5HDRA

Crystal structure of a bacterial fucosidase with iminocyclitol (2s,3s,4r,5s)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
445
structure length
440
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a bacterial fucosidase with iminocyclitol (2S,3S,4R,5S)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords Alpha-L-fucosidase
total genus 158
structure length 440
sequence length 445
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5hdrA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5hdrA01
2WPGA 1V6VA 5CPQA 1F4HA 1B3ZA 5TD4A 3SCPA 5A8MA 4AISA 1V3JA 3WFZA 4EK7A 3L4WA 1JGIA 1QNQA 1E72M 4D1JA 3WMBA 3GXPA 5I78A 2F7PA 4KWUA 1TG7A 1UR9A 3VIGA 2ZICA 3L4TA 2WCGA 3I3BA 5DFAA 2Y8KA 3WF3A 4W84A 3MUAA 5BWFA 4FNSA 1UR2A 2ZWZA 1O6IA 2XFFA 1KXHA 1G9HA 4GO9A 4NSBA 4AEFA 5DT7A 3CUGA 1UD4A 1E6NA 4MB4A 1WB0A 2JIWA 1EQCA 4ACZA 3TTYA 3EDEA 3A4WA 3BGAA 1NOWA 3BVWA 1M53A 4D6DA 1TA3B 1D7FA 1ZBKA 3FAXA 4AY1A 2CHNA 4HA1A 1V6UA 3VGBA 4CU8A 3ALFA 3K8KA 3VIKA 1B9ZA 1HNYA 1VJSA 5ABHA 1VEMA 1R85A 1BLIA 1UR8A 3MS8A 3CBWA 3WF1A 1PZ2A 3W81A 1QNPA 3GDBA 1Q6GA 4IPLA 4AD5A 5BXTA 1JD9A 3GH5A 4V2XA 1QOXA 4B3LA 3BVTA 2EPNA 3T0BA 3QHOA 1KQZA 1JG9A 1IV8A 1UR4A 2VZVA 3VTRA 2YA2A 1SYTA 5A3HA 3DHPA 5AC5A 2DT3A 1TA3A 2Q8XA 3MUZ1 1GJUA 2ZXDA 3WDIA 2CBJA 2WK2A 4X9YA 1RPKA 4ATDA 2VVSA 2A3HA 3AHXA 3U5YA 1HL8A 3NJ3A 5E70A 2X2JA 1JFHA 1WPCA 4PMYA 1MW1A 4NRSA 4W88A 3AYRA 4AIEA 1E6ZA 4AW7A 2DT2A 2WVSA 4ML4A 1W9XA 2VR4A 1A47A 1QVBA 1EOKA 3RJYA 4KGJA 1A3HA 1UWUA 4PMVA 5HNNA 3PBGA 4PUDA 5DO8A 5FL0A 3HJEA 1CGYA 5HPCA 2HVMA 1VEOA 3A22A 2WHJA 2YBUA 1PIFA 3FAWA 1NWSA 2D20A 1E5JA 1WP6A 2DSKA 2UY2A 2YDQA 3CZSA 1QBBA 3HU7A 2FH8A 2FGLA 3AIEA 3WD3A 2YFNA 2CPUA 1HTYA 1JAEA 4FLRA 2O9RA 1W1PA 4W85A 1W3KA 2IUZA 2E40A 1V3LA 3TTOA 2DQXA 4RL3A 5C8BB 1M03A 1CPUA 2Y5EA 3ARVA 3GXFA 3H55A 5BRPA 2QMKA 3B9EA 1B0IA 4DWSB 1RP8A 3VPLA 3ARUA 3CGTA 1GVYA 4W89A 2CBUA 4A3YA 2IGTA 1HJVA 3WNKA 2GDUA 3TV8A 3O2LA 4LGXA 2YLLA 4AZ6A 2G4FA 3DHUA 3LRLA 5A6AA 4UCFA 3VDBA 2W63A 4UZUA 2VMFA 3ARYA 1PJ9A 4UOQA 3G6MA 1EO5A 2J7CA 4TTGA 1HL9A 4H8VA 2G41A 3VVGA 4PEEA 3K4AA 3KL0A 2BVDA 2XIIA 4WKHA 3BLBA 2C0HA 4HOZA 2BHYA 3ARRA 5M5DA 5D9PA 3BLKA 3THDA 1V0NA 4HZ7A 5BXPA 5GQBA 1Q6EA 5I5RA 4QP0A 3VINA 4FNUA 1JDCA 4DM2A 2QV4A 4C7GA 1W1VA 3IGUA 1H5VA 3CH9A 1KGXA 3WN6A 4NX0A 4GZJA 3SUTA 1US3A 3M46A 1MWOA 3WDJA 3MSDA 5CSYA 2VO5A 1NQ6A 2D0HA 3W0KA 3PTKA 3VIPA 3W27A 1ZBCA 3WH9A 4AWEA 4UFIA 2CKSA 3N11A 3BH4A 1UWQA 4JKKA 1CDGA 2DSVA 2OWWA 1UH2A 2EADA 2JALA 1V02E 2G3NA 2VI0A 1ZB5A 2AMGA 1NARA 1JYWA 3WQ5A 2ZUNA 1EA9C 2ZX5A 3RM9A 5ABFB 3BUPA 3LXCA 2DT0A 1HP4A 3GZAA 4U5KA 3CUJA 3ZOAA 1WZMA 3MMDA 4J27A 2XYLA 1OD0A 2GK1B 4J28A 2PWEA 1E6SM 3B9DA 1XSJA 4YHGA 5AY7A 4D6CA 1G01A 3ZR6A 5CPTA 1HJUA 5IHSA 5HPOA 3PZTA 1YQ2A 2WC3A 1LJYA 2WKLA 4PTWA 1JYNA 3NYDA 5A1AA 2F7QA 2ZWYA 3E1F1 4IPNB 3L2MA 1Y7VA 3MU7A 3EMZA 3PZMA 3WL0A 3DYPA 1QHOA 4OIFA 1DWGM 3ZJ7A 3BMVA 4RE4A 3OGSA 3ARPA 2ZUVA 5LA1A 2XFRA 2OSYA 3A24A 4M24A 4LYQA 5ABEA 1FFQA 3EMQA 4C7DA 2EPOA 3VD5A 3BAIA 4MADA 2VRQA 3VDAA 1CXEA 3ZT6A 1X6NA 2EPLX 1UWSA 4QDMA 3FW6A 1CGTA 3VGFA 2ZUTA 3W28A 4UTFA 3VILA 1V0LA 1V08A 3EYPA 1AQHA 5I0DA 1EQPA 2FHCA 2YKKA 3SCRA 2ZE0A 1R34A 9CGTA 4KH2A 4D1IA 3D4YA 5A6KA 4OBRA 3N13A 1HKIA 1JZ2A 2CETA 3AS3A 1UQZA 1UASA 1VBRA 4GI9A 1FA2A 3T0DA 3ZSTA 4NZFA 1XSKA 2E8YA 1JI2A 3F4VA 4CGTA 1KCKA 3M07A 2F7RA 4DWSC 5CJ5A 1CXLA 4OOZA 3N15A 4MDPA 3N1AA 4DO6A 2J78A 3L4ZA 5CZKA 3GXDA 4CCDA 3O9NA 3VGHA 3VD3A 3TOPA 4BS0A 3K8LA 4CD6A 1UYQA 1M04A 3ZSSA 1V6XA 2CESA 3WSUA 5JIPA 2BFGA 4D6GA 1CGXA 1PX3A 4BF7A 4AMXA 3A5VA 4OUEA 1LL7A 1QHZA 3GH4A 3NDYA 5LA2A 2YA1A 3CHFA 4A3HA 1KTCA 1Z32X 3SCOA 5D8ZA 1Q4NX 2JE8A 4AD4A 3BVVA 5JUVA 3EJQA 1UUQA 5GNZA 4W87A 4KGLA 2IXUA 2VRKA 1NWTA 2YJQA 4GIAA 2EAEA 3QOMA 2CITA 1UZ1A 4MDOA 3F5KA 1R46A 4JKLA 1C8QA 3WBEA 1JNDA 5IXEA 1E4MM 3HZ3A 2EPMX 4FMVA 3VIFA 4BQ3A 4NRRA 3PN8A 4IISA 1JI1A 1E0VA 1HIZA 1E6RA 3ARQA 1H1NA 3NCOA 2V3DA 4GI6A 4GINA 1HP5A 2NSXA 1E73M 3BLPX 3HG3A 3BXWA 1B3YA 4OBSA 4PMRA 5C71A 2VZUA 1E6QM 5A8OA 3SCUA 1ITCA 1R87A 3VDCA 3KZSA 4XUYA 3O6AA 4UQ9A 1U30A 1EIBA 4J7RA 3MV01 3MKKA 4HZ8A 1MW0A 3A4XA 1K6AA 2VQTA 2IXVA 2CXGA 1TVPA 3W29A 2UY4A 3OG2A 2GJPA 2XM2A 2Y24A 1TFVA 4CVUA 4TXEA 4ACYA 2DGAA 3WF2A 3WUFA 2DH3A 5D9NA 3TA9A 3EBVA 4PCTA 4UQAA 1B90A 1JZ4A 1J18A 5F7UA 4BQ4A 4GPNA 2WZEA 1E0WA 1JYXA 1UKOA 5M3WA 4M1RA 2VVNA 2G3JA 3AISA 4D6JA 3LRKA 1CLXA 4DO5A 1G94A 2OW7A 4DUWA 2WKGA 3WD1A 3LXAA 1WKYA 1E9LA 3AXIA 4ACZB 2YL5A 1JD7A 3WH5A 2WHLA 4OJYA 1XSIA 1J0YA 2FH6A 1BG4A 1EOMA 3WDQA 3RO8A 4AZ5A 5CGTA 1GQIA 2PWDA 4H8HA 1PX4A 1W91A 1S46A 4GQRA 1FHDA 5FCZA 1IT0A 4BQ2A 1SMAA 4S3KA 1UD6A 4DUVA 3WKZA 1PS3A 1K9DA 3U7BA 1J01A 2VX7A 4UOZA 1UWRA 4P8UA 2PBGA 2D1ZA 4HU8A 4MNKA 4AZHA 2VTFA 3UESA 2CIPA 1ZU8A 4W93A 3KL5A 3WF4A 3S2CA 2WCSA 1E0XA 5IFTA 2DSWA 4PYSA 3KWXA 1E5NA 4B15A 3SUVA 3EDKA 4ZXOA 1JNEA 3MSGA 1I75A 1BYBA 1ISVA 3VSVA 4U3CA 4UFMA 1KGWA 3TTQA 5FL1A 5HXMA 1RH9A 3T09A 5CLTA 4EE9A 1E55A 4AD2A 4FK9A 1CWYA 3UCQA 1LF1A 5DEZA 3RJXA 1MW3A 2QMJA 3AZTA 3CZJA 3HMCA 3AHVA 4LQ1A 5AYBA 5D9OA 5JIWA 5A8QA 3CUHA 1LWJA 4CCCA 3SURA 1EDQA 3PZIA 4CD5A 1KCLA 5M03A 3MV11 3AYSA 4AEEA 3SUUA 3UG3A 1JL8A 1TQVA 2VX4A 5CG0A 3IJ8A 4QFUA 1UR1A 2F7OA 4P7NA 4P7LA 1RD6A 1B30A 1AQMA 4CKQA 3AJ7A 2X2YA 2BY3A 4F79A 3PZNA 4UZSA 8CGTA 1PX8A 3K1DA 2OSWA 2ZXQA 4FNRA 2XM1A 3VIHA 2D0FA 1QBAA 1FP8A 3IK2A 3QOKA 6CGTA 3VD7A 4X0VA 3VX1A 5ECUA 4LYPA 3SCSA 4L4PA 3WIJA 6TAAA 1OSEA 2NT0A 3N9KA 1XV8A 3NSNA 3I3DA 2GVYA 1K9EA 1BYCA 3VMOA 2WBGA 2FHBA 3BSHA 3PZGA 1V3KA 2J7EA 1GOWA 2XGBA 3WDHA 1H41A 4FNTA 1OGBA 1C92A 1W1YA 4GXPA 4D6EA 2J25A 4UOJA 5FOOA 3VSUA 3AZRA 1MFVA 1C7SA 1XD0A 1PPIA 3DX3A 2BVYA 3HG2A 5I6SA 3IANA 3OGRA 4H04A 3N12A 4L4OA 2VURA 3EDDA 2V5CA 4QAWA 1T0OA 1KR1A 4D6FA 4N42A 1UD5A 1VRXA 3K4DA 2GJXB 1UD3A 2GFTA 2PC8A 3HG4A 1XCWA 4AZCB 4WK9A 3VOCA 4AIOA 3KLLA 4UQEA 4YN5A 4ZE4A 3BVUA 4X0NA 3GYCA 2V3GA 1SZNA 2WCAA 3PZQA 5KEZA 1LQ0A 3N18A 3AICA 3CZNA 4JCMA 2E9MA 3VGGA 4TVCA 2FHFA 2E9BA 1ISYA 2BS9A 1GQKA 5A2BA 1K9TA 1JXJA 2WMHA 4URIA 2ZUSA 1VAHA 1D3CA 4JHZA 1TR1A 2D73A 2VR5A 2EACA 3PZ9A 2W92A 4AZGA 2GJXA 4PMNA 3F5JA 4FLOA 1CIUA 3G6LA 1VENA 2W4XA 1UA7A 1NH6A 3PHAA 4GZEA 1EHAA 3OLDA 3K46A 1UG6A 1UQYA 1WDPA 3TONA 3WENA 1WDRA 3AIWA 5E9AA 3QHNA 2J7FA 2PBOA 1WZAA 1GVIA 4M29A 2BNJA 5A6BA 2EABA 1QPKA 5A2AA 2QF8A 1BVZA 2XWDA 5HOSA 3AMDA 2XN0A 1QNSA 1QI5A 1VJZA 3GXMA 3ECQA 3RIKA 3UR8A 1WDSA 4P8VA 3DYOA 2ZUMA 4KMQA 4U3AA 1Q6DA 4TUFA 3S6TA 3FN9A 2BXYA 1C8XA 2W67A 1XD1A 1KBKA 1JDDA 4Z2LA 3T2OA 1E6PA 1GHSA 2YL6A 3VUPA 2DSUA 2J7DA 1ISXA 3D3AA 4AIUA 4MAZA 4HA4A 5E09A 4PTXA 4D6HA 2GSJA 3CHEA 3RPMA 1O7DC 4ZFMA 1MW2A 3BAKA 2Y2WA 2ALWA 2ZX8A 5I79A 1V3MA 2X2IA 3W24A 1AVAA 5EMYA 4TVDA 3M7SA 1MQPA 4LX4A 1ODZA 1GOOA 3W38A 1EO7A 1GPFA 2X8RA 5KZ6A 3AS0A 4WJXA 4BQ5A 3VD4A 3EJPA 4IM4A 3SEPA 3AIBA 3U7VA 2OSXA 4EAMA 2VX6A 1GNXA 2BXZA 2EO7A 5BRQA 2BHUA 3A21A 4AYGA 2OLHA 1BHGA 2F1AA 4DM1A 1MXDA 1J0ZA 2F61A 1TQTA 2W5FA 3WH7A 1UH4A 1VFOA 1XH2A 1VFFA 4AZBA 1TZ7A 4D6IA 1X1NA 4E8DA 1E71M 1NP2A 3QGVA 5A8NA 3EJRA 1BG9A 3WY2A 3UG5A 2JF7A 3CHDA 1H0GA 1TQSA 5CLWA 2V3EA 3WQ8A 1HJWA 1IZKA 2XG9A 5ABFA 4PMXA 4P8WA 1R75A 2WC7A 4B9ZA 4Z2JA 2WM0A 5BCAA 4V28A 2RGLA 2VC9A 2VCAA 4HZ6A 3L4XA 4J3TA 1LLOA 1WO2A 2FGZA 5EBAA 1UD2A 3CZKA 1HVXA 3BUQA 4EKJA 4Z2HA 5DF0A 3T08A 1UA3A 1H3GA 1J12A 4YHEA 4MB5A 4UQCA 5CXPA 3WL1A 3VO0A 3L2LA 3MO4A 1LWHA 3QHMA 2GDVA 2YLAA 1U33A 4LXFA 1OINA 2CERA 5E0CA 2V5DA 1J11A 2YOCA 1FP9A 3BAJA 3GNPA 3AHTA 3SCNA 2GUYA 4M56A 3II1A 4JFSA 1ZJAA 3SCQA 4F8XA 3VNZA 2J75A 2J8GA 3SCVA 3VIMA 3LPOA 4B3KA 2G8ZA 2JEQA 5A69A 3WY1A 3KE0A 1JF5A 5A95A 2WVVA 2VOTA 3FXYA 1OGSA 1EXPA 3FHAA 1OGGA 3POHA 5A6LA 1B31A 3AXXA 3CC1A 3W6MA 5I24A 2J47A 3ZM8A 1BFNA 3CV5A 1YHTA 4WSJA 2VT0A 3OGVA 4PSPA 1JDAA 3W82A 2CBIA 3VSTA 4PMOA 4PRWA 3VIJA 1ITXA 4MNJA 1B1YA 1E15A 1ECEA 3MUY1 5JBDA 3MI6A 2Z1SA 3W25A 4W86A 1XH0A 4JL1A 4FF5A 3RMEA 3VNYA 1V6WA 2XTKA 2BY1A 3EJUA 3W53A 2XVPA 5CGMA 2WZIA 3A6OA 3MUIA 2ZX9A 1CXHA 2XSBA 3LPGA 3EDFA 4P7QA 4AZCA 5AC4A 3AZSA 4PMQA 5HBFA 1I1XA 2WNWA 1QW9A 2X0YA 1HXKA 4QLJA 1H2JA 3CHCA 4M82A 3FNDA 3AIUA 1R7OA 3ARSA 4NZCA 3VMNA 3OZOA 2X1IA 1KXVA 2D24A 2Y8VA 1UKTA 5M17A 4NZJA 2A3BA 1V3HA 1P6WA 1J0IA 3DYMA 2WYSA 5FKYA 3A3HA 4J3XA 4XX6A 4HPGA 1TCMA 2VNCA 4LYRA 3AROA 1W2VA 4KRUA 3PZUA 5JBEA 1GOIA 3U57A 3I3EA 4ZE5A 1UH3A 1X6LA 4NF7A 3GNRA 3WQ4A 3PZOA 3D4ZA 1GQJA 4QCEA 1UZ4A 4PUEA 4PSRA 4WKFA 2B31A 5FD0A 1NOFA 1E4IA 4JZ5A 2WHMA 1GCYA 4H8UA 2WMIA 2XGIA 2D3LA 1M7XA 1MQQA 3GXNA 4MB1A 1HXJA 4OKDA 3LX9A 1VF8A 1K9FA 7TAAA 4HOXA 1E3ZA 2V38A 2WVVB 3WDPP 3D50A 1US2A 1OB0A 3SCTA 3WUBA 5I23A 5I3DA 2GK1A 3OLEA 3SIMA 3CPUA 1ZBWA 4DO4A 4YPJA 3IJ7A 3CMJA 4W5ZA 3THCA 2JIEA 4D72A 3GXTA 4F66A 2JEPA 1HKMA 3WDRA 2Z1KA 4ATLA 4MTVA 1J10A 3WNNA 3CZ8A 1BQCA 2ZIDA 2PWFA 4Z2GA 4WLCA 2EEXA 2O92A 1JZ8A 4TVUA 1GZJA 2VL4A 5CPSA 4AD3A 3WH6A 3UR7A 3WUGA 3CO4A 4PTVA 2UWFA 2J8FA 1JFXA 1B2YA 3N17A 3VM5A 3OIHA 3SCWA 1H0IA 5CQ1A 2VQUA 2YBTA 3ZT5A 2ESCA 4MPKA 3U5UA 4HMDA 3AI0A 4H7VA 4HP5A 3VIOA 3DX0A 1MVYA 2DIJA 1KR0A 1LG1A 4QLLA 1BF2A 3VGEA 4TOQA 2D23A 1W9VA 2XVNA 1UHVA 4J3VA 5IHRA 2D3NA 1OT1A 2PI6A 3BSGA 2DPEA 4JKMA 1V0KA 1BGGA 4FNQA 3TP4A 3VDHA 2YFOA 5BYWA 3S5YA 5CSUA 2WWCA 1KGUA 4J3UA 3IJ9A 4NXSA 1EDGA 2A3EA 1TUXA 4M8UA 3H53A 1CZ1A 3WQWA 2TAAA 1E43A 1J0JA 4GQQA 2J7BA 1UWTA 4F9DA 1BVNP 4CN4A 1KWGA 5EFFA 2XN2A 1GJWA 3BVXA 1HWWA 2WAGA 1PIGA 1CYGA 1J9YA 4PTMA 3IAPA 1GONA 3NSXA 1FOBA 2E3ZA 5FIPA 2GJRA 2ZX6A 3N04A 1QX1A 1E6XM 3VKKA 3WNMA 1XHGA 1CBGA 4HOWA 4LPCA 3LPPA 1PBGA 3VX0A 3WQ6A 1I1WA 2QPSA 1NOUA 4U2ZA 3PTQA 4P8XA 4C7FA 1UKPA 2DH2A 2WLZA 2DIEA 3AHZA 4W8AA 5JBFA 4GZIA 3BCFA 1KBBA 1E1EA 1V6YA 4M81A 1H49A 2W61A 1E40A 3CMGA 3OBAA 1SFSA 1UKQA 4MJ4A 3GM8A 8A3HA 4AC1X 2WVTA 2XJ7A 1M01A 1QI3A 1E3XA 2CCRA 3ZMRA 2FE0A 2E0PA 2WANA 3BUBA 1IZJA 4OOUA 3AS2A 2E4TA 2CBVA 1CXIA 4R27A 3VM7A 2W66A 2VZOA 1L0PA 1W2PA 1GOKA 1GQLA 1GHRA 1EH9A 1GUVA 1HX0A 1TE1A 5A6SA 2F18A 3K8MA 3DECA 5C70A 3KEHA 1WZLA 1UD8A 1C93A 2PWGA 1R47A 4TTUA 3W6LA 2VCCA 1XGZA 3WUEA 4JHOA 2A3AA 2WB5A 5DT5A 4CVWA 5E6YA 1B3VA 3MMWA 3WH8A 1HT6A 4QLKA 1E4LA 1QI0A 3FY1A 4NXKA 2CEQA 5BROA 3LMYA 4AXNA 1VEPA 5D4YA 1Q6CA 1W9PA 4MJ2A 4CU6A 3ZR5A 1JYVA 1V3IA 2CNCA 1QNRA 1AMYA 4XZWA 1BYDA 3WELA 3DDGA 4MB3A 3BC9A 1QI4A 2XVKA 5A6JA 1CGWA 4UFKA 5IDIA 3TTSA 3SUSA 4PCSA 1NP0A 1JAKA 3AMCA 3BUDA 1WAWA 4DWSA 1OWQA 1DWFM 2VZSA 1G5AA 2OWXA 5EB8A 4AYSA 1JZ5A 5E1QA 1JXKA 1GOMA 4E2OA 3OLGA 1QHPA 4NI3A 5D9MA 3AOFA 1BGAA 3T2QA 2VX5A 2XIBA 4CUCA 5A8PA 1EHNA 6A3HA 3WF0A 4JFTA 2E8ZA 2XWEA 4A4AA 4RE3A 2XVLA 1W3HA 3NSMA 5E0FA 1JZ7A 2XSAA 1QNOA 2WMIB 4QCFA 4JFWA 3RDKA 4D71A 3VGDA 4CU7A 4XV0A 3WNLA 2FDMA 3CUFA 4PN2A 4E8CA 1E56A 1R7AA 3WBAA 2ZXBA 2EJ1A 3M6DA 7A3HA 2VUYA 1OIFA 5BXRA 2XN1A 4AMCA 3W26A 5DMYA 3AMKA 3D5HA 3CLWA 1BSIA 2OWCA 3ZJ6A 4CCEA 5I77A 4HPHA 3D51A 2WW5A 3WD2A 2D2OA 4XB3A 3CUIA 1CLVA 4N0RA 1KXTA 1PAMA 3CZEA 1DTUA 2FYVA 3UEQA 2OW6A 3GBDA 2DSZA 3A23A 3WY3A 2E9LA 2F1BA 1KWKA 2W91A 1KTBA 3J7HA 3EJTA 2J4GA 2MANA 4TX8A 3OA5A 4B16A 1J0KA 1E1FA 2V3FA 1HVQA 2D0GA 4RE2A 1HJSA 3DX2A 1E4NA 1H4PA 3APGA 1C7TA 3WMSA 2O9PA 3NIYA 5BXSA 1FH7A 4BA0A 4DUXA 4CN6A 3WNPA 1HJXA 2O9TA 1SMDA 3GH7A 2OYLA 2DEPA 3WQVA 1WZKA 1QWUA 5E6ZA 4OZOA 3ZJKA 3SUWA 4U33A 3AS1A 1H11A 2PB1A 4WSKA 1XC6A 1CNVA 2WSKA 1WE5A 5I2UA 5EFDA 3CTTA 1FH9A 3BMWA 4UR9A 1XYFA 1BAGA 3ZIZA 2PWHA 3HG5A 3KL3A 1KQYA 2PF0A 1DEDA 3WNOA 1NWUA 1OD8A 1KFWA 1AQ0A 1QW8A 2WXDM 1W3JA 2BV9A 4U5IA 2YL8A 2YDRA 3RCNA 1HKJA 1QI2A 1D2KA 2XPKA 4UFHA 1WNOA 2ZX7A 3ALGA 1VB9A 1LL4A 3A47A 3H54A 1V02A 2ZUWA 2F2HA 3OLIA 2G3IA 2HISA 2YDSA 1R8LA 1TMQA 1XH1A 1LL6A 3BUIA 4PBGA 1GW1A 3LXBA 2EPKX 1CEOA 3EDJA 2WHKA 1MXGA 1W9UA 5GNYA 1GOQA 1RP9A 1UWIA 1R86A 2VRJA 1E70M 4P7OA 3DDFA 1DWAM 4ZXLA 3EMCA 5A6BD 3DC0A 3WEZA 1OM0A 3BAWA 3T0AA 4UFJA 5D8WA 2XVGA 4ATWA 2WMJA 2EQDA 4JFVA 3HN3A 1VIWA 1BYAA 1O7AA 4H2CA 1F4AA 3NDZA 4ZENA 1VFUA 1KXQA 2WVUA 2ZUUA 4WF7A 2XFYA 1CENA 3CZGA 1R33A 2BVTA 4IUGA 4WIWA 4JL2A 2J74A 3UERA 2J7HA 2XHYA 3WD4A 4FLQA 4MAVA 4UNIA 1OT2A 2O9OA 1GORA 1XRVA 4JIEA 3DX1A 1UOKA 4PMUA 4K68A 3CZLA 3B8SA 4U31A 4JCLA 1DHKA 4BCEA 4BZYA 2WSPA 1WDQA 1UKSA 3EJSA 1W9DM 1JIBA 3AIQA 2X05A 1C91A 1BPLB 3AXHA 1C3FA 2J77A 2RGMA 3BAXA 3PTMA 2C7FA 4MNLA 4EANA 2YIHA 4WKAA 5GNXA 1KB3A 1DWHM 2NW0A 1XCXA 2WMGA 4HMCA 1N82A 4JAWA 2UY5A 4AZ7A 1OIMA 1JF6A 3MANA 1JZ3A 1W9BM 4PMDA 4W7VA 4AD1A 1Q6FA 1W1TA 1CECA 5IFPA 3NUKA 3GTNA 3AMLA 3BAYA 1OCQA 4W8BA 7CGTA 4CD4A 2A3CA 3AQUA 2X0HA 3ARXA 4R5EA 4F9JA 3L4UA 1L8NA 3ARTA 1DWJM 4P7RA 1CTNA 1V03A 4MNMA 4PMZA 1B3XA 4J3WA 2JFEX 2AAAA 2CHOA 4Q7NA 3OZPA 2XUCA 1C8YA 5ABGA 3ZJ8A 3WMCA 2J62A 1CGVA 1CXKA 4B9YA 1TVNA 2EBNA 2W62A 4W7WA 5A94A 1ZJBA 4GKLA 1W32A 2F8QA 3RM4A 1G1YA 1MQRA 1G0CA 4Z2KA 4XZBA 3AMGA 4HA3A 3KLKA 3GXIA 4CN1A 3DX4A 4UQDA 1UR0A 1V0MA 1FHLA 2UY3A 4Z2IA 4CD8A 2YL9A 1PZ3A 4DWSD 3D52A 2QHAA 4AZIA 1JZ6A 2WMFA 4M80A 4E4PA 1FFRA 3QR3A 4W8LA 1HKKA 2WC4A 2Y4SA 5LYRA 3A4AA 3VD9A 2AOSA 3WEMA 1U2YA 3VU2A 5GPRA 1H09A 1VFMA 2G3MA 1SR0A 3VIIA 1CGUA 1DP0A 3L4YA 3AIVA 3GNOA 4ZEPA 1WCGA 5LA0A 1BTCA 1B3WA 3WD0A 2WZHA 4KRTA 1VBUA 3FHQA 4TX6A 2BHZA 3LRMA 4J3SA 3PZVA 4HTYA 4JFUA 1NWRA 2EXOA 2J7GA 3ZO9A 3ZQ9A 1TQWA 3ARWA 3RILA 2ZXAA 2WLYA 1W3LA 2WBKA 3BCDA 4GO8A 2C8NA 4U2YA 2QPUA 1C90A 3IAQA 4HU0A 1J0HA 1TQUA 2NT1A 3UETA 2YA0A 3VMPA 3WFLA 3MMUA 1HF6A 2WMKA 1ISWA 2CYGA 3AFBA 1EDTA 2D22A 4UFLA 3AIRA 3JUGA 2OYKA 3S5ZA 3WEOA 1ZBVA 4AMWA 2DDXA 2BY2A 2QLYA 2DT1A 3WY4A 4AD0A 2X2HA 1OBAA 3W37A 4Q22A 4FLSA 1MFUA 5A6MA 2WWDA 4FNPA 4W7UA 3LPFA 3AHYA 3RM8A 2VZTA 2VCBA 3F5LA 4HMEA 4W5UA 1LG2A 1ODUA 1ZL1A 4S3JA 5AYIA 3T2PA 1ESWA 1QWNA 4OGZA 1HN1A 4H41A 4UQBA 2ZOXA 2VJXA 4GI8A 1XYZA 4V27A 1CXFA 3ARZA 3UG4A 1EGZA 4Y7EA 3W4RA 2X09A 1DWIM 2CKRA 1ZS2A 3POCA 4CD7A 1FH8A 3L4VA 3GBEA 1NM9A 1HJQA 5A2CA 5HDRA 2JF6A 2BY0A 3B9AA 1ISZA 3OB8A 1PEZA 1MYRA 3ZT7A 2J79A 3CIVA 2OYMA
chains in the Genus database with same CATH superfamily
2WPGA 1FL3A 3CC5B 4KDTC 4ORGB 3MZGB 4XMPH 1XF4A 2PYEA 3REWA 3VXMB 5HY9B 5D1QD 3HAEB 3LZNA 3T0EB 2V9DA 4OQTA 3UPWA 4D3CH 1A02N 3E8UH 4JB9H 3G3MA 3GE7A 3TYZA 2GLKA 1JPTH 3B56A 4XTIA 4S39A 4G8GD 2FBRA 1DJXA 1PZCA 4Q8TA 4HEPG 3RIFK 2Y2TA 4UUIA 1YEDA 2DRUA 1AP2A 4JS3A 3CAVA 4G8FB 4ELMA 2C16A 3CDCA 3NFSH 2IBBA 5IQLA 2HTLD 3GMPA 4Y7OC 1E6JL 4QRRB 4D0DA 2P7TB 4OD2B 1QYGL 1EX5A 3GXPA 5K93A 2WTRA 3OO2A 4YQXL 2CJTA 4GX9A 4JHVA 4D8LA 5I78A 5LNUA 2VLKB 3QG6A 1N2RA 4PRIB 1INEL 1CI3M 3AWFA 1TG7A 1XKJA 2E25A 4R96A 4FJYA 3F84A 4QRPB 1C5CH 1G1CA 5ICUA 3MC0A 2OI9B 3NVTA 2GSGA 2LU4A 5AW7B 3WF3A 4W84A 5BWFA 1QFUL 1RBOB 4FNSA 2XFFA 4ZS7H 4P04A 4MXQC 5LNGA 1WBHA 4GO9A 4A2GA 2N7BA 4OZGF 3SJVE 4AEFA 3IGKA 4QHKI 3B7SA 2VN4A 3CN2A 4W1TA 2OXNA 2FWSA 4DP2X 2JIWA 2P1FA 1W15A 1J8KA 3NDOA 1HKLH 3H9SE 4FQJL 1GVOA 3A4WA 1S1RA 3NPWA 1RZGA 4JANB 4HCIA 1M53A 3HB3B 3P4MA 4KOBA 4M8QA 5AVUB 3GIPA 4LUSA 2OK0H 1YEFL 1IFGA 1K5NB 1YUHB 1ZPLA 4MWAB 4DZ5A 3L7EA 4PJ5B 1G7QB 3HW7A 4C55A 2NRDA 3UTPE 4Z7NE 5LKYA 2D3VA 3H2PA 4JFFE 3FAXA 5IHLB 2DI8A 5IJVA 1K7XA 2H8XA 1MNUL 2Q8ZA 3P14A 5IGXL 1M9HA 5JW3L 3K8KA 4FABH 2DAVA 4BWTA 1V05A 1T7WA 1UM5L 1XCQB 2WXLA 3H7UA 1KJMB 4XBSA 1B9ZA 5CSSA 1HNYA 1VJSA 4NOFA 4GY4A 5ABHA 4WUKL 4Y4FB 3PAYA 1R85A 4S3GA 3S46A 4TNFA 1UR8A 4XBGA 1YY9D 2P5EB 3C8HA 3Q9PA 3VXTA 3CBWA 4JLRA 1N5YL 4F57H 1RCQA 1MEXL 1J5OH 1SDDB 1PZ2A 1FLRH 1BX2A 2WZ6A 3GDBA 4Z7WE 1TTQA 3FYOA 3GSVA 4Q7BA 2LOEA 1LE9A 1W1ZA 2NQLA 4N2HA 4L3AA 3GH5A 1SW7A 3PP4H 4HJFA 1MI3A 5C07D 3BKJL 3QEUB 2B3IA 2UX7A 1MDTA 2VSDA 3CXHK 5GGVY 1LZOA 3BVTA 2Q10A 1I9CB 3UTTA 1T2XA 3LBCA 3LZOA 3TCEA 1KQZA 1GH7A 4RW5A 1UR4A 1UADC 5DGRA 4KI5F 3RWJB 3VTRA 3TV3H 3EYFB 2X2UA 3FYIB 3MRMA 3UO1L 1TA3A 4ZMNA 1KCRL 2Q76B 3NCMA 4L37A 5K69A 4FQLH 1GJUA 4R3SB 4YZWA 4UM9A 4UM8A 4PVBA 3SPVB 1W1B1 4D8PB 1AQDA 3CV6A 1A1NA 2DIKA 5CGYD 2XWXA 2A3HA 3AHXA 2QXWA 2XWBB 1HL8A 4JO8A 1Z9SB 3B5HA 4P9HC 4YYFA 2IKGA 1GOFA 3PPHA 1WPCA 4PMYA 2APXA 1MW1A 4YZFE 2R83A 1RZFH 3QXDB 4WKZA 4NRSA 1PTDA 5BQDA 3R19A 5I19L 2BIMA 3V10A 1G4MA 1UC4A 3INPA 4G6CA 4LVBA 4ML4A 2XWTB 4YHNA 1EOKA 1ZS8B 4ZQOA 3HBLA 3QNZA 5HDWA 1DUYB 1WCBA 3UTOA 3ZVHB 3RWGA 3UTSD 2XTSA 1A3HA 1NUNB 5C0ND 5KYXA 2I9LB 4HU2A 4YDLB 4YL2A 3S9ZA 1A64A 5HGDA 3R4DA 3FQRB 5DO8A 2Z4QB 4PJ8A 2CJSA 3BZ4B 5DUPL 3U1SH 5FL0A 1YEEH 3D30A 1NLDL 3ATFA 4N2LA 4O8RA 3BZEA 1A6UH 3L1OH 1ZEAH 2R1PA 1ZIAA 2WHJA 3PG2A 2YBUA 1PIFA 3FAWA 4IL2A 5E2TH 1SYVA 3FCTA 5T1DL 4Q33A 2WOQA 5F8QC 3HV8A 4UQ3B 1QSFD 1YECL 3ABOA 5CSGA 2NX5D 5SWUA 1JCLA 3CL7A 2FH8A 4HCRL 3NIDF 1L5GA 1DQTA 2HH0H 1P5BA 3EB2A 1NM4A 1Y07A 4RDYA 5D2LA 4JICA 2YFNA 1EAQA 2CPUA 1HZYA 2H0JA 4ODUB 4YDJB 3OMAB 2O9RA 3NOEA 3UYIA 4PUUA 1W3KA 1J5DA 1M7DB 5EUOE 1XDLA 1T2JA 3KYOA 1YPXA 5HVWA 3APYA 3H24A 3UXAA 4RL3A 4S2CA 3QZLA 5IROD 1IF2A 4K7PX 3CFJB 4Z1AA 1FFPB 2YK1L 1A6VH 3VH8G 4L8SB 5FJOA 3IIXA 5DMLA 2EDLA 3H55A 5BRPA 2ZRUA 3B9EA 4XO3A 5HVGB 5D05A 3SIZA 3W2UA 1JHLH 3ZS4A 4PWHA 4FXKA 1A2YA 1K8DB 4DWSB 3CGTA 4ISVB 5K39A 7PCYA 4W89A 2AL1A 2CBUA 2IGTA 1QWHA 1AG0A 2BWDA 5ECJE 4JG5A 3FQ4A 1HJVA 4DZ8B 1R2TA 2OT1A 2C9VA 5FF4A 2ADFH 3WJWA 1KTDA 1MI5E 4AU0A 1FNFA 5E0KA 4ZTOH 4ZUVB 4EF8A 2G4FA 2JKAA 2GIYA 3C75A 5IF0B 1FSKC 3S8GB 3T3MB 4UCFA 3TEZA 4DYKA 1DQDH 1E9PA 2VMDA 3L7EB 4TSBH 2W63A 2VEGA 4UZUA 3PM6A 5IVXE 3TC9A 3TU6A 3DPBA 2CLRB 3WQDA 3NQBA 2QCDB 3VSQA 1BVWA 5HI4C 5EC1A 4J35A 1QPXA 1BVOA 3BLLA 1D5MB 1WJ3A 2UWEE 2J7CA 3E49A 3M1ZA 4AT6B 3E02A 4TTGA 4DGWC 2L04A 5L0QC 2NXYD 4PJIB 2PDGA 3MY9A 3MU3A 4GZ7A 4Y9AA 2BOGX 4QNEA 3K0YA 2A6DA 1N8FA 2G41A 3BWSA 3H9SA 4LGPB 4E5XG 3ONCA 3Q7JA 4LRIA 3BD4A 2BVDA 3S1WA 1VFBA 4IJ3B 4OZHB 1HYRC 2C0HA 1ND0A 4QQ3A 2EG7A 2O56A 4QRFA 5M5DA 3L5LA 2WJEA 4L9YA 1ES0B 3CCHB 5CGYC 4KKLD 4NP4L 1Q6EA 4ORGA 4EN2A 1DZBA 1FWXA 1JDCA 1J7VR 2IO5A 4AM0Q 2NY2D 2VDNH 3QUMA 3I4KA 2QV4A 3ZHFA 4KW2A 5KSUA 4C7GA 4AWUA 3BOLA 1KGXA 1XF3A 2WMPB 2N1TE 1LTDA 2ED8A 3H6JA 4DN3H 4MQSB 2AJUL 1M7UA 1FZKB 4GRLD 1EC8A 4YX2L 2F5AH 1F6PA 2VO5A 2KC0A 3RTQB 1U91A 2R59A 3G1XA 2B16A 2D0HA 1RZJL 4IX2A 3GJFA 4YS1A 5FF2A 4NVTA 1SY6A 1V8HA 3QT2A 2NQHA 4ICCX 1IE4A 3QXDA 2QSVA 1CDGA 4IGBC 1FAIL 3RBSA 1UH2A 4WHBA 4UDTA 4RIRA 2X4OA 2MOQA 4EE2A 2ZADA 2JALA 3M4HA 3WAKA 2G3NA 2VI0A 3VI4A 3GF8A 3MA7B 1ZB5A 2NY6C 3HNVH 1RJZB 1TPXB 4WWKA 4GUIA 2YZ8A 4JOMA 3QW9A 5HD8D 2X4UA 3EYVB 2HA1A 3E6HB 1J9RA 3Q2WA 4MS8D 4TUJA 1G9NH 1PUDA 2PUZA 3BUPA 5KTEL 2AQSA 4ALDA 4Y2DA 2X4PB 1K4HA 3GZAA 4FB7A 4BELD 1NBYA 1KGYE 4B95C 3HAEG 4HSCX 4YX2H 5LHFA 4X5WA 1WZMA 2CLIA 3MMDA 5F2LA 1V79A 2PDMA 1TZZA 3WLWC 4KK9C 1OD0A 5AHFA 4B4FA 5MEQB 1E6SM 3B9DA 5CEXA 4WJG3 1MUWA 3BICA 3FFSA 1I2NA 3W53A 4YDMA 1YNKL 5LXVA 2GGHA 5A2LH 3S35H 3QFJE 3GDKA 5DUMH 2WUCH 1FCBA 1SZFA 5LUMA 3W1ZA 1S2WA 2J9XA 3T6VA 2APWA 3H8NA 2IBGA 2Z93A 2WC3A 1LJYA 3I85A 1IGIL 3CQIA 4U7SA 2FEEL 1HXMB 4JFOA 1XCQA 2WKLA 3RTLA 4BFOA 1TPUA 5MENB 4IICA 2A79A 2Z2UA 3LZQA 1YECH 3PFMA 3HI5L 4JEQA 2VDRB 4Y4FA 2BODX 3E1F1 4BUHA 3TYBA 3MUGB 3L2MA 5DHYA 4PEKA 1PTGA 2IOMA 3MU7A 2QHLA 3WKPA 3QPYA 3P0XA 3UAEA 4AAJA 2QEZA 3V6BR 3CFKA 3DYPA 3WE6B 2VENA 1V54B 4GBXD 4OIFA 8FABB 1S9XA 3DG6A 2R1KA 2WZAA 2KLSA 5F0LB 5B7MA 4JDZB 1R0AH 3HIJA 2YD5A 1EPFA 2KERA 2VH5H 2C18A 3COOA 4XP1H 3RITA 1F7BA 3DFPA 4H8WC 4LYQA 1FIGH 5LAXA 5TDOB 4XN1A 1FFQA 4U3SA 5FDWB 4OV5B 2PP1A 1VPQA 3LHYA 3O9WA 1J8HE 1AGBA 3BAIA 3QUYC 3ABRA 2VRQA 4GIEA 4H1LB 3TQVA 3VDAA 3DBSA 3MLSL 1ZSHA 4ZMLA 5E23A 1E4KA 4WO4D 2NWRA 4PGDA 4H9UA 3DX9A 2JTYA 1RZMA 3O41A 4NIRA 4NQDB 4UTIA 5FCUH 1CGTA 4P2AA 5XINA 3DN5A 4DZHA 1IZCA 1V08A 2CZEA 2CZ5A 5ACMA 3EYPA 1TV4A 1FVEB 3QKEA 4O13A 5I3JA 1NLBL 4Y6GA 3IVKB 4Q6XA 2C1HA 3WIHL 2GTQA 1OFOA 1AOHA 4OLUH 1A4LA 3SCRA 3WIFB 5IOKA 2I5IA 9CGTA 2E7HA 3BEWA 4PLNC 4UZGA 5I8CB 5A6KA 2BOLA 3QJQB 4XN9A 3H2NA 2XFWA 2CETA 1G4EA 3B40A 5INCB 3CHVA 5DRWA 1EUAA 1DVUA 4S10A 2E5CA 3V9FA 3W7CA 5FUOH 5T3ZE 1WDDA 3HC0A 2CIIA 5IW3A 4FA8A 4UTAH 1TSRA 4G6FB 4WTZA 3EHBD 4YHKL 4FQCH 2VR3A 2B4GA 4WUUD 4CNSA 5DCCA 2F5BH 3EOLA 1HAUA 3B3IB 4WFEE 1OPGH 1IGML 4EN3C 3MGTA 3ZY7A 4G9FB 4KS0A 3GC4A 3ETBF 1S2CA 2F7RA 2XRAH 3NN8B 1GG1A 3UZJA 3THQA 3DXIA 2FX8L 1CXLA 3EH4B 4ZQTA 4BQ8A 1IBGL 4KIEA 4NJJA 3U36B 4UTHA 4GQBA 4Z0BH 5E2VH 1F07A 1HCFX 1NJ9A 1XXXA 1M3UA 3QZ6A 4O02L 3DTUB 4GS7C 4NO3B 3EWXA 4FRWA 4WGHA 5AZ2L 1L9SA 5T5NG 3VD3A 1EYWA 4BKLB 4YSEA 3ES7A 5I3GA 3PYCA 4ZD3H 1CFSB 3K8LA 4LSVH 4PTNA 3GTXA 2BFGA 2CK2A 2PRMA 2HRHA 1U83A 4D0CA 5IQNA 4E5TA 3OB0H 4KRMB 1YNLL 4AMXA 2X4OB 1V6TA 2V30A 3E0FA 2OLDA 4XPAH 4LLYA 1TIUA 1QHZA 3GH4A 3LN3A 1FNHA 3KPRD 3QUMH 4KKLC 4OSUH 4PB0L 1IAMA 1MLBB 4BE6A 1L3WA 4D8AA 1P4IL 4FXKB 2R4RH 5BQ7A 4Z0XA 2EF9A 3FF8A 1BVNT 3NPVA 4PJAF 3E2HC 5HR6A 1VP5A 4QJ1A 4XX5A 1WFTA 2VDRH 4Q56A 1DSYA 3QB7C 1YYAA 1JZEA 3GR8A 2R94A 3MBXL 2AQ2A 4AD4A 1NOLA 4A67A 1V55B 2Y9RT 4WFED 4FZ8H 4QXGH 3SE4C 3CG8A 3VFMA 4OZFB 3EJQA 1NGZB 1KCRH 1X6UA 3EOAB 5D2NB 5DC4B 1H15B 5EHFA 1QLEL 2DU2A 4ZUSA 4V1DD 4ZX3A 4ZD3L 3V7AE 5FO7B 2PGWA 2P42B 25C8L 3KD4A 4XQ6A 1OAUL 3TJPA 1AL8A 1EJFA 3G6AA 2VYOA 4LUJA 2CITA 4MDOA 3T6WA 4IGBA 3ZE0B 3CSFA 3O8XB 3KWSA 2W5PA 4K8EA 1OZTG 4JKLA 5DEGA 1EGJL 5F7EH 3CK5A 2VXVH 4Z7UB 1G9MH 1N6VA 4JFYA 3WBEA 5K9OA 4YGVB 1JPDX 4W9IC 5IOPB 2H32A 1HWHB 1NGYA 1S7VB 2EPMX 4Z78A 3VIFA 4LF1A 4BQ3A 3KTCA 3VTMA 3VA6A 3PN8A 3MV8D 4DP9X 3W70A 3BFWA 5E2JA 5FA3A 5GSVA 2I16A 2OFJA 3K30A 3L21A 1Q1JH 1KB9K 1SFHA 2BP8A 3IXAB 4L2YA 1JI1A 1U8HA 2BINA 2Z92B 3VQMA 3ZZSA 4E38A 1TVHA 3S88L 1DDHB 1H1NA 2HS6A 4PRNB 3UZVB 1YDNA 2OCFD 3H22A 5KSAD 1W3NA 5B8CC 4F7MA 4GI6A 3BHBA 1K3UA 3K71B 2XINA 3PBMA 5HI3D 1HP5A 4HT3A 5ID1B 3CL8A 4PRHB 3JU2A 4NQEA 2XZQH 3U2OA 5AHLA 4W6XB 3BLPX 2CMRH 1WX0A 4AY7A 4ERSL 1FWHC 2Z6IA 3XIMA 3IDXH 4J6RH 4HIXH 4QT5B 5C71A 5K9DA 1ZGLP 2QKFA 3AAMA 1N55A 2VZUA 4ICWA 4Z7QF 2LVEA 5F3BA 5FLVA 4LB8A 2D7NA 2DUZA 4PJ8C 1G43A 2NUTB 3V4PA 3S1VA 2IV9A 4YS4A 1O95A 4JDBA 4OVXA 3B8WA 4AH2A 1CL7H 3HS0C 4XNAA 3MZTA 1NY1A 3NRPA 3VGAB 5LIXX 1K02A 2VLJE 3BEWB 1EIBA 2XV3A 5HYSB 3QIUB 3V5HA 5HGBA 5I8CA 4J7RA 4PBXA 2ISSA 3GDRA 4EXAA 1GG0A 3QP3A 2GABA 4L3FA 5JPNA 4RMBA 5AYTA 4HZ8A 1MW0A 4PL1A 1K6AA 4XKYB 2DKUA 2BP1A 3V4PH 2Y6ZA 3BQUC 3BPCA 3CAKA 4YTRA 2IXVA 2LU5A 1XG4A 4FKKA 1P7BA 3LHPL 2UY4A 3GSWB 1JK8B 2R0KL 2QVIA 2DJ4A 2Y24A 3GWJA 3PAVA 2RJMA 1E6JH 3PWVA 4RCAA 1HIMH 5DDHB 3LK6A 1XIWD 2A9BA 2VQ1A 3FC8A 4NENB 5EU6D 5TF1L 4CVUA 1TFVA 4FQPA 5EMUA 4UTBA 3HAEA 1NF7A 2DGAA 4G9FA 2P3ZA 3HRZA 3MCLL 1P1ZA 3GLAA 2R29L 1GW9A 2PDWA 5U4NA 3HFMH 5H8PA 2DH3A 3TA9A 3NJIA 5IW1B 2Z8VC 4PCTA 4NN5B 4HUCA 3K2GA 1SVBA 3T3PE 4HWZB 4H7CA 4O52A 5I1GH 2QJMA 1K5WA 1GY2A 4KQNA 3BN3B 4Y5YA 3WSQH 4BQ4A 1E6OL 1N9PA 4KWVA 3NEEA 4XH2B 4GPNA 1D6VL 3NL2A 1UA6H 3OZYA 3IEAA 3MUGA 5M3WA 1JWSB 4M1RA 2CKBB 4PV8B 2CO2A 2O6DA 2WYHA 2VVNA 3NFPA 2PYEE 4FCAA 1ZCCA 1E1CA 1DQWA 1MCNA 4GYFA 4JY6A 4K8RD 2ORBL 3FOMB 4WJ5B 3XINA 1CLXA 4C1KA 4CL7A 5CBIA 3ZYIA 1OYAA 4YMZA 2G5RA 2WKGA 3VWKA 1CK0H 1FGNL 1FDLH 2J3SA 2X28A 2YD9A 3MTRA 4UYQA 3SD2A 5LVEA 4GQ0A 4ELME 4LY4A 3GMNB 5DANA 3SQLA 3OKNB 1QOQA 2VC2L 3AXIA 1QABA 2YUZA 3QULB 2VR7A 5EOQL 4CC1A 5D4IA 4FXTA 2BIHA 1Z6JT 4G9DA 4OZIB 4JFXA 2I9UA 4AIBA 3W71A 3VFMB 4H2HA 3RUGB 3IETA 1TB3A 5KANG 3WDQA 3RO8A 1IWBA 4AZ5A 5CGTA 1RY0A 4MWAD 2PWDA 4H8HA 3W1RA 2R0ZH 1ACYH 3EJYD 1FHDA 1NMBL 1JXFA 2NY3D 4MLIA 2J6XA 1UWGH 5I76A 1H3XA 5ID0A 4KKXA 4GAJH 3V4UL 4Z7QB 4GT7A 1SMAA 5C0CE 3WKZA 5DC2A 5L2KE 4DN3L 1J01A 5C07A 5IOPA 1BECA 2CBMA 4Z7VF 5E4EC 1R3IL 2NXYC 2Y1ZA 3ABGA 2EO9A 4MNQA 3GFYA 2MNWA 2QQLH 4XBGB 4Q8BA 1UWRA 3GBNH 2PBGA 2DJMA 4PCPA 1GPWA 2CIIB 4KAQH 4AYMC 4X22A 2VTFA 3GMQA 2HVBA 1KNOA 1UENA 3HG1B 1A0DA 1IGCL 1JOIA 4X4YA 2CIPA 4W93A 5DXYA 4TN9A 3US9A 2BNQD 4WTZG 2DSWA 2F74B 3B3DA 4FX5A 4E9QA 2J1KA 1QLRB 4FZEL 1KEGH 2JK2A 2BS8A 4IRSB 1XGEA 4MSSA 1UBSA 3MSGA 1TZIA 4JZJA 1BZ9B 1BYBA 4PBWD 1QLFA 1H9VA 3TVMD 3E38A 4U3CA 3VSVA 4UFMA 3KUMA 3EO1A 1NIAA 1VKXA 3TTQA 1OOAA 5FL1A 4HWEL 1IT9L 2PP8A 4HALA 1ORSB 5CLTA 1VSCA 2ZKYA 4EE9A 4V1XA 3R0NA 3DX8A 4NB7A 5EB9A 4DGIH 4GXUM 1VCGA 1CWYA 1A5LC 1LF1A 3CEUA 3R11A 5DEZA 4OCSL 1FO0L 3B4NA 3W1LA 3IDMA 4WKZB 5AYBA 3OJDA 1B88A 3P69A 3D25B 1KYFA 2BVEA 4H88H 4XRCB 3ZXWA 4GG8B 1HS6A 4LRNH 3GZKA 4P8QA 1JCXA 5A8QA 1LWJA 3P2VA 2XUWA 1EDQA 3CSTA 3L23A 1EXUA 3ULAB 3O4OB 1HINH 2ZFAA 4WWPA 1E90A 2RH0A 4LVNC 3MR9A 1C9SA 1R3JB 3M44A 3IPWA 2YUWA 1Y18B 4FQHA 5E5UB 3VWKD 1P69B 1LO3H 3E9TA 4WO0A 4F27A 2I7OA 3SUUA 1JK8A 2CR0A 4M5ZL 1JL8A 2NY3B 4TNVK 5C09A 2RTTA 3JTTB 3RYMA 2GUOB 3UC2A 3SHSA 2BLEA 2YXOA 4R33A 4M4RA 1X44A 3MRCA 3P62A 3V6ZB 2CHZA 2ZF9A 4P7NA 1AQMA 2AJUH 4QXUH 3AJ7A 2ZOKA 3ULSA 4A68A 3L3OA 3ATZA 5J04A 2BY3A 2GTZA 1XQKA 3EYUH 3UEZA 4FXFA 1NFPA 3E8UL 5CAHA 1NC4D 5DJDA 2PNDA 2OMWA 1J5OL 4NKMB 1LGVA 2OQJB 4MKNA 1AMKA 1X5IA 4FHKA 5FF3A 5CJOL 2R2CA 1PX8A 4QHMB 8CGTA 3GFXA 3C60A 4MWFB 3NCJH 4WUKH 4N9EA 1IE7C 3W7DA 1YN7B 3W9ZA 1NCHA 4G7SB 4JZNB 2D0FA 2O6PA 4RZKA 4BZ2H 4AC7C 5AVTB 1U8CA 3QNYA 3ITTA 2Z92A 3PDDA 2ITEA 3QOKA 1FNSH 4FD0A 4KTYA 5J1AA 3UMTA 5ABDE 3GT6A 3LCXA 2Z27A 1VGKB 4MJZA 3CS2A 1GVQA 3V0UA 3SCSA 3W22A 3ZKQD 2PDLA 2X16A 4KITB 4MKVA 1ONQA 5HHPB 3WIJA 4LF3A 2K3HA 6TAAA 4ZUVA 2V2WA 2NY1B 3FQNA 2WKOF 5MERB 4FA6A 4PREB 5MKGB 3N9KA 3ETSA 2WLLA 4A3UA 1XV8A 1IVTA 1H7XA 2GVYA 3F58H 1AW2A 4MMYA 1BYCA 1K9EA 3AXMA 2DYPA 2NW2A 1G7HA 4QX4A 3MO1B 5AUMB 1VF5C 4I1NB 1UWXK 3BSHA 1DORA 4EOUA 4I18B 5H2ZA 1FNEB 5HUPA 1LQSR 4IIQB 1GOWA 1YADA 3GVQA 1IM9A 2XC8A 3O9WC 1PLCA 4ALAH 4FNTA 5HSFA 4DZAA 3LB0A 3PS7A 1EBPA 1MI5A 3RL1B 3WS6C 1GXEA 3X3FL 3MBEA 3O8XD 4XX1E 1PYMA 1W1YA 4GXPA 5LSMA 1YJDC 5IFAH 1RR2A 3B5TA 4S1RL 3IDGA 2ZF8A 4OD3L 4G1EB 4QXWA 4X2RA 4DVOA 1TYRA 2UXGA 1A5CA 4R4BB 1AJ2A 1HH9A 1C7SA 3F4CA 1G7JB 4YR6A 4Q58C 5JORA 4PR5A 1XLJA 1L7TH 3HG1D 2Y2YA 4JE4B 4HCRH 1M7JA 1MEXH 4ZMPA 2QDWA 3IMUA 3L3OC 5MHSE 3L5WA 2A9DA 3DHMA 3HB3D 4YLCA 2QJNA 4X6EA 5ICZB 2IDSA 2KKQA 4UTBL 1RJLA 2GWNA 3L3JB 3T8MA 1SN5A 3RDJA 4TPRH 3ULUE 2VURA 1NVMA 4O57A 2XV6B 3CE1A 5K9XA 4ORIA 2V5CA 3U6XA 3OR6A 3TVAA 1KR1A 5AW1B 2OL3L 5J13B 5GZOD 4J2PA 4XMLH 4X5XA 1UD5A 3VI3E 2PR4L 1Q94B 3QJUB 3LN4A 4AK1A 4L9XA 3NZSA 3SOBH 2QZ5A 2X6AA 1GC1H 4P99A 1V27A 3IFNL 5F89A 3TURA 4EWND 4PJBA 2H26A 1XBDA 3VAVA 3BISA 4LCCB 2IF7A 1LBMA 3I9IA 4TUKH 3SDCB 2O0TA 1BQLH 1XCWA 4AZCB 2IOOA 1EX0A 5F7DB 4EF9A 3T1WA 5I1DA 5D70L 3NAAH 3ZTDC 1Q9LB 1FCVA 4S1DD 4DKAA 5FA4B 4ZE4A 4LE8A 4K3EL 3SJVB 2V9TA 3VWJC 3PANA 3PZQA 3WXVH 3NCEB 5L6UA 1RUKH 1FHNA 1MN4A 4BFKA 4ZX6A 3PWPE 2OMVB 3AICA 3CVHL 5C09B 1NUFA 3MKGA 1DN0B 3VFUB 2A4EA 3VGGA 5A16A 3SZ6A 4TVCA 1BD2A 4IU2B 4RMRA 4IOIB 4GKOA 1FH5H 3GBLA 4XMUA 3BKCL 3VXRB 1A66A 1X96A 4S1SL 5GJTL 2JVUA 1TTAA 2HK0A 3PJXA 4URIA 3W2DH 2VM9A 3EO9L 1MHCB 2HJKA 3M6YA 3SZ8A 4H4IA 1TFPA 1SHXA 2D73A 3HBQA 3LJ3A 5GRJH 3NFUA 2IGFH 3CFBA 2Y63A 3PZ9A 4NNAA 3O4OC 4H40A 2GJXA 3NQVA 5CP3A 1XP3A 2PDNA 5FOBA 4HAFA 3A3YB 1INQB 4IMKC 3VXUD 2NLJB 4CC0A 1IC4L 3F5JA 3S6OA 1YPZB 3AFLA 3G6LA 5ADPL 4OF3A 3AY4A 3OC5A 2W4XA 1DDTA 1NH6A 2P5EE 4EDXA 1KJ3H 2K9UA 3K46A 3OLDA 4XCYA 4U4IA 1HGYA 2PYED 3LHTA 2NMSA 3KVLA 1UQYA 4X4YB 4JIPA 1Z3NA 4K7PL 3G0SA 3TONA 1AE6L 4C4KT 1A21A 1UT9A 4JRYD 2DV6A 4I4WA 4KU1A 2IDFA 4MDRA 3WENA 1WDRA 5K4XA 2CLHA 2BVQB 3Q3GA 3TW9A 4R7NB 1IKNC 2J72A 2R2BA 4EO5A 2VEMA 3TYAA 5A6BA 3TYFB 2EABA 5C9ZA 3HE7B 3C61A 2HKFL 3OGCA 3MTXA 1BVZA 2XWDA 4KHTH 2FJGB 4PJEE 4XP9H 2EXTA 3ESUF 5DRZB 5HOSA 4L29A 3FUNA 3FQNB 3QEQD 1QNSA 2EAWA 1K6QH 4WU7A 2R1MA 4NQCB 1T1WA 1EXGA 4PWEA 1CR9H 1EANA 1VRSA 3SQOH 3ZQXA 4PVLA 4Q97A 3O16A 2PDYA 2GBUA 1X97A 2V7HB 1KDJA 4AOFA 1ASPA 3FU5A 3UTQA 4TUFA 3ZE2B 3QDGA 5D7LE 1MKFA 1RUML 4ZW3A 2P8LA 3P7YA 4PPTA 4CC4A 2JBMA 3LNPA 4K5LA 2DYRB 1C8XA 3Q58A 3HTLX 1M3IA 1X7TA 3N1FC 3FO1B 2OMUA 2F9BT 3MLYL 1QBMH 5D6CB 4JJ5A 3VWJA 2OG9A 2R82A 4H1LG 1JDDA 2PMQA 3XISA 3EEGA 1CO1A 5SWSB 4Z2LA 4JX0A 1CFTA 2DBLH 3D69A 4NAMA 3T2OA 3LS9A 4MCYB 1CUOA 5MEOA 4JN7A 4EI5C 2YXXA 2F7IA 2YL6A 3M8OL 1D3GA 4KJPC 3M5YA 5JXAH 3W7JA 3HGSA 1XGQA 2ENYA 4D2JA 3TAOA 1TT6A 4PUBH 1XAKA 3O06A 5KN5B 1HL5A 4GLRI 4KMLB 4HA4A 4M7LT 2P47B 2DZTA 4D6HA 4GMSH 3LDVA 1A7BA 2VXSH 4HZLA 5JH1A 2FJUB 1YC8A 4MZIA 2MH4A 2Z35B 2Z91B 1AKPA 2DQJL 2APTA 4N68A 2R69H 3N4FA 3ULSB 1V3MA 1MJ8L 4JQIA 4BF5A 4J8QA 3W24A 1LP9F 3UJTL 1K4GA 2NY6D 2VFEA 5EMYA 4EPSA 1BPVA 2PCQA 4M6PA 4OVUA 1F13A 3E2VA 1DFXA 1MWAL 3FTZA 1FWAC 2G37A 3M7SA 4IKIA 4TVDA 5FUCC 2XYBA 2QJIA 5JPMC 4M9OA 4MNHB 4R2GB 3DKJA 1LMIA 2Z7WA 4U1HB 5AVSB 3RGBA 1LOSA 4ANUA 3G5EA 2W80C 2DMCA 4JZNA 1AKJD 1XGTA 2J4WH 1NIFA 2OMXA 2X8RA 1EF3A 4HFWA 5FB8B 1F8IA 2BB0A 1E5YA 3R1ZA 3VD4A 1ZVYA 5CJBA 3AIBA 4HUUB 3QS2A 3IJ6A 1RCXB 1AJ7H 2G4JA 3DCPA 2YEZB 4JQIH 4XXCC 2RDWA 4DBDA 4WI5A 4CJ1A 4KI1A 4AF0B 5FFOA 4R7LA 2EO7A 1WFIA 5BRQA 2BHUA 4PY7B 3U1QA 1EHLL 2FFIA 3I2CH 3MRFB 4FOUA 2OLHA 1BHGA 1Z5HA 5IQOA 2F1AA 3UTTD 2OMVA 2XZAH 3EOTH 3FGCA 3LOTA 3WGVB 4DJED 5EF1A 4L3EE 2Q3XA 3G24A 2F61A 1FBIL 1UH4A 4UOW0 4QAIA 1B0RB 1BQUA 5GJTH 1OCCB 1VLXA 5I0XA 1R30A 3PJLA 5KBDA 4EWJA 3VZZA 4I18A 2FVMA 4HU3A 3LD5A 3ZE1E 3MV8A 2AK4E 2VR6A 3B2XA 4OTXL 4X6CE 3VU1A 1NP2A 1TIMA 2BX5A 2YD4A 5DMIH 3RAJL 1W5NA 1EPXA 2QNEA 3GSXA 4PJIE 5A8NA 3NEOA 4POUB 3EJRA 4A2MA 1NGYB 4D8OA 1J9SA 2I7GA 2XETA 2BSSA 3UG5A 4LPUA 4L4TA 2MTPA 3QEGL 4KXAA 5F9WB 3D8MA 5KANI 3T6QC 1DHPA 5E1IA 4LCWE 5CLWA 5HNRA 5EDXA 3K91A 3WQ8A 1O5DT 3ZL1A 4MYPA 2XG9A 3ZZQA 3VNLA 5JYLA 5HMSA 5KBKA 3OKOA 1DDHA 4MJ6B 4B9ZA 1H8OA 3C6CA 4DJDA 4LDOB 1S9VA 1A6TB 1U8PA 3LQAL 4AC2A 2CDGA 1MCFA 4WWNA 1E5BA 3CV2A 3K6NA 2FZNA 5KS9E 3HE7A 1Z9PA 3UVAA 1UM5H 3ZTCC 1TCRA 4YIQB 1MSSA 4WOQA 2O26U 3UJSA 4MFDA 3L81A 2CR6A 4AUUA 3R13A 1RIHL 4XNYH 2Y5QA 4PGBB 3PWAA 1C1EL 3EBHA 3FT3B 4NUJB 1O5QA 1X5ZA 32C2A 3HBPA 4BH7B 1NDZA 1WC7A 1K4CB 1H3GA 1J12A 2ZUQB 2DS4A 3BP5B 4JO3H 2QEJA 1P0KA 2QFRA 5CXPA 4GX8A 4K8RC 2ZJSH 4K36A 4XAPA 3KXFE 2GDQA 5HR7A 4AQOA 3DETD 4RMWA 3WJLC 1XR9A 1I7UA 3ZGIA 4AV5A 1OE3A 1RHFA 4I3SH 1U8MB 2XWRA 4LP5A 2YLAA 3QC5X 1T04B 2CDEB 3LQMA 3CT7A 3LKRB 3TWCH 4I3RH 3BSZA 1NUGA 5FKAA 4HKXB 5E5RB 5KYXB 4NLHA 2O72A 4G7VH 3S4SG 3GLZA 4M5YH 3M8OH 1ICTA 4Y88A 3NQ6A 4DUOA 1HHHA 3EX4A 1FP9A 3W75A 3MLXH 5F2GA 2KZWA 5FW7A 2VDRL 2GUYA 1FYTE 5LCVA 3T6XA 1DN0A 4GQ9H 4O4YL 2CSPA 4PJDF 1CWVA 2W65B 2XBZA 1HU8A 3NM1A 1YX1A 1MPAL 4NCC2 3SCQA 3HRZB 3QDAA 5MHSD 2J8GA 1NKOA 3NO1A 4FJZA 5G4MA 4C6CA 2FLRT 3VIMA 1MO0A 4DF2A 4YBLB 3B6SA 5HYJB 4DETA 2G8ZA 2UXFA 2AK1L 4NQXB 2HVKA 2JEQA 4DPCX 4LU5L 1JDEA 2YJLA 3UTSB 1UB6A 1ZSDA 4Y9NA 3K7UA 1FGNH 3KE0A 4RWYH 1JF5A 1JVOA 2CD0A 4FXKC 3FNKA 4AZ8A 4PJ9B 5A95A 2OZ8A 3RJQB 4RRPG 1HL2A 3F6LA 1T4KA 4INFA 5GHWH 2FGWL 1OGGA 2BVPA 4YBLC 5A6LA 4DNLA 3MVIA 3MV7A 1B31A 1EWDA 2XH4A 5E9XA 2ZVRA 5ABFB 2W0FA 2VC6A 3CC1A 3QYNA 5DS2A 3W6MA 3OZKA 3SYQA 1A5UA 5I24A 1NDGB 5FEXA 2H32H 1TZGL 1S78C 4WSJA 5B1JC 3ITLA 2DN7A 2UXTA 5HANA 1JDAA 5MP6H 3W82A 1CVRA 2HDJA 3DFOA 4B92A 3TN0C 4W9DC 4XNMA 3G6DH 3OKEB 2BGSA 3FJ6A 1AA1B 2EICA 3WQPA 4LU5H 3T65B 3FCPA 4S2SA 2NNAB 4PRIE 4XSMA 3STGA 3KGTA 1AMXA 2ZUXA 2K4WA 2RCSH 1BJ8A 2WBJD 4UNUA 3ASWA 3MRHB 1B1YA 1H3TA 3MRKB 3QJTB 4YXLH 1FWGC 3B04A 3S8WA 1YW1A 3DIVA 2PCEA 4PUJA 2QCDA 2UY6A 3P4OA 1MY7A 4Y8AA 5CKGA 2VR2A 4UIOA 3RMEA 4A3RA 1TLMA 1ZENA 3VNYA 4MJMA 3FRUB 2XN9D 3JYBA 2BY1A 5EFIA 5B1AB 4NJ9H 4DKFL 3CFEA 3EZ4A 4IGSA 3DMMD 3W2MA 3QZWA 5DJZA 5F0MB 2ZUQC 1ADOA 1QA9A 4ZSUA 1UEMA 2AJ3A 4U1MA 4AI7A 4XXWC 2KPNA 3H9SB 3MUIA 4I9TA 3S83A 1REQA 5SWZA 1YRRA 3GHBL 3M41A 3LCHA 5HJXA 1L6XA 3EDFA 2DL2A 2DQCH 4ABVA 1ND0B 2ZAIA 1K85A 2EKGA 1EP3A 3MNWB 5I0VA 4DLMA 5IK3B 3FLUA 3RAJH 2XZQL 1VBGA 4LVOC 2JELL 3ITYA 3UH8A 2A21A 3LM3A 4N9DA 4JFFB 3Q65A 3BGJA 1QW9A 3CASA 4RNRB 1P53A 4APQA 4NRXA 3CX5J 1ZXKA 3ISIX 3PR2A 4KCVA 3F7YA 5SWQB 4PB0H 1YMYA 4ONVA 1SBBA 2IWGA 4H20L 1OP3H 2BGQA 2BIQA 2Z65C 1LQ2A 3AIUA 3MPCA 5SX4I 1R7OA 3FNDA 4BGLA 2C9RA 2X42A 5IVZA 3OZOA 4PWFA 4HT1L 4G83A 2X1IA 1TCRB 4YIQA 4MA3A 2Y7DA 3NYKA 4Q0XL 3EFOA 3CD4A 3FBQA 4RRPA 3CLMA 5D09A 5M17A 4MXQD 5CBAA 3KR3H 1F3WA 5LBGA 1EJUC 2MHAB 4PB9H 2WYSA 5BMFH 4R26H 3CPGA 3A3HA 3DXAE 3MRJA 4J3XA 1TTFA 4EUPG 3L13A 3IXTB 4ONFL 5H94B 2VDKB 3LHWA 1UXSA 3ENLA 2RHGA 3R1GH 3DSFL 5GZNA 2CBQA 5FEPA 4PV9B 3K5SA 4IU3A 4LYRA 1D7DA 2CK0L 3L9RB 4PJXB 3TO4A 3UIZA 2PTWA 3AROA 4DEUA 3RDTC 5KVEH 1A5FH 1SJMA 3D07A 3PZUA 1GOIA 2FBJL 5AN7A 4QRRD 2H3NA 3URNA 1E9YB 3QIBC 2BO0A 4BK5C 1OPGL 4I9XA 3MLPA 4C8XA 3NYZA 2X9WA 1Z7AA 2EO1A 5H2BB 2NNRA 3GMMB 2Q9OA 3LA4A 4NF7A 1KCSL 2IGFL 3SE6A 2HJLA 2OXGB 4NKIL 3A3XA 3MCOA 4C4KO 4JBRA 1A5NC 4PUEA 5D2LF 1BGXL 4D2NA 1M56B 2B31A 3G5YB 2VXNA 5FD0A 4FG2A 3MRGA 3JTTA 2K6ZA 1GCYA 4H8UA 4G72B 4XBEL 5FYJU 4HHGA 4L0ZA 2G3FA 2WHMA 2ZRVA 4AUBA 1UWGL 2VDKH 2XGIA 1SMOA 1JRBA 2WXFA 2YRBA 2YAOA 1XYMA 1MQQA 1JXDA 3BRDA 1NFDB 4Y9PA 4UDTB 3LZ5A 1AZZC 3DMMB 3GZ3A 5EEWA 3VNKA 5JH2A 1UATA 4A29A 3ARGC 2XN9B 1LNUA 1K9FA 1EAOA 3P54A 1NAML 4FNLH 4K3JL 4KOCA 4M3JA 3F5WB 5DMGC 1THAA 3V95A 7TAAA 2OCZA 2IJ0C 5CSZB 1SLUA 1DVFC 2J9ZA 3TCLB 3DBNA 1WAUA 3UIYA 2C26A 3H9SD 1LT8A 3WKQA 3TBSB 1O94A 5C3TA 2ZCKH 4JRXD 3JV4A 3DGBA 2VISA 3TN0A 4PJBF 3R7QA 3WDPP 1F6FB 1K6QL 1SLXA 1ZRQA 1OB0A 2FYYB 5C0CD 3AABA 3RWFA 5LKNA 1AYRA 3CIAA 4WNQA 5BO1H 1QK0A 5C0DB 1U8CB 3RX3A 3TH3T 2QDEA 3ZRSA 4JX5A 4A55A 3M17A 2X44D 5AKTA 3ARDC 1TZGH 3RKDC 1MFMA 1OX4A 2EECA 5E00B 3CPUA 2XU2A 3O3AB 1WAPA 3NO5A 1O6TA 3GKWH 4JTKA 9XIMA 3E0GA 1OY3B 2ERJC 3M1BA 4TLKA 5LAXB 3IPEA 4JFPB 4U3SB 5HHOD 4R8WH 1MJ7H 5J3HC 3VFSA 3ICJA 1IQDB 4FZEH 4D72A 3TA3B 3Q44A 3ZDYF 2JEPA 4TO8A 3EOUA 2RJHA 1PKOA 2UZIH 2C3HA 5C7HA 3SECA 4FJ6A 1E42A 4OQTL 2EYTB 3L3DB 1GKEA 2WJ7A 3KLDA 2XXMB 4ZPTA 2XIOA 2F19H 3CQFA 2Y6SD 3UJTH 2EDTA 1BVLA 4G42A 3CFKB 1JGDB 3EOYG 1I8IB 3WE6A 3NGJA 1FPTH 2ATPA 4DXVA 4GBXB 4B9PA 3IIPA 3Q2VA 3PJSB 5I6LA 1RZJC 2R56L 3PWIA 1WHOA 2Z2AA 2PPAA 3WIFA 2EIDA 3L5AA 4FG4A 3L65A 2DLFH 5CH9A 1BM3L 1E8WA 1OVZA 1TETL 3AG1B 3DLQR 4LSPL 4BSVA 1OK4A 4PP1D 3N6QA 1KBGH 1MI5B 3FCSA 3DRTA 3RL1A 2E7FA 4UNKA 1WFOA 1EUNA 1FGVH 1OALA 4P0DA 3KWWB 4G7RB 4PGEB 2FWUA 2CO4A 2EYRB 4PQXA 2IKJA 4E41E 4N02A 3RPDA 2V4LA 2EVGA 3Q05A 4NJKA 2J8FA 5BMWA 3H6AA 1HHHB 3WHXB 1NDWA 2PZNA 4NZTH 4IIBA 1RIVL 2F68X 4LUIA 1ZLVH 3MXWL 3UTPD 4ZMOA 4XMKH 3OIHA 4FOJA 4OQVA 5CEWA 2VQUA 5EH1A 1IILE 2CCVA 2D2GA 2FLIA 4MPKA 3S36X 4FQ1L 5TQ2L 1DPMA 4BINA 3QUGA 2IAMD 4NO2A 4HP5A 4NM8H 4X6EB 3SUVA 1VRDA 4HJEA 4KJQC 1GOMA 4JQ3A 4QE1A 3QJOA 2P8CA 2YPLE 3IFOB 4GWEA 4QNPF 2J24A 3D6GA 4LAZA 4NN5C 2L0DA 3CHXA 4PGZA 5CILH 3T1FB 3WE1A 5ENWB 2L7UA 1M5WA 4GRSA 1URIA 1ZP4A 2AQRA 1SHWA 1NWPA 4MKTA 3MQTA 2D2JA 4J3VA 3STLB 1J8HD 2D3NA 3NAAL 4I8YA 3AT0A 2PI6A 4IK6A 1NFIB 1A3WA 2VDOL 3D85D 1FNSL 1G1OA 3PCYA 1ZLEA 5E8OA 5E9DB 4PGJA 1LUCB 5HI5D 4L8CB 1OCBA 5F9JB 1R9XA 3P74A 5C08D 4KK8D 2PYEB 2CKBH 3OVGA 4U6TA 1XMWA 4FNQA 4I5BB 2B2XL 5DLMH 1E9OB 5EBWA 5TDNB 4QJ4B 2YFOA 5CEZE 5CSUA 1DQVA 3EXLA 3F3HA 1KENL 1A50A 3MNMA 2XISA 4X83A 5GGRY 1KFBA 2KDYA 3ID7A 5EZIH 3QS3A 1KLYA 2AQQA 4YHPB 2FEJA 2QTEA 4YO0B 1H62A 4KAQL 3PABB 4WHYH 2VEKA 3C0QA 1LOQA 1TUXA 1QSEE 4GMSL 3F4WA 4NGHH 1L9NA 3MLWL 2CALA 1JCYA 2CGRL 3PAZA 4ASTA 3L8QA 5D2NA 1M7PA 1U4FA 5CP7B 3RUGE 1N64L 4BKNA 2Q7YA 2GQ8A 2K1MA 4P3DA 4JHMA 2XN2A 5EFFA 1T0MB 2CZNA 5FV2A 4NHCL 3LV6A 4KVNL 4AW4A 3TIEB 4FZ8L 4MXWH 4PTTA 1X7QA 4QXGL 3GD1C 4KRPD 5I1JH 1S78D 4N2OA 3N41F 1J9YA 5HAOA 3V1HA 3IAPA 3AB0B 3NSXA 1BYOA 1GONA 1UACH 1KKOA 3AAZB 2EYSB 2VE6B 4MVAA 1J2BA 1XMEB 1FOBA 4MAYC 2B3RA 2E3ZA 5FIPA 4ANWA 4A37A 3OHXB 1DEEB 4XMKL 3Q2LA 3K6IA 3QORC 4FI8A 3GIQA 2YW4A 4PCNA 2N0MA 2H2SD 1HEJC 4HOWA 4UV4H 3WTWA 4P23C 3PF3A 1CFNB 1K5NA 3B06A 1FO0H 1T83C 1NBVH 3ARDB 4CDGC 2VLJD 3ASNB 5IM7B 4DCQB 2OTDA 1PBGA 4JRLA 4AQEB 2QPSA 3BW9B 3C4UA 1JV5B 3JTBA 1YNTA 3QFDA 4WTXA 5IESL 1B4TA 1HXYB 2CUMA 5GS0L 1DVYA 4OFVA 3RB5A 3SGKA 5HYQA 1UKPA 2WLZA 5EUKA 1SFLA 4DX3A 4N2IA 4UMGA 5DY2A 1CLOL 4Y5YC 2VDML 1ITBB 1ZALA 1D7CA 1E1EA 1V6YA 4KESA 1H49A 1KCVH 3LKNB 2YPKB 4Z78B 1EEZA 3B37A 3V0VB 2X1TA 3T0ED 1UKQA 2ATKA 4MJ4A 2B2XH 5F3BB 2FSDA 4AC1X 3QYQA 5IJKC 2WVTA 4FI7A 1GK8A 1JUFA 4JDEA 2X3BA 4N8CH 4GB9A 5E4IA 1CT8A 1QI3A 2D9CA 3MCYA 1M01A 2NXIA 4LUTB 4GW1B 3G3DA 3IFLH 3MWCA 2WANA 1Q0EA 1IZJA 3R4RA 1LK2A 4RGMB 1W6LA 3HR5A 2G60H 4V1DE 2QLVB 4GOAA 2GK1A 1A4BA 3MRIB 3DRTB 5E2TL 1W31A 2HKHH 1M9WA 2E7LA 5HQLA 3GMRA 1VHCA 2ZXCA 1M57B 3GHUA 2VM8A 3PNUA 4IT1A 3IGSA 3QJHA 4APXB 2I57A 3TSDA 3NQDA 1OGAE 1WT5A 3CFQA 2PAJA 1R5VA 1IAKB 4WTQA 4YE4H 1D8WA 9XIAA 3QIBB 1W2PA 3LERA 1GQLA 1CFVH 1TYEB 4FLHA 1GHRA 2Y61A 5C0FB 3EOOA 3G8RA 1HQ4A 1JV2A 1CDIA 1EGJA 2B1HH 1GGBL 3HNTH 3OHMB 1HX0A 3W7PA 4AD3A 3CVHH 4HQQH 4KTGA 2XKUA 1DQDL 3K8MA 4NO2B 3DSNA 5BS0D 4ZQRA 2Z24A 4B2DA 4HUNB 3N5AA 3PPSA 1T66D 3P3SA 4OTKA 2PO6D 4YHNB 1IFHH 3AG3B 4QRTB 2GT9A 1G4PA 1L8PA 4X8CA 3RWGB 4MOZA 1IBBA 1F3JB 1SLWA 2VCCA 1XGZA 4ZVJA 5EPMA 2G75B 1HILB 4HLZH 4LHJB 4N5ED 2A3AA 3KBMA 4JHOA 2Q8AL 2WB5A 1Q9KB 2NCEA 1NL0H 3SE3A 3FQRA 5HDQL 4CVWA 2OO0A 3MLSH 4WFGD 5E6YA 4F2MA 4QAMB 3RLSA 1EHKB 3S35X 3KLHC 4J1OA 3APDA 3GSWA 3H2WA 4Y5VB 4HX1A 3AACA 3HBZA 4EJ1C 4IHCA 4XNQA 2ORBH 2CEQA 4Q4QA 3DV6A 1IM3D 5BROA 5D4YA 4LQFH 4NPKA 5JR1H 2W60B 3LU2A 1NEUA 4MASA 1UGNA 2WM1A 3T3ME 4E2BA 1W8OA 5AW0B 4CU6A 1JYVA 2R91A 4OUUB 4NQUA 3QIWC 4D3CL 2EE9A 1NFKA 2NY3C 2C15A 3EF7A 2MNRA 3O0KA 4AF0A 4KKAC 2UUDH 3OKNA 1EQWA 1BYDA 2Z1WA 2GVGA 1CJYA 5AKRA 3TN4A 4ODVH 3PUDA 1ECYA 2NY4B 4MB3A 4NO5B 5T3ZH 3ILDA 1IL1A 1GZHA 4HPYH 1MJJA 4P4KD 4RDBA 4OZIA 1RUPH 2GG1A 2JIXD 1CE6B 1O6SB 2DQ6A 2BG5A 3DFQA 2GQ3A 2H2SC 2Z0IA 2EXYC 3URQA 4MJ5A 1CICC 2Z7KA 4Y2LA 3UY8A 3WO8A 3QORA 3HC4H 1SXNA 4DVBA 3U25A 5I8KL 2OX5A 3NA8A 4ICXA 4TRPH 5B22A 1S2TA 5DQPA 3BUDA 2N01B 4J4KA 4DWSA 4OJDH 1U92B 4FYSA 1F58H 4JDYA 5AB2A 2BCKA 3H7BB 1G5AA 3BT0A 4NN7B 3EJJX 2OWXA 4UU9A 3W7NA 3QULA 1JZ5A 3Q8AA 5E1QA 3KPPB 4E2OA 1AXTH 2C9XA 1QHPA 2G2RA 4WK2B 4NI3A 5BRZD 4M93B 2HBXA 5J6SA 3AOFA 3BI9X 1YDOA 3TBTB 1LEIA 3MJ7A 3T2QA 5I6KA 1E9PB 4HZMA 5CZSA 3ZIYA 4XO8A 2XIBA 2GVEA 2VX5A 1E7UA 1XWVA 1CF8H 2V5MA 1XF5B 4ES4A 2VGLM 4GAGL 5CINL 2UZXB 3OM3B 3QTPA 3OD3A 1H60A 6A3HA 2E8ZA 3LLDA 5JTWA 1VYPX 5KJRL 4N8VG 2FX9L 1KBPA 2FO8A 3OC8A 3HCVB 1YNLH 1TELA 4RE3A 4ZQCA 1A1OB 2O5YL 2XVLA 4YHMH 5E0FA 1JZ7A 2R6OA 1LM1A 1QRNE 4Y1AE 2E6JA 1GKQA 3W7LA 1X9QA 3VGDA 1QLFB 3TYDA 2YXFA 4B5EA 1A5OC 1PL9A 4XV0A 4IQJA 5CLZA 1RJQA 1KN4L 1NANI 3J8F7 4OZHA 4YDZA 1RPQA 4E8CA 5ENWA 2DW7A 1J5TA 1UP3A 1B2WH 2Q01A 2VUYA 2WYZA 2EHHA 4F7CA 3N6HA 2XN1A 4IKNA 3QO1A 4PJ7F 2IFFH 4HDIA 1HKVA 4HCGA 4IIEA 3V4VH 2TRSA 3GTIA 5TQLA 4F33A 1I3GH 2ZCGA 1DR9A 3ARED 1NGQL 5F9JA 5CBEA 3W26A 3IPBA 3E6FB 4GFIA 3PLYA 2QUUA 2PA6A 1RMFL 5TDNA 1TU2A 5JOFA 3VFLA 3MRIA 4PRHE 3VB9A 3HPLB 1XBRA 2VYRE 3KNBA 3HOGA 3ZJ6A 3LRHA 3IBOA 3B9VA 1NCJA 3VAEA 3C2AH 1QFWH 2WNZA 2WW5A 4JFHE 3MHUA 4IG2B 4JFEE 1OABA 2ZP0T 5U7SA 1P5VB 1N6QH 3KDMA 1CLVA 1IAKA 2VDPL 3I02A 1FRBA 4CILA 3PDOA 3UZ5A 1KXTA 2DQDH 2B0SH 1O0VA 2GJ6D 3DGGB 4M62L 5F7LB 4KRPB 4OZFH 4S1QL 2OW6A 3P1VA 4RWYL 5DJ6B 1ZHNA 3NIGB 1ILSA 2FB4H 4DXKA 4LEOA 5PTDA 4PJFE 1ME7A 1AGDA 2YGYA 1MRFL 4R7DB 5I1HL 1B9KA 1ZAGA 3CX2A 3W11D 4F2EA 1BFOA 4XWOD 4XC3L 3EJTA 3NJXA 3LEYH 3GB7A 1TV2A 3GMOA 4DAIA 3VI4B 4OT1L 5A43C 1O6VA 3TZVA 2EEDA 1CT5A 4YWSA 1UWEH 2BDNL 1E1FA 5DCDA 4B91A 1F05A 3LNDA 5DQ9A 4G2DA 1D5XB 1SGKA 4PJ9A 4DVRL 4ZB0A 1HOEA 4PC8A 4RX4A 2COVD 1XGPA 3HPJA 3ZW3A 1J8HB 4KC3B 5DA0B 4ERSH 4GCXA 4DK5A 1JDFA 4O1EA 3MJGX 4O0QA 4Z1DA 2HMID 4LY8A 1C7TA 3SRKA 3TL5A 2E59A 1WBJA 1JSYA 3SSJA 1DQQB 2WXRA 3EFDH 2D2HA 1V8EA 3CUPB 3B83A 5IDZA 1OAZL 1UG9A 4P3WA 4DUXA 3GHPA 2YAFA 1S7UB 3ES6B 4HXBL 1GSKA 3FUDA 5FW6A 3WNPA 3QUKB 1HJXA 3ARFB 3GHTA 2DFAA 2PDKA 3GH7A 1A6WL 3FU6A 3K6FA 3MBWB 5JHDE 3WQVA 4Q2ZB 3BP7B 2KI6A 1RUAH 3OBEA 5EORH 3WTXA 2BBFA 1LO5A 2E27H 4H8WH 1IU1A 2VKXA 5E51A 2I5GA 4KWWA 3AS1A 5CJOH 1U8LA 5IKCA 2WLLB 2PB1A 1EEZB 4IBVA 4IRJD 4FQXB 3D2UB 3CPRA 1A1MA 5I2UA 2GGEA 4GBUA 5CWSB 5EFDA 1P7QA 1QSZA 3INOA 3SRFA 4WUIA 1FNEA 2Q2EB 4UMSA 3B8YA 4PJAB 3JWOL 1BAGA 1IQWH 4YHKH 5D2LE 3QN3A 4M6QA 3ZIZA 1OFBA 1LDCA 4K71C 3CQQA 3RBGA 1AR1D 4NNPH 1I1RA 3GU9A 2CM6A 4K1WA 1U3JA 2ACQA 3L0NA 4JZOA 5J5RA 2IWFA 1N59A 2ODHA 4N6QA 5CILL 1E2WA 1MREL 3X1GA 4BSJA 4HD9A 3HUJA 4HT1H 4PN6A 5KUMA 3QJHB 4APXA 1ZA3A 3DFHA 4R85A 4U7KA 4IOFC 3ILPA 5FM5M 3OG4B 1T7ZA 1CI1A 2W79A 5AALA 3QXWA 4ZQKA 1ID2A 1MZZA 1HH9B 4E9LA 2E9WA 3Q45A 4NY2A 1FORH 2HK1A 1JCKA 3BLEA 4NRXB 2P8PA 4GSUA 4URTB 2RQ8A 3HC2A 3LH2H 4D0BB 2YGQA 3RCNA 3APNA 1HKJA 2EXYD 4Y2NA 5J9PA 3MLZH 2C4FT 5SWZD 5ICZA 5EO1B 4QCIB 1QI2A 1Y5XA 4UFHA 3DZ1A 5LAPA 4EACA 4NNYB 1A0EA 4WSGA 5H35A 3TEUA 1MJUL 2VM3A 3DURA 5AD0A 2J6EL 4GUFA 3T9WA 2AMXA 2ZUWA 5F7BA 4GVHA 2FX7L 2MHAA 2WIMA 4JFDB 1X38A 1O68A 4JTFA 5GJPA 4R5VA 1YNQA 4Z95L 3GSMA 4APQD 2OSLB 2LAGB 2VM4A 4HWBH 2PGFA 1LL6A 2YN3A 1X9RA 3EKGA 1H8LA 2L7JA 2ZDSA 4OIBA 4PBGA 4P2OD 2JCWA 4QTIL 5D4HA 4E0RA 3IKKA 5EZOH