5HDRA

Crystal structure of a bacterial fucosidase with iminocyclitol (2s,3s,4r,5s)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
445
structure length
440
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-L-fucosidase
publication title Crystal structure of a bacterial fucosidase with iminocyclitol (2S,3S,4R,5S)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 158
structure length 440
sequence length 445
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5hdrA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5hdrA01
4U33A 2GDUA 2XWEA 3G6MA 4IPLA 2UY5A 3DX3A 2YFOA 2E8ZA 4AIOA 1HX0A 2XJ7A 2CBVA 1QW8A 1UOKA 3FHAA 2WHMA 1GPFA 1W9VA 3ARTA 1WB0A 2XM2A 2FH6A 1QI3A 2B31A 2NW0A 2EADA 1AQHA 2W62A 1UZ1A 2WZEA 9CGTA 1MW3A 3NUKA 1UKPA 2F1AA 4W88A 3WDIA 2J7BA 2WBKA 1A3HA 2VQUA 4OZOA 1QNOA 2G8ZA 4PMDA 1W9PA 3MI6A 3VIPA 7TAAA 4GZIA 3THDA 4HMEA 4BQ2A 3U7BA 3PZVA 2QMKA 1SMAA 3LPOA 1OD8A 3TTOA 1JXJA 3WEMA 3WDJA 2PWFA 2X2JA 1GW1A 7A3HA 3VNZA 4UQAA 3VD5A 4D6HA 4AZ6A 1JZ2A 7CGTA 1H1NA 2J25A 4YHEA 2QMJA 2ZXBA 2DEPA 1ZBCA 1PZ2A 3WQWA 2J8FA 3AXHA 2QF8A 1GORA 3CZ8A 4Z2GA 3WD2A 1O7AA 1VFUA 2PWEA 3UEQA 4FNTA 3VX0A 4H8VA 4HMDA 1WDPA 1KQZA 2D73A 1CXIA 3PTKA 3MUIA 3HJEA 2EPNA 1G5AA 3A5VA 3IGUA 3GNRA 2JIEA 1GQKA 5IXEA 3ARQA 4F9DA 2ZX5A 1BYBA 1XSIA 2DT1A 1E43A 3OIHA 1TQSA 3QHMA 3K4AA 4YPJA 2F7OA 5CLTA 3AS0A 3UG4A 1RPKA 1B30A 2ZX6A 3AISA 3AROA 5I3DA 1HWWA 1WZLA 1KCLA 3HG3A 3WNNA 3OLGA 3MUY1 3SIMA 3GDBA 1QHOA 4D1IA 2YDSA 2J77A 4TUFA 1IT0A 1QWUA 1E0WA 1GHRA 3A47A 3WF2A 4UR9A 3RM8A 2BVYA 1HL8A 2C7FA 3EMQA 3CLWA 2D0HA 4ZE4A 2EABA 4KRUA 4CD5A 1GUVA 2WVSA 1BG4A 3BH4A 5A6AA 3AHYA 5KZ6A 3A3HA 3AYRA 4CU8A 1E6NA 2WMIA 3CHCA 3CIVA 5A6SA 2VUYA 4WKAA 5M3WA 2G3IA 2XG9A 4PMZA 3WBAA 2WHJA 2BXYA 2PWHA 3WH6A 4J3WA 1UZ4A 1PX3A 2UY2A 1QW9A 1V0LA 4GPNA 1GOIA 3S5YA 1V02E 1LG1A 5E6YA 2E3ZA 1KTBA 1CWYA 1OBAA 4ACZA 1AQ0A 3AIUA 3O2LA 2BFGA 3U7VA 1WO2A 1XC6A 3DX1A 2WZHA 1V3HA 4HPHA 5HPCA 1FH9A 1SR0A 3OZPA 1GVIA 3GXTA 1V0KA 3WQ5A 3A22A 4MDOA 5D9OA 4E8DA 1TA3A 1V3MA 3M46A 1LWJA 4TX8A 1QI5A 2FE0A 3GTNA 2BY1A 2EBNA 4UFIA 1NWSA 4X0NA 3RM4A 1LL4A 2E40A 2BHZA 3BXWA 1X1NA 1GOKA 1XCWA 1UQYA 3O6AA 4UQCA 3IJ7A 4Z2LA 4J3XA 1TE1A 1GOOA 2YJQA 3N13A 2PC8A 4JIEA 2D23A 3B9AA 2WBGA 2WSKA 4B9ZA 4HU8A 3WY1A 1V3JA 1V02A 4H7VA 2WWCA 3BCDA 1J0YA 1W1VA 2VX4A 3ZM8A 1MYRA 1R33A 4BA0A 1WDSA 3VINA 3ARPA 3ZSTA 1ZB5A 4Y7EA 1HXKA 1NH6A 1QWNA 5LA0A 3NSMA 4JHOA 1EA9C 3SCQA 1E4NA 5EFDA 1D7FA 1FP8A 3GNPA 3RJXA 3D50A 5GQBA 4QP0A 3VDHA 3VUPA 4W5UA 3RMEA 4ACYA 2CETA 3K1DA 3A24A 5I6SA 5GNXA 1XSKA 2G3JA 4HZ7A 1JGIA 1E3XA 1R46A 5JBEA 4QLLA 5LA2A 2CIPA 5D4YA 2WMFA 2YLAA 3BAYA 3OA5A 4MADA 5JIWA 4LYPA 3CUGA 3AFBA 3SCTA 4A3YA 3H53A 4AMCA 1CIUA 1FFQA 4AZHA 3BVUA 2Z1KA 3AMDA 3HG2A 2WSPA 3SCVA 1O7DC 2VQTA 1E4MM 4PTWA 3RCNA 4AZCA 1XHGA 1D3CA 4Z2JA 1CGYA 2F1BA 2A3HA 4L4PA 1MFUA 1XCXA 2DT0A 1V3IA 5DF0A 2Z1SA 4J27A 3NDYA 4ATLA 3AZRA 1MQPA 4P7LA 4AISA 5E0FA 5HPOA 3EJRA 3MANA 1O6IA 5LYRA 3WL0A 2W63A 1HKMA 4P7RA 3VGEA 4FNQA 1EOKA 3VVGA 1J01A 1GONA 5IFPA 2ZUVA 4JFUA 2ZUUA 3T08A 4MB5A 2WANA 4AZ5A 4PCSA 2CEQA 2XSBA 1TG7A 3BVVA 4PMVA 4GXPA 1KBBA 3SCUA 1EOMA 3FNDA 3ZQ9A 1PS3A 4U2ZA 2BS9A 1E0VA 5CPQA 3L4YA 5FIPA 2ZUSA 1HJSA 1NWUA 1C8XA 4CCEA 3W37A 2CHNA 5EBAA 2OW7A 5I23A 3KL5A 1J18A 2J4GA 3SCRA 4AEEA 4W7VA 4AD0A 4UFMA 1JXKA 3PZNA 4UOZA 5C71A 2WVVB 3N9KA 3DX4A 4FLQA 1UWTA 3GXMA 2F8QA 4CN1A 4W8LA 1ZL1A 3ZJ7A 1VB9A 4P8VA 2EPMX 3DX0A 4XZBA 1G1YA 4C7DA 3KL3A 3NSNA 4NRSA 3D4YA 4YN5A 3SUVA 1QHZA 4H2CA 4QCFA 1B0IA 4D6JA 3DECA 2FDMA 2C0HA 1VIWA 3LXAA 3RILA 4PMOA 1CEOA 3PZTA 1H0GA 3W4RA 4V28A 3FAWA 1XSJA 3VO0A 2CNCA 1VRXA 3PZUA 3WEZA 4QLJA 4UFLA 3ZIZA 5D9PA 3N15A 4F8XA 5JUVA 5I24A 1DWAM 2GUYA 1FHDA 4U3CA 1C8QA 2AOSA 3OGRA 3WEOA 2XIIA 3G6LA 1VEOA 5I2UA 4P7OA 5DFAA 1HP5A 5A8MA 3SCSA 2YA2A 3I3EA 1W9UA 2CKRA 5AC5A 5ECUA 4M56A 1W2PA 1Q6GA 4WSJA 1CZ1A 4U31A 1QNPA 2PWGA 4OBSA 3VKKA 3S2CA 1EGZA 4MAVA 4UOJA 1KWKA 1KWGA 2XUCA 3ZSSA 2JFEX 5AC4A 3CZSA 4CD6A 2WWDA 3AHXA 1QI2A 3ARRA 4E8CA 1JYXA 3WH7A 2VOTA 4HA1A 3VGDA 3MSGA 2VCAA 2JEQA 3QR3A 1B3YA 2XFRA 3TTSA 1PPIA 1MW2A 1QI4A 2WK2A 4MNJA 1I75A 3SEPA 5CSUA 4HZ6A 3PTMA 1NOWA 1JNDA 2Y2WA 2TAAA 3EJUA 1KR1A 2VNCA 2PF0A 1JAEA 3GXNA 3EMZA 1JFXA 3MU7A 5ABHA 4NI3A 1VEPA 1R7OA 3DDGA 1KFWA 1HJQA 4N0RA 1F4HA 4PMYA 3W53A 4K68A 1ISXA 1BYAA 4OOZA 1I1WA 4DM2A 2V38A 2DDXA 1U33A 4F9JA 4ML4A 2XTKA 1LQ0A 3D5HA 2WZIA 1KB3A 4CVWA 1RD6A 3WIJA 4OKDA 2C8NA 1B1YA 2XFFA 4JKMA 3VD9A 3AS1A 3CUJA 1BAGA 8CGTA 4CD7A 2V5DA 3VMNA 4W86A 3VMPA 2CYGA 4ZFMA 2E8YA 2VI0A 4UZSA 1WE5A 1HKIA 2F7RA 1EHNA 2PI6A 3OBAA 4DWSA 1EH9A 1E9LA 2DSVA 1H5VA 2VL4A 5IFTA 3WENA 3WH5A 4W5ZA 3WMBA 5A95A 2OYKA 4FNUA 4P8WA 1PJ9A 1L0PA 1E1EA 4WIWA 5BXSA 1A47A 1SZNA 4P8XA 3FY1A 1NP0A 1TQVA 4EE9A 1V03A 2DIEA 2WMGA 1FA2A 4TVUA 2WM0A 4HOWA 5FL1A 1VFMA 3NSXA 5D9NA 2Y4SA 4PN2A 2BY2A 2FGLA 3BUQA 1J12A 3E1F1 1GOQA 4AD5A 2WC4A 1JYWA 3OZOA 4H8HA 4W7UA 4DUWA 4RE2A 4PMUA 4CU6A 4M1RA 2A3BA 2BHUA 1CXKA 3OLEA 3W26A 3QHNA 3CZEA 3WF4A 1BF2A 4X9YA 1M7XA 3AS3A 2VZTA 1NWTA 1W3KA 4ZEPA 1H09A 1GJUA 2OWWA 5I78A 3VGBA 4BF7A 3WUBA 4CGTA 1UKTA 1V6VA 4EANA 1DEDA 2VX7A 2ZUNA 4MNLA 1VFFA 1OIMA 3L4TA 4IM4A 4D6GA 3T0BA 3F5JA 1EDGA 2OYMA 3VD7A 3BSHA 1ECEA 2A3AA 3FW6A 1B90A 2YKKA 2WKLA 1V3LA 3GBDA 4MB4A 4PSPA 4GZJA 2ZXAA 1HVQA 3WQ8A 3M07A 2IGTA 3B8SA 5GPRA 3CUIA 1B3ZA 4AZGA 1S46A 2OW6A 3F5LA 1XH0A 1OIFA 1W32A 3IK2A 1HVXA 1R75A 1H2JA 1V6XA 2W92A 3ECQA 2XN0A 3BAIA 4UQDA 3VOCA 5HBFA 1UR9A 2QHAA 3BSGA 1XGZA 1MWOA 3TA9A 3VSTA 4PSRA 4BQ5A 5A2CA 3ZR5A 1CXEA 3D51A 4FLSA 1E56A 4AZIA 4E2OA 2YDQA 1JZ4A 3FN9A 4LXFA 5M17A 3EMCA 2BVDA 4EKJA 4HP5A 3EDFA 1H49A 1E0XA 3MUZ1 1CLVA 3JUGA 5BRQA 1Q6CA 2VC9A 2NT1A 2BY0A 4C7GA 1EO7A 2ZE0A 4CCCA 2F2HA 3HZ3A 3OG2A 3OLDA 3W27A 1AQMA 1LWHA 3EJQA 4WLCA 1OGBA 2D0GA 4GO9A 1EQCA 2ZOXA 4B3LA 3AQUA 3SUSA 3TV8A 3CZJA 1R34A 3IANA 2ESCA 1J0ZA 5I79A 2X2HA 2QPSA 2WHLA 2XGBA 4DWSC 1PIFA 3T2PA 3W81A 3WY3A 3MO4A 1UD6A 3AOFA 5EFFA 1WPCA 5C70A 1TVNA 2WPGA 1E73M 1KXHA 2EPOA 1HN1A 1K9EA 3MS8A 3AHTA 3VMOA 2WVUA 1HJXA 4FMVA 1IV8A 3W38A 5LA1A 2W4XA 4KH2A 3RM9A 2BNJA 2GK1B 1J0IA 4AD4A 1K9DA 4TVCA 4BQ3A 2XWDA 1P6WA 4P7NA 1XRVA 3PZGA 4H8UA 1WKYA 2QPUA 2Y5EA 1DWHM 3L4VA 4QCEA 5A6BA 4JFTA 1E15A 1UWIA 2G3MA 3CGTA 3BAWA 2WVVA 4DWSD 5A6MA 3HN3A 3T2OA 1QBAA 1UH4A 1G0CA 1PX4A 5CXPA 4UTFA 2ZX9A 2DQXA 2D22A 1RP9A 4XZWA 4OOUA 2YA1A 1U30A 5E70A 3WD1A 3DX2A 1ZJBA 4D6FA 1R86A 2CKSA 4AMWA 4LYRA 1CDGA 3VIHA 4IISA 3PN8A 4J3VA 3UETA 1MW1A 1FOBA 2GVYA 3VGFA 1E6XM 1OSEA 2ZIDA 3LXCA 1C90A 3AMCA 5E9AA 1W3LA 1CNVA 4HA3A 2ZX8A 4HA4A 4BQ4A 1GJWA 2OSYA 1BGAA 4TX6A 2JF7A 2Y24A 3EDDA 1MVYA 3OGVA 3PZ9A 4PRWA 3UERA 2XVPA 3W24A 3A21A 4KGJA 4ZENA 3SURA 2GJRA 2F7QA 2ZUMA 3WSUA 5GNZA 3VSVA 2BVTA 4A3HA 4AD2A 4WF7A 4DO5A 4AWEA 1PZ3A 4JL2A 1OT2A 5CPSA 1W1YA 2BV9A 3CTTA 1JZ8A 1X6NA 2DPEA 5BXRA 3CV5A 1ZJAA 5EMYA 3ZR6A 4CCDA 1CTNA 4FNRA 1PEZA 4B16A 1J10A 5A2AA 3BGAA 3ZJKA 2BY3A 3F5KA 1ZS2A 4HU0A 1NARA 4QLKA 5HOSA 2CESA 1CECA 3CZNA 4NRRA 3SCWA 3KL0A 4DO6A 1JD7A 1MQRA 1V6UA 3VM7A 4TXEA 3WNOA 2WCGA 1JL8A 3SCOA 3S5ZA 1B2YA 2VRKA 2VJXA 3W29A 2XN1A 4Z2HA 2VVSA 4JFVA 1Y7VA 1LJYA 4MDPA 1JYNA 1E5NA 2XYLA 4GI6A 4CUCA 4AEFA 2ZXDA 1QNSA 2VZOA 1JZ3A 3ALFA 3AXIA 4Q7NA 3EYPA 1BG9A 3OLIA 4PTMA 1JFHA 4IUGA 4JL1A 4U2YA 1KGUA 2HISA 2WHKA 3DYMA 2Q8XA 1SYTA 2BHYA 4UQ9A 3MV01 2XGIA 3IJ8A 1UKQA 1UKOA 2WLZA 1JZ6A 4ZE5A 4FLRA 3K46A 2X2IA 1W9XA 1NOFA 1NM9A 4PMNA 3W25A 1XH2A 4MB1A 1Q4NX 2W67A 5E09A 4XUYA 3KE0A 3AZSA 1QI0A 4YHGA 1RP8A 3MMDA 3N1AA 4LPCA 3MUAA 1LF1A 5D8ZA 3SCPA 1W91A 1UD8A 3AS2A 2YA0A 3BC9A 1UWRA 1ITCA 4LQ1A 3T0AA 2V3FA 1LLOA 1DWIM 4KGLA 4A4AA 5CSYA 1XD1A 5ABGA 1W1TA 5ABFB 3QHOA 3ZJ8A 3CUHA 1H4PA 1M53A 3DYPA 4MJ2A 3WH9A 4HMCA 2WC3A 2WVTA 1R87A 2X0YA 5AYIA 4S3JA 3UESA 3GZAA 3EJPA 3ARYA 3U5YA 3WNPA 3KEHA 3GBEA 3WMCA 1UHVA 4UFKA 3VIFA 3RJYA 3NIYA 3BVWA 1V6WA 2WCAA 3BUPA 3LMYA 1UD3A 3T09A 1ZBKA 2VZUA 1K9TA 4UQEA 3EJTA 2VRQA 2D1ZA 2HVMA 3EBVA 3WUFA 1TFVA 3WNKA 1HIZA 1CGXA 5EB8A 1DWFM 1Q6FA 1CBGA 1JYVA 4TVDA 1QNQA 1HJWA 1MXDA 1VF8A 1OT1A 3POHA 3RPMA 2WYSA 1E71M 1PX8A 3WUEA 1TVPA 4UOQA 1LL7A 3L4XA 1M01A 3MSDA 3BMVA 2VTFA 2VURA 2J47A 3K8LA 1UH3A 5FCZA 1AVAA 1WAWA 3LPGA 1QHPA 2QV4A 3AXXA 5A2BA 3HG5A 2MANA 1NOUA 3NDZA 3BAJA 5A8QA 3SUWA 3WL1A 3N04A 1WDRA 4AXNA 2EPLX 3AIEA 3WFLA 3A6OA 5D9MA 1ISYA 2V3EA 1NQ6A 2DT2A 4LYQA 1ITXA 3OGSA 1KXVA 2AAAA 4OJYA 2Y8KA 4JKLA 2X2YA 4IPNB 2EO7A 2VX6A 3ALGA 4D6EA 4UFJA 1HJUA 1D2KA 1H11A 1ODZA 4JFSA 4PMQA 1IZJA 1L8NA 3AIQA 4W85A 2DSZA 1CGTA 4AIUA 3BAXA 2FYVA 1CGUA 1FHLA 1TQWA 3FXYA 4AD3A 3LXBA 4V2XA 1CENA 2ALWA 4NF7A 5A3HA 1PIGA 2WKGA 1JIBA 3CHEA 3WKZA 1E4IA 1C8YA 4JHZA 3VD3A 1TQTA 4BZYA 1UA7A 1UR1A 4JCLA 2WMJA 2CCRA 1ISZA 3MMWA 3VNYA 2CBUA 3TTYA 4W87A 5CJ5A 4NSBA 4NXKA 3IAQA 2IUZA 2IXVA 4PMRA 3WQ6A 2VX5A 1HKJA 2EXOA 4DO4A 4AYSA 2GK1A 1OINA 4J28A 3WDPP 4U5IA 3RDKA 2DSKA 1CYGA 1E6SM 2W5FA 2YL9A 4KRTA 4CU7A 1JI2A 4ATWA 4MAZA 3WN6A 3A23A 2ZUTA 4D1JA 4PYSA 1HXJA 3GXIA 1UH2A 1U2YA 1FH7A 2JEPA 5A8NA 1K6AA 3MV11 3W28A 3ZOAA 3U57A 1UWQA 5M03A 2OLHA 1JDDA 1MW0A 3VSUA 2VMFA 5DEZA 4TTGA 1GQIA 1HTYA 1WP6A 4U5KA 4DM1A 5BYWA 3VIIA 3WY2A 2O9PA 4JKKA 4FNPA 1E6PA 2XVNA 2BXZA 3L4WA 1M03A 3ZMRA 3A4WA 1KXQA 3THCA 1JAKA 1J0HA 2D2OA 1H0IA 2W61A 1J0JA 1HL9A 2ZICA 1J11A 6A3HA 3NYDA 3KLLA 1UUQA 3A4XA 3WD4A 5A6JA 1WNOA 4TTUA 1XYZA 3F4VA 4D6CA 3M7SA 4FLOA 4H04A 1H3GA 4JCMA 3GXPA 1IZKA 3BVXA 1E4LA 1BLIA 1Z32X 1B3WA 1R85A 3DYOA 1EDTA 1FH8A 2O9RA 1CLXA 4AD1A 3VU2A 2DH2A 5BRPA 4H41A 3K8MA 5I0DA 3VX1A 5E0CA 2FHBA 2WMKA 1W3HA 3O9NA 2JIWA 3GXFA 2W91A 1EIBA 1LL6A 3W0KA 4MNMA 2J7CA 1JF5A 1KGXA 3L2LA 3K4DA 5HDRA 4AIEA 2DSUA 3ARXA 3BMWA 3CZGA 5E6ZA 1E70M 1E1FA 4E4PA 2DGAA 2XVLA 2VCCA 3AIVA 3CUFA 3KWXA 1FFRA 1NWRA 1OCQA 2X0HA 1CXHA 4J3SA 4D6DA 2A3EA 1TR1A 5C8BB 3PBGA 5CPTA 1BFNA 1VJSA 1GQLA 3PHAA 5GNYA 4M24A 1UR0A 3LRKA 1QBBA 4M29A 2WC7A 1CGWA 1JDAA 1MQQA 4GI8A 2VRJA 3GH4A 4CD8A 3UG5A 4DUXA 3I3DA 5FD0A 2DH3A 1GCYA 1ISWA 2XPKA 3WF3A 2OWXA 3N12A 3W6LA 1JNEA 5BXPA 3BUIA 4PBGA 4RE3A 2OSWA 3SUUA 2E9BA 2VR5A 1VJZA 2JF6A 3WDRA 2D3NA 1KR0A 4HOZA 5DT7A 1UR4A 2CITA 3AIRA 1G94A 3LX9A 2QLYA 3CHFA 3MMUA 3CZLA 2ZXQA 1HKKA 2WW5A 3T0DA 3WNLA 4CVUA 5ABFA 2J7HA 2UWFA 4LGXA 2FGZA 4J3UA 1EXPA 3WBEA 3CBWA 5FL0A 4NXSA 1BGGA 2JALA 4B3KA 4D72A 3WELA 2GJXB 1B3XA 2YBUA 1B31A 1US2A 4WK9A 1E6RA 1CXFA 1UD5A 3AZTA 1UQZA 2WLYA 2PBOA 3FHQA 4BS0A 1BPLB 3I3BA 3VILA 2X05A 5A1AA 3AICA 1ESWA 1UR2A 4M80A 3TP4A 3NJ3A 1JZ7A 1BVZA 2XVGA 2YL6A 2E0PA 3WY4A 1ZU8A 4NZCA 5JIPA 1E5JA 2YL5A 4J3TA 2CXGA 2O92A 1OGSA 3AMGA 3QOKA 4OGZA 2GSJA 4V27A 3AIWA 3PZIA 1HNYA 5DMYA 3AJ7A 1JI1A 1UYQA 1WZAA 1BQCA 1NP2A 1E6QM 1BHGA 1V0NA 3U5UA 1W3JA 4R5EA 4UQBA 4QFUA 4OUEA 4NZFA 5JBFA 3OB8A 4U3AA 1V0MA 5CZKA 3N17A 3II1A 3B9DA 3WMSA 3GH7A 5IHRA 2WNWA 1JZ5A 1EQPA 2XIBA 4LX4A 4W8BA 5ABEA 1SFSA 1V3KA 2J62A 1AMYA 1KBKA 4D6IA 4DWSB 4KMQA 3UG3A 4UFHA 1GOMA 2EJ1A 2VZSA 3A4AA 4JZ5A 3BVTA 5TD4A 3ZT6A 2WAGA 4FF5A 2F18A 2X09A 1US3A 3WUGA 3GM8A 3CZKA 3RIKA 2XSAA 1WZMA 2AMGA 1DP0A 3WD0A 5DT5A 1E3ZA 2EAEA 2XN2A 3APGA 1VBRA 2GJPA 2D24A 1B3VA 4TOQA 1JDCA 2Y8VA 3W82A 1V6YA 2VZVA 3HU7A 4CN4A 2F7PA 2X1IA 4M8UA 3K8KA 4FK9A 1QPKA 4M81A 1DWJM 5JBDA 2E9LA 3CMGA 4PEEA 1DTUA 3WQ4A 3UR7A 1YHTA 1EO5A 2VT0A 2E4TA 4BCEA 5CGMA 2XFYA 1UD4A 4B15A 1B9ZA 4NX0A 3BLKA 1E55A 1W1PA 3M6DA 4ATDA 2PB1A 3WQVA 5A6KA 4MNKA 5AY7A 5BROA 4Z2KA 2J78A 4ZXOA 4CD4A 1GQJA 2PWDA 3VGGA 1XYFA 3VD4A 1UD2A 4W84A 3S6TA 4X0VA 3LRMA 3BAKA 1WCGA 3VGHA 3ZT5A 5CLWA 3DHUA 1QVBA 3LRLA 2J7DA 4W93A 2YBTA 1OM0A 3VM5A 5KEZA 1E72M 3EJSA 2O9OA 4Z2IA 3GNOA 4GINA 1C7SA 1H41A 3CH9A 1R8LA 2YDRA 2J79A 1R47A 3IJ9A 1OD0A 2OWCA 1KXTA 2O9TA 1BYCA 3AYSA 3D3AA 3D4ZA 4J7RA 4AYGA 3IAPA 1ZBWA 5BCAA 5E1QA 2V3GA 1XV8A 3CMJA 1UWSA 4JFWA 4FNSA 1R7AA 2WMHA 4MTVA 1GNXA 5A8OA 3LPPA 4F66A 3H55A 1E40A 1KCKA 2V3DA 1RH9A 3TOPA 1OB0A 1LG2A 1UR8A 4WJXA 1WDQA 2WCSA 3EDEA 5BWFA 3WH8A 2CBIA 1C7TA 2ZX7A 4WKFA 3AMLA 2D20A 2CERA 4QDMA 1OWQA 3KZSA 1X6LA 1UWUA 1PAMA 2G3NA 3BUBA 2FHFA 3WD3A 3WDHA 2PBGA 3WDQA 3ZO9A 4PTVA 6CGTA 1F4AA 4PUEA 2DIJA 4MB3A 3ARSA 4ZXLA 1QOXA 2EPKX 4XX6A 1TZ7A 5I5RA 1J9YA 4GZEA 4GKLA 4P8UA 2VCBA 5A94A 4PTXA 3B9EA 4P7QA 4D71A 3DC0A 1TUXA 3ARUA 1W2VA 5A6BD 3PZOA 2V5CA 4L4OA 3N18A 1G01A 1C93A 2D0FA 1GVYA 3VPLA 3VIOA 1UG6A 1JD9A 2FH8A 4OBRA 3FAXA 4GO8A 2ZWZA 2WMIB 3EDKA 3CO4A 3NCOA 2VR4A 4HOXA 3L4UA 4DUVA 5A69A 3VDBA 2CHOA 1JG9A 2ZUWA 4R27A 1KGWA 4B9YA 3ARWA 1QX1A 3L4ZA 2E9MA 1UA3A 1BVNP 1GHSA 2A3CA 3ARZA 3DDFA 1YQ2A 2VO5A 4ACZB 4KWUA 3N11A 4UCFA 4HZ8A 5A8PA 2D3LA 3AHVA 2GDVA 5D8WA 3GXDA 4EAMA 3RO8A 5F7UA 5I77A 2CBJA 1PBGA 4URIA 4UZUA 1W9DM 3AHZA 2NT0A 4AMXA 3QGVA 3UR8A 3MKKA 3TONA 1C92A 1CPUA 5FOOA 2G4FA 3GYCA 3J7HA 1JF6A 5CQ1A 4AZ7A 3AMKA 1TA3B 2XHYA 1HP4A 3AI0A 1V08A 1OGGA 1FP9A 1ODUA 3TTQA 3VIJA 1N82A 2IXUA 2FHCA 4WSKA 1HJVA 1HT6A 4PCTA 3VDAA 3PZQA 5CG0A 4OIFA 4S3KA 3T2QA 4AW7A 1VBUA 1ISVA 4RE4A 5IHSA 4CKQA 3KLKA 4MJ4A 4F79A 4M82A 2J8GA 4PMXA 5DO8A 1GZJA 4W8AA 1EDQA 2XM1A 4Q22A 1BYDA 2GJXA 2J7GA 2ZWYA 3CHDA 2JE8A 2EACA 3VTRA 4GQQA 1Q6DA 5IDIA 3VIMA 3EDJA 2DSWA 1QNRA 3ZT7A 1DHKA 3GH5A 1SMDA 5HXMA 4XV0A 3PTQA 5A6LA 2YIHA 3WF1A 2OYLA 2NSXA 4MPKA 1VFOA 2J7EA 2XVKA 2J75A 1XD0A 2W66A 2RGLA 4W89A 5CGTA 3QOMA 3BLPX 1E6ZA 3VIGA 1CGVA 2F61A 3D52A 1ZBVA 1VENA 3L2MA 2YLLA 1TQUA 4XB3A 1UASA 5HNNA 3BLBA 1MFVA 1HF6A 4GQRA 2GFTA 2G41A 4AY1A 1BSIA 5AYBA 2EQDA 4QAWA 1TCMA 3CPUA 3HMCA 1C3FA 3DHPA 1W9BM 1Q6EA 2CPUA 4WKHA 4C7FA 2EEXA 3CC1A 3BCFA 1G9HA 2YL8A 2WB5A 4GI9A 1KQYA 1UKSA 1GOWA 4CN6A 1BTCA 1T0OA 2OSXA 4GIAA 5BXTA 2YOCA 1KTCA 2YFNA 3HG4A 4AC1X 6TAAA 1WZKA 4RL3A 4AZCB 8A3HA 1EHAA 5FKYA 3SUTA 3BUDA 4AZBA 1CXLA 3SCNA 1I1XA 4N42A 3VDCA 3AIBA 4W7WA 4UNIA 3POCA 3ZJ6A 4EK7A 1J0KA 1DWGM 3WNMA 2UY3A 4JAWA 3VIKA 1VAHA 3UCQA 3LPFA 4NZJA 2UY4A 1M04A 1XH1A 2DT3A 4HTYA 1TMQA 2WXDM 2J74A 1VEMA 2RGMA 1K9FA 2VVNA 4HPGA 1C91A 1MXGA 3H54A 3PZMA 5M5DA 2J7FA 3WFZA 3W6MA 3WF0A 2X8RA 3ARVA 4PUDA
chains in the Genus database with same CATH superfamily
2E5BA 2X1RA 5KVGH 3SSJA 3LEPA 4MLRA 4PBDA 1FCCA 3QXAA 3NGJA 1IGML 4K9EL 2Q6WA 3WFHA 1BECA 4XB8A 4D2NA 2PCFA 4U1IB 2ZJSL 4N25A 1T4KA 2IBZX 5D7HA 3MI6A 4WSHA 2VDKL 3S9ZA 1V4YA 1DL7H 1KCUH 5EWIL 3LS4L 4YDMA 3QDMA 5I8EB 3VD5A 4WW2F 1JZ2A 1U92A 1ZBCA 3FHEA 4FXKA 1PUDA 5AZEL 3PDDA 3CZ8A 5E03A 5KITA 5T5NG 1E9OA 3ISRA 3L8QA 1C1EH 4WWNA 4IRJD 2V7NA 3UWVA 3RFRA 1MHEA 2EICA 4KFNA 1FC2D 1UP2A 5A3IC 4B9FA 5E8PA 3E5BA 4QHMB 1N7MH 4H9TA 1X5YA 1WZLA 2DUZA 3HMXA 5LZLA 1GHRA 1IEWA 4HGWB 1H3VA 4JDZA 4KY2A 4HNCA 2XXFA 3IS0X 4QAMB 4F8LA 1FWEC 2ZC8A 5LDUA 4UI2A 5AUMA 1DCLA 4L05A 3QQ3B 1B6UA 5IVNA 1SHXA 2VC7A 4PJ9A 5BVPL 1CWYA 2JV6A 4PG9B 4XNYH 2WTRB 1S5MA 32C2A 4FX8A 4K7FA 4IF2A 1TO5A 3L67A 2XI9A 4HPHA 5BUPA 1V8EA 2R4RL 5K59E 5I2IA 3BIKB 1GVIA 1YEDA 3KHQA 1P7QB 4TYUA 5HMSA 3VKJA 3ZTEA 3SBWC 5E1AB 1XS2A 4TX8A 3H42L 1PQZB 2BY1A 4NZUL 3JS3A 4X0NA 4RAVA 4N5EC 1L9WA 1MCPL 1UT9A 1UQYA 3HPAA 3P14A 3OAYH 4RWYL 2PGWA 1Q13A 1DANT 3IVUA 2J20A 4B4HA 2P0OA 1AZRA 4U0QB 3IUHA 2XTLA 2KDGA 4YVVA 3VJ6A 1XLGA 3SRFA 1D5BA 1QWGA 3TH3T 4HJEA 3SCQA 2IDCA 5FGCE 4PU2A 3SCMD 5J3HD 3M1BA 1I0DA 4U7MA 5BO1H 1KEGH 1SYVA 4P2RA 3QJVB 2WP3T 4DQOH 3MXWL 4JNMA 1A65A 2ZE3A 1QSFA 3O11A 3RN6A 3ICJA 2BP3A 3HG2A 3GTVA 3E1ZA 4S3CA 5ADPH 1BWKA 2VQTA 5K9CA 4Y2DA 5JNYA 1HXMA 2ISFA 4GBUA 4GJJA 1MI3A 4PBEA 3NL6A 1XCXA 1XYLA 2G75B 3S37H 1CE1H 1E0OB 2XIDA 3KM2A 5H94B 1ORSB 4DY1A 3ZDZF 5IT2H 3O3UN 1I8IB 2E9IA 4D7PA 2NDFA 3GJFB 1HKMA 3R7MA 4EVNB 4LJ3A 4EDXA 1P0EA 4NZ8A 5CBJA 4MB5A 3R0MA 2CEQA 2XSBA 2FD6H 4Z7UF 2ATSA 4CVXA 4Q33A 4NAQA 4M43H 3ZQ9A 3QFEA 4ONOA 3I10A 3S2AA 4RAHA 3VCLA 2H32B 3CFTA 1NBCA 5E6IB 1LBLA 1QQDA 3NCXA 1FBIL 2B08A 2FB2A 4OF8A 2F8QA 4M1CD 1T41A 4W8LA 4ELME 4YUEH 1ZANL 2NZ1A 3G22A 4FF9A 1KDJA 4ZZ9A 4C7DA 1VRSA 3IJEB 2TODA 1PL9A 1Y5VA 2YXOA 1IGFH 4DYJA 2WXGA 3GUTA 2UZYB 3GSUB 1MJ7H 3OMZA 4RLDA 1O94A 3DSNB 4FOUA 4DPCX 4JTRA 2P9RA 1LGVA 4E9YA 1QLRB 2IXQB 3PWUB 1Z0MA 4YX2H 1CT5A 5ECUA 4YIQA 3U4AA 5DRNA 5JZ7D 2ZSVA 4ABUA 2VW7A 2ICEC 5EIIB 1BV8A 1NCIA 2VOTA 3SHSA 3N6QA 3O63A 4OGXL 4U6VL 1GPOH 3RVTD 1TNNA 2NNAB 1PPIA 3RWGB 1QTSA 5AW4B 5FHAH 4LU5H 1JAEA 5F6IB 5D1QC 2YD0A 3GBMH 2LU4A 1JV2B 5FF2A 1JCVA 5JW4R 4JTEA 5MHSD 1YKWA 5ETUA 2WZIA 1B1YA 4DGYH 4MGXA 1ZCCA 5CBIA 3H23A 1VFTA 1F97A 2R23A 3LKQA 4YDJB 2CYGA 3B83A 3QUZC 2ITDB 3LXUX 3QA3B 4DWSA 1EH9A 2MKWA 4DJDC 1GYWA 3VFGH 1LO5A 2DL9A 2A9NH 2CUIA 5GJSH 3REVA 5FHBL 4ERSH 5I0YA 5T33L 2OI9C 2HRLA 1V03A 2WMGA 1BM3H 4TVUA 4HOWA 5FL1A 3BTNA 1IAIL 3MV8A 2HTMA 1U3HA 2VKZG 3C08L 3B2UC 4PB9H 4R7DB 4X7CC 5D02A 4LIQL 2FDSA 4HF5H 1NOLA 4PJAB 1TVLA 1F6AA 4QRFA 5C0EA 1YEWA 1E5UI 1WHOA 3FONA 3SGJA 1AXIB 4G59C 1O4UA 2VDHA 1PSCA 4BZ2L 3CUIA 2ZOTA 2Y85A 4R8WL 1OIFA 1U8CB 5T3ZL 1W32A 4UCGA 4M5ZL 2DBLH 3BSGA 5DMIL 3KRBA 4EF8A 2DLHA 2NWSA 1ZLUH 3MRPB 5IJCC 1RZFL 3OMNB 2Y6SD 2I7OA 5DJ6B 5JU6A 3ZKQD 1H49A 1E0XA 4EUPG 3MUZ1 4MKVA 5H8DA 5DJZA 2NT1A 2GQAA 4HVBA 2J9YA 3APNA 1JXFA 5G5DA 2M1KA 5C0DB 3SDAB 1C5CH 1XGTB 4PJCF 3P84A 4R26L 4AVHA 2BGSA 4NHCH 1SOKA 4PRPA 2A4ZA 1E0TA 4GRWH 1PIFA 3FO1A 1VHNA 1QR4A 4Y9AA 3MLVL 4Z7WE 1UBPC 3NCFB 1TPDA 2QIWA 4Y4KA 4KRPB 5LNRA 1XRVA 1OSYA 1MHHB 2VEPA 4GRLA 3O2VH 2JGQA 4R3UA 3L9RB 5IDZA 1A4JA 3M5ZA 3K2IA 4UTFA 1GEHA 2K6WA 1M7DB 4OLVL 3TJEL 1OGPA 5E8DH 1NWPA 1LDSA 1XRTA 4LYRA 5E2VH 4HIIB 4HJJH 1QPQA 1O5KA 3JYCA 1N8OE 3AMCA 4IQHA 3IRDA 1QRNE 2UYLA 2OL3A 2I9TA 3CSTA 2JF7A 4DGVL 3TZVA 2ED6A 4J8RB 1BTMA 4Y2WA 4LOVA 2X9XA 4UM8A 3P4MA 4KKCC 3C2AL 4IIGA 1AG1O 1W1YA 2XPZA 4MMWA 3QIUA 2H26B 4PVBA 2PTUA 2AGJL 1RUPH 4C47A 5IQOA 1AHWB 2WXJA 3HBPA 4QLKA 4MKTA 2P5EA 1JGDA 3LRSB 5JW4N 4JO1L 2QGYA 2AZUA 3IKCB 4LV9A 4MD5A 3KL0A 4TXEA 2Y2YA 3TL5A 1PCXA 5T1DL 3WTVA 5K2ZA 5F7FA 2F6AA 3O3DB 1LTDA 3GGWA 1BG9A 2HNEA 4PTMA 4MJIA 3US9A 3V4PA 4XPFL 2HISA 3CO8A 2XN9A 4O58L 3ARGA 2VLLA 2WXIA 2BDNL 2OKOA 2LFEA 3COOA 1W9XA 1A7QL 2IH3B 4OD1L 4PRBB 3LEYH 1LF1A 3FUIA 2YA0A 2J71A 3JZEA 2UZIH 3RNKA 4E42B 2XHNA 1SBSL 1NDGA 3QHOA 1FH2A 3X12B 3DUUB 1U1UA 3HUJF 4J9JA 4YSEA 4AEHL 1DVFA 2NDGA 2CA3A 5I1KL 3MO1A 1WTLA 4TUKL 3S0CA 2G4GA 2J44A 2VRQA 2D1ZA 1CG9B 2H1PH 2Y6TE 5ID1A 1F9CA 3OHIA 4XNDA 1HIZA 4E5XA 1DWFM 3W0WA 4G43A 1FNLA 3M86A 3R10A 3POHA 5JXAH 2H3XC 1HGYA 1JPDX 4YL9A 4XCFH 3PV6A 3QIBB 4MBRA 1KSRA 5CGBA 2EE0A 4AIZB 5I9QB 2VAAA 3NOEA 3T1FA 1MZRA 4IMAA 2LLNA 2P50A 3HO8A 3FOLA 3QUKB 4NN7B 2QDGA 4TV6A 3R8QA 1TJPA 3HLAA 3LTVA 3PP3K 3LHVA 2Q8BL 3N4FA 3DX6A 3QUMH 1S7QB 3LHUA 3MGOA 2EO7A 3PQYA 2FGWH 4JM0A 4NJ9L 3THML 2EDHA 4AIUA 2A77H 3BEVB 2VFHA 3MDUA 1ML1A 5D72L 1E4IA 5KYXB 4HYRA 4JDTL 4ZFCA 1VR6A 3MBWB 1M3UA 3GSMA 3G5XB 3IIPA 3EB3A 4ZAKD 1I1FA 3ULAB 4NXKA 3GTHA 3F05A 4H9MA 2EXOA 2IANB 1DE5A 1IIHA 1FRGL 3E3QC 3AWGA 2L7QA 3H21A 1OINA 4MSWB 3VXTA 3FRPG 3ELAT 4LP8A 3C8FA 1D5IL 3GJFK 4OIIL 3BZ5A 2ZUTA 2REQB 5GRXG 4R3SA 1UH2A 1X97A 4TQTA 5AHNA 2AABL 1E8XA 2FNWA 4LLDA 4HXAH 4JAMB 4P5MB 5JDJA 3UOAB 3DSFH 1KXQA 3KR3H 1R3RA 4OZFB 3SKNB 2NY2B 4ONHB 1SYSA 1FGNL 4L9DA 3FCSB 4MAYD 3FUMA 4ZXBC 5CJXA 3A4XA 2FB4L 5E9DB 2VXNA 4FQHB 4PJGB 1D3HA 1QXLA 4M8RA 1S9YA 1CB4A 5CD5D 3DYOA 3ZLHA 2GQ3A 3HGOA 1UIOA 4HW6A 3B9KD 4HPOL 2GDQA 3O9WC 2WMKA 3BP7A 1JV5B 3TEVA 3UYIA 3FQNA 4QKTA 3M8OL 1PW3A 4NUGL 1IUZA 3QQ4A 3WL9B 1DE4B 4Z3HA 3GMPB 3QQ9C 3DI2B 3CZGA 2OSLA 3RFZA 4LLWB 4JRXE 4XHJC 1ICSA 3PGDA 4AVFA 3CFUA 4QCIB 1XLMA 5ICZB 1YY8B 2AJUL 1GQLA 3H9SD 1NJJA 1BQKA 5J13C 4GX8A 4E2DA 1Z3GL 4ZW6A 1YPXA 4X4YA 3U0TB 4HD9A 5I76B 2E7DA 5BS0B 4OJCA 3W6LA 3UR2A 25C8L 1S78D 2I85A 2P7TB 4M00A 4HFWA 3WDRA 2BRQA 1P0KA 4K8HA 4O5LL 1RZ7H 4TMPA 3T0EE 3U2SA 5K1VA 4ZUSB 2Y22A 3QXVA 2BFVL 4PTDA 3S35H 1B31A 1FDLH 3ESNA 2IH8A 5GHWH 4DPAX 3FHQA 2LAGB 2Q7NA 5KZCB 1MNNA 3HPLB 3NA9H 4HEMA 3D39B 2XVGA 5DDHB 4WO4D 1JDFA 4IPJA 2HN7B 1WXZA 3HG1A 3MA7B 3UWUA 1NICA 1GGCH 4GIRA 4G6JH 4KQ0A 2KKQA 4XOBA 3SGUA 4IJTA 4NUQA 5I5IA 3C5SA 1KFEA 5IHRA 1EJTC 3QG7L 4HIJA 1NTDA 4DP5X 2NYYD 3M0HA 3OR6B 2HVKB 3B05A 4WW2A 2IALA 2VWSA 3UTZA 4FF5A 3MNZB 5JPMB 4R96B 5B7YA 1WA2X 5HHNB 2XSAA 1OYCA 2NMSA 3NK4A 1A7BA 4LEXL 4MVBC 3JWDC 1W0MA 4WUUB 5XIAA 4UM9B 2HMCA 3GVRA 4E4FA 4OM1H 4CN4A 2XV3A 4UNVA 4LPTA 3SQBA 2A9CA 5AOMA 5DD6B 3SN4A 4O2CA 5JBDA 3TS8A 3ID7A 4PEEA 1FL5B 4XSLA 1SXCA 1E6OL 3MJ7B 2E4TA 4N9GA 5GIRA 3MHZA 1SLWA 3CHOA 5K39A 3OZMA 1TZIA 1TVBB 2I60H 1ZT1B 3MYJA 3C5XA 5C6TH 1LMKA 5HGHA 1NCAH 2V9RA 2PWDA 1UM4L 4F2ME 5C09E 3FEMA 3HPSA 1WFTA 2O9OA 4N8CL 1JPFA 2DWSA 1Q9OA 3BZEA 1V79A 4ODWB 4ZD3L 1K7XA 4JB9L 3SKUD 4MDIA 4Z1PA 2H90A 3WIHL 1PFCA 1QNVA 4L80A 3ULUF 4JFPA 4EOUA 3P2DA 5BOZG 4G9FA 4WUIA 3HI5H 2ZPKH 3JV0A 1LE9B 3MV9B 1F8TH 3TOPA 1OTSC 3VFVB 3MXVH 4RKAA 1WDQA 2KZKA 1F18A 1XJBA 4QYOA 3QBUA 2ZXGA 1OP3K 5AWNH 2A2IA 2K8MA 4RDZA 2VYRE 3LCIA 3PNWB 4GABA 4FS0A 3NIDE 4W9GC 1TZHA 3NACH 2E7HA 3X1GA 3HPFA 4OFVA 4D71A 5HHME 2FUQA 3N1PC 5DS8B 1OVDA 1G01A 3BLLA 2A7PA 1C93A 3QG6B 2GYSA 1OTTC 4DLFA 1UG6A 5EA0H 1MJUL 5EBGA 1B0GA 1FN4A 2IOIA 6FABH 4PLOB 1ADDA 3G3DA 2MNUA 3ARWA 3L4ZA 2VDRH 2J43A 3O4LB 4X42A 4PJHE 2V67A 4PWEA 1XIMA 3AHVA 2BCMA 2W88A 1H7XA 5LCVH 4PUJA 3MKKA 1VGKB 3HNVH 1CPUA 3IFNL 5I00A 4ZUTA 1U93B 4ACTA 4CC1A 3IV3A 4JQ4A 1YRKA 4AZ7A 4P46D 3E9AA 7FABL 3V0SA 2Q87A 5F8QC 4WSKA 2AAMA 1R1CA 4Y90A 1U8LB 3W70A 3OKYA 4W8AA 5CZVL 2Y1ZA 4G8GE 2XQBH 3DESA 2P42B 2VGFA 3TNOA 3NEEA 4ZFOL 4UV7H 1VCAA 2FIQA 4GQQA 3LNFA 1XR8A 3D5OF 4YE4L 1BX2A 1AIFB 4KVNH 4URTB 4G11A 4FQIL 5I1DA 2DQCH 1VFOA 3BRGC 2X9YA 2HSAA 1A9BA 2CM5A 1E9PA 2P45B 2Y1VA 4FFYH 1V5XA 3QW9A 5C0QA 1RI8A 2LR4A 2CWXA 2CA4A 4XB3A 4LARH 1UASA 2DWYA 1D7DA 5D4IA 2ZUQC 4FNLH 2ICCA 2G2RA 4AY1A 3S34H 5AYBA 2J6EH 5AECA 4PAZA 1WJ3A 2K8QA 2CPUA 4WKHA 4ZX6A 5C0GB 5DC2A 1KQYA 4E0RA 3HS9A 1TKWA 4CN6A 3HQPA 4EWND 4IRSD 3TYFA 5FW6A 4J2MA 4Q9QL 2J12B 3W1XA 1A8ZA 5CU9A 5EBMA 3KCWA 1TSHA 4N42A 2PLJA 4LSDA 3JWDH 2EDBA 3CFDA 1RIUH 3B0UX 2GSIA 4Y5VA 1GMEA 4A35A 5I1CH 3UCQA 4RW5A 2O7QA 3VZZA 2HT4C 2J7FA 3WFZA 3BSMA 1A5AA 3CIQA 1F5WA 1E5AA 3NPSB 4PRIB 4YXGA 1X9QA 3UADA 1QW8A 1P5UC 2Q2LA 4WJEA 3FHAA 1GPFA 2H0JA 4NQDD 4QAIA 4X5PA 4G1EB 3V75A 1UCTA 5IVXA 2E7BA 1J9SA 2BVQA 4Y9CA 1RJZB 1SW3A 3NJKA 2YRPA 1HL2A 2DD8H 1FPTH 1GHFL 3QEQE 2EZ0D 2QJGA 5SWZB 5B3NA 2X1SA 3OMAB 1X39A 4NC2B 2I57A 4G6AC 2DEPA 2E75C 1ZTXL 2A74A 3IIOA 3WQWA 2QF8A 4JNXA 5I18H 3WD2A 1WD8A 2XSKA 4NO3B 3EJYC 1VZHA 5I75C 3QIWC 4QOKA 1ZLWH 5LXXA 2Y7GA 5A7BA 4NX5A 5CP7A 1LOQA 3MVIA 1S3RA 4JRYA 3IVKA 4MY1A 3VABA 3FCPA 3RVXC 4Y16C 5EMKA 1UJ3B 3KVMA 1GCFA 2JI3A 3X14A 1GOHA 3PG9A 2D2HA 4I2XE 2H2PC 4Z6AT 2J77A 2A2QT 4GAYB 1ES0B 2VWTA 4PBWD 2WW8A 2XH4A 3U4BL 2V2DA 2K1MA 1MRCH 3EMQA 3C8KA 2WTOA 4K3EH 3SPIA 1UUOA 4HJIA 4PLKD 3UP6A 3T4WA 4HUMB 3WK0A 4HIXH 2G3IA 2XG9A 4ZFZA 2RTTA 3SOBL 1Q5MA 3UC0H 3F2BA 1EEZB 2RH9A 3BKMH 1UWEL 2E6DA 4L1GA 1PYFA 1Y6MR 2QAPA 3F7QA 3MSRA 4AZ8A 4WWKA 5I3GA 5LBSL 5D1ZC 1DBJL 2DU2A 5LWYL 2DV0A 2OODA 1BWMA 1W5QA 3OZPA 3DFTA 1WITA 1OF8A 4P2OA 2Z92B 3C60B 1G4PA 2X1TA 4NAEA 5D9OA 5SX5K 4UTAH 3MRCB 2GY7B 1CYXA 3IEAA 3L95B 3KYNB 1P84J 1ZV2A 2RDUA 2FVKA 1VGEL 1OIOA 2YRBA 4RZ4A 1SGJA 4JFYA 1LLAA 1D5MA 4LQFL 5CKSA 3L1EA 2NY4D 4U1GC 4HALA 5FYKE 3P4NA 5FA4B 2GUOB 5HYSB 1FSKB 4YLQT 3W2DL 1V02A 4HSOA 3DX7B 3BCDA 1WISA 5XINA 3VWJC 1NCCL 1WDSA 4Q4MA 5DJAA 2IC2A 1KPUB 2XA3A 4RBPK 4N2EA 4QP0A 3MREB 2R4SH 3DMMB 2VUOA 4FZIA 1BD0A 1FWTA 4TUJB 3SYOA 3ZE2F 2NY1B 3VI3B 2P8PA 4LKCA 3H2AA 4Z0BL 2H3NB 3WHXB 2X4TB 4TQEH 1AI1L 2QULA 1A21A 4UUIA 3GKWH 4YTRA 2Y70A 3WIHA 4JJ5A 4MQTB 3RZCC 3ZIMA 2WJEA 4KETA 2EVGA 1I2OA 1T1WA 1CGYA 5BV7L 1QK2A 3TN0D 1S5WA 4PHZA 2EKJA 1KIRA 1ALDA 2DY2A 4JO2L 4RISH 2VYOA 1HE8A 3SIZA 3G5ZA 2G60L 2HVBA 2LT9A 4AYEC 4Y9NA 3F64A 3F62A 2EIMB 1E4XH 4X7DC 3T40A 3BVVA 1NANH 1B6DA 3SCUA 2J2ZB 5SWSB 1FWAC 5D7LB 1MLBA 2AXFA 3L4YA 3SDDD 5FIPA 1US0A 2CHNA 1ZKAA 3ULUL 3E9UA 1I3RB 4A38A 4WGKA 1TTPA 1QLEH 2FQGA 5DBUA 3G5VB 4DERA 3K13A 3KOYA 3P30H 1T83C 3SUVA 1J1XH 3CB3A 4QHRA 2X0UA 3D46A 2YPLB 3AUJA 3EOTH 1XSJA 1BZEA 3WFBL 3JV4A 3B56A 3ZIZA 4F8XA 5I24A 3G0XA 3OGRA 2XETA 4XPBL 4JKWA 3RU8H 1WD9A 1X4YA 3SCSA 2H4EA 1XXXA 3ZLQC 5EHFA 2PWGA 3VKKA 1R0MA 5D33A 4EXPX 1QI2A 1JYXA 4LOCA 4HA1A 5I5JA 1KENH 5G4MA 1F05A 4JZNA 4GUOA 2Z93A 1GYLA 1YEHH 3PTMA 3IDMB 2PDNA 2IV9A 4DI8A 1HL4A 4LFHG 4GBDA 4NI3A 3UTTD 3SJVE 3EXJA 5MEOB 4Z0XB 3RWFB 5AZ2H 2Z8VC 1N0LA 5GGRY 5GSRA 1Z6KA 2DDXA 1CWVA 1UWXK 3VXSD 4D8PA 1D2PA 1RD6A 3NIGE 1GPWA 4G5ZL 4JKMA 2GGJA 2IBGA 1BAGA 4RGNB 3V6ZA 3L6FA 3FB7B 4HUVB 1A3RL 4E8GA 1WV2A 4HX1A 5A95A 4BA8A 1A14H 5CUSL 1KTDA 4L1LA 4WHDA 1FWSA 4XNUH 1FCGA 1M6JA 1YNLH 4W9JC 1TQVA 2SEBA 5KSBB 5TE7H 2GOKA 1OAUL 2BY2A 2Y5TB 1WICA 3MV7A 3E1F1 2WC4A 5FM4A 1XIWB 1YXCA 4RE2A 1Z7JA 2FR4B 2FTPA 4Z1BA 1F3RB 2NXZC 4AQEB 1Y65A 4FA8A 1QUNB 3LCWA 1W3KA 3IGSA 3IU3A 4BRVA 1L0YA 3MNWA 1BEXA 1VFFA 5DHYB 5D7IE 2J57A 5LNVA 1MFAL 3UG8A 3BSHA 3HA1A 1BZ9A 3PUCA 1A6TA 2BMKA 3MLUH 4FEMA 1IC5H 1RBAA 3TA6A 1KYOJ 4I1PA 2YGOA 1AL8A 1PDKB 2XLLA 2DQJL 3ECQA 1EUAA 3E8VA 4FFZH 2CLPA 1XGZA 3W83A 2E27L 4BQ5A 3ZR5A 5JHDA 5ICXB 2JK5B 2UY7B 1LLWA 2DBJA 1T7ZA 4HAKA 4AC4A 3EDFA 4AEIL 3ZE1F 1GH7A 1A1NA 4X9HA 4GUFA 2KERA 2R2HB 4P3CL 1KBLA 4JKNA 4LF3B 3O8XC 4Y4HC 1RQ5A 3STLB 3TF7C 2WNKA 4PJFE 2WTPA 3ZRSA 3ARBD 4JIIX 1QFWL 3U2IA 5I79A 3ME3A 3PL6A 4D9QD 4MNGA 3T4AB 3B5HA 3I75B 1EBGA 2A79A 2WVUA 1R0AL 1FYTA 1KJ2B 2BZNA 5DFTA 3EGDA 1P6WA 3EAKA 5DTFA 1F2XK 4QCEA 1TVHA 2MCMA 3RWJB 4PD4K 5IY5B 3SGEH 3KNBB 3GHSA 4QHKJ 5J8OA 1NUGA 2WVVA 1TT6A 5F96L 4APQB 5I1EH 3G8EA 1JUFB 1AO7D 1TLMA 1PD6A 3MACH 4LKXB 1XIJA 3JUYA 3APDA 1LT7A 5MI0C 2GVYA 4N8PA 3W57A 1KB5H 4RNIA 5I3HA 1EXGA 3BYYA 2CUMA 2PGRA 4MD0B 3OHXA 1OVZA 5F44A 4RDQF 4HGKC 2OMTB 1F74A 2BSSA 3GSNL 4MD4A 4JTDA 1QPNA 1IXOA 4ZQRA 4Z77B 1JSYA 3RDTB 1V7YA 1F3EA 5EMJA 4KC3B 4MYWB 3CH1A 4KAQL 1Q0EA 4XN8A 2DB8A 2HBVA 3R79A 2CLRB 3LDBC 2ZF9A 2AHIA 2EDTA 1DXEA 4XP4H 4EN3B 3LQAH 4OF7A 4MG4A 3V6OE 1HFBA 3DROB 3PHQA 5GGRB 3S3GA 1YYLL 4A05A 3ASWA 4H8WH 1FWDC 4FXRA 1X44A 4IGHA 1JWUB 3PFMA 4GNKB 3S5ZA 1OM3L 2VJXA 1S38A 1A5CA 1HH9B 1XL6A 1JYNA 3DEQA 4GI6A 4TQIA 1EUUA 1K6WA 4HFUH 2YPIA 2YKLL 4PULA 1QFEA 4DBSA 1ETA1 4UQ9A 2CW6A 2TYSA 5I1HL 2VDMH 5D2LB 1JPMA 5DQ9A 4JY6A 2BB0A 3FDGA 3DVNB 4APXB 4LPCA 3TT1H 2V0TA 1O9WA 4U05A 2BM3A 4PMEA 4ODVH 3DHDA 5KVEL 4JFFE 2CJTA 3A6CH 1EJUC 3QS2A 4N87A 1EL3A 1IARB 2R9HD 1XF3A 1XF5B 4MJ2A 1JE6A 3RRAA 1NVMA 3L9EA 3ILQC 2Y5JA 4M1GL 1ZJIA 3NIYA 1R5WA 3GI9L 1X5FA 4GBXD 4C5YA 1N18A 1RZGA 2PR4H 1AMXA 2LHAA 1ROCA 1AJ0A 4D9PA 1FFNB 3ANUA 4HV8A 1DQKA 1LL7A 2GIMA 4HIQA 3ZTJH 3G8RA 3QI9D 4US5D 4N28A 1DQDL 4PY8J 1OX4A 4KPHL 3E0WA 1TOXA 3DGBA 1FNGB 3NJIA 5EMLA 1WDRA 5H2BB 4GS7C 3A6OA 3ULVF 1I1AB 1NQ6A 1XDJA 3GI8H 1QAWA 5HD8C 2P26A 3EOAA 3HS0B 3GY1A 2DMKA 2XWJB 2Y7MA 4ELKB 4ZYKB 4FL4B 5ES4B 3T78A 2CAKA 5IEHA 3V0IA 1CGUA 3FXYA 4ALAH 2X87A 3LXBA 2ZUXA 4E38A 3SY6A 3TWAA 4NF7A 5JW3L 4YTTA 1QHQA 2J4WL 2XBDA 2VRAA 2WWMD 5B39A 4XAWH 2ZAHA 4P48A 2FBRA 3IVTA 3WIAA 3H4FA 3ARDC 3BFWA 3MMWA 3UZZA 1WXJA 4HJ0C 5EDXA 4HKPA 2BLEA 4JG5A 1RIHL 4M7LH 1HCFX 2LAAA 3LN9A 4KH9A 3WQ6A 2RQEA 1HKJA 2VDNL 1CGSL 1ONQA 4JTFA 5HI4D 2FZ8A 1TYEB 3UZEA 3CSPA 1WFJA 1RK0A 4OZ4B 4HUUA 3UTSE 1JZHA 2YSSA 4DF1A 4ORGB 1YEEH 3LKPA 4JLRB 1HI6B 1P0DA 3QZMA 5M1TA 1G6RA 3SGKA 2VGGA 4YHZH 1DBAL 1WKDA 4GKNA 4FOMA 2RJGA 2XWTA 3DG7A 4FTVE 1M7UA 3L3OA 1P48A 1VZIA 1BBDH 1ND0B 2PTVA 4PW3A 2L0DA 4ZW5A 1J5SA 2PNDA 1IQWH 3EYSH 2WWNA 4Y7MA 4NP7A 1E4LA 1DPMA 3DVFA 4Q6IA 4XOCA 5CJ8A 1LOLA 1R85A 2OCJA 1SJMA 2E6YA 3W7IA 3K8MA 5MENB 3NFUA 3GU1A 4EF3A 1D5XA 4WHBA 2GBVA 2E7FA 4P9HL 4Y5XC 3T65B 1FWFC 5E6ZA 1L7IL 4EKXA 2VCCA 1YDNA 4JFQA 1J2BA 3GS7A 3W9DA 4V1YA 4JZOB 1G0YR 3ILPB 4DIXA 4NCDA 4N0YH 4XO7A 1OX6A 3MHUA 4RK8A 5I6LA 3GH4A 1F0LA 1W1ZA 3IN2A 1H5BB 4X83A 5HYJB 3D09A 3HRZB 2QJMA 1F3XA 1LK2B 3NSDA 3N42F 1CN4A 2YMOA 2JF6A 4XTRD 3W5MA 3QJOA 2WJZA 2VDRB 4I0PD 3CZLA 1HKKA 2L7UA 1AYRA 3NIFE 3O3EA 5T9BG 4OZGE 3U1SL 1TWDA 2CWRA 3N9GL 4OI8A 5F7LB 4LLVA 5KWYC 1CXFA 3QXDA 2PXYA 4RV3A 5C0AD 5AYZA 1NQBA 3AB0B 5AYXA 1IT9L 3LD5A 5FYLE 1B4KA 5FO7B 2OCCB 3OX8A 2EILB 1RFDL 2PZ0A 4DW2L 1A0CA 5ITBH 5ERWB 4OZIF 3JT2A 4PRAA 3UZWA 2F53D 2ESVE 4FOJA 4V27A 3AIWA 4XCYB 2W9DH 1SFTA 2YBVA 1HKWA 3PFRA 4RZ6A 4UT7H 3GKAA 4X8CA 3VFOA 4FABH 5HR7A 1EIXA 3LKOA 3CHSA 2Q2EB 1EQPA 1H19A 1MN4A 4J4PC 4RGMB 4RMVA 5CZXC 1UCBL 4L4JA 1GOMA 4TNWK 3IBOA 3A4AA 5C08D 4Y8FA 1W1A1 1OGTA 1RLDA 1Q6OA 4G6FD 4LAQH 2UWEB 4TULL 3ZE0B 4CC4A 2ED7A 1NIDA 2VE6B 2VXQH 1FVEA 2VXTH 2VDPB 1TPXB 2VR9A 4JRLA 3SDCA 4IOFD 2C3VA 3IB4A 4M8VA 1QPKA 4IIQB 1ZAHA 1DWJM 1DKWA 4ZQPA 2L4OA 4B15A 3H3KA 4GG8A 1VACA 4YE0A 5AHIA 2QVTA 3WKML 3T5WA 4OY9A 2NY3C 4QXTB 4Z3EA 5IMMA 3GMQA 1OGAA 5B80A 4CNUA 4B9JA 4QE4A 3VM5A 1HNGA 1KFGA 1VLWA 1KRAC 2C3HA 2GCYB 3IJ9A 3RGTA 3R43A 4N1HB 1Q9LA 2WXMA 3UROR 3Q6GH 1N10A 4OF6A 1HTIA 4NUJA 1H3UA 5E51A 1F4YL 4JX6A 1XFBA 2FYYB 3DOIA 2P3ZA 1KJVA 3IU4L 3AAMA 1CUOA 5CJQH 3WH8A 5EIVA 1OW0C 4N0CC 5GGTH 2GABA 4JFHD 2ENQA 5CHNB 1JGUH 1PAMA 3NEOA 4MS8D 3UJTH 1WA3A 4H9YA 3ZO9A 1F4AA 2PCQA 4MB3A 3OAZH 5TDNB 4JFXB 1W5MA 1B4JL 4N0UE 4RA3A 2VCBA 2Q86A 4YL2A 5F3BB 1M7PA 2ITCA 1R2TA 4KFPA 4B50A 3AWEA 2HJLA 1MWAL 1KTLB 4U1NA 3TCLB 2EIDA 5LNEA 3VPLA 1SJDA 2ZKMX 2WWKO 1T04A 1I8KA 1F6KA 5FO9B 3CLFL 1TSIA 3TO4A 4FEIA 3LD8B 3RY4A 4DUVA 2BWDA 3FUHA 5E1GA 4I3GA 1QX1A 1HSBA 3JTBA 1S7TB 1UA3A 1WBYB 4P23C 3EXTA 4ETQA 3U36B 3P73B 1T5XA 4TSAL 4LCCC 4EQ3A 2CBJA 1PBGA 4H6RA 1W9DM 3RWEA 3QGVA 5LN4A 4NL1A 4X5RA 4J39A 5CQ1A 3AMKA 4KTDL 3TR2A 1A6VH 5IW3A 1E6JL 1LO0L 3FA3A 2W60B 1U8PB 4GAJH 5E99H 1ODUA 2AKRB 3FQ2A 2OZNA 2IGLA 4TRPL 4LASL 5FK9B 4X60A 2XM1A 3RIAF 3QHZH 3V4VL 1XGPA 3RHWF 2DQGH 1H7WA 3D0VA 5J0BA 5LHDA 4GT0A 2BOBB 1NAL1 1WAEA 4WI6A 3GH5A 4G8AC 3FOMA 1P7KB 5GS1A 4L4TB 1T3FB 3R11A 3IDXH 1R6WA 1INQA 5F9WC 4PLJC 2RGLA 1DZ0A 3FQRB 4XMVA 4B4FA 3NVDA 4A1RA 2P47B 4W9EC 3TCEA 3P67A 3BGMA 1AGBB 3EO0A 1LUCB 5ENLA 2BSEA 3ULVL 4PRNB 2HFFA 2E1WA 4JM2F 4KRZA 4WHCA 2BZ7A 3BVNB 4PGBA 1G7UA 3L5WB 1EZSA 4P4KB 1Q6EA 5AW5B 2JKLA 3S3CB 4OVUA 3K4ZA 3M45A 4JTKA 1HINH 1FZMB 4K9JA 3TEWA 2NW2A 2AJSH 1KTCA 1XGUB 3B4YA 5JPNC 3O3RA 5AW8B 3MLPA 6REQB 3DX5A 3QDME 2BIIA 3QT2A 4X9GA 2DYRB 4OFIA 4ZTXA 4C6NA 4J35A 5KBNC 1J0KA 2ICWJ 2YGPA 1MCKA 3QPXL 2DUXA 4YYCA 3T6ZA 1I2RA 2ZKWA 3QISA 3H7BB 1VEMA 3QC0A 1MXGA 4WJKB 1R24A 2JBMA 1VYPX 4O28A 5M5DA 3SADA 4NO0B 2OMZA 2EGZA 1EBPA 1NFBA 3WO4C 1GY1A 1SPDA 12E8H 2YFOA 1HX0A 3FXGA 1W9VA 2VH5H 3LI1A 2BRRL 2FEEL 4F9LA 2EADA 2YXGA 4NT6A 1E8ZA 9CGTA 2JXMA 2Y88A 1A3HA 4PMDA 1KV5A 1AZCA 4BFIA 4EUPB 3OO2A 1P5VB 4LPYA 2YPVL 2ZWKA 4O50A 4Q8TA 2C1IA 1THCA 1JZEA 2J25A 5DVLA 3QJXA 1PZ2A 1REQB 4N8VB 4CEUC 1O9ZA 1E2WA 1KBGL 4MJMA 4K07A 5JQHC 3OKDB 4D9RE 5GS0D 1YPZB 3MHGA 1OCNA 4JMNA 1QLEB 4ZUVA 4XKMA 5KSAD 4WXYA 3IETB 3ALPA 2FWLB 3SAZA 4DT2A 3NABH 1M1XB 4JXCA 1H0DB 1BFOA 4AQ1A 3LKSB 4N8VG 4WTWA 4EI5A 2QCCA 3FYEB 4YSUA 3AISA 2VO8A 5I7GA 3GDBA 3G7TA 3BMXA 1X9UA 1E0WA 1Y0LB 1NCNA 4AH7A 2C7FA 1FCUA 3QQDB 1DBBL 5EU6B 3HPZA 4X6FA 1QEWB 3M41A 4JHUA 1ROWA 4PH8A 4DHLA 3U9UB 4BRJA 3CHCA 5DFVC 4WKAA 4HS3B 2EG8A 2XIQA 3MKCA 1N26A 4QEHA 2E3ZA 1UC4A 3E0LA 1OBAA 1YJDL 3BJTA 1SVBA 4P5KA 5ACZB 3FTYA 3QULB 1JRHL 1KN2H 4PUMA 5HPCA 3KVKA 3EO9H 2AQWA 3OR7B 4MDOA 2VFFA 4A8RA 4P2RE 3VKAA 4MCYA 2W0FB 1NWSA 3FGCB 1EX0A 2F19H 1QSFE 1P2CB 2QR6A 2CQVA 1E42A 1S9XA 4UQCA 2YRZA 4Z2LA 2NOYA 4M1DH 5BQ7B 3N13A 5DA0B 3WY1A 4N24A 4J1UA 4TVPH 3NFPB 1NL0L 1ZV9A 2AGTA 1UZHA 4JY5H 1HXKA 1D7FA 1M05A 2WYHA 2DZAA 4DKTA 4Y9GA 2ZG3A 2XH2A 3PK7A 2GGIA 2GJ6A 2V69A 3R8RA 4Z78A 1E3XA 4PN6A 5JBEA 2A0LD 5LA2A 2AEPH 5IBLC 2CIPA 4LLQB 4TSCH 3G6JB 3TW9A 5IFAL 1UYWH 4PQXA 2ADGB 4H8NA 4GW5A 1WFOA 3OKKA 3VG0H 4OFKA 3UCDA 1S2UA 2GI0A 4AZCA 1XHGA 4Z2JA 1EJRC 1PZ5A 3HKZA 1LYXA 1B9KA 1T03L 3CQJA 5AW2B 2Z1SA 3YPIA 2NR6C 4JR9L 1ZEAH 5AZ1A 3NJJA 2YUXA 4O54A 3FU7A 2W63A 2CIIB 1VP5A 3MROA 5F7KC 3OKLB 2OXGB 1OADA 3NZQA 4OV5A 4HUKB 1OABA 1HO1A 3IDNB 1R3JB 2VL5B 1WA1X 1H62A 2BS9A 1C8XA 4YK4C 3KL5A 3PB0A 1CMOA 4L3FA 2A5HA 3W22A 2H7WA 2FK9A 4CN1A 1X98A 4OTXH 2D9QB 4M7KH 1KY6A 1PBYA 2VN6A 4MXWL 3KL3A 4GUHA 1DR9A 3RI5F 4H1LA 5EFIB 5CCKL 3CFBB 5AAWC 3FRUB 1PZSA 1U8NA 4XH2B 4AQLA 4LLYB 3IRCA 1CDYA 4NZTH 4B5UA 2NXYD 4XVSH 3NQDA 4M19A 4BHUA 1W2PA 4PWIA 1QNPA 1T7VA 1U8OA 1IM9B 2WZTA 3IGAB 3P9WB 3V4BA 3FRPB 4JPVL 2H9GB 3V2AR 2Q7YA 3N3MA 4DOHE 1KB5B 5IB4A 3QR3A 2IPTL 1MW2A 1ESOA 5G4OA 1S3KH 1VEPA 2YSTA 2QFRA 1G9ML 3W53A 1VFBA 3CXFA 2V8LA 4OOZA 3QKZA 3WFEH 1I1WA 3LQZA 3KXFD 1YMMD 4U1HA 3LGDA 4PRRA 3D5HA 1EJFA 4OQTH 3VRJA 2C8NA 5I74B 4G1KA 3CUJA 4IIZA 4LVDA 5DYFA 4Q6KA 2GT9B 3D9AL 4HBKA 4S1DC 3LNIA 2QJDA 4FHBD 1GKEA 2CGRL 2PO6B 3M5YA 3FQ1A 3GMMA 4UU9B 3KDMA 5DCCA 5I17A 4AX7A 1X5HA 4I9XA 4PMUA 1L9NA 2VDMB 4CU6A 3ESOA 4Z7AA 4F92B 3F7LA 4LPWA 2WZ6A 4JICA 2LVEA 4I1NB 4K7YA 4I9TA 3CBJB 2CR3A 2KX9A 4LBAA 2OMVA 4Z95L 4PODA 3PNZA 1CFQA 2CG9X 2X2UA 3HVDA 4HISA 2CDGA 3CASA 1V6TA 4JCWA 2Y06H 4PRPE 4JGJA 5KBLA 3PXJA 4CMMA 1R3KB 3RDJA 1B3OA 2FSEB 3O6FD 2IGTA 1EPVA 3MRRA 4XVJL 5IHWA 3C5ZC 2BNRD 1XH0A 3QR1A 2OQHA 3L13A 2CRMA 1DQJB 5TBOA 3ONBA 4MZ2A 4WFEE 1OOAA 4BZ2A 1C8VA 5CEZL 2H9AB 4AZIA 2BO0A 4JKPL 2JTYA 3IFPA 3M6YA 1V51A 3KG5A 3QEGL 4K94L 4HKXB 2FSDA 1RBOB 3VNLA 3OLDA 4RSVA 3GSVA 4BWWA 3NZRA 4P2QD 5HWJA 4CNSA 1OGBA 4AL8L 1O0VA 4RX4A 1RZPA 4BUGA 3CLEL 5RUBA 1QT1A 3VI4A 2ESCA 3E2HB 4XNBA 4LVHB 3BWSA 6PTDA 4Q8MA 3CC5A 5L0QC 2V5JA 4LVOB 3MRLA 2YD3A 1WPCA 3VCRA 1KXHA 1IBDA 3ZTJG 4LMQE 1ACCA 1CFSB 2B1AL 1BREA 3HZKA 4W6XB 4MWAB 4AK1A 3PB2A 3EFOB 1WKYA 8PAZA 4UMCA 4QRPB 1TJRA 3KYMB 3RWDA 1SU5A 3RUGF 5INCA 4DSYA 1ZHLB 4NHUB 1NIFA 1G0CA 2FIKA 1U3NA 5MEPB 1G4TA 1MIEL 1RP9A 2CXEA 2W59A 5IREA 3UXIA 3VFNA 4C56D 2Z1WA 1GGUA 4IBTA 1WUFA 2ATAA 2HH0L 3LSBA 3W11C 1BF5A 2O56A 2WOBA 2H6PB 1XIBA 3PPCA 2OSYA 3CEUA 1MF2L 1MVYA 1QR1A 4XE0A 3WBYA 2XVPA 3EX3A 2XN9E 1U91B 1MNSA 3REQA 4HHMA 4RWHA 1OT2A 5I07A 2Q3AA 4XP1L 4H9ZA 4CCDA 4P59H 1M71A 4MUPA 1MCRA 4YDIL 2IPFA 4ERIA 4NQEB 4Z9KB 3ZJKA 1PMYA 1NARA 4DB7A 3HC3L 2XFXA 5I1AB 3WNJA 3ZTNL 1X5LA 2PU0A 2I7SA 2YGQA 3TWYA 3FC8A 1ZLDA 3E8UH 1VZGA 4OV9A 3W0WE 3S36L 3VFPA 4NRZB 1LMIA 2IAAC 3WE6A 5E09A 1Q4NX 2GK0A 3A67L 1UZ8A 3FO0H 1QI0A 2OKTA 1EA0A 3N40P 1VBGA 2WJFA 4ZBCA 4POCA 1ITCA 1YMHA 4A4AA 5ESQB 5CSYA 3RRXA 4H25A 5GS3A 1CD1B 4Q89A 4Y5YA 5LGHH 1TCDA 4HA0A 2QADB 3JBG7 1QPRA 4HMCA 1OQXA 1BF6A 5DRXA 2NNRA 2P5WA 1PKLA 1UM6H 4UQIM 3RJYA 4AGMA 3W2UA 3FEQA 4O4WA 3WUFA 4FLHA 3HB3D 1V7NH 5EB8A 3B9KA 3CHXA 1JVLA 4RIRB 1MXDA 1PX8A 1AQKH 5DUML 4KWVA 5IG7A 3O2DL 2VURA 2IMRA 4N6RB 4LVNC 1ET5A 1UH3A 2EH8L 2IQAA 2DKSA 5C7HA 1G7HB 3P6LA 3UYPB 4JQ1A 2UBPC 4C1NA 3CVIH 5A8QA 3WL1A 1KCXA 5HHPA 2Y1HA 1A5FH 1UEYA 4IPNB 4IGBA 2VQ1B 3UAJC 1YDYA 5HHOD 2BSCA 2TRHA 1FDYA 5EO0A 4NNYB 3BAXA 5DCEA 4XGZB 3PJWA 2E25A 4ONFH 1GVQA 4MXQC 1KXQE 5D71H 3ZQWA 4FG2A 2CCRA 3HHSA 3KHJA 1ISZA 2ODIA 2VDOH 2ZG2A 2XG4B 3TTYA 4W87A 3GEWB 1G7JA 4Z7UA 1L6YA 2IUZA 3DTUB 5DZ9A 3GR7A 3QDGA 4N0FB 3B3DA 4EJ1C 2D7TH 4KEVA 1D7CA 1KV8A 3TZNA 1AP2B 3JRKA 4L9LB 4P2VA 1RLBA 3QHFL 1BWLA 4FADA 3U57A 2PP1A 3SKOB 4WFHE 1YNTB 1WP6A 3CSYA 2EKSA 3O3BB 1T0MA 4K8RD 1TEYA 5DUJA 4FNPA 2JB6A 5CCHE 4YGAB 4Z7OE 3TJLA 2ZZUT 5GXBB 2V7HB 4WI9A 4MNQD 5C2BH 1MI5B 5TE4H 2DMBA 1TTJA 5T1KA 1A3QA 3WD4A 4RMQA 4LBEB 5LAPA 4JG0L 2LQRA 1XIFA 4ZPVB 5CEYA 2C26A 2R7EA 2E7LC 4OTKA 3ESPA 3R4IA 4H41A 4YXHH 1TMCB 2XXMB 2MCPH 5H91A 3L7EB 3IXAB 1XHHA 4WJG3 4EZKA 4WU7A 1JF5A 3L48A 2FQFA 2DSUA 4J2QA 2EXYC 1XM3A 4P9MH 1N2RA 3ZHFA 2XZAH 2R2CA 1EJVC 4GYJA 2NTFA 4QWWC 1J1PH 2OFQA 4KHTL 1Z2KA 3HEIB 1A1MB 5CN3A 4JM2A 4U6YB 4FQCH 3U9PH 1OB1A 3MTRA 3C6LC 1KCVL 3LNEA 3TBTB 1JPHA 3T8QA 1G6VK 3VD0A 1TLKA 5IFHH 4C65A 3QPQD 4U1SA 5BXPA 3G1RA 2EG7A 3PUOA 4L1XA 2PYFA 1ZAIA 4XCNB 2Y7SA 3IWVA 1E4XI 3HM7A 1QSVA 4GSUA 3QEUB 5EUOE 2ZXQA 5LN8A 3T0DA 1XF4A 3MOAH 5JMUA 1X9RA 4GQ9L 1LP9B 5FL0A 5HUPA 4NRXA 3D39D 4PTUB 5GRUH 2GJXB 4ODSL 1T7LA 4KRLB 2H45A 1R3HA 4UB0H 4AUJA 2X05A 3LGEA 1KM3A 2XV0A 1ESWA 2VUKA 1S2TA 2DM7A 4BKLA 5JQIB 5HGGS 4R33A 3FB5A 1F90L 3M44A 3RAJL 3TA3D 3QOKA 5D1XD 2Z24A 1INEH 2V30A 4L1WA 3ZDYE 2OEMA 2X6MA 1FVPA 5EBLA 3CHRA 5AD0A 3SZKC 1JXDA 2TRYA 2OTWB 5ENWB 3VNJA 3W7GA 4JY4B 2JCCF 4KKQA 1FVCB 1W6LA 4D6IA 4KMQA 5BMFL 4UFHA 3WJLA 4YHOL 3EFFA 5ISZB 1WZMA 1PIIA 3P69A 4PCKA 3EB2A 4JFDB 3APGA 4PJDE 3BK0A 4JS3A 3URNA 1TJHH 4PJCA 2HRPH 1IM3A 4BY3A 4FK9A 4G9FE 5J89A 3UAFA 3V52H 3CUPA 2E9LA 4LF1A 2DL2A 4HKBB 2OB3A 4ZQCA 4IKIA 2P8LA 4ZSUA 2VSMB 3PE9A 4KBXA 3BZ4A 1J1OH 2PTZA 1XO8A 3DJ9A 3CV7A 4HWBL 1QG3A 3QUYC 2J7DA 4NJAH 1BVNT 1B54A 2WINA 4GINA 4BFJA 1KEMH 3ZBMA 3QJHA 5ESAA 4MFEA 1R47A 3Q01A 5C6PB 3GX9A 4GAAA 4L2LA 1ILUA 2MOQA 1XV8A 3IDUA 1R7AA 4JN1H 4HBCH 2CZ5A 4NVTA 5IB2B 1XIGA 3TH6A 2C79A 3SM0A 2ZADA 1HC1A 4G1NA 3T3MB 1EGJL 5IVZA 1K5NB 2D20A 1DQMH 2G3NA 4AW4A 1DUYA 3RIFF 3WDHA 3CFCH 4HSNA 1AKJB 1MKFA 1NMCC 2RDWA 3TBVB 6CGTA 3MW7A 2MQ0A 1F02I 2VMJA 3PWPD 4NQCA 2IFFL 1RXOB 4ILSA 4K2SA 4OQVA 4PTXA 1XZ0B 3OKEB 4OGYH 2P24B 2ROXA 2FTYA 1SJBA 3VFSB 1RULH 1GVYA 3PULA 2Z31D 1WOBA 5IK3A 5TFSH 2I5QA 4QS5A 3ROLA 2PMZA 3KYOB 4NOFA 3MYPA 4K2UH 3QZWA 1WQ5A 4PUKA 1TPWA 1KGWA 2DQDL 3AITA 2OR7A 4Z76B 4R9XA 4GRWB 1NGXB 2A3CA 2R0WH 1KN4H 4HZ8A 5T3XD 1XCQB 3KH3A 5M7QA 3PJLA 4K7PL 1C08B 3NJFA 4IQLA 1FV1A 3D4CA 4ZO7A 5EF1A 2J8UF 3GYCA 3KCJA 1NC4B 1XFCA 1TO4A 1MVUB 3AI0A 3QORC 4DBWA 5BQDA 4O1FA 4FX5A 1JTOA 2DQ6A 3SY1A 1RSYA 4S3KA 1Z8AA 4IU3A 4LRSA 3WEXB 2ATKB 4M82A 3HUJA 2J8GA 3DO7B 3UQNA 1CD0A 1RU9H 5EU5B 3TTEA 3BKJH 1KLFA 3WMQA 5GJMA 3FU3A 1X5AA 1H3WM 1NFIB 1F86A 4DCQB 4Y9PA 5EZJB 4H2HA 5JW4Q 5IDIA 3VIMA 3RTQD 1DHKA 2V2TB 5LNSA 5TGBB 2OP4H 1LD9A 2BNUA 4MZIA 4ZFOA 5CGTA 1H8SA 1CGVA 5FYJE 1ZBVA 4YDVB 4UF7C 1I9IL 3LN4A 1GTFA 1XP3A 4C5ZA 2ICEB 2PN5A 1IZCA 1O1HA 1F73A 5AKQA 1BXNA 5G4WA 3DHPA 1XAKA 4LSSL 1EXUB 2RMNA 4S11A 2ATPB 1PTAA 2B4CL 4QO1A 4PJ5B 2VQ4A 3UGVA 3IV8A 1CICD 1UOWA 4AC1X 5D1QB 1EHAA 5IVXE 2LU3A 3ATDA 4G82A 3CD4A 2CSPA 1I1XA 4NASA 2ZCHH 4AX6A 1QO3B 1OY3B 1A4LA 4EK7A 2YCLB 4PRID 2E6FA 4J1OA 1G87A 3BFQG 4UIKH 1TMQA 3QUZB 3D6GA 1T5KA 4FCHA 2A6IB 2IGFL 3W6MA 1IF2A 5BO0D 4L9ZA 5FI8A 3GW3A 3MWCA 3G6MA 5SV3A 2K9FB 2MPAH 4Z3GA 4L3CB 5AHMA 3KPLB 4XD3A 2QW5A 3GK8H 2OI9B 2GTWA 1IJNA 1A3LH 1R5YA 4JRYE 2CRZA 1I2PA 3KVLA 4TU1A 2IPKB 3MCG1 2GBUA 2R2EA 2CIKB 3LHYA 3MC0A 5KBMA 4GZIA 3PUUA 4HMEA 2X44D 4F1SA 4UYQA 1BP3B 2YD1A 2AJXH 2B7DT 3TTOA 3F3HA 1X4XA 5H4ZA 2DQEL 2E68A 3P0VL 4G71B 3H8AA 4YHEA 3KVDD 5IROD 3TMQA 1J8HD 1I9JH 3HLKA 4FXFA 2FX7H 5KYYB 5EU3A 4HJ1A 1R3QA 3OAYK 1PKNA 4K39A 4PJ8A 2EIZB 3QJZA 1TJ0A 4G2AA 4Q52A 4RQQB 3EBAA 3U7WL 2AK4A 5FUOL 2CLLA 1K8XA 3NRPA 3UG4A 2VABA 1B30A 3GHRA 2FIRT 2WXOA 1GVRA 3MUY1 3QUMB 1NPUA 1HHGA 3B37A 1MUMA 4JPWH 2IPJA 1PLAA 1UTDA 3NEXA 1WT5C 4R7JA 2Q76A 2OZTA 4Z7VE 3FTVA 3HZMB 2N7SA 5JXEA 1CLYH 3MOQA 1BQHG 2DQUL 1URZA 1PX3A 1XVSA 3ATYA 3QEHB 2OAAA 1GOIA 3S5YA 1V02E 4ACZA 4PTTB 1YYML 2PA6A 1MCOH 3OZKA 4K3JH 1UQSA 1RJQA 2WZHA 3EH3B 1JN6B 1WCBB 1U8IB 4I85A 3BW9B 5F72S 1DJHA 1W72H 1ZVSA 4NKIL 5DXWA 4AUUA 3KJ6L 3UH8A 4I9MA 1BA9A 1A6WH 5LBSA 1CD8A 3MA9L 5IFJB 4PG2A 4DNLA 1X1NA 1GOKA 3UIZA 4IOSA 4JN2B 3PWGA 1MREH 3N41F 1LQ2A 5GRVK 5IKCB 4GPVA 4HU8A 2WSKA 1MPAL 3MTXA 4U1MA 2K3HA 3V5KB 2YBGA 1POJA 1TWSA 1VFAA 1NFKA 5F6HI 5FCSH 4M5PA 3S2JA 3BCJA 3OU8A 1E4NA 1SXZA 1AZUA 5GQBA 3S97C 2HKFL 2AMUA 1RZ8A 3K1DA 3WK3A 1NDZA 1R46A 3U0WL 5J6GB 2RHGA 4FAAB 2R15A 1BXBA 1ZPTA 5MERB 1O6SB 5JLZB 2VGIA 1VHPA 3FFCA 3ZY7A 1CL7I 2W9LA 5C0BB 2FWUA 5DJDB 4AZHA 1TX0A 5DWUH 1Z9AA 3AMDA 4XPAH 4I9AA 3DIVA 2O26U 4S0TD 2AXGA 2EE9A 3HV9A 3WJJC 1MFUA 4LCWA 5I5MA 3T0EC 4B5VA 4XMLL 1D9KC 3P77B 3RAOA 3AZRA 2APSA 3DAQA 1KMGA 5LYRA 3KVQA 3SSGA 3MR9A 4N3TA 4FG4A 1L9PA 2FT8A 4KHXL 3UABA 2PLMA 5JH1A 4O2EA 5EV7A 2CCLA 3GSWA 1E0VA 5CPQA 3S5LA 4B5EA 3OXRB 3LHWA 1NWUA 5EU4B 3W07A 4Y8EA 4KO5A 2OXHA 3N9KA 4KW2A 1UWTA 1JNHB 3UTQB 4AVKA 4KWOA 3VH8A 1C16B 1QEXA 4H5SA 3QZ6A 1OYAA 4KK8D 3RILA 1M2VB 4MDJB 5HHQB 3W9EB 35C8L 2AJYL 2F8OA 5DEJA 4HCHA 3CQQA 3PDOA 4OLZH 2IQ0A 4HWZB 2V9UA 5EZOH 3NPZB 3UWYA 4POUB 2GIXA 3QUXC 4DBEA 2V5RA 3GB6A 4JQVC 4ECNA 1PEWA 3D08A 3JW7A 4G5AA 4I87A 4P0DA 2X7WA 3BT2H 5AC4A 3I02B 3VE0A 1GS6X 3PBYA 1OCWH 4IDJL 3VGDA 2MSPA 4NIRA 1LILA 2VCAA 3NFSH 4UBDD 1B3YA 3KGRA 5CSUA 2PP3A 5F4SA 4UINH 3MV7E 4ODTL 2WYIA 5EU9A 1CS6A 4AKPA 3G0SA 4NO5A 3V5HB 4F0SA 1ISXA 4GP8B 4PEKA 1W17A 4PJXE 5CZ0A 5I8OH 2QCNA 3KS5A 4L61A 2XFFA 3VD9A 3NJHA 1ZLUK 1J6PA 3HE7D 1DQWA 4KCWA 2L3BA 3E6FB 1T89A 5C7XH 4Z8FL 3FKRA 1HSAA 4XBGB 1HXYB 3APCA 3ATFA 5ABDE 2VENA 3UYRH 5SWUA 4UT6L 1XIWD 1SZNA 5EIQA 1J8VA 2NQ5A 2H0EA 2HG5B 2WM0A 1ZJHA 1IAMA 5H2ZA 3NSXA 4CW1B 3T2NH 5CSSA 4L4VA 1J5IA 1GOQA 4KK5C 4W7UA 3MJGX 1T66D 4DUWA 1ED3A 4UR7A 4NJJA 3D18A 1JPTL 4XVUC 2PF6A 4E9WA 2J1XA 4JANA 4QRRB 3SQOL 5AVNA 1LEGB 4H13C 1YCSA 2F54A 3STZB 2ZUNA 1AD0B 1A7NL 1TYJA 3S47A 2EXSA 4ZXBB 3C5QA 4GXMA 2Y9RT 3OA3A 5KBDA 2QBWA 4Q7IA