1TVPA

Endoglucanase cel5g from pseudoalteromonas haloplanktis in complex with cellobiose
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
293
structure length
293
Chain Sequence
b'AVEKLTVSGNQILAGGENTSFAGPSLFWSNTGWGAEKFYTAETVAKAKTEFNATLIRAAIGHGTSTGGSLNFDWEGNMSRLDTVVNAAIAEDMYVIIDFHSHEAHTDQATAVRFFEDVATKYGQYDNVIYEIYNEPLQISWVNDIKPYAETVIDKIRAIDPDNLIVVGTPTWSQDVDVASQNPIDRANIAYTLHFYAGTHGQSYRNKAQTALDNGIALFATEWGTVNADGNGGVNINETDAWMAFFKTNNISHANWALNDKNEGASLFTPGGSWNSLTSSGSKVKEIIQGWGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cellulase
publication title Structure of a Full Length Psychrophilic Cellulase from Pseudoalteromonas haloplanktis revealed by X-ray Diffraction and Small Angle X-ray Scattering
pubmed doi rcsb
source organism Pseudoalteromonas haloplanktis
molecule tags Hydrolase
total genus 119
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1tvpA00
1WDSA 5ABEA 2ZUVA 3EMCA 3AFBA 4NF7A 1MW2A 2OSWA 4L4OA 3CUJA 3L2LA 1XSKA 5I2UA 2PB1A 2VURA 3WQ5A 2ZUNA 1LL6A 1HKKA 1W2PA 4PMYA 1W2VA 3WD3A 1V0NA 1KB3A 1BYAA 4AZIA 4QFUA 5GQBA 1EA9C 7CGTA 3AIVA 5HDRA 4DWSC 1FFRA 1Z32X 1VBUA 3GNPA 3OLDA 3VDHA 4MAVA 1VEMA 4TX6A 2W63A 4U33A 1JZ7A 4M1RA 3F5KA 5A95A 1MW1A 1UD5A 1ISXA 2VZVA 1OB0A 4GPNA 3WEOA 4QLLA 5DO8A 3AROA 4AD5A 1G5AA 1OM0A 4M8UA 1JYXA 3VIFA 4W8BA 4HA1A 3DHUA 1UD6A 1NWSA 2C7FA 1DWAM 3AMCA 3S6TA 4U3CA 4QAWA 3FNDA 2CHNA 2UWFA 3WNPA 2YIHA 3RIKA 2YDSA 3B9EA 1X6LA 1FH8A 2W62A 3KL0A 2ZICA 3CZLA 2QMJA 2OYKA 3VM5A 2IUZA 1QNOA 2G3NA 4GXPA 2DSVA 4W85A 3ZJ8A 3WN6A 1MQRA 2G3IA 3A4XA 4MB5A 5IDIA 1CXIA 1WZMA 1PEZA 1KGUA 3VGGA 1J11A 4PMVA 7TAAA 2JALA 2WHMA 1NOFA 3WENA 1HL8A 5D9NA 3WH6A 5HOSA 1W1TA 4D6FA 1O6IA 4GQQA 4MNMA 3CIVA 3SUTA 5ABFA 2CESA 1C92A 3VIGA 2XGIA 5IXEA 1JIBA 4H8HA 2VQTA 2XVKA 4W8LA 3NYDA 2J7DA 4PMZA 2WB5A 1CNVA 4F8XA 1NWTA 1HKMA 3POCA 3CTTA 1V3IA 1EO7A 4AZ5A 2Y24A 4PSRA 4F79A 3AZTA 1EDTA 1ODZA 4AZCB 4X9YA 3EDEA 1QI5A 3AOFA 3IAQA 3MUAA 5BXTA 3HU7A 2BV9A 2J25A 1XC6A 2DT3A 2VR5A 1QI2A 4PEEA 3N9KA 1JZ5A 1MYRA 4D6GA 2UY4A 5CLTA 2OSYA 4F66A 1CGTA 1NOUA 2XM2A 4WKAA 5CPQA 3WD2A 4L4PA 1ZS2A 2XPKA 1GONA 3J7HA 4D71A 3WQWA 3QGVA 4NRSA 1R86A 5LA1A 1HJUA 4Q7NA 2RGMA 1GNXA 3MUIA 1TZ7A 1M7XA 2BVDA 1B3YA 1CBGA 1KXVA 5LYRA 3VX0A 1KWGA 5EMYA 3TA9A 3MANA 4HZ8A 3ZR5A 1W91A 1KBKA 1V6UA 3CMJA 3A47A 3NSMA 1PX3A 1V03A 4PMXA 1GW1A 4HP5A 1E6NA 4MTVA 1V02A 2XWEA 4GI6A 3ZJ7A 3ALGA 2EBNA 2WVTA 2WHJA 4PCSA 3VX1A 5I24A 1ZBVA 2BY3A 1PZ2A 3GH5A 4GQRA 2VX5A 3VNZA 3B8SA 1S46A 3RMEA 1VF8A 2YBTA 1UA7A 2JF6A 3UCQA 1K6AA 2ZWYA 2D0HA 4UFJA 3AZRA 4HA4A 3GXIA 3TTOA 4AMCA 1HT6A 3T2OA 5CGTA 3HMCA 3TP4A 4BCEA 3OBAA 4A4AA 1V3JA 3SEPA 2WMIA 4UQBA 2WSPA 2WPGA 4NI3A 3GH7A 1UR0A 4Z2GA 5C71A 2QF8A 1QBBA 3GXMA 3BMVA 1TVNA 2G3MA 3AHXA 3VD5A 1NOWA 1XYFA 4AZ6A 4HU0A 4S3KA 2JE8A 1CXHA 2V3EA 3II1A 6CGTA 4AY1A 3PZ9A 4XB3A 4ZFMA 1C8YA 3M7SA 4JKMA 4M56A 5A6JA 1WAWA 2BY0A 2ZUSA 1FH9A 1H2JA 3QHNA 1FFQA 2G8ZA 4YN5A 1RP8A 1R8LA 4YPJA 1JYWA 3DYPA 3W4RA 1V0KA 1W9DM 2Z1SA 2W61A 3BXWA 4ACYA 1HJVA 1LJYA 1W9UA 5AC5A 1EQPA 3SCTA 1KWKA 1B1YA 1B90A 2BHYA 2D0GA 2EPMX 2D22A 3RO8A 2XJ7A 4AWEA 2YJQA 4UFIA 1UD3A 1XGZA 1HJSA 1VEPA 1LWJA 1CXFA 3OLGA 1FP8A 1DEDA 2DIEA 1VENA 3ZIZA 1LQ0A 1R7AA 3WL0A 4U2YA 4LQ1A 3LPPA 1QBAA 3WY1A 3KZSA 1QI4A 1Q6FA 2ZXDA 1CGYA 2WBKA 2ZX5A 3CHDA 1YQ2A 4CVUA 3DECA 4FLQA 2EPLX 2J75A 1E6PA 4P8XA 4PSPA 2OYLA 1MFVA 3MV01 1PIGA 5A6BD 1GCYA 4FK9A 1PBGA 1HXJA 1UKPA 3GBEA 2WZIA 1B0IA 3DC0A 4WKHA 2J77A 1OSEA 3WBEA 1J0YA 2V5DA 1ZBCA 5HXMA 1JGIA 2WBGA 1E56A 1BQCA 2TAAA 5CJ5A 4UQAA 2F2HA 1ISWA 3AS2A 2E8YA 2VZOA 1V0LA 2YA1A 3VOCA 3ZO9A 4P8UA 1BYDA 2CBJA 3WDIA 4E2OA 3AMGA 3GNRA 4RL3A 2V5CA 2CKRA 3VDCA 3EDKA 3WBAA 1TCMA 2WKLA 3GDBA 3ARUA 5I23A 3W81A 4AZCA 1XH0A 3WNNA 1J10A 3AISA 2BHUA 3WEZA 5F7UA 2WKGA 4AIEA 3UG5A 4HPGA 2XVPA 4UOZA 1H3GA 5HPCA 3SUVA 3GH4A 2DEPA 1KBBA 3BSGA 3WUGA 2VR4A 2D3NA 5A69A 4F9JA 3BLPX 4W88A 3K4DA 1JF5A 2GFTA 2J7BA 3CLWA 1GOWA 1KGWA 2X05A 1KCLA 2VNCA 1G01A 2D0FA 3AYRA 2W92A 1GVIA 3OGVA 4PTMA 4KGJA 4CKQA 2YL8A 2XYLA 4AD1A 2JIEA 3FW6A 4UFKA 5GNZA 1BTCA 1B31A 1BLIA 4WSKA 2AMGA 3U7BA 4QDMA 1GQLA 2YA2A 3L4ZA 3T0BA 4QCEA 3SCVA 3BMWA 2A3AA 2J7GA 2O92A 1HN1A 1E72M 1LL7A 3LMYA 2UY3A 2VT0A 1UWSA 1XD0A 4HZ7A 1O7AA 4H2CA 2WCAA 5A6KA 3PZUA 3BAYA 4J3WA 3SCNA 2X0HA 1SR0A 2PWDA 1H11A 3CO4A 5CXPA 2WMKA 2G3JA 4OZOA 2J78A 1UR1A 2WK2A 3AXIA 1KXTA 2ZX7A 1LF1A 3VMOA 3AIUA 4MB4A 3VILA 1GQIA 2BNJA 1J0KA 1FHDA 3L4UA 2WHLA 3UERA 1KR1A 1M53A 2XHYA 3HJEA 2E4TA 1ZJBA 4UQEA 1DHKA 5A2BA 4HMDA 5CG0A 2VZUA 1E1EA 3W25A 2DT1A 2X1IA 4HU8A 4AC1X 2J47A 3WNMA 3O6AA 1WZLA 4M80A 1VRXA 4W87A 3RDKA 1JFHA 4H8VA 3VNYA 2D1ZA 2VRJA 1VBRA 4WF7A 3UEQA 4M24A 4AZHA 1M04A 1I1WA 4PTVA 2WANA 3AIQA 1KGXA 1P6WA 3AQUA 4UOQA 2GDVA 5A6LA 1X6NA 1H09A 3VIJA 2OWXA 4UQCA 1V6YA 4DUWA 1VAHA 3JUGA 1B3WA 1UG6A 1HKJA 1WP6A 2ZWZA 1GJUA 3VM7A 1RD6A 2XWDA 2QV4A 1J18A 1JXJA 2PWGA 3WUBA 2J7FA 3NSNA 4V2XA 1FA2A 5A1AA 1KXQA 5A6MA 1J0IA 1C7SA 3QHOA 3T2QA 2QPUA 5CPTA 1HP4A 2O9TA 3AXHA 1CLXA 1QI0A 5HPOA 2ZX8A 3L4TA 3PTKA 2J7EA 2WC4A 3WQVA 5DFAA 5IFTA 2EPOA 1D2KA 4GZIA 3AHYA 3SCWA 4PMDA 4J7RA 3N13A 4AD2A 2ZXQA 4FF5A 2GSJA 1H49A 1W3KA 5AYBA 4CN6A 4UR9A 5E09A 2PF0A 5A8MA 2D24A 2WC7A 1W3HA 3ARXA 3W24A 1GOOA 4DWSB 3ECQA 1GQKA 3UETA 2DSUA 3M46A 3SCOA 2ZUTA 3ARWA 1JD7A 3BAKA 2NSXA 4U2ZA 2WZEA 3EMQA 4MNKA 4P8WA 1B3VA 4ZE5A 2X0YA 1UH4A 1A47A 2A3EA 3I3BA 2D23A 3WD0A 2JF7A 3S2CA 3N11A 1B3ZA 4WIWA 2UY2A 1E70M 3NDYA 1UWQA 5IHRA 1E43A 1QNRA 1GPFA 2CBIA 3RJXA 3VD9A 4BA0A 3T0DA 4JAWA 1OD0A 4C7FA 1BVNP 2CIPA 3VO0A 2ZUUA 3WMSA 4Z2JA 1JAEA 3CUFA 2E0PA 1E6ZA 4TTUA 4GIAA 1BGGA 1ZJAA 4GI8A 2V3GA 1OD8A 2JFEX 1W9PA 5JIWA 3PZMA 3SUUA 4MB1A 3T09A 1BFNA 4BQ2A 4W86A 5M3WA 1R87A 1V3HA 4XV0A 1HJWA 1BSIA 2C8NA 2WXDM 5A8PA 3PZQA 4MNLA 4H41A 3EYPA 5E70A 4AW7A 1ZB5A 1V08A 5E9AA 1WO2A 2WMFA 4W7VA 1E6QM 4PBGA 1ESWA 3N12A 1FHLA 2ESCA 1ZBKA 3CPUA 4TTGA 4B9ZA 2XIIA 3LPGA 4HA3A 5LA0A 1ISZA 4E8DA 2XFYA 4UQ9A 1L0PA 2HISA 3UG4A 5BCAA 3T2PA 4CUCA 2WMHA 1CTNA 3ARQA 2CEQA 3WELA 3AHZA 4TXEA 1QHZA 1E4MM 3G6MA 3AIRA 5ABGA 3W6LA 1IV8A 3SUWA 5E0FA 2O9PA 3U57A 1HP5A 4JL2A 5D8WA 3FN9A 3NJ3A 1KQYA 5ECUA 2FGZA 3CZGA 3OGRA 4UFLA 3ZT6A 4TUFA 1EHAA 1UD8A 1ZBWA 3IANA 3ARTA 2XGBA 5A8NA 1E55A 4JHOA 1VFFA 4M29A 5M5DA 4H8UA 2X8RA 5CQ1A 3VD4A 1W32A 3WMCA 3VIMA 1V3KA 4URIA 1PJ9A 4LYPA 1UZ4A 3BGAA 4EE9A 4J3VA 1UWTA 1E4NA 1E15A 1GZJA 3K46A 2OLHA 1OIMA 5D4YA 4W5ZA 2YLLA 4W8AA 1E40A 3PZVA 4P7NA 2XM1A 3GNOA 1HVXA 4UCFA 1HIZA 2AOSA 2G41A 4UZUA 4OOUA 4MADA 3SURA 2EJ1A 3WL1A 5M03A 2VJXA 2YLAA 3A3HA 5FL1A 1WKYA 1B30A 3WDHA 1UKTA 2XVLA 4C7DA 4OIFA 3E1F1 4D1JA 4BF7A 2J8GA 3L4XA 4CGTA 4PUDA 1JD9A 1WE5A 5DT7A 2EPKX 5CGMA 5GPRA 4TX8A 1PIFA 3N04A 1EHNA 4B9YA 3VDBA 3EDFA 3KL5A 2WNWA 3WUFA 1XCXA 3MSGA 1F4AA 5BXRA 4D72A 1QW8A 5JBFA 4AZBA 1XHGA 3D3AA 1CENA 1JYNA 1EO5A 1VB9A 1XCWA 1ZU8A 1JDAA 3WF0A 1I1XA 2ZX9A 3WKZA 4PMOA 3PHAA 4XZBA 1IT0A 4JZ5A 1NWUA 3POHA 4LGXA 1XSIA 1LWHA 3U7VA 1B9ZA 2F61A 2DH3A 5JUVA 4B3LA 4EANA 4PMUA 3THCA 1XV8A 1MFUA 5BROA 1EOMA 5FD0A 1GHRA 2PWFA 1QNQA 5GNXA 1G0CA 4AEFA 4KRUA 1FOBA 4DUVA 4GI9A 4ZEPA 1K9EA 2CITA 1F4HA 1QVBA 1GOMA 1H5VA 3OZPA 3IAPA 4U31A 4IISA 4DWSA 4CCCA 2DPEA 4W5UA 3PZTA 4MNJA 1HX0A 3QHMA 4Z2HA 2GK1B 4GO9A 1XRVA 2RGLA 1XSJA 2GVYA 1KQZA 1NM9A 1EGZA 1J9YA 1E6SM 4MPKA 1JYVA 4XX6A 2PWEA 2FH8A 1QHOA 1JZ3A 1G9HA 4BQ3A 3AIBA 2WMGA 4V28A 4CD6A 3ARYA 1JF6A 5EFFA 2V38A 4W7WA 2DGAA 3VIIA 1EDQA 3A6OA 2VZSA 1CXKA 2DSKA 1GJWA 2PBGA 3ZT7A 1D7FA 4CU7A 3CHCA 3T0AA 5E6ZA 3A4AA 1PAMA 1UH3A 1ISVA 2OYMA 1C93A 4W7UA 4RE2A 3VIKA 2BHZA 3VIPA 3LPOA 1BG4A 2VVSA 3GZAA 3ZR6A 5I79A 5CSUA 1WCGA 4AD3A 5EBAA 4ACZB 2WAGA 3VVGA 5A6SA 5FKYA 3WF4A 4AISA 3VKKA 1UKOA 4D6IA 4Q22A 2J74A 3N18A 1BAGA 4H04A 2WMJA 4Y7EA 4D6DA 4W93A 2OWWA 2WWCA 1HJXA 3SIMA 3OLEA 2V3DA 2EEXA 3W38A 3CZJA 1Y7VA 4MDOA 2XTKA 3VMNA 2NW0A 1J0ZA 1EOKA 3AHTA 3MUY1 2ZXAA 4A3YA 1GHSA 3I3DA 1PX4A 1CPUA 3WDQA 3CBWA 4WSJA 4CD4A 3FHQA 2JIWA 5BYWA 2JEQA 2J8FA 3F5LA 1E4LA 1E9LA 2W5FA 1NQ6A 1JAKA 4JFSA 4D6EA 4JCMA 4PN2A 3RILA 2JEPA 2VTFA 2VQUA 3SCQA 1QOXA 1PPIA 4OKDA 2NT0A 1U33A 5FL0A 2BVYA 2FGLA 2OWCA 1U30A 1BVZA 4ML4A 4CVWA 1CEOA 4C7GA 3TTQA 1OBAA 1R7OA 3DYOA 1GOKA 4XZWA 2VL4A 2VCBA 3VGEA 3IJ7A 1UR4A 1HJQA 1TA3B 3NUKA 1JI2A 1HL9A 5JBDA 4JIEA 1W9XA 1CLVA 2WVSA 2DH2A 2VRKA 1TVPA 4OBSA 2QPSA 4D6CA 1CXLA 3IJ8A 2Y8KA 4IPNB 1PX8A 3AXXA 3WD4A 3FAXA 4D6HA 4MJ2A 2ZUMA 2QLYA 3TTYA 3WDPP 1TG7A 4OOZA 1E0VA 3OG2A 1JZ6A 3OLIA 4IUGA 2Y2WA 5DF0A 4Z2IA 1GQJA 3SCSA 1CGXA 1UOKA 4J3SA 3WDRA 4WK9A 4NZCA 1KFWA 3NCOA 2CXGA 1VIWA 1WNOA 2WVVB 1VFOA 3A4WA 3EMZA 4MJ4A 5DEZA 3VINA 3W27A 1C8XA 1E1FA 3F5JA 5D9MA 5GNYA 5A8QA 3APGA 3GTNA 2WYSA 3RPMA 2VUYA 2YA0A 2EO7A 1VFMA 3W6MA 5I78A 1UHVA 1J01A 4BS0A 1B2YA 4GZJA 1A3HA 4U5KA 4CN1A 1UWIA 5AY7A 2FH6A 5D9OA 1E71M 2BS9A 4BQ5A 3QR3A 2C0HA 1BYBA 2XG9A 3WNKA 3WF3A 4QCFA 3RM8A 1JL8A 4V27A 3O2LA 3KWXA 2Z1KA 4WJXA 1CGUA 1V3LA 2ZUWA 1MVYA 4HZ6A 4OJYA 2E3ZA 2VX4A 3SCRA 3WFZA 1CGVA 2WLYA 5IHSA 9CGTA 2G4FA 2GUYA 2AAAA 4B16A 3OB8A 4J27A 1XH1A 4ATLA 1V02E 3WH7A 3N15A 7A3HA 4KWUA 1C8QA 3PZIA 4A3HA 1UR9A 3WDJA 3UR7A 2GK1A 1QI3A 1LL4A 3M6DA 3QOMA 3KEHA 1OWQA 2CERA 3WH5A 2DSWA 4KH2A 1Q6DA 1L8NA 5EB8A 2O9RA 4FLOA 3N1AA 1WZKA 3ARPA 3IK2A 4ZE4A 2J7CA 3TOPA 5A6BA 3CH9A 1M03A 3WQ8A 3W53A 1V6XA 8CGTA 4HOWA 1C91A 1MQQA 2QMKA 1Q4NX 3UESA 5TD4A 1YHTA 1I75A 1JXKA 2XFFA 1EQCA 1UD2A 3W82A 1C90A 1E73M 1H4PA 3BAXA 4KRTA 1WB0A 5FOOA 1UD4A 2WCGA 4ATDA 3N17A 3MS8A 3FY1A 4AZGA 1TR1A 1B3XA 3CHEA 1M01A 1UKQA 1WZAA 4MAZA 3VMPA 2W66A 4AD4A 1E5JA 1W1YA 3PZGA 4ACZA 3AJ7A 1ISYA 2E9MA 1QW9A 2CNCA 3L4YA 3PTMA 5A6AA 2YL9A 1ODUA 5A94A 2XVGA 5I3DA 4DWSD 2IXVA 2UY5A 4LX4A 3WQ6A 2V3FA 1TE1A 2CBUA 4UZSA 4D1IA 4HMCA 3RM4A 1LG2A 4QLKA 1V6VA 1E0XA 1GOQA 3VUPA 2XSBA 2VOTA 1G1YA 4OBRA 1UWRA 1QNSA 4AD0A 1CXEA 3B9DA 4PUEA 2J4GA 4HOXA 3BCFA 1US3A 5D9PA 1NH6A 2VC9A 4CD8A 2FHBA 1J0JA 3ARZA 3ZM8A 5LA2A 1H41A 3WH8A 4BQ4A 1C7TA 4CU6A 4N42A 5EFDA 1VJSA 1NP2A 3FXYA 4U5IA 3AS1A 3NSXA 1W1PA 3VPLA 1J0HA 4J3TA 2GJPA 3W0KA 5I5RA 4NRRA 2GJXB 4K68A 4P8VA 4W89A 3D5HA 2ZXBA 2BY1A 2WHKA 2FHFA 3VD7A 1D3CA 3AS0A 1DWHM 3OGSA 2CBVA 1CYGA 1JG9A 4BZYA 4IM4A 2ZE0A 2CKSA 2WWDA 4FMVA 4ZXOA 1C3FA 2D3LA 3CZKA 1K9DA 2XSAA 2YL6A 2YDRA 3ZOAA 5BXPA 3TTSA 3AIWA 1TA3A 4GO8A 2YDQA 3ZSSA 3CUIA 4GINA 2FDMA 2XIBA 2WCSA 2BVTA 3GYCA 3K1DA 1N82A 4DM2A 3EDDA 5AYIA 4WLCA 1GORA 1KCKA 5A2AA 5KZ6A 1MQPA 5CLWA 5CZKA 1SMDA 3M07A 1UKSA 5DT5A 3MMWA 2FHCA 3CGTA 6TAAA 3VTRA 3ARVA 1JZ8A 2ZIDA 4P7LA 3VGHA 1OGGA 2DT2A 1EXPA 1E4IA 4LXFA 2YOCA 4TVDA 5AC4A 1CGWA 3BCDA 1V0MA 4R5EA 1U2YA 1MW3A 2WVVA 4AXNA 2ZOXA 4J28A 5FCZA 4PYSA 3WEMA 3AZSA 4PCTA 1CWYA 1RPKA 3VGBA 3W26A 1NP0A 3FHAA 2VVNA 2VO5A 3GBDA 4X0VA 1IZJA 3AIEA 1AVAA 1TFVA 3AHVA 3MKKA 3L2MA 4P7OA 5BRQA 1UQZA 4QLJA 3T08A 2XUCA 2XVNA 4DUXA 4TVCA 3L4WA 3QOKA 2PC8A 3W28A 1AQMA 3ZSTA 2W4XA 2W91A 4JKLA 3B9AA 2YKKA 3NDZA 2Y8VA 4YHGA 4UFHA 2CPUA 3UR8A 1EIBA 4D6JA 5E6YA 1CECA 4CN4A 3WNOA 2WVUA 3VGFA 4ZENA 4LYRA 5CPSA 1DWFM 1US2A 4FLRA 1UH2A 3AS3A 4UFMA 1ZL1A 4JFWA 3SCUA 1AMYA 3MU7A 3WQ4A 1DWGM 1JDCA 6A3HA 3CMGA 3O9NA 1TUXA 2VCAA 3F4VA 3ZQ9A 1ITXA 1K9TA 2MANA 3AYSA 3GXFA 3GM8A 1JFXA 1WDRA 5CSYA 4XUYA 3AMKA 4ZXLA 2CETA 2Q8XA 4U3AA 1UR8A 3OA5A 4F9DA 2WSKA 1WDPA 2Y4SA 2DSZA 1OCQA 3THDA 5I6SA 2HVMA 4E4PA 4HMEA 1AQHA 1BGAA 1XD1A 2D2OA 2J79A 4JKKA 4DM1A 2WZHA 1W9VA 4JCLA 1SYTA 3BSHA 4AYSA 2W67A 5BRPA 4P7RA 1MW0A 4R27A 3DHPA 3MMUA 4JFVA 1Q6EA 1KR0A 1OINA 4JHZA 1GVYA 3WUEA 3ZJKA 3CZ8A 4HPHA 3RCNA 3RJYA 2ZX6A 3BAWA 5FIPA 2OSXA 1E0WA 5BXSA 2VCCA 3PTQA 4UNIA 2DIJA 8A3HA 1HNYA 1UYQA 4LPCA 1JDDA 1UA3A 4N0RA 4CCDA 3KL3A 3VGDA 1V6WA 4UTFA 2WC3A 2PI6A 1DWIM 3PZOA 4JFUA 1XH2A 4UOJA 1LLOA 3GXDA 4KGLA 4JL1A 3WMBA 2NT1A 3I3EA 2A3HA 1DTUA 2BY2A 4E8CA 1BHGA 3PZNA 1DWJM 1ECEA 3WIJA 1OGSA 1ITCA 3UG3A 1UUQA 1MXGA 1OGBA 3IJ9A 3MV11 2X2YA 4GKLA 2E9LA 3ZT5A 2VRQA 1UR2A 2EXOA 1VFUA 1IZKA 1G94A 1UQYA 3L4VA 2WW5A 3ARRA 4H7VA 2PBOA 4KMQA 1Q6GA 1E3XA 5I0DA 4PTXA 3SUSA 5HBFA 3PBGA 3ZJ6A 4TVUA 3BC9A 1OIFA 3CUHA 1JI1A 3WFLA 4AIOA 4P7QA 3W29A 3BAIA 3KE0A 1CDGA 1K9FA 3AMDA 4WKFA 1WPCA 2F8QA 3VU2A 1MXDA 2VMFA 4GZEA 1E6XM 4UQDA 4Z2LA 1H0GA 4PMQA 2QHAA 2GDUA 4FLSA 4LYQA 4AIUA 5C8BB 4RE3A 3K8LA 1SMAA 1UWUA 2EQDA 2GJXA 3SCPA 3WH9A 3W37A 3WSUA 4S3JA 4Z2KA 1GOIA 3CHFA 4X0NA 1JNDA 1W3LA 1UZ1A 2BXYA 3VDAA 1V3MA 1XYZA 1HF6A 5E0CA 5BWFA 5IFPA 1HVQA 3VD3A 2VX7A 5ABHA 2DQXA 2CYGA 1GUVA 3MO4A 5A3HA 4W84A 1E5NA 5D8ZA 1KXHA 4EK7A 4ATWA 2A3CA 3WF1A 1H0IA 1E6RA 5ABFB 5M17A 3EDJA 4HOZA 4CCEA 4AZ7A 5JIPA 2J62A 1OT2A 5DMYA 1EH9A 1FH7A 3K8KA 1LG1A 1X1NA 5HNNA 3VIOA 3TONA 2EPNA 1QHPA 2A3BA 1DP0A 3EBVA 4TOQA 3U5UA 1R85A 2E9BA 1BPLB 3DYMA 1BYCA 4JFTA 2XFRA 1NARA 2IXUA 4B15A 2GJRA 1MWOA 3MUZ1 5KEZA 5JBEA 1JZ4A 2YBUA 2J7HA 4M81A 4OUEA 3CUGA 1QPKA 2D20A 2VX6A 1J12A 1HKIA 3WNLA 3MSDA 2VI0A 2Y5EA 3MMDA 4HTYA 5A2CA 3K8MA 1FP9A 3AICA 3BLKA 2DDXA 3LPFA 1EDGA 4QP0A 3U5YA 1W1VA 4MDPA 2VZTA 4PMRA 1W3JA 1VEOA 2CHOA 4J3UA 3HN3A 1PZ3A 1OT1A 1RP9A 4J3XA 4EAMA 2E8ZA 3RM9A 4CD5A 3NIYA 1NWRA 1W9BM 4YHEA 4M82A 2WM0A 1AQ0A 1TMQA 2BFGA 3OIHA 4PMNA 4AEEA 5C70A 3AMLA 3AI0A 2DT0A 2PWHA 3G6LA 2O9OA 3OZOA 1VJZA 2WLZA 2BXZA 4PRWA 3ALFA 2B31A 2E40A 5I77A 1H1NA 1JNEA 4CD7A 1WDQA 3BH4A 3ARSA 1CIUA 4EKJA 2CCRA 3WF2A 4IPLA 3FAWA 3WD1A 3PN8A 1QNPA 1CZ1A 4B3KA 1JZ2A 3ZMRA 3BAJA 4CU8A 4PTWA 3K4AA 5A8OA 4MB3A 1BG9A 2X09A 3VIHA 1BF2A 1E3ZA 1Q6CA 4NSBA 3CZEA 1SFSA 1RH9A 2YL5A 2WMIB 4RE4A
chains in the Genus database with same CATH superfamily
1WDSA 3NQGA 5ABEA 4L1XA 2OSWA 4ZODA 3EAUA 1FCVA 3AUJA 3CL6A 3L2LA 1XSKA 3QKZA 2EG8A 3R8RA 2VURA 5FJTA 3WQ5A 2ZUNA 2VEPA 3EPNA 3UJRA 3O1NA 4FB7A 1WQ5A 3MSRA 1TQJA 4FPSA 2NUYA 4H6KA 5I06A 1YPIA 1BYAA 1DYSA 8TIMA 4QFUA 1EA9C 1IHIA 7CGTA 3KTSA 3PBMA 3AIVA 4I7VA 3W76A 3L0GA 4OQVA 1Z32X 1VBUA 3VDHA 3ES8A 1K8ZA 3SADA 4WDXA 3G1FA 1X97A 2PTYA 1MEWA 1M68A 3P2VA 3KOZA 5MHBA 2ACRA 3UD6A 1ISXA 2VZVA 4GPNA 2O7SA 4AD5A 3NL5A 2PP3A 2Y8UA 3I65A 7TIMA 3KS6A 3GD6A 4JTDA 1RLCL 4N9CA 5D2TA 5LGXA 2C7FA 2FMOA 3S6TA 4FZIA 4BF5A 3P0XA 5FJRA 3RIKA 3WK0A 4NZ4A 3O16A 1OFRA 1H1YA 3TOYA 3LY0A 2ZICA 1TX2A 2QMJA 2PEVA 1X1ZA 2G3NA 1TRIA 1US0A 3WN6A 5HANA 2QV5A 1H62A 1WZMA 1KGUA 3OZYA 5D2VA 5HMDA 2EHHA 1J11A 4PMVA 3T0TA 3TYAA 1HL8A 1RQHA 2REQA 5HOSA 1NDYA 4GQQA 4MNMA 2Z7KA 5AHNA 3VIGA 5IXEA 1DXFA 1I45A 2J7DA 4R88A 3OBEA 3RK8A 3HPSA 5HK4A 2ZRXA 1EF3A 1V3IA 3H2OA 1KKRA 4V15A 4LBRA 3OP2A 2IKHA 3AZTA 3I4EA 1AQFA 3LHVA 2WZMA 4AZCB 3AOFA 5BXTA 3HQPA 1YLVA 4C5ZA 2J25A 3TNOA 4PEEA 3N9KA 1JZ5A 1ELSA 2PA6A 3NQFA 2UY4A 2OSYA 4FNRA 3TYDA 5H8MA 1VFHA 3L0KA 4QE4A 5CPQA 3WLPA 3GFXA 4L4PA 3Q67A 3GG7A 1FWNA 3QGVA 2YCLB 4FOKA 4HQVA 5LA1A 1KV8A 3MUIA 1XL9A 1M7XA 2D69A 1B3YA 1KWGA 4HZ8A 1UIPA 3ZR5A 4GHRA 1UIOA 2E67A 1V6UA 3BQ6A 1I2QA 3NSMA 1NU5A 1PX3A 4PMXA 4ICNA 4MTVA 1NDZA 4GXWA 4GI6A 2PDMA 4IPIA 3VX1A 2PDYA 4LVAA 4GQRA 2VX5A 3VNZA 3P84A 2DIKA 1PDYA 1RHCA 4FSAA 3U6WA 2ZWYA 2GPTA 4HA4A 3MSYA 3NPWA 1XIEA 5CGTA 2VDHA 4YVXA 4M6VA 5HMSA 1V3JA 5REQA 1JPMA 3XIMA 1FDJA 2WSPA 3IV3A 1JRCA 3AWOA 2HTMA 5C71A 3ATYA 4JDBA 3S5SA 5I7GA 1XYFA 3V0UA 4RR4A 4AZ6A 4Y9MA 1EEXA 4IGMA 4S3KA 1DJQA 3R11A 1CXHA 6CGTA 5HWJA 1CB2A 4AY1A 3PZ9A 4XB3A 3VYLA 4DF2A 2AMXA 3LRMA 3M7SA 4M56A 2BY0A 4DI9A 2E5CA 1FH9A 2ZRVA 3QHNA 5T26A 2JKPA 2V5BA 4J2PA 3DI1A 3MC5A 1P0KA 3DYPA 4O17A 3G18A 1W9DM 4ACYA 4CNTA 2W61A 4TQTA 1EQPA 1QOQA 2D0GA 3SFWA 4JTQA 3LUTA 2YJQA 3CIXA 1XGZA 4BI7A 4HYRA 4QM1A 3OLGA 1VENA 3EOUA 2ONEA 3WQPA 4U2YA 3H12A 3TQPA 4GX8A 1XLEA 1W5OA 4FEZA 4XK2A 3BSMA 2OELA 1VPXA 3DECA 1SVDA 2EPLX 1YX1A 1E6PA 1MFVA 4B5XA 4DJDA 4O16A 1K02A 1YBQB 1TIMA 4DO7A 1PXGA 3VFLA 1HXJA 1UKPA 4R85A 5DXXA 1MMFA 2WZIA 5G5IA 2YGYA 2P8CA 2PDLA 2XFWA 3HQNA 5KZDA 3WBEA 2EJAA 2V5DA 5EBUA 1JGIA 4PTDA 1DJNA 3MHGA 3ZLHA 3CLMA 3W22A 3HGSA 1EEPA 4B92A 4DEFA 4QSFA 2TAAA 5D32A 2P3EA 2F2HA 2HJPA 1S1PA 4AY7A 4XZNX 1QPQA 2RAGA 2C1IA 3AMGA 1C9WA 1EP3A 4RL3A 3STEA 1OC6A 4YVVA 4WGHA 1TCMA 2WKLA 5EA9A 3GDBA 3ARUA 4MKNA 3KCOA 4AZCA 4HNUA 3BG9A 1KM6A 4O13A 3UWWA 1TQXA 3WEZA 2RJHA 3UG5A 4HPGA 1JCJA 4UOZA 3GH4A 3LCGA 1ME7A 1RVGA 2J8TA 4B4HA 2ZRYA 1N8FA 3HGOA 4BHYA 4PRRA 2PDNA 4NILA 3CLWA 3WQGA 4JX6A 5L9FA 2X2GA 3UZWA 1KGWA 2HK0A 2D0FA 3PBYA 2X7WA 2YCLA 4GVGA 3RO6A 3AYRA 4CKQA 4HSHA 4X2PA 5G2IA 4ZCWA 3WJXA 3C2FA 2CZ5A 2C1GA 3R2GA 3PUEA 3NEVA 3WK3A 2AMGA 4Q32A 1GQLA 3CH0A 3TZNA 3EKZA 3L4ZA 2BOGX 3Q4DA 3P82A 3RX4A 4I5XA 5H91A 4QCEA 3URAA 4HCLA 2J7GA 3BG5A 4QXIA 2VT0A 3P93A 2PGWA 2VGIA 4YTTA 5ENLA 2YB4A 3TN4A 4J3WA 2BTMA 3B8VA 2PWDA 4OZOA 4AU0A 2I56A 1UR1A 1HG3A 4LUJA 3F7JA 1LF1A 3EEZA 4DAFA 3HMJG 3PTDA 4Q7BA 3GVRA 4WOZA 2XHYA 4JEJA 5B7YA 1FWCC 5A2BA 5BNKA 1KO0A 4FR6A 1E1EA 4HIBA 3W25A 3CPRA 5DANA 1WZLA 4M80A 3WLMA 4W87A 1TYGA 1JFHA 4HK7A 3OOQA 2VRJA 4GVFA 3W85A 4O1DA 3EWZA 4AZHA 1RBOB 4PTVA 5C54A 3QC3A 3H6OA 5AB3A 5A6LA 1X6NA 1Z7AA 2I9EA 3VIJA 4QX4A 2BB0A 2OWXA 2Q3OA 4YYCA 1VAHA 2Y7EA 4KS0A 4DWDA 1UG6A 1EJUC 4JTCA 1S2UA 4C6PA 3V0SA 4Q8MA 3W7DA 1RD6A 4FXRA 1Q45A 4M3PA 1TV8A 3TA6A 3E0WA 3DKLA 4J40A 4O4VA 4KESA 5A1AA 5A6MA 4WOQA 1C7SA 4M7TA 3T2QA 2QPUA 5CPTA 4K39A 4IL2A 4IP7A 2BG5A 2ZX8A 5HPOA 2EPOA 1D2KA 1J96A 4AHPA 1EX1A 3DBPA 3MP3A 3N13A 4NKCA 2QUNA 4X60A 1RXOB 2GSJA 4CN6A 4UR9A 5E09A 2PF0A 1Q7ZA 2FZNA 4J9JA 1W3HA 3GAKA 4XAPA 3VOHA 4G2DA 3W24A 1SFJA 4NZ5A 1GQKA 4J5NA 5F2GA 4ICMA 1B4KA 2HVNA 1F5ZA 4U2ZA 2WZEA 1SPQA 3TJXA 5LNSA 1ZENA 4KFNA 4AX6A 4XZ9A 1RY0A 1ZCCA 1UH4A 1N55A 2D23A 3LCIA 5K4XA 2PGFA 4WIWA 4HHPA 4I6VA 4LUSB 5IHRA 3HO8A 4Q33A 1E43A 1QNRA 2A3LA 1AUSL 4BA0A 4RXFA 3P67A 4GX9A 4C7FA 3VO0A 3WMSA 3CUFA 1FCUA 5KZMA 4XZLX 1Q13A 1P0NA 3ATZA 5DRIA 3SUUA 4Q4MA 4TIMA 2OPJA 1S1RA 3T09A 1BFNA 3GR8A 1TZZA 2CLFA 3B03A 3FVMA 2C8NA 1TSIA 3GU2A 4ZB0A 1YKWA 5TQLA 4K3ZA 4AW7A 1V08A 1X96A 4W7VA 1E6QM 1ESWA 5LSMA 1ZBKA 3C2VA 2XIIA 3LPGA 4HA3A 4E8DA 3D46A 4UQ9A 2DW6A 2HISA 3NGFA 3ZVHB 3PUDA 3ARQA 1KV5A 1XIDA 1QNVA 1DJIA 5IDZA 4Z0JA 4FALA 3R4IA 5TF0A 3EWUA 3WLIA 3N6JA 3MJMA 3ITTA 4IIGA 3W2LA 3MWAA 5FSEC 1HP5A 2QGYA 3LTPA 4JIRA 4L56A 4TUFA 4FX8A 3TQ0A 2R1MA 5A8NA 4G8TA 1UZDA 4JHOA 2ZKMX 2ZDRA 4M29A 3DI0A 3SSJA 4H8UA 5CQ1A 1SZGA 1KLZA 3E0IA 4WY0F 3FIGA 3THUA 4ZO9A 3VIMA 3TXVA 1PJ9A 4LYPA 3OZMA 1NIUA 2QCHA 5KINA 3NVDA 2O55A 4EE9A 1Q6OA 3UZYA 2A5HA 3QGAC 3S0CA 3VDGA 4RW5A 3L65A 3K46A 2OLHA 5I02A 1OIMA 2RUSA 5D4YA 1E40A 4P7NA 2Y5SA 3N6HA 3W87A 4US5A 1HIZA 4WDTA 2EJ1A 5M03A 1WKYA 3WDHA 1HKWA 2QYGA 3APYA 4OIFA 4D1JA 4BF7A 2J8GA 1Z3NA 3L4XA 1JD9A 2H90A 5CBBA 1A5OC 5DQPA 3VOJA 1EZWA 9XIAA 4TX8A 4NY2A 1O60A 4AX7A 4DBDA 3U2ZA 1NQKA 3VDBA 3ABSA 4ZR8A 3KTXA 3WUFA 2AL1A 1GWJA 2FQIA 3S46A 1A5KC 1CENA 1VB9A 1ZU8A 2O7QA 3UCCA 2Q71A 4H9YA 4DELA 1HL2A 4XZBA 1I4NA 1IT0A 4AUBA 4GBDA 4JN7A 4LGXA 1THFD 3M0KA 5JUVA 4B3LA 4JPGA 2Y7GA 3THCA 1XV8A 1VGAA 4FR1A 4MGGA 4G1NA 1EOMA 3W7JA 5FD0A 1O1ZA 4R34A 1T96A 5GNXA 1R5YA 3U4FA 1AD4A 4ZEPA 3DG3A 2CITA 3C5QA 1YTDA 3FV9A 2V30A 5T8GA 3WBYA 1H7XA 4C6BA 2DPEA 2P76A 5AN7A 1XLJA 4MNJA 3HG3A 3ZZ1A 1VFTA 4Z2HA 3Q2DA 5HR7A 4MWAC 5H2ZA 3EX1A 4QDPA 4NYUA 1JQVA 2CLIA 1EGZA 3N4FA 3NXFA 4MPKA 4V1XA 5AHFA 4XX6A 3G8RA 3KOFA 4ORIA 4I8DA 4MIMA 3H2AA 4LUSA 4L6OA 1JZ3A 4IX0A 4BQ3A 3AIBA 2WMGA 3H4WA 3ARYA 1OFEA 2ATSA 2WO5A 2BSLA 4WXZA 3A6OA 1GTHA 2J6VA 3V5OA 1B54A 1W5QA 1CXKA 1GJWA 3GKAA 1F7BA 4C6MA 1UH3A 2TODA 2HNHA 2VKZG 4EF9A 2OX1A 3TSMA 3LPOA 3CQHA 2AAMA 1OADA 5I79A 3GR4A 4ACZB 3LLFA 2EF9A 3H23A 4Y9AA 4ERGA 2G95A 4AISA 3VZXA 4IIBA 1UKOA 3WG6A 4D6IA 4Q22A 4H04A 1GTEA 4Y7EA 3UWEA 4A3QA 4JTFA 1FBAA 3ZVHA 2V3DA 3W38A 5AC7A 3CZJA 2OQLA 4DZHA 4I7UA 4PTNA 2QZRA 1XBXA 4UTJA 1D3HA 4JGDA 2VGGA 3CBWA 3KRZA 1A80A 1MNSA 3EZ4A 2JEQA 4JTJA 2J8FA 3EKLA 3G0UA 3TW6A 2W5FA 1UC4A 5LKYA 1JAKA 4JFSA 2I5GA 1VLIA 4D6EA 3OW1A 2YW4A 3KRBA 1P48A 5K4ZA 3GVVA 2VTFA 4CQBA 4YTRA 3DESA 1QOXA 1ZP3A 4OKDA 5F2IA 2NT0A 2V2CA 1P1MA 1EUNA 1XI3A 2BGQA 4ML4A 4CVWA 1OBAA 1R7OA 3DYOA 9XIMA 1GOKA 2C91A 1VZWA 3P0WA 4DVOA 4HNVA 2VCBA 3IJ7A 3V1PA 3S5OA 3BMXA 4JIEA 2FZMA 3P81A 2PS2A 1A50A 2Z1XA 4D6CA 1CXLA 3W75A 3IJ8A 3PM6A 3RLHA 1PX8A 3CU2A 3QC0A 4RUBA 1QWGA 5K2ZA 3Q45A 3W23A 3V1HA 2VR2A 3OG2A 1JZ6A 2Y2WA 5DF0A 1CGXA 1S38A 4NZCA 2WJZA 2V81A 4I9TA 5DRCA 2WVVB 2J9YA 1ZP4A 5BOOA 1N7KA 3F5JA 1FWGC 2WYSA 2PPGA 4GISA 3C8FA 4TX9A 3WJSA 2EO7A 4AAJA 1A3HA 5AY7A 4WVXA 1M5WA 4ZMGA 4BQ5A 4O53A 2VP8A 3BLDA 3SN1A 1NVMA 1W31A 2Q3RA 3UJSA 3GQYA 2I16A 3WF3A 3BLFA 3G2GA 4RZBA 1L8PA 4V27A 2I1OA 4XZMX 3O2LA 2Z1KA 3E12A 4IFRA 1V3LA 4WJXA 3ZFHA 1CGVA 1Q66A 2WLYA 1OCBA 4G5DA 9CGTA 2G4FA 4GE8A 2GUYA 5LNWA 4J27A 3BG3A 5DMLA 1JGMA 1C8QA 1P7TB 3SO7A 1FKXA 4AQLA 2RDWA 1YTKA 3QOMA 3KEHA 2WV8A 1VCVA 3IGHX 4KH2A 1AMKA 2PUZA 4GH3A 1KRCC 4DRSA 3ARPA 4ZE4A 2J7CA 3W7GA 1XLKA 2PDXA 5A6BA 4C90A 4FF7A 3WQ8A 3IIPA 1V6XA 1TR9A 2PRMA 1DJZA 2BP1A 2QMKA 3WLQA 3QTGA 4V33A 4ZQRA 1MI3A 1I75A 1JXKA 2OFJA 3LSCA 5LIKX 1PHWA 5LHFA 5D05A 1C90A 4FX7A 1WB0A 1IXPA 1TPC1 1KM4A 3W88A 3N17A 3MS8A 3SFKA 4B5TA 1SSGA 2ATMA 1SJAA 1UKQA 4S3FA 2DUAA 3I6RA 4HKPA 5LIYX 2Z6JA 3LCLA 3PAOA 4ACZA 1QDSA 4KWSA 3CWNA 5A6AA 2YL9A 1ODUA 2PTZA 5A94A 2R9RA 4QR6A 3O8AA 5HINA 4DWSD 4AEOA 2V3FA 5BOEA 1G4PA 2NVAA 3I68A 1H7PA 1J8VA 4HMCA 3QRHA 3RM4A 1XLMA 4QLKA 4DAIA 2UBPC 2PCQA 4A3UA 3VUPA 3FSTA 1P4CA 4JICA 3EWYA 4AD0A 3B9DA 4KPLA 1JVNA 5KETA 1RV8A 3E5PA 2C19A 1DJXA 3BARA 2CLEA 1C7TA 4YCPA 1NP2A 1MRAA 4DX3A 5TIMA 3AS1A 4KBXA 3BVJA 2OJPA 2DVTA 5F4WA 3GC4A 4AXKA 3VPLA 4LYKA 4DJDD 3LOTA 4J3TA 3W0KA 1KA9F 3MVTA 4IH3A 3TC7A 3QPEA 1Q6LA 1D3CA 3AS0A 4DF1A 1DWHM 3K2GA 4QG9A 1F07A 1JG9A 3SW6A 4FMVA 1E1CA 5FAGA 1TO3A 3UXLA 3B4UA 4L4LA 4MOZA 3E5BA 4HCDA 4GO8A 3NQMA 2OT1A 1VPQA 1YPXA 2FB2A 1R3WA 1KTNA 4LVBA 1TUFA 1SMDA 3KBVA 3M07A 5DT5A 1ME8A 5I00A 2ABBA 2D2HA 2QJJA 2NQLA 4IGSA 4JR5A 4RZ4A 2YOCA 3KAOA 4REQB 3QV9A 5AC4A 3KBMA 2Z7GA 5KZEA 1U2YA 2WVVA 1FWAC 4Y9OA 4JTAA 1GGOA 2RDXA 2PCEA 2PRHA 5KITA 1NP0A 2F38A 1TFVA 1OHLA 3MKKA 4P7OA 5BRQA 1UQZA 4WJ8A 3M0LA 1LBMA 3T08A 3VKCA 1WDWA 2XVNA 4DZ5A 1SGJA 1AQMA 4HVXA 4DZIA 2W91A 4JKLA 3LTYA 1EIBA 3FEMA 4O15A 1BRLB 3LHUA 2WVUA 4ZSUA 3ZYZA 3LK6A 4LYRA 5CPSA 4B5WA 3MO7A 1FTXA 3AS3A 5EMMA 3TR9A 1NDVA 4MHBA 4DHGA 1C8VA 3WQ4A 1DWGM 3QJAA 1KM2A 4H00A 1JDCA 1IF2A 4AVOA 3PC0A 5FSDC 3CMGA 1P7TA 3A22A 3F4VA 1ITXA 3SQMA 1NY1A 3TYCA 2ISSA 5J5RA 1XJBA 3GM8A 4R33A 3DEQA 4XUYA 3WJYA 2Q8XA 3CO8A 3OA5A 1WDPA 3THDA 4IFOA 4E4PA 1AQHA 1XD1A 2D2OA 2J79A 3EOLA 2J24A 3PK7A 4Z17A 2CHRA 3G5EA 4ZO8A 4AYSA 4C6CA 2W67A 5BRPA 2FZBA 2WJEA 3QLLA 4JFVA 1KR0A 1IZCA 1OINA 4JHZA 3A3XA 1GVYA 4HPHA 4AG0A 4TMCA 3RCNA 5FF2A 2C14A 1SZEA 3BAWA 2ZC8A 3K13A 4HN4A 4RDWA 2OSXA 1Q7QA 2YXOA 3M1ZA 5L6UA 2PDQA 4MWAB 1WXZA 4UNIA 4LT9A 8A3HA 1F9CA 4LPCA 4YU1A 4DPQA 3O3RA 3VABA 1DWIM 4JFUA 3R43A 3M47A 5F1VA 4H9VA 3TYEA 2A3HA 1E9ZB 2GWGA 2Z2AA 4PR4A 4GABA 4DXVA 1J93A 1EA0A 1F05A 1OGSA 3D3FA 1HZYA 3MV11 1OX6A 2VUNA 4FAMA 2VRQA 4WR3A 1UR2A 3SJ3A 1G94A 1IXNA 3L4VA 3DGBA 2WW5A 1IQ8A 5HMEA 4OGZA 1EIXA 5AKQA 5I0DA 1Q6GA 3PBGA 2OXNA 4TVUA 1E0TA 4XIAA 5DX7A 4I90A 1WOBA 5IM51 3W29A 3BWWA 2CLLA 4WKFA 1WPCA 2F8QA 1TELA 1XYCA 1SW3A 5SWUA 5C9ZA 3W73A 1O95A 1E6XM 3EOOA 2QHAA 4FLSA 3EWDA 4LEQA 4NQ1A 1SMAA 2EQDA 2OT0A 2R1NA 2AQWA 3BJFA 3A5FA 5FF4A 4S3JA 4Z2KA 1K4HA 4X0NA 5C55A 3OYXA 3EWCA 3VDAA 1V3MA 5BWFA 4FNTA 3G8EA 5HJYA 1XG3A 3WLHA 2CYGA 3N2BA 3RN6A 5LIWX 4O50A 4UMBA 1GYLA 5EGRA 4YVPA 5M17A 3EDJA 2VD9A 1TPDA 4HOZA 4KW2A 4C6JA 4GI4A 4DBUA 1PVNA 3WQCA 5DMYA 2P8BA 3CAWA 5CG7A 2BOFX 3S6DA 5JH2A 2F6KA 1QHPA 1KM3A 1V77A 3PF3A 3NWRA 3DYMA 1BYCA 3ONBA 3FLUA 3FYPA 1J5TA 5EL1A 1TMLA 1JPHA 2PP0A 3MUZ1 1UUOA 4NNAA 4H7ZA 5JBEA 2X40A 4IMEA 4IMDA 3QM3A 3M0ZA 3RRXA 1FCQA 2VENA 3G24A 5I3GA 2VI0A 2Y5EA 3SY8A 3K8MA 1FP9A 1D8CA 3AICA 2DDXA 3LPFA 3GVQA 4MJZA 3UXAA 2V2HA 3P14A 1EYWA 3IJQA 2R91A 4MDPA 2ZZ3A 5DLCA 2CHOA 3RFAA 3GDLA 3HN3A 3I7SA 4EAMA 2E8ZA 3RM9A 3NIYA 4AVFA 1NWRA 3KBSA 4M82A 1X98A 4ZO6A 4YYFA 2Y62A 3EXRA 4P61A 4PMNA 3GAYA 5C70A 3AMLA 3BOXA 1EWDA 1BRLA 2PWHA 3G6LA 1V8EA 1K3UA 3OZOA 2I14A 1WKFA 3WLNA 2BXVA 4TV5A 4XKMA 4PBEA 1CX9A 3TC6A 3RCYA 1IR2A 2ZTJA 3APTA 4EKJA 3LDVA 2PZ0A 2OGYA 2NQ5A 4A8NA 3IIVA 1PKYA 3WD1A 3V16A 5AECA 4MY9A 4E38A 2BLEA 2FKPA 3MTWA 1NF7A 3C56A 1WKDA 4H01A 3L5AA 1OVDA 2W0UA 1BF2A 3S9ZA 4B4FA 4NSBA 3PSWA 1RH9A 3BV4A 3EMCA 3WFAA 5BZAA 3BGJA 1ZAJA 3GSMA 2HQAA 3P74A 5D38A 5ECVA 1RCXB 2IPGA 1RA5A 5EY5A 4Z0SA 2CU0A 3U9IA 4MWAA 1K6WA 1VFLA 1W2PA 3WD3A 2BODX 4AZIA 5GQBA 3MKVA 4GC4A 4RKAA 1TREA 1IWPA 3M0IA 3LXCA 1SU5A 2ICSA 2W63A 2A6LA 1MUCA 2C3ZA 2HV5A 4P5UA 4H3DA 1JZ7A 3WLJA 3KZPA 3GNNA 1AH3A 1K70A 4OTKA 3T81A 3PAJA 4AVNA 1OB0A 3TYBA 5TNVA 3PR2A 5EMKA 3F1QA 1VH7A 2CZEA 4M8UA 4W8BA 1XFBA 2POZA 2F6UA 1UD6A 3ZLGA 3UYCA 4WDWA 2W9MA 2CHNA 3QQ0A 1EJWC 2UWFA 1LQAA 4S3EA 2YDSA 2QDDA 4H9TA 3B9EA 1XRSA 1FH8A 3W2NA 1K4GA 2XN2A 3FYYA 3E0FA 1TV5A 4B2DA 4CEUC 4DUOA 2PMQA 1QNOA 2DSVA 3ZJ8A 3RX3A 1MZRA 1W1ZA 2DZBA 1TWWA 2QVHA 1WXJA 4KIRA 4DQWA 3A3WA 2RKXA 3P62A 1PEZA 3F2BA 1BXBA 5HR6A 1FHVA 1AK5A 3IPWA 4HD5A 4JTEA 3WH6A 3CB8A 3LV6A 4H9MA 4L65A 3ABOA 2CESA 2VWTA 2FVLA 2XGIA 1JIBA 4H8HA 2VQTA 4W8LA 4ALDA 2WB5A 3NO3A 3VKAA 2F6XA 1OFDA 3POCA 1XPGA 2E5DA 3M5XA 2UV8G 5C7HA 1XS2A 3MUAA 5B80A 4XAZA 1XC6A 2VR5A 2TYSA 1Y8BA 5DCEA 3UJ2A 1MYRA 1WBJA 4QE5A 4RZ6A 1NOUA 2FMNA 1M7JA 2W27A 4KCUA 4IMAA 2QJIA 1O5RA 1DE6A 5E1QA 5GJMA 1A53A 4D71A 4H6RA 4YNGA 4NRSA 4B5SA 1VYSX 1R86A 1QUMA 1HJUA 2RGMA 3IVSA 1JCLA 3D6NA 3IGSA 1TZ7A 2BVDA 3C2OA 3VX0A 2XH7A 5EMYA 4A8RA 1A5CA 4ADUA 1W91A 3UVAA 1KBKA 4E8GA 4IIFA 3A47A 1SJBA 3P3BA 1GW1A 4IXXA 3PBUA 4O0ZA 2XWEA 1GVEA 4KF1A 1YMYA 1LOSA 1ICQA 1OYAA 5I24A 3OTRA 1ZBVA 3UGVA 4LS2A 5K9DA 2EG6A 1H51A 1S46A 2Q8LA 3W1MA 1SO4A 1QFEA 1R3QA 1UA7A 2JF6A 3MDUA 3WJWA 3LBMA 1AD1A 2D0HA 1RBLA 4Q8OA 1K7EA 3AZRA 5CSRA 3TTOA 1AW1A 2NQJA 3LHZA 3NDOA 1HT6A 3DX5A 3HMCA 2CZVA 4BCEA 3SEPA 1ONWA 3U48A 3URNA 1EJTC 1EWEA 4U4MA 2IS7A 1UR0A 1E9YB 2QF8A 3OG3A 5U7SA 4LCRA 4IMGA 2G3MA 1NOWA 5CSSA 4O1CA 4XKYA 5PTDA 4PODA 1D7KA 3QSTA 1U83A 3UXKA 3NQ7A 1AZ2A 2R1LA 3GVGA 3MYOA 3C3UA 4CNSA 1H2JA 2D2JA 1W56A 2G8ZA 1RP8A 4Z1AA 2YYUA 5C6MA 4K7VA 2Z1SA 1W9UA 2ZVIA 5EKYA 1ZPTA 3GG8A 4UNLA 2D22A 1ITUA 1I8JA 3GNDA 3DU0A 3PY2A 1B5TA 4QEHA 3I7RA 4NNCA 4ZQCA 4HU4A 1LWJA 4GACA 1CXFA 5H6HA 1DEDA 1YXDA 3VNDA 4X22A 3O07A 3WL0A 4LQ1A 1RQEA 3A13A 5FF3A 5FEPA 5LZLA 1CGYA 1H1ZA 2ZX5A 3CHDA 3SQSA 4CVUA 3W1UA 1S2TA 4YMZA 1KC7A 2J75A 4UTHA 4PSPA 2QVNA 4Q4SA 2OYLA 3MV01 1RSCA 5C5YA 2BOEX 2OEKA 3VNMA 5A6BD 2A6NA 1ZY9A 2GJNA 1O12A 3GBEA 6ENLA 5CPOA 1B0IA 4MZ8A 5FESA 2C0AA 4MWAE 4ZTYA 3TJLA 4H9ZA 2WBGA 4RPPA 3W07A 3LM7A 3MWCA 1KFJA 1ISWA 1R3TA 3GHUA 2E8YA 4H4IA 3KHJA 4P8UA 1A5MC 2H3BA 4E2OA 2OTDA 3EDKA 2NLIA 2PTDA 3WBAA 1VC4A 2IPJA 5D02A 3LN3A 3DFNA 4GUGA 2ADAA 1UZHA 3A9BA 3COTA 1Y5VA 5F7UA 2WKGA 5AHEA 1A5SA 3SUVA 3TEVA 3CEPA 4HTBA 3WUGA 1DJGA 2XINA 5HULA 5FA5A 3WZ0E 4WX2A 3AC0A 4HJFA 1ZALA 4Y6GA 3K4DA 1LT7A 1JF5A 4GH1A 3IIXA 4LAKA 1DKWA 3OJGA 4Q8PA 3GFZA 2V8ZA 1KCLA 4I7WA 4DF0A 1XQLA 4LSBA 3TAOA 1M3UA 2INEA 5FEWA 3OGVA 1LRNA 2A7PA 4PZVA 2XYLA 2JIEA 1G69A 1EYEA 5GNZA 1BTCA 1B31A 2VXNA 3T8QA 3M5VA 3VA8A 1UROA 2HMCA 4QDMA 3H26A 3GB6A 4U10A 5C7VA 2HEJA 2HBVA 3KW3A 3TR2A 1E72M 3LMYA 1FKWA 2DU2A 1CB7B 1WV2A 1XD0A 4HZ7A 1O7AA 4H2CA 1A4MA 3PZUA 4ADSA 3NA8A 2X0HA 4C6IA 3UXDA 3OIXA 4JYDA 2G3JA 3QPYA 1XGEA 2J78A 4O8AA 1R2RA 3AXIA 4BWLC 1MDLA 3AIUA 4MB4A 3LEPA 4PUKA 1GQIA 3EXTA 1FHDA 3L4UA 4TO8A 4PUUA 2WHLA 1KR1A 4Z1BA 2E4TA 2E77A 1OYCA 1DHKA 4LB3A 5AVHA 2VZUA 4EF8A 1DTNA 2Y63A 2DT1A 4HU8A 4ZB2A 4AC1X 1GVSA 2YYTA 1VRXA 1E9IA 5BWAA 3BLOA 3DUGA 4M24A 4AIBA 1M04A 2WJDA 5E0KA 4JQ4A 4Q8VA 4IIDA 2P5NA 3AQUA 1R0MA 4UOQA 3P60A 2GDVA 3W7LA 5E93A 3GTIA 1GW9A 3JZUA 4UQCA 1VRDA 2TMDA 1WP6A 3VM7A 3G1YA 2QV4A 4NAFB 2PWGA 1DJWA 2J7FA 3NSNA 3BW4A 6XIAA 3IRDA 4OV9A 3RPTA 1J0IA 1PZ1A 3QHOA 1UBSA 1LROA 1CLXA 2EKCA 3RLVA 4FNPA 3L4TA 3ME3A 5IFTA 1Z48A 3AHYA 3SCWA 4PMDA 1TPVA 1EBGA 4HNCA 3W02A 4FF5A 4UTIA 5AYBA 2QNEA 4JXCA 5A8MA 3A4JA 3DXIA 3KTCA 3PWGA 1FWBC 3DENA 4HB7A 3UETA 1XYAA 2NX3A 3U2OA 1RJQA 2ALRA 5MF5A 3BAKA 2NSXA 4S3DA 3EMQA 4DJEC 4P8WA 2X0YA 2J9XA 2A3EA 3M43A 1RUSA 1DJYA 4A05A 2GJLA 4WQ6A 3NDYA 3TWAA 2PSNA 4LF1A 5HJLA 4N9BA 4FXFA 1GPFA 4GZ7A 4FOUA 1AFSA 5JQ9A 3NFUA 3T0DA 1YADA 4JAWA 2G96A 1OD0A 3ZLFA 3SRHA 3B4YA 4C6NA 1XXXA 1JAEA 2E0PA 4GIAA 1ZJAA 3GO2A 4FA3A 7REQB 1OD8A 2JFEX 1W9PA 4DIAA 3SM0A 5CEWA 4ZOBA 3SGGA 2E6FA 1DE5A 3UQNA 1AH0A 4BQ2A 2OO6A 4RX0A 4MFEA 2X1RA 1R87A 2OX4A 1U22A 2WXDM 4MNLA 5I3JA 1XRTA 3EYPA 4L7ZA 5G4EA 5E9AA 1WO2A 1VCFA 2ZZ5A 4PBGA 4RCXA 4AY8A 1W1IE 3CV7A 8RUCA 5HUOA 3UG4A 5BCAA 3T2PA 2RDUA 2E09A 2WMHA 4S23A 1ADOA 4F0SA 3AHZA 4XAGA 1PTAA 4TXEA 3QW4B 1LT8A 3W71A 4I8YA 3W6LA 4M1BA 2NUWA 1LWIA 3LHTA 2CLKA 3FN9A 3NJ3A 4MY1A 2FGZA 3OGRA 3ZT6A 3GK0A 3GY1A 3LNMA 1EJVC 1ZBWA 3IANA 1K8YA 3VFCA 2XGBA 2PE4A 1E55A 3GDRA 1R2TA 1I0DA 2B0MA 1Q6RA 5M5DA 2GUBA 3VD4A 1W32A 4M0XA 1KNWA 3BDKA 4C1NA 1NAL1 3W1TA 4IIHA 3BGAA 2YR1A 3EWBX 3FJ6A 3SR7A 1E4NA 2EPHA 4LUIA 3UA4A 4LUTA 2YLLA 4DO5A 3PZVA 3B0PA 3ITYA 1Z69A 4C6DA 1HVXA 3CTLA 1QW7A 3NYZA 4UZUA 4MADA 3SURA 4CNUA 3WQOA 3WL1A 3A3HA 4LTSA 5FL1A 4UTKA 3UJFA 1B30A 2QCDB 3KM8A 4EWJA 3E1F1 4IMCA 4LY8A 4PB3A 4A29A 2FTWA 1A5AA 1MXSA 4CGTA 4PUDA 3W1PA 4UWMA 3TX9A 5CGMA 4HCHA 3LERA 1ZJIA 3M44A 1PCKA 1IXOA 2GDQA 1EHNA 2PD5A 2Y1HA 3H24A 3OU8A 2DQWA 3EDFA 1PE1A 1DHPA 3RRAA 1W5NA 1F4AA 5BXRA 2FDSA 1QK2A 3N2XA 4F0KA 1QW8A 5JBFA 4AZBA 4R53A 1JYNA 3FS2A 1EUAA 2PDWA 1JDAA 2OEJA 4N6FA 1K7XA 1M7OA 2XGZA 4PMOA 3PHAA 1TJRA 3T55A 2GQ9A 3M41A 3GWQA 3CQ0A 4GG9A 3A9IA 1LWHA 3U7VA 1B9ZA 2GSHA 4E0CA 1BWVA 2DH3A 4EANA 1UBPC 1YXYA 1MFUA 3W7NA 3NOEA 3B9NA 4MFDA 1EJSC 3R12A 1FOBA 5FF0A 4DUVA 1YDNA 4RDYA 2IKJA 1QVBA 2YCKX 1GOMA 3N3TA 2IQDA 3O7UA 4IISA 1J79A 3GC2A 4CCCA 4WEVX 3LYEA 3PZTA 2QJMA 1HX0A 3QHMA 1XX1A 4DO6A 4Z1CA 1J2BA 2GK1B 4LWWA 4GO9A 2CLPA 4KETA 5XINA 3XINA 5DMMA 5C9WA 1XSJA 1OX4A 4GJ1A 4O8RA 5C0QA 1J9YA 1E6SM 1JYVA 3NQDA 4EOUA 1ZFJA 3W74A 2PWEA 4LFYA 1GEQA 3QZEA 2FZDA 3EA3A 1G9HA 1XLGA 4QISA 4CD6A 2Z1VA 2R24A 1R3SA 4W7WA 2YDAA 4QROA 3VIIA 2VZSA 4XSLA 7REQA 2NV1A 3GHTA 3MY9A 2XISA 6ALDA 4ZFCA 2DUZA 5E6ZA 2HDJA 3A4AA 2CLHA 1XLDA 1ISVA 5DXYA 2OYMA 4P2VA 2VDIA 3VIKA 3GZAA 3ZR6A 1UJQA 5CSUA 1WCGA 4AC7C 2KZHA 3MUCA 1KM0A 4E6MA 3TH6A 2OZ0A 4MLJA 3QSRA 4O14A 2WAGA 1Y0EA 2HROA 3VVGA 3GHRA 2JKAA 2J74A 2WMJA 2ZZ7A 4W93A 2WWCA 2OWWA 3HG2A 3OLEA 4ZSTA 1RD5A 5CAKA 1Z42A 4INFA 3LHWA 1Y7VA 3VMNA 1XPYA 3SECA 1J0ZA 1AZ1A 1ZTVA 1M1BA 4KIEA 5CKSA 3RX2A 3AXKA 4A3YA 1GHSA 3I3DA 1IGWA 3VNIA 1VS1A 3DCPA 5D37A 1CPUA 3E49A 5HWNA 3IJLA 4WSJA 4OFCA 4KCVA 3R0UA 3DDMA 3F5LA 2E7FA 2HCVA 2QT3A 4L9XA 3IVTA 3RU8X 2XH4A 1H5YA 3P5YA 3RILA 1KW1A 3O6DA 4AWTA 1BF6A 2VQUA 3TDFA 1JDEA 3H53A 1HGYA 3BO9A 3U8GA 1M9HA 2KX9A 4S3BA 1AJ0A 4PE8A 4O1FA 2CZDA 2FGLA 3UG8A 1BVZA 4YCOA 2OZ8A 4ZOAA 4F3HA 3F2DA 3GTXA 1Q2RA 4XZWA 2VL4A 2FZ9A 2QULA 1HJQA 1TA3B 1DBTA 3QH2A 1JI2A 1TIWA 1I0BA 1CLVA 3FA5A 2VRKA 1TTIA 2GVEA 5B7ZA 4MVAA 4OBSA 3W83A 2QPSA 1W0MA 2QCDA 2B81A 3GX9A 3AYTA 4LAUA 5D30A 4UMCA 2Y8KA 3THQA 3WD4A 4MJ2A 4Q4KA 3MUXA 3TTYA 1KFEA 3CNYA 1L6FA 4IOTA 1GOXA 3TUUA 4IUGA 3SCSA 2I7GA 4J3SA 4WK9A 2OOGA 1KFWA 3BJTA 3GU9A 1XKYA 3P8IA 4K8EA 2TSYA 5H1WA 3L67A 3EMZA 5DEZA 4A22A 4HZMA 3PPFA 1ME9A 1P0EA 3APGA 3GTNA 1VFMA 3K1GA 4YWSA 5CC5A 1ZUAX 1SW7A 1D3GA 4CN1A 4MZ1A 4V1YA 3PG8A 1UWIA 3ITGA 3LI0A 4N9DA 1BQGA 2BS9A 1TJ2A 3QR3A 4G7FA 5LIXX 1UWAA 1KFBA 1POJA 5EMJA 2I9UA 1EL3A 4LUYA 3NQEA 1KKOA 1GYMA 2PODA 2OB3A 1FWIC 3GIPA 1JDFA 3HPAA 3KWXA 2ZUWA 1MVYA 4I5UA 4OJYA 3GE7A 2W6RA 1S2AA 3SQLA 1R6WA 4HYWA 2HPMA 1V02E 2POTA 3OA3A 1UR9A 4X9SA 2VEKA 1Q4WA 3UR7A 2GK1A 2QR6A 4J2MA 1LL4A 3M6DA 3IJ6A 3WH5A 4O4WA 4F2UA 2O9RA 4FLOA 5XIAA 3N1AA 3IK2A 3LCHA 4IQLA 5I03A 3TOPA 1JUBA 2HVOA 3CH9A 4B91A 3LTSA 8CGTA 1TTPA 2FVMA 1R3YA 1RVKA 1JJKA 1MQQA 1VYPX 1Q4NX 1EGMA 1L2QA 4CQAA 3LB0A 5CC3A 1EQCA 4LU0A 2NWRA 1UD2A 2XN1A 4X2RA 3BAXA 4KRTA 1YEYA 1UD4A 1VFSA 1TR1A 1B3XA 3W86A 1M01A 3EXSA 4Q6JA 3MVIA 3C2RA 3VMPA 2W66A 3S9IA 1FUYA 1W1YA 1ISYA 3LNPA 4WJEA 1QW9A 3L4YA 1ZHAA 1K7FA 2XSXA 5I3DA 1AODA 4LX4A 3WQ6A 3PS7A 1UOZA 2OQHA 4Y9PA 4UZSA 4D1IA 2Z25A 1LG2A 3WK1A 1GOQA 2XSBA 2VOTA 1G1YA 1SJCA 3CWHA 2XIQA 1UWRA 1QU4A 4PUEA 2DZWA 2J4GA 3BCFA 3NZQA 2JK2A 1Q6QA 5D9PA 4CD8A 3MJYA 3ARZA 4S38A 3H2NA 3S4TA 1WAUA 2V0TA 1XDMA 3CQJA 5EFDA 3NPUA 3FXYA 3TJ4A 3UWZA 5F4SA 1RAKA 3DZ1A 2Z1WA 1PL9A 4S3GA 2PLKA 4GY1A 1EPVA 3W7OA 4MYXA 4GBUA 4H9UA 4K68A 1SZRA 3R8GA 2A0NA 2BY1A 4K37A 2E6AA 2J6XA 4JQAA 4LBUA 1CYGA 4IM4A 2ZE0A 5AZ1A 3UXIA 4JEQA 5BMXA 2D3LA 3P7YA 1T40A 3GIYA 1K9DA 5BXPA 1HUVA 3AIWA 1S2VA 1TA3A 3W1XA 1TTJA 3HV9A 5LGZA 3QMTA 2GVLA 4DLMA 3LMZA 4IQEA 2PDCA 2BVTA 3NEHA 1N82A 3G3MA 3CXOA 3JU2A 4WLCA 5AYIA 1GORA 4PB5A 5A2AA 5KZ6A 4GC3A 5CZKA 1UW9A 3DERA 2WSQA 6TAAA 4E2VA 1QPRA 1JZ8A 2ZIDA 4GFSA 2ZBTA 2DT2A 4FIQA 1EXPA 1E4IA 4PRTA 4TVDA 2O4QA 1FWTA 3KVKA 3BCDA 3CJPA 2A79A 2Z6IA 4NZFA 1OCJA 5FCZA 1FWSA 3WEMA 4BWLA 3AZSA 3OVRA 5HQMA 3BOLA 4L9YA 3FHAA 3OVGA 4YWIA 3AU6A 4X0VA 1IZJA 3AIEA 1AVAA 4FHAA 4F0HA 1ONXA 2B7QA 3L2MA 3MW7A 3TW9A 1AW2A 4M5PA 2XUCA 4DUXA 4GCAA 3ITOA 1PIIA 2CWNA 3W28A 3TCEA 2EKGA 5DCBA 1O5KA 2Y8VA 2Y88A 2CPUA 3UR8A 2WNNA 3LQGA 3OPSA 1CECA 3C8NA 4Y9NA 5E6YA 4CN4A 3WNOA 1UP2A 3VGFA 2QDGA 4ZENA 3S9YA 3QZ6A 1SR9A 1P6BA 3MZNA 2MUCA 1AMYA 1PO9A 3MU7A 3O15A 4DJFD 1IWAA 1GVQA 4IMFA 2ZA2A 1HO1A 2YCIX 1QPOA 1K9TA 5AVNA 1T41A 2I5QA 5LNRA 3TSDA 4JIPA 1UPPA 3URQA 4ZXLA 3V7PA 4Q8WA 2WSKA 2Y4SA 1GKRA 3C0QA 4JKKA 4DM1A 2WSRA 2WZHA 3LZ3A 4HNLA 4JTSA 1SYTA 4KFOA 1Q85A 3EKGA 4P7RA 2YZ5A 4Q3MA 3IACA 2V5LA 2BX7A 3RJYA 1RQBA 5FIPA 3B0YA 4L64A 4DJEA 3T8LA 3PTQA 1TB3A 2DIJA 1HNYA 2WZTA 4EVZA 4QQUA 4PMJA 2HXTA 3VGDA 2FLIA 4UTFA 3W2MA 3PJWA 3CAVA 3PZOA 1XH2A 1G67A 4JL1A 3WMBA 2P3ZA 4HMNA 2GGEA 1DTUA 1J4EA 1BHGA 1ECEA 2ZC1A 4GGHA 3UYIA 3ITVA 2WKJA 3FJNA 4MM1A 1XIMA 2PDJA 3IJ9A 1LRQA 4JBRA 2X2YA 4JY9A 4QSHA 1L9WA 4GKLA 3G1DA 2E9LA 2PWVA 1CW2A 1I2PA 4DNHA 2EXOA 1I60A 3HIJA 1VFUA 1GJPA 1UQYA 5DCDA 1GK8A 5BW6A 4I9JA 3SUSA 4PC8A 3BC9A 1OIFA 2AGTA 4AIOA 1BD0A 3QEZA 3KE0A 4PH6A 1QPNA 2E28A 4O10A 4GZEA 4UQDA 2Y0FA 4PMQA 3HOJA 3W7KA 2GDUA 5TBOA 2VHLA 3C4UA 5A6TC 2VEFA 3W37A 3WSUA 2RDTA 4ZA0A 3CHFA 1W3LA 3SY5A 1AJ2A 1XYZA 1HF6A 1VYRA 3QW3A 1UB3A 1GUVA 4W84A 1E5NA 2ABAA 1JUKA 2QXWA 3TN6A 2A3CA 1E6RA 4GGBA 1G7VA 5ABFB 4AZ7A 5JIPA 2J62A 1FH7A 1LG1A 4XBJA 3ZS4A 3VIOA 3TONA 3H4GA 3URBA 3FCPA 2A3BA 4TOQA 2AL2B 1R85A 3PNUA 4JFTA 2XFRA 2VYOA 3QFEA 5K7JA 4WHBA 3FDKA 4LANA 4B15A 4NI8A 3S42A 4O18A 4CNPA 4E2DA 2C71A 4NJGA 3WJZA 4Z1DA 3NQVA 4M81A 2GGGA 3UWUA 1ADDA 1J12A 3IGUA 3LLDA 3MSDA 3S1XA 2QGHA 3F4NA 2B7OA 3H4XA 4UTWC 1SW0A 1DIOA 4ZTXA 3CPGA 1PZ3A 4CD5A 4DYKA 3SGUA 2GWNA 3I6TA 3F2CA 2WM0A 1AQ0A 2HS8A 2HZGA 3AI0A 1KFKA 3USZA 2FZ8A 1L6YA 4YTQA 1DQUA 1JNEA 1I2NA 2Y6ZA 3PFMA 3BH4A 3ARSA 4NZ1A 2ODOA 5LXEA 2BASA 1CIUA 3NO5A 2C1HA 4RE0A 4IPLA 3AYVA 1QNPA 4NZ3A 1BXCA 4DPPA 4LCQA 3ZMRA 3BAJA 4CU8A 2INFA 5A8OA 1LBLA 2ZZ1A 8XIMA 1BG9A 2WSYA 2WQPA 2WQDA 3VIHA 1EJ7L 2X30A 1Q6CA 2ZZ2A 4PFHA 3CZEA 1SFSA 1PTGA 5G1YA 2YL5A 5A5WA 3OO2A 2WMIB 1M6JA 2R82A 4UCGA 4XBKA 2ZUVA 3H55A 4NF7A 1MW2A 4RV3A 5JMUA 3CUJA 5I2UA 3KHDA 3M0VA 1KFCA 2PB1A 2QUMA 3CQIA 1HKKA 1UASA 2J66A 3O6CA 4R9XA 1KB3A 1V7YA 1EZ2A 2AQVA 1QO5A 2WPBA 3O6YX 2HWGA 3AXMA 4ONVA 2R6OA 4S2BA 6XIMA 3M16A 5HDRA 4DWSC 3QKEA 4LS1A 1BKSA 5HMFA 3OLDA 4MAVA 2Z26A 3NQ8A 4N02A 4TX6A 1JUEA 4U33A 1EGVA 3PSVA 4EXQA 3N3MA 3GNXA 3QF0A 3QZAA 2QIIA 5BMWA 2ON3A 4ZVJA 1XLBA 1YNPA 3WEOA 4G1KA 4EPEC 2F2KA 3T9PA 2Y5JA 1DQWA 1W5MA 3VKJA 1JYXA 1YBQA 3VIFA 1YE4A 4N2YA 3GDMA 4HT3A 3KX6A 4HA1A 3DHUA 1DWAM 3AMCA 3FGCB 5CZJA 3FNDA 5D2WA 3W01A 4FIRA 3CAKA 2NVCA 4JQ1A 4DJDC 2YIHA 5FJJA 1X6LA 2OVLA 4QQ3A 3T0CA 2W62A 5D04C 3UA3A 2AKZA 1DVJA 3CZLA 4DBSA 1TV4A 1ALDA 2OYKA 1KM5A 3S2NA 2IUZA 4Z1YA 4W85A 1WUFA 4LC6A 2G3IA 1R9YA 5IDIA 3W7EA 3N4EA 3M5YA 3SRFA 4LAMA 4ADTA 1NOFA 4XTIA 4ECLA 1ZQ5A 1TPEA 4YS1A 5ABFA 3SUTA 2JGYA 3R79A 1C92A 3BLLA 1MEIA 1MNZA 2V67A 1OABA 4AZ5A 2AL2A 2FPYA 4PSRA 4F79A 3B8IA 4JQ2A 1ODZA 4DI8A 2R1PA 3EDEA 1KBIA 3H70A 3MBDA 4UTUA 3N4AA 3HU7A 1JEZA 2BV9A 4EAYA 2NUXA 4NXSA 1N8WA 4D6GA 2QS8A 3KOWA 1QCWA 5CLTA 4IL0A 2FFIA 4E4UA 1CGTA 4WKAA 4OECA 2G0WA 3WD2A 1ZS2A 2XPKA 1GONA 3J7HA 4NHVA 4H9XA 2VEGA 3VCNA 3WLRA 1X7FA 3N9SA 5A8GA 3KBWA 3R5EA 1GNXA 3CASA 4WUIA 1CBGA 1KXVA 3TA9A 3MANA 1XYMA 1SJDA 3VXGA 3CMJA 4JIQA 3F4CA 4YL2A 1S5TA 4HP5A 1T7LA 1DIDA 1FWRA 3ALGA 3FA4A 5BU9A 2WHJA 3V75A 3W2JA 4ORMA 5F1UA 2BY3A 2OEMA 4RW3A 1F3EA 3GH5A 3LRLA 3DH7A 3QQ1A 2NXHA 4LS0A 1VF8A 2YBTA 4RNIA 3N2TA 2QQ6A 3KCJA 5C2CA 3RG6A 3UCQA 3W84A 3HZ3A 1K6AA 1WX0A 2VGBA 2O4MA 1S5NA 3NNTA 1IE7C 3RGTA 4Y8FA 3UFYA 3L2IA 3T2OA 3TP4A 4A4AA 2J9ZA 2WMIA 4UQBA 3C0SA 1OFQA 4NI3A 1P0BA 2Z0IA 1PUDA 4MLRA 1QBBA 3CHVA 1SSDA 4LNCA 3MI2A 4PUJA 3BMVA 1TVNA 4IP5A 3AHXA 4RV8A 4O54A 4JY8A 2QW5A 2JE8A 4G9PA 1W17A 3W9ZA 4LRTA 1KRMA 3IRSA 1WAWA 1B3OA 1PKNA 1SO5A 3QV6A 1YXCA 1WDDA 3FKRA 2G5WA 4KERA 3G77A 5G2WA 1JYWA 3BXWA 5AC5A 4YXGA 1HJVA 3IVUA 1H63A 4AWUA 3R8HA 1Z44A 3SCTA 4Q4QA 2NXIA 3MBFA 2BHYA 2EPMX 3H7UA 1XR2A 3RO8A 2P53A 1XC4A 3EX2A 1KCXA 2XJ7A 3KVJA 3CT7A 3BE7A 5G4HC 4QTGA 1EX5A 1HJSA 1Y65A 1VEPA 2V69A 3RAOA 2DIEA 4Z08A 3RF9A 4L1WA 4MSSA 1EP1A 1LQ0A 1WBHA 3LPPA 2QPXA 1QBAA 4PA8A 3WY1A 4NG3A 3KZSA 3O05A 3CV1A 3CC1A 3ENLA 1VHNA 3LENA 3KRUA 1YQ2A 1EPXA 4FLQA 3HV8A 4K1WA 4ZL1A 2A4AA 3MT1A 3QBUA 2GOUA 3UGRA 1GCYA 4FK9A 3HG4A 3I6EA 1PBGA 4KT2A 3TVAA 3BQ5A 2F84A 4N4PA 4NJIA 2Z2UA 7PTDA 3DC0A 1IWBA 4WKHA 3NL6A 4PUMA 1ZBCA 3FOKA 1RZMA 2DJLA 5JH1A 3SJNA 5CJ5A 3U2EA 2ISVA 1Q2SA 1S2WA 2ZFAA 1LP6A 1V0LA 2YA1A 3VOCA 3EA1A 3Q37A 3ISIX 1TPFA 4H6EA 3WDIA 1RCQA 2CKRA 3VDCA 2PZNA 3OHIA 1HTIA 3W81A 4QITA 1XH0A 3WNNA 4F2BA 3AISA 2BHUA 4JTRA 4YLWA 3TJIA 3T1GA 4AIEA 1E51A 1F8IA 5HPCA 1BVWA 1OK6A 2DEPA 3TIMA 3BSGA 4X63A 3MI3A 4IFKB 2VR4A 3THAA 5A69A 4F9JA 1H50A 4UTLA 2WNZA 1V4YA 2X05A 2VNCA 5D09A 4LV9A 4AMAA 2D73A 4PTMA 4ZQNA 4KGJA 3DKJA 4AD1A 3FW6A 3NM1A 3E2VA 3S1UA 2P88A 3HF3A 4JN8A 3FX4A 3SCVA 8XIAA 3BMWA 3NURA 3G3DA 2O92A 4ZQMA 1Q8JA 1A0EA 3EB2A 4GYFA 1LL7A 3BZGA 1XLCA 3A23A 2VD8A 4N4QA 2VC5A 1K77A 1G7UA 3TK7A 2WCAA 4XD6A 3RMJA 3BAYA 4L6DA 3TW7A 3SCNA 3KDNA 1SR0A 1UUMA 1H11A 3CO4A 4Q8NA 5CXPA 1EJRC 2A1YA 3ANUA 3I7QA 5F2MA 1FDZA 1UMLA 1ML1A 2ZX7A 4UXDA 1VKFA 3VMOA 3LHYA 3BANA 4QGCA 2V6AA 4FNUA 4JNMA 3GG0A 3NTYA 3ABXA 3UT0A 1M53A 3HJEA 1ZJBA 4DLFA 4HMDA 3WQDA 4DO4A 2H6RA 2X1IA 3R10A 3WNMA 3O6AA 1BEUA 3U3HA 4QS5A 3RDKA 1DPMA 3QY8A 1TCDA 2D1ZA 3OVQA 4HN8A 4KEZA 4WF7A 5F4XA 1HO4A 2YBVA 2WANA 4LB4A 3AIQA 1KGXA 1P6WA 3RLGA 1H09A 1X38A 3VUSA 4RJEA 2R94A 4DUWA 1B3WA 1GJUA 4TV6A 3V0TA 3ONCA 2XWDA 2INZA 4YJ5A 1J18A 1JXJA 3HFYA 3WUBA 1IIGA 4Q7IA 4V2XA 1GVOA 1FA2A 2V82A 1WKEA 2OOFA 4QEEA 2DZSA 1HP4A 2O9TA 3MA8A 1O4UA 1QI0A 1MO0A 1YDVA 1KCZA 3PTKA 2ASHA 3W7PA 3M64A 1SZNA 4UNKA 1FDYA 4J7RA 4AD2A 4NJJA 1KRBC 2PDBA 1H49A 1W3KA 1S5MA 2PDPA 1XLIA 3ARXA 1GOOA 4DWSB 1R47A 3ECQA 4QG6A 1XLLA 2DSUA 4IICA 3M46A 3SCOA 2ZUTA 2B4GA 1VR6A 5I3KA 4MNKA 1V5XA 2A7NA 3S5YA 1B3VA 3AALA 4ZE5A 1GVRA 4WD0A 5AC8A 5K3VA 1TMHA 2JF7A 1PSCA 1V93A 1B3ZA 4GNJA 1U1JA 4TR9A 3TAKA 1A0CA 1KBJA 2JBMA 2QIWA 2OLAA 4YIWA 2DZAA 2VDGA 3WLKX 2CBIA 3B97A 4IJRA 3DBNA 2DZPA 2ALDA 3N25A 4OT7A 3KP1A 4NU7A 5AC6A 2IKGA 2CIPA 1LM1A 4Y96A 3RR4A 2PFHA 1NFGA 3NM3A 1POKA 2P0OA 3GS6A 2NLYA 2WNQA 4GI8A 2V3GA 1Q8AA 3B8WA 3I10A 4DJED 3XISA 4MB1A 4GXMA 1YNYA 4W86A 2DVUA 1V3HA 1HJWA 1BSIA 3E2SA 4ICCX 5A8PA 3M7WA 2VFHA 5ABTA 4BI6A 5CC6A 2Y89A 3B40A 1HFBA 3N12A 1FHLA 1OK4A 2VM8A 3CPUA 3V3WA 4JTHA 2P0IA 2XFYA 1L0PA 1S5WA 3M6YA 3LD5A 1KD0A 4CUCA 5CCZA 4IFKA 2QUVA 3OEXA 4GRSA 4E5TA 3F4DA 5C9RA 2CEQA 3ZWTA 3ABZA 3P5ZA 4EX4A 4DN1A 1YDOA 1E4MM 2NQ9A 4ZGYA 5ABGA 1I9CB 2HS6A 2YXXA 3SUWA 3WYZA 4RDZA 4JL2A 5D8WA 1OZMA 2UZ9A 1KQYA 5ECUA 2PLCA 4I5RA 5HATA 4JNZA 2HRWA 3U2CA 3OYZA 3LXAA 2XH2A 3FXGA 1GKPA 3UJEA 1VFFA 2X8RA 3AAMA 2ZCGA 4BKNA 1TWDA 5GJPA 2X41A 4H7CA 3WMCA 3GUWA 4DYEA 1RLDA 1V3KA 2PC4A 3HTWA 4URIA 1O5XA 4JTLA 1TE6A 4J3VA 4JN6A 1UWTA 4UTWA 3O63A 2YFOA 2IQTA 3KVMA 4UCFA 4JYFA 1W3IA 2G41A 4OOUA 3MZ2A 4ZQOA 3DFSA 4MMWA 4E4FA 1UKTA 2XVLA 3Q58A 4FOJA 2QAFA 4RPQA 4JD4A 3TN5A 4LVDA 3CQKA 1H7RA 3FJ4A 1WE5A 1I2OA 1QWKA 5DT7A 3FKKA 5GPRA 1IXQA 4GYKA 3UY8A 1PIFA 2GGIA 4C1KA 3N04A 1W1A1 4NUWA 2WNWA 3MP4A 1XCXA 2C79A 3O0KA 4IHCA 4Y90A 4D72A 1LZOA 4GIYA 5CBJA 4CQ8A 1ZCOA 3L21A 3D3AA 2Z1BA 4M51A 1EO5A 1XCWA 5GVJA 1GVFA 3MHFA 1GZGA 4PEKA 1I1XA 2ZX9A 6TIMA 4HPJA 1L2UA 3UNDA 4JZ5A 4Z42C 3W70A 3LXBA 3VAVA 2F61A 2KAUC 3RHGA 4PULA 5BROA 3FSUA 2PWFA 4OBTA 4AEFA 1LQ2A 1W8SA 4MYAA 2GQAA 1FWFC 4GI9A 1F4HA 3W7HA 4CCZA 1PWLA 2W79A 1H5VA 2PDUA 3OZPA 3IAPA 2QAPA 1Z9AA 2FIQA 3C52A 1L6SA 5JVLA 4DWSA 1OFPA 4J1OA 4W5UA 3EX3A 4BEQA 1XIHA 3C0LA 1JRBA 1XRVA 4FP1A 3BCJA 2GVYA 2IPWA 3NPVA 4A2SA 2B7PA 1KQZA 2OR2A 4CEXC 2FH8A 2HPIA 1QHOA 4DXKA 1ICPA 4V28A 3GIQA 2ZVRA 1TZ9A 2XIJA 2YX0A 5EFFA 4BEUA 2Y7FA 2RH9A 1JPKA 2DGAA 5F2LA 2TPSA 5IOBA 2X7VA 1C9DA 7ODCA 5TAOA 4CU7A 2ZZ4A 1C93A 4W7UA 5CAHA 3ANYA 4AD3A 4UTTC 1TKKA 1EC7A 3L66A 2BGSA 1GG1A 5A6SA 3EA2A 3S83A 3WF4A 2WJFA 3JRKA 2A2IA 1M7PA