4UQAA

X-ray structure of glucuronoxylan-xylanohydrolase (xyn30a) from clostridium thermocellum
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
391
structure length
391
Chain Sequence
SHMASATINLSAEKQVIRGFGGMNHPVWISDLTPQQRDTAFGNGEGQLGFTILRIHVDENRNNWSKEVATARRAIELGAIVSASPWNPPSNMVETFTRNGVPNQKRLRYDKYGDYVQHLNDFVAYMKSNGVDLYAISVQNEPDYAHEWTWWTPQEMLRFMRDYAGQIRCRVMAPESFQYLKNMSDPILNDPQALANLDILGAHFYGTTVNNMPYPLFEQKGAGKELWMTEVYVPNSDSNSADRWPEALEVAHNMHNALVEGNFQAYVWWYIRRSYGPMKEDGTISKRGYMMAHYSKFVRPGYVRVDATKNPTYNVYLSACKNKKDNSVVAVVINKSTEAKTINISVPGTSIRKWERYVTTGSKNLRKESDINASGTTFQVTLEPQSVTTFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords CARBOHYDRATE BINDING FAMILY 6
publication title Conservation in the Mechanism of Glucuronoxylan Hydrolysis Revealed by the Structure of Glucuronoxylan Xylano-Hydrolase (Ctxyn30A) from Clostridium Thermocellum
pubmed doi rcsb
source organism Ruminiclostridium thermocellum
total genus 135
structure length 391
sequence length 391
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uqaA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uqaA02
1I1WA 3T09A 3HJEA 1MW1A 2F7QA 3L4XA 1PZ3A 1HWWA 1C8XA 4HMEA 5I79A 5D9OA 2D0GA 5A1AA 1V6XA 3L4ZA 4M80A 3QOMA 3W53A 1H09A 2YOCA 1DEDA 3WDQA 3FW6A 1XCWA 2GDVA 2YDRA 5BYWA 5CSYA 3VNYA 2YKKA 5GQBA 1CGWA 5C70A 3ECQA 2DT1A 1YHTA 3B9DA 1H41A 1MQPA 3D4YA 4OZOA 2DH3A 3U7VA 2PWHA 2DSUA 4J3XA 2EEXA 3ZQ9A 4PRWA 1CDGA 1WZAA 2XFRA 2DT0A 4EKJA 3A4AA 1DWHM 1W1YA 5AC4A 4JFUA 4JIEA 4P8WA 5I2UA 3A22A 2ZXAA 3ZM8A 4LYQA 3ARWA 2YFNA 4AD2A 3CHDA 4MNLA 5A8QA 1MXDA 1QNOA 1UUQA 2WVTA 5E09A 2XVGA 1JIBA 2EPMX 1H3GA 3KE0A 1J0HA 1C3FA 3QR3A 2VRKA 1V0NA 1V3JA 1RD6A 1GJWA 1JFXA 2YL9A 2ZWYA 2UY5A 5D8ZA 5JBFA 2J7DA 5HOSA 1G9HA 1UQYA 3SCQA 4UTFA 4JHZA 2D23A 1PIGA 3KL3A 5A8MA 3N18A 2EAEA 1O7AA 1HP4A 3VDCA 1XD1A 3K8MA 2D20A 1RPKA 3A3HA 4RL3A 4MJ2A 3SCPA 2F7PA 1QWNA 3EYPA 3CIVA 2XN1A 4MB1A 1NOFA 2YLAA 3AXIA 1Q6CA 4DM1A 1HJWA 1K9DA 3K8LA 4A3HA 2WZIA 4AD3A 3NJ3A 3OA5A 4XZBA 3FAWA 2WC4A 4F66A 4Z2KA 3AJ7A 4QCFA 3AIBA 3N04A 4AISA 1HJQA 1GVIA 2VT0A 4X0VA 3ZSTA 3TONA 2VO5A 5M3WA 4JAWA 1JNEA 1HTYA 4E2OA 1OWQA 3GDBA 3MMWA 1FH8A 5ABHA 1LJYA 3NSNA 3W6LA 4FLQA 2EJ1A 4CVWA 1ITCA 3MO4A 2VCAA 1JDDA 1SYTA 3WQ5A 3LPFA 1KWGA 3U5YA 1KB3A 3UG5A 1GVYA 2B31A 2DIJA 9CGTA 2XSAA 2VURA 1H0IA 1QI4A 4RE4A 1AQ0A 1TFVA 1WZMA 3GZAA 4JCLA 3LPOA 2PWGA 4V27A 3W25A 1RH9A 3L4UA 4PBGA 1E9LA 1W9BM 4PMQA 1S46A 2JFEX 1VFUA 4PMUA 1R85A 5ABGA 5M5DA 1PEZA 1JD9A 4JFTA 3VGGA 1J0IA 3VIFA 3POHA 1R75A 2XHYA 2WMIB 1B3XA 1JZ7A 3AFBA 3GXIA 3DX2A 3L4VA 3VGBA 2WMHA 1FFRA 3AIEA 4W7WA 3EDKA 4J3TA 1T0OA 2D3NA 3EJTA 3WSUA 2BY3A 2DSZA 3AYRA 2WMJA 4AZ5A 1QW9A 1UKOA 2JEQA 5BRPA 2YFOA 1X1NA 1UYQA 1W3LA 1HJSA 3KL0A 1H11A 1HP5A 1XH1A 1E1FA 4XZWA 3W82A 3BUIA 3TTSA 3BLKA 3WL0A 4DUXA 3GXMA 2V38A 3MUAA 3N13A 1R33A 2Y2WA 2VI0A 4NZFA 5JBEA 4U33A 3TOPA 6TAAA 3PZOA 4W85A 5F7UA 3ARYA 2Y5EA 2J4GA 2BV9A 3BMVA 2A3HA 5I78A 2XIBA 4HPHA 4AXNA 4NI3A 1E15A 1EDGA 4EAMA 1EHNA 1KWKA 3DHPA 2CITA 1D3CA 1VIWA 3ZSSA 1IZKA 3K4DA 3IANA 2OSWA 4D6IA 5HPCA 2YBUA 4PCTA 3PTQA 5BRQA 1VJSA 3SUTA 1VF8A 3VDHA 1ISYA 1JGIA 4P7QA 4UOQA 2A3BA 2J47A 1W32A 4L4OA 3SCUA 3WDJA 3BVXA 2W5FA 1HVXA 4JL1A 1VFOA 2CBJA 3T0AA 4XB3A 1XV8A 4AZIA 5IFTA 1UHVA 5HDRA 1DWAM 2WMIA 1D2KA 1CECA 3VIJA 2J7FA 4FF5A 3DDGA 2W66A 2OYLA 1QOXA 4NZJA 2J7CA 3OB8A 1E0VA 1TG7A 3F4VA 3VUPA 2CYGA 1BYDA 4AZCB 2OWXA 5EFDA 1J01A 1EDQA 3TV8A 5ECUA 1FOBA 3VGFA 3GNRA 2X2YA 4U2ZA 5EFFA 1HKMA 1W2PA 1E70M 1EOKA 4CGTA 1GONA 3VX0A 2F18A 2GJRA 1JNDA 4TX8A 5GNXA 3W81A 4GQQA 3AMKA 1E5JA 1EH9A 4TOQA 2GDUA 3BCDA 1BYAA 1G5AA 1I75A 2OWWA 2ZWZA 4FNUA 3CMGA 1E0XA 1UR4A 2PBOA 1KCLA 3VMPA 1CEOA 3KWXA 2ZIDA 5CLTA 1UG6A 2WLZA 3WDRA 1GJUA 3CZGA 1BVZA 2CNCA 3AZSA 2ZUUA 2CEQA 2XGBA 4EK7A 3ZJKA 3VSUA 1R34A 2F8QA 5C8BB 8A3HA 1KBBA 3WDHA 2E9BA 2WMGA 3AS3A 3M46A 3WUGA 1DHKA 2YL6A 1VFMA 4H8HA 2X8RA 3VIHA 3BLBA 1W9UA 3N1AA 4MNKA 3EJPA 1HT6A 3LXAA 2EABA 3WN6A 3RJYA 4HZ8A 1KGXA 3VMOA 3WQWA 2Y4SA 4C7GA 3CUJA 1KXQA 2PF0A 4TVCA 3SCNA 2PB1A 4NF7A 1HJUA 4CD7A 3ZJ8A 4GXPA 1J11A 4PUEA 2WCSA 1NWRA 2QF8A 2E9MA 4PMVA 3VINA 4PUDA 4FNRA 5I23A 1E6SM 4IPLA 1WZLA 2V3EA 1EDTA 3VMNA 1AMYA 2C0HA 3AMCA 2YL8A 1HXJA 4WJXA 3DYMA 2A3AA 2DDXA 1PX4A 1JDCA 4AZCA 1UH4A 4H2CA 2WXDM 3DHUA 1E5NA 4W7VA 2BHUA 1PZ2A 1OBAA 2ZXDA 3BUQA 5A2CA 1MWOA 3AIQA 1QHOA 1NQ6A 1BQCA 2YL5A 1LWJA 3M6DA 2FE0A 4UFKA 2F7RA 4D6GA 3OLIA 1OGSA 3BVVA 1V0MA 2PWDA 1UA3A 5DF0A 1J0JA 4XX6A 4JZ5A 2V3FA 3WD1A 1E4NA 3WH9A 5FL1A 1VRXA 4FNPA 4JKKA 3CBWA 5DFAA 2ZX6A 1EQCA 3N9KA 3GXPA 3W0KA 3DX4A 1HL9A 3WMBA 1C90A 3WMCA 1G1YA 5EBAA 2E40A 2V5DA 4E8DA 3VGHA 2AOSA 1US2A 4CD5A 3AI0A 3OLEA 4JKLA 4CUCA 5A8OA 2RGLA 4BCEA 4BQ5A 3UERA 1SR0A 3ARUA 1UQZA 2WLYA 4TX6A 4OOZA 1TVPA 2PWEA 3WNKA 1QI0A 1E56A 1ZL1A 1WCGA 3VSVA 5FOOA 1SMDA 2ZX9A 1UD8A 3VIOA 4J3UA 4B3LA 3BC9A 1JZ4A 2F1AA 3HG5A 4V28A 2BVDA 4KWUA 3TP4A 4M1RA 3VNZA 2Z1KA 1MQQA 1K9EA 4W8BA 4ATLA 1D7FA 3OGSA 1EHAA 1W9PA 3GNPA 3MKKA 2J8FA 2VQTA 1VB9A 4MTVA 1CGXA 2WSKA 2ZXQA 4TVDA 1V03A 1KXVA 1MFUA 4U2YA 4MPKA 4KGJA 3L2LA 5E6YA 3WY4A 1JAEA 2VQUA 1TQVA 3AHZA 3W29A 1EGZA 3W24A 2VZOA 1I1XA 1E55A 2G3JA 2CBUA 3T2PA 4LXFA 1JF6A 2F2HA 1VEPA 2QMJA 4IPNB 4HA1A 3UETA 1J9YA 3CUIA 5D8WA 3PN8A 3DX0A 2VX7A 2EQDA 2BVTA 2VZVA 1X6NA 3AS2A 3VD9A 3BAXA 1CNVA 3ZT5A 2DIEA 4H8VA 3OZOA 1PBGA 4UCFA 1GCYA 1DWIM 2OLHA 4LX4A 3FY1A 4BQ2A 1V02E 4D1IA 1EIBA 4CCCA 2JEPA 3WKZA 3ARQA 3S5ZA 2ZXBA 3WY1A 2G41A 3LXBA 1DWGM 2WCAA 3PZUA 1E3ZA 1JDAA 5I5RA 4AW7A 4GIAA 2OW6A 1WDPA 3TTOA 4WIWA 4AC1X 4W88A 3DX1A 4S3JA 3L2MA 2D73A 2J7GA 3SUWA 3CPUA 3VGEA 3MU7A 2NW0A 1QBBA 5A94A 1NP2A 2G3NA 4Q22A 4YHGA 1UR8A 3LPGA 2CIPA 4AY1A 1HNYA 3VIIA 3IAPA 2JE8A 1AQMA 3GH7A 4ZFMA 3WBAA 4AD5A 4AZBA 1GOMA 2BHYA 2OYKA 2BY1A 3PZVA 2ZX5A 4QLKA 1DWJM 1BTCA 4LQ1A 2C8NA 4AMCA 3WENA 1V3KA 5AC5A 5DMYA 5E70A 1BHGA 3U5UA 1SMAA 1UWTA 3CGTA 1TUXA 3NCOA 2YDQA 1UR2A 4P7OA 5I24A 4X9YA 1E6QM 1Q6FA 1KFWA 1ESWA 2XVNA 4UQDA 4M81A 3CZ8A 3KLKA 3SURA 1BF2A 4FNQA 4LPCA 2XN2A 1WKYA 1H1NA 3GBEA 2WSPA 2FHCA 3I3DA 5GNZA 2DSWA 1E3XA 3MI6A 4UQEA 1W9DM 2ESCA 3PZMA 1CPUA 4W86A 3AHXA 3NIYA 4P8XA 3MMUA 4BF7A 3WEOA 1KXTA 1OCQA 3NSXA 3GH4A 2F1BA 1B9ZA 3BAIA 1MW3A 3WBEA 4J3SA 3AMDA 3CUGA 1YQ2A 1EO7A 3PZIA 4MADA 1U33A 1FFQA 4S3KA 1C7SA 3UG3A 1UZ4A 1IT0A 2XTKA 3HU7A 2XYLA 4M24A 5E0CA 3HG2A 4AIUA 1H0GA 1ECEA 4M8UA 3OGVA 3MANA 2QPSA 2FYVA 1BYCA 2Q8XA 3TA9A 3AS0A 1TQSA 4JKMA 3DDFA 3ZR5A 1MXGA 1BFNA 2ZX8A 1UKSA 5FIPA 2YIHA 2FHFA 2J62A 2DH2A 1HXKA 5JUVA 1GQKA 3RM9A 2QLYA 4LYRA 1CXLA 3PZQA 3RILA 1TQUA 4R27A 4HTYA 4YPJA 1H2JA 4LGXA 4URIA 5C71A 2XVLA 1UH2A 5HBFA 2W91A 5IXEA 2IUZA 3WD0A 3CHEA 3MV11 5E0FA 2X05A 4ZENA 2CESA 4QCEA 3WNPA 2WZEA 1UR1A 1JYWA 3WELA 3LRLA 1J0YA 2CBIA 1TVNA 2Y8KA 1QI5A 1KGUA 3ARVA 1QHPA 3BCFA 1O7DC 1OM0A 1E4IA 1W3HA 2EADA 3AISA 1HIZA 5FCZA 2BNJA 3B9AA 3ZO9A 2O92A 4CU7A 4ZE5A 1P6WA 2HVMA 3SCSA 3M07A 3OBAA 2XWEA 4HP5A 5LA2A 3SCWA 1ZBKA 3RIKA 3VTRA 3GNOA 1E6RA 1GORA 3UESA 5CLWA 2AMGA 1OD0A 4B15A 3IJ8A 1XD0A 5CPSA 1ISZA 3CV5A 1JZ8A 2GJPA 2D0HA 1VENA 4FLOA 4W93A 1F4AA 5A8NA 3LRMA 1CIUA 4W5ZA 1G01A 4CU6A 3BAYA 2RGMA 4UZSA 4Q7NA 4W7UA 3SCTA 2YA2A 2D1ZA 3G6MA 2BHZA 1AQHA 2JIWA 3BVWA 2JALA 3ZT6A 3CO4A 4AWEA 1UWUA 5CJ5A 4F8XA 3PZTA 3AYSA 5FKYA 1LL6A 1GOQA 4HOWA 3IGUA 2D2OA 2YA1A 5ABFB 1FH7A 4JCMA 3DC0A 1PAMA 5A2BA 1XRVA 1JXJA 2CKSA 4NXSA 3WQ4A 2ZOXA 3CZLA 5I77A 1LL7A 1LQ0A 4D6HA 4FLSA 1R7AA 1CYGA 2JF7A 3AZRA 3WF4A 4DUVA 1R47A 4W87A 2A3EA 3KL5A 1VJZA 1B3VA 3WH5A 1HJXA 2VOTA 4U5KA 2YJQA 4CKQA 3MMDA 3BAJA 1ZJAA 4PMXA 3LXCA 1US3A 2VNCA 3A4WA 4JFSA 3A5VA 3K1DA 4CN6A 1HF6A 1UKTA 3BMWA 2DQXA 1KR1A 1GNXA 1E43A 1GOIA 1JG9A 5CZKA 3RM4A 3JUGA 2ZE0A 4UQ9A 1UASA 3K46A 7A3HA 5E1QA 1KQZA 5DEZA 2O9OA 1V3LA 3ARXA 3BVUA 3FXYA 2YA0A 5DO8A 5BCAA 4DO5A 1GOOA 2VR5A 1C93A 1JYVA 4H41A 3AQUA 4PTWA 3PHAA 1CXFA 1MYRA 2WYSA 2EPKX 4GO8A 2WHLA 1BG4A 4J27A 5CQ1A 5CXPA 4WLCA 1E6ZA 3AIRA 3WNOA 2VRQA 2OSXA 2XSBA 3L4YA 1EQPA 4UZUA 2Y24A 4NSBA 1XYFA 1UR0A 2WNWA 5A8PA 2WMKA 3VM7A 1OGBA 4AZGA 1Y7VA 2BY2A 1V08A 1OSEA 3T0DA 3BAWA 4UOZA 4HU0A 5IHRA 5LYRA 5DT5A 3WIJA 1V0LA 3RJXA 4GO9A 3BH4A 1KTBA 4ATWA 1Q6GA 4CN1A 2X2JA 1U2YA 1LG1A 1CWYA 4EANA 5JBDA 4B9ZA 3CLWA 2XFFA 4IISA 3VD4A 2VVSA 3D5HA 3LMYA 1W9VA 5KZ6A 4OIFA 4GKLA 5ABFA 3RDKA 1BGAA 3FHQA 3MV01 3EBVA 2D3LA 2OSYA 3ALGA 4QLLA 1BVNP 2YDSA 2AAAA 4AYSA 2CERA 3BSHA 1TE1A 2WAGA 3OIHA 4D6DA 3LX9A 1UWSA 4UQBA 4W8LA 4X0NA 5LA1A 2X2HA 3NUKA 3U57A 3BUBA 1UWRA 2VC9A 3VSTA 3HG3A 3ZR6A 3THDA 1UH3A 4UFHA 2E9LA 2DGAA 3AHTA 5A2AA 3WD3A 1JF5A 1ISVA 1CBGA 4OUEA 2D0FA 4DUWA 1U30A 4ACYA 1XH0A 1A47A 3II1A 5A6AA 2ZUTA 2WMFA 3VIMA 4MAZA 2EACA 5A95A 1AVAA 1UZ1A 3WD4A 1C8QA 1TA3B 3UEQA 3ARTA 4UFJA 6CGTA 5I3DA 1OD8A 2UWFA 1JI1A 2J78A 1CXIA 2WM0A 1B0IA 4AYGA 2VRJA 2WHJA 4CD6A 2WHKA 2V3GA 5M03A 5E6ZA 1M53A 1XSKA 4BZYA 1W91A 3VIKA 3PZ9A 3GXDA 3ARZA 4NZCA 4WSJA 3HN3A 8CGTA 4D6FA 3QHNA 1Q6EA 1CLVA 4QP0A 1ITXA 3UCQA 1ZBCA 4PMZA 5GNYA 2OYMA 1TQWA 3WMSA 1QHZA 3O6AA 1QVBA 3WUBA 4KMQA 4PMYA 4GZJA 1V6WA 3CZNA 4D1JA 1FP9A 5LA0A 2GFTA 3E1F1 5DT7A 2PWFA 4U3CA 2WC7A 1WP6A 1L8NA 1OB0A 3WH8A 1CXKA 3N17A 3N15A 3CZJA 2XUCA 1NWTA 2WKLA 1GQJA 3VD3A 5M17A 4Z2IA 3CH9A 3AROA 4AMXA 2E8ZA 1C8YA 2XN0A 4WKFA 1O6IA 5BXTA 3IJ9A 1WPCA 2WW5A 3J7HA 4NXKA 1GOKA 4AEEA 3NYDA 3HMCA 4HMDA 2G3MA 5GPRA 3WQVA 2GJXB 4WKHA 3CZEA 2E4TA 4ML4A 2G4FA 1FHLA 2CXGA 4TTGA 3AIVA 1ODUA 3BUPA 1NH6A 4J28A 3W37A 3OZPA 2WBGA 5BXPA 2VZTA 3OG2A 1XYZA 4TVUA 3ZT7A 2CETA 1TA3A 4E8CA 4DWSB 1HKJA 4HOZA 2WC3A 3GYCA 5I6SA 1K9FA 1ZU8A 3U7BA 3MS8A 1UD4A 4OOUA 1FA2A 5JIPA 4F9DA 1CXEA 3I3EA 3T2QA 3GH5A 3ZIZA 3A23A 3MUY1 3BSGA 4N42A 4XV0A 3H53A 2ZUMA 3M7SA 1CGVA 4TXEA 4ATDA 4PN2A 1E4LA 2PI6A 5D9NA 3VDBA 1JFHA 1HJVA 3B8SA 3AOFA 2CPUA 4Z2JA 4QFUA 3RMEA 1JYXA 3WY2A 5A6KA 4CU8A 5A6JA 1UKQA 1A3HA 5EMYA 1B90A 1E0WA 2BXYA 2DEPA 3A4XA 4TTUA 4AD1A 2VX6A 1J18A 1W1TA 5A6MA 2NT0A 5D9PA 1V3HA 7CGTA 3GBDA 3DX3A 4AIOA 3NDZA 1ZBWA 1CTNA 4H7VA 3VGDA 3MSGA 1CENA 1E4MM 1H49A 1W2VA 1UKPA 3SUUA 4AMWA 4AZ6A 1K6AA 3UR8A 1QBAA 3EJUA 2CKRA 3K4AA 3QOKA 2X1IA 3EDEA 2O9PA 3AXHA 3MUIA 2VUYA 4IM4A 1B2YA 3D4ZA 2GJXA 2EXOA 3D52A 4UFIA 1J12A 1MVYA 5CPTA 1XSJA 3ARPA 4NRSA 2E3ZA 2XG9A 3VM5A 4UFLA 3VD7A 1MQRA 2ZUWA 1FHDA 4FMVA 1VFFA 2BS9A 4M29A 3EJRA 4AD4A 1TZ7A 1TQTA 1M01A 1CZ1A 4C7DA 2VCBA 2X0YA 3EDFA 1B3WA 1QNQA 2OWCA 3WFZA 1W3JA 1Q6DA 1UOKA 1KGWA 3EDJA 4DWSA 1N82A 2E8YA 2WANA 2VR4A 4Z2LA 1TCMA 3KZSA 1LWHA 2UY3A 3PZNA 3W28A 2GUYA 2BFGA 3VVGA 1CGYA 3ALFA 1Q4NX 3WNNA 1R7OA 4W5UA 1BLIA 2WVVB 2EO7A 4A4AA 3O9NA 5I0DA 1J10A 1BSIA 5TD4A 1WZKA 3EMZA 3WUFA 5A6BA 4MB5A 3LRKA 1R46A 3POCA 3A24A 2QPUA 3BVTA 3FAXA 1LF1A 3GXNA 1V6YA 3AMLA 3SUVA 3T2OA 1E72M 3AICA 1XHGA 2FGZA 4Y7EA 4PSRA 1GQIA 1NP0A 1SZNA 3WEZA 3AHYA 3CUFA 4MDPA 1NARA 3SEPA 3GM8A 4UNIA 2DPEA 4U31A 1JAKA 3KLLA 5FD0A 2OW7A 4OJYA 1W1PA 4HZ7A 3S6TA 3WL1A 2VX5A 3AHVA 2GVYA 4GZEA 2F7OA 2IXVA 3CTTA 1E6PA 1WAWA 1JZ6A 1ZJBA 2BVYA 1R86A 3BUDA 4MNJA 4Z2GA 1G94A 1GHRA 3VILA 3H54A 4MDOA 4AZHA 1JXKA 1DP0A 4WF7A 2XFYA 1EXPA 2VJXA 2IGTA 1UD3A 2WB5A 3K8KA 2WZHA 4M56A 2ZICA 4DO4A 4CN4A 2W62A 2JF6A 2PBGA 2J74A 1XH2A 3A47A 5CPQA 2EBNA 3UG4A 4DWSD 3AIWA 3CMJA 1JYNA 1MW2A 3APGA 1FH9A 1J0ZA 4E4PA 1UR9A 3CHFA 3THCA 3W27A 2VTFA 3H55A 2VX4A 1QNPA 1LLOA 1UWQA 1KQYA 4NX0A 1OIFA 1QNRA 2IXUA 5A6BD 5D4YA 5CGMA 2FH6A 3SUSA 4CVUA 3WF2A 4QDMA 4K68A 1B3ZA 1UD6A 4ACZB 5A6SA 3QHMA 5BROA 3PBGA 4U5IA 1H4PA 1BAGA 1V3MA 4TUFA 1JI2A 4A3YA 2X0HA 4OBSA 5BWFA 4D6EA 1QI2A 3RPMA 4RE2A 3SCVA 2DT3A 4WK9A 3WFLA 3PZGA 4YHEA 4JHOA 4MJ4A 2WVVA 1CGTA 4AD0A 3WNMA 1KBKA 3BLPX 5IHSA 4FK9A 2V3DA 2J7HA 4QLJA 3VIPA 3ZJ7A 3W38A 2FDMA 4GQRA 3VX1A 2J79A 2WK2A 3N12A 2TAAA 3ARRA 4HPGA 2CHNA 2W4XA 1MFVA 4J7RA 4M82A 2WPGA 1PS3A 4HU8A 1DTUA 1OGGA 1SFSA 2VL4A 2NSXA 5ABEA 4P8VA 3WQ8A 1FP8A 2O9RA 3T08A 5A6LA 1B3YA 1V0KA 2VZUA 4MB3A 3TTQA 1UWIA 3A6OA 1E1EA 1ISWA 1CLXA 2YBTA 2QMKA 1LG2A 3WH7A 1OT1A 2GSJA 2FHBA 1PPIA 1GOWA 1W3KA 1W9XA 3OLGA 4P8UA 2E0PA 1KTCA 3EJQA 2FGLA 3F5LA 4P7RA 1JZ5A 5BXSA 5D9MA 1PJ9A 1F4HA 2ZUSA 2WVUA 2XPKA 1ISXA 4GINA 1QI3A 4BQ4A 1QW8A 2J25A 4AEFA 1VBRA 2W92A 3AIUA 2XM2A 5E9AA 4HOXA 4FNSA 1PX8A 2ALWA 3EJSA 1BPLB 1KXHA 1HL8A 4PMRA 1UD2A 3SIMA 2X2IA 2UY2A 1NOWA 1VBUA 1M04A 1M7XA 4ACZA 2F61A 4ZE4A 4V2XA 3T0BA 3WY3A 3W4RA 1JZ3A 3HG4A 1M03A 4W8AA 3AS1A 3BAKA 3S5YA 1WDRA 1QNSA 3SCOA 5A3HA 3BGAA 3RO8A 1MW0A 2J8GA 3IJ7A 2UY4A 2X09A 2W63A 1R8LA 1JL8A 7TAAA 4MB4A 4PEEA 1EO5A 1QWUA 5JIWA 3PTMA 2DT2A 4B9YA 2QHAA 3FHAA 2A3CA 4L4PA 1WDSA 4WKAA 5AYIA 4AIEA 1IZJA 2PC8A 4D6JA 3VDAA 1E6XM 3VU2A 3TTYA 1K9TA 4DWSC 3NSMA 1NOUA 4HA3A 1GUVA 4HZ6A 1GZJA 4GPNA 3RM8A 3L4TA 2JIEA 3PTKA 1ODZA 2CBVA 5IDIA 1R87A 4RE3A 3WEMA 5HXMA 2HISA 4IUGA 3WNLA 1X6LA 2G3IA 4KRTA 5BXRA 3L4WA 3AMGA 4HA4A 2C7FA 3KEHA 4FNTA 4HMCA 1C7TA 3WH6A 3VOCA 4PMDA 1EA9C 1W1VA 1NWSA 5CG0A 1OT2A 1E40A 4OKDA 3WF1A 2GK1B 3GXFA 4F79A 5IFPA 1HKKA 4DM2A 3ZMRA 2WHMA 1L0PA 3OLDA 3N11A 2VMFA 1WE5A 1UD5A 2FH8A 5HNNA 3FN9A 1WO2A 3WF3A 3F5JA 3QHOA 1GW1A 4ZEPA 3RCNA 1XSIA 5CGTA 1C92A 4P7NA 4Z2HA 1XCXA 1ZS2A 3A21A 1BYBA 4DO6A 3MSDA 1CXHA 2J75A 1VEOA 4ZXLA 4GI8A 3OGRA 2ZX7A 3B9EA 1GHSA 2XM1A 1V3IA 2XIIA 4P7LA 4JL2A 3MUZ1 4PTMA 1G0CA 3EMCA 1XC6A 2W61A 1KR0A 1JD7A 2WVSA 5AYBA 3WQ6A 1PIFA 1Z32X 1HVQA 3CZKA 1EOMA 4KGLA 3DECA 3LPPA 3ZOAA 1OINA 4H04A 2BY0A 3W26A 3BXWA 5FL0A 2D24A 1IV8A 3UR7A 2Y8VA 1VAHA 3F5KA 3G6LA 4JFWA 1E6NA 4NRRA 1KCKA 2WKGA 1B31A 4UR9A 2XVKA 4J3VA 3IAQA 3W6MA 2ZUVA 3O2LA 5CSUA 1B1YA 2J77A 3AXXA 1DWFM 2ZUNA 2YLLA 1B30A 1NWUA 2WWDA 4OBRA 3WDIA 4PTXA 3ZJ6A 5AY7A 2EPLX 3DYOA 1CGUA 4MAVA 4W84A 4EE9A 3VPLA 4PMNA 2GK1A 4WSKA 4PYSA 3VD5A 1OIMA 1BG9A 4U3AA 3FNDA 2EPNA 5A69A 3D3AA 3WF0A 1V02A 2V5CA 3AZTA 4KRUA 1LL4A 1E71M 1WDQA 1GQLA 3SCRA 2VVNA 4AZ7A 3D51A 4H8UA 3S2CA 1RP8A 4F9JA 1ZBVA 4QAWA 4BS0A 1NM9A 2O9TA 3CC1A 4CCDA 3VKKA 4OGZA 3QGVA 1QPKA 4PCSA 4D71A 4UOJA 5KEZA 1HN1A 2NT1A 2DSVA 4GZIA 2EPOA 4GI9A 4KH2A 4W89A 2XGIA 3WUEA 4J3WA 4FLRA 1V6VA 2CCRA 4PMOA 4B3KA 1TR1A 2XJ7A 4UFMA 3EMQA 2VZSA 3DYPA 4N0RA 4CD4A 1TMQA 2WBKA 1C91A 4GI6A 3GTNA 2VCCA 1V6UA 1HKIA 1BGGA 3VIGA 3IK2A 4B16A 4C7FA 4LYPA 1VEMA 2XWDA 2J7BA 2WCGA 1WNOA 1RP9A 1PX3A 2XVPA 4MNMA 6A3HA 3WDPP 4CCEA 2MANA 1ZB5A 3ARSA 3CHCA 1XGZA 4UQCA 4PTVA 1JZ2A 4D72A 4UQAA 4PSPA 2G8ZA 4XUYA 2W67A 4D6CA 4R5EA 1QX1A 1H5VA 2D22A 4CD8A 1UA7A 4JFVA 2BXZA 2J7EA 3CZSA 2Z1SA 1J0KA 2CHOA 3VO0A 2DSKA 2QV4A 3HZ3A 4BQ3A 1E73M 4ZXOA 1WB0A 1HX0A 5HPOA 3WD2A 3NDYA 4YN5A 3CUHA 3GXTA 4BA0A 3D50A 3I3BA 2WWCA 1GPFA 5EB8A 3EDDA
chains in the Genus database with same CATH superfamily
1OGPA 4XD6A 2IH9A 3UOAB 1A5FH 5HHPA 4C56D 2OZ0A 3LCYA 2GVLA 4DESA 2GPZA 3E9AA 4XMXA 2VLJB 3B97A 3MLWH 4X6FB 1ACYL 4M0XA 1O7DE 3D3VD 1BIIA 4XCCL 4U6YA 1H41A 4A7TA 4WR3A 5DBTA 1W1YA 4P8WA 3A22A 4JOMA 1DKWA 4XAFA 5K9JH 1U1HA 5JW3H 4NNXB 4BXSV 4HA0A 1D3HA 1ADOA 1I3GL 2GGJA 1J0HA 2Y06H 1MH5B 5I6XB 2HROA 2B15A 2XISA 5HI4C 3H2OA 5KVEH 2XZQH 2X1WL 4JHZA 3JV6A 1L6FA 4M7SA 4HWNA 3ZFHA 4L5FH 5EOTB 3A3HA 1T04A 4DGVH 4P3CL 1HG3A 3GLCA 3EYPA 4XNXH 1YNLH 2FZ3A 1NOFA 1QA9B 1TU2A 3W2JA 3KBSA 2H26B 5DRZB 1HJWA 3SBFA 4DKAA 5KG9A 2FUQA 3AJ7A 3JRKA 4M8QB 2DWEA 1GVIA 5C07E 4XRCA 3EGJA 3GT6A 2E6DA 3DUSB 5BV7C 4FLQA 3A0OA 3HQPA 4BI7A 1ITCA 4CVWA 3MO4A 5I1KH 4IK7A 4KI5F 1JRHH 4UQ2A 2R69A 3EF4A 3QIBD 3PNWB 3G6JE 2EDXA 4N5EC 1A4AA 3O2WL 4NSKA 2HMCA 1SJHA 4TUUA 3W0WD 3MV9A 1MJ8L 3MMTA 4PBGA 3AQYA 4H9ZA 1QFPA 4DEWA 4JFTA 5DJ2A 4XVDA 4NS0A 4DVRL 3LRSA 4P61A 3VIFA 1INQB 3VB8A 2CZDA 2WMIB 2ZCLH 1A9BA 5L2KA 1TV7A 1SUHA 1XLKA 3SHSA 4QAMB 3CSYA 2XWRA 2XV6B 4XTIA 5T91A 3SQRA 2CGRH 1BVKA 3UYIA 2DV0A 2YQBA 4HC1L 3PPEA 4HETA 5I00A 2VI0A 1FNFA 2BZCA 3CUPB 3QORD 1FY6A 3BOLA 1QOPA 4RZKA 2J4GA 1L3NA 2IAMA 3BMVA 1HKVA 5AL0A 5ACZB 3GINA 4YE4H 4IBZA 1RZKC 2K4AA 3O3DB 5HPCA 2OSWA 2FNBA 3R4RA 4XN8A 3UBXB 1WQVT 1QASA 1XLAA 4UOQA 4R7DA 1E2VA 4XAZA 3WDJA 1ZA3B 5I0XA 4ZB5A 5GRVL 3VKDA 3I6KB 2BG5A 4DK5A 3V6OA 2J4WL 2OLSA 2ZRXA 4GRWE 4NZJA 3QZNA 1N19A 4IKKA 1V7NL 2OKOA 4K7PL 1NCDH 4L3EA 4DPQA 2V5MA 4J35A 3O41A 5HHME 5LHDA 1E9PA 1J01A 3DXAA 1FVCA 4HIHB 4FA3A 4ZFFA 3PQYD 1X5JA 5E4EB 4CGTA 3ZKXC 3CFDB 1PO9A 2J8OA 2ED8A 1ZSHA 5DVLA 3UGVA 2F58H 3RKDC 1I75A 1HTIA 1UM4H 1MWAA 4Y9GA 1X5GA 1YY9C 2PTDA 3H4FA 1S78D 1IILE 4KFMA 4HHHA 5HGAB 1BVZA 4LSRL 2ZUUA 4XN1A 4EK7A 4NGHH 2IBZX 4UTCA 4TNGA 1OF0A 2EAWA 4DI9A 4RFEB 1VFMA 4F93B 3RJYA 5DD5L 1KBGH 4LUTB 1ASOA 1JCYA 3L65A 1KGXA 5CJXA 4WU7B 4V2CB 4HUUB 3SDXE 3B8YA 4LCWE 1AH3A 3ZJ8A 1QRNB 1OL0A 4BHUA 2E9MA 4KROC 1ZNNA 1E6SM 4U1JA 4ADTA 2CRIA 1AMYA 3AMCA 1N64L 1HXJA 2X16A 3I84A 1O5KA 4H2CA 1YEIL 4N9CA 3RGVC 3VXNB 3GR8A 3UZEA 3EO9H 1CFMA 2CDEB 4GJIA 1A3LL 2VGIA 1NAKH 1FQ0A 1M7IA 4YLQT 4HJIA 3VXSA 4EVNB 3O2VL 2EDWA 1FNSL 4B96A 3QQ1A 1QOKA 4PJ8C 3MUXA 3BP4A 5F0MB 2W95A 1CFSB 1T20B 4I7VA 4HT1L 3UYRH 5F3FA 1JPSH 3ZVIA 1RHHA 1NY1A 3F2DA 3FK4A 3WTUA 2O5NA 2K78A 3H4HA 4FQHB 2BVDA 3L23A 4JANA 3MR9A 1JNJA 2CBMA 3GSXB 1FL5B 3GNPA 2BIQA 4LARL 5GS2D 4JRYE 1LORA 3LU2A 5DRXA 3Q5TA 3BE1L 5ECGA 1WGOA 4YDMA 1I1XA 3LB0A 4OLWL 3C5JA 5B8CB 5JPMA 1ZTXH 1X1ZA 4ERSL 3U0PA 1IAII 3FN0H 3IFLH 3M0LA 3CUIA 1DN0B 3IF1B 1RVFH 5C0GB 5A3ID 2CCLA 5D2NB 4FMFA 3MUCA 5DWPA 2CJUH 4U1HA 3LHAA 5CR1A 4EKXA 5HYJA 5AEAA 3LNFA 2MOGA 3QDJD 3TT1L 1KFJA 5MF5A 5HHQB 2EKSB 1E3ZA 2Y62A 4XVSH 3TTOA 3MACH 1EK3A 4QTIH 1UZ8B 3QY6A 2QQNL 4FHJA 2J7GA 3GLEA 3KM2A 4PRPB 2X44D 2NW0A 2GY7B 2HLEB 2I9UA 3WLWD 2NQLA 1NBVH 5K9QG 4LUSA 3VIIA 2GTZA 4PJ5B 3TN3A 1HOCB 1A5AA 5DRWA 5FA5A 2QJJA 4QLKA 1ZJIA 1PD0A 1DWJM 3CBKB 4MA8H 1ZLWH 3ZDZE 3O0RH 1BTCA 2P5NA 4H88H 4ZDHA 4YTQA 1SMAA 4HHMA 1NL0H 1DN2A 3G6DH 2Z31B 2HP4A 1LO2H 4MMWA 1RJQA 3P4NA 4M81A 5IVNA 3PPCA 3B56A 4IUOA 1ZV2A 4US6A 3I3DA 1KFAL 1UT1A 3L3IB 3NIYA 3EOEA 3KBEA 4XCFH 1CF8L 3V52L 3FH7A 4OCYH 5E4OA 1W2KT 1VSCA 3NVQA 25C8H 2XYLA 5IJKA 2OQYA 3DX8B 4JY8A 5C6TH 2HJLB 3B3IA 2VXSH 3QKZA 3WO4B 2IXQA 3GTXA 1A9EB 5JUVA 3NFNA 4XBPA 1XISA 4PM1A 1LDPH 4J9JA 4U7SA 2D03L 3DUHA 1IQDB 1E1CA 1S7TA 2K70A 3V0AC 5FM4A 2X05A 3WNPA 4IJRA 1VESA 5KJ7E 5B7MA 4MXVF 4WEVX 5E94A 1QI5A 4R4FL 1OM0A 1Q94A 1TZ8A 2BNQA 2CMRH 1QLEB 1GTNA 2O5YH 3KGSA 4HP5A 4P2VA 4NBXB 5CEYA 1PY9A 2W0UA 4A7GF 3KJ6L 3W22A 1P84K 4G6MH 3UGUA 2DIBA 1EFXB 4JBSA 1R0AL 5CC7A 4K8RC 4MJ6B 1F4AA 3LRMA 1XR2A 3I10A 3C2YA 3C0QA 2AJVL 5KSAB 4HQVA 2J1KA 4XZLX 3WL9A 3IU3A 1KRCC 3QEUB 3GDRA 4Y5VC 3TCXA 3MA8A 4GP4B 3PZTA 4PB3A 4B5XA 3UWVA 1N8ZA 3IGUA 2MWCA 3BUYA 5I1CL 2WQXA 1XL9A 1NMBL 3NNTA 4NXSA 4GEJA 1IIIA 1Y07A 2WAQA 1G9NC 3KL5A 4GVIA 3MNDA 2PR9A 3HMWH 4U5KA 2J7LA 1ZJAA 3EOBB 5GRZA 2VDGA 4HZAA 1YEEL 4LAZA 1AC0A 3BIAX 3TEZA 2OQJA 4YNYB 4UQ9A 3UROR 4Q6IA 1QW7A 3RAOA 1KULA 1TZZA 3U4AA 3BEWB 1A4LA 4PULA 3PDOA 5C6PB 4S1DC 5CXPA 1EEQA 3VH8A 3N34A 4PTNA 3GRGA 1P43A 3CU1A 5C9ZA 4Z77B 2YX0A 2MOVA 5H8MA 5FJJA 4KZ0A 5C0AB 5IHRA 2FQIA 1BYOA 1OFEA 1PD6A 2UY7B 2PTZA 2FT7A 1KTBA 4CN1A 1TZIA 2X4SB 4NC2B 4B9ZA 4UYPA 3D5HA 4KUZL 4K37A 5AOKA 3A6CL 2E7LA 3AGWA 3AXLA 1Q9KB 4YBQD 2YDSA 5CFAA 2FYMA 3RZCC 4E9RA 4OV4A 4PQXA 4ALAL 3JT2A 1NCUA 1E5YA 3ZDYF 3V3WA 2RIKA 1W0YT 1XIWC 2HFEB 4OD1H 4ZMPA 2OR7A 3HG3A 3UIYA 4JYEA 2E9LA 1T83A 3ARDA 4MAUH 1HSBB 3WIFA 1H7NA 3QI9D 1WAAE 2X40A 3D85D 2LLLA 4Q97A 3P73A 2WMFA 5AQ0A 5C08E 4MAZA 2ISWA 4JFXB 3V0FA 5I3DA 2ZDSA 1OF6A 2UWFA 2IVFC 4OIIL 4HN4A 4JFFD 1S5TA 3PZ9A 1IEIA 1WHPA 3N43F 4CNNA 1S3TC 3AREC 4XCCH 4PMZA 1XYCA 3QQ9C 1QVBA 3PB2A 1ADDA 4NPYA 1XZWA 3RWJB 4K1GA 3FFDB 5FEBA 4N2DA 4WI5A 5T1KA 2DQEL 5IF0A 3Q8AA 1HKWA 1LYXA 1VS1A 3EPMA 1CGSL 5CCZA 1HH9A 3WJJC 1TFPA 3VJ6A 2G3MA 4GH1A 3QFJD 3T6XA 3L7EB 4N8UA 1ICTA 1ODUA 3FO9A 3M8OL 4J28A 5DQPA 5AECA 3VXMD 4BXVA 3AQXA 4G43A 1NF7A 1PQZA 5GS0L 5KZEA 2OXHB 1QFOA 3QR2A 4GQ0A 1YW1A 4HYWA 2WC3A 3U6RA 3A5FA 5EU5A 2Z4TA 1TFHA 4IBUA 4ILSA 5E95B 3MUY1 1T0MA 4IJ3B 4W1TA 4RZBA 4O1CA 1NCNA 4FALA 4OZGF 3WUZA 2WOYA 4PTTB 4QM1A 2BASA 2J1ZA 4UDUA 3DX3A 4AIOA 5D1XD 1YZZA 2DF3A 2X4RB 1M1XA 4GRLD 2ZOKB 2X1IA 3SSZA 2VLRE 1B2YA 4QGYA 2E09A 4UFIA 2NY0C 3NG3A 3NPWA 1MQRA 1GW6A 1EX1A 3MFFA 4DVRH 1SPDA 4J2MA 5SWZD 4AD4A 1TE6A 4HJ0C 2Y70A 1N82A 2DWYA 1UMLA 4X4XA 1PYFA 3VVGA 3HG1E 4C54A 2AQSA 2B0MA 4HC1H 3NEVA 3TU6A 4G2AA 5F1IA 2QPUA 1BXBA 5D72L 3K80A 2X5PA 1H6UA 3QQDB 2V7HA 1PNCA 5IROD 3CUFA 4DK3A 2CM6A 3COTA 1SDYA 2P8PA 5CJOL 4OJYA 5ESVA 2M83A 3OJMB 2IXVA 1FDJA 2ZTJA 5KBPA 3G0UA 4PIBA 5FGBC 2IGTA 3KPSE 3F4CA 4M56A 3VRJB 4M6PA 3QZPA 2X4UA 4DAGH 5CP3H 2JF6A 2BDQA 3ZO0A 2C6QA 4X9IA 4KTDL 3Q13A 1S2EA 1YNKL 1BQHG 3FBKA 5FJIA 4NRXA 1NDZA 3UTTD 2B7PA 3P3TA 4FXKC 5A6BD 2IXUA 2OZTA 3MV8B 1V7NH 3G5XA 1UJ3A 4K7PH 1IARB 5KYYA 1XINA 2PP7A 1H5BB 4DN4H 4JFYA 2RKXA 4LBAA 3QW4B 1YEWA 3TJPA 4PJ9A 5IHSA 1ZHLB 3EXJA 4HCIA 2F8OA 1NFBA 1OM9A 2CR3A 3G77A 4NQCA 2FTAA 3IMBA 5C2XA 3CDZB 5TDNA 3B7RL 3JZYA 1T3FA 4HPGA 4RNFA 4FL4C 4L4MA 3OR6A 5F7AA 1IAOB 3CZFB 4PP1C 2HMIC 3NGFA 3OAYK 4H8WC 2VZUA 1CYXA 4MB3A 5IKCA 3PFUA 1TTCA 3UTSB 1NEUA 5CG7A 1LG2A 4FHBD 1T1XA 3GJFB 1F4XH 5DD5H 1AHWC 3IE4A 2WQAA 1WDDA 4J4PD 3QFDA 2F74A 1ZVHA 1VPXA 3MYZA 4NO2B 3GAKA 3UPRA 3H2EA 2C26A 1YEHL 4JN1L 4XNDA 3QP3A 1EPXA 3SIMA 1XKJA 4G8EB 1LBLA 5FA3A 3OKYA 3TWBA 4TNWF 1N64H 4UIOA 4ZE4A 3W4RA 1MFBL 3M44A 1K4DA 4ABVA 4Q4MA 2EZ0C 4Y1SA 3V8OA 3B06A 1DQJB 2WXKA 3S9IA 4H0GA 4NJJA 4IXXA 2V5TA 3W74A 3CS2A 1W1ZA 4Y4KB 4RGNC 5IBXA 1EO5A 3QO1A 2JCCA 2DT2A 1FZOB 2QHAA 1F3JA 4ATTA 3ROOB 2NXHA 4OE7A 3QEQA 3F7QA 5HJXA 4AIEA 2I9TA 1FNSH 3M7FB 2XG5A 1B54A 3PWGA 4PGEB 2B7DT 1OAUL 3W1NA 2C9VA 4CDHA 1IEHA 1HCFX 4HWEH 4HT1H 2C9XA 5L2KE 5IDIA 1Q90A 2WLNA 1AK5A 5HGBB 3WH6A 3DHFA 2AXFA 4FCHA 5ESAB 2R8SH 1E40A 4NAJA 2FH8A 2WV3A 3EYSL 2ZOLB 3BE1H 3MDUA 3THUA 4OLWH 3L3GA 4FQLL 2R14A 3ZZLA 4NWTL 4ERSH 1PDYA 5BU6A 1VEOA 5HDWA 4B5NA 3D0CA 1UOZA 3S3GA 3OGRA 2DN7A 2ZX7A 1MJUL 2VDNL 5L4MA 2OG9A 3IDXL 1FL6B 1JD7A 5TK4A 2X88A 4U1NB 3TT1H 4QQUA 2VLLB 3T0EA 5GS0D 3WMLA 3IAQA 2I17A 2QVMA 2QQNH 1BP3B 4K3GA 5CSUA 3UYOD 3DXAE 1U3HC 2WWDA 2PP8A 2AXHA 3QUXA 1UUSA 4FQCL 3GI9H 5JXQA 4HNLA 2K4WA 2POTA 1YECL 2OZ4A 1D5IL 2QV5A 5IMLB 4PJIB 1BG9A 3FEMA 1NOAA 1J9TA 2RUSA 3WF0A 2CKBB 4XZ9A 3E80A 5C9JA 3U0WL 3PGDA 1IM3B 4N85A 4W9DC 4AZ7A 1ECYA 3ZE2E 4GLEA 4D2JA 3E0LA 3UIZA 4F3HA 4LSTH 5E6IB 1XQLA 4TNEA 3W1AA 3R0DA 3L95A 4G8GB 4MSWA 1KFAH 4LEOB 1T1YB 2ADGB 5F7YC 1TQBC 1CF8H 3V52H 5C0DB 1P6CA 2VXVH 3GGWB 1CW2A 2DZAA 1PZ5B 4GUCA 2MHAA 5M1TA 2DBJA 2YRZA 3LSOB 1RBAA 2VC7A 5CZTA 3WDPP 3NAVA 1ZB5A 5GRXG 4JNZA 4TTDC 2ICEA 2EO9A 1YYML 1I1AD 4NC1E 2WCPA 4FNLH 1NBZA 1R6WA 1UA7A 1FFPA 1R6VA 4PE8A 1ZT1B 1KCRH 4LVNC 3EIFA 3VXSE 5C7VA 5AOJA 4QKXB 2D03H 1PNDA 1M4KA 3L17A 5TE7L 1FRGL 3GVRA 1BZ9A 3MCLL 3T09A 5IEHB 5EBLB 1HWWA 4KEVA 4R4FH 5LAXB 5TK2A 2ABBA 2Y9RT 1QEXA 4C91A 2D0GA 3NZRA 1J05B 1DEDA 4NQSB 3PSWA 4QRBA 1F6PA 4E38A 5C70A 2CLVA 2BP0A 1BVLB 2DH3A 3I9PA 2PWHA 1CD1B 4MQXD 1R0AH 1EXGA 3OKEB 3N6YA 4EKJA 2QHRL 3MJWA 2AJVH 4KKQA 1K4CB 3EJZC 3RITA 2UV3A 3QJFA 4I4WB 3QA3A 1G7IA 4AH2A 5FECA 3T3PE 1EP3A 1E6JL 4DGUA 1LP9A 3WXWL 1H7WA 4Q6YA 2Y63A 2ADJA 2UY5A 3ALWA 1NMBH 3F83A 2J7DA 1A6AB 2DLHA 4I1NB 2Q3XA 2XDFA 3K8MA 4A3QA 4M6NL 1OGAB 1H3VA 1TJMA 4XAPA 4IOSD 4QTHB 5KUMA 4HK3J 2VFIA 2UWEF 4ZXBC 1YEEH 1W54A 3AXIA 4DM1A 3GBML 3K8LA 4WI6A 2J66A 4QCFA 3BH9A 3NN8A 1BD2A 4AEHL 4N90D 3UBXG 3D47A 1P0EA 4BH8B 2OOGA 1SHWA 3VXOB 1W8EA 3GMOB 3W6LA 1JE6A 4A2DA 4WDXA 3BPWA 1KRBC 1NLDH 2VCAA 1JDDA 3PAUA 1SYTA 2OQHA 2AQPA 3VCRA 4TU1A 2YCLA 3CHQA 3OHXB 4PG9A 9CGTA 4ZMVA 5EU9A 4ABUA 2BOFX 1M6JA 1I31A 3P0XA 5E6UB 5GZOA 4PMQA 5AC6A 5D7KD 5MERA 3S2NA 2R29A 4PU2A 5M5DA 4AITA 3PYCA 4M8VA 1EP2A 4ALAH 2VLJD 3RTQB 3Q05A 1X98A 4B27A 1TTPA 3STCA 4NRYB 3W85A 4W7WA 1ED3B 1Y8BA 3OYXA 1XG4A 2GYSA 3RPKA 1SFLA 5HD8C 2JEQA 3OZLA 3WMPA 3W2LA 3TCSA 5GXBB 3W82A 4HPYH 1IGMH 4AVKA 3G04A 4ZFZA 4O58H 3S35L 4ZB2A 5HINA 5EU3A 3V1HA 4EZMA 2VM9A 4E36A 2E76C 4OIIH 3QUYD 4KEMA 1JPMA 2XIBA 4QRRB 3M9YA 1E15A 1LNUB 2V17H 4WW2A 3O16A 3MGOB 1DL7L 4W4OA 1D3CA 1EEUA 3H6AA 4TNVK 1IXPA 4PCTA 2HCZX 4DX3A 1LBMA 2OB3A 3NA4A 3LHTA 1JSYA 2BBFA 3TUUA 1KB5L 1YEDA 1Q1JL 1EZVY 1PVNA 4R88A 1B0RB 2DQEH 1YN7A 4O0QA 4L6OA 1XV8A 3GHPA 2Z91B 4RSYA 1FWWA 1K7EA 3DDGA 1CGSH 5IIEB 2OYLA 5BJTA 4IEFA 2IGFL 1H62A 3GKWH 3NL2A 5HJ3B 4RGMB 1DE4B 1BYDA 3M8OH 4HIXL 3WJYA 1HSAA 1FOBA 3GNRA 2WQUA 4DBEA 2ZTBA 2RALA 3V0JA 1M3UA 1F0LA 2P3ZA 5GS0H 4QEHA 5B39A 1EUTA 1KB9J 1KLFB 2A3TA 4G7RB 2PBOA 3DVGB 3VMPA 2GTWA 1S3HA 4E4UA 3VWJC 3H9YA 4FXSA 5MEOA 1KIPA 2DJXA 1U58A 4EUPG 1HW6A 2X8RA 1KLYA 1AG1O 3E2HC 3OF6D 1OTTC 3PAZA 2WXMA 3FEQA 2DU2A 4IYKA 4N6RA 3FQRA 1ZVNA 3FJTA 3CMOL 4XXWC 3RX2A 4LAKA 5EEVA 3S98A 3UPBA 3RY6A 2NY5L 1H1YA 3HRZC 3F12A 4RX0A 3C75A 4N87A 1PZ2A 4PRHE 1LLWA 3PFRA 1MWOA 2NLJA 4GLRH 5F1OB 2J9ZA 4UBDD 1A3ZA 4GSDL 3QCTH 2I5QA 3BVVA 4AWJC 2PWDA 2BW5A 4JKPL 1FV1A 3N42F 4E2DA 4PEKA 4WHTA 5I16A 4RIRB 1EEYB 4JKKA 4V1DA 2XIOA 3S36H 3DX4A 1QLEL 1DQMH 4D8OA 5D72H 2Q8BL 1X44A 1VHNA 1NMAH 3UERA 2WLYA 2IOMA 2Y88A 1RK0A 1VCBC 3EA3A 3AT0A 2DZWA 5CJOH 4J3UA 3DTUB 4B3LA 1JXFA 3GHBH 3VNZA 1HYRC 1F11A 3F2BA 4M5YL 4MTVA 3UXLA 1S7SB 4MKNA 4DPCX 3FCPA 4I9JA 1SHMA 5J9PB 1U8MB 3GZQA 4MZ8A 4KDTC 1YNKH 1MZZA 2G3JA 4F1SA 3P82A 4PWJA 2GJ6A 3B6SA 1VEPA 3T7VA 1XO8A 2FEEL 3D46A 4DPPA 3QEZA 3CEUA 3M0ZA 3WLLA 4TVSa 2AJZB 4FFVD 5ECJE 3QDGB 3T2NL 5H37A 3IJYA 5C5YA 1JGMA 5DA4A 2TRHA 1FLRL 5J11B 4IMDA 3R06A 4YNGA 1OOWA 3WY1A 3KAAA 1ZFJA 3II2A 4Q8QA 1WDPA 1RA0A 2CK0L 1QRND 3DX1A 4NI8A 1QBLH 1ZE3H 4R6UA 3FF8A 3C2VA 3GSRA 3MRIA 3QARA 4X98B 1BVWA 2YEZA 1GOMA 2W9LA 1V5XA 2XXCB 1BMWA 3L4CA 2VN5A 1RZIB 4B9JA 5E51A 3OO2A 1YEHH 3ARGB 4JN1H 3U5UA 4QIUA 4GIPD 9PCYA 3BLFA 1OCZB 1FC1A 3TZNA 1KPUB 2NY4C 4HXAH 3OKOA 3V5DA 2FHCA 4AMKL 4PCKA 3OR7A 1PU0A 2DW6A 1WF5A 5ITFB 4NUWA 4YDLC 4HAGA 4YAQA 1DANT 3DTXB 4KETA 3F7VA 3M43A 3PBWA 5EZOL 1ONQA 5BOEA 3MANA 1UATA 3LHWA 3EZJB 1OAUH 3N2OA 3TLQA 1T21B 4ODUB 5JDJA 5LN8A 2R2HA 1ZP3A 4GW4B 1QFEA 4G5ZL 1CXLA 4WWOA 4Z0SA 5CZJA 4P2OA 1PZBA 1B6DA 4AXWB 2WZEA 4NENB 1UR1A 3LRLA 2Y25A 3MRHB 3EYSH 4LOEA 1W72H 2EINB 3NK4A 1RSCA 4DTGH 5HDBE 4H1LB 4FQLH 2PCPA 4Y88A 1FO0B 5AOZA 4NWTH 1I85C 4PRPD 5CLWA 3VFTB 4ZQTA 1WYIA 1MJUH 1OD0A 4DNMA 2VDNH 1DXEA 4PJ5D 4UM9A 2P5PA 5BS0A 4L1DA 2L4OA 4Y1AB 3QWNA 1VZHA 1S39A 4UZSA 3G6MA 4FAAB 3P2DA 5D6CA 4JDVA 3M1BA 4L1BA 1Z66A 3UZYA 1GOQA 4ZMGA 1AD0A 2J44A 4PY7B 2QNEA 1TZOA 5FW7A 3ETTA 2CKSA 3IARA 4ZQOA 3U30C 1LQ0A 2Z65C 1PF3A 2VR2A 4FQCH 4L3FA 1DVJA 3O6FA 1S4IA 1E5CA 4AV0A 1Q8MA 4W87A 4PG2A 1YECH 4YFEA 3I74A 3MMDA 1D5IH 5B7ZA 3SKOA 1O7SA 3BMWA 4M3PA 1GNXA 1RQBA 4MLSA 3JUGA 4A63A 4AJWA 5DEZA 2CXKA 3LS4L 3U0WH 3DETD 5FKPA 4HSAC 5FWQA 4Z8FL 1UXMA 4KRPB 4G7SB 1V51A 2G2PA 4GO8A 1OZUA 4PWHA 1BWWA 2CWNA 3ECWA 1T4WA 1Q9OA 2KS0A 2IH3A 5F4XA 1AOHA 1FH2A 1ZCCA 3TH6A 5T26A 2V7NB 4XNYH 4K23L 2VKWA 1U2YA 1HAWA 1ANUA 3BZJA 1Z6KA 1RU9L 4EANA 3H3PL 1NGQH 2OTUB 1HAUA 1L2UA 3WLNA 3HG0A 1HUVA 1E27B 2BNRB 5C9RA 1R3WA 2OFJA 2FX8H 4U4IA 4TSCH 2FFCA 2OFQA 1W3IA 4LPVA 4A2SA 1YYMH 3K0WA 1T4KB 4X0NA 1R9XA 3WIHL 3MJMA 3T8LA 5T3XE 3QEQE 1N5YL 3NRFA 5L6UA 5TQLA 1EFXD 4WQOA 3ZGIA 2IGLA 1D5MB 2H2SD 4IBSA 5TE7H 1OAYH 1FRGH 5TTRA 1C8VA 3M64A 3VABA 5KSAD 3OJGA 5AW7B 5HYSA 2OO0A 2WQWA 1R2SA 3K5XA 2WZAA 4JTFA 3DFSA 2NNFA 3LNDA 2C16A 1BX2B 3BG3A 2A3LA 3VXTB 4L8BB 2MQGA 1L7IL 3SBWC 5GNYA 3BVJA 4WUKL 4MNQA 3QXWA 5CS7A 3W86A 4XHJC 1AO7B 5G4EA 1EO8H 5GGTH 5H4ZA 3O6DA 3LEXA 4QOKA 2PWFA 1UJTA 3S36X 3DIVA 3AU0A 1DVSA 4NHUB 2WKLA 4KKCC 1JUBA 4JO2L 1KYFA 3WK3A 5E5UB 1HZLA 1XFPA 1QSEE 1O6IA 5BXTA 3IJ9A 2FIKB 1E6JH 2GJXB 1UM5L 2IADB 2WM1A 1T2XA 4Q4KA 3HNVL 3V5HB 1A5UA 3BQ5A 4DXVA 2QCNA 5ELIA 3KBHE 5K1VA 5I6KA 2QADD 4XG1A 1V54B 1DVFC 4Y16C 5C0AD 3QC3A 5DY3A 4NZ1A 3CN0A 5LNUA 1RK5A 3T0EE 3WBWA 4ICCX 3GBMH 2OMYA 3WI9A 1XW8A 1WAEA 1WT5A 2A77L 3X1EA 1SSDA 5JIIA 5F8RC 3U7WL 4AEHH 3PGCA 5DRCA 1HJVA 2DQMA 3AOFA 5IFHL 4TTUA 2GFBA 2BWIA 3LD8B 1G7HA 4WO4A 4P5MB 4HGWA 4OZIB 5KMYA 2FO8A 2C1GA 2CFFA 2ENPA 4BSVA 3QOKA 4HLEA 3D4ZA 3FDGA 3D52A 1VKFA 4BK5C 3ARPA 4FYTA 3M0HA 5ABZA 1IJ9A 3GWJA 1EZUA 2GJJA 4LCCC 4XAGA 3W1MA 4C7DA 3DIFB 3ONCA 2HBXA 1AIFB 2Z8SA 2P5EA 4GX9A 3CB3A 3FYIB 3EDJA 1TJXA 4JXCA 1YPZA 4EUPH 4X7SL 3LMZA 4R7NB 1U3JA 2BFGA 1TNMA 1WZKA 3WUFA 2H6OA 1CVSC 3TH2T 1P7BA 2YAPA 4EIBA 3S35H 1FWEC 3A24A 3RB5A 1LF1A 3AMLA 3XIMA 3LCHA 3WEZA 3MKCA 1DL7H 1QEWB 1M9SA 4LSDA 1U8KA 4HDIA 4WTQA 4W6XB 1R86A 4HBCL 5FYLE 3QW3A 3QFEA 2ED7A 2FEDD 1KB5H 1Q1JH 5KBNC 3QZWB 4NDMB 4QHRA 4FTVD 4JTQA 2Z6IA 2ZP0T 3UG4A 3Q3GA 2Z92A 5C0CA 5ISZA 3AIWA 3RUGB 2EDBA 2JTYA 1C5BL 3KPMB 4Z3TA 2IGFH 4K68A 4H0HB 4ZUTA 4DPRA 4KCTA 4HIXH 4C4BA 2D31A 1RZGB 4A8NA 5CBAB 1WAUA 3BLPX 4Y8EA 2I69A 3KDPB 1VP5A 2V63A 5IJVB 1TYGA 2WXNA 2FDMA 4LPYA 4D9QE 1FZMB 3Q9PA 1SO5A 2ESVE 1LP9E 3L9YA 3H4XA 4JM0A 1K8DB 4X6EA 1XBYA 2LU4A 4WHBA 3HQNA 4P5UA 4ELMB 1UOVA 3GNDA 3PXHA 4PJ7E 3BQUA 3KPRA 4M51A 4Z17A 4MJZA 4OTKA 5T1DL 4G6AD 1IX2A 5EBMB 3KR3L 4ISVA 2FGLA 5DJ6A 5TF1L 3CQJA 4XHQA 1KN2L 1HILA 2XM2A 3QSTA 4G5AA 1L0QA 4Y9EA 2HS8A 3L3OC 4YTUA 2MTAA 2NY5H 4R97C 4YYCA 3NIGF 4Y4HC 2PO6C 5JO5B 3WY3A 1FYTB 4I9WD 4G9FE 2A0LC 4LS0A 4R7VA 3GMPB 1NGPL 4GSDH 4JG9A 4P5TC 2O6PA 1A7RL 3CVBA 3NQCA 5E08L 5IGXL 4Z7VB 4PEEA 4C83A 3BKYL 3H2AA 3TX4A 3TN0A 5BUGA 1E2WA 2X1RA 1E6XM 3FPYA 3RVXC 3ULVE 3Q06A 3V0WL 4ZUWA 2AV7B 2NQ9A 2E47A 2JIEA 4QD2E 2Q8BH 2J8HA 4MJIA 1OP9A 2W8CA 3KDNA 2JJTA 1IC7L 4K2UL 1E6OL 3MV8D 4Q8PA 2ADFH 3PWLB 1TWIA 5FV2A 4PMDA 3VI3B 4Z78B 3BVNA 3LCGA 4H5SB 1QFWM 2OPCA 1MXSA 32C2B 1A4JB 3MLYH 4M5YH 5EU7E 4G82A 2WLIA 2NYYD 1OQOA 2EHHA 4GI4A 1AG6A 4WVXA 4AI7A 5AFAA 4G8IB 3KP0A 1WGVA 4G7QB 4PLKC 2DZSA 4LLYB 3LJ3A 1I3RB 2QVIA 4YIQA 5MENE 2EDRA 5CEZE 3UTSD 3T2NH 2F5AL 3EHBB 3F62A 1GZ1A 2HT2D 3FU0A 4O51B 1S9VB 2W61A 4GP5B 3CAQA 1PIFA 1WS7A 3MKVA 1FLRH 4BKTC 5BWAA 3ZOAA 3IJSA 4O16A 3IVKA 4ESKA 4X8XA 4HK0A 2CO1A 4DNHA 2FLBT 1Z9NA 2CK0H 3HOGA 2C4XA 3I6LE 3GQYA 3PWVB 4GG6B 3GFUA 1AKPA 1EC9A 2PF8A 1ILUA 1AH4A 1WUFA 2GVEA 1D5BB 1MFAL 3VXRA 5GRJL 2X6UA 4EE9A 1OWWA 5JHDA 2FVMA 4ZB0A 3IEBA 4MWFB 4PJDE 4NPJA 3CFNA 1NDWA 4Y4KD 1UZHA 1IYXA 1JPST 1P7TB 5JIMA 4GKTA 3M0JA 4H8UA 4KEZA 2GCYA 4FYRA 1FFOA 4LLDB 4AIZA 5HYFA 4I90A 5AYZA 2J73A 5KVDH 1TPXC 1HK6A 4PCSA 4AMKH 5DK0B 2XETA 3WTYA 4KH2A 4U1MA 5C0BB 3WUEA 4CNUA 5ID0A 4UUIA 1QR7A 2VZSA 1AC6A 1MQKL 1MI5B 1N59A 3QJXA 3FRPB 2NUYA 4AUUA 4AOFA 4JHBA 3NZQA 5EZOH 5LG6A 3L45A 3LKSA 1AGEA 2BOLA 2MANA 3G22A 5KSBB 3TO2B 4GSQA 5EN3A 5L4IA 4L8SC 4PTVA 3KCPB 3I9GH 2B4CC 2DVTA 3LV6A 3APTA 4U3XA 4G5ZH 2ICWA 2YMOA 5D9SA 1WB0A 4V1DE 4ZX3A 4FQQB 5HPOA 1U8HB 2LTQB 3OG4B 4F24A 2ZUQC 4MJ5B 2XXGA 1DLHB 3HUJB 1IEXA 2HG5A 4QCIB 1AYRA 1C8XA 1I7TA 2HH0L 3TYFB 4G56A 5I79A 3LV3B 2WW8A 1V6XA 3L4ZA 5D30A 1FKXA 2B7QA 4JTHA 3R11A 1HKLH 1TMCB 2ZF9A 1NBCA 3CN3A 2ITCB 4L05A 3MQIA 2AQ2A 1YHTA 4XO3A 5DMGC 4J3XA 3ZQ9A 3URNA 4J2QA 2Z4QB 3I4KA 1SF5A 3ZM8A 3KOZA 1FVDB 3SDDD 5J1AA 3F7YA 4AIBA 1MFNA 1IM3D 3RVWD 3OAZH 4LIQL 1XB6A 1U92B 4BQ9A 5E6ID 5JBFA 4PV9B 1IC4H 5HOSA 4MHHG 1YMMD 4LRNH 4G8GD 2C1IA 2P8MA 1IR2A 2JIXB 1HP4A 4X22A 4Q2ZA 1KO0A 2D20A 2PTTB 1X9LA 3KPPA 2XN1A 4WK2B 3WQOA 4MB1A 3W2DL 2VL5A 1AKJA 2P5WB 5K9CA 3BPNB 1CTMA 4KZDL 1P1ZB 3LS4H 2ZSWA 4JFOB 1AL7A 2BIOA 3KPLA 1VCGA 5HVGB 4JAWA 3S3PA 1JV5B 3ZRCC 1HTYA 3MMWA 4YSQA 1PY0A 2XN9B 3VQLA 4POZC 3N73A 4G1NA 4QHLB 5HY9A 1DYSA 1D7BA 4K23H 4X9SA 2J1XA 1ZK9A 1GVYA 4OVVA 2XSAA 3VXPB 1RU9H 1EXUB 4OJCA 5DURB 1E5UI 5EWIL 4PRID 4ABWA 1IAMA 3MYJA 4PJCB 4X5WA 4PFEA 1E9LA 2GLKA 4YHNB 3B1TA 1XH3B 5T1LB 3TZVC 3POHA 2RDTA 5DS8A 1EFZA 3QZAA 3WIHH 2YD5A 2APBA 3F84A 3KPQB 3D0LB 3MROB 2NPLX 4HPNA 5HWMA 3EFFB 3SGGA 2QSTA 5FB8B 4JN2B 1N5YH 3FS2A 4HH9B 4JZOA 1ONXA 2APVA 1KFBA 3KYMB 3BN9C 3MUAA 4GG8A 5DA0B 6TAAA 1SN2A 1QPXA 2GGIA 3QNFA 3K6IA 5SWSA 4FX7A 4FJZA 4ZFOB 3QJTB 2D4DA 2WZ5A 4AXNA 2Y5TB 3H26A 1OF2A 3UXDA 2B5IC 3R58A 4OR1A 4XVOA 4GAAA 1HHIB 2UZXA 1L7IH 3R7MA 4P2QB 4WUKH 2CDGA 3IJHA 2WQRA 2O61B 2FX7L 4R90L 4JO2H 1UG9A 3RRAA 3KXQA 3K30A 2VD9A 3EOYG 3QPQC 4YC2B 3BJSA 1UM5H 4LRTA 5T8IA 5BS0E 3V55A 2DMKA 3HNVH 3KM8A 1E4JA 1RK1B 3VGFA 5AVTB 1E70M 2J6EA 1GONA 2FZDA 2XU9A 1G5AA 2NNAA 4S2SB 1OAJA 3H12A 1UR4A 2WMPA 4QT5B 2GSGA 2WLZA 3NCBB 3CZGA 2WQDA 4U6HB 3GRWL 3QHFL 4JQAA 4GKSA 3U7WH 3WDHA 5CBEB 2C3VA 2AJXL 2YRLA 3RTQD 3VIHA 3MVSA 2IH1B 4MNKA 1TVLA 1ZWIB 1NJJA 2WB1A 2HKFL 4BKLA 1OFQA 4PGCB 4F0MA 8FABB 2RFGA 3MUGB 3SCMD 3MRMA 2E4FA 3MZTA 1ML1A 4PR5A 3VI2A 1AGFB 1T89C 1F6FB 4F7PB 3IDIA 3DYMA 2A73B 3ANUA 1NJ9A 3OU8A 5DS1A 1R9FA 5LN4A 4WFHD 4IQLA 2EGZA 3H9SB 1JDEA 1ACYH 3OVUB 3UA4A 1AQDA 2OS7A 5K1NA 1AANA 2Q86A 4ZMAT 3DV6B 5GS2H 1FTXA 4X7SH 1XF5B 4LOVA 3CBWA 4LVHB 4WV1B 5G5DA 1G1YA 2OMWA 4H2HA 1S2AA 2BLEA 1AQKL 4CSSA 1I3GH 1X5KA 4GPVA 3B7TA 4DFHA 1GYLA 1E9QB 1PVHA 3FIGA 1NU5A 1TO5A 4TSBL 2DQFA 3LS5L 3X1NA 1M56B 4HBCH 4GIEA 3OHMB 4AKPA 2XYBA 3SKMA 3GI8L 3LA4A 1V03A 4P3CH 1QDSA 3RBGA 3MRQB 5EIVA 5IB2B 3WN5B 1KJ2L 3PHQB 1T5WB 2GK0B 3MO1B 3HPAA 4HA1A 3G1DA 4MNQE 3ERXA 2VSCA 2VZVA 2ZBTA 5FO9B 4NQVB 4JR5A 4UXDA 1PBGA 2VELA 4DSYA 3AWGA 4D1IA 2VLKA 3CQFA 1KIRB 1FWXA 2OW6A 2EYTB 4KXBA 2V9UA 3O9WB 4Z7QB 3O2WH 4E9WA 2EIBA 1ME9A 1MJ8H 2GQHA 5F6HJ 1T5XB 1RAKA 4EZKA 2IPKA 3QISA 1MUJB 1HNYA 4Z0XA 3IAPA 3GH7A 1G6RA 3V6ZA 2WSRA 5T1DH 3Q2DA 4WZ9A 3PHOA 1S5NA 3QUZA 3KR3H 2AXGB 4H1LG 5BUPA 4L80A 5TF1H 1GRWA 4AMCA 1J8RA 3ELQA 1KN2H 2Y7FA 2Z2BA 4IMKC 3DFTA 3GK8L 4Z3IA 1CLKA 2PP3A 2CGZA 1F90L 5D1ZA 3LCIA 4KO5A 2BSTB 1ZVSA 4WGXA 3AU1B 1NGPH 3WQDA 5EUOB 1GMIA 1A7RH 5D71L 3WBEA 1U8NB 5D1QB 4B5TA 5E08H 4UTKA 3PZIA 3CFCL 1WYJA 3QJHB 3L5WA 1FZKA 1R1CA 4GFSA 1FWBC 3V0WH 3R10A 1W8NA 3A9IA 3ZXWA 4GZ7A 2BSSA 2C3WA 2F8IA 2J4WH 2DH2A 1HXKA 1IC7H 5FC9A 5EBWA 4K2UH 1TZHB 1E6OH 1HJCA 3I02A 4L4LA 4XGZA 3QDGD 2GIYA 5JDSB 4JHVA 4LP4A 4B4FA 4PJIF 3CHEA 4EWND 2XBTA 1XGTA 2PDHA 5IJCC 3B9AA 2HB0A 1QPNA 1P6WA 1R3RA 3QQ3B 1NCJA 4QHKJ 5GS1C 4A6YL 1SDDA 1ZDQA 4LSRH 4RA3A 5DC0A 3P9MB 4O14A 4B15A 2R91A 1T8XA 5DCEA 4XZUB 3F5WA 4OCSL 1MFCL 2QKFA 4R0LB 3L3HB 4L2LA 4Q7NA 4O18A 4FI7A 2JKWA 3RB7A 2Q76A 4GXVL 3UZQB 4JQVA 5D2LB 3ARGD 5CJ5A 1I1YB 2VC6A 3K2IA 4X7CC 3BYYA 1KT2B 3GBLA 1FSKC 2Q7AA 5DMLA 2GUOA 1A53A 1X7FA 1Y6MR 3VNLA 3FYOA 3NEXA 1MFAH 1KBIA 2JF7A 1CYGA 5D96C 2VDHA 1YEIH 5GRJH 5CZXD 2FYYB 4B7IA 2PUQT 2ZYSA 1AW2A 3CFEA 3T44A 5FKAB 4OCLC 1A3LH 3UL4A 5E1AB 2AK4D 3GHTA 2BSEA 1GOIA 1E43A 2AQNA 2XWTB 3MV9E 3HEIB 2O9OA 3O2VH 3ARXA 2YA0A 3TSMA 4O02B 4PTWA 3UQNA 3MJ9L 3PHAA 4I6KA 4QY8B 3UWZA 1JGDB 1UCBL 2CZNA 1XYFA 3Q6FA 3J8F7 4QLRA 5IB1B 4UC5A 1OADA 3C60C 5HPMB 5AZ1A 2G0LA 1QATA 3RWHA 5LWYL 3FTVA 1MQKH 1GTEA 2YKLL 2OL3A 3U1QA 1EEXA 3HAEA 2XFFA 2ZKXA 5AUMA 4LARH 5IR1B 1QAPA 2QDDA 4Z1BA 4GKLA 3FHQA 1IM9A 3MV01 4KTEL 3QCUL 4W8LA 4AUYA 3WLMA 4OZ4B 4RZ4A 3VUAA 2JB6B 4ZUUB 4CJ1A 4NNAA 2EIEA 2I27N 5F1NB 4N24A 2E86A 5JOFB 3MCG1 1TITA 4Y1AD 4XNUL 3DGCR 4MJIE 1HGWA 1S7WB 3V6OE 3SFWA 2GI7A 2HH0H 2FSDA 3SO5A 4DJEC 2F9BT 2VRJA 4RX4D 4YR6A 1ETJA 2O55A 4L3EE 1GOXA 4X3ZA 1QPPA 1JPHA 3U9IA 2R1KA 5BQ7A 5A2IH 1NCGA 3LTVA 4DLFA 1W5OA 3WMSA 3X11B 3GE7A 2X9XA 3DROA 4GVGA 4M1DL 1F3RB 3O6AA 5L7XL 4PMYA 3KPNB 4IIQC 5BZWB 1I9RL 5LA0A 2NUWA 4DUOA 1TV8A 4R2GD 3ZDXE 1DBBL 4NO5B 1FA4A 5AKRA 1XLFA 4AMXA 5AAPA 3INUL 2QDVA 1WPCA 4KRPD 4NXKA 1T7ZA 4O54A 4UTTA 1FWNA 4PGZA 3U36B 4XMPL 4LANA 4MPQA 5J8OA 3LKPA 3VXUA 3MV7A 1TJGL 3OXRB 1MCHA 2NX5A 4G83A 3ZT7A 4P4RA 4QHUB 2DUXA 3Q7JA 3SJVB 2ADIA 5IB5B 4DEPC 1TJ2A 4QHNA 4JMNA 4HK3N 5IMMA 4NHVA 4QSFA 2BNRD 3T2QA 2FT6A 3ZIZA 5ABAA 3HI1B 4ZQRA 5B38A 1SLVA 1PL9A 2XTJB 5JHDE 5BZAA 5E8PB 4Y19A 3QZWG 5J06A 4CU8A 3TA6A 1UKQA 5EMYA 1FWTA 5D8JL 4NKOB 3NEEA 5D09A 2H32H 3EPNA 5JHLA 4FXGA 1W2VA 3IDMB 3AW5A 4D8PA 2VR9A 4LUYA 2HT4D 4QYOB 1SMOA 2PTVA 3SB0A 2DJLA 3AT9A 1NCOA 3UEZA 2AVFA 2X41A 3RY4A 2VEMA 2VUNA 4U0RB 1KNOB 2JBMA 1LMKA 1TQTA 3WQFA 3KJ6H 1UOKA 4DWSA 4XSLA 3EYQD 3PZNA 5D2TA 3SPIA 1TPDA 1AO7D 1HFBA 1UIOA 4KHTL 4Z3EA 1UBSA 1YTDA 4K36A 1CMOA 4N0FB 1N3NB 3TGXA 2WQVA 1PB0A 4UMAA 1R3LA 2H9GB 2FGZA 4R34A 1NDMA 4XTRC 1DE6A 5I1CH 4NKQB 4XIMA 5FD0A 5LDUA 2WBWB 5ESQA 5HYJE 4ZO8A 3C52A 1E9YB 1DO5A 1FN4A 3RVTC 2WB5A 2WZHA 3QIWB 5D04C 4CSTA 4WHDA 2BNUA 1EJVC 4NJHA 4C55A 3PJLA 2FX7H 1MW2A 4R90H 3APGA 1ZGLA 3WQGA 5L0QC 4E5XA 1X5FA 3S6DA 1JR1A 4L0ZA 1N6UA 2NXZC 5IJBC 5DYFA 3M86A 3FO1B 4HUXA 5CJNA 4K7PX 3WJLA 4JMXA 2G5RA 1V3MA 1JI2A 2X0HA 1XBXA 5LG1A 3RPMA 4CDGC 4NB7A 4JHOA 2WVVA 3QYNA 2H6PA 3LTPA 1BREA 3VFNB 1RD5A 2QDGA 3TVMC 3I6GA 2G75B 1N8IA 4N68A 4E6MA 5MEQB 1HNGA 1XGPB 2CUMA 3N12A 2XGZA 4KUZH 4CMHB 2QW5A 3A6CH 2NSXA 3TYZA 3GRWH 3QHFH 5FR3A 4K7FB 1V0KA 2FJFA 3T8MA 1EF2A 1ZRUA 2VYOA 4N9GB 3QWRA 2AJXH 3PJTA 1N7ML 3H4WA 4LV9A 4YTTA 1PPIA 3N9RA 2HKFH 3TCTA 2OMNA 2JLPA 4KI1A 4KI5C 5F7EL 4JTRA 1YC8A 1PJ9A 2UX7A 3KYOA 2J88L 4AEFA 1J79A 2G96A 4I77L 1M7XA 4ONHB 4GMTL 3DI2B 1B4JL 2PXYA 4LOFA 2C1OA 3AB0B 5A3HA 5EEUA 3BOFA 1W8SA 1DPMA 2COVD 3HVNA 4LV4A 2WWMD 2B1AL 2IDCA 4UR8A 3ZYJA 1ERNA 4XP6L 4F33A 2A3CA 3ECBA 5CGQA 3VDAA 4CC0A 2APXA 3FQXB 3BIKB 2BNQE 2BOBA 4IIZA 1JV2B 1KUMA 3TC7A 4NASA 5EEWA 4ZA0A 5DD1L 2A6LA 3NQAA 5KSVA 2KQMA 4EAYA 4REQA 3VKCA 3AMGA 2C7FA 3X17A 3PU7A 4TSBH 4R9HA 5CAHA 3H2QA 2IMNA 4NFCA 1W1VA 2Z7KA 4YHIA 1OK4A 3R7RA 1IC5L 4FAMA 3MHFA 2IPFA 1DHPA 1OKEA 2V9TA 1T5AA 3OLDA 4RCXA 1UD5A 4L56A 3REWB 3FB8B 1GW1A 4ZEPA 1VGKB 4ZFCA 4UMCA 1XSIA 3N19B 1UVQA 4CGUB 2HSIA 1KJ2H 3OKLB 3PP7A 4XNZB 2R1WA 4S1QL 1VFBA 1GHSA 1TIUA 2B39A 1U8CB 3W9EA 3TA3C 1SSGA 5FO8B 1G0CA 3J07A 1XC6A 2ISFA 3RWGB 1MCWM 1JGEB 2W80C 4KGLA 4OFIA 4Q74A 5K93A 3DECA 1UZ6F 3LPPA 5DEJA 5LNDA 4B2DA 2YUVA 5GS3A 3LY6A 2E59A 4JFWA 2WKGA 2HPMA 3W6MA 3QIUB 1IFHL 2E5CA 5CN1A 2J27A 3PUCA 2J77A 2W0KA 3AXXA 1DQWA 1ZEAL 2X1OA 4LO9A 3E8UL 2ZFAA 1FYTD 1LDSA 1TO4A 1NVMA 4KKBD 5GGRB 5H91A 4N22A 1VCFA 1IAKB 4MMXB 4EDWL 4XCNB 2V5CA 2TMDA 3UAJD 3RL2B 1WDQA 1YXYA 4JTKA 2NV2A 1ZLVH 3TNNB 3GK8H 4O2CB 3FUEA 4YSAA 1GHFL 3FC8A 4HJ1A 2Y6SD 3X3FL 4JFDB 2YN5A 4EJ1C 1ZCRA 2EEAA 2CCRA 4TQIA 1TR1A 5D71H 3DX7B 3DYPA 4C65A 1J9RA 5KBLA 2J55A 1E4WL 3CFCH 1V6UA 2DKUA 3BW9B 2J7BA 1RP9A 1EAOA 5C8JB 5FF2A 3BLLA 2ZKWA 1SU5A 2ARJB 4KTDH 3QAZB 4UT7L 3CMFA 1M7DB 4Y8FA 1QX1A 4AQAB 1ETA1 4BE5A 1C08B 5EZJB 1YBQB 1JHTB 3I7QA 3VO0A 3SGEI 5DHMC 3ARFC 1RQHA 2WLLA 3EHBD 3MSPA 4DH2A 1HX0A 3T8XA 2VERA 4QMEA 1BMZA 2W1NA 2QVFB 4QRTA 4JJ5A 2YUWA 2YPVA 3MBEC 4PVNA 4A6YH 2D3JA 1R9YA 3ELAT 3OA3A 4TSAL 3U7VA 1UXWB 4DJDD 3A4FA 2P4AB 2WNXA 4OCSH 1MFCH 2WTRA 4LYQA 3KTXA 2KZHA 2VISA 3CE1A 1UUQA 4GXVH 3VQ2C 5H94B 3OVGA 3QC0A 2Q7YB 1V0NA 1RLBA 3TNMA 4LHUA 2WJFA 1GJWA 2YL9A 3W23A 4RFNB 3RWIA 5KS9B 3BLOA 3DMMC 3SCQA 3VNKA 1ZV9A 1MFBH 2VLKE 1W37A 3U46A 1IAIM 4UTMA 2VENA 5C0BD 1MCKA 3NH7L 4TQ8A 4Z3GA 5ANMA 3L1OL 4LB4A 3RE0A 5LBSA 3CIVA 4AAJA 3D08A 2EXWD 3K72A 1Q6CA 1OY0A 4IU2A 1Z5LB 4YWIA 4NKIL 3ZQWA 3GYRA 4XWUA 2OTPA 2DWTA 2R2BB 3NQDA 1L6ZA 5J1SC 2RHGA 5IV2A 4JPQA 3C6SA 1UCBH 3TYGL 1JNEA 2P24A 5FK9A 5G2HA 3TBCA 1O75A 2ATPA 4D8AA 4HIJA 2YQ3A 4MZ1A 1B0GA 1KB3A 2EE0A 3IWVA 4P9HL 5LWYH 1U8IA 5AKSA 4RE4A 3IM1A 4HH8A 4LGSB 4AQ1A 3SQOL 4V27A 2DQCL 4IBVA 3TNOA 3GFXA 4BHUI 3LKQB 2HRGA 4KTEH 4IS6A 5DFTA 3QCUH 2XKNA 3NJFA 1NGYA 4OKVA 3DX2A 2WMHA 4IT1A 4KKPA 1IT9L 2A74C 1XGEA 2C5DC 5EC2A 2MKLC 1W3LA 1K5NB 4G11A 3S9ZA 3AU2A 3IDXH 5G4WA 1E1FA 4YOKA 1JJKA 4XNUH 5FSDC 3GXMA 3N06B 1R33A 1F07A 4LJ3A 5JPNA 1EC8A 3TOPA 1S5WA 4FHAA 2Z31D 4NUJB 4WFEE 3DOPA 2OKTA 1EHNA 3O6ML 5EIIB 4C6OA 3OJ2C 2DYSB 4LCSA 3K4DA 2XICA 2BK8A 3H85A 1WEJL 4F2MB 1VJSA 4OZHA 43C9A 1P9MC 3VDHA 3CLFL 1ZLSL 4JTDA 4M1DH 5L7XH 5F44A 4ZMTA 4NQCE 4OZIF 2W9MA 3VFRA 1I9RH 5TQ2L 2NDGA 4CEUC 2P5WD 3E3QC 3ZK0A 1DBBH 3BP5A 1LD9B 3EG9A 1L9WA 4YGAB 3INUH 4PFMA 3GAYA 3SKUD 3D2TA 1QOXA 2ZKMX 2J7CA 3HB3C 4KY2A 5F89A 1GC1L 2UX6A 2CYGA 4XMPH 3TV8A 2XC8A 2XN9D 1B57A 3KFTA 3T81A 3BLEA 4DP6X 3ABMB 3OAUL 1MCLA 1E2ZA 4U1SB 3NQBA 3X13A 3PFMA 3EB3A 4YPGA 4LL4A 2VJ0A 3WDRA 1KTLB 3HTWA 1CZ8L 4C4KT 2OTWA 4XBGB 1IBGL 4ZBJA 2WPBA 2WINB 1DHKA 2BP1A 4WUUA 2CW6A 2JCCE 4C7GA 2FJSA 1TJ1A 2J8UA 2Z0BA 4F0LA 4IIFA 4PJAA 4TVCA 1OF8A 4E0RB 1NOLA 5T3ZD 4PJFB 4M6VA 5IK3A 4ZPVA 3OX8A 4R84A 3FCBA 3MCLH 1PKMA 4GK8A 5BZDB 1GY2A 5HMDA 3RUGF 3SDAB 5AHFA 1PX4A 2OJZL 2LABA 5EMUA 2JGQA 3UA3A 4GY1A 3J27A 3RFZC 1RCQA 4ZAKB 3W1ZA 4LUIA 3CWHA 4P2QD 5ETUB 3PNRB 3WH9A 1MCBA 3PJSB 1BJ1J 5FGCE 4KHTH 4FULA 2QHRH 4D0CB 3IDYB 1LO3L 1MNSA 1TCRA 4CD5A 3WTVA 4E42B 5AW5B 4NILA 4ETQB 4X0KB 1HHHA 2I7GA 4ELMF 4FXRA 4ZSTA 3W3OA 1QAWA 4ZT1A 2C3GA 2ZX9A 3WXWH 3LLFA 4YK4B 4JQXC 2HN7A 4GUHA 1DDHA 1O95A 4W8BA 5DGRA 3WLTA 4M6NH 4U2YA 2H3BA 1TQVA 1RY7B 4CKVX 3UWWA 4PUJA 2G3XA 2QVTA 1S78C 2F2HA 2P7TB 1KM4A 3G6AB 1RH8A 5TFSL 1HXMA 2OTDA 3MRRA 4LLVB 5JORA 4JDZA 3APFA 3QNZA 3I75B 3SY1A 4IKLA 1WUEA 1MCDA 2YHGA 3B5TA 2LR4A 3T8QA 1MG3C 2PTUA 1D2OA 4Z7VF 2TODA 4TS6A 5I8EA 2PDJA 4O02L 4IKJA 2W07A 1GEQA 4MMZA 4ZMWA 1YE6A 4FXTA 2R23A 4WFFD 4Y6GA 1CLZL 3P4OA 5IEKB 5AW2B 4J39A 4MSSA 3QNYB 2G3NA 4IIHA 1L5GB 1UR8A 3MV7E 4F7MB 3ULUL 4RISL 1R9ZA 2WNQA 1I1CA 4WWKB 1N7MH 2EDKA 1RK6A 1E8XA 4PCPA 3H9SD 3VI3F 4RMQA 1I53A 2F9RA 4XVJL 3UBGA 5DZNA 5CC5A 1A8ZA 5DMYA 2J88H 3EKZA 1X9QA 2COQA 4MXQC 4KIEA 4FNQA 5EH1A 1FHVA 4GMTH 5F9JB 1MVFA 2XIMA 1B4JH 3P5ZA 2X1TA 2D8KA 3HHSA 4QRSB 5IHWA 4RESB 4JZJB 4XAKD 2B1AH 4WXZA 5EO0A 3TTEA 3TASA 3S8FB 2I5YL 4BV1A 4XP6H 3VSQA 3LOTA 3FH5A 1RXLA 3RX3A 1J9SA 2HLFD 4GG6F 4YDJB 1Z7AA 1KEGL 4B41A 4B95C 1U21A 1TV2A 3KVKA 5A3IC 4JG5A 5E2VL 4XTDA 4XPFL 1SUXA 4IL2A 2AJ3A 2IUZA 1IC5H 3TYUA 3WD0A 5J3HC 4ZENA 1NELA 2CKBL 3C5QA 5H2ZA 4AGPA 4F37K 2MSPA 4EPEC 1OVDA 3AISA 4K94L