4UQAA

X-ray structure of glucuronoxylan-xylanohydrolase (xyn30a) from clostridium thermocellum
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
391
structure length
391
Chain Sequence
b'SHMASATINLSAEKQVIRGFGGMNHPVWISDLTPQQRDTAFGNGEGQLGFTILRIHVDENRNNWSKEVATARRAIELGAIVSASPWNPPSNMVETFTRNGVPNQKRLRYDKYGDYVQHLNDFVAYMKSNGVDLYAISVQNEPDYAHEWTWWTPQEMLRFMRDYAGQIRCRVMAPESFQYLKNMSDPILNDPQALANLDILGAHFYGTTVNNMPYPLFEQKGAGKELWMTEVYVPNSDSNSADRWPEALEVAHNMHNALVEGNFQAYVWWYIRRSYGPMKEDGTISKRGYMMAHYSKFVRPGYVRVDATKNPTYNVYLSACKNKKDNSVVAVVINKSTEAKTINISVPGTSIRKWERYVTTGSKNLRKESDINASGTTFQVTLEPQSVTTFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CARBOHYDRATE BINDING FAMILY 6
publication title Conservation in the Mechanism of Glucuronoxylan Hydrolysis Revealed by the Structure of Glucuronoxylan Xylano-Hydrolase (Ctxyn30A) from Clostridium Thermocellum
pubmed doi rcsb
source organism Ruminiclostridium thermocellum
molecule tags Hydrolase
total genus 135
structure length 391
sequence length 391
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uqaA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uqaA02
3PZTA 5IDIA 4H8VA 3T09A 4HZ7A 3D51A 2MANA 4HOXA 3ZT5A 1C92A 1C7SA 2VL4A 2XG9A 2WYSA 1LWHA 2VZVA 2YFNA 1VEPA 4UQCA 4JL1A 5A6BD 5A1AA 1C90A 1US3A 2NW0A 3ARSA 3GH7A 2EPOA 2DH2A 4OKDA 3RCNA 3N13A 1KXVA 5ABGA 3A24A 4AD4A 3CHDA 5BXSA 1UKTA 4P8VA 1H41A 3WNKA 3AMCA 3VGDA 1KTBA 2A3EA 1BLIA 5D9MA 5ABEA 3EMCA 4N0RA 1E73M 1UA3A 1VAHA 4S3KA 4M56A 4BS0A 4H8UA 2ZWZA 2WXDM 2VI0A 2XVNA 3II1A 2BVYA 3EDJA 4W7WA 1YQ2A 3CBWA 1E71M 4W84A 3OZOA 1W1TA 1G1YA 2DSVA 3IJ9A 3CUGA 3AS1A 2F1AA 2WVVB 2BV9A 1M7XA 1H09A 3W28A 3DHPA 2X0YA 1CENA 3VGGA 1GJUA 2FHFA 4UR9A 1XYFA 3WMSA 2VURA 1IZKA 3VX1A 2D24A 4AXNA 1UD6A 1HXKA 3MSDA 3IJ8A 4QCFA 3F4VA 1HJWA 3WQ6A 4FLSA 3LXAA 4GINA 5A94A 1PS3A 2ZX9A 5E6ZA 2ZE0A 4AMWA 2J7GA 3CV5A 3ZR5A 4JFUA 1UKOA 1KWKA 4HP5A 5A8NA 1TVNA 2JALA 1OGBA 2G3NA 3DDGA 1W3LA 1W9VA 1OB0A 1UWIA 3D5HA 2PWFA 1E4MM 1PX8A 4AZGA 5FD0A 4AYGA 3N11A 2E8ZA 5A3HA 1PZ3A 1E72M 2A3HA 2DGAA 4F66A 2BVDA 3IK2A 1BQCA 4QLLA 1XSJA 3MUY1 5CXPA 2XHYA 3VVGA 3L4VA 5TD4A 5GNYA 3WDJA 2WMIB 1EGZA 3ARWA 1ZBWA 2OSYA 4X0VA 1EDGA 3AFBA 4JKMA 3A6OA 1ITCA 4GKLA 1FFRA 5A8MA 5IHSA 3AROA 3WUEA 1C8QA 3WDIA 4AD0A 4AZCA 1CXLA 4U33A 1W2PA 4QP0A 1M04A 1CGTA 2J79A 2PWHA 2VRQA 3NSMA 3KEHA 3FAXA 4WLCA 3BAKA 1GCYA 1VEMA 5I5RA 2EPLX 5AC5A 4MNJA 4JHZA 1WAWA 4B16A 5I77A 4JCLA 1JDDA 5BRQA 5A95A 3JUGA 2BY2A 1HXJA 3MUAA 2DT0A 1W9XA 1OCQA 3T2PA 5CSUA 1CPUA 4AD2A 4CD5A 2WSPA 2E9LA 4QDMA 5I78A 3TA9A 3CIVA 3RM8A 1ZB5A 4JIEA 4CCCA 1BFNA 5FOOA 1JYXA 3NSXA 4W88A 3VIKA 4JFTA 1GQLA 5I24A 3WQWA 1MW2A 2VZTA 1XSIA 3HN3A 4W89A 5D8ZA 3W82A 4HPGA 4GZIA 2X2IA 3O9NA 4AZHA 1V0LA 4FF5A 3SCWA 2X2JA 4UOQA 2X05A 2JEPA 1XD0A 1LL7A 4UNIA 5BYWA 1UH2A 3PBGA 2OWXA 1JI1A 2WMGA 4WKFA 3WFLA 1O6IA 4UQDA 3HZ3A 3OBAA 1XH2A 3KLLA 2DPEA 1R75A 4WK9A 2EPNA 2F2HA 4AZBA 5A8PA 3L4YA 2VX4A 2GSJA 1UWQA 4L4PA 3GZAA 4JL2A 3L4XA 3BUIA 4LGXA 1E0WA 2WHKA 4WSJA 3W4RA 2X1IA 3GYCA 2F7QA 1W9DM 4UZUA 3ARTA 3WDHA 1UZ4A 1ZBVA 4GQRA 3S5YA 2CBJA 2VCCA 3KE0A 2O9RA 3WD2A 3WH8A 4HOZA 1H4PA 1E6RA 1EXPA 2YL9A 2D0HA 4HOWA 2CNCA 3VKKA 2X09A 1UWTA 3VGEA 5JBFA 3NIYA 1JZ3A 5KEZA 2VQUA 2W91A 1PZ2A 2FDMA 5CPSA 1BHGA 2ESCA 1EO7A 1BSIA 1JZ2A 1W1YA 4M80A 1TA3A 3HG2A 1E70M 1V6WA 3DYPA 1GHRA 2YBTA 4P7NA 4PTWA 2Y8VA 2WCGA 3ZIZA 2OYMA 4XV0A 4X9YA 2CBVA 2VR4A 3K8LA 5D4YA 4H8HA 3PN8A 2AAAA 1EQPA 2PC8A 2XVPA 3WY1A 3AIVA 4AC1X 3LXCA 1BAGA 4LYRA 1DTUA 4HPHA 5JBDA 1HNYA 3M7SA 3CUJA 3K4AA 4PTVA 1CGWA 1HN1A 3CZNA 5BROA 3W27A 2CESA 3WMBA 1UQZA 1L0PA 1GJWA 1TA3B 3F5LA 5E09A 1C8XA 1WDRA 5M17A 3VDAA 4U2ZA 4BQ4A 3CPUA 4AW7A 5CLTA 1TR1A 3K1DA 4XB3A 1J0IA 1B3XA 1BYDA 4NXSA 1IV8A 4D1IA 4EK7A 2NT0A 1CEOA 2CKRA 2QV4A 1V6XA 1UWRA 4TX6A 2Z1KA 5C71A 1QOXA 2VZUA 2YDRA 2RGLA 1BPLB 2J25A 5FL1A 2XVGA 1WE5A 3APGA 5FCZA 3UCQA 3WH7A 4B9YA 1UH3A 3UETA 4U3CA 3EJTA 1JZ4A 3E1F1 3PTMA 1BGGA 1EDQA 1T0OA 3VIPA 1V3KA 3UG4A 5BRPA 1UYQA 3PZQA 4P8UA 1GOWA 1I1XA 4RL3A 3L4UA 1E6ZA 5DO8A 3MV11 4FLRA 3D52A 3WBEA 4DUWA 4MJ2A 1CXHA 1L8NA 3MV01 2XVKA 1KBKA 2OWCA 2J7CA 4D6GA 3VD4A 2GJPA 4UFJA 4GI8A 4AIOA 1U33A 1Q6GA 5IXEA 4NX0A 2D3LA 1AMYA 2ZUSA 3NYDA 1QBAA 5I23A 1M03A 3VPLA 3RDKA 2A3AA 2CCRA 1C7TA 4IM4A 3NUKA 4K68A 1J9YA 1Z32X 2ZICA 2BY3A 3TTYA 2GJXA 2VCAA 1W9PA 1V0KA 2YBUA 3NCOA 1E0VA 2WANA 4U2YA 1DWFM 4UQAA 4DO5A 1Y7VA 4AZ7A 1B30A 1W32A 1S46A 3DYMA 1I75A 5DT7A 5HPCA 1V03A 4UFHA 4AISA 3SCNA 3WELA 2CBIA 1HVQA 1H1NA 3MSGA 4AEFA 4M82A 1B31A 1B3ZA 3CUIA 3GBDA 1EOKA 2J62A 4HZ8A 4PSRA 5A6AA 4ZXOA 4J3UA 1HVXA 3M07A 5LA0A 3AIEA 2CITA 1D2KA 3HJEA 5F7UA 4TXEA 3BLPX 3CZLA 2YA0A 4M1RA 1E4IA 1F4HA 3POCA 1KBBA 5JUVA 3A4WA 1AVAA 1GVYA 3RO8A 4H7VA 1EO5A 5DF0A 2OSWA 4U5IA 3AZTA 4CD6A 1RH9A 1SMDA 4U5KA 3WDPP 4WKHA 1G5AA 5A2BA 4OOZA 3MUIA 3QHMA 2WVTA 1EHAA 3BAJA 3AICA 1MXGA 2XIIA 1ODUA 3WUBA 3WF2A 2VX5A 1MVYA 4PTMA 4YPJA 4NXKA 1TMQA 4WKAA 5DFAA 1J0KA 1E4LA 4MADA 2ZX7A 1VJZA 2E40A 1B3VA 1XH0A 4UFMA 3PHAA 1HKKA 2W67A 1E6PA 3N04A 3MKKA 3N12A 4J27A 3AXXA 4R27A 4D6EA 2Y8KA 1UR9A 2EAEA 4FNSA 4OIFA 7CGTA 2V5DA 4MNKA 2J7FA 1TQTA 2OW7A 3MO4A 5C70A 1GW1A 1KGXA 1UR4A 3WNNA 2BS9A 3RPMA 4WJXA 3DDFA 1UD5A 2FH6A 5HDRA 3TOPA 2WSKA 2Z1SA 3AHZA 1FHLA 2WC3A 2W66A 3SCVA 1ZL1A 3CMGA 2J74A 1B1YA 4W93A 1E9LA 2XN0A 1GVIA 3WH9A 4J3VA 4V28A 4UQBA 3WNMA 3WDRA 1K6AA 3BSHA 3WF4A 3VSUA 1GOIA 1HL9A 1OSEA 1JNDA 2VVSA 2QPUA 3L4ZA 3TONA 1UD4A 4AZ5A 1LG2A 1W3JA 5CZKA 4D6IA 4M8UA 2DQXA 3OLDA 3ALGA 3OLGA 3EDKA 2JEQA 1N82A 3BUDA 2EQDA 2YA1A 1ISWA 1XD1A 3GNPA 3GXNA 3LPGA 4MAVA 1JG9A 4JKLA 2VZOA 5A6LA 1KFWA 4DWSA 1JZ7A 3VMPA 4PYSA 2PB1A 4FNPA 1YHTA 2VOTA 4P7OA 4DWSC 1QPKA 4UOJA 5EFFA 2NT1A 3ZO9A 3WIJA 2XJ7A 4TTUA 1W2VA 3WY2A 3BCFA 1OGGA 2DIJA 1TCMA 3WEOA 1UUQA 1KGUA 2D0FA 3FXYA 3KLKA 2PWEA 4GIAA 4CCEA 1H49A 3IGUA 4IISA 2YA2A 3TTSA 2XM2A 5A8QA 3UR8A 3AQUA 4ACZA 1CXFA 2WVSA 3T2QA 1F4AA 3OGRA 3ARYA 1O7DC 2DIEA 1LF1A 2ZOXA 1FHDA 4CU8A 1W1PA 5A6KA 2X2HA 4DO6A 4W8BA 3WENA 3DX0A 3AS3A 2VCBA 4H04A 3RILA 1X6LA 3S6TA 3EJQA 1NWSA 1KTCA 3H55A 1UKSA 1B9ZA 2XYLA 3MS8A 3LRLA 4GO8A 3N18A 2WZIA 2DH3A 4HTYA 4NRSA 3IJ7A 3VNZA 1HP4A 1V3HA 3GXMA 1QNRA 4ZENA 4PMZA 3CUHA 4W5ZA 3VOCA 1QI4A 4AMCA 3EDDA 4BZYA 1CLVA 4ATWA 4HA1A 1E6QM 3W6LA 2V3DA 4LXFA 5BCAA 2OSXA 4CGTA 1NH6A 2W62A 4GZJA 1R7AA 1GQIA 1CTNA 4HMCA 3BVVA 3BUBA 3U57A 4BQ5A 3AIWA 3FHQA 1Q6EA 2JF6A 3L4TA 4C7GA 2Y24A 2VT0A 4M81A 3W26A 4AYSA 3L2MA 1JIBA 2E3ZA 2WWDA 1PPIA 4B15A 1HTYA 4IPNB 1WNOA 3L4WA 1U30A 2OWWA 3VSVA 2BNJA 1MQPA 4M29A 4RE4A 4BQ2A 2VO5A 3CHEA 2J7HA 6A3HA 4P8WA 2VJXA 3DHUA 1OT2A 4D6JA 2O9OA 3BVUA 3W37A 1IT0A 2QLYA 3PZOA 3CO4A 5GPRA 1GOOA 3WY4A 3DX2A 4ZEPA 2QMJA 1J01A 2UY5A 3VX0A 1JL8A 1GPFA 3CHCA 1WCGA 1QI0A 5IFPA 3QHOA 3EJSA 2X8RA 1ITXA 1JXKA 4OBRA 3A21A 3ZJ6A 4CVWA 2F7OA 5A6MA 1HX0A 4EKJA 4JKKA 3OGSA 3RJYA 1FH9A 4Z2GA 1MW0A 1KXHA 2XIBA 3LPFA 3BCDA 5M3WA 1UA7A 1MQRA 3ALFA 4OBSA 2DEPA 4P8XA 1ISZA 1UR1A 3I3EA 4C7DA 1QI2A 2FE0A 3AS0A 1W9BM 2O9TA 4Z2HA 4ZXLA 2OLHA 1V6YA 4ATDA 1E1FA 1FFQA 4TVDA 4AZCB 2WHLA 1OD0A 4PBGA 1GOQA 3BMVA 4PCTA 4EANA 4W7VA 1JDCA 3BVTA 3GTNA 1J12A 1VFOA 3ARQA 4CUCA 3EBVA 2WAGA 3KL5A 1QX1A 3ARPA 3UR7A 4V27A 1JAEA 5ECUA 2XSBA 2E0PA 4J3TA 3VU2A 4FLQA 3FW6A 2WB5A 1FP8A 4PMDA 4KH2A 2PI6A 3KZSA 3TV8A 3GDBA 3AYRA 4LYPA 1KQYA 1A3HA 5CJ5A 4L4OA 1PBGA 3CZJA 2FH8A 1OINA 1M53A 3T08A 4NI3A 1XSKA 1GNXA 3VIIA 4DM2A 3WNLA 1UR8A 3LMYA 5GQBA 2B31A 5E6YA 3WQ5A 3NSNA 1GONA 5CGTA 3SCSA 3QR3A 3VINA 3I3DA 5E0CA 4OUEA 5JBEA 1GQKA 4QFUA 5BXRA 4DUXA 3HG4A 3U5UA 3WQ8A 4EE9A 1LJYA 3DX1A 2X2YA 3AZRA 3M6DA 4MB1A 3FAWA 3GXIA 1UWUA 1AQ0A 4GI9A 3WFZA 3ZSTA 1D3CA 3VD9A 5A6BA 5E70A 1RD6A 2G3JA 3W25A 3GH4A 3OG2A 5A2CA 2E4TA 2V38A 5AYIA 1VIWA 1R86A 3RIKA 4JAWA 5C8BB 1UD2A 2O92A 1W91A 4A4AA 1E6NA 1HKIA 3ZMRA 3ARXA 1AQMA 3CMJA 1SR0A 4OOUA 2WCAA 4D6CA 1CLXA 2XN2A 4AIEA 4FNUA 5FIPA 3QHNA 2Y4SA 3VDBA 3WF1A 1JDAA 1Q6FA 2W5FA 3SCQA 1LWJA 3VIFA 3B9DA 3UEQA 1ZU8A 3GXTA 1E55A 3VIHA 1JYNA 1SFSA 2J8GA 3PZMA 1PIFA 1E5JA 1PX4A 4UQ9A 4LQ1A 1B3WA 3PZIA 1KGWA 1KR0A 1V08A 4AD5A 3RMEA 1QBBA 1UD8A 1SMAA 1E56A 3AMDA 1CXEA 3SUWA 4FNRA 1JZ5A 4JFWA 1MWOA 1QHZA 4Q22A 3SUTA 3AMGA 1H0IA 3U7BA 1GQJA 2VUYA 3F5JA 7A3HA 5M03A 2PBOA 2DSZA 1V0MA 4ZE5A 5E0FA 5EB8A 4BQ3A 4E8DA 3WD3A 1XRVA 3HG5A 3OB8A 4FMVA 5HPOA 1XCWA 4XZBA 2W92A 3BC9A 3S2CA 3O6AA 1TQWA 1DHKA 2CXGA 4AWEA 2VX6A 3GBEA 2BHZA 2BY0A 2VRJA 5HNNA 1J10A 1JD7A 3CZEA 4TOQA 2ZXBA 3THCA 3CGTA 1PX3A 2ZXQA 3J7HA 3AXHA 1NWTA 2GDUA 1J0JA 2Q8XA 5A6SA 5AY7A 4X0NA 3D3AA 5LYRA 2YOCA 3ZJ8A 5CG0A 1CBGA 4URIA 4DM1A 5M5DA 4CU6A 4HMEA 2WLYA 1OWQA 9CGTA 2BHYA 2XVLA 2D0GA 3M46A 4QAWA 3MANA 2W61A 3NDZA 2A3CA 3PTKA 2ZUUA 2F7RA 3BAYA 3HMCA 1TZ7A 1ZBKA 2HISA 4YHGA 4MNLA 1NQ6A 5CSYA 3UESA 1ECEA 1LG1A 3PTQA 1R46A 1IZJA 2VNCA 3VM7A 5JIWA 3SIMA 4RE3A 3WL0A 2WK2A 2TAAA 1JXJA 2D22A 2XFFA 3WUGA 3NJ3A 4MJ4A 2GK1A 2WWCA 3LX9A 3AMLA 4MDOA 1EOMA 3MMWA 1KCLA 1W3KA 2FHCA 3N1AA 4PMVA 1V02A 3DECA 3POHA 2WC7A 4PMOA 4F9JA 2YFOA 4AD3A 1HP5A 3W53A 1HF6A 1QHPA 5EMYA 4PUDA 3GXPA 2ZUVA 1K9FA 2WMHA 2YLLA 1WP6A 1UOKA 2GJXB 5E1QA 1H3GA 5CLWA 1D7FA 4KRTA 3WNPA 3RM4A 4J28A 1E6XM 3LXBA 4AZ6A 2W4XA 2DSWA 2ZXDA 2VX7A 1X1NA 3IANA 3AIBA 4HU0A 4D6DA 4PMXA 2UY4A 2WMFA 1BVNP 4AZIA 1HT6A 1CYGA 1JYWA 1RP9A 2IUZA 2WKGA 3A47A 1A47A 4E4PA 1FA2A 2BFGA 4W7UA 2O9PA 1BYAA 2QPSA 3VIGA 3DX3A 3ECQA 2CEQA 5AYBA 2G3MA 1QWNA 3VGBA 3SUVA 4CCDA 3AJ7A 5DMYA 1R33A 4AIUA 2FGZA 1CIUA 4W86A 4TVUA 3WUFA 4CU7A 5HXMA 1MYRA 1PAMA 3UERA 2GDVA 2YJQA 2AMGA 1V3JA 3CTTA 2V3GA 1BVZA 3EJUA 4RE2A 2PWGA 2D2OA 1VENA 2VC9A 2ZUMA 3W24A 3MMDA 1G94A 1R47A 2ZIDA 2GVYA 4A3YA 3ZT6A 1Q6DA 2DSUA 1NOUA 1GOKA 2WC4A 3VTRA 3T0BA 4D71A 3T2OA 2WW5A 4F8XA 3AIQA 4Z2JA 3A4AA 4XUYA 2WM0A 5BWFA 2XGIA 2J77A 3U7VA 4LX4A 4BA0A 1C8YA 1V02E 3ARUA 2C7FA 3ZOAA 4Z2LA 3AOFA 2IXVA 2X0HA 1E3XA 2CBUA 3LRKA 3ZT7A 1EA9C 3BLKA 3VDHA 4R5EA 3VGFA 3B8SA 3FY1A 1JNEA 4E8CA 2PBGA 2QHAA 1WO2A 1G9HA 5AC4A 3WEZA 1P6WA 1JI2A 4PRWA 2WHMA 4ZFMA 1NP2A 3AHYA 2UY2A 1WZMA 1JFXA 4MPKA 5GNXA 3VD3A 4S3JA 3WN6A 2IGTA 2G41A 3VIMA 4E2OA 1E6SM 2G4FA 3LPOA 4NRRA 2EPKX 3TP4A 3WH5A 2OYKA 1DWIM 3QOMA 2CYGA 4DO4A 1TUXA 4PMUA 3WH6A 1R34A 1CECA 2XGBA 4NF7A 4UFIA 1E0XA 2CHNA 4IUGA 1ISVA 2E9MA 3H53A 1FP9A 1K9DA 3VMNA 5DT5A 4H41A 2DT2A 4PCSA 2WVVA 1MQQA 3KWXA 2XWDA 1KB3A 2QF8A 5D9PA 3EDEA 1XYZA 2OYLA 1KXTA 1XH1A 3AI0A 6CGTA 5LA2A 3AISA 1EDTA 3ZM8A 3RJXA 2G3IA 3ZJ7A 3PZ9A 1VFUA 1R87A 3EJPA 1TE1A 4DWSB 2WBKA 1QVBA 4XX6A 1HKJA 3DC0A 4TUFA 1WKYA 3BAIA 3H54A 4Z2KA 2WBGA 3WKZA 3GH5A 1UWSA 1JZ6A 3BUPA 4ACYA 3AHXA 1ODZA 2J47A 5IHRA 4MNMA 5E9AA 3DX4A 1OGSA 1G01A 2ZX8A 5IFTA 3BH4A 3SCUA 1JAKA 3VNYA 1DWAM 3IAQA 4TVCA 3BVWA 4ACZB 1NM9A 2IXUA 5CQ1A 4AEEA 2W63A 3SUSA 1EH9A 2WCSA 4PEEA 4EAMA 2FHBA 5A8OA 3CUFA 1WDPA 1WZLA 4JFSA 3A3HA 2FYVA 3BMWA 3CLWA 2V5CA 3CZ8A 2XUCA 4JFVA 5JIPA 1BTCA 2F1BA 4NZFA 4D6FA 2WMIA 1US2A 4CD8A 4WSKA 2ZUWA 3KL3A 1KWGA 2AOSA 1NOFA 1BF2A 4OZOA 1R85A 1CGYA 3GM8A 2YIHA 1R7OA 3LPPA 3WSUA 2UY3A 2D1ZA 3VMOA 1HJSA 1W1VA 3LRMA 3U5YA 1BYCA 1OIFA 1HJXA 3ARZA 4QCEA 1FH8A 3VILA 3VD5A 4GI6A 1W9UA 3WQ4A 2BXZA 3PZNA 2XPKA 3SEPA 1V6VA 1V6UA 4B3LA 2WZEA 2ZXAA 3AYSA 4CN1A 1XGZA 1J0YA 2WMKA 5BXTA 2CKSA 1GHSA 4MTVA 1FH7A 1OD8A 3G6MA 4W5UA 3TTQA 3NDYA 4P7LA 4PUEA 2XSAA 3SCRA 1PIGA 3AHVA 4HA3A 3GNRA 2JIWA 4IPLA 2BVTA 2YL5A 1B0IA 2JF7A 4OGZA 4DUVA 2J4GA 5A69A 1DWGM 4F79A 3T0DA 1CXIA 4U31A 5LA1A 2JIEA 5I79A 3OLEA 2F8QA 2YLAA 1XC6A 4J7RA 2XFRA 3VDCA 2JFEX 1VB9A 3K8KA 1WB0A 1MXDA 1LL4A 2YL8A 5DEZA 1O7AA 3OIHA 2EJ1A 3VO0A 3F5KA 1KXQA 1PEZA 1UG6A 1E43A 4YN5A 5GNZA 1UHVA 3CC1A 3D4YA 3SCOA 1E5NA 1WPCA 2GFTA 1VBUA 3EMZA 1OM0A 2CIPA 1UASA 2D73A 4UCFA 4FK9A 3W38A 3AXIA 3CZGA 1NP0A 3EYPA 2EPMX 4M24A 3WY3A 1GZJA 1CXKA 2ZUTA 1ZJBA 1M01A 5D9OA 2WVUA 5FKYA 2WHJA 3VD7A 2ZWYA 1TQVA 1SYTA 1OBAA 1XHGA 5A6JA 1VFMA 4GXPA 1NWUA 1DWJM 2DDXA 2ZX6A 1WZAA 1E3ZA 2ZUNA 1DP0A 2NSXA 1X6NA 3A4XA 4J3SA 3TTOA 3D50A 4PSPA 3AIRA 3PZVA 1EHNA 3B9EA 3ZSSA 3EJRA 2GJRA 1QW8A 2A3BA 2J78A 2WZHA 1ISYA 8A3HA 1E40A 1JD9A 4PN2A 4GPNA 2JE8A 1B90A 4D1JA 3OZPA 1LL6A 4D72A 4PTXA 1VJSA 8CGTA 1MFVA 1NWRA 1QNSA 4KGJA 1BG4A 4AY1A 1UH4A 2Y5EA 4B9ZA 1UD3A 3ZR6A 3BUQA 1Q6CA 4HA4A 3WEMA 2VZSA 1VRXA 2XWEA 3FNDA 1HKMA 3CZSA 1J18A 1KR1A 1H11A 3B9AA 2XTKA 4UZSA 2C8NA 3FHAA 4W8AA 2J7BA 2EO7A 3QOKA 2F61A 1AQHA 2ZX5A 1OIMA 3CHFA 1TVPA 3AIUA 3W29A 3CZKA 3EDFA 4ATLA 3DYOA 2WKLA 4QLJA 3WNOA 5CPTA 1QW9A 3AHTA 2HVMA 2UWFA 3W0KA 4BF7A 1E1EA 3T0AA 3A22A 2EADA 1JZ8A 3HG3A 4WIWA 1NOWA 1HWWA 2OW6A 3KL0A 1QNQA 1UKPA 3WD1A 2J8FA 1JGIA 1UR0A 4DWSD 3ARRA 3BXWA 1OT1A 1VFFA 3THDA 3QGVA 5FL0A 2RGMA 1QI3A 4GO9A 2YL6A 5HOSA 1SZNA 1QI5A 2YKKA 3OGVA 4PMQA 1TG7A 3GNOA 1MFUA 1HJVA 1C91A 3MMUA 2D23A 2E9BA 3WL1A 4PMYA 1VEOA 1CNVA 4UFKA 2GUYA 4H2CA 1W3HA 5KZ6A 3N15A 1CGXA 2J75A 4YHEA 3WMCA 2F7PA 1C93A 3FN9A 4CD7A 3BAWA 5I6SA 1H2JA 5D9NA 1G0CA 1HIZA 5CGMA 4Q7NA 4Z2IA 7TAAA 1HL8A 3MUZ1 1C3FA 5D8WA 1V3LA 3K4DA 1QNOA 4GQQA 2XFYA 2XM1A 3W81A 3MU7A 5EBAA 1ZBCA 3K46A 1TQSA 2VRKA 1GORA 4MDPA 1CGVA 1QHOA 4Y7EA 1R8LA 3OLIA 4P7RA 1QNPA 1V3IA 4CVUA 1NARA 4MB3A 1TFVA 3K8MA 3L2LA 3PZGA 4F9DA 4QLKA 1UKQA 1UQYA 1B2YA 1RPKA 2V3EA 1Q4NX 3BVXA 1V3MA 3AMKA 4ML4A 4KMQA 3N17A 1PJ9A 4JHOA 1ZJAA 2G8ZA 4W8LA 4FNQA 4HZ6A 3WD0A 2CERA 2WMJA 1ZS2A 2J7DA 3SCTA 2XN1A 3O2LA 1WDSA 2ALWA 3VSTA 2DT3A 1ISXA 1VBRA 1JF6A 4HMDA 5ABFA 3GXDA 4TTGA 1H0GA 4WF7A 1LQ0A 5I2UA 1JF5A 2VVNA 1KQZA 1K9EA 4GZEA 4P7QA 1EQCA 3A5VA 1UZ1A 1UR2A 1WDQA 1LLOA 3RM9A 1K9TA 3BGAA 3SCPA 4PMRA 1ESWA 4CD4A 4OJYA 2GK1B 3CH9A 3OA5A 3SURA 1FOBA 2EXOA 2E8YA 1QWUA 4KGLA 1VF8A 1GUVA 5I0DA 1DWHM 4MB4A 2V3FA 3S5ZA 2PF0A 3ZQ9A 1JFHA 4UTFA 1J0HA 2EEXA 2WLZA 2VMFA 3AZSA 2QMKA 3A23A 3PZUA 4ZE4A 3VGHA 1V0NA 4XZWA 3WBAA 4KRUA 1CDGA 3G6LA 4UQEA 2FGLA 2CPUA 4UFLA 5ABFB 1J11A 1CGUA 1U2YA 3GXFA 1BYBA 3EMQA 2CHOA 1GOMA 4UOZA 3N9KA 2D3NA 1BG9A 1CWYA 2BHUA 2F18A 4AD1A 5HBFA 2BY1A 2DT1A 2VQTA 1KCKA 4JZ5A 4KWUA 4FLOA 4MB5A 1HJUA 5BXPA 4PMNA 3WF3A 2YDSA 3HU7A 1CZ1A 4D6HA 1WZKA 4LYQA 5EFDA 4FNTA 6TAAA 1MW3A 4LPCA 4AMXA 3VIOA 2BXYA 1JYVA 3SUUA 1I1WA 4JCMA 1XV8A 4CN4A 4NZCA 1RP8A 1BGAA 1HJQA 4NZJA 3WF0A 3D4ZA 4U3AA 3WQVA 3VM5A 3ZJKA 2WPGA 2VTFA 4NSBA 2YDQA 2D20A 4B3KA 2EACA 4J3WA 3IAPA 3BLBA 4HU8A 4C7FA 3UG3A 3VUPA 4A3HA 3VIJA 3WD4A 4CKQA 2WNWA 1E4NA 2DSKA 1EIBA 3W6MA 2C0HA 4TX8A 3MI6A 4J3XA 3BSGA 2EBNA 1MW1A 2VR5A 5A2AA 3WDQA 1TQUA 4MAZA 5I3DA 1H5VA 2EABA 1J0ZA 4N42A 4W85A 4V2XA 5CPQA 3I3BA 2CETA 1E15A 2J7EA 1B3YA 3BAXA 3UG5A 3ARVA 2PWDA 4CN6A 1DEDA 4BCEA 4W87A 5ABHA 1XCXA 3AS2A 2Y2WA
chains in the Genus database with same CATH superfamily
1CLOH 2R0LH 3UTTE 4AQ8C 1HFBA 3I7QA 4E9LA 4HZ7A 3TJPA 2P24B 4Z7WE 5L8JB 2WYSA 3ZE1F 3CFDB 1WYJA 3WMLA 3G77A 2NW0A 2IDSA 4NYLB 2Z7GA 1MI5A 1KXVA 4RZKA 5ABGA 4QROA 4Q8PA 3ILQC 4WTZA 2PTDA 3H2FA 2DYPA 1GSKA 4L1TA 1I1AC 3HS0B 1AW5A 4MSSA 3SCMA 1JGVH 4NNXB 3D0LA 4ZMAT 1IGJB 3GMPB 1A6VL 3MVTA 3OZOA 3DSFH 2QXWA 2WVVB 4HNNA 3HV9A 1R3LA 4X5XA 1A7RL 4XHJC 5IV2B 3Q6GH 4HZMA 4F37F 1PDKA 3W0WD 1GJPA 3QV7A 5C6MA 2PR4H 1KFLA 4MNGA 4OJFH 1LK3H 1IM9A 2WNNA 3TEYA 1P6FA 2A3TA 4S3EA 5KSBA 3KTSA 3NJJA 4I0PA 1EDYA 2E8ZA 5A3HA 1AE6L 1A8ZA 5B7MA 3YPIA 1YEEL 2WNGA 4IRZL 3MT1A 2FO4B 4KI5D 2VR8A 2FZ3A 5DS8A 4J6RH 3WDJA 4ZMZA 1GKRA 1OSZA 1YEFL 2YSSB 3A6OA 2DMGA 2YPVH 1BFTA 1OL0A 3RL1A 3NQ8A 4N6EA 1GTFA 5BU9A 4AC4A 3ZDXE 4G8FA 4JJ5B 3DGBA 3N1PC 1MRQA 3T04D 1WLHA 1UZ8A 2CBMA 4D9QE 5AKRA 4MNJA 1WAWA 2BVEA 2CCVA 2DT0A 4I9WE 5I6LA 3LKPB 1OB1A 1UWGH 1POJA 4QDMA 1EHKB 1RK5A 3GPEA 4Z78A 2J6XA 1CTMA 1P5UB 3RZWA 4R4BA 1FNEB 5K9OB 1UWEL 2XV0A 4ZOAA 2X7WA 4YXLL 4BZ1H 4L05A 1JHKL 2X4PB 4JFHD 1SJHA 2X2JA 5AG8A 2NY4C 5CJXC 1XD0A 2EE3A 1CT8B 1T5KA 1ZPTA 3S7GA 4AEOA 3LD5A 2XFXA 3FCPA 1WHPA 4GUCA 4WK9A 4GUHA 3MR9A 5MEOB 3ARGA 4JL2A 2DM4A 3BUIA 1CLKA 4GMEA 2Q8ZA 2DM7A 4JB9H 3ZHKA 2B77A 2CGZA 3EKLA 3IXAB 2FO8A 4LUSA 4G8IA 2GSEA 3TR9A 4HVXA 2CNCA 4X6FA 4JDTL 3VRIB 2YAPA 2W91A 2EKGA 3OMIB 3HCVB 1A0QH 2J5LB 4Q58C 1G7QA 1EZLA 1E70M 1GHRA 2YBTA 2PO6D 2Y3AA 4PBEA 1XCTA 3QZWB 5SWSA 3KLHD 4ZQTA 3MBXH 1EX0A 5I6NA 2WLNA 4P5UA 4AC1X 3FDKA 2HTKC 3C3NA 2MFNA 1AR2A 4IU2B 3FOLB 4UT7L 3GSOB 5BVPH 5KBLA 3MHFA 3D39D 1C8XA 3IWPA 5CLTA 3QQDA 1Y6KR 3FPXA 5E6RB 3VWKB 3MLRH 2F38A 5CAKA 2OELA 4UTBA 1UWRA 1TJGH 4XXDA 1EGJH 2Z1KA 2VZUA 2YDRA 5E9DE 4K3DL 4NCC2 2ZCLH 1JN6B 1K03A 1G1CA 1EDQA 5L6UA 1V3KA 4LSBA 4NQTA 4PJDB 2BCKB 1IBYA 1HHKB 3MV11 3IRCA 4DUWA 4MMWA 4AX3A 3K6SB 1QKZL 1HH6B 4ZK8A 4TQ8A 2J7CA 2JJUA 4Z7UF 4XGZB 3W7JA 3QWNA 1TMLA 4WHYH 3LAFA 4MSWB 1J9YA 5B39G 4JE4B 1TV4A 1K8XA 2WANA 3GX9A 1FFOB 5H37H 4GX8A 4DJEC 4UNUA 3H4WA 3UBXI 2Q8AL 1NICA 3S0PA 4IJCA 2DWXA 2DIBA 1NUDA 1H1NA 3MSGA 1B31A 3CUIA 1S5MA 4YL9A 4J3UA 2FX7H 2P8MA 5HDWA 4JY4A 2AQSA 2GHZA 1TPXB 3QRFM 2PP7A 4MS6A 3WLKX 1FDYA 1SFTA 3QEHA 4DVRH 4QEGA 1A5LC 4RSYA 4NAEB 3DKJA 4JPVL 3O7UA 2XIJA 5TH2B 3ATDA 2FLIA 4LOEA 2C6QA 4Y9NA 1OQXA 3RITA 3BT0A 1RQHA 3M7OA 3S2MA 5T26A 1MVYA 4JG5A 1QTSA 2A1WL 2ZX7A 1PTAA 1OCJA 4UFMA 1OTTC 3BYYA 3WIHH 5AZ2H 1I45A 4S2BA 1ZHKA 1A6AA 7CGTA 3K7UA 5AB1A 3RPKA 3UCRA 4PRAB 2PDYA 4AJWA 3H6OA 1SYVB 1GRWA 3ORJA 1A66A 1PZUB 5C0IA 1RVKA 3TPUA 4Z77B 1F86A 4P2QE 4X6EB 1JNDA 5DD1H 5D5ME 1O75A 4PIBA 4PRID 2G4GA 1X5LA 3AREA 2PPEA 1D7KA 4Z7QB 5J89A 5CN3A 3VD2A 3RLSA 2FNBA 7PTDA 4KBXA 1JZ7A 4LRNL 4A7GA 2B15A 5FM8A 4J8QA 1XGTB 3LDVA 4DTGL 1NJ9B 2DIJA 4L8DA 1GGOA 2DBJA 3O4OB 5I1CH 2E67A 4ZOEA 3TH3T 2D0FA 3FXYA 3MPCA 3AQUA 4ACZA 1CXFA 2WVSA 1L0YA 4E9TA 4Q4IA 1KBVA 3ARYA 4X7SL 5KG9B 1XCQB 1MG3C 5HHOA 3PWNA 4G6JL 5IT2L 4H04A 5FW6A 3KPQA 5EZIL 3ES8A 1B9ZA 4OIBA 2V4LA 4HG4J 2BXVA 2G95A 3WTSA 4OF0A 4PJ7F 1TYJA 3TYDA 3DFPA 3D0VA 3L7EA 1T1XA 4ATWA 2V3DA 1LE5A 2K8QA 3FEMA 1LUCB 1OGAA 2W62A 3TWYA 2Z28A 1GQIA 1JTPA 1XIEA 1G87A 3BUBA 1KN4H 3GT6A 3PV6A 2PTTA 2VT0A 4X80L 3A64A 1JVKA 2D03L 5E8DH 3RVVD 6FABL 1AXIB 2O4EA 1PPIA 3W73A 4PBDA 3VE9A 1MQPA 3S35H 4XPHH 1QFUL 1EEYB 1ZSHA 1VHCA 1KTNA 4GAGL 1Q9LA 4FADA 5HSFA 1FN4B 4JANB 1DO6A 4C8XA 1RHHB 3HC4H 1CBVH 1IBDA 4F9LC 1JWMB 2OR2A 2X7VA 4HJFA 5DK0A 5KYUB 1HSBB 3BRGC 4Q9CA 4R33A 1OF2B 2GJ6B 5IJVB 5IZ7A 3D8MA 1KM5A 1FNGA 4MBRA 4IGBA 2DEPA 3B2VH 2GBUA 3BGFB 5IB2B 5JPNB 2ZUQB 3AS0A 1MCCA 1T4WA 5IBTL 4AQAA 5AVYB 2ODOA 4DGUA 1FYTE 3SDXA 3VE0A 3U4EB 5CCZA 4K7PH 4BK5C 3EBVA 3TSMA 4B5XA 2PYEB 1XUUA 2GITB 3WTXA 3CCHA 3IBOA 5C9JB 4LANA 2R4RL 2B0SL 4C4UA 3OF6A 4LNVA 2V2XB 1ILUA 4JFOB 1TYGA 4EAYA 3CHPA 2BP5M 5IEKA 5C7XH 1MWAL 5GS0C 1BBJB 4J4KA 4AB4A 3T3MF 1ZHAA 4KKLC 1MCRA 3L3IA 4OUEA 1PUDA 1PWMA 2FPTA 4KRPB 3PABB 5KJ7E 3QI9B 5BVJB 3HHSB 5AHMA 4MB1A 1UWUA 5FW8A 5FECA 1ZV2A 1IEBB 1W0WA 5IROC 5E70A 2G3JA 1FWEC 3V36A 4URKA 1UJ3A 4J3OG 3A0OA 4LSSH 3LH9A 5KBPA 2A4EA 3CVBA 4MX7A 1WAAF 2PN5A 1SNRA 2YSTA 4UTKA 3VDBA 4BCXA 2W5FA 1FGVL 1HXMA 4YH6A 3B9DA 1IGTA 1XRTA 3UZYA 2I5YH 2CZDA 3L1OH 1KCSL 1SMAA 1UUSA 3O0RL 4CGUB 4E6MA 3FV9A 1OCWL 1SJVA 1XMWA 1WITA 3VFMA 4GKSB 3GUWA 3W0WA 4DZAA 3W11C 1TOXA 3PPCA 3NSJA 3SDYH 5JPMA 3NZ1A 2VRJA 2VSDA 1PX3A 2P5ED 5BS0D 3P4MA 5IJKA 3UTPE 2CK0L 5LYRA 4XHJD 1TJIL 1H60A 4U7MA 2TPSA 2X4OB 2DM2A 1OWQA 4ZPTB 2XVLA 5ADOH 2ZUUA 2CLKA 3OTTA 3MKCA 1Z9PA 2C9QA 1JGDA 1UYWH 3PTQA 3ZFHA 2ALRA 5LIUX 1Z3GL 2R69L 4BFKA 5TF0A 4U1MB 3W75A 3WUGA 5HVHB 3QARA 1B3JA 1EOMA 3QKZA 4OU1A 1SSDA 3FT0A 3T0CA 3CXDH 3S37L 2XA8L 1S7VB 3EYFA 1TZHA 4JM4L 1K9FA 5G2HA 1ONQA 1FX6A 1NF0A 1WP6A 1S9XA 3MJ8B 1YMYA 1KFJA 4NNYA 3DFOA 1Z3RA 1K8IA 4GGHA 4WUKL 3AIBA 1HGWA 1ZEAH 2MCAA 1PV8A 2BFGA 1S8DB 4W7UA 3IKKA 3VXUA 3MRRB 3N6YA 4KTYA 5AYBA 5ICYB 1QWNA 1FE8L 4WDIA 3WFDL 5FF4A 4Y9EA 4PY8I 3TT1L 4M5PA 4LEOB 2YD9A 3A3WA 4XKYB 4C65A 1HE7A 4RISH 3HGJA 3DUHA 2R2HA 1CD8A 3EJZD 2CXEA 1NOUA 3FQTA 3UGVA 2NXHA 3T4YA 3WKMH 4F3FB 2ISSA 4A2DA 5F0MB 3U7VA 1YPIA 5F7LB 4EXBA 4ETQA 4QIUA 3BG5A 4O1FA 4ZSTA 3K6DA 4AL8C 3ZT7A 1WWAX 4Y5YC 2VEPA 3IJHA 5K9XA 3NPSC 1G9HA 2PO6A 2ZZ5A 1H6UA 2DIKA 5KYNA 8FABA 2CDEB 3L3OB 1IQDB 4DAGL 4EUPB 3HI1A 25C8L 3WH5A 2XXFA 3W71A 1IAKA 3K13A 1AGEA 5I19L 1YPZF 4QTIH 3ENEA 2R56L 5JHBA 4EVNB 5DT5A 1QR1A 5IQ9A 5CPOA 3D39A 1XH1A 6CGTA 4JFED 2WZPD 5I18H 3RJXA 4UC5A 1U3HB 1TZ8A 4NHCH 4DWSB 1L2QA 3BLIA 2YYUA 2HTKD 1TPUA 4TUFA 1H1YA 2OVLA 1LO3L 3JUYA 1ZAGA 3HAEG 3AUWB 3CAQA 3RY6A 1G9MC 1NAMA 4NERA 3W76A 1AZRA 4U1NA 1CLCA 5GS0L 1XB6A 4M93C 4OFPA 4LAZA 4Y1AE 4O13A 2XXMB 2WCSA 4PEEA 4WI3A 3VXNA 1SY6H 2IGLA 2J8UB 4WJG3 4LRSA 3P54A 3NOEA 4GMTL 4JFVA 1HTIA 1U21A 4OF6A 3KL3A 3MRBB 5CJ8A 4M4RA 1T0NA 3KLDA 3B7RL 2JLLA 4QYAA 4IICA 3DMMB 1W1VA 4I3GA 3GFYA 3C75A 2WQAA 4AEHH 1UXSB 4GT0A 4MKNA 4B3LA 2ZXAA 3Q05A 1F45A 1J0YA 3ZKNC 3O2DH 5I8CB 4W5UA 3IN0A 2J6EL 5I15H 1YEIL 5EYWA 4IOIA 3RWDA 2J6VA 4DP6X 3PDGA 2IJ0C 1CXIA 5LA1A 3DC8A 5TDPA 4ADGA 1IC4H 2HLEB 1YDNA 3CAVA 4XRCA 1QNZH 4IOFC 4K8RC 1KXQA 3ABZA 3H9HA 5CBEA 1CE6B 1UG6A 1RZKH 1E5NA 2GFTA 5FJPA 3U2SB 2A1YA 3W38A 4IS6A 5ELIA 2ZOKA 3QPXH 4A3QA 4ZNEA 4QE4A 3ILPA 4AEIL 3A67H 4YLWA 3VGAC 3ULUE 1OBAA 3M0LA 1WH0A 4FL4C 4DBSA 4PL2A 2PUQT 5I8OL 3I02A 5DMKB 2C91A 3KJ6H 4NAQA 4XPTL 2RJHA 5CH9A 1OTTD 4WV1B 4LT9A 4PSPA 5JXAL 5LAXB 1W5OA 4Q2ZB 4PRIA 3T05A 3I50L 4MQ7B 4XZNX 2MTAA 2IDFA 3UXAA 3Q45A 4TSCH 1HDMB 3WAJA 1TUPA 4O17A 3BW9A 2EHHA 1QNSA 4YOKA 1YBQA 4I2XE 3RJQB 4PHZA 2C1GA 3W7DA 1XJBA 5JW4R 3UTQA 4QAMB 3B7UX 4MDJB 4FA3A 2C8NA 4K94H 1I7ZB 2YR3A 1AQHA 1OIMA 3HOJA 5D9SA 3AIUA 4LAOA 5HNTA 2AXGB 2YD5A 5CINL 3E8UH 3JWOC 5ITBL 2CGRL 4AMKH 3T0AA 3CLEL 4ICWA 2VWSA 1G4MA 1RK7A 1A4KA 3H26A 3QW3A 3LCXA 3THDA 4JM2C 4XN2A 4O9HH 3U6XA 2YL6A 2HSAA 2XDFA 1F73A 1FP5A 3KOYA 1A7QL 4PMQA 5H8UA 3SDAB 2HFGL 2QF7A 2E9BA 4KQNA 2OI9B 2AITA 3S1VA 3RX2A 2LTQC 1HW6A 5LHEA 4WW2A 5BNKA 2F54B 1CR9H 3BWAA 1QA9A 3IIPA 3MV7E 3JSSA 1QFPA 1NGZA 3PWUA 2WGNB 3IAGC 3CHQA 1HEZB 4JHBA 2VRKA 4KHTL 4XVTL 4JIRA 4GO6B 1Z0MA 3PG8A 4BH8B 5CR8A 1BVWA 4POYA 2VW7A 1SW7A 2TODA 3TEVA 2XY1A 3SE9H 4UTTC 2GT9B 3MU3A 5D7IA 3EH4B 1MRDH 4MDIB 1LEIB 5F93C 1ZS2A 1GIGL 2G96A 4CQDA 2GQ8A 4B9JA 4F0RA 1JRCA 1JF6A 3QJSB 3HS9A 2VEKA 4RMWA 2Z65C 1P0SE 1C5DB 3B37A 4RQQA 3RM9A 1FWDC 4H9UA 4MMYA 4U6VH 4CD4A 2NCEA 1BVNT 3O3EA 1IXOA 3DUGA 4L1BA 2YHGA 5I0DA 1G9ML 2HT3C 4PLOB 3WK2A 5I9QB 3P9WB 4UQEA 1N7KA 1T1YB 3S3PA 1IGWA 2BP1A 1JZHA 4IRSC 1CGSL 3EMQA 3RY5A 2B5IC 4Z8FH 4I85A 4M02A 5HANA 5DQ9A 3WMPA 4RUBA 3LI0A 4PMNA 2DPKA 3ZDYB 1D2PA 4N20A 4YLBA 3IF1B 2EKJA 3L81A 1X96A 1BGXH 4FQPA 3W2JA 4FFWC 2BXYA 1TXKA 4OCWH 3QV6A 4J1UA 1G7IA 4K3JL 2XH2A 4TQIA 4FZEL 3FMGL 4JFFB 4XCYB 3ZJKA 2A73A 1XYBA 1U93B 4F2MA 4F7MA 4HWUA 3W5NA 4R34A 4WW1A 3H6AA 3OKLA 2OXNA 4GYBA 4E0RA 3EWWA 4GSUA 4FX5A 1U8HA 4PRDA 1G7MA 3CLFH 5GGTH 4AZ8A 4KKLD 2JKRM 4J3XA 5IVXB 5CG7A 1KLYA 4XOCA 1Y5VA 1J0ZA 4LVHC 4N42A 2CETA 3SADA 4AQ8A 1QNVA 4ZQMA 4JFZH 1KJ3H 3V75A 5IROD 3IIOA 1C90A 4I9AA 3PDOA 3UAJC 1UCBH 2FYMA 1JS4A 5SWUA 2V67A 4NRYA 4JREB 4KWVA 4MZIA 5A2JH 3MJYA 1I8UA 4G8AC 2CHXA 3C0LA 2AZUA 1KTDA 4N25A 4QG6A 4R83A 5J12C 1KCUL 5ABEA 4YHOH 1I4FA 4S3KA 2BOEX 5ERWA 3F4WA 2P5EA 3SODB 5BS0A 4X8XA 4NENB 3HM7A 4M1DL 1YXDA 2WUCH 3W11D 1FSKC 4PB3A 1PS3A 4QHPA 1DL7H 3GKAA 1EP3A 4H3DA 4PJBB 3PWAA 2FCBA 1TVNA 5I1EH 2VLJB 3U79A 3LNDA 4ALAH 1B2WL 1KIPA 4HCRA 3ULVH 4ZTPL 3FSUA 5MHSE 5FYKH 4K3EL 7REQA 5ES4B 3JWOL 4M3HA 3RKDC 1GYLA 3PBWA 4LHUG 1UGKA 5KN5B 4XPBH 3FUEA 5GNYA 4PBVC 5T1KD 5M7QA 5EFIA 4ZMNA 1UZHA 4I4WB 1T03H 4IU3B 5TE4L 2BIPA 3QCVL 4DW2L 1GW0A 1QSED 2G4EA 3ZE0F 3ABQA 4NJAH 2V17L 4GIYA 2AL2B 2PWHA 3W39A 3NSMA 3FAXA 4H6QA 3QRBA 5AC5A 1EDHA 3UZZA 1JDDA 3MLUH 4YX2L 4JLRA 4U6YB 3RU8H 3CDCA 1KACB 4QITA 4AD2A 2PGEA 1TZAA 4MD5A 1R3TA 1JYXA 3U4AA 4XCNB 3VIKA 3Q01A 2OGJA 3L3DB 2C9UA 3VB9A 1F07A 1K8CA 3G6JF 1HC1A 3HA0A 3ARBB 1V0LA 4LB8A 3ZKXC 4XR8C 4RAHA 1IIGA 2Q01A 4ROQA 1LDSA 1AH3A 4WKFA 3DARA 3GC3A 4AZBA 4JG0H 1NGYB 2YQ3A 3V0DA 1X9LA 2C1OB 3WQFA 3FO9B 3B43A 5DK2B 3MUUA 1E0WA 2FVLA 3QFEA 1A6UH 3W4RA 1UC6A 3MWAA 1OPOA 2GUUA 2V2TB 3MRCA 3Q65A 1JCVA 3KNBA 4EIGB 1RBLA 5GRVL 4K1WA 3WKNA 4ODXA 1CCWB 1OF6A 4WCYH 2AV1B 1PZ2A 3DX9A 1EO7A 2RFXA 3UJSA 4JFEA 2WZPA 4HSNA 4XV0A 5DQDL 1V27A 2QUMA 1H3PH 3ZN6A 1YEWA 1K4DA 4F33A 2B20A 3C5XA 1H5BC 1RVFL 4HV8A 5E5MA 3TFKC 4IJTA 4WWPA 4LNYA 1AY1L 4J4PD 3G8RA 3BKYL 2GOUA 3V6OA 3F58L 3OV6A 4B4HA 3ID7A 4XUGA 3IVTA 2A21A 5HHMD 1H7RA 4D1IA 3WLQA 2WIIB 1S5IH 3CIQA 1V6XA 2BSDA 1KTLB 2DLFH 3WFCL 4DZ5A 5KVDE 4PRHE 1H15A 4TULL 1KV3A 4YSQA 5F9WB 4WJKB 3DI2B 5DJ8A 1WZ1L 3PJXA 5I3FA 5MERA 5TAOA 1JE6A 3RTQC 4KJPD 3R18A 4N0CD 3MV01 1RIVH 2OMZB 4LH8A 4DLFA 4L18A 1R9XA 4OLEA 4ODTH 4XMTA 1U33A 3OEXA 3V6FA 2I07A 3FSWA 4JKPH 1P5VB 2PCYA 2CCRA 3P77A 5DZAA 5C07D 3BWWA 4P5MB 4XPGL 3TTYA 3SPVB 5I00A 1MEIA 4DJEA 2P88A 3CN1A 1M7DA 1IM9D 4QTFA 5BRZE 4Y8EA 3EWXA 1A5SA 4JO1L 2YXOA 2GC4C 3FCTB 1UR3M 2H26B 1QMUA 5DJ0B 5INCA 4XOBA 4YQXH 4AVJA 1A1MB 2ZWKA 2AGJL 3LS4H 3F1QA 1S38A 2XTJB 4ZFOL 1LOSA 3OXSB 3FU6A 3FQWA 3I4KA 4HFUH 3MRDA 1R5IA 3B5HA 1AJZA 1YDYA 2OQLA 4O00A 3IVKB 3LNFA 2VENA 2F19H 3CG8A 2R1LA 1JHTB 4QE5A 4B92A 2Y5JA 2DWDA 3FFDB 2KKQA 4LDEB 3VUAA 2Y7NA 1ZVSB 4TVPE 1YIXA 4IOFD 3FSZA 4HIHB 4WUUB 1OEZW 4PTMA 4YYFA 1LE9B 3WJWA 5F2LA 4WKAA 1DYZA 3G1FA 5EF1A 4X5WB 5I0XA 3OZLA 3CV1A 4LUTB 1KJVB 2IS7A 1YDPA 1GPWA 4MQXC 3QJXA 2CJTA 5MI0C 3NCFB 1F8MA 2AP2A 1ZA6B 3AU2A 1TJRA 1DJXA 3MFFA 4R97C 5FYLD 4R2GD 1WIUA 2XN0A 3G5VB 3MLZL 3TYFB 3MV9E 3II2A 4A7QA 1HKLL 2JI1A 2JCCF 3L4CA 4AVKA 3KD4A 1OG6A 5E6UB 3QTGA 3ASWA 3JZ7A 1XICA 3STCA 2FL5A 1MCEA 3PUUA 4WO4D 4AZUA 1OAYH 2Z1PA 2F9BT 1A0DA 3PQYE 4JDZB 5A6LA 3S6OA 4PGEB 1D2OA 4YGVA 5ID1A 5EL1A 2NWSA 1KFAL 4FNPA 4GJIA 4KZEH 2NNXA 3TLQA 5CM1A 2DTML 3GNML 3LV3A 3DA0A 1URZA 3LN9A 1BF6A 2GL5A 1RZIA 2RIKA 3PJSA 4HLJA 3UBXG 2LGNA 2IPKB 2WZ6A 1EX1A 1KT2A 3LMZA 3NQIA 3TBTB 3QORD 5SWSD 3OGRA 1JXGA 4N2GA 2ZOXA 1XYAA 4U1KB 2A77L 3PBUA 3JR2A 2OV0A 3AC0A 1OADA 2YW3A 1OABA 3SKMB 4ZAKC 1KTCA 2YX0A 1DFBL 2Z7UA 4IMGA 3CN4A 4PGJA 1WYIA 2R4SH 3GB7B 2PWVA 3TJXA 1N7MH 4X6DB 3BO8B 2HXTA 1QI4A 2BTMA 5F7AA 1R2SA 5E8OB 2XH7A 4MA7L 5D4QA 4LXFA 1OY3B 3EOUA 2IOOA 1I8MA 2NQ5A 4FPSA 4QSHA 5HJLA 1A9EA 4UT6A 4Z7WF 3TBBA 3LKQB 2ZCHL 4V33A 1QD0A 4QOKB 5I1LB 2B4CH 3LCFA 4UI2A 4B15A 4LE8A 1U30A 3NFPA 2H8ZA 3V0HA 4LNRA 3TMQA 4H25A 4UQ2B 4DPCX 2F53B 4EUPH 5FUZL 4LF3B 2SEBA 1NDMB 3CHCA 1ITXA 2Q6ZA 4Q6JA 3FB7B 1Q65A 3A21A 4HHPA 5DJAB 4B9PA 3D5OF 2R1NA 1MW0A 3OGCA 1KXHA 3WLOA 1S2TA 4J2XA 4FI6A 3AAMA 1MQRA 2W60A 3B97A 1T21B 2WMPA 2NDGA 2Y5TA 4U4MA 5LGJA 4CNTA 1NAKL 1KDIA 2HT3D 5EWIL 5ICZB 1QX1A 1JAEA 3QWQB 3CDYA 4IRSD 3ARDC 2VL5B 3L1EA 5TDOB 5B39B 4XP5L 3GDBA 3TBSA 4LNCA 1L9SA 43CAA 4ES4A 1MNUL 1M53A 4FFWD 2KZBA 3T08A 3ZDXF 3UZXA 2ZJSL 3IMSA 2B31A 4Q0XH 3SY0B 1GR7A 3SZ8A 3CVHA 3HRPA 4DUXA 1DKWA 3WQ8A 5IROA 1C08A 3X11B 1QEXA 3W25A 2FDBP 2WTRA 2XQYA 3RX8A 3CPRA 1SEBA 1W91A 5C0FB 5C8JA 1TPC1 1U8IB 3WI9A 3KPSE 2OPJA 3DU0A 3PF2A 5DMJB 3L17A 3QQNA 5EBLB 5E9NA 2L7EA 4G72B 1DE4A 1OZUA 2IH3A 4RWHA 1E55A 2UYLA 4IWWA 3PZIA 5EDSA 2C79A 2D7QA 5GRUL 1JZ5A 4O18A 4P9ML 4JDBA 4M1GL 4AIBA 3F5JA 2A4ZA 4RMQA 4PJHB 3U1PA 3TYGH 3MUJA 5D32A 4ZE5A 3QB7C 3NCYS 3I6GB 4G8EB 3H22A 4ZUUB 4E8DA 2J88H 3ZZQA 2Z91B 4LU5L 2W92A 3AWGA 3RPIA 4LKXA 4X8CA 2LVCA 4C56E 2WXGA 3VXRE 5CEZH 3F2DA 3ABMB 3DUSA 5ANMA 1R3JB 1EXBA 3D3AA 4DXVA 4URIA 5I07A 4RZBA 2X40A 1O7SA 1TZZA 5GIRA 4KWOA 2FFIA 3DESA 3QUZC 1BYOA 3QIBC 4KAQL 3GG1A 5T1KA 2BLFA 3NGFA 3DXAD 4OCRH 4Z0BL 1UT9A 3VNLA 5MEPB 3L13A 4ZUTB 2GK1A 3B9KC 1QSEA 5J9PA 2AZAA 2QSVA 5T9BG 1NDWA 4PJ5B 2A4AA 3RYMA 3MRIB 2OZ8A 1XGQA 3UFIA 3ZGIA 4GCXA 2ZAIA 2XZAH 1MDTA 1H3GA 2P7TB 3WNPA 4Z7IA 2DSWA 2V8MA 3NZPA 1E4HA 4FQLH 4P3DA 2J5WA 4YWGL 2UY4A 4OTXL 4H1LA 3ECUA 3E96A 4MUZA 4ADSA 1ID5I 4PTTB 4WDTA 3BH9B 2BODX 4EPBC 4RK8A 3MA9L 3SY6A 5IQMA 1RLBA 4X4XA 3VGBA 5DMYA 4GUQA 1D9EA 5LNDA 3B3DA 2X1XR 2P0OA 4Q4QA 1FWJC 1A2YB 2X70B 2Y89A 4OECA 3ZYZA 1BZ7B 1NBYB 4CLMA 1DE6A 2GVYA 4QRTB 1XF4B 1KYOJ 4JN6A 1MCPL 1O60A 2O5XH 3A13A 1D5BA 4WEBL 3RLUA 3NXFA 2XRAL 4YDKH 1NCHA 7ODCA 5E00B 5GSRA 2MMXA 3KXQA 1G9NL 1TEFA 4MGGA 1HZHH 5DD5L 4MXQD 1E5AA 4ONOA 1KC7A 4AG4H 1BV8A 4NI6A 5LGXA 1NP2A 4ZQOA 4D9LH 1WWWX 4PFEA 5K39A 5JQ6H 1SLXA 1J4EA 3TFCA 4WK4B 2G9HB 1R34A 4NF7A 3OZ9L 2VR9A 4J4PA 1HOEA 1UM4H 2EG7A 1MQQA 3KWXA 2VRAA 5D9PA 5D2LB 2ZUYA 5JXQA 5DUPL 4YGAB 4PJGB 5FEZA 1FPTL 1RUML 4JFPB 3DSNB 3TFKD 1ZV9A 2AQ1A 5AQ0A 2WBGA 2H3NA 3DJZA 1HHGA 2XQBH 5EDXA 3BG3A 4JQIL 5D5MF 1NGQL 1GG1A 1ONXA 4DBWA 5EMKA 1S7WA 1JK8B 3RX9A 1PKOA 3G1AA 4MJHA 3NA9H 4PBFA 1DN2A 1XDJA 2O6EA 2AL1A 2R2EB 4Y4HC 3CHXA 3MRJB 5C07A 4EOUA 2AEQH 3KBVA 2VXUH 4P04A 1CBJA 3T8QA 5DXYA 4CD8A 4HXBL 5GJTH 1R85A 3D2UD 2TSAA 4X22A 3HB9A 5FUOL 2VEGA 4QRRB 5LNVA 2G75A 1V6VA 4I9JA 1H61A 1YEGL 2QQNL 1V7AA 1Q9OB 2A7BA 3LKRA 4DHGA 4WWKD 3V0GA 5IUSA 1ENUA 3HTLX 2PMZA 2NY5L 1B0IA 4OGZA 2Z93A 4BSWB 4NNPH 4OU3A 3NPUA 3DJRA 2J55A 1R3IL 2JB5L 3DBXB 3VOFA 3VA8A 3CFKA 1K2DB 3OIHA 4IIFA 1RZFL 4NEHB 4Z7VA 4Y4KB 1BWLA 3RB5A 3URQA 3V5HA 4UCFA 3KBSA 4YHLL 1P4LA 1X5ZA 4KJWD 1T2JA 2ZTJA 3VD7A 5I8KL 2BWQA 2Y7QB 3VXUD 4RNRA 1GVRA 4KH9A 2WBXA 1MFCH 4WDWA 1MCDA 1JXDA 3TYAA 5E5CA 2DDQH 2ZSVA 3MMTA 1M3IA 2QSTA 2WZHA 5AHEA 5EC2A 2Z1VA 4HUWA 4QRUA 3O4LB 4WO4A 3DROB 4ZMLA 4JFDD 1BG4A 4RKAA 4XBGA 3WHXA 3SSZA 1UH4A 3OVRA 4IQHA 3GFUA 2VZSA 3FJTA 1T96A 3TEUA 4HC1L 1ZLSL 4NHUB 3VFWB 5FI8A 3WO3B 2WIMA 3CZKA 2BOFX 1AD1A 3QORA 2OW6A 2LOEA 2PLJA 4ZUSA 1UR0A 5JMRA 2H90A 2AFNA 5DMMA 1JDEA 1XR9A 3M7FB 4ZD3H 1E9OA 1RIHL 1A3LH 3E49A 3HN8A 4M6AA 3RNDA 5FJUA 3KCPB 2Q86A 1JZIA 5CKSA 1H2JA 5AVZB 3MPGA 3BQ5A 4Z0XA 5AZ0A 3DVGA 4GYJA 5G2WA 3H70A 3BWSA 3NIDB 2BSSA 3C2SA 4ZAKD 3FBKA 1U58A 1AS7A 4AGNA 4A3RA 2RMNA 4TNFA 1TCRA 5EZJB 4DJDC 1N64L 4OQTH 1OC6A 3LNEA 2Q76A 1NARA 1T0MB 4MB3A 1SDYA 3U0TB 4UTTA 1B2YA 2ZBTA 2FT7A 1A9VA 1NANH 3SDDD 2KC0A 2CCLA 1JRHH 1U95A 4K9JA 8XIMA 1KB9J 4UM9B 4C59B 4I77L 4MXVE 1IFHL 3VSTA 5C9ZA 4GFIA 3OAUH 4LBRA 3T0XA 5D72H 3NZQA 2OQYA 2R29L 4GQ9H 1K9EA 3DURA 1E9QB 1GAFH 4P7QA 1YEDB 3BSZH 1FL5B 1HKVA 4RE0A 1QLEL 1DIDA 1FOBA 3HAEB 5TIMA 3Q2NA 1PKMA 1PKYA 1MVUA 2UBPC 1FH5H 4XH2A 1UM5H 1WG3A 3UTOA 3R1ZA 4XD5A 3G6LA 4IRSA 3TV3H 4ICXA 5IJCC 3G5WA 1SJDA 2Q2EB 1K3IA 3ISWA 3L5WB 1BQUA 3BK0A 1MCOL 3E6FA 4K5MA 3FT2A 2V0AA 3O8AA 1A9BB 4B5TA 4PG9A 3CB3A 5MENE 1MIEH 5L2KD 1NKRA 3ES6A 3HU7A 5D7KE 5EFDA 2YRLA 4PGBA 5F7FA 2X9ZA 1JYVA 3DTDA 2ZD0A 4Z3TA 3KM1A 2YC1A 3ARDD 5BMWA 3IACA 4PB5A 2Y6SC 5KYWA 2WNZA 3UGUA 1XGRB 3WS6C 1XIHA 4JPSA 1SJAA 1T3FB 1OSPL 3VFTA 1ZZMA 1PTGA 2ESVB 4LVOB 4XD6A 1OYAA 4BEQA 4KEUA 5KJRL 4ODSL 2DW7A 4APQC 2NVCA 4H83A 1B3YA 4Z1BA 5BV7B 3PZTA 1R2TA 1YVLA 3L65A 3D51A 3ZT5A 3KCWA 3ISIX 1UP0A 5D70L 1TELA 3S96B 1FYHB 4HUUB 1FFNA 3FH8A 1EC9A 5EO1B 4OJCA 1F0LA 5I1HL 1FVPA 1I9RH 1MPAL 3HC3L 1DBAL 1IF2A 3CMOH 5LB1A 5D9MA 3FH5A 1KBPA 1LMIA 4Z7AA 5BUAA 4YDLC 1UA3A 2R2CA 1OP5K 1ZRUA 1RFDH 4I1PA 3EYVB 1FY6A 3H9SB 5HD8C 4ZO8A 2BOLA 3VWJD 4G42B 3RIFK 2OK0H 2C71A 1IZKA 3VX1A 4PJEE 3DO4A 2Q3AA 1OTSC 4Z5RB 4PRNB 2V30A 4UTAH 4LCWD 3DXAA 2H6PA 2CA3A 1ZAHA 4HP5A 1UCTA 4NCDA 1L9TA 4YYCA 2HFFA 1S7XB 1U91B 1W3LA 4PJIE 4RRPM 5DANA 1EHXA 4DJMA 1VPOL 1W56A 1TG8A 1J9QA 4WX2A 4FZIA 1K70A 3NNTA 4Y19D 5LGHL 2A6IB 4Y5VB 3JBG7 3IK2A 5DZ9A 4ZTOL 2ZOTA 2AJSL 2OLSA 4MBOA 4C6PA 2BVOA 1P4IL 1E4WL 1HHHB 3QR0A 3DO3A 3SD5A 1ITCA 3X3FH 3B9KD 5BU6A 4NO2B 3BOVA 1CXLA 4IBTA 2J79A 4FYTA 3DIFA 1IT9H 1CICB 2PDJA 4UINL 1XTMA 1QW7A 4GP5B 2J24A 3T8XB 2O1AA 3T8VA 5IHWA 1AI1L 3ZDWA 3HGOA 2X6CA 5K2ZA 4KKQA 4EWND 2YXWA 5I78A 4MMXC 4R4NC 5FOOA 4KWWA 3ASNB 5IOPA 4M7JH 5FJOA 4W88A 5I24A 3VFGL 4YFEA 1B5TA 2CRZA 2FATH 3PGCA 4PJXB 1IR2A 5BYWA 5IB1B 3C60D 1T6BX 1SJEB 4G1EB 3IFOB 4NDMA 3UC2A 3CFCL 3PR2A 4ZSUA 2JK5B 5DVOA 1SXNA 4BIKA 4QDGA 3PPHA 3GO1L 1PLGL 3REQA 4Q8MA 5C0BD 1H4PA 1NDZA 4G6CA 3RWJB 2O7SA 1ZT4A 3FO2A 1UWTA 3M64A 2VDKB 5DDHA 2ESCA 4HNLA 2FTPA 3V0JA 3O9WB 3ULUF 1EQPA 2FX9H 1ZDQA 3HQ1A 4OLUL 1JPTH 3SBQA 1JPHA 5CEYB 3IFPA 1AGDB 1DVQA 4TX9A 4HPHA 3W6YA 2Q6WA 2VH5L 3M7SA 3KM2A 1MFDH 3DGRA 3O05A 2WV8A 2VDNB 3NL2A 3F5LA 3I6RA 4LFYA 3VDAA 1RQ5A 1SRDA 1JPST 3ZL4L 1BYDA 4NXSA 4QXVA 3T9PA 3ILQD 3TJIA 1T6WA 4ZB0A 3C9NA 4XZIA 4XQ6A 2F8XC 2EYRA 1I1AD 2MEJB 4L9LB 3E1F1 3UJFA 5D96B 3RTQA 2I7SA 3FB6B 3D2UA 1MKFA 1L9NA 4PJCB 5HDOA 4FHKA 2GVLA 3NK3A 3PHOA 4MJ2A 1KBKA 3S5NA 1D5RA 3I6LD 4OFIA 1QABA 4AIOA 2DWEB 4GFTB 5C09E 3F7KA 3SD2A 3VPLA 5JOFA 1T5XA 5CCHE 5CMAA 4K68A 5HATA 2VCAA 3WN5C 1XTLA 4WWKA 5T3ZH 7PCYA 2V81A 2EDNA 1D3GA 3HMJG 4RFNB 5DZOA 1E8ZA 2PZ0A 4PR4A 2VDPL 3B9OA 2WHVA 1B3ZA 3ANYA 4J3ZA 3OX8A 4Y1TA 1C16A 5CBIA 2CWRA 2XT1B 2EIKB 2KAUC 3HE7B 4S1QL 4AWUA 4K7PX 2HT2C 3MLSL 1RJQA 2WQSA 3O0FA 3JWNC 2X38A 1EQWA 5JW5A 2W65B 3VOJA 3ABRA 2VGIA 4LPUA 5HI3C 4OZHB 3IK4A 3MQIA 3QHMA 4D8PA 3MRPB 4KXAA 2Z7ZA 3KPMB 1OP4A 1IJ9A 4Z95H 3ULUL 5K9KA 4X9HA 4MRBA 4RJEA 2Y8KA 1FUNA 1A1OB 3GIZL 2N3JA 1ORQB 4C6CA 2J7FA 1TQTA 3MO4A 1J5TA 4JFDA 1P1ZB 4X99A 4WJXA 3UPRB 3TCSA 1JDFA 4LHUB 3SCVA 5KSVA 3GPSA 4WKZA 2NY4D 5T1MB 4NC0B 1TV2A 1DQIA 5IJBC 4HAFA 3THAA 5HHXH 4OT1H 4X0KB 4P06A 2OB3A 2NNCA 1NFIA 3DGDA 3G0SA 4OFYD 5IVZA 4ELDA 3STLB 4K23L 4IFKB 1JNJA 4XMPL 3KS5A 3QFWA 3CFIC 2XWTA 2BNQE 4R0LB 2Q7AA 4AT6B 1YHTA 1RZGA 3IDIA 1E7VA 1WFUA 1RHCA 3C5ZB 2CRYA 3QDJE 2DZUA 3ZO0A 1JMZA 1GGIL 3WD5L 1IGYA 3EBIA 2V2HA 4IOSD 1OP5H 5HGHB 2MOQA 4HALA 3PRZA 3TTSA 4POZC 3QXDB 4L9YA 1YYLH 3GMNB 2I7GA 3DG6A 5B3JE 1F3DH 1NSJA 5B1CA 3TN4A 4ZAKA 3TH4T 5JHDD 2FYYB 1XX1A 1QSFD 2H32B 3VG9C 3IIVA 4ZMQA 4Z0JA 3PWPB 2EGZA 4TNEA 1HP4A 3EGDB 4AXKA 1A6ZB 3QFJB 3VOCA 1W72B 1GG0A 2C3VA 1J1XL 3ABGA 5IGXL 1YEJL 2OL3L 3BGMB 3KW3A 4NM8H 4NUQA 1NGXA 1CTNA 4HMCA 3SDDA 4GB9A 4KW2A 4H20L 4WNQA 2UWEB 5DJZA 5JQIB 4DJDD 4PUUA 4H8QA 3CQQA 4Y0GA 1E0OB 3BANA 1E65A 5SWZB 2D31A 5D4HA 4RE4A 4B5SA 5GGRB 4ELKA 1GOHA 4BUQA 4BXVA 4DQAA 3PL6B 2OJZH 4DKAA 3W37A 3DX2A 1BFOA 3JV5A 3V5KA 4DJED 1X5GA 4JKKA 1C5CH 4IMLA 4U6HA 2XIBA 1EGMA 1NMAL 5DWPA 3RAOA 3UVAA 3AQDA 3SECA 4OBSA 2E1DA 1U8KA 4ZFZA 4FFYL 4KVNL 2QL1A 2GSMB 2HJLB 1R24A 1FZOB 1SZGA 1HL2A 1YXYA 3NCEB 2WHLA 1NCOA 5L2KA 4LAMA 4ZMGA 3JQOB 5E1AB 4OF5A 4CUCA 4XOAA 1XGUB 2DQJH 3ARDA 4R8WL 5I6KA 5EORL 1O1ZA 2VM4A 1KLUB 4OKVA 3UACA 2X4RB 1L6FA 1I7UB 4OCMC 4KKCC 1E6OL 1ZVYA 4KQ3H 5FJJA 1OINA 4JAMA 2EF9A 5KVGE 3WLIA 2I5IA 1GONA 4J3OH 1BXVA 2E47A 5B3NA 4W6WB 1TETL 4LC8A 2DQUL 1RUQH 1I31A 2VXSH 2Y6SD 1ZHBB 2R8WA 1HINL 3VXMB 4KFPA 4XNYH 5MKGA 5EUKA 3VD9A 3RRQA 4Y2OA 3LBCA 2VM8A 1JHLL 2IWFA 1QFHA 3QS3A 4QNPE 3SJVB 3CDZB 3IPEA 3NACH 2KZ1B 5DVKA 4APQD 1G4SA 2WV3A 3P62A 4IRZA 4JFXA 4FNUA 5F88B 4KXZH 2ZOUA 3VIFA 4D7BA 1ZU8A 2XFWA 1J8HE 12E8H 4ZMPA 2WSQA 2GUOA 3SKOA 1XFBA 5T1DL 4G6FB 2B08A 3VQLA 2Q8LA 2CA4A 1IKOP 4RX4D 3VWJA 4M48L 1FTXA 3W9DB 4XMXA 3HR6A 3HI5L 4KO9A 3T0EC 3WD3A 2LVEA 4ZODA 5CC6A 5K4ZA 1HXYB 2WXRA 4LCWA 3S2CA 4Z76B 5C0RL 4LL9A 5AKSA 3DBNA 4ZVJA 1T6MA 4MA3A 3BIBX 1GPOH 1Y1UA 4BELD 4EOWL 4DP0X 3AXHA 5TF1H 1KLFA 2X87A 4HEMA 5A6SA 1DTNA 4L9DA 3HKFA 4Y19A 4PFMA 5AL0A 4QAWA 2E6QA 2VDQL 1OTSD 2X4NA 4MNLA 5T5FH 1XEDA 5F6IB 1ECEA 3EO1A 3UGEA 3G08B 4G2AA 2I60L 3OKMA 2VNCA 3KBMA 3ZQWA 3G04B 3B9KA 1MDLA 3QZOA 5I3GA 2TAAA 1F6LL 4U0RB 2OTDA 3RGVB 3V4PL 5DRXB 3LZOA 3UBXB 3H3BC 2WQDA 2WZ0A 4LPXA 1MRCH 3O6ML 1NLDL 5C2BH 4JKWA 4HS3B 2YQBA 1UOKA 5E1QA 3MY9A 1F6YA 5AOKA 2W4XA 5CEWA 1OZQA 2P8PA 1A7NL 1CYGA 4WIQA 3BKJL 2EXSA 5CBBA 3W2LA 1FA2A 5FEWA 5F9AC 2F2KA 3PWGA 3DX3A 1A6WH 5FA4B 2O6CA 2FDSA 4FHAA 1DIKA 1A14L 4GXUN 3E3QC 5F1NB 5D2NE 1AO7E 3C60A 2Y6ZA 1AGCA 3U83A 3PWIA 4UTHA 5ICXA 4R4ND 3MMDA 4G7RB 1TDQA 2LU4A 3V8CA 3EOSA 1NBVL 1H7XA 1T7VA 4TNVK 1LNUA 4HCHA 1WTGT 2NQJA 4QI3A 5ACLA 4FF7A 1HYRC 4Q6IC 2DZPA 5C0BA 2X30A 1W3IA 3OVQA 3BJ91 3H2MA 1WKFA 1V02E 3B7YA 4ZA0A 2VDLL 2IXVA 4O2FB 3K2IA 4BFOA 2BSCA 2H45A 3GDTA 5AW7B 4HCGA 1NL0L 2R0WH 5GS0D 5G4MA 4UR7A 4WVXA 4QF1A 1LCOA 5D1QB 4ZFMA 5MEQB 2B7QA 1YPFA 2VDHA 5K59E 5DUMH 4IIGA 3QG6B 5XIMA 1P7QD 4NRRA 2GBVA 3DRTA 3CAWA 4M4PA 4OLWL 3I65A 5T1LB 3RFRA 4DO4A 3QYQA 4XMKH 1A7PL 5FR3A 4UFIA 1FL6A 2VR7A 4B5NA 1I3GL 1M68A 4PCSA 3FS2A 5HR7A 3NDOA 4OF8A 4PJAB 4OSUH 3HAEH 1M7OA 2W9LA 1I1AA 1FRGH 4XX6A 3LUTA 4AF0A 4WI6A 2Z2BA 2XX1A 4JPGA 1A64A 1H9DA 2Y5QA 4IMKC 5KVDL 3Q48A 4XP4L 5DZLA 4QMEA 5IFTA 4P2RB 5C9RA 4FQ1L 3LQGA 1XGYH 1IKFL 1NM9A 3OPSA 2IXQA 2Y7MA 4YTSA 3ECBB 2V5YA 1A4JA 5JUEL 1WZLA 5ISZE 2FYVA 5ID0B 4FQXC 2PW1B 4UILL 1P7TA 3SGEI 4WSKA 3D1MC 1NOFA 1BF2A 3GM8A 2APSA 3LPPA 3WSUA 1BWKA 1N2RA 3VFSB 4NT6A 3G5EA 3QZEA 1A5OC 1ZANH 5EU6D 3ARZA 4N4YB 2XWCA 2GAZA 1FVEB 2PCEA 3R8GA 1IBGL 1NMCB 1XHHA 1UB6B 2BSRA 5BV7H 1H50A 5REQB 1EB3A 1OGTA 4UQ3B 2Z6JA 4DI8A 2GVJA 4XN9A 5D71L 1BRLA 2NR6C 5ENWA 1OHQA 2R2BA 2I9LB 2CLPA 2JF1A 4M5ZL 2E46A 4L1LA 1MXDA 4O52A 2Z31B 3H4FA 1O7AA 5IB3B 2HT2D 3N3EA 5AYZA 2K6YA 1PL9A 3CC1A 4Z7UA 4LALA 4TVPL 2HUEA 1V54B 1OM0A 4DYJA 3VNKA 2AK4B 4NILA 4UMCA 2HVBA 2BGNE 4JRYD 3F8UB 4JQ2A 4MMZC 4Z3HA 1OK6A 1AFSA 1G6RB 1TWDA 5CJXA 2ZUNA 4P2OC 1X6NA 2AAVA 2E5BA 3RNKA 2AQVA 4LCIL 4A29A 2A3BA 1ZCOA 5IREA 3N3MA 4OFYA 3LZ3A 1JD9A 3RDTB 3ROOA 4CDHA 1VGKA 2NV1A 1PKLA 1TCDA 3ZR6A 1BEYH 3FHAA 4LASH 4HK0B 3TYCA 4HQQL 4OCLC 4PU2A 5IB5B 2KLSA 3JV4B 4IOSA 3WNOA 4LSQL 2ZP0T 2ACQA 3BH8B 3GW3A 3JTBA 1VKFA 3K81A 3KCOA 5G5DA 4AKPA 1UT1A 1Y6MR 5HY9B 5B1JC 4JGNA 4JTKA 4E5TA 5JHDA 1DJNA 5BQ7A 3WXVH 4GE8A 1QI3A 5FB8A 1QSFA 2ZRVA 4UWMA 4F7PA 3DH7A 5I74C 1XIJA 2O5ZH 5EHFA 4M6ML 4NL1A 1LQSR 4XVSH 3C09B 3MTWA 1BFVL 4C1NA 3S34H 3SW6A 2AEWA 3TW7A 4EDXB 3OG6B 1QLFA 2IQAA 2XFYA 4C6EA 4JW3A 3MU7A 4DJDA 1ZHNB 3UG8A 1TQSA 1GORA 1CGVA 2YLHA 1QHOA 1DBBH 3SZ6A 4REQA 4KPHL 2XZCH 4WFED 2HRPL 3QULB 3FXIC 2QJHA 4XISA 1X1ZA 2AJXL 2VN6A 3CFBA 2Z25A 3S3JA 1DSFL 4L23A 1W0VA 2BC4A 5JVLA 1MWAA 3OPUA 4IIBA 4ODHL 6XIMA 5JIQA 2C3WA 3HIZA 4AE1A 2VDKH 2DT3A 4HD9A 1DJZA 1NMBH 2XPYA 3MGOB 4ORZC 4S0HA 2YUZA 2FJGA 3QXAB 5JO5A 4PJ7A 1YJDH 1X98A 4JTRA 5HI4C 3ZKND 3HFFA 4BRVA 4L6DA 3IRPX 3Q8CA 1JUBA 1QWUA 1ADQH 4MB4A 4DQOL 4PLJC 1CFNA 1P4CA 3AZSA 3LQZB 3QUYB 1TZGH 3K4ZA 1ZJHA 3H9ZA 2FGLA 2VDNH 3N85H 2NY6B 1CGUA 4D0DB 3GXFA 3IARA 1A50A 3LLFA 4K8RD 1ETB1 5HBFA 1N8ZA 3IUHA 1E5BA 4XNUL 4QHLA 4XN4A 3OQ8A 3D69A 1FHNA 3HB3C 4TQTA 4ODWB 1ED3A 5FSEC 4HKXA 4CCZA 5EZPA 5CD3A 1HILB 2GBTA 2ZKHL 4JYFA 5DBUA 5IQLA 4GUJA 4JICA 5I26A 5HGDB 4ACPA 4LVFA 5EU9A 1EJOH 1AH1A 1S2AA 3WS6A 1RZ7H 3VUPA 5DQPA 1XZ0A 3B8VA 1PLCA 2EDEA 3BP6A 1Z6JT 2XTLA 4M3KB 4APQA 1WDWA 4MFHA 5HJ3B 5I3DA 4YE4H 1OARL 4JY5H 3BZDA 3P2BA 4IKJA 3D47A 1N0XH 3WS3B 1B4LA 2LAAA 1DVFC 1FORH 3KR3L 4M19A 1F3RB 2IBBA 2R69A 4APXA 3WLHA 2XG9A 2CH8A 2JKLA 4UQCA 1US3A 5J6HB 4RX4A 1TPB1 2ICCA 4DEPC 1ACYH 1DQXA 2V2WA 3ITOA 4HJSA 4DP7X 5CJMA 1SO6A 4NQDE 3DO7B 4DVBB 1BLIA 4DN3L 4ECLA 1AP2B 4AQLA 3AS1A 4JM2D 1HEJC 1ULVA 3GZOA 4QYOB 4YSEA 3MSPA 3I9PA 2V68A 3DFQA 4FF9A 1KM6A 3WMSA 3T0ED 3MNMA 4NC1E 1Q63A 2HLAB 3V0UA 4G9DB 2ZDSA 5GISL 3AM8C 4K1GA 4BFIA 3L7FA 2HG5B 4NQCE 5A8NA 1WAAA 3UF9A 3EA1A 1J2BA 4LCUB 1JZFA 1RJLA 1GVSA 4HT1H 4NKIH 4NUPA 2WLMA 3UROR 3IJSA 3CQIA 3N11A 1PZ3A 4YDJB 5J3HC 1BKSA 4GKTA 3S9ZA 2PU0A 1FV1B 4Q32A 3NQGA 6PTDA 4MXWL 1UP3A 2WMIB 1PKQE 5ACMA 3ME3A 3AROA 1G9NC 4F9LA 5I1DB 5D03A 2BSTB 3QM3A 5DI8B 2M1KA 4RGMB 3FQ2A 2X1UA 3O45A 3BAKA 1A4CA 4KVCH 3NP4A 4AYFA 3RK8A 1J5SA 5IBXC 5D7HA 2P3ZA 2ZRXA 2HCZX 1VFBB 3MUAA 3KVLA 1S7QA 1CPUA 4MMXA 1L3NA 3QA3B 3A6BL 1HEHC 4JNXA 3UWQA 3TA9A 3QWOA 4CCCA 2WLKA 1HQ4B 4BK5A 3NSXA 4K71B 4FALA 1ZJIA 2H32H 4XP1H 2O5YL 2QZQA 4KQ0A 3SGKC 5I1KH 4FF5A 2L3BA 5JW3H 3N9SA 1W72H 4F20A 3TBWA 3N1GC 3WFLA 3KLLA 4L1HA 2XJLA 1UWQA 1CTOA 2NSOA 1RY7B 3L4XA 4YO0B 1LMKA 3OA3A 1P7QA 2OZ3A 3CDGA 3D05A 4GMSL 3MP3A 2XWZA 3CD4A 3GHBH 4XVOA 4A39A 4OCSH 1F8TL 2EIDA 5CPSA 5BZWB 3HG2A 4X9BA 2NLJB 2XG5A 4R9HA 2IMMA 3ZHDA 1VR6A 3K8LA 2YAEA 4H8HA 3PN8A 3G5ZB 6REQA 4DN4H 1J6PA 1D5MA 4KMTH 4NFCA 1YNPA 4B0MB 1BAGA 2J6EA 2CO3A 1ZS8A 4IIZA 3SQOL 1CGWA 2DW5A 4YNGA 4IEFB 3VXSD 4MY1A 3UAJD 5JLZB 3BOXA 2NY5C 3U9UA 5L6YH 1HH9A 3DPBA 1EL3A 4XCFL 1IV8A 1TJ1A 1CEOA 3BRFA 3U82B 4JIQA 4KV5E 3EBHA 1BPLB 4H9VA 3T1FB 3MC0A 1YYMH 1BGGA 3VIPA 3E6HA 4RW3A 1TQBC 1NGPL 2A74C 2UUDK 1MEXH 1YPZA 1PCSA 1B0GB 1TJXA 2OWCA 5EU6A 5IESL 1NA8A 5TQ2H 3LY6A 2ZONA 3LDBC 2A3AA 4B9FA 4FQXD 3NUKA 2KQNA 1LEKA 3WN5A 4AWTA 4DN1A 4KDWA 4XAKE 4PMJA 1RSFA 3KHQA 3MO1A 4YXGA 1VCAA 4CILA 1I1FB 3HLAB 1PTDA 3RKDD 1NCCL 3L5MA 2PDUA 1ZY9A 3KPTA 3M07A 1U92A 1QTYT 5CGYC 1K4GA 1TENA 2VLRB 1G7PB 2ZCKL 3BLDA 4IQDA 5M95B 1H5YA 4AH2A 4MA8H 4KFMA 3V4UH 4JRYA 1HWGB 4L8BA 1M56B 4U5IA 3AZTA 3MX0B 3GMLA 2NX5E 3BAJA 1IQ8A 3W56A 1RA5A 1T7XA 3WF2A 3H42H 2DQWA 3GAYA 1E4LA 2CW6A 4OBTA 3QZMA 2X0VA 1IE7C 4NO3B 3PHAA 2WWNA 2OCCB 3UNDA 3W01A 1DUYB 4MHBA 3T2NH 4MXVF 4OIIL 1DXIA 3QV9A 2JIXD 1AOHA 1AZZC 4JFQB 4FXGC 3UBGA 3EOBB 2IO5A 2VMCA 5HDRA 4JHUA 5IIEA 4X83A 3BDXA 3U4BH 3HPLB 1L7IL 5FS5A 3WH9A 3PG2A 5DJ6B 4P2OD 3WNMA 3WDRA 1K6AA 4LARH 3HNSL 4G7VH 3PK7A 4HJIA 4PREB 4YHYB 3US9A 2IADB 4Y5YA 2ISDA 4GSRA 3LH2L 4HIJB 1KULA 4R7DB 5CJQH 5D7LB 3GKZA 5J6GA 3QAZB 2EQDA 1EFQA 3TASA 1O9WA 1MSSA 1BBDH 3BFOA 2PA6A 1W8GA 5I16A 3P0VH 3QSKB 2E9JA 1ZGLP 1SPDA 3M0XA 1U5HA 2F5BL 2ZXGA 2EKSB 3ANUA 4DWDA 3GYEA 1I8IA 4OAWB 4OJDH 2HTLC 2EEDA 5IKCA 4JQAA 1LF1A 2O30A 1UQSA 4RZCA 1HE8A 4PL1A 4PULA 2KDGA 2VISA 2B7DT 2WZIA 4X5PA 4ZENA 1XRSA 3IUIA 2DYPB 2PGFA 4NJJA 3NXLA 4XO5A 1U3ZA 3W6LA 1U3JA 5DURB 2OT0A 1IAII 2MQ3A 3D0LB 1CX9A 4L3ED 2OSXA 2AI0H 2CIIA 1KYUA 3CQKA 1GZGA 1E9ZB 3U57A 4S11A 4BQ5A 1R3LB 2C9RA 1W1B1 4XVUC 2VQ4A 4X5XB 3RTQD 3G0XA 2UZYA 4NUGL 4X9IA 3VSVA 3T3PB 1PDKB 5FOJA 1WUZA 1NDYA 4LVNB 1OF0A 3HRZC 3GK8L 3QQ3A 5IOBA 5GRWA 5B4MC 2LLLA 4O1AA 1D6VL 1P6CA 4A7TA 4KEZA 1GOOA 1NEZA