4F2UA

Structure of the n254y/h258y double mutant of the phosphatidylinositol-specific phospholipase c from s.aureus
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
304
structure length
304
Chain Sequence
DSLSKSPENWMSKLDDGKHLTEINIPGSHDSGSFTLKDPVKSVWAKTQDKDYLTQMKSGVRFFDIRGRASADNMISVHHGMVYLHHELGKFLDDAKYYLSAYPNETIVMSMKKDYDSDSKVTKTFEEIFREYYYNNPQYQNLFYTGSNANPTLKETKGKIVLFNRMGGTYIKSGYGADTSGIQWADNATFETKINNGSLNLKVQDEYKDYYDKKVEAVKNLLAKAKTDSNKDNVYVNFLSVASGGSAFNSTYYYASYINPEIAKTIKANGKARTGWLIVDYAGYTWPGYDDIVSEIIDSNKLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Competition between Anion Binding and Dimerization Modulates Staphylococcus aureus Phosphatidylinositol-specific Phospholipase C Enzymatic Activity.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Lyase
molecule keywords 1-phosphatidylinositol phosphodiesterase
total genus 114
structure length 304
sequence length 304
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 2012-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 4f2uA00
1DJIA 1YDYA 1QATA 3V16A 4I9MA 2OOGA 4PTDA 4R7OA 3RLHA 4Q6XA 4F2BA 4QJ4B 4QJ5B 4I90A 5T9BG 3KS5A 1DJZA 3V1HA 4OECA 4RV3A 1GYMA 3QR0A 1ZCCA 2PLCA 3H4WA 4F2TA 3QR1A 3I10A 3L12A 2OR2A 4GNKB 3CH0A 1T8QA 1DJGA 7PTDA 2F9RA 2FJUB 4I8YA 4RW5A 1AODA 1DJHA 3MZ2A 5T9CE 1T6MA 6PTDA 4RW3A 4I9JA 3QVQA 3V18A 1PTDA 4S3GA 2ZKMX 1V8EA 3EA2A 3RLGA 1DJXA 3H4XA 3KS6A 2P76A 3EA3A 4I9TA 3EA1A 1QASA 1DJYA 5T91A 1O1ZA 1PTGA 2PZ0A 2ISDA 5PTDA 2PTDA 4QJ3B 2O55A 4F2UA 1VD6A 1XX1A 3PTDA 1DJWA 2OTDA 3OHMB 3NO3A
chains in the Genus database with same CATH superfamily
2FLIA 4IGMA 2A85A 3TYCA 1A80A 1TO3A 4IUOA 4UNLA 1X8FA 3LZ3A 4O4VA 5CPLA 1PIFA 4HZ8A 1TA3B 4BY3A 4M6QA 2YLAA 2E7FA 3TJ4A 3M46A 4HTYA 3GY1A 3WQ4A 4ZMGA 3ZJKA 2ZX7A 5H8UA 4FS9A 4ENLA 1S2VA 4IQEA 5AKQA 3VNIA 4WSJA 2PP1A 1KFCA 4QE4A 3VNLA 1A4LA 4CD4A 1UOZA 4JXCA 4C7GA 4E5TA 3CO8A 3MDUA 1MZRA 4C5ZA 3MHFA 4XK2A 1DORA 1UUQA 1YPIA 1F8IA 1SFLA 1S2WA 3HG2A 3F4WA 4LVFA 1QNOA 3VNYA 1UHVA 3MBDA 4GYPC 2WJFA 4A8NA 1JDCA 3UD6A 1RVKA 3TYEA 2DORA 4JFTA 2H90A 3SQLA 1H5VA 2WK2A 2YB1A 4ZGYA 2BWGA 3WY1A 1A4MA 1VIZA 3TROA 1PWLA 1ICQA 3KOWA 5I6SA 4ZE5A 4R7JA 1XRSA 1ZALA 3RCYA 2QJGA 4JFWA 4ZO9A 1QO2A 3EXRA 4NIRA 1VPQA 2E6FA 4DX3A 3MV11 1OC7A 3U5UA 3N11A 3VD5A 5H1WA 3ZLFA 4GIAA 1LLOA 1O95A 2BGQA 2HK0A 4H8VA 3QW3A 1GKQA 3VXGA 4GCXA 1RJQA 4O10A 5H2ZA 4KGLA 4PH6A 2DZXA 2DZPA 2Z2BA 1R2SA 1EJSC 3WQDA 4BHYA 5FJJA 3M0ZA 2CETA 1JYNA 3S6DA 3PBMA 1V7AA 4IPPA 1MFUA 1NU5A 4F0SA 2P50A 3CLMA 4YL2A 1H63A 4XBJA 4X22A 4JIHA 1BEUA 1FXQA 3UZWA 4FSAA 3LY0A 3IGXA 4GG9A 3VIIA 4HJFA 3OVPA 1C8YA 3TX9A 1G4SA 4NZJA 1DIDA 1OM0A 3EOEA 4UFHA 4PRWA 4NY2A 1FFQA 4OKDA 3STGA 3WH6A 3KEHA 3GVQA 4ZA0A 1ZS2A 4IFKB 3F2DA 3OG2A 1D7KA 4D6GA 3WH7A 3CMJA 4MYAA 2Z1SA 4EIVA 1XLCA 2O56A 2NX3A 1TRDA 2NUXA 3PPCA 3OODA 1BVZA 2Z7KA 1KGXA 3TU9A 1V6WA 1UR4A 1DOSA 1E0WA 4GI9A 3CHCA 4C6QA 4H9VA 1HFBA 3LYEA 3W7EA 1SR0A 4GINA 4LX4A 3GB6A 5IFTA 3OVGA 3SUUA 1SO6A 3GTHA 5GJNA 1XCXA 2QUNA 1AW2A 4W8BA 1Z7AA 1LUCA 1NDWA 3ZS4A 4R9OA 1P1XA 3CV1A 2CNCA 2W0UA 1U2YA 4O12A 2PU1A 4AWSA 3L2IA 4OU1A 2VQUA 4C7DA 4YYCA 3KTCA 1LJYA 3S1WA 2WHJA 4C91A 4RXGA 2VC5A 1XRVA 5G2HA 1OG0A 1XRFA 5KTLA 3RO8A 1JFXA 1Q6OA 4MWAB 1MQQA 5LNUA 3RYSA 3EEZA 4DXXA 3RK8A 2ZXQA 4PTWA 1BWVA 3RIKA 1E4IA 2VL4A 1Z41A 3H2NA 2ZYFA 1TCDA 4JTEA 4W87A 2D2HA 3T07A 4I5UA 3SUSA 4MLRA 2WSRA 3VIOA 2DZBA 5E09A 2W79A 2QCGA 3PNUA 1Q6QA 1J9YA 5CC7A 3OGVA 6REQB 3KLKA 1V6YA 5BCAA 1UW9A 4FNPA 2MUCA 1QK2A 4XZLX 3AS2A 1LP6A 3BO9A 2AMXA 1FWAC 2HS6A 2HK1A 2XFYA 1H62A 3T81A 2FDMA 3DUGA 3HJEA 3NQBA 3N3MA 3EX1A 4PCPA 2I14A 2JF7A 3CUHA 2YCLA 1XUUA 1F3XA 1PL9A 3AYVA 2LLEA 2W5FA 2E09A 3TP4A 1W1ZA 4GC3A 3W7GA 2BDQA 2G5WA 1FWSA 4AHQA 4UFJA 1GONA 1NY1A 1CCWB 3C3NA 2GUYA 4WOZA 4LC8A 2X2GA 3UXLA 1NELA 5LGXA 3LPPA 5I3KA 3R25A 1YEYA 5AN7A 3VGDA 3IANA 1OD0A 3R1ZA 3E0IA 1XLHA 2PDQA 3NQDA 3WEOA 3WN6A 3OPSA 3RF9A 3ME3A 1ZNNA 1NP0A 1UR9A 3EDKA 4CEUC 2XZ7A 3A5VA 3B05A 4B16A 5E9AA 1OCQA 1M01A 4ADSA 4C6OA 1MVYA 3LU2A 3GVVA 1E70M 4FAMA 2D2GA 4NZCA 2VRQA 4NZ3A 2WC7A 2A7RA 4AZCA 3SI9A 2DDXA 3EDJA 4K8EA 1TE1A 1GQKA 3OEXA 4UTJA 3U9IA 3C52A 5BU6A 2O9OA 5XIAA 4JTRA 1Z89A 3TYDA 3W7HA 2D22A 2QIWA 1AW5A 1XH2A 2D2OA 3STPA 2CBUA 1EJ7L 3IK4A 5IHRA 2G3FA 3W1MA 3BK0A 7TAAA 1PYMA 3EPMA 3BC9A 4IGSA 4RDYA 2ALDA 1QHOA 2X0SA 1GCYA 2Y6ZA 3AZTA 3GC2A 3MKVA 5KITA 2P10A 1SJBA 2O9TA 5BOFA 4TV5A 2J62A 3GNPA 4JIIX 4AU0A 4EF9A 3S5ZA 3N2OA 3PBYA 3TAOA 5AYYA 5ABGA 1J0HA 4PEEA 2SFPA 3BOFA 4Q6JA 4XTDA 1FRBA 4YTTA 2V82A 3MTWA 4PCFA 3CK5A 1CNVA 3HBLA 1ITXA 3SCQA 1GW1A 2J88A 4CCDA 3CUXA 4NI3A 4BEQA 2QYGA 1Q2SA 1SO4A 1E1CB 2HS8A 1LQ0A 3RMEA 3WIJA 4XB3A 2V5JA 1GT8A 4Z0JA 4IL0A 1OCBA 5AECA 5JIPA 1A5AA 1K7XA 1ISZA 1JQXA 4I9TA 3U2EA 2GWNA 2J8FA 5IBXA 2O55A 4PZVA 4PCTA 3UWVA 3GIPA 4H1ZA 3QXBA 3S9ZA 1YTDA 3AS3A 3F7JA 2QNEA 4QX4A 1L6GA 2W27A 2XGBA 4V1XA 1YTEA 4R7OA 4JTLA 1QNQA 3I65A 1OFPA 4DBEA 1MQRA 3AAMA 3L12A 3DFSA 2WC4A 2EAWA 3LCGA 3IV3A 1UIOA 4FF5A 3STFA 5HANA 1RD5A 1TR9A 1UWTA 4FMVA 4GIEA 1BRLB 1I0DA 4JFSA 4PYSA 3SGGA 1REQB 3G24A 1XLAA 1KTNA 5GNXA 3H53A 5F4SA 3VDBA 1J18A 3VKBA 2Y63A 3TONA 1GOMA 3BJTA 1JQVA 1TTJA 1HW6A 2I5QA 4Q33A 1SU5A 4Q7BA 4RW3A 4GZJA 1QI4A 1FOBA 1QVBA 5A8MA 4MYXA 3H12A 3UGRA 1E5NA 2CHNA 3VIFA 3CUJA 1TUFA 3GS6A 4D6HA 4UMBA 1L6YA 1RUSA 3GAKA 4A3QA 4QEEA 4URIA 1A5OC 5D2YA 4P5UA 3N18A 3UJFA 3E6EA 1UWIA 4DRSA 1EIBA 5JQ9A 3WJYA 2PF0A 1WOAA 2VO5A 1O5KA 1U83A 2CLFA 4BKNA 1JI2A 3U8GA 4H9XA 4ROQA 3KE0A 3CUGA 3W1QA 4FXRA 4M81A 5C54A 1RP8A 4ZE4A 3LCFA 4CN6A 3PBUA 3GUGA 1JR1A 1JGMA 1CENA 4HZ6A 4GJJA 1EBHA 2YL6A 4Q3MA 3MVTA 2CWXA 2OSXA 1XIFA 1E72M 3UU0A 1AD4A 1SPQA 3P5ZA 3WDIA 4DUOA 4JKKA 1LBLA 1AJ0A 3H2EA 2Z1WA 1ONWA 8XIAA 7REQB 3WQWA 1KB3A 4I8YA 3WNPA 3BCDA 2GL5A 4GUGA 4IJRA 3PWAA 2GK1B 4QSHA 2GOUA 3E5BA 3ARPA 4IUGA 2JKEA 1H11A 2ZFAA 2E9MA 4F9DA 4UOJA 3N2BA 3NDYA 1M04A 2NQ5A 1YXYA 1CDGA 2EQDA 1JZ6A 5D30A 2GSHA 2GVYA 3VDAA 2ZICA 1F4HA 3Q45A 1B57A 2NQHA 1ODZA 4AVOA 5CG0A 4GXMA 3W2JA 3KVJA 5C2XA 4JIPA 1H0IA 3CJPA 3OLGA 1QW7A 3HN3A 2V67A 4HCHA 1KGUA 1Q13A 3QY8A 1KWGA 1Q4WA 3QY7A 2IPWA 3H4XA 3KCJA 3S5NA 3RDKA 3SCNA 4GVIA 3S8HA 1UWRA 3OW1A 4P8WA 4P7QA 3KS5A 5CZSA 5CAKA 4FXSA 4JYDA 3NXFA 4R5EA 1DQUA 1HJWA 1DYSA 4PODA 1JEZA 3IEBA 3EKLA 3WBXA 3P0XA 3W1LA 2ZX9A 3IJQA 1QASA 3L5MA 5C9WA 1VH7A 4OWGA 3BJSA 4Q7NA 3QHNA 3B0YA 1E4MM 3MVIA 2QCCA 1QI5A 5BRQA 1V7YA 3ZJ8A 1S5MA 2QJJA 3A4AA 4UZUA 1PIIA 5DCDA 2EXOA 1V8EA 2Y62A 3KRSA 2P76A 3VABA 2A79A 3ELFA 3ZT6A 5SWUA 3QOKA 5HMDA 1FKWA 3QY6A 2DW7A 2I17A 1WXZA 4NJHA 3N12A 2XM1A 3E2QA 3V5CA 3VKCA 3MUY1 4YU1A 3SIMA 1RCXB 2JEPA 1S5NA 4ZO8A 2V68A 4U2YA 3XINA 3CB3A 2W4XA 4Q8WA 2J13A 4Y9MA 3DZ1A 4DI8A 5C0QA 4GOAA 3KZSA 3W70A 4F2TA 5BXTA 4WXYA 5J04A 1SSDA 2EPLX 3V7PA 1MQPA 4M80A 3PJTA 3CTTA 2DJLA 4Z08A 3Q67A 2OJPA 3GQYA 2B81A 4XISA 1GTEA 3L4TA 1PSCA 1UCWA 3MV01 3UY7A 2E9LA 3N04A 4DEFA 4XG1A 3CQIA 2PDXA 2XIIA 2BVYA 1W1PA 3GXNA 3AHTA 2QUTA 4AISA 2HNHA 2PGEA 4NZ1A 4REQB 1UWAA 3KOXA 5EPDA 5LIUX 1TPVA 3SSZA 4GH3A 2PWUA 4UQBA 1KM4A 4F0LA 3M0YA 3OLIA 3EB4A 3VGBA 3QTGA 1LWHA 1FWWA 4H6KA 2D24A 2WM0A 2CXEA 2XIOA 3P0WA 5D09A 3ITCA 4CN1A 2PDHA 5GJMA 3GG0A 4TR9A 4RNFA 3OO2A 4DAFA 4LS1A 2OSYA 1YDYA 1CX9A 3WLSA 4AIBA 1YTKA 2V2DA 1ICPA 3LV6A 3EWXA 4X9YA 2PGRA 3ZR5A 1LDCA 1VAHA 1S1PA 3V0UA 3SDOA 3WJXA 3FFSA 5G1YA 5I06A 1D9EA 4JOMA 1GTHA 2DVTA 4G7FA 3UY8A 2VFGA 4TVUA 2TSYA 4HN4A 3AI0A 1J93A 1XSJA 5FJRA 1OJXA 4JTUA 1CXFA 3REQB 2V5BA 2DIEA 2WSKA 2UZ9A 1UG6A 2OXNA 2OX4A 2VP8A 3RU6A 4H7VA 2CKSA 3UG5A 3IIXA 2OLAA 3DG6A 4PULA 1YYAA 4C1NA 4GZEA 1Q7ZA 4NG3A 4CD7A 5C70A 4KT2A 3CZLA 4MB3A 3PBWA 2PAJA 1QRQA 3R8GA 2G4FA 5AC8A 2FGZA 1G4EA 3W1PA 5FD0A 1IWPA 3EWZA 3GHSA 3CC1A 4LRTA 1K9FA 1JDEA 2WMHA 4AW7A 1OYCA 3DC8A 4O16A 4MWAC 4MPQA 4EPDC 3W7LA 1WYIA 4NXSA 1K8CA 3B40A 4HTBA 4NNAA 3FEMA 2YJQA 2AOSA 3UERA 4IF2A 3T1GA 1PX4A 3SY1A 5K4ZA 2P8CA 4QAWA 4HU8A 2BVDA 1R7AA 6A3HA 2GZXA 3FK4A 3DHPA 3ZSTA 3W01A 5F2LA 3W75A 2MNRA 3WQPA 3PBGA 3MT1A 1X1ZA 3UPWA 5DCEA 2DIJA 3QQ0A 4HU3A 3ZYZA 4GJIA 3VGGA 4IXXA 3IPWA 2PZNA 1CLKA 4O19A 2HNEA 1BTMA 8TIMA 2E6DA 3EOLA 3IJ9A 2G8ZA 4DWSC 3VNKA 5E1QA 2ZWYA 3G3DA 1E71M 3WG6A 2PP0A 5DMYA 2A0NA 2VDGA 4E0CA 1TZ9A 2XN1A 4JYEA 2ZRYA 4LYKA 3T0AA 3R8RA 4AZCB 3BOXA 3WENA 3DU0A 2J74A 3HGOA 4OUEA 4DWSD 3W7JA 1DBTA 4MJ4A 4MAVA 1J01A 3WUBA 3AALA 2CERA 1OK4A 1F3EA 2Q3RA 1JZ7A 3TEVA 4PMNA 1P0NA 4U31A 2IKGA 2ZRUA 3GDKA 1SM9A 3XISA 4QBXA 6PTDA 3HM7A 3I3EA 3FAWA 2WKJA 3ITLA 1LWIA 3P6LA 3MO4A 3MSRA 1VEPA 5AFDA 1PKLA 5AC5A 3F4DA 1E0VA 3HO8A 3NZ1A 1KFLA 1ZTVA 1V0KA 1VS1A 4O4WA 4OV4A 4A29A 4J2PA 4H3DA 1QHPA 1R47A 1QK0A 4BZYA 3PNZA 2A3LA 3SUVA 4DNMA 3E02A 2C71A 2VGFA 4IMEA 4M82A 4UTUA 1J10A 3LPOA 4B4HA 3NL3A 4LCRA 3JUGA 3M4HA 3QSRA 1FWEC 3C61A 2VZUA 1IEQA 4ADUA 2QKFA 3W9ZA 1GZJA 1SMAA 4ILSA 4RLIA 4ERGA 2NVCA 5CC3A 5DF0A 2FFCA 1R3TA 2R6OA 3CHEA 3UZJA 2H3DA 3KVMA 3E74A 1T7LA 3LRLA 4WRHA 4QNEA 4DVOA 4QFUA 2YL9A 3EWYA 3VOFA 5F2MA 3TCSA 2DZSA 4U10A 1J6OA 1H7WA 1W5QA 4DWSB 3AFBA 4O1DA 1T6MA 1E40A 2Q8XA 3B03A 1TSIA 4IXHA 4OJYA 4E2VA 4OBRA 4CQAA 1GOXA 4D2JA 3EOOA 2JE8A 5T9BG 2R1NA 3CT2A 1H49A 2VJXA 2PLJA 1TIMA 1RK5A 3NO1A 3QPYA 4AXKA 3W28A 3ARYA 3N2TA 3E5PA 1GVFA 5AYXA 3CYJA 4GRSA 3LCXA 2DSWA 4AVFA 4UFMA 2G3NA 3WL1A 4Q4RA 3WFAA 1HJQA 1AD1A 5JU6A 4C1NB 1KXQA 4LVBA 4PFHA 3P82A 1XKJA 2BG5A 2E9BA 4L9YA 3KLLA 1I60A 4A6GA 4WLCA 5FF0A 5EMKA 5LNRA 1M7JA 3USZA 3CB8A 1BGAA 1ECEA 4R3UA 3E0WA 5LIXX 4JIEA 3WH8A 3T0CA 4DY1A 4DUWA 1ZHAA 2OWCA 3CWNA 1VFHA 1UZHA 3NDZA 3ATZA 3WNLA 1G9HA 1XR2A 1IT8A 4FK9A 2DZUA 1EDTA 4JN6A 3FA5A 3IWPA 4FNRA 1EF3A 2E1DA 3EXTA 3M7WA 4FR1A 4R27A 2XH7A 3PZOA 3KHJA 3IV8A 2CHRA 4C7FA 1BSIA 1P48A 4W9TA 3SR7A 4UTWC 2J77A 1QPKA 4Q4SA 2PP3A 2VZSA 3VC6A 2YSWA 3KX6A 3VOCA 4XIMA 5D9NA 3AZSA 2GDQA 1B1YA 3W6YA 1K70A 3SFWA 3T55A 3LHWA 2O7SA 1VFLA 3EWWA 3GTNA 3TN5A 3GHUA 4GPNA 5D05A 3CHVA 3CHFA 3LG3A 4B2DD 1TZ7A 4LVAA 4W8LA 1K9DA 1HVQA 3B0UX 4AEFA 2UWFA 1GPFA 4KFOA 2E5BA 3DKJA 1IEWA 2WC3A 2WYSA 4JQ3A 4N4PA 4EK7A 3WUGA 3TYAA 2ZUMA 2GGGA 3N6JA 2C91A 4GFSA 1RAKA 2E6AA 4PMDA 1E3ZA 4DM2A 5DN1A 1NOFA 1C90A 1W8SA 1YKWA 1R2TA 1X7IA 4Y8FA 3FGCB 3I6TA 4O1AA 1D7FA 3LHYA 4BFAA 3V1HA 1DE5A 4ONVA 2Z26A 1TPB1 4ZR8A 2BTMA 3L4ZA 2IXUA 3A3XA 4FNTA 4JTGA 4TX9A 4W7WA 4DNHA 2PDJA 2Y8VA 1KNWA 1R6WA 4UNIA 3KW3A 2POTA 2W66A 3FEQA 1X38A 4ICMA 9XIAA 3G0XA 2B7NA 3II1A 1W1A1 3D0CA 3G1DA 3N17A 4AC7C 1XBVA 3THAA 2RFGA 2VFFA 4H01A 3UYIA 2PBOA 5DX7A 1RCOB 1FHVA 2I56A 3AIBA 3C86A 2CZ5A 7ENLA 4B9ZA 2YA2A 3MZ2A 3EDDA 1O4UA 3C5QA 4KEUA 2WMKA 4DZHA 1I2QA 2DSUA 4GQRA 5GJPA 1Q6GA 3WH9A 4ZB2A 4FX8A 3RPDA 1E1EA 3GIQA 1RLCL 3QFWA 3STCA 4NT0A 4LW7A 1DKWA 2XFRA 5DT5A 1QI2A 1UZDA 4QDPA 1O1ZA 3IRDA 3A5FA 3UCQA 3KRBA 3MS8A 4JDBA 4Y90A 3BG9A 2ZXDA 3CZKA 4WIWA 4DYKA 1RZMA 2WB5A 4ZQPA 1O60A 1IR1A 2WXDM 3VIMA 2INFA 2D0HA 3H54A 3NG3A 1YDNA 1W6TA 3AISA 4G1NA 4FLOA 3NTYA 1M7XA 2V2HA 1B0IA 4K1WA 2E4TA 4FF7A 2OT0A 1LOSA 3MUAA 5I78A 4W7VA 4MSSA 1C9WA 4S23A 1R3QA 2WZHA 4UTTC 2HISA 3F4NA 4DZ5A 2GFTA 3BCJA 4JGDA 2I9UA 4X3ZA 1CGUA 1W17A 1KQZA 1YW1A 2WMIB 5L9FA 5GNZA 1JAEA 1CPUA 3TQPA 1EQCA 3QMRA 4GVGA 2XIMA 3U2ZA 1IR2A 3ZVHB 4FOJA 5HINA 1WXJA 4QITA 3L7RA 3UJRA 3Q94A 2PWHA 1CEOA 4LRSA 1B31A 2P1FA 3BSGA 4UQCA 4O28A 1VQTA 5EBAA 1UQZA 3TJIA 4ADTA 1T99A 4YHGA 2X1UA 1KTBA 5HUOA 4PUDA 2OEJA 1WA3A 4MKVA 3D3AA 4DPQA 4GJ1A 3NUKA 1DL3A 2D20A 1VFMA 1WDQA 4A05A 5A3HA 3VKJA 1OGSA 3LQGA 4CU6A 2DQXA 3W24A 1L0PA 1Z44A 5E6YA 3EWCA 4HT3A 1I4NA 3S4TA 4UNKA 4NF7A 2XIBA 3MC5A 2QMKA 3VMOA 4AD0A 2XVPA 3QJAA 2VOTA 2WM1A 2QMJA 2E67A 3RRXA 1E15A 1TPUA 1M41A 4KFPA 1JCXA 2WBGA 2POZA 3MYPA 4WSKA 3SW6A 5I3GA 2IW0A 1GKPA 3UWEA 3ITTA 1QNSA 3H21A 2ZC1A 3OHIA 3ZT5A 3WDQA 1DIEA 4MY1A 3E96A 3BV7A 4E4PA 1KM2A 5REQB 4MNLA 1VR6A 1EJWC 1BRLA 4IH3A 5HBFA 1JNEA 1HNYA 3QMSA 1SFJA 3R13A 3WLJA 1PEZA 3LTYA 3CHDA 2PC4A 2X41A 3BAWA 3Q58A 4K36A 2X7WA 4GNVA 2Z27A 1LL4A 5BU9A 3W53A 3GXFA 1FH8A 2GWGA 1WKDA 2VUYA 3VAVA 5C9ZA 4Y6GA 4CGTA 2FVMA 1SZFA 2A7NA 4LUTB 2DW6A 1RPKA 3F2BA 2FB2A 4GI4A 1UD5A 1UR3M 1W8GA 3JZEA 3OQ8A 2YBUA 4NX5A 2OR2A 3JZUA 5A2AA 2HVNA 1J2BA 2OO0A 4B5UA 4QP0A 1AH4A 1AFSA 2XN0A 4BQ4A 1GQLA 1FHUA 3S9IA 3M6DA 3E2VA 3D6NA 1ONXA 1Y65A 1YDOA 4D9PA 3QKZA 2CIPA 1RY8A 1N55A 1OK6A 2EPNA 4CCZA 4LSBA 3NQGA 1X7FA 3UR5A 3WQOA 1E6NA 3APTA 4HNTA 3PZIA 5LNVA 1BVWA 3KWSA 2C18A 1BYAA 5MKGA 4HHMA 5ENLA 1XS2A 3VD3A 3UF9A 3E38A 4ZEPA 1RJPA 5FJOA 1F6PA 3UFYA 3A21A 2ABAA 2BGNE 5T26A 5I77A 2GQ9A 4EPKA 2XGIA 2AGTA 3BL3A 3TV8A 2PS2A 3GAYA 3JRKA 3TQVA 4AF0B 4A35A 2H8ZA 5ABFB 1XLMA 1XLJA 4EAMA 1J5TA 3BLPX 2Q01A 4UTMA 4TMCA 1SZRA 3EPNA 4JHZA 1FWCC 4XO7A 3TYBA 3PPHA 1HTIA 4EWJA 3G1SA 1NDZA 1XM3A 1YRRA 2NV2A 3P80A 3BLKA 5HQEA 3WYZA 4C6KA 1R5YA 4E8GA 1XLBA 1ISWA 3C3UA 4H19A 1KCLA 3ITOA 4GUHA 4GZ7A 2G0WA 2YFNA 4DAIA 2PTWA 5CZJA 2PODA 4GBDA 2HTMA 2OZ3A 1EQPA 3GXTA 3QR3A 4NYUA 1OVDA 3TAKA 4JQ2A 2HPIA 2V8ZA 3GDLA 5HDRA 1YNYA 3LUTA 2E28A 6REQA 1L6SA 5CPOA 1DE6A 3R2GA 2DSZA 4PR4A 2ISFA 4ZFMA 4S2BA 2VD8A 1XD1A 1XYZA 1TMQA 2OQYA 2R9RA 1SSGA 3W85A 2DZAA 3ECQA 1ADOA 1MEIA 3DESA 2NX9A 4GWEA 3RCNA 2OWXA 1LBMA 3RHGA 4W93A 3A24A 1BXNA 3AXXA 5D4YA 4A2RA 2WJDA 1XDLA 4C6LA 3TOYA 3GC4A 4AHPA 3KCLA 3E9AA 4HHPA 3W2LA 2YGYA 5EMYA 1LCOA 4K1GA 3RM4A 3T0TA 2CU0A 4IPNB 2RDUA 5I0DA 3N3TA 4S1FA 3AICA 2YOCA 2X09A 5G4HC 3M0VA 4LVDA 5ABEA 1QPRA 3MHUA 3ARQA 1V5XA 1ITQA 4DZAA 4DI9A 1LOQA 1GQIA 1US3A 5HA7A 5A5WA 1F76A 1X97A 5CC6A 3URAA 4HJWA 3AIVA 1DXIA 4ZOAA 2HPMA 3QF0A 3ARXA 3O7UA 3PP7A 3U57A 1TWWA 9XIMA 1XISA 2VX6A 3HTWA 4ZXOA 4E2DA 4E4FA 2EF9A 5FSEC 3VOHA 2OMAA 3KTSA 2FVLA 4ZQCA 4UQAA 2Z2UA 4AHOA 4CNSA 1JXKA 1F3TA 1WZLA 4Z2HA 3W25A 1G1YA 3W7KA 4GYPA 4JCLA 2EPOA 4PB4A 4BWLA 4C1KA 1VLIA 4YPJA 3O05A 4LANA 4ATLA 2J6XA 2RGMA 1BHGA 2QF8A 3TVAA 1U5JA 5HR7A 4Q4MA 4L1XA 1E6QM 2W3ZA 4O18A 2OGJA 1W1IE 3GDTA 1JD9A 2GVEA 3BTNA 1TZZA 2DUZA 1FCUA 1X6UA 2J7DA 3A3HA 4J27A 3W22A 3PFRA 1VFOA 4BS0A 2YXGA 2QF7A 1FXPA 1MUWA 4C6NA 1TWDA 2HZGA 4BK9A 1H1YA 5E5CA 2FZNA 1E9YB 2OEKA 2ZZ5A 3DCPA 5RUBA 1OCNA 5EFDA 2ZX6A 1GZGA 2GVLA 2FPTA 4EANA 3AQUA 2J25A 2HSAA 3GG1A 3CH9A 1F61A 1DJIA 3R6IA 4WVXA 3V5OA 4LAMA 1OADA 4W5ZA 4AB4A 3PZQA 3S5OA 3EWBX 5JBEA 3UXAA 5C7VA 1P5BA 1DQWA 1GHRA 3PUEA 2OODA 3A47A 3VCCA 4XTIA 5JBFA 1QBAA 2NW0A 3FSUA 4A3RA 4JX4A 1XPGA 4RE4A 1PKMA 3FOKA 1ZAHA 2DEPA 3UWUA 1POKA 4FNSA 2WMIA 4DPPA 1TPH1 1L2QA 1Q8AA 2DY3A 4EXBA 3OOQA 1SQ7A 3TZFA 5CZTA 1RBLA 4CD8A 3BURA 1U1HA 4XBSA 2QDGA 2HXTA 7XIMA 3L23A 4NL1A 3HMJG 3HF3A 1H0GA 4QQUA 2OT1A 2PTZA 4DYEA 2VEMA 1A47A 1R3WA 3F4CA 3I7RA 3H26A 1U1UA 3KTXA 1F74A 1ZENA 1WP6A 2REQB 3CZJA 1V3MA 5I09A 3MW7A 1GUVA 2QPSA 3GXIA 1B54A 5D2TA 5K7JA 1GJUA 2WZMA 2YDQA 1J12A 2ZZ2A 4JFVA 1V08A 1A5MC 2GVJA 4WK9A 1ALDA 3I3DA 1D2KA 1BXBA 2Y5EA 2Z4GA 2CEQA 4LUSB 4NZ4A 4B5NA 1NWTA 1CECA 2REQA 3QLLA 4NJIA 4I5RA 1JCJA 5JBDA 1Q2RA 2YDRA 3ZLGA 5CPMA 1XJBA 3BQ5A 2WOQA 1KV5A 4NQ1A 1K1DA 4Z2KA 3ABSA 3AIRA 3W0KA 2Q8ZA 2EPHA 2O4QA 2O4MA 5D2WA 1TPDA 4GH1A 1M03A 3EKZA 3LPFA 3QFEA 4PUWA 5JMUA 2EG7A 3TTSA 2OZTA 3UWZA 2EPMX 1C92A 4YWSA 3BV4A 1EUAA 5CKSA 1NVMA 1HP5A 2WHKA 1E43A 2Y24A 3EKGA 3MJMA 1RHCA 1JYWA 1XGDA 1W9PA 1TMLA 3MKCA 1UKOA 3M0IA 3N2CA 3G0SA 2PFHA 1TREA 1KM5A 1TJ0A 4RE2A 3WFZA 4D8LA 1NAL1 1J6PA 1KD0A 2YPIA 4BR1A 2OPJA 4C6BA 1OINA 4BWLC 2VRJA 1T96A 3LM7A 2J78A 3DYMA 5D8ZA 1FY6A 2V2CA 3NPWA 4BF9A 4BQ3A 1RJRA 1GOKA 3TSBA 3MANA 3TWAA 4HP5A 3QGVA 2R82A 3W1AA 1MDLA 1TV5A 3W71A 4JTHA 4KW2A 4G9PA 4JL1A 4K8HA 4XVDA 1M6JA 3ZJ6A 1EP2A 2FH6A 2QDDA 2YDAA 4U2ZA 4ZOBA 3U7BA 4JPGA 4JY8A 1QJWA 3W1UA 1G94A 3TYZA 1IIGA 4NRSA 2J4GA 1XX1A 4PUJA 1ZAIA 5E93A 4GBUA 3LQLA 2OX1A 5EMUA 1I2RA 4CCCA 2B7PA 2BP1A 3GM8A 3H4WA 3VM5A 3FSTA 4JIRA 5AVNA 1W54A 1FDZA 4LQ1A 4PUMA 2QPXA 3H24A 2ALRA 5E6ZA 2QW5A 2CLIA 1H41A 3MSGA 3B9NA 1NOUA 2ISDA 1R0MA 1NSJA 3M9YA 1TTIA 2OLSA 4GLEA 4LF2A 2J8TA 4L1GA 3GUWA 2V9DA 3R58A 4IFRA 4D1JA 4IM4A 3KBNA 2A2IA 4GY0A 3E12A 5H6HA 4DJDC 1LL7A 2IKIA 2R91A 5M5DA 3I4EA 4FIQA 1HKVA 1PXGA 4I6VA 4TVDA 3P84A 2OU4A 3WF1A 2H9AA 4XKYA 1K8XA 1ML1A 4NYYA 1ZZMA 3P2VA 4M6UA 2IKHA 1Z32X 1R85A 3CS2A 3MPGA 4TX8A 2AKZA 2GGHA 1F3WA 2Q6ZA 3WDPP 3BJFA 5AYIA 4MMWA 4UTWA 1H4PA 4AAJA 3OGRA 2VNCA 4FNQA 3E0VA 1GG1A 3A9IA 3F2CA 3PUGA 4E3TA 3ZIZA 1J0ZA 4JTCA 2CITA 1XIIA 9RUBA 3JW7A 3O9NA 3WNKA 3DI0A 1WKFA 2DZTA 2V63A 3S42A 1XINA 3GU1A 4CQCA 4HPHA 4ATDA 1IZCA 4IMCA 3VINA 2HBVA 3TW7A 2WLYA 4EXQA 2JKAA 4NI8A 3RILA 3AUOA 2ZOXA 1KFWA 2GGEA 3N6QA 3NEHA 5CCZA 4AMAA 5HPOA 1UWQA 4XZMX 3OZPA 4LAUA 4Y9PA 2CHOA 3BQ6A 1CGVA 4V28A 4LY8A 2VGIA 2BV9A 5HQMA 3F4VA 4L1WA 2YLLA 4DJFC 3GR8A 2AKMA 5BW6A 4ZQRA 1YDVA 1DJQA 4KWVA 4LEFA 5B80A 4K2SA 1MWOA 2RHGA 3UWYA 5TBOA 4WUIA 3RLHA 4QXIA 5HNNA 1ELSA 2PF8A 1OB0A 3USBA 3BUVA 4KIRA 2Z29A 1RBOB 1LRQA 4AZIA 1TJ2A 4V15A 3GBEA 2V3GA 3W1XA 4CD5A 3S1VA 2VHLA 4AX6A 1RPXA 4EACA 4L80A 3CNYA 3H70A 7PTDA 5AB3A 3LSBA 1I75A 3A12A 3PS7A 2F2HA 5J5DA 4CEXC 3UETA 1UD3A 2NUWA 3V3WA 4KEVA 2VEKA 4ACYA 4NAFA 3NQ7A 1V6TA 2W61A 5DBUA 1EO5A 4PBFA 2PA6A 3VIHA 2DQWA 2BXZA 1IV8A 4AYSA 2QCEA 2WV8A 5A6SA 2DT1A 3P61A 3H8AA 3ARRA 4HCLA 2NQJA 3W1RA 1S38A 3WMBA 5MF5A 1PCWA 4HNUA 2J9XA 1YX1A 2ZZ7A 3INPA 4MY9A 1MYRA 1O1HA 5M2FX 4PBEA 4RK8A 4HU0A 4PC8A 3KP1A 4JDYA 1K9TA 1W1B1 3BAKA 3FHAA 1Q7QA 1NQKA 4U28A 3MP4A 1XRTA 1W3KA 1K8ZA 3MU7A 2J9YA 3BAXA 3PZGA 3WBWA 4ICNA 1US0A 3R4IA 3OB8A 2QEZA 3UZ5A 3THQA 2J27A 4IIFA 3WNOA 2X1TA 1M9HA 4IIDA 4MLJA 3JVAA 1IEVA 3ZLHA 2ZWZA 3FKKA 1H51A 3NO3A 2Z1VA 4A3YA 3S1GA 4US5D 4PL2A 4LT9A 1V0LA 3ARWA 4XKMA 5A95A 4B5VA 2PCEA 4IQLA 4WY0B 1VBGA 3WF4A 3WX7A 2CWNA 1XQLA 1DJWA 1F5ZA 1PZ3A 3SJ3A 3VM7A 3LTPA 4UQDA 7ODCA 5AC6A 1XYAA 3SCSA 3PB2A 4X2PA 4LCSA 5E0CA 2WSQA 2J7FA 2QCMA 5D8WA 3RN6A 1QI0A 3N6HA 4JS3A 1CB7B 4UR8A 4JTFA 3CWHA 2VCAA 3B8TA 3O0KA 5TAOA 2BOFX 1BQGA 3TR2A 1AH0A 3VILA 4N0RA 3W2MA 5LSMA 3LLXA 4XD6A 1QMLA 4EWND 1TIWA 1W5OA 2OTDA 3GYEA 1SJDA 4Q6XA 5D37A 3G8RA 1W31A 4P61A 4R9XA 3OBEA 4GCAA 4IP4A 1LQAA 4WGHA 2GOKA 5D33A 1GVRA 3LN3A 1M7PA 3BXWA 5A6BA 1RR2A 3GDRA 3ALFA 3GKAA 3LB0A 4CQDA 3T05A 4IIGA 4KCVA 1BYBA 4PUNA 1DJZA 1LORA 2WVTA 1GWJA 2ZRZA 4IG2B 1MO0A 1V3IA 4AIEA 1I1XA 2ISVA 3AJXA 1R3VA 4NU7A 5XIMA 4LC6A 1PTAA 3OBAA 2VTFA 1G7UA 5C55A 3YPIA 2QS8A 1ZFJA 1O6IA 2R94A 2XSBA 2X2YA 5FJTA 3KRZA 1WXYA 3NWRA 3MO7A 1VBHA 3L65A 3I6EA 3LS9A 4AD3A 3PAOA 3BLEA 1OX6A 2VZVA 4AWEA 5IHSA 2ZADA 1U5HA 1EWDA 4HD5A 1K4HA 4I3GA 1DJHA 3CU2A 2XIQA 1DHPA 1GQNA 2A3CA 1VEOA 4KEZA 2Z1KA 1YE4A 3G3MA 1MUCA 2WW5A 2W9MA 3B04A 3CWOX 5C71A 3WJZA 3VIGA 4G7EA 1KM6A 2R24A 3D47A 2CXGA 3KOYA 3NJ3A 4P7RA 4JY9A 3T2PA 5JUVA 1SVDA 4ZOCA 1ZGDA 3M0HA 5BROA 4HKPA 2ZUUA 3IAPA 3VKAA 4F40A 1A50A 3FJNA 4JTAA 1RQEA 3P7YA 3O07A 1UBPC 2INEA 2Z24A 4GVHA 3LLDA 3L5AA 1TELA 5DMMA 3GRIA 3CV2A 4AIUA 1HQTA 1S2CA 3RX3A 3GKFA 6XIMA 3QC0A 1KBBA 3JS3A 1DIOA 3BLLA 2JF6A 5CSYA 4CD6A 1EGVA 3W74A 1FWHC 3ZMRA 3DKLA 3ITYA 3NO5A 3QV7A 1UR8A 4QG6A 5F4WA 1BYCA 1O5QA 1CGTA 4J3VA 1HO4A 4GQGA 3L4WA 5CEWA 3WKZA 3AIWA 1P7TB 5IRPA 1KCKA 4GUJA 1EC9A 2QHAA 3QZAA 3B9EA 4MKSA 3G1AA 1X96A 3PZVA 4XSMA 4NNBA 4A8IA 4H8UA 3G5EA 1BAGA 3W6LA 1E6XM 5DMLA 3K2GA 1A49A 1C7TA 1XF0A 3B9AA 4KS0A 3GFZA 1FDJA 2DH2A 2RGLA 3WQFA 5K2ZA 4J3WA 4MGGA 1WBHA 2TAAA 2FVKA 3MQTA 3QR1A 4JTJA 1US2A 3A6OA 4PTVA 3E0LA 3QV6A 4NVTA 3LTSA 3TTEA 4W86A 4O0ZA 1VPXA 3W81A 3IIPA 1XLEA 4F8XA 4MZ1A 1OFEA 3TZNA 1P0KA 3W7IA 4LU0A 2Y8KA 3LX9A 3T9PA 1L6WA 1JFHA 1BGGA 2QUMA 3IUDA 1X6LA 3ANYA 1TV2A 3FDKA 5JH2A 3ONCA 3TUUA 3L4YA 8XIMA 1ZBWA 4QSFA 3ZQ9A 4PSPA 2WANA 2GDUA 4PSRA 5FACA 1A3HA 1POJA 1CXLA 3AHVA 2Z0IA 3N15A 1EHNA 3FGCA 3CPRA 3I7SA 5KZMA 3B4UA 4XZHA 5AC4A 1F73A 3LEPA 1RLDA 2PDBA 1NDYA 1ZU8A 3V4BA 5ABTA 4W7UA 1M1BA 4XZIA 2I1OA 4DJDA 3NOEA 3P62A 4E38A 1V6VA 1B2YA 1K3UA 1EP3A 3AU6A 3O6YX 4H7ZA 1GW9A 4YXGA 1XYCA 3A9BA 3B3DA 4H41A 4F66A 4B3KA 3EMZA 3SCOA 1VBRA 2RJGA 4YMZA 4CQ9A 5BRPA 3HGJA 2P5NA 2VX4A 5FAGA 1NM9A 3R11A 4GD0A 5CGMA 4F4RA 3DFYA 3VNZA 2UBPC 4N9BA 1JPIA 5LA0A 1ITUA 3APGA 4N6FA 2VGGA 4ZCWA 2PD5A 1S46A 3B06A 7A3HA 2OWWA 4H2CA 4O0KA 2ZUNA 4V33A 3W3OA 2FFIA 1M68A 2FZMA 3LGGA 1EPVA 1XBZA 3C8NA 4P2VA 3QRHA 1AQMA 3N9KA 5HJYA 3G22A 1OFDA 3S2CA 3PF3A 1NF0A 1Y5XA 4HYRA 1HP4A 2ZQ0A 3GC5A 2ZDRA 3MBFA 3QPEA 4UOZA 3MP3A 1WB0A 1R86A 1B4KA 4MM1A 3W29A 4QDWA 3UXIA 2GYIA 4J3UA 1WKEA 3V35A 2GK1A 3QQ1A 2D23A 3CIWA 1VFFA 4JKLA 4QTGA 2FTPA 1SZGA 2B0MA 3ZM8A 5AY7A 3NAVA 3TLQA 1VP5A 1EJUC 3VCNA 1KW1A 1ESWA 4MKNA 3VIKA 2AQOA 3IJLA 2Q3OA 3QBUA 1QPOA 3RR1A 1WDRA 1IEXA 2XTKA 3BSMA 1PX8A 2IS7A 2D0FA 2FGLA 3URQA 5BXRA 1UKQA 5C2GA 1AJZA 2FIQA 4NZ5A 2PRLA 2JIWA 3C0QA 3BZGA 2YA1A 3HV9A 3K1GA 1D8CA 4R53A 2VR4A 3H2CA 4JNYA 4ORMA 1GOQA 3VKKA 2PLMA 4ASTA 1KFKA 1PCKA 3VD9A 2PI6A 2OYLA 3CV6A 2GUUA 4UTHA 3GYCA 1QAPA 3PY2A 3MY9A 3N73A 3VUPA 4LPCA 3MMTA 2A3AA 4US6A 5HWMA 2YIHA 3VYLA 5FSDC 5MKGB 4M56A 4EOUA 1W91A 3QM3A 3S2MA 3KFTA 3HMCA 1EEXA 2QVHA 1W5MA 3OZOA 5KMYA 2IQTA 1FQ0A 3EEGA 1PZ1A 2L5HA 1XC4A 3FVDA 2QUUA 3TW6A 1E5JA 1QCWA 3TTYA 1H7PA 1TX0A 4KEMA 4D6IA 1XXXA 4QS6A 1TE6A 4WKAA 2DVXA 3W7PA 4Y8EA 3GW0A 4H7CA 1SJCA 4L9XA 3C2EA 4U5IA 4A2SA 1VYRA 1O7AA 2WNWA 1C8VA 3OVRA 2VFHA 4AZBA 3ZOAA 3T7VA 1K7EA 2QGHA 3OHMB 5FCZA 2PC8A 2YCJA 4YWIA 3ZVIA 1FP8A 4IICA 3NQMA 3W7MA 1T8QA 1ZY9A 4ZSUA 1DXFA 2F9RA 3F5LA 3DHUA 2ZBTA 4KMQA 1OFBA 5BXPA 1LG2A 4K8GA 1KQYA 4QJ3B 3V0SA 1XLKA 5F1VA 3K4AA 3NQ2A 4YNGA 3B8UA 4IQJA 2XN2A 1KWKA 3A3WA 1UMLA 1E6PA 5BXSA 1TX2A 4P7NA 3LRMA 3CAWA 5D9MA 1QXLA 4O1FA 1DWJM 4GIRA 3SQSA 3WQCA 4GXWA 3EXSA 1OYAA 4ICCX 5G4WA 4S3CA 1IGWA 3S47A 2AGKA 3HGRA 4HMEA 3ZT7A 4O54A 3WQ6A 1RV8A 1FWGC 2CBJA 1RA5A 3TTOA 1Z48A 3N4AA 5LNWA 1GOWA 1A5CA 5DMNA 1BLIA 4Y9OA 3DYPA 2WKLA 1S2UA 1L6FA 4OTKA 3TA9A 1TPFA 2G3IA 2WKGA 1A5SA 1JUBA 4J5NA 3J7HA 3T6CA 3WDHA 3EWDA 3CZGA 4XBKA 4E4UA 1OT2A 2D0GA 1TB3A 4KRUA 3RJYA 4GMEA 1E9ZB 4UFIA 3SO7A 4YJ5A 5H8MA 6TIMA 3SRDA 1EH9A 1GK8A 4GUIA 1GZ1A 4CNUA 2CC0A 2XH4A 2AAAA 3H22A 4DHGA 3I6RA 4WGXA 3SFKA 1PBGA 3FLUA 4WJ8A 3QVQA 1PTDA 5G5IA 4J7RA 4KWWA 5EMJA 2PE4A 1FFRA 2QJHA 5B7ZA 4GC4A 4YHEA 3MJYA 3ABQA 5FEXA 1ZCOA 1UH2A 3O1NA 3SZ8A 3VU2A 4TV6A 5CH9A 3NZRA 4UBPC 2NSXA 1XDJA 1YPFA 3NPVA 3GZ3A 4IMAA 1N82A 1W3TA 3WUEA 1MNSA 2OOGA 2UV8G 3PC0A 2UY2A 2XSAA 2GGIA 1Y5WA 5FL0A 3N13A 1W9DM 1BD0A 8RUCA 1AZ2A 4WF7A 2DZWA 4KCUA 3MSYA 4D6JA 1W0MA 4ZQNA 4DUVA 4QLKA 2BVWA 3CASA 4HA3A 4KF1A 4O8RA 3P8JA 4LNCA 2ZE3A 4W5UA 3V75A 3M5VA 2PMQA 1QPQA 1IWAA 4QRNA 4D6FA 3BLFA 3BCFA 3FXYA 4JBRA 3UPBA 2E5DA 5HWJA 5F1UA 1PDZA 1C91A 3IJDA 3V18A 1AK5A 4IL2A 4IOTA 3KVLA 4UCGA 4AZHA 1UKPA 3G1XA 2F8QA 1QOPA 1JDDA 4JTTA 4AQLA 3AYRA 4XIAA 3OTRA 1DVJA 2P0OA 3WQ8A 3O8AA 4HN8A 1GPWA 3LHTA 2B7QA 4O52A 3EA1A 2PDMA 2IQ0A 1IIHA 4YVVA 2C79A 1TG7A 5DQPA 2OYKA 3EX4A 4JICA 1IZKA 5CSUA 3I10A 3P60A 3KUMA 1TTPA 1O94A 3UA3A 4UR7A 3NYDA 1OCJA 4UMCA 5I5RA 5DXXA 1FCVA 4GGBA 1KA9F 2FZDA 4YIWA 3WK0A 3RLGA 2ZUTA 1R9YA 1WUFA 1XV8A 3RLVA 2X40A 3C0JA 1EUNA 3OLEA 4UQEA 4AG0A 1LTDA 5U4NA 2VEGA 2VURA 4C6PA 3ABXA 3G1VA 1QNPA 3UGVA 3O2LA 2PDYA 1AQFA 1A5BA 3G0UA 5LNSA 3WQEA 3K4DA 1FWFC 3CEPA 1ZBCA 3EBVA 4WHBA 1H09A 5U7SA 1KCZA 4UMAA 1JF5A 1HJXA 4UTFA 3NGJA 4N42A 2QLYA 2HJPA 3VGFA 5LHEA 2HVMA 2G96A 1OIFA 1J0JA 2VC6A 3E2RA 3LERA 4MWAA 1JJKA 1VCGA 4OIFA 5C9UA 4GQ0A 4DUXA 2YXOA 3QTPA 1DJYA 4LBRA 4RDWA 3RG6A 1Q8JA 2YCEA 3DDMA 4LB4A 5K9CA 3DIPA 1NWSA 3L21A 3WNMA 3WK3A 1JXJA 3GVGA 4REQA 3NEVA 1U1JA 1JGIA 5FF4A 2J75A 3EWUA 3LA4A 1JAKA 2QV5A 3LENA 4RZBA 1MZHA 3CQJA 5M03A 3L4XA 3VE7A 2ZRVA 1JRCA 4US5A 2PUZA 4A3UA 2VD9A 7REQA 5K4XA 2W91A 4MIMA 4X63A 4G1KA 1I45A 1RALA 3VDHA 2PWEA 1WQ5A 3W7CA 4PTMA 4X60A 4MNMA 4OV9A 1K77A 4WCJA 3S2JA 1KRBC 1JZ3A 3WQVA 1XLDA 2UY4A 1KBLA 1H60A 2W67A 3BANA 1QBBA 2YKKA 2F6KA 2BXVA 1O5XA 3T09A 3T2QA 3OZMA 2FZ8A 2PDPA 3H2OA 3RO6A 3CUFA 1KM0A 4H6EA 4I7WA 2BS9A 4N6EA 4B5WA 1KM3A 2CKRA 1IXPA 3WDRA 2WSYA 4AWTA 4P8VA 3K46A 2R8WA 3FNDA 3PB0A 4GI8A 2XWEA 1R3YA 3BW2A 2CCRA 4LUJA 1EXBA 3ZZ1A 3HQ1A 1LOLA 4LJ3A 4JFUA 1UKSA 2ODOA 4MNJA 1TKKA 1H50A 1W5PA 2Z2AA 4JYFA 2V81A 2W63A 5CQ1A 1MUMA 3RPTA 3WMCA 2VI0A 3NVDA 3UG3A 1G5AA 2JFEX 1DWIM 3UR8A 4MADA 2PWGA 3DFQA 3E49A 3GE7A 2AMGA 3IUHA 1ME7A 4LF1A 3S46A 4OUIA 5LHFA 5G1MA 1ISVA 3PFMA 5D9OA 3GTFA 2IQDA 1ZJBA 3L0NA 1H5YA 1MXDA 1J2WA 1GOOA 2HBXA 2ZZ4A 2Y5JA 1MRAA 4X0VA 3SB0A 4M7TA 2EPKX 2QQ6A 3FS2A 5J5RA 4ERAA 2E6YA 1JPHA 4UFLA 4B3LA 4Z1BA 4FA3A 1XYFA 3JU2A 5AVHA 4HOZA 1LWJA 2E8YA 4ZO6A 4KWUA 3URNA 3MB9A 2WCAA 3S9YA 4M6VA 3FJ4A 3PTKA 3W7OA 2CLPA 4LFYA 2VDHA 3UNDA 3PWGA 2P3ZA 4IJCA 1F9CA 3NFUA 3M5ZA 3GBDA 5AC7A 2NV1A 4DJFD 3M0MA 5EFFA 4FX7A 3NA8A 5A6LA 4RKAA 3HFYA 3LGDA 3W02A 1UQYA 3HG4A 3S0CA 1OC6A 3SURA 4J2MA 3THUA 4PUEA 3M0LA 1IQ8A 1W9UA 3GIYA 2DP3A 3NGFA 3O6AA 1AZ1A 2NT0A 3NQAA 1QHZA 5A8PA 1N8FA 3L9CA 3GNNA 3TSMA 1XBXA 1EJTC 2GVGA 4WZHA 4PMYA 5M3WA 4ZSTA 5CSRA 3MA8A 1KRAC 3K4WA 4RPQA 3QEZA 2I5IA 1SW0A 2PURA 3TC6A 1ZBKA 2AL2A 1HJUA 2VRKA 4DF2A 1CI1A 2ZVIA 4E2BA 4LALA 3GWQA 1B9BA 3HQOA 4DJDD 4JHMA 1VENA 3SCTA 3RMJA 2X1SA 1C93A 1GG0A 3QGKC 3WLOA 1YQ2A 3PWIA 5HOSA 3W7DA 1FKXA 1B30A 3CUZA 3NOYA 2H6RA 4H6QA 1A5NC 3VKDA 2VWTA 3DFPA 4AZ7A 2ZIDA 1JPDX 2EGZA 3LHUA 3VFLA 4E8CA 1GYLA 3CAQA 2ACQA 2WMGA 3M64A 4GX8A 1NTHA 3NQ8A 3CTLA 4BCEA 4DF1A 1MW3A 3IGHX 2PDWA 4IQDA 3DERA 5HJXA 1FWNA 1UP0A 1Q6LA 2G50A 1SW7A 4Y9NA 2QXWA 3UESA 5IXEA 4QISA 1TQXA 2J7EA 4OT7A 3FAXA 3UG4A 1Q4NX 3K13A 2YR1A 3WH5A 1YPXA 4GI6A 3EAUA 4HNNA 3ZWTA 4IG2A 1KKOA 2RDXA 5EMLA 1GKRA 3POHA 2XVGA 2YZ5A 4DLFA 4O1EA 5H91A 1YLVA 2BVTA 1JVNA 4MHBA 1XICA 1S2TA 1V77A 1FVPA 1OT1A 3H4GA 1E9IA 3SCRA 2EBNA 2WVVB 2GGJA 1RQBA 1P0EA 2QJIA 2D69A 2Z6IA 1KXVA 2JKPA 1QU4A 1JYVA 3PANA 3UXKA 2DUAA 3K8KA 2XDFA 2YCLB 2ZC8A 3OIHA 3GTXA 3WDJA 2J9ZA 5KZEA 3WLNA 2YYTA 4IIHA 3U2OA 5LIWX 1J0KA 2A5HA 4PTDA 4NSBA 4QG8A 3RX4A 2GJXB 4DJEA 1AL8A 1E1CA 3M41A 1V79A 2I5GA 1J0YA 4X2RA 3DG3A 4LUIA 5FF2A 1UWUA 3QMTA 3H7RA 2YCIX 3UVAA 4UXDA 1OF6A 1W32A 4K7YA 3EA2A 1BWLA 1K6AA 3SQMA 1WZAA 3KL5A 2F2KA 1B3OA 3W2KA 4TU1A 1ENUA 2QVNA 3SRKA 1UWSA 3V1PA 1OWQA 1AA1B 1OFOA 1SZEA 1N8WA 3HG3A 1W1TA 1XLFA 4EVZA 3QR0A 3G18A 3TN3A 5T8GA 1TPC1 4JN8A 1ISYA 2FKPA 3VZYA 3GG8A 3DC0A 4K3ZA 4P8UA 4V27A 2ZXBA 3T4WA 2BOGX 1QFEA 2ISWA 1TCMA 3MCOA 1TMHA 4D6DA 2UY5A 4PL1A 3SN0A 4YTUA 1JCLA 4A8RA 3MCMA 2FHFA 4Q8MA 2FHCA 3BMVA 1T40A 3GLCA 4RV3A 1VFSA 1BWKA 4IJBA 3F03K 1Q45A 4LCQA 1H7RA 1U33A 2ZXAA 1IHIA 4AY8A 3ALGA 2CFFA 3QV8A 2JBMA 1OABA 5D03A 3WD0A 2YYUA 2YZRA 3OA5A 4MJZA 1YNQA 3L67A 1JPKA 3P5YA 5I3IA 5BYWA 4IGNA 2FPYA 1CT5A 1V3KA 5BWAA 5K9XA 1OC5A 2GSJA 3ZR6A 4MFDA 5AHIA 2PLKA 1WBJA 2PZ0A 4XAZA 3A22A 4O0QA 1HF6A 5I3FA 2XVLA 4JQ4A 4NJKA 4UTLA 4LBSA 4XKYB 4GA8A 4IIBA 2FZBA 4HSOA 2OFJA 5BMXA 2QCFA 1X1NA 2AAMA 2X0YA 2IKJA 2C7FA 5I24A 2VFDA 1CTNA 3LOTA 2PD9A 4DO6A 2VQTA 4PMJA 4MAZA 2FYMA 3BGGA 4ML9A 1B3WA 2QCDB 3GNOA 3TNOA 1YMYA 5BRBA 1KC7A 3KBVA 4GO8A 1WOBA 3T0DA 1UBSA 2JK2A 2RUSA 4QEHA 1OF8A 1FCBA 2OB3A 1GORA 1YXCA 1OFQA 2GQAA 1WNOA 1XLLA 4BQ2A 4A8LA 4HMCA 2ZX5A 3HPSA 3CPGA 5A8GA 4IMGA 4RDVA 3W82A 2P3EA 5DANA 1JDFA 3VE9A 3FX4A 3W00A 2PRMA 2Y7GA 1AMYA 3TCEA 2HDJA 4M5PA 1PDYA 2VEIA 4PRTA 2GJRA 3ANVA 4PCNA 1SFTA 5AHLA 5GQBA 3WLLA 2PTXA 3GNDA 1MRQA 3W4RA 3S5SA 5AYZA 3FCPA 1HVXA 1MXGA 2BMBA 2GJLA 4PMRA 1UD4A 1IEIA 4OGZA 4S3JA 2VT0A 3SECA 1YHTA 3KL0A 1UC4A 5A2CA 4I7VA 5CSSA 4FLQA 5M1TA 3ONBA 1EOKA 3DEQA 3AIUA 3Q4DA 4XQ6A 1QTWA 4Y7EA 3VPLA 3BG5A 4KESA 3SY5A 4TQTA 5M17A 5D04C 3AXIA 4J28A 1IYXA 2WNZA 4Q7IA 3LBCA 4HZMA 2WPBA 5HXMA 3N4FA 2CZEA 3MI6A 4FXFA 3FN9A 5J8LA 4HBKA 1GYNA 1PWMA 5AHMA 1HKWA 4N9CA 1DPMA 1VFUA 1AMKA 1C29A 1GVEA 5BNKA 3ARZA 2FTYA 5KZ6A 4FP1A 4J9JA 2BNJA 1NIUA 4LXFA 4EF8A 4FIRA 2W92A 4YCOA 3VVGA 5I7GA 4AX7A 5EB8A 3NQ6A 2BHZA 4I9AA 1QATA 4GKTA 3TMLA 2G3MA 1FP9A 4MTVA 1HL2A 5F2IA 3FYPA 4ZO7A 4AUBA 4KERA 4B9YA 3U3HA 4O15A 3THCA 1EGMA 1W3IA 5DLCA 1BF2A 5HMEA 4NJGA 4TVCA 3TN4A 3GVWA 1Z8AA 4O14A 1XH1A 1ECQA 1R9XA 4LUYA 3I68A 3AOFA 3LMZA 1DWHM 4IFKA 5JXQA 1EL3A 2DU2A 4O57A 2H3BA 3THDA 1R87A 2F61A 3CAKA 3L5LA 1R7OA 3H2AA 1M5WA 2ZCGA 3WQ5A 4KETA 3WLIA 3WL0A 4BQ5A 4DN1A 1J11A 3CQKA 2P0IA 4YLWA 3QPZA 4HVXA 3LZ5A 1P0DA 4GK8A 3ABZA 3AXHA 5CBJA 5LKYA 4KCWA 3HFTA 1BKHA 3PJXA 1XUZA 2R14A 1NARA 1V3JA 4YCPA 1W5NA 2O0TA 3AWNA 3HB9A 3P81A 1HKJA 2Q09A 4AFYA 2YL8A 4M24A 4TUFA 3S1XA 1C8QA 2V5LA 3NL6A 1E9LA 2V3DA 4XUGA 2Y70A 1VF8A 1A5UA 1ZSXA 2Y88A 3R43A 3DN5A 1HL8A 3OZYA 4BEUA 4Q4QA 4F9JA 1EO7A 1O5RA 3W7RA 2BHYA 1E1FA 5BMWA 3N29A 4IPIA 2WHLA 1J5SA 2ACSA 4DJED 3S1UA 1PKNA 4KBXA 3B8VA 2R1KA 1TV3A 4N9DA 4C6JA 3LPGA 3PHAA 3TIMA 4JTKA 2FTWA 1TJRA 4Y96A 2TRSA 3KBSA 3CIXA 1P1MA 5G2IA 3U4FA 2ZUWA 4LS0A 1UKTA 3VDCA 3SRHA 1Z6KA 2DVUA 5IOBA 1TVPA 1ADSA 1RCQA 2BX7A 1FTXA 1XQKA 1ZAJA 1UD2A 3C2YA 3WBYA 3O63A 2VWSA 2C19A 1HKIA 2ZRWA 1F6KA 4O13A 3A23A 3FIGA 1MNZA 1E6ZA 4AY1A 2ACRA 1EDGA 3ARUA 2FPVA 1EX1A 4LS2A 2DFAA 3AO0A 1FHDA 1Q66A 3PUDA 3BLOA 3K8LA 3MWCA 1DHKA 2JIEA 1FDYA 4UTKA 2CZFA 3TKFA 2Q71A 8A3HA 2VMFA 1LRTA 4QE5A 1XIHA 4H8NA 2X0HA 2HE5A 4XSLA 4Z42C 3O16A 5D02A 1UOKA 4YTSA 4YS1A 1CYGA 1MSSA 1UD8A 1MXSA 3UZZA 1YE6A 1JUEA 1HKMA 4S3GA 3G1RA 4ATWA 3UNTA 4A21A 2DUXA 1KFJA 2VENA 4Q8NA 4GQQA 3PG9A 1VGAA 5C9XA 3SIZA 4KGJA 3KBJA 5FKYA 1FH9A 5I3JA 3T8QA 5KETA 4FZIA 3VTRA 1ZPTA 1E4LA 1KFBA 2WVUA 3BSHA 3WK1A 2DT0A 2OCZA 3ITXA 2E40A 2DSVA 5CPSA 3BPWA 4J40A 4IZGA 1B5TA 3ITGA 4OBSA 4OVXA 2C8NA 3H7VA 3CMFA 2DSKA 2OQHA 1HZYA 1O68A 2O9RA 4KWOA 4RNHA 1EPXA 4CQ8A 4DBUA 3NQEA 5MHBA 4GGHA 4F0KA 4Q8OA 3NZPA 1LQ2A 1XKYA 4M1BA 4JQ1A 5EGRA 3AMCA 4HNLA 3GZAA 2QCDA 1OX4B 2HV5A 2J47A 4PEKA 2F38A 2WPGA 3K8MA 3ATYA 2DV0A 3QYSA 1BFNA 2RDTA 1JNDA 1E51A 1KBKA 1Q5MA 1R8LA 2WJZA 1OX5A 4XZ9A 4AEOA 3IGSA 3W27A 4U4MA 1Y8BA 2G95A 3ARSA 3DFNA 1NF7A 4HQVA 4L5ZA 4CN4A 4MG4A 3T08A 1XP3A 4RPPA 4QCFA 2VDIA 3TNBA 2ICSA 1ME8A 3C2RA 4Z2JA 1KRMA 2ZVRA 1JULA 4DJFA 1UP2A 1G69A 4TX6A 3BH4A 1JRBA 2Y85A 1OG6A 4IPJA 4IPLA 4NAFB 2QCNA 4FR6A 1XBYA 1PX3A 2FGBA 1NFBA 2Y5SA 4LOCA 1Q7MA 5PTDA 1TQJA 1PTGA 4CVWA 1KLYA 1V02E 4A22A 1V6UA 2VCCA 4PMVA 4L4PA 3LSCA 5K3VA 1ONRA 4IWWA 2O92A 5EMMA 2EHHA 3NCOA 3SADA 1JUKA 1V51A 1NH6A 3B8SA 4EPBC 2QAFA 1ZP3A 1VJSA 3BAYA 1OBAA 2A3EA 3U7VA 5F4XA 2OKTA 5D32A 4IFOA 2V5DA 3U48A 2FDSA 4TMBA 4JZ5A 5HJLA 2QIIA 3B0XA 3I7QA 3N19B 4L4OA 2YBVA 2P8BA 3LRKA 4JTDA 1ZB5A 2D1ZA 4ROPA 5AOUA 2I9EA 4J3SA 3CGTA 3PK7A 2V5KA 1YNPA 2PCQA 4KQNA 3R10A 3I4KA 1ISXA 1OFRA 4J1OA 4ZB0A 4C90A 3B4YA 4PBGA 1W3LA 2VZOA 3CPUA 3C4UA 4CCEA 3A13A 3B97A 3VFCA 3W88A 1EC8A 3DFOA 1EC7A 1E3XA 2PDCA 3OYZA 3VI2A 1ITCA 4Q32A 3ES8A 1YXDA 1LUCB 2QCHA 3K5XA 4RX0A 2IUZA 3QOMA 3MUXA 1CXIA 3KP0A 5HMSA 3WD1A 4AD4A 4C6MA 2WQPA 1FWRA 2VFEA 2ZA3A 3BLDA 1X8CA 4C60A 3AMKA 2QUVA 2GJPA 5HR6A 4V1YA 4PA8A 4N4QA 3IJ6A 2E5CA 1XLIA 4KH2A 1DJXA 4GFIA 1BG9A 3WLTA 1VJIA 3AZRA 2PDFA 3C2FA 5EL1A 3GU9A 3B0PA 3M7SA 3OVQA 3NSXA 2B4GA 4GYKA 2WAGA 2Z1XA 1A3XA 2HCVA 3G1HA 1BPLB 4LB3A 1EP1A 3CBWA 3IJ8A 3A64A 5DT7A 3PTMA 4GYFA 2OVLA 4JX6A 4IT1A 1M65A 5D2XA 1WZKA 1YIXA 1LT8A 4YYFA 5FAJA 2Z7GA 3N9RA 4H9ZA 4G56A 2YCKX 3FW6A 1TV7A 3H6OA 4HK6A 4PUUA 2BBFA 1ODUA 3WFLA 1EYEA 4WEVX 3PSWA 1OFAA 4DXVA 4U5KA 3WBEA 2ON3A 3GXDA 3R12A 4UUIA 3GW3A 1Y5VA 4XAFA 4GX9A 2XISA 5DCBA 4QQ3A 3CQ0A 3L0GA 2ZA2A 5IDZA 1K02A 3DAQA 1P4CA 2VC9A 4XX6A 5A8NA 3GH4A 3IJIA 1XGEA 1D8WA 3P14A 3OP2A 4H00A 4LAOA 3OU8A 1PKYA 3P93A 3UJ2A 4B3ZA 3L4UA 4Z1AA 3EB3A 4MVAA 1SUXA 2V30A 4MFEA 3APYA 2I57A 1EX5A 4PUKA 3QN3A 3T4CA 5TQLA 1BKSA 2IPJA 4RXFA 4JAWA 1GHSA 2VEPA 3VO0A 1DJNA 2XSXA 4AVNA 3OIXA 5HWNA 4EX4A 3DFHA 2J7CA 3T40A 5CZ0A 2PPGA 2WWCA 1S5VA 1A5KC 1OX4A 2WNNA 1TJPA 3PULA 3RNDA 3GFXA 1NEYA 2VR5A 4QS5A 3KZPA 1FWIC 3DHFA 2RKXA 3RJXA 3U6WA 3R5EA 2NXHA 2YW4A 1VHNA 2P53A 5CPTA 1JG9A 2HWGA 2J66A 3HPZA 2BOEX 3DOPA 4JX5A 4Q8VA 1QOQA 1UASA 1PVNA 2WLZA 2X42A 4FLRA 4Z1DA 1GJWA 3V16A 5I2UA 4Q8UA 5I3HA 1IZJA 2BSLA 3MKKA 3GDBA 2WCSA 4GE8A 1X98A 4IP7A 1TA3A 4FXJA 4CNPA 3ZFHA 3PUOA 3RLUA 5FJPA 3DBNA 4Z2IA 2D3NA 2PDIA 3VOGA 4HMNA 4DXKA 3R0DA 1UZ1A 1H61A 2E8ZA 3GSMA 2O7QA 4AEEA 4D8ZA 3GVRA 3TDFA 1FWDC 4W88A 1IE7C 1TYGA 1KRCC 3OA3A 2NX1A 3D46A 2FZ9A 4PRRA 2EG8A 5A69A 1SR9A 1HUVA 3SBFA 3AXKA 2OLHA 2F6XA 1JZ5A 4E8DA 1TRIA 3W2UA 1LZOA 1RP9A 4WOQA 2ONEA 3OYXA 1S5TA 1DXEA 2CW6A 4D71A 2WBKA 4MWAE 2DZVA 1UP3A 1Z42A 3Q37A 4C5YA 2DT2A 1EEPA 4HA1A 3MHGA 5IM51 4BF7A 5C2CA 2PTDA 1Q3NA 1I0BA 3CXOA 2FB3A 3RM9A 3M0JA 5FEWA 1SMDA 4RE0A 3C2VA 1Q6CA 3REQA 1S39A 1RH9A 3R8HA 3TH6A 3T44A 3W73A 4RZ5A 3AXMA 3U2CA 4TIMA 4F2UA 1CWYA 4M6PA 3AMDA 3U4AA 4DB7A 3WZ0E 1KV8A 2A21A 3WCZA 1GEHA 4NKCA 3OJGA 1N2VA 2RJHA 3DG7A 1CGYA 1UA7A 1OGGA 4C6CA 2CESA 4H9TA 1XW8A 1KBJA 2ZA1A 3QKEA 2KX9A 2CLMA 3NXLA 3HV8A 4G2DA 2WJEA 3IIOA 4NAEA 1PS9A 1XG3A 2NLYA 3FYYA 4H6RA 3P74A 4PFMA 4ZFCA 2BXYA 3AS1A 1F2JA 3R0UA 1DTNA 3SJNA 1W3HA 1UUOA 2OKOA 3IACA 2WHMA 3RGTA 4P8XA 1VYPX 4FI4A 1OEPA 3MCNA 1YBQA 1EYWA 2PWFA 1Q6EA 2J7BA 1JDAA 3BZJA 4UQ9A 3UZYA 3WUFA 1GVIA 1HXJA 4Y2WA 2NZLA 3GR7A 5A8OA 1IGSA 1NJJA 1PJ9A 4JL2A 2QR6A 5DXYA 1H1ZA 4EAYA 3LNMA 3R7MA 1UB3A 3TSDA 3C8FA 1XG4A 4L4LA 4HPJA 3N2XA 4M29A 4LEQA 4ZB5A 1WDSA 4HCDA 2G3JA 4ZODA 1NWUA 3MMUA 2ZUSA 3IIVA 2FJUB 3LHZA 5EKYA 1S2AA 3UZXA 1W1VA 3VCRA 4JTIA 1QOXA 1PE1A 3FVMA 3HA1A 3HOJA 1K03A 4FHAA 5HQLA 4NJJA 1B3ZA 4RW5A 3NQCA 4S3KA 4HGXA 4A4AA 2ZKMX 3PN8A 3Q65A 2ISSA 1TTQA 1JZ4A 5LA1A 1ZRQA 3DXIA 1OGBA 3S6TA 3KWXA 2X16A 3UQNA 1HJVA 3GH5A 1ZJIA 3DBPA 2G37A 1I1WA 3VK5A 3DGRA 4HYWA 2XGZA 4U3CA 2CLLA 3FY1A 4HPGA 5C6MA 4INFA 3JR2A 4JR5A 4UTTA 3W86A 3UWQA 2NVAA 4O11A 1V4YA 4HHHA 4BF5A 1A0DA 3NR0A 4QM1A 2BY0A 4MPKA 4XV0A 2Y1HA 5HATA 3L2LA 3G6MA 3ICJA 3VZXA 1SFSA 2I7GA 4GNJA 4MB5A 2TMDA 4HOWA 2PDGA 1JZ8A 3AIQA 3MWAA 4ZTYA 1G67A 4MB1A 5EY5A 1EDQA 3GX9A 4HOXA 1MW1A 4QAIA 3LI0A 1LLWA 2RH9A 1MEHA 4DWSA 5TIMA 1R3RA 4S3BA 1JIBA 4QHRA 3NDOA 4Q8QA 3TWBA 4QLLA 4RDZA 2J79A 2C1HA 4EE9A 1QI3A 4LY4A 5DFAA 1T0OA 4FNUA 4C65A 2HVOA 1R9ZA 2QJMA 2C15A 4MJ2A 4F3HA 4KFNA 2DH3A 4WDWA 1OZMA 5A6AA 1BYDA 2VCBA 1HN1A 1AQHA 1LL6A 1WAWA 3K30A 1EJVC 3O6CA 1DTUA 1G6CA 4LAKA 3VNDA 2FH8A 4DO4A 4ACZB 4NXKA 2XVNA 4JQAA 2OG9A 4CNOA 1B90A 3BGAA 3VIJA 2PEVA 3S2NA 3EYPA 3CZ8A 3KM8A 4NASA 1KXHA 1VB9A 5ABFA 5FF3A 5DEZA 2ZE0A 4TTGA 5FESA 4NILA 2FHBA 3L2MA 4RZ4A 1QNRA 1D3GA 3R94A 2VC7A 4HIBA 2VVSA 2B31A 2HROA 3B9OA 2WZIA 5ECUA 5CAHA 4U3AA 1QDSA 3UEQA 2A1YA 4DF0A 5TD4A 1D3HA 3E1F1 3OG3A 4XVEA 1EFZA 3IVSA 3B8IA 5A6KA 3M43A 1XD0A 3AS0A 2C0AA 2RDWA 1QPNA 4HA4A 2G97A 4DO7A 3CIVA 2GJXA 1VIWA 2E77A 3T8LA 3VZZA 1V6XA 2F7FA 4M1RA 1CBGA 3N25A 2Y7FA 3KOFA 1XIBA 4LVGA 1TJ1A 5I23A 4JEJA 4H9YA 2PWDA 4LYRA 3HQPA 4AMCA 2PRHA 3NQVA 2ZUVA 1Z69A 1XCWA 1T5AA 2EJ1A 4FOKA 1R46A 1CLXA 1O66A 1REQA 2PDNA 3STEA 2D73A 4RL3A 2QJNA 4H9UA 4O1CA 3NYZA 4LGXA 6XIAA 3HPXA 3MSDA 1J96A 1XCFA 1CW2A 4ERIA 1MW0A 4QJ5B 4MDOA 2OOFA 2F84A 1LBFA 3LBOA 4G5DA 1Q85A 5C8BB 3TJXA 4QDMA 1P43A 4Z0SA 3O3RA 4TTUA 4ZXLA 2XFWA 3PZTA 2TYSA 3A4JA 4I90A 3KL3A 2QDHA 4GVFA 2XH2A 3R0KA 3UG8A 4WR3A 5LA2A 1PPIA 4L6OA 3G2GA 3F5JA 2NWRA 4LYPA 5KINA 5A2BA 3WLPA 3ZXWA 1I2NA 4CUCA 1E6SM 3GR4A 5DY3A 4R33A 1B9ZA 3VOIA 1P6BA 3ITVA 1QUMA 1T41A 3IGUA 3LGEA 4LNYA 4PTXA 3SCVA 2PDUA 1WO2A 1HJSA 3L0KA 1QW9A 5TNVA 2ZZ6A 1I9CB 2Y2WA 2WVSA 1J8VA 3VNMA 2JALA 4UB9A 5BZAA 1GQJA 3UYCA 3DHDA 1I8JA 3W38A 4WD0A 2AL2B 1AVAA 3PAJA 4L56A 4B91A 4AY7A 1EWEA 1LT7A 4C6FA 1V3LA 2PDLA 2V5CA 1VBUA 3HGSA 3MP5A 3K1DA 5AZ1A 3IRSA 4B5TA 1JCNA 3LXAA 8CGTA 3PTQA 1E0TA 1CZ1A 5GNYA 4UTIA 5HNUA 5HAOA 2ANUA 4L6HA 1FWTA 5C7HA 4D8AA 3IIZA 4JEQA 1EGZA 2YDSA 3QYQA 3W1TA 1Q63A 3V0TA 4W4QA 1N7KA 2X1IA 2DGAA 4PGLA 4JNZA 4YTQA 1BSLA 4W8AA 3PM6A 3COTA 4HMDA 2IPGA 4X9SA 3TFXA 1Y0EA 3LDVA 4L65A 3BOLA 2KAUC 1AH3A 3FDGA 4CVUA 1U22A 4EKJA 4L64A 1LF1A 3PPFA 3UJSA 3VC5A 1GYMA 1JI1A 4RCXA 4ORIA 3EA3A 3SAZA 2GQ3A 3VUSA 4HK7A 1SW3A 3E0FA 1CXHA 4OOUA 1T8XA 1PV8A 1UIPA 1S3HA 2WQDA 3B8WA 4C6IA 3G77A 3OQEA 4XO6A 4Q8PA 3GHTA 3NL5A 2YFOA 5FJUA 2VGBA 1C3FA 3LCWA 4AD5A 1C8XA 3LCLA 4NP7A 2OYMA 4ML4A 3G1YA 4J35A 3C0LA 3EOSA 1M7OA 5A94A 3HIJA 5CZKA 2OGYA 3H7UA 3SCPA 4L4MA 1FBAA 4R7WA 3B9DA 1EOMA 4O1BA 4Q22A 3UR2A 1GVSA 1ZQ5A 3QV9A 3QHOA 3W07A 1VD6A 3WLMA 4F48A 3KVKA 3ES7A 1LM1A 1ZJHA 4MNKA 1NWRA 4GO9A 1A5LC 4ZQMA 1WKYA 3SN1A 3AC0A 3W23A 1K9EA 1XGZA 3EOUA 3GNXA 3QC3A 2ABBA 3G1FA 3P67A 1EJXC 5BOOA 4ZBCA 1BG4A 3TW9A 3E3HA 5FEZA 2YW3A 5CPNA 1H7OA 3FJ6A 3LCIA 4XZBA 4CLMA 3AHYA 5E9XA 4HB7A 3GH7A 2NQLA 3BAIA 4C6DA 2V6AA 5CJ5A 1XFCA 4QJ4B 3LMYA 4WDTA 1VBJA 3UCCA 3TA6A 4W84A 4HNVA 5JH1A 3TQKA 4O17A 4WSHA 1JCYA 3BVJA 3BICA 4YN5A 4PMUA 2WCGA 1EZWA 3MI3A 3MI2A 1XIJA 1UMYA 1K7FA 1UR1A 1VRXA 1IWBA 2R1LA 4GACA 1R2RA 3FJLA 1AW1A 1PHQA 3L68A 2BASA 5DRCA 3B8DA 2VKZG 1WDPA 3LM3A 4GHRA 2WO5A 2F6UA 3LCHA 3AHXA 1TFVA 3IAQA 4GISA 2XIJA 4MZ8A 1P7TA 2R1PA 1AUSL 1J4EA 3T42A 2Z28A 2DPEA 2PLCA 2G4JA 3PVFA 2Y7EA 4IMFA 3NPXA 4QR6A 1SGJA 3GD6A 1GOIA 5C5YA 2J7GA 3DFTA 2NV9A 1DWGM 2QCLA 4KIEA 3QZEA 1RY0A 4LYQA 5JIWA 3KAOA 3M0KA 4ZENA 3W7NA 4FLSA 3A4WA 3WELA 1OSEA 4LTSA 3SUWA 3TYUA 3PBVA 5FEPA 3IK2A 5CJMA 2ATSA 4M7SA 2ESCA 3QQWA 3CL6A 3T0BA 3VDGA 3CT7A 1MI3A 2ZTJA 1HT6A 3EX6A 2FQIA 3N1AA 1PO9A 1OHLA 2YA0A 1GVYA 2BY1A 1B3VA 3QSTA 4Q4KA 4HA0A 4ZL1A 1VLWA 4H4IA 2IMRA 3NM1A 1H7NA 3BMWA 5DBTA 4GY7A 2NUYA 4F2BA 3AMLA 1B3YA 4F79A 1JYXA 2YB4A 3VGEA 3IARA 3SRFA 3LNPA 3EDEA 3VNJA 4MDPA 5I02A 1AQ0A 5DO8A 1AL7A 1HKKA 1SO3A 1WCGA 3CMGA 3H23A 3IVUA 4NHVA 4FEZA 1Z9AA 4N02A 4O50A 2Z00A 4PMXA 7TIMA 2NQ9A 2E1WA 2OO6A 4IMDA 3DGBA 2XG9A 1KBIA 2Z1BA 4FX6M 2HQAA 1Z3NA 1OZQA 4HPXA 1PYFA 4UR9A 4ZQOA 4XAYA 4IIEA 1DWFM 3TMQA 4NNCA 4MUZA 5ABHA 2OZ8A 1QNVA 5E0FA 3TOPA 4X61A 1AG1O 1MEWA 5E70A 2J6VA 1LYXA 1UR0A 4N2YA 4OE7A 4CNTA 1DQXA 3UR7A 2VYOA 1EZ2A 1VCFA 3MZNA 1V3HA 7CGTA 3OGSA 2E68A 4X0NA 1XDMA 1EJRC 1CXKA 2Z25A 2BY3A 5D38A 3IJ7A 4PMQA 1TV8A 5LIYX 1EB3A 1CLVA 4K7VA 4PB5A 4WKHA 3CV7A 1RXOB 3WQGA 3BARA 1EA0A 1GVOA 1RSCA 4RV8A 2XM2A 1L2UA 3W6MA 4K38A 1MW2A 4KRTA 1XIDA 3O06A 4FB7A 4GUFA 3H55A 1WZMA 4W85A 4CNNA 3KDOA 4UCFA 1FWJC 4D6CA 3BE7A 3O15A 2W6RA 5I03A 4CQBA 4NZFA 3PTDA 3ID7A 4NRRA 2JGYA 2V3EA 4D1IA 3C6CA 2VX7A 4XAPA 3ANUA 2J7HA 1SYTA 3SEPA 3FA3A 2UY3A 4CU8A 2GJNA 3MUCA 4S39A 4F0RA 2D3LA 2X1RA 3WEMA 1NP2A 2CBVA 1KO0A 4S3AA 3G8EA 3QH2A 3WSUA 3ENLA 4CKQA 3P3BA 4S3FA 3MUIA 2WZEA 4B2DA 5CLWA 3VOJA 1XHGA 4GQBA 3BG3A 3KBWA 3CEUA 2VELA 2ZRXA 4E3VA 4O8AA 5CBIA 3EMCA 4XZWA 2XYLA 4UOQA 3C0SA 1ZJAA 2A3HA 2WZTA 2NWSA 2VOMA 1W9VA 3POCA 1FWBC 4O53A 3EZ4A 2QULA 1C7SA 3PZMA 6TAAA 1UYQA 4RUBA 1K8YA 5CC5A 1E73M 1VJZA 3N14A 3KBMA 1WPCA 2Y8UA 3CZEA 1RBAA 3GHRA 4EPEC 2H8XA 4LH8A 1K6WA 3VD7A 4OOZA 4GIYA 3WMLA 3FHQA 4LAZA 5LIKX 3M6YA 2ZDSA 5FA5A 2Q02A 4WDXA 3VX1A 4DBDA 4QCEA 1XSIA 3H2FA 3UCDA 4N9EA 3KXQA 2V38A 3KHDA 1XL9A 3RX2A 4PB3A 2A6LA 3KRUA 2WSPA 1TV4A 1E55A 1UH3A 1J79A 1SJAA 3L66A 2PTYA 1W2VA 1DIKA 2XWDA 4IX0A 3AIEA 2OELA 3AYTA 3AWOA 2CLEA 3GFYA 3GO2A 3W7QA 2YBTA 2VR2A 4OECA 3WD2A 1TWZA 1F6YA 2BFGA 3M5YA 2NT1A 1UD6A 5TF0A 3QLDA 4W89A 1F05A 1PHWA 3M44A 2HEJA 1A53A 2XJ7A 1C9DA 1VCVA 2BZNA 3GK0A 2NXGA 3N2MA 4R85A 1J0IA 5KZDA 1XWYA 1JF6A 2A7PA 1CB2A 2NQZA 5KSWA 3TXVA 5LZLA 1W9BM 2XFFA 1UR2A 1PIGA 1HG3A 3WF2A 2D2JA 3MMWA 3M5XA 1OQFA 1TR1A 3WNNA 4H2HA 2JEQA 4IISA 1W2PA 1Y7VA 1V93A 3HPAA 3C2OA 4ECLA 1F07A 3W76A 3DECA 3BDKA 2FMOA 4GXPA 2XUCA 3GDMA 5L6UA 1E0UA 2AQWA 2JGQA 3AHZA 4IX2A 3CLWA 4QE1A 3WLHA 3UT0A 3VD4A 3F1QA 1H3GA 2A6NA 1GVQA 3L4VA 3BWWA 1A3WA 2A3BA 5G2WA 1V03A 1XIEA 4AZ5A 5HNRA 4K39A 3SCUA 1KGWA 6ENLA 2CYGA 2PGWA 1IXOA 3AMGA 3DYOA 5CBBA 1ZP4A 4PCSA 3S2LA 1M3UA 4HNCA 4QGCA 4NUWA 3VGHA 3W2NA 2BB0A 4B5SA 1OYBA 3RCMA 4XD3A 2VEFA 4XAGA 3GG7A 1BF6A 1ADDA 3WMSA 3M16A 2CLHA 2I16A 1KCXA 4HNOA 4IP5A 5DELA 2VUNA 1EF2A 4WX2A 1G01A 5FOOA 2ZTKA 1AODA 4TOQA 3QHMA 1Q6FA 4Q4OA 3FA4A 3EX3A 4QLJA 2XZ9A 4ZOEA 3MMDA 1W3NA 3WBAA 3LXBA 5ECVA 2VVNA 4K68A 3VMPA 2A4AA 1UA3A 3VA8A 4JNMA 2HMCA 4FALA 5EBUA 3SGZA 1TWSA 1WX0A 1NFPA 5HK4A 4OFCA 4I6KA 1EKOA 2IPFA 4MF4A 1NDVA 2GUBA 4JCMA 5AYBA 1O12A 1ZLPA 1LLZA 5CG7A 3DI1A 3SM0A 4I9JA 4OBTA 2EEXA 4EXAA 3R89A 5T91A 4AZ6A 1IT0A 1LROA 2ZX8A 2CZDA 3AU2A 5CLTA 3OBKA 3TLLA 3N9SA 1KKRA 5DRIA 1KTCA 4DLMA 3DENA 9CGTA 1EIXA 3FXGA 1QW8A 2Q8LA 3BW4A 2QDEA 2YL5A 5I3DA 1L9WA 1XYMA 5F2GA 1E6RA 1E56A 4DWDA 3W72A 5G4EA 2G41A 1XSKA 1RD6A 4DM1A 2Y7DA 1A0EA 3KCOA 5K9DA 3KDNA 1L8PA 1CGWA 4XD4A 3RAOA 5A1AA 3ISIX 3TK7A 2PB1A 4I5XA 3H2MA 3C56A 1JZ2A 2XHYA 3S83A 1ZBVA 2Z6JA 3GU2A 3UXDA 3IUIA 1HX0A 1U30A 1THFD 1I2PA 2P88A 2VX5A 1SZNA 1UC5A 3LBMA 4QJ1A 1JL8A 1OY0A 1VFTA 1DEDA 5JVLA 1E0XA 1S1RA 2OZ0A 4J4KA 1PZ2A 5EU9A 1I6NA 1MMFA 4QROA 1YADA 4BJHA 4DYJA 4M0XA 3W1NA 2C3ZA 6CGTA 1JD7A 1ICSA 4FPSA 4HZ7A 1P6WA 3LI1A 5T9CE 5A6TC 1A0CA 4WJXA 1BVNP 5DY2A 5HULA 4FOUA 2HRWA 2AL1A 4NAEB 4AIOA 4HHLA 1WAUA 5HPCA 2NVDA 3NVTA 2ASHA 3CYVA 2V0TA 4MJMA 1QWGA 5A6JA 3AUJA 1VHCA 1WV2A 2BLEA 4AH7A 2PGFA 1SO5A 2PSNA 4KPLA 5REQA 1V0NA 3ZJ7A 5F7UA 1DV7A 2OQLA 3PR2A 3HPFA 5AHEA 1CIUA 1TVLA 3PSVA 5G1TA 1GGOA 5FF7A 1QT1A 4R34A 4XZNX 3CL7A 5C9RA 4GZIA 1FHLA 4DELA 3SCWA 4WDUA 3UWWA 2GQ8A 2XH0A 1YBQB 2FMNA 4GKLA 4H04A 1R38A 4PMZA 4MZYA 4AZGA 3ZO9A 1ONEA 1VKFA 4KWSA 3CL8A 4F0HA 3QZ6A 2J8GA 4L7ZA 3G6LA 4E6MA 2Y4SA 4OHQA 2X05A 4MWAD 4B15A 4LUSA 2X30A 2ZZ3A 5KEZA 4JKMA 3NM3A 2DJXA 1MFVA 1KM1A 4ZTXA 2E0PA 3EDFA 2EJAA 3TN6A 4K37A 5FIPA 4UIOA 3PZ9A 4MUPA 1I2OA 2GSEA 3IS4A 1ZCCA 1JCMP 1QR7A 4RNJA 1UH4A 4MB4A 1W1YA 1GEQA 4HU4A 2YX0A 3PJUA 4PN2A 1EBGA