4UQAA

X-ray structure of glucuronoxylan-xylanohydrolase (xyn30a) from clostridium thermocellum
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
391
structure length
391
Chain Sequence
SHMASATINLSAEKQVIRGFGGMNHPVWISDLTPQQRDTAFGNGEGQLGFTILRIHVDENRNNWSKEVATARRAIELGAIVSASPWNPPSNMVETFTRNGVPNQKRLRYDKYGDYVQHLNDFVAYMKSNGVDLYAISVQNEPDYAHEWTWWTPQEMLRFMRDYAGQIRCRVMAPESFQYLKNMSDPILNDPQALANLDILGAHFYGTTVNNMPYPLFEQKGAGKELWMTEVYVPNSDSNSADRWPEALEVAHNMHNALVEGNFQAYVWWYIRRSYGPMKEDGTISKRGYMMAHYSKFVRPGYVRVDATKNPTYNVYLSACKNKKDNSVVAVVINKSTEAKTINISVPGTSIRKWERYVTTGSKNLRKESDINASGTTFQVTLEPQSVTTFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CARBOHYDRATE BINDING FAMILY 6
publication title Conservation in the Mechanism of Glucuronoxylan Hydrolysis Revealed by the Structure of Glucuronoxylan Xylano-Hydrolase (Ctxyn30A) from Clostridium Thermocellum
pubmed doi rcsb
source organism Ruminiclostridium thermocellum
molecule tags Hydrolase
total genus 135
structure length 391
sequence length 391
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uqaA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uqaA02
5D8ZA 4LGXA 1BYCA 4J3XA 1E4MM 4PMZA 1SZNA 3UG4A 2VRQA 3WMBA 2YDSA 1CXEA 4PSRA 2F1AA 4Z2GA 3K8LA 2EPNA 5A69A 4D6EA 1DWHM 3MMDA 1CGXA 4JFWA 1PIGA 2BXYA 2AAAA 4QFUA 2OLHA 2YKKA 3PZVA 4FLSA 4WK9A 1QI3A 4AD0A 5ABFB 3LXBA 1JF5A 1Q4NX 2DT2A 3OZOA 2ZUTA 3MV01 1EGZA 3FHQA 5BRPA 5HNNA 4XUYA 1ISXA 4UQ9A 1KFWA 4FLQA 1ZBCA 3ZSTA 1CTNA 5D4YA 3W82A 2WSKA 3CLWA 3FNDA 3G6MA 4W7WA 2A3EA 1QNRA 2WMHA 1JF6A 1MXDA 1E5JA 2FGZA 3DECA 4J3VA 1R85A 2BHZA 1LF1A 1OIMA 3CHCA 1M7XA 3IAPA 3B9AA 4RE2A 1KXVA 4L4OA 3B9EA 4Z2IA 4MNJA 3W37A 4AEEA 2XVGA 3VIMA 1WDPA 3VIKA 3DX3A 4M29A 3ZOAA 4HMDA 2X0YA 1MFUA 1E3ZA 2D2OA 4NZFA 2VX4A 1MW0A 4E2OA 3ARRA 3MUY1 1EO7A 1UA3A 3WY2A 4Z2LA 3L4XA 1GZJA 5LA0A 1XH2A 1HJVA 1W9XA 2W92A 2VX5A 3LX9A 4ACYA 1CECA 4HPGA 2HVMA 1LLOA 1B1YA 4EE9A 2A3BA 3WEMA 4GZEA 1YHTA 1GJUA 1WO2A 2GJRA 2WMFA 4AZHA 3VSVA 2ESCA 4CCEA 4EAMA 3AYRA 5GNXA 4D72A 1VBRA 1CGTA 4XV0A 1VJSA 3BAKA 2VMFA 3WFLA 3WD4A 4RE4A 3CUIA 3MKKA 3BVTA 1RD6A 3ZR6A 3N17A 3VD9A 3NSMA 1W9VA 3PZIA 2CBJA 2WWDA 5CXPA 3WF2A 5A6KA 3APGA 4AD2A 4GI6A 1JDAA 3CC1A 4A4AA 1B90A 3QR3A 1B9ZA 5LA1A 2XN1A 2MANA 5C8BB 1UHVA 1Q6EA 5CLTA 2VL4A 3SCPA 3WH6A 5HBFA 5KZ6A 4DO4A 3N11A 1HP5A 3BAJA 3CZSA 2BY2A 1E4IA 1JD9A 1PX8A 2Y2WA 5EFFA 5C70A 2DT1A 1ZL1A 1UWTA 4QCFA 4J3WA 1HL9A 6TAAA 5ABEA 1JNEA 1VEPA 3AHZA 4CN6A 2WVTA 1HN1A 3GTNA 5IFPA 4D6DA 1WKYA 2X8RA 2X1IA 4F8XA 2NSXA 5CQ1A 1C92A 3GXPA 3D50A 4U5IA 2BVYA 4W5ZA 2PC8A 1BAGA 1H4PA 1BVNP 4QCEA 3KEHA 3AIUA 3BAXA 2D23A 3LXAA 1B2YA 3HN3A 4QLLA 5KEZA 1DHKA 1JZ6A 2PBGA 1WZMA 1NWRA 3AIEA 3OGSA 3EMCA 4NZJA 3CZGA 2ZE0A 4P7OA 3TTSA 4X9YA 3WEOA 3GXMA 4AIUA 3OB8A 2ZXQA 4BA0A 2VX7A 3AIBA 1SMDA 1WDQA 5E9AA 4TOQA 1PBGA 1WDRA 2XTKA 5A8PA 2A3HA 4DM1A 1OT2A 2V5CA 1XGZA 5CPSA 4B9ZA 3PZUA 4HP5A 1GPFA 2OW6A 2A3CA 1ZS2A 1V0NA 3T2PA 2DDXA 2WB5A 1BFNA 2D0GA 1EOMA 1QHZA 4MPKA 2O9PA 3AS3A 1J0IA 3BAIA 4BZYA 5A6AA 5FD0A 1GORA 1IT0A 2XN0A 1E15A 5FOOA 3NSNA 4ACZA 1ISVA 2C8NA 5FL1A 4AYSA 1W2VA 1V08A 3VIIA 3T09A 2DPEA 4JKKA 1UD4A 8CGTA 4IUGA 2OWWA 2ZXBA 1HJWA 1UWUA 4JHZA 1NP0A 2E9BA 2DSUA 5I23A 5EBAA 2F8QA 1UD6A 3UG5A 3H54A 3WMSA 4AWEA 1GUVA 1R86A 2EAEA 1DWGM 4UFIA 2PF0A 4FF5A 3VINA 3W38A 2WWCA 2EBNA 1E0XA 2EPOA 2XYLA 4P8UA 2G3MA 3UESA 2CKSA 1PX4A 4HOWA 3F4VA 3WUEA 4HU0A 3CZLA 2F7RA 2CHOA 4OOZA 4J3UA 7A3HA 2BV9A 1R87A 4R5EA 1UZ1A 2CBVA 1CZ1A 3TTYA 1MWOA 4JZ5A 3KLKA 4UOQA 1H0IA 3ZJ7A 2XJ7A 1HJQA 1C8QA 2WPGA 1EDTA 2AOSA 1JYNA 1KXHA 5GNZA 3EDEA 3FHAA 4AISA 1HF6A 3RM8A 2GVYA 4M24A 4AZ6A 4W84A 1V02E 4FNQA 4PMQA 4GPNA 4X0NA 4PEEA 4ATDA 1DWJM 3BCFA 1C8XA 2GDVA 4HZ8A 1LL4A 2YFNA 3WH9A 1J01A 3TOPA 2J7EA 2XGIA 1XD1A 2VRJA 1WE5A 2VZOA 2WW5A 2CNCA 3GH5A 4MAVA 1CYGA 2W61A 1ZBKA 3ZO9A 1K9TA 2J8GA 3WD0A 3RIKA 1VB9A 3AYSA 4D6GA 3CUFA 3VNZA 1OSEA 4EK7A 2F7OA 4TTUA 4DWSC 3W28A 1UA7A 3W6LA 3HZ3A 2WCGA 3SUVA 1Z32X 3AICA 4J28A 1W3LA 1Q6GA 3VDBA 1ECEA 4D6HA 1HKJA 4GI9A 3S5ZA 3HU7A 1UKPA 1CGWA 3DYOA 1M01A 4DWSA 2WHJA 1H3GA 3BVVA 4FNPA 2FHFA 3WQ5A 2J62A 5LA2A 3ZMRA 3VD3A 5I5RA 1R46A 5EMYA 1UKTA 3WD3A 2W91A 1OWQA 1J0JA 1NWSA 3NSXA 4W7VA 4XZBA 1W9UA 1E56A 1QNOA 4PSPA 3M6DA 2RGMA 3VKKA 1QHPA 1D2KA 4P7RA 1X6NA 2W66A 4HA3A 2VQUA 3U5UA 2VTFA 1W2PA 1JYXA 5CG0A 2X05A 3IGUA 3N15A 1K9DA 3CMJA 3AS1A 3HG4A 5AYIA 1OM0A 2UY2A 1KWKA 1G94A 3RM9A 1QPKA 4PTWA 4FNSA 2XFYA 3W53A 1R7AA 2WSPA 1UD3A 2WK2A 5E0CA 1TQVA 1JL8A 1XCWA 8A3HA 4KGJA 5EB8A 1QNSA 1GHRA 3M7SA 1QNQA 2Y8VA 2IUZA 5A6MA 3CTTA 2YOCA 1XCXA 5A6BD 4JKMA 5TD4A 3OG2A 4TUFA 3EJRA 3RJYA 2C7FA 1QWUA 2D0HA 3VDHA 2XVKA 4Z2KA 2BY3A 1UWIA 1W1TA 5E6YA 4AY1A 1XV8A 1GW1A 1GHSA 1CDGA 1US2A 1CXKA 1D7FA 2V3GA 3WH5A 4CKQA 1BGGA 4GI8A 3AHTA 3VDCA 1J0ZA 2VCBA 1JYVA 1KGXA 4YHGA 1CENA 4MNKA 3UETA 1RP8A 2CERA 1FHLA 4U2ZA 2ZX9A 2WVUA 4OOUA 1TR1A 1GVYA 2CKRA 4H04A 1GOWA 4U31A 3VUPA 1GQLA 5IFTA 1G0CA 1HIZA 1W9BM 2BS9A 4HA1A 4JAWA 1KXQA 4W89A 1JDDA 5FKYA 2XHYA 2OWXA 3VDAA 1KGWA 3SIMA 1TQWA 2NW0A 3WQVA 1K6AA 4HOZA 1EDQA 2BVTA 1E3XA 3F5KA 4UCFA 3PZ9A 3ARPA 5A3HA 4ATWA 5A8MA 1JZ7A 2Y5EA 3CMGA 5EFDA 3S5YA 1UH3A 1KQYA 1E71M 4XX6A 4F66A 3DDGA 4K68A 1JFXA 4JCLA 1P6WA 3QOKA 4ZXOA 3KL5A 1KTBA 4PN2A 1LWJA 1HP4A 1UKOA 1J10A 2WXDM 2IXVA 3N13A 1EHAA 3LRLA 4AYGA 1HJSA 1OGSA 1QNPA 3BUBA 3AZTA 3E1F1 1CNVA 1E4LA 1A3HA 1WNOA 2XVLA 1UD5A 4GZIA 1TCMA 4KRUA 2FE0A 4CD7A 2J7HA 1GCYA 4AD1A 2BHYA 4NXKA 3AS2A 5BXRA 1W1VA 4LQ1A 3HG2A 3WN6A 2VVSA 1OINA 5D8WA 3IJ7A 1EA9C 1VENA 4ACZB 1N82A 4TX6A 4W88A 1ODUA 1M53A 3PZGA 1UASA 2F1BA 2DIJA 1XH0A 4JFTA 4MDPA 4P8XA 2OWCA 3U7BA 1UR1A 3EMZA 3WNLA 4PCTA 5JUVA 2BNJA 4LYQA 2BHUA 2VZUA 3QGVA 4D6IA 4HTYA 2GUYA 2GK1B 3AOFA 5LYRA 1EHNA 2ZXAA 3T0DA 1VF8A 4UQBA 1AQMA 3DX1A 3WH7A 1V6WA 5DT5A 1W9DM 3MMUA 1C7SA 1WP6A 4ATLA 3WF0A 4QAWA 1AQ0A 3BGAA 1HL8A 2X09A 5D9PA 3TA9A 4B9YA 1GJWA 3VMNA 5BROA 2XVPA 2DIEA 3CZJA 4CVWA 4UNIA 2NT1A 5CJ5A 1V0MA 4OIFA 1EDGA 1EIBA 3N9KA 1BHGA 3OA5A 4Q22A 1H41A 2J77A 3PZQA 1CLVA 3FXYA 5D9OA 3DDFA 4WSJA 1CIUA 3CZEA 2Z1SA 3GNOA 1H49A 2J25A 1W91A 4NRSA 4QLJA 1QI4A 1GONA 2ZX5A 1ITXA 5M3WA 4W93A 2CBIA 1K9FA 3WY4A 4W86A 3WDPP 5A6SA 3CZKA 1C3FA 2WMJA 4AD3A 3L2LA 2XIIA 3GH7A 4LYPA 3UR8A 1UYQA 1HX0A 5JIWA 2BXZA 3MUAA 1UD2A 1V3MA 3EDFA 1EOKA 3PZTA 3EDDA 4Y7EA 1QVBA 3LPOA 3BCDA 4V27A 3EDJA 2Y4SA 1TVNA 1GVIA 2WMIB 3AISA 3A4XA 1J18A 2VI0A 4GINA 1UD8A 2ZWZA 2VZSA 1VEMA 2UY4A 4BQ5A 4PMDA 2ZWYA 3BUIA 4NZCA 4AXNA 4D1JA 3L4TA 2J7GA 2BY0A 2BVDA 2FH8A 2FGLA 3CUGA 4HA4A 1XSJA 3GM8A 2ZUUA 3BMWA 4AZ7A 3VIFA 3LPPA 1GQIA 3UEQA 1RH9A 4M81A 4C7FA 2VO5A 1XH1A 4JL2A 3BH4A 3RPMA 1ISZA 4ZE5A 5BRQA 2V5DA 1YQ2A 1LL6A 4CCDA 1J12A 4CGTA 2Y8KA 3BSGA 4MAZA 4UFLA 1VFOA 3OGVA 2VVNA 3A24A 1XSIA 1XHGA 3DX4A 3IJ8A 1O7AA 3BMVA 2VX6A 1ISYA 3VSUA 1LWHA 2O9OA 4CU8A 3ALFA 3EMQA 5D9NA 1QI0A 3AHVA 1NQ6A 1TA3A 1GOKA 5AY7A 5A8QA 3WF1A 1B3VA 1UQZA 1LG2A 1CGYA 1B3XA 3ARTA 1E6SM 1OCQA 3AIVA 1WZKA 3ZIZA 4U33A 3K4AA 3AZSA 1FH9A 3VTRA 3A4AA 3VD7A 4LXFA 2F61A 3VM7A 4OKDA 3BUDA 1OGGA 1L0PA 1A47A 1LJYA 4RL3A 2E40A 3PTQA 3L4UA 4IPNB 1BG9A 5CPQA 3NJ3A 1V3KA 4J3SA 1HT6A 4F9JA 1ITCA 4E4PA 2XSBA 1HKMA 1JZ2A 1U30A 4M8UA 1KXTA 4B16A 3HG5A 2O9TA 3QHNA 1E40A 3ZSSA 3AROA 3UR7A 3WIJA 2WC4A 1DWAM 3PTMA 2YA0A 5JBDA 3SEPA 1G01A 3KE0A 2VJXA 2WZIA 1TE1A 1DWIM 4J7RA 3MMWA 1PX3A 3IAQA 2E9LA 4CD4A 1MW2A 3J7HA 4W7UA 1FP9A 3BAWA 3D4YA 4IISA 1ZJBA 1QHOA 3G6LA 3ARWA 1C93A 2J47A 2WMKA 3NCOA 2WMGA 3BVXA 3AMLA 1IZJA 4CD6A 3DHUA 5BCAA 3SURA 2CITA 1I75A 1UUQA 2DGAA 1H0GA 4EKJA 1HVXA 1H11A 2EXOA 4NSBA 2OSYA 4MB4A 1UQYA 2EADA 3WL1A 5ABFA 4YN5A 2WCSA 1E5NA 1R75A 3AMDA 4CN1A 3SCSA 1NOWA 1V6VA 4FMVA 2CXGA 3THDA 1NARA 4CD8A 2JALA 2JFEX 5ABGA 5I2UA 1M03A 4UFMA 3WDJA 4PMOA 5E09A 1WCGA 4W87A 4CN4A 1XRVA 4GIAA 5BXSA 3ZQ9A 5IDIA 2A3AA 1Y7VA 4P7QA 2Q8XA 1VJZA 3PZOA 4DUWA 3W6MA 3K8MA 3ARYA 3W4RA 3N18A 3KWXA 4EANA 4JL1A 1JAKA 2GJXA 3B8SA 3MANA 1EQPA 1ESWA 4UOJA 1UH4A 3S2CA 1MQRA 2VT0A 4Z2HA 4YPJA 4X0VA 5E6ZA 3FN9A 3ARSA 4W8BA 2J75A 3SUSA 3WKZA 2TAAA 1E43A 1PPIA 5AYBA 3W26A 4AMCA 1LQ0A 5HOSA 3OLEA 1MQQA 2WANA 3W25A 2XFRA 3IJ9A 4GQRA 1XYFA 3WF3A 1VBUA 2DEPA 2WC3A 9CGTA 2JE8A 4P7LA 4MJ4A 1OBAA 5M17A 1NM9A 4DO5A 4S3JA 4A3YA 1GOOA 3CH9A 3W29A 4MB1A 1CGUA 2J74A 4NX0A 1GOIA 1HXKA 5IHRA 3D5HA 2PWDA 2CEQA 1HKIA 2CBUA 2WKLA 4URIA 1RPKA 1SR0A 2J7FA 4IPLA 2OYMA 5A6JA 1KBKA 5IHSA 1CXHA 4D1IA 1MFVA 1HJXA 2J7BA 3CGTA 2YJQA 1QW9A 4GQQA 1QBBA 2ZUVA 1XSKA 3K8KA 2X2IA 4AZCA 4M80A 3GXDA 2IXUA 4UFHA 2VZTA 2JEPA 3N1AA 3CPUA 3VMOA 2FHCA 3GNPA 2OSXA 1E1FA 2OYLA 4WJXA 1NWTA 5CSUA 4MJ2A 4H41A 1JIBA 4AIEA 2WVVA 2QMJA 2CETA 2X0HA 2DSKA 4UQAA 2X2JA 3NIYA 2W4XA 1Q6CA 2W67A 2CIPA 1AMYA 2GFTA 3FW6A 3RMEA 1W9PA 1H5VA 4ZFMA 2E8YA 2BY1A 1JFHA 2WC7A 4PTXA 5DT7A 3AFBA 1NOFA 2WNWA 3A3HA 3FY1A 2J78A 1UR2A 5CGMA 2V38A 1SYTA 4JFSA 2VUYA 4AIOA 1VFMA 3UG3A 2G3JA 3GH4A 3AQUA 3EJTA 1UH2A 2F18A 3A6OA 3ECQA 1SMAA 1FOBA 4ZEPA 5JIPA 1GQKA 1Q6FA 3O6AA 3EJSA 1FA2A 3ARZA 3UCQA 1SFSA 3BLBA 3WBAA 4PTVA 1OT1A 3WQWA 4P8WA 2ZOXA 2AMGA 4FNUA 3LRKA 1VFFA 4UTFA 3D3AA 2YDRA 1MW1A 2YLLA 2PI6A 5GPRA 1HWWA 4LX4A 5FIPA 3ZM8A 4ZE4A 2QHAA 5I3DA 3GBDA 4JCMA 4UQDA 3VX0A 4GO8A 2JEQA 4S3KA 3OZPA 3U5YA 5M03A 2CYGA 2E8ZA 1J11A 4TXEA 1Q6DA 3WD1A 4TTGA 5BYWA 1JZ8A 1R47A 1EH9A 3VGFA 2DSWA 1DWFM 4ML4A 5E0FA 3MO4A 6A3HA 3O9NA 4H8UA 3GNRA 1M04A 5ABHA 2BFGA 3RJXA 2QF8A 3L4WA 1TG7A 4GKLA 1ODZA 2YA1A 3GXIA 4C7GA 2WBKA 3SCVA 3BUQA 4OGZA 3D52A 1V3LA 4P7NA 4JHOA 2XVNA 3CHEA 2D73A 4CCCA 4PMYA 3T2QA 2IGTA 1V03A 1GQJA 2WYSA 3HMCA 3OLIA 5A2AA 3D51A 2XWDA 2WHMA 1AQHA 2JIWA 1ZJAA 3POHA 3ZT7A 1TA3B 4PCSA 1F4HA 2VOTA 3WFZA 3OLDA 3BUPA 4NF7A 1PS3A 2C0HA 2G3NA 1QWNA 1JDCA 1DP0A 4DUVA 2ALWA 2JF6A 4CU7A 3HJEA 3H53A 2G4FA 3PTKA 3GXNA 4J27A 3AI0A 1HTYA 3CHFA 4D6JA 1CXLA 3EYPA 1G1YA 3VILA 4OUEA 4FLRA 3WDRA 1KTCA 1JI2A 3A23A 2YBUA 4W85A 1KBBA 2FYVA 3BLPX 5A6LA 1E6RA 4HZ7A 1O7DC 1E72M 3W27A 1VRXA 2W62A 4PMVA 3TTOA 3W24A 3M46A 2ZUNA 4JIEA 3WEZA 3EDKA 4KWUA 1B3ZA 1W32A 3WY1A 2J79A 2GJPA 3VD5A 1MVYA 1E0VA 3WF4A 3NUKA 1V6UA 1FFRA 3MSDA 3QHOA 4OBRA 3VIHA 5A94A 1JZ5A 2DT0A 3N12A 4H2CA 3O2LA 5GQBA 4B15A 4PMNA 1V3JA 2DSZA 5HPOA 1V3HA 1I1WA 2UWFA 1WPCA 4B3LA 3GZAA 1UKQA 2FDMA 4M56A 1VEOA 4PBGA 2PBOA 3THCA 3N04A 3OBAA 4AZIA 2WLYA 1EQCA 1PIFA 2E3ZA 1OD8A 3DHPA 2X2YA 1B30A 1AVAA 3CIVA 3F5JA 1H09A 3A22A 3NDYA 2F7QA 2XGBA 5CGTA 3A4WA 4PYSA 2XIBA 1KR1A 2ZUSA 4JKLA 1EXPA 3VMPA 1E6PA 4WIWA 3WNMA 4LYRA 1G5AA 1E1EA 1PJ9A 3NDZA 3UERA 2YL5A 3U57A 1NWUA 1XYZA 5I78A 2HISA 4V2XA 2EJ1A 2J7DA 3L4VA 5FL0A 5I79A 3LPGA 1FFQA 4XB3A 2ZUMA 2E0PA 1UR0A 1TMQA 4DM2A 3ARQA 1ZB5A 1C7TA 1KGUA 2VC9A 4U2YA 1FH7A 2GJXB 3TP4A 1QBAA 3CZ8A 3POCA 1WDSA 4UQEA 4MNMA 2WBGA 3SCOA 3A5VA 1J0KA 3WNOA 4MNLA 3D4ZA 4QDMA 1T0OA 4ZXLA 2EABA 1FP8A 3A21A 4F79A 4UZSA 1W1PA 2EEXA 2VCCA 3WUGA 3SUUA 1UWRA 3AZRA 2O92A 5DF0A 3SUTA 3WDHA 1JI1A 2J8FA 2JIEA 4D6FA 1GOQA 1DEDA 3QOMA 3EBVA 4NI3A 1UWQA 2YL9A 4PMUA 1TUXA 3AIQA 2O9RA 2RGLA 4GXPA 1BQCA 4UR9A 1LG1A 2WZEA 3VGDA 4W8AA 2D22A 2X2HA 2F2HA 2D3NA 3I3DA 5CLWA 1VFUA 3WY3A 1CXIA 3M07A 4BCEA 4F9DA 3KL0A 1L8NA 4AZCB 4DWSB 3BXWA 3DYPA 4H8HA 4JFUA 4GZJA 4Q7NA 1S46A 1UG6A 2OW7A 2ZUWA 1JNDA 3LPFA 3AIRA 1V3IA 1B0IA 3WNPA 3PBGA 2WVVB 4NXSA 3VGBA 2YIHA 3TTQA 2DH3A 2V3DA 4WSKA 2JF7A 3AJ7A 1JGIA 1QOXA 4UFJA 1CGVA 2VR4A 3A47A 3TV8A 2XUCA 1JZ4A 1E0WA 1WZLA 4OBSA 3MUZ1 4MDOA 2WLZA 1E6XM 4B3KA 1E6QM 2ZX7A 4MTVA 2ZXDA 3ARVA 1BF2A 3EJQA 4MADA 1BGAA 2XPKA 4AC1X 3CUJA 3L2MA 3WQ8A 4BQ4A 1R7OA 3AXXA 3VIJA 6CGTA 1V0LA 5AC5A 2CPUA 4IM4A 3MU7A 3AHYA 1IZKA 2OYKA 1UR4A 4AZGA 5BXPA 2YL6A 3IK2A 3ZJKA 2DH2A 4AZBA 3VOCA 4E8CA 1CBGA 5I0DA 3KZSA 1B31A 2XSAA 1VAHA 3VIGA 1MW3A 2Y24A 3SCUA 3CV5A 5M5DA 3AXIA 1NOUA 4TVDA 5C71A 4HMCA 4FNRA 4AW7A 5BXTA 4PUDA 3VVGA 1B3YA 2J7CA 4CU6A 1X6LA 3OLGA 1BLIA 1PEZA 5E1QA 1U33A 3T08A 1E70M 1TQTA 3MS8A 4M1RA 3L4YA 3WDQA 3WNKA 3PHAA 3KL3A 4UFKA 2EACA 2WHKA 4WF7A 3W81A 4QP0A 1XD0A 1ISWA 1U2YA 4H7VA 3WQ6A 3AXHA 3RCNA 1HNYA 1JG9A 2XM2A 2QV4A 1JZ3A 1CEOA 4ZENA 1HVQA 4DO6A 3ZJ6A 1E55A 1GNXA 3II1A 3CZNA 3VSTA 1B3WA 2QPUA 3T0BA 1JYWA 3VO0A 3EJUA 4UQCA 1JXJA 2PWGA 2GK1A 3U7VA 1WAWA 1FH8A 4UOZA 4LPCA 2W63A 7CGTA 1K9EA 3L4ZA 2UY3A 4HOXA 1TVPA 3ZJ8A 4HU8A 3CBWA 3SCTA 3WDIA 3IANA 3EJPA 1UR9A 4N42A 3AMCA 3F5LA 2FHBA 4H8VA 2XN2A 1CXFA 2VR5A 4PRWA 2XFFA 2D24A 3VIPA 1TQSA 4WKHA 1UWSA 4CD5A 1E6NA 4FK9A 5AC4A 1QX1A 1XC6A 1R8LA 3CUHA 3GXFA 4DWSD 5HXMA 4MB5A 3WENA 2YFOA 2VZVA 5A8OA 4DUXA 5A2BA 2DSVA 1LL7A 2NT0A 1E4NA 3FAWA 1PZ2A 3W0KA 2ZICA 3ZT5A 5I6SA 1IV8A 1JD7A 1TZ7A 5JBFA 4W5UA 2E4TA 3AS0A 1FHDA 1H1NA 1OD0A 3ZT6A 3ARUA 1J0YA 4CVUA 1CWYA 4R27A 4C7DA 3MI6A 1WB0A 3SUWA 4KH2A 1V6YA 3BSHA 7TAAA 2VRKA 2D3LA 3BVWA 3VX1A 1F4AA 2D20A 4OZOA 4TVCA 3BLKA 2W5FA 3T2OA 2YLAA 1TQUA 1V6XA 5FCZA 1OB0A 4PTMA 2XWEA 1KCKA 3DC0A 3WBEA 2V3EA 4TVUA 1NP2A 2YBTA 3RM4A 5IXEA 1E9LA 1CLXA 3PZNA 2WMIA 3WSUA 5A95A 4N0RA 2D1ZA 3S6TA 3QHMA 3VM5A 1W3KA 4NRRA 2WCAA 4QLKA 1V0KA 3WQ4A 3SCNA 3RILA 4M82A 1VIWA 4D71A 3TONA 1ZBVA 2Z1KA 3VGHA 1C91A 2WVSA 4HPHA 1BYAA 3KLLA 1R33A 4KGLA 3WELA 2PWHA 3WNNA 3K1DA 2GDUA 3OGRA 5HDRA 3GXTA 1I1XA 2QLYA 1DTUA 4WLCA 4AZ5A 1V02A 4E8DA 1HXJA 1BYBA 3OIHA 4P8VA 1PAMA 3RDKA 5CZKA 3LMYA 4AMXA 3SCQA 5E70A 1UOKA 1E6ZA 1KWGA 4OJYA 4U5KA 3ALGA 3NYDA 2WHLA 2OSWA 4HZ6A 1C8YA 2VURA 2ZX6A 3WD2A 3JUGA 3HG3A 2DQXA 3GBEA 4J3TA 2WKGA 4RE3A 4HMEA 2XM1A 3H55A 1H2JA 1BYDA 1US3A 3I3EA 1JXKA 5DFAA 2G41A 2G3IA 3VGEA 1KQZA 3CO4A 4AD5A 1JAEA 3VU2A 2E9MA 2QMKA 2WAGA 3FAXA 2QPSA 5I77A 1NH6A 1QW8A 3ZR5A 5ECUA 2EPKX 1G9HA 1C90A 2YDQA 2G8ZA 1E73M 3BVUA 1HKKA 3WMCA 4TX8A 1ZBWA 3VD4A 3VPLA 1KCLA 4FNTA 3T0AA 3ARXA 2YL8A 3WUFA 4KMQA 4BQ3A 4PMRA 4BF7A 1W3HA 1X1NA 5GNYA 2WM0A 1GOMA 3I3BA 3K46A 1BTCA 2VNCA 2V3FA 1MXGA 1MYRA 3CHDA 4KRTA 2PWEA 2F7PA 4JFVA 5A2CA 5HPCA 5DEZA 3BC9A 4UZUA 4AEFA 3SCWA 3WH8A 3AMGA 4BS0A 3DYMA 3MV11 2XG9A 2VQTA 2CESA 3DX0A 5BWFA 1BVZA 1PZ3A 4FLOA 1TFVA 3MUIA 4XZWA 1QI2A 1OGBA 2DT3A 4U3AA 1BG4A 2B31A 4PMXA 3AMKA 1MQPA 1UKSA 2WZHA 3SCRA 3WL0A 4W8LA 3MSGA 4GO9A 3LXCA 4L4PA 1QI5A 4Z2JA 1KB3A 2J4GA 2EQDA 1O6IA 3AHXA 5JBEA 4U3CA 3VIOA 5F7UA 2GSJA 3RO8A 4MB3A 3PN8A 5D9MA 2PB1A 1ZU8A 5DMYA 2EPLX 3DX2A 2UY5A 3GDBA 4BQ2A 3K4DA 4PUEA 1EO5A 3PZMA 4WKAA 1CPUA 1UR8A 1HJUA 4D6CA 1BPLB 4V28A 5A6BA 3GYCA 2EO7A 1WZAA 4CUCA 5DO8A 1RP9A 2YA2A 2EPMX 5A1AA 3VNYA 3BAYA 3WUBA 3AIWA 5CSYA 4AD4A 1J0HA 3VGGA 2ZIDA 3LRMA 3B9DA 2CCRA 4WKFA 1W3JA 1D3CA 5A8NA 1J9YA 4YHEA 1BSIA 2CHNA 2PWFA 4AMWA 1R34A 1W1YA 5I24A 1OIFA 4A3HA 2ZX8A 1UZ4A 2D0FA 2FH6A 1KR0A 2VCAA 5CPTA
chains in the Genus database with same CATH superfamily
1ZGLP 1BKHA 3V7AE 4E0RA 3M43A 4KF1A 1UQSA 1I2NA 4R84A 1J48A 4B90A 3ZK0A 1UCWA 3PJTA 4YHPA 1Z3GL 4MQ7B 3QYSA 4HCDA 2FQFA 3C2SA 4JN2A 3BO8B 5BUGA 2B0MA 2NDGA 2LU5A 5FYJH 3RVTC 3MV01 2E9JA 3EJYC 4R7JA 1E2ZA 1MWAA 1KBVA 3RCYA 4O1EA 1ND0B 4NPJA 2AITA 1L7IH 4BXVA 1IGIL 4TN9A 4TOYH 3CU2A 3R6IA 2VDKL 4XXWC 1WDPA 1LO4L 3A5FA 3O6FC 3WLIA 2XN9A 1IEAA 4X5XA 5FCUL 1R0AH 3MYJB 4F0SA 1BOYA 2FECL 3AABA 5MF5A 4XSLA 3UAEA 1M7JA 4JM4L 1ET5A 4FQXB 2ZDRA 4AGNA 1GS8A 1UOZA 4PRHA 4P5TB 4PULA 4DGWC 4AGOA 3HVDA 2JKXA 4IKKA 1DVFB 4WHTB 3N6QA 1B9ZA 2AEQL 2EKGA 4F8TA 4B5UA 3UGXA 3N11A 3UJFA 4XMTA 4XPFL 2C91A 2PP9A 2HP4A 4JY4B 5LG1A 4HLJA 2R1WB 3N1PC 5HGHB 2E1DA 4QCFA 3OC5A 1U8NA 4BE5A 1OE2A 4F15C 2H4EA 1FVEA 4U1KB 1YEGL 3THMH 3ZPDA 1C92A 4GNJA 3KVDD 4C6FA 4Q58C 2FFIA 3QEUA 4QCEA 3LSBA 2YD8A 4XCNB 3HTLX 5CFAA 1T0MA 5CD3B 1S7RA 3ALWA 3CSTA 5L8JB 5AB2A 3CO8A 1SDAB 1PBGA 1OJXA 1BQRA 5KBLA 2VMDA 2EG7A 5F1UA 4U1JA 1G7IB 4KCTA 3FA5A 2NXZC 3P62A 4H1LH 5E7BA 3U25A 2Q8BL 4YN3A 2Y1YA 2EYTB 1BWKA 4PBFA 1EEZB 2YEVB 5B39G 1FZMB 3P2VA 4US5D 3APYA 4UAHA 1YEIL 3WBYA 2OWWA 2APWA 1HZHL 1JPMA 1KCSH 1IEVA 3UG5A 1FFTB 3GVQA 1ORSA 3MCNA 2WWMD 3VFLA 2XH7A 1V7NL 3PP7A 2F7RA 1X5YA 2XV3A 4YVNA 4G9DB 1TKKA 3S4SB 3BZ5A 4JTDA 4ZTXA 4Q9RH 3QEZA 4MJ5A 3S37L 1Z5YD 2G75B 2ACSA 4WI5A 3KHJA 2XG5A 2OZ3A 1K8CA 2MCPL 2OJ1A 1NMAL 4NM4H 3RYMA 1H8LA 4Q6XA 5IWLC 5D2NE 1U5HA 4I9MA 1HHHA 4IMLB 3GWJA 4PMQA 3UP8A 1BQHB 1HWGB 4DZHA 3MI2A 4G7QB 1WT5A 1T4KA 2LOEA 3C6SB 1MY7A 4G8AC 3VFVB 3W73A 1SQ7A 1HDMB 3PAYA 3I7RA 3SY8A 1CF8L 1OSEA 4GSXA 3S2LA 2A99A 2B39A 4JPVH 3LD5A 3QUYA 1MJ8L 3ULSB 3VQMA 1YMHB 3IS4A 4R83A 4LRSA 3CH1B 3LKQB 2Q76B 2DZWA 4EI5B 4ZXBA 3EO1B 4HC1H 1F11B 3T78A 3PABB 2UUDH 4Y5YB 3SQBB 4IJBA 3WQ5A 3SPVA 3WLOA 4WKXA 3W76A 3WO4C 3EPNA 4U10A 4GYPA 1J4EA 3DPBB 3DVFA 1K5NB 4QTIH 3RHWK 2ISVA 1MFCL 1NWSA 4BI5A 4P46C 1WK0A 5CR8A 1T2QL 1D5XB 5CEXA 5AENA 2O61B 2DUAA 3ULUE 3RO6A 1K9DA 4AF0A 1A1OA 4KV5F 4DJDA 1GOGA 4FC3E 2ENYA 3EB4A 2JI2A 5FYKD 1EJOL 1TQVA 4X2PA 1XF4B 4R4FL 1JL8A 3EKCA 1LE9A 2ZZ3A 4UQ2B 7PTDA 4I1PA 5EB8A 2W60B 3G5YB 3TJEL 4PJBA 5F1IB 4TUJA 1TIWA 4NN6B 1AKJD 5ECVA 3MFFB 3KBHE 3ULVF 1RSCA 4RGMC 4LYKA 2W5PA 2XPYA 1CENA 2ZZ7A 4NSKA 1N5AA 1MKFA 3M41A 3ETBJ 1UFUA 2CKRA 2AKMA 1Q9LA 2XZ7A 4KO6A 5CPOA 2C6QA 5BVPH 1XLDA 4E38A 4E4FA 2W0KA 2ZVRA 1RQEA 1YNKL 2ATMA 2Y22A 5H35B 2BVTA 4UCFA 3GD6A 3UAJD 5EDSA 3D2UB 1QSED 2HCZX 2X53A 5FGBC 3DDGA 1VCGA 2J9ZA 1VGAA 2Y07H 5BOFA 3AU6A 4PN2A 3AJXA 1FGNL 2K70A 2ZKXA 4NHCL 3LQZA 2WYIA 3EOLA 3LRLA 2K6YA 3MRKA 2AZUA 5H37G 2GSEA 4W6YB 5ELIA 5DBTA 4R90H 4XN9A 1TTUA 2EZ0C 1IL1B 4K7FB 4DB7A 5D1QD 3L08A 3JZEA 1YXCA 1KBIA 2ENSA 5DYOB 2WUBL 1NLDL 2QGDA 3QGVA 2BRRL 3O06A 4FA6A 3N85L 2RDXA 2AZAA 1I7TA 4EN3D 2ZXAA 2ZAIA 2J88H 1J8RA 4LLQB 3NJIA 7ODCA 2ZNXA 3MMUA 5BVJA 1SFTA 5D9PA 1YYLH 3L5MA 4U4IA 1G1OA 5I3IA 5LNDA 3NA9L 4DGVH 1E6JH 1XVSA 3Q45A 2NY5H 3C8KA 4MLIA 1EIBA 2FZDA 4QHKI 4E3VA 1CLVA 4R0LC 3OR7A 3DDFA 1NUNB 1TTCA 3KTCA 1RZPA 1KV7A 3TZFA 4LGPB 4P06A 3IIPA 1OF8A 1GONA 1ITXA 1QSFA 5EU7C 2VEFA 5M3WA 3UJIL 1G7PA 3WY4A 2Y1ZA 1X5XA 4FQQA 4NZ3A 2FZ3B 5D2LA 4YOKA 2LR4A 1H19A 1ZHAA 1HX0A 1JGLH 3K6SA 5I6XB 3BCDA 3NOIA 3FUNA 5JPNC 3UTTD 4L9LB 4S1RH 4UQ3B 1AD9A 2J5LC 4TTDC 4HA4A 1UA6H 2QQKL 4QXGL 4JTSA 3VIFA 4TLUA 1MHEB 4LLYA 3TAOA 4XN7A 1N67A 1H5BC 4YSPA 2YCEA 2P45B 1VFOA 4MVBC 5IZ7A 5KJRL 1XSIA 5DRWB 3OWRA 4E6MA 3IJ8A 1O7AA 2HVJA 5DD0H 1FWRA 3NSJA 3BN9C 2FYYA 1CLZL 4J3OG 4QHUB 3H4GA 1RIHL 1CD9B 3N43B 4NT6B 1UP2A 1F9CA 1UADC 3RWIB 3TEZA 3MWAA 3K6DA 3CZFB 1I4FB 1V93A 3QPKA 1A5SA 3RL2B 5CPQA 3NJ3A 3ZGHA 4GBDA 2WBJD 4S23A 4F9JA 4LCRA 3FU5A 3TJHD 5HDBF 5I75B 4N8CL 4Q2ZB 1H5YA 1POKA 3U2IA 1MIEL 2INFA 3OU8A 1EZVY 4LVDA 5CIPA 2PDGA 2BCKB 3WXWL 1AHWC 3CL6A 4IISA 3QQ3B 1G4TA 5AVTB 4OHQA 3VKJA 3AMLA 1YN6B 2G97A 1OAXH 3E0IA 2F7IA 5D9SA 5HNUA 9XIAA 4NSBA 2E27L 4M62H 2IH3B 1UQYA 4AKQA 1WA3A 3RCMA 1KYDA 1R75A 3MU3A 3GKWH 3U4KA 2K6ZA 1U8JB 3DJSA 5ABGA 5I2UA 1ZT1A 2PN5A 1L9NA 3B3DA 3BWWA 3IF1A 3IJYA 3SYPA 4JHBA 1QDSA 3GDMA 3LTSA 4TUKL 3ARYA 4GP8B 4GMEA 4JQVC 4HIHB 5IMOB 4JL1A 3VKDA 1FGVH 1UVQB 4QRQA 1OTTC 1BZQK 1ESOA 2ZUQC 4UV7L 1CR9H 4JNYA 3W7MA 2PE4A 5IVZB 4LSUH 4HKXA 1DBBL 1YNTB 3P9MA 1JPIA 4W9CC 1F61A 1R2SA 2JQXA 1U8HA 4M5ZL 4PJGE 4S3JA 3TNMB 2XFGB 3ELQA 3EFOB 4DKFH 4KJWD 1AD0B 4B5SA 3ETBF 4MNQD 4NHUB 4LCUB 1TELA 3VMOA 1SDYA 1NGXB 3ESPA 4MJ2A 1AODA 2VDLB 4Z7QB 1RUPH 5ITFB 3F84A 1IGTA 4Y1TA 3SDDB 4FHKA 2YGYA 3CWGA 2Q7YB 1TJPA 3VXOA 1ZCCA 1EFXD 3BE1L 3UBHA 4FEIA 5C0FA 2BSTA 5AOLA 3PB2A 1J9TA 4JPKH 2VFEA 2VUYA 1OCWL 1R6WA 5DD1H 1P0BA 4X7TB 2BDNH 5ESQA 1GQKA 5DJXB 2BGNE 2CO2A 1M7DB 4KKAC 5IIEB 1TKWA 3KVJA 3GSOB 3BGGA 2IAMC 4HBQA 4UUJA 3UPAA 5JR1H 4MDIA 3F7LA 5FIPA 3MRFB 3VX0A 3W7JA 1J5SA 2E47A 2G50A 1HI6B 4YCOA 2KYIA 4MY1A 3BP4B 4S1DD 3O9NA 4FPSA 4WFFE 3GMNA 3MNDA 1KKRA 4OZGB 5HI3C 3IJ6A 3EBGA 2XVNA 4O02H 3O3EA 4LSQH 1J5IA 3IXTA 4NYYA 3IDIB 5KVGH 3WSQH 1I82A 3P40A 3QZAA 3PTKA 4YHLH 1ZT7B 1KPUB 1RIUH 3BLOA 2XWJA 3CEUA 4X4ZA 1R9FA 5EL1A 5HHXH 3BLPX 2XTJD 4L4VD 4ELMA 3W27A 2Y7EA 2W62A 4PMVA 3ERPA 4KWUA 5E4IA 2FYMA 2WQRA 5IFHL 2B1HL 3WY1A 3P3RA 4LJ3A 4RWYL 3SE8L 2QR0B 4HDIB 2XN9D 2FIKB 5DVKA 3WD5L 3VIHA 2Z26A 4L8SC 5GQBA 1T83C 4IJRA 4DTGH 3R0DA 4B3LA 1UKQA 4EWND 2FDMA 4JY5H 1F6PA 3UD6A 4YHIB 4BHYA 3EOYG 5IROC 3N04A 1UB5B 3DHPA 4J9JA 4Z3IA 4J3OD 5EBGA 4ERIA 3GUTB 4FQLH 3GI9H 4PRHD 4JEJA 3VMPA 4KY1L 1E1EA 2BBFA 2FUQA 4HUWA 2GIMA 5C09A 4V2XA 4MAYC 3PWNA 2BH0A 1KLYA 2CE6A 4EIGB 1ZB5A 3MCG1 4G43B 3QEHB 2ADGB 4G6KL 4OKVA 1OEPA 3K30A 4G6JH 5IUCA 3B0XA 4HS6A 4XZ9A 1GQNA 4EBQL 5D7LD 1J0KA 5DQJB 4WW1A 4HSCX 2EE0A 1UWRA 3V4VA 3QYMA 4JAMA 1GOQA 3QZ6A 4OFKA 4LAZA 1RAMA 1DN0B 2O72A 4L3EB 1W1IE 3CFNA 1RK1A 1ZTVA 3AIQA 4WGVB 4APQC 3T81A 5GJPA 1NMBL 2XYCA 5D5ME 1JK9A 2ZPKH 5DZVA 3TJIA 3APMA 4PJCB 4AZCB 4LLDB 2Y2YA 3ISIX 1QU4A 2Y7DA 4UTAH 1V3IA 3QUKA 2A0NA 3VUSA 3CN0A 1AIZA 2QELA 4UMBA 2BASA 3HQ1A 3BW3A 1UATA 3ZKXB 1JGIA 1P53A 3EA2A 2YMTA 4L3CB 4U7SA 2AXGA 2OQJB 1U6AL 5ANMA 3LY0A 4M6NL 5LHFA 3GHEH 2F19H 2J43A 2DLFH 5FHBH 3WQ8A 4RNRB 3GSNB 3PGFH 1R7OA 2RJHA 3QUMA 1KULA 2OZ8A 2ESVA 2YL6A 3RFZB 1GW0A 4NO5A 2Q86B 3FB6A 2IMNA 4XXCA 4ZFZA 1M65A 2C1OB 32C2A 5H37H 1GVFA 1I85C 4R96A 1ZHKB 5EEYA 2VDMH 3PSVA 3A13A 1YYML 2R0WH 4RRPG 4D8PB 4IOFC 3NFNA 4C90A 3Q8AA 4WU5B 2EXSA 3KLHD 4IKNA 1E65A 4Z1AA 1QACA 5HGBA 1YDPB 3CVCA 3C2YA 4RFNB 4Y9EA 2FQEA 1MLCA 1UP3A 3VI4B 3QUYD 4UT9H 3HRZB 4OLUL 2CLRA 1FHNA 4HFUH 5EF0A 1E6NA 1BVLB 2ZP9A 4ZXBD 1QFWM 3TZVD 5HXMA 5I1CL 3WJMA 3JU2A 3ZKND 4Z0XA 2WQXA 5AVZB 3NK4A 2E6QA 2BIOA 3P2BA 1WB0A 2VDKB 5EOTA 5TE4L 3K2UL 1EYWA 5J12C 2VRKA 3G6JF 4U1IB 4ERSH 4JQAA 4OZOA 3UJJL 3M7FB 1ZLVH 4MNHA 1I1AA 4P23D 1W0WB 3HOJA 5C0CB 2R1NA 4MA3A 3WSUA 5J11B 2UY7A 2WCAA 5EPMB 5XIMA 5C5YA 1VIWA 3SGGA 2BSRB 4AHQA 2UXFA 5GRWA 1IF2A 1L9RA 1VBGA 2GDUA 4ZUWB 1V02A 2RDUA 1G9NH 1U1UA 3OIHA 4YYFA 2J72A 5FJPA 2EO9A 1E6ZA 5C92A 3ZDYF 2M1KA 3X1GA 4LFYA 3UQNA 2IXQA 2WKGA 4GSRA 1QZNA 4J3OH 4PGZA 1IQDA 1AGDA 2AF2A 4XNUL 5CILH 3O05A 3G1DA 4F48A 4MGXA 3MRBA 2WAGA 3HUJE 5GSRA 1N6UA 4LAQH 1GGBH 2QKFA 4QY8B 2Z1BA 2YL8A 1OQXA 4WFED 3GLCA 3ZE2B 1T21A 1I8LC 3SJVA 2UZXA 4Y9OA 4YSTA 5DK2B 1R0MA 1QVOA 2ACQA 2J8UF 2YN5A 4PB0L 3UF9A 4N1HB 2ZKWA 2BP1A 4KK9D 4N6EA 3TVMA 5PTDA 4BZ2A 4YDVB 5JHDD 4L4PA 2ZD0A 1BXUA 3GRWL 3GNML 4H01A 1I1YA 1XF2B 4NRYB 2FL5B 4XWUA 4HEME 2EPLX 3WCYA 4YSCA 4ZFFA 1S7SB 2VXVL 1VPQA 4JQIH 1BPLB 2ODHA 1Q8JA 5EU5A 1BD2B 43CAA 3MRPA 4FOUA 4W9ZA 1R30A 3PJSA 3QUZA 3HN5A 3WUBA 1TO4A 1TWSA 1J9YA 3P0XA 3BW4A 1M42A 3P4MB 2OK0L 3IPBA 3QJUB 4PSRA 5E6UB 2VAJA 5EH1A 4WK2B 5GGRA 5KOVC 3ZIYA 3TX9A 3QORA 4K36A 3OKMA 1Z3RA 1E28A 4EAYA 4GYBA 3QGAC 2X1OA 1JXFA 3GC5A 3ML8A 2Y25A 2DRUA 5ABFB 3K80A 2DT2A 4PBXA 3FHQA 5G1TA 5DMIL 4AVNA 1QFUL 4UQ9A 1KTNA 4FLQA 1U1JA 5SX5H 4WNSA 1JF6A 5BOOA 4HZAA 4HEPG 1E5JA 4J3VA 2ZJSH 5HJ3A 4I7UA 2ZBTA 4PBVC 4M02A 4YGVA 2DQJL 3H26A 2H8ZA 4Z2IA 4WRLA 3W37A 3VIMA 4PB5A 3M86A 5DS8B 2Q7NA 3DX3A 1NDYA 1CG9B 3E6FA 3NABL 3Q6GH 4UMAA 2GJ6B 1HJVA 4DPAX 1G0XA 4JPIA 5DVPA 4ACYA 3N29A 3P69A 2RCSL 1DJSA 3WEMA 2GJRA 4JEGB 4N22A 2RJMA 5TTRA 4LC8A 2XX1A 1KY6A 3QUGA 3G8EA 1XINA 1JWUA 3BEVA 3Q5YA 1J93A 3BVTA 3ZR6A 5EU6B 2J55A 2WWDA 4NOFA 1NFGA 3M5YA 2CBPA 2VXSL 3SKJL 1P4BL 4X42A 3QAQA 3BP5B 1XS2A 3UIYA 1UTDA 5T5FA 3W1AA 2BY2A 1PX8A 2BC4B 4M6QA 3MBEC 5KYWB 1IM9A 3LEXB 2WZMA 1I7ZB 1UWTA 1U8IB 1JNEA 4KKZA 4TL4A 5BS0B 4TV6A 1WBYB 4PJ9A 4EPKA 1R2RA 3F7VB 2BOLA 4J1OA 2PBGA 4I7WA 4NZJA 1WFJA 4IBUA 1HHGA 3TX4A 4Q4PA 3R5EA 1WDRA 3N6YA 1OADA 5IFAL 4NQSA 3US0A 4CADA 4HPJA 4PRID 5AVVB 2EC8A 2V8ZA 1BWLA 1RUQH 4GRWF 1I3UA 3C5JB 2KQNA 5EG6C 1QHZA 2HKFH 4KAQH 3WKQA 3L1OL 3JTBA 4URKA 3CG8A 5T33H 4JGDA 3UYRH 2V8LA 5AW4B 3RGVA 2C8NA 3BPOB 1FPTL 4GVHA 2TSAA 3T09A 4JN1L 2CMRH 2FTAA 4F7TB 2P1YA 1YBQA 4Y2DC 1MCKA 2DSUA 5I23A 4W68A 4RGNE 2R24A 4YXKL 5K4ZA 3C8NA 3D48R 1TJ2A 3EPOA 3LSCA 4B0MB 3HLAA 3V0HA 1ZLWK 5IJBC 4LUIA 3JWNE 2OXGA 5DO2C 3OPZL 2OZ4A 3ZTJG 3NR0A 1THCA 2QFRA 1I6NA 1UZ8B 1SSGA 4C6LA 1D7KA 2X1QA 3DA0A 4HZ1A 1HIML 1IE7C 4ZMGA 5B1KA 4AZ6A 3KW8A 3RWHA 3T1WA 4J2XA 2YR3A 3WH9A 2J7EA 2OMXB 1R3IL 4D6GA 1OAKH 3S8GB 1JRHH 3QWRD 2CKNA 5C07A 4ADTA 1RJYB 3QPQD 3FQ4A 3B05A 5CGYC 1VCFA 4EPBC 1JN6B 2A1WL 4PTTA 2EO1A 3UADA 1MFAH 4J6RL 5GSVA 4X5PA 5E5RB 1JHLH 3K6FA 1DV7A 3LD8C 3DYOA 1UKPA 4MD4B 4F0KA 3GO1H 3KPQB 1S8DA 2G60L 4FNPA 4KX8A 3MRJA 2OMBA 1TJ0A 4HJUA 3ZMRA 4LRNL 2ZONA 1UKTA 1MZZA 1QQDB 3GMOA 1P7TB 4WKZB 3NSXA 2YPIA 4XPHH 1NC4B 2J5WA 1E56A 5I3KA 2VIRB 4QO1B 1MDTA 3V0WL 2RGMA 3M0LA 3OJGA 1S2WA 3PDOA 3CSYB 4QRPD 3SKOA 4QXTB 4AYFB 2IG2H 4W70A 3HQNA 2YD0A 1G94A 2J44A 3QJRB 4MVAA 3NJFA 4UM8B 2WK2A 1CQKA 1EHLH 8A3HA 5IB1A 3RZCC 1JCKA 4AC2A 2E46A 3ZE1F 1V55B 3B2VL 5I1GL 3EHBC 4UNTA 5JVLA 1XGPA 3PP3K 4XVTL 5ANHA 4NQDB 2H9GB 3I74A 3QHZL 4NC1E 3LS4L 4KFMA 3IN2A 3KPPB 4JIIX 4OVXA 1CFTB 4NQXA 3QARA 1RJZB 1YEEL 1A9VA 2DTML 4EO5A 1QR1A 2OVLA 3TFXA 3QZBA 3WIAA 3VUPA 1GQLA 5IFTA 2DQ6A 4LS1A 2B2XH 2BNQE 3Q94A 5K1NA 3RUGA 5HPMB 1BG1A 1W5MA 4BFOA 1GXEA 2OWXA 3R1GH 3L9YA 3LYEA 2NX5E 2Y5EA 3K74B 3ZVHB 2QQLL 1HINL 3SBRA 3HCVB 5FFGA 5B8CC 1M1XB 2NV1A 3RNKB 1LD9B 2NY1C 1JUEA 4Q6IC 3V4PH 5BNXD 3LV5A 5I3HA 3E1F1 3OHXA 1EJSC 5DZ9A 3VAVA 1SO5A 4H1LG 1MZHA 5BXRA 3ZE0F 1VENA 4ACZB 4C6QA 2AEPH 3T0EA 2ID5A 1RUKL 3H7BB 1BIIB 5HYSA 3NAAL 1KGCE 3K4ZA 2O4EA 4PB9H 4CC4A 5HHVH 5KBKA 1HCVA 1UB6A 4X60A 1DCEA 3CJPA 3ISYA 2HLAA 3LMJH 4GX8A 1FHGA 1X3DA 4L05A 3FSOA 5I8KL 4Y4FD 5C2BH 3IDXH 5KG9B 4YMPA 3K0WA 5IBTL 2C16A 2BSSB 4H6QA 1M7PA 2QDWA 1W72A 1A6WH 1T0NA 1A0EA 1AOHA 3VI3A 4ZOBA 5AVQB 1HWHB 5F9DC 1EUAA 3TS8A 5CP3A 3ZHDA 4AD3A 4N2IA 5HYJA 3W7OA 1QWGA 3BXNB 2WXIA 3BT0A 3UTSD 5JIWA 4Y1AA 2ICES 3MBWB 3UO1L 2JF1A 4IF2A 2VI0A 4GINA 2VYRE 4IMAA 4LQFH 1VEMA 3S5OA 2ESVD 1Q0YH 4JO3L 2E6FA 5F9OL 3FU9A 1T6BX 2VDLL 4E42A 4Q8TA 3WS3A 5D96B 2I9UA 1SM9A 1PSCA 4FXGC 1NU5A 2HFEB 4JQ2A 5BRZE 3F5WB 1ISZA 4ZE5A 2J8OA 1LL6A 4NFCA 3CPGA 3PLYA 3HZKB 4JFOA 4M5PA 3FXIC 4I88A 4K3ZA 4HIBA 1CS6A 1VFHA 1AR2A 4HJ0D 3BMVA 5I71B 3T6VA 2QVTA 1HZKA 4LSTH 3QXAA 2C18A 5JW4Q 5SWZB 4B27A 1I8JA 3KUMA 4PN6A 4YEFA 5AHEA 3PU7A 1TIUA 5DJ8A 5IB4B 4NQCD 5CU5A 3DX9B 4GG6F 1Q0EA 3BJ91 2YPLA 1AJZA 4N24A 1U30A 2VJXA 1I3RA 3OSVA 3OMIB 1BZ9A 1C93A 3NAVA 4NQ1A 1YMME 5CINH 4HNVA 5I09A 1CLOH 3R7RA 5IMMB 3TO4B 4BJLA 2IEPA 2H6PB 2VGIA 3P9WB 1I1AD 4YFDB 5F3HA 5DT1H 3MP4A 2IBZY 2JB6B 3U1SH 4OTXL 3TU6A 4NKDA 1XRVA 3QEGH 4ES8A 2Q71A 2PW2A 3AALA 3HOGA 3PZOA 4C6IA 4LOUC 4BSJA 3MV8A 1AG6A 1YX1A 3N73A 4YBQD 1Q65A 3ESOA 4HKZB 4MWAD 2DVUA 1BAFH 5GIRA 3OVGA 1UWEL 4Y2OB 1M7OA 4REQB 4RFEA 4KITB 5FDWA 3LBMA 1MQKH 4IIGA 1EQWA 3TU9A 2PDPA 2WANA 5LJYH 2FATL 2AQ3A 4QHNA 2R2EB 2DZSA 1NM9A 5IVXA 1S78C 5SWQB 4GW4A 4OD3H 4TSAL 3AXLA 2G4EA 2ZWNA 1SR0A 1FAIH 4AI7A 3W6YA 4XAKD 4GZ7A 3GXDA 2F53A 1RIVH 1CCZA 4DP2X 3CPUA 5IBLC 2PMZA 2FHCA 1JIBA 2ENPA 2PXYD 2HMIC 5IQ7L 4D9QD 4L9XA 2W67A 4LF3B 2PYEA 1KCUL 4OUUB 1IQ8A 1NLBL 2HXUA 3MZ2A 5EN3A 1JFHA 1XIDA 4G7SB 4F3FB 3FY1A 4XPAH 6FABH 5CJOH 4JFSA 2VITB 4NJAL 1TQJA 4JUTA 3JVGC 3H22A 2FJHB 1PW3A 3ZYZA 4ZEPA 3O6FB 3O6AA 1RBOB 2QF7A 4Y8FA 5CC7A 5D71H 3ARDC 4FFZL 2AMGA 1LEGA 4WIQA 3E49A 5E8DH 3M7WA 1ZA6B 5TE7H 4LX4A 4NQVB 2QHAA 2HFGH 1KT2A 3QRFM 1U8PB 1B3OA 3QUZD 5AEAA 2ICEB 5IJVB 1CVRA 5AC6A 4A63A 3STEA 4R5XA 1YQVH 3KWWA 3A6CH 4QRNA 4I0CC 4IKJA 2A6IB 1PKQB 4OIIL 4EUPG 4XNQB 5A2FA 1DQJB 5HSFA 3R1ZA 3QUMH 1GQJA 5H4ZA 3D0CA 3MJ9A 4GAJH 3I6KA 2OMWA 4A6YH 3O9WD 1NM4A 2EECA 1BGXL 2QTVA 3MGTA 3ZTJH 1B4JL 1XCTA 1CXLA 4FOMA 4GS7C 4LFHG 4HNCA 3VILA 2PCEA 5ALBL 1IZCA 4XAPA 4L7ZA 4WOZA 4UR7A 3VXMB 4OQVA 3QH3A 1DVUA 5HHOE 2ZC1A 4MZIA 4WUKH 2HT4C 4V2CB 2I07B 3VD5A 3LJ3A 3QHOA 1PVNA 3GHTA 3BKJH 2R91A 1FCCA 3G5VA 2DZPA 4HS8H 4ZMAT 4E5XA 4B15A 1NDMA 5TE6H 3NVTA 1GSMA 3P5ZA 4M56A 3LDVA 2DW5A 2N4IA 4AZIA 1K02A 3T0XA 2HT3C 1BRLA 4CDHA 5FF6A 1N3NA 4DK5A 2JI3A 2G0LA 4L23A 3MLSL 2L4OA 3PR2A 2NTSP 1KJ3L 3NQCA 2CRIA 1XG3A 1CGSL 1TV4A 2YL5A 3MRIA 3KPRB 2HISA 3TN5A 2CIKA 2EJ1A 5FO9B 5FAAA 5AOMA 3GMLB 1ETZB 2C3ZA 4U2YA 3RX7A 2GJXB 3TP4A 2HYMA 3KXFD 4Z7WB 1AQ8A 4FGMA 4HYRA 5E1HB 3T0VA 3HE7C 4LBUA 2ZRVA 1E4WL 3L9CA 3UR5A 2VLKA 2O92A 2NY4D 3OKDA 4XC1H 1F58H 4D6FA 3KOYA 4M6ML 2E5CA 1OAJA 1UWQA 4KEVA 3V0JA 4BM7A 1LG1A 2G2NA 4H25B 1L7TH 4UILH 5ABZA 2MCG1 1NCNA 3CMOH 3F2LA 3IDMA 4GH1A 4JFUA 3GSUA 2NYYD 4QGCA 4ATTA 1NFIB 3PNZA 2ED9A 5FO8B 1TJRA 2A6DB 4JFDB 3RGVD 5IW6A 3BUYB 1PD0A 4AQ8A 4UFJA 2BVUA 2E9IA 3A47A 4TPRL 1I8KA 4ZUUA 4X0KB 4MDOA 1JZGA 1GHFH 4IJTA 1FBIL 1SHSA 4MTVA 4WJ5B 4DPPA 2ZXDA 1BF2A 3EJQA 4PUBH 4F7PB 4ES4A 4AC1X 1DQQA 4PJDB 1VRDA 4YE4L 3RR4A 4P46B 1EX0A 2H0JA 1IZKA 5IEKB 4OD1H 4OZHF 1QNIA 2BSLA 1K4DB 5GRZA 4C6PA 1NA8A 3K6IA 4AZBA 1BVKB 3RKPA 3QZMA 2BTMA 5FYJE 1AGEB 1KC5H 4L4TE 1AZBA 1MW3A 1NOUA 1H51A 1G9MC 2O5ZH 1KDIA 4OM1H 1B3YA 2ZTBA 1WC7B 2DYSB 1BLIA 3V0VA 3MDJA 5FSDC 4YO0A 1XLFA 3LKNA 4GY1A 1EPFA 2JB5L 5EWIH 5KETA 1KTRL 2HAZA 4FFVC 2XJKA 3O2DL 4DO6A 5FB8A 2OO6A 4G7VL 1XZWA 2A74C 3DV4B 5G4EA 3ZZLA 2GK1A 3HS0A 5FX3A 2Z91B 1H3PL 1FRBA 3L4ZA 4N2DA 3PHQA 2NUTA 5ISZB 2FHBA 1NY1A 4QUOA 4JM2C 4LCWA 3V55A 4ODXA 1QBML 4TNEA 1U8LA 3CQHA 1XC6A 4PJAF 1MCWW 4LB8A 3QEQA 4OJAA 4HH9A 1PZDA 1FH5H 4KTGA 3WMLA 4TF4A 5KSVA 4BFGA 3AS0A 3GQFA 1LUCA 4R27A 3RQ3A 3NJJA 5I0XA 3RFAA 4MJIE 4XXDB 3GGWA 2YLAA 4NZ1A 4JYFA 4JG0H 2XWEA 4AKPA 2YBTA 4NKMB 3QHMA 2Z1WA 3WQ4A 3REQB 4M82A 2QSQA 3BQUC 3SBFA 5IEHA 4M48H 3SCMD 4LY4A 2PWHA 4LFHD 2CDFA 1R5YA 1AXTL 1U3HD 2RTTA 1D5BA 4JTHA 1HXJA 1XIBA 5LGJA 2DQDH 1AZNA 3MCOA 3LS9A 4U6VL 3BD3A 3S96B 3IRPX 1F13A 3EGXA 4RNFA 5DVOA 2OSWA 5J57B 4BEIA 4CEXC 4JRWA 3M0JA 2R1KA 4LSRH 5ID0A 1JXKA 5DFAA 2UWEE 1K2DA 2AEOA 4AD5A 2CR6A 1JAEA 1AK5A 1TRDA 5I74C 5AW6B 5MEQA 3GVVA 3WQFA 3G5XA 5DRNB 4CSPA 4N8VG 5KN5A 4RX4A 4U1MA 3WLQA 1YY8B 2JWYA 3OBKA 5T5FH 3PM6A 4JEQA 1B4RA 2PLKA 4M4RA 3OB0K 1YAIA 4Y4HA 4KRTA 2F7PA 1BM3L 5JPNB 4GPVA 3MRRB 4IRJA 2Z34A 2ROYA 3BGMA 3S34H 2J5LB 3D39A 3U4BH 3FT2B 1RZ8B 4U3AA 5FM4A 1JRHI 2PRLA 4ZFGL 2HMCA 4CNTA 1RZFL 3L3KA 1SFDA 1NDTA 3USBA 3IKKA 4U3CA 3VIOA 4KVNH 1LQ2A 1JWMA 1W8GA 4LSSL 3T3MB 1TJHH 5L6YL 1H1YA 1OC7A 3QB7C 1IIHA 3AG3B 2OMYA 2EHHA 1WBZB 4IH3A 1J8VA 3FO0H 3FFCA 2VR8A 3WMPA 3MRGB 3EYOA 4AD4A 1AUSL 3VXQB 1PG7L 4YHEA 1Z5HA 3BIAX 1AG1O 3QA3A 5IGXH 5CLYA 5FUOH 4AM0A 2VCAA 2G95A 4H44C 2OMZA 3VFUB 4G42A 1CXEA 5BQ7B 1W6TA 2EPNA 4N2NA 4JFWA 5HYJD 5GRXG 2YKKA 4NP4L 3GSVB 4LCIH 2X4SA 1DQKA 2C3VA 1A4KB 1QI3A 1TZGH 3D05A 2AGJH 3LVTA 4FXRA 3T40A 4LCYA 4O12A 2X40A 4D0BB 3LCLA 3WAJA 1EAOA 5K39B 3B8TA 3SGKC 3VI2A 1DLFH 2PF6A 1HILA 3IMRA 3B0YA 3O6DA 5DZPA 4NNXA 1KCRL 4UQIM 2J9YA 1O7SA 4L1BA 4KKLC 3RVVD 1VGEL 4GIOA 1NBYA 2P43B 3L4XA 1A6AA 3IKCB 3TBVB 4O2EB 1F2XK 1HKFA 2A3BA 2NX3A 4GZEA 1YHTA 1OFDA 2ZUQB 1YPZB 3EJZD 3N55A 4PV9B 4EXQA 4CCEA 2DI7A 1VBRA 2PR4H 3NZRA 4XV0A 3SY6A 3T9PA 3WF2A 3V5KA 5T1KD 3WQDA 2A73A 4OCYH 4HV8A 3SCPA 3SW6A 4N8UA 4OSUL 1WV7T 3KBPA 2Y2WA 1XIWC 2FLRT 5B7FA 4WNQB 4EUPH 4KWWA 2WQUA 5KS9E 4N25A 3W1UA 4JQXA 5F2MA 3QZPA 3TBTB 3EWXA 1T5XB 5IF0A 3FZUC 1ZRQA 1O9ZA 1DHKA 1ES0B 2IWKA 1C16B 2V0AA 4MCNA 1EGJA 4AIUA 2ZXQA 2CBTA 3CFBB 1SMDA 3LZOA 1WDQA 3WLSA 4P9HH 3IU3A 4YZFE 1A7QH 3JV4B 2A3CA 3N41F 3UGRA 1LP9F 1BFNA 2DEWX 3TYGH 2O9PA 3MSRA 3DU0A 2IAMB 4KFZC 3PWPD 1GORA 4PW3A 5LCVH 5JZ7D 5FOOA 1JPGB 3NSNA 5CEYA 3QYQA 2AV1A 3N2XA 2XKUA 4O00A 1A3XA 4Y96A 3FYEB 4XI5D 4XP9L 2PCXA 3NEVA 5D7JC 1NCAH 4GE8A 2E56A 1UWUA 3GU9A 1TJGL 1BQSA 2H2PD 1WCQA 1BF6A 5I5IA 3MTXA 2OMUB 2VMJA 3ILPB 4G6MH 1R86A 5FYKH 4N9GB 2GVLA 3DSNA 3FX4A 4O1CA 4QHMB 5EEXA 3RLSA 1XBDA 1GPOL 3WKMH 1T04B 3FTYA 3MJMA 1ILSA 3FH8A 3U30B 2J20A 1MWOA 3H7UA 1OAQL 1F18A 1FVPA 1SOSA 3QHTC 5EIVA 3UH8A 2AQRA 4HGWA 4L3FA 2YEZB 1KLUA 3WQOA 4KUZL 3KJ6H 2PYED 4BFRA 2BW4A 5E9DA 1JGDA 2G9HB 1SFJA 4TULH 1TV7A 5AUMB 1F90H 1DJNA 1S38A 2WW5A 1AHKA 2UBPC 3RJQB 1NGPH 1OCOB 4FQ2L 3GE7A 4YFLI 3AYSA 1KEGL 1RJCA 2A77L 3CUFA 3KAAA 2C9SA 1O66A 1FZJA 4CJ0A 3HPAA 4OLXL 4L8SB 4ZNEE 4ZS6C 3LEYH 4X9SA 1N8OE 3AICA 4ICMA 4KDVA 2BLEA 3GBNL 2DQGL 1W72H 4XRCA 4PVLA 4GQBA 3TXZA 4QRRD 1IGJA 3WTXA 3IMWA 1DLHB 3F64A 3PIQA 2XDHA 5CP3H 4K9EC 4XQ6A 4NP9A 4NAQA 2PD5A 4XK2A 2BSBA 4DGYH 2NXYD 5INDA 3T4YB 3V0DA 5CN3A 4HPNA 4UCGA 1RHCA 5DCEA 5CZVH 2VMEA 4HA3A 3L5HA 4MKNA 1TYJA 2XIMA 3GVWA 4KERA 5ITBH 1NBZB 1E4KC 1UM4H 3U0WH 2DQFA 2Z8RA 3SN1A 3W84A 1PDYA 1ZLUH 3HR5B 2JSFA 5I0ZA 1RK0B 1FG2A 1QNQA 3CHRA 1JV2B 4PG2A 3BWUC 2HH0L 1I8IA 4TUFA 3HC3H 3OAYK 1QWUA 4LLWA 2LHAA 4FQHB 3HI6L 5FOBA 4APQB 3VXRD 2DQHH 4FHBD 3CDCA 3FU7B 2OXNA 1XMEB 2WINA 2IFGA 4RR4A 2QVIA 1QEWA 2CDEA 4NBZB 2MWCA 4KEMA 4X6DB 1DKWA 1DSYA 4U6HB 2YZRA 5F88A 5DD6B 1YUKB 5D8JL 7TIMA 4UOW0 1ZWIB 1D3HA 2NSQA 3OZ9L 1ZTXL 4QYOA 4PJ5A 3BDKA 3WQVA 1BMWA 1YNQA 3R8HA 2SFPA 4BD4A 1QSEE 4WJEA 2RH0A 2ABAA 2FVLA 1MCFA 4F66A 2AI0H 2EVHA 1A7OH 1HP4A 1EZWA 1KA9F 1YN7B 2B81A 2JCCE 4OF8A 4G9FB 2Y88A 2XVLA 1JF1B 2FE0A 1A7NL 4NNYA 5KBDA 1KEML 1H7WA 1FWTA 4J4PA 5D1QE 2W9EL 3L7RA 2PURA 2YQBA 1XTMA 1RI8A 1ODUA 1LK3H 2F1BA 3UNDA 1OAYH 1UR1A 2OOFA 2BHUA 5T1MA 3LCYA 3PANA 2O7QA 1Z9LA 5HBBA 3N40F 3T0DA 3WIFA 3QWOA 4ONHB 1T7VA 3VW3H 2K1MA 2Z64C 2KT6A 1V51A 1ZKAA 1TCRA 4QAWA 2YJLA 3EGDA 5J8LA 4PY7A 3ARBA 4B9YA 4S0SD 1RULH 1TYEB 4UNIA 4H9MA 1LGVA 4MJ6A 3V8OA 1T7XA 1JK8A 3FF8A 4PI0A 1NOLA 3SDXA 3SOTA 3G6JA 1I1FA 2G5RA 4YWIA 4ADGA 2WN2A 4K8RC 4G8GB 1GTEA 3CU7A 4DF1A 3DXIA 2NW3B 5LUMA 4C91A 3IFLH 5L8LB 5I17A 3EDDA 1G7QB 1U8CA 2OFJA 3QJOA 5KVGE 3UDWC 2JKPA 2JQMA 3JRKA 4JY9A 5J12B 1U5JA 2NLYA 1KJ2A 2ZKYA 4N90E 2FGLA 3IPWA 3FT3B 3GIVA 3FYIB 1QZ1A 4M8QA 3ITCA 3PYCA 1XFPA 5L2JA 3E5PA 4JANB 3UXKA 3GSWB 3WUZA 5KAQF 4HBCL 5C55A 3ID7A 4JO8A 2YAFA 3IDJB 1ISYA 2NZ9C 1WOBA 3IK4A 2NY0D 3NRQA 3B3IA 3X14A 4WEMB 4F3HA 2MUCA 1XPYA 5FM5O 4B60A 3UJSA 1IIIA 2J3SA 5LBSH 4P2QB 3K0YA 4RK8A 3INUL 4MS8C 3D33A 4PTUB 3D4CA 3F05A 1FNFA 4Y1SA 2CGYA 1XX1A 1OK6A 5AHIA 2JXMA 2CLZA 1QFEA 3ZUCA 4PP1C 2Z1PA 5AD0B 1GYWA 1HKLH 2IH1A 1EJ6A 2NY3D 4PJFF 2XSBA 1BKSA 3H9SB 3WIJA 3QEQD 1SLVA 1SJHA 4ZOEA 3MDWA 3M1BB 5B38B 2MNWA 3BPCB 3AREC 4QOKB 3MJ9H 3BAWA 4KK5D 1W1A1 3VOGA 4J2MA 2ALAA 3UBXA 3DX8B 2Y70A 1BXBA 1RMFH 4TRPH 4JZJC 4EPDC 2FWOB 2OR9L 1ADQL 2Q02A 3JZUA 4LALA 3P30H 3AMDA 4G7YL 4DYJA 3SGDH 4YHZL 1VH7A 5J3HC 1RLBA 4WWKA 2IALA 1KB9J 1REQA 4L1WA 1A5AA 4XAZA 1WZ1H 4ZMLA 4DUWA 2QNEA 3QQ9D 5FIEA 3GAYA 3RUBL 3NJXA 4CQBA 4Z2HA 5E6ZA 2J75A 4L65A 3PAOA 5E2VH 4YDLC 3W25A 2HVBA 1VBUA 2Y06H 3OAUL 4OLEA 3AYVA 4OW6A 4OZIB 1GOOA 3CH9A 5LB1A 4AIZA 4M3KB 4DJDD 4URIA 3UJTL 1MWAH 1W0YT 4IBLT 4MNQE 4GQPH 4M80A 1OFBA 5ERWA 1ME7A 4AUUA 1X4YA 4GWEA 3TCSA 4RDVA 4JTAA 4IQJA 4A68A 1HH6B 2ZDSA 1MFEH 3QNXA 3R0NA 4GUPA 4X4YB 5KSBF 3M45A 3MACH 4I18A 2WC7A 5I1HL 2FJKA 2G5WA 2UZYA 5K2ZA 2H45A 1AANA 4RV8A 2W07B 2KLSA 2HVKA 4X8JB 5D93C 2MQ0A 4WU7A 4YSAA 3IJHB 1M6OA 3A6OA 1M1SA 4Z0JA 2EC9T 3VFRA 1G1CA 4UMSA 2P8MB 1KXQE 5A16B 5DTFA 5KSUA 3WQWA 4RQQA 1F6LL 5E03A 5K9JL 2GQ9A 2J8TA 1VFFA 4YDKL 4D9RD 2FR4A 1KN2H 4UQDA 3FFCD 4B9PA 5M03A 1E8XA 3UZEC 2WUCL 2ZZ2A 4TTGA 1UT9A 2GTWB 25C8L 6A3HA 1YIXA 1INEH 3DKHA 4WO0A 4BSWB 2YQ3A 2WYSA 4O0KA 3D51A 2XWDA 4DLMA 2JIWA 1GIGL 1MCCA 3Q44A 3ZT7A 2TRHA 1Q6OA 5HDQL 2GJJA 4QRSA 1PS3A 4YVVA 1YPIA 4LE8A 3BK0A 2X4RA 3U9UA 1RBAA 2VDRH 1SDDA 4MJJA 2DWEB 3S5SA 4Z7VB 5IOPB 2CBMA 2XTJE 3NESA 4L4VE 1X8FA 1KM0A 1GA2A 2PTDA 2ISDA 4Z7UA 3GHRA 4DNMA 4UB9A 4MA8L 2DWSA 4CMMA 4KWOA 2FQIA 4X7FC 2GJPA 3AUOA 5I73B 3D46A 1AH1A 1FG9C 5L88H 2XU9A 1K03A 4YCPA 3G5WA 3CFEA 4XMLL 4MLSA 4GT7A 2UWFA 5LNEA 1FZKB 4N2LA 1QSFD 4XBGA 4D94A 1JGVL 3THCA 5AOUA 5MENB 2Y7NA 2QW5A 1XI3A 2E3ZA 4QTFA 2Q6WA 1H09A 3HB3C 4K3JL 3D08A 4Y2DB 3V35A 3HZMB 2ZUSA 4E9VA 4FG2A 3UC0L 4B4HA 1TWWA 1JGEB 1PJ9A 3QUXA 5I78A 2J7DA 2WNQA 1AFVH 2QVMA 5FAGA 2BFVH 1XISA 4FTDA 3EWBX 2QKSA 4KRMB 3E8UL 5E2UH 3L3OC 3SHSA 5D7LE 5HI4C 4QRAA 3WNOA 5L7XH 4QTHB 4FZ8H 4RETB 2AAMA 1NIBA 5SWSA 2B3IA 5I8OL 4I3SL 2QCEA 4OGYL 4CQDA 2WIIA 2XIOA 4OCSH 4J4KA 2IPUK 5CZXC 3FYPA 1NGQH 1RK6A 4U1HB 2JFCA 4NI3A 5J06A 3SQRA 5C7HA 2Z4QB 1M2VB 4GRMB 5I26A 1QTSA 2QCFA 4M7JL 4IQEA 3TW6A 1T7ZA 1F02I 4NM8H 2X2HA 5H8PA 4G8TA 2BLFA 1AS7A 4ZJ9A 4R5VA 3KL0A 2GCYA 1L8NA 4F0RA 3DYPA 3F01A 5GS2D 2OW7A 1JNDA 2VDGA 1OG0A 2VDNL 2YSSB 1TJIH 1CGVA 4DPRA 3SKNA 5KZEA 4ZMXA 2QGBA 2BNRB 5IHZB 1AZZC 4QLWA 2OMVA 5F97E 4KVCH 5DZNA 1IKNC 3SQLA 3FOLA 4M7KL 3VFNA 1ZS8B 1RERA 3P0YL 3KBJA 1UG9A 4G2AA 2V17L 2A3LA 4E8CA 1U91B 4KZDL 3PFUA 2QZ5A 4TV3A 4I9JA 5FC9A 2PDUA 4LLUB 1QP1A 1HO1A 4OT7A 3L2IA 3W00A 2UXVA 5FO2A 5MEOA 1X6LA 4P5UA 3T08A 3MS8A 3ATFA 1U4FA 3SFWA 3ARFA 4UFKA 4R3UA 5F7DA 5E9DD 5ENWB 3V7MA 3EHBB 4WY0F 2OX1A 2R0KL 3B3BA 3VSTA 1DBJL 2HSIA 4OFCA 4YUEL 2WLIB 5JO5A 1MI5E 3ZIMA 5IB2A 4M1GH 1HSBB 4PJ7F 3S88H 4DJEC 7CGTA 3CUPB 1Z7AA 3SCTA 4JFQA 3T6XA 3VSQA 5A7BA 1I9RL 1J8KA 3CN1A 5CD5D 3FUMA 1H3WM 4MDJB 2D24A 4CD5A 2Y85A 4NNBA 2OQYA 3D12B 4IM8A 2W27A 2OMNA 3TFBA 1LCOA 5IKCA 5DJZB 4L64A 4PJIF 3SBQA 3I9AA 1OCBA 3UPBA 5C0ND 1QK2A 1RL1A 1H1NA 2O93L 2ZUYA 2NY1B 3OZMA 4JYEA 5CEZL 5E99L 7TAAA 1PLBA 3HQOA 5A40E 4DN1A 2Q8AL 1RK5A 4GKZB 1MQ8A 3RM4A 4JHAH 5EUKA 5D2NC 3JV6B 4N0RA 2D1ZA 5B1JC 4QDPA 2F54B 5I1EL 4LUYA 4GUHA 3TONA 1T3FB 3VGHA 3TBSA 1KN4L 4FHAA 1FY6A 4QR6A 1TV8A 1UWYA 3BIKB 1KFLA 5D1ZC 1PAMA 5LQBL 1NCBL 1BZ7B 1QA9B 4D0CB 3NYKA 1IAOA 2ATAA 1RJRA 1N7ML 2G3IA 3VGEA 4NWTH 4DZBA 3S0PA 5L4MA 4LSVL 1SJEA 2BINA 4BR1A 1ZCOA 3BIBX 1KFAH 1SXZA 1WS8A 3N19B 5K59F 5TQLA 4WFEE 4MRBA 3T0AA 2VAAB 4Z1YA 3CHPA 3CSFA 3DX7A 4WEVX 3QJTB 2CLPA 5JHMA 4F91B 1AXSA 2PWEA 3AWGA 2Z9TA 2IKHA 3BC9A 2PDHA 3WH8A 1GC1C 2VQTA 1IE5A 4P5SA 2QCHA 3FO2B 4BGLA 2NOYA 4KKNA 4LSPL 1V7YA 1QFWL 4UU9A 1OGPA 1CB7B 1NKGA 4J4PD 4XH2B 4B5ZA 1YJDH 3RYSA 2E68A 5JHDE 1R2TA 4IG2A 3TCXA 2G5BB 5SV3A 3AQZA 3IJEB 5F7UA 3TA3A 4PMFA 1E0OB 2GSJA 3UZYA 5G4OA 4IOIB 3BZEB 3RPKA 5T3XL 5F96L 2UY5A 2ICWJ 2FZ9A 3K4DA 3OQ3B 2R8WA 5EIQA 4GG6A 1CPUA 1HJUA 4V28A 5GS2H 3ARBD 1TVLA 2O5YL 2ZA1A 1TU2B 1T1YB 3CDGA 1NEPA 5C09D 4GUFA 4HFWA 2OQHA 4YSEA 2JK5A 5CNHA 2PF8A 1DE5A 3NZQA 1SJMA 5CIPH 1JHKL 1FNSH 4WW2C 5CPTA 4W9IC 2N7AA 3H2NA 3QZWA 5D7IF 4FMFA 4P57B 3GEWB 5DRZB 4O51B 2FWLB 3ZTNL 4BQ6A 2FEDC 1TTBA 3MRLA 2Q6ZA 1CYXA 1SJBA 2GBUA 5B4MD 2R9HC 3M0XA 3PDGA 1IFHL 1DBAL 2K3HA 4XUYA 3GVRA 5CPMA 4ZB5A 4EX4A 2Y1VA 1PWLA 2OKTA 5JORA 3VNMA 2WMHA 3HFFA 1MXDA 2PCPA 1CICC 1ZHNB 1M7XA 3IAPA 3B9AA 4RE2A 1KXVA 1KTLB 2VEGA 5DVNA 5IG7A 3W7GA 2K4AA 4HMDA 2F15A 3TWCL 1DXEA 1G7HA 3PL6B 4PCYA 1HK6A 1SGKA 1Q0XL 1T6MA 2J1ZA 3LX9A 4NNAA 2HVMA 4XCYA 2ZOUA 1KYAA 1WO2A 4ZTYA 4PJXE 4LEXL 4MNGA 4Z78B 4XBEL 4UTHA 1BVOA 5FKAA 3CUIA 2O5NA 5JQ9A 4OUIA 4NOBA 4YU1A 2V5TA 2P26A 1H60A 3K5SA 3VC5A 1XO8A 5DHYB 4IT1A 5C8BB 5E4OA 1GYMA 2Y5TB 4AENA 3CZSA 3H9HA 3ZL4L 5CBAB 4DEPC 3II3A 2YDAA 2X4QB 3ZLGA 3W11C 3C3NA 2XTSA 3WHE0 5HD8C 2DKSA 3KDNA 3V0GA 2ZP8A 3GTNA 1YLBB 2OI9C 5E1GA 3KCJA 1F4YH 2PC8A 5CN1A 5CEWA 3LS5H 2VFFA 3KEHA 3AIUA 3LZFH 3NFPB 1R38A 5EMMA 4X99A 2COQA 4UYPA 3W9EB 1CDCA 1A50A 4ZGYA 2OJZH 2P5WA 3GI8L 4XCEB 1OT2A 2YMXH 4ZMQA 3ESUF 4FAMA 1KTDB 2IMMA 4B9ZA 4YLBA 4PRIE 1ZS2A 1O4UA 3X3FL 2I5YH 5G1MA 3IFPA 1H50A 3VC6A 1IBHA 5DWUL 1NFPA 2XN0A 4NKIL 2DMHA 4UDTA 4H19A 4XP1L 3DUUA 3VIIA 3EBHA 2EXYC 1HJWA 4FXSA 5C7XL 3DURA 3NZUA 1UD6A 2GC7C 3SM0A 2V7HB 3O3BA 1NAMB 3WMSA 4AWEA 1K4GA 4PMEA 4Z3JA 2WWCA 5EN2A 1L6WA 4NPYB 4B7LA 1U8MA 2ARJQ 2ASHA 1S4IA 4DEUA 3U0TA 3CLEH 4PS7A 4M19A 2XJ7A 3RITA 3FK4A 1ZV2A 3GBMH 1FCUA 4KUCD 3EDEA 3GG1A 3CIXA 4W84A 1D5RA 2LLEA 3DZ1A 3LKOA 4GS7B 4Y5VC 4PEEA 2R7EA 3VFWB 5XINA 1C8XA 4HZ8A 3KCPA 5TJWK 3FONB 1SBSH 3EGSB 4PGCB 3C08H 2GITA 3LGGA 3GH5A 1A6PA 1MUJA 5B1AB 5HGDA 2J8GA 1TETL 5ABTA 1U3JA 2ORBL 1OVDA 4LWWA 1RY7B 3L81A 3C9NA 3WOVA 4GCAA 4TVPD 1NSNH 5HY9B 3W5NA 4ZO9A 1AQFA 5FYLL 2YYUA 2XT1B 3EOOA 5AL8A 1N18A 3VDBA 1TWDA 3VQLA 3RU8H 4D6HA 1TMCB 1N59A 5HQLA 5EF3A 3BARA 2YD4A 3AADB 2W80C 3Q1SH 3SJVD 3ECBB 1FYHB 3QQWA 2NDFA 4M5SA 1OWQA 2Z65C 4C6EA 5J56B 1W9UA 4I5XA 1A6TB 1HQ4A 4TS6A 2YD7A 4WXZA 2AXHA 3V4VH 1INDL 2W66A 2J6WA 2VTFA 4QRPE 3SGDI 3TVMD 3E80A 2X05A 3IGUA 3N15A 5G2NA 3AS1A 2AQTA 3WYZA 3WLHA 1KJ2H 3ROLB 2EIBA 2AV7A 3F58L 4DKAA 3HE7B 1FWBC 1Q9OB 4YDJB 1XGEA 3VXUB 5IBXA 4XHQA 3KPSA 1UXLA 4Z2KA 2BY3A 3JT2A 1XV8A 4DEFA 2O6EA 1X4XA 2X70B 1J0ZA 3B5GA 4DYEA 5D1XA 5DQ9A 1S3RA 1V5JA 4FJ6A 4U1SA 8RUCA 4JO4H 1TR1A 3QFJA 3TWBA 1HUVA 3RX3A 2NQLA 3QORD 4JAWA 2MCAA 1EBGA 3GMMA 1LO0H 3G6DH 4L1LA 2XV2A 4F15B 1OPGL 4HOZA 3RXZA 1FE8H 4S0HA 3USZA 5A3HA 2ARJA 3A9IA 5G5DA 3TNNA 4OCWH 3S5YA 3MNVB 5DEFB 1A4LA 3G5ZB 3G0SA 1JTTA 3QUXD 2PCYA 1UKOA 3OKEB 4OB5H 4TKWA 2J21A 4JNMA 1EHAA 1RUAH 3CYJA 3MJ8B 4MXQD 4TR9A 1RV8A 3FT4B 2V5BA 4DAIA 4P3DB 1E1CA 5A3ID 3IFOB 3NTCL 4PRTA 1LO2L 3O8XA 1UOLA 3CFCL 4MYPA 2NXZB 4K73A 4KNQA 1YUHB 2W9DL 2SEBA 4PWIA 2AHIA 4HX1B 2GUYA 4XP6L 3AOFA 3B8UA 2D2CC 1AQMA 3C5SB 4JKWA 4C4KO 3PBVA 3WF0A 2LVCA 2X09A 5JPMC 1ZE3C 5DJ0B 4H9YA 3I6RA 3E6EA 1PZ0A 1PTZA 3N9KA 4YPGA 1RURL 3W7EA 1IM3B 5IVOA 4XTRD 4JM2B 1OIOA 4IJ3C 3JUYA 1H49A 2J25A 2Q3RA 5C0GA 1EF2A 1IM9D 1S9YA 1OQFA 1QI4A 4FXFA 1R3KB 1USZA 2ZAHA 2ISWA 2YGOA 4O54A 2WXMA 3MV9A 5D4IA 4HPOL 3UTSE 2DICA 1OGAB 2VWSA 5DSCA 3WFAA 4PJ9D 5DXXA 5MHBA 4OR1A 5HYSG 3NCXA 3OGCB 4XVUD 3R0KA 1T8XA 3MLYL 4P4RA 3TK7A 3AW5A 1DEEB 2WMIB 3OVPA 1PDKA 5DRXA 1RZGB 2UZ9A 3BANA 4OZ4A 2BVDA 3KGUA 3LPPA 4GSQA 4HULB 2VO5A 2BIIA 1XH1A 3W1ZA 3RLVA 5FKPB 2C26A 3BQUB 1LK2B 3GJFB 3ARFD 2W94A 4K94H 4CNIA 2ISSA 3UBFA 2OM5A 1FQ9C 3UZJA 4DAGL 4G11A 1BBJA 1G7MA 3PP4L 4RDQG 4TVPH 1CMOA 2P5EE 4M8RA 1Q94A 1XLKA 3TT3H 4OLVH 4L8CA 3ARTA 3WO4B 3WN5C 1AOZA 1QPOA 4K7YA 4K7PL 4F9PC 3PAVA 1FH9A 2WXOA 3GLEA 2CCWA 1T20A 4KOBA 4NQCE 2W65B 1A47A 2E40A 5F6IC 5I74B 2DV0A 1D8CA 1BWMA 2JKEA 4M8UA 3NQ8A 1PGRB 4A2FA 4B3VA 3SKMA 4JTJA 5HDWA 1S6NA 3VH8B 2CKBL 4M6AA 2V9TA 1F3DH 4BZ2H 4YHKH 1WDDA 1H3TA 3WHXA 1SOQA 3QDGA 4BBWA 1FDJA