1TVPA

Endoglucanase cel5g from pseudoalteromonas haloplanktis in complex with cellobiose
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
293
structure length
293
Chain Sequence
AVEKLTVSGNQILAGGENTSFAGPSLFWSNTGWGAEKFYTAETVAKAKTEFNATLIRAAIGHGTSTGGSLNFDWEGNMSRLDTVVNAAIAEDMYVIIDFHSHEAHTDQATAVRFFEDVATKYGQYDNVIYEIYNEPLQISWVNDIKPYAETVIDKIRAIDPDNLIVVGTPTWSQDVDVASQNPIDRANIAYTLHFYAGTHGQSYRNKAQTALDNGIALFATEWGTVNADGNGGVNINETDAWMAFFKTNNISHANWALNDKNEGASLFTPGGSWNSLTSSGSKVKEIIQGWGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords cellulase
publication title Structure of a Full Length Psychrophilic Cellulase from Pseudoalteromonas haloplanktis revealed by X-ray Diffraction and Small Angle X-ray Scattering
pubmed doi rcsb
source organism Pseudoalteromonas haloplanktis
total genus 119
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1tvpA00
1RPKA 1ZBVA 4KWUA 4QCFA 5CXPA 3MU7A 4PTVA 3WMSA 3KL5A 1UH3A 2CXGA 4TXEA 4YHEA 2Y24A 1KXQA 3AQUA 3SCSA 1CXFA 4ZENA 1KXHA 1E4LA 2CBJA 3BAYA 1KXTA 1E6XM 1UD6A 3RM9A 1B3ZA 1J0JA 3OGRA 4L4PA 2W63A 3UERA 1WCGA 3CHEA 1H49A 3W26A 4NZCA 1CEOA 4BQ3A 3RJYA 5ABFB 2VQTA 1ZJAA 2YDSA 3VDAA 2VNCA 1E5JA 2CBUA 2RGLA 3VD5A 1GQJA 3JUGA 1E1EA 3BMWA 2XSBA 1ZL1A 3SCNA 1DWFM 1B1YA 3NDYA 2VTFA 3PZNA 4QP0A 3WUGA 2X09A 5A6AA 3FHAA 1V0NA 1CTNA 4HA4A 2WMIA 2ZICA 2J25A 2VX7A 3MUZ1 2D2OA 1A3HA 3AYSA 2W62A 1HIZA 1QBAA 1CPUA 2ZOXA 3WY1A 2YA0A 3M7SA 4YHGA 3ECQA 1V3IA 2J8FA 2VCAA 2BY0A 5C8BB 2OLHA 2D23A 5D9NA 2WZIA 3WD1A 1UR4A 2CKSA 5BXPA 3WNMA 3VGHA 1EHNA 1HKKA 3PZIA 3GXFA 3ARQA 1K6AA 2ZX9A 5LA0A 4HTYA 4HOWA 5GNYA 1GHSA 3VU2A 1CZ1A 3SCWA 1BAGA 1M7XA 4XZBA 1M03A 1C90A 1J0KA 1KBKA 3WF4A 1AQ0A 5A6JA 1BYCA 3NJ3A 2ESCA 4PUDA 5EFDA 2XGBA 5HPOA 3ALFA 1E6RA 2VZOA 2FHFA 5F7UA 1HJWA 4DM2A 1ZU8A 5E09A 2WVTA 1XSJA 1B3VA 2BY2A 4UFHA 1HVXA 4CKQA 2XPKA 4S3JA 3GDBA 4J3UA 2WZHA 3I3DA 4MB3A 2IXVA 3RILA 1EDGA 4BA0A 2GFTA 2WVSA 1PJ9A 3F4VA 4W89A 3S6TA 4PUEA 3WQ4A 4UCFA 5E0FA 1JL8A 1W91A 3AIWA 1C7SA 4UFJA 1VF8A 5BYWA 5HXMA 2ZXBA 3DECA 5A69A 2BXYA 3AMDA 4ZXLA 4Z2GA 4EANA 4F8XA 4V27A 3WH8A 3FY1A 4PTXA 3WQ6A 5A8NA 1TFVA 4AYSA 1OWQA 4JHOA 3N11A 4CUCA 3VGDA 1ODUA 3AISA 4AD5A 2FGZA 3ARZA 3RM4A 5C70A 2G4FA 2ZUSA 3CZEA 3GBDA 3HMCA 4U2ZA 2EXOA 3K4DA 4UFMA 2UWFA 3W27A 5HDRA 4TX6A 1RH9A 3THCA 4AZ5A 2HVMA 2J7DA 1PX3A 3FW6A 3U57A 3GM8A 2V3FA 3AIBA 1EO7A 4JIEA 4MPKA 5D8ZA 3VD4A 1J0HA 5HOSA 3EMCA 2PWDA 2E3ZA 2JF7A 3CBWA 2PC8A 4ML4A 2PBGA 1KQYA 1WZAA 3ARPA 1UYQA 3AROA 3B8SA 4W5UA 4S3KA 2C0HA 2ZX6A 3BAKA 1G01A 3GH4A 4Z2LA 3PBGA 5A8QA 3B9DA 1XH0A 3WUEA 1X1NA 3QR3A 3RCNA 4CU8A 1DEDA 1WB0A 1QHZA 1QNOA 2XVGA 3F5KA 1DWJM 2D20A 5E70A 2VX6A 5CLWA 2E4TA 1HP4A 2D0GA 1HJUA 3AS0A 4KGLA 1V6YA 4CN1A 3VDCA 2WSKA 4JKMA 4GO9A 3AIVA 1MW1A 2E9MA 1V6UA 1F4AA 3ZMRA 4FLSA 4P8UA 3ZT7A 1BFNA 1UHVA 1PEZA 1KBBA 2EPKX 3ZJ7A 3BSHA 2GJPA 2EPNA 2JEPA 4W7WA 4GPNA 5FD0A 1DWAM 4E8CA 4X0VA 4UFLA 2CERA 2WXDM 1ZS2A 4GXPA 4UR9A 1UA3A 1VBRA 3DYMA 3AOFA 1EXPA 4DWSA 1VEOA 4D72A 2VR4A 3WNOA 1JAKA 4UFIA 5A2CA 3BAIA 4AD1A 4V28A 2YDQA 1VB9A 8A3HA 3ARXA 1TVPA 1V02E 1UWUA 3AMKA 4BZYA 2EBNA 1CWYA 2CCRA 4AEEA 2WKGA 1MW0A 1V02A 3TTSA 3T2QA 2E9BA 3NUKA 1OGGA 4TX8A 4JFUA 4JZ5A 5FL0A 4CD8A 3SUUA 3PZTA 2WWCA 4HOXA 5GQBA 3AHVA 1E6SM 4E8DA 4MNLA 1C93A 1MW3A 5I6SA 1B9ZA 1W1VA 3D3AA 1E72M 4HZ7A 4UQAA 5BROA 2OWCA 1BQCA 1UWTA 1R87A 2BV9A 4XZWA 3AMGA 1GVYA 3PZGA 2UY4A 2NT1A 2YL9A 4P7LA 2OSWA 4ATDA 3GTNA 2EQDA 4W84A 2OYMA 4U5KA 2DT3A 4KGJA 8CGTA 1JI2A 3CTTA 2FH8A 3RO8A 3CUHA 4GIAA 3BCDA 4W88A 1VJSA 3WNNA 3E1F1 4LYRA 2WZEA 1UD2A 1NWTA 1WZLA 1HVQA 2W91A 4Q22A 2DT1A 5IDIA 3W53A 4OKDA 1OD0A 1JZ3A 1FP8A 2VCBA 3CH9A 1ISYA 1JFXA 4M1RA 2E0PA 1UWQA 1NWUA 2WVVA 1EDQA 5ABGA 1A47A 1PZ3A 4ZEPA 3LPPA 2MANA 3OGVA 2VX5A 3OGSA 4QDMA 2A3AA 3SIMA 3T08A 4MDPA 4LGXA 2G41A 2G3MA 4A3YA 3RDKA 1QNQA 1V3MA 4HOZA 3U7BA 1K9EA 4TVDA 4R27A 1UR2A 4MNJA 1U2YA 4V2XA 1BSIA 2WMHA 3TTQA 1OCQA 1MQQA 3VKKA 1ECEA 1CGXA 1QHPA 1UD5A 3WD2A 3N04A 3AICA 1KR1A 1FFRA 1V3LA 2YL8A 3IJ8A 4CN4A 4J3XA 2WCGA 3AMCA 1KFWA 5A2AA 1G9HA 1HKJA 2VRJA 1UKOA 3RIKA 3J7HA 5CJ5A 5A6BD 1CLVA 1L0PA 3UR7A 3L4UA 1D3CA 1D7FA 2VUYA 2WHKA 2J7CA 4UOQA 1GW1A 2JALA 4AISA 1GCYA 3SCVA 2AAAA 3M07A 3A4XA 1TMQA 4LYQA 1DWHM 2DDXA 1UKQA 1KR0A 2GUYA 1B90A 1B2YA 1JIBA 2OYKA 3MANA 4AY1A 3CHFA 3ARVA 2D3NA 1PX8A 4DUVA 1SR0A 4W7UA 4LXFA 5A95A 2EO7A 3SCOA 3DYPA 2BY3A 1OGBA 4MB1A 3W37A 3G6LA 3RPMA 3W24A 2TAAA 2BNJA 2YLAA 1V3JA 1US3A 2CESA 1B0IA 1CGUA 1E15A 3MKKA 7TAAA 1LL7A 1X6LA 3AS1A 1M53A 4P7RA 2BY1A 4B3KA 1BVZA 3VNZA 2YBTA 2B31A 2PWHA 2YLLA 2G3NA 5KZ6A 1JZ7A 2O9TA 3L4YA 4UQDA 1UR9A 1VRXA 3PZ9A 4W93A 1UOKA 4PMYA 3ZQ9A 1E56A 1LF1A 2VC9A 3WEMA 3NSNA 1J9YA 3SUVA 1Q6GA 2GK1B 2X8RA 3PN8A 2OSXA 3K8LA 3GNRA 4EAMA 5D8WA 3SCPA 1VENA 2W66A 3L4VA 5D4YA 2X2YA 3FXYA 2CHNA 1W3JA 5DF0A 5DT7A 4BCEA 4B9ZA 3QOKA 4QLKA 1MFUA 2BHUA 4OOUA 3T0AA 1C8QA 1QI0A 3ARUA 5A6BA 5M5DA 2D0FA 4OIFA 1UUQA 3VDHA 2CKRA 1B3WA 3NSMA 4MNMA 3ZIZA 4D6IA 1E5NA 2FHBA 1EO5A 1ISZA 5CSYA 1UQZA 1GOWA 2F61A 2QV4A 4Y7EA 4QLLA 1H41A 2WK2A 1MXGA 3DHPA 4AZ6A 1E71M 2DIJA 2WLZA 1QI2A 1W3HA 4PMUA 5FKYA 1ITXA 4IISA 2XWDA 1NOWA 2UY2A 1E55A 3GH5A 1CXIA 1J0IA 4ATWA 4JFVA 4MB5A 3W28A 3WL1A 2EPOA 1CGVA 3IJ9A 3VIMA 4PMDA 3ZM8A 3VINA 1E3XA 3VIKA 1E1FA 3SURA 3WEOA 1HKIA 1JF5A 4D6DA 3BC9A 2CNCA 1DHKA 3F5JA 4P7NA 2X05A 3W6LA 1B30A 1SMAA 4UZUA 2DSKA 3WN6A 2VT0A 1E0VA 1UWIA 3LMYA 1FOBA 3WQ5A 3M46A 4D6EA 1JAEA 1NOUA 4CD7A 1JGIA 3N9KA 1GONA 2GDVA 2XGIA 3ARYA 4HA1A 1CYGA 1W32A 2XWEA 1QVBA 4W5ZA 4TTGA 4LPCA 2DEPA 1E40A 1CNVA 4JAWA 1FFQA 3TONA 1XH2A 1E4NA 3MSGA 3EDDA 3VNYA 4W8LA 1MWOA 3CZJA 2DSVA 3BMVA 4MJ2A 1UR0A 2VQUA 1VFUA 3WD0A 1GPFA 1XD0A 1EGZA 5D9PA 1I1XA 2E8YA 4HP5A 1V03A 3A3HA 2ZE0A 1YQ2A 3WFZA 1JYWA 1V6WA 2QMKA 3CMJA 2VZTA 4K68A 2BVDA 1S46A 2DPEA 3W25A 4WIWA 3OB8A 1C7TA 5DO8A 3UCQA 2Y8VA 4XUYA 1GHRA 2FDMA 1X6NA 1UD8A 1XYFA 2ZXQA 4MB4A 5I24A 4D6GA 1ODZA 2EPLX 1JYNA 4UQBA 3VD9A 4M8UA 1WKYA 4UQEA 2PF0A 4UOJA 5LA1A 3MSDA 1QI4A 2C8NA 2VR5A 3OZOA 3WQWA 4NF7A 5I23A 4GO8A 2ZUVA 3FNDA 4JCLA 3GNPA 1W2PA 4W87A 1J01A 4GQQA 4LYPA 3BAXA 3ZJKA 3A4AA 1WDSA 1JDCA 2O9PA 6TAAA 4UQ9A 3EMZA 2Y4SA 1MQPA 4PSRA 4OBSA 4AWEA 1G1YA 4CU6A 3SUTA 3ARRA 1GOQA 2XIBA 1UZ1A 3MMWA 1R8LA 1R86A 2Y2WA 2J7FA 1YHTA 5IFPA 4DWSD 1WZKA 4NRSA 1W2VA 2ZUNA 4AZCB 2XJ7A 3VIOA 2WB5A 2XM2A 1OIMA 2YDRA 1P6WA 2AMGA 1ISXA 4NRRA 2YBUA 3NYDA 3LPFA 1H1NA 5GNXA 3VD7A 4J28A 2CEQA 1OIFA 3OLDA 2WCSA 4WKHA 2XSAA 2ZX5A 4DWSC 2XHYA 4D6FA 1BPLB 1W3LA 1JYXA 4CU7A 3CO4A 1TG7A 2JEQA 3VOCA 3SCRA 3HN3A 3UR8A 4JHZA 2A3EA 1H4PA 4P8VA 2E8ZA 1UQYA 1R7OA 2VVSA 2DSWA 4QAWA 2W61A 2QLYA 3W4RA 4AIUA 5DMYA 5HPCA 1AQMA 1KGUA 1Q6EA 1CGWA 3QGVA 3WF0A 4M81A 1E6QM 3FAXA 1PIGA 2V3GA 2JFEX 4FLRA 4P8WA 5FIPA 1LLOA 1E6NA 3MV11 4CD4A 2FHCA 3UEQA 5JIPA 2J77A 4NI3A 5A8MA 1K9FA 3AHZA 2XUCA 1EHAA 3T09A 2WLYA 1J12A 4AXNA 1W9UA 1GQKA 4JCMA 1BG4A 3K4AA 3W81A 2IXUA 5BRQA 3AS3A 1E3ZA 3AZRA 1HL9A 4OUEA 4WSKA 2XFYA 3VIGA 2WANA 3U5UA 4QLJA 5KEZA 2F2HA 2G8ZA 3TTOA 1VFFA 2BVYA 3UG3A 3N17A 1K9TA 2GDUA 4B9YA 2CBIA 1VJZA 3WUFA 2DQXA 1H09A 1WPCA 3VVGA 1JI1A 2A3HA 1XHGA 2GJXA 4WSJA 1WDRA 3VDBA 4PEEA 2D1ZA 2Z1KA 4D1IA 3MUY1 3CZLA 1JDAA 2D0HA 2IUZA 4N42A 4ACYA 4AMCA 1JD7A 4C7FA 3VGEA 1ZBWA 1QNRA 1EOKA 2WW5A 2XVNA 2WMIB 4CD6A 1UR1A 4X0NA 3GXMA 1EQCA 2YL6A 3VM5A 2V3EA 1CGYA 1W9PA 4GI9A 1QBBA 3CUJA 4YPJA 2ZX7A 4W8AA 2VMFA 1TA3A 3CHCA 5IHSA 4UQCA 2VZUA 5EB8A 5D9OA 1QOXA 3IAQA 1UD3A 4W7VA 1ISVA 5AYIA 5IXEA 3WEZA 4LQ1A 4D1JA 4M80A 1XC6A 4RE3A 4XX6A 4JL1A 1KQZA 4GZIA 2GK1A 1HNYA 5JUVA 1LL6A 1CXLA 3AHXA 5E0CA 4AZBA 3BAJA 3EBVA 3ZT5A 1HJXA 2W67A 1NP2A 3QHOA 2GVYA 3N12A 4Z2IA 1HT6A 2Y8KA 2VI0A 1AMYA 5AC4A 5CZKA 2DIEA 5JBEA 5E6ZA 4Z2KA 3LPGA 5CGMA 1OM0A 5BXSA 2YOCA 1BHGA 4PBGA 3VD3A 1JF6A 5IFTA 3KWXA 2ZUMA 3BXWA 1H0IA 1M01A 3OIHA 1G0CA 4N0RA 2PWEA 5GPRA 4J7RA 3M6DA 3VM7A 1GORA 3CUFA 2VRKA 3IJ7A 4M56A 3L4WA 4GQRA 1TVNA 1SMDA 1XSIA 3QOMA 1MQRA 3T0BA 3WNLA 4RL3A 4AD3A 2XYLA 2JF6A 2W92A 4HA3A 3N13A 1WO2A 2EPMX 2J4GA 1BYDA 1CECA 3AHYA 5JBDA 2ZXAA 3VPLA 4URIA 4UNIA 4XB3A 3WF2A 4OJYA 2AOSA 1GJUA 4IM4A 4M24A 1OINA 1NWRA 1GJWA 5ABFA 3WQ8A 3ZR6A 3ZT6A 1XSKA 3WBAA 3K8KA 1NM9A 1KGXA 4X9YA 2YIHA 2WMKA 1V6XA 4ATLA 3GBEA 1PBGA 2J8GA 3BGAA 3PZOA 1WZMA 1UA7A 2JE8A 1GOIA 1LWJA 3II1A 3BLPX 4KH2A 1ZBKA 3FAWA 3HU7A 3CMGA 3ZOAA 4E4PA 5BCAA 1E6ZA 2XFFA 1OBAA 4JFWA 4MDOA 4TVUA 4HZ8A 2QF8A 9CGTA 1ISWA 5JBFA 4UFKA 3K8MA 4MTVA 2V38A 3AMLA 3QHMA 1CXHA 4AW7A 1WDPA 3WQVA 2OSYA 3N18A 2VJXA 1C3FA 3WH6A 4B15A 2OYLA 5FCZA 4W8BA 1EDTA 2ZWZA 4CD5A 3SCQA 3ARTA 3AXXA 3PZUA 1TE1A 4KRUA 3BH4A 3NCOA 4PCSA 3BSGA 1MW2A 3A4WA 4Z2HA 2BHZA 3L4ZA 4W86A 3CZ8A 1CLXA 2DT0A 1I1WA 1E9LA 2JIEA 1SYTA 3CLWA 4R5EA 3MO4A 1RP9A 1D2KA 1TUXA 1IZKA 2WHJA 4UZSA 3EDFA 4FF5A 3CZKA 5E9AA 2BFGA 5M3WA 1AVAA 1E4MM 3POHA 1TZ7A 5ECUA 2EEXA 5CQ1A 4PMNA 4HMDA 4BQ2A 5A6KA 3AIQA 1JXKA 5CSUA 2GSJA 2WKLA 3K1DA 4GI8A 2VX4A 1NP0A 1I75A 4F9JA 3GZAA 3VIHA 1OSEA 4U2YA 2ZIDA 1VBUA 2WHLA 2J7HA 5AC5A 2CPUA 5DFAA 1GQIA 4GI6A 2OWXA 3WD4A 1MFVA 1MYRA 2BVTA 3MMUA 2DT2A 3G6MA 3WKZA 4MADA 3ZJ6A 1JZ6A 1QW8A 3B9EA 3AYRA 3PTKA 4BF7A 1NH6A 4Q7NA 1W1TA 1GZJA 3RJXA 4AD2A 1UZ4A 4AIOA 5I3DA 2DH3A 4HPGA 4CVUA 1W9BM 1G5AA 2X0HA 1L8NA 5BXRA 2W5FA 1HX0A 4U5IA 3NIYA 1UKPA 2XIIA 1JZ2A 1NWSA 1JNEA 2V5CA 4A3HA 2J79A 2Y5EA 4L4OA 2VO5A 1CDGA 4TOQA 1CXEA 3VMPA 4PRWA 2QHAA 3GXDA 1BYBA 4ACZB 5A6LA 3WH9A 2OWWA 1FHDA 1Q6CA 3WH7A 3VMOA 1DTUA 3WL0A 2A3CA 1OGSA 3AIRA 1M04A 4GZJA 1PPIA 4ZXOA 3WSUA 2WNWA 2XVLA 1RD6A 3VIPA 5ABEA 1U30A 2RGMA 4PSPA 4P7OA 5CG0A 5CPQA 5LA2A 1DWIM 1ESWA 4HPHA 4WF7A 3T0DA 4FLOA 3RM8A 3UETA 1Y7VA 2WVVB 1V08A 5A1AA 1WAWA 4AC1X 3DHUA 1W9VA 4PMQA 3PHAA 3SCTA 1HL8A 3AHTA 4WK9A 3W29A 3ZSTA 3WENA 4J3SA 4F79A 2J47A 3EDEA 1HJVA 4H04A 3W6MA 4F9DA 3AFBA 1CBGA 4LX4A 3UG5A 1KCKA 1BGGA 1ZJBA 1UH2A 3PZVA 1XRVA 4Z2JA 1VFOA 3DC0A 3VIIA 3WF3A 3U7VA 5IHRA 3ZR5A 2WSPA 4CN6A 2NSXA 3VIJA 2WC7A 2JIWA 3GNOA 4JFTA 4IUGA 4PTMA 4MAZA 4UOZA 3MMDA 4IPNB 2WMGA 3VGFA 3CGTA 2WHMA 2Q8XA 7CGTA 1CENA 1QNPA 1HXJA 2NW0A 1XH1A 1UKTA 1MVYA 2QPUA 1G94A 4WKAA 1UKSA 4PMVA 3AZSA 2VOTA 1IT0A 4YN5A 1GOKA 4P7QA 2J62A 2DH2A 4IPLA 4FK9A 1HP5A 4H41A 1JZ8A 3W0KA 4ZE4A 2YJQA 1W9XA 1U33A 1GQLA 1LG1A 2DSZA 2GJRA 2O92A 3BLKA 4U3AA 3U5YA 3WD3A 1BG9A 1MXDA 1XCXA 1PZ2A 1EH9A 2VZVA 1NOFA 3WDHA 4BQ4A 3TA9A 1H0GA 5I0DA 3BCFA 1WNOA 2WC4A 2DSUA 3SUSA 1V3HA 4BQ5A 1ZBCA 1J10A 1OD8A 1EIBA 3WUBA 1LQ0A 1XD1A 1C91A 3D5HA 3VILA 2C7FA 1QW9A 3NDZA 1O6IA 4U33A 1FH9A 1FP9A 4JKLA 3OBAA 1HN1A 3VGBA 2XG9A 2XVKA 3ZJ8A 1SFSA 5EFFA 3VX0A 4M29A 1NARA 3WMBA 1ZB5A 2FGLA 2CYGA 3DYOA 1ITCA 4WLCA 4JFSA 2VZSA 4ZE5A 3AS2A 3OG2A 1WE5A 1EA9C 2ZUTA 4CGTA 3EDJA 3CHDA 5M03A 1UWSA 3TTYA 1LG2A 3WELA 2D22A 1BTCA 1DWGM 3ZSSA 4HU8A 4FLQA 3MV01 1WDQA 3NSXA 3L2LA 4RE2A 4BS0A 4AZ7A 4EK7A 4D71A 4PN2A 2J78A 3MUIA 2YA1A 3CPUA 5GNZA 5FL1A 1QI5A 2PWFA 2VCCA 1J0ZA 1JZ5A 2W4XA 4H8HA 4J3VA 4MJ4A 4EE9A 3WDRA 4U31A 6A3HA 5HNNA 3ALGA 3LPOA 5A6MA 2WMFA 1XV8A 2J75A 2E40A 2BS9A 2O9RA 4TTUA 4EKJA 2WVUA 5HBFA 1JG9A 1HKMA 1R85A 3I3EA 4B16A 2WWDA 1KB3A 2VURA 4OBRA 3IANA 4UTFA 4J3WA 2YA2A 5I77A 3SUWA 3VGGA 3W38A 5D9MA 1LJYA 3AIEA 3EYPA 1HJQA 2WMJA 1TCMA 5A6SA 1WP6A 2A3BA 1W1YA 4H8VA 4DM1A 1O7AA 4NSBA 3FHQA 3APGA 3WH5A 4U3CA 1LWHA 3L4XA 1VFMA 4CCCA 1JDDA 2J7GA 3KZSA 4CCEA 2WAGA 2ZXDA 5A3HA 3OLIA 3QHNA 1JYVA 3POCA 1H11A 1UG6A 3VIFA 5A94A 1GUVA 2ZUUA 2Z1SA 2VL4A 2ZUWA 5TD4A 1E73M 1FA2A 5M17A 2J74A 3MUAA 1E0WA 1HF6A 1RP8A 3A6OA 1EOMA 4AZIA 1J11A 1PIFA 4KMQA 1JFHA 4DUWA 4ZFMA 4PTWA 2F8QA 1J0YA 3WF1A 3B9AA 5ABHA 1KWKA 4HMCA 1JZ4A 4WKFA 2O9OA 1KCLA 1EQPA 3VO0A 1JNDA 3KE0A 3KL3A 1E0XA 4GKLA 3O6AA 1OT1A 5EBAA 2CIPA 4PCTA 3CZGA 1OT2A 4D6HA 2V3DA 2X1IA 4JL2A 4QCEA 3FN9A 2QMJA 1H5VA 1JD9A 5BWFA 1US2A 3VX1A 4RE4A 4F66A 5JIWA 1KXVA 1LL4A 2X0YA 2ZX8A 3PTQA 1B3XA 7A3HA 3SCUA 1GOMA 3CUGA 3MS8A 3PZMA 3CIVA 1B31A 1XCWA 2YL5A 5DEZA 4ACZA 1V0KA 1UD4A 4PMZA 3W82A 1J18A 3AXIA 1KGWA 1CXKA 3BAWA 3N1AA 1IZJA 4AD0A 1W3KA 3WIJA 4C7GA 3KL0A 5FOOA 5BRPA 2G3JA 3WDJA 3WDIA 4H2CA 1V0LA 4HZ6A 3VTRA 5I5RA 6CGTA 3AJ7A 4AZHA 2D3LA 2QPSA 1QPKA 4D6CA 1H3GA 4CVWA 3O9NA 1VIWA 4FMVA 5I79A 1TR1A 3AZTA 2XTKA 2CHOA 3UG4A 4GINA 5E6YA 2WBKA 2WC3A 5CGTA 3GXIA 1Z32X 1W9DM 2PBOA 1H2JA 3RMEA 3WFLA 2WYSA 1V0MA 2DGAA 2NT0A 3WNPA 1AQHA 5CPSA 1KWGA 2YKKA 4AEFA 1UH4A 2J7BA 3GH7A 3OLGA 2PWGA 1UR8A 1XGZA 1C92A 5BXTA 3EDKA 1GNXA 1CGTA 4XV0A 3CUIA 1FH8A 1QHOA 2ZWYA 5C71A 1BYAA 1GOOA 2XFRA 3AI0A 4PMXA 2G3IA 3ZO9A 3AIUA 3PZQA 5I78A 5DT5A 1Q6FA 3T2PA 3OLEA 5CPTA 1DP0A 5A2BA 1N82A 1C8YA 4A4AA 1PX4A 3A47A 3GYCA 1Q4NX 3K46A 3THDA 4CCDA 1VEPA 5AY7A 2VVNA 3TOPA 1E6PA 4M82A 1E70M 4AZGA 4J3TA 4W85A 1VAHA 1C8XA 2D24A 2PI6A 2WCAA 2WM0A 3I3BA 4E2OA 2J7EA 3KEHA 2GJXB 1Q6DA 3OA5A 1FHLA 1F4HA 1IV8A 4MNKA 5AYBA 4DWSB 4H7VA 1V3KA 2CETA 2PB1A 4OZOA 4B3LA 3ARWA 2WBGA 4OOZA 1B3YA 2UY5A 5LYRA 3WNKA 4HU0A 1VEMA 3L4TA 1PAMA 4TUFA 3WDPP 3IK2A 2CBVA 1BF2A 1JXJA 3S2CA 1W1PA 4TVCA 4AIEA 1QI3A 1QNSA 4D6JA 4J27A 1E4IA 4AZCA 1FH7A 1TA3B 5EMYA 1BVNP 1R7AA 3PTMA 2XVPA 1GVIA 2CITA 4HMEA 5CLTA 3VMNA 3SEPA 4P8XA 1OB0A 4PMRA 4AD4A 2UY3A 3L2MA 4DUXA 3OZPA 1HJSA 3WBEA 5A8PA 3N15A 2V5DA 3EMQA 3O2LA 4WJXA 1CIUA 3WMCA 3VUPA 1UWRA 4MAVA 3HJEA 2HISA 2BHYA 1E43A 2EJ1A 3WDQA 2VRQA 4C7DA 1K9DA 3T2OA 4PYSA 1BLIA 3F5LA 5I2UA 2FH6A 1BGAA 3TP4A 1V6VA 3UESA 4GZEA 2BXZA 2XM1A 4KRTA 4H8UA 3ARSA 1NQ6A 4QFUA 5A8OA 2E9LA 2WPGA 3AXHA 4PMOA 4JKKA 1XYZA 3IAPA
chains in the Genus database with same CATH superfamily
4YXGA 1ZBVA 5CXPA 3MU7A 1TJPA 1RD5A 2ZDSA 3WMSA 1UH3A 2CXGA 3VK5A 3WLLA 2D2GA 3EA3A 7XIMA 2B4GA 3SJ3A 4JY9A 2QUTA 3OG3A 1XI3A 4B5SA 4LUSA 5LKYA 1B3ZA 4XSMA 1J0JA 4NNAA 2W63A 4D2JA 3HPXA 4JY8A 2YX0A 3STCA 2Y7FA 1ZJAA 4HPNA 1A5KC 2OCZA 3KUMA 3KVJA 1UUMA 4E2BA 4WX2A 4G9PA 4LCRA 1XLFA 3LNPA 3WUGA 2X09A 2CZDA 1I2OA 3TUUA 1OY0A 3SZ8A 2ALRA 2J25A 2D2OA 3G1SA 3P0WA 3TXZA 2I5QA 2QAFA 4YHGA 3ECQA 1V3IA 2J8FA 2OLHA 1YNYA 3SB0A 1JCLA 4H6EA 3G3DA 2ZVRA 3N2TA 4ZZ9A 4LW7A 2IPWA 2R94A 4DVOA 3UXAA 3CQJA 3M0VA 1HO4A 4IFRA 2EG7A 3KOFA 5LSMA 1K6AA 1XGDA 3W2KA 4HTYA 1GHSA 1TTQA 1BAGA 2W6RA 4RKAA 1PDYA 2VDHA 4XZBA 1J0KA 1KBKA 2YXOA 3EA1A 1AQ0A 4NZ4A 5D2XA 2XGBA 4H2HA 3GR7A 4YTRA 3ALFA 1FWGC 4XD4A 3FGCA 1RQEA 4HPXA 5E09A 2R1NA 3UCDA 2WVTA 2Z27A 3P14A 3O0FA 5G5IA 4S3JA 3GDBA 1GGOA 3I3DA 5LGZA 4WDXA 3QY8A 2HBXA 2I56A 1T8XA 2W0UA 4TR9A 3QH2A 1VFTA 3DFSA 4W89A 4ROQA 4UCFA 4GBDA 1BRLB 1HKWA 1J96A 5E0FA 4RE0A 3R94A 3AIWA 5HXMA 5CBBA 3DECA 3HQ1A 4ZXLA 4EANA 2FQIA 4V27A 3WH8A 3WQ6A 5A8NA 1KFCA 1PXGA 4ERGA 1OWQA 4C6JA 3W1RA 2OZ3A 3VKBA 3GUGA 3HTWA 1QUMA 3WG6A 3EWDA 3RM4A 3NPXA 4DJED 5C70A 2ZTJA 3K4DA 3VNDA 2XN0A 3ZS4A 4TX6A 1YMYA 3AWOA 4BEUA 2HVMA 4QE5A 1LOSA 3GM8A 5KZDA 5G2IA 1SJAA 1EEPA 3LEPA 4IL2A 2XU2A 5HOSA 3CBWA 3JR2A 4UMAA 2PC8A 5C9ZA 1WZAA 1BWVA 1Z69A 2H6RA 3AROA 3VNIA 2QJIA 4S3KA 3GH4A 3PBGA 3WUEA 3AYVA 4PRTA 2HE8A 4FX8A 3LU2A 1ZSXA 3QR3A 1YEYA 1S2UA 4MM1A 2PF8A 2REQB 1DWJM 3W7QA 5CLWA 2E4TA 1P48A 1YPFA 3QPZA 3BZGA 3A64A 5G2HA 3W85A 1O5QA 1MZRA 1BFNA 1UHVA 4JTUA 3KM8A 3ZJ7A 3U2EA 4LAUA 4FO4A 5FD0A 3OPSA 2VEPA 5C2CA 3YPIA 3S1VA 4ZMGA 6XIMA 4NUWA 3BUVA 4LT9A 4R3UA 2HZGA 4M3PA 4MYXA 2GL5A 4KEVA 3LMZA 4JTKA 1VYRA 1IZCA 1TPWA 3LTSA 3GVWA 4IXXA 3N6JA 2YDQA 2FZBA 3NQ6A 1NJJA 3GO2A 2ADAA 4IMDA 1VGAA 2CCRA 4AEEA 5BOFA 1MW0A 4GNJA 1M41A 3T2QA 1VCVA 4PTDA 3DG6A 4RXFA 3PR2A 3UW6A 2YW4A 2O56A 2PD9A 4JZ5A 5FL0A 1UZDA 5DBTA 3TW6A 2WJFA 5GQBA 3AHVA 1E6SM 4E8DA 3BPWA 1C93A 4YTUA 5I6SA 1W1VA 3GAKA 5D33A 3GK0A 4LH8A 1OFPA 1UWTA 2Q01A 3AMGA 3MP3A 4QBXA 1FHVA 2NT1A 3KTCA 3P84A 2OSWA 2XIJA 2ZRUA 4LEFA 4W84A 3S1WA 2TYSA 4U5KA 1QO5A 2DT3A 2YCJA 4EPKA 1JI2A 4IUOA 1VJSA 3NXLA 3QV9A 1UD2A 3EOLA 1WZLA 3TX9A 4NNBA 1U22A 4K1WA 1JZ3A 3N2XA 1ISYA 1M68A 1T99A 2DZVA 1W8GA 2P76A 4UXDA 3FSUA 4M1RA 1DXEA 1XLBA 2A7PA 4LUIA 1EDQA 1LM1A 1PZ3A 4ZEPA 3DOPA 2HNHA 3LPPA 2MANA 4NZ1A 2VP8A 2Z0IA 4Q6XA 4M5PA 2VX5A 3FXGA 1KFLA 1TMHA 2OX1A 1VS1A 3NQ7A 3V75A 3GVVA 2JGYA 4LGXA 2G41A 3I6TA 3WLHA 4R85A 1Z44A 1OZMA 1VH7A 1V3MA 1ZALA 1K9EA 4FOUA 3LHYA 4IJRA 2PDXA 3V7PA 2RJGA 1T6MA 3D46A 2CW6A 3F03K 4NZFA 3JZUA 1FWWA 2BP1A 3HM7A 2RHGA 4CN4A 2FZMA 1PS9A 3L0GA 5E1QA 3KRZA 4N02A 5AC6A 5MKGA 2QCNA 1HKJA 3IIVA 1EJ7L 1GVFA 4RDYA 3RIKA 1VR6A 3J7HA 4BI7A 4ZVJA 4LAMA 3UR7A 3OP2A 1RZMA 1KKRA 2VUYA 4JNZA 2GOKA 1R46A 3KS6A 1R47A 2PSNA 2XIQA 4N4QA 1V79A 5H1WA 1UKQA 1FCVA 1KR0A 5FSDC 3MANA 4HU3A 3W1TA 1TVLA 3UBPC 3V5CA 4LXFA 3SCOA 1LUCB 4DB7A 4J1OA 3M0XA 1OGBA 3QW4B 3W24A 2CESA 4RV3A 3MKKA 2H3DA 2ISWA 3AS1A 3RX3A 4IMEA 4NJGA 1W54A 4ILSA 3S3GA 5DCEA 3VNZA 3U9IA 2B31A 3VOJA 3STGA 2YLLA 2G3NA 1JZ7A 2O9TA 4YTSA 3FX4A 4UQDA 4EWJA 3PZ9A 3FA4A 4PMYA 5FEXA 3ZQ9A 1N7KA 3AYTA 1KBJA 2JBMA 3WEMA 4N4PA 3SUVA 1Q6GA 3UZZA 5C2XA 2X8RA 1RQHA 2PDHA 5GVJA 3T9PA 5EYWA 1W3JA 2Z29A 5DT7A 4HGXA 4Y9NA 4C6MA 1Q63A 3VOFA 4QRNA 4O54A 1WYIA 4OOUA 2BASA 1QI0A 5K4XA 3R6IA 5M5DA 2PGFA 3GTXA 2CKRA 3MSRA 2O4QA 4MNMA 3M5XA 3O0KA 3FEQA 3VZXA 5CSYA 2F61A 2NVCA 1I2NA 3BG9A 2WLZA 1PDZA 1TPUA 1E55A 3U0HA 1CXIA 1J4EA 4JFVA 3CC1A 2I14A 1XIJA 3IJ9A 1V5XA 1W5NA 3QQWA 4PMDA 2DZWA 3ZM8A 3VINA 1HKIA 1K1DA 4FP1A 3BC9A 1DHKA 2X05A 1B30A 1TPFA 3JZEA 1XUZA 1UWIA 3VC5A 1XFCA 2YZ5A 4D6EA 1NOUA 4Q32A 1ICSA 4QX4A 3G3MA 3ARYA 1NU5A 2XGIA 1RHCA 1W32A 4HHHA 2XWEA 4W5ZA 3TZFA 2DEPA 1E40A 1H51A 1MEWA 1FFQA 2V5BA 5H8UA 3RG6A 3EDDA 1WOBA 3W71A 2DSVA 3BMVA 5FF7A 1A5SA 1UR0A 2VQUA 1KKOA 2A7RA 3WD0A 1PKNA 4M0XA 1I1XA 1VPQA 4HP5A 4C91A 1YQ2A 3G1XA 3M0KA 5HWMA 2ZRZA 2VZTA 1S46A 2DPEA 1GK8A 3W25A 2DZBA 3GE7A 4WIWA 4NP7A 2HXTA 1GHRA 3RR4A 1X6NA 4I7UA 3LTYA 4JTCA 3VD9A 4M8UA 1WKYA 1JDFA 4AF0B 4UOJA 2HV5A 3RU6A 1E0UA 2DIKA 3OZOA 4AXKA 3N3MA 2ACUA 3WLPA 3UXKA 5G1TA 4E0CA 2PE4A 4J2MA 3RLVA 1H5YA 2Y63A 4IP7A 3GNPA 1TIWA 5I3JA 2QUUA 2Z7KA 1JDCA 4DYKA 1B4EA 2O9PA 1LORA 1YPIA 1QCWA 4UQ9A 5G2WA 1SFLA 1SZFA 1AW2A 3LGDA 4M6PA 3PJUA 4CU6A 1LQ2A 3G0UA 3ARRA 1GOQA 1UZ1A 1GYMA 1YHTA 4HD5A 5IFPA 1EC9A 2VC6A 3GG1A 1W2VA 2ZUNA 2YDRA 1P6WA 1ISXA 3PB2A 4NRRA 4JTGA 1Q2SA 1P0NA 3V0TA 1OIFA 3PBWA 2PP3A 1RVGA 1ME9A 4ZSUA 1XDJA 2BLEA 5TQLA 3MYPA 1TG7A 3S5NA 2QV5A 3UJFA 2BX7A 4JTDA 4F0RA 1GVRA 2BODX 1UQYA 2VGGA 4QAWA 3W7IA 4DJFA 3TSBA 1Q6EA 5K4ZA 3KCLA 3IJIA 3QGVA 4FLRA 3RUBL 3THAA 4P8WA 4GIEA 1YDVA 1F9CA 3UZXA 2NUWA 2E1WA 1ZCCA 5A8MA 1SO4A 1K9FA 4DBSA 3AHZA 3T09A 1J12A 4AXNA 3BW2A 1GQKA 4JCMA 1KM0A 2IXUA 2XINA 2V2CA 2HS8A 1E3ZA 1OF8A 4HNTA 2XFYA 4QS6A 3U5UA 3UZ5A 5KEZA 1ZJIA 2BGSA 1AH0A 4I5XA 2GDUA 4HNVA 5HJLA 3GC4A 1XHGA 2GJXA 5LNSA 4QM1A 1JDAA 2D0HA 2F7FA 2IUZA 2EF9A 5K7JA 3TA6A 3VGEA 1FWFC 3N25A 4AX7A 1LTDA 2BGNE 4GK8A 2WW5A 3GXMA 2YL6A 2V3EA 1CGYA 1TIMA 1W9PA 3BICA 4ZTXA 1LT7A 1XG3A 4YPJA 2VEGA 3MUXA 4W8AA 5AHEA 2VMFA 2YXGA 4GJ1A 3I6EA 2Y85A 4LQ1A 4D1JA 4M80A 4RE3A 2FZDA 1TUFA 3OU8A 4GZIA 2GK1A 3QPEA 1HNYA 3THUA 4LVDA 1CXLA 2HTMA 3UYIA 2EJAA 3GY1A 1FDJA 3UPWA 4DPPA 1ADOA 2W67A 3W83A 1YYAA 3M0ZA 2Y8KA 1UBPC 4ECLA 2OODA 5AC4A 3HQNA 5T9CE 1U1UA 3PS7A 4Z2KA 3LGEA 1DJQA 4QQUA 3QMSA 1OM0A 4PCPA 3VD3A 4TV6A 3TJXA 4LBUA 1H0IA 3E3HA 1XIBA 3OIHA 1VYPX 4N0RA 4S3AA 2VOMA 1GORA 3VM7A 3CUFA 3L4WA 4L7ZA 2GGIA 1SMDA 3COTA 1LLZA 4NYYA 2B81A 2FPVA 3N9RA 3GFXA 2G5WA 4HA3A 3N13A 2EPMX 3VE9A 1BYDA 1CECA 3AHYA 2QCEA 5JBDA 3VPLA 3F4WA 5FEPA 4C6LA 4AVOA 1FCQA 1GJUA 4IM4A 1RBOB 1TJ1A 1XPYA 1OINA 1NWRA 2GUUA 1PTAA 1GJWA 3VZYA 4DZ5A 4G5DA 2IKJA 4LAKA 1Z3NA 3M4HA 5J04A 2PU1A 4MGGA 2NWRA 5HA7A 2YIHA 4J4KA 2WMKA 3HJZA 3NDOA 3GRIA 3IGXA 2HQAA 4ROPA 3TROA 3II1A 3WQEA 3KDOA 5F2GA 4L80A 3OEXA 3PWAA 1E6ZA 5EBUA 3IUDA 1ISWA 3K8MA 1EBHA 4AMAA 1WA3A 2V38A 1Z89A 3AMLA 3LCWA 4O8RA 1X97A 3WQVA 4DAIA 3MO7A 3PJWA 2PFHA 2OYLA 2GSHA 2OT0A 3RX4A 5FCZA 3LCIA 4NJKA 3ARTA 4HHMA 4YYFA 2ZRVA 4S39A 1MW2A 1TQXA 3CZ8A 2DT0A 3HA1A 4QNWA 2YZRA 1FDYA 1D2KA 3EDFA 4FF5A 2BFGA 3CQHA 2C1GA 1TZ7A 3CB3A 2EEXA 5CQ1A 4PMNA 3AC0A 5K3VA 3LZ3A 5HJXA 1JXKA 2GSJA 3TCEA 1DTNA 1OFQA 3GZAA 3L0KA 1NQKA 4JTEA 4QEEA 1EPXA 2J7HA 4GX8A 3VOHA 3HPZA 1MFVA 3SRFA 2HVOA 3MMUA 2DT2A 3WKZA 2Z00A 4QAIA 2Y70A 1KCXA 1JZ6A 1QW8A 2P8BA 3B9EA 3SRDA 5IBXC 5KZEA 2ZC1A 4PUMA 4YVXA 4HA0A 5JU6A 4YYCA 6XIAA 4F2TA 3W7RA 1KBIA 5XIAA 3S6OA 4NAFB 3VCNA 3DKLA 2DH3A 3SBFA 4CVUA 1XIDA 3L67A 2W5FA 4A29A 1UKPA 1JZ2A 2Y5EA 2Y62A 3GXDA 6REQB 3STFA 3WH9A 3WX7A 3E02A 1FHDA 3D47A 2A2IA 3WFAA 3ITYA 1S5WA 2A3CA 1OGSA 2IPGA 1IIHA 4GZJA 4MYAA 2P8CA 4WOZA 4ZXOA 5AOUA 3R2GA 3O16A 1YTDA 3EX3A 4KWSA 5CPQA 2J6VA 3H7UA 3PC0A 4WF7A 3T0DA 4MUPA 3UETA 2WVVB 1V08A 5A1AA 4JIRA 3TAKA 5J5DA 3LUTA 2JKAA 3R0DA 2J47A 3W6MA 5LNVA 1GVEA 1KCKA 1XIEA 1GG0A 5IBXA 3PZVA 4Z2JA 2ZKMX 3WQGA 1JUEA 4DBEA 4ZB5A 1FTXA 4CN6A 3DFNA 3MHGA 2NSXA 3GNOA 4JFTA 2X1RA 1J2WA 4PTMA 3LYEA 1XISA 4Q8MA 3AUJA 2X30A 4QNEA 4MAZA 4UOZA 3SFWA 3RLHA 2BDQA 3MMDA 1CENA 4C6FA 3REQB 1QNPA 3TN3A 1XWYA 1Y65A 1TELA 4DLFA 1KM3A 4F40A 3SY5A 1XH1A 2RFGA 1UKTA 3OYZA 4XVDA 1MVYA 1VLIA 3C8FA 4IPLA 4WDTA 2IQTA 2QR6A 3WYZA 4H41A 1S1RA 3H70A 4ZE4A 1U33A 3HF3A 4ADSA 1IR2A 1XS2A 1Q6QA 1UJQA 1MXDA 1PZ2A 1EH9A 5CC5A 4PB3A 3U6WA 5REQB 4Q4QA 2ANUA 1ICPA 2AKMA 3U48A 2PPGA 2DSUA 3E2VA 4LUYA 1ZBCA 2E6DA 2E5DA 1P0EA 2VGFA 3L5AA 1C91A 6ALDA 3IACA 1Z41A 3NDZA 1DJNA 4XAPA 3KVLA 1FH9A 4PMJA 4OTKA 5AZ0A 4DYEA 1ONRA 2XG9A 3W73A 3UZJA 4IMAA 1SFSA 5CKSA 2C1IA 4ZB2A 4U10A 5KTLA 5DMNA 2FGLA 4WLCA 4XUGA 3ITOA 4ENLA 3SECA 2OX4A 4CGTA 3UPMA 4QDPA 5CJMA 2F6XA 4OU1A 3I65A 1OCNA 3F1QA 3MV01 3MKVA 1R2SA 3QSTA 4RE2A 2NQHA 1DJZA 5CZSA 1P7TB 3B0VC 5AHIA 2ISSA 4H7ZA 3LD5A 2VUNA 1L6WA 3MUIA 3UA4A 4C6NA 2PWFA 4PRRA 4ZSTA 3INPA 4M7TA 3GIPA 4O18A 1HL2A 2R9RA 3LA4A 1OADA 3MVIA 1XYMA 1OC6A 2JGQA 1WX0A 3C8NA 6A3HA 2PZ0A 3UT0A 1SUXA 5A6MA 2WMFA 1RJQA 2J75A 2BS9A 2WVUA 1R85A 1R9XA 4CNNA 3BLEA 1KB3A 3R0KA 4OBRA 3IANA 3LHVA 3R12A 4Q8PA 4J3WA 2WSRA 4XQ6A 2BVWA 1OX6A 5D9MA 4LJ3A 2DZSA 3AIEA 4NZ3A 3UYCA 3PJXA 4WR3A 5FEWA 1AG1O 1TCMA 2HROA 2OZ8A 4IGHA 3D0CA 1Q66A 1H62A 3R79A 1VFMA 4CCCA 2Q3RA 1YBQB 1LUCA 3WK3A 4CCEA 1QATA 2Q09A 2YGYA 5A3HA 3XIMA 2HJPA 1I4NA 3P67A 5A94A 3UGRA 2NSOA 1GUVA 2ZCGA 4GVHA 3DHFA 7REQB 2PDPA 5M17A 1W37A 1W1IE 1QNVA 4C6KA 1EOMA 1TPVA 4IGNA 2F84A 3K5XA 3G77A 1SW7A 4PTWA 5D30A 1UBSA 3WF1A 3B05A 2A85A 1W6TA 2BOFX 4QE4A 4NASA 1UCWA 1JZ4A 1E9ZB 4O28A 3PANA 3GVGA 3QFEA 1E0XA 1GZ1A 3RX2A 5EBAA 2OOFA 3CZGA 1OT2A 3WJSA 2V3DA 4QCEA 1D9EA 1H5VA 4UR8A 3LOTA 3DI0A 3URNA 1US2A 4Z0SA 2DUXA 4RE4A 1KXVA 3Q4DA 1LL4A 2ZX8A 3KBVA 3SQSA 1QJWA 3WQPA 3TSDA 5C9RA 4I7WA 4ZBCA 2R1MA 1XCWA 2KAUC 3NQEA 1V0KA 3N19B 5LXEA 1O66A 1NDWA 5HQLA 3AXIA 1KGWA 4H1ZA 1CXKA 5A5WA 4GRSA 3W1XA 1E1CB 2V63A 4WQ6A 4C65A 3ITTA 4C7GA 1X6UA 2G3JA 4IQEA 1WKDA 4H2CA 3WDIA 3WBWA 3DH7A 4J35A 3LHUA 1A5MC 5T26A 4HZ6A 4C6PA 1DXFA 3C6CA 3AXMA 4JTIA 4CQDA 4FMVA 1GWJA 5E6YA 1WXYA 2PDKA 2V2HA 2WC3A 3GU9A 1O5KA 2DJLA 4UTUA 3L23A 1GKRA 2OQLA 3OOQA 4GIRA 3MPGA 3FK4A 3L21A 4QJ4B 3EDKA 3GDLA 1UIPA 2C19A 5I00A 4IHCA 3NL2A 2PCQA 5C71A 4XWUA 1PL9A 1ZFJA 4PMXA 3MCMA 3HGRA 5FF2A 1S5MA 4REQA 3TR2A 5I78A 5DT5A 1Q6FA 2NX3A 1P0BA 3OBEA 5CC3A 1LBFA 4IIEA 4ZQOA 3A47A 4B3ZA 3PBMA 5KSWA 4AF0A 5AY7A 3FFSA 3RLGA 3B3DA 5F4SA 2QT3A 4K37A 4K3ZA 2PI6A 3S42A 2WM0A 3ZWTA 4E2OA 5BRBA 3CQ0A 3CWNA 2IPJA 1DPMA 3TYDA 1S39A 3R8RA 1FHLA 1IV8A 5CAHA 1EP2A 4DWSB 2CETA 1I2RA 3DGBA 4PBEA 4B3LA 1B4KA 3H7VA 5LYRA 1VFSA 3WNKA 1XDMA 1PAMA 1GVOA 3BG3A 3S2CA 1JXJA 2X2GA 5HNTA 4AIEA 4CNSA 2HCVA 3PPHA 4D6JA 4J27A 5M1TA 3HB9A 4GI4A 1FH7A 3PTDA 5G4WA 4XZNX 4QIUA 1I45A 1GVIA 2PP0A 4HMEA 3SEPA 4PMRA 1F76A 4Z1AA 3L2MA 1HJSA 3BJSA 4K39A 3CTLA 4M19A 2H90A 2PGWA 1TWDA 2OEJA 3O2LA 4NAEA 1A0DA 2DW6A 3CH0A 3CV2A 4IGSA 4M6VA 3DBPA 1KCZA 1QASA 4JQ2A 3UXDA 1UWRA 4L64A 3E2RA 3W7LA 3SAZA 3TN5A 3WDQA 3LM3A 4LC6A 3IS4A 3RAOA 4KQNA 5JH2A 3FA3A 4GOAA 1EPVA 4GZEA 4RPQA 3QC3A 1AQFA 3QYSA 1NQ6A 4QFUA 2Y5SA 3LX9A 4RNJA 1PWMA 5FJJA 4HNUA 1RPKA 2AGKA 4Q4RA 3RO6A 3UP8A 3VAVA 3EEGA 4KWUA 4QCFA 3F2BA 4CQCA 1EJXC 1DVJA 5FF3A 3P93A 3KL5A 4G1KA 3MCOA 1KXQA 3AQUA 3SCSA 1NDVA 2EGZA 3IVTA 1E4LA 2WV8A 1PWLA 3UU0A 1HQTA 1E6XM 3R13A 3G1AA 1UD6A 1RK6A 1A3WA 2WO5A 3OGRA 3UERA 5DY3A 3W26A 1CEOA 1KO0A 4Q7BA 5ABFB 1W31A 2YDSA 1M5WA 2VNCA 2QCFA 4LB3A 3JUGA 3BMWA 1ZL1A 3QZEA 3SCNA 2H3BA 1B1YA 4XD5A 1KC7A 3O6DA 1XIFA 4QP0A 3UVAA 1EJVC 4JDYA 1V7AA 1V0NA 1CTNA 4NX5A 4TU1A 3AYSA 2W62A 2OKOA 2NXGA 1QBAA 1CPUA 4LVAA 3SGUA 2ZOXA 3W9ZA 3NQMA 1UOZA 3QV8A 4HNNA 2WZIA 1YX1A 3C2RA 1TYGA 4NU7A 1UR4A 4RW5A 3PAOA 3U2OA 1U5VA 5AN7A 1HKKA 1EKOA 3PZIA 4O16A 2F2KA 4BR1A 2VFHA 3UNDA 3ARQA 2YCKX 5LA0A 5GNYA 4RUBA 1M7XA 4RJEA 1M03A 1C90A 3WF4A 3QGKC 1RUSA 5DRCA 4BF9A 3EPOA 4C6EA 1F3TA 2VC5A 5EFDA 2BXVA 3BJTA 3GC2A 4JQ3A 1HJWA 3H2CA 2O7QA 3DFYA 4O1AA 2PDFA 2GJNA 4IQJA 4LAOA 1XSJA 2IKGA 5BZAA 2BY2A 4X9SA 4UFHA 4KRZA 2XPKA 4J3UA 3LB0A 4MB3A 3P61A 1XFBA 3UXIA 2QDEA 4D8AA 1TR9A 1IEQA 4BA0A 2DVUA 1DOSA 3S5SA 2GFTA 1PJ9A 2ZYFA 3WQ4A 1XPGA 4ZO9A 2X1UA 9XIMA 4HN8A 3DFPA 4NVTA 1EC7A 4Q33A 4BK9A 1VF8A 2X1SA 1J2BA 3AMDA 1L2QA 3EWWA 5AHMA 1Q8AA 3DEQA 1TFVA 4AYSA 1O1ZA 3UVIA 4O4VA 3VOGA 5HAOA 3WQOA 2NXIA 3VGDA 4HTBA 4C1NB 4TMCA 1N8WA 4RW3A 4DXKA 4AD5A 2FGZA 4JEQA 3ARZA 5E5CA 3DAQA 3CZEA 1TREA 4U2ZA 2I16A 5HDRA 1LRNA 1DKWA 3NTYA 1WBHA 1WKEA 4AZ5A 3ANVA 3H26A 4S3FA 3AO0A 1AZ2A 1FDZA 4AYGA 1ZP4A 3OVRA 2PWDA 3EMCA 4RDWA 3W1LA 1SVDA 2CHRA 5CEWA 3ARPA 4IFOA 4FX7A 3TMQA 3BAKA 4GABA 2FFIA 5A8QA 4BHYA 3B9DA 1XH0A 3TK7A 2POTA 1DV7A 1OG0A 1PTDA 2J9XA 3W87A 1DEDA 3A5VA 3BANA 1QNOA 3F5KA 2D20A 3ENLA 2VX6A 2P53A 1HP4A 3LBCA 4JIQA 1A4MA 3WQCA 1HW6A 3LLXA 2OO0A 4JKMA 4JTAA 1XBYA 4ADUA 3QZ6A 1MW1A 1F4AA 2TODA 4KBXA 2FB2A 2AAMA 2UZ9A 3U3HA 2GJPA 2EPNA 5AECA 4W7WA 2WNQA 3S4TA 4AB4A 2I9EA 1OFBA 5JH1A 4UFLA 5C9XA 2BGQA 4B4HA 3DYMA 4HK7A 3AOFA 4WJ8A 3P5ZA 4H6RA 3TN4A 3WNOA 3MI3A 1TCDA 3PWIA 2V8ZA 4FXJA 4L56A 1UROA 1E9YB 1TVPA 1QMLA 1V02E 3AMKA 2Z7GA 2EBNA 2WKGA 2ASHA 2PLJA 3MWAA 5FJOA 3CXOA 2V2DA 3QV7A 4NAFA 3VNLA 1KFEA 2QJHA 3WJXA 3PZTA 3UCCA 4HOXA 3TCSA 5TNVA 1W1A1 1MW3A 1B9ZA 4UQAA 1E72M 3IIXA 3CT2A 4A21A 2OWCA 1DBTA 1R87A 3ITCA 4C6CA 1WDDA 5J5RA 4S3GA 2DP3A 1R2RA 2QVHA 3GTNA 1OK6A 6REQA 5E93A 1P5BA 4UR7A 8CGTA 3WLSA 1B57A 2FH8A 3V5OA 1MSSA 5F2IA 2TMDA 2HNEA 3BCDA 3WNNA 3DN5A 1NWTA 1HVQA 3DCPA 3GDMA 3TZNA 4OKDA 3UWEA 1JFXA 3W7HA 2JQXA 3V1HA 3A24A 3NEVA 1J5SA 1NWUA 2WVVA 3JU2A 1VP5A 3GKFA 2PGRA 3IJ6A 4UTHA 2X7WA 3ONCA 2OOGA 3OGVA 1BXNA 5FJTA 1KRAC 2CU0A 2A1YA 4O15A 3CLMA 4YCOA 5B7YA 3N9SA 4GUHA 3CK5A 3VNMA 3CS2A 4PL1A 4EWND 1QNQA 3P7YA 4WJEA 4HOZA 5EA9A 3U7BA 3M9YA 3T81A 2QULA 4MNJA 2Z2AA 2WMHA 3ZWSA 3ISIX 3PM6A 3GKAA 5D2TA 1UD5A 3REQA 3W72A 3N04A 3G0SA 2CLLA 3KOYA 1V3LA 3EAUA 3A22A 4UC5A 1KFWA 4RNHA 1G9HA 4FOJA 2VRJA 4NYUA 3W1QA 2VWSA 2OZTA 4MY8A 4GYKA 1D3CA 1A5BA 2WHKA 2J7CA 1AW1A 1GW1A 2JALA 1GCYA 1QWGA 1XR2A 3M07A 3SCVA 1DWHM 5REQA 2DDXA 1B90A 1B2YA 1JIBA 4XKMA 4FIRA 3CHFA 3ARVA 2I1OA 2NQZA 4GYJA 4RK8A 1XIMA 5EY5A 4NZJA 4DUVA 3WMLA 3LG3A 3C0LA 1X96A 3V4BA 3FCPA 1V3JA 4XIAA 3GR8A 1NFBA 3R8HA 1LL7A 1X6LA 3UWVA 3B0XA 3LK6A 1BVZA 1P0DA 3TFXA 3WCZA 4D9PA 3NG3A 5HR7A 1MUWA 3WO8A 1A5NC 3L66A 5KZ6A 2NV9A 4CNUA 2Y7DA 4IOTA 3BJFA 1XLAA 2PDQA 4TIMA 3R4IA 2FTYA 4YU1A 3ITXA 2OSXA 3GNRA 5D8WA 3N2MA 1P1XA 2WZMA 3MBDA 2YCLB 3SCPA 1VENA 4A05A 4WEVX 1SGJA 2X2YA 2CHNA 3W7CA 3CT7A 3ANUA 2DZXA 1ZAIA 4QLKA 1MFUA 3C4UA 5ECVA 3ARUA 3TFCA 5K9XA 4AUBA 3IIZA 4Y9AA 1IXPA 2RDWA 2WQDA 1XLGA 2BB0A 3ONBA 2WPBA 3EWZA 1XYAA 2FHBA 2VHLA 4FSAA 3ZIZA 1EO5A 4QG8A 4GX9A 4AY8A 4JN8A 1GOWA 1IT7A 4TV5A 3IV3A 1UPPA 1KM1A 2NUYA 5HUOA 1XG4A 1R3TA 1W3HA 1LP6A 5FKYA 5BOOA 5HULA 2QUMA 3GH5A 3IGUA 7TIMA 4DZHA 2GLKA 2DZAA 2F6KA 3H23A 4UUIA 3W28A 1U1HA 1ONWA 1HO1A 4P5UA 1CGVA 3DI1A 4PULA 2QIIA 4MZ8A 1AUSL 2P5NA 1E3XA 3VIKA 1BEUA 1JF5A 4M6QA 4Y9MA 4DO6A 4B5XA 2CNCA 2GWNA 3F5JA 1REQB 1TZZA 2DSKA 3WN6A 1YBQA 2PTXA 1FOBA 4EVZA 3M46A 1A49A 4DEFA 5CSRA 3QM3A 4XZHA 4KFOA 2WQPA 3TAOA 3C0SA 1PZ1A 1QVBA 2O0TA 3W07A 5HWJA 1U5HA 4GACA 3QV6A 7REQA 4EXBA 2QPXA 4GNVA 1XH2A 3OVPA 4YNGA 3VNYA 4UMCA 4W8LA 3IPWA 3CZJA 4I90A 1TMLA 1RLDA 4LWWA 4MJ2A 2QYGA 4M51A 4Q4PA 1R30A 1EGZA 5D2YA 1L6GA 3A3HA 1K8XA 3WFZA 1N2VA 1P1MA 1EB3A 1J6OA 1UUOA 2INEA 2WKJA 3QF0A 1S5VA 4DF2A 2ZXQA 1SFJA 4D6GA 1ODZA 3W2LA 4ASTA 2EPLX 3MI6A 5AB3A 3M0IA 4UQEA 1BXBA 3CM4A 4XKYB 5HNRA 4WDWA 2VR5A 5D38A 5I23A 3C2EA 4O53A 2OO6A 4GO8A 1JCJA 4DF1A 2QNEA 2V5KA 2PRMA 1EA0A 3FNDA 2WM1A 3CYVA 2D2HA 1TB3A 2C14A 4LYPA 1IEVA 3BAXA 2G37A 1IIGA 6TAAA 1MQPA 4RDZA 4U4MA 3M16A 3LNMA 1E1CA 1G1YA 1KW1A 1YIXA 2R1KA 1R8LA 1R86A 1Q7QA 2Y2WA 3ABQA 3E2QA 2XJ7A 1OIMA 3TNOA 3WJZA 2W3ZA 3NYDA 5I03A 3CEPA 5GNXA 1FWTA 4F4RA 1IR1A 2XSAA 2ZX5A 4DWSC 2XHYA 3B4UA 3HPFA 1EBGA 1W3LA 1JYXA 3H8AA 4PUJA 3SCRA 3UR8A 4JHZA 3TJLA 3RPTA 1K7XA 4N9BA 3RCMA 4MJZA 3WLNA 2VVSA 2DSWA 1F07A 1XRFA 4EF9A 2Y7GA 4PB5A 5TIMA 1BWLA 1KGUA 3CWOX 2INZA 1PIGA 3LHTA 2RUSA 2PU0A 3N6HA 3IJLA 4NT0A 2PDNA 4CD4A 4E6MA 3PPCA 3BOLA 5AC7A 3UEQA 4F48A 5M2FX 2RDUA 2ZA3A 1EEXA 4NI3A 4MWAB 3KTXA 1EHAA 3NO5A 1ZRQA 1DIEA 1FY6A 1BG4A 1F2JA 3EKGA 3TMLA 3PNUA 3C61A 5BRQA 2QKFA 1ZTVA 3TWAA 4OUEA 4WSKA 1O5XA 2WANA 2F2HA 5H6HA 3O6CA 1S2AA 3TTOA 2G0WA 4B9YA 1VJZA 2DQXA 1H09A 2P1FA 4GQ0A 1DYSA 2A3HA 1X1OA 1WDRA 2FZ8A 2V68A 1KFKA 2ZC8A 1WUEA 1FWHC 4N42A 2F9RA 5DMLA 4C7FA 1KV8A 3MP5A 1K4HA 1XIIA 1A5UA 1LWIA 3VKDA 2J13A 2XVNA 4CD6A 3SSJA 3N3TA 1QBBA 3CUJA 4US5A 5LHEA 4GY7A 3KBJA 3CHCA 3P0XA 1UB3A 1UD3A 4W7VA 5IXEA 1QWKA 3WEZA 3I4KA 4I8DA 3LQLA 4XX6A 1KQZA 3CUZA 3BQ5A 5JUVA 4GXMA 3NPVA 3BL3A 5I3HA 1OCBA 2POZA 3AHXA 3UJ2A 5AFDA 3NO1A 3EBVA 4A3UA 2CLPA 2E28A 4Z2IA 2V67A 1FWEC 3L7RA 4K8HA 4N7QA 2PTZA 3M5ZA 4UMBA 5FI8A 4YS1A 5E6ZA 3R8GA 3LPGA 2YOCA 4PBGA 1F6PA 1JF6A 1H61A 5IFTA 3OTRA 3ICJA 2ZQ0A 4H6KA 4DI9A 1G0CA 1TV5A 2ZVIA 2V82A 2VRKA 3W7OA 3IJ7A 4DQWA 3WLOA 1TVNA 4JN6A 1W1ZA 4DLMA 3QOMA 1MQRA 2Y7EA 3PG8A 1R9ZA 2XYLA 3KZPA 5CPLA 2FMOA 1GYLA 2JF6A 4WRHA 1WO2A 9RUBA 4A2SA 2J4GA 1JPDX 3SIZA 1LOLA 3KBNA 3B8VA 2IQ0A 4UNIA 4AFYA 5HR6A 4OJYA 2AOSA 4Y90A 3LI1A 1ZP3A 4M24A 1N8IA 3BO9A 1A4LA 2A5HA 5ABFA 4QSFA 3PVFA 1H7NA 3PPFA 4GC4A 3K8KA 2PRHA 2J88A 5CG7A 2Y6ZA 4WGXA 3S2NA 3NQ2A 1EJWC 3LXCA 3ABRA 3N4EA 3GBEA 3BGAA 1QT1A 1OYBA 1UA7A 1Z6KA 1K7EA 4LUTB 1DJHA 1SW3A 1A0CA 2WNNA 4KH2A 4FR6A 4EP8C 3ZLFA 4GJJA 4GUFA 2HSAA 2XFFA 2GQ8A 4MDOA 1BWKA 4TVUA 4HJFA 2QF8A 2VYOA 3SN0A 5JBFA 4C6BA 2QCCA 4UFKA 4XISA 4NXKA 1CXHA 3S1XA 4LEQA 1Z7AA 1UJPA 3L65A 1C3FA 3WH6A 3BVJA 4W8BA 4I5RA 2ZWZA 3M0MA 4MKVA 3SCQA 3GHRA 4EPDC 3C5QA 4KRUA 3BH4A 4PCSA 1R9YA 4Z2HA 3C2OA 3L4ZA 4W86A 2AL2A 1I1WA 1E9LA 1NY1A 2JIEA 1O60A 3CLWA 4R5EA 1FWAC 3MO4A 3CZKA 1E4MM 1GTHA 1YDNA 1JPKA 3W1MA 4LRSA 1K70A 4BQ2A 5A6KA 2NWSA 3AIQA 3MDUA 3SJNA 2VX4A 3VCCA 1I75A 4F9JA 1OSEA 2C0AA 4XZ9A 3I7QA 1QK0A 3QZAA 2WHLA 5AC5A 4FXRA 2HE5A 5DFAA 1RK5A 4N2YA 1MYRA 2J66A 2OELA 3G6MA 4ZCWA 3NQ8A 4MADA 3AYRA 1G7VA 3PTKA 5LHFA 1R3RA 3I6RA 4Q7IA 4BWLC 2E6YA 4C1NA 1UZ4A 3V36A 4Y96A 4AIOA 1FRBA 2E6FA 2ONEA 4JPGA 1G5AA 2D2JA 4HIBA 2C1HA 1XLKA 3LHWA 1DQUA 1XYLA 4WXYA 1FXQA 3TU9A 2Y8UA 1NWSA 2V5CA 4L4OA 3TC3A 1TQJA 4JQ1A 3HURA 1AFSA 1VBJA 2X41A 1Q2RA 4PRWA 2QHAA 4C1LA 4LOCA 3VUSA 2OWWA 1Q6CA 3VCRA 3WH7A 3VNJA 4OBTA 1QO2A 4WSHA 3ZVHB 4MWAE 1PPIA 2NZLA 1NDYA 1RD6A 2HDJA 5ABEA 2RGMA 4P7OA 3AU2A 1KNWA 5LA2A 1DWIM 1UPMB 4AC7C 2AQWA 3GXNA 1RXOB 3TC7A 2SFPA 2NLYA 2VFIA 1GOXA 4AC1X 1W9VA 3NZ1A 2G95A 4XBSA 3PHAA 4WK9A 3G18A 3WENA 1HKVA 4J3SA 4FA3A 4EACA 1HJVA 4ZQNA 4F9DA 1CBGA 5CAKA 3N14A 1BGGA 1ZJBA 3F2DA 1POJA 5XIMA 4UTIA 1DJGA 4BWLA 3H53A 3U7VA 5IHRA 2WC7A 1AJ0A 3OODA 1QOQA 3SQMA 4GZ7A 1CB2A 4H83A 4XBJA 1NIUA 1POKA 3VABA 5C5YA 1K8ZA 3U8GA 4BI5A 3VGFA 1IGSA 3GHUA 2HPMA 5JQ9A 1IEWA 1KM4A 2B7OA 1HXJA 3H55A 1K8CA 4JDBA 4IG2B 2VEIA 1UKSA 4PC8A 1GOKA 4P7QA 2DH2A 4FK9A 3W0KA 2YJQA 3SSZA 3RYSA 1EWEA 2DSZA 2GJRA 2O92A 3U5YA 3MMTA 3W2JA 1BG9A 2ABBA 5PTDA 1EYEA 2CC0A 4BQ4A 4M7SA 2GVJA 1XRTA 3W88A 3SUSA 4N9DA 1J10A 4B5VA 1US0A 2A6LA 1PV8A 2VEFA 2E09A 2C7FA 3VILA 1YE6A 2Y89A 3OHMB 4YTQA 1XICA 4HCDA 4TMBA 4JKLA 3VGBA 3T0TA 4G8TA 3ZJ8A 3S2JA 3LCXA 3GIQA 3GXTA 1ZB5A 4EXQA 3DYOA 4JFSA 3QKEA 4NIRA 4ZE5A 3AS2A 2DUZA 3PUEA 5EMKA 2PWVA 4OWGA 3TTYA 1LG2A 2YPIA 4A6GA 2ZZ3A 1P4CA 3TNBA 4AG0A 3ZLHA 4OT7A 3DFOA 4MPQA 4AWUA 2PDIA 1WDQA 4AH7A 5FAGA 1QPOA 2IMRA 4AZ7A 3NR0A 4Y8EA 3GHSA 2J78A 2E5CA 4AU0A 2Y61A 3FVMA 4QG6A 1R3VA 1A5LC 5EMJA 5FL1A 1ELSA 3KP0A 1X98A 2I5GA 1J0ZA 3TW9A 4LY8A 3NQVA 1FXPA 4H8HA 4EE9A 1KBLA 2GUBA 3M64A 3UR5A 2G96A 1Q6OA 4HNLA 4RR4A 1XV8A 1PKMA 4G7EB 3VKCA 1ZJHA 1TV3A 5BU6A 2E40A 2J9YA 1EX5A 4TTUA 4EKJA 4N6FA 4R7OA 5HBFA 3FEMA 1HKMA 4ZO8A 3GUWA 2VURA 5LGXA 2ACQA 1UASA 2BSLA 5L9FA 1PKYA 4US6A 3VGGA 2YFOA 4PUNA 1LJYA 3EYPA 2WMJA 1H7RA 4X61A 2A3BA 1V8EA 1W1YA 4DM1A 1O7AA 2PDBA 4NSBA 4JIHA 3L9CA 4U3CA 3R89A 1LWHA 3RCYA 4B90A 1JQVA 1JDDA 2J7GA 2Z6IA 3JRKA 3KZSA 1RA0A 3OLIA 4DELA 1JYVA 4F0SA 4E5TA 1V4YA 2FTPA 3E12A 3IRDA 4JN7A 2HK1A 3HQOA 3CQIA 5TD4A 4ONVA 3WLTA 1E0WA 4NILA 3GR4A 3SN1A 1RP8A 2XISA 3TJIA 1PIFA 2FTWA 3OVQA 1PTGA 1JFHA 4DUWA 1JVNA 5HUPA 1WOAA 1RY0A 3ES7A 1AW5A 3G0XA 2F8QA 1H7OA 2HPIA 3B9AA 3KAOA 4AVFA 4UIOA 4B2DA 3AJXA 1XBVA 3HV9A 3W7EA 3KL3A 5C7VA 4GKLA 2YCLA 2CIPA 4ZQCA 5IM51 4PCTA 3EWYA 3L0NA 4E38A 2GVEA 3PP7A 3GVRA 4PB4A 3QQ0A 4JL2A 4AHQA 4DBDA 2QMJA 4XAFA 5EU9A 3W1UA 1OF6A 2PGEA 4JTHA 5JIWA 3GW0A 4A8RA 2BTMA 2PTYA 2Z1WA 7A3HA 3UPBA 3QY7A 4GNKB 1OFOA 1OYCA 3QMTA 3UA3A 1H60A 2MNRA 3NURA 1VHCA 5DEZA 5HQMA 4ACZA 3W76A 3EEZA 1S3HA 1UD4A 2EAWA 4PMZA 4OE7A 1J5TA 3NVTA 2BMBA 4CNTA 5IDZA 1FWSA 3N1AA 4KERA 3E74A 3E38A 1IZJA 3G1YA 4AD0A 1EL3A 2WZTA 2GGJA 4DJDC 3WDJA 1IXOA 5C54A 3VTRA 3I7SA 1AD1A 1QW7A 6CGTA 2I9UA 4AZHA 3NPUA 2QPSA 3O9NA 1VIWA 1EZ2A 4ZQPA 1V77A 5CGQA 5I79A 3AZTA 2XTKA 3Q65A 3UG4A 5C9UA 4GINA 1L2UA 4C1KA 4KCVA 2P3EA 5CGTA 4IMFA 4WUIA 1W9DM 2PBOA 3IJQA 3BW4A 4JNMA 1AJZA 2CLEA 4IXHA 1RPXA 4XTIA 1XLLA 2NX1A 4Q8OA 5TAOA 4AEFA 1UH4A 2J7BA 2I5IA 3GH7A 3OLGA 1UR8A 4IWWA 3NQFA 2ON3A 1AL8A 1XYCA 3O05A 4G6CA 1BXCA 3CUIA 1FH8A 4E2DA 2ZWYA 4B5TA 3Q94A 3C0QA 1OX4A 1RSCA 4ZTYA 2G3IA 3ZO9A 3KFTA 3DDMA 5FEZA 3T2PA 1TJ2A 1T96A 5CPTA 1DP0A 2XN1A 3RR1A 1N82A 1C8YA 3GYCA 1Q4NX 4LU0A 1N55A 5H8MA 4W4QA 4NY2A 1UP3A 2VVNA 4FR1A 3FV9A 4M82A 1E70M 4XKYA 4AZGA 3UWQA 4W85A 1XP3A 1DQWA 4DJDA 2C79A 3NQAA 3VKAA 4BKNA 1BVWA 3OA5A 3SM0A 1F4HA 4LBRA 2IKHA 4MWAC 4H7VA 2PB1A 3RXZA 2X1TA 3PY2A 2R91A 2WBGA 3BMXA 4O50A 1B3YA 4HU0A 1VEMA 3D6NA 3EA2A 3L4TA 4TUFA 1W1PA 3GWQA 3H2OA 2CLMA 4GLEA 3FKRA 1ZLPA 1E4IA 3EXSA 4GH1A 4O8AA 1TA3B 5EMYA 2VENA 3PTMA 5CLTA 3VMNA 3MT1A 4P8XA 3WK2A 4AD4A 3M5YA 4DUXA 3OZPA 3FOKA 4IP4A 1PKLA 5FF0A 4GE8A 2OZ0A 3LGGA 1G7UA 2V5DA 3EMQA 3WZ0E 2YB1A 3T6CA 1CIUA 2VDGA 3VUPA 4GQGA 2W9MA 4RXGA 2BHYA 1E43A 2EJ1A 2DVTA 3MB9A 2DFAA 2Z1BA 4HN4A 3VXGA 2V0TA 3T05A 1J6PA 4YJ5A 2FH6A 1BGAA 3TP4A 1V6VA 3UQNA 3S83A 5I3GA 2NQ5A 2XM1A 4KRTA 4H8UA 3GC5A 5A8OA 3TOYA 8XIMA 4JKKA 1XYZA 1Z9AA 1WDWA 4MWAA 3A21A 1D8WA 1ZY9A 3IUIA 4TXEA 4YHEA 3UWWA 2Y24A 1NDZA 4GWEA 1TV2A 4ADTA 1CXFA 4ZENA 1KXHA 3B8WA 1GVSA 4GFIA 5DQPA 4KWWA 3KX6A 4C90A 1R38A 3RM9A 1UWAA 2QF7A 1WCGA 3L68A 4HB7A 3VZZA 1I6NA 1H49A 1L8PA 3EX4A 4KIRA 4H9TA 4NZCA 4BQ3A 1W3TA 2VQTA 4A22A 2RGLA 3I68A 1W5QA 3BQ6A 4F0HA 1D8CA 1JPMA 4WZHA 1DWFM 2P88A 2R1LA 5D2VA 3NDYA 5A6AA 4RNIA 3FHAA 4MY9A 1TV8A 1Q5MA 2ZICA 2VX7A 4HHLA 3MUZ1 1V93A 1ZAHA 2X40A 2QAPA 1EP3A 3WY1A 2PDMA 3MW7A 3QJAA 3NAVA 3T0CA 5MKGB 1W5PA 4Y9OA 5C8BB 3A12A 4HNOA 2D23A 4ZQRA 3WD1A 2VDIA 2CKSA 1GYNA 4O57A 3WNMA 3BG5A 3W22A 2A0NA 1EHNA 1FX6A 1FKWA 5FJRA 4F2BA 3GYEA 3SADA 1D7KA 4KPLA 2TSYA 5K9DA 3T07A 3VU2A 2QXWA 5A6JA 4EXAA 3AALA 3T8LA 5HPOA 4GGBA 4RLIA 3UZYA 3PK7A 2Q02A 2FHFA 5DCDA 5F7UA 3TYAA 3ANYA 1GQNA 5I7GA 1B3VA 2PURA 1O12A 4CKQA 8TIMA 1IWPA 2WZHA 2OGJA 4GFSA 1M7JA 4ZODA 5DN1A 4Y6GA 4Q4SA 2P50A 2IXVA 2AGTA 4CEXC 4LY4A 4K8GA 4PUEA 3S6TA 1EWDA 1MNSA 2GZXA 1JL8A 1PCKA 3WJYA 5G4HC 4E3TA 3S8HA 5BYWA 2ZXBA 5A69A 2BXYA 3KRBA 4Z2GA 4F8XA 2OEMA 3FY1A 3S5YA 3GVQA 2FIQA 4X22A 2O7SA 4ZA0A 3UXLA 1YXCA 2R8WA 2DZUA 3DUGA 3V3WA 3EB2A 1ODUA 2GDQA 3AISA 5LIWX 3GBDA 3HMCA 4PUKA 1XKJA 2IQDA 3W02A 4L1XA 2UWFA 3LN3A 2GQ9A 1OYAA 6TIMA 1XF0A 2VD8A 3U57A 1EO7A 4JIEA 4LUTA 4MPKA 1EJSC 3VD4A 1E0TA 2E67A 1J0HA 3V18A 1DQXA 3V0UA 2JF7A 1NFGA 4ML4A 4BY3A 1KQYA 5HQEA 1JPIA 2V5JA 4W5UA 3GFZA 3ATYA 3MYOA 2C0HA 2VXNA 2ZX6A 5D09A 3HOJA 4G56A 4IIBA 4CQ8A 1DJIA 3QGAC 4K8EA 1HZYA 4CU8A 1UP0A 5CJNA 2XVGA 3VC6A 3H24A 4IIGA 2A6NA 1VCGA 1GKPA 5I02A 2D0GA 1HJUA 3LXBA 3EX2A 1L9WA 3LY0A 1V6YA 4HMNA 3VDCA 2WSKA 2Z6JA 2WJZA 4LANA 3AIVA 4D8LA 5C9WA 4KEUA 2E9MA 4P8UA 3ZT7A 4UTJA 5C55A 4BJHA 4WOQA 1TX2A 4GPNA 3M6YA 3NA8A 5LNRA 4NNCA 4E8CA 4KF1A 4X0VA 3H4WA 4YVVA 2CERA 2WXDM 4RCXA 2YW3A 4UR9A 1EXPA 1VEOA 3M7WA 2ALDA 3G1HA 1XBXA 2QCGA 4UFIA 1JPHA 5A2CA 1EJTC 4GUGA 4AD1A 1O68A 1KTNA 1TX0A 2QCHA 8A3HA 4FNQA 3ARXA 3NWRA 1IE7C 3IV8A 3NNTA 4MLJA 4FPSA 3TTSA 2ATSA 2FKPA 2E9BA 2Y0FA 4TX8A 4HYVA 1ICQA 4JFUA 4CD8A 3EWUA 3T78A 4WD0A 3SUUA 2C71A 2ZZ5A 2WWCA 4ZFCA 3RF9A 3MTWA 4MNLA 3LDVA 4HZ7A 5BROA 1BQCA 1XXXA 2BV9A 2CWXA 4H9VA 1GVYA 2EKGA 2YL9A 4ATDA 1LLWA 3WLJA 4KIEA 1PUDA 2OYMA 1TWIA 4I8YA 4O0ZA 1MZHA 3KCJA 3TSMA 3KRSA 3NGFA 1I9CB 4NI8A 3WLKX 4V15A 1QDSA 3RO8A 3BV4A 2IW0A 3TYBA 4ES4A 4GIAA 4W88A 4AY7A 3ZVHA 3E1F1 4LYRA 1H7WA 2W91A 3W53A 1OD0A 3SQLA 3PBUA 1FP8A 5F1VA 2VCBA 1FWIC 4JEJA 3DZ1A 2E0PA 1UWQA 5ABGA 4IH3A 4LS0A 1YTKA 5E9XA 1H63A 3SI9A 2FPYA 3OGSA 4YLWA 4QDMA 2A3AA 1Q7MA 1OVDA 3SIMA 3GG0A 3T08A 1IWBA 4MDPA 2G3MA 4A3YA 3F4DA 1Q65A 5A8GA 5TF0A 1THFD 1U2YA 4V2XA 3NYZA 1BSIA 2BOEX 2C16A 1KRCC 5EGRA 3TTQA 1OCQA 4LC8A 3W00A 4GCAA 3S0CA 2AKZA 3Q67A 5HATA 1CGXA 2X7VA 4OV4A 3WD2A 3AICA 1KR1A 1FFRA 1PYMA 2YL8A 1KTBA 1SJCA 1NTHA 3OZYA 1KRBC 4IG2A 4Q4OA 4UCGA 2WNZA 1KM6A 1UKOA 4LSBA 5CJ5A 4EF8A 1CLVA 3L4UA 1D7FA 4HHPA 2ZA2A 1JRCA 4AISA 3A4XA 7ENLA 5HWNA 3DXIA 3ZVIA 1KM2A 3G2GA 4AY1A 4YL2A 3ZXWA 5TBOA 4AHPA 2OFJA 3LENA 4DBUA 2J27A 1SR0A 4W7UA 3HGJA 1QAPA 4GMEA 1ITQA 3FDKA 3B9NA 4I9MA 2BY3A 4MB1A 4GG9A 3RPMA 3UWYA 2BNJA 1US3A 4XIMA 7TAAA 4PFMA 3CASA 4OGZA 5D32A 1J8VA 1M53A 4P7RA 3RRAA 3LCLA 2YBTA 1NSJA 3Q2DA 2PWHA 1EF2A 1R3SA 1XLJA 1VRXA 2B7NA 1BRLA 1W8SA 2VWTA 4H6QA 3LV6A 4JTFA 5T8GA 1A53A 1J9YA 1QXLA 1Q3NA 3UWUA 2QW5A 2GK1B 4EAMA 3EB3A 1EJUC 2FVKA 3QXBA 4LYKA 2DORA 3SGZA 3L4VA 5D4YA 3S5ZA 3DGRA 3ZZ1A 3BWWA 4KCUA 4B9ZA 5DANA 3KBSA 2BHUA 3T0AA 5A6BA 2D0FA 4OIFA 4QHRA 2VFGA 4UBPC 3VDHA 1B3WA 3NSMA 4D6IA 3EPNA 3HGSA 4RNFA 8XIAA 4G7EA 2PC4A 1UQZA 4GUJA 1MMFA 4QLLA 4Y7EA 2WK2A 2NV2A 3DHPA 1XX1A 2PUZA 3HG4A 4AZ6A 1K6WA 1E71M 1TRDA 1ITXA 2F6UA 2XWDA 3BCJA 4GCXA 2UY2A 1Z8AA 1BQGA 1NF0A 1SJDA 2YCIX 2C18A 1Y0EA 4PA8A 4MB5A 2G3FA 3SR7A 1KM5A 2EPOA 4ZGYA 2X42A 1OJXA 4L9XA 5F1UA 1F73A 1AK5A 3SURA 2REQA 4EIVA 2I7GA 4D6DA 4KESA 2P0IA 1SMAA 2QQ6A 4UZUA 2GGEA 2VT0A 3T7VA 3B97A 4JX6A 1JAEA 4CD7A 3N9KA 1B3OA 4Q4MA 1GONA 2GDVA 4HA1A 3IJDA 3EB4A 4S3BA 2CLHA 5MF5A 1RCQA 4DI8A 3GS6A 4LPCA 1Q6RA 3QLLA 3DIPA 1CNVA 5EPDA 3TONA 1EGVA 2UBPC 3MSGA 3L5MA 5DELA 2VKZG 3QTPA 1VFUA 1GPFA 4DPQA 1VKFA 2E8YA 1V03A 2ZE0A 3NM3A 1JEZA 2HK0A 1V6WA 2QMKA 3LQGA 3CMJA 2NQ9A 4LTSA 2QJNA 1C7TA 3OA3A 2ACSA 2PD5A 5DO8A 3UCQA 1OK4A 4A3RA 2Y8VA 4XUYA 4F0MA 5LIKX 2FDMA 3SN4A 1UD8A 4AAJA 4N6EA 1JYNA 3CL7A 3N4FA 1K4GA 5LA1A 5EL1A 1SO6A 3WLIA 1HGYA 2HVNA 1FWBC 1F7BA 1H1ZA 5F2LA 1TV7A 1TPC1 4NF7A 4K6AA 1A3XA 2E6AA 1XIHA 4BF5A 3GNNA 4IMGA 2QGYA 4W87A 3W7NA 1J01A 4GQQA 4XZIA 4MKNA 3W2MA 5D05A 4E3VA 3EMZA 3PBYA 2B0MA 4Z0JA 2C3ZA 3AU6A 2C91A 3GDTA 4NJHA 5I3KA 2XIBA 2CLIA 2J7FA 3BSMA 4DWSD 4NRSA 3ZFHA 4H8NA 4XAYA 3VIOA 2AMGA 3USZA 2YBUA 4GH3A 3LPFA 3HG5A 3GX9A 3VD7A 4J28A 2CEQA 2E77A 3OLDA 5HMDA 2WCSA 4WKHA 3LI0A 2QUVA 5I07A 4HJWA 4NQ1A 3HPAA 1ITUA 2JEQA 4US5D 3HN3A 4PGLA 5F4WA 2PDLA 4GBUA 2E8ZA 4JX4A 2ABAA 1R7OA 4PUWA 2XGZA 2W61A 2QLYA 2E68A 4AIUA 4I9JA 4B5UA 4L1WA 3W7KA 3WF0A 1E6QM 2V3GA 2V81A 1XLEA 4C5YA 2ZBTA 5FIPA 3URAA 1E6NA 5AVHA 1ADSA 5JIPA 4X2PA 4YIWA 5CCZA 4C60A 3MHFA 3HV8A 1Q45A 4QSHA 2XUCA 5T91A 2HXUA 1W9UA 1L6FA 3K4AA 1IXQA 3EWXA 3AS3A 5I06A 3I4EA 1VRDA 2C6QA 1HL9A 5B7ZA 5JVLA 3BLFA 4I7VA 4F0KA 4DO7A 2G8ZA 1SSGA 1S2VA 1VFFA 1TWZA 3UG3A 4V1YA 3A3XA 2CBIA 1P43A 3WUFA 1S38A 1WPCA 1JI1A 3C2YA 4IIFA 2NQJA 4GYPC 4WSJA 3DG3A 3MBFA 4DYJA 3VDBA 1LDCA 2IS7A 3NEHA 1FUYA 2Z1KA 3MUY1 1XLIA 1DXIA 1EF3A 2DV0A 3T42A 4FALA 4LV4A 3U4AA 4A2RA 1UW9A 1JD7A 5IRPA 1ZBWA 1QNRA 4QGCA 1WKFA 2WMIB 4X0NA 3TW7A 1RAKA 5HK4A 1JUBA 3V0SA 4EPEC 5CPOA 4MZ1A 4DXVA 1G4EA 1TA3A 1DIKA 5IHSA 4UQCA 2QDGA 4FX6M 1T41A 5EB8A 5D9OA 3IAQA 1W3IA 5AYIA 2EKCA 3L5LA 5G4EA 3GXPA 2Z4GA 4BI6A 4O1EA 3M0YA 3LM7A 3CNYA 5E0CA 4AZBA 3ZT5A 4UB9A 3EXTA 3W74A 3QHOA 3OQ8A 2Q3OA 1F6KA 1HT6A 2XZ7A 3KCOA 4W9TA 3NOEA 2GQAA 2RAGA 5CZKA 4JTTA 5CC6A 3GTIA 3KP1A 4Q8VA 3F2CA 2YFNA 1ZNNA 1GW9A 3IVSA 3KWXA 2ZUMA 3BXWA 4A8NA 2VEKA 4GYPA 3CV1A 1M01A 4Q8NA 3GDKA 1OFRA 4OFCA 4GY1A 2PWEA 4J7RA 5HMSA 3M6DA 3TQPA 2ZZ7A 3SY8A 3HG3A 1V7YA 2Z26A 1FWCC 5JXQA 4HQVA 3RITA 3F4CA 3T0BA 3WNLA 3VOIA 4MSSA 3W7JA 3B8UA 4MVAA 2OJPA 4JXCA 3B4YA 1S2CA 2H9AB 4S2BA 2XH7A 4ERAA 5IOBA 1A5OC 2YBVA 4K1GA 1HGWA 4PODA 4L9ZA 3HO8A 4NHVA 3WQ8A 3ZR6A 3FYOA 1XSKA 3WBAA 3LRLA 1MRQA 3A23A 3WLRA 3KS5A 3PULA 3PSVA 1KGXA