5HDRA

Crystal structure of a bacterial fucosidase with iminocyclitol (2s,3s,4r,5s)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
445
structure length
440
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-L-fucosidase
publication title Crystal structure of a bacterial fucosidase with iminocyclitol (2S,3S,4R,5S)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 158
structure length 440
sequence length 445
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5hdrA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5hdrA01
2VRQA 1WO2A 2QPSA 1XH1A 1K9EA 2PWFA 4AD2A 4KMQA 2VX5A 1CWYA 1JF6A 4DM1A 3S5ZA 4DWSC 1HX0A 3KL3A 1GOKA 1AVAA 2AMGA 2JF7A 4S3KA 2CNCA 2ZX5A 3UETA 2WLYA 3ARVA 3W26A 5A6BD 3AHXA 3U7VA 3GXNA 1WDPA 3AIWA 3VIHA 3CZGA 3PZNA 5CGTA 2E9LA 4AISA 2YOCA 2VX6A 1HL9A 1GOIA 4AZ6A 1EHAA 3S5YA 4UQCA 1CIUA 2J7EA 2ZX8A 1CENA 4U2ZA 3QOMA 1PZ3A 2XTKA 4BQ4A 3CUJA 4CD6A 4PMOA 4JL2A 4Q7NA 2WLZA 3BVTA 4ATLA 2W67A 4QLLA 1PX3A 3WH8A 1Q6EA 3EJRA 4PRWA 1BLIA 1TMQA 1OT1A 5GQBA 2WMHA 1DWJM 2PBGA 4Z2LA 3T0BA 4FNSA 1PBGA 3RJXA 3AYRA 4NZCA 3OB8A 4F66A 2VX4A 1JZ8A 1MVYA 2WMIB 4X9YA 4PUEA 2EAEA 1MW3A 1KBKA 3ZT5A 4TVCA 1OGGA 1W3LA 2ESCA 2F8QA 2VI0A 3LMYA 2XVGA 3WN6A 5A94A 1OBAA 4U5KA 3NSMA 2O92A 1FHLA 1RH9A 2CXGA 5CQ1A 2A3BA 3CBWA 1HJSA 1LQ0A 3TV8A 3M46A 3UR8A 5JIWA 3GNOA 1I1XA 2GJPA 2XJ7A 2DPEA 2JIEA 2XSBA 3EJTA 1R86A 1JZ2A 4WSJA 5TD4A 3G6MA 1GONA 1E73M 3NSXA 1QNSA 4J3VA 2ZX9A 5I23A 2O9OA 1LWHA 1V6WA 3RCNA 1SYTA 5IDIA 3VD9A 1D7FA 1XV8A 2V3EA 4UQEA 1WCGA 4MTVA 1Q6FA 2GDUA 1H3GA 1LF1A 2GJXB 3I3BA 4CD7A 1CYGA 3L4UA 3VU2A 3CZJA 3CV5A 1FH8A 1JL8A 1XYZA 5ECUA 1C8QA 1UKSA 1E6ZA 4DUVA 3VNZA 1GVIA 1PZ2A 4HTYA 3VINA 2F7RA 2CBUA 5A2AA 3OGRA 4GZEA 3AHZA 1W32A 4J28A 1UD2A 1GNXA 2Y8KA 4R27A 4AIEA 2VURA 5HOSA 3A3HA 1E72M 4UOJA 5A6BA 4OIFA 3AQUA 1ISZA 1QWUA 4KWUA 4PCTA 2CESA 3BAYA 2ZXQA 3ZO9A 2YBTA 2JE8A 3TTSA 5E6YA 3CUHA 4NF7A 3CHFA 4IPLA 1QHPA 1UA3A 4D6JA 3A24A 5A2CA 1BYAA 2G3NA 2IXUA 3VILA 1M04A 5A95A 4TX8A 3HG2A 2F7OA 3N11A 3MMWA 4NZFA 5DO8A 2QMKA 1NWSA 5JBFA 3B8SA 2XVPA 4GQQA 5I2UA 1B3WA 3I3EA 5A6LA 1WDQA 4W8LA 1R87A 4PMYA 1DWFM 4UOQA 5I5RA 2WSPA 5AYBA 1V0NA 1J0ZA 4B9YA 1ISWA 2F18A 4U3CA 2E9MA 3VX1A 4FK9A 5A6KA 2VO5A 1W2PA 4HMEA 3W0KA 3AIBA 4M8UA 1OT2A 1AMYA 1OGSA 1TE1A 1W2VA 5IHSA 2WHJA 1R7AA 3PTKA 1UWIA 2XHYA 3GXDA 3CMJA 1TQWA 1JAEA 1V0MA 4QLKA 1R85A 1ZBWA 3D3AA 4FNQA 1PAMA 4W7WA 4JAWA 1LL7A 1XRVA 2YLAA 3VGEA 1VJZA 2WMGA 4UZUA 3SEPA 3WL1A 1J9YA 3VIMA 2X0HA 1GHSA 1E6XM 4J7RA 3ZSTA 1PPIA 4AIOA 2F1AA 1LLOA 3EMCA 1TCMA 3SUSA 5IHRA 2J7CA 3L4WA 1QNPA 3VMPA 1FFRA 4D6DA 1W9BM 4MNJA 2A3EA 4FF5A 1GHRA 3TTOA 1N82A 3ARTA 2CETA 4MPKA 1TFVA 3BAWA 3LRMA 1WPCA 3ARUA 1E55A 2BY3A 3WQVA 4TX6A 3AMKA 1GOQA 3RM9A 1UR9A 1QPKA 1SZNA 3HMCA 3CTTA 2BHYA 5EMYA 2BY1A 4IM4A 2A3CA 3W24A 5A6JA 4LYRA 1Z32X 3BCDA 3WFZA 2UY3A 5I24A 1W3KA 1BVNP 4D1IA 1H41A 1DTUA 2ZWYA 1PIGA 3MU7A 3A22A 4AW7A 1JAKA 2BNJA 3L4VA 4J3TA 5FCZA 3DYMA 3EDDA 2WVVA 3OGVA 4M1RA 3T08A 4PMDA 4HP5A 4NXSA 4FLRA 3LXBA 1SMDA 1UKQA 1MYRA 3J7HA 3NUKA 1E6SM 1E6NA 3U7BA 1UD5A 1H5VA 1M53A 4AYGA 3VKKA 5CSYA 5CPSA 3A6OA 1MQQA 1KB3A 4M56A 2G3MA 5D8WA 1J0YA 4JHZA 3RIKA 2D20A 3MUY1 1QW9A 2WK2A 5D4YA 3ZT6A 2Y5EA 2XSAA 3WY1A 4H8UA 2WZHA 2W92A 1WZLA 3N18A 2VZSA 2CPUA 2WWDA 1ISVA 5E1QA 1WE5A 3EJQA 3WD2A 4RE3A 1JD9A 1LG2A 1VIWA 2WYSA 1J0JA 4WK9A 3WNOA 3OBAA 1MW0A 4FMVA 5C71A 3BVWA 4EAMA 1W9UA 2WZIA 3WNLA 3AICA 4E8CA 1KGXA 1QOXA 5A8QA 3WEZA 4QP0A 4MB5A 4PMZA 2XG9A 1BFNA 1JD7A 3WNNA 3WUEA 4XB3A 1CXKA 3AROA 2V5CA 1OSEA 4ZEPA 5BXPA 1TZ7A 2PF0A 3IK2A 2XVKA 1OD0A 3AXXA 3W28A 4CU6A 1E70M 1NOWA 4P7LA 2YA1A 2XUCA 4W7UA 1O7DC 1W91A 3WEOA 4AXNA 1HXJA 3VMOA 4S3JA 4XUYA 5A3HA 1E1EA 4XX6A 5EBAA 4BQ2A 3ARWA 2DDXA 5IFTA 2WAGA 3BSHA 1UWQA 3A4AA 3AMGA 3W29A 1CGWA 1Q4NX 3WNKA 2J75A 4HA3A 2J8GA 2YKKA 1E0VA 2C0HA 3AFBA 4NRRA 5D8ZA 3GXFA 1OINA 2QLYA 4UFJA 2E0PA 4D1JA 1JZ6A 1JDAA 3DX3A 1CGVA 1KXVA 4D6HA 1QW8A 3BAXA 3EJPA 2YIHA 2VR5A 2VZVA 2JFEX 3VD3A 1OM0A 2YL6A 4JCLA 1H49A 4LQ1A 1EDTA 2HISA 4PMNA 4L4OA 5DFAA 2BVTA 3ZJ7A 2G3JA 4XZBA 1XSIA 2WPGA 2YDQA 3AIRA 4ZENA 1V03A 4FLOA 4H04A 2QHAA 1NWUA 2JEQA 3TTYA 3WY3A 1E15A 2YDRA 2WVUA 3DX2A 4D6CA 1FP8A 4PMUA 3ZR6A 5AY7A 3CZKA 2VC9A 1TVNA 1J0KA 3GH4A 4OOUA 1DWGM 2WHKA 5D9NA 1FA2A 1UQYA 2UWFA 4JHOA 3EDKA 3BH4A 2OYMA 3BCFA 3FW6A 2OWXA 1CDGA 1PX4A 3K4AA 4Y7EA 2BV9A 1E3XA 2D0GA 2WNWA 2VJXA 5FD0A 1AQHA 1EDGA 3CZLA 2WC3A 4GQRA 4OBSA 3PZMA 1WZAA 5CPTA 3EDFA 1OCQA 1WDSA 2VCAA 4AD1A 2V3GA 3WBEA 3AHVA 1F4HA 4H8VA 2FGZA 5ABEA 5KEZA 3BLBA 3VVGA 1B3YA 1UD6A 3BGAA 4JKLA 4A3YA 3QGVA 4DUWA 1DP0A 3WD1A 4TXEA 2WMIA 3VIGA 4Z2IA 4YPJA 2PBOA 3WQ4A 4UFKA 4UQDA 3WY2A 3AS0A 1RD6A 2V3DA 3KLLA 1W3HA 2VVSA 1KTCA 1JZ5A 4AZIA 2WCAA 3BLKA 1KXTA 1MXGA 5C70A 1B3ZA 4YHGA 1OIFA 1C8XA 1EXPA 4P8VA 2CKSA 1OD8A 1ZJBA 2O9PA 3N12A 2WHMA 4CN4A 4B15A 1BYCA 3WDHA 3SIMA 2X2JA 4WF7A 4W86A 3SUWA 4OOZA 4EKJA 3WMSA 3M7SA 3EDEA 1R8LA 3QHOA 3KE0A 1QWNA 3ALGA 5CZKA 1KQYA 4TVUA 1QI5A 1KQZA 5LA1A 3AYSA 2FH8A 3WDIA 5HXMA 4B3KA 4AMXA 5EFFA 1KCLA 3ZM8A 4GINA 4CD5A 2J62A 2WCGA 1UASA 3K8KA 4HA4A 2FE0A 4DWSB 1UH2A 1FH7A 4QCEA 4KRTA 2W5FA 3WUFA 3FHAA 3ZJ8A 2OWWA 1MQRA 3IANA 5FKYA 3OZPA 2GJXA 3LPFA 2ZUWA 2VZTA 3RDKA 1VENA 1Q6DA 4Z2KA 4D71A 4MJ2A 2DIEA 4ZXLA 3MMUA 2FGLA 4V2XA 3KLKA 1CGTA 1I1WA 5M3WA 1M03A 2E8YA 1E5JA 4JZ5A 1O7AA 1WP6A 3MV01 3MS8A 3AZTA 2TAAA 4Q22A 3CHCA 3TTQA 5C8BB 3BUPA 3OLGA 3CUIA 5FL0A 1JI1A 5A8OA 1XGZA 1E6QM 2F61A 4EE9A 1OB0A 1UA7A 4H2CA 3VGFA 3WD4A 3CZNA 3W82A 4JIEA 4LXFA 1BYBA 1WKYA 2PWDA 1QHOA 1FHDA 4AMWA 3BVUA 3A47A 2ZXAA 1E1FA 4M80A 3D52A 1X6LA 1CXEA 2X2IA 2CBIA 5CSUA 4OZOA 6A3HA 2WWCA 1QI2A 3EDJA 8A3HA 2NW0A 1NWTA 1UOKA 1SR0A 3AZRA 2XFFA 4P7OA 4UQ9A 4PMXA 4TTGA 3DC0A 3VNYA 1HP4A 4U33A 1L8NA 4F9JA 3FXYA 1VF8A 2XYLA 4U5IA 1JI2A 4GO8A 1C91A 3WQ8A 1HVQA 3W27A 2V5DA 5M03A 2DGAA 1NARA 4BZYA 2OW6A 1C90A 2PWHA 2EADA 2Z1KA 4RL3A 1K9TA 4PMQA 1VFUA 3SCWA 3FY1A 1EH9A 3FHQA 2V3FA 3ZQ9A 1MQPA 4TVDA 5E0FA 1B3VA 5CLWA 1ZJAA 2CITA 4A4AA 1HT6A 1VFOA 3SCRA 1E3ZA 1M7XA 3PZVA 2W63A 2UY5A 4HOWA 2WMFA 4UTFA 3EJUA 4F9DA 3SURA 2DQXA 1QNRA 1GQIA 1B90A 1JXKA 3WD0A 1XCWA 4JFUA 1NOFA 4ZFMA 1ITXA 4XZWA 5HBFA 3DX0A 3BAJA 1C92A 4YHEA 1V3HA 4PTXA 3WH5A 6TAAA 2B31A 3CUGA 3EBVA 3T2QA 1HXKA 4QAWA 3ARYA 1VJSA 1H2JA 4P8XA 1UKPA 1NM9A 1EA9C 1MFUA 2GVYA 4WKHA 2YL5A 3MSDA 1FP9A 3ZIZA 3MUZ1 4AZBA 1QBBA 2D2OA 1UR2A 2VOTA 3BAKA 2D1ZA 3QR3A 1GPFA 3FNDA 2YA0A 1EGZA 2EPLX 2PC8A 2CBVA 4PTWA 1EDQA 5FOOA 2FHBA 3PZTA 4CN1A 4HU8A 2EACA 1HP5A 2ZUTA 2EPKX 4NRSA 2VT0A 1JXJA 4PSPA 2VRJA 1PEZA 4M82A 3WDRA 1XH2A 4PYSA 1US3A 1VB9A 1CTNA 4AIUA 1P6WA 2D3NA 1CXFA 3VPLA 5M5DA 3W25A 3VIIA 1NP0A 5AC4A 1R33A 3MANA 3VDHA 1J0HA 3WUBA 4GZJA 3PHAA 4JFSA 5HPCA 5F7UA 1CXHA 5BXSA 1V3KA 2WC7A 1UWUA 3PZUA 1R47A 1B1YA 1E56A 3F5LA 5BYWA 2FDMA 3UG5A 3VGHA 1CBGA 2G8ZA 1JNEA 3HU7A 2ZIDA 3OIHA 3ZMRA 2XWEA 2BFGA 5FL1A 3SCTA 1R46A 4AD5A 4HPHA 1E4LA 1JDDA 3D5HA 4MAZA 3ALFA 4AD3A 1BPLB 4HZ8A 1UWSA 4W5UA 1HJQA 2J7DA 2VQUA 2HVMA 4RE4A 4BS0A 4J3SA 1NWRA 4UR9A 2D0FA 3BVVA 3N9KA 1TA3B 4MJ4A 3I3DA 3NCOA 4CU8A 2CEQA 5BXRA 2NT1A 3O9NA 1MXDA 3WH7A 3BVXA 1CGXA 4DWSD 1E0XA 1LL4A 4J3XA 4P7NA 2VL4A 2CKRA 3T0AA 5A6AA 2WBKA 3UR7A 2X09A 3U5YA 1HKJA 3WBAA 1HKMA 3SUTA 1BTCA 1EHNA 1US2A 2V38A 5IXEA 3AXIA 1JZ3A 3WQWA 4UQBA 2OSXA 3MSGA 5I79A 3NDZA 1PX8A 3PZOA 5EB8A 4JFTA 5HDRA 3PZ9A 1ODUA 8CGTA 1E6RA 1QVBA 2E9BA 4DO6A 1WZMA 3EMZA 3QOKA 3IAQA 1V6XA 5HNNA 5HPOA 1G5AA 2Q8XA 1CLXA 1A3HA 3WFLA 1X6NA 1JYNA 3FN9A 2OYLA 4MAVA 3A23A 3T09A 4J3WA 1V3MA 1BG9A 1FFQA 4PTMA 5BXTA 2JEPA 5I78A 4NZJA 2BY0A 4UNIA 2J7FA 2J79A 2XIIA 4JFVA 2WKGA 4QLJA 3RPMA 4M24A 5A6SA 5BCAA 2EO7A 3ZT7A 1G9HA 3GTNA 4UCFA 2AOSA 2WM0A 3VTRA 4ZXOA 2IXVA 4UFIA 2DH2A 5CPQA 4C7DA 1V08A 3MUIA 3VX0A 2EPMX 4A3HA 3EJSA 1J01A 3F5JA 1CNVA 3DDGA 1W9PA 2QF8A 2X05A 3WF3A 1B0IA 1PIFA 4CD8A 1EIBA 3WH6A 5JUVA 1JFHA 2EXOA 4OBRA 3MUAA 1UHVA 1JYXA 3WDPP 2W4XA 2DSZA 5JBDA 4F8XA 3A21A 2PWEA 1MW2A 2ZUMA 3AOFA 1B9ZA 2VR4A 3VIJA 2VNCA 2OWCA 1UUQA 3SCPA 1G1YA 3DHUA 3L2LA 1XD0A 2G41A 2WKLA 2Y8VA 3PZIA 5IFPA 1KTBA 3CGTA 3DYOA 5KZ6A 3MV11 1R75A 1RP8A 3CPUA 2WC4A 4UZSA 4D6IA 2ZE0A 4HU0A 1JIBA 2IUZA 4V28A 5ABGA 3L2MA 2DH3A 4DO5A 4OJYA 1UR4A 2WSKA 2PB1A 5JBEA 2BVDA 3CH9A 3WMCA 3M6DA 1H4PA 1KR1A 3S2CA 7A3HA 3SCVA 3EYPA 1JG9A 1EQCA 3K46A 4NX0A 2YDSA 2BXYA 2WMKA 3S6TA 4QCFA 2W91A 3ARXA 3IAPA 3GYCA 1GVYA 3LXAA 1HJWA 1WNOA 3UESA 2WANA 3AIQA 4LYPA 2X8RA 4W85A 3VSUA 4DWSA 4FNUA 2AAAA 2GK1B 2XM1A 3A5VA 2ZUNA 3LPOA 2WVSA 3VM7A 1BF2A 1SMAA 3PTMA 2E4TA 4MB3A 2XVLA 2DSWA 1ZBKA 3ECQA 3BC9A 3GH5A 1UR0A 1NP2A 1NOUA 1V02A 5CXPA 3WDJA 4TOQA 4CN6A 3MO4A 2ZUSA 3FAXA 4W5ZA 2X1IA 3ZSSA 4W84A 4M81A 3CLWA 3APGA 4KRUA 2XM2A 2D24A 1BSIA 1O6IA 2VTFA 3OZOA 4J3UA 1KR0A 4AZHA 3BXWA 3PN8A 1E0WA 2WVVB 5BRQA 1DWHM 4X0VA 2W61A 5A8PA 1VBRA 3DDFA 4DUXA 5E0CA 2J8FA 4CUCA 1CZ1A 4JFWA 3KWXA 4B9ZA 4WKFA 1V3JA 4R5EA 3UCQA 4HA1A 1BHGA 1UWTA 2XIBA 2EPOA 1I75A 4AZCB 1QI4A 1A47A 2D3LA 4GO9A 3H54A 4UFHA 1J0IA 2PI6A 3VD4A 1DHKA 2XGIA 3ZR5A 3KZSA 3DHPA 4E2OA 1QI3A 3AZSA 5ABHA 1H0IA 1R34A 2QMJA 3II1A 1U2YA 1QNQA 4OUEA 4NSBA 4HMCA 1RPKA 5BRPA 4ATWA 2PWGA 4MNLA 1GOOA 2GDVA 3N13A 4UFLA 2YA2A 2VCCA 3W53A 3OLDA 1EOMA 1GORA 3PZQA 4CCCA 3RM8A 9CGTA 2XGBA 3N17A 4H8HA 5A1AA 2BHZA 3VIPA 3WSUA 4MNKA 1UD3A 5I6SA 1ZBVA 3AS2A 4N0RA 1MW1A 3BSGA 1ECEA 4DM2A 4FNRA 5GNYA 5I77A 1J18A 2J77A 4P7QA 5CGMA 1LWJA 2GFTA 1QNOA 1HTYA 2VX7A 2BXZA 3F5KA 4HZ6A 4HOXA 2VZOA 2RGLA 4CD4A 1TUXA 4GZIA 2J25A 1BYDA 1WAWA 4BF7A 3DX4A 1C8YA 2DSUA 4H41A 1HL8A 3W37A 2OLHA 5E70A 2O9RA 3VUPA 4ACYA 3WNMA 3POCA 5ABFB 4DO4A 3NYDA 5E09A 2EPNA 4PTVA 3KEHA 1MFVA 1W9XA 4PUDA 5CG0A 1TQSA 2ZOXA 3BUBA 3AS3A 2NT0A 3MKKA 3TP4A 1AQ0A 2FHFA 1B3XA 1TG7A 5A2BA 2Y24A 3TONA 3N1AA 3WIJA 3RILA 2CBJA 4QDMA 1GOWA 4TTUA 2DT3A 4W87A 3UG4A 1QBAA 5A8NA 2WZEA 1BAGA 1TQTA 4AD4A 2W62A 3BMVA 3WENA 1TVPA 4E4PA 1C3FA 1U33A 3K8LA 1AQMA 1ESWA 2J78A 2VZUA 3CMGA 4BCEA 2D73A 2NSXA 2W66A 4PBGA 3AJ7A 2ALWA 3GDBA 1U30A 2DEPA 3OLEA 1XC6A 4GKLA 3GH7A 3VM5A 4W8AA 1LG1A 4CU7A 4LYQA 1VAHA 3D51A 1ITCA 4KH2A 1QHZA 3N04A 2FH6A 2Y2WA 2J7HA 1JDCA 2CERA 3B9EA 4HZ7A 4U31A 1B31A 1K9DA 3CC1A 2OSYA 3A4XA 1HJUA 1HKKA 2OW7A 4XV0A 4U2YA 4W88A 3HN3A 3G6LA 1ODZA 2YL9A 4GPNA 5CLTA 3AMCA 1WZKA 1W9DM 4NI3A 1W1PA 2G4FA 1XH0A 4ZE4A 5M17A 1E40A 1DWAM 4MDOA 2A3HA 3OG2A 1FH9A 3ARPA 3BUQA 3GNRA 4HOZA 2YL8A 4BQ5A 3WELA 4AZGA 2XN0A 3ARZA 2OYKA 2Z1SA 4P8WA 2JF6A 1NQ6A 1GQKA 5DT7A 1EQPA 3IJ8A 2ZUUA 1KWKA 4Z2JA 1UKOA 3N15A 3KL0A 2X2YA 1CLVA 3FAWA 1ZB5A 1GJWA 4BQ3A 1GZJA 3LRKA 1F4AA 1E9LA 1GCYA 4PMVA 1E71M 2CHOA 3D50A 1UZ4A 2DT0A 2YFOA 4UOZA 3SCNA 2EABA 2MANA 4JKKA 4ACZB 1TA3A 3AMLA 2FYVA 2DSKA 1H11A 5BWFA 3VIOA 3D4YA 3GXTA 2GUYA 2YJQA 1V6YA 2XFYA 3ARRA 4Z2GA 1OGBA 3VDAA 4D6GA 1ZS2A 3HZ3A 1V0KA 3F4VA 4GIAA 2A3AA 1LJYA 3HG5A 3WQ5A 3ARQA 3AS1A 1JF5A 4K68A 1HIZA 3RMEA 2F7QA 3POHA 3U5UA 5E6ZA 3MMDA 4CKQA 1UG6A 4W89A 1QI0A 1KGUA 3CUFA 4UFMA 5FIPA 1VEPA 1ZU8A 3LXCA 1L0PA 1CXIA 2CIPA 1HWWA 7CGTA 3TA9A 2CHNA 3K1DA 2EBNA 2E3ZA 3GBEA 3WF4A 1PS3A 1CEOA 3NIYA 3QHNA 3LX9A 1GQJA 1IZKA 1J11A 4H7VA 1CPUA 2FHCA 1Q6GA 3SCUA 3RO8A 1YHTA 2WXDM 1KBBA 4OKDA 1GUVA 4EANA 3H53A 1S46A 2OSWA 2VVNA 1GJUA 4FNPA 1UQZA 1C7TA 4B16A 1HF6A 3WH9A 2CCRA 4GI9A 2D0HA 3VIFA 3IJ9A 5GNXA 3VOCA 3CZEA 3VSVA 1J10A 3BUDA 3AI0A 3L4XA 4GI6A 1JYWA 2YFNA 1MWOA 1XD1A 5DF0A 3RM4A 3DECA 4OGZA 5A8MA 1R7OA 3NDYA 3VMNA 1CGYA 1JFXA 1B2YA 4LPCA 2BS9A 2G3IA 1T0OA 4AMCA 4P7RA 3VGDA 2F1BA 5EFDA 1G0CA 3DYPA 2ZWZA 1OWQA 3IGUA 4WSKA 2D22A 4AWEA 3K8MA 3VSTA 1IT0A 5LYRA 1V6UA 4NXKA 3WEMA 3M07A 1BVZA 1UZ1A 1HNYA 1KXQA 2UY4A 4LX4A 4P8UA 1UD8A 1JZ7A 3E1F1 4GI8A 5CJ5A 4FLQA 3ARSA 1JYVA 1X1NA 1UD4A 3O6AA 3RJYA 1LL6A 2DIJA 1ZL1A 2DT1A 4TUFA 3T2OA 4AEEA 3K4DA 3WF1A 3CIVA 2WB5A 3BUIA 1G94A 4KGLA 1TQVA 1HN1A 3VD5A 3AIVA 4MNMA 3CHDA 1D2KA 3SUVA 3VDBA 2GK1A 4URIA 3D4ZA 5D9PA 5D9MA 4AC1X 1V3LA 1EO7A 1UR1A 1HJXA 2ZX7A 3NSNA 1W1TA 4F79A 4C7FA 3L4TA 4CVUA 3WY4A 4JKMA 4C7GA 4GXPA 2WHLA 4YN5A 3HJEA 2ZXDA 4WKAA 4BA0A 1VRXA 5JIPA 1ZBCA 2BVYA 5LA2A 3WF2A 2D23A 1G01A 4Z2HA 3THCA 2XVNA 4FLSA 4IISA 3ZOAA 1TQUA 4LGXA 2GJRA 1BGGA 2J47A 2BY2A 3W38A 3HG3A 1W9VA 1ISXA 2VRKA 4AZ7A 3WNPA 2XN1A 3GBDA 2WMJA 3UEQA 1DEDA 1XYFA 3OGSA 1GW1A 5GPRA 2ZICA 3AHTA 2GSJA 4AY1A 4MADA 4AZCA 2E40A 4D6EA 3AMDA 5AYIA 1WDRA 2F7PA 3SCSA 1JGIA 1E43A 3VIKA 3QHMA 2DT2A 4IPNB 4PSRA 5BROA 2CYGA 3H55A 2X0YA 1IV8A 4WJXA 2YBUA 1D3CA 4MB1A 3AIUA 3VO0A 2O9TA 1BQCA 1WB0A 1C93A 3NJ3A 1CXLA 3BLPX 3KL5A 3CHEA 1UR8A 3AISA 1K9FA 3GZAA 1KGWA 1JNDA 4ATDA 3CZ8A 4HMDA 4HPGA 1V02E 4X0NA 1E4NA 3WDQA 3BMWA 2YLLA 5A69A 2XWDA 4WLCA 2EEXA 3W81A 3VGBA 3AXHA 2J7BA 4CVWA 1J12A 3THDA 3GXMA 2BHUA 2XPKA 1VEMA 3ZJ6A 1XCXA 4RE2A 4J27A 2ZXBA 3W6LA 4IUGA 2J4GA 3B9AA 2Y4SA 1BGAA 4E8DA 2VCBA 4AEFA 1XSJA 3WL0A 2J74A 3PZGA 3HG4A 5ABFA 1GOMA 2WVTA 4FNTA 3WUGA 2C8NA 1C7SA 1UH4A 1ISYA 4W8BA 5GNZA 3WF0A 2WW5A 4W7VA 3VDCA 3T0DA 3GM8A 1HJVA 3SCQA 1IZJA 3WMBA 4AZ5A 3W6MA 2UY2A 2XFRA 4CCEA 4CGTA 4B3LA 3OA5A 1H1NA 4ML4A 3L4ZA 4L4PA 1KXHA 1E4IA 2J7GA 4M29A 3WD3A 1CGUA 1HVXA 1SFSA 2VMFA 1E5NA 5I3DA 4WIWA 3EMQA 2VQTA 7TAAA 3A4WA 3CO4A 2IGTA 4U3AA 1QX1A 1UWRA 1FOBA 2QV4A 1VFMA 4PEEA 1H0GA 1KFWA 1Y7VA 1VEOA 3U57A 4D72A 1EOKA 1B30A 2VUYA 3OLIA 3GXPA 1XSKA 5AC5A 4JL1A 4V27A 5DEZA 2DSVA 1TR1A 3CZSA 3SCOA 4PCSA 5DT5A 3DX1A 3GNPA 3LRLA 1W1YA 1NH6A 2WCSA 3W4RA 3LPGA 1DWIM 3B9DA 1JZ4A 3VD7A 3JUGA 4W93A 4KGJA 1RP9A 3BAIA 1PJ9A 1VFFA 4MDPA 2RGMA 4UQAA 4MB4A 1HKIA 1CECA 5LA0A 3AHYA 1W3JA 2EQDA 2ZX6A 2WBGA 3IJ7A 3UG3A 3VGGA 4ZE5A 2XN2A 5I0DA 3PBGA 3UERA 3T2PA 1K6AA 1OIMA 1KWGA 1EO5A 1YQ2A 5E9AA 1E4MM 4D6FA 2C7FA 1KCKA 4AYSA 3O2LA 1GQLA 1V3IA 4PN2A 1M01A 1BG4A 6CGTA 5D9OA 4N42A 1XHGA 1UH3A 4CCDA 3ZJKA 1E6PA 1W1VA 2E8ZA 4ACZA 1V6VA 3LPPA 1VBUA 2ZUVA 2F2HA 2QPUA 2JIWA 4JCMA 1H09A 3AIEA 4QFUA 3WQ6A 3GXIA 1UKTA 3PTQA 3TOPA 5A6MA 3WKZA 4EK7A 4PMRA 1UYQA 2EJ1A 3L4YA 2JALA 4AD0A 2X2HA 3SUUA 5DMYA 3MI6A 1Q6CA 1V0LA
chains in the Genus database with same CATH superfamily
3UYOD 2OMVA 1XH1A 3UBHA 2WHVA 4M02A 2PWFA 4JNXA 2UZPA 3P81A 3EYSH 5FLUA 2ISDA 4HUCA 4Q89A 4PJ5D 2Y6SD 2IWFA 4AUBA 2AQQA 1WDPA 4GQZA 5F7AA 5C2XA 3MRNB 4O2EA 1OKEA 3PWJB 1HL9A 1OK4A 2XQBH 2JB6A 2X1QA 4BQ4A 3UWZA 1RZMA 2LU3A 4B95C 3P73A 3P2DA 3C0LA 1F90H 5JQ6L 3W7PA 3ELFA 4FHAA 3ONBA 3UC0H 3C8KA 3D0LA 4N4YB 4KKBD 4AF0A 3OYXA 2VDOB 4MXQD 1INQA 1KBPA 3HQPA 3OB8A 5F7DB 4QY8A 4AMKH 3O6LH 3Q06A 4EIGB 1KBKA 5B1CA 2KX9A 2VLLA 5T1DL 3HZYB 4HIEB 3U2SB 4BWLC 2NW3B 4MQSB 4WO4D 3MZGB 3DFOA 2GAZA 3EBAA 5CP3H 3MJ9A 1UP2A 1WUNT 1LQ0A 2PLCA 1LMIA 1AACA 3HFTA 2NY5H 5FUZH 1MHEB 3CXDH 4K7FB 5BRZD 3C5ZD 4HOMA 1QNSA 4J3VA 1OFBA 2O9OA 3QXWA 2D7TH 5LG6A 1XV8A 5JIMA 1KIPA 3WJLC 2VGLM 1WAEA 4PL1A 2ZRVA 5CMAA 4H4NA 3QMSA 2H26B 4YS4A 4WDIA 4E41A 4ERGA 3XISA 2EDFA 3R1GL 3VI4F 3NQVA 4HU3A 4HK3J 4PR5B 2XFXB 5DZ9A 4IRJA 5A6BA 5SWQB 2VXQA 1VF5C 4PCTA 5EIQA 3ZKND 2ZZ1A 2CZ5A 1HOCB 1A7RH 2DW6A 2G3NA 3QV6A 3DV6A 4PEKA 4UM9D 4XC1H 4PJEF 2GYIA 4W8LA 3QUYA 4DNMA 4MCZA 1B4TA 3PHOB 2Z9TA 4MPQA 4B9YA 1VS1A 5E5RB 3ARED 3QY8A 3Q37A 3Q1SL 3O9WC 4V1DB 4O9HH 5E2WL 1R30A 4Z7IA 2A3LA 1AMYA 1SM3L 1OGSA 3K74B 3D3VB 5BWAA 3CMJA 3R4RA 1V0MA 4N3UA 3F03K 3RYSA 5E08L 1RUQL 1AZNA 4NC2B 4NCC2 4JAWA 5EZPA 5D1XC 5A2KH 4F5CA 2GTWA 4FABH 4OQTA 4GJTB 1TTCA 4Z7VF 4XODA 1TT6A 2XIQA 4FF5A 3TTOA 2O4QA 4PJIE 2CCWA 2MUCA 5H4ZA 4JZJC 4UV4H 1BJ1J 1QPKA 3HMCA 3P5YA 1TR7A 3WFZA 1L6YA 1NVMA 4D1IA 3C2FA 4NQSB 1DTUA 4PJFB 3MDJA 4Z78B 3FCSB 2R1WB 2WVVA 1TSHA 2XZCH 3SPGA 5KSVB 3I2CL 4XRCA 4WHBA 4NQDE 1TYJA 1M53A 1W3NA 5CSYA 3W84A 5HHNA 3MUY1 2D20A 4FQHB 2P1YA 3FSVA 3VXMB 5DRWB 5FJTA 1J9CT 2JK2A 2R59A 3RX8A 4E8CA 5B4MC 5A2LH 4JJOA 1OAQL 1UM6H 4ZO6A 2V5CA 1R3YA 1T03H 1GWJA 3Q6FB 4TRPL 3W28A 2XVKA 5AHNA 1WAPA 3MV8D 1BRLA 5IB4B 4DFHA 1BQHG 3KDPB 1BWWA 3ZTJG 2EO1A 4ACTA 4YGAB 1MI3A 2GWNA 1TO3A 3EPMA 3NCJH 3U2ZA 3ET9F 4OZ4B 3MJ7A 4ZSOE 2AANA 1LEGB 2KMWA 2FZ3A 1XXXA 3ZL2A 1ETA1 4QXTB 3DSNB 2YIHA 3QIUC 4MKTA 4MSWA 3T8XA 1CDYA 4KZDH 4XNYL 3QIBB 4AEIL 3GE7A 4LCCC 1D8WA 3NABL 5DANA 5B21A 3H7BB 3U0WL 4IHOA 3QKZA 4PMUA 5AY7A 5JXEC 5LHFA 3RJDA 5AW4B 1EX1A 2C1OB 3EDKA 3I6GB 5IK3A 5B7FA 2UY6A 4MJIB 1DIKA 4DFIA 3M1OA 4D9QD 4TL4A 5TDOB 3N4AA 4US5A 5D5MF 2E47A 3S3BB 4AD1A 4OQVA 4RNJA 4G7FA 1ENUA 5DLMH 3VIGA 4MQ7A 1QAWA 2A83A 1GH7A 4NQCA 4GGHA 3RI5K 4IGNA 4PS7A 4EI5C 4P8VA 2CKSA 2GL5A 2O9PA 2XG5B 3M0VA 5HD8D 1DOSA 3IBEA 3C6CA 3QHOA 1VJIA 1PU0A 4ZPVB 2QVIA 3FQRB 3TH2T 5C6MA 3RBGA 3P2BA 5EFFA 4PV8B 2WXKA 1VSCA 1IT9L 2ED9A 1T1ZB 5TFSH 5AZ2L 2PO6C 2D3JA 2FX8H 1UM4L 4E6MA 5EF0A 4RPQA 1G7MA 3BLDA 3M1CA 4C5ZA 4F2ME 4ZMQA 5I5MA 4W9IC 3G18A 3EKGA 1B0RB 1IAOA 1IO4C 4LSPH 3D08A 4KTYA 5GHWH 3RPKA 3CHCA 4QOKA 5C8BB 4PZVA 3KBEA 3TROA 4KKQA 3SJ3A 1BDYA 2EIEA 5KSAC 1F8TL 3BCJA 2EH8H 3D3FA 4NKQB 1OHLA 3L5WA 1CXEA 3OJDB 4OZOA 2QTVA 1W8EA 3UZVA 2VN7A 1XIJA 1L2QA 5LVEA 5FM8A 3FXYA 4QWWD 3M0ZA 5CSZA 3AUWB 3FSUA 3WQ8A 3SFKA 1NARA 3MACL 2NQLA 3LHWA 4PS4L 1JZIA 3GMPB 2AL2A 4BWWA 2B1OA 4PGJA 3PZVA 4P5UA 2OR9H 2FECI 1ZPTA 3ARFD 5DUBA 3G08B 4LBSA 2GDQA 3C2OA 1R3KA 3NZHH 1W5OA 1R3IL 5DRCA 4AQAB 5C0AE 4ZS6C 4UAOC 4Q3MA 4FHBD 1KO0A 1NCBL 4P5KA 4YK4B 3VNMA 1NM9A 4X9IA 5AZEH 3QH2A 5I30H 3WIIH 4GFIA 3AC0A 4QXVA 1LROA 2VT0A 4JMNA 1PEZA 4M82A 1XH2A 1OGAA 1I8JA 5DVNA 3ML9A 1TQXA 2DQWA 2AK4E 1CW2A 3VXRE 2PN5A 4HKXB 3Q45A 3PHAA 1RIHL 3UCRA 1Z66A 1UWUA 3KYMB 5C3LD 3F6JA 4I5BA 3F5LA 5ANME 3UG5A 4UTWC 1CBGA 1S7QB 4X7CC 5IEHA 3REQB 2DQFA 5EU6E 3SCTA 1Q2RA 4GYPC 3BWSA 1YLBB 4FA6A 4PCNA 2WZMA 2K6ZA 3TCXA 3R4DA 4YHNB 2BZDA 4M61A 1ZA3A 1TJHL 3LKSB 2W9LA 2JGQA 1AXIB 3ZLFA 1MREH 4KVNL 5LGXA 1V7MH 3QJAA 1TZAA 3FPYA 3FTWA 5DJ6A 3FKUS 3QNYA 4DAGH 3WH7A 1QEWA 1L9PA 1WFIA 2E5BA 5EOCJ 4NUPA 3ARDB 2W95A 1H15A 4UI2A 3OIXA 2Y06H 4M1GL 3DUGA 3SUTA 5L4JA 3LCFA 4IRSA 3MJ9L 4XBPA 2Z4QA 5L88L 4ZB5A 1VR6A 1U3NA 4OT1L 4DO6A 3G7TA 4GKZB 4AI7A 2HFGL 4G6JH 4ELME 5GRXG 3O6MH 4GMSH 3TYGH 5A16B 3HUJA 3VW3H 1MPAL 4M24A 5HHPA 1Q45A 1UVQA 5FOJA 2WN2A 3SE9L 4OUUB 2FDBP 1UM5H 3H2WA 2WM0A 3SKOA 2I27N 1ZT4B 2IXVA 5I6KA 1TYRA 1VFTA 8RUCA 3EJSA 4S0SD 2B5IB 2W5PA 4FF7A 1JYXA 3I6TA 2B2XH 4PD4K 2DSZA 5CZXC 4OF0A 3PV6B 3FQ2A 3GM0A 1YPFA 2EC9T 3DOSA 1NDMB 3T1WA 4MD5B 4KAQL 1H50A 1RP8A 4XPTH 1KBLA 3C60C 3TQVA 4JCWA 1E2ZA 4C6NA 2G9HA 1WKEA 2QUVA 1JIBA 5CC3A 4L1LA 3F3HA 3MSPA 5CINL 4V28A 5ITBH 4HG4K 5ABGA 1GYVA 1P4LB 5CJQL 3BPNC 1NA8A 3UO1L 2XC8A 1QSFB 5DI8B 1IWPA 2BVOA 1FLRH 1FBIL 3I9GH 3FT1A 3LXAA 4FJ6A 3M4HA 3BN9D 2NDFA 4JR9H 2YXOA 3EOAA 1XFPA 1X5LA 1D3HA 5K2ZA 2XM1A 3H7VA 4IIQC 2CMRH 1BF2A 3MUXA 1ZBKA 1HTIA 3OR7B 1HHIA 5DMIH 1OP9A 4OQTL 3WDJA 4KEMA 1KPUA 5I0XA 1YYLL 3VTTA 4EVNA 4W5ZA 3ABOA 1K1DA 4OCYH 4NIYE 4UMCA 1SOQA 1CICA 5BRQA 2C14A 3QPEA 3U6RB 2XH2A 4WEMB 4K71B 4DLMA 1KBGH 2FX7H 5JH1A 2BIPA 2IDTA 5T1LA 5ABHA 5I0WA 4KESA 4F7MA 4NSBA 4HMCA 3HC2A 3IIVA 3P60A 5D1XD 3KPLB 2PTXA 4KS0A 2VCCA 5SWZA 3MTXA 4H8HA 2X4PA 1E0UA 1DSFH 2YAMA 4GW5A 5JOEA 1LWJA 3M5XA 2R0KH 5F7FA 1EXHA 4WO0A 4PJCE 1BFSA 3P3BA 3WHXA 4CD4A 4GZIA 2Q86A 1WAWA 2DJLA 1DVTA 4NI8A 4UINH 2BSBA 1HL8A 3NAVA 3I02B 2QFPA 4HGMA 1MZRA 1GGBL 5C2BH 3CHXA 3ZDZB 3DX8A 2HUEA 1WHOA 2Y1AA 2A9ML 4ORIA 1YNTB 2ZCLH 1UA6H 1UWEL 1JGMA 1JVKA 2X7LA 5B38A 1E9OB 5AVRB 3SYQA 1M3IA 4YHYC 4M4RA 1JPSH 3UU0A 3H56A 3VH8B 3O3UN 3BW2A 1KXVC 2PUQT 1EF3A 4O02B 4K5PA 2MMXA 2R14A 3MLRH 1F3DJ 1ITCA 5EOQL 1S2TA 2YB1A 3FDWA 2AXGB 3U79A 1QASA 3SKJH 3TF7C 1HKKA 3L2IA 1EJ8A 2O26U 5B4MD 1SY6A 2OS7A 5JQ9A 1IM9A 3S6DA 4AZUA 1OZUA 1D7DA 1E40A 5CIPH 2OT0A 1YMHB 2VFHA 5C6TL 1IEQA 2B9AA 1EXUB 3NO1A 3PP4L 3CMOL 3VZZA 1MWAB 4NFDA 2QV5A 2XZ9A 5C09B 1GQKA 4Y4FB 4KRNA 4RZKA 4WGHA 2ZOUA 3KFTA 2IMMA 4NWUL 3TJEL 1CR9L 3L95B 2NXYD 3UJFA 5DN1A 3NRQA 1BBJA 1FYHB 2QV2A 4Q9QH 1V54B 3PJWA 3Q9QA 5AVHA 4XNMA 3BKML 3AMLA 1IQDB 1TEFA 1TSRA 2BCMA 2CK0L 2SFPA 4WWNA 4M6PA 3NIGE 1T8QA 1ML0A 3GO1L 4D6GA 1NMAH 4IMCA 3EO0B 3FYPA 3CPLB 3HG5A 5EORL 2VLJE 4N0CC 4K68A 2OMVB 3WGVB 3BKJH 4PGDA 4Y9AA 2CD0A 2Y6ZA 3FO0L 4IIEA 2NOYA 2IDQA 5EO0A 4JTTA 1VESA 4Z3GA 4H7VA 4O2EB 1CPUA 1U92A 4KMLB 3UNTA 1CLOH 4ZTPH 1S46A 4ELKA 3CL8A 4DPAX 3MC0A 3CH0A 3F4CA 4E38A 3B9KA 5MHBA 3WH9A 1QKZH 3P73B 2V69A 3DTUB 1ECZA 1KCRH 3VSVA 1V8HA 5TBOA 2BIHA 2FQFA 4R7WA 3BUDA 5E2UH 4NU7A 2YFNA 2E56A 4AF0B 1OK6A 1INQB 3LNHA 2HPMA 4HD5A 1T0OA 4QY8B 4OKVA 3A67H 4IXHA 2VLLB 3CB8A 1BVZA 3UTTA 2UY4A 2RHGA 4JREB 2ODIA 1F74A 1NEYA 2XPGA 3KTXA 1EJWC 1KBJA 3Q8EA 2EDNA 1QO2A 2GAZB 1SJVA 3HB3C 3W0WE 4UIKH 4Y9CA 2DIJA 2G5BA 2APBA 4DCQA 3WF1A 1XVSA 1FWEC 3SKNA 3MCYA 1JTOA 3DKJA 3IGSA 2B7OA 4MCMA 1DJWA 1D2KA 4ICWA 4XP9L 3RWFA 3B8YA 4AC1X 5KZDA 1ZCRA 1MFBL 2E1WA 3PJLA 3H4XA 1KIPB 2WP3O 5T3ZE 1P0KA 5CMAB 4M5YH 5KSAD 4WDIB 4E41B 2WHLA 4FFVD 3FYEB 3WF2A 1TQUA 4FHKA 5J11C 4JDTL 4WFGD 4IRJB 3C9NA 2DZPA 3KLDA 3H2EA 2W0FA 4WV1A 4Y2OA 3DOHA 3JTBA 5GZNC 1A5UA 2E40A 3W9ZA 1YUKB 3BLLA 5C0CD 3UZQA 4AYMC 3TO4A 3PAZA 3GK0A 3KBFA 1A3QA 4XAWH 4XCCL 4WJXA 3QUYB 1AG1O 4MCZB 2IAMA 3WD5H 2J3SA 1NFDF 4ERSH 3BMWA 4NO0A 3VQMA 2VD9A 2OSLA 2YR3A 3B8DA 3W2JA 3AXHA 2J7BA 1B4JH 5FYKL 4XPGH 2IPWA 4YVPA 3ZJ6A 5EMLA 3F2CA 2M26A 1XBVA 4Y19D 5HHVL 2J8TA 4KXBA 3S35L 3THQA 2Y3AA 4N90D 5KSBE 2GTWB 4N2IA 1OGTA 2F58L 5ABFA 2F8OA 2C8NA 3O05A 1URZA 1DE4A 5JHDE 1PVHA 3K2IA 2LTQB 4JAMB 1PHQA 3RPDA 1Q6QA 1ASOA 3OA5A 4FOMA 1KXHA 1OP5K 1W31A 2CIIA 2EYSA 5E6RB 2NX5E 3ZYZA 3ULUH 2IGTA 1QX1A 3GD1C 3WYRA 4F7EA 2QVNA 4UT9H 1T89C 4QYOA 4M5SA 2X4NA 3CZSA 5CJMA 5HHNB 3GUTA 4KDWA 5JLZA 3UYIA 5HMSA 3EWCA 3CDGA 4LUYA 1JZ4A 4PRHA 3MOAL 1DZ0A 4N2MA 4B5VA 4WR3A 2XZQH 5JNYA 1IGIL 4GT0A 3H70A 2FGBA 2DFAA 1ZPUA 3GDRA 4K7PH 4S3AA 3VA8A 3FOMA 3LS4H 2VD8A 2F5AH 1BRLB 1TETH 1ONRA 3GC2A 5KTLA 2DZAA 1Y6KR 2AJXL 2E8ZA 1T04A 3Q43A 1JFQH 4H6QA 3TWCL 2CRZA 1MFCH 2JIWA 3FN0H 4RZ4A 5DD3L 2AVGA 1NUGA 3MNWA 4GRLD 3QZWA 2MHAA 1H9DA 3SDAC 3QQ3A 1H7OA 5FIEA 4HK5A 3MJ7B 3MRHA 2FZ3B 1DQLL 2GQ8A 2ID5A 4MSWB 3T8XB 5BNXD 4F7CA 1SO4A 4JMXA 1AVAA 5DO2D 2HJLB 5DD1H 1G4PA 1YEKL 5JDSA 2WLYA 3HF3A 5AHLA 1HKVA 1NCDL 3APFA 3MW7A 3DO3A 4IHOB 4K9EC 1EZUA 5TE7L 4Z0BH 4WOZA 3L7EB 3KBHE 4XH2A 1W5NA 1IT7A 4UQCA 1G0DA 4MS6A 3BQ6A 1F58L 3CUJA 5IK3B 5CZXD 2UY6B 3CLFH 2DN7A 4G7YH 3D2UD 2FATH 3G1DA 4PRWA 1BLIA 3WJJC 5AEAA 4FTVB 1QQDA 3I84A 4QIRA 3C60D 1V51A 5JVLA 4OCMC 3AYRA 2JKXA 3FQYA 4W4QA 3TSMA 2VX4A 2AABH 2DF3A 2VB5A 1REQA 1RPUA 5DZOA 4MQ7B 3FS2A 2A83B 3F58H 2C3ZA 4HYVA 1ADOA 5EOTB 3QNXA 3G6AA 3U7YH 5F7NC 5D71L 4LNCA 1IARB 4MAYA 2JIEA 4QRRD 1PDKA 1DBTA 3KDNA 4HB7A 1K70A 4LVGA 1OP3K 5J7CC 3LTVA 3SRFA 3BZEA 3UWEA 4UQEA 3D47A 4L1XA 3FFCE 1G7MB 1TG8A 1TTBA 4OR1A 1L8PA 4MA8H 4F91B 3TNMA 4LWWA 5BZZA 4HTYA 1K8CA 2RAMA 4Z7UF 5A2AA 1MJ7L 3N43F 3IRSA 4QOKB 4POYA 3F2LA 2IBGA 3Q8CA 5DFVD 5FW7A 1E9PA 3E2QA 2N59A 5AW3B 4X6BB 3KJ4C 4DHLA 1YY9C 1QHPA 3CC5A 3FVMA 1TV2A 1M04A 1OC5A 3CVIL 2F7OA 3L5WB 4GAAA 1IQWL 3MY9A 2W07A 5JIIA 3P5ZA 3P84A 1IBGL 5A8GA 4KRPB 1YNPA 4DP7X 2V33A 4KEZA 4XXDB 2FLIA 3QEUA 1CD0A 3IRZA 3C2VA 1YG9A 1SY6L 4PUNA 2QKFA 3W0KA 4Q6KA 3STCA 5CSZB 3SDYH 25C8H 2HT4D 2FZMA 1JAEA 3BPOB 5JHAA 4PJHE 5HYSG 5BZWA 2AL2B 3G1VA 3CK0L 3VGEA 4JJHA 4F7PA 3JSSA 4GP5B 3VNLA 3F7YB 1RBLA 2HLFC 4WKZA 3BD5A 5C0DA 3VC5A 2R1MA 5E23A 5DSCA 3K6IA 3CBKB 4D8PA 5EEYA 3W76A 1R3KB 2O1AA 5EO9A 4KTEH 1CJYA 2ADFH 2OX4A 1NOAA 1U8NA 2WLLA 2FNWA 5J12B 2B3RA 3W24A 1YZZA 4OF6A 3ZJAA 4P5KB 2X9XA 5AG9A 3DC8A 5GS1A 3N2MA 1CBVL 4N9DA 3H4FA 2ZWYA 5HHME 3TL5A 4L1DA 3KPRB 4PMDA 4FLRA 4GYFA 2AJZA 2LT9A 1EEYA 3L1FA 1OGAB 2P5WD 3S36L 1I53A 3GJFH 2WPBA 4UV7L 1WYIA 5D6DC 5D2LF 2XSAA 4JO2H 4E42A 2Y6SC 4EX4A 3CQPA 1R9ZA 1YE6A 1JGEA 4I5BB 3WJMA 4UM9A 5DZVA 2ZZ6A 3HC4L 5IEHB 4DW2H 2DQFB 3Q58A 4HFUH 5EIIG 4ZOAA 4X4XB 3B6SA 4L8BB 1ZA3B 3FSOA 2CGYA 2GUUA 3WEOA 1SMOA 4LVNB 1UFGA 2C34A 4O02H 1OM3L 3WKPA 43C9A 4XX6A 4KKBC 5I1EH 5DJ6B 3CLEH 4CA4A 3OQ8A 5D2XA 3MUHL 3MUGA 1WZ1H 5EZOL 4YSEA 4AWSA 1CGWA 5FO8A 4JX4A 4U3XA 2C19A 3ESOA 4U3SA 2RQ8A 4WO4C 1A5NC 3Q1EA 4P04A 3GXFA 3MDWA 2VLKD 3LCYA 1BXAA 1OAKL 2VR5A 2VZVA 1MWAH 4AIBA 1WA3A 5AZUA 2JKAA 1E4JA 4AX6A 3C5ZC 1LT7A 2YUXA 3HS0A 1X5YA 1BM3L 2OR7A 2QHAA 3A9BA 3HUJB 1XHHA 4XPHL 3INUL 1TVNA 5HHPB 3UJIL 3OKOA 4JR5A 3LNPA 1JXDA 3NIFE 3SKOB 4TSCL 5FD0A 3SCMB 3KRSA 3FN3A 1VFHA 5H8PA 2GBTA 3OQRA 3F5WA 3MLTA 3FQUB 1IM3A 3ZKNC 1L7IL 5IW1A 3TYCA 5IBTH 1YXDA 3SYPA 5EEUA 4KW2A 5XINA 3R19A 4UFKA 1BGXL 2MRYA 3DOSB 5FO7A 2BVEA 1T83C 4WCYL 1Z9OA 3VI3E 4AXWA 4L3AA 3ECWA 2WXPA 1C8XA 4W9JC 1FYTA 3LERA 2A79A 4CN4A 1IEXA 5TNVA 2X2JA 1VLXA 1QWNA 1DVUA 3NQAA 3AREC 3AYSA 3MBED 4HWEL 1TCRA 2BVOB 4O11A 4EPEC 4HA4A 3EOAB 4PWKA 3L5AA 4I7ZC 4LSUL 15C8L 3V7PA 4DLFA 1SLXA 3Q3GA 3IANA 4YL9A 4R7XA 4KROD 2VZTA 4PBXA 5FO9A 3EH4B 2E8YA 3M43A 5CU9A 2Q1EA 4PGLA 1UB5A 1Z3GH 3ZE1E 1F6FB 4H2CA 3CZNA 3UJJH 2Y2TA 5ESVA 1KRBC 5FSDC 4AMWA 1MCNA 4P3WA 3CYJA 5FR3A 3UPMA 1X6LA 2WWCA 5T1LB 3IJQA 3HBZA 3IBOA 3ZIMA 4F7MB 4ODXB 1RJRA 4JGUA 3I7SA 4RUBA 1M7DA 2FT7A 1R3SA 3NACH 2B0SH 5SWZB 1G6CA 4PFMA 3AGWA 5AD0A 4XN8A 3SAZA 4RRPM 5D32A 2X4PB 1NUNB 1C90A 4GW5B 1F1GA 5TQ2H 4TVDA 2V5SA 4MNQD 3W1MA 4B3ZA 4Y5XC 3G77A 3WHXB 3S2JA 2H45A 4L8DA 4WI0A 5IWLC 3HR6A 2GKIA 3VXSA 3DX8B 2A2IA 1ZTXH 1C92A 5C86A 4QGTA 3TYDA 5B38B 2RB8A 5AQ0A 4KX7A 2VELA 3INPA 5HYJD 3QR1A 4QAWA 3FA5A 3KAAA 2PPDA 1D6VL 4FQQA 1EFZA 3HNSL 2GVYA 4KI5F 4N6RA 2B59B 5KJ7E 3MV7A 4N22A 2EPLX 2CBVA 3PZTA 3P02A 4JO5A 5JR1H 4KI1A 3WDRA 1OCZB 3KHOA 4RISH 1US3A 2IW0A 1I9IH 4M6AA 2D3NA 2RKXA 4P2OD 1KJ3H 1IM9B 4UILH 3ZLHA 4P5RA 2WC7A 1U93A 1C5DA 3T04D 4HWBH 1OSPL 3X12A 3M0XA 1KBVA 4OLZL 4RFNC 4JFFA 2JNZA 1QTWA 1CL7L 4MAZA 4NKDA 1T41A 5FHAH 2WYIA 1F3JA 1EZLA 3LJ3A 4DEPC 2X1SA 4Y2NA 3SDAD 1HJQA 2ZZ7A 1TDQA 2R94A 4PN6A 1OTUC 2Y69B 2QSCL 1TXKA 3I9PA 4EWJA 2WBJB 4XNMB 4F8PA 3C2YA 3EWDA 1WSST 2O93L 3WFHA 2AQRA 4KI5D 4BK8A 1OAZH 3PDOA 2K6WA 3REVB 4Q33A 3TC6A 4YBQD 2P8LA 3C2SA 2V38A 3WLHA 2HRGA 1A5LC 3ZZLA 3H3PH 2J7LA 1PCWA 4PGDB 5CSGA 1TWSA 2WV8A 3QFWA 1MEWA 5FPIA 5I66A 4M6QA 2VW6A 3A23A 3PP3H 5EO0B 5FM5M 5BVPL 1KTRL 3OG4B 4ZMZA 2PU0A 1CFTB 4PWGA 2R56H 4ELKB 1DIEA 4W9TA 4YIWA 3LS5H 5IHHA 2PWUA 2O4MA 3B9KB 3G5ZB 4ZXOA 1VKFA 4C6CA 3CQ0A 2GQAA 5INDA 1CNVA 3MRDA 3NCWA 4PI2A 4E9QA 4HW6A 1KIUA 1BQLL 3ZTDC 2X30A 4PLJD 3Q65A 6PAZA 3A21A 4M5ZL 3AOFA 1NBVL 5IHUH 4ZB2A 4AC4A 2DKMA 3UTTB 5KBKA 4Q8TA 4A21A 2XPGB 3I74A 3HHSA 1J8KA 4FG0A 3DXAA 4ZX5A 2F53E 5EUOB 3VI2A 3PULA 1FGNL 1BQUA 3GZKA 1LRNA 3L5HA 3S2CA 1P6AB 2GCYA 3SE8H 4G5DA 2PD9A 4MVAA 4I9XA 2G5BB 5JPMB 5D93B 3S6TA 4NZTL 3SKNB 1WNOA 4LDEB 4QWWC 2WANA 2ZCHH 5KS9A 4HK7A 2BNQB 3TN0C 1VHNA 2AAAA 1VDGA 3KYKL 4M48H 3RWFB 2WJZA 1QWKA 4MB3A 4TSAH 2DSWA 2FX9L 5F1SA 2C91A 3F4NA 4GJ1A 3GH5A 2GPZA 1QLFA 3ARFC 4GBDA 2VWEE 4AL8C 4UT6A 5HI4D 1QHQA 2PW2A 1UPPA 2W0FB 4WI4A 4WV1B 4Y2OB 3PUOA 3CWOX 4LPXA 3UZQB 3TO4B 1HE8A 3KVLA 3VD4A 3C3NA 2BBFA 3UZEC 3UIYA 2DLTA 2B16A 1CLKA 2IAMB 4BWLA 1X4ZA 3NCFB 3CDFA 3RY5A 5E2VL 1EZSA 1AZVA 1QWGA 4NO0B 1BECA 4CNNA 4NYYA 1U91A 4ZA0A 2OSLB 3VKCA 2PE4A 3BSGA 5ELIA 5HDBE 4XE5B 3EA1A 1O1ZA 3RDJA 3RPTA 2WWNA 1P5UB 4S1RL 5D7LD 4LSDA 2J72A 4LLUB 3ZUCA 3H21A 4A8IA 3TIEB 3QPZA 5E70A 1UENA 4LCUA 5ABFB 4LV4A 3WJLA 2C3WA 2IPUK 4Z17A 1Y8BA 4PUDA 1DE4B 4JTIA 2NT0A 3O2WH 4XHJC 3FU0A 5A2BA 4L4MA 1IB5A 2KPWA 2CBJA 4QDMA 4F8TA 3AITA 1AI1H 1P6FA 4LEFA 2CIIB 3FB8B 3LXUX 1DBAL 3ABQA 1LG1A 4CMHB 4ADTA 1DIDA 4F7EB 4F57H 2QAFA 2YAEA 3OR6A 1Z5HA 1A6VL 4QYOB 2X4NB 3MJMA 3W74A 4GVGA 1EA0A 3HN3A 3II3A 5E99L 3GUTB 4IX2A 1W9DM 5JLZB 3CDGB 3R0UA 2ZAIA 4PRHB 2MOQA 4Z7WA 2A3HA 2WOBA 2DEXX 3PLYA 2CUAA 3O9WA 3UFIA 1MAML 2VQ1A 2XN0A 2Z1SA 4G8GE 3PL6D 1KWKA 3NA9L 5D1XA 2YZ5A 1VPQA 4HIHA 7FABH 3FOMB 1GZJA 2WQDA 1E9LA 5FYLD 2VXTL 5LIUX 5L7XL 3EH2A 4DVRH 5G4NA 3QYSA 1T04B 1TA3A 1VACA 1H11A 1RJQA 4N2AA 1U3HD 3WJWA 4JZJA 1Z5YD 3MNWB 4DVOA 2MHAB 3VDGA 1V0KA 3U0PA 4PJGE 2YMXH 3QQ3B 3ARQA 1RUML 5FJIA 3MRHB 1WEJL 3ZE0F 2MQ0A 5FESA 3QFJA 5KG9A 1YJDC 3MMDA 3G1AA 1XMWA 4UFMA 4ABVA 3QG6A 1DJZA 4F7CB 1W5PA 2WJ7A 2EILB 3NCYS 1HH6A 1BVWA 4ADJA 5JDSB 3BN9C 2DQIH 4S1SH 5E9DA 5BW6A 3KBMA 3NRPA 3NRFA 3RO8A 1NIAA 1R3LA 1KBBA 1GUVA 3W07A 3UACA 3FFSA 2DI7A 2LABA 3KOWA 3MYOA 2IAND 4X7SL 1T66C 1IAIM 1QQDB 4WIQA 5A43C 2P0OA 4HDIA 1R7OA 2POTA 2BS9A 1WWCA 5EFDA 4C6FA 2NXIA 3IGUA 2PF8A 1REQB 3EOSA 4HHWA 1F4YH 4BD4A 1H60A 2X0UA 1UD8A 4DKFH 2C3XA 5AOUA 3QNXB 3NYZA 3G6AB 3SR7A 2CBOA 2QQKH 3LIZL 4MAYB 3T2OA 1PDKB 3UWWA 2GITB 1S7UA 1TQVA 2ITEA 3QIUA 5HVGB 1FF5A 2ZPKH 3BZEB 1E6OL 4LCCA 4NUQA 5LKNA 4A3RA 1OQXA 4FC3E 3GSWA 2WLJA 4K3HA 1ZSXA 4W9EC 5AUMA 1ND0A 3TNMB 3QK0A 4J2MA 2BVYA 5JXEA 4ZMWA 1JDFA 5DD0L 3VYOA 4IISA 1J2BA 1LO4H 2AV7B 4KKAD 5B7MA 5T33L 2J47A 3L3OC 4NNAA 1IIIA 3M8OL 3MRCA 1D5BA 4S1FA 3CC5B 3LMJH 4KHXL 1JWMB 2APVA 1E5ZA 1I9JH 4UTAH 1LO3L 2NYYD 1P4CA 3U4EB 2QGHA 2W07B 4E4UA 4PSRA 4P9HC 4P2QA 2O61A 4TLTA 1O95A 1U8IA 3HTWA 4G1KA 3T6ZA 1J8RA 4BHUI 3SO3B 4EI5A 1H8NA 1FNGA 1II4E 1HE7A 4O8AA 4G83A 3MX0A 4XCFL 4MY1A 1LMKA 4FX6M 5DC0A 1QRND 5BZWB 3SY6A 2PO6A 2XACC 2WUCL 4KRMB 4F7PB 3CV1A 4S2CA 5C0DB 2ZA1A 2P48B 2NXYC 5DSCB 4UNTA 3HOGA 4D8PB 3UGXA 1KN2H 5EO9B 1GGCL 1D5MA 1U8NB 4JY4A 2WLLB 3WMBA 3W6MA 4ORMA 3TF4A 1H1NA 4F7TA 1FE8H 1XF3A 1BJ1H 1E4IA 2J7GA 4I9JA 4K3DH 5HDQL 2A99A 3W2KA 5KSAA 4R34A 1XLLA 2B81A 1DYSA 2UX7A 1YPZE 3KXFE 4EN3B 2AKRA 4JIRA 2AJZB 1EEYB 5AC5A 4N2EA 3EH3B 4NC1C 5AHMA 3ESPA 2BVWA 3US9A 3NAAH 3WKMH 4E42B 2Y7QB 3JUGA 5C0CA 1CF8H 1JGEB 4MDPA 1VFFA 1GJIA 3CFBB 3WJMB 1OTUD 3OC5A 1P84J 4RH4A 1ZLSH 2YQBA 3ZKQD 4Z8FL 2ESVE 1XYLA 1EEXA 3QF0A 4R7VA 3B6SB 3QUMH 2ADGA 3TO2A 3ZE2F 2PCPA 1SHWA 1EJSC 6CGTA 3IJEA 1POKA 3VVVA 1E6PA 43C9B 1MFDH 5FAAA 4EXPX 3QEQE 4O4YH 3V4UH 1EAQA 2J1ZA 3MUGB 4FQLL 2OAAA 3JWNH 5FO8B 4U3SB 4Y9PA 3NPXA 1JK8A 1D9KB 3JWDC 2Q3OA 3W9EA 4UDUA 5M1TA 3HJ0A 4MIMA 2R83A 1CWYA 3G1SA 2X7WA 3F12B 2AMGA 5AWNL 5C2UB 1W1ZA 4OFPA 3U7VA 4N7QA 3HS0B 1BF5A 2O55A 4FP8H 4E5XA 3AQXA 4EACA 4NBZB 4L3EE 3VXTA 1GOIA 3WLMA 3S5YA 1I2PA 1NBZA 2IALB 3EG9A 4UTWA 4PMOA 1NFDA 5GJSL 3NIDB 2W0KA 4UBDD 3PP7A 1EHLH 2WLZA 4FFVC 4M1DL 1I2RA 4Y90A 2V9DA 1W5MA 4GYPA 4UT6L 2E9WA 5C92A 2PBGA 3QDGE 4NOBA 4HBCH 3F5WB 3MLTB 1IM3B 1PZCA 5IW1B 2HYMA 1Z3RA 2I07A 1RJCA 3D1MC 1OGPA 5KVGE 3E0LA 4BZ1H 4YFLF 2PWVA 2Y8UA 2OMWA 5FO7B 5K69A 1AMKA 4CJ0A 2F8QA 4UTHA 2Z29A 1LQ2A 3BPLB 5A94A 4AXWB 5I82A 3TN0D 2O92A 3PY9A 2VDHA 1RH9A 1NQKA 1FYTB 3R8QA 5EU7E 3LOTA 3QQ1A 1I1XA 5C0BE 2DPEA 1XX1A 3OKNA 3EJTA 2ATSA 2BX5A 2XRAL 3MNZA 4DQWA 5B8CB 4PB9H 1YYMH 1GSMA 5TF1L 1R1CA 3K71A 4QXGH 3KBSA 4TUOA 1QBLL 5I3IA 3Q3GB 5F9AC 3QBTB 3EF4A 3L54A 5F1VA 5FO9B 1C8QA 2PYFA 4A2DA 3RVXD 3FYIB 2CLOA 2X1PA 3AHZA 2XIJA 4FYRA 2O5YL 1XR8A 4K5LA 3HNVH 1J5IA 1M7UA 2FO1A 4OIFA 1UB5B 1MAJA 3AAMA 4C6LA 4P2RA 4YDIH 3T77A 2OMAA 5A2CA 1J8HE 1BYAA 4IFKA 3VILA 5ESVB 2WJFA 3NZUA 5A95A 4H2HA 3O3EB 2AXJA 3WI9A 1R9YA 1B3WA 1CK0L 3LDBB 4R85A 2YRZA 1JHTA 2IF7A 1J0ZA 5DQDL 3RUGA 3L8QA 3C60A 3VQLA 1M7DB 4XVSL 4HMEA 1I9RL 5AD0B 4HUWA 4M7JH 3NL3A 4LY4A 5ANHA 5LGKA 1UWIA 1URLA 3TJXA 1PLBA 5EA0H 3GVVA 5K9OA 1P0NA 4XHJD 2Q3ZA 2XA8H 4NM4H 5I8OH 1WQ5A 4JHBA 5JH2A 1KRCC 4IIQA 3T3PE 4AC2A 5D1ZD 3ZSTA 4L8DB 2C4FU 2ZVIA 3VXSB 1JE6A 1N82A 4QG9A 2O5ZH 3GKAA 1L3WA 1GGUA 1UXLA 3IN2A 1A5FL 4JDVA 4JO4H 3WCYA 4HUXB 2XWBA 4NJGA 4IHBA 4G6KL 3RVWD 4GRLC 4N6RB 2RJGA 4R3UA 3KTCA 3MV7B 2OOFA 1THCA 2Z92A 1EJ6A 3CEPA 3T08A 1Q66A 1QDSA 3YPIA 1OANA 2I7OA 2ZCGA 4U6HA 1I2QA 2CHWA 3CVDA 2V5MA 2UWEB 4X9GA 1JPIA 1KV8A 3ALPA 2I60L 3FTUA 2B4CH 5J5EA 5DO2C 3WY1A 1GYAA 1MEIA 4WXYA 2ONEA 1IGMH 2VQ4A 4AC7C 1U93B 1C5DB 3X12B 3WL9B 4NJIA 3PJUA 2AK1H 4P9HL 4EAMA 4JFFB 4QM1A 3HS9A 3WEZA 4QP0A 3OF6D 1R24B 4NKDB 3WUEA 2OLSA 2PF0A 4XC3H 4LKCA 4WD0A 1UXWA 2JMRA 1P7TA 1VLWA 1XPGA 3VOHA 2DYPA 3FXIC 1JZDC 2FUQA 1UWXH 4IP4A 4B50A 3C8NA 1ZPLA 3DKLA 3L3KA 4AK1A 3PDOB 5CD5D 8TIMA 1F02I 1U3YA 4FMKA 2P8LB 4Z7UA 4N8PA 5D8ZA 2ZZ2A 4M03A 2E0PA 2K70A 1BYNA 3QVQA 1WF5A 1KXVA 2X4QA 1EWDA 1D8CA 4XNBA 4AEHH 3SGEH 3AFLA 1N18A 3D07A 3LQZA 4QD2E 4RZCA 2VDOH 5I66B 1IEIA 4IXXA 3EXRA 1V03A 4FMFA 2WVUA 1T66D 3CWHA 4ZMVA 5D1QE 3MV9E 4JY5L 1NGPH 4RDYA 1U1UA 4WGVB 1FAIH 5E94A 1BXBA 4LOFA 3PWIA 1FC2D 5E03A 3A4DA 1VBJA 3IDIA 4J5VA 5FSEC 2BVPB 3EDFA 4GIOA 4Z7NF 2B7NA 3MRDB 3DN5A 5DFVC 3TR2A 1KIUB 4A3YA 2XV2A 3B03A 1EDYA 3EOBA 4PP1D 3COTA 4JO1H 3GR7A 4Q0XH 4HIQA 1RQBA 1WFJA 1XGPA 2C9SA 1ML1A 3DXAB 1MIEL 2YW4A 1PWLA 4C6IA 1FRGL 1I82A 3EDEA 3NTCH 4YO0A 2GCYB 5L4MA 5HULA 5I18L 2Y36L 4AMXA 1RPQA 2MPAH 4KY1H 5KS9B 3CDZA 2HT4C 1YEJH 5DGRA 2HWZL 3E38A 3LNIA 5HMDA 3LQAH 3LPFA 4M62H 1C9WA 4PHZA 1VENA 3VQ2C 1ET5A 1QLFB 2CPCA 4IIBA 4JRYE 4GXVL 4LVHC 5D2LA 3V0WH 1RK0B 5AVUB 3MV01 2VE6A 1DUYA 3QJQB 3DO7A 1F9CA 2TAAA 3IFNH 1FNEA 3CUIA 1JI1A 3I65A 4JG5A 2PYEE 3HG1E 5H2BA 3EOLA 4HKJA 2ZNWA 4GCXA 5JXQA 2PW2B 4FQIL 5FKPA 1LM1A 3WJZA 3A47A 1MQKL 3BQ5A 5MERA 1V7NH 2CRIA 3VRIA 4O0KA 1DO6A 1PO9A 5SX5K 3NWRA 4P7OA 4PMXA 2W9EL 4TTGA 1CQYA 1Z42A 4YBLC 3X3GL 1FHVA 4HSCX 1R0AH 1VF8A 1U91B 4LCYA 1KMGA 4PM1A 2EVJA 1HQ4A 4BZYA 1GKPA 1K9TA 4U05A 3FY1A 2J66A 1B88A 1Q72H 2FLMA 1VFOA 2JXMA 2DVUA 2W63A 2DMHA 1RJZA 2WMFA 3IIZA 4PWEA 4YZFF 5ILTL 2A4EA 4LCUB 3HJZA 1NOFA 1BZ7A 2DV6A 3BESR 2OZTA 5HBFA 4JO3L 3MXVH 4U1KA 1GZPA 2MH4A 2VJ8A 1HXKA 4BF5A 2GSGA 4DPCX 2EDYA 3QQ9D 3A0OA 1DE6A 1MJ8H 4H9TA 5GZNA 3TA3C 3HC0A 1HXYA 5DJYA 1VRSA 35C8H 3IEAA 1F3DH 3GMQA 1VB9A 2DZUA 3OR6B 1EZVX 1TWZA 3VPLA 5F7HA 2JB6B 5AC4A 1EYWA 4JE4B 5HPCA 2YD9A 1MCIA 4ELDA 4Z7WB 1NMBH 5BUAA 3O9WB 4PRPA 3VGHA 4FN0A 2I25N 3HU7A 3KLAA 2VQ1B 2VR7A 3C8KB 3D0LB 5C08D 1YEEL 1J93A 1X97A 4GH7B 3MLVH 5IVOA 5D1XB 4HZ8A 3VZXA 3DJSA 4LAUA 1HZHL 4HIHB 4ZGYA 3UA3A 1F3EA 3QCUL 4OLYH 5K9KA 3JZYA 3TBSA 1TA3B 3UAFA 1O9VA 4KV5F 5E6ID 4J12A 4JDBA 4JZJB 4MNQA 4OM0L 2WKOF 4G6ML 2EE2A 1E50A 3U0PB 3WG7B 1S9WA 1LO0H 1T7LA 3U9WA 1HKJA 5PCYA 2BOFX 5IXEA 2A5UA 3NQIA 3QFJB 5KG9B 3NDZA 2DJUA 4DPBX 5JMUA 3QG6B 1JV5A 1A7BA 3NM3A 1JNHA 4V1YA 5HPOA 4YWGH 3CHVA 3WFLA 1ZK9A 3MBEC 4MJHA 1T89A 1DTNA 2VR6A 2YD8A 5E9DB 1KM5A 4H13C 4N2DA 1RCYA 2R1LA 5I74C 4KTDL 2PETA 2EO7A 2G3ZA 4KROC 4YDKH 3APCA 4OZHF 4PH6A 4C7DA 1JF1A 3MUIA 3TIDA 3DV6B 5ALCH 4QT5A 4ZTYA 3TFBA 2BP8A 1T40A 2XDFA 4MWAE 4F8XA 3MCMA 3ZRCC 4O57A 3E9AA 4ODSL 3RWJA 1B54A 1KTBA 2G9KA 3M16A 3VE7A 3K13A 3SDAA 3O11A 2ITFA 5C07D 5JQ6H 1N8FA 4YHOL 3CH9A 2H4EA 4H83A 4A37A 1JRHI 4GO6B 1S7UB 3IPFA 1ZLVH 4FHJA 3QIUB 4X6DE 5E9NA 3KBWA 1FDLL 3MO7A 3LPOA 2VWSA 3LUTA 4B5UA 5T1DH 4Q56A 4KQ0A 3SO5A 1FQ9C 3RKPA 2F5BL 4FQCL 3TX4A 4QRPA 2AP2A 3GIVA 3DOIA 4QXUL 1WYJA 2WVVB 5IUCA 3MRCB 3RNKA 1D5BB 4GP8B 4XRCB 1K8XA 3WJJA 4NKIL 1BHGA 3TKFA 4ZX4A 1V7YA 3V0DA 3GIYA 3AT8A 4ZMGA 4ZR8A 1RUAL 3OD3A 3F64A 5DMLA 4P2QB 3UADA 4LSTL 2O61B 1UBPC 3R1GH 3BRDA 1U8IB 3NQEA 1HHJA 4TQIA 5CEXA 2E86A 4EI5B 1ADDA 3G6DL 2YCKX 1B4EA 1NLBL 4P2OC 4DJMA 3RX9A 1FNGB 5J04A 1UD3A 3MRIA 3MX0B 1IGTA 5I77A 1J18A 4GH3A 3WNIA 3ZYJA 2PZ0A 2X88A 4IOSD 2PO6B 4FZIA 1C8YA 1BXCA 2BASA 4RV8A 2BNRE 3RWEA 1DCLA 5AOKA 4NAMA 4HWNA 4Y1AD 3S8WA 5DLCA 3WTWA 1TG7A 3Q1SH 2Y24A 2X42A 1QPXA 5E2WH 2V8ZA 4JY4B 4WQ6A 4ZMAT 5A8NA 1BAGA 4NHCL 4F7TB 1XF3B 5E08H 1RUQH 3TYFA 4MXVE 4KI5C 3GXUB 2NSXA 3RHWK 4GLRI 5EB9A 4MY9A 2CBPA 4YBQC 4IJBA 1T5XA 4OZGF 1QNZL 2IPTL 1PKOA 2AKRB 3LOWA 1J79A 1RU9L 2Y07L 3H12A 4AKQA 1WZKA 5M17A 1GYWA 3ZL4L 4MBOA 4XN9A 1F6YA 4X5PA 2H3BA 1A7PH 1BXNA 4QPEA 4XK2A 2MCPL 3L65A 2BC4A 2YN3A 1J1OL 3I2CH 5AALA 1XO8A 2ADGB 3UTSE 2GIMA 3TO2B 2R1NA 3MBWA 2PCPB 3FSTA 4DYJA 4PMVA 4Y4KD 1E71M 4NQCB 3IJEB 3HPJA 3CDYA 2R7EA 2YAOA 4X2PA 2IOOA 2DSKA 2YCEA 3VIOA 3GXTA 2XFYA 4JTUA 4PLJC 4WTZG 1MFMA 5IHZA 1QPQA 5D7LA 5FOBA 4UAOB 1ZIBA 4G59C 2YKLL 3M1ZA 4WWPA 3MLXL 1OAQH 5CEZE 3WQGA 4UUIA 1WK0A 4NN5C 3IN0A 1HIZA 1LVEA 5D70H 5DMMA 2F54A 2WIMA 1OTSD 4N9BA 4N85A 3Q0HA 2VSMB 4K36A 3GBML 1IAOB 2WZ0A 4R7DA 1KD0A 4JN8A 5D6DA 3GKWL 4BYHA 4N86A 4PJ5A 2P5EE 3S3JA 4EANA 3FLUA 4HBQA 2H6OA 4WJ5A 3BH8A 3EG9B 2L7JA 1CWVA 3W1XA 4Z7OF 3RZWA 1HF6A 1OEZW 1NFDB 4XNXL 4AIZA 2YRPA 3U82B 5CN3A 1OOWA 4AEIH 1MWOA 1XD1A 5HI4C 1LUCA 5IBUB 3UZVB 2PTTA 3GKFA 2I07B 3U0WH 3QDJD 4LBRA 4DOHE 1WAUA 3ME0A 1IT0A 1SSGA 3ORJA 2OMWB 1HNYA 4P8UA 1VHPA 2VW4A 5HHOD 2OULB 3VOGA 2V0AA 4X9HA 1KW1A 1L9MA 4WO4A 4NQED 2KZWA 3OKNB 5GRVK 1CZ8L 3MNZB 3KLQA 5JA8B 4MNMA 3BFWA 5T3XD 1MCRA 3E9TA 5DUBB 2R91A 2IBZX 4AYBA 5BRZA 3C5ZA 1W8NA 3F7PC 1UZGA 4AJVA 3CSBA 1ZVSA 2PYFB 2QHLA 4YN5A 3WQDA 4FQJL 3GT6A 5LGYA 4AG4H 1XR8B 3QDAA 1D7KA 3WFEL 3OHMB 2ETWA 1IT9H 4P2RB 1DEDA 3BJSA 5AZ2H 1AW1A 3V55A 4IFKB 5DHDA 5E93A 1EJFA 3MRFA 2D7PA 2IANA 3IVSA 2CYGA 3K0YA 1E8XA 2O9TA 1C93A 5AVWB 4F27A 1T83A 1XW8A 3TFXA 3GZAA 4XNUL 3RUGB 1V02E 1BEUA 3F7KA 3AG4B 5GRZA 3S9IA 5KYNA 3ESNA 4HUWB 4LOVA 3W72A 1FI8C 1F8TH 4K9JA 1I7TA 4UTTC 4M61B 1RH8A 3AREA 4FEZA 1FFNA 5LNVA 4P61A 5K9OB 3SGUA 2P28B 1AYOA 1INEL 5KANG 4U1NA 4LL1A 5F6IC 3UABA 3PL6C 4IIQB 3TH4T 1WOAA 1LZOA 4PYHA 1XF2A 3QNYB 4RNFA 4EPBC 4DUOA 1QEWB 4I87A 1BQKA 4N0UE 3WFDL 4EAYA 3H42L 1FWJC 1OF0A 1XT5A 1H15B 3TA3D 2P50A 5D7IE 3VI4A 1PKQE 4JDVB 4M43H 3MACH 1REIA 4JFHD 4IRSB 4J2XA 5DCCA 4XBPB 4ML4A 2Z4QB 2XWBB 4PS4H 1U3HC 4LAQL 4EPDC 3CO4A 4IL0A 4P49A 2WNGA 4H9UA 1BMGA 1OQOA 3VC6A 4IMEA 2UBPC 3L1EA 2NDGA 4U6HB 2OV0A 2VXVL 3GXPA 4JL1A 4DAFA 4PJEA 4Q8PA 3Q7JA 4YHLL 5AKSA 1R3IH 1UVQB 3S2AA 1CG9A 1AZZC 1J5OH 4N8VA 4QRNA 4I85A 1NCBH 1ZS8A 2E7CA 5F4WA 5I06A 1TTGA 1HKIA 1C9DA 1F05A 1Z0MA 1MO0A 4XBGA 5IROD 5IQ9A 3UERA 4EPSA 3LRGA 3SGKC 2CLMA 1SXBA 1KCKA 3E2HC 4Y5XA 4IBQA 3HAEA 4LKCB 1EZ2A 1M01A 4O13A 4JFED 4LVBA 4KFNA 1UXWB 1PG7W 4NM8L 4Z7VA 5IWLA 1BAFL 3DVFA 1HO4A 4ACZA 3LPPA 2G9HB 3MV8A 2D2JA 2DYPB 1KT2A 4IHCA 1QRNA 2IWKA 3ITOA 3FB5A 3B83A 4QFUA 3L3KB 3ULVC 3K72A 3EUDA 3SSZA 4Y2LA 2PGRA 3P7YA 1GGIH 4RLIA 4K5NA 2GI7A 4YHYB 3KBJA 2ADIA 1HYRC 4Z7UB 4TO8A 4O51A 2Q2EB 2ENSA 1TJHH 2FEDC 2X4QB 3TJLA 3C56A 4DWSC 3KL3A 4PGEA 3MJYA 4KVNH 1Q5MA 3LI1A 1HHIB 4RZCB 1KPUB 4MQXD 4EVNB 3N44B 4Q8WA 3CZGA 4DNHA 1J5DA 4DN4L 3V5KA 1CICB 1G0YR 4M1GH 3FL7A 3NT0A 5E94B 2I69A 4K9EL 5F21B 4L9LC 3MJ9H 5L88H 4MYPA 2YJLA 3IDIB 3M0IA 5GRJL 1Q6EA 4KKAC 3EAKA 2IV9A 2HRPL 3OAWA 1NFKA 2H6PA 3P14A 1GVEA 4A2EA 2FBRA 1QP1A 2OLDA 3LIZA 1MPAH 3EOBB 2QUMA 2NYYC 4LS2A 1PCSA 3MLPA 2P7TA 3SE9H 1YEIL 1TPB1 1FHLA 4C6MA 5C0IA 4OD3H 2G96A 4OBTA 2QXWA 3BZFA 1I31A 5JIWA 1JCNA 1TJIL 4YO0B 1Z2KA 2Q7YA 3NZ1A 2Q86B 2PDXA 3N1QC 2VXQH 3DJRA 2A6KA 4PVNA 3CDZB 3CX5J 3GU1A 2WWKT 1BEYL 3SPVA 1F11A 1MIML 3SKUD 4KAQH 1O7DE 5G2WA 2X7LB 1NPNA 2YPVL 4ZQMA 4S2BA 5KANI 5GS0D 4M4RB 1LQAA 5D2LB 3OGRA 2VE6B 1DUYB 3PWLA 5CJQH 3UO1H 1ITQA 3DO7B 1PD1A 5HOSA 1FNEB 1FBIH 4KWUA 3ZO9A 5D5MA 5H2BB 1QFPA 4HKJB 4O12A 3ETTA 5EL1A 4I5RA 5FKPB 2J24A 1KGCD 2QMKA 5MERB 4OQTH 3VRIB 1YYLH 3LSOA 3LZOA 3S2NA 2DQ6A 4U3CA 3FUKA 1BVNT 4FI6A 4M8UA 2PP9A 3HB3B 4LCYB 3B43A 1QCWA 5DFWH 3E74A 5D7JD 4J3OF 1BBJB 5AYZA 3L5LA 3H2AA 1ACYH 2OXHA 3TN0A 2JXMB 2WMGA 4QEGA 1JTPA 1N8ZA 1RJZB 3S9ZA 2WJDA 4Q74A 3M7OA 3LTYA 1VPYA 5IHRA 4D6DA 1QNPA 4HGWA 4LLVA 1BZ7B 3KWWA 2CU0A 4U1KB 3IRPX 2QDHA 4BCXA 3L68A 4TX6A 4BA8A 3ARFA 3B0PA 1GZPB 2HV5A 2JCCF 3KS6A 5LBGA 4LYRA 1Z32X 1U22A 2GSGB 5J11B 5I24A 3TEZA 1PIGA 4PJAF 1CI5A 1AO7E 4HP5A 2Y70A 3LEPA 1HXYB 5DJYB 4X0KA 1E6NA 1GGBH 3HPXA 4F48A 2A9MH 3UZEA 1U92B 3ECBA 1CF1A 1UWEH 4K94C 3IV3A 1XAUA 2VZSA 4J3OD 1SOKA 3M5ZA 3H2FA 4I0PD 4PRPB 1M9SA 5C71A 3KCWA 3KLAB 5E00A 5F3HA 3OEXA 4OJFL 2O6EA 3A6CL 4K8HA 4KKRA 5EOQH 3W1AA 4UBDC 4OKVB 3AXXA 2Z28A 2CIKA 1IR2A 4WU5A 1W91A 4DWHA 3GRIA 5K9KB 4RW5A 1FORL 4PY8I 3RWHA 3TBSB 3TZVD 2E7FA 4UMAA 2PDPA 1HHGA 1XCFA 2D9QB 3PP4H 3CMOH 3BP6A 2XWCA 1OF2A 4U1LA 3W29A 4DCQB 3WNKA 1S9WB 4NWUH 3TJEH 3AFBA 5DQPA 1CR9H 4HHPA 3K6NA 2QCCA 5FYLL 3N40F 1USQA 4FYSA 2FJFA 1JV5B 2HFFA 4DJEC 1DJGA 3LZRA 3TVMD 1JNHB 2P9RA 5SWSD 3HLKA 4XZBA 3NQ7A 7ENLA 4DK3A 2CK0H 2XKUA 1FWBC 3WSQL 3TYUA 3AU1A 3GO1H 3GO2A 3TNNA 1YEFL 4IIGA 3LSCA 1J0KA 3USBA 1UGKA 5EORH 3C9NB 1W80A 2PTUA 3PS7A 3FW6A 1PX4A 2DWTA 3RVXC 2W79A 5A40E 3UT0A 1JF1B 3TIDB 1OCQA 4QT5B 3FO0H 3FU9A 4B4FA 4H8VA 2E9IA 3HC3L 2BP8B 1DBML 4IJRA 3B3IA 3EJZD 4JKLA 4WRHA 2HCVA 3BG9A 2PPAA 4DP0X 5MEQA 4QRAA 5LN8A 3RCMA 2V3DA 1RV6X 2F6KA 1A9EA 2Z31D 4AQ8C 3IU3A 2ORBL 1GVSA 1UWAA 5CNHA 3O11B 1M42A 4H20L 1KB5L 5F9JA 4MRCA 3WMSA 1HQTA 3S1UA 4A7SA 1M65A 2AQ3A 1KC5H 3H26A 5IBLD 1OGTB 4GIEA 3BKYH 4GINA 1N26A 3WTXA 2CHRA 3W1NA 1GPWA 3OJMB 1O68A 3ZRFC 3BRGC 3FUFA 2ZUWA 2ISVA 2APWA 5F1IA 2QJHA 5D1ZC 1BWKA 2R9RA 2EYSB 1YAIA 4QRPB 3AZTA 4Q22A 4DP6X 1SFJA 3GIVB 4JDYA 2H8XA 4X4ME 2DMCA 3TA6A 4JTHA 1DXEA 3RNKB 1IKNC 1NCJA 5ISZE 2NZLA 2O0TA 3RVWC 1MFBH 1QRKA 2WLKA 1E1FA 4H4IA 1FPTL 4GNJA 1GXEA 1SR0A 3GRWA 1OAXL 3W7KA 4I3RL 2FUTA 1HHJB 3VNYA 5JNYB 3V6BR 2NY7H 1TUPA 2QT3A 1IVLA 4HHGA 4JDTH 2ICWJ 4YSSA 4GO8A 2J8UE 1EAPA 3QJSB 2IV8A 3K5RA 2IBBA 1IGTB 3O6KL 2EADA 4BK5C 3TAOA 3VB9A 1KTDA 2YK1L 2HVNA 3UBXA 4N2YA 1AOHA 5E6UB 2F19H 4UTFA 5I3JA 4XCCH 3EJUA 3RWEB 2WQ8A 3QZWB 3ULVF