4F2UA

Structure of the n254y/h258y double mutant of the phosphatidylinositol-specific phospholipase c from s.aureus
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
304
structure length
304
Chain Sequence
DSLSKSPENWMSKLDDGKHLTEINIPGSHDSGSFTLKDPVKSVWAKTQDKDYLTQMKSGVRFFDIRGRASADNMISVHHGMVYLHHELGKFLDDAKYYLSAYPNETIVMSMKKDYDSDSKVTKTFEEIFREYYYNNPQYQNLFYTGSNANPTLKETKGKIVLFNRMGGTYIKSGYGADTSGIQWADNATFETKINNGSLNLKVQDEYKDYYDKKVEAVKNLLAKAKTDSNKDNVYVNFLSVASGGSAFNSTYYYASYINPEIAKTIKANGKARTGWLIVDYAGYTWPGYDDIVSEIIDSNKLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-phosphatidylinositol phosphodiesterase
publication title Competition between Anion Binding and Dimerization Modulates Staphylococcus aureus Phosphatidylinositol-specific Phospholipase C Enzymatic Activity.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Lyase
total genus 114
structure length 304
sequence length 304
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 2012-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 4f2uA00
3NO3A 4R7OA 2O55A 4F2TA 1PTDA 1AODA 4I9TA 4RW5A 4RW3A 4F2BA 3CH0A 1DJGA 1GYMA 1DJIA 1T8QA 2PZ0A 2OTDA 3EA1A 3KS6A 3V1HA 3I10A 1DJWA 2PLCA 1T6MA 1YDYA 4QJ4B 1PTGA 7PTDA 4RV3A 3KS5A 2ZKMX 3QR1A 5T9BG 3OHMB 1QATA 3L12A 2F9RA 3V16A 1DJXA 3EA2A 4QJ3B 2P76A 5T91A 3H4WA 4F2UA 2OR2A 3RLGA 3QR0A 4I9MA 2ISDA 3MZ2A 4I9JA 5PTDA 3RLHA 4Q6XA 3H4XA 4QJ5B 1V8EA 3PTDA 4I90A 1VD6A 1DJYA 3EA3A 1DJZA 6PTDA 5T9CE 1XX1A 2FJUB 2OOGA 4PTDA 4S3GA 4GNKB 4OECA 3V18A 3QVQA 2PTDA 1QASA 1DJHA 1ZCCA 1O1ZA 4I8YA
chains in the Genus database with same CATH superfamily
3WH5A 2YL5A 3GB6A 3MHUA 4D6GA 3LPFA 3VCRA 5AYXA 4NVTA 2BP1A 1F8MA 3E02A 1EX5A 1W5MA 1Y8BA 1VEMA 1DTUA 5BXRA 2XFWA 1O6IA 4NJGA 2E0PA 4PH6A 3W2UA 1EO5A 2C16A 1GJWA 3K8MA 2FZ9A 4NP7A 4XZMX 4ZFCA 4ALDA 1VCGA 3RGTA 3A3XA 4RJEA 4GYFA 4A8LA 2VFIA 2W66A 4JCLA 3NM1A 1MO0A 2PMQA 1WE5A 5JH1A 2H3DA 3TR2A 4AC1X 3EA2A 2VC5A 4ZZ9A 4ZQNA 4C90A 3OBAA 1AUSL 5GJMA 1Q85A 3L4UA 4ZSTA 3B8WA 4J28A 3VIMA 2X30A 3CZEA 1Y65A 3IVUA 3PNZA 3UZYA 4PRRA 2C0AA 1VFSA 5GNXA 3TP4A 3FIGA 5I3KA 4NF7A 2SFPA 1RCQA 5HA7A 3TLLA 1KRMA 3BLIA 3SCOA 2TPSA 1CENA 3HPFA 3GFYA 2J79A 1EDGA 3TU9A 2ZUWA 2XIQA 1C8YA 3U2ZA 1G6CA 3WF2A 2R1PA 3IIVA 3OBEA 2VEMA 3RJXA 3PANA 4C6CA 3UJFA 1E3XA 1S1RA 2ZRVA 4JTSA 1Q6RA 3B9DA 3CUFA 3LPOA 4BY3A 4L1GA 3VA8A 4RE3A 1NJJA 4QEHA 1NM9A 2VZVA 4Q7NA 1X6UA 3IJ6A 1W1B1 4YCPA 2WJZA 1PSCA 5M2FX 5HR7A 5I02A 2NX3A 3DZ1A 2YKKA 4GUGA 3UZZA 1R3VA 2PDNA 4GINA 1EEPA 1ZQ5A 3AAMA 3T6CA 4PB3A 3T2PA 3O9NA 2QV5A 3T44A 2XH2A 4NAFA 1V6WA 1CPUA 2AKMA 4XZLX 4PBEA 1WXYA 3NQGA 2HK0A 2BZNA 2AAMA 4O19A 1LT8A 4AY7A 2ZIDA 4NZ5A 2DVUA 4KRZA 3WELA 1TWWA 4L1WA 1XSJA 4HSHA 1Q2RA 4MZ8A 1LG2A 4JHOA 3IEBA 2EXOA 2V2HA 3OVQA 4NI3A 4XAFA 3NQFA 3R43A 4EANA 2DSZA 4HHPA 1Q6GA 1RD5A 2HE5A 3C0JA 2GJXB 2G0WA 4J3WA 4FPSA 3CHDA 3MI2A 3VOHA 4OZOA 4B16A 4E6MA 1UP0A 5CXPA 2FHFA 1Q4NX 1AODA 3SDOA 4CLMA 2ACSA 1QPNA 4IFKB 1JCMP 4U2ZA 2Y7DA 1PZ3A 3ID7A 5HNNA 4GJJA 1HKKA 4LCRA 1L6SA 4HKPA 4HOWA 5D02A 1ISWA 4PFMA 2YXOA 1EC8A 1GYLA 3U4FA 1B3OA 2Y4SA 4PB4A 1IWAA 1ZJBA 3MDUA 3EPOA 2CETA 2GJLA 1PHWA 2W63A 5K9CA 3B0XA 3SCNA 4JEQA 4YXGA 3POCA 5T91A 4Z08A 1GHRA 3MP3A 2H9AB 4IMCA 2X42A 1GORA 3O1NA 5HQMA 2DZBA 5H8PA 2WMKA 4F0LA 1X98A 1GQKA 3UR8A 1KBLA 3GXTA 4RPQA 2UBPC 2OOFA 3M0XA 4XAGA 1EF3A 4DJDD 1H2JA 5KMYA 5A2CA 2PURA 4LSBA 2VT0A 1R3RA 1PX3A 2IQDA 5C2CA 3ATZA 3VPLA 4AAJA 2D3NA 2OOGA 1TPWA 4AWUA 1A5OC 1GG1A 4I9AA 5LKYA 4KETA 1OYCA 3WQ4A 2GGEA 3G2GA 3W1XA 4S3AA 4NQ1A 1BKHA 4P8VA 4CQ9A 3CUHA 3UG3A 4XK2A 5TF0A 1E1EA 3GUGA 3P8JA 1HJXA 2MANA 5HJXA 2YZRA 4C7GA 2DUXA 1BXBA 5JBFA 2WANA 3CK5A 3F4CA 3GXFA 2F7FA 4GVGA 4J27A 4QIUA 4IFOA 1ZGDA 2ZZ2A 4IOTA 2PDWA 1CGXA 4O12A 4Z2GA 1HZYA 4XVDA 1CIUA 1ONRA 2BHYA 2ZTKA 1KCLA 3LLXA 2WQDA 2JKEA 4U5KA 2V5CA 3BOLA 1NFPA 1FQ0A 5A1AA 3ITCA 1XISA 2HPIA 4WDWA 3FJLA 3W6MA 4G1NA 4LF2A 1HJQA 3GM8A 3W25A 2XZ9A 4EAYA 2AQVA 3GUWA 4H7ZA 1RR2A 1KM3A 4AWEA 1PIFA 5LHEA 1B3ZA 4MPKA 4YTSA 3CZLA 1ICSA 3DI0A 1UKOA 3BGJA 4PMOA 4UWMA 1KWKA 1MUCA 2Z2UA 2XIBA 4IUOA 3W0KA 5K7JA 1RSCA 1I2PA 2Y5SA 4FALA 2PS2A 4INFA 5LNRA 4MYXA 4Y7EA 3VCCA 4L5ZA 1DQWA 3KXQA 3NO3A 1TE1A 3N2MA 2ZX9A 1W54A 3I3DA 4O1EA 4ES4A 3TOYA 2ALRA 1EJSC 3KWXA 1AZ1A 3GYEA 4I7WA 1AH4A 3ABZA 4LVAA 4N6FA 4XTDA 2DP3A 3W7DA 1GYNA 4AYGA 1WV2A 5IHSA 4PN2A 3WD1A 4EK7A 2WM0A 1B1YA 3EDJA 1VJSA 4MMWA 2RFGA 2YXXA 3LMZA 1YBQA 4M82A 3WLLA 1HKVA 1QXLA 4N9EA 4HN8A 3VIJA 4E2BA 4QG6A 2FPVA 4DI9A 3UQNA 5MKGB 3CHCA 4XISA 1TE6A 3GFZA 3C8FA 4GUFA 3VZXA 2OX4A 1ZJIA 1GOKA 3UPMA 2QMKA 3MVIA 5I09A 2GGIA 3SURA 4I5UA 5B80A 5F2MA 5HWMA 4C1NA 1F3TA 2OCZA 4B5WA 2VX4A 3VKJA 2QZRA 3AS1A 5CJMA 3S2LA 4HN4A 4PMQA 2GWGA 4O1BA 2R1NA 3O15A 4FSAA 1GTHA 3NQDA 1SZNA 4GFSA 3EMZA 3H2OA 3M0LA 1SJCA 2OWXA 2DU2A 4CEUC 1P6WA 1SJAA 2G8ZA 3LUTA 5DT7A 4LAOA 1O1HA 3C61A 4JTHA 2ZUTA 3GG1A 3PZVA 3R2GA 3CGTA 3GTXA 1JPKA 1UPPA 3LU2A 1Y0EA 1M5WA 3QFEA 5L6UA 4JYFA 4PUJA 1KCZA 1PWLA 1GUVA 2Q8LA 2VFGA 4J3VA 4BF9A 1OYBA 4P7LA 2VX7A 2YSWA 3G0XA 5TBOA 2X16A 3GW0A 3UERA 3WQVA 3LEPA 3SO7A 2FMNA 3Q58A 2D2GA 3CAVA 2NQZA 1ZU8A 3PBVA 2ASHA 4F79A 3DGBA 3I68A 1KW1A 2F84A 3E74A 3M0ZA 5EFDA 4IG2A 3LZ3A 4G7FA 6XIMA 3QZAA 4LEFA 4UXDA 3TJ4A 4Q6XA 5CZSA 3T4CA 4A8IA 2PDIA 2W3ZA 2HEJA 3A5FA 3AUJA 2V5KA 5CZTA 4XZIA 8RUCA 1I9CB 2WZMA 4RNFA 3VIFA 4L9ZA 1XIBA 3MYOA 4IP5A 1N8FA 1MSSA 4KRTA 1X7IA 1B5TA 2YW3A 3N9SA 4JTCA 1XIJA 4UNKA 5BWFA 1M41A 5CEWA 4QAIA 5CSSA 4PMDA 2B81A 1MUMA 2BODX 1XLFA 2PGWA 4PMVA 3DGRA 3S2CA 3STFA 3S1UA 1ADOA 4DJDC 3QSTA 5LGXA 4RW3A 2BB0A 3MCNA 2ZTJA 1FHVA 6TIMA 1PUDA 2E6AA 3BLKA 3GYCA 2IQ0A 2QV4A 3KOWA 5BNKA 1DOSA 5C54A 1T6MA 4UTUA 3FEQA 4GYPC 1MEIA 4C60A 3PC0A 4GI8A 3W1TA 1TVLA 4H8HA 4GIAA 1HJWA 3GBDA 4DF0A 3HG5A 1RK6A 3AI0A 2WCAA 3VDAA 4XO7A 3GKAA 3D46A 1ADSA 2WC3A 3TMLA 3A47A 4I9MA 3VNJA 3SN4A 3FJNA 5DXXA 2ZDSA 4JICA 2CKRA 1GOWA 3ITVA 4JTGA 2WCSA 3WLRA 5DY2A 1CI1A 1TMLA 2JIWA 4WY0F 4BQ3A 1UH2A 5AHNA 3WNMA 1QNVA 1W9VA 4O1FA 3AIUA 5D32A 4ZE4A 1BF2A 3LV5A 2Z24A 2WLYA 2J7CA 2BX7A 3K2GA 1ZLPA 3BSGA 3UWZA 2X09A 5C8BB 1B57A 4NSBA 3KOXA 1H7WA 4IHCA 1G0CA 3BH4A 4TMBA 3CIVA 2Z1BA 3DG7A 1RV8A 1QFEA 1PDZA 4IPIA 2J47A 3P3BA 1PKNA 2GSHA 4AD0A 4Y9PA 4J3ZA 4AZ6A 4EF8A 1YADA 1EQCA 3LI0A 4ZENA 4KF1A 1TZ7A 1LRQA 2Z1XA 3GU2A 1S5MA 3CPGA 3W7KA 3DKLA 2YR1A 1EDQA 3SN1A 3DYPA 1MQRA 2H8XA 1L9WA 1KD0A 3P0XA 3ITOA 3ZR4A 5CPLA 4FO4A 3L4TA 1E55A 3C0QA 4Z1AA 1LOLA 4BI6A 4WOQA 4Y2WA 4GNVA 1MNZA 2YPIA 3UA4A 1BG9A 1GZ1A 3EAUA 4F0SA 1JCXA 4NAEB 4ICMA 3SJNA 5HQEA 1GEHA 4XTIA 3SY8A 4FI4A 2J8GA 3E2QA 4YWIA 1L0PA 1W3NA 1AL7A 3OEXA 1AQMA 2GJPA 1SO6A 4JIQA 1B0IA 2A7NA 1EP3A 5CPSA 1QO5A 3ORWA 1LYXA 4A21A 1A5CA 3GNOA 4P61A 1V6YA 1B3XA 5H91A 5F4SA 2J78A 1NOWA 3K4WA 4PEEA 3ITXA 4NT0A 4NKCA 1QI4A 5A6LA 1VKFA 4B5XA 5LIXX 4PUNA 4IFKA 2WLZA 1Q6OA 3BAYA 1I8JA 2QGYA 1HUVA 4KFNA 4S38A 1RVKA 3UCCA 3B8VA 2BMBA 2XH4A 1ONXA 1IQ8A 4LC8A 1POJA 1EXPA 3MZNA 2WW5A 5K2ZA 4MZYA 4MOZA 3PS7A 3MKVA 5HXMA 4GD0A 1AJ0A 2ZZ1A 3T78A 3QYQA 2VZSA 4RR4A 2EPMX 4WLCA 4J2MA 4F0RA 4TV6A 2H9AA 5J5RA 1YXDA 1VGAA 3WK1A 3O3RA 4GA8A 4HHHA 2EQDA 5SWUA 3THUA 3EX1A 3RPMA 1WAUA 2PWHA 2WMFA 3GW3A 1E9ZB 1XCWA 3II1A 3HURA 3MKCA 3B40A 4LNCA 3HGOA 1KFKA 3JZEA 2QYGA 2BASA 4NUWA 3DFHA 4WXZA 2Q3RA 3N12A 4PSPA 4MDPA 4MDOA 1JPMA 1ECQA 1JG9A 1XGDA 3WY1A 4UQ9A 2HTMA 3B8IA 1JUEA 2A7RA 4IUGA 3VILA 3W7EA 1F61A 3VGDA 4GVFA 1WDPA 1TYGA 1S46A 2DPEA 4ZQRA 2XN2A 8TIMA 3T0CA 1TZ9A 2ZE3A 2J6VA 1A0DA 2CESA 2OEMA 5DCDA 1U5VA 4MWAE 3W6LA 1B90A 1KBBA 1MXSA 1T8QA 3F5LA 5AC4A 5I06A 3UWWA 1TTPA 3SEPA 2Z2BA 4OBTA 3CIXA 4DXXA 3VD9A 1HKIA 5CAKA 1R3QA 1H1ZA 1EYWA 5FJPA 2PP1A 1OT2A 2HPMA 3E0LA 2P10A 3KHDA 1E0XA 3R0KA 2UY2A 5A2BA 2CKSA 1A4MA 1PS9A 3H70A 1E15A 4GJIA 1IZKA 1JD7A 3KVMA 4PEKA 1WUFA 3BV7A 3T9PA 4AWTA 1A3XA 3C0SA 5XINA 1YYAA 4IP7A 4LQ1A 1Q7ZA 4AHQA 4O4WA 2CWNA 3A4XA 3B3DA 2EJAA 3Q67A 2ZUNA 4XD5A 1V5XA 3ZQ9A 1LWHA 2GZXA 1TPH1 3LHVA 4JHMA 4HOXA 4XIMA 1HFBA 4DBEA 3TAOA 4H7VA 3UPBA 1P0KA 1W5PA 3ZT6A 4LALA 3FYPA 1DVJA 3KDOA 3WL1A 1IT8A 4UNIA 3V5OA 3N3MA 1XYCA 4M19A 1C3FA 3AS2A 3CL6A 4US5A 1O5RA 1IXNA 3E12A 1MRAA 2FKPA 1XLGA 3S1VA 3NL5A 5E1QA 1CLKA 2FPTA 2UY3A 2PC4A 3MMUA 2G4FA 3U2OA 7ENLA 5MKGA 2CLPA 1L8NA 2QPUA 4PRWA 1PO9A 4W8BA 2JFEX 3A9BA 2VL4A 3L5AA 3HOJA 3NEVA 3BW3A 1R7OA 1UA3A 3P80A 4FNQA 2INEA 4JQAA 3W1RA 1KV8A 1FKWA 4XZNX 3RN6A 1P43A 5F4WA 4YTRA 1EHNA 1OCNA 2B7OA 2BHZA 3CQKA 3MS8A 3O05A 4QHRA 1UPMB 1XUZA 5HMFA 3MZ2A 5CSRA 2YDSA 1KCKA 1ZL1A 3RLHA 1S5TA 2WMIB 3A12A 4X61A 3GNXA 3LBMA 3LXBA 4HD5A 4AIUA 2NUWA 5EMJA 4UCFA 1U1HA 1KM4A 1GPWA 4Y8FA 1A5NC 2VVNA 3K8KA 1HT6A 3BV4A 3BQ5A 3U9IA 4J3SA 1UA7A 2DJLA 4GNKB 2HROA 3LXCA 5CPQA 1XYZA 4AY8A 2Z0IA 2ZA3A 3N6JA 4Y6GA 9XIAA 2ESCA 4IT1A 4DF2A 3BVJA 3EDEA 3QBUA 1JF5A 3D3FA 2Z29A 5HWJA 4PYSA 2OZ3A 4DVOA 1RA5A 1JCLA 1R85A 3WFLA 1QAPA 3NQMA 4GHRA 4KS0A 1UBSA 2BDQA 1A0EA 3NSNA 1OSEA 4PMJA 2DY3A 5A5WA 1B31A 1GVOA 3UNDA 3BAKA 2JKAA 1BWKA 1F76A 3SRHA 2W0UA 3F4VA 3NPUA 2P53A 3ZWTA 4GO8A 2WCGA 4RZ5A 4ZVJA 2D24A 4D9PA 2POTA 5FJIA 3A4WA 4HP5A 3C3UA 4H41A 2VC9A 4QFUA 3BL3A 1IWPA 2PP3A 2ZX7A 3CQJA 1N82A 4GO9A 1K7FA 4HK6A 3WQ6A 3KVLA 4FR6A 2QDHA 4I8DA 3CL8A 1J12A 4DY1A 3EWWA 2I56A 2ZCGA 4RDZA 5A8MA 5FJRA 4C6IA 3C4UA 4A05A 3S2JA 1TPVA 1RVGA 5D4YA 4Q7IA 1CYGA 2BGNE 3OLGA 6ENLA 1JDEA 5D03A 3CWNA 3VNDA 3W1MA 4R7WA 5EYWA 1YNPA 4C6QA 3WH8A 1LROA 1EJRC 1YDNA 1VIWA 1I1WA 1AMYA 4WY0A 2R1LA 4H83A 1XR2A 5JUVA 3S8HA 4ADSA 4DYKA 4QROA 1VFLA 4NG3A 3S6DA 3WEOA 1Q6LA 3RILA 1KTNA 4S3EA 3C52A 3HMCA 2W9MA 4H1ZA 1XKJA 1BGGA 3TCEA 5CH9A 3M0YA 1ZENA 3COTA 4X9SA 2A85A 4GYJA 4PRTA 3NPVA 2P3ZA 5C7HA 4PUDA 3USZA 3NZ1A 2R6OA 1RA0A 3AIEA 3JU2A 3GR4A 3RR1A 5GNYA 3NZGA 3W27A 1IEQA 5BOOA 3VIOA 1W1YA 1EPXA 1V6UA 4RPPA 5BRQA 2GUUA 2PFHA 2V68A 4B90A 1OFOA 4HZ6A 3SUSA 3TN6A 3PAJA 4DYJA 5E0FA 2QUNA 1O95A 2QIWA 2YW4A 5F2IA 1MZHA 3ABRA 3NL2A 1GPFA 4BK9A 3VYLA 4CQDA 1EP2A 3RUBL 3W01A 4W84A 3STPA 3I6TA 2CHNA 5FEXA 3QV8A 1EKOA 3C2OA 3R13A 3IGXA 2E09A 3V3WA 2G3MA 3D6NA 3K4DA 4EVZA 1ZTVA 3UJEA 4Q4SA 3P62A 3HB9A 3P93A 2OB3A 1NIUA 3LHTA 1OD8A 3VTRA 4D6DA 4K1GA 3FAWA 3MY9A 1P1XA 3GZAA 4NZCA 2YDAA 1CCWB 4N4QA 2P88A 3BW4A 2TODA 4I8YA 1F5ZA 1R8LA 1CECA 4UMBA 5AYYA 1C9DA 1GQNA 2J7GA 3IIPA 4HB7A 4GVHA 3TV8A 1VC4A 1SR0A 5EBAA 3L0GA 2PWGA 4UR9A 1L6GA 3A5VA 5DXYA 2IPGA 4M81A 3VGGA 1TV2A 1P6CA 3C2EA 4NAEA 4U3AA 1VYRA 2PTWA 4ICCX 5AVNA 4DNMA 5JQ9A 4ASTA 4QJ4B 2PU1A 4R53A 1Q5MA 1O12A 2OPJA 3WEMA 4LVFA 1UR9A 1FFQA 1FHLA 2RGLA 3JW7A 3TYCA 3FLUA 3H4WA 1C91A 2O9OA 3QH2A 4NYUA 1UP2A 1F9CA 1KCXA 4FK9A 4IIDA 3RLGA 1FVPA 4QCEA 3RK8A 2QS8A 4S23A 4AISA 1PKLA 1DXFA 4US5D 2NW0A 3SUWA 4HCDA 3TYUA 4AY1A 2WZTA 2IXVA 1PB0A 2PWEA 1R38A 2ZA1A 1V7AA 2P0IA 3TQVA 3VZYA 3WJXA 1PXGA 1R3YA 3N6HA 4E8GA 1OCJA 2HVNA 4C7DA 4DM1A 2I5IA 3V75A 2E6FA 2DT0A 4UTMA 1O94A 2A21A 1R7AA 2ZZ7A 3SRDA 3UWUA 1GVYA 2VM8A 1Y5WA 2PDMA 5BOEA 3MKKA 2I17A 2NXGA 3RJYA 3E2RA 2JBMA 3W72A 3TJXA 3F7JA 2ZVIA 1JCTA 2W27A 2PD5A 2G3JA 4M6UA 2ZZ5A 3UJ2A 4K6AA 2IKJA 2XIIA 2ZBTA 2Y2WA 3WQ8A 4NJHA 2X05A 1AL8A 3EB2A 4DUWA 1Z44A 3OQEA 4IFRA 3M47A 5HINA 2DIJA 4JAWA 4GIEA 4IX0A 4FXSA 4YWSA 3ABXA 1ME9A 5EGRA 3TE9A 5A69A 3I4EA 3OLDA 2W91A 2QCNA 5JBEA 4N6EA 3W7OA 1TFVA 3SUVA 4EPEC 4BA0A 1SUXA 1TTIA 4W88A 3TKFA 2HXUA 2EPOA 4AZIA 4HYRA 3QFWA 2VDHA 5E6YA 4H6EA 2I9EA 4A3QA 2Y6ZA 2WMGA 3F4DA 4Y96A 5CPMA 3F4WA 2WHKA 5KITA 5CCZA 1J2WA 4C91A 3AHVA 3ANVA 4IJRA 4NXKA 3QRHA 4JL2A 3QXBA 2HVMA 1VR6A 2CPUA 4ZO6A 3AMKA 1NELA 4AXKA 1GZJA 1KXHA 3R8HA 2V81A 2Z7GA 7TAAA 3WK2A 3P7YA 3H53A 2E77A 2O9RA 2Y62A 4YTUA 1VP5A 3VDGA 2G4JA 3H26A 2AL2B 1A0CA 4HCLA 2DVXA 1DE6A 1E6PA 3B0PA 1UZHA 4ZOAA 1VEPA 4MB5A 4FNTA 1S39A 1EJXC 2EKCA 1KM2A 3PFMA 3FEMA 2P1FA 1UB3A 3W81A 4HNCA 3VFCA 2R82A 1A3HA 4E8DA 2O7SA 4ML9A 1LF1A 3ONBA 3RM4A 1HN1A 1VBUA 2FJKA 1M7JA 3NL6A 3W76A 4L9XA 2HBVA 2LLEA 3LLDA 4AD5A 2ZX6A 4P7OA 3V36A 1S3TC 2DIKA 5C70A 2D2HA 2WV8A 1UD2A 1RQBA 2CW6A 4CN1A 5HDRA 2FZMA 2IKIA 3H2EA 3AHXA 1X6NA 5A6MA 4NILA 4DO7A 1EDTA 2G97A 2TRSA 1XLJA 3BARA 3KP0A 1QPOA 1KLZA 3W71A 5HNRA 3CJPA 2V3GA 5J5DA 1EUNA 3GXIA 4IQEA 3RCYA 2Z1SA 3DC8A 4WGHA 1HX0A 2IPWA 1JZ6A 4O15A 1SU5A 3EXRA 2BVTA 4W7VA 3AHYA 2IUZA 4UOQA 1G7UA 2ZXQA 4QG9A 3UNTA 3FVDA 2QCMA 1EBGA 3U5YA 5E5CA 1K7XA 2EJ1A 2E1DA 3GD6A 3D5HA 2PRHA 1VRDA 1F3EA 4AUBA 2E67A 3TEVA 3RITA 3OZOA 2VTFA 1DE5A 3EKGA 4PMZA 1V51A 2ODOA 1TZZA 2HISA 4JNYA 5CG7A 1W37A 4KIEA 4LGXA 3FN9A 1TREA 1O5XA 2WMIA 1KXQA 3DHDA 4C6KA 1ZFJA 3PSVA 1TJRA 2PTXA 1TV4A 3BG9A 3QHNA 5GJNA 1JF6A 2P76A 4X9YA 5D9PA 3DUGA 3CB8A 3CZ8A 5FL1A 2C1GA 1E9IA 3ZVHB 3JZUA 1OFQA 3TVAA 4EP8C 5HR6A 6ALDA 2GGHA 4ZQMA 5DT5A 3Q2DA 4GZJA 2QCEA 3RG6A 4JYEA 3B0UX 3T4WA 2IMRA 2QUTA 3G1DA 1FCQA 4YLWA 2D3LA 3UXDA 3HQ1A 4TIMA 3UGRA 4H8VA 1DWAM 2WPGA 1JAKA 2FMOA 5HMSA 4LCSA 2DW6A 4PCNA 3BG3A 3G77A 2OQLA 1LQAA 1TRIA 3SR7A 4IMFA 3WUEA 3W75A 4U28A 5I79A 1KRBC 1VQTA 3OLIA 2DVTA 1W3JA 4PTNA 1QW7A 3HMJG 3RX3A 3WKZA 1LBFA 4B3ZA 4HA3A 2DSUA 4TX9A 4IMDA 3CO4A 1WXJA 2WSQA 2QJHA 3M46A 3PJTA 3NXFA 2Y61A 2PWFA 4DBDA 4REQB 2IPFA 3LENA 2WSKA 3R0DA 4HMEA 3CB3A 1PX4A 3HV9A 4DAFA 5C55A 3SFKA 2DW7A 5AC5A 2ZXDA 5EMMA 4PGLA 5AECA 2CHOA 3IGSA 1CNVA 9XIMA 3UP8A 2QDEA 2Y88A 2VGBA 4NNAA 1HXJA 3WD3A 3W73A 3VNZA 4J2PA 1XM3A 3AJ7A 3I7QA 3DDMA 1EGVA 3R8RA 1TIWA 1EEXA 1P0DA 2P3EA 1XCFA 1J0HA 3B03A 3M5YA 1WKYA 1KKOA 1AJ2A 1OGGA 3WNLA 2V0TA 3KBMA 3AHTA 2WK2A 1MW1A 3WNOA 1UKTA 3TWAA 1E0TA 1DHPA 2BV9A 1Q8AA 3UCDA 4QSHA 3CTLA 1JUBA 3NDOA 4LAMA 1AJZA 1H7RA 1KGXA 4GX9A 4MY8A 1HQTA 2OSWA 4HPGA 4HYWA 4A3HA 4I6VA 3W02A 3W74A 3QC3A 4QR6A 3G24A 4OKDA 3GXNA 1OX4B 3QLDA 4ZODA 2C1HA 1WDQA 1R9XA 4FXFA 2IW0A 1V3LA 4XB3A 4WF7A 1J5TA 3UXAA 4DJFA 3MV11 1B3VA 5KZMA 4JN6A 1KWGA 3JRKA 2GQ9A 3RXZA 3NGFA 1JPDX 4W4QA 3FV9A 2CYGA 1CB2A 1D9EA 4MJMA 3NPWA 1SZRA 3EMQA 2A1YA 4AMCA 3HTWA 3P61A 2NUYA 3OVGA 4M1BA 4YTQA 4KCVA 4C6DA 3Q37A 1W1VA 4DO4A 2A79A 1C8VA 1FWIC 1LWIA 1I45A 1F2JA 1FWFC 4GXMA 4DN1A 1Z48A 3F5KA 1TPUA 3NYZA 2ZRZA 2ZX5A 1ESWA 2ATMA 3LCFA 1JQXA 4GISA 2VI0A 4A2RA 1ZJHA 4E3VA 3W07A 3LRLA 3FX4A 1WBJA 3E96A 3HO8A 4H9YA 5ABFA 2ZE0A 2BOEX 4IL0A 3AXIA 1C90A 4KEZA 5I3FA 3BLOA 4O14A 4WK9A 2WSRA 3QQ1A 5D38A 5IDIA 3THDA 3R11A 1WNOA 2I5GA 4CNUA 5K3VA 2VCBA 4FX6M 3L7RA 4QITA 1ML1A 1XP3A 2R8WA 4MUZA 3W1AA 1F6PA 1MW3A 3L5LA 3O0KA 1I60A 4S3CA 3KBNA 2EPHA 1R87A 2QT3A 1OY0A 1B9BA 1B3YA 3GVWA 4UFIA 3RR4A 4M51A 4A3UA 2OKTA 4GK8A 1ICQA 4PULA 1BD0A 2O56A 3P5ZA 4NZJA 2Q8XA 1UHVA 4I6KA 1NQKA 1UD3A 4LY8A 3ONCA 2JQXA 1IZCA 3NWRA 1PL9A 2PLMA 2XSAA 4EAMA 3TQKA 4YVXA 1FHUA 3PBGA 2DSVA 3QMTA 1VLIA 3CZJA 3A23A 2EHHA 1R0MA 2FB3A 4Z1YA 1Q7MA 2A4AA 2NZLA 3B0VC 1DWFM 3EX3A 2A3BA 3MWCA 3M6YA 1WUEA 1AD4A 1N2VA 5BRBA 2GWNA 5HMDA 1H62A 4CD5A 1FFRA 2J6XA 2WVUA 2PPGA 3TYZA 2J9YA 2EBNA 4HGXA 1QPQA 3AYRA 5E0CA 4LXFA 1KLYA 5FJUA 1OFAA 3VE7A 4AEOA 1GVRA 2OU4A 2XWDA 3UY7A 3TN3A 1RJPA 1YQ2A 1FX6A 5FAGA 1K6WA 3BXWA 4F8XA 4LUTB 1E0UA 3RM9A 3NL3A 5FJTA 3KVJA 3T0AA 1GVIA 2XFRA 1YMYA 1BTMA 1BVWA 5AHLA 4CD4A 4R9OA 1KBKA 1TVNA 4D1IA 3RU8X 9CGTA 1BAGA 1EIXA 3SBFA 3WUFA 1WZLA 2CHRA 1MWOA 3SIMA 4J3TA 4X2PA 1GG0A 4QLKA 3H7VA 3ABOA 1RY8A 4LUIA 4XSMA 3SN0A 4MUPA 1GVFA 2BWGA 5H8MA 1OB0A 3NVTA 1B9ZA 1QNRA 1YTEA 4C5YA 3STCA 4HZ8A 1TMQA 5DF0A 4ZCWA 2W62A 1IZJA 4AIBA 4C6FA 3GC2A 4ERIA 2Z27A 5DQPA 1CXHA 1LM1A 5DANA 1E4LA 5HPCA 1PIGA 3G22A 3BO9A 2HDJA 5D33A 3E6EA 2CNCA 2ZXAA 3V5CA 2AL2A 3M5ZA 2OZ0A 4Q22A 3GAKA 2Z25A 5AY7A 4GBUA 3FXYA 1LZOA 2Y63A 3IK2A 3N9KA 1SMAA 3N14A 2YIHA 1TTJA 4JXCA 4CVUA 3VVGA 1OFDA 4CN4A 3W23A 4FIRA 4QG8A 1GHSA 1E70M 2R9RA 5HNTA 4WOZA 3LK6A 1EBHA 4G2DA 1JVNA 2JKPA 3DOPA 2AAAA 3GVQA 4GZ7A 1JJKA 4ZOBA 5EMYA 7A3HA 3KVKA 3W7CA 2QCDA 1W3HA 1YDYA 5M1TA 4UFKA 1PTGA 4ZEPA 4LYQA 2VRJA 3QR1A 4POCA 1GK8A 1UCWA 2X1IA 3B9EA 2V9DA 4JX5A 3OB8A 4Q8QA 1TKKA 1O60A 2F9RA 1KM6A 3TSMA 3WEZA 1DXIA 2ZOXA 1KBJA 3SUUA 1A50A 3BJSA 1WPCA 2FDMA 3IUIA 5D8ZA 4K2SA 1VLWA 1XIGA 2BXVA 2WVTA 3SB0A 3CV2A 2JF6A 2KX9A 4MB3A 1H7OA 3CQIA 2A3AA 1IR1A 1DWIM 4YN5A 1QI3A 3LOTA 3PFRA 1ITQA 4ZTXA 2VX6A 4O53A 4N7QA 1OABA 3VOGA 3CUGA 4YS1A 4O8AA 3DBNA 4PFHA 1X1NA 2G95A 3QHMA 5I3HA 1TWDA 4BZYA 1XICA 2QIIA 1VPXA 4H9ZA 1OIMA 4LAUA 1J0YA 4MY1A 1K8CA 1T7LA 3B04A 4DJFD 4P7NA 1DWGM 1M7XA 2I1OA 5D9NA 3CYVA 1Z9AA 2GUBA 2R1MA 4GQRA 3KOZA 2VWSA 2CZ5A 3CIWA 4L6HA 2O4MA 3SJ3A 4KEVA 3REQB 4EWJA 2D69A 4CD8A 5E0KA 1XINA 2PLCA 1ZSXA 1Y7VA 2OELA 3WLNA 1Q65A 1DTNA 2BXYA 3SI9A 2ZKMX 5FA5A 2BVDA 3WL0A 1EF2A 1ALDA 3LCIA 3V16A 5HAOA 1J0JA 2Q01A 3WQDA 4D8ZA 4ECLA 4Z17A 3FW6A 1V0LA 4PCPA 3OLEA 4GZIA 3AHZA 1G7VA 5AYBA 3CAWA 4MJ4A 3OPSA 3I3BA 1E4NA 1W9BM 4IPJA 2PDFA 3KLKA 1UWQA 3LGDA 4Z0SA 1BFNA 1UW9A 3DHFA 3VX0A 1MXGA 3PG8A 3O6AA 1SO3A 5A6TC 5FJJA 3PPFA 3CEUA 4XUGA 1DBTA 1ZP3A 1QVBA 4DLFA 4JTEA 5DMMA 1FXQA 2DZAA 2CZDA 4AVFA 1J93A 2YYUA 2Z1VA 3ENLA 1WOAA 3P14A 3TXZA 5ENLA 1TPC1 1S38A 4AZCA 2NV2A 3PWIA 1J0ZA 1XH2A 4MZ1A 5JXQA 2PDLA 3KL3A 1LTDA 3T81A 4M29A 4IISA 1FWTA 2D0HA 5LNWA 3M0HA 3GSMA 4REQA 4U5IA 3DFOA 5A6BA 4DM2A 1YNQA 4RKAA 1JNDA 4BI5A 3W22A 1TV8A 1M03A 4KQNA 1WZMA 4AB4A 1UWTA 4G1KA 3LS9A 2G96A 2RUSA 4ZGYA 7PTDA 4PUKA 4QDMA 4R9XA 5A6SA 4FA3A 1G4PA 4UZUA 2EG6A 1CGUA 2FDSA 1ICPA 5GVJA 3ZLFA 4UMAA 2PODA 3SM0A 1V3IA 5JVLA 3CU2A 3BLEA 2NV9A 3QTGA 4ZBCA 2PAJA 5AZ0A 3AXHA 2DSWA 5EKYA 1HL9A 4ZL1A 3LNMA 3EX6A 4ZB5A 4IPLA 1HJUA 4JTJA 1LORA 3IGUA 3W87A 1XBVA 1FCVA 5G4WA 2X1RA 2I14A 3KLLA 3L0NA 3L4ZA 4HIBA 4UC5A 1Z89A 5IM51 1RALA 3W29A 5A2AA 1SVDA 1ZCCA 3FSTA 1YRRA 4FHAA 3E9AA 1KRAC 2QCCA 1RH9A 4UZSA 3SCUA 3H55A 1GZGA 4O0QA 5F2GA 3AQUA 4P5UA 4ZR8A 2QJIA 3KHJA 2V82A 2A3EA 1FWGC 2HCVA 2I9UA 5D9OA 1R2TA 4UFHA 4AF0B 2BVWA 1Y5XA 2YBVA 3GZ3A 3OW1A 3G3DA 3GR8A 2NSOA 4KWOA 1W1ZA 1OG6A 3BE7A 1RJRA 5GPRA 3O6DA 3T8LA 3UT0A 3YPIA 5JIPA 5KTLA 2RDUA 5FD0A 3HFYA 4MNLA 3WLOA 2VX5A 3RRXA 3VIPA 4D6IA 1U1UA 1IT7A 3S83A 3D3AA 2V30A 4DBWA 1BYDA 4TVDA 1E1CB 3BW2A 1FP8A 4AIEA 2FGBA 1BLIA 3N17A 3O2LA 3PZNA 4RUBA 3Q94A 3S9IA 3P74A 3WDJA 4EPDC 4JTQA 1GOOA 2W4XA 4UUIA 3N2TA 1XDJA 2H8ZA 5I5RA 3IJLA 4L4MA 4M6QA 3QLLA 1FA2A 4QQ3A 2TYSA 3VNLA 4F9DA 2J27A 1A5BA 1SZEA 1E56A 2F38A 3GK0A 2C3ZA 3WDHA 4JIPA 1BSIA 7REQA 3WDRA 5DELA 3OU8A 1O1ZA 2CLLA 3FY1A 5HOSA 2BNJA 1QCWA 5EPDA 4WSKA 1XLIA 5DMNA 1IR2A 4RZ4A 1PTDA 4LX4A 1SR9A 4H00A 1BRLA 3N11A 3MUY1 2IQTA 5DY3A 1LBMA 4MVAA 4JIRA 4QCFA 3S42A 1J6PA 1SW7A 1UJPA 4C6BA 3KAOA 3GNNA 3GIQA 3NEHA 4BI7A 3MB9A 2TMDA 3HA1A 5DRIA 3TROA 1O66A 5AN7A 2J9XA 4UFMA 1R6WA 4YYFA 4LV9A 4JQ4A 5C6MA 1VENA 4DJFC 3VNYA 1JI2A 3W7RA 3ZFHA 2PDBA 1TJ1A 2WJEA 3OHIA 1YE6A 1T40A 5AYIA 2V67A 4KH2A 3TC6A 3QV9A 4JZ5A 3NQBA 4FIQA 4QDPA 1XC4A 4JQ2A 4H04A 2CBIA 3ZT5A 3QY6A 2DEPA 1QNPA 2V5DA 4RNIA 2J13A 2W92A 5E9XA 4P2VA 2B7QA 2GQ3A 4D6JA 1C92A 4H7CA 1R2SA 2FZNA 2Q09A 4JFWA 2Y70A 3OBKA 1XYBA 2XINA 2QHAA 4TX6A 2WNQA 1VFUA 2HZGA 3CUJA 3K1GA 4ICNA 1NFGA 4LJ3A 4PUWA 1XLDA 3W7LA 1X96A 3M0MA 4O57A 2VOMA 4NI8A 1P48A 1W3IA 4LUTA 3UWVA 3EWZA 4TR9A 4Q4KA 2OKOA 1JPHA 2G3IA 3E2SA 4FNSA 1W1TA 2GQAA 1REQB 4GE8A 4O28A 1EPVA 4YHEA 3LG3A 2DUZA 3BLFA 4QJ1A 3SSJA 1E5JA 3CXOA 4GYPA 1F8IA 3GXDA 4NJKA 4JGDA 3GTNA 3L9CA 4B9ZA 4GH1A 2YFOA 2VZTA 2WZIA 3VOIA 4KERA 3GDTA 2QAPA 3V4BA 1XLKA 1GJUA 2PBGA 2F2KA 3B8UA 3TQPA 1EA0A 1PZ2A 1QNQA 4GOAA 4JTRA 1XBXA 3WDPP 4QE5A 1QK2A 3B9AA 3WNNA 3S5YA 3KTXA 2XSXA 1F7BA 3W1PA 4LYPA 1I4NA 1LL6A 3G1SA 3QM3A 1DYSA 1FKXA 4AYSA 1OHLA 3C5QA 3N13A 5FEWA 1ZS2A 3QZEA 2QVHA 1JZ2A 5U4NA 1J9YA 1UG6A 4JTIA 2NX9A 1NEYA 1DEDA 4BJHA 1X1ZA 3U2CA 2XYLA 3DEQA 3T40A 4FX7A 5A6BD 1FY6A 1RP8A 3TYEA 3QPYA 4HMCA 2ZRUA 2PDYA 3ARTA 3OJGA 2OYLA 2ZUSA 2QEZA 3CV1A 3QKEA 3FS2A 3RHGA 4J3UA 1UC5A 3BLLA 4TU1A 2ADAA 1RQHA 1ZB5A 3VC5A 4V15A 1I2QA 1DXEA 3S1XA 5D2WA 2WSPA 4LS0A 1RD6A 1OFEA 3AIRA 4YTTA 3IJ9A 3EOLA 4KMQA 4V28A 1V08A 1TV3A 4Z42C 3WLIA 2GSEA 3WBXA 2JEPA 4XWUA 3WD4A 3G1YA 4JNZA 4D6HA 3IWPA 3TN4A 1TPFA 3GFXA 5MHBA 1M7PA 2IKGA 4O13A 1H60A 4Q3MA 3Q45A 7CGTA 1Q8JA 4P7QA 4HA4A 2GGGA 1V02E 2WKLA 1GEQA 3ARQA 2BY3A 4UTFA 4QJ3B 2PWVA 3CYJA 1GW9A 3O63A 2YL9A 1OGBA 3PB2A 4Q33A 4AZ7A 4GG9A 3S2MA 2NQJA 3PUDA 4F2UA 3OVPA 2C71A 4RLIA 4FNUA 1BF6A 1TMHA 1K1DA 2V69A 1MXDA 5CC6A 3IJQA 2WC4A 2DT2A 4NRRA 1PKMA 3OGVA 2OSYA 4JBRA 3L4VA 4W5ZA 2PDGA 3UJSA 1QDSA 4IX2A 4O10A 3TTSA 1NP2A 4F0HA 4XSLA 3LCWA 4FXRA 2E9BA 2NT0A 3H12A 3TFCA 4GACA 3T55A 2EPNA 3B9OA 1FBAA 3HN3A 1ME7A 2IPJA 3O06A 1XS2A 5A6KA 1MZRA 5E09A 3NQEA 3VGEA 1PAMA 1US0A 5C0QA 5DBUA 3PPHA 5HQLA 3OG3A 5GNZA 4B4HA 1S3HA 2VWTA 3S2NA 3WLJA 3L68A 3VUSA 1W3LA 3E1F1 4C6MA 4ZE5A 2CBUA 4CNTA 4E8CA 1LDCA 1F3WA 4IGSA 1OG0A 1VBRA 4YMZA 3DX5A 1W1PA 4LPCA 3KCLA 3TQ0A 4RXFA 4WUIA 3NVDA 3MJYA 4D72A 4DX3A 3IIXA 2XM1A 2W61A 1SSGA 5KZDA 3ALFA 3GHRA 3WLPA 3QW4B 4DZIA 4F0KA 4CVWA 1E72M 2GVGA 2Y8VA 3G6LA 4TUFA 1TUFA 3WDIA 1ODZA 1TUXA 2VFDA 4PUEA 5LNSA 1VB9A 1XKYA 2AGKA 4ML4A 4KFOA 4LRSA 1UC4A 3EDDA 3UU0A 3WMSA 2DZSA 4U2YA 1W9XA 3VE9A 3LB0A 3GNRA 1UD8A 2O9PA 4GUHA 1XV8A 1IIGA 5JU6A 3ES7A 3OP2A 1UUMA 3QY8A 3CLWA 3NIYA 2I57A 2XIOA 3WF3A 4S3GA 2V38A 2QDGA 4IXHA 1BEUA 3ARUA 4GKLA 3HG2A 4UFLA 3HM7A 3WN6A 2X0YA 3ZR5A 3D47A 5I3DA 1NY1A 1QI2A 3PHAA 1X38A 4ACZB 4HPXA 4L56A 4MFEA 5D05A 4WQ6A 3DYMA 3BMXA 3OZMA 2CLOA 4BFAA 5D2VA 3AICA 4O1AA 3NA8A 4MWAB 2JE8A 1V6VA 1H50A 2FPYA 4PL1A 3FA4A 3TOPA 2Y7FA 4NXSA 1S2TA 4O16A 1GQJA 2XU2A 4JTDA 3GG7A 5XIMA 4LUSB 3H24A 3K4AA 2GLKA 4S3BA 2QR6A 1CGYA 4X60A 4C5ZA 1XL9A 3EKZA 4MKVA 2ACRA 4MKNA 1KFBA 1VYSX 2YFNA 3QR0A 1CEOA 2ZFAA 5EMKA 4G9PA 1CGTA 4QBXA 1U5JA 2BTMA 4FLOA 2YDRA 3NQAA 4ZO7A 1RPKA 4P8XA 3DCPA 1XYMA 3KTSA 4CU7A 4DZHA 5FAJA 4FP1A 3LHZA 3BLPX 1T5AA 3JVAA 3ES8A 4ILSA 5B7ZA 5DN1A 1O5QA 1KQZA 4AWSA 2PLJA 4O8RA 3SGUA 2VCCA 4UNLA 1JULA 2CEQA 5BYWA 1LLOA 2O9TA 2P8CA 2PU0A 3TTQA 2ISSA 1RLCL 1UWRA 4WSHA 5EMUA 3AYTA 4IWWA 1N7KA 3TZNA 3NZPA 2PF8A 5KEZA 4QLJA 2I16A 4PR4A 3UVIA 2BY2A 2P50A 3W2JA 1R47A 1H3GA 1E1CA 3PUEA 1SZGA 1SJBA 5ABGA 3ZMRA 4NZ4A 4WR3A 4WSJA 1JUKA 5A6AA 2A2IA 3KCJA 3NQVA 1TELA 2F6UA 3FGCB 3L66A 2VURA 4L4PA 5AOUA 2V2CA 1DIEA 3TSBA 4M80A 5EB8A 1RK5A 3H7RA 2Z7KA 4YVVA 4EOUA 1TQXA 4EPKA 1FH7A 3W2MA 1W56A 5CGTA 3APYA 4JPGA 3GRIA 1KV5A 3MQTA 4LB3A 2XZ7A 4LTSA 3LPPA 2WNZA 3AMGA 1J4EA 5I00A 1P0EA 3VDCA 4FLSA 3E0IA 2FVLA 2NQHA 1KFLA 4MGGA 5L9FA 1R2RA 3TLQA 4JDYA 1I0BA 3E0WA 1QWKA 1XIDA 3MP4A 2VD8A 5BZAA 5A8OA 4UTKA 4JNMA 3DC0A 1XYFA 3VOFA 2XISA 1JNEA 3PTMA 4GABA 2FVMA 2OMAA 3WZ0E 1DV7A 3L4WA 1WOBA 1XYLA 2ZZ3A 3ELFA 7TIMA 4LUYA 3KRSA 2HBXA 4P8UA 2WYSA 1F05A 2F8QA 4CNNA 4X3ZA 2AL1A 4H9UA 2Z26A 4GC3A 4OOZA 4P8WA 3BICA 3K1DA 4QRNA 3PPGA 5GJPA 2VCAA 4CN6A 1NDWA 3G1HA 3TW7A 4US6A 1L8PA 1XD1A 3RMEA 3W1QA 5LA0A 3G1XA 3FAXA 4URIA 1M7OA 2YA1A 3NSMA 1K7EA 4GGBA 1FDYA 1EZWA 2E3ZA 3W7IA 4AX7A 3LCLA 4GY7A 3DFNA 3AZRA 1R9YA 2UWFA 4R88A 1KKRA 4D2JA 1W5NA 1X7FA 3APGA 1E0WA 3KBVA 4FF5A 3IS4A 3THCA 1W2VA 4XO6A 1BKSA 2QULA 2PGEA 3WLSA 2XVLA 2YB4A 4WKHA 2AQWA 2ZYFA 4RNJA 4JX6A 1W3KA 4UQEA 1Z8AA 2HQAA 3M43A 3BUVA 3IK4A 3PP7A 1IE7C 1QT1A 3E2VA 1KXVA 1V0NA 1HIZA 3GXPA 3C2FA 3NQ7A 2QXWA 1H0IA 3UWEA 4QJ5B 3T0BA 3WK3A 4F4RA 3WMCA 1TV5A 2OLSA 4LY4A 4JFUA 5E9AA 1REQA 4I3GA 1EP1A 4XZ9A 2YOCA 2OEJA 5FSEC 4TXEA 3N19B 2DZXA 3P6LA 3L2IA 4ZMGA 1QWGA 3M64A 4J40A 4PBGA 1QO2A 3KBJA 3OQ8A 3AS3A 3NGJA 2YX0A 4ZQCA 5LNUA 3TWBA 1W9PA 2CITA 2O7QA 3EWYA 3ANYA 4R7OA 5BXTA 2WM1A 3TUUA 3B8DA 5DRCA 3G1VA 1GKQA 1GCYA 3SQMA 6REQB 4W85A 3DU0A 2JK2A 3BAIA 4PTWA 2PZ0A 2GK1A 4ZA0A 1VRXA 1PVNA 3U6WA 3M0JA 3I65A 3TYBA 1ISXA 4LVGA 2WZEA 5F2LA 4BQ5A 2FVKA 1M04A 5I3JA 4K38A 1NF0A 2JGYA 4QLLA 2Y85A 2O4QA 4DZAA 4WDXA 1EJUC 3H7UA 4WDTA 2NT1A 3ZLHA 4GQBA 2FHCA 3EMCA 3W2NA 3GIPA 1WKFA 4PMNA 2WPBA 4M56A 3QF0A 2AMXA 4MM1A 5PTDA 4L4OA 2VYOA 3CWOX 4PMRA 2BFGA 4UQCA 1D3GA 1JDCA 4JCMA 4HBKA 5A8PA 4DHGA 2VO5A 1OYAA 1MEHA 2OQYA 3DYOA 3IUHA 2CXEA 2ZWYA 1ZHAA 3CMGA 2FZ8A 1QOXA 3A4AA 4KW2A 4MFDA 4J35A 1XD0A 2HS8A 4PCSA 1T41A 4TV5A 4HNLA 1HKWA 2OZ8A 3TZFA 3EWUA 3WSUA 3USBA 5C9ZA 1ME8A 3UETA 3RAOA 5TQLA 3EXSA 4EXAA 4R27A 5D2YA 3A13A 2NQ5A 3S5NA 1VEOA 4KCUA 4BF5A 1SW3A 4EWND 3ZJ7A 1V3JA 4RW5A 3DI1A 1A49A 3C86A 4ZFMA 5HANA 1UKSA 5HJYA 1FDZA 3KBWA 3ARWA 1JCJA 2DSKA 4Q8MA 2WOQA 2E1WA 3MHGA 1AK5A 2EG8A 2WMHA 3P2VA 1O5KA 4U31A 4GJ1A 4NX0A 4Y9AA 3W85A 2WHLA 5K4XA 3VNMA 3V1PA 3HQPA 4AW7A 3EWBX 5I6SA 1PWMA 1PEZA 1FP9A 2NUXA 3AZTA 5AC6A 4QNEA 4CGTA 4UQDA 2D2OA 2J74A 5LSMA 2NQ9A 2ACQA 3CEPA 1NU5A 3NJ3A 4XZBA 3H2MA 3QSRA 3L0KA 4JTUA 1EJTC 4Q4QA 4UQAA 1UYQA 1L2QA 3CO8A 4FXJA 2BG5A 3K8LA 5K4ZA 1K77A 3TA6A 3MSRA 3GAYA 3I3EA 2XVKA 1XIIA 2ZWZA 3EDFA 4TX8A 3FCPA 2ISDA 3EB4A 3UGVA 3J7HA 3O7UA 3WF1A 4WIWA 5T8GA 2HSAA 2PTZA 3WENA 2DFAA 3VNKA 2QUMA 1VFTA 4GUIA 3NR0A 2EAWA 3CS2A 3IJIA 1JCYA 1DWJM 2CBVA 4R3UA 1LRNA 3TJIA 5HMEA 3C56A 3TYAA 4LWWA 4HYVA 2JF7A 3CHEA 4MHBA 2OJPA 4DBSA 3W84A 2VR5A 3ARSA 3G0UA 4QS5A 2B0MA 3K30A 1XW8A 4JTAA 3M0KA 2J77A 4JTKA 4YNGA 4BF7A 3M16A 3UXLA 4ZSUA 1H7NA 4EXBA 2REQB 4MB1A 5HPOA 2I5QA 1RQEA 4DJEA 3W83A 3ARZA 3OIHA 1I6NA 3WJWA 1FWEC 1EQPA 3W2LA 4ATDA 3QV6A 4W9TA 3GY1A 3NTYA 2GJXA 2E8ZA 4LVDA 4UTLA 5H6HA 1JDFA 1EB3A 3FNDA 1W17A 4N9CA 4D8AA 3LZ5A 4CCCA 3T08A 1XIEA 3HQNA 1Q6EA 1EOMA 1JGMA 1YTKA 4PMYA 4C6OA 3BLDA 4QISA 2F2HA 3WCZA 4R7JA 1SO5A 3GKFA 4LCQA 2RJHA 2WVSA 1YW1A 1V8EA 3Q65A 1MEWA 4OU1A 4XBJA 3FHQA 4BHYA 3KL0A 1V3MA 2HNEA 4DQWA 1GT8A 4JKKA 3SGZA 4N9DA 5F1UA 3WFZA 6TAAA 2E8YA 4K1WA 1ONEA 5G4EA 3NG3A 1PYFA 3DG6A 4H9XA 5I03A 2EG7A 1RAKA 1I0DA 5AC8A 4GCXA 4IXXA 1UD6A 2ABBA 3HFTA 3PWGA 4N0RA 1F6YA 3L4YA 4GQGA 2ZRYA 1AVAA 1WZKA 4K7YA 3VFLA 1H0GA 3ITYA 2CC0A 1D2KA 1A5LC 3P8IA 3CH0A 4Z2JA 2BGQA 3C6CA 3SZ8A 3LSBA 1L6WA 2XH0A 4Q8TA 1EWDA 1PV8A 3LCHA 3WG6A 3EKLA 4O1CA 1RLDA 3MMTA 3FKKA 4IJBA 1PDYA 1C9WA 4I5XA 4OUIA 1G9HA 5D30A 1WAWA 4HMDA 1M68A 2JALA 2P0OA 3BZGA 1XDMA 1VJZA 1QPKA 2VOTA 3WK0A 3P82A 4A2SA 3ATYA 1A5UA 5HUOA 1M01A 3OHMB 1A5AA 1UWSA 3OYZA 5G5IA 1U2YA 2X8RA 4N2YA 1V93A 2E7FA 3GBEA 5F4XA 2E9MA 2ZUMA 2VZUA 2Y89A 3ITGA 4H6QA 2ON3A 3IV8A 3BZJA 4U3CA 3AU6A 3TTYA 1MDRA 3TR9A 1BGAA 3GDRA 1FRBA 4KT2A 3NPXA 1Q3NA 4ZOCA 3I4KA 4L64A 2NXIA 4QP0A 4HU8A 2OXNA 1WX0A 3ARXA 3TA9A 4MIMA 4RK8A 3CASA 1R3WA 3S9ZA 1YBQB 4S3JA 4KEUA 4CEXC 2YLAA 4HHLA 3NURA 3VO0A 1AD1A 5DBTA 5D8WA 2GJNA 2C91A 1FCBA 5CSYA 1OJXA 4W89A 2PCQA 3O07A 2I7GA 1Q6DA 1U83A 1IXOA 3FHAA 4M0XA 3DENA 1QHPA 4AD2A 4IGMA 2NWRA 3QQ0A 4KGLA 4IIBA 5I77A 5BW6A 4HPJA 1E6RA 5D2TA 4YVPA 2Q6ZA 2D22A 3BOXA 3URAA 3WDQA 2VFHA 2NVCA 4IPPA 3LBOA 2XDFA 3HF3A 4C1NB 1XYAA 5BU9A 1E6SM 3LCGA 4UR8A 3TX9A 1NOFA 1A80A 1E1FA 2A6NA 4IIFA 1ONWA 2BHUA 2R1KA 4ERAA 2ZX8A 2XIMA 2R91A 4A29A 3GNPA 4A3YA 2DUAA 2VQUA 2NWSA 1XG3A 1ENUA 3H2NA 1IT0A 3BJFA 4WKAA 1KTBA 3LGEA 3LV6A 5A8QA 4R5EA 3VK5A 3TDFA 4AIOA 3NQ8A 3LBCA 3VIIA 3WIJA 1IXQA 3WQFA 1UOKA 4E4PA 3F4NA 1CGWA 3AFBA 5AFDA 4TVCA 4O18A 1XLAA 3AIVA 3HGRA 4N9BA 1UKQA 3DN5A 3EOUA 1GVSA 3SECA 3WBEA 2BS9A 3S5OA 2ACUA 1R30A 4NX5A 3FYYA 4EACA 4PMXA 1RBOB 1XIHA 2PDQA 2BBFA 3BAJA 3HPXA 1C29A 1XRFA 1Z3NA 2QJNA 2G5WA 1IEXA 3QEZA 1AQHA 3E5BA 5TNVA 3KCOA 3I6EA 1BHGA 3ITLA 2ISFA 3BAXA 2OT1A 3PJUA 2VD9A 1HL8A 4LANA 4KWUA 1J01A 2JIEA 3KEHA 2FIQA 2V8ZA 2Y8UA 4K36A 1XLCA 2XHYA 4RV3A 2PCEA 4Y8EA 1WCGA 2OYKA 1YKWA 3GDKA 1FH8A 4LBRA 3NFUA 5LIUX 4D8LA 4IZGA 4BKNA 3GHTA 1MFUA 3TJLA 3H2AA 4MY9A 3U5UA 3UWYA 3VKAA 3IIZA 3W86A 1JFHA 1DIDA 5FCZA 3A4JA 4ZXLA 3DXIA 1DJQA 4UOZA 4PODA 2DQWA 4Z1BA 3GNDA 1F73A 5CAHA 3KX6A 4GI6A 2YCIX 3DESA 5CZ0A 5HJLA 3WYZA 1DIKA 3ZSSA 4O54A 5AC7A 2H90A 2PDHA 2W5FA 3AXXA 5D2XA 2ZC1A 4Y9NA 3F2CA 1UZ1A 2OZTA 2FTYA 3S3GA 3UXKA 2Y5JA 1ZRQA 1LJYA 1TJ0A 4DJED 3IAPA 4MKSA 3DECA 1VFOA 3CBWA 6REQA 1J5SA 3ABQA 1L2UA 2GDVA 4GI9A 2PDCA 3GXMA 3RDKA 1TWSA 2J24A 4ROPA 3VGHA 5C7VA 4FLQA 3FFSA 3ZR6A 2PA6A 3QZ6A 4Q4PA 4X0VA 1OEPA 1G01A 4QE4A 1V03A 1XC6A 4HNUA 3W9ZA 4RXGA 3KRZA 3CV7A 4MAZA 1T99A 3H54A 3P84A 1CB7B 1XPYA 4HZ7A 3MP5A 5A95A 4DF1A 3CC1A 4JDBA 5T9BG 4E4UA 4L1XA 1W9DM 3ALGA 1QK0A 2WVVB 1CDGA 3MA8A 3INPA 3AYSA 3CUZA 2OYMA 5I24A 4YYCA 4GVIA 2O92A 1T96A 1X8FA 4AG0A 1J8VA 3EWCA 3WQPA 4J5NA 4MWAD 4PUUA 2V3EA 5C9RA 3XINA 1Z7AA 1UIPA 2WZHA 3A6OA 4JKMA 3P0WA 3ZSTA 1IEIA 2QJJA 4QTGA 2VDGA 3LHUA 1TPDA 1CT5A 2OGYA 1XLHA 3QW3A 4QE1A 3GIYA 3CL7A 2D2JA 2J75A 4F3HA 4PUMA 1Q45A 3N4FA 1OF6A 3W7PA 1XLLA 1H51A 1ADDA 4U33A 4H2CA 4NL1A 4A22A 3BQ6A 1QASA 3EX2A 2X2GA 1HJSA 3WJYA 5C9UA 2AMGA 1QBAA 4OHQA 3RPTA 4L7ZA 2PZNA 4BCEA 3VMOA 1Z32X 2QKFA 3CWHA 2RAGA 1UD5A 5LXXA 1FWJC 4NY2A 4GY1A 3MUAA 3KP1A 1IEVA 3NOYA 4XD3A 1YPXA 1M53A 4ATWA 5AHIA 1E6QM 3BPWA 4EE9A 3GC4A 3R4IA 3QJAA 4DLMA 3CUXA 1E43A 1Q2SA 3U7VA 3UJRA 3WBYA 4GWEA 5ECUA 5M17A 2ZZ6A 3JS3A 5I3GA 3BGGA 5MF5A 3N29A 3P81A 5C2XA 3ZXWA 2WO5A 1G69A 3R94A 1QNOA 2ZXBA 1DIOA 3MBDA 2PP0A 4LS2A 3NO5A 3MYPA 1ITUA 3LDVA 3DBPA 3GH5A 3WQEA 5G1MA 3AZSA 3SFWA 4DWSC 3HPSA 5ABHA 1CZ1A 1WKEA 1VHNA 4M8UA 4HNOA 1LLZA 2QAFA 2QCHA 3CUIA 3FOKA 3WLKX 2REQA 3MT1A 4A8RA 3F2BA 2BVYA 1LQ0A 2X0SA 4NYYA 3FJ6A 2E5BA 4D71A 4LV4A 3KZPA 4XZWA 2A7PA 3GVGA 4NNBA 4PTXA 5ECVA 4F9JA 2UZ9A 4FMVA 1FCUA 1PJ9A 2NLYA 3LCXA 5FEZA 3GO2A 1YPFA 4S2CA 4WD0A 4XAZA 2C14A 1AQ0A 1JRBA 5AB3A 5LHFA 1S5VA 2YCJA 3RRAA 5CKSA 2GFTA 3NNTA 4FOJA 1FDJA 4MADA 3UG8A 1OC5A 3EWXA 3AIBA 1HJVA 3M0VA 3NCOA 2QJGA 2JEQA 2J7FA 1K9DA 4LC6A 2X1TA 2PI6A 1Q63A 3S0CA 3W7MA 1P6BA 2V5JA 3I6RA 4Y9OA 2GVYA 4PTVA 5HBFA 1V3KA 3U2EA 2DORA 3FKRA 4CQAA 2BXZA 2GVJA 4IIGA 1VD6A 4TTUA 2C0HA 2CCRA 1DJYA 3U0HA 2ZA2A 4XBSA 3M9YA 1DJNA 3IJ7A 4AC7C 3ERPA 2HNHA 3VCNA 2CLEA 5I7GA 3WD0A 1TV7A 1VZWA 2DQXA 1TR9A 3ARYA 4O50A 4WVXA 4AZHA 4JQ3A 4XQ6A 1SW0A 4MLRA 1DJGA 1SFJA 3O8AA 4DJEC 4ERGA 5HK4A 1GGOA 1CLVA 3CHVA 3EEZA 4BWLC 1EO7A 1I2RA 3T8QA 1W0MA 3VX1A 2DGAA 2Z1KA 1QI0A 3UZWA 5KZ6A 2R94A 4KEMA 4RNHA 5D09A 1T0OA 2G37A 1Z69A 2YL6A 5CJ5A 1NFBA 4M1RA 1DQUA 1T8XA 2TSYA 4MG4A 3M07A 3S6OA 4R34A 4DEFA 1GKPA 3OGSA 2YCLB 1OX6A 3LRMA 1W31A 2VGIA 3UF9A 4BEUA 2CWXA 1K6AA 2E9LA 4FF7A 4QXIA 4PB5A 1V6XA 3BCFA 1BQCA 2DZWA 1EYEA 3WUGA 4EXQA 3W70A 5M5DA 3N34A 4XUYA 3R25A 4NZ3A 1B4KA 1J10A 4JYDA 4KWVA 2ZUUA 1UMYA 4MWAC 4FAMA 4E2DA 1UQZA 5TAOA 3BANA 3M7WA 2HVOA 1ZNNA 2J8FA 5E6ZA 3W7JA 1JR1A 5FF4A 4O11A 1FWNA 2VEIA 1MMFA 2WHJA 3M7SA 1JI1A 2NSXA 1H1NA 2W67A 1JQVA 4IICA 4Z2LA 1AW2A 1DJIA 1QOPA 1EGZA 4OVXA 3R8GA 4ROQA 1M1BA 2DDXA 2WMJA 1S2WA 3NAVA 4JN7A 3L21A 2GDQA 1EC7A 2INZA 1EL3A 1OK4A 4Q6JA 5KZEA 4OGZA 1R46A 3VNIA 1XWYA 4QAWA 1IF2A 4K68A 3PWAA 1XG4A 1IGSA 2Z4GA 2C7FA 3M1ZA 3SADA 1WDSA 1XPGA 4AX6A 4PE8A 1GOXA 3URQA 3MI6A 2YA0A 4H9TA 4NNCA 1X6LA 5E93A 4MNMA 3IANA 1GOMA 1FXPA 2G3FA 1TA3B 2Q3OA 4UR7A 4PSRA 3SQLA 1JIBA 4LVBA 4FOUA 2YA2A 1HVXA 3OYXA 1XIMA 1IIHA 3IAQA 2WJDA 4AVNA 5U7SA 1EH9A 4D6EA 2MUCA 4HTYA 3W7QA 1K70A 4BQ2A 2HRWA 5EBUA 1HGWA 2WKGA 3N73A 3W26A 1B2YA 4NJJA 3QYSA 4HVXA 4L9YA 2R14A 2CIPA 2PUZA 3EOOA 3IJDA 4FNPA 3AIQA 2RJGA 2D73A 4LS1A 2GQ8A 3PUGA 3PZTA 1GQLA 5I2UA 1R9ZA 3G1FA 1C93A 2O55A 3VGBA 3TNOA 4CQBA 1S2VA 3NOEA 1JFXA 4GFIA 4E2VA 1F3XA 3T0TA 4H8NA 3FYOA 1GYMA 5CC7A 4PBFA 1BTCA 2F61A 5A94A 2VNCA 3N04A 2RKXA 1VH7A 2GJRA 2Z2AA 3L4XA 2XVGA 1ZUAX 1FWDC 3TC3A 4DXVA 3AIWA 3NXLA 5FJOA 3LTYA 3QKZA 6CGTA 3R0UA 4KESA 5CPTA 4WY0B 2VMFA 4KCWA 1AMKA 4OIFA 2J7EA 4B5UA 1YNYA 4HU3A 3LA4A 1CLXA 1KR1A 3N25A 1H5YA 4UTTA 1NH6A 3MVTA 1V79A 3S47A 4NHVA 3VKBA 5DX7A 4X22A 4CU8A 2DV0A 3VM5A 4MTVA 4I90A 1XJBA 5FI8A 1WDRA 1K8ZA 2BSLA 6PTDA 3AU2A 3ZS4A 3THAA 2PE4A 4RE0A 4LW7A 3N18A 5IBXC 3RCMA 1P0NA 3B8SA 2VQTA 5FF7A 3I7SA 4F40A 1MI3A 1XQLA 4LBSA 1LRTA 3RYSA 4Q8WA 3W7NA 3SQSA 2H3BA 3MWAA 3QOMA 1TRDA 1TJ2A 3B9NA 4B5SA 5BXPA 4PTMA 1UD4A 3IV3A 1O7AA 4AH7A 1D7FA 2WVVA 1L6FA 5FF3A 3GS6A 2VRKA 1OM0A 3RCNA 5A6JA 3ARPA 2CZFA 3PG9A 1SPQA 1XBYA 4UTWA 1XIFA 1Z42A 3UG5A 2J88A 1XFBA 3GE7A 4Q4OA 5C71A 2QLYA 3MW7A 4WX2A 4JIHA 4Z2IA 5BRPA 2CLMA 4MPQA 3TK7A 4RZ6A 2Y0FA 2IXUA 3IACA 3PBMA 3KL5A 1W3TA 3UBPC 4LFYA 3WQ5A 1UBPC 1FHDA 3O6CA 2CLHA 4HNTA 1EX1A 2OODA 3M5VA 1UMLA 1SFTA 1NARA 4HJFA 1ZZMA 4QSFA 3LM7A 3SRFA 3TFXA 1SMDA 2RDTA 3FVMA 3RO6A 2E4TA 1E51A 1O4UA 4CD6A 4S3FA 3LNPA 2PLKA 1AQFA 2X0HA 3GX9A 3IVSA 4CNPA 4M6PA 8A3HA 5J04A 1BG4A 2WNWA 3OA5A 2NXHA 2PWUA 2WWCA 4MSSA 3MO7A 3SCQA 3VMNA 3R10A 4I7UA 4JFSA 1SYTA 3VD5A 4RDWA 1MDLA 2QF7A 4CNSA 2CZEA 1GNXA 5H1WA 4JKLA 1NWTA 3GVVA 5BMWA 5FSDC 1H7XA 2CZVA 3EOSA 2D0GA 4H3DA 3LTSA 3A21A 3AALA 4DZ5A 1TJPA 5E70A 3CT2A 1TX0A 3C8NA 4JFVA 1TG7A 1WKDA 3LX9A 3RO8A 1XSIA 2NVAA 1OFBA 4UQBA 1H7PA 3MMDA 4J9JA 2NV1A 1JXJA 5REQB 3N2BA 1N8IA 9RUBA 2DJXA 4YCOA 4S2BA 1OFRA 2QQ6A 1UH3A 2D23A 4L6DA 2FTPA 3AMLA 1NP0A 3F5JA 2OWWA 1BPLB 1H09A 1CWYA 4F0MA 4JQ1A 2A5HA 1RJQA 2QPSA 3TTEA 1P4CA 4Z0JA 1KO0A 2PD9A 2DZUA 4N02A 3TC7A 2GGJA 1QHZA 1V3HA 4CCEA 3T2QA 5CLTA 4D1JA 1Q66A 5B7YA 1TCDA 3URBA 2Y7EA 3NDYA 2E6YA 1EJ7L 1VFMA 1UWIA 1E71M 3OGRA 3W4RA 4AD3A 1ZBWA 3W1UA 1D8CA 3V0TA 3R6IA 4O4VA 4IIHA 4WXYA 1B3WA 2IS7A 3IARA 2Z1WA 1OQFA 1LOQA 4QS6A 1OZMA 1K9FA 3MV01 2E5CA 2J8TA 5FF2A 4MYAA 2OLHA 4NZ1A 3SCRA 3GVRA 1GONA 4B5VA 3EPNA 1PZ1A 2E40A 3L23A 1P7TB 4HJWA 3VU2A 2VEGA 1CTNA 2VUNA 3STEA 3TAKA 2DIEA 4W8AA 3H2FA 1JEZA 4KCTA 3UEQA 2OT0A 1IWBA 1J79A 1LL7A 1UH4A 3AMDA 2ATSA 1OCBA 2ABAA 1Q6QA 2EF9A 1PCWA 4IF2A 4HTBA 4Q8NA 4LAKA 1WDDA 2Q02A 1F4HA 1UWUA 1N8WA 1P0BA 2GYIA 1PKYA 3BDKA 2ZADA 3MUIA 5EY5A 3E38A 3O6YX 1TIMA 3C2VA 4I9JA 5AYZA 1NTHA 4HSOA 1G4TA 4OBSA 3E5PA 4NU7A 4JR5A 2XIJA 3VKCA 3LXAA 1BXCA 1PBGA 2QF8A 4A4AA 4XBKA 3APTA 1HO4A 3ZJ6A 1XUUA 3R12A 2ZDRA 2FJUB 4RE4A 2PSNA 3T7VA 2Z6IA 3GDLA 4U10A 1JYVA 4R85A 3MSDA 4FR1A 2X1UA 4HZMA 4C6EA 1HP5A 2PDKA 3ARVA 3BJTA 1V77A 2XGIA 1BYCA 4ADUA 2EPKX 1G5AA 2YBUA 3PK7A 3DG3A 2PGRA 1LWJA 2J62A 1OGSA 3PBUA 1BQGA 1MW0A 3UY8A 2J7DA 4C6PA 1J6OA 2ICSA 1OBAA 1HNYA 3S1GA 2ZQ0A 2HS6A 2Y8KA 3N4EA 3KS6A 1PHQA 1XLBA 5M03A 1ZY9A 4M3PA 2POZA 2YCLA 2VEPA 2WWDA 3N9RA 3SCTA 3GLCA 3RIKA 1YIXA 3VD4A 2YCEA 3E3HA 3W00A 3A24A 2B4GA 1HW6A 5DFAA 3QMSA 2X7VA 4GYKA 1XDLA 2VR2A 3KFTA 4A6GA 4PCFA 2FGLA 4V1XA 1RPXA 2B31A 2P8BA 4GXPA 3ZOAA 1F6KA 3SCVA 3BOFA 3OVRA 3WH7A 1TVPA 4XKMA 5IFTA 4CU6A 2FH8A 1AH3A 3B97A 3AWOA 1H1YA 3V5FA 1GTEA 1J2BA 3CLMA 4O1DA 4UTHA 4M5PA 3QPEA 4ZB0A 2YBTA 5EA9A 3LPGA 3UD6A 6A3HA 4AZGA 1JZ3A 1J96A 4ZQPA 1DL3A 2VENA 4H4IA 4EF9A 2KAUC 4DIAA 4IMGA 2XJ7A 4QX4A 4OV4A 4BS0A 4EX4A 1W5QA 4RDVA 3UFYA 3STGA 4GY0A 1XLMA 2XGZA 2VC6A 4C7FA 4UB9A 1TO3A 3WBWA 4Z1DA 4B3LA 4WJEA 5BCAA 4O0KA 5CZJA 4DWDA 4N4PA 2Y1HA 1XLEA 3CTTA 2C18A 4QDWA 1GKRA 3RX2A 4CQCA 3WNPA 1K03A 1PZ0A 2GOKA 1TA3A 3NZQA 3LM3A 4JIEA 1JYNA 3B4UA 4AMAA 3W7GA 2VR4A 2VXNA 4EKJA 3FA5A 5DLCA 1E5NA 1JL8A 1W9UA 1KRCC 4IPNB 1IV8A 1DJXA 2G41A 3EX4A 1E9LA 2CFFA 3ZWSA 2HK1A 1P5BA 2J4GA 3BC9A 4NASA 2G3NA 3O0FA 1US2A 1RZMA 4OT7A 1KM5A 2YZ5A 1WO2A 1LCOA 1VS1A 1YXYA 3DFYA 5G2HA 4E3TA 3GDMA 5H2ZA 5A8NA 1XHGA 4LOCA 3T0DA 1K8XA 1B4EA 3GHSA 3TN5A 2B7NA 2C8NA 1POKA 3VINA 3LI1A 3KOFA 4GQ0A 5CLWA 1KA9F 3RX4A 3PZQA 5CBBA 1E6XM 1EJVC 1PCKA 3OA3A 3NO1A 3ZVHA 1DWHM 5LXEA 4XVEA 1E4MM 3CAQA 3EGJA 3HPZA 3GQYA 1H61A 1JPIA 5CPNA 1MNSA 5LIKX 1UUOA 3UZ5A 4WHBA 2AKZA 2E25A 4H8UA 2GDUA 5IOBA 4LB4A 3PULA 1S2AA 4QNWA 3QGVA 4LT9A 3U8GA 3QOKA 1TWIA 1S5NA 3WMBA 1SGJA 3UW6A 3PM6A 3AROA 4AZBA 3W88A 4JHZA 2PEVA 4QQUA 4G8TA 3MDWA 4HU0A 3WX7A 3RNDA 3MPGA 3ZO9A 1V4YA 4LBUA 2OG9A 3M5XA 3VDBA 3N15A 4NRSA 3S46A 3QC0A 4GIYA 1UR4A 2DT1A 2G50A 1XXXA 1RBLA 4AD1A 4QGCA 1I75A 3MC5A 1V0MA 3KM8A 2OFJA 2A3HA 1R3SA 4W8LA 4XD4A 3MUXA 4H19A 1DHKA 2EO7A 3H4XA 1DQXA 1UQYA 3C0LA 5C2GA 3LQGA 4GBDA 2Z00A 2QNEA 3UZJA 3AJXA 1VYPX 1MRQA 3XIMA 3UG4A 2OO0A 3ITTA 2PC8A 3UVAA 2WC7A 3S1WA 1F07A 3V18A 4ZB2A 4GKTA 1K4GA 1EOKA 3HZ3A 2J66A 3MI3A 5CJNA 3WH6A 3A9IA 1KM0A 4F48A 4XKYB 1SJDA 1HGYA 3QTPA 3MUZ1 2VP8A 1TPEA 1LP6A 1KGUA 1LBLA 3GH4A 4DB7A 2EPLX 3N3TA 5G1YA 5BWAA 2YGYA 3AUOA 3MU7A 4K3ZA 5TIMA 4LH8A 1ZBKA 3VDHA 4LF1A 2PB1A 3FDKA 1SQ7A 4PMUA 1OC6A 2QCGA 1XFCA 3U48A 2FFCA 4MNKA 2FLIA 3TH6A 1ZAHA 2XUCA 1QATA 4JY9A 2C79A 2R24A 1TSIA 3A3HA 4IMAA 1VPQA 4MLJA 5FF0A 3M44A 3OZPA 5ABFB 4UTTC 4HMNA 2YCKX 2PDUA 5IHRA 1LUCB 3CPUA 4L4LA 3KE0A 3WQWA 4Q32A 1NDVA 5AVHA 4UFJA 4WKFA 1XH1A 1OX4A 3HU7A 1AH0A 3DFSA 1OC7A 2VDIA 3R58A 1DP0A 2UY5A 3W38A 4GRSA 3SGGA 1CXLA 3OOQA 5AHEA 4KGJA 2V2DA 1ZBCA 4DRSA 5A3HA 4IQJA 1DJHA 2OVLA 3L65A 3TW6A 4M7SA 4FX8A 3DIPA 3KDNA 3VOJA 3WO8A 1HO1A 5REQA 5DMLA 4I9TA 4Z1CA 1IYXA 3PJWA 3R1ZA 4G6CA 3NSXA 1QPRA 1NDYA 5FIPA 3B0YA 3KOYA 3P60A 2VEKA 3WBAA 1XCXA 4JS3A 3PJXA 4UIOA 1N55A 3UPWA 3ABSA 4DUXA 4UTWC 2BGSA 4TVUA 1QUMA 1RCXB 4IQLA 4HK5A 1RUSA 1F4AA 4UMCA 4GIRA 3TMQA 2PF0A 1KFCA 1JZ5A 2GOUA 4HA1A 1QI5A 3VIGA 2E28A 2FTWA 1AW1A 3ZYZA 1XGZA 3WFAA 3V0SA 1GWJA 4KWSA 3FJ4A 4H9VA 3W1NA 1W6TA 5G1TA 3OO2A 5JIWA 1OZQA 5LA1A 3G8EA 2ALDA 2PDJA 4HQVA 2NVDA 1A3WA 4B91A 4Z2KA 3UR2A 3VOCA 3LQLA 4WDUA 5DMYA 4RCXA 5JH2A 3THQA 1L6YA 4DUOA 3LN3A 4E38A 4K8HA 1R86A 1B54A 2D1ZA 2QDDA 3K46A 1P7TA 2KZHA 4PTDA 4TMCA 1KM1A 2J9ZA 1UR2A 1GOIA 2FYMA 3M4HA 2AGTA 1XQKA 1C8XA 3P67A 2XPKA 4YU1A 2ONEA 4DBUA 1UUQA 5G4HC 4JEJA 4S39A 1XRTA 1H63A 3VABA 3G8RA 1RP9A 2F6KA 1VBJA 2WXDM 4ORIA 4WRHA 1WA3A 1PX8A 4KRUA 2IKHA 2OQHA 5FESA 1C7TA 2BOGX 4GNJA 1KC7A 1NWUA 1HG3A 1R5YA 2X2YA 3PN8A 4OUEA 3K13A 4B2DA 2YJQA 2J7HA 1BVZA 2V3FA 1TTQA 4GQQA 3WLHA 3K5XA 2FZBA 4KFPA 4GH3A 4Q8PA 3S6TA 3AO0A 3LERA 1W1IE 2OWCA 2P5NA 1EGMA 1YDVA 1MVYA 3DAQA 1MQQA 2VEFA 1LL4A 3GG0A 4JY8A 3QR3A 1KFEA 5EFFA 2NX1A 3V0UA 1QRQA 1W8GA 3FSUA 3LLFA 4H9MA 4NJIA 3L67A 3UXIA 2XN0A 3BSMA 4X63A 3M41A 3ZZ1A 5M3WA 2QCDB 3VUPA 3PR2A 4NZFA 5DO8A 1S2UA 1YPIA 1YDOA 3BGAA 1KB3A 1PE1A 4MB4A 1VIZA 1EC9A 3S4TA 3NZRA 1NSJA 1U30A 3PNUA 2QUVA 1X97A 1YEYA 3IRSA 1VHCA 1VCFA 2WBGA 3BAWA 3QV7A 5LIWX 1ISVA 1EIBA 1IXPA 2XN1A 3GHUA 3KUMA 3MUCA 3Q4DA 4N42A 1WQ5A 1NVMA 3P5YA 1YTDA 3T09A 1M6JA 2Y5EA 3EA1A 1ECEA 3V1HA 3D0CA 2QMJA 3I10A 1DJWA 2W79A 2PDXA 2WAGA 4IGHA 2PRMA 2ZRWA 1V02A 3RF9A 1BYAA 3GWQA 4WEVX 3ZLGA 1MYRA 1B30A 2VVSA 4GLEA 4CD7A 3L12A 4H01A 1ODUA 3LSCA 2WB5A 3WF4A 3TTOA 1MW2A 4W7WA 4Q8VA 1PIIA 4JOMA 2XVPA 3G6MA 2HXTA 5I0DA 3WQCA 3WNKA 3DKJA 3FK4A 1AG1O 3W28A 1D8WA 4GPNA 2C1IA 3PTDA 3GU1A 1WBHA 2NLIA 1KTCA 2B7PA 1LT7A 4GCAA 4XX6A 1TX2A 4W7UA 1E0VA 3OZYA 2YB1A 1QJWA 4ZO9A 4DWSB 1UR8A 3PZ9A 1JCNA 3UYCA 4Q4RA 3VM7A 3UA3A 1IHIA 3QVQA 3V7PA 3ECQA 2CU0A 2FHBA 3G5EA 3XISA 2QUUA 1SFSA 3KWSA 1HKJA 1MFVA 5A8GA 2VHLA 3N6QA 2QCFA 4C6NA 3SRKA 3ZVIA 5CSUA 2VKZG 2A6LA 4J1OA 1A53A 3FXGA 4UCGA 3O16A 4JTTA 4F2BA 4FEZA 1A5SA 4Q8UA 4G7EB 3U3HA 2O0TA 1XRVA 3BCJA 4J3XA 1Q13A 3IUDA 5FEPA 4DELA 3U4AA 4IH3A 3S9YA 5LIYX 3GG8A 2GSJA 2XVNA 4HPNA 3GDBA 4DUVA 2C13A 1UIOA 4IM4A 1NDZA 4RE2A 3RMJA 4ATLA 3W37A 1ISZA 1ZPTA 4AZCB 3CPRA 4NIRA 3R89A 2FQIA 2Y24A 3BK0A 1EJWC 3V35A 3LHWA 1PPIA 5HUPA 3QPZA 3ZIZA 3REQA 1G67A 4HCHA 3MJMA 1NWRA 4J7RA 4CCZA 3VZZA 1WXZA 5BXSA 3HJZA 1ZJAA 3SW6A 4GXWA 1RHCA 4B4FA 2UV8G 5DCEA 1XX1A 4OJYA 2WKJA 3L2LA 4A35A 4B15A 3HIJA 2WNNA 3C3NA 4K37A 1ZP4A 1FWAC 4AEEA 3WF0A 5EMLA 3W53A 3GC5A 2VJXA 4GZEA 4F2TA 4QEEA 4H6KA 1BWLA 4L61A 2CLFA 3TSDA 3B8TA 1Q6FA 3LRKA 4Q8OA 3AMCA 3BTNA 4AZ5A 1ZAIA 1OIFA 3PF3A 4C1LA 4K8GA 1W2PA 3LY0A 2OTDA 3VXGA 3RLUA 3AOFA 4HNVA 1X39A 1CBGA 5CC3A 4L6OA 4I5RA 1U22A 3N2XA 5I07A 1NWSA 5JBDA 2YYTA 1UOZA 1TQJA 4HA0A 5TD4A 4U4MA 2VGGA 4AHOA 1RY0A 3EPMA 2CBJA 3ZJ8A 4V1YA 5EU9A 4BR1A 1ITXA 3W6YA 1CXIA 1W5OA 2ANUA 1WP6A 4XAPA 1XI3A 2AQOA 1VCVA 1VBHA 1YXCA 4LEQA 3FDGA 3DHPA 1THFD 4KWWA 4JL1A 5CC5A 1C8QA 2XTKA 3PSWA 4E2OA 1SM9A 4TOQA 1VFHA 3T07A 4XKYA 1XF0A 4XAYA 3IVTA 1DORA 3E0VA 2J25A 5LZLA 5C9WA 3HG3A 2BY1A 4B2DD 4YJ5A 3QQWA 1JZ8A 1O68A 3KZSA 2GUYA 2V63A 4ORMA 3R7MA 3ME3A 3URNA 3SY5A 1OK6A 5LGZA 4L80A 3CH9A 3DERA 1SO4A 4ZQOA 1I1XA 1E9YB 3LTPA 3MMWA 5KETA 2PRLA 3T42A 1SFLA 1HKMA 2E6DA 5G2WA 3VIHA 3EBVA 2NQLA 2RGMA 3PY2A 3TW9A 1XGEA 4Y90A 2FFIA 2OGJA 1W32A 3HGSA 3OTRA 1UWAA 1U33A 4S1FA 1LUCA 4DAIA 4C6LA 3W7HA 5AZ1A 5CBJA 5AHFA 4K7VA 3JUGA 3WQGA 4M7TA 3EOEA 4B9YA 3LMYA 1JGIA 3VI2A 7REQB 2X40A 3EEGA 2V5LA 1OX5A 1VJIA 3AXMA 1CGVA 3HPAA 5FL0A 3ZM8A 1UR0A 1QNSA 5D04C 4Q7BA 3AXKA 4AF0A 2X41A 4JTFA 1BRLB 1K02A 4AXNA 4IP4A 4Y9MA 2YL8A 3CQHA 5K9DA 4JTLA 4H6RA 4M6VA 4DPQA 1K8YA 3ZT7A 3N1AA 5HATA 3OG2A 4UTIA 4P7RA 5T26A 4WGXA 1FWCC 2QVNA 1R3TA 3IJ8A 5CGMA 2GVLA 4CUCA 1TCMA 1ZCOA 3PZGA 5XIAA 1UJQA 3EDKA 3POHA 5C5YA 3PVFA 2QGHA 2QW5A 5IRPA 3SCPA 4JX4A 4XV0A 1FWBC 4CNOA 2VGFA 3WD2A 2VUYA 1WZAA 5CBIA 3NM3A 4YIWA 3HJEA 4LYKA 3KTCA 3VIKA 5AKQA 4ZTYA 3WJZA 1K4HA 3OIXA 3WUBA 1YHTA 1AW5A 1F74A 1QTWA 4OFCA 3BURA 1QW9A 4JFTA 3MBFA 3KS5A 3BSHA 1VFFA 3F2DA 1ISYA 4KKXA 2DZTA 3EZ4A 3T1GA 4WJ8A 4AQLA 1ZBVA 2WHMA 4XD6A 2BY0A 3G0SA 3ARRA 2EEXA 5IFPA 1H5VA 5CQ1A 2PWDA 1HP4A 3VD3A 4W87A 1E6NA 2WSYA 3UWQA 2ZVRA 4L65A 1Z41A 3W24A 1DKWA 4E0CA 1Q7QA 2CERA 3GTHA 3DHUA 4DO6A 5IDZA 4S3DA 2W6RA 2A3LA 1K3UA 4LRTA 3DFTA 1LLWA 3PZMA 5G2IA 1DJZA 2E5DA 1GVEA 2E68A 3H21A 4DNHA 3CZKA 1AFSA 4C1KA 3VAVA 2Z28A 1JXKA 3AISA 5GQBA 1XSKA 1X8CA 1NAL1 1S2CA 3MTWA 4DYEA 3NQ6A 2ISVA 3HG4A 4QM1A 5CG0A 1J11A 4UTJA 3CMJA 3G3MA 2DZPA 3WJSA 4YL2A 2PGFA 1JD9A 1US3A 1M9HA 5FOOA 5ABEA 2BOFX 1E40A 4PCTA 1U5HA 1QW8A 3L5MA 4K39A 3T05A 3SCWA 2D20A 2L5HA 1H11A 1UKPA 4DPPA 3PAOA 1KFWA 4TO8A 1A5MC 4UOJA 3ICJA 3KBSA 4MJZA 3QHOA 1EXBA 4IJCA 1I2OA 2ZUVA 4X2RA 1G4EA 5HWNA 1S5WA 3QGKC 1KGWA 5CPOA 1G94A 3RU6A 1TB3A 1EUAA 1Q6CA 4ZXOA 4RDYA 8CGTA 1ZALA 1V7YA 3DFQA 1EHAA 1HF6A 1JYXA 2OX1A 4TTGA 5BOFA 2XM2A 3NDZA 7ODCA 1JZ4A 4HHMA 3MSGA 4LAZA 4H2HA 4C65A 1UASA 2Z6JA 5HULA 4J4KA