1TVPA

Endoglucanase cel5g from pseudoalteromonas haloplanktis in complex with cellobiose
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
293
structure length
293
Chain Sequence
AVEKLTVSGNQILAGGENTSFAGPSLFWSNTGWGAEKFYTAETVAKAKTEFNATLIRAAIGHGTSTGGSLNFDWEGNMSRLDTVVNAAIAEDMYVIIDFHSHEAHTDQATAVRFFEDVATKYGQYDNVIYEIYNEPLQISWVNDIKPYAETVIDKIRAIDPDNLIVVGTPTWSQDVDVASQNPIDRANIAYTLHFYAGTHGQSYRNKAQTALDNGIALFATEWGTVNADGNGGVNINETDAWMAFFKTNNISHANWALNDKNEGASLFTPGGSWNSLTSSGSKVKEIIQGWGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Full Length Psychrophilic Cellulase from Pseudoalteromonas haloplanktis revealed by X-ray Diffraction and Small Angle X-ray Scattering
pubmed doi rcsb
source organism Pseudoalteromonas haloplanktis
molecule tags Hydrolase
molecule keywords cellulase
total genus 119
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1tvpA00
3RPMA 1HF6A 1V3JA 2CCRA 4JFVA 1QHOA 5BRQA 5CZKA 4LX4A 5M03A 4WKFA 1NARA 3U5UA 3VGGA 1LL4A 1UD6A 2VX6A 1XCWA 2JEPA 4X9YA 3L4YA 1H2JA 2WXDM 5CLTA 4TX6A 2QHAA 5IHSA 1WB0A 1C8YA 5AC4A 3SUVA 3HMCA 2J25A 3VDBA 1HKIA 4IUGA 1QNSA 3CZGA 5I2UA 1E4LA 1NOWA 3MMUA 1NM9A 1R7OA 4WK9A 3T09A 5BRPA 3DC0A 3HJEA 5A8OA 2X0YA 2WKGA 3OLEA 3DECA 3N18A 2JIWA 4TXEA 2EXOA 4RE4A 4FLSA 4AEFA 4BS0A 3W27A 4HOWA 5CPQA 3OGSA 1F4AA 5DF0A 1E55A 3WSUA 4W8LA 2V3GA 1CXEA 1MW2A 5BXSA 2BY0A 3VIIA 4TUFA 1AQ0A 2Y2WA 5CSYA 1DWAM 3VIOA 4WKAA 2UY5A 4M24A 5FIPA 1PEZA 4HPGA 3SURA 3W81A 1UD4A 4PMNA 4PCTA 3SCSA 3FXYA 3WN6A 2J8GA 3RJXA 4Z2HA 3ECQA 3GDBA 1TFVA 5E09A 3WH5A 2YBUA 3AXXA 3VVGA 1QBAA 1H3GA 2BNJA 1C3FA 1QNQA 3CUGA 1JI1A 2VX7A 2WMJA 2VO5A 3DYPA 1CGYA 2PWEA 3WF1A 3CHFA 2W62A 1VFOA 1VJSA 4UFHA 1E6RA 4P7RA 3RMEA 3WELA 4B15A 1JL8A 4PMVA 2ZXDA 1DEDA 2J7FA 4TX8A 1E15A 4EE9A 2MANA 1W91A 4J3SA 3CPUA 4GO9A 1W9BM 2GSJA 3VD4A 1V6UA 4MNJA 2XGBA 2ZXBA 2Q8XA 5AY7A 3ARPA 5FKYA 2C7FA 4AIUA 1BPLB 4XB3A 1VEPA 3T2QA 5A6JA 3WEOA 2JF6A 3GM8A 4HU8A 5I5RA 1ODUA 2X09A 3WUFA 4MAZA 2O9TA 3AIUA 1W1TA 4LQ1A 3WH8A 1GOWA 3AISA 2YJQA 3SUTA 3PZOA 1WPCA 3T0DA 3ARRA 1EOKA 4U31A 3WNOA 3VIPA 2QPUA 4L4PA 5I24A 1UKPA 1ZBCA 2XSBA 1QOXA 2DT0A 3TTQA 1UD5A 1GQLA 1LLOA 2ZX9A 3AROA 3ARUA 5CXPA 1V3LA 2J79A 3ZQ9A 5A2AA 4OKDA 3VKKA 5A8NA 1VEOA 1KWKA 1OIFA 4L4OA 2DGAA 1CXLA 4MTVA 2XVGA 2VVSA 3G6LA 2OSYA 2WW5A 2J7HA 2BFGA 1X6LA 2G41A 2YA2A 5HDRA 2BXYA 1E4NA 1B90A 4AZIA 1G1YA 3WH6A 4GZJA 1OGBA 3QOKA 2XWDA 5AYBA 4HMCA 3MSDA 2WHMA 3PN8A 1US2A 1WZKA 1G0CA 3GBDA 5JBDA 1NP2A 1KGWA 1TG7A 2BHYA 3OB8A 3CMJA 4GINA 1CTNA 2XWEA 3FN9A 1DWHM 1W9DM 3PTQA 3WBEA 1PJ9A 2AOSA 2RGMA 4J27A 1W32A 4AD4A 3VPLA 2V5CA 2PB1A 1W2PA 3QGVA 4IISA 6CGTA 1Y7VA 3MANA 4MNLA 1GHRA 1WE5A 1KCLA 2OWCA 2A3CA 3CZLA 3W6MA 5HPCA 3EDKA 2W63A 1HKKA 4LYPA 3K4DA 1Q6DA 4M1RA 1J9YA 3DHUA 4N42A 2D22A 3IK2A 5FOOA 2EO7A 3M07A 5A1AA 2ZXAA 1HL9A 3MO4A 1ZJAA 5C70A 1HX0A 2E9MA 3K1DA 1O6IA 1EA9C 1BG4A 2WK2A 2FHBA 3PZMA 1J0JA 3LPOA 1AQHA 2Y4SA 3MUZ1 3PZVA 1BG9A 2WMHA 2GFTA 5HOSA 5M3WA 1ISWA 3B8SA 3WD1A 4PEEA 4J7RA 4AW7A 3PBGA 2Z1KA 3CHEA 1UR2A 2XFYA 1E5JA 2AMGA 4CKQA 1HP5A 2E8YA 4DWSD 3CHCA 3BH4A 2F2HA 3K8MA 4OOUA 4MPKA 1EO5A 1ZU8A 3QHMA 5GPRA 1NWTA 1CGTA 1XGZA 4YHEA 1HKMA 1XSJA 1W3HA 1BGGA 5E0FA 2IXUA 5D9PA 2VVNA 2D2OA 2DEPA 3W24A 5CLWA 1JNDA 1FP9A 4B3LA 4FF5A 3KZSA 1XH1A 1V6YA 4QCFA 4UQEA 2WSPA 1CZ1A 2UY4A 3EMZA 1VENA 3MSGA 3M6DA 1ZB5A 1H0GA 4IPNB 5I23A 2FHFA 1M04A 1B3XA 3VD3A 4CN1A 2W92A 1JF5A 3VIJA 2CHOA 3WNNA 4W7WA 4ML4A 4F9DA 3WL0A 3BLPX 4RL3A 1J18A 3TONA 1H09A 1BYCA 3IAPA 2DT3A 1HJSA 2F61A 2XUCA 1V6WA 1LL7A 2YL9A 1FH7A 4E8DA 2J7EA 1E73M 2CKSA 5JBEA 1QW9A 4HMDA 4GKLA 4S3JA 2OWWA 4M56A 3WDHA 3SUWA 4CU8A 3THCA 1FFQA 4W8BA 4HZ8A 3A3HA 4GI6A 4ZXOA 3L2LA 4BQ5A 5BWFA 2WVVB 1HN1A 3VIFA 4XUYA 3T2PA 3N12A 5GNYA 3ZSTA 3AICA 5C71A 1KXQA 3WBAA 1V0LA 5EMYA 2CBIA 3CUFA 3HN3A 1W9PA 4UQBA 2VQTA 2WC7A 3WEMA 3OZOA 3RCNA 2PWHA 3AMCA 3BSGA 3VX1A 4Z2IA 1GJUA 4H04A 3GH7A 2GK1A 5I77A 2OSXA 1PIFA 3AZSA 3F5JA 1NH6A 3RILA 3I3EA 4U3CA 1UD2A 2TAAA 4BA0A 5LA1A 1K9TA 4W84A 3AMLA 2O9RA 1ESWA 1LL6A 1V02A 5A8MA 1OGGA 1ODZA 5IDIA 3MS8A 5EFFA 1OWQA 2V5DA 4UFLA 5A6AA 4D6IA 5IHRA 3TTSA 1JAEA 3MUAA 4W8AA 1CEOA 3VM7A 1KWGA 1W1VA 1KGXA 2V3DA 3CUIA 2XFRA 1SMDA 1C7SA 2WHJA 2PWGA 3U7BA 3UG3A 4MB5A 1E6XM 2CESA 3VIHA 1GVIA 1VEMA 4ZE5A 4P7QA 1JXJA 2WNWA 2PBGA 3MUIA 5EBAA 5A2BA 1DWFM 3ZO9A 4JFSA 1J11A 3SUUA 1V03A 3GBEA 1KB3A 4JHOA 1K9EA 2VRKA 5HBFA 3F5LA 3WFLA 3VD9A 4NRRA 4UFIA 4CU6A 3NUKA 5M5DA 5D8WA 5HXMA 5BXRA 1OIMA 3CUJA 1DTUA 1H41A 1HP4A 4Z2JA 4AD2A 3W25A 2D1ZA 2GUYA 3QHNA 3PZGA 2B31A 4R27A 2VI0A 4BF7A 2J77A 3ZJ7A 4DUVA 1CIUA 2DH2A 3RM9A 1AMYA 3U5YA 2E4TA 2O9OA 4P8XA 3VX0A 3CUHA 2VZTA 4P8UA 4RE3A 1MVYA 3II1A 1UYQA 2WBKA 3DHPA 5A6SA 1WP6A 1F4HA 1UA3A 4HOXA 1JIBA 1HJQA 4LYRA 3K4AA 1PX4A 4GZIA 1TVPA 1UQYA 1DHKA 3ZR5A 1MFVA 2WLYA 4JCMA 1JZ4A 5DMYA 2WLZA 3BAKA 8A3HA 2WWDA 4GIAA 1UZ1A 2BHZA 3AFBA 2G3MA 3PZUA 2J75A 1E6NA 4MDOA 4QLLA 1XSIA 4WKHA 3WIJA 1RH9A 3WQ6A 4LPCA 2YIHA 4PMDA 3WF3A 4X0VA 2CNCA 2DT2A 2Z1SA 3UR8A 4E8CA 4NRSA 3D5HA 3WQ4A 3EMCA 1TCMA 3WUBA 1RP9A 5AC5A 1BYBA 1E6PA 1Q6EA 3WDJA 3AS0A 4M82A 3VIKA 4GO8A 4AXNA 1WZMA 2VUYA 3POCA 2QMJA 1V3MA 3VNYA 4M8UA 3HU7A 1GOKA 1UWSA 1E71M 1EOMA 1XRVA 3WL1A 3WMSA 1W9UA 1BVZA 5JIPA 2DSKA 1UR0A 5CJ5A 4PTWA 4D1JA 2J7CA 2PC8A 4N0RA 2JALA 3CMGA 1VFMA 3WUGA 5GNZA 1BTCA 3ZSSA 1GCYA 1WZLA 2BXZA 3SCPA 3SCQA 2WM0A 2BY3A 5BROA 1OB0A 5LA0A 5DT7A 1MQPA 1JGIA 4UCFA 1WNOA 4PCSA 3CIVA 3EDDA 1CXHA 1Q6CA 2YA0A 1SMAA 4OBSA 1KR1A 1LG1A 3WFZA 4GQRA 2WCAA 4AY1A 1GQJA 1GPFA 1JFXA 2DPEA 2WVTA 2VTFA 2QF8A 5C8BB 3POHA 4BQ2A 4ATLA 3WDRA 3GNOA 4D6DA 2WSKA 4W85A 1C8QA 2GK1B 4F8XA 3AI0A 2J7GA 3DYOA 2YDSA 3NDYA 1WDPA 3PZNA 6TAAA 1YQ2A 3MKKA 3NJ3A 3VMPA 2BVDA 3OBAA 5CQ1A 5IFPA 3FAWA 1SYTA 3GTNA 2YOCA 1UR9A 1B3VA 4MAVA 1ZL1A 1QI2A 2YBTA 4H8UA 1JYWA 1XYFA 2ZE0A 5EFDA 4MB4A 4KRUA 3AHVA 1UWUA 4DWSB 1GOIA 2YKKA 4GI9A 3VGDA 1JDDA 4M29A 2VZSA 2GJXB 2ZUUA 3NYDA 1ZBVA 1CGWA 5A6LA 1QHZA 2NW0A 4JKMA 4GPNA 3ALFA 3ARSA 1V02E 1S46A 4C7GA 4AZHA 3ARVA 4ZFMA 2CPUA 1Q4NX 3VDCA 1E5NA 5ECUA 2QMKA 1J12A 2CKRA 4H41A 3KWXA 1EQCA 4PMUA 4S3KA 2G8ZA 4E2OA 1L8NA 4HTYA 2YLLA 2YDQA 3AIWA 5GNXA 3AMDA 4XZBA 2BV9A 5DO8A 1EH9A 5CG0A 2D3LA 1TMQA 2W66A 1O7AA 1DWGM 2WHLA 2YL8A 6A3HA 1B0IA 5BXTA 1GVYA 1EDQA 4KMQA 2CXGA 2D0GA 3TTYA 4PYSA 4Z2GA 1LG2A 2ZUTA 3L4ZA 1E6ZA 1JYVA 3MU7A 1J01A 4PBGA 3LPPA 3LPGA 2OYLA 2E3ZA 4P7OA 2XM2A 4H8VA 3N1AA 1HXJA 2ESCA 2WPGA 5ABEA 2NT0A 2VZUA 3IJ8A 5A6MA 1A3HA 1CXKA 1E3XA 1TR1A 3SCUA 2JE8A 4U3AA 4A3YA 3ARYA 1UH2A 3ZJ8A 2G3JA 3AIQA 4X0NA 3OLIA 1QW8A 1UH4A 2WKLA 5E70A 4EAMA 2WHKA 2XSAA 4A3HA 4DUXA 3CLWA 1W3LA 3S2CA 1B3WA 4CCCA 1VFUA 1WAWA 1XH0A 1H0IA 4TVUA 1PIGA 1M01A 4DWSA 3W53A 3T0BA 4W7UA 4PSRA 2ZWYA 4V28A 3AYRA 5ABGA 1V08A 4ACZA 1AVAA 3VM5A 3BCDA 5ABHA 2WZIA 1WDSA 2VURA 2WBGA 3AIBA 1ZJBA 1CXFA 3FY1A 2OLHA 2BVTA 5D9OA 1UD8A 3I3DA 1NOFA 3KEHA 2DT1A 1GW1A 1LF1A 4URIA 3SUSA 2CYGA 4OOZA 4PMQA 2EPMX 4W5UA 8CGTA 1B31A 4JL2A 3IJ9A 1M03A 1MQQA 2GVYA 4UQ9A 5DT5A 5EB8A 1OT1A 4AD3A 1PX3A 4EANA 4E4PA 3VINA 1FH9A 4HOZA 1ECEA 2WVSA 1KQYA 2XTKA 2ZUWA 4JCLA 4PMYA 4V2XA 3ARXA 3W0KA 4PSPA 3VILA 4CVUA 1OD8A 2DIJA 1UKTA 4H7VA 1U2YA 4MB1A 5A3HA 5JBFA 1B1YA 4V27A 4KGLA 3UR7A 4WLCA 2VQUA 1JXKA 2WZEA 1E1FA 3BMWA 4AD1A 4BQ4A 3WENA 4KGJA 2VCCA 4PN2A 2GJPA 3NDZA 4A4AA 4AEEA 2VR5A 3WQ8A 4P8WA 1W2VA 2FDMA 5BYWA 1UHVA 5A69A 2WMIB 1GZJA 3SCNA 1XD1A 1BQCA 1R86A 2ZUMA 1OINA 1HNYA 4UFKA 1BGAA 4UQDA 2E9LA 1BLIA 5CGMA 1ISVA 2GDUA 4GQQA 4CVWA 2ZX5A 2ZUVA 2WCGA 1RD6A 1TVNA 4JKKA 3VGBA 1EQPA 1J0HA 1JZ7A 3VGFA 2VNCA 2O92A 2D0HA 2XFFA 1J10A 3LPFA 4Z2LA 3M7SA 3VNZA 1JAKA 5JIWA 3RO8A 1XD0A 1NOUA 1BHGA 1BYAA 3PZIA 3RM4A 1A47A 2W91A 1HT6A 2VMFA 4GI8A 3WY1A 1EXPA 2CBJA 1JZ3A 4NSBA 5A8QA 1ZS2A 5I3DA 1QHPA 1UUQA 4U2YA 2OYMA 1HVXA 1XYZA 3ZJKA 1RP8A 1IZKA 4W88A 1J0ZA 2WMIA 1KBBA 2CETA 3OGRA 2F8QA 1J0KA 4PTVA 3BSHA 4NZCA 5ABFB 4UOZA 2WMKA 1G9HA 1ZBKA 5KEZA 4QFUA 2YL6A 2PWDA 3AOFA 3LMYA 2XJ7A 4JFTA 1E0XA 3WDPP 1C7TA 2JF7A 2BS9A 3MV11 1CDGA 2DDXA 1CECA 3G6MA 1V3KA 5CGTA 3FHAA 2E8ZA 3IANA 3WD0A 4M81A 1HJUA 1EDGA 2EPKX 2OWXA 2QPSA 4JFWA 1I1XA 3CBWA 1VBRA 4UQAA 2DSUA 2NT1A 3GXDA 3U7VA 3RIKA 1I1WA 3QOMA 1JG9A 1NWUA 1W1YA 4FLQA 3UG5A 4M80A 2W4XA 1NWRA 1TE1A 4U2ZA 1E43A 3ZIZA 2ZICA 2XG9A 1M53A 5A2CA 1BAGA 4WSJA 1CYGA 3WD3A 3MUY1 1CGUA 4OIFA 3TP4A 2VOTA 3AS1A 2BHUA 3BMVA 4J3XA 2CERA 2A3HA 4JHZA 2VC9A 4MNKA 3A47A 4GZEA 3ZT6A 4B9ZA 2XHYA 2VT0A 2XVNA 2XVPA 2J62A 2ZOXA 1R85A 3FHQA 3ZT5A 4TVDA 3WH9A 2Y8KA 3L4TA 4P7LA 3W37A 1Q6FA 1QBBA 3O6AA 3BC9A 3SCTA 3SIMA 1JYXA 4LXFA 4MJ4A 1PBGA 3TTOA 2YDRA 3MMDA 5LYRA 3GNRA 1IZJA 1GJWA 3JUGA 2C0HA 2Y5EA 3AZTA 3ZJ6A 3W26A 2OSWA 1PAMA 1XH2A 4UQCA 1LWHA 3AHXA 3CH9A 4AC1X 2WVVA 4HMEA 3FW6A 2VZVA 1UQZA 3ARTA 4PTXA 9CGTA 3QHOA 1ZBWA 3SCOA 1YHTA 1QVBA 1TA3B 3B9DA 4J3VA 1VF8A 4FK9A 5E9AA 1PPIA 2XGIA 1OBAA 1JNEA 1UR8A 1GONA 1GQKA 3DYMA 1D7FA 3WF2A 1W1PA 1UD3A 4UZUA 3N11A 2CIPA 5HPOA 3ZOAA 3WQWA 1C90A 1UG6A 3OZPA 2PI6A 1JDCA 2ZIDA 2AAAA 2VCBA 5BCAA 1ITXA 2YL5A 1WDQA 3UG4A 2W5FA 1CWYA 3AHTA 1V0NA 2EJ1A 4AIOA 1MFUA 7CGTA 1KQZA 4J3UA 4W86A 2FH8A 4D1IA 2YA1A 5TD4A 3WF0A 4UNIA 3W28A 1FA2A 2VR4A 1QI0A 4YPJA 1FHDA 1ISZA 2D0FA 1K9DA 3AMKA 4WJXA 2V3FA 4WIWA 1JZ2A 4CCEA 1H5VA 2UWFA 3A4XA 1HJXA 3IAQA 1U33A 4Q22A 3EDEA 1EO7A 4D6GA 2V38A 3WMCA 1BVNP 3ZMRA 3VMOA 2W67A 4PUEA 4F9JA 2E0PA 3VTRA 4MJ2A 3AHZA 2ZUNA 3WDIA 3VIMA 3UERA 1CGVA 3BAYA 2GJXA 2X1IA 2XM1A 1GQIA 4HZ7A 2VCAA 3M46A 4OZOA 2WWCA 3WEZA 1UZ4A 2DSVA 3MMWA 4CCDA 4D71A 2Y24A 4AYSA 1P6WA 4JZ5A 4KWUA 3F4VA 2ZWZA 2FGLA 1CLXA 3T08A 2X8RA 2X0HA 2A3EA 3WMBA 2J7DA 3WNKA 1B9ZA 3OA5A 3GXIA 1H1NA 1NP0A 3RDKA 1QI5A 5F7UA 1HJVA 2BY2A 4C7FA 1V6XA 3WUEA 4AZBA 3EDFA 2CBUA 1Q6GA 3A4WA 1LWJA 4MADA 3VO0A 1MW1A 3N15A 4AZGA 1TA3A 1VIWA 4UFJA 4UOQA 1VAHA 2ZX6A 4PUDA 3O9NA 7A3HA 4D6HA 4D6JA 1E56A 1OT2A 1XV8A 3CGTA 1CNVA 3APGA 1G01A 2CITA 5E6YA 4W5ZA 2E40A 4TTUA 4D6EA 1US3A 4YHGA 3U57A 1KXTA 1G5AA 1XC6A 3UESA 1H49A 4U5IA 1KCKA 1QI3A 1FHLA 2XPKA 2WMFA 1D2KA 3WQVA 5I0DA 2BY1A 1E4IA 1MYRA 1XHGA 4ZE4A 5A6BA 3L4UA 3WD4A 3FNDA 1BYDA 1MQRA 1HJWA 4FMVA 1WO2A 2DH3A 1WZAA 3ALGA 3I3BA 4F79A 1MWOA 4UTFA 3WQ5A 4HU0A 1GOOA 4B3KA 4JKLA 3BGAA 1N82A 2FHCA 4AWEA 3UCQA 1JDAA 2A3AA 3WH7A 3K8LA 2JEQA 1UH3A 4MB3A 4RE2A 3OG2A 5D9NA 1UWRA 2W61A 3QR3A 1MXDA 3VU2A 1X1NA 2PWFA 1DWJM 1LJYA 3J7HA 3OLDA 4BZYA 1W9VA 4PMZA 4YN5A 1UOKA 3MV01 4DM1A 1PX8A 3N9KA 4W7VA 3CHDA 2EEXA 4CD4A 4U33A 1U30A 2CEQA 3GXFA 4DWSC 3CZEA 2JFEX 5I79A 3WF4A 4PMOA 2WC4A 3NSXA 3L4VA 2GDVA 4JL1A 1JD7A 1GHSA 4XZWA 1UKOA 2WZHA 2DQXA 3E1F1 5E0CA 4HA4A 4CD5A 1JZ8A 3AXIA 3VMNA 2EPNA 4HZ6A 1OGSA 4AZCA 3W29A 4NF7A 4PMXA 2WB5A 4JFUA 7TAAA 3CO4A 4MDPA 1UWTA 5DEZA 3FAXA 5HNNA 4ATDA 2NSXA 3KL5A 5FCZA 1BFNA 2UY2A 3T2OA 1JI2A 5IFTA 3GNPA 1C91A 4TVCA 3NIYA 4XV0A 2J4GA 3UETA 1B2YA 2EPOA 3EYPA 1GUVA 2E9BA 3B9EA 1UR4A 3W38A 5D8ZA 1KXVA 4BCEA 3OIHA 4AZCB 3ZT7A 1R87A 3TOPA 5A6KA 4JIEA 1IV8A 4QP0A 2DSWA 1UKQA 3GYCA 2IUZA 3N04A 3BLKA 4B9YA 5ABFA 3VUPA 1MW0A 1DWIM 3PTKA 1E1EA 2YLAA 3AQUA 1ITCA 1SR0A 5I6SA 1FH8A 1G94A 4W87A 1EHAA 4C7DA 1GNXA 1J0IA 4LYQA 3VD7A 1CXIA 3VDAA 3PZQA 1VFFA 2OYKA 3AZRA 1FP8A 3NSNA 4CGTA 1E0WA 1DP0A 5IXEA 4MNMA 1QNOA 4LGXA 3ZR6A 3GH5A 4CD6A 3PZ9A 3A6OA 2G3NA 2VL4A 1SFSA 1E6SM 1VBUA 4BQ3A 3PTMA 2XIIA 4K68A 1W3KA 1NWSA 1QNPA 3THDA 3AS2A 5E6ZA 4ATWA 1V6VA 3EBVA 3EMQA 1JD9A 3VGEA 3AIRA 3N17A 1UR1A 5FD0A 4CN4A 1UWQA 1BSIA 3PZTA 3NSMA 4UZSA 1CPUA 2ZX8A 2VX5A 1NQ6A 3IJ7A 5JUVA 1CBGA 1PZ3A 3WD2A 4ACYA 3KE0A 4EKJA 4ZEPA 1J0YA 3OLGA 1QI4A 2VJXA 1TZ7A 1KBKA 1XCXA 1CGXA 1Z32X 4QLJA 1VB9A 3KL3A 4DM2A 4AD0A 3WNLA 1K9FA 4HPHA 4P7NA 1EGZA 3UEQA 3B9AA 1VRXA 1ISYA 1KGUA 2G4FA 3RJYA 2D3NA 1FFRA 3WDQA 1D3CA 5A94A 4H8HA 4WSKA 2J8FA 1HVQA 3BAIA 4CD8A 4Q7NA 2X2YA 4ACZB 4D6FA 4QAWA 2WVUA 3GXMA 1CENA 5AYIA 1E3ZA 3T0AA 3CZ8A 3VGHA 3BAWA 1K6AA 2WC3A 2JIEA 1CLVA 2EPLX 2XVLA 1WKYA 1LQ0A 4KRTA 4UFMA 2WYSA 5GQBA 4W89A 1OM0A 1OSEA 3L4WA 3S6TA 2DIEA 3N13A 2EBNA 5M17A 2WANA 4WF7A 3KL0A 5DFAA 1X6NA 3TA9A 4B16A 1M7XA 1JF6A 2O9PA 3EDJA 4AISA 2UY3A 4IM4A 5CSUA 3AXHA 5CPTA 4OBRA 4EK7A 2C8NA 4R5EA 1WCGA 3GH4A 1JZ6A 1WDRA 2XYLA 1H11A 3NCOA 4AZ5A 3RM8A 3SCWA 1C8XA 3AJ7A 4HA1A 1H4PA 1EIBA 1C93A 1E40A 3ARQA 5CPSA 5LA2A 1OD0A 3CTTA 3PHAA 3O2LA 1I75A 4P8VA 1GOQA 1E72M 5A95A 1E4MM 1KFWA 2D23A 3CZKA 1TUXA 4FLRA 1V3HA 2D24A 2J7BA 2VX4A 1KXHA 3AMGA 4U5KA 2X05A 3VD5A 2PF0A 5D4YA 2QLYA 4FLOA 3ARZA 4CUCA 1JFHA 3VIGA 3BCFA 4J3WA 3A4AA 1HL8A 2RGLA 3W6LA 4HA3A 4IPLA 1AQMA 1KR0A 4OUEA 1E70M 3AIEA 3D3AA 5BXPA 1B30A 1QPKA 5A6BD 3ARWA 2WAGA 1R7AA 3WNMA 5FL1A 4AZ6A 3L2MA 4AMCA 2CBVA 2ZXQA 1V0KA 1JYNA 3AHYA 4ZENA 1E6QM 4AD5A 1W3JA 1GOMA 2HVMA 4OJYA 2V3EA 4UOJA 5I78A 5FL0A 2ZX7A 5D9MA 4F66A 3WNPA 1EHNA 4PTMA 2WCSA 1ISXA 4CU7A 4Z2KA 4UR9A 3WKZA 2G3IA 3AYSA 4QLKA 4AZ7A 1C92A 1E9LA 2D20A 1HKJA 3VOCA 1BF2A 2VZOA 3W4RA 1L0PA 3VDHA 2A3BA 1QNRA 2GJRA 1V3IA 3F5KA 3SCRA 4PRWA 4GXPA 3AS3A 4CD7A 1RPKA 1GORA 4JAWA 2PBOA 3CZJA 1MXGA 3SCVA 2CHNA 1FOBA 4DUWA 1UA7A 4D72A 3K46A 2FH6A 1UWIA 4D6CA 4QCEA 4PMRA 2WMGA 4H2CA 1OCQA 2J74A 2BVYA 3GZAA 4QDMA 2EQDA 4AIEA 1EDTA 2VRQA 4XX6A 3L4XA 3BAXA 4NI3A 2DSZA 1R8LA 1B3ZA 1W9XA 2QV4A 2VRJA 4TOQA 1JZ5A 5KZ6A 1MW3A 3W82A 2J78A 3AIVA 2ZUSA 1XSKA 3K8KA 4J3TA 3SEPA 4KH2A 2XIBA 2HISA 2IXVA 1UKSA 4ZXLA 2J47A 5A8PA 1IT0A 2Y8VA 4Y7EA 4TTGA 1B3YA 1PZ2A 3ZM8A 1V0MA 4CN6A 3BAJA 1HIZA 3BXWA 2XVKA 1VJZA 4J28A 1E0VA 4HP5A 2FGZA 3OGVA 4W93A
chains in the Genus database with same CATH superfamily
2NQLA 3RPMA 2J13A 5BRQA 2ZQ0A 3BG5A 1U1UA 5M03A 1SZGA 1NARA 3VGGA 4HK7A 1BKSA 5ECVA 4BEQA 4XKYB 1UD6A 2BG5A 2DZSA 3NQ7A 1S2CA 1X7IA 1RQHA 2VD9A 2E25A 3F1QA 2FMOA 3PB0A 3L4YA 1AODA 2E1DA 1UCWA 4TX6A 2QHAA 5IHSA 1MNZA 2HV5A 4PUMA 2GVEA 3GIQA 3H26A 3VDBA 2X7WA 4IUGA 5FI8A 3WK1A 5I2UA 3EX1A 3MMUA 4WK9A 1NM9A 1R7OA 3NR0A 2DUZA 4JQ3A 4WHBA 3HJEA 2CU0A 2WNZA 2CW6A 4C60A 3BGGA 3N9SA 1K1DA 4DNHA 5L9FA 2WKGA 1FDYA 4ZB0A 5E9XA 3IGUA 4BS0A 4H9XA 2ZA1A 3OGSA 1R9XA 1E55A 1VBGA 4IX2A 4Y9AA 3MVTA 2WSYA 3QR0A 4FHAA 1B3OA 3D47A 4LY8A 3L65A 1PEZA 1UD4A 1ZHAA 3WN6A 1OFEA 3GDBA 1TFVA 3UR5A 3WH5A 5I02A 3NQGA 2ZKMX 4IICA 1RR2A 1XBYA 2BNJA 1U83A 2WMJA 2XH2A 3RCMA 3S1GA 3CHFA 3LCXA 4MYXA 4P7RA 4B15A 4PMVA 1E15A 2MANA 5D37A 3GW0A 5FSEC 3M5XA 4GO9A 2EHHA 3RAOA 5I07A 3N2XA 4WOQA 3QMSA 1EJXC 4IHCA 2Q8XA 1I2RA 3UXAA 2C7FA 3CPRA 3BV4A 3EOSA 1FWBC 5A6JA 2PDFA 2NWSA 2TODA 3H55A 2X2GA 4R3UA 5HJXA 1W1TA 3N6QA 4LQ1A 1MO0A 3AISA 1WPCA 4HNTA 3LS9A 1FKXA 3DBNA 2WZTA 2ZBTA 2QS8A 1LLOA 2ZX9A 5CZTA 3AROA 1FHVA 2QDGA 3Q37A 4LF1A 2R1NA 3M0JA 3DG3A 3BANA 5AOUA 2Y1HA 1VEOA 5H8MA 4K36A 3IIVA 5T91A 1UMYA 3QC0A 1IEWA 1OFDA 5AZ1A 4H7CA 2WJEA 1RHCA 2Y62A 4KWSA 1LTDA 1O68A 5D04C 4I5XA 3NNTA 3MSDA 2WHMA 4DUOA 4HPXA 4QS5A 3GC5A 2RKXA 3KVMA 1CB7B 1KGWA 1TG7A 3QRHA 1XFBA 3EWWA 3OBEA 4US6A 4XO7A 1CTNA 4GINA 1F05A 2V68A 3PTQA 2AOSA 3DDMA 4J27A 1HQTA 1WKEA 1SZFA 5MF5A 2V5CA 3MANA 4O52A 1ME7A 4A2RA 2A3CA 3LGGA 4QROA 4LF2A 1OFAA 1HKKA 4LYPA 1Q6DA 1J6OA 4GUJA 1IXPA 4O4VA 2C1GA 3IK2A 3MO4A 3K1DA 3MUCA 3KTCA 4QG6A 2FHBA 1A5SA 4JTCA 2AL2B 3SO7A 3LPOA 4LBRA 2ZC1A 1BG9A 2NQ9A 3FYPA 1XYMA 5HOSA 1XRSA 5M3WA 1VLIA 5CBBA 3WD1A 2Z25A 3LI1A 3O63A 3SGZA 2Z1KA 1QFEA 1JUKA 1UASA 3KBSA 3LGEA 2F6UA 3TK7A 1K8XA 1DBTA 1IXOA 2E8YA 3DXIA 5KZMA 4DWSD 4Y96A 5HATA 2PLKA 3K8MA 2Z24A 4U10A 5AYYA 1EO5A 1ZU8A 3QHMA 1E9YB 5GPRA 2E7FA 2ZCGA 4HSOA 2O4MA 3DFYA 5E0FA 3RGTA 3HPFA 2YCJA 1YPIA 3SY8A 3W24A 3NO5A 4A8LA 1JNDA 1FP9A 3F2DA 4FOKA 4B3LA 3HBLA 5CBIA 2F2KA 2Q8ZA 2X1UA 1S2TA 9XIMA 1R6WA 1ICQA 4UQEA 2PCEA 3EMZA 3QW3A 1VENA 3MSGA 1TV4A 4MPQA 1G6CA 4EXAA 4MFEA 2A7RA 1OX4A 3TQVA 5B80A 4M7TA 2I57A 1XBZA 4ML4A 4F9DA 1OX4B 3WL0A 1ITUA 4RL3A 2XISA 5MKGB 4IIDA 2NVDA 3TAOA 3GG0A 2XUCA 2KAUC 3QQ0A 3TN3A 2J7EA 1C9DA 4O14A 3FDGA 2CKSA 5JBEA 3P62A 5K4ZA 1PDZA 3USBA 4W8BA 1FFQA 4UXDA 3A3HA 3FA5A 5BWFA 2WVVB 4JR5A 1LRNA 3QZEA 2J9XA 4DJFD 3T2PA 3K1GA 3ZSTA 1UC5A 4NAEB 1KXQA 6REQA 3UZXA 7REQA 1XJBA 3CUFA 4HNUA 3HN3A 4MGGA 2VQTA 3WEMA 1QCWA 5U7SA 2PC4A 4Q4MA 3OZOA 3WCZA 3AMCA 3LYEA 1GJUA 4ICNA 5DXXA 3LRLA 2CHRA 3E0VA 1H51A 2OSXA 1PIFA 3GVVA 3HPXA 1O12A 2TAAA 4V15A 2O7QA 3HG4A 3VNKA 4KWVA 5LNUA 2PDGA 2QXWA 1S2VA 4BF9A 3P5YA 2NZLA 3V18A 3PBWA 3P8JA 1OWQA 2V5DA 2GOUA 1TPH1 2GGEA 3TTSA 1U5JA 1JAEA 3VA8A 3MUAA 4JTQA 4Q8TA 2OOGA 1XL9A 1ML1A 3UWYA 4GK8A 2V3DA 3CUIA 2XFRA 4INFA 2GGJA 3U7BA 4LUYA 3V5OA 4G7EA 3TAKA 2ZRVA 3E2SA 1DWFM 1J11A 1MMFA 4AWSA 1LT7A 4RXFA 4PCFA 2ZA3A 3CQIA 5AECA 2QJHA 1F7BA 4G8TA 4Z2JA 3NEHA 4AD2A 3W25A 1TV3A 2GUYA 3QV7A 4N9EA 4QJ3B 3QHNA 3TR2A 1AD4A 1BWLA 3UWQA 3ZJ7A 1CIUA 5BZAA 2DH2A 4GCAA 5G2HA 2CLLA 4H01A 1GWJA 4RE3A 3PUDA 3DHPA 5A6SA 5LIXX 1DXFA 2A1YA 1PB0A 1S5VA 4FNRA 5MKGA 2D2HA 1Q63A 4EACA 4AXKA 1HJQA 4YCPA 4GZIA 4ZOEA 1EWDA 2PLCA 1DHKA 1FWAC 2DVTA 5AHLA 3ZR5A 1JZ4A 4NILA 3A4JA 1LBMA 3IVTA 2WWDA 5D2VA 1OZQA 1T96A 2O7SA 3LTPA 3URAA 1TPDA 3E49A 3RG6A 4WKHA 4LY4A 3WQ6A 4NJKA 3QYQA 4IIEA 3R0KA 4I9AA 3NG3A 3UR8A 1FWSA 3EMCA 4K3ZA 1RP9A 5AC5A 1E6PA 1FTXA 3VIKA 1TREA 1WZMA 5L6UA 1V3MA 2R82A 1KFEA 2O0TA 1GOKA 1R38A 4YTQA 4IMGA 4OE7A 3WMSA 1W9UA 1UR0A 1J4EA 5CJ5A 2J6VA 3TR9A 4O11A 1JDFA 2R1PA 4D1JA 2J7CA 1IEXA 2ZRYA 2QCNA 3IUIA 3CMGA 4LFYA 1VFMA 1DJGA 3NXFA 2HNHA 2A7NA 1GCYA 1K6WA 1H61A 1XLCA 2OU4A 3TDFA 4LAUA 1H1ZA 1OB0A 5DT7A 4CQAA 3CNYA 2QEZA 4UCFA 4OVXA 2Y5JA 3CIVA 4X9SA 1Q6CA 2V5KA 2YA0A 3WQDA 1R3YA 1RCXB 2PGFA 4RR4A 4YWSA 4IOTA 4GQRA 1PSCA 4REQB 1YDOA 1GQJA 2IQTA 2PTZA 3PG9A 4HJWA 1X98A 3POHA 4BQ2A 4ATLA 1AL7A 1SW3A 3NVTA 2ACRA 3CXOA 4D6DA 4W85A 3ZWTA 1C8QA 2GK1B 3AI0A 3S5YA 1QNVA 2C1IA 1M1BA 1YBQB 3VMPA 4Q8WA 5IFPA 3W7QA 3FAWA 4QNEA 2GLKA 3GTNA 2YOCA 3SN1A 4H00A 1QPRA 4PTNA 4MAVA 2YBTA 2Q09A 3BLFA 4MB4A 2PF8A 1UWUA 4DWSB 1DTNA 4GI9A 3VGDA 1JDDA 2VZSA 3IGHX 3H2AA 2ZUUA 4ML9A 3NYDA 3U8GA 1CGWA 1A50A 4PUUA 3LGDA 1PKLA 4JKMA 3ALFA 2ZRUA 3ARSA 1S46A 4C7GA 2PDBA 1S1PA 2IKIA 1JCLA 5H8UA 3H2NA 1Q4NX 1BSLA 2EAWA 2OPJA 5BOOA 2QMKA 2CKRA 4H41A 3UXDA 2JGYA 2G8ZA 4E2OA 3LCGA 1L8NA 4JX6A 3AIWA 3RNDA 3W84A 3PP7A 5CG0A 2D3LA 1O7AA 1DWGM 4PBEA 1GW9A 4RDYA 1GVYA 5HAOA 3UZJA 1W1ZA 3STGA 4KMQA 1G69A 1KKOA 3RXZA 5D2TA 5DMLA 3IIXA 2ZUTA 1XUUA 4ZB5A 1N7KA 3D6NA 4M7SA 1QRQA 3N1AA 4DX3A 2YCEA 2V9DA 4BWLA 3IJ8A 4DJEA 1K7FA 2RDXA 1EP1A 4NNAA 4Q8PA 3AIQA 1DYSA 5DLCA 3RX3A 1FHUA 5E70A 2WHKA 3WQOA 3GTXA 1W3LA 3SQMA 3NAVA 3NTYA 2HJPA 1QWKA 4KW2A 3ZLFA 3T0BA 4W7UA 3ERPA 2WZIA 1WDSA 3TW7A 5LZLA 1Q65A 3COTA 2WBGA 4B92A 1W5QA 2D2JA 1DJIA 1UD8A 3G8EA 3RK8A 3S9YA 1UJPA 5H2ZA 2DZAA 2CYGA 2CLMA 3LB0A 1PXGA 1K7EA 4W5UA 4ZR8A 2OZ0A 8CGTA 3PANA 4QM1A 5CPLA 3M0MA 4QG8A 4JL2A 4K7VA 4KS0A 1DVJA 3JW7A 5C55A 3PK7A 4GVFA 3W2JA 4IL2A 4C6DA 3KP1A 3QC3A 4LRTA 4AC7C 1R2SA 1AG1O 4OTKA 4TIMA 4C6MA 4F0LA 2XTKA 3G1FA 3QV9A 3VILA 2C91A 4OUIA 2GQ9A 1JRCA 1U2YA 2DVXA 5A3HA 3FGCA 3OZMA 2VQUA 2GWGA 2QCGA 4DYKA 4AVFA 3DFTA 3WENA 4OQVA 1EC8A 4XKMA 3LM7A 3LLXA 3L23A 4FR6A 3PNZA 4JTGA 2VR5A 1FUYA 4KFPA 2IPGA 2XIOA 3NWRA 2BOGX 2Z27A 2OZTA 2WMIB 3SCNA 2Q6ZA 4H6KA 1OINA 3SB0A 1OEPA 3KVKA 3LCIA 4KIEA 3E38A 4UQDA 2E9LA 4I7WA 1ISVA 2GDUA 1QWGA 4GQQA 1OYCA 3R25A 5C7HA 1WBJA 4YS1A 4HKPA 1KCZA 3MY9A 2JGQA 4JKKA 3FKKA 3IIOA 2VNCA 5FF2A 2O92A 4E4FA 1LDCA 2YYTA 1J10A 1B9BA 3M7SA 5DMMA 1KV8A 5JIWA 3URBA 4Q7IA 3EX4A 4Q8QA 1SJCA 4GI8A 3WY1A 3TYBA 5U4NA 4REQA 1YLVA 3GU9A 1QHPA 1SR9A 5HANA 2J27A 2OYMA 1HVXA 4WQ6A 4W88A 1J0ZA 2WMIA 1XM3A 4R9OA 3OHIA 3M6YA 2G0WA 2WMKA 3P0WA 4JTKA 1TIMA 3LMYA 2XJ7A 4JFTA 2WNNA 3TV8A 1HTIA 3TJLA 2P5NA 4DO7A 2Z29A 3MT1A 1LLWA 1CCWB 2VM8A 4JIRA 4IIFA 1NU5A 4BKNA 1OX5A 4E5TA 2E6AA 2DSUA 2EGZA 4RKAA 3VUSA 1SFJA 3S4TA 1O4UA 4PMJA 3CL6A 3TTEA 2W4XA 1ONRA 1A5CA 2Z2UA 1TE1A 1X1ZA 3EWXA 2ZICA 4LUIA 1H7NA 2ICSA 3L0NA 5A2CA 1X97A 3WD3A 1O5QA 4OIFA 8TIMA 8XIMA 3T6CA 2DZPA 2PTXA 2BHUA 4PC8A 3BMVA 4J3XA 1R2RA 1RQEA 3A47A 4GZEA 3ZT6A 4B9ZA 2Z6IA 4MWAB 1R85A 3OEXA 3UVIA 1BRLB 3W37A 3SCTA 4C65A 4PL1A 1A49A 4MYAA 3IPWA 1AJ2A 1Q6OA 2YDRA 3UNDA 2C0HA 3GD6A 3W26A 1PAMA 4UQCA 4JX4A 4C6OA 3AHXA 1J8VA 4GX8A 9CGTA 3ARTA 1RA5A 2R8WA 3V0TA 3GNDA 4E38A 3WO8A 3TNBA 1GVQA 1P1XA 4FXJA 4WDUA 2XGIA 1OBAA 1JNEA 1FWEC 1UR8A 1XI3A 4S38A 1EA0A 3H4GA 2BBFA 3E0IA 3ZXWA 2CIPA 1TPEA 3LHUA 3WQWA 3OZPA 4NXKA 1WDQA 4WDWA 2POTA 1CWYA 3AHTA 3HQNA 3HGRA 2EJ1A 7CGTA 3K13A 3SQLA 4J3UA 4W86A 2I9EA 4Q4OA 1VCGA 3SADA 2OQLA 1Q8JA 5K9XA 3HMJG 4OV4A 3CQJA 1QI0A 7ENLA 4PRRA 1FHDA 1Q5MA 5FJIA 1UBSA 2BOFX 1XWYA 1K9DA 3GKAA 1NJJA 1F6KA 4RW3A 4UTTA 3GK0A 1Q4WA 1H5VA 5CC3A 4XTDA 1HJXA 3MI2A 5CC7A 1YTKA 2V6AA 3SECA 5FSDC 2QZRA 3OPSA 2W67A 5T8GA 2E0PA 4WGHA 4DF2A 3XISA 3PSVA 1UJQA 5KETA 1TPC1 2ZUNA 3WDIA 4C91A 3TQKA 2INFA 4HU3A 4IGHA 1VFSA 3GFXA 1FCUA 2QJMA 1RJPA 3IWPA 4PEKA 3I6TA 2XM1A 3FEMA 3LK6A 1GQIA 3V0UA 6REQB 3M46A 4OZOA 3QZAA 1SZEA 4A8NA 5I03A 1RXOB 1RAKA 1P6WA 4JZ5A 2ZVRA 1GKRA 3CB8A 4ASTA 4DZHA 3CAKA 3QLLA 3TVAA 3LTYA 1S5TA 5AHFA 3WYZA 1B54A 3PUEA 1XIIA 3WNKA 2O56A 1NP0A 5GJNA 1HJVA 3PAJA 4C7FA 3RX2A 2Q3RA 4L7ZA 1K7XA 1XQLA 3O05A 3EDFA 2O55A 3CUXA 2PGWA 3N15A 1VQTA 2Y70A 3W7MA 3N25A 2ZX6A 1XF0A 3A5VA 3QQWA 3O9NA 1YE4A 7A3HA 1FWIC 1OT2A 3M0KA 1L6GA 1GVSA 2PTDA 4DLMA 3B04A 3WLTA 3CEUA 4N6EA 1G01A 4MIMA 5PTDA 2AKMA 1G5AA 3S1UA 4U5IA 4N6FA 1QI3A 1RJQA 2IMRA 1DQWA 2G95A 1KFJA 4H9VA 4FB7A 1YADA 3WQVA 3P5ZA 5I0DA 3QR1A 4I5UA 1Y5XA 3GTIA 5EMMA 1MYRA 1CX9A 3A21A 1M7PA 4ZE4A 5A6BA 3S6OA 3FNDA 4B5VA 2EG7A 2WNQA 1REQB 2A6NA 2P76A 1WO2A 1R47A 4QHRA 5AC6A 2QCFA 3M0YA 1P43A 4BY3A 3NL6A 4UTWC 1N82A 2FHCA 3UCQA 3FV9A 1JDAA 1XLEA 3WH7A 1A5OC 1UH3A 5REQA 3T05A 3CTLA 4FX8A 2ON3A 5D03A 1LCOA 4HHHA 4DBUA 2GZXA 1W9VA 4L9ZA 4JN6A 1KFBA 3GTFA 1UOKA 3MV01 4DM1A 1QO5A 1UP3A 4HN4A 3OYZA 4QIUA 4DWSC 1VC4A 3WF4A 4PMOA 1QAPA 4XD6A 2WC4A 5FEWA 2E09A 3NSXA 3QPYA 3L4VA 2GDVA 1JD7A 3W2LA 1ITQA 2OQHA 1BKHA 4DJDC 5EMUA 1P7TB 4HA4A 1E51A 1P0KA 3AXIA 1OGSA 1PWLA 3EWCA 3ZYZA 1MDLA 2Y7FA 3OA3A 3TC6A 4AZCA 4PMXA 3M5VA 2HE5A 7TAAA 4JTEA 3CO4A 1XLDA 3W7IA 3GUWA 5HNNA 4DELA 4JN7A 4B5TA 2UY2A 4G1KA 5IFTA 3GNPA 1C91A 1BWKA 3NIYA 4XV0A 3ITGA 4DHGA 3EYPA 3NPVA 1P6BA 1UR4A 4FEZA 1YRRA 1OHLA 3BE7A 1T8QA 3G24A 1ZAHA 2VDIA 4I9TA 2H3DA 1R87A 4NZ3A 3W2MA 5I3IA 2YX0A 2DSWA 2VXNA 4Y90A 4QDPA 3GYCA 1W54A 2IUZA 3TWAA 1DWIM 3W1LA 5I6SA 3RU8X 1G94A 4LYQA 2QCEA 3R89A 4UR8A 5TNVA 3F4DA 1Y8BA 4LV4A 3NSNA 4CGTA 1E0WA 5IXEA 4MNMA 1QNOA 1LORA 4XAPA 4LGXA 3GH5A 1K02A 3KZPA 3C2OA 3KOFA 1SSDA 2QCCA 5CBJA 3SJ3A 3DI1A 3IS4A 4BI6A 4BQ3A 4H9YA 3OO2A 1TWWA 3F03K 1QDSA 4F0HA 1QNPA 3M16A 2ODOA 3IARA 5HUOA 5E6ZA 3PG8A 4ATWA 4GQGA 3W7KA 3EBVA 3ZVIA 4YTTA 1JD9A 4MZYA 1O66A 4JIIX 3W74A 3N3TA 1YPXA 4FX6M 1F3TA 3NSMA 1VYPX 4FIRA 1POKA 4EKJA 1K03A 2NQZA 1Z9AA 2DU2A 2R24A 3IUHA 4L9XA 4O19A 4BI7A 3GFZA 4M5PA 1VB9A 3KL3A 4AY7A 3DH7A 2ADAA 1D9EA 7ODCA 2E5CA 4HPHA 3B3DA 4P7NA 2QQ6A 2X30A 1EGZA 1OFRA 3UEQA 2GDQA 3MMTA 1PE1A 2G4FA 3RJYA 2R94A 3GAYA 3R58A 4H83A 1D3CA 5A94A 4E4UA 4JY9A 4F2TA 1XPYA 1HVQA 3JRKA 3QGAC 1TJPA 5JVLA 4Q7NA 3N14A 3BG3A 2WJZA 1FXPA 1KA9F 2RHGA 3MYOA 4C6JA 4D6FA 1PHWA 4HA0A 3OBKA 3CZ8A 3D3FA 5CC6A 4DQWA 2E5BA 4S3EA 4I9JA 1HGWA 1K6AA 2G5WA 4HNOA 3VKDA 3TW9A 1R9ZA 1YXDA 4MG4A 3KBWA 1CLVA 5FF4A 5CAKA 3C0JA 4IF2A 2WJDA 4DBDA 2G50A 2XVLA 3U9IA 2WYSA 3MBDA 5GQBA 4JIHA 6XIMA 3H7VA 3CAWA 4LVBA 3S6TA 3N13A 5M17A 2Q01A 1PZ0A 3NO3A 4ROPA 2WANA 1H7WA 2XN1A 1EGVA 1UOZA 3KL0A 4HHPA 3LHWA 5GVJA 2O9PA 3LMZA 3MKCA 3EDJA 2X7VA 2UY3A 5CSUA 2DP3A 4EK7A 2C8NA 3ORWA 4O50A 1JZ6A 4GRSA 1H11A 3R43A 4AZ5A 3RM8A 3A9BA 1DV7A 3VOJA 3ONCA 1EIBA 3EWUA 3DEQA 2QF7A 4LNYA 4EWJA 2W6RA 2TRSA 2Y6ZA 1E40A 3ARQA 1THFD 3EB2A 1ICPA 5CPSA 5LA2A 1OADA 3PHAA 4XWUA 3O2LA 4NT0A 1H7PA 1TWDA 5A95A 2PTWA 1TUXA 1TPWA 2QULA 4FLRA 3UW6A 3S83A 3FCPA 2YPIA 2BLEA 2J7BA 1TO3A 1J93A 1U1JA 3AMGA 2C6QA 2PP1A 4H6QA 5D4YA 2ACUA 3VIGA 2FQIA 4RXGA 3W6LA 1AQMA 1EL3A 3D3AA 1A5NC 5ABTA 3HV9A 3ARWA 2WAGA 1R7AA 3SQSA 1KM5A 4AZ6A 3L2MA 4Z42C 2CBVA 2ZXQA 4IMCA 3BV7A 4ZENA 4GNVA 1E6QM 2QCDA 5KZDA 3FIGA 4AD5A 3S2MA 1W3JA 1GOMA 4R88A 1DIKA 4V1YA 2CFFA 5FL0A 1J5SA 2BVWA 3WNPA 1EHNA 3FKRA 4LBSA 4MUPA 2NLIA 2YB1A 3MI6A 3R7MA 4JIQA 4UR9A 5CEWA 3W7DA 2G3IA 4AAJA 3PSWA 4AZ7A 2HS8A 3PBMA 2GGHA 3G3DA 2D20A 1HKJA 3VOCA 3C56A 3W4RA 3VDHA 3RRXA 1K77A 2CLKA 4ERAA 1U5HA 3B8VA 1QATA 1V3IA 4EVZA 1WBHA 4JNYA 1MUMA 1Q66A 1BEUA 4RUBA 3TYEA 4GXPA 5C6MA 4IZGA 1ZJIA 1GORA 2PBOA 3HM7A 3GDKA 3SCVA 4DUWA 1UA7A 3PPFA 3K46A 2FH6A 3NEVA 3SAZA 1SO6A 1GG0A 2Y0FA 2J74A 3DIPA 2DQWA 4QDMA 4AIEA 5J8LA 3L4XA 1TPVA 3NA8A 5EY5A 1XRFA 4NI3A 3GX9A 4OT7A 3G5EA 4DJDD 2QV4A 3W1AA 1MW3A 3W82A 2J78A 3VNMA 1XSKA 4QRNA 5M1TA 3S9IA 4J3TA 4JYFA 5FJJA 3SDOA 4DO4A 4KH2A 2XIBA 4YCOA 3FDKA 1UKSA 5A8PA 2Y8VA 2JKEA 1J96A 2PTYA 1PZ2A 3ZM8A 1XIHA 1V0MA 4R85A 2EG6A 1J79A 3BAJA 1HIZA 1JGMA 1PYMA 5HULA 3BXWA 1VJZA 4YVVA 3IRSA 4E2VA 3OGVA 1UC4A 2OOFA 1V3JA 4JFVA 5CZKA 3NPXA 4LX4A 3NZGA 3U5UA 4J2MA 1LL4A 5AB3A 3IRDA 1IEQA 3IACA 4MWAC 3MA8A 2G96A 2PGEA 1I4NA 5I7GA 4X9YA 4NZ1A 1H2JA 2WXDM 1WXZA 4MJZA 5F2GA 4NZ5A 1SQ7A 3CZGA 1O5RA 4K1GA 1E4LA 1NOWA 4ZL1A 5BRPA 2ZRXA 2ZZ7A 3FVDA 2X0YA 5C9RA 3DECA 3WJZA 1TELA 4TXEA 4FXSA 3EAUA 3W27A 1L6YA 5DF0A 4G9PA 4W8LA 3WBWA 2BY0A 4TUFA 3LHTA 1AQ0A 2Y2WA 1OQFA 2ATMA 5CSYA 2PD5A 2UY5A 5FIPA 3LI0A 3SURA 3W81A 2PU1A 4PCTA 3SCSA 3GKFA 1WXJA 2J8GA 3MZ2A 4Z2HA 5E09A 4HJFA 5FESA 3W76A 1LQAA 1CB2A 1TTQA 4FXRA 3EX6A 1KM2A 2PWEA 2NQHA 3C5QA 2B7NA 4UFHA 3EOUA 3TMLA 2GQ8A 2VR2A 3RMEA 3O6DA 3A3XA 4MZ8A 4TX8A 4JQAA 1GVFA 4HTBA 2OEKA 2RUSA 2ZDSA 5F4SA 3CS2A 1W9BM 1XLLA 4RCXA 2FTYA 1MRQA 2HXTA 5HR6A 3GHUA 1AZ2A 4ZFCA 1V6UA 4QJ5B 2XGBA 4YWIA 3AU6A 3ARPA 4FR1A 2OO0A 4HCLA 3URNA 3O06A 1BPLB 1VEPA 4DZIA 3GM8A 2GGIA 3A24A 4HCHA 3ZLGA 1ODUA 2X09A 4TX9A 2QJNA 3WH8A 2OXNA 2YJQA 1EOKA 4R7JA 3IGSA 4QJ1A 2NX1A 3CWHA 1T40A 2VC6A 4IWWA 4L4PA 2XSBA 5IBXA 3H23A 3W73A 3ARUA 4ZQOA 4OKDA 3VKKA 5A8NA 2AQVA 2VVSA 2FZMA 2OSYA 2WW5A 1AW5A 1W37A 1X6LA 2G41A 2YA2A 3KAOA 2RH9A 2PCQA 4AWUA 1E4NA 4AZIA 3GHTA 4GZJA 3NGFA 3QOKA 4HMCA 3PN8A 1US2A 1WZKA 3TWBA 2DW7A 3SN0A 3W1QA 2JK2A 5JBDA 3C2FA 4IPPA 1WAUA 2XWEA 3FN9A 2HE8A 2Y8UA 2RGMA 3AYVA 2KX9A 3FA3A 3W70A 1HO1A 1UIOA 3VPLA 2X1TA 2A0NA 3QGVA 4IISA 1Y7VA 1WE5A 5T9BG 4MOZA 3QF0A 3W6MA 2GJNA 1M9HA 1KLYA 3EDKA 2QDDA 3K4DA 3NGJA 3KS6A 3DHUA 4IGNA 1TPFA 1GJPA 3M07A 1VFTA 4WY0A 5A1AA 2ZXAA 1HL9A 5C70A 1MEIA 1HX0A 2PDKA 1O6IA 1EA9C 1VPXA 1BG4A 1O1ZA 2WK2A 2D2GA 1F61A 3MUZ1 2V0TA 4XTIA 5G2WA 3BJFA 1ISWA 3B8SA 4FS9A 4J7RA 1OF8A 4AW7A 3PBGA 3PWGA 4G7FA 3H8AA 2XFYA 3BLLA 1E5JA 2R6OA 3WLMA 1WX0A 5LNRA 4EF9A 2F6XA 1ZJHA 4OOUA 1XGZA 4YHEA 1HKMA 1ZLPA 3B03A 5D9PA 4JTLA 2VVNA 2D2OA 5DQPA 4HZMA 4Q6JA 5I06A 4I7UA 3UD6A 5AVNA 1V6TA 4QCFA 3UXLA 2WSPA 3BW2A 2UY4A 3GFYA 2XZ7A 1H0GA 3IGXA 1I8JA 4IPNB 5I23A 1B3XA 4G56A 3APTA 4GZ7A 3WNNA 4W7WA 3R13A 1ADOA 2HWGA 4FNSA 2P1FA 1KFLA 1H09A 1XIJA 1BYCA 2HBVA 2MNRA 3BJTA 2F61A 4O1EA 4N4PA 1V6WA 3GXPA 1LL7A 1NDVA 7TIMA 1E73M 2H6RA 3GR8A 3R8GA 1J2BA 4GVHA 4GFSA 3QKZA 4GKLA 4S3JA 2HXUA 2HSAA 2OELA 4A29A 4CU8A 1T6MA 4IPIA 4HZ8A 2P53A 1QASA 1PYFA 4JD4A 5CJMA 1XUZA 5LNVA 2IKHA 5M2FX 3VIFA 4XUYA 2XH0A 3OODA 3N12A 5GNYA 1FCVA 3OVPA 4CNSA 5EMYA 3KM8A 4GG9A 1W9PA 2PWUA 4LAOA 4UQBA 2OEMA 3KW3A 4JGDA 4Z2IA 3GH7A 5LNWA 2GK1A 2WZMA 5I77A 3VKJA 3AZSA 1Q2SA 3PVFA 1A0EA 1PZ1A 3U2OA 1V8EA 4KETA 1AJZA 4W84A 4ZO8A 3PJWA 3QPEA 3A13A 3P3BA 3W7LA 3B8IA 4TV5A 2OO6A 5EFFA 1XC4A 3G1VA 3U0HA 1YXCA 3ABOA 3S3GA 1UP2A 3GW3A 2GUBA 4TV6A 4DYJA 1ZAIA 4W8AA 5DBTA 1KWGA 1H1YA 1VFLA 3DGRA 3LV5A 3WMLA 4IH3A 1XXXA 1SMDA 4PZVA 1C7SA 2PWGA 3EZ4A 1RV8A 1U5VA 3UG3A 1EEXA 1JXJA 4GE8A 4FIQA 3FJ4A 1V03A 2NSOA 3GBEA 1KB3A 1RBLA 1K9EA 3WFLA 5LXXA 1C29A 2OX4A 3M43A 4NRRA 2CLOA 4F0RA 4YXGA 2F9RA 1JCJA 2PGRA 4XKYA 4QR6A 3FX4A 3GO2A 4Y8EA 4ECLA 1H41A 4PTDA 1F9CA 1M41A 4Y2WA 4XAGA 4R27A 2VI0A 4DUVA 1G4TA 1YPFA 3U5YA 3HG2A 3AAMA 4H4IA 4CEUC 5T9CE 3CUHA 1MVYA 1VYRA 4L1WA 3II1A 4LALA 3M0HA 3SRKA 3N73A 1F4HA 3NQ6A 1IF2A 3T4CA 3BLIA 1IXQA 1JIBA 3K4AA 2NWRA 1VBJA 1TVPA 3W1NA 1E9IA 3S8HA 1DJQA 3RUBL 5DMYA 3SGUA 3QSTA 1PV8A 2FPYA 2GWNA 2A85A 3TNOA 1V5XA 3AFBA 3GB6A 3B4UA 2DUAA 4PB4A 1VZWA 3R4IA 4PMDA 4X0VA 2CNCA 2DT2A 5LIWX 1O5KA 2Z1XA 1TV7A 1Q6EA 3WDJA 4YL2A 3N19B 1OG6A 2QMJA 4FF7A 3LY0A 3VNYA 1X96A 4A3UA 3HU7A 3SFKA 3C0QA 1GK8A 4S3CA 2DSKA 4DIAA 5AN7A 2OMAA 3KP0A 3WQGA 1XW8A 3H4XA 3WUGA 1BTCA 1VHNA 2YR1A 4Q33A 4UNKA 5LA0A 1MQPA 1JGIA 2Z0IA 1WNOA 1TX0A 1ZCOA 1CI1A 2RAGA 3A23A 2OKOA 3NOEA 3INPA 2WCAA 3TEVA 4AY1A 3W7GA 3I4KA 1G7VA 3G18A 3UZWA 1TUFA 2Y85A 4UTMA 3TYDA 1R9YA 3GNOA 2WSKA 1YXYA 4FALA 2ATSA 3NDYA 3PZNA 1YQ2A 2BVDA 3OBAA 3W01A 1XYLA 3P2VA 5F1VA 4NJJA 1DJNA 2V2HA 1R46A 1QI2A 5LHEA 4EPEC 2ZE0A 1AH4A 4KRUA 1D8CA 2W0UA 1Q6LA 4UMBA 3CC1A 3PPGA 3SW6A 4B3ZA 4LEFA 5A6LA 1RK6A 1A5AA 2B81A 3OOQA 1LUCB 2R1KA 1W8GA 4GPNA 4IIHA 1TR9A 3ARVA 1XLBA 4ZFMA 2CPUA 2EJAA 3VDCA 3DZ1A 1PTAA 1Z8AA 1J12A 1EQCA 4H9MA 3T78A 3GXTA 3TXVA 3PUGA 4GYFA 4HTYA 2YLLA 3O3RA 2PDLA 5GNXA 4CQCA 2FB2A 2ZZ4A 1B0IA 3F2CA 4DI9A 3E96A 4GA8A 2PRMA 2CXGA 2VD8A 3P6LA 4PYSA 4XBJA 1LG2A 1XBXA 3V16A 2BWGA 2CLIA 2QGHA 4M6QA 4S23A 4NU7A 3MU7A 1J01A 1QK0A 1X7FA 3LPPA 2OYLA 1LOQA 3KRUA 2E3ZA 2Z1VA 4P7OA 5FJOA 1HXJA 2WPGA 4LS0A 3VOFA 1F76A 2A7PA 2IKGA 3CT7A 4A8IA 1CXKA 1P7TA 4ORMA 2A4AA 2JE8A 5C9UA 3E0WA 3ZJ8A 1AUSL 4X61A 2G3JA 5BOEA 4M3PA 2VEFA 1BXNA 1SFTA 2PPGA 3HQOA 4A3HA 3S2CA 4HHMA 1PIGA 5CSSA 3WLIA 4PSRA 3UA3A 1H7XA 2NV9A 1OK6A 4X60A 4JTTA 1EEPA 3MTWA 4MWAA 1NOFA 1RK5A 1LF1A 1MI3A 4URIA 1IXNA 3SUSA 4PMQA 1KRAC 2G3FA 2HDJA 4LS1A 3KCOA 5EB8A 3R12A 2TPSA 3EEZA 3ANUA 2FZBA 4EANA 4R34A 4E4PA 1FH9A 1ECEA 3LSBA 2WVSA 4PMYA 3W0KA 3N2MA 1CW2A 2OR2A 4H7VA 1GPWA 2I14A 3MJYA 1N8IA 2CLEA 3T42A 3W7CA 4R53A 1XPGA 4WLCA 1E9ZB 2WZEA 1E1FA 1PCWA 5D33A 3BMWA 5A6TC 1UROA 5FEZA 4YYCA 4GI4A 3K4WA 3VCRA 1PVNA 5FF0A 4PN2A 2GJPA 2C15A 4A4AA 4EPKA 3BQ6A 4HB7A 5FACA 1FWHC 1W2VA 2P8BA 1W5MA 4GQBA 3TCSA 5A69A 3B05A 3T07A 4CNNA 1PWMA 1BQCA 4PH6A 2ZUMA 4TO8A 5H6HA 3RR1A 4IMAA 4NX5A 2C18A 1SM9A 1VGAA 4ZO6A 1TVNA 1EQPA 1JZ7A 4L9YA 3VGFA 3S0CA 3V5CA 1DORA 2PODA 1F3WA 4GXWA 4LSBA 4Z2LA 4J5NA 3VNZA 1JAKA 3AUOA 3RO8A 1NOUA 1MUWA 3IJQA 4IFKA 3RM4A 2W91A 2OQYA 4KEZA 3MCMA 2XGZA 2J8TA 1UUQA 1UZHA 1JVNA 3LEPA 1XYZA 3KBNA 3ZJKA 4C6PA 2FPVA 3OYXA 2CWXA 4UWMA 4IMEA 1KBBA 1WDWA 3OGRA 1M6JA 2F8QA 4PTVA 5ABFB 4GNKB 4UOZA 2Y7EA 3W1TA 4QFUA 4WVXA 3KDNA 1E0XA 3WDPP 5AC7A 2DDXA 1EKOA 1CECA 1AW1A 1T99A 1W56A 4DNMA 3FHAA 4AG0A 3WD0A 4YTRA 4QS6A 4Q8MA 1I1XA 3LCHA 4IQLA 1KM4A 2FMNA 1I1WA 4GY0A 1JG9A 3MSRA 1GG1A 1W1YA 1ONXA 3UG5A 1WOBA 3BOFA 1NWRA 4NZJA 2FIQA 2REQA 4PULA 4U2ZA 3ZIZA 3UT0A 1BAGA 3F4CA 4AWTA 3I7QA 1CGUA 1AMKA 3V36A 3SY1A 3TP4A 3PR2A 2CERA 2A3HA 4RW5A 4Y6GA 3MP4A 4MNKA 2XHYA 2J62A 3TSDA 4CQBA 3KHJA 3FHQA 1V77A 1F3EA 4HSHA 2GQ3A 4LUSA 3B8TA 1QBBA 3BC9A 4H1ZA 2V69A 4L4MA 4RDWA 5C2XA 5J04A 4MJ4A 4F0MA 3MWCA 1QO2A 3TTOA 4GUFA 3UQNA 3MVIA 2L5HA 2GSHA 3CJPA 5TIMA 1IZJA 2PMQA 1PKYA 4MWAE 3JUGA 2Y5EA 3AZTA 3ZJ6A 4D2JA 1XH2A 4XISA 3ITLA 4DLFA 2W3ZA 1D3HA 2I1OA 4AC1X 2Y61A 1PS9A 1ZBWA 1TA3B 3UPMA 1A4MA 1Q85A 4IX0A 1PPIA 4LW7A 4MKVA 2NVAA 1GONA 1GQKA 3W3OA 3NQVA 3WF2A 4KT2A 1UD3A 4S2CA 3N11A 1UG6A 3NPUA 3SJNA 2AAAA 1XRTA 1TB3A 1ITXA 2YL5A 3R0UA 2QJGA 5I3GA 4ENLA 2UV8G 5LKYA 1TE6A 1I60A 1V0NA 4IGMA 4DI8A 4NY2A 5TD4A 4J2PA 3P60A 1GGOA 2HROA 3L0GA 4JBRA 1FA2A 1GVEA 1NELA 3GG8A 3P93A 1XGDA 3W22A 4HNVA 3W86A 3S5SA 2AMXA 4ZOBA 2ALRA 5KZEA 1EC9A 1LBFA 1A5BA 2MUCA 4O28A 4CCEA 3H2MA 3TQ0A 3ZZ1A 3EA1A 4MWAD 3UY7A 4D6GA 4C1NA 1SO4A 1BVNP 3DAQA 2VOMA 3GDLA 4PUEA 3MHUA 3AHZA 2AKZA 1CGVA 4HCDA 7XIMA 1RZMA 2Q3OA 4BEUA 1NF0A 3ID7A 5A8GA 2OZ8A 3EA2A 3H6OA 4L1GA 1P1MA 3A12A 2PDMA 4HZ7A 4UTWA 1B57A 3WEZA 1UZ4A 4MKSA 4CCDA 3HTWA 5FF7A 2Y24A 3LBOA 3F4VA 2ISDA 4I8DA 4ILSA 5LXEA 3UVAA 3TW6A 1CLXA 5HK4A 4PFHA 1Q13A 3W7OA 3GZ3A 1TZ9A 5IBXC 1KD0A 1AD1A 3L5LA 3GLCA 3GXIA 1X1OA 4O8AA 4Z1DA 5F7UA 2RJHA 1DXIA 4NASA 1V6XA 5G1MA 4AZBA 4WOZA 4FA3A 2CBUA 1Q6GA 2QPXA 3A4WA 5G4EA 3EWDA 3S5ZA 2ZTJA 4AZGA 1Z42A 4UB9A 1TZZA 1LQ2A 4O17A 2IQDA 3FJLA 5FF3A 1R3WA 4D6HA 2DUXA 4QG9A 3H7RA 3NZ1A 4O54A 3CGTA 4XIMA 4WSHA 3RU6A 3UGRA 3BDKA 3APGA 1S2UA 2YYUA 5DY3A 1V7YA 5E6YA 2ZA2A 4IFKB 4TTUA 4D6EA 3U57A 3P7YA 1KXTA 2TMDA 3UESA 1WUEA 4LUTA 4Y9NA 3VE9A 1KCKA 1FHLA 3NPWA 1A3WA 2JBMA 4UMCA 1D2KA 1XIFA 1E4IA 3CL7A 3O6CA 4ERIA 1XHGA 1EWEA 1KBJA 1Q6QA 3WD4A 4J40A 3B8DA 3ZLHA 2DH3A 1BQGA 1ZGDA 4GY7A 4Z0SA 3FYYA 1E0TA 1I9CB 2ACSA 3RHGA 4O1DA 3WQ5A 2JKAA 1GOOA 4B3KA 4PBFA 3K30A 4Z1CA 4AWEA 1OFOA 1XLAA 3RX4A 2INEA 4S3FA 4Y9MA 3BW3A 4MB3A 4RE2A 1KM6A 3OG2A 3PTDA 5D9NA 1UWRA 3PAOA 3WLHA 3VU2A 1ME9A 2CLHA 1X1NA 1DWJM 1YEYA 3IEBA 4DXKA 3OLDA 1QT1A 4XZLX 3OP2A 4YN5A 1WOAA 1F6PA 1TX2A 4L6DA 1XG4A 1S1RA 1Y0EA 2EEXA 4CD4A 4U33A 3GXFA 3HIJA 5I79A 4JYDA 3JZUA 4KKXA 3C2VA 1UWAA 1XBVA 4PRTA 4POCA 4LVDA 4XBKA 3HQPA 1RSCA 4MF4A 1ZAJA 2BASA 2DQXA 5DCDA 2CZVA 1TMHA 1JZ8A 3DHDA 2EPNA 3LQGA 2BTMA 1K8ZA 4UTIA 3W7RA 4MMWA 2WB5A 1T7LA 3E2VA 5HWJA 3CIWA 3O07A 4J9JA 3FAXA 2C14A 1TWIA 4ATDA 3M0XA 1JPKA 4NP7A 5HJLA 1BFNA 1XDLA 2YBVA 1VP5A 3T2OA 2WV8A 3OU8A 2HBXA 4TVCA 4MUZA 3UETA 1I2PA 3W38A 1Z89A 3C52A 3G8RA 4BCEA 3KVJA 3ZT7A 4ORIA 4YVPA 1IV8A 1UKQA 3I4EA 4DJFA 4PCNA 4B9YA 2YLAA 1ITCA 4ZZ9A 1SR0A 3AUJA 3NQ8A 4ZTXA 1L2UA 4W87A 3W00A 3V0SA 3G1AA 5AHMA 1GNXA 1J0IA 1CXIA 3IJDA 3PZQA 1VFFA 4Q7BA 2OYKA 1KO0A 3VFLA 4KEVA 3TN4A 1TV5A 1MUCA 3M5YA 2AGKA 3PZ9A 2VL4A 3EEGA 1VBUA 1JUEA 3LQLA 1W3KA 4NJGA 3AS2A 3S5OA 1KM3A 1I45A 2QGYA 3EMQA 2NXHA 3T0TA 3GUGA 1UR1A 3EB3A 1SZNA 3R5EA 1BSIA 3VKBA 3PZTA 3P0XA 4UZSA 3W88A 4RDVA 1NQ6A 3IJ7A 1GVOA 5JUVA 1XLFA 1CBGA 1PZ3A 1UR3M 3KE0A 2FZ8A 3UJFA 1KBKA 1XCXA 1CGXA 3WQCA 4H2HA 2P3ZA 4AD0A 5C5YA 3G1SA 3LBCA 1K9FA 1WKFA 3GHRA 1H50A 3ITVA 3LNMA 3B9AA 1FKWA 2E5DA 1VCFA 2QYGA 5I3FA 1FFRA 3BL3A 5C2CA 1OC7A 4H8HA 4WSKA 5CCZA 2FZNA 5EMLA 3VC6A 1ICSA 1FQ0A 4MLRA 4ACZB 4N9DA 4AX6A 2XN2A 3M7WA 4PODA 3THUA 3B40A 3BAWA 3NZPA 1EJUC 2J24A 3V5FA 2JIEA 2EPLX 4XAFA 4KRTA 4QX4A 1W1IE 3IJ6A 1OM0A 3NQBA 1OSEA 3G1YA 3CB3A 1OY0A 5DFAA 2PFHA 4B16A 3DFNA 1JF6A 2PDIA 3REQB 4LU0A 4NZFA 4HT3A 3Q65A 1ZRQA 3Q58A 4R5EA 4AF0A 2PAJA 2ZVIA 3DFOA 3I7SA 4ZQNA 3V1HA 3SCWA 3DFHA 2HK0A 5G2IA 4HA1A 1H4PA 3UCCA 2ZC8A 3P8IA 2WO5A 1C93A 3UGVA 2W9MA 4GABA 2X42A 3ANYA 1OD0A 3CTTA 1QUMA 1I75A 4P8VA 1GOQA 5I09A 1E72M 1KBIA 1QR7A 3MHFA 5TBOA 4AUBA 2VX4A 3LDVA 1KXHA 2X05A 2ISFA 2DW6A 2PF0A 1JFHA 4OFCA 1HL8A 4HA3A 3JS3A 3AIEA 2VGIA 4PCPA 4C6NA 1QPKA 4LCQA 5A6BD 4JTDA 4XD4A 3C6CA 2Q02A 3N34A 5FL1A 3LHVA 4QSFA 3M64A 3USZA 2ZDRA 3ATYA 4F4RA 1VBHA 2GYIA 1RALA 3LBMA 3MW7A 1W0MA 3QBUA 4IT1A 5G1YA 2ZZ2A 3HGOA 3VZZA 3AYSA 2QUVA 1UB3A 3R11A 3WLLA 3TFXA 2HPIA 1DPMA 1LZOA 4R9XA 5EKYA 1Y5VA 4ZA0A 5CKSA 2A3BA 5AKQA 3SCRA 3CL8A 3C61A 3EPNA 3AS3A 4XVEA 1QOQA 3NL2A 3CYJA 1FCQA 4NAEA 3NURA 4H9TA 2ZTKA 4ZQMA 1HGYA 4H2CA 1OCQA 3EWYA 3GZAA 5CC5A 2EQDA 4JDBA 1EDTA 4IGSA 1OG0A 4N2YA 4HGXA 1IEIA 1X8FA 1R8LA 3BLDA 3IIZA 2VRJA 1JZ5A 5K2ZA 4YU1A 1R3VA 5FJPA 3M4HA 1KV5A 1IE7C 4D9PA 4ZXLA 1R5YA 2HQAA 4F40A 5AHEA 3LM3A 4CN6A 2OLSA 3WLRA 3W9ZA 4J28A 4HP5A 3E02A 3EGJA 4KWWA 2H3BA 1HF6A 2Y89A 1LUCA 5FA5A 3F4WA 1Q45A 3MDWA 4WKFA 3QW4B 3GNXA 2BZNA 2PRHA 4LVGA 1XCWA 3CPGA 4QEEA 2JEPA 5JH2A 3WLQA 3MSYA 4LCRA 5CLTA 4BFAA 1C8YA 5AC4A 1IYXA 4J3ZA 1HKIA 2QDHA 1FX6A 5DRCA 6ALDA 1YX1A 2PSNA 1QNSA 1Q7ZA 4NI8A 3OVQA 4ZGYA 3T09A 3DC0A 1E1CB 1LWIA 2BB0A 3C4UA 3SY5A 3OLEA 3VI2A 4JYEA 1UW9A 3FA4A 4B90A 4YTSA 1EF2A 2EXOA 4OU1A 4RE4A 4AEFA 1FVPA 3B9OA 4HOWA 1EP2A 5CPQA 4O1BA 3WSUA 2G37A 2WKJA 2V3GA 4WRHA 3RCYA 2I56A 4NYYA 3VIIA 1G4EA 1N8WA 4ZQPA 3L5MA 3RO6A 3B0UX 1QMLA 2VFEA 4FAMA 4I9MA 4KCTA 1MXSA 3IUDA 4B2DD 3GDRA 3FXYA 3WQFA 1GQNA 3NQFA 3RJXA 3ECQA 4QDWA 3E12A 2AQOA 1VFHA 1X39A 4KFOA 2YBUA 2KZHA 3W85A 3AXXA 3VVGA 1QBAA 2PDWA 3B06A 1EIXA 1C3FA 4JNMA 2GOKA 2VX7A 5HMDA 2RJGA 1CGYA 3W02A 1PCKA 3WF1A 3V3WA 3E5BA 1VFOA 3EOLA 3PBVA 3WELA 4G2DA 1DEDA 4ZTYA 3M5ZA 4EE9A 1W91A 3VZXA 4QTGA 1TYGA 2D69A 3R8HA 3WLJA 4KQNA 1REQA 2BX7A 3LOTA 4W4QA 5HWNA 2I17A 3E5PA 1XGEA 4MNJA 5AY7A 2XFWA 2JKPA 1QK2A 3STCA 4XB3A 3R0DA 1IIGA 1YTDA 1FDJA 2IPJA 4HU8A 3CASA 3G1XA 2O9TA 3AIUA 3PULA 1GOWA 2VHLA 1YE6A 3PZOA 3T0DA 1SJBA 4U31A 3WNOA 3VIPA 1IWPA 1FRBA 2QPUA 5I24A 3LG3A 4FNQA 1QOXA 1XLJA 1KRBC 2DT0A 3TTQA 1GQLA 4NHVA 1IIHA 2YSWA 5CXPA 1V3LA 3VXGA 1XDJA 5JH1A 5B7YA 2F38A 1OIFA 5K4XA 1I2OA 3SSJA 1CXLA 4MTVA 3UWVA 4QQ3A 2BFGA 3TN6A 1UMLA 5AFDA 1PL9A 1Z7AA 5HDRA 4UTLA 1XX1A 2BXYA 3KHDA 1B90A 3L68A 4RX0A 5LIUX 1OGBA 2GQAA 2XWDA 5AYBA 4CNUA 2OJPA 1G0CA 3GBDA 4RPQA 1DJYA 4GWEA 3LLFA 4LVAA 1NP2A 3S1WA 1TTJA 2BHYA 9RUBA 1Z48A 2DY3A 4H9ZA 3WBEA 3KOZA 1PJ9A 3NM1A 1YIXA 1W32A 4AD4A 1DJXA 4Q6XA 2PB1A 1W2PA 3PPCA 4ICCX 1PTDA 3G0SA 4MNLA 1GHRA 2NUWA 1KCLA 1GT8A 3H2EA 1AK5A 4GMEA 3CZLA 1OF6A 1O60A 1YNYA 4G6CA 4O10A 5CPNA 3LRKA 3LZ3A 4N42A 1OCJA 2D22A 5FOOA 1GZ1A 2EO7A 3ABQA 5E93A 3STEA 1ZJAA 4QQUA 1RA0A 5C9XA 2BGQA 3EPOA 3BGJA 2HVOA 1J0JA 1WKDA 1AQHA 2Y4SA 2WMHA 4HD5A 2P88A 1TJ2A 3SZ8A 3VAVA 2GPTA 2XSXA 3EXSA 4PEEA 3HFTA 4C6EA 3TU9A 3GDMA 1W1B1 3NQCA 1BWVA 5C7VA 4Q3MA 1OX6A 1F74A 2QUTA 3Q45A 3U2ZA 3MUXA 1B4KA 3BH4A 2F2HA 2XIJA 1T8XA 3KOXA 4GUHA 3ELFA 1NWTA 1CGTA 3R8RA 2VFIA 3EWZA 7PTDA 1W3HA 1BGGA 2IXUA 2VYOA 4LEQA 3TOYA 4DRSA 3CHVA 5CLWA 3AU2A 1ME8A 3UZYA 3V7PA 1NY1A 4FF5A 1L9WA 3KZSA 4DJDA 4TR9A 1ZALA 3C0LA 1XH1A 1V6YA 3UJ2A 1CZ1A 3SSZA 5AVHA 3M6DA 1ZB5A 1GTEA 2FHFA 1X38A 3VD3A 4CN1A 2CHOA 3W7JA 2IPWA 3SBFA 1QU4A 1YBQA 1J18A 3TONA 2DZTA 3IAPA 4K39A 4LTSA 4PB5A 4JIPA 2DIKA 1HKWA 1FH7A 4E8DA 1DJWA 3UYCA 4HMDA 1ADDA 3DOPA 1UIPA 2OWWA 4M56A 4FI4A 3WDHA 4LS2A 2ISSA 3TROA 4ZXOA 1XS2A 4BQ5A 4R33A 4JQ4A 1KRMA 3NXLA 2VFHA 3AICA 3RLHA 1OCNA 3HA1A 5C71A 5GJMA 2C16A 2CBIA 4JTRA 3BZJA 4L6OA 3RCNA 4PE8A 3VX1A 1ZY9A 3BSGA 4H04A 1I2QA 5LIKX 1WV2A 2HEJA 1OFPA 1XLGA 1A5MC 3RILA 4U3CA 1KTCA 1UD2A 1U1HA 3V75A 4JTAA 3W75A 4AB4A 1XYBA 4A2SA 3AMLA 3W87A 1AJ0A 1V02A 1LL6A 4GJ1A 1OGGA 1ODZA 3CAQA 3EKZA 3M0ZA 4UFLA 5A6AA 4D6IA 5IHRA 2FZ9A 3UJEA 1CEOA 3VM7A 1LOLA 2JQXA 1W1VA 2GJLA 1KGXA 4XVDA 3GRIA 2WHJA 3O15A 1E6XM 2CESA 3QMTA 3G22A 1GVIA 4AHOA 4L4LA 3MZNA 4ZE5A 3LU2A 3MUIA 1Q6RA 2QAPA 5A2BA 4JFSA 4AU0A 3HG3A 1KKRA 3SUUA 4JXCA 5LGXA 3EB4A 2OT1A 4M0XA 3UPWA 5EBUA 1K8YA 1WA3A 1YYAA 2VRKA 4GLEA 2R1LA 4UFIA 4CU6A 3NUKA 2OEJA 5BXRA 3NZQA 4LANA 1BF6A 3NO1A 4AEOA 4JTSA 4NIRA 1QXLA 3PZGA 2HVNA 2B31A 1YDVA 4LAMA 4BF7A 1KCXA 1AMYA 2E4TA 2O9OA 3VX0A 4EWND 4CEXC 2GVGA 4XO6A 4P8UA 1EYWA 3L67A 2FGBA 2NLYA 4E2BA 1VPQA 1WP6A 4DVOA 1ONEA 4HOXA 1KC7A 2PUZA 3T81A 1EPXA 3T0CA 1TSIA 4HNLA 4ERGA 1MFVA 2J88A 2WLYA 3KBVA 4JCMA 3BAKA 8A3HA 1XISA 1P0DA 2NX9A 1XFCA 4GIAA 2G3MA 1KM1A 1SVDA 1E6NA 3NQMA 4MDOA 4M19A 1GOXA 4JN8A 2LLEA 4LPCA 4A6GA 1I6NA 3WF3A 3WUBA 2CC0A 3PS7A 3ABRA 2OKTA 3AS0A 4M82A 4DF0A 4AXNA 5A5WA 1GVRA 2Y63A 3POCA 4GIYA 2Y88A 1EOMA 1XRVA 3WL1A 1BVZA 5JIPA 3LSCA 4MM1A 4Z17A 5F4WA 3RLGA 4O16A 2C13A 1QPNA 4PTWA 4N0RA 3GYEA 5KTLA 1R3RA 4KEUA 4X2PA 2BXZA 3KBMA 2WM0A 5BROA 3DU0A 3G1HA 3F4NA 3KWSA 4PCSA 1CLKA 1TKKA 3EDDA 3CYVA 2F7FA 4FSAA 2BDQA 1KR1A 4MY9A 4UBPC 4IFRA 1JFXA 3AALA 4IIGA 2WVTA 5DANA 2FLIA 4HBKA 2XH7A 4L1XA 3WDRA 1RQBA 1NFGA 3RPDA 1E1CA 3AXMA 4HN8A 1XINA 1SZRA 3CWNA 3UFYA 2ISWA 1RVGA 1WDPA 1VD6A 6TAAA 3CLMA 5CQ1A 3NDOA 1GYMA 3TSBA 1B3VA 4HPJA 2VC5A 1ZL1A 4H8UA 1JYWA 5EFDA 1DKWA 4A05A 2PDJA 4B2DA 1M3UA 1GOIA 1IEVA 3BMXA 3KRZA 4O1CA 1NDZA 2VFDA 1OC5A 1V02E 4AZHA 1AZ1A 2WM1A 4C90A 4GBDA 2FFIA 3T1GA 1ZCCA 1R2TA 3T4WA 3G0XA 4S3KA 4XZBA 2BV9A 5DO8A 4DEFA 4C6LA 1FBAA 1TMQA 2PWVA 2W66A 4GH3A 2YL8A 6A3HA 4DB7A 1DIOA 5BXTA 4ROQA 3QY6A 3WBYA 3EOOA 2DZUA 3CK5A 4Z2GA 1QW7A 3VYLA 1NIUA 1TWSA 4PBGA 1EUAA 1ALDA 2X41A 4NNBA 1Y5WA 2BMBA 1K70A 2XM2A 4H8VA 5KMYA 5ABEA 2NT0A 3W71A 4GJIA 2VZUA 5A6MA 1A3HA 3SCUA 1TR1A 3ARYA 1UH2A 1OZMA 1S2AA 2Z1WA 3OLIA 4XZNX 4PUKA 3W83A 1UH4A 1RPXA 2WKLA 4EAMA 1PIIA 4BK9A 3CLWA 2EKCA 4CNPA 3W2KA 2YFOA 4IIBA 1XH0A 2ACQA 5CZJA 3W53A 4M6PA 2ZWYA 4V28A 5ABGA 2ALDA 1V08A 4K8GA 4ACZA 4GCXA 3NQDA 3VM5A 3MB9A 3TZFA 2WJFA 5ABHA 1POJA 3AIBA 3OVGA 1UPMB 3VNIA 3LLDA 3FY1A 5D9OA 2BVTA 5HINA 4JPGA 3WLPA 3CQHA 3I3DA 3KEHA 3UJRA 4JHMA 1XYAA 3BICA 1B31A 3W1PA 3IJ9A 1M03A 4WJ8A 2I7GA 1MQQA 2GVYA 2ANUA 5DT5A 1LRQA 3L2IA 3SR7A 3C8NA 1OT1A 2WOQA 4AD3A 3LV6A 3VINA 3LRMA 4HOZA 4O57A 4IQEA 4PB3A 2Z2BA 4EXQA 1KQYA 2ZUWA 4JCLA 4IXXA 3ARXA 1VPYA 1F73A 4Q8VA 4CVUA 1OD8A 1RCQA 1MRAA 1UKTA 4DO6A 4OWGA 1XLIA 1RVKA 4FP1A 3EXRA 4V27A 4GUGA 4KGLA 3UR7A 1JXKA 2DJXA 4AD1A 3KUMA 2CZ5A 3FGCB 2C79A 2VDGA 3QGKC 4BQ4A 3VCNA 5D09A 4KGJA 4HYVA 2B4GA 2Z00A 2ZE3A 4LUTB 2VCCA 4RJEA 3QJAA 3GS6A 3CV2A 4IG2A 1G67A 4AEEA 2FVMA 4P8WA 3BCJA 2PP0A 2Z1BA 1M65A 3L9CA 1UHVA 3TC3A 5LNSA 1GZJA 1XD1A 3TYZA 1MZHA 1R86A 2HNEA 4DZAA 4EP8C 3ZVHB 4FX7A 4X3ZA 3W2NA 3ONBA 3REQA 2ZUVA 4AVOA 4DF1A 3VGBA 1J0HA 2D0HA 4RZ6A 3CEPA 1ZP3A 3H22A 4LAKA 4IJRA 2XIQA 4H19A 3FFSA 4GJJA 5FJUA 3NOYA 1BHGA 1XIGA 1BYAA 3GVWA 3M41A 2VMFA 4HNCA 4C1NB 1EXPA 2CBJA 5A8QA 1CT5A 1GKPA 5I3DA 1N55A 4U2YA 3O1NA 4OHQA 1RP8A 3QY7A 1L6SA 2V2CA 3S1XA 3MI3A 1NAL1 1J0KA 4NZCA 1UZDA 3NVDA 2IS7A 2Y5SA 3NL3A 1G9HA 1LLZA 1ZBKA 1EJVC 5KEZA 2PWDA