5HDRA

Crystal structure of a bacterial fucosidase with iminocyclitol (2s,3s,4r,5s)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
445
structure length
440
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Alpha-L-fucosidase
publication title Crystal structure of a bacterial fucosidase with iminocyclitol (2S,3S,4R,5S)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine
rcsb
source organism Bacteroides thetaiotaomicron
total genus 158
structure length 440
sequence length 445
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5hdrA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5hdrA01
2FDMA 1E1EA 2XGBA 2O9RA 5AYIA 2F7QA 1E72M 2W63A 1HKIA 1EA9C 4AYGA 1XHGA 4J3XA 1B3ZA 2F1BA 4GINA 1K9EA 1BG9A 3CZSA 4JFUA 4W5ZA 4GZEA 3L2MA 3WH7A 3ARPA 1SZNA 1E3XA 2F7RA 5A8PA 3QOMA 2FGLA 3L2LA 2J77A 1BYCA 1E6RA 5A8NA 3F5LA 1NH6A 2CETA 1KTCA 2C0HA 1JXJA 3IJ7A 3VIGA 4UOJA 3AIWA 2WC4A 3AOFA 5D8WA 3GNPA 1V6WA 5CG0A 3VIFA 1ZBVA 3VINA 3DX2A 2X0YA 2WLZA 4PN2A 2EACA 1I75A 2DSWA 4AWEA 3GTNA 2JIWA 3MV01 4AZ6A 2BVTA 1WNOA 2ZX6A 5JBEA 2VVNA 2VTFA 1GQJA 3VGEA 2ALWA 4AD0A 3ZJ7A 1E1FA 2WSPA 1KWKA 1JZ5A 4CU7A 3BCDA 2A3CA 2E40A 5IHSA 4NZJA 5M03A 4W86A 1E9LA 1NOWA 3LXAA 5E09A 4KWUA 1CYGA 2E8YA 1OIMA 5CJ5A 3M7SA 3MUZ1 4ZENA 3BMWA 1Q4NX 1NOFA 1XH0A 2GDUA 2PWGA 1HJUA 2ZUUA 5JIPA 1TVPA 4BA0A 1J01A 1X1NA 1MVYA 3CO4A 2WBKA 1E70M 3WL0A 1BYAA 1JI2A 3W27A 1MQQA 1CLXA 2CKRA 2EQDA 3WDIA 2E9LA 3AZRA 3GH5A 4D6GA 1O7AA 3J7HA 5I2UA 1B3YA 1WB0A 1W2PA 3CPUA 1E4IA 1W1PA 5FOOA 1VJZA 1HTYA 1DWAM 2OWWA 2BXYA 4LYRA 4GZJA 3SCTA 4AZ7A 2XM2A 3TV8A 2XVGA 2ZXBA 3FHAA 4EK7A 2X0HA 1UWQA 3DHUA 3FY1A 3WELA 1M01A 1LL6A 5CGTA 3BAJA 2ZWZA 2FH8A 4P7RA 1GJUA 4MDOA 4C7FA 3EDJA 2VQUA 2XVLA 1K9DA 1OGGA 4CCEA 3LRLA 4JKLA 3MUAA 1RPKA 3VD3A 4AD1A 3W38A 2GK1B 4FLOA 1JZ7A 3MO4A 2BV9A 1H4PA 1H2JA 1JF5A 2XN0A 2WAGA 4PMOA 3KEHA 5D9PA 1HXJA 3AHTA 3BVTA 4D6DA 3PBGA 2V5CA 3VMPA 1M53A 4MDPA 3GXPA 2OW7A 1PPIA 5I23A 1CEOA 1HP4A 4PMQA 1VEMA 4XB3A 5A6AA 3U5YA 1UWIA 1CGWA 3CIVA 4WKHA 5BCAA 3GXIA 3VMNA 1K9TA 1C7TA 4AZHA 1VBRA 1FHLA 4WF7A 3AHXA 3BXWA 2WW5A 4U5KA 4CD4A 3AROA 3WNPA 2A3EA 5I24A 1QNPA 1GVIA 1TVNA 1VJSA 5HNNA 4DM1A 4FLSA 3UETA 4W5UA 5A1AA 1JAKA 4M1RA 1HKKA 4D72A 3CZGA 1E6NA 4ZE5A 3MMDA 4MPKA 3MMUA 3VDAA 1XH1A 1W9PA 1LQ0A 4GXPA 2F61A 3HZ3A 1UOKA 2ZUTA 1Q6EA 2QLYA 1J0IA 3WNNA 1J10A 3JUGA 4WKFA 4GO9A 1JIBA 2G3MA 1V08A 3QHOA 3VSUA 3EJQA 4PMRA 1ZBWA 1HJXA 2X09A 3BAIA 3W28A 3HN3A 1PZ3A 2ZE0A 4LYQA 2YL9A 5EFFA 4RE2A 1TQTA 2PBGA 2G4FA 2OSYA 2E3ZA 1C91A 1JNEA 1UQZA 2DPEA 3L4XA 2D3LA 1TFVA 1J9YA 2W62A 3BUIA 1DP0A 2XVKA 2CERA 1XSKA 2BHZA 3MS8A 2DSVA 2WVTA 4HOWA 2YBTA 2BVYA 2QMJA 2GJXB 1ISZA 2X05A 1E56A 1QNOA 4UFMA 4JHOA 3U7VA 5FL1A 4ACZB 4UZUA 1YHTA 1V3KA 3AS0A 3KLKA 5GPRA 5ABFA 1KCLA 3WNLA 4MB3A 4ACYA 1WDQA 1KXVA 4U5IA 4CUCA 3PZQA 4K68A 2D73A 3D51A 2DIEA 3K8MA 3ZR5A 4QAWA 3AXHA 1DEDA 1B3XA 1CXLA 4D6IA 1E73M 1OD8A 3MSDA 2XG9A 4FLRA 2XN1A 1S46A 1B31A 2WCAA 3GH7A 4W93A 1V3JA 3WH8A 2YFOA 4UQ9A 4W8LA 4CKQA 2JF6A 4DO5A 3BVUA 5I6SA 2CIPA 1IV8A 2YL5A 4M81A 3FN9A 1GOMA 4F79A 1UD2A 3WQ4A 1LG1A 2PI6A 1E0WA 1CDGA 1E5JA 1W32A 4NX0A 1ISXA 2J4GA 4P7NA 3LXCA 3W6MA 1UR4A 1B9ZA 5BRPA 2VX4A 1B3WA 1MQRA 4U2YA 4IPLA 1JD9A 2VX6A 3ZMRA 1PZ2A 2GUYA 3D3AA 3K4AA 3WDPP 3EDKA 4OBRA 3A4AA 3WF4A 4P8XA 4UQCA 1WAWA 3SIMA 4BF7A 1TE1A 1FFQA 1US3A 5I78A 1C8QA 1CXKA 1I1XA 1KB3A 5FIPA 1E0VA 3F4VA 4MNLA 2FGZA 2AOSA 5IXEA 1AVAA 2PWFA 4X9YA 1TG7A 2QMKA 4MNJA 3OGVA 4QDMA 5CZKA 2XIIA 1H5VA 2ZX9A 2VQTA 4H04A 1ISVA 3WMBA 2Y24A 3VD4A 5LA2A 5IFTA 1ZU8A 1R8LA 3UR7A 2YA0A 3LXBA 3W82A 3SUWA 2VZVA 3KWXA 3EJUA 3A3HA 4DWSA 3AHVA 1OINA 2VI0A 2ESCA 5JBFA 4XV0A 1E3ZA 1JXKA 1MXGA 1AQHA 2ZOXA 1B1YA 5M5DA 3RMEA 3VD5A 5HPCA 5I0DA 3N17A 4MB4A 3ALGA 1PBGA 4PCSA 3SEPA 1HP5A 1OBAA 1QNQA 3HU7A 3WNOA 3U57A 1V0MA 2X8RA 3BSGA 1JYVA 2J74A 1BAGA 2WVVB 3OIHA 3HJEA 3CUHA 1HJQA 1KXQA 2CESA 3BSHA 4MAZA 3NSXA 1NWRA 3VX0A 3CC1A 3N15A 3T0BA 1X6LA 1MFUA 5ABGA 3WF3A 3W37A 4AD2A 1UH3A 2GJRA 1EOMA 1US2A 1UZ4A 4A4AA 4AIUA 5A6LA 4AXNA 4PBGA 3GXFA 3AIUA 4UTFA 4GKLA 4HZ6A 3ZJKA 3D4YA 4Z2IA 4AZCB 2ZXQA 2BY1A 3CH9A 4MB5A 5HBFA 4AMWA 1JD7A 2ZX7A 3B9AA 1W3LA 1XV8A 4EKJA 3EYPA 2NSXA 4CVUA 2CNCA 5KEZA 1BPLB 2CHOA 2DGAA 3RM8A 1VRXA 4F8XA 2W4XA 3AS3A 1PX4A 1R34A 4NI3A 1E6QM 2J75A 3PTMA 1MQPA 4HP5A 3QHMA 3HG3A 5GNXA 3H53A 1KFWA 1NWUA 3VIKA 1J0JA 2F7OA 1WKYA 5JUVA 1EQPA 3EJRA 1C8YA 4PTMA 4AEFA 1UR9A 1KTBA 1J0HA 3ZOAA 1UR2A 4J28A 3PZ9A 3HG5A 4KH2A 4PTXA 4U2ZA 5D9OA 4ATDA 2DDXA 1FFRA 3AIRA 3BLBA 4AZIA 3WDHA 1TR1A 5CLWA 3WD1A 1JGIA 5CPTA 1VFOA 3WDJA 4TTUA 2RGMA 1W1TA 1GONA 3BAWA 1KGUA 2WCSA 4J3WA 1TQSA 5FL0A 3VIMA 1UKQA 2V3GA 1KXHA 3W26A 3AXIA 2J62A 1BYDA 3GXTA 5BRQA 1F4HA 3BUQA 2V3FA 5HDRA 3N9KA 1BSIA 4QCEA 4U31A 3ARWA 3VIJA 4M82A 4PMVA 3CBWA 4TVDA 2OWXA 2J7BA 1MYRA 1RD6A 3VDHA 1QHZA 5DMYA 3OB8A 3M07A 1WDPA 3BUDA 3MV11 2CITA 1MFVA 2J25A 2ZUVA 3LRKA 3DYMA 1V02E 3AIBA 1CLVA 1ZL1A 3F5KA 4V28A 3VNZA 1FP8A 3IJ9A 1CNVA 3VM5A 1PEZA 1ZB5A 5CLTA 3CZNA 3IJ8A 3DX1A 4P7QA 1QW9A 4AW7A 2X2IA 3OA5A 3NCOA 2XHYA 4NSBA 4E8CA 1CGXA 1NOUA 4P8WA 2WC3A 1QVBA 3UEQA 4NRSA 5AC5A 5DT5A 3D4ZA 5HOSA 1JAEA 2CYGA 3WEZA 3VM7A 1QI0A 7CGTA 2XFRA 1CBGA 4UFJA 3ZT5A 1R7OA 4OKDA 4CD6A 2WC7A 5CPQA 2X2JA 3T09A 3OZPA 1HKJA 2WWCA 3THDA 1QNRA 4PMXA 4JCMA 1V6UA 3WDQA 3MANA 1XD1A 1MW3A 4N42A 2NW0A 5IDIA 2PB1A 4FNUA 1WZKA 1B2YA 1EQCA 4PSRA 1I1WA 1V6XA 2WLYA 4FNRA 1TQUA 2CXGA 4UCFA 1C90A 1NP0A 2J7FA 4ATLA 1SFSA 4JFVA 3LPPA 3WSUA 1DTUA 4V27A 3ARZA 1LJYA 2ZX8A 1EO7A 1QWNA 3CZJA 6CGTA 4Q7NA 1NWSA 1UA3A 2UY5A 1UR1A 5E0CA 3B9EA 3HG4A 4GIAA 1GUVA 1VFUA 1AQ0A 1V3MA 3MUY1 1JZ2A 1R85A 3SCWA 3EBVA 4GI6A 3EMCA 5A6JA 3SUVA 3WDRA 2WMKA 1OGBA 2DH3A 3VIIA 5JBDA 2PBOA 2VURA 1G94A 5A2CA 4E8DA 2OW6A 3POHA 3VILA 2XSAA 1W3JA 1VEOA 4RE4A 2EO7A 2BY0A 1JDAA 4Z2JA 3AS2A 4LYPA 4NZFA 2X2YA 1ISWA 5A8MA 3DX4A 5AY7A 4CN6A 3E1F1 4W89A 2JIEA 4JFTA 2VC9A 1E6XM 1CWYA 2W92A 4DWSC 1ZBCA 2Z1SA 2X1IA 1BLIA 3WF1A 3NSNA 4HOZA 1UH2A 2BY3A 4E2OA 4GI9A 3CLWA 4BZYA 3II1A 3WENA 2WMFA 1VFFA 1EH9A 1GHRA 3WD3A 3T0DA 2E4TA 4UNIA 3CUGA 3D50A 1TA3A 5M3WA 2J7CA 5GNYA 3FAWA 2VOTA 2Z1KA 4J3VA 5TD4A 1J11A 5CXPA 4BQ2A 1U30A 1QI4A 4KGLA 2Y2WA 5A2AA 4PCTA 3ARXA 3SCRA 4MNKA 2IXUA 2AAAA 3SUTA 3VD7A 5A6BA 2V38A 3AYSA 4BQ4A 3A6OA 4UQBA 2E9MA 1OCQA 1KBBA 3WY2A 3AICA 2JFEX 3OZOA 1H11A 3W25A 5F7UA 2CBUA 1QPKA 2CKSA 2OSXA 4UQEA 1C93A 2YOCA 4AD4A 5C8BB 3WL1A 3CHEA 5HXMA 1GPFA 1PIGA 4U33A 3B8SA 3WUEA 3VDBA 1HVQA 4PMNA 7A3HA 1ZS2A 2D0HA 1BVZA 2W66A 3NSMA 4CGTA 3TP4A 2J79A 3L4TA 1W91A 5D9NA 2G3JA 5DF0A 4WSKA 1HVXA 3GXNA 2G41A 1N82A 2Q8XA 4MB1A 4WIWA 2VZUA 1IT0A 1OWQA 2O92A 4FNPA 2VCCA 3WEMA 3EDDA 1H0IA 1QWUA 2ZX5A 4P7OA 1GNXA 3IGUA 4UZSA 4H7VA 1HX0A 3TOPA 2J7EA 2EJ1A 3OGSA 1UUQA 4XZWA 4AZ5A 2WZEA 3WY1A 1JFXA 3T2PA 1XC6A 2OLHA 4ZFMA 3K1DA 1CGYA 2ZICA 2YA2A 3AIQA 1CZ1A 4GZIA 1JYXA 4AD5A 2QHAA 3VGBA 3VSVA 1BG4A 1Z32X 1R87A 1E5NA 3UG5A 3O2LA 1BGAA 3AZSA 2Y8VA 1GZJA 3VPLA 5E9AA 2VR5A 3BC9A 1UR0A 4CU6A 4GI8A 4Z2KA 3SCPA 1VEPA 5BXSA 1CGUA 4WLCA 2XFFA 2WZHA 1KQYA 1HT6A 4S3KA 1E6PA 2DT1A 1UWSA 1CIUA 1WE5A 2VRJA 2WVSA 2EAEA 1HJVA 3DYPA 3D5HA 1CXHA 2D23A 2WMIA 4JZ5A 4HMDA 3PZGA 3B9DA 4Z2GA 3O9NA 2J47A 2CBIA 1X6NA 2XYLA 4AIEA 4R5EA 2XJ7A 4YPJA 3N1AA 1R33A 2WSKA 3S5ZA 4OGZA 2VVSA 3QOKA 4X0NA 3AIEA 3AZTA 1M03A 3SCNA 3L4UA 2D20A 1ODZA 2B31A 2FHCA 1E4MM 4AMCA 5CSYA 3AS1A 4M29A 3CZ8A 2VRQA 3KL3A 4W7WA 1UA7A 4IISA 1LWJA 3LMYA 4IM4A 3HMCA 3VIOA 3WD4A 4QFUA 3SUSA 1ZBKA 2BNJA 4CD8A 1V6YA 3UG4A 3BLPX 3BVXA 2D1ZA 4UQAA 3SCOA 3WKZA 2DSZA 2W91A 1YQ2A 4W7VA 3GXMA 3OG2A 1GOKA 1DWFM 2EPNA 1DWIM 2XGIA 4OIFA 4W85A 2O9TA 4WJXA 2CHNA 3FAXA 4NZCA 1E55A 5I77A 1W3KA 1MXDA 1JF6A 5LYRA 2XWEA 5M17A 1OT1A 1CGTA 1FH9A 1TA3B 2VCAA 4L4PA 1JI1A 1Q6GA 4KGJA 2QPUA 4TUFA 1GCYA 3EMZA 3AMKA 2YJQA 1ZJBA 3IANA 2EPOA 2WKGA 3WIJA 5A2BA 3WD0A 4J3UA 3VD9A 1MW1A 3CUFA 3CGTA 3RPMA 2J8FA 1QI3A 2VCBA 4CD7A 4B3LA 3BVVA 1DWJM 3AMCA 3UR8A 4F66A 1W9UA 1W1YA 3ZM8A 3BCFA 4AEEA 5A8QA 5BXPA 2W61A 2ZXDA 4J3TA 5AYBA 3S5YA 4OOUA 1OB0A 2VJXA 2YA1A 4LXFA 1WZAA 3W53A 4UOQA 1B90A 3PHAA 3TTQA 1WDRA 1ITCA 1EXPA 2EABA 1M04A 4CN1A 4PTWA 5DEZA 5I3DA 4HOXA 1LLOA 5IHRA 1QOXA 3ARSA 2XIBA 4R27A 5IFPA 1VIWA 2GSJA 1T0OA 2YKKA 2YIHA 1XYFA 4FMVA 2YLAA 1EHAA 3SCUA 5D8ZA 4YHEA 3GBDA 2ZXAA 3ARYA 5AC4A 2V3EA 3AMGA 1CXIA 5E6YA 1JNDA 4EANA 3TTYA 2Y8KA 3BLKA 2PC8A 1PIFA 3FW6A 1E43A 4AMXA 2WHMA 2XVNA 2DT2A 4DWSD 2FYVA 2VX7A 3VKKA 4D6HA 2D0GA 4CD5A 6A3HA 1W9VA 4ZEPA 2EADA 1QI2A 4GQQA 1RP9A 2WVUA 1NARA 4JFSA 4H41A 2IXVA 2F8QA 5E70A 3GH4A 1AQMA 2ZIDA 3RO8A 3GDBA 1GORA 2BFGA 1XH2A 4GPNA 4Z2HA 1G5AA 4UFHA 1JFHA 2FH6A 3W24A 1VF8A 3GXDA 1OSEA 2J8GA 1KR0A 3LRMA 3UCQA 3KLLA 2EPKX 1E15A 4PSPA 5GNZA 4JIEA 3PZTA 5DT7A 4ZXOA 4WKAA 1Q6CA 1A47A 4B9ZA 1OGSA 3W29A 3BAYA 3W81A 4BCEA 4AISA 3PZIA 3EMQA 4DO4A 3ZO9A 4L4OA 4C7DA 5ABFB 4P7LA 4Z2LA 4CCCA 3ZSSA 4KRTA 1D2KA 1QHOA 3AJ7A 2VT0A 2V5DA 1H41A 3MSGA 4JL1A 4OJYA 3BAXA 2YDRA 4DM2A 5A95A 3A47A 4HA4A 2W67A 3VTRA 3A4WA 4D6CA 2UY3A 5GQBA 4OOZA 3ARTA 3QHNA 2JE8A 4FNTA 3POCA 1QI5A 3DDGA 4CVWA 4TX6A 3L4YA 2G3NA 1R47A 4UFKA 3MUIA 2YL8A 4TVCA 3I3DA 2HVMA 4UFLA 3WMCA 4E4PA 1HXKA 2JF7A 1H3GA 4JKMA 1FH7A 4DUWA 3BVWA 3RM9A 4FLQA 3WEOA 3VMOA 2UY4A 3RJXA 2F18A 1BFNA 1U2YA 4ATWA 4W8BA 4Q22A 3MI6A 2F1AA 4DUVA 3H55A 2RGLA 3K8LA 2GK1A 2WB5A 4AC1X 4MTVA 4TX8A 1C92A 3GYCA 2ZUSA 3T2OA 3WFZA 1LF1A 1W3HA 3W4RA 1UD6A 1R75A 1E6SM 3G6LA 4PRWA 1A3HA 4MJ2A 2DQXA 1FHDA 3APGA 1XCWA 1CXEA 1V3HA 1EGZA 3AMDA 7TAAA 5A3HA 2FHFA 1W1VA 5C70A 2YBUA 4D1JA 4P8UA 2TAAA 4OBSA 1PAMA 1UD5A 4HA1A 2XTKA 4MADA 3IAQA 3A21A 3MKKA 1JL8A 4PMZA 2VRKA 2WHKA 1GJWA 1NM9A 3BGAA 3VIPA 2FE0A 1F4AA 2JEQA 5E6ZA 4YHGA 4HZ8A 4WSJA 3A22A 4DWSB 3CMGA 1NP2A 1PS3A 3S2CA 5A6MA 2F7PA 4CCDA 4CN4A 1C8XA 4ZE4A 3AXXA 1KQZA 5JIWA 4HPGA 4KRUA 1UKOA 5FCZA 1XSJA 1RH9A 1WZLA 4NXKA 3CUIA 4M80A 1JDCA 3OLDA 3WQ6A 1GVYA 4UR9A 3DX3A 2ZUNA 2VZSA 2CBVA 5BWFA 4GO8A 3PZOA 5ABHA 5EB8A 1V6VA 1KWGA 1UQYA 1H1NA 3DDFA 4JFWA 4D6JA 2YDSA 4UOZA 2EBNA 1G0CA 1GQLA 5BXTA 3SURA 2PWDA 1EO5A 3FXYA 4J27A 2OYKA 2OSWA 3I3BA 2JEPA 1SR0A 2PWEA 2IUZA 3VX1A 4LPCA 3AHYA 3LPGA 3WH9A 1JYNA 4PUDA 3WUGA 4ZXLA 5FD0A 1JDDA 4D1IA 1BGGA 3PZNA 1ITXA 3GNOA 1DWHM 1NWTA 2BVDA 3WQ8A 8A3HA 2GJXA 2NT0A 3CHDA 4IUGA 1TZ7A 4ACZA 3DX0A 1XRVA 5ECUA 4J7RA 5D9MA 2DH2A 1KBKA 2WXDM 3ZSTA 2NT1A 1TMQA 4AIOA 4C7GA 1BVNP 4M56A 3ALFA 3A4XA 4QLLA 1PJ9A 1ODUA 1GQKA 3IAPA 3RCNA 3AI0A 5EBAA 2XFYA 1TCMA 5E1QA 1W2VA 4D6FA 2D24A 2F2HA 1HF6A 5HPOA 1XD0A 1HWWA 1EDTA 9CGTA 2WM0A 1J18A 1RP8A 2EPMX 3WQWA 3NJ3A 2XPKA 4B3KA 1E71M 1V3IA 1TUXA 1J0YA 4D6EA 3N13A 4HU8A 3RJYA 1QW8A 1GOIA 4YN5A 3VGHA 4LX4A 3SCSA 1XCXA 2MANA 3NYDA 2PF0A 3LPFA 4XX6A 1CECA 2Y4SA 3BUBA 3ARUA 3KL0A 1BTCA 3MMWA 2XWDA 3DYOA 1UWRA 2VO5A 2OYLA 1VBUA 3ZJ6A 3WH6A 1V0KA 5EFDA 3DECA 2E0PA 4B16A 3VUPA 2G3IA 4QLKA 3VIHA 4DO6A 1JZ6A 1BHGA 1UD3A 2A3HA 3F5JA 4PMUA 2BS9A 4PMYA 1M7XA 5FKYA 2OWCA 4TXEA 3WUFA 4IPNB 5A6KA 2D2OA 4QP0A 3TA9A 2UY2A 1WCGA 1VENA 2WMGA 5CGMA 4JHZA 3EJTA 2J78A 3WD2A 3NDZA 2O9PA 3K4DA 3WH5A 1TQVA 5A6BD 3WNKA 3NUKA 2WBGA 1L8NA 4AYSA 1IZKA 1VB9A 3VDCA 3T0AA 2ZWYA 2VMFA 2DIJA 1R46A 4URIA 3L4VA 5LA0A 1UD4A 4PYSA 1E6ZA 2CEQA 2YFNA 1C3FA 2WPGA 4LQ1A 3UG3A 3OLIA 8CGTA 3GNRA 4P8VA 1E4NA 1UHVA 2WYSA 1HKMA 4W87A 1K9FA 4TOQA 3WF0A 1UR8A 5EMYA 1JZ4A 1XSIA 2XVPA 1UG6A 3FNDA 2E8ZA 2WHLA 4F9DA 2VX5A 3WNMA 3WMSA 4PUEA 2VNCA 4A3YA 4S3JA 1H49A 3KE0A 4HMCA 1OD0A 2O9OA 2OYMA 4HMEA 2GJPA 1KGXA 3OGRA 5BROA 1FH8A 1C7SA 2XSBA 1V0LA 4M8UA 2GDVA 4LGXA 3A23A 1V03A 1UASA 2WVVA 1B30A 5KZ6A 1UD8A 5DFAA 1FOBA 2YL6A 2J7HA 1HJSA 4H8VA 4FF5A 3VGDA 3WQ5A 1SYTA 1V02A 4U3CA 2PWHA 4J3SA 1D3CA 3GZAA 1HL8A 1B3VA 3ARVA 3ZR6A 4PMDA 2VL4A 1Q6FA 1ESWA 1G9HA 1KCKA 2VUYA 2E9BA 2EXOA 3PN8A 4NF7A 2D3NA 1V0NA 2WHJA 4AZCA 1VAHA 2DT0A 3A5VA 1QX1A 1XYZA 2XM1A 1CPUA 3VGGA 4H2CA 1FP9A 3MU7A 3EDEA 2HISA 3N18A 3CHCA 1NQ6A 3RM4A 2C7FA 1G1YA 1WO2A 4HU0A 3UESA 4FNSA 1HN1A 1GOQA 1OIFA 1W9BM 1Y7VA 4MNMA 3TTSA 2CPUA 4PEEA 1EIBA 2XUCA 2Y5EA 4ML4A 1UKPA 3L4ZA 4HPHA 2CCRA 2WANA 1J0KA 1GHSA 2WZIA 3CV5A 2YDQA 3PZMA 1BYBA 3ZJ8A 1Q6DA 3VGFA 1LL4A 3N04A 2QF8A 3VOCA 2BHYA 5A8OA 2WCGA 3RIKA 2JALA 1H09A 4FNQA 3K46A 1J0ZA 4A3HA 2A3BA 3W0KA 4EAMA 1JG9A 3QGVA 2WK2A 2DSKA 3VNYA 1ECEA 1E4LA 2DT3A 4QCFA 3HG2A 3BAKA 1KXTA 3I3EA 4EE9A 3RILA 3AFBA 4JKKA 3EJSA 1CTNA 2VR4A 3BMVA 3DC0A 5A6SA 4D71A 2WMHA 4W8AA 4HTYA 3NIYA 4NRRA 4HZ7A 3AYRA 1ISYA 2DEPA 1FA2A 3WF2A 3AHZA 2XN2A 5DO8A 1SMDA 1SMAA 3ARRA 1D7FA 2IGTA 1EDGA 3SCQA 3TTOA 3WFLA 1JYWA 2W5FA 3WBEA 4H8HA 5CQ1A 3WN6A 2YLLA 3VO0A 5D4YA 1LWHA 3PZVA 4AZBA 4TTGA 1K6AA 1UWUA 4B9YA 3LX9A 5C71A 4FK9A 3BUPA 3D52A 3ECQA 3EJPA 1PX3A 1J12A 1QNSA 4M24A 1EOKA 6TAAA 4QLJA 3T2QA 2GFTA 1GOWA 3CTTA 3WBAA 3ZQ9A 1LL7A 1WP6A 4AD3A 2FHBA 2AMGA 4BQ5A 1QBBA 3SCVA 2VZTA 3OLGA 1UH4A 5E0FA 1GQIA 1WZMA 1MWOA 5BYWA 3WQVA 2UWFA 1O6IA 2WWDA 4UQDA 2WMJA 2DSUA 3PTQA 4X0VA 4B15A 3A24A 4U3AA 3U5UA 4H8UA 1HJWA 5I79A 2ZUWA 1CXFA 3K8KA 1PX8A 3M46A 3CMJA 1BQCA 1WPCA 1UWTA 4W7UA 3W6LA 1E40A 3S6TA 4RE3A 4BQ3A 3LPOA 2J7DA 1O7DC 4W88A 4WK9A 1G01A 4RL3A 4BS0A 1XGZA 3OLEA 4XZBA 3M6DA 2WMIB 4N0RA 5A94A 1WDSA 3CHFA 4TVUA 3G6MA 3AMLA 3RDKA 1BF2A 1TQWA 4KMQA 3VSTA 1VFMA 1V3LA 4MJ4A 2X2HA 1MW2A 1DWGM 3PTKA 1W9DM 3IK2A 2WNWA 3CZEA 2D22A 3U7BA 3ARQA 3N12A 3N11A 4NXSA 3BH4A 5I5RA 4XUYA 4AY1A 3QR3A 2ZUMA 2G8ZA 1UKSA 3AISA 5BXRA 5LA1A 2CBJA 3ZT7A 1ZJAA 3EDFA 3H54A 1HL9A 3SUUA 3NDYA 1QHPA 1HNYA 2C8NA 3AQUA 1CGVA 3CZKA 4HA3A 5CSUA 4JCLA 4MAVA 2BXZA 3THCA 1KGWA 2QPSA 2A3AA 1QBAA 1JZ3A 1B0IA 3KZSA 4AZGA 1OT2A 1UYQA 1OM0A 3ZIZA 4CU8A 1GOOA 1R7AA 1E0XA 2BHUA 1H0GA 2BY2A 4OUEA 2J7GA 3PZUA 3T08A 4JL2A 4Y7EA 1MW0A 4V2XA 2QV4A 4GQRA 3CUJA 2GVYA 1L0PA 4UFIA 3GBEA 1KR1A 2VZOA 1DHKA 1AMYA 5A69A 3OBAA 1EDQA 5ABEA 4DUXA 1W9XA 2EPLX 3CZLA 1UKTA 4W84A 1P6WA 3ZT6A 3DHPA 3FHQA 2EEXA 3GM8A 3O6AA 2WKLA 3L4WA 1GW1A 3KL5A 2D0FA 3AIVA 1LG2A 3VVGA 1UZ1A 4PTVA 3UERA 1EHNA 4JAWA 4F9JA 1R86A 1IZJA 3WY3A 1HIZA 1CENA 3WUBA 3TONA 5CPSA 4OZOA 1U33A 3VU2A 3WY4A 2V3DA 1JZ8A
chains in the Genus database with same CATH superfamily
3IS0X 4GKNB 1T1XB 2H0PA 1E72M 1VADA 4I18B 1D5ZA 4AYGA 3UROR 4PLJC 3WNIA 1UM5H 4ZNCD 3PGCA 1K8XA 2JKPA 1YNLL 1JUBA 5CJOL 2AXFB 3NJNA 1XLKA 3HBQA 1I31A 4WW2C 1E6RA 1OOAA 4R26L 2V8ZA 4DNHA 2VR7A 3EJYC 1JXJA 4C47A 1MJ7H 4NQDB 4H2AA 2PDFA 2X6AA 2C4FU 5D8WA 3TJHC 2ZZ3A 1QBLL 5LBSL 2B9BA 4NPYB 3QIUA 3FFSA 2X70B 1DE6A 4ALAH 1CIDA 4L8SA 3FCTB 3TT1L 1CD1B 5H35A 3N9GL 1UB6B 5C0IA 1VZHA 2GTZA 5CJ5A 1T7WA 1GZQA 2ADJA 4K3JH 1IBFA 3URAA 5J04A 4YWSA 4LSVL 4GXUN 2QVTA 2BNRA 4AYID 3UP6A 3O6LL 2V5TA 3UDWA 4JEJA 5GGTL 5I2UA 2AK4B 2CCVA 5ENWB 4KW2A 1VJZA 1A49A 5JHDB 5FR3A 1JCKA 2TPSA 3GMPA 5HHXH 5C07B 2PD5A 3TV8A 3B2PA 2ZXBA 1FWCC 3BQUB 1X6UA 2Z64C 2NXYB 1LTXA 3WELA 1A5NC 4I77L 5AZEH 3GC5A 4LPXA 3ARDD 3BAJA 1ETZB 3H24A 4NQQA 3VXMB 4ZUSB 2HPTA 3QZWG 5AENA 3IPBA 2B7PA 5IEKA 2CMRH 2AFNA 4XOAA 5EUKB 1NFPA 3VFGL 2QGYA 2DWDB 3L13A 5FFOA 5I8EA 1A5FL 5D1XE 4IIDA 9RUBA 4QTHA 4WJ8A 4PJAF 4LARH 1T89A 1UWIA 5H8DA 4L3FA 5D2LF 2EXTA 4FMKA 5JNYA 4QYOB 3HN5A 4NC1E 4MYAA 2A3EA 5F3FA 1DSFH 1DFBL 1WXYA 3N2XA 5A1AA 2P46B 2FL5A 3NA8A 5J8OA 4M1RA 1ADDA 3CFEB 1Q7QA 4KJWC 3ARBB 4MZ8A 1I8MB 4GXPA 4OCNC 3SB0A 4U1IA 3SOTA 4HXBH 1OK4A 4B3EA 2ATKB 5FYJE 2VDLL 2YUWA 3EHBC 4YYFA 3IIOA 1PZSA 1P4IH 4MG4A 2PW1A 6XIAA 3VFVB 3W9DA 3BTNA 2G60H 2MFNA 1ACCA 4KKPA 3UY8A 2HEJA 3U2CA 4WV1A 1B3IA 1A80A 1XSKA 3UTQA 1J8HB 5F6HI 3GSMA 3DPDA 5AKSA 3LRHA 3UCCA 1WDQA 1TJIL 2D7PA 2D73A 3BZ4A 1DYSA 1B31A 2DKSA 4K94C 1FA4A 3AYTA 2YFOA 1IGYA 1V7NH 5BRZE 1TQXA 2D31A 5DK0A 1CDGA 2WPBA 1WF5A 1CTOA 4H0HB 3S35H 1EUNA 3CBJB 1WQVT 4F2TA 1D2PA 3NFPA 2Y70A 4A7GA 4LNYA 4HH9A 2PR9A 3M47A 4TOYL 4LASH 1MREH 3V0TA 3BI9X 3QDHA 4X8GA 4YSPA 3C75A 2MPVA 2O5YL 4PJIB 4EAYA 2FGZA 5IXEA 4G5ZH 3BX7C 2PWFA 1FHNA 2ARJA 2XIIA 4Y6GA 1ISVA 1XIMA 3PPHA 5IFTA 3DGDA 4G7FA 3ZE2E 3AHVA 4QRFA 2QVKA 1E3ZA 4GUHA 4HALA 2VC2B 3VD5A 5HPCA 1BQLL 3V0SA 1ZSHA 3B9VA 3KPNB 2VXTH 4DETA 3VI3B 5EFIA 3CFUA 1IKOP 1EJOH 3MNMA 1LK3L 3QJHB 2H9AA 3O06A 2P1YA 2PE4A 1RZFL 1US2A 3CYJA 5D7JA 4F3FB 1L9WA 2ACRA 4WDTA 4ZNEE 2B7DT 2CCWA 5J1SC 5FO8B 5C92A 1RULL 1SRDA 4MX7B 3M88A 2DGAA 1F8TH 1QACA 4JZJA 4OKVA 4N0CD 4PJ7B 1N4XH 3MRHB 3MV7B 3OC5A 4X7CC 3RTQD 3TSBA 1PY9A 1SEBA 5T9CE 1S7UB 4W81A 3RDTA 2X7LA 2O6FA 2ZOLB 1AXTL 4J28A 3QJFB 2BG5A 5TPWH 1AJ7H 1YY8B 4AZIA 3GU2A 3S48A 4CW1B 3HNVH 1U8KA 1IILE 2WCSA 4GAJH 1QHQA 1XCQB 3EA1A 1LEIA 4QITA 1PZBA 1QVOA 4LLQA 1BSIA 5CFAA 4F57H 3GTXA 4M82A 2A4ZA 3PWNA 1TV8A 1VERA 3TNBA 3WEXB 1UUNA 3OKLA 2PCPB 2GITB 4U6TA 4PG9A 5KOVC 3BUDA 4GUJA 3PWAA 2J25A 4GXUM 2N0KA 4NQCB 2RH0A 3TA3A 3EZ4A 1OF8A 3QPXL 1WDAA 3WLOA 2V2DA 5IMOA 2EC8A 3T3PF 2FT7A 4D94A 1UQSB 2NX1A 2HXTA 1RZ8A 3VM7A 3K5XA 3HA1A 3OPZL 3TS8A 4UNTA 1SXZA 3TLLA 1W0YT 1OTSD 4PCNA 1BVKB 3DTUB 2PP3A 2OQLA 1U8HA 1KTLA 4Z5RA 4OB5L 2DMKA 2CLOA 4WHDA 4ZA0A 1NGXA 1AP2A 1GYLA 1JUFA 3NJGA 3LPPA 2QVNA 1YUKB 2E59A 5AEAA 1IWAA 2DLTA 2WB1A 3N5AA 1H3PH 3G5EA 5ID1B 1R3KB 5HGDA 1GGBL 5LIXX 3F12A 1V3MA 2QCNA 1JZ2A 2DLEA 1D8CA 3RWJA 5DHEA 4RXFA 4DW2H 1P7QB 1OGBA 3L3OB 5A16A 4P23A 3AWNA 4ODSL 4UXDA 4Y2DB 1E4JA 4FXSA 3POHA 5KTEH 1T2QL 4L7ZA 1HEJC 1UJ3A 1W1IE 3HS0B 4J3OC 3SZ6A 5B22A 1LDSA 2VC9A 4IKNA 2FVMA 1BLIA 4CC1A 3ML8A 1HUVA 5I1HL 1EZWA 1ASQA 2WMFA 3U4BL 4KQ3L 4R0LC 4X5XB 2MKWA 1MH5A 3KPOB 4JO1H 3PNUA 2F6AA 2Z1KA 1EUTA 5CXPA 4NUGL 1U95B 2DVTA 1VFAA 3T0EC 2IXUA 3ANYA 5TQ2L 2YAQA 3GHBL 4HJWA 2BSSB 3OZOA 1QQDB 1E8ZA 3UXKA 2CBUA 5DEGA 4ICNA 4AD4A 1SBBA 4GIEA 1D5IH 1BJMA 1X7QA 1BWLA 3S34H 5K9KB 7A3HA 3NWRA 4CGTA 3C2AL 1W91A 5DF0A 4IU3A 2G41A 5I76A 2WUCL 1X4ZA 1GZGA 1NCWL 3CVHB 1BEYH 1LBLA 1HCZA 3TOPA 2EJ1A 1AD1A 3WY1A 2XLLA 1CZ1A 2L3BA 4RE0A 2NY6B 1BZ7A 1C29A 3O2LA 3BC9A 4QRSB 4YDJB 3KTXA 3KCWA 3OG4B 4JPIB 1Q8JA 2WZHA 1EBGA 1EEPA 3MFFA 3X2QB 1G9NH 5KVEH 1AUSL 4BF9A 4AC2A 4QDGA 1YN7A 4FHBD 4MIMA 3DYPA 2ZOUA 1EVUA 4IRZH 1MIMH 4DKFH 1X6NA 1KJVA 3FTSA 5F1KC 1OYBA 3D39D 3EOUA 2FUTA 2GTWB 4WFFE 5IP4A 5FA5A 1PTZA 4BDVB 3PIQA 3VFMB 2E7HA 2Z1VA 2DZSA 3FT3A 5FUZL 4Q6JA 3TIMA 1J05A 4GJTB 3UC0L 4UTKA 5HDBB 1N2VA 4IG2B 5IB4B 2J12B 2RH9A 1LVEA 3OG2A 1DWFM 5I1DB 4WW2A 1GHFL 5IGXL 1KY7A 3BT2H 3FAXA 5AL0A 1E55A 3GGWB 1YLVA 3UZQB 2R1YA 3PL6A 2DQGL 4DLMA 3AMKA 3LRGA 4NAEB 4RH4A 3KXQA 5A2BA 3RVWD 3IRSA 3CGTA 1RUKH 4HJJH 4ECNA 4LSSH 3DOPA 3INPA 4Q4EA 1TQCC 1TSHA 3HC2A 4HNVA 2KI6A 3QS2A 1TJHL 1OC5A 5A8QA 4MNHA 3CDCA 1A50A 1J87A 5AVXB 2DJ4A 1WA3A 4HUWA 5ANME 2NY7L 5TK4A 2V63A 3BESR 3MP3A 1ZOXA 5AD0A 1IBYA 5F7DB 5I3DA 4HWZA 1I7RB 5HSFA 4H83A 2GSJA 3QUMH 1S7QA 3VH8B 1FP5A 3Q6GL 5E6YA 1XF3A 1JGEB 4MNGA 2PC8A 4AMXA 3V4PB 2FYVA 4J8RA 3KBNA 4D7PA 1KNOA 5MEQA 4RX4A 5DGQA 1MCBA 1KYOJ 3NABL 3KW3A 3MLXH 2B1HH 5FJTA 3F6LA 1V8EA 3B7SA 3II2A 3GH4A 3SGZA 3KP0A 2Y6TE 2X89D 3ARGB 3CNKA 1I9RH 3W84A 4HYRA 1MRDL 4ZXOA 1A47A 3U1QA 4NZTH 2WNQA 3RNDA 4JX6A 1S7SB 3G0SA 1U93A 4ABWA 4NP4L 2WZPA 4FQ2H 4NKOB 3RGTA 5IESL 5G1YA 5IT2L 3UWUA 1U58A 4DM2A 2N56A 3VTRA 1SLWA 3POCA 5F9WB 4GSRA 1OM9A 3GLDA 4QRQA 1KD0A 4IK6A 4LAKA 5F0MB 2XETA 2KH2B 4AX6A 5ANHA 3MLVL 1IHIA 3O6FD 3GIPA 3E2VA 4XO6A 1LUCA 1FFOB 4M62L 3S2NA 3UZXA 5MP6H 1INEH 4UUJA 5B1BB 5IG7A 4M5PA 3EO9L 5IHBA 4XXDB 1ZLWH 4AC1X 1C92A 4IMLB 1SY6L 3GYCA 3WS6C 5LXXA 1LO3H 1H3VA 2X6BA 3DN5A 1YDPA 2BSDA 3NIGB 3ROLB 2Q86A 4DZ8A 1AOHA 5CBAA 4PGBB 4X4XA 3IAQA 5L7XL 1EC7A 4BKLB 4NJHA 1AOZA 4ZRGA 1F4AA 2FK9A 4PS7A 2JEQA 3RKDC 4HZ8A 2ESVA 1OE2A 3B8WA 4WHYG 2ZSVA 5B7EA 4UMAA 4YIQB 1AZ1A 4QE1A 5D7EA 4M80A 3VU1A 4LSTH 4QRRD 3E80A 3DX3A 4NHUB 3VFOA 1IL1B 3EYSL 3C3UA 4LAQL 2NV9A 4P2OB 4YHNA 4AVIA 4KXCA 1NCBH 2PWDA 1EO5A 3P2TA 1K3IA 4XVTH 1EWDA 5ADPH 3UTPE 4G80A 4B5EA 3W5NA 4HIEA 1NWTA 3D85A 3CUPB 4X98B 4MNQE 1UYWH 2DH2A 3QTPA 3QIWC 1WKEA 4F7CB 1SPDA 1FNLA 5CC6A 1F1AA 1XUZA 4DB7A 3LCFA 1KFLA 2MCG1 3KVJA 4ZTPL 3N13A 4YN5A 1UXSA 3IFOA 5EC2B 2MANA 4JY6B 1UC5A 2X4TB 3UTSB 1VBUA 3QEQE 3HBZA 2EHHA 4N85A 2PO6C 3ROOB 2ZAGA 4PMYA 2WLKA 3FQ1A 1T21B 5ISZB 3LBMA 2H3BA 2YHGA 4J35A 5MEND 3D1MC 1M6UA 5A6BD 1FYTE 3A3XA 2QT3A 3KBWA 2D69A 2PDQA 4ZD3L 2VOMA 3ILQD 4LCWD 4H8WH 2CA4A 1C8PA 3GSWA 1IEBA 3SE3A 4REQB 4UBPC 1E4NA 4FQ1H 3KM2A 3OV6A 5E99H 3SDCC 1A6UH 1RZ7L 4YX2H 2VLRB 2RGSA 3UJIL 3QNFA 1N70A 2E8ZA 4A2LA 3O45B 3WNMA 4JPGA 1MFDH 2KERA 2RACA 5DJAB 1QSZA 3SKMA 4XBEL 3TURA 5ECJE 2YCLB 2N59A 5I8CB 3UWQA 1KLUA 4XMTA 2EG7A 4GZ7A 5DMGC 3WJJA 1UD8A 3IU3B 5BV7H 1FH2A 4H8VA 3PM6A 3RNQB 4YK4B 1V02A 2BIQA 5CGQA 1HL8A 3QUYD 3TFKC 1HKWA 1KCKA 2D3NA 5T1DL 2VLKE 2PCFA 3WK3A 2PUZA 4H8QA 2XM1A 2J8OA 1YN6B 3GJFK 4TVPL 1T0NA 4KQ4L 4HU0A 4FNSA 3KYMB 3BEVB 3P0VL 1AGDA 4XNMB 1ET8A 4JPWL 3GSXB 1R17A 1NBVH 3ALXA 1WFIA 2FX9H 4GMTL 4HNNA 2JTYA 2A9BA 5FK9B 5A8OA 4EI5B 3I74A 1PD6A 1T0MA 5I17A 3K2KA 4PD4K 2EDJA 2DQJL 3X3FL 4KMTH 4RNJA 1VJIA 3RPIB 1PFCA 3L5WB 4QNPE 5A6SA 2ENQA 4BD4A 4XCEB 4NZ4A 4DJDA 4H8NA 1UM5L 1X5AA 5DO8A 1MAKA 4Y4FC 5EC1B 1O75A 1SYSB 3AGWA 1T4WA 1T40A 3QARA 1GOHA 4BSVB 3N43B 4C60A 4GXMA 4R6UA 2C9XA 3C08H 1EWHA 1ZHBB 4OI8A 3LM3A 3QHFH 5ESQA 3IVTA 3QIBB 3ESOA 3UZEA 1FO0A 3PP4L 3SYOA 4KETA 3SDAD 3GSVB 2UWFA 4ZW8A 2WINB 3ESMA 5DHXB 4ALAL 1VKXB 3I75A 3CLFH 3NZPA 4LBRA 1WPCA 1YMHA 5GS1A 3H9HA 3H7BA 4YR6A 1WGVA 1YPIA 3T0EA 2YGYA 1S3KH 2WMIB 1U8PA 3RDKA 3ABZA 3VSTA 4ZFFB 2OZTA 4OZFG 4DZAA 5JO5A 3NZUA 4MTMA 4R7DB 3T4AC 1IIIA 2R8SH 1L5GA 4XUYA 5G2WA 4DKAA 4P2QE 3DX9B 1R30A 3MO1B 5HHXL 1FUYA 5EPDA 1TPXC 1FWWA 2PDMA 1FVDA 4QROA 1OWRM 1WA0X 3RAOA 3SECA 1IJ9A 2Z31D 2AQSA 1H3XA 2WZMA 1OGAD 1R7AA 4JL2A 4V2XA 4GQRA 4P0DA 5HYQA 1KJ3H 3FQNA 4PY8I 2D2JA 5A69A 1R3TA 2ZTKA 1NC2D 3SQOL 3L4WA 5DZJA 1TO3A 5C0GB 1AGFB 1DSFL 1IT7A 5FB8A 4GMSL 1YEHH 2HVOA 5JHLA 1XQ4A 1R86A 3LXUX 2N1TE 1DDTA 2V3DA 4O18A 1JZ8A 1EX0A 5EU6D 3DWTA 3F7RA 2AGJL 4ANVA 3OKKB 2AJ3B 1GKEA 2HK0A 3DXAD 3WE6B 1KLZA 5JXQA 3ILEA 4C6MA 3OJVC 1E3XA 1H63A 3PWUA 1P4IL 1TJGL 2CO6A 3MJ8A 1NDMB 5F3HB 1R5WA 1NICA 2N3JA 3MRJB 4DOHB 1FL5A 3IJ7A 1T4KB 2ZCHH 3GSOA 2QCEA 5C7XH 2E76C 2EACA 3TT3H 5CU9A 2IANA 1D6VL 3ELFA 3BN3B 2WXFA 5IVXB 5JBEA 4L64A 2QL1A 3QB7C 3N1PC 2EDFA 4CU7A 3APTA 4K6AA 5DYOB 3ZPDA 5L2KE 4LMQI 1IFGA 4CNOA 3V6FB 4O2EB 2PMZA 2ITCB 1VCGA 2IPKA 2AJXH 3C09B 5L8LB 3V0UA 4FZ8H 4TUJB 1ZLUK 4QJ1A 2FO4A 4KKNA 2H2SC 1H51A 2HCVA 4JNZA 4X60A 2IWGA 3CSYB 5KWYC 3CCHB 5TAOA 3OKMB 2JMRA 3QQDB 1QFUL 2R4SH 1KIRA 4XXWA 4D6GA 4Q9RH 2BINA 4XCYA 5FOOA 2L0DA 3CWOX 2WXLA 2FYMA 5LN4A 3S35L 3SQRA 2R1PA 2CAKA 4Z7NB 4LBAA 1H7NA 4U1JA 5CCGE 4HIJB 3NN8A 2P5EA 2BZ7A 4MPQA 1LO0L 5D2NB 4O5LL 4G5ZL 4IJRA 1H2JA 1OD9A 2ZKWA 5LQBH 2YD4A 5LHEA 4L1GA 1BD2A 3VWKB 3VFTB 3MXVH 1E0TA 1OCCB 2Z26A 2EP6A 2AI0H 3TBSA 5J4MA 2XKSA 1AQ8A 3DPBB 1GYWA 4XBSA 4U5KA 2H26A 3IKKA 1R24B 3G1YA 2VXTL 5LGKA 2ZZ7A 3MRQA 3TMLA 3PV6A 2JI2A 4C6BA 4TNGA 5EH1A 1LQ0A 2F61A 3EFOA 4LLVB 3FFCB 2XJKA 3F03K 5CP3H 4I5RA 4BELD 5B39G 3ABSA 2W81C 1IAMA 5D04C 2AABL 3RZCC 3ZL4H 3TQKA 3PE9A 5EYWA 4QO1B 1PZ3A 4UM9A 1MUCA 3DGBA 2DLFL 1F8TL 4H26B 3GS0A 5AG8A 3G5YA 5DD6A 1BFOB 1BQHA 1N4XL 3E8VA 3TDFA 2VDGA 3F01A 3ILPB 3QC6X 4C90A 5E93A 3MJYA 3MS8A 5C2GA 4HC1L 3DFTA 5HAOA 1GZ1A 4DZIA 5IM51 1CQYA 2J6EA 2WWMC 5TPWL 1AJ7L 2WXMA 4PJ9D 4GUPB 1M6OA 4ODVL 1ONXA 1PB0A 4ANKA 3MLWH 1HCVA 4GAJL 3G1RA 2IXQA 5IHWA 4PLJD 5DMIH 4F57L 1NBZA 2C3VA 3RVXC 5HHVH 1YW1A 3BG9A 4EPBC 1KZYA 1KCSL 1W32A 1K4DA 3CZUB 3VOHA 4P4KA 3EJYD 3QIUC 3TJHD 3IT8D 4ZQMA 4Q9QH 3ZTNL 4XNQB 4NQVB 1MDLA 4B7LA 3VFWB 3VQLA 3R7MA 35C8L 4YBLC 1FFQA 3U7WH 1UOZA 2AGTA 1VFBB 3DOSA 3F83A 5EUOF 5ITBH 1E6JL 4RK8A 5LA2A 3NPXA 3BHBB 1DCLA 3UDWC 5DC9B 4NWUL 3KPRB 2FIKB 5F0LB 3BFQG 2XISA 1WBYA 2J73A 3FUKA 3KX6A 1H3PL 3TPUB 2XA3A 5GRZA 4C6QA 1GVQA 1IIGA 3FYEB 1DXIA 1X6LA 4F91B 3S6DA 1HGYA 4IKIA 4HIIA 4AIUA 3NYZA 5KTEL 5A6LA 4JFFA 2NDGA 1GS8A 3IXAA 1CFBA 1K8CA 2BNQD 1Q6OA 3B9KB 4QHMA 1UG9A 5EBWB 3LN4B 1E2ZA 1LDPH 4N4YB 1CG9B 1T89C 3KPSD 5CCKH 1HQ4A 1A4KA 4UMCA 1Z6JT 1BPLB 5KJ7E 4Z3TA 2W4XA 1RK0A 4L5FL 5E7FA 1JGUH 1RZGB 4TLKA 5K39B 1M7IB 4UOW0 4JFDE 2QIWA 3TYUA 4CILA 2VR2A 1B4LA 1G1KA 1E9QB 1C8YA 4AEFA 3ULVE 3MNWA 2F08A 4ATDA 1D8WA 4MRBA 3LB6C 5CLWA 3WZ0E 2L7QA 1W1TA 1SLVA 3JYCA 1NU5A 1XIBA 4W4QA 4QJ5B 2BIOA 1F4HA 1L4IA 1Y65A 1AO7D 3RGVB 4M48L 1KFJA 4QCEA 1D5IL 5AW1B 3AU1A 2I26N 2OKMA 4EWJA 3M8OH 2Z1PA 3SZ8A 3QJAA 3EHBD 3IJSA 2IAMB 4C56D 3FKUS 4RAUA 4H5SA 1CD8A 1XFCA 2NXZB 4UT9H 4WV1C 3BP4A 3GTVA 2VR3A 2FJSA 3FV9A 1P6CA 4M7ZB 2ICSA 3ZW3A 2YK1L 2VDOH 3B04A 4L4JA 4UWQB 3SQSA 3QS3A 4IIEA 5AC5A 1YO4A 3QSRA 1JAEA 3KZ8A 4GYPA 3H85A 4UFJA 1XR9B 3JBG7 4XN7A 4O0KA 5CPQA 1QKZL 3OAZK 3NCWA 3QO1B 5KVEL 4Q32A 1BAFL 1WZKA 1QUMA 4IRZL 4PSRA 3L3IA 4MMZA 4P3WA 4AWUA 1OK6A 1CQKA 1BKHA 2ITFA 4A35A 1OE3A 3IMBA 4DBUA 3U0HA 1MG3C 4NQSA 4GI6A 3EMCA 4E6MA 4G3YH 1KB5B 5KYNA 1BWVA 1MFCH 3SGEH 1L2QA 5D4HA 2GHWB 3A4JA 1S4IA 3TM6A 3T65B 4NZFA 1R5VA 3BT2L 3ZKNC 3DX4A 5E2VL 5IHUL 3WTUA 3OBEA 4U49A 1WICA 1WUZA 5I74C 2QPXA 2OX5A 3RWDB 1JZGA 3NAAH 1Q3NA 3S5SA 3HE6B 4A6GA 1RUKL 4HJJL 4LSSL 4PJCA 3VNKA 5DEJA 4NQDE 3MBXL 1LE9B 1ICSA 4Y5VB 3HE7B 2AXHA 4HCDA 1JNNH 5FM5O 1GTFA 3WY2A 4OV4A 1H11A 5D7JC 4I5BB 4M3JA 5HTSA 3CHOA 3U6RB 4B91A 4RSVA 4IBSA 4UIKL 4Q2ZA 4C4BA 4HJSA 1TE6A 1ZCOA 1UOLA 4JZJC 2PA6A 3GR7A 1KJMA 4JQXA 4DCQA 5CJMA 4N9GA 4GY7A 1F3EA 4U6VL 3LN9A 3W2UA 1C08A 4WI9A 3RDTC 5I75C 1CDCA 1WKFA 1BPVA 5I3HA 2X9ZA 1HX0A 4XZWA 1QAWA 1WBJA 4G1KA 3MTRA 1NUFA 2AK4E 4YHYB 5FFGA 1KFGA 3K1DA 2VMEA 3MCKB 5JHDE 5FYLD 5DHYB 1IEXA 1GZJA 1I9RL 5B8CB 4ZTYA 4UYQA 3K6NA 4PRIB 4LOCA 2OQJB 3HIJA 1YUHA 3ETSA 3SDDB 5E9DD 3T0WA 2C9PA 2XWRA 3GIVB 3FB8B 2WSKA 3TA3C 5HHPB 1OD7A 3IRCA 3H6OA 2Q3RA 3M0ZA 5IB1A 4C6LA 3MA7B 5I0VA 1E4MM 2XU2A 4LCIH 5JXAH 2Z7YA 3BPCA 1P0KA 3Q58A 1XCTA 4KWSA 1ZBKA 3MUJA 3FEMA 5MP6L 1UZHA 4R96A 2IAAC 5T1MB 3FQTA 4MQ7A 2TRYA 4DWHA 2V8MA 2CHNA 2MQGA 4M5YH 4QG8A 3RLGA 5TDOA 4U6YB 2IKGA 2ZKHH 3TN4A 2YJQA 3SDXA 3IANA 3F64A 4M1CC 5DURD 4R90H 1MZZA 1EFXB 3BVVA 4HYVA 2X4UA 1DVJA 4L29B 2E4FA 4AEEA 4GXVH 4ZMXA 4J3TA 4H25B 3CQ0A 4Y5XA 4RAHA 4P23C 3SN0A 3KPLA 4BZ2A 1J8HE 1WDRA 2R8WA 5T5FA 3DGRA 4PJ5A 4WVXA 3CBRA 4LSTL 1OFBA 1HDMA 3WJSA 1DQKA 1UJ3C 4GC3A 1RJLA 2DJSA 4WEBH 2NQ5A 5IFPA 1G7MB 4DERA 1SHWA 4FQHB 1L7IH 4RFNC 2BVEA 4O9HL 5F71A 4JG5A 2LAAA 4J3OD 1JPHA 5DUMH 5EA9A 4YU1A 1N64L 4G8EB 4UAOB 4XVTL 4DWDA 2WXJA 2IV9A 4HIBA 5ADPL 1BMZA 3EGDB 2YEZA 1NARA 4H41A 4JX5A 5DK3A 1EA0A 1IM9D 2YUXA 4R4NC 3KPPA 1OSEA 4LSQL 3G5WA 4A6YH 4KDTC 5G2NA 1A0CA 4JFOA 3PK7A 5JIIA 2OODA 4EDXB 2R2HB 4DKDC 2Z2UA 3X12B 2WGNB 5K9QG 4GW4A 4LW7A 3KYAA 1IEWA 4PJIE 3BCJA 2VT0A 4JKPL 2O6EA 5E7BA 3HNTL 3NMEA 3TVMB 4F8QA 3BAXA 2APTA 3A4WA 4US5A 2C13A 5HDQH 4G8FB 4GG8A 3S4SG 3WO4B 4FI6A 3WYRA 3JWNC 4GRLA 3W7CA 3U3HA 1AQDA 3ZKXB 3VI3E 2BMKA 1U3JA 4P5SA 4N2NA 2ETWA 1FJ1A 4B41A 5KS9B 3AAZB 3MCLH 4H8WL 4NQXA 1LT8A 3W4RA 2NUYA 2OXNA 1TWDA 3N25A 5E2JA 5I1KH 4X5LA 1CFTB 1CXEA 1OW0A 3APDA 4M61A 3TYEA 1ZPUA 1KFKA 1A6UL 4L4TD 4P8UA 1YBQB 1UD5A 4HA1A 5K1NA 4TQHA 4I0PC 1MFDL 2ACQA 1FZJB 5GRVL 4PJ7E 4BSJA 3MV7E 4YLCA 5A6MA 1FSKC 1K5NB 4R2GD 2I9TA 4E5XG 5C9RA 1Z6KA 4CN4A 4GABA 4ZE4A 2EXYC 5BV7L 5EEXA 4DXVA 5DTFB 3CVIH 1DTNA 1XBXA 1XLFA 2OXHA 4EOWL 3NPVA 2BW4A 1A0DA 1HZHH 3KRBA 3NQIA 2CLVB 3PL6C 4FTVB 2V5SA 2OMTB 3RGHA 2JQMA 3TH3T 4YBHA 3CQFA 4MFEA 3B9OA 3C2OA 5I8KH 2AZAA 4LFHG 3KVDD 3BOLA 2TODA 4ZDHB 2AKRB 5ESAA 3IE9A 4ZO7A 1JWSA 3DERA 2XV6B 2FX9L 1VA9A 4Y1AD 2VELA 4AIOA 2P48B 4IOSA 4Z7UF 4IT1A 3VGAC 3LS4L 3DFHA 3WIHA 3UJTH 2CKBB 2IDCA 2XPKA 4B3KA 1ET7A 3KBJA 3HI6H 1QW8A 2XZZA 2QZ5A 4KPHH 1BTCA 1M7DB 5E1HB 1XGPA 3U7YH 2C3GA 2HJLB 2NV1A 2W8CA 2J1XA 4QLKA 3KWWA 1UD3A 4O02A 5L88H 5E0QA 2INEA 2DIKA 2WMGA 3VFNA 3W2DH 2H9GB 3C08L 2X4NB 4Q97A 3EWXA 3W56A 5MEPB 1Z5YD 2Q76B 3M1BB 4URIA 2FQDA 1OSPH 4PG2A 3BJTA 2DJXA 3UG3A 1HKMA 4YZFE 3CLFL 4GYBA 1T8XA 3HGRA 4PMEA 3U0TB 3HLAB 4XC3L 4O8AA 2QQLH 2HDJA 4HUMB 2VNCA 1R1CA 1F97A 1L6YA 3QQWA 1S3KL 4XRCB 5E5UB 5EDXA 2FJHB 4EN3A 1P6FA 1FH8A 1L6SA 3UTTD 1CI3M 1U6AL 4HFUH 1F11A 4L9LA 1B2WL 1G6RB 5CCJA 5JORA 3L3GB 5JOFA 3NJLA 4HSOA 5FJPA 3PJLA 1SOXA 1U8QA 4WI6A 4CBPA 1RPQA 3GSUB 1T1YA 3FT0A 1BJ8A 3VK5A 4M1DL 5BJTB 3K2UH 2QQKL 4HU4A 1N0LA 1VAHA 1IC7H 3TCLB 4O1FA 2W0LA 2DP3A 2QVMA 4JHWH 4XP5L 3UESA 1YEKL 3ABKB 5IQ7H 5FESA 4ERIA 1M4KA 4HSAC 2QSCH 1PD0A 3MMEB 4L3CB 4FXGA 3TTSA 2BGSA 1HHJA 3H2CA 1TJRA 1SVZA 2WXOA 2QLVB 3TF7C 1NANH 3RKDD 2JCCE 2YDQA 4PRPD 4DN3H 1LL4A 4UT6A 3E0LA 4PWIA 2AL2B 2CK2A 3QZ6A 3QGVA 5AC7A 2QCDB 1I9CB 3QTGA 1YEHL 3BAKA 5AAWA 3TFBA 1F6LL 5KSUB 2GL5A 4XTRC 5FYKH 4BWWA 2J88H 1RSCA 2VN3A 4TM9A 4MBRA 4JPQA 1HAUA 3F04A 5KZCD 1NIDA 5I06A 3AYRA 5DJZA 1W0VB 4ZPVA 1AG1O 3QCUL 1SMAA 1XIGA 2E74C 1OZQA 1T5XB 1LWHA 5FS5A 2W6RA 5C71A 3IB4A 3P30H 4YHPB 4N0UA 1AGEA 4FAMA 3PGDA 2ZCHL 3QZLA 3PJSA 3MRNA 3B8UA 5C7XL 2AMGA 3QIWD 2VDRL 3KPQA 2EAWA 1A3ZA 1BXUA 1G87A 2QBWA 1TV4A 5HDBE 3UVAA 2IIJA 5C0JA 3I50L 4MASA 3U0PA 4E9QA 1CE6B 2R39A 4IWWA 3LPOA 2AJXL 5D1ZA 4FZ8L 4NT0A 3LCWA 4RL3A 1MCOL 4KVCH 3ZLFA 1TVBB 1X7TA 3L7FA 3M6DA 3UPMA 4H6RA 4UINL 3RLVA 3NK4A 3DTXB 4PB0L 4RSYA 3KGSA 4KMQA 3E38A 2PO6D 3SZKC 3OKEA 2SEBA 4YCPA 3LG3A 1WBZA 1UZ8B 3MRMA 4K3GA 4KUZH 1PYWA 4WFGE 4YHIB 4OIAA 2VQ1B 3SE3C 2UYLB 2V5JA 1NAMH 4H9XA 1LEKA 3PUGA 2AQQA 3V4BA 1OT2A 4ZSOA 4JGJA 3VI4A 2BVUA 4KOCA 4LMQE 3CDFA 4XAZA 3SDCD 2J7GA 1Z3GL 4ZFOB 3MXVL 2P5NA 4C55A 3WJJC 4UTIA 5AZ0A 1WYIA 1QSFD 1NKRA 5A7BA 1EDQA 2G37A 3QXDA 5FXCH 2F7FA 1P6WA 4RISL 5DMGD 1WJ3A 2QKIB 1FG2B 3IFLH 4XNYH 1G43A 4HD9A 3ESVF 4UNUA 4OJDH 3HG0A 4JAWA 3FTUA 1MUMA 2WXNA 1AJ0A 3TFKD 1IC5L 4LSRH 3TOYA 4WWKB 1XHGA 3E74A 4J3XA 4JANB 4G8GE 3S37X 4GINA 4R97C 3GC3A 4WDUA 5JW4N 3ZL4L 2XZAH 1JS4A 5T3XH 1F1DA 4P2RD 2DJLA 3TJEL 5A8PA 3PFRA 3QOMA 3P3SA 1M1SA 2AKMA 3DHFA 1J1XL 2ICEB 1P7HL 5IHLB 1QR4A 3RNKA 3GR4A 4B5XA 4M8QA 3MPGA 2C9SA 3EKZA 2X0YA 3LEXA 4KERA 1HXYB 4OF5A 1P0NA 4AV0A 2V9RA 3NVQA 4QY8A 5FV1L 5IR1B 3MLSH 4NUJA 2V0TA 4BFIA 4LLMB 1E1FA 2F5AH 2KYIA 5C9WA 3FOLA 1AFSA 4UTTA 3NQ8A 1NOWA 4DJDC 3QWOB 3A5FA 3MLWL 1CYGA 2YEQA 4ZENA 1IGCL 3UZ5A 4HG4K 3NIGE 4PR5A 3P9MA 2IBZX 1WRFA 2X1SA 1N5YL 3ANUA 4G8AC 1KKOA 4Y4FD 3DGGA 3FO0H 5E08H 1RZIA 2CUMA 3UP1A 5HHVL 5AHNA 4YVPA 4H6EA 1W2PA 3W76A 1RZJH 2ENSA 4OGXL 1QOQA 2AV1A 1A5OC 3UZEC 2NY3D 3R7RA 4FXJA 4GCXA 4Q9QL 1R9XA 1UWXH 2YWZA 4YDVA 4ZBCA 3UWWA 3P84A 3IMSA 5GS1C 3U7WL 1QPRA 2W9LA 3MUAA 3IEAA 1IEVA 3KVPA 2E6DA 4JFPB 2WAGA 3N44F 4Q89A 5C08E 1U4EA 1M53A 3CV7A 4MDPA 3OVPA 1PPIA 5I23A 3V0VB 2ORBL 4KDTA 4PRHD 5A6AA 3VXRB 4L1LA 4BKTC 3C5SA 1BVOA 2JKEA 1RJRA 1VBRA 1KV8A 5FAJA 5HNNA 2BOBA 1Z42A 3PAZA 4W5UA 4NN6C 1HEZB 1IVTA 3ME0B 3GQFA 4D72A 4ZUWA 2D7NA 3HR5A 2RFXB 1KJ2H 2PXYA 2OFJA 4WI5A 2VEFA 2R1WA 4KTEH 2GQHA 4AZUA 1CTMA 1MRQA 1CICA 5ID0B 1V54B 3W0WA 2WQVA 2FSDA 4L9YA 5KYWB 1LDPL 2D4FA 3L3HB 3HC0B 3UTSE 3S3PA 3KBPA 2O6DA 4D3CH 2MSPA 2B5IC 3M0IA 1B0GB 2J8HA 4GFXA 2XVKA 2FTAA 3FSVA 4A7QA 4QRPD 5ISZE 2ABBA 4GSUA 4P5UA 5LAPA 3HUJB 2PTUA 1OC6A 2V2XA 2BWGA 1FY6A 2GK0B 4U5IA 5K59F 4I0PA 4K68A 3W39B 3QA3B 3FU6A 4LEXH 5F9AC 2HNHA 2G4GA 4BKSC 5H37H 4JFHD 1MCRA 2EDNA 2WCAA 1YEGH 4UB9A 2XTSA 3EYFA 2VMDA 1QPOA 3BVUA 4UBDC 4KI5C 4V1DA 4O2FB 3QMRA 1UB3A 3VXPB 2E27H 1IGWA 3WQ4A 4UT9L 1E0WA 2EUXA 1LYQA 3RG6A 4Y9PA 1SJEB 4ZMVA 4U1MA 3WXWH 1GZHA 4IFRA 2APSA 5DC0A 2WSRA 2L8AA 2VDOL 2XY2A 1NDGA 5DQJA 4DTGH 1IEIA 3KCLA 4YGVB 1R3QA 1ADQL 3CWHA 1H8OA 4P5MA 2IS7A 3RAJL 2C3HA 1HH6B 5I6OA 1J5TA 4MSWB 3OGVA 3TYDA 3ZFHA 4AXWA 3AVEA 3I7QA 4HJ1A 3ZLQC 4XO3A 3SQBB 3MYJA 1XRTA 2IH3A 1KGCD 2WJ5A 3HFFA 4XXWC 3OMNB 2DYPB 2H2SD 3EJUA 5T1JA 1OINA 4IMAA 3EWWA 1JXKA 4MA3A 4OCXH 4YSQA 4OZFB 3JTSA 1MCHA 5G1MA 3BSGA 4UIMA 4A8IA 5FF3A 2GUOB 2OBGA 4G3YL 2YAFA 4U1HA 3KDNA 1BXVA 2Y3AA 1MEHA 3P7YA 4HU2A 1A64A 5E1AB 4HETA 5DRXB 3MLTB 3I10A 3A6CH 1THFD 4GKLA 1GAFH 3H2FA 3D4YA 1D6EA 4HJUA 4M6NH 3CXHK 4Q8BA 3BWWA 5DJDB 5I9QB 1NQKA 4JRFA 4YNYB 3E8UH 1Z3NA 3NAAL 4XNDA 1QSEB 4KTGA 3NJIA 2X12A 3ZOAA 5DRNA 3DI0A 5EBUA 2G3ZA 3E2QA 4PRBA 5K33A 3AIRA 3B2XA 3DC8A 1JDEA 4TTUA 8RUCA 1JNNL 3DJRA 4J2QA 2ZXCA 1XR8B 2V8LA 1CLYH 3PUCA 3R7QA 4JGMA 3ZLHA 2NPLX 5EG6C 3W1TA 5H4YA 5DXXA 3B3DA 2DOCA 3UADA 4LF2A 3RZCD 4ELKB 1VKFA 3F65A 2UWEF 3RIAK 4Q4RA 3MUGB 3VRIA 5BXFA 1S2AA 5DRZA 2N1KA 1QHZA 1ETJA 3V79C 1KM4A 2BWQA 2E6YA 4HGMA 3TK7A 4PJGA 2X4PA 3LI1A 2AF2A 1GTEA 4MAYB 5INCB 3IJ8A 1SSGA 1HI6A 1QFPA 1CW2A 2BOFX 4L8DA 1VFSA 2NTFA 3GAYA 2ADYA 2JV6A 3DSNB 2NCMA 1TTAA 3ANVA 1MHHA 2EDDA 3ZWSA 5HVGB 4OD2B 4XTIA 3BW9B 1EEUA 4L0YA 1UUMA 3VACA 4OT7A 1V51A 1ZV9A 4ELMF 1B2YA 1KUMA 4EDWL 1W80A 5E8PB 1WDDA 1L0YA 2W0KA 1TTJA 4TLSA 1Z0MA 5DCCA 3CX5J 2EO1A 4V27A 2F58L 5C09A 3O81A 4P4KC 4PBDA 3RVXD 2ZX8A 3TC9A 4WHCA 1AQ0A 4LCIL 3PP7A 5JXAL 3EXJA 3QIUD 4JM0A 3AB0C 3WDRA 5EZJA 4UTLA 5JBDA 4KDVA 4DBSA 3I02B 1FVPA 4MWAA 3K7UA 1KFAH 3QH2A 3IJDA 4PW4A 3TV3H 3GRWA 2EINB 1V4YA 4JM2A 5BZZA 2HH0H 1E7VA 1SM3H 2NW2A 2ZKHL 3NSNA 2BNRD 4XBPA 4GIPD 2J4WH 3ZKQD 5J11C 4FX8A 3GBNH 3PU7A 2GAZB 2OMWA 4F2UA 3FIGA 1EH9A 3T0DA 4J6IA 3FOMA 4F8TA 3NP3A 2JJWA 3WBXA 1XZWA 3KXFB 3FCSA 4GXVL 5EUOB 3UACA 2E6FA 1DLFH 4U0QB 2WYZA 3VTAA 4MHBA 5IVXE 3AICA 4HUUB 2X1OA 5F7UA 2GY7B 4B9FA 1C93A 3MHUA 3AW5A 4UQ3A 3KHOA 3GDCA 2PETA 4I13B 3BD4A 1L7IL 2V5KA 4N2FA 5B39B 4MRCA 2X0SA 5FLUA 3GLZA 2PDNA 3HRZA 3OVUB 3TP4A 2HVKA 1TDQA 5GS3A 4IJBA 4WIWA 5DUML 4KK5C 3HG1A 1JCJA 4L1HA 1FZMA 4MKMA 4H7VA 1JFQH 2DZWA 2AW2A 3PJNA 1PYMA 1UUQA 4RRPG 4ZXBA 3THUA 3R4IA 2QDDA 1FAIH 4BWTA 4IRJB 1VPXA 1U1JA 1BG4A 2VP8A 2Y8VA 3SGJA 3PHQB 1FNEB 3B8TA 3LB6D 3Q1SL 1FWSA 3C2RA 1EBPA 1UWSA 1RAKA 2WVSA 1JZIA 2H47C 1YC8A 3D5HA 2D23A 4JZ5A 5D2NE 3EB4A 3MDJA 1SEQH 3I6TA 1MVUA 2J47A 3QFDB 2BVQA 2P8PA 4J6RL 4AEHL 2GC7C 2HP4A 2A2QT 2LLEA 2ICWB 4QGTA 1CJYA 1XMWA 2VRQA 4L3EB 2Q09A 5J3HC 2AEQH 4JVPA 3UNDA 3LMYA 4GMEA 3CFBA 1W72A 1Q9WB 2BNJA 2GSMB 4OGQC 4GYPC 2JK5B 4JN1H 4HHPA 4N8VB 3GXMA 3RFRA 2EPNA 1DE4A 5AHIA 1O12A 3FFCE 5L4MA 4MMZC 1TA3B 1AZUA 4MKSA 1V27A 1L9OA 2IWEA 2LFGA 1NTHA 2ODHA 1GVOA 1EL3A 4AY7A 4D8AA 3RPMA 4MXQC 1NMAH 4MA1B 4W9EC 3QYQA 3UR8A 3GTTA 4K9EC 5F1NB 1CT5A 2FQFA 2EYRA 2ZXDA 5E2TH 3HI5H 1WZAA 2OELA 4I9XA 5DI8B 1JPSH 4CN1A 4PTWA 5TJWK 3CVIL 3BIBX 2Z8WC 3IKCA 1LYXA 4F4RA 4G1EB 2H90A 3EX1A 3FJ4A 1CI1A 1MJ7L 2YLAA 3IE4A 3QLLA 2NLIA 2ZXAA 1EPVA 5AC4A 1T3FA 1CXIA 1W3TA 2WYIA 3ZKND 3O41B 2NZIA 4BCXA 3KM1A 1KTRL 3LV5A 2OQYA 3V1PA 5KN5A 1MFNA 3UJSA 4GQQA 2DQFA 1TZ9A 3HGSA 5GGTA 1BXNA 4K3JL 4UDUA 1E1CB 5FOBB 2P50A 3CFNA 2OMVB 3E2HC 3PZTA 1AQKH 1OGSA 4Z7WA 3FA3A 4A2FA 1PKQB 5D7JD 1J6OA 4L4VB 3CDZA 1YSOA 4JQXC 2V5DA 4YVVA 1T2XA 2W3ZA 2AJSH 3VOJA 5ERWA 4KRPC 4KPHL 1GC1H 1ZT1B 4D6CA 3QMSA 4KPLA 2N7AA 2ZZ4A 3U7YL 2JE8A 5AZEL 1F3WA 3P3BA 3L4YA 2FEEI 5XIMA 2YGOA 3FQUA 2L5HA 3RDTD 1N8ZB 3HPJB 1XIJA 4JB9H 2CMRL 1LD9B 4HVXA 3W2DL 2F84A 1U2YA 4JD4A 1F6FB 4DUVA 1NDVA 4LARL 3K8LA 1SM9A 1LEGA 3WFDH 4DKEH 2MIZA 3BWSA 1O6TA 1OSPL 3N3TA 3ZWTA 1V3HA 4FL4B 2OLDA 1X9RA 4L1BA 2TAAA 2YPVH 4PRAA 3CZFB 4JHUA 3AUOA 4JKNA 2QQLL 3Q05A 3TA3D 5EZPA 2G2RB 1WCBB 4WSJA 4MF4A 1NP2A 4HWUA 4HXBL 1C8XA 2G0LA 1UZGA 4EIGB 3JU2A 4P4RA 4ZX6A 1S1PA 4UR9A 3NRQA 4ZOAA 2ZUNA 2AQWA 3Q43A 3P0GB 2G60L 4GO8A 1EAPA 2RMNA 2P52A 1FIGH 3K2UL 5EPMA 4XO8A 2DM3A 5MHSD 5BXTA 1XIHA 1EJRC 4K1WA 1XGQB 1UMYA 3DA0A 3WH9A 5AVRB 4YDNA 4XG1A 1BTMA 4OQTH 4M1CD 1ITXA 3H4FA 4M4RA 1N2RB 2VXSH 1LZOA 1TPH1 4Y5XC 2EDXA 4R7LA 4LHQB 3FKKA 3ML9A 1V7NL 4P23D 4QLLA 1MNUH 5EBAA 2Z8SA 2XFYA 4PWFA 5E1QA 3CN3A 3HKZA 2NUPB 3TYFA 4ZB5A 4ISVB 2J88L 3NZ8B 4FYRA 3IDNA 1F3JB 1IQWH 4NAMA 4DBEA 4MGXA 3S96A 1TKWA 3NEHA 1O60A 4NRXA 4N2DA 4JRYB 4X4MA 4IMCA 8FABB 4LASL 1CYWA 1MREL 2YCIX 3LOTA 2QGCA 1JZ6A 4AQLA 3WJLA 1I2PA 4YO0A 1ZFJA 2D2OA 3WJMB 1FZKB 2FJFA 1GR7A 1URLA 2J78A 5EO9A 3H9SB 3UBXG 2X3BA 1ORSB 2H6RA 3HV9A 3NSJA 3CQHA 5AFDA 4R4ND 3TROA 5LXGH 5I6XC 1POKA 3TZVC 2HRLA 4NQEE 1CLOH 2E75C 3IMVA 3GYEA 1D9KB 5TTRA 4ONGH 2JIXA 2CCLA 3FRPB 3ZDXF 3S88H 1EJOL 2FSEB 3H8AA 3WMSA 4W6YB 1N5AA 4EZMA 1ZVNA 4KVCL 3BAEH 3E9UA 4GRLC 4IKLA 3P0WA 2PNDA 1V0LA 4RZ4A 1G0YR 1KEMH 2WVVA 3S5LA 5KZ6A 4J12A 4NX5A 4M93B 4D8ZA 1J5OH 2C3ZA 4KUZL 1N6QH 4LALA 2ZUQC 1S2UA 3ZR6A 2E9IA 1O7VA 4N7QA 5CWSB 5EMKA 1R2RA 2V30A 1OW0C 1CPUA 3PG9A 3SGKA 1EO8H 3C5QA 3SYAA 1HL2A 4TQPA 3BOVA 3HNVL 5I07A 2FZMA 4PEEA 1P5UB 3N85H 5EEYA 1JPST 5I8OH 3L4ZA 1MWAA 2H0FA 2J8UB 2OKOA 4M0XA 3M0VA 3PWJA 3T0TA 3ZJ8A 1FDJA 2WCGA 1AD0A 5M7QA 2EXYD 1NPUA 1GWJA 3IFLL 4GUGA 3ISRA 4TQTA 1Q94A 5BZDA 2PYEB 3K2GA 1URIA 2FEJA 3P0XA 3DV4A 1S7RB 4PRIE 3RJQB 4X9IA 3PL6D 4D71A 4LSRL 2C71A 2ZE3A 3MV8B 1FV1B 2FD6H 1HL4A 2HLFC 4MLJA 4IIQC 1MI5E 2XZCH 1F76A 4GH3A 2XZAL 2FB4H 1WISA 5I1IH 3VO0A 2GVEA 3GTHA 3E2SA 2FZ3A 4LFYA 3M17A 5LCVA 4XMUA 3HMWH 1PBYA 4GIRA 1QDSA 3F84A 5IBUG 2W07A 5A2IH 1I8IB 1AKJB 5C7HA 2VZTA 1FVEA 3E0VA 4KWWA 4LCVA 5IOBA 1ZAHA 4B3ZA 1UJQA 2WMJA 1D5BA 3IYLW 4CNIA 3MRGA 2F5AL 5FLVA 4MLRA 1I82A 4S2SA 3GSNH 5HY9A 4HN8A 5HYJE 3DU0A 2P24A 2A6IB 4RE3A 4GJIA 1EJVC 2CHZA 1PQZB 4PJEA 4DW2L 4FAAB 4Y8EA 4RX4D 1H9DA 1NCOA 4X6DA 4IGBB 4WD0A 3BN9C 4MJ4A 1DWGM 3S4SB 4F7PA 5E08L 1MELA 3EJCA 3FFDA 2HVNA 3MP4A 4FQQA 4JGUA 2CIKA 4MCYA 4QTIH 4CEUC 2AQ3A 4QS5A 4PG2C 4XUGA 1MNSA 4NAFB 2DRUA 4PCPA 2WZPD 1M2OA 1SQMA 5FUCC 4M6QA 2PP0A 3LKQA 4MAVA 5AVVB 4JO1L 2QHRH 3CSPA 5AW0B 4NDMA 4EXKA 3QKEA 1BXCA 5C0AB 4LSPH 1DBTA 3RHGA 3PZUA 4MGGA 4Y7EA 4EN3C 3FF7A 5G4OA 3QHTC 1Q9LB 5I02A 4KJWD 4PJAB 4ZW3A 4L9LC 3QO0B 1AMYA 3DIPA 5D2LB 1IBZA 2ISVA 3D3VE 3BANA 3ZT6A 3DHPA 4WOQA 4ONVA 4E5XB 4WJ5B 3S34L 3VVGA 4CNSA 2M83A 4PTVA 1EHNA 1S7XA 3QQ3B 4QOKB 3SE6A 4BH8A 2IF7A 2A74B 2NDFA 1BEYL 4CQ8A 1HKIA 3QDGA 4QHPA 4KTEL 1OP5H 3B5TA 2ODIA 3LIZH 3MJWA 4W5ZA 4FXGC 1SZNA 3HAEA 3KJ4C 4HCRA 2V7HA 2ESVD 3QRLA 5SV4A 1G9NL 4UOJA 5DMNA 4GRWF 3II3A 1VBJA 3VIFA 3VINA 2V81A 3UJJH 3KZPA 4NNPH 3RBGA 2EDOA 4HSQA 4PN2A 3LZ5A 4MLSA 3VCLA 1MIML 5IOKA 4DKFL 1FCUA 5AAWC 4PVLA 4HZAA 5IBXA 3KS5A 4WTQA 1RPXA 4IHBA 3VGEA 2OS7A 5DMLA 4ASTA 1F58H 1OY0A 4ODTH 4D2NA 5F4SA 4XTRD 5KS9E 2EUZA 5HPMB 3MUZ1 1YVLA 4FJYA 1CO1A 4KRMB 2ZUUA 4UM8B 4DGWC 5T1KB 1UR3M 1YEGL 5FDWB 2Y5TA 3NL3A 2QJJA 1DEEA 5IWLA 4DP4X 2EICA 3LQZB 3D85D 4Y1TA 4UTBA 4LESA 4NKQB 5D7KE 3QZWB 5F4XA 4Z95H 2ZA2A 4IJ3C 1E4IA 1Z89A 1WOBA 5D7HA 2J71A 4A3QA 4I7WA 3FB7B 1K6QH 4EK7A 4DTGL 3QFEA 1XBYA 2GBAA 2DPKA 3OXSB 4P7RA 5HNRA 1OE1A 5J1TC 3C5JB 5D1ZC 3WFEH 3VD3A 4Y8FA 4FTVE 4QM1A 5LGYA 4XIAA 4WW2F 5D9PA 4M51A 3FSWA 2V5CA 1OTUC 3IGSA 3QW9A 3V4VB 4L6OA 1K9TA 1XG4A 3QUML 4OCXL 3IETB 4UQ2B 4QHKI 1HWGB 5HQMA 3B3IB 3BJLA 4B2DA 2FLBT 3Q94A 1RUQH 3MRLA 5FKPA 1UC6A 1WFTA 5CD3A 3VDAA 5FM5M 3W3OA 4P2AA 4Y9GA 3MLXL 1A9EA 5BQ7A 2B1HL 3EWDA 4GO9A 5H94B 3ZTEA 3WAKA 1MCEA 2CZVA 4X6FA 4M6NL 5C07E 3P5YA 2D7QA 2V2WB 1TQTA 1TV7A 4NZTL 2OSYA 5ABAA 1C91A 3E8UL 1ZE3H 4H9YA 2YXVA 2D3LA 3L4CA 3VXME 2HK1A 4FQ2L 4MZ1A 4KJYA 2KS0A 2B39A 4HOWA 1QNZH 1E56A 1UBPC 2DV0A 4UZUA 3DX7B 1YHTA 3BP7A 4BGLA 5DXYA 3SY1A 2AV7A 1HE7A 1KCXA 3H2EA 1NIBA 1ZT4A 3BFOA 5JQIB 1B3XA 2IH1B 3DRQB 3HB3C 2K4WA 3TZNA 3F00A 4DXKA 2EKCA 1INEL 4LEQA 4TF4A 3EBHA 4F79A 1LNUA 4LEOB 3DBXB 2ZC1A 1LO3L 2X1PA 3LVTA 1ZV5A 3RRAA 3BKYH 3T3PB 3VZXA 1JD9A 4IOTA 2A4EA 3CH8A 3N9SA 4FOUA 4UTTC 2W94A 4O51A 4DY1A 4KKQA 1OKEA 3FQRB 4KXZI 1NLDH 1JK9A 4N5UA 2Y7EA 4HS6A 1XDJA 4X9YA 3GHTA 1A7OH 4DJDD 2HLAB 3UIYA 3VFLA 2Z0BA 3UGVA 3VYLA 3GAKA 3A3HA 4PJFA 1SJXA 4G9DA 3KLHC 5K9OB 2ZOXA 2YRZA 4RZCB 2IW0A 3UEZA 1F6AB 2LVEA 2OM5A 3VUSA 1NCBL 3HU7A 5AB1A 4IDJH 3GKWH 3ZE1F 3CN1A 4X9GA 5IQ9A 5E4OA 3BSHA 5ICYB 4OAWA 3REVB 2WWNA 2PDLA 1T5AA 2VSKB 2WO2B 3VD1A 1DPMA 1KFAL 2MH4A 1UYWL 2GQ9A 2JJSA 2ZXQA 4OZGA 3IGAB 2E7FA 3WIFA 2QVIA 3TV3L 3T0ED 5E24E 3VFRA 1DSYA 2HH0L 2RDWA 5BO0D 1X96A 4GLRI 4JN7A 1EYWA 3TZVA 3JWOH 4B60A 1WKYA 3SY0A 5JUVA 1DL3A 4XN5A 2APFA 3NJVA 5C5YA 3IV8A 4XMLH 4U2ZA 2PTVA 1DQDH 3N44B 3FUEA 2P8MB 3QAZB 1DLFL 2PXYC 5A43C 1R3JA 3T77B 3HHSA 5G4EA 4IYKA 5ACLA 3PPFA 1UKQA 3CC5A 4AIZA 1CICC 3TBYB 4KX8A 3P4OB 3FDKA 5I66A 1TTRA 5TBOA 4JLRA 2IO5A 5IB2A 3GE7A 2Y22A 4KXAA 3OGCA 3GMOA 1LXMA 5HJ3B 4R7XA 4E9YA 3OVRA 2NR6A 2WXPA 4Y7MA 1C12B 2JJTA 2ZCKH 5GXBB 4FQ1L 2GT9A 3QEZA 1ETB1 3N0AA 2YQ2A 3DHJA 5E99L 4YX2L 2E7CA 4WTXA 1DQVA 1TZGH 2GVJA 3UTZA 5DMMA 4HYWA 3NSYA 1FCGA 1DQXA 3Q67A 1QI0A 2VIRA 3Q9QA 1R7OA 3LGDA 3FU7A 1D5MA 5C0DB 1IAIM 1HKJA 4ZOEA 5BVJB 4ZMGA 1V6UA 3T78A 2NLJB 4N42A 2NW0A 5AC8A 2WLYA 5SWSA 2K9UA 4HUCA 4U6HA 3AADB 5SX5H 2DIBA 4J3OG 1Z8AA 4UBDD 1GZHC 1HHHB 2V7NA 4FHKA 1DJSA 2IAND 4DPPA 1R85A 1PVHA 3RTQB 1ZVSB 1EZ2A 4AKQA 3SUVA 3TUUA 2I7OA 5E5RB 3WLSA 5D93B 4IIQA 4HUKB 4QIRA 3TBBA 4JN1L 1NBVL 4NQCE 4LKXB 4NUMA 3HQPA 4N9DA 1YA5A 5I6KA 5CLZA 2B08A 5SWZA 5HJLA 4H01A 4CN6A 1MO0A 5KZEA 4NENB 4E2OA 4MSSA 2FBJH 3CLWA 3EPOA 3WENA 2ZFAA 4KMTL 1JDFA 3S97C 3FVDA 1NMAL 5KSVA 5I3JA 2Y25A 2W9MA 1AZVA 1YNPA 4HXAH 1XF2B 4GRMA 4ZUVA 4F33A 3QDJA 4TMPA 3GSQB 3UQNA 1JPSL 3KNBB 5KYXB 2P5ED 2JFEX 3LN5B 2FYYA 3QXVA 2B16A 3Q3GA 1ZLSH 1RAMA 3DAQA 3VDBA 2MUCA 2W95A 3QHFL 3QG7H 4NNXA 1BD2D 3RL2B 4P5KA