1TVPA

Endoglucanase cel5g from pseudoalteromonas haloplanktis in complex with cellobiose
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
293
structure length
293
Chain Sequence
AVEKLTVSGNQILAGGENTSFAGPSLFWSNTGWGAEKFYTAETVAKAKTEFNATLIRAAIGHGTSTGGSLNFDWEGNMSRLDTVVNAAIAEDMYVIIDFHSHEAHTDQATAVRFFEDVATKYGQYDNVIYEIYNEPLQISWVNDIKPYAETVIDKIRAIDPDNLIVVGTPTWSQDVDVASQNPIDRANIAYTLHFYAGTHGQSYRNKAQTALDNGIALFATEWGTVNADGNGGVNINETDAWMAFFKTNNISHANWALNDKNEGASLFTPGGSWNSLTSSGSKVKEIIQGWGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cellulase
publication title Structure of a Full Length Psychrophilic Cellulase from Pseudoalteromonas haloplanktis revealed by X-ray Diffraction and Small Angle X-ray Scattering
pubmed doi rcsb
source organism Pseudoalteromonas haloplanktis
molecule tags Hydrolase
total genus 119
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1tvpA00
2DIEA 4E8DA 1ZL1A 3F5KA 1W1PA 2J74A 2V3FA 3UERA 4CUCA 5C71A 1AQHA 3VGFA 2DH2A 3CZ8A 3VIJA 4PMNA 3DHUA 1IV8A 2ZX9A 3WH7A 2UY4A 4XB3A 3MMDA 1B90A 4KGLA 4PCSA 2D3LA 1CDGA 2D3NA 1V6XA 4D6HA 2CESA 4AZ7A 1UR2A 3SCTA 2CNCA 5A6MA 2GDUA 1BYAA 4JCMA 1QNRA 5EMYA 3SCNA 4Z2IA 1W3KA 3QOMA 1BG4A 4IM4A 3SCVA 4IPLA 1KWGA 1OCQA 3VX0A 5EFDA 1BF2A 2WCAA 2ZUNA 3A4XA 4D1JA 2FHCA 5CSUA 1E6NA 4AISA 2Y24A 1VFOA 1E55A 3WSUA 3GM8A 4Q7NA 3CBWA 1KR0A 4OIFA 4GI6A 3OZPA 1OIFA 3FY1A 1YQ2A 1CGVA 3AHYA 3GXFA 4S3JA 2TAAA 1UKOA 1JAEA 3PZIA 4J3XA 2Z1SA 4P7NA 4DWSB 1KXHA 2BY0A 2W91A 4W86A 4QCEA 1NOWA 2G3NA 3BAXA 2VR4A 3N11A 1TR1A 6TAAA 4BF7A 1E6PA 2G3IA 3EMCA 4HMDA 3TA9A 2DDXA 4JIEA 4V27A 3WH6A 1KXVA 2CBVA 2J25A 3WQ4A 1V3IA 4TX6A 4TTGA 2J7BA 1IZJA 5TD4A 3BAKA 4JKLA 1E56A 4CD4A 2PWGA 1NOFA 1UWTA 1V3JA 4N42A 4UFHA 3LPGA 1TZ7A 4PMZA 1B3VA 1CXKA 4AZBA 3DECA 3GDBA 1JFHA 1KFWA 1V3MA 2CETA 3G6LA 2E40A 4HOZA 3VGHA 4PMVA 4J28A 1JL8A 8A3HA 1HF6A 5ABHA 3O6AA 2J7EA 3K4AA 4CU7A 3CPUA 4MNKA 1UH4A 4B3KA 1BSIA 2GSJA 3WDQA 1UD2A 4AD1A 1JXKA 2VCBA 2XVKA 2J8FA 4AZHA 1Y7VA 1CYGA 4M82A 1SMAA 1U2YA 4PCTA 4PRWA 3AXHA 1PPIA 3AIWA 2X2YA 2YOCA 3GZAA 2WXDM 2BHYA 1PX3A 4MJ4A 1HKMA 3WD3A 2VT0A 1ITXA 3OA5A 4GQQA 4HZ6A 4PUEA 5ABGA 2XM1A 4HU8A 1E6QM 5A1AA 1G0CA 2O92A 3E1F1 5FKYA 1GHSA 2Q8XA 3WMBA 5BXRA 4QFUA 3UR7A 4E8CA 1HKIA 3KWXA 4GKLA 4CVWA 4TUFA 3WELA 3II1A 3CZGA 2JALA 3N04A 3WF2A 5FOOA 1J9YA 2EQDA 4JL2A 2BVYA 1DWAM 2ZE0A 1SMDA 1UD4A 2WZHA 5AY7A 5A3HA 4JFSA 2C0HA 2OYKA 1UA7A 2WWCA 2CIPA 2VL4A 1CIUA 2ZXAA 4MPKA 3WDIA 1G5AA 3IANA 2AOSA 4HZ8A 2XM2A 2G4FA 1JGIA 1J0KA 3SUUA 1W2VA 1MWOA 2VZVA 3WNOA 4JFTA 4FLSA 1H4PA 1OGBA 4W8BA 4OZOA 1GOOA 1H11A 2YL6A 1WP6A 3KEHA 3WF1A 3VGBA 4H04A 1UR9A 5I23A 3WD2A 2YKKA 4TVUA 4AZCB 3GNOA 1DTUA 1XCWA 3S2CA 2CERA 4B9ZA 4OJYA 1GJUA 1PBGA 3VM5A 1V6UA 3MSDA 1OIMA 3BSHA 4QCFA 4JCLA 4NSBA 4BQ3A 2X09A 3OZOA 3L2MA 4ZEPA 4OOUA 1V3KA 1FH8A 2GJPA 4D6IA 4JL1A 1ECEA 1AVAA 4WF7A 3VX1A 4WIWA 1BGGA 5CZKA 3WNMA 2OWXA 5I0DA 1GOMA 2D0GA 4XV0A 2E3ZA 2ESCA 3BLKA 3VNYA 4HA1A 2E8ZA 3AJ7A 2D1ZA 5HBFA 4MNLA 1XV8A 5LA0A 3VMOA 3GYCA 5DO8A 2Y4SA 2EPMX 2G8ZA 3WFLA 2WZIA 3I3BA 1JF6A 2YLLA 2YIHA 3N18A 1KB3A 1ZBVA 3NCOA 1F4HA 1R7OA 2WSKA 4YN5A 4WK9A 1JYVA 5HNNA 1TVPA 3DYOA 3QHMA 4AY1A 3L4VA 1LF1A 1LQ0A 3AMGA 4W85A 1NWSA 2PBGA 4P7RA 4TVDA 1E3XA 4OUEA 1TA3B 4Q22A 4CU8A 4UFJA 1IZKA 1UKPA 4XUYA 4WSJA 3QHOA 2W66A 1C90A 1J01A 1LLOA 2DH3A 3MUAA 4D71A 2WSPA 1C92A 3AIBA 3WEMA 2IXUA 3UETA 1MYRA 5HPCA 3HJEA 2E4TA 1MQRA 2VJXA 3EBVA 5D9NA 4AEFA 1RD6A 2XPKA 4AEEA 3AHVA 2GK1B 1B31A 5BXPA 4M29A 3SEPA 4MTVA 3K4DA 4J3WA 1QNQA 2YA2A 5E9AA 2WVSA 4YHEA 1C93A 4PTVA 2VZTA 3UG5A 4UTFA 4JAWA 4HA3A 1G94A 3VDCA 3MKKA 3LPPA 1BYBA 4ACZA 4AYSA 3TTSA 2YBTA 1C91A 1Z32X 1RH9A 1C7SA 4C7FA 1OD8A 4Z2KA 2Y8VA 1K6AA 3T2QA 3VD4A 3WQ8A 3GXIA 3A3HA 1HL9A 3MANA 3SUSA 1D7FA 2XFFA 3KL0A 4AZGA 2WVUA 3U7BA 4Z2HA 3VILA 3NDZA 2WB5A 3WQWA 3WNLA 3FHAA 2XGBA 5A6KA 3PZTA 3PTQA 1MFVA 1GONA 2XYLA 3RILA 5GPRA 2ZXDA 4CD8A 1HX0A 5A2AA 3EDKA 4CN1A 2OSWA 3ZT6A 1QVBA 1W1VA 1OSEA 1J11A 2CHOA 1W9VA 4EKJA 1EOMA 1K9DA 2EPOA 2VCCA 3RM8A 4GI8A 1JIBA 2WMIA 1WNOA 3PBGA 1ITCA 1S46A 1WE5A 3A47A 3OGVA 4TTUA 1E73M 2V3EA 4JHOA 2J77A 2BY3A 1TVNA 1GUVA 4XZWA 1HVQA 4UOZA 1JZ2A 3U7VA 4QP0A 2PWFA 3PTKA 1FOBA 3GH7A 4JKMA 3VGEA 1CXIA 3WDHA 3ZJKA 1NQ6A 1E6XM 4MB4A 4AZ5A 1UD3A 5A8OA 3BMWA 3BGAA 1HN1A 5CPQA 2XG9A 8CGTA 4HU0A 2WKLA 2A3AA 3L4WA 3PZ9A 2DQXA 3PZOA 2ZX5A 4CKQA 1AMYA 3CGTA 3GBEA 1WDSA 4KRUA 3M07A 4QDMA 3AS3A 3WBEA 1QNPA 3L4UA 1HNYA 1CGXA 1RPKA 3AIRA 4MDPA 3WMSA 1DP0A 4ACYA 4AIEA 1W32A 2A3CA 4DWSC 1GZJA 2YL5A 4Y7EA 4AXNA 4W7UA 3TOPA 2WM0A 3BH4A 3MMUA 1GW1A 3OGRA 2ZWYA 4ZXOA 3BAYA 2DSZA 1UR8A 1PZ3A 3L2LA 1KBKA 1DHKA 1TCMA 1V02E 1Q6FA 3OLEA 1CPUA 5E09A 1HJUA 4DWSD 4LYPA 2EEXA 3EDJA 1VEPA 1MXDA 1KGWA 2VNCA 3VVGA 3T0DA 3T0BA 4TX8A 4H41A 1UOKA 3BXWA 3CHEA 1HJQA 5A8NA 4CCCA 4JKKA 4UFIA 5ABFA 4UZSA 1E4NA 1E43A 2D24A 3WEZA 3M7SA 3VIKA 5D8WA 3W26A 4AWEA 4LYRA 1BYCA 4BCEA 2CYGA 4BQ2A 1NWTA 2XSBA 5M03A 4A4AA 4PTWA 1JI2A 1UKTA 1XH1A 3AROA 2G41A 2WVTA 5D9MA 3A4AA 1ZBWA 1BTCA 3NDYA 2RGMA 3ARQA 4JFUA 2VCAA 2VO5A 4C7DA 4PSRA 1YHTA 4YHGA 2VVSA 3FHQA 1H0IA 1UD8A 4F8XA 1X6LA 5HXMA 3WIJA 2XIBA 4BZYA 1MQQA 4J3SA 3WMCA 2NSXA 1UR0A 3CO4A 4U33A 5A6BD 3RJYA 1MW0A 2PWEA 3VKKA 1DWGM 2ZX7A 2AAAA 2JIWA 4B9YA 1EO7A 2VQTA 4W5ZA 1R8LA 2WC3A 1UA3A 1EA9C 1XGZA 5FD0A 2ZUTA 3WUEA 1WO2A 3ARYA 1E6RA 2IUZA 5EFFA 1EIBA 3KE0A 1MW2A 5BCAA 3RM4A 1M04A 1XH2A 4U2ZA 3BC9A 5BWFA 2CBJA 1K9TA 1JAKA 3VIMA 1ZBKA 3VIGA 1OB0A 2E9MA 5D4YA 3ZMRA 3L4TA 4CCDA 3OBAA 2YA1A 3AYRA 3PZMA 3VD3A 1I1XA 2VX7A 2YDQA 4DUWA 5DFAA 1H3GA 3WKZA 4MB1A 3CMGA 2UY3A 4H8HA 3QOKA 2BNJA 3N12A 2BY1A 3APGA 2OLHA 3MV11 4Z2GA 1V0KA 1PX4A 1VEOA 5CGMA 1C3FA 1G1YA 2B31A 2VX5A 1DWJM 2W67A 2WVVB 4UOJA 4B15A 3ZSTA 3IK2A 4P8XA 1VAHA 1W1YA 2WC7A 2ZX8A 3AMCA 4FF5A 4ML4A 3W27A 1WDRA 2VVNA 2O9RA 3AXIA 3U5YA 3W6LA 2WLYA 1Q6DA 4UNIA 1HKJA 4GZJA 2OYMA 3EYPA 4LXFA 1PIGA 3A4WA 1VJSA 1E4IA 3CH9A 1ESWA 2VX6A 4FLRA 1JYNA 1FFQA 2GVYA 1EQPA 2C8NA 2CBIA 2JFEX 3PTMA 3VGGA 2CKRA 5AC4A 3AIQA 1D3CA 1GORA 2IXVA 5FL1A 2J7CA 1J0JA 3KL5A 3AS1A 1UWIA 1FP9A 4QLKA 3UCQA 1IT0A 1JNEA 3WNPA 5D8ZA 4X0VA 4JFWA 4F66A 4H8VA 4V28A 4UFLA 3W82A 2XHYA 1PAMA 3VOCA 1QHPA 2VR5A 3CUGA 1RP8A 1CGYA 1B3XA 1HT6A 3CUHA 1WZMA 5IHSA 5CPSA 1V0LA 4H7VA 1ZBCA 4GIAA 2WLZA 5BXTA 3NSNA 4P7LA 3T08A 1BQCA 3MS8A 3KL3A 1E5NA 1E72M 3T0AA 3WF4A 4ATLA 5LA2A 2O9PA 2DGAA 1CXEA 1AQMA 3VDAA 1V02A 2ZIDA 2ZXQA 1JZ3A 2X1IA 1QHZA 2EXOA 3EDDA 3BMVA 1V3LA 2DT2A 3CIVA 5E0FA 1W1TA 1JI1A 2HISA 4WSKA 3WUFA 1JXJA 1UR1A 4U31A 1ODZA 1R7AA 3WD0A 2VURA 3FN9A 1GOIA 1H41A 1JYXA 1PX8A 2WAGA 4NF7A 4URIA 1LL6A 2F8QA 5A95A 4MJ2A 5CPTA 4AD2A 2CITA 2YDSA 2BV9A 5CGTA 5HDRA 2BY2A 1X1NA 5A8MA 2WHJA 1OWQA 3ALFA 1VBRA 2A3BA 3F5JA 4E2OA 4MB3A 2DEPA 3VD7A 3IJ8A 1XRVA 2DPEA 1E3ZA 4OBRA 4EE9A 3VU2A 3ARTA 2CCRA 1HIZA 1WKYA 4TOQA 3WF3A 3G6MA 3DC0A 3M6DA 1JZ4A 4WKAA 3O9NA 2VI0A 2VMFA 2BXYA 3CMJA 5HOSA 1CGTA 3BSGA 2F61A 3GXDA 5ABEA 1H1NA 4P8VA 1Q6GA 1VFFA 3LPOA 2EPLX 3SCQA 1XSKA 3NSMA 1UG6A 1WAWA 4MAVA 1KGXA 1GQLA 1NWUA 3DYPA 1B3WA 3EMQA 1UH2A 5LYRA 3VIIA 4GXPA 2GK1A 1UHVA 2WYSA 5A94A 2FH8A 1GVYA 3TONA 3AHXA 4KGJA 2NW0A 2XWDA 1V6VA 4U2YA 4XX6A 1B30A 2EPNA 2J4GA 2E0PA 1LWJA 1JZ5A 3M46A 1JDDA 2FDMA 5GNZA 2DIJA 3AIVA 5A6AA 3OG2A 4IUGA 3RCNA 4MB5A 2D0HA 4J3UA 3T2PA 6CGTA 2WNWA 3ARWA 1GOQA 3ZT7A 1ZS2A 3OLIA 1EDGA 3UESA 3FNDA 1JF5A 4M80A 4U3AA 1EGZA 2PI6A 4MAZA 1KQZA 1WZLA 1FHDA 2OWCA 5M3WA 1OGGA 1SR0A 3FAWA 2J7FA 1HP5A 4EK7A 2XVGA 3T09A 4AIUA 1QI0A 1MQPA 3B9DA 1OM0A 3WUBA 4R27A 1B0IA 2DT3A 5E6ZA 1ZU8A 3N1AA 3WF0A 5BYWA 3THCA 1KR1A 2QV4A 1J18A 4PMRA 4W5UA 3SCPA 3T2OA 2JF6A 3POHA 3VM7A 4J27A 4A3HA 4DM1A 4F9JA 1EXPA 1L0PA 5A6JA 3WD4A 1B1YA 3DYMA 4OOZA 2W63A 1PZ2A 3W25A 4CVUA 3A6OA 1KCLA 7TAAA 4PSPA 2UY5A 1UWQA 4RE2A 3UG4A 4ZE4A 1BAGA 5I77A 3VUPA 4CCEA 4EAMA 5DT7A 2WK2A 1KWKA 4UQ9A 3LPFA 4ZFMA 1LG2A 1E0XA 1E1EA 1J10A 1G01A 1QNOA 3W4RA 1QOXA 3W29A 2JF7A 1B2YA 1QBAA 4S3KA 4HOWA 1CBGA 3WUGA 1CTNA 5BROA 4D6FA 4CN6A 2O9TA 3OLDA 2YJQA 2J75A 2WBGA 3AIEA 3TTYA 1WCGA 3WNNA 5EB8A 1EOKA 4B16A 4HOXA 4IPNB 1A3HA 3VMPA 1ZJBA 3WDPP 3SCUA 1EHAA 1OT1A 5IFTA 5E70A 1PEZA 2VZSA 3N17A 1E6ZA 1W9DM 1KXTA 4UQCA 4KRTA 4MDOA 2VOTA 4X0NA 4H8UA 1TE1A 4JHZA 3WH8A 3B9AA 3ZJ7A 3VD9A 2VRJA 1M7XA 1VJZA 1DWHM 3CUJA 2BVDA 2E9BA 4UQAA 3POCA 3VIFA 4V2XA 5E0CA 4GO9A 2XVLA 3UR8A 1QPKA 3WD1A 2YLAA 4U5IA 2XFRA 4AZIA 3WBAA 3NUKA 1H09A 4PTXA 4PBGA 3L4ZA 1NM9A 1SYTA 2X05A 3K8KA 4GZEA 1E40A 3SCOA 2WANA 5A6LA 1ISVA 2QHAA 4PYSA 1I75A 4NZCA 5I24A 4UZUA 3MO4A 1JZ6A 3WENA 4M24A 4FLOA 1XCXA 1J0YA 1UZ4A 1ODUA 4BS0A 4ACZB 5FL0A 2Y2WA 1W3HA 5A8PA 2AMGA 2GDVA 3CZJA 3W24A 2V3GA 4W89A 1BFNA 1VB9A 5JBEA 1W3JA 1X6NA 1CXLA 4WKHA 4LQ1A 2X0HA 1VFUA 3AS0A 3AFBA 1B9ZA 1E9LA 1GVIA 3RM9A 5JUVA 3RMEA 3BCFA 4D6JA 3NYDA 1OD0A 3W38A 1EHNA 3VINA 2GFTA 3FXYA 4AZ6A 1XC6A 4BA0A 3QHNA 3B9EA 1QHOA 1W9BM 4E4PA 5CXPA 1R87A 2Y5EA 2WMIB 4RE3A 3AHTA 3SCWA 1XHGA 1ISYA 2CXGA 4UFMA 2EJ1A 3ARZA 3ARSA 1KGUA 1EDQA 1W9XA 4NRRA 1GOKA 1PIFA 1G9HA 2ZUUA 3AOFA 3LMYA 4ZE5A 1JDCA 4HMCA 4F79A 1HL8A 1D2KA 1JFXA 1KQYA 1JDAA 4CGTA 3SCRA 1MW3A 1OT2A 4ZXLA 1JZ7A 1KXQA 3SUWA 2YA0A 4J3TA 2WWDA 2XUCA 2FHBA 3SCSA 3RJXA 4AD3A 4QLJA 3AISA 3CHFA 5IDIA 4C7GA 5IXEA 3AI0A 1GJWA 5I78A 1VEMA 3THDA 1QI4A 3RO8A 2QPUA 1UYQA 3F5LA 3GNPA 1OBAA 1E71M 2GJXB 1CEOA 4PMDA 2OYLA 3ZM8A 4HA4A 3ZJ6A 3S6TA 1UH3A 4DWSA 3OGSA 2Y8KA 3UEQA 1HJXA 3OIHA 1XD0A 3CZKA 3WY1A 1MFUA 5KEZA 2X8RA 3GH4A 2GJRA 2PWHA 1ZJAA 4W7WA 1CWYA 5IFPA 2EBNA 4B3LA 2G3MA 5I3DA 1F4AA 4BQ5A 2QLYA 2XIIA 1HKKA 1VFMA 4MNJA 1JD7A 1V0NA 5DEZA 5BRPA 2QPSA 1CNVA 4Z2LA 4HPHA 2WKGA 1FH9A 2BS9A 5ABFB 5CLWA 2XSAA 1UUQA 1XYFA 3VO0A 4L4OA 1VENA 4W8AA 4LYQA 2ZX6A 5A6BA 4W7VA 3SURA 5I79A 2VRQA 1BHGA 2XVNA 3AYSA 3CHCA 4MNMA 1E0VA 2G3JA 5DMYA 2XJ7A 3VIOA 4IISA 4Z2JA 4K68A 1J12A 2A3HA 5DF0A 2ZUSA 3GH5A 1J0IA 4H2CA 2MANA 2JIEA 3VIHA 4AIOA 4DM2A 1OGSA 2J7DA 3NSXA 2W5FA 5CG0A 2CPUA 1JD9A 5IHRA 1V6YA 1KBBA 3GXMA 1W3LA 3GBDA 1LWHA 4ATDA 3MUZ1 3W37A 1DWIM 1GQIA 1R85A 3EDFA 4CU6A 4GPNA 4JFVA 1NARA 3AMDA 3VIPA 6A3HA 2D0FA 1LL7A 4AC1X 4PMXA 3CUFA 1M03A 2OWWA 1CLVA 1XYZA 2RGLA 4W93A 1JZ8A 3VGDA 1QW9A 1U30A 1VRXA 1M01A 2J47A 4GO8A 1QW8A 4WKFA 4U5KA 3WFZA 1C8YA 1GPFA 3MUIA 2JEQA 3GNRA 2JEPA 4HTYA 3ZIZA 5JBFA 4F9DA 3WL1A 4W87A 5GNXA 1NP2A 3MMWA 1UR4A 2WMJA 3EMZA 3WNKA 3K1DA 1ZB5A 1EDTA 2DSUA 1GHRA 1BYDA 4AZCA 4TXEA 1HVXA 2FGLA 1NP0A 2PC8A 3CZEA 2J79A 3N9KA 3CHDA 1Q4NX 3IAPA 1US3A 2OSXA 2YL8A 1JG9A 3AICA 2C7FA 4J7RA 2Z1KA 4PEEA 1GCYA 2GUYA 1C7TA 4NI3A 4P7QA 2PF0A 1E0WA 3ECQA 2WCGA 1A47A 1J0HA 4GQRA 4LGXA 5JIPA 1H0GA 1XD1A 2WZEA 4PTMA 4D72A 2J62A 5D9OA 1DEDA 1EH9A 1W2PA 2XVPA 3K8LA 2W62A 3HU7A 3O2LA 3RPMA 2CBUA 1BPLB 3K8MA 1WB0A 3WQVA 5AC5A 2D22A 3N13A 1V6WA 5CJ5A 1E5JA 1JYWA 1V03A 2V5DA 3CUIA 5M5DA 1US2A 5BXSA 1CLXA 3PZGA 3BCDA 5CSYA 3FW6A 2PB1A 5ECUA 2YL9A 2YDRA 1BGAA 2BFGA 3OB8A 1UQZA 4RE4A 3ALGA 2CHNA 2A3EA 5JBDA 3OLGA 2BHZA 5A8QA 1EQCA 4X9YA 4ZENA 1CENA 2VQUA 2YBUA 4WLCA 5F7UA 1TG7A 3AIUA 3D5HA 1QBBA 1I1WA 5I2UA 1TA3A 3PZVA 3UG3A 1AQ0A 2UY2A 1OINA 1K9EA 4NRSA 1WZAA 1C8QA 2QF8A 3ZJ8A 2WW5A 1WDQA 1HXJA 1UWSA 5HPOA 3VTRA 1WPCA 3MSGA 1O6IA 3U5UA 2DSWA 2DSVA 3BAJA 4UOQA 4D6GA 5JIWA 2WHKA 1UWRA 2ZUMA 3AMLA 1DWFM 3NIYA 5A6SA 3W53A 1CGUA 1UKQA 3BAWA 2X0YA 3CZLA 4UQDA 4ATWA 2VRKA 1MXGA 1HP4A 5FIPA 3ZOAA 4OKDA 4EANA 2WMHA 3SUTA 4OBSA 3AHZA 4GINA 4CD7A 3RDKA 2VC9A 2D20A 1H2JA 3ZQ9A 1HJVA 2WHMA 2OSYA 2J7HA 4N0RA 5DT5A 4TVCA 1H49A 1CGWA 2J8GA 1QI3A 4RL3A 3PZQA 2JE8A 5CQ1A 2FGZA 4W84A 2QMJA 3ARRA 3J7HA 2VZUA 2J78A 2WMKA 3PHAA 4QAWA 1V0MA 1U33A 4M56A 5D9PA 3WH9A 1QI2A 3KZSA 2WHLA 2ZUVA 1UWUA 2ZUWA 4BQ4A 5EBAA 1E70M 1KCKA 4M8UA 5LA1A 2QMKA 2V3DA 4UQBA 4L4PA 3MU7A 2XFYA 1WZKA 1GNXA 3AXXA 4AMCA 5GNYA 3I3EA 3WQ6A 2E9LA 1CZ1A 5I6SA 2ZWZA 2VUYA 4LX4A 3AS2A 3VDBA 4AD4A 1Q6CA 2WBKA 3ARPA 3VNZA 3QR3A 4QLLA 3IAQA 5KZ6A 4YPJA 5GQBA 1UD6A 3B8SA 2WMFA 1E4MM 2PBOA 2XTKA 1J0ZA 1LG1A 1M53A 1WDPA 3MUY1 7CGTA 3TTQA 1W9UA 4XZBA 1L8NA 1EO5A 2ZOXA 2BHUA 3PZNA 3VMNA 3VDHA 5BRQA 1E6SM 3WEOA 1HJSA 1HJWA 3W81A 5A2BA 5A2CA 2HVMA 1UKSA 1XSIA 1W9PA 3ARXA 1NWRA 2ZXBA 1ISWA 1E4LA 2NT0A 1JNDA 4U3CA 3ZO9A 5E6YA 1K9FA 4UQEA 3NJ3A 1B3YA 1B3ZA 2BXZA 1SFSA 2WCSA 4W88A 5M17A 3ZR6A 3ZSSA 1E15A 1H5VA 2J7GA 3BLPX 2WC4A 3IJ9A 4JZ5A 3AMKA 3JUGA 3ZR5A 3N15A 3WQ5A 4W8LA 3W28A 3EDEA 2W92A 3VD5A 4CN4A 3HMCA 4A3YA 4P8WA 3K46A 2DT0A 4R5EA 4AD5A 4M1RA 1FHLA 3TTOA 4D1IA 3ARVA 4HPGA 1ISZA 3MV01 2FHFA 1BVNP 1V3HA 2CKSA 4P7OA 4D6DA 7A3HA 2NT1A 4D6CA 2CEQA 3BAIA 3CTTA 1NOUA 1UZ1A 2BVTA 2ZICA 5CLTA 3QGVA 3FAXA 2O9OA 2DSKA 1GQKA 3L4YA 3ARUA 3W6MA 4WJXA 1LJYA 3AQUA 5AYIA 3WN6A 3PZUA 4CD6A 1CXHA 4AW7A 1MW1A 4AD0A 2VX4A 4UFKA 2V38A 4DUVA 4PMUA 4PMYA 1QNSA 1CXFA 1ISXA 1BVZA 3RIKA 4LPCA 1TUXA 2GJXA 1O7AA 4HZ7A 1UD5A 5C8BB 2XGIA 2XWEA 4KH2A 3VPLA 1R86A 4FLQA 3I3DA 3AZSA 5FCZA 1GOWA 2WMGA 3WH5A 2WPGA 4UCFA 2W61A 4PN2A 4D6EA 2E8YA 1CECA 4GZIA 3D3AA 1XSJA 2DT1A 4MADA 5C70A 5A69A 1FFRA 1UQYA 2VTFA 2V5CA 1PJ9A 3WL0A 3PN8A 1VIWA 4HP5A 4P8UA 1VF8A 3F4VA 4DUXA 1Q6EA 1MVYA 4FMVA 4CD5A 4M81A 3L4XA 1XH0A 5I5RA 1BG9A 3ZT5A 1LL4A 3IJ7A 2EO7A 3SUVA 3DHPA 1NH6A 2UWFA 3WDRA 2D2OA 4HMEA 4KMQA 4FK9A 3HN3A 1W91A 1TMQA 4J3VA 3AZTA 4PUDA 1C8XA 2EPKX 1TFVA 4KWUA 4UR9A 2W4XA 4PMQA 1FP8A 4PMOA 2F2HA 4GI9A 1FH7A 1FA2A 9CGTA 1QI5A 3TP4A 2FH6A 3GTNA 1V08A 3AZRA 1GQJA 3W0KA 1RP9A 2VZOA 3SIMA 1VBUA 2WVVA 5AYBA 2PWDA 1BLIA 3U57A 3WDJA 1E1FA 1P6WA 1N82A 2D23A 3CLWA
chains in the Genus database with same CATH superfamily
1FTXA 1VYPX 5D09A 4DQWA 1W1PA 2V3FA 3NZPA 3UERA 5AC8A 1Q6OA 3HMJG 2DH2A 5F2LA 4E8GA 1KTBA 3RX2A 3PPHA 1IV8A 1XXXA 1TTPA 3WK0A 2HE5A 3PSVA 5H8UA 2VDIA 1MEWA 1XBVA 3MI3A 1UR2A 4IIDA 1TV5A 3CB8A 1PVNA 3KOXA 3QOMA 4IM4A 3UXLA 4IPLA 2YCLA 4DYKA 2VD8A 4D1JA 4XD3A 3K5XA 2PS2A 4IX2A 4AISA 1NJJA 1E55A 4G7FA 3VNDA 3KBMA 2NZLA 5LIKX 4IOTA 2C18A 3A23A 4JTHA 1WOBA 3FY1A 3AHYA 4HPNA 4J3XA 3H7RA 3LNPA 3W75A 1RQEA 3DERA 3M5VA 1TWSA 2VR4A 1TR1A 3LM3A 1BD0A 1OCNA 1DJGA 3STPA 1TPUA 3WH6A 2OB3A 1KXVA 2CBVA 1V3IA 4A05A 2J7BA 3NAVA 3BAKA 1GGOA 4DXXA 1BXBA 5CKSA 4C6QA 5LNVA 5FA5A 4UFHA 4JTJA 3T7VA 1UJQA 1CXKA 1S3TC 4G7EB 1JFHA 3GDBA 3VCCA 5HUOA 1VCVA 4L4MA 4IG2B 4J28A 1QDSA 3N2TA 8A3HA 3V5FA 3K2GA 2GPTA 3ZWSA 4AD1A 4JR5A 3C8FA 3SY1A 5ENLA 1H7OA 1CYGA 3LBMA 1SMAA 3UGVA 1KFCA 3SY5A 2X2YA 5FI8A 1JUKA 1HKMA 3V75A 2HE8A 2VT0A 5CC5A 3OA5A 3OZMA 4REQA 4JGDA 1E6QM 4ZCWA 3SM0A 1G0CA 3FA5A 3UGRA 4QFUA 1OVDA 4OGZA 4CQ9A 3RK8A 1YE4A 3H7VA 4CVWA 3WELA 2YB1A 1W6TA 1W3IA 4XG1A 1J9YA 4OBTA 4IX0A 2KX9A 1UD4A 4YTTA 5AY7A 1BKHA 5A3HA 2JBMA 3BLEA 4DVOA 4F48A 2WWCA 3S6OA 1WXJA 1XM3A 4KETA 3W74A 3WDIA 1GW9A 4HZ8A 1JGIA 3P67A 4DBWA 1J0KA 3E0VA 3SUUA 4QQUA 4MJZA 4JIHA 3S9IA 1WP6A 3WF1A 4LAUA 4KBXA 3ATZA 3KWSA 3RITA 3PR2A 1OFQA 3UJFA 1GEHA 3RCYA 1DTUA 4IFRA 4HYVA 1XC4A 4UUIA 2OZ3A 3TMQA 1V6UA 4XUGA 3BSHA 1TJ2A 4NSBA 4IMDA 3A12A 1FDJA 3L2MA 1V3KA 4AFYA 4RZ5A 2DP3A 1A0DA 1ECEA 4WF7A 4UB9A 5JQ9A 4QROA 5I03A 3M0LA 2V81A 3CU2A 1LDCA 1BGGA 3UWYA 3WNMA 4JICA 1GOMA 3GTHA 2R1MA 4XV0A 3CQKA 1PB0A 2E8ZA 2ZDSA 2P50A 1DJQA 3DFYA 3LI1A 4L1XA 8RUCA 4JTDA 1EBGA 3NO5A 4NJJA 4MNLA 5LA0A 1XRSA 2WNZA 4E5TA 4MFEA 1US0A 1YPXA 5DO8A 2GOKA 1ZJIA 3U2CA 4LY8A 2WZIA 3WCZA 3I3BA 2YIHA 1KB3A 2CWNA 4GH1A 1JULA 2WSKA 1U5HA 1UC4A 5EBUA 3APYA 2PLCA 3FGCB 4QJ1A 3DYOA 1LF1A 4NILA 1EC9A 1LQAA 1LQ0A 2SFPA 3HGSA 1MDRA 4DYEA 3DIPA 2I56A 1ZUAX 3MI6A 4OUEA 4IH3A 2DZVA 2PRMA 1IZKA 3NQEA 3I6RA 4G1KA 5AHIA 1DIOA 2DH3A 3AUOA 1SU5A 4JIRA 3NM3A 1AQFA 4O16A 4ZODA 4AEFA 3MZNA 4AEEA 1N8FA 3GRIA 4M29A 3SEPA 3ONBA 2NX9A 2XGZA 2QGYA 2WVSA 2XH4A 4NZ5A 1OFBA 4CNPA 4JAWA 2HXUA 2ISFA 3H22A 3H4XA 5G5IA 5PTDA 2J8TA 4JX4A 1F6YA 5K2ZA 2QJNA 1P1MA 1Z32X 1HL2A 1LQ2A 2Y61A 1S2VA 3W84A 1XBYA 2Y8VA 3A3HA 1XDLA 3W7GA 4HN8A 3SUSA 1D7FA 2XFFA 4AZGA 2WVUA 5HWMA 4KEVA 3GIYA 1ZAHA 3VILA 3ELFA 4ZQRA 3C0QA 4JS3A 5K7JA 3WBYA 3FHAA 4NL1A 1FWFC 3PTQA 4RDZA 3RILA 2ZXDA 1S5NA 1Z9AA 1QPRA 3NVDA 5FJJA 4DZIA 3RLHA 4CN1A 3L67A 5I3IA 1OSEA 4PUWA 4US5A 5GJPA 2BB0A 2Y70A 2DFAA 3KVJA 1ITCA 2E6DA 1WE5A 3U9IA 4KWSA 3SRFA 3M47A 1HW6A 3FJ4A 4RE0A 2BY3A 3M16A 5XINA 3KTCA 1HVQA 3TCEA 4QP0A 2YZRA 3F03K 2QUUA 1RBAA 2ZZ2A 4JKMA 3VGEA 3ZJKA 1NQ6A 2YXOA 3OVQA 4AZ5A 1UD3A 1PKLA 4G9PA 4HYRA 1W5MA 4DJDC 4KT2A 2XG9A 2ZC8A 5CPQA 4HU0A 2V63A 4GNJA 5FJTA 1F05A 4YYFA 2C0AA 3UZ5A 1RQHA 2ZX5A 4CKQA 4JNMA 3W1MA 1F3EA 3CGTA 1WDSA 4YS1A 5I02A 3IV8A 2NVCA 1E9ZB 3BJTA 3AIRA 3P2VA 4UR7A 4HA0A 2V2HA 2A3CA 4I7UA 4DWSC 4R7WA 1EF2A 3ZVIA 2PSNA 3BL3A 3G1SA 1EWDA 4LAZA 4LS0A 3TROA 3L5LA 5U7SA 4GHRA 2DSZA 1V02E 4LTSA 5I3GA 5E1QA 3OTRA 3EWCA 1HTIA 1HJUA 1T8QA 3RYSA 1A53A 1XIBA 4DB7A 1QAPA 2WNQA 4JNZA 1XP3A 3BLFA 1KGWA 3VVGA 1TJPA 4FI4A 3T0BA 3GO2A 1UOKA 2FPVA 1BF6A 3S83A 5DCEA 4RNFA 1M9HA 4L4LA 1AA1B 4UFIA 5ABFA 1X7FA 4KWWA 5DCBA 4AWEA 3W26A 3B06A 4Q7BA 1BYCA 3O0FA 2R1LA 4BQ2A 5M03A 4C6BA 1L6SA 3V35A 1WXZA 2WVTA 4YWSA 2DJLA 1ZBWA 2I5QA 2VEGA 1BTCA 3IEBA 5H6HA 2VCAA 4HJWA 3MYPA 4PSRA 4PTNA 4YHGA 2VVSA 3FHQA 5CG7A 1KRCC 1X6LA 4GJIA 3S5ZA 5HXMA 3WIJA 2BDQA 5HWNA 4BZYA 3V36A 3RMJA 1YE6A 3H2CA 2E67A 3VFCA 3URBA 1UR0A 3CO4A 4U33A 5A6BD 3HV8A 4AYGA 3W23A 3WQPA 3G8EA 4NXKA 1EO7A 1QO2A 1DJHA 2ZUTA 4BWLC 3ARYA 1E6RA 2DU2A 5EFFA 2PLJA 3DDMA 3M0HA 4B90A 1MW2A 3MI2A 1WQ5A 3W00A 3RM4A 1M04A 1W54A 3WMLA 3RGTA 1Z89A 4LC8A 2HBVA 1K9TA 4PA8A 3VIGA 2FB3A 2WJZA 3ZMRA 3L4TA 3MZ2A 3QV8A 5K3VA 4CCDA 1I2RA 4R33A 1TWZA 5JVLA 3AYRA 3PZMA 2QAPA 3VD3A 2VX7A 4KIRA 3M0IA 2OVLA 4DLMA 1S2WA 4EXBA 1QWKA 3T81A 3VOFA 5CPMA 4RPPA 2PRHA 3P14A 4H9YA 4XO6A 4O10A 3KOYA 4LT9A 4S23A 1PKNA 4B15A 1RJQA 4R85A 1XPYA 4HHPA 2GVGA 1N2VA 2QCMA 2ZX8A 1OFAA 4ML4A 5DCDA 2WSYA 3W6LA 3GHTA 2WLYA 4GQBA 1Q6DA 1HKJA 5AC6A 2HSAA 2NUXA 3CH9A 3N14A 1ESWA 2VX6A 1V4YA 3DKLA 2C6QA 3CIWA 2CBIA 3PTMA 2ADAA 3VGGA 5AC4A 3AIQA 4E2VA 5IDZA 3NURA 1TO3A 3KL5A 3RLUA 3OEXA 1UWIA 1FP9A 1V93A 1O1HA 4UTJA 4A8RA 1IR1A 1IF2A 4IMCA 3TFXA 3B8IA 4UFLA 3DGBA 2HVNA 2FQIA 3N6JA 2XHYA 4KKXA 3I4EA 2VDGA 4DI9A 4B2DD 3CUGA 1IQ8A 1CGYA 1B3XA 1KFKA 3E96A 1R9XA 2HS6A 1EPVA 2QW5A 1ZBCA 2HROA 1KO0A 3EEGA 2J9ZA 4P7LA 5DQPA 1AG1O 3LI0A 2WQPA 2XIJA 3BURA 3KL3A 3LCFA 3N19B 1JRBA 4F2BA 3ITYA 2O9PA 4LUTA 3SN4A 1CXEA 2WV8A 4WY0F 4JBRA 2PDCA 5G2IA 3VDAA 1V02A 2ZIDA 1MEIA 4DBDA 2I7GA 4GUHA 1LRNA 1DIEA 1RALA 4UMBA 4MGGA 2DT2A 5E0FA 1W1TA 3TC7A 2CC0A 5HQEA 3MCMA 7PTDA 1JI1A 4FIRA 4YTUA 3V1PA 3WD0A 4V15A 2VC7A 1GOIA 4L65A 3N3MA 4ECLA 1CI1A 2ZRXA 4J9JA 2F8QA 1F9CA 3GVQA 4US6A 1O66A 3RHGA 2YDSA 5CGTA 2XH7A 3FS2A 1ME9A 2WHJA 2EG6A 4IHCA 4INFA 4I6VA 1TV3A 3F5JA 3NQDA 3GU2A 1W0MA 4E38A 3M0KA 3ARTA 2CCRA 1K77A 3PBWA 3KRZA 4EX4A 3ZLHA 1W1IE 1ELSA 3FYOA 2WQDA 1CGTA 3BSGA 2PEVA 2F61A 2RJGA 1H1NA 2F6KA 5DELA 3LPOA 1M3UA 1R30A 4WEVX 3QSRA 4YWIA 3FYPA 3R89A 3M5YA 1DQUA 2VGGA 4O4VA 3E2QA 2IW0A 2DZWA 1UG6A 2Z00A 3OA3A 1K4HA 1KFLA 1GQLA 2P1FA 5AYZA 3DYPA 1UH2A 4GXPA 2WYSA 2IPWA 2HTMA 5A94A 2INZA 3P84A 3RNDA 1I2QA 2G0WA 1AJ0A 2ZTJA 3BSMA 1XFCA 4JX5A 1XLEA 1JZ5A 3M46A 5C54A 3VOGA 2DIJA 2VP8A 4AU0A 5A6AA 1R3TA 3O16A 4FOKA 4R7JA 1QXLA 3ITTA 3V18A 4J3UA 4HK5A 4MLRA 1PS9A 3BV7A 3FNDA 1SZNA 4M80A 3XINA 4MAZA 1KQZA 1XL9A 3PWAA 4KFPA 5I09A 4OV9A 1OFDA 4LEFA 1OGGA 1VPQA 3BWWA 1DE6A 3WLMA 5FEPA 2J7FA 3W2NA 4EK7A 2XVGA 1LBFA 3H7UA 1K8YA 4UTTC 4ZOEA 3INPA 4AVFA 3P74A 3A9IA 5LSMA 3CAVA 1OM0A 3WBXA 4R27A 4Y9MA 1B0IA 3N1AA 1R6WA 2DUXA 2QV4A 1J18A 2ACRA 2C19A 3CAWA 3BDKA 3S5YA 2JF6A 3POHA 4L9ZA 1NDYA 4F9JA 1EXPA 2OKTA 4L9XA 4NZ1A 3VA8A 2NSOA 4HK6A 4AY7A 4MPQA 2W63A 1YXYA 1PZ2A 3S42A 4G8TA 2UY5A 1UP2A 4MKVA 4ZE4A 5I77A 3MUCA 3PFMA 3ZFHA 4UNKA 4ZFMA 1LG2A 3W07A 1XYAA 3AALA 4S3KA 4GGBA 1CTNA 1J79A 4UWMA 3DG3A 2NQ5A 4CN6A 1K3UA 1H7XA 2YJQA 2J75A 3GNXA 3SAZA 1Q6RA 3M0YA 2PLKA 5D02A 1AUSL 3WNNA 3FA3A 1EOKA 3A13A 4B16A 2YXXA 1A3HA 4IPNB 4ERGA 3LB0A 4H01A 2REQB 4CNOA 4EPKA 3GVVA 2YCKX 1EHAA 1PHWA 1PEZA 4IMAA 1W9DM 2P53A 5LIUX 3PAJA 4MDOA 2VOTA 4X0NA 4H8UA 4GXWA 5EA9A 1F2JA 2X40A 2VRJA 2PP3A 4XSLA 3NYZA 2BVDA 3POCA 4JTLA 3G3DA 4JTSA 3OPSA 3UR8A 1D8WA 2Y8UA 1TJ0A 3VI2A 4DUOA 1ZGDA 4QJ4B 1XQLA 3L21A 4QDWA 5K9XA 2NUWA 1TX2A 2WANA 4M19A 5HWJA 1GWJA 2PU1A 1ISVA 4H83A 2V5KA 3C5QA 3THAA 1EJTC 5I24A 4F0SA 3VNJA 3QC0A 4BS0A 1OQFA 3Q67A 2Y2WA 2PTDA 5A8PA 1AK5A 2CZDA 3W24A 4Q8VA 1VS1A 4I6KA 2I17A 1FHUA 2NXHA 1W3JA 2BGNE 1SO4A 3WLOA 4OTKA 2X0HA 3W7JA 1E9LA 3UWUA 4AY8A 3NQFA 3RM9A 1ZENA 1TQXA 3H2OA 2HCVA 4WXZA 1W31A 3GG8A 3VC6A 2CLFA 3VINA 2GFTA 2RDXA 5IBXA 4XAZA 4RPQA 3DC8A 5CXPA 3T0TA 1R87A 3NZQA 3AHTA 2OKOA 3SCWA 2TRSA 3ARZA 4GA8A 3ARSA 1KGUA 1GOKA 1SFJA 2ZUUA 3GHUA 1G4TA 4G1NA 4F79A 1HL8A 1JFXA 1TPB1 3LG3A 3HG5A 1JDAA 4XKMA 4NAEB 1MW3A 4XK2A 1OT2A 4O53A 3UBPC 4ZXLA 3D6NA 2DY3A 3SCSA 4AD3A 3CHFA 4LV9A 3O6CA 5IXEA 3WLIA 4C1NB 4CQCA 1S1RA 2AKZA 4GXMA 4Q8OA 4QAIA 3RO8A 2QPUA 1XIJA 2AL1A 4Q4PA 4KEMA 4LOCA 4TV5A 3ZM8A 3TXZA 1UH3A 4QE5A 4I9JA 4B4HA 1XI3A 3B0PA 1HJXA 4ICNA 3W7EA 1MFUA 1P0BA 5DX7A 2CZ5A 3YPIA 3TFCA 3BPWA 4Q8PA 4DO6A 3PFRA 2G3MA 5C5YA 1KCZA 2GL5A 4PRTA 4BQ5A 1HKKA 1VFMA 1HKVA 1SPQA 4IQEA 5C9ZA 2DZXA 4WOZA 2X1UA 3NO1A 4GY1A 3MO7A 5I07A 3CWNA 3EOOA 1CNVA 4HPHA 1FH9A 4F0KA 4MWAB 3TYCA 2BP1A 4MMWA 1LYXA 3EXRA 3GU1A 3BVJA 4I9MA 2J9YA 3DI0A 3T9PA 3TAKA 2PAJA 3BLLA 3FJNA 4LYQA 3ZXWA 1XYCA 4GCXA 3SURA 1Z7AA 3B97A 3CHCA 2C1IA 3H2EA 2OFJA 4ORIA 3WJZA 3LLXA 4O18A 4IQJA 3ANUA 4A2RA 4CNTA 4Z2JA 5DF0A 4PMJA 3GH5A 3IIVA 4H2CA 1P43A 4Y9AA 2MUCA 3E0IA 1OGSA 2J7DA 3NSXA 2W5FA 9RUBA 1I2OA 3TTEA 4LANA 1W3LA 1CB2A 3D0CA 3W7CA 5JMUA 2V82A 1DWIM 4DWDA 2FTYA 4IIBA 3JU2A 4PEKA 4GPNA 5GJNA 1N55A 2PPGA 3AMDA 3NZRA 4CNUA 5KITA 1XBZA 1LL7A 4PMXA 3CUFA 2ZZ6A 3WK3A 3L5AA 3GVWA 4MUPA 2OWWA 1CLVA 1XYZA 1J8VA 5D2WA 1Y5XA 4GO8A 1C8YA 3HA1A 4JQ3A 1LTDA 4HTYA 1I4NA 4LWWA 4F9DA 5JBFA 1I6NA 3B9OA 3U6WA 3MMWA 2WMJA 3DHDA 4S38A 4F0RA 4P2VA 3K1DA 1VLWA 2F7FA 1EJ7L 7ENLA 3R5EA 1KBJA 2FGLA 3EWUA 2VEKA 3LERA 3N9KA 4RR4A 3K4WA 3CHDA 1X39A 1AZ1A 3EOLA 2OSXA 3FA4A 4J7RA 2Z29A 2HQAA 5HUPA 1GPWA 2QVNA 4UC5A 1E0WA 3MBDA 1EPXA 4GQRA 2X1RA 4Y9PA 3W73A 4JQ4A 2AGTA 1IHIA 2WZEA 1KFBA 3A64A 1Q5MA 3QPZA 3SGUA 2W62A 3HU7A 2XN1A 3P60A 3SSZA 2VEIA 3K8MA 1WB0A 1LP6A 3UT0A 1TV2A 1V6WA 5CJ5A 1E5JA 1JYWA 1AW2A 2V5DA 3CUIA 5M5DA 3W7DA 2QKFA 3PZGA 1XPGA 1ZLPA 5CSYA 3FW6A 3WX7A 2NWSA 1V51A 1UQZA 3ALGA 3QFWA 2CHNA 5BNKA 2ZRUA 1RBLA 2NQZA 4RW3A 2EF9A 1EQCA 4PFMA 3FGCA 1GJPA 4ZENA 1CENA 3W22A 4RJEA 3CV1A 1H1YA 2ZCGA 3BZGA 2ISDA 2WSRA 1FWCC 3CL6A 3IVSA 5KZEA 3T1GA 1QRQA 3GXNA 1EWEA 4K8HA 3UVAA 1I1WA 3UYCA 3R25A 4O57A 2ZZ3A 3PZVA 3R6IA 1AQ0A 4PGLA 1UC5A 2A7RA 1POJA 1S3HA 3GNDA 4QDPA 1YX1A 3UZYA 5HPOA 4F0LA 1WPCA 1XYMA 2DSVA 3BAJA 4H9MA 5JIWA 1ZJHA 2CHRA 3NQCA 1DWFM 3GB6A 3W53A 1UKQA 1RSCA 4ATWA 2DIKA 2QDEA 3OYXA 2VRKA 2PP1A 1HP4A 4OKDA 1TRIA 2WMHA 3SUTA 2Z1VA 4OBSA 5BRBA 3E0FA 5CH9A 4CD7A 2HEJA 3N9SA 2VC9A 3K1GA 5EYWA 3NZGA 1XW8A 3DFSA 1XIHA 3S9ZA 2J7HA 5DT5A 1H49A 4KFOA 2PGEA 4L64A 2RAGA 1W3NA 1QI3A 3U2OA 1FWIC 3PZQA 2JE8A 3NPUA 4U28A 3WK2A 3J7HA 2VZUA 2WMKA 2CLPA 3OJGA 2FMOA 2E6FA 1V0MA 1U33A 5D9PA 4FZIA 3DGRA 1QI2A 4BQ4A 1NFPA 3T42A 1UB3A 4IT1A 2AL2B 4HZMA 4M8UA 4AB4A 3UY7A 1UMYA 3FLUA 4PZVA 4Q4MA 3UJEA 3LD5A 5I3JA 4GGHA 4Q4OA 3TQPA 3RG6A 1GNXA 1DBTA 2QUMA 1LROA 2EKGA 3L66A 1LBLA 1G69A 4KQNA 2Q01A 2E9LA 4YIWA 1R3RA 1MZRA 4HSHA 4QXIA 3IRSA 4HJFA 2DUAA 4S2CA 1P1XA 3C8NA 3QW3A 3AS2A 3A24A 3IIPA 5F4WA 1Q6CA 4RDWA 3NM1A 3VNZA 1W5OA 4KCVA 5GQBA 3W7NA 2VEMA 4LAKA 4LVGA 2VOMA 3TTQA 3AJXA 2BBFA 2BHUA 3VMNA 3VDHA 3KRBA 3W88A 1XKYA 1HJWA 3W81A 1WA3A 3GTFA 4A35A 1A5BA 3TYAA 4P5UA 1XSIA 1W9PA 5FF7A 3SQMA 1E4LA 3QFEA 4E3TA 1BWKA 2YBVA 4U3CA 3WZ0E 5CSRA 3DENA 3ZO9A 1K9FA 4HU4A 1B3ZA 5C9WA 3NOYA 3ZSSA 1S2AA 3IJDA 1Z48A 3IJQA 3IJ9A 1PUDA 3LM7A 4X3ZA 5FEWA 3EDEA 1JPHA 1V7YA 1UPMB 5J8LA 2OT0A 3FX4A 3QY8A 1JQXA 1S39A 3DCPA 4GC3A 3TTOA 2CFFA 2YPIA 4QBXA 5KSWA 1BVNP 1XS2A 2MNRA 2GGEA 4R3UA 3VYLA 2ACQA 4P7OA 4PC8A 5CAKA 7A3HA 4NG3A 3BGJA 1W5PA 4NNAA 2EHHA 4C1LA 2IKJA 3S5NA 1UZ1A 2BVTA 3BTNA 3MHUA 3TJXA 3WQOA 4F0MA 2DSKA 3L4YA 3W6MA 5XIAA 1LJYA 3AQUA 2Y85A 4Y9NA 3UCCA 1EBHA 1MW1A 4NNCA 3R11A 1GYLA 2QXWA 4DUVA 3LHVA 3W2MA 1FWNA 3RIKA 2P3EA 1XBXA 5D32A 2D2JA 2GJXA 4DPPA 4R88A 2NV2A 2XWEA 2F6XA 3VPLA 3C56A 3AU6A 4FLQA 1WKDA 5FCZA 4Z1BA 3SDOA 1GOWA 2HVOA 1U1HA 1BQGA 2HS8A 2DZTA 3FDGA 2E8YA 1A50A 2QULA 2W79A 3PBYA 4GZIA 1K7FA 4V33A 1XSJA 2DVUA 1KFJA 4HD5A 1SJAA 1XLKA 2DT1A 1WUFA 5G1TA 3SADA 1VIWA 1VF8A 1Q6EA 4FMVA 2GSEA 2PDJA 4WZHA 3ZT5A 3SUVA 1J93A 4KEZA 5G1MA 3VOJA 1J96A 3MPGA 3SSJA 4KMQA 3QZEA 4Z17A 4ZBCA 1IWPA 1TMQA 3LTYA 2WM1A 4J3VA 1LOLA 1C8XA 2R14A 1Q2SA 2W4XA 3R0UA 5D2YA 1FH7A 3KS5A 1QI5A 1FWWA 3GX9A 1RP9A 2VZOA 1OCJA 2J6XA 5AYBA 1A5SA 3U57A 2GDQA 5G1YA 3LNMA 2Y6ZA 1E1FA 2POTA 3IPWA 4MZ8A 4EP8C 2DIEA 4E8DA 4CUCA 4ROQA 3TW6A 2X30A 4PMNA 1W1A1 3GD6A 3WH7A 2UY4A 3UWZA 2AQOA 4WCJA 1U83A 4N9CA 4LBUA 1TSIA 2D3NA 4AZ7A 1V6TA 5A6MA 1KTNA 1X1OA 4PUJA 4JCMA 2G5WA 5CAHA 5EMYA 3KRSA 4K37A 3TSBA 4IIHA 3VX0A 3BG3A 3O06A 3CT2A 5GVJA 1TCDA 2Y1HA 2PTWA 2INFA 3SBFA 1A5UA 3P5YA 2QCNA 3QY6A 4GJ1A 3WSUA 1QR7A 4C6FA 4LV4A 1UW9A 1Q7QA 4QRNA 3RUBL 3CBWA 3WLNA 1KR0A 3Q37A 3OZPA 4ADUA 1OIFA 5HANA 3KXQA 1UKOA 1JAEA 2QT3A 2BX7A 1ECQA 4JIQA 2I9UA 4P7NA 5DMMA 1PZ0A 2W91A 2GZXA 4W86A 6ENLA 4U10A 1PE1A 3GE7A 3N11A 3R12A 6TAAA 1OFEA 4HMDA 1R3QA 4V27A 5FJRA 4C6EA 4WSHA 1I45A 2FZNA 4JYDA 4M1BA 1MNZA 1IZJA 1E56A 1TX0A 2PWGA 1F6KA 1NOFA 2TSYA 4N42A 5AHLA 3PY2A 5C55A 2Y7FA 2IPGA 4A8IA 3UVIA 1FDZA 4DELA 4XBKA 2NV9A 2F6UA 2CETA 3TQ0A 3M6YA 2I5IA 2E40A 3UNDA 2PZ0A 3S1WA 1FWJC 4ENLA 3UG8A 1E9YB 1HF6A 4BFAA 1NDWA 1VGAA 5ABHA 3K4AA 3CPUA 4MNKA 1XR2A 1EUAA 1QNVA 2A4AA 1BSIA 2GSJA 2OZ8A 3WDQA 5AOUA 4F4RA 4WX2A 2PDQA 3CAQA 1H7RA 1U2YA 4PRWA 3AXHA 4MIMA 1EUNA 2VFIA 1ONRA 2BHYA 4MJ4A 1YRRA 4Q4RA 3WD3A 2PDLA 4GQQA 3TVAA 3E1F1 3B40A 4YTQA 3TSDA 3KX6A 1DORA 3CZGA 2PMQA 4EPDC 3N04A 2OEKA 1GYMA 3GDRA 2BVYA 4YU1A 1SMDA 2XN0A 4JFSA 1L8PA 2C0HA 2OYKA 1UA7A 1YXCA 2ZXAA 4MPKA 1QPQA 1M7PA 3B05A 2AOSA 4GVIA 3LHZA 2XM2A 5ECVA 1FWGC 1A3XA 1W2VA 3UWEA 3WNOA 2PC4A 1H4PA 1GOOA 1H11A 2YL6A 4KW2A 4O1BA 2VM8A 2NX3A 4H04A 5MKGB 2Z6IA 5HINA 4Q4SA 5I23A 3EWXA 4TVUA 4AZCB 2GUBA 4DZAA 3EWBX 1LT7A 1R9ZA 4B9ZA 1RLCL 1OIMA 3BCJA 2Z1WA 3OZOA 2J13A 4OOUA 4B5XA 1KBLA 2GJPA 4D6IA 4GD0A 1OK6A 3OVGA 2Z26A 4R53A 4FOJA 3BK0A 4WIWA 5CZKA 2OWXA 3PG9A 3H2AA 4LYKA 1OF6A 2E3ZA 5BWAA 3LCHA 4J35A 2ESCA 1TPWA 3FKRA 3ZLFA 1PXGA 3BLKA 3VNYA 2D1ZA 1TTQA 4F3HA 3N2XA 1Q4WA 1XV8A 1EYWA 4S3DA 5AB3A 2FMNA 2VFFA 5D38A 3A21A 3RFAA 2QUNA 4OUIA 4MWAE 3G1YA 1TWWA 1XUZA 1IEQA 3WFLA 4G6CA 1OHLA 3FOKA 1JF6A 1ZBVA 2Z0IA 4HT3A 1R7OA 1VJIA 3WLPA 3AAMA 3ZVHA 4KIEA 1E0UA 1JYVA 5HNNA 1S2CA 4O1AA 3EB2A 1TVPA 3H8AA 4BI5A 1AW1A 2PBGA 4P7RA 1LT8A 4FXJA 3STCA 4TVDA 1E3XA 1NELA 3CV2A 1TA3B 1UKPA 3TN6A 2W66A 2IKGA 4DBUA 4D71A 2WSPA 3PP7A 4A22A 1MYRA 1CCWB 1F76A 1DL3A 3KCJA 5D9NA 1RD6A 3HM7A 1B31A 1K70A 4J4KA 3K4DA 1ZFJA 2C13A 4YHEA 1C93A 2ZADA 2OPJA 3IARA 4PTVA 4IGNA 2OQHA 2B0MA 4IZGA 3NQ2A 3Q2DA 1R2SA 1BYBA 1KLYA 5JH2A 1MEHA 2FFCA 3CWOX 5G4EA 2PGRA 1V5XA 4C7FA 1K6AA 1IXQA 5FACA 3IIXA 3C3UA 4ADTA 1I2PA 3KL0A 2ALRA 3U7BA 3BOLA 4GUJA 5FF3A 2QUTA 3WNLA 4UTHA 3WQDA 5A6KA 3PZTA 1GONA 2XYLA 2NVAA 4BEQA 3A22A 1HX0A 5A2AA 3EDKA 4FO4A 4H9XA 3QV9A 3ZT6A 1QVBA 3BLDA 5IBXC 1W1VA 1J11A 2H8XA 1K9DA 2VCCA 1UJPA 1JIBA 1WNOA 4I8YA 3PBGA 4RNJA 3A47A 3OGVA 4TTUA 4E3VA 2V3EA 2GOUA 3UZXA 4X60A 2J77A 1TVNA 1GUVA 1LZOA 1NEYA 3PTKA 1FOBA 2NVDA 3N4EA 3VFLA 5A8OA 3BMWA 3GUWA 4NAEA 8CGTA 1JPIA 2WKLA 2VGFA 2QDDA 4YCOA 3BICA 3PZOA 4C6LA 3FEMA 3BOFA 1AMYA 1XRFA 3GBEA 4QJ3B 3M07A 2ICSA 3KCOA 3L4UA 4PUMA 2OOGA 1PKMA 4V1XA 2FKPA 3NL2A 2P88A 3UY8A 1W32A 1HUVA 4R34A 4LW7A 4Y7EA 4AXNA 4W7UA 2WM0A 3MMUA 1GW1A 2PTYA 4U4MA 3R0DA 1X38A 1PZ3A 1KBKA 1DHKA 1RK6A 3OLEA 1PHQA 4K7VA 3CV6A 4DWSD 3W7RA 4YYCA 1IXOA 4MZYA 2C15A 3EDJA 1VEPA 1MXDA 4Y8EA 3T0DA 4H41A 4CCZA 4KCWA 1HJQA 4MWAA 5A8NA 2Y7GA 4CCCA 1E4NA 5AC7A 3TXVA 3L65A 3M7SA 3T6CA 3H2MA 4LYRA 4GBUA 2FB2A 4O1DA 3PS7A 2CYGA 4BCEA 2P0IA 4PTWA 3RXZA 1UKTA 1XH1A 2G41A 1W56A 1EIXA 5D9MA 1AD4A 4PCPA 2J88A 4JFUA 3S2JA 2V5BA 4C7DA 1YHTA 2QNEA 3W7KA 5HQLA 1ICQA 2Z4GA 1SZRA 3CUXA 1FWBC 3NQ7A 1MQQA 3GC4A 3WMCA 4TIMA 3OVRA 1K7XA 1FHVA 2PFHA 1MW0A 2PWEA 3EGJA 3VKKA 1DWGM 2ZX7A 2VQTA 4HNCA 1A5OC 2FPTA 3WUEA 1V7AA 2PDNA 4ZSUA 5A5WA 1NFGA 1EIBA 3KE0A 1TREA 5BCAA 2GUUA 2YYTA 5EMUA 2JKAA 2WJDA 2J27A 2QJHA 3BG5A 4LFYA 5KINA 1JAKA 4O8RA 1MI3A 1OB0A 3ANVA 5D4YA 1NSJA 2WOQA 1RCXB 3OBAA 2YA1A 1O94A 1I1XA 3UFYA 2F84A 2VXNA 3PBUA 4GMEA 4GUIA 4LCSA 5DFAA 4DXVA 3W2JA 4FB7A 4Z1CA 4MB1A 4H8HA 3QOKA 5FSDC 4JIIX 4M51A 4IMFA 2BNJA 3N12A 3ONCA 2OLHA 3MV11 4Z2GA 3ABOA 1V0KA 5C9RA 3ATYA 1G1YA 5CPNA 3QQ0A 1OX4B 2B31A 3T40A 3VOIA 3EA3A 3PNZA 1EYEA 1WYIA 1DJNA 4QS5A 5D2XA 3I7QA 4PBEA 2VVNA 4MY9A 3AXIA 3U5YA 4UNIA 4ALDA 4GZJA 5D30A 2OYMA 3EYPA 2RJHA 1E4IA 1XLLA 4QE1A 5F1UA 4XWUA 4O13A 2C8NA 5FF0A 1H61A 2CKRA 3H2NA 3B8TA 5FL1A 4DF0A 1XIMA 1UBSA 1FDYA 2W27A 4WDUA 1ZQ5A 4X0VA 5LZLA 3LCIA 4YVXA 3W82A 4B5TA 2XINA 5GJMA 1WUEA 5IOBA 1RP8A 3DX5A 3IK4A 1NVMA 4H7VA 1R2TA 2WLZA 5BXTA 6ALDA 3NSNA 3B4UA 3KM8A 4WR3A 3MS8A 1E5NA 3T0AA 4GWEA 2HXTA 4ATLA 5LA2A 1IEXA 3EA1A 2DZPA 3TW7A 3MHFA 2ZXQA 1JZ3A 2QS8A 3PULA 2X1IA 4XD5A 3EDDA 5IRPA 1V3LA 4K1WA 2VFDA 2HISA 3WUFA 5DN1A 5HATA 4U31A 1ODZA 4O0QA 2VURA 3G18A 2PGWA 1JYXA 1PX8A 2WAGA 3QQWA 3UXKA 4NF7A 3R79A 2FTWA 5A95A 4MJ2A 5CPTA 1GVOA 4AD2A 4XTDA 2BV9A 3E0WA 2IPFA 1A5AA 5A8MA 1D7KA 4EIVA 1FXPA 3ALFA 3UXAA 3VNKA 4E2OA 1RVGA 2DEPA 4XAFA 2G37A 4OBRA 4EE9A 3C86A 4JN8A 2OELA 3ME3A 4WKAA 2ATSA 2VMFA 2X41A 3CMJA 2XU2A 2AL2A 3UZWA 3FFSA 5ABEA 4WQ6A 4HCHA 4P8VA 1Q13A 1V8EA 3KHDA 1VFFA 1YDOA 1XIEA 1MUMA 4AHOA 1Q6QA 4KF1A 3CT7A 1BWVA 1KGXA 2O7QA 1NWUA 2Q09A 4MHBA 1KM2A 4H7CA 5B80A 2GK1A 4AUBA 2FH8A 4NVTA 3TONA 2NW0A 2PDYA 4N7QA 2X1TA 1ADOA 3O0KA 2QDHA 2EPNA 2J4GA 3GQYA 2E5DA 1RJPA 4MF4A 5L9FA 2FVLA 2NLIA 3OG2A 3RCNA 2VWSA 2Y7EA 4DZHA 2D0HA 6CGTA 4QR6A 3ZT7A 1ZS2A 1L6FA 3OLIA 3UESA 4UIOA 3USZA 1EGZA 1QK2A 2V0TA 1LRTA 4QE4A 3WQFA 3FAWA 5DY3A 3T07A 1HP5A 4WD0A 2VKZG 2QCEA 4ZOAA 1XKJA 5AVHA 3LOTA 3WUBA 3RO6A 3WF0A 5BYWA 1TPEA 1KR1A 3THCA 4HHHA 3RX3A 5DLCA 4GLEA 3SCPA 3B8UA 4J27A 4DM1A 3LMZA 1L0PA 2D73A 5A6JA 2A6NA 1FWEC 1B1YA 3W9ZA 3N34A 3R8RA 1KCLA 3RF9A 2GLKA 1UWQA 3CMFA 4RE2A 1GVQA 4Q6XA 4O11A 3DUGA 3VKBA 3R0KA 4CCEA 2PUZA 4EAMA 3CO8A 4UQ9A 3G1AA 3UJSA 4HNNA 4WDWA 3ORWA 1J10A 1QNOA 3W4RA 4YTSA 3W29A 1CBGA 4E2BA 3WUGA 4AF0B 3NL6A 4NYUA 3ABZA 4QNEA 5BROA 4A6GA 3LZ3A 4AQLA 2I16A 3H26A 3N6HA 3VZXA 2Z25A 3PPCA 3OLDA 4A2SA 3AIEA 5KMYA 1P6BA 1LCOA 4HOXA 4ZTYA 3LBCA 4MM1A 1ZJBA 2ODOA 3PWIA 3WDPP 1GOXA 1OYBA 1EA0A 1OT1A 2OJPA 3DN5A 5IFTA 5E70A 3VC5A 4GZ7A 1E6ZA 1KXTA 1NAL1 3VNIA 5LGXA 2H9AB 1G6CA 3KVKA 5FAGA 3W85A 3HO8A 1YTEA 2ZFAA 1DWHM 1FCUA 4UQAA 5DXYA 5E0CA 5H91A 2Q3RA 4GO9A 4YJ5A 2BGSA 1QPKA 1A5CA 2XFRA 4AZIA 3NUKA 2OQYA 4PTXA 2G50A 1NM9A 3K8KA 4GZEA 3SCOA 3EX1A 4BKNA 2V30A 3TU9A 4UZUA 4PCNA 4QEHA 2ISWA 3WENA 4JTFA 3SO7A 1J0YA 1R3VA 1ODUA 1XDMA 3UR5A 1EJVC 3O63A 3H53A 1R9YA 4PUUA 1W3HA 2AMGA 1DXEA 3JS3A 4ZOBA 2Q3OA 1ZPTA 1BFNA 3OIXA 1TR9A 4CNNA 2V69A 5JBEA 1CXLA 1L6GA 4LQ1A 3QEZA 1VFUA 1DQXA 4GK8A 1XLDA 3RMEA 3BCFA 4GFSA 1SZEA 3NYDA 5T9BG 1OD0A 9XIMA 4UTKA 3GWQA 1SM9A 3QH2A 4BJHA 4WDXA 2R94A 2H8ZA 4BA0A 4KWVA 3G0XA 1TV8A 4XISA 2Y5EA 2WMIB 4RE3A 2FYMA 1DQWA 2PP0A 4QEEA 2BG5A 1XHGA 5TIMA 1ISYA 5EMJA 3KOFA 4EXQA 1AJZA 3TLLA 4UFMA 2GJNA 3STEA 4H7ZA 3HZ3A 3PB2A 4NRRA 2V8ZA 3ISIX 2HRWA 2L5HA 5CEWA 1XWYA 4ZE5A 3UPMA 4DRSA 4L7ZA 3SCRA 3V1HA 1M68A 3V4BA 4DXKA 2YA0A 5FJIA 4L1WA 3UF9A 2FHBA 3W1NA 2P8CA 4IPPA 1DJYA 4C7GA 4JTQA 2RFGA 3AI0A 3M4HA 1ME8A 3OQEA 3TYEA 5C9UA 4LUSB 2C91A 1FWAC 2FZ9A 4GBDA 1W17A 3OGSA 3TC6A 2UZ9A 3UEQA 1TV7A 3HBLA 3WY1A 3CZKA 5KEZA 1F6PA 3L0NA 1DIKA 2X8RA 1SJCA 4WJEA 2PWHA 4W7WA 1CWYA 5IFPA 2EBNA 3GC2A 4HCDA 5I3DA 1F4AA 2XIIA 2WPBA 1OG6A 1JD7A 2Q6ZA 1MUCA 4Q8NA 4GISA 5CPOA 4PBFA 1OJXA 3MY9A 2F9RA 1XYLA 2BS9A 3GLCA 3TIMA 2OGJA 6PTDA 1XG4A 1UUOA 3G1RA 4EPEC 1UUQA 5EKYA 4L4OA 4W8AA 5I3HA 5LIYX 1V77A 3M0MA 2ZX6A 4W7VA 4F0HA 1FQ0A 1YMYA 3CQJA 2ZRVA 1BHGA 1UIOA 3W2UA 1WX0A 1QT1A 1E0VA 1VFTA 1ONXA 2O0TA 3BOXA 4IISA 3DBNA 2PD9A 4K68A 1J12A 2A3HA 1G4PA 2ZUSA 3ABRA 4NJIA 1VD6A 2MANA 2JIEA 3VIHA 4AIOA 3HQPA 2RUSA 5CG0A 3JR2A 4EOUA 1JD9A 4AHQA 1V6YA 3GXMA 3LXCA 3MUZ1 1OEPA 1GQIA 5K4XA 1R85A 3EDFA 4JFVA 3ZYZA 2XSXA 1NARA 6A3HA 2WNNA 3LLDA 4OWGA 4C6KA 1M03A 5EMMA 4AIBA 1IWAA 3KVMA 2NUYA 2RGLA 3VGDA 1UUMA 1U30A 3W71A 3IGHX 4WKFA 1OZMA 4U5KA 2V68A 5T8GA 4QJ5B 3S6DA 3M7WA 1F8MA 2OTDA 3MUIA 2JEQA 3V5OA 2JEPA 3UD6A 3ZIZA 1S2UA 1PTAA 1PDZA 4FAMA 1XX1A 1XGEA 5EPDA 1RY8A 3WNKA 1FY6A 3URQA 1R3WA 1VBHA 3W1QA 5MKGA 2IKHA 1YNQA 1EDTA 3V0TA 3VXGA 4AZCA 5T9CE 3OQ8A 1VLIA 3W1AA 4TV6A 5D33A 4FXRA 3TQVA 1H7WA 1US3A 3L7RA 2CLKA 1JG9A 1KM3A 2C7FA 2Z1KA 3P62A 1J5SA 4AMAA 2ZE3A 3KDNA 1KD0A 1XG3A 4JYFA 2WCGA 2DQWA 5JIPA 1UCWA 1XD1A 4PTMA 4D72A 1ZZMA 1W2PA 3K8LA 1GKRA 4XD6A 3O2LA 1T7LA 3RPMA 1BPLB 3LCLA 3WQVA 3N13A 1VCFA 3HQOA 2O55A 3AXMA 2BODX 4CQBA 1V03A 4K7YA 1US2A 3QMRA 3P82A 4OECA 2PB1A 2Y5JA 4I7VA 4DO7A 5JBDA 1TZZA 1YTKA 4JTRA 4MSSA 4E4FA 5A8QA 2OEMA 2IQDA 1XLGA 3DFHA 1TJRA 5F7UA 1TG7A 4IJRA 4JDYA 3W1LA 2Q71A 3S1GA 1QBBA 1KBIA 1TA3A 2YYUA 1QU4A 5EY5A 3CXOA 4AHPA 3TW9A 4REQB 2PA6A 3QTGA 3R13A 3ZJ8A 1WDQA 1EP1A 3SN0A 3H4WA 1HXJA 1K8XA 3DZ1A 2Z27A 4TO8A 3B8DA 2C1GA 2DSWA 3SW6A 4GUGA 1BSLA 1JPMA 2WHKA 3V5CA 1UWRA 3UR2A 4XIMA 5HNUA 1ITQA 1NY1A 3AMLA 3AXKA 2Q8ZA 2PODA 2X0SA 3BAWA 1GTHA 2X0YA 5EU9A 3B8WA 3JZEA 3ZOAA 3S2LA 1FWDC 4NXSA 3ZLGA 3TSMA 3G5EA 3P8IA 4H19A 4GINA 3RDKA 1QOQA 2D20A 1F5ZA 1H2JA 2WHMA 1IXPA 1JCTA 5AHEA 2OR2A 4XAYA 3VDGA 3ERPA 5F2IA 2R1KA 2VGBA 3ANYA 5J5DA 4RL3A 2C14A 3EWYA 2FGZA 5AHNA 2GWNA 4W84A 2PDMA 1AL7A 3G0SA 4AWSA 1S2TA 4TX9A 3P6LA 4QAWA 2CLMA 2WZTA 1JUBA 1PZ1A 3FV9A 3TWBA 5CC6A 5LA1A 2QMKA 3WLJA 1GEQA 2OZTA 2XFYA 1BKSA 1WZKA 3VCRA 2NQJA 3AXXA 3I3EA 3S4TA 2B81A 4PB5A 4H1ZA 5I6SA 3GTIA 2ZWZA 1IT8A 3WYZA 3VDBA 4AD4A 3R4IA 2NV1A 3ARPA 4US5D 1O95A 4GIYA 1XUUA 5KZ6A 4YPJA 2WMFA 2V67A 2XTKA 2JGYA 1M53A 3MA8A 4RV3A 1T5AA 3MUY1 7CGTA 2BWGA 1L8NA 1W8GA 3PZNA 5BRQA 4X2RA 4WVXA 5CZSA 3G77A 1AH3A 4QG6A 4GFIA 2QCGA 1JCYA 2YFNA 3EX4A 3M5XA 3EX6A 1JCXA 1JNDA 5E6YA 3G1HA 2PCQA 2QF7A 3NJ3A 3OG3A 5M17A 1RD5A 2J7GA 1Z3NA 5F2GA 4IL2A 3JUGA 5EMLA 4H3DA 3SR7A 3N15A 3WQ5A 4W8LA 4R9OA 3VD5A 4CN4A 1A5NC 3HMCA 4ORMA 3NDOA 4A3YA 3EKZA 3K46A 4R5EA 4AD5A 2ACUA 4LBRA 4D1IA 2FHFA 3N3TA 5HMFA 1LLZA 5HK4A 4MWAC 4HK7A 1JGMA 2GVJA 4PFHA 3CTTA 1NOUA 3IUIA 2J66A 1X7IA 3QGVA 4C91A 3FAXA 2ZBTA 2O9OA 5REQB 3SI9A 2B7QA 4RZ6A 1KC7A 1OC7A 4KRZA 4WJXA 3UU0A 3S1VA 3WN6A 4DNHA 5E9XA 2PDWA 2QAFA 4AW7A 1MO0A 1UROA 2VX4A 1XIDA 3ENLA 4UFKA 4DHGA 4PMUA 4AAJA 4QSHA 1PTGA 1QNSA 2FPYA 4DLFA 1BWLA 4LPCA 3G1XA 2O4MA 3OOQA 4IICA 4DPQA 4HZ7A 4XAPA 5C8BB 4NJGA 1VFSA 2GVLA 2OZ0A 4PH6A 4GOAA 1B3OA 3R8HA 1FXQA 4PN2A 3N9RA 4K6AA 3KOWA 4J3ZA 1KRMA 4RX0A 1ZRQA 3O3RA 3STFA 2WZMA 1FFRA 1PJ9A 2QJJA 3HQNA 3WL0A 1Z6KA 2HZGA 1VC4A 5DMNA 4NYYA 4DJDA 3F4VA 4DUXA 4Q6JA 1MVYA 4UR8A 4M81A 2VENA 4JIPA 1BG9A 2QIWA 3LHTA 3IGSA 2UWFA 2BMBA 2D2OA 1AZ2A 4C5ZA 2R1PA 4FK9A 4JTEA 1W91A 4IGMA 3AZTA 3KZPA 2AMXA 3N4AA 4PMQA 3HPAA 2F2HA 4GI9A 2Y62A 5FJUA 2FH6A 3GTNA 4KESA 3VKJA 1GQJA 3B03A 1Q7MA 3W0KA 1OX4A 4EF9A 3SIMA 2FVMA 2V6AA 5TF0A 1YXDA 3W02A 2HPMA 4H6RA 3V0UA 4Q33A 1IXNA 1P6WA 1H51A 3VK5A 4UTMA 2FGBA 3IVUA 3QY7A 3CLWA 3GAYA 1ZL1A 1YDYA 4PE8A 3W3OA 1AQHA 3DHUA 5C2CA 1G7UA 2R8WA 4DN1A 3MMDA 4PCSA 3PBMA 5CBIA 4JD4A 1CDGA 1OFOA 4ZO6A 4XZNX 4PR4A 1OZQA 4D6HA 2CESA 2E09A 4Z08A 3GDKA 2D69A 2GDUA 1BYAA 3TMLA 3P0WA 3P5ZA 1QNRA 4H2HA 1TRDA 4Z2IA 1W3KA 1R0MA 3LEPA 4MY1A 1DIDA 1KWGA 3EWZA 1SQ7A 2YX0A 1OCQA 2FZ8A 3CV7A 1O5KA 3EXSA 4ICMA 4LB3A 1X1ZA 2FHCA 4RW5A 1E6NA 4LUYA 4HHLA 4WRHA 4JTTA 1PTDA 3GM8A 1UOZA 1S38A 3DG7A 3G1DA 1KV8A 1P5BA 4K8EA 2TAAA 3NPWA 3PZIA 2CLIA 1L9WA 4PODA 4O1FA 4NI8A 4FNSA 3Q45A 1NOWA 2G3NA 3BAXA 2E25A 4QCEA 3SN1A 4DO4A 5D2TA 3PSWA 3CHVA 3W70A 4JN6A 2G3IA 3C2YA 3M0JA 1AODA 4K3ZA 1W5QA 3LCXA 2J25A 4FNTA 3WQ4A 4TTGA 4TX6A 3C2OA 4UNLA 1M41A 3WJXA 4XZIA 4CD4A 1UWTA 3OW1A 3NO3A 2BVWA 4DJFA 4ZSTA 4OHQA 3LPGA 1TZ7A 1B3VA 1XFBA 1AH0A 5LIXX 1G7VA 4ZQPA 3MQTA 4ZFCA 4PMVA 1TWIA 1JL8A 3HGJA 2J7EA 2Z2UA 5I3FA 4CU7A 3N2MA 1UH4A 2A7PA 1UD2A 5LXEA 1JXKA 2VCBA 3S5OA 2J8FA 4OVXA 5M1TA 4AG0A 4AZHA 3QR1A 1ZAJA 4M82A 3RX4A 3NPXA 3G22A 1PPIA 3AIWA 2FZDA 4Q8QA 2CZEA 3GZAA 1S5VA 1JEZA 1N8IA 3GR8A 1KRAC 1Y8BA 1ITXA 2E6AA 4GRSA 4PUEA 5ABGA 3C4UA 2XM1A 4LS2A 4HU8A 2XZ9A 1GHSA 2Q8XA 5BXRA 4E8CA 4QQ3A 1HKIA 1VYRA 2GQAA 2E28A 3PG8A 4O28A 3QR0A 3M44A 4GVHA 2EQDA 2PDFA 3LGDA 3HTWA 1DWAM 3LN3A 2Z28A 1T8XA 1SZGA 1CIUA 3HG3A 1G5AA 3IANA 3DU0A 5DBUA 1NFBA 3U4AA 4HTBA 2G4FA 2YDAA 3QJAA 1Z42A 4FNRA 2TMDA 1MWOA 2VZVA 4ONVA 4JFTA 1W1ZA 1OGBA 3IS4A 1LOQA 4OZOA 1RV8A 4M7SA 2PTZA 3KEHA 1QTWA 1VPYA 2NXGA 3WD2A 4FXFA 4GVFA 2YKKA 4XBSA 1WBJA 3GNOA 2PE4A 1XCWA 3S2CA 1EX5A 4GQGA 3W7LA 4B5VA 2IS7A 3GHSA 4OJYA 1GJUA 1J5TA 1PBGA 3VM5A 3LV6A 4XZLX 4QCFA 4JCLA 1BTMA 1NIUA 3GW0A 2V2CA 4ZEPA 5LGZA 4LCQA 3A5VA 4J1OA 3BW4A 3WLRA 2ZA3A 4QNWA 1PIIA 5I0DA 2D0GA 3E02A 1WAUA 4HA1A 4QX4A 4JTCA 2Y0FA 1BRLB 3LU2A 2EPMX 2RDUA 2G8ZA 4AF0A 1P4CA 3HV9A 3N18A 3NCOA 4RXFA 2LLEA 1GKPA 3URAA 3KRUA 1DXIA 3UNTA 1A5MC 5E0KA 3CS2A 2AKMA 3SGZA 4AY1A 3C52A 2C16A 1QASA 3AMGA 4W85A 2VFEA 3HG4A 3TN4A 4IMGA 4Q22A 3RPTA 4CU8A 4UFJA 4XUYA 2H9AA 4WSJA 4MJMA 3QHOA 1C90A 4N4QA 1J01A 3W7IA 4LAMA 4AX7A 4J5NA 3MUAA 1EEXA 3RLGA 1C92A 3WEMA 2OO6A 3E5PA 2ZKMX 3KP0A 4DJEA 3HJEA 3EWDA 3EBVA 1XDJA 2A5HA 3AHVA 3U3HA 2H3DA 3BUVA 4FR6A 4ZMGA 2YA2A 3PBVA 2OU4A 1EJUC 4HA3A 3KOZA 1G94A 3O6DA 3MKKA 4M7TA 3TN5A 3N73A 2PU0A 1IR2A 1AFSA 2YBTA 1C91A 1RH9A 3BJFA 1DE5A 1KM6A 5A8GA 3W7HA 4Z2KA 1DPMA 5FF2A 3WQ8A 3VD4A 5F4SA 2FTPA 4NZ3A 1L2UA 1HL9A 4X63A 4CQAA 1LWIA 1SW7A 2E5CA 5DRIA 3WQCA 4Z2HA 4GY0A 4DO5A 1K1DA 4JTIA 2Y89A 3WQWA 2PURA 1DKWA 1SSGA 2XGBA 4XZ9A 2XFWA 5HA7A 1MFVA 4GE8A 4HBKA 3T0CA 2IMRA 2OSWA 5CGQA 1VH7A 2CHOA 1W9VA 1EOMA 3RM8A 2WJEA 2WMIA 4N6FA 1S46A 1E73M 1YPFA 4JHOA 2Z24A 2VHLA 5K4ZA 5K9DA 4XZWA 1JZ2A 1XLCA 3U7VA 3GH7A 1H7NA 3NEHA 1J2BA 1CXIA 2IQ0A 3H2FA 1V79A 3WDHA 1E6XM 4QTGA 4KS0A 4DYJA 3BGAA 1HN1A 5AN7A 2QCDB 3DHFA 2A3AA 3LHUA 3OHIA 5AHFA 1RPXA 1VCGA 3L4WA 1JDEA 4GH3A 4EXAA 5AZ0A 1C8VA 4GX9A 3V0SA 1RK5A 1IZCA 2QJMA 4QDMA 2Z7GA 1TELA 2Y7DA 3WBEA 1RR2A 1QNPA 1CGXA 1RPKA 3FJ6A 1DP0A 4MZ1A 4ACYA 2NLYA 3PVFA 2R1NA 2YL5A 3ZR4A 1FKXA 5I00A 3TOPA 3KVLA 3CM4A 3OGRA 2ZWYA 3C2RA 3BAYA 4ZO9A 4O0KA 4TMCA 3L2LA 1UZDA 1AW5A 4NZ4A 1CPUA 4IL0A 3GXPA 3H54A 5D37A 3UPWA 1YDNA 1SZFA 1SJBA 4QIUA 1Z41A 1UBPC 2VNCA 3EPOA 3BXWA 3CHEA 4IGHA 1TPFA 1GVFA 4Q4QA 1PWLA 4UZSA 1E43A 2D24A 3LHWA 3WEZA 3ITOA 1PO9A 4HMNA 5D8WA 3VIKA 3VNMA 2JKEA 3C3NA 3E6EA 3SRHA 5FJPA 4A4AA 1RLDA 4J2PA 3UP8A 3AROA 3ABXA 3O07A 4ADSA 3A4AA 3UA4A 3IVTA 3I7RA 1K8ZA 2RGMA 3ARQA 4JEQA 2VO5A 2PDHA 1UD8A 4F8XA 4GJJA 3TK7A 1DOSA 1X97A 2E6YA 2PTXA 3G24A 4EF8A 2TODA 1T99A 3LLFA 1YKWA 4ICCX 4BY3A 1K6WA 2AAAA 5HJXA 1R8LA 1EJSC 1XGZA 5C2XA 1EEPA 5FD0A 4IWWA 1SO3A 4DAFA 2PCEA 1WO2A 4C6DA 4PRRA 4FIQA 1TTIA 4NNBA 5H8PA 4C6MA 5HMEA 3RN6A 4H9UA 3W7MA 3QV7A 4G7EA 4KCTA 3VCNA 2CBJA 3VIMA 1ZBKA 2E9MA 3U0HA 4IG2A 3B0UX 2YDQA 1H3GA 1Q65A 3RLVA 1F07A 3CMGA 1ZALA 3MMTA 3FSUA 3NG3A 1VEOA 5CGMA 4QSFA 3TCSA 4IXHA 2VX5A 2QGHA 3VAVA 4WOQA 4H9ZA 3W2KA 1HGWA 4GQ0A 4UOJA 1OG0A 5C9XA 3ZSTA 3IK2A 4P8XA 1DJIA 4NKCA 4MYXA 1F61A 2WC7A 1Q8JA 4FF5A 1VRDA 1WDRA 2O9RA 3SFKA 1O5RA 2GGIA 1QWGA 2ZA1A 4FLRA 3MJYA 3OYZA 4XTIA 2ABBA 2FVKA 3FKKA 1EQPA 1LM1A 2IXVA 3NQMA 2J7CA 1XLAA 2CLEA 3AS1A 3BG9A 3G1FA 3UCQA 3TNBA 1IT0A 5I7GA 5D8ZA 4JFWA 4F66A 4YXGA 4DBSA 5D03A 1UP3A 4WDTA 2J24A 1PAMA 4UCGA 1UR3M 1WOAA 1QHPA 2VR5A 4MG4A 1HT6A 2Y5SA 1CT5A 3L23A 3TV8A 1R3SA 4XIAA 2QQ6A 1OYAA 1O12A 3UZZA 5XIMA 3T44A 3WF4A 4IIGA 5MF5A 2Z2AA 1JPDX 3BV4A 5E93A 1QHZA 2EXOA 1IEWA 3BMVA 4Z0JA 3CIVA 5HMDA 1TQJA 4JTGA 4WSKA 1UR1A 4WJ8A 1R7AA 3FN9A 4ZVJA 3U48A 3FJLA 1XIGA 1E0TA 3LTSA 4URIA 4JEJA 1OABA 4AC7C 4TQTA 3CLMA 1D9EA 5I3KA 2BY2A 1X1NA 4N2YA 3MT1A 3C2FA 1T41A 5CC3A 1ICSA 5EGRA 1A0CA 9XIAA 1EF3A 2GQ3A 4JY8A 2VELA 1ZTVA 4M0XA 1XRVA 4L6OA 4DAIA 2A21A 3LUTA 3ZWTA 1WKYA 5K9CA 3G6MA 3NGJA 3M6DA 1JZ4A 1VBGA 3O9NA 4MLJA 4MUZA 4OE7A 2BXYA 2YFOA 5HOSA 1T6MA 3S8HA 3CEPA 1YW1A 3WK1A 4LBSA 3MP5A 2VUNA 2J6VA 4L9YA 3EPNA 4PL1A 2QZRA 5ABTA 3HPZA 1A0EA 1VBJA 1XSKA 1Q8AA 4FHAA 4RCXA 2I57A 1WAWA 4MAVA 2ZQ0A 4BI7A 4QG8A 5AZ1A 5DMLA 4ZQCA 1HZYA 3EMQA 5LYRA 3VIIA 4CEUC 3GFZA 4LF1A 1N7KA 4CQ8A 1GVYA 3RR1A 1EXBA 4BK9A 2EG7A 3AHXA 1WKEA 3S5SA 2XWDA 3BLIA 3PAOA 4XX6A 4L61A 2ZZ7A 2E0PA 3SRDA 2FDMA 5GNZA 2DORA 1Z8AA 1OADA 4MB5A 1OY0A 1VR6A 3T2PA 2WNWA 3R2GA 1OCBA 1OFPA 4GY7A 3BQ5A 5FAJA 5HMSA 4NX0A 4U3AA 1U1JA 2PI6A 5M3WA 3FCPA 1P0DA 1SR0A 3CUZA 4NAFB 1PSCA 4KCUA 3OP2A 3E2VA 4AIUA 1QI0A 1WBHA 4KERA 4I5UA 3I6EA 3CTLA 2DT3A 5E6ZA 1ZU8A 2CU0A 4PB3A 4PMRA 1ZAIA 4ZL1A 4UTUA 4PULA 1NDZA 5LNWA 3HOJA 4O50A 3MDWA 5HJYA 3HIJA 3GVGA 3WD4A 3DYMA 4OOZA 4NJKA 3A6OA 4Y96A 3BGGA 3HPXA 3SFWA 3VUPA 3L12A 5DT7A