2VWSA

Crystal structure of yfau, a metal ion dependent class ii aldolase from escherichia coli k12
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
256
structure length
256
Chain Sequence
MNALLSNPFKERLRKGEVQIGLWLSSTTAYMAEIAATSGYDWLLIDGEHAPNTIQDLYHQLQAVAPYASQPVIRPVEGSKPLIKQVLDIGAQTLLIPMVDTAEQARQVVSATRYPPYGERGVGASVARAARWGRIENYMAQVNDSLCLLVQVESKTALDNLDEILDVEGIDGVFIGPADLSASLGYPDNAGHPEVQRIIETSIRRIRAAGKAAGFLAVAPDMAQQCLAWGANFVAVGVDTMLYSDALDQRLAMFKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Functional Assignment of Yfau, a Metal Ion Dependent Class II Aldolase from Escherichia Coli K12.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords YFAU, 2-KETO-3-DEOXY SUGAR ALDOLASE
total genus 91
structure length 256
sequence length 256
chains with identical sequence B, C
ec nomenclature ec 4.1.2.53: 2-keto-3-deoxy-L-rhamnonate aldolase.
pdb deposition date 2008-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03328 HpcH_HpaI HpcH/HpaI aldolase/citrate lyase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 2vwsA00
1A49A 4QGCA 3LG3A 3M0JA 1JDEA 1OQFA 3I4EA 4ROQA 1E0UA 4MF4A 2DUAA 3SRKA 2VWTA 3B8IA 4FXFA 1OY0A 3R4IA 4DRSA 3QV9A 3GR4A 4QG8A 3SRDA 2VGIA 1UJQA 2V5JA 2BG5A 5TAOA 1O5QA 1ZLPA 1F3WA 1U5VA 3QLLA 3HQPA 4IMAA 3EZ4A 1KBLA 1A3WA 2HROA 3PUGA 4L80A 4YNGA 3HQNA 1GGOA 1IGWA 2HJPA 3ME3A 2G50A 2DIKA 4L7ZA 1IZCA 3IS4A 4MG4A 3PP7A 4B5TA 2VGGA 1DQUA 2VGFA 4L9YA 3M0KA 3QZ6A 1U5HA 4B5VA 1XG3A 2E28A 4KCUA 1DXEA 3EOLA 4TV6A 3QV6A 3OQ8A 1T5AA 4TV5A 4KCTA 4WJ8A 1DXFA 4KS0A 3BJFA 4IQDA 3P0XA 4JPGA 3U2ZA 1O68A 1F3XA 1Z6KA 4HYVA 4B5WA 4B2DA 3G2GA 3OYZA 2V5KA 4KRZA 2XDFA 1E0TA 1PKNA 4B2DD 1KC7A 1ZJHA 3HQOA 2XZ7A 1VBHA 3QQWA 1F61A 1S2WA 3FA4A 3LYEA 3EOOA 3EOEA 4B5XA 3E0WA 1A5UA 1PKLA 1S2TA 1M3UA 3VAVA 2QIWA 1M1BA 3SRHA 1A3XA 4HYWA 4FXJA 3E5BA 4L9ZA 1SGJA 3QV8A 3OYXA 4QG9A 4IQEA 3QTGA 2HRWA 4YJ5A 3MA8A 1PKMA 3GG8A 2OLSA 3N25A 1F8MA 4RPPA 1VBGA 3T05A 1DIKA 2VGBA 2ZE3A 3KTXA 1S2UA 4KCWA 4B5SA 2WQDA 2X0SA 3FA3A 5JVLA 1F8IA 1PKYA 3BJTA 4QG6A 2VWSA 4LSBA 2HWGA 3SRFA 2L5HA 2XZ9A 4IP7A 4KCVA 1MUMA 3T07A 4G1NA 1PYMA 1S2VA 3GQYA 3KHDA 1XG4A 3QV7A 3T0TA 4B5UA 1O66A 1AQFA 2KX9A 3H6OA 3E0VA 2R82A
chains in the Genus database with same CATH superfamily
3I68A 4RUBA 4PR4A 5I77A 1Q6FA 3QKEA 3VOGA 3MJYA 4EPKA 1S46A 1POKA 1BAGA 3GB6A 3GVWA 3LPFA 3LPOA 1UQYA 3DIPA 1J93A 2BG5A 4C1NA 4C6KA 1EGZA 1BG9A 4Q8WA 5CPMA 1R2RA 1IEXA 4CQ8A 2DIKA 3ZLHA 1G4EA 5H1WA 3HQ1A 2VGGA 1I9CB 3W29A 1WZKA 1T5AA 3CV7A 2FHBA 2ZRVA 3S5NA 5LA0A 5FCZA 5HQMA 3R7MA 4LUTA 5A6JA 5AFDA 3MPGA 1W1IE 1VFSA 1EZ2A 1GPFA 4RW3A 4LGXA 4MY9A 5FKYA 1AFSA 4XBKA 2G4JA 4A21A 2OX4A 2PTDA 2X42A 3DENA 3WQFA 5EFDA 4JL1A 1R87A 4AC7C 3C56A 1MRQA 3DGRA 1SPQA 1W56A 1VJSA 5D9NA 3GXNA 4MJ2A 4B92A 3UZWA 1J18A 1FWRA 1J0ZA 2L5HA 3O07A 3PTDA 1A5CA 3W24A 3GXTA 2QW5A 1JCTA 3UJFA 3IJDA 1KBKA 4Q33A 2PWHA 1OGGA 4HNNA 3ZSTA 2PTXA 1TG7A 5F4XA 2CHOA 2HVNA 3GNOA 3WLKX 4LVBA 1MZRA 3KLKA 3UW6A 4C5YA 3M0IA 1SYTA 3W1QA 4M6VA 3O1NA 1AL7A 2ZICA 3NQGA 4E2DA 4RDZA 1GNXA 3USZA 1XIEA 4DBSA 6ALDA 1BG4A 2J9ZA 4NXSA 4FLQA 4UFJA 3DKJA 2V5DA 2J88A 4B5WA 3GM8A 3W7MA 4AD0A 1K6AA 2BGSA 3E12A 3VIJA 3RO6A 4OHQA 3TQPA 4N42A 4NAFB 1KNWA 4ECLA 1ME9A 3QJAA 3N2MA 3V35A 4GXPA 2BY1A 1I2PA 4PMDA 4QM1A 5LNWA 3ABOA 3VNZA 4JTDA 4K8HA 2P88A 1U30A 2TYSA 4TQTA 2G3JA 4Y2WA 1DL3A 3SBFA 1FH9A 3ABSA 1YE6A 2B4GA 1HQTA 1ZZMA 4IXHA 5AOUA 2I5QA 5HWNA 1V8EA 1GQJA 4QSFA 3KX6A 2AL2A 4A3RA 2B7NA 2XVLA 5A6KA 4UOQA 3GAKA 2QCFA 3ZJ8A 1DIEA 3PWAA 1Q45A 4L61A 1XLJA 1EXPA 3PTMA 2YCJA 2E5BA 5FIPA 3AISA 1VFLA 2CLHA 1NH6A 2BZNA 1UD6A 3HPSA 3W7DA 3R25A 2W63A 4PTVA 1R38A 1WZMA 3LI1A 3C3UA 1HIZA 3ZR5A 3HA1A 3NURA 4KT2A 1TV3A 4A8IA 1OFBA 3GBDA 3DYMA 3ATYA 5IHSA 3JU2A 5E9AA 3QVQA 3TW9A 4ZVJA 1QHZA 1RCQA 4W9TA 3T8QA 4IPLA 4J40A 1SVDA 1SW0A 4CNSA 4C6OA 1S1PA 2ZRZA 2G96A 4KFPA 3HB9A 4PMRA 2Y8KA 3GHRA 5I2UA 1Y5XA 2GUUA 1I4NA 4QCFA 3VUSA 1V3MA 1XKYA 3U2CA 3NPUA 3V16A 3NR0A 2I16A 2Y70A 2YR1A 4DF0A 1ZENA 1ONXA 3VE9A 4AD3A 1HGWA 1JYVA 3UETA 2Q01A 2HS6A 2JQXA 1L6GA 3OPSA 2J6VA 2D1ZA 4ADUA 1S5MA 4A35A 3WX7A 1XJBA 4ADSA 4MWAC 2RFGA 1JPKA 2EJAA 2J7BA 2PBGA 3SCSA 3VDBA 3R43A 4L4LA 1EP2A 3GUGA 4CN4A 3VIKA 1X7IA 2BMBA 4HTYA 2G5WA 4R33A 3HMCA 4NZJA 3ZVHB 4UTJA 2WK2A 2OEMA 2JE8A 4E3VA 4H01A 3S47A 1SUXA 1KFEA 5DCBA 3ZMRA 3ZT5A 1K9FA 1OCBA 1OGBA 1XLEA 3NPWA 4IJCA 3O63A 3TDFA 1QK0A 3MZNA 4AIEA 2PTYA 3DI0A 1GTEA 3PZGA 3A5FA 2VUNA 3P0XA 3EXTA 1AZ1A 4BFAA 8TIMA 2X1TA 2ZTJA 1M03A 1TTPA 2QQ6A 3CQIA 4TMBA 1PCWA 3UA3A 1KLYA 3KRUA 1EZWA 3KUMA 1MDLA 2PGWA 2J7GA 3NL5A 5DFAA 3VIGA 4LAMA 1QI2A 1XLBA 3SQMA 1TWZA 4L9ZA 4TTUA 1DJIA 3FGCA 2GDVA 2WZTA 1GKQA 1KV8A 4UTHA 3IANA 3HPAA 1KFCA 1TE1A 4QG6A 4LSBA 5EMUA 1V0MA 3TYDA 1NEYA 3CGTA 4G5DA 3J7HA 4YU1A 3MHFA 2D73A 1VRXA 2FZMA 4WSJA 3WLIA 1WOBA 1UD3A 4H00A 1E3XA 2P50A 4HCHA 3L2LA 1QR7A 3JRKA 1A5BA 1E6QM 3M0LA 1YIXA 2Q6ZA 1HJQA 1A80A 3TNOA 2Z1WA 1ISWA 2DZXA 4O11A 3TIMA 4JIIX 1LOSA 4D1JA 2E1WA 3BLFA 3NDZA 3AYTA 1I0BA 1XYFA 4OKDA 1GG0A 3FCPA 3LK6A 3WFLA 1E6ZA 4IX0A 2OT1A 1R2SA 2VJXA 3VOFA 3WLHA 3EWBX 4Z2IA 2GSJA 4WRHA 1V0KA 4LVAA 1DJGA 4V33A 5GJMA 3H2MA 2X7WA 4FLOA 4YTTA 2VXNA 2EBNA 4XD5A 1M53A 5D05A 2ZRYA 1XIDA 4O1BA 1TJ2A 3NZGA 3SSJA 1TV8A 3N2BA 1YQ2A 2G3FA 5HNUA 1VFMA 3WEOA 1HZYA 4BQ3A 2A7PA 3PB0A 3FJ6A 1PZ3A 4LAUA 2HQAA 4GKTA 1CPUA 2ATSA 4JFVA 2J25A 1OC5A 4W5ZA 1R3WA 4M24A 1A5OC 3W22A 4EANA 3R11A 2Y88A 4GUJA 3CV2A 4WY0F 2NX3A 1B54A 4HPXA 3L0GA 5AHLA 4X60A 1OADA 2ZQ0A 1QU4A 4F0MA 1O7AA 4MAVA 3EX4A 1TJRA 2V5JA 3CMGA 2VENA 5C7HA 5JU6A 1YW1A 2DJLA 3SCOA 2IUZA 3R1ZA 5LNUA 1R3SA 4RZ6A 3MV11 2OEJA 3WMLA 3TH6A 1E9IA 5AYBA 5E0FA 1W17A 7REQA 1P5BA 5AYYA 4DJEC 3UWZA 3WENA 1GZJA 3LBCA 4PC8A 1EC7A 1ONEA 1W31A 3W23A 3FS2A 2VR5A 5LKYA 4AC1X 3OA5A 2ZCGA 2TAAA 5BXSA 4FB7A 1F5ZA 3AAMA 2PWDA 3BAIA 3THDA 4MNKA 3VKDA 3N11A 4MNLA 1WCGA 3AIVA 1B0IA 3KTCA 2J27A 3UZ5A 3G8EA 4QJ1A 3WQ5A 3TQ0A 4I7WA 3PVFA 1QOPA 1DWFM 3PBMA 4I5RA 4C1KA 2QCCA 1EYEA 1H51A 2PP0A 1JXJA 4E8CA 4HOXA 1EA9C 1OX4A 3W73A 4G2DA 5HUPA 1QI4A 3AIBA 4PUNA 4MJMA 1HP4A 4AZCA 1J8VA 5G1TA 2QZRA 1AMKA 2V5LA 4Z1BA 1VFHA 1ZFJA 1QPQA 2WMHA 4KGJA 2E4TA 4PB3A 1ZCCA 3FN9A 2QS8A 1E43A 1SR9A 4GBUA 4JTFA 1XLDA 5HQLA 3WH5A 3TZNA 4HVXA 1ZLPA 4JQ4A 1KRCC 1GVOA 1XC4A 2I1OA 1SO4A 2CKRA 1E72M 5FSDC 4HNUA 2BP1A 4F0SA 4GVHA 3A3XA 2FMOA 3AIUA 3M0YA 1EPXA 3MYPA 2V69A 3TW7A 3VFCA 2HVOA 5HULA 2JKAA 3SZ8A 5H8MA 5AKQA 1OFOA 3TP4A 4Y9PA 4F48A 3RUBL 5LXXA 4GYKA 3PSVA 3WK0A 4CCCA 4FF5A 2VD9A 1Z7AA 3QFEA 3WEZA 1KCZA 4R7WA 3T2OA 1XRVA 3VO0A 1TR9A 1W54A 4PMZA 5AYIA 2QVHA 4J3XA 2QUMA 3HZ3A 3K8MA 1Z32X 1RV8A 3W4RA 4C1LA 3H54A 5CJ5A 1RUSA 4AD4A 2XU2A 2BVDA 1IXPA 3MWCA 1GPWA 2QEZA 4KCVA 4WKAA 1QASA 1UP2A 4GI8A 2O9TA 3EA1A 2BHZA 5FAJA 3MB9A 2EG7A 3PBYA 4MNMA 2ZX6A 3B40A 3W0KA 3WJYA 4JYEA 4UZSA 4XZIA 5MF5A 1E4NA 4FLSA 1UIOA 1XINA 2W66A 3GG7A 1I45A 3RPMA 4Q32A 1WKYA 4GJ1A 1OT1A 2QDEA 3BCFA 4WDWA 7CGTA 1J0HA 2A7NA 1L6SA 1QBAA 1DJQA 2BS9A 4L80A 1QPKA 4DLFA 2CZDA 4DXVA 4AFYA 2RHGA 5G1MA 4BHYA 4HHPA 1YPFA 1TPB1 3UXAA 5C71A 3LCXA 2O55A 2VOTA 1WNOA 1YDOA 2ZXBA 3N9SA 4H7VA 3BICA 1AZ2A 3WK1A 3ZWTA 1V02E 2Z0IA 2YXXA 1K8ZA 4V1XA 2RGMA 1B9BA 1Q7QA 3QQWA 1E56A 3WG6A 3ZFHA 3R8GA 4AHQA 4HSNA 1WXZA 3LCIA 3SW6A 3LHUA 3LQGA 2X41A 4LXFA 1MVYA 1HUVA 3WEMA 1NP2A 1ZJBA 2PDXA 1MFVA 4OOZA 3BW2A 4U2YA 3EDDA 1W9PA 1RQBA 1XIJA 1PZ0A 3KBSA 3IUIA 4JTHA 4GY7A 4BJHA 3M0HA 2WLYA 4UQCA 3EB3A 4F9DA 5ABTA 4E3TA 3TA9A 4W8BA 3NOYA 1FH7A 2PDWA 2WMJA 2VELA 2VL4A 1JPDX 3CAQA 2OSXA 5D09A 3TZFA 3B9DA 2E67A 3CQKA 5D2YA 3DHPA 2C16A 3MUIA 3Q94A 4QG8A 1TKKA 3D47A 2G37A 4WOQA 1GOMA 4CQBA 3PAJA 2V67A 4UUIA 4LUTB 4C6CA 1NFBA 1G94A 1GQNA 4UTFA 2G50A 3QSTA 4Z42C 3BAYA 5A1AA 3REQB 3L5LA 5CBBA 1SFTA 5CC5A 3MBFA 3QY7A 3W28A 3TWAA 1DXFA 5FJUA 1UR9A 4GQ0A 1J5TA 1QXLA 4WCJA 1F3XA 3O7UA 4F66A 1UCWA 1GYLA 2DZUA 3NAVA 4LC6A 2QJGA 3KEHA 4C6QA 2X30A 2Q71A 1NQ6A 4KBXA 3R13A 1EOKA 1EEPA 4H6RA 1M1BA 1XUZA 4FPSA 1KA9F 1V0NA 2ZUNA 3K46A 5MKGA 1JJKA 3CUFA 1C9WA 1A0EA 2QAFA 1P6WA 3N6HA 1SFLA 3S8HA 3USBA 1T8XA 3QOKA 1OINA 3GC4A 2P10A 4IXXA 3SO7A 4GOAA 4W7UA 5LA1A 3QSRA 3EYPA 3W2KA 3N1AA 4KWSA 5F2IA 4LNYA 4Z2JA 1KR0A 2PF0A 2VKZG 3RLUA 1XC6A 2D2JA 2G4FA 4MWAA 2NV9A 1P0NA 1CENA 1E55A 1UP0A 4BF5A 3CZ8A 5ECUA 2C13A 3RIKA 4FHAA 1U5JA 4PH6A 3V7PA 4RXFA 4P5UA 1JZ7A 3PBUA 2RDUA 3EZ4A 1PDZA 1JAKA 1TB3A 4DVOA 3VI2A 1JZ4A 1ISVA 2FZBA 1VBJA 1YRRA 2E77A 2PP3A 3KRZA 1XG3A 2Z28A 3OQ8A 4KPLA 3QGAC 1XGZA 1R8LA 3DCPA 3VIOA 1KRAC 3WMBA 3GDTA 4QLLA 4S3DA 2NWRA 3UJRA 5KZMA 2PU1A 1XGEA 1W3NA 3PS7A 4PUKA 4F0HA 5JIPA 5CJMA 3RJYA 4CLMA 2J47A 3H70A 3M0XA 2YCKX 4IFKA 3KZPA 3MUY1 4XKYB 2VFGA 3G6LA 2FTYA 4O28A 3TC6A 1GOIA 4IH3A 2VNCA 4D1IA 1B3XA 3KWXA 3RU6A 2WNWA 2YBTA 3PZIA 3NQEA 2CKSA 2YCLA 2QNEA 3H53A 4MPKA 1QK2A 3A64A 5MKGB 3WN6A 5EBAA 3BK0A 1G01A 4AIUA 2RJHA 3BSGA 4B90A 1KW1A 1DIDA 3BG3A 3SUTA 3NO3A 1FA2A 4HA0A 3UR2A 2DFAA 3SQLA 4DO7A 1K6WA 3QMTA 1X8FA 2CEQA 1KBIA 1VBUA 2E6FA 3APGA 5K9CA 4N4PA 1M7OA 3MI6A 3WNLA 1UB3A 3CPRA 4P7LA 4MWAE 1IZCA 3RR4A 5LGXA 1BF2A 4PRTA 2A6LA 1K7FA 5C55A 1ISZA 1SQ7A 2WC7A 5BRQA 2I5GA 5HOSA 1KCKA 4A29A 3A23A 3GRIA 1WUEA 2WVSA 1XLKA 1RLDA 4L6HA 2IXUA 3CB8A 2BVYA 3DFTA 1A5UA 4JTCA 3EX1A 2DU2A 4MZ1A 3TKFA 1TMQA 2MANA 4IF2A 3HG4A 3QV8A 3TN3A 1US0A 3ZS4A 2VZVA 1MW1A 1C29A 2Z1XA 1A5SA 2WM1A 1H62A 1CX9A 2BTMA 2G95A 3CL8A 3AHZA 1AVAA 4JHOA 3WF2A 3LXBA 1V6XA 4LBSA 3RLVA 4YHGA 2ZXDA 1UR3M 3W81A 4IIGA 2B81A 3QTPA 4WZHA 3URBA 5TBOA 4FNSA 2IW0A 3JS3A 4DBUA 3APYA 3WJWA 3VNJA 1WKEA 1E40A 7XIMA 3AZTA 1PZ2A 4RNFA 4AXNA 1H1ZA 1UYQA 5CSYA 3VIIA 3MP5A 1KGXA 2F7FA 1ZAIA 1YTEA 4IMAA 1ZQ5A 4KQNA 4N6FA 3GTHA 1PAMA 1WDRA 2AGKA 4C6LA 2B7OA 1D2KA 2EPKX 3COTA 2XIJA 4WGXA 3A22A 1A5LC 4M5PA 3CQJA 1MW3A 3S2MA 3WDJA 4O16A 3VKJA 4AF0B 3L4VA 4GHRA 4UQAA 3FA5A 4HB7A 3BGAA 3GFYA 4B5NA 3LLFA 5LIYX 1REQA 2PS2A 5ABGA 3U4AA 4US5A 2C3ZA 1KWKA 4JN7A 3S5OA 3C0JA 1SJAA 4NRRA 2LLEA 5J8LA 3LM3A 4ZOCA 1D7FA 2QDDA 2WV8A 2CLLA 3FJLA 4EXAA 4R3UA 1UD4A 1R7AA 4EVZA 1HXJA 1Q6QA 4R85A 2A3AA 1VFOA 2YCLB 3GNPA 4XZNX 5EMJA 3FA3A 4KIEA 3OU8A 5I5RA 4MNJA 2QUTA 1K9EA 3A6OA 3SUUA 2QF8A 1H7OA 3DFYA 2YXGA 1G67A 3S9IA 3ZOAA 1LQAA 1AK5A 4DUXA 3WQVA 3FEQA 4K2SA 2FFCA 3WDRA 3I65A 3W1AA 3W2LA 1SSDA 4ERGA 1VFFA 3OVGA 3SJNA 4MKVA 2VVNA 4IJRA 2R1LA 1UPPA 1JFXA 1JFHA 4GQGA 3BARA 4RL3A 2OTDA 4GVIA 4J3ZA 1H61A 3LNPA 4ICCX 3JR2A 4NZ1A 1ELSA 1LRQA 4NL1A 4S2BA 4EAYA 3ZQ9A 1IYXA 3GFZA 4AHPA 1F05A 1F2JA 1QTWA 1TSIA 4B3ZA 4JGDA 1UG6A 4A05A 3OP2A 2V3GA 3AS2A 3W7NA 1JCNA 5DY2A 1TQXA 3IEBA 3BWWA 2BWGA 2P3EA 4QSHA 1GT8A 2OOGA 4H8NA 4OV4A 3RJXA 1PKNA 4AISA 1GVFA 1FH8A 4WDXA 1G4SA 3LI0A 3QYSA 2ISWA 4RCXA 4HZ7A 1BGGA 5EY5A 1OX4B 2ZZ7A 1OFPA 3P62A 2XIQA 2WSPA 1TJ1A 1ITUA 1LL4A 2GGJA 4RK8A 3LGEA 1VF8A 5BWAA 2VC7A 5LNRA 4AZIA 1X97A 4OE7A 3B97A 3WO8A 1LRTA 1TRDA 3CHDA 1AMYA 3N6QA 3W01A 2F9RA 2VURA 5A8NA 3K4WA 1VYPX 3GK0A 1H7NA 5AZ0A 5AB3A 2WHKA 3PZVA 3H6OA 2J7FA 2J77A 4MUZA 3GE7A 3K8LA 3BSHA 2A0NA 4I9AA 4PCSA 2EEXA 2QV4A 3F5JA 3WD3A 5FF0A 3RCNA 1OBAA 4IG2A 4TVDA 3WK2A 4I6VA 4EX4A 3GH5A 4FX7A 3ATZA 4C7GA 1TVLA 3L4XA 4ZTXA 3LMYA 1QCWA 4PZVA 3IS4A 5DCDA 2YZRA 1RH9A 3HURA 1B4KA 4ML9A 1GOQA 2VQTA 1VIWA 4U10A 3W84A 4AVNA 4EE9A 1W6TA 2TSYA 3RILA 4WDTA 3G2GA 4XAYA 4D8LA 1EHAA 4FSAA 4WJEA 4XB3A 1FWEC 1LJYA 3AMLA 1V6WA 2ZRXA 5T9CE 1LYXA 1QFEA 3WL0A 1L8NA 7A3HA 1HVQA 4CNNA 2WHLA 3IACA 5D9PA 3C0LA 2O92A 5LYRA 1UIPA 3LNMA 5AVNA 1CXHA 1N55A 3MA8A 1AQMA 5L9FA 5D03A 3OVRA 1CGTA 2A5HA 4QEEA 1Q63A 1IEWA 4RZ4A 2D0FA 2J4GA 2WZMA 2WJEA 1QI0A 1XR2A 4Z0JA 2I57A 1TV2A 2XVKA 2PGRA 2UWFA 1MQQA 3SADA 3CH0A 4O8RA 1CGWA 2PLJA 4GRSA 4H19A 1XD0A 3CZGA 4ES4A 4C6JA 1NDYA 2V2CA 1JDCA 3ITVA 4MF4A 3G6MA 4ZEPA 3I3DA 5I78A 5FEXA 1XDJA 3N12A 3B8IA 3G1RA 4NZCA 3E74A 4ZODA 3ICJA 4RXGA 3U48A 3P7YA 1ITXA 4LANA 4MFDA 4G6CA 5JBEA 3QBUA 3UBPC 2DT0A 3N34A 4NAFA 3LLXA 2IKIA 3IJ8A 4LAKA 2V2HA 3SCVA 5I07A 2YCEA 3CTLA 4PL2A 3IAQA 4DIAA 5REQA 2H9AA 1U83A 4UQDA 4GYPC 3M7WA 4L1GA 3QZ6A 2ZVRA 4IMCA 4NAEA 4TV6A 4HT3A 5CSUA 3S5YA 1JYWA 2DZAA 4KS0A 1JUKA 3HGRA 1JZ5A 2YXOA 5I7GA 3P74A 3RHGA 3RAOA 2G8ZA 4CNUA 3DFHA 4GUFA 3VXGA 2CWXA 2X2GA 2AMXA 5T26A 1JCMP 1QAPA 1TV7A 1PKLA 1QVBA 3M16A 1W1ZA 4HU3A 2REQB 4O54A 4QAIA 1E4MM 4MZYA 4OECA 1IGSA 3GYEA 3UYIA 3SFWA 4AG0A 3MW7A 4TIMA 3SN4A 1LQ0A 5AN7A 2NLIA 3WF0A 4DLMA 4PEEA 3O05A 2FH6A 3B8DA 1M65A 2GOUA 4Y8FA 4D2JA 3WQWA 4NX0A 5K7JA 1FFQA 3B06A 1K9DA 3LV5A 4Z2HA 1XLLA 1RP9A 5EMKA 4C6BA 2HPMA 5FF4A 5KINA 4XKYA 2OLAA 3SCRA 3LA4A 1DQWA 3XISA 3B0UX 1PX8A 2NV2A 4I7VA 2ACRA 5FF2A 1VIZA 4QGCA 3O0FA 1XPYA 1W2VA 4EWND 1WKFA 1KGUA 2KZHA 3ARYA 1CECA 4NIRA 3R5EA 1L6WA 1SO6A 5LHEA 3TYCA 2PP1A 3R8HA 3HTWA 4IPIA 3AROA 4D71A 4Y96A 3TTSA 2J62A 5D37A 3WUEA 1CXFA 3LTSA 2Y8UA 5K4XA 4RNJA 3WD0A 1DHKA 3EX2A 4JIRA 4W5UA 3LCGA 3TJXA 1UOKA 1ITCA 5F1VA 3P0WA 5U4NA 4MG4A 4LCSA 1GWJA 1SW7A 1JZ6A 2DY3A 1J6OA 1FOBA 4CVWA 1UUMA 4PMVA 3VKBA 4M29A 4Q8VA 4XO6A 2PDLA 3GC2A 3VGHA 2NQZA 2P5NA 3MKCA 3S4TA 3CT7A 3UG3A 4AU0A 4Z2GA 4ZOEA 2BODX 4PSPA 4A2SA 1FY6A 2DZBA 3B03A 2R1NA 5A2AA 2Z1BA 1W91A 4HZ8A 1QI3A 2ZUTA 4ZA0A 3NQAA 1H7PA 1UHVA 3W6LA 1R9YA 2FH8A 2E5DA 2WJFA 4JTJA 1KQYA 1W3HA 3TXVA 1W1YA 3TYBA 2HVMA 5AYXA 2QYGA 3U2EA 2V63A 1DHPA 3KBWA 4YVXA 1TVPA 4X61A 5M17A 2POTA 2R82A 3GXIA 4LALA 1TVNA 5RUBA 4EF9A 1Z44A 4L4PA 3UG5A 1KD0A 3LCFA 4DJEA 2G41A 1JI2A 1VYSX 1Q8JA 3S6DA 3A4AA 2ZKMX 4YTSA 2CBVA 4RLIA 4H04A 3V1PA 1AH3A 4RPQA 3S83A 3DOPA 1O95A 4AD2A 2V82A 1G4PA 3LTYA 1BYAA 2PDJA 4GO8A 4PMUA 2H3DA 1YX1A 2YDQA 3TXZA 3WQGA 2FLIA 3NL3A 1XDLA 2E28A 2GJNA 2I14A 4MLRA 2GWGA 3PZNA 4LH8A 1LZOA 3O2LA 1JZ2A 4YHEA 1DWHM 2BHYA 3H4WA 4HMCA 1RPKA 1KTBA 4O50A 3CXOA 2NUYA 2VC5A 3TC7A 3DFOA 1EYWA 1FDYA 3N2OA 4G7EA 3WD1A 5XINA 1EJUC 3DC0A 3WNMA 4DO5A 2QDHA 3MI3A 4H8UA 4P7QA 3RGTA 1R3YA 3CPGA 4L56A 3DC8A 4E2VA 4V1YA 4IGMA 4HK7A 3MCOA 2ZZ2A 1SSGA 3P3BA 2AAAA 3WL1A 1RK6A 1ZPTA 5LIUX 1JNDA 1SW3A 2GVEA 1VFTA 4AEEA 4NT0A 4XKMA 3OLDA 3PPHA 3S1UA 2BGQA 4N4QA 3W87A 3SCTA 2PGFA 2POZA 3OOQA 3L7RA 5I23A 1N2VA 1GVEA 2GQ8A 2OO6A 4W8AA 2NT1A 4YVVA 3BW4A 1EJTC 2D0HA 1EC8A 4AD1A 4CD8A 4GXWA 2V8ZA 3NWRA 2GQAA 4LTSA 2PWGA 5CPLA 3W82A 1VFUA 2VRQA 1FWTA 1ZRQA 3MKKA 3SFKA 3NIYA 2WSQA 3MMWA 1FCUA 4KFNA 5G2IA 3RLGA 4LOCA 1KBLA 3K30A 4X2PA 1T96A 4A8RA 2EXOA 1LUCA 3B0YA 1KR1A 2VX6A 2WPGA 4A6GA 3W2MA 1K70A 3FXYA 1TX2A 2PTWA 2Y62A 1RJPA 2EGZA 3TN5A 1BYDA 1LROA 1F6YA 2YDRA 3TEVA 3BJFA 3G77A 3ARQA 2CHNA 2GUBA 3O8AA 3CWHA 3NQBA 2FYMA 4RNIA 1IQ8A 3A24A 3UWYA 1L8PA 3LDVA 1A3XA 3VKKA 1VJZA 4U33A 1H1NA 1RCOB 2NXHA 3G3DA 3ITYA 3PTQA 2OWWA 9XIMA 1FWNA 5E0KA 3TNBA 4O0KA 3DBPA 3VX1A 3N15A 4Q3MA 1H4PA 3EKGA 1SJBA 3Q65A 1XRSA 5H8UA 1V51A 1ZBWA 2Z1KA 4PRRA 1XCWA 3ZWSA 1J0IA 3GNRA 1OYCA 5H2ZA 1S2AA 4CNOA 5BMWA 1YE4A 4FXFA 5HMFA 2YKKA 2GOKA 1ECQA 4LB3A 3L4YA 4S3BA 1B9ZA 2WPBA 2JALA 4J3TA 3V0SA 4JY9A 3LU2A 3S9YA 4WSHA 1ZCOA 4IG2B 5D30A 4YNGA 1GGOA 1X39A 5I24A 4L7ZA 5AECA 4WKHA 3B8SA 4K8GA 4CNPA 1KFKA 2PUZA 3CU2A 3GIQA 1MZHA 1GZGA 4B4HA 1VLIA 1OX6A 1A5AA 3W2JA 4HYVA 1ME8A 3SY8A 5CQ1A 2CLFA 3W7OA 3ZSSA 4DELA 3CLWA 4J7RA 5HJLA 1BVZA 3P80A 2EO7A 4LX4A 4GY1A 2FZDA 4GLEA 2ISFA 1IT8A 3FSUA 2PFHA 4CCEA 1KB3A 3EOEA 4UR7A 4TX9A 3PM6A 2G3NA 4LV9A 2HK0A 4DBWA 4KF1A 2DW6A 2DZTA 4YPJA 2WVVB 3CHVA 2ZZ4A 4LVDA 4GCAA 2JGQA 2NQHA 2WJDA 1UKTA 5I00A 4BY3A 2J75A 5I3DA 1ISXA 1UR8A 4N9CA 4Q7IA 4UMBA 1Q4WA 1MWOA 3ZLFA 4TTGA 1A5MC 1JNEA 1G69A 3KFTA 2BHUA 4CQ9A 1DXIA 3P61A 5CSSA 4GUIA 1OHLA 1R47A 4ZO6A 4GIEA 2J79A 1Q6OA 4KGLA 3NZRA 3NZPA 4YVPA 3CUJA 4MSSA 4EPEC 4LS0A 3DX5A 1MXSA 2HROA 3GLCA 1GVYA 2UV8G 3HQNA 4MADA 1N8FA 4JICA 3OBKA 3S5SA 3GW0A 2F8QA 1BEUA 1U5HA 3TN4A 3KBVA 4N2YA 3V0UA 3UGVA 2WZEA 1JDFA 4DO4A 3DERA 1OVDA 5CLWA 3G1VA 3FY1A 3WMSA 1UWTA 4ONVA 3MCMA 2WWDA 3LPPA 4JAWA 3KCJA 4ERAA 3ITGA 4JQ1A 1MUWA 5K2ZA 4ATLA 3LZ5A 2HCVA 1OC6A 1XV8A 1NQKA 3H22A 4AAJA 2G3MA 2VDHA 5CSRA 3S1VA 1EDTA 1W2PA 4GYFA 4JR5A 2C1IA 1A0CA 3I4KA 4XSMA 2REQA 4O17A 3UU0A 1AH4A 3GHTA 3RM4A 3W38A 3TA6A 4KEVA 3VOCA 3ZLGA 3CBWA 4JKMA 3FVMA 4Z2LA 3TJLA 1I2RA 7ODCA 2E68A 2VWTA 4NNAA 1YNQA 4W88A 5CCZA 3LX9A 2VZTA 1R85A 3ITCA 3APTA 4KH2A 2ON3A 4QRNA 2Y4SA 1REQB 3EDFA 3N73A 1A5NC 2GGGA 3PSWA 4ZFMA 3GTFA 5E70A 3KVKA 3DXIA 4ZTYA 3WBEA 1KCXA 4WJXA 4KEUA 4IIHA 3L5AA 3EWCA 1F73A 2E40A 2VC6A 4GZEA 4L6OA 5AC6A 3TCEA 1ZJHA 3EKZA 4WGHA 3NM3A 5D8WA 1Y8BA 1S2CA 3GTNA 2B31A 2GVLA 4XVDA 5GQBA 4AHOA 3A47A 1W5MA 4F4RA 4NZFA 1MEHA 4PA8A 3S1GA 3BGJA 1WYIA 1XHGA 1ONRA 3GFXA 3HJEA 1FBAA 1LF1A 1FX6A 2PRHA 4H9ZA 3IK2A 1HW6A 1AQHA 5H91A 2Z6JA 2HE8A 1XS2A 2AKZA 3LS9A 2H8ZA 2BV9A 3F1QA 1UR0A 4ZB2A 3SY5A 4TX8A 3L66A 2BNJA 3LY0A 3QOMA 3BLEA 2PPGA 3LENA 3EOSA 2ZUSA 4Q7NA 3ARVA 4DO6A 2ZA2A 3B9EA 4EXBA 4D6JA 4R5EA 4H6EA 2X2YA 4ADTA 5M5DA 4B16A 2ADAA 4BI7A 2WW5A 4LNCA 3UR5A 5DX7A 1KXTA 3QGVA 1NOWA 3NPVA 3R6IA 2WO5A 2HJPA 4H2HA 4ZB0A 4AZHA 4L4MA 1PXGA 1DQUA 3M0KA 5FJTA 2Z29A 3CYVA 3UCCA 1ZUAX 1FHDA 2OYLA 2JEQA 4H6QA 2QXWA 1H09A 2CZ5A 4MHBA 4C6EA 3CQ0A 4Z1YA 2PC4A 3G1DA 3TU9A 4ZL1A 5EB8A 5JBFA 3O9NA 1H7XA 3BTNA 3VDAA 3MBDA 5DEZA 4FOKA 2INEA 4JTTA 1LORA 2W91A 4MB4A 4CCZA 2D22A 4DX3A 3IJ9A 1GVRA 4PUJA 4IIFA 1S5VA 4Q4RA 2F2KA 4A8LA 2HPIA 1X38A 2VFEA 3VINA 3VNMA 1Q2RA 3T6CA 2HSAA 1LLOA 3SAZA 2PDUA 3UYCA 3W1RA 4PBFA 4UR8A 1E1EA 1W5OA 2ZDRA 4CEUC 3NOEA 4KESA 2V2DA 5DY3A 1MXGA 4JHZA 1F7BA 4UTTC 2R1PA 3QC3A 4M81A 5A6BA 5HNNA 2UY2A 2WOQA 1BPLB 5GNZA 2IPWA 5KETA 5C2CA 3N2CA 4NF7A 3UWUA 1HP5A 1XYLA 4IFRA 2GL5A 4MYAA 2YL6A 4HSHA 4QLJA 1F9CA 1JG9A 1SFJA 3L5MA 2YLLA 3GXPA 1TREA 2Q8LA 4JNMA 1TIMA 3AXHA 4C7DA 1KGWA 2VDIA 3CV1A 3E02A 2RDXA 3IPWA 1WDDA 4WXYA 2ISSA 4N7QA 1J4EA 4AX6A 2YA2A 3BZGA 3NCOA 2O7SA 4R9XA 4B4FA 3SGGA 3HQOA 3F5LA 1SZFA 1F61A 3BAKA 4AWEA 1M41A 3CUZA 3HV8A 3ONBA 2QKFA 4JIQA 4M6PA 4DJDD 3NO5A 2B7PA 3AS3A 4MWAD 3WLOA 1TZ7A 1B2YA 1RXOB 3TYAA 1W3LA 3NSNA 4KWVA 3EDEA 2OWXA 3TR2A 2OZ3A 3DYPA 1IZKA 5CBJA 2CCRA 1FWIC 3WDHA 1XBVA 3L65A 3L4ZA 2IQDA 1E9YB 3WBYA 1RSCA 4G56A 3TJIA 4E5TA 3QLDA 2X7VA 4JEJA 3VMNA 2DZPA 4AY1A 2B7QA 1MW2A 2OEKA 2QAPA 3UR8A 1AJ0A 4GC4A 4U31A 2EPMX 1J11A 1K9TA 3PZUA 4H9XA 2PWVA 1XUUA 3BE7A 3LHWA 1HFBA 1RD5A 4IMEA 1W9VA 3EWXA 4IT1A 3UZXA 3TK7A 1DORA 3T9PA 4H9MA 1JCYA 1NTHA 1V3IA 4NJJA 1H5VA 1UWQA 4MM1A 4XISA 1Q4NX 3C2YA 3OYZA 1EDGA 3ES8A 4QCEA 5E5CA 2NUXA 4HA4A 3T42A 1RP8A 1SMAA 3C0SA 1L0PA 5BRBA 3U5YA 5CZJA 3E2QA 3FIGA 1P1MA 3UQNA 3KTXA 5HINA 2VI0A 4NI3A 3FFSA 3PUOA 4CGTA 1ODUA 3VNYA 4LVFA 5AHNA 5M2FX 1K02A 3NTYA 3N04A 4WD0A 4C6MA 3PB2A 2AMGA 4U2ZA 2ZXQA 1BWVA 5M1TA 4GD0A 2GSEA 3OZYA 2C15A 3LG3A 3TQKA 4DNHA 4MB5A 5I3JA 2W92A 4HMEA 5DXYA 1NDWA 1YHTA 3GHUA 2FKPA 3EEGA 3ZM8A 4JYFA 2CETA 1PTDA 2RDTA 4H6KA 4YWSA 4MUPA 1WKDA 3AHTA 1XGDA 2XVNA 5D2XA 3E2SA 1PPIA 3CZKA 1ZGDA 2VX7A 3WNNA 3GNNA 2GGHA 4PMQA 4ZO8A 3M43A 5HNRA 4B5VA 3GTIA 4OJYA 2YYTA 1FDZA 1UA7A 3F4VA 4JX5A 4ZCWA 2PDYA 1Z6KA 1PTGA 4O0ZA 2VVSA 4R88A 4CD6A 1I2NA 3G5EA 3IJIA 4GMEA 5EMMA 4HJFA 2XN0A 2CBIA 4GJJA 2NLYA 4LUYA 2ZC8A 5A3HA 3FA4A 2AQWA 1MYRA 1OFRA 3LCLA 3SRHA 1UBSA 3VCNA 4WY0B 2BOEX 3IARA 4TMCA 2DIEA 2R8WA 3G0SA 3GX9A 1X6UA 4V15A 4H9TA 4OBSA 2Y1HA 3IIPA 1P0DA 1V03A 3GVVA 4O13A 6REQA 3CAWA 1R46A 3RXZA 4HBKA 2INZA 3W1XA 2NQ5A 4S3KA 5H6HA 3MHUA 4U5KA 3VGEA 1US2A 3MTWA 2E8YA 1L2UA 1IR1A 4GISA 2CXEA 4GYPA 4JTUA 3UGRA 3IGXA 1OQFA 3L12A 5D8ZA 4YLWA 2QV5A 7TIMA 1JPMA 4LRSA 4CNTA 1Q3NA 4PTMA 1W5QA 2NW0A 2DZVA 1GJUA 5DT5A 3O6AA 2BLEA 2JGYA 5A8PA 3W02A 4FZIA 4MB1A 5HJXA 3VOJA 2QCHA 4E4PA 3ECQA 3DGBA 1BWLA 4Q7BA 4C1NB 5F2GA 5IBXA 2XH0A 4IP5A 2G97A 4LCQA 1XX1A 1R9XA 4UMCA 5HBFA 2W67A 2BVTA 2IPFA 3G0XA 3RM9A 4LEQA 3UWWA 3T2QA 3UXDA 3TAKA 1CW2A 1R2TA 1TPVA 1DP0A 1ZNNA 1W9XA 1B3OA 3MMUA 3P60A 4QDPA 3UXIA 3GG8A 3NUKA 4KMQA 1V93A 3LSBA 4EIVA 2YW4A 4CN6A 1FHUA 3QF0A 2YB4A 3QY8A 4MDOA 1Q8AA 1RCXB 3BJTA 3VNIA 3LRMA 1ADDA 1OSEA 2W3ZA 3QV7A 3KBMA 1QNPA 4E8GA 1LLZA 3OEXA 2WCGA 1BLIA 4Q8QA 1XIHA 2Q3OA 4UTLA 1YTKA 3TFXA 1G7VA 2DUAA 5CGQA 5LSMA 4P7OA 1OCNA 1XLIA 5TNVA 3EDKA 1ADOA 1JF5A 4ZZ9A 3WF3A 4DWSC 3CO8A 3GSMA 1VC4A 4ZQOA 4CU8A 3OQEA 1JULA 3RFAA 3PJXA 3EWZA 3U6WA 4F3HA 3ALGA 3T44A 1H3GA 3PNZA 1BRLA 2INFA 3UY8A 4ZQRA 3NA8A 1DXEA 3N14A 3GZ3A 1SMDA 1MMFA 1UZHA 4K1GA 3F2DA 4HNCA 3HGSA 5JIWA 1TPDA 4XK2A 4IIBA 5DELA 4HHMA 4U5IA 3CEUA 3AWOA 3WDPP 2HNHA 1O60A 4JNYA 1Q6DA 3AIRA 5HDRA 2MUCA 3HFYA 4E2BA 4ZQMA 1O5XA 3IK4A 4HYWA 3T2PA 4F9JA 4IL2A 4AWUA 3QEZA 4WUIA 1MQPA 3RYSA 3D3FA 4D6IA 5IBXC 5FJRA 3W1LA 4FEZA 2WMGA 3S2LA 1EIBA 4U28A 4E0CA 4S23A 2PCEA 2ZX5A 4Z08A 1LG1A 2F6KA 2X16A 1V7YA 3FLUA 5A8GA 1VKFA 1RBAA 2FJKA 1WAWA 1F07A 2Z1SA 1OD0A 2OSWA 4IFKB 1KM5A 4AZ7A 4EOUA 3DDMA 5AC7A 1J01A 1X1NA 3OLGA 1JQXA 1OJXA 4JTEA 4PMYA 1PX3A 1NWSA 2DSWA 2WHMA 2BVWA 1UMLA 1HL8A 4DJDA 2ACUA 3L9CA 5G2WA 2C1HA 2NWSA 1RK5A 3RN6A 1J0YA 5E6YA 3VC6A 4RDVA 3WDIA 1VPYA 4A2RA 3EMCA 3MDWA 4HZ6A 1GQKA 2QDGA 2OO0A 1EEXA 4QNWA 3EKLA 1VGAA 3M1ZA 2AQVA 4FNQA 4WJ8A 3NQ7A 3EMQA 3CMFA 2QT3A 3GDMA 4C6FA 4UFHA 3PPFA 3UA4A 1AODA 5D2TA 3GU9A 3CZLA 5HWJA 1EJ7L 3RDKA 2DSVA 4XV0A 2ZFAA 3BO9A 1NAL1 1TV4A 3G1FA 4X0NA 3HV9A 3HG5A 3UWEA 2WZIA 2QGHA 4LUSA 2GGIA 1RVKA 1BTCA 1W1B1 1AW1A 1C9DA 3NDOA 4FNRA 1NOUA 1GQIA 4J3WA 5G1YA 1JGIA 1R30A 3H55A 3N25A 4RPPA 4TR9A 1V3HA 1LT8A 4PEKA 3RK8A 5J04A 1SM9A 5HWMA 2YYUA 4JTSA 4DUOA 3W71A 4AMAA 1E9ZB 4HK6A 1MSSA 2FDSA 3OVQA 1VCGA 2J7CA 1POJA 5A5WA 1W37A 1VBRA 2IKHA 3QV9A 5XIMA 2H90A 1K7XA 5EMLA 4ZB5A 3T8LA 1XLCA 3WNPA 1MQRA 3PUGA 4JTLA 3AJ7A 4DAFA 4JTKA 3N19B 3TAOA 4WQ6A 3LQLA 1KTNA 1B30A 2X8RA 4W89A 1ODZA 3U4FA 2OMAA 1JDDA 2HNEA 2DT2A 4OU1A 3U7VA 1K8CA 4O12A 2HEJA 4UCGA 4LYRA 1QI5A 4PUEA 1TWWA 4ZO9A 3WJSA 4Q8TA 3NQVA 4ZXLA 1CTNA 1KV5A 2VHLA 2OELA 2CLOA 4OT7A 1GHRA 1OIMA 1V3LA 1RHCA 2H3BA 4EK7A 3D6NA 4ERIA 4GUGA 3PHAA 4F0LA 4WX2A 3IV3A 4XIAA 4HU4A 1LWJA 3OVPA 4GXMA 3W1TA 2PDIA 3P5ZA 4GPNA 3UCDA 7PTDA 4AY7A 4NKCA 1O4UA 3WUBA 1LDCA 1E5JA 3XIMA 4GG9A 5CPOA 3KZSA 3B04A 1NWUA 3KP1A 1A0DA 1B57A 2JKEA 3SGZA 1QW8A 1EBGA 1GOWA 2F2HA 1O5RA 2D3LA 4K39A 2ANUA 2FIQA 3W74A 3WUFA 1UZ1A 3MU7A 2GJLA 3E2VA 4XIMA 3L21A 3K13A 3RITA 2TPSA 5FOOA 3MKVA 4CD4A 3RF9A 3PBWA 1ZHAA 3LCWA 5A95A 5CGTA 1CYGA 1JR1A 4I5XA 2QUVA 3CAVA 2JFEX 3VMPA 2FDMA 3B4UA 4KEZA 1AA1B 1AUSL 4PFMA 4HP5A 4GZ7A 4MKSA 1VQTA 2Y61A 4RDYA 3DFSA 4Z1AA 3G0UA 2HTMA 2VEMA 1VAHA 4Y9OA 5J5RA 3IUHA 1JPHA 3NNTA 5BOFA 1TCMA 1QNOA 3UG4A 1FWHC 4AZCB 1LL7A 1CLKA 3W2NA 5FACA 2QIWA 3R0UA 4KWUA 4J2PA 1SGJA 4RNHA 4LYPA 4AWTA 2FHCA 4GFSA 3EWDA 3VC5A 3HU7A 3MUCA 3CH9A 4HA3A 1EHNA 3DESA 3TUUA 2CZFA 4K37A 3G3MA 1ICQA 3WYZA 1Q85A 3VK5A 3I6EA 4CCDA 3SRFA 2FB3A 3BANA 1UWSA 1XG4A 4GABA 4M51A 4JX6A 4IMDA 1QNSA 2CYGA 3TLQA 4ATWA 2XWEA 4S39A 1BQGA 2ZX7A 1W0MA 1KFLA 2A2IA 4DN1A 2DT1A 3EPOA 1P6CA 2SFPA 3FK4A 2UBPC 5CJNA 2QJNA 1IE7C 1UJQA 5IDIA 4W84A 2VCCA 1PDYA 1IEVA 2Y2WA 2ZADA 2CBJA 3W7HA 2PD5A 3QFWA 3SN0A 2YW3A 4OWGA 5A6AA 1QBBA 3MWAA 4A4AA 5LXEA 4WSKA 1LL6A 4JFSA 3RMJA 1X96A 3BLIA 4UNIA 4DJED 1NDVA 3MO7A 3BCJA 1DBTA 1Q13A 1EO7A 1A4MA 1G0CA 3EBVA 3SCUA 3S2CA 3AMGA 2Y5JA 1VBHA 3VIMA 1NDZA 3P14A 1A47A 1XKJA 1OCJA 3V5OA 3TONA 4D8AA 3WF1A 1S2TA 3WLNA 3N2XA 3TMQA 3OYXA 3DAQA 1J96A 1XH2A 1W1A1 3BMVA 4DYJA 3N3TA 1X98A 1KLZA 4EWJA 1VJIA 3PWGA 4QP0A 3QZAA 1I0DA 3FXGA 2E6AA 4FP1A 1S2UA 3PTKA 3A13A 4IP4A 3W27A 3NVDA 4K36A 3GQYA 4BI6A 1T41A 2EF9A 1KTCA 1PHQA 2EPHA 5I02A 1K4HA 3L0KA 2FTPA 3I4EA 4NY2A 5GVJA 3RR1A 1T8QA 1C8XA 4HKPA 2CXGA 4DZHA 4E4UA 4KRUA 1S5TA 4JBRA 5HPOA 3QW3A 1NM9A 4DHGA 1MNZA 3A9IA 4B3LA 1YBQB 2QJIA 3U7BA 5KZDA 4LQ1A 1QNRA 4Q8NA 4O1DA 1XBYA 2WC4A 2W6RA 3URNA 4XG1A 2VD8A 3THAA 3H2EA 5PTDA 4F2UA 3L4TA 1J0KA 2XSAA 1UPMB 4PUUA 1KXQA 2GK1B 1GK8A 1YYAA 4FX8A 3E3HA 4FO4A 1JZ8A 3ABQA 5F2MA 3MUZ1 4ZFCA 4S3GA 1JD7A 4ZXOA 1V3KA 1HKWA 2OZTA 3VCCA 3W2UA 3T0AA 4U3CA 1AJ2A 2BOFX 2O9PA 2E8ZA 1RZMA 1VBGA 2QPUA 4Z1CA 1UKQA 3TN6A 3L4UA 3VD7A 1RD6A 1F74A 4NQ1A 3W76A 4NU7A 2PURA 2FPTA 1DJHA 1HJWA 5AHFA 1H2JA 3EB2A 3P8JA 4Y8EA 2XIOA 4DQWA 4AIOA 4G7EB 4AZ6A 4H9UA 2XN1A 4BCEA 3DFQA 4ZO7A 3DUGA 1E6PA 1R9ZA 3W6MA 5BRPA 3QHOA 4C6PA 3PZOA 1VLWA 3EAUA 3WLPA 4HIBA 5LIXX 3E0FA 4UR9A 2YJQA 4FLRA 2GZXA 3K1DA 1EL3A 2QR6A 4BEQA 5DMYA 1FVPA 4GI6A 1GVIA 4REQA 2WJZA 2HDJA 2JF7A 1JUEA 2DIJA 2R94A 2OGJA 5CZSA 2VQUA 2YB1A 3E6EA 1IR2A 1FCVA 3S46A 1H7RA 3P67A 3W07A 1ECEA 1LCOA 5AYZA 4PULA 1D9EA 5A6TC 2P76A 4Z0SA 3MCNA 3AIEA 2DH3A 1LT7A 3UNDA 4J3SA 2Y7GA 4YS1A 1YADA 4MPQA 1HN1A 1PKMA 3WF4A 3T0BA 5CAHA 4O18A 3Q67A 1W8GA 5BROA 2XZ9A 4IP7A 1IXNA 8XIMA 4DJFC 2XFYA 3AYVA 4GYJA 4QNEA 1CGYA 2D24A 3NSMA 5F1UA 1IIHA 3O6CA 4I9TA 4AVOA 2C6QA 1ICSA 4H3DA 5TD4A 1T6MA 1EIXA 4KRTA 1US3A 3CHFA 3C3NA 1XBZA 1XM3A 3PULA 4MVAA 1XYCA 2JEPA 3SUSA 1NVMA 1GHSA 3R8RA 3RPTA 1OWQA 4L1XA 2ZWYA 1AG1O 3ARTA 1RR2A 2A3EA 3AICA 3PK7A 2C0HA 3KE0A 3VOHA 4KCTA 1HO1A 3ARSA 3HG2A 1WV2A 2GJXA 1E6NA 1UR2A 3V3WA 3L68A 3G22A 1Z69A 1S2WA 2ESCA 1M04A 3VMOA 3FAWA 3VGDA 4FOUA 4IIEA 3LN3A 3WH8A 2YBVA 4C90A 2OLSA 3V5CA 1UZ4A 4D9PA 1OFAA 2X09A 5BOEA 2PLKA 5D9MA 5T91A 3THCA 2EQDA 1KKOA 1PKYA 1FWJC 2Q02A 1TJPA 4PCNA 1ZAJA 4G1NA 4YYCA 2A1YA 1HVXA 2ATMA 1QHOA 4UMAA 3TFCA 4US6A 3W75A 1PB0A 3PWIA 4TVUA 5A6LA 1I6NA 3KS6A 3SEPA 3I7RA 1JRCA 3MSRA 1DOSA 1L2QA 4DJFD 4P8UA 3I6RA 4PUDA 3WJZA 4Q4MA 2GVYA 3OB8A 1MXDA 2ZA1A 3FOKA 4H83A 4Q4KA 4AH7A 1W9DM 4DM1A 2VGFA 1K1DA 2RKXA 3E5PA 5HMDA 4D6HA 5FEZA 1OD8A 4V27A 1UZDA 4FNPA 3ARWA 4PTNA 4P8VA 4PB5A 4URIA 3C8FA 2GGEA 2QCDA 3F7JA 4GIAA 3SM0A 2P53A 2VT0A 3M07A 4XX6A 1E73M 2PCQA 1LP6A 4XZ9A 3S9ZA 3I6TA 1W1VA 5EPDA 2VYOA 1K8YA 1MW0A 2B0MA 4AEFA 1RBOB 3TE9A 5JXQA 1ZB5A 5BXRA 3WQ6A 3W6YA 1UP3A 1H41A 2Y7FA 1OFQA 2QJMA 1RJRA 1OG6A 1XYBA 4ORMA 3PBGA 4QE4A 2VFDA 2ZRWA 4D6DA 1EXBA 1ITQA 1H49A 4GVFA 4MWAB 4QQUA 3ZVHA 4DBDA 2YFOA 3CC1A 2QPSA 3UZYA 5GJNA 3WLJA 1TWSA 3UZZA 1FWCC 2XFFA 3GDRA 1TR1A 1V4YA 3UERA 4INFA 4DRSA 1UR4A 1PX4A 4LCRA 2BFGA 5TAOA 1S39A 1TPH1 4BKNA 4FA3A 3LV6A 1FKWA 3NQMA 1DYSA 5SWUA 1V7AA 1C8YA 5GNXA 1LWIA 4HMDA 5DT7A 1TPUA 2ZZ5A 1WOAA 3S6OA 1LBMA 1BTMA 4F2TA 3LGDA 1WDPA 2XGBA 1DJZA 1PSCA 1WB0A 2RJGA 4IGNA 3PF3A 4B2DA 1QO2A 2VRKA 4AD5A 1E0TA 3LXAA 5D4YA 4GQRA 2XFRA 2IMRA 3UZJA 2V9DA 1W3KA 3MT1A 4MGGA 1BKSA 4IFOA 1CT5A 3V36A 4QJ4B 1XSJA 1KWGA 2YX0A 3QY6A 1OYAA 2PC8A 1XPGA 5LIWX 5DCEA 2YPIA 4B5SA 1RLCL 3DHDA 1MNSA 1NWTA 4QE1A 2UY4A 3KLLA 3KHDA 1LBFA 2WHJA 3OIHA 3DHUA 1GONA 3A3HA 1XDMA 1DE6A 5IXEA 3ARUA 3VFLA 2Y63A 1JUBA 4OUEA 1I8JA 4W87A 1YXYA 2ZA3A 1V6YA 4YMZA 3NM1A 4EPBC 1DQXA 2PD9A 3T81A 2CW6A 5E0CA 5C54A 1KCLA 1TE6A 4JKLA 1Q7ZA 2NQ9A 2ISVA 1XIMA 5D02A 3I7SA 3UPMA 3S2JA 3MSDA 2Y7EA 2ZVIA 3LMZA 4J3VA 2FPYA 2BY3A 2GLKA 1XL9A 4W4QA 1HKMA 2F6UA 1T0OA 2CLPA 1EBHA 3DG3A 4JKKA 4PBGA 1EA0A 4C6IA 5HXMA 3W7JA 4D6GA 4HZMA 3GR8A 4LYQA 4MOZA 1JXKA 1E1CA 1FP9A 1L6FA 4CU7A 3N13A 3GO2A 1FRBA 4ZE5A 2XH7A 1A5KC 2V68A 3HBLA 4KRZA 4P7RA 4S3AA 3FDKA 1C91A 3IJQA 1M9HA 2OSYA 5DQPA 3ITOA 3GH4A 1FWWA 4MDPA 3NGJA 2Q8XA 4W7VA 5FESA 4AF0A 2R24A 4CU6A 2Y5SA 3Q37A 3S42A 3A4WA 3BJSA 3SDOA 1EP1A 2VCAA 2VX4A 5EU9A 4AY8A 3UVIA 5B80A 5CG7A 5JVLA 1TA3B 1V6VA 1HKVA 2OVLA 4C60A 1Z3NA 5FI8A 3SR7A 3ZJ7A 3KVMA 1ZSXA 2GUYA 1X6LA 3W88A 3F4NA 1NARA 1Q66A 1EWDA 3GW3A 2J74A 3PANA 3TV8A 2ZRUA 1OY0A 1OIFA 2JBMA 4DJFA 5KZEA 3IIVA 5F7UA 4Q4QA 4J27A 4N02A 3LSCA 4QFUA 3HQPA 2PU0A 1S1RA 4UQ9A 2C0AA 2QIIA 4DF2A 1TV5A 2BY0A 2P8CA 3CZJA 3LHVA 3AFBA 3TW6A 4B9YA 3ORWA 3GKAA 5CZKA 2PLMA 3CLMA 3O15A 3ARRA 5BWFA 2BOGX 3BDKA 3BCDA 1E1FA 5G5IA 3BURA 2XG9A 5GPRA 2VDGA 4MJZA 4UTMA 4K38A 8CGTA 2CZEA 1RY0A 3CUGA 1PEZA 4L1WA 2TODA 2WNZA 1OM0A 1DTUA 3O3RA 1Z48A 4RE3A 5CPQA 1EJXC 4OUIA 4BQ2A 3HMJG 4QDMA 4NJKA 1CXIA 4JTGA 1V08A 5BYWA 4G1KA 3NL6A 3WCZA 4ICNA 2A85A 2NX1A 1RJQA 4LAZA 3GXFA 3VPLA 1O12A 1J9YA 4M56A 3PN8A 1XYMA 3WLMA 2YL5A 2IQTA 3T07A 1W1PA 3UFYA 1Q2SA 5I3KA 3KCOA 3E1F1 5FF3A 3SECA 2IS7A 1A49A 4DEFA 2E09A 4JFWA 1JYNA 4XWUA 2NZLA 3AOFA 3R79A 3WZ0E 2A6NA 2WKLA 3R4IA 1K4GA 2WSKA 3MQTA 4E2OA 1PIGA 2HXUA 3VTRA 3OHMB 2XHYA 1Q65A 4XBSA 3HIJA 4Q6XA 1E6SM 3BAXA 5A6BD 3PR2A 3VM5A 2YL9A 4W85A 1KQZA 4YWIA 3AXKA 2OOFA 4PCFA 4GGBA 4B5TA 2ODOA 2KAUC 1B90A 4O10A 4QJ3B 2WMIA 4DY1A 1XLAA 3F2CA 1ZS2A 5LNSA 2DT3A 5A2BA 2OG9A 4IM4A 2UY3A 4MLJA 2GVJA 2A3HA 2WM0A 1KM0A 2VEGA 3AJXA 3HGOA 1VPQA 3AUJA 3UD6A 1AW2A 2E1DA 1RBLA 3NZ1A 2FTWA 2PRMA 1GZ1A 3B9AA 2CLIA 3KVLA 3CWNA 3U0HA 4GBDA 4NJGA 2ABBA 3AZSA 3K2GA 1G4TA 4HQVA 3SIZA 2R1MA 1DWIM 4YCPA 3OG2A 2XH2A 4I90A 2BDQA 4JY8A 1TWDA 3FYPA 4ZSTA 1FUYA 1N7KA 2ZX9A 1J5SA 1PUDA 1YXCA 4NJHA 1E5NA 4JCMA 3W86A 1KM6A 3SRKA 5LNVA 2QCEA 4LF2A 4JCLA 1ENUA 3QGKC 3M47A 3MUAA 1U1HA 1OCQA 2O56A 5AHIA 1GYMA 1XXXA 1O5QA 4BF7A 3NJ3A 4FXSA 4A8NA 1P0BA 4CUCA 1KRBC 3UCQA 3BAJA 3F4WA 4GH3A 1WP6A 4UQEA 3RRXA 2DVTA 3RRAA 2ZYFA 2VC9A 4V28A 3AMDA 5HK4A 2I9EA 4OOUA 2PAJA 1UOZA 1UBPC 1HG3A 5DF0A 1UASA 4RE0A 2ZXAA 3NXFA 5DRIA 4DJDC 2Q3RA 3L0NA 3NQ8A 2ZZ3A 1DWAM 2E7FA 4DF1A 3BAWA 2HBVA 3PPGA 4M3PA 4NUWA 1EJRC 2WYSA 8A3HA 4HN4A 3HPXA 3KHJA 2DZSA 1BRLB 2UZ9A 2Y85A 3EOOA 2Z7KA 2XTKA 1H50A 1TPEA 2Z00A 4H8HA 1FQ0A 2XN2A 3WJXA 1XIFA 1I2QA 4BZYA 1K77A 1C93A 1CBGA 3R2GA 4US5D 2ZUUA 5IOBA 4C6NA 5G4EA 3WBAA 1GVQA 3BOFA 3OBAA 2X0SA 2QJHA 2F61A 5AC5A 4N9EA 3RPDA 1GVSA 1CGXA 4I3GA 4QDWA 4GZIA 4AYSA 4L6DA 3FW6A 1I75A 4MAZA 1V6TA 4LS2A 5C9UA 4MB3A 4QS6A 1J6PA 1E0UA 3E9AA 4U3AA 3TTOA 2YA1A 2P8BA 1FTXA 2EG6A 3LBMA 1XBXA 1MDRA 1QW7A 4H41A 1W8SA 1QO5A 4M82A 7REQB 1Z42A 1BYCA 3F4DA 1C92A 1A3WA 2FHFA 3B9NA 2V38A 3QC0A 3W26A 2RH9A 3B0PA 4QQ3A 3VD3A 4HK5A 1C90A 1E4IA 1U22A 3H26A 3VIFA 1B3YA 5LHFA 3QV6A 1GKPA 3GUWA 1GOOA 3WQ4A 3BLKA 1GEHA 4QAWA 1AD4A 1OEPA 3DEQA 3K8KA 2VUYA 1DJXA 4C91A 3VD9A 3ZVIA 2XSBA 4IISA 2OYMA 3NO1A 2VM8A 1AD1A 2XUCA 3G1AA 2C7FA 1YNYA 4HNOA 2YZ5A 4BQ5A 3ITTA 4HOZA 4M1RA 1FP8A 3GZAA 4IQEA 3DN5A 3CHEA 4JL2A 3IRDA 4X22A 2IPGA 3W70A 3W37A 1P6BA 3KDOA 1B3ZA 4OQVA 7ENLA 5CZ0A 3STPA 3BPWA 1YPIA 4QLKA 3GWQA 1UH3A 3VM7A 2QLYA 1JCXA 2XGZA 1CIUA 1Q6CA 3KOYA 3BH4A 1OC7A 3MANA 1HJSA 3FYYA 3VILA 3ANUA 1ICPA 3IUDA 4I7UA 3WBWA 2VZUA 3DKLA 3JW7A 2V81A 1PHWA 1GUVA 1UC4A 4CEXC 3AALA 3IRSA 3DHFA 2Y8VA 4NASA 4Q4OA 1E51A 3OO2A 5JH1A 1GORA 3WY1A 1H0IA 4NXKA 5DRCA 3WFAA 2DORA 2EKCA 3FEMA 8RUCA 2ZC1A 4NHVA 4IUGA 3D0CA 3P84A 3ID7A 3KW3A 1Y65A 2I5IA 4K1WA 4XTIA 5JMUA 2H9AB 1OB0A 3WH6A 1UJPA 3LLDA 1Q6RA 4AVFA 2OQHA 3K1GA 2WVTA 2D0GA 3TROA 2FVLA 2WMKA 1BSLA 2H8XA 5C9RA 3KS5A 4LV4A 1XYZA 1Y5VA 3W7IA 1IZJA 1XYAA 5FEPA 2ICSA 1MEWA 2IXVA 2W62A 2NQLA 3L2IA 4ZOBA 5JH2A 1P0KA 1T40A 4UNLA 4G9PA 1F76A 2X1UA 3I7QA 4I8DA 1H63A 3AZRA 5BMXA 2DQWA 1EUNA 2G0WA 3GDLA 4JZ5A 4QS5A 4HNTA 5EA9A 5E9XA 2PWEA 4IQLA 4AIBA 1PTAA 3AI0A 4MKNA 1JAEA 4FF7A 5C9ZA 1O66A 5HANA 1O94A 1TYGA 2YIHA 1QDSA 4HPHA 1DE5A 4OFCA 4O15A 4B3KA 2MNRA 3AXMA 4GKLA 1C7TA 5JUVA 5A8MA 2XPKA 4LFYA 1XD1A 3WQOA 1FHVA 4Y6GA 1ZTVA 1M68A 3FJ4A 4I8YA 4KKXA 4N6EA 3L67A 5DLCA 2VFIA 3AYRA 1ISYA 3UWQA 4TUFA 5EKYA 5HJYA 3H24A 5D2WA 2Q09A 2J7DA 2BSLA 3EEZA 4NI8A 3GXDA 3H21A 1ZL1A 2CPUA 1TPWA 4O53A 1PZ1A 1JRBA 2XINA 1OT2A 3NYDA 1FWBC 1UUQA 3W7RA 2R9RA 3T09A 4R7JA 3G1SA 1OX5A 3F4CA 3F5KA 1BKHA 3BMWA 4MFEA 1WAUA 3STFA 1NF0A 1DJNA 4RZBA 1S3HA 4UTUA 4HU0A 1EF2A 2R91A 3IAPA 1VPXA 1YKWA 5F2LA 3N2TA 5JQ9A 2Z7GA 1NWRA 3AIWA 4ASTA 2PDNA 4DPQA 3VZYA 3MI2A 1NFGA 3GDKA 4PBEA 1TPC1 2O4QA 1GW1A 3URAA 1CDGA 4JIEA 4HA1A 2E3ZA 2CBUA 1V77A 3NEHA 1M7JA 3KOXA 2XVPA 4P61A 1W1TA 3IIZA 4AX7A 1B1YA 3MUXA 1HX0A 2F6XA 2WNQA 3GR4A 3T78A 3WH7A 3JZEA 4IWWA 4AWSA 1U5VA 5CC7A 4JN8A 1JDAA 5BU9A 3PJTA 3M0VA 1O5KA 1Q7MA 3QM3A 3KDNA 2AAMA 2OCZA 2QCNA 2HISA 1QWGA 2Z2UA 3DH7A 3TJ4A 1X6NA 5CC3A 4D6FA 2FFIA 3M5YA 2QCGA 2QUUA 4JFUA 5LIKX 4IHCA 3FX4A 1E0WA 3NXLA 4NZ5A 3FHQA 4L4OA 4RV3A 2ZUMA 4OGZA 3LYEA 4FS9A 1E6XM 2QUNA 1GOKA 1EFZA 4DUVA 2PDGA 4AW7A 1XCXA 3V1HA 1GYNA 4D8ZA 1SZEA 1Z41A 4IPJA 3BL3A 1CI1A 3TTYA 3W00A 4HPNA 2D20A 1DVJA 1N8WA 3GVGA 4H4IA 3UXLA 1DIKA 4FK9A 1BXCA 1LRNA 3KRSA 3VGGA 4DXXA 5KZ6A 2PWUA 2FPVA 5HPCA 3EX3A 3T4WA 3FKRA 2O7QA 4ZBCA 1MRAA 1J0JA 3BLPX 4UFIA 2NUWA 3BC9A 1U1JA 3TYEA 4XUGA 5CGMA 4JTRA 2X1IA 4LAOA 4ZGYA 5A69A 1KBJA 2VEFA 2PMQA 2VR4A 2ACQA 3BQ5A 1J2BA 1M5WA 3DBNA 3M5ZA 3W7CA 1WUFA 2Y24A 3OODA 3Q58A 3PUEA 3D46A 3IWPA 4LW7A 3RG6A 3MP4A 2V3EA 1BXNA 5I3GA 5C6MA 2WAGA 3TQVA 4GFIA 2J78A 3II1A 2QCMA 4AZBA 4JPGA 1ZJIA 1LQ2A 4QJ5B 4NP7A 4O1FA 2XIIA 3RCYA 3G1YA 4GQBA 1DWGM 5G4HC 1TCDA 3BOLA 3QR0A 4IGHA 1P43A 3UJ2A 4RE2A 5ABFA 2PTZA 3TSBA 4UOJA 4OBTA 3ZR6A 1XRTA 2WNNA 3PNUA 4A3QA 4S3CA 4KIRA 2ZIDA 3SCPA 1UWUA 1AQ0A 2ZOXA 4X9SA 2PWFA 1R3RA 2ZE3A 3BQ6A 3U5UA 4NYYA 5A94A 2D3NA 2VZSA 1XW8A 1S2VA 1D3HA 1UH2A 4MZ8A 5D38A 4EPDC 3VGFA 2QJJA 4FXRA 4N9BA 2DH2A 3P5YA 2ALRA 3SIMA 1DJYA 4O1EA 2EPOA 3CB3A 3BZJA 2P0IA 1TWIA 4W93A 5H8PA 1G5AA 2OB3A 1MO0A 5EBUA 4NSBA 2TRSA 3VDCA 3HG3A 1FWAC 3PJUA 4JQ2A 2DZWA 1FWGC 2XVGA 5CBIA 2Y7DA 1Y5WA 1OF8A 1P7TB 1QJWA 2PODA 3BV4A 4Q22A 3FVDA 4RZ5A 4DWSD 4DZIA 4UTTA 1EJWC 4ACZA 3M5VA 2VRJA 1R3QA 2OKOA 2PB1A 3GTXA 3M6DA 4Q8MA 3WLQA 4DYEA 3QH2A 3LHTA 4LUJA 1U2YA 2GFTA 4WIWA 2XZ7A 4MTVA 4GJIA 4CD7A 4B9ZA 1UA3A 4LYKA 1VHNA 2PEVA 1E15A 3M9YA 4LS1A 3HPFA 5EMYA 5D33A 4CVUA 1F4AA 1SZGA 3ZIZA 3U2OA 2HK1A 1JZ3A 4J5NA 2I7GA 3RCMA 4KETA 4R53A 3HJZA 2HWGA 3KBJA 3G18A 3M41A 3U9IA 9XIAA 3TMLA 1ZBCA 3VDGA 1QPOA 1S3TC 3B9OA 3N18A 5I3HA 2Y0FA 3N29A 2CLMA 1MFUA 4LBRA 1XI3A 4BEUA 3WLLA 2DPEA 3WQCA 1WPCA 3TYUA 2OQLA 3MSGA 3N4EA 1JVNA 3B8UA 3W25A 4RV8A 3SRDA 5T9BG 1ONWA 1EKOA 1GKRA 5AC8A 4F2BA 5I3FA 4A3HA 2BASA 3VD4A 3AUOA 1DIOA 4DB7A 1EUAA 3QHMA 4ROPA 3ZXWA 1K7EA 5CLTA 1PE1A 4YTRA 3V18A 3GNDA 5DBTA 1XH0A 4DZ5A 1B3VA 1OFEA 4UIOA 5DMNA 3H8AA 1LTDA 3T4CA 2CIPA 2F38A 3QW4B 3NQ6A 1XIBA 1CZ1A 3B05A 1UKPA 4DYKA 3NQ2A 3K5XA 3VDHA 4Y90A 1RALA 1K8XA 4OIFA 5HMSA 5HR6A 2QHAA 4IOTA 4WVXA 1CNVA 4EP8C 4WHBA 5KSWA 3R10A 4XAZA 3GR7A 4HNVA 3FNDA 1E0XA 2A79A 1EH9A 3NQFA 1CLVA 2EPNA 3M6YA 5ABHA 1EB3A 1R5YA 1HKIA 3NEVA 2A21A 3B3DA 2PF8A 2FVKA 3BSMA 1EP3A 3E0LA 4HHLA 3EXRA 4LEFA 3CAKA 3PFRA 2D69A 1YDVA 2PDBA 3P82A 1V3JA 3Q2DA 4MY1A 1LOLA 1IXQA 2WVVA 5E09A 4GC3A 3HO8A 4X0VA 1NFPA 4HCLA 5BXPA 5AHMA 4P2VA 4GCXA 4D6EA 2VMFA 4UTIA 1H60A 4LRTA 2IPJA 3FJNA 4W86A 2GK1A 3IV8A 3QLLA 3GKFA 2JIWA 3W7LA 1VEPA 2DW7A 1IGWA 2H6RA 1UWRA 3ARXA 3TSDA 3VOIA 3OHIA 4FALA 5D2VA 3EOLA 3ES7A 3JVAA 3MJMA 5J5DA 3RU8X 3GAYA 1B3WA 2Z26A 2XYLA 3TTEA 1WXJA 3CUXA 3QMSA 5K9XA 3H2FA 1Q6GA 1VB9A 1R3TA 1RY8A 1WX0A 4G8TA 3OBEA 1OK6A 3R89A 2ABAA 3ZO9A 4REQB 5M03A 1AL8A 4JQAA 2PDMA 1CEOA 3WFZA 1QOQA 2A3LA 4XQ6A 2QF7A 3D3AA 1HNYA 3F2BA 3KBNA 4FI4A 1ZAHA 3LEPA 2CU0A 5KTLA 4Q8PA 3GG1A 4LWWA 1NIUA 4MY8A 3A5VA 1F8IA 5FF7A 4Z1DA 3W1MA 4QE5A 3U3HA 1YEYA 3BGGA 1MUMA 2E25A 3H2NA 5IM51 3W7PA 1ZALA 1DTNA 3NFUA 1I2OA 5HQEA 1XIIA 2NXGA 1IT0A 4KFOA 2BBFA 2OR2A 3M0JA 3MHGA 3TOPA 5C0QA 4ZQNA 4DWDA 3T0DA 1TUXA 3TR9A 1W32A 3H2AA 2R6OA 2E9LA 4NAEB 3QR1A 2OT0A 3EMZA 4M0XA 1QNVA 2XIBA 3QQ1A 1C8QA 4RE4A 1LLWA 2DEPA 1BQCA 3SSZA 1VH7A 3AHVA 3IJLA 4QBXA 5HAOA 3PZMA 4IZGA 3UEQA 3PP7A 4L9YA 4J2MA 3UESA 5B7YA 3VNDA 3IIXA 3H7VA 2GJRA 2PZ0A 3T1GA 4QHRA 5CH9A 3QRHA 4J3UA 3B0XA 3CL7A 1HJVA 1P7TA 4D72A 4J1OA 3KP0A 3WELA 2AL1A 1HJXA 3PY2A 3KOZA 2HZGA 1O1HA 1GJWA 2PE4A 1KFBA 3A4JA 4L9XA 4UNKA 3MY9A 1JCJA 2AL2B 4C65A 4HD5A 1T7LA 3U57A 1AW5A 2UY5A 5D9OA 1T99A 3PZQA 5ECVA 3E2RA 3K4AA 1ML1A 5A8QA 3TC3A 4NNCA 1ALDA 1C7SA 2EPLX 3AXIA 1A3HA 4W7WA 1E9LA 1R6WA 1IEIA 2QMJA 3CEPA 5KEZA 4GINA 6ENLA 3AO0A 2ACSA 2YA0A 2GVGA 3TTQA 3C2FA 1X1ZA 1D7KA 6REQB 3GIPA 1THFD 4I9MA 4B15A 4O19A 5I79A 3O06A 3GY1A 3KWSA 3N3MA 1R86A 6TIMA 4HSOA 3TYZA 1OF6A 2GSHA 4LU0A 1XICA 1TMLA 4F79A 2V5CA 4GVGA 1PVNA 1KKRA 1XLHA 3R0KA 3EA3A 3A9BA 5CC6A 1FDJA 1JQVA 3NPXA 4PE8A 3M0ZA 3KOWA 3U2ZA 1FHLA 2JK2A 4JQ3A 4MYXA 4JHMA 4Y7EA 1UKSA 3RX4A 5FJOA 3WD2A 3ZT6A 3CUIA 1BYBA 1EX1A 5F4SA 4GO9A 4JXCA 2BXYA 1H11A 4F0RA 2GJPA 1PWLA 3CT2A 3GDBA 2ASHA 3E0WA 4PTDA 5BXTA 2E6YA 3FDGA 3STEA 4IPPA 1N8IA 3T08A 1EDQA 3B8TA 3WBXA 2XISA 4AMCA 2O4MA 3HFTA 2AQOA 2YLAA 5C7VA 4HPJA 5B7ZA 1XF0A 4QITA 3QHNA 4P8XA 4QR6A 4IMGA 4V2XA 2WSRA 1PYMA 2C8NA 4JX4A 4NX5A 2OWCA 2TMDA 3OZOA 1QPNA 4H7ZA 5BOOA 3RX2A 3VCRA 2OFJA 3TOYA 3M5XA 2ZZ1A 3KVJA 3OGSA 4GA8A 1VR6A 5FJPA 3C2VA 2DSUA 1D8WA 3QYQA 2WMIB 1TZZA 4JS3A 1KM3A 2QULA 1WDWA 5A8OA 4IIDA 1EGVA 3AHYA 3JZUA 2WXDM 1E3ZA 1I60A 1UKOA 1A4LA 5U7SA 3EA2A 3HM7A 1NOFA 4YL2A 4GX9A 5HATA 4PL1A 3OJGA 3B8WA 1WA3A 3VD5A 1QT1A 2X1RA 5G4WA 3VKAA 1F3EA 1O68A 2J8FA 1ZP4A 2VO5A 2E0PA 3LHYA 4ZE4A 1UROA 1EQPA 1PIFA 3M46A 3NYZA 4OZOA 4NYUA 4WR3A 3PUDA 2QPXA 4H1ZA 1WQ5A 4NG3A 1UD5A 3FHAA 4S3EA 4B5XA 4GNKB 5BNKA 3THQA 1TUFA 2PLCA 4K7YA 1TTJA 3EPNA 3CASA 3M44A 2XM1A 4UWMA 4YJ5A 1OG0A 3P6LA 1QPRA 4NNBA 1TRIA 2VEPA 2PA6A 4UBPC 8XIAA 5CXPA 5C70A 4O1AA 4WDUA 1RPXA 1MUCA 1ME7A 1QUMA 4OBRA 5G2HA 4JOMA 2CZVA 2FZ9A 1JEZA 2IQ0A 4XO7A 1UH4A 3P93A 1FCQA 1XLFA 2FQIA 1H5YA 3PFMA 1XWYA 5MHBA 1GTHA 2YCIX 3WK3A 4XZBA 2YSWA 4GNJA 1AJZA 5C9XA 1GG1A 1IWAA 1SZNA 2J7EA 4O4WA 3KM8A 4GI9A 3GD6A 3DFPA 2Y5EA 1Q6EA 2WCAA 2PDPA 3I3BA 1UD2A 2OX1A 2V0TA 5HR7A 4ACYA 4Q6JA 2XH4A 4IUOA 1S38A 5I06A 4AUBA 3H4GA 3W83A 2J24A 4DNMA 5D04C 2NVAA 4KW2A 4PB4A 1F6PA 5FJIA 2OPJA 2XSXA 3E38A 1BHGA 2VOMA 4JFTA 4UXDA 2RUSA 2X0HA 4C7FA 1YBQA 2XM2A 1XP3A 4J9JA 4M7SA 4TO8A 3V4BA 3CHCA 1QOXA 4HHHA 3RM8A 5FEWA 4E4FA 4UTKA 3SCNA 5LZLA 4PCTA 1KXVA 1EX5A 1FCBA 1ZBKA 1DWJM 3MS8A 5FAGA 3GVQA 2PRLA 3FKKA 1A50A 5M3WA 3O6DA 4ZMGA 5IFPA 1FWDC 1DKWA 4XZWA 3A21A 3WNOA 5IRPA 4HN8A 4NILA 3BVJA 3PPCA 5K3VA 1SR0A 3FGCB 1WZLA 3W72A 3QPYA 5ABEA 4CQDA 3V75A 3WQEA 1D3GA 4NZ4A 1HT6A 1S5NA 3L4WA 2VEIA 3GBEA 4TXEA 3QPEA 3G1HA 2J9XA 1JD9A 1V79A 4JDBA 4FX6M 4QX4A 2NVDA 5FA5A 5I6SA 3IGSA 4PTWA 4XD4A 1XQLA 3C5QA 2PGEA 4WF7A 3O6YX 1WXYA 3BLLA 1GQLA 4P7NA 3W9ZA 2JF6A 3CNYA 1FKXA 2DUZA 2CESA 1TTIA 2V5KA 4YYFA 2Z2AA 3MO4A 5C2GA 3PJWA 3EWWA 2C18A 1YDYA 3B8VA 3WLSA 1K03A 3G24A 3BOXA 4K68A 1JCLA 2PDFA 3C0QA 4TVCA 3VIHA 1CXKA 1OZMA 3T55A 1CB7B 4L5ZA 4HOWA 3C52A 3WNKA 3IVUA 5EFFA 1A53A 2CLEA 4BR1A 1OYBA 4YTUA 3UPWA 3B0VC 2YDSA 2XFWA 3ITXA 3THUA 3RNDA 3T40A 3QR3A 3SQSA 1XSIA 3N9RA 2O0TA 4S3FA 4FIQA 3UF9A 1XSKA 4O52A 5IFTA 4H7CA 3MZ2A 1KFJA 3LHZA 4IICA 1KO0A 1RAKA 5REQB 1DPMA 4A3UA 3LD5A 1JF6A 3GG0A 2VX5A 2NSOA 3QPZA 5EL1A 3IVTA 1CCWB 4AZGA 3PG9A 1E4LA 2EG8A 1LOQA 4K6AA 5IDZA 3HGJA 1RA5A 4Q4PA 4MMWA 1G6CA 4M7TA 4GZJA 4GX8A 4MJ4A 3QMRA 4M6UA 4W8LA 4U4MA 5T8GA 5BU6A 3DG7A 3S6TA 4AEOA 1UMYA 3ERPA 2NSXA 6CGTA 4FR1A 4UCFA 4KWWA 1KC7A 3BLOA 3LB0A 4PMOA 1L6YA 2V6AA 2Z6IA 5CAKA 4S38A 1M6JA 5A2CA 3W1PA 1YMYA 3RMEA 2CHRA 2HRWA 3STCA 1E0VA 5I3IA 5AHEA 4TU1A 3VU2A 4S2CA 3E96A 1YXDA 5XIAA 1D3CA 4PGLA 4PFHA 4WY0A 1OK4A 4X3ZA 3UG8A 3SB0A 4ILSA 4QROA 4IJBA 5D32A 2CC0A 3VZZA 4P8WA 2KX9A 4PMNA 3PBVA 5BCAA 1CB2A 1P0EA 3VE7A 3NQDA 3AXXA 1TQJA 3DU0A 4IPNB 1RVGA 1W3TA 2W79A 3PZ9A 5K9DA 5LA2A 1VCFA 1M01A 3W7QA 4I5UA 4KERA 2I17A 3QN3A 2Z2BA 2Z1VA 3PC0A 3C8NA 3BV7A 3MP3A 3VYLA 1Y7VA 5I03A 1LWHA 1V5XA 4RW5A 4GGHA 1HTIA 4HGXA 4LC8A 3WUGA 4TV5A 1WE5A 1PWMA 1TFVA 3PZTA 4EXQA 2J9YA 1TMHA 3VKCA 1HKJA 3PG8A 4DZAA 3RO8A 2W4XA 4POCA 4WEVX 3DZ1A 3QZEA 1IHIA 5E1QA 1NF7A 3P8IA 1KM2A 3VGBA 3SUVA 3G1XA 3H7UA 2Z24A 4X2RA 1F6KA 1SZRA 3GH7A 2R14A 1M3UA 4XZHA 4Y9NA 3AU6A 2WQPA 1SJCA 4PYSA 2WZHA 1EC9A 2WMFA 1ZBVA 1E70M 3E49A 4ZQCA 2DGAA 2OODA 2QCDB 3ZJ6A 1KM1A 3VA8A 4C6DA 2ZUWA 3KAOA 1FXPA 4ZQPA 1TELA 2DQXA 1ZY9A 3A4XA 4O8AA 1OZQA 3W7KA 3KL3A 2F84A 4ALDA 3JUGA 1KRMA 1TO3A 2FJUB 5AZ1A 5FL1A 1QRQA 3KXQA 1EF3A 1XLMA 3IGHX 5AY7A 4GUHA 3CIVA 2VGIA 4DBEA 1L9WA 2PZNA 4WXZA 1YTDA 2GYIA 4XZMX 3H2CA 3UJSA 1QNQA 4C5ZA 2OZ0A 2OQYA 2WBGA 1LM1A 2ZWZA 2WB5A 3C4UA 3EB4A 3CL6A 3CIWA 3NVTA 5CKSA 5HUOA 2WANA 3WH9A 2RGLA 2X05A 1PJ9A 3UJEA 1XCFA 1YLVA 5FJJA 4RDWA 2AGTA 4MIMA 3FSTA 3LZ3A 1TZ9A 3AS0A 4WKFA 1LUCB 2EAWA 2E9BA 4HPGA 1M7XA 1IWPA 3LXCA 2A3CA 4TX6A 4Y9AA 1CXLA 1TX0A 5DN1A 4HMNA 1O1ZA 2WBKA 1WBHA 2ZDSA 4FAMA 4L65A 1CGUA 3H7RA 4JN6A 4XVEA 2YOCA 1WBJA 4E8DA 2X0YA 1W5PA 2O9OA 2E6DA 6XIAA 4FNTA 1FXQA 1VCVA 4QEHA 4DWSB 1IEQA 3TVAA 2VGBA 4GACA 2D2OA 2BB0A 3C2OA 4D6CA 3LUTA 3H4XA 3PAOA 4GNVA 4LVGA 1NU5A 3D5HA 4H9YA 5E93A 1Q5MA 3CM4A 3TCSA 4O57A 3WIJA 4OTKA 1PS9A 4QG9A 1FWSA 3S2NA 4JTQA 3NDYA 1TIWA 4UFKA 4DAIA 2GQ3A 3VNLA 1LG2A 1ZJAA 3UVAA 2HS8A 3R94A 1E1CB 2NXIA 3ARPA 1GEQA 3INPA 4EAMA 1NY1A 3P81A 4GY0A 2V3DA 3OG3A 3SUWA 2J7HA 2YDAA 4FMVA 1IWBA 4UB9A 2IKGA 3N17A 3ZR4A 1E6RA 3CPUA 3ABZA 3CUHA 1JI1A 4G7FA 1HL9A 3LBOA 4BQ4A 1P1XA 4AB4A 5FD0A 4IX2A 3AS1A 4R27A 1W5NA 4S3JA 2OYKA 2D2HA 2FVMA 3UNTA 4GIYA 6XIMA 4LJ3A 1TA3A 4B2DD 4PSRA 2FMNA 1SFSA 2HBXA 2OKTA 4YTQA 4F8XA 1Y0EA 1GCYA 1UQZA 2XGIA 4J28A 2GDQA 3AC0A 3W1UA 2C79A 3LRKA 3M64A 3S3GA 2Y89A 2FGLA 3P2VA 3NG3A 1B4EA 2DSKA 3ANYA 4KCWA 4JIPA 3EGJA 4FNUA 2HV5A 2YBUA 3BG5A 2V3FA 1FFRA 3ALFA 2NQJA 3H12A 1R7OA 3OIXA 4QIUA 3MDUA 1I1WA 2P1FA 4OV9A 1UC5A 4ROQA 4XZLX 2W9MA 2Y6ZA 4K8EA 4HJWA 4XSLA 3MYOA 5HMEA 1RQEA 2QVNA 2EHHA 3C6CA 4UTWA 1F3WA 4L64A 3MMTA 1J10A 3CV6A 2ZX8A 4QISA 3BG9A 3ME3A 1IIGA 1IT7A 5KMYA 4J4KA 2XIMA 4JIHA 2ZZ6A 3SN1A 5BW6A 1YPXA 3M7SA 3AQUA 5EYWA 4LUSB 2XDFA 1GJPA 2BX7A 1XIGA 2CITA 2FZ8A 4JTAA 4I9JA 3W53A 5CPSA 4PCPA 3IGUA 3OLEA 4RKAA 4RX0A 3VAVA 2WSYA 3C61A 1PO9A 2PDCA 3K4DA 3AIQA 4X63A 5I0DA 3AYSA 4QXIA 3W1NA 4GI4A 2I56A 4LB4A 3H23A 3BMXA 4R9OA 3LERA 4UOZA 3DI1A 3WSUA 2QMKA 2HE5A 4DI8A 1JPIA 4JTIA 3UR7A 4M80A 2PDHA 2PBOA 3R0DA 4XAPA 4WK9A 1BVNP 3AHXA 3ARZA 2FGBA 3GNXA 2JIEA 5I09A 2A3B