4F2UA

Structure of the n254y/h258y double mutant of the phosphatidylinositol-specific phospholipase c from s.aureus
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
304
structure length
304
Chain Sequence
DSLSKSPENWMSKLDDGKHLTEINIPGSHDSGSFTLKDPVKSVWAKTQDKDYLTQMKSGVRFFDIRGRASADNMISVHHGMVYLHHELGKFLDDAKYYLSAYPNETIVMSMKKDYDSDSKVTKTFEEIFREYYYNNPQYQNLFYTGSNANPTLKETKGKIVLFNRMGGTYIKSGYGADTSGIQWADNATFETKINNGSLNLKVQDEYKDYYDKKVEAVKNLLAKAKTDSNKDNVYVNFLSVASGGSAFNSTYYYASYINPEIAKTIKANGKARTGWLIVDYAGYTWPGYDDIVSEIIDSNKLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 1-phosphatidylinositol phosphodiesterase
publication title Competition between Anion Binding and Dimerization Modulates Staphylococcus aureus Phosphatidylinositol-specific Phospholipase C Enzymatic Activity.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 114
structure length 304
sequence length 304
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 2012-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 4f2uA00
3RLGA 7PTDA 2OR2A 4F2BA 1T6MA 4Q6XA 4I8YA 4PTDA 4GNKB 2ISDA 1DJGA 2O55A 1QATA 3QVQA 4I90A 1V8EA 2F9RA 2FJUB 3EA3A 1GYMA 1PTDA 4QJ5B 4RW3A 1ZCCA 5T9CE 3I10A 1DJXA 3MZ2A 1DJIA 1DJHA 3CH0A 4I9MA 1DJYA 4F2TA 4QJ4B 4S3GA 3PTDA 1PTGA 1T8QA 4RV3A 2P76A 4I9TA 4RW5A 5PTDA 3H4WA 2PZ0A 4R7OA 2ZKMX 2OTDA 6PTDA 3V16A 3V1HA 3NO3A 3EA1A 2PLCA 3KS6A 3QR1A 1VD6A 4I9JA 3OHMB 1XX1A 3L12A 4OECA 4F2UA 2PTDA 5T9BG 1QASA 3H4XA 5T91A 4QJ3B 2OOGA 3V18A 1DJZA 1AODA 1YDYA 3QR0A 3KS5A 3EA2A 3RLHA 1O1ZA 1DJWA
chains in the Genus database with same CATH superfamily
4UR9A 4NNCA 3OIHA 2XIMA 2ISWA 3NAVA 1QU4A 2QDEA 1X1OA 1DP0A 3Q65A 3QHOA 3QOMA 3ITXA 1OYBA 1K02A 4YVVA 3G1RA 1EGVA 3GDMA 3RITA 4YIWA 1QO5A 2VEPA 5JU6A 2DV0A 1RQBA 1YNQA 1XH2A 3ONCA 4RDVA 1EJ7L 2F6KA 2DT1A 1M04A 5CJMA 4YWSA 1XXXA 3F7JA 3N6JA 1CTNA 3M6DA 4H9YA 4GO8A 1MRAA 2G37A 5DANA 3UR7A 3T8QA 4AH7A 1Q6QA 3WBEA 1I45A 2VRKA 2J7HA 4ENLA 3P67A 1G4TA 1ZALA 4XSMA 3PSWA 1H4PA 7REQB 1QWKA 3GTIA 1FH9A 3LZ3A 1SVDA 4UIOA 3VIGA 4BWLC 1R3RA 2CLKA 4ALDA 1A5UA 3HM7A 2VX5A 1FWBC 3CAKA 1ZAIA 3G1XA 3O6CA 3W7OA 4B5NA 3PUGA 4WDWA 4IMGA 3VFLA 5DMMA 6XIAA 5DMYA 1YPFA 3C2YA 4FNQA 3TN4A 3UXAA 4Y9AA 1ISVA 3QF0A 1A4LA 1JZ7A 5F2GA 5CPMA 2ZWZA 2PGFA 2BHUA 4K1GA 4J9JA 2X16A 1MO0A 4ML4A 4GCAA 4Z2IA 1EKOA 3B04A 3EDFA 1XYZA 3PFMA 4PB4A 4KPLA 5B80A 2BZNA 4MJMA 2WMIA 3M0JA 4Z42C 1B3YA 3HN3A 2DORA 3MC5A 2O4QA 2QYGA 5I3KA 2BGQA 4AHQA 1F7BA 1XBZA 3O15A 3OA5A 4NJGA 3G0XA 4QSHA 4Y9PA 5HUOA 4TTUA 1K8XA 3CPGA 4Q8PA 2EPKX 3DOPA 5IOBA 4O18A 2A3CA 1OIMA 1P0DA 5HJLA 3P62A 3SB0A 3GR8A 2Z24A 3PULA 1FVPA 1JDDA 4Z2LA 1E0UA 4LUSB 1K7XA 4GXWA 4C6CA 4GQ0A 4A4AA 1XLDA 1EZ2A 5CAHA 4HPNA 4JPGA 1KFKA 2QCDA 2BLEA 1TTQA 1SFTA 1NTHA 1KCXA 3GXMA 2C0HA 3QZ6A 1E43A 3CZ8A 3WUEA 3LG3A 1PEZA 2J6XA 3WQPA 4XD3A 3TW7A 2VQUA 4QJ3B 1H0GA 1PO9A 1V0KA 3TH6A 3L66A 2BSLA 2Q6ZA 4AIUA 1YXCA 1JD7A 3DU0A 1RY0A 3NO1A 8CGTA 4I6VA 1KM1A 3TAKA 4IPJA 4CNOA 4HGXA 4L1WA 3F2DA 3WEOA 2HS6A 2OQYA 2PWFA 1FH8A 2VFEA 2VTFA 3QC0A 2C13A 4PUWA 4UNKA 4JR5A 4F9JA 3QPEA 2Z29A 3IGUA 5AHIA 4BJHA 3MWAA 3LHYA 3M6YA 1Q45A 1X1ZA 3E5PA 2OFJA 3F4DA 3B40A 1GOMA 3FHQA 2V5LA 1KBBA 1ADSA 3FDGA 2W61A 2GQAA 4GRSA 3T05A 1LYXA 1W1VA 2PF0A 3WK3A 2G8ZA 4EIVA 2OSWA 1QBBA 1XYFA 2C3ZA 3FA5A 3G1VA 1EA0A 1XLBA 4BF9A 1V5XA 4L9ZA 1GZ1A 1W17A 4LT9A 2UZ9A 1XF0A 4DO7A 4PSPA 1Y5XA 4QLKA 3LHUA 3BLLA 4PCFA 3EYPA 4QX4A 4E3TA 1QT1A 4O54A 3BO9A 3TLQA 4UXDA 2DUZA 3P84A 4DBSA 2VZVA 2GQ8A 3TNBA 4BZYA 3EDEA 2CFFA 5JQ9A 3IS4A 4Q6JA 4HA0A 4N02A 3H8AA 4GYFA 5EBAA 2X0YA 3JRKA 4HNOA 3PZTA 3BXWA 4Z0SA 2E0PA 5FJJA 5REQA 2INZA 4V33A 4M0XA 1AW2A 4IJBA 3TR2A 3WBAA 2WANA 1T6MA 2CC0A 2I7GA 1UIOA 1PZ2A 1JFXA 2XH2A 4GKTA 1QNVA 3F03K 4KCTA 4DZ5A 1JD9A 5CPLA 1KFEA 3DFHA 5FEZA 4GI6A 4L7ZA 2FMOA 3JUGA 5A6LA 2OWCA 4UZSA 2W3ZA 4OE7A 5I23A 5E9XA 1XPYA 2DP3A 3M9YA 4X22A 4EACA 4X0VA 3SUVA 2A2IA 1W1IE 3TYBA 1PZ3A 1RP9A 1V02A 1WDSA 1YRRA 4H00A 1DHPA 4B4HA 4HU4A 1L6WA 2C8NA 3NZGA 3WD4A 3L5MA 4WSHA 5LZLA 3WBXA 4K37A 3FW6A 1R3SA 1GQKA 3A64A 3PPCA 3NTYA 3MP5A 2YZ5A 2OZ0A 2VGGA 2X42A 1C8YA 4MB4A 3WBYA 4MNLA 1FDYA 1IIHA 5AECA 2CKRA 4PODA 1HG3A 1E6NA 4NQ1A 3ITYA 2NXIA 3SRFA 4O50A 2OOGA 2NLYA 1IR2A 3GUGA 4MADA 3MBFA 2QLYA 1WX0A 4J7RA 3NGJA 1ZL1A 2PDCA 5D2XA 3E0LA 3KE0A 5FF2A 3RPMA 1QPKA 2BXZA 4CQ9A 5LNSA 3RF9A 2BASA 4RNJA 4FF7A 5C7VA 3K4DA 3E0IA 4Y2WA 3W7LA 3ZXWA 3HPAA 3R6IA 2WXDM 4PMRA 4GUFA 3CC1A 1VYPX 2R82A 4ACZA 5BZAA 2PBGA 3PBYA 1UH4A 2HRWA 3PTQA 3C61A 1WDWA 4AG0A 4TVUA 4H8VA 4A05A 1BSIA 3BLIA 1JGIA 2ZOXA 3PR2A 1GKPA 4D6IA 2NQLA 3RMEA 1JR1A 1PTGA 1V6TA 1JXJA 3M07A 3HQNA 3CO8A 4C91A 2XJ7A 4DIAA 3W27A 1XFCA 4XO7A 5BXTA 1VFFA 1YDOA 5FCZA 1BG9A 5A95A 1O68A 4KFNA 3VILA 1OCNA 4QG6A 1PX4A 4C6IA 2XVNA 1GOIA 3E5BA 3JR2A 1YNPA 1WKYA 3BAIA 3R79A 3QHNA 1Q13A 1S5TA 4MMWA 4AW7A 3AZSA 4BQ5A 1UPMB 3L4ZA 4YTRA 3AUJA 4K7VA 3STCA 1XIDA 1DJZA 2PDMA 1YNYA 4K8EA 3VCNA 1J9YA 4LS2A 4WKFA 3NYZA 3OZPA 3VTRA 1XH1A 4AFYA 3UJSA 3KWXA 2Z0IA 3UG3A 4DJDD 5AYZA 1AD4A 1V3JA 4BS0A 5A8QA 2QMJA 2CU0A 1OINA 3TWAA 2HS8A 4MDPA 2ZVIA 1QFEA 3H2CA 1TX0A 2L5HA 3VZYA 1J5TA 1BEUA 3GHUA 4LEFA 3QJAA 4HHHA 4FK9A 5K9XA 3M0VA 5LIWX 3I10A 1XIEA 1A4MA 1A3XA 1UPPA 3DGBA 1JNDA 1HP5A 4M7SA 3VXGA 1QNQA 4JX5A 3VU2A 2ALRA 1ODZA 3AJ7A 1A5SA 3NXLA 1TPFA 1UG6A 4KBXA 3O6DA 3SN1A 3G2GA 2SFPA 4WKAA 2WLYA 1JDEA 4TU1A 2MANA 2BBFA 2Y63A 3O7UA 4DJEA 3NM3A 1XG4A 4AHOA 3T78A 1J0HA 3AS0A 4A3YA 4LYRA 3TYDA 3L67A 2HBVA 2PD9A 3THCA 3PP7A 1RQEA 1W9BM 5EMUA 3GG7A 5MF5A 2Y0FA 3K5XA 1K70A 1LWHA 3ONBA 3GD6A 2R1NA 1ISWA 4DVOA 3ZJ6A 4PMDA 3WJSA 2YBUA 1RP8A 1FKXA 3APTA 2C19A 1DXFA 1UR4A 4GA8A 4BR1A 4F0KA 5CBBA 7XIMA 1KM2A 3EOEA 5HNUA 5BMXA 3B4YA 3SRDA 1KA9F 3CMFA 2IMRA 5C9UA 3U9IA 3MANA 1E5NA 5FL0A 3OA3A 3IEBA 1GUVA 4R5EA 2QR6A 4WY0F 3M5YA 2PRMA 3HJEA 4ZOEA 2PTZA 2QCCA 3FEMA 1ZAHA 2OELA 2OYKA 3CZKA 1ZBCA 3WMCA 2X0HA 1PIGA 2BGNE 2I9UA 5CEWA 4OWGA 1UD8A 3W3OA 3DYMA 4ZEPA 1MUMA 2WNNA 4R34A 3QXBA 4XD4A 1NSJA 3ARYA 1PX3A 3N9SA 2VRJA 4N9EA 3DBPA 4KF1A 3LHVA 1GPFA 3I4EA 1XH0A 3MMWA 8TIMA 2EPMX 4WJEA 2VEGA 1TPEA 1R0MA 4B2DA 2P3ZA 3ABRA 4IF2A 3NEHA 2YFNA 4GYPA 4MWAE 2DT2A 4UQDA 1DIOA 1MXGA 3LI0A 1BXBA 1CDGA 1W3IA 4S3FA 4F2UA 1IXOA 3EX1A 5A94A 3W23A 3PUOA 1EJTC 5DBUA 3BARA 3MSGA 6A3HA 1K9TA 5JBDA 2CLHA 1E6XM 3OVGA 4TV6A 4ZOAA 1SW3A 3AMLA 7ENLA 3W53A 2V5CA 2DZSA 4IT1A 2BVTA 1BVNP 3MSYA 4R53A 3GLCA 3DHPA 4AQLA 5F2IA 2HXUA 1QOQA 2WMFA 2ZA3A 2FZ8A 4Q4MA 3CQJA 3GB6A 3PUEA 1M5WA 4V28A 3QFWA 3GXPA 3WYZA 4N4PA 3AXXA 1AVAA 1A80A 4CCEA 3CZJA 4PN2A 5M5DA 1TX2A 5AC4A 5H1WA 1TYGA 2ICSA 2ZZ6A 1R3TA 4GABA 4IFKA 2VOMA 3MVTA 4LYKA 4IICA 3ZO9A 1KGWA 3BCDA 4X3ZA 4A3RA 4GI4A 2VGBA 4U3CA 3GFZA 2IUZA 5U4NA 3RU8X 1J10A 4U4MA 4X9SA 3WD3A 4M3PA 3M5VA 3EZ4A 3QFEA 1IEIA 2P76A 1YQ2A 4KCVA 2P88A 3P5ZA 1SU5A 1V77A 1Q7QA 1I9CB 4US5A 5GVJA 4DXKA 2E67A 3A5FA 4R7OA 1B90A 1E51A 5IHSA 4JTKA 2D3LA 3B9AA 4UTWC 4IG2B 4U3AA 1F74A 1BRLA 1BYDA 3EMZA 4INFA 1GPWA 1ZGDA 1E4MM 2WKJA 3TYUA 5HATA 3RX4A 2Y5EA 3LLXA 1E9LA 3ZR5A 3C3UA 1X97A 4E2DA 5JBFA 1VBGA 3HGOA 4UQEA 2ZZ4A 4CVUA 3N29A 2X8RA 3RLUA 5EFFA 1KGXA 1O5QA 1E6QM 1AFSA 5A8GA 4P7QA 4FNSA 4XKYB 4GUIA 5BWAA 3G3DA 1E3ZA 1QW8A 1Y7VA 1ONWA 4IQJA 4PYSA 1QCWA 4GPNA 3U4AA 1ZNNA 1A0DA 1HF6A 3K8LA 3TTOA 3RCMA 3V1PA 4NT0A 3S1GA 2A6LA 4NILA 4WQ6A 2IW0A 2WSPA 1YTDA 4UFHA 2EXOA 2H3DA 3IRSA 1DEDA 2G0WA 1AJ2A 4CCZA 3N1AA 1ZB5A 2E1DA 3C0SA 5KITA 3EA3A 1KCZA 2DZWA 4OUEA 1KM5A 4M81A 1ONEA 2HISA 2EPOA 3CL7A 4P8UA 2QCNA 3E3HA 5FD0A 2X1SA 4DWSA 3BMXA 4MLJA 4NAEB 4JTHA 3SIMA 1G5AA 1I2OA 3EB3A 2QUNA 2GFTA 2BOGX 3PPGA 4OIFA 2PODA 3F4NA 3KAOA 3W28A 3I7QA 2ZUNA 3LERA 1SGJA 3CHCA 1QI0A 1KO0A 1NM9A 2XUCA 3UPMA 3OHMB 1UA7A 1PWLA 4E3VA 1KLYA 3A4AA 3NQ6A 4O15A 5KZDA 3H22A 3TC3A 4FHAA 4BY3A 5ABFB 3GNDA 5F4SA 3ATZA 3DFTA 5IXEA 1UWRA 3S3GA 4FIQA 3LZ5A 5F4XA 8RUCA 3U8GA 4NNBA 1MXDA 3KBVA 4JY9A 3WKZA 4XTIA 3KM8A 1IZCA 1A5BA 5CXPA 4FSAA 3B0YA 2OGYA 4PFHA 1NY1A 6XIMA 2NV1A 3UJ2A 5FEXA 2Q8LA 1V8EA 2WJDA 4G8TA 3TN6A 1REQA 5A6SA 1K7FA 1P5BA 1O5KA 4QRNA 1N8FA 2VC6A 3SN4A 4JTCA 3TAOA 3OZMA 5A6TC 4US6A 4RDYA 1EEPA 1LRNA 5G1YA 2EJ1A 1ML1A 2WKLA 3QOKA 2PMQA 2JKPA 1S3HA 1E4LA 2W62A 1S46A 1TVNA 3UETA 1SJCA 4D6EA 3EX4A 4Z2HA 1KRBC 3R8GA 4TR9A 1W9XA 3UR2A 2PDBA 4C6EA 4YS1A 3WNMA 3SZ8A 1S39A 3NURA 4TQTA 3HPZA 1XGEA 1P0KA 2ZTKA 3TWBA 1I6NA 4DBUA 4HOWA 3WQVA 2I1OA 3KZPA 1AZ1A 3AWNA 4C7GA 4LY4A 3STEA 1UA3A 4DI9A 1V7AA 4QXIA 1FWWA 2ZC8A 4GUGA 2H6RA 3STFA 4HYWA 2VGFA 1E55A 3U7BA 3CTLA 3WNKA 3URBA 3ABZA 3LS9A 3HFTA 2V30A 3HURA 1UR8A 5CPQA 2IQTA 3C56A 2JIEA 1AJ0A 3WSUA 1N82A 4W5ZA 2OEMA 4Z1BA 2RDUA 3UVAA 1MYRA 4PRRA 3QVQA 3NQMA 2CBJA 2H9AB 3HG5A 2XFYA 1UROA 3VDGA 2Y8KA 5ABEA 3UP8A 3S1UA 3W7HA 2E6DA 3GBEA 4ZB0A 4PUJA 3W7GA 4FLSA 1DV7A 4W5UA 1R3WA 4AAJA 3GUWA 2V69A 3G0SA 4Z2KA 3KOWA 2X41A 3GNNA 4JEQA 1KKOA 3OGSA 4XVEA 1GNXA 1HT6A 3THDA 3TJLA 9CGTA 3UCCA 2FPYA 3S0CA 2RDXA 3OB8A 4AZHA 3A21A 4A35A 1O1HA 2PDQA 4XZNX 4L56A 3HF3A 4KERA 1S2UA 3W7IA 2VCBA 5K7JA 3S9IA 1UP3A 3AUOA 2CZVA 1CZ1A 4GI9A 3REQA 1SO4A 4M6QA 2HVOA 4IIGA 4MJZA 3LGEA 3WJXA 1J0YA 1FCBA 1V3HA 1LWJA 3P0WA 3QV6A 2CEQA 4I5UA 3CIXA 2Z25A 1H0IA 3SSJA 1KFLA 1TJRA 3WJWA 4RXFA 2VEKA 4AY1A 2ANUA 4K6AA 1TA3B 1YW1A 1KTNA 1UZ4A 2FGZA 3VX1A 1WZAA 4ZB5A 1ZAJA 4UQBA 1YLVA 3AISA 2YPIA 3TSDA 5HNRA 3CHFA 5DEZA 1H41A 3OLGA 4PTNA 3BANA 1Q3NA 4XWUA 4EK7A 1DWAM 3TSBA 2YCJA 3RPDA 4MFEA 1QOXA 1MDLA 4OQVA 2YW3A 3VE7A 3E0FA 5EGRA 3NXFA 1MZRA 3AIWA 5EFDA 5DBTA 4LVAA 1VBRA 1PKNA 4QFUA 1EP3A 2WKGA 4D6DA 3QGAC 4RE4A 4YXGA 3W1QA 1RV8A 4JTAA 2DZTA 1C9DA 1WDPA 1UH2A 4CNPA 2ISSA 4C65A 2WVVA 3QV7A 1D7FA 1BF2A 4W93A 3NG3A 4G7EA 1XBXA 5H8MA 2G96A 4Y9OA 1QPNA 3WIJA 3TFXA 3MKCA 2JKEA 1XLMA 2PTDA 3THUA 1US2A 3TTYA 4EF9A 1EIBA 4H41A 4ICCX 1P6BA 3SM0A 4TVDA 1R3VA 4KEUA 1I4NA 2PGWA 4CD8A 3IJ7A 2HE8A 2X05A 3ZVHB 2NQHA 1JL8A 1YDNA 5CSRA 2FFCA 1F6PA 1KFJA 2A3HA 3OGRA 1FRBA 2QJJA 3W7CA 4CQDA 1KBJA 3PY2A 3MYPA 3DG3A 3ARZA 1OZMA 5A8NA 3UWVA 4B2DD 1KQYA 2BVWA 1OFDA 1VFSA 4XBJA 3GXNA 3T44A 5C71A 2RKXA 1F3XA 1LLZA 1GVIA 4CKQA 1RLDA 9XIMA 3B9NA 2XIJA 4AVFA 2Q8XA 4XVDA 4FP1A 4R7WA 3ABQA 1A47A 4KH2A 1Z89A 3WBWA 3VDHA 3BK0A 4BCEA 3ZJKA 4JD4A 5LIUX 3TC6A 4JIIX 1I2NA 2VFIA 4DEFA 5BWFA 1U1UA 2JALA 1HJQA 1C93A 4XZBA 3EB2A 4WKHA 3AS3A 1EJWC 2WM1A 1XICA 4H9MA 4H8HA 1W3HA 3W75A 4IGHA 3GR4A 1FCVA 1ONXA 4QSFA 3TMLA 4A21A 3PTKA 4LNCA 1WV2A 2XH7A 2ZXDA 2A21A 3C2VA 3R94A 1GONA 2WC4A 3UYCA 4WZHA 1W9DM 4S3EA 2ZICA 3WUGA 1W2PA 3BMWA 3CQIA 2FHFA 3MQTA 1XRSA 1GJUA 1XIFA 4HIBA 1E5JA 1ME8A 1LORA 3GNRA 3CGTA 4Q32A 1V03A 4US5D 2GJXB 2OEKA 3RDKA 4FF5A 1VS1A 1V6UA 2HK0A 2NXGA 1AQ0A 4ZTXA 1EWDA 4JAWA 1G67A 3O2LA 2VR5A 2J27A 3A3XA 6CGTA 2V3EA 1H11A 2AMGA 3MW7A 1JPKA 1TE1A 4S3GA 3SUWA 2WPGA 2PU1A 4DRSA 2YYTA 3QMTA 3GXFA 3W82A 2CKSA 2A79A 2QPUA 3L2LA 2V5KA 4C6FA 2AOSA 1MQPA 5I2UA 2P50A 4MWAA 1FWNA 4Q4RA 3VIJA 1K1DA 3R58A 4DUWA 5M17A 3LU2A 1XI3A 1RAKA 1GHSA 3IUHA 4XD5A 3IWPA 1SSGA 4PMNA 3ARWA 4WSKA 5JH2A 4GLEA 3NZ1A 4ACYA 2CLIA 4O53A 1JZ3A 4MZYA 1LBMA 2J78A 4QCFA 3OYZA 4KESA 4RDZA 1P6WA 3N15A 4XIMA 2WWCA 4E8DA 1WP6A 2B7PA 2CZ5A 4UTIA 3C2RA 2Y4SA 3W71A 4G6CA 1SO3A 3S2MA 4KEZA 1CB2A 1OJXA 3B9EA 4ROQA 2NW0A 4EAMA 4JQ3A 3QMRA 1O1ZA 3RM4A 2IKHA 1P48A 4N42A 1XPGA 2IXUA 3UG5A 3GZ3A 1JI2A 3IUDA 2QNEA 1Z42A 2YXXA 1N8WA 2DSUA 1F73A 3RLVA 1FX6A 3VYLA 2J25A 4GY0A 4JTQA 4A8RA 1NF0A 1BXCA 2WVUA 2VEMA 1JUKA 3KDOA 3ZJ8A 2E3ZA 5H8UA 4RZ5A 1AL8A 3LTSA 3JZEA 1S5MA 4V15A 3G6LA 2D69A 3AHVA 3IANA 5CLWA 3RGTA 1L0PA 2G3MA 4GQQA 1ECQA 3EMCA 2CZDA 1ADDA 2W27A 4BEQA 1TQXA 4W8AA 3SUUA 4UB9A 3NYDA 3TA6A 2W91A 3EA1A 3C8NA 4L4PA 2JF7A 1EGZA 5CGMA 3TEVA 2WQPA 3W4RA 2PDUA 3RPTA 4P61A 2ZFAA 4DYKA 5E93A 1PS9A 2DIKA 2OKTA 4X0NA 4MYAA 1JQVA 1RCOB 4WRHA 1EL3A 4NZJA 4KW2A 3L68A 4XAGA 3VNLA 3NFUA 1G4SA 3KP0A 2ALDA 3E2RA 3GRIA 1LT8A 1V93A 5C5YA 3HU7A 4JTJA 2H3BA 3PPHA 1XIGA 4ES4A 3VUSA 1HGYA 3FA4A 3NQDA 4LY8A 1TKKA 2BX7A 4QQUA 4UCGA 4ATWA 2Z27A 3ENLA 1FWIC 4IL2A 3HMJG 2XVKA 1WZLA 4RW3A 3ZIZA 1M3UA 3LBCA 1J0KA 4XK2A 5HPCA 3FAWA 1QPOA 5JUVA 1TMHA 5FEWA 4X2RA 4IM4A 1W3NA 3VKCA 4C1LA 2R91A 3WUBA 2G95A 2V8ZA 2YL9A 1KV5A 4CEXC 1R9XA 5JBEA 1NFGA 4A3UA 2WMJA 2ABBA 3EOSA 5HMSA 3ZM8A 3WFLA 4LUYA 2EGZA 3MSDA 2XWDA 5JXQA 1YBQA 1V7YA 2GDVA 3ES8A 1S3TC 2YR1A 3IK4A 4PGLA 3LLFA 3T42A 1XBYA 3O06A 5FOOA 4O28A 3U0HA 2DSWA 2VO5A 3LDVA 2WAGA 3CYVA 3UT0A 4HCLA 1RHCA 3ANYA 3KVKA 4DO4A 1EQCA 4Q8WA 2EG7A 2I17A 4LUSA 4EWND 2UY3A 1YX1A 4M19A 2UV8G 1NVMA 1XLFA 4TTGA 1EF2A 1Q4WA 4IMFA 2FQIA 1W3KA 2V67A 1F3TA 4YWIA 3TLLA 1W1B1 3CHDA 7PTDA 3TMQA 2YCLA 1ZBKA 3TQPA 4M6VA 1YMYA 3VIPA 2QAPA 4DXXA 2E40A 1MMFA 3UY8A 2V5DA 3DHFA 1E1EA 4HKPA 5GJNA 5CC7A 1XDJA 4MZ8A 1X6UA 2FGBA 5DT5A 4U2YA 2QQ6A 1CXIA 1B4KA 5FACA 4Q8QA 4JHOA 3VVGA 1OFQA 5AZ0A 1G4PA 2F84A 2GGIA 2P8BA 3VC6A 4W8LA 4JFSA 4MY1A 5B7YA 5H8PA 1PZ0A 3BL3A 4FX6M 4FXRA 4LQ1A 2OZ8A 4MYXA 4RJEA 4ZE5A 3MO4A 5TAOA 4HMEA 4EXQA 3I3BA 4ORMA 1X8FA 4AZCB 2PDXA 5H91A 1OX4A 1RALA 4C6JA 4E4PA 1XRFA 1S1RA 2OEJA 5HANA 3EEGA 4WCJA 3TJXA 3UWZA 1VR6A 4LTSA 4R33A 3P6LA 1B3WA 3EWDA 3EB4A 1E0WA 3MDUA 3T1GA 1LDCA 4A2RA 4HJWA 3A9BA 1W9VA 2D3NA 2QHAA 2VFGA 4MSSA 2GGHA 3SI9A 1UR3M 4TMBA 5FAJA 4AF0B 4QE4A 3I6TA 4O16A 3VIOA 2ZUMA 3WELA 2QUVA 1RPKA 4W7VA 3SCSA 1QPRA 1V0MA 2FJKA 2EKGA 3W1RA 2HDJA 2YB1A 1BTCA 2P10A 2TRSA 1JYVA 3OVRA 1CENA 1ZY9A 3CNYA 1EJSC 3INPA 2NX9A 1E40A 4JIPA 1UD4A 1LL4A 3BG5A 4C6QA 1TCDA 5KZMA 1Q2SA 1GJWA 1B2YA 1Z3NA 4Q8UA 2VENA 3LSCA 3V5CA 1DKWA 1Q6FA 1IIGA 4FOJA 2B31A 2FPTA 3LMZA 4PMQA 2HTMA 3FY1A 5IDZA 2RJGA 4I9TA 1KC7A 4KRZA 1L6YA 3QBUA 1O66A 3VI2A 2V0TA 3P74A 3B05A 2J79A 3BOLA 1BVZA 3QYQA 3UR5A 3GDKA 1UZ1A 4JQ1A 1OIFA 3B8SA 5CBIA 3CAWA 3BGAA 3W26A 4Q4PA 4A3HA 3QR1A 5G4HC 3B06A 1A5KC 4LUTB 3UXKA 3GNXA 5C2GA 1QOPA 1YTEA 2DJXA 2ABAA 1ZP3A 4DO5A 1ITQA 4LALA 3VNDA 3N18A 3DXIA 4I7UA 3THQA 2B81A 5DXYA 3W29A 5I5RA 3TNOA 2WNWA 3T09A 4AZ7A 2FB2A 4AD5A 4J1OA 4CNSA 4PTWA 1UC4A 4Z0JA 1F61A 1XISA 1OD0A 1JPDX 4RZBA 3F4CA 1JEZA 3CZGA 4V1XA 1E0TA 3S5YA 3T2PA 1VEMA 1XD1A 4JX4A 5BW6A 2Z1KA 3Q58A 3TROA 1C29A 3WLJA 1C8QA 4QAIA 5DMNA 2A7RA 4JGDA 3LEPA 3KCJA 2Y1HA 4JTEA 4F0HA 5I3IA 4GYKA 4PEKA 5A5WA 4J4KA 3DAQA 4OJYA 4G9PA 2D0FA 4F8XA 4HMDA 1S2TA 4H01A 3L2MA 3T8LA 4RNFA 1ITUA 1GOOA 3USBA 4HBKA 4LUIA 2BVYA 2AGTA 3HGJA 4ZBCA 1YADA 1VD6A 3PBWA 4V2XA 4I9JA 3IGHX 2BG5A 4Q8NA 5LA0A 2ZCGA 2YA2A 4ZO9A 1A5MC 3HQ1A 4QISA 1Q4NX 2GL5A 4E8CA 4JTIA 2RH9A 2WCAA 3W84A 3WK2A 2WZHA 2JKAA 3MKVA 2YW4A 4DPPA 3TXVA 1HFBA 1KNWA 3OU8A 3DBNA 1XIIA 4AZ6A 3CIWA 3LM3A 3VAVA 1UWIA 2E5DA 3N9KA 1OCQA 1XD0A 4R27A 1MFVA 3JVAA 5C2CA 2DDXA 2UY5A 3LGDA 3I7SA 3RCYA 1M7OA 1GKQA 4U5KA 1GT8A 4RLIA 2P8CA 2BOEX 4QTGA 1POKA 4HCDA 5DRCA 4KQNA 4MWAD 3VKAA 3SR7A 3ZLFA 3AO0A 1TELA 1K4GA 1V4YA 4HK5A 1WUFA 1I2QA 1V3MA 3RJYA 4NZ4A 2V38A 1XLKA 5CSSA 2FFIA 5KZEA 4K7YA 2J7BA 2XIOA 4CQCA 2XISA 2REQB 1Z6KA 4PMUA 2EPNA 2R14A 1FFRA 3DCPA 5HWMA 2NVAA 2IPFA 3P80A 1LBLA 4F48A 4MAZA 1FDZA 4HA1A 2ZRXA 1JF5A 3A12A 3KL3A 4ERAA 4GZEA 4RZ6A 3JW7A 3GVVA 3J7HA 2GQ9A 4DBDA 1J01A 1JFHA 4JTSA 5T91A 4OVXA 2Y7GA 1OY0A 3LB0A 1YXDA 3BG9A 2ZUVA 1W8GA 2WWDA 5TIMA 3H70A 2W66A 4M8UA 3IIVA 3UNTA 2GJRA 1XYMA 2ACRA 4MHBA 3GG8A 1HJXA 4AU0A 2AL2A 2J7EA 1JYWA 2WVSA 3M0HA 4F66A 1GK8A 2Y62A 4F2BA 3LHWA 2PDGA 1OX6A 4EE9A 3P14A 4E2OA 3ZMRA 1CIUA 4Z08A 3GY1A 4L5ZA 4QJ5B 2VWSA 4Q4OA 4J27A 2GGJA 3W1AA 3T81A 3NCOA 3MUAA 4FLQA 1LQAA 3AU2A 1JDCA 2Q3OA 1FHVA 3FGCA 2TPSA 4KWWA 1UBPC 4GFSA 2HVMA 3W7QA 2Y7DA 1IV8A 3WQWA 3BV4A 1A0CA 3WLIA 1G6CA 2HVNA 2C15A 3KBJA 4IPIA 4XSLA 1U5VA 1J12A 3AYRA 3PJXA 5D8WA 4NAFB 2VR2A 5AOUA 3S42A 4ZVJA 4MM1A 1XYBA 3W2JA 4W8BA 4LBUA 3KBNA 3W83A 3H2AA 4MVAA 2HE5A 3U3HA 3PPFA 1S2VA 5F4WA 1SMAA 4KCUA 1KRAC 2P5NA 1TR9A 1KM0A 3T9PA 3VOGA 1TV8A 4E2BA 4QM1A 2R8WA 4U5IA 4GZIA 3OO2A 1QHPA 3UBPC 2V3FA 1DWGM 2OO6A 3GIYA 4G1NA 4PTMA 2JE8A 3N12A 2OWWA 3QYSA 1C8VA 1FP8A 2XVLA 1Q6OA 1QMLA 2OQLA 4KRTA 5A8MA 4CQ8A 4LBRA 2I16A 1V79A 1PAMA 1W54A 2GSEA 4QE5A 3CEPA 3BC9A 2POTA 1CB7B 3IJDA 3MCNA 2WYSA 4YYCA 2FZ9A 2J6VA 3DZ1A 5GQBA 2PDKA 4Q4KA 2Z26A 4GD0A 1JDFA 4GJ1A 1RCXB 3TOYA 5RUBA 1TMLA 4NJIA 2XIQA 2RGMA 1I0BA 4NUWA 5E5CA 3VKBA 1T99A 3SJNA 3W1UA 1Q85A 4DJEC 4IWWA 5E6ZA 1WE5A 4DX3A 4AWTA 1TTPA 4R9OA 4HHMA 3OZOA 2E68A 1U2YA 3VNIA 3OVPA 5LSMA 3M0XA 2CHRA 3WLHA 4JYDA 2W6RA 4OT7A 3CUIA 2AAMA 2R6OA 2PF8A 1J79A 1JVNA 5A6KA 1OF6A 4NZCA 3UG8A 1CGVA 1S1PA 1YTKA 5CPOA 5DRIA 5AHLA 1LOQA 1DIDA 1FWEC 2WLZA 4PFMA 1H1YA 2QEZA 3R1ZA 1CYGA 3E2QA 3EPNA 3GFYA 3H21A 3MZNA 3A9IA 2V3DA 2XFWA 3VX0A 3VIIA 1VCVA 3SY1A 4QLLA 1FUYA 2OGJA 1EB3A 1B0IA 1A0EA 3LQGA 3UZZA 3GIPA 3WH7A 2CYGA 2WZIA 3IJIA 1W6TA 2ZXAA 3CWHA 1HVXA 2VKZG 3OBEA 3MKKA 4NZ3A 1GVYA 1UQYA 4GNKB 1Z32X 4QJ1A 1I1XA 1R30A 5F1VA 3EX3A 2F9RA 2GZXA 4XKYA 4Y96A 1RJQA 1XKJA 3IV8A 1VIWA 4CLMA 5KMYA 4H9XA 1EGMA 1PL9A 4P7LA 3IIPA 3VNKA 3VC5A 2XGZA 3IRDA 3KTXA 5HWNA 2MNRA 3CUHA 2IXVA 1VENA 4NI8A 4A6GA 2WK2A 3SSZA 2AGKA 4MB1A 4GYPC 4H8NA 3ITTA 3TN3A 4GKLA 5LA2A 3DFPA 3CUXA 4LX4A 4PULA 3UERA 1TV3A 5DQPA 2VDHA 3B8IA 2DSZA 5IFPA 4KWVA 1K9DA 4NAEA 4M24A 2Y24A 4TX9A 3WLRA 4DUXA 1YPIA 1XCXA 3THAA 2Z1XA 4WDTA 4J2MA 4ORIA 4HOXA 4UMAA 3UZ5A 3RCNA 5FEPA 4DY1A 4IPPA 1E0VA 2I5IA 1IYXA 4DAFA 4JCMA 1R2TA 1VEOA 3LNMA 3AHXA 2CBUA 4GH3A 1UMYA 2WBKA 4AD2A 3MUCA 4XD6A 3D46A 4IFOA 3TDFA 4EPKA 4IFRA 2I5GA 1AG1O 4DLFA 1R7AA 1NDWA 3TXZA 4AC1X 1WNOA 1ZLPA 4DN1A 1OBAA 4GC3A 3RR4A 3QLLA 2VM8A 4AYGA 3T4WA 4XZIA 1XUZA 2WHLA 3K1GA 5D32A 2ATMA 4QROA 1SMDA 3VD5A 2GK1A 4JN7A 2YDQA 4JNMA 3WLNA 2BWGA 5PTDA 3UWWA 1Z9AA 2CERA 2PLMA 3AMGA 3G1HA 3NJ3A 5CZSA 1WAWA 2Q01A 2BDQA 3CLMA 5D03A 3BVJA 3P60A 3V0SA 1NF7A 3QQ0A 3RM9A 4MLRA 3BQ5A 3IPWA 4D1JA 3TE9A 2RDTA 1MSSA 3Q4DA 4NZ1A 4W89A 4WF7A 3T07A 4UQ9A 3EPMA 2BV9A 3XINA 3K30A 3NGFA 2DY3A 3TONA 3GW3A 4UTFA 2PC8A 2ZBTA 1R47A 1MUCA 1SPQA 2WHKA 4XG1A 1XWYA 3QR0A 4MJ2A 4UR7A 1G0CA 5KZ6A 1OGSA 3KS5A 1ZUAX 3VA8A 5HQMA 4EF8A 3F4WA 3PVFA 2OZTA 4K8HA 1XLEA 1XSIA 2WMIB 4YTUA 2WV8A 1WKEA 4B16A 3E74A 2PDWA 2JEQA 4LCSA 4I90A 1NDZA 2X0SA 1NEYA 5E70A 3GVWA 1FWAC 2E09A 1TVLA 1E1CA 1A3HA 4O0ZA 4AXNA 2C0AA 4ZOBA 2XN0A 2FZBA 2G4JA 1WXYA 1XQLA 2TSYA 4DWSC 5AYXA 4O10A 2Q3RA 4B15A 3VMPA 5FAGA 4ZTYA 2YA1A 3TC7A 2G41A 2QV5A 1IGWA 5CCZA 5JIWA 5EYWA 2ZA2A 2VT0A 4L6OA 2H9AA 1ECEA 5CSYA 3LYEA 3UWQA 1J6PA 4ZXLA 2MUCA 1QVBA 3DG7A 3BAKA 4ZSUA 1UBSA 1QW7A 2QCDB 3ARTA 3SO7A 1BSLA 1CGXA 1ISYA 3V75A 4OU1A 3KS6A 1NOFA 4LB3A 1Q6DA 3WENA 1M7JA 4O52A 2V9DA 2J9XA 1BWLA 3OJGA 3GXTA 2PDNA 4HYRA 5LIYX 5T9BG 2JEPA 3R11A 3IARA 2A85A 3BAWA 1FY6A 3N19B 5A2AA 4ZO7A 2X7WA 2OYMA 2O92A 3CWOX 5C8BB 3IJQA 1Q8AA 4M7TA 1DXEA 5MHBA 3WFZA 4YTQA 4O1DA 1TRDA 3L23A 5EMKA 1NU5A 1G94A 4GJJA 4QP0A 2QJMA 2NXHA 3HTWA 4DF0A 4Q7NA 4HA4A 1VRDA 3PC0A 1ISZA 1W5PA 4S38A 4UWMA 4GY7A 4P8VA 1UKQA 2ACUA 8A3HA 4NHVA 4GZ7A 1IEXA 2ZZ3A 2PB1A 3W6MA 1FWSA 1TWZA 3F2BA 2ZUUA 1QK0A 1NWTA 2CLEA 3U4FA 4W87A 3A22A 1QNSA 4N9BA 4RW5A 4W85A 3PNZA 3GIQA 5DCDA 1QNRA 3C52A 2PDPA 4AZBA 2CBIA 3F5JA 3WJZA 1JCTA 2IPWA 2QCFA 7TAAA 5AN7A 1KQZA 4MFDA 3NZQA 3DUGA 2V63A 3VIFA 1FH7A 4LGXA 1H7NA 2G3FA 3E0VA 1VRXA 2DH3A 1W1PA 3T2OA 4R85A 1NAL1 4K68A 1K03A 3WQ6A 1Z41A 1UJQA 3W72A 2E8YA 1Y5WA 3HJZA 4P7OA 1VH7A 2QIIA 1EF3A 4J3XA 1ZCOA 1IF2A 2VYOA 3LY0A 4PRTA 4CU8A 3KRBA 3SCNA 1HKWA 4BQ4A 4NRRA 5CAKA 9RUBA 1PXGA 2NSXA 3VGHA 2Y89A 1GYNA 4HN4A 1MW0A 1O5RA 3BAJA 4N9CA 4DJDA 3WDJA 3N4EA 3WLLA 1PKLA 5HWJA 4ONVA 1ZHAA 1HL2A 4PCNA 1OB0A 1J2BA 1DJNA 1E9YB 2YDSA 2QMKA 1UP2A 4KWSA 5HA7A 2DVTA 3W1NA 1RJPA 4HB7A 4W88A 4JIRA 3R8RA 3P82A 1KXHA 4A22A 3OLIA 4ZQPA 1LOSA 2XGIA 2WJEA 4LAUA 1IE7C 1NFPA 1FWJC 1EX5A 3RU6A 3OZYA 3MI2A 1WQ5A 1P0EA 2A3EA 3URQA 5I0DA 1XL9A 1N2VA 1MXSA 1XG3A 2ZVRA 4G2DA 4WR3A 3TK7A 3A4JA 3UZXA 1OG0A 2QCHA 3UZYA 1XFBA 2R24A 4FS9A 2WNZA 2NWSA 3N14A 3T55A 3PZMA 1EBHA 1AA1B 2ISFA 3CPRA 3K8KA 1OCBA 3LRLA 3RRXA 2W5FA 3APYA 2PWGA 5T8GA 3WDRA 2G3NA 3NL3A 2GLKA 3CLWA 3B8WA 1LUCB 3P7YA 4XUYA 2C1GA 2ZTJA 2PGRA 4ACZB 1GGOA 3R8HA 2PWEA 1FBAA 3WF2A 1MNZA 1ZFJA 4HK7A 4Y7EA 3DENA 3TP4A 4G56A 4JFUA 2GVGA 2Y8UA 1PTDA 2VURA 4ZQMA 4IGNA 4H7ZA 4ZENA 4Z1AA 2I5QA 3GSMA 4LRSA 2PI6A 4GG9A 2QDGA 4NIRA 4DUOA 1EX1A 4HSNA 5C0QA 4ZQNA 2NV2A 1T7LA 4IMAA 3MI3A 3RO8A 3ITCA 3PBGA 1X38A 4F0RA 1UD5A 3H7UA 3W00A 3DG6A 2DSVA 2PLCA 4UQCA 2QCMA 3G8EA 1DQXA 4KCWA 4EVZA 1BD0A 5GJMA 4AHPA 4CD4A 5BRPA 5I77A 2WC7A 1T5AA 4S2CA 1QNOA 3V18A 3BWWA 4XZHA 4Y90A 4D2JA 3EMQA 4DYEA 2OX1A 2WM0A 4MDOA 3RYSA 4B5WA 3L9CA 4GZJA 4YN5A 2PGEA 3N2OA 5C9RA 3NDOA 3FKRA 2OT0A 4B3KA 2DU2A 1JI1A 5CJNA 3MUIA 1ALDA 4DPQA 1R6WA 1RJRA 4I8YA 3BW4A 1X8CA 1XLAA 3I3DA 4ZXOA 1TJ2A 3LBMA 3VIMA 1FKWA 4JFVA 3MPGA 2Z2AA 3GFXA 1SFJA 1V3IA 3XISA 2OODA 1PYFA 2E5BA 3KTCA 3WNLA 3C0QA 3UWUA 5J5RA 1IT7A 3EOUA 3EXSA 4UOJA 5C6MA 2OLAA 4HU8A 3KCLA 2YKKA 4GVHA 4JX6A 3PBVA 4O11A 3L0NA 4UFMA 3O6AA 5AZ1A 2D20A 3YPIA 1AMYA 2NVCA 4LRTA 1ZBWA 4G1KA 5DF0A 2HMCA 1MQQA 5FJUA 4XX6A 5HPOA 3RX2A 1OFEA 3O3RA 3B4UA 4NRSA 4FALA 2YSWA 3QGVA 1E6RA 1PHWA 3CBWA 2Z7KA 1UZDA 1XHGA 3NQVA 3UXLA 1QASA 3MS8A 1M7XA 3AAMA 2J8TA 1CXFA 4XKMA 3JS3A 4S1FA 3FXGA 1HXJA 3OBAA 4TO8A 4JTLA 3BV7A 3ARPA 3FJ6A 3ICJA 3CAQA 1DWJM 1MW1A 1JZ5A 3PJTA 3KVMA 1THFD 3K4WA 4RR4A 4C6NA 4GE8A 4CN6A 4LSBA 2J9YA 3EWZA 4CCDA 4Q8VA 4C6BA 1EP1A 1U1HA 3NDYA 3IJ6A 3SAZA 4ZQOA 3BDKA 1H1NA 1W0MA 4IQDA 3BGJA 3WQFA 3W2UA 3PJWA 4AMCA 1BGAA 3DEQA 4PUUA 2VFHA 4B91A 4GBUA 4OTKA 3KBMA 2Y6ZA 4JFWA 3P2VA 1WPCA 4AD0A 2FTWA 3IV3A 3RUBL 4E8GA 4MWAC 1DQUA 3WEMA 1H7RA 3WH6A 1KTCA 2OJPA 4GCXA 1JJKA 2Q09A 1IT0A 4TX8A 3WQ8A 3G24A 3N2TA 3QH2A 4YU1A 2DJLA 4C6MA 3G5EA 5G4EA 3CZLA 3L5LA 2J75A 3PM6A 4EX4A 4AIEA 4MKVA 1JRBA 3L4YA 4L9XA 3BAYA 1QI3A 1XS2A 4MUZA 1H3GA 1LROA 3MV11 2IKIA 4GFIA 1LRTA 5HNTA 4PE8A 4O57A 1V0LA 2NSOA 4RKAA 3LRMA 1KXVA 1TSIA 4KRUA 3WF1A 3HO8A 4N6EA 3U6WA 4S3BA 2AQWA 1F76A 5AHEA 2FZNA 2OLHA 4RL3A 3QMSA 1LG2A 3KL0A 1OSEA 1R2RA 2DT0A 3UWEA 1W91A 3TR9A 1ZU8A 3PZQA 2WJFA 5BCAA 4C90A 1UOZA 1UR0A 3GAKA 1OK4A 3E12A 5I06A 2FJUB 1QWGA 3KRSA 3LMYA 1FTXA 1W1A1 2Y61A 3EDJA 4HU0A 4JQAA 1WXZA 1X7FA 3F4VA 3KXQA 3KP1A 3EDKA 2LLEA 4WVXA 3TSMA 4PA8A 4RV3A 3S83A 4LC6A 3QQ1A 5CKSA 3DKJA 3DESA 3DH7A 2R9RA 1BRLB 1BXNA 1E72M 3FCPA 3N3TA 4LV4A 4Q7IA 4GO9A 3ZSSA 4I3GA 4D1IA 3G22A 5M2FX 2PDIA 5CG0A 3UG4A 4KMQA 4J3UA 3ZZ1A 1SW0A 2UWFA 3AZRA 3HMCA 4BQ3A 1VPXA 1DVJA 3QV8A 3T08A 1F07A 1D3CA 2GGGA 2BS9A 4QQ3A 1F2JA 1C7SA 3E2VA 4P8WA 1SJAA 5GNYA 1KXTA 1CW2A 1BHGA 5KINA 4LEQA 2HBXA 3MMTA 8XIAA 3QW4B 3H2OA 4XZ9A 5GNZA 1OM0A 5EL1A 2V5BA 4GX9A 4Z1YA 3SQSA 3VABA 4BA0A 2DUXA 2DGAA 1LLOA 3NOYA 1VQTA 5C55A 3AHZA 1R2SA 5BNKA 4DQWA 4CD5A 1LJYA 1B30A 1ZTVA 4Q7BA 4TXEA 5HULA 3PF3A 5BXRA 1UB3A 1JZ6A 1D8WA 4HZ7A 4GGHA 2PC4A 2PP1A 4H6EA 1HKJA 3MHFA 2QCEA 4DWSB 1BF6A 1I2PA 3AIQA 5DY2A 4FZIA 3DHDA 3BJTA 3TYEA 3S1WA 4A8NA 4FEZA 1WOBA 3O63A 3TW6A 1TUXA 1P7TA 2VD9A 5I3HA 4QCEA 2YLAA 4F0LA 1Q6RA 3HG3A 3ECQA 5BRBA 2W9MA 3NQGA 6REQA 1GHRA 1N8IA 3SECA 1OX5A 3LV5A 1Q6LA 4FIRA 4OKDA 2E4TA 1R9YA 1GOXA 2H8ZA 2VC5A 1GVQA 1QI5A 2J47A 4LW7A 4IMEA 1A50A 2QVHA 3FJNA 3LUTA 3OODA 4JDBA 1AW5A 2QXWA 2J7GA 4W86A 1CXKA 4NASA 4LWWA 3CM4A 3AZTA 1HL9A 4C1NA 3PUDA 2VEIA 3M0YA 3HV9A 4O0QA 3SCPA 1U22A 4J40A 3CPUA 3POHA 1UUOA 2EQDA 4LUTA 3S6TA 2O7SA 1REQB 3VGBA 3AXMA 1LTDA 1G1YA 5LNRA 3WF4A 2BXVA 1JG9A 4LYQA 1EHAA 3C6CA 2TAAA 4HNNA 4JKKA 5AYIA 2F7FA 4REQB 2EPLX 1H50A 1MWOA 4WXZA 3MT1A 5I79A 2OSYA 4WDXA 3VOIA 4GX8A 2PUZA 5L6UA 3IVSA 1EEXA 1VYRA 3ZT7A 1KR1A 4AYSA 1UKSA 4L6HA 1AQHA 3GHTA 4C5YA 3ID7A 4DNHA 4C6PA 1CGUA 2X30A 2O0TA 4JNYA 4IJCA 5C7HA 1WDDA 1XIMA 3C3NA 3DFOA 2VGIA 2VCAA 3N2MA 4DLMA 1VBJA 1V6WA 4IP5A 1V0NA 3DGRA 3OG3A 5CBJA 1JQXA 4DF2A 1OADA 2D22A 4GH1A 4J3TA 2IPJA 1HQTA 1AL7A 4F4RA 2DH2A 1P1XA 4PMVA 2CITA 4UFJA 2D2GA 3NDZA 3T0BA 1IHIA 4OUIA 1ZJIA 3N2XA 4OOZA 4QIUA 3ZQ9A 3EKGA 1RLCL 4JL1A 2XN1A 3V5OA 3DFQA 4LJ3A 1XIBA 1E56A 3R89A 2NWRA 2H8XA 3DI1A 2ZUSA 3CXOA 3R7MA 1QDSA 2A6NA 4D8LA 4GVIA 3CH9A 3N4AA 4E5TA 3CUZA 4HOZA 4AEOA 3ZT5A 2BMBA 3FDKA 5FKYA 4XBSA 4RPPA 1J0ZA 5D30A 1DXIA 1AH3A 2XU2A 1XGZA 4LYPA 4A8IA 3WZ0E 4HQVA 1L8NA 3GO2A 4JOMA 1HKIA 4KS0A 3WQ5A 3GTHA 4YJ5A 1DBTA 4W7WA 3ME3A 1QI2A 4LS1A 2PZ0A 3ZOAA 1YYAA 1J4EA 5ENLA 3W9ZA 3OP2A 5XINA 3MTWA 5BRQA 4D71A 2QJNA 3AHYA 3REQB 1AZ2A 1W8SA 1R5YA 4GACA 3W24A 1DPMA 3T4CA 2DVXA 4UOZA 1OWQA 1ICPA 2R1MA 3SJ3A 2C1HA 5A2BA 3RFAA 4CVWA 4AZIA 5J5DA 1B54A 3H26A 2REQA 3I7RA 2AAAA 2YYUA 4YVXA 1S38A 2E5CA 5ABHA 2D73A 1AODA 1NOWA 3MU7A 3OQ8A 4UMBA 4HVXA 3W1LA 3COTA 3LGGA 3HFYA 4LOCA 4IXHA 1OFAA 1UMLA 3GK0A 2DZAA 3M44A 4N0RA 1TVPA 4DYJA 2A5HA 1W5QA 2GUYA 1BYCA 5DCBA 1NWUA 3QN3A 1GZGA 1W1ZA 3M0LA 4GJIA 2OO0A 5A6BA 1H7XA 4GQRA 3CV6A 4KGJA 3UWYA 3S1XA 4FR1A 4IOTA 2C71A 4MIMA 2E6AA 1O6IA 1Q6GA 3A3WA 3H4GA 2PD5A 1UKPA 1QO2A 5FF0A 2HPMA 5LXXA 3S6DA 2WSYA 3QTPA 3KBSA 2JF6A 1DJIA 4LF2A 3P8JA 2GPTA 3CH0A 3GU2A 4JY8A 3T0TA 1J2WA 5HQLA 5FL1A 3UA3A 2ZZ1A 3NL5A 4XAZA 4HTYA 3BCFA 4F40A 5LGXA 5F2MA 1PHQA 1EDGA 2F8QA 4DNMA 4P5UA 1HVQA 1SZFA 1L2UA 2OPJA 4PR4A 1QBAA 3GYEA 2OT1A 1KXQA 3S5OA 3GYCA 4KIEA 2PAJA 3II1A 2JIWA 2ZUWA 3H53A 2C1IA 2VDIA 4EANA 1DYSA 1XR2A 1EDQA 1DWIM 4CCCA 1KV8A 3CO4A 5HR7A 3BLPX 4E4FA 3GC4A 3VNYA 3W7NA 3EPOA 2DVUA 3CL6A 3KUMA 3V35A 3TJIA 4QLJA 1T41A 3BJSA 4UTTC 1QXLA 2PP3A 4GY1A 3B8TA 1HL8A 4RX0A 4D9PA 2FYMA 3D6NA 3SFWA 3S2JA 4J3VA 2Y7FA 1NOUA 3QY7A 3LCXA 2AMXA 4A29A 2FZDA 3AHTA 4PTVA 3PNUA 4DUVA 4UFLA 4S3KA 4AWUA 3MUXA 3W76A 3AC0A 4GUHA 5JH1A 1ENUA 1ZJBA 3VMOA 3WJYA 4XBKA 2V81A 4YLWA 3TVAA 3B8DA 1Q63A 1F4HA 1P0BA 1KCLA 3SGGA 1X39A 4MNJA 1ICQA 1LP6A 1MRQA 4DJFA 1TPB1 1MEHA 3CZEA 5IBXA 4YPJA 4NG3A 2VZOA 3RILA 2D2HA 3QLDA 5FF4A 3T7VA 4EKJA 3IACA 3MV01 4X61A 2XVPA 3QZAA 1OGGA 4NXSA 1Z48A 1BQGA 1M1BA 3FAXA 1P43A 3KDNA 2FTPA 2B0MA 4MOZA 3W7RA 4Q3MA 3I6EA 4PBEA 3NO5A 5I3JA 1OVDA 3NO3A 2GQ3A 3ITGA 4L1GA 4GC4A 1KKRA 3BZGA 3A23A 1KBKA 3NPWA 4MNMA 2B7OA 1DQWA 4ATDA 1C3FA 3AI0A 3UGVA 3OG2A 3KVJA 3VOHA 3D47A 1E4NA 5CC5A 2Y88A 3DYOA 3HPFA 1TPH1 2A7PA 2DSKA 4DBWA 3USZA 4H6KA 4Z2JA 1OQFA 2WCSA 2QVNA 3GE7A 5CZ0A 4QS6A 2QUTA 4LC8A 1PV8A 3B9OA 5DN1A 3M0MA 1XUUA 3NZPA 2PCEA 3KHDA 4WY0B 2A4AA 1C92A 3GH4A 3PWAA 2NT0A 1DJGA 4ZE4A 1E9IA 4LAZA 4HN8A 3VGDA 2BHZA 4QDPA 1W9UA 3WH9A 3AICA 1PBGA 2OQHA 4JQ2A 1TWWA 4JTFA 4Z2GA 3AIRA 1O5XA 3O8AA 2VHLA 4KGLA 3GC5A 1U5HA 4AVNA 4Q8OA 1EXBA 2ODOA 1Z8AA 2DZXA 2YFOA 2BY1A 3WO8A 1F4AA 4X63A 1F8MA 4AEFA 2ZZ7A 3PWIA 1XKYA 1AH4A 1LZOA 3O1NA 4TVCA 2NX1A 3UPBA 4MWAB 2ON3A 2PWUA 5K4XA 1JPIA 4N9DA 2BNJA 5M3WA 3V7PA 5IHRA 5G1MA 1L6SA 3E9AA 3FOKA 2POZA 1BVWA 2W67A 4X2PA 2ZX9A 4BI7A 3BURA 2D1ZA 4NX0A 2W0UA 2ZC1A 1MEIA 5LYRA 4B3ZA 2BVDA 2CWXA 4MTVA 4GOAA 5G2HA 3WQOA 3H23A 3R13A 3TUUA 2OYLA 2WC3A 4PUMA 2C18A 4E4UA 4RPQA 3MWCA 4EPDC 1JAKA 1IWBA 3KOZA 5D33A 3STGA 2O9OA 2WPBA 3V36A 3HV8A 3ANVA 2NV9A 3DIPA 3E38A 1Z44A 4LAOA 2FPVA 4NYUA 1LCOA 1EP2A 2J66A 4Y8EA 4BF5A 5AVNA 2C14A 1NFBA 4RXGA 1XIJA 4TV5A 3K8MA 1PCKA 2F6UA 4KETA 4O14A 4M6UA 1VLWA 1CGWA 3GDBA 3IIOA 4ADSA 3BG3A 2BB0A 2V2HA 3CASA 4RE2A 2PSNA 1L2QA 2KX9A 4J35A 5A69A 3LN3A 2YIHA 2VNCA 4ILSA 4KFPA 4HCHA 1VHCA 1LF1A 1S5WA 3NIYA 3G1SA 4F2TA 4QJ4B 5LNUA 3B3DA 1UQZA 3S5NA 4N2YA 3EWUA 1FDJA 2YCIX 2AKZA 3CQ0A 3O05A 1QUMA 3PZ9A 2ZRUA 1B1YA 4B9YA 5K3VA 3ZSTA 3WL0A 3PN8A 4Z1CA 3NQFA 5I09A 5BROA 3ZT6A 3DC0A 6PTDA 3ARSA 4JTDA 1B5TA 1WZKA 5G4WA 1NP2A 2IKGA 5TQLA 1CX9A 5AC7A 1R8LA 4WUIA 3UXDA 1NDYA 1UUMA 1UHVA 3KEHA 5GNXA 5C9XA 1UWTA 3CYJA 3ITOA 4YMZA 1KTBA 3AOFA 4MKSA 5DCEA 3QZEA 1XJBA 4H9ZA 2GOKA 3UYIA 1B3VA 4C60A 3JU2A 1VJZA 4HPJA 3QY6A 4H7VA 5CZJA 1AQFA 3QTGA 3TOPA 3UY7A 1JPMA 4XAPA 4U28A 2NX3A 3MO7A 5A6JA 4DELA 3Q2DA 3W22A 1LG1A 3NSXA 3F5LA 3GAYA 3IIZA 4TMCA 1WCGA 1TJPA 3SGZA 2YCKX 1VPQA 4L65A 3MMDA 1VYSX 2DT3A 2OR2A 3I6RA 2GVLA 3S6OA 1X96A 3WLSA 3W2KA 2OOFA 3QRHA 3T6CA 3ZYZA 3VZZA 3BOFA 3EDDA 1E6SM 4B5TA 3H55A 4ZGYA 4JIQA 1RD5A 2J4GA 1C8XA 2PDFA 3H2FA 1E0XA 3S9ZA 2D24A 4RV8A 1B9BA 3F2CA 2YLLA 1UP0A 4FNTA 3E6EA 3GVRA 1Z7AA 1X6LA 5K9DA 2ISVA 2I14A 3W7JA 1TJ1A 2ZZ5A 1JNEA 1P0NA 2XGBA 1I8JA 5FI8A 3VD4A 1XSJA 2YCEA 2EG8A 3SCQA 1OT2A 2EKCA 2DPEA 3M43A 1YBQB 4H9UA 4LAKA 4ZL1A 2EEXA 1FA2A 1RCQA 5FF3A 2QDHA 3FYOA 3SEPA 2Z1SA 3EWBX 4PSRA 3PK7A 2FH8A 1EA9C 4RE0A 1IQ8A 4ICNA 1K77A 1M7PA 3OYXA 1OFPA 4DB7A 3V3WA 3AYTA 4I7WA 1CI1A 3WLOA 3FK4A 3GHRA 3N04A 5CPTA 1T0OA 4C1KA 3K13A 1JCMP 2ZIDA 3PB2A 3SCUA 1NQ6A 4R9XA 4HSHA 4LPCA 4OBSA 1J18A 2YCLB 4RDWA 2G4FA 5A8PA 1UD2A 1HJWA 1XP3A 1H51A 1T96A 4OV4A 3WQDA 3GM8A 5BOEA 4LBSA 5D05A 1DIEA 2VRQA 4WK9A 3LRKA 1FHLA 4ADUA 3WX7A 3VE9A 3U57A 1SM9A 3L21A 4YTTA 1SZNA 5LNVA 4HYVA 5I7GA 3BOXA 3SUSA 2ADAA 4I8DA 5AC8A 4LFYA 1QHOA 1EC9A 1U30A 1A5AA 3QPZA 3LD5A 5HINA 1B9ZA 3BAXA 4FLRA 4WIWA 2NZLA 4DZIA 1T8XA 1OX4B 4Y9MA 4EPEC 3SN0A 2Z6JA 3U2OA 5AHNA 4HTBA 3T0DA 1H62A 1TPVA 3IK2A 4H8UA 3PS7A 2P0OA 1AD1A 1DIKA 4ZO6A 2NUXA 1B3OA 4YTSA 2VUNA 4FXJA 3L2IA 4C6LA 3K1DA 2X40A 4F79A 5A6BD 1GQJA 5LGZA 1HKKA 6ENLA 4LVDA 3LI1A 1B3ZA 2J24A 2DZPA 4CN1A 3EA2A 3G1FA 2WZEA 2X1IA 4GMEA 5ABGA 1HKMA 1NWSA 5XIMA 3W74A 3NPUA 3WCZA 2YB4A 3T0CA 3N73A 2PWHA 1MW3A 3MBDA 1WKDA 5LNWA 4IMCA 3WK0A 3PAJA 1GVEA 1QR7A 2GUBA 1IWPA 4D6FA 3GH7A 1UWUA 2JGYA 3FSTA 4IIEA 3FJLA 1XW8A 1G01A 1OHLA 1ZCCA 1EOKA 1DJXA 1E6ZA 4J3ZA 5G2WA 3W7KA 1DJYA 4K1WA 4S39A 2XH4A 5A3HA 3VGEA 1YPXA 4PMZA 1OFBA 2HK1A 2CLOA 5A8OA 2VP8A 1IXNA 4FX8A 1SR0A 4WOZA 1PE1A 3H7VA 4PBFA 3C8FA 5AHFA 4MJ4A 3WLKX 2VXNA 4PB3A 2HCVA 5HXMA 2G3IA 3MJMA 3TN5A 4QNEA 3RXZA 3EWXA 3NVDA 1QK2A 4L64A 3N2CA 1AW1A 1UR9A 1TIWA 4MGGA 3SIZA 3WD2A 4BHYA 1UW9A 5ECVA 1VBHA 1WXJA 1TWDA 3RK8A 4M80A 4AIBA 3NQCA 2V3GA 5D2TA 1TRIA 5SWUA 4H04A 1FWFC 1VFTA 4OZOA 4CQBA 2VC7A 1Y5VA 3BSGA 4DJFD 3GH5A 5KEZA 3TU9A 3RLGA 5D37A 4ZODA 5HDRA 1XYLA 3BICA 3E49A 1PVNA 3GC2A 3R2GA 4IP7A 1UKOA 3HQOA 4LVGA 2OU4A 2GDUA 2VUYA 4L80A 1RZMA 1AH0A 4QG9A 3QPYA 2QJIA 1BLIA 2PTXA 4AEEA 1LUCA 3STPA 3VCCA 1W1TA 4EAYA 5CJ5A 3VIHA 3ARVA 4IXXA 2ASHA 4XIAA 5I03A 3CHEA 4FXFA 1AK5A 5CC6A 1UZHA 2VX6A 3NWRA 5FESA 1LM1A 5D09A 3VDBA 1FWRA 3LTYA 3VNMA 1BQCA 2BY2A 3V0UA 5DX7A 1MW2A 1HP4A 3PAOA 2E28A 1I60A 3H24A 3BZJA 1HUVA 4O8AA 3NOEA 5D2WA 3H2NA 2ZZ2A 1KWKA 3M16A 3WNPA 3TZFA 2YL5A 2YX0A 4I5RA 1XM3A 3MSRA 3MP4A 5JVLA 1H63A 4C7DA 1ZPTA 2PDYA 7REQA 3VUPA 3WLQA 3LXAA 4JTRA 5K9CA 2PDLA 4M82A 3TYAA 1MZHA 3L0KA 2B7QA 2GWNA 3ZVIA 1YXYA 1VC4A 4P7NA 3VOFA 4XUGA 1XSKA 2X1TA 1MFUA 2PWVA 4DJDC 5J8LA 2ZDSA 4LNYA 3M41A 3RR1A 1RD6A 1XLHA 4PZVA 1ZJAA 2XG9A 4O0KA 1EUNA 1VP5A 4L9YA 4JICA 3BSMA 3E0WA 2VI0A 3PG8A 4UTJA 1TWIA 5EMJA 2O9RA 3I65A 2V68A 3BTNA 1GORA 3MHGA 4QDWA 4OHQA 5TD4A 3GTNA 3VD7A 2ZDRA 3UJFA 5A6MA 1JZ4A 3C86A 1S5VA 3LXCA 4O13A 1L6FA 3QHMA 1NJJA 1WA3A 3BLFA 2GYIA 3MY9A 3G1DA 3EAUA 4MY9A 2PEVA 3W73A 1UIPA 1ZQ5A 4UC5A 2HEJA 1CLKA 2QS8A 2CHNA 3QW3A 2Y5JA 4BI5A 3ERPA 1W5OA 5A2CA 1R3QA 4BEUA 5C70A 3UF9A 1JAEA 4A2SA 2VFDA 4XZMX 3AIUA 1XLGA 5EB8A 3VGGA 2E8ZA 4GXPA 3FA3A 3AALA 4JYFA 4QGCA 4M51A 1XGDA 1TB3A 2AKMA 2GSHA 4GIYA 5EY5A 3OHIA 1KM4A 1ZS2A 3TFCA 3H4XA 5C9ZA 4LV9A 4K3ZA 5I3FA 4GGBA 4GINA 4JDYA 5D4YA 1ITCA 2ZYFA 1GEHA 3IJ8A 1W3TA 5HMDA 2AL2B 4O1AA 1O12A 4N7QA 3LBOA 2R94A 4HZMA 4GQBA 5LIXX 1M01A 4B90A 1HZYA 3WF3A 4QEHA 1OD8A 2CLPA 1QI4A 1RBLA 2RGLA 4GWEA 2PBOA 5EMMA 5D38A 5LHEA 5CQ1A 3OTRA 3GG0A 4J28A 3FGCB 1E15A 5JIPA 3WLMA 1C90A 2QT3A 5E09A 4YVPA 2EO7A 3S2NA 1Y0EA 3UVIA 3GTXA 4FA3A 1XQKA 2WB5A 1ELSA 1UJPA 3P0XA 4AD4A 4C6OA 1I75A 4DZAA 3QSTA 3WH8A 3CMJA 5AFDA 1D7KA 1EYEA 1G9HA 5G2IA 1JULA 1HGWA 3DERA 4RNHA 1NH6A 4MUPA 3B0UX 1UOKA 1IEWA 1BPLB 1RR2A 1W2VA 4P8XA 3W02A 1Y65A 1GKRA 1PX8A 3VPLA 3W7EA 1KW1A 1G7VA 4RK8A 3N25A 1VFHA 1KR0A 2J77A 3PBMA 4JNZA 3EXTA 3BW2A 1JCXA 1TFVA 3RX3A 2A3AA 3LLDA 3KLKA 2FH6A 3R0KA 3VINA 3AFBA 3CAVA 3VFCA 4A8LA 4X9YA 1TCMA 1TV2A 1LQ0A 2E1WA 1OG6A 4Q6XA 3DFYA 1G69A 3HGRA 7CGTA 3FKKA 2XSBA 3SDOA 2OLSA 3VGFA 4URIA 4X60A 1Q6EA 2RHGA 1ONRA 3A4XA 3IUIA 4H3DA 1P4CA 1Q8JA 3LENA 1VKFA 3UXIA 3PTDA 1A5OC 5D04C 4J2PA 3MJYA 2FMNA 2Q71A 2V82A 3KTSA 5AC5A 2X09A 1WDQA 1IWAA 1WB0A 4JXCA 4EP8C 1GOWA 2BGSA 3H4WA 4NL1A 3VM7A 4QDMA 3BLEA 4BK9A 3WMBA 4D8AA 1CEOA 1FCQA 3ARXA 1WKFA 4KEMA 2IPGA 1RPXA 4PCPA 1FWHC 3URAA 4OBTA 1EC7A 3MVIA 2NVDA 3T2QA 1YE4A 4M1BA 2ZX6A 2PURA 1RH9A 4NVTA 3ALGA 4AY7A 5LA1A 1TZ7A 1BFNA 2QF7A 4O4WA 5BU6A 3ZR6A 1OC7A 1SJBA 3WL1A 4BQ2A 2R1LA 4C6KA 4YYFA 1EDTA 2TODA 3RLHA 1ICSA 4MY8A 4H9TA 1CGYA 5EPDA 4N4QA 2RFGA 4WHBA 4HMNA 1PJ9A 1SFLA 3LNPA 2ZA1A 3LPFA 4FO4A 3SBFA 1QJWA 1VJIA 3AIVA 3WUFA 4XO6A 4UTHA 2E6YA 5FJPA 3W88A 5FJTA 2HPIA 4U33A 2QF8A 3ZWTA 2BOFX 1SSDA 1HW6A 4HHPA 4XZLX 1Q2RA 1VLIA 3KL5A 3TV8A 3H54A 3NQ2A 1RVGA 2EG6A 3BLOA 2DIEA 3LCIA 1YDVA 5CH9A 2GGEA 1PIIA 3EOLA 4KWOA 2F2HA 4RUBA 5E9AA 3FV9A 3KOFA 4WD0A 5G5IA 3NPVA 1GVFA 4M1RA 4O1FA 3JZUA 4IIBA 3LPOA 3CL8A 3CJPA 3WK1A 4UTTA 1GTEA 3KOYA 4P7RA 1HIZA 4H6RA 4JN8A 1Y8BA 1UASA 4P2VA 4JBRA 3N3MA 4NJJA 4ATLA 3W1MA 4ICMA 5MKGB 1GEQA 5D9OA 4RNIA 4CNTA 4IJRA 2Z2UA 1JF6A 1PSCA 2QV4A 2VJXA 3CS2A 5FIPA 1Q66A 1HN1A 1OT1A 1J96A 1AUSL 3V0TA 4QHRA 2YJQA 4E38A 1DOSA 4MB5A 3SRHA 2WMHA 2D2JA 1XYCA 3ZLHA 3FYPA 1RY8A 1AQMA 1JXKA 3IVUA 5DELA 3MZ2A 1EYWA 3WNNA 3W87A 1OGBA 2GK1B 1EIXA 2INFA 2ZWYA 4WGXA 1EPXA 2QGHA 4NF7A 1KM6A 3B97A 1ZSXA 3PB0A 1V6VA 3NL6A 7A3HA 6TIMA 4DF1A 3WY1A 1O94A 3BQ6A 2WHJA 3PZUA 3ZWSA 1SQ7A 5CPNA 4UTUA 2PRLA 2VZTA 3K4AA 2VC9A 3ES7A 3SY8A 4C5ZA 1ME7A 2Z1BA 5I6SA 1GZJA 4RZ4A 4JIHA 5BMWA 1I1WA 3EXRA 4REQA 2CETA 3FLUA 2CCRA 2BHYA 2GSJA 3DN5A 1CBGA 4O1CA 3M0IA 4OBRA 3AXHA 2YXOA 4V27A 3WD1A 2OVLA 4BKNA 1Z69A 3HG4A 4NKCA 3VNJA 3CB8A 5LIKX 1DL3A 4H4IA 3A6OA 3S9YA 4AWSA 4IPNB 3CMGA 2YBVA 4IPLA 3IAPA 1S2AA 4ZA0A 3L7RA 5D2VA 1QRQA 2NT1A 2QCLA 1CCWB 4YCOA 5DFAA 1QW9A 4WSJA 3DYPA 1SUXA 1XINA 4B92A 3KVLA 4IISA 1E1CB 4RCXA 4UNIA 1POJA 3OIXA 2FLIA 3B03A 4HU3A 2XH0A 3HBLA 3R12A 1K4HA 3W7DA 4AX7A 1TTJA 4GUJA 2GWGA 1R3YA 3HPXA 1DJHA 3D3AA 2XSXA 4B9ZA 1NELA 1TZ9A 2ESCA 2PS2A 3V4BA 5DLCA 1T8QA 1VF8A 4HZ8A 3HOJA 5CZTA 5KETA 1LQ2A 1MDRA 1W9PA 4UTLA 1PYMA 2WOQA 1PKMA 3B9DA 1H5YA 3HG2A 1L9WA 4PTXA 1CXEA 5AYYA 3LCFA 4BFAA 1JCNA 3W38A 2YA0A 3HPSA 3ZLGA 1K6AA 3R10A 3VD9A 1X1NA 5DT7A 2CIPA 3SW6A 3PANA 5G1TA 2ZRWA 4JKMA 2O9TA 2V2DA 4MKNA 3WLTA 3G0UA 4UCFA 5IDIA 1H49A 1TZZA 2YBTA 4LUJA 3W1TA 1K8ZA 3AS2A 1IXPA 3M7SA 4IZGA 1MUWA 3KZSA 1J0JA 1HNYA 1H7PA 1U1JA 2E6FA 4GNVA 4L1XA 1VBUA 2OG9A 1S5NA 4YL2A 3CQKA 4LCRA 4EXBA 1FXQA 4JTGA 4JCLA 4PBGA 1KBIA 1PWMA 1J6OA 2JFEX 6TAAA 1DJWA 1ESWA 2HSAA 1RXOB 2PZNA 3VOJA 5KSWA 1R86A 2A3BA 3DECA 1EPVA 2HV5A 2QGYA 4XISA 1H7WA 1I0DA 1WAUA 3WMLA 4PL1A 2J9ZA 1V51A 5KTLA 1Q6CA 2WNQA 3U5UA 3UJEA 2WHMA 1J5SA 3OPSA 2Z00A 4K8GA 1ZP4A 1K9FA 4JTTA 5GJPA 4DJED 3WQEA 3WH5A 2QUUA 2WMKA 2ONEA 4Y9NA 2HWGA 2IQ0A 1TG7A 2HNHA 3KW3A 3LQLA 4S3CA 1VFOA 3GG1A 4WOQA 2R1PA 1TPC1 4ERIA 3OBKA 2XHYA 3R43A 5CZKA 1H61A 5K4ZA 4IG2A 3U5YA 1F6YA 3CV7A 2BY0A 3C0LA 4FX7A 3RAOA 3QEZA 1KRCC 1OC5A 2V2CA 3MB9A 3BE7A 1TE6A 3L5AA 5L9FA 3SGUA 1XLIA 3N4FA 2YL6A 1TJ0A 1VGAA 4BWLA 1NDVA 5I3DA 4PC8A 4CNUA 2UBPC 1UH3A 1D3GA 3UD6A 4EPBC 4UTMA 5DMLA 3NM1A 3UW6A 4HT3A 1V6YA 2ATSA 2XINA 4FR6A 3KLLA 1H09A 3C4UA 1VPYA 5HOSA 1DTUA 2OZ3A 4G7FA 3FX4A 1US3A 3URNA 4Y6GA 3W86A 1QATA 3M47A 3BLKA 1PDZA 3UGRA 3WN6A 4L4MA 4FXSA 2OSXA 4XV0A 1QPQA 1XRVA 3MDWA 5FSDC 3CUGA 3TQ0A 4H2HA 1SFSA 4NSBA 2J8GA 1W3LA 1ZJHA 2JQXA 3W37A 2WJZA 5C2XA 8XIMA 3WG6A 1D8CA 3TQVA 2XM2A 3PZIA 2CHOA 2W4XA 3OOQA 4QE1A 1A5LC 3C0JA 2DZBA 4HZ6A 3KWSA 3ANUA 1EQPA 1UWAA 2XWEA 5HQEA 3PZGA 2VR4A 3ARQA 2WO5A 3T40A 1EOMA 4K36A 3LPGA 4H7CA 3UCQA 1EFZA 1TPDA 3GTFA 1FWGC 4NY2A 2ZUTA 3RMJA 1EJUC 3F1QA 4ROPA 4C6DA 3R0DA 2PCQA 6ALDA 4PMOA 5DO8A 4CU7A 3ELFA 2O56A 3AROA 3NL2A 2Z2BA 3TCEA 2CWNA 4ZR8A 4XQ6A 3VD3A 2FDMA 1UCWA 2J88A 5ABFA 5AY7A 5I78A 2INEA 4XB3A 3MUY1 3RM8A 4PMXA 3KOXA 5E0KA 2XVGA 5HJYA 4HNVA 5DXXA 4IL0A 4TOQA 1OK6A 3SQMA 3KX6A 3L4WA 2ISDA 4CGTA 2FIQA 2EBNA 4HHLA 2F2KA 1W56A 3MCMA 1LL7A 4ZMGA 2WMGA 4S23A 3NEVA 3ARUA 3TJ4A 2ZXQA 2XZ7A 4I9MA 1ME9A 3Q45A 4D6GA 3QQWA 1FOBA 1OF8A 1EJVC 2CBVA 5XIAA 1XCWA 4Q8MA 1NWRA 4I5XA 4ZCWA 1BG4A 4WY0A 5BOOA 4YNGA 1HX0A 3CV2A 3RRAA 2R1KA 2Y8VA 1XC4A 4HP5A 5CGTA 4WGHA 2NLIA 1CPUA 4IX0A 3K2GA 1PUDA 3AIEA 2C6QA 2GJLA 5AHMA 3GDTA 2WZMA 1P1MA 3R0UA 3TIMA 2B4GA 3O0FA 4JHMA 1M65A 4TUFA 1E71M 4AB4A 1PZ1A 3WF0A 2BY3A 2P0IA 2EHHA 3FVMA 4XZWA 2ZQ0A 4D6JA 5CSUA 1RVKA 3EX6A 4FPSA 3AMCA 1F3WA 1VZWA 2NQJA 4F9DA 5U7SA 4IX2A 4LF1A 3VIKA 4QR6A 4FAMA 2WZTA 4HPHA 1QAPA 1H2JA 2FGLA 3M0ZA 1V6XA 4E6MA 3W1PA 3Q94A 4Q22A 4AD3A 1FWTA 3TTQA 3W01A 5AYBA 4HJFA 3MA8A 3NZRA 3SURA 2YGYA 4HNLA 4H83A 3WD0A 5AC6A 2Q02A 3GNOA 4L4LA 3QM3A 1T40A 2UY4A 4LS0A 3W81A 4DJFC 3FXYA 2QUMA 2VL4A 5IBXC 4WEVX 3ITVA 3M0KA 3C2OA 4Z17A 2PWDA 3E2SA 2W92A 4L6DA 4H19A 2VX7A 4WLCA 4AZ5A 1GW1A 4DWSD 5BU9A 3CV1A 4LXFA 4S3JA 3C2EA 1TUFA 1TMQA 1BGGA 4AVOA 1MI3A 1TR1A 4ADTA 1F3EA 3ZR4A 2YXGA 1GVRA 5TBOA 3S8HA 4LAMA 1A49A 2F61A 3E02A 3UNDA 1EXPA 2CLLA 1WYIA 1IXQA 1US0A 3CEUA 3RO6A 3L4TA 5IM51 1DE5A 2XIIA 2ZX8A 3LCGA 2CXGA 3MYOA 1CECA 3CUJA 1OCJA 4CEUC 3PG9A 3TKFA 1JCJA 3W7MA 2ZX7A 4L4OA 4GHRA 1LRQA 2VWTA 3D3FA 3IJ9A 2PA6A 4AISA 1D9EA 1LLWA 3Q37A 3WQCA 2E7FA 3VK5A 2EPHA 5EBUA 1J93A 3OW1A 5HR6A 2AQOA 4PB5A 4FNPA 1C91A 3L4UA 1XV8A 4LCQA 5D8ZA 1JCLA 2PRHA 1XDLA 2CPUA 1TA3A 1GQLA 2GJNA 4JN6A 3WLPA 4JEJA 1F05A 4DM2A 1DTNA 2HXTA 3GBDA 1RK5A 1JRCA 4UUIA 2W63A 1ISXA 1VFLA 1B57A 1U83A 1KGUA 3UPWA 1LT7A 3VCRA 2P1FA 2XM1A 1MNSA 1E1FA 3SADA 4U2ZA 4CN4A 3ABSA 1I2RA 3UEQA 5EMLA 3TYCA 3VDAA 3VMNA 3S5SA 3LV6A 2C91A 1M68A 3LCLA 2PLJA 1BTMA 3LXBA 3BUVA 2J62A 3N11A 4CD7A 3TTEA 2D0HA 1FP9A 5AKQA 4ZSTA 1HO4A 3G3MA 1UUQA 1ITXA 5REQB 3RHGA 4WJ8A 1KBLA 1BKSA 2JK2A 2HZGA 3LSBA 5K2ZA 3CT7A 5D9NA 1EBGA 3LOTA 4BF7A 5IRPA 1TQJA 4S2BA 4RE3A 1YEYA 1JUEA 4C7FA 1KD0A 4AWEA 3LCWA 3DX5A 1N55A 3CK5A 3NR0A 4FMVA 4NJHA 1XLJA 1PKYA 1O4UA 1K9EA 3ABOA 2OMAA 2FVKA 5H2ZA 4N6FA 3ZVHA 3KHJA 3W2NA 1FWDC 4KWUA 3DDMA 4M29A 3DC8A 2XDFA 2Y2WA 4QNWA 1ADOA 5H6HA 3GQYA 5FJOA 4MPKA 3FFSA 1OC6A 4K39A 2HQAA 2E77A 1KRMA 2PTYA 2X1RA 3O6YX 4XAYA 1XC6A 1JYXA 3QY8A 4B4FA 1DORA 2GVJA 2RAGA 2ZRZA 2CW6A 3ARRA 3W6YA 4D6CA 1CLXA 1V3LA 5I3GA 3CUFA 4JIEA 4LVFA 1J8VA 2V5JA 1FFQA 1QTWA 2WQDA 1PB0A 3S5ZA 3QGKC 1TV5A 3T0AA 3HGSA 1TV7A 1HO1A 3ALFA 2E9BA 3BH4A 1A53A 3V5FA 2O4MA 4IH3A 1P6CA 2Z4GA 1GQIA 3H2EA 1UC5A 2IKJA 4AXKA 4PCTA 1YIXA 4PUEA 3W6LA 2PP0A 3G18A 3G6MA 4GK8A 1WO2A 4CD6A 4WDUA 4CU6A 5HMFA 4NJKA 3O16A 7TIMA 1RBAA 5A6AA 4LVBA 4OFCA 4ZQCA 2QDDA 2VDGA 3M5XA 1TPWA 1BYBA 1JGMA 3G8RA 3RG6A 5CC3A 2HJPA 3OEXA 3RIKA 1R87A 4DWDA 5B7ZA 2BODX 1H7OA 3FNDA 2GJXA 2O7QA 4UMCA 3M4HA 4YCPA 3M7WA 2BTMA 5EKYA 3MCOA 2YDRA 3WQGA 4B3LA 1WBHA 3AXIA 4GBDA 2VMFA 5M03A 1P7TB 4J3WA 3BSHA 4UBPC 1A5CA 1HTIA 3KCOA 6REQB 1FHDA 3NQEA 4R3UA 5EMYA 2OKOA 3NVTA 1EO7A 1RBOB 5F7UA 4QEEA 2DQXA 2WW5A 3RJXA 1E70M 4K38A 3PZVA 4IGMA 4CQAA 5EU9A 2H90A 3VOCA 1TPUA 2EAWA 3NQBA 5HK4A 2X7VA 4NP7A 4IUGA 2Z7GA 2GVYA 1ODUA 4C1NB 1ZRQA 1YE6A 2BXYA 4G5DA 3QV9A 2XYLA 1S2CA 3MMUA 4MG4A 3D0CA 1JZ2A 1CWYA 4KEVA 4B5XA 4I9AA 4ECLA 4EWJA 3EKLA 1EJXC 2XPKA 3H2MA 3POCA 3CTTA 4AZGA 3MP3A 5HNNA 4OOUA 9XIAA 1XLLA 2DQWA 2D0GA 2VVNA 3VNZA 3A24A 1BAGA 1X6NA 1XRTA 1M6JA 1PTAA 2X2GA 1W5NA 4UFIA 3SRKA 3CHVA 2E9LA 1R46A 5FJRA 4HNCA 1VCGA 4FI4A 5CG7A 1JDAA 2XFFA 2G97A 3PZNA 3FHAA 4DI8A 2VZUA 1JPHA 3AU6A 1U5JA 2WSKA 2YL8A 3DFNA 4B5SA 1H60A 4PUKA 1A3WA 1Q7MA 2VX4A 2HNEA 1HJUA 3P8IA 1NIUA 4NZ5A 3QSRA 1SZRA 1GWJA 3AXKA 3W25A 5ECUA 3KFTA 4M6PA 2VZSA 3ITLA 3GNPA 2FHBA 3EBVA 3IJLA 3NSNA 1HJVA 4UTWA 3GVGA 3NQ8A 2I9EA 2VEFA 3EWYA 3L12A 4QS5A 3DHUA 3LHZA 4E0CA 3U2ZA 3EEZA 3O07A 1LL6A 3K46A 5E0CA 1IZJA 1PIFA 1C7TA 1BWVA 3XIMA 2Z6IA 4XTDA 3ABXA 1XLCA 2OX4A 2GUUA 2QKFA 1IEQA 1WBJA 2Y85A 4MF4A 4GNJA 5TNVA 3Q67A 3AYSA 3WQ4A 2D2OA 2A3LA 3WMSA 4S3AA 3BCJA 4D8ZA 1ZENA 2I56A 4PRWA 1R38A 2J7DA 3I4KA 2FB3A 3P81A 3SCTA 1K7EA 2KAUC 5HJXA 3GXIA 4Y8FA 3S1VA 5C54A 2OXNA 3ZS4A 1LBFA 3GDLA 1O95A 2QZRA 3DI0A 5FF7A 2FZMA 3HB9A 1JYNA 3R4IA 1D2KA 1UR1A 4R7JA 2KZHA 2TMDA 1F8IA 3EGJA 3A13A 3H7RA 1C9WA 3LPPA 3U48A 3LCHA 2EF9A 2FTYA 3BW3A 3UR8A 3V16A 3N34A 4O12A 1B3XA 1EH9A 3NQAA 1O60A 3HQPA 3OQEA 1SJDA 3W0KA 2CXEA 3PTMA 4AX6A 1KM3A 3W85A 3OGVA 2XTKA 5M1TA 1VFUA 2BP1A 3GR7A 2CLMA 3AMKA 4DAIA 3EX2A 2E25A 1SR9A 3S4TA 1GJPA 1BYAA 1E4IA 4J5NA 4TX6A 4FB7A 4IFKB 3WDQA 4EXAA 2QW5A 4HPGA 5DY3A 4B5VA 1GG1A 2V6AA 1E3XA 2XIBA 1LWIA 2Z1VA 1SZGA 1UKTA 3RN6A 4IMDA 3GKFA 3FIGA 3FN9A 1GVSA 4U10A 4QAWA 2PDJA 3OLDA 2VD8A 1U33A 4KIRA 1CT5A 4H2CA 2CNCA 4NU7A 3R5EA 4IUOA 1VFMA 3LM7A 3NQ7A 4NZFA 2PPGA 3UZWA 4FNUA 3AJXA 4PEEA 3FS2A 3MHUA 3P93A 4TIMA 2G5WA 2DEPA 4QG8A 4UZUA 2RJHA 1K8YA 3O0KA 4GVFA 1GOKA 1EUAA 1XYAA 4LH8A 1E9ZB 1UD3A 5BXSA 2G50A 1L8PA 4GI8A 1GVOA 3PHAA 5J04A 4UFKA 4CNNA 2FKPA 4HNTA 1UD6A 1OYAA 1M9HA 4QBXA 1FWCC 4AZCA 1G4EA 3WNOA 4HSOA 1KCKA 1G7UA 1MVYA 3A3HA 3P61A 3VZXA 3TX9A 1RA0A 1UWQA 2GDQA 5AB3A 1J0IA 3N6HA 5TF0A 1RA5A 2ACSA 1DWFM 1R7OA 4HNUA 1M53A 2A1YA 4UQAA 1IT8A 3DKLA 4JFTA 4ERGA 3QC3A 2PFHA 4AF0A 4FOUA 5D9MA 4UTKA 3D5HA 1FCUA 2VCCA 1EZWA 1HKVA 1MEWA 2J8FA 1RUSA 3AMDA 3WDPP 4DBEA 4MAVA 2Y5SA 2PTWA 1VAHA 3TZNA 1B4EA 1J11A 2B7NA 2ZX5A 5EA9A 4DM1A 1OFRA 3WEZA 2F6XA 4IIFA 2QIWA 3PZOA 3IVTA 3GXDA 2CZFA 2J7CA 3SCWA 3S46A 2AL1A 1IEVA 1YHTA 3L65A 2YZRA 2NQ5A 4PMJA 3LK6A 4JTUA 4V1YA 4Q8TA 1JCYA 1F9CA 4PUNA 5GPRA 1K3UA 2FDSA 3QKEA