3WUEA

The wild type crystal structure of b-1,4-xylanase (xynas9) with xylobiose from streptomyces sp. 9
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
312
structure length
312
Chain Sequence
b'TATLGELAEAKGRYFGSATDNPELPDTQYTQILGSEFSQITVGNTMKWQYTEPSRGRFDYTAAEEIVDLAESNGQSVRGHTLVWHNQLPSWVDDVPAGELLGVMRDHITHEVDHFKGRLIHWDVVNEAFEEDGSRRQSVFQQKIGDSYIAEAFKAARAADPDVKLYYNDYNIEGIGPKSDAVYEMVKSFKAQGIPIDGVGMQAHLIAGQVPASLQENIRRFADLGVDVALTELDIRMTLPRTAAKDAQQATDYGAVVEACLVVSRCVGITVWDYTDKYSWVPSVFPGQGAALPWDEDFAKKPAYHAIAAALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase A
publication title Structural perspectives of an engineered beta-1,4-xylanase with enhanced thermostability.
pubmed doi rcsb
source organism Streptomyces sp.
molecule tags Hydrolase
total genus 126
structure length 312
sequence length 312
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3wueA00
4C7DA 2EEXA 2DSVA 2QLYA 3LPPA 4M8UA 1UUQA 1GQIA 1JZ3A 4P7QA 3W37A 3VIHA 3KWXA 1PIGA 3NDZA 1H0GA 4HMDA 2BV9A 2QPSA 1ISVA 3SCSA 4AXNA 2VUYA 1N82A 1M03A 1W9DM 2YDRA 1LWHA 1ODUA 2VURA 1FH8A 3WD3A 4EE9A 4P8WA 3RM8A 1BFNA 4Z2GA 3CZEA 3POHA 4Z2KA 3T2QA 2Y24A 4MAZA 2WKGA 1XH0A 3OGVA 3ZQ9A 1I1WA 4RL3A 1E56A 2UY5A 1CGTA 5FIPA 4FLQA 1RP9A 4PTVA 2WBKA 2ZX6A 3WMBA 2XYLA 1HN1A 4B9ZA 2CYGA 5BWFA 4U3AA 3N15A 5D9OA 4D6JA 3MANA 1ITXA 4AYSA 1UKQA 4OIFA 1FA2A 2JF6A 4AD5A 5FL0A 1F4HA 3CHFA 1HJQA 3TTYA 1UKPA 1BYDA 2DIJA 4TTUA 3RMEA 1IZKA 2YA1A 2VI0A 1NP2A 5AC5A 1DTUA 2CBUA 2Z1KA 3WNMA 4TUFA 1B3ZA 1TMQA 3GBEA 3AYRA 4NF7A 2YA2A 3AMDA 1TG7A 3PZOA 2ZXBA 3ZJ8A 2WCGA 1VIWA 2FGLA 5DMYA 3MKKA 3VGBA 2FHBA 2YDQA 1BVZA 2XVGA 1ZS2A 1E0VA 3RJYA 1TZ7A 4XB3A 1MQQA 1GOQA 5GPRA 4AZCA 2VVSA 3AIUA 2W66A 2XWEA 3G6MA 3FW6A 2J7FA 1XSKA 3BSGA 4U2ZA 4W7UA 4HA4A 1OT2A 1OD0A 5CPQA 2ZUVA 2IUZA 5E6YA 2TAAA 1IZJA 1CPUA 1EIBA 1K9DA 4AD0A 4RE3A 2CESA 5I78A 1W9PA 2ZUWA 2VZTA 4AC1X 1ZBCA 2A3CA 3WUFA 5A2BA 5IDIA 2CEQA 3WF3A 2YL6A 1EHNA 1HJSA 4JKMA 7TAAA 4LX4A 3NYDA 3DYOA 3ZSTA 3AS3A 4OOUA 4PSPA 4AZHA 3QGVA 1A47A 5IFTA 2G3NA 1OD8A 4M24A 4CN4A 4XX6A 1CZ1A 3TP4A 5BYWA 2W67A 2O9TA 2BVYA 1JXKA 3SUTA 2V38A 3VDBA 1WZLA 1B31A 2XTKA 3IJ7A 2MANA 1E4LA 2WMFA 1VJZA 1UD3A 3VMOA 2VRKA 1H11A 1R7AA 1O6IA 1CGXA 4YHEA 1CIUA 5AY7A 3WDRA 3WEOA 4JHZA 4HMEA 5E6ZA 3THCA 5CLWA 1GUVA 3FHAA 2XVNA 1B3YA 1K9FA 1FFRA 1NP0A 5KEZA 3AHZA 3WNPA 4HU0A 1FHDA 3WBEA 3CZKA 3RPMA 3L4UA 3CUGA 2EPLX 3UR8A 4M82A 1NWTA 1CWYA 4UQDA 4W86A 1WZKA 1W2PA 2DT2A 3S2CA 3WQ4A 1PJ9A 2WKLA 1W32A 3A4XA 4HZ7A 3WUBA 3AROA 3MV01 4AZBA 4WSJA 5HPCA 1CGUA 2WZIA 3AIQA 1VRXA 3K4DA 1JAEA 3SUVA 4UOQA 5JBEA 4D6IA 4B9YA 1UKSA 3OB8A 4HOXA 5A8PA 4JCLA 3K8LA 4XZWA 2YL8A 3VIPA 2WLZA 4W8LA 3OIHA 1BGAA 2X09A 3T2PA 1J10A 1HL8A 3VGDA 4CVWA 1BHGA 3MMUA 1W3KA 1KQYA 3PZNA 1G0CA 4ATWA 4ZXLA 4E2OA 2XFYA 1X6NA 4F9DA 1QI0A 1V03A 2GUYA 2GK1B 1B3VA 1QBBA 1GVIA 1LL7A 1ISYA 5BXTA 3VGGA 4N42A 2WMJA 1SMAA 3UERA 3W81A 4QLLA 2WMIA 1UOKA 4XZBA 4K68A 2DPEA 3EBVA 1WNOA 1OBAA 2BVTA 3PBGA 2VZSA 2PC8A 5ABFB 1OWQA 3VIIA 3T0AA 3W4RA 1B0IA 5CZKA 1YQ2A 1J0ZA 4PTXA 3NUKA 3CH9A 3WDHA 4X9YA 1E6PA 2WMHA 1W9UA 2XFFA 1JNEA 1W9VA 3QHOA 4TOQA 5LA2A 1VFOA 1HXJA 1E5JA 1UD8A 3KZSA 1UR1A 5BXPA 4UFLA 3SCOA 4CN1A 3W25A 1QI5A 2FHCA 3BXWA 1H0IA 2YIHA 1PPIA 5D8WA 2FDMA 1C7SA 4UOJA 4MTVA 3VO0A 3WL0A 3PZIA 3TTOA 3GYCA 3ARPA 4H8VA 4F8XA 4FMVA 5JIPA 1CTNA 4PRWA 3MMWA 4UTFA 3ZJ7A 2OSYA 1X1NA 3SCQA 2Y4SA 3W6MA 3W24A 3WENA 3WDQA 2VNCA 3GH5A 4CU6A 2B31A 2WHJA 4UQCA 4AMCA 1WO2A 4QLKA 3ZIZA 1H1NA 1VFUA 2J62A 3VD9A 3RDKA 2CXGA 1OGBA 1VFFA 3PHAA 3BAKA 1VB9A 2CKRA 4W5UA 1V0MA 3ZOAA 3WF2A 1C8QA 2YOCA 1DWIM 1JD7A 3VDCA 2JFEX 3WQ8A 3WY1A 4V28A 1WKYA 2OWXA 1JZ5A 1TR1A 4CGTA 3VKKA 4H8UA 2VT0A 1V6WA 1MXGA 1QW9A 5E0CA 3QOKA 2CIPA 1NOWA 4RE4A 1J01A 3RJXA 2AAAA 3FXYA 3OBAA 1HVXA 2GSJA 2IXVA 1GOKA 4TXEA 1KWGA 4W5ZA 1OIMA 1QNOA 3B9EA 1UKOA 1JYWA 3VDAA 4UQBA 1KFWA 3T0BA 4NRSA 3F4VA 4MB3A 5HOSA 4D6HA 1GCYA 5A2AA 1H3GA 5I3DA 1MQPA 2D3NA 2WC4A 4A4AA 3CHDA 2Z1SA 2X0HA 3WH9A 4MB4A 1V08A 4W85A 3W82A 3BAXA 1BF2A 1F4AA 1JG9A 3RM4A 2PWEA 2J25A 1LG1A 3CPUA 3UETA 3MU7A 4JFWA 1BPLB 4ZE5A 1K9EA 4YN5A 4GI8A 2EPNA 5ECUA 1QHOA 4UR9A 5FOOA 5E9AA 5A8MA 4CU8A 3O2LA 2X05A 2VTFA 4AD1A 4FLRA 2D0HA 2O9PA 4PMOA 5HDRA 2D3LA 4PCTA 1J18A 3CUHA 1OCQA 4U5IA 1XYZA 4WKAA 3ARYA 2WB5A 4UFMA 1CXIA 1WPCA 2WW5A 4OBSA 5GNYA 2W61A 3W38A 1V3MA 4B15A 1PX4A 4WIWA 3CIVA 2V5CA 2UY4A 4B3KA 2J77A 4U2YA 4V27A 3BLPX 4J3TA 5I5RA 2J8GA 1KR1A 3MUIA 3M07A 3WNOA 9CGTA 2A3HA 3ARUA 4H41A 2W4XA 2WWDA 4P8UA 5CPTA 1MVYA 4NZCA 3CBWA 4AD4A 5BXRA 3CZLA 4MNKA 3FAXA 3AZSA 1EHAA 4FK9A 2BY3A 1M53A 1UHVA 4QCFA 3BGAA 2OSXA 1E4NA 1S46A 4AZ5A 3O6AA 4EAMA 4GINA 4Z2LA 2O9OA 1NWRA 2VX6A 4TVDA 4TVUA 4ZENA 4CKQA 1EGZA 2J75A 2J47A 4QP0A 4M56A 4UOZA 5A6SA 2CHNA 4W87A 1BVNP 3HJEA 1SMDA 3CMJA 2CCRA 4S3KA 5IHSA 4A3YA 1XH1A 4MJ4A 2ZXAA 1IT0A 2PBGA 2G41A 1WZAA 2VCAA 4BQ4A 1VFMA 3WD2A 2G3JA 4LYPA 1NH6A 1UKTA 3UG3A 1QOXA 4CU7A 4AZGA 3L4WA 2VRJA 1W3HA 2FH8A 3VGEA 3AQUA 1GHSA 3F5KA 3EDKA 2ZUMA 1US3A 3L4XA 4C7GA 5BROA 4UQAA 5A3HA 1V02A 2WYSA 3EMCA 3MS8A 2QMJA 1JDCA 3WMSA 3NCOA 4AEFA 2EPMX 5A2CA 2X1IA 4EK7A 1VBUA 4IISA 2F8QA 2XVLA 1ISZA 1MQRA 1E43A 5GNZA 1E0WA 1BQCA 4PMDA 5I77A 1CDGA 2VQUA 1MW3A 3KE0A 4KRTA 4BF7A 1G94A 4MB5A 5ABEA 3I3BA 1KQZA 2EBNA 3SUUA 3WF0A 1PAMA 1MYRA 4XV0A 2W5FA 3CZJA 1C93A 2YKKA 3WKZA 1GQLA 2YJQA 1VENA 2GJPA 3A6OA 1UWIA 1E0XA 1CGWA 1WDQA 5A6KA 2NT1A 3SEPA 2VX5A 1JF5A 5GQBA 4WF7A 3AIBA 4AD2A 3PTMA 3AIVA 4TX8A 1W2VA 1ZJBA 2J74A 4JAWA 2ZXDA 5ABGA 4HU8A 4H7VA 2ZUTA 3OZOA 3CTTA 3PTKA 1AQ0A 4KMQA 2J8FA 3SUSA 1XCWA 3W0KA 4MPKA 4W8BA 4HA3A 5F7UA 2V5DA 3SCTA 1W3JA 2DIEA 1PEZA 4MB1A 4MJ2A 3AJ7A 3LMYA 5JBFA 2ZWYA 1TCMA 2X2YA 3QHNA 2XGIA 2J7GA 5HBFA 3WNNA 4WKHA 1I1XA 4KWUA 2YBUA 1AQMA 3ZSSA 3EDEA 2ZX7A 3EMZA 1QBAA 1GOOA 1BLIA 4CN6A 4GXPA 2EJ1A 4TTGA 2ZUUA 5EBAA 5A6AA 3AHYA 4JHOA 2BS9A 3VM7A 5FL1A 1M04A 3SURA 3BMWA 4CUCA 1MW1A 1UZ1A 3ARXA 3ZJ6A 1V6UA 4U33A 3AHVA 3CUIA 1G01A 4QDMA 2ZX9A 2VRQA 4L4OA 4OUEA 4IPLA 1Y7VA 4YPJA 4CD5A 1J9YA 3AXXA 1UG6A 1ISWA 2WCAA 3ZO9A 3PZMA 4GZJA 1OIFA 4BS0A 4UCFA 3UG5A 3TOPA 5EFFA 2OWCA 1V3JA 4N0RA 4LQ1A 4JL1A 1XCXA 2DSKA 5AC4A 2VZUA 3UESA 2XFRA 2XJ7A 2EPOA 4ACZB 3FAWA 1GNXA 1JZ7A 3AFBA 4U31A 1J11A 2PWDA 4BCEA 3IANA 4OBRA 1QW8A 3FY1A 1ZL1A 2CITA 1DP0A 1SR0A 5D9PA 5A8QA 1MW2A 3AZTA 1LL6A 4ML4A 3GNOA 2E0PA 3D3AA 4IPNB 3WF4A 4GI6A 2GFTA 2WZEA 1HJXA 5A8OA 1EQPA 4WSKA 4DM1A 2XIIA 1C90A 1E71M 2WM0A 3WEZA 4PEEA 2HISA 3AYSA 4WJXA 1UH2A 3CHCA 3SUWA 3GXFA 3VMPA 1HJWA 1HX0A 1SYTA 4B3LA 4BQ5A 1BAGA 1GZJA 2J79A 3QHMA 4HP5A 3WUEA 1JI1A 1J0KA 1XH2A 2ZUNA 2WMIB 1V3KA 3BLKA 1GQJA 1FFQA 3E1F1 1FHLA 4HZ6A 1V6VA 3CZGA 2DH2A 1E4IA 3UR7A 1UWRA 1TUXA 2OYMA 1CXHA 2VX4A 5HPOA 5CQ1A 3VTRA 3I3EA 5A6LA 1XSJA 1KGXA 3GNRA 2D20A 3WD1A 1MXDA 2CPUA 3SCPA 2D2OA 1VJSA 1WE5A 3CGTA 3WN6A 2WVTA 3AISA 1UWUA 2JEPA 1UR8A 3RCNA 1GJUA 4URIA 4J3SA 1AMYA 3GXDA 3DHPA 3CHEA 4BZYA 3L4VA 1V6YA 3SCUA 1NOFA 3FN9A 2E4TA 4IUGA 3MSDA 2VQTA 4DUVA 1PBGA 1C8XA 4JFUA 1CXKA 3L2MA 2J7HA 1GQKA 4M1RA 3RM9A 4MDPA 3WH7A 3ZT6A 2ZXQA 1HP5A 2JE8A 2PBOA 3LPGA 1V3IA 3OG2A 1E15A 4AY1A 2DH3A 5A95A 4Y7EA 8CGTA 1IV8A 1GPFA 3W29A 2Y2WA 7A3HA 1B9ZA 3WDJA 1WDRA 3VIKA 2VOTA 3APGA 1LLOA 1LWJA 1Q6EA 1EQCA 3IJ9A 3WH5A 5IHRA 4PTMA 4JZ5A 1B90A 4QAWA 1HIZA 3VD5A 4P7NA 4GI9A 4PUDA 4TX6A 1E70M 1QVBA 2VZVA 3AI0A 3VX0A 2DDXA 3CZ8A 2D24A 3WMCA 2J4GA 1KB3A 1JDDA 2CHOA 1MW0A 2YA0A 4GPNA 5A94A 1RPKA 3W27A 3VU2A 2OLHA 1KCLA 5FKYA 2WMKA 3WH8A 5I6SA 2WVVB 1KBBA 2WXDM 2XWDA 1ITCA 1EDGA 3NSMA 4PMUA 1K6AA 2GDUA 2YL9A 3BCDA 3GDBA 5ABHA 4J28A 4PTWA 4A3HA 2WC7A 4Z2HA 1W9BM 2XM1A 3TTQA 4MAVA 1W91A 1E6ZA 2WSPA 2PB1A 3IAPA 1L0PA 1I75A 4JL2A 3HMCA 1Q6GA 1LJYA 1RH9A 5DO8A 2BHUA 3B9AA 1JFXA 4OOZA 4DWSA 2VJXA 3HN3A 3ZR5A 1GOMA 3ECQA 4D6CA 1U33A 1AQHA 3VNZA 1BGGA 3ZM8A 2J7CA 1UD4A 2ESCA 1U2YA 4X0VA 2CETA 1CBGA 1FH9A 1EOMA 2DQXA 4PMVA 1QNSA 4Z2JA 1ECEA 1OGSA 4ZE4A 5A6BA 3MV11 3ALFA 2WZHA 6CGTA 4F66A 4AW7A 3PZ9A 3B9DA 5I0DA 2JF7A 3T2OA 4WKFA 1WP6A 1EA9C 4AZIA 2WLYA 3WDIA 4PMYA 1KGUA 1JZ8A 2WWCA 3N04A 2HVMA 3SIMA 4W88A 1GORA 1V02E 1KXTA 1H49A 1QI4A 1HJUA 3AHTA 1PZ3A 5EFDA 1KR0A 1JIBA 1J0IA 5CG0A 5D8ZA 3HU7A 2XIBA 1HP4A 3TA9A 1ZBWA 2D23A 3BAWA 5JBDA 1C91A 1SFSA 4PMQA 4KGJA 1B2YA 4IM4A 1C7TA 2G4FA 3KL5A 4PMZA 2YLAA 4TVCA 2JIEA 1U30A 5CGMA 1E6QM 1DWAM 2WCSA 1V3HA 2J7BA 4LGXA 2OYLA 2WK2A 4U3CA 3VPLA 1J0HA 2E40A 2XM2A 3MUZ1 3IAQA 2ZOXA 3AMKA 3AIEA 2RGMA 1TA3A 1FP9A 1QHZA 4GQQA 3KL0A 4PUEA 1J0JA 2DSZA 1D7FA 2GVYA 1JZ4A 1NWSA 3AS1A 1HNYA 2XVPA 4EANA 3VVGA 5CSUA 3ARZA 3AS2A 3VX1A 4D71A 2J7DA 5CGTA 1UH4A 4B16A 3VDHA 3WDPP 1E1FA 1UWQA 2GJXA 2ZICA 3ZR6A 1GVYA 1PX3A 1JD9A 1ESWA 1DWFM 2W63A 3ZT7A 2YDSA 1XRVA 2WSKA 2D0FA 3CUJA 4DWSC 1E5NA 1KBKA 4ATDA 1JNDA 1TVNA 1UD6A 4E4PA 1QPKA 1XHGA 3J7HA 5JIWA 1E4MM 4W7VA 3S6TA 6A3HA 4J3VA 2WNWA 4HTYA 2WHLA 3A4AA 4CCCA 2RGLA 1DEDA 4JCMA 3K8KA 5A6JA 1CXLA 4AWEA 4GKLA 1KXQA 3OGRA 2OYKA 2NSXA 1K9TA 2XVKA 4AIEA 4M80A 1QNRA 2DT1A 3DYMA 1CLVA 3AICA 1HKJA 4QFUA 1J12A 2XUCA 4CD7A 2A3EA 1JYXA 3K1DA 3U7BA 1KXHA 1VEPA 3A4WA 1V0LA 2XSBA 3FHQA 3PZVA 3WNLA 2ZWZA 4QLJA 1C3FA 3AIWA 4CCEA 3MMDA 4PMNA 3F5JA 3N12A 1G5AA 1XSIA 4AEEA 1UR9A 3WUGA 3L4TA 3BCFA 1JAKA 3AZRA 1CEOA 1HF6A 3ARWA 5I2UA 3POCA 4HPHA 3SCNA 4QCEA 4ZFMA 2JEQA 2O9RA 1E6SM 4W89A 2QMKA 4AZCB 3K46A 1JYNA 5EB8A 2WAGA 3U7VA 3WQVA 2EO7A 1DWGM 4OJYA 1JZ2A 4UQ9A 4MDOA 3BH4A 3NSXA 1US2A 2XSAA 3TTSA 5CPSA 2DEPA 4FLSA 5M5DA 2V3DA 5BXSA 3GH7A 1JGIA 2YLLA 1JDAA 1HT6A 3LPFA 1B3WA 1XV8A 1R8LA 1OGGA 4KGLA 3WIJA 3F5LA 5AYBA 1YHTA 3K8MA 3MO4A 3W53A 2DT3A 2CBJA 5C71A 4L4PA 2EQDA 1UH3A 5LA1A 4JKKA 2D0GA 3L4ZA 4PBGA 1QI3A 4DM2A 2E9LA 1CXFA 3EDFA 2YL5A 3GM8A 1PIFA 1WCGA 3NDYA 1VEMA 3VM5A 1H2JA 5DF0A 2D22A 1W1YA 3AXHA 4KRUA 3PZGA 2ZX8A 3O9NA 4F9JA 3QOMA 2ZUSA 2Q8XA 1E3XA 4M81A 1FOBA 2FHFA 3D5HA 1GOWA 1VAHA 2E9MA 3JUGA 4J27A 1H4PA 1FP8A 3KL3A 1NARA 4RE2A 1C8YA 2J78A 2XG9A 3II1A 4D6DA 1MFUA 1FH7A 2WHKA 1B1YA 3RO8A 4HZ8A 1B3XA 4AZ6A 2VR5A 4GZEA 5DT5A 4ZXOA 3SCWA 1QI2A 2BNJA 4JIEA 1XD0A 5A69A 2AOSA 5CJ5A 2C0HA 3N18A 1E9LA 1CYGA 2UWFA 1CLXA 5I24A 3AMGA 5GNXA 3SCRA 2CBIA 1Z32X 3WL1A 4J3XA 1OINA 3M6DA 2A3BA 1EO7A 5LYRA 4F79A 1H09A 3N9KA 3WEMA 5TD4A 2W91A 3VIFA 1CENA 3GNPA 1Q6DA 3AIRA 1Q6CA 3N17A 3T08A 1XYFA 1JXJA 2V3FA 4E8DA 5E70A 3GTNA 4P7RA 3G6LA 1OM0A 4NI3A 2BVDA 1HKIA 2F61A 3KEHA 3L2LA 1UQZA 3PN8A 1HKMA 4H8HA 1UZ4A 2C8NA 3U57A 1GJWA 3BAIA 5A6MA 1CECA 2WPGA 3ZMRA 1HVQA 1QHPA 2GDVA 4GIAA 4S3JA 5A1AA 2VX7A 1L8NA 2E9BA 3BSHA 4CD8A 3K4AA 3VILA 1G1YA 1ZJAA 1BG9A 3AMLA 5M17A 2G3IA 1TFVA 2BY2A 2XPKA 3CUFA 1BYBA 1WB0A 4PSRA 3M7SA 4AZ7A 3WELA 2QV4A 5D9NA 1GOIA 1GONA 1E73M 1EDTA 1V3LA 2YBTA 1CXEA 3MUAA 3CO4A 4ACZA 5LA0A 1E6NA 2A3AA 1H41A 1VF8A 5IFPA 3ARVA 2PWFA 2VC9A 4J7RA 2F2HA 1ZBKA 1EO5A 3WFLA 4LPCA 3ZT5A 4LXFA 4XUYA 4LYQA 1EOKA 1V6XA 4D6FA 1AVAA 4P7OA 1R85A 3DC0A 5I79A 4P7LA 1P6WA 1WAWA 2VO5A 4UZSA 1E1EA 3WD4A 3IJ8A 8A3HA 2BY1A 3WQWA 1RP8A 4PCSA 1R7OA 1O7AA 1PZ2A 3AXIA 2V3GA 1TVPA 4Q7NA 5M03A 1JL8A 4JFVA 5DT7A 1D2KA 1NOUA 3GXMA 5I23A 1BYCA 1W3LA 1QNPA 3DECA 1UYQA 2PWGA 1XC6A 2FGZA 1E6XM 2WVSA 1Q4NX 1MWOA 1WDSA 5C8BB 3OLEA 4DUXA 2BHZA 3I3DA 1W1VA 1GW1A 4YHGA 1MFVA 4DWSB 2WVUA 1NWUA 2QF8A 2NT0A 1G9HA 2DSWA 4W84A 3VIOA 1UWTA 3L4YA 4HMCA 4W7WA 1OSEA 3OZPA 1QNQA 3VINA 3IK2A 1C92A 4AIOA 5M3WA 4HPGA 3RILA 5C70A 1E55A 2BY0A 3ARTA 3VNYA 3OLDA 1ZBVA 3AS0A 2Y8KA 1KCKA 4GZIA 1LG2A 2CERA 5D9MA 4W93A 2AMGA 4D72A 3UEQA 5CXPA 2NW0A 2X8RA 4H2CA 3N13A 3ALGA 1KWKA 4MNJA 1D3CA 1WZMA 4W8AA 5D4YA 1PX8A 1W1TA 4PMXA 1EH9A 5CSYA 2GK1A 3FNDA 4WK9A 3MUY1 2BXYA 1E72M 2WHMA 3ARQA 1R86A 1EXPA 2E8ZA 2IXUA 4C7FA 1CGVA 3DYPA 4NSBA 5BRPA 1R87A 3OLIA 1LF1A 1XD1A 3N1AA 5ABFA 3W26A 3GBDA 5EMYA 2O92A 1ZB5A 4D1IA 4ZEPA 2PWHA 3WF1A 2VVNA 1RD6A 1UA3A 1JF6A 2DGAA 3DHUA 2XHYA 3OA5A 4PN2A 4BQ2A 2VZOA 3NIYA 4D6GA 1UA7A 2WBGA 3NJ3A 5E0FA 1XGZA 5FCZA 1JI2A 3PZQA 4UZUA 2DT0A 4FF5A 2FH6A 2V3EA 3VD7A 4AD3A 2W62A 3VGHA 4ACYA 3ARSA 1UD5A 2JIWA 2C7FA 1NM9A 4X0NA 4Z2IA 1OT1A 3SCVA 3PZTA 5E09A 4EKJA 1UR2A 1NQ6A 4PMRA 1DHKA 3T09A 4KH2A 2BFGA 2E3ZA 4MADA 1DWJM 2UY3A 1UD2A 1TA3B 3QR3A 3AOFA 3MSGA 4CVUA 1UWSA 3W28A 4UFJA 2WVVA 2ZIDA 3CLWA 1HJVA 3WQ6A 3WSUA 4HA1A 4JFSA 2VMFA 1M01A 2D1ZA 5IXEA 2ZE0A 1ZU8A 3U5YA 1KGWA 1UR0A 3N11A 3GZAA 2VCCA 3OGSA 4UFKA 1M7XA 4DWSD 4BA0A 4AIUA 2GJXB 3AHXA 1BTCA 2WC3A 4OZOA 5A8NA 1ISXA 4LYRA 3VD4A 1UQYA 3B8SA 1X6LA 5HXMA 2EXOA 3GXIA 1WDPA 4V2XA 1JZ6A 2CBVA 3WH6A 1V0KA 4JFTA 4P8VA 3UG4A 4R27A 4R5EA 1JYVA 1A3HA 3UCQA 1Q6FA 5A6BD 2OSWA 2ZX5A 4E8CA 3WD0A 2Y5EA 4FLOA 1DWHM 2OWWA 1H5VA 2EPKX 3LPOA 1EDQA 1B30A 3VGFA 5CLTA 3TONA 4GO9A 5FD0A 2WANA 3WNKA 4OKDA 3PZUA 1ODZA 1OB0A 4AISA 3VIJA 4DUWA 1TE1A 1KXVA 4PYSA 3BAJA 4MNLA 4NRRA 3T0DA 3NSNA 4CCDA 5DEZA 1HL9A 3GH4A 5BRQA 3M46A 4GO8A 3AMCA 5BCAA 4H04A 4JKLA 1GHRA 4UFIA 1E3ZA 1LL4A 1BSIA 3WQ5A 4J3UA 1J0YA 1VEOA 1BYAA 3OLGA 2Y8VA 4BQ3A 1VBRA 3VMNA 2QHAA 4J3WA 2GJRA 1HKKA 1CGYA 3PTQA 3VD3A 2W92A 1UR4A 4CD4A 5HNNA 1W9XA 1BG4A 2X0YA 3A3HA 3WBAA 2JALA 1E6RA 4WLCA 1LQ0A 2VCBA 4HOWA 3VIMA 4UQEA 3VIGA 3A47A 3ARRA 4D6EA 1W1PA 2G3MA 3VUPA 4GQRA 2DSUA 3EDJA 3VOCA 1V0NA 3U5UA 4CD6A 1JFHA 3W6LA 3CMGA 2VR4A 2PI6A 3EYPA 3WFZA 2QPUA 7CGTA 2G8ZA 5DFAA 5KZ6A 3EDDA 4D1JA 1E40A 5AYIA 4Q22A 4U5KA 3RIKA 6TAAA 2J7EA 3BAYA 2VL4A 4M29A 2E8YA 2CKSA 3BC9A 2CNCA 4MNMA 4HOZA 2BXZA 1CNVA 3BMVA 4P8XA 2UY2A 5JUVA 4ATLA 3THDA 2BHYA 2PF0A 4UNIA 4UFHA 3ZJKA 2WMGA 3EMQA 2XGBA
chains in the Genus database with same CATH superfamily
3FJ4A 1KV5A 2Q02A 1EGVA 4OVXA 3MVIA 4EPBC 3A22A 3W23A 4NZ1A 3QJAA 1H0GA 1RV8A 2QJIA 1PDZA 2YDRA 3B4UA 5G2IA 4OE7A 3HPSA 1J6PA 4J1OA 3OZMA 3TSBA 2VURA 1TPDA 4POCA 5EL1A 1RQHA 6XIAA 4R7OA 1BFNA 3POHA 4DI8A 2XFWA 1KRBC 1IZCA 4MAZA 4YTRA 3AO0A 1D3GA 2D2JA 3FOKA 4GVFA 1BKSA 2XYLA 4WHBA 1XIHA 3TJXA 3KRBA 2YB1A 5BWFA 2PTYA 2OX4A 4JIHA 2DUXA 4AYSA 3QW3A 3P67A 2VEIA 1FUYA 1I0DA 4H00A 3PVFA 1EJUC 3CHFA 1BYDA 4UB9A 4PTDA 1TVLA 2VDHA 2ZCGA 4LY4A 3KBJA 3WNMA 4RDZA 2C6QA 3M6YA 4WDXA 4MKNA 3AMDA 3H2AA 3HPXA 3QXBA 2OQLA 3PZOA 2FGLA 3MKKA 3WQGA 1BVZA 1PO9A 2BOEX 4CLMA 4GMEA 1XLIA 4O4VA 2X7VA 4XZ9A 4XB3A 2B7NA 1A49A 4LVGA 4TV5A 4AZCA 4ADUA 1VPXA 7TIMA 4Q4SA 4EX4A 4JTIA 1J96A 4HA4A 1OD0A 5CPQA 2IUZA 1EL3A 4R34A 5E6YA 1A3XA 1U5JA 2TAAA 4XVEA 3S5SA 1K9DA 1VQTA 4GYPC 3CIXA 4AH7A 4KCWA 1GVEA 2A3CA 4KT2A 3WUFA 3ITTA 3GIQA 3RLUA 5IDIA 1A5SA 3MUCA 3E2SA 1UR3M 1HJSA 3W83A 1Q7MA 2OGJA 3NYDA 4A8LA 3DYOA 4AZHA 3QGVA 4CN4A 3DG3A 1CZ1A 3O07A 5BYWA 2O9TA 4UTLA 3SUTA 2UZ9A 1PKLA 3WLKX 2XTKA 3HGJA 1MUWA 1E4LA 3EX2A 3VMOA 2Y5SA 4K1GA 1CGXA 1CIUA 2YCJA 1WXJA 5E6ZA 1X39A 1B3YA 1K9FA 5TF0A 1RAKA 3WNPA 1FWDC 3M43A 3CZKA 4LUTA 5EPDA 4QEEA 4JBRA 3EX3A 3UR8A 1BRLA 1CWYA 1R3VA 1NEYA 5FEZA 4Y6GA 2WKLA 3MV01 4C6MA 4WSJA 5HPCA 1CGUA 3AIQA 1UWAA 4LVAA 3SUVA 5JBEA 5JMUA 3ABRA 2PGFA 1TPC1 2H3BA 1B57A 1P0KA 1VBJA 1W5PA 4NJHA 1HL8A 3VGDA 3WX7A 5FF4A 4DBDA 5T9CE 5CAHA 4IIFA 3W6YA 5CGQA 2Q09A 3TYCA 1W3TA 4PEKA 5DMLA 3W7IA 4I6KA 1X6NA 4DNMA 1QI0A 1JCYA 2GUYA 2GK1B 4DBWA 1QBBA 4MWAD 1GVIA 2XDFA 2QGHA 2RAGA 3OU8A 2J6XA 3L9CA 3M5VA 4K39A 4UUIA 2C1HA 2DPEA 3EBVA 3UZYA 2VZSA 3UPWA 4KCTA 1OWQA 3W74A 7ODCA 3NUKA 3CH9A 3WDHA 4KWWA 1ZALA 1QT1A 4RJEA 3EGJA 4Q8QA 1RQBA 3KZSA 1XS2A 2O4QA 4AMAA 4G9PA 1BKHA 5HWJA 3VOHA 1UROA 4D8ZA 7ENLA 4UOJA 3MPGA 2PODA 1EJVC 3PZIA 4GK8A 2VGFA 2JQXA 3H2CA 4PRWA 3MMWA 4TR9A 3ZJ7A 3W73A 1DORA 3SCQA 3P93A 2Y4SA 3WDQA 5HQEA 3TQVA 4D9PA 4AMCA 2WHJA 3CUXA 3M41A 3RX2A 4QLKA 3ZIZA 3P84A 1F6KA 5ECVA 3TLLA 5U7SA 2VHLA 5J8LA 3MI2A 4FOUA 4UTHA 4QE1A 1V0MA 1LRTA 1ME9A 3GFZA 3S1GA 3ZOAA 2DZUA 1EPVA 1C8QA 4E2VA 3RGTA 2NUYA 1LOLA 1KCXA 2FPVA 4ENLA 4DBUA 3ES7A 1V6WA 1QW9A 1F6PA 1FWBC 5E0CA 3QOKA 2CIPA 3FXYA 3S6OA 1XBZA 3MT1A 5FJTA 3A3XA 3SFKA 1K03A 1LLZA 5DXYA 1YX1A 3IGUA 1OIMA 3SY5A 3B9EA 3GVQA 1MDRA 1P7TA 3CH0A 4B92A 1KFWA 4MB3A 4D6HA 5A2AA 2A7RA 3Q65A 3FCPA 1IWBA 2WC4A 1D3HA 1TMHA 4PGLA 1E0TA 2Z1SA 2NV1A 2X0HA 1KW1A 1P0BA 3UGRA 1M7OA 2E5DA 2I1OA 3IV8A 3UWVA 3T0CA 1F4AA 3WLPA 2J25A 1R2RA 4OU1A 1OK6A 5GJPA 4ZE5A 2OO6A 1FCUA 2EPNA 4GI8A 2XIOA 5HULA 3ZVHB 4UR9A 5FOOA 2RFGA 4RZBA 2W6RA 3S1UA 3D0CA 3N2OA 5T91A 1RQEA 4IX0A 4ZL1A 2D0HA 4PMOA 2D3LA 1J18A 3CUHA 2Y6ZA 1CXIA 1WPCA 3M47A 4CNNA 1R5YA 1AL8A 1POKA 3LBMA 4BJHA 2V5CA 2J77A 2KAUC 3B0YA 3GTIA 1OX4B 1K3UA 4JTEA 2J8GA 1KR1A 3M07A 3WNOA 3N4AA 5CPTA 2REQB 2I56A 4NZCA 3KBVA 2TPSA 4NKCA 3FXGA 2QT3A 3PUGA 3KCLA 4XZLX 3HB9A 1E1CA 4TVDA 4ZENA 4Y90A 4CKQA 3N6HA 2J75A 3WBYA 4QP0A 4M56A 4UOZA 5A6SA 2CHNA 1YBQA 4JQ3A 4W87A 2P53A 1SMDA 3TNBA 4C6IA 3M64A 2XIJA 2CCRA 3N14A 1DXIA 4S3KA 5IHSA 3HFYA 5CSSA 1XH1A 2BGQA 4MJ4A 1VYPX 4LF1A 3MHGA 4C6BA 3WD2A 2G3JA 5H2ZA 3WK1A 4LYPA 1WKFA 3UG3A 3LNPA 4WRHA 3V0TA 1O95A 2V6AA 4QNEA 1F3WA 3WMLA 2FH8A 3VGEA 3AQUA 1GHSA 3F5KA 4F0SA 1SJDA 3EDKA 1WX0A 1US3A 4Y8FA 1V6TA 1IXNA 5BROA 5A3HA 1V02A 1BXNA 4M6UA 3NCOA 3U4FA 3EX1A 1WOBA 4Z42C 1OJXA 4A21A 2NX9A 2GOKA 4JN7A 3L23A 4YVXA 1K8ZA 2XVLA 1E0WA 5I77A 2AL2A 1CDGA 2VQUA 3KE0A 4C1NB 4BF7A 1AJZA 4FHAA 3F4WA 2EBNA 4Q4PA 4DO4A 3WF0A 5M2FX 2Y70A 2YKKA 3WKZA 3CAWA 2GJPA 1KBIA 3A6OA 1ECQA 5BMWA 1TUFA 3LNMA 1E0XA 1VPYA 3V5CA 1SO3A 1CGWA 3PANA 4G1NA 3G1XA 4I5RA 1KFKA 3B4YA 3AIBA 4AVFA 4PC8A 3PTMA 1EFZA 2X1TA 2FZ8A 2WNQA 3DHDA 1SJCA 3HURA 2PDGA 2J74A 4JAWA 2ZXDA 2A21A 2VEFA 2AKMA 3M0XA 3UXKA 3OZOA 3QY6A 3PTKA 3B8VA 1S5WA 4CNSA 4YCOA 5CC6A 4JQ2A 3N73A 5LNUA 1LWIA 3DDMA 1W3JA 1PEZA 4HD5A 2DVUA 4MJ2A 4L1WA 3LMYA 1M7PA 2VOMA 4OUIA 4FIQA 4JDBA 3CL8A 1J5TA 3TYUA 1FDYA 4K1WA 3RCMA 1ZJIA 3ZSSA 3EDEA 2ZX7A 1QBAA 2Y1HA 4TTGA 2BS9A 5EMKA 4OHQA 3BMWA 3E0LA 4CUCA 4ML9A 1MW1A 1UZ1A 4GX8A 1V6UA 4GFIA 1R6WA 1O5QA 3WBWA 4L4OA 1AG1O 6XIMA 3KLKA 2ISWA 1J9YA 1ZJHA 3ES8A 5BOFA 3C3NA 2G3FA 4UCFA 3N3TA 3H23A 3W75A 3I65A 1PCKA 4H6RA 4N0RA 4S39A 1W6TA 2DSKA 5AC4A 1F7BA 2XFRA 4HNLA 2XJ7A 5FEXA 2EPOA 1GG1A 5LSMA 3FAWA 4Z17A 1GNXA 3GC4A 1V93A 4ZB5A 2GDQA 1J11A 1LOSA 4QX4A 3IANA 1QW8A 2IKGA 4H6KA 3TZNA 3CV6A 2AMXA 1GTEA 1MW2A 1WBHA 4ML4A 3TX9A 2WSRA 4Q8VA 1PWMA 3D3AA 1QW7A 1GG0A 1MNZA 3NL3A 4HIBA 4MYXA 2GFTA 2Z1WA 5A8OA 1EQPA 4WSKA 4NXSA 4DAFA 2XIIA 2WM0A 5FEWA 3WEZA 4ZQOA 3AYSA 4Q8OA 5M1TA 1H7PA 3SGGA 4HVXA 3MTWA 3VMPA 4QRNA 3K5XA 1HX0A 1TV7A 1THFD 1XINA 3JR2A 4O8RA 1C9DA 3E3HA 1YXCA 4IMCA 3W1RA 3Q4DA 3PFMA 3TH6A 5LIXX 2WMIB 3H54A 2C19A 3E1F1 4FEZA 1JULA 3UR7A 4OV4A 3EPMA 4JTAA 3A23A 3S6DA 4L9XA 4UTIA 5A6LA 1TE6A 3GNRA 3VKAA 1LQAA 1IXPA 5KETA 4DF0A 4A2SA 4QJ3B 4DX3A 2D2OA 4XKMA 1VJSA 3VXGA 3WN6A 4A6GA 2WVTA 2JEPA 1UR8A 2CLPA 3WLJA 1GJUA 4E8GA 3UXAA 5MF5A 1KRCC 1ZPTA 3SJNA 2CLFA 4Y96A 1WDDA 4I6VA 2B4GA 3LG3A 1NOFA 4QXIA 5C2GA 3PSWA 3FN9A 2Z6JA 2E1WA 3S8HA 4IUGA 2HQAA 2QUNA 3Q45A 4D8AA 1GJPA 8TIMA 2NWRA 1CXKA 3JVAA 1GQKA 3ZT6A 2ZXQA 4KEUA 4ZVJA 1XIGA 2YXGA 2Z27A 1V3IA 5LNWA 1U1JA 3BTNA 4N4QA 3BCJA 4AYGA 4GISA 3W29A 2Y2WA 1WDRA 3TU9A 2QAPA 1YXDA 5K9XA 2DZPA 3PR2A 1Q6EA 4NI8A 3IJ9A 3LCFA 3AYTA 1OABA 2ISDA 1B90A 2Z1VA 2ZRZA 1SFJA 4GI9A 2E5CA 5K9CA 4TX6A 1E70M 2VZVA 3U8GA 3CZ8A 1UP2A 2D24A 1DJWA 1N7KA 3O15A 4GCXA 3W22A 2CHOA 2YA0A 4C1LA 4IGHA 3P82A 3VC5A 1B4KA 3NAVA 2WMKA 4LVBA 1KBBA 3OQ8A 2XWDA 1PS9A 3ATYA 2OELA 4REQA 1ITCA 4QAIA 4PMUA 3BPWA 2YL9A 3BCDA 3RITA 4A3HA 4CNPA 2WC7A 2XM1A 1W91A 3B8UA 1E6ZA 2IKHA 1EJWC 4WY0A 3ITYA 1GGOA 1LJYA 2I7GA 3B9AA 3WQEA 1JFXA 1YLVA 4ZODA 1RCXB 1TJ2A 4UIOA 1SZRA 1TRIA 3BUVA 4NNAA 1ZZMA 3IUIA 1CX9A 1GOMA 4IPIA 4MF4A 4D6CA 3QC0A 1X7IA 2GLKA 3QZAA 1BGGA 1UD4A 2J88A 1U2YA 1LBFA 5G1TA 1QNSA 1J93A 1ECEA 1OC7A 4EF8A 4YCPA 3RMJA 3GG1A 3MV11 2WZHA 4LF2A 1T6MA 2L5HA 1DYSA 3PZ9A 5I0DA 3S2LA 1PXGA 3UXLA 4WKFA 2J13A 3GHUA 3P14A 4UTKA 2OVLA 3CYVA 4PMYA 1KGUA 3H2OA 2B81A 3BMXA 4M51A 1DXFA 2QCEA 2HXTA 3QW4B 4H7CA 4ERIA 3KTXA 3FK4A 3SQMA 4LUSA 3MJYA 1HJUA 4A8RA 2NSOA 2QCFA 2E1DA 1FWCC 5G2WA 1OG0A 5FI8A 5CG0A 3HU7A 2XIBA 2DZXA 1HP4A 1FWFC 1ZBWA 4C60A 3IIPA 5JBDA 3OEXA 4QJ5B 4NJJA 4HHHA 1G4SA 4ZMGA 1GK8A 2E67A 2C14A 3ANYA 4PMQA 1F3TA 1SZEA 1B2YA 4IM4A 5LIKX 3AYVA 2G4FA 4LANA 1XYCA 1U30A 5CGMA 4WJ8A 4NHVA 1GEQA 2V5LA 1QFEA 4J4KA 3KP1A 4QGCA 1F3XA 3G0SA 2DJLA 2G4JA 3IAQA 1G6CA 5AHNA 1EJTC 3M0IA 1TWDA 2CWNA 3NQDA 1KA9F 1DHPA 4DZ5A 5AC8A 3AU2A 4GGHA 3O16A 3ARZA 3VX1A 5G4WA 4B16A 3VDHA 3GE7A 1E1FA 2PP1A 3ZR6A 1ESWA 1S2WA 3BLIA 5C55A 4A05A 2W63A 2YDSA 1YEYA 2WSKA 1W1B1 3ABOA 4JY8A 2PDYA 3UVIA 2VEKA 1QPKA 3ZVHA 2YYUA 1E4MM 4KETA 5EYWA 1RBAA 4PRRA 4HTYA 3A4AA 1FRBA 2RGLA 1ADSA 1XI3A 4AWEA 3B06A 1ENUA 1R3SA 1Q66A 4NX0A 5C9XA 1XG4A 4BEUA 1R9YA 4EXAA 3ATZA 4AIEA 2DT1A 3T55A 3NQMA 1UJQA 3CJPA 4HT3A 3S9ZA 1XKJA 3GDLA 3W7HA 1VEPA 5C7VA 3LOTA 2G95A 4UR8A 4PB4A 1GWJA 4QLJA 4PUMA 4JICA 2QQ6A 3F4NA 3HQNA 4HK6A 3RYSA 1T8XA 3CB8A 4XWUA 3VKDA 4Q4OA 3O3RA 1SUXA 3EA3A 3GVRA 3SZ8A 3IIZA 1QJWA 3POCA 4ZFMA 1ME7A 4O0ZA 1E6SM 4W89A 3N6QA 1K7XA 2O4MA 1VCFA 4HYVA 3Q2DA 3PJUA 1JYNA 4H7ZA 1HW6A 4PMJA 3U7VA 2R24A 5FJUA 5TQLA 2EO7A 3CT2A 4DUOA 5AYXA 1JZ2A 3E5BA 1SSGA 3BH4A 4BI7A 4ZR8A 3DFNA 3DI0A 1BWLA 2NLIA 1I2QA 3LZ5A 4FXSA 3TAKA 2P1FA 1XF0A 3GH7A 2YLLA 2ZADA 1JDAA 3VAVA 3RHGA 3LPFA 3WQPA 1LM1A 4KGLA 4I9AA 3UZXA 1BSLA 5AYBA 3K8MA 1BXBA 4LAKA 4ZZ9A 3KRZA 3NQAA 3NM1A 1XPYA 1GZGA 2ATSA 1X6UA 1KRMA 4F0KA 1GPWA 4GACA 2D0GA 5LIUX 3B05A 4XO6A 3KTSA 4DM2A 2E9LA 3EXTA 1XYLA 1TRDA 2YL5A 5I7GA 3NDYA 1R9ZA 4LVFA 3GLCA 5CH9A 4F9JA 1AH3A 1KO0A 3MWAA 3TCEA 3ZWTA 4A3UA 2FHFA 3V5OA 2PRLA 1GOWA 1VAHA 3ANUA 5FEPA 4J27A 1H4PA 2QCGA 1OFPA 1GVFA 2PP3A 1XYAA 4F3HA 3WK3A 3II1A 4LT9A 2ISVA 1GVOA 2TYSA 1FH7A 3PUOA 3QSTA 3RK8A 2VR5A 5DT5A 3FSUA 5EKYA 2UV8G 1TMLA 5DY2A 5DMMA 7REQB 4JIEA 4NG3A 3T0TA 2PZNA 4MGGA 2C0HA 3N18A 1E9LA 3A5FA 1Y8BA 3JZUA 3W2LA 4AHOA 3EA1A 5I02A 5GNXA 4GJIA 2QCDA 2CBIA 1ME8A 3M6DA 2XGZA 1J2BA 5DCEA 4F79A 3N9KA 5TD4A 3W1PA 1ONRA 2W91A 3VIFA 2Y5JA 1Q6DA 3CV1A 4KEMA 4O15A 1JXJA 4E8DA 3L5LA 2A6LA 5E70A 3CHVA 1OM0A 4NI3A 5DMNA 2BVDA 1HKIA 3GU2A 3V0SA 4ZQPA 3ZVIA 2FQIA 4IMEA 3CASA 3GC5A 2QUMA 2W9MA 4PUJA 1J6OA 2AQWA 3ZMRA 1HVQA 3LM3A 4GIAA 1P5BA 3PJWA 1L8NA 4H9TA 1RLCL 2QS8A 2E9BA 1G1YA 1ZJAA 4UMBA 4B5VA 3LTYA 2G3IA 4MZYA 4LALA 1TFVA 3CUFA 1WB0A 3ITLA 2D2HA 4AZ7A 5BMXA 2XN0A 3R94A 3GWQA 4HCHA 4GUIA 4QM1A 3QPZA 1E73M 1EDTA 1AMKA 1V3LA 1CXEA 2GL5A 3SECA 4C6DA 1GVSA 3U6WA 4MUPA 2H8ZA 4AF0A 1VF8A 3ARVA 4JQ1A 1FCBA 4R9XA 1ZBKA 1SZNA 1NELA 4LPCA 2PCEA 1XGEA 4KEVA 2QUUA 1AVAA 5C9RA 1R85A 3NQGA 1QTWA 4P7LA 5I79A 1P6WA 4Y9PA 2VO5A 4MLJA 8A3HA 2ZA3A 2C71A 1EX5A 1RP8A 2A5HA 1R0MA 4M6QA 4XTDA 5GVJA 3CO8A 3PJTA 3OP2A 2QUTA 4Q7NA 2CLMA 4FR1A 1K7EA 5DT7A 1XDMA 2ZZ4A 2XH7A 2FFCA 1JUBA 4CQ8A 1QU4A 4E2BA 1W3LA 2X42A 3DECA 1VBGA 2YX0A 1AA1B 1AW1A 1UYQA 4M3PA 1XC6A 4I9TA 3S1WA 4DYEA 1Q4NX 1MWOA 3M5ZA 3WLHA 3I3DA 5HAOA 2OZ3A 1XIDA 4DWSB 3HZ3A 1NWUA 2QF8A 2NT0A 2W3ZA 1DIEA 5EMJA 3SRHA 3L65A 4IFRA 1KFEA 2CC0A 4W7WA 3OZPA 1V5XA 3GDKA 4AIOA 4QE4A 4HPGA 1TELA 1PZ0A 2GQ8A 2EG8A 4QISA 3VNYA 3AS0A 4LSBA 3CM4A 2GPTA 3QGKC 4IG2B 4DBSA 4UTTA 1LG2A 2NX3A 4H83A 3DC8A 3GHRA 5CXPA 3NPXA 4Q4KA 4H2CA 3N13A 3BLLA 1JQXA 4FIRA 3TW6A 1S38A 3CPGA 4PMXA 4DQWA 3MUY1 2CXEA 2QCCA 5IM51 1I4NA 3QSRA 2WHMA 1K70A 3ARQA 1EXPA 1J4EA 1A3WA 3BLEA 4O11A 2R1KA 2VR2A 3DYPA 3RO6A 4S3EA 1R87A 4B90A 3OLIA 1XD1A 3N1AA 5EMYA 2O92A 2WZTA 2PDNA 5A5WA 3NQ7A 2VVNA 3LB0A 1E9ZB 3NZPA 4LVDA 3OJGA 3DHUA 3JW7A 3TV8A 4Z0JA 1WYIA 3GG7A 2VZOA 4D6GA 1UJPA 3AC0A 3W2UA 3GXPA 2W62A 4ACYA 1Q6LA 2C7FA 1NM9A 2KX9A 1OT1A 2ACUA 3SCVA 4EKJA 1UR2A 1NQ6A 1U83A 2BFGA 5AHIA 1V8EA 3OODA 4MADA 1XFCA 1DWJM 3WLQA 2YR1A 4PL2A 1UD2A 1IEVA 4WGHA 4JS3A 4HTBA 1HJVA 4DRSA 3W07A 2IMRA 2VMFA 1ICPA 3B8IA 3DFSA 4C6KA 2CLKA 1KGWA 3RF9A 3GZAA 3C4UA 1BTCA 3W7PA 1QPQA 1XL9A 5A8NA 1EZWA 1RA5A 2F84A 1UQYA 1YNPA 3QFWA 3KHDA 4MFEA 1DV7A 1TO3A 1X6LA 4UBPC 2OR2A 1JDFA 2VDIA 1O94A 1B5TA 1O4UA 3WJYA 3BURA 3NXLA 3PBWA 3VNDA 4NU7A 2HJPA 1Q6FA 3PNUA 5A6BD 2QCHA 4E8CA 1Q6OA 1BTMA 3WD0A 3Q37A 1GYNA 4CCZA 1EDQA 3M0MA 3KBWA 4GO9A 2WANA 5CEWA 3CT7A 2WNNA 1TV4A 4RW5A 1JPHA 2B7QA 1SJBA 3TE9A 1F6YA 4H9ZA 3NSNA 3TROA 5FJRA 5BRQA 3MSYA 4JEQA 1GHRA 3TJLA 1SVDA 4S2CA 4HN4A 1YTDA 3G0UA 3W86A 1BYAA 5C9WA 1A0DA 1TWWA 3W87A 2GJRA 3C0JA 5H1WA 4I7UA 4NASA 4CD4A 2PDXA 3HPFA 1BG4A 3PWIA 2RHGA 1UZHA 3KRSA 1E6RA 2GGIA 4WLCA 2VCBA 5HJLA 1Q6QA 3LERA 1XLAA 4D6EA 5C2XA 4HCLA 1H62A 4GQRA 4AUBA 2X40A 2NUWA 3U5UA 3DFHA 1LRNA 3W6LA 3EYPA 4KWVA 4M7TA 2G8ZA 3EOLA 3EDDA 4DEFA 3LI0A 1DKWA 4Q22A 3RIKA 2DZSA 4ES4A 2CLIA 2FTPA 4C6EA 2UY2A 3H22A 4ATLA 3THDA 3NFUA 2G96A 2X1RA 4UNIA 4UFHA 3M0KA 4ASTA 1ZGDA 4HNUA 4Y9OA 1Q45A 1S5MA 5C9UA 3LPPA 4M8UA 3M5YA 1P6BA 4J40A 3B97A 4FOJA 3FJLA 4N9EA 4QEHA 4Q7BA 1QRQA 1R3QA 1ZY9A 2QPSA 1T8QA 3C2EA 4XBKA 4IFKB 1KBJA 1ISVA 3V75A 3TN5A 4DJEA 3SCSA 1HKWA 1N82A 1M03A 1W9DM 4JTRA 4XAFA 3LCWA 3MDWA 1YW1A 3WLIA 4FXFA 4FNSA 4BWLA 4EE9A 4Q8TA 3B3DA 4P8WA 2HK0A 4Z2GA 3HF3A 3PP7A 3CZEA 2Y24A 2WKGA 3LQGA 4LFYA 4A2RA 1AD1A 4FX7A 5LGZA 4YTQA 2QPXA 2FB3A 3OGVA 1E56A 1CGTA 4PTVA 3WMBA 5IBXC 1CCWB 3V7PA 3G5EA 5DANA 4U3AA 5D9OA 5I07A 2PPGA 1R2TA 4OIFA 1DJZA 4QIUA 4PULA 3B8WA 1F4HA 5KTLA 3O6CA 2PDUA 1HJQA 2XZ7A 3TQKA 3M5XA 5BZAA 4TTUA 2VI0A 1NP2A 1I2OA 3HG2A 5AC5A 5FJJA 2Z1KA 4Z0SA 3TYAA 5CZTA 1TG7A 2ZXBA 2WCGA 3BLOA 5DMYA 4M7SA 5CPOA 1IWPA 4UCGA 4L6DA 1ZS2A 1FDZA 3GIYA 4EPKA 1X98A 4LAUA 1KFJA 2GGGA 4AAJA 3QY7A 2XWEA 4NIRA 4Y9AA 2PWUA 3FW6A 2XISA 1XSKA 2ZZ6A 4ZO6A 4MZ8A 5T26A 3KVLA 3UQNA 1XQKA 4KIEA 3CWOX 2BG5A 4LAZA 4L1XA 1T7LA 1KTNA 1IZJA 4AHPA 3M0JA 2W27A 4G56A 1TPWA 2ZUWA 3SJ3A 3GXNA 1O1HA 2INFA 1Q7ZA 4LRSA 3HGSA 2P88A 3MW7A 3IIOA 3PK7A 1M68A 3ITOA 3VNKA 3ZSTA 3AS3A 1A47A 3LMZA 1OD8A 1ICSA 3TP4A 2BVYA 1JXKA 2I9EA 3VOGA 2OB3A 3IJ7A 4DJEC 1RVKA 4XBJA 3TQ0A 3KBMA 3RAOA 4JNMA 2PMQA 4FX6M 3WDRA 3V16A 3WEOA 5AZ0A 4M1BA 5CPLA 4J5NA 1XIJA 1XUZA 4KF1A 4HMEA 2V9DA 2XVNA 3S2MA 3IS4A 1FFRA 4RLIA 3UWEA 4DZAA 1XLBA 3CUGA 2EPLX 1NWTA 1ZSXA 4UQDA 4L9YA 1WZKA 4MLRA 2DT2A 3H55A 3WQ4A 4UTUA 6REQB 2AQVA 3A4XA 3STPA 3WUBA 4AZBA 4ZO7A 1S39A 2WZIA 1VRXA 4UOQA 3E2RA 1V7AA 2SFPA 4B9YA 2R82A 1WKDA 1FY6A 2ZZ5A 3OB8A 4HOXA 5A8PA 1JGMA 4XZWA 4MPQA 4W8LA 4L9ZA 2X09A 4K7VA 3SO7A 3HG4A 4RPPA 4CVWA 3MI3A 3MMUA 4QJ4B 1KQYA 3PZNA 1VCGA 3NXFA 5F1VA 5D04C 1F74A 4ATWA 5AHMA 4F9DA 2VFDA 1B3VA 2AL1A 3G22A 1UBSA 3OIXA 4G7EA 4GYJA 2WMJA 3UERA 3RUBL 2OOGA 4QLLA 1UOKA 4AQLA 4K68A 1OBAA 3PBGA 3G1SA 1DIOA 2GQ3A 3EEGA 2PC8A 1U1HA 3VC6A 4DO6A 4US6A 1EA0A 3S5OA 4BF9A 4PTXA 3IGXA 4CQ9A 1E6PA 3T4CA 2WMHA 2IPJA 3Q67A 5AYZA 4ZOAA 1VFOA 3THQA 2JGYA 3ABQA 1SQ7A 4WEVX 1UR1A 5BXPA 4UFLA 2P5NA 3SCOA 1NDYA 1QI5A 1QUMA 3G3MA 1EF3A 1PPIA 3TYBA 2FDMA 3PF3A 3WL0A 3TTOA 2QJHA 4AVOA 4JTGA 5EMMA 2Y0FA 3MKVA 3G8RA 4H8VA 3KWSA 4GY7A 5JIPA 2Q8LA 1SPQA 3LQLA 1XBXA 4UTFA 1Z44A 1KM3A 3NQEA 4WUIA 1NFGA 1X1NA 1XLMA 2VNCA 2C15A 1L2QA 4GBUA 2DJXA 1VFUA 4YL2A 1I45A 2PDPA 3RDKA 3M0HA 1FWRA 2CXGA 1XUUA 4L64A 1VFFA 4H9UA 3EOSA 3PHAA 3BAKA 2ABBA 1VB9A 4W5UA 4FS9A 3W00A 1JUEA 4AG0A 1DWIM 3WQ8A 5HJYA 3WY1A 4PFHA 1VC4A 4EOUA 4H8UA 3PC0A 5D02A 2XIMA 3T8LA 3W88A 4YYFA 1J01A 3RJXA 2AAAA 3OBAA 4H2HA 2GSJA 3ZLHA 2IXVA 3I7RA 9XIAA 3VDAA 4G8TA 4GC4A 3T0BA 2QV5A 1GCYA 3OQEA 1TREA 2V5KA 1H3GA 1MQPA 2D3NA 2J6VA 1Z41A 5CJNA 3VNJA 4AWSA 4HNOA 3CLMA 3CHDA 3WH9A 2IPGA 2FZMA 3PULA 4JTFA 4GJ1A 3GTFA 1OX5A 4O0QA 3RM4A 2J9ZA 4GXWA 1LG1A 1OCBA 4JFWA 4DZIA 2PDMA 3P0WA 4YN5A 3EKLA 3L66A 2A79A 1JCMP 1H7XA 2H9AA 1D8CA 2Y7DA 2OKOA 2E68A 2X05A 2VTFA 3LXBA 1OCQA 4U5IA 4WSHA 5G1YA 3IRDA 1M5WA 3ARYA 1OFOA 4OBSA 1VYSX 1PX4A 3WJXA 1FCVA 4B3KA 4U2YA 3BLPX 2FMOA 5XIMA 3MUIA 9CGTA 3WYZA 3ARUA 4H41A 3T6CA 3C0QA 1RJQA 2VKZG 4KWSA 1JCNA 2BGSA 4AD4A 5BXRA 2V68A 4O53A 2HROA 3UPBA 1EHAA 1ONWA 1VP5A 2BY3A 4FK9A 1UHVA 4DB7A 5H8PA 2OSXA 5I09A 1CLKA 4AZ5A 3GY1A 3O6AA 3IGSA 2XH2A 4EAMA 4Z2LA 2O9OA 2Z2BA 2Z6IA 1AK5A 3C2OA 4KQNA 3URBA 1BVNP 5KZMA 4YJ5A 4EWND 3K13A 3VI2A 1S2UA 2ZXAA 3RCYA 1IT0A 2OKTA 2G41A 3B8DA 3HQOA 1A5LC 2ZVRA 2PDCA 1XQLA 2AKZA 1UKTA 3L0GA 4PFMA 4AZGA 1OG6A 1UZDA 1FTXA 1XIBA 4LJ3A 2QDHA 3REQB 3IUDA 2QW5A 1WBJA 2ZUMA 3L4XA 1W5OA 5FJIA 4UQAA 5DCDA 1MUCA 3C8FA 3MS8A 2QMJA 3QZ6A 3WMSA 1YNYA 3E96A 4EK7A 1VBUA 3PJXA 2F8QA 1Q6RA 1VBHA 1NU5A 3N19B 3SI9A 1EB3A 1MW3A 1WDWA 3FVMA 1TJRA 2QIWA 3KFTA 1G94A 4XZMX 5ABEA 3I3BA 3ICJA 4HYRA 4CEXC 3V5FA 1VFTA 3SUUA 4GH1A 1MYRA 3CZJA 1C93A 2YJQA 4O17A 2NXIA 4GUGA 2QCNA 4L5ZA 4PUWA 4O1EA 3S3GA 3VUSA 2YXXA 3DFYA 2OPJA 3ITXA 4KBXA 3GNDA 3QBUA 5G1MA 1QK0A 3MBFA 3QMTA 2ON3A 3F4CA 3WBXA 1XRFA 4IL2A 4J2PA 2WQDA 1TV5A 4H7VA 4L1GA 2ZUTA 4KWOA 3CTTA 1AQ0A 4KMQA 2J8FA 3SUSA 2V82A 4EACA 4W8BA 4OQVA 5F7UA 4Q6XA 1ITUA 1A5AA 2V5DA 4R9OA 3SCTA 2DIEA 2WO5A 1OEPA 2RJHA 2E77A 4JX4A 1JCXA 3AJ7A 4XAGA 3UXDA 2XN2A 5J04A 2X2YA 2R1MA 4R53A 4XIMA 3WNNA 4U28A 5CC5A 4OT7A 4CN6A 2YDAA 1LROA 3AHYA 4DO7A 4JX6A 5TNVA 1YKWA 4U33A 1I8JA 3TLQA 1G4TA 3BJFA 1W8SA 2WJDA 4KESA 4CD5A 3E6EA 3E5PA 3KOWA 1UG6A 4GVHA 3UR2A 1ISWA 4MWAB 3O06A 5HMSA 2WCAA 3ZO9A 4XD4A 1XP3A 3EX4A 3LRMA 5I03A 2YSWA 1BXCA 2OWCA 2Y85A 9XIMA 4DLMA 1RXOB 2J9XA 2VWSA 4LUTB 2GGEA 1XCXA 1XCFA 5FF0A 4R85A 2VZUA 3MP5A 3JZEA 5F2GA 4ACZB 3EWWA 4UWMA 3AFBA 4DJFA 4G6CA 3ISIX 2GZXA 3TYZA 2BP1A 1ZL1A 2GUBA 1H7RA 1DP0A 4L56A 2VC7A 3AZTA 2Y7EA 2OCZA 4BY3A 2GJNA 2I17A 4J2MA 3QTGA 3FFSA 3DFTA 4IPNB 3WF4A 3NNTA 1N55A 4GVIA 3W2JA 3G3DA 4IWWA 2BASA 1SZFA 5CC3A 4LBSA 4DM1A 4JYDA 3M0YA 2NUXA 3EPNA 1UH2A 3AJXA 3GQYA 3W7DA 4JIPA 1SYTA 1VS1A 2XINA 4B3LA 4Y2WA 1ONEA 2BOGX 4BQ5A 1GZJA 3QHMA 3WUEA 1JI1A 1J0KA 1XH2A 3BLKA 1FCQA 1FFQA 3NQ8A 4MKVA 4GOAA 3T81A 2ALDA 4X61A 3OBEA 3N2XA 4IIGA 1TJPA 3UZWA 3LEPA 4NJGA 3VTRA 5HPOA 2IPFA 4JXCA 2WKJA 1KGXA 4YTSA 1MXDA 2CPUA 4KIRA 3RFAA 2FJKA 3CGTA 2OQYA 2DU2A 5LXXA 3DI1A 4V1XA 3RCNA 3OVQA 3SFWA 4LYKA 4J3SA 2V5BA 8XIAA 3CWNA 4LS0A 5LHEA 2Z2AA 4NZJA 1R3TA 3F1QA 1QCWA 2PSNA 3GX9A 2VQTA 4DUVA 1C8XA 4PR4A 4R88A 4BI6A 4B2DA 4M1RA 3RM9A 3WH7A 4JYEA 4JTJA 1Z69A 1P48A 3LPGA 3OG2A 5IRPA 4AY1A 4IP5A 2DH3A 5A95A 1OF8A 4Y7EA 1IV8A 3LHWA 3SRKA 5F1UA 3APGA 1LLOA 2ZZ7A 3SY8A 1EQCA 4DJFC 4H6QA 3WH5A 3FV9A 6REQA 2PC4A 3MCOA 5BNKA 3TSMA 3GW3A 2P0OA 5AHFA 1Q8JA 4LCRA 4QAWA 1UUOA 4P7NA 3DHFA 5D03A 4S3GA 4Q8WA 4IJBA 3H4XA 3R0UA 3VX0A 1PCWA 3MSRA 2CW6A 2HXUA 1JDDA 1YXYA 4E3TA 5FF3A 1OFDA 1P7TB 3W27A 3TJ4A 1TWZA 3VU2A 3IGHX 3KOXA 3WH8A 2WXDM 5MKGA 3SDOA 4Q3MA 1Y0EA 2VFGA 3R10A 2DUAA 4RNJA 1Q7QA 3NSMA 3T42A 2OT0A 3NYZA 2YB4A 1EF2A 3EAUA 5EBUA 5ABHA 5TAOA 4GUJA 1TZZA 3BDKA 3NG3A 1KFBA 2WSPA 1VHNA 2PU1A 5KITA 2A7NA 4HNNA 3IAPA 1XG3A 3AUJA 1RY0A 1IQ8A 1NTHA 2R8WA 5DO8A 2BHUA 4INFA 4OOZA 1NDZA 2R91A 2CZVA 1ZENA 3QMSA 5I00A 1EP1A 3U48A 1IEWA 1XDJA 3UG8A 3VNZA 5CPMA 4GQGA 3ZM8A 2J7CA 4NZ5A 4TO8A 1TPH1 5D32A 4OTKA 3TN6A 5EA9A 2DZBA 4AW7A 4IGMA 3HJZA 3B9DA 2QZRA 3HV8A 4GBDA 1WP6A 1ITQA 2Y8UA 4YMZA 3WDIA 3LYEA 3U2OA 2WWCA 3N04A 3SIMA 3BGJA 1GORA 3S5YA 3UJFA 1V79A 1NSJA 1G4PA 3MVTA 3WJZA 1QI4A 4Q32A 4B91A 4DJDD 4Z1CA 4V15A 1E1CB 3P5ZA 5D8ZA 1F05A 3KVKA 1K4HA 3TA9A 1C91A 4TMBA 3RRXA 2JKAA 5HJXA 4KGJA 4YLWA 1C7TA 1W5MA 2YLAA 3S1VA 1NJJA 1L2UA 3BW3A 3XINA 3QN3A 2WCSA 1V3HA 1FWGC 1J0HA 2E40A 3N29A 3AIEA 4HQVA 2RGMA 1TA3A 1F9CA 4AEOA 4ROPA 4PUEA 1TIMA 2DSZA 2DW6A 5K3VA 1NWSA 3AS1A 2V8ZA 2D2GA 3VVGA 5AC6A 5CC7A 3SGZA 5CGTA 2AL2B 4JQAA 1TZ9A 8RUCA 2NQ5A 1YDNA 2NVCA 1EGMA 5L9FA 3EB3A 1PX3A 4FNUA 1FHUA 1RD5A 3QC3A 1XRVA 5LGXA 3CUJA 1KBKA 4ATDA 4XUGA 1TVNA 1F3EA 3VCNA 1XHGA 3J7HA 3U3HA 5JIWA 4W7VA 3LCHA 4Q8PA 1LQ2A 4J3VA 4IHCA 3NQ6A 2WHLA 3KAOA 3EWBX 2WNZA 4JCMA 3K8KA 5JVLA 1XKYA 1CXLA 2HE5A 1PWLA 1RPXA 1KXQA 2NSXA 4DVOA 3FGCB 1K9TA 2XVKA 2CZ5A 3BGGA 3LY0A 2A3EA 1PHQA 3K1DA 4NP7A 3A4WA 1V0LA 1RHCA 3S42A 3KS5A 3AIWA 1FWIC 3RX3A 3FYOA 2NQHA 4AEEA 3WUGA 3L4TA 2FLIA 4EVZA 2GOUA 5I2UA 4E4UA 4HPHA 1LYXA 4Q7IA 3SCNA 1N2VA 5DLCA 3EOUA 3PSVA 3K46A 1FX6A 2VFEA 4H9XA 3NPWA 4O1BA 6PTDA 2CZFA 1DWGM 1UB3A 2A0NA 1OY0A 3PBUA 4HSOA 2ABAA 2XSAA 5AVHA 1W1A1 2GVJA 4FLSA 4YVVA 1NVMA 4C6CA 5M5DA 2ODOA 1K8CA 3REQA 5BXSA 3R12A 2EKCA 3LX9A 1R8LA 5BOEA 3GD6A 3WIJA 3PAJA 1EWEA 2CZDA 2DT3A 3NL2A 3DERA 4L4PA 2EQDA 3VOIA 1UMYA 3RR1A 5LA1A 1PKNA 1NQKA 2VC5A 3NEVA 4MWAE 1LBMA 1CXFA 1KKRA 4QQ3A 4Z1AA 4GA8A 1VEMA 1H2JA 4KRUA 3L67A 3O9NA 2ZUSA 2YCLA 4B5TA 4WJEA 2E9MA 1TX2A 4QE5A 4KCVA 2WJEA 3QMRA 1QASA 3L0NA 1SM9A 4FNTA 2NWSA 1C8YA 3ZLGA 2LLEA 4D6DA 1MFUA 1XC4A 2QIIA 2WHKA 1UUMA 1NY1A 1B1YA 1H5YA 3RO8A 4HZ8A 2FGBA 2X30A 1B3XA 2HWGA 3KBNA 1WV2A 2HPMA 2C3ZA 3NQBA 3KDOA 2NVDA 3NO5A 5T9BG 5HA7A 1TTJA 3TSDA 3STFA 3ID7A 3GU9A 1AQFA 1Q13A 1TV2A 4PUUA 3CQHA 5SWUA 2EAWA 4AWTA 1VLWA 1CENA 3GNPA 3AIRA 3R89A 2ONEA 2V3FA 1OCNA 3W7RA 3C2VA 4MM1A 3QY8A 2F61A 3KEHA 3L2LA 3PN8A 4QG6A 4H8HA 4LBUA 1UZ4A 4HBKA 3FYPA 2C8NA 3O6DA 1MNSA 4ZGYA 4KS0A 4RXFA 1CB7B 1QHPA 2GDVA 4S3JA 4JHMA 2VX7A 2Y62A 3BSHA 4CQDA 4CD8A 3K4AA 4MWAA 3AMLA 4GNVA 1BYBA 3C5QA 4ZQCA 3WELA 5D9NA 1GOIA 3SW6A 3CO4A 2FIQA 4ACZA 4YIWA 3MDUA 2HDJA 2IPWA 4F0RA 1RALA 3E74A 1P0NA 1GKRA 5IFPA 2YXOA 2PWFA 1OADA 2VC9A 4RX0A 3WFLA 4LYQA 1EOKA 1QATA 3FYYA 3SGUA 1E1EA 2BY1A 3WQWA 4XZHA 4PCSA 1PZ2A 3R0KA 3AXIA 1FXPA 1TVPA 4TV6A 3QR0A 4REQB 1D2KA 1NOUA 4LC8A 3Q94A 1SW3A 1BYCA 4Q8UA 1VKFA 3BO9A 1QNPA 2PWGA 4WY0B 3F2DA 1IYXA 3TTEA 1AJ0A 2WVSA 1WDSA 4DUXA 1SFTA 4JTSA 1GW1A 3F03K 3SRFA 3SBFA 4GHRA 2DSWA 3VIOA 1UWTA 4WD0A 3USBA 1JCTA 1OSEA 4A8NA 3VINA 3RILA 1E55A 3W7OA 3KZPA 4V33A 3UYIA 4K8EA 5KZDA 1IXOA 4GZIA 2CERA 5D9MA 4W93A 3UEQA 2NW0A 2X7WA 2BZNA 3VNMA 2XSXA 4O52A 1MI3A 4ZQMA 1D3CA 3NPUA 3SAZA 1PKYA 1PX8A 1W1TA 1EH9A 4WK9A 2Y7GA 5AYYA 2BXYA 4WR3A 3ANVA 3DUGA 3LN3A 3RNDA 3DGRA 2ADAA 1XLEA 4MVAA 1H7WA 1CGVA 4C7FA 5HNTA 3C0SA 2V2DA 4MWAC 1LF1A 3NQ2A 4LUSB 1KKOA 5ABFA 3A3WA 3GBDA 1DIDA 1B54A 4D1IA 1T99A 3B0UX 3QGAC 5CKSA 2ZRUA 2ZE3A 2I14A 4XZNX 2XHYA 3TA6A 3VDGA 3I10A 4BQ2A 3MWCA 3P0XA 5E0FA 1XLKA 4L7ZA 5FCZA 1JI2A 3CYJA 3KLLA 2FH6A 3RLHA 4KFPA 3ARSA 1EP2A 3URNA 3DESA 1UD5A 3I4KA 2JIWA 2YZ5A 4LU0A 1EC8A 1OC5A 2E5BA 1Y5VA 3G1YA 1DHKA 3RU6A 1DJGA 1RVGA 2E3ZA 4PH6A 4F0MA 1SR9A 2QEZA 4K2SA 3W7GA 5FJPA 4CVUA 4YWIA 1UWSA 5TBOA 2JBMA 4JTHA 4UFJA 5DQPA 4IJRA 5C5YA 2PA6A 2ZIDA 1CW2A 3PPHA 3WQ6A 3BWWA 2CU0A 1DE6A 4RR4A 3MCNA 4XD3A 2ZE0A 4HB7A 1RJPA 4UFKA 4DWSD 1A4MA 1KLZA 3AHXA 5AECA 1ISXA 4LYRA 4S3CA 1TKKA 3BSMA 3N9RA 2ANUA 3UBPC 5HXMA 3NOEA 2EXOA 3GHTA 4KW2A 4X2RA 4GVGA 4R27A 1PTDA 3R8RA 3I68A 3H8AA 1JYVA 2ZC8A 4H19A 1A3HA 5EGRA 3WZ0E 3H12A 3A5VA 4YNGA 2OWWA 2EPKX 2PDIA 5CLTA 5FD0A 1DTNA 3WNKA 2FYMA 3PZUA 5DELA 1JR1A 3AALA 4LAMA 4DUWA 3O8AA 1KXVA 4PYSA 3HM7A 4CCDA 5DEZA 3LV6A 3GH4A 3M46A 3A9IA 2H8XA 1P0DA 3DIPA 1S1PA 3U9IA 3P60A 4HPXA 5CZJA 3R58A 3LS9A 1BSIA 3G1FA 1VFSA 3DFQA 2UBPC 3OLGA 2Y8VA 4BQ3A 1S5NA 4NAEA 1W37A 2QHAA 2H90A 3V1HA 2QCLA 1UR4A 2HVOA 4TIMA 4ILSA 2I16A 3KCJA 1XXXA 4RCXA 3GVWA 1LQ0A 2CLHA 4UQEA 3A47A 2F7FA 3KRUA 1A4LA 1W1PA 2G3MA 4JDYA 1HG3A 2DSUA 3EOEA 1V0NA 3C2YA 3VOCA 1JFHA 2PI6A 4S23A 3V36A 3UJEA 5AYIA 3STCA 4U5KA 2C16A 2J7EA 1YRRA 3APTA 3GFYA 3TWAA 2E8YA 2CKSA 3VZXA 3NURA 5C9ZA 2HK1A 2BHYA 2DV0A 1H1YA 2PF0A 2Z29A 4EXBA 4M6VA 3M0VA 3ZJKA 1UASA 3EMQA 2XGBA 2PRMA 4N02A 4C7DA 2QLYA 3BG9A 1R2SA 1S3TC 3R11A 1P6CA 3W37A 3VIHA 5DRIA 2ACSA 3KWXA 1PIGA 3NDZA 4QS5A 4M6PA 4BR1A 4Q33A 2H3DA 1S5TA 3CTLA 4FPSA 2Y7FA 3VCCA 3E0WA 3G0XA 4AXNA 5E1QA 2G50A 1YTKA 3CQIA 4FAMA 1LWHA 4C6QA 1IE7C 2ZZ2A 2NQZA 1ODUA 3OHIA 3WD3A 4L6OA 2ATMA 4Z2KA 3T2QA 3H70A 3O0KA 1F61A 3GR8A 1PVNA 4GWEA 4IT1A 3O7UA 3R0DA 1TV8A 1I1WA 2UY5A 5FIPA 4E6MA 1RP9A 2ZX6A 3GTHA 3FGCA 3W7KA 5KZEA 2CYGA 2ZRXA 3C86A 3N15A 3CC1A 4UTWA 1LUCB 3MANA 1ITXA 2Y89A 4A35A 2JF6A 3NO1A 4ADTA 3TTYA 3W76A 1UKPA 1X8CA 3ZZ1A 3RMEA 1IZKA 3APYA 2QCDB 4GYKA 4QDWA 1DTUA 1TTPA 3AXMA 1TMQA 3I6EA 4NF7A 3KOFA 1SJAA 4QROA 2BBFA 1LLWA 3VGBA 2YDQA 6ALDA 2XVGA 3UF9A 2GYIA 1E0VA 2GGJA 3RJYA 1TZ7A 3C8NA 1MQQA 4OFCA 4A3RA 5GPRA 3AIUA 4KEZA 4PL1A 3U0HA 3G6MA 1JPMA 2J7FA 4U2ZA 3A13A 3C3UA 4GNJA 1I6NA 1N8IA 2ZUVA 2DY3A 3B9NA 2WJZA 2HVNA 1EIBA 4RE3A 2CESA 5DRCA 5I78A 3PPGA 5HMEA 3QFEA 1QWKA 2VZTA 2NV2A 2VYOA 1ZBCA 5C54A 2FTYA 1E0UA 3TUUA 4S1FA 2QCMA 4P2VA 4LS1A 3UZ5A 3WF3A 4AF0B 1C29A 3MMTA 4LEFA 4JKMA 7TAAA 2BDQA 3R2GA 4NZ3A 4OOUA 1ZLPA 1DXEA 3IVSA 4NYYA 4M24A 4XX6A 4WXZA 3K1GA 3WO8A 1F8IA 1WZLA 1B31A 1EUAA 2WMFA 3M0LA 2PDWA 1H50A 1HO1A 1O6IA 3GAKA 2QVNA 5AY7A 1Q5MA 1NF0A 1FWEC 1WOAA 2RDTA 4FNRA 3HIJA 4XTIA 1Z48A 2ACRA 5CLWA 1ZRQA 2E7FA 1QAPA 1GUVA 2PDFA 3THCA 4XBSA 1NP0A 5KEZA 3UWYA 1L6WA 1GYLA 1VFLA 3AHZA 3AXKA 1PV8A 4HU0A 4DELA 1FHDA 3QVQA 3HPAA 2X1SA 1HUVA 3RPMA 3L4UA 2NXHA 4LB4A 4M82A 4WDUA 3C56A 1EYEA 1WA3A 3S2CA 4LC6A 4KFNA 1NFBA 4UTWC 4NXKA 3ZR4A 5CCZA 3DXIA 2RH9A 3K4DA 1JAEA 3G18A 3QQWA 4D6IA 1RK6A 3IV3A 3UA4A 3UY8A 3HGRA 3VIPA 3GR7A 1BGAA 3GU1A 2Y61A 4HCDA 1J10A 2IQ0A 1BHGA 1LRQA 4W9TA 3AUOA 1W3KA 1L6GA 3L7RA 3C0LA 1MZRA 1R38A 3R25A 4H6EA 4ZXLA 3FLUA 1L6SA 3ELFA 3P2VA 1OYBA 4K6AA 4QQUA 3DZ1A 4OWGA 1F76A 4AY8A 1ISYA 5BXTA 4NVTA 1FKWA 1SMAA 3GG0A 4XZBA 1WNOA 4DXXA 2BVTA 4GIEA 5AN7A 3WLTA 3W4RA 5CZKA 1YQ2A 1J0ZA 1VR6A 2JKPA 4H9MA 2XFFA 2GJLA 3MP3A 1JNEA 1W9VA 1X38A 3UCCA 3QHOA 4TOQA 5LA2A 2PP0A 1E5JA 1K7FA 1XWYA 1UD8A 3EKGA 3W25A 1H1ZA 2FHCA 3STEA 3W1TA 3EA2A 1C7SA 1MZHA 4MTVA 3VO0A 2PLKA 3CV2A 5LNVA 4RDVA 5A8GA 5I3JA 1W8GA 2ACQA 3ARPA 4AU0A 3DFPA 4F8XA 3NWRA 1F73A 4FMVA 3IJQA 1ZFJA 4AIBA 1KLYA 1QPRA 3PB2A 5D30A 4RNFA 2NQJA 3MUXA 3UU0A 2HEJA 2PGRA 2V30A 3NTYA 4ZFCA 4IL0A 5HWNA 1WO2A 1TB3A 3FSTA 2RDWA 4X9SA 5A6TC 1H1NA 2J62A 2Z7GA 3VD9A 2VEGA 3NDOA 4WDWA 4X2PA 1A5OC 3CUZA 3VKCA 2FKPA 4LH8A 4QG8A 2PF8A 3H6OA 2BLEA 3WF2A 2VEMA 2KZHA 1LCOA 2YOCA 5D09A 4M5PA 2HRWA 1JD7A 2RDXA 5BU9A 1T41A 2JFEX 1BD0A 1VPQA 4V28A 1WKYA 1TR1A 3VKKA 4IMGA 3Q58A 1MXGA 4ZO8A 4AWUA 1DJIA 1I2RA 1HVXA 3ENLA 3C2RA 4TXEA 1KWGA 1DBTA 4US5D 4UQBA 1V51A 4I8DA 3PAOA 3TC3A 4IIEA 3LV5A 4E4FA 2VWTA 1FKXA 3P74A 4QSHA 4A4AA 1CT5A 3LD5A 3E2VA 4MB4A 4B5UA 1H7OA 4W85A 1W1IE 3NGJA 4ZCWA 3QPYA 3MQTA 4NJKA 4DF1A 1N8WA 1BF2A 5KMYA 1JG9A 2PWEA 2V63A 3CPUA 3UETA 4BK9A 4XSMA 2VEPA 3GC2A 1KFLA 1BPLB 3TIMA 1PL9A 2OXNA 3HQ1A 3CL6A 1Q8AA 1YE6A 3TOYA 1FVPA 4CU8A 1E9IA 3O2LA 3UNDA 4AD1A 4FLRA 2QVHA 4A8IA 3VCRA 1ZUAX 4WKAA 2WB5A 4UFMA 3SADA 2WW5A 5GNYA 2W61A 3W38A 4WGXA 3QKZA 1V3MA 4B15A 3U2EA 3CIVA 3QQ0A 1KV8A 1TTQA 2PDBA 4PCPA 3LGDA 1Z89A 4EPEC 2E6AA 3OBKA 1GZ1A 3FX4A 2W4XA 2WWDA 4P8UA 4FA3A 2PDQA 3CZLA 3GVVA 3FAXA 5F4WA 7PTDA 1M53A 3H24A 1UC5A 4QCFA 3BGAA 3LHYA 3R13A 3S9YA 1S46A 1XRTA 1H63A 3D47A 4MZ1A 4JEJA 1NWRA 2VX6A 4TVUA 1EGZA 1RA0A 3EXRA 1DOSA 5J5DA 3HJEA 4HMNA 4A3YA 3NZRA 2Q8ZA 2P3ZA 2ISSA 4BQ4A 3WLSA 1J2WA 3LDVA 5B80A 5FACA 1VFMA 4RXGA 1TV3A 4N9DA 3G8EA 2VRJA 1FWSA 1B9BA 2FVLA 1QNVA 3F7JA 1DJYA 5FESA 3CEUA 3I6RA 3NM3A 5J5RA 4O1AA 4B5XA 3EMCA 3LTSA 5A2CA 2EKGA 3DN5A 4NUWA 1KFCA 5CSRA 3FJ6A 2OFJA 1ISZA 1MQRA 1E43A 3UT0A 3NEHA 1BQCA 3IEBA 1IHIA 1QOPA 4JTKA 2QXWA 2D73A 3BOFA 1KQZA 1PAMA 2PTXA 4XV0A 2W5FA 2F38A 1GQLA 1VENA 1UWIA 4QJ1A 2ZA1A 3IJIA 3K4WA 4TX9A 4K3ZA 1PE1A 1WDQA 1Y5XA 2NT1A 5E5CA 3SEPA 1H51A 5GQBA 3TJIA 1IEIA 1BWVA 4FO4A 3LA4A 1ZNNA 5AHEA 3AIVA 3QV7A 4XAYA 1W2VA 2V5JA 4ZBCA 3VZYA 1LORA 4ZOBA 5B7ZA 1CB2A 5ABGA 1XFBA 4HU8A 2YW4A 3B0XA 2DW7A 1DVJA 5D2XA 1XCWA 5AVNA 3HBLA 2X16A 3SR7A 3UWUA 2NX1A 2BVWA 3WLNA 1HO4A 1Z8AA 4UR7A 5G5IA 3UXIA 1ZP4A 1EEPA 5JBFA 2P76A 2ZWYA 3L5AA 1TCMA 3QHNA 2XGIA 2J7GA 2QJGA 3PG9A 4WKHA 4X63A 1BLIA 4B3ZA 4GXPA 3MKCA 2EJ1A 4JHOA 5FL1A 3VM7A 1M04A 2V81A 3MYOA 2Z00A 3AHVA 1G01A 1M65A 2J9YA 4DYJA 5XIAA 2GWNA 3N2BA 3W01A 4IPLA 4YPJA 2HS8A 3GW0A 2V2HA 2JK2A 3ORWA 1OIFA 2G37A 3UG5A 1O68A 4IQDA 4DHGA 4JL1A 5D2YA 2WSYA 3H21A 1QR7A 3TN4A 2HBXA 3UESA 4DIAA 1XLGA 4DPQA 4PBEA 2VXNA 4U31A 2PWDA 4BCEA 2PLJA 1H7NA 1LUCA 4YS1A 3FY1A 3DCPA 5A8QA 3BG3A 3UVAA 1C8VA 2P8CA 3W71A 2E0PA 1RSCA 1O5RA 4HNVA 2PUZA 3R6IA 3ZWSA 4GI6A 1A5CA 3L21A 5KSWA 1S2VA 2WZEA 5HWMA 3E0FA 4GY1A 3W7EA 3SSZA 4PEEA 3H2NA 3BJSA 5D33A 4WJXA 1HJWA 1YPIA 1BEUA 1REQA 3GKFA 4G7EB 2J79A 2YW3A 2ZQ0A 3UY7A 2ZUNA 5I3GA 1GQJA 4ZQNA 3CZGA 1E4IA 4C6NA 1UWRA 3NGFA 2OYMA 3MP4A 3W1UA 4KKXA 3QV6A 1ONXA 4W4QA 1XIEA 3UZJA 4TMCA 3I3EA 1PB0A 2D20A 2WM1A 2ASHA 1TJ1A 1WE5A 3FDKA 3HFTA 3AISA 1UWUA 3W85A 4O13A 4HU4A 4URIA 3G1AA 3WLRA 2Q71A 3E38A 4L65A 3GXDA 2HCVA 2FDSA 2VFFA 3BZGA 3CHEA 2FVMA 4BZYA 4WY0F 3L4VA 1V6YA 3V3WA 1S1RA 5E0KA 5AHLA 5H8MA 3CEPA 1P43A 3KM8A 3IJ6A 3MSDA 2Z1BA 3V0UA 4JFUA 2V0TA 4DXKA 1UIPA 3V4BA 4Q4QA 2OMAA 3N25A 3VKJA 1HP5A 3VYLA 1E15A 4UTMA 3OHMB 8CGTA 1A5MC 2OT1A 1B9ZA 3QV8A 3WDJA 1W5QA 3E0VA 3OG3A 1LWJA 4EIVA 4QG9A 1QWGA 4GABA 1T96A 4JZ5A 1HIZA 3VD5A 1R46A 3AI0A 3PBVA 5F4SA 2RKXA 5G4HC 1XRSA 3DKJA 4AC7C 1XW8A 4IMAA 3GVGA 4GPNA 3OYXA 2C1IA 4E5TA 4AFYA 1KCLA 2EJAA 5I6SA 2WVVB 5JU6A 3M0ZA 2TRSA 5D37A 2HS6A 1D7KA 4ORIA 2F6UA 1DIKA 1EDGA 5FF2A 2ZKMX 2BWGA 2GDUA 3H53A 4J28A 4PTWA 1IIHA 3TTQA 4MAVA 1KM1A 4J9JA 4IH3A 3HPZA 4NAFA 5FSEC 1I75A 3HMCA 5T8GA 1IF2A 3NVTA 4ZB0A 3TN3A 1X1ZA 3THUA 2AGKA 4UTJA 2P8BA 2VJXA 3HN3A 2H9AB 2WJFA 3ECQA 4AVNA 2MUCA 1FQ0A 3W02A 1TIWA 4IQJA 3SB0A 1Z42A 3EEZA 2CETA 1FH9A 1EOMA 4Y9MA 2DQXA 1OGSA 4XIAA 4ZE4A 3V35A 3IACA 5A6BA 3P61A 1UPMB 4H01A 3ALFA 1DL3A 3FVDA 4O16A 3GAYA 3VABA 4R7JA 6CGTA 3F2CA 4DZHA 4JIRA 2JF7A 3DG6A 3ERPA 1X1OA 2WQPA 3UJSA 1EA9C 3RXZA 4AZIA 3GNXA 2WLYA 4RZ5A 5REQA 1DJHA 2OO0A 4FXRA