5HDRA

Crystal structure of a bacterial fucosidase with iminocyclitol (2s,3s,4r,5s)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
445
structure length
440
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a bacterial fucosidase with iminocyclitol (2S,3S,4R,5S)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords Alpha-L-fucosidase
total genus 158
structure length 440
sequence length 445
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5hdrA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5hdrA01
2JF6A 4MNLA 4UFIA 3TTQA 1J18A 3L4ZA 2VCBA 4PCTA 3WF3A 4M56A 1EDGA 2F18A 3PZGA 1EDQA 1KBBA 4J3TA 1BTCA 1H4PA 5A6BA 4MB3A 4URIA 2X2IA 3S5ZA 4BS0A 4WIWA 4D6JA 1HVQA 4AD3A 3ZM8A 4HPHA 2XM1A 1WZKA 1ODUA 4CD8A 1B9ZA 4AD2A 4HMDA 2AAAA 1U33A 1KGXA 3VGHA 3RJXA 5FOOA 1UR0A 4GI6A 2WMKA 2F7RA 2D20A 2ZX8A 4A4AA 2D3LA 1RH9A 1VEOA 3RO8A 4EAMA 3ARPA 3CH9A 3SCOA 3RCNA 4P7NA 3AMGA 3GYCA 1NP2A 4ZFMA 1F4AA 5BXTA 1E6SM 1RPKA 3M46A 1GQLA 3HJEA 3K4DA 1AVAA 1NQ6A 1C7TA 2G3MA 1K6AA 2X09A 4TVCA 3O6AA 4M8UA 2EPLX 2GK1A 3I3DA 1CGXA 2V3DA 1AMYA 1DHKA 4A3YA 1OIMA 3ARZA 5JBDA 2XYLA 2ZUMA 2DEPA 2F1AA 1BQCA 1J0ZA 1R33A 1EGZA 1PBGA 4JAWA 5BXSA 1EOMA 1PX8A 2VX6A 1WDQA 2DPEA 2WMJA 2CETA 5FL1A 1BAGA 1NWUA 1MFVA 4HU0A 1XH1A 4GI8A 3BVWA 2VL4A 3IK2A 4Z2HA 4EANA 3VX1A 1NOWA 1CGTA 1M03A 3NDYA 4FF5A 5HXMA 2GUYA 3GZAA 3S2CA 1HJQA 5I23A 3RIKA 3W28A 3NSXA 1IV8A 5M5DA 4GZIA 4NF7A 3OLIA 4TXEA 3VMNA 3VO0A 3NDZA 4HTYA 4FNSA 1QWUA 1J11A 2DH3A 5HNNA 5E0FA 1JAKA 2PF0A 3ZJ8A 3VIJA 1VRXA 4WLCA 2WPGA 3UG3A 1JZ3A 3WY1A 2Y24A 1JXJA 4AMCA 4ZXOA 4PMZA 2X2YA 2WXDM 1XSIA 4V2XA 4D1JA 1ISZA 1FH9A 2CEQA 4MB5A 3N13A 1DWIM 3WQ4A 1SMAA 3EJUA 4AD0A 3RILA 1GCYA 1ECEA 4GZJA 3OG2A 2WZIA 2EXOA 5BWFA 3BUDA 1C91A 3I3EA 3PZ9A 3N1AA 4H8HA 3OGRA 2XGBA 3EDEA 1IT0A 1PX3A 4PMDA 1V0MA 3VIKA 4AZBA 1OT1A 3ZT6A 2W92A 1RD6A 1J0KA 2UWFA 2VURA 1TQTA 4AC1X 1UR4A 1DEDA 2XVLA 8CGTA 3PBGA 2F7PA 3LRMA 4MB4A 1DTUA 4LYPA 4ZXLA 4DO4A 1Q4NX 1R46A 3W38A 1PAMA 4GZEA 1TG7A 4PMYA 1V6UA 1H09A 2VZUA 1JZ7A 4ACYA 4PTVA 4LYRA 4CD5A 3D51A 3BLPX 1M01A 2J78A 2VZOA 2X8RA 2JEQA 3WF0A 3DHUA 1JYWA 3T0BA 4YHEA 4W8LA 4CCEA 2ZUVA 2Y8VA 2WKGA 3WUEA 3AMDA 4AYGA 2DT1A 4W87A 3MANA 4UQAA 1KR0A 4JKMA 2DSZA 2WVSA 1FP8A 4NXSA 5TD4A 2FH6A 3GXPA 2JIEA 3TV8A 1HP4A 1WE5A 2WK2A 3BVUA 4PUDA 3SIMA 5CGTA 2VZTA 4HU8A 1EO7A 4NZCA 4BCEA 1E5NA 5A95A 2J7CA 3VM5A 2YA1A 4MDOA 3VD9A 1DP0A 3ALGA 2WVVA 4HZ6A 4AZCB 1NWRA 1TFVA 3U5YA 2F7OA 3UESA 2YL9A 3BUPA 4MNJA 1UD4A 3OB8A 4ZE5A 4UOJA 4W7UA 3GXDA 4MPKA 3FXYA 4V27A 3WEZA 1XYFA 1AQMA 1XV8A 4W85A 5CGMA 3EBVA 3S6TA 1HXJA 1M53A 5I0DA 1TQUA 1R7OA 1N82A 2ZWYA 1JDAA 1TMQA 2CPUA 2FHCA 3IGUA 4LGXA 1FHLA 1V08A 3ZJKA 4UFHA 1UR1A 3CZJA 4PTXA 3LPFA 2CCRA 4UFJA 3VD3A 5ABFA 2ZUUA 4J28A 1HXKA 3EDKA 1E56A 3SCQA 2E8YA 2D24A 5A3HA 2JE8A 3W26A 2XFFA 3WDQA 3D4ZA 1GHRA 3WF4A 4PMVA 1EQPA 3ARXA 3K46A 4CGTA 5C8BB 1E4IA 5CSUA 2W91A 1G1YA 3BUQA 4WSJA 1JYNA 3TOPA 3SUTA 1KQZA 1UR9A 1ISYA 1W1VA 2OWWA 3WBAA 4U3CA 2E9BA 1C93A 4E4PA 1JIBA 3AIWA 2WLZA 4GKLA 1C92A 1WNOA 1V0KA 3VGBA 3BH4A 1NWSA 2AMGA 4QCFA 3VSTA 3VDAA 1HP5A 5BRQA 1G0CA 3S5YA 3G6MA 4N42A 1C90A 4AZ6A 2WMGA 3M07A 2BY3A 2DT3A 3WUFA 2CKSA 1ISWA 3BAXA 1OGSA 3BMVA 1GUVA 2QMKA 3WDHA 2ZX9A 1Q6FA 4DWSD 4JHZA 3BLBA 3F5JA 2ESCA 2YOCA 4H41A 4D71A 4HMEA 4BQ2A 3WY4A 2QHAA 5JBFA 1AQHA 2PC8A 1QOXA 2ZXBA 4J3VA 1W1PA 2WBGA 2IXVA 4GQQA 3VKKA 2WVVB 4J3XA 1XH0A 1W9UA 3W82A 3CHCA 5CSYA 3WQVA 2VZSA 2VVSA 4BQ4A 1UWRA 4FNRA 4PMRA 3VGDA 1E6QM 3AIBA 3BMWA 2GSJA 3SUSA 5A8PA 1CXEA 9CGTA 1WPCA 2OSWA 3VGFA 5KZ6A 1O7AA 5A6SA 1E0WA 1CTNA 3ZO9A 1X1NA 3KE0A 5GPRA 4J3UA 1C7SA 5CZKA 3FN9A 3AROA 4PTWA 3MV11 2CXGA 4HMCA 4AISA 1CBGA 4YHGA 1GOQA 5AY7A 4HOWA 2VI0A 3HU7A 1ISXA 1GQJA 4B3LA 1W3HA 2W5FA 1SZNA 3EJSA 4U31A 1VBRA 3LRKA 4P7RA 3ZT5A 1BYBA 1UKSA 2CITA 3WIJA 2PBOA 3BVVA 3VM7A 3ZOAA 1E4MM 2A3BA 3N18A 3BSHA 1OIFA 1UG6A 4MADA 1W9DM 5D4YA 2VRKA 2G4FA 3W53A 4DWSA 4DWSC 1JYVA 5I78A 4FNPA 4CKQA 1CECA 1WZAA 1TVNA 2WCSA 3L4XA 4M24A 4H2CA 2BHZA 5E6ZA 1KWGA 3SUVA 3VMOA 2XG9A 4NRSA 1UA3A 1CWYA 1DWGM 3T2PA 2DDXA 3H54A 2VR4A 2XFYA 1EXPA 2QLYA 3DX0A 1NP0A 4D6HA 1VEPA 1GJWA 1UD3A 2CHNA 5D9MA 3ZSSA 5A8OA 5CQ1A 5CLTA 1UASA 1GOIA 3DYMA 1OM0A 3L4VA 2JEPA 2ZX7A 2CYGA 4ATDA 1VFMA 1TR1A 4W93A 1KFWA 4TOQA 4XZWA 2VUYA 1J0JA 3LXAA 1B30A 1ZBCA 2D0FA 1TQWA 1S46A 3GNRA 3VMPA 3GNOA 1GOOA 4BA0A 5A6LA 2Z1KA 1LG1A 5ABGA 2ZUTA 4CU6A 3UG5A 3VD5A 1V02A 2DIJA 2O9TA 1AQ0A 3JUGA 3CZGA 5E09A 3RJYA 1FH8A 4QLLA 1JDCA 4OZOA 2E4TA 3TONA 1F4HA 1K9TA 2J7EA 3DECA 3DDFA 3NSNA 1JZ4A 4TX6A 2VRJA 1FHDA 3AXHA 3OIHA 1OB0A 2CHOA 4FK9A 4DO5A 2D3NA 1CNVA 4D6DA 1CPUA 2Y8KA 3MMDA 5CLWA 1QBAA 1HN1A 1UR2A 3FHAA 4PBGA 4J3WA 4YN5A 1CXLA 1RP8A 4W8BA 2MANA 2YL6A 4W5UA 2F7QA 2XSBA 3AIUA 4GIAA 3MUZ1 4P7LA 2EADA 1TUXA 1V3KA 5DMYA 2YDRA 4A3HA 2WM0A 3THDA 4MJ4A 1CXIA 1HWWA 2GJPA 3ZSTA 2OSXA 3AI0A 4M82A 4ZENA 4C7DA 1UZ4A 4DM2A 4FMVA 3PZVA 2EAEA 1BVZA 3SCPA 3AHZA 2X2HA 3QHNA 3W29A 2WSKA 3D3AA 3ZR6A 3FW6A 2WWCA 3ZJ7A 1QW8A 3MMWA 1TCMA 1VFOA 3AIVA 1KTCA 7CGTA 3T2QA 2ZICA 2X0YA 1QI5A 2X05A 1BG4A 2X0HA 3BSGA 3CBWA 3VIFA 2XTKA 3PZOA 1JZ2A 1NM9A 2PBGA 4WJXA 2W4XA 1PEZA 4AIUA 3AMCA 2UY5A 2A3AA 1JL8A 3LX9A 1QVBA 1D7FA 5ABEA 3D4YA 1CZ1A 4UFKA 5FL0A 3ZJ6A 1E4NA 1JZ5A 1WZLA 1GQKA 4ATWA 4CU7A 4OOUA 3VDHA 4JL1A 3ZT7A 2J4GA 3EMQA 2BHUA 3CHDA 2WSPA 4W7WA 3D52A 1CEOA 3F5KA 2IXUA 3NYDA 3QHOA 4AYSA 2UY4A 1WAWA 3II1A 1RP9A 2BNJA 4PTMA 3FHQA 3HG3A 1MXGA 4H8UA 4KWUA 2QPSA 3QOMA 4C7GA 4D6EA 5HPCA 1OD8A 1UUQA 3SUWA 2BY1A 3N04A 3BCFA 5I79A 6CGTA 4QAWA 2IGTA 1XRVA 1X6NA 1EA9C 1B3XA 1QHPA 1E1EA 2EJ1A 5IFTA 4R5EA 2GDVA 2Y2WA 1UKTA 3KZSA 4AZ5A 2EO7A 2HVMA 2J7BA 3EYPA 2E8ZA 2VQUA 1Q6CA 1EDTA 1XCXA 4TUFA 2ZX6A 3POHA 5JBEA 3AS2A 4F9DA 3VU2A 4NX0A 1FFRA 5A6BD 2BFGA 1T0OA 2ZE0A 4DO6A 3CZNA 5D8ZA 4GI9A 1UH4A 3B9DA 1GOKA 3WDRA 5LA1A 3OZOA 4YPJA 4RE3A 2XN0A 3CGTA 3AYSA 4D6CA 3HG2A 3IANA 1NARA 4UQ9A 1JDDA 2G41A 3WN6A 5HBFA 1GVIA 4QFUA 2C0HA 4JHOA 2J62A 1L8NA 3LPPA 5IHSA 4TVDA 1ZJAA 4DUVA 4AZ7A 1JGIA 3PZQA 1E71M 1SMDA 2F61A 1OGBA 3UERA 1KQYA 2DT0A 2ZUWA 4JFUA 2BS9A 2W63A 3OA5A 5BRPA 1EH9A 1H5VA 4J27A 1CXFA 1KGUA 3WDJA 3OBAA 1BYAA 3AOFA 4D72A 5GNYA 4P8UA 1GORA 2WHKA 3AZRA 1UHVA 1EO5A 4U2YA 3RM8A 1ZS2A 3KEHA 4MJ2A 1VBUA 2EPMX 4JZ5A 3ARTA 3WH9A 2E9LA 2EPOA 3AYRA 3VDBA 3WF1A 2GK1B 3EJRA 3L4WA 1B2YA 3SCVA 4S3KA 2FYVA 1E73M 4GO9A 1BG9A 5CPTA 4WKAA 3T0DA 3VX0A 1HKKA 4TX8A 2FGLA 3A4AA 1LWHA 2YDQA 1OBAA 3EMZA 2J8FA 4XV0A 3UR8A 5ABHA 2J77A 5JUVA 3AQUA 5GNZA 1R7AA 3AHVA 3NSMA 1HT6A 2PWFA 1HKMA 4AZGA 3IJ8A 1FA2A 5GQBA 4HZ8A 1HNYA 2XIIA 1HJSA 4PMOA 4E8DA 1E3XA 3MS8A 2AOSA 2FHFA 3L4TA 4PEEA 3WD3A 1HTYA 1X6LA 3VOCA 3CIVA 3WDIA 2BVYA 3FNDA 4W86A 4XX6A 2OYKA 3SCNA 4FLRA 2W62A 4IUGA 3VIIA 1D3CA 4WSKA 1W9PA 4FNTA 2FH8A 5M3WA 4ACZA 1HVXA 2EACA 1LL7A 3WMSA 5IDIA 5E70A 1CLXA 2XWDA 1UR8A 4CVUA 1QNQA 1TVPA 2G8ZA 1KWKA 1OWQA 1GNXA 3U7BA 3LPOA 4HA4A 5A2BA 1CGYA 3W25A 5C70A 4D1IA 3PZUA 4KRTA 1TQVA 3CZKA 1KXTA 1E6RA 1BYDA 1NOUA 4KH2A 5A69A 3D50A 3WD2A 2WHLA 5JIPA 4WF7A 1EHNA 1W9BM 1MQRA 2DQXA 4AWEA 1VENA 2J7GA 2NT0A 4AXNA 3A23A 3WNMA 2D1ZA 1QNSA 2JIWA 4C7FA 4PMXA 2GDUA 3EJQA 3VSUA 3PZTA 1XD0A 1C3FA 1BVNP 1J0HA 2CIPA 3KLKA 2XWEA 1GOWA 1W3JA 2VZVA 4AMXA 4L4PA 2XGIA 4JCLA 1NOFA 4WK9A 3H55A 4IM4A 2BXZA 4JFVA 1WKYA 1I1XA 2EBNA 5A6MA 1UD8A 3B9EA 4MNKA 2J7FA 5HOSA 1UWQA 1U2YA 3WQ6A 1BGGA 1W3LA 4F8XA 3K8KA 1UD6A 3UEQA 3MI6A 3DHPA 1EOKA 3MSGA 3MO4A 2W61A 5CXPA 4TVUA 1Q6GA 1HJVA 3WBEA 1QX1A 4CCDA 3DX3A 3VIOA 3L4UA 5AYIA 4M29A 1JYXA 3ZMRA 3AS3A 1VEMA 3GXMA 3QHMA 3EJTA 2WZHA 1B1YA 2D22A 4BF7A 3WL0A 4AY1A 1GOMA 4W8AA 1CGUA 3HMCA 4TTUA 2PWHA 4OBSA 2GJRA 2A3HA 1MXDA 3WEMA 5A1AA 2CKRA 3THCA 2OW7A 1C8XA 3NCOA 1UKQA 3EJPA 3VIGA 4AD1A 3VINA 4FNUA 4JL2A 1W1YA 3WH6A 4CD6A 3OLGA 1UYQA 1H0IA 2V5CA 1U30A 1VJZA 1B31A 2X2JA 4NXKA 1V6VA 3AISA 3F4VA 2JALA 1MW0A 4H7VA 3CTTA 3WF2A 3RM4A 4LXFA 4B3KA 1K9FA 1J10A 5AC5A 2DH2A 1CGVA 5CPQA 1CENA 1MWOA 2F1BA 3FAXA 3H53A 3WENA 2G3IA 1ITXA 3OLEA 5A8MA 3HZ3A 1FOBA 3GH4A 6A3HA 4MDPA 1JAEA 3VTRA 4NZFA 3TP4A 2C8NA 1HL9A 4FLSA 4DM1A 1CDGA 4MNMA 2DSVA 2V38A 1PZ2A 4Y7EA 4UTFA 5I6SA 1B3WA 1I1WA 1DWHM 4MAVA 1ZBKA 4X0NA 1XD1A 5A6JA 1CGWA 3CUJA 4UZUA 2XN1A 2ZWZA 2WMIA 1NH6A 1ZBVA 4B16A 2VCAA 3DX2A 3BAJA 1MQPA 3WNKA 3DX4A 3DYOA 1TA3A 3K8LA 1W2VA 3IAQA 2BVTA 3DC0A 1UWSA 3WMBA 5A2AA 3VILA 4U3AA 4XZBA 7A3HA 2VJXA 5I3DA 1H3GA 1XC6A 3K8MA 3PTQA 5F7UA 4HA1A 1W9VA 4B9YA 3WEOA 1JD9A 4UQCA 4D6IA 3IJ9A 4GPNA 3M6DA 3WY3A 2WC3A 2C7FA 3D5HA 4AEFA 3MUIA 4HA3A 3EDDA 3T0AA 3RDKA 1CYGA 4AZCA 3CO4A 1B3VA 1Q6DA 3GH7A 4ML4A 3WD4A 5E6YA 1LJYA 1W1TA 1C8YA 3LXBA 3LXCA 1VFFA 4UQBA 2O9RA 1KR1A 1KBKA 3VNYA 3W37A 4HOXA 1HF6A 1ZJBA 4U33A 1JFHA 2QMJA 3UETA 3BXWA 4W5ZA 3AJ7A 2WHJA 1OCQA 1LWJA 2GVYA 1UD2A 3ALFA 4X0VA 1IZJA 4AIEA 3WQWA 3UCQA 4W89A 2JFEX 2G3NA 5IXEA 3VIPA 1R8LA 4UQDA 3SCUA 4AZHA 2E40A 1LLOA 1O7DC 2XN2A 2YIHA 3CLWA 5BYWA 5CG0A 2EPNA 4OOZA 4PMQA 3GXIA 1J12A 1LQ0A 1SFSA 5M17A 2ALWA 3BC9A 2XSAA 3N9KA 5A6AA 1R87A 2WMHA 3AMKA 2WVUA 3WNOA 1K9EA 3MMUA 1QW9A 4AZIA 3CUIA 4PYSA 2J79A 1XH2A 1XSJA 1R47A 1WDRA 3EDJA 1B3ZA 5E9AA 4L4OA 3KL5A 1R75A 3IJ7A 1YQ2A 2WC7A 1BHGA 3GNPA 1KCKA 2O92A 3VUPA 4P8VA 4W84A 4ZE4A 3A22A 3VGEA 2E9MA 1PJ9A 2FE0A 2DT2A 1UOKA 4JFWA 1PIGA 3BVTA 5HDRA 1JI1A 3IAPA 4KGLA 1UD5A 2OW6A 3QGVA 3AXIA 3B9AA 1HX0A 4AW7A 1J9YA 1E6XM 4KMQA 1VFUA 3BCDA 1W32A 1V03A 1US3A 2WMFA 4Q22A 5I24A 1BLIA 1G01A 4J3SA 4TTGA 1PX4A 3CZLA 2D0GA 1CXKA 4Q7NA 4Z2JA 3W6LA 1EQCA 5JIWA 1VJSA 1BGAA 2PWDA 2YKKA 3LPGA 4V28A 4DWSB 4P7QA 4UR9A 2EEXA 1XGZA 3VNZA 1JNDA 2PB1A 1G5AA 1V02E 1JFXA 4GO8A 4NRRA 2D73A 3AXXA 4B15A 3NJ3A 3T08A 4RE2A 1EHAA 4KRUA 5CPSA 3BAIA 4JCMA 1J0IA 3ZIZA 3ECQA 1PPIA 4P7OA 5EB8A 1MVYA 2J7DA 1KXQA 1WO2A 1V3HA 3L2LA 2J8GA 1QHOA 2XIBA 4PSPA 4OGZA 3GTNA 2V3GA 4AD5A 1M04A 1OSEA 2ZXDA 3I3BA 3POCA 3BAWA 3CPUA 2BVDA 5DT7A 2DSWA 4FNQA 4X9YA 3WH5A 4BQ5A 2WKLA 1VF8A 3BGAA 4PN2A 3AZTA 4EKJA 4ZEPA 4BQ3A 1E72M 2DIEA 2X1IA 3KWXA 2VR5A 2EQDA 3HN3A 2D23A 1Z32X 4WKHA 1V0NA 3EDFA 3MV01 1QBBA 4PCSA 3OGVA 2DSUA 2Q8XA 1QHZA 5A94A 2JF7A 2W67A 1HIZA 1E0VA 1MW1A 4NZJA 1B90A 1V6YA 1QWNA 1PS3A 2FHBA 1BYCA 2WC4A 4GXPA 1JZ8A 4HP5A 3U7VA 2WYSA 2WVTA 1LG2A 3APGA 1H11A 3VPLA 6TAAA 3WNLA 4OUEA 4W7VA 5KEZA 1E15A 4QLKA 3AIEA 1JI2A 2YL8A 1OINA 5GNXA 1Y7VA 1KXVA 3HG5A 1SYTA 3L2MA 2V5DA 3OZPA 5IHRA 3EMCA 4LX4A 1G94A 4CD4A 3VIMA 3WUGA 2Z1SA 5BXRA 2VO5A 1QI0A 4RL3A 3CUGA 3F5LA 1KCLA 2ZOXA 2CBUA 2V3EA 4GQRA 2WWDA 2CBJA 1V3LA 5BROA 3ARSA 3ARUA 3DDGA 3CUHA 4CUCA 1FH7A 2BHYA 4XB3A 3VIHA 3MUAA 5FD0A 1E43A 2O9OA 3SCRA 3W81A 3SCWA 2FGZA 3WUBA 3UR7A 2XVKA 1MQQA 4F66A 2IUZA 1H2JA 4R27A 4PRWA 4ATLA 4AMWA 1EIBA 4UCFA 4EK7A 1OGGA 2YL5A 3VVGA 1KTBA 2XVGA 4E2OA 1E0XA 4ACZB 5E1QA 1ZL1A 2YLAA 5A8NA 3PHAA 3CMJA 2BY0A 2WMIB 2YFOA 2BXYA 2XUCA 1TZ7A 3G6LA 3AMLA 1E9LA 5FIPA 2ZX5A 4CCCA 3BAKA 1B0IA 5E0CA 1ODZA 3AFBA 2E3ZA 2WANA 1E1FA 3AZSA 4Z2IA 2GFTA 1JG9A 3W6MA 1A47A 1E40A 4KGJA 3GH5A 4F79A 1WDSA 2RGLA 3CZ8A 1J01A 2WBKA 3N12A 3J7HA 4EE9A 3GXFA 1CLVA 8A3HA 4LQ1A 2WZEA 3ARYA 3NIYA 3KLLA 2WW5A 4WKFA 5ABFB 3T09A 2XVPA 2ZXQA 3RM9A 1UKOA 5I2UA 3QOKA 5EBAA 2FDMA 4OBRA 4MB1A 3WKZA 5DEZA 2VX7A 1E55A 4FLQA 2VCCA 1E6PA 5DF0A 2UY3A 4CVWA 4HPGA 2WNWA 3FY1A 3AHTA 1GVYA 3CC1A 1W91A 3WL1A 3CV5A 5IFPA 3UG4A 5C71A 2OSYA 1LF1A 2YA2A 3SUUA 1LL6A 4MAZA 3WELA 3A4XA 2VTFA 1R34A 3ARWA 3CHEA 1HL8A 2YDSA 2G3JA 3PZIA 3WQ8A 5LA0A 3VSVA 1V3IA 3RPMA 3HG4A 2B31A 4UOZA 1W2PA 1UWUA 1H1NA 3NUKA 4OJYA 3FAWA 3AIRA 3OGSA 3VGGA 3BUIA 2DGAA 1E4LA 4M1RA 1TQSA 3E1F1 5AYBA 4QCEA 4PMNA 2EABA 2BY2A 3RMEA 1GHSA 2CNCA 2ZUSA 2XHYA 1WDPA 3GXNA 1M7XA 4LYQA 5A6KA 4UQEA 3WD0A 3CZSA 3AHYA 3CHFA 3A6OA 1GONA 5BXPA 2O9PA 1ZU8A 2WAGA 4CN4A 1E3ZA 1MFUA 4H04A 5D8WA 1UKPA 3PZMA 4N0RA 3PZNA 3WH8A 2J7HA 2VMFA 1H41A 1US2A 4PSRA 2J47A 2CERA 2XFRA 3W27A 2QPUA 3ARQA 1L0PA 1IZKA 2BV9A 3MU7A 5CJ5A 3WDPP 4D6GA 3MSDA 1MYRA 4Z2LA 4IPNB 1FP9A 2WCAA 2XVNA 5AC4A 1WZMA 3BUBA 3U5UA 4AIOA 1XCWA 3CUFA 4S3JA 2UY2A 4UFLA 5EFFA 1V0LA 1WP6A 4UFMA 3ARVA 5M03A 3WFZA 1JNEA 2CBIA 1HKIA 1H49A 1GJUA 3WNNA 3MUY1 1B3YA 1UH2A 1KB3A 3TTYA 4RE4A 1LL4A 3AIQA 1A3HA 4P8WA 4Z2GA 1QNOA 4JFTA 4B9ZA 3SCSA 1DWJM 3WSUA 5EFDA 1QI3A 4FLOA 1E6NA 7TAAA 4DUXA 4AEEA 2XM2A 1PIFA 3SCTA 1E70M 4CN1A 5DT5A 1ITCA 1V6WA 3DYPA 1QI4A 2DSKA 4CD7A 3W0KA 2Y5EA 3AHXA 3K1DA 3SURA 2NW0A 1JXKA 2HISA 4JIEA 2CESA 2VVNA 2WHMA 3M7SA 2VT0A 1QI2A 4QP0A 1MW3A 1ISVA 4UZSA 3MKKA 3BAYA 3A21A 2GJXB 2VRQA 2QF8A 3VDCA 1I75A 2WCGA 1XSKA 2NSXA 3OLDA 4UOQA 1C8QA 2NT1A 1UA7A 1VAHA 3KL3A 2J75A 4H8VA 3K4AA 2RGMA 4BZYA 2TAAA 1HJWA 2F2HA 1W9XA 3O2LA 3GBDA 4OKDA 2YA0A 1V6XA 4CN6A 5HPOA 4IPLA 1JF6A 5ECUA 2VQTA 1GQIA 1BF2A 3CZEA 3WD1A 3VD4A 2F8QA 2EPKX 1V3MA 4M80A 2OWCA 1D2KA 4GINA 2VNCA 1NWTA 1UQZA 4W88A 5EMYA 1BFNA 1WCGA 3ZR5A 1BPLB 3N15A 4Z2KA 5BCAA 1HJUA 4QLJA 4PMUA 4UNIA 3WQ5A 3PTKA 2YBTA 3WFLA 3TTSA 3GM8A 2J74A 2PWGA 3LMYA 4JKLA 1GZJA 1P6WA 3AS0A 3A24A 1VIWA 3GBEA 2PWEA 4XUYA 4HZ7A 3B8SA 3WMCA 4IISA 4HOZA 2ZUNA 1V3JA 3DX1A 1O6IA 4OIFA 2D2OA 3U57A 4DUWA 3GDBA 1FFQA 4D6FA 2GJXA 1BSIA 2YJQA 1XHGA 4E8CA 1JZ6A 5A8QA 1HJXA 1JF5A 2ZIDA 3GXTA 4U5IA 4AD4A 1OD0A 1DWFM 1ZBWA 3O9NA 2XJ7A 2A3CA 1ESWA 5A2CA 1OT2A 3PN8A 4U5KA 4NSBA 1MW2A 2OYLA 1YHTA 2OLHA 1TA3B 5FCZA 4P8XA 1J0YA 1E6ZA 3W4RA 3TTOA 4PUEA 2VX4A 4CU8A 1W3KA 2WB5A 3A4WA 3T2OA 1UQYA 1UZ1A 3KL0A 4J7RA 1KGWA 5D9OA 3W24A 2VX5A 2Y4SA 1KXHA 1PZ3A 1UH3A 1VB9A 2CBVA 1GW1A 1GPFA 2YBUA 1G9HA 3ARRA 1R85A 2W66A 2D0HA 1E5JA 5I77A 2V3FA 1R86A 5D9NA 2PI6A 3LRLA 2QV4A 5LA2A 1K9DA 1HKJA 3PTMA 3VD7A 4F9JA 3WNPA 4LPCA 3TA9A 1DWAM 1Q6EA 3N11A 3A47A 3CMGA 2OWXA 1H0GA 1CIUA 5DFAA 4JKKA 2E0PA 3N17A 5I5RA 3A5VA 1QPKA 3A3HA 4QDMA 5FKYA 2YLLA 4NI3A 3L4YA 1WB0A 1UWIA 4U2ZA 2VC9A 1JD7A 4K68A 3AICA 5LYRA 1SR0A 3WY2A 3BLKA 2ZXAA 1QNPA 4M81A 3BVXA 3ZQ9A 1QNRA 1XYZA 1ZB5A 4MTVA 3AS1A 2OYMA 2VOTA 3QR3A 1TE1A 1CXHA 2XPKA 2YFNA 2WLYA 4JFSA 3WH7A 1UWTA 5D9PA 2J25A 3SEPA 5DO8A 2A3EA
chains in the Genus database with same CATH superfamily
4AKOA 2JF6A 4XUGA 1YEFL 3QRFM 4UFIA 4NF7A 4R5XA 1ML1A 4TVPH 5I8CB 3L4ZA 1HSAB 3FK3A 1SVZA 5EBMB 4DK5A 4IMLA 3RWGA 5HD8C 2VCBA 3W71A 2YUWA 3EO1A 4OI8A 2XIQA 3O1NA 3ZHNA 5KAQG 3DXAA 1RA0A 3PZGA 4KJWD 4KRPD 1GKRA 2V9QA 2Y3NA 5A6BA 3W9ZA 5J12C 3TJEL 9CGTA 5TFSH 4HU4A 3W7OA 1FN4B 4OQ1A 2OEKA 2WWKO 3HAEG 5L8LB 1T7XA 3PY9A 5I1CL 5JDJA 2B9BA 3QN3A 4TLUA 1W5MA 4TNWF 4D6JA 4QHNA 1HVQA 1U21A 1PKMA 2X2GA 4AEOA 3UBPC 2EIZB 1WZKA 2VW6A 4PY7A 2G97A 2DQEH 3IDMA 1ODUA 1MJ7H 3SJVD 2JBMA 7REQB 4WI7A 1AJZA 3ZZ1A 3VGHA 5KJ7E 5M95B 1I8MB 5FF2A 4C6DA 4JUTA 1F6AB 5D1ZI 3X14B 2C1HA 2WMKA 4XVJH 1QRNB 3LN9A 1TTIA 2QVNA 1QKZL 4NP4L 1AL8A 4H00A 2D3LA 2ALDA 3RU6A 3QDGD 3DG7A 5AZ2H 1RH9A 1FCQA 3SQLA 4WVRA 3LHTA 1JK8B 2YSTA 3L6FB 5TE6L 3GJFB 4YZFE 4WNQB 4P7NA 2IDUA 2E5CA 2HCZX 4GLEA 1U8MA 4DCQA 1L6SA 3G6AB 1M65A 5BXTA 2G9HA 1OARL 5I17B 2FBRA 3MV7B 3QISA 3UT0A 3DX8B 2YPLA 4OF6A 3HJEA 4KXZI 1GQLA 3NQGA 4P3DB 1T6MA 1OF2A 4ICXA 3U2ZA 3UZ5A 1NPNA 3NQEA 3E6EA 1RK1B 5EU6E 2XG5B 3G77A 5D04C 1DE4B 3TYGL 3W84A 2BERA 2JSFA 3U30C 5KYNA 2P8LA 3I3DA 3WLIA 3GNNA 5DK2A 1EC9A 3BW3A 3CAWA 5FEZA 1XF2A 3L9BA 4JPVL 3S6CA 4XISA 2ADYA 3V75A 2XOTA 3MACL 5JBDA 1UJ3B 3A64A 1BWKA 1G7LA 4G9DB 4APQB 2DEPA 3LH8A 2WQWA 2F15A 3L67A 5JMOC 5IB4B 1DJZA 5BXSA 2VDNL 4AENA 2DU2A 2KYIA 1QRND 4JR5A 3GI9H 3WS6A 5MEPB 4HH8A 1JPKA 2V30A 1WUZA 3DX7B 1WYIA 1K8IA 3HC3H 2R2EB 1E6OL 3DRQA 5F21B 2C9UA 2CETA 3MJMA 1TREA 3QY7A 1RZFH 2PRLA 2QIWA 2VC2B 1FWRA 4WJKB 1M3UA 3RU8L 4CADA 4PBWD 2ZRWA 3UJFA 2P10A 3R7RA 4K6AA 4NHCH 1BAGA 3UZVA 1NWUA 1HIML 2B1OA 1SZFA 3QDGE 4HU0A 5LKYA 3T44A 4PQXA 3ZZQA 4NCC1 1IC4L 3ARDA 2Z64C 3TFKD 4Q4EA 2A74C 4YTUA 2GUOB 4CRPA 5E5LA 2PO6D 3IK2A 1VYPX 2R4RH 1CFVL 3HMXL 4J39A 1NOWA 4JCWA 4ZBJA 2MOQA 3QZWA 5CD5C 1XF0A 3BPCB 3EBHA 4AWSA 4DGIH 3ASNB 3NAVA 3FUKA 2ICWI 4O1FA 3W28A 5D72H 4NJIA 1FBIL 1MZRA 2ODOA 1L7IL 2WBJD 1IV8A 4XB7A 1OAXL 4HD5A 5D1ZB 4LBRA 4APQD 4ANXA 3KVLA 3M0ZA 3OLIA 2D9CA 4GKZB 5IOKA 1W5OA 1FIGH 3VO0A 3NCYS 4Q6IA 5T1DH 4X6EB 4E9RA 1TPWA 2QAFA 4FNSA 3B0XA 1QWUA 1W0VB 4RNFA 5CKGA 1L2UA 5HNNA 1TJ0A 5C0RL 2WZ5A 5E0FA 1R5WB 4EO5A 3VGAC 1PB0A 5LIYX 4WLCA 4H1ZA 4KZCA 3WY1A 4A2FA 1PYFA 2CIKB 2Y24A 1OK0A 4XZ9A 2NX9A 3PJWA 5JMUA 3L5HA 1QAWA 1BLNA 3OJDA 4NDMA 3WQPA 1GYWA 3CFQA 3QUZB 1A6VL 2ZWSA 4EDWL 3U6RA 1ENUA 5MEND 1LXMA 1R19A 3KR3H 2WXDM 4ZZ9A 1OW0A 1YLBB 1I7ZA 3G1AA 1FH9A 4KROB 1XBYA 1E2ZA 4G7RB 2DPKA 5ESQA 4M7ZC 5AW9B 1ZKAA 4G6JH 2WUCL 3ZS4A 4YGVA 4IU3B 3W3BA 3E8UL 4V1DD 2EXOA 1T5XB 3UZVB 3I3EA 1OLLA 4NFDA 4CBPA 2Y63A 4F37K 3TBYA 5F6IB 2X89A 3LD5A 2R4RL 3LZLA 4FG6D 4OFQA 5D1ZD 1THFD 1OAZH 2XN9B 2ZCLH 3SKJH 5GS1B 1MCOL 2VXVL 2F54D 5I1JL 4ODXA 3C60B 2QUUA 1BVLA 2HLFC 2Q86A 4Z7NE 2W92A 2CWNA 4IOTA 4XOBA 1HIMH 2YPKA 1QFHA 5JQ6L 1LRNA 3NJLA 1DEDA 4BKLB 2DMCA 3QJVB 2V2XA 3BPOC 3T8MA 8CGTA 3W9DA 2I17A 4ZMOA 2OK0L 3CEPA 1WDAA 3FU6A 3MLZL 1EP3A 1XB6A 4MMXA 3QUZD 1KFJA 4H2AA 4D2NA 1PAMA 1XF2B 1UB6A 4G9FE 4M5YL 1TG7A 4GZEA 1JQXA 4XZ4A 2ED6A 2VZUA 1H09A 1KCVL 4GRLA 4O13A 2LLEA 2X4NA 1A1OA 3CN2A 3OHXB 4KQ0A 2WKOF 1OZMA 4ACYA 3DBXA 5EU3B 2Q10A 3WTWA 3IN2A 2Q87A 1MFEH 2WXHA 1NVMA 2FB3A 1NAML 4XWOD 4H8NA 4LUIA 1M01A 2J78A 1XYCA 4KUZL 4RIRA 3E38A 3UR5A 3SDCB 1YRRA 1X3DA 1DSFH 3DX8A 3DHUA 1YUHB 4M03A 3STBA 4GEIA 5L4IA 1KBVA 3EEZA 4Q7DA 5DWPA 3US0A 2Y8VA 3O0FA 3FO1B 4Z17A 5TK4A 4US6A 1QVOB 3ZLHA 5EOQL 1XIGA 2GGGA 3LEVL 5TK2A 2XN9D 3VXSD 5J8LA 4AD2A 5SWZA 2F54B 3DXAE 1BQKA 3QEQA 4UQAA 3QHZL 5CUSH 4KI5D 1J79A 2PDNA 4I13B 5H37H 2DSZA 2WVSA 3RMJA 1S7UA 4WQOA 4NXSA 2JLPA 2YJLA 5DRXA 1P1VA 5TD4A 3O8XB 1EB3A 4PGBB 1QUPA 2DN7A 4EUPB 1XIJA 1YN6B 5TE6H 1WE5A 3HZYB 1TJGH 3ZKSD 5EF2A 2Q09A 2WK2A 3A9BA 4EXKA 1ZT7A 1HOEA 1RJCA 3HGJA 4QY8B 1EPXA 1G6RA 2NUPB 2P5EE 1KCXA 3M0HA 1IBGH 2VDML 3QORD 4ODHL 2NW3A 1ZHAA 5FEWA 2AXHA 1ET7A 1YDYA 1ZE3C 3QQWA 4NZCA 4YTSA 5F9DC 4MMZA 1JJUA 1RIUL 4X6CE 5DMIL 3HBZA 3IJYA 4D7BA 2OX1A 4L1XA 1MJ7L 5A95A 4O00A 2YA1A 3ARDC 3BJ91 3B97A 3C6SA 1UOVA 5EOTA 1F9CA 5MKGA 1DP0A 1XC6A 4IRJC 1ZRUA 5IUSA 4HZ6A 3EJCA 1AG0A 3GSRB 2F7OA 2XA8H 5ESVA 2WTRB 1RMFL 5F4XA 3FQ4A 3TH3T 4K5MA 3SE6A 3RUGB 1AZ1A 3C6CA 3BGFB 4ZE5A 1JRHI 4JAMB 4QRTB 2WKJA 1A4JA 3GXDA 1BGXH 2HTKD 4Z7WF 3QC6X 3OHIA 3B3IA 5HGDB 4MPKA 2J43A 1VLXA 2VE6B 4U0RC 3B3DA 3FSUA 4AUBA 5CHNA 1BW8A 4MHHI 4OCRH 4PJBF 3MLSL 1NFIB 2R2BB 2ADGA 2JELH 1A14H 2WCPA 3W1ZA 1KM3A 1AD4A 2A4CA 4OLXL 2PRMA 1M6UA 3WLHA 4NYUA 1FWXA 3QDGA 4JDTH 2G5BA 1TJXA 4PBDA 4A6YL 5D5MA 3S6TA 1HXJA 5KINA 1A02N 4DZ8A 3F8UB 3FTXA 5I0DA 1TQUA 1YJDL 1JCLA 3W2DL 2N1TE 1Z69A 2CIIB 3HPLB 1SBSH 2VWEE 3CN0A 1PY4A 2XETA 3TEXA 5K1JA 1LT8A 2FHCA 2YZ1A 4LO9A 3STGA 3IGUA 2AF2A 3GMNB 4G1NA 4JNZA 3PWNA 4XCCL 5IM7B 1EUAA 1FHLA 4MG4A 3I75A 4O5LL 5ENWA 4U1MA 2QGDA 3PGFH 2XZCL 3QHFL 4PTXA 3LPFA 5LIWX 4AJVA 2ZUUA 3RKDD 5ABFA 2ZC1A 2FL5A 2VUOA 3SAZA 5HDBB 3QR1A 3VQLA 4KWOA 3RKPA 1PCWA 3S9YA 4WXZA 3PQYD 2J8UA 2VAAB 3NJMA 2W27A 2XFFA 4JHMA 1MI5A 1EJ6A 4N85A 1F4YH 4P05A 3D4ZA 5I0VA 1D9KB 3WDQA 1NIBA 5EN3A 5J13C 3WF4A 4XPBH 4PMVA 1YUKB 2OL3B 3MFGB 2EO9A 1MRCH 2NTSP 5CSUA 1E4IA 4LHJB 2FVNA 3NSJA 5I76B 1LUCA 4O58L 1L6XA 1HI6A 2CUAA 3LQAH 4MYAA 6TIMA 1NIEA 3EJZC 5F89B 3VXUA 3ZDZF 1NBYA 3BUQA 4PRIB 3ECVA 2DQCH 3MJWA 5DD5H 4W9KC 5I16B 2HP4A 2XBDA 4A2EA 3FH7A 1JYNA 1EP2A 3SUTA 4JFEE 4MAYC 1YNLH 3L9YA 3N9GH 4X5LA 4FXKC 3B2UC 3KWUA 2D8KA 4EQ3A 3AIWA 4OVVA 1UWGL 2HZGA 1E0OB 4RESB 3B9KA 5I6XC 2WSYA 3ISWA 2PPEA 4X8GA 5J4MA 3VGBA 2Y1AA 5BO1L 1NWSA 3LQLA 4U1MB 4IEFB 1R3JB 2IKIA 4GAJH 2J7LA 4QCFA 3V36A 3HQOA 1T2QL 3GIVB 4KO6A 5D7IE 1HESA 4GJ1A 1NGPL 3ULUL 5IW6A 1IFHH 5BRQA 3L0NA 4B5SA 4N0UE 3ULUD 3KHOA 3VFGH 1IC7L 1C90A 4ICCX 3VXMA 2X1XR 1T1XA 2F5BH 2GGEA 3M07A 1FNHA 5KTEL 4RGNC 1R2RA 4Z42C 5LGZA 1O7SA 4BEIA 1P5UC 3WUFA 1B4LA 4U1HB 3O3RA 1OGSA 1ZHLA 2JXMA 1G69A 4NRYA 2PDBA 2BP5M 4ZUUA 3NVDA 3V7PA 2A4ZA 2ACRA 1BDYA 2PDQA 2ZX9A 2H6PA 1Q6FA 3P0WA 1M71B 1JN6A 5DGQA 4ABQA 4OCWH 4BSVB 4ZQCA 4DWSD 2DF3A 4JHZA 2LU3A 2Z7GA 3BLBA 2BBFA 3F5JA 3I9GH 2Z4TA 2IKGA 2IIJA 3F62A 3M45A 4K8RD 2CLEA 3LENA 4MPQA 3D9AH 2CGZA 3L16A 3RWEB 4EEEA 4A6YB 3OKEA 4HMEA 3QA3B 4H8QA 4LCIL 2AZAA 5ES4B 2NZ1A 4LSSH 1AO7A 2G60H 1FG2A 1TU2B 2ZXBA 4J3VA 4NB7A 1W1PA 2CLPA 3FU7B 2WBGA 3Q5TA 1PKQB 3ZZSA 2WVVB 3KS0J 5C2BL 3VKKA 3RVUC 1GGBL 3NJFA 3FB5A 1VR6A 5FYLD 1W9UA 3ZXWA 3P3SA 3ZE1E 2YHGA 2TRYA 3LKOA 1PQZB 1EXBA 2DMBA 2DLFH 2NW3B 1UCBH 4LLDA 4J4PC 4WFED 4BQ4A 1V7AA 1SFDA 2ZWKA 1V7YA 3VGDA 4S10A 1GW0A 4S3BA 3BMWA 5AVSB 3NZHL 5DMGC 3S5NA 3F7YB 3P73B 3L3GA 4DEWA 4GD0A 5ILTH 2M8XA 4AYID 1KEGH 3K72B 4BJLA 3IGFA 4F2MB 4POUB 1XXFC 5JNYA 5BU6A 1SEQL 5DUBB 5HR6A 1GC1H 3LZPA 3R8QA 1IXOA 4FFZL 1O7AA 4NAFB 3BV7A 1KG0A 2J6EH 3LEYH 1CTNA 1E0WA 4RCAA 2A0LC 1X1NA 4ZXBB 2VC5A 3SDXB 2QS8A 3TFBA 3BKCL 4ZMYA 1RZIB 1QTPA 4RVBA 3X12A 3ZTCC 1HH6B 3OVUB 5GGRB 3G5EA 2AK1H 1XX9C 3Q8EA 1VP5A 5IK3A 1RUMH 5CZKA 3O2VL 4KPHH 3FTGB 2NX5A 4Z77A 3ZTDC 4DN4L 1ZLEA 3IJDA 4QYOA 3JRKA 1G6VK 4YXHL 3A3YB 4PV8A 4KQ3L 5C08B 3PUUA 4XTIA 2QDHA 4A3RA 1CBGA 3KD4A 4HOWA 2VI0A 4H7CA 1ISXA 2H2PD 5GGRA 5EZLA 4BD4A 2I9TB 2W5FA 4B3LA 4FL4C 1KCRH 3OHXC 1THCA 4NKMB 1DQQA 2JKWA 4WU5A 4NZTL 4E41D 1BYBA 2OB3A 4GRWH 3RWFA 3VG0H 3MJ6A 4YMZA 3IRZA 4Y7MA 3FZUD 1KNOA 2PBOA 3BVVA 3GQYA 2A3BA 1A6UH 1EEQA 4KY1L 3BSHA 2ANUA 1OIFA 5DXYA 2CO1A 1TTBA 2GQHA 1W9DM 1NCIA 5GJSH 2VRKA 4HLZG 2G4FA 1YEWA 3L3GB 3WTUA 4DWSA 3K6IA 4DWSC 1IKFH 5GS1A 1I9JH 2HG0A 2W3ZA 4ONFL 1OO2A 2OZTA 1GOXA 4J8QA 4UV7L 3V52H 3K71B 1JUEA 2QR6A 2OZ4A 5GZOC 1SJHA 4PJHB 5E6ZA 1KWGA 3SUVA 3RPTA 3VMOA 1YXYA 1SXNA 4LKCB 2IAMA 1PQZA 4H41A 1RLDA 2VDRL 2GBUA 3HRZB 3T2PA 5AAMA 3WHXA 2DDXA 4K8HA 2PN5A 3X1BA 4PLJC 4E41A 3QNYA 3QUMB 2VQ4A 4ZUVA 3O9WC 4HFWA 3U1PA 5C0JB 2XFYA 1U6AH 4B5NA 3CQHA 2NZ9D 1VPOL 2QLYA 1NP0A 1F6LL 3AWOA 4NP7A 4L8SA 3WL9A 5FPIA 5I1EL 1ZSHA 4D6HA 1VEPA 1GJWA 2AJSL 3N41B 4LL9A 4Z7NB 4Y90A 3OKYA 1D9KA 1UD3A 4HUKB 5G2NA 3KVMA 1EPFA 2XN9E 1Q72L 2VAAA 4P9HH 3CBKB 3MRGB 5DD6B 1FQ0A 1J1XL 4Z3HA 1P7TB 2PDWA 5G4HC 2VDOL 4ZX3A 2R1PA 3RZWA 2J3SA 2JF1A 5CLTA 1UASA 4WHTA 4EQ2A 1IT8A 3R0DA 2V7NB 2YCKX 2PW1A 2EXYC 2OMWB 1VFMA 4CNSA 3B4YA 4FOKA 4W93A 2DEXX 2ZCZA 4PR4A 1TB3A 1X7QB 5A2JH 5B8CC 1PZSA 4KCUA 1MQ8A 1OFRA 5REQB 4ELKB 4JN2A 2VLKB 3K6NA 1TQWA 1S46A 4TS6A 1X9UA 4M9OA 4P2RD 2IPGA 3BG9A 4EJ1C 2VM8A 3R8RA 1A1NB 1MCIA 2ZSWA 5FS5A 3GNOA 3C8KB 1UXSA 4KTDH 4L9LC 3ZKMC 1QZ1A 5I3JA 3OD3A 2FDSA 2QUVA 5I74C 4Y9MA 1XAKA 2GC4C 3RVVD 1XISA 1X4XA 4QT5B 1EX5A 3VFNB 4R3SA 1LG1A 1ZALA 2A3LA 4H7ZA 3TKFA 5ABGA 3J8F7 2ZUTA 3VK5A 3BYTA 3UG5A 4QTFA 5I73C 5JW4M 4HJSA 2PDLA 4GBXB 3R5EA 4PJCF 3ZHLA 4N2MA 1UEYA 1KEMH 4XBGA 3W26A 3HF3A 5FSDC 1IBZA 4L2YA 5CS7A 5DO2C 3JUGA 5D38A 3T4AA 2EE2A 5KVEH 2ISSA 3RJYA 4QLLA 4ZQKA 3RIAK 4XX5A 1C8PA 4Z1BA 3LKRA 4X9BA 2V5RA 1SHWA 5FUZL 3TONA 2L5HA 5LDUA 3QARA 2EEDA 3CK0L 3GZOA 4OLEA 3HJZA 2AK4A 3KWSA 3DDFA 3RDTB 1RVFH 3IVTA 1A7PH 3JBG7 4PI2A 3NQIA 4DFHA 2VRJA 2WQUA 5HHVL 3HE7A 2PYFA 1LO0H 4NQDA 3PV7A 1JWSB 2NUPA 3IIVA 4A8IA 4GSUA 3KOFA 4JM2D 3AB0C 2HSIA 4AT6A 4Y7EA 3NIFF 4PJ8B 2QVHA 3PDOA 1FNAA 1NCDH 3O45B 4A8NA 2O72A 3PP4L 4G5ZH 2UY6A 2B0SL 3UBGA 1B6UA 4MRBA 1J86A 3MNMA 2F54A 3TX9A 3L3JA 5JU6A 1V27A 1FGVH 4W5UA 3SGUA 3AZUA 2ENQA 4NP9A 1RZGB 3TBCA 3QIUB 1V4YA 3ZWSA 1CT8B 1GS6X 1OTTD 3K1KC 4IRSB 4LAQH 2G50A 1KB9K 1QPXA 4B97A 5CO1A 2WM0A 2RAMA 3EGXA 1KIRA 5IQ9A 1DORA 2AL2B 4LKXA 3PUOA 3UWZA 1FE8H 1IM3D 4MJ4A 1A8ZA 3UQNA 2IQDA 3X14A 4L18A 5F9OH 4NJAL 3S3JA 2H0EA 4XAWH 1JNNL 4WV1B 2YGYA 2GJPA 3ZSTA 4DGYL 1YAZA 3QG7L 3QJQB 1QZNA 2GTZB 2OSXA 1NMCB 2ICWA 2QJDA 1GYNA 3E2HB 2V2TA 1SUHA 3B7TA 3Q01A 2M83A 1ZV5A 4FYSA 4QHNB 2WO2B 2CWXA 3BJSA 3SCPA 4DLFA 3STZA 3WKPA 2BNQE 1B4JL 5FCSH 1ZLUH 5I1HL 1NUNB 3AHZA 2VLRB 1UUSA 4OQVA 4IJ3C 1O0VA 4UT7H 5F7MC 3IFNH 4ETYA 3FUDA 3ZR6A 1WBJA 2CZDA 3PTDA 4IFKB 4IIGA 1JRHL 3ZJ7A 2K0RA 1FYHB 2X0UA 3UGVA 2DYSB 3ALPA 5CJOH 5F2IA 3T2QA 4CDGC 4RNIA 1CLZL 1QI5A 3T07A 4PTTB 1DVFC 4ZFFA 3CBWA 4KK9C 3BAEL 5J5RA 4IRJA 3E9AA 3MTRA 1QPPA 2AQ2A 2NMSA 4R3SB 4AXKA 3VACA 3OL2A 3D2UD 5IHUL 4AVFA 1H3PH 1OP9A 2GPZA 2G3ZA 3I74A 5IP4A 1KN4H 2RQEA 1VADB 4NS0A 2PBGA 1CUOA 1NC2A 3NXLA 2IOIA 1XP3A 3EOAA 1S5IL 2FX8L 1MFDL 3FUJA 4N2LA 4YU1A 4JFEA 3RLVA 3LPWA 4ODWB 5GGUA 3C6LC 3HE7D 3HPJA 2XNAB 3U0TB 3EYVA 5IFHH 4LPUA 3VJ6B 2BH0A 5AW8B 1UM6H 2NSQA 4JN2B 3ZE2E 1O66A 1QVBA 3TJIA 3OMIB 4BZ1L 1JUBA 1X5FA 1VZIA 3EBIA 1DQTA 3C3NA 1WZLA 2I85A 5C3IA 1I3RB 3G6JB 1R4XA 2IOMA 4YFDB 5F7NC 4ATWA 2GGJA 1CE1L 3MNZB 2P1FA 4ZQPA 2F19H 3CMOL 1PLCA 5D70L 3VFSB 1US0A 3MRHB 2W60B 4R83A 4Y1AE 5FW6A 4MX7A 3V0IA 3CHDA 4NNAA 1UWAA 1DVTA 1AOZA 3R6IA 2J2ZB 5FOJA 43C9A 1AUSL 3TU9A 2YZ5A 4W7WA 4LB3A 3VNLA 1NSNL 3TO2A 2X6CA 3GRWH 3I7QA 3NH7H 1BIIA 1FWJC 2WJDA 1HL5A 4S2CA 2DRUA 5A5WA 3T7VA 3IDIA 1ZCRA 3EAKA 4XP1L 4ZFOA 3MLVL 4JB9H 5KUMA 2FGWH 3VRIA 2X4PA 3ULAB 4NNCA 4C6JA 1RP9A 2BNJA 3ZVVA 4EPEC 4FQXD 5ELIA 1P1ZB 5A8OA 3FKRA 4KWUA 1G9NC 3L45A 4LHUD 4AFYA 3TBTA 3QOMA 2EG7A 1UUQA 3GTFA 5I1DA 1BZ8A 3H2WA 3SUWA 4UTAA 2BY1A 3RIAF 5CNHA 3BCFA 4NQSB 3RPIA 2XN9A 3O6FA 4N2CA 5F3BB 2CLKA 1UWEL 3ATFA 3MFFB 4HIHA 2EUVA 1J9QA 1EBAA 1X6NA 4MCYA 2AGJH 5E9DA 3CV2A 1DFBH 4BGDA 1QHPA 3W0WA 1E1EA 1DANU 1YE4A 5IFTA 3ERXA 3H4HA 3O2DH 3QFDA 2GB2A 2I07B 2IANE 1QEWB 1UKTA 2FPTA 2GDVA 3PP3H 2EO7A 5AAMC 3LGDA 3DX9B 4AZ5A 5ICYA 1G9EA 3FYOA 3GDLA 5ESQB 3MBFA 1P7HL 2ICSA 4AEHH 3IB4A 2ZKHL 2IDTA 2E6AA 3UJEA 5IJBC 4ADGA 4F9DA 4TQ8A 2XU2A 3LXUX 3VU2A 1H51A 3A9IA 3PG8A 4NC1C 4FQIH 1MEXL 5IBTL 1T0OA 1WZ1H 4GXUM 4Z3IA 2ZE0A 1I1YB 1NBZA 1WUEA 1KENL 1GGIL 3K91A 5ETUB 1A5CA 2W8CA 3L08A 2FVLA 3KOXA 2EDFA 4FQXB 4PG2C 3REVA 4AQ1B 2AEIT 4BFOA 5D8ZA 1MIML 1OM9A 3NTCH 4HFUL 3B9DA 2Q7NA 3QNXB 2AABH 4JQVA 4X2UA 1CTOA 3OZOA 4HJIA 4Z9KB 3U7WL 5DR5H 5EZOL 4PRIE 4NO3B 4PN6A 2Z1XA 3AYSA 3G6AA 5ETUA 4AWUA 5T5FH 3VXRD 4ZXBA 3HG2A 3RIFF 3H6JA 4Y19D 1KG0B 4BFFA 2PGEA 1N68A 1NKGA 35C8L 1JDDA 1N2RB 2G41A 2E46A 5IVOA 3W7GA 3U46A 5HMEA 4O10A 4LF3B 2EDLA 2NXYD 3F5WB 1SXBA 1GVIA 2IWFA 3EYVB 4M7JL 1FNLA 5C0CA 4QFUA 3NSYA 1W5NA 2C0HA 2Y0FA 1EYEA 4UT9L 1Z41A 4LDEB 3VWJB 1GGIH 1KENH 3W1RA 1J8VA 4OLYL 1ZJAA 4KXBA 1WZ1L 4DUVA 4AZ7A 1U41A 3QO1A 1R2TA 1JGIA 2ZXWB 3HRZA 3WHXB 4MCNA 2EXWC 3IJSB 4HHAA 2BOCB 3I02A 3U2IA 1RJYA 4LDOB 3UERA 1KQYA 2C34A 1HZHH 4FQ1H 1JQVA 1H6TA 2GSGB 2CHXA 5FGCB 1WLHA 1NGXA 3QZLA 5GRUL 5BZXA 3RPIB 2P49B 1H5VA 2R2CA 4HPYL 3UYPA 1Q5MA 2OL3L 5DWUH 3HS0C 4R7OA 4GT7A 3H2AA 2QCLA 3GIYA 3GNDA 5FWRA 1BYAA 5B21A 3TBTB 2F8XC 2MOGA 4LCUA 4US5A 3ULVH 3SJ3A 3DGDA 4WDIA 1GORA 2OMXA 2YZRA 4JTSA 1TJIL 3VXRB 1EO5A 4ORZC 4HF5L 3CDZB 2VDOB 4Y19B 2IV8A 1ECQA 1OWWA 1ZXKA 1XGRA 4MJ2A 4JZ5A 4YGAB 3UPBA 3W7NA 4ZNCD 2HN7A 4MA3A 3ULVC 4V1XA 3ROLB 1HO1A 2OGYA 3MHGA 4ODUA 4TKWA 5AHFA 3MRDA 2QQNL 4P2QE 3ZYOA 4Z76B 1NMBL 2CXKA 4EZMA 5TGBB 1HL2A 3C2YA 4O11A 3WQFA 5HDOA 3SCVA 4FS0A 4PJAB 3EH2A 3MRMA 2CLHA 3GDTA 4TIMA 2FKPA 4XBPB 3QW4B 3JV5A 3X12B 4B5UA 1AKJD 1YKWA 5DMMA 2PO6A 1L6WA 3G6JA 2O1AA 3FYPA 4V1DE 5G5IA 2UVFA 4YSAA 3VX0A 1HKKA 4OFCA 3VOJA 2COQA 4RXGA 2WOBA 1GPOH 3QEGH 1LWHA 2YDQA 1RQHA 1FJ1B 2EUWA 1J48A 3EMZA 4XV0A 5E23A 3UR8A 3GBMH 3K72A 3B2UD 2J77A 5AW7B 2I24N 5GGUB 4HVBA 4Y5VA 3KTXA 1CICB 5LNWA 2OZ3A 4HK3N 4M3PA 1BXVA 4AX7A 3MROA 2ZXGA 1SJMA 1HHJB 5DVOA 3CLEL 2BJMH 1HT6A 3QKEA 1YMMD 4L3ED 2L4OA 1F97A 1FXQA 5TAOA 3RO8A 2P76A 3KRBA 4ADSA 3U83A 4HHMA 4MXVF 1BQGA 3ZO0A 4Q58C 3C75A 3TQ0A 2PR9A 2WLNA 5F89A 2HUEA 1GYAA 1K5WA 3ATDA 1R9XA 2R59A 4Q4QA 4AHQA 1GY1A 1H3PL 4JRXA 5LXVA 4AHOA 1NAL1 3MJ8A 5EBGA 3W76A 3MJGX 4TQEL 4AOFA 1ONQA 1BFTA 3LKRB 3KS5A 4H1LA 2PGRA 2IBZY 1IEVA 1UIPA 2XICA 3CAVA 4PC8A 4LFHG 3WJZA 1X6LA 3QC5X 4PWEA 4F33B 3C5QA 2K3HA 3O15A 3D3VB 3VOCA 3SCNA 3CZFA 1QLFB 2OYKA 4W86A 2G30A 5LN4A 4O14A 4PJGB 4XGZB 1ORQB 2C3VB 4HK7A 7PTDA 4NI6A 3NGFA 1VFHA 1TVDA 3VIIA 1D3CA 4Q3MA 5CZTA 2O6PA 5FJTA 3CVCA 1XXXA 2Q3XA 4JRWA 5IOPA 3FDGA 4FNTA 5CINL 3UZJA 1Q9LB 3TTQA 3CX2A 3AJXA 4NERA 4N2HA 5JW5A 4ACZA 4DGVH 2LR4A 1JHKH 5DJ8A 1JP5A 2HT3D 3OR7A 4YVNA 1HXYB 2FDBP 3AT9A 4N2AA 2Q8BH 1LL7A 4XPHL 3WMSA 3RNQA 4FXRA 5EF1A 3RHWK 1CG9A 1Z9AA 3QMTA 4XN1A 1BTMA 4WUKL 1TV4A 5EUOA 4ABVA 4M6OH 3OMNB 3W57A 1QNQA 2POZA 3HIJA 3TC9A 2ATPB 4JFFD 1ADQL 1IC5H 1IGTA 1J6OA 3R43A 1CGYA 4KZDH 4XPFL 1P9MC 3QZOA 4QHPA 1RPUA 3CK5A 5AALA 3TDFA 4NJGA 2C9QA 2NPLX 3G1FA 3A0OA 5T1MB 1DOSA 2GK0A 2VN6A 3D3VD 4NZRL 1NEUA 1ZLWK 1NOLA 3VG9B 1EGVA 1GW6A 1S5HA 1P7TA 1XBDA 4X98A 3LZOA 3CZKA 1S2UA 3J27A 4MYPA 1LROA 1P4LB 1JWSA 3P30H 3GSRA 2B0SH 4LOVA 3RWJB 3RVUD 1E6RA 1NOUA 1OPGH 3D50A 1QXLA 2PYFB 2FWUA 3EWDA 2H0PA 4ANUA 4GRSA 1D5ZA 3EJYC 3BWSA 2ZQ0A 3TJPA 4MHBA 4NENB 2ZUQC 4HDIA 4RETB 3RBGA 1PHQA 2DQXA 4LPTA 1LO4H 2NT0A 3A23A 1OFAA 1IEXA 1N7ML 2MNUA 4HIEB 2DQGL 4F92B 5HYEA 4MBRA 3ZMNA 1QNSA 2CH8A 2QFRA 3J07A 4ZRGA 1YNYA 2JIWA 2APBA 4C7FA 4I18B 1XLMA 3K2IA 4QY8A 6FABH 2RFXB 3WCZA 2I9LB 2WLJA 3AXLA 5C7XH 2J55A 2ESVD 2W65B 3UZEA 2HTLD 2AAMA 4DJDC 2H6OA 5C2GA 4TVSa 4LARL 4GW4B 4WW2F 1MG2C 3CX5K 5JW3L 1KN2H 2BVOB 1EEZB 2XWEA 5B39G 2E86A 1I4NA 1QCWA 1W3JA 2VZVA 4HEPA 4PJXE 4X6CA 4YH6A 1OCWL 4L4PA 3QEQB 4WI3A 2P45B 5I82A 4C83B 4XP9L 32C2B 2G95A 3PWNB 2J6VA 3KCLA 4JTLA 4O1DA 3I6GA 3MLPA 1YPFA 2BXZA 4LV9A 2IAMD 3GQFA 1V05A 4PJ9D 3P61A 4Q8TA 1I1XA 4JPWH 1IX2A 4XXWA 4F37F 5HYJB 4XIAA 1H3WM 5DD1L 1TWZA 1LEGB 4KY2A 5AVNA 4CMHB 4GIOA 4HV8B 2P8PA 1AD9A 1UWQA 1MFMA 3WJJA 4B50A 1A53A 1BGGA 4R7DA 3QRLA 4Q32A 4N2IA 2V8MA 5L0QC 4LCVA 1EBGA 4GSDH 4LCWA 4C55A 2ALAA 3MUGA 4HIPA 5C0EB 5L4FA 5E8EA 3RA7L 4Z7WE 1ETA1 3HPXA 4JTAA 4Y19A 3DHPA 4HPYH 3G1DA 4GBUA 4E3TA 4A7GF 5C8JA 3CQ0A 3GE7A 4ABWA 3Q9PA 3TC7A 1QQDB 4L9YA 4OGAC 3H8AA 3ZLGA 5HWNA 3ABMB 3A4FA 5DJ0A 4OZFG 1Q6GA 1YXCA 3QZMA 1QX1A 2VDOH 3WBEA 3C60A 3DX3A 2UZ9A 1U8KB 5T33L 2PCYA 1XRVA 3GFYA 3L4UA 3OR6B 3VIOA 4IBZA 4MMZB 1R3YA 3IV8A 1Y18A 2KZWA 2IAMB 3UAEA 2DUXA 2QZRA 5DJ6A 2F8OA 4AH2A 1JSYA 4DP6X 2VGGA 1NANH 2AVFA 1Z6JT 1Z9OA 3SKOB 2A99A 3ZDXB 1KC5H 4FZ8H 3ZMRA 1IAKA 2IH9A 5MI0C 1MCKA 2WZHA 3FJNA 1KBGH 1XGYH 4LIQH 5I74B 5EZJB 1B1YA 3KTCA 1DVFA 3Q8FA 5K9KA 5KVFH 2QPFA 3DFPA 3MY9A 1PWLA 3DUSA 2Z1BA 3HMCA 4Z6AT 4QG9A 3HBQA 2GJRA 5K1VA 4Y5VB 5HWMA 1MLCB 3U7WH 1AS6A 1MXDA 4N22A 3RFZC 1N55A 1R2SA 4YYFA 5A1AA 1FO0L 3ZTJH 3U6RB 2QDDA 1WK0A 2BX5A 3S47A 1C8XA 4FQQA 4WDUA 3F3HA 3RFAA 3QBUA 1DBAL 5I8EB 3QB7C 4RFEB 4LGPB 1KIUA 4NWUH 4POZD 4U4BA 4WTQA 3OBEA 3V1HA 3LCFA 5DVMA 4WV1C 3VFOA 4KQ4L 2Y7MA 3V8OA 3RO6A 1AS7A 2YN5A 4ZW5A 1DJGA 1UIOA 4UINH 4Y96A 4FNUA 1V5XA 5G1YA 3VCCA 1B3IA 5HR7A 4X42A 4B9PA 2HQAA 2GYSA 5TQ0H 3REVB 1A0EA 2WNZA 1FVDB 3M7OA 4GYPA 3WH6A 5HJBA 3OLGA 2R9HC 2V5CA 3LHZA 4CQ9A 2DLIA 3CXDH 3VFCA 4G9PA 3VXMB 5E1GA 4EOWH 4GUQA 2X2JA 1EWDA 4GSRA 1WXJA 2B7NA 3O2DL 3LMJL 1C5CL 3PQYE 4NXKA 3D2TA 2Y7FA 3P2VA 5CIPH 3TNNB 3RZCB 2XXMB 2VDIA 1AZUA 4WWKD 2DWTA 4S39A 3UAJC 2GUUA 2VD9A 1I1FA 3H6OA 3Q6FB 2I26N 2X1OA 4XMWA 2I07A 2V9TA 1NICA 4UTBA 3ZHFA 4WY0B 1BVLB 5EPDA 1J10A 3DROA 3LKSA 3WIIL 2EKGA 5AC5A 3DKLA 3VU1A 3WIAA 3LEYL 2BOBA 3MYZA 3F65A 1ZUAX 3DC8A 1EXUB 3ZIMA 4EMZA 3B8WA 3AXLB 2F1BA 1HG3A 3ZRCC 3DRQB 1GTHA 4JX0A 1DQKA 1T5WA 4DT2A 4Q2ZA 5T3XH 1KEGL 1ITXA 4JB9L 3KYKL 4LSPH 3EWXA 3FCUB 1VCAA 4DVOA 1DYSA 3H9HA 3VFRA 4KI5C 2A74A 2VDQH 2XY2A 4DP5X 4N8VG 4UWMA 1BQLH 2QCCA 2UZXA 1JAEA 3GRWL 2IADA 4MS8C 4OLZH 1AH1A 3E2SA 3VNMA 2YAOA 1Y07A 2C8NA 2CCVA 5SX5K 1VGAA 4FS9A 1N8OE 4JO2H 2DQTL 2F9BT 3N50A 5EMJA 2FNBA 1AGEA 1CDGA 4Z7UA 5D7EA 5HDQH 3WKQA 1IGCL 4R4BB 1TPB1 2GQ9A 1L3NA 2DOCA 3IDIB 2YUVA 1MI5B 4JGMA 1BLNB 4NDMB 2ZDSA 2WBWB 1I1WA 2DQFB 2CKBB 4MAVA 3RZCD 2XWZA 4HWBA 3UGEA 1OYAA 1CGWA 2FTPA 4RUBA 2MCPH 2K78A 2OI9B 3LZQA 4XCNB 4TV6A 4AYDC 3L2IA 1JTPA 4LSSL 1H8OA 2TSAA 2BINA 1S6NA 3VI4A 3WNIA 1VFAA 3BAJA 2QGHA 4F8XA 3GDCA 4C56B 4Q6IB 2VJ0A 4PL1A 1E27B 3EUDA 4K5LA 1S78D 1SHMA 4Z95H 4NT0A 3L3DB 2CRZA 4IHOA 1WT5A 3E80A 1TA3A 1EEXA 5IBLD 1TV8A 1UT9A 1WAAF 2WQXA 4FYRA 2JJWA 2GGHA 4K7FB 1HFUA 2CR3A 3DOSA 3FULA 4JY9A 2BVTA 3Q44A 3TMQA 1A6ZA 4NBYB 3HNTH 3ROOB 1LDSA 2QF7A 3FQTB 2GIYA 3GF8A 1ZY9A 3BAEH 3ESOA 4XOEA 2KBGA 2XM1A 2VJXA 4U3AA 3L5IA 1CE6A 3HB3D 4MJIB 4S1DD 1YY8B 2QSCL 3BVNA 3IGAA 1NFIA 1IGYB 4XCFH 5AQ0A 5ICYB 3PQYA 1W9VA 4IIEA 4CGUB 3W5MA 1JMXA 4UQCA 4D6IA 3GX9A 1QNZH 1QG3A 2IH8A 2KZBA 3P0YH 4GPNA 2YR1A 4AHPA 2I27N 1I1AB 3ARFC 3O6LH 2C7FA 4CADB 4JTGA 4GAJL 4ILDA 2D2JA 4AEFA 4WUUE 4HAFA 5JXQA 2BVPB 3LEXA 3T0AA 3FA3A 3MRFA 4Z1DA 3RDKA 2VSDA 3SOBL 1S4IA 1ECYA 1FZKA 2CHRA 1AGBA 1KPRB 1A9EA 3MODL 4PVNA 1EGJA 5E2VH 4AZUA 5JXEA 1B3VA 3CXHJ 4JQ1A 1EX0A 1JPGA 2VXSL 4OJCA 4B5TA 3RLSA 5F93C 3O6MH 4ML4A 2NYYC 4JK0D 2PDKA 4X4XB 3GKFA 1L9TA 3WD4A 2R0ZL 1QSED 3APFA 4GP4B 1G7LB 4G9DA 2YR3A 7ODCA 2WSDA 4NX5A 1K70A 4H25B 4UUJA 2E6QA 2FIRT 1XGUA 5F9AC 1FE8L 4ANWA 4RGMB 1C8YA 2QADD 2NY0D 4BWTA 1RUPH 3LXCA 2XV3A 2XKNA 4FG6C 5H37G 4A55A 4LAQL 1PZ1A 5JIHA 1S38A 2DMHA 3IJ6A 2O9RA 4FF7A 1MRCL 1MEIA 3VNYA 3W37A 4MJID 2X12A 2EVHA 2H8ZA 4XX1G 1I9IH 4DWDA 4D9LL 1A6AA 1MJ8H 1QR4A 3UETA 5H2ZA 1DJWA 3AJ7A 1FJ1A 3MV7A 1BZDA 1V7MH 4WHYH 2FFIA 4DI9A 3DLQR 4Y19E 3GMNA 4JY4A 3S8HA 4GCAA 4ZMWA 4PGCA 2Z91A 2XV0A 1ZGLA 4FG4A 2BODX 3WQWA 4XAYA 3G1XA 4WSHA 5KANI 4MNGE 5IXEA 2IPJA 1CDYA 1WWAX 1IMHC 2FATH 2DZVA 3MP3A 3NQFA 4F3HA 1YEJL 3KCPA 25C8L 4MQ7A 1CU4H 2CGRL 1SHSA 4YSDA 3UO8B 3PDOB 4ZAKD 3OHXA 4HH9A 1TUPA 2FO8A 1QSEB 3QWQB 5IHBA 2VUKA 3D0VA 2YIHA 4MA1C 4PRNA 2OJZL 2WQAA 5CZXD 4AM0A 2EPNA 4O4WA 2QADB 2NY0B 1J12A 4H25A 3I7RA 3CLFL 1NEZG 1TTRA 3A6CH 2ALWA 4AG4L 3T3MB 1G7PA 3UROR 2XQYG 3WHE0 5K39B 1S2EA 2HKFL 4JFFE 1QSFB 3RDTC 3WNOA 6PTDA 4Y2OB 1QW9A 2ZCKL 1RZJL 3CUIA 1GZPB 4F5CA 2KZKA 4PYSA 1XSJA 5H4YA 3AAZA 4PRDA 1R47A 4NM8L 3M0VA 1N7KA 4OWGA 2AERT 3IJYB 3UYPB 4S38A 5DQJA 5E9AA 1RPQA 2VLRA 1KIQA 4O2FB 5L8JB 3FOKA 4L9DA 4WJG3 4N0CC 3U7AA 4ZUTB 4KTDL 3CE1A 2BNQD 4ORMA 1ZSDB 3GMPA 3NIDE 1U3JA 2HVJB 4R96A 5DVPA 3VWJC 3IJSA 4MA8L 1LORA 4IU3A 4KNUA 3NPZB 5H37A 3BUTA 1M7UA 2L7EA 1HGYA 1DUZB 4PGBA 4HKJA 5E2UL 1PJWA 43CAB 2E9MA 3C6EA 3KFTA 1X44A 5F0MB 1ZMYA 4Y4FA 1IBGL 1H6FA 4UT6A 3IVKB 5DI8A 1UOKA 4JFWA 1CO1A 4OGYL 3GRWA 1N59B 3LIZL 5IHLB 3GXUB 4PRPA 4IFRA 1QBLH 2WIIB 3RYSA 1A3RL 3CSYA 4UTTC 1WAEA 1R0MA 3M1BB 1JI1A 4HWBH 4K1GA 5FYKD 2JIXD 2WXMA 5D8JH 1H63A 1T5KA 1EJSC 2E9IA 4P9HL 4Q9BA 4L64A 2AXGB 1P0NA 4J1UB 2V7HA 4S3AA 4XXDA 2AJSH 1QLEH 2P52A 4KOBA 3EOYG 3IF1B 3D87B 2FB4H 4NZUH 3BO9A 3U0PB 3BD4A 4I6KA 2V37A 5DD0L 1VPOH 4X7EC 1CK0H 3SZ8A 4F2TA 5FGCE 2YDAA 3WFAA 1RULH 1W32A 3HVDA 3UABA 3TNMA 2BSSA 1ED3B 2WMFA 4KS0A 4Q22A 4DK3A 2B20A 4XBJA 1OHQA 1RLWA 4IJBA 2ADJB 4HK3J 3UTQB 1RCQA 1MCJA 5JR1L 2EDKA 4DRSA 1PX4A 3CZLA 4DEFA 4XAZA 1PD6A 4PMFA 5KBNC 3QXWA 2BNRB 4KJPC 1RI8A 2VLMD 3DX9A 2CMRL 1I0BA 2J72A 1IKFL 1G7HA 2H8PB 4Z5RB 1BGAA 4WDTA 3D69B 4HJWA 4QQ3A 3HE6B 3MLZH 3KJ6H 4K7PH 2XQBL 4MAYB 5B22A 5HJ3A 1E9PB 4A66A 1TPDA 2DM7A 3MCG1 3ULSA 2YMXL 3BO8B 1BF6A 4MJ6B 4GUJA 4HBQA 1B9KA 3NIDB 3N11A 5CBEB 3IWVA 1Q38A 1R3HA 2E7BA 3JQOB 3FN0H 3VG0L 3ALWA 4P7QA 1NMAL 1N6UA 4WTXA 3VNZA 1JNDA 3TYZA 1NL0H 3RWIB 1NCBH 4RV3A 3QF0A 4CKVX 1TPEA 4LUJA 1JFXA 3TYUA 3SY0A 2XYBA 1OK4A 4LL1A 1GR7A 4Q97A 5JIMA 4US5D 3TURA 2DYPB 1JWMA 2EC8A 4HULB 3NJ3A 4B15A 4WGHA 2E25A 1BZEA 5T5FA 2CPCA 5DVLA 3IFLH 5MENE 1A66A 4HN8A 1EHAA 1PNCA 4NM4L 2E6YA 1WG3A 3ILPB 4PBXA 2BZDA 2ZG2A 3MNVB 4FP8H 4GLRH 4JM2F 5IB1A 3SDCC 3N3MA 3TWBA 3BKCH 3SY6A 5FV2A 5C08A 4AE0A 1P0KA 5EB8A 1MVYA 1HKWA 2J7DA 2X4SA 4AIZB 4D0DB 4TRPH 1KKOA 2Y23A 3JZ7A 1V3HA 1AC6A 3GK0A 1M68A 4NUJB 2CZ5A 1QHOA 2PTYA 1DCLA 4K15A 1FUYA 4XHQA 2HV5A 4PIRF 3RCYA 3QCUL 4FADA 5CEXA 2ITDB 5FYKE 2DJSA 3SQBA 5IEKB 3C2OA 3LY0A 4ZB0A 4K94H 1H8LA 4XVSH 4RFEA 5I6LA 4ADTA 4GWEA 1OSEA 8PAZA 5B1BB 2ZXDA 3BAWA 2AZUA 2WO5A 3H2CA 3VVVA 1KTLB 4X9YA 4GG9A 4JN6A 1CI3M 4H26B 3BVDB 4JFDE 1P1MA 5IB5B 1VF8A 1QRNA 3P73A 5BVJB 1A5KC 1I8JA 1FWHC 2WNKA 4LEXH 5C97A 1I8MA 4X99B 1TPXC 1DVFB 3PREA 4XRCA 1N19A 2UUDK 3QNZB 4XPGH 3MTXA 5LDSA 1SM3H 4BUGA 5DJXA 3KWXA 4F0RA 4U1KA 3RTQD 2HVJA 2MHAB 1HH9B 3ARBC 4HK5A 3RX5A 3VDGA 1V0NA 2BIIA 3MV01 4X7TA 1LHZA 2Z2UA 3BK0A 2J1KA 3OG4B 2CJUH 5CILH 3E3QE 4XP4H 5TF0A 4PCSA 5A43C 5HYIA 1V7NH 3PNWB 4X22A 4GXFA 4R4ND 3IGHX 4OFYA 1DLHA 3FOLA 2CO7B 1Y6MR 2VDGA 4OCWL 3KPRB 1WGOA 4WGXA 2W67A 3CO8A 3QV8A 4HTBA 3COTA 3CFDB 1J8HE 4KK5D 3W56A 2WPBA 3PWJA 4NZJA 3ZVHB 4WO4D 1Z9NA 1HSAA 5EBMA 4F8NA 4E5XA 5B8CA 2BHFA 4JTEA 4BEUA 3DBNA 2OXNA 1Q90A 2LOEA 3TZVB 1UBSA 2DL9A 1NDVA 4WK4B 4G8TA 3RYMA 4LEOB 4OF7A 3VFGL 5BZWB 4OIAA 4G3YL 1E5ZA 1X98A 3QDAA 1RK7A 5FO7A 5DLLA 5BJTB 3HGOA 1AQKH 1ZHLB 2JXMB 3AREC 3LQMA 1FV1A 4QRRD 4R0LB 3TAOA 3VPLA 3FONA 1CF8L 1OOWA 2DQ6A 3GMLB 3BH9A 1P6BA 3KCPB 3MACH 3GY1A 2V5YA 1DVFD 5IK3B 2PYED 1EJ7L 3IN0A 1LP9E 3M5XA 2NQCA 1OF8A 1GY2A 1HH6A 3DKHA 4I77L 3QBTB 1OTSD 4PVLA 2WXPA 3ARGD 4OZGA 4QLKA 1C5DA 4ENZA 4LE8A 3DG6A 1OINA 3NN8A 3I6GB 2Z2BA 1SYTA 3LM7A 4XVEA 1R3JA 1ZV9A 1E51A 3FPXA 4PJGE 3CLMA 4KESA 1OP5H 4AV0A 1A6AB 2YGNA 2L8AA 1FC2D 4RRPM 4PVBA 4XWGH 3EMCA 5DRIA 2Z8WC 2LABA 4GW4A 1G94A 4HCGA 4K3DH 5CD3A 1ZVYA 1IR1A 1UB5B 1NDWA 4O58H 3ZGHA 3WUGA 3RR1A 3GUWA 4E3VA 4MNGB 1DBTA 2LAGB 5AZ2L 4YTQA 4WTWA 5I16A 5AG8A 3CUGA 5BPPA 4FLHA 3ABKB 1BSLA 4P57B 2ISFA 3EKGA 3V0TA 4GQRA 3R1ZA 2Z93A 3ABGA 3D39B 1V3LA 3FB5B 1R24A 4UMBA 4N5EC 4DXKA 4X7SH 3CHSA 4P06A 4QI3A 3DVIA 4DOHB 3GHUA 4AEIL 2Z31D 4PRPE 5F7HA 1Z42A 1NCCH 5INCA 1TLMA 4QTHB 4XB3A 4Y5XB 4X4ZA 3UZEC 3QA3A 3DI0A 3T4AB 4W1TA 1E6JL 4NIYE 4LBSA 1BZQK 4OCYL 5EN2A 1XLCA 1NANI 4GW1A 2VITA 4ZMPA 3SCWA 5H35B 4NJJA 1UMYA 1PL3A 1F3XA 3UR7A 4Q6XA 4AYFB 4KZEH 2AS5M 4FI6A 2UYLB 2FZMA 2NQ5A 4D8PA 3T42A 3LKPB 1ZLVK 3I75B 4PRWA 3UWVA 4ATLA 1K7EA 3FO9B 2WXJA 4JRLA 3PULA 1P5UB 4KKLD 1E1CA 4OZ4A 1YEFH 4UCFA 2YCIX 3OBKA 3FJLA 4RZKA 4HPOH 3PAJA 4EK7A 3JZUA 3PHOB 4GW5B 2NSMA 3O0RH 5EBLB 4OUIA 4A05A 1Q0XL 1DIDA 2F53E 4DZ8B 5DHVH 4KZEL 1KKRA 3H4XA 4OH2A 1BGXL 4G6ML 3OSKA 4NC0B 2JIXA 1DFXA 2YKLH 1ZAIA 5E1QA 1E1CB 3W7PA 3MLWL 5LBSH 5EEWA 2YLAA 3D07A 2H3DA 2XA8L 4MLJA 1IJNA 4WW1A 4IRZL 3UC0L 2Z31B 3HFML 1Q45A 3SDDD 2BY0A 3TC3A 5FJUA 1YNPA 2BXYA 1EAQA 1TZ7A 2B5IC 2YPIA 4GW1B 4AQ8A 5I3HA 3AMLA 2DQFA 3KNBA 5DD6A 3GSWB 1EEYA 5FIPA 1CFSB 5GRJL 3REQB 3TEWA 5ALBH 2FK9A 3O3DB 1ZHKA 1VFLA 5LBGA 2VDMH 3BAKA 4ODHH 1B0IA 1YY9D 3IPFA 4NLHA 3WG7B 1HDMA 4POZC 1LEKA 4JS7A 1ICTA 1UMLA 2P88A 2WSRA 3HRZC 3WK2A 2LV4A 1E1FA 4GP5B 1ME8A 4XMXA 4GFSA 4AC7C 2XPGA 3T1FB 2J73A 3EYQC 1KB5L 4LSVL 1F4WH 3OAUH 3E74A 1TZHB 1HZLA 5FDYA 3V0DA 1GMIA 3VE9A 3BTNA 1WDSA 4IJCA 4FKKA 4C6IA 3CZ8A 4QTIL 1S8DB 1XLAA 1UXWA 2DM4A 1E50A 2WBKA 2YRBA 3HCVA 3LEVH 3NZQA 4IYKA 2A6IA 5EOQH 3P0GB 1N70A 1U58A 2XZAL 3MX0B 5AVHA 3GXFA 4B3EA 2DIKA 3F12A 4JNYA 4GRWB 3N5AA 5KSAD 5BO0D 2A83B 4GKSA 3MVIA 3T09A 1YX1A 2WXOA 4FDWA 1NAMH 5I2UA 1HAWA 4N6RB 1M7JA 4OT7A 1PY0A 2IALB 5DJAB 1OM3H 4AAJA 3R0NA 4FERA 1AQKL 2NZ9C 2WYTA 5IQLA 4DJMA 5EBAA 1FPTL 3DWTA 2BSCA 3PPEA 4MB1A 5DD3H 1XLHA 1YADA 3EB4A 5D2YA 1YUHA 5F2MA 4NN6B 3W07A 4I88A 1P7QB 3NP4A 3T71A 3SDCA 2Y69B 5C9XA 5DYOB 3BZEA 5GGSY 3TOYA 2CRYA 4OZIB 3VFVB 4WSGA 5DF0A 4ZQNA 3M64A 4KK8C 1MCWM 3TCXA 1EZSA 4CVWA 4MGXA 4I0PA 3GZPA 3HFFA 2F6XA 3IIXA 1A6PA 4G80A 3AHTA 4YXLH 2E7FA 1OG0A 4F2EA 2MKLC 4YPGA 1MCFA 1TRDA 3RHWF 1W91A 2HN7B 1J9SA 3QUYA 4JHAH 4MA3B 3QUYC 1XPGA 3CHVA 3WX7A 3QZPA 2IGFL 3ET9F 4N9BA 2QTVA 5ID0B 4LH8A 4R9XA 5IFPA 3UG4A 4EN2A 3T4YB 4GS7C 4J3ZA 4ZW6A 4JFYB 3N1MC 1OK8A 3TFKC 2EDTA 1TNMA 4M8RA 1U8PB 4P5TD 1TMCB 2FMNA 1LL6A 5F2LA 3SUUA 1MAJA 2R83A 1HNGA 2C1PA 3USZA 2H45A 2YPKB 2O55A 2IAAC 2Q20A 4XN8A 5KSAB 1VIZA 1VYRA 1OPOA 1A3QA 5F3HB 4ADJA 5IFJB 3GB7A 2G3JA 3BW2A 4XPGL 3F7YA 5GSVB 1TJ2A 3FEQA 4O8RA 2HLEB 3WKNA 1U0QA 2GVGA 4PB9H 2MPVA 1SLVA 3NL3A 5ENLA 3N2OA 2OTWA 4I8DA 3NMEA 2OX5B 5ISZB 4W4QA 3L4CA 3HLKA 3N44B 3O3BB 5SWQB 2JGYA 1MPAL 3VE0B 1LQAA 1UWUA 2WZTA 2CLVB 3FFCA 3FAWA 4LLDB 5IVZB 1MQKH 4N6QA 3A13A 3QNZA 3CWOX 4TSBH 1CFBA 3MDWA 3HEIB 4G7FA 1QK2A 1RIVL 1A5AA 3VWJA 2R0WH 3ZKXC 4MWFB 1E4LA 2OOFA 4M1RA 1UOLA 3IDYB 5D7IF 2Q6WB 4CCZA 1G43A 1TQSA 1BFOA 1LO5A 1MCEA 4NPJA 2FJSA 5DJ0B 2AEWA 2N01B 5EUKB 4X4YA 5C0RH 4NKCA 4OECA 4LF3A 4C60A 3BLEA 3S3CB 2VIRA 4K8RL 4M00A 4WWID 5FO8A 4HXAL 5D2LA 1QPOA 2EYRA 3EH1A 3KOYA 2E9JA 4ACPA 5E08H 2YD1A 2CNCA 2GOUA 3ZTNL 2RA1A 2ZUSA 2XHYA 1CD0A 4YK4B 1UXLA 2AXFA 5C0EA 3HS8A 4QS5A 3PCYA 3Q1SL 2ICEA 3F7VA 4LYQA 4PJCA 3KLHC 1WEJL 4UM9A 5A6KA 3C9NB 4DGIL 3AHYA 4GUFA 3CHFA 3CNKA 4YUEL 4GZ7A 3W1QA 4G82A 4L9LB 5SX4H 1J93A 3PAUA 4N20A 1I1YA 1NBZB 1HQTA 4JYDA 4CN4A 4KVPA 1F3RB 1GT8A 1K03A 3GMMB 1XFBA 2P3YA 2QPDB 2EG8A 4KEUA 1S3KH 5JPMB 4PYHA 1K8CA 1WHOA 4H04A 3S3DB 2F0CA 3BI9X 4XI5D 1TG8A 3F83A 4FXSA 3S83A 4N0RA 4PJBA 3SE3A 5JPNC 2NY5L 5KS9B 1UKPA 1Z89A 3NFNA 4Q74A 3NEVA 4FN0A 4F8OA 2E7LC 1H41A 4XMZA 1ZHBA 4WRHA 4PSRA 1UG9A 1E67A 3JVGC 3HZMA 4IEFA 5GSRB 5HY9A 1IIHA 2CERA 1Z5YD 1E6OH 3HC0A 3MU7A 1L0PA