEC 1UP3A 3R6IA 3PULA 4YTSA 1U1HA 4JTSA 1GORA 1ZP4A 1LOSA 3THAA 3GG7A 3W28A 1PCKA 4HNLA 4DZ5A 1XYMA 3REQB 1ONWA 3ARWA 1EA0A 4O1AA 2Z29A 1QI5A 4US5A 1ZBCA 5I2UA 5A69A 4DN1A 1O1HA 1ZJAA 3GZ3A 4C6CA 4Z2LA 2MUCA 2E8ZA 2ZX5A 4YCPA 2J27A 4UIOA 2C1HA 1XYAA 3OO2A 2XIBA 2VHLA 4MPQA 4PH6A 3NQ7A 2FPVA 4I9JA 1OGBA 1Q8AA 3WJSA 1DKWA 2ZRXA 1ZBKA 2YA1A 3KOXA 4LPCA 5CSUA 2V8ZA 5D2WA 2PU1A 1WDPA 3TTOA 1HZYA 1OSEA 4AX6A 1UQYA 3W6YA 4YVPA 3M0JA 1EZWA 4K39A 4DIAA 1D3CA 1C8YA 1T5AA 2E67A 2IMRA 4N6FA 3ZJ8A 2NQLA 4ES4A 4WRHA 1XRTA 1C92A 2FH6A 5FD0A 5T26A 3WQCA 1ECQA 2IS7A 4IIGA 5FACA 1WKFA 4AX7A 3GH4A 1E5JA 1V93A 4ZQRA 2Y7DA 4PL2A 1IQ8A 4E8CA 3W86A 3QSTA 7PTDA 4O8RA 1MRQA 2OKOA 1OCNA 3SRKA 3O0KA 2J78A 3N4FA 3QZ6A 4HPNA 5BRPA 3WF4A 2INEA 4OQVA 1M9HA 2X0YA 1XV8A 4IFOA 2ZUWA 4PMVA 5JMUA 2YGYA 3QV7A 3NPVA 1GTEA 4CNNA 3STGA 3A4JA 4UFMA 1QBAA 3TOPA 5LXEA 3SJNA 1KBLA 1UKTA 3R0DA 1JVNA 3GDMA 2A21A 4UTUA 3FKRA 4IXHA 1PO9A 2QGHA 2UZ9A 4W9TA 5LNUA 1GOXA 3C8FA 1QR7A 1U1JA 1BVZA 4U5KA 2DY3A 4FLQA 2ONEA 2X05A 3WF0A 3L9CA 4JGDA 2J8GA 1KWKA 1EXPA 3ZFHA 2EJAA 2REQB 1DVJA 1NAL1 4Z1AA 4KESA 3BG9A 1DJWA 1EPXA 2ZZ2A 1M7OA 3W23A 3HMJG 1YPFA 4AWSA 3HPZA 1V5XA 1SZNA 3MP5A 3LCWA 3G22A 1JDCA 3LGGA 3MUZ1 1T41A 3A3WA 5EBAA 5DN1A 3W84A 1XLHA 2O4QA 1ONRA 1IR1A 8TIMA 3PZ9A 2VRQA 3GYEA 3Q94A 3E5BA 3CAKA 3FAXA 3W37A 2PRLA 2X1TA 2ZVRA 3FEMA 5ECUA 1EH9A 1PHQA 1VEOA 4GD0A 4AVNA 3R11A 4GI6A 4KT2A 2WNWA 3GDLA 5D9OA 2J74A 3WF3A 1UKQA 1J0HA 1MNSA