3WUEA

The wild type crystal structure of b-1,4-xylanase (xynas9) with xylobiose from streptomyces sp. 9
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
312
structure length
312
Chain Sequence
TATLGELAEAKGRYFGSATDNPELPDTQYTQILGSEFSQITVGNTMKWQYTEPSRGRFDYTAAEEIVDLAESNGQSVRGHTLVWHNQLPSWVDDVPAGELLGVMRDHITHEVDHFKGRLIHWDVVNEAFEEDGSRRQSVFQQKIGDSYIAEAFKAARAADPDVKLYYNDYNIEGIGPKSDAVYEMVKSFKAQGIPIDGVGMQAHLIAGQVPASLQENIRRFADLGVDVALTELDIRMTLPRTAAKDAQQATDYGAVVEACLVVSRCVGITVWDYTDKYSWVPSVFPGQGAALPWDEDFAKKPAYHAIAAALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural perspectives of an engineered beta-1,4-xylanase with enhanced thermostability.
pubmed doi rcsb
source organism Streptomyces sp.
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase A
total genus 126
structure length 312
sequence length 312
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3wueA00
3LPPA 1W32A 3IANA 3W6MA 1Z32X 4LYQA 1E43A 4JCMA 3TTQA 4PMUA 4ACZA 4AZCA 3A4XA 3W6LA 3NDYA 3WNKA 2UY5A 2ZXAA 1OT2A 1CGXA 4CVWA 1EDQA 4PMRA 3RIKA 4F79A 2Z1KA 5FOOA 5D9NA 4A4AA 4J7RA 4U3AA 2WMJA 3VINA 2QPSA 3VD9A 2X1IA 2FGLA 4ACZB 1ISWA 3M6DA 2XJ7A 2W91A 2WVVA 6TAAA 1BGGA 1CEOA 5DO8A 3AIUA 4ZFMA 1HKKA 4UFHA 3L4YA 1FP9A 4M56A 2D20A 4QDMA 5DMYA 4LPCA 1HJSA 1EIBA 2VR4A 3KL3A 5EFDA 3CBWA 2J7FA 1E70M 2O92A 1MWOA 3MSGA 3AROA 2ZE0A 5FL0A 2VRKA 7CGTA 3SCQA 1W9UA 1EQPA 1HP4A 2ZUWA 1SYTA 3AS3A 1VRXA 3N9KA 2D0HA 1LF1A 2BXYA 3CMJA 2C8NA 3BSHA 1V08A 3DHPA 1ESWA 3WY1A 1UD8A 3GXDA 4FK9A 3BAKA 1BG9A 1OT1A 3HU7A 2E9MA 1WZLA 4Z2JA 1JI2A 3I3DA 1MFVA 2WWCA 2ZOXA 1E0VA 1W3LA 1K9DA 2NW0A 1I1WA 1WB0A 1E9LA 3J7HA 1UWSA 3UR8A 3O2LA 1L0PA 4MPKA 4JCLA 3ECQA 1QOXA 2X8RA 1UKSA 3K4AA 2PBGA 2ZX5A 5JBDA 5CGMA 1OIMA 2CERA 4UQAA 2D1ZA 1J11A 2G3IA 1RP8A 2A3EA 2QF8A 4WSJA 4CCDA 4UFJA 1EGZA 4U5KA 1GQIA 1CYGA 3AXIA 1J0KA 2XWDA 3GH7A 3U5YA 1E6XM 5BXSA 1D3CA 1JFXA 3M7SA 3VNYA 2D22A 3GH5A 3W82A 1ZBCA 1JL8A 1GHRA 2XVNA 4P7NA 3SUVA 4XZWA 4XX6A 1CBGA 1PX4A 4AZGA 1FOBA 1QNPA 3TP4A 4J3XA 2CKSA 1HJWA 1KR1A 1NWRA 1X6LA 4PRWA 2XIBA 3EDFA 4W93A 4DWSB 4W87A 2ZUUA 3VDAA 4ZXOA 1JYWA 2PWEA 4R5EA 4UFLA 3ZSTA 1QNSA 3KL5A 5GPRA 3ZM8A 2WLZA 1RH9A 3AZRA 1QW9A 1WZKA 1V0LA 3FY1A 5BRPA 2VX4A 4UQEA 3WKZA 2CBUA 1XYZA 3WDQA 4W5UA 4GI8A 4UTFA 2W62A 4ML4A 4AY1A 2Y8VA 1PPIA 2XSAA 1B3ZA 1CXLA 3NUKA 4YN5A 3M46A 1M04A 3ARPA 1BFNA 1QBAA 2D3LA 4AC1X 4P8VA 4QCFA 3AOFA 4GKLA 3BLPX 2YDRA 1E4MM 4TUFA 1EA9C 3DC0A 5DEZA 4M81A 4PTVA 3PHAA 2C0HA 1W3HA 1BSIA 5EBAA 2BVTA 2XGIA 4FLQA 1CLXA 2F2HA 2YDSA 3K8KA 1NWUA 1TG7A 5LA0A 2VOTA 4M24A 1MW2A 3IAPA 2W5FA 3OBAA 2WVUA 2DT3A 4U2ZA 3G6LA 2G4FA 3GDBA 2WHLA 1G0CA 2DDXA 1BAGA 3GM8A 5LA2A 2CCRA 3MUY1 5FCZA 2ZUVA 4GINA 2WZHA 2ZUSA 1Q6CA 2PB1A 3GZAA 1NOUA 4GZJA 2WHJA 4EK7A 2Q8XA 1CTNA 5BCAA 3AHZA 1C92A 1BG4A 1X1NA 1W9VA 2WZIA 3FXYA 1OGSA 1O7AA 4JKKA 3CH9A 3ZJ6A 4D6CA 2ZWYA 1GONA 3APGA 1H0IA 1KB3A 3ZJ7A 4D6DA 4CN1A 1ITXA 3K46A 4P7LA 2A3CA 4GXPA 2WVSA 4IISA 4P7QA 4LGXA 4Q22A 1GVIA 4UQBA 4X0NA 1UZ4A 2WBGA 3OLGA 2C7FA 1XCWA 3WF2A 3A47A 4TOQA 2G3NA 4CU7A 3CPUA 3VTRA 1GOMA 4URIA 7A3HA 2DPEA 4CD6A 3CHCA 3OIHA 2E9BA 2J74A 1WDPA 1MQQA 1UR4A 5M17A 1BTCA 2EPMX 2CIPA 2VNCA 1GZJA 2D0FA 1W9PA 4KWUA 3MMDA 3CHDA 2OWWA 3HJEA 4LX4A 1EDTA 4YHEA 4OIFA 5A8MA 4Y7EA 4QLJA 1B31A 1UD5A 1JFHA 1BYDA 4MB3A 1CGUA 2VURA 4IUGA 1EHAA 3SCWA 1XGZA 1CNVA 4OBSA 2E40A 2XVPA 2JF6A 3ZIZA 2XHYA 1UR8A 3SCRA 1F4AA 3I3BA 3VDCA 5EB8A 3EBVA 4OBRA 2DSZA 5GNZA 1V03A 1JZ6A 4V27A 1NARA 4HTYA 5CPSA 4H41A 3VMNA 3ZQ9A 2O9OA 3WMCA 4Z2GA 1CGYA 1UWIA 1E3ZA 2PWFA 3ARRA 1I75A 4AEFA 2VL4A 3VGBA 1GUVA 1TA3A 4J27A 5EMYA 1B3XA 3SUUA 2EPKX 4ZE5A 2OYLA 3WQ8A 3E1F1 3POCA 3ARWA 2YL6A 1C93A 2WC7A 3ZSSA 4XZBA 4BS0A 1OIFA 2WM0A 2DH3A 2WMIB 4ZEPA 2ZXBA 1OB0A 5E9AA 3THDA 4PSPA 4V28A 1GOKA 3LPOA 2DT0A 4PCSA 2VC9A 3VIIA 1UKPA 1CXFA 3B9DA 4PTMA 1ZBWA 1UR2A 3KWXA 4ATWA 4HZ8A 1JIBA 1D7FA 1QW8A 4AIOA 2E4TA 3WQ6A 1EOMA 1ECEA 3VD7A 3K8LA 3W81A 4UQ9A 1E6NA 4IPNB 4EE9A 5CG0A 1B9ZA 1TR1A 3AISA 4W8AA 1R7OA 1JXKA 4RE2A 1OGGA 2XFFA 3BAJA 1HT6A 4D6EA 3CUHA 2BVYA 3TONA 1XD1A 3WFLA 2QMKA 3AMLA 2X2YA 1M03A 4CN6A 3N18A 1Y7VA 2Z1SA 3D5HA 3OGVA 4NI3A 4PN2A 4UFMA 4W7WA 3GXIA 2OSWA 1FP8A 4W8LA 3QHNA 3FAXA 4QLKA 1ITCA 2WANA 2WC4A 1UD2A 4ATLA 1UWQA 4B3LA 3BGAA 1G5AA 2FGZA 2A3BA 5A6JA 3UR7A 1NM9A 4QP0A 1W2VA 1E4IA 5M03A 2QHAA 5A6KA 1QVBA 4E8CA 2VUYA 1E72M 1KR0A 1V3HA 1XD0A 3VM5A 3IK2A 4MAZA 2VCAA 1VFFA 2HVMA 4UQCA 3SCTA 2J79A 4MNLA 4UCFA 3BCFA 3CUGA 3PTMA 5HBFA 3RO8A 1E56A 3PBGA 1K9FA 1WKYA 4QCEA 1M7XA 3B9AA 2FHCA 2BFGA 2EJ1A 3EDKA 1E3XA 2WCAA 3FHAA 1F4HA 1MW0A 3LPGA 5EFFA 3SCSA 5I0DA 2YOCA 1XSIA 3SCNA 2CNCA 2J4GA 3VVGA 1IV8A 1GORA 4PMQA 5AC5A 1E4LA 1NWTA 1X6NA 3EDDA 3SCUA 2CBVA 1Q6GA 1WO2A 3AS0A 5IXEA 1LQ0A 2XTKA 1BGAA 3F5LA 4DUXA 4MTVA 3WF4A 3AXHA 2GJRA 1CECA 1HJUA 2UY3A 4S3KA 1E0XA 5A94A 1VF8A 2ZX7A 3NSMA 3I3EA 1KXHA 1DWJM 1OD8A 2AOSA 3RILA 1KXTA 1FH9A 5CSYA 3GYCA 1V6WA 2WMFA 4AZ5A 2V5DA 3WEZA 3TA9A 4AISA 3GNOA 4CVUA 3BMWA 1ZBKA 1AQ0A 4B16A 1FH7A 5C70A 3W28A 4HMDA 2VZOA 1UH4A 2AMGA 1QI3A 4KRUA 4UFKA 4J3WA 3F4VA 2X0YA 4S3JA 1R8LA 3VX0A 1J9YA 4W8BA 1NWSA 2Y8KA 1JZ5A 1TFVA 1J10A 4JFSA 2WPGA 3VIOA 3VIPA 4RE4A 3WQVA 1SMAA 3NSNA 5JBFA 2NT1A 1J01A 1H0GA 1C8QA 1KWKA 1Q4NX 1GCYA 1ZS2A 4J28A 1LG2A 2WSPA 3BAXA 3WH8A 2VQTA 5KZ6A 1UYQA 4HMCA 3WQ4A 1G01A 3EMCA 4GQQA 1BQCA 3TTSA 3CZJA 2XYLA 4HOWA 2BXZA 4Z2LA 4W5ZA 3VGDA 3WD1A 3WMSA 1JZ7A 3AMKA 5DFAA 3L4VA 4N0RA 4U31A 3CIVA 3OLDA 3G6MA 4BQ4A 1JD9A 1XH2A 2PWGA 3ZJ8A 1HNYA 4MNJA 2GDUA 1NQ6A 1HL9A 2WMGA 3NYDA 1VBRA 1WNOA 2GJPA 4ZENA 3IAQA 3ARQA 5CZKA 2BV9A 5A6MA 5DF0A 4WSKA 1ZJBA 4V2XA 1SFSA 4AZ7A 4MNMA 1E6PA 2GVYA 2WMHA 4UOJA 1U30A 2GJXA 4EKJA 2W67A 1JF5A 4C7DA 3CUFA 4LYPA 2W63A 1BVNP 5A3HA 1VFOA 1A47A 4AIEA 3WNLA 3O9NA 1V0MA 2OWCA 3VX1A 3WMBA 5E0CA 2EPNA 1DWIM 2VRJA 1R7AA 1GOIA 4HU8A 5HOSA 1JNDA 4HZ7A 4Z2KA 1KCKA 3DYOA 1KCLA 3QOMA 3BLKA 1RD6A 1PX3A 1CGWA 2J47A 2J77A 4D1IA 8CGTA 4FMVA 2X05A 1GOOA 2V3GA 4DUVA 4J3SA 3DECA 1VB9A 3AHXA 1VJZA 1MQRA 1BLIA 5D9MA 1LL7A 3T0AA 1MFUA 2VI0A 3BAWA 3PZOA 5F7UA 4DWSD 4HOXA 1VAHA 4GIAA 3PZNA 1LJYA 2EPOA 3BXWA 4HP5A 4MB1A 2YBTA 1G94A 1E55A 4PMNA 3AS2A 5A2AA 3VIJA 2Y2WA 4MJ2A 1ODZA 3EMQA 5E70A 5DT7A 4AW7A 4H7VA 2DEPA 4P7RA 4MB5A 2VZSA 4AZCB 1V02A 1GJUA 3NDZA 1OBAA 4WKFA 2WCSA 3MMWA 1DTUA 3UG5A 5IFTA 4MJ4A 2YA2A 2YKKA 1QI5A 2BY0A 1LL6A 5AYBA 5ABHA 2OYKA 3AYRA 1EH9A 1HKJA 1J12A 1JDDA 4JIEA 5A8QA 1XC6A 3FW6A 3MMUA 2YBUA 4N42A 4PYSA 1KGXA 5ABGA 3PZ9A 4K68A 2G41A 4AZHA 5KEZA 1BF2A 3ARTA 4XUYA 1PIFA 3L4XA 2O9PA 3RM4A 1VENA 3FHQA 1GOWA 1UD3A 4WJXA 3UETA 2GK1A 3CZKA 1ISXA 2EO7A 5IDIA 3B8SA 2QPUA 4FLOA 3WNOA 1UOKA 1BYCA 2JE8A 5E6ZA 4U2YA 2ZWZA 5I24A 3CMGA 5ABEA 2UY2A 1CZ1A 4HA1A 1IT0A 2VX6A 4NZCA 1YHTA 2DT1A 4F66A 3RM8A 1CXHA 1SMDA 1UZ1A 3DYMA 4M1RA 2HISA 4W89A 3MSDA 3GTNA 2VMFA 5BWFA 3T0BA 2ZX9A 1WPCA 3WELA 4L4OA 2WB5A 4MAVA 3AYSA 3VU2A 4ATDA 1C7TA 1HJXA 2O9TA 4UOZA 5AC4A 1C90A 1GW1A 3T0DA 1VFMA 3QOKA 1ZL1A 2FH6A 3WDPP 1W1VA 3ARVA 2XIIA 5HDRA 1E5NA 2YL9A 2YA0A 4LXFA 4CUCA 1KFWA 2YIHA 1HP5A 4AWEA 4FF5A 4KH2A 4IPLA 4JL2A 4BQ5A 1HXJA 2VCBA 3OZOA 1PEZA 4UNIA 4GI9A 4FLSA 2X0HA 1DEDA 1PJ9A 4PMXA 3PZUA 2CITA 2J7EA 2VRQA 9CGTA 1JXJA 4DM1A 2ZIDA 1UKQA 3K1DA 4J3VA 3S2CA 3VILA 3WD4A 1M01A 3L4TA 1NOWA 1JYXA 2Y4SA 1QNOA 1XSJA 4AD2A 5I3DA 1NOFA 3KE0A 1CPUA 2J7CA 4TX6A 1BPLB 3II1A 4U3CA 2EEXA 1J0IA 2VVNA 4H8HA 3VGGA 1MQPA 5BXPA 2WKLA 4P8WA 2RGMA 3N1AA 1EHNA 5A95A 4YPJA 3RM9A 4EAMA 2CPUA 5IFPA 2BY2A 4D6GA 2WAGA 1UHVA 1XH1A 3KZSA 1E6ZA 2OWXA 3W37A 5HPOA 1VEMA 4OOZA 1E6QM 2EXOA 3UEQA 3VIHA 3LMYA 2BY3A 1QI0A 4GZEA 4WKHA 4BQ2A 2DQXA 3OGRA 1JD7A 2E3ZA 3ZJKA 1B1YA 2OYMA 3BAYA 1GHSA 2UWFA 4R27A 7TAAA 3ARXA 4HZ6A 1E15A 3W0KA 3SCOA 4JFTA 2WCGA 2CKRA 2E8ZA 3VD5A 1UKOA 2IXUA 1UA7A 1CENA 3AZSA 2V5CA 2WMIA 5I6SA 2NT0A 1VFUA 4F8XA 5HNNA 3WNPA 1PX8A 2WXDM 4CCCA 2VVSA 5D8ZA 1WDRA 2BS9A 5I78A 3U5UA 3ZOAA 2GFTA 1JAKA 3GXFA 4OJYA 3TTOA 3PZGA 3AIWA 1HVXA 1ISYA 4JHOA 2CBIA 1UG6A 3A4AA 4PMZA 1GNXA 3MKKA 1IZKA 4MDPA 3VIKA 1VJSA 2V38A 5CXPA 2GK1B 2XVKA 4NSBA 4J3UA 2J8GA 2WMKA 3VD3A 4OOUA 2VX7A 3AIVA 4OKDA 3WDHA 2VJXA 2NSXA 4BCEA 2YA1A 5CLTA 3ZT6A 1GPFA 1W1TA 3UESA 1UH2A 1P6WA 2J78A 2WZEA 3OGSA 1KQZA 3EDJA 4IM4A 1C3FA 2BHUA 5D9PA 3SEPA 3VUPA 4AZBA 3ZMRA 2WC3A 1E1FA 4AD5A 2ZX6A 1DWFM 1KBKA 2F8QA 3OB8A 4KRTA 1E6SM 3K4DA 1GOQA 2ZICA 2J7GA 3RCNA 3VDBA 2PWHA 3WUBA 3BH4A 3EDEA 3ARUA 2YL8A 2WW5A 1AVAA 4MNKA 4TXEA 2ZXDA 2J75A 1JYVA 4FLRA 1QHZA 3AJ7A 3CGTA 4HPGA 4WKAA 2EPLX 1V3IA 1OM0A 3VM7A 5FD0A 4X0VA 2G8ZA 3ZT7A 5A8NA 3ARZA 1XRVA 1EO7A 4GPNA 3EMZA 4PMOA 2V3DA 1IZJA 3OLEA 1R86A 3UG4A 3WEMA 5A1AA 1XSKA 4ZE4A 1RPKA 1B30A 1UA3A 1UD6A 3WNMA 3WD0A 3VGEA 2D0GA 3OZPA 1HKIA 3WH5A 3L2LA 4AMCA 4TVUA 2J7BA 1B3YA 2GSJA 5GNYA 1QNQA 1MYRA 1PBGA 3AMGA 4W84A 5A2BA 1C7SA 2QMJA 3CHFA 3K8MA 1V3KA 1E5JA 1EO5A 1V3LA 1LWJA 1XH0A 2D2OA 4QAWA 2RGLA 4PCTA 3PZTA 3MU7A 3SUWA 3UG3A 1CWYA 2VQUA 4AD1A 1L8NA 3GBEA 1TZ7A 2XPKA 3N17A 2XWEA 3CUIA 1DWHM 1UWRA 2W4XA 1V6VA 4NRSA 4PMVA 1JZ4A 1JAEA 3WUGA 4PUEA 1FFRA 3CZGA 1OCQA 4LQ1A 4BZYA 4AD0A 1ODUA 4AEEA 4WK9A 2ZUMA 1ZJAA 3CTTA 3FAWA 3L4ZA 3A3HA 3AI0A 3WIJA 3WF1A 1HJQA 5CQ1A 1BHGA 5IHSA 6A3HA 1DWGM 1HIZA 1E4NA 2PF0A 1D2KA 3AS1A 3FN9A 1B90A 2XFRA 4DM2A 4JFWA 2V3EA 4CD5A 3WH9A 1PAMA 1JDAA 1H49A 2WLYA 2E9LA 1G9HA 3QHMA 2E8YA 3U57A 3RMEA 4CN4A 2CYGA 3TOPA 3SIMA 4C7GA 2OSYA 3BMVA 1H4PA 1GQLA 3L4UA 2GUYA 1V6YA 4X9YA 1N82A 1NP0A 5E09A 1MW3A 4CD4A 3WBAA 2G3MA 4D6IA 1GJWA 3CZLA 2BHYA 1V0KA 3W26A 1B3VA 2B31A 2DGAA 1GQJA 1LG1A 3WDRA 1BYAA 2FHBA 5LYRA 1Q6DA 1E40A 5A2CA 4AIUA 1WP6A 2JALA 2VCCA 2WKGA 1G1YA 4CCEA 4TTGA 4UQDA 3ZR6A 4GI6A 5A69A 5AY7A 3WD3A 4D72A 2XG9A 2WK2A 3RDKA 4JZ5A 1K9TA 1QBBA 2YL5A 3VD4A 1KBBA 3A6OA 3SUSA 4D6FA 2UY4A 3WDIA 3ARYA 4TVCA 3CO4A 1J18A 2CETA 1UH3A 2TAAA 5DT5A 2XM2A 2WWDA 5M3WA 2IXVA 2O9RA 5FL1A 4HOZA 1E71M 4M82A 3CUJA 1B3WA 1W1PA 4CD8A 2VZVA 4JFUA 3WENA 2V3FA 4D6JA 1KGUA 1UR1A 1VBUA 2XVGA 5LA1A 1AQMA 1W9DM 3BCDA 4XB3A 2E0PA 3W4RA 2DSWA 4MB4A 1CXKA 1V3MA 1W1YA 1V3JA 1V6UA 1UQZA 3W29A 4H8VA 3AXXA 1PIGA 3WFZA 1HVQA 4E2OA 1H11A 3W27A 1C91A 4PMYA 4PTWA 2WYSA 3CZ8A 1W2PA 2YDQA 1QI4A 3AFBA 3CLWA 3AHTA 2BY1A 1J0JA 2DIEA 3QHOA 1OWQA 1CGTA 1UWUA 3GBDA 5I79A 5TD4A 1JZ3A 5BXRA 4MDOA 2D24A 1KWGA 5I5RA 1ZU8A 5C8BB 3RPMA 5A6LA 4EANA 2CBJA 3B9EA 1A3HA 1MXGA 3ZO9A 1QNRA 3EYPA 2OLHA 2W61A 3THCA 3QGVA 3MUZ1 1Q6EA 1C8YA 1H1NA 2XUCA 1VEPA 4KGJA 4UR9A 3GNRA 2YLLA 5I77A 1S46A 4J3TA 1AQHA 1UR9A 1US3A 1XYFA 4KMQA 2ZXQA 1MVYA 1LL4A 4QFUA 3HMCA 5D4YA 3FNDA 5I2UA 4GO9A 1XV8A 3NCOA 5HPCA 4RL3A 3VIMA 1UQYA 5IHRA 2XM1A 1ISZA 3W25A 3MV01 1TVPA 2XVLA 4GZIA 4GQRA 3T08A 3NIYA 3UCQA 4HPHA 4PSRA 5ABFB 3OA5A 2Y24A 5BXTA 3VGFA 1TMQA 2W66A 4CU8A 2D23A 4B15A 1CDGA 4UOQA 1KXQA 4HA4A 1JG9A 3AZTA 5JIWA 4JL1A 1K6AA 2DSKA 5CLWA 4P7OA 1RP9A 4UZSA 4B3KA 2QLYA 4JAWA 3WUFA 1V6XA 3A4WA 5A8PA 1TE1A 1WZMA 2EQDA 3W38A 1E0WA 1B0IA 1WAWA 2A3HA 1Q6FA 3UERA 5D8WA 4PTXA 4YHGA 1TA3B 2CHNA 5CSUA 1JZ2A 5C71A 3TTYA 1NP2A 4BA0A 2JFEX 4HMEA 3VIFA 2VZTA 4M29A 4D1JA 4D71A 3ZT5A 1QI2A 3QR3A 3WQ5A 3ZR5A 3LPFA 1TVNA 5HXMA 3BSGA 1HKMA 3NJ3A 4W86A 1KQYA 2DSUA 3MO4A 3M07A 4A3YA 2X09A 2J7DA 2PBOA 4WF7A 4XV0A 1B2YA 3OG2A 1WDQA 3VMPA 3W24A 4CD7A 3W53A 4CKQA 5CPQA 3AIEA 1JDCA 1JYNA 1HL8A 5A6BD 1U2YA 5ABFA 4C7FA 1H2JA 1HF6A 5AYIA 2XFYA 4D6HA 5CGTA 2GJXB 3N13A 1WE5A 2AAAA 3ALGA 1BYBA 5A6SA 1J0ZA 5GNXA 2PI6A 3U7VA 4TX8A 1E1EA 4OZOA 4W7VA 1OSEA 3SUTA 3WD2A 4AXNA 2JEPA 2YJQA 2ZUNA 1BVZA 1UKTA 3IJ7A 2G3JA 4PBGA 3AQUA 3DHUA 4NRRA 1JNEA 1UD4A 3AICA 3PZVA 1EXPA 1XCXA 4H8UA 3WL1A 4HA3A 1W9BM 2PWDA 2WVVB 3NSXA 2JEQA 4UFIA 3T09A 2BNJA 4Z2IA 2MANA 2PC8A 3GH4A 5CPTA 1H5VA 3HN3A 3AHYA 3IJ9A 1R85A 3WEOA 2QV4A 3CHEA 1V0NA 1CXEA 3WH6A 3POHA 4JHZA 4AZIA 1HN1A 4KGLA 4Z2HA 1TCMA 4P8UA 2IUZA 3AIRA 3AIBA 1MXDA 3OLIA 3S6TA 2DSVA 3SCVA 2XGBA 3N04A 2WHMA 3ALFA 1JGIA 2FH8A 3MUIA 5A6AA 1US2A 1FFQA 1E6RA 1YQ2A 1HJVA 4DWSA 1NH6A 5D9OA 2ESCA 3N15A 1LWHA 5M5DA 5FIPA 2XSBA 4NF7A 2BHZA 1FH8A 3ARSA 4LYRA 1W91A 2EBNA 2W92A 3WDJA 3WL0A 1QHPA 2VO5A 1UWTA 5FKYA 3VDHA 3F5JA 4CU6A 3RJXA 3SCPA 1OINA 4JKLA 1GQKA 2WHKA 4DUWA 3PZMA 4TVDA 3PTKA 2CESA 2WBKA 2VTFA 2WVTA 3MUAA 4OUEA 3T2PA 4BF7A 2D3NA 4BQ3A 4W88A 5CJ5A 1E73M 4H2CA 4F9JA 1WCGA 4B9YA 2VZUA 1FHLA 2FDMA 1CXIA 2JF7A 1FA2A 3JUGA 3MANA 4Q7NA 3WSUA 1EQCA 1H41A 5JUVA 2WNWA 5ECUA 4MADA 3N12A 1KXVA 1QPKA 3KL0A 1H09A 1CGVA 1VIWA 1JI1A 4TTUA 3O6AA 4AD3A 1JF6A 1OD0A 2JIEA 3AMDA 4E4PA 3WN6A 4RE3A 1JZ8A 1DP0A 1TUXA 5GQBA 2CHOA 5JIPA 1K9EA 4ACYA 1CIUA 3AMCA 5A8OA 3RJYA 2VR5A 4AD4A 4W7UA 3T2QA 3VPLA 1ZB5A 1U33A 1H3GA 3MS8A 1HX0A 3GNPA 4W85A 3PN8A 3PZIA 6CGTA 5BRQA 1W9XA 2FHFA 2F61A 1DWAM 5E0FA 1MW1A 1I1XA 3WQWA 4A3HA 5BYWA 3GXMA 1VEOA 1FHDA 2OSXA 4AZ6A 4DWSC 2ZX8A 3VMOA 4JFVA 2DIJA 3IJ8A 1EDGA 8A3HA 1XHGA 4HU0A 1J0HA 2VX5A 3U7BA 1UUQA 5A6BA 2DT2A 2CXGA 4UZUA 1CLVA 1V02E 1J0YA 2VT0A 3VGHA 2J7HA 1SR0A 4M80A 1WDSA 3T2OA 3L2MA 3VNZA 1W3KA 5E6YA 2CEQA 3N11A 3AHVA 1QHOA 1O6IA 3VIGA 1DHKA 4WIWA 4PUDA 2Y5EA 1OGBA 3BAIA 1KGWA 3WF0A 3WBEA 1C8XA 3BC9A 5I23A 5JBEA 2J62A 2JIWA 4QLLA 1W3JA 1M53A 4GO8A 3MV11 4U33A 2YLAA 2J8FA 1EOKA 4ZXLA 3L4WA 1R87A 3KEHA 4E8DA 1ZBVA 3WF3A 4B9ZA 1PZ2A 1ISVA 2BVDA 4CGTA 1WZAA 3DYPA 3AIQA 1AMYA 1PZ3A 3WH7A 2A3AA 3SURA 1GVYA 4F9DA 3VOCA 2ZUTA 4L4PA 3CZEA 4AYSA 3PZQA 1UR0A 4H04A 4WLCA 3WUEA 3VKKA 3PTQA 4P8XA 4M8UA 4PMDA 4JKMA 3D3AA 2WSKA 3F5KA 3WNNA 2J25A 2DH2A 2GDVA 4PEEA 4U5IA 5BROA 3VO0A 1LLOA
chains in the Genus database with same CATH superfamily
1QWGA 3VCCA 3UPMA 3W6MA 3N4AA 3TK7A 5E0KA 1E43A 4J4KA 4FNUA 3CEUA 4NU7A 4A8IA 3F4NA 3VNIA 1AA1B 4CVWA 4FX7A 3DFSA 4F79A 2Z1KA 5FOOA 4Y90A 3NM3A 2XFWA 3HIJA 2ZRWA 2P3ZA 5I07A 1PWMA 2V69A 3V36A 1XLJA 2FJUB 3CO8A 1F8MA 2VEFA 4QDMA 3H26A 3FK4A 3NDOA 3G0XA 3SRDA 3BANA 3KL3A 3PAJA 2YYUA 2O92A 3AALA 2WM1A 3AROA 3O0KA 2QIWA 5FL0A 3W74A 1EYEA 5AHFA 4A2RA 1W17A 2VRKA 3V0TA 1W9UA 4GBDA 1P4CA 1PSCA 1HP4A 2WV8A 1J2WA 4WZHA 3N9KA 4NP7A 1POKA 3EWDA 1LF1A 3HGJA 4QDPA 1XGDA 4F2TA 3CMJA 4YWSA 2NQ9A 3OA3A 4AVNA 3RCYA 3PPCA 1TPEA 3U4AA 3VCRA 4MM1A 3TW7A 1D3GA 2EKGA 3A21A 3CHVA 5C9RA 4MY1A 3W7CA 5I00A 2I16A 3M0VA 2WWCA 2ZOXA 3R12A 1YEYA 1GTEA 1WB0A 1E9LA 3J7HA 6PTDA 3O2LA 5K2ZA 1L0PA 4KW2A 3ELFA 4WDUA 1OZQA 4JCLA 3ECQA 1UKSA 3K4AA 1LQAA 2ZX5A 5C2GA 3LHZA 1OIMA 5DCBA 1J11A 4CCDA 3GVVA 4UFJA 4Q8PA 4C6NA 2Q09A 1GQIA 1CYGA 5BWAA 1J0KA 3U5YA 2FZDA 1JFXA 3PB2A 3S2JA 2D22A 1ZBCA 1ALDA 4FNPA 1A5NC 4Q4PA 1TMHA 1GHRA 5FEPA 4HT3A 1FOBA 5F4WA 3FYYA 4HNUA 1HJWA 3IIVA 3WLLA 1OC6A 1X7FA 3R89A 4W87A 4ZXOA 2QUMA 2V2HA 1JYWA 2PWEA 3OEXA 3NQEA 4FA3A 3ZSTA 3IRSA 1RH9A 3AZRA 2CLMA 1QW9A 4I5UA 2RKXA 2XIOA 4G5DA 5EMMA 4UQEA 3A4JA 5DBTA 2EG8A 4W5UA 4QSHA 4UTFA 4NZ3A 4ML4A 2GVGA 1YYAA 1TKKA 3OU8A 1PPIA 2XSAA 4GJIA 3LRLA 1CXLA 4ERAA 4NZ1A 4I5XA 3PSWA 1UBSA 3EEGA 2D3LA 1AQFA 1C29A 2VEPA 3W7RA 4P8VA 3LXBA 4LVBA 1LOLA 5PTDA 2QVNA 5C2XA 5D02A 2NQHA 3KHDA 4JIHA 3KDNA 2C0HA 4HHHA 3BLIA 1PHWA 2XGIA 3PPGA 4FLQA 2ABBA 2F2HA 2YDSA 5HR6A 1YE4A 1NWUA 3FFSA 1TG7A 4ROQA 1P0EA 1MW2A 4EF9A 2A6LA 2DT3A 4S2BA 3SJ3A 4LFYA 2CLHA 3HTWA 4LH8A 4WDXA 2DDXA 3P0WA 2XIJA 1BTMA 5LA2A 5DY2A 3W1TA 3CQKA 1I2PA 3DI0A 2ZUSA 2DZSA 1Q6CA 1O95A 3VA8A 4GZJA 8RUCA 4XTIA 1OCJA 4NJJA 4Q3MA 2YFNA 5TQLA 3FDKA 5FESA 2QCNA 2QUNA 1FWGC 1W9VA 3KBMA 4QX4A 3PC0A 1WOAA 3WQFA 3O07A 4LJ3A 3APGA 4HQVA 1ITXA 2Z1VA 2QJGA 1IE7C 1ZCCA 4NJIA 4RNJA 3RNDA 4AWSA 2B7NA 3VXGA 4IISA 3E0VA 4IP5A 4JDBA 5HUPA 3WLPA 4BWLA 4ZZ9A 1GVIA 2GQAA 3H6OA 1UZ4A 4MLRA 1RJRA 4CU7A 3KTCA 4HNTA 4XISA 5HJLA 3OIHA 2J74A 1DJQA 1WDPA 3ORWA 1UR4A 2HTMA 2X0SA 4KWUA 4CNSA 3AU2A 3HJEA 4Q8QA 4OIFA 4GRSA 3I7SA 3RAOA 4QLJA 1DIKA 1SUXA 4OBSA 2E40A 1B4KA 4L61A 1A5SA 3UJSA 2V63A 2XHYA 3NOYA 1LOQA 5EB8A 3EBVA 4OBRA 3A12A 4O1FA 2FZ8A 1NARA 2ALDA 4HTYA 4AH7A 5BNKA 1VBGA 3KXQA 4G1NA 4C60A 4Z2GA 1MEIA 2HE8A 4LALA 3W84A 3OYZA 1R3WA 1PYFA 4AEFA 3GXTA 4C6QA 1TA3A 2GUBA 1EB3A 1DHPA 4JY8A 3TN4A 3W1NA 1Q45A 3SUUA 3WQ8A 4C6FA 3E1F1 2YL6A 4XZBA 2X7WA 1RUSA 2DH3A 2ZXBA 1VP5A 3URBA 3NQGA 2GWGA 1GVFA 4GIYA 4NZJA 1DE6A 3LPOA 1K4HA 4YJ5A 2AKMA 1CXFA 4RCXA 4BFAA 4DBUA 3HGSA 5FEWA 1ZBWA 1PKNA 1V6TA 3LB0A 3WK0A 3P8JA 4ATWA 2ACUA 4AIOA 1XW8A 1EOMA 3CWOX 3K8LA 3W81A 4UQ9A 2FGBA 3AISA 4W8AA 1YTDA 1OGGA 1VGAA 3BAJA 2Z2BA 4ZQMA 1A5CA 5HQMA 4DJFD 3F2DA 2F7FA 4JY9A 2OKOA 3W1AA 2X2YA 3C61A 4JHMA 3A22A 1LLZA 4PN2A 3GFYA 4W7WA 3K5XA 3UNDA 4W8LA 3FAXA 4L6DA 2WC4A 1QO2A 1UD2A 4WOZA 2A3BA 3UU0A 3N2OA 1Q2RA 2FJKA 1L9WA 3AC0A 3URNA 1GG1A 4F4RA 4EXAA 1E72M 1H62A 2ZRUA 4MAZA 2VCAA 4GQBA 3B8DA 1BEUA 3B3DA 3O6CA 1N55A 3NQAA 2BBFA 3CUGA 2PGFA 4PUWA 1UZHA 5GJNA 2WSYA 3FKKA 1WKYA 1V4YA 1M7XA 3ME3A 2Z0IA 4JS3A 4XD5A 2EJ1A 4PUUA 3HMJG 3HGRA 2VGFA 4JTKA 3OP2A 3IK4A 7ENLA 3FHAA 1MW0A 5EFFA 1XSIA 1GORA 1NWTA 1OK4A 1X6NA 1UASA 3EDDA 4IICA 3G24A 2Y6ZA 3HM7A 4IPPA 3F5LA 1XIBA 2GSHA 4DUXA 4MTVA 3W7IA 4LRTA 3QGKC 3WZ0E 1HJUA 2ZX7A 3NSMA 3I3EA 4MZ1A 4GFSA 1OD8A 3LEPA 1WA3A 4PGLA 3VCNA 2G3FA 2WMFA 2HVOA 4RW5A 4PE8A 5D2TA 3EOSA 2PDKA 4FNSA 1BKHA 3FEMA 2OELA 4GVIA 4GYKA 2G5WA 3QLDA 3IIXA 2J13A 3VX0A 3IV8A 4IUOA 1J9YA 5DX7A 1NWSA 1TTJA 3N4FA 5JXQA 3G77A 3GIYA 3I7QA 3H8AA 2DVTA 4XTDA 4KBXA 4MG4A 1EP3A 4M0XA 2DUAA 3NSNA 4AAJA 5JBFA 3TQ0A 4DJFA 3G1SA 1Q4NX 1GCYA 5HJXA 2E25A 3GTHA 3GVQA 4JTGA 3WH8A 3TJIA 3T81A 2WOQA 4G7EB 4DLMA 4GQQA 1SO3A 4TO8A 1TPUA 1B9BA 4HOWA 4C6MA 4LF1A 5DFAA 4U31A 1W1B1 4DPPA 4LNCA 1AZ2A 3MMTA 1AZ1A 1YDVA 1UZDA 2PWGA 2Y7EA 4LRSA 2NV2A 2CLFA 3UPBA 1XINA 4HIBA 1NIUA 3QN3A 3MA8A 1HL9A 3GZ3A 1WNOA 3TQVA 1H61A 4R3UA 3ARQA 2BV9A 5A6MA 4XKMA 1ZJBA 3O63A 3BWWA 4AZ7A 4RZ6A 3BJFA 1E6PA 2E5CA 2GVYA 2IKIA 2VEGA 3M7WA 1QOQA 4L7ZA 4UOJA 2GJXA 3D3FA 2W67A 1QFEA 3FYOA 1S5WA 1HO1A 3GVGA 3WNLA 1V0MA 3HQOA 3WMBA 5E0CA 3BZJA 1JULA 4LCRA 1QW7A 3MWCA 3S1XA 4Z2KA 3DYOA 1HTIA 4A22A 4MWAC 2J77A 1OF8A 2HXUA 4J2MA 1WQ5A 3DFQA 4TQTA 2V3GA 4B5UA 1TJ1A 2G0WA 4ZODA 1VB9A 1VJZA 2CLEA 2B7PA 5D9MA 3RGTA 3BE7A 2PTXA 3P5ZA 5F7UA 1OYAA 3LXCA 4B90A 4GIAA 5RUBA 2EPOA 4IG2B 4QJ5B 2YBTA 5CBIA 4PMNA 2GQ3A 3PANA 4QEEA 1ODZA 3GXPA 2XGZA 4LWWA 4TMCA 4MB5A 3H24A 4I9AA 2DZPA 4LC8A 1Q7QA 3NDZA 3GVRA 3A23A 5I7GA 3UG5A 3HA1A 3O6YX 1QI5A 4M1BA 1XLCA 1V77A 3W1LA 3G8EA 1KM3A 1OFQA 5AYBA 2B4GA 6XIMA 4Y8EA 4XD3A 3MCNA 1C9WA 4LANA 4Q8WA 1PKMA 4N42A 1E0TA 4PYSA 3RPTA 3CB3A 5ABGA 1OF6A 3DFYA 3VKCA 4C6OA 4J40A 3G8RA 2G41A 3O15A 1BRLB 3H4XA 3VK5A 4XUYA 1TV8A 1A5LC 3NL2A 4WJXA 3STGA 5CSSA 1OZMA 3LU2A 2YCKX 4KIRA 4DWDA 2ZWZA 3MC5A 5CZ0A 3OIXA 2DT1A 3CL7A 3REQB 1UZ1A 4HNLA 4O8AA 2HISA 4E2VA 4FOKA 2VMFA 3IJLA 1TIMA 3FKRA 2ZX9A 3WELA 3E6EA 4LAUA 4MAVA 1A0DA 4KPLA 2CZDA 2O9TA 5AC4A 4QITA 4ROPA 2QNEA 2BTMA 1UB3A 3H7VA 2FH6A 3WDPP 2ZZ4A 4XAFA 2XIIA 4CUCA 3VKAA 1R9XA 1VFSA 4EPEC 1AL8A 4FEZA 3M0LA 1A0EA 1HXJA 5DRIA 1RA0A 1FKWA 1SGJA 3M64A 2DZAA 1KFKA 2OEKA 4PMXA 2X0HA 1DEDA 4GI9A 9CGTA 2PMQA 2R9RA 3MKCA 3WFAA 3K1DA 3WD4A 1M01A 3M44A 4WXYA 2QAFA 1JYXA 1IT7A 1RBLA 3A24A 5C54A 1XLBA 5C9XA 4OTKA 2PU1A 1CPUA 2D2GA 1PTGA 3G18A 1J0IA 4H8HA 4QRNA 3VGGA 4XAZA 4HPNA 4IG2A 3PJXA 3LQLA 4GNVA 1SJBA 2RGMA 2P10A 3MSYA 3KCLA 1FWDC 1EHNA 1PS9A 5A95A 2XINA 4GZ7A 4K8HA 2WAGA 1TX2A 5GVJA 4NUWA 1WXYA 3VE9A 2P8BA 1MZHA 2I9EA 4Z0JA 1VCVA 3W71A 3UEQA 3KRZA 1HGYA 1QI0A 4XBKA 5EMKA 4LCQA 1XX1A 2IPFA 1Q8JA 5CPNA 4D8ZA 1X8FA 1PKYA 1EF2A 2OYMA 3K2GA 1GHSA 5AC8A 3UD6A 4HZ6A 3W0KA 3KP1A 3STCA 3EWXA 3OG3A 3S8HA 2CFFA 2E8ZA 3VD5A 3H2EA 2H3BA 1EZWA 1UA7A 1CENA 1GZGA 4A8RA 4QE4A 4DPQA 3OW1A 3WNPA 1SJCA 5D8ZA 3U0HA 2NWRA 2DZVA 3RK8A 3LBCA 1KLZA 2QJHA 3GHRA 1ENUA 3AIWA 1ISYA 1ME7A 1KFEA 1ZENA 2WNQA 3P6LA 4L65A 3QFEA 5U7SA 4O50A 4B4HA 2V38A 1ICPA 2XVKA 2PUZA 4NSBA 1XXXA 1P7TB 3DZ1A 2VX7A 3AIVA 3HJZA 3WDHA 4ZQOA 5CLTA 3GS6A 2PLMA 1RA5A 2P88A 5IBXC 1GPFA 4HCHA 4ADTA 5LNUA 2E28A 1P6WA 5CPLA 3W7PA 1KQZA 2IPJA 3SEPA 4Q7BA 4S3GA 3VUPA 4AZBA 4AHPA 1E1FA 4MMWA 3VYLA 2G50A 3E12A 2I1OA 3H7RA 4PBEA 4QG6A 3ITLA 4ZFCA 4DJDC 1GOQA 2J7GA 3NNTA 1PUDA 3KFTA 3BH4A 3WLRA 2YL8A 5FF3A 1WXZA 4TXEA 1SO6A 4ZOAA 1JYVA 1IGSA 1QHZA 1RHCA 3SO7A 3CGTA 4WKAA 1UMYA 4HYWA 2KX9A 3L12A 3S9ZA 5AYYA 2POTA 3CAKA 4HYRA 3DKJA 1S2WA 1V8EA 3PWAA 3MZ2A 4ZE4A 3N6QA 5C7HA 4HCLA 3NEHA 1ZAHA 3UR2A 1FX6A 3VGEA 1HKIA 2J66A 1FWJC 4UTUA 1OCNA 4C6BA 3K8MA 1DJNA 2WSRA 1V3KA 4POCA 2D2OA 4ENLA 4QAWA 4PCTA 4H8NA 4AD1A 3I65A 1TPH1 3OO2A 1O5RA 3AU6A 2XWEA 4ICNA 4GVFA 1RY0A 4E8GA 1DWHM 1UWRA 1UC4A 1V6VA 4NRSA 4PMVA 3WUGA 4PUEA 2FTYA 1AG1O 4F0KA 2OCZA 3S9IA 4QDWA 1VD6A 4PRTA 4WXZA 3S1WA 4AD0A 2WZTA 4PCNA 4AEEA 4WK9A 4GX8A 1Q6LA 3EZ4A 3CTTA 3FAWA 1S5MA 3ID7A 3AI0A 5D04C 3WF1A 1LWIA 4FP1A 4BY3A 3W02A 2Y63A 3OVRA 1RPXA 3AS1A 3A64A 5TAOA 1FTXA 2YXOA 3FOKA 2QGYA 4UTMA 4CD5A 1PAMA 3KVJA 3UJFA 1RVKA 3BOXA 3PBUA 4CN4A 2CYGA 1G4PA 2VC5A 3L0KA 4C7GA 1RBAA 1H4PA 2GUYA 1F5ZA 1V6YA 1MW3A 2R91A 3DUGA 4CD4A 2G3MA 3ONCA 3CZLA 2EPHA 1XLFA 1J6PA 1V0KA 3W26A 1XS2A 3WDRA 5LYRA 1E40A 2QGHA 4N9EA 2OEJA 4B5TA 5KETA 4L1GA 3TWBA 4CCEA 2QDEA 4QJ1A 2QQ6A 3KLKA 5KTLA 2SFPA 3W6YA 3XIMA 3RDKA 1QBBA 2X2GA 2XH2A 1XISA 2YL5A 3R25A 1FDYA 2PDCA 4FIRA 4D6FA 3GE7A 3WDIA 3ARYA 1J18A 4B3ZA 2CETA 2TAAA 3KRUA 2WWDA 2ACSA 1UUMA 2IXVA 1M9HA 2O9RA 1E71M 4KFPA 2DIKA 1XBYA 3LV5A 1AQMA 3BW2A 3U3HA 1M5WA 1TJ2A 3TDFA 2G95A 4MB4A 4J5NA 1CXKA 4XSMA 1V3MA 1V3JA 1KRAC 1PIGA 3K13A 3SY8A 1Z48A 4I8YA 3W27A 4K6AA 4PMYA 4QG8A 2PE4A 4PTWA 1LORA 3CLWA 5HNUA 3AHTA 3DH7A 1J0JA 1J8VA 3IGXA 1OWQA 1W5PA 1UWUA 5REQB 5BXRA 2BASA 1SW7A 4MDOA 4E4FA 3GAKA 3GFZA 3H2AA 4ORMA 3SRFA 1FCUA 3PWIA 1MXGA 3O05A 3TSMA 4LVDA 4A3RA 4U4MA 1R9ZA 4NYUA 6REQA 2X7VA 4UTLA 3AXMA 5LGZA 3QGVA 1R2SA 3VE7A 4KGJA 2DVUA 4JIQA 2YLLA 4KEZA 4E2DA 5EMJA 5I77A 4O28A 3TN5A 3NQVA 1GVSA 1MVYA 1WDDA 4LF2A 4JYFA 3HFTA 3Q45A 2XM1A 3W25A 3ATZA 3MV01 4XAYA 1MO0A 1L6WA 1L8PA 4PSRA 1EJWC 3VOGA 1NFGA 2Y24A 1XRTA 3VGFA 4S2CA 2QW5A 2BOGX 3ZWSA 1OK6A 1JG9A 1XG4A 3GTXA 3Q2DA 3AZTA 2DSKA 4U28A 2X1TA 4G2DA 4JAWA 2NUYA 2OMAA 2Y7DA 2PDIA 2CZ5A 4HKPA 1E0WA 4GE8A 1KM0A 2A3HA 1Q6FA 2JBMA 4YHGA 1DXFA 3C8FA 1BKSA 2GPTA 1IF2A 4BA0A 2PRHA 2C16A 2VZTA 1FWSA 1JRCA 1QI2A 3QR3A 3HPAA 4RNIA 3LPFA 1TVNA 5HXMA 3D0CA 3CPRA 4W86A 2IQ0A 1KQYA 2DSUA 1RALA 3MO4A 4OHQA 3QY8A 5C7VA 3LERA 3W24A 4MWAB 4AFYA 1VCFA 4CLMA 5CPQA 1JDCA 1HL8A 1ZLPA 1SJDA 3GG1A 1EF3A 2FPYA 2NX9A 2XFYA 3C5QA 5CGTA 4O53A 4QXIA 1WE5A 2AAAA 1XIHA 5JQ9A 4WGHA 4CQ8A 4DVOA 3U7VA 1U1UA 1RK5A 4OZOA 2ISVA 3SUTA 3WO8A 3N29A 2JEPA 1UD4A 1GOXA 5EMUA 1EXPA 1XCXA 2PWDA 2WVVB 4HA0A 4F0HA 2ZVIA 1POJA 4Z2IA 2F6XA 4DYKA 1R85A 3WEOA 3CHEA 4OBTA 4L56A 2PP1A 1IEVA 1AMKA 4KGLA 1TCMA 1UIOA 3MHUA 1S1RA 3W2LA 2OODA 5F2LA 2XGBA 3SQLA 2AL1A 3W3OA 4M3PA 3MUIA 4ZQNA 1J79A 1US2A 2RJGA 4H9TA 1E6RA 1HJVA 2DFAA 5D9OA 4PL2A 5I3FA 2BHZA 2B7QA 4WJEA 2PRMA 2YW4A 2E1DA 1P0KA 1QHPA 3VDHA 3P84A 2PEVA 3C4UA 1EWDA 2WHKA 4TVDA 2CLKA 4PODA 3M0HA 2GOUA 2VTFA 2PRLA 3LGEA 4NX5A 4OUEA 3T2PA 2D3NA 5KITA 1PYMA 3Q37A 5CJ5A 4B9YA 2VZUA 3P82A 3OZYA 2JF7A 3TYCA 1UBPC 5GJMA 4GNKB 3MCMA 3WSUA 1EQCA 3AYTA 5JUVA 1XLHA 2GQ9A 3AWOA 3ITVA 4MADA 5HMFA 1F8IA 4RR4A 3PWGA 1KXVA 1QPKA 3W83A 1IEXA 1JI1A 3DESA 4HN8A 2I57A 2Y7GA 1JF6A 2JIEA 5HMSA 5M2FX 1HGWA 1AJZA 4E4PA 4RE3A 1DP0A 1TUXA 1XCFA 1K9EA 3BG9A 3RR1A 2AQOA 4Y9AA 3UWVA 3AMCA 5A8OA 4ZMGA 1W54A 4KFNA 3BW4A 1XKJA 3EOEA 1OYCA 3DFHA 3M47A 4HHMA 3T2QA 1IT8A 1U33A 2FYMA 6CGTA 1TTIA 2XH4A 4C6IA 2ONEA 1A80A 3ZVHB 1QPOA 4CNTA 1YDNA 4A3HA 3NQDA 5BYWA 1FWHC 3TFXA 2VC6A 3HPFA 3GO2A 5F2MA 3RO6A 2IQDA 1GYMA 2DIJA 3R0KA 2OOFA 4YVPA 1J0HA 2A0NA 3RUBL 3I10A 3IJ6A 4C6PA 1G67A 1CLVA 1J0YA 3S3GA 2MNRA 2VT0A 3KBJA 2OXNA 2QUTA 2J7HA 3VNZA 4Z42C 1W3KA 2CEQA 3AHVA 1KA9F 4M6QA 2PDBA 3SZ8A 3LLXA 1XLDA 3W22A 3RU8X 4LS2A 3B8WA 3IVTA 3GR4A 3BC9A 3ZLHA 1KTCA 4QLLA 5B7YA 1DJIA 3VKDA 4GCXA 5HQLA 4ZXLA 3T8QA 2DORA 1PZ2A 4UUIA 2BVDA 4ZOEA 3DYPA 1PVNA 2Z7KA 1PZ3A 3SURA 3TMLA 5T9CE 4DI8A 3MHGA 3VOCA 1WUFA 3WG6A 3FYPA 1I0BA 4IJBA 1UR0A 4H04A 3W1XA 1W31A 2HBXA 3W75A 3LCHA 3D3AA 1XG3A 4MPQA 3EB4A 5BROA 4RDWA 2DV0A 1W32A 1QASA 3IANA 4LYQA 3LLDA 4I6KA 3TTQA 4ACZA 4E2BA 5AYXA 3GRIA 1T41A 2QJNA 4M19A 3WNKA 4GIRA 1R3SA 4WDWA 5BW6A 3M0MA 1P6BA 1VC4A 2HNHA 2TPSA 1KM2A 3W2UA 4J7RA 4FS9A 4A4AA 5AHIA 1TV3A 4YVXA 2D73A 4UTWC 2FGLA 1UPPA 3BARA 3NYZA 2WVVA 1BGGA 1CEOA 3QW4B 1HQTA 3PSVA 1HKKA 4I9JA 1W1A1 2Z4GA 1ONRA 4M56A 1JPHA 2D20A 2VFFA 2A79A 5DMYA 3IV3A 4UCGA 3P74A 1O1ZA 5EFDA 4H9UA 1E70M 3BK0A 4JTIA 1XUUA 4PH6A 2QT3A 3EGJA 7CGTA 4DEFA 2R1KA 3CASA 1L6YA 1SYTA 1VRXA 3VI2A 2C8NA 1D8CA 4V33A 3DHPA 2IKJA 3PUEA 3WY1A 4N2YA 3GXDA 4DJEA 4PULA 1BG9A 1WZLA 3TNOA 4J2PA 2F9RA 3QXBA 1MFVA 2NW0A 1I1WA 1F6KA 1X6UA 5FF0A 2VP8A 3I6TA 3WQDA 2PBGA 4EACA 4IP7A 1DJWA 5HANA 2G3IA 2PDHA 2A3EA 3GDRA 2BOEX 1Z9AA 1TO3A 1EJSC 2XWDA 3DIPA 1Q3NA 1UR3M 3M7SA 1GYNA 3GH5A 4M6UA 4MFDA 1JL8A 2XVNA 1LOSA 4N02A 4P7NA 2Q3OA 3LENA 3C3UA 2IKHA 4REQA 3UCDA 3EWWA 3TP4A 2FB2A 3MP5A 4K1WA 1PDYA 3TR2A 1X6LA 4PRWA 2XIBA 1OY0A 3LTPA 3LA4A 3FIGA 5EBUA 3TAOA 3TNBA 3CT2A 3UZJA 4R5EA 5H1WA 3NL5A 3KL5A 2JKPA 3ZM8A 1M7PA 4XBSA 2E6YA 1ZQ5A 4IPIA 3SR7A 5BU9A 2ZADA 3L0GA 4GI8A 1G7VA 2VEIA 4IGNA 4RZ4A 3JW7A 1ZP4A 1IWPA 2Y8VA 4FXFA 5LHEA 3NUKA 4YN5A 3DFOA 4MZYA 4NIRA 4X22A 3N6HA 4AB4A 2PTZA 4QE5A 1RQBA 4QCFA 3M0KA 3AOFA 1RZMA 4TUFA 2RDUA 5DEZA 3VUSA 4M81A 2ZRYA 1LUCA 1W3HA 1BSIA 2FDSA 1A5AA 5EBAA 2BVTA 3TAKA 1CLXA 1ZCOA 2DUZA 4XZNX 4N6FA 4LAZA 2BGNE 3P3BA 2VOTA 3IAPA 2WVUA 3OBAA 4FOJA 1W3NA 3GDBA 4JQ3A 1X97A 3IUHA 4O1EA 2WKJA 5A8GA 3LOTA 3MUY1 3PBVA 2ZUVA 4GINA 2Y89A 3W7OA 4XAGA 4PR4A 1YPXA 3BMXA 3S4TA 4KEMA 4XWUA 2WHJA 4EK7A 2Q8XA 5HJYA 4HSOA 3AHZA 1C92A 1YNYA 4FR1A 2PTYA 1KKOA 1GZ1A 3PK7A 3R8GA 1WOBA 1DXIA 2WZIA 4KCTA 1TV5A 5AB3A 4JKKA 3GKAA 3MPGA 1W5NA 4D6CA 2ZWYA 1UCWA 1H0IA 2TODA 3INPA 3ZJ7A 3SB0A 1Z7AA 2PWUA 3K46A 2A3CA 1DJXA 4LGXA 1FHVA 4UQBA 1VFLA 3MVTA 3OLGA 2C7FA 1LP6A 1XCWA 2Y85A 4X60A 3A47A 4TOQA 2GDQA 2G3NA 2R6OA 3ABZA 1Z6KA 3VTRA 1IXOA 2H6RA 3K1GA 2VWTA 4S39A 3P81A 2E9BA 4GABA 3R94A 3F03K 5M17A 1Z41A 4A8NA 5LZLA 1E0UA 1EDTA 5A8MA 2JKEA 3UJ2A 3KOFA 1CGUA 1MEHA 3LCLA 3BGJA 2OQLA 2JF6A 3ZIZA 2HCVA 4BI7A 3SCRA 4OFCA 3IIZA 3UWEA 3KZPA 2I7GA 4XD6A 4LW7A 4ONVA 2HPMA 4NZFA 5GNZA 4GY0A 1V03A 1JZ6A 4ZO6A 4V27A 3P14A 1H7WA 1LZOA 4H41A 4IX2A 5FJPA 3W7HA 2PCQA 3ZQ9A 1FCBA 1EPVA 3WMCA 3F1QA 1CGYA 4GUIA 4ZQRA 1E3ZA 4IL0A 1CLKA 5DANA 2Z29A 4J27A 1B3XA 2EPKX 3TQKA 4FNRA 3OVGA 1QPRA 3W76A 2XN0A 1X39A 1OIFA 2WMIB 4ZEPA 1OB0A 1TJRA 4PSPA 4V28A 1GOKA 3ZR4A 2DT0A 1S2AA 3VOJA 2HS8A 2VC9A 1UKPA 3C2FA 3B9DA 1WBJA 5TIMA 4H3DA 1YMYA 1WV2A 1JIBA 2E4TA 4KIEA 3W7DA 3QY6A 4MWAD 3OHIA 4KKXA 3P0XA 3M0XA 1KM5A 1JXKA 2XFFA 1HT6A 3CUHA 2BVYA 3TONA 4QR6A 1TB3A 1TPC1 3NL6A 5EPDA 3OPSA 3KX6A 1NAL1 1M03A 4CN6A 3N18A 1OJXA 3VFLA 1Y7VA 3D5HA 3OGVA 4NI3A 4UFMA 1EP1A 3UYCA 1U83A 4D2JA 2OSWA 1K7EA 1FP8A 3NZRA 3QHNA 4K8EA 3THAA 3KVLA 4MYAA 3T4WA 5D30A 1G5AA 3VAVA 3UT0A 3UR7A 2QDHA 1W2VA 3H21A 4DELA 1E4IA 2JKAA 1XYLA 5M03A 2QHAA 2OX4A 3S5SA 1ONWA 1IXNA 4E8CA 4N4PA 1GT8A 1XD0A 2WJFA 3W07A 2Z25A 2IPWA 2HVMA 1MRQA 1MZRA 4QGCA 4UTHA 4R34A 3LM3A 1YXYA 2J79A 1C9DA 4L9XA 3PTMA 4L5ZA 3RO8A 1U1HA 1O68A 3M1ZA 3PBGA 4K37A 2Q6ZA 2I14A 4QCEA 1T40A 2FHCA 3HG4A 1ME9A 3CYJA 4AG0A 5BOOA 5D33A 3VABA 3EPNA 3SCSA 5I0DA 1OHLA 1X96A 1IV8A 5CG7A 4IQDA 5AC5A 1OVDA 2RDWA 2PA6A 3SCUA 4G6CA 3U48A 4YNGA 2PDYA 5IXEA 2XTKA 4EF8A 1XLEA 4ZB5A 3ZLGA 3WF4A 3AXHA 3KDOA 2ISFA 4S3KA 2HEJA 1KXHA 2TSYA 3V35A 5CSYA 1P6CA 3U4FA 2AGKA 4AZ5A 2V5DA 4AISA 3GNOA 4CVUA 2Z2UA 1YTKA 3BMWA 1JCJA 1AQ0A 3NL3A 3SI9A 4FIQA 4HMDA 5K4XA 1TE6A 2R1PA 4KRUA 4UFKA 4J3WA 2X0YA 4S3JA 3ITCA 1BRLA 1W8GA 3CEPA 4GJ1A 2OGYA 4Y9NA 5DRCA 1J10A 4JFSA 4G7EA 3VIOA 4RE4A 3WQVA 3PFMA 4D8AA 3NQ8A 2E6DA 3CQHA 1DJYA 4B5XA 2NT1A 3T44A 1J01A 3VC5A 4IWWA 2ZZ5A 1ZS2A 1LG2A 3WQOA 2WSPA 3UPWA 3B0VC 4H9VA 2YCLA 4HMCA 2GGGA 3WQ4A 1V51A 1AH4A 1G01A 3U2ZA 4PC8A 4JYEA 3TTSA 1XIIA 3LN3A 5T8GA 3SN0A 4GQ0A 4YYCA 2XYLA 4GUFA 1RY8A 3W1RA 3CU2A 1FWIC 3CAWA 3CIVA 4EPBC 3G6MA 3DG3A 3ZJ8A 4MNJA 1XDLA 2GDUA 3OVPA 4R9XA 3Q58A 2WMGA 2P8CA 3NYDA 5DN1A 3HG5A 5LKYA 4F2BA 3IAQA 2VOMA 4L9YA 1M7JA 2E5BA 5DF0A 5C9UA 4WSKA 2C13A 3RMJA 4O57A 4M51A 3IARA 4C7DA 4DO5A 1OFDA 3CUFA 4EIVA 1OABA 3NWRA 1R2TA 3ENLA 3CUXA 1FCVA 2I5IA 3CM4A 1L2UA 3A13A 2ANUA 4IQJA 3S5OA 2EPNA 2VRJA 1W56A 1TZZA 3I68A 3KWSA 3PNUA 1R7AA 5HOSA 4EWJA 1KCKA 3QOMA 4DJEC 1RD6A 1CGWA 2J47A 4F0SA 3A5VA 3P62A 3TUUA 1XFBA 8CGTA 1SQ7A 3WJSA 4DUVA 1PHQA 3DECA 1BLIA 5IBXA 4K36A 3IGSA 2VI0A 4I9MA 1ADOA 3GIQA 3PZOA 3HBLA 4JYDA 4L6HA 4DWSD 3MQTA 2HZGA 4ASTA 3BXWA 5K9XA 4MB1A 1E55A 5L6UA 4F0RA 3AS2A 3CAQA 3V16A 4MJ2A 3EMQA 5E70A 4AW7A 4H7VA 4P7RA 1CW2A 3RYSA 1V02A 1A5BA 2XN1A 1KM6A 4QJ3B 3MMWA 4MJ4A 4BHYA 1H60A 1LYXA 2YA2A 2YKKA 3WBWA 3UWZA 4K39A 3R4IA 1A5MC 1IXPA 5KINA 3W85A 4LEFA 3B06A 3ZYZA 3GK0A 3UJRA 1LL6A 3UWUA 3S1VA 3H2NA 3AYRA 1EH9A 3MP4A 1OFPA 4JTFA 1JDDA 2PGWA 5IOBA 2OO6A 4Q8NA 2F6KA 3KRSA 3MMUA 2YBUA 3DG6A 1R3TA 3SDOA 4K68A 4AZHA 5KEZA 1BF2A 2C3ZA 3R79A 5E93A 5BMWA 1TVLA 3SIZA 3L4XA 4D9PA 2O9PA 3W7NA 1NQKA 1MNZA 1K8XA 1B4EA 4FLOA 1UOKA 1BYCA 1IHIA 2VFIA 5E6ZA 4HBKA 3CMGA 1FVPA 1S38A 1OFEA 1CZ1A 1Q66A 3V5CA 4F66A 3NVTA 1DKWA 1ZGDA 3VOIA 3DYMA 4GH1A 4M1RA 1FDJA 1LM1A 2BLEA 3T0BA 1VKFA 5MKGB 5A6TC 2UZ9A 3E0FA 1TPWA 2WB5A 4DXVA 1VLIA 3AYSA 5CC6A 1C7TA 3LGGA 1EBHA 1VFMA 4NT0A 1J5SA 5HDRA 2YL9A 4LSBA 1B54A 1YLVA 2KZHA 3EWCA 3PNZA 1KFWA 3SFKA 4AWEA 4JTJA 3L2IA 4IPLA 4EOUA 4JL2A 3GDTA 3OZOA 4EXQA 1XDJA 2I56A 3B9OA 3T42A 1HUVA 5DY3A 4FLSA 3PZUA 1JXJA 3U2EA 4NNBA 2ZIDA 4HB7A 3S2CA 3VILA 3DDMA 3KLLA 1NOWA 4NASA 4UTJA 3IJQA 4R7OA 3NO3A 4AD2A 2FZ9A 5EA9A 2J7CA 2V5BA 3II1A 2EEXA 2VVNA 4P8WA 1Z69A 2FB3A 4INFA 1V93A 4JX4A 1THFD 4AXKA 4X9SA 2NZLA 2CPUA 1TPFA 3RXZA 1X38A 4D6GA 3UWQA 5FI8A 1Y65A 1VEMA 3EOUA 3TIMA 5CAKA 4DZAA 3EOLA 3LMYA 1CCWB 5HMEA 2BY3A 3FDGA 1Z44A 4GZEA 2O55A 3KHJA 3IVUA 1Z3NA 3PS7A 3PJTA 4FZIA 4N4QA 4R27A 3BDKA 1VPYA 1S39A 2C15A 3ARXA 2NVDA 1HL2A 3SCOA 1NJJA 2CKRA 1QMLA 2IXUA 1P0DA 4BI6A 2QIIA 3GXNA 5HNNA 4PB4A 3ZWTA 1EFZA 1PX8A 2XISA 3WK2A 1WDRA 2BS9A 3LCFA 5T9BG 1JAKA 3LBMA 1BXNA 2DW6A 4OJYA 1QU4A 1HVXA 1A53A 2PPGA 4HSHA 1ZY9A 3K30A 1SVDA 3CIWA 3A4AA 3BV7A 3ITTA 1BXCA 3W1UA 3CYVA 4MDPA 1GJPA 1VJSA 5CXPA 2DZUA 2B7OA 5AC6A 2GK1B 3AO0A 3RCMA 4J3UA 4B92A 3QF0A 5KZDA 3WLHA 5H2ZA 3COTA 2PDWA 4OOUA 1NU5A 5AN7A 4MLJA 1HFBA 4OKDA 2VJXA 4FAMA 1W3TA 3ZT6A 1WYIA 3GU9A 1W1TA 3UWYA 1UH2A 2VC7A 2J78A 1AFSA 4UTTA 2BHUA 3PG8A 3N4EA 3FV9A 5K7JA 4AD5A 3ANVA 4LOCA 3MY9A 1DWFM 1KBKA 5FF4A 3OB8A 4DZ5A 2I5QA 3RCNA 3VDBA 2ZC8A 2PWHA 4A29A 3EDEA 3B05A 1RJQA 2CLLA 4MNKA 2ZXDA 3UY7A 2V6AA 4S3EA 1WX0A 4FHAA 4PBFA 4HPGA 4I9TA 3E3HA 2XZ9A 2EPLX 1XBXA 1OM0A 4K2SA 3KOYA 4X0VA 1EC8A 3BQ5A 3ZT7A 5A8NA 3FVMA 3B0XA 4BI5A 4MGGA 2AGTA 2F6UA 4QS5A 3EMZA 1KCZA 3W7JA 4F48A 2RH9A 1S3TC 2G37A 3QYQA 5A1AA 5J8LA 3CQJA 4XD4A 1X1ZA 2GZXA 1B30A 1UA3A 1UD6A 3WD0A 4IX0A 3OZPA 1KBJA 2GSJA 5GNYA 1QNQA 1MYRA 1PBGA 4UMCA 1E9YB 1IGWA 2QMJA 1A3XA 4ZA0A 1E5JA 1EO5A 1V3LA 1LWJA 4GKTA 3C0QA 2RGLA 5MF5A 3SUWA 2ZZ7A 3LNPA 3UG3A 2VQUA 3MP3A 3TN6A 1L8NA 4MIMA 1ZPTA 4NQ1A 1E51A 1TZ7A 2PD9A 3O1NA 4JEQA 3WBXA 3B0PA 2IW0A 3G2GA 3RLVA 3F7JA 1XYMA 4BZYA 1EX1A 4PA8A 1ODUA 3NQFA 4YTTA 1GEHA 5HK4A 3KBWA 2NQLA 5FJRA 1D2KA 1QT1A 4V1YA 3T0CA 2V3EA 4MOZA 3WH9A 4LUTA 3TXVA 1JDAA 2WLYA 3KS5A 2RDTA 3QHMA 3V7PA 4DF1A 2Z2AA 4OV4A 3OODA 3RMEA 2CHRA 3RITA 1GQLA 4DYEA 3RFAA 4X9YA 1FCQA 1ZNNA 1NP0A 5E09A 3R5EA 3T9PA 1B3VA 1H7OA 2B31A 2DGAA 2C91A 3T78A 1BYAA 5A2CA 3L7RA 3HO8A 1ZP3A 3ITYA 2WKGA 1TUFA 2Z26A 5EGRA 4TTGA 3DHFA 3ZR6A 3V18A 3WD3A 2IMRA 2QUVA 3HB9A 4TU1A 2WK2A 1F07A 2Z6IA 4G7FA 3IUIA 5CJNA 3VD4A 2VDGA 4FR6A 4FXJA 4QISA 3V3WA 3H2MA 3URAA 1RLDA 5F1UA 4UC5A 4QG9A 3QM3A 1FWNA 1B3WA 1W1PA 2ZQ0A 2QUUA 3TEVA 3N25A 2BGQA 3ONBA 3RF9A 4D6JA 4JTSA 1KGUA 2P3EA 5LIYX 3S5YA 2AAMA 3M4HA 3BCDA 4XB3A 2E0PA 4I6VA 1TV2A 3W29A 4H8VA 1I2NA 3AXXA 3FEQA 2Y8UA 3ABXA 4RK8A 3ES8A 2P1FA 3QHOA 1RV8A 3GBDA 4CNNA 3M6YA 7REQA 1VYRA 2D24A 3P5YA 4NYYA 3R0UA 1ZU8A 3C2YA 4C1NB 3CK5A 3S2MA 1YDOA 5A6LA 4EANA 2CBJA 4GC4A 3UR5A 2CWNA 5LIUX 1JPIA 5I02A 4B5NA 3WK3A 1I0DA 2WQPA 1L6GA 3MUZ1 1Q6EA 2Z27A 4UR9A 4O11A 3GNRA 3CUZA 4IMDA 2E1WA 5ABTA 1VZWA 4C1KA 4C6DA 5HUOA 1US3A 4KMQA 3TZNA 2ZXQA 3STEA 1WUEA 3C2RA 4QFUA 5D4YA 5I2UA 4GCAA 1KD0A 4MZ8A 4Y6GA 3NQBA 3VIMA 4HD5A 1ISZA 4O10A 4R7JA 2DZXA 4B91A 3S83A 4O0ZA 2XVLA 3PJUA 3T08A 1T0OA 5ABFB 1DV7A 5BXTA 1FXPA 1TMQA 4CU8A 2D23A 3BZGA 2PDPA 4UOQA 1KXQA 1UP3A 4HSNA 3NZQA 1Z8AA 4JL1A 5JIWA 1DBTA 2ISSA 4S3CA 5CLWA 4P7OA 4LV4A 4XKYA 4JTCA 2QLYA 1V6XA 4AMAA 1TPVA 3FLUA 1B0IA 1WAWA 3AYVA 4DY1A 4IIFA 4PTXA 1TA3B 2CHNA 3T05A 1KC7A 4UTTC 1J96A 4HMEA 1REQB 5LHFA 2WJZA 1S2VA 1S2UA 5HWNA 3DX5A 4D71A 1D9EA 2E77A 1FBAA 3ZT5A 2EJAA 3ZR5A 5HNTA 1JUBA 3BSGA 4YU1A 4CNOA 3PPHA 3NO5A 5KSWA 1PE1A 1I45A 1A50A 3OBEA 2J7DA 2C1HA 2DU2A 4WF7A 3WLSA 1T96A 1B2YA 4NX0A 4H6EA 4O1AA 1ZALA 4CD7A 3GQYA 3W53A 5G4HC 4YIWA 4CKQA 2IPGA 3W2NA 3W7LA 1JYNA 5A6BD 2HXTA 3KCJA 1HG3A 3FGCB 1H2JA 4DHGA 5LSMA 3R8HA 3EXRA 4D6HA 3PPFA 5DMMA 3JZUA 1Q4WA 2GJXB 4GACA 2O4QA 3ALGA 3WLQA 1XGEA 4NY2A 4W7VA 1OSEA 4DIAA 1XJBA 2YJQA 1HW6A 1UKTA 1PV8A 3A3XA 3DBNA 2G3JA 4PBGA 4PMJA 4Q33A 4NRRA 1JNEA 1W1ZA 3UA3A 4US6A 4GY7A 4FALA 4NNCA 3B8IA 3PZVA 2OT0A 3WL1A 4H8UA 4HA3A 4FXRA 1W9BM 4QS6A 1FWAC 1F2JA 1F9CA 4I7VA 1I9CB 2MANA 3H2FA 3VKJA 3LCWA 5CPTA 1H5VA 3AHYA 3IJ9A 1EJUC 2QEZA 4HJFA 3EX2A 4Y9MA 1EJTC 1O4UA 3M5ZA 3MWAA 1V0NA 4ZVJA 3WH6A 3EB3A 1NDYA 4AZIA 4Q8TA 4Z2HA 1VHCA 3ABSA 1U5JA 3AIRA 1MXDA 1MMFA 5CC5A 3N04A 1JCYA 4XO6A 2J6XA 3ALFA 1RJPA 2XH0A 5I3IA 2V2DA 3GIPA 1YQ2A 4DWSA 1NH6A 1LWHA 4XIAA 1YXCA 4NF7A 4ZCWA 4NL1A 4MF4A 4LYRA 5BMXA 3H23A 2FKPA 5AHMA 4MFEA 2VO5A 5FKYA 2C19A 4CU6A 3M5YA 3SCPA 1JDEA 3PZMA 4CEXC 2CESA 4NHVA 1K70A 4GQGA 2WVTA 2PSNA 4RDVA 4BF7A 2XDFA 4W88A 4ECLA 4F9JA 3R13A 1WCGA 3QGAC 3VZZA 1TV4A 1OFOA 3C0LA 2QCDA 5E1QA 3LUTA 1PZ0A 3MANA 3T4CA 1H41A 3TSBA 4Q8UA 2HQAA 3CL6A 1BSLA 4FOUA 1I2RA 1H09A 2J24A 1CGVA 3O6AA 4AD3A 3V75A 3TJXA 2HS6A 1MNSA 3CWNA 3EEZA 3UXDA 3B4UA 1JZ8A 5FJTA 3EX1A 1OX6A 4DQWA 3ANYA 4ZTYA 1TTPA 4WJ8A 2A6NA 3GW0A 4W7UA 3VPLA 1ZB5A 2QCFA 4BEUA 1HX0A 3GNPA 4L1WA 3MI2A 4DBWA 3PZIA 5JH2A 1EXBA 1UPMB 5BRQA 3LHWA 1W9XA 2FHFA 1EYWA 5CKSA 1DWAM 4Y9PA 4I7UA 2OSXA 3NTYA 2ZX8A 4JFVA 3IJ8A 8A3HA 3U7BA 4HU0A 2QKFA 2DT2A 3RRXA 2CLPA 3R6IA 1AL7A 2CZVA 2V5KA 3VGHA 3G1RA 3W23A 1YPIA 3QVQA 1WDSA 3N11A 3GUWA 1UUOA 1O6IA 4DNMA 1RXOB 4WIWA 1QK2A 3SGUA 3NQ6A 2AL2A 4JNZA 2DZTA 1C8XA 4DXKA 5JBEA 2J62A 2JIWA 3SBFA 1VFHA 1M53A 1Q6QA 3RLHA 4GO8A 1KBLA 4XSLA 1EOKA 4N9DA 2J6VA 4WEVX 3G22A 4E8DA 5FEZA 3PY2A 5HWJA 4BR1A 1ISVA 1WZAA 3G1YA 2A3AA 1TQJA 5J04A 4FX6M 2G4JA 3W9ZA 1RAKA 2OJPA 1Q85A 1F3WA 3TX9A 2GL5A 3PTQA 2PD5A 3L9CA 2WSKA 3B0YA 3F5KA 4YTQA 4PEEA 4LTSA 4NXSA 4Q6JA 4TIMA 4R33A 3RG6A 1M7OA 3UCCA 4I3GA 1Q2SA 3DXIA 1SFLA 3A4XA 2UY5A 2ZXAA 1CGXA 3W2MA 3CJPA 1EDQA 4L64A 4PMRA 3RX3A 3RIKA 5JH1A 3HQ1A 3FCPA 3G1AA 1ECQA 5D9NA 3TC6A 5AKQA 4HPJA 3EA2A 2WMJA 4LB4A 3VINA 3UVIA 2X1IA 3EX3A 5I09A 4Q8OA 1A49A 4ACZB 3TKFA 2Z1WA 3M6DA 2AQWA 2WNZA 2XJ7A 6TAAA 1MUCA 3TCSA 5DO8A 4ZFMA 4KFOA 4UFHA 1FP9A 2FVLA 2YZ5A 4R85A 1BWKA 3QPEA 3OQEA 1HJSA 1IWAA 2Z6JA 2J7FA 5D32A 3MSGA 2XIQA 4IJRA 1G7UA 2HBVA 1JGMA 2VD8A 1TIWA 3P8IA 3CC1A 3LMZA 3C6CA 3SCQA 3N73A 1RK6A 1TREA 2QF7A 3L65A 2OEMA 3AS3A 2VGBA 5K9CA 3S2LA 3UA4A 1IIHA 1V08A 1KM1A 2GLKA 3GWQA 5CGQA 2O56A 2P53A 3TOYA 3ABRA 1ESWA 2YDAA 1UD8A 3KBSA 4FK9A 3KBVA 1MRAA 1OT1A 3HU7A 3NQCA 2E9MA 4R9OA 1ZJIA 3I3DA 1OX5A 1W3LA 1VLWA 4MKVA 4C90A 1UWSA 1AH0A 3QYSA 3UVAA 4S1FA 4MPKA 5BOEA 1QOXA 3L21A 1GGOA 5JBDA 7ODCA 2D1ZA 2A5HA 1RP8A 2PDQA 2QF8A 2ADAA 1WXJA 1V7AA 2BODX 3LHVA 3LK6A 4U5KA 3GH7A 1E6XM 1FWWA 1D3CA 2RFGA 3DOPA 4HVXA 3TTEA 5I03A 2QAPA 3VNYA 4FNQA 1LUCB 1RLCL 4JICA 3SUVA 1JCNA 4XX6A 1FDZA 1GVOA 1PX4A 4Q32A 1N7KA 4NILA 4QROA 1I60A 4J3XA 2NXIA 4YTRA 3U2CA 2CKSA 2Y1HA 1XRSA 1NWRA 4GA8A 3JVAA 4W93A 3W2JA 2EG7A 4JBRA 2ZUUA 2AKZA 4XKYB 4LAKA 4I7WA 1KKRA 2F2KA 4O1CA 2WLZA 3G0SA 1Q6RA 4OVXA 4JTUA 4R53A 2AL2B 1WZKA 3QRHA 2NSOA 2TRSA 3WDQA 1REQA 1RVGA 2W62A 4AY1A 2H8ZA 2WJEA 3W7QA 2QCLA 3M46A 4UMBA 1M04A 1QBAA 7TIMA 4O16A 3MHFA 4GI4A 4M5PA 1RSCA 4ZB2A 1W5OA 2FFIA 3EKZA 4GKLA 1R3YA 2YDRA 1E4MM 4LY8A 3DAQA 4GH3A 5IM51 2JK2A 4LYKA 2YZRA 2PGRA 2VENA 1XL9A 4QAIA 2P5NA 2QJMA 1P1MA 2C0AA 2NXHA 1P0NA 1RR2A 2QCEA 3MSRA 3NQ7A 3H54A 4U2ZA 3G6LA 2G4FA 1NTHA 3IGHX 2WHLA 1WKDA 3SFWA 1BAGA 3GY1A 2O7QA 1NDWA 1Q6OA 6TIMA 3Q4DA 1HZYA 3H70A 2WO5A 1PL9A 2WZHA 2PB1A 4L9ZA 3NQ2A 1NOUA 3BLEA 3PBWA 2HWGA 2CLIA 2INFA 5BCAA 1PB0A 2ZZ1A 2PAJA 2W79A 3FJ4A 2ZTJA 1OGSA 3MKVA 3CH9A 1M6JA 4US5A 4XAPA 2YSWA 3EKGA 4QE1A 1GONA 1KB3A 5T91A 4D6DA 3RLUA 3R58A 2TYSA 1OC7A 4K7VA 4P7LA 2VFEA 3TE9A 1G4TA 3GUGA 4GUJA 4GXPA 8XIMA 3H4WA 2F38A 4P7QA 1E1CB 1F3XA 4X0NA 3QC0A 3WF2A 2NLYA 3NURA 4O19A 4KRZA 4RE0A 3WLNA 3O3RA 2YCJA 1GOMA 1T6MA 4URIA 3V1HA 2NV1A 3C8NA 4CD6A 1MQQA 1BTCA 4ZOCA 2EPMX 2VNCA 2D0FA 1W9PA 3MMDA 3CHDA 4KCWA 4YHEA 1SZGA 1B31A 1BYDA 4IUGA 1DJZA 2IQTA 1EHAA 2XZ7A 1U22A 1XGZA 3H7UA 1Z89A 1WAUA 3OJGA 2GQ8A 2FZBA 1UR8A 3W1QA 1F4AA 3CV2A 4CQBA 3VDCA 3BGGA 1XUZA 2DSZA 3L66A 3UW6A 3S47A 1ONEA 4H83A 3BLOA 3VMNA 2E5DA 2V81A 3TW9A 4AX7A 2VGGA 4QIUA 4B5SA 1UWIA 4FSAA 1FRBA 2PWFA 3QZAA 1GYLA 3HURA 4LNYA 1I75A 4L80A 2VL4A 4XO7A 1GUVA 5HAOA 4S38A 1Y5XA 4CEUC 2OYLA 3POCA 3ARWA 1C93A 3ZSSA 4Y96A 4BS0A 4ZTXA 2D2HA 4RKAA 1DORA 4AWTA 2P76A 4LUYA 3THDA 5H8PA 1EJVC 4L6OA 1R38A 3UZXA 1SZRA 4HGXA 5J5RA 3VIIA 4UBPC 2VYOA 4PTMA 3KW3A 3ITGA 1UR2A 4C65A 3GX9A 3KWXA 1IIGA 4G9PA 1XIGA 3GR8A 1D7FA 1QW8A 3WQ6A 3G3MA 1ECEA 3VD7A 4IPNB 5CG0A 4UR7A 1TR1A 4HNCA 1R7OA 5AHEA 3N9SA 4D6EA 3E2SA 3NGFA 2QMKA 1F74A 3WLIA 2CLOA 1T8XA 5GJPA 1FUYA 1EL3A 3UBPC 3TROA 3GYEA 2EKCA 4CNUA 1VHNA 1YE6A 4U10A 3GC4A 1K1DA 1GEQA 4O1DA 1OX4A 1GPWA 4J3ZA 1KLYA 1Q63A 2A4AA 2E6FA 4QLKA 1ITCA 4WVXA 2WANA 4DNHA 1ZAIA 4B3LA 1XLAA 5A6JA 1MXSA 2ODOA 1KFJA 4F3HA 1QVBA 2KAUC 4BWLC 1QWKA 2VUYA 1KR0A 3VM5A 1VFFA 1SW0A 1V79A 2VDIA 3GSMA 4UQCA 4MNLA 3BCFA 4WCJA 5HBFA 2VWSA 3B97A 3QZEA 2PTWA 1EC9A 1E56A 4O54A 1H63A 4JN6A 3B9AA 3O6DA 2UV8G 4ZO7A 1E3XA 4JIPA 2WCAA 3MYOA 5H8UA 1F4HA 2YOCA 2CNCA 2OZ3A 4IIEA 3BPWA 1P43A 1Q6GA 1FWTA 3GU1A 3REQA 2GJNA 2QV5A 1WO2A 3RRAA 3LHUA 4OGZA 3W1PA 4IMEA 5EKYA 2ACQA 3P2VA 2ZA2A 1CECA 2UY3A 4IIHA 3PUOA 5A94A 1VF8A 4RPPA 1O12A 2PP0A 5HWMA 4Z1BA 1FH9A 3GYCA 1R3VA 1V6WA 1JJKA 3WEZA 5CPOA 1GTHA 3C56A 3NOEA 3DG7A 2QZRA 2R24A 5C2CA 1FH7A 4C5YA 2VZOA 4DXXA 5ECVA 2OQYA 1UH4A 2AMGA 1QI3A 3TYAA 4L1XA 1TWWA 1F3EA 3MT1A 3F4VA 3HF3A 3UQNA 3BCJA 1R8LA 3PR2A 2Y8KA 1GKQA 1TFVA 4PEKA 3U2OA 3VIPA 5B7ZA 2GGHA 1XPGA 3N2CA 1SMAA 4XG1A 3B8VA 1GG0A 3EXTA 6REQB 1XFCA 1H0GA 1KWKA 3QFWA 3BAXA 2QCDB 2VQTA 5CSRA 1UYQA 2HJPA 3T40A 4AF0A 5FAGA 2ZZ6A 3KTXA 2HMCA 3EMCA 2AMXA 3HG2A 4LS1A 1EJXC 5F1VA 1NY1A 2B81A 2BXZA 2X30A 2W6RA 4W5ZA 3VGDA 3WD1A 3WMSA 1JZ7A 5AYZA 3L4VA 2BXVA 1XRFA 5F4XA 4RZ5A 4MSSA 4F0MA 1HNYA 4FO4A 4O12A 5TNVA 1NQ6A 2GJPA 4O52A 3KOZA 1ICQA 1A5UA 2EAWA 2A1YA 5CZKA 4OU1A 1YXDA 3FGCA 5HATA 2I5GA 1SFSA 4JN8A 2H8XA 3VNMA 3FSUA 1U30A 1JF5A 4N7QA 2W63A 1BVNP 5A3HA 3BURA 4E3VA 4YCPA 4WQ6A 2OWCA 4JTEA 3VX1A 3QKEA 1BD0A 3S1GA 3QW3A 1GOIA 1OEPA 4HU8A 1JNDA 4XZ9A 2FMNA 4HZ7A 4C1LA 4HK6A 1PX3A 3OVQA 1XLGA 3W86A 1GQNA 3QKZA 4FMVA 2X05A 1GOOA 4J3SA 4ICMA 4AHOA 2ZRXA 3AHXA 1MQRA 3CQ0A 1FWEC 5CZTA 1LRNA 3A5FA 5BRBA 5SWUA 3IGUA 3NXFA 1OC5A 4HOXA 5TF0A 1KTNA 1H7RA 3PZNA 1TR9A 1AK5A 1TWSA 1P1XA 1Q5MA 2C1IA 1G94A 1B5TA 5A2AA 3VIJA 2J27A 5DT7A 1W5QA 3W7EA 4IL2A 4QHRA 4NNAA 1X1OA 1QO5A 3QQ1A 1GJUA 2CWXA 1OBAA 2ICSA 4WKFA 4WY0F 3LZ5A 3NPUA 1DTUA 1W0MA 5IFTA 4LUIA 3JS3A 1HKWA 4R7WA 1TRDA 2YPIA 4ES4A 3DEQA 2BGSA 1R3RA 3E5BA 4DF2A 1KRBC 2HE5A 2BY0A 4NAFA 4P2VA 4GG9A 4DO7A 1EPXA 5G2WA 2GVEA 5M1TA 3LI0A 3W70A 1IZCA 1UJQA 4JN7A 1FWRA 2NLIA 3FW6A 3N2BA 4AX6A 2R1NA 1S2CA 4US5D 4Z1DA 4KERA 4TV6A 1MDLA 1PIFA 1DOSA 3FHQA 1GOWA 1UD3A 2GK1A 3CZKA 1XF0A 1H1YA 1Q13A 5IDIA 2PTDA 3B8SA 3WNOA 4H7ZA 3WQEA 4K3ZA 2JE8A 4U2YA 5I24A 1AH3A 2FQIA 2PU0A 2UY2A 5DXYA 4PB3A 4GUHA 4GYFA 1YHTA 1F3TA 3RM8A 1XBZA 1MUWA 1Y8BA 4JOMA 5D05A 4AIBA 3EWUA 4W89A 3MSDA 3GTNA 5BWFA 1IEQA 3XISA 3CLMA 1WPCA 2CXEA 4L4OA 2C6QA 4ATDA 1HJXA 4DBSA 3E2RA 4UOZA 2GVJA 1PTDA 1C90A 1GW1A 5G4EA 2BSLA 3ARVA 1YBQB 3WCZA 4KWWA 2YA0A 5FF7A 4LXFA 3HZ3A 3TC7A 6XIAA 1K77A 2X1SA 7XIMA 1HP5A 2C1GA 4FF5A 1AW1A 3WJXA 2VCBA 4Q7IA 1PEZA 2DUXA 2CITA 3IIOA 3IPWA 4UXDA 1UKQA 3EPOA 4J3VA 2Z1XA 4IFOA 2R8WA 5LIXX 2J8TA 4UNKA 2Y4SA 1OFRA 2PDJA 3GDKA 3W7MA 1NOFA 2ZZ3A 5LIWX 3IWPA 3S6OA 1VBJA 3SADA 1BPLB 4U3CA 1UMLA 2PDLA 3SJNA 4PUMA 1YDYA 1W37A 3PAOA 1YBQA 2WKLA 3V5FA 3C0JA 3EKLA 3GLCA 1IR1A 4IH3A 3V5OA 1SJAA 3N1AA 3BW3A 4XVEA 4HPXA 4YPJA 4EAMA 4H01A 5IFPA 3IACA 3W37A 1SR9A 2Y70A 5HPOA 4OOZA 1W3IA 1E6QM 4LCSA 4ADSA 2EXOA 3FJ6A 3DCPA 1UP0A 1GVRA 3VIHA 2R82A 4WKHA 4HJWA 4O4VA 2DQXA 1CT5A 3VDGA 2E3ZA 4M6PA 3IEBA 5LNWA 3NAVA 4A35A 2HROA 2UWFA 1TWDA 7TAAA 3TYBA 1JQXA 4FNTA 5LNSA 3EPMA 1H7NA 5XINA 3Q65A 2QCHA 4XVDA 1UKOA 1NSJA 2R1MA 4H6QA 4IQLA 2PDMA 1TCDA 1QNVA 3AZSA 3TA6A 2WMIA 3MTWA 5I6SA 2NT0A 3GW3A 1VFUA 4QQ3A 4F8XA 1XM3A 1IXQA 6ENLA 2WXDM 4CCCA