4F2UA

Structure of the n254y/h258y double mutant of the phosphatidylinositol-specific phospholipase c from s.aureus
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
304
structure length
304
Chain Sequence
b'DSLSKSPENWMSKLDDGKHLTEINIPGSHDSGSFTLKDPVKSVWAKTQDKDYLTQMKSGVRFFDIRGRASADNMISVHHGMVYLHHELGKFLDDAKYYLSAYPNETIVMSMKKDYDSDSKVTKTFEEIFREYYYNNPQYQNLFYTGSNANPTLKETKGKIVLFNRMGGTYIKSGYGADTSGIQWADNATFETKINNGSLNLKVQDEYKDYYDKKVEAVKNLLAKAKTDSNKDNVYVNFLSVASGGSAFNSTYYYASYINPEIAKTIKANGKARTGWLIVDYAGYTWPGYDDIVSEIIDSNKLEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-phosphatidylinositol phosphodiesterase
publication title Competition between Anion Binding and Dimerization Modulates Staphylococcus aureus Phosphatidylinositol-specific Phospholipase C Enzymatic Activity.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Lyase
total genus 114
structure length 304
sequence length 304
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 2012-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 4f2uA00
1DJYA 4F2BA 1QATA 5PTDA 1ZCCA 2PZ0A 4I90A 1T8QA 7PTDA 3H4WA 4QJ4B 1DJWA 3OHMB 3EA1A 3KS6A 3V16A 4RV3A 4F2UA 4I9JA 2OOGA 1O1ZA 2F9RA 2FJUB 3V18A 2ISDA 1PTGA 2OR2A 1DJHA 5T9CE 3I10A 1V8EA 1DJIA 2P76A 3MZ2A 4OECA 4PTDA 4S3GA 4RW3A 1VD6A 3QR1A 4GNKB 5T91A 3QR0A 3EA3A 3RLGA 4I9TA 6PTDA 4QJ5B 1XX1A 3PTDA 2ZKMX 1DJZA 4I8YA 3KS5A 3CH0A 4F2TA 3EA2A 1T6MA 3V1HA 3L12A 4RW5A 4I9MA 3H4XA 3RLHA 2OTDA 3QVQA 1DJGA 1YDYA 4Q6XA 2O55A 2PTDA 5T9BG 1AODA 1QASA 1PTDA 3NO3A 1GYMA 1DJXA 2PLCA 4R7OA 4QJ3B
chains in the Genus database with same CATH superfamily
3NPXA 1A0EA 4D1IA 2Z1KA 4ROPA 3H70A 4NZCA 2ONEA 4DUWA 2HVMA 2GGJA 1B5TA 4XVEA 3GTFA 1A5KC 1N8WA 4C60A 3VIPA 4M5PA 1HZYA 1EJWC 1O1ZA 2XM2A 1NTHA 3EX2A 3TTYA 3ZT6A 4CCDA 3OA3A 1VLWA 3LQLA 4A3QA 2WCAA 1EWDA 2B0MA 3EPMA 4IP4A 4JR5A 1XINA 1US0A 3R0KA 4FXRA 3UJEA 3V0TA 4QSHA 1IWAA 1M3UA 3DHDA 1BG4A 4BFAA 4EF8A 1IYXA 3CS2A 4JTCA 4LWWA 1SZRA 3VDAA 1A5MC 1VIWA 3U9IA 4P8WA 5FD0A 4AVNA 3GWQA 1V3JA 4GE8A 4C6MA 3DU0A 2PLJA 1H0GA 4LBUA 8RUCA 2PP3A 3S9IA 3VE7A 3FSTA 2DSZA 2WBKA 4IPPA 5HDRA 2EEXA 2VOMA 5M2FX 5HPCA 2FPYA 4UQAA 2VD8A 1S3TC 5BYWA 3E1F1 3GG1A 5M1TA 3VDBA 3KE0A 4RE0A 1GVSA 2VYOA 3O0FA 2RAGA 4N42A 1P0KA 4QP0A 4BCEA 3OQEA 5J5DA 1RJRA 4UXDA 4DBEA 2E6AA 3CT2A 1LCOA 1JGMA 3L0GA 1AJ2A 3OIHA 3M0JA 1XLDA 4MZYA 3KXQA 4O8AA 4CCCA 1YE4A 1WKFA 5HQLA 2QW5A 3OVRA 2I9UA 4HPGA 2OX4A 2W91A 3P7YA 2WHMA 4IX0A 2VR2A 1SZGA 3PNUA 3F2DA 4G56A 3SFWA 3TYCA 2QHAA 1W3NA 2J4GA 4ZQMA 1UH3A 1WAWA 2CZEA 4KWSA 3CZ8A 1RAKA 3U7VA 2QXWA 4JFSA 4WUIA 2X8RA 3CPUA 1QBBA 1PKMA 1TPFA 1YHTA 3M0ZA 3NG3A 3C52A 3PG8A 1JPHA 2I16A 3RHGA 1W8GA 1C29A 4PCFA 4MNMA 6PTDA 2A0NA 3FVMA 2OWXA 2PWFA 2TMDA 5D2YA 2D69A 4MY1A 1JEZA 3T42A 4RNJA 4IFRA 3W7OA 1H09A 1GT8A 3ES7A 5G2IA 3LB0A 5CXPA 2IMRA 1XBXA 4CN1A 5GJMA 5DANA 1Q6CA 3VKKA 1S39A 3K1GA 3IRDA 4AHPA 3T0BA 4RR4A 3S5YA 1J93A 3ITVA 3WD3A 2BP1A 4AZCB 1JZ5A 1VBRA 2W0UA 4L4MA 1WX0A 2PTWA 3E12A 3LPFA 4L7ZA 4LEFA 4K37A 2F2KA 3SAZA 4LYPA 4HCDA 1XM3A 4KH2A 5I0DA 4D1JA 1XLLA 4MPKA 4KIEA 4DF2A 1EA0A 3OGSA 1MW3A 3DI1A 2ISDA 3NO1A 4CUCA 5HWMA 3PSWA 3LZ5A 4M6UA 3C0SA 7A3HA 3N2XA 4CEUC 4PL2A 5EA9A 3LM7A 3SURA 1Y0EA 3S9ZA 3FS2A 3QR1A 3U7BA 2EQDA 1C9DA 3P0XA 3HGSA 3HG5A 2GJRA 4BS0A 1KBKA 3VGHA 3BVJA 3IAQA 4RE4A 4CD6A 2H3BA 3TW7A 4JDBA 3CO8A 4XIAA 4Q8UA 2GQAA 1LUCB 4NUWA 7REQA 4LU0A 3WNLA 2ZX7A 3ABXA 3LNPA 4GI9A 4IFKB 3M7WA 2OTDA 2HPMA 4MY9A 2YXOA 2BTMA 2PB1A 4PUWA 2QT3A 3MUAA 3UNTA 3LG3A 3MC5A 3MQTA 1UQZA 1XSIA 3VKCA 2VELA 1E4NA 4CNSA 3ARRA 1J5TA 4EAYA 1H7OA 4GH3A 1UR9A 4ZOCA 3AO0A 2J7FA 1JIBA 1TG7A 5C71A 2A7RA 2V63A 1LJYA 3QGKC 3DECA 3BV4A 2C18A 1XLMA 3DI0A 4AZ6A 1DXIA 1GG0A 3RF9A 1F61A 3KLKA 4JTAA 3QTGA 4Z42C 4XBSA 1FWHC 3QSTA 3OVPA 5KETA 1DWIM 2Z2AA 2DT3A 1HO4A 1FX6A 5TBOA 1RSCA 1ICPA 3WMLA 2YSWA 1JFHA 4RJEA 1KCZA 2ZVRA 1VRDA 1VD6A 4NJKA 4Z0SA 3PG9A 3S42A 4AEFA 1KD0A 2C79A 3NZPA 3BMXA 2ABAA 4H19A 3VM5A 3G1VA 3KBVA 4HJWA 1V0KA 1XUUA 4ICNA 1BSLA 3H53A 3MUIA 2GYIA 3ABZA 4C7DA 1R7AA 1RBLA 4AIBA 3HV9A 4ICCX 1U30A 1ZNNA 4RE2A 5CPMA 4FAMA 1FWAC 2VX5A 1XSKA 4IISA 1M7JA 2WC3A 3AXHA 3ZQ9A 1IEQA 1EP3A 3BLEA 3CWHA 3HGOA 1M5WA 1NOUA 5EBUA 3OQ8A 4QROA 1DWGM 1X1NA 3M64A 1NVMA 4I6KA 1FH9A 1WV2A 3VC6A 1OCQA 3CAQA 4N7QA 1S1PA 3LCWA 3EXTA 1S5TA 5A6LA 1DVJA 4M1RA 5AYBA 2NQZA 1RCXB 4GYPC 3EOSA 4LB4A 1W3HA 3VX1A 3B8WA 3TYEA 3GSMA 1K7XA 1C91A 4QEHA 3IV8A 3NSNA 5EB8A 3BLDA 3NL3A 3S5NA 1LBLA 2QCCA 1IWBA 4B90A 3VZXA 4O0KA 4X9SA 2DV0A 1AFSA 3TK7A 4FK9A 4AC1X 1WP6A 4EWJA 5C9WA 5I3GA 1HL8A 2XVLA 5D4YA 2ZXQA 4WY0F 4X2RA 1DXEA 2ZX6A 1KM0A 3H22A 5GNYA 3RO6A 1Q6QA 4UC5A 3CAKA 3Q45A 1YIXA 3BAWA 2VCCA 3L0NA 3QZAA 3WDHA 1AQ0A 4W8BA 3WF2A 1TV7A 2E8YA 1XX1A 1POKA 3WNKA 5LXXA 4FOKA 1QMLA 1XICA 2YR1A 2PRMA 2J9YA 2XDFA 4OT7A 3RM8A 4ROQA 3D6NA 2P10A 1VGAA 1VH7A 3WZ0E 4J40A 3WBYA 4J3UA 4MB4A 4ZA0A 4B91A 3CAWA 4K38A 3VCNA 4X3ZA 3DDMA 5I79A 1Z8AA 3LLFA 4O52A 1VEPA 2PDHA 1D2KA 5U7SA 1TMHA 4H41A 4ZOAA 3GIYA 1V6TA 3CEUA 3S0CA 4RDVA 4U2YA 1ZP4A 2YCIX 2E1WA 4JKMA 1WBHA 4FX6M 3VOGA 4CQ9A 2YDAA 3GHSA 3K2GA 3DFOA 3D46A 3O6DA 1TVPA 4K1WA 2Z1WA 3QFWA 1UJQA 5A8NA 5ABFA 2VR4A 2V5CA 1KM1A 1L8NA 1TRDA 4QG6A 3SY8A 1R9YA 4EOUA 3RU8X 4F0HA 2YXGA 1V8EA 4A35A 3DAQA 3QMRA 5C9UA 2WWDA 3ARYA 4IQJA 1XIMA 1L0PA 3BICA 2CLKA 3PY2A 2DFAA 1G6CA 3WLMA 4KS0A 3VIKA 4N9EA 4UTFA 1H51A 1HTIA 3UPBA 3AIRA 4LF1A 3T07A 9XIAA 3BL3A 1OF8A 1Z3NA 3BV7A 3T05A 1YBQA 2CWNA 5FEPA 1LL4A 4JTIA 4WDUA 1UWIA 1S5NA 2WO5A 4UOQA 3CHFA 3VNKA 1UJPA 1HKJA 2XG9A 8XIMA 4FR1A 2OEKA 3CK5A 3PN8A 4P61A 1CTNA 3P8IA 4ZO7A 2W66A 3DKJA 3BZJA 3VC5A 3I3BA 4MB3A 3SJ3A 1L2QA 3IUDA 4BQ3A 5TD4A 4O17A 1QHZA 2NT1A 1YXDA 2XPKA 4P2VA 4QM1A 4UWMA 3Q2DA 3CPGA 1JCYA 4LAUA 3A3HA 2A79A 4PRTA 3T08A 2DT0A 3NPWA 5BXSA 1FDZA 3EGJA 2GGIA 2AKZA 3GS6A 4UNKA 2QKFA 1HJWA 1YPXA 2ZOXA 1BKSA 3TR2A 2Z0IA 4AY8A 1BWKA 4DJDA 1KBBA 5LHEA 3VINA 3BH4A 4EIVA 3GM8A 3SCOA 2E5BA 3QY6A 5DBTA 5CBJA 3VOIA 3G2GA 1EH9A 2QV4A 4Y7EA 1IZCA 2PCQA 1FP9A 3ZLHA 3G1SA 5HK4A 1Q4NX 4GLEA 3ITYA 4AQLA 1S5MA 2PD9A 1O5KA 2NT0A 1UR4A 4IJCA 1SW7A 4YTSA 4GKLA 4H3DA 2H8XA 1T7LA 5BXRA 2VGIA 2XIJA 4L1XA 3PVFA 2DZPA 2Z26A 1ESWA 5FF4A 1TQXA 3W73A 4O1BA 1H63A 1T6MA 1ECQA 4I7UA 3QC0A 2VEPA 1SJDA 1EC9A 4J2MA 4MZ8A 4JXCA 3B0YA 1TPDA 4WOQA 3WF4A 3GFXA 5D02A 5GNZA 5EMJA 3B3DA 1TWDA 1WQ5A 4CU7A 4LJ3A 5AB3A 1HNYA 1VYRA 3LPPA 4CN6A 5BW6A 2W9MA 1QBAA 1CX9A 4H01A 4DLMA 2AAAA 1OYBA 1MO0A 1QATA 3IUHA 1KKRA 4TVUA 2GWGA 1R0MA 4Q8MA 5A8GA 2X1RA 1VP5A 2JEPA 1CXLA 1WZMA 1DQWA 4HOWA 3H2OA 4MAZA 4NNBA 1XISA 3N18A 3GIQA 4C6FA 3VAVA 4HYRA 1E1EA 1E0WA 4M24A 4HMEA 4IICA 2HNEA 1VS1A 2CBUA 1PJ9A 1TZ7A 3PSVA 3C0QA 2BASA 2P76A 5FEWA 4AX7A 3KBSA 5I03A 3CV1A 1TA3A 1P0BA 4NYUA 2OSWA 3EKGA 1DQXA 3T9PA 4IJBA 3RJYA 4J3SA 3AZRA 3AROA 5BRQA 3MANA 3OVQA 2FMOA 5LYRA 4BZYA 1H7PA 3QQ0A 3AQUA 4KCTA 2PDUA 5J04A 2FTWA 5XIMA 2FYMA 7REQB 3QMTA 1GONA 3TTEA 4E2OA 1ZZMA 4YVVA 4TUFA 2V5KA 2IKIA 1ODZA 2NSXA 3BC9A 1KGUA 3WK3A 4EXAA 3R11A 1U83A 5M17A 2ZXAA 3EWDA 1MYRA 4TTUA 3N2CA 3ZJ6A 4ALDA 4QNEA 4C6DA 3IACA 3D47A 3E5PA 1Q2RA 4F8XA 2C1GA 3WL0A 2BY1A 4F0KA 1KCLA 1KNWA 1ZBCA 2WKJA 1RK6A 1CGWA 4R34A 4S2CA 1P6BA 2WSQA 3OGVA 1JUKA 4H6QA 3KDOA 3GTIA 1LBMA 5LHFA 2VZVA 2EO7A 1IWPA 4H7ZA 1BAGA 1CI1A 4I7VA 1MRAA 3GR4A 4PMRA 5CH9A 3QPZA 4GG9A 1FHVA 2B4GA 1KXHA 1SU5A 1ITCA 2W79A 4JIIX 4MHBA 2FQIA 3C2OA 1G69A 4YJ5A 1WZAA 4QLJA 3OJGA 1E43A 4UTTC 2ZUNA 1W56A 4WXYA 4D9PA 3L4UA 1GUVA 1XUZA 3ENLA 4TX9A 1FA2A 3T44A 5D9MA 3W37A 4FNRA 4HVXA 4Q8QA 4NZ4A 1ZJIA 1U1HA 3IUIA 1JDEA 4O0ZA 4P7NA 3A23A 1EPVA 3MU7A 4MY8A 4DXKA 2BGQA 2E0PA 1NOWA 2NUYA 1BYBA 2Y70A 1UD8A 1NF0A 1MDLA 4OOUA 4Q8PA 2F6XA 3SQLA 1E72M 5I23A 3O1NA 1PIGA 3NZGA 4HA0A 2WNQA 3NO3A 4V15A 3V36A 5FJPA 4KWOA 2WNZA 5AHNA 9XIMA 3H2CA 4PE8A 5K9DA 3VKJA 3BARA 3WDJA 4MB1A 4QJ4B 4N6EA 1I2QA 2ZX9A 1NARA 3SCTA 3T8LA 3TLQA 1L8PA 5A5WA 3KS6A 2ZZ5A 2F7FA 5CC7A 1VFTA 4CU6A 2YPIA 2F9RA 4B3KA 4XD6A 2WJDA 2DQWA 4ZQPA 4CNPA 1P7TA 4LS2A 1TPUA 2CC0A 1FCQA 1XG3A 1AJZA 2F38A 4XO7A 2OELA 1BRLA 3W82A 1OFBA 4P7OA 1J0KA 4JQ1A 4XG1A 5IFTA 4ACZA 1KGXA 2O92A 4DAIA 1E1CB 4JHMA 4OV9A 1WOAA 3S5ZA 2JF7A 2XSBA 3LMYA 1J8VA 1F3XA 7TIMA 4FF5A 3G6LA 1KLZA 3GAKA 2OQLA 2NZLA 3H2NA 3RRXA 3AU2A 3PPHA 1U2YA 3CYVA 3PWAA 5LIWX 4K7YA 4FNPA 1V0MA 3MP3A 3W7CA 5DMMA 3LN3A 1OG0A 1PE1A 2PTDA 3W53A 4S3CA 2CXGA 2QGYA 2J7HA 3QJAA 5E0FA 2P50A 1RVKA 4B4HA 4B3LA 2YCLA 3TW9A 4BA0A 3TNBA 3MKKA 1V0LA 1PUDA 4HSHA 1ISZA 1CGXA 2BFGA 2QYGA 3KX6A 2PLMA 1GVFA 1W37A 3FKKA 3LS9A 3QEZA 3CH9A 3C4UA 4NI3A 3DFTA 3IVTA 2WANA 5ABFB 1CDGA 2VRKA 3AMKA 3MA8A 1TIWA 3V18A 1FWTA 1E9YB 4HCHA 1BVWA 1QJWA 4TOQA 1F74A 4M0XA 3MBDA 3M5XA 4A8IA 3GDKA 2QMKA 4NX0A 3JZEA 4QEEA 4H8HA 5I3FA 3UR2A 5F2GA 4R5EA 3TTQA 3T81A 5HNRA 1VFSA 3WQVA 1W3KA 4C7FA 2RDWA 4U4MA 3QKEA 3W1MA 3O6AA 4BY3A 4YWSA 4QE5A 2FIQA 4RUBA 1K02A 1YBQB 2FGBA 5BROA 1TPB1 4PMDA 5CCZA 3K8MA 3NQMA 1IHIA 5JBEA 2YBUA 4AC7C 1MZHA 2WVSA 3H2FA 2ZRYA 4W89A 5A2CA 4M56A 4L4PA 2HXUA 1VFUA 3B8VA 3TN6A 1Z41A 3UA3A 1NY1A 2BLEA 1FQ0A 3NYDA 3S47A 2GJPA 1PL9A 1FRBA 4K7VA 4NF7A 3K8LA 4LUSB 4N0RA 3E0LA 1E9LA 1EL3A 3HMCA 1H7NA 4WJXA 4EVZA 4DN1A 3B8TA 3OBKA 2V9DA 3KCJA 3R12A 2YXXA 3LTSA 1H7RA 1G4TA 1TSIA 2A1YA 3P67A 1QNVA 3BSMA 4UQBA 1KB3A 3O7UA 2E9MA 5AHFA 3ITXA 4KEZA 4BHYA 1GHSA 2E5DA 3ZOAA 2Z4GA 4US5D 4D8LA 4JY8A 3MO7A 4HNCA 3SUUA 3TVAA 4YVPA 3XIMA 4LF2A 3DG3A 1MRQA 1NU5A 4KEMA 4PRRA 4QE1A 1U1UA 1JCNA 4JTHA 3CHDA 3P6LA 1EUAA 3TOYA 1KV8A 1VENA 3SM0A 1VR6A 3ARSA 2DZUA 1CCWB 2ATMA 3M41A 3QW3A 1GK8A 1V0NA 1PCWA 3B0UX 1NSJA 1TV5A 1F7BA 5BXPA 2HNHA 3LRLA 4EWND 2J78A 3WJXA 4J4KA 5A6AA 3CQKA 1EGMA 3G1YA 1ME9A 2Y7DA 2GSHA 1DYSA 3GVWA 2PGFA 3O9NA 4UQCA 4KRUA 3BSGA 3PR2A 3RPMA 1TMQA 4UTJA 3T4CA 1PAMA 2VCAA 4ZEPA 5JH2A 2D2OA 1ZCCA 2NV2A 2Z1SA 3OPSA 1KR1A 4WDWA 1AQMA 1JYNA 4O57A 3CIXA 1RH9A 3VNLA 4HQVA 3IGSA 3IWPA 3DKLA 2NLIA 1S2WA 2TYSA 5LNVA 3IRSA 5CZJA 3MSDA 4AMCA 4X9YA 1EZ2A 4ZTYA 4IGSA 1PS9A 4FZIA 2F61A 2VOTA 3MUXA 3RR4A 3XINA 2G8ZA 1OIMA 3U8GA 2CZFA 3W87A 4CNTA 4CQBA 2WM1A 1KFLA 3ERPA 2C1HA 1E3ZA 3SUVA 4ZVJA 1RD5A 3WMBA 4JIPA 2BY3A 3GG0A 3PK7A 3RM9A 4L80A 3O16A 1TA3B 3E2RA 3K5XA 1Q5MA 4XIMA 1PBGA 3DEQA 2G3MA 1UC4A 3AIVA 2EJAA 1OCJA 4AX6A 1UD4A 3L21A 3SY5A 3EOOA 2Z27A 7ODCA 3LGEA 3BLFA 2ZKMX 3TJ4A 3B9EA 1GOQA 4JEJA 3TW6A 1H2JA 4NYYA 3IS4A 1Z48A 4RW5A 4AWUA 4AY7A 1K7FA 3JUGA 1QK0A 4YHGA 3DGRA 1NFGA 3CLMA 1Z42A 2XFRA 3VIJA 4KCVA 3OO2A 3H7UA 1PTDA 2FPVA 5F7UA 2CNCA 4JTEA 3VOHA 4D6FA 2W67A 2Z2BA 3S1VA 1XG4A 3T0CA 4I90A 3WBAA 3GZ3A 4KT2A 3TX9A 1WUEA 5DXXA 4ZR8A 3AMCA 4GZ7A 4JN6A 1IT7A 5HJYA 2AAMA 2VJXA 1V77A 1XIFA 3SGZA 2DT2A 5HWNA 3PUOA 2IQDA 2HBVA 4QDWA 3TQVA 2BODX 5FAGA 3U57A 1KCXA 4L64A 1XJBA 3CJPA 2TSYA 4DF1A 4B5WA 5CGMA 2Q6ZA 1R3RA 2VUYA 5FL0A 2GOKA 4GJIA 1MWOA 3FEQA 1K7EA 3GDRA 4GQGA 2R1PA 1HN1A 2WCGA 3HN3A 4K68A 4MDOA 3PFRA 4O12A 3UETA 1YMYA 4OUEA 1KC7A 3VNMA 2Y8UA 5D03A 3SQMA 4HNVA 4TR9A 3H21A 1RXOB 1J0ZA 3I68A 4NZ1A 4EPBC 1JD9A 4ZXLA 2CIPA 4XWUA 2VFFA 5K9CA 3MHFA 1B0IA 4Q3MA 3G1HA 1CLXA 3HIJA 3MI2A 3SSJA 2PGWA 1H1YA 3MTWA 2WAGA 2GQ9A 4FNQA 2ISSA 3DZ1A 1E55A 3GG7A 1UWRA 2VC6A 3POCA 1P6WA 2PMQA 3KOYA 1JZ7A 3HPZA 4AIUA 4RKAA 1P4CA 3CV2A 3WUEA 3TWAA 3L9CA 4HSOA 4LS1A 3NQAA 1KXVA 5BOOA 1KA9F 4NX5A 5CPSA 6REQA 4IL2A 3QY7A 3WEOA 4J3ZA 2OSXA 3WCZA 4PYSA 4CU8A 2GVYA 2PTXA 1NOFA 2R91A 1B4EA 4DXXA 3GDMA 2GUUA 3BK0A 3PPCA 5E70A 2ZA1A 3EB3A 4UIOA 4R33A 4DRSA 3UWEA 4Q8NA 4ILSA 4B5TA 2FTYA 1W1A1 4LV4A 5D38A 4JQ4A 3A47A 3CV7A 4HNOA 1UR0A 1P7TB 3E0VA 1IEVA 3CTLA 2YYTA 3PUGA 3I10A 4DJFD 3SIZA 4AIOA 2X0SA 2X0YA 3L23A 3MI3A 1BRLB 3SO7A 4JKKA 3HQ1A 3OOQA 4Y90A 4ACZB 1WDPA 5FJRA 1AA1B 4AZIA 3F03K 1UD2A 1VBHA 5E6ZA 3UYCA 3L67A 5IOBA 5F4WA 1JYWA 1W0MA 1EDTA 2ON3A 4Q6JA 3QOMA 4NJJA 1JPKA 3DFNA 1UIPA 4XZHA 3MWCA 3DUGA 2C15A 3SSZA 1V5XA 1F6PA 4F9JA 3W2LA 1Q45A 1MMFA 1FWBC 3SN0A 1MUMA 3CUGA 4MTVA 2PDXA 2TAAA 1KTBA 3NL5A 4AWTA 2DDXA 2OOFA 3RLHA 3U5UA 2WOQA 3VKBA 2XN1A 3LU2A 1R2RA 2C0HA 2NSOA 1JXJA 1CXHA 5HMDA 4AB4A 4IQEA 4QR6A 1LOQA 2QULA 2YA2A 5EYWA 2BMBA 1Y5VA 5G2WA 2O0TA 1JCLA 3WDQA 3E96A 4UZUA 5CPNA 4C6BA 1E73M 3EDDA 3AS2A 3IJQA 2YCLB 2E8ZA 3RIKA 3WFLA 3FYYA 4IG2A 4NT0A 4XZLX 1ZCOA 3CL8A 3CIWA 3SCPA 5BU6A 2MNRA 3W00A 2C14A 4W84A 3DFPA 4XD3A 4TIMA 3GFYA 4KIRA 4HK7A 3S8HA 4LBSA 3TFXA 3W1QA 4ASTA 3BCJA 1BWLA 1DJHA 4DO4A 2ABBA 3BZGA 3UZZA 5A2BA 3PHAA 1DXFA 4DJDC 2WCSA 1K4GA 3NYZA 4Q33A 4Q7BA 4GI6A 3WL1A 1XFBA 3M1ZA 3MSYA 1W1VA 3STGA 4RE3A 5D9OA 3HPAA 1TR9A 2Z2UA 2E9LA 4P8UA 4UNLA 4D6HA 2XSXA 4PBFA 1JDAA 2OODA 2XN0A 4U3AA 5D8WA 1EJ7L 3KBMA 1FWCC 3M5YA 2A7NA 4M8UA 3LBMA 1B54A 1AMKA 3GXNA 3LHYA 5EL1A 2VNCA 2PDIA 3S83A 4L9YA 2ZA2A 1L6SA 2ASHA 3U48A 3LHTA 1H1NA 3R2GA 5FI8A 3A21A 2X40A 4GYKA 4A8LA 1NAL1 2J9ZA 4UFHA 3LXBA 3F5LA 3WQEA 4H8NA 3MUZ1 5CLWA 4U2ZA 2X1UA 1JAEA 2Y0FA 2X7VA 1T99A 2XZ7A 3H26A 2BXYA 3V16A 1PHQA 3QPEA 3G0SA 3WNNA 3ME3A 2ESCA 1K6WA 2VEFA 3I7QA 2AQWA 4JPGA 4CNOA 2GK1A 3WNPA 4DB7A 3EAUA 4YCPA 4M80A 1XQLA 3SN4A 3ZS4A 1RHCA 1VQTA 1EP2A 4GINA 1D3GA 2DUAA 2FJKA 4UFKA 1MEIA 3NQDA 5E09A 3WQWA 3CWOX 1GTEA 2FTPA 4KRTA 3MMTA 4GGHA 1Q7ZA 4FF7A 1W3TA 4YPJA 1XYAA 4U33A 3K4DA 1BXCA 2WKGA 2CPUA 3W81A 3ISIX 3QF0A 2VQUA 1H1ZA 2EPHA 5IXEA 4XZNX 2WM0A 2PWVA 4D6DA 1EYWA 4LBRA 4NKCA 3L66A 4DJED 2Z6JA 3UPMA 1X98A 3TYZA 2R9RA 2O56A 4W85A 2CEQA 2X41A 2PC4A 4Z2LA 4YTUA 2ZUVA 1D3CA 6ENLA 3OHIA 4QSFA 1XLFA 3W88A 1I4NA 2QDDA 2J27A 4QE4A 2AL1A 1TWIA 2VR5A 4DNMA 4RL3A 4OFCA 1LP6A 3M0XA 4RV3A 2J66A 4JYFA 1DTNA 1MI3A 1R3SA 2XIBA 3KRZA 1UH4A 2ZZ4A 9RUBA 1VPYA 2EPKX 1MQPA 4U28A 2I9EA 1V6XA 4EX4A 3WQ6A 1LL6A 2ZYFA 2PSNA 3QW4B 3W86A 5C6MA 1W9XA 5TNVA 3R1ZA 4E3TA 4E6MA 2QR6A 5I3IA 3GX9A 2PP0A 1SSGA 1UC5A 4IIBA 1PVNA 5HUPA 3M46A 1OT2A 1Z7AA 1IT8A 3F4DA 1CXKA 3KEHA 2PWDA 3LLXA 4GX8A 3N14A 3TA6A 3GB6A 4DUXA 1JDCA 3LGDA 3MS8A 5C5YA 4EAMA 1LG2A 1TCDA 2Q8XA 3FA4A 1PIFA 1JNDA 3EWCA 4WIWA 4QJ1A 3M47A 2QVNA 3W85A 2VDGA 3N25A 2EKCA 4AWSA 3E2SA 2X16A 4ZTXA 3Q94A 2PBOA 5AHLA 3QLDA 1K4HA 1LLOA 1GPWA 3RDKA 1QVBA 1ZBVA 3HGJA 3GXMA 2PRLA 2FFIA 3IV3A 3BW3A 3DX5A 2YA1A 3W7GA 4DLFA 4LALA 3AXMA 2R1MA 4ZFCA 2XWDA 2A4AA 1XLCA 2QQ6A 4Z2KA 4NP7A 2R14A 4NRRA 3OLGA 1OFOA 4B5VA 1CBGA 3PP7A 4TU1A 1JYVA 5FSDC 5EBAA 4JICA 3FAWA 3NQBA 3NTYA 1ZRQA 1BSIA 4DYEA 2BV9A 1X97A 3RCNA 1R3VA 3SR7A 3KOWA 2V2HA 2PD5A 4ZB5A 4IM4A 3GG8A 1W1YA 5G1MA 2PDBA 4PULA 5LIKX 4HMCA 3W28A 3AS1A 2HSAA 2OLHA 1E9ZB 4TV5A 1EQCA 4AAJA 1FY6A 1R3YA 3FN9A 1JUBA 2GUYA 1FDYA 4XZMX 3DH7A 5CKSA 1XCFA 2XH0A 5FACA 1Q3NA 1S2UA 1XIEA 5F4XA 1M6JA 2WSYA 1NDWA 3II1A 4MWAD 2OJPA 3PJXA 1SMDA 4UTWA 4N02A 3WLOA 4IGNA 4AYGA 2PA6A 4GZIA 4QFUA 5LSMA 2DIKA 4PMYA 3UWZA 5D04C 2GPTA 1ECEA 4NNAA 3U4AA 4Q8OA 4AMAA 1W1PA 1XS2A 4ES4A 4M19A 3DFQA 3PZUA 2VRQA 4MPQA 3FDGA 1KBJA 2A3CA 3W2KA 1BTCA 1X39A 3D0CA 4C6QA 2V69A 3I6EA 4YHEA 1NIUA 3N2BA 3PANA 3PBGA 3QV6A 1WPCA 2PBGA 5A94A 1PSCA 3QR0A 4UQDA 4GYFA 2R1NA 4MKVA 2ZQ0A 2X0HA 5AHIA 3WQCA 4AD2A 2FHFA 4JY9A 3CUZA 4QQ3A 3MCMA 3VM7A 1WA3A 2OWCA 3QN3A 1GYNA 1OG6A 4QS5A 3AIQA 4XO6A 1MZRA 1D7FA 5CLTA 3H7RA 3W01A 3SCRA 3CGTA 4O15A 5CG7A 3S4TA 5K9XA 2PDNA 1GOXA 1Q66A 5TF0A 1UH2A 3E0WA 2I1OA 1R46A 4C1NA 4HK6A 4IG2B 4QITA 2QCEA 1VBJA 2ZUUA 2ZRZA 5E0KA 4FB7A 5HOSA 4YYCA 1OK6A 1JL8A 2JBMA 1GVIA 2YIHA 4YLWA 3N9RA 3SJNA 3ANUA 4IOTA 2FJUB 1VJZA 2XVGA 4AF0A 5I24A 3CB3A 4O1AA 6CGTA 3BO9A 3R43A 3OVGA 4GFIA 2YCJA 3NEVA 1S2VA 3VUSA 4W7UA 4Z2HA 2ICSA 1Q6EA 2OVLA 2NXIA 4RV8A 3EDEA 4GVGA 4BI5A 2ZRXA 3OZMA 4IPNB 3WK1A 2QDEA 4IIEA 4S39A 4GABA 3WG6A 4Z1CA 3AWOA 4PSPA 3UCDA 4NHVA 1W5NA 4JQ3A 3GAYA 4C1LA 4GXWA 3LBCA 1HG3A 3GHUA 3ANVA 1R3WA 3EKLA 1GQLA 3GH7A 1M7XA 4FOJA 1SO3A 4B16A 4F40A 1A5SA 4W4QA 1VFMA 4OWGA 7TAAA 4MM1A 1TB3A 3E49A 4LV9A 4MB5A 1BF6A 4A8RA 2XVNA 1YNPA 3UGVA 1VEMA 1SJBA 3AXXA 4GYJA 3SUSA 1GZJA 2JGQA 2PGEA 3IIVA 3IGHX 4BF7A 4US5A 4C5YA 5E9AA 1BXBA 4PMVA 2ZUWA 4QXIA 5F2MA 3S2LA 3V3WA 3GTHA 3NXFA 2QCNA 3NQ8A 4POCA 2Y61A 3UJRA 1ONEA 1QR7A 3NM3A 4JHOA 2C16A 5BCAA 3WH6A 4ZSUA 4F0RA 2WLYA 1WCGA 4D6IA 1XRSA 2GK1B 4LRSA 1M7OA 4MKSA 3KL3A 1IXNA 2PDPA 3UXIA 2WMHA 1H5YA 2DW7A 2PUZA 1PO9A 2BSLA 4OKDA 1MFVA 1DHPA 4ZODA 1TX2A 4IJRA 1W3IA 3PPGA 2CBJA 1OX5A 2CKRA 3GNXA 3WQ4A 1XDJA 3EA3A 3W6YA 1V6VA 4HOZA 3V1PA 2QF8A 3KCOA 4GBUA 1EWEA 3TXVA 5AY7A 2W4XA 3W83A 4TVCA 3CO4A 2WMFA 4O19A 1A5BA 2OX1A 3AI0A 5C54A 3TSBA 3LHZA 3L4ZA 1ZAJA 3RX2A 4XZIA 1EPXA 3T0AA 3TOPA 5IRPA 4U3CA 5F2IA 4IMAA 4YTTA 1ONWA 3UXAA 1QNRA 3S1GA 4E2BA 4BF9A 1XLAA 3PPFA 2IXUA 3RPTA 2Z1BA 2EF9A 3AYVA 3H4WA 1WDDA 5CSRA 7XIMA 3OHMB 3WD1A 3W0KA 2OQHA 2UWFA 3ID7A 3LCGA 3OZOA 4ZXOA 3QQWA 2J8TA 4WR3A 3UR8A 3SFKA 3W7QA 1D7KA 3IVSA 5HANA 2VC9A 2D2GA 3DHFA 2E4TA 1V51A 4UMCA 3H8AA 3UZYA 1IR2A 3G24A 2YFOA 5EMLA 2I17A 4S3GA 4CQDA 3W23A 5FJUA 3PBVA 2OO6A 1M53A 1UIOA 2FVLA 4RNIA 3LHWA 1TPH1 4WKAA 1DIKA 2QAFA 5T91A 4DX3A 3TZNA 4RDYA 2DU2A 3JW7A 1ISWA 3GH5A 3NOYA 1HL9A 1FXPA 4UCGA 8TIMA 1GQKA 1MW1A 4O10A 4H83A 3RITA 3ZM8A 5DCBA 4U31A 2X2YA 4AZHA 3GVVA 3QOKA 1KRCC 1Q6RA 4RZBA 3WFZA 4D8AA 4QLLA 2YYUA 3GIPA 2A6LA 1TE1A 1V7YA 3ARWA 4PCPA 5I2UA 5I7GA 5TQLA 3IIOA 4C7GA 4AFYA 3T2QA 4I5XA 4HA1A 3EDKA 3LXAA 3INPA 2TPSA 3LSCA 3GC4A 1SYTA 1A4MA 5B7ZA 4K1GA 2DPEA 2Q3OA 2GJXB 4ZCWA 4UTKA 3QQ1A 5CPLA 1X6UA 2Q02A 4LUIA 2AMGA 5J8LA 4WSHA 3H2AA 3LSBA 3GVQA 2RKXA 3TC7A 1C3FA 1KRAC 1QOPA 2BOEX 3W02A 3HURA 4IP7A 1RJQA 3A4JA 4ZO8A 4AYSA 2Y88A 4PEEA 4EXBA 1CEOA 2Q09A 3KL5A 1FWIC 2DUXA 1U22A 3RFAA 2VHLA 5DY2A 4MUPA 1F2JA 4MYAA 3UY7A 3OA5A 1CXIA 1J6OA 5K7JA 1FFQA 1QNPA 5T8GA 1B3VA 2I14A 4WLCA 3WIJA 5CJNA 1FUYA 2GQ8A 3LEPA 2X1SA 1QTWA 3EWZA 1R3TA 2O7SA 5G4HC 1KBIA 2QCDB 3W1RA 5EGRA 1UCWA 3QGAC 1GPFA 3STEA 4DJFA 3HM7A 1A5NC 3WO8A 2YX0A 5I3JA 1IZKA 5FF7A 1Q85A 3AALA 4MKNA 1CLKA 4QISA 2UY3A 2HBXA 2PDKA 1OGBA 4NAEA 3N19B 2VEKA 1BQCA 5L6UA 4JTTA 3UWWA 5HR7A 4IP5A 3CWNA 1PTAA 3LZ3A 4LPCA 5H1WA 3S46A 1KFKA 4NZ5A 3URAA 5C7HA 3USBA 3ZIZA 5AC4A 2ACSA 3MZ2A 3W7EA 3LPGA 4UR9A 2C19A 3EYPA 1W8SA 2IKHA 5ENLA 1C93A 1ITQA 2DZAA 4RW3A 3BLLA 4LSBA 4DPPA 2NW0A 1XSJA 3U4FA 1CT5A 2JALA 1RUSA 2J75A 1LZOA 2VTFA 3TUUA 4WX2A 4XVDA 8XIAA 3EB2A 3G18A 4MNLA 1K70A 2Y89A 4YMZA 5SWUA 3P14A 1WDSA 1ZPTA 2CLOA 3GTXA 2RGMA 1YPFA 4GWEA 1FWWA 3DN5A 3PAJA 4KGLA 1DQUA 4JNMA 2ZIDA 5LIXX 5D2WA 1Z69A 4GMEA 4DWSD 2NWRA 3LM3A 3L65A 3MYOA 1UG6A 1W9VA 3QV7A 2BWGA 1JZ2A 1X6NA 3AJ7A 1C90A 1PZ2A 1XLBA 3FGCB 2VFDA 3KTXA 3FSUA 2EBNA 1EF2A 2PDJA 2WMIB 1JI2A 3DFHA 3AUOA 5CGTA 3AC0A 1H49A 3W22A 3TCEA 1OCNA 2GGHA 4LAOA 2D23A 1H7XA 4KEVA 1OX4B 1O5XA 1E6ZA 3NZRA 3U2EA 3VNJA 1B3WA 2FGLA 1GEHA 4DUVA 1OZQA 4HK5A 4IPJA 5D05A 4MNJA 4DPQA 2PS2A 3BJSA 1Q7QA 3T40A 4I3GA 4FLRA 3VFLA 2PPGA 3IARA 3A3WA 4TV6A 2QLYA 4PB3A 4PMOA 3VI2A 1PCKA 2I5GA 4W93A 1RD6A 4FXFA 3ABOA 2PE4A 2DGAA 2HE5A 4I8DA 3RGTA 3E0IA 4S38A 1NJJA 2VGFA 9CGTA 3GXDA 4GQRA 5FJIA 1XRVA 4XZWA 1IEWA 4JTUA 4F4RA 1AVAA 1TMLA 4ZB0A 1EEPA 4WOZA 1HO1A 4O14A 4AEEA 4X0VA 3U3HA 4WJ8A 3KFTA 1DWAM 1XIGA 1NEYA 4LUJA 2OZ3A 1RP9A 1OVDA 3BQ5A 1W9DM 1DE6A 2Q01A 3NXLA 4UUIA 4OGZA 1KWGA 1EJUC 4XBJA 3LCHA 1JCMP 3T0DA 1X1ZA 2Y7FA 2NQJA 4I9JA 3TDFA 2DY3A 4S23A 5EKYA 1V6YA 2Z24A 1XQKA 1Y5XA 3L7RA 2QIIA 4H00A 2VX6A 4HOXA 4YTQA 4HZMA 1GJWA 4LW7A 1C7SA 2VFGA 3NA8A 4S3KA 3UZJA 5AVNA 4Q32A 1R7OA 4JIRA 2SFPA 3MJMA 2YB4A 4DJEA 2H6RA 4AVFA 5FF3A 2CBIA 2BHZA 3TSMA 2EPLX 6TAAA 3B4UA 2XU2A 4W8AA 3CMJA 1XLEA 2D3LA 2XIQA 4CGTA 2J13A 3C3UA 3QLLA 2DZSA 5DN1A 5DF0A 3BWWA 3ITLA 3UG8A 5IBXA 1MNZA 3W7PA 4JN7A 2XINA 4MG4A 1UR1A 3WK0A 4CQ8A 3VMPA 4UTHA 3QVQA 4XX6A 2NQHA 3THQA 2WVVA 5IHSA 1QI5A 4INFA 1R5YA 4OZOA 4NAFA 3EPNA 4C91A 1OWQA 2HV5A 3PF3A 1W1ZA 3GR7A 4LNCA 3F7JA 2J24A 3T78A 4L61A 1XC6A 3F5JA 2C7FA 1EGVA 3CLWA 3SECA 1FWGC 4YNGA 1XYMA 1QPQA 2YFNA 3BMWA 3N15A 1DIEA 3W29A 7ENLA 4C6JA 4GO9A 1J11A 2UZ9A 1XYFA 2HE8A 2OLAA 3G0UA 4HPHA 1B3ZA 3PJUA 2ALRA 3F1QA 2XFYA 1DIOA 1TJPA 2EPNA 5K4XA 1DEDA 2PODA 3A3XA 3VVGA 4JIHA 1PYFA 3SEPA 2QPUA 3FKRA 2UY2A 4KQNA 3A5VA 3ZR4A 2P8BA 4QAIA 5BRPA 1RQEA 1IZJA 4GX9A 1RPKA 1NDYA 3AXKA 2FDSA 3PFMA 3EEGA 3GKAA 3AU6A 3UD6A 3KBNA 4PUEA 4M3PA 1HGYA 2QDGA 5T26A 4WY0A 3VE9A 3ZFHA 1SO6A 3L2MA 5I3HA 3RILA 2OSYA 3UW6A 4UFLA 1KFEA 1EO5A 1RA0A 3O63A 4LVAA 5KZMA 5BU9A 2V6AA 1LLZA 1UWTA 3OG3A 1OC6A 1I0DA 4UMAA 2GSEA 4JCMA 3NSXA 4UFIA 1NF7A 3CZGA 5HA7A 3S2CA 1TTPA 4IUOA 3GVRA 2YBTA 2G3NA 2DVUA 5T9BG 3TFCA 1JXKA 2ZX8A 4H7VA 4H6KA 1CENA 1G94A 4JL1A 1SFJA 1IIHA 3AXIA 3TYAA 3R79A 2V5BA 2VUNA 1TVLA 5A8PA 3N6QA 1FVPA 3TV8A 1EXPA 5BZAA 1K8ZA 4UTWC 3MYPA 2ZTJA 1J01A 2ZDSA 3GK0A 1JCXA 1SQ7A 2HMCA 1CIUA 1AZ1A 4XZBA 3KL0A 3NPUA 2PDLA 1Q65A 3CUHA 3IJDA 3E02A 3WBWA 4JAWA 3TH6A 2W63A 1YQ2A 2G3IA 3CAVA 1FOBA 4J2PA 6XIMA 2J79A 1KBLA 2WZEA 1YNQA 1SZFA 2BG5A 3BXWA 3UJ2A 1OYAA 4DF0A 3THAA 2HK1A 3LMZA 2G50A 4S1FA 4I9TA 2Z28A 4QJ5B 2BVWA 4GISA 2VEMA 2ZRWA 1WUFA 3KS5A 4MWAA 5LNWA 4BK9A 3HO8A 3ZJ8A 1BYDA 4HPXA 4NJGA 3SGGA 1E4LA 5A8QA 2AQVA 3VD5A 3MSGA 4Y9NA 3TN3A 2BB0A 1LOLA 4GQ0A 3IJLA 3OZYA 2VL4A 4J3WA 4IXXA 3WQPA 1HJXA 4DBDA 1GW9A 2YGYA 2OG9A 3ZYZA 4M7TA 2PU1A 4R7OA 2BY0A 1FWRA 3IGUA 1IXPA 3CL6A 2WBGA 1UA3A 2EPMX 4QIUA 2FPTA 4EANA 1FXQA 5JBDA 2CHRA 4CD5A 4XKYA 3TN4A 3CASA 3BOFA 2JGYA 3AIBA 1OF6A 3TXZA 1KLYA 5MHBA 2PDGA 3WBXA 3UQNA 3CU2A 5DCDA 2FH6A 1WAUA 3G8EA 4W5UA 3ZO9A 2PFHA 5DX7A 4D6JA 2NV9A 4E0CA 1E6SM 4U5IA 4CN4A 1E6XM 5A6BD 1JYXA 1CGVA 3GDTA 3WLRA 4IUGA 1H61A 1LOSA 4RZ4A 5A1AA 4JZ5A 1DJNA 3C6CA 2CKSA 4YS1A 5GVJA 4E8CA 1LG1A 1EIXA 1IE7C 1J18A 3FXYA 3KM8A 3VX0A 1E5JA 2DEPA 1XHGA 1T5AA 4FXJA 2CLPA 3I7RA 3W3OA 3SCVA 2J25A 1LT7A 3AYSA 4ZQNA 5AECA 4JTFA 1REQB 4JCLA 1DJGA 2HISA 4G9PA 2J7CA 3F4WA 4GACA 2O55A 5FF0A 2C8NA 2H3DA 1S1RA 4QGCA 1GVOA 2E67A 5PTDA 3BURA 5E1QA 3FJ4A 4IIDA 4LTSA 3N4EA 5MF5A 3EMCA 1ZLPA 2JKPA 1XCXA 2GVLA 4J1OA 3W76A 2C1IA 1QO2A 1SZEA 2AQOA 1VCGA 4PZVA 2YCKX 4LY4A 5AYZA 2VWSA 2CZVA 3QV9A 3ORWA 1OBAA 3M5VA 3CZJA 2Z7GA 2E6YA 1NELA 1ZGDA 1HIZA 1Z9AA 4H9ZA 4Z1DA 5LA2A 2ZZ2A 5HPOA 3JS3A 2TODA 1OGGA 4DBSA 2PWGA 4IMFA 2PGRA 3R8HA 3D3FA 4DBWA 5ECVA 4J28A 3O2LA 3U6WA 2ZX5A 1QNSA 1BYAA 1QI0A 2DH3A 3LV6A 3APYA 3WNOA 4QDPA 4YN5A 3WENA 2PAJA 1AD1A 3KRSA 3IIPA 2GGGA 4I5RA 3CQIA 3NCOA 1UKSA 3P84A 2VZOA 3W07A 1DP0A 2ZZ7A 1NH6A 1EXBA 4G5DA 3CUJA 3HFYA 6TIMA 3UZXA 5D32A 1KM5A 2V5DA 3P5YA 3MMWA 3KVJA 3ARTA 3PJTA 2QF7A 2G4JA 3GU9A 3GY1A 3O3RA 4KFPA 4OBRA 3B04A 1PEZA 5AVHA 1KRBC 4LGXA 3EWUA 4XTIA 1QOXA 2Y85A 2DJLA 4WDTA 2TRSA 4XUGA 1OIFA 3W7DA 2A85A 2V67A 1KFCA 1E40A 5A6KA 3UXKA 2IKGA 3P93A 1JI1A 3IJ8A 4TX8A 3UVAA 4GY7A 2XSAA 4W88A 3R10A 1W6TA 5JVLA 1RALA 4N4QA 4MWAE 3GD6A 1W5MA 2VZTA 5KINA 1BXNA 3AAMA 2I7GA 4O4VA 3G1XA 2R24A 5A6TC 2OZ8A 4UB9A 4GA8A 1KCKA 1K9TA 2O9PA 1SGJA 2PDFA 3VNZA 3RK8A 4AH7A 3LY0A 4N4PA 3KZPA 2F2HA 1MEHA 1RCQA 1RY8A 3GW0A 1JD7A 2G37A 2PF8A 4WXZA 5FKYA 3K8KA 2VX4A 3QY8A 4NZJA 7CGTA 1QAPA 2Z7KA 3VPLA 2A7PA 3TZFA 1TV4A 3I6RA 2NV1A 4GUJA 1E15A 1L9WA 1AK5A 1A5OC 2PWUA 3UXDA 2HEJA 3IAPA 5KTLA 3B9OA 1DWJM 2WVVB 3EX1A 3P80A 4ZFMA 3KOFA 4NAFB 3STCA 3LHVA 4GQQA 5GQBA 1ZBWA 1JRBA 1ME7A 4LVDA 4C6OA 3WYZA 3DGBA 4URIA 4NI8A 2YDSA 3I3EA 6XIAA 1KFWA 4L6OA 4NL1A 2NX9A 5EPDA 3E5BA 2D24A 3NIYA 3PB0A 2I57A 4EPEC 2Y5SA 5HATA 2GWNA 4PB5A 3DC8A 3HGRA 1PKNA 3VDGA 3CHEA 1V79A 1V3MA 3QKZA 4CKQA 1GORA 1EJSC 3GXFA 4GH1A 3RR1A 1RLCL 3KW3A 2CETA 3GNNA 2OT0A 3FVDA 4LYRA 2YL8A 3F4CA 3FFSA 3KWSA 5CPQA 3RUBL 4F9DA 1UZDA 3GE7A 4JYEA 1JGIA 2QUUA 5AC6A 2A6NA 1R6WA 4QG9A 4HBKA 4WY0B 1H50A 3IGXA 3TMLA 2W92A 3PM6A 1C8XA 4ADUA 3DOPA 1DWFM 4E2VA 4AUBA 2CITA 4IMEA 2FVMA 2ATSA 4XSMA 3S6TA 2J7GA 3NDYA 4K2SA 4UFMA 5I78A 4O4WA 3WD0A 3Q4DA 4Y9MA 3LD5A 1WDQA 5DT5A 4LUYA 4FS9A 3RN6A 3AWNA 4RPPA 3NUKA 3HG2A 3UWVA 3RPDA 1H5VA 1M1BA 3DYMA 3CV6A 2HJPA 2PLCA 1VCVA 3GNRA 1XF0A 1QCWA 2PU0A 3P3BA 5CGQA 1XLKA 3K4AA 1B3YA 4OBTA 4Z2IA 1SW3A 3TAOA 2WB5A 2CZ5A 4KKXA 1HUVA 2PCEA 2X1TA 1DBTA 4DJFC 3ELFA 3M0KA 2F8QA 5KITA 3EWWA 3EEZA 5CAHA 2PEVA 2ALDA 3UERA 3FOKA 1K3UA 4W5ZA 2FZ9A 4WF7A 4ATWA 1XIDA 4JX6A 3L5LA 1V3KA 2WKLA 4FXSA 1EJXC 3G1DA 1TKKA 4F0LA 2ZRVA 1UKPA 5G1YA 3N3TA 3C2YA 1KFJA 3T09A 3PBUA 3PTQA 3WLHA 3EDFA 4HZ6A 3A64A 3I6TA 5REQA 3TONA 4LS0A 1RY0A 1XYBA 4FEZA 4C6NA 2RUSA 4OE7A 4ZMGA 4Q4PA 4MWAB 4LEQA 3OTRA 1UKOA 4XB3A 4UTMA 4LUTA 2DZBA 4GC3A 1UPPA 3C0LA 4MGGA 4G6CA 2I5IA 3WJZA 3SCNA 2OYKA 2V81A 4IH3A 3S6DA 3H6OA 6A3HA 3V4BA 5DRCA 1QASA 4GNVA 4G8TA 3WN6A 4CD8A 4D6GA 4FO4A 1JJKA 3FHQA 4JTJA 2HS8A 1TJ0A 1M7PA 2ACQA 3KRBA 3CL7A 4HHLA 1XD1A 4C6KA 2JE8A 4XAPA 2BY2A 5DCEA 4XKYB 1MEWA 1OM0A 4KESA 1ZQ5A 4DWDA 3W1XA 2OO0A 3AZSA 3W6MA 3LOTA 3R6IA 1QOQA 4AZCA 5EMMA 1N7KA 5H8MA 3PTKA 2VC5A 3W26A 5G4EA 1V4YA 3O15A 2IQTA 2VFEA 4R85A 1QPRA 3QTPA 5FOOA 4GNKB 4DWSA 1GQIA 1OHLA 1GYLA 4MJZA 4AZBA 1GOIA 2NXHA 3BG5A 3P61A 4PR4A 2GZXA 2G97A 3I3DA 4W87A 1DJZA 3NEHA 1A5AA 3AHVA 3EOEA 4S3FA 4AD0A 1NWSA 3R8RA 4YL2A 3KTSA 2QCLA 4IXHA 5E6YA 1NWUA 3BSHA 1TWWA 4R7JA 2PDYA 3SQSA 1ML1A 3C0JA 1QUMA 2XGBA 2CBVA 1IXQA 1EJVC 1FHLA 1WE5A 3TLLA 4P7RA 2GL5A 3ARPA 1SZNA 2VX7A 2O9OA 1LUCA 3TC3A 2P5NA 3BMVA 4QJ3B 2I5QA 1IEXA 1P1XA 4EXQA 3ZWSA 4ML9A 2P8CA 2VXNA 2VZSA 4MADA 5IHRA 1OGSA 3GLCA 3A6OA 2WMKA 3SCWA 1EBGA 3TR9A 1KKOA 4MFEA 5RUBA 3M6DA 5F4SA 1WDWA 1W9PA 2G41A 2E68A 4HD5A 4H9XA 4JTRA 4ZBCA 3TTSA 4QX4A 3TWBA 1XWYA 2JIWA 2UV8G 1SO4A 3T0TA 3EX6A 4FIQA 1WB0A 3B8DA 3PB2A 4FI4A 1TV2A 5IM51 4RX0A 3RRAA 1W9UA 2ZC1A 5I02A 1EGZA 1H41A 4HTYA 2QZRA 2IS7A 4XKMA 3UYIA 4GZJA 5I6SA 4RCXA 4YU1A 1FCBA 4DJEC 3CHCA 5BMWA 3QYQA 4M6QA 4ICMA 3THUA 3UG3A 2VVNA 5M5DA 4B92A 2GVJA 4LB3A 5JIWA 2Y8KA 3M7SA 5D8ZA 3MKCA 1QU4A 3NGFA 1E0XA 4H2HA 3LRMA 4JX5A 4WEVX 2J7EA 3MVTA 1W54A 1A49A 1LM1A 3VIHA 4NG3A 1ADSA 3VABA 3T2PA 4EE9A 3VA8A 1B30A 4IGMA 1P1MA 3ARZA 4AVOA 4LANA 4IIFA 3HJZA 3LTPA 3VMNA 1DOSA 3THDA 2YCEA 2ZUMA 3LBOA 5IFPA 1DJWA 3T2OA 2GUBA 3CUXA 3ITOA 3VKDA 1PZ0A 4FLQA 2VVSA 4HMNA 5DY3A 3N12A 4WKFA 1LORA 1QPKA 2OOGA 4ZQRA 3MMUA 3BCDA 3M0YA 4GIYA 3NOEA 4HNUA 5HNUA 1A5LC 2INZA 2FLIA 4GI8A 4WQ6A 4ML4A 3AZTA 1XBYA 2Z6IA 2HCVA 1D8CA 4JHZA 1U5JA 4HA3A 3BUVA 1H60A 4ENLA 1EC8A 1TJ1A 1P0NA 4JFVA 3UZ5A 5JIPA 1J2BA 3VOJA 3VD3A 3POHA 4JQAA 4MMWA 5GJPA 1PV8A 2ZBTA 5E5CA 1G67A 1FWNA 2GDQA 3M0VA 5CC3A 2WSRA 1OCBA 3MP4A 3EZ4A 1HJQA 4A3UA 1UUQA 2WVTA 2DQXA 1YNYA 5H8UA 1B31A 4JX4A 5GPRA 2VM8A 2G95A 1Q63A 1ZAHA 1ZENA 3RXZA 5AC8A 4M82A 3VXGA 3VGGA 3AMLA 3WMCA 1IGSA 1D9EA 1FKWA 4DO7A 4WJEA 2ADAA 3DG7A 2QCGA 1EJTC 4E2DA 1EX5A 1J0HA 4XTDA 1S38A 1EFZA 4S3BA 3A4XA 2EG7A 2VGBA 3GXTA 1I2PA 1ONRA 3MVIA 4DAFA 1UA7A 3HQOA 1B2YA 1E6RA 1OABA 5D9PA 4LAKA 1AW2A 4KW2A 3VD4A 4B9ZA 1XPGA 3ARVA 4UFJA 3A24A 1E3XA 4QLKA 4MF4A 2J7DA 3MHUA 4IZGA 4N9CA 4M7SA 2W5FA 4H9TA 3UGRA 1N55A 1EQPA 1YTDA 3RLGA 3BGAA 4O54A 1BHGA 2INEA 4GJJA 1GVEA 4PTMA 3GHRA 2ZE0A 3PS7A 1O5QA 3G3MA 2A3LA 1HW6A 1ENUA 2D20A 2ZZ6A 4DUOA 3TEVA 2YDRA 4MWAC 4UZSA 2WC7A 3N6JA 3URQA 1A5CA 3AHTA 1EUNA 3A9IA 3ABQA 1EC7A 2QUMA 3GUWA 1BVZA 1GQJA 2HTMA 3RCMA 3VMOA 5LGXA 1DE5A 2OXNA 4WK9A 3W1NA 1P48A 3ICJA 1MW2A 3W7IA 2C3ZA 4PUUA 3N73A 3PWIA 1XGDA 2Y2WA 3OU8A 1W2VA 1PDYA 1V3LA 5D2VA 3KP0A 1GOWA 3MHGA 1TTJA 4B4FA 3L4WA 2GVEA 4UBPC 1QW8A 4F0MA 3M0LA 3H4GA 1ZTVA 3AFBA 1POJA 1WZLA 1VCFA 1TPWA 2WNWA 2J77A 3C5QA 4PSRA 3CHVA 1L6YA 4N9DA 3WH5A 1IXOA 3WH7A 4OU1A 3HBLA 1G4EA 1GQNA 3TE9A 3M0HA 4R88A 3WK2A 4X2PA 4IIHA 4KF1A 1KW1A 3QSRA 4YWIA 1VPXA 1WKEA 2J62A 1KM6A 3GXIA 3C2RA 1XLHA 4PN2A 5REQB 3BLIA 5AC7A 4GRSA 2E3ZA 5E0CA 1RA5A 4H2CA 3JU2A 1UR2A 1R2TA 1DL3A 4G1NA 2V2DA 4LUTB 2QJGA 3QGVA 2PWEA 1UP2A 1LQ2A 4V28A 4J3XA 3YPIA 4WHBA 5CQ1A 4QG8A 2Z00A 4ACYA 1T40A 1AQHA 4HMDA 3W71A 3DHPA 3PZMA 5DT7A 4UR7A 4MJMA 2H90A 4XBKA 4Q8VA 3I7SA 4Q4RA 1F8MA 1EEXA 3WUBA 5AN7A 1OINA 3I65A 1XLGA 3G3DA 1BYCA 2RH9A 3SI9A 1SFSA 3H2MA 1EP1A 3W25A 4B15A 4PTXA 2JIEA 1EDQA 4IF2A 3RAOA 1PZ1A 2EG8A 3S6OA 4BF5A 5J5RA 1RP8A 5A6BA 1W91A 3EA1A 4LVGA 2VQTA 3LLDA 2WZMA 1E6PA 3ABRA 3TQKA 4XQ6A 4ZB2A 3HA1A 4MYXA 4WSJA 3UPWA 3BJFA 1I2RA 3SADA 5I77A 3FHAA 1K9FA 1XKYA 2WQPA 1CZ1A 4M81A 5FA5A 3B9NA 3M5ZA 2D73A 3ZZ1A 4FNUA 5AZ0A 2WZHA 4E4FA 2YZRA 3MV11 1F9CA 4AZ7A 1I6NA 1JCTA 3NL6A 2WSKA 3S1UA 4E4UA 5B80A 4DWSB 3ARUA 4KEUA 2PI6A 4HZ7A 1I8JA 2A5HA 1XLIA 1TELA 4A05A 5JXQA 3LHUA 4DM1A 1JVNA 1P0DA 1OFAA 1Q8AA 3A9BA 2JF6A 2ZZ3A 3G1AA 4C6LA 4MOZA 2E40A 4JDYA 2W6RA 1IF2A 2WJZA 2HZGA 4P7LA 4XK2A 2NVDA 4PB4A 2J9XA 1XP3A 2ZZ1A 4P8VA 3TJIA 4NZ3A 3Q65A 4FX7A 2Y7GA 3SBFA 1WZKA 1QI4A 3QYSA 4KETA 4G7FA 4AHOA 2P0IA 1C8QA 3VNIA 1M41A 1YYAA 1P6CA 1TPVA 2W3ZA 4PH6A 3WEMA 4H9UA 2DZXA 3TYUA 5CJ5A 3DCPA 3V5CA 3UZWA 1J2WA 1I2NA 3E0FA 3W2JA 4LAMA 3AMGA 1F4HA 3NJ3A 4GXPA 3W1PA 3UBPC 1QI3A 5CBIA 2Q3RA 3VOFA 2C0AA 1HQTA 4PRWA 4W9TA 2ZUSA 1MXGA 4Z2JA 1PWMA 1F3EA 4B5SA 5AFDA 1UKQA 4CVUA 5JBFA 1JPMA 4OHQA 5CPOA 3BOLA 1GTHA 3FXGA 3A13A 1DWHM 3QR3A 3GR8A 2FHCA 1HVXA 3VNYA 3AMDA 1KGWA 1Z89A 1G1YA 4H8VA 1HGWA 2VEIA 3BJTA 3AHZA 3N9SA 2BBFA 4W86A 1GOOA 1ISYA 2QJHA 2GOUA 3HJEA 4OBSA 4ERIA 4JTSA 3ECQA 1RBAA 2FB3A 4JD4A 4Q8WA 4B2DD 4GCAA 3EXRA 1DJYA 3N04A 4M1BA 1Q13A 3IIZA 3CZEA 2RHGA 1R85A 2Y63A 4Q7NA 3VNDA 3PZGA 2CLHA 1VYPX 1XRFA 5IDIA 1GEQA 4GCXA 2JKEA 1EDGA 4JFWA 4A4AA 4PODA 2YA0A 3GU2A 2VDIA 3LRKA 3VCRA 3TTOA 2IPJA 3VIGA 4K8EA 2ISFA 1HKIA 1MVYA 2OQYA 3N11A 4JS3A 1O7AA 3PAOA 5XINA 1ZB5A 3R58A 4DM2A 1DJIA 1FDJA 3APGA 5AHEA 1FHUA 4HZ8A 1SR9A 3BAKA 4LXFA 4O53A 2WZIA 3V0SA 2QDHA 2D1ZA 1KXTA 5AYXA 1UROA 5TIMA 2ZC8A 5C55A 1VB9A 4TMCA 1ZY9A 2DSUA 3D5HA 3PC0A 3F5KA 1EOKA 3SCQA 3GC5A 1L2UA 5HJXA 1XYZA 1ISXA 1JDDA 4IT1A 2QCHA 1E1CA 1XIBA 2PWHA 3WF0A 2E09A 3EOUA 4P7QA 3AIWA 1VIZA 2IKJA 1NFPA 1UWQA 5FSEC 1AH3A 1MW0A 4E4PA 3DG6A 4NJHA 5F2LA 1XIHA 1DJXA 1R87A 4Q4MA 3ZVHA 1BLIA 2DVTA 1UR3M 4O1CA 3FJLA 1FCUA 4LVFA 3MZNA 4AD1A 1XCWA 4DZIA 1P5BA 2EXOA 4CCEA 1SFLA 1NDVA 4A3RA 3NDOA 3L68A 4QRNA 1A5UA 1W3JA 2OR2A 4S2BA 3RX3A 5BXTA 1XXXA 5CAKA 4L1WA 1CGYA 4CQCA 3ZR5A 4PBEA 1HT6A 1SPQA 3MDWA 3MT1A 3NZQA 4O11A 3P5ZA 4AD5A 1ZJBA 1KQZA 3T55A 1F76A 1M68A 4GUFA 3EWYA 4MUZA 4EF9A 1NP2A 2NUWA 3VIIA 3VTRA 3R0DA 2VC7A 1A4LA 1I1WA 2BGNE 4GC4A 2EAWA 2RJGA 1V08A 3WUGA 3WH8A 4ADSA 4GIAA 1I0BA 4QBXA 4DEFA 3RG6A 3MBFA 3V1HA 3IK4A 3N34A 4O28A 3LPOA 4I9MA 3TQ0A 3L4TA 1UYQA 4D71A 3KWXA 1OFDA 3E9AA 1D3HA 3KUMA 2WW5A 1O66A 3W2MA 4GI4A 5FL1A 4MFDA 2CLMA 3NQ2A 2NXGA 5AKQA 5FESA 2PDCA 2WPBA 1H62A 4F2BA 4BJHA 4DYJA 4HU3A 1VHCA 3NURA 3VU2A 2OPJA 1NQKA 4MLJA 2Y4SA 3KZSA 2B7QA 3PZTA 1ZHAA 4I6VA 1OQFA 1ADOA 2J74A 4IFOA 3RMJA 5C9RA 3A22A 1K6AA 1CGTA 4TX6A 2R82A 4NNCA 5CC6A 3VKAA 4LUSA 3RJXA 4E38A 4Q4SA 2DIJA 5JQ9A 2YJQA 2CHOA 4XZ9A 1GOKA 3OLIA 4O18A 3U5YA 2CYGA 4NILA 1CB7B 3DFSA 5KSWA 2DJXA 2RJHA 4EP8C 1C9WA 1HFBA 1OD0A 1KM2A 3K46A 1ZUAX 2DIEA 4UCFA 4LCQA 4FP1A 3HG4A 5A95A 3GTNA 3SIMA 1A50A 1X96A 2BX7A 5CSUA 4FR6A 4IHCA 4E8GA 2B7PA 4Q4QA 3AS3A 5EU9A 4AXKA 1TV3A 1M01A 4DWSC 4NJIA 3W72A 2Y7EA 1OEPA 3W9ZA 2BVYA 2V3FA 3S2MA 2P53A 4NXSA 5DMLA 3UR7A 3R13A 3ABSA 4ZSTA 3SRHA 4EK7A 1K8CA 1LF1A 1TFVA 2DP3A 5KZEA 1JRCA 4L65A 3LGGA 4I7WA 5FIPA 3O8AA 1O5RA 1IIGA 2A3HA 2NQLA 5IDZA 3TYBA 2B81A 2GDVA 5G1TA 4L1GA 2XUCA 4G2DA 4PFMA 3WF1A 1ZBKA 4HT3A 2J6VA 2A2IA 2P0OA 5C9XA 1LQAA 3B9DA 4LX4A 1TZ9A 3W7HA 4J9JA 1F6KA 5LNRA 1OC7A 1GCYA 1VFOA 1ZFJA 3K4WA 1MSSA 2ZXDA 3KP1A 1THFD 3QFEA 5AOUA 1CNVA 1QO5A 1ME8A 4BEQA 2G0WA 3Q58A 2DSVA 3IEBA 1HL2A 3DXIA 3PZOA 4C1KA 4OECA 1K77A 3W1AA 1FHDA 3AHYA 3SRDA 3UWQA 1WXZA 4GPNA 1QDSA 1R9XA 3GNPA 3T1GA 3O05A 4Z1AA 3GVGA 3UJSA 4RDZA 3MMDA 4ECLA 3RNDA 3EWBX 1E5NA 1W5PA 1YXYA 4F2TA 2BOGX 4JTGA 2YL6A 1Q6OA 1M9HA 2FFCA 4XAGA 4ZZ9A 1V6UA 3B40A 4GJ1A 3FJNA 1RR2A 4DYKA 1F3WA 1HKKA 3K13A 1UZ4A 4ZO6A 1XH1A 3T8QA 1ZAIA 4ATDA 4GQBA 1YLVA 1TCMA 4IX2A 4WGXA 2HROA 4E5TA 4PUMA 1JCJA 1P43A 1OADA 3W70A 2V5JA 1B4KA 4A8NA 1C8VA 1K9DA 1A3WA 1OZMA 1HKWA 2Y5EA 4H4IA 5A8MA 2DORA 2BHYA 4QQUA 4XSLA 1GOMA 5A3HA 1WKYA 3WDRA 3L5MA 1Y65A 2CESA 4LVBA 3OYXA 2IPGA 2YKKA 3TSDA 1RPXA 2X30A 5CEWA 3BTNA 5JUVA 4ADTA 1RJPA 1RQBA 4ERAA 3ZR6A 5DO8A 1XKJA 2OGJA 4H04A 2GVGA 1NWTA 4J35A 3HV8A 2EHHA 5KZ6A 3GH4A 1T8XA 4HU4A 3UY8A 3KHDA 1Q7MA 5FJTA 1I45A 4M6PA 2VDHA 4RXGA 1LWIA 1MQQA 3HOJA 4XAYA 3EMZA 1RBOB 3CQJA 4GVHA 3G22A 3L4VA 4H9MA 2V30A 1Z32X 4V27A 1UMLA 4O0QA 2B7OA 2H9AA 1CPUA 2Z1VA 3V75A 1NM9A 3NL2A 6REQB 1B1YA 5I3DA 3EA2A 4PCSA 1LBFA 4AW7A 2XWEA 1ZL1A 3RCYA 1VKFA 3URNA 5C8BB 1YXCA 2QUNA 1TR1A 3H4XA 5I06A 3LUTA 3NVTA 3MB9A 3B8IA 2P88A 5A6JA 2ODOA 5AYIA 4QAWA 5DRIA 4ZO9A 2RDXA 1YDOA 3B8SA 3UG4A 1K8XA 3S1WA 2NVCA 2OB3A 3TMQA 1VEOA 4FIRA 1HXJA 1BGAA 2VRJA 1JFXA 5DXYA 4AZ5A 3WBEA 3JR2A 1EJRC 2YB1A 4AG0A 1AD4A 2WXDM 4K6AA 4RLIA 3V0UA 1PKYA 1ZSXA 3COTA 2Y6ZA 4GOAA 2OZTA 1UD3A 1W17A 2H8ZA 2BS9A 4GIRA 5G5IA 2VKZG 1XH2A 4NY2A 1A0CA 3M6YA 1E1FA 3W2NA 2QS8A 4Q7IA 2Y24A 4CLMA 4FALA 2YW4A 4BI7A 4B5NA 4AY1A 4ERGA 2J47A 5KMYA 2ACRA 1ALDA 4ZL1A 2QMJA 1QPOA 3XISA 4JBRA 4YIWA 4X63A 5TAOA 3WQ5A 3VIOA 3E74A 3HFTA 4LOCA 3ANYA 4H8UA 3FX4A 4F0SA 2FHBA 4H9YA 4ORMA 1CXEA 3BLPX 3KOXA 4OUIA 4FA3A 1FWJC 5LA1A 2QJNA 1E70M 1M04A 3ITGA 3ZVHB 2Y62A 3N3MA 1PPIA 4C90A 4PL1A 4PTNA 4Y2WA 4QTGA 1D8WA 3LV5A 4Y9PA 2R8WA 4DZAA 3WX7A 4MIMA 4CQAA 3GQYA 1FTXA 4PUNA 5EY5A 1GVYA 3URBA 3BGJA 1P0EA 3ONBA 3MY9A 1F07A 2HRWA 3T6CA 2O9TA 2O7QA 2DW6A 3C2FA 3B03A 2D2HA 5A6SA 1YDVA 3FA5A 1Z44A 3DENA 3ZXWA 1C8YA 1XIIA 1K1DA 1IV8A 3TA9A 4QS6A 3RU6A 2YW3A 3CUIA 4Y6GA 3FDKA 1OJXA 3GZAA 2Z1XA 1JPIA 4Z1BA 3B97A 5LNUA 4HNTA 3H55A 1I2OA 2OU4A 2X7WA 3OG2A 3FNDA 1F4AA 1QHPA 1FP8A 3EWXA 3MW7A 2WHKA 3EDJA 3TIMA 3BLOA 2ZUTA 1QWKA 3N2OA 4QDMA 4DELA 2G3JA 3IJ9A 1BF2A 3S5OA 2P3ZA 3MCOA 4DZ5A 2F6UA 1B3OA 1B90A 2JEQA 3N4FA 4WKHA 3BLKA 3G6MA 4MZ1A 3CPRA 2PC8A 1S2CA 3N2MA 1HJSA 1BPLB 4JNYA 2NQ5A 5JU6A 4HSNA 1BFNA 4Z0JA 2NLYA 1XH0A 1ZJAA 1R3QA 2XGIA 2XH7A 3M4HA 5DMYA 3GYEA 3VK5A 1KR0A 3WUFA 4HB7A 4C5ZA 5C7VA 2A21A 3LERA 3WLNA 2HXTA 3G8RA 3OZPA 5BNKA 1AH4A 3IANA 1QRQA 1A3XA 1AJ0A 2KAUC 3HMJG 3NO5A 4B3ZA 3AISA 1MDRA 1JF5A 3E3HA 2W27A 3W75A 3P82A 3GNOA 1GJUA 5L9FA 3TQPA 1TTIA 3PTMA 2B7NA 2R1LA 4B9YA 4R27A 1ZS2A 1J0IA 1Q6LA 3ITTA 3VD9A 4L6HA 1K9EA 4TVDA 4DO6A 1O12A 3BPWA 4O16A 3TJXA 1X8FA 5HR6A 3DESA 3O6YX 1ELSA 1TE6A 3NM1A 1EX1A 3ATZA 3U0HA 1J9YA 3SDOA 3UF9A 2QEZA 4UMBA 2B31A 1PXGA 3QM3A 3NQ6A 2RFGA 5DFAA 4HHHA 2DH2A 4A2RA 4GUHA 3FW6A 4LYKA 4A21A 3CMFA 4FMVA 2DT1A 4Z08A 2PZNA 4MAVA 3GKFA 4CEXC 1QW9A 1YE6A 1V93A 4RK8A 4PUJA 4K8HA 3AIUA 1LYXA 3SCUA 4UTIA 3RLVA 2R6OA 4WRHA 5LIUX 2F6KA 3GU1A 3WNMA 2HS6A 3ITCA 4LC8A 4BWLA 2IPFA 1ADDA 1J12A 3MDUA 1G0CA 1LL7A 1UD5A 3KDNA 1HP4A 4Z2GA 3C3NA 2QNEA 4I9AA 4KCUA 4NRSA 2ISWA 4GBDA 4LYQA 4BEUA 5BMXA 5T9CE 1W1B1 3JRKA 1GHRA 3H54A 1EBHA 2DZVA 2HVOA 4UOJA 2IPWA 4PTDA 3BQ6A 5HUOA 4E3VA 3VILA 3W24A 2V8ZA 1CB2A 2OKOA 3CUFA 4OIFA 4HA4A 5HWJA 1CXFA 1EF3A 4TXEA 3N13A 5FJOA 5AHMA 1BG9A 4JFUA 3BG3A 4HN4A 1XDMA 2AGTA 3SB0A 1K8YA 4GHRA 4ZOBA 1E9IA 3BAJA 4PUKA 3LCXA 5D9NA 1S46A 2WV8A 3O0KA 2KX9A 4NU7A 1YDYA 4Y96A 4W8LA 2OLSA 3T4WA 3KVLA 4XAFA 4MSSA 4Y9OA 4GVIA 4GXMA 1HJUA 2OEJA 1X1OA 4X22A 4ZOEA 3SRKA 4KFNA 1L6WA 4OV4A 1JAKA 2CW6A 4G1KA 1VZWA 3W7JA 2BXZA 1VYSX 3WF3A 3EB4A 3D3AA 3AIEA 2QCMA 2FZBA 3W1TA 5EMYA 3NVDA 5CZTA 4AISA 2E6DA 3HB9A 2J7BA 3EBVA 4GGBA 4IPLA 4EKJA 3Q67A 3N6HA 3VGBA 3NGJA 3RLUA 3WY1A 2WZTA 3N17A 1L6FA 3G77A 2CLEA 4LRTA 2VFIA 1J79A 2ZXBA 3FA3A 1CLVA 2E9BA 1NFBA 5H6HA 1RCOB 2AL2A 2XH4A 1YTEA 5BWFA 4FX8A 1UWAA 2WWCA 1IGWA 5DBUA 2VEGA 2QJMA 5K2ZA 1W9BM 4DY1A 2IW0A 1Q8JA 1HKVA 1G9HA 3LQGA 2H9AB 5FEZA 3WKZA 2R94A 2WNNA 4AU0A 3OB8A 3W4RA 1SJCA 4B2DA 3UR5A 3W27A 2V3DA 2QUVA 3AYTA 1TZZA 3DERA 1TRIA 2BVTA 5C2GA 3H7VA 2QJIA 2D0FA 1U1JA 3W84A 3FEMA 1HKMA 4JN8A 2GQ3A 3TCSA 3TJLA 3BGGA 4KBXA 4FHAA 3QZEA 2XVPA 4JFTA 5C9ZA 5XIAA 4IQLA 4CD4A 4IMDA 1XV8A 2CXEA 1WKDA 3EX4A 3NQVA 4FOUA 1W3LA 1O1HA 4BR1A 1KM4A 1OD8A 3QMSA 4Q4OA 3GXPA 5CZSA 3EKZA 3SW6A 5DMNA 4A3HA 3VUPA 1LRTA 1TPEA 1BTMA 3FK4A 2GDUA 3K30A 3N1AA 4YVXA 2J8FA 5H2ZA 1JR1A 4JTQA 1SM9A 1E0UA 3GNDA 2YLLA 1R30A 3IJIA 2INFA 1QXLA 3W2UA 1T96A 5I00A 4PTWA 5FF2A 1TPC1 3PBWA 2OYMA 3OLDA 2ZADA 2V82A 4REQA 4GY0A 2RGLA 1FBAA 1ZU8A 4OJYA 4XV0A 5H91A 1G7UA 2BZNA 4AEOA 1R8LA 3QRHA 1PWLA 1BD0A 3NAVA 3P60A 4TO8A 2E77A 1KTCA 2BNJA 3SUWA 3H2EA 3G1RA 1SW0A 4HIBA 2CWXA 3WLLA 4UR8A 1S5WA 1S2AA 1AL7A 4DI9A 3F4NA 4GY1A 3WFAA 4C1NB 2C71A 3CT7A 2Q71A 1W5OA 3S5SA 2XIMA 3JZUA 2BOFX 4OOZA 3VZZA 3L2LA 4TTGA 3R25A 5H8PA 2G3FA 3REQA 1HJVA 1AODA 2XN2A 2CLFA 1VFLA 1EIBA 4Q8TA 3WD2A 3CB8A 4ZE4A 4PUDA 1EOMA 1MFUA 3VFCA 4AF0B 4ONVA 1O60A 5HMSA 1ITXA 2V3GA 1R38A 3B06A 7PTDA 3KVMA 4F66A 5EFDA 4J3VA 2XM1A 4NIRA 1OFEA 4KWVA 4PCNA 3UESA 3ALGA 2CERA 1VFHA 2PDMA 1QNOA 1V6WA 1YTKA 1PB0A 1LWHA 4NSBA 2VI0A 4HN8A 3MPGA 2FKPA 4D6CA 4RDWA 4GFSA 2VMFA 3H12A 1EA9C 3WJWA 3L4XA 4WD0A 3W38A 1Q6DA 1O95A 3HU7A 3WH9A 1B57A 2Y1HA 4HHMA 1SMAA 1W5QA 3C86A 3PBMA 1DORA 5DELA 1F73A 2XIIA 3W74A 4E8DA 8A3HA 4GIEA 2E28A 3HQNA 2YL5A 3SCSA 1UR8A 1U5HA 3NPVA 3WLPA 5CC5A 3F2CA 4KWUA 1GKQA 3BAXA 1VRXA 1V3HA 4FNSA 2C13A 4S3AA 3CZKA 1R47A 4CCZA 3MUCA 5CSSA 2A3BA 3ZLFA 3N2TA 1H4PA 1KO0A 1SSDA 4OTKA 2RDUA 3T7VA 3FYPA 5M03A 1XC4A 2OEMA 3MJYA 3VIMA 5HMEA 4C6EA 1LRQA 5I09A 1VAHA 3MKVA 1IEIA 4JEQA 2HWGA 1LDCA 5AYYA 5BOEA 3WSUA 2XISA 2L5HA 2EG6A 1Q6GA 1GKPA 5FCZA 2FVKA 2QGHA 3PZIA 5D2XA 4A2SA 4AIEA 4O1EA 3SY1A 3J7HA 2LLEA 1TUFA 3HTWA 2W62A 1A80A 3R5EA 4JYDA 3LI0A 4ORIA 2J6XA 4HTBA 3SN1A 1H7WA 3ZJKA 2ZA3A 1FH8A 4P8XA 2J8GA 4GKTA 3LXCA 3UFYA 3AYRA 2VZUA 3LNMA 3ES8A 1JG9A 1MQRA 2VGGA 1S2TA 1Y8BA 4GZEA 4LFYA 2VFHA 4J7RA 2Y8VA 3STFA 3W7MA 4I8YA 4JIEA 2O9RA 3CH0A 3VOCA 2ACUA 2CLIA 5DLCA 4BQ4A 5LNSA 3O06A 2DZTA 1IT0A 3W7NA 3GUGA 1V03A 2JFEX 3NDZA 1BQGA 1YKWA 1UUOA 5G2HA 3ALFA 1EKOA 3B8UA 2VD9A 2W61A 2AMXA 2WJEA 3NQEA 3VD7A 1WXYA 4PMZA 1PX3A 4S3JA 2PDQA 1ONXA 3SZ8A 3MUY1 4L9XA 3B9AA 4HYVA 1JQXA 1OFRA 3GRIA 1GYMA 3K1DA 5HULA 1Q2SA 3RO8A 5FEXA 1T41A 3E2QA 3LYEA 2PZ0A 4TMBA 4BQ5A 2PTYA 2WK2A 4YTRA 2WC4A 1XDLA 2OWWA 2ISVA 3QH2A 3BANA 3EXSA 1UP0A 2HK0A 4F3HA 4LC6A 2WLZA 4C6CA 4FLSA 3CXOA 3UA4A 5ABGA 4A6GA 4XAZA 1GKRA 2XFFA 3P2VA 4HU0A 3WLJA 2IQ0A 1NQ6A 1DPMA 3W7KA 5MKGA 1B9ZA 3C2EA 3NQFA 1HX0A 3NSMA 3CQHA 3L0KA 4Q22A 1UBSA 5K3VA 1M03A 4LH8A 2O4MA 1E0TA 2Q8ZA 2HDJA 4IGHA 2Z29A 1JQVA 3UEQA 5E93A 3TAKA 4D8ZA 1BWVA 1J0YA 1I75A 1VC4A 4HYWA 4AWEA 3M07A 4N6FA 3V7PA 1GZGA 3A5FA 4O1DA 3NQ7A 3S9YA 3S3GA 1LRNA 4Y9AA 3GC2A 3UCCA 2YL9A 2WHJA 3KBWA 4QHRA 1BVNP 1TUXA 3UWUA 3ZMRA 3W7LA 2OGYA 3G0XA 2VCBA 1SFTA 5I07A 4FNTA 2UBPC 1EYEA 3JVAA 1S3HA 2A3AA 3ZT7A 3U2ZA 3LK6A 3E6EA 1UOZA 4LNYA 1N8IA 1UBPC 3VYLA 5HNTA 2GLKA 3L2IA 1TVNA 2BXVA 5C70A 1F05A 2ZTKA 3BE7A 4GUGA 2HPIA 2POZA 2ZFAA 2I56A 4RNFA 1TIMA 1G01A 1OSEA 5U4NA 3R8GA 1GWJA 2YBVA 1UWSA 1YPIA 3QHOA 4NZFA 5LZLA 1XRTA 3UT0A 1VLIA 2EKGA 1FWDC 1ZALA 1O4UA 1R86A 1OYCA 1U33A 4NASA 3S1XA 2ZCGA 4YXGA 2AL2B 2GJXA 4JKLA 3WLQA 4L6DA 4K36A 4PGLA 5CJMA 3O07A 2QPSA 3MSRA 4WCJA 3BAIA 4A3YA 3A4WA 3GYCA 2AKMA 4IQDA 4JQ2A 1L6GA 1LWJA 1X7FA 1EHNA 4Y8FA 4HU8A 2CU0A 1RVGA 3FY1A 4X60A 1A47A 2WSPA 3MV01 1C92A 5LXEA 4J5NA 1RLDA 2JQXA 3W1UA 4DI8A 1UZHA 1BGGA 1EO7A 2GGEA 1LTDA 1CGUA 4NAEB 1KFBA 1V02A 3WLTA 4AD3A 2V2CA 2MUCA 2RDTA 1EB3A 3FV9A 2QPXA 1J96A 3VO0A 3ZLGA 3RX4A 4H1ZA 5JH1A 4UQ9A 3QV8A 5DEZA 3OODA 4D6EA 5LA0A 3DIPA 2X1IA 1ZP3A 2QVHA 4AD4A 2KZHA 1A53A 2QCDA 3GDLA 3WQ8A 1J4EA 1TTQA 1UOKA 3DC0A 5FJJA 3KAOA 5A2AA 1AW1A 1G4SA 1K03A 3STPA 5HXMA 1F3TA 2OFJA 3V5OA 3QC3A 1XIJA 3AICA 3USZA 2A3EA 3CBWA 2OZ0A 4PEKA 4L56A 3VDHA 1TWSA 1G4PA 4REQB 1MUWA 1R9ZA 4L4LA 5ABHA 1MXSA 1I9CB 3C8NA 4JTKA 3F4VA 3H23A 4PMXA 2WVUA 3THCA 1O94A 4K3ZA 8CGTA 1G7VA 4JTLA 3QXBA 1US3A 1YRRA 5M3WA 5CZKA 4CD7A 4CNNA 2EGZA 1WNOA 2OKTA 3PZVA 5A6MA 1ODUA 3TNOA 1J6PA 2WHLA 4Z17A 1E0VA 3LDVA 3ZJ7A 3W6LA 1Q6FA 3HPSA 2WMGA 4M51A 4PMUA 1FH7A 1AUSL 4H6EA 1DIDA 2ZWYA 3REQB 1UPMB 3WMSA 2HVNA 3O6CA 1XBVA 1GGOA 1HVQA 1RK5A 1QW7A 4RZ6A 1LROA 2E6FA 3OW1A 4K8GA 1AH0A 4N2YA 3GBEA 3DBPA 3S2NA 4QNWA 1XGZA 4X0NA 1A3HA 5HAOA 4ZGYA 2XGZA 1OB0A 4H9VA 4GK8A 2FZDA 1RV8A 4ZENA 2E25A 3HQPA 3ONCA 4GUIA 2Y5JA 1I60A 4WDXA 2X05A 1V7AA 2D0HA 5EMUA 2CHNA 2AGKA 3LTYA 4ZQOA 3C61A 1NP0A 2OMAA 3B0PA 3FGCA 1PIIA 4LT9A 2WMIA 1E71M 3OYZA 2D2JA 3UJFA 1OX4A 2FZNA 2GSJA 4L4OA 3CZLA 4PA8A 4DXVA 1V3IA 5B7YA 4DHGA 4R9XA 3B4YA 1SO5A 3TROA 1GZ1A 2REQA 2XFWA 1Z6KA 2XIOA 2NX3A 4Z1YA 3GO2A 1J10A 2MANA 3RM4A 3VGEA 3NQCA 3MO4A 2ZE3A 4PBGA 1GVRA 3KLLA 2DZWA 3GDBA 5ECUA 4XISA 1UKTA 5JMUA 2NWSA 2XHYA 5GJNA 1SJAA 1AQFA 3HF3A 4KGJA 1Q4WA 1N82A 3FAXA 1VJSA 2XYLA 5D2TA 3PBYA 3P62A 3UG5A 3VGFA 3ZWTA 3KCLA 2UY5A 1B3XA 3VDCA 4R7WA 1US2A 2WJFA 4QCFA 1J0JA 2V5LA 1QT1A 3C2VA 3ZT5A 5HJLA 1WO2A 4O1FA 2DUZA 5ABEA 2XJ7A 1QK2A 4N9BA 4C6PA 4PCTA 5KZDA 4JOMA 4LQ1A 2C91A 5HNNA 4F2UA 2EJ1A 1JULA 2QIWA 3M0IA 1TJ2A 4LCRA 4BWLC 3PZQA 5CG0A 4EPKA 3AS0A 1YW1A 3PWGA 4V1XA 5KEZA 4US6A 1FWFC 1Y5WA 3WELA 5BOFA 1SUXA 1LQ0A 5I3KA 2G5WA 1F8IA 1XYCA 3WEZA 3BG9A 3LCLA 4UOZA 3QHNA 3F2BA 3PUDA 3MCNA 3VCCA 4IIGA 2VURA 1F6YA 1ICSA 2X42A 4M29A 1V02E 2NQ9A 2Z25A 2DVXA 3QPYA 3NFUA 4ZE5A 3P0WA 2YOCA 4RXFA 4LCSA 1AMYA 2JK2A 3CNYA 4F79A 3KOZA 4M6VA 3FIGA 3WJSA 2QUTA 3EPOA 1WBJA 2PLKA 3L12A 5F1UA 1GJPA 3TN5A 1RZMA 3C56A 1WDRA 1KRMA 1F5ZA 1GNXA 1UASA 3WLSA 3E2VA 3IVUA 1VPQA 4G7EA 4YYFA 1XLJA 2P1FA 4AZGA 1YADA 4GVFA 4V1YA 4GYPA 4QCEA 2BHUA 4KRZA 3ATYA 1WOBA 3CYJA 3BAYA 4HPNA 4JGDA 3WD4A 1JZ3A 4HP5A 1XPYA 1PX4A 3KRUA 4DO5A 3C8FA 5ABTA 1KV5A 5D37A 2P3EA 3W7RA 1UWUA 3LENA 4LAZA