5HDRA

Crystal structure of a bacterial fucosidase with iminocyclitol (2s,3s,4r,5s)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
445
structure length
440
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a bacterial fucosidase with iminocyclitol (2S,3S,4R,5S)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords Alpha-L-fucosidase
total genus 158
structure length 440
sequence length 445
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5hdrA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5hdrA01
3WMBA 4D72A 3UG4A 4B16A 2EPKX 1W1YA 5BWFA 4FK9A 5I23A 2EXOA 1C91A 3QOKA 4CU6A 3D50A 3H54A 1TFVA 3IAPA 3PN8A 5C71A 4CVWA 1OGGA 3WF2A 2CHOA 3MSGA 4Z2KA 1R34A 3RILA 1E6PA 4UQEA 2OYKA 3VX0A 3DHUA 3RM9A 1XD0A 2EPLX 2WBGA 2PWDA 4NRRA 4PSRA 5GPRA 4JZ5A 1KXTA 3W27A 1TVPA 1OWQA 2YBUA 4AD4A 3VMOA 1HWWA 1YHTA 1EQPA 2JEPA 3L4WA 3A3HA 3ZJ8A 3D4YA 2XVLA 7A3HA 5I78A 4LQ1A 1SR0A 3WQ4A 1ZU8A 4IPLA 1JYVA 2VZOA 2XJ7A 1HXKA 3RMEA 3BLPX 3VNYA 3FHQA 3VD3A 2G8ZA 4KRTA 1ZL1A 4XUYA 2OWWA 2WC3A 1VFMA 2Z1KA 4RE4A 4MNLA 2W66A 2VUYA 3BAIA 2W62A 4W87A 1HKMA 4X9YA 2QPSA 2VZUA 4ATDA 2ZXQA 1GOKA 1J0JA 4MB4A 2ZX6A 4AYSA 1H11A 4DUVA 5A6LA 2J7CA 1BHGA 2VR4A 1R47A 3GXIA 2BY0A 1VEMA 1M53A 2CIPA 4OBSA 1B90A 4WKAA 4QLLA 2GK1B 4HA3A 4Q22A 2DQXA 4R27A 2D3NA 4UR9A 4B3LA 2D22A 1QBBA 1MVYA 2EEXA 3ZO9A 3PTMA 1LQ0A 2YKKA 2X0HA 7CGTA 4HA4A 1E6XM 2E9BA 3DX4A 1H5VA 2YLAA 2CBVA 1QPKA 1TMQA 2BFGA 1JFXA 4UQAA 1WDPA 3GXNA 2WCGA 3GH5A 1V0LA 4GI9A 3EJPA 2VJXA 3ALFA 1C8QA 1Q6EA 4PN2A 1QOXA 5M03A 1PPIA 3RIKA 1KCKA 1H3GA 3BCDA 2Y8VA 1PJ9A 4PMVA 2XUCA 1KFWA 1GOWA 2J7GA 4J27A 4KH2A 4Q7NA 2D23A 2DEPA 1JDDA 3AZRA 4J3VA 5DF0A 4OJYA 4P8WA 3WMCA 3ZM8A 3K4AA 3U5UA 3WNMA 3ZQ9A 2XG9A 2J7HA 3ARVA 5EMYA 1G0CA 2CESA 3NSNA 2DT3A 1ODUA 3W37A 1KWGA 1EO5A 3SCTA 3UG3A 2BVDA 2QHAA 2VT0A 3MS8A 1PIFA 4AIOA 1HP5A 3SUVA 2J7BA 2DPEA 2EPMX 5LA0A 1WB0A 3EJQA 1UKQA 4AD3A 4W8LA 3WENA 3WNOA 2AOSA 1BLIA 1UASA 5A6AA 1W1VA 3W26A 4IPNB 4CD5A 1DHKA 2VCAA 3WEZA 2CNCA 1H41A 4FF5A 1TG7A 2W91A 2WHJA 2F1AA 1GPFA 1UR0A 1JXJA 3AS0A 3SUUA 3BAKA 3DX2A 3S2CA 5ECUA 1V0NA 3MUY1 3CZLA 3PZMA 4GZEA 1GVYA 2EBNA 4AIEA 1BGAA 1BYDA 1DWAM 2X0YA 1KBBA 3FY1A 3PZIA 3EDDA 4CUCA 1Q4NX 3BUIA 1UKPA 2J75A 4CD6A 3LPGA 3GNOA 3WF0A 1WPCA 5A8QA 1HJUA 5ABFA 2E9LA 4HOZA 3W6MA 3CZNA 1B0IA 3PZNA 2Y4SA 3AXIA 2A3HA 1UR9A 1RP8A 2O9RA 1FP9A 1UUQA 3BSGA 1UD4A 2J78A 4TVDA 1ISYA 2IUZA 3WUFA 1GNXA 3PHAA 4RE3A 1GQIA 1CPUA 3AZTA 1B2YA 2F18A 3DX3A 1TUXA 1ZJAA 2XVPA 2X2YA 5BXPA 4JL2A 1WNOA 1J12A 3BAXA 2IXVA 3SUWA 1EDGA 1JDCA 1W1PA 1ZBCA 3HG5A 1MW2A 4FNUA 2VNCA 3CO4A 1HJVA 1MWOA 2ZIDA 3B9DA 3VINA 3NCOA 4P8VA 3KLLA 1I75A 5CPTA 3VIOA 1DWJM 2VZSA 3ARWA 2J4GA 6CGTA 3N18A 3WFLA 3RO8A 4DWSD 3WIJA 3CZSA 1HX0A 4DUXA 3VD7A 3T08A 1VIWA 4CU8A 4TX6A 2G3MA 5DFAA 2PWHA 3BAJA 4RL3A 2WHKA 3AS1A 4FLRA 4W7WA 4E4PA 4B15A 2VX4A 3A4XA 1UZ4A 1UWIA 3GNRA 3T2QA 1CENA 1I1XA 1QI2A 3EDEA 1DWGM 4M81A 3T0AA 1CXKA 1CXLA 3HMCA 3MO4A 1OBAA 1JAKA 3WQWA 3L4VA 1NWUA 2WYSA 1QI5A 4UNIA 2C7FA 2UY4A 4C7DA 1MW1A 2AMGA 3WDIA 2EPNA 3UR8A 2GDVA 5HXMA 1E6RA 3KZSA 3WD0A 4PMQA 2Q8XA 1NARA 3TV8A 3AMCA 1MW3A 1EH9A 3GXTA 4XB3A 5D9MA 1JZ4A 1UOKA 4PMDA 2OSXA 3BSHA 1V02A 3CZKA 2YLLA 4PMUA 3IK2A 2VURA 5IDIA 5FL0A 2GJXB 2EABA 1VAHA 2BVYA 3POHA 3TTYA 1EHNA 3GZAA 3BLBA 1QHOA 2WVSA 4UZSA 2F7PA 5AC5A 3ARXA 3BUPA 3OLEA 2D73A 3MMWA 1AVAA 1ISWA 1W91A 1IV8A 3VIMA 1C7TA 4AZHA 1IT0A 1UG6A 1EDQA 4D6CA 3CUHA 2XFFA 2PWEA 2A3CA 3VIIA 1CWYA 4U33A 3BMWA 3BAWA 1H09A 5CSUA 3T0DA 2VRJA 1R85A 4CCEA 3F5KA 3VDAA 3AHTA 1UA3A 4AD2A 1B3XA 4E8CA 1ZBKA 7TAAA 3D51A 3M07A 4PMNA 2ZUNA 1A3HA 4H8HA 1CLXA 2IXUA 1GOOA 5TD4A 4W86A 1E4NA 1Q6FA 4UFKA 4ZENA 1BYCA 3K8KA 4YN5A 4JKKA 2XN1A 1GZJA 3VNZA 3VM5A 1XGZA 3CZ8A 2O9OA 3NDZA 1TQSA 3E1F1 4P7QA 3UEQA 1I1WA 3VD9A 1BYBA 3LPPA 4HP5A 1DP0A 2J47A 5JIPA 4JFTA 3ARSA 3BVUA 4TXEA 1E3ZA 3LRMA 1HL8A 1ODZA 1UR1A 2V3GA 4L4OA 1HKKA 3EMCA 1ZB5A 1BSIA 3RJYA 4NXSA 4UQCA 5ABHA 1V6XA 1GQKA 4U5IA 4ZE4A 2VRQA 3WDJA 3U57A 3M7SA 5DO8A 1V6YA 2DDXA 3ZT7A 4OIFA 4AZBA 1JZ7A 2WHLA 5GQBA 4FMVA 1VJZA 4MAVA 1EXPA 3S6TA 4JL1A 1H1NA 4U3CA 5A6MA 2J8FA 2CEQA 2XM2A 4FLQA 4OKDA 4JFUA 3OB8A 2DSVA 4B9YA 2Y2WA 3VVGA 3EDJA 3A6OA 1PZ2A 3UCQA 1V02E 3AQUA 1X1NA 4P7NA 3LXAA 4YHGA 3VDBA 4KGLA 2YL6A 4AIUA 1FFQA 4UFHA 1V3HA 2WBKA 3L4ZA 4JFSA 3BAYA 1R7OA 3SCNA 4TVUA 3SCOA 1ISXA 4D6DA 2UY5A 3W0KA 1UHVA 2CITA 3RM4A 1CXFA 1BVNP 3MUIA 2WZIA 1HIZA 4TTUA 2E0PA 4LPCA 3LX9A 3AIUA 4QCFA 1UH2A 4HMDA 3CMJA 3WFZA 1JDAA 4HU0A 2YL8A 2YJQA 1W9UA 3MU7A 5GNYA 1KGUA 2BS9A 4QCEA 2WMHA 1O7DC 5A3HA 2AAAA 3LXBA 1J9YA 3MKKA 4S3KA 1UKTA 1WCGA 3AIVA 2ZWZA 5C8BB 4WLCA 2Y5EA 3DDGA 1TZ7A 1E4IA 1W2VA 3A22A 3WNNA 3OIHA 2D20A 1NP0A 2J7DA 4P7LA 5D8ZA 5I6SA 3WEMA 4UFJA 3SCUA 4CVUA 3TTOA 1JL8A 4R5EA 3OA5A 4H2CA 1QI4A 4PMYA 3S5YA 4CD8A 2B31A 3CIVA 3PTKA 4D6EA 4HU8A 5IHSA 1C8YA 5E70A 3NIYA 5CJ5A 2W92A 3VIHA 2Z1SA 1C92A 3S5ZA 3WQ6A 5I79A 2OYLA 2BHUA 1NQ6A 2IGTA 3A4WA 1WZMA 2DIEA 4HZ6A 1B9ZA 1MYRA 1UD5A 1F4AA 1EQCA 4W8BA 3SCRA 1BVZA 1GOMA 5FKYA 1QX1A 5A2CA 3OZPA 3A23A 3CUFA 3DYPA 1CGTA 1BGGA 1LG2A 1E55A 5C70A 2YFOA 4F66A 1QVBA 4WKHA 2BV9A 4JIEA 1PBGA 3K8MA 1UWSA 2D24A 4MB1A 1EOMA 3HG3A 1HP4A 3TTQA 2WPGA 1NWSA 1AMYA 3QGVA 3VIKA 1MFUA 5DMYA 4GQRA 2MANA 4D71A 2FH8A 2WVVA 2XGBA 1UD8A 2O92A 3CC1A 2G3NA 4J3SA 1DWFM 2VCBA 1AQHA 1CZ1A 2PWGA 5CLTA 3H55A 1JIBA 5I24A 1YQ2A 4AZ6A 4F8XA 1XCXA 4E2OA 2JFEX 1XSKA 3GNPA 2PB1A 1Q6GA 3NUKA 1HJWA 1AQMA 3ARPA 4CN1A 3SEPA 5A2AA 4WK9A 3WY1A 2F61A 3DX0A 5AC4A 1HT6A 3DYOA 3VMNA 3T0BA 5CSYA 3POCA 3SUTA 1WAWA 3N04A 1W3KA 1KCLA 3HN3A 4NSBA 2QF8A 3K1DA 1LG1A 3CZGA 3AMLA 4JFWA 4AZIA 4DM1A 3G6MA 4PTWA 1V6WA 5GNZA 2VOTA 3WH9A 3OGSA 2X2HA 6TAAA 3GM8A 1OD0A 2YOCA 3DECA 3KL5A 2UY3A 1MW0A 1ISZA 3BH4A 3FAXA 3ZSTA 2FGLA 5ABEA 4YHEA 3APGA 1GORA 5CPQA 4HA1A 2FHBA 2ZXDA 3IANA 3CUGA 2YFNA 5CQ1A 2OSWA 4W7UA 3IGUA 4UZUA 4WKFA 4Z2LA 3DC0A 1ITXA 2ZICA 4OBRA 4OOZA 5A6KA 1V03A 1V0MA 3WH5A 1PEZA 1XC6A 2YA0A 4LYQA 2XN0A 4M24A 3WD2A 3ZT5A 1WZKA 5LA2A 3ARZA 3VIGA 1J18A 2W5FA 3MI6A 1UWQA 2JIWA 4PTMA 2QV4A 5FIPA 1E73M 1LL4A 3AJ7A 3W81A 3BUDA 3VIJA 1E0WA 4W5ZA 4D1JA 3W6LA 3WF1A 1E71M 4FNPA 1M04A 1JD9A 4DO6A 1O6IA 1QNPA 1KQZA 4YPJA 1TQUA 3U5YA 2ZUMA 5CGMA 2ZE0A 3KE0A 1XCWA 2D0HA 1QW8A 3AYSA 2VVSA 3PZQA 1ITCA 2EQDA 5DT5A 1JG9A 1JXKA 3BCFA 1FH9A 4P7RA 1WDQA 4J7RA 2CCRA 1OIFA 2BVTA 4W93A 3MSDA 2J77A 1RP9A 1XYFA 2E9MA 2RGLA 4FLSA 3A47A 1JZ3A 4GQQA 4PCTA 4CCCA 2WMIA 4V28A 4F79A 2WSKA 2Y8KA 3THCA 3M46A 1C8XA 2OSYA 3WQVA 4ACYA 4BA0A 3NSXA 2DH2A 1XYZA 2WXDM 1B3VA 3UG5A 1E72M 3CBWA 3NDYA 2VMFA 3WDQA 3AFBA 1G01A 3TP4A 4U3AA 4BQ4A 1HNYA 2X2IA 4QAWA 3DYMA 4AMWA 1FOBA 3GXMA 3AYRA 5DT7A 1W32A 3SCWA 5D8WA 2EPOA 1LWJA 3GBEA 4NZCA 2A3AA 4NX0A 4HPGA 4GZJA 3FN9A 2F1BA 4IM4A 3AHZA 4DO4A 4TOQA 3VSTA 3AZSA 3PZTA 3LXCA 3ZSSA 3B9AA 1B31A 4PMOA 2YA2A 1LJYA 1E70M 1X6LA 2NSXA 5E0FA 4UQ9A 2X05A 5JBEA 1E0XA 4MJ2A 3AXXA 5BRPA 3WDHA 3VDCA 4OGZA 4ATLA 3VGBA 4ZXOA 1H0IA 4ATWA 2QPUA 1E1EA 3WKZA 2FDMA 3ARRA 1BPLB 3L4XA 1E6NA 5D9OA 4LXFA 4MNJA 4JAWA 2TAAA 5D9PA 2PF0A 1SMAA 2CPUA 5CGTA 4GIAA 1IZJA 2VQTA 3AI0A 1ECEA 3IJ8A 1MFVA 2D0GA 1JYXA 3RPMA 3CUJA 1M7XA 4P7OA 1QI3A 1W9DM 2UY2A 4DWSC 2BHZA 2WCSA 2XHYA 2XPKA 3WY2A 4EAMA 1TCMA 2VCCA 4M8UA 5FCZA 3WF3A 2VR5A 2DH3A 1VENA 1JFHA 1XRVA 2XM1A 4Z2HA 4F9JA 2GVYA 3RJXA 1EIBA 5FOOA 2QLYA 5M3WA 1VJSA 5BCAA 2X8RA 2GJXA 1N82A 5A94A 3SCVA 2BY1A 1QNQA 1TQTA 2BXYA 2JALA 2BY2A 3UR7A 1WZAA 2G4FA 2WKGA 1NH6A 1UQYA 2O9PA 1WO2A 3A4AA 2DT2A 4UFIA 5BXSA 5HOSA 4U2YA 2GDUA 4QLJA 4PUEA 4AD5A 3VGDA 3W25A 1VF8A 1E3XA 3OGRA 2ZX8A 4PCSA 2OYMA 3EJTA 3ZR5A 4DO5A 3W82A 1H0GA 2GJPA 1GUVA 4H41A 5FL1A 3HG2A 1W9VA 2WSPA 3NSMA 2XIBA 1CBGA 4U31A 2YDRA 2PC8A 3O2LA 1QWNA 3JUGA 2D3LA 4PRWA 3ARQA 1LLOA 5IFPA 1SMDA 4HOXA 2J74A 4AW7A 4AZCB 5IHRA 4J3TA 1BG4A 3GXFA 4UTFA 3FW6A 2ZX5A 3K8LA 1KXQA 2C8NA 1B1YA 4MADA 5BXTA 2FHFA 5BRQA 1L8NA 3WUGA 4ZEPA 2ZUWA 4A4AA 1H4PA 3F4VA 1NP2A 3II1A 2XGIA 4MTVA 2OW6A 4PYSA 3VIPA 4U5KA 2CYGA 4RE2A 4AD1A 1DTUA 1K9EA 4GPNA 5E09A 3GXDA 2DSUA 5KZ6A 3WY3A 3K46A 3VSVA 2V5CA 4UOJA 1PX8A 3VKKA 1U33A 1SYTA 4KMQA 3WUBA 1CECA 1BFNA 1J01A 2EAEA 2OWCA 4GKLA 3AS2A 2WVTA 1JZ5A 3QR3A 5JBFA 2ZUUA 4AD0A 2FE0A 4AZGA 4AMXA 1LWHA 2F7OA 4M56A 4GI8A 2W63A 4PSPA 3VDHA 3OG2A 1GOQA 1KTCA 4JHOA 2EJ1A 2A3EA 3L2LA 2VC9A 3ARTA 1E43A 3MV11 3WEOA 3QHMA 3WNKA 1XSIA 1QWUA 1E6QM 4WSJA 1FHDA 3WUEA 1WE5A 4ZE5A 2GSJA 2WZEA 1FP8A 1JZ6A 1E6SM 6A3HA 3A5VA 2D0FA 2QMKA 4J28A 3O9NA 1R87A 1V3MA 1UD3A 2WMKA 4CD7A 1JYWA 3AIEA 1E40A 1OSEA 1R86A 1ZBWA 2GFTA 1ZJBA 2VX6A 3MUZ1 5IFTA 2WB5A 2NT1A 1CTNA 1E4MM 2VTFA 3K4DA 5HPCA 5I5RA 4W85A 4W5UA 3F5JA 1GCYA 1NWTA 5EFDA 2WLYA 3NYDA 1K9TA 2X2JA 3GH4A 1KXVA 1UWUA 4QFUA 3LRLA 3TONA 1MQRA 3WF4A 2XIIA 4MAZA 1R75A 4AY1A 3GDBA 1Z32X 2ZUTA 4CD4A 3VMPA 1VFUA 4H8VA 4BS0A 3ZT6A 1HKJA 3SCSA 2ZXBA 3ZIZA 2ZUSA 2YA1A 3ARUA 1D7FA 3WD4A 4UFLA 2EO7A 3CZEA 4OOUA 1BQCA 5IXEA 3L4YA 1GONA 4D6FA 4AZ5A 1MQQA 3SUSA 4P8UA 5I0DA 1V6UA 1S46A 3HZ3A 1R7AA 2WWDA 2WK2A 1HJSA 2WMJA 4MDOA 1D3CA 2GJRA 2ZX7A 5LYRA 3W4RA 1JGIA 3ALGA 3IJ9A 5FD0A 4LYRA 1QNSA 4BCEA 3AIQA 3WH8A 4DWSA 2RGMA 1WDSA 1PZ3A 1P6WA 1K9DA 2W67A 1UR2A 4H8UA 4MNMA 4ML4A 3WDPP 3OBAA 1LF1A 4UQDA 4WJXA 3BVXA 2E8ZA 2F7QA 3WDRA 1US3A 1ZBVA 1WP6A 1J0ZA 4W89A 3W38A 4X0NA 4DUWA 4KRUA 2WAGA 1UH3A 1VFOA 3BUQA 4BF7A 1JYNA 3CLWA 4D6IA 1K9FA 3WMSA 3PZGA 3ECQA 3WBAA 1QI0A 3W53A 3BC9A 2DGAA 1U2YA 4B9ZA 3CHFA 1E4LA 3VPLA 4AMCA 3VX1A 2V3EA 1O7AA 2DSWA 3AIWA 1UR8A 4MB3A 2G3IA 1C7SA 4PMXA 1B3YA 4HZ7A 2WHMA 1E1FA 1C90A 5EBAA 2W61A 4BZYA 4PMRA 1UD6A 4Y7EA 4JCMA 2WZHA 2PBGA 3EJUA 2OW7A 2VX5A 1KR1A 1LL6A 5A6BA 3CHCA 3B8SA 5AYBA 4UQBA 2DIJA 2WNWA 2VRKA 4AISA 3HU7A 4GXPA 1KTBA 3VM7A 3ZJ6A 1RPKA 4NRSA 1DWIM 1TA3B 3EJRA 5DEZA 3KLKA 4UOZA 3TA9A 4D1IA 1NOFA 1OGSA 1E9LA 1TVNA 3AISA 3THDA 5E1QA 4EKJA 3BGAA 3BVWA 3AHVA 5HDRA 1J11A 2FGZA 2YL5A 1CGWA 1GJUA 1K6AA 3VSUA 2XFYA 4H04A 4PTXA 4CCDA 1GQLA 1VB9A 2YL9A 3AMKA 4HMEA 1J0YA 1FH7A 3CPUA 3GBDA 3LRKA 1JI1A 1GHSA 1OT1A 3HG4A 1JF5A 4JFVA 3KL0A 4PEEA 2WC7A 2WLZA 1W9BM 1UA7A 4W88A 1VBUA 3ZJKA 2PI6A 2DT0A 3I3EA 2JIEA 2E40A 3ZOAA 2YBTA 4BQ5A 3T2PA 1F4HA 4AWEA 4MB5A 1EHAA 4Z2JA 1E0VA 2JE8A 1UWRA 2BHYA 1XSJA 2F7RA 1B3ZA 4ACZB 3AOFA 3PZOA 3SCQA 5HNNA 2XSBA 1JF6A 4M80A 3B9EA 4LYPA 3RM8A 4M29A 5A8OA 1M03A 4ZXLA 3T2OA 3CUIA 4NI3A 5E9AA 3OGVA 3UETA 4FNTA 1VBRA 2O9TA 4GZIA 4AZCA 3N9KA 3VGGA 3WH6A 1HTYA 5M17A 4UCFA 4N42A 1JZ8A 1U30A 1NM9A 4C7FA 3EYPA 2YDSA 2NW0A 2CERA 2CKRA 3FHAA 1CDGA 2J25A 1W1TA 5BROA 2YDQA 1Q6DA 3WBEA 3WL0A 3GH7A 2ZUVA 2D1ZA 2CBUA 3ARYA 3VGHA 3N1AA 2WW5A 1OINA 1JNEA 4N0RA 4PTVA 3RCNA 1V3LA 4OUEA 3EDKA 1LL7A 2J7EA 1CGUA 1HF6A 3WH7A 2CETA 1E5NA 3MANA 3SURA 3ZJ7A 4QDMA 1FFRA 1EGZA 4D6JA 1EDTA 1HXJA 1QNRA 5CPSA 3WN6A 3KL3A 1GJWA 1H2JA 1KR0A 3WD1A 2E3ZA 2ZXAA 3LPFA 3CH9A 3CHEA 1TA3A 4W84A 1HJXA 3I3BA 4EK7A 1B3WA 3BUBA 1UR4A 1BTCA 2CHNA 4NZFA 5A2BA 4M82A 4GI6A 5A6BD 4K68A 1GQJA 4H7VA 5AYIA 1ESWA 3U7BA 1BF2A 2Y24A 2XVKA 2VVNA 1HL9A 1NOUA 1CNVA 3AMDA 2WC4A 9CGTA 1HVQA 3OLDA 1TQWA 1G1YA 3CGTA 3ZMRA 3L4UA 1V08A 3U7VA 3VGEA 1M01A 2CKSA 1XHGA 3VIFA 1D2KA 5BYWA 5JIWA 1UYQA 3CZJA 5GNXA 1HKIA 2CBJA 4GO9A 1OB0A 1L0PA 2VL4A 3BVTA 4FNQA 3AIRA 3VO0A 2VZVA 4DM2A 3WNPA 1QBAA 1G94A 3IAQA 3VTRA 4U2ZA 2QMJA 1CGVA 2F8QA 4S3JA 4J3UA 4AEEA 2G3JA 4WIWA 2J8GA 1QW9A 3LMYA 2WWCA 3CTTA 2CBIA 3H53A 1R33A 1JD7A 2ESCA 3N12A 1Q6CA 5E0CA 3MMUA 1KQYA 3WL1A 2OLHA 4A3HA 1J0HA 3VGFA 4BQ3A 3AIBA 4JHZA 4C7GA 3HJEA 1X6NA 4HTYA 4URIA 4OZOA 1W3JA 1HVXA 1W9XA 1VRXA 2VX7A 1UKSA 3NJ3A 4WSKA 4V27A 2HISA 1CGXA 1KBKA 2BXZA 3W29A 5CZKA 3G6LA 1NOWA 5F7UA 1KWKA 2ZX9A 3QHNA 2E8YA 4XZWA 3D4ZA 1CXIA 3DX1A 4CGTA 1AQ0A 3OLGA 4PBGA 3O6AA 1JNDA 2J7FA 1WDRA 4HPHA 4CN6A 4AYGA 4W7VA 1OGBA 3BVVA 1V0KA 5LA1A 1E5JA 2UWFA 3AICA 4GO8A 1A47A 4KWUA 3TOPA 1RH9A 2FYVA 1R46A 3EMQA 1G5AA 3AHXA 4TUFA 3VILA 1G9HA 4HZ8A 4QP0A 4AZ7A 1PX4A 1E56A 2V3FA 1DEDA 3N11A 4ZFMA 4J3WA 1BG9A 1GW1A 1WZLA 2BNJA 3WY4A 3CV5A 3CHDA 4X0VA 3LPOA 2WCAA 2JF7A 1FH8A 1OCQA 1HN1A 4D6HA 5M5DA 1GHRA 1TR1A 1T0OA 3FAWA 4KGJA 2VZTA 3FXYA 5E6YA 3I3DA 4LGXA 1UQZA 1E6ZA 4EE9A 1NWRA 2WMFA 4V2XA 1QNOA 2WVVB 3IJ7A 5E6ZA 4XZBA 4AXNA 2XTKA 3F5LA 5EFFA 1FHLA 1CGYA 4E8DA 3WELA 2XSAA 2X09A 3VUPA 3WNLA 4NXKA 5AY7A 1XH0A 1PX3A 2GK1A 3VD4A 4PMZA 1BAGA 4TX8A 4B3KA 5EB8A 4UFMA 1W9PA 2XN2A 8A3HA 4IUGA 1CXEA 1XH1A 4DWSB 4CU7A 5CLWA 5D9NA 4MJ4A 2V3DA 3SCPA 5I77A 1IZKA 1C3FA 4MDPA 3L4TA 4CKQA 3QHOA 4TTGA 3PZUA 3OZOA 4AC1X 2VO5A 1Y7VA 1W3LA 3MUAA 2HVMA 5A8MA 2ZWYA 3WSUA 1OM0A 1V6VA 4NF7A 2JEQA 1UH4A 1XD1A 2VQUA 3PZ9A 4W8AA 3BLKA 1W2PA 3KEHA 2GUYA 3DHPA 1V3KA 4XV0A 3EMZA 3MV01 2NT0A 5ABFB 1MXDA 2J62A 2G41A 1VEPA 1PIGA 1OIMA 3L2MA 1KGXA 3ZR6A 3AXHA 4UOQA 3W28A 4M1RA 5A8PA 3PZVA 3VU2A 3WQ5A 1H49A 5A6SA 2V5DA 1CIUA 1TE1A 3FNDA 5I3DA 1FA2A 1OT2A 2YIHA 3WD3A 2WANA 2DT1A 4JKLA 3M6DA 1EA9C 1V3JA 1JI2A 4P8XA 1VEOA 3D3AA 1CYGA 5I2UA 4J3XA 3J7HA 2DSKA 5A1AA 2V38A 5A69A 4BQ2A 5A8NA 4FNRA 4WF7A 2XWEA 2FH6A 3BXWA 1QHZA 3AS3A 3N13A 5JBDA 1OD8A 5A95A 1SZNA 1US2A 4JKMA 4AEFA 4LX4A 2X1IA 3EJSA 5CXPA 5HPOA 1ZS2A 2CXGA 1CEOA 4IISA 1KXHA 4EANA 3OLIA 4FLOA 2DSZA 2WMIB 2WM0A 1W3HA 4D6GA 4FNSA 3GTNA 3N15A 5KEZA 4QLKA 2JF6A 3UERA 2D2OA 2FHCA 1CLVA 1B30A 3A24A 4NZJA 2EACA 1RD6A 4PUDA 4CN4A 3CMGA 5BXRA 2J79A 1SFSA 3KWXA 4A3YA 3N17A 3AHYA 4JCLA 1XV8A 3GYCA 2ALWA 4Z2IA 2WMGA 3D52A 1R8LA 1J10A 2E4TA 2EADA 1C93A 1J0IA 3MMDA 1MXGA 1BYAA 1QHPA 1MQPA 3QOMA 1UKOA 4TVCA 1GVIA 1UD2A 1UWTA 5CG0A 1XH2A 5ABGA 2C0HA 1UZ1A 3EBVA 1HJQA 1KGWA 3VD5A 2XWDA 3T09A 2A3BA 3DDFA 1ISVA 4Z2GA 1WKYA 1KB3A 1EOKA 8CGTA 4XX6A 1PAMA 2XFRA 5D4YA 2OWXA 3RDKA 3BMVA 3W24A 2XYLA 2ZOXA 5A6JA 2XVNA 1JZ2A 1EO7A 3AROA 3PTQA 3A21A 4HOWA 4GINA 3SIMA 3AMGA 3D5HA 3VOCA 2WKLA 1TQVA 4MPKA 1DWHM 2F2HA 2PBOA 4MNKA 3TTSA 4ACZA 2XVGA 4HMCA 1GOIA 1VFFA 2WVUA 1JAEA 1J0KA 1PS3A 3GXPA 3PBGA 3WQ8A 2PWFA 2BY3A 4F9DA 1V3IA 5JUVA 3EDFA 1CXHA 2VI0A 4L4PA 5HBFA 2W4XA 1E15A 3UESA
chains in the Genus database with same CATH superfamily
4C65A 5C97A 1JNHB 1MJ8H 3LKRA 3V10A 3P11L 3PP4H 3UG4A 1M9HA 3TFXA 1F11A 1Y0LB 2D7QA 3LH8A 4N2DA 4EDXA 5A2JH 3WTXA 3LHVA 5BWFA 5I23A 3WJSA 3UGEA 5CZVH 2PYFA 3T0EC 1C91A 2NUPA 2WMPA 3KRBA 5LDSA 1I4FB 4H26A 4R96B 3NTYA 4ROQA 1TFVA 3B2UD 4G9DA 3MUGB 5C71A 4CVWA 4NIRA 4GYBA 3V52H 5BV7H 1R34A 2WUBL 3T04D 3V6OC 1YYAA 1XGRA 4HHPA 4UQEA 4KBXA 4HEPG 2DWXA 3NSJA 1WS8A 3ARED 3B2VL 1SEBB 3OQ8A 4QXVA 5DLCA 1S2CA 2XACC 3EX6A 1NDGB 4NGHL 4WUUA 5EU9A 2DBLH 3LNPA 5AHIA 3BJ91 1U93B 1RZ7H 4M8VA 4LT9A 2DKUA 3Q48A 3UJIH 1RK1A 1KXTA 4NB7A 2HWGA 1IKNA 4JPWH 3ZIYA 2MMXA 2WZPD 3M5ZA 3GRWL 4TU1A 3FOKA 3K3QA 4LW7A 1ZA6B 3HI6L 4OB5H 5DJ6A 2V5TA 1BYPA 3NH7H 5FYJU 1OYBA 3A3HA 5HVWA 2G60H 3ZVIA 3KPTA 4KKLC 3L3GA 3O9WA 4K5MA 4WHYH 3D4YA 5AVTB 7A3HA 3UMNA 1U6AL 2WXLA 4HZLA 3SBRA 1LD9B 4Z7WF 4G56A 3WQ4A 2JNZA 1ZU8A 1LGVA 3G6AB 3BIAX 4KRPD 1PKQA 3BDYH 4BD4A 4NQUA 2XSXA 4L2LA 5AAWA 4ODUB 3AYVA 4PJXB 3T3MF 4GSUA 4S39A 1OCNA 1PTAA 3IN0A 1FZOA 4S1DC 1XB8A 3AABA 5CWSB 1X5KA 4PA8A 2X4NB 4P2OA 5HMDA 2G8ZA 4KMLB 3O15A 2VSCA 4LASL 3DMMA 4AE0A 2A74A 4YJ5A 5CEYA 5JPMB 1VFMA 2Z1KA 1U8PA 3BP7A 2NCMA 3DV4B 4N22A 3MBEB 5DHYA 3SJVA 5ID1A 3PIQA 1GJIA 1OFOA 4TMCA 5CNHA 4JD4A 2I07A 1KBVA 2VUYA 3ISRA 4LHUB 2W62A 3C56A 3NPWA 4W87A 2NXZD 3MMEA 1JCXA 2J8UF 3ZTJG 2VZUA 3BIKA 3LIZH 4X6FB 3V0IA 2G97A 3N6QA 1J0JA 3QXDA 2ZX6A 3P4OA 4MB4A 1OP3K 1WYIA 5JH1A 4O2FB 2YRPA 3OVQA 3ZQWA 4GEIA 3DBXA 1YNTB 4G9FE 4DKTA 2CBQA 3SPVA 1VQTA 1ZRUA 4H83A 1DVFB 1VR6A 1H5BB 5E6ID 5I00A 3QYCA 1BEXA 3REQB 3KPPA 3R0KA 3MACL 1M53A 4UINH 2CIPA 2XN9D 5FFGA 4QO1A 1XGRB 5IJKC 4JQIH 2X89D 4PCKA 3MXVH 1IIHA 5E7FA 4GW1B 4PJDF 1Q2SA 2HH0H 3OQEA 1R6VA 5DMIL 4F91B 1F1GA 1GT8A 2DQXA 3HF3A 4MOZA 4X22A 2D3NA 1RUPL 4BFRA 4YHYB 1XPGA 3H2AA 4FEZA 1RIUL 4ZFQA 4B3LA 4O2CB 2D22A 3JWNG 4OFIA 1XAUA 2F38A 5HR6A 2YKKA 3RY4A 3UR5A 1SW7A 3HCVB 4QYOB 3G5YA 3DX4A 2HTMA 2BRRH 3LZLA 2WLLA 2WQWA 1J5SA 5JHDB 3LY0A 1QP1A 1VGKA 2JJUA 3CT7A 4RPQA 4YR6B 2CBVA 5HI3C 4H04A 1WQ5A 4NN5B 5AVQB 1YECL 2NNFA 1A50A 1XIJA 3DZ1A 3GH5A 3TLQA 1UUSA 2W8CA 1R2TA 4PRID 4XP9L 2ZA2A 1V0LA 1M57B 2R0ZL 4GI9A 4NHCH 5LG1A 3TBTA 4NRYA 6PAZA 1XZWA 5FECB 5JIIA 2XIMA 5I06A 4UF7C 4KQ0A 3DG7A 4FYTA 4BWLA 5M03A 4JY4B 4PJHE 2B4CH 4KROD 1RJRA 2RDUA 3TH6A 1H3GA 5DRWB 2PLCA 4DLFA 1PJ9A 2R2BA 2F74A 3OXRA 3FT4B 1I9CB 1NFBA 5H8DA 3C6EA 4QRSB 3QZWA 2NNAB 2PZNA 1X1ZA 3LERA 1UJTA 2HRWA 4NZ1A 3D39D 1IJNA 3NJJA 2H1XA 3BPNC 3M0IA 1U3HB 5BUPA 4CMMA 3GKFA 1TPFA 2JQMA 2D23A 4NJKA 2F08A 5AECA 4FKHA 1M42A 5BJTB 3IGKA 1JDDA 5DF0A 3VXMD 2QYGA 3JS3A 3FYIB 2A4EA 3V18A 2IOOA 3SE4C 4AQAA 1AL7A 4P8WA 3I6GA 2P7TB 3OAYK 4YDLB 3Q6GL 2PLMA 4UMCA 3ZQ9A 4TULL 2XG9A 3CL8A 2VISB 4R97B 3CPLA 3I9GH 1TIMA 3PV6B 4EWJA 4UV4L 4JY5H 1KPVA 5GS0H 2A9DA 1XGUA 1IB5A 2Z4QA 2FWLB 4PBDA 3OG4B 3U4BH 3LSOA 3UAEA 3VI4E 2VWTA 4O12A 1T1WA 1HSAB 5L4MA 2WWNA 4AIOA 3KVPA 1XGPA 2CA3A 5F9OL 1XXDC 1M7IB 1KTLA 1IM3B 3L6FA 4QHLA 2AQNA 4AKPA 1HP5A 2QVNA 2X1UA 3O1NA 3VKAA 1UC5A 2YK1H 1PF3A 1AW2A 5LA0A 2OOGA 4FO4A 4LPWA 1OF0A 1TTBA 1PQZA 4N2LA 4XNZB 4PY8J 4S10A 2L7EA 4UYQA 4X6DA 1AJ7L 4XRCB 1KRAC 4O53A 1NMAH 4H13C 3WENA 1ZLUK 4K7PH 3GDKA 4HD5A 3EADA 5JDSA 4MUPA 1IT9L 4NOFA 1W1VA 1UJ3C 4M48L 4DZ8B 5CZRA 3DO7B 1NC4B 5L8KB 4ETQB 1NF0A 3WEZA 4XZ9A 1BJ1H 1Z9SB 5B8CA 2CNCA 4N0FB 2VW6A 6REQB 4IJ3C 1A9EB 1QFWL 3AS0A 1UR0A 2IPWA 3SUUA 2OU4A 3S2CA 1LK2A 4R3UA 2VDPB 5JW4M 2VWEC 2FD6L 3LH9A 5E1GA 4CRPA 1ZVYA 2Y2TA 1BYDA 1U3YA 5HY9B 2X0YA 3LNIA 2ZZ6A 4N0UB 2FZ9A 3I7QA 3L65A 3LN3A 3PZIA 1RZ8A 2HSIA 2IQ9L 3EDDA 5DRZB 5SX5H 4HVBA 5I6OA 4YDJB 5ISZD 4HJEA 1UKPA 3M0JA 1WS7A 2WW8A 2E77A 2APXA 2Q8ZA 1YUHA 4TTUA 6REQA 1YMHA 2N7BA 2EUWA 2J75A 4CD6A 4R96A 3B9OA 3A6BH 3I02A 1OW0A 4ETQA 3CV7A 4R6UA 2PTZA 4YMPA 5JMRA 3VZXA 1KIRA 1OZUA 1NFKA 1WPCA 3MKVA 2CHXA 1HJUA 1OGTA 2PCFB 3HE7C 4Z7NB 3M41A 4XKYB 4U0QB 1NTDA 4NS0A 5FYKE 2E9LA 4LCRA 3NOIA 3PZNA 1MEIA 2PURA 4P2OD 4AZUA 4F8OA 3BPCA 4ODSH 3C60D 5FLVA 1MVUB 2QADC 3HZVB 3V5KB 2Q71A 5C9UA 1RP8A 5F7FA 4PUUA 3LRSA 1FP9A 1ECQA 1FL3A 4AH7A 3LH2L 3RZCA 1ISYA 1FE8L 1UB6A 1HE7A 4HEMA 5E5MB 4WFED 5AZ1A 1GC1H 1GNXA 3F5WB 4F9LA 3F7YA 1NEYA 4XVUC 3IRCA 1RPQA 3A4FA 5KYWA 2GCYA 2GT9B 4GSQA 1IGIL 3AZTA 3DX3A 2OJ1A 1X4YA 4KFMA 1RH8A 3S3DB 1WAAE 4PGLA 1GOHA 1OB1B 5BVPH 2C19A 2RH9A 2XWBA 4Q14A 5EU6B 2XVPA 2Z1VA 4YHNA 3INPA 5LN4A 3K2UH 2IDFA 4L4VB 3F12B 2NY7L 5C0AA 3ABLB 4WW2A 2ATMA 3LQLA 1LBMA 1H8LA 1EDGA 2AL2A 4MMZC 1U8KB 3PBWA 4AX3A 1TT6A 3HPLB 1EHLL 3IDXH 4FNUA 1FDLH 1DVFC 4GRWF 1X6UA 5JPMA 1QACA 1HL5A 4F15C 2H90A 2P8PB 1DUZA 4XCNB 4DPCX 1EC9A 4BEIA 3HW7A 4QG9A 2CUHA 2NW2A 3QK0A 3JSSA 4LO9A 3P77B 5E5UB 5C0AE 5CR1A 2P5EA 1LE5A 5JHMA 3B9DA 2CLRB 3MX0A 1EEZA 5SWQB 4M1BA 4X3ZA 3VINA 1TNNA 3NCOA 1HH6B 3QH3A 4GCAA 3EOEA 3T2NL 3X3FH 2CGZA 5LVEA 1GGYA 3PHSA 5ESAB 3PGCB 2VZSA 3W72A 1FFNA 1NMBH 1ODAA 6CGTA 5IOPB 4C58B 1KB9K 2CZ5A 2B59A 3Q2VA 4J4PA 3GRWA 1G1OA 4G1KA 3MCYA 1ZT1A 4ICCX 4PWEA 4KNSA 2HG5A 5TE4L 1CMOA 4QRRD 4O4YL 2AQ3A 1HX0A 5F88B 4Q8WA 1VBGA 3LIUA 4XPHH 1VSCA 4DUXA 4PB3A 2V5BA 4CU8A 1JPEA 3M8OL 2V5MA 3Q6GH 4G82A 2X9YA 1TPC1 3BSMA 3SCMB 3CV1A 4GQ0A 4DJED 5H37G 1N5YL 3TSMA 2W0FB 5IQMA 1R0MA 1EEZB 3KLSA 1UUOA 3FQTA 3TN0C 2F8OA 3MLRH 4NY2A 5DFAA 1MCOH 4IMLB 1J79A 1TQBB 2Y1VA 2YAEA 3BAJA 4D2JA 2CK0H 2QQKL 2NX5B 3SECA 1M71A 2VXQH 3AS1A 2R69H 1KEGH 1I2QA 3CYVA 3KS6A 2E5DA 4NFBA 2VX4A 4B15A 1WFIA 3L5IA 4X7EC 3SQSA 3SN0A 1UWIA 1N19A 4UUIA 1T1XB 1CENA 1GK8A 4TNVF 1BQHB 4HJTA 4WTXA 4ZI8A 1I1XA 1BIIB 1RHFA 3OKLA 5E6SB 1D7KA 4I6KA 4ALAC 4PLNC 3E12A 3PAVA 3LSBA 1OIOA 4L3CA 5BZWA 1J1PH 1XQKA 4LNYA 2PRMA 2VQ4A 4N0YL 1TZIB 4QRRB 4MKNA 4UYPA 1CXKA 4GEJA 2NDGA 5DEFA 3T9PA 4GUGA 1XIBA 3T65B 4CNOA 1FE8H 3UBHA 4EEEA 3ETTA 4LFYA 4JQXC 3KAAA 4OT1L 3L4VA 1FYHB 3D4CA 4B9FA 2PP1A 4O11A 4QITA 4MX7A 2JCCA 3T8VA 3FA3A 3ETBF 5C0RH 4QNPE 5IROD 3BPLB 4WO4A 1FCUA 3NPVA 1DJXA 1KIQB 2C7FA 3MNVB 4LU0A 3D08A 5EV7A 1EK3A 4AEOA 1MW1A 3W0WD 4C7DA 5IBUB 5C54A 2GJLA 2W65B 3G0XA 4C6PA 1B0GA 1JSYA 1I8LC 5C6WH 1E6RA 3KZSA 3LCIA 4R5XA 4GOAA 4DESA 4FE9A 2QVMA 5EIIG 4B4FA 3RTQA 4MQTB 5KSUB 1SHWA 4X8XA 2H47C 4WU5A 1PXGA 5C2XA 5RUBA 1OGTB 2PCFA 1F05A 3PHQA 4O1CA 3Q2CA 4K8RH 3SFKA 2R1YA 4J35A 3MMTA 2Z8RA 3PDDA 3QJHB 5CCKH 1DQJA 3W70A 2DUXA 3HUJA 1XUUA 1R17A 1V02A 3CZKA 5AVWB 2PWVA 4TULH 3JVAA 4PMUA 3QORD 5FUCE 3UC2A 3A9BA 4XIMA 3IK2A 4I18A 3V79C 5B38A 3L54A 1BX2A 4Y5XC 5H94B 1BFTA 1BZDA 2UVEA 3L3OA 1JPTL 5HQLA 3M1OA 3U46A 2X70B 1V8HA 3EWCA 5HMSA 3BD3A 3TTYA 4W4NA 2DLFL 3SPHA 3FYPA 2ISDA 1CD8A 2F7PA 3OSVA 4CDGC 4JQ2A 1HH9A 3MV8E 1I8UA 1O9WA 2FL5A 3RUGB 3TYFA 1XDJA 3H2CA 2XQYA 1NTHA 3R1ZA 3S42A 2ZT9C 3MNWA 1H50A 3RMJA 3O6AA 3HPJA 3RNQB 3MMWA 1L9TA 1HIML 5DS8B 1X5IA 2LV4A 2BSTA 3IJSB 4B96A 4UM9B 3OP2A 4NM4L 5EZLA 4S1RL 1A0QH 4G6AC 2CR0A 1EPXA 2WJ7A 5F9OH 1GC1L 4DELA 3RLSA 1VHNA 3WFHA 2XFFA 1QKZH 3GSOB 2A3CA 1MFCH 4M5YH 3BARA 3M17B 5M7QA 2NUXA 1OM3L 2CLRA 2UX6A 1IEHA 5DJXA 3TCTA 2K7PA 3NCFB 5EO0A 4GS7C 2DWSA 4KX9A 4M1CD 5CD5D 3CFNA 2PP8A 3T4AB 5J56B 2JH2A 3MNVA 1E67A 2Q7NA 2XETA 4Y4HD 3WOVA 4LS0A 4ZQCA 3CFCL 3H7VA 3D2UA 5C8JA 2B1AH 3BUYB 3R1GL 5H94A 3WJJC 3GSNH 3ESOA 1P0EA 1W8GA 4RDQG 3DSNA 1FQ9C 3CDGB 2MPAH 3G1XA 4Q3MA 4HLZH 2X0UA 3IMUA 1A3HA 3TL5A 4L3EA 1MO0A 1A6TA 4MHHG 5D4QA 1T20B 1TO5A 4K3JL 1THAA 5CP3H 3BUVA 4EN3C 3W7OA 4X7SL 5IT2H 5B39B 1CLXA 2E7BA 3UDWA 2P5ED 2FX8H 3HAEG 1E4NA 1MZYA 2VGFA 1LILA 4W1TA 4ZENA 4P2CG 3RVWC 4YN5A 4JKKA 1KMGA 3EBHA 1DQDH 1XAKA 3NIFB 1D9KB 3DH7A 2SEBA 1WBZA 2QHRH 3WIHA 4LB4A 1CIDA 2X9WA 1N67A 2EIBA 4PLJD 3VWKC 3ATEA 3L3HA 2CC0A 2Y07L 3M6YA 4DXXA 1O5DT 1D8WA 1X8CA 3G9AB 4FXSA 3MA9L 3BW4A 3NQCA 1V8EA 5LBGA 2W38A 4F37K 4LVOB 4L6HA 2EYRA 4RQQB 1A1OB 1AJ7H 4IS6B 4UTAL 4JFTA 3TASA 4O4WA 3QUYB 3ARSA 2HKHL 3BVUA 3RAJH 1R6WA 4IGHA 4L4MA 4U10A 3E6HB 4R33A 5AHLA 2OR2A 1S2VA 3CHOA 2J6XA 3UZVB 1IT8A 3EMCA 2AEOA 1J8HD 4HUXA 5HHVH 3QDMA 2CO3A 5KS9F 1ZB5A 3PNZA 1WFTA 3IFLL 4UTBL 5TGBB 4UQCA 2Y7FA 4G8GD 3H3PL 4NVTA 2HXAA 3WDJA 4F40A 3U9PL 4LRIA 5F1IB 1DQLH 3BFWA 1XLHA 1V6YA 2J8TA 5GS0L 5DMGD 4BFNA 1IGTA 2NNXA 1WA1X 1JZ7A 3W1UA 3WTVA 4DCQA 4DZAA 3DBNA 3EFDL 4FMVA 4PJ9B 5I6XC 5FF3A 1NBZB 2ENQA 5IUSA 1IGJA 5K3VA 3KVMA 2ADGB 2PTXA 1T6VN 4HCHA 3P73B 3MRNA 1VHCA 4JL1A 4K8RD 2EYSA 1EJXC 1VZGA 4BXSV 3W2KA 2XFWA 3WBWA 4XWGH 3KYOB 2ZF8A 3FS2A 2J8FA 3QQ9D 2FYYB 3O45A 4IOFC 1IM3D 1MCPH 4FFYL 4FLQA 3KBNA 4MWAD 2EIMB 1U36A 3H6AA 4JFUA 3GTXA 3QXAB 3P69A 3UMTA 5T5FA 5D7IB 1YA5A 2WCPA 5JW4R 1A5KC 4NT6B 1JPFA 3WAJA 3WTYA 1CW2A 3QS2A 3QDMB 1DJQA 1I9IL 2N56A 3HMXH 4PUBL 4XO6A 5T1DL 2WXFA 2R0LH 1G9NL 3E3QC 3NEEA 3S3JA 4YHGA 3H3PH 3HS9A 1X96A 3IARA 4WEBL 3E3HA 3TZFA 1T04A 5D72H 5I1GH 2E7FA 2J5LB 3XIMA 1VACA 5D5MA 4AIUA 4PVLA 5C08A 1AS8A 2I5YL 1DVYA 3DOIA 3B8VA 2EECA 4TNFA 3HM7A 4QXIA 4EIUA 2NYKA 3VCNA 1LO2H 2UWEE 4ORGB 3BAYA 5HI5D 1ZT4B 1JGUH 4E41E 1I9EA 3NA9H 3WMLA 4MS6A 4O8AA 1KG0A 2H2PC 2ZYFA 4DN1A 1FL5B 3QQ1A 5F89B 2DVTA 2ESVB 4D6DA 3C6CA 2O26U 5FF6B 2N4IA 3NJIA 4TVSa 4PJIE 3MUIA 3LCYA 3IDMB 3P3YA 2EP6A 5KVDH 1HIZA 3QCTL 3GXUB 3V35A 1E9IA 3PBVA 5EOQH 3C08L 1JN6A 1IBGL 1VZIA 3ESVF 3UJJL 3EOSA 4HU0A 3MU7A 5LNWA 1P5UB 1KGUA 3GMPA 4JQIL 5A7EA 3VWKA 4LUSA 3RNDA 3DWTA 4HJ1A 2WMHA 1O7DC 1J9RA 5GZNC 1LTXA 4TUJA 3UO1L 1UKTA 4K94C 1HFBA 2OVLA 1EFXB 4A8IA 2IH9A 4L8SC 4FXRA 2CCWA 5D7SL 4NUJB 3BLOA 2KDYA 3KTCA 3DETD 4FI4A 5FJTA 3W00A 5FW6A 3IF1A 4WUUD 2DORA 4KRPB 2VDHA 7ODCA 2PDUA 1D3HA 2RQ8A 1B5TA 2VC2L 5M2FX 4KWWA 5C9RA 4I1NB 4DQAA 2B1AL 3GMMB 1TZ7A 4XNYH 5G5DA 3LZ3A 1YLVA 3FYYA 3ATDA 1GYNA 5FO8A 1H1ZA 3OIHA 4PJIF 1EEYA 2DY3A 4GAYA 4WDIA 5ANMB 1EO8L 5D30A 2AKRA 1R19A 2ADJB 2GUOA 4FHJA 5B1KA 1ZLSH 3SCUA 2WXIA 2L4OA 4HIJA 4TN9A 5I6SA 3TTOA 3O9WD 4R5EA 4ECNA 2A3TA 2NXZB 5A16A 1WCBA 1PQZB 2UYLA 1BYOA 3OKDB 4YDZA 1MCKA 1MUMA 1UPMB 3HBLA 1QI4A 5JQHC 1G84A 1IEBB 1MFCL 3WGUB 4LSTH 3CMOL 5FM8A 3S5YA 3UT0A 2Y7QB 3GQFA 4ABWA 3D87B 4BKNA 3TBVB 1BD2D 5DK2A 2R0WH 1PKYA 2OQHA 2P28B 1J9TA 3MNWB 3VZYA 3PWLA 3RWJA 1ZSDB 1AZZC 3VB8A 4NUGL 4R83A 1Z6KA 3SO3C 3VIHA 1GHFL 4NKCA 1C92A 2DTML 3QZLA 5FXCH 4WFHD 3ZQXA 1UXLA 5FFLA 4O0QA 1VFLA 2O5NA 5E4OA 4MM1A 1WA3A 2WLKA 3OZLA 4KO6A 2ZAGA 4IBLT 4Q9BA 3ZDWA 1P0SE 4GBXB 5I1KL 1YBQA 3LRGA 5E1AB 1QTSA 3ZN6A 5DRNB 1UWEH 3TURA 3FS9A 2OM5A 3A9IA 4V15A 3E6EA 1DQKA 4IHOA 4DTGL 3VA6A 3GMQB 1F4AA 4M5ZH 1EQCA 3N9RA 1F00I 3N42F 4W8BA 2VLMD 4X7TB 1HL4A 5BV7B 1IQ8A 1GOMA 5DUBA 1ZXKA 2IAAC 1MIML 3CHXA 1GVOA 1XYCA 3EXSA 5FKYA 3WFDL 3OZPA 1J5CA 4DZHA 3A23A 5B80A 3QUXC 4J12A 3DYPA 4CC0A 4NBXB 5D7KD 4C4KT 5IMLA 1JJUA 2DKMA 2RH0A 3NPXA 2B16A 1AKPA 2E7DA 2EEAA 4XO9A 1ZIBA 5E7BA 1MXSA 2D24A 3VI3B 2BNUB 4O14A 3R79A 3WF3A 2YLKA 3IFLH 4UTBH 1QVOA 4F58H 3CC5B 4DPQA 2AGTA 2QT3A 1EX0A 3DRTB 3QGVA 3VXNA 2XINA 3RGTA 5ABFB 2E27L 3FO9B 3VG9B 5DMYA 1BF8A 4TVPD 1UG9A 5AOIA 2MANA 4DIAA 1R38A 4UOW0 3PFMA 1U3HD 5MENB 1L2UA 2E1WA 6XIAA 2FZ8A 3FB8A 2O92A 2ODOA 3QZEA 1MCRA 5I17A 1BMGA 3RWCB 4X60A 3QQ4B 4KHXH 4XVTL 1SEQH 3RDTB 3CPRA 1N0XL 5EUOB 3TJEL 2KC0A 2N1TE 3GTIA 4FQHB 1QZNA 1OAZL 5EEVA 2OTWA 4CW1B 2R29H 1FWCC 3RFZB 4F8XA 4JPSA 4E2OA 1ZBVA 4ZS6D 4GYKA 4DHGA 2JFEX 5BVJB 4WWPA 4HKZA 1XSKA 4Z7AA 4BV1A 5KJRH 3QHTC 2FATL 2Y3AA 3B34A 2CCVA 4OF5A 4OZHE 2F1EA 4TLUA 4Y5VB 3WL9A 4AV4A 5J9PA 2CMRL 3KPPB 1L0YA 5BS0E 1TNMA 4WWNA 1AGFA 1AQMA 3D39A 2K4AA 3ARPA 5D1QD 2IANE 5LB1A 3U0PB 4CN1A 3WFAA 1GPWA 1VGAA 3SEPA 3DBPA 4JM4H 1Z9LA 4HTBA 4WK9A 4ONFH 2D2GA 2F61A 2MPAL 3DX0A 3OKKA 4KJQC 4TIMA 5AC4A 4KV5F 3VMNA 4A7SA 2X5PA 3H2MA 1J8RA 1K70A 2GGJA 3QPEA 2J8UA 1KCSH 3QJFB 3POCA 3HBQA 1E4JA 2XG4A 3UAJA 5HQEA 2IAMA 3WKMH 3DC8A 4N8CH 1Z5LA 3LHUA 3IV3A 3QV6A 2OI9C 3N04A 1SLUA 2VLJA 3BISA 5C08D 1E5UI 3X12A 3HCVA 4BQ6A 4YCOA 3HN3A 3E2SA 4NSBA 1QEXA 4F48A 1BMZA 5F7WC 1JCJA 4AJ0A 3N2BA 2BP0B 5BU9A 2WWKT 4QPEA 1Q6QA 1V5XA 5EBWB 1U1UA 1S9XB 3CZGA 1ETZA 3LQZA 3P3RA 2ABAA 3N2OA 4L0PB 3NFNA 2CNYA 1KC5L 4JZNA 4MQ7A 1V6WA 2YUVA 1E50A 4DGIH 1PKQB 2DQTH 4JDVA 3OGSA 1B4JL 2YOCA 3QULA 1ZNNA 3PC0A 4UIKH 3KL5A 1K4GA 4Q9RL 4KXZH 4ERSH 1ZANH 1ISZA 3MRCB 3BH4A 4CSPA 1DYZA 4Z1CA 2FGLA 2PCEA 1KFGA 2EDOA 4AL8H 3ZDZF 1W0VA 1G7LB 1GORA 2GGHA 4XTRC 4N4PA 5D71H 1EEPA 3IANA 1CB4A 3KS5A 5EZIL 4K1WA 5CQ1A 2ZADA 2JB6B 3F01A 2CO6A 2PLTA 4S1QL 5BMFL 1R3KA 4UTBA 5LN8A 1XIFA 4Z2LA 3DC0A 4JFHD 3X17A 2R27A 2ZICA 3LV6A 1FO0A 4FHAA 2YEZA 5FEWA 4OF6A 4YEFA 4W9KC 1JPTH 5C07A 2AQTA 2YPVL 4TQ8A 4U1IA 3WN5A 3FXGA 4A2SA 5A6KA 2NLJA 5DJDB 1XISA 3GMRB 3A0OA 4BKLA 3WH5A 1Z3NA 3NTCH 1H63A 4ECLA 2WO2B 1K6QH 4LGRB 4YDNA 4B9JA 2RDXA 4Z1YA 5SWZD 2CGYA 5BO1H 4BH7B 5IHHA 2YC1A 2XJKA 5ACLA 1C08B 3GZPA 4N85A 2KERA 4TVPH 5ITBL 4Y96A 2ZQKA 3FQUA 2FTPA 2QSCL 5HJLA 3BPOB 5BNXD 1TUPA 2HTKC 4ZZFA 5C9KA 5C9ZA 2QDVA 4HPOL 2PYFB 1MCJA 1RMFH 3CIQA 3VI3E 3G1YA 1LYQA 5ALBL 4E5XG 4M62H 1JFQH 1Y0LA 2OMWB 3UYRH 3E2QA 1F58H 4TQHA 4MCZA 2VXVL 2X4OB 1JRCA 3P0WA 3KPRD 4QS5A 2ZWLT 5CPOA 5H8PA 5DI8B 1FGVH 4N5EC 4I3RH 2BDQA 3VIJA 1E0WA 1FCBA 1IEAB 4LK4A 2RFXB 3C6LB 1UXWA 2J4WL 4X0KB 1PVNA 3TYAA 2EDJA 4OM0L 3S5OA 3AXLA 2PKDA 4PVMA 1U1HA 4XMLH 4YSDA 5AHFA 3RZCD 2MJWA 5JZ7C 3MTRA 1G7VA 2XZAH 4FQIH 3U5YA 4X80L 3DG3A 5I6LA 4H6KA 1GRWA 4E4FA 1XCWA 4MA3B 1SN2A 5B38B 5DT5A 1WAEA 4M7TA 2BXVA 2QKIB 2YQ3A 2G3FA 2EQDA 3IUDA 3LMZA 1QZ1A 4GQBA 5TAOA 4P05A 4N2GA 1PZAA 3KWWA 4XAKE 3COOA 3U46B 4B0MB 3QIUD 3WLNA 2P3EA 4LCCC 5FKPA 3UXFA 5LGXA 4QGYA 5I8OH 2PDNA 2PDYA 3NAAL 4XXDA 2PO6B 4ZQKB 2D3JA 4W93A 4Z7QE 3ZS4A 3MSDA 3HRZA 2C4FU 2E7LA 3U0WH 3GLDA 3QHZH 2J77A 1RP9A 4G70B 2HFTA 1OX4A 2HJLB 4LF2A 4KDTA 1R3TA 5ACZA 5IF0B 4OV9A 2PYEB 4N87A 4OLYH 4PW4A 3A47A 4DKAA 4PCTA 3GG7A 3UOAB 1LLWA 4N5UA 5KANI 3TIDB 3E0FA 4WENB 2WSKA 4TV3A 3S5LG 5DS2A 1FAIH 2DYPA 2NY6B 1A5AA 3QDHA 3C5SB 1U8JA 4OGXL 4AQOA 4ACYA 1XI3A 4PJDB 5E95B 4BA0A 4JZJB 3VXOA 1VLWA 3N4EA 3LGDA 4MZIA 3U4AA 3C2RA 3QJUB 1SFJA 3FF8A 3LHWA 3CH8A 1HSAA 2DH2A 4GRMB 1G4EA 3IT8D 1HILA 3L17A 3TBCA 1XYZA 2WXDM 3D3VB 1L9SA 3HA0A 4NQCE 4FA7B 2I9EA 3UG5A 1BWWA 3LN5B 1ZA3B 4TMPA 1IAMA 3T0ED 1F6AB 3ZE1F 1XFCA 4IOSA 2AKZA 1XL9A 3OKOB 2YBVA 1X5ZA 2HFGH 1YEIL 2OA9A 1BMWA 2XG4B 1HNYA 2XG5B 3EG9B 1RCQA 3QWOB 4Y2OA 4O51B 4YHYC 1OCWH 3M44A 1N5AB 2V30A 1IGYA 3O0RH 4AVJA 1ZGLB 1IKFL 2HCZX 3SO7A 2FEEL 4P2QE 4D0BB 1QR4A 3NFSL 4EI6B 2C3GA 4RMWA 1XMWA 1AY1L 4LMQI 3O3AB 2OJZH 4BRVA 3AYRA 4XZIA 1E5AA 1CB2A 5DT7A 1TKWA 1QMLA 2HNHA 1YPZE 2OL3A 1OFDA 2FNBA 1BVKB 5I1IH 2EPOA 1CFTB 1GZHC 1LM8V 4NZCA 1G5GA 3WN5B 3MJWA 4G2AA 2AJUH 2I57A 1RJLA 4S2BA 4B97A 2W0FA 3QCUH 4O51A 4XN9A 3IIZA 1LWRA 4WRLA 5D96C 1A9VA 1L5GA 3VFGL 3I4KA 2QDDA 4Q4IA 5DD5H 3GJFK 3K5RA 4XPAH 1XKYA 4TOQA 4WD0A 4PBFA 5DO2D 4KRPC 1B31A 2KHAA 5EU7E 1F2JA 2VCOA 5DGRA 5KVFH 5IROA 2C1PB 1DQML 1C9SA 5LWYH 4GYPC 1EJFA 1E70M 3EXLA 4C1NB 2ANUA 1YNKH 4UQ9A 4Y7MA 5JBEA 2X1WL 5BRPA 1FN4A 1QNZH 4PPTA 3NA8A 3NO1A 1H0IA 4JE4B 5DC9B 5DJ0B 4ATWA 1E1EA 3I7SA 1CFBA 1KIPB 1OAJA 4N8PA 4P48A 5IMOB 2XTLA 1A6AA 3GSQA 1ZHBA 4PJCB 4MA7L 3H6OA 2FEDC 1EC7A 1P84J 3R0NA 3TZVB 4WIQA 1XF0A 3U3HA 3TZVC 5CD3A 3C61A 1HI6B 1ND0B 3H42L 1BZ7B 2TAAA 3FB5B 4RV3A 4X8GA 2PW2B 4W9FC 1RIHH 4PGZA 4CSTA 5FGBA 5GZOA 4FR1A 1A3RL 1OP5H 4M19A 2PF0A 3RR4A 4PRHD 1S5VA 1SMAA 3FT1A 4ZSUA 2ITCB 5AOMA 4Y9EA 3G5EA 4TUKL 3LKQB 2CPUA 1EJUC 2H9AA 3W39A 1DBTA 4GH1A 1JZGA 5I8CB 1BWVA 3AI0A 4TVPE 2EIJB 4HJGB 4QRRE 3IJ8A 4Z7IA 2AERT 3STGA 4EANA 4YE0A 1SXCA 3SDAA 3P11H 5EU5A 1CWVA 1RUQH 4UAHA 5DTFB 4FOUA 3RPMA 2ROXA 5IB3B 2C9QA 4LUIA 1BAWA 1AFSA 3D18B 3OR6A 5TBOA 2WJZA 1M7XA 4P7OA 1FH5H 4B9PA 1W9DM 2BHZA 2IPUK 1EYEA 4Y9PA 2WCSA 2X4TB 2XHYA 5T33H 2GDQA 2AK1L 5CEZH 4PRIE 4JRXB 3ASOB 4YE4H 2PDWA 2BGSA 3B83A 3GFUA 4MAUH 5GRZA 3SDDB 4RCXA 15C8H 5E6UB 4EAMA 4M8UA 1HDMB 1QNIA 3GHSA 5FCZA 3E96A 1YXCA 2AANA 5AZ2L 1Z44A 2VELA 3MJ7A 4WY0F 4HVXA 2VR5A 3CK0L 4MA1C 1AW1A 5TIMA 3HNTH 4QGCA 3US1A 3FB7A 4YLWA 2X44D 3U9UA 1ZVSA 2H3NB 2PCPA 4N8VA 3V7AE 3P40A 3RYMA 3WXWH 4DFHA 3FU8A 5KN5B 1R4XA 4F9JA 3FQUB 2F58L 3LAFA 2XKSA 2Q8BH 2F53B 1KM0A 4IIDA 4QROA 1I8LA 5JIMA 5CJBA 5B7EA 1YDOA 5FOOA 4OJEH 2QLYA 3IDIB 1V7NH 4FZEL 4U1NB 3TC9A 1HAUA 2JELL 2K1MA 1A7OH 3MRLB 3KFTA 4OD1L 4QTFA 3UPCA 2GITB 4AYFA 1G69A 5A94A 3HAEH 2CO4A 3E7JA 5SX4I 3G8RA 4KTDL 4PE8A 4DTGH 1QNQA 4JM0A 1JK9A 4I9WE 2NXGA 3FONB 1EC8A 4QRQB 5GSRB 2YQ2A 5AG9A 4PJEF 1SJCA 2A9NL 4OGAD 4NCC1 2VD9A 1NELA 2A9BA 4G8EA 5CSSA 3WLQA 1FWNA 2DZBA 1WZAA 1O6TA 2YRZA 1NH6A 1YEYA 1KYFA 2VXQA 3UR7A 2PCPB 5KN5A 1ZGLA 1YADA 4GYPA 3VRLF 4CL7A 1WFJA 2P5WB 4C56A 2L7UA 3TNNB 2O9PA 4LU5H 3UBXB 2WLIA 3MJ6A 2V8MA 3S2AA 4ZQNA 3DHMA 4F7TA 5KSUA 1O12A 3M1BB 3SPJA 3NQBA 4LNRA 3QZNA 3SDDA 3EGXA 4JFXA 5B4MC 4QLJA 3VXSA 3RWHB 2TSAA 4AD5A 1G9MC 5FGRA 4KUZL 4MDIA 5FCSH 1ONQA 4XP4H 2ZX8A 4MCMA 4PCSA 4AGQA 2C9XA 2JFCA 3W9DA 2DIKA 4DO5A 1REQB 3W82A 1GWJA 4PG9B 1ZWIB 4W9JC 4XWUA 4WEEA 2NQJA 2Y62A 1QFHA 4K9EH 2ICEA 2WAQA 1KCRL 2FR4A 1XCFA 4BZ2A 2PDXA 3AUOA 3WEBA 1I8MA 4LAUA 1SLXA 2WSPA 1S7SA 3B9KB 1DL7H 4QRNA 3HNVH 2Y07H 4X7FC 5BRZB 2PC8A 4HWBA 43CAA 1MDRA 1DQWA 3CFJB 1SRDA 5AVSB 4YN3A 2HROA 5J8OA 3QUZA 1YY9D 4MLIA 2X4PA 3SBWC 1LLOA 2VDQB 1JRHL 2XY1A 2J74A 4S2CA 4AZCB 4AX6A 3E9UA 4U0RB 4F0MA 5I18H 2EH8H 4S3DA 5CSBA 4A2RA 5IHRA 2XTJE 2BNQD 1L2QA 4R7XA 3GXFA 4AEIL 3FW6A 4WJ5B 4U1GB 4P23D 2Q0ZX 2FLIA 2A73B 3O2DL 1X4XA 4LOFA 2BVEA 2LR4A 4P9ML 4TNEA 5CP7B 3U4EA 3QDJE 5EEZA 1XLAA 4XG1A 3KYMB 3VRJA 3M0MA 1FYTB 3ARFA 1MWAB 5T1LB 3TFBA 5EN2A 2X6VA 5EOQL 3QDAA 4QDGA 5HGHA 3X1EA 5C2CA 2JXMB 1LWIA 1PZ5B 4Z78B 4YMZA 1AC0A 3MBWB 4W9CC 2BDNH 4PJ8B 4L4JA 2OT0A 3F4VA 1F97A 2GJZA 3TVAA 1XT5A 5KVFE 2IWFA 1KCRH 2WQXA 1IKOP 2DJLA 2IPTL 4MJID 2IH1A 2XGIA 2V2TA 1VFAB 3EW3B 3FU0A 4X99B 4Y4FD 1GG1A 1GYCA 1NSNL 5KG9A 5D1ZB 1GEQA 4QAMB 1HKLH 4PYSA 3VVGA 1RIVL 4BRJA 5ABTA 1DQMH 3KXFE 3BVJA 3LQMA 3QEQB 1I1AD 3HZYA 1KPRB 4JFHE 3S4SA 3GK8H 1G6CA 4AD1A 1VF5C 3G6DH 3P74A 4ZXBB 5CIPA 8XIAA 1DTUA 5I71B 2J3SA 1J6PA 4HKBB 4RMTA 4UDTA 2DSUA 3GI9L 3K46A 1N0LA 1LROA 1BECA 2GQ8A 1IBYA 4LRTA 2AXFB 1E9QB 1PX8A 1U33A 3AUVA 4KMQA 1Y07A 2F54D 2ZWNA 5B3JF 1CECA 4HHWA 5AW2B 3GRWH 3SRFA 1ECYA 2CRZA 1TEFA 2ZZUT 1KT2B 3TYGL 2ZAHA 4AGPA 1J01A 2H3KA 4I5RA 4BFAA 5FV1L 1ZZMA 1JZ5A 4LVNB 3MMEB 1W8EA 2DQCL 1WGVA 3GG0A 4KKCC 3B9KA 2X6UA 4L3EB 1WX0A 3ULSA 3C5QA 4AD0A 4GE8A 2AABH 4Q9QH 4JYFA 3HIZA 5I8EA 3TYCA 1OQXA 3EB3A 4AZGA 3LNEA 3EZJB 4XHQA 3V6FB 2KUTA 4U1JA 1XICA 1TENA 3E6FA 2WOBA 4GI8A 3FU7A 4XPHL 1QR1B 4OCRH 1S5NA 1LT8A 4F33B 5DJYA 3N2XA 1D3GA 2CDFA 2DMGA 5DJ8B 3GNNA 1RZKC 4EOWL 4EACA 3L2LA 2VC9A 1C5BL 3MV11 1VGEH 4G6KL 1RL1A 3QHMA 1E42A 4WSHA 3WNKA 3CK0H 3D85B 3TN0A 3UTTE 1TV7A 4IGBD 2OI9B 5D2LF 2X1TA 1FHDA 4MVBD 1L0XA 4M6PA 4ILDA 4S11A 2Y7QA 2EE3A 1XFPA 4Y4HB 4X4YB 5ESQA 3EA1A 3R7MA 1E6SM 3EXTA 4YE4L 4Y2DC 3MB9A 1CLOH 4H9TA 2FCBA 1EAJA 3QEGH 1O7SA 2QMKA 4WY7L 5L2JB 4DQWA 6A3HA 4GXVH 3HC2A 4ZAKA 2GVEA 2XH0A 4HF5L 2YZ5A 1IIIA 4WU7B 1UD3A 3QG7L 4X83A 5FGCE 2WQRA 4G9PA 4ROPA 2WMKA 4F0LA 4JHUA 4Z0BH 1XF2B 4AQ1A 1OSEA 4CNPA 3V0HA 3O3DA 2PTWA 5E5CA 1MCFA 5D37A 2VX6A 4A3RA 3HO8A 3MGOB 3MO1B 3ATYA 4HYVA 2CBMA 2YCLB 3N73A 3MUZ1 4OQ1A 3HPXA 4HFWB 2WB5A 2NT1A 4QF1A 2VTFA 4KMTH 1U93A 1R5VB 2YO3A 5HHOA 2EC9T 2DL2A 4C83A 4YSSA 5C0FB 3LQAH 5I5RA 4GG6A 4NUJA 5D71L 3FCBA 1TPUA 2MWCA 3KWTA 1XGDA 3F5JA 1NWTA 2P5WE 1I4FA 1BRLA 2HWZH 3NYDA 1K9TA 3OKNB 3EH3B 4AQ1B 5G4EA 4AH2B 3NCEB 1V7AA 2OZ8A 2J9YA 2HKFL 3H2FA 3T1WA 3JV6A 4AJYV 3FUNA 4OJDH 2Q87A 5GS0C 2FLBT 4HKJB 2JI3A 3LRLA 4OI8A 2ZRUA 2E5BA 1F07A 3E74A 3G24A 4IRZL 4MNQE 1EIXA 1ZHAA 1R75A 2MNJB 3LHPL 3IDYB 4KXDA 3N44B 3SQOL 1Z32X 4XMUA 1GH7A 3W57A 4GY7A 4CILA 2H6OA 5I1AB 2YKLH 2J9ZA 2CLEA 4GAYB 1I9JH 3HZKB 3D69A 5ANME 4LPVA 2ZUTA 5GGRY 2BOGX 3TC7A 2IMMA 3NZHL 1VFUA 1X5GA 3VMPA 5E0KA 1AXSA 1E28A 5CGYD 4H8VA 3IPEA 3VFPA 3LSOB 2C9RA 4J3OG 3VXTB 1ONEA 4A35A 5EMUA 5FK9B 2PP7A 2Z1PA 1NAL1 5DJ8A 3BJSA 4IP5A 3SCSA 3O6FD 3MCLH 1XYMA 3ZIZA 4N0CC 4OLXH 1KTLB 3L6FB 3BGJA 2YA1A 3ARUA 4R4ND 3EXJA 4O52A 1D7FA 5JMUA 3V7PA 4Z6AT 3FXIC 1X7IA 2EO7A 4KEVA 4OOUA 3SGKC 3T2NH 4ZUUB 3W2DL 1BQCA 3W7EA 5G4NA 4A8NA 5IXEA 1EFXA 3ZRCC 4I77H 2VIRA 4F7TB 2O7SA 1OSPH 2V33A 4Q6XA 4Y6GA 4AM0B 3BWAB 4GRLC 1SYVB 2LVCA 1KJ2L 1S46A 1Q1PA 1R7AA 1OJXA 2OV0A 2UUDH 4LAOA 2WK2A 5JA9A 3TFKD 1T4KA 4TNWF 1FLRH 1NAMH 3F64A 2ICCA 4H8PA 4B60A 4IIHA 2W0KA 4MDOA 1M6OB 2AHIA 3SO3B 5K69A 2Q7YB 1IXOA 2VGIA 5E99L 1M3IA 3ALGA 4H0LC 4XNDA 5FD0A 1R0AH 2IAND 4P2QA 4IFKB 3FOMA 3U79A 1AANA 2UZYA 2VIRB 2NPLX 3C09C 1WAAA 1DUYB 3WH8A 1U8LA 4JQ4A 2XQ0A 4PJBF 1YAZA 5HYFA 5H4YA 2A0NA 1WDSA 5D1QA 5C0BB 3IU4L 3QZWB 3HE7B 3Q8EA 3LI0A 1OSPL 4ANUA 2NR6D 2R9HD 2YAMA 3GUGA 2W67A 1UR2A 1H7OA 1AAJA 4EVZA 1LP9A 2PDCA 3OBAA 1WWAX 4POUB 2O5YH 2D03H 3VFPB 3BVXA 3WKYA 2E8ZA 2IOMA 3V7AG 4IJ3B 4RZKA 4U49A 2W0UA 4XZMX 4WY0A 1X44A 2XISA 5EOCH 4M9PA 2HTLD 4OD2A 4WTWA 2JVUA 1LLAA 3T8XB 1AQ8A 1HQTA 2YXVA 1YSOA 2GY7B 3VI4A 3C3UA 3LGGA 4FX6M 1NFDB 1T0MB 2WINB 1IBDA 4ZG1A 3V16A 3TR9A 2Z35A 3IFNL 1SPQA 1W1A1 5EIVA 4NNCA 3G5YB 2IV9A 4L1DA 2CNZA 4NNYB 5BQDA 3QTPA 1AGBB 4JR9L 5F3BA 4F2UA 5HAOA 4NM8H 3TO2A 4KRUA 1R24B 5E8NB 2WAGA 1UH3A 4QI3A 3HA1A 4L8CA 1OAXL 3BUQA 4G80B 2Y0FA 4BF7A 5KS9E 4I9MA 2ADIB 5HYJA 1QCWA 4WUKH 3GMMA 2DQCH 5GRWA 2I56A 4XAYA 3PZGA 1Q90A 4P5KB 3OF6A 4WWID 1NANI 2YRBA 4MDJB 3TO4D 2GJNA 5FPIA 5IFJA 4EAYA 1MHCA 2DGAA 1CYWA 3PTDA 1U2YA 5K4ZA 2OK0H 3CHFA 4ATTA 1SQMA 4DZBA 4GXFA 1MHPL 3HFML 4HKZB 5T1MB 1P0DA 1S7RA 2ZFAA 1H9VA 4AMCA 1ZTXH 1A7RL 4X5PA 1Z69A 4PTNA 2FO4A 3MO7A 1GHFH 2VDOB 3DKHA 1M9SA 2WIIA 4MBOA 4ZJ9A 4R97C 1S7VB 4LSSL 5D4HA 3WO3B 3G18A 1AD0B 1QD0A 3Q2WA 1N4XH 2L7JA 3RJOA 3MRBA 1BF5A 4X6CA 1UR8A 3ES6B 4PULA 3MBEA 3L3DA 4P5TA 3SJVB 1QMUA 3VSQA 1B3YA 2WHMA 3P30H 2AJVH 3PNWB 4P2RA 3O0KA 3P5YA 5CBIA 2I60H 2GC7C 4AHOA 1HYSC 4KKAC 2A6NA 1GMIA 1PL3A 2BSRB 2IIJA 2PDBA 5FAGA 1UD6A 4ANVA 4JRFA 3WLWD 5DQPA 4JCMA 1O5XA 2WZHA 4XMKL 1C12A 4P9HH 3G6AA 4JTHA 3W7MA 2AVFA 1VPOL 4ADTA 4NAMA 4KFOA 4YBQC 4P2OB 2KL6A 5AYBA 4E41A 2I5GA 1E4WL 1W6TA 4UQBA 5LO7A 3TYDA 1UT9A 2CO7B 3VJ6A 1L7IL 3FO0L 2VH5H 3N2JA 4AK2A 4GXPA 2BSRA 2HKFH 3TWBA 3DI0A 1I1YB 3E6FB 1I8IB 1NLBH 1RPKA 4NRSA 4OLUL 2J12B 4QIUA 3JWNH 4XO4A 4ENED 5IP4A 4HIEB 4UOZA 3FB6B 2G0LA 5KVEH 3TA9A 3GJEA 5GRJH 1A66A 3FVMA 1A5SA 1NDVA 1S2AA 1BDYA 1E3FA 1ZJIA 5I18L 2FEEI 4TNVK 5F9AC 1RXOB 1Q94B 3B43A 3WLMA 2H26B 3JTSB 4YHMH 1NDGA 1IFGA 5E1QA 1UOZA 2P10A 4GRLB 4N2YA 1F4YL 2I27N 2BWQA 4HD9A 3D85D 4HCRL 4NN5C 3QDGE 2XFYA 3VSUA 1MQKH 5FYKL 2CZFA 3H3KA 4XN4A 4POCA 1T7WA 32C2A 3QIBD 4ZDHA 4GFTB 4Z7UA 3MDUA 3PAJA 3Q44A 5TNVA 3O3BB 1FH7A 3CPUA 3GBDA 1Z9SA 3LRKA 4LAJH 4TNWK 2V5KA 3FJNA 5HQMA 1UM6L 2XTJB 1BQLL 2NTFA 5AW6B 3TPKA 4JFVA 4FP1A 5LIKX 2WC7A 2O6CA 2BSDA 5DI8A 5EH1A 1TTQA 4I77L 1FH2A 1W9BM 3HGSA 5GS3A 1TQBC 3B3BA 1CGSL 3MOAH 2I5IA 4GGBA 4Z0JA 1MCCA 4TSBH 5H91A 2EILB 1AH0A 2C9PA 5U4NA 1FBIL 1H3VA 2JIEA 3ZOAA 2R0KH 1KGYE 3GK8L 3CU2A 3T2PA 2CHWA 2ODIA 2BZ7A 4ERGA 5EZLB 3TQVA 2DZTA 3LN5A 4AGNA 3ROOB 1Y8BA 2GK0B 1I9IH 3QZOA 4JFED 4MB5A 4RWYH 2JKAA 3P2VA 4U7KA 4W70A 1UWRA 2Z92B 1MZZA 2BHYA 4YSUA 1XSJA 4OB5L 1TQJA 5C5YA 1XGUB 5D7LA 5DELA 4ACZB 1YO4A 4JTSA 2E28A 3TN3A 1RV6X 1SN5A 3PV6A 4ES4A 4HS8L 5HNNA 4ONGH 1JF6A 3HNSH 4XX5A 5GS1C 1VCFA 4Y2WA 4M80A 1S7XB 2IADA 2K6YA 5GS1B 1BQKA 1MFNA 5E8PB 3UACA 3LNDA 1YNYA 4XISA 1OEZW 3RDTC 2R8SH 3AACA 4ZXLA 3OQRA 4NI3A 3OGVA 2HJLA 4JS7A 3G5XA 1VBRA 4X5QA 1S3HA 5JHBA 4Z18A 3SKMA 4NP7A 4X9HA 2ZXGA 3MO4A 5IESL 5F7NC 1HTIA 1A4BA 5JXEA 1I8AA 1C5DB 1M9WA 3OEXA 3VGGA 5J6HA 3EH2A 5KSBF 3R58A 2P0IA 5JOPD 5IQLA 2OQYA 1SXBA 3ELAT 4UCFA 1Q4WA 4G8FA 1RQBA 3S8FB 1V7MH 4ML9A 1MJ7L 2D7PA 4RIRA 2INEA 2R0ZH 4NHCL 2OR8A 4ZUVA 2CERA 1S8DB 2FJSA 3ALWA 4L3EE 1UMLA 1P6AB 2KLRA 2VMJA 4JZNB 4RGNB 1OAZH 2RAGA 4DETA 3SJVE 2ISFA 3HQ1A 4XP5H 2J25A 3IDGA 3QV9A 3CB3A 4MY8A 4RAVB 3U6RB 1OE2A 1Q6DA 3WBEA 2BJML 2G2PA 4BK9A 1GYUA 3NA9L 3ARYA 1OAKL 1AXIB 1RBAA 4DJFC 4U6YA 4YR6A 2J55A 1DQTA 3OKYA 4FJZA 3VGHA 5BV7C 5SWSB 2FTAA 3ONBA 2JCCB 1IE4A 3QVQA 1YMYA 1U91A 3QUGA 3QO1A 4NIKB 4DN4L 5KANG 2DQWA 3QC6X 4L4TD 3NO3A 3QXWA 1DLHB 4GBXC 1KCBA 4OCMC 3TBSA 4Z3GA 5E5RB 1YEKL 3EDKA 4P49A 4OUEA 4RPPA 1A3LH 4O02A 1CGUA 1BVKA 1AQDB 4Z3JA 5CBJA 2OJEA 4RH4A 3N1PC 3CBKB 1AUSL 2Y7NA 2QCEA 1SGKA 4NQXA 2YS4A 1FFRA 4P57B 3DAQA 2AFNA 1XF1A 4PB9H 2JJVA 3MRHB 4JE0A 4KZ0A 3EAUA 4UTWC 1A6WH 3RHWK 4B9IA 4WHBA 1TX0A 2YGOA 4EI6A 5FA3A 4JO4H 3VQLA 4BSWB 2NYYD 1GJWA 2Z0UA 1H2JA 1CE1L 1SZGA 1J05B 2FIRT 3Q2DA 2UXGA 2YPKA 5FEXA 1DKWA 3SQMA 4Z7OB 3S1XA 1NGWA 3BKJL 1I1RA 4AFYA 3NWRA 3RAOA 2E4FA 4GKNA 3VXRA 3CH9A 5C6MA 5T1JA 1Q9WB 1B0WA 3NIDE 2R1WA 3TBWA 3BP5A 2XWBB 3I3BA 3RA7H 4AKOA 1DO5A 5KVDE 1A5NC 3V4UL 2QCNA 5JQ9A 3WV0A 3MP3A 4IFOA 5TQ2H 3GTTA 2NX3A 2BVWA 4OQVA 3GI9H 3W1AA 2P8LB 1HXMB 1P2CB 3CBRA 3JQOB 4OLZL 4OZIB 3FYEB 2WOQA 5A6BD 3NEXA 1M3JA 5CCHE 3SDAD 3AU0A 4GKOA 3TH4T 4EDWH 3ESUF 2J7GA 4ZFGL 1TYEB 4KNQA 5E9NA 3IACA 2X6AA 3URQA 4NO5A 2Q6WA 4HK0B 1E8XA 3U7BA 2C4FT 2WYIA 1AGDA 4XCCH 3GVGA 3GPSA 4KO7A 3SDYH 1TE6A 5SX4H 4OCYH 3WBDA 3BDBA 3EFFA 2VYRE 2IPTH 3KCWA 1AFVL 2P8PA 4M7LH 2P8LA 4GP8B 1KPUA 3WUWA 3ZTDC 1MH5B 4WV1C 2GSMB 1BVWA 1CNVA 2IG2L 1OF8A 3GIQA 1FZMA 3DJSA 1OX4B 5IDZA 3FU3A 9CGTA 4KRLB 1WUNT 1L7TL 2ATKB 4HS6A 5MI0C 2IQAA 1FZJA 4A2DA 1BIHA 1MJUL 3WD5L 2DIBA 3ZMRA 3I6RA 1XTLA 5JLZA 4GKNB 3QWRD 4L4VA 3VGEA 3VXRB 5C0GB 1F90H 1M01A 5IKCA 4ALDA 1DQDL 3MRGB 1GGCL 1D2KA 1J05A 2UY6B 4HXBL 5J11C 4LLMB 1G0DA 5EBUA 4EN2A 2FUQA 1BXAA 4MJJA 4YUEL 5D1QC 5IHUH 4XHJD 2W0PA 4YHOH 3CZJA 5E2VL 3TJPA 5CD3B 2HFEB 3TW6A 2O6DA 4X7SH 2X1PA 2CBJA 1RIHL 5ETUA 1A0EA 4GO9A 3GI8L 5C8JB 1JGLH 1A65A 1HS6A 2QKSA 4ZO9A 2A77H 3PNRB 2FO1A 5F7MC 4F7MB 1ZAGA 3VO0A 2VLLA 1QBAA 2Z0BA 1T6WA 2EUVA 3MI3A 5FR3A 2Y06H 2QMJA 5D4YA 1Q63A 2J88A 2D8KA 2HAZA 4I48A 4JDEB 4UBDC 3QPKA 2F8QA 1GTNA 2EEDA 5LGJA 1D6EA 3D5OF 1PZUB 4JMNA 5HHPB 2EF9A 4M4RB 5H2BB 5CZXC 3RVUD 5AOJA 4CVZA 2J8GA 3GSRA 1G9ML 4NFCA 5KJ4A 3ZUNC 5K5YA 5FO8B 5HJ3A 5JIDA 1Z9NA 3N85L 3CO8A 2CBIA 2IH1B 5DHDA 1R33A 3RN6A 2XFXA 1SHSA 2Y69B 3CSFA 3DVIA 5IIEB 1KM4A 4JPIB 2DZPA 2W59A 3W0WB 1M6JA 2ODHA 3U6RA 4A7GF 5FJUA 1H7NA 5IM7B 3H7UA 2VW4A 1J0HA 1WFUA 2OLDA 2R15A 3HC4L 4RISH 1LK3H 5F44A 4UILL 3UTSB 4JHZA 1KSRA 2EZ0D 1FJ1A 3RPKA 5HGHB 1DE6A 1EJSC 4JTGA 4O0KA 1S78D 4Q8NA 2WXKA 2HJKA 1RZIA 1MI5A 4L3FA 4HTYA 2QIIA 1T89C 4D8PB 4OZOA 1HVXA 1KJVA 4BFEA 4B0MM 3P9MB 2V2WB 4HQVA 4WSKA 1GA2A 3P62A 1E6OH 1BX2B 4HJSA 5DK0B 3ME3A 3BD5A 2BXZA 1QLEH 4HNOA 1KN4H 1PD6A 4IMAA 2O6EA 4GACA 3EEGA 3G6LA 3ZVVA 1NOWA 2AEQH 1NJ9B 1XH3A 1ADWA 3HMXA 3VFOB 4C6MA 4EUPA 3QHNA 5FF6A 2BSSB 4KPHL 4ZPTB 3KPMB 1JVOA 2FDBP 4QR7A 1VKFA 1MWAH 2A6JB 2RBLA 4NKMB 1TWZA 2YARA 3H9HA 3SE8L 3P9MA 1CXIA 4HJUA 3CQJA 3DX1A 2XPZA 3SY6A 1AGCB 1MI5B 1QYGL 2HTKD 4M1GH 2GOKA 3G1DA 2MIZA 2H1LM 4XPBH 2FEJA 5EEXA 2J1WA 1JNDA 1L0QA 1WDRA 2AKMA 4J1UB 4K5OA 1AD9A 4GSDH 2BERA 4JHAL 2R0KL 2P52A