1WXJA

Crystal structure of tryptophan synthase a-subunit with indole-3-propanol phosphate from thermus thermophilus hb8
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
257
structure length
239
Chain Sequence
MTTLEAFAKARSEGRAALIPYLTAGFPSREGFLQAVEEVLPYADLLEIGLPYSGPVIQRASELALRKGMSVQGALELVREVRALTEKPLFLMTYLNPVLAWGPERFFGLFKQAGATGVILPDLPPDEDPGLVRLAQEIGLETVFLLAPTSTDARIATVVRHATGFVYAVSEVKDLVRRIKARTALPVAVGFGVSGKATAAQAAVADGVVVGSALVRALEEGRSLAPLLQEIRQGLQRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure Of Tryptophan Synthase A-Subunit with Indole-3-propanol phosphate From Thermus Thermophilus Hb8
rcsb
source organism Thermus thermophilus
molecule tags Lyase
molecule keywords tryptophan synthase alpha chain
total genus 91
structure length 239
sequence length 257
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2005-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1wxjA00
3QZEA 3A21A 3SW6A 2H3DA 3P61A 3LI1A 3W7DA 3BGGA 4OU1A 5D09A 4ZQRA 4UFLA 2HS8A 3TDFA 3EKLA 3L21A 5LNUA 2TSYA 5K3VA 4XQ6A 1TPVA 4DEFA 2A0NA 3N14A 3KVKA 3USBA 4Y8FA 5D30A 2VENA 5EY5A 3L0GA 4XTIA 3UWZA 1W0MA 5AYZA 1XL9A 3C56A 4WZHA 1W5OA 4O11A 2CU0A 5FI8A 1OYAA 1X7FA 4BK9A 4AF0B 2NUXA 2C15A 3EEGA 4PC8A 2FQIA 4BWLC 3KX6A 4RZ6A 3TSMA 3IIZA 3NOEA 5H91A 2B7OA 4N9EA 2ZDRA 4ALDA 2RDUA 3RLVA 2CLFA 2WOQA 5EBUA 3S9YA 4XZ9A 4RR4A 2F7FA 4IWWA 3NG3A 4Y9AA 2ZA3A 4NT0A 5BOOA 5C54A 3FKKA 3SGUA 3TMQA 3IV3A 4ZQOA 1XFBA 2YGYA 5KINA 3B06A 5DXXA 3EX4A 3CPRA 2W6RA 2C0AA 1OFAA 2ALDA 2CWNA 3S5OA 4MPQA 4JTEA 5FEXA 1GTHA 4QJ1A 3OHIA 1WYIA 2QJGA 2ZZ3A 2BX7A 3C8FA 4NX0A 4H4IA 3LX9A 3HJZA 4AWUA 3KAOA 2FPVA 3CU2A 1ADOA 5DELA 1JCXA 1JCMP 2QDHA 4UNLA 2E09A 2A2IA 1KM6A 3NQEA 2IQTA 3OVRA 1BWKA 1TV7A 3P8JA 1LOLA 5DXYA 5FEWA 3W2NA 1JVNA 2NXGA 3TV8A 5K9CA 3NVTA 4Z1BA 4O53A 3GKFA 2ZZ7A 4JDBA 1IGSA 2NZLA 4WD0A 5AHEA 3NQCA 2I14A 3NL3A 1P0NA 1P0KA 3QPZA 4FXRA 3TQKA 2V81A 3KVJA 1SO5A 1KFCA 3S0CA 5AC6A 3PBVA 1FCUA 3MHFA 3DFTA 2PE4A 4Z08A 3IVTA 1LROA 2CZ5A 1FBAA 3W73A 5J5RA 1JJKA 3M5YA 4JTGA 3QJAA 5LZLA 4HNNA 3HGSA 4UFHA 4I7UA 2P0OA 2RFGA 3E9AA 2EF9A 2YFOA 4HHPA 2ISWA 5BRBA 1ZJIA 3W7RA 1UASA 1DVJA 4DO5A 3W1XA 2QKFA 1SU5A 3L5LA 3OBKA 4O28A 4WQ6A 3QEZA 4S1FA 1YXCA 4CCDA 3NPUA 3NAVA 5G1YA 1OFDA 1GT8A 5DBTA 3MYOA 1LLZA 5EKYA 4Z0JA 3EXRA 2ZA1A 4QAIA 1ICSA 3GB6A 4ZQNA 3TKFA 1F05A 1TPDA 2QJIA 5G2WA 2X1SA 3FOKA 4O16A 4HPJA 4YL2A 3R89A 1KV8A 2PCQA 1TJRA 3PVFA 3Q37A 2BZNA 4OHQA 2ZFAA 1FCVA 1QDSA 1P4CA 1A5BA 1G7UA 3TMLA 3W9ZA 3M5VA 2WNZA 4LVDA 1SSGA 2QCGA 4AXKA 3QPYA 1LRNA 1NVMA 3GDMA 2V2DA 5D04C 5FF2A 1XI3A 3LRMA 1K3UA 4FO4A 2A5HA 4QNEA 4XKYA 2Y89A 4OV4A 2H6RA 3A5FA 1OG0A 2TYSA 3TH6A 1QNVA 2E5DA 3MI2A 3L66A 1K8YA 4U28A 5C2XA 2X16A 1F6PA 4MJMA 3TIMA 4QM1A 4NXSA 1TQJA 1G6CA 1KFEA 4TO8A 2WV8A 1T99A 1XBXA 4NNAA 1ICPA 3LHYA 4UCGA 4OWGA 2V0TA 1SFJA 1YPFA 4O4VA 3KVLA 4OBTA 4AEOA 3LCFA 3W2JA 1ZALA 5AYXA 2E77A 3QFEA 1S5WA 1X1ZA 2CLOA 1HO1A 1VR6A 2A7RA 1SZEA 1V7YA 3EWYA 1WOBA 4ORIA 1QR7A 4CNNA 1R47A 1H1YA 3MP5A 4NQ1A 3PB0A 3TJLA 2GVGA 3Q2DA 3TXVA 1T96A 1WQ5A 2EGZA 1KM3A 1XKYA 3NPVA 3RK8A 3TU9A 1ZCOA 1Y0EA 4WY0B 1CX9A 4MYXA 3WJZA 2YX0A 4L4MA 4JTUA 1ZY9A 5AHLA 3KRSA 4NUWA 5F4XA 5F2IA 4X9SA 2B7NA 4EOUA 3S1WA 3HF3A 3P84A 3IIPA 5KZMA 1I2QA 1VCGA 3WK3A 3JRKA 1TIMA 2E6DA 3L2IA 5DCBA 1BWLA 1TRIA 2GOUA 5CZ0A 4O52A 3UPBA 4GFSA 3CB8A 2QCDB 4JN6A 3L5MA 3M5XA 4MVAA 4YLWA 1SZFA 4WOQA 1DQWA 3LXBA 4M6PA 1VS1A 1YDVA 4WUIA 1DV7A 3VKJA 1EIXA 1K02A 2J88A 5D05A 3VFLA 4MOZA 3PG9A 3QW4B 2DP3A 3I7RA 2G5WA 3W2LA 3CHVA 5FF4A 3B0UX 3F4NA 4M19A 3U8GA 3W87A 4DF1A 1IIHA 1KM0A 3W1QA 3F03K 1HUVA 5LKYA 5KMYA 3S42A 1GEQA 5I3FA 4CQ8A 4YCPA 4NZJA 3EB2A 4N9CA 4HIBA 4FNSA 1Z41A 3G0UA 2Z6JA 5FESA 4FNQA 1RZMA 1WBJA 1T8XA 3BK0A 4LC8A 5EL1A 1S5VA 5U4NA 4GUIA 1PCKA 1A53A 2TMDA 3IEBA 4POCA 3G22A 1SUXA 4M6QA 5D2XA 1VGAA 3L0KA 2V2CA 4UTWC 1D3HA 4GE8A 3G24A 3HQ1A 2F84A 3TAKA 3NQ2A 1H60A 4JR5A 3KHJA 3MW7A 4UTIA 4QISA 2J24A 1TTQA 5FEZA 4P61A 3OVPA 4K36A 5A8GA 2BWGA 3NL2A 4Q32A 5K4XA 1TB3A 1TSIA 7TIMA 2XN1A 1DQXA 1RPXA 4JYEA 3IIXA 1W3NA 3W7EA 2PRLA 4HNTA 5H2ZA 1SQ7A 4JTTA 2VFIA 5EMUA 4AHOA 3IGSA 5LNWA 1MSSA 3W1LA 3N2XA 1S3HA 3UWYA 5CZJA 1M7OA 4PCFA 3O05A 2VEIA 4DF2A 4XBKA 4MLRA 1EPXA 1GWJA 3W07A 3VNDA 4O50A 3W23A 3NQ6A 4JXCA 5KZDA 3E0IA 3TSDA 4MFDA 2QCMA 2A4AA 4O1AA 4LY8A 1KBIA 3CEUA 4RCXA 3NQFA 1GVQA 1TPFA 1YXDA 1WAUA 4ZMGA 5LNSA 1JCJA 4IGHA 1XUUA 1GJPA 4JICA 1B4EA 3PS7A 5G2IA 3B0VC 3LLDA 2Y7FA 4UTUA 2X1TA 4FX8A 1JUKA 2PURA 1M6JA 1NEYA 4N4PA 2FTPA 3R2GA 3ABOA 1AL8A 1FDYA 3U2OA 4MZYA 2E6YA 3M44A 4R33A 5DCEA 4Z1DA 1PCWA 3S5NA 2QCNA 1VQTA 2QJHA 3TC7A 1BKSA 4ML9A 3MWAA 2XN0A 1V5XA 1A5CA 1XC4A 1EA0A 1OYBA 5G4EA 4CQAA 4C1LA 3L9CA 1VCVA 2OCZA 4CNPA 1LP6A 3G1SA 5K4ZA 2C19A 4JTLA 4UUIA 3S5YA 1PL9A 3BG3A 4O15A 2AAMA 3FIGA 4CQ9A 4LW7A 1I2OA 5CPOA 4AH7A 3W1AA 2GQ8A 5HWMA 3LCXA 1EP2A 2QUTA 5L6UA 4JIPA 1TO3A 1FDJA 3MHUA 5G1TA 4BI5A 4AAJA 4YWIA 3LTPA 3UWUA 3LCWA 3Q94A 2A21A 2NXHA 4IMDA 2TRSA 4DO4A 3TUUA 3FFSA 2GJNA 4O10A 4PL2A 4E2DA 5I3HA 5CGQA 4G1KA 1AW5A 4LVGA 4UIOA 4EF9A 3TFXA 3DFPA 3QW3A 1HG3A 4WY0F 4U4MA 4JX6A 3W7CA 2E1DA 3UNDA 3EX1A 1LBLA 1LCOA 3NQGA 2OX1A 3R5EA 1F74A 3GAYA 4PTNA 2YR1A 1H7OA 2VC6A 2WSYA 3LCHA 3SY5A 2DJXA 2ISSA 4IXHA 3EKZA 2QCFA 1QAPA 4M5PA 3KRUA 3B03A 4IPJA 2D73A 2CLIA 2YZRA 2Q3OA 1OHLA 4GRSA 2BXVA 3P5ZA 3O06A 1O95A 1OX6A 4LVFA 1TREA 3N2MA 1Q45A 1PS9A 2Y62A 4WXZA 1FWNA 3HBLA 1KM2A 1L2UA 5CPLA 3MJYA 1VC4A 4JYFA 1VJIA 4K6AA 4Q33A 3UZJA 3UWQA 1XXXA 4NJHA 3TQ0A 2A6NA 4UTKA 1C8VA 4BFAA 2CLMA 5U7SA 1YTDA 2NWSA 1GZGA 5C55A 1QPQA 3YPIA 1YTKA 2ZCGA 5I3KA 3TE9A 5FF0A 3QMRA 1WV2A 3LHVA 3M9YA 4LC6A 5AHMA 3SI9A 3W7OA 3EXTA 4LUIA 5SWUA 4S2BA 1M7PA 2VFDA 2QDGA 3CT7A 1R46A 2V9DA 3UQNA 3I65A 3G3MA 1YXYA 3SGZA 3T78A 1A50A 2CLKA 2VKZG 4GUJA 4JTFA 4NJKA 3S1XA 3GXPA 4E38A 4HN4A 2QCEA 1VLWA 2Y61A 4M7SA 1W5QA 3OIXA 3O15A 1XBVA 2DZUA 2RDWA 4O12A 4N9DA 4R53A 4BR1A 1OX4A 3W75A 3TA6A 1QPOA 3G1AA 6ALDA 1KTNA 3GZ3A 3BG5A 3LXCA 1F5ZA 3W83A 5CSSA 1WBHA 3W1MA 5C5YA 5DCDA 3WK1A 4X22A 3BLIA 2FDSA 3W86A 3OA3A 5DY2A 3O1NA 3LTYA 3STCA 4Y90A 4HPXA 3GYEA 3HGJA 1R2SA 1H7WA 3NGJA 2UV8G 1IXNA 2ZQ0A 1G67A 2J27A 4TMBA 4XKYB 1NF7A 5T26A 5LSMA 5AOUA 2Q8LA 1I2NA 2B7PA 3QSRA 1NF0A 3TQVA 4DBEA 2JKAA 3FEMA 3FS2A 3ABSA 2FPTA 4TMCA 1O60A 4E0CA 4UC5A 3I68A 2B0MA 3CIXA 2QUVA 1TV8A 4FB7A 1SFLA 1FCBA 1WXJA 3EXSA 1D3GA 1Q6RA 3C52A 4ZQPA 4ONVA 4D2JA 1GG1A 1VH7A 1KW1A 2OT1A 5AHNA 2C16A 3M47A 2Y63A 4HT3A 3ABRA 4NXKA 3STEA 1GVRA 2VELA 2ZRYA 1SR9A 1T0OA 3C2VA 5IBXA 4O4WA 4JDYA 1IIGA 3DZ1A 2ZBTA 1ME9A 4TU1A 4M6VA 5KZEA 3PC0A 1SO6A 2V82A 2H3BA 2NLIA 1W5MA 3MMTA 4W9TA 1I8JA 1XBZA 1VPXA 3DGRA 3CQ0A 1K03A 1G4TA 3N9RA 4XBSA 4YCOA 1OFPA 1EUNA 1K7XA 5CPMA 1VHCA 4MJZA 3G1VA 3NQMA 3CTLA 1TYGA 3QYQA 2A1YA 4GUFA 3THQA 3FKRA 3T4CA 4FF7A 1QPRA 3C2EA 5MHBA 1QCWA 3MP3A 1GVSA 2ATSA 3GDLA 3L68A 3MHGA 1SW3A 4O0KA 1LOSA 4BI6A 3BO9A 3A23A 4K7YA 4CLMA 1XUZA 1SW0A 3I7SA 1J2WA 3EWUA 4AF0A 4Y96A 1HFBA 1P1XA 3ATYA 2E5BA 1E51A 5HJLA 2VOMA 1OJXA 3UY8A 3NZ1A 3GDKA 2QCHA 2YYTA 3CC1A 1TMHA 2C18A 2NWRA 3N19B 4J9JA 4QITA 1RQHA 2GUUA 3NO5A 1AL7A 1UUMA 2ZRUA 4BWLA 3M41A 1GG0A 2R91A 4JTIA 3TW6A 3BLEA 2ATMA 5AC7A 2ZZ1A 2BSLA 4GWEA 4LV9A 3TK7A 4HSOA 4YXGA 5BW6A 1J5TA 4JX4A 1HO4A 4R34A 1BTMA 2J9YA 4NNBA 3LRLA 3F4WA 2R8WA 1GYLA 4DBDA 4HNUA 1VYPX 1FWRA 1L6YA 4UR7A 3IIOA 4RXFA 3LERA 1VCFA 5D2VA 1W1ZA 1N8FA 1Z48A 2VFFA 1JULA 3GVGA 3LCGA 3UPWA 5HULA 2BLEA 3HPSA 3S6DA 4JX5A 1YLVA 4WJEA 3PBWA 1IXOA 5F2LA 1I4NA 1IXQA 1OYCA 4JD4A 1Q3NA 3UYCA 3G8EA 1ZAHA 3B04A 5BMXA 3KFTA 3BPWA 1TCDA 2DJLA 2ZYFA 3R12A 3C2FA 3G1HA 1I2PA 4LNYA 4N6FA 5D33A 1DORA 1YTEA 3BLFA 1G4EA 5AC8A 3B8DA 1EB3A 1W3IA 3B0PA 1BEUA 4LS2A 3HGOA 1W31A 3QC3A 4A21A 3P8IA 3E96A 4FX6M 4NJJA 2EPHA 3CWNA 2VFEA 3HPXA 2GVJA 1OX5A 1TRDA 3NNTA 3DI1A 4PODA 4LU0A 2QAPA 4K38A 5CSRA 3TJXA 3HG3A 2WSRA 4R7JA 3ZWSA 3GDTA 4O1DA 1FXQA 3W22A 1EP1A 2WNQA 8TIMA 4QSHA 4O13A 4IMFA 1O4UA 3WJXA 2Y7GA 4UTTA 2WPBA 4LV4A 2YFNA 4I9AA 5ABTA 1R2RA 1PIIA 1QPNA 3UY7A 3P62A 2A7NA 4CCCA 5LNRA 1SW7A 1GOXA 3NQAA 4JTJA 1SPQA 2GVLA 3GX9A 2ZZ4A 4A2SA 1W56A 2P10A 3N9SA 4K39A 4MZ1A 1THFD 1M5WA 3W7PA 6TIMA 4TIMA 4RV8A 1KLYA 2VFHA 3OVQA 3W1PA 1WA3A 2NXIA 3IIVA 2G96A 2DZPA 2DZVA 2QAFA 3HOJA 1OFOA 3ZR4A 2W79A 4IPIA 4RX0A 3NA8A 3KOFA 4KKXA 3DKLA 3QMTA 2WO5A 4FNTA 3HO8A 2A85A 2PRHA 4XUGA 5D32A 1TPH1 3W7JA 2JKEA 2H90A 3NDOA 5TQLA 1TJPA 3DHFA 3NZRA 1K8ZA 1VYRA 3M1ZA 3WK2A 2DZTA 3PUDA 1W5NA 2JK2A 1JUEA 3AJXA 4UFIA 3B05A 4UMBA 5HWJA 2V8ZA 1PE1A 2FPYA 3C6CA 3L5AA 2NX9A 3DFSA 3LV5A 2I1OA 3PF3A 1W5PA 3TROA 1VHNA 1LBMA 3TSBA 3W7QA 3NQVA 2H8ZA 2C1HA 2VEKA 3DBPA 4N02A 1UB3A 1TV5A 1UCWA 1L9WA 1VLIA 1HL2A 1C9DA 2OT0A 2ZRVA 2FB3A 3G0SA 2RHGA 1YDOA 2FIQA 3LOTA 5GVJA 5CPNA 4PFMA 4MYAA 4O0ZA 4AMAA 5I3GA 3O6CA 2OMAA 4K7VA 1A5AA 5D2WA 5LGXA 3S1VA 3PY2A 3NPXA 2VEPA 3PUEA 3TFCA 1G7VA 5HINA 4UTMA 3CEPA 4EF8A 1GTEA 1LTDA 4KFOA 3PB2A 3TW7A 4UTWA 4M7TA 2GPTA 2NV1A 3O8AA 5J5DA 3M5ZA 3MP4A 1RQEA 3NPWA 3M0ZA 4NNCA 2CW6A 5EA9A 4B5NA 5A5WA 1F7BA 4UTHA 4RLIA 4LTSA 3RU6A 2NX1A 1TTPA 2XFWA 2ZZ5A 1D9EA 4KFNA 2FFCA 5TIMA 3KRZA 2A6LA 4ADUA 4DPPA 3O16A 4JNMA 2RH9A 1B3OA 3LV6A 1KFKA 3HB9A 1VYSX 3RFAA 3SZ8A 4RZ4A 1KA9F 4ZZ9A 5F4WA 4N4QA 1PHQA 2CLHA 1R2TA 3W7MA 3ATZA 4IUOA 5L9FA 3W6YA 3LI0A 2GQ9A 1KFLA 4RKAA 3INPA 3EX2A 2QEZA 4PA8A 3QM3A 1G4SA 3GAKA 5CZTA 1H1ZA 3KVMA 4JS3A 3MUXA 2YXGA 2QCLA 1KLZA 3UXDA 4UFJA 5AN7A 3S8HA 1K8XA 2YYUA 3IVSA 4A3UA 1O5KA 1DOSA 1EEPA 4TX9A 3VCRA 1H5YA 4IQLA 4FXSA 5C6MA 1AW2A 2O7QA 3LM7A 2YSWA 3CM4A 1WDWA 3L67A 2NUWA 3W7GA 2XN2A 3PAJA 3GIYA 3LLFA 1JQXA 2CZEA 5HR7A 1H7RA 2QF7A 1NFBA 1TPB1 4WX2A 4PL1A 1AMKA 3G18A 4QNWA 4RXGA 2Z0IA 3ABQA 3O63A 3TNOA 3WK0A 4PEKA 3W7NA 5DLCA 3P67A 3ZFHA 1AK5A 2CLLA 4LOCA 3IGUA 1G69A 2Y7EA 3NM3A 4HKPA 4NU7A 1FCQA 3W2UA 2CZFA 4XWUA 4DO6A 4MFEA 5E93A 3C4UA 3LHTA 1IF2A 2X1RA 1QO2A 5K9DA 2X2GA 3C61A 2CLEA 3S5ZA 1DKWA 1H63A 3IGXA 1KFBA 4XTDA 2Q3RA 4PH6A 4AHPA 4RK8A 5KSWA 3PM6A 5HUPA 3R8RA 4JYDA 3P82A 2NV2A 1OFBA 2ISVA 2JGQA 3PUOA 2ZRWA 4MKNA 1LORA 3VE9A 3V1PA 4O1BA 3W72A 3ZWTA 3I7QA 1OK4A 3FJLA 2I9EA 4BF9A 2HTMA 4WOZA 3AO0A 3TC6A 4NJGA 2B4GA 3KXQA 3N34A 3O6YX 1SZNA 5E0KA 5FF7A 1LOQA 1LRTA 3P7YA 3EWZA 3RNDA 4DF0A 4UFMA 1OFQA 3DKJA 4GUHA 1S5TA 3DI0A 3LB0A 5AB3A 2G95A 4HNVA 1DL3A 1U83A 4DXVA 1KTCA 1KM1A 4JIQA 1KTBA 2GJLA 3P81A 4UFKA 3ZS4A 1O94A 1CI1A 4QQ3A 3L65A 1H7PA 3BVJA 2FB2A 3M7WA 3QH2A 1MEIA 3NYZA 3M43A 1B57A 4A2RA 5DN1A 1LZOA 3SIZA 4EVZA 2PRMA 3EWBX 3W74A 2HS6A 3CIWA 3QQ1A 3W1NA 3W76A 5HMSA 3B4UA 3GNDA 1UUOA 2HMCA 3LBMA 3GLCA 3DHDA 3W71A 4ICNA 3ELFA 3HG2A 1TPC1 1U5JA 1TPUA 3G0XA 4DELA 4OQVA 3NXFA 5G2HA 2G97A 1PVNA 3MI6A 2EKCA 1ZENA 4Q4KA 4O1CA 2NX3A 4IOTA 1WOAA 4UTJA 1P5BA 3UXAA 3HGRA 1H51A 1DJNA 4O18A 1AW1A 1IXPA 3SFKA 3NQDA 4KWVA 3DFNA 2FLIA 2V5LA 2JKPA 1FWSA 4WY0A 3WJSA 2O7SA 2C13A 2E5CA 4I7WA 4LWWA 5D2TA 1A5SA 4LRTA 4OGZA 2Y88A 5AHIA 3SECA 4LRSA 2W0UA 3T7VA 1F6KA 3BGJA 4ORMA 4Z0SA 1W8SA 1WX0A 1QO5A 3W7HA 3M16A 1TQXA 3LCIA 5EPDA 3T40A 1LRQA 3VE7A 5LHFA 4MUZA 3SR7A 4YMZA 1B9BA 3QSTA 4FIRA 1RR2A 4ZQMA 3O07A 2OZ0A 3G1FA 1NAL1 1F2JA 2H8XA 3W2MA 1H7XA 5AHFA 3LDVA 2PC4A 1NSJA 5LNVA 3W7KA 3C3NA 3GXNA 1YYAA 2ZRZA 3FLUA 4IMGA 3STGA 3GK0A 4JGDA 2VEMA 4KWWA 1FY6A 3QRHA 2J9XA 1AG1O 1XM3A 1ML1A 3F1QA 3PBUA 3PSVA 1HTIA 4Z1CA 3W1UA 1DHPA 3SJ3A 2JBMA 3BG9A 3TR2A 1ME7A 1FDZA 1LDCA 3BV4A 3PG8A 5LGZA 3IRDA 2CFFA 5BNKA 2E68A 4UTLA 1QOPA 3EWWA 5K7JA 2WQPA 2ZA2A 2YCEA 3D0CA 1PV8A 1C29A 3BARA 4O57A 3W85A 1OF8A 3DFOA 5K2ZA 4O19A 3PWAA 5D2YA 1JRCA 2EHHA 4UMCA 2C3ZA 5HWNA 1G4PA 2Z1BA 1YPIA 2Z2UA 4RZ5A 3H53A 5IM51 4NX5A 1MEHA 4UR8A 3OG3A 5F2MA 4O54A 3S1UA 3EX6A 1ME8A 3HPZA 2E6FA 4LVAA 4O17A 1XDLA 4NVTA 4Z1AA 4JEQA 2Y6ZA 3A22A 4L4LA 3TX9A 2RDTA 1OX4B 1I2RA 4MY9A 2TPSA 2WNNA 3LXAA 3MYPA 4K8HA 1ICQA 2E6AA 3THAA 4GJ1A 4UXDA 4GNJA 1UBSA 3DENA 5CKSA 3DU0A 2YW3A 3CWOX 3GDRA 3PR2A 4FIQA 3LCLA 1N55A 4FX7A 3WJWA 2QR6A 4TR9A 4ADTA 3N3MA 5FF3A 1I45A 4UTTC 1KV5A 4FNPA 1TTJA 2Y85A 1LBFA 3FYPA 4AWSA 2ZRXA 1UJPA 2DZSA 5D02A 2DU2A 3NQ7A 2OJPA 4FNRA 3WFAA 4ADSA 2ZTJA 1K7FA 3W3OA 1RVGA 2YDAA 4X2RA 2J9ZA 4IMCA 4N9BA 1CW2A 1JRBA 5KITA 4N2YA 3G3DA 3G1XA 1R30A 2YPIA 2P1FA 5HNRA 1FWWA 1Q6QA 2X30A 2ABAA 3WJYA 4OV9A 2WSQA 4AVFA 3U6WA 2WJZA 3NEVA 4KFPA 4HSNA 1FWTA 2Q8ZA 1ALDA 1DBTA 1KM4A 3STFA 5HQEA 3C0JA 1W54A 4P2VA 4O14A 3GKAA 3EX3A 4GXMA 1KBJA 3JR2A 4O8RA 2Y70A 2C14A 3LBCA 4AHQA 3Q58A 4CNOA 1EP3A 5DY3A 1QFEA 4IJBA 3MI3A 3MBDA 1EX5A 1XCFA 2VXNA 3HMJG 4LS0A 4JTKA 3NR0A 1GPWA 4I7VA 2EAWA 3GXTA 1MEWA 2V5BA 5CZSA 2QCCA 3FJ6A 1B4KA 2J6XA 1ZHAA 4MY8A 2HSAA 1RV8A 2AGKA 2Z6IA 4Y6GA 3L0NA 2ZZ6A 4RJEA 1Q6OA 3G1DA 1OFRA 3H55A 1ZFJA 1MZHA 2LLEA 2KZHA 3G1YA 2ZTKA 2R94A 4FEZA 4ZQCA 3BW2A 2ZZ2A 3E49A 3UWWA 3W7IA 1RD5A 1SO4A 5D37A 3TAOA 4H3DA 3PULA 1YDNA 1EUAA 4DPQA 3LGEA 4GC4A 4LUJA 1W3TA 3ANYA 4UMAA 3W70A 5KTLA 2DZWA 3RF9A 1ZAIA 3C2RA 1JCNA 3P80A 4IMEA 1FUYA 1LM1A 4FHAA 1TPEA 5BMWA 3LHZA 1F73A 1ZAJA 2X1UA 3P74A 1OFEA 3V75A 2FJKA 2QUUA 1QWGA 2R14A 4MZ8A 1H7NA 1N7KA 5DBUA 4IX2A 1KFJA 4NZFA 3C2OA 3HIJA 4IX0A 3HG4A 4EWND 3IVUA 3SSJA 4E2BA 5CG7A 2ABBA 4X3ZA 4K37A 1SZGA 4A29A 5D38A 5F4SA 4GBUA 1ZNNA 4ZL1A 1FXPA 1O5XA 2C6QA 3I6RA 3VI2A 3A5VA 3RMJA 5I3JA 3E12A 3UZ5A 1H50A 5LHEA 3PBYA 1GVOA 5G4WA 4JY9A 5G5IA 1H62A 4JTSA 5HR6A 1TPWA 1VRDA 5EYWA 4JY8A 3W88A 4WXYA 3LHWA 3W84A 1GVFA 3MO7A 5AYYA 3NM1A 1TTIA 1X8FA 1VZWA 3RLUA 1JQVA 3GNNA 4IXXA 1X6UA 4EIVA 3UD6A 3GR8A 2YW4A 1DJQA 3PSWA 1JR1A 4K8EA 2RKXA 2WKJA 3P60A 2NUYA 4LT9A 2DORA 1FQ0A 4MLJA 5FEPA 1LYXA 3TCEA 3T44A 1K7EA 1EWEA 1Q6LA 2JGYA 3LHUA 2CZDA 1Z44A 5TBOA 3CLMA 3T55A 2VFGA 3G8RA 3W7LA 3W1TA 1JUBA 4S2CA 2Y7DA 5F1VA 5F1UA 3TXZA 4NJIA 1OABA 5K9XA 3NL6A 4N6EA 3A9IA 4A22A 1X1OA 4FNUA 4LS1A 3LTSA 1XDMA 5AFDA 1ONRA 1PHWA 1FX6A 3OEXA 1QMLA 2A7PA 4AB4A 3W2KA 3FA5A 3EWXA 3BW3A 2V30A 1MO0A 4MY1A 1XBYA 4DQWA 4C1KA 4AWTA 1SSDA 1LLWA 1RQBA 1EWDA 1H61A 5F2GA 1J4EA 4OE7A 3DH7A 1YADA 5D03A 2B7QA 4H6KA 1JCLA 3O6DA 3K30A 4BI7A 2GQAA 3DXIA 2QCDA 1Z42A 1L6SA 3GR7A 1OVDA 1GYNA 4MIMA 1L6WA 1OF6A 4QIUA 3W1RA 1GQNA 3QQ0A 3DAQA 3N73A 2AQWA 1MXSA 1W37A 1SO3A 2BTMA 5HUOA 4UNKA 1JCYA 3P5YA 5IBXC 3R13A 3A24A 2V2HA 5I3IA 3FYOA 3QMSA 4JTHA 3NQ8A 2DZXA 4CCEA 1OK6A 3BW4A 3DFQA 3M6YA 3NL5A 1QOQA 4ZVJA 4OT7A 4GUGA 3H54A 1F76A 1KM5A 3UWVA 3LRKA 3E02A 3HG5A 5E1QA 3QF0A 3MBFA 3JS3A 4LVBA
chains in the Genus database with same CATH superfamily
1VFFA 2H3DA 1ZP4A 2PWEA 3WUGA 2ZX5A 4OU1A 4ZQRA 3PUGA 3EOLA 3EKLA 3ALGA 1QVBA 2TSYA 2XINA 4B16A 4DJDC 5K3VA 3UZXA 1L8PA 4DEFA 5KZ6A 2VI0A 4LEQA 4Y8FA 1IEIA 4DLFA 4ES4A 2VENA 1UR3M 1W0MA 2NT1A 3C56A 4RE0A 4BF5A 4O11A 5D4YA 1X7FA 4GZ7A 4JQ1A 5CSUA 2FQIA 3KX6A 1DP0A 3TSMA 3IIZA 3NOEA 2PI6A 4PB3A 2RDUA 3AYTA 3AMDA 5EBUA 1BQCA 2OYKA 3OQ8A 4RR4A 2F38A 1Q66A 2P5NA 3NG3A 3VOHA 2ZA3A 5BOOA 3TWBA 3SGUA 3IV3A 4FXJA 4AZ7A 4GI8A 2DT2A 1VBGA 1OFAA 2C0AA 2W6RA 4ICCX 3UT0A 3LU2A 1MRAA 3N6JA 1K77A 3R79A 3HPFA 2DSWA 2QJGA 1ONWA 1O1ZA 3HJZA 3K13A 1HNYA 2VGGA 5DELA 2QDHA 2VP8A 1JIBA 1NJJA 4U31A 4F79A 1BSIA 4Q7NA 5HMFA 5LYRA 1E9IA 2IQTA 3OVRA 5FL1A 1P7TB 5DXYA 5FEWA 3L4YA 3MUAA 2HJPA 2NXGA 5XIAA 4Z1BA 4ERGA 3CAQA 3W28A 4O53A 1IGSA 3NEHA 3TQKA 1UMYA 3N4EA 2J6VA 1VBHA 2YCKX 4C6BA 3GVRA 2D69A 3CZJA 3DFTA 3IVTA 3WY1A 1CB2A 4GH1A 1FBAA 3AS3A 5A2BA 3QJAA 3RHGA 4INFA 2BASA 4GGHA 2RFGA 2EF9A 1J96A 1US0A 4HHPA 4JL2A 9CGTA 9XIMA 3PPGA 5DT5A 1OM0A 4LQ1A 2R1MA 4DO5A 3VD5A 3W1XA 2W92A 2QKFA 1Q5MA 3OBKA 4O28A 4WQ6A 2WSKA 5IRPA 3ZZ1A 3B8VA 3BC9A 3FXYA 5TD4A 5EKYA 4IIBA 4C7GA 2FZ8A 3VIHA 2PU0A 3EXRA 3GB6A 2VGFA 1F05A 4GFIA 3MU7A 2ZX8A 4RE3A 4O16A 1A4LA 3QR3A 1KV8A 1E40A 2ZFAA 1TUXA 4AQLA 1G7UA 1BYCA 1S1PA 2P3EA 3DYPA 2FZBA 1P0DA 2XWDA 4K3ZA 4M1RA 1GZ1A 1NVMA 1HKJA 5AZ0A 4J3SA 4OV4A 2H6RA 3A5FA 1OG0A 2TYSA 3TH6A 3CUZA 3MI2A 1K8YA 4U28A 2C71A 2HPIA 2NT0A 1LL6A 5JIPA 1JYVA 4C5ZA 4UZUA 4MJMA 4L1XA 1RJPA 4RV3A 1EZ2A 4TO8A 4HOZA 2WV8A 2YB4A 1BVNP 1T99A 4LSBA 1XBXA 1DQUA 4CN6A 3LHYA 4OWGA 1MW3A 4O4VA 3LCFA 3DG6A 1TWDA 2XFFA 3LNPA 4D1JA 1S5WA 1HO1A 2A7RA 1V7YA 4Q4MA 2AL2B 3PB0A 3CAWA 4FK9A 2W5FA 5C8BB 4FLRA 4DWSD 3RK8A 3TU9A 1CX9A 5HJXA 1ZY9A 2Y8UA 2VDIA 1R3YA 1UKPA 3VDHA 2B7NA 1O5RA 2WXDM 3P84A 3K8MA 4I8YA 1I2QA 3TW9A 4C6QA 4A8NA 1XFCA 1TIMA 4CCZA 1UZ1A 5CZ0A 5I07A 3GRIA 2ISFA 4W5ZA 4LXFA 4NIRA 4RDWA 1P48A 1DQWA 5AVHA 3N18A 3APYA 2ZUMA 2W9MA 3N2CA 1YDVA 3VKJA 2J88A 2G5WA 3CHVA 1XIMA 3CQKA 4BEUA 3U8GA 4DF1A 5JQ9A 1E9LA 4NYYA 3S42A 3CBWA 2W4XA 1KD0A 4HPNA 2DQWA 3I4KA 3RR1A 3EB2A 4N9CA 1V02A 5FESA 7ODCA 5ABEA 2OVLA 1RH9A 5U4NA 4GUIA 1A53A 1SUXA 3H2OA 4KCWA 4GI9A 1MRQA 3HQ1A 3TAKA 2CCRA 3JZUA 3M4HA 4LAZA 3REQA 3Q45A 4LGXA 1BGAA 2YDSA 3EA2A 2VRQA 4P61A 1V4YA 1NQKA 4J27A 3IJLA 3WLIA 1GW1A 3NL2A 2ACRA 3UR5A 1UIPA 4XO6A 1B2YA 4H83A 3WH5A 4JIEA 2JE8A 1UH2A 3IV8A 1TB3A 3RCYA 1DQXA 3UG8A 3IIXA 3W7EA 2UWFA 4HNTA 1SQ7A 4DUOA 5EMUA 1Q4WA 1S3HA 4QCEA 3O05A 1E5NA 3EOEA 2XVNA 4MLRA 1GWJA 4O50A 3W23A 2G4FA 3E0IA 1E3XA 3TSDA 4PCNA 2QCMA 1UP2A 2A4AA 4UWMA 4QJ3B 3CZKA 1HKIA 3VILA 1KBIA 3SUUA 4RCXA 1L2QA 3DYOA 1GKRA 2ACSA 1TPFA 3MUCA 1WAUA 2NQZA 4KT2A 3LGGA 4LUSB 4ZMGA 1CLVA 3SFWA 4C6CA 1W8GA 5LA0A 3CMGA 1IT7A 2HEJA 4PBFA 4WLCA 1GJPA 1B4EA 3PS7A 1AH0A 2Z1XA 3LLDA 2Y7FA 3K46A 4KEMA 4UTUA 2X1TA 4MJ4A 3PZ9A 4KW2A 4N4PA 4AX6A 4EACA 2GDUA 1TZZA 3K8KA 3S2NA 3U2OA 3M44A 2QXWA 5JBDA 4M3PA 4GVFA 2QJHA 1OIMA 3QTPA 3ZOAA 3RX2A 1XC4A 1EA0A 1UR1A 4CQAA 2C79A 2BDQA 1GQJA 1B5TA 5K4ZA 4JTLA 4UUIA 1PL9A 5HBFA 1REQA 4P8VA 4O15A 1I60A 3FIGA 1W9UA 3QV6A 4GJIA 1I2OA 1YNPA 1E6NA 1FTXA 3V0SA 4RPPA 2QUTA 3W37A 3MHUA 1UKTA 5G1TA 1TWZA 4ZOEA 2NXHA 1DWIM 1J6PA 3FFSA 3UEQA 3BZGA 2GJNA 4O10A 4E2DA 4NAFA 4G1KA 4LVGA 3KL3A 3H6OA 3DFPA 4WY0F 2QDDA 1UKSA 2XVLA 5JMUA 2OX1A 1F74A 1FWCC 1TE1A 2YR1A 2WWCA 1A5KC 4EANA 3SY5A 2WKGA 4D6FA 1H4PA 3EKZA 2QCFA 4M5PA 1HP5A 3C0LA 3KRUA 4CEXC 3NSNA 2Q3OA 1PXGA 4NRRA 2BXVA 3OLGA 3P5ZA 2GJXB 2REQB 4LVFA 1TREA 4ZENA 4EWJA 3HMCA 2Y62A 3SB0A 2FVKA 1FWNA 3ZJ7A 2WM1A 2XFYA 1UPPA 5CPLA 1QNPA 3UCCA 3AIUA 1VJIA 2WZTA 3N04A 4I8DA 4U5KA 3UZJA 2PTYA 3UWQA 4G5DA 2A6NA 2G8ZA 1PWLA 1C8VA 4BFAA 2CLMA 1YTDA 2J7DA 2NWSA 1GEHA 1MYRA 2QS8A 1YTKA 4BQ4A 4F0HA 2DIKA 5I3KA 4LYRA 3QMRA 1AD1A 1MNSA 3R94A 3SI9A 4HBKA 5SWUA 1AH4A 2FMNA 3RILA 1DJHA 4S2BA 2QDGA 3CT7A 2VUNA 1E0VA 2R24A 3O2LA 3UQNA 7XIMA 1KGUA 1TJ1A 3G3MA 1YXYA 2VKZG 3W01A 1H5VA 4M7SA 3OIXA 3W81A 3TC3A 1RCOB 4QEEA 2DZUA 3UA3A 2CNCA 2RDWA 3SRFA 4O12A 4XVDA 4R27A 3WLPA 3U2CA 4R53A 4BR1A 3GBDA 2AGTA 1OX4A 3TA6A 3GG1A 4AC1X 3BG5A 3V0TA 3S2CA 3SEPA 1F5ZA 1MW0A 2NV9A 2PDIA 3KDNA 1WBHA 3W1MA 4AEEA 5C5YA 3WK1A 3MZ2A 1IT0A 3W86A 3OA3A 3STCA 4YTTA 1CZ1A 2VCBA 1EL3A 4M51A 4WDUA 4HPXA 3HGJA 1H7WA 3PTMA 3ZR5A 3U7VA 4XV0A 1NWUA 1NF7A 2PGWA 2DH2A 5D9MA 2Q8LA 1CLKA 1TFVA 1NF0A 3TQVA 5KETA 2JKAA 3FS2A 5A69A 3V36A 1O60A 2B0MA 3CIXA 2JFEX 1FCBA 1XD0A 4WVXA 1D3GA 3TWAA 4D2JA 3RGTA 1KW1A 4W89A 3M47A 1K6AA 4S39A 4DO7A 4L61A 4GQGA 1SR9A 3C2VA 3PBGA 3SCUA 3NJ3A 3N1AA 3FGCA 1UC5A 3P0XA 3WN6A 2E4TA 1Q7MA 2ZXBA 4S3DA 3MMTA 4W9TA 1I8JA 1VPXA 3DGRA 2PWGA 3CQ0A 1K03A 1PIGA 2YLAA 4YCOA 1OFPA 1EUNA 3GG8A 1VHCA 4MJZA 4LH8A 3G1VA 3GE7A 3M0IA 3QYQA 1HW6A 3VKCA 2P8BA 5HMEA 3C8NA 1GVSA 3L68A 3MHGA 1UA7A 2GDQA 4F3HA 5AECA 2F2KA 1RBOB 1J2WA 3EWUA 2E5BA 3T09A 1CTNA 2OODA 1TV3A 4L4PA 5HJLA 4PUWA 3NZ1A 2C18A 7REQB 1TUFA 2BGNE 3VMPA 1VBUA 4Y9OA 3B9NA 3PZNA 2ZRUA 1DTUA 4HMNA 2DGAA 1CGTA 1VPQA 3THDA 2ZZ1A 2BSLA 5T91A 3TK7A 4PMJA 1HL9A 3HN3A 1UR2A 4JX4A 3W4RA 1HO4A 2BBFA 2VCCA 2ZX9A 1XGEA 1VFHA 1WKYA 1V3KA 4GPNA 3F4WA 2GQ3A 2HWGA 3TYDA 4HMEA 4XAZA 4QEHA 1VFMA 1CGVA 1VYPX 1UJQA 4CVUA 3KS6A 1VCFA 1O68A 2PLMA 1Z48A 3QXBA 3GVGA 1JD7A 2BLEA 1YLVA 2GGGA 1PX3A 5A2CA 4GY7A 1I4NA 2F8QA 1FWIC 2OYMA 3OJGA 3CHFA 3L4VA 1KCLA 4HCHA 4IUGA 3KFTA 1RLCL 1JCTA 3BPWA 3KBMA 3R8GA 1TCDA 3R12A 1XW8A 3G1HA 3JW7A 3WQ6A 3QKZA 1LG1A 4N6FA 3SCSA 1EB3A 3VNYA 4IMAA 1W3IA 1BEUA 4FXFA 4UQ9A 1F3TA 4NZ5A 3VOFA 5ENLA 4IIHA 3QN3A 2UY4A 3NSMA 4R7JA 5JXQA 1LJYA 3ZWSA 3H7UA 3F4DA 1FXQA 3CQJA 1YBQB 3PHAA 3LS9A 4IMFA 4GIEA 5AKQA 4UTTA 4I9AA 2FKPA 1QPNA 5BXSA 4Q8NA 1CXEA 3NQAA 4TTUA 1VFSA 3N4FA 1UWRA 2XZ9A 3HV8A 3B9AA 1KLYA 1EA9C 2VFHA 3IIVA 3LNMA 2DZVA 3VIMA 2W79A 4DNMA 4QR6A 3H70A 3IAPA 3L4TA 4A8RA 5IOBA 3AYRA 4TUFA 3RPMA 3IS4A 3W7JA 4HOWA 5TQLA 1UWAA 2FTYA 1VYRA 2ZVIA 3W25A 3POHA 4HQVA 2DT3A 4UFIA 5HWJA 2V8ZA 3C6CA 2OLSA 3RUBL 2NX9A 2OXNA 3PF3A 1PO9A 3GU2A 3D3AA 3EBVA 1BGGA 3W7QA 1RUSA 3DBPA 1VIZA 4JFVA 1ECEA 3J7HA 2GL5A 5LIKX 2NQ5A 1VLIA 4ZB5A 5BROA 1C9DA 2ZUNA 3AMLA 2PTDA 5GVJA 3VNKA 3BH4A 4H00A 4MYAA 5I3GA 2VDHA 5LGXA 3BJSA 3NPXA 3KL0A 5I06A 4NI3A 2OO0A 5JH2A 4CNTA 1W2VA 5HINA 1HIZA 1OADA 2WPGA 2PD5A 4JNZA 4PGLA 4AD1A 3A47A 5B80A 3ITTA 1LTDA 2BG5A 1FP8A 1I1XA 3EA1A 2OQHA 3MP4A 1J9YA 4NNCA 3WQFA 5EA9A 4B5NA 4RLIA 2PDGA 1TTPA 3W00A 1D9EA 4KFNA 2DY3A 4UQEA 2FFCA 2A6LA 1B3OA 3PZGA 5I78A 4RZ4A 3WLQA 2DZAA 4N4QA 1RHCA 1R2TA 3ATZA 1KFLA 3WDIA 1AJ2A 3GAKA 3UXLA 3WQGA 3ABXA 1RP9A 1XCXA 2PWVA 1KLZA 4UFJA 3NUKA 2Z2BA 4A3UA 3CL8A 4ACYA 1DOSA 4AZ5A 2PDLA 3S5SA 2PDYA 5FJUA 4OZOA 4XD6A 4FXSA 1TIWA 1DIOA 3GU9A 4IP4A 3PZUA 1WDWA 4AG0A 1TCMA 1JQXA 1H7RA 2QF7A 1MUWA 4HYVA 1HX0A 2Z0IA 3O63A 4C6KA 3L12A 3TNOA 3VUSA 3TLLA 4EPEC 3BAKA 3WK0A 5DLCA 5BXPA 3P67A 2CLLA 3LZ3A 1G69A 2Y7EA 3NDYA 2I56A 4MB4A 4GCXA 3B9OA 4HYRA 1E43A 4OUIA 1DEDA 1UR4A 1U1UA 4PH6A 3PM6A 2XDFA 1RVKA 1JGMA 4JYDA 3N6QA 4ZTXA 2ISVA 4MKNA 2PZ0A 1IR1A 1Z69A 1Y5VA 1OK4A 1D2KA 4GCAA 4XIMA 4BF9A 3OP2A 3AO0A 3CV6A 4F0MA 1CGWA 4XZBA 1PZ2A 5C9UA 1F61A 3KXQA 1V3JA 1TMQA 5FF7A 3KCLA 3CUFA 4W85A 3EWZA 4DF0A 1XLGA 3PTDA 1EEXA 3DI0A 1PBGA 2P50A 1DL3A 4AEFA 1KTCA 1KM1A 4CD6A 1KTBA 4P7LA 1XX1A 1X98A 1PKNA 2B81A 4UFKA 1YIXA 3ZS4A 4A3RA 4JBRA 2J47A 3LA4A 3L65A 3I10A 1H7PA 3BVJA 3FDGA 3KCJA 3VFCA 4G8TA 3RM8A 5FA5A 4CQDA 1GK8A 4A35A 5JBFA 3SIZA 2WJDA 3KOXA 1Q13A 3ALFA 4HA3A 4AVNA 3VYLA 1SMDA 4WHBA 4D72A 1H41A 3EKGA 4I5RA 3W76A 1NARA 3B4UA 1PAMA 3LBMA 3HM7A 5D8ZA 1IEWA 6REQB 8RUCA 3AXMA 3SY1A 4MWAC 1GJUA 4XAPA 3NXFA 2JEQA 5G2HA 2J13A 2EKCA 1ZENA 4MAVA 2V3FA 4O1CA 1M65A 2NX3A 1WOAA 3HGRA 4I6VA 1XLKA 2XSXA 3SY8A 3GQYA 4AD4A 1GOOA 2JKPA 5FAGA 1AJ0A 1X6LA 1FOBA 1A5SA 4MSSA 3P93A 4LRTA 3FGCB 2PSNA 2Y88A 5AHIA 1W9DM 4TOQA 2HQAA 1VF8A 1SGJA 4L9YA 4ORMA 4Z0SA 3DHUA 3WLSA 1WX0A 2BOGX 4Q8WA 1DJYA 4GVIA 5EPDA 3T40A 1J6OA 1LRQA 3VE7A 1YKWA 5HQLA 4HA4A 4JKLA 1B9BA 3QSTA 4FIRA 3FN9A 3VXGA 3O07A 1E1CB 4OBSA 2H8XA 1JEZA 3W2MA 4IIEA 4F9DA 3LDVA 3ZIZA 3W7KA 4MWAE 3C3NA 3FLUA 1W17A 3MCMA 4IMGA 2GZXA 2VEMA 4KWWA 1FY6A 3ANVA 3QRHA 3CPUA 5DX7A 3MVTA 4BY3A 1XYZA 4YTSA 1XM3A 4B2DD 3F1QA 2D3LA 2JBMA 4GXWA 3B0YA 3CHEA 1XYCA 3ZLGA 3IRDA 4PN2A 4JHOA 1PJ9A 3TZFA 3EWWA 2VEFA 5K7JA 2CHOA 3BMXA 4JTDA 1C29A 3I3EA 5I09A 3GBEA 3DFOA 3FW6A 1K6WA 2PP1A 3II1A 1UWQA 4RZ5A 3FXGA 1JYXA 5IM51 5DMMA 4NX5A 1MEHA 5I2UA 3LQGA 1Z6KA 3EWDA 4Q6XA 4HNCA 4O17A 2BY0A 4PRRA 4H7CA 5HANA 4Z1AA 2J8GA 3A22A 1OX4B 2WHJA 4K8HA 5DMLA 1BAGA 1TZ7A 3UZWA 1UBSA 1ZRQA 4G7FA 3N4AA 1ZJAA 2WAGA 4CD5A 3OB8A 3CXOA 4YTRA 2Y5EA 4FX7A 4TR9A 3N3MA 2PB1A 7CGTA 1LBFA 2QDEA 1MWOA 2ZRXA 2QVHA 2G3JA 2DZSA 4W5UA 2OJPA 1D8CA 1RD6A 1K7FA 2HROA 3W3OA 1EJXC 1RLDA 1RVGA 4W7WA 3QHOA 3W6LA 2J9ZA 1SZRA 4N9BA 5KITA 4N2YA 4UQDA 2D20A 3NQBA 1I0BA 3WLKX 5C9XA 3WJYA 1KRBC 4AVFA 1C8XA 3U6WA 4KFPA 2E0PA 2V5KA 3BLPX 1KM4A 2CEQA 3L4ZA 4P2VA 4RNHA 2UY2A 4P8XA 3EX3A 1CIUA 4XB3A 1A0DA 2ZUTA 4O8RA 2WMIA 1FWJC 1A3WA 3CIVA 1EP3A 4NASA 1R3VA 2G3FA 5BRQA 2VXNA 1V03A 4LS0A 4M8UA 3VDGA 4I7VA 4NILA 1XPYA 3P14A 4NAFB 4E4FA 8CGTA 4HHHA 4QAWA 2WZIA 2HNEA 1JDCA 2AGKA 4QP0A 3SCOA 3L0NA 2ZZ6A 4LUSA 1GOIA 1YQ2A 2CKSA 2TODA 1K9FA 1MZHA 3GDBA 2R94A 2VT0A 4ZQCA 1H49A 1JAKA 2B31A 3BAIA 3WH6A 2W66A 3VNJA 1RXOB 3W7IA 1OD8A 1RD5A 5D37A 4PTWA 3VIFA 3LGEA 4LUJA 3RG6A 3APTA 3ANYA 3AIBA 5CJ5A 2VR5A 2YXXA 3W70A 2D23A 3RF9A 1JDFA 1JCNA 4PMQA 3P80A 4E2OA 4IMEA 4ACZA 5CC6A 2C91A 1HVXA 1Z8AA 1ADSA 2ACQA 1XH1A 4XK2A 3H21A 3P74A 4REQA 2FJKA 4H9VA 4GD0A 5M5DA 3WG6A 1H7NA 1C7SA 2WNWA 3T8LA 4OUEA 2IKHA 1KFJA 4NZFA 4IX0A 3HG4A 4ML4A 4PMZA 4CU8A 4DYKA 2DQXA 2VC5A 1OIFA 3WD1A 2E67A 3H22A 4NZ3A 4V1YA 4PUJA 3F5KA 2C6QA 2I16A 3I6RA 4AY1A 2HE5A 4PUKA 2O9TA 2W67A 4KGLA 2Q09A 3UW6A 4JY9A 1XD1A 2EQDA 1V0MA 1DJIA 4HN8A 5EYWA 5HATA 3LHWA 3RRXA 3RX4A 3UJ2A 1GVFA 1HF6A 3QY6A 1XIJA 2CBIA 1JQVA 4CQCA 4IP7A 4PB5A 3M0HA 1J12A 4TX8A 2VMFA 1DJQA 1XH0A 4GISA 2WKJA 5E0CA 3P60A 2BOFX 1E3ZA 4J3ZA 4CN1A 5A8OA 1XIDA 1UD2A 5GJMA 1O5QA 3CUGA 5TBOA 1NOWA 2ZC8A 1VRXA 2OR2A 1XPGA 1DWHM 3OOQA 1MFUA 4NJIA 5K9XA 4CD7A 1NU5A 4O8AA 4Y9NA 3WQPA 2ZDSA 4FNUA 5JIWA 3LTSA 2ZADA 3M6DA 4GKLA 3U9IA 1UIOA 4P7QA 2VO5A 1H09A 1V6VA 4L6OA 4DJFD 1P43A 3FA5A 1XWYA 2V30A 1MO0A 3A3WA 3LK6A 4MY1A 1XBYA 4AD5A 3BCDA 2UZ9A 1EWDA 1H61A 1J4EA 3DH7A 5D03A 2EPOA 1CYGA 3RM9A 3VAVA 3LSBA 4ZOBA 4BI7A 2A3EA 3AMCA 2E9LA 1RJQA 3GR7A 3AXHA 1U33A 3CUJA 4MIMA 1L6WA 3USZA 4QIUA 1E6QM 2PDWA 5M3WA 2Y2WA 1EJSC 3A24A 1L6GA 3VM7A 5I3IA 5LIYX 3MT1A 2DZXA 3KBWA 3W6MA 3DFQA 1JZ6A 3M6YA 3GTFA 2FMOA 3D6NA 4DZHA 1KM5A 4F4RA 3LRKA 5DT7A 3E02A 3FEQA 3QF0A 3QZEA 5HDRA 1DWAM 1EYWA 3WQ8A 3WSUA 4JCMA 4QFUA 3A64A 3TDFA 3WQDA 2WMHA 2QIWA 4C6PA 2DVTA 4AVOA 2Y8VA 2A0NA 4H7ZA 3S46A 3USBA 1QWKA 1JZ8A 3E5PA 1J0KA 3L0GA 4MNJA 1QPKA 2G37A 5AYZA 2DT0A 3KM8A 4XISA 1W5OA 2E8YA 5FI8A 1OYAA 3JZEA 4Q7BA 1E70M 3P0WA 4YU1A 2NUXA 4PC8A 3U4FA 1K4HA 3F2BA 3OLIA 1W1B1 2Q6ZA 4U2YA 1Q2SA 2B7OA 4N9EA 4PMOA 3RLVA 2CLFA 4XZ9A 2F7FA 2D3NA 3FKKA 3LEPA 4ZQOA 1XFBA 3B06A 5DXXA 3EMQA 3E0VA 1CBGA 2DUZA 4MPQA 3GTNA 1E73M 5CZKA 3OHIA 1WYIA 1E1FA 1XYBA 2BX7A 3LX9A 2Z27A 3OLDA 5TNVA 2KAUC 1JCXA 3CHCA 3UJFA 3WUFA 3E2RA 2VRJA 4UNLA 3B9EA 1KM6A 3NQEA 3WQ4A 3CLWA 1V93A 3VABA 1TV7A 1LOLA 1CDGA 1J0IA 1E4LA 4LAMA 5EMYA 5K9CA 1CGYA 2ZZ7A 3WNKA 3NQCA 3M0YA 5CC7A 3GIPA 2FZ9A 5AC6A 1BD0A 1M53A 3MHFA 3WD2A 3AROA 1LROA 1F8MA 3W73A 1IEXA 5LZLA 3BAXA 1FWFC 4B90A 4YTUA 3HGSA 5E9XA 1PKMA 1VJSA 3E9AA 3W82A 1BPLB 4Q22A 1UASA 3GS6A 1S2VA 5FJOA 2E7FA 4S1FA 1YXCA 2YBVA 4CCDA 3V7PA 3NAVA 4MADA 5HJYA 2ZUVA 3HFYA 3OYXA 1S2WA 2W91A 4JEJA 4RE2A 3NIYA 2VC9A 2X1SA 4LYKA 3FOKA 3VCCA 4YL2A 3MSYA 1TJRA 3IK4A 5DEZA 3PJUA 1RA5A 2PDKA 4M81A 4H2CA 1QDSA 2IKJA 1VFLA 3VD7A 4S23A 3W9ZA 3MVIA 2IW0A 3QPYA 2IMRA 3VX1A 3GDMA 4GLEA 4LNCA 2V2DA 5FF2A 3MY9A 4FO4A 4XKYA 4ZGYA 2Y89A 3U0HA 2VNCA 3CB3A 1QNVA 4IGMA 3IPWA 2HXTA 1TVPA 4B3ZA 5E09A 3PN8A 3TIMA 4XSMA 3SADA 1G6CA 4M1BA 1GVYA 4OBRA 1XRTA 1MUMA 2X0YA 1K9TA 4HGXA 4HHLA 1QBBA 3AHVA 1YPFA 4J2PA 3S3GA 3KVLA 5MKGA 4NG3A 3W2JA 1XP3A 3JVAA 1DYSA 1XG3A 5AYXA 4ZR8A 1R9ZA 3AWOA 1JZ5A 2QJJA 2MUCA 1X1ZA 2CLOA 1M03A 1SZEA 1WOBA 4ORIA 4CNNA 4C6LA 1AQMA 1JF6A 3MP5A 4NQ1A 5JVLA 3TJLA 4KCUA 1S3TC 2GJRA 2AQOA 4FF5A 5HPOA 4EXAA 2EGZA 1E0WA 3WJZA 5T9CE 2XTKA 4NUWA 4XVEA 4EPDC 4X9SA 3WD3A 4EOUA 2CERA 3WK3A 4AZHA 1FWGC 4PZVA 1NWRA 3URAA 3L2IA 3R6IA 1U5HA 4DAIA 4LAOA 4GFSA 2CBVA 3CB8A 4JN6A 1XQLA 2AOSA 1PUDA 3HU7A 4AXNA 3LXBA 1V0NA 4GHRA 4F48A 4WK9A 3KBSA 1VS1A 5DF0A 4AIUA 3VFLA 2ZICA 2DP3A 3I7RA 4OFCA 3MC5A 4PMUA 3MUIA 3W87A 3BQ6A 1V3MA 5KMYA 4DYJA 1H3GA 1GEQA 4IJRA 4E3VA 1G94A 2ISDA 1RZMA 2DSKA 1CXIA 3GH7A 2GUBA 3BK0A 4LC8A 5EL1A 3LBOA 2TMDA 4POCA 3H4GA 1UH4A 3SM0A 4GE8A 2Z7GA 1W3JA 4G7EB 3BUVA 3NQ2A 3BICA 2SFPA 4UTIA 1RP8A 2J24A 1TTQA 1F3WA 2VX6A 2FVLA 2YCLA 1K1DA 4A3QA 2NQJA 5A8GA 1QW9A 2MNRA 4ZO9A 1ODZA 4D6GA 5D8WA 5A95A 4F9JA 5K4XA 2V38A 1XLCA 3L4XA 4JYEA 4ZO6A 2AQVA 1R85A 3IUHA 1OT1A 2VFIA 5H8UA 5CC5A 3IGSA 3AISA 3GVQA 3W1LA 3T9PA 1UUQA 2Y5JA 4PRWA 3MKVA 1OCBA 2OOFA 4PCFA 1NFPA 4XBKA 1XSJA 3VNDA 1GVEA 4KWOA 4JTRA 1BXBA 3K4WA 4O1AA 1FKWA 4LY8A 3B97A 4D8AA 1WNOA 5IHSA 3PBMA 1TX0A 4Q4QA 1F4AA 1GVQA 1ZPTA 3BV7A 3C0QA 4Z2LA 4IG2A 5GPRA 4JQ4A 1D7KA 5LNSA 1XLIA 1XUUA 3ARXA 4J28A 3KBJA 5A8MA 3B0VC 3NTYA 4V1XA 4A8LA 5HQMA 2FTPA 3R2GA 4QG8A 1AQ0A 1FDYA 1P6CA 5I0DA 2E6YA 1E15A 4Z1DA 4HNOA 1PCWA 4TQTA 2QCNA 2VX5A 2WCAA 3TYAA 4QLJA 1BKSA 3N11A 1KBBA 2VZTA 3V0UA 2PAJA 1MI3A 5G4EA 5A1AA 4DWSA 2XYLA 1V6UA 1PEZA 2PF0A 4FLOA 2AAMA 1CXKA 4PBGA 4PMRA 2HDJA 3WENA 1MMFA 4LW7A 3W1AA 4WF7A 4UTFA 2PUZA 3LCXA 5L6UA 2J74A 4GNKB 1CGXA 3QV7A 1M01A 2OSWA 1W3HA 3WCZA 3UWUA 2ADAA 4JNYA 3DIPA 4DO4A 2W61A 5I3HA 3W27A 1IE7C 1NDYA 4NZ4A 1ZB5A 3TFXA 3QW3A 1JGIA 1HG3A 4U4MA 4ZE5A 2E1DA 1GHSA 1WO2A 3NQGA 1EJTC 3GNOA 3NZQA 3VD3A 4PTNA 1H7OA 4B5WA 4DJDD 4IXHA 1LQ2A 5IHRA 3WH9A 2YZRA 1WZLA 3SGGA 4KCVA 4WCJA 1OHLA 3UU0A 3PZQA 1U30A 2BVDA 2Z4GA 1OX6A 2IXVA 1NDZA 1R3WA 3WFZA 1PS9A 3T0TA 5H8PA 3QGKC 1O12A 2XVGA 5H6HA 3MJYA 4JYFA 3MO4A 4K6AA 2FGZA 5BXTA 4NJHA 3GXDA 4MMWA 1PB0A 1HQTA 2XUCA 4NY2A 2JIEA 3R43A 3YPIA 4QJ5B 2FZDA 2V68A 1KGXA 2WC7A 4FMVA 3W7OA 1Q2RA 1UQZA 1QT1A 4V2XA 2OWCA 2GK1B 1R46A 4JIIX 2V9DA 4KEZA 3WLTA 3VKDA 1A50A 4NJKA 4GUJA 3GXPA 3APGA 4EE9A 1VLWA 1W5QA 2OTDA 4DJFC 3O15A 3QLDA 2FHFA 4S3JA 4U2ZA 1XBVA 4XG1A 4KS0A 3OTRA 1KTNA 1US3A 4A6GA 3UR8A 5C0QA 2FH6A 4EPKA 1C8QA 2BHUA 2PP0A 4NZ1A 4MNMA 3O1NA 3LTYA 3TLQA 4QXIA 3WFLA 2GJPA 4GY0A 3GYEA 1S5NA 3K2GA 5CBIA 1A0CA 1IXNA 1M9HA 2ZQ0A 5CAKA 1G67A 2WZHA 3UNTA 1W9VA 5CH9A 1US2A 3FK4A 3BJTA 1KXQA 5AOUA 1B3ZA 3OZOA 1I2NA 4KWSA 3AHZA 3QSRA 4WSHA 4DZIA 4NL1A 4DBEA 3E6EA 1O7AA 2FPTA 1I0DA 3S1GA 3I68A 1TV8A 1Y8BA 2I57A 3UPMA 4FB7A 4H9YA 3FHQA 1SR0A 3EXSA 5IDZA 3KLKA 3ARQA 4TVCA 1OCJA 4BF7A 4J4KA 4LALA 2C8NA 4OKDA 3A4JA 5CG0A 4GOAA 4HT3A 2O55A 3ABRA 4WDWA 4GA8A 5EMKA 3U7BA 1V02E 3TTQA 1TE6A 2H9AA 3STEA 4O4WA 3TEVA 2R1NA 5HPCA 2ZKMX 2OWWA 4M6VA 4Z17A 4L64A 1SO6A 2NVDA 2V82A 9RUBA 1W5MA 4H8NA 3WZ0E 5CCZA 4XBSA 1G4TA 1K7XA 4R7WA 3WF2A 1WZMA 1TV4A 3G2GA 1MDLA 2A1YA 3RPDA 4GUFA 1D3CA 4AZCB 1XSKA 3T4CA 1QPRA 3C2EA 3QV9A 1QCWA 4MWAA 4LUYA 1LOSA 3DC8A 4BI6A 4PE8A 4MB5A 5I00A 1LLOA 2GWGA 3I7SA 3VIJA 2GUYA 4L9XA 5M2FX 4YYFA 1HFBA 1Q7QA 1OJXA 3GDKA 3QTGA 3CC1A 1TMHA 4GABA 4OTKA 2NWRA 5CQ1A 4H8UA 1M1BA 4QITA 2GUUA 4DJED 1UUMA 4UQBA 3ARRA 3M41A 4ENLA 3GHTA 4JTIA 3GTXA 4AZBA 4KGJA 3B8IA 3HQNA 1KQYA 2ATMA 5AC7A 4GWEA 4HSOA 4YXGA 1A5UA 3BDKA 1NDVA 2WSPA 3ARPA 4Q7IA 1BTMA 4RUBA 1O1HA 4NNBA 3LRLA 5IFPA 3VK5A 3WQ5A 5CBJA 1E9ZB 1L6YA 3RJYA 4GKTA 3GVVA 5D2VA 1W1ZA 4EAMA 5C7HA 1H2JA 3CS2A 1C93A 4ZA0A 3SURA 1V6YA 2J7GA 5HMDA 1UR0A 3HPSA 3S6DA 4WJEA 1XLFA 1XLHA 1ZCCA 4PEEA 1OYCA 4JD4A 1Q3NA 3UYCA 1ZAHA 2IPGA 3B04A 4O1FA 3ZMRA 4IP5A 3CH0A 4ILSA 3VVGA 2R9RA 4LNYA 4TVDA 2QULA 3OIHA 4GZEA 4LS2A 2P8CA 3HGOA 4MJ2A 3WL0A 4A21A 3E96A 2EO7A 1IV8A 4NJJA 1WCGA 4A8IA 3VMNA 3TN4A 3WEMA 3CWNA 3AZRA 3GSMA 2GVJA 1VP5A 1TRDA 3NNTA 3DI1A 3MZNA 5DMYA 4LU0A 5CSRA 3SRKA 3HG3A 2WSRA 8XIMA 4IGNA 1BRLB 5BU6A 1SJCA 4O1DA 3T2PA 1UMLA 2WNQA 3O9NA 8TIMA 3U48A 5TF0A 3WJXA 2HVMA 2YL8A 2WPBA 2YFNA 1PIIA 3UY7A 3P62A 4CCCA 5LNRA 1HN1A 3DBNA 1DJZA 4JTJA 3O7UA 4F2TA 4JTCA 4LF2A 4A2SA 1G1YA 1W56A 1V8EA 4RDZA 2BY3A 4KBXA 3GVWA 3W1PA 1WA3A 1AJZA 2DZPA 3SJNA 4IPIA 3DKLA 3QMTA 1BKHA 1XIEA 3HO8A 3HZ3A 1J2BA 2AMXA 1RA0A 1NM9A 2PP3A 5D32A 2JKEA 3NDOA 5T9BG 4NF7A 1TJPA 1BHGA 2VX4A 1XYAA 3LQLA 1K8ZA 4TTGA 2ZWYA 3WK2A 1FRBA 3T2OA 4L6DA 4GQBA 3CQHA 3WNPA 1AH3A 3B05A 4UMBA 3G1RA 3L5AA 4UOZA 3LV5A 2I1OA 5I77A 3AI0A 3WUEA 1LBMA 3TSBA 3G5EA 2J77A 1FWAC 4KQNA 1ZJHA 1ZBVA 3K1DA 4JN7A 4DI9A 1V3LA 4MB3A 4N02A 1T41A 1HL2A 1FFQA 4DWSB 3VIGA 2RHGA 3LOTA 2OU4A 3AICA 4H01A 2BFGA 4IISA 4K7VA 1B3XA 1OGGA 2VM8A 5FJPA 3PUEA 3E74A 1G7VA 3A13A 4UTMA 2P0IA 3CEPA 5ECUA 2WKLA 2DZBA 2I17A 2PS2A 3CMFA 3IJQA 4B91A 4DHGA 1AZ2A 2J7CA 3NPWA 4C7DA 2XHYA 3CUHA 4LTSA 1OEPA 5TIMA 1R6WA 4DPPA 1J93A 5CGTA 4JNMA 2RH9A 3HB9A 4DM1A 3VNLA 4GG9A 1R7AA 1M3UA 3W7MA 4HOXA 2INZA 3LI0A 2WZMA 3W6YA 3LUTA 5AZ1A 3COTA 4RKAA 3INPA 3MANA 4RDVA 1UD5A 4JS3A 3MUXA 2ZXAA 3WIJA 3SIMA 2VOTA 3ZLHA 3LPPA 5AN7A 3S8HA 4YHEA 1K8XA 2YYUA 1T5AA 1OBAA 2CXEA 4QRNA 3H26A 4IQLA 3TA9A 3VD9A 1GOQA 2O7QA 3ONBA 2QPSA 2YCLB 1F6YA 2YSWA 2QIIA 3CM4A 3EB4A 4H9XA 1GKPA 3FAXA 1FHUA 2XN2A 3PAJA 4RZBA 4DZ5A 5HR7A 1NFBA 4HMDA 1AMKA 4U3AA 4RXGA 4OJYA 4I6KA 3K4DA 3ABQA 3KWXA 1XYMA 4JZ5A 2WVVA 3EDJA 4PEKA 2CHRA 3W7NA 4JQ3A 1WE5A 1EOMA 1PZ0A 1VKFA 4NSBA 3IGUA 1ITUA 4JFWA 4KMQA 3CYVA 4DO6A 1IF2A 2BXYA 5K9DA 2X2GA 2DFAA 1DKWA 4JN8A 4JIRA 2Q3RA 3PJWA 4AHPA 5HOSA 1TVLA 5GQBA 5EMLA 3P82A 1H0IA 2E1WA 2JGQA 3PUOA 3BLLA 2A3HA 3V1PA 3W72A 7A3HA 3FJLA 4DAFA 4EPBC 4C6FA 1KKRA 1FHDA 2WW5A 4B5VA 1JD9A 3EA3A 2XH2A 5EU9A 3VPLA 2B4GA 2WLZA 3N34A 2WMKA 1PZ1A 1K9EA 1B1YA 3P7YA 7ENLA 1QRQA 1J01A 1OFQA 4GUHA 3E0WA 4ZE4A 5A6JA 3LB0A 4HNVA 1KXHA 2XVKA 3VKAA 4C1NB 1UWSA 2AKZA 3T6CA 1O94A 5C71A 2P76A 2FB2A 3RCNA 3RLGA 3QH2A 1KCKA 2UY5A 3DERA 5DN1A 4EVZA 3VOJA 1RBAA 3IRSA 3VDBA 2PRMA 3EWBX 1QI4A 2CPUA 2EPLX 3W1NA 3QQ1A 5HMSA 2TAAA 5A6BA 3GLCA 4GQRA 3SUSA 4B3KA 4TV5A 1HGYA 1BYBA 1TPC1 1U5JA 1TPUA 3NXLA 4DELA 2A3CA 3OU8A 1PVNA 4WEVX 2R1KA 3XIMA 3EYPA 4IOTA 5FJJA 1RAKA 3WELA 3DECA 2RAGA 1PIFA 4J1OA 4KWVA 4Y9MA 4UR9A 4WY0A 1SVDA 2O7SA 6A3HA 4BQ5A 3WNMA 4LWWA 3ITOA 2HBXA 1V6TA 5D2TA 4JL1A 1F6KA 4I90A 1W8SA 1QO5A 3W7HA 3DN5A 4ASTA 3GWQA 2XU2A 2V5JA 5LHFA 3SR7A 3ES8A 1LG2A 4PUDA 3T0DA 1R7OA 4ZQMA 2OZ0A 2XIIA 4Z2IA 2YIHA 4FOJA 3T42A 3MCOA 2PC4A 4LB4A 5LNVA 4H2HA 1YYAA 1VJZA 1Q6GA 3UETA 3ITLA 3WBAA 3LMZA 1J0JA 3OPSA 3M0KA 1WZKA 1AG1O 1ML1A 3IAQA 3BLOA 3TJ4A 4AYSA 3PBUA 2NVCA 1Q6FA 2C1IA 1Z7AA 3BG9A 5MF5A 1EDTA 4XZIA 3TR2A 1ME7A 1LDCA 1F8IA 4YPJA 5LGZA 3WEOA 2CFFA 2J66A 1QOPA 4Q4OA 2ZA2A 4QQUA 3D0CA 3W85A 1OF8A 1UD8A 3ZVHA 1CENA 2WHMA 3Q4DA 2Z1BA 3VM5A 2ODOA 3TJIA 2Z2UA 4LBUA 4Y2WA 3BXWA 2HCVA 5G1MA 4N7QA 4UR8A 2HVOA 5F2MA 5BCAA 4O54A 3S1UA 2R6OA 5I7GA 4IPLA 3EX6A 1ME8A 3GM8A 4JEQA 1QK2A 2Y6ZA 5LXXA 4GXPA 3TX9A 2RDTA 1BQGA 4XKMA 5JUVA 4PTVA 2WNNA 2E3ZA 1ICQA 2E6AA 1WDDA 3DU0A 4XAGA 1XYLA 4Z1YA 4H6QA 4GX9A 1B90A 3CWHA 3PR2A 1GZJA 1C9WA 1FFRA 3UZZA 3LCLA 3EB3A 1PX4A 1N55A 2WM0A 4LX4A 4J40A 4B5UA 4DUWA 2DPEA 1NIUA 1UJPA 3IUDA 2F6UA 3NQ7A 3M0XA 3WFAA 1EXPA 2QPUA 1JG9A 4PSRA 1MFVA 2BGQA 3QOMA 3SUVA 1JRBA 2PDPA 3G1XA 4EXBA 3BAWA 2X7WA 1NP0A 3N3TA 4H7VA 1EOKA 4PMVA 4OV9A 3KUMA 1EJ7L 1W9PA 3NEVA 3C86A 4HSNA 1FWTA 3WMCA 3NSXA 1ALDA 1B3WA 3STFA 4FR6A 4REQB 3FSTA 5REQA 2NQ9A 4H04A 5TAOA 3UXIA 1VEOA 1QI2A 2Y70A 4C90A 2XM2A 1KRCC 3Q58A 1ZJBA 2HXUA 4CNOA 3TYZA 3HMJG 2J8FA 1E4IA 4JTKA 3NR0A 2HISA 4FOUA 3L4WA 1GQLA 4UQCA 1D8WA 1WZAA 4E4UA 1IGWA 2VVNA 2ZC1A 4K68A 1ZHAA 3F2DA 4RW3A 4MY8A 1UC4A 2DV0A 2HSAA 5IXEA 1JFXA 4FAMA 2Z6IA 1Q8JA 3ARTA 3RR4A 1GQIA 4EKJA 1E4MM 1Q6OA 3GXFA 3G1DA 3H55A 3FNDA 3UA4A 2X7VA 2DH3A 9XIAA 2VD9A 2JF7A 4J3WA 5IDIA 4UCFA 3DX5A 3IWPA 4H3DA 3PULA 1YDNA 4MWAB 4C6DA 1EH9A 3VZYA 4DPQA 4GC4A 2WBKA 4F66A 1W3TA 4CU7A 5KTLA 2DZWA 1ZAIA 5CPTA 1BG4A 3QZAA 1LM1A 4FHAA 1I9CB 1TPEA 2HV5A 3F5LA 3HFTA 2X1UA 1OFEA 1FP9A 2QUUA 1OGSA 4BQ2A 5HAOA 2GSHA 5ABFA 3GHSA 1C92A 3HIJA 2V6AA 3TTYA 3WNNA 4EWND 3IVUA 4DY1A 4E5TA 2VQUA 3SSJA 4E2BA 1NWSA 4V27A 2WC4A 4LBSA 4Q8QA 2VYOA 1I6NA 3U57A 1AMYA 4L5ZA 3CV7A 3BCJA 4US6A 3T08A 3VU2A 2GJXA 4B2DA 3RU8X 5I3JA 3C0SA 4GC3A 3WD4A 4Z2HA 1UW9A 4XAYA 1T8QA 3SCTA 1GVOA 1GONA 5G5IA 1UG6A 4JTSA 1TPWA 4GYPC 1VRDA 1M7XA 3HA1A 5EFDA 3CQIA 3MO7A 1X8FA 1VZWA 2D24A 2RJHA 3RLUA 2PFHA 1V79A 4IXXA 1X6UA 5E0FA 1LL7A 2YW4A 3H2NA 1IR2A 3TR9A 4PTDA 1ZQ5A 3VIPA 2RKXA 3VNIA 3GR4A 4GH3A 1VFTA 4GZJA 2NUYA 5C2CA 5DANA 4ATLA 1FVPA 1WB0A 1FQ0A 2D2OA 2PDCA 5FEPA 5C9RA 1KFWA 4XD4A 1Z44A 1E0XA 1BG9A 4GGBA 1GOWA 3T55A 4CNUA 3IJIA 3SN0A 4S2CA 2Y7DA 5F1VA 5F1UA 3EPMA 1W91A 1WP6A 5E70A 3NL6A 3VINA 3A9IA 1ZZMA 4PCPA 1QNSA 1MUCA 4LS1A 1XDMA 2AKMA 3OEXA 1QMLA 1G01A 4JOMA 3SCQA 4AB4A 3TTEA 2UBPC 3W2KA 3FYYA 5D9NA 2ZUWA 5ECVA 2DDXA 4M24A 1L6FA 4AWTA 1SSDA 1RQBA 3C3UA 3WMBA 4ZB0A 2GQAA 2QCDA 1OVDA 1GYNA 1W3LA 3XISA 3BURA 3W1RA 1GQNA 3ZLFA 3N73A 1BSLA 1UD3A 1W37A 4MGGA 4PUNA 1MZRA 1HJXA 4ZFMA 2V3GA 1ONEA 3UR7A 3GHRA 5A6TC 1E0UA 1OK6A 4AZCA 3BW4A 3L4UA 3R4IA 1Q65A 4KEVA 2GVEA 5E1QA 3HG5A 3JS3A 4LVBA 4L7ZA 3SW6A 3P61A 3LI1A 3WLOA 4FA3A 5D09A 4UFLA 3ANUA 2G41A 4GIRA 4DJFA 3FA3A 1Q6CA 3ARSA 5D30A 4E3TA 1NH6A 4JIHA 1ZBCA 5EY5A 4HZ7A 4XTIA 3UWZA 1XYFA 3BOLA 3EWCA 3GC4A 1XIHA 2XIBA 4WZHA 2CU0A 5I23A 1OZQA 4AF0B 1S2AA 4GACA 3WLJA 4L9ZA 2C15A 4BWLC 4NRSA 5H91A 4ALDA 4DUVA 4WDTA 2E28A 1XLEA 4IWWA 1LWJA 4Y9AA 3VKKA 5C54A 3UVIA 5KINA 2YGYA 4P7RA 3CPRA 2ALDA 3VZZA 4C65A 2CWNA 2HE8A 4JTEA 5FEXA 2QV5A 1OGBA 4ROQA 3CV1A 5RUBA 2ZZ3A 4HU4A 4NX0A 1UOZA 5CJNA 4AWUA 5C2GA 2NW0A 3KAOA 5M03A 1ADOA 5BWFA 1JCMP 3WDQA 2X05A 4CN4A 2H9AB 1H1NA 3D46A 2A2IA 4HP5A 3BLKA 3PWGA 2EEXA 4EXQA 1EGMA 3P8JA 2GGHA 3CYJA 6REQA 3TV8A 4KH2A 3ORWA 3GKFA 1LL4A 4WD0A 1GVIA 3U2ZA 1P6WA 1P0NA 1P0KA 3QPZA 4FXRA 3VMOA 2VZUA 4A3HA 1KFCA 3S0CA 3WQEA 1HJWA 2PE4A 3K5XA 4X63A 2PDNA 2CZ5A 4CD8A 3LN3A 1JJKA 4JTGA 1TX2A 1M04A 4L6HA 4HNNA 2YL5A 4UFHA 3F7JA 1DWJM 3RCMA 2ISWA 5BRBA 1ZJIA 3W7RA 1L0PA 1KBLA 3FVDA 4WKAA 1SU5A 3VNZA 3L5LA 4N0RA 1EDQA 3QEZA 1ZSXA 4V33A 5DBTA 1LLZA 3I3DA 1CEOA 1E6SM 4M82A 4Z0JA 3QHNA 1PKYA 3PNZA 1TPDA 2QJIA 5G2WA 1A5LC 2YLLA 4HPJA 3CNYA 1B9ZA 3Q37A 2BZNA 4Q8OA 4OHQA 2BS9A 1EO7A 5AC5A 2QF8A 1A5BA 1P4CA 3A12A 3TMLA 3VA8A 4LVDA 3O0KA 1SSGA 1JNDA 4AXKA 5A6KA 2OO6A 1LRNA 2XIJA 1D7FA 3QGAC 2CYGA 1OZMA 1XI3A 4H6EA 2A5HA 4GIYA 3W26A 4IFRA 5DRIA 3BLDA 3KBNA 3CUXA 3OGRA 2QQ6A 2X16A 8A3HA 4S3FA 2XH4A 1F6PA 2VQTA 4QM1A 1K8CA 4NXSA 1TQJA 5E9AA 1KFEA 1JPDX 3RXZA 1XQKA 2Y4SA 4NNAA 4C7FA 4UCGA 3B9DA 3OBEA 4IGSA 1MW1A 4KRTA 3MMWA 5LA1A 2E77A 3QFEA 4XZNX 4B5XA 1VR6A 4CGTA 1ZLPA 1QR7A 1E72M 4I9JA 2GFTA 3UP8A 2GVGA 3Q2DA 3URBA 3TXVA 3A3HA 3UBPC 1T96A 3H2EA 1WQ5A 1K70A 1KM3A 3NPVA 1SFTA 3IJ9A 3AXKA 3C5QA 1Y0EA 4PR4A 4WY0B 4MYXA 2BHZA 4L4MA 4JTUA 4QX4A 1B30A 5F4XA 2C1GA 2QJMA 5F2IA 5A6BD 3S1WA 2GVYA 1Y5WA 3HF3A 3LMYA 3IIPA 1VFUA 4DI8A 5KZMA 4B4HA 3NWRA 5DCBA 1BWLA 3VIOA 4O52A 3UPBA 3CV2A 2AL1A 4PBEA 3M5XA 4MVAA 4YLWA 1SZFA 3VNMA 3AYVA 3CH9A 4WOQA 3KHDA 4M6PA 4F0KA 2VGIA 3UG5A 1CT5A 4UQAA 1DV7A 2XGIA 4OVXA 4GYPA 2VRKA 4IT1A 3B0UX 1UHVA 4M19A 2E25A 4U5IA 3FCPA 4IQDA 4W93A 4O1EA 5LKYA 3UYIA 3K8LA 1IEQA 5I3FA 4GINA 4CUCA 4CQ8A 4HIBA 4FNSA 1Z41A 3G0UA 3GXIA 3N6HA 2Z6JA 1LWIA 1WBJA 1BYAA 1XIGA 1T8XA 1EZWA 3FDKA 3ISIX 1PCKA 1PPIA 3G22A 4M6QA 5D2XA 2QVNA 4D6IA 3L0KA 4IL0A 4MNLA 1D3HA 2G3NA 3G24A 4I9MA 2OQLA 8XIAA 3SQLA 2F84A 4JR5A 3KTXA 3MW7A 3FV9A 4G6CA 5FEZA 2PPGA 2BWGA 3KL5A 2RJGA 4Q32A 3AWNA 3TYBA 1TSIA 7TIMA 1IWBA 2XN1A 3UJRA 2RGLA 1RPXA 4LPCA 4JTTA 1OINA 4MM1A 2QNEA 3EDEA 4AHOA 3WQCA 5AC4A 4TX6A 1WDPA 2C7FA 3KP1A 3UWYA 2J7BA 3R8HA 1FWBC 2VEIA 1TVNA 1EPXA 3W07A 3NQ6A 4JXCA 5KZDA 3B8UA 4MFDA 3H8AA 1E6ZA 3T0BA 1NELA 2X40A 3HTWA 1KWGA 4CU6A 3DDMA 1I75A 3OZMA 1JCJA 2BODX 4IGHA 3MV01 4M6UA 4KEUA 2YZ5A 2OKOA 4JICA 5G2IA 2WK2A 4FLSA 2ZXQA 1JUKA 1JXKA 2PURA 3IUIA 4LJ3A 1OC5A 3ZT6A 2YOCA 3KP0A 1P6BA 5FJRA 1IYXA 4BHYA 1IWPA 4R7OA 4X9YA 4S3CA 3QY8A 2XN0A 1V5XA 2CBJA 1A5CA 3I6TA 3GH4A 3DG7A 4C1NA 1V08A 3L9CA 1HJSA 4CNPA 1NP2A 1Q85A 5BOFA 3WLLA 1L8NA 1XIBA 1KXTA 1HJUA 2C19A 4WRHA 5EFFA 3S5YA 1HVQA 2VWSA 3BG3A 3ITGA 1GHRA 1QW8A 3CUIA 5CPOA 3DOPA 2NVAA 4AH7A 2O92A 2GQ8A 3NYDA 2OEJA 4H6RA 5HA7A 5HWMA 1ONXA 1EP2A 4H9TA 3GIQA 4JIPA 1TO3A 1FDJA 2OKTA 2Q71A 1TR1A 5XINA 4BI5A 4AAJA 4YWIA 2JIWA 1XLMA 4B5TA 4IMDA 2TRSA 4KPLA 3N15A 4JFTA 1OY0A 2I7GA 4J7RA 4PL2A 5CGQA 1W9BM 3N13A 4W8AA 2V5DA 4UIOA 5EMMA 3N2OA 2AAAA 1ENUA 2QMJA 3W7CA 4DUXA 1CNVA 3UNDA 3S4TA 2OG9A 3CZEA 2ZWZA 1V0LA 1LCOA 1XHGA 2QYGA 2VC6A 3E3HA 3LCHA 2DJXA 3B40A 5A2AA 1QAPA 1R3QA 3CZLA 1M41A 3B03A 2D73A 2CLIA 5DFAA 2Y0FA 3O06A 1O95A 3IGHX 3N2MA 3OO2A 3POCA 1Q45A 3FY1A 5JH1A 2EKGA 3DYMA 3HBLA 1L2UA 1XKJA 4Q33A 3VGDA 3WLNA 1XXXA 3SCNA 3TQ0A 2IPJA 5U7SA 1PSCA 4PRTA 5C55A 5M1TA 3WDJA 4LAUA 2ZCGA 5FSDC 4A4AA 4FOKA 4DX3A 1XLLA 4KIRA 4PCTA 3LHVA 4IPNB 4LC6A 4ATWA 4M29A 1SFSA 5FD0A 2V69A 1EC9A 5EB8A 3T78A 3SGZA 2HBVA 4E38A 2Y61A 2X0SA 4LEFA 2XJ7A 4MKSA 2WVVB 3IJ7A 4BKNA 1TELA 2G4JA 3WO8A 3NVDA 3UJEA 4ERAA 3G6LA 6ALDA 3GHUA 4HSHA 3GZ3A 4L80A 4FALA 2O56A 1KRMA 4PSPA 4Q3MA 1R3RA 3SO7A 2HRWA 5CSSA 4C6IA 3BSHA 3ZT7A 3SBFA 3GTHA 4X22A 1X1NA 1E4NA 3BLIA 2FDSA 1UWIA 5DY2A 1S2TA 3BAJA 4Q4RA 1V7AA 3ZYZA 1LUCA 5A6MA 3NGJA 2UV8G 1MXGA 3VIKA 2PF8A 3RM4A 5LSMA 2WYSA 2WCGA 2PTWA 1W1PA 3ABSA 5I3DA 4H9UA 1JF5A 4E0CA 4TMCA 4UC5A 1IZJA 1YNYA 1SFLA 2OPJA 1QJWA 1WXJA 4WSKA 4HPGA 2I9UA 4XZWA 1Q6RA 3C52A 2HK1A 4ONVA 3OODA 1VH7A 2DW7A 1E56A 3PFRA 4IIDA 2J4GA 3M0VA 2Y63A 2FZMA 5DMNA 1GVRA 2VELA 2Q8XA 1T0OA 3AIQA 3VOGA 5E6ZA 5IBXA 4JDYA 2ZBTA 3CAVA 5KZEA 3AIRA 3PC0A 2FJUB 3U5UA 1TJ0A 1IT8A 2REQA 3SUTA 3I4EA 1VBRA 3VGHA 1XBZA 5FOOA 1GQKA 3CHDA 3N9RA 5CC3A 1Q6EA 1VIWA 4R9OA 1VEMA 3AZTA 2YJQA 3CTLA 1R86A 3NO1A 4RPQA 1OD0A 4JCLA 3LYEA 1QNOA 5MHBA 1PTGA 1TMLA 3ZO9A 5LIWX 2ATSA 3GDLA 5HNNA 4BEQA 4QE5A 4GYFA 1XUZA 2OYLA 3SCPA 1BYDA 4AIEA 1PDYA 5CGMA 2Z1WA 4AF0A 1P1XA 3ATYA 3KOZA 4QDWA 1DJWA 4G9PA 1E51A 2VOMA 3UY8A 2QCHA 2YYTA 4S3BA 3LGDA 3N19B 4FR1A 2HVNA 3AMKA 2ZUSA 3T05A 1ESWA 1AL7A 4BWLA 2Z1VA 4GYKA 1GG0A 2R91A 3TW6A 1XLDA 3QBUA 3BLEA 4LV9A 4Y7EA 1RJRA 5BW6A 1A5MC 1ZU8A 3BE7A 2CBUA 2PEVA 4HNUA 1UH3A 1TZ9A 4HYWA 4UR7A 4RXFA 4DJEA 3LERA 2C0HA 2XFRA 4YNGA 3MSGA 1N8FA 1XLJA 5FACA 1JULA 4ERIA 1U1HA 3LD5A 3WD0A 3EAUA 1W2PA 2OFJA 4JX5A 1V3HA 3PBWA 1M7JA 3ZXWA 1IXOA 3LM3A 4XBJA 5F2LA 4Y8EA 1PDZA 3A4AA 1PX8A 2BB0A 3G8EA 2OQYA 3WH8A 4GMEA 5BMXA 4D6HA 3TTSA 4K1GA 2DJLA 3C2FA 4BQ3A 4ZSUA