4F2UA

Structure of the n254y/h258y double mutant of the phosphatidylinositol-specific phospholipase c from s.aureus
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
304
structure length
304
Chain Sequence
DSLSKSPENWMSKLDDGKHLTEINIPGSHDSGSFTLKDPVKSVWAKTQDKDYLTQMKSGVRFFDIRGRASADNMISVHHGMVYLHHELGKFLDDAKYYLSAYPNETIVMSMKKDYDSDSKVTKTFEEIFREYYYNNPQYQNLFYTGSNANPTLKETKGKIVLFNRMGGTYIKSGYGADTSGIQWADNATFETKINNGSLNLKVQDEYKDYYDKKVEAVKNLLAKAKTDSNKDNVYVNFLSVASGGSAFNSTYYYASYINPEIAKTIKANGKARTGWLIVDYAGYTWPGYDDIVSEIIDSNKLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Competition between Anion Binding and Dimerization Modulates Staphylococcus aureus Phosphatidylinositol-specific Phospholipase C Enzymatic Activity.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Lyase
molecule keywords 1-phosphatidylinositol phosphodiesterase
total genus 114
structure length 304
sequence length 304
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 2012-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 4f2uA00
3EA2A 1DJZA 1DJXA 3CH0A 3RLGA 1VD6A 1XX1A 2OR2A 1T6MA 3PTDA 4S3GA 5T9BG 5T91A 4F2UA 1PTDA 1DJYA 1QASA 1QATA 4GNKB 3V1HA 3KS5A 3V16A 3H4WA 3RLHA 1AODA 2PZ0A 4QJ5B 3H4XA 2PLCA 3NO3A 7PTDA 5PTDA 4I9TA 3OHMB 1T8QA 4I90A 2ZKMX 2PTDA 1DJWA 2F9RA 2OTDA 4OECA 4RW3A 4F2BA 1DJGA 2OOGA 3V18A 4Q6XA 4I8YA 3EA3A 1GYMA 1DJIA 1DJHA 4PTDA 4QJ3B 3I10A 6PTDA 3L12A 3EA1A 5T9CE 1ZCCA 4I9JA 1YDYA 2O55A 3KS6A 2ISDA 4RW5A 4F2TA 3QVQA 3QR0A 2FJUB 4I9MA 4R7OA 1PTGA 3MZ2A 1V8EA 1O1ZA 4QJ4B 2P76A 3QR1A 4RV3A
chains in the Genus database with same CATH superfamily
3GTXA 5LSMA 3VNKA 2PDIA 3AUJA 2WCAA 1X8FA 5CGTA 3K8MA 1DTUA 1WKFA 3LXBA 1E70M 3K4DA 4YJ5A 1P6WA 2EBNA 3Q67A 4ZFMA 3T6CA 3MI6A 1F6YA 1KM0A 4ZSUA 1JZ3A 1XLKA 3GQYA 4Q8NA 3WK2A 2ZRWA 5HNRA 3H2OA 2HVOA 1RJQA 2BV9A 5FAJA 1PKMA 3M9YA 1KFCA 1KA9F 1KKOA 1Q7ZA 4EPEC 1ZAJA 4B2DD 1J2WA 3KTSA 3EOSA 4IT1A 2QZRA 2ACUA 5HWNA 1DE5A 2J7CA 4S39A 1B9BA 3B4UA 4GKTA 2WSQA 4X9YA 1H62A 2O92A 1UWRA 2V3DA 1B30A 5K3VA 4ICNA 5M1TA 3RU6A 1A50A 1VQTA 1V0NA 4JTCA 3NG3A 1QO2A 1XSKA 3THCA 5JIPA 1P48A 3WO8A 4GUIA 1FRBA 4AD1A 3N3TA 2E6DA 1JZ6A 4CCZA 7PTDA 1W9VA 3DH7A 1M68A 3F2CA 1HJUA 1X1NA 1XF0A 4OOUA 3B0PA 1V6YA 3CIWA 1BF6A 3E74A 4ICCX 3SCOA 4A8NA 4JTHA 3EKZA 3WYZA 1KFBA 1N55A 2WZTA 1TPWA 1OCQA 3UESA 2BFGA 5HA7A 2DZPA 1FHDA 4FXSA 3B8SA 3BW2A 2VC7A 4KWOA 1JL8A 1A3WA 4ZR8A 3UPMA 1UWSA 4ZXOA 4RZ5A 1J12A 1AW1A 2FZNA 5FF2A 5A6MA 2JALA 5DO8A 1YTKA 3KXQA 2WJEA 3O0FA 4TVDA 3VM5A 3E6EA 3UCDA 3IAQA 1SW3A 2Z24A 1C91A 4IICA 1GG1A 1AH3A 4R34A 1YYAA 4AEFA 4BJHA 5EU9A 2E6YA 3S5NA 3WX7A 2EPLX 4AX7A 1VBUA 1IQ8A 1W1YA 3SSZA 4DNHA 2Z1SA 4GIAA 4WDXA 1VHCA 3STGA 3HIJA 1LQ0A 1Y8BA 3AIVA 3CQIA 1TCDA 1UR8A 3CC1A 1Q7MA 2XUCA 5HANA 4WDUA 3QN3A 3UWQA 3WLQA 4A35A 1VBHA 4YNGA 3HPSA 3NZGA 2HE5A 2HK0A 1R86A 3LXCA 5I06A 3OODA 2W61A 2Y5SA 1UMYA 3W87A 2Z2AA 1Y0EA 1TZ7A 1EDTA 3GZAA 1KM6A 3BXWA 4FNTA 2PWDA 3KL3A 3L66A 3CQJA 1Z9AA 3CZLA 1BD0A 4MYXA 2YL8A 5CGMA 2ATMA 3K46A 1X7IA 4UWMA 4ERAA 3G1FA 2Q3OA 3N3MA 3TN5A 3OLGA 4R9XA 4RPQA 4EAYA 1HQTA 5F2IA 4GG9A 2HCVA 3UGRA 2QYGA 2AGTA 2QUMA 2J78A 3FSTA 4D1JA 3V0UA 2GUBA 3TU9A 2DSVA 2O56A 4DZ5A 2XJ7A 4LH8A 1KCXA 2E1DA 5EFDA 5A95A 3KRSA 3L5LA 3W1PA 3APGA 3ZJ8A 1HW6A 4H7ZA 3HG3A 2NV2A 2QDEA 1NQ6A 4J27A 3GNDA 4H7CA 4AB4A 1W9DM 4O4VA 5LGXA 3UPBA 2I14A 4HNCA 1VKFA 5HR7A 3KBJA 4CEUC 3BK0A 3SCRA 4DBEA 1JEZA 1BAGA 4EOUA 1Z8AA 4EX4A 1O5XA 1Y65A 1XQKA 2FH6A 3AS0A 3DFTA 4P8UA 4ZQOA 1LG1A 3GFYA 3PZOA 4TX6A 2DV0A 3MQTA 2YL6A 3IVTA 3H23A 3BSMA 2UY5A 3GG8A 3DBPA 2VURA 3VD9A 1B90A 4TVCA 5HQLA 2W6RA 1F2JA 3BH4A 5HBFA 5C2XA 2HMCA 4MADA 3UA3A 4IF2A 1R3YA 1J93A 3GTHA 3LZ5A 2JEPA 4QLKA 4JTUA 1XGZA 2EG6A 2PGWA 1PX3A 4AZCA 1DVJA 3MKCA 2NVAA 4UB9A 2CZVA 2EG8A 2J8GA 1PHQA 2YYTA 3M41A 4LVDA 2GPTA 4IQJA 1QHZA 2YGYA 1N7KA 3RG6A 2ZADA 4D6IA 4JL1A 3VI2A 2OG9A 4LBRA 1G69A 2QDGA 1W3IA 4LGXA 1JPHA 2ZUMA 5I3DA 2XN1A 3LHZA 4AMAA 4TTUA 1I6NA 2GFTA 5LNWA 1BSIA 4WKHA 3ZJ6A 1BPLB 4WIWA 4G5DA 2HPIA 2ZFAA 2BY3A 4R9OA 1JCMP 2A1YA 5A1AA 4JNYA 3W7NA 5GNXA 5AC8A 2WLYA 3QTPA 4NT0A 3NQVA 3W7KA 4D6CA 2QCCA 4NU7A 1XLBA 5EMKA 5CJMA 1VS1A 4GINA 2ZE0A 2TPSA 2XHYA 2MANA 3ELFA 5ABHA 3AQUA 2WO5A 2VO5A 1EBGA 2I7GA 3W28A 3I3BA 5KSWA 4YIWA 4YHEA 1DJGA 4D9PA 4HOZA 1VFOA 4RE3A 3E0IA 3O3RA 3W53A 3LSBA 1BVWA 3M43A 3ZVHA 4ADSA 4KWSA 1DIEA 5DBUA 2RUSA 1A5OC 1FFRA 1Q4NX 3AI0A 3VNJA 2TMDA 2CC0A 3W7OA 1EJ7L 1M7XA 1UKTA 2PU0A 2NT0A 3E0VA 4TVUA 3BV4A 3T05A 1GKQA 1HXJA 4ACZB 5LNSA 3B9EA 1XLJA 1CENA 1TELA 3ICJA 3GSMA 1GVIA 1SGJA 4ORMA 3ZZ1A 3G1HA 2PZNA 1R8LA 3VUSA 4W93A 4ZCWA 3KDOA 2PSNA 2QPUA 3R94A 3PJTA 1V3KA 2HVMA 1UKQA 4UTJA 3WD3A 3N2BA 1XS2A 2F6UA 4AMCA 2Z1WA 4PN2A 1XWYA 1U5HA 4X61A 3IRSA 2QULA 4MJZA 2ZTJA 1K1DA 4Q8PA 1SFJA 3TW6A 2Z1KA 4NYYA 3T0TA 4B5WA 1RZMA 5DCDA 4KGLA 3HN3A 1XM3A 3WBXA 1WKYA 3B9AA 1V6WA 3BC9A 5I09A 3LCGA 4JGDA 2JF6A 3WLTA 1V02A 3LY0A 4G7EB 4JTQA 4XSLA 1H50A 2D69A 4IP7A 1BYCA 2G5WA 3UZYA 3ZT5A 1Z42A 4UTKA 3NL2A 4AFYA 5G1YA 4QDWA 1B57A 4CNUA 3AYVA 4OFCA 4KF1A 1YDNA 1TZ9A 4GKLA 3F4WA 4H9XA 3ONBA 1ONWA 3KW3A 4LV4A 3PUOA 4WY0B 1NWUA 4J3XA 1I60A 2IXVA 3L67A 3H70A 1Z3NA 1EZ2A 4RZ4A 3WNNA 2QDDA 4ZQPA 3GIPA 3KUMA 2PDYA 4GYJA 1WV2A 1EH9A 1TVNA 1YQ2A 3KVKA 1I2OA 4P8WA 1QUMA 3ARUA 1LYXA 3RR4A 1K6WA 1VRXA 3QMSA 4B9ZA 3S1VA 1NWRA 4WXZA 4JX5A 1NEYA 2WKGA 1K6AA 2PUZA 2BX7A 4LAKA 1EWEA 4YVXA 4M7TA 2VL4A 2H9AB 2VFFA 4N6EA 5BU9A 1D3GA 1E43A 4JTTA 4EXAA 2PDBA 1Z44A 3NA8A 4DELA 4WGHA 3FDKA 2J7EA 1AQMA 1RD6A 5LA1A 4DF0A 3E1F1 3H2FA 2E28A 3R0KA 3ZT7A 1M1BA 3WQGA 4LBSA 1W31A 4W85A 3RPMA 3VIMA 1BVNP 2C16A 5PTDA 3GTNA 4OVXA 3CLWA 3TE9A 3EYPA 1ZL1A 4XBJA 4L6HA 1NIUA 1WE5A 1P6CA 4XAFA 3N2OA 2GJXB 5CZSA 2WVSA 4L4PA 3TAOA 1DQXA 1IT7A 3H21A 1H1NA 2WANA 3BLEA 4GZEA 2CERA 1A3HA 1WXZA 1TMLA 2F6KA 1ZAIA 1WBHA 3LRLA 4QBXA 2WXDM 3M0MA 1NFBA 3I3EA 1RQEA 3FYYA 1OCJA 2FHBA 2ZA3A 4WX2A 3U2EA 1R9ZA 2WVVA 1H09A 1JNDA 3L4ZA 4KFOA 3ZO9A 2PA6A 5I00A 4XVEA 2WBKA 2X8RA 3PBGA 1AD1A 2CLLA 2R14A 1V6TA 3WSUA 4HK6A 3U7BA 2ISDA 1ZP3A 3IEBA 3VX1A 2CITA 4DUXA 3NQ7A 3SRHA 2Y4SA 1JCJA 4IMAA 1BKSA 3KX6A 1FWGC 3I4KA 1MEIA 4W5UA 4Y9OA 5AB3A 4AHPA 5ABFB 4AZ5A 2V5CA 1GZGA 4S38A 3GDMA 3KTCA 3OZPA 5L6UA 1KD0A 2XVPA 2P1FA 4JNZA 1GYMA 1ZENA 1S2VA 3TC6A 5AC4A 4XQ6A 1EIXA 3KL5A 1MQPA 5BOEA 3VPLA 5A3HA 3UEQA 2YSWA 3TZNA 1SYTA 1UR1A 4JQ1A 3F4VA 3UZ5A 1OX4B 1L6SA 1NFPA 3EB4A 4W8AA 1E1CB 1E1CA 2BGNE 5T8GA 5AHIA 1LOSA 4JFTA 2VEPA 4PUMA 2F38A 2Z1VA 5C8BB 3WH8A 1PTDA 4AWEA 4JYEA 1TMQA 3MUCA 1W9XA 4UTTC 4L9YA 3UCQA 3LCLA 4FOJA 1HJXA 4GQQA 3I6TA 4HYRA 3BSGA 3C4UA 1XDJA 2HVNA 1YIXA 4LAMA 3EDFA 3M47A 3SGZA 4DWSB 5BWFA 2HQAA 5A8MA 4JQ4A 3WH6A 1IV8A 2WVUA 3QLLA 1K02A 1EB3A 2ISFA 1QNVA 2Y5EA 1NP2A 3NJ3A 1TWIA 1J96A 3ZYZA 3TFXA 3WL1A 1ZY9A 3N6QA 3SDOA 1OFQA 3RHGA 4REQA 5FI8A 3M44A 4MB1A 2W0UA 1UPMB 3ZFHA 1UZ4A 5GJMA 1IWPA 1PYFA 3W2NA 4J3VA 3WDIA 5CBJA 1C8XA 1XCWA 1TWZA 4I5XA 4HPJA 2NT1A 3M5VA 1Z89A 3ARSA 5EMMA 4I8YA 3CL7A 4LC6A 3SCQA 2RDUA 2A6NA 2V8ZA 1JYXA 2XZ7A 4NXSA 4DJEA 4Q7NA 5E9AA 4XO7A 2NX9A 4EWND 4Q4QA 2Z4GA 3EDJA 1QAPA 4Q4MA 4DX3A 2DW6A 3IACA 1O68A 4DBSA 5A8QA 1CX9A 1SZFA 1JUKA 2WJZA 3CO4A 4JN6A 3EWXA 3NPVA 3TLLA 1XD1A 1WCGA 4WK9A 4DWSC 1PE1A 4AZCB 4D2JA 2NLIA 2KX9A 1KW1A 3IVUA 3P74A 1QXLA 1CDGA 3ARZA 2O9PA 5I3FA 2DP3A 4XZMX 4GLEA 2E1WA 2I1OA 5DRCA 2NQ9A 3ZJKA 2ACRA 3CS2A 3HO8A 4PL1A 1QNSA 2C0AA 2JQXA 3SQLA 2D1ZA 2BGQA 3STPA 2YPIA 4UMAA 2XINA 6REQB 4V27A 1E6RA 4HNTA 3AMCA 5LHFA 1WDSA 3N2CA 4QE4A 3M0VA 4B5NA 1TZZA 3B8TA 2HROA 1Q6FA 4XUGA 3KBMA 3DYMA 4A2SA 5D9NA 2EPHA 1OCBA 5EBUA 4J28A 1LTDA 2YDQA 2IQTA 2PDHA 1NDZA 4XZBA 2PDCA 4PZVA 2JGYA 2ZUTA 3B06A 3R25A 1HFBA 3IWPA 3SCNA 3ES8A 3VGBA 3HG2A 3H22A 4QS5A 4H9TA 1WOBA 3CL6A 1TJ2A 5I07A 4NAFB 4Z2JA 2XU2A 1LBFA 1TVPA 3L4XA 4ZL1A 2E40A 4I5UA 2P5NA 4JTSA 4IQEA 3RMJA 1VB9A 1L6YA 4LRSA 1GG0A 1M01A 1S1RA 3GFXA 2CLEA 2PC4A 4ACZA 3S6TA 1XX1A 2QHAA 1Q4WA 4E2VA 1Q6EA 2E5CA 2J13A 4DEFA 5LGZA 3HMJG 2ALDA 3L2MA 3RX4A 3KOZA 1FWHC 1LUCB 2OOFA 3NDYA 1V93A 2OT0A 4DRSA 3WG6A 1ONEA 3UBPC 3D3FA 3MSDA 1RV8A 5CC6A 5DXYA 2PRLA 4CNPA 4IMEA 2WKJA 2WB5A 2R94A 4JYDA 3FA4A 4FX8A 3T2OA 1XQLA 3TUUA 1U30A 4F0RA 5KZ6A 1SW0A 4XO6A 3P8IA 3IK4A 1DHPA 2QXWA 2DSZA 3AROA 3C0LA 1ECEA 4J3UA 3LLXA 3WLPA 2FZ8A 3N6JA 1THFD 1TJRA 4IQDA 4FAMA 2HK1A 1CXIA 4Z17A 2P8BA 2VWSA 3W7EA 1TG7A 4MPKA 4LVFA 3AIQA 2OGYA 1GJUA 3TYCA 1POJA 4S3EA 4LB4A 1NF7A 4XIMA 1ISVA 3AIUA 3NSXA 2GZXA 2ZVIA 3KOFA 1MW3A 5A6LA 3FKRA 4K37A 3UWEA 1TKKA 1E9IA 3EWCA 2PWGA 2Y70A 2FVMA 1V6XA 3HBLA 2CESA 4WDTA 3W2MA 4C6CA 2WK2A 3WF1A 1LCOA 2VQTA 3ARVA 3BE7A 3CU2A 1X1ZA 3KCLA 1PV8A 1NJJA 1S5VA 5GVJA 1ZLPA 4IM4A 3SZ8A 2YDAA 3R4IA 5A6SA 5AECA 4LWWA 3G5EA 2NX3A 3O06A 4R27A 5HJXA 2FTWA 1P43A 3S47A 1H41A 3SCPA 1K8XA 4M1RA 3WMLA 2ZZ5A 4HCLA 4YTTA 1JPMA 3TQPA 2ZXDA 4DO6A 1U5VA 2GUYA 1UD4A 1G0CA 3NXLA 2F9RA 3EWBX 1UMLA 4HCHA 2YZ5A 4GQBA 1MXSA 3OYXA 5CSSA 3S1GA 1OF6A 2V3GA 3A4AA 2TAAA 2E0PA 4HHPA 4HPNA 4GNKB 1YW1A 5CCZA 4A05A 5FD0A 4YLWA 1TA3B 2I5IA 3QMRA 3NQ2A 1W17A 5GQBA 4ZTYA 2ZA1A 3B4YA 2YLLA 5REQA 3OGRA 3BGAA 3DX5A 4R7WA 3CMFA 2QS8A 1UR9A 1E4NA 5K9CA 3ONCA 3C56A 1GOWA 1I8JA 5JMUA 1CECA 3L23A 4MG4A 3NQ6A 1QHOA 3NZRA 2XVLA 4G1NA 3TN3A 1PPIA 1AFSA 2Z6IA 2RFGA 3T9PA 1AJ0A 1CLKA 9XIAA 1GHSA 2X7VA 4UTHA 3RIKA 3IRDA 4GVHA 3V16A 1JJKA 3CH0A 2OWXA 5KMYA 3DENA 1CGWA 4YYFA 3VX0A 3OPSA 3SY1A 4XBSA 3NZQA 1R2SA 1V0LA 4JTDA 3LV6A 1P7TB 3IV3A 1UR4A 5A6BD 2HPMA 4M56A 2ZUVA 2AQOA 4Q8VA 4X2RA 5C0QA 4U3CA 3TQKA 3AXKA 1U1JA 3BO9A 1S2WA 2W9MA 1IWAA 3E0LA 3QYQA 3L7RA 4G6CA 1YRRA 4H9VA 3QZEA 4DUVA 4ILSA 5DT7A 3O2LA 1N82A 3FGCB 5H8MA 2WWDA 1LWIA 1SO3A 1G4PA 4WGXA 2GGIA 1XLDA 1ISZA 2VC9A 3C3NA 4IG2B 2XFWA 4PCSA 3I7SA 3UR2A 2V5KA 3KZSA 3G18A 1SW7A 3VTRA 4HTBA 1XRFA 3A22A 2CWXA 1WKDA 1BVZA 4LUIA 4IHCA 2WHKA 4U5KA 3PPGA 1W1IE 4YTUA 3ECQA 1G5AA 5M2FX 4FK9A 1H61A 2Q8ZA 2FPTA 4UQEA 3F2DA 4PEKA 3BAXA 3T0BA 1HP4A 3NTYA 1CI1A 2Y8VA 1NDVA 2CETA 4HZMA 3QSRA 4ZOEA 2D0GA 4GIEA 3RCYA 3SY8A 3NM3A 2EJAA 3PUGA 1G6CA 5CJNA 3UERA 4PBFA 1UP0A 4HNUA 1J11A 1R30A 4DYJA 2YYUA 5K4XA 4H7VA 3N9SA 1NARA 4ZQRA 2D3LA 2QGYA 3EMCA 1H7WA 1Y5VA 4CQCA 4P7LA 1VBJA 4FLRA 4Z2HA 1AH0A 3TFCA 3TCEA 5DANA 1J10A 3N1AA 4IJBA 4BQ2A 1E0UA 4LANA 1HTIA 4D8AA 4Q8QA 3R0DA 4KS0A 2O7QA 2WZHA 3RYSA 1FDZA 4IX2A 4M6VA 4U2YA 1LRTA 4LCQA 1M41A 2TODA 4KEZA 2VEFA 2XZ9A 3G0XA 5FIPA 4WSJA 4A3HA 3W1TA 3FVDA 1GVRA 1EGVA 2L5HA 3LNMA 5IFPA 4D72A 5F2LA 5CH9A 5EMJA 3SEPA 1Q8AA 2BVYA 1AJZA 3FXGA 3EXRA 3FIGA 3F5LA 2OT1A 1OT2A 4HD5A 1UWQA 3TOPA 2AL2A 1XYLA 3XISA 1HL9A 3WH7A 3VFLA 4DYKA 3M64A 1OZQA 2WHLA 3DKLA 1XIIA 3KS5A 4XKMA 1E15A 1P0DA 4H2HA 4C91A 3IJ7A 4AD5A 3BICA 2QMKA 1ZCOA 2X16A 3Q45A 4NUWA 2ZC8A 3EEGA 1KM1A 1BYDA 5CC7A 5I6SA 3EOEA 4YXGA 1F6PA 2OODA 1LL7A 5FEZA 1WUFA 4H8HA 3WLRA 2I5GA 1W5OA 3OHIA 4GYPA 4NSBA 5E6ZA 4L6DA 4DJFD 1X7FA 3VGGA 1PUDA 1KLZA 2F2HA 4XB3A 2C1GA 3ORWA 3BW4A 3PBVA 4LYRA 2G3MA 1VR6A 4L61A 3VC5A 4P2VA 3RGTA 1H63A 2VOMA 1DTNA 3ANUA 3K1GA 2QCLA 3BJSA 3CUHA 3UXAA 3HA1A 1QI4A 2ODOA 3AJ7A 2A3AA 1K9DA 3UQNA 3LN3A 2PTWA 2UBPC 3TC7A 1XD0A 3VZXA 3W72A 5KINA 3N73A 2HXTA 4QAIA 2X1IA 1A0EA 1J0IA 4MKNA 4GK8A 3WKZA 1E3ZA 3MMWA 4F0LA 2PDMA 2WMJA 1WDWA 3QKEA 3BVJA 1TPDA 4BF7A 2AAAA 4PE8A 4DUOA 3N9KA 5H6HA 3STCA 3S9YA 2DT3A 1B3VA 1PIIA 5LA0A 1JGIA 1GZ1A 1J18A 1PBGA 1Q3NA 4GVIA 1TQJA 2ZZ2A 1HKKA 4B15A 1UD6A 5BXPA 3TYAA 2VVSA 4ADUA 1ONXA 4FLQA 3AYTA 4C6KA 2WCGA 3GVGA 1XGEA 4F9JA 2XTKA 4UQCA 1OGBA 1GQJA 5FL1A 3S1UA 1PTGA 3FY1A 4H9UA 4M8UA 4UR9A 4F0MA 4O1CA 4BZYA 1AW5A 4W89A 2J27A 3UR8A 3WD4A 1XLAA 1GWJA 3S2JA 3WD0A 4ZB0A 3CTLA 4BQ4A 3DZ1A 4RCXA 4ROQA 3W23A 5FSDC 4JFUA 3CPGA 4IFRA 1XFBA 1HKWA 3LGEA 1OSEA 1GQKA 3H53A 3SADA 2VRJA 4GZ7A 3FVMA 2YCKX 1VJSA 4GVFA 2R1MA 3FAXA 3JS3A 4PTWA 3T78A 2HDJA 4JIHA 2WNWA 2DVUA 3GXPA 1B4EA 3PVFA 5T9BG 1HJSA 2QEZA 4W7UA 3P61A 5F1VA 1RAKA 2BLEA 2RJHA 3G2GA 2PB1A 4RNHA 3U9IA 3GH4A 2B7NA 2QUUA 4S3CA 1IZJA 2J9ZA 4MWAE 5A8NA 2ZDRA 2X0HA 3EA1A 3UG5A 4JIEA 1OBAA 1ZU8A 2EXOA 3AHYA 1X38A 1ESWA 3TTYA 1XLGA 4NRRA 3NFUA 2BXZA 4GA8A 4X0NA 2YXXA 3NVTA 5KTLA 4W7VA 2H90A 3KP1A 2D24A 1GVSA 2B7PA 3QYSA 1OGGA 3L0GA 3GDTA 3M07A 4ZOAA 2NUWA 5HNTA 4XZLX 4AVOA 3GG1A 1YKWA 1KBLA 4MDOA 3QGVA 2YXOA 4S3FA 2DJXA 4A2RA 5T26A 3O15A 4M19A 1VD6A 3W01A 4PCTA 2X42A 2P50A 3LU2A 1FWCC 4C6QA 1C90A 1F3WA 3DFYA 3PC0A 3CWOX 4XISA 3FEMA 3N2TA 5M3WA 1XDLA 2XGZA 3NQAA 4KW2A 3B40A 1J0JA 4EXQA 1IR1A 1VPQA 2QCDB 3E02A 1BEUA 1MUMA 3CV1A 1SZRA 1O1ZA 4GQRA 1AD4A 4ZVJA 1ADSA 4B5VA 4K39A 2DEPA 3KHDA 1IGSA 4UFLA 5A6AA 1DWHM 1GCYA 1CT5A 1KCKA 1OFAA 2BY2A 3SCTA 4E3VA 3SIZA 2CZEA 4MZ8A 3VOFA 4GQ0A 4PB5A 3VGEA 1AG1O 3DECA 4XD6A 4QDPA 2BDQA 5CPSA 4IWWA 1OFOA 3N14A 2PODA 4GWEA 1A0CA 1GONA 2VQUA 1K9FA 4GFIA 3CMGA 1V4YA 5C9XA 4WHBA 2HRWA 3FJNA 1UWUA 2G3JA 4A29A 3D0CA 3LI1A 3G77A 4UQBA 1PZ0A 3B0UX 3TXZA 1TV7A 1WQ5A 1GVEA 5EMLA 3THDA 2OVLA 3QGAC 2IPJA 4YHGA 3PBYA 1FVPA 1KNWA 4JFVA 3CBWA 1EPVA 2WNNA 2ZUUA 2PLJA 1Q13A 4PTVA 1XRTA 1CYGA 3R43A 1QPQA 5LIWX 3LQGA 1CIUA 4PL2A 2PZ0A 1RHCA 4XZNX 4EP8C 2YXGA 3G22A 2PWUA 4AVNA 3NOEA 1HF6A 2PGFA 1F8MA 2X41A 1GNXA 5HAOA 3O6AA 1YADA 1UJPA 4JIRA 4JTEA 4F0KA 3T44A 3CZKA 2NZLA 4ONVA 2EAWA 4Q4RA 3FJ4A 2FVLA 3ABQA 1KFKA 2P10A 3GYEA 4QGCA 4JR5A 1A5MC 4B3LA 3M1ZA 3I6RA 3CEPA 4IL0A 2BBFA 3R8RA 4PH6A 3EDEA 4A4AA 4LOCA 3ZT6A 5HUOA 3NO1A 4XZHA 4FNUA 4IGNA 4DPPA 1W1PA 3SW6A 4AF0B 4KEMA 3LBCA 4HU8A 1W1ZA 5KZEA 3T0AA 1XIBA 4WY0F 1LQ2A 3VE7A 3BGJA 4XZWA 4L7ZA 4W8BA 3PAOA 3CHCA 3MVTA 5E70A 1KLYA 5IHRA 4K8GA 1HVQA 1ISWA 4JIIX 4ENLA 1TTPA 1S39A 3RX2A 3GDBA 2YOCA 4QEEA 4AYSA 3S3GA 3W7IA 2DDXA 4X2PA 1I1XA 3RJXA 1FP8A 3TMQA 3T09A 3P3BA 3L4YA 3PZUA 1UG6A 4BI7A 5C7HA 3N15A 4H6RA 4EPBC 2F6XA 3WJXA 4FI4A 4JTGA 1BWKA 1YXDA 2ZUNA 1MW1A 3GS6A 4AY1A 5C9ZA 4S2CA 4TO8A 1V5XA 2NSXA 3AMDA 4OUEA 3SGUA 4AIUA 1BTCA 4DYEA 4EWJA 4UNLA 1Z32X 3T2PA 2GL5A 4OU1A 4YYCA 5BYWA 1B54A 3RLHA 4FLSA 3UWYA 3N2MA 1H7PA 1TO3A 4N9DA 2J6VA 3G0SA 2YL9A 3C2EA 4EANA 4WJ8A 1J0ZA 5HDRA 5D9MA 2SFPA 4HJFA 1YTEA 1HN1A 4JHMA 1HL2A 1LT8A 4FEZA 1EJRC 2OTDA 2FHCA 3RJYA 3GM8A 1RP9A 4MJ2A 4HGXA 3BMVA 4K7YA 3M46A 3KLKA 5D2TA 2YFOA 4ADTA 2QQ6A 1JF6A 3SRFA 4W8LA 3CLMA 2ZX6A 1YE4A 1UASA 3QEZA 3S0CA 5E9XA 3E5PA 2W79A 4H4IA 3VNZA 2YKKA 4GX9A 4GIYA 5H1WA 1VFTA 4KWUA 4MNKA 4UNKA 2DZVA 1B9ZA 4AZ6A 2D20A 1TQXA 2DZXA 6CGTA 1OF8A 4LV9A 3VNIA 1EUAA 3KTXA 3EDKA 5DRIA 3DOPA 3BV7A 3BG3A 4NJIA 1JYVA 4AH7A 1KTNA 5CLWA 2OB3A 4R3UA 1EJVC 1RSCA 4HA1A 4C65A 1S2TA 4FALA 3BAKA 4H3DA 3S46A 4DJFA 2D2OA 5GNYA 1MWOA 1O4UA 4UZUA 3UJEA 2A7RA 4JEQA 2WQDA 2YDRA 2GJLA 3R11A 2VM8A 3GR4A 3PF3A 2J6XA 3K4AA 4TR9A 4HNLA 4YN5A 3Q58A 1ZFJA 1U22A 1US3A 4ZQNA 1V3JA 1EUNA 1OVDA 1OQFA 3KRBA 3TONA 2OLSA 1GOXA 3N17A 3KP0A 4UZSA 4I9MA 4D6JA 1KTBA 4O1DA 1DJZA 2IPFA 4J3TA 1LLZA 3KAOA 3EAUA 4TIMA 2ASHA 1LP6A 2BODX 2DZBA 3H7RA 4JAWA 3OVRA 5F2GA 1F3XA 5T9CE 1EYEA 2PURA 2W91A 3CZJA 3NQGA 1FUYA 4HHLA 2AQVA 4V1XA 3GU9A 4GFSA 3WNLA 1AMKA 2VYOA 5HATA 3JZUA 4XAGA 3M0IA 1PB0A 1DBTA 4RK8A 1W3JA 4H8UA 1U2YA 5CPOA 3SCVA 4ZA0A 1JRCA 3WMCA 3B3DA 4HVXA 2Z28A 4EKJA 2R6OA 1H5YA 2VMFA 4K1WA 3UYCA 1EEXA 1EOMA 3DG6A 3C8NA 4GBUA 4Q8MA 1M7OA 3PPCA 1UZHA 4LVBA 2Y7DA 2QF8A 1VYPX 1B3YA 4CNTA 5I02A 5CZTA 1YE6A 1WAUA 2E09A 3T81A 1SJDA 1DORA 3QLDA 1H3GA 4KQNA 2YFNA 5H2ZA 2G3IA 2ZZ7A 3BL3A 5FL0A 4MVAA 4UTWC 1GZJA 4MB5A 5EMYA 5M03A 4FR1A 1EA9C 4H6KA 4G56A 2PTYA 1O66A 4Y6GA 4PTMA 5AHFA 2PS2A 1FWAC 2VRQA 3LM7A 1A4MA 3H4WA 3B0VC 1LOLA 1UCWA 4PMRA 1T8QA 2XYLA 1NOWA 4LBUA 2ZX8A 1IYXA 4BWLA 1TPVA 3GXIA 3LLFA 1XRSA 3U48A 5LIUX 4XV0A 1OD0A 2Y85A 2NUYA 1JZ8A 5CSYA 4G1KA 1XLCA 4LNYA 1IXQA 2WM0A 3TTQA 4HK7A 1O60A 2CKSA 5DLCA 1ONRA 4K8EA 4UIOA 1RA0A 2VEKA 3GC4A 3WEZA 3IUIA 3DGBA 2E9BA 3QTGA 1XKJA 2NXGA 2ZRYA 3VNMA 1OC5A 1QOPA 5TD4A 3L4WA 1B4KA 4JYFA 4PMOA 3DG3A 2ATSA 4AIOA 1NWTA 3FA3A 1RK6A 1EGZA 1XL9A 1QRQA 4S3AA 1UR2A 5I79A 3EPNA 4S3KA 4I8DA 2PD9A 3SUWA 1HP5A 1JD9A 3VK5A 3O1NA 3HQNA 2PDJA 1UUQA 5I3KA 5JBFA 3A24A 1TUXA 1OK4A 3W2JA 4IPPA 5A6JA 4QNEA 1PYMA 2Q8LA 5ABEA 3KVLA 1MFUA 2E8YA 4LY8A 5DMMA 4MY8A 4FNQA 2JK2A 1R47A 3N19B 1JG9A 5E0KA 3U7VA 3EWZA 1M04A 3FXYA 4Z1AA 5DY2A 1W8GA 2OLHA 2Z2UA 3ERPA 1OFPA 3PY2A 1FHLA 1M9HA 3R6IA 4LPCA 2V2DA 1GGOA 4KPLA 3BQ5A 1CW2A 4EXBA 4NF7A 1MRQA 4KRUA 3P0WA 3USBA 4K68A 5I23A 3HMCA 1KRMA 1US0A 3CUFA 4JHOA 3FDGA 2VC5A 2VR4A 5FESA 1WZLA 5AC5A 2V68A 3TX9A 3MI3A 3QR3A 4DZAA 4XTIA 1T5AA 2O9TA 5CXPA 5D04C 1XLHA 1ZSXA 3WH9A 3P62A 2ZWYA 5FJTA 1WZMA 2FMOA 4CCCA 2GUUA 3QOKA 1FWFC 4NXKA 3N4EA 5CPQA 2FMNA 4DLMA 2DW7A 2FB2A 1E6NA 2HV5A 3WBYA 4HU0A 3AALA 4IFKB 1E55A 4ROPA 4NX5A 1XBXA 3Q37A 1YEYA 3LV5A 3BW3A 4LS2A 3WQPA 3FYPA 2Z7KA 2NSOA 4AISA 2V9DA 3QMTA 3NIYA 1UOKA 3VFCA 3LBOA 1J5TA 1P5BA 5G4WA 4TXEA 3SB0A 3A4WA 2XIBA 3B9NA 1EGMA 3PJXA 3RCMA 3WD2A 3UXDA 1HL8A 1M6JA 2ACSA 3O6YX 3EWYA 1B3OA 4MKVA 2P76A 3APTA 4QITA 4CVWA 4K1GA 3GE7A 5A2AA 4GH3A 3GVVA 3INPA 5K9DA 1P7TA 3KEHA 5E6YA 3R12A 4RW5A 2NW0A 1WPCA 4A21A 1ICPA 1Q8JA 2XN2A 1KM4A 3OGVA 3O6DA 4UFMA 1VH7A 1BYBA 1QI3A 3WQ6A 3MVIA 1KFEA 1OYCA 2JKPA 4PMDA 3B03A 3D5HA 1MW2A 3U2OA 3G3MA 2QUTA 4GCXA 2VKZG 2YLAA 3AUOA 3RFAA 1IT8A 3PPFA 3SRDA 5FF3A 2ZRUA 1N8FA 2EPMX 5HNNA 5H8UA 1H7NA 1D3CA 1GPWA 3MMUA 3W1XA 2GVJA 1DOSA 3NYDA 5K4ZA 2OZTA 4PSRA 1ZCCA 3B9OA 2P8CA 3DHUA 1TCMA 3QPEA 2P3EA 5D2WA 4CNNA 2Y7EA 4CGTA 3GH7A 1BRLA 3G1AA 2CNCA 3R0UA 1W5MA 3QF0A 3UYIA 4KIRA 1DIDA 2CHRA 2PC8A 1WDQA 1O94A 1W3KA 3WBAA 4IGMA 1QPNA 4RX0A 3VIIA 3WUGA 3EWWA 1FBAA 1SFTA 2ZZ1A 3NDZA 1CBGA 2W62A 1C8VA 2FZBA 1ZUAX 5FKYA 2O0TA 4HOWA 3WELA 5G2HA 2H3DA 3ME3A 1W0MA 3OQEA 3M5YA 4MPQA 3F4CA 4UTUA 5HQMA 3BOLA 3OVQA 3HPFA 3CIVA 4U5IA 4US5D 3DBNA 4PMZA 3WUFA 3BAIA 2CBJA 2R91A 3ABRA 4ZFCA 8XIMA 3TWAA 4Z1YA 4LUSA 2OEMA 4LUSB 1JZ2A 4NG3A 3A9IA 4D6HA 3WMBA 3FFSA 3CASA 2HZGA 4Z42C 1TRIA 1QHPA 1P6BA 4Q7IA 3N6HA 3K8KA 3NDOA 4DAFA 3PFMA 1NDWA 1DEDA 1EXPA 5D2VA 5D32A 4AWTA 2E9LA 2DORA 3LM3A 4CU6A 5DMLA 3R8GA 3ABOA 4LYKA 2ZBTA 1JFXA 4BY3A 4J3WA 1QBAA 3CQHA 4J1OA 4UFKA 2VUNA 3EMZA 4QP0A 3AIRA 5H8PA 3ALGA 3SCSA 2BTMA 1XLIA 4ERIA 3Q2DA 5CG0A 5HMDA 1CWYA 2ZC1A 2NVCA 1E6PA 3RU8X 1IEWA 2J8FA 3DHDA 4A8RA 1JAKA 5I77A 2XIIA 4UTIA 3WLLA 4LF2A 1LL4A 1ALDA 2G96A 1EP3A 4IP4A 4YS1A 3SURA 4CD7A 2NQJA 3W1QA 2Y62A 4NZCA 2GGGA 3WEMA 1BFNA 1QPOA 3LCFA 3LPOA 1BSLA 3OVPA 1XH1A 4I6KA 4HCDA 3OHMB 4JY8A 4AW7A 2AKMA 2PWFA 2VGGA 2J74A 1KXQA 3VDCA 2HNHA 4IH3A 1OC7A 2Z25A 3UG4A 1TE6A 4ZSTA 3HOJA 4MSSA 4LB3A 1AJ2A 3HQPA 3UPWA 1QU4A 1T41A 3L65A 1WKEA 2A6LA 1VLWA 4PRTA 3JR2A 1J9YA 3O05A 1CNVA 3W7PA 3VUPA 3PBWA 2GOUA 2WSYA 3EGJA 1YBQB 4IMGA 1Q6DA 1PCKA 5I3JA 4O0KA 3VD3A 1R5YA 3UY8A 1HT6A 3CUXA 2BOGX 3CHDA 3OW1A 5D05A 4DIAA 5GPRA 3W84A 4JZ5A 3R13A 5TF0A 3MJYA 2GOKA 3M6YA 3E9AA 3EPOA 3GG7A 4G2DA 1EO7A 3A9BA 3TNBA 1PZ2A 1DQUA 2I9EA 4ZEPA 1OB0A 4KCVA 2GJXA 3L21A 3JZEA 3JUGA 3CV2A 1VIWA 4B9YA 3O8AA 1I2PA 3AIBA 3BOFA 4F40A 5LA2A 5DY3A 2PRHA 1YNPA 3F4NA 3W7QA 3RITA 4O54A 1JCYA 3W0KA 3S2LA 4BQ5A 1V77A 2BXVA 3I65A 5BXRA 4RDWA 4I5RA 4WRHA 4YTRA 2PCEA 1W54A 4W87A 1E1EA 3CIXA 1YBQA 1F8IA 1LLOA 1LBMA 2UWFA 4B5TA 4D8ZA 3G8EA 4BS0A 5DEZA 2P0OA 3BWWA 1VEPA 2DPEA 3JU2A 1FWBC 4XSMA 3EEZA 4IIDA 3C0QA 1WZKA 1DQWA 1C3FA 1ZBKA 1EC8A 4GNJA 3M7WA 3WBWA 1WO2A 4S23A 4AXKA 5FJUA 1SFLA 1TB3A 1TA3A 3EX3A 2Y2WA 2EKGA 2JKEA 2WC7A 3UY7A 4CU7A 4C1NA 4NRSA 4S3JA 4WKAA 2ZX9A 2EQDA 1XSJA 4JFSA 3HJEA 1IF2A 2QCNA 4DM1A 4AX6A 1HJQA 3PWGA 3TSBA 4CUCA 3PB2A 4O1EA 4V2XA 4GO9A 5HINA 1SUXA 3HF3A 3TTOA 2A5HA 3F4DA 4JKMA 3S9ZA 1QPRA 3NQFA 3LUTA 3CL8A 4I9TA 3VDHA 1DJWA 1R46A 2DZSA 3O0KA 4KWWA 4JY9A 1JIBA 3I10A 4L9XA 4UQAA 3ARQA 4JOMA 1Y5WA 3VDGA 4ACYA 3G1XA 1XYFA 3FNDA 4NP7A 4XAYA 4GUJA 2E77A 3TV8A 5CKSA 3LPFA 1V02E 2QCMA 4QG8A 2A3BA 5AVHA 1F4AA 1LG2A 2V2CA 2BGSA 5C2CA 3C2FA 3FAWA 2XM1A 4HA3A 4GO8A 3F2BA 1H11A 1YDOA 3DI0A 3NGJA 4C6JA 3B8VA 5C6MA 3EPMA 3PG8A 4ASTA 1VCVA 1IIHA 4A6GA 3P82A 3GY1A 1H7XA 2VX7A 4YVPA 4B92A 1GQNA 1LT7A 4MDPA 4Q4KA 5H91A 4F66A 1VFLA 1YDYA 4A8LA 4W7WA 1TIMA 5TNVA 3SGGA 1JZ4A 1Q5MA 3WLMA 4GBDA 4JTLA 3S4TA 1R3QA 3M5ZA 1ZBCA 3N34A 1C7SA 4IPLA 4CCDA 3W9ZA 2PWVA 5HXMA 3T4CA 4REQB 1ME9A 3AYSA 3OQ8A 4ZOBA 1WDDA 4ZOCA 3V7PA 1M3UA 3G1DA 2CHOA 3V1HA 3H24A 3R79A 4E2DA 3LQLA 4JTFA 4MZYA 3ABSA 3GK0A 2A21A 1V08A 1AQFA 4EF8A 1TTQA 2CLPA 2QLYA 1S1PA 3W1NA 4GJ1A 2DSWA 1F74A 4QAWA 3QVQA 4PUUA 3ARYA 3OG2A 4PBEA 2ACQA 3BOXA 1XR2A 5JIWA 5I5RA 1F4HA 3WQDA 2WC3A 3I6EA 4GCAA 1E71M 4DJDC 3HU7A 4E8CA 4O8RA 5A69A 5I24A 4IIBA 3HPXA 3OO2A 2XGIA 2IPWA 5D09A 4Y8FA 3QZAA 5BXTA 3DDMA 4EPKA 1RH9A 5IXEA 2I17A 4QCEA 1B3XA 4O1BA 3F03K 1G7UA 2CBUA 2VZOA 1IGWA 4FS9A 3UG3A 3WDQA 4E6MA 4PUWA 1CXKA 3VZYA 3GH5A 1MNZA 4R88A 3TROA 1W56A 3PK7A 3R89A 4QJ5B 1FOBA 4X60A 2R8WA 4PB4A 1R7OA 1V3MA 5B80A 2BMBA 1I0DA 3S5SA 3ZWTA 3TA6A 3WNMA 1C8QA 1E56A 4CVUA 3U5YA 1JZ5A 3QQ0A 4LF1A 2Y7FA 4IUGA 4OT7A 2E7FA 2HS8A 2RAGA 1CGVA 4UMCA 4H6EA 3NL3A 1FA2A 2QV5A 3G8RA 4JCLA 4RW3A 3W6LA 2DUAA 1FY6A 5KETA 4FXFA 1LRQA 3VINA 2ZUWA 4C6OA 2WV8A 3UJ2A 1R2TA 1UZDA 4BF5A 1B1YA 1ZPTA 2PDUA 2NLYA 2PFHA 3KOYA 3NQBA 3MJMA 3B8DA 2HSAA 3F5JA 5EFFA 2GK1B 5F2MA 3NYZA 2G41A 4MUPA 1Z6KA 2IKGA 2QAPA 3UWVA 4LAUA 2FZDA 4QLLA 4BI5A 4QSFA 2ZQ0A 2WNZA 1NP0A 4L9ZA 5CZJA 4WQ6A 4U28A 4E8DA 2G3FA 1AMYA 2J88A 1FX6A 1O5QA 3P80A 2O9OA 3FKKA 5I78A 2YA0A 2PDPA 1GHRA 2FDSA 2DJLA 4GE8A 3TWBA 4DI8A 3P2VA 1KO0A 4RPPA 3ID7A 1YXYA 2OPJA 1S2UA 4WXYA 1XYAA 4G9PA 3N13A 1LROA 1KGXA 4RNFA 5HUPA 4HOXA 2PRMA 1CXLA 3OBAA 2IUZA 3WQEA 1MYRA 2PP0A 2D22A 3APYA 1SMAA 2TRSA 5JVLA 1RXOB 2XWEA 5LHEA 5E09A 2YR1A 3LGGA 1N8WA 4C6LA 3A12A 1QBBA 2CZFA 5B7ZA 3AMGA 4LAOA 4CN1A 1MXDA 1OC6A 4RR4A 4N0RA 2UY4A 2PLMA 3E5BA 3GHSA 4O0ZA 1V3HA 3OIXA 2JGQA 4W88A 2D23A 5EB8A 2VR2A 2DSKA 3DC8A 1POKA 1R3VA 3W1LA 3PZNA 1R3RA 2XN0A 2Y5JA 1VGAA 1XXXA 5G2WA 4Q4SA 1TTJA 3SR7A 5E0FA 2Y88A 2PF8A 3I7QA 3AHZA 3TC3A 3G6LA 3MSRA 4MAZA 3ZVHB 1E1FA 4JQAA 4L4OA 3LK6A 1S46A 3P14A 2F2KA 4HPHA 3H7UA 3K2GA 5FEXA 1MQQA 1RQBA 3PWAA 2Z29A 3ZM8A 2V5BA 4KT2A 1BQGA 4YPJA 1FHVA 3KDNA 1P4CA 2VWTA 2ZX7A 3LD5A 4MFDA 4WCJA 3II1A 1VZWA 4Z2GA 2J79A 4NQ1A 4H9ZA 3EB3A 2LLEA 2Y6ZA 3VILA 4HP5A 2YCLB 2OO6A 3MO4A 3UVAA 1QK2A 4ML4A 1HGWA 2WZEA 1ADDA 4JIQA 3M0YA 2D2JA 3UR7A 3WK1A 4NZ1A 1CEOA 1WAWA 2OR2A 2VFHA 3EB2A 1EQPA 4DY1A 4EK7A 3FGCA 1OABA 1W3TA 1TV5A 1RR2A 6TAAA 1UB3A 1C7TA 4ML9A 1NOFA 4AWUA 3PZGA 3VZZA 3IJDA 2GVLA 1JF5A 3DUGA 5JH2A 5AHEA 1VPXA 2NV1A 3BGGA 1XG4A 2QR6A 3VAVA 2WPGA 4XVDA 3SBFA 3MW7A 3GAYA 1ODZA 3UR5A 2XFRA 3AHVA 4O16A 2INEA 3O63A 3E0FA 4NZJA 1BQCA 3THQA 4AYGA 3DU0A 3HG5A 3HPZA 4C1NB 1OG0A 4Z1BA 2J7DA 4ALDA 2EO7A 3EX2A 1GT8A 2WQPA 2PDGA 3GB6A 1TPEA 4B5UA 4C6NA 1UOZA 3UG8A 4TX9A 3W1UA 1VC4A 3STEA 5KZMA 1XH0A 1Q2RA 2C1HA 3NAVA 2ZXQA 2VVNA 4IG2A 1UR3M 4WSHA 4DJDA 3GR8A 4JXCA 2CIPA 4D1IA 1UWAA 2X7WA 1S5TA 1IEQA 1L0PA 2O4MA 4QLJA 5EL1A 3LHWA 3AS3A 1YPIA 4UOQA 2VX6A 2G3NA 2CXEA 2Y7GA 4Q6XA 1X8CA 4E0CA 3FK4A 5U7SA 4IXHA 2FIQA 3VIJA 3JRKA 4IJRA 4QDMA 1GOOA 3LS9A 2F7FA 3NQCA 4BQ3A 8CGTA 2FB3A 3VCCA 1W1TA 4F2BA 4I7UA 1XPGA 3ARRA 2E4TA 3DERA 3L0NA 3AWOA 3CXOA 1HKIA 1VP5A 1UPPA 3VXGA 1FDJA 3AXXA 1O1HA 3FV9A 5K2ZA 3RLGA 1Q65A 4FLOA 4OOZA 2NX1A 1QWKA 1T0OA 2ZIDA 4X9SA 2PLKA 3TOYA 1GJWA 1JI2A 3U4FA 1K8CA 1AH4A 1SO6A 3SN0A 4JTIA 4OIFA 4S3GA 5AYXA 3HPAA 2ZZ6A 1CPUA 1VFMA 2V2HA 2Q6ZA 3TYZA 1FFQA 4HJWA 3EX6A 4WOQA 5FJOA 1M5WA 1OFBA 1ISYA 4ZQCA 3ANVA 3SIMA 1PKNA 1TREA 4HSNA 2Z00A 3URQA 1W9UA 3AMKA 4S3BA 3TYEA 3FCPA 1KGUA 3C2VA 2V3FA 4ZB2A 2BHYA 2E25A 2WMGA 1NTHA 5AY7A 3C0SA 3PUDA 1UBPC 1E5NA 1FWEC 2TYSA 3KZPA 3MMDA 1IZCA 2CLKA 4RJEA 1PDYA 3WJZA 2DQWA 1B3WA 5K7JA 5ABGA 3ZVIA 1WA3A 4HMNA 4M24A 2Y89A 3B8WA 3OP2A 3SUSA 3VGFA 1BRLB 4MIMA 3QFEA 2H8XA 4O28A 3MANA 4H8VA 3DEQA 3PG9A 4IOTA 2IPGA 4GVGA 5A6BA 4WZHA 3PM6A 1EJUC 4Z0JA 4C7FA 1T96A 4DWDA 5L9FA 1Z41A 1UKSA 1X96A 1L8PA 2VX4A 2OZ0A 3V4BA 1HKJA 4YTQA 1GVOA 2QCHA 5A8GA 1Z7AA 1ODUA 1IWBA 5CGQA 4DJEC 5MKGA 1E5JA 2QIWA 1EO5A 2WVTA 5C7VA 2Y63A 4KERA 2BNJA 3UZJA 2E68A 3WK3A 1QDSA 3ITXA 2WBGA 2WCSA 2J9YA 1DJXA 3FHQA 5FJJA 4G7FA 2POTA 2E6FA 5A8PA 4U31A 3Q94A 1SJAA 1NVMA 1AQHA 3PZQA 4ICMA 4GRSA 1TIWA 3RO8A 4NYUA 4LXFA 3GRIA 3E96A 4WEVX 3CPUA 2JE8A 1F5ZA 1KR0A 1GW9A 4FSAA 3PHAA 2ISWA 4GYFA 1ME7A 5CSUA 3KFTA 1OM0A 2W63A 3H54A 5BU6A 4GC3A 3RX3A 1D3HA 1L9WA 1REQA 2XPKA 1KV5A 1SSGA 4MM1A 5DT5A 1MMFA 3WQ5A 5FJPA 1P0BA 2WSRA 4LEQA 1C9DA 3FX4A 1QO5A 1WDRA 4GIRA 2QKFA 3A6OA 4XKYB 5BMWA 1RCOB 2IQDA 1QATA 4MB4A 4L1GA 2GK1A 5J8LA 3W70A 3BCFA 1KV8A 4J7RA 3T07A 3MPGA 4O52A 1X97A 4PMQA 3EOOA 1R0MA 1OCNA 4Q8TA 1LL6A 1SO5A 4DF2A 2ON3A 4C60A 3QW3A 3TJIA 4PBGA 5M17A 3AXHA 3TYBA 1R3WA 2AQWA 2GDUA 3IJQA 1SZEA 4ECLA 4RZBA 3N2XA 4FO4A 1A0DA 1E0VA 3CTTA 3PP7A 2GQ9A 1WB0A 3LHVA 3VC6A 2PPGA 2A0NA 3TVAA 3MHGA 3ZLGA 1JPIA 3CZ8A 3W22A 3JVAA 5DMNA 2REQA 1GORA 1IR2A 2XH2A 2WJFA 3W83A 1GTHA 4H1ZA 2V5DA 3UNDA 1UA3A 4FA3A 2D0FA 5CSRA 1QNRA 3W1RA 3FJ6A 4PCNA 1UHVA 3IJIA 1K9TA 2WOQA 2GSEA 4YVVA 2CLIA 2RDXA 1OYAA 1X1OA 5CJ5A 2C13A 5HR6A 4RUBA 3S2NA 1LJYA 3ITCA 3OG3A 5FJRA 3VOHA 3U3HA 4B5XA 1O12A 2GVGA 3WF3A 2C71A 2Q02A 2GJRA 1EJXC 4M81A 3H4XA 2ZZ3A 1F05A 3PZMA 3A64A 2YCEA 3WL0A 3M0XA 3ITLA 1ITQA 4Q4PA 2ISSA 2HJPA 3LZ3A 4MMWA 3RF9A 3BLDA 3DFSA 2FJUB 3ISIX 1AUSL 3H55A 4F2UA 3TJXA 4ZXLA 4OBRA 1E6SM 4WKFA 3EXSA 3PFRA 5BOOA 3DFPA 3CHFA 3W7DA 1B0IA 4ZO8A 3GX9A 3REQA 1XLEA 4HZ6A 2ALRA 3KM8A 3LSCA 5FCZA 1XCXA 2J9XA 3W7CA 5HK4A 3MY9A 3SFKA 2X2YA 3G0UA 2OWCA 2BSLA 5HMEA 3NWRA 4DZHA 1K9EA 5G1MA 4LRTA 3AU6A 4HTYA 2VCAA 2YZRA 2Y61A 4JKKA 4OKDA 2IKIA 1P0KA 4MWAA 4HN4A 5XIAA 3O16A 1DJNA 5BRPA 4UBPC 1FKWA 2PLCA 2G0WA 4QS6A 1UBSA 2PTDA 2VD8A 1U1HA 1L2UA 4QROA 3CZEA 1OWQA 2PMQA 2DVTA 1VEOA 2YA2A 3C0JA 3G1RA 5REQB 3NQMA 4RE4A 4RXFA 1GJPA 4JTRA 7REQB 1EPXA 4ZZ9A 3GKFA 3QHNA 3SJNA 5DN1A 1W3NA 4PB3A 4OZOA 1TYGA 4MAVA 3DFOA 1E40A 4E5TA 5KITA 5G2IA 3XIMA 1MDLA 1XBYA 4JQ2A 2AKZA 1CGTA 4H01A 4BEUA 3PJUA 3VKKA 3H4GA 1YNYA 1XBVA 1YNQA 3HGOA 4FXJA 4ERGA 2WSPA 3SUTA 1KXVA 4ZB5A 1VYSX 1FWTA 1HNYA 1BXNA 1OX4A 1OYBA 3GHTA 1D9EA 5IDZA 2ZTKA 5AHMA 5M5DA 1RD5A 3T40A 2FQIA 3W82A 4ZO9A 1A5NC 3W37A 4I9AA 5KZDA 4NJKA 3K8LA 3MBFA 1O5KA 1A80A 2PP1A 3BSHA 3BAWA 2C6QA 3M4HA 1FCVA 4J3ZA 5ABFA 3PN8A 4O15A 3L2IA 1H0GA 1DL3A 1MUWA 4B16A 4IMFA 4E4PA 4B4FA 3EA2A 1RVGA 3RNDA 1O6IA 2FLIA 1WDPA 2C1IA 3B04A 3MUAA 2XFFA 3TQVA 2I5QA 4EE9A 4OV9A 3PSVA 1SZNA 2P88A 1TTIA 4HK5A 3TJLA 3IIZA 2Y8KA 3PZTA 4XUYA 4DO7A 2TSYA 3QHOA 3MZ2A 3QM3A 2A3CA 3AZTA 4LCSA 3CH9A 3U5UA 4HNVA 3P6LA 4QE1A 3HQOA 4U33A 3HTWA 4E4UA 4IIGA 2W67A 2X1RA 2Z26A 4QSHA 2GLKA 2Z1BA 3C5QA 1A5LC 1OADA 2YBVA 3QKZA 5GJNA 3SFWA 3E3HA 2I56A 2J7GA 4GXMA 4QJ1A 4RNJA 3LENA 5DF0A 1E6ZA 4B2DA 5FF4A 3VD4A 1EJWC 2A4AA 5IRPA 2PWEA 1TV3A 3HFTA 3LTPA 3MYOA 1H0IA 1NELA 4DVOA 4JN8A 4KEUA 3K4WA 1E6QM 3VE9A 3NNTA 1LZOA 3S9IA 3WENA 3QC0A 4QJ4B 1CGUA 1UD5A 1UUMA 3LRKA 4UFIA 8A3HA 1DWGM 3LMZA 1GVFA 4MY9A 3VIKA 6A3HA 5FEPA 4GZIA 3G3DA 1PWLA 1J2BA 4KBXA 1I2NA 5E0CA 1I2QA 4UCGA 4RE2A 1R85A 4Y8EA 4CQBA 1BF2A 3S5ZA 3BG9A 2A85A 4M80A 1VEMA 1TWDA 1W2VA 3W7RA 2ZRZA 1A5UA 2BVWA 1OG6A 3GTFA 1NU5A 1Q6LA 3W2KA 1JCTA 4XAZA 7TAAA 1ZP4A 1G01A 5K9XA 3R8HA 5BOFA 2VZSA 5AYYA 2QJGA 1XYBA 3I4EA 4LVGA 3W00A 5LZLA 1DV7A 2XSBA 1Q7QA 3OYZA 4C1LA 2YW4A 1BGGA 4XD4A 4BI6A 3CV6A 1JPDX 4AQLA 4XWUA 4GJIA 1F3EA 3B9DA 5IOBA 1Q6RA 2GVEA 2FZ9A 2R9RA 1OHLA 1FCQA 3NEVA 5A6KA 2WZMA 1AODA 5EGRA 5ECVA 4JKLA 2WAGA 1K03A 3BLIA 3U8GA 1B5TA 4LNCA 4PSPA 1R3TA 3SCUA 1S2CA 2JKAA 1QW7A 4BA0A 3NO5A 3UXIA 3WLJA 5CAHA 4RKAA 4AAJA 1NF0A 4GYPC 4IJCA 2QPSA 3NR0A 2BHZA 5I03A 2INZA 5DBTA 3WDPP 4GNVA 2Z27A 2Q3RA 3R10A 2EPOA 1KXHA 4UTMA 1VIZA 1PHWA 3VDAA 4HMCA 1W37A 4I9JA 3S5YA 1JYWA 3NSMA 4KETA 1KC7A 2YDSA 3CYVA 2DT1A 4AY7A 3HJZA 2PGEA 2W5FA 2GWNA 1WP6A 3BMWA 4P7NA 4AZIA 2NQLA 1ITUA 3L4UA 1FWIC 7ENLA 1UP2A 1GVQA 4CEXC 2GSHA 4N2YA 5AFDA 1PDZA 4IIHA 3DKJA 4ES4A 1RBOB 3MI2A 3IANA 1XICA 1I45A 1LQAA 3NL6A 3P93A 4NI8A 3QV8A 3V0TA 3W27A 1TJ0A 4JEJA 4DXXA 4OE7A 4Y9PA 2C79A 1I1WA 2ZYFA 3MHFA 1EX5A 4POCA 3RR1A 1RQHA 4L65A 2V38A 1B2YA 2V3EA 3URAA 2FZMA 4E2BA 3SO7A 4LFYA 2VFIA 2VR5A 2XH4A 1F73A 4IZGA 4A22A 2IW0A 3MKVA 1OX5A 1NDYA 5CC3A 2FTPA 1F76A 3EX4A 3RLVA 5JBDA 4O57A 5CZKA 1TFVA 4WD0A 4MNMA 5AZ1A 1CXHA 4LX4A 2FH8A 3GIYA 2Z7GA 4GGBA 4LUTB 1N8IA 4KRTA 3WUEA 2VFGA 3TYDA 3P8JA 1SJCA 3A3XA 3SECA 1EF2A 4K3ZA 3URNA 3TW9A 4JN7A 1KFJA 1EA0A 2YJQA 4I7VA 2DGAA 4AXNA 3WH5A 3H7VA 2VJXA 1E0WA 5A6TC 2J24A 1NH6A 1E6XM 4M6UA 4WF7A 1KGWA 1GOIA 4ATWA 2E5BA 3W73A 4KGJA 1ZNNA 3U2ZA 3WDHA 4GJJA 3WLSA 1SR9A 2O9RA 4PFHA 1GPFA 2PD5A 5I0DA 1S3TC 1LWJA 4PGLA 1EXBA 3CB3A 3M0ZA 1TX2A 3QH2A 4U4MA 3KLLA 4KIEA 2FYMA 3VIFA 7A3HA 2X30A 3T0DA 2ZDSA 1IHIA 2PDQA 4FF7A 4AWSA 4Q7BA 2YBUA 4J4KA 3SN4A 4IP5A 1D8WA 5AYZA 3W86A 3M0HA 3ARPA 2VGIA 1GOMA 1U5JA 4O0QA 3CHEA 3CWNA 1LF1A 3THAA 1SO4A 2HTMA 2JIWA 4Q8WA 4XX6A 2C19A 1ML1A 4QX4A 4HIBA 1LOQA 2P0IA 4H41A 4URIA 1MZHA 3BTNA 1ECQA 1FCBA 3RPTA 3W75A 1XSIA 2ZXAA 3MP3A 4UNIA 2G8ZA 3UZWA 3TTSA 4F3HA 1WYIA 2CLOA 4NJHA 1SJBA 2GVYA 3GC5A 4XTDA 1KXTA 3SQSA 3JW7A 3ANYA 4N02A 3V36A 3Q65A 3RILA 4QQUA 3PULA 1VRDA 1V6VA 5IFTA 3ATYA 5LIKX 2DFAA 3V18A 4P5UA 2OYKA 1SM9A 4N4QA 1RLDA 1GQLA 5C54A 1CGYA 1MRAA 1QR7A 5D9OA 3DN5A 2IKJA 2W92A 4TX8A 4LEFA 3VOCA 1UZ1A 4FNRA 4TOQA 3K5XA 3P81A 3WK0A 3NO3A 1QW8A 3QJAA 3DYOA 4DUWA 4PULA 3LMYA 1XCFA 1KWGA 1US2A 4LVAA 5B7YA 2CLMA 3MYPA 4O13A 3PSWA 3PTQA 2OQYA 3H2EA 2V81A 2OYMA 3DHFA 3B8UA 3IPWA 5IM51 3FSUA 3POHA 1EDQA 3BLLA 3SSJA 3N9RA 2PI6A 3S6DA 5BW6A 2PAJA 2ZWZA 1TR1A 3U4AA 5C55A 1JUEA 3CEUA 4FOKA 4TU1A 3VMPA 4ORIA 3KHJA 5TQLA 1W3LA 1B31A 4B4HA 4PTXA 1M53A 1YLVA 4XAPA 2C18A 1EX1A 2UZ9A 2OEKA 4RXGA 3I68A 1IE7C 2DIEA 1DJIA 1BTMA 3E12A 2QMJA 2C0HA 2C7FA 4K38A 2CWNA 1XW8A 3WFZA 4C5YA 4R7OA 1KR1A 2DQXA 1V0KA 2XVNA 4JTKA 4V28A 3KBWA 4AHOA 1CTNA 2BY0A 3UJRA 4UUIA 5JUVA 2VTFA 3WQ4A 3TLQA 5D38A 5BROA 4NZ3A 2NWRA 3FJLA 4Z1DA 4IFKA 1TVLA 2FDMA 3POCA 3AICA 1M7JA 3WLOA 1DXEA 1F9CA 2ISVA 3ARTA 3NOYA 1WBJA 4UQ9A 3WD1A 2BWGA 1RY0A 1OINA 2FFCA 1ICSA 1S5WA 3N29A 3W7MA 1RPXA 4GUFA 3T0CA 3QPZA 2A7NA 4UR8A 1ISXA 3VIHA 3DHPA 2EKCA 2VDGA 3SUVA 3T8QA 5CBBA 1UD2A 3WQCA 1P0EA 2BXYA 3MU7A 4U2ZA 1R38A 2J77A 4CQ8A 5LIYX 3TKFA 2AL2B 1WUEA 1NFGA 3VCNA 3SRKA 3L12A 4D6GA 1S5MA 2DZTA 2O55A 3GTIA 4EVZA 2ESCA 1O95A 2CFFA 5LNUA 1KRBC 1SFSA 4MLRA 1G94A 1E4MM 4L5ZA 1RALA 4EPDC 4DB7A 4ZE4A 1XYCA 1ZZMA 5D2XA 1XFCA 1LBLA 4NAEB 2Q71A 1CCWB 1PIFA 1PZ3A 2HE8A 1UR0A 2X1UA 5GJPA 3A4JA 1UROA 2QPXA 3GW3A 5XINA 4JBRA 1BXBA 5AC7A 4V15A 3K30A 5AYBA 4GZJA 4PMYA 1KFLA 1K3UA 3WY1A 8XIAA 4RE0A 4OV4A 3VDBA 2WPBA 1PTAA 3VNDA 1UD8A 1V51A 1GEQA 2CU0A 4J35A 1EQCA 2IXUA 1JDEA 3T4WA 1VCFA 2ABAA 4XBKA 1GUVA 4Q8OA 1JQVA 1QWGA 2EJ1A 5I3IA 4ZO7A 2QIIA 1A4LA 3KE0A 3GR7A 3MB9A 1UW9A 1LDCA 1QFEA 3MBDA 4S3DA 2VUYA 3C8FA 4IL2A 4IMDA 2ZRVA 1QASA 1H5VA 3S83A 4IMCA 1JI1A 1JVNA 3LTSA 5U4NA 5C9WA 1RJRA 1Q45A 3H2NA 3FLUA 3IIPA 3T7VA 1WOAA 2V0TA 5BMXA 4GI9A 2HEJA 5FOOA 3IS4A 1EL3A 4H19A 5DCBA 2DU2A 3TH6A 4V1YA 1ZJAA 4DAIA 4JICA 1W5QA 4OBTA 3IIXA 2DY3A 3VD5A 2V82A 4O1FA 3AS1A 5A2BA 2XSXA 1R7AA 4NILA 6XIMA 5IHSA 2ZVRA 1MXGA 3CAWA 4Z0SA 3ZLFA 2OO0A 5TAOA 1V8EA 1H1YA 4KCUA 4OHQA 4GPNA 1EJSC 1U33A 2CBIA 3W2LA 3DAQA 2YCLA 4HA0A 1IEIA 1GVYA 1ZJIA 4DQWA 4WUIA 2PGRA 2QW5A 1RPKA 3ZOAA 5F4WA 1KBIA 3NGFA 1B3ZA 3UXLA 3GVRA 5DFAA 3AHTA 3MP4A 4YWIA 2YIHA 1JRBA 1DJYA 5ENLA 1K70A 4PFMA 2V6AA 3OEXA 4O14A 1AL7A 3VNYA 3USZA 4KCTA 4DXVA 1DKWA 4OJYA 4QR6A 4PRRA 1AVAA 3OOQA 1Q2SA 2PBGA 1QPKA 5E1QA 4ZGYA 2H9AA 3QC3A 1VPYA 3GHUA 5I2UA 4MGGA 4QG6A 2XVKA 4PMVA 1MO0A 1A53A 1TPC1 4XD3A 7TIMA 1K77A 3HV9A 1R9YA 5DXXA 5HPOA 2OKTA 2R82A 1SZGA 4MJ4A 4C7GA 1YHTA 1W9BM 1UH3A 3S2MA 2QDHA 3RN6A 3LG3A 2HWGA 2CZDA 3MUXA 3V35A 5D2YA 3W6YA 3E2RA 5CC5A 3UWWA 3OLEA 2RDTA 1QI5A 2ZKMX 5BZAA 1XBZA 1V3LA 4OECA 4GISA 3STFA 1NM9A 1QOQA 2Z6JA 1JXJA 2RGLA 4DN1A 1DWAM 1BGAA 2BOEX 3TEVA 4KCWA 1TUFA 3PZIA 4XG1A 2OSYA 3F7JA 1MW0A 2R1PA 1J0HA 4NZ4A 2XM2A 5LNVA 4AIEA 3N4AA 3GKAA 4CCEA 1PAMA 1OGSA 3H2AA 2W3ZA 3ALFA 3UFYA 2WMKA 1UIOA 3QV7A 1J8VA 3V0SA 3KCOA 2XIMA 4L1WA 2VOTA 1SPQA 4PTNA 4UR7A 1XRVA 3IAPA 4NZFA 2KAUC 3BZGA 5A2CA 1K8YA 3DG7A 3LPGA 4BKNA 1C29A 5TIMA 3UW6A 4F0HA 4MNLA 2YB1A 3TR9A 1JD7A 3QBUA 1IEVA 4FP1A 3M6DA 1H7OA 3KVMA 3GHRA 3PZ9A 5JH1A 4LJ3A 3LLDA 2DVXA 1MSSA 2CYGA 1AL8A 3SJ3A 1AK5A 3OU8A 4MTVA 3MTWA 2VEIA 1MI3A 4KH2A 4AC7C 1HGYA 3QQWA 3NEHA 4CD4A 1TJ1A 4JL2A 4LS0A 3ZXWA 4MWAB 2PU1A 2DSUA 1H2JA 1HO4A 1BKHA 2O4QA 1CB2A 1UA7A 4BK9A 3AC0A 4MWAC 1JXKA 4J2PA 3WN6A 4PUEA 1DWFM 2Q8XA 3TJ4A 4O8AA 1G4TA 2BVDA 1PL9A 2DT2A 1L6GA 4BWLC 2ZRXA 2FFIA 6ENLA 1H49A 2EGZA 1AQ0A 3A13A 2VX5A 2WC4A 2A3EA 1C8YA 1OK6A 3RM9A 1WX0A 3DFNA 4R5EA 2YCJA 4AEEA 3MHUA 3RO6A 3NUKA 1JCLA 1OY0A 3WJYA 4HHMA 3BCDA 5HJLA 3ZIZA 4Z2IA 2BZNA 4NVTA 2B81A 3R7MA 4HMEA 3HURA 3W24A 4L1XA 3GNPA 2E6AA 4LU0A 1X39A 2D3NA 3GG0A 1GYLA 3PTDA 3GBDA 3ABXA 3RLUA 3UP8A 4NX0A 3UWUA 2QJHA 3TMLA 4MLJA 4L80A 4NNAA 1ZJHA 5EMUA 5ECUA 1TR9A 3L4TA 2WW5A 1K4GA 1H7RA 4B90A 4C6BA 4W5ZA 1CLXA 2ANUA 3NM1A 3PR2A 1ICQA 3RPDA 1H4PA 1EF3A 4DXKA 1YXCA 3UETA 2CCRA 1PZ1A 5F4XA 1FH8A 1FXQA 2R1LA 1ZALA 4N9EA 3O9NA 1FWRA 4C6PA 2VDIA 4GI4A 3D46A 2ZCGA 1XLFA 3QY7A 3MDUA 3RMEA 2CEQA 1PIGA 1EOKA 3M7SA 3KVJA 3MCOA 3RCNA 1E9LA 4DLFA 5G5IA 4HSHA 2JIEA 2JF7A 2Q01A 4B3KA 5AHLA 4EF9A 3RDKA 1I9CB 1VFFA 4UTTA 4PUKA 2R1KA 2BOFX 2CXGA 1GQIA 4K36A 4NHVA 3CUGA 2XSAA 5BXSA 3UCCA 4FB7A 1XUUA 3LX9A 1PWMA 3GU1A 4PUJA 3IJ8A 4YMZA 2OQHA 3B0XA 1W91A 2E5DA 3PZVA 1E3XA 3ZMRA 2CZ5A 1C9WA 2VDHA 3WQFA 1JQXA 1J79A 1EHNA 1FTXA 3TCSA 3R1ZA 5FF0A 3W1AA 1KFWA 1Q85A 5DX7A 3P7YA 2XDFA 4YU1A 2B4GA 4Y7EA 2EF9A 3TSDA 5FACA 3LCWA 4JQ3A 5HNUA 1VBRA 2WM1A 4LUJA 1EFZA 3ZR4A 1W5PA 4WR3A 3LHYA 1O7AA 1W1VA 3QHMA 1QOXA 3B0YA 4IISA 5J5DA 3G1YA 4FNSA 4HZ7A 3CQKA 1R2RA 1QW9A 4TV6A 1XH2A 1Y7VA 1FHUA 1VFSA 1RK5A 3ZLHA 4Z1CA 4HT3A 4R53A 4F8XA 2HNEA 3KOWA 3CJPA 3W81A 3LI0A 3OIHA 3E2QA 3W7LA 4B3ZA 1H51A 1OIMA 1RLCL 4NAEA 1NQKA 2DH2A 1TV2A 2J7HA 3KS6A 4JPGA 1FP9A 2MNRA 3WFAA 2AGKA 3H6OA 3QR1A 4GACA 4C5ZA 3C2OA 7CGTA 1PCWA 2PDWA 1YPXA 2FVKA 2IMRA 1XIGA 2WMIB 4L6OA 1KBKA 5FSEC 5FEWA 1I2RA 1XV8A 2OLAA 1L6FA 3K13A 1A5BA 1XISA 3W7GA 3M16A 4GABA 1BYAA 2G37A 4GQGA 5ABTA 4GY0A 3G1VA 2GYIA 1EYWA 2FGLA 2UY3A 4FMVA 2E3ZA 4NI3A 3RM8A 5F1UA 2GQ3A 4JNMA 3AO0A 3AMLA 2OELA 4K7VA 2VFEA 3WQVA 1W1A1 1Q63A 3GNXA 4QE5A 1FCUA 1W3HA 1RUSA 3VKCA 2J75A 4MHBA 2VI0A 3NQ8A 4DHGA 2I9UA 3GYCA 3MA8A 4H6QA 5D03A 2OZ3A 2ONEA 3LERA 4MZ1A 2NQ5A 4F79A 2DZUA 1PEZA 1FWJC 4L4LA 3ITOA 3V5CA 1DJHA 2FKPA 3VMOA 1DPMA 2VGBA 3GVQA 2Y24A 1XIDA 3V1PA 1QI0A 2X09A 2J4GA 5EA9A 4AY8A 4YL2A 1DWIM 1IXNA 2C3ZA 1NWSA 2PDFA 2FTYA 2HISA 2P53A 4LCRA 1LUCA 1UIPA 4JDYA 4MY1A 1LLWA 2O7SA 1HX0A 2GDVA 1UP3A 2WZIA 1JR1A 1HJVA 1ZAHA 3A3HA 1QVBA 3MCMA 3S1XA 3SAZA 3TN6A 5AOUA 4XIAA 1UUOA 3ZWSA 1GTEA 1V0MA 1VHNA 3TW7A 3SN1A 2WKLA 1AZ1A 3V3WA 2Z1XA 4H00A 4TMBA 4RV8A 5E5CA 1HKVA 1M65A 1ZRQA 1EJTC 1ZJBA 1VLIA 1H60A 4AEOA 3D3AA 1V3IA 4FR6A 2DUZA 2XG9A 7ODCA 2FGZA 2X2GA 4F2TA 3LA4A 4NY2A 3QOMA 3W26A 2CKRA 4O18A 2B7QA 3RK8A 2PWHA 1SSDA 3DFQA 4IGHA 2QCGA 5HMSA 1CZ1A 3ZJ7A 1IXPA 1UYQA 3DIPA 3PTKA 5MHBA 3QV9A 5DCEA 3S2CA 1JZ7A 3IIOA 4O19A 1NOUA 3L68A 4H2CA 3IGXA 3PJWA 4M29A 2NV9A 3THUA 2B7OA 3W29A 2PCQA 1RBLA 2J47A 1GKPA 1BWLA 3EX1A 4WDWA 3GUWA 1TMHA 3WLKX 4I90A 3FHAA 5JBEA 1REQB 2GSJA 4GI8A 4OUIA 3I7RA 4RZ6A 5D4YA 2X40A 4LTSA 3SY5A 3AOFA 1KQYA 2OJPA 3VGHA 3EWUA 2HS6A 1FWDC 3WLHA 2ICSA 1VAHA 5HPCA 2RDWA 4QTGA 1MEWA 5C9RA 3DI1A 1W1B1 2R1NA 3DXIA 2X05A 4CQ9A 4E2OA 3GAKA 2OKOA 1VJZA 1JCXA 4KKXA 1YDVA 1U83A 4KESA 4CD6A 2ZE3A 1LM1A 4U10A 2YBTA 4ZQMA 2ZZ4A 4N9BA 4J3SA 3UVIA 3HG4A 3KL0A 3M0JA 3OVGA 3VD7A 4PCPA 1EIBA 2E8ZA 5D30A 4OTKA 3MS8A 2JEQA 3IGSA 4IUOA 3MSGA 1JGMA 1XKYA 4BF9A 4BFAA 1T40A 1QTWA 1TWWA 3NZ1A 5G1TA 3WDRA 1IEXA 5DQPA 5RUBA 3S8HA 1OFRA 4OGZA 4LUTA 1P0NA 5JQ9A 3I3DA 3AXMA 4AG0A 2G97A 4FIQA 5G4HC 2XISA 1XYMA 4WLCA 5A8OA 4HPXA 3WQ8A 3ZR6A 2Y1HA 3DCPA 3A5VA 1EEPA 4NJJA 5F7UA 4JTJA 2WNQA 3GUGA 4C1KA 5J04A 2QCDA 3TAKA 3C52A 3FA5A 3P0XA 5AKQA 1OD8A 1ZB5A 1TE1A 2WMIA 5T91A 2WYSA 2CHNA 4O12A 3SM0A 2RKXA 4Y2WA 2FGBA 3CMJA 3TP4A 2XH7A 3FN9A 4C6DA 1QMLA 2UY2A 1MFVA 5EKYA 4IIFA 4AHQA 3QY6A 3IARA 1J4EA 4HNNA 3WMSA 1E9ZB 1XIFA 4MWAD 4AC1X 4GHRA 4RDVA 1Q66A 4BR1A 1YTDA 2OXNA 2BVTA 4DBWA 1XG3A 1Y5XA 3H2CA 3L0KA 5F4SA 1ELSA 1ZBWA 2RH9A 1WXJA 2YA1A 4L4MA 1IZKA 3DGRA 1XIHA 3LEPA 3KBVA 4DBDA 4PMUA 5CPTA 3WNKA 3OBEA 4QG9A 1L8NA 4GH1A 4X0VA 3E49A 1W32A 4NKCA 3N18A 4H8NA 3ZS4A 8TIMA 4QISA 1XIMA 1FH9A 1G7VA 3LBMA 1XC4A 1ADOA 1E51A 3IV8A 3MO7A 1K8ZA 4NAFA 1V7AA 4M0XA 2PDXA 3QXBA 3NQDA 4KWVA 1P1XA 3C3UA 3EXTA 4QQ3A 1GYNA 1K7FA 1A5AA 1EDGA 1XLLA 1K7XA 3UA4A 3RRXA 2P3ZA 5BNKA 1G4EA 2YW3A 4Q8UA 1L6WA 4IPIA 3HM7A 3S5OA 3L5AA 2JFEX 3PPHA 2XVGA 3DYPA 1GW1A 4PRWA 3KWXA 1JPKA 2ZA2A 4UQDA 2WLZA 3TTEA 1DE6A 2EEXA 5HQEA 2WSKA 4DO4A 1KM5A 3GBEA 4YWSA 2W4XA 4Q4OA 2PDLA 5LXEA 3TZFA 3VKAA 2QUNA 4UXDA 4ATLA 4XKYA 2V67A 4NJGA 2C91A 4KEVA 3VKBA 2QJJA 2J66A 4FPSA 3WDJA 3CQ0A 1A47A 3CO8A 1IIGA 1Z69A 2DZAA 1JDFA 1KQZA 4PUNA 3TDFA 5C5YA 6XIAA 3MT1A 1W8SA 2OCZA 2XIOA 3BQ6A 1UKPA 3P5ZA 1QT1A 3G24A 3J7HA 1VJIA 3VMNA 1V03A 3LHTA 1QI2A 4DF1A 5HJYA 4KRZA 3ITVA 2WMHA 1OFDA 3KBNA 4QNWA 5EPDA 4X22A 2OZ8A 1JFHA 4JCMA 2A3LA 1OEPA 4EAMA 3AS2A 1OFEA 3SUUA 1ZTVA 4CNOA 6TIMA 4PEEA 4J40A 2VCBA 1XI3A 3GW0A 4W86A 1JDCA 5KEZA 1VYRA 4RLIA 1CGXA 4W4QA 4DWSA 2QJNA 3BG5A 4PMJA 1S3HA 1J01A 1TPH1 1QK0A 3NXFA 2PP3A 3WFLA 2GGJA 1TPB1 4C6FA 3AWNA 4DM2A 2JBMA 4FOUA 3URBA 2V63A 3CT7A 1ENUA 3MMTA 3T8LA 5CZ0A 4FZIA 3GDKA 4J9JA 1L2QA 3VNLA 5CPLA 3S42A 5FAGA 4L56A 2XIQA 1P1MA 2AMGA 4D8LA 3TN4A 1E0TA 3SI9A 2G50A 3N04A 5A94A 1PSCA 3C86A 3BARA 3ITGA 2UV8G 1HO1A 4I3GA 3KRUA 1XIJA 2REQB 4JHZA 3QW4B 3OZMA 3OLDA 2ZX5A 3EZ4A 4O1AA 1RVKA 1ZHAA 5AN7A 2Q09A 2F8QA 3BCJA 3ZQ9A 4AU0A 1UD3A 3PNUA 1LWHA 3MKKA 4EACA 1YMYA 2VC6A 3CHVA 3MUY1 4AIBA 2PTXA 4AVFA 4CN6A 4I7WA 4PA8A 3VA8A 1ZS2A 1OIFA 1XDMA 4O17A 1XIEA 3GFZA 2OWWA 2IQ0A 2WHJA 4M3PA 3LOTA 4BEQA 3EOUA 3CZGA 4J5NA 1EKOA 4MFEA 5BRQA 1XP3A 5BRBA 2GWGA 4Y96A 3QY8A 4B5SA 3ES7A 1SQ7A 4NZ5A 2G4FA 2OU4A 5LNRA 3W1MA 3CM4A 4DJED 4W9TA 2OGJA 3NSNA 3U57A 1HJWA 3TR2A 3CK5A 1CB7B 4DBUA 1S5NA 4FX7A 3VOJA 2IS7A 3UT0A 1ITCA 4FIRA 1J0KA 3QR0A 3GXTA 3OA3A 4LC8A 1XC6A 2AMXA 4YCOA 3ABZA 1PKLA 4GUGA 2I16A 2W27A 3RAOA 5CBIA 2VNCA 2OOGA 1X6UA 3V5FA 3H2MA 3KBSA 3OLIA 2EPNA 2VZTA 3LTYA 2I57A 2QT3A 1X6LA 1C93A 2GJPA 3VKJA 4WOZA 5XIMA 4FNPA 1H1ZA 3GVWA 3KWSA 3HGSA 1HVXA 1HKMA 1K4HA 1UQZA 4P8VA 3AFBA 1I0BA 4E4FA 3UJSA 3E2SA 2DIJA 2B31A 4HA4A 1HUVA 4PYSA 4A3RA 3LB0A 1RJPA 1YX1A 2ZUSA 4RV3A 2VELA 4Z2KA 2HBXA 3LRMA 3PBUA 1F61A 3W71A 2FHFA 4HN8A 5HWJA 2CBVA 9XIMA 4MUZA 2ZICA 4HB7A 1FXPA 2V30A 4Q6JA 3E0WA 3MP5A 4WJEA 1DIOA 4AF0A 2DIKA 3GU2A 3W2UA 4LYPA 4HKPA 3EOLA 3NZPA 2PDKA 3BUVA 4QXIA 4INFA 3ZSTA 2QAFA 2A7PA 4C7DA 1QCWA 3BZJA 2VRKA 4O10A 3W25A 3PBMA 2Y0FA 4EIVA 1T7LA 4Y9MA 3VYLA 3EMQA 2KZHA 2QVNA 3H26A 3WEOA 1G67A 2GQAA 3K1DA 4Q22A 1V7YA 5JXQA 1VCGA 2QUVA 2BASA 2H6RA 2PBOA 1DJQA 4AD4A 1IXOA 3ARWA 5CEWA 3WQOA 2QVHA 5LXXA 4A3YA 3IJ6A 4UOZA 3VVGA 1BWVA 2OSXA 4GXPA 4K2SA 4JX4A 5AVNA 3LDVA 4JX6A 3NPWA 4G8TA 1BXCA 3QZ6A 4N6FA 3IIVA 4D71A 3AZRA 4WVXA 5JU6A 2OMAA 1ME8A 5DMYA 4UCFA 2X0SA 1D7KA 3VABA 3TSMA 3O7UA 1MZRA 4US6A 4NNCA 1EHAA 2VXNA 5GNZA 5CAKA 4M6QA 2A2IA 4N7QA 1RBAA 5CPNA 2W66A 1F3TA 3OGSA 3YPIA 4DPQA 1GOKA 4JDBA 4MB3A 3CUIA 1EZWA 2VP8A 4MYAA 2WVVB 3S6OA 1BG4A 2XIJA 3LCHA 1T99A 1ZGDA 1D2KA 3W88A 4O11A 4IPNB 3HGRA 1TWSA 1G1YA 3GNOA 5EYWA 1Q6GA 4D6FA 4XZ9A 3PS7A 3A23A 1R9XA 4BCEA 3HV8A 1HG3A 3LHUA 4AD3A 3U0HA 3NPUA 1PXGA 3PNZA 3CT2A 2V5JA 2QJIA 1EWDA 4XK2A 2ABBA 4GMEA 1DIKA 4ZMGA 3CGTA 3NURA 4K6AA 2XH0A 1GOQA 2QCEA 2BG5A 1EP1A 2FPVA 1XHGA 1F07A 2D2GA 4O4WA 1OJXA 3VIOA 1S38A 1QNQA 3QV6A 1JDAA 4LQ1A 3BMXA 5IDIA 3BDKA 3W3OA 1TRDA 3BANA 2J7FA 4TMCA 3MV01 3G1SA 5D9PA 3OBKA 1DWJM 2IKHA 4C6EA 1TSIA 4GC4A 5FA5A 3BPWA 3UU0A 4NIRA 4D6DA 1JUBA 3GXFA 3GC2A 4IFOA 5C2GA 1AW2A 2VGFA 3C61A 1E0XA 3L4VA 4IPJA 2VFDA 3W74A 4C6IA 2C15A 1XLMA 2G95A 3HB9A 3WCZA 3MUZ1 3WNPA 1YPFA 4XD5A 3HFYA 1Q6QA 2V69A 2ZOXA 4M82A 1JAEA 2POZA 4M7SA 4LAZA 1UQYA 1XYZA 3EBVA 1WXYA 3M5XA 1SMDA 2X0YA 5J5RA 6REQA 3O6CA 1V79A 1A3XA 4A8IA 1VFUA 3B8IA 2WWCA 3P60A 3E2VA 3VIPA 3MCNA 3IUHA 4P7QA 1JDDA 2NQZA 3W38A 4ZBCA 1UJQA 1VFHA 5BWAA 4S2BA 4C6MA 2BY1A 3CPRA 4ZTXA 3C2YA 3CB8A 5A5WA 4TTGA 1VENA 4P61A 1ZBVA 1RCQA 3FW6A 3SQMA 1UKOA 3N11A 2BB0A 4ZO6A 4WY0A 3QFWA 4HZ8A 5TBOA 3NPXA 4P7RA 4W84A 3MUIA 4LT9A 5D37A 4X3ZA 4GD0A 4ZE5A 3UXKA 2E9MA 3BURA 3NL5A 4JS3A 1LORA 5AYIA 3WLIA 1BG9A 2YX0A 4R7JA 4F4RA 2G4JA 4OQVA 2BS9A 3OJGA 2PF0A 3LYEA 2BP1A 4GUHA 4H83A 2J7BA 1XPYA 2D73A 4UC5A 2YL5A 3GDLA 4Q33A 2DZWA 2VD9A 4GY1A 1MEHA 3MSYA 4D6EA 4RNIA 5IBXC 3QQ1A 1F7BA 4HHHA 2RJGA 3CAKA 3WQWA 4LSBA 1E73M 2OSWA 2WJDA 2HXUA 3UWZA 1A5SA 4R85A 5C9UA 1JULA 3GD6A 5LIXX 1MDRA 3BLKA 4N9CA 4M51A 4P7OA 2QJMA 4TV5A 2OEJA 4YTSA 2GJNA 1MUCA 3H8AA 3HGJA 1X6NA 3BLFA 7XIMA 3F5KA 2AOSA 1AZ2A 4S1FA 6PTDA 3AIWA 4O53A 1RP8A 4H04A 3W85A 4P8XA 4HPGA 4JFWA 3D6NA 1M03A 1XUZA 1NAL1 3P84A 3SCWA 1C92A 1UC5A 3WJWA 4N4PA 3T55A 3AIEA 4AZ7A 3OZYA 1W9PA 3GXDA 3DC0A 1VBGA 2Y8UA 1IT0A 1EBHA 5EBAA 4HBKA 1GEHA 3WF4A 2OQLA 3N4FA 4NASA 1D8CA 3LXAA 4DWSD 3MWAA 4UMBA 4O50A 2AL1A 1SVDA 4DJFC 3W76A 3U6WA 4MOZA 3P67A