1TVPA

Endoglucanase cel5g from pseudoalteromonas haloplanktis in complex with cellobiose
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
293
structure length
293
Chain Sequence
b'AVEKLTVSGNQILAGGENTSFAGPSLFWSNTGWGAEKFYTAETVAKAKTEFNATLIRAAIGHGTSTGGSLNFDWEGNMSRLDTVVNAAIAEDMYVIIDFHSHEAHTDQATAVRFFEDVATKYGQYDNVIYEIYNEPLQISWVNDIKPYAETVIDKIRAIDPDNLIVVGTPTWSQDVDVASQNPIDRANIAYTLHFYAGTHGQSYRNKAQTALDNGIALFATEWGTVNADGNGGVNINETDAWMAFFKTNNISHANWALNDKNEGASLFTPGGSWNSLTSSGSKVKEIIQGWGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cellulase
molecule tags Hydrolase
source organism Pseudoalteromonas haloplanktis
publication title Structure of a Full Length Psychrophilic Cellulase from Pseudoalteromonas haloplanktis revealed by X-ray Diffraction and Small Angle X-ray Scattering
pubmed doi rcsb
total genus 119
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1tvpA00
3MO4A 4E4PA 4AZCA 2O9PA 2WVTA 1E5NA 2DSWA 4MPKA 2OSWA 4ACZB 5A2BA 4D72A 2EO7A 3B9DA 5CLTA 3DHPA 4JKKA 1KGWA 2YDSA 4OBSA 1UH4A 1CXIA 4J7RA 1J11A 3SUTA 2CHNA 3SCWA 4JFVA 2BXYA 1E6ZA 2PF0A 1VFOA 1OD8A 4LPCA 3WH7A 5DO8A 4C7DA 5M17A 3GXFA 4LYPA 3BSHA 1W3LA 3ARTA 4U2ZA 2E8YA 2V38A 1NP2A 3ALGA 5C71A 1H3GA 1H09A 3MSDA 2FHBA 4ZEPA 2EPMX 1ZBCA 4JHZA 1UQYA 3VD7A 4BZYA 1J01A 1E3XA 3T2PA 4MDPA 1AQHA 1BLIA 2WYSA 5AYIA 1KGXA 6CGTA 1E15A 1EQPA 3II1A 5CLWA 2PWDA 4AXNA 3VDAA 2CYGA 4D6EA 2VL4A 4HPGA 3ARVA 3BMWA 2EPLX 4ML4A 4UTFA 4JL2A 3L2MA 4LX4A 4XV0A 1D2KA 4MB4A 4LXFA 3CUHA 2JIWA 3WH8A 3WN6A 1JF5A 1I75A 1V0LA 3AMKA 3QR3A 3GXDA 5EB8A 4M80A 3G6MA 5M3WA 2WMKA 3WF3A 1MVYA 2VURA 3A3HA 2JEPA 3FNDA 4PUEA 3W37A 3OB8A 4RE3A 1V3IA 2XFRA 3VIHA 1R87A 3UESA 4AD0A 1JZ5A 4ZXOA 1AMYA 1QNOA 5GNYA 1UR4A 1DEDA 3WEOA 4UQAA 1OGSA 3J7HA 1K6AA 3SCNA 1GZJA 5D8ZA 3AS2A 1KXTA 2G4FA 1XD1A 1UWQA 3RM9A 4PEEA 1G0CA 2CCRA 3SURA 1OGGA 2W5FA 2XTKA 1R7OA 4AMCA 4CD6A 4EE9A 3OGVA 1ZS2A 1PAMA 3B8SA 2PWFA 1WDQA 2W62A 1SMAA 3TP4A 2EPKX 1KXHA 2FHCA 1VFMA 1TE1A 1V3MA 2WMJA 2WBKA 3WDJA 1XC6A 3NIYA 1JZ2A 2YIHA 4GO9A 3ZOAA 4BCEA 2ZE0A 4PMNA 4GXPA 1H0IA 1MQQA 1GNXA 1GQJA 1XYFA 1S46A 1WE5A 2YKKA 2XVLA 3HMCA 1R86A 5HBFA 3K8KA 2VX4A 3PZTA 3UG4A 3KZSA 2EQDA 5DMYA 5HOSA 3K1DA 2OWCA 4HOWA 2BY3A 4PMYA 3A6OA 4PCSA 1UR0A 1MW3A 4A4AA 4D6CA 2JEQA 1VBRA 1VB9A 2DSVA 1CPUA 1IT0A 2VI0A 3D5HA 3GNRA 3OGSA 4AEEA 3S2CA 4V27A 2XSBA 4BQ5A 4NZCA 5ECUA 1UZ1A 4HZ7A 4AZIA 2J7BA 3ZO9A 2V5CA 3MANA 4BQ3A 3VDBA 5A95A 1GQLA 2FGZA 2D24A 2EXOA 4UFKA 4F66A 1FA2A 3GNOA 1W9VA 1J9YA 1DWAM 3NUKA 1E5JA 1RH9A 4EANA 4W8LA 5A8OA 3N9KA 1Q6DA 2WXDM 1C7SA 1OWQA 3ARWA 4B16A 3W0KA 2WC3A 1W3JA 4CVUA 2OWXA 3VVGA 4AD3A 4PMOA 3WBAA 1KWGA 4PTVA 3VIFA 3O9NA 3WQ6A 2J7DA 3TONA 1OGBA 4AY1A 2VTFA 4S3KA 4FLQA 1KXQA 5A94A 4KWUA 1VBUA 1WDSA 4CD7A 3VPLA 1J0JA 3ZIZA 4FLOA 1FOBA 4QLLA 3ARYA 3CUFA 4KGJA 4W5UA 2B31A 3AIWA 2XFYA 5FL1A 1GQIA 2J47A 3A4XA 1GCYA 2E9LA 2G41A 4JCLA 5A2CA 4OOZA 1D7FA 3MMDA 4C7GA 3CLWA 2GJRA 3MUIA 4CCEA 3T0DA 3WNLA 1QW8A 4A3YA 4S3JA 5ABFB 1B3ZA 3WEZA 3AS1A 5DT5A 3VD3A 3WY1A 1BYAA 3VMNA 5BYWA 2GJXB 3HN3A 2UWFA 4YN5A 3WENA 1QI0A 3NDZA 3GH5A 2YA1A 1B90A 2ZUTA 4XZWA 2ZXDA 1V6WA 4P7NA 1RPKA 1ODZA 3BCFA 1U33A 3CTTA 2YLLA 2X8RA 2XJ7A 2Y4SA 1IZKA 2V5DA 3QOMA 1D3CA 4UZSA 5I0DA 2PI6A 1HJSA 3T0BA 3WF1A 1VF8A 2J7GA 3KWXA 3PZ9A 1GOWA 2ZOXA 2VNCA 3PHAA 3WKZA 5JBFA 4AZ5A 4IISA 1TCMA 3JUGA 1KGUA 1QNRA 1UWSA 5I3DA 1VEOA 2VRKA 2D23A 1XV8A 1I1WA 2W61A 3BLPX 2J7EA 2DEPA 3NSNA 5D9OA 2CETA 4U2YA 4J3WA 1QHOA 1V6YA 4R5EA 4TVDA 3CZEA 3NSXA 1ZBKA 5C70A 2GDUA 3EMZA 5ABGA 1UWIA 1OBAA 3CUIA 1V08A 2XFFA 4IUGA 3AROA 3FHAA 1BVNP 4JFSA 1BAGA 4H7VA 1BG4A 1EDTA 4UFJA 1UG6A 3CGTA 1TUXA 2BY2A 2WVSA 5D9PA 1AQMA 1HKIA 3BLKA 1W32A 5EFDA 4QLKA 3U5UA 1E56A 1HKMA 3VKKA 3MUY1 4N0RA 1GHRA 2X0YA 5FD0A 5AC5A 4M56A 3AJ7A 1R8LA 1CEOA 4MNMA 2ESCA 3VGDA 2V3FA 3M7SA 1PX4A 3ZJ8A 3DYMA 5IXEA 2DQXA 2DH2A 1BGGA 4AISA 2Y8VA 3T09A 4M1RA 1BGAA 3AIQA 3NJ3A 4B3LA 3W82A 1W91A 4JKMA 1E40A 3WL0A 2WAGA 3KL3A 2WWCA 4UQ9A 2G3IA 2BXZA 3LPGA 2XVPA 2CHOA 3PZVA 4ACYA 1U2YA 1V3LA 4HU8A 3VD4A 4PMUA 1IZJA 1UOKA 4WKHA 5BROA 4MTVA 4F9JA 1OCQA 1JXJA 4UQDA 2ZWYA 4OUEA 4DUXA 4AC1X 3ARUA 2YBUA 3N11A 1E3ZA 1KR0A 2YA0A 2PBGA 4UR9A 1WPCA 2Y24A 4H8UA 3SCSA 3WQVA 4MB3A 2Y2WA 2EBNA 2GK1B 3WUBA 1NOUA 3ARRA 5E70A 5CPQA 3VGGA 3AXXA 1JD9A 3WFZA 1HL8A 3AZSA 1DWJM 4U3AA 5JBEA 2DDXA 1W9DM 5CGMA 4QDMA 5A1AA 2XM2A 4AZ7A 1BHGA 3PN8A 1CYGA 5ABEA 4AIUA 3FAWA 4MJ2A 1E6SM 4Q7NA 1K9TA 6A3HA 3TTOA 4HOXA 7A3HA 1E6XM 4GZJA 1JDAA 1QI2A 1WDPA 3VMPA 3RM4A 4D6DA 3N13A 1M53A 4AD4A 3VGFA 3VDCA 3AHYA 1G9HA 2J74A 4HOZA 1P6WA 1ISWA 1TVNA 1PIFA 3NSMA 2WPGA 4ZE5A 3W81A 1CXFA 4UFHA 2VX5A 1WDRA 4F8XA 2VRJA 3RJXA 4AYSA 1GW1A 2E9MA 3OLGA 4DUVA 3CZ8A 3IAPA 2J8FA 4WJXA 3UCQA 3NYDA 1ITXA 4LGXA 2DT1A 3UG5A 4WSJA 3POHA 1BPLB 3WD1A 1NWSA 4NF7A 2F61A 2HVMA 2OSYA 2Q8XA 1MW2A 1W1PA 2YLAA 4HA4A 4HZ8A 2WC7A 3KE0A 1EOMA 1YQ2A 1CLXA 1MW1A 3FAXA 3GDBA 5E6YA 1VFFA 3CH9A 3IK2A 4YHGA 4AZ6A 1XGZA 2WKLA 1M7XA 2AMGA 1Q4NX 3TA9A 2UY3A 4JL1A 4ZXLA 2GK1A 1Y7VA 3M6DA 1UA3A 3LPOA 2RGMA 1B3YA 3AQUA 3OLEA 1HP4A 1NP0A 2GFTA 4D1IA 2D20A 1PIGA 1JG9A 1E4MM 2ZUNA 4W8BA 4M8UA 1QHZA 3PZIA 1UKSA 3ZT6A 5A8NA 3ZQ9A 2AOSA 5I24A 1VJZA 3OZPA 4CN6A 2V3GA 2XUCA 2J79A 4OKDA 1TZ7A 1HJWA 1W9XA 2WC4A 3ARZA 4EAMA 4OBRA 3VM7A 3K46A 3TTYA 3B9AA 3ZMRA 3CMGA 2JF6A 1A47A 4MNJA 2WHJA 3S6TA 3EMCA 1I1XA 3EBVA 1DWIM 3BAKA 1LL4A 1JYWA 4H41A 2G3NA 2PWHA 1PBGA 2EPNA 3EYPA 1JIBA 3TOPA 2XGBA 4AD2A 2CKRA 1UWTA 1B3XA 1X6LA 3LPFA 1GJWA 2W91A 2CPUA 2BVDA 1WKYA 3GNPA 4TVCA 3L4XA 4BA0A 2WWDA 1E71M 1ZJBA 3RILA 1MYRA 3RCNA 1E72M 2X1IA 2VMFA 1CIUA 2O9RA 2WHMA 2XG9A 3VGBA 1OT1A 3IJ8A 4URIA 4D6HA 2A3BA 4JFWA 3T08A 2J78A 4UQBA 1E0WA 3THDA 1KBBA 5BRQA 1WAWA 3BAJA 1QNQA 4PRWA 4GKLA 3AIEA 1CBGA 1JDDA 1UHVA 2WBGA 1K9EA 3ZM8A 1CWYA 2Z1KA 1GVIA 5CZKA 4WIWA 1BTCA 2VQTA 1BYBA 5CXPA 2VO5A 2A3CA 3CUJA 2PC8A 4XUYA 1JAKA 1EOKA 4A3HA 3QHOA 5CPTA 4PN2A 3QGVA 4PTMA 2G3MA 3AMLA 3CHFA 1MQRA 1G01A 2O9OA 2J62A 1FFRA 4P7RA 1UQZA 4CUCA 4YPJA 3OIHA 5IFPA 4XB3A 5A6KA 3SUWA 2QLYA 1CXHA 4CKQA 4QFUA 2DGAA 3WNMA 5IDIA 2XPKA 4Z2HA 3OG2A 4W86A 1HJQA 2JIEA 4PMXA 4DWSD 2DT2A 3A47A 1HN1A 1JAEA 4GZEA 1QBBA 2VCCA 2QV4A 1QOXA 5BRPA 1JDCA 3GXIA 1C3FA 3BCDA 4DWSA 1WP6A 2WW5A 1NH6A 4KRUA 2VZVA 1PX8A 4D6FA 3GYCA 3WMCA 4D6IA 2V3DA 3MMUA 2W67A 1UD2A 3AHZA 3VMOA 1E1EA 3MV11 3LPPA 3ARPA 4GI6A 1W1TA 4RE2A 1CXKA 3RMEA 3BXWA 4J27A 3VIOA 4W7UA 3WDPP 2ZUVA 3W25A 4QLJA 2FHFA 1IV8A 2VZUA 2ZUMA 7TAAA 1DWFM 1NWRA 1G1YA 3DYOA 3WF2A 5A8PA 1E6QM 4CD5A 2WMFA 5KZ6A 4U5KA 1K9DA 5EFFA 3VIKA 4AD1A 3VNYA 3PZGA 4FK9A 5BXTA 1E55A 5E0CA 2EPOA 5A8MA 2D1ZA 3F4VA 5HDRA 2BHYA 4AWEA 3DYPA 3UG3A 4Z2LA 4OJYA 5A3HA 1QNSA 7CGTA 1US3A 1GORA 4OIFA 5CPSA 1FH7A 3AHTA 4Z2IA 2GSJA 3MS8A 4B9ZA 1BVZA 1OINA 4WF7A 3AS0A 3RPMA 1HVQA 1OB0A 4H8VA 4U31A 1TA3B 3GZAA 4EKJA 2BFGA 2WVVA 3I3EA 2WVVB 2Y5EA 2W66A 1HKJA 1JFXA 1MFUA 5LA0A 3W6MA 3DECA 1JL8A 3VIJA 2WNWA 2CESA 1LF1A 4L4PA 1C8XA 4R27A 2CBVA 2VJXA 2YBTA 2VC9A 2Y8KA 1PZ3A 2GUYA 2VZTA 5F7UA 3VO0A 1C90A 2QMKA 1UD4A 3GM8A 3WEMA 1CGWA 1LG2A 4W7WA 1RD6A 1SYTA 2YL8A 3QHNA 3N15A 1SMDA 4W84A 5TD4A 3WIJA 5JIPA 3WDHA 1JI2A 2D0HA 2VR5A 3WELA 4P8XA 1V6VA 4KMQA 2WM0A 1HF6A 3UR7A 2ZWZA 3WNPA 4Q22A 3AICA 3SUVA 1KFWA 1E4IA 5A2AA 1CGYA 1H49A 5A6SA 2AAAA 3RDKA 5JBDA 4W8AA 1UZ4A 5GPRA 3W27A 1UKPA 3SUUA 2BVTA 5A6BA 2WCAA 3TTSA 3WH9A 4D1JA 4LYQA 1JZ7A 2OWWA 2PWGA 1GVYA 3VD9A 4V2XA 3L2LA 3L4VA 1ZU8A 1XSKA 1C8YA 2WMIA 4CU6A 2W63A 5GNZA 4CCDA 4PSRA 2UY5A 1EO5A 3AZTA 3KL5A 4LYRA 2XIBA 4KH2A 4PTWA 1DWGM 4D71A 1ZBVA 1DP0A 1HL9A 3U57A 4UOQA 1BQCA 4TUFA 3BAYA 3VD5A 2XVNA 1DHKA 4CD4A 1VJSA 1UWRA 5IFTA 3VIGA 1B31A 1TFVA 4PMDA 2UY2A 4XZBA 2DIEA 1KWKA 3RJYA 3PZUA 1US2A 2WHKA 2WMIB 1HIZA 1NOFA 2TAAA 5GNXA 4RE4A 1WO2A 1JYXA 3PZOA 4EK7A 1TR1A 2BHUA 4WSKA 1GOKA 4GINA 1CECA 1GOMA 1K9FA 5I79A 1NWUA 1E9LA 1JF6A 1SFSA 5A6BD 1DTUA 1KB3A 3WBEA 5DT7A 3W53A 3TTQA 1XSJA 1LL7A 1O6IA 3FY1A 2CBJA 1J0ZA 1KCLA 3MUAA 3I3BA 4Y7EA 2D0FA 2OSXA 3OLIA 1Q6GA 8A3HA 1JZ8A 3MU7A 4W7VA 1HX0A 3RIKA 5D8WA 4PSPA 3PBGA 3M07A 5D4YA 2DT3A 3AYRA 1C7TA 4FF5A 1WZAA 4AEFA 1QW9A 4J3VA 5E9AA 5AYBA 2CBUA 3U7BA 4P8UA 1JYVA 3FHQA 2DSUA 4JKLA 2YJQA 2CNCA 1UKOA 1C8QA 1L8NA 1W2PA 4GO8A 1GJUA 2VCAA 4W85A 3APGA 3T2OA 1OSEA 4AZGA 4ATWA 4WLCA 1V02A 3AHVA 1JNDA 3GH7A 2PB1A 2WCSA 4AIEA 4AZCB 2D0GA 4UCFA 1OT2A 2CERA 5LYRA 3IAQA 4P8WA 3F5JA 2G3JA 3AI0A 1PEZA 4TOQA 1FHLA 4MB1A 1RP9A 3A4WA 3BAXA 2WMGA 1CNVA 2YDRA 1J0KA 2IXVA 1QHPA 4QCFA 1G94A 3FXYA 4UOJA 4H8HA 2WHLA 5I5RA 2C8NA 3AZRA 5HPCA 1H11A 2VX7A 3VIIA 4GQQA 1YHTA 1HNYA 2ZXAA 5E09A 3L4ZA 1E70M 3GBDA 2BV9A 3FW6A 4ATLA 4E8DA 1KQZA 1CGUA 2YL5A 2ZX9A 4CU7A 2XVKA 3AHXA 4TTUA 2VR4A 4BQ2A 4H2CA 3SEPA 4TXEA 1ECEA 2CKSA 1R7AA 2W92A 1QI5A 1W3HA 1V3JA 4UFLA 1JGIA 3UEQA 3K8MA 3AISA 3BAIA 3MMWA 1GQKA 1UKTA 4MDOA 5BCAA 3W38A 3VU2A 1NQ6A 3ARQA 1GPFA 1TVPA 4DM2A 5HNNA 1E6PA 3KL0A 1EIBA 4X0VA 3SIMA 4BF7A 3BGAA 4CN4A 3CUGA 1V0MA 2BVYA 2VUYA 4MAVA 1EA9C 4NRSA 4J3UA 3G6LA 4PUDA 5D9NA 3FN9A 2RGLA 1KQYA 3WQ8A 5I23A 1XD0A 5FIPA 3MKKA 3VNZA 4X0NA 1V03A 5I78A 4JCMA 3WDQA 3ZSTA 1FH8A 1UD6A 2ZUSA 2IUZA 4PCTA 3BSGA 2XM1A 3UETA 3PZMA 3W6LA 3WL1A 1LG1A 4TX8A 4WK9A 2FH8A 1UR1A 4MB5A 3SCVA 4P7LA 3WQWA 3K8LA 4F79A 2WZHA 3WH6A 5LA1A 5M5DA 4IPLA 2VOTA 1LLOA 3WNNA 2J75A 3VDHA 4HTYA 2JALA 4MAZA 2D2OA 5I77A 1QPKA 1WZKA 3WFLA 2JFEX 3WD0A 1XHGA 1J10A 2XWEA 4NSBA 4HMEA 4ZFMA 2W4XA 2OYLA 5GQBA 1GONA 3GBEA 3WF4A 4AW7A 1UA7A 1C91A 2X2YA 4ATDA 3PTMA 1M01A 3MV01 2GVYA 3CHCA 4PTXA 2BNJA 3AS3A 3WNOA 1L0PA 1BFNA 3WUFA 1ISVA 1B3VA 3UR8A 1HKKA 1KXVA 3K4AA 3EDJA 2NT1A 2YOCA 1V6UA 1NOWA 1VIWA 3O6AA 3CZKA 3ZJ7A 1HT6A 3L4WA 1W1YA 3CIVA 1FP8A 3CO4A 5D9MA 4AIOA 1FP9A 3AMCA 1UKQA 2A3HA 4DM1A 2O92A 1M04A 5EBAA 2YA2A 3IANA 2QHAA 2CIPA 3HU7A 5FCZA 4J28A 2GJPA 4JHOA 3AOFA 2V3EA 5CG0A 1VENA 1W9UA 3VGHA 4ZE4A 1X1NA 3VOCA 5DF0A 2J8GA 1CGTA 1LL6A 3M46A 1JD7A 3AIVA 1Q6FA 3ARSA 3WMSA 2XVGA 1ZJAA 3OZOA 2E9BA 4PYSA 4JFUA 1WZMA 2NW0A 3WUGA 1MW0A 5CSYA 1V02E 4U33A 3MSGA 4P7QA 4FLSA 2ZXQA 3WUEA 2UY4A 2J4GA 1HP5A 1UR9A 2C7FA 1XSIA 3VIMA 1X6NA 3RO8A 1FFQA 1W9BM 3VGEA 1FH9A 4W89A 1VEPA 1UD3A 3OGRA 2IXUA 2J7CA 2FH6A 2ZUWA 1VRXA 3O2LA 1H41A 4H04A 1NWTA 4M24A 1E0XA 4P8VA 3ZT5A 1JXKA 4AZHA 3GH4A 5JUVA 1SR0A 2WZEA 1H0GA 1MQPA 4LQ1A 3AYSA 3OBAA 1J0HA 4AD5A 5C8BB 4ZENA 1XH1A 4UFMA 3ZT7A 4HMDA 3AIUA 4ACZA 1C93A 1HJUA 1EO7A 3EDKA 3EDFA 1UR2A 4X9YA 1B2YA 5E0FA 2XWDA 1EGZA 1MFVA 4M29A 2NT0A 3N18A 1MXGA 1JI1A 4Z2GA 3BC9A 1AQ0A 1TG7A 3KEHA 3PZNA 5IHSA 2QPUA 2DT0A 4W5ZA 2FDMA 2QPSA 1EHNA 2E8ZA 2F2HA 3N1AA 1CLVA 3OLDA 4GZIA 2QF8A 1VAHA 4NI3A 2WANA 4IPNB 4UNIA 3NDYA 1TA3A 1UH3A 3GTNA 1DWHM 4FMVA 1BYCA 1ZB5A 2E40A 1XH2A 3WH5A 4CVWA 1ESWA 5KEZA 2E3ZA 2JE8A 5A6JA 3WDIA 1QBAA 1XCXA 2EEXA 3U5YA 2ZICA 2ZIDA 1GUVA 3ZJ6A 2BS9A 3B9EA 2VT0A 3CPUA 2WZIA 3VM5A 3I3DA 1B3WA 2D3LA 1LWJA 4D6GA 3BAWA 1NARA 5ABFA 1GHSA 1E4NA 2D22A 3CZGA 1W9PA 2BY0A 2EJ1A 2WKGA 2WB5A 4E2OA 3N17A 4JAWA 5DEZA 2VRQA 2FGLA 2WVUA 1V0KA 2WLZA 4JZ5A 3MUZ1 1PPIA 1W1VA 3HJEA 3D3AA 2F8QA 1PJ9A 3T0AA 4HA3A 1OIMA 5FKYA 2DSZA 1HJVA 3ZJKA 2X05A 1H5VA 3WD3A 3VX0A 1EH9A 1B9ZA 2VZOA 4FLRA 1OM0A 3PTQA 1EQCA 3PTKA 4WKFA 1UD8A 3BMVA 5CQ1A 3AMGA 3T2QA 3CZJA 4B9YA 3W24A 1HJXA 1NM9A 2DH3A 4W88A 3WD2A 4JFTA 5E6ZA 1UUQA 4UQEA 1TMQA 3L4UA 1GOIA 1E4LA 3IJ7A 3SCQA 3ECQA 2XSAA 3PZQA 4HA1A 2E4TA 4Z2JA 1ISYA 1XCWA 1UR8A 1XH0A 3BH4A 8CGTA 2J77A 4D6JA 5HXMA 4BS0A 5I2UA 1HXJA 4UZUA 5A69A 1CGVA 3AFBA 3ALFA 2OYKA 5ABHA 3VTRA 4HMCA 2O9TA 1KCKA 2G8ZA 4HP5A 1J12A 3AIRA 1UYQA 5I6SA 2BHZA 2VX6A 1VEMA 3ARXA 4PMVA 1XRVA 4CU8A 1OD0A 2CBIA 1VFUA 1WZLA 3SCUA 4GQRA 1Z32X 1W2VA 9CGTA 3ZSSA 1GOOA 1J0YA 1KBKA 3OA5A 1H2JA 2XHYA 5LA2A 5BWFA 1MWOA 3SCPA 1MXDA 4IM4A 1QNPA 2ZX5A 4CD8A 1CXEA 3VIPA 3ZR6A 5A6LA 1OIFA 3A4AA 2MANA 4CGTA 4E8CA 2J25A 4P7OA 2WK2A 1EDGA 1LWHA 1AVAA 2WMHA 1C92A 3AIBA 4V28A 4U5IA 2OLHA 1CTNA 2X0HA 4YHEA 6TAAA 2VCBA 1BF2A 3ZR5A 2GDVA 4QP0A 1E73M 3EDEA 4PMQA 2YL6A 1JYNA 5IHRA 1J0IA 2YDQA 3CHEA 1ZL1A 4HPHA 4GI9A 4PMZA 3L4YA 4KRTA 3WQ4A 3THCA 5FOOA 2ZUUA 3POCA 4DUWA 2J7HA 1V3KA 2VVSA 1QVBA 3WSUA 5FL0A 2ZX7A 4GIAA 2WSPA 1WNOA 3W26A 4MNLA 1UH2A 2XGIA 1EXPA 3SCTA 1W3KA 3CZLA 1JZ4A 2CXGA 4PMRA 1CDGA 4U3CA 3W29A 1BSIA 3RM8A 5EMYA 1V3HA 4J3TA 2WSKA 4BQ4A 1HVXA 2J7FA 4L4OA 1GOQA 3VUPA 3W28A 1KR1A 1B1YA 4AZBA 1V6XA 3U7VA 2PBOA 4UFIA 5BXSA 4OOUA 4J3XA 4UQCA 5CGTA 4W93A 3F5LA 1A3HA 3SCOA 2OYMA 4B15A 1H4PA 5BXPA 3EDDA 4N42A 4QAWA 2PWEA 4PBGA 1UWUA 1QI4A 1B30A 3QHMA 2VVNA 1E1FA 2YL9A 3W4RA 3DC0A 1ITCA 2WLYA 1M03A 2DPEA 4TVUA 2X09A 5BXRA 1J18A 4MJ4A 1CXLA 2NSXA 1E43A 3E1F1 2GJXA 3WF0A 2A3EA 2Z1SA 2DIJA 3LMYA 2JF7A 4J3SA 1QI3A 5AY7A 1XYZA 4M82A 5A6AA 4TX6A 3WNKA 4W87A 2DSKA 1R85A 3SCRA 3N12A 4GI8A 1E6NA 4DWSC 5A8QA 2XYLA 1RP8A 4F9DA 4QCEA 1WCGA 2E0PA 3L4TA 1G5AA 2A3AA 1ISXA 1LJYA 1PX3A 2C0HA 3IJ9A 2ZX8A 3QOKA 4M81A 3EMQA 4XX6A 4Z2KA 1UD5A 3F5KA 1F4HA 5JIWA 4K68A 3AXHA 3WD4A 1EHAA 3K4DA 5CJ5A 1JNEA 2ZX6A 4B3KA 3NCOA 1CGXA 4KGLA 3WMBA 5CSUA 1N82A 2D3NA 1E6RA 2QMJA 2XIIA 1CENA 1ODUA 1E0VA 4RL3A 3GXMA 4HZ6A 1ISZA 1ZBWA 3VILA 1U30A 5A6MA 1CZ1A 3CHDA 3CMJA 4NRRA 2BY1A 4HU0A 4TTGA 2CEQA 4GPNA 4UOZA 1JFHA 3WQ5A 3VINA 3CBWA 4DWSB 5DFAA 1PZ2A 3SUSA 3AMDA 2VZSA 1H1NA 4CN1A 3UERA 4MADA 4CCCA 4WKAA 4MNKA 1B0IA 3DHUA 1EDQA 2VQUA 1JZ6A 5HPOA 1WB0A 1Q6EA 4C7FA 5AC4A 5M03A 1LQ0A 1FHDA 3AXIA 4JIEA 1F4AA 2HISA 1BYDA 1V0NA 3VX1A 2CITA 1Q6CA 3WDRA 2WCGA 1BG9A 2ZXBA 4OZOA 1JZ3A 3N04A 1O7AA
chains in the Genus database with same CATH superfamily
3MO4A 1XKYA 4MPKA 3W1AA 5A2BA 4B5VA 2EO7A 5CLTA 1KGWA 2MUCA 2YDSA 1J11A 1EGMA 4C6QA 1NTHA 1M6JA 1SR9A 3NXFA 2BXYA 3EX2A 3LLDA 1UZHA 4XZHA 1WKEA 2GGGA 4BJHA 1XLLA 2E6DA 2POTA 1I2QA 2E8YA 4A8IA 2V38A 1GOXA 2XN2A 1R2RA 4G56A 1H3GA 4M0XA 3R8GA 4H7ZA 3SADA 2EPMX 2W27A 1UQYA 1U5HA 4BZYA 1AODA 4BI6A 4MDPA 3UY7A 1AQHA 1BLIA 1KGXA 3MHGA 1E15A 1A3XA 2PWDA 2QW5A 3L68A 3VDAA 2CYGA 2OR2A 1K4HA 5FEZA 4D6EA 2VL4A 4KERA 3P60A 3G0SA 4UTFA 3EEGA 2DZVA 3HTWA 3NQMA 3WQEA 1I75A 2CLOA 5HQMA 3AMKA 3PR2A 3G6MA 2VEFA 3P0XA 1XS2A 3GW0A 3OBKA 3WLSA 5G2WA 3LQLA 4PUEA 3E2VA 3C0JA 1F3XA 2Z0IA 3SR7A 3R1ZA 1L6GA 4B4HA 5GNYA 1OZMA 1G4EA 5F4WA 2BOGX 5AZ1A 4PCNA 4MPQA 1DEDA 3WEOA 3UZWA 1OGSA 3J7HA 2Y1HA 3GTXA 1ZCCA 1KXTA 2I16A 3FV9A 5H2ZA 1AD4A 1G0CA 2CCRA 2QUTA 4DBUA 3LOTA 4X22A 2HBXA 1FWCC 2BOEX 1R7OA 1ZS2A 2QULA 4G2DA 4NNBA 2PFHA 3V4BA 3W88A 4F2UA 4JYEA 1SMAA 4GX8A 5LGXA 2X0SA 5G4EA 2EPKX 2FHCA 2QDEA 1TE1A 1V3MA 3T44A 3O15A 3STFA 2RDWA 3H2EA 4GO9A 2HVOA 4GXPA 1MQQA 1GNXA 1GQJA 1AK5A 2O7QA 3VE9A 1WE5A 2VFHA 4IICA 1PKNA 1MEIA 3HMCA 4O0KA 4L1WA 4I5XA 2BZNA 3UXIA 3KZSA 4L64A 3M0HA 1D9EA 4Y2WA 2XGZA 2OWCA 4HOWA 3IACA 4QTGA 4JTIA 4K38A 3BL3A 4A4AA 4D6CA 1VB9A 1IT0A 3P82A 4NZCA 5ECUA 3TQ0A 1UZ1A 3B0YA 1GG1A 3BOXA 1V5XA 2J7BA 3ZO9A 3ZLGA 1XIIA 3QV7A 4UNLA 4BQ3A 2F6KA 1GZGA 3CHVA 3W75A 2FGZA 5HNTA 1CT5A 4C6PA 5AHMA 4NJGA 4OU1A 3GNOA 3VOHA 3UYIA 3P81A 1OABA 1DWAM 3NUKA 1E5JA 1RH9A 2ATSA 2UBPC 3M0VA 4HNLA 5A8OA 3N9KA 3S42A 1C7SA 4B16A 4H3DA 3LEPA 2WC3A 2FQIA 2OWXA 1AQFA 1BSLA 1ZAIA 3UZZA 2QS8A 4XAFA 2QJMA 3PPFA 2GUBA 4AY1A 1FWDC 4FLQA 3A9IA 4EPDC 3QPEA 4CD7A 5BRBA 3EZ4A 2BODX 2FFIA 2B7PA 3ZIZA 1BXNA 4LCRA 3ARYA 3TW6A 3CUFA 2GVGA 4AUBA 4KGJA 3RFAA 4W5UA 2E25A 3ZVHB 5CJNA 4ZQCA 1TPB1 4HPNA 1JGMA 1GVOA 3MUIA 4KCWA 3WY1A 1SJAA 3IGXA 1IR2A 5BYWA 4MWAC 3HPAA 4LS1A 1B90A 2ZUTA 5LNSA 1V6WA 1IXNA 2E28A 3RF9A 3CTTA 3EWUA 2V69A 2YLLA 2XJ7A 3TQPA 1IZKA 3CLMA 4HSNA 4UZSA 5I0DA 1VF8A 3DUGA 2QQ6A 5C2GA 4E3TA 3EPNA 4B5SA 1TSIA 4Q4OA 3K30A 5CG7A 1TCMA 4Q4RA 1UWSA 1VEOA 1O1ZA 1F6KA 4A29A 3H2OA 1I1WA 2VEPA 4Q8MA 3NSNA 3DN5A 1QATA 4IGMA 4U2YA 3NGJA 2O56A 3O63A 1V6YA 1OFOA 1DHPA 4R5EA 4ZQRA 4YTRA 3CZEA 3QSTA 5IOBA 1ZBKA 2OZ3A 5I3GA 1OBAA 2QAFA 1R38A 4QDWA 1V08A 3EOSA 1EJWC 4O12A 1BG4A 2PE4A 4J4KA 3HG4A 4L80A 3CGTA 1TUXA 2XH7A 5BMWA 1AQMA 4JIPA 3BLKA 4FX8A 5EFDA 4QLKA 5CBJA 2W79A 3JRKA 1HKMA 4N0RA 2X0YA 2E6FA 2R82A 4RDYA 4M56A 3L67A 1Q13A 2PAJA 3VKDA 4AFYA 3ZJ8A 2NV1A 3DYMA 3RPTA 4C65A 3HA1A 4HHMA 1BGAA 3NJ3A 4B5XA 2XZ9A 1F9CA 2OZTA 5M2FX 1DJHA 3W82A 5DCDA 2ZCGA 4PZVA 4DZAA 5D2YA 4UTUA 4RZ6A 2GQ3A 1MRAA 2P53A 1X39A 4JQ4A 5FF0A 3LPGA 1DYSA 2D73A 1V3LA 3VD4A 4UTWC 1Z7AA 4JIRA 5FJTA 1P7TB 4S3CA 1XKJA 3C0QA 2IKIA 3BZJA 3WLTA 1KTNA 2QCLA 4AC1X 3ARUA 4ICNA 2TMDA 1E3ZA 4OV9A 3RUBL 4US5A 4JEQA 2JKAA 4FOUA 3SCSA 2Y2WA 2EBNA 1AH4A 3UJEA 3WUBA 1NOUA 5E70A 3CYVA 1JD9A 3IWPA 3WFZA 3TXVA 1EB3A 4U3AA 1X98A 2VFGA 2CZ5A 3MKVA 5A1AA 1GVRA 2E1DA 3PN8A 2PLKA 1CYGA 2IPGA 2NQZA 3FAWA 4MJ2A 4HK5A 1K9TA 4N9DA 3MDUA 4KIEA 1Q63A 1F73A 3TA6A 3B8WA 4US6A 4MWAD 1FXPA 5HMFA 3NQ2A 1Q65A 1I0BA 3IV3A 4UNKA 1M53A 3VGFA 1G9HA 4HOZA 3KVLA 4I8DA 1KO0A 2WPGA 4ZE5A 3V5FA 1YTKA 2ZE3A 3MWAA 3SY8A 1DJQA 4L9XA 2E6YA 5AHNA 3KBWA 4WJXA 3NYDA 1BXCA 2DT1A 4K2SA 3UG5A 4K3ZA 1FDZA 1R2SA 1NWSA 2Q8XA 1W1PA 4K7VA 1EOMA 1YQ2A 2OFJA 1CLXA 3F4CA 1MW1A 4OQVA 5AYZA 4PBEA 4B5NA 3KDNA 1XW8A 4YHGA 4FF7A 1M7XA 3JR2A 3TA9A 2C91A 2A6NA 2UY3A 1Y7VA 4EPKA 4HCLA 4XKMA 2CU0A 1HP4A 1GYMA 1BXBA 1E4MM 5FEXA 3C0LA 2ZUNA 2WM1A 4M8UA 1UKSA 2P0OA 3ZQ9A 3KBJA 5I24A 3R12A 3MT1A 4NL1A 4CN6A 2V3GA 3LGDA 4IOTA 1DIKA 2J79A 3NDOA 4GNVA 4OBRA 2W6RA 3F7JA 3P2VA 2V5LA 4QE5A 3B3DA 4AC7C 1XPGA 4XAGA 2C0AA 2A3LA 5TNVA 3W2UA 3WCZA 4MNJA 2PGFA 3EMCA 3GIQA 3OZYA 2VEKA 4PGLA 5DCEA 5LGZA 1LL4A 1ZZMA 4O10A 4H41A 1JYWA 2G3NA 2PWHA 1RLCL 3EYPA 1PTDA 3TE9A 3WG6A 3PJWA 1UWTA 1B3XA 3LPFA 4HNUA 2W91A 1HQTA 2OEKA 3CJPA 3GNPA 4TVCA 1XLIA 4BA0A 4FR1A 1UUOA 3RILA 3H6OA 5T91A 1DE5A 4S3GA 2PDWA 1OFPA 3DFPA 1OT1A 5TAOA 4AVOA 4URIA 2QIIA 4D6HA 3GYEA 3THDA 1KBBA 4GWEA 3PJXA 2ISDA 1WAWA 4QEEA 1QNQA 1TV2A 3AIEA 2PTYA 3W1TA 2V2CA 2PTWA 1XIDA 3RAOA 2ZC8A 1GWJA 1MSSA 2Z1KA 1GVIA 4NAEA 1DJYA 4PRTA 4WIWA 3SZ8A 1EXBA 1O5QA 2ZZ3A 4IP7A 1I60A 5CXPA 1XLGA 4YU1A 1L6SA 1J93A 4EIVA 5LNWA 4A3HA 3QHOA 3AMLA 4F40A 4UTMA 3FYPA 3VI2A 7ODCA 5KITA 2J62A 1FQ0A 3LGGA 4ML9A 4IG2B 5CC3A 5IFPA 3E2QA 3UWQA 3S1WA 4XTDA 3M0YA 5AC8A 1ADSA 1G6CA 4JTSA 4QFUA 4GC4A 1XF0A 4PEKA 5IDIA 1RXOB 2XPKA 4DWSD 3W7JA 3BG3A 3BGJA 1JAEA 1P48A 1XDJA 2ZRVA 4ZSUA 2QV4A 4Y8EA 1WP6A 1NH6A 4UR7A 3E38A 3MMUA 4LUTA 1NJJA 5F2LA 4FX7A 4JNZA 3BXWA 3TJ4A 1QAPA 3VIOA 1XP3A 3WDPP 3UJRA 3P62A 4GVIA 4FEZA 4Z0SA 3LBMA 1KBIA 1IV8A 2ZUMA 1FCVA 2HE5A 5G5IA 4GUIA 1G4SA 4TR9A 1PYMA 1E6QM 3CS2A 4O1EA 1X8FA 2HTMA 4H9TA 3N9SA 2GWNA 3PZGA 2IMRA 1E55A 2EKCA 2WQPA 1ICQA 5E0CA 4FNPA 5A8MA 1I2RA 3LI0A 4Z2LA 3ONCA 2CZEA 3TN3A 4IGNA 5E9XA 1RK5A 7CGTA 2CLMA 1FH7A 2HRWA 3KLLA 3LBCA 1BVZA 1OINA 3UG8A 2ABBA 1AH3A 1DJXA 4H8VA 1TA3B 1KBJA 3M44A 1BQGA 3GQYA 1MFUA 5BWAA 2FPVA 1JL8A 3H70A 3DFHA 3PK7A 2YB4A 1Y5XA 4XD5A 2H8ZA 2E77A 1C90A 1NELA 2ON3A 4GJ1A 3VNIA 2YL8A 3QHNA 5I07A 1YRRA 4M6QA 3WDHA 5JIPA 2YSWA 3BQ6A 3WELA 2PWUA 1M3UA 1NDWA 3WNPA 1VLWA 3SUVA 1KFWA 1KM2A 2NQLA 1G4PA 2A0NA 1LOSA 4IMFA 3TYAA 1A0DA 2J6VA 5GPRA 3RITA 3QC3A 3TTSA 3LM3A 3ENLA 3NQ7A 1KTBA 5T9BG 2PWGA 3UW6A 1TPEA 4L7ZA 2FPTA 3CPRA 2OGYA 3AZTA 2PDMA 5EMKA 1M1BA 1DP0A 1HL9A 2QGHA 4UOQA 1KKOA 4PB3A 3FYOA 2VGIA 4TUFA 4RJEA 3KWSA 3IRDA 4CD4A 4MLJA 3ES8A 4EACA 4QJ3B 2ISSA 1US2A 1NOFA 2TAAA 5GNXA 1JCLA 3PZOA 2CLKA 4KWWA 1PUDA 3KTSA 5KZMA 1GOKA 1K7XA 3LERA 1K9FA 3GR7A 1S5WA 1A5CA 2F6UA 2PC4A 3IARA 2PZ0A 1J2BA 1WA3A 5A6BD 2GOKA 2GVEA 4JIQA 4BK9A 4RZ4A 3R5EA 2X7WA 4KWOA 3TTQA 3FY1A 5CJMA 3AU6A 2CBJA 4K36A 4H7CA 5FJRA 2ZRUA 4HN4A 8A3HA 2ISFA 2P88A 3MU7A 3RIKA 3RCYA 5D4YA 2DT3A 3W87A 1TPUA 1RV8A 4DXVA 3H53A 5EY5A 4FF5A 6PTDA 1EBGA 2VGFA 1SJCA 5E9AA 5AYBA 2CBUA 4P8UA 3CYJA 3RN6A 4WXZA 4JKLA 3GX9A 2CNCA 4L5ZA 1L9WA 4CNTA 4GLEA 2QUNA 2WSYA 4GO8A 3APGA 1SW3A 1NVMA 2HPMA 1OYAA 4NZ1A 2HJPA 4CQCA 2HK0A 2WCSA 1OFQA 2NUXA 4EXAA 1LUCA 1IXOA 4LAKA 5DY3A 3CUXA 4QQ3A 3F5JA 2G3JA 2GVJA 1QO5A 3H2MA 1RP9A 3D46A 2WMGA 2Q09A 2DY3A 1CNVA 2YDRA 2IXVA 3HURA 5PTDA 4ZMGA 2P1FA 4QSHA 1Q2SA 2PMQA 3BLLA 2WHLA 3B05A 4CQ8A 1EJTC 1J4EA 4Q6XA 2VX7A 4XISA 1IXPA 4GQQA 2G5WA 3FW6A 1AL7A 4E8DA 1OQFA 1ZENA 3BK0A 3V0SA 2ZX9A 4QR6A 4M6VA 2PGWA 1YLVA 4BQ2A 2VR4A 2ZA3A 3B9NA 4H2CA 5U7SA 1UC5A 1QI5A 3DBNA 4INFA 4N6EA 1O5XA 2J66A 4DJFC 3DG6A 3DBPA 1JGIA 4H6RA 3UEQA 1K1DA 3AISA 3ZYZA 1GQKA 4MDOA 1F3TA 1GPFA 1TVPA 4JYFA 3EPMA 3KL0A 2J9XA 3SIMA 5I3IA 1JCYA 3ZWSA 5G4HC 4JDBA 4Q8WA 3BOLA 2RGLA 3PB0A 3WLJA 3TWBA 2QGYA 2QCFA 3LB0A 5FIPA 2A79A 3VNZA 1LRTA 1XDLA 4JCMA 3USZA 3ZSTA 1ME7A 3TR2A 2Z4GA 2XIJA 3W7HA 1WUFA 2GSHA 3LX9A 2PDFA 3PZMA 1Q66A 1XLFA 4MB5A 3SCVA 4P7LA 4JOMA 5B7YA 3KBNA 3HB9A 1XG3A 3I7RA 2J75A 3VDHA 3OQEA 2EG7A 4OVXA 1SZRA 1AUSL 4KESA 4ZOAA 1J5SA 4EPEC 3E0VA 1PKMA 1R2TA 3LG3A 4LOCA 4O8AA 1GVQA 1WDWA 1GJPA 4AW7A 1UA7A 4DXXA 4DI8A 1P7TA 1J6OA 1M01A 1TWDA 1H1YA 3E5PA 3B0VC 5FAGA 4GY1A 5J04A 1YNPA 3AS3A 3EB4A 4RPQA 1L0PA 2AL1A 3DKLA 1ISVA 2PODA 1B3VA 3HF3A 4GABA 3EDJA 1KRCC 4IIFA 2FVLA 3O6AA 3L0GA 2PP3A 4R33A 1KM3A 1HT6A 3HQ1A 3LY0A 3ZFHA 3L4WA 1W1YA 3CIVA 4QRNA 3F4DA 3QGKC 2A3HA 3U8GA 4S3EA 4IIHA 5IBXC 4XAYA 2YA2A 1XLBA 1OADA 2YFNA 4S1FA 2A2IA 1VP5A 1EF3A 2H6RA 2YFOA 3XINA 5KSWA 1W9UA 3HQNA 7TIMA 3W86A 1TCDA 3VOCA 3C5QA 2J8GA 4HNVA 1CGTA 4A3UA 1FWHC 3AIVA 2XVGA 2VFDA 1PXGA 1QMLA 4JFUA 2NW0A 5HUPA 5CSYA 1R9ZA 3S9ZA 4A21A 5I3KA 4TQTA 2CHRA 1VBJA 4DJFD 1MEHA 2O4MA 2C7FA 3VIMA 2VDIA 1W9BM 4IL2A 4JX6A 1W1ZA 2GPTA 2FZBA 1PKYA 1VEPA 2IXUA 2J7CA 1FWFC 2FIQA 3NQDA 1VRXA 1N8FA 1UW9A 3LN3A 1XFCA 1W56A 4M24A 2GUUA 1P0KA 4Z08A 4P8VA 1JXKA 4AZHA 4XBSA 3FSTA 4DELA 3GH4A 1WBJA 1SR0A 3W85A 3MI2A 3DI1A 3OBAA 1Q4WA 5A6TC 1RY0A 4AD5A 4UFMA 1LBMA 2W9MA 3ZT7A 3QN3A 3AIUA 1C93A 1WV2A 1P0BA 3KP0A 2D2HA 3GIPA 2GQ8A 1KRAC 2OG9A 1UR2A 2PDXA 5E0FA 3V35A 1F6PA 1MFVA 3AWOA 4M29A 4GNKB 2NT0A 4OGZA 1EJUC 4DF0A 3BC9A 1AQ0A 1TG7A 3CH0A 5IHSA 3BCJA 4ALDA 6XIAA 2FDMA 4RV8A 3APTA 3LENA 4GZIA 3CIWA 1OFDA 4K1GA 1VAHA 3GO2A 4H8NA 4MSSA 2E09A 2V63A 1BYCA 3P14A 3WH5A 1OCBA 2E3ZA 5A6JA 2ZBTA 2QDDA 3WDIA 2EEXA 2AQVA 4UWMA 3S5SA 3ZJ6A 5BMXA 3B9EA 4PH6A 1OFRA 2FKPA 4ILSA 2WJEA 2AGKA 1B3WA 4MG4A 4DPPA 1GHSA 1W9PA 1QT1A 4B2DA 2EJ1A 2WKGA 1CCWB 5LNRA 4FS9A 3LUTA 5D30A 1UASA 3N2MA 4JZ5A 3ITCA 1O95A 3F4NA 1PPIA 1X1ZA 4DZ5A 3HJEA 3TYUA 4D8ZA 1XLAA 1IEXA 3GVVA 4HA3A 2CWNA 3Q37A 4XVDA 4Y6GA 3BO9A 4DF1A 3WD3A 3VX0A 2VZOA 5HANA 3PTKA 4WKFA 4G5DA 3VXGA 3BMVA 1FWTA 4M3PA 2Z2AA 3A23A 2PDGA 1RCXB 3L5MA 4FX6M 2VYOA 3THQA 1EJ7L 3LRKA 4B9YA 5LNUA 1QWKA 1QWGA 3V5CA 2A85A 4LY4A 3C3UA 2FZ9A 4PBFA 2I5GA 3IJ7A 3SRDA 2X41A 4NJKA 3ECQA 1G69A 1ISYA 4JTQA 2HVNA 3BH4A 8CGTA 5F4XA 2X1SA 2EAWA 2W0UA 5FSEC 2QT3A 3PG9A 2V2HA 3NL3A 4NYYA 3AFBA 2OYKA 1UMYA 1J12A 1L6FA 3ANYA 1UYQA 1VEMA 4L1GA 1BVWA 1M41A 1H62A 3H2FA 2CBIA 2NVAA 3UGRA 4Y8FA 1W2VA 2A4AA 3MQTA 2QCEA 1J0YA 2EG8A 1H2JA 2XHYA 4N4QA 1S2UA 3SCPA 2E5CA 3VIPA 4REQB 3VCCA 3ZR6A 3F2CA 2WOQA 4XWUA 1SFLA 3F03K 2NX1A 4E8CA 2I7GA 5C6MA 1AVAA 3AIBA 4V28A 3KM8A 1T8QA 1ADOA 5FF7A 6TAAA 1QCWA 3SY5A 3ZR5A 3I6TA 1MMFA 1E73M 3EDEA 3QV9A 3T05A 5IHRA 1IGWA 2YDQA 3VZZA 2QCDB 3NPWA 3TJIA 4KRTA 3ABZA 2VVSA 1QVBA 3IVTA 1G67A 3EX3A 2ZX7A 2WSPA 1BF6A 4ORIA 3TN5A 1S3TC 3W26A 1VCFA 4LB4A 1EBHA 3IGHX 2IKGA 1JZ4A 4PMRA 1CDGA 2V2DA 3N19B 4P61A 4H4IA 3RU6A 1BSIA 4XIAA 4EOUA 4O16A 3CAVA 4HSOA 3KBMA 1AZ1A 4GUGA 3LTYA 4KCUA 4C1NA 4O1BA 1KR1A 3PPCA 4QX4A 4QS5A 3PBYA 3U7VA 3C2YA 1AJ2A 3PANA 5BXSA 4ORMA 4UQCA 4HYWA 4GH1A 3A64A 1H4PA 2R1KA 3G1YA 2DORA 1QI4A 4RNFA 3MSRA 4U28A 3S5YA 3B06A 3W4RA 1XQLA 1ITCA 2WLYA 2DPEA 1W5OA 3HGSA 4KEZA 3ZLHA 1ZJHA 4HNNA 2FTYA 3C2VA 1XLKA 5HNRA 5D32A 1O12A 1A5OC 2BX7A 4M82A 2OOFA 3G2GA 5TIMA 4W87A 2DSKA 4XQ6A 1R85A 3SCRA 4GI8A 1S2AA 2H3BA 1E6NA 1R3YA 5A8QA 2WZMA 4DYKA 1T0OA 1TO3A 1WCGA 3IGSA 2C0HA 4XSMA 3D0CA 3NA8A 3B4UA 2FMNA 1SW7A 4O0ZA 4XX6A 9RUBA 1F4HA 3M5ZA 4CQBA 1CB7B 3WD4A 3K4DA 3MCNA 4UTLA 1EL3A 3NCOA 3QRHA 4PB5A 3CNYA 2D3NA 3EOUA 1SUXA 3GVRA 2QXWA 1CENA 2GDQA 4GGBA 1IIGA 4FNUA 3NQFA 4RL3A 3NAVA 1CZ1A 3T6CA 3CHDA 3CMJA 3NM1A 4NIRA 4TTGA 2CEQA 5LNVA 3EWYA 4HNOA 5G1MA 4UC5A 2XIOA 5GJPA 3W7IA 4JXCA 4A8NA 5C55A 2QJNA 4HJFA 4MADA 2Y63A 1IEIA 1B0IA 4WVXA 4PA8A 1EDQA 3I7QA 4ZL1A 1A49A 3PB2A 2QUUA 4LV4A 1RJPA 1JPKA 1ZP3A 3R10A 4C7FA 4JIEA 2ASHA 3DFYA 1V0NA 1TV5A 1Q6CA 1OJXA 5C9XA 1Q7ZA 1X96A 1O94A 2D2JA 1AW1A 1O68A 3GTIA 4B4FA 1O7AA 3MYOA 4KT2A 1DE6A 3UFYA 4E4PA 1Q45A 4AZCA 2WVTA 1E5NA 3EWDA 1DXFA 4JTGA 2CC0A 3T0TA 4OBSA 1XIJA 3SUTA 2CHNA 1OC6A 2Z24A 4Q8TA 4UIOA 3DG7A 4LPCA 5DO8A 2OCZA 3V5OA 4C7DA 3GXFA 3ARTA 1L8PA 3UR5A 2FJKA 5C71A 1H09A 4GY0A 3H2CA 2FHBA 3A22A 3ZR4A 4ZEPA 3S6DA 3BWWA 4JHZA 5CC6A 3C2FA 2YDAA 3UPBA 5D02A 3DDMA 3E0LA 5I7GA 3II1A 5LXXA 4GBUA 1A3WA 4BF9A 2CXEA 4HPGA 3ARVA 1T8XA 8RUCA 5LKYA 2HV5A 2JIWA 3WH8A 3WN6A 1AD1A 3IJQA 3AWNA 1QASA 3XISA 3KOFA 3QR3A 3SFKA 1NFBA 5HWMA 4B5TA 4M80A 3RX2A 4XZMX 2WMKA 3WF3A 3K13A 5D33A 5LIKX 4US5D 4DO4A 1MVYA 2VURA 3PF3A 2JEPA 4WY0B 1XIBA 3NL2A 2PU0A 5GVJA 2HZGA 3PBUA 4ZXOA 4W9TA 1QNOA 2E7FA 1UR4A 3QW3A 3FA3A 3Q94A 3BSMA 3CC1A 1LBLA 3IUDA 4IZGA 1MUWA 1K6AA 1OF8A 4AAJA 3AS2A 1R3WA 1XD1A 4HK7A 3SURA 4H01A 1OGGA 3U48A 2XTKA 4KEVA 4DBDA 1JPHA 4PUMA 4AMCA 2WSQA 4CD6A 3LV6A 3U4FA 1PAMA 1W1B1 3B8SA 1R5YA 5KETA 2Q3RA 5HWNA 1R0MA 1WDQA 2QUMA 4U10A 4V33A 5DBTA 4D9PA 3RLGA 4F0HA 6REQA 2WBKA 2POZA 4MGGA 2A21A 2Z7GA 4BCEA 2P76A 2Z26A 1RK6A 1S46A 3AXKA 3UPMA 3EOEA 3KVMA 3LXAA 5HUOA 1I9CB 5JMUA 3NFUA 2YKKA 3RHGA 2CWXA 3MW7A 2VX4A 2Y0FA 5EL1A 3R11A 3VDGA 5DMYA 1Z69A 2BLEA 1UR0A 1MW3A 1W5MA 5AC6A 4LC8A 4AEEA 3OGSA 3D5HA 3GNRA 3IUIA 3NVTA 3TAKA 3O16A 3DX5A 3W01A 4PUKA 2HE8A 1TPFA 3H2AA 3AU2A 3MANA 1P4CA 2WNNA 3BANA 4PR4A 1J96A 4C5YA 6ALDA 3M1ZA 1MI3A 4F66A 1FA2A 3QV8A 2XH2A 4MWAB 1ZP4A 1B5TA 1J9YA 4Q4PA 1XISA 5F4SA 3KFTA 2INFA 1Q6DA 2ZZ2A 3R43A 4O17A 1F7BA 4TX9A 3LLXA 3SECA 1T40A 1KWGA 2BXVA 3O9NA 2X1UA 1P43A 3ZXWA 1OGBA 1E9ZB 2VTFA 5HINA 4S3KA 4I9MA 4JBRA 4KWUA 4Q4MA 1K77A 5K9CA 1VBUA 4ZA0A 1PKLA 3VPLA 3H7UA 3T0CA 2ALRA 5DX7A 1QK0A 2DZUA 2GQAA 3UWVA 4G6CA 4QLLA 4Q3MA 2R14A 2B31A 3HQOA 1XGDA 1AG1O 2J47A 4LANA 3V3WA 2VKZG 5J5RA 1PV8A 3RK8A 4ERAA 2E9LA 5IDZA 3BUVA 5A2CA 4OOZA 4S23A 2GJRA 1DIDA 1Y5WA 1IEVA 3MHUA 3WNLA 1A5SA 4CCEA 4GIEA 3M0KA 4H2HA 2I5QA 1B3ZA 1AL8A 3CQHA 4JICA 2UV8G 3GNXA 2QCHA 4QAIA 2BDQA 2UWFA 3O07A 3WENA 4PRRA 4XZWA 5G2HA 3GDKA 3L0NA 3GVGA 1ODZA 3BCFA 3GC5A 4FXFA 1FXQA 3GFYA 1FCUA 3MBFA 3T0BA 4UTHA 1YBQA 4IHCA 1UP2A 1BRLA 3PHAA 3WKZA 1RJQA 1SO6A 1K7EA 4AZ5A 1W1A1 1FWNA 4IISA 3T81A 3JUGA 1KGUA 2VRKA 2D23A 4DBWA 1Q8JA 3V1PA 2DEPA 4O53A 1A80A 4IGSA 1OK6A 4K8EA 3HO8A 1HTIA 1RVKA 3EXSA 3EMZA 5ABGA 1UWIA 3CUIA 3M5XA 2O0TA 2XFFA 3RLVA 3FHAA 1BAGA 1UG6A 2Y70A 4YVVA 1EJSC 1RCQA 2WVSA 5D9PA 4TO8A 1TZZA 3EB2A 1FTXA 2PDUA 4GC3A 4I5RA 3RLHA 3E0FA 1N55A 4DJEA 3VOGA 3MUY1 1XYCA 2NVDA 1GHRA 4MFEA 3KRZA 4QS6A 5AC5A 3AJ7A 3GDMA 1CEOA 4MNMA 4WOQA 2VUNA 2ESCA 3LHVA 3M7SA 3AAMA 3CWNA 3W84A 1BGGA 1XL9A 4JX4A 5I3JA 3T09A 4M1RA 3AIQA 3KTXA 4DLMA 3QH2A 1W91A 4JKMA 1E40A 3FEMA 3KL3A 2G3IA 2BXZA 2Z00A 3MP3A 3M5YA 2XVPA 3S1UA 3DIPA 3PZVA 1UROA 3GDLA 3PBMA 2AL2A 1UOKA 1PDZA 3ONBA 4F9JA 2V9DA 3HPFA 4G7EB 1X6UA 2ZWYA 3GAYA 1VJIA 1DL3A 2YZ5A 1PL9A 4JGDA 4DHGA 2PBGA 4UR9A 2Y24A 3WQVA 4R53A 1FCBA 3TVAA 3BGGA 3KOYA 3G22A 5LHFA 1TB3A 3GG1A 2HS8A 3CT7A 3UJSA 3AZSA 2QCNA 1DWJM 5JBEA 3VKCA 4D8AA 3MZ2A 4AZ7A 3WBWA 4NJHA 5ABEA 1T96A 1UZDA 4AIUA 1JCNA 7A3HA 2FZMA 3N2XA 4GZJA 5CZSA 5FJUA 1JDAA 3AUJA 1WDPA 3HM7A 5CGQA 4FNTA 1VHNA 4B92A 3NZQA 4ZOBA 1P6WA 3W81A 1AH0A 1CXFA 3OHIA 4ZQNA 3PUGA 3LGEA 5HNUA 4X9SA 2EPHA 2QJJA 2VRJA 3RJXA 4A22A 3EWZA 4LF1A 4FALA 4DUVA 1XIEA 1WX0A 4CNSA 4WSJA 1A5BA 3WD1A 4NF7A 2F61A 4GHRA 3HG5A 2YLAA 2P0IA 4HA4A 4GGHA 3ANVA 1P6BA 3FAXA 3GDBA 3UQNA 1N2VA 1IT7A 2HNEA 4AZ6A 3P5ZA 1GQNA 2AMGA 3LQGA 4ZXLA 4JL1A 3LPOA 3FKKA 3S5ZA 3CQIA 3OLEA 4EAYA 3FEQA 2GFTA 2D20A 3R8RA 4ZFCA 5FI8A 4W8BA 3VOFA 3ZT6A 1VJZA 2AAMA 4GYFA 1J79A 3VC5A 3LSCA 4ADUA 4E0CA 1H63A 4OKDA 1HJWA 3NZPA 3IVSA 5DN1A 4TV6A 3DKJA 2AQOA 1KCZA 3HV8A 3CMGA 4GISA 2XIMA 3EOLA 1OF6A 1FWWA 4AU0A 2C71A 1A47A 2WHJA 2PTZA 2J6XA 1DQWA 1I1XA 1QPOA 3FVDA 3FJ4A 4WDXA 2Z6IA 1OFBA 4IIEA 1PBGA 2EPNA 3BICA 3K4WA 3N6HA 4M19A 2XGBA 1XYAA 3OG3A 4AD2A 1HG3A 1SPQA 1X6LA 4C6BA 3INPA 1IGSA 4RKAA 1KW1A 2CPUA 1EJXC 2WWDA 1E71M 3HOJA 5C2CA 5FJOA 3WK1A 1HGWA 2ZDRA 4Y90A 2C16A 1S2WA 1UC4A 1XRFA 1T99A 3SB0A 1UOZA 3IJ8A 4LS2A 3VA8A 2A3BA 3T08A 4H9XA 4LEFA 1U22A 4ZCWA 4ES4A 5BRQA 5MKGA 2GJLA 4UB9A 1REQB 1R9XA 1ICSA 4GKLA 3MDWA 1CBGA 1JDDA 4E38A 1UHVA 1K9EA 2OQLA 3WBYA 5ENLA 3U6WA 2PURA 5CZKA 1BTCA 3VYLA 2VQTA 2J9YA 7ENLA 3TZNA 1WQ5A 1BYBA 1YE6A 1IQ8A 4MLRA 2PC8A 2PP1A 1JAKA 3H21A 3TIMA 5CPTA 3T40A 4PTMA 3A13A 1EX1A 1RHCA 3SO7A 4DVOA 1ZFJA 1RSCA 3DOPA 5EMJA 1XYLA 3BJTA 4KEUA 1V8EA 3MKCA 4YPJA 2OO6A 5A6KA 4UTKA 3M16A 2QLYA 1J8VA 1NEYA 1CXHA 3I4KA 4LSBA 1NF0A 1RBOB 4CQ9A 4Z2HA 1XX1A 4WRHA 4I6VA 4PMXA 2DT2A 1MDLA 2Z27A 3IV8A 3L2IA 4UTTC 4PMJA 1OYCA 1I6NA 1C3FA 3BCDA 3MA8A 3NPVA 2VZVA 4M6PA 2V3DA 2Z7KA 1TPH1 1UD2A 4HT3A 3AHZA 4JPGA 3LHTA 3MV11 3EKLA 4IJBA 4RE2A 1CXKA 3TW9A 2QKFA 3ITXA 4W7UA 5E0KA 3EA2A 2ZUVA 3W25A 4QLJA 4ICMA 3QFEA 1OVDA 4C6NA 1K9DA 5EFFA 2V5BA 3VIKA 4PL1A 3PJUA 3CL7A 1ZPTA 2D1ZA 3TKFA 4KETA 5LIYX 3F4VA 5HDRA 2BHYA 2CLEA 1VIZA 1EJRC 3UG3A 2FDSA 3UWEA 1OZQA 3TDFA 4UR8A 2ACSA 4GK8A 2X16A 5CPSA 4XZNX 4Z2IA 1XGEA 4NAEB 1UWAA 2GSJA 3OIXA 3GNDA 3MS8A 3W73A 3F1QA 4K37A 3RRXA 3UNTA 2X30A 4EKJA 3V1HA 2WVVA 4IX2A 2TYSA 3DC8A 2WVVB 3G1RA 4DX3A 1LOLA 3W7RA 3GG0A 5LA0A 4WGXA 3G1SA 3DECA 2DUXA 1YKWA 3IRSA 4M7SA 4N9CA 3VIJA 3QGAC 4L4PA 1C8XA 3Q4DA 4C6OA 3D6NA 2YPIA 2VC9A 3LD5A 2VWSA 7XIMA 2OOGA 2VZTA 5F7UA 2GQ9A 4G8TA 4WHBA 4YVXA 1LG2A 4ZTXA 4JNMA 4W7WA 2QZRA 1RD6A 3N15A 4UMBA 3GC2A 4W84A 4REQA 5DELA 2D0HA 3OBEA 4JD4A 4P8XA 4O18A 1Q8AA 2CFFA 1MUMA 1JDFA 5CSSA 1ZGDA 3HZ3A 2ZWZA 4B91A 5A2AA 3NVDA 1H49A 1R47A 5A6SA 4S2BA 2J8TA 4F0MA 2QYGA 4W8AA 1UZ4A 3W27A 3SUUA 1DJGA 2PCQA 4FXJA 3WH9A 3B97A 3SGGA 4Z1YA 3VD9A 1ZU8A 4ZO9A 4CU6A 4CCDA 2XIBA 4GXWA 4KH2A 4PTWA 2CZDA 3LLFA 4D71A 3UGVA 1ZBVA 2NV2A 1T7LA 1L2QA 3GUWA 3TC7A 3G1AA 4KFOA 3EGJA 4NKCA 2VFIA 1VJSA 3KOWA 3PTDA 1TFVA 4JIHA 2VXNA 4ZO8A 1KWKA 3TEVA 1ADDA 3RJYA 4JTJA 2V6AA 3MSYA 3USBA 1XC4A 1WO2A 4MY8A 4EK7A 2CLIA 1TR1A 3CXOA 2BHUA 4WSKA 1TTJA 4GINA 1GOMA 2OLAA 5I79A 1JF6A 3AJXA 1UP0A 2PRMA 1DTUA 5EBUA 3UWYA 3WBEA 4L4LA 1JQVA 3GTHA 1FWAC 4JNYA 4NNCA 1XSJA 1O6IA 3M47A 8XIMA 1UIPA 3FGCB 3DH7A 1N7KA 4YTUA 2D0FA 3OLIA 1Q6GA 3S5NA 5D8WA 4PSPA 4A6GA 1LROA 1ZNNA 3I10A 3GFXA 1Q5MA 1IHIA 3AYRA 3NPXA 4HHLA 1XINA 2IQ0A 3KHDA 4J3VA 4FO4A 3U7BA 1JYVA 1UKOA 1QDSA 2ZYFA 1L8NA 4AB4A 3EWCA 1OSEA 3IEBA 2FB3A 3ABQA 4WLCA 1V02A 4TMCA 1JNDA 3NL6A 3VE7A 4AZCB 2Y5JA 3DU0A 3LNMA 4UCFA 1OT2A 2CERA 3IAQA 2DJLA 5JXQA 4S3DA 3N4EA 1PEZA 4TOQA 3A4WA 1TQXA 4RE0A 1VBGA 2Q8LA 3W22A 1W17A 4KPLA 4QCFA 1L6YA 3LTPA 1G94A 3UXKA 4H8HA 4JQAA 3MO7A 5HPCA 3AALA 3MWCA 3L4ZA 1E70M 4C6DA 3GBDA 1A5UA 3GC4A 2IQTA 2JQXA 2XDFA 2H8XA 3JZEA 3T8QA 4DJDA 1W5PA 3G77A 1W3HA 1VPXA 3FDGA 2VFEA 1U5VA 1LTDA 3ES7A 4YWSA 2ZTJA 5BOEA 3K8MA 3R79A 2G97A 4ERIA 3AUOA 1Q3NA 4J9JA 1EIBA 2Q02A 2I57A 4C60A 4BY3A 2VUYA 2GGHA 1W8SA 4RZ5A 2ZA2A 3G6LA 5D9NA 4D2JA 4Z1BA 3WQ8A 1OCNA 4WEVX 3OJGA 3PUOA 1IXQA 1VFSA 1XLEA 4TU1A 5EGRA 1ELSA 3WJXA 1DKWA 3C2EA 1UD6A 2ZUSA 3BSGA 2XM1A 4DNHA 1XM3A 5AHIA 2I1OA 4ZB0A 5C7HA 1LG1A 4GCXA 2RUSA 3WQWA 4HK6A 3TN4A 4F79A 3NZRA 1Q85A 3AXMA 5M5DA 5G4WA 3C61A 4R9OA 2D2OA 4LALA 4I6KA 4Y96A 3LBOA 3LTSA 5JH2A 4PB4A 2J27A 5AZ0A 5GJMA 4IJCA 1WZKA 3LRLA 1J10A 4HMEA 4MZ8A 1CLKA 1GONA 3HFTA 4ASTA 3NURA 3GBEA 3WF4A 1GKPA 3TLLA 2X2YA 4ATDA 4O19A 3GFZA 3TYEA 3FA4A 1YMYA 3DAQA 2QF7A 1Z3NA 3ANUA 2OLSA 2Y6ZA 1W5QA 4PTXA 4A2RA 2R24A 3WNOA 2YXOA 3N2OA 3UR8A 5K4ZA 1HKKA 3QZ6A 3HPXA 4HIBA 4GD0A 4QEHA 2NT1A 2NUYA 2V0TA 4I8YA 2C6QA 3S2LA 1VIWA 5K9XA 2OZ8A 3ZJ7A 4YYFA 2VEGA 4DO5A 2FVMA 1X1OA 3TXZA 1EYWA 3A5FA 4AIOA 2PDPA 1FP9A 3AMCA 4KCTA 1PCWA 4DZHA 3NZGA 1M04A 3W02A 3HU7A 3CL8A 4J28A 3B03A 2BMBA 3W72A 3IIPA 1PWMA 3MUCA 1FX6A 4OV4A 3GKAA 5DXXA 1OG0A 5DF0A 3M5VA 4LWWA 1DVJA 3FS2A 3ITVA 1ZSXA 5EA9A 1JD7A 3BARA 2F9RA 2G96A 4LS0A 4I9TA 2IW0A 3TR9A 3STEA 3OZOA 3L21A 1JJKA 1NY1A 1N8IA 1OHLA 2BGSA 2ABAA 4U33A 5BU9A 4P7QA 4HN8A 1BKSA 4FB7A 3EA1A 3FYYA 3RO8A 2GZXA 3OTRA 1LT8A 3OEXA 3OGRA 3E96A 3O2LA 4H04A 1NWTA 1E0XA 3GHTA 4IP4A 1VFTA 3GY1A 4R7JA 1P0EA 2WZEA 1MQPA 4LQ1A 4F48A 5J8LA 4J2MA 4ZR8A 1LYXA 1XH1A 4HMDA 4G7EA 3G5EA 4UTJA 2WO5A 3GVWA 4R9XA 4LV9A 1LUCB 3VNJA 5BNKA 1KC7A 1G4TA 2XWDA 1JRCA 1I2NA 2P8CA 4YXGA 4BHYA 3W7EA 1OFAA 3GVQA 5CAHA 2ZC1A 2IS7A 5SWUA 2OJPA 3WK0A 2QPSA 1EHNA 1MRQA 4N4PA 3U9IA 1CLVA 1EYEA 1VPYA 2WANA 4IPNB 5AYXA 3KRSA 3ATZA 3NDYA 4UNIA 2UZ9A 3QSRA 4PUNA 3L66A 4LTSA 1QBAA 1TJRA 1RBAA 4AMAA 3CIXA 1SGJA 3NPUA 4QJ4B 4ECLA 3CPUA 2JK2A 2WZIA 3KBSA 1KV8A 2D3LA 3G3MA 2BY0A 1TMLA 3S46A 5JU6A 2WB5A 3PWGA 1GKRA 3IJLA 3E49A 5HMDA 4JY8A 1UR3M 4O1AA 1N8WA 3B0PA 1P6CA 1RJRA 1XLDA 3P8IA 1Y5VA 4O57A 2WLZA 4NZJA 1W1VA 3C3NA 2JBMA 1Z89A 4LY8A 5JVLA 2ISWA 5FKYA 2DSZA 3DFTA 1HJVA 1H5VA 1QTWA 1D7KA 1CB2A 3KS5A 3M7WA 3WLRA 1OM0A 1A0EA 1PB0A 1UD8A 1JPMA 3FDKA 3KRBA 3QF0A 3AMGA 3CZJA 5FF2A 1FHVA 3Q67A 3GUGA 1NM9A 2DH3A 3WD2A 4JFTA 3F4WA 1TMQA 1GOIA 1PDYA 3CO8A 4HA1A 3Q2DA 3R94A 1XCWA 1UR8A 1JPDX 1XH0A 5DCBA 3R0DA 3OVGA 3BLOA 1HXJA 4UZUA 2HXUA 3VKBA 4PTNA 1CGVA 3ALFA 2BOFX 1RLDA 3FK4A 4HMCA 4ADSA 4BWLC 2O9TA 1J5TA 2RHGA 1Z6KA 2OODA 4HP5A 2Z25A 2VX6A 2OGJA 3ARXA 4JR5A 3NOYA 3B8UA 4HHHA 3UWUA 4AQLA 6ENLA 2DUZA 3ZSSA 1GOOA 4R7OA 3PPGA 1KBKA 3M0IA 3HG2A 5BWFA 1MWOA 4AXKA 2Z29A 3NEVA 4BI7A 1V7YA 1QNPA 4GUHA 5A6LA 4ZSTA 1VHCA 3A4AA 4CGTA 1FWRA 4IIDA 3WFAA 2J25A 4P7OA 1PZ0A 2WK2A 1XIFA 1EDGA 1GZ1A 2WMHA 3MB9A 2P10A 2OX1A 5LXEA 4C6LA 1TIWA 2VCBA 4IQDA 4L9YA 5G1TA 2GDVA 3SSZA 3S9YA 2Y88A 3C2RA 2ANUA 2YL6A 1JYNA 1BEUA 3URBA 1KFLA 1KM6A 1XUUA 4Z1DA 3L4YA 2X2GA 3L23A 1YPIA 4RV3A 1EC9A 3POCA 4DUWA 5LIWX 4H1ZA 3W1LA 1H61A 5DXYA 5FJIA 4GYJA 3ITTA 4MNLA 1A0CA 1UH2A 1EXPA 1W3KA 1X7IA 4DJED 3SDOA 3RGTA 4U3CA 2GOUA 3EWBX 3LRMA 5T8GA 1WOBA 1JUKA 4GNJA 2DVUA 3O6DA 1V3HA 5EMYA 5FSDC 4J3TA 1TJ0A 4BQ4A 2NZLA 1F3EA 2IPFA 2J7FA 3W28A 3NO1A 4WY0F 1B1YA 4AZBA 1DV7A 3TC3A 4UFIA 2C79A 3WQPA 1QO2A 5HJYA 2PUZA 1WXZA 4J3XA 1IWBA 2YW4A 3P3BA 5A8GA 2OYMA 4B15A 4L9ZA 3STGA 4FIRA 3EDDA 4QAWA 3LCIA 2PWEA 3CPGA 2CZVA 1UWUA 3DERA 3QHMA 1E1FA 3EAUA 5JH1A 3VNKA 5JQ9A 5KMYA 1E43A 2A3EA 2QVNA 3P5YA 2DIJA 2JF7A 1TJ2A 1KFJA 4C91A 5HATA 3TU9A 3N12A 4WX2A 1RP8A 2ADAA 4QCEA 2REQB 4Z1AA 2QDGA 3EKZA 5MHBA 3IIXA 4JTAA 4MYXA 1D8WA 5CSRA 1UJPA 2C15A 3ISIX 4HYRA 3EMQA 5JIWA 4F0SA 1EHAA 4IQJA 1QPNA 4LJ3A 3SAZA 3WMBA 3REQB 3UA4A 4YIWA 2B4GA 3SJ3A 5I06A 3GXMA 2MNRA 4HZ6A 1ISZA 1XWYA 1ZBWA 5A6MA 1U30A 4NRRA 4DAFA 3CL6A 4JTRA 4UOZA 4DWSB 4UMCA 5DFAA 3PVFA 1PZ2A 3SUSA 2PDQA 3AMDA 4GQGA 4J2PA 3IGUA 2VZSA 4LVGA 3UERA 3MVIA 4WKAA 1Z48A 1F05A 2XZ7A 1F5ZA 3WK3A 2JGYA 2VD9A 4RCXA 3QY6A 3UZXA 3MI3A 1WB0A 4HJWA 5M03A 1LQ0A 3NQCA 1DIOA 2V68A 1QUMA 7PTDA 2HISA 3BJSA 3TJLA 3SW6A 1TYGA 4OT7A 4Z0JA 4BWLA 3WDRA 1ONRA 5IM51 1BG9A 2DUAA 1JZ3A 3C8NA 2WV8A 4Q8NA 4FP1A 2DZPA 3BZGA 2O9PA 1W0MA 4ACZB 2DSWA 2OSWA 5CH9A 1OC7A 2OKOA 4I9AA 4JS3A 3SCWA 1EEPA 4JFVA 1SSGA 1QXLA 1VFOA 3BOFA 3WH7A 3C6CA 4LFYA 5M17A 1UUMA 3BSHA 1W3LA 3N4AA 4LYPA 4U2ZA 4IJRA 1NP2A 2FB2A 3ALGA 3HGRA 4YS1A 3MSDA 5G2IA 2H9AB 4GYKA 1SSDA 2KX9A 1FWEC 2ACUA 3T2PA 5D03A 3LHYA 5REQA 2WYSA 4LUYA 5HJLA 6CGTA 5CLWA 1NFPA 1WXYA 4XKYA 3W7GA 4NG3A 2VEIA 1HKVA 1K8YA 3BMWA 2EPLX 4ML4A 2ZA1A 2AKMA 5U4NA 4LX4A 5FAJA 4UTIA 1JCJA 2OMAA 3CUHA 3FJNA 3P93A 3IIZA 5EB8A 4F3HA 5M3WA 3DHDA 3EXTA 4O0QA 3A3HA 2I9UA 3FNDA 1YBQB 3W37A 2SFPA 3VZYA 4RE3A 4WZHA 1KFKA 3VIHA 4O50A 1AMYA 4PFHA 2NLYA 4QHRA 3LZ3A 3LDVA 4UQAA 1GZJA 3GXTA 2B7QA 1UWQA 1HFBA 1TMHA 3RM9A 4PC8A 2YGYA 2CZFA 1TTIA 4KFPA 3BW4A 3OGVA 3TMLA 3LYEA 1EP2A 5E93A 2PWFA 3UD6A 2FTPA 2W62A 3TP4A 5C9RA 1KXHA 3FSUA 2WMJA 3L65A 3WDJA 1XC6A 2YIHA 3OODA 3ZOAA 4PMNA 1H0IA 1P1MA 2PDJA 1R6WA 4NZ5A 4Q8VA 1XYFA 2V5JA 1VD6A 4HPXA 2R1NA 3RYSA 4MFDA 1FKWA 1H7PA 2BB0A 2XVLA 4IMEA 2JKPA 1TRDA 2EHHA 3K8KA 4JTEA 5EYWA 1QU4A 4LUSA 3VCNA 4J35A 3N25A 2EQDA 5AHEA 4NU7A 5HOSA 4ZBCA 4PMYA 3A6OA 3AYVA 4PCSA 4RLIA 3JZUA 4V15A 4IL0A 2JEQA 2VI0A 1CPUA 2Y7DA 3S2CA 4V27A 1XBVA 3ITOA 4E4FA 3BQ5A 4DYJA 2V5CA 3FIGA 1QW7A 2HXTA 2G3FA 1FWIC 3MCOA 5C7VA 3VDBA 5A95A 1TWWA 1GQLA 2EXOA 3DGRA 4IXXA 4YCPA 4EANA 3KOXA 4W8LA 1TV8A 4OBTA 1RALA 2C18A 1OWQA 3ARWA 5CBBA 3W0KA 2PP0A 3U4AA 4DLFA 1W3JA 3VVGA 5FJJA 2FPYA 4PMOA 1RY8A 4PTVA 3VIFA 2J7DA 4C5ZA 3TONA 1DJNA 5C0QA 4AX7A 5A94A 1WDSA 4M6UA 2NV9A 1LRQA 3PSVA 1J0JA 1UP3A 1V51A 4FLOA 2FJUB 4MKNA 2XN0A 2NUWA 2QV5A 4DRSA 2XFYA 3T07A 5FL1A 2DJXA 2AKZA 3A4XA 1W3NA 1TR9A 1GCYA 2P8BA 3IJ6A 4JCLA 5B80A 1JCTA 1S2VA 4GA8A 4O52A 1YNQA 3CLWA 3W1NA 1QW8A 1F8IA 4S3JA 4Y9NA 3LI1A 4DO7A 5KZDA 4FA3A 2Z1VA 2QPXA 3AS1A 5DT5A 3VD3A 4CQDA 1BYAA 3GWQA 4AWUA 3HN3A 5FJPA 4YN5A 3WK2A 1CI1A 2YA1A 1A5LC 1YTEA 2PLCA 1YDNA 1DIEA 1QFEA 3TYZA 2ZXDA 4P7NA 3Q45A 3UA3A 3W2KA 5I3HA 2V5DA 2OT0A 5HA7A 1D3CA 3WLLA 3LCFA 2PI6A 3UVIA 5HAOA 1ITUA 2VNCA 5JBFA 4AEOA 4UTWA 3W2MA 5DMNA 1OYBA 2GJNA 1QNRA 5I3DA 1LLWA 1XV8A 4WUIA 3QQWA 2W61A 4NAFA 3R58A 3BLPX 5D9OA 3WQOA 3SRFA 4GJJA 2CETA 2GL5A 4J3WA 1RQHA 2VEMA 1RQEA 4CLMA 4TVDA 1PYFA 1DQUA 8TIMA 4IFRA 4NX0A 4IUGA 3M0MA 4GX9A 3UZJA 1TWIA 3G24A 1BWLA 3E12A 2BY2A 4HMNA 1DXEA 2PD9A 3UXLA 1HKIA 1JUEA 4WJEA 1FVPA 3U5UA 5K7JA 1VCGA 4N02A 1E56A 4GIRA 3WJWA 3QY8A 2NXHA 1VYPX 4IX0A 1RVGA 1I2OA 3QPZA 5FD0A 4H9MA 1R8LA 2BASA 3E0WA 3VGDA 4G1KA 3B8IA 5M1TA 2DH2A 1IEWA 2Y8VA 2Q01A 3WLMA 2QAPA 5MKGB 4V1XA 5T26A 2QIWA 1TUFA 2WAGA 2YCJA 2NLIA 5K4XA 2WWCA 4LNYA 4UQ9A 2CHOA 4ACYA 3M0JA 2Y89A 4HU8A 1B3OA 3GG7A 1RZMA 2PDYA 4PMUA 1FCQA 1F07A 4GI4A 4WKHA 4FAMA 4HHPA 2OB3A 5BROA 4HKPA 4LAOA 3SFWA 1JXJA 4XZIA 2P50A 4GZ7A 3N11A 1LT7A 1ZHAA 2YA0A 4Q8QA 1X97A 1X8CA 4H8UA 1ECQA 1A4MA 5EKYA 3QBUA 1YDYA 4MB3A 2YZRA 5K2ZA 4ZO7A 2GK1B 1KFEA 3ARRA 3CAWA 5CPQA 3AXXA 1SJDA 2DQWA 4AY8A 2DDXA 1W9DM 4X60A 5CGMA 4D8LA 5D37A 5E5CA 4IQLA 1GG0A 2B7NA 4ZTYA 1E6SM 1W3IA 3NO5A 4Q7NA 2R8WA 4HSHA 5AB3A 1WAUA 1E6XM 5AHFA 1NDYA 3W6YA 4QM1A 1QI2A 4Q8PA 3UT0A 1GT8A 3RM4A 4IIGA 4D6DA 4AD4A 4NVTA 3VDCA 2E1WA 3AHYA 1GGOA 4AVNA 2PF8A 2J74A 1ENUA 1TVNA 3NZ1A 4DJDD 3R2GA 1R3QA 1PIIA 4MM1A 4JHMA 4X61A 3BVJA 4I5UA 4AYSA 1GW1A 2E9MA 1HO4A 3EWWA 3CZ8A 4IIBA 1GTHA 1YEYA 3UCQA 1ITXA 1WXJA 4QE4A 4RZBA 1DJIA 2OO0A 3LS9A 3S0CA 3EKGA 1WYIA 3B8TA 2HVMA 2PCEA 2C3ZA 4XG1A 3DEQA 3WLIA 1VFFA 3IK2A 4LAUA 1S1RA 2WKLA 1Q4NX 2GSEA 2GK1A 3WQCA 3M6DA 1UA3A 4R7WA 3QC0A 4HCDA 2HQAA 4TIMA 3TOYA 1B3YA 3AQUA 1S3HA 1NP0A 3GNNA 1PIGA 3E5BA 1QHZA 1EUNA 2AOSA 1XCFA 2XUCA 1GPWA 3CK5A 3OVRA 1W9XA 2WC4A 3ARZA 3QKZA 1PHQA 5L9FA 5IRPA 1WKFA 4DI9A 1Q7QA 4AX6A 1UPPA 4AWTA 2JF6A 3T9PA 3S6TA 3TCEA 4QROA 3EBVA 4FNSA 3KCOA 4L56A 1DTNA 1YXCA 3BAKA 5A5WA 4XTIA 4Q4KA 4UXDA 2I14A 5L6UA 1GVSA 3A4JA 3B9OA 3M4HA 1ZUAX 2BVDA 1WKYA 1I4NA 3THAA 3RG6A 1ZJBA 1B9BA 1PSCA 1MYRA 3F2BA 1P1XA 3RCNA 2X1IA 4A35A 4MY1A 3O8AA 2O9RA 4MWAA 3W7PA 3VGBA 4A05A 4N6FA 4JFWA 3PULA 2J78A 1QPRA 4UQBA 5C9UA 4LU0A 3HPZA 3A21A 3BG9A 5CPNA 5B7ZA 3MJMA 4PRWA 3JW7A 3P6LA 1TVLA 3S8HA 1RUSA 3IS4A 2H3DA 3ZM8A 3IJDA 5I3FA 3GHUA 3HBLA 2OEJA 2P5NA 5AC7A 4LVFA 3LHUA 2VO5A 3H7RA 2A3CA 2R1PA 5T9CE 2INEA 3QFWA 1HKWA 4TMBA 3SJNA 4PN2A 3QEZA 2YYUA 1XLHA 2G3MA 3SQLA 3CHFA 5H8PA 1MDRA 2O4QA 3QYQA 2O9OA 1PVNA 1FFRA 4P7RA 1UQZA 3DFNA 1TE6A 1AW2A 2C1IA 3QM3A 3OIHA 3SBFA 4XB3A 1XXXA 3E02A 3CMFA 4QXIA 4HZMA 1B57A 4CKQA 3P61A 1R46A 4PUWA 5HULA 3BJFA 3OG2A 3HGOA 4GG9A 4W86A 4E6MA 4MKSA 1HN1A 3QZEA 4YL2A 3WJSA 1QBBA 4H83A 3TYBA 4DZIA 1L2UA 3ATYA 2QNEA 5BRPA 1GVFA 5DMMA 4DWSA 5ABTA 3GU2A 4KRUA 1PX8A 4D6FA 1KD0A 2W67A 3VMOA 2OQHA 2BGNE 1E1EA 1EIXA 2TODA 3LPPA 3ARPA 1W1TA 4GVHA 1HW6A 5CKSA 4J27A 3KLKA 2PLMA 3KP1A 4XAZA 2FHFA 4FHAA 1DWFM 3DYOA 1O5RA 1XI3A 1O5KA 2WNQA 2HSAA 5KZ6A 4U5KA 4M51A 4HYVA 3VNYA 4JTTA 4LBRA 1VC4A 4GUJA 2EPOA 1VQTA 1TZ9A 2ZTKA 3CQ0A 3R8HA 4Z17A 3R89A 3DYPA 4OJYA 2Z6JA 1QNSA 1ME8A 4WXYA 1XUZA 1GORA 4OIFA 4LVAA 3AHTA 1D8CA 2OELA 3BV7A 1TV3A 4WF7A 4EP8C 3RPMA 5HQEA 3HGJA 1HVQA 1OB0A 4O1CA 4K8GA 4GKTA 3GZAA 2W66A 1HKJA 4JDYA 3ABSA 3NYZA 3W6MA 4XD3A 4P5UA 3TROA 1LF1A 4R27A 4ENLA 4LRTA 1GVEA 3C8FA 3VO0A 2C14A 2QMKA 5C2XA 3WEMA 1CGWA 3QXBA 1SYTA 4LW7A 1SMDA 5TD4A 3PBVA 4UCGA 3WIJA 1JEZA 1V6VA 4KMQA 3ABRA 4K1WA 2WM0A 2TRSA 4NUWA 3UZ5A 3H2NA 4S2CA 4O14A 3ITLA 4QG9A 4XZ9A 2AAAA 3RDKA 4LC6A 3QJAA 3CTLA 4NI8A 2WCAA 3S1VA 2NX9A 1JZ7A 1GVYA 3L2LA 3L4VA 1XSKA 2NQ9A 2WMIA 2ISVA 1XBXA 2W63A 3W1UA 2UY5A 3A3WA 5H8MA 4JEJA 4LYRA 4Q7BA 1V7AA 1DWGM 3W9ZA 1A5KC 3ITYA 2BSLA 4HU4A 1SO3A 3U57A 4FI4A 5GJNA 1BQCA 4DWDA 3RCMA 2XVNA 1DHKA 3ID7A 4IXHA 4C1LA 3S2JA 1UWRA 5IFTA 1B31A 4PMDA 4XZBA 2HS6A 2DIEA 4EF8A 1FWBC 2L5HA 3E3HA 2WHKA 4R88A 4HU3A 4RE4A 1JYXA 5BW6A 4CQAA 3O0KA 1SFTA 3R13A 4FNQA 4FNRA 1CECA 5XINA 1CW2A 1E9LA 3PG8A 3G1DA 3URNA 3GU9A 2NWRA 1KB3A 1KM4A 3W53A 5F2MA 2BGQA 2QCDA 4JTDA 4E2DA 1E1CA 1LL7A 1AJZA 1J0ZA 1OX4B 2OSXA 4C6CA 4LYKA 1H7XA 3W2LA 1HX0A 4I9JA 3PBGA 1K8CA 2E6AA 3H23A 3N9RA 3UU0A 4L1XA 1C7TA 1KA9F 1VPQA 1THFD 3AYTA 4HQVA 4H00A 4AEFA 1JDEA 1H7WA 1QW9A 2I17A 1US0A 1TPWA 2DSUA 4NT0A 2YJQA 1C8QA 4XBJA 1ICPA