1NP0A

Human lysosomal beta-hexosaminidase isoform b in complex with intermediate analogue nag-thiazoline
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
53
structure length
53
Chain Sequence
ALWPLPLSVKMTPNLLHLAPENFYISHSPNSTAGPSCTLLEEAFRRYHGYIFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of Human beta-hexosaminidase B: Understanding the molecular basis of Sandhoff and Tay-Sachs disease
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Beta-hexosaminidase subunit beta
total genus 7
structure length 53
sequence length 53
chains with identical sequence B
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2003-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1np0A02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 1np0A01
3WL0A 3ARRA 3AIQA 2BHUA 3K8KA 2PB1A 3AHXA 2OWCA 1OB0A 2VCAA 3N15A 4F79A 2Y5EA 1HNYA 1FP8A 4NRSA 3N11A 5HNNA 2J7DA 1LL7A 5DT7A 2G8ZA 5GNYA 5AYIA 1UR1A 3CMJA 2XUCA 3M7SA 1LF1A 1US2A 3MMDA 1HT6A 4BQ3A 4QDMA 4CCEA 1DWGM 1HVXA 1ISYA 1Q6DA 1BTCA 1CGYA 1PEZA 3GNPA 3DC0A 1BG9A 1SFSA 1W9XA 1SMAA 2UWFA 2YBTA 4AZCA 1C7TA 1PX4A 3SUTA 4KGLA 2BV9A 4TX6A 4UQCA 3VIJA 1LG2A 2OWXA 1E0VA 1ECEA 2XVGA 1W1YA 3B9EA 1QOXA 2XM2A 1W9UA 1KXHA 3T09A 1VFUA 1JZ7A 5E0CA 1XD0A 3M07A 1E6XM 2XGBA 1M04A 4U5IA 1W9VA 5D9OA 1ZBCA 1B1YA 4WKHA 4JFTA 2WC3A 4LYRA 5CPTA 1JD7A 2ZIDA 4YPJA 5JBEA 5CPQA 2CCRA 4HOXA 4HTYA 3AS0A 4AW7A 1DWFM 2VX5A 1V02E 1J9YA 3AOFA 3WH6A 1NH6A 4FLRA 4UZUA 5A94A 1U30A 1W3HA 3NSMA 3FHAA 3PN8A 1WZAA 1ZB5A 4DWSA 4M56A 4CU6A 1DEDA 1CXEA 4D6GA 3AIWA 5I5RA 1ITXA 1U33A 2EPMX 3W6MA 3CZLA 3M6DA 2WBGA 1KXTA 1KBBA 2EXOA 4W8BA 4MNKA 3GZAA 1NWRA 4FLSA 4D1IA 1Y7VA 1EH9A 2BY3A 4UNIA 3T0AA 1J0IA 2VZUA 1GJWA 3IAPA 1W9DM 3AHVA 4H7VA 4AZCB 2W63A 1U2YA 4D6DA 3ZIZA 2NSXA 2ZX9A 3KEHA 3EMZA 1GOOA 2YLLA 3QHNA 1C90A 5E0FA 1EHNA 4AC1X 3CIVA 3PTMA 4H41A 2WMGA 4L4OA 3GXDA 4CN4A 2ZWZA 4D1JA 5A6MA 1JAKA 4WKAA 2ZX8A 1BG4A 4JCMA 3PZOA 1TZ7A 2W61A 3ZT6A 5C70A 2VC9A 1D7FA 2BFGA 1LWJA 1UR9A 2GK1B 1JYNA 1HX0A 1UKTA 1XGZA 4GI6A 1RH9A 1V3KA 1OGSA 3DYOA 3OLGA 4P7RA 5HBFA 3WDPP 5A3HA 3DECA 1RPKA 3CUFA 1QW8A 3AXXA 2WCSA 2WLZA 3AISA 2AOSA 1WPCA 4W93A 1VFMA 2V3FA 4AIUA 2ZUUA 3APGA 2DQXA 4GI8A 3VGGA 1JYVA 3A4XA 1GHRA 5A6AA 1CBGA 3L2LA 4ZENA 1GQKA 3PZ9A 4S3JA 3TTSA 3CZGA 2FH6A 2X1IA 1RP8A 3THDA 2XVLA 5DEZA 4YHGA 4YN5A 4GZJA 3THCA 1JYXA 2PWHA 1GOWA 1CGVA 2BNJA 1M01A 1QVBA 2GUYA 4W85A 1KWKA 1HKIA 4D6EA 1CXFA 1E6QM 2CERA 2CKSA 1UA3A 4JIEA 1ITCA 1TFVA 3CH9A 1LJYA 1VRXA 5ABFA 4J7RA 3BAWA 3AS1A 3RO8A 3WF1A 2WVSA 5JIPA 1W3JA 2VRQA 3SURA 4MADA 4LQ1A 5LYRA 1SMDA 1EQPA 3PZIA 4D6JA 4C7GA 2WM0A 3WUFA 4E8DA 4MNMA 2YL6A 1QI3A 1D3CA 2Y8KA 2V5CA 1EQCA 4TUFA 1OGGA 4IUGA 3AZTA 3WBEA 2B31A 1E0XA 1V0MA 1UD6A 3G6LA 3TOPA 4LPCA 4K68A 1HJSA 3T0BA 4ZE5A 1ZJAA 4AZ7A 4R27A 3OZOA 3SUSA 1ZJBA 1J0KA 1KXVA 2CKRA 2QV4A 1K9TA 1KGWA 3AIUA 2D0GA 1WKYA 1BVNP 3SCVA 1QI4A 4C7DA 2ZXQA 4HMDA 3VM5A 4W84A 4UQAA 2J7GA 2D2OA 4E8CA 1WP6A 4W5ZA 3POHA 3SUWA 4WKFA 2Y4SA 4BQ2A 4PBGA 4UFIA 3WL1A 3WDIA 3BLPX 3ARWA 3AFBA 1W9PA 1K6AA 1B0IA 4P7OA 3VIHA 3NYDA 1JZ8A 3PHAA 3GH4A 3O9NA 1V6VA 3WUEA 3VM7A 3VIIA 3CGTA 1OD0A 3VNYA 3RM9A 8CGTA 5EBAA 2V38A 3F5JA 2IXVA 3FAWA 1E1EA 1JG9A 3IJ7A 4QCFA 3MUZ1 3PZUA 2XIIA 1CZ1A 2UY5A 2AMGA 3AIBA 1J0YA 4ACZB 1UOKA 4NF7A 3O2LA 1WO2A 2UY2A 2EPNA 4LXFA 1E5JA 3GTNA 1N82A 3HMCA 3I3BA 3AMCA 3T0DA 3ECQA 2W62A 2F2HA 3CZJA 1MW1A 2WZIA 4MDPA 5HXMA 2CIPA 1E73M 3AYRA 1GOQA 3WNPA 2WBKA 2WCAA 2DT2A 1UA7A 2YA0A 3J7HA 3CPUA 1TCMA 3EDDA 1VBRA 5A8MA 5AYBA 2C8NA 4ATDA 4ZE4A 5KZ6A 1P6WA 3WKZA 3WNKA 2XTKA 4MJ4A 3WY1A 3GDBA 1OD8A 1UD5A 2WHMA 2PBGA 2Y2WA 7TAAA 4AY1A 3WNLA 3K8LA 3WF0A 3BAKA 2D20A 2XWEA 1A47A 4ZXLA 1NM9A 3UETA 2WHJA 4HZ8A 4PEEA 1C92A 2BY1A 4H04A 5C8BB 3VGBA 3WSUA 3CMGA 2PWDA 1HKKA 2CETA 3MMUA 3HJEA 2WLYA 1M7XA 1MWOA 5A2AA 3SUUA 1MFUA 1DP0A 1PIGA 1K9DA 2G4FA 2CBUA 1GZJA 1HJVA 1UKPA 4W88A 1JZ6A 1CYGA 3MV01 2BVTA 2CPUA 5ABHA 1CGXA 4A3YA 2QLYA 1WZMA 3VD5A 4PCTA 1JD9A 5E6ZA 4F66A 1OT2A 3VGDA 5LA0A 1AQ0A 1V0KA 1R85A 3RM4A 2HISA 5I78A 1G9HA 1NWSA 2WAGA 2XSAA 3VO0A 1H49A 4RL3A 2VNCA 2J75A 3ARVA 3L4TA 3RIKA 1HKMA 1UZ4A 3WDRA 2WHKA 3SCRA 4UOZA 1JFXA 4W5UA 4HOWA 4ATLA 4PMXA 1F4AA 1UD4A 2X0YA 5BCAA 4JCLA 2CITA 4AWEA 1VF8A 3K4DA 2ZUSA 5JUVA 4TVUA 2A3CA 3PTKA 1ODZA 1UR8A 4AD5A 1JL8A 2VMFA 1O6IA 2DSZA 2FGLA 1X6LA 3ARUA 4TTUA 3AMGA 4PTWA 1B9ZA 3A47A 1NARA 2Z1KA 3OGVA 1V0LA 4P8XA 1OCQA 4Q7NA 1ZBKA 2EJ1A 4P8VA 3U5UA 4EAMA 4PMOA 1TA3B 2J7EA 1YQ2A 2ZE0A 4PMZA 3HU7A 3QR3A 1W2VA 2VX7A 3N1AA 2E9BA 5IFTA 3FAXA 1E56A 1XHGA 4HOZA 4AMCA 5I3DA 4V28A 2VZSA 2WKGA 2IXUA 3T2QA 1DWAM 3NUKA 5DMYA 4RE2A 4ACYA 4TOQA 2VVSA 1K9EA 1CNVA 3KE0A 4V27A 1BF2A 2E0PA 3T2PA 3BAXA 5M3WA 4D72A 3WQ5A 3WD1A 1BYCA 1IT0A 1XSJA 2D0HA 3AICA 5CQ1A 7CGTA 2F61A 1PJ9A 3VUPA 2V5DA 4AYSA 3BAIA 4LYQA 4XZBA 4TTGA 1IV8A 1DTUA 4IM4A 3VDAA 3OZPA 3W24A 1V6UA 2BXZA 1CTNA 2E9MA 4FK9A 3N12A 4CD8A 1ISZA 3AIRA 3BAJA 3MU7A 5BRPA 3W53A 2W91A 1CWYA 1K9FA 1EGZA 2OSYA 4HMCA 5HOSA 2WANA 1QI0A 3MO4A 1JXKA 1J0JA 3ARTA 3WBAA 3CZEA 4ACZA 2EPKX 1ISVA 2OLHA 1J18A 1GOIA 5CPSA 3ARSA 1VIWA 4MNLA 3L2MA 5DO8A 2CHOA 1TE1A 4KRUA 3BMVA 1W9BM 1G01A 2A3EA 2W67A 5C71A 2WSKA 3AS3A 4GQRA 3GH5A 2XG9A 2G3JA 5LA1A 1MXGA 2YDSA 1E71M 2VRKA 1TG7A 3VILA 1NP2A 4IISA 5D4YA 2A3BA 3B9AA 2VX6A 2XSBA 1R7AA 3BC9A 4Z2LA 4JFVA 2VTFA 3GBDA 3AIVA 4DUXA 3KL3A 1LG1A 3ARQA 5EMYA 4JZ5A 1OM0A 4D6FA 2J62A 3VDHA 1BYDA 3OIHA 3S6TA 3CHDA 2WNWA 4JKKA 1EO7A 1JDDA 3ARZA 1QNPA 1JI2A 3GH7A 2FHBA 2YA2A 1NOUA 1E70M 3U5YA 1QHPA 3GXIA 4CD7A 4YHEA 3I3EA 2PF0A 2YLAA 2O9RA 1UUQA 5TD4A 1W32A 3AMDA 3SCWA 5IHRA 3GXFA 5FL0A 2EQDA 3OB8A 1Z32X 5GQBA 1CENA 3W28A 2QPUA 1FOBA 4AD4A 4QFUA 3OGRA 4M24A 1BLIA 5CJ5A 1XSIA 4XV0A 3FY1A 1E4LA 2GDUA 1EO5A 4M80A 3RJXA 2ZXBA 1JGIA 1E6NA 1KR0A 2ZXDA 2W66A 1XH2A 3AROA 4IPNB 1AQHA 4UOJA 4UQBA 4PSRA 2ZX6A 3ZT5A 1XH1A 5CXPA 5CGTA 4UQEA 1UH3A 4JHZA 1MFVA 2GDVA 4ML4A 4HPGA 1V6XA 1GNXA 3A3HA 1L0PA 3VPLA 3WF2A 5I79A 4OOUA 1H09A 2VT0A 1JNDA 5M17A 3IK2A 3WEOA 4HPHA 2EPLX 1FP9A 1UD2A 2XVKA 1MW3A 1V3LA 4B3KA 2YL5A 4J3VA 3VGFA 1MXDA 5BXSA 3EDEA 4AEFA 2WVUA 1J10A 2CHNA 1X6NA 3RPMA 2VURA 4PSPA 5I77A 1QNRA 4FLOA 1FH9A 3AI0A 1FFQA 4Z2GA 3QOMA 2XHYA 1TA3A 3VDCA 4OBRA 2MANA 3N17A 4WLCA 4BCEA 3U57A 4AZHA 3VIMA 4PMDA 3PZQA 2WVVA 1JZ3A 1XCWA 4H8UA 2WC4A 3ZR5A 3ARYA 4ATWA 5IHSA 3OGSA 1KR1A 5I23A 1CXLA 5BXTA 3TP4A 1EOMA 1XRVA 3M46A 3ZQ9A 1H0IA 2GK1A 3ZT7A 3BLKA 1H5VA 3NDYA 5DT5A 2G3MA 2D1ZA 2DDXA 3VNZA 3EMQA 4BZYA 1UG6A 1OIFA 2QPSA 4XX6A 2XJ7A 4EKJA 2XVPA 3RILA 2WMIA 1EXPA 2WWCA 3WQWA 2C0HA 3WELA 4F9JA 3SIMA 5GNZA 5D9NA 3F5LA 2BVDA 3GNRA 4GXPA 3S2CA 1W91A 4R5EA 4HZ6A 1MQPA 2WZEA 4PCSA 5A2BA 1Q4NX 1V03A 4J27A 1V08A 4KGJA 2C7FA 3U7VA 4UFKA 1KGXA 5BXPA 2ZUWA 1J0ZA 3QOKA 4KRTA 2YJQA 2OYLA 4MB1A 3EDJA 1BAGA 2JALA 4CVWA 3NSXA 2J25A 3PBGA 3ARXA 3A4AA 1W1TA 3F4VA 6TAAA 1US3A 1UWTA 1J12A 1GUVA 1HF6A 4TX8A 1V6YA 1G1YA 1ZBVA 1PZ3A 4GKLA 3F5KA 2D0FA 2WB5A 3WD0A 5D9PA 3AXIA 1KFWA 1LLOA 1AQMA 1H3GA 1PZ2A 4Q22A 4P8UA 3OA5A 1MQRA 1GVYA 3D5HA 1XV8A 4ZEPA 2DGAA 1UWUA 4QAWA 2G3IA 3EDFA 4ZXOA 3N18A 1UKQA 4RE3A 1UD3A 5ABGA 4AZ5A 5CGMA 3AMKA 1Q6CA 2D3NA 4JL1A 4A3HA 4UCFA 4JKLA 1V3HA 4PMUA 1ZL1A 2D3LA 1UHVA 3N13A 1CGTA 3MUY1 2DIEA 2YA1A 1H1NA 3NCOA 3SCNA 1E6PA 1KQZA 4U33A 1UWIA 4CCCA 1E0WA 1W1PA 1KQYA 5A69A 3KL0A 2J8GA 4PYSA 3VMOA 3WH5A 4EE9A 2ZWYA 3VVGA 4H8HA 1V3JA 2NW0A 1JFHA 4L4PA 2E9LA 4LGXA 5A8NA 1V3IA 1H0GA 2JF6A 3NIYA 1J01A 4GIAA 1WAWA 1V6WA 3RCNA 3OG2A 3ZMRA 1W1VA 1QI2A 2BS9A 3FW6A 2HVMA 3QHMA 3AJ7A 3W29A 4TXEA 2PC8A 4WJXA 3JUGA 2QMKA 1B3VA 3II1A 3I3DA 5AC4A 3W0KA 2Y24A 1GHSA 1R86A 2VUYA 4M81A 1E4IA 2XWDA 1BSIA 1QNQA 2NT1A 4EANA 2ZUMA 4AXNA 5FKYA 1ODUA 4DWSD 3W37A 1WB0A 1H41A 1RP9A 2X2YA 4KMQA 1FFRA 4W7UA 1GCYA 1VAHA 3UESA 5JIWA 2FHCA 4W8AA 5D8ZA 1YHTA 4MPKA 2J47A 1H2JA 5A2CA 3BAYA 1X1NA 5DFAA 3BCDA 2W92A 1PAMA 1EA9C 2DT3A 4OOZA 1I1WA 2ESCA 3W38A 1ISXA 4HA1A 4F8XA 1JAEA 2PBOA 4PRWA 3AHZA 1HP4A 1E55A 4U2YA 4CCDA 4OJYA 2OSWA 3VDBA 4W7WA 1VJSA 4DWSC 1LL4A 4DM2A 3WUGA 1QW9A 5GNXA 4PUDA 2A3HA 1NWTA 3PZTA 3ALGA 2EEXA 5EB8A 1C8YA 3CZ8A 1G94A 1GOMA 1BVZA 3UR7A 4Y7EA 3IANA 4JFWA 1E3ZA 2E40A 3WENA 1UD8A 4D71A 2BHYA 1AMYA 3MANA 4W7VA 1XCXA 1QI5A 3AZRA 4XB3A 4Z2HA 1E40A 4AEEA 1Q6EA 4UTFA 3L4VA 2EBNA 4GINA 6A3HA 2CBJA 4AZIA 3VU2A 1VFOA 4B3LA 3HN3A 1QPKA 2XPKA 3WD4A 2VZVA 4CU8A 2O9TA 2VZOA 1OWQA 3D3AA 2JFEX 1JIBA 1UZ1A 4GQQA 1KBKA 4JAWA 1GQIA 4PTVA 3UG4A 2GJXB 4BA0A 4CN1A 4WIWA 1LQ0A 1FHDA 1XSKA 1HL8A 2DT0A 3ZJ7A 3SCUA 1OINA 2CBVA 4PTMA 2ZUVA 3K8MA 1E3XA 5GPRA 5ECUA 3RDKA 3ZJ8A 3L4YA 3UCQA 1CXHA 1PBGA 2PI6A 1CECA 4UOQA 1KXQA 3VINA 1WE5A 1WZLA 2O92A 2FH8A 4MB5A 3L4WA 2YDQA 1QNOA 2ZXAA 4TVDA 4PMNA 1NQ6A 3A4WA 2FGZA 3BSGA 3L4ZA 3W26A 2WXDM 4GI9A 2D23A 1B3ZA 3OLEA 5BXRA 1BQCA 1EDQA 1NOWA 2QHAA 4AISA 1HIZA 5A6BA 3AMLA 2WC7A 3NJ3A 3CHEA 1VEOA 4D6IA 2YIHA 4QP0A 4MTVA 2X8RA 1HL9A 1S46A 1H11A 4B9ZA 4Z2IA 4Z2KA 2E8YA 2RGLA 3NDZA 3BSHA 2E8ZA 2W5FA 4JKMA 4UR9A 3TTYA 1UWRA 1UKOA 1UYQA 3N04A 3AXHA 3WNOA 4GPNA 3WQ4A 1PX3A 5E09A 4CGTA 3BCFA 1M53A 3EYPA 4UFHA 3K4AA 4NI3A 4AZ6A 5A6BD 3SCPA 1FH7A 4OBSA 4OZOA 2CEQA 4GZEA 1M03A 1WDQA 3KWXA 1RD6A 4OUEA 3ZO9A 1W3KA 4W8LA 1VENA 1C8XA 1KGUA 2BY0A 1GVIA 2BXYA 3ZSSA 1LL6A 1EDGA 4HA3A 1GQLA 2DH2A 1E15A 1MVYA 3PZMA 5ABFB 1B3XA 3MS8A 4NSBA 3UG3A 3ZM8A 5CLTA 1E6RA 2BHZA 2VJXA 4GZIA 1HJUA 1KB3A 2V3DA 5CG0A 1VFFA 5A8PA 1JI1A 2FHFA 3ZSTA 3EMCA 4P7QA 1WCGA 3FXYA 5FCZA 3MKKA 1BHGA 4J3WA 4D6CA 4PMYA 2QF8A 4DWSB 4Z2JA 5CZKA 2EO7A 2JEQA 1PX8A 1HN1A 1OSEA 1R87A 1UKSA 3W27A 1W2PA 2WCGA 5JBDA 4AIEA 1SYTA 3BMWA 4AD0A 4V2XA 3KL5A 1B90A 4HU0A 5FIPA 4CD6A 4DM1A 3VGEA 2VZTA 5A6KA 1JYWA 4N42A 1R8LA 2DSVA 4D6HA 1QHZA 2VI0A 1BPLB 3B8SA 4FMVA 2EPOA 2XGIA 3W25A 1TR1A 4CN6A 1KCKA 4WF7A 3MSGA 1CLVA 1UH4A 5FD0A 3GNOA 2W4XA 4ZFMA 1NOFA 1GQJA 4XZWA 2F8QA 1KWGA 1UWQA 4BS0A 2PWGA 3W4RA 3WEMA 2WZHA 2VR5A 1G5AA 4AZBA 1DWIM 1NWUA 3AIEA 1Q6GA 3VKKA 4JFUA 1C7SA 3VD4A 4M82A 1JXJA 4CD5A 1CPUA 2DPEA 3WH9A 4C7FA 1MW0A 2ZICA 1V0NA 2J8FA 1PPIA 5A8QA 2A3AA 3VIKA 3A6OA 1ZS2A 2XVNA 2D22A 1PIFA 4J28A 4FF5A 4OKDA 4AD1A 1ESWA 4WK9A 1MYRA 4X0VA 1E9LA 3SUVA 3WNMA 1E4NA 3DYMA 1EIBA 4U31A 9CGTA 1UQYA 4MB4A 3QGVA 3OLDA 3CO4A 5I2UA 4JL2A 4BQ4A 1TVNA 4UZSA 4A4AA 4HP5A 1XD1A 2VOTA 1J11A 1UQZA 2VL4A 1IZKA 1B31A 3WD2A 2PWFA 1CGUA 3TONA 5A8OA 4NZCA 3VIPA 2GJXA 4PMVA 1J0HA 1E1FA 5CSYA 2E3ZA 5BRQA 2DSWA 2XM1A 2YL9A 3WFLA 2YBUA 1V3MA 1F4HA 3EBVA 3WFZA 4W87A 4OIFA 2Y8VA 1JZ2A 2OSXA 1E6ZA 1ISWA 5FL1A 2QMJA 4QLJA 4E4PA 1ZU8A 3LPOA 1HJXA 5CLWA 2YL8A 3WEZA 2VX4A 3KZSA 4U3AA 4J3UA 4CUCA 1JDAA 4AD2A 4M8UA 1OGBA 3DHPA 4QCEA 3LMYA 4XUYA 1XYFA 3BXWA 2J7FA 5CSUA 5HPOA 2IUZA 3ZJ6A 3PZVA 1C91A 3FNDA 1JF5A 1HP5A 2J7CA 4W89A 1B30A 5AC5A 2WMFA 3UG5A 3TTOA 1HXJA 2J7BA 2VR4A 4PMQA 3O6AA 4CKQA 4UFJA 4J3TA 4KWUA 3BGAA 5E6YA 3VTRA 7A3HA 1FH8A 2DSKA 1GJUA 1JDCA 4WSKA 4HU8A 1BYAA 5E9AA 5JBFA 1XC6A 3LPFA 5BWFA 1C93A 1CLXA 1UH2A 3ARPA 4S3KA 3VMPA 1MW2A 1EHAA 2VRJA 1UR2A 5M5DA 3WDQA 1C3FA 3ZOAA 3WN6A 1OIMA 4HMEA 1GW1A 1E4MM 2DH3A 3SEPA 1E72M 1WDPA 2OWWA 4KH2A 3AS2A 3WDHA 3SCTA 3CUGA 1O7AA 4DUWA 3UEQA 2WSPA 3T2OA 1LWHA 2GJPA 4E2OA 1R7OA 3VD3A 1UR4A 1B3WA 1TMQA 2ZUTA 1VBUA 4IPLA 2X09A 5A95A 4WSJA 3AHTA 4PUEA 5A6LA 3PZGA 1BGGA 4MDOA 1GOKA 2CXGA 2WPGA 3T08A 2UY4A 3W6LA 3CHCA 4J3XA 1CXIA 1D2KA 3K1DA 3EDKA 4TVCA 4URIA 1FHLA 2WMHA 2OYKA 4UFMA 2V3GA 1JZ4A 4CVUA 3RMEA 3AQUA 2XFRA 5IXEA 3NSNA 2XYLA 1CIUA 2GSJA 4X9YA 4B9YA 2ZX7A 1VEPA 3B9DA 5E70A 3L4UA 3VIFA 2J79A 3LPPA 4UQDA 3GYCA 5HDRA 3GBEA 3WUBA 1WZKA 2WYSA 5HPCA 1C8QA 5A1AA 1E6SM 3RM8A 3CZKA 2Z1SA 4U5KA 1UR0A 4PTXA 1QBAA 3G6MA 2J74A 3GXMA 2DSUA 2BY2A 3K46A 3AHYA 5AY7A 1FA2A 5DF0A 3VOCA 3WMCA 2ZUNA 1TVPA 2ZOXA 2CBIA 1VEMA 3CBWA 4DUVA 1EOKA 5FOOA 4B16A 4BQ5A 1EDTA 2O9OA 4MNJA 6CGTA 2JE8A 1B3YA 2XFYA 3W82A 3WIJA 1E5NA 2XIBA 4JFSA 1I75A 5BYWA 3VD7A 1GPFA 2X0HA 3CLWA 5I24A 2WHLA 3LPGA 5M03A 3WH8A 2G3NA 1XYZA 4W86A 4GO8A 5F7UA 3WQ6A 2JF7A 1W3LA 5A6JA 3VGHA 3VX0A 5BROA 3VIGA 1VB9A 3BH4A 2E4TA 3MUAA 3N9KA 3U7BA 4GO9A 2DIJA 1VJZA 2JIWA 1CGWA 3UERA 4QLLA 1AVAA 5KEZA 1QNSA 4HZ7A 3ZR6A 1WDSA 1MQQA 1OBAA 3UR8A 4P7LA 4MAVA 2J4GA 2FDMA 3PTQA 4C90A 3DYPA 4NRRA 5I6SA 2WMIB 5EFFA 1V02A 5IFPA 4M1RA 2VVNA 4H2CA 3L4XA 2CNCA 3CHFA 1XH0A 3ALFA 3VMNA 1H4PA 3PZNA 3SCQA 1KCLA 2VCBA 4P8WA 1GONA 2WMKA 1I1XA 5I0DA 5IDIA 4CD4A 3OLIA 4RE4A 4QLKA 1CEOA 2VQUA 2ZX5A 3MV11 3FHQA 3POCA 1Q6FA 3RJYA 2NT0A 2PWEA 4PMRA 1JZ5A 4LYPA 4HA4A 3MMWA 1WNOA 4AZGA 2GFTA 3DHUA 2Q8XA 1BGAA 4MAZA 4M29A 4H8VA 3SCOA 1NP0A 4PN2A 4FLQA 4AD3A 2O9PA 3IJ9A 2OYMA 2WVTA 2YKKA 1E43A 3WQ8A 2WMJA 1L8NA 3GM8A 2UY3A 4BF7A 2WW5A 1JNEA 3AZSA 1JF6A 3W81A 2CYGA 3TA9A 4U3CA 4U2ZA 3WMSA 3ZJKA 5A6SA 1HJWA 1DHKA 2GVYA 3MUIA 2V3EA 2G41A 2WKLA 3CUJA 3WQVA 4CU7A 4J3SA 3VX1A 1CDGA 1B2YA 2VCCA 2D24A 2BVYA 2VO5A 2AAAA 3WNNA 1QBBA 8A3HA 1SR0A 4JHOA 4MJ2A 2J77A 1HVQA 2DT1A 4B15A 1HKJA 1QHOA 1WDRA 5LA2A 1GORA 2J78A 2WK2A 2WWDA 2J7HA 3VD9A 4LX4A 3WMBA 3WF4A 1ZBWA 3WH7A 4C91A 1TUXA 1DWHM 2YDRA 1OT1A 1UWSA 5EFDA 1BYBA 3WD3A 4N0RA 4P7NA 3WDJA 1A3HA 2RGMA 1CXKA 2YOCA 2JEPA 4UFLA 4UQ9A 3WF3A 2CESA 3IJ8A 3MSDA 3CUIA 2X05A 4EK7A 5ABEA 3OBAA 1DWJM 5D8WA 4MB3A 3SCSA 3CUHA 3QHOA 4F9DA 1BFNA 1IZJA 2XFFA 2GJRA 2JIEA 2TAAA 3AYSA 3IAQA 5D9MA 2WVVB 1HJQA 2VQTA 3CTTA 2DEPA 3TTQA 3VIOA 4X0NA 3FN9A 1G0CA 4AIOA 3E1F1
chains in the Genus database with same CATH superfamily
2BTMA 3SN4A 2VEFA 1JUBA 3AIQA 3B0YA 2BHUA 2TYSA 3NYZA 4O50A 2Z2BA 3N15A 1ME8A 2Q8LA 3N11A 1LL7A 3E2QA 4DLMA 5BOOA 1UR1A 3LLXA 1EPVA 1XPYA 1MRQA 2HSAA 3NPWA 3M7SA 3P2VA 3GNXA 1KM6A 3MJYA 3WX7A 4RLIA 1S1RA 1YTKA 1HT6A 2CFFA 4QDMA 3TH6A 4CCEA 4RW5A 3CMFA 2RDTA 4LVGA 3B04A 4LAUA 1CGYA 4RZ5A 1O1ZA 3BG3A 5EMKA 3C0SA 3I6TA 3W7OA 4TX9A 3SUTA 4AY8A 1A5LC 1W3TA 3CC1A 3T4WA 1IF2A 5TQLA 2V2HA 3GLCA 4IGSA 4QX4A 3B9EA 5K9XA 1GPWA 1W9UA 3O06A 3MZ2A 1RJRA 1VFTA 2PZNA 4U5IA 2BODX 4XTDA 2SFPA 4WKHA 3W75A 3GE7A 4O53A 5KMYA 1UMYA 5CPTA 3UCDA 5JBEA 4UWMA 4I9TA 4HOXA 3KOZA 4HTYA 3AS0A 2VX5A 1XLLA 2WJEA 3BLOA 3AOFA 4O18A 3VCRA 4H6RA 5D02A 1U30A 5CC7A 3OZMA 4M56A 1DEDA 3QM3A 2EKGA 5LIWX 3LA4A 2EPMX 2DVUA 4ONVA 3CZLA 2EXOA 3PP7A 4W8BA 4Q4KA 3GZAA 2GOUA 2ONEA 4UNIA 1J0IA 1UPMB 1YX1A 1KO0A 2FVLA 1OCNA 3STGA 3WJXA 4AZCB 4OBTA 1XRSA 4H3DA 3KEHA 4UTJA 3QFEA 2YLLA 3TXZA 1DJXA 1KRCC 2Z27A 1YTDA 3OHMB 4AC1X 3VNMA 1GG0A 2ZWZA 5A6MA 3QYSA 2E25A 1XINA 2WJDA 1TZ7A 5BWAA 1CLKA 2W61A 3ZT6A 2VC9A 2BFGA 2JKEA 1R30A 2DUXA 4E2BA 4UTTA 1I0DA 1ALDA 1UKTA 3EKLA 3UYCA 1DIKA 3FCPA 1Q63A 3TYAA 3PG8A 5CH9A 3QW3A 2V69A 3WYZA 3D0CA 1QW8A 4LCQA 3VNKA 2AOSA 2TPSA 1WPCA 1VFMA 1QK0A 4AIUA 4TV6A 4M19A 4LOCA 4G5DA 4NASA 5A6AA 1CBGA 3PZ9A 4X9SA 1OFAA 4M6PA 3M0VA 4M7TA 3H4GA 3GG8A 4YN5A 3THCA 1CGVA 3KRZA 1SUXA 1TJ1A 1GEQA 4RNJA 4H01A 1IGSA 3V5OA 1OFOA 3GFZA 5JVLA 2CERA 5BMXA 4MZYA 4JGDA 4QEHA 4EPKA 1DPMA 5ABFA 1VRXA 3DCPA 3AS1A 1VBHA 1R38A 3EAUA 3TYEA 4GISA 1I2RA 1QCWA 4GUFA 1UUOA 3U2OA 1SQ7A 3UZXA 3WUFA 2CZEA 4E8DA 4MNMA 3GW3A 2QJJA 1D3CA 1NF0A 1YE6A 2BOEX 4IUGA 3WBEA 1E0XA 3KOYA 3GFYA 2OGYA 4K68A 1FWEC 4J3ZA 4HNVA 4HPJA 4BR1A 3MSRA 4AZ7A 4HYWA 4R27A 1FWWA 1RCXB 3OZOA 3SUSA 5CPMA 1A5OC 4E3VA 3FJ4A 3W7CA 3NL5A 4C65A 5HULA 1KGWA 5G1MA 5J04A 2D0GA 1BVNP 1QI4A 3MQTA 1XIDA 4W84A 4UQAA 3W74A 2J7GA 2A79A 1D8CA 5CPNA 3SUWA 1J5TA 2Y4SA 4BQ2A 3P5ZA 4PBGA 3WLJA 3WL1A 2Y7EA 3WDIA 3VYLA 3GDLA 2VKZG 3AFBA 4XQ6A 1R3SA 3PHAA 1F3EA 1V6VA 3G1XA 7REQB 2XU2A 3VIIA 4OECA 3VNYA 2XINA 5T26A 5EBAA 2FZNA 3UY7A 4RV8A 2V38A 4KWSA 2TRSA 3RUBL 4QCFA 3PZUA 2UY5A 2AMGA 4XIAA 1KLYA 3NQBA 1PYMA 4UIOA 4NF7A 3IGSA 1S39A 1WO2A 1K77A 1OYBA 3GZ3A 4FOKA 2HV5A 1WOAA 2PDXA 2UY2A 2DZWA 4LXFA 5F1VA 1XKJA 1E51A 3ME3A 1N82A 3M5VA 2QJMA 2W79A 1UC5A 2WBKA 4JTSA 1UA7A 2CU0A 3GK0A 2Z26A 1FDYA 3OODA 5A8MA 5AYBA 4ENLA 1SR9A 5HWMA 3BQ6A 4AY7A 4K38A 3WY1A 3GDBA 3PBYA 4JN7A 3T81A 1UD5A 3RU6A 2QV5A 1FDJA 3G1YA 2BOGX 3BAKA 1VH7A 3ATYA 2D20A 2HCVA 3BQ5A 1NM9A 2OEMA 4HZ8A 1PIIA 1XRTA 4PEEA 4S39A 4DXVA 3FEMA 2HRWA 5I3HA 2R14A 3E0LA 3UXLA 2REQB 1WUEA 2V5BA 3FDGA 1HKKA 3NQ8A 5DMNA 3T0CA 1MWOA 2QT3A 5A2AA 1TSIA 1PIGA 4H00A 1XBYA 4LV4A 1FWCC 1FDZA 2G4FA 3PFRA 4C6FA 4E5TA 3VOFA 4JIHA 1CYGA 1V51A 4BK9A 1RAKA 2VFHA 2R1MA 2QCGA 3VD5A 3T44A 3NDOA 3RRXA 5E6ZA 4D2JA 4POCA 1TIWA 1XFCA 1AQ0A 1T96A 1R85A 4FO4A 3AO0A 4RL3A 2VNCA 3KS5A 3RIKA 2NQHA 2WHKA 2Z29A 1JEZA 2ACSA 1GG1A 4W5UA 4I9AA 4HOWA 1P6BA 2PDJA 4GY1A 5BCAA 4JCLA 2CITA 1TV3A 3K4DA 4ICNA 2ZUSA 1LBFA 5L6UA 4TVUA 3UWYA 2A3CA 3UJ2A 3FDKA 3M47A 3MI3A 3THUA 4TTUA 2V81A 1QOPA 3H23A 1QNVA 3A47A 1NARA 4ZO7A 1QATA 2Z1KA 3OGVA 4ML9A 3MC5A 1V0LA 5ENLA 1OCQA 1OQFA 1N7KA 3IK4A 3U5UA 4EAMA 2VD8A 3FFSA 2R1PA 2ISVA 1L9WA 3QTPA 2PWUA 3G18A 4DZ5A 4ZCWA 4PMZA 1XIMA 5LKYA 1XIJA 3QR3A 1W2VA 4JICA 2E9BA 5FA5A 1E56A 4AMCA 2WKGA 5HMFA 1DWAM 2GDQA 2OXNA 4RE2A 3P7YA 2OMAA 4AVNA 2V5KA 2YW3A 4LF1A 4ZVJA 3CB8A 4V27A 3AWNA 2PGFA 3BAXA 2DW7A 3U48A 3A3XA 1P0EA 4D72A 4S3CA 4N9DA 2QYGA 2A2IA 1AJ2A 2D0HA 4WUIA 7CGTA 5K3VA 2V5DA 2F84A 3BAIA 5LNWA 3WLTA 4Q4MA 1TPEA 1DTUA 4M1BA 7REQA 3OZPA 4FK9A 2BXZA 1CTNA 4GA8A 4MHBA 3R94A 1L2UA 4NI8A 3W7GA 4GGHA 4NZ5A 3BAJA 3MU7A 5C9UA 1K9FA 2XFWA 4D9PA 4HMCA 4HKPA 4R34A 1UPPA 1QI0A 3LQGA 5AC7A 2Q8ZA 4YS1A 2OLHA 1J18A 3WLLA 1VIWA 4MNLA 4E4FA 4JTAA 5DO8A 2CHOA 2OO6A 1SZNA 4IIBA 3TOYA 1EFZA 5C71A 1HO1A 4GQRA 1JPMA 1E71M 3P84A 3VILA 3M0YA 5D4YA 4ORMA 2A3BA 1YDNA 1R3TA 2XSBA 3B9NA 4O10A 4B2DD 4JFVA 4IMAA 1OJXA 1DJHA 3GBDA 1JPHA 1I4NA 4MUPA 1UMLA 4ZO6A 1KV5A 3ARQA 5EMYA 3T07A 3EEZA 2QNEA 4JQ4A 4H4IA 3DIPA 4GQBA 4G7EB 2YA2A 1NOUA 1E70M 4CD7A 2PF0A 2INFA 5C9ZA 1IXPA 2QJGA 3C5QA 1GTEA 5FF2A 5TD4A 5REQA 3SCWA 2UV8G 1I9CB 5FL0A 1SW3A 3QR0A 4HN4A 1Z32X 5H6HA 1BWLA 2QPUA 1YBQB 3G3DA 2VDIA 4FP1A 5BOFA 3FY1A 1FVPA 3TYBA 4X60A 2GDUA 4M80A 2VYOA 2ZXBA 2A7PA 3S9ZA 1LRQA 3HPFA 4JDBA 3UPBA 3M0ZA 4FNPA 4PSRA 1U5VA 5EKYA 2GGJA 1F73A 1XIHA 5LIUX 3UG8A 1NJJA 4QQUA 4ZBCA 1UC4A 5H2ZA 1J79A 2UZ9A 4ML4A 1OX4A 3HV9A 2H6RA 3VDGA 1L0PA 1ZZMA 1BKHA 3B03A 4DRSA 1P6CA 1REQA 1JNDA 1DIEA 3WJSA 3WEOA 2JK2A 4HPHA 2EPLX 4J4KA 1UD2A 2NXHA 3T8QA 5FSEC 2VEKA 5AHLA 3XISA 1MXDA 3EDEA 2JQXA 1PVNA 1J10A 5KITA 1KRAC 2CHNA 3RPMA 2Z1BA 5I77A 1QNRA 1XUZA 3NO3A 4FLOA 3CU2A 4M5PA 3FVDA 2EAWA 2Y61A 3KFTA 3TR9A 1TREA 2J66A 3B0PA 5AB3A 4BCEA 4KPLA 1JZ3A 2WVVA 1XCWA 1W8GA 1NAL1 1LWIA 5FAGA 3C4UA 5LIKX 3RFAA 4ATWA 1LRNA 2B7NA 3L0NA 5I23A 2XZ9A 1EOMA 3W7HA 1H0IA 3DBNA 1XR2A 4ZGYA 4K8EA 3E12A 3FIGA 4H9XA 3NDYA 2G3MA 4HYVA 3GKFA 1UG6A 2VGIA 2QPSA 3TWBA 2XJ7A 1A0DA 5AFDA 4J5NA 4O12A 1Q8AA 1EXPA 3WQWA 2C0HA 4QS6A 1RPXA 3WELA 5FI8A 1J5SA 1Y5WA 4LUSB 1ICQA 4MY9A 2BVDA 4W9TA 3UPMA 2OZ0A 2GGGA 2WZEA 5E1QA 1Q4NX 1XLGA 1OG0A 2RH9A 4Q7IA 2DZTA 4HNCA 2PLJA 2YJQA 4MB1A 1BAGA 2QGYA 1KFBA 2J25A 4C1LA 4DPPA 2OFJA 1XFBA 1BXBA 3WLSA 3KZPA 5F2MA 4TX8A 4JTGA 1ZBVA 1EJUC 4F0MA 1PZ3A 3TN4A 3NL3A 5D9PA 3AXIA 1KFWA 3O6CA 1AQMA 4RUBA 1PZ2A 5I09A 3VC6A 2OZ8A 5CC5A 5FJJA 4Q8VA 5I06A 3NFUA 3S2NA 5E9XA 1UKQA 4GRSA 5CGMA 3AMKA 3UJEA 4A21A 2ODOA 4IG2A 4F0LA 1P0BA 4KWWA 1V3HA 4PMUA 3UJSA 4MUZA 3V75A 2DIKA 1SW0A 2ZA1A 2E5BA 5REQB 3NCOA 1E6PA 4U33A 1I6NA 3IPWA 4OHQA 2OOFA 4UTLA 1ZCOA 4R9XA 1TZ9A 2OU4A 1Q7QA 1YBQA 4DO4A 4TO8A 3EX3A 1V3IA 1XLJA 4GIAA 1WAWA 2YZRA 4AAJA 5D2TA 3ZMRA 3VOIA 4QAIA 1QI2A 3C3NA 4TXEA 1SFJA 2AKMA 3I3DA 3W0KA 1R86A 5H8PA 2DVXA 3NXFA 2H8XA 3P0XA 2NT1A 4UMAA 5F2LA 1ODUA 5FKYA 3DN5A 4DWSD 5AC8A 2PTYA 3SFKA 1RP9A 4AFYA 4KMQA 3ITLA 1REQB 1R9ZA 2GL5A 1YHTA 4MPKA 4YXGA 4O17A 2W92A 1PAMA 1EEPA 4OOZA 1I1WA 3QSTA 3R58A 5CEWA 1FQ0A 3W38A 3IGHX 4UTUA 4JEQA 3TWAA 4F8XA 2HJPA 2BWGA 1E55A 4CCDA 4OJYA 3KDOA 1E1CB 4DWSC 3KBJA 5BZAA 2X16A 3LBOA 1QW9A 1XF0A 4PUDA 4M0XA 2ZA3A 2DJLA 4WDTA 1U5JA 3TC3A 2F38A 3CLMA 1ADDA 3UR7A 4Y7EA 3V7PA 3UVAA 3IANA 4HHHA 4ZQMA 2QUTA 4D71A 4OV9A 2BHYA 4C5YA 3MP4A 3MANA 4W7VA 3MBFA 1QI5A 4QHRA 4WY0F 3AZRA 1MRAA 4Z2HA 4WSHA 4E3TA 3L4VA 2EBNA 4FNUA 1OABA 5C9WA 4AZIA 4B3LA 1CI1A 1SSDA 3QMSA 2VZOA 3RR4A 2KZHA 1GQIA 3UG4A 1HG3A 4KT2A 3UJFA 3TFXA 1KM0A 4YNGA 4CN1A 4LEFA 1LQ0A 3F2CA 3TLQA 1G67A 3ZLHA 2QDHA 2DT0A 3UA3A 5CZ0A 3SCUA 2C1HA 2PLCA 3UNDA 1XISA 2OQYA 5ECUA 5C2XA 4M6UA 3W6YA 2PPGA 1L6FA 3ZJ8A 6REQB 3A22A 2YZ5A 4DBWA 1Q5MA 2Y63A 1CECA 1HKVA 2XGZA 3S46A 2C14A 4W4QA 3HGRA 3E5PA 3EA3A 2FH8A 3PBVA 2VGBA 2YDQA 4TVDA 1S5WA 1NQ6A 4HNNA 3BSGA 3L4ZA 1UR3M 5AYYA 5FF7A 1VJIA 2NQ9A 1ZAHA 3DEQA 4QM1A 5BXRA 5CPLA 4MPQA 4PUMA 2NXIA 1EDQA 4JTHA 4AISA 1HIZA 1XBXA 3CXOA 2ZDRA 1VEOA 5EYWA 3GUGA 1QPNA 1H11A 4B9ZA 2RGLA 3H7RA 4JKMA 2O4MA 2HNHA 3WLPA 3FX4A 3PUGA 4GC3A 3N04A 1F6KA 3AXHA 4GPNA 1PX3A 4Q4SA 2E77A 4I90A 3BCFA 4JTCA 3K4AA 4AZ6A 5A6BD 2YFOA 3WQFA 2YFNA 2KAUC 1BRLB 1A53A 2BBFA 4WGHA 1W3KA 5T9BG 4INFA 1GVIA 2BXYA 3R1ZA 4XD6A 3DG6A 1SPQA 1GKPA 1GQLA 1E15A 3MJMA 3PZMA 4Q6XA 5XIAA 4DLFA 2QJNA 3W2JA 3MKCA 4ZZ9A 4AVFA 4KIEA 4GC4A 4OQVA 4HNTA 2FHFA 1ONXA 2GVGA 1BD0A 3QYQA 3FXYA 3SB0A 1X1OA 4C5ZA 5FCZA 4G7FA 2J9XA 4Y2WA 4DWSB 3MTWA 5CZKA 1RHCA 1T6MA 1V5XA 5U7SA 1N2VA 5HQLA 3LY0A 4MLRA 1P1MA 5HNRA 3TE9A 4X22A 3KL5A 1B90A 5FIPA 3H54A 1JCTA 4GNKB 4XAFA 4LT9A 4ERGA 1QHZA 3C86A 1BPLB 3VZZA 2UBPC 1TR1A 3GR8A 4O16A 4WF7A 1CLVA 3GNOA 2W4XA 1U83A 4FXSA 1CX9A 2J9ZA 4UMCA 2BVWA 4JN6A 2PWGA 3FXGA 2VR5A 3OVRA 1MMFA 4JIIX 3T4CA 2YB1A 4NYYA 1XCFA 1JXJA 1IXQA 3LOTA 1LRTA 1B4KA 3ZR4A 2J8FA 2A3AA 4DVOA 2A85A 3A6OA 4B5XA 2I14A 2XVNA 4WR3A 1ESWA 4LAMA 3WNMA 1AW1A 3L67A 2QCNA 1EIBA 4YCPA 1JQVA 3ANYA 3TQPA 1M1BA 3GTFA 4JBRA 2VUNA 3CO4A 4PCPA 5I2UA 4FOUA 4Y9MA 4BQ4A 1TVNA 4LH8A 2VELA 2NX9A 4A4AA 3SADA 3KRSA 1UQZA 2OGJA 2VL4A 4XO6A 2HQAA 3WD2A 2BGQA 5A8OA 1M65A 1J0HA 2I57A 1VPQA 4GUJA 4DUOA 5JH2A 3PK7A 5LHFA 4L56A 1KFLA 1ZGDA 1WKDA 3WFLA 1TPVA 2GVLA 1GZ1A 3LLDA 1Z89A 4W87A 4FNTA 2X0SA 2OX1A 1LROA 1JZ2A 1F6PA 3DH7A 3UZWA 3W85A 1KBIA 5D2XA 1NFBA 4GNVA 3PG9A 2VX4A 3ITCA 1K3UA 1OGBA 5CZTA 4QCEA 1JJKA 1T7LA 1FBAA 2I56A 5MHBA 3PZVA 5HNUA 1PKNA 4FNSA 4W89A 5CZSA 1B30A 3QTGA 2PDIA 2YCJA 2ISDA 3UG5A 1MI3A 3TTOA 2L5HA 2VR4A 1P1XA 4GX9A 3L0GA 4GY7A 4CKQA 3HPXA 4UFJA 4V33A 4GYFA 2INZA 5IBXA 1VPYA 4WSKA 1JCMP 1BYAA 5JBFA 3NOYA 3WQEA 2QJHA 1EJVC 3UXIA 3W1XA 4C6MA 3KVLA 3GVWA 5G4EA 4CNNA 2NXGA 2XISA 4HMEA 2DH3A 1RCQA 3SSJA 3SCTA 2V63A 3TQVA 4DNMA 5CC6A 2B7OA 4WJ8A 2HZGA 3UQNA 1KV8A 3F7JA 2OEJA 2GJPA 3N73A 4LJ3A 4E2OA 2Z2UA 3BJTA 2FB3A 4MG4A 1T8XA 4YL2A 2ZUTA 1H62A 2X09A 3H2FA 3M5YA 4MWAE 3MVTA 1BGGA 4H9ZA 2Y5JA 2CXGA 1YTEA 2WPGA 2UY4A 2QDDA 4XVEA 4JYEA 1D2KA 3W7RA 2XH2A 4P61A 4TVCA 3MI2A 2ZZ3A 3RMEA 1VBGA 5K9CA 4Z17A 2XFRA 1O12A 2BG5A 3NSNA 3T1GA 4CCZA 2GSJA 4IHCA 4X9YA 3M9YA 3KBMA 1RA0A 3B9DA 3NNTA 3RNDA 1XWYA 3DOPA 1RBOB 1W0MA 2ADAA 3VIFA 1NDVA 4UR7A 3B8TA 1F61A 4Z1DA 3GYCA 1WX0A 3GBEA 3WUBA 1E0UA 2WYSA 4K37A 5HPCA 3R8RA 4ZB0A 4HCLA 3RM8A 2Z1SA 4NHVA 4N02A 8RUCA 4B90A 4UNKA 3BGJA 1XLDA 1TV7A 5FF3A 2OR2A 3H2NA 4IMFA 1PZ0A 4DJFC 4MNJA 2TMDA 6CGTA 2XFYA 3PPFA 1YRRA 3GKAA 4S3DA 3WIJA 2XIBA 4JFSA 5HINA 4LY4A 6TIMA 3IV8A 5I3IA 3GY1A 3CLWA 3GG7A 5M03A 2G3NA 4NZ3A 1XYZA 5CGQA 2OEKA 4GO8A 5FEXA 1S2AA 4DYEA 5F7UA 3WQ6A 2NVCA 4IFKB 3G22A 3O16A 4NAFB 3VGHA 1XDMA 4ADTA 5BROA 3W02A 3N9KA 4GO9A 2DIJA 3HMJG 4S38A 4DF1A 4Y9NA 1AVAA 2Y8UA 4UUIA 2VWTA 4MAVA 4K8HA 3KLKA 4KEVA 3WQOA 1VCVA 4NRRA 3CJPA 5EFFA 1LLZA 4YTQA 4JDYA 1HFBA 3T9PA 3RR1A 2G37A 1KCLA 5G2HA 4P8WA 2VCBA 3B0XA 3STEA 5I0DA 2CLEA 4GNJA 1H1YA 1KM3A 4IWWA 1FWAC 1KD0A 1VRDA 2A0NA 3S42A 1VFSA 3NPVA 3WBXA 4QG6A 2PWEA 4PMRA 2GGIA 2ZTJA 1K70A 1R3QA 3LGDA 4AZGA 2GFTA 1FXQA 4M29A 4U28A 1O1HA 3RMJA 4DJFA 4FLQA 3CV7A 2DVTA 1XLFA 3IJ9A 2OYMA 3UNTA 1E43A 3GM8A 2WW5A 4DPQA 3AZSA 4EX4A 3PPHA 3W81A 3UJRA 3ZJKA 4U2ZA 4G6CA 3URAA 5I3KA 2PTDA 2HROA 3MUIA 4IQJA 2V3EA 3OVQA 4CU7A 4J2MA 3OZYA 4A2SA 1IYXA 1NELA 1RY0A 3CYVA 5FSDC 1BEUA 1Y5VA 5FJRA 2XN2A 2PTXA 8A3HA 2J77A 4MF4A 1RCOB 3HOJA 3SGZA 1WDRA 3BZJA 3FYPA 2AMXA 3RF9A 2Z7GA 2WWDA 3I4EA 1W5MA 3VD9A 4LX4A 3JZUA 1FCVA 3WF4A 3CEPA 1BF6A 2XH0A 5KTLA 1JR1A 3PAOA 4H7ZA 3WH7A 1TUXA 3PNZA 1LCOA 3UYIA 1BYBA 1AJZA 2WSQA 4IT1A 1K7FA 7XIMA 1K8XA 3K13A 1VC4A 2R6OA 4PRRA 2JEPA 2FZ8A 3WF3A 3TJIA 3KBNA 1FCBA 2X05A 5ABEA 4B3ZA 2FFIA 2ISSA 3SCSA 4JNYA 4Q8MA 2TAAA 3IAQA 3QJAA 1EBGA 3CTTA 2DEPA 4X0NA 4PB5A 1G0CA 3MA8A 5D2YA 3GVRA 4PUWA 1RXOB 3ICJA 2VEIA 1TJ2A 3BDKA 3BK0A 3K8KA 4C6PA 1UIPA 2BP1A 1P0DA 1N8WA 1GW9A 3KTSA 3WFAA 2PDGA 4IP7A 3BMXA 5DCEA 2G8ZA 1EGVA 5GNYA 4IIFA 1UZDA 2PS2A 2DUZA 1DQXA 2PU0A 3TA6A 3N25A 4IMEA 4BQ3A 1XLKA 1ZJHA 3O0FA 4OTKA 2ZE3A 6PTDA 2OQLA 2PDMA 1Q6DA 1NIUA 3ERPA 1PEZA 3VKJA 3GNPA 3DC0A 1SMAA 2YBTA 4AZCA 1KM2A 1GJPA 1LG2A 2IQ0A 2OWXA 1E0VA 1NTHA 1S2TA 3EXRA 2XM2A 2QULA 1FKXA 3TSDA 4JTQA 2BDQA 3T09A 3DI1A 2A4AA 5E0CA 3ZWTA 1T41A 5D38A 1W9VA 3B4UA 5D9OA 1ZBCA 1B1YA 5AOUA 3OJGA 5XIMA 2ATSA 2VFEA 4R7OA 1S3TC 3CT2A 3SRFA 1V02E 4QE1A 3E0FA 3M0JA 1NH6A 4BEUA 4UZUA 3QGAC 2BASA 4BEQA 3R43A 1OC7A 4NYUA 1CXEA 1ZALA 5F4WA 4HU3A 3GHUA 4CQ9A 1UJQA 4NZ4A 3PANA 4O1AA 1AW5A 4DEFA 3W6MA 3M6DA 4ORIA 2WBGA 4FZIA 1KBBA 3TIMA 1NWRA 5HNTA 4D1IA 3CYJA 2DUAA 1Z7AA 1F8MA 3RX4A 4JIRA 1W9DM 5C7HA 3LCIA 1MEIA 4QJ5B 4EXQA 2H3DA 3TQ0A 2NSXA 1DJYA 1QTWA 1GOOA 1EIXA 1C90A 1W5OA 3JRKA 5E0FA 4XO7A 3PULA 4B5VA 4CN4A 1JAKA 2ZX8A 4KFPA 1BG4A 2VFDA 2ZCGA 4JCMA 3QQWA 5F4XA 1OHLA 1HX0A 4B92A 4J35A 4B4FA 3GIQA 1XGZA 4JD4A 1RH9A 3KCLA 4AUBA 1OGSA 4B5TA 1XLCA 4F40A 4EXAA 3SJ3A 3TSBA 4HBKA 4P7RA 4O13A 5HBFA 3WDPP 4UC5A 2DQXA 5HJLA 1GHRA 1O68A 2P76A 4L7ZA 2IQTA 1B57A 2WZMA 1YXDA 3GAYA 5KETA 2FH6A 2WNQA 3EB4A 5DN1A 2X7WA 2HWGA 1ECQA 2BNJA 2PWHA 1IEQA 1QVBA 2GUYA 4W85A 1UCWA 5HQMA 1DBTA 3GO2A 4CQBA 1E6QM 3PWGA 1XI3A 1R3WA 4HCHA 3I7QA 1DJIA 5JXQA 3WLMA 1LJYA 4J7RA 2ALRA 3BAWA 5JIPA 2VRQA 2BOFX 2QDEA 3AUOA 1K7XA 3STCA 1SMDA 1W1B1 4YWIA 2WM0A 2YL6A 1FX6A 4C6BA 2V5CA 1GK8A 2AGKA 1OGGA 2WPBA 1PZ1A 1W1ZA 2B31A 4DYKA 1UD6A 3G6LA 3M0HA 3TOPA 2QKFA 4O4VA 3WG6A 1I8JA 4ZE5A 3GVVA 4LYKA 1R9XA 4EACA 4HIBA 1ZJBA 4RKAA 3SW6A 3VXGA 3MP3A 1KXVA 2CKRA 2DZXA 2RKXA 2P0OA 1K9TA 5ABTA 1RQHA 4AHQA 4C7DA 2D2OA 1WP6A 1S2WA 1FHUA 5DRIA 4TMCA 5G5IA 1EJTC 3BLPX 2CZVA 3M44A 1W9PA 1K6AA 1B0IA 1JZ8A 3O9NA 3NM3A 1ZAIA 2GQ8A 3CGTA 2XH7A 3GXPA 3A5VA 8CGTA 3IUHA 4L64A 3G2GA 2PUZA 2YXOA 1PWMA 3K5XA 4UTMA 3ZLFA 1F05A 3IJ7A 1OYCA 3MUZ1 1Q85A 3NQMA 3TMLA 1CZ1A 5FJUA 1J0YA 4MWAC 3HG2A 1UOKA 4XUGA 1Z6KA 2C6QA 3GDTA 3KWSA 3O2LA 2GSHA 1QDSA 2GGHA 1XP3A 2GVEA 4P2VA 3GTNA 2ATMA 2GOKA 1TV4A 1XG3A 3I3BA 1KC7A 3AMCA 3T0DA 3ECQA 3WBYA 2F2HA 3CZJA 2BZNA 4MDPA 5HXMA 3T55A 4NL1A 4AB4A 3BV4A 4RX0A 4PBFA 2DT2A 4RPPA 1DYSA 1TCMA 3VA8A 1VBRA 3B05A 4ROQA 4LFYA 3TZNA 4ZE4A 5KZ6A 1P6WA 4DJDA 2PRMA 4MJ4A 1E1CA 4PR4A 1OD8A 2XN1A 4PB4A 1EC8A 5AYXA 2WHMA 4PUKA 7TAAA 4PRTA 2NLYA 1KKRA 3EOEA 4ZXLA 3TW6A 2WHJA 3C0LA 4F48A 4MVAA 1C92A 4LV9A 4AH7A 1WOBA 3QQ0A 3V0UA 3D6NA 5D30A 1ITUA 2WLYA 1M7XA 3LCLA 1G4TA 4FXJA 3GRIA 1TX2A 4Z08A 4IMGA 4JTFA 3KRUA 1GYNA 2V2DA 2CBUA 4KW2A 1IT7A 1W1A1 3LQLA 5LNRA 1GZJA 1PTDA 4IXXA 4HA0A 3ITGA 1UKPA 2NSOA 1JZ6A 3MV01 1LZOA 2B81A 4A3YA 3HURA 5HMSA 2HS6A 4PCTA 1JD9A 5MKGB 4ROPA 3N34A 2HISA 1G9HA 4DN1A 2XSAA 3VO0A 1PTGA 3ARVA 3L4TA 1B3OA 5I3JA 2P88A 1UZ4A 3WDRA 3ABQA 3W00A 4RDZA 4JTRA 3B0UX 3NEHA 4ATLA 4QSHA 4QG8A 2X0YA 4WY0A 1FWDC 3H24A 1VF8A 3G1AA 5BU6A 3SZ8A 2J9YA 3PTKA 1UR8A 4AD5A 2VMFA 1DIDA 2DSZA 2FGLA 3NO1A 3PM6A 1FHVA 4IQDA 5LNSA 1EBHA 3ZXWA 2V2CA 5AYZA 4Q7NA 4HHPA 1R6WA 1TA3B 2J7EA 3REQB 1BQGA 2FJUB 1WBHA 3PJWA 3HU7A 2XIJA 2VX7A 3N1AA 3EWUA 2R1LA 4HD5A 1QT1A 5I3DA 4Q32A 4N2YA 3LENA 4V28A 2VZSA 2Y70A 1OC6A 3NUKA 1EX1A 3RN6A 2EG6A 2HS8A 4TOQA 2VVSA 2HEJA 3GTIA 3DX5A 3FKRA 4MKVA 4REQB 2OODA 4YTTA 2Z00A 4NIRA 3WQ5A 3EEGA 3SAZA 4H9MA 5K9DA 3S5OA 5D2WA 3LZ5A 3UGRA 4XAZA 4AYSA 5CZJA 5FJPA 3CHVA 3QMTA 4IM4A 2H9AB 1XYLA 2J6VA 1V6UA 2OPJA 3GSMA 1Q8JA 4YYCA 3AIRA 3E2SA 1JRBA 2OSYA 5HOSA 3VZXA 1A3WA 4C1KA 3VNJA 1Y5XA 1ENUA 2QVNA 3CZEA 4ACZA 1GOIA 5CPSA 1DJGA 3W7NA 1A5NC 1MSSA 1XG4A 3LNMA 3BMVA 1G01A 2A3EA 2W67A 1J93A 5LA1A 1F8IA 2Y7GA 2VRKA 4IICA 1KFKA 1E0TA 2NV1A 4MKNA 3DESA 3FKKA 2GJNA 4B5NA 2CHRA 2C1GA 3W84A 4D6FA 3VDHA 1BYDA 4O1BA 3OG3A 4QJ3B 3GH7A 2IW0A 3S6DA 1QHPA 1P0KA 1UOZA 3W7EA 4YHEA 3DKLA 3MMTA 3CQKA 4ICCX 3NG3A 4OT7A 5IHRA 3O05A 4ASTA 2EQDA 1GVQA 2Y7DA 2QW5A 3VNLA 1CENA 3AAMA 4LWWA 3S2JA 4GE8A 1FOBA 3FJ6A 1TTPA 4M7SA 1G4EA 4L9XA 5CJ5A 5IM51 3JR2A 4Z0SA 3I7RA 3ID7A 1KR0A 3ELFA 2NUYA 1QPOA 2ZXDA 3ENLA 3GAKA 1DXIA 3GS6A 4RV3A 3S9IA 3OU8A 3E02A 5D37A 2ZX6A 3SQSA 4PE8A 5CXPA 1X6UA 2YYTA 3M5XA 2YR1A 4UQEA 1LDCA 1THFD 2GDVA 1V6XA 3NL6A 4MMWA 1TYGA 3A3HA 3PWIA 5I79A 4CQAA 4JTLA 1H09A 3C2RA 3G1FA 4OUIA 3E6EA 3FA5A 3PSWA 2ZQ0A 1KCXA 5A8GA 3C2OA 1EKOA 3W7IA 1MW3A 4FF7A 3GC5A 4AEFA 1ZP4A 3LN3A 2WVUA 3DGRA 4GABA 4AQLA 3H12A 2XIMA 4PSPA 3LXAA 1YNQA 3AI0A 1EB3A 2INEA 3OOQA 1EYWA 1OCBA 5A5WA 2XHYA 1TA3A 2MANA 4PTNA 3U57A 5BRBA 3WO8A 1DKWA 3FYYA 2A7NA 3VIMA 4H8UA 1Q4WA 3FGCB 2WM1A 2WZTA 3ZR5A 5IHSA 3QPZA 3OGSA 1CXLA 3UXAA 1XRVA 2PD9A 3M46A 1RR2A 1H5VA 5HR6A 2DDXA 3VNZA 3G5EA 1I0BA 4EKJA 3PBMA 1FTXA 2QCDA 2CXEA 2WWCA 2HXTA 4H9TA 4F9JA 4JTIA 3SIMA 1H50A 5GNZA 3BPWA 4KS0A 4LAZA 2RJHA 3CIWA 4GXPA 4MY1A 4HZ6A 1TO3A 4PCSA 2PGRA 3LLFA 3N2TA 5HJYA 1V03A 4DYJA 3LRLA 1V08A 3S4TA 4KGJA 4CLMA 3LHWA 4AEOA 1TE6A 3TYCA 5BXPA 1C9DA 2HDJA 3QOKA 2OYLA 4GVIA 4XBJA 3S1GA 4DF0A 4CVWA 3TJ4A 3BVJA 3PBGA 3A4AA 2DZVA 1IEXA 3S5NA 3M4HA 4GFSA 1UWTA 1GEHA 3NURA 1V6YA 1B4EA 3GHRA 4GKLA 3UGVA 3N4EA 3ITYA 2D0FA 2WB5A 1XLMA 4FEZA 4L4MA 3QH2A 3CQ0A 1MUWA 2OZ3A 4Q22A 4P8UA 3RXZA 3OA5A 2PZ0A 4Q3MA 1R2SA 4ZEPA 4V15A 4XD5A 4HK7A 4XKYA 4ZXOA 5FACA 1UD3A 3LK6A 3STPA 3LUTA 1F07A 4JL1A 4MGGA 4WQ6A 2QCMA 5GJMA 4UCFA 4TR9A 4DQWA 3W1RA 1ZL1A 5B7ZA 1FWSA 2YA1A 2E1DA 2A5HA 1S5NA 1KQZA 1UWIA 1JUEA 3B06A 4KFNA 2ZZ6A 1KQYA 5A69A 4NVTA 3KL0A 6ENLA 1O95A 2J8GA 4QRNA 3VMOA 1VS1A 4H6KA 1JFHA 4O54A 2E9LA 3CS2A 5A8NA 3NIYA 4WXYA 5DXXA 3RCNA 3VOJA 3OG2A 2B4GA 3BJFA 3PFMA 3AJ7A 4H7CA 3IUIA 1OADA 1AL7A 3JUGA 1A5CA 1RJQA 4JYFA 2Y24A 1GHSA 3W72A 2IMRA 3OBKA 1IWPA 2G95A 2VUYA 4M81A 2VFIA 4FR6A 4KIRA 1BSIA 4UTWC 3CQJA 4AXNA 1XC4A 4JY8A 3UR2A 4AX7A 4FPSA 4K39A 4K7VA 5GVJA 3KUMA 3OHIA 3VCCA 3SI9A 4GUIA 1XLHA 5F2GA 5A2CA 1N8FA 3JZEA 5DFAA 3B40A 3QKEA 3BCDA 1EA9C 1M7PA 3LDVA 3KBWA 2ESCA 3R5EA 4H2HA 1ISXA 3LCFA 4KCVA 1VGAA 4XAPA 4NAEA 2OSWA 1VJSA 1YMYA 1LL4A 3SY5A 3D47A 1S3HA 4N4QA 3C0JA 5GNXA 4IIGA 1NWTA 3BW3A 1O60A 1LM1A 3BW2A 2E6AA 3XIMA 4WX2A 3PZTA 3ALGA 5TBOA 1Q13A 2BSLA 3CZ8A 3S6OA 1GOMA 2P8BA 1AH3A 1BVZA 3UWQA 2E40A 3LCWA 1OX6A 4FAMA 1AMYA 3MKVA 1HQTA 1XCXA 2ABBA 4O14A 3CWNA 4GYKA 4ZOAA 4WDWA 3MBDA 1WA3A 1F76A 4HJWA 2DQWA 3KX6A 1QPKA 1RSCA 2XPKA 1TCDA 3E74A 3INPA 2ZC8A 2B7PA 3SN0A 3W1QA 1IIHA 1JIBA 3A64A 4YIWA 1KBKA 2D2JA 3MO7A 4L6DA 3F4WA 1ZLPA 2G50A 4J9JA 1HL8A 3ZJ7A 1RVKA 2QVHA 1OINA 2ZUVA 3PAJA 3N9RA 4GGBA 5GPRA 2ZRWA 3BANA 3RDKA 4LS2A 4ZQNA 2QUVA 2R24A 1U22A 1LBLA 1PBGA 1NU5A 3W2MA 3VINA 2P0IA 3C8FA 2OOGA 4IX2A 5CAKA 2O92A 4I7VA 1IEWA 4NXKA 5HATA 3TFCA 3QBUA 4OWGA 3LV5A 1GYMA 1QNOA 3EXTA 3M7WA 4JNZA 2V8ZA 5I03A 3LEPA 1ZSXA 4NNAA 2ZA2A 2Z7KA 2O7SA 3TC6A 4PCNA 1NFGA 5A6BA 2WC7A 2DORA 1Q7ZA 3AU6A 2X8RA 3H70A 4ZA0A 4HGXA 1YEYA 4IGHA 3GU9A 1EL3A 1XGEA 3BSHA 3TCEA 2E8ZA 2W5FA 4UR9A 2Z25A 1UKOA 3T0TA 3CK5A 3WNOA 5H8UA 3E0WA 3WQ4A 5E09A 4NP7A 3H22A 2E5CA 5I00A 4WDXA 4CGTA 3SCPA 1FH7A 4OZOA 1GOXA 4GZEA 1YNPA 1VD6A 3AXMA 2OQHA 1RD6A 4OUEA 3QN3A 3ZO9A 4W8LA 1C8XA 1KGUA 1EJSC 4EWJA 1EP1A 5M1TA 3M0KA 1B3XA 4NSBA 4YYFA 3UG3A 3D46A 3USZA 5CLTA 2PDBA 3DFSA 3QF0A 4GK8A 2C16A 3VZYA 3QFWA 4L9ZA 1PO9A 4S3AA 2V3DA 5HAOA 5EL1A 1YPIA 2CZ5A 4P7QA 4UXDA 4GVFA 4P5UA 1BHGA 2I17A 4Z2JA 4HVXA 2JEQA 1R87A 3W27A 3TXVA 3M41A 1SYTA 2E1WA 4CD6A 4R88A 1IT8A 4JQAA 4AF0B 2DSVA 2VI0A 2A6NA 4Q4RA 2XGIA 3OA3A 2ZVIA 4CN6A 3ITOA 2Y7FA 3UCCA 4XZIA 1GTHA 4G7EA 5FD0A 2GQAA 4AWSA 4ZFMA 4BJHA 2Y1HA 1MO0A 4LB4A 1GQJA 4FXFA 4XZWA 3N14A 2F8QA 1KWGA 1FWTA 3W4RA 3WEMA 2V5LA 4AZBA 1MNSA 2Q3RA 4FSAA 4LW7A 3VKKA 1L6YA 5TF0A 3SY1A 3LRMA 4HN8A 3OQEA 1QPQA 4C7FA 1MW0A 2ZICA 3VIKA 4Q4PA 3H2EA 3MPGA 2J27A 5DBTA 4ZSTA 4GIYA 2D22A 4V1XA 4AD1A 2HVOA 3SUVA 3CWHA 2Y62A 3DYMA 3RLVA 3TV8A 4U31A 1UQYA 1QWKA 3OLDA 4YTRA 4O1EA 4DZHA 4UZSA 4HP5A 1EF2A 2VOTA 3HZ3A 2FMOA 3ZVHB 1ZTVA 4RDWA 1B31A 1KTNA 1CGUA 1BXNA 4WHBA 4QNEA 4Z1CA 4PMVA 3SO7A 6ALDA 3QY7A 2XM1A 3LSCA 2YL9A 1NDZA 4DY1A 3CUZA 3EBVA 5IRPA 4OIFA 4YWSA 4M6VA 2C0AA 1ISWA 4ZTYA 2VXNA 4JIPA 5FL1A 3W23A 2QXWA 5DRCA 1DJWA 4QLJA 4ZOEA 4E4PA 3HTWA 4WOQA 3STFA 1FWGC 5CLWA 4HTBA 3KZSA 2E6FA 2R94A 4J3UA 4CUCA 2IKJA 4GVHA 4IL0A 4MZ8A 4M8UA 4Y90A 2NQZA 3LMYA 4XUYA 3BXWA 5CSUA 3QSRA 1UP0A 4NNBA 2IUZA 4XZMX 4K36A 3BGGA 1C91A 1TTQA 1HP5A 3EWZA 3R2GA 1OK6A 3PJXA 2PC4A 4DX3A 3IS4A 3IVTA 1WYIA 3C2FA 1BTMA 1HXJA 1QFEA 1SO5A 5MF5A 4J3TA 4KWUA 3BGAA 4MFEA 5E6YA 4CQDA 7A3HA 4A2RA 3EX4A 2Q3OA 3GNNA 1JDCA 4WVXA 4NX5A 4YU1A 1VFLA 2BB0A 3EKGA 4JTJA 1XC6A 5BWFA 1CLXA 2CWXA 3ARPA 4KERA 4ZODA 3SFWA 3ZLGA 5FF0A 3KRBA 2VRJA 4LU0A 1UR2A 5M5DA 5PTDA 3WDQA 1O5RA 3U6WA 3P5YA 1GW1A 4A8LA 1E4MM 3SEPA 1E72M 1RLCL 4KH2A 3WDHA 1KTBA 1I2PA 2VDHA 3CUGA 4YJ5A 3T2OA 2QUMA 3THQA 1GYLA 2QS8A 3F4DA 1B3WA 1QOQA 4X3ZA 1VBUA 1TV5A 3KM8A 5A95A 3ABOA 4MSSA 1M9HA 1DXFA 1GKQA 3KBVA 3L0KA 1TVLA 3W6LA 1CXIA 3K1DA 3LS9A 2PDWA 2OYKA 2V6AA 3NTYA 2V3GA 4IFKA 4CVUA 4DXKA 1LUCB 5F2IA 4HU4A 2XYLA 4E0CA 4MWAB 2W3ZA 2XSXA 3JVAA 2R82A 4JTUA 5C9RA 1VEPA 1ZCCA 3L4UA 3E2VA 2J79A 5DANA 3LPPA 4C6QA 1AW2A 3MHUA 4UQDA 1WZKA 3NAVA 3QRHA 1E6SM 4BWLA 4U5KA 2J74A 2DSUA 2QIIA 3DHDA 3AHYA 2G3FA 4RZ6A 5DF0A 3VOCA 3WMCA 3ZYZA 4IMDA 1PWLA 1TV8A 4B16A 1Q7MA 4BQ5A 3LGEA 4GYJA 1US0A 3TX9A 3M0XA 2VC7A 3I65A 1IZCA 1LT8A 1TPDA 2PCQA 3EB2A 1HL2A 3CL6A 3QMRA 3G1RA 3H6OA 2B0MA 1CB2A 1L8PA 3W3OA 4S3FA 3LERA 1ZENA 5D33A 1W3LA 3MB9A 3WBWA 3GNDA 2FZ9A 2PODA 3ANVA 2IQDA 3BH4A 3H21A 3U7BA 1VJZA 2JIWA 3UERA 4QLLA 3NM1A 1QNSA 3ZR6A 3UR8A 1MQQA 1OBAA 1XLEA 2J4GA 2FDMA 4XWUA 1LLWA 2CLKA 1P0NA 5IBXC 4C90A 3GHTA 4K1WA 4TU1A 1FRBA 1ME9A 5CSRA 3EWDA 1KFCA 3I6RA 5DY3A 4H2CA 4IH3A 2CNCA 2J8TA 3CHFA 3TN3A 4ZB2A 4DBUA 1H4PA 3U4FA 1TTIA 1TX0A 3T78A 1XUUA 1BVWA 3A4JA 3RYSA 3OLIA 4RE4A 2ZX5A 3MV11 4MYAA 1T0OA 3FHQA 3POCA 3RJYA 2NT0A 2QPXA 1JZ5A 1OF8A 1QRQA 4HA4A 5EA9A 2IKHA 3T40A 1BGAA 2FKPA 3MZNA 4MAZA 3QZEA 1YLVA 1GQNA 3ITXA 3SCOA 4GIEA 4PN2A 3WLHA 3N9SA 4AD3A 2P1FA 1MZHA 3KBSA 2FMNA 2YKKA 5FJTA 4TIMA 2RFGA 1JNEA 1ZQ5A 2A7RA 2O55A 3TA9A 2I9UA 2YCEA 2X1RA 4I7UA 2BGNE 3PF3A 4AC7C 4EF8A 3AYTA 1B2YA 2VCCA 1UP3A 4I5XA 2VO5A 2AAAA 2PDKA 1SR0A 4JHOA 2G97A 2X1UA 3LM3A 1HVQA 1HKJA 4IPPA 3RAOA 5EGRA 4GACA 3WMBA 4DJDD 3MVIA 4Q8PA 4Q6JA 2W0UA 4C91A 4IGNA 3NR0A 3GDRA 4Z1BA 3APYA 2YDRA 1A5UA 3WDJA 4N0RA 4P7NA 1EEXA 2RGMA 1CXKA 4UTKA 4C6EA 1C9WA 3DI0A 4UQ9A 3IJ8A 1V93A 3MSDA 3MUCA 3ISIX 4UTHA 3MYPA 4MB3A 3CUHA 2HBVA 1DJZA 2IKIA 3GQYA 2XFFA 2JIEA 3CIXA 2WVVB 3KCOA 1HJQA 3PTDA 3CO8A 4B91A 1S2CA 3TTQA 4DF2A 3NQGA 3FN9A 1HTIA 4AIOA 4ZTXA 1RK6A 2J13A 4IIEA 3E1F1 4E2VA 1W17A 3R0UA 2OWCA 1OB0A 1TUFA 4F79A 1EYEA 2Y5EA 1TQJA 1FP8A 1UJPA 5HNNA 3D3FA 4C6NA 2OJPA 5AYIA 3W7JA 1US2A 1SJAA 3UW6A 2NX1A 4ADSA 4H83A 3KHDA 1ISYA 4GX8A 5KZDA 1GVEA 1BTCA 2QZRA 3MCMA 1SFSA 2UWFA 1XIFA 4KGLA 2P3ZA 1LQAA 4TX6A 3VIJA 3PPGA 2C79A 4GXMA 1HGYA 1Q65A 3URBA 5L9FA 2B7QA 2XVGA 1W1YA 3A12A 4N9BA 4F2TA 3R8GA 1KXHA 2YB4A 4AMAA 3M07A 2DZAA 1K4HA 2XGBA 3UWEA 1DQWA 2ACRA 4JFTA 2WC3A 3SQLA 5CBJA 4LYRA 1JD7A 4HNLA 1HUVA 4YPJA 2FPTA 5E5CA 5CPQA 2CCRA 2OT1A 4IJBA 1DWFM 5CBIA 4H6EA 2VHLA 4MZ1A 3IGXA 3N4AA 4LVFA 3WH6A 1RZMA 3NSMA 3QLLA 3P82A 3SN1A 1HGWA 2AGTA 3FHAA 3PN8A 2IKGA 1WZAA 4DWSA 4CU6A 1W5NA 1UASA 4HB7A 2CWNA 4D6GA 1F5ZA 3AIWA 2C3ZA 5I5RA 1R9YA 1ITXA 2ISFA 3CEUA 1U33A 1LQ2A 4GXWA 1KXTA 2E28A 3VOHA 4XISA 3GDMA 2X41A 4FLSA 2Y0FA 1KFEA 3WLKX 1XKYA 1EH9A 2BY3A 3T0AA 2PEVA 1GJWA 1LBMA 3LTYA 2YCLB 2W63A 1QASA 1U2YA 1SFLA 3EMZA 1R47A 4H9YA 3QHNA 1BKSA 3CIVA 3FGCA 3O1NA 2WMGA 2PGWA 1F3TA 1H51A 2A1YA 3GXDA 4GBUA 4D1JA 3W70A 1HZYA 4WKAA 3EPOA 2Q6ZA 3B0VC 2PLMA 1MDLA 1XICA 3PUDA 1UW9A 2GK1B 1JYNA 1X7IA 4GI6A 1VIZA 1V3KA 3UZJA 2BXVA 3S5YA 5FEWA 3EWWA 1RPKA 3CUFA 3AXXA 2WCSA 2WLZA 3EGJA 4ZO8A 4W93A 2ZUUA 2ZADA 3APGA 3VGGA 3HFYA 4KFOA 3BOLA 5B80A 3I68A 3WQPA 3L2LA 1PCKA 1GQKA 4S3JA 1L6GA 3TTSA 3TYUA 3CZGA 3TQKA 3BLDA 4QITA 3E2RA 1RP8A 3THDA 2XVLA 4A29A 2FGBA 5BU9A 4I7WA 1GOWA 2R8WA 1X38A 3BW4A 3CV6A 1KWKA 1N8IA 1JQXA 1RQBA 4D6EA 1CXFA 4KEZA 3Q37A 4HSOA 3M0IA 2CKSA 1UA3A 4JIEA 1ITCA 1EX5A 2O7QA 1W3JA 4AIBA 1X97A 4LQ1A 5LYRA 2FTYA 3PZIA 4NZ1A 4D6JA 1IR1A 4C7GA 1TZZA 1FWRA 4NXSA 1QI3A 2IS7A 4TUFA 4QXIA 4FALA 2C19A 3AZTA 3IGUA 4XKYB 1J6PA 3KTCA 5HANA 3LXBA 1HJSA 1ZJAA 1YXCA 3H26A 3KP0A 2ZTKA 1Z42A 2QV4A 5G4HC 2WJZA 3QW4B 1ICPA 2FJKA 1DTNA 3AIUA 1DJQA 3GVQA 3R25A 3SCVA 4EF9A 2OELA 4NT0A 1S1PA 4HMDA 3VM5A 4IFRA 4TMBA 4E8CA 1EXBA 3POHA 4QSFA 2DZSA 3KLLA 4KEUA 4WKFA 3S83A 4UFIA 4Z42C 4Y6GA 5EMUA 3CL8A 4IF2A 2QCHA 4P7OA 3NYDA 2OTDA 3GH4A 3VM7A 1ZNNA 1OD0A 3TK7A 5E93A 2MUCA 3IACA 2VM8A 3IJIA 2EG7A 2IXVA 4XD3A 3FAWA 1E1EA 5M2FX 2HE5A 2E68A 1VFHA 3AIBA 3DDMA 5HA7A 1DL3A 4QEEA 4ES4A 2G0WA 4FNQA 4LRTA 1DVJA 2Z2AA 2EPNA 3C2EA 1E5JA 3UZYA 2W62A 3A13A 4MJZA 3ATZA 2WZIA 3Q67A 3IJDA 1E73M 3AYRA 1GOQA 1XJBA 5KZEA 4Q33A 2WCAA 1V7YA 3CPUA 2PMQA 1TJ0A 5HUPA 2C8NA 4EP8C 3P93A 1U1UA 4ATDA 2AQVA 3EOUA 3WKZA 1TTJA 2XTKA 4JYDA 1JUKA 1MZRA 2VWSA 1VBJA 4UMBA 3O0KA 1EUAA 1NY1A 5BNKA 1A47A 1XLAA 3CAWA 3UETA 2BY1A 1AH0A 1AD1A 3WSUA 3IJ6A 3LNPA 2PWDA 1JCJA 3MMUA 1OC5A 5G2WA 1DXEA 3IV3A 5D32A 3SGUA 4X61A 4JEJA 1MFUA 3UWWA 3QZAA 2RAGA 3QQ1A 3Q2DA 3YPIA 3V16A 4P02B 4W88A 2Z6IA 2BVTA 1A4LA 2CPUA 1CGXA 3WK2A 4EAYA 2QLYA 1WZMA 3N29A 3NQCA 4KCTA 4QJ4B 2CLFA 4F66A 1OT2A 5LA0A 1W31A 3RM4A 5I78A 1NWSA 2ZZ7A 3HPSA 1H49A 3BLIA 2O0TA 2ZZ4A 4L1WA 1BSLA 1XL9A 5HK4A 4OVXA 3SCRA 4UOZA 1ZHAA 1JFXA 2DFAA 1RBAA 1XBVA 4PMXA 1AJ0A 1UD4A 4LBSA 4AWEA 2GUUA 5JUVA 1NDWA 4A8IA 1JL8A 9XIMA 3DFOA 4XSLA 1X6LA 4O1DA 1P5BA 4IX0A 3AMGA 2YX0A 3F2DA 1A5MC 4P8XA 2EJ1A 4LC8A 4HZMA 4PMOA 1YQ2A 2ZC1A 3DC8A 3W83A 2XH4A 2Y88A 4LCRA 3IIOA 1EP3A 5HUOA 4JS3A 5IFTA 3FAXA 3FVMA 4RXGA 1XHGA 2NX3A 1SU5A 2WQPA 4UBPC 3T2QA 4ZFCA 4ACYA 1F3WA 4DZAA 4GH1A 3W88A 1CB7B 1CNVA 3KE0A 4EVZA 3C56A 2E0PA 3M16A 4CQ8A 4Z1AA 3P14A 3WD1A 1IT0A 2BGSA 3W1PA 4MYXA 3AICA 1K02A 1PJ9A 4XZBA 1H61A 1IV8A 3VDAA 1SGJA 3N12A 4KWVA 3CH0A 3W71A 4BI7A 1ISZA 4O52A 4LNCA 3AU2A 3W22A 3W53A 1CWYA 2HK1A 1EGZA 2GPTA 1DOSA 1H1ZA 3G24A 3CUXA 2WANA 4O4WA 1JXKA 1TB3A 4IUOA 2P53A 4GJ1A 2EPKX 3LB0A 3H2AA 3QV8A 1ISVA 3OPSA 1W3NA 3HFTA 5T91A 4FOJA 3R12A 3MYOA 4LS0A 2HK0A 3QLDA 4O19A 4QGCA 1POJA 3GH5A 2XG9A 2G3JA 5CSSA 3O15A 1MXGA 1QPRA 1WV2A 5AKQA 1TG7A 4C6CA 1NP2A 4IISA 4KCUA 2VX6A 1R7AA 3BC9A 4Z2LA 2VTFA 4XVDA 3AIVA 2FFCA 1JPKA 3KL3A 1LG1A 4PULA 4KETA 4JZ5A 3PY2A 2WSYA 3E0VA 3OIHA 3S6TA 1K7EA 4JKKA 1JDDA 3ARZA 1QNPA 1JI2A 1R0MA 1U1HA 3SM0A 1IXOA 3U5YA 3FSUA 2F9RA 3I3EA 4ZMGA 3VCNA 2YLAA 3WK1A 2O9RA 3UZ5A 2H9AA 3LTPA 1PKLA 1UUMA 9XIAA 1W32A 5C6MA 5IDZA 3GXFA 3O6YX 5H91A 5GJNA 3RX2A 5LNUA 3W28A 2E6YA 5JU6A 2E7FA 4QFUA 2FIQA 4M24A 2QJIA 1GZGA 1OX5A 1W6TA 1JPIA 1E4LA 1Y65A 2VEPA 3RJXA 4US5D 3P67A 2V30A 2W66A 3AC0A 4XD4A 4ERIA 1R3RA 4IP5A 3NO5A 1AQHA 4L9YA 4UOJA 4UQBA 4KEMA 3ZVHA 1XH1A 1ZPTA 3F2BA 1UH3A 3V4BA 4OE7A 1MFVA 3EPMA 2QAPA 3HGOA 4HPGA 1GNXA 3DENA 4GUHA 2V82A 4K6AA 3WF2A 1YDOA 2QCDB 1OVDA 4OOUA 4FB7A 3DFHA 5M17A 5J5DA 1VPXA 1X8CA 3IK2A 1TMLA 3PS7A 3AYVA 1FP9A 3LTSA 4LY8A 2XVKA 1LOQA 1V3LA 4I3GA 4B3KA 4J3VA 4PFMA 2PP1A 2W27A 3Q94A 3I6EA 3U0HA 4C60A 1X6NA 2HE8A 3FV9A 4RZBA 2I5IA 1FH9A 1VZWA 1EJRC 2JGYA 4E4UA 4LUTA 1FWJC 1PUDA 3SRHA 4Z2GA 3HQOA 3QOMA 4OBRA 1YPFA 4JIQA 4GVGA 4AZHA 4GYPC 3HF3A 2Z4GA 4PMDA 3PZQA 2WC4A 1H7RA 2R91A 3CV2A 4A3QA 5BXTA 3ZFHA 3TP4A 5EJZB 3ZQ9A 4I6KA 3ZT7A 3BLKA 3GHSA 5DT5A 4JQ3A 2HBXA 3PJUA 2D1ZA 3EMQA 3VE7A 2OLSA 2J24A 3LBCA 1A5BA 1OIFA 4XBKA 3RILA 2NVAA 4EWND 2C18A 1AZ1A 2WMIA 4DB7A 2IPGA 3T7VA 4MY8A 5D9NA 4LCSA 4O28A 1YDYA 1Y8BA 3F5LA 3S3GA 3W1LA 4P00B 3N2BA 3GNRA 3NVDA 3KDNA 3HQPA 3S2CA 1TRDA 1W91A 4R5EA 1MQPA 3W01A 3FA4A 3QEZA 2YBVA 5A2BA 1K8ZA 3CAQA 4B5UA 2C7FA 1F9CA 4O0QA 4UFKA 1KGXA 2PFHA 2ZUWA 3CQIA 3UD6A 3QPYA 3GU2A 5H1WA 3EDJA 1IWAA 4FX6M 3NSXA 1W3IA 3I10A 3VABA 1QU4A 3ARXA 3BUVA 4JX6A 2GUBA 4XKMA 3VK5A 3S1UA 2D2HA 3W9ZA 6TAAA 1C29A 1LUCA 4MOZA 4D8ZA 3ABZA 2QCEA 2PDLA 1J12A 1GUVA 1HF6A 4PB3A 5KSWA 1NF7A 3F5KA 4MJMA 4K7YA 3HG3A 2ALDA 1H3GA 1KRMA 1NQKA 4MM1A 3IIVA 1TWSA 3D5HA 4QAWA 2CLHA 2G3IA 4LUJA 3U8GA 3T05A 4IIHA 4HG6B 5AHMA 1F3XA 4RE3A 4QDPA 4ZL1A 3EPNA 2W9MA 1XGDA 1QMLA 2D3NA 4ERAA 4XAGA 1UB3A 1M68A 1MNZA 4A3HA 1Q66A 4JKLA 3BLEA 1J96A 1DIOA 5DY2A 2D3LA 1UHVA 1CGTA 3L7RA 4AWUA 2DIEA 1XPGA 1H1NA 3SCNA 3NXLA 1W1PA 5FF4A 3ES8A 5BW6A 3F4NA 4M6QA 2EF9A 5LZLA 3WH5A 4EE9A 2ZWYA 3HBLA 4H8HA 1V3JA 1FUYA 5AVNA 4L4PA 1DJNA 3HJZA 4LGXA 1M6JA 5C55A 2JF6A 3JW7A 1J01A 1V6WA 2FTWA 3HG4A 4QR6A 1W1VA 1EWDA 2BS9A 3FW6A 2GJLA 2Z1XA 3N19B 3A5FA 3ABSA 3W29A 1DE6A 4WJXA 4O8AA 3E49A 1B3VA 1G6CA 1EPXA 2PP0A 3II1A 4RNHA 1UIOA 4BI6A 1QK2A 3NQFA 4JX4A 1I60A 5TAOA 3U2ZA 1E4IA 2ZDSA 5K2ZA 1A5AA 3L5LA 1QNQA 2ZUMA 3O07A 3W37A 1H41A 3EWYA 2ISWA 2X2YA 2V9DA 1FWIC 1GCYA 1VAHA 3UESA 4OU1A 4W8AA 5D8ZA 3B9OA