4UQAA

X-ray structure of glucuronoxylan-xylanohydrolase (xyn30a) from clostridium thermocellum
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
391
structure length
391
Chain Sequence
SHMASATINLSAEKQVIRGFGGMNHPVWISDLTPQQRDTAFGNGEGQLGFTILRIHVDENRNNWSKEVATARRAIELGAIVSASPWNPPSNMVETFTRNGVPNQKRLRYDKYGDYVQHLNDFVAYMKSNGVDLYAISVQNEPDYAHEWTWWTPQEMLRFMRDYAGQIRCRVMAPESFQYLKNMSDPILNDPQALANLDILGAHFYGTTVNNMPYPLFEQKGAGKELWMTEVYVPNSDSNSADRWPEALEVAHNMHNALVEGNFQAYVWWYIRRSYGPMKEDGTISKRGYMMAHYSKFVRPGYVRVDATKNPTYNVYLSACKNKKDNSVVAVVINKSTEAKTINISVPGTSIRKWERYVTTGSKNLRKESDINASGTTFQVTLEPQSVTTFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conservation in the Mechanism of Glucuronoxylan Hydrolysis Revealed by the Structure of Glucuronoxylan Xylano-Hydrolase (Ctxyn30A) from Clostridium Thermocellum
pubmed doi rcsb
source organism Ruminiclostridium thermocellum
molecule tags Hydrolase
molecule keywords CARBOHYDRATE BINDING FAMILY 6
total genus 135
structure length 391
sequence length 391
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uqaA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uqaA02
1UA7A 1HXJA 5CLTA 3RPMA 1KXHA 3I3EA 3B9EA 4UQBA 3VIJA 3VSUA 3BVWA 4PMDA 1HL8A 1XHGA 3WBEA 5BXRA 4HOXA 3WNLA 5I79A 5DF0A 1ZL1A 3CUJA 1WZAA 2WVVB 2PWFA 1KGXA 3THCA 2JF7A 3EJQA 2VMFA 2EXOA 4MADA 4TTGA 3EDDA 1WCGA 1C8QA 1CXLA 4S3KA 4NX0A 2XIIA 4ATWA 4W84A 4FK9A 2PWGA 4PEEA 2WMFA 3AISA 3KL3A 5I23A 1Q6GA 4GPNA 3N9KA 1GQIA 2PI6A 4TOQA 5BXPA 1KBKA 4AYSA 2J62A 1PX4A 2J7BA 2YA1A 4B9ZA 3AS1A 3CHFA 4PSPA 5DO8A 2DIEA 2J78A 2W5FA 1JZ8A 4PCSA 1V3HA 2J47A 4PTMA 2EO7A 1OINA 3WY3A 4UOQA 1EHNA 1W2VA 1E15A 1F4HA 3ZJ6A 2VQUA 1UR9A 3AIRA 3EMZA 5E6ZA 3L4WA 4PTWA 2F18A 3WQ4A 2GFTA 1X6LA 1CGWA 3BSHA 3WNPA 2VI0A 4F79A 3MUIA 4ATLA 2DEPA 1GOMA 1JZ7A 2JALA 5HPCA 5AC4A 2PB1A 3I3DA 1BVNP 2XG9A 2F1BA 1XD0A 4V27A 1CGUA 2Y5EA 5ABFB 1J0YA 3WD3A 1P6WA 1W32A 4AZCB 3W24A 4UZUA 1EIBA 3WY4A 1ESWA 1J0HA 2EPKX 1UR0A 3GYCA 1BYDA 3WF0A 3KLKA 2CIPA 2IUZA 1FFRA 2WHKA 3LX9A 2OWCA 3BMVA 2YDRA 3GZAA 2V5CA 2WYSA 4JHZA 3D52A 1NWRA 1QHPA 1TFVA 3WNNA 1FA2A 1RH9A 4PMVA 2XWDA 3A3HA 4U31A 2A3CA 1CPUA 2VQTA 3SCWA 3CUFA 1OCQA 5ECUA 5M17A 1IT0A 5M3WA 5ABHA 1MQRA 3D4YA 2BNJA 3O2LA 2E4TA 3OLGA 4LXFA 2VZTA 1A47A 3UR7A 2GJPA 2CBIA 2EQDA 3MKKA 4AYGA 2W61A 1CYGA 1E73M 2QLYA 4P7NA 1E40A 4P7LA 4H7VA 2WMGA 5GNZA 3U57A 1W9PA 2D23A 3PZQA 2WK2A 2O92A 1W3LA 2WNWA 3SUSA 3MMUA 2VX7A 1R33A 4J3TA 3RM9A 1HF6A 1PIFA 3I3BA 1Z32X 3RJYA 3CZJA 3W0KA 3DECA 5CGMA 3FAXA 3A24A 2J25A 3WDHA 2VCCA 3ZQ9A 4W7UA 2CBJA 1CZ1A 3ZT6A 2X09A 2GUYA 5DT5A 2CBVA 3GXIA 4CU6A 3GXDA 5D9OA 4B3LA 1BGGA 3QOKA 4F9JA 1BPLB 1PIGA 3MI6A 5BRQA 2C8NA 1I1WA 2V38A 5FKYA 1JD7A 1LL4A 4JKMA 4KRTA 5GNYA 1PS3A 1KWKA 1EXPA 2J8FA 4DO4A 3WUEA 4F9DA 1XYFA 3NSMA 1WNOA 6A3HA 1EHAA 2WCSA 2X05A 1ZJAA 2E9MA 4D1JA 3GNRA 3VDAA 1PZ2A 4MB3A 1JYVA 3SCSA 4QLKA 1U30A 3VILA 1MQPA 3BAXA 4AXNA 2RGLA 3K1DA 3AIEA 3VNYA 1E6NA 4MNJA 2W66A 4KWUA 2Z1KA 4J28A 1V0KA 2G3JA 4ML4A 1VFOA 5CQ1A 3CMJA 4PMZA 4NRSA 4L4PA 4OZOA 5JIPA 1Q6FA 2ZIDA 3N15A 2YA2A 4ZE4A 4NZJA 2NW0A 2JEQA 3WUBA 3N12A 4YHEA 3EDEA 5E6YA 1X6NA 1RP9A 4E2OA 3CV5A 3SCUA 5CSYA 5A6KA 1MW2A 3D51A 3EJPA 3OLDA 1EA9C 2BXZA 3BCDA 3T2PA 2W4XA 3WF4A 1JAEA 2ZXDA 1OGBA 4PUDA 3BAIA 4HZ7A 4DWSB 1GOIA 1T0OA 4W5UA 4AZIA 4P8XA 4YHGA 1BGAA 3IAPA 3LPOA 1WB0A 2WLYA 3DDGA 3UERA 4D6DA 3UCQA 1HKJA 1G5AA 1UR8A 4JZ5A 4WKHA 5I24A 1GPFA 1QHOA 2G3NA 2GK1A 1JXKA 4B3KA 1KR1A 3MU7A 4QCEA 3WDQA 1F4AA 3POCA 4XUYA 4OBRA 4D6IA 2XSBA 3LPGA 1E56A 1GOWA 4HA3A 1JYWA 1O6IA 1C8YA 3CH9A 4FLSA 1QI4A 1UD5A 4OKDA 3U7BA 4DWSA 5A8OA 1JG9A 5ABFA 1JL8A 1KR0A 1JZ2A 2VT0A 4UFLA 1ZU8A 2YOCA 3VSTA 3FW6A 2J79A 5A6AA 2Y4SA 4ACZB 1UH4A 3UG4A 3WNKA 2EBNA 3CO4A 4U2YA 3ALGA 3JUGA 2WMHA 4U3CA 1K9TA 3AIQA 1M01A 3EDKA 1GOOA 4V2XA 2YL5A 2F7OA 4PRWA 2W67A 2ZX5A 2VR4A 4MNKA 1KTCA 2DIJA 2TAAA 5E0FA 2VTFA 4P7QA 4GXPA 4GIAA 4TXEA 4EANA 2PWEA 2WSPA 3KE0A 3WQ8A 4ACYA 1NWTA 1V6UA 7A3HA 1R47A 2VR5A 1W2PA 3D50A 4H8VA 1HP5A 2XGIA 5LA0A 3BVVA 1JDAA 1WO2A 1GVIA 4UOZA 1V03A 2V5DA 3QOMA 1C93A 4UCFA 3QGVA 2J7HA 1KFWA 2GJXA 1HP4A 1KQZA 3D3AA 4AD2A 3T09A 4J7RA 1ZBCA 1OB0A 2WHMA 3TOPA 1LG2A 4WIWA 2WHJA 4GQRA 2NSXA 3DYOA 1CGTA 1H2JA 3UG3A 4FLRA 1J11A 1UWSA 3MUY1 3AS0A 1E3XA 3O6AA 1BTCA 1MFVA 1EH9A 2UY2A 3IJ8A 1OD0A 5BCAA 4QAWA 2YIHA 1E6ZA 1UWIA 2CNCA 3SCVA 4ZE5A 3VPLA 6CGTA 3GTNA 5GQBA 2DGAA 4AISA 3PTQA 3VX0A 4AD0A 3A47A 3J7HA 4U3AA 1BYBA 1QBBA 4IPLA 1QI2A 3EMCA 4W86A 3VINA 4C7FA 3SURA 2O9RA 2OYKA 1HJQA 4N0RA 2DSZA 2JEPA 5HXMA 3IAQA 3ARSA 1JNEA 1N82A 4PMRA 1XCXA 3VO0A 3OB8A 1VFMA 4IPNB 5CSUA 2O9TA 1CTNA 3RDKA 3ZJKA 4RE3A 3HG4A 4D71A 1UD3A 4EKJA 5F7UA 1W1TA 1E3ZA 2VVSA 1EQCA 3T2OA 1TCMA 2WZIA 1DP0A 5ABGA 3WF2A 1H0GA 1JZ5A 2E9BA 1UYQA 4UTFA 1IZKA 1KTBA 2PWDA 3VM5A 3MMWA 4M80A 3GNOA 3WQWA 3PZTA 3TA9A 1XGZA 1UH3A 4H8UA 4ATDA 1GJWA 4X0NA 4JFVA 3W38A 3MANA 4CD6A 1LQ0A 1G94A 1TVPA 5M5DA 1PX3A 3VGHA 5A6BA 4UFKA 3WMSA 3CHDA 4MJ2A 2QMJA 1B31A 1QVBA 4H8HA 2V3DA 4Z2JA 3WKZA 3RILA 2E8ZA 4ZENA 4D6HA 1PJ9A 3MV11 5CG0A 2D73A 1ZBKA 1CXFA 2ZWYA 1JYNA 1WPCA 2BY3A 3VU2A 1HVXA 5I77A 1E1EA 8A3HA 5CPTA 3K4DA 3FXYA 1E6XM 3WEOA 2ZXQA 4DM1A 3FN9A 4QLLA 2WKLA 3BUBA 4HU0A 3ARUA 1E4IA 3PZGA 5A6JA 1MQQA 1G1YA 3AIBA 2XFFA 2CITA 4JFSA 2OWWA 1LL6A 2D1ZA 4TTUA 1WDSA 4XZBA 3IGUA 3CZEA 1ISVA 3O9NA 4NZFA 1H11A 3NDYA 1GVYA 1J9YA 3PBGA 2G8ZA 3SCTA 5E70A 2X2YA 3AYSA 1PAMA 2ZXBA 4U33A 3VMOA 3MUAA 4ACZA 2OSWA 3L4TA 5FL0A 4J3XA 3AMDA 1W9VA 2VX4A 3GXTA 2UY5A 3WENA 4URIA 1EO7A 3WH5A 3W4RA 4X9YA 4UFIA 9CGTA 3MS8A 4LYPA 2DT2A 1ODZA 1L8NA 1H3GA 2QPUA 2VJXA 3T08A 2OWXA 4AMCA 2X1IA 1GQLA 4YPJA 3VUPA 1PEZA 4UFHA 3WUFA 1PPIA 1TVNA 1VFUA 1JIBA 4W8BA 3OLIA 3UG5A 3SIMA 2XN0A 1OBAA 3AHYA 3CUHA 4KRUA 1AQ0A 1DWFM 5E9AA 2EEXA 4PMNA 4E4PA 2ESCA 4FNUA 4MDOA 5CJ5A 3BH4A 2WKGA 5JBDA 3AMCA 2GJRA 4OUEA 4HMEA 3BVUA 3W6LA 2NT0A 4PSRA 4CU8A 1NOFA 2ZWZA 3CBWA 4OBSA 2CCRA 2PBGA 2WCGA 2CHNA 4JFTA 3TONA 2JE8A 3VIOA 4AEFA 1B30A 4JKLA 3VX1A 3OGVA 1E4NA 1CBGA 4NI3A 1E43A 1ISZA 1B3YA 3LRLA 1D3CA 3WBAA 2J7CA 2VZOA 1OM0A 3ARPA 4LYQA 4BS0A 1JDCA 4XZWA 4OJYA 1TQWA 3EDFA 1BF2A 4PUEA 2VZVA 3W25A 3K4AA 3LRMA 2XVLA 1GZJA 3KWXA 1E71M 3RJXA 3DX3A 3VD7A 3VSVA 3AROA 1H41A 3EMQA 4UOJA 1NM9A 1JI2A 1BHGA 2A3EA 3VD3A 2C7FA 1XH2A 1E6RA 4J3WA 4HOWA 4CU7A 5M03A 4ZXOA 5GNXA 3FHAA 2G3MA 1E72M 3ZR5A 1J0IA 3GBEA 4AY1A 4NF7A 2XFRA 3VNZA 1IV8A 1CIUA 3S5ZA 2OSYA 3TTOA 2WMIA 1TUXA 2VUYA 3OZPA 4GZJA 2ZX6A 2WC4A 1EDTA 1MYRA 3F5KA 4HZ6A 1W9DM 4TX6A 3CC1A 1W1VA 3VIMA 1AMYA 2EPLX 3IANA 1NOUA 5FIPA 2X8RA 2QPSA 1LF1A 2VL4A 1UR4A 2IGTA 3LPPA 1OD8A 1OT1A 4UNIA 1BG4A 2XN1A 1DWJM 3ARYA 3IJ7A 1FHLA 1KGUA 3IJ9A 3UR8A 2G3IA 2CKRA 2J8GA 4GI8A 2WWDA 1CDGA 1BSIA 2V3FA 3K8MA 2WHLA 4LPCA 4M8UA 1XD1A 1B9ZA 3WH9A 4BQ3A 3BGAA 4U2ZA 3AOFA 3N1AA 1W3KA 3VTRA 3WY2A 2V3GA 3CUIA 5I6SA 1EDGA 4B16A 2D22A 1EDQA 1B1YA 2QF8A 4H04A 3AYRA 4P7RA 3NDZA 1UKTA 3QR3A 1E6PA 3BUPA 2DDXA 2HISA 3BUIA 2GJXB 3PZNA 3QHNA 4OOUA 1CXEA 1WZMA 3W26A 4Q22A 1JI1A 2GSJA 3KL5A 3WL0A 1C92A 2ZUSA 2VCBA 5C70A 2YA0A 1JDDA 4N42A 4GQQA 5A8NA 1L0PA 3DHPA 4KMQA 5E1QA 2EPMX 3BUDA 3WY1A 1TG7A 5A6BD 5A6SA 1FHDA 4ZFMA 4P8VA 3AI0A 3PZ9A 3WQVA 1TZ7A 1YHTA 2WBKA 2PC8A 3MSDA 3OA5A 1KWGA 4NSBA 1V3MA 4AZ7A 1W3HA 3SUVA 5LYRA 4D72A 2EABA 4AW7A 1QOXA 2OYMA 4GINA 1DEDA 2X2JA 3CGTA 1U2YA 1QHZA 1FOBA 3VGFA 3NJ3A 4GO8A 3A4AA 1JAKA 4P8WA 4M56A 2E3ZA 3LPFA 2BY2A 1W9UA 1UKPA 1HKMA 4UFJA 3WIJA 5JBFA 3NSXA 3WMBA 5FL1A 4PYSA 5EFFA 3FAWA 3HG3A 3ZIZA 1S46A 1E70M 2FHBA 2YLAA 4LQ1A 1GW1A 3U5YA 1C91A 1HVQA 2ZX7A 4HPGA 1MW3A 1CNVA 4WK9A 4D6EA 4HMCA 4DO6A 4TVDA 1BAGA 1VJZA 4L4OA 4E8CA 4BQ5A 1HKIA 2WLZA 3BAKA 1QI5A 1UWUA 2WVVA 2PBOA 3ZR6A 1HIZA 2D2OA 1V3IA 1VB9A 1MFUA 1B3VA 4Y7EA 1UOKA 4TX8A 4W8AA 1E5JA 1E1FA 2F2HA 2GVYA 3LXCA 2DH2A 2B31A 1DHKA 4H2CA 5CPQA 1C7TA 3VIHA 3W6MA 1MXDA 3WD0A 1UKQA 2XJ7A 1TMQA 4V28A 4KGJA 1OGSA 4RE2A 4DUWA 5D9MA 1MXGA 4FLQA 4FNRA 3OGSA 3PZMA 4W8LA 1TQTA 4HOZA 1UQYA 5LA1A 1JGIA 1C3FA 1WDQA 1W91A 3WNOA 3VMNA 5JIWA 3SUWA 2E8YA 3ARRA 1SMDA 4F66A 2A3AA 1HKKA 3HG5A 1HJSA 3FHQA 3AQUA 4AD4A 3ARVA 3W27A 4RL3A 4QLJA 4HTYA 3VIPA 4EAMA 2ZOXA 4PBGA 2ZE0A 2EPOA 2BXYA 4XV0A 4JAWA 1CEOA 2ZUTA 4P8UA 2FYVA 2VZSA 2CEQA 3LRKA 2BY0A 1V08A 4CCCA 3GH5A 3WUGA 2BHYA 1XCWA 3BVTA 4AIUA 3L2LA 2X2IA 3AJ7A 3VIKA 5A2CA 1GONA 1O7AA 1C90A 3EJRA 4M82A 4EK7A 1XRVA 3CZNA 4JL2A 1UWTA 2ZICA 4AD1A 1FFQA 3AHZA 4U5KA 3RO8A 2E0PA 1QW9A 5DEZA 2J7GA 4UQCA 2XUCA 1W1PA 2VVNA 4CKQA 2DT3A 1B3WA 4AC1X 3DYMA 2YL8A 3IK2A 2O9PA 1GHRA 1MW0A 1OWQA 1UHVA 4C7GA 1ZJBA 3ZOAA 1BYCA 4CGTA 2AOSA 1GNXA 5AC5A 2FDMA 5AY7A 2YDQA 3VMPA 2VCAA 1H0IA 1E6SM 1OSEA 1Q4NX 1KGWA 3BLBA 3AZTA 2WVUA 5CGTA 2YDSA 4D6GA 2D3NA 3BVXA 3W53A 5A95A 1QX1A 2VOTA 4H41A 3LXAA 5BXTA 5CXPA 2XGBA 5IXEA 2GK1B 3M07A 1YQ2A 2YBTA 3TTYA 1E4LA 1ZBWA 4W93A 2J7EA 1JZ3A 3DX4A 3TTSA 1Q6DA 4CN6A 2D0FA 4HZ8A 2BVDA 1HT6A 1MW1A 1CENA 4K68A 2F61A 3AHTA 1CLVA 2IXVA 3PHAA 1B2YA 1H5VA 5IFPA 3G6LA 1VBUA 5AYIA 1Q6EA 1TA3B 5EB8A 6TAAA 5BXSA 5DMYA 1QI3A 3WDIA 3EBVA 2ZUUA 2MANA 1SFSA 2FHFA 2XVGA 2DH3A 3ZSSA 1R46A 4DUVA 4W5ZA 3T0DA 2XVPA 4W88A 1GOQA 3ECQA 3WDPP 2BFGA 3SUUA 1C8XA 3CZSA 5GPRA 3K8LA 3APGA 3CZLA 5D9PA 1WAWA 3SCPA 4FNPA 1SZNA 1GQKA 2Q8XA 1UUQA 3AMLA 2XTKA 5IDIA 1TR1A 2Y2WA 3GDBA 3B9AA 1RP8A 1GQJA 3CUGA 4P7OA 1HX0A 1V3JA 1QNRA 3VM7A 3ZSTA 2OSXA 1XYZA 2VRKA 5JUVA 3DX1A 2OYLA 3LMYA 1V6XA 5AYBA 3L4XA 4CCEA 4CN1A 1NWUA 2CPUA 5A3HA 1KBBA 4A3YA 4CD7A 1CLXA 4GZIA 5HDRA 5TD4A 4D6FA 3A4WA 4FLOA 1U33A 3AMGA 3AMKA 3DYPA 3ZMRA 1GJUA 3M6DA 2JF6A 1B3ZA 4Z2LA 2UY3A 4BA0A 2WAGA 3W81A 4CD5A 3LXBA 3L2MA 4MB5A 3F5JA 3ZO9A 2Y8KA 4WSKA 1Y7VA 3GXFA 3W37A 1VENA 3M46A 4KGLA 3WQ6A 3PTKA 4UR9A 1J18A 3DX2A 2W91A 3TTQA 1H1NA 1BQCA 3D4ZA 3GXNA 5FOOA 1KQYA 2XWEA 4GI9A 4AZ6A 4A4AA 3BAWA 4CUCA 2YL9A 1SYTA 1JFHA 3H53A 3UEQA 1E0XA 1HXKA 3F5LA 4M81A 3T0BA 1NP0A 3BXWA 4Q7NA 4YN5A 4OIFA 2NT1A 4XB3A 1R8LA 1JZ6A 3S6TA 3SCOA 4UQEA 2Z1SA 4IUGA 2YL6A 3N04A 1TA3A 1HN1A 2ZUNA 1KXQA 1J0JA 2D0GA 4AZCA 1DWAM 1HTYA 4PMYA 5BRPA 1HJVA 1OGGA 2ZXAA 5A8PA 5A2AA 2VNCA 4ZXLA 5IFTA 4WLCA 2OW7A 3T2QA 2OW6A 3MO4A 2CXGA 1OIMA 5D4YA 3DX0A 5A8QA 1QBAA 1K9EA 7TAAA 1SR0A 5FCZA 3NYDA 4TVCA 3DC0A 4AMXA 4BQ2A 4GZEA 1E9LA 2VO5A 2VC9A 1WKYA 3HZ3A 1ISXA 4HP5A 4MAVA 2D20A 3WD1A 1XSKA 2DSVA 4QDMA 2QMKA 2DSKA 1G01A 5HOSA 1UWRA 2CHOA 1JNDA 4IISA 4CD4A 4J3UA 1J12A 1NP2A 2A3HA 5BROA 4MNMA 4PTXA 2F7PA 5DT7A 3KZSA 5A8MA 2BHZA 5I5RA 1VAHA 2Y24A 4HMDA 2WPGA 1TQSA 3ARXA 1PBGA 5HNNA 2WZHA 2G4FA 1W9BM 1BVZA 4E8DA 2FH6A 1G9HA 4GO9A 3H55A 3AFBA 4M1RA 4W7VA 3EJUA 3ALFA 3WQ5A 5EFDA 2J7FA 3GXPA 2FHCA 3VD5A 1UD2A 3WNMA 4AD3A 3SCNA 3A6OA 3WMCA 1EOMA 1HWWA 3VIGA 3DDFA 2QHAA 3ZM8A 4JKKA 5KEZA 4JCLA 1VEOA 3S5YA 3A4XA 1ISWA 1V3LA 3EJTA 1M04A 2PWHA 3SUTA 4FNTA 1Q6CA 4S3JA 1UQZA 3HG2A 4DM2A 1KCLA 2F8QA 3GBDA 3BSGA 2W63A 3EDJA 4J3VA 1HJWA 4MTVA 2D0HA 3TP4A 1UR2A 3AIWA 1GUVA 1UKSA 3FY1A 1EGZA 2J4GA 3RM4A 2XVNA 5A6MA 3VDCA 2X0HA 2HVMA 2ZUMA 2ALWA 3WELA 1V6WA 3NIYA 2DSWA 1M7XA 1UZ4A 3K46A 3KLLA 1LJYA 2XIBA 3VD4A 3VIIA 3N13A 2Y8VA 2J7DA 4PMQA 1BG9A 1GOKA 2YBUA 1AQMA 3BLPX 4JIEA 1EOKA 3EJSA 4AEEA 2DSUA 4LX4A 3ZJ8A 1W1YA 4UZSA 1VF8A 3AZRA 5EBAA 3DHUA 4JL1A 3HJEA 1EO5A 2WSKA 1JYXA 3WD4A 5CPSA 2D24A 3E1F1 3OIHA 1KXTA 3WH7A 4OOZA 4ZEPA 2CYGA 3ARQA 3WFZA 5JBEA 3QHMA 4CCDA 1OT2A 2ZUWA 1WP6A 1D2KA 4WKFA 4F8XA 3MV01 1CWYA 3QHOA 1CXKA 1JZ4A 4AZGA 1R87A 4D6CA 1MVYA 1E6QM 1J01A 3SCQA 1XSJA 1WZKA 1PX8A 1R85A 1UG6A 2VX6A 3A22A 1UWQA 1UASA 3PN8A 1XH1A 2RGMA 2XM2A 1FH7A 4PMOA 3N11A 1V02A 1R7OA 4FNSA 4HU8A 2OLHA 5E09A 2CERA 1VIWA 3BAYA 3B8SA 3SEPA 3GNPA 1DTUA 1C7SA 1LLOA 3GH7A 1UZ1A 3L4UA 1KCKA 4KH2A 3GM8A 2DT1A 4HA4A 3W82A 2WCAA 1WDPA 3VGGA 1QWNA 3THDA 3N17A 5IHRA 2WXDM 4TUFA 4WF7A 4LGXA 1XC6A 3EYPA 4PMXA 1R34A 4PCTA 4MDPA 3WDJA 2PF0A 1PZ3A 3HMCA 2VX5A 1E0WA 4UQDA 5DFAA 5ABEA 2GDVA 2F7QA 1E55A 1SMAA 2WC7A 4TVUA 3AXIA 1V0LA 2WC3A 5BWFA 1HNYA 3MMDA 1VBRA 1V0MA 2VRJA 4GKLA 3CLWA 4JFWA 1TQUA 2XPKA 1D7FA 4A3HA 4W87A 3CHEA 3D5HA 1JXJA 4BF7A 1KB3A 1US3A 3POHA 3W28A 4UQAA 4U5IA 2DT0A 3CIVA 5I0DA 3AICA 1I75A 1CGYA 1DWHM 8CGTA 1EQPA 1DWGM 1FH8A 3GXMA 2BY1A 3CPUA 3AS2A 4MAZA 3BLKA 2UY4A 1QNSA 3S2CA 3ZT7A 2BVTA 4M24A 4AD5A 3SCRA 4NXKA 3BMWA 1H49A 2WB5A 3CZKA 2W92A 2AMGA 4JHOA 3RCNA 4BQ4A 1ZB5A 4PMUA 2J74A 4B9YA 2G41A 1UD8A 3U5UA 3VDHA 1BFNA 4DWSD 1VRXA 1GCYA 1UKOA 2XYLA 3WN6A 1IZJA 4HPHA 1JFXA 4UFMA 2AAAA 1QNPA 1K9DA 2ZX8A 3WH8A 1QW8A 2ZX9A 3RMEA 3OBAA 4HA1A 1HL9A 1NQ6A 1K6AA 1XV8A 1H09A 3AHXA 1LWJA 5A2BA 1QNQA 1ECEA 2WWCA 4X0VA 3H54A 4Z2HA 2WMKA 4LYRA 1NH6A 1QPKA 1LWHA 1BYAA 3G6MA 3FNDA 1VJSA 1M03A 1JF6A 3CTTA 1TE1A 2J75A 2BV9A 3OG2A 2EADA 1FH9A 3BAJA 1E4MM 3MSGA 3B9DA 4RE4A 2WMIB 4NXSA 2V3EA 3A21A 4R27A 1VFFA 3BUQA 2ZUVA 4MJ4A 5C71A 3CHCA 4UQ9A 2C0HA 3ZJ7A 3U7VA 1OIFA 4FMVA 1ZS2A 5D8ZA 1K9FA 4Z2KA 5CZKA 4FNQA 1VEPA 2GDUA 3PZIA 1ISYA 4AIOA 1CECA 4PTVA 2F1AA 4W85A 3HN3A 1ZBVA 1J0ZA 4W7WA 3L4ZA 7CGTA 2IXUA 2J77A 2WBGA 1RD6A 3ARWA 3WEMA 4MB4A 4CVUA 3N18A 1WDRA 4B15A 3M7SA 1HJXA 2FGLA 4Z2IA 4D6JA 2JIWA 1UH2A 1R86A 1G0CA 2YJQA 4M29A 3NUKA 3WDRA 5I3DA 3VD9A 3VGDA 3BCFA 2DQXA 3W29A 4QP0A 1B90A 3A5VA 2JFEX 4MNLA 4C7DA 4DO5A 4DWSC 1QNOA 2D3LA 3OLEA 1I1XA 3F4VA 3VDBA 5E0CA 3CMGA 1UD6A 5KZ6A 5D8WA 2UWFA 1HJUA 2A3BA 1UA3A 3ARZA 1E0VA 1XSIA 1NOWA 5A6LA 4QCFA 1DWIM 3VVGA 3WL1A 1BLIA 3OGRA 3NSNA 2BS9A 4CVWA 4Z2GA 3TV8A 2YFNA 1JD9A 3AS3A 2O9OA 4JCMA 1ITCA 2XHYA 3CZ8A 1GORA 3WSUA 4XX6A 3RM8A 4EE9A 1A3HA 1FP8A 2FE0A 1V02E 2VZUA 1CGXA 3HU7A 1V0NA 2FGZA 2WM0A 2XSAA 2EACA 3WF3A 5HPOA 3GH4A 1LG1A 4AIEA 2WMJA 2X2HA 4OGZA 3AIVA 1WZLA 1NWSA 1E5NA 2XN2A 2X0YA 4DUXA 4W89A 2EJ1A 1CGVA 4BZYA 3WH6A 3K8KA 1TQVA 2WZEA 1O7DC 4R5EA 4MPKA 3BC9A 4WSJA 1V6YA 2XM1A 2WVSA 1QWUA 3OZOA 1H4PA 2BHUA 4AWEA 2CKSA 1LL7A 1RPKA 5IHSA 3VGBA 1JF5A 2QV4A 1V6VA 4AZBA 2DPEA 4JFUA 1KXVA 1J10A 3WEZA 2CETA 3RIKA 1US2A 1R75A 5HBFA 3VOCA 3UESA 5I2UA 3AZSA 3PTMA 2BVYA 1B3XA 3AIUA 5LA2A 3AXXA 4AMWA 3T0AA 5A94A 1XH0A 4D1IA 2VURA 1CXIA 4CD8A 2CESA 2YFOA 3AHVA 3WD2A 2W62A 3II1A 5D9NA 2YKKA 2E40A 2YLLA 3NCOA 3VIFA 3WFLA 5FD0A 3VGEA 4IM4A 4BCEA 5C8BB 2F7RA 4WJXA 1B0IA 1R7AA 1WE5A 4J3SA 4NZCA 4WKAA 1ITXA 3ZT5A 4GI6A 3MUZ1 3KL0A 1NARA 4NRRA 2WANA 2EAEA 3WF1A 3L4YA 2JIEA 1MWOA 2WW5A 3PZUA 3ARTA 5BYWA 3L4VA 1FP9A 1J0KA 4CN4A 4J27A 3VKKA 2E9LA 2EPNA 4QFUA 1W9XA 4AZHA 4PN2A 5A69A 3UETA 1GHSA 4FF5A 3CZGA 2VRQA 1V3KA 1ODUA 1AQHA 5CLWA 2FH8A 1CXHA 1AVAA 1QI0A 1X1NA 1M53A 3A23A 3AXHA 1W3JA 2CBUA 4AZ5A 1VEMA 2XFYA 3KEHA 3PZVA 1UD4A 5I78A 5A1AA 5EMYA 1UR1A 2XVKA 4MB1A 3PZOA 2WVTA
chains in the Genus database with same CATH superfamily
2W07B 1UZ6F 1Q0XL 3SE9L 5EBLA 4IS6B 5AALA 5A3ID 5CLTA 1MHPH 4KKQA 3CFKA 5E6ID 3ATZA 4OM0H 1LP9F 4E9VA 3ZFHA 1XCQB 4PRDA 3S0PA 4U3SA 5C0FA 1HH9B 2CALA 4R2GB 5HJDA 1KJVB 3LEVL 2YC1A 2ACQA 1J5HA 3VSUA 4LCUB 3BVWA 1SW0A 1XWYA 3H26A 4PMDA 1RIUL 3KRUA 4UR8A 4O2CA 1S38A 5FM8A 3QDJA 2P8LB 2YRLA 3US9A 5K7JA 8XIAA 4X6DF 1NCIA 1ZL1A 3V6FA 4PLKD 5IR1B 3MTXA 2WVVB 3FB6A 1U8CA 1J1XH 3ARED 3H7BB 4LCWB 3TASA 4C83A 3SDDC 2CDEA 2YSWA 4R7OA 3MBEB 2VMFA 4GAGL 3BSZA 4WVRA 3LLFA 1U58B 4MADA 4TTGA 3RO6A 5DLML 3EDDA 3L7FA 1Q66A 1OXYA 1C8QA 3EXJA 4BFOA 5GXBB 3RA7H 4WGVB 3P0WA 4NJKA 4AVNA 1WRFA 1OW0A 3MZNA 1WAUA 4W84A 3GBMH 4FK9A 5BW7A 4EI5C 5C2UB 1S7UB 1REQA 2CW6A 4N2KA 3T3ME 5IBUG 1IRAY 1E6JH 4PREA 3VXPA 5IJKA 2WMFA 1MNNA 3NPVA 4IMFA 3TMQA 4N90D 1ZDSA 1OZQA 4IF2A 2HVBA 2K6ZA 5B1AB 3SJVE 5I1EH 2ON3A 4GPNA 4H40A 2X2GA 4NNBA 5T26A 3PUCA 4BZ1L 3STLA 5BXPA 4YTSA 3V0WH 2GJLA 2J7BA 3H4HA 2FEJA 2Q86B 1TZ8A 3LQZB 4LNVA 4A2GA 3NL5A 3UC0L 3K1KC 3DXAD 1NC4B 3VI3B 1T66D 2X9WA 4A2EA 2FBJL 4M62H 4E5XG 3EX1A 4MQSB 3MRLA 2J78A 4WOZA 3RU6A 5D7IA 4LYKA 3O4LB 3ARGC 2QIIA 3BD3A 4NO3A 1N2RA 1Q1JH 2VLJB 5EZJA 2Q09A 3ZDYE 3X1BA 4A8LA 3GKWH 5GJSH 1XMEB 4UOQA 1EHNA 4IYKA 3T0ED 1WG3A 1IGWA 3AIRA 5I6XB 3EMZA 3R6IA 4QG9A 4GKOA 1OL0A 5T1JA 2BCKA 2YPLE 5DDHA 1S39A 1OYCA 3IIOA 1WJ3A 1IARB 5DEGA 4PTWA 4WI3A 2YKLH 4LEOB 5KN5B 4L1GA 1X5JA 5E24E 1X6LA 5KW9L 1LHZA 1CGWA 2EZ0C 3EYQC 4NGHL 3BSHA 4Y1AE 1V7YA 2NQLA 2XH0A 4WCYH 3HA1A 5HGGS 4GZ7A 2VI0A 3NURA 4I0CC 2PPDA 3IS0X 3MUIA 2VEGA 4XVSH 5DZLA 5IB3A 2JALA 5HPCA 4ERGA 4Z7VE 2FJFA 5DU7A 3I3DA 1BVNP 5CJXC 5HJ3A 1SY6A 1UPMB 4LP4A 1XD0A 5JPMA 2J9YA 5AFDA 1JUEA 1H5YA 2H3NA 4AH2A 3WD3A 4M6UA 3CLEL 4F9LA 1IEHA 5EMLA 2ZYFA 2E9GA 5FR3A 1NM4A 2MPAL 3SQOH 5BVPL 3W24A 1T20B 2OM5A 4P2AA 2C0AA 3TVAA 1EIBA 4UZUA 2AL1A 3HW7A 4WDWA 1R6WA 3SDYH 1VCBC 1RQBA 1S9XB 4Y2DA 1XEUA 1EEPA 3GYCA 4BI7A 2BJML 2EDFA 1XLGA 5D2XA 4NO0B 4PGLA 3U25A 3WMQA 4NQXA 3LZ3A 4CNPA 2R23B 4O51A 2INFA 2OWCA 1NIBA 5D8JH 1QBML 3OVUB 3KYKL 4ROQA 5JLZA 3D52A 3S4SG 1G0DA 2RR3A 5I6OA 1NWRA 1SJCA 4LBSA 4E41D 3TBBA 4ZMPA 4AZ8B 1UIOA 2CDGA 1EFXD 2MOGA 3LOWA 1N5YH 5EF0A 4KVNH 4MRCA 1FA2A 4O9HL 1OSYA 2N3JA 3O11A 4NOBA 4PV9A 5ICZB 4KX9A 5E9DB 4XCFL 3MDUA 3UJ2A 4TQEL 1YXYA 2BNQA 1BOYA 1QK0A 3OKKB 1P0BA 4JPIA 3VFTA 4CNIA 1J9CT 2VISB 3G77A 4MLJA 4KK6D 1FLRL 4RZKA 1CB2A 3WQCA 5M3WA 1L2UA 3NIDB 5F89B 3D3VA 3D4YA 2HFTA 4UM9A 1NCUA 4N2HA 3BIKB 4LXFA 1GYLA 4MF4A 3L1GA 1G7UA 5KSVB 2GJPA 1SYSB 1FNGB 1TJIL 5BQ7A 1O94A 3TT3H 2CUAA 3PNWB 3KPPA 3NQDA 3G9AB 5IREA 2W61A 2A1WL 5E2JA 5HHNA 4HKBB 3UPBA 5KVGL 4RMTA 5TGBA 1WTGT 5EEXA 3UR2A 1KLGA 2DQFA 1S6NA 5IMOB 4UTKA 2WWKT 4LBEA 1WWCA 4MWAC 1P9MC 4JTKA 2X0SA 4P7NA 4ERSL 2B7QA 2NZ9C 1FVEA 4IHBA 4TV6A 3ZYIA 3BIBX 4EX4A 4RISH 4ZQPA 1D7BA 1JPSL 3PNRB 4H7VA 4JIPA 2P5ED 1K4HA 1P7QD 5H37A 4F3HA 1IEWA 2ZA2A 3COTA 4KFOA 4JZOB 4JTAA 1PCKA 4K8RH 4K7FB 3W7KA 2B1AL 3ABSA 1AAJA 3OAUL 1K1DA 3QHZH 4KKNA 4U6XA 1V7NL 3LEYL 4X98A 4L37A 4YZWA 4ZDHB 1HXYA 1CO1A 3M5VA 4PMEA 4AX3A 4XD6A 4F2BA 3RJYA 1QWGA 2INZA 4HUKB 4QMEA 5IHWA 4NERA 3A24A 3N0AA 1RJLA 4MZRA 4Q14A 3WDHA 4ALAH 3F58L 4NQDB 1PB0A 4PJCB 2NR6D 5DRWB 1FORL 2CBJA 4FXGB 2WLMA 5I6NA 1DDHB 1DEEB 2ZSWB 3PPGA 4L4JA 3W9ZA 3GXIA 3VFNB 4P46B 4PJIE 5DD5L 4J2QA 3DJRA 1MCLA 4U6VL 3UOAB 3QYNA 3GE7A 1PQZB 4CU6A 5IBLD 4MA3B 1OW0C 3GXDA 4P9HH 1ORSA 3SD2A 2IWKA 1BGGA 2KAUC 3FSUA 4B3LA 3WIAA 1PIGA 3MI6A 4D8OA 2L7EA 1V5JA 2PXYA 2J6EH 2QJDA 2V38A 5DD1H 1JD7A 1XGQA 2VXTH 2VDRB 2QTEA 2XU9A 1E8YA 3E8UH 4WW2F 4AKOA 1TSIA 4IJBA 1TE6A 1TV3A 3NEOA 2Y6ZA 5AOLA 2FJGA 2WY3B 3TL5A 4OJDH 4F9PA 1D9KD 4E9XA 1XYFA 3ABKB 1M9HA 5HHOD 4D0DA 3NSMA 3CSPA 2YMXL 4KI5F 1AC6A 3QAQA 4Z3HA 3PABB 1B4LA 1C5CH 4P9HC 4QO1B 4Y1TA 4POZC 3FUMA 3UAJA 3ZHDA 4B90A 3L3JB 3FDWA 2X05A 3ARGA 3QQ3A 5DVOA 3GBNH 1VKXB 1MWAA 4AW4A 1TG8A 4H7CA 2JIXA 3FX4A 4O12A 2EDWA 5KBKA 1RV6X 3N6HA 1FL5A 4FQIL 5DQDL 3GD6A 4MWAE 4XD5A 5GRJL 5LGJB 3GPEA 3T9WA 1VGAA 2PTDA 3OQRA 3VILA 4R8WL 4N4PA 1U3HC 3NO1A 4LANA 2MNUA 4LLYA 1XMWA 2BMKB 5E1AA 3K1DA 2IADA 2OMBA 4URTB 2DLIA 1E6NA 2W66A 4KWUA 2Z1KA 3FT1A 1TJPA 1VACA 3C2AH 1VFOA 4P4KC 2WSYA 3PSWA 1TMHA 3CMJA 4HC1A 3TSBA 4ZOEA 1YKWA 1RXOB 4GH1A 4KJWD 1LE5B 1PZ1A 4X80L 4P46A 4IGBC 4NJ9L 3QR0A 4WK2B 5TJWK 3IJSB 1F6LL 3DESA 3N15A 4IGHA 5D02A 1GW0A 1A6AB 1MCIA 3T44A 3DPDA 1BX2A 1R30A 1SU5A 1XISA 2WXQA 1FYHB 3N12A 3AG2B 3T81A 3WUBA 5AWNH 1ZCRA 3EOAB 2KZKA 4WWKA 1LD9B 3BFOA 4YDNA 1PY0A 5A6KA 3RWCB 1QQDB 3D51A 3EJPA 3FXIC 4M3PA 3OLDA 4CGUB 2BXZA 4AVKA 4HMNA 4Z42C 4PJIB 5B8CC 3BICA 4JZOA 4WWPA 3SE3C 4JDVA 1OGBA 2DVXA 4B97A 4MNQE 3CYVA 1CD9B 3P82A 1QAPA 4IEFA 2HG5A 4GAAA 1IVTA 3RNQB 3ID7A 3WK3A 4DWSB 4WJG3 4P8XA 3NAVA 1JNNH 4FCHA 2OPJA 3DRQA 1BGAA 3PP3K 3B2DC 1GPWA 4MHHI 3LPOA 3SE8L 5GRZA 2IKHA 4XBGB 4GUHA 3GI9L 1J5OH 4G7FA 1T40A 1KW1A 4MQTB 3UAJC 2KMWA 3UERA 4YXHH 1YN7B 2IV8A 4G42A 1TTFA 3FFCA 2VIRA 4EVNB 6FABL 2J4WH 5I24A 4UM8A 1QHOA 4X80H 1GPFA 4Q6JA 4NI6A 3BN9C 3BQ5A 1ZVYA 4XVUC 4B3KA 3O05A 1P69B 3EGSB 4QRUB 1KR1A 4QCEA 4NRYA 5IQ9A 1RK5A 1Z3GL 3NIDE 1ME9A 1TPFA 4S3EA 3P30L 1MIEH 5AAMC 1DYZA 4HJTA 4UM9B 3R18A 4WY7H 4XUYA 5K1VA 4OBRA 3UPAA 1V79A 1DCEA 1OY0A 1A6VH 4Z7QB 5I2IA 1FORH 3GKFA 2DQDH 4HC1L 4DT2A 3OKNA 4Z77A 2BNQB 4K4KA 2C16A 5G4EA 3G1HA 4DPCX 1GOWA 3L1EA 4ZRGA 5RUBA 1LRNA 3CH9A 1NBCA 1TZGL 3EGXB 2WQVA 3VXNA 2EKJA 4AL8H 4FLSA 4KTEL 1LMIA 4BWTA 4DWSA 4FFYH 5I02A 5ID0A 2B1AH 4DB7A 4MJMA 1A0QH 4OLUH 2AEOA 5I30H 2JXMB 2W80C 4LCYA 5I5IA 1HGYA 4LCWD 4NQED 3HC0A 1MHCB 4ZQOA 3FW6A 2ACUA 3AO0A 1SZGA 3WOVA 2CC0A 4K3ZA 4B5VA 4BFGA 4G8GB 5D71H 5IHZB 4BKLA 2M83A 4ACZB 4JNZA 2DQ6A 1U8MA 3N41B 4BJLA 3ALGA 2VLKE 4R2GD 2C9SA 4G9FE 1IXNA 1NCOA 1EMTH 2NX5B 5CZVH 2D9CA 4U3CA 1CR9L 4R4FL 1LE5A 3BZGA 2J56A 3KUMA 4RCXA 2IQ9H 4G80A 5PCYA 1XFCA 2CAKA 2HTLD 4NYLA 4AF0B 5I0ZA 2VHLA 1GOOA 3US0A 2EIKB 5E03A 1K7XA 1W8GA 2RB8A 4OZGE 1QTSA 1RK7A 2AQ2A 2J8HA 1XB8A 1EEZB 4KUCF 5E1AB 2ZWNA 1AZUA 3AVEA 5B1JA 5F9JB 3HQ1A 1KFEA 2TAAA 5D7JC 5E0FA 1LP6A 1ACYH 1IIKA 2IWEA 4HUWB 4XCFH 1N8WA 4P7QA 4GXPA 5CGYC 4EANA 2PWEA 2WSPA 3ES6A 2FCBA 3KE0A 3APFA 4MKMA 1NWTA 3NP3A 4KK9C 4G43B 5IMMA 4L7ZA 5H94B 1QW7A 2RTTA 4EF9A 3NA8A 3R25A 4HISA 1MWAB 4H8VA 2XGIA 3OTRA 1NDWA 3M0ZA 3SBPA 3UZJA 3D87B 3MRIA 1BA9A 1AH1A 1RBLA 1JGDA 5AB0A 3LB6D 2V5DA 4QTGA 1X7QB 3M6YA 1NGZA 2R9HD 4ZPTA 1UATA 4IZGA 3UG8A 2IBGA 3IJYB 3RGVC 3TYFA 1Q13A 1KQZA 2GJXA 3D3AA 1ZAGA 1DFBH 4ERSH 3GY1A 4XMLH 1NIAA 2ENYA 1ZBCA 2FFCA 1LG2A 3P2VA 4WIWA 2IWGA 2YRBA 1AO7B 2UWEF 3KDMA 3QHFH 4RWHA 3GGWA 3A4EA 3F04A 1AA1B 3UG3A 5DELA 4PODA 4ZQKA 2Q8AH 4Q52A 1XGQB 1SN0A 3FCUB 1HEHC 1ZGLM 3HUJB 3LHPL 4IMKA 4DVRL 5AOMA 2I27N 3NZRA 1E2VA 4YDJB 3PDGA 3PWNB 2XDHA 4Y16A 3UPCA 1N6QH 2UY2A 3KPRE 3IDXH 2WOQA 3PHOA 4IICA 2QDVA 3L3IA 1T7VA 3R4DA 5BCAA 5DHYB 4YJ5A 1A1OB 3GSMA 1B57A 5KW9H 2PYEE 1HKFA 2ENQA 1M2VA 1RUQL 3UJIL 4F27A 5LO7A 5BOZG 2EVIA 2WN2A 4R26L 3UBGA 4CVZB 1V4YA 2PTYA 4ZE5A 4NFCA 1AJ7L 1BMZA 4PTUA 4Z7NE 2B4CL 1D8CA 3VX0A 2CFFA 2GL5A 2QQNH 2X70A 4HF5L 2RDUA 3PTQA 4X60A 4TQPA 4BDVB 1XAKA 5GJSL 4GG6A 1GTEA 4XNBA 1JHKH 1QBBA 2OMNA 2PE4A 3RRAA 2DBLH 2YCLB 4PULA 1Q1JL 3FL7A 3PK7A 4W86A 3BH9B 1QFWM 1IL1A 2DWTA 4C7FA 4ZSOA 2I5QA 3SURA 5KOVC 3SCMA 2GT9A 2MQ3A 4PG9A 4N2EA 2HK1A 2DSZA 3DO4A 3UAAA 4UTAL 1SOKA 5FCUL 2P0IA 3G1YA 3S6OA 2Y62A 3E0WA 1BOGA 1DZ0A 4PMRA 5DBUA 5CSUA 1NSNL 1EDHA 1ET5A 4JFPA 1IEQA 4GT0A 4H8QA 4Q8PA 2JKRM 4DZBB 3T6VA 2XG5A 2WO5A 4K38A 4O15A 3TVMD 3CLEH 2V9QA 1MSSA 4LUSA 3CD4A 5EBLB 1QRQA 4HJWA 1WUZA 3PNWA 3ZJKA 1EBGA 1PG7H 3REQB 3VH8A 1QSEA 2PPGA 4XAWL 3HG0A 5LIWX 2HFGL 4F2FA 2VVSA 3W2LA 2PTUA 3S37X 5IFJA 1OFDA 4PJ9A 3IJIA 4ZO9A 3OAWA 3KVLA 3RWJB 2V5BA 2WZIA 3W1QA 3LGEA 1DP0A 1UT2A 3QI9B 1DVQA 1YNQA 2FTYA 4X3ZA 2CZDA 3OKKA 2VO8A 3TZFA 3QC6X 3MRDA 3DSFH 4H1ZA 3A3XA 1L3NA 3HS0B 3U4AA 2E9BA 4GAGH 4XO8A 1IZKA 1MFCH 1JZ5A 1H0GA 1H3VA 1ORQB 5DGQA 3GIVA 3TH4T 1UFGA 1EIXA 3VM5A 5ICXA 3CBJB 4K71C 3S35L 2XH7A 3KOZA 2OP4L 3WLOA 2AQ1A 4TSBL 5TTRA 2ICSA 4H8UA 1AHKA 3TPUB 4KHXH 5D9SA 1KCUH 3K74B 1K5NB 3CNYA 1HESA 2V9DA 1A0DA 4X61A 1AC0A 5J56B 4GUGA 3W84A 4OFCA 1NTDA 2ISWA 5T91A 2JJTA 4CSTA 5JHLH 2Q71A 2DLGA 4UFKA 3NEXA 2Z7YA 4PTTA 5LN4A 3ZPDA 3WMSA 2I9LA 3UTZB 1A49A 3ZGIA 1HSAB 1KYDA 2Y1VA 1G7PA 2VUOA 1O60A 2GGJA 1QVBA 4MXQD 5E1GA 1RCXB 1BQHB 4RSYA 3CT7A 3Q0HA 1TVHA 4QG8A 3IPEA 4F2UA 1JN6A 3MV11 4H0IA 2ZXEB 1U6AH 5HMEA 4PJBE 3V9CA 4ZZFA 4ZZKA 4GOAA 1PZCA 4Z95L 1ZBKA 1CXFA 4UDTA 3UGEA 3WCZA 2AXHA 1I9IH 1YEJL 2BY3A 2VDOB 3DJSA 4PLJC 4D9LH 5I1DA 2VB5A 2HT3D 2Q8LA 4Q6XA 3FT3A 3AY4C 1EEUA 4YQXH 1F8MA 1LOQA 4XMTA 2DZBA 3HRPA 1J1XL 1GGBL 3K4DA 4Y1AA 4GT7A 4AWUA 2MCMA 5DJXB 5AB2A 1HQTA 3BT0A 1JGMA 4W6XB 4Y9AA 4OCSH 1K2DA 1N10A 3FN9A 1BXAA 5JA8B 3NBNA 3TROA 3ECWA 2WKLA 3S3JA 3JR2A 5T1KA 4HU0A 4IHOB 1SHMA 5H2BB 4QRTA 3X11A 3RFZC 3GLEA 1G84A 3PXJA 3RN6A 1WQVT 3T4YB 2DQTH 4NAJA 4EBQL 4X5XA 3FQXA 3ZE1E 1I9RL 1XYBA 1MQQA 4G8TA 1W1B1 3BG5A 3SBWC 3FCPA 3BYYA 5J06A 3AIBA 2OWWA 1MHPL 1WCBB 4TTUA 3GDKA 5L9FA 4C4UA 3U0TB 4UBDC 1NA8A 1TO4A 1NDTA 3TZVB 5D2YA 1U1HA 2F53B 3TN3A 1REQB 2XZCH 1VFBB 2IPFA 3RGTA 3GS0A 4XP5L 5L2KE 4PBFA 1QR1B 4NNXB 4QY8B 2OR2A 5HQEA 5E70A 1AACA 1UM6L 3U1PA 4UT9H 4YEEA 3WTVA 4JMNA 3U9UA 4R4NC 3WL9A 1HEJC 2HRLA 1JHLL 4HWBA 5I75B 3P7YA 3QEQA 3VMOA 3MUAA 1PLGL 2OSWA 5A40E 3HPLA 4OT1H 3SQBA 4KROC 1FH5L 1AGCB 3G7TA 3MO1A 4J3XA 1U58A 1ES0A 2Y9RT 2ZNXA 5FYKL 3RHWF 2FPYA 4HHWA 2UY5A 3C0SA 3TV3H 5C0RL 3RWEA 3OV6A 5D7LB 5ABAA 1FNLA 4M4RB 1EO7A 3FN0L 3CNKA 4PGBA 2ZUYA 5EZLB 2DYRB 5IR1A 1RY0A 2GC4C 1IJ9A 4WQOA 4UFIA 1SJEA 5D70L 2YGYA 1X4ZA 9CGTA 2DT2A 1UGNA 2Z7UA 1MI5E 4GQPH 1XYCA 1I9IL 1U8HA 1YEJH 1CD1B 1VPOL 4M7JL 3HMXL 1OHQA 1H3GA 5CR8A 4OV5A 3HE7B 4UUJA 3SDAB 1MDRA 1E9YB 3KBNA 3QMSA 1LTXA 4HGWA 5DJ0B 1T5KA 3QQ4B 3WS6A 3WQFA 3KHDA 1OOAA 2DMKA 2HKFL 1QR7A 4KXAA 3ZKNC 4JPGA 4WFGD 4W8BA 1IBGH 5C9WA 3V5KA 3NVTA 1PY9A 2VABA 2W60A 3FU7B 5J6HA 2XN0A 3AHYA 4KIEA 2EO9A 3QXTA 4L05A 2AJUH 1JR1A 3QJFB 1AQ0A 2BRRH 1YEWA 5E9AA 2EEXA 3FQXB 2NZLA 4FNUA 5HGHA 5CJ5A 5AC7A 5JHLA 5DRNB 1LP9B 4R5TA 1KM5A 5JBDA 1E7UA 3DPBB 4RZ6A 3MU3A 1TU2A 3MLZH 3GYRA 4XBPB 3BCJA 1E28B 2X10A 3QQ9C 2X1SA 1G7MB 3BVUA 3BOLA 4MYXA 3VD1A 2NT0A 4Q2ZA 3GSNA 3GTTA 1NOFA 3PGDA 5DJXA 2OK0H 1BKHA 1W3NA 1XR2A 3JU2A 3QUYC 5AZ1A 4WUKH 2JJVA 4R4BB 1IB5A 4KKZA 5IJVB 4UT6A 4IP7A 1IAIM 3L3KB 5HP5A 2PBGA 4IRSD 1XYLA 2PTXA 4FHAA 2WCGA 2ZRWA 3F4NA 1QAWA 2CHNA 3VKAA 3C6LA 1TFPA 4K7PH 3W74A 2V5SA 4QRAA 4U6HA 1H9DA 3MJYA 4HFWB 3GJFH 4BHYA 4FFZA 1Z9AA 3F5WB 4R90H 4HHGA 1YEDB 4LLUA 4MD0A 4QEGA 3N2CA 5TDNB 2XY2A 5B4MD 2HFGH 2WXRA 5GJTH 1P7TB 5F4WA 3T6WA 3RY5A 1BQHA 2VUNA 2FX9L 2VZOA 1YEKH 2JKNA 3DARA 4I3GA 2X9YA 1DBAH 1OM0A 2V2XB 5JOPD 3V55A 4TVPE 3QJZA 1WFNA 3UTZA 5I19H 1JDCA 1L9WA 3DTXA 2DMCA 3PIQA 2ALDA 4JTTA 4BELD 3F4CA 1FH2A 3FCTA 1YMMA 2AJXL 2VZVA 4U0RC 3WO8A 3W25A 3BLLA 3FJ6A 2MCPH 2XVLA 4NJAH 2CGRH 2QT6A 4N5ED 3I02A 3OXRB 4NDMB 4TTDC 1LLWA 1I8IA 3ESVF 4UTAH 4LSRL 2E5BA 1KCVL 4MA7L 1TEFA 5DD6A 4XCYA 5ADOL 2R7EA 3CXOA 2BP0B 4NN5C 5EIVA 3LERA 4JOMA 1NC2A 4KDWA 3AREB 2FPTA 3EMQA 3TFKC 2CCVA 1L0YA 2HT2D 4UOJA 4O2EA 4Y4HA 3AZUA 3BX7C 4KXZI 3PFRA 5KVEL 1QOPA 2A3EA 2BNQD 2QQNL 3VD3A 1NBYA 1SXZA 1K8CA 3IGAB 2DBJA 5KSUA 5IQ7L 1Z8AA 4J3WA 4HOWA 5M03A 4LLDB 3RDTB 4LMQE 2PR4L 1TV8A 4YXKH 3QFWA 3B2UD 1WEJH 2OJEB 4UTCA 3LNDA 4NC1C 1ZHBB 1RUQH 2D4DA 2CIIA 3ZIYA 3JZ7A 3CV7A 4L9ZA 3SM0A 4DJDC 4GRWB 4XZUB 4DEPB 2YPVA 4YHOL 1E72M 3ZDZE 3ZR5A 4OTXH 2BW4A 3RIAF 3QUYA 3TZVD 4C54A 3KOYA 3P5YA 3GBEA 1XL6A 1I3UA 3F7LA 4JDEA 4F92B 5IFJB 1DL3A 2ZQ0A 2RH9A 1C5BH 4YDLC 3W2DL 1KJ3H 4ZXBA 1N6QL 3KHQA 4GQBA 5L6UA 1IV8A 3QDGA 2XTJB 1CIUA 3S6DA 5HATA 1TKWA 5DD0H 3CSGA 4FFWD 4YEFA 1S8DB 2WMIA 4INFA 3EYOA 5FA3B 2XKSA 1LORA 4NP7A 5C7XH 2OTDA 3VIMA 1AW5A 1G9MC 3CC1A 1UPPA 3NQVA 5J6GB 1U21A 1FZMB 1JPTH 2EPHA 4IRJC 4FQCL 1BDYA 2CGYA 4MTMA 4WJKB 1L8PA 2FZBA 4GXWA 2VL4A 4PRPD 3L5WB 4TLUA 2IGTA 5HD8C 3VXRB 1UR4A 4X9IA 3CPGA 7PCYA 4WHBA 1IL1B 2QKIC 5ACZA 1PE1A 1F42A 4GC4A 1WSST 1YBQA 4AT6A 2A74C 3QZPA 3L3DB 3QEQD 1C8VA 2YZRA 4S1FA 5C55A 2WJ7A 1DXFA 3QFEA 3ARYA 3FA3A 2JKXA 1FC1A 2OU4A 4I0PD 3V7MA 1KENH 3IJ9A 4TUJA 3SDAC 3N19B 1EGJA 2P28B 4H6EA 3VG0H 4RV3A 5JUEH 2A9ML 3Q8CA 1TCDA 2V3FA 4RRPM 2YS4A 1XIIA 2OMWB 3XINA 1BEYL 2VAJA 4HS3A 5CUSL 3U30B 3SN4A 3SGGA 3PF3A 5B8CB 1IT9H 3L5JA 2HRGA 3L1FA 3IAGC 2X6VA 4Q8WA 4PJXE 3L3IB 1QSFD 5GIRB 4ZS6C 3TIDB 5D4HA 3N1AA 3GBLA 2DQUH 4DGVL 3TOYA 3QUXA 1KM3A 3AXKA 3WGVB 3DETC 3CUIA 5I6SA 4H26A 3CQHA 3HN5A 4Q6IC 3E0VA 2YGVA 4ZFFB 3UP6A 3CUPA 4H04A 3AYRA 4KBXA 3IEAA 1UKTA 4DJEC 1Q0YL 4NNPL 1A4BA 1P1VA 3RE0A 4BM7A 1BLNA 1DXEA 2VSMB 3BUPA 3FT4A 3KPLA 5J5RA 3PWIA 1T80A 1MAMH 5TQ2H 5JIMA 5ITFA 1XLJA 2GJXB 5DMMA 1RHHA 1MI5B 3ARGD 5IY5B 4EPDC 1MDAA 1Z3NA 2XU2A 2IPUK 5IG7A 3HUJE 2IPKA 4OIIH 3E6EA 1U8NA 5D6CA 3QHNA 5FS5A 4PP2B 4BH8A 5C2BH 2DYPA 4PWFA 5I1LB 1VCAA 5J11C 3FDKA 1FVDB 2GJNA 1MJ8H 3M4HA 1RZGA 4MJ5B 1UWEL 2CJUH 1XAUA 1OE2A 1P4UA 3MUGB 4JFEB 2GSJA 2H8XA 4PJDE 4G43A 3FCSA 3EX2A 3LZPA 3Q2DA 3QZ6A 3KL5A 1TZGH 4N02A 4ZBCA 3QSKB 4JTIA 1RUKH 4WK0B 2ZUSA 1KXQE 4FOUA 2VCBA 4WFGE 3ATAA 1P2CA 1ETZA 2CO2A 3O45A 4ZO8A 4PC8A 3PWVA 1AKJD 3ZO0A 5KVFE 5C0QA 3B9NA 4RQQA 5MP6H 4WTQA 4O54A 2YA0A 3GTIA 3C6LD 4J8RA 3RZCC 1T0NB 4WY7L 4UV7H 3T6CA 2EPMX 4MQXD 4DP1X 4K15A 1TPEA 3NPZB 4PJCF 4XNDA 4MA1C 3HNVL 4M48L 3WY1A 4L4TB 2R8SL 2UZIL 4P5TA 4UMSA 1JQVA 3R4IA 3P0GB 5HVHB 4QGCA 3QWOA 1FHDA 1KLZA 1FRGL 3GVRA 1DQQA 3WJXA 3EFFB 3UO1L 4AHPA 3TBSB 2R1WB 1F3WA 2WUCH 1POJA 5E6IC 3WXWL 1NCWL 2OMTB 1TZ7A 3NWRA 4YXHL 3T07A 3UGVA 4K23H 3CE1A 1ETZB 3MO7A 3MNDA 4BFNA 2AK4D 3B2PA 3D33A 4RSVA 4WRLA 1NPJA 2VITB 2X4QA 1KWGA 1V3MA 3ECVA 4NUQA 2VGIA 4NSBA 7ODCA 2IQDA 3EADA 2IANE 1AO7D 2AJSL 2W79A 3JWNC 4GP5B 3PBWA 4KZDH 5LYRA 3HC0B 1UCWA 5C54A 5I1LA 2EDLA 3RWGA 1S9YB 1QOXA 2XBDA 1AXTL 1XRTA 2IBZX 5FA5A 2K7PA 4OLZL 1EJUC 4O1FA 4DGWC 4FIRA 4NBXB 3VGFA 1FOBA 4GO8A 3A4AA 1RR2A 1JAKA 3B4UA 3TLRA 5T3ZD 3KPLB 5L2JB 2AEPL 4FSAA 3OKEB 2BVQA 4HGKC 4ES9A 4F91B 1W9UA 1FGVH 3TAKA 4L4TE 5M94B 3W1MA 1HKMA 1Z6KA 3VTMA 5G5DA 3IRCA 3E80A 1AGEA 2P53A 2PPAA 4WNQA 3VTAA 1A3QA 5FL1A 5C0CB 4H25A 4IRZL 4JGJA 4PYSA 3ABLB 4JHAH 1JCLA 2ZYSA 4G8FB 3QUXB 5FF3A 2VDOH 2H26A 1HCFX 3ZIZA 3EO1B 5A16B 1GOFA 5CLYA 3I75B 4DO7A 3VI2A 3UWEA 2FHBA 4XI5D 5FB8B 3C2AL 3U5YA 1IGFL 5C3IA 2DUXA 3GEWB 5CSBA 3T1FB 2E25A 4P4KB 1MW3A 1T6MA 2P80A 4F80A 1NFAA 1SBSH 3LH2L 4QRPA 2XH2A 1OP4A 2TSAA 1KYAA 4PWJA 4GAJL 1GYMA 3B8TA 5AW6B 4HSNA 3BAEH 3DRQB 4DO6A 3MODL 1CLZL 4UT9A 4M00A 3L3DA 2D69A 4L4OA 4Z3FA 2AZAA 2OTWA 3NL6A 2QLVB 3P84A 3H22A 2YCIX 4XPTH 4XXDB 1NMCB 4QR7A 3T05A 1T7XA 2GLKA 3NOEA 1SZRA 5JXAL 4WY0A 2VXVH 2CKBB 2GSIB 1CU4H 1IAIL 4Y9MA 1FZMA 4PJIF 4XUGA 1TV4A 5B38A 1RVGA 4B0MB 4FA3A 4WWKB 2XHNA 2PTWA 4AY7A 1SUHA 4XWUA 3MBXH 5E2TL 1AP2B 4AQOA 1J8HB 5J57B 2PDQA 3X3GH 2Y0SA 4XPAL 5IOBA 2ZFAA 3MLSH 3Q06A 3F01A 4LAQH 3G6JA 4R84A 3REVB 1ALDA 1QLEB 3P4MA 5DD1L 1P0DA 4F58L 1ZKAA 5IFAL 4O1EA 4K9EH 2JCCE 2V9UA 1PKQE 2HLEB 3HRZB 5GZND 1DBTA 1QK2A 4L5FH 5IHHA 3HPSA 3ARFD 3ITYA 5AVUB 2LAAA 2IAMD 2B31A 4M1DL 12E8L 3GINA 4N8CL 4PS7A 4O02H 1MXDA 1QSFA 2A73A 3LRGA 1UKQA 4EVZA 1P53A 3L6FA 2CIIB 1HYSC 4LB8A 5G55A 3K6OA 2YXMA 3H3BC 1KM6A 1TMQA 3IACA 4V28A 3KLQA 4NENB 3NPSB 3MLRL 4REQB 3GTVA 2OB3A 2BZCA 4H19A 4G1MA 4LC6A 4DUWA 3GSVA 1FL5B 4YK4B 1YYLL 4WNJA 1JPFA 3QHZL 4FLQA 4FNRA 4O2EB 1T7YA 2DQMA 2DB8A 4Y4HB 5D1XC 1L6XA 3QQ3B 4HOZA 3OGCB 3FLUA 3NJJA 3CVIH 1GSKA 4R83A 1UB6B 2ZZ5A 1NC2B 5SX5K 1YC7A 1VADB 4CQ8A 1JGIA 5GGRB 2QCDA 4Y96A 3VA6A 3TEZA 2QZ5A 4XCYB 3VFRB 1DIOA 2Q7YA 1OF6A 2FZDA 1W91A 3WFBL 3DFTA 4ODWB 3S4SB 4CNOA 2XXCB 2OMUA 4WD0A 1PZDA 4JZJC 43CAA 4I9WD 4IGBB 5KYUA 1CK0H 4KUZL 1E4WH 2OJ1A 1X5YA 2Y3AA 4UNTA 5T1MA 1Q7MA 4F66A 2QADD 3BG9A 1HJSA 2F9RA 2OQHA 3WLMA 3SGDH 3AQUA 4RX4A 3MCLL 4GW4B 4ALAC 4R2GC 3GFXA 4KQ4H 4OLYL 2B7NA 4O4VA 1YNLL 3S5LA 4AJYV 4DOHE 3THQA 4HCRH 4JTUA 3VIPA 5T8IA 3TBVB 4EAMA 3VXMD 4FQ2H 4MA3A 1GGCH 2ZOXA 2ROYA 3MRHB 4PBGA 1UQSA 4LESA 1Z1WA 3RVWD 4PUBL 2ZE0A 1FLRH 2V6HA 3IM1A 1E9QB 2VLRA 4MS6A 4XV0A 1RU9L 2OMZA 2CJTA 1DDHA 2ZSWA 1FLTX 3GDMA 4FS9A 4HJ0D 2AP2A 3RVWC 1NDGB 2FSEA 3PSVA 5JUEL 2CEQA 4IOTA 3HLAB 3GHTA 5BRZB 2NY2D 4JHVA 1ZLWH 5JHDB 2DWEA 3GH5A 3KCOA 2E5CA 4X9HA 3WUGA 3BVTA 3BT2H 3KWTA 5FF4A 3HE6A 4RAHA 1CGSH 4Y9FA 1HZHH 5DO2D 1IXPA 4NZRL 1NGXA 3VI4A 5FF7A 5CHNB 1KRBC 3HTWA 4LNYA 3O8XA 4MCNA 2P5EE 4HYTB 1OP5H 1IEIA 2H3DA 3EOOA 2V2TA 4YTRA 1TU2B 1IBZA 4XBPA 2JF1A 2IQAA 3QG6A 3ES8A 4M82A 2BPBA 2BJMH 4OCMC 1IO4C 3H2MA 1KACB 5EH1A 4QXTB 3URBA 1ND0B 4WDUA 4OE7A 2BNRA 5AW2B 1KT2B 3RTQA 5KYWA 2JK5A 4U7KA 3NQ8A 3HNTH 4AD1A 4JRYB 3P9WB 3BN9D 4U5KA 5C08D 5G2IA 1AQDB 2WLNA 3QAZB 3KPPB 3LH8A 1PO9A 3M16A 3LN9A 2OL3B 2E0PA 3PL6D 5F71A 1FQ0A 1TJ0A 4P2CG 3GZOA 1HKVA 4LUTB 1QW9A 3HR6A 2J7GA 3L0GA 4BKNA 2QGEA 5IQOA 4MLSA 2FB4H 2H2SC 5F2FA 5FV1L 4MJIA 3CSYA 2ZNWA 1Z41A 4CKQA 1B3WA 3HUJF 2X1QA 5IBUB 1J93A 1GJIA 1T6BX 2YL8A 5ENWA 2IPTH 1GHRA 2H2PC 1RULH 5D55A 1MW0A 1CD1A 4I3RH 4LCCB 3IDJA 4K8HA 4G8AC 2JVUA 2OXGB 5D1ZA 5E00B 1R3JB 1YXCA 4NRXA 5CEZE 5CFHA 3T77A 3S42A 3W7RA 3O6FD 4AJVA 3VFWA 5TE7L 3WTTA 2CDFA 4JTEA 1YEGL 3G6AA 3WX7A 4XPFH 4LMQI 5AC5A 4F0MA 1D6EB 4UBDD 1DIEA 2DLHA 5F3FA 3S5SA 3WG6A 3KAOA 3WE6A 4TSCH 4NWUL 3H3PL 2LTQB 1INQA 3BVDB 3UW6A 2FBJH 4M62L 1R9XA 4YSOA 3V4UH 2OELA 4KROB 4BI5A 1AFVH 3AZTA 3F2DA 3HI6L 3LS5H 3SPVA 4YHYC 1PL3A 2FIKA 1IVLA 2NQ3A 3VXTA 5IUSA 1JGEA 2YDSA 3QY7A 1QR1A 1WFJA 3R7RA 2R91A 4UQ3A 1NFBA 3W53A 5A95A 1XT5A 4YHLL 2VOTA 4H41A 1XKYA 1U8OB 3PWUA 3SIKA 3LXAA 3ZE1B 3TVMC 1EHLL 5BXTA 3ME0A 2R1NA 1BAFL 3BDBA 1Z42A 1TYRA 2R2BA 4GQ0A 2D31B 4JQIL 3RR4A 1YEKL 3GW0A 2VDLL 3TW6A 5IXEA 4YGVA 1AY1H 1H8SA 2OCCB 5DRXB 2V7NA 5F7BA 2YBTA 3QEUA 3SY1A 3FO0L 2GOKA 3NPSC 1A7NL 4GSXA 1ZP4A 2WQXA 3DX6B 4X5XB 3O6KL 1T5WA 1J05A 3MNZA 1ZHNA 1JZ3A 4HHMA 4ZMYA 2J24A 2BP1A 3QZWG 1U4FA 2YZ8A 3GT6A 3FKUS 4R3SA 5EBMA 5JHDE 1M68A 2GEEA 1G7QB 3DX4A 3PWLA 1POKA 5E95B 5KTEH 3R8QA 4JFFD 4CN6A 2PP0A 1MVUA 1WBZB 1HT6A 2KT6A 1PSCA 4AQEA 1KTLA 2I7GA 4N2OA 4OR1A 4FQJL 3G22A 1DSFL 2WOBA 4O11A 3RDTD 3D2TA 4HU3A 3TIMA 1GIGH 1SDAB 2IANA 3KH4A 3GD1C 4ZCWA 1QUMA 2VLJA 1H5VA 1HL2A 1PG7X 2YEVB 4OCRL 2I9TB 2MIZA 4KNQA 4PW9A 2AXFB 3WFEH 1Q9WA 1KBPA 4NFBA 4Z7IA 1NC4A 5EDXA 4DEPC 3EBVA 4XBSA 4TLSA 4EPEC 2MANA 4JFYB 1JWSA 3O6DA 5T3XD 5DCDA 1SFSA 4ICNA 2XVGA 3UZXA 2DH3A 2F54E 2BS8A 3MRKA 3D07A 2Z1WA 3UJFA 5CMAA 4DUVA 5HBBA 2J3SA 2R1KA 3D3FA 5BU6A 2LLNA 2HLAA 1TITA 4F7MB 3LRSB 1GOQA 4LCIL 4UXDA 3QZOA 3QPXH 1VF5C 1IBHA 4BRVA 4NSKB 2DJUA 4NUGL 3VW3L 5SWUA 2W65B 3TSMA 3WDPP 2YARA 3ZKXB 4GG6E 1O5RA 3MJ8A 2GQ9A 2XV6B 3QCTH 4F9LC 3CZSA 3O0RH 1TWIA 2BNUB 3CZLA 3G08B 1MFNA 2RAGA 3VNLA 3K5RA 1SZNA 4JDTH 4IOIA 2Q8XA 3C5XA 3AMLA 5DS1A 2XTKA 3NCJL 3C6SB 1BFOA 3E0FA 3IFLL 3P3YA 1A7QL 1XXXA 3CUGA 4B6ZA 3KWWB 1ZMYA 1HX0A 4JFDE 5DURB 5EA0L 4ZMTA 1XKJA 2HRWA 1HKWA 1IGCH 3TV3L 4JYDA 3ZSTA 2OSXA 1QXLA 4H88L 1DQVA 2VRKA 4K3JL 5IROC 4L4VB 3U83A 5K39A 1QSEE 4L2LA 1ZIAA 4NN5B 3VXOA 1TSRA 2EDYA 4L8BA 2RJHA 2W9DH 3HIZA 1XF2A 3QR1A 4PJGE 4CN1A 2ITEA 1FE8L 3MTRA 1AHMA 3D1MC 4ANKA 2X44D 2FVKA 2TSYA 2CPUA 2YMTA 4LT9A 4NUGH 5A3HA 1EJWC 3PWAA 4F1SA 1EWEA 3WH8A 4CADA 2JMRA 2VW6A 4LCIH 3D08A 3Q5OA 1QABA 1CLXA 4W9TA 4N2YA 5HDRA 3MP5A 2W8CA 2EC8A 2FD6H 4FLOA 3KZPA 4FQ1H 4FXLA 3UWZA 2BDNH 4K71B 5GGSY 4DK3A 4E0RA 2CMRH 5F7HA 5XIMA 3HMWH 1B3ZA 2UY3A 2E6JA 3JV5A 3AADB 2ED8A 4B9PA 5EOQH 3LXBA 3D0VB 1C08B 1A7BA 2YK1H 1E5UI 3TZVC 3ZO9A 3GMRB 3HR5A 4P9ML 1JWMB 4WSKA 1VENA 2D03H 3GXFA 5FYJE 1XGDA 5LBSA 1NANH 2FIRT 2ROXA 2OKMA 3HG1A 3OZLA 4KGLA 3EYSH 4KO6A 3W9DA 3TX4A 1VFTA 2DQJL 1BYOA 3BGMB 4X8XA 3LNPA 4QHUA 2DI7A 1J5IA 4GKNA 1UT9A 4N0FA 1B3OA 4UUIA 1LDSA 3CXHJ 3GR7A 5LHFA 1IILE 2W91A 3U4KA 1L7TH 1EFZA 3G1DA 3GXNA 1HILA 1T21B 4IOIB 4KJYA 5HYJA 1MCPL 1KQYA 4YHNB 2AAMA 3G08A 4P04A 5HULA 4ODHL 4A4AA 1IIIA 1CFQB 3MOAL 1ZGDA 3QBUA 1FNFA 4W68A 5FA4A 4FXTA 5HVGB 1JFHA 3LNMA 2EDEA 3HZMA 1HXKA 3QZBA 4M81A 4MXVF 4QNWA 3T0BA 4DF1A 3BLFA 4MA1B 4CNSA 4JRYD 4Q7NA 3CC5A 4LEBA 2VDLH 4OIFA 1HKLL 2Y5SA 4A68A 2CRIA 5FUZH 1ZCOA 5B3NA 2B59A 1R8LA 3S6TA 3OZ9L 1M7IB 2H6PA 2HX9A 4ONFH 2O61A 3JV6A 4TLTA 3QUKA 4BWLA 3QDJE 4AYBA 1PTDA 1JWSB 4HT1H 2PD5A 4IUGA 2ADFL 3KPSE 4QHKJ 3SQLA 3FQWA 5JPNB 4O02A 4PW3A 3ITGA 3PXLA 4O00A 3LBMA 3AWFA 1CICA 2GIXA 5EU5B 1Q9WB 4BK5C 1F2QA 4AQAB 1VRDA 3HPZA 5JOFA 1KXQA 3QZLA 4OCNC 2QDDA 2G30A 2D0GA 4GXVL 3VOIA 2NNXA 3W72A 5HYIA 1K6QH 1M9SA 4PMYA 5H37G 2VDNL 2JKTM 3OKLB 2V5YA 4ZUSB 2ZXAA 1U93A 5A8PA 1QBLH 1INDH 5KSBA 3C6EA 2QJNA 4LOCA 4ZXLA 5IFTA 1HOEA 1CF8H 3I6KA 3PG2A 5BVJB 4HUWA 3T2QA 4DTGH 3CHPA 1QRKA 1MMFA 3PWLB 1UB5B 3MO4A 5BO1L 4B53A 1M7PA 5G1YA 1TUPA 4ZI8A 3BQUA 5IMLB 2NPLX 1IE5A 3T6ZA 3TIEB 2VFIA 3GSNH 1OIMA 3LLXA 4HZ1A 4I5UA 1HQ4A 3C5ZB 2XA8L 4OFKA 4ZOAA 3DX0A 1BZOA 1U3HA 3F7YA 5TQ0H 1JVNA 3CLMA 2FWLB 4C58B 2VDKH 5KS9A 3LUTA 3N73A 3PAOA 3W0WE 4Q8MA 4JUTA 5D2TA 4EXBA 7TAAA 3DERA 1DJYA 4C6KA 3WHE0 1QSZA 4RW5A 2D31A 4TVCA 1P4IH 5ITBH 1HHKA 4XCNA 1BMGA 4AMXA 2GPTA 2JQXA 4GW5B 4NQCD 1J6OA 2YRPA 4PP1C 5IW1A 4DPBX 2OXNA 2VO5A 2C26A 4MWFA 3R8BB 3WLSA 1H6TA 3HZ3A 1ISXA 3GS6A 4LNRA 4PP1D 4GBDA 1O5DT 4HLZG 5GRWA 4HP5A 4MAVA 3U6RB 1XGUB 5BS0E 1RZKC 2XQYK 2PTTB 3WD1A 2PW1A 1SUXA 2DSVA 4KRZA 4DK6A 3WHXA 3ISRA 4K55A 4ENEC 1FGNH 2Z24A 1XB3A 5L8KB 2R0LL 4I0PA 3FJTA 3WO3B 1TJRA 3QYQA 4Z7WE 1G01A 5HOSA 1JHKL 4NQ1A 4NZRH 4EWJA 2X4NA 4UR7A 3LCIA 3LIZA 4KRMB 4IISA 1I2QA 2NDGA 1RPQA 4I1NB 4L3EE 3QF0A 1ED3B 2Y70A 3UPRB 1J12A 1E27B 1NP2A 4JR9H 3GMNA 1BQGA 2A3HA 1S5IL 2ZDRA 3VE9A 4PTXA 5E0QA 2UXTA 4M5SA 1HL5A 5DT7A 1I1YA 2BHZA 1VAHA 2KS0A 4GSRA 1M05A 4HMDA 1XLCA 3U48A 3IUDA 5CC7A 3QW9A 3TYGL 3HZKB 4FQ2L 1KV8A 1NEYA 1Z9PA 3O0LA 2I57A 4Q0XH 3QQ1A 3O8AA 5IM7A 2OFJA 3EBGA 2F74B 3RU8H 4GRWF 3CN0A 5TF1L 3ARXA 1E30A 4WKZA 1HOCA 4RMRA 2YAQA 5AW1B 1UMLA 1XLHA 4S1SH 1T5XB 2VGLM 2GI0A 3IGXA 3DXAA 3INUL 4ODVL 3AJXA 3ULUD 5T1DL 3AY2A 1LYXA 3H55A 4QXTA 1KLFA 4XP1H 1EC8A 2QR6A 5A2FA 3HPAA 4NKDA 1E9ZB 3ULSB 4NHVA 3LPWA 5A6TC 1FAIL 1XQKA 2VYOA 5F4XA 1XGTB 2YD3A 4R96A 4Q89A 3RGVB 2QUTA 3RLUA 4PV8B 2Z29A 1Q85A 4PRNA 2D7TL 1S2AA 4LRIC 3VD5A 4AM0B 3NM3A 2UZXB 2BNQE 3NCYP 5JQIB 5CP3H 3WMCA 3MA7B 4PLKC 4M6PA 4DJED 3B2MA 1BQLL 1AKJA 3ILPB 4HD5A 4RGMC 1H62A 5LZLA 1DBKH 1K3ZA 1NGYB 1ETA1 5GGQL 2FQGA 2V5RA 1NDGA 2FSEB 5DC4B 4ZJ9A 1XLMA 4KIRA 1VEOA 3V6OE 4LY8A 1GY1A 3R06B 5DZOA 2CLHA 2PDFA 3DH7A 5ANME 2I32A 3LIZL 1Y8BA 1E9QA 2VP8A 3EOUA 4ECLA 3I2CL 3AAMA 1KC5L 1SN5A 2PWHA 3QORB 3S8WA 2GWNA 3RB5A 1D7KA 2D7OA 1Q6CA 4LF2A 4JEGB 2ARJA 3K5SA 2EINB 4KFNA 4JRYE 2H1LM 3VXQB 2VXSL 5E51A 5D37A 1P5VA 4K9EL 5JOPE 4ABUA 4YS1A 3EDJA 4J3VA 1ZPTA 4WGHA 5I8KH 2YD6A 3WD5L 3F7KA 4WWOA 2WTPA 3FHEA 3N85H 2C13A 3EFOB 1Q72H 3QORD 1K6WA 1Q0EA 3MRBA 4DP5X 4Y9OA 4D8LA 3FQ1A 1EGZA 4QEHA 4DXVA 5DYFA 1I6NA 2PMQA 3CAFA 4N0YH 1TZIB 4X6FB 4Y7OC 2A2QT 2WB7A 5D71L 3AITA 3DI3B 4QOKE 1GVQA 3DNKA 2R0WH 2OKOA 3TT1L 1A14L 1AIZA 3L5HA 1MF2H 4PJ8D 3U0WL 4C4KO 1QD0A 1U8QA 3H0TA 2ZUMA 2DVTA 2ALWA 5GGRA 3NQEA 2TSBA 1LDPH 4KCWA 5GGUB 4AXKA 1A0QL 5I30L 2QZRA 1OCBA 4DPQA 3V52H 1MUWA 1JRHI 1LL1A 2LU3A 1IIGA 4DZHA 4L8SC 2WKJA 1NDMA 4ADTA 3K46A 2YPLD 3KLLA 2V4LA 4P2RB 2MUCA 5FJOA 4TS6A 3ZZSA 4C4BA 5I00A 4AV0A 2TRHA 4NP9A 2QQQA 4Y90A 4OGXL 5FDYA 1Y65A 4QXIA 2NY3B 5FFLA 2P9RA 2WB1A 3N13A 3TC7A 3VIIA 2Y8VA 2YD9A 4DKFL 4QBXA 3JV4B 4L4TD 4UINL 1NSJA 1EBAA 2ICEB 3L6FB 4PMQA 5EOTB 5H2ZA 1IGFH 3JUZA 1HHGA 3GMLA 4Q9CA 2X0UA 1NUNB 1A6TA 2BP8B 3HPJA 4JIEA 3PL6B 4HWZB 1XQ4A 4TRPL 4WXZA 1PNCA 4KNSA 4XWOD 4PEKA 1ME8A 7REQA 3B2UC 5EL1A 2GUOA 4ZTPH 6FABH 4XN1A 2OVLA 1SN2A 2CJSA 2FWOA 3VCLA 2QAFA 4JBRA 5CSSA 5DWUL 3ZJ8A 4NQDA 3AZRA 3QFJD 3GI9H 5BW7C 5EBAA 5ECJE 2Y7OA 4JL1A 2P5EA 2CNZA 3MNWA 4M7TA 4A8NA 1A9BA 1IGMH 2ITDB 3VRLE 1JYXA 1FX6A 3K72B 5HVHC 5D72H 5HJYA 4WXYA 1HXYB 3P77A 3CQPA 1MEXH 1MCJA 3E6FB 5I76A 2EXTA 4Q4SA 2XZQL 1MI5D 4GABA 4LLAA 3PAYA 2JKEA 4IBLT 4OOZA 2EDHA 1R3IH 3NEEA 1KGYE 3ROOA 3WIFB 5EPMA 3K71B 4QJ1A 4GRLA 1JWUA 4AC7C 1MEXL 1NDZA 1FG9C 4Y5YA 2NY5C 2P46B 1D2KA 1CCWB 2A9BA 1BXNA 1S2UA 5KBLA 5EC2B 5DA4A 3QHOA 3CQ0A 2OCJA 4Y4FC 2ZDSA 4AZGA 2ATPA 4Q4EA 1R87A 1IC4L 3F2CA 3DX9A 5KWYC 1R3KB 2QSVA 2VDPL 3RKPA 3OPZH 4PFMA 1U3ZA 4EI5D 5C0AE 1X96A 3M0JA 4IJCA 5KSVA 4O14A 4H9UA 1A4JA 3KXFA 3JBG7 2DLFH 2IDSA 1EXGA 3G3MA 3DENA 4BFKA 3NQFA 5C08B 1V8HA 2BH0A 3LJ3A 3QP3A 3EF4A 5F89A 3MCKB 3QIBB 5F1IB 3OZMA 5IB1B 2AMXA 1TKKA 2VX6A 4HK0B 2E9JA 5FK9A 1K4DB 1UWQA 2NZIA 1AGEB 3IYLW 1XH1A 3PN8A 1OFBA 4PMOA 5ERWB 1OF0A 1V02A 3B8UA 5G1TA 1OK4A 4H0HB 2Y7EA 5JQ9A 2BMBA 1N68A 4G1NA 4HHLA 3B8SA 2IW0A 2QHRH 3CPRA 4WFFE 4Z7NF 3GNPA 2E7LA 4HKPA 4RGMB 1DTUA 4X2UA 5D1ZI 3HNSL 3EG9A 4O0QA 2BSRB 1V93A 5LDUA 1LDPL 4NO2A 4U0QB 2J71A 3LZFH 3RQ3A 5HDWA 3V95A 2DT1A 4ZNEE 1UENA 3GSUA 3ASOB 2R0WL 3NIFB 4FTVE 2CBTA 3VGGA 1FXPA 1I3GH 2LQRA 1J1PL 4WI9A 4LVAA 1MJJA 6XIMA 3BDYL 4TUFA 3KBHE 4WF7A 5HINA 4LGXA 4PMXA 4RZCA 1ZK5A 4KI5E 3WDJA 3P14A 4RX0A 3JXAA 3WD5H 3FUEA 2CLZA 3T0TA 3HMCA 1Z9MA 5I3HA 2NY1B 1I8LA 2VX5A 4N8VA 5IB3B 1ZT7A 2X7LA 1KYOJ 4YWGL 5AZ2L 5BJTB 1E0WA 4ABWA 1EX5A 3UNTA 5C09E 3URAA 4QOKD 5FHBL 5DCBA 4RXGA 5EF2A 5J8LA 2EDNA 4K3DH 4U6VH 1O5XA 4FYSA 5FKAB 4E2BA 2GVJA 3X1FA 2IDTA 2WC7A 3WLJA 3AXIA 1BEYH 2WC3A 1KJMB 1EUAA 1VESA 1TV2A 3UABA 1ZV9A 2A9MH 4PMFA 4F8QA 1XL9A 1YEIL 3T0XA 4EACA 4UTMA 4EF3A 2OEJA 2J20A 1HHIA 3QZWA 1UT1A 4C7DA 4JFWA 4H8NA 3FYEB 2HN7B 1ZT1B 3MRNB 2XPKA 4N0CD 5REQB 4W87A 5D1ZC 1BYPA 2JWYA 3JWDC 2ODOA 2P3YA 1TEYA 3MGOA 2DIKA 5EZJB 2NX5E 3CV2A 2NV1A 1DJWA 3EPNA 4PP2A 4QF1A 3HGSA 2GFBA 3MP4A 4UQAA 4DFIA 3M64A 2V9TA 1HWGB 1UEYA 1I4FB 3K2IA 5IG7B 5KVFL 2NOYA 1GC1L 1KELL 2DT0A 2I1OA 3AICA 3H9SD 3VSQA 1WIUA 2E9IA 1DWHM 4Z7UA 3LQZA 2RALA 1LK2B 1EDYA 3L3GA 1Q4WA 2OZ0A 1JPST 1MRDH 4YNYB 3RG1C 2WZ6A 3AS2A 1RIVH 1YZZA 1ZSDB 1F1GA 3CHOA 3A0OA 1EP3A 3CX5K 3IDYB 4GSUA 4JUSA 3N50A 1MIML 3MROA 2UY4A 3HPXA 3NGBC 3ARFB 4P2QB 4PRHD 1OP9A 1TJIH 3ZT7A 5C6TL 1ZRUA 4AD5A 1LUCB 1XYMA 4PREB 4NXKA 4DQOL 5E5RB 1HO4A 4M8QA 3RCYA 5C9ZA 5F3HA 2YX0A 2A21A 4H9XA 1H1ZA 5JNYA 2GIYA 2L7UA 3NQAA 2W92A 4GG8A 3USBA 2CKNA 1NL0L 2YGQA 4X2RA 4U1GB 5F0PB 4G2DA 3OWRA 5EU3A 1BD2D 3TBYA 4OFQA 4B9YA 2J74A 3NDOA 3AGVA 1UD8A 3U5UA 3FTGB 1BFNA 3VDHA 4DWSD 4J3OG 3QGKC 4XKYA 1KXVC 1GCYA 1CW2A 4IL2A 4NQDD 2XYLA 5TPWH 4HPHA 4LCWA 4XE0A 1F05A 5GISH 1YBQB 3B34A 1BQSA 4H0LC 2ZX8A 4H20H 3QG7H 4HV8A 1ZPLA 1V05A 1I8KA 3QDJB 1K9DA 2CLOA 2Q3RA 2H3BA 1ZVNA 3MV7B 4WGWB 3FJLA 4J1OA 3PRZA 3X12B 3TJIA 8TIMA 4C57C 5HHPB 4X5LA 3LNGA 3IGHX 3BE1L 2MCPL 1CE1H 1JPKA 2GGGA 2I17A 3DV4B 4XP9H 4ORGA 4JN8A 1F58H 3BPWA 4GRLD 1AHWC 2Z91A 3BWSA 4PRDB 1HL9A 4C56A 3S96B 4GKZA 2P8MB 5DTFA 4HLEA 5C86A 3T7VA 5KZEA 3WUWA 2HBVA 1TETL 5C1MB 3GMQA 5JO5A 1XV8A 5IQNA 3MC5A 4GW1B