2VWSA

Crystal structure of yfau, a metal ion dependent class ii aldolase from escherichia coli k12
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
256
structure length
256
Chain Sequence
MNALLSNPFKERLRKGEVQIGLWLSSTTAYMAEIAATSGYDWLLIDGEHAPNTIQDLYHQLQAVAPYASQPVIRPVEGSKPLIKQVLDIGAQTLLIPMVDTAEQARQVVSATRYPPYGERGVGASVARAARWGRIENYMAQVNDSLCLLVQVESKTALDNLDEILDVEGIDGVFIGPADLSASLGYPDNAGHPEVQRIIETSIRRIRAAGKAAGFLAVAPDMAQQCLAWGANFVAVGVDTMLYSDALDQRLAMFKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords YFAU, 2-KETO-3-DEOXY SUGAR ALDOLASE
publication title Crystal Structure and Functional Assignment of Yfau, a Metal Ion Dependent Class II Aldolase from Escherichia Coli K12.
pubmed doi rcsb
source organism Escherichia coli
total genus 91
structure length 256
sequence length 256
chains with identical sequence B, C
ec nomenclature ec 4.1.2.53: 2-keto-3-deoxy-L-rhamnonate aldolase.
pdb deposition date 2008-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03328 HpcH_HpaI HpcH/HpaI aldolase/citrate lyase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 2vwsA00
1S2VA 2VGBA 3KHDA 1KBLA 4L80A 1O66A 4B5XA 2KX9A 3MA8A 4FXJA 2R82A 4L9YA 4B2DD 3U2ZA 2VGFA 3OQ8A 3GR4A 3G2GA 1UJQA 3N25A 2HJPA 1E0UA 3QTGA 1A3XA 1JDEA 3E5BA 1PKMA 1XG3A 3HQNA 3VAVA 1OQFA 1U5HA 3HQPA 3EOEA 3QV7A 4KS0A 4TV6A 3BJFA 2VGGA 3OYZA 1VBHA 4B5VA 3SRKA 2HWGA 3EOOA 3EOLA 4YNGA 4JPGA 4L7ZA 3B8IA 1O5QA 3QZ6A 1A49A 2VWSA 3QQWA 4RPPA 4KCWA 4IQDA 1ZLPA 1AQFA 2DIKA 1KC7A 3GQYA 3SRHA 1ZJHA 3E0WA 5TAOA 3SRDA 2G50A 1PYMA 2QIWA 3IS4A 1MUMA 2WQDA 3I4EA 3OYXA 4B5SA 2XZ7A 1U5VA 1M1BA 1F8MA 3GG8A 1OY0A 2V5KA 3QV8A 4IMAA 2E28A 4QG9A 1O68A 2VGIA 1F61A 3P0XA 3T05A 4KCUA 1T5AA 1DQUA 2V5JA 2VWTA 3T0TA 2DUAA 1GGOA 2XZ9A 3BJTA 1A3WA 4HYVA 3QLLA 4B5TA 4B5WA 3ME3A 1PKLA 1SGJA 2ZE3A 3T07A 3M0KA 1E0TA 3H6OA 3QV6A 4KRZA 3LG3A 5JVLA 1DXFA 4TV5A 1Z6KA 2OLSA 1F8IA 1IGWA 4KCVA 4MG4A 4QG6A 1DIKA 2HROA 2L5HA 4ROQA 4HYWA 3LYEA 4L9ZA 4KCTA 4IQEA 1S2UA 4WJ8A 4IP7A 3FA4A 3M0JA 4G1NA 1PKNA 4B5UA 2HRWA 1F3XA 3R4IA 3SRFA 4FXFA 1IZCA 2XDFA 1A5UA 1S2TA 3EZ4A 3FA3A 4QGCA 4LSBA 4DRSA 1M3UA 3PP7A 4YJ5A 3KTXA 4MF4A 1VBGA 4QG8A 1F3WA 3PUGA 1DXEA 2BG5A 3E0VA 1PKYA 3HQOA 4B2DA 1XG4A 1S2WA 3QV9A 2X0SA
chains in the Genus database with same CATH superfamily
4Q8OA 3ZT7A 5FEZA 1GZJA 6TIMA 4EANA 2YR1A 3PY2A 3HB9A 4TO8A 2XN1A 2WWCA 1TIMA 1GQNA 3KTSA 2C71A 3FEMA 3FGCA 1FX6A 1H50A 3BSMA 1AH0A 2G5WA 4RE0A 1XSIA 2GVYA 3NVDA 3UXIA 1ZBKA 4ZB0A 2YXOA 4AWSA 3TFXA 1IV8A 3D3AA 2X1TA 4M56A 1NY1A 2BVYA 3UJSA 3WBWA 1P1XA 1J01A 4V1YA 1GYMA 1R3TA 1P48A 3I4EA 5GVJA 5A6TC 1KWKA 4AD0A 1TR1A 1KCZA 5EMLA 4LVDA 7ENLA 3VNIA 2DH2A 5I07A 3QSTA 4NG3A 1V6YA 4PH6A 5AOUA 2WSKA 1RY8A 3R79A 3CL6A 4CGTA 4UTJA 4PMVA 3N73A 5U4NA 5AKQA 1GQKA 2XVGA 3SCUA 3UY7A 4P8VA 1PEZA 3RCMA 2YDQA 2GGHA 1RQEA 4LQ1A 1GJPA 4MZ8A 4D71A 2J6XA 3VCNA 5TQLA 4DJDA 4C6FA 4NILA 1YE6A 1FWFC 3ZJ7A 3MANA 1TZ9A 4Q8NA 4MYXA 4XBKA 2DVXA 3SW6A 3AMLA 3RMEA 2CERA 1O6IA 3KL3A 3ARTA 1PCKA 1DV7A 4LW7A 3UXKA 3APTA 3TCSA 4XAYA 3L7RA 2A5HA 1G5AA 4LTSA 4ZB5A 1PHQA 1VPYA 1FVPA 1Z41A 1UH4A 4BQ4A 2Z2BA 1OIFA 3V1PA 3PJWA 3SM0A 2Z25A 1TKKA 4L4MA 4G9PA 4KGLA 5A2BA 4ATWA 2VCCA 3FYOA 1OCQA 5L6UA 1XIHA 4BI7A 1MMFA 1A80A 3VNJA 3WJXA 5TD4A 1UASA 3VK5A 1U1JA 1VYRA 4Q8QA 1N8WA 1TVNA 2DGAA 3T4WA 3WH9A 4LAUA 3TKFA 4DPPA 2A3HA 3L4YA 8XIAA 3MO7A 1NDWA 1BVWA 4GVGA 3AIUA 3NZRA 2Y4SA 4IIDA 3NEVA 2EG8A 2O7QA 9XIMA 5J04A 3TXZA 2GQ8A 2DT0A 4HNCA 3IIZA 1V0MA 3TLQA 1FH9A 3QMTA 3VZZA 2VFGA 3O6DA 1PZ2A 2JK2A 2RDUA 4WDUA 5I5RA 4PUWA 3SZ8A 1YYAA 3WF3A 4HU0A 4W89A 3TNOA 1X6NA 2VX7A 3EA3A 1JI2A 3GS6A 3T9PA 5E0FA 4ZE5A 2WJZA 3WH6A 3GXMA 1WDPA 2VGFA 4J3SA 3O0KA 2Z27A 3DFHA 4GX9A 2A0NA 4PMRA 3RLHA 1LYXA 1SZNA 3H2MA 1GQJA 4MJZA 1DVJA 1UB3A 5HATA 3GHRA 2XN0A 1E0WA 3IANA 2NV2A 3D0CA 1JPDX 4AD5A 1H7OA 4LBSA 4NKCA 1K70A 1XGZA 3VGFA 4M19A 1D7KA 1M01A 1E1CA 2O92A 3U7VA 3ZSTA 1H7RA 3H2FA 3ZVIA 3AIRA 4GUFA 4LYRA 3MSRA 4O17A 4YTTA 4I7WA 1LP6A 3URBA 1IF2A 3W83A 2ZX6A 3AXXA 2BTMA 3QGKC 4DPQA 1AL8A 4FXSA 4MPKA 3C52A 3W2MA 4JY9A 1G4EA 1TREA 3U2CA 2W92A 1GKQA 4MZ1A 2ISVA 1HGWA 2ODOA 3TC6A 1MEIA 3KOFA 4W86A 1NOUA 1S2TA 2VDIA 3V35A 2CLOA 4AVNA 1IIGA 3JRKA 1KTBA 2ACUA 2BG5A 2DUZA 1A5OC 4XBSA 4GX8A 3LXBA 4MJ4A 1QI0A 3GD6A 1IWBA 2J7HA 2ASHA 1EBHA 2VEMA 4R9XA 4DHGA 4HA1A 4O4VA 1CGUA 2CU0A 3PBWA 1A3XA 3MB9A 3INPA 1SMDA 4N4PA 2POZA 4FO4A 3RR4A 4JHZA 4EACA 2VX6A 3UERA 4FNTA 4JDBA 1F4AA 1V0LA 3QR0A 1VYSX 4DI8A 2X09A 2WQPA 3QM3A 2EO7A 2I14A 1ZJHA 3T2OA 1BLIA 3W1PA 2TPSA 2OWWA 3FK4A 3GFZA 1AL7A 3H70A 3BH4A 1Z8AA 1LG1A 4PUJA 4NYYA 4GJJA 1IZKA 1ZRQA 2F6XA 4I5UA 6PTDA 4C7GA 1V3LA 4IICA 2EHHA 5A8MA 4ADTA 4LOCA 2DY3A 3M6YA 3T07A 4LVGA 3LRMA 3F5LA 3OZPA 2AAMA 1AUSL 4Y9MA 5CPTA 4IFKB 1FCBA 1YDVA 1PO9A 1XIGA 1GJUA 4OUIA 4NL1A 1RV8A 2D0HA 1AD1A 5AC7A 6A3HA 2PWUA 3MDUA 3TMLA 1CDGA 3G1FA 4QHRA 5AHLA 1MO0A 1K9DA 4LYQA 3UJ2A 2AGTA 4IFOA 3N4AA 2DPEA 4HZ8A 2FZ9A 3W7NA 4IMEA 4Z1DA 1VFMA 2VUNA 5E0KA 1MYRA 3M0VA 3PBMA 1P0EA 1C8XA 3APGA 1MW2A 3WEZA 3RRXA 3EYPA 3MP5A 1UG6A 5LNSA 3VABA 4A3YA 3W76A 1BYCA 2D20A 3N2MA 5I3DA 1DQWA 2OGJA 1UH3A 4LAOA 1GPFA 2PP3A 2CCRA 5K4ZA 3LDVA 2V68A 2WKLA 3A4WA 3UNTA 4HZMA 4CQDA 3NZPA 3GKAA 3FCPA 3KEHA 3COTA 3UWEA 1TV4A 2OQLA 2ZZ2A 3BAKA 1D8CA 4JR5A 2CLFA 4OV4A 1NDYA 2Q02A 1LJYA 4GUGA 1JDCA 3S2NA 2VCAA 1AQHA 1Z3NA 1UR4A 2D0GA 2Y5EA 4W85A 2DZUA 3HPXA 1WZAA 2EJ1A 4MB1A 2YB1A 3A9IA 2WLYA 1EP3A 1DJWA 2FDMA 3UPMA 4BWLC 2CKRA 5EBAA 1CECA 4V1XA 4MF4A 2VEGA 2WZMA 1OYBA 2EBNA 4I9TA 1BKHA 2FZMA 1HJQA 3W02A 1PDYA 4MJ2A 4U4MA 1B30A 3L66A 3VA8A 1OD8A 1E6QM 5D9OA 2Y6ZA 3OYZA 2EG6A 1MRAA 1RLCL 3NOEA 4QSHA 3CC1A 1HP4A 4AZGA 3PZMA 1R7AA 1F07A 5IM51 3L2LA 5GJMA 3LCFA 4AYGA 2R14A 2DDXA 4CNOA 2P8CA 1VFOA 2WQDA 2D22A 1T99A 4O8AA 1TZZA 4EPBC 1VBJA 1H3GA 4W9TA 1ZJAA 1YKWA 3HPAA 4CEUC 5D03A 4Z2GA 3S3GA 2CC0A 1Q6CA 3GDBA 3BXWA 2EPOA 3QPEA 1W1PA 1EX1A 1Q2SA 1Q6LA 5BWFA 1LWHA 1YDOA 4ONVA 2FB3A 1OSEA 1H41A 3N2BA 1CB2A 3WLLA 3ARPA 3B9AA 2PZ0A 3A3HA 1BYDA 4WLCA 3QHMA 4Q8PA 1X1OA 3WLIA 3NL3A 2VR4A 3HQOA 4WX2A 1UMYA 4J3ZA 4C6OA 3BE7A 3L0GA 4XAGA 3QHOA 1HN1A 2H9AA 1P4CA 3OQ8A 3OW1A 4Z17A 4BZYA 3N4EA 1BYAA 4QDWA 3U7BA 4EF9A 1XYLA 3VGHA 3VKKA 3L23A 3PZUA 2QJGA 1EJVC 3CIWA 3TH6A 3PUEA 5A6JA 2G4FA 4WSHA 3SI9A 2F7FA 4OWGA 1FCUA 2R6OA 4K6AA 1TPWA 2BOEX 4ZQNA 1VEMA 4XAZA 4QJ3B 3E0WA 5BROA 3B4UA 4LAKA 3M43A 1H5VA 1X8FA 2QCGA 3MZNA 1HQTA 2REQA 4A8LA 1F8MA 1LL7A 1OB0A 2D2JA 1B3WA 3CZGA 1VIWA 3MVIA 3KOXA 3R43A 4PCFA 4AEEA 1EHNA 2V82A 1JFXA 1OBAA 4ICCX 1X6LA 1R38A 4B5TA 1AD4A 2ZC8A 4C90A 1C3FA 3H6OA 1ZB5A 4WOZA 3AMCA 3TMQA 4N6EA 1XM3A 1WBHA 4D6CA 1KNWA 1EPXA 4I3GA 3UGVA 1ZZMA 3CUGA 4I7UA 2VYOA 1QNVA 2OOFA 3KRUA 3PP7A 1KR1A 5D33A 4J27A 4G8TA 5C70A 2OFJA 1WX0A 7REQA 1K1DA 4LEFA 4DBUA 2DEPA 4QDMA 3E2VA 3G6LA 2EG7A 5HAOA 3NPWA 2IPWA 1Y5XA 2YLAA 4Y2WA 4W7VA 4E4FA 4D2JA 4JYFA 4RZ6A 3HOJA 2YIHA 1JULA 5D8ZA 1U22A 1H11A 4AVFA 1GHRA 2FMNA 2EPHA 3GG7A 4WY0B 2I7GA 3M5XA 1R2TA 2VT0A 4IIBA 4JTLA 4MAZA 1B3ZA 4UQCA 2DZTA 1A5AA 3ABZA 2WSYA 1HL8A 2GOKA 4PMQA 3PAOA 3QZEA 1I1XA 3TXVA 4F2UA 2GWGA 2E77A 2A7PA 1PB0A 3B8TA 2QCLA 3NO1A 4BHYA 2BP1A 1ZCCA 1XRFA 2FH6A 2VRKA 1S46A 4CVUA 5GJNA 1XV8A 1U1UA 4WIWA 1IEVA 4KETA 1AJZA 3OGRA 3W3OA 1XJBA 4OQVA 4ACZB 4MADA 3ZR4A 3PTQA 5DF0A 1QW8A 3SCTA 3NVTA 3W29A 4CQCA 4M0XA 1I2NA 4AXKA 3S1GA 4JN7A 2P1FA 1UYQA 3SFKA 1KCXA 3F4CA 3PVFA 1VRDA 1XCFA 2CLPA 2CXEA 1XDMA 2Z29A 4OZOA 3CTTA 1U30A 4JFSA 2V5DA 3UG3A 5HJLA 1XLGA 4QBXA 4HMCA 2R82A 3RAOA 3TONA 1H7WA 5FCZA 3W7HA 3HV8A 1PHWA 1XISA 4PTXA 3P3BA 2ZE0A 4YPJA 3C0LA 3LXCA 1UR0A 4JFWA 3ATYA 3AIBA 2ACSA 4DJFA 1KM3A 4M1RA 3L67A 1FFQA 4F79A 4P8UA 1OFOA 3AS3A 1E9LA 4C6CA 4AZ5A 2DQXA 1R7OA 2PLJA 4H8VA 2A7NA 4QAWA 3DX5A 1F6PA 1W9PA 4AIEA 5CPQA 1VPXA 3O8AA 1DIEA 4EPKA 2PDUA 1E3XA 2XIIA 3YPIA 3A3WA 1TJRA 3LCXA 1QJWA 4LXFA 2VEFA 5AYBA 4QM1A 4ORMA 2XH4A 3T05A 2OWXA 1F7BA 2V5JA 4LYKA 1SJCA 1F05A 2DUAA 2BLEA 4YCPA 4JCLA 3R12A 3WQDA 3USZA 3Q2DA 2ANUA 2OODA 1ML1A 5KEZA 4KCVA 3U5YA 1Y0EA 4QSFA 3LPFA 3UZWA 1ONEA 1US2A 4IGSA 2VEIA 4WJ8A 4DX3A 2GK1B 3VMNA 3NXFA 4XUGA 5TIMA 1YBQB 3GZ3A 4LWWA 4Z42C 3AIEA 3E02A 5A8OA 2GQ3A 1GVRA 5RUBA 3UFYA 1UBSA 4ZR8A 4PCSA 2ALDA 3F1QA 1W8GA 3KHDA 4IP4A 4TX9A 4NJHA 4HU4A 1E71M 2YZRA 3QGAC 3WEOA 5BOOA 3CZKA 3UT0A 2XU2A 3PPGA 5DCEA 2Y7EA 3R7MA 1GORA 3XINA 2BFGA 3EWWA 2PTXA 2G3IA 2X1IA 4HHLA 3L12A 4TOQA 4GYPA 2GJRA 2Q8XA 4RCXA 1DJHA 4N9BA 4ML9A 1Z32X 4R3UA 2X1RA 4LUJA 4O1CA 4XZBA 3SUWA 2VVSA 1ZNNA 1AZ1A 1JCTA 1EXPA 3VD9A 2IQ0A 1JPKA 3LLDA 3VMPA 1GUVA 3MBFA 1K7XA 1UR1A 4FR6A 1PTAA 5JH1A 4C60A 3EB3A 5SWUA 1TWIA 1JIBA 3NUKA 4JEJA 1TELA 5T8GA 4REQA 2J9ZA 4H2CA 1KXVA 3PZ9A 3LCHA 2OCZA 1LDCA 4HZ7A 4UTWA 3QR3A 1XPYA 1XSKA 3STPA 3I4KA 4QDPA 2H3DA 2G97A 3KRZA 2E9BA 2JF7A 1R86A 3WSUA 3TZFA 4OBTA 1ZS2A 3ZLFA 3SB0A 1C90A 2CBVA 4N02A 2A4AA 2W4XA 1UQYA 3VOCA 1YXDA 3TA6A 4Q22A 1N2VA 3MW7A 3PWGA 3OGSA 1FWBC 1HP5A 1OVDA 5KSWA 5IDIA 4XISA 3UQNA 1FDZA 3E1F1 3IRDA 1ESWA 5D30A 2WZEA 1SVDA 5D2TA 9CGTA 2XIMA 2ZDSA 3SRKA 1VAHA 2IQDA 4IQLA 4Q33A 1KFJA 4S39A 1AQMA 2IPGA 1FOBA 1W1IE 3EB4A 4WR3A 1ZLPA 3F5JA 2E1DA 4R33A 3LBMA 1XS2A 4MB5A 3S1WA 1G67A 2BGNE 1RH9A 5A8GA 4XBJA 4L1WA 3VKBA 1H0GA 3LN3A 3ARWA 1CGXA 1GHSA 3CUXA 4PEKA 2ISFA 2WCAA 3EWCA 3VO0A 3KW3A 1B54A 2ATMA 3GHSA 3ME3A 1JCXA 4GYKA 5BXRA 4ZL1A 4FA3A 5JVLA 3UWZA 2QCHA 4MG4A 4KFPA 4DXKA 4DJED 3PWAA 4W5ZA 4PC8A 3M64A 1UA7A 3TN3A 5I78A 4PUUA 3GC2A 3V0UA 3S5OA 1OFQA 3GVRA 1JYVA 5D38A 4QJ4B 4C65A 1XIDA 1G4TA 3FW6A 4MWAA 3O15A 2FYMA 4G7EA 1QNPA 3G2GA 1KLZA 1SYTA 5GNZA 5F2LA 1UWQA 4RE4A 5IHRA 4AX6A 3R8RA 2X1UA 2FGZA 4MDOA 4WKFA 5ABEA 2Y70A 3DBPA 1UR9A 2FPYA 1O5QA 5F1VA 5L9FA 4V27A 2QCMA 4AQLA 4L5ZA 4XIAA 1J6PA 3SGUA 2QPSA 1CXFA 3VD5A 1JUKA 2DT1A 3DFTA 3R94A 3MWAA 3AIWA 3NYZA 4OBSA 3AYVA 3RPDA 1E51A 3PZGA 2CPUA 3NL5A 1L2UA 5DELA 3GUWA 2C1IA 4DN1A 2DVTA 2YW3A 5KZDA 2OO0A 4NZ5A 5HMFA 2NVCA 1GQIA 4Z2LA 2NQ9A 2W27A 5CSSA 1QI4A 4OGZA 3S6TA 1D3CA 1AJ2A 2YL9A 1TX2A 3CB3A 4HOZA 3VD3A 1B90A 3MUZ1 3VCRA 1E5NA 2VC5A 4UFJA 2W5FA 1MSSA 4KRUA 3W9ZA 2J7EA 2QJJA 1WOAA 3LLXA 2J8GA 3BAIA 1DL3A 3ZXWA 3GWQA 4G7FA 4XAFA 3EGJA 3LUTA 1KBKA 4QP0A 3QRHA 1AA1B 5AB3A 5LHFA 1LUCB 5LNUA 3QJAA 1XYAA 4GFIA 3E0LA 2FFCA 2VHLA 1VS1A 1KFWA 5HA7A 3VZXA 4ERGA 3BCJA 3VGEA 3W7IA 4M3PA 1RD6A 4EXBA 1QNRA 3N9RA 3DFNA 3GXPA 3CV6A 4HCDA 1Q5MA 3WD0A 4F66A 4KCWA 5A8PA 2ON3A 4CU6A 4F8XA 1PL9A 3W86A 1E4NA 5HJXA 5DMNA 2XPKA 1N8IA 3K5XA 5LXEA 1OM0A 4UNIA 3BG3A 2PLKA 1XIIA 3AZTA 1QR7A 4L56A 3AIQA 4S3EA 4DLMA 3R5EA 3UETA 2OSWA 1KCKA 3VNZA 3EPOA 1ZPTA 4PCTA 1PX8A 5HPCA 4K7YA 1K3UA 1BFNA 3LG3A 1L0PA 3OZOA 3M44A 4O28A 1OZQA 5REQA 4HYWA 5DY2A 4KWVA 3M7WA 2ZQ0A 4UR7A 2B4GA 3WLMA 2HBVA 1ZTVA 4JIQA 1MFUA 2FTPA 3LMZA 1KFCA 1GG0A 1A53A 4S3FA 3NWRA 3C4UA 4Y9PA 5B7ZA 2OOGA 1B9BA 2X0SA 2VGBA 3CS2A 1K03A 3VVGA 1OC5A 1CT5A 1TPB1 4C6PA 3W75A 1E0UA 3WH8A 5A5WA 2ZWYA 1RLDA 1CLXA 1S2CA 2DFAA 4BEUA 2G3JA 4WDTA 4M7TA 3HV9A 3QTPA 3NYDA 3RLUA 3HIJA 2PBGA 5D9MA 1MNSA 2H8ZA 3FLUA 4H9XA 2ZUSA 1QI5A 3QQWA 4QEHA 2OJPA 4EXQA 3KP0A 2J8FA 2AKMA 2NQZA 2PDCA 3Q58A 5G2HA 3MHUA 4NXSA 2V3FA 1Y5WA 4FF5A 2CZDA 3OBAA 3VIGA 1R30A 2IKHA 3MUIA 3H2AA 4JS3A 3GUGA 5ENLA 3RO8A 5CKSA 1E6NA 4MUZA 5G4WA 4QS6A 2WXDM 3W00A 4FP1A 2P10A 4F0SA 1LLOA 3C56A 5C9UA 1T0OA 4N9CA 1CIUA 3H22A 2E9MA 3GM8A 4MNLA 3T78A 3H4GA 1V3IA 2ZRVA 1DWGM 1P43A 4XB3A 2DSVA 4K8HA 1XI3A 3CL8A 3O2LA 5T9BG 3UG8A 2A7RA 1JF6A 2C1HA 3W22A 1K8YA 1X1NA 3WFAA 5LNWA 4WD0A 4K3ZA 1RUSA 2YDAA 3W87A 3CT2A 4B9YA 4NY2A 1AMKA 3FJ6A 1B1YA 2DZXA 3VZYA 3CZEA 2QJHA 3A12A 1XG3A 3NFUA 4IL2A 2XM1A 4CD7A 1U5HA 2VJXA 3G1HA 4LV4A 3BUVA 5CLTA 3EOLA 2TODA 1VC4A 4O52A 3W1LA 1CXKA 2QAFA 3S9IA 5IFTA 4YS1A 1GKRA 3GNDA 1JAEA 4GABA 3QC0A 1FCVA 3SRHA 2WVUA 3F03K 2G50A 2Q3OA 3PAJA 1REQB 1EFZA 3WMLA 1XW8A 1M7XA 3OYXA 1Y8BA 3VU2A 4OU1A 3DYMA 3IVUA 3WQ6A 3THQA 4HYRA 2WNZA 3AXIA 4IL0A 1FWRA 5CC7A 1KV8A 4NAFB 4ZXOA 1IZJA 3PS7A 2EKGA 1YTKA 4H8UA 5BZAA 3RU6A 1K77A 1JD7A 5CZJA 3UR5A 4O15A 1QUMA 1F9CA 1W9VA 4LUYA 1GJWA 5DXXA 3CQKA 2OLHA 2VFIA 1OG6A 3FX4A 4J2MA 3H4XA 4HTBA 2PU1A 2A3CA 2DSKA 1YNQA 1HXJA 3M5YA 4CVWA 2FGBA 2WMJA 4GIAA 1NIUA 3REQB 4AF0B 3FSUA 2DORA 3BOFA 4LS2A 3WFLA 3UXAA 1HJUA 4E8CA 1XRTA 3P14A 2CLEA 4I9MA 3ITLA 4GUHA 3AHXA 3CO4A 2C7FA 2B0MA 3UWYA 1OFEA 4XVDA 1FA2A 1P0NA 1KXTA 2PLMA 3TYAA 3LY0A 3NZGA 1R8LA 2QQ6A 1EJRC 4RPPA 1BYBA 4R5EA 1F3TA 3ITYA 4O53A 4LCQA 3WQPA 1WCGA 2J9YA 3VPLA 2GJXB 1XFBA 4C1NA 2C91A 1EWDA 3VIHA 2XSAA 5AYXA 1NP2A 4CD4A 1UUMA 5HNTA 1VLIA 3U2OA 3QGVA 2V67A 4AXNA 1BTMA 4ZSUA 1S5WA 4KH2A 4GIYA 3CUHA 1HW6A 3L5LA 1GEQA 4ZOCA 2L5HA 3BW4A 4GHRA 4IQEA 1TTPA 4ADSA 4IP7A 4PMJA 4AWUA 1K7EA 4GIEA 3I6TA 1IYXA 1JNDA 1W1B1 3SN1A 2NWSA 2ZX7A 2VELA 3W2LA 3N19B 2YCLA 5G2IA 1OGGA 4XZLX 4RNJA 2RDWA 4FIQA 3SCOA 1Q7ZA 1BHGA 4B5XA 3LEPA 3ZWTA 3BQ6A 4HKPA 3S1VA 2GYIA 2V3DA 2VFFA 3IIOA 2YFNA 2XVKA 3O6YX 4RNHA 3WQ4A 3STEA 1NOFA 4UCFA 3G77A 2PE4A 3ZT6A 1W9DM 2ISWA 4AD1A 3N17A 3FN9A 2Z00A 1A49A 3WJSA 2NSXA 3CL7A 2ZFAA 4LVFA 1NSJA 3AUOA 1EYEA 3GNRA 1CWYA 5K7JA 4NRRA 3R8HA 1QHPA 2J27A 4S3AA 4S38A 3N14A 1YEYA 1Q45A 3RN6A 1LOLA 2HNHA 1QCWA 2PEVA 4O19A 4E3VA 2CLIA 1J0ZA 3QV8A 1H7XA 3LI0A 2XIQA 3ZSSA 1SSDA 1DJQA 3PZVA 1W2PA 4AWEA 3G18A 1OT1A 3PG8A 1UKQA 5HINA 4GH3A 5BW6A 1W5OA 4NI8A 5AYZA 3KVMA 1M7OA 4PFHA 2DZPA 3RNDA 3AISA 5I0DA 4LPCA 2HNEA 3V5FA 3LLFA 3TUUA 4EWND 1FDJA 3CYJA 4GY7A 1F2JA 2QIIA 3M07A 3DBNA 1ELSA 1UIPA 1Q6EA 2YKKA 2DJXA 4ROPA 4US5D 4UNKA 1E5JA 4B2DA 4BKNA 4IGHA 3QV9A 2Q3RA 4ZQMA 1UW9A 2Z1WA 1PTDA 4OUEA 4HN8A 4QRNA 2YLLA 4UBPC 1NFBA 1KRMA 1TJ1A 3VTRA 2HJPA 4MSSA 1TA3A 3NQAA 3MCMA 3DYPA 2EF9A 1F73A 4U31A 3CLWA 4IIEA 5AHFA 3W6LA 1GOWA 1TPEA 5G2WA 2P76A 3FAXA 4YCOA 2P0IA 1I4NA 4PUMA 2AL2B 3D3FA 1G7UA 1POJA 4PA8A 2WC7A 2J4GA 3TTSA 3LV6A 4GLEA 4EWJA 2RFGA 4MTVA 4LUIA 3GTFA 4HPXA 5ABGA 2ONEA 4ZO8A 3NQBA 4GNJA 4AHOA 1LBMA 2VQTA 3TR2A 1EP1A 3IJIA 3NQEA 1L2QA 3P0XA 4MAVA 1UOZA 1Q6QA 2YOCA 3QKZA 5CBJA 3KXQA 4QISA 3UG4A 1IWPA 1GONA 3KAOA 2PWGA 4PULA 1UWIA 1FHUA 1KKOA 4IF2A 4OTKA 3GHTA 1RCOB 3SQMA 4BWLA 1E1EA 3AU2A 2YA0A 3VIKA 5FF3A 1B3VA 3ARSA 3PSVA 3U9IA 2DSWA 1XHGA 1UZ1A 5HWJA 2QJIA 4QROA 1R2RA 3FKRA 1YHTA 4R7JA 1DWAM 3GU9A 4Q8UA 4QGCA 2F84A 1EHAA 2G0WA 2YBVA 4EPDC 4LY4A 4N9DA 2J78A 3AS1A 3E0VA 4GJ1A 2Q01A 3MPGA 3NOYA 4Q8WA 3SEPA 3ANUA 1UCWA 2CWNA 3T81A 1QHOA 1VFSA 5DXYA 3VOHA 2BY0A 1KR0A 1TPDA 2PWDA 1EP2A 4OHQA 1NJJA 3G8EA 4L7ZA 4NJIA 1I45A 4PYSA 2VTFA 4J5NA 3GIQA 4EE9A 5TF0A 5DQPA 2Q6ZA 3PPHA 1E73M 4KBXA 1AQFA 2GGEA 4I7VA 2VZVA 4PFMA 1KCLA 3OIHA 3C0QA 4N2YA 3MUAA 3FHAA 2A1YA 2O55A 3WD1A 2AKZA 2UZ9A 3DHDA 4PE8A 2A6LA 4XIMA 3TK7A 3WELA 1OK4A 3HO8A 3ANYA 1EJUC 3KL0A 1BVZA 1JJKA 4XWUA 3T7VA 3M0IA 3UVIA 3WLQA 2F6KA 2G8ZA 3TSBA 3K4AA 1FY6A 4WGXA 3OLGA 7PTDA 3K8MA 2NXHA 4QG6A 4J28A 3HFYA 3KDOA 3W81A 5D9PA 2WMIA 3GLCA 1BTCA 1K8XA 5H91A 2Y0FA 3DCPA 1WDDA 3MI2A 2PFHA 5KINA 3D6NA 1TMQA 5E70A 4HK6A 1AODA 4HOXA 2PCQA 3ALGA 3B4YA 5K3VA 2CW6A 4HZ6A 2J9XA 4HPJA 1B3OA 1WUEA 2YA1A 1ADDA 3A21A 1W3HA 4YVXA 4NI3A 3WLOA 3HG2A 2EPKX 4PBEA 1T8QA 3E6EA 3CBWA 1NWUA 1D8WA 2OYMA 1XDLA 1MEHA 4Q8TA 5CZKA 1RJQA 4X9SA 4NQ1A 2W6RA 2E8YA 4I90A 3W2UA 3Q67A 3AIVA 2J7BA 1CZ1A 5D02A 3UZXA 3B8UA 3K46A 2CESA 3IK4A 3XIMA 3ONCA 4MNMA 2A85A 2OKTA 3PZNA 3VE7A 1XQLA 3LZ5A 1O7AA 4L9XA 3VOIA 3CT7A 3KUMA 3E0IA 1OHLA 2WAGA 1XFCA 1TPUA 1JL8A 3CM4A 3RM4A 1VFLA 3UF9A 4YTRA 2E6DA 4XUYA 3UWUA 1ADSA 3V16A 5DBUA 2PGEA 4DO4A 3N6HA 3CASA 2J7DA 4CCEA 4J3WA 3SJ3A 3P67A 3PFRA 2PURA 5LSMA 4EP8C 3M7SA 3ZT5A 3BLIA 3N6JA 3WNOA 2OQYA 3EB2A 3LERA 5BYWA 3FA4A 2OYKA 4UR9A 2BHZA 1FXQA 1XR2A 2VX5A 3UCQA 1A47A 1GK8A 2PDGA 3FNDA 5C9ZA 5BMWA 3BLLA 3SN4A 4PCPA 1H49A 1EQCA 1GG1A 4NZCA 4LRTA 3S83A 1OEPA 3FEQA 3PK7A 1TFVA 1S2VA 2PTYA 2KX9A 4M82A 5LYRA 3HJEA 1W31A 4JIRA 1ISXA 2FJKA 2ZC1A 1LG2A 2WMGA 1ECEA 3HQNA 4JDYA 4E4PA 3W85A 4US5A 3RCYA 2A6NA 4A29A 3TU9A 5ABFA 1J11A 4FI4A 1ZHAA 3N6QA 1V03A 1I0DA 3BW2A 4HHHA 4OIFA 2ZX5A 1WNOA 5LXXA 3H2EA 5LIWX 2QF7A 3LHZA 1I75A 1AQ0A 1YX1A 1XH2A 4DLFA 3CHEA 3ZYZA 3IS4A 3LX9A 1AFSA 3AYSA 5I03A 7TAAA 3HMCA 1H0IA 5I7GA 2IMRA 1F61A 2PC8A 3LBCA 1B3YA 3KM8A 3Q45A 4ECLA 3EKZA 3HG4A 4O12A 3QY8A 1HF6A 5FOOA 4U3AA 1RA5A 2HV5A 4IFRA 4ROQA 5D05A 2WPBA 5G4HC 1OWQA 1DEDA 4B92A 3O06A 1HKMA 4GQGA 3BAYA 1LRTA 4IOTA 1FDYA 2W9MA 5B80A 1OFPA 1EGVA 4IXHA 4OT7A 5H8PA 4WY0A 2G3FA 2KAUC 1J93A 1SJBA 1L6WA 3FXGA 2VL4A 2NT0A 3LK6A 2J7FA 3UA3A 1ZCOA 4MWAE 3C5QA 2JKPA 4UTMA 1RALA 4P7QA 3W2KA 3A9BA 2JALA 2H8XA 1PSCA 2NX1A 4INFA 3CZ8A 1NEYA 1RCXB 3QOKA 5D4YA 4X3ZA 5A6SA 1AMYA 3ARZA 4M24A 4A3UA 3DKLA 3RM9A 2ZKMX 4LJ3A 3GIYA 3QBUA 4A8RA 4AHPA 3AC0A 2PTDA 1IR1A 3T0DA 4GBDA 3RR1A 3TOYA 5D09A 1SUXA 3CU2A 3W0KA 1ZSXA 3DG6A 3TSDA 4MUPA 3RLVA 2YXGA 1XLHA 3WK3A 1OZMA 3IJDA 2VDGA 1SGJA 2INFA 5EY5A 2I56A 2WMKA 2PRLA 3GXIA 1US0A 3WF1A 3G1XA 2V30A 3UYCA 4DAFA 2QS8A 2Y88A 2Z0IA 4TTUA 1VPQA 2CZVA 1V79A 2VZOA 3SCQA 4YYCA 5GNYA 5IOBA 3JW7A 2WSQA 4HPNA 3VOJA 3G3MA 3CIVA 4GYFA 3VUPA 1XUUA 2OT0A 2EJAA 2EEXA 2PGWA 4PUNA 2O0TA 4B4FA 2FGLA 5C8BB 3UP8A 4HMEA 2G3MA 2YJQA 4PODA 4ZQRA 2JIWA 1DHKA 1B5TA 3HZ3A 4UWMA 3KE0A 5U7SA 3QSRA 1V0KA 2PP0A 1DJIA 4J1OA 1V51A 4AWTA 4WKAA 3NQ8A 3O07A 1KFKA 3N3TA 4D6FA 1YXCA 3DESA 1UWTA 1FWWA 5F1UA 2HPMA 2AAAA 1MEWA 2QIWA 4O1FA 1E9YB 4LC6A 3VNDA 3ARYA 3CZJA 2CYGA 3LQGA 4XAPA 2GK1A 4PBFA 2GGGA 3DC0A 3WMBA 1S2AA 5BOFA 2NLIA 1DQUA 3C86A 4U5IA 4NX0A 4BR1A 4ZQCA 4IJCA 2IS7A 1B31A 1MW1A 3MC5A 2DZAA 5I23A 3M4HA 2QF8A 3OHMB 2OU4A 4J40A 1KW1A 1SQ7A 3ZVHB 1O12A 1D9EA 3N9KA 3TE9A 1PKNA 2PWHA 4HJFA 1PIFA 2ZTKA 4O11A 4UQBA 4WHBA 4JTSA 1UWSA 3TAKA 4DRSA 2CZEA 2J13A 7CGTA 3W37A 2HS8A 1SR0A 5FESA 3IRSA 1ODZA 3EKGA 1NFPA 3AZSA 4M6VA 3P5YA 4WSKA 1KGUA 4L61A 3BC9A 3EDJA 1JPMA 2WOQA 4O0ZA 1BGGA 1TWSA 3LS9A 4GYPC 5AYYA 4TVCA 3OJGA 1KM0A 1KLYA 3P74A 1EEPA 2VMFA 4PUEA 1L6SA 2UY5A 2QCCA 2XFRA 2X7WA 4U10A 3N11A 3N34A 4ZB2A 3A4AA 4PR4A 5BRPA 1KGWA 1W3NA 4GG9A 3B8WA 4O54A 2E6FA 4NASA 1X96A 2WK2A 4RZ5A 4IMDA 3S5NA 1PJ9A 4BEQA 3M0HA 4H8HA 1QATA 4UTHA 2EGZA 5AHEA 1XLEA 2CITA 4A8IA 2J25A 1HZYA 3EBVA 1OX4B 4O57A 3JS3A 2FKPA 4DBEA 3CPUA 4UTWC 2ACRA 1QK0A 5KETA 2WWDA 2A3LA 2V3EA 4DQWA 3SIMA 3RLGA 3DGBA 1O60A 1Q4NX 1P7TA 1UUQA 1C8YA 2AMXA 3WKZA 1FH7A 1NF7A 1QI2A 2V3GA 1TSIA 1KM5A 4ATDA 1TZ7A 1UR2A 3RX3A 4HK7A 4GXWA 4DEFA 3MQTA 3U2EA 1TJ0A 1ONRA 4QQ3A 4LF1A 3IV8A 2XFYA 5MKGA 5I02A 2DIEA 3VGGA 1J2BA 1VH7A 4JGDA 2PD9A 3EEZA 1QBAA 1V7YA 4JQ4A 3F7JA 3BLEA 1V6XA 1LQ2A 3GHUA 5EMYA 5CJ5A 1OK6A 3HGOA 3UA4A 3QVQA 2ZOXA 4OKDA 6ENLA 3G1YA 3VM5A 1IXNA 3WLHA 1CLVA 4GJIA 3VX1A 3M0ZA 4NUWA 5I3IA 1JUEA 3W72A 6REQB 2PU0A 3PB2A 5HULA 1TTQA 4PRWA 2IPJA 1Q8AA 3STGA 3R1ZA 4MIMA 3KOWA 3ZR6A 3VIIA 4RV8A 1OY0A 3HG3A 2NV9A 1E6PA 1EDTA 3VFLA 1E6XM 4BI5A 2Z26A 2D2OA 2XFFA 5C0QA 2NV1A 3WZ0E 1GTHA 1R3QA 5BNKA 5LZLA 2PDBA 1GOOA 5D2WA 2F2HA 5F2MA 1GVYA 1MWOA 2QULA 4K36A 4M51A 7ODCA 1DXFA 1UZDA 3H26A 5I06A 3WLJA 4RDYA 5AY7A 4Z1YA 4F4RA 1N82A 1TPH1 3D5HA 3CUIA 2YL8A 1ICPA 1GEHA 1QW9A 1L8NA 3KZPA 5FEXA 3M0YA 3KVJA 5C5YA 4EOUA 3R58A 1TTIA 2A79A 1O1ZA 3R13A 5LKYA 4XSLA 1Q6RA 1UWAA 4FLOA 1ONWA 4F48A 3NQVA 1LZOA 4Q3MA 3URAA 4C1KA 1T96A 1R3VA 4D6EA 1QK2A 3DGRA 1HVQA 2JKAA 1D3GA 3QV7A 4E8DA 3WQGA 4NF7A 4AAJA 4QLLA 4QNWA 4AZ7A 2WYSA 3LSBA 2BBFA 2UY3A 2PDHA 2R1MA 3L4UA 3PZTA 4IZGA 3TN6A 5CG7A 1LORA 1H62A 4ZOEA 1SO6A 2UY4A 4M1BA 4B4HA 2ICSA 1Z44A 2BY1A 5EPDA 1KFLA 4PCNA 4AZ6A 1I2RA 5E9XA 1E9IA 1R46A 2QDGA 3L21A 1XX1A 3AXHA 1XLIA 3E2QA 1X38A 2C18A 2GGIA 3NGJA 4Q7BA 2WKJA 3O0FA 2WPGA 1HJSA 4XZHA 3LCGA 1C8VA 1AZ2A 1LUCA 4DNHA 2VURA 1KQZA 3PBUA 1KBBA 3GC5A 4HMDA 4LVAA 3CWOX 4HNVA 3UJRA 1PWMA 3OG2A 1JFHA 4UTIA 3NCOA 5CSUA 1JCNA 3NQ6A 3SJNA 3UXLA 1M3UA 3TTYA 4UQAA 1WOBA 4JTQA 1DP0A 2I57A 1M53A 1V93A 1E1CB 2F38A 4JTFA 1ZJBA 4UFMA 5IBXC 3TAOA 3S6OA 3DHUA 2QCDB 1OADA 2BHYA 4UTLA 3L4WA 3E49A 3MY9A 3DUGA 1UC5A 1WKYA 1QTWA 1O1HA 3MKCA 4WKHA 4YLWA 4DUWA 1JAKA 2Q71A 1MXSA 7XIMA 3NQDA 3MP4A 1R9YA 2ZIDA 4O16A 1XF0A 3ZWSA 3B8VA 4F2BA 1DTNA 4OV9A 4W8LA 3B9OA 1KGXA 3S5ZA 4MM1A 3IGHX 2VVNA 3NQCA 1YW1A 3PNZA 1T7LA 1J8VA 2V8ZA 3W7CA 3GDRA 4TIMA 2V38A 1XUZA 3A64A 1KWGA 1VJZA 4GPNA 4JICA 4GK8A 3DFYA 2JE8A 3TP4A 2P88A 1JZ6A 1GGOA 2XFWA 1WZMA 2OYLA 4DWSB 3WK0A 3ANVA 2HCVA 2HROA 2WVTA 3GXTA 1OF6A 3GH5A 2WVSA 1TE6A 1VFHA 5CH9A 2TSYA 4GWEA 3EWYA 2PTZA 2Z1SA 1VB9A 5LGXA 1FBAA 1ME9A 2J75A 1BWKA 3KRBA 1HTIA 1GYLA 1JXJA 3NZ1A 3FXYA 3TFCA 1O66A 1Q13A 1J9YA 5ABTA 1JZ7A 1A0DA 1V0NA 1TV2A 4WGHA 5G1YA 1XIJA 3GXNA 1BRLA 2Y61A 3ZOAA 4EVZA 3N1AA 5CQ1A 2C3ZA 1YXYA 3PN8A 4K1WA 1FWHC 2DIJA 3QZ6A 3T2PA 2WO5A 1LBLA 3BZGA 2ESCA 1FP8A 1MNZA 2CIPA 3KBNA 1V02E 2XH2A 1G94A 3WUGA 3KBJA 2UWFA 1ICQA 1EF3A 1QI3A 5HNUA 1SFJA 2Y8VA 3SECA 3RFAA 4AW7A 1U5VA 4XZ9A 1PZ1A 4S23A 6CGTA 2XVNA 5F4WA 3W4RA 1R6WA 2YCKX 2WVVA 1VKFA 1LLWA 1EJXC 3BICA 6XIAA 2VO5A 1UWUA 2NXIA 5BWAA 1ISVA 2I1OA 3WD3A 5AC6A 1JYXA 1A5KC 2GVGA 2P53A 1W1VA 1A5UA 3W1TA 2CLHA 1G6CA 2B81A 3IPWA 1A5SA 4XZMX 4PB4A 2X30A 1EZ2A 1VP5A 2ZUMA 3C2FA 3M46A 3PBGA 3W2JA 1KBLA 4FXJA 2DW6A 1XL9A 5AC5A 4W4QA 3BOXA 1JD9A 4R7WA 4TVUA 2BXYA 3WD2A 3VAVA 3SDOA 2BGSA 4IIHA 3MYOA 3CO8A 3AYTA 4K68A 3TWBA 3WN6A 3NSMA 2CEQA 5DCBA 3CH9A 2YL5A 1W6TA 2QXWA 1BXCA 2JEQA 5MHBA 4J3XA 4A35A 4IIGA 4L4LA 4K37A 6ALDA 4UMBA 3H21A 4KMQA 4D8AA 4PTDA 3R2GA 2ZWZA 2HXTA 3EXTA 3FVMA 4HPHA 2IKIA 2XWEA 2V2CA 2QCNA 1RVKA 2AOSA 2JQXA 2VNCA 1QPRA 3H24A 3HMJG 1B4KA 3GYEA 4UQDA 4KERA 1SZFA 3USBA 3REQA 3VMOA 4CLMA 1XIMA 3GTHA 3NL2A 4LAMA 1OGSA 2XWDA 3NQGA 3NNTA 4U2YA 1S38A 4QE4A 4XZNX 3WK2A 4F0LA 3RX4A 2F2KA 1EH9A 5E6YA 4ZCWA 4PMYA 3W53A 3WUFA 3CPRA 2FVKA 3NM1A 3DIPA 4Q32A 3GY1A 1ISWA 3AAMA 2D73A 1WA3A 4CU8A 1XDJA 1JDAA 3LPOA 3UWQA 4QAIA 2VI0A 2VX4A 3T2QA 1TMLA 3U8GA 1FKWA 1HO1A 4NJKA 3KZSA 1TWZA 4YVPA 3CIXA 1X7IA 4JTHA 4PN2A 1YQ2A 2E67A 4Q4PA 1MW3A 1LT7A 5HOSA 1SU5A 3GRIA 3EEGA 4H6KA 3RPTA 3E2RA 4AY8A 2WC3A 3T55A 3WL1A 4O0KA 2ZXBA 3OIXA 3VDAA 5BXTA 2PDWA 2J66A 3BAWA 4PMDA 1XGDA 2GUBA 1UP3A 3EA2A 3LHYA 3B9EA 1DJXA 2ZTJA 5I00A 1TWWA 1V7AA 4BFAA 1EDQA 1F6KA 3CMJA 3LXAA 3LZ3A 3W82A 2VFDA 3S5SA 1O68A 4JX4A 2XGIA 4UOZA 2GDVA 3QMRA 4W8AA 3POCA 4JN6A 2H9AB 5FSDC 1XBXA 3GTIA 4LB4A 1UBPC 1C93A 4CCCA 3N15A 2GDQA 3GTNA 1A3HA 3KTCA 3ZQ9A 3DG7A 1KA9F 1KTNA 3THCA 1KB3A 3W28A 1DIKA 1QVBA 2DSZA 3OZMA 5ECUA 3UR8A 4H9VA 2C13A 2P0OA 3SIZA 5GPRA 4F40A 1JZ5A 4FLRA 1XWYA 3WBXA 3ZFHA 3ERPA 3W1NA 4Q7IA 3G1VA 3R0UA 1YNPA 1ZU8A 5I3FA 2REQB 4CCDA 3FV9A 3A3XA 3CUFA 1JZ8A 2R1PA 5F4XA 1ZUAX 5EA9A 1RZMA 2OKOA 3QQ0A 3BJFA 3EOOA 1I6NA 2UBPC 4DAIA 1LL6A 4JTRA 4CUCA 4JY8A 3RUBL 3GW0A 4H7VA 5HNNA 1PUDA 3IGSA 5JBDA 4B16A 1JYWA 1Q6DA 3WENA 3VOGA 5IDZA 2AMGA 1TUFA 1M5WA 5CGTA 2D1ZA 3G0SA 4CQ8A 1DWHM 3MDWA 3P6LA 4QS5A 7REQB 1A5LC 2ATSA 3F4NA 5K9DA 4L65A 3K1DA 3CAKA 3WBAA 4AD2A 3GVVA 2OZ3A 4C6QA 4DI9A 1QWGA 1T5AA 3WY1A 2XVLA 3TWAA 4FF7A 3I7RA 3WQ5A 5J5RA 4CD6A 2QV4A 1KFEA 2VENA 4R85A 3FA5A 4GKTA 4Z2JA 5AFDA 1R9XA 2WJDA 3G6MA 3A5VA 3RCNA 3PULA 3G24A 4B5UA 2WB5A 4ZQPA 3C61A 1KM1A 1P6WA 1AH3A 1GYNA 5M5DA 4JN8A 4M80A 2YYUA 3W88A 4ZTYA 1W1TA 3W1QA 4GQRA 3LSCA 3MMDA 5XIAA 5DO8A 2QEZA 4D6HA 1W5PA 1GTEA 3WG6A 4AZCB 2QMJA 4WDXA 5BCAA 1SMAA 5EGRA 3LMYA 3ITVA 2D3LA 3GR4A 4EKJA 1X8CA 1GVIA 4ZO9A 4BA0A 3A4XA 1NELA 3KDNA 4LY8A 3QW3A 3A22A 5HQLA 2ACQA 3P80A 1X97A 2RKXA 4PMOA 4Y7EA 4JTKA 1JCJA 1PWLA 2WNWA 3W70A 3FS2A 4MLRA 2PWEA 3VKCA 1C8QA 5F2IA 4W5UA 3L4ZA 1S1RA 4GUJA 4H7CA 2HVNA 4KESA 3UEQA 1F76A 1TJ2A 2Z2AA 3CEPA 3L2MA 4LYPA 4XO6A 1JGMA 2ZBTA 3OVRA 5D04C 4FMVA 1UR8A 1SW0A 2J74A 1VGAA 2TAAA 2VOMA 3V0SA 1HGYA 1UP2A 3TTEA 1OYCA 1L9WA 1EJSC 1QNSA 3UBPC 3QLLA 3C3UA 4RLIA 4LUTA 3W7PA 3DYOA 2X2YA 1XQKA 2C15A 5ABHA 2QV5A 1FHDA 1QFEA 2AL1A 3SCRA 3WUBA 4GKLA 4Q4KA 1E1FA 5CC3A 4DIAA 4A22A 1VRXA 4GH1A 4X60A 5AHNA 3ITGA 3FJNA 3WH5A 2DZWA 2V0TA 5BMXA 3AMKA 4QG8A 3NEHA 4D1IA 4JFTA 4CN1A 4H1ZA 1NVMA 3EDFA 2QCEA 1XLJA 3OLIA 3SURA 4V2XA 2QYGA 2JFEX 2XINA 2WJEA 4S3JA 4DELA 4RL3A 2E6AA 1EDGA 2PI6A 4DYEA 5CG0A 1XLDA 5ECVA 2HTMA 3KCLA 4NZJA 2NQHA 1ZALA 3LD5A 1NDZA 4HVXA 3CHDA 2OO6A 3GU1A 2ZRZA 2VXNA 3G0XA 4B5VA 2YA2A 2WKGA 1RJRA 1YE4A 1BAGA 1E55A 2J79A 4N4QA 4L64A 4TMCA 4BQ5A 2R8WA 2PWFA 2IXVA 4N9EA 4JTJA 4LRSA 3VD7A 4H6RA 1RXOB 1KBIA 2DUXA 3O6CA 3FYPA 1X98A 2Q8ZA 5HBFA 1IXOA 4Z1AA 4HNTA 1ISYA 3P8JA 1H2JA 3MJMA 3BJSA 3IIVA 2E5CA 4GY0A 1NWSA 4AYSA 1MUWA 2XSBA 4X0VA 4M29A 1EYWA 4B90A 1SR9A 2FJUB 4W84A 3P93A 3C8FA 2OLSA 3IWPA 4CQBA 1MQPA 2XUCA 3R11A 2B7OA 2G41A 3WDIA 1LBFA 3QYSA 3A6OA 1W2VA 4UMCA 4C6LA 2VUYA 1VCGA 3II1A 5HMEA 1VR6A 4PTMA 1D3HA 4KEZA 3S42A 3F4VA 4EF8A 4ML4A 4UQEA 4ZOBA 4KF1A 5T9CE 4GISA 3C8NA 3UYIA 3I7QA 2CFFA 5M03A 5LIUX 1MRQA 2VC9A 2W66A 1CGTA 1MZHA 4WCJA 2X0YA 3RXZA 1G9HA 5LA1A 4TV6A 4L6DA 2VGGA 3GTXA 1FWAC 4LV9A 4REQB 3KL5A 3HG5A 3QHNA 1AH4A 1EUNA 1YLVA 4JTGA 4O1EA 3RJYA 1R85A 3T09A 3AQUA 3LU2A 1NH6A 4ZQOA 1VFFA 2FHCA 1IHIA 3MCNA 3WLNA 4ENLA 4HNNA 5E1QA 1I60A 1L6YA 1LRNA 4UTUA 2YW4A 3GE7A 3K30A 1BSLA 3BLFA 4N7QA 1T40A 4XD6A 4ZFCA 1H1YA 3AXKA 3BL3A 1WDWA 2B7NA 3KBVA 4XTIA 1EA9C 4CN6A 5BU9A 3CHVA 2ZADA 4H19A 3T0BA 1R2SA 4JD4A 1GWJA 5K2ZA 1JDDA 2Y2WA 4J9JA 5T91A 5AYIA 1GOIA 4AY7A 4MLJA 3WLRA 1XRVA 3MSYA 1A5NC 2XGBA 4G1NA 3E3HA 1XRSA 1IEXA 3U3HA 1UWRA 4AIOA 1IZCA 1FQ0A 2X05A 1K9TA 5I09A 4UXDA 3WD4A 1ITXA 4H6EA 4UTKA 4YHEA 3WEMA 1E72M 4OE7A 1T41A 1XSJA 1K9FA 4NNCA 4MNJA 3W7MA 2B7PA 2QVHA 1TCMA 1FWIC 1VENA 3GAYA 1E4MM 1D2KA 1YMYA 2GVLA 3LTSA 4U5KA 3HN3A 2ZXDA 2CLMA 2QVNA 3ONBA 9RUBA 4FNRA 4YL2A 4KWSA 3IGUA 5CGQA 2FLIA 5HR6A 3FDGA 3O05A 3THDA 5AHIA 1FP9A 3W2NA 3QFEA 4JHOA 4GVHA 3OVQA 2NZLA 4E6MA 2VZSA 4HTYA 3BLDA 1UP0A 5EMUA 2R1LA 1EKOA 2PDLA 1JG9A 3L9CA 2YDRA 3URQA 5BU6A 1JDFA 3FY1A 4MHBA 3WNMA 4HSOA 3GDKA 1K8ZA 3WDRA 5T26A 1OFAA 4UCGA 5CBBA 3DC8A 4MWAB 4G7EB 3QN3A 4F0RA 3RU8X 2FMOA 1TJPA 1W17A 5CPNA 4D72A 3K4WA 1WQ5A 2VRQA 2GUYA 3VOFA 4L6OA 1VEPA 3NQMA 3W38A 5AC4A 5AZ1A 2J77A 3TYDA 3W1MA 4DJDD 4S1FA 4P8XA 4H9ZA 1E9ZB 4O1BA 1CXLA 3TC7A 4NP7A 2QCFA 1BXBA 3BGGA 2XIJA 4GI6A 2HE5A 2VC6A 3G22A 3WDJA 2D2HA 3JZUA 1SO5A 2ABAA 3LNMA 2MANA 1Q3NA 3A24A 2ZX9A 3L0NA 2F61A 1GT8A 1VZWA 1NF0A 1R3YA 2X7VA 2WBKA 2OMAA 3CJPA 4H6QA 2YB4A 4IQJA 5C7VA 1U2YA 3ALFA 2P3ZA 4HPGA 4IGMA 4X9YA 5C2CA 3FJLA 3AHTA 4MKVA 1EJ7L 4MNKA 1M9HA 1LM1A 2PF0A 3ITTA 4FSAA 4IGNA 1KD0A 3TJIA 3M5VA 3I3DA 3OVGA 4K8EA 2A3BA 4KCUA 4HN4A 3TTOA 3ZZ1A 4LS1A 4BF7A 4I5XA 2WNQA 2TMDA 1C91A 4OJYA 4OECA 3LOTA 2XH7A 1EC8A 4GXPA 5HXMA 3SCVA 3W7RA 2V5LA 4I6KA 4JX5A 3JU2A 1KXQA 1E15A 3I3BA 1XLKA 2V2HA 3NA8A 2Y7FA 1DXIA 4DZAA 3WK1A 3R4IA 1NWTA 3N2OA 2KZHA 3NDOA 2IQTA 2ZXQA 2I5IA 1XD1A 3TVAA 3ABOA 4C6NA 4HBKA 2DQWA 3U48A 1F3WA 3QFWA 3T1GA 2C14A 4MY9A 4K8GA 2INZA 4WZHA 1T8XA 1MW0A 3BLKA 1NQKA 3F4DA 3GU2A 3QPYA 4FS9A 1CXIA 1GZGA 1UD2A 4PUKA 1YTDA 1UUOA 1GNXA 4PRRA 1CYGA 2AGKA 3GYCA 4QE1A 4IPPA 1YDNA 3QOMA 4WQ6A 4O4WA 2EPMX 4AD4A 4I9AA 3F4WA 4HU3A 5REQB 3H2OA 4GYJA 5C2GA 4H2HA 3IEBA 1EIBA 1LROA 2I17A 2OB3A 1KM2A 1TO3A 4KKXA 2C0HA 5CPOA 2OG9A 3LNPA 5BXSA 4FR1A 3W6YA 2J47A 1WAUA 2CHOA 3W1RA 4POCA 1Q66A 2YGYA 4PGLA 4IPJA 2DZVA 1WZKA 2ZRXA 1DKWA 2VZTA 2AQVA 2BB0A 2ZA1A 3ARRA 4FX6M 3CZLA 4YHGA 3WFZA 1G7VA 3GNPA 3BWWA 4WXYA 3H54A 4GCXA 2X42A 1XC6A 2IXUA 2PLCA 1I2OA 2CLKA 3VDCA 3I6EA 1HO4A 4Q6JA 4FXRA 3B97A 1JPHA 1W91A 4L4OA 3T8QA 5FF2A 3TQKA 2ZCGA 4GZ7A 4UFIA 2UY2A 4MJMA 1W9BM 5HPOA 2Q09A 1Q7QA 4X63A 1E6ZA 3HPFA 1WDRA 1VD6A 1PKMA 3V75A 3CAQA 1UH2A 2POTA 1E4LA 4DWSD 3QY6A 2WLZA 1OCJA 3XISA 2RUSA 2NLYA 1V4YA 3IGXA 1OX4A 2C0AA 1ISZA 2PODA 4RDZA 1EL3A 2E0PA 1TQXA 3KWXA 2QDHA 4PUDA 3PR2A 3CQIA 4YTUA 1MZRA 3SO7A 5H8UA 3GG8A 2D23A 3V4BA 3BG5A 5CBIA 1EWEA 5LNRA 1OX5A 5CZSA 4YXGA 4URIA 3TN4A 2VWTA 2CBIA 1J0YA 1XPGA 1XIBA 3N04A 4GIRA 1H7NA 1GVQA 2HK1A 3PJUA 1S5VA 3LB0A 5D2YA 2DVUA 1JUBA 4QIUA 4UUIA 3TA9A 3NL6A 4FZIA 3K13A 5BOEA 4UZSA 1NARA 4Z1BA 4N6FA 2PDFA 2AQOA 2P3EA 1M7JA 2YFOA 4GMEA 3SUTA 3EZ4A 3W24A 4Y9OA 3U0HA 4DO7A 1VBGA 1CI1A 5BRQA 5KITA 3PUGA 4RPQA 3WF4A 1P0KA 2FVMA 1SJAA 2J24A 4JTDA 4GZJA 1X39A 2V2DA 4P7OA 4PMUA 4EX4A 6REQA 5G1TA 1HJWA 4UTTC 1OX6A 1KM4A 3EKLA 1OFRA 4DB7A 3VKJA 3STFA 1ZBWA 4RR4A 3WLTA 4ZXLA 4ZGYA 5KZ6A 3AJ7A 2YBTA 3KCJA 3W07A 3AZRA 5HQEA 2QNEA 2IUZA 4UFKA 2YSWA 2Z7KA 5A6KA 1CXEA 5JMUA 4LAZA 3HA1A 3CMFA 1HIZA 4LUSB 4QLKA 4QE5A 4HMNA 1QO2A 4M6UA 1B0IA 5FJRA 4ALDA 3SRDA 3HJZA 2J62A 3KVLA 3PC0A 4IG2B 3VNMA 2FDSA 3NG3A 3ZIZA 3VDBA 5A6BD 4JL2A 4LNCA 3WQ8A 3ABXA 3M0XA 3VDHA 3ARUA 4TR9A 4AZBA 2QR6A 5HWNA 1XC4A 4C6DA 3QV6A 1PAMA 5DMYA 1R9ZA 4IJBA 4CN4A 3S2CA 1UA3A 3V3WA 4HOWA 1PS9A 1S2UA 4QNEA 5HJYA 2Y7GA 3DDMA 1O5KA 2Z28A 1UQZA 3LRLA 1QPKA 3A23A 3FA3A 4YJ5A 4XSMA 4I8DA 3TQVA 5IBXA 4AZIA 1XLAA 2FTYA 1FXPA 5I3HA 4BJHA 4C6EA 1OCBA 4RXGA 2OWCA 1XGEA 1P5BA 2WZIA 2OX4A 5D37A 4C1NB 3C0SA 1PTGA 1JF5A 3VIOA 4QXIA 2ZUTA 4WVXA 5HDRA 4JEQA 5D9NA 2I5GA 3S5YA 5HNRA 5CZTA 1W5MA 1MUCA 1P6BA 5F4SA 2G37A 2QPUA 3UXDA 1PVNA 5K4XA 3UVAA 3IIXA 3GW3A 1E3ZA 4IUGA 2Y5JA 4PSRA 3M0MA 2ZVIA 1PYMA 2B31A 5JH2A 4NSBA 2YCLB 5I79A 1WZLA 4AD3A 1LL4A 3PUOA 3S9YA 3CNYA 2A21A 5GNXA 1RSCA 2XYLA 3F2CA 4MYAA 3K8KA 5XIMA 5D2VA 4S3KA 3ARQA 4W87A 1RQBA 5EFDA 5I6SA 1MXGA 1IIHA 2J7CA 1KM6A 1TB3A 2CBUA 2WC4A 1XIEA 3GNNA 2QCDA 3GH7A 3M0JA 4IH3A 2HRWA 3A13A 4V28A 4H9TA 4M8UA 4NAEA 3ARVA 2P5NA 4HT3A 5CZ0A 3VUSA 2OT1A 2ZXAA 3QY7A 3IJ7A 4C6BA 5I3GA 1M03A 4L9YA 4LU0A 3FYYA 3KS5A 4Q8VA 5HK4A 4G5DA 1CCWB 1ZQ5A 4RNFA 2E09A 3FHQA 1VJSA 5LGZA 4JIEA 4ZENA 4JXCA 3GB6A 3BCDA 4W93A 2IKJA 1HKVA 1WYIA 1DJNA 5KZMA 4KIEA 1JXKA 4IWWA 3TROA 4RKAA 3S1XA 3W7LA 4DWSA 4I9JA 1ZJIA 3ZR5A 3LCLA 4IX2A 4DF0A 3SCSA 1NFGA 3EPMA 1UPPA 4FNSA 5EMJA 5AC8A 2WM1A 1DYSA 4FLSA 1Q63A 1FTXA 2Z1BA 4XX6A 3H7RA 3UCCA 4GZEA 3AFBA 3NJ3A 3B0YA 3EA1A 1TA3B 1QOXA 1OCNA 3RX2A 1A5BA 4DJEA 1GOMA 1C29A 3LYEA 1WE5A 1GZ1A 3HURA 4UFLA 1K6AA 4GNVA 2ZUUA 4DY1A 5CPMA 3GBDA 3N13A 3BURA 3UPBA 1AJ0A 4U28A 3IUIA 3L4TA 3IVTA 1EC7A 2PMQA 2BS9A 3C2VA 1DOSA 3PNUA 4J3TA 1HFBA 4W7UA 2NX3A 3U2ZA 4O1AA 3SCNA 1CX9A 3LHVA 4PMXA 4L1GA 1GOKA 2AQWA 1JDEA 3EX6A 2ZYFA 4KQNA 3MWCA 3DFOA 1EUAA 1NM9A 1WKFA 3FJ4A 2HEJA 1C92A 2XIBA 3LCIA 2HQAA 3MUY1 3AUJA 3DXIA 4JNYA 3N9SA 2FQIA 2C8NA 1KQYA 5M2FX 4K7VA 1J79A 4AC7C 1KC7A 3GQYA 4FEZA 5M1TA 1L8PA 3ZS4A 3DU0A 4PTWA 3AICA 1TPVA 1ZGDA 4S3BA 3TX9A 4A2SA 3H55A 1S5MA 1X6UA 2ZZ1A 4R7OA 4DBWA 4Y9NA 2PBOA 1B3XA 1IWAA 4G2DA 3W1AA 1N7KA 2YBUA 1VEOA 5E09A 1R47A 2O9OA 1O95A 4JFUA 5H6HA 1RBAA 3OEXA 1IXQA 3K1GA 3EDKA 5EMKA 1CGVA 5A6BA 3UESA 1SFTA 3ICJA 3MTWA 3MI6A 1QXLA 3GH4A 1H1NA 3AMGA 3RM8A 5LA2A 4MVAA 2DSUA 1ECQA 4XQ6A 1BWLA 4H01A 1XLBA 8RUCA 2WCSA 4QTGA 1VHNA 3Q94A 1PZ0A 3T40A 4RV3A 4NJGA 2G3NA 4S2BA 1EF2A 3CGTA 3VCCA 1VBUA 2A3AA 2CWXA 3S9ZA 1IT7A 1KKRA 5CJNA 4UMAA 2ZRUA 1RQHA 2BY3A 2C6QA 4IX0A 1G4PA 3WQEA 4FX7A 3SQSA 4TMBA 2ISSA 4X61A 3C3NA 4O18A 3M6DA 3PTDA 4DJFD 3N2TA 2E1WA 4BF9A 4DZIA 3W25A 3R25A 4PSPA 4GBUA 5E93A 3LTPA 2WMIB 5JBFA 3MCOA 5CPSA 3VKAA 1Y65A 3AWNA 1KRBC 2BASA 4A21A 3WF2A 4IMAA 3OP2A 2VOTA 4B5NA 1XBYA 3L0KA 2IKGA 4MKSA 3KS6A 3WDHA 3W7QA 2G96A 3EDEA 3M0KA 3MI3A 1THFD 3S6DA 1EIXA 4G56A 3IV3A 4H9YA 2ZZ6A 4ZO7A 1XCWA 3ABRA 1V3KA 3W26A 3N29A 1V77A 3G8RA 1FWTA 4P7NA 1YPIA 3PF3A 3BTNA 2OELA 2VFEA 4Z1CA 4IPIA 1GOXA 4LANA 4A3QA 2V5BA 1P1MA 1PIIA 3BLOA 4GA8A 2JEPA 1DE6A 3W7KA 2GSEA 3I6RA 1VCVA 4HNUA 2FZDA 4XD4A 4LCRA 1O4UA 4FOKA 1EGMA 3C0JA 3CQHA 3OODA 1ZL1A 1E6SM 2OLAA 3Q4DA 3W84A 2X41A 1UKSA 4IISA 3DHPA 2FHBA 4G6CA 5A3HA 3ZLGA 4C7DA 3S4TA 4LC8A 1L6GA 1CTNA 2QZRA 4RZ4A 4V33A 1QW7A 3BGJA 3MMWA 3TEVA 2QJNA 4YTSA 1J4EA 2PSNA 3SCPA 3BVJA 2WSRA 4GE8A 3RPMA 5KTLA 2EXOA 2QW5A 3P81A 7TIMA 1FWJC 1ZP3A 1QOQA 4H4IA 3CQ0A 5DANA 1IXPA 2GQ9A 3KWSA 5A94A 4MY1A 3WL0A 3WJYA 3GAKA 3HF3A 2JKEA 3PG9A 1RR2A 2HMCA 1I0BA 4XD5A 2OQHA 2FH8A 5DEZA 4J35A 3GBEA 2ZA2A 1D7FA 4AX7A 2RJHA 1WPCA 2J8TA 4Y8FA 4JTUA 4KEMA 3EWDA 4FAMA 4X2PA 5ABFB 4AUBA 1HJVA 3CTLA 3WJZA 2WM0A 3THAA 2FZNA 2MUCA 3B06A 4E2DA 1TPFA 5CCZA 5FJUA 4JX6A 3DFQA 3O9NA 4TX8A 4LFYA 1PE1A 1TWDA 1SFLA 2VC7A 1XCXA 2J6VA 4XZWA 1E70M 3TJLA 3QKEA 1FWSA 4NHVA 3BCFA 3GVGA 3QF0A 5FACA 4AZHA 3IAPA 2OEJA 5JU6A 5G1MA 3GR8A 4KEVA 4GC4A 5A69A 1S3TC 2NVAA 2YCJA 2F9RA 1TTJA 4CNUA 4IFKA 2V81A 3FKKA 5GQBA 3C2RA 1VIZA 1Z69A 3Q65A 3UWWA 3VI2A 2V63A 1UZ4A 1TV5A 1RK6A 1WDQA 3GSMA 3SQLA 4UZUA 5DN1A 2YX0A 1OFBA 4YMZA 1UIOA 1WXYA 1Q85A 4TX6A 4IPLA 3MYPA 2W79A 3LPGA 2X1SA 2XZ9A 3UD6A 1UD8A 4F9DA 2E25A 1WB0A 1BG4A 5M3WA 4JNZA 3L4XA 4AZCA 1E0TA 1SJDA 1DWIM 3SY8A 2B7QA 1JQVA 5HUOA 5EMMA 4DYKA 3TYUA 1S1PA 3MVTA 3NPXA 4H04A 4KT2A 3TIMA 5IHSA 2X2GA 4MGGA 3VNLA 3I7SA 1W3IA 4C7FA 1LQ0A 3NO5A 3VFCA 1IQ8A 3VGBA 1TRDA 4IUOA 2Z24A 3EMCA 3QPZA 1V3JA 3T44A 2CXGA 2J7GA 1TVLA 4GI9A 4C6MA 1J0KA 1CW2A 5CGMA 3M41A 4MWAD 4JZ5A 3E5BA 3SN0A 2DT2A 1PIGA 3KBMA 1R3RA 2NUXA 3K2GA 3NXLA 3S2JA 3VM7A 4NRSA 1RA0A 4O0QA 1MVYA 1MFVA 1X1ZA 3W6MA 5A8NA 1EB3A 4J2PA 1H09A 2YDSA 3R10A 5FJOA 4JL1A 4GCAA 2RJGA 3HFTA 4P7RA 5C71A 4PB5A 4PRTA 4DBSA 5I2UA 3EWBX 4M5PA 1V08A 4KFOA 5CJMA 3T0TA 1TG7A 2OZTA 2PC4A 3AS0A 3HGJA 1Q7MA 4Z2IA 1CPUA 4ASTA 3OPSA 1UMLA 2C16A 3L5AA 3FFSA 1Q2RA 4GFSA 1NAL1 4NX5A 2GDUA 2VFHA 1XBVA 3DI1A 1SFSA 3DZ1A 3VNKA 4HCLA 3MZ2A 1XLFA 1XYBA 4FNUA 2VEPA 2GVEA 2Z2UA 2GOUA 2IW0A 1JI1A 3V1HA 2BV9A 1UJPA 4K39A 1V6TA 4TXEA 2Y89A 4LT9A 1TCDA 1NP0A 1QNQA 1CLKA 2WANA 1J2WA 3EWUA 4EPEC 1EOKA 3PSWA 1OC7A 3WQFA 1VFUA 2WZTA 3HQPA 3IJLA 4GQQA 3MKKA 4UB9A 4IIFA 3TDFA 3MSGA 3B0UX 4QLJA 4BI6A 1ITUA 4YVVA 2OEKA 3OGVA 2HZGA 1BGAA 2PUZA 3KBWA 1A5CA 2P8BA 3O3RA 3R6IA 2CKSA 3TN5A 4B15A 2BVWA 3GIPA 1CGWA 3CV1A 5BXPA 1H1ZA 1HG3A 3BK0A 2XG9A 1M1BA 3SY5A 4RE2A 3PZQA 2E28A 3C2OA 4AG0A 5A2CA 2RGLA 3MU7A 3PB0A 5DRIA 4CNTA 9XIAA 2FPTA 1F3EA 1VQTA 5CSRA 2H90A 2DJLA 3AO0A 3VD4A 3D46A 1FWGC 1XYMA 2HPIA 1JZ2A 3G3DA 4KEUA 1BWVA 3DECA 2PGRA 2JF6A 3S46A 1ZP4A 4ZVJA 2YL6A 1W5NA 3WUEA 1OYAA 3TYZA 3T42A 1RPXA 3B0PA 3DAQA 2W3ZA 3BANA 4LH8A 3VDGA 1GOQA 2F6UA 4JCMA 4Y96A 2PDYA 1FHVA 1PYFA 3TW9A 2H3BA 6XIMA 3N25A 2G4JA 4IPNB 3RILA 2GJNA 1IT0A 4ZBCA 1MXDA 1HL9A 4ZO6A 1SW3A 1POKA 3RHGA 1VBHA 1G4SA 2QGYA 5K9CA 1EZWA 3NQ7A 5EBUA 4P5UA 1XYCA 4Z0SA 5F2GA 1P7TB 4NIRA 1BXNA 4EAMA 2E40A 3WQVA 2BODX 3B8SA 4WUIA 1XP3A 4ZSTA 2YCIX 3S2LA 5B7YA 1TMHA 3H23A 4Q4SA 1BKSA 5KMYA 4JNMA 5TAOA 4D6GA 3W23A 5A6MA 2QT3A 2VZUA 2RGMA 5A6AA 3JR2A 3ECQA 1F6YA 5A6LA 1B9ZA 4O50A 4GUIA 2I5QA 3WLPA 4RE3A 3A5FA 5MKGB 3QEZA 4D6DA 4B5WA 5A95A 3CB8A 3CAWA 1GVOA 2YCEA 1H61A 3FSTA 2BXZA 4GZIA 1WXZA 1A4LA 4H9UA 3AXMA 3PJXA 1TQJA 4L9ZA 2PDIA 4KCTA 1NWRA 2QUTA 1U83A 4ACYA 1EQPA 3BDKA 3P0WA 1HKWA 2BVTA 4GXMA 1RPKA 3WMSA 1FFRA 3LGDA 4M6PA 3APYA 3BAXA 4KW2A 3W1XA 4BY3A 3OOQA 3PANA 3TQPA 3MA8A 1DORA 1R3SA 1TV8A 1XLMA 5TBOA 4AIBA 1TUXA 4LB3A 1A0CA 1W1A1 5LIYX 4UR8A 5CAHA 4C91A 2VRJA 4XKYB 3BSHA 4A05A 4GOAA 4ACZA 4QQUA 3SSJA 4D6IA 2X8RA 2HSAA 5HANA 5D8WA 3QYQA 2QDEA 3WDQA 4H3DA 1SSGA 4A8NA 4ZEPA 3P62A 4LGXA 2HK0A 3GKFA 5FF0A 4JKLA 3ENLA 1EPVA 3PHAA 3EX2A 4MFDA 3S0CA 3LA4A 3WBEA 4E5TA 3BLPX 3P2VA 3W73A 4F9JA 3UWVA 1B4EA 3L65A 2OSXA 4WRHA 3SY1A 2XVPA 3EOSA 1BF2A 1LCOA 4DM1A 2Y24A 4J7RA 3RYSA 4V15A 3DI0A 4XG1A 2BY2A 3GG0A 3TR9A 3VC6A 3QH2A 3B05A 1CENA 3R89A 3OVPA 3LPPA 2CNCA 4E4UA 3CWNA 3U6WA 3N2CA 1JZ3A 5FEWA 3WLKX 3T6CA 4E8GA 4OOUA 1XYFA 2QUNA 5G5IA 1BD0A 4ZMGA 2XGZA 2IPFA 4Z0JA 3RK8A 2R1NA 4AB4A 4E0CA 5I3JA 4MPQA 4RJEA 3W7JA 4YYFA 5C9WA 5I3KA 3OA3A 1FWNA 4AEOA 2INEA 4YTQA 1WUFA 4AISA 4JTEA 4FALA 2OVLA 3QTGA 3HPZA 1OQFA 1V6UA 2BNJA 3OZYA 4UOQA 3DH7A 2NT1A 2PDPA 5FA5A 4WOQA 5DFAA 4R34A 2UV8G 3AS2A 1YBQA 3I65A 5I77A 5JQ9A 2GUUA 3FVDA 4IQDA 3RIKA 2EAWA 5HR7A 1QU4A 2BGQA 4Z2KA 1W56A 1UD3A 1J10A 2CHNA 1G69A 3B03A 4IT1A 3DERA 2PCEA 4EK7A 3U4FA 3CAVA 4F2TA 3NQ2A 4ILSA 1AW2A 3H7VA 3WIJA 4J3UA 3UW6A 1AG1O 3DEQA 3JVAA 3SBFA 5D2XA 3TW6A 1GPWA 2VR5A 2Y62A 1F74A 4BCEA 4GNKB 5DLCA 4FX8A 1GCYA 1IGWA 3UZ5A 5A1AA 3E5PA 1K8CA 4DF2A 2GPTA 1FKXA 3M16A 4HK5A 2NQ5A 3WNKA 1PCWA 4M81A 3WCZA 5EKYA 1RP9A 4JQAA 4XVEA 1WKDA 3R8GA 4K38A 2FVLA 4WDWA 4DO5A 2QGHA 3H7UA 4Y8EA 3ISIX 3RDKA 3PUDA 4R88A 2O7SA 2JGYA 3PM6A 3GVWA 4FNQA 4PBGA 4HNLA 3G0UA 2O9PA 3RGTA 1NTHA 4AH7A 1ME8A 1H63A 1I9CB 2QLYA 5C2XA 5EB8A 1S5NA 4KFNA 4FB7A 2V9DA 3B8DA 3TYEA 2ABBA 1IE7C 1K9EA 4PL2A 5IFPA 5E6ZA 1RK5A 8TIMA 2QKFA 5FL1A 3GXDA 4JQ3A 2R24A 2V5CA 4Y6GA 4EAYA 3UR7A 1EA0A 1CNVA 4BS0A 1R87A 3RO6A 3ABSA 2XSXA 3FGCB 3S8HA 3QLDA 1DIDA 5M17A 4HA0A 4JTIA 4YIWA 3ZLHA 2YYTA 3NPVA 4BK9A 3KP1A 5HMSA 4LBRA 5CC6A 4O8RA 1ZFJA 4DXXA 4F3HA 1H51A 1BRLB 3LM7A 3TQ0A 5DT7A 3HGRA 1J0HA 1WP6A 4JBRA 4CNPA 3E38A 1HJXA 2YZ5A 1IEWA 1QPQA 2JGQA 3H2NA 1V3HA 4AC1X 4WJXA 3TTQA 5EU9A 3GNOA 3SRFA 2Y63A 4FXFA 3CLMA 4QX4A 2XDFA 4C6IA 4C5YA 2ALRA 4FK9A 3VYLA 4K2SA 1DXEA 2RDTA 5LIXX 4XO7A 3MJYA 3LBOA 2OPJA 3IVSA 4UTTA 1K7FA 2WCGA 3IK2A 5LHEA 2OX1A 4YN5A 4L80A 1UHVA 3AWOA 1PZ3A 3LGGA 4H8NA 1QPOA 4B2DD 5FF7A 2PDJA 1WAWA 4H9MA 4NZ1A 1OT2A 1E6RA 1UROA 1ZAJA 2WVVB 2QMKA 3L2IA 1J5TA 3BMXA 1JEZA 1PX3A 2FZBA 1G01A 1NOWA 2I16A 1FWEC 4QEEA 2ZUWA 4OVXA 1E0VA 4GACA 1HKJA 1MQQA 1V3MA 1CXHA 1O94A 2JBMA 5CAKA 3DFSA 4Q4MA 1C7SA 3LQLA 1VLWA 2W67A 3ES7A 1MUMA 3VIJA 1DJYA 1W3JA 2HBXA 3NTYA 2OXNA 3P7YA 3OO2A 4B3KA 4ZTXA 3GFYA 5HMDA 3UY8A 3O1NA 4AIUA 4HU8A 2NQLA 6TAAA 1K02A 4GRSA 5EL1A 1V5XA 3PTKA 2EQDA 4J4KA 2BXVA 1DWFM 1UPMB 3RF9A 4DYJA 4FHAA 3MV11 1NQ6A 4Q6XA 4RW3A 3UR2A 4GINA 3V18A 3MS8A 2VD8A 3CUZA 1JR1A 3CPGA 4NVTA 2O4QA 3WBYA 3B3DA 3H53A 3P5ZA 3O6AA 4GGHA 4QFUA 3UZYA 3S2MA 1HVXA 1RBOB 5E0CA 2PF8A 3GR7A 1PKYA 4DJDC 1A0EA 3V0TA 4XTDA 4LUSA 4LNYA 1I2PA 1OD0A 3NZQA 4RX0A 4IG2A 3W7DA 4H41A 1XKYA 4KS0A 3DENA 1ODUA 5TNVA 4LBUA 3JUGA 2XHYA 1M41A 2R91A 2RDXA 4CD5A 3CV2A 1RBLA 4AEFA 4NZFA 4YWIA 3IUDA 3B9NA 2E5BA 2HVOA 4X0NA 2NWRA 1PPIA 1GVEA 3E0FA 1IEQA 3NSXA 1M6JA 4A6GA 4HHMA 4DF1A 4HGXA 3CHFA 4B5SA 3NIYA 2BZNA 3B04A 3GXFA 5F7UA 3U5UA 3CH0A 3W1UA 1O5RA 3KLKA 4RUBA 1PBGA 3P84A 3F2BA 4TVDA 1I1WA 1UR3M 2XJ7A 1RP8A 1A3WA 3H8AA 1SO3A 1WV2A 5FJTA 3MO4A 1PXGA 3LGEA 4KRZA 3BV4A 4PZVA 4GQBA 2XTKA 2CBJA 2WW5A 1I8JA 2CHRA 3GC4A 3UG5A 4IMCA 4F0KA 3BAJA 2GJLA 4R9OA 3G1DA 3BZJA 3QZAA 3KTXA 2ZZ3A 3EPNA 3GNXA 3IJ6A 3VX0A 4BQ2A 3LV5A 2DP3A 3ELFA 4Y9AA 3WQOA 1JGIA 4G1KA 1S2WA 1KRCC 4NZ3A 5HWMA 3HU7A 3R0DA 2ADAA 2EPNA 1V8EA 1BF6A 4Q8MA 3EX3A 2NUYA 2VD9A 1UD4A 2RAGA 3FIGA 1DJGA 2EKCA 3BV7A 3TLLA 3C2EA 1QAPA 2C79A 1VJIA 3NO3A 5FD0A 4DUXA 3WNLA 4ZFMA 1C9DA 4D8ZA 1I2QA 1A50A 1ZAHA 1E0XA 5FJPA 4AMAA 1QHZA 1EO5A 2NUWA 5JIPA 1GVSA 1W37A 3NAVA 5G4EA 1EXBA 2HVMA 3CYVA 1WBJA 1W9XA 3P60A 2YXXA 1GVFA 4RK8A 3VE9A 3BO9A 1ITCA 1KV5A 4O14A 1XXXA 3SAZA 5DX7A 3S1UA 3GDTA 3IACA 1B57A 1OF8A 1US3A 4QG9A 1TYGA 4QJ5B 1W0MA 2DH3A 5C9RA 3W27A 1XKJA 4GO9A 4GQ0A 1TPC1 4M6QA 1V6WA 2ZX8A 4GI4A 1XD0A 1QNOA 1IT8A 4S2CA 5FKYA 4MKNA 2HISA 1QPNA 1QWKA 1W1ZA 4WEVX 8A3HA 4IP5A 4KWUA 3PFMA 5KZEA 4PEEA 2Z4GA 1QMLA 1DJZA 1MQRA 3E96A 2PDXA 3SFWA 1B2YA 4UNLA 2FFIA 1LRQA 5A8QA 5FEPA 2G95A 3CUJA 1YPFA 4NZ4A 3THUA 3RG6A 2E9LA 3P61A 4LCSA 4B3ZA 4D1JA 1JQXA 3R0KA 5D32A 2PRMA 5HQMA 2VM8A 4HB7A 5CC5A 3NPUA 4LF2A 3EMZA 4U2ZA 3BMWA 1MDLA 1BG9A 1BEUA 2O9RA 4DWSC 3O7UA 3BPWA 1C9WA 1P6CA 1ALDA 4P2VA 3ITCA 2WHKA 1BQGA 1EX5A 5DT5A 4HIBA 1Z42A 4D8LA 1JVNA 3WQWA 1X7FA 2DV0A 3BMVA 3B0XA 4YWSA 1J0JA 3RITA 1LTDA 4UOJA 1J96A 2X16A 2XZ7A 3KBSA 4HSNA 1V02A 4DJEC 3MP3A 3HQ1A 3N2XA 4P8WA 4QJ1A 4MZYA 2ZE3A 3EDDA 1P0DA 4GGBA 1UKPA 3K4DA 1TR9A 3I10A 1H4PA 5I24A 1F8IA 3GVQA 1CB7B 4LEQA 4PMNA 1TRIA 1XLLA 3KOYA 3AU6A 4ICNA 4C5ZA 3O16A 4MOZA 4WK9A 1QT1A 1OINA 5XINA 1REQA 3T0AA 4HSHA 1FH8A 2Z1VA 1TV3A 2XIOA 2ZZ4A 4FLQA 4KWOA 3SR7A 4DXVA 1QBBA 2Z1KA 1VYPX 4MDPA 3EOUA 4ZZ9A 4NAFA 2DT3A 3EX1A 1LT8A 3LTYA 3P82A 5EFFA 1IR2A 1KO0A 1JYNA 4DZHA 1G1YA 1TX0A 3BG9A 2PGFA 4LUTB 2Z1XA 2E7FA 4YNGA 4AMCA 1CBGA 3VC5A 3Q37A 2HE8A 3ID7A 1HL2A 1PX4A 2Z7GA 5DRCA 3AYRA 4JHMA 5DY3A 4NT0A 4NNBA 4RDWA 2TYSA 1ZENA 4AF0A 3CHCA 4RZBA 3BGAA 1AVAA 1JCYA 4H83A 2BX7A 1QASA 1HKIA 3HBLA 2J88A 3E2SA 3MUXA 4FIRA 3TYCA 3OBKA 2E8ZA 1J5SA 1BVNP 3N18A 3KHJA 3JZEA 1WO2A 4W8BA 3TJ4A 4HA4A 4JAWA 2QJMA 3W01A 2PWVA 1LWIA 3OLDA 1IGSA 4GI8A 1RVGA 1W5QA 1FRBA 2PP1A 1A5MC 4ZE4A 2PDMA 1J12A 1WXJA 2NW0A 1ZY9A 1UKOA 3H2CA 2GJXA 3EWXA 3P8IA 2DZSA 4XZIA 3OA5A 4Q4QA 4GY1A 4UQ9A 2BHUA 4E2BA 3FOKA 3WNNA 4QITA 4DNMA 3LM3A 2BMBA 3EAUA 4LVBA 4H00A 3EX4A 1YTEA 1TIWA 4PB3A 1Z48A 1OJXA 2WBGA 4S3CA 2WJFA 2ZZ7A 5CSYA 2Y8UA 2PDQA 2HDJA 3FAWA 3G1AA 5HUPA 7A3HA 1Q6FA 3CQJA 5AVHA 4A2RA 1VF8A 5LA0A 3M0LA 3A47A 3TSMA 2E68A 4RDVA 4E2VA 2NVDA 4PTNA 1W3TA 3F5KA 4EIVA 4O1DA 3AI0A 4KGJA 4TU1A 1ONXA 4IMGA 3I68A 1BQCA 1QDSA 1KXHA 1NU5A 3CWHA 4D6JA 4B3LA 3ORWA 3MMUA 5JBEA 2R94A 4IXXA 3V7PA 4X2RA 2VGIA 3DG3A 3D47A 3VIFA 1J18A 4FOJA 1LQAA 1S3HA 3MMTA 1E56A 2XM2A 2Z6JA 5DMMA 1J0IA 4CNSA 3VKDA 8CGTA 1Z6KA 4CQAA 3W7EA 1OG0A 4JQ1A 3MHGA 4ERIA 1DWJM 1UZHA 1J6OA 3G1SA 5AZ0A 3CK5A 3V5OA 2OZ0A 1U1HA 1H60A 3A4JA 2YPIA 1VHCA 3WLSA 1YDYA 1YRRA 2ZDRA 3VXGA 4J3VA 1SW7A 1UD5A 1UD6A 4Q4RA 1ITQA 2X0HA 5GJPA 2Q8LA 3NSNA 2CZ5A 1Q65A 2W0UA 4Z08A 1OIMA 3NGFA 5JXQA 3AALA 1GKPA 1E4IA 3C6CA 2CLLA 2V69A 1DQXA 4GVIA 4NJJA 2ZUVA 3ZM8A 3GX9A 4JPGA 3B9DA 1VCFA 2FTWA 2CETA 4TQTA 2GLKA 4ZOAA 3UNDA 5AVNA 2DIKA 3PPFA 3IJQA 3W74A 3QR1A 3SGZA 1EOMA 1PDZA 4DUVA 5J5DA 1HX0A 5FL0A 1S39A 3NDZA 2OEMA 1TE1A 3LRKA 1OFDA 2ZUNA 3NR0A 3ZJKA 4DUOA 2FIQA 2PA6A 3LHWA 3HGSA 1JZ4A 3PZOA 5MF5A 3CV7A 2NX9A 2Z6IA 3POHA 3LENA 3H4WA 3EXRA 3U4AA 2E3ZA 1GW1A 5BRBA 1UKTA