4A3HA

2',4' dinitrophenyl-2-deoxy-2-fluro-b-d-cellobioside complex of the endoglucanase cel5a from bacillus agaradhaerens at 1.6 a resolution
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
300
structure length
300
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ENDOGLUCANASE)
publication title Snapshots along an enzymatic reaction coordinate: analysis of a retaining beta-glycoside hydrolase.
pubmed doi rcsb
source organism Bacillus agaradhaerens
molecule tags Hydrolase
total genus 122
structure length 300
sequence length 300
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 1998-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4a3hA00
1KR1A 4U33A 1JZ8A 2MANA 3K8LA 1MFVA 4HOWA 3OGSA 3T0DA 1XD0A 1JNEA 3L4TA 4BZYA 2XVPA 2PWDA 1NM9A 3W24A 2WCSA 1E6RA 1E3XA 1IZJA 3FXYA 2WCGA 3OLDA 2IUZA 1V03A 2VZOA 3VIKA 3D3AA 1ODZA 3AISA 2WKGA 1VFUA 3ECQA 3PZQA 4LGXA 3N04A 4GO8A 2Y4SA 5HDRA 1GJUA 3WBEA 2IXVA 3VKKA 2X8RA 3GYCA 3CZLA 4PRWA 5A69A 1KQYA 1MW2A 3ARXA 1HL8A 4AZ6A 2FGLA 4F79A 3AIWA 5IDIA 3I3DA 2E40A 2VOTA 1WZMA 4JFWA 4UOJA 3RO8A 4V27A 2XUCA 2FH6A 2QLYA 5LA0A 3B8SA 4P7LA 1TR1A 4E8DA 2V38A 4CD6A 3WENA 1WKYA 2DIJA 2E3ZA 3CGTA 3GM8A 2QHAA 1XHGA 1GUVA 4NI3A 3APGA 1DWAM 1WCGA 1JXJA 3DYOA 1N82A 1WZKA 4UQEA 3BLKA 3WQWA 4H7VA 4QDMA 3POCA 2VX4A 3U7VA 4Z2LA 3GXIA 5LYRA 2XFFA 4D6FA 2NT0A 1E43A 1UUQA 2J47A 3WSUA 2VR4A 1OGSA 1R8LA 2WBGA 1QNQA 1CGTA 1Y7VA 5GPRA 4M80A 3WF4A 4AW7A 2ZICA 1R87A 4BQ5A 2D0HA 3RDKA 1VFOA 4TTUA 1XV8A 5CPSA 1E6PA 3ZSTA 2CBJA 1ISWA 1VIWA 2O9RA 1LL6A 2DSKA 2GJXB 2XGBA 1B90A 5EB8A 1E0XA 1GNXA 1UD6A 3ZJ8A 1X6LA 5A94A 4TX8A 1W9VA 4GQRA 2EEXA 2VRJA 3QHNA 2WZEA 4W85A 2Q8XA 2Y2WA 4LYQA 1XSJA 1J18A 4FK9A 4CN6A 1OSEA 2O9OA 1PX3A 4H8HA 1U2YA 1EA9C 3WMBA 3CH9A 5JBFA 1WDSA 2AOSA 1XYZA 4U2ZA 3AMLA 2WHJA 4PMZA 4WJXA 2G8ZA 5E0CA 1J0IA 2WC7A 2CBIA 4PCSA 1L8NA 1DWIM 2GJPA 2WVVB 4MNMA 1EO7A 1EDTA 1QI4A 4C7GA 3T0BA 4JKKA 1HP4A 2YDRA 2G3MA 3UEQA 2F2HA 3WEMA 4BF7A 4PCTA 6TAAA 5A2AA 1ITXA 5M03A 1CTNA 2BS9A 2WK2A 4AWEA 1BYCA 1UYQA 3VPLA 1L0PA 3BSHA 5I6SA 5EMYA 1HX0A 4AIUA 3ZMRA 1BGAA 4E8CA 5HPCA 4CVUA 3DC0A 3FHQA 2XYLA 4FMVA 2XSBA 3EDDA 1PBGA 4D6HA 1E71M 4YPJA 2OSWA 2W91A 3OZOA 1C90A 2YDQA 4AD1A 4BQ4A 4TOQA 2W61A 1H11A 2J8GA 2WLYA 4JCLA 1QNPA 1QPKA 3WEOA 1BF2A 3VTRA 1W1YA 4W84A 1UR1A 2JIWA 1E6SM 2FHFA 2J7CA 3MMUA 2YKKA 3B9AA 4A3YA 1E6QM 3AS1A 1B1YA 3FAXA 2W63A 2J62A 3ARQA 4DM2A 1NWTA 1XH1A 3WNPA 3W38A 5A8MA 3EMQA 1BQCA 4Z2GA 3QHMA 4J27A 3BAYA 2CERA 1AQ0A 4Z2IA 1VF8A 4B15A 1W91A 2C8NA 5EBAA 3W29A 5JBDA 2Z1SA 1ZL1A 1HP5A 3GTNA 3VO0A 1QNRA 4GI9A 1UR4A 5ABFB 3W53A 4PSRA 4MNJA 1OGGA 2WVSA 2ZUSA 2ZX5A 1LF1A 3BAKA 4UZSA 1E70M 2FH8A 2AMGA 1R85A 3KEHA 4AIOA 4RE4A 3VX0A 5BRPA 1B3XA 1PIFA 3CHDA 3SUUA 3UR7A 2PF0A 3HN3A 5A8QA 4NSBA 1JI2A 1BVNP 1KCKA 4P8VA 3RPMA 1AVAA 2YA2A 1K9DA 1R86A 1OWQA 1UQYA 1JF6A 1BGGA 1FHDA 1MQPA 4P7RA 1MVYA 4W93A 3DECA 4QAWA 3O9NA 3AXXA 1FP9A 2PB1A 1DWJM 4PUEA 1JL8A 2WYSA 4HA1A 2DQXA 5A3HA 1GONA 2D2OA 1LWJA 4AD3A 2E9MA 1MW0A 1V0LA 4P7NA 2ZIDA 1UG6A 3ZSSA 2VUYA 5FIPA 2A3CA 4MDOA 2PWEA 1MWOA 2ZXDA 2DSZA 3ZJ7A 1YQ2A 1HKJA 2J7EA 1Q6DA 4OBSA 1EDQA 3SCOA 1GOIA 4M56A 1V3HA 3WFLA 3MV01 2XTKA 1H09A 3VUPA 3VDBA 3WUFA 3A47A 2A3AA 3A3HA 1EXPA 2VX7A 4GZJA 3W37A 2Y8VA 5FD0A 2V3EA 3KZSA 2WSKA 3K4AA 4UQ9A 1Q6CA 3VILA 3ZQ9A 3MUY1 3PZIA 4Z2KA 1UQZA 4M81A 3AJ7A 2DT0A 3II1A 2YJQA 3MSDA 3OBAA 1CENA 1YHTA 3JUGA 3WH9A 2VQUA 2WMFA 3UESA 4PMUA 4MADA 3WMSA 3N9KA 4HOZA 3OB8A 2VJXA 2WAGA 2UY2A 3CMGA 3WBAA 3ARWA 2DEPA 1ZU8A 2UY4A 2D1ZA 4P8XA 1C92A 1QI3A 2F8QA 1ISVA 3B9DA 1UA7A 3W4RA 3SURA 2D3LA 4N0RA 3ZJKA 4ZEPA 3K46A 1C8QA 2HVMA 3TONA 1FA2A 1UD8A 2JFEX 1X1NA 4M8UA 1WDPA 1HT6A 1CGXA 3TA9A 1ECEA 2ZUWA 1CNVA 3RMEA 1CLXA 3AIBA 3AXIA 4MDPA 1WNOA 4YN5A 1HKKA 4F9DA 3F5LA 1E9LA 1HN1A 2EJ1A 1F4HA 4GI6A 2BVYA 2WMGA 1BPLB 2V3FA 1KFWA 2XM1A 2D23A 3M46A 2DDXA 2CHNA 1B3WA 2A3HA 3NIYA 2ZUNA 5IFTA 2EPKX 3SCTA 1W3JA 1UWIA 2XM2A 2CEQA 1J9YA 1UWQA 1TA3B 4Q22A 3VINA 4U2YA 1OCQA 1R7OA 3L2MA 1J0ZA 4J3SA 4PTWA 1ZBCA 2CCRA 1G94A 1QW8A 3GH5A 3MO4A 2PI6A 3CMJA 4CU6A 3WDIA 4E4PA 3WUGA 4X0NA 4AISA 4PMQA 2Z1KA 1VAHA 5ABFA 4PUDA 5DEZA 1WP6A 2CXGA 3EYPA 2BY1A 5AYBA 2VURA 1BYAA 2PC8A 3FW6A 4D6JA 4R27A 3M7SA 1UWRA 3OGVA 5F7UA 4XZWA 4ZFMA 3TOPA 4B16A 1GQIA 2QMJA 4ACZA 1E6ZA 3AIVA 1SYTA 4J3TA 4BQ2A 2J75A 2DGAA 3THDA 3ZO9A 4B3KA 4CU7A 2BVTA 2QPUA 2W4XA 4W8LA 4EE9A 1US3A 4GIAA 4QCEA 3NCOA 2GDUA 2YOCA 1UR9A 1JYNA 4AEFA 3WNLA 1LG2A 4JZ5A 3GDBA 4WKHA 3NYDA 4W89A 1KXQA 1O6IA 1XH0A 2WCAA 4W7WA 1JI1A 1PZ3A 3W81A 1AQHA 3K8KA 2A3BA 1TMQA 5I77A 2GK1A 3TTQA 4CD8A 1OT2A 5CLWA 3RM9A 3N18A 1B3YA 3DHUA 4PMXA 3PTQA 4UCFA 1GVYA 3MUZ1 3G6LA 4HA4A 2QMKA 3BAWA 1X6NA 3IJ8A 3OLEA 2FHCA 2W66A 3SCQA 2WMKA 3MS8A 2Y5EA 1UKTA 2X05A 4MNLA 1OGBA 3UG3A 1QVBA 3VDHA 1OD8A 2OYLA 1PEZA 2AAAA 3AYSA 1E56A 3ARVA 2BXZA 4ML4A 3U57A 1V6WA 4ACYA 3FHAA 4NZCA 4RE3A 3VU2A 2EPNA 1OIMA 3DYMA 4LX4A 4J7RA 1H0IA 1Q6EA 4OIFA 2BHYA 1OM0A 3WNNA 4V2XA 3QOMA 3UG4A 4MNKA 3CZEA 2NT1A 1QHZA 3WD2A 4YHEA 4JCMA 2XHYA 1QHOA 2CYGA 2YIHA 3W26A 4RE2A 3EDFA 1C7SA 4IISA 1NP0A 3WL0A 3AICA 1E5NA 1KBBA 1JD9A 3BSGA 2VC9A 4UR9A 3PZNA 4RL3A 1US2A 2VR5A 5GQBA 5M17A 2J78A 4TVDA 4PMVA 5E09A 1TVPA 2C0HA 2WWDA 3VDCA 5C8BB 2QPSA 4W8BA 1HJVA 3IANA 5A2CA 1EHNA 1JFXA 1VEOA 2G41A 3ARYA 1B2YA 3PZVA 4AY1A 4FF5A 3W6LA 1VJZA 2JALA 3LPOA 5CGMA 5BCAA 3WF2A 5I3DA 2ZXQA 1WO2A 1MW1A 1HL9A 2YDSA 2E4TA 1KGXA 1UKOA 2CBUA 1VFMA 4H8VA 4LPCA 5HOSA 1NH6A 1TCMA 5CSUA 1ZS2A 3CHEA 2VCCA 2CPUA 4DWSC 2WMJA 1W3KA 2E8ZA 3AIRA 4OKDA 1HXJA 3M6DA 3VMPA 4PYSA 4HP5A 3M07A 2VO5A 4W5UA 4UFIA 4AZBA 3AIQA 4JL2A 5D9OA 3TTOA 1HVQA 3WELA 3VNZA 1BHGA 1NARA 2J7DA 1EOKA 3OLGA 2XVLA 1GQKA 3O6AA 1CPUA 3VGFA 1IT0A 2BV9A 3VIJA 1UKSA 1W9BM 1UD3A 4AZCB 2FDMA 2C7FA 5JBEA 3ZOAA 1C7TA 2HISA 3WDPP 3RILA 4LQ1A 3WNMA 4Z2HA 1ZBVA 4GZIA 2W67A 1GORA 5CLTA 2X0YA 1E4NA 3RCNA 2YA0A 4UQBA 3L2LA 1CXFA 4CCCA 1TG7A 2Y8KA 5D8ZA 4QP0A 3VIPA 1HNYA 1NWSA 5BYWA 1FOBA 3OG2A 3AHVA 2YLLA 4AZ7A 2VI0A 3WF1A 5JIWA 3MANA 4L4OA 4M29A 1H0GA 4UOQA 1DTUA 3VMOA 1E3ZA 1JFHA 3MMDA 3K1DA 3N17A 3BMWA 1KXVA 4H2CA 3KL5A 3CPUA 1U30A 3RM4A 1NOUA 4F9JA 1MW3A 2JEPA 4PBGA 4AEEA 3WQ8A 5A2BA 4PTVA 2WHLA 2BFGA 3SUVA 4HU8A 1TE1A 5E9AA 1CXHA 1W1TA 1WZAA 1HJXA 2XWEA 2J7HA 4W7UA 4LXFA 1CXLA 5A6MA 1CDGA 2D0GA 3VD5A 2RGMA 5A6BA 2VMFA 4U5KA 2VQTA 5FKYA 1NWRA 4HPHA 4A4AA 1M7XA 1ISYA 5DFAA 1UKPA 2WZIA 3EMCA 3WD3A 2ZWZA 3CHFA 4W86A 3PZOA 3W25A 5M5DA 4DUXA 1G1YA 3WN6A 1NQ6A 4H8UA 2D20A 4ZXLA 5A95A 1GZJA 5A6AA 4D1IA 4TX6A 1Q4NX 4QLKA 2WXDM 2GVYA 2G4FA 4GQQA 5IHRA 2VCBA 4UTFA 3S2CA 1BAGA 5A8OA 1VEMA 3MU7A 4HMCA 2V5CA 3MMWA 3WD1A 1NOFA 1LJYA 1LL4A 4DWSB 1KWKA 1M01A 3UG5A 1QHPA 4CCDA 2CHOA 4XX6A 5DF0A 2IXUA 3ARUA 3WIJA 1KGWA 3WQ6A 3NDYA 1V6YA 2WMHA 2GJRA 1BYDA 1FFRA 4URIA 1B3VA 4MB5A 2DH2A 3GNRA 3PZGA 2DT3A 4UZUA 3AS2A 4GXPA 5LA2A 1QI0A 4AZHA 1UD5A 3N11A 1B30A 1UZ4A 4JIEA 1M04A 2E9LA 2D22A 1SFSA 5GNZA 5DMYA 3AI0A 1K9EA 3SCSA 2TAAA 4AD4A 4MJ4A 1QNOA 2PBGA 1JGIA 2GSJA 4AZIA 5I5RA 1A47A 4MTVA 1PPIA 1GHSA 5CXPA 1DWHM 4ATWA 1WDRA 4J3VA 4J3UA 5CZKA 3MUIA 3LPGA 3GZAA 1V6XA 2GJXA 1P6WA 2GFTA 1W3LA 4M1RA 3IJ9A 4GKLA 1NOWA 1E6NA 4C7FA 4DUWA 2WPGA 1GOOA 4AMCA 4HMEA 1LWHA 3LMYA 3ZT6A 1LLOA 1VBRA 1C8XA 4HTYA 5BXTA 7CGTA 1CXEA 2OWXA 3VGDA 3T08A 3VIIA 4ZENA 4ZE5A 3SCRA 1G5AA 1H4PA 4D6EA 1Q6FA 2J74A 3SUTA 5E0FA 3VD4A 4GPNA 2DSUA 3POHA 2WVVA 1F4AA 1UH2A 1GJWA 1HF6A 2YLAA 4FLSA 4P7QA 1WDQA 3VGBA 4U3CA 1O7AA 3W28A 8A3HA 4B9ZA 3MSGA 5IFPA 4D6DA 1TFVA 1E0VA 4HZ7A 3WH7A 2G3NA 1JZ2A 4P8WA 2WVUA 1JYXA 1V6VA 1UH4A 1K6AA 1GVIA 4TTGA 1JIBA 4D71A 2J25A 7TAAA 1QW9A 3WL1A 3BC9A 4WSKA 1EOMA 4XV0A 1UD4A 3VD7A 1D2KA 3LPPA 4D6IA 3WEZA 3ALGA 3THCA 3GH4A 1J10A 2OSXA 4D72A 2DSVA 1UWSA 3SCUA 4UQCA 1WB0A 1MXGA 2YBTA 2VNCA 3PBGA 4NRRA 3B9EA 1PJ9A 5ECUA 1KCLA 4M82A 4PN2A 3CUIA 1W1PA 3NUKA 1BG4A 3VGHA 1S46A 1K9TA 3BXWA 5IXEA 3FN9A 4UFLA 2W62A 1QBBA 4EK7A 1FH7A 1FHLA 1JZ4A 6A3HA 3RIKA 1B0IA 5E70A 3AHXA 3ZT5A 4QLLA 2EQDA 3QOKA 2DSWA 4R5EA 4BA0A 4JHZA 2CBVA 4KWUA 2VVNA 1Q6GA 1EHAA 3BCFA 5JIPA 1E6XM 1UR0A 4WLCA 5BXSA 3WH8A 2UWFA 1H3GA 1NP2A 2VTFA 2BNJA 1NWUA 3UERA 4D6CA 1ISZA 4NF7A 1CGVA 1EQCA 1KXHA 2VX5A 2ZXBA 5A6KA 3ALFA 4UQAA 4PEEA 2EXOA 3TP4A 1D3CA 2ZUMA 5D9MA 3IAQA 3GH7A 3WF3A 5A8NA 2PWFA 1A3HA 4MB4A 5A6JA 3WD4A 2EO7A 2XG9A 3VOCA 1EIBA 2NSXA 4AZ5A 5FL0A 1AQMA 2W92A 3ARRA 2VRQA 3WH5A 1UOKA 4L4PA 4P8UA 2VL4A 3VGGA 4AZGA 3NSNA 1E0WA 3CUGA 1H41A 2WANA 5A1AA 3UR8A 2G3IA 2ZE0A 3AROA 5A8PA 1LQ0A 1V3LA 2CITA 4Z2JA 1E1EA 2YA1A 3L4YA 3VX1A 1GW1A 2VZSA 4W87A 3DYPA 5M3WA 3EDEA 5I0DA 3TTSA 4FLOA 7A3HA 3OGRA 1XSIA 2PWGA 1LG1A 5ABGA 1CBGA 3ZR6A 3OLIA 1JZ5A 2DT2A 3VD3A 1CXIA 4JL1A 4UFJA 1H2JA 3SEPA 1KBKA 3N12A 2E8YA 2WW5A 1J0YA 4F8XA 2WC4A 1JZ3A 2VT0A 2OLHA 4S3KA 3NSXA 2J8FA 1B31A 3AS0A 4MB1A 3U5UA 1UKQA 3L4VA 1BLIA 2GDVA 3CIVA 2BHZA 1ISXA 3WD0A 1PAMA 2VVSA 1TVNA 3CUFA 4PSPA 3GBDA 2VCAA 1XC6A 5HPOA 3SIMA 5CPQA 3E1F1 4W5ZA 3SCNA 5FCZA 2ZUVA 1V3MA 2OWWA 1W9XA 1ITCA 2BXYA 1XGZA 2WHMA 3CUJA 2G3JA 5HXMA 3EDJA 4K68A 1GHRA 2J7BA 3CO4A 4JKLA 2OYMA 3AMGA 4OUEA 4C7DA 1E5JA 4J3WA 2EPOA 2J7GA 4TVCA 4CVWA 2QF8A 4JFVA 1UA3A 4P7OA 3O2LA 4OOUA 2XPKA 3PZMA 3WF0A 3WNOA 1GQLA 5GNYA 3WKZA 4AXNA 1BVZA 4QLJA 4TXEA 2V3DA 2VX6A 1E15A 3ZT7A 3N1AA 1OINA 1CIUA 1W32A 3F5JA 1W1VA 4XZBA 1PX4A 2DT1A 4QFUA 4BCEA 1KWGA 3L4XA 1G01A 4CU8A 1JD7A 1HKIA 1QI5A 3KE0A 5KZ6A 1RH9A 1UR8A 2FGZA 4WK9A 1HJUA 1TA3A 1XYFA 4UFMA 3IAPA 2ZUUA 3CLWA 4KMQA 4WSJA 1JDDA 2GUYA 3OIHA 2J79A 1B3ZA 4X9YA 2O9PA 3FNDA 5HBFA 1CECA 1VRXA 1ODUA 4HA3A 4MPKA 4D1JA 2VZVA 1HKMA 4B3LA 3A4XA 3L4UA 1JG9A 1DP0A 2XWDA 4HZ8A 2PWHA 3ARTA 5KEZA 3VM5A 3BAXA 4AD2A 1UR2A 5D9NA 1WZLA 5AC5A 1V02E 1XCXA 2WNWA 5JUVA 3AFBA 1E73M 5BXPA 1V6UA 1QNSA 4KRUA 1JF5A 2ESCA 3BMVA 2O92A 2BVDA 2XSAA 3NSMA 2UY3A 2OWCA 4KGJA 3WQVA 4WF7A 2F61A 2DPEA 1DEDA 4IPLA 5A6LA 1KB3A 3ZJ6A 1W9PA 2PBOA 1R7AA 4TUFA 1RPKA 2WB5A 3VIOA 1J0HA 4CD7A 2V3GA 2E9BA 4H41A 2CKRA 3ZIZA 1CXKA 1LL7A 3UCQA 2ZWYA 2UY5A 3KL0A 2WC3A 3I3EA 3WFZA 5BWFA 1UHVA 3SUWA 4EAMA 5C70A 3RJYA 3F5KA 2J4GA 4HMDA 3SCWA 4XB3A 1C8YA 3VNYA 1BYBA 3WDJA 1RP8A 4HOXA 2XVNA 4N42A 5BROA 3AHYA 3T0AA 3BAIA 4ZE4A 1HIZA 5A6BD 1VEPA 3CZ8A 3AHZA 2VZUA 1JZ6A 4CN4A 5HNNA 1CYGA 1ESWA 2CKSA 2XVKA 2JE8A 3SCPA 5ABHA 1C91A 2D0FA 2CETA 1JDAA 1HJQA 1VB9A 3BCDA 1WAWA 1B9ZA 2J77A 1QI2A 4B9YA 1PIGA 4EKJA 5I2UA 1IZKA 1H5VA 1ZBWA 2WBKA 1JDCA 3AZRA 4BS0A 4KGLA 4JFTA 4OOZA 4UOZA 4CGTA 4PMOA 3J7HA 1J01A 1FP8A 3L4WA 4BQ3A 1V0KA 1WE5A 4WKFA 4JKMA 5I78A 1TUXA 2B31A 4HPGA 2O9TA 1V02A 1RD6A 3GXFA 1I75A 1UWTA 2JIEA 4MAZA 2YL5A 5CG0A 2X2YA 2CNCA 3PZUA 4Q7NA 1JAKA 1OD0A 2DH3A 3CZGA 3W27A 4CKQA 1XSKA 4W7VA 3L4ZA 2V5DA 4U31A 3A6OA 1H49A 2WKLA 1KGUA 4KH2A 1HVXA 3NDZA 1SMDA 3SUSA 4GO9A 1DHKA 2ZXAA 3A4WA 3WMCA 3QHOA 3SCVA 1EDGA 1QBAA 2JEQA 1KR0A 2RGLA 3IJ7A 1SR0A 1BTCA 1XD1A 2YL8A 1GCYA 4CCEA 3N15A 3ARSA 1UWUA 1U33A 2ZX7A 2XGIA 1W2PA 4WIWA 2XFYA 5CJ5A 5LA1A 4ZXOA 4PMDA 4GZEA 4MAVA 1ZBKA 4J28A 1C3FA 2OSYA 4JFSA 1OT1A 9CGTA 3W82A 1RP9A 4J3XA 1CZ1A 3CUHA 3W0KA 2WMIB 3BGAA 2JF7A 2BY3A 2XFRA 1CEOA 1W9UA 1JNDA 4LYPA 4FLQA 1MYRA 3BAJA 4ACZB 1MQRA 1GOMA 1OIFA 3AIEA 1CGUA 4OBRA 5E6ZA 2E0PA 4PMRA 4H04A 1XH2A 1C93A 2EPMX 5D4YA 2CIPA 3GBEA 3K8MA 2WSPA 2ZOXA 4TVUA 4UNIA 5CPTA 3HJEA 5AYIA 3BH4A 1GPFA 3CHCA 1KQZA 3GNOA 1TZ7A 2VRKA 1EGZA 5A6SA 2ZX8A 1JZ7A 3K4DA 1BG9A 5CSYA 5AC4A 4JAWA 1J12A 3WDQA 3AQUA 3N13A 2D24A 3S6TA 4AZCA 5DT5A 1UH3A 1W9DM 5I79A 3MKKA 2GK1B 2JF6A 3PZ9A 3HU7A 4JHOA 1IV8A 3BLPX 5CGTA 3WNKA 6CGTA 4LYRA 2WZHA 1SMAA 1FH9A 1V3IA 4DM1A 1M53A 1VBUA 1UZ1A 1I1XA 1E40A 1HJSA 1ZJBA 4S3JA 5BXRA 1H1NA 3DHPA 4W8AA 4OJYA 3WDHA 1GOWA 1QOXA 1ZB5A 2X09A 4PMNA 1E4MM 1XCWA 3UETA 3GXMA 4DUVA 3GNPA 1GOKA 2OYKA 3VM7A 1MXDA 4EANA 3AZSA 3VDAA 2W5FA 1PX8A 3ARZA 5CQ1A 1BSIA 1JAEA 1V3KA 4GI8A 1OB0A 3FAWA 3CTTA 4A3HA 2X1IA 3KWXA 3VVGA 3QGVA 2YBUA 1MQQA 1G0CA 1EO5A 4U3AA 2DIEA 1Z32X 8CGTA 2EBNA 3A4AA 4PTMA 4CUCA 1G9HA 3NJ3A 2X0HA 4FLRA 3ARPA 4M24A 5DT7A 3T2PA 3VMNA 4IM4A 1I1WA 4V28A 3WQ4A 1MFUA 3PZTA 4KRTA 3WUBA 4HZ6A 4QCFA 1PZ2A 1EQPA 3VD9A 1V3JA 3KL3A 3EMZA 4X0VA 4ATDA 4AIEA 4YHGA 5EFDA 2D3NA 4JFUA 2XIBA 2XVGA 3LPFA 4GINA 4Y7EA 3T09A 4E2OA 5IHSA 3QR3A 2J7FA 3PTMA 3IK2A 2WWCA 2BY2A 4W88A 1UD2A 1ZJAA 1FH8A 1M03A 4DWSD 4WKAA 4U5IA 5I24A 5DO8A 1CWYA 3TTYA 3AMDA 3FY1A 3GXDA 4AD5A 4NRSA 3HMCA 2VZTA 3VIGA 4HU0A 4IUGA 1E72M 4AYSA 1VFFA 3AYRA 4AD0A 1VENA 2YL9A 3CBWA 4XUYA 1E4LA 1EH9A 4OZOA 1CGWA 5D8WA 1FFQA 5D9PA 1CLVA 1E1FA 3U7BA 5TD4A 4DWSA 2FHBA 3ZM8A 3MV11 3W6MA 3U5YA 4AC1X 5E6YA 1J0JA 1KXTA 4D6GA 3RM8A 2BY0A 5ABEA 1JYWA 4UQDA 3AMKA 3CZJA 1V0NA 3AHTA 2ZX9A 3T2QA 5EFFA 3PN8A 1E4IA 3VIHA 4CD5A 5AY7A 1V0MA 2EPLX 4F66A 4ATLA 1V08A 1BFNA 2XJ7A 3AIUA 2WHKA 3AXHA 5C71A 2WMIA 3AMCA 1CGYA 2WLZA 2QV4A 4UFHA 3AZTA 3AS3A 2WVTA 1XRVA 3WUEA 5FL1A 2NW0A 1AMYA 2BHUA 4PTXA 1DWGM 4UFKA 1WPCA 3RJXA 4MJ2A 3OZPA 3AOFA 3MUAA 3WDRA 3G6MA 1W2VA 1DWFM 2A3EA 3T2OA 5FOOA 2XIIA 1GQJA 3F4VA 3EBVA 3WY1A 1J11A 3EDKA 3D5HA 2YL6A 1HJWA 3OA5A 3PHAA 3WH6A 2WM0A 5GNXA 1VJSA 1OBAA 1K9FA 2ZX6A 3PTKA 1JXKA 4CD4A 2CESA 1E55A 3ZR5A 3CZKA 1J0KA 5BRQA 1JYVA 3VIMA 4IPNB 1GOQA 3WQ5A 4MB3A 5I23A 2Y24A 3VIFA 1W3HA 1D7FA 3VGEA 3I3BA 2ZUTA 4PMYA 4CN1A
chains in the Genus database with same CATH superfamily
4H9YA 4C60A 3WJWA 1JZ8A 5TIMA 1MFVA 4H6EA 4I9MA 1QOQA 4Q4KA 2WQDA 5TBOA 4GXWA 5C55A 1JNEA 3L4TA 4BZYA 2XVPA 4IH3A 2O56A 2IPWA 1NM9A 3E49A 3DBNA 3GU1A 1E6RA 1E3XA 3PUOA 3W1AA 3MZNA 2Y7FA 3SR7A 3W02A 1ODZA 2QJHA 5J5RA 1S1RA 3URAA 3B0VC 2Y4SA 5HDRA 2NXGA 1GJUA 4GK8A 3TZFA 1VFSA 2BODX 5A69A 1KQYA 1ADDA 1MW2A 2G0WA 1R3WA 4LAUA 1LCOA 1MUCA 4PL2A 4LUIA 3T0TA 2ZRYA 5CPOA 4JS3A 2NV1A 3I3DA 1MRQA 1WZMA 2QLYA 3BTNA 4O28A 4P7LA 1O5QA 4M6QA 2OG9A 1EFZA 4US5D 2QHAA 2ATMA 1FCVA 3APGA 1WCGA 2NXIA 1O1ZA 3NR0A 2GPTA 4QE4A 1WZKA 4B90A 1TX2A 4XZ9A 3W1XA 1VYPX 1GZGA 1S3TC 4NZ3A 4NXKA 2QZRA 3O15A 4OFCA 4WCJA 4HKPA 4D6FA 1E43A 2J47A 1W3IA 4GFSA 1OGSA 1R8LA 2PLCA 2DORA 1YNYA 4KWVA 4KT2A 1RPXA 2EGZA 4BQ5A 3B3DA 1XV8A 4HSHA 3H4GA 1E6PA 2ZTKA 3LV6A 1ISWA 3NVDA 2OTDA 3SM0A 1EZWA 2XGBA 5EB8A 2PGFA 3STGA 1UD6A 1VYRA 3DBPA 4QIUA 3MT1A 2EEXA 3QHNA 4DVOA 3O05A 2ZZ4A 4X3ZA 2Q8XA 2Y2WA 4LYQA 2D2JA 3N34A 4H83A 4FK9A 4CN6A 3OOQA 3LCIA 3SQSA 1EA9C 2Z28A 7REQB 1JCXA 3CH9A 5JBFA 1A5BA 1QU4A 3EPNA 3T42A 1J0IA 3U4AA 4DPPA 3GG8A 2CBIA 1DWIM 3A3WA 4KF1A 1EDTA 4C7GA 5ECVA 1JRBA 1U1UA 5DBUA 3WJXA 4RLIA 2WK2A 1O68A 4JQAA 3VPLA 1L0PA 1AJ2A 3HQ1A 3UT0A 4GJJA 5EMYA 3G0UA 4K1GA 1QWKA 5HPCA 3QV6A 3FHQA 2V8ZA 3TN3A 2XH2A 4FMVA 2I56A 3CAQA 3EDDA 1E0TA 4HYWA 1ONWA 3V0UA 1LYXA 4CQAA 1E71M 3V5CA 5EYWA 4YPJA 2OSWA 2W91A 2X0SA 3OZOA 4AD1A 4TOQA 1U1JA 2J8GA 3WEOA 1QNPA 3KBWA 1I2OA 4LRTA 4JTTA 1UR1A 3MMUA 2J7CA 3VE7A 3O7UA 1VCGA 4O12A 1XL9A 2G95A 1DPMA 3VUSA 3VZYA 2W63A 2O7SA 3LV5A 8RUCA 2QCLA 4QNEA 3SQMA 1EBGA 3W38A 1XLIA 5A8MA 3MHUA 2VFEA 2Z27A 3P61A 4L5ZA 5EBAA 3LNMA 2Y63A 2R1KA 1ZL1A 1KTCA 2V68A 3QGKC 1ADSA 4GI9A 4XUGA 3W53A 4PSRA 3W7NA 3GDKA 4HNLA 3P93A 2PP3A 3SGGA 3C2OA 3TEVA 1LF1A 1U22A 3BAKA 1E70M 1R85A 2PRMA 4Q7BA 3C2EA 3PB2A 1F6KA 3TIMA 1UOZA 4Y9AA 1GZ1A 3CHDA 3GDRA 3UR7A 3HN3A 1JI2A 3WQDA 1V79A 2E6YA 4IFKA 1F07A 1OWQA 1UQYA 1JF6A 1BGGA 4GGHA 4JN6A 4P7RA 1MVYA 4BHYA 5I3GA 2BBFA 3T07A 1DWJM 4KFOA 1I45A 1JL8A 4JYEA 2P8CA 1GONA 1LWJA 4QRNA 2CLEA 2RDTA 3VABA 2YPIA 3WLRA 1XBYA 4LJ3A 1P0BA 3ZSSA 2VUYA 3M1ZA 2A3CA 4MJZA 2PWEA 2ZRVA 1SQ7A 3THAA 4BY3A 3ZJ7A 4Q8TA 2QCDB 2XINA 4YTQA 1HKJA 2J7EA 1Q6DA 3Q67A 1EDQA 4OBSA 4O50A 3M44A 4Q8PA 2BASA 5HNTA 2H9AB 1QOPA 3WUFA 2CLPA 3DKJA 2A3AA 3OEXA 3PB0A 3UXAA 4F0SA 1W1ZA 1LROA 2YYTA 3LY0A 3VOJA 3G0XA 4GZJA 4RX0A 3PAOA 1RCXB 2I16A 5FD0A 2V3EA 3EWUA 1O5RA 4UQ9A 3V35A 3PR2A 3ZQ9A 3PZIA 3KXQA 1FWSA 5CZSA 1KTNA 3OBAA 4ZTXA 2ZYFA 1VBJA 2VQUA 2WMFA 4O8AA 4Z42C 4PMUA 3WMSA 4HOZA 1UJPA 3DAQA 4BI5A 1CW2A 3WQGA 1DJHA 4ECLA 3PF3A 1ISVA 3W4RA 1Z8AA 2WJZA 3CUXA 1LRTA 4MFDA 4N0RA 3ZJKA 4LVAA 3K46A 3STEA 5AECA 1C8QA 1TTPA 1NSJA 2JFEX 3P8IA 1CGXA 1CNVA 3GXNA 3RMEA 1WNOA 2ZVIA 1HKKA 4JN7A 4QROA 2HNEA 1E9LA 4EVZA 1EP1A 4DZIA 5H8PA 1NFGA 3OBEA 3QJAA 2GVLA 1KFWA 3FFSA 4F0MA 1PCWA 5U7SA 2XM1A 3TN4A 4ZQNA 1W5OA 4G7FA 1IEVA 4PGLA 1XC4A 3IIXA 3SCTA 1W8SA 1TV7A 1UWIA 2XM2A 2CEQA 1J9YA 1OFRA 2FZ8A 3QV9A 4J3SA 1G94A 5I02A 4A3RA 5BRBA 4RZ6A 3CWNA 3SI9A 3NURA 4H4IA 1RK6A 2BXVA 4I6VA 4E4PA 4PMQA 3EGJA 4UC5A 3EYPA 4NAEB 4D6JA 4MZ8A 4J3ZA 1TVLA 4XZWA 4ZFMA 5BOFA 1M68A 4AX7A 2KX9A 2AAMA 3SAZA 3NM1A 2ZZ1A 1EJRC 4J3TA 4IMFA 3T4WA 3P0XA 5HA7A 3N6QA 5IM51 1NFPA 1FCUA 2QPUA 3G1AA 4W8LA 2QUTA 3TYAA 4GIAA 3GW3A 4IQDA 3VFCA 3AXMA 2YOCA 1UR9A 1JYNA 2XFWA 4Y9NA 4AEFA 3CEUA 3W85A 3UA4A 3NYDA 4W89A 2BWGA 5CC5A 1KXQA 2WCAA 1XH0A 3PUEA 4W7WA 2GVGA 1PZ3A 2QCMA 1VBHA 5I77A 2DVUA 3RM9A 5F1UA 1AW5A 2PUZA 3N18A 1YMYA 4UCFA 4HA4A 3BAWA 1LUCA 3ZYZA 3IJ8A 3PANA 3OLEA 2FHCA 3W75A 1VP5A 4C1KA 2VM8A 3W7GA 4DBUA 3UJ2A 2X05A 4MNLA 1OGBA 3LSBA 3RX3A 1JULA 4ZOAA 3DXIA 1T0OA 3AYSA 3FX4A 1UMYA 1G67A 2O55A 3M0VA 2NX1A 4RE3A 2EPNA 5D38A 2EKCA 3S1GA 1H0IA 3R2GA 2I9UA 4OIFA 3WYZA 3QYQA 3C2FA 4MNKA 4O11A 3TA6A 4F0HA 4ERIA 4MJMA 1WKDA 4AY7A 4YWIA 1UUOA 1RBLA 2OKOA 3BQ6A 3V4BA 2HBXA 3K30A 2PP0A 4N6EA 1C9DA 2I14A 4IL0A 3NL3A 4XISA 1ITUA 3Q37A 3W83A 1GTHA 3H54A 3EDFA 1VQTA 1LORA 1E5NA 4KRZA 2C79A 3BSGA 5AB3A 5AZ1A 2J78A 1OCJA 1WYIA 5E09A 1X8CA 3VDCA 1A5CA 3LGEA 1SO3A 1SFJA 2PDUA 3NZPA 1VEOA 4G6CA 3MYOA 5AOUA 1VJZA 4H6RA 1TWWA 1H7NA 2OEKA 5CGMA 1TYGA 3WF2A 3MY9A 1MW1A 3N6JA 3CV6A 2OZ8A 4V15A 4LPCA 3QW4B 1TCMA 3M5VA 1DE5A 1ICPA 1FWRA 3ATYA 1IWBA 2OB3A 3HQNA 5XIMA 2E8ZA 3NG3A 1YBQB 1KM5A 4HP5A 1OFQA 1FDJA 4JL2A 1FWFC 3CPRA 3DGBA 3LHVA 4EIVA 2QR6A 1NARA 4Z1BA 3MBDA 1T6MA 3TMLA 3UWVA 3OLGA 2XVLA 2HVOA 1MXSA 2AGKA 3WK1A 3QKZA 4IPPA 3LCHA 1W9BM 4AZCB 4FNRA 5HWJA 1I2QA 1R46A 4KCVA 2HISA 3UPMA 1Q7ZA 4MYXA 1TB3A 5C9WA 3WNMA 3W9ZA 3E2QA 2PFHA 5BOOA 4DYEA 1GORA 2Y61A 3WLLA 2ZC1A 1TJ1A 1ICQA 2YA0A 1VLWA 9RUBA 3L2LA 4IMEA 1FBAA 3VIPA 2XU2A 1PKNA 3OG2A 3L68A 2YLLA 4AZ7A 4HHPA 2WPBA 2QYGA 4M29A 1VBGA 1H0GA 2A2IA 5DBTA 4ICNA 3N17A 3BMWA 4K38A 4US6A 3CPUA 1U30A 1NDZA 4LAKA 4HCHA 4F9JA 3ZXWA 4AEEA 4XAFA 4PTVA 3WQOA 3G18A 1LQAA 5KITA 1H60A 3BQ5A 3SUVA 3EEZA 2DP3A 1W1TA 3OVRA 4LC8A 4LXFA 3L67A 4S3EA 1CDGA 2G97A 1JRCA 3A21A 1XIDA 4LNCA 5A6BA 1RVKA 3NWRA 2VMFA 3ZLFA 1NWRA 5HANA 4EP8C 7TIMA 3KTCA 4LB3A 1A5OC 1ZUAX 4CNNA 4IG2B 1M7XA 4A4AA 3TZNA 2X7VA 5JH2A 1NTHA 1PSCA 1G1YA 3MI6A 1NQ6A 1YDOA 4H8UA 2ON3A 1NAL1 4ENLA 3VKJA 3GZ3A 4ZSUA 4Q8OA 2WXDM 4GQQA 3CQKA 5IHRA 5C5YA 1OC5A 3GSMA 4RXGA 3MMWA 1NOFA 3QPEA 1LJYA 3LRLA 3ABQA 1KM6A 1M01A 4UTMA 3UG5A 1QHPA 3CNYA 1G4TA 4I90A 4ORIA 4AVOA 4CCDA 3DDMA 2R1MA 4MY8A 1G7UA 1GQNA 1L2UA 1D7KA 4GCXA 1ECQA 1FFRA 2H90A 3BOFA 3PZGA 3RX4A 4AC7C 2H8XA 3W1MA 3Q94A 2HRWA 4B92A 2QVNA 1UD5A 3U4FA 5CJMA 1B30A 4M0XA 1UZ4A 2Q3RA 2DVTA 5LHFA 2FDSA 1M65A 4Q8VA 3WLTA 1D3HA 4DB7A 4QJ5B 3KTXA 3W1QA 4F2BA 4AD4A 2Z29A 2PZNA 3CUZA 3NTYA 3NO1A 3UYIA 4J3VA 4J3UA 5AHNA 2GL5A 3W7OA 3LHWA 3GZAA 5A5WA 1VCFA 2NV2A 2GJXA 4X9SA 1FUYA 2GFTA 1W3LA 3WBWA 2X2GA 4ES4A 4Y9OA 1E6NA 2QGYA 4C7FA 4DUWA 1B57A 3HGSA 3W7QA 1HKWA 1U1HA 4C6FA 5AC7A 4E6MA 5I06A 1LRNA 1VBRA 7CGTA 4O16A 4PR4A 4IT1A 4H19A 4ZE5A 2YCIX 3SCRA 3C0LA 3L9CA 1P7TB 4D6EA 2J74A 3TROA 4FEZA 3SUTA 1FWEC 1O1HA 3SZ8A 4TR9A 5E0FA 3VD4A 5KSWA 1FHUA 1XKJA 4JX5A 3M7WA 1H1ZA 3M0ZA 1Q2SA 3GO2A 3VGBA 1T7LA 1RSCA 2Q8ZA 1N8FA 1O7AA 3RLGA 4ZR8A 3W28A 8A3HA 2W0UA 2G3NA 1JZ2A 2WVUA 2BG5A 5U4NA 3H2NA 1GVIA 1S38A 4CNSA 1JIBA 2QNEA 2J25A 7TAAA 5CAHA 2EPHA 1UBPC 3BC9A 1UD4A 2CZEA 3VD7A 4JEQA 1XI3A 3VKAA 3WEZA 4DJFD 2PU1A 3W7HA 4NNCA 4UQCA 4I9TA 1WB0A 1MXGA 5C7HA 2RH9A 3PBGA 2HBVA 3KCJA 1YXDA 1OX4A 2V2DA 3CUIA 3NUKA 1WQ5A 2QEZA 3VOHA 1TV2A 5IXEA 1OZQA 2I1OA 5DCDA 4UFLA 3I68A 3VCCA 4IICA 1FH7A 1FHLA 6A3HA 3BL3A 4XSMA 1SW7A 3G77A 1W6TA 4EACA 1CX9A 3AHXA 3EB2A 3GXTA 3ZT5A 2EQDA 4KIRA 2DSWA 1Y5VA 3GUGA 4IMGA 3UXKA 2VVNA 4LEFA 1IEQA 1W54A 3H22A 5I07A 5LNWA 1GG1A 4UTKA 3WH8A 1YE6A 2ZDSA 1EKOA 1GW9A 2V81A 4D6CA 3NGJA 1ISZA 4CEXC 1X38A 1EQCA 1KXHA 3NQ8A 3ITLA 2EXOA 2OZTA 2YXOA 4N9BA 2QW5A 1D3CA 2YGYA 1V4YA 3IAQA 3GH7A 1A5SA 3LUTA 3AO0A 1KC7A 1A3XA 3WF3A 2Y0FA 3QH2A 3MA8A 2HS8A 4O52A 3PG9A 4MB4A 3STFA 5A6JA 2F7FA 3WD4A 5DN1A 3IIVA 1YDVA 2NSXA 4F40A 4REQA 5FL0A 2VRQA 5M1TA 4L4PA 1LTDA 2NVAA 1YXYA 3M43A 3NSNA 1E0WA 3ZVIA 1XGEA 1OQFA 3S5ZA 4C65A 2G3IA 3LZ3A 2I5QA 2ZE0A 3C2RA 1LP6A 3G8RA 1I9CB 4HTBA 3VC6A 2YA1A 3L4YA 3VX1A 3BMXA 2RDXA 4I8YA 4IJCA 3RPTA 3EDEA 4NILA 3W07A 4FLOA 1LG1A 1S2AA 3ZR6A 4L9ZA 1JZ5A 3C0SA 1YPFA 3ABSA 1DIDA 4UFJA 3OYZA 3SEPA 1KBKA 2E8YA 4Y2WA 1JZ3A 2VT0A 3DHDA 5H8UA 3L12A 1H7RA 3H53A 5F2MA 1SZFA 1M1BA 1PTGA 2TPSA 1UR3M 3S2MA 3CTLA 1OYAA 2OOGA 4XAPA 4DRSA 4ZBCA 1UBSA 3M5YA 1PAMA 4QAIA 3QZAA 3DFNA 3CUFA 5FI8A 5HPOA 3E1F1 1UC4A 3NZ1A 2FLIA 3FVMA 8XIAA 2OWWA 1IXOA 2WHMA 1KW1A 1KFBA 1JJKA 3EDJA 3FA3A 2AL2B 3DI0A 1O94A 1E5JA 3CV2A 1UUMA 3BE7A 3E0VA 4TVCA 2QF8A 4P7OA 1XFCA 3Q4DA 4ZQCA 3GG7A 2TSYA 2XPKA 4JTLA 2PDFA 3WF0A 4EWND 1PYMA 1RJQA 1GQLA 3MKVA 3SSJA 4K37A 3N2BA 1BVZA 5HK4A 4QJ4B 2IS7A 1XFBA 3P0WA 4GUHA 2VX6A 4MY9A 3TCEA 3N1AA 1OINA 2HCVA 1W32A 4ASTA 1W1VA 3W86A 5KZDA 2ADAA 1JD7A 1A5NC 5KZ6A 1RH9A 1Q6LA 4GYPC 2P3ZA 1TA3A 3R58A 4N7QA 2QDGA 2ZUUA 4EPBC 4KMQA 3GFYA 3OIHA 4GUGA 2V6AA 1HUVA 1JUKA 4HA3A 4US5A 3A4XA 2VEFA 1DP0A 2XWDA 4D8LA 1XCXA 3GVVA 3T7VA 3AFBA 1FRBA 2HE8A 4UIOA 3BMVA 4WDTA 3LBMA 5MKGA 1Q7QA 3WQVA 1IIHA 4WF7A 2F61A 4LVDA 3PTDA 3PPFA 2PBOA 4TUFA 3LERA 1RPKA 5CBJA 3E38A 2E9BA 4ZVJA 4H41A 2CKRA 1ML1A 4FAMA 4MLRA 3UCQA 3W2MA 2DU2A 2UY5A 2QVHA 3WK3A 1Z44A 3O06A 3U2EA 3SUWA 4FA3A 4K3ZA 3BDKA 1WUEA 2ZZ7A 4XB3A 3DGRA 1BYBA 3WDJA 3HMJG 3KOWA 3BARA 3AHYA 4DF0A 1VEPA 1K7FA 3AHZA 1TX0A 3GWQA 4OHQA 1CYGA 2E77A 2XVKA 3AXKA 3ABOA 2D0FA 2GSEA 5FEPA 2EG7A 3DOPA 3NZRA 3RMJA 2GQ8A 4EKJA 5I2UA 1IZKA 1H5VA 3AZRA 1XUUA 4JFTA 4OOZA 2EAWA 1DOSA 1ZRQA 4IQLA 1J01A 1EL3A 1K7XA 4OE7A 4WKFA 2YZRA 1R2SA 2O9TA 3GXFA 2P50A 3EOOA 3VKCA 4JNMA 5HQLA 3UY8A 3M9YA 2BOFX 1ELSA 4Q7NA 4AEOA 2FZ9A 3CZGA 4LWWA 4W7VA 4LALA 3L4ZA 2OT1A 3IV8A 3A9IA 1SW3A 4JTGA 2WQPA 1H49A 2WKLA 4Y9PA 4DNHA 1HVXA 2PWUA 1OFBA 5DY3A 3SUSA 5LGXA 1DHKA 2ZXAA 3WMCA 1AW2A 2CU0A 2Y7EA 1IXQA 3SCVA 4AWTA 1TV3A 3IUHA 1Q6OA 4PUUA 1EDGA 2JEQA 2FZNA 2BX7A 1BTCA 1XD1A 1KNWA 3B8IA 4ICCX 3N15A 3ARSA 4WJ8A 4GVHA 3ES7A 2HNHA 4GC4A 1W2PA 4WIWA 4CQCA 3LRMA 4IIFA 4ZXOA 4MAVA 2PCQA 1C3FA 5MHBA 9CGTA 1GWJA 1TV4A 4KESA 3W82A 1MMFA 2WSYA 3IEBA 3U9IA 2Y7GA 1T41A 1W9UA 4LYPA 4KPLA 4FLQA 4JEJA 3PFMA 4L1WA 4GBDA 2IKIA 2VEPA 1T8QA 1V7AA 2Z1XA 2QAFA 5EMUA 5D4YA 2NV9A 5JVLA 3GBEA 3K8MA 3B0XA 2FVKA 3DFSA 1EP3A 2VRKA 4J2PA 1J79A 1BG9A 3OIXA 2VP8A 1AD4A 2YB1A 3N13A 1AQFA 2D24A 4AHOA 3QM3A 1XLDA 5T91A 3I6TA 3BLPX 4NJIA 3B0UX 4RDZA 4LOCA 3B9OA 3BW2A 3GR4A 1VHNA 1SMAA 5BZAA 1FWWA 1IYXA 3FA5A 4Z0JA 4LUYA 1VBUA 5LKYA 3H7UA 4DWDA 5CZ0A 3GY1A 3ONCA 3UP8A 4OJYA 4M6PA 2Q09A 2H3BA 1ZB5A 3C3UA 1GOXA 2PD5A 3KS5A 1R0MA 2GGIA 2BLEA 4GX9A 4XQ6A 5CQ1A 4KEVA 2NX3A 4HPNA 4QQ3A 1V3KA 4O1CA 4A3HA 1HTIA 3KDNA 3KWXA 1ZCOA 1ZZMA 3JW7A 3QGVA 3HPAA 1EO5A 1Q65A 8CGTA 4ZODA 4QDPA 4PTMA 3NJ3A 2X0HA 3VMNA 3ARPA 4DF1A 4V28A 3VYLA 3WQ4A 3WUBA 1L9WA 2OLAA 4TQTA 1PZ2A 3O6YX 1LBFA 2RDUA 2YCLA 1V3JA 3ICJA 5FJUA 1Z7AA 3H6OA 3EMZA 4X0VA 1Q8AA 2RFGA 3SO7A 1PL9A 3G5EA 4ZO9A 4JFUA 5HMEA 3GYEA 1EPXA 2E6AA 2J7FA 2B4GA 3GKAA 3IK2A 3IRDA 2VWTA 2WWCA 3VCNA 1UD2A 1M7OA 1R2TA 1M03A 4IIHA 4DWSD 5AFDA 4U5IA 4DJDD 4QISA 4Q3MA 1Z41A 3TTYA 2NVDA 4AD5A 3PBYA 2I17A 4QX4A 2Z2BA 3HMCA 3NEHA 4FO4A 1Q6RA 1VFFA 4AD0A 4IOTA 1E4LA 3Q58A 1EH9A 3P80A 4DXKA 5D8WA 1FFQA 2RJHA 3MYPA 4FNPA 3V3WA 4O54A 1M9HA 4WJEA 3ZM8A 5GJPA 3Q45A 1XIFA 1W3TA 3MV11 1WX0A 3XISA 4AC1X 4D6GA 2FGBA 3K1GA 5ABEA 1SUXA 3AMKA 1TV5A 3QC0A 1KRAC 1SM9A 1FKXA 2PTYA 4TO8A 1YEYA 4AU0A 1FWGC 5AY7A 3R8HA 4F66A 4PCNA 2V30A 4IGNA 1EBHA 1V08A 5CSSA 4IIGA 3NQ6A 3H7VA 5EMJA 3AIUA 3O6DA 1XLBA 2WLZA 4NXSA 2VEKA 1K1DA 3AS3A 4NQ1A 1P1XA 4OQVA 1AMYA 3LN3A 2BHUA 1DWGM 1G7VA 1XICA 1DL3A 5BOEA 1TJRA 3C86A 3MI2A 4HMNA 3GE7A 5G2IA 4JGDA 3HJZA 3E2VA 2Q3OA 1UROA 2Z2UA 1FWJC 2HPIA 2HDJA 1D8WA 3ITGA 2PC4A 3QPZA 1S3HA 2E28A 4IP4A 1OBAA 1IF2A 2J9YA 3I6RA 2A0NA 2Y5JA 2ZX6A 3FK4A 4KCTA 2OKTA 1JPHA 4O53A 2FPTA 4YVVA 3ZR5A 4HJFA 4GQ0A 2OR2A 5DELA 3VIFA 1D7FA 3I3BA 2ZUTA 5AN7A 1KR1A 4M7TA 4U33A 4ZQRA 4HOWA 3OGSA 3WJSA 4JY9A 3HQPA 2J6VA 2ZCGA 3NQAA 3SB0A 1HGYA 5HJLA 4F0KA 1W17A 3GQYA 1IZJA 3FDGA 4ZB0A 3C8FA 3OLDA 1XWYA 2X1TA 4HHMA 2WKGA 4N4PA 3MCNA 1EEXA 2ISFA 5HR7A 5FEWA 1EWDA 2IXVA 3RNDA 3VKKA 3CZLA 1HL8A 2ALDA 4JNYA 4F79A 3AIWA 3LM3A 1JUEA 3R6IA 3RO8A 5FF4A 5LA0A 5G2HA 4GYKA 2V38A 3MB9A 4RDYA 3OQEA 4ZO8A 1CLKA 1OFAA 3GM8A 5E5CA 1KRCC 2ZA3A 3I7RA 4HQVA 3LLFA 1N82A 3N4FA 4UQEA 3RU8X 4L80A 4DJDC 3WSUA 1UUQA 5L9FA 2VR4A 4LTSA 1S2CA 3EB3A 3WF4A 1R87A 1BVWA 2D0HA 1YX1A 3R43A 1RA5A 2PPGA 5CPSA 2CBJA 1VIWA 2Y7DA 5TNVA 4QGCA 1X6LA 4TX8A 1W9VA 3KUMA 3AUJA 4C1NA 3BURA 3S8HA 1EX5A 1GK8A 2O9OA 1PX3A 4A6GA 3W7PA 3L23A 2GVJA 1XYZA 3HG3A 2CLHA 1UZHA 1SO5A 2G8ZA 4I9JA 3CWHA 5E0CA 1S5MA 2ZZ5A 1POJA 2TYSA 1OCBA 2WC7A 1KBJA 1SSGA 3BG9A 2GJPA 3G1HA 5FESA 4N9DA 2A6LA 3UYCA 1QI4A 3T0BA 5CSRA 3UEQA 3DCPA 3LX9A 3CMFA 3E6EA 3WEMA 3KRUA 6TAAA 5A2AA 1KLYA 4JTFA 4AWEA 2BS9A 3UJFA 5FEXA 1UYQA 3B9NA 5I6SA 1HX0A 2NQHA 4AIUA 3ZMRA 1SJDA 4I5UA 3R0KA 3BV4A 1BGAA 5JU6A 4CVUA 2PP1A 3DC0A 4LCRA 3WQFA 2VUNA 2XYLA 4M5PA 2XSBA 2E5DA 1HG3A 1DQWA 1JPIA 2RJGA 1CB2A 3QSRA 2PEVA 2POZA 3N2OA 4QG6A 4B2DA 3C4UA 3N6HA 4NUWA 3HTWA 2F84A 2W61A 2WLYA 1ITQA 1R6WA 3USZA 4GCAA 1W1YA 4W84A 3R8GA 3B9AA 4A3YA 3CM4A 3BJTA 3B03A 4QSFA 2OOFA 1RY8A 4LRSA 2V67A 1XPGA 1RAKA 3FGCB 2Q6ZA 4MKVA 4DM2A 4LCSA 1NWTA 1TZ9A 2E1WA 1QWGA 2Y88A 4OGZA 3OZMA 1TKKA 1NDVA 1V77A 2CERA 3P14A 3W73A 3YPIA 1W91A 5JMUA 2A6NA 4Q32A 2QCEA 1SJCA 1ME8A 5AZ0A 4CQDA 1OG6A 3N73A 4HYRA 4JQ4A 5RUBA 4UNLA 4WOZA 4MNJA 1OGGA 5G5IA 2WVSA 5K4ZA 4LUJA 3DERA 2P1FA 2AMGA 4Y6GA 4GE8A 3O8AA 5FF3A 1B3XA 4GOAA 1OYBA 1PIFA 4DI9A 1TIMA 3MZ2A 3QV7A 1F74A 1SZRA 4NSBA 2V69A 3SGZA 4FF7A 1XLEA 3FEMA 3UFYA 1KKOA 1XDMA 6ENLA 3GK0A 5REQA 1R86A 4DO5A 2Z7KA 3PK7A 4YLWA 5CZJA 4QBXA 3AXXA 4PUEA 2WYSA 2E7FA 4WUIA 5A3HA 2D2OA 1MW0A 4LV9A 1UG6A 1H7XA 2X41A 3P74A 1AODA 2PDIA 1VC4A 3H2AA 4BK9A 3DG6A 5B7ZA 4RV8A 1THFD 4IFRA 1WOBA 3SCOA 1E0UA 1P6BA 2FB2A 1H09A 4WQ6A 3W7LA 1BXNA 1I60A 4IMCA 1LOQA 2B81A 4H00A 4KCUA 3WLJA 3GNXA 4INFA 3MJYA 1EXPA 4O15A 4NX5A 1DJGA 2VX7A 2OX4A 4XKYB 1N8IA 2Y8VA 2YZ5A 2I5IA 4Z1AA 3VILA 4Q8NA 1UQZA 3B04A 4PZVA 2YW4A 4L9XA 4Q8WA 4YIWA 1YHTA 3JUGA 3ITVA 3N9KA 3OB8A 1C9WA 3RLHA 2D1ZA 3GKFA 4IQJA 1C92A 3NAVA 5DRIA 4LYKA 3T78A 2QGHA 7ENLA 1UPPA 3NO5A 2GWGA 3L0KA 3QSTA 3TOYA 1FA2A 2CZ5A 3KHJA 1FXPA 3TA9A 1VJIA 3CXOA 3OODA 4UTJA 1CLXA 4PEKA 4MDPA 3RPDA 4F9DA 1P0KA 3FIGA 3F5LA 1HN1A 1RLDA 2LLEA 1F4HA 5HMDA 6REQB 4M6UA 1EEPA 1PKMA 2Z4GA 3ENLA 3UWQA 3BSMA 4KEZA 4WDUA 1NFBA 3N3TA 5AC8A 1WBHA 2IMRA 3IGSA 2A3HA 4UXDA 2AKZA 2QF7A 2IQTA 4FNSA 3PUDA 2DJLA 1GYLA 4WVXA 5DMLA 1SO4A 4GYPA 4U2YA 1R7OA 3D0CA 4H9MA 3S2NA 4PTWA 1ZBCA 2CCRA 1QW8A 3GH5A 3GTHA 2DZVA 4GABA 3CMJA 1UW9A 3QXBA 4IZGA 3NXLA 1ZHAA 4AISA 2ZBTA 5ABFA 2CXGA 2BY1A 3STPA 5AYBA 3FW6A 4JTAA 1R3TA 3OGVA 4GACA 3IGHX 5HQEA 3G22A 3S5SA 4E3VA 1PS9A 3UG8A 3TOPA 4FNTA 2VR2A 4ACZA 1E6ZA 3HOJA 3AIVA 3WZ0E 4BQ2A 1GGOA 3IWPA 3W01A 4B3KA 2V2CA 1ZLPA 4CU7A 1VPXA 1EJUC 4S3CA 1MZRA 3IGXA 4EE9A 4QQUA 4DXXA 3NCOA 3DH7A 4RW3A 4PCFA 4J2MA 3KDOA 5FACA 1TPDA 1DJYA 3FEQA 1O6IA 1MO0A 1YLVA 2D2HA 5LXXA 3M0IA 3BVJA 3K8KA 2A3BA 3NPVA 1TMQA 3EOLA 4PUWA 3S83A 2GK1A 3TTQA 4CD8A 4NJHA 5FA5A 3F03K 5I3IA 3DHUA 4ZGYA 1GVYA 4PBEA 1F2JA 4V1YA 4C6EA 3G1FA 2ISWA 1FY6A 3QV8A 3SCQA 3MS8A 2RAGA 2Y5EA 1UKTA 4KWWA 1UB3A 2PDPA 2PRLA 3ITCA 3UG3A 1QVBA 3K2GA 1OD8A 1FCBA 1YW1A 2CWXA 3WJZA 1XDLA 1E56A 3WLQA 4ZFCA 2JGYA 1RJPA 1V6WA 3UVIA 3H2OA 1OIMA 4C6NA 4J7RA 2W27A 4RDVA 1Q6EA 1J6OA 2GZXA 5D30A 2DZWA 2Z25A 2OVLA 3UG4A 3VI2A 2NT1A 3P3BA 2NUYA 2R6OA 1R47A 4JCMA 4LUTA 1TCDA 3VDGA 4Q8MA 5E9XA 3NQ2A 1QHOA 3KRZA 4QS5A 4GJ1A 1XIEA 3LI0A 3D6NA 2FTWA 2CXEA 5DRCA 2ZZ3A 4RE2A 2VC6A 4PUNA 4IISA 5BU9A 2VC9A 3PZNA 4RL3A 1L8PA 4HN4A 4CQBA 2VR5A 3OW1A 3TNOA 4TVDA 1I2PA 4B5UA 2C1HA 2VD8A 2ALRA 2G41A 3ARYA 3PZVA 2ISDA 2FZMA 2ZZ2A 1E51A 3AALA 4QM1A 3H21A 4H9VA 4JYFA 2JALA 4KKXA 3WBYA 3OG3A 1OYCA 1TWZA 3FLUA 2ZXQA 2E4TA 4TIMA 1KGXA 2AGTA 1NH6A 4O4VA 3U8GA 3PSWA 2DV0A 4OKDA 3AIRA 4GFIA 4B5NA 1HXJA 3M6DA 4XZMX 5ENLA 1XIJA 2DZSA 1RA0A 3VMPA 4PYSA 1ZALA 3BICA 3M07A 3TE9A 4W5UA 1GVRA 4AZBA 3HPXA 3EWYA 5F4WA 5BU6A 3RG6A 4K8EA 4J5NA 2HXTA 3DG3A 3ITOA 4L61A 1GVEA 2YX0A 3ES8A 3F4NA 2VWSA 3AU2A 4OBTA 3V1HA 1MUMA 3VGFA 2BV9A 4FS9A 3VIJA 4GVIA 4B5TA 1IR1A 1VS1A 2JBMA 2C7FA 1TTQA 5LSMA 2OLSA 1OFOA 3TJXA 3RILA 2V63A 1JCTA 3GG1A 4DBEA 4GZIA 1MI3A 3I10A 1P0DA 3WQPA 4LY4A 5DQPA 4V1XA 1GTEA 1SFTA 1XGDA 4GX8A 1JPMA 4R85A 2PWVA 3FDKA 3DFPA 5D8ZA 3E96A 2GGGA 3UGRA 3JS3A 3FJLA 4K36A 4AXKA 3LM7A 4I9AA 2OO0A 3WBXA 3WF1A 3MANA 4L4OA 3B8WA 4UOQA 1DTUA 2HJPA 1SVDA 4WDXA 4AVNA 4RCXA 2INEA 3MHGA 1KXVA 4H2CA 2Y89A 3KL5A 1NU5A 1JQVA 1P5BA 1AH0A 3COTA 3RRXA 2OT0A 5HNUA 3LOTA 4JTQA 3H26A 4PBGA 4WHBA 5GVJA 4FHAA 1A53A 2Z7GA 3GRIA 3VNIA 2WHLA 4NZ1A 4IPIA 3SJNA 5A6MA 2DVXA 2RGMA 3SY1A 2VQTA 4YWSA 4HPHA 1S5NA 3DEQA 4AF0B 1UKPA 1QPNA 4NZFA 3PZOA 1KV8A 4LNYA 5M5DA 4DUXA 4RNHA 2Y62A 3HA1A 4AB4A 3WN6A 4OTKA 4S3DA 2H8ZA 1VR6A 4WY0B 5A95A 5A6AA 1DYSA 4A8LA 1RBOB 2G4FA 2R82A 3GC4A 1VEMA 3MU7A 1KM2A 3K13A 3KBJA 1QDSA 4HMCA 4UTLA 3DN5A 4K8GA 4CNUA 3S3GA 1UIPA 3N29A 1I8JA 1P0NA 2CHOA 4UTUA 4XX6A 3WIJA 2FQIA 2QJNA 4ZOEA 3B8VA 3TFXA 4R9XA 2PDGA 1B3VA 3GFZA 2ZRZA 2Z0IA 4XD4A 3GNRA 3G1RA 3APYA 3WO8A 3VNKA 1K70A 5HMSA 1EJ7L 5I3HA 5LA2A 1QI0A 4GYJA 4REQB 2E67A 3G2GA 1M04A 2D22A 1TPFA 2PDMA 1DHPA 5DMYA 3OPSA 3OHIA 2XZ7A 2TRSA 4MJ4A 2PBGA 1JGIA 1UZDA 3KRSA 3RYSA 4XK2A 2Z26A 4FB7A 3W7KA 5I5RA 4BI6A 1PPIA 1GHSA 5CXPA 1GPWA 3U2ZA 5FSDC 1DWHM 1MSSA 1GG0A 4OECA 4A2SA 1HGWA 4IGHA 1WDRA 4XVEA 1ONRA 3VA8A 4JTKA 2Y70A 1LQ2A 4R7JA 1P6WA 3R94A 4KWOA 2ISVA 4PCPA 1NF7A 1A0DA 1NOWA 2F6UA 3UJSA 1R9YA 3BLOA 3L5MA 2B7PA 1LWHA 3DENA 1FVPA 5H91A 4F3HA 1PCKA 5EKYA 7REQA 4O0QA 1FWIC 2OWXA 1G5AA 1H4PA 1Q6FA 2XIJA 2DZTA 2J88A 4Y8EA 2ISSA 3HG2A 4PE8A 1X98A 1GJWA 4PFMA 2YLAA 5D2TA 6ALDA 2VFHA 3CH0A 5C54A 3E0FA 2XIOA 1EJSC 2X30A 2XN1A 3H55A 4HZ7A 3WH7A 4BWLC 4XD3A 3JVAA 1JYXA 4DQWA 4D71A 4KIEA 4JNZA 3WL1A 5D02A 1EOMA 4XV0A 1F3TA 1OX6A 3DFOA 5EGRA 2NLIA 1D2KA 3LPPA 1JR1A 1PB0A 3NZGA 3THCA 5LHEA 2OSXA 3DIPA 4JTJA 4D72A 1UWSA 1V6TA 2YBTA 5AYZA 4NRRA 4JIQA 1PJ9A 4JTDA 3NQDA 3TCSA 2VFDA 1W8GA 4PN2A 3PBVA 1GVQA 2AMXA 2BGNE 4PUMA 1NVMA 3BW3A 1K9TA 3BXWA 4EK7A 2QCHA 4JQ2A 4UMCA 1JZ4A 4P2VA 4GIRA 1B0IA 1OABA 5HINA 3QOKA 1PTDA 1JDFA 4BA0A 1X7IA 1IE7C 4KCWA 3QY8A 4QSHA 3TXZA 2DJXA 4YTUA 4ZB5A 3I7SA 4FALA 1W0MA 3RXZA 3UXDA 3RU6A 4Z1DA 4X60A 2IKJA 4DY1A 5AC6A 1NP2A 4YTTA 3CT7A 3H7RA 3UERA 4DJDA 2E09A 5J5DA 3MDUA 5LZLA 2VX5A 3W1NA 2ZXBA 3ALFA 2WJDA 4GUIA 2ZUMA 5D9MA 1XPYA 3IJDA 1ZSXA 4FOKA 1F9CA 3S6OA 2EO7A 4GXMA 1EIBA 3F1QA 4RV3A 4JX4A 4GY0A 3V5FA 1C29A 1XLAA 1AQMA 3ARRA 3WH5A 2ZTJA 3UNTA 4FP1A 3WLHA 4P8UA 1OFEA 4AZGA 1Z69A 3CUGA 3T8QA 5EY5A 3HFYA 3NVTA 5A1AA 2FJUB 3UR8A 3HURA 1VFHA 2PE4A 3ITTA 3AROA 1QAPA 2B7NA 2A85A 3W1LA 5B7YA 4R53A 5K7JA 3B0PA 2VZSA 2HROA 5M3WA 5EMKA 1TPH1 5M2FX 4PL1A 3EXTA 2H9AA 2HMCA 2XISA 3QRHA 5ABGA 4U4MA 3OLIA 3KP0A 5LIKX 3F4WA 3VD3A 2XIMA 1XIIA 2OEJA 3VE9A 3BOLA 4F8XA 1WUFA 4MLJA 2INFA 3UJEA 1Y65A 3GR7A 5FF2A 1UKQA 5K9XA 1BLIA 8TIMA 3EKLA 3W7RA 1LLWA 2GDVA 3CIVA 3KBVA 2VGGA 2VVSA 4A8NA 1TVNA 4PSPA 2V82A 4JD4A 3SIMA 4F0RA 5CPQA 2PDKA 1F5ZA 5IRPA 2ZUVA 4OVXA 1V3MA 3V1PA 3IJLA 3W3OA 2BP1A 1W9XA 2BXYA 4I7UA 3EEGA 7PTDA 1FQ0A 1KM4A 3CAVA 1GHRA 3ME3A 4OUEA 4X63A 1TZZA 5FJJA 3LXBA 3H24A 1TJ0A 2EPOA 2J7GA 3IIPA 5D32A 4YL2A 3QR1A 4OOUA 3S1UA 2WJFA 3S42A 4E2DA 5GNYA 4YYFA 1BKSA 3WKZA 4CQ8A 2V3DA 3EXRA 2QJMA 1CIUA 3SRHA 4GISA 4XZBA 1PX4A 4QFUA 3ZVHB 4GY1A 2CLLA 1QI5A 3W72A 1UR8A 5EL1A 1QXLA 1HJUA 3BWWA 1XYFA 5HWMA 1M7PA 1XYBA 4GQGA 4XZHA 4AYGA 4DXVA 2OGYA 4NY2A 4ZMGA 3A24A 1K3UA 4QDWA 1CECA 3QMTA 1HKMA 4LCQA 3TW9A 3L4UA 4NAEA 2WZMA 1JG9A 2Z6JA 3VM5A 3BAXA 1UR2A 1WZLA 1HO1A 1V02E 5D2YA 1E73M 5T9CE 1F7BA 1JF5A 2ESCA 3DZ1A 2O92A 3LTYA 4EOUA 4KGJA 5A6LA 4H9XA 1R7AA 3AWOA 4ICMA 1OZMA 4HJWA 1M5WA 1Q4WA 4HN8A 1V51A 4EXAA 1TPUA 1LL7A 3W88A 3TC3A 3MCMA 2ZWYA 3R0UA 4HCDA 2FZDA 2WC3A 1Q85A 4Y9MA 5D33A 5BWFA 1UHVA 3B0YA 3RJYA 2J4GA 3RF9A 1F8MA 1C8YA 3WFAA 3VNJA 1RP8A 2XVNA 5BROA 3T0AA 2ZVRA 3UWYA 2V5JA 2PTXA 5BMXA 4ZE4A 4YCPA 1JZ6A 3TSBA 5HNNA 2CKSA 1ESWA 3C5QA 3KVJA 1WBJA 4B9YA 1PIGA 3IJ6A 5HAOA 4FPSA 1ZBWA 2NZLA 2WBKA 1VLIA 4KGLA 2ACRA 3FVDA 1W5QA 2VXNA 4CGTA 4PMOA 3L4WA 2QCGA 2B31A 2Q02A 4HPGA 1UJQA 1YRRA 3AWNA 4K6AA 3S5OA 4GUJA 2CNCA 3PZUA 4PMJA 1JAKA 3N19B 2DH3A 1YYAA 2B0MA 4CKQA 3H2EA 2HTMA 4M7SA 2A7PA 2X16A 3A6OA 3QFWA 3ZS4A 1SMDA 1EPVA 2I9EA 2FJKA 2DZXA 1SFLA 1XBZA 4ERGA 4DUOA 1QBAA 1KR0A 1TWDA 3PWIA 2QDHA 4S3BA 3L5AA 1S5VA 2XGIA 5LA1A 3A22A 3I4EA 3M0MA 3HQOA 1ZAHA 4PMDA 4DO6A 5D03A 3EA1A 1ZBKA 2OSYA 4DX3A 1OT1A 1YPXA 4R9OA 3R89A 4J3XA 3G1YA 2ZQ0A 1CEOA 1JNDA 3SRFA 4MWAB 1YBQA 2PURA 5CBBA 4XAGA 3LXAA 4LBUA 2MUCA 3AIEA 1CGUA 4Y96A 5TQLA 4WZHA 2EPMX 4L7ZA 2WSPA 2ZOXA 3W00A 3HJEA 3BH4A 1GPFA 4EWJA 4A8IA 1KQZA 4FXJA 1M3UA 3GNOA 4G1KA 3PPGA 3V18A 1EGZA 5A6SA 4EAYA 1SGJA 5CSYA 1UCWA 2GJNA 5AC4A 2Z6IA 3WDQA 3C0QA 3KLLA 1VZWA 4AZCA 5DT5A 1FWCC 1W9DM 4LFYA 2JF6A 3A64A 3PZ9A 4JHOA 1SJBA 6CGTA 3SFKA 2Y85A 1TPVA 3N25A 3O0KA 4DM1A 2YBVA 5LIWX 3TQVA 1UZ1A 4S3JA 4LAOA 4S2CA 1NY1A 3KM8A 3DHPA 2C1IA 1E4MM 4JTEA 1XCWA 3JZEA 3GVGA 3LB0A 3UETA 3UZJA 3GNPA 3TNBA 1GOKA 4MMWA 2W5FA 1PX8A 3LBCA 1EUNA 3CWOX 1BSIA 1EP2A 1OB0A 3PBUA 3CTTA 4LY8A 1DORA 2NWSA 1B5TA 5FJRA 1HW6A 4NJKA 1MQQA 4RNJA 1G0CA 2DIEA 1Z32X 3RUBL 3A4AA 5C2GA 3BGGA 4FLRA 4LUSB 1BWVA 2VD9A 3NXFA 3PZTA 4KRTA 5C9ZA 1QO2A 4QCFA 1EQPA 1KTBA 2PDBA 3VD9A 3KL3A 2R91A 4Y90A 4YHGA 4HSOA 3FYYA 1QNVA 2D3NA 5C6MA 4GINA 1P48A 4HHHA 4E2OA 3NQCA 3QR3A 4IG2A 4C6JA 1DIEA 1LRQA 4IUOA 4LAMA 1W3NA 2A79A 3EWZA 4W88A 4B5WA 1ZJAA 2PTZA 4Z1CA 2C18A 5I24A 1ZAIA 2R1NA 5KTLA 1OFDA 4IJBA 2E1DA 4NRSA 4BKNA 2WSRA 2PTDA 1E72M 3R4IA 4FXSA 4RW5A 3STCA 4ADSA 1VENA 1W1A1 2E6FA 3ABXA 5FJIA 4NG3A 5D9PA 3AYVA 4MYAA 1E1FA 3E9AA 3U7BA 2FHBA 4GH1A 4XAYA 4L1XA 3WJYA 3W6MA 3U5YA 3H2CA 5E6YA 1IQ8A 1J0JA 3RM8A 2BY0A 1JYWA 3GHRA 4MG4A 1A5AA 1KCXA 2BDQA 3BLDA 4GVGA 3HZ3A 4LW7A 3T9PA 5EFFA 1E4IA 2B7QA 4CD5A 2REQB 1V0MA 2EPLX 1PVNA 3M0LA 4FI4A 1E1CB 4LS2A 5DANA 3RRAA 1H7WA 1ONEA 1U5HA 2ZRWA 3FYOA 2WHKA 3PBMA 3AXHA 2WMIA 3E02A 1EA0A 5F4SA 1KM0A 4GIYA 3AZTA 4C6QA 3F4DA 4A21A 2WVTA 1XRVA 4X2PA 4XD6A 2VFFA 2NW0A 4PTXA 4AMAA 1WPCA 1X97A 3OZPA 2XH7A 3MUAA 2QAPA 4FX6M 1DWFM 4Z08A 1ZCCA 3T2OA 3K4WA 1EX1A 3OA3A 1J8VA 4MUPA 3UWUA 3F4VA 3EBVA 4IWWA 3BOXA 4QJ3B 2YL6A 1HJWA 2QUVA 1G4SA 3QY6A 3WH6A 3ZLHA 1BD0A 5GNXA 3D46A 4EF9A 4HA0A 1XLMA 3PTKA 4XIMA 1VCVA 4ZO6A 3CAKA 3PVFA 2CESA 1E55A 1L6GA 4GD0A 1J0KA 1EJWC 1P7TA 4FIQA 4IPNB 4MB3A 5I23A 4XO7A 3O07A 4A2RA 2NVCA 4N4QA 4GH3A 1AJZA 2HWGA 2MANA 3B8TA 3IVUA 3BLIA 4Q8QA 1T8XA 1XD0A 3ORWA 4BF5A 4GYFA 5H8MA 3KS6A 4ZQOA 4Q4RA 3DFYA 3V36A 4TV5A 2WCSA 4L65A 1EGMA 2WCGA 3TTEA 2IUZA 3W2KA 2X1UA 3VIKA 3F2BA 3AISA 1QASA 2QS8A 1D8CA 3ECQA 1QPRA 3TJ4A 3PZQA 1BSLA 3CL7A 2DUZA 5DX7A 4POCA 1F6PA 1MDLA 3GYCA 3CC1A 4BI7A 3QZEA 1VPQA 4LBRA 2FGLA 4B4HA 1VRDA 3E12A 3BG5A 5IDIA 2E40A 4PUJA 4XWUA 4JFWA 2PAJA 2ODOA 4V27A 1KBIA 2XUCA 2Y5SA 4YXGA 1RCQA 4PA8A 2IKGA 4CD6A 1XLCA 4S2BA 1WKYA 1TSIA 3CGTA 3NQEA 2PDWA 3QMSA 5CPMA 1O66A 1GUVA 3SDOA 1DWAM 4JTHA 1B4KA 3DYOA 3OBKA 3GXPA 1BXBA 4O13A 1LT7A 4R7OA 5EMMA 4QDMA 1OJXA 3POCA 2VX4A 3U7VA 4Z2LA 3GXIA 2NT0A 2WBGA 2HZGA 1Y7VA 5GPRA 4ILSA 4M80A 4AW7A 2ZICA 3E0LA 1T5AA 4S23A 2O9RA 1LL6A 3VC5A 1B90A 1FCQA 3OHMB 1E0XA 1GNXA 3PM6A 3QW3A 1YNPA 2WZEA 2G50A 1XSJA 1J18A 2OQYA 1OSEA 1K6WA 3HGJA 4H7ZA 1YDNA 5LGZA 1WDSA 2AOSA 3N2XA 2WHJA 1JVNA 4AG0A 4OWGA 1NDYA 4Z1YA 4KFPA 1L8NA 2WVVB 3KCOA 4NIRA 1EO7A 3TN5A 1RV8A 4R88A 2P5NA 3EX2A 1HP4A 3QPYA 2X40A 2F38A 2F2HA 3Q2DA 1ITXA 5M03A 1SR9A 3EXSA 4B2DD 1DXEA 2JKAA 4S38A 4BWLA 4LC6A 1TPB1 3A9BA 2DQWA 3GC2A 2PS2A 2J66A 5AHMA 4YNGA 1ONXA 3UZYA 5PTDA 4HNNA 4EF8A 1AK5A 1PBGA 2GGJA 4M3PA 4D6HA 1BTMA 4BQ4A 1TIWA 3R11A 1H11A 1BF2A 3AAMA 1E6SM 2YKKA 4Q4OA 2BOGX 1XRTA 4J40A 1JCMP 3GIQA 1B1YA 3FAXA 3H12A 4ROPA 3GNNA 2C3ZA 4C91A 1XH1A 3EMQA 4I5XA 3RAOA 1BQCA 2ONEA 1POKA 3QHMA 2AL2A 1SZNA 3BAYA 3CQJA 5C2CA 3UXIA 1AQ0A 1GVSA 3R0DA 2XH0A 4C6KA 2C8NA 1EYWA 1QUMA 2Z1SA 2YDAA 1HP5A 1WOAA 3BZJA 3GTNA 3PAJA 3VO0A 2OU4A 3EB4A 4NT0A 1UR4A 5ABFB 1L6SA 3NNTA 1DXFA 5CEWA 4I3GA 1JCNA 3MMTA 4Q4SA 1TELA 3KP1A 5BNKA 4AQLA 4RUBA 1SPQA 3GC5A 3MP3A 4UZSA 2FH8A 2G37A 2XN0A 3KEHA 4RE4A 1R30A 3S9ZA 2PF0A 4L4MA 2JKEA 2F6XA 3E2SA 3VNDA 3RPMA 4Q6XA 3M0KA 1AVAA 1QATA 2YA2A 1ZNNA 4NJJA 1FHDA 5HJXA 1MQPA 3KVMA 3M16A 3VZZA 4DZ5A 1LBLA 7XIMA 2EJAA 2PB1A 1DJNA 2H6RA 3C0JA 4UTIA 4Z0SA 5IBXC 2DQXA 4HYVA 4AD3A 1PHQA 3TX9A 1DVJA 1PTAA 1V0LA 2BMBA 2UZ9A 4HNCA 2PGRA 2ZIDA 2X1SA 3BW4A 4RNFA 1SW0A 4XO6A 2HV5A 3M5ZA 4LVFA 4LSBA 2ZXDA 5I7GA 2G4JA 6PTDA 3UPWA 3LCXA 2VKZG 1V5XA 4D8ZA 4X61A 5FJPA 3N2TA 1F73A 4JDBA 1V3HA 3PFRA 2XTKA 3VUPA 2PZ0A 4HNTA 3A47A 1XP3A 3S9IA 3A3HA 2E5BA 3NGFA 3TU9A 1RUSA 2QKFA 3TWAA 3HB9A 5KMYA 2CWNA 3K4AA 4TV6A 3PP7A 1X1ZA 3MUY1 4M81A 4IJRA 3II1A 5HNRA 4HBKA 2YJQA 1CENA 3QN3A 4MADA 4UCGA 2I57A 2UY2A 3CMGA 3WBAA 3ARWA 3EOUA 1ZU8A 1BRLB 2UY4A 1XLLA 1XYMA 1QI3A 1L2QA 2A7NA 3GG0A 3B9DA 1GKPA 1UA7A 1QT1A 4GHRA 2GVEA 1O5XA 2DIKA 1OF6A 4MWAE 1XW8A 3TONA 1UD8A 1X1NA 4M8UA 5AHEA 4YTRA 3AIBA 2DZBA 1U5VA 2BVYA 3W2NA 1KFLA 1TQXA 3NOYA 4JICA 1VPYA 2D23A 3M46A 2HS6A 2DDXA 3EA2A 3NIYA 3WLOA 1ZP3A 1IT8A 2ZE3A 1UWQA 3LRKA 3C61A 4Q22A 2CZFA 1OCQA 2QJGA 3L2MA 2A21A 1SSDA 5LNSA 1J0ZA 3EX4A 4G56A 3GHUA 1AG1O 4GZ7A 3WDIA 3WUGA 1VAHA 1RLCL 5DEZA 1BYAA 2PC8A 5D2XA 1UWRA 1ZY9A 1LT8A 3LK6A 2FMOA 8XIMA 3EX1A 3KZPA 4LU0A 1PKYA 3C2YA 1GQIA 1J5TA 2QMJA 4NNBA 3QF0A 4KQNA 1S5WA 3MSRA 2DGAA 2D69A 3KBNA 1XLKA 3MDWA 4KEMA 2IKHA 5A6TC 3R8RA 4ZSTA 3LEPA 1B9BA 4L6HA 1US3A 4NX0A 2B7OA 1PO9A 2Z24A 3JRKA 4JIHA 5E93A 3GDMA 2NSOA 3S47A 4IX2A 2GDUA 3GFXA 1ME9A 2J27A 4PRTA 3B4YA 3WNLA 1LG2A 3OYXA 4A22A 3TUUA 3GDBA 4WKHA 3SFWA 4IIEA 1JI1A 1D3GA 2GQ9A 3HBLA 1BF6A 3CK5A 1DV7A 4XZNX 5CLWA 3UWZA 3MWCA 3ONBA 1B3YA 4PMXA 2DZAA 3LENA 3PTQA 4JTIA 3G1DA 3MUZ1 1X6NA 1XG3A 3JU2A 1TMLA 2JK2A 2GQAA 2WMKA 3DG7A 2PD9A 2PF8A 4XTIA 1QK0A 1PEZA 2AAAA 1K8CA 1O5KA 3ARVA 2PU0A 5I09A 5FF7A 4NZCA 4LX4A 4Q8UA 4CNOA 3MKCA 3UZZA 1FX6A 1Z9AA 2BHYA 3WNNA 4V2XA 3IJIA 3FJNA 3QOMA 3CZEA 3T1GA 1GKRA 3WD2A 4YHEA 1XBVA 4MF4A 3EKGA 1GEQA 3CS2A 3REQB 2XHYA 2CYGA 2YIHA 1FWBC 3BUVA 3SJ3A 4MGGA 3W7MA 2QV5A 3CL6A 4J35A 1KFJA 1S39A 2NQ9A 3GHSA 3BLEA 1C7SA 1NP0A 3AICA 1KBBA 4R33A 1R3RA 1JD9A 4E5TA 3H70A 4H7CA 2ABAA 3EWXA 1A0EA 2O4MA 1WV2A 2WWDA 5K4XA 5C8BB 4W8BA 4YS1A 1R2RA 5A2CA 4S3AA 1EHNA 1JFXA 1B2YA 3EZ4A 4QS6A 3M0JA 1BKHA 3W6LA 4MY1A 3ZWTA 3LPOA 2E25A 3CQ0A 5BCAA 3LZ5A 5I3DA 3R12A 1HL9A 2YDSA 3PULA 4IHCA 1PZ1A 5LXEA 3ABRA 3UZWA 1UKOA 4H8VA 1VFMA 2UBPC 1ZS2A 2VCCA 2CPUA 3H2MA 3N9SA 3TYUA 3QMRA 1QFEA 4CCZA 4ZQMA 3WLPA 2J9XA 3RITA 2VO5A 5DY2A 2ZADA 3AIQA 1RR2A 4ONVA 1TJ2A 3F7JA 3NQGA 1BHGA 4MVAA 1K8ZA 2PODA 1EOKA 3ANVA 1GQKA 4F2UA 1CPUA 1IT0A 1K8XA 1UKSA 3G1SA 1ZP4A 1UD3A 3UZXA 2FDMA 5JBEA 3B06A 1I2RA 4G7EB 4O17A 4F2TA 4D8AA 4H8NA 3WDPP 4PBFA 4G5DA 4Z2HA 1ZBVA 3G8EA 5CLTA 2O4QA 1REQA 2X0YA 1E4NA 4JQ3A 4WR3A 2R94A 4UQBA 1ICSA 4RE0A 1CXFA 5JH1A 3WQEA 1TG7A 2Y8KA 4QP0A 2BGSA 3H4WA 4LH8A 1NWSA 3LHYA 3IGUA 5BYWA 4IP7A 1Q3NA 3AHVA 2VI0A 1Z6KA 5JIWA 2XN2A 4MIMA 3VMOA 3U0HA 3A13A 1JFHA 3GW0A 1N55A 3BO9A 3K1DA 3CQIA 3NQVA 3QC3A 1NOUA 4RXFA 2JEPA 3CU2A 1PIIA 3WQ8A 5A2BA 4DF2A 2W6RA 4Q4PA 2BFGA 4HU8A 1TE1A 1WZAA 3FA4A 3KWSA 4RZBA 2J7HA 4W7UA 4PTDA 3W2UA 1ZJHA 3CIWA 2YFOA 3KVLA 4U5KA 5DFAA 3EMCA 2WZIA 3WD3A 2ZWZA 2O7QA 3CHFA 4W86A 3W25A 4FX8A 1TR9A 2J9ZA 4LV4A 1UPMB 3P81A 3FSUA 2D20A 1GYMA 4ZXLA 3I65A 1GZJA 4GI4A 4D1IA 2GVYA 2VCBA 4GUFA 4UTFA 1BAGA 4GA8A 2V5CA 2NXHA 4H3DA 2DW6A 3W76A 3EWBX 1H50A 3FKKA 2BB0A 4DWSB 1KWKA 4FX7A 2INZA 4ADUA 2NLYA 2IXUA 4DYJA 4FNQA 1KGWA 4RPPA 3NDYA 4OT7A 1V6YA 2A1YA 3PWAA 1X39A 2GJRA 1BYDA 2GLKA 4URIA 3AC0A 3TYDA 4MB5A 1KV5A 2DW7A 1O95A 5D05A 3M47A 4GXPA 1XQLA 4AZHA 4HNOA 4C6CA 4JIEA 1J4EA 2E9LA 5G4HC 1SFSA 3QQWA 5CH9A 2WOQA 4UNKA 3RN6A 2QJIA 3AI0A 3H23A 3TKFA 5D09A 3E0WA 3SN4A 3CO8A 4MTVA 3TC7A 4ATWA 1XDJA 4PULA 5G1YA 5CZKA 1XRFA 3MUIA 1ADOA 3LPGA 1V6XA 3UW6A 2X7WA 5T9BG 3SRDA 1PUDA 1F76A 3IJ9A 2WPGA 1GOOA 2I5GA 4AMCA 2CZVA 4NAFA 3ZT6A 4GVFA 1LLOA 1NELA 3MP4A 3OZYA 1C8XA 5BXTA 1LBMA 4GRSA 4H2HA 3EPOA 3VGDA 1G4PA 3R13A 3EX3A 5FJOA 1TE6A 4GPNA 2DSUA 2OZ3A 1F4AA 1DQUA 3DX5A 1AH4A 1Z3NA 3IS4A 1RQHA 2QIWA 1HF6A 2PDNA 1Y8BA 4FLSA 4P7QA 4QITA 1JPDX 2JQXA 4RR4A 4U3CA 4WXYA