4A3HA

2',4' dinitrophenyl-2-deoxy-2-fluro-b-d-cellobioside complex of the endoglucanase cel5a from bacillus agaradhaerens at 1.6 a resolution
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
300
structure length
300
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots along an enzymatic reaction coordinate: analysis of a retaining beta-glycoside hydrolase.
pubmed doi rcsb
source organism Bacillus agaradhaerens
molecule tags Hydrolase
molecule keywords PROTEIN (ENDOGLUCANASE)
total genus 122
structure length 300
sequence length 300
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 1998-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4a3hA00
2W92A 3POHA 1LQ0A 3WF1A 2OSYA 4HU0A 2IUZA 4M1RA 3VD9A 4FF5A 4QFUA 1MQRA 5I2UA 1V3HA 1J0YA 1DWJM 3B9AA 1RP8A 3SCPA 1KGWA 2ZXDA 1U2YA 4E8DA 3PZGA 2WVUA 1W1YA 1WB0A 4BQ2A 3QR3A 3OLDA 2ZX9A 3IJ7A 3W37A 3NDYA 2WSPA 4PTXA 4W8AA 2F8QA 3AYSA 1V03A 1QI4A 1GOQA 3OBAA 1QI5A 7A3HA 3CUFA 1OSEA 2EXOA 3AZTA 4MTVA 4UNIA 3GBEA 1GJUA 2O9PA 4MB4A 3SCOA 3AXXA 1UH4A 1C7SA 1FFRA 3WD1A 5E0FA 4CU7A 3W26A 4AYSA 3WFZA 4PCSA 1TUXA 1ESWA 3FAWA 3BAJA 3MSGA 3UERA 5A6AA 4OOZA 2JE8A 1EDQA 4PMRA 1W1PA 4YHGA 4D6FA 3VIGA 4XV0A 3CZEA 4WKAA 3VIFA 2NSXA 1B3XA 3WNMA 1GORA 1E1FA 4U31A 1CZ1A 1W9UA 3VIKA 3W6MA 1JD7A 1V08A 2NT1A 1J0JA 3ARYA 3AZRA 1BYDA 3VGHA 1MXGA 2WC3A 1KXQA 2XSAA 2CHNA 5FCZA 2GDUA 3CZJA 1JXJA 2VX6A 3O9NA 4IUGA 4AW7A 3T09A 1R7OA 1WPCA 2YA1A 2WHJA 4U2YA 4UFJA 1X1NA 2WC4A 3DHPA 1DP0A 4X9YA 2XFFA 1WCGA 5A2AA 1KXVA 4GZEA 2VQUA 4C7GA 2GJXA 2CKRA 2ZUMA 3VOCA 1VEOA 2VR5A 1MQQA 1UKTA 1UWIA 2Z1SA 4R27A 4AZ5A 3A6OA 1WAWA 3WF2A 8CGTA 1Y7VA 3MV11 1J0ZA 2G3NA 4DM1A 4ML4A 1CXLA 3WENA 1C8QA 5A6BA 4UQAA 5AYBA 3N9KA 4UQBA 2YOCA 3MMWA 3VD3A 2YA0A 3ARSA 2WPGA 1KFWA 2V5CA 1XGZA 4FK9A 4MNKA 1KQZA 3FNDA 3HN3A 4TX6A 4Z2IA 5TD4A 3RDKA 2QMKA 2XFYA 3WEMA 1E5NA 1VFMA 3WL1A 4UZUA 2HVMA 3SCWA 3W81A 4IISA 2RGMA 5FKYA 4LX4A 4Q7NA 3GNRA 1CECA 3CO4A 3VD4A 3ZIZA 1M01A 1JZ6A 2XVLA 5E70A 1D7FA 1XYFA 3ZJKA 3OB8A 3IK2A 3NCOA 1NOFA 4K68A 2OYLA 4GI6A 4MDPA 3M07A 1UZ1A 3CZ8A 4BQ4A 6TAAA 4W5ZA 1GPFA 5ABFB 1I1XA 2CCRA 1DHKA 1UD4A 1EO5A 3CHEA 3JUGA 4M56A 1BAGA 2EQDA 4MDOA 1SMDA 4PEEA 3AICA 1CLXA 2XJ7A 3SEPA 3VDAA 6A3HA 3VIPA 2VO5A 2V3GA 2VUYA 3CUHA 4GIAA 1HKKA 2CETA 5FL1A 2VZUA 3LPGA 2CESA 3M7SA 3U7VA 1XD1A 1V3MA 1CXFA 2G3JA 4AZCA 1K9TA 3WNPA 2XPKA 2VQTA 5IDIA 3WNKA 1VJZA 4PMQA 1EDGA 4ZE4A 5JBEA 2JF7A 1J0IA 3F4VA 3M6DA 2VVSA 3ZT5A 1B30A 3TTOA 2XM1A 1OGSA 2PWDA 3ARPA 2ZIDA 4PMYA 1IT0A 3IAQA 4QAWA 1UA3A 1C8XA 5E09A 2YLLA 2C0HA 3SUTA 4H04A 1UH2A 3II1A 2QV4A 1E0XA 1GJWA 2QHAA 2PWFA 3N15A 4AD2A 3VMNA 1E4IA 4Q22A 2BY3A 4UZSA 3SCTA 1R85A 5GNXA 1V0NA 1FA2A 5DMYA 1GOKA 1S46A 2WB5A 4J3VA 2GFTA 1CIUA 5CSYA 4J3TA 4GZIA 1UD6A 3UCQA 3T0AA 1B3ZA 1CDGA 2W4XA 1UR4A 2OWXA 2W61A 4AD3A 3KWXA 2O9RA 4U3AA 3T2QA 3WUFA 2X1IA 4U33A 4U2ZA 4TUFA 1GCYA 4BCEA 3N11A 1AMYA 3WD4A 2BY2A 4HOZA 2A3AA 5HNNA 3WKZA 4UFMA 5CGTA 3WEOA 2ZUNA 1NWTA 1Q6CA 2AMGA 2J7GA 2V3EA 4ZFMA 1RP9A 1X6LA 4XZWA 1HNYA 3WDRA 2WKLA 4ATDA 1B3VA 1M53A 1FP9A 2YDRA 3OLIA 1CENA 4LYQA 5DT5A 1GW1A 4WK9A 4XUYA 4V27A 2BNJA 5FL0A 4JL1A 1JYVA 3IANA 1G0CA 5CQ1A 1MWOA 3AROA 3UG3A 4XX6A 5ABGA 4F66A 9CGTA 2E0PA 4KRTA 4XB3A 3U5UA 1QNRA 4KH2A 1KCLA 4WJXA 2J7EA 1FOBA 1E40A 4J3UA 1GQJA 1TZ7A 2JEQA 2OYMA 4WIWA 4HP5A 3F5JA 1JAKA 4X0VA 1ZB5A 5HDRA 5DEZA 2FGLA 1XYZA 4AZCB 4GPNA 2DT1A 2Z1KA 3VX0A 1E4NA 4BQ5A 4EKJA 1NOWA 1XSKA 1E5JA 1JG9A 1E6QM 4HZ7A 3GH4A 2WK2A 1OD0A 1OT1A 1MVYA 4IPNB 2DIJA 1NP0A 5EFFA 2EPMX 3K8KA 1R86A 4CN6A 1WO2A 3QHOA 1CPUA 5A8PA 2WC7A 1OIFA 2A3CA 5IFTA 4U5KA 2PWGA 4UFLA 4ZXLA 3ZR5A 4W89A 1JZ7A 1W3JA 1CGYA 2ZX8A 3GH7A 2J62A 1HL9A 4YN5A 1CEOA 3THCA 1YHTA 4JFVA 2EEXA 3UG5A 3OZOA 3BAKA 3BSHA 5JUVA 2YL9A 1ZBVA 3NSXA 4UQEA 4S3KA 1Q4NX 1TA3A 5A6KA 3LPFA 1VAHA 1V02A 1B2YA 3K4AA 3FY1A 3ARUA 4ACZB 4BZYA 3SCQA 2PB1A 3MSDA 5BROA 1JFHA 1UWQA 3VIOA 3EBVA 1ITCA 4W7UA 3AMLA 1QI0A 4QLLA 5JBDA 1UWRA 2G8ZA 3PZTA 4AZ6A 1W9DM 1J0HA 3ZJ8A 1IZKA 4W85A 4D71A 4R5EA 1UHVA 3AHZA 1E6XM 1PX3A 3I3BA 3MUY1 4DUXA 3GH5A 2VI0A 2WZHA 3AOFA 3AYRA 1VBRA 4MADA 1XSIA 1J9YA 3AZSA 1XV8A 4WLCA 1ZJBA 4MPKA 1QW9A 1VFOA 1E6ZA 3PTQA 4AY1A 4JCMA 1TMQA 4WSKA 1GOOA 3MKKA 1CGTA 1LG2A 3NJ3A 1QNQA 3VIIA 1W9VA 1FH7A 2QMJA 2YIHA 1CXKA 1QI2A 3UEQA 3WMSA 2JALA 3GNPA 1R7AA 1EHAA 1SMAA 4DWSC 2D1ZA 4C7FA 3MU7A 1CGVA 3L4UA 4QCFA 3WUEA 1OM0A 2FDMA 1JXKA 5D8WA 2VX5A 4B16A 1KXTA 4TTUA 5M17A 3U7BA 3GZAA 1HXJA 2WBGA 3VGEA 1JYNA 1WZAA 4PRWA 3SUVA 1WZKA 5A6JA 1BQCA 1EQCA 1J10A 1QNOA 1B90A 1B31A 4LYRA 1QVBA 3N12A 4PUEA 3LPPA 5BCAA 4E4PA 4ATLA 3QHNA 4CKQA 1V3KA 1N82A 5A3HA 5I5RA 2VL4A 2J74A 3PZQA 5ABEA 2Y4SA 1UOKA 1TR1A 2W91A 4BS0A 3GXDA 3W6LA 4J7RA 3GBDA 4NRRA 4UR9A 2CIPA 2J7HA 4JFTA 1BTCA 3WNLA 3RPMA 4CVUA 3NUKA 1LWHA 3VMPA 3THDA 2D0GA 4HOXA 3M46A 3BLPX 3UESA 2QF8A 1G9HA 1CYGA 5D4YA 2QPUA 1ISYA 1UZ4A 3T08A 1GOWA 4S3JA 2CITA 5I3DA 2WKGA 3CMJA 1PX8A 5HPOA 1W9PA 4QCEA 3WMCA 1E4MM 3WDHA 1GHSA 3CHDA 1E72M 2JIWA 3AISA 5KZ6A 3KE0A 3FHAA 4D1JA 1JZ5A 3VDCA 1ISXA 2XUCA 5CZKA 1HJQA 4PTVA 2VVNA 1W3KA 2V3FA 2A3EA 5D9OA 3BGAA 2X09A 4KMQA 5IHRA 5GPRA 3CGTA 1R87A 3WUGA 1AQ0A 4JKKA 2YL6A 1W3LA 1VIWA 3PZMA 1XCXA 1U30A 1J12A 1HIZA 2ZUTA 3ARWA 3WF4A 5BXSA 2BVDA 3WBAA 3AIVA 2DSKA 2WZIA 5I24A 2WMJA 4H41A 2GSJA 1MW0A 1CGXA 3SCUA 5CPSA 2EBNA 5FIPA 1CXHA 4PYSA 5ABFA 2DQXA 3DYPA 3ARVA 3QOMA 3BLKA 2WVSA 1QHOA 3N1AA 3G6LA 2OWCA 3AS2A 4W7VA 3ZR6A 3O6AA 5AC4A 2VZVA 4JHZA 4YPJA 3WQ8A 3WDIA 3PHAA 5LA0A 4MJ2A 3GDBA 1ZBCA 5AY7A 2VTFA 1V6VA 3RM9A 1ZBWA 2Y8KA 4M8UA 4JCLA 1H09A 4OZOA 4D6IA 2WBKA 3MO4A 5I79A 1KWKA 1ODZA 3AMCA 5AYIA 4QDMA 3AIQA 3B9EA 3WNNA 5D8ZA 3BC9A 1B9ZA 4JZ5A 5ABHA 3VDBA 3RCNA 1GONA 1TVPA 2FH6A 2DDXA 3AXHA 1V02E 4WKFA 1KWGA 3BAXA 1DEDA 4OBSA 2D0FA 3GM8A 1Z32X 1V0MA 1RD6A 2WSKA 4EK7A 1EA9C 2A3HA 4AIEA 2PF0A 3F5LA 1E4LA 2F61A 5IFPA 2WCAA 2YL8A 4P7OA 1CLVA 3OLEA 1C90A 4L4PA 5IXEA 1JYXA 3TOPA 3AMKA 1OINA 1NWUA 1NM9A 2WMFA 3UG4A 1BG4A 2DEPA 3DECA 5DFAA 3DHUA 3HJEA 1WDPA 3OG2A 2XGIA 4WSJA 3WQ6A 3U57A 3MMUA 2ZX5A 2OSXA 3VPLA 4AD4A 5CG0A 3VNZA 2RGLA 1LLOA 4HMDA 3LMYA 5ECUA 1WDRA 2FHCA 2JEPA 1UYQA 1DWIM 3OGVA 4ZENA 1QBBA 2J8GA 3WIJA 1J11A 3L4ZA 5DT7A 1PZ2A 1HN1A 2E3ZA 3CIVA 1VEPA 3VUPA 4F8XA 3SUWA 2X2YA 1BPLB 2BHYA 1EHNA 1GUVA 2WVVA 2WMHA 5F7UA 1W1VA 3VD7A 4F79A 3L2MA 4MNJA 2VMFA 3GXMA 3CMGA 4DWSD 3EMZA 1MYRA 1TA3B 2PWEA 2W63A 2J4GA 3ALFA 5EBAA 1SR0A 4J28A 4A3YA 4QLKA 4Z2LA 2JFEX 1UH3A 1US2A 4CN4A 1JD9A 1TFVA 1UD2A 4PMDA 3RILA 2V3DA 4W8LA 1Q6EA 4JAWA 4CCDA 1IZJA 5A8MA 4IM4A 5CSUA 4URIA 1TE1A 3W29A 2VR4A 3ZMRA 4FLSA 1B0IA 1AVAA 1PIGA 1JIBA 2XWDA 4J3SA 1CWYA 5A6SA 6CGTA 4RE2A 1BVZA 3BAIA 4HZ8A 3WBEA 3W24A 1KBKA 1QHPA 4AIUA 3N18A 4AC1X 4CGTA 2YDSA 2J8FA 2GDVA 2YKKA 3EDFA 2BFGA 3OZPA 4UQCA 1V0KA 2WYSA 4LXFA 1W9XA 4AD1A 1ISVA 1UKQA 2C8NA 3LPOA 2DT0A 4MJ4A 3AI0A 3AFBA 2XVKA 4BQ3A 4HPGA 3EMCA 1A3HA 1CXEA 1VF8A 3SUSA 3ZO9A 4GO9A 4OOUA 1DTUA 1HF6A 2TAAA 3VGGA 4B9YA 2CPUA 3AIUA 2WWCA 4OJYA 4UCFA 4UOZA 8A3HA 2DH2A 1D2KA 4UOJA 5A2BA 3PN8A 2OSWA 3ECQA 1L0PA 1X6NA 1PBGA 3ARTA 4GZJA 4W7WA 4AZHA 1GQIA 1KB3A 4PMZA 4TTGA 1NWSA 2ZXAA 4QP0A 3CZGA 3SCNA 1E43A 1M03A 1W2PA 4PMUA 3AHTA 4D6DA 3QHMA 3BH4A 1LL6A 1IV8A 3KL5A 2VCCA 2PBOA 2E9BA 1V0LA 1V6UA 4HA4A 2J7CA 3GYCA 2BHUA 4TOQA 5HPCA 1WP6A 4CD5A 2O9OA 3NSNA 1HT6A 1UR2A 1H4PA 1JZ3A 2G41A 2WAGA 1F4AA 2XIBA 3K8MA 3L2LA 3HMCA 3VNYA 2Y5EA 4PTMA 3VX1A 3SURA 1GQLA 4B15A 2WCGA 3EDJA 4J3WA 4A4AA 2UY5A 3APGA 3HU7A 4PMVA 3WF0A 1OIMA 5A8QA 3CLWA 3S2CA 1GOIA 2E4TA 4P8UA 2D3NA 5C8BB 2NT0A 3CHFA 5LYRA 7CGTA 1CGWA 1DWHM 4MB3A 2JF6A 2XHYA 1VFFA 5I0DA 2D22A 4NRSA 3PZOA 2F2HA 2CBUA 4TVDA 1QOXA 3CZKA 4PMOA 2G4FA 5M5DA 1UA7A 2CBJA 2O9TA 3VDHA 4AD5A 1UWSA 4KRUA 3S6TA 3EDKA 4DWSA 1US3A 4P7QA 1TVNA 2PI6A 1KGXA 2VC9A 5AC5A 1W91A 1A47A 4JHOA 3W82A 3N04A 4P8WA 1FHDA 2ZWZA 3BXWA 3ALGA 4OBRA 3DYOA 4FLQA 2WMIA 3PZ9A 1ZU8A 1E0VA 4LYPA 1FH8A 4JFUA 2WWDA 4U5IA 4P8XA 3AIEA 4GQRA 1BVNP 1SFSA 3VIJA 3ZSSA 3AMDA 4ACZA 4HU8A 3IAPA 4AIOA 3B8SA 2CERA 1H1NA 4TVUA 1WZMA 2XTKA 3L4XA 4MNMA 3WMBA 1E6PA 5M3WA 1ISZA 2YA2A 5A6MA 2WLZA 5IHSA 3QGVA 4MB5A 3BAYA 5CLTA 4B9ZA 1K6AA 4AMCA 3SUUA 3W4RA 1JNDA 4V28A 4AZ7A 1E3ZA 1YQ2A 1BFNA 4U3CA 4BA0A 3MUZ1 2Y8VA 1GNXA 1E70M 2VX7A 2WM0A 4F9JA 2E40A 1J18A 1OT2A 2FGZA 3RM4A 3AMGA 2Q8XA 3WD2A 2YBTA 2XG9A 5D9MA 2ZUVA 2UWFA 1ZS2A 5BYWA 5A94A 1WZLA 1HVQA 1DWFM 3W38A 3AS1A 1HJUA 1BHGA 1OBAA 1HKIA 2VCAA 1E0WA 3AHVA 4GKLA 2OLHA 1OGGA 3WUBA 2D20A 2XWEA 3ZQ9A 4EAMA 3NDZA 3E1F1 2XSBA 4PUDA 3WNOA 2D2OA 1HJVA 4GXPA 1HP5A 2J47A 3SCVA 1OWQA 3NSMA 5E6YA 2O92A 1E55A 1MW1A 1UD3A 2DSUA 1XSJA 4GINA 3VM7A 1E1EA 3MMDA 1ITXA 2WMGA 3OGSA 2UY4A 4IPLA 3K8LA 1JL8A 1MQPA 1E6NA 1PIFA 2V5DA 4CUCA 5A69A 2PC8A 1BSIA 2ZUSA 4AZGA 3ZM8A 1E71M 3BCFA 1JF5A 1QPKA 1UR8A 3GXFA 4W88A 3ZSTA 1MFUA 1K9EA 1KGUA 1XH2A 1HKJA 4MAZA 4BF7A 3VO0A 3OLGA 1HL8A 1W32A 2GK1A 4ZXOA 3NYDA 3WH5A 5BXRA 4H8HA 1W3HA 2PBGA 3POCA 3IJ9A 2GJPA 5HXMA 4LGXA 1ZBKA 3RM8A 3WFLA 3PZNA 3FXYA 4ATWA 3VU2A 1AQHA 5CJ5A 4HZ6A 1UR9A 5A95A 4AWEA 3ZT7A 4GI9A 2FH8A 1E6SM 4N42A 2ESCA 1G01A 2GJRA 3TTQA 1PZ3A 3CPUA 4GO8A 2QPSA 4DWSB 3K1DA 3MANA 1OGBA 4PN2A 4KWUA 4CD4A 4UTFA 4QLJA 5E9AA 1RH9A 2VRJA 2IXVA 2AOSA 4H8VA 2ZE0A 3WQWA 1JI2A 1FHLA 1H0GA 1H49A 1XH0A 3FW6A 3WH6A 1UG6A 3AHXA 3L4VA 1HX0A 2NW0A 3MS8A 3VINA 3ARXA 5BRPA 2E9LA 2FHBA 5LA1A 4RE3A 4D6CA 3PTMA 3GTNA 3ZT6A 5EB8A 1LF1A 2GUYA 1UUQA 2VCBA 1V3JA 3GNOA 3WH9A 1JZ8A 2BVYA 2XVGA 2CHOA 4ZE5A 2W67A 1G5AA 1WNOA 1EH9A 2DT3A 1EQPA 3O2LA 1JNEA 3PTKA 1KR0A 4Z2GA 4MAVA 2D0HA 3B9DA 3K46A 3RJYA 4HOWA 4Z2HA 2X0HA 4M24A 1OB0A 2GJXB 1KBBA 3BSGA 3CBWA 1OCQA 5JBFA 2W66A 3KZSA 1H0IA 5C70A 1XHGA 4WKHA 3WDJA 2ZX7A 3W0KA 4CVWA 1LG1A 4NSBA 1BG9A 3W25A 1VRXA 2WNWA 7TAAA 3WQ5A 5D9PA 3VM5A 1JF6A 3TA9A 4DUWA 1O6IA 3U5YA 2E8ZA 2VZOA 3L4TA 1VBUA 4PSPA 1PJ9A 3BAWA 3D3AA 3FN9A 1UD8A 4HMCA 1W1TA 3WEZA 2VJXA 3W27A 3WQ4A 2GVYA 2DIEA 2QLYA 1ZL1A 4V2XA 2DSVA 3L4YA 1NP2A 2OYKA 3GXIA 3VMOA 3UR7A 2CBVA 5A6BD 3KL3A 3MUAA 2YBUA 1C93A 2BY0A 1FFQA 4P7NA 4AEEA 1D3CA 3IJ8A 1R8LA 1UKOA 4PTWA 1HJSA 2WLYA 4CCCA 1QHZA 2J75A 1E6RA 1XD0A 5A1AA 2X05A 2CYGA 3VTRA 1M7XA 5EFDA 4AD0A 2J25A 5CPTA 4CD7A 2XVNA 4H8UA 3RJXA 3WN6A 2CKSA 1EXPA 3RIKA 4FLOA 1VJSA 2DH3A 1UKSA 2FHFA 5DO8A 3TTYA 1MXDA 1B3WA 2J7DA 3N17A 5HBFA 1ZJAA 4CU8A 5A6LA 1Q6DA 2JIEA 4H2CA 2DT2A 3VD5A 4AXNA 1GQKA 2UY2A 1JFXA 2EPKX 4UQDA 2VT0A 3SIMA 1QI3A 2BS9A 4FLRA 3ZJ7A 4UQ9A 1FP8A 1JDAA 3EDEA 3KEHA 5M03A 2J7FA 2WMKA 2BVTA 5JIPA 3EYPA 1XC6A 4PCTA 4HA3A 4GI8A 2ZUWA 1JZ2A 3PZUA 3FAXA 1W9BM 1UR0A 3AIRA 5LA2A 3CHCA 1Q6GA 1C7TA 1QNPA 4B3LA 4D6EA 4XZBA 4P8VA 4JFWA 1EOMA 1K9FA 3CUJA 2BHZA 3ZJ6A 2PWHA 3BMWA 3MUIA 3BCDA 1XRVA 2CNCA 1GVIA 4PMNA 3DYMA 3WD3A 2WHLA 4M80A 3AIWA 1P6WA 2AAAA 2W5FA 4DUVA 1CXIA 4CD6A 1BYCA 2EPOA 3A4WA 4EANA 4E2OA 4TVCA 3KL0A 5CGMA 4N0RA 1MFVA 5CXPA 4F9DA 4A3HA 3OIHA 1BGGA 3AS0A 1E9LA 4W87A 1V3LA 1WDSA 3FHQA 1GOMA 1V3IA 3N13A 4W5UA 5A8OA 1UWTA 3ARQA 3AIBA 2E9MA 2J79A 5I77A 2A3BA 1UD5A 1LJYA 2WZEA 1LL4A 2XIIA 4AZBA 4LPCA 5DF0A 5BRQA 4AZIA 5I78A 1FH9A 1UKPA 4HTYA 3VGBA 2J7BA 4P7RA 3ARZA 1JYWA 1V6WA 4D72A 4H7VA 5E0CA 4JFSA 3VGFA 5I6SA 2EJ1A 3CUGA 1AQMA 1VFUA 3AJ7A 2YDQA 3CZLA 2DGAA 2ZXBA 2Y24A 3T0DA 2WANA 2EPNA 3L4WA 1NARA 2DSZA 5C71A 3W28A 1HVXA 1DWGM 3VGDA 3AHYA 1JAEA 1VENA 2YJQA 1QW8A 1WKYA 4L4OA 2VOTA 2UY3A 2J77A 4UFIA 1JDCA 5JIWA 1E73M 4OKDA 1PEZA 1JDDA 5BWFA 1C3FA 2CBIA 1J01A 1M04A 3WY1A 2OWWA 2C7FA 3SCSA 4X0NA 1TCMA 4CCEA 1BLIA 1C8YA 1H3GA 3VILA 3UETA 5HOSA 1KQYA 2J78A 2WHKA 1PAMA 5CLWA 1BYAA 3WSUA 3AXIA 1UQZA 4Y7EA 4OIFA 4Z2KA 5GNZA 2XVPA 2DPEA 5KEZA 2YLAA 1WE5A 5A2CA 1QBAA 2WW5A 2WVVB 5GNYA 3VKKA 4DM2A 2HISA 4CU6A 4PMXA 1E56A 3QOKA 1V6YA 1F4HA 1H11A 4M29A 4ACYA 1JZ4A 4UFHA 1C91A 4NI3A 5CPQA 3UR8A 1KXHA 1ECEA 1J0KA 5BXTA 4HA1A 4JKLA 4J3XA 1JI1A 3CH9A 2YL5A 2BY1A 4GQQA 3CTTA 4HMEA 1BYBA 3RMEA 2BV9A 1KCKA 1E15A 2B31A 2GK1B 3AS3A 1K9DA 1MW3A 4W8BA 3K4DA 1UQYA 1MW2A 3RO8A 2V38A 4KGJA 5GQBA 2CEQA 1XCWA 1NQ6A 1EGZA 2Y2WA 2ZWYA 2ZXQA 2G3IA 1WDQA 3WQVA 4NZCA 3W53A 1U33A 3OGRA 1DWAM 1PPIA 2WVTA 3TP4A 3TONA 4D6JA 4M82A 1I1WA 4EE9A 2CXGA 4RL3A 4ZEPA 2ZOXA 1XH1A 4JIEA 4NF7A 1CTNA 4PSRA 1BF2A 3T0BA 4TX8A 1UWUA 3DC0A 4MB1A 3PBGA 4TXEA 1LWJA 4LQ1A 4MNLA 3F5KA 5FOOA 2D23A 1H41A 1OD8A 3VIMA 1KR1A 4WF7A 1E3XA 1HP4A 4RE4A 3WH7A 1G1YA 1GZJA 1LL7A 1B1YA 4CD8A 3A4XA 4UOQA 3EDDA 3G6MA 3SCRA 1NH6A 3WD0A 2X0YA 1EO7A 3A3HA 1HJXA 1EOKA 4W86A 4W93A 1RPKA 1UR1A 2IXUA 4D1IA 1BGAA 4YHEA 3I3EA 3AQUA 4JKMA 1JGIA 3EMQA 5BXPA 4M81A 3WDQA 1B3YA 3I3DA 1HKMA 2D24A 2X8RA 3WELA 2WXDM 3WF3A 3ZOAA 4PBGA 2ZUUA 1V6XA 5A8NA 1C92A 4D6HA 2ZX6A 3PZIA 1EDTA 3A47A 3T2PA 4D6GA 1O7AA 4UFKA 4HPHA 1CNVA 2EPLX 1H2JA 3TTSA 4FMVA 5I23A 4E8CA 3VVGA 1CGUA 1G94A 2DSWA 2MANA 5D9NA 3NIYA 3CUIA 5FD0A 4CN1A 2BXZA 2VNCA 2WMIB 1W2VA 5E6ZA 3MV01 3A4AA 4AISA 3PZVA 2VRQA 1Q6FA 2XYLA 3ARRA 1NOUA 1NWRA 2XM2A 2ZICA 4OUEA 3BMVA 3VIHA 1PX4A 1ODUA 2VURA 4W84A 2VRKA 1TG7A 2E8YA 3WH8A 1ISWA 3WL0A 2D3LA 3D5HA 4JL2A 1SYTA 2BXYA 1EIBA 3OA5A 2XGBA 1I75A 1L8NA 2WCSA 1QNSA 1H5VA 2VX4A 1VEMA 2VZSA 1GVYA 2EO7A 4J27A 4C7DA 4B3KA 1GHRA 1CBGA 1HJWA 4KGLA 2XFRA 3WDPP 2G3MA 2VZTA 4AEFA 2W62A 4P7LA 2WHMA 5EMYA 1VB9A 3T2OA 3J7HA 4Z2JA
chains in the Genus database with same CATH superfamily
2W92A 3POHA 3GTIA 4S3FA 3F1QA 4DJFA 3UT0A 1LOQA 1R3TA 3SR7A 2DZXA 3DCPA 1XDMA 1UB3A 4QFUA 1MQRA 1J0YA 2CLHA 1F8IA 3B9AA 1U2YA 2WVUA 4QG6A 3FJNA 3U4FA 3OLDA 4E2DA 1AD4A 2NQHA 2ZX9A 2PDHA 2YPIA 2HXUA 2PDPA 1YDNA 3S8HA 3T40A 4IJBA 4US5A 3LRLA 4S39A 2WSPA 3PFMA 1FWGC 1I8JA 3APTA 3QYQA 1NDVA 4L7ZA 5K9XA 1GOQA 3B8UA 3SQSA 1ZJHA 1XLJA 4UNIA 3RN6A 4PB3A 2O9PA 3EKGA 3SCOA 2VFEA 4NXKA 5IRPA 5E0FA 2J9YA 1XLGA 4CU7A 3W26A 3BANA 1XLAA 3RGTA 1ADSA 2DV0A 4TV5A 2B7OA 1Z48A 4PMRA 1W1PA 4DVOA 2D69A 1OCBA 1SO5A 1YIXA 4LU0A 3CZEA 3SM0A 2NSXA 1GORA 1LORA 3UVAA 1CZ1A 3RR4A 3VIKA 3H2AA 1LRQA 4CNPA 4ICCX 3B0VC 3UYCA 2PGRA 3C2FA 1BYDA 1KXQA 5FCZA 4UMCA 2X1UA 3O9NA 1R7OA 4MJZA 5CPMA 1SW7A 4H9YA 2Q71A 4H2HA 4X9YA 2XFFA 2WM1A 2FMNA 5A2AA 3EB3A 2GJXA 2QT3A 2CKRA 1KV8A 1VEOA 1EPVA 4DBUA 1UWIA 2Z1SA 3UU0A 4R27A 4AZ5A 1IIHA 1PZ0A 3QZAA 1WAWA 3WF2A 3EWZA 3EA2A 3MV11 4NP7A 4G6CA 3N9KA 3V5FA 4NX5A 4YTQA 3VD3A 3MMWA 1KFWA 4IMFA 2ACSA 3HN3A 4MWAA 3VKCA 3WEMA 3N2OA 1VFMA 1P1XA 4MHBA 4UZUA 2PDBA 5FKYA 4Q7NA 3GNRA 2ZBTA 3IIOA 4KPLA 1CECA 2ONEA 1M01A 3WLRA 1WX0A 4JX4A 3UW6A 4JN7A 1H7PA 4Y8FA 3SGGA 1Z6KA 3UNDA 1DQWA 1KFKA 4W5ZA 1KFEA 1VHNA 1UUOA 3QV7A 1UD4A 2C1GA 4K7VA 1TPWA 4DX3A 1F8MA 5K3VA 3LU2A 2ZFAA 1BVWA 4XUGA 1DJHA 3VIPA 4UTHA 4IJRA 3CUHA 1NQKA 2ZKMX 3G1YA 3U7VA 1TJRA 4UBPC 1QFEA 3T4CA 1CXFA 4LJ3A 4I5UA 5F1UA 3JW7A 2VVSA 1B30A 4HNUA 4GY0A 2DVXA 1L9WA 3PANA 2PWDA 5CSRA 2BOEX 1A5BA 4PMYA 1F6KA 4QAWA 1DJXA 2YDAA 1C8XA 2YLLA 4AY8A 2PCEA 1FBAA 4JTEA 1UH2A 3II1A 4Z1BA 4GX8A 4N9CA 2QV4A 5FEZA 4EIVA 8RUCA 3N15A 3C8NA 1S2VA 3UP8A 3VMNA 2ALRA 5FSDC 1GOKA 3H7RA 4MZYA 4J3VA 4JYEA 1CLKA 2XFWA 5CSYA 3UZYA 4J3TA 3NZGA 1UR4A 2OR2A 1W17A 4O8AA 4WZHA 1K4HA 2OWXA 1BWLA 2W61A 3MTWA 2ZTJA 4AD3A 1XLBA 2VDGA 4U3AA 1JGMA 3TEVA 4DXVA 3JU2A 1JCMP 4U33A 3AWOA 1GCYA 4L9ZA 3N11A 2HBVA 4GYFA 4LVFA 1CX9A 4HOZA 1PZ1A 4JYDA 4UFMA 1EZ2A 3QPEA 1AL8A 4A05A 3WQFA 2J7GA 1Q6CA 1RP9A 1DPMA 1HNYA 3EXTA 1XPYA 2ISDA 4ATDA 4EOUA 5AOUA 2YDRA 1Z44A 3VABA 1HKWA 5LXXA 3HGJA 6ALDA 4V27A 2OOGA 4JL1A 3IANA 3BQ6A 3QTPA 3BO9A 2V63A 4R9OA 4XWUA 1LROA 3UG3A 4F66A 1EKOA 4H9MA 2JKPA 3U5UA 1QNRA 5C5YA 2Y88A 1E40A 3NYZA 2OYMA 3IGSA 4WIWA 1GOXA 4HP5A 4X0VA 1JAKA 5HDRA 3TW9A 1XYZA 3MP5A 1W8SA 3S1VA 1DORA 1G7VA 4GPNA 2Z1KA 3VX0A 3KBSA 4EXAA 4H9XA 3FSUA 3K4WA 2P0IA 2FPVA 4YTRA 3GH4A 1OT1A 4F0RA 4WQ6A 4D8ZA 1R86A 3ENLA 1CPUA 3HBLA 1OIFA 5IFTA 2NVCA 1MRAA 6REQA 5C7HA 1B4KA 4MY8A 2NV2A 2ZX8A 4IG2B 4DZ5A 2FKPA 5C9WA 3C2YA 4YN5A 2PU0A 1CEOA 3ITLA 4NAFA 1PWMA 3KRUA 1YHTA 2EEXA 3BAKA 3W7LA 2Z1BA 2P10A 3C2OA 2GGGA 1F07A 4E4UA 3B9OA 1W5NA 3NSXA 4S3KA 2OQHA 3AUOA 1Q4NX 3GWQA 2GSEA 4L1WA 1TA3A 3ARUA 4ACZB 3L67A 1TPDA 1GTEA 3RLVA 3C2VA 2PB1A 4KFPA 2WPBA 1UWQA 4UXDA 4Q4MA 1XUZA 3AMLA 3CYVA 2ZZ2A 1DE5A 4DJEC 4PE8A 2PRLA 1RQBA 3PZTA 4AZ6A 1NDYA 4Q33A 4NY2A 1J0HA 4NZ4A 5DXXA 4W85A 4D71A 1AH3A 4R5EA 1TV5A 2NUWA 3TU9A 1E6XM 1QPNA 4HU4A 2V5BA 1PX3A 4NZFA 3MUY1 3SRFA 1RA0A 3AYRA 1VBRA 1ZUAX 2PC4A 2OXNA 4NZ1A 1XV8A 1ZJBA 3W1QA 1Y65A 2HQAA 4JCMA 1P0BA 2OX1A 4WSKA 1GOOA 2Y5JA 3JR2A 1PE1A 1ZNNA 2QMJA 1PL9A 1CXKA 1KTBA 3PJTA 1A5UA 1XIHA 1R7AA 1TE6A 3GNPA 3QW4B 3W7MA 1GYMA 2F6XA 4V15A 2B7NA 4DEFA 5C9ZA 1CGVA 1TWZA 4L6HA 1O1ZA 3L68A 1FKWA 2FDMA 3QMRA 5CH9A 3XINA 1KXTA 3U7BA 2WBGA 4IJCA 3QC3A 4S3EA 2CLKA 5TBOA 3TYDA 1OADA 1O5XA 1EQCA 4GVFA 3TYBA 1QNOA 1B90A 1QVBA 3TTEA 1XG3A 3KHDA 1K4GA 3LPPA 1N82A 4NJKA 5A3HA 3B97A 1W1ZA 3IRSA 3PZQA 4JEJA 4OHQA 5IBXC 4C1KA 2W91A 4BK9A 2BMBA 3GXDA 4J7RA 2OOFA 4XO7A 1XDJA 3WNLA 4CVUA 4HHHA 1LWHA 4Q8VA 2VEMA 3ATZA 2HV5A 2D0GA 1V6TA 3M0HA 1PKYA 2FPYA 2BWGA 1VD6A 3IGXA 3VC6A 5FA5A 1G9HA 1CYGA 4IFKB 2GGIA 4QNWA 3T08A 3W76A 2WKGA 1RSCA 3CMJA 3IS4A 1GTHA 4FI4A 5HPOA 1W9PA 4QCEA 3WMCA 1E4MM 1XIBA 4GISA 3O06A 1EEXA 1KLYA 2JIWA 3AISA 4GA8A 1PXGA 2YCLB 3FHAA 3GIPA 5FF3A 3VDCA 5BU9A 3A22A 3UR5A 1TPUA 4PTVA 2V3FA 5D9OA 3BGAA 4KMQA 3WFAA 1JQXA 1R87A 4WDTA 4PB5A 2YL6A 1W3LA 5FJOA 1XCXA 1QO5A 1OQFA 2G96A 3R4IA 3GVWA 3NQ7A 4N7QA 3ARWA 3O15A 1O5RA 4QSFA 3MQTA 2PCQA 5BXSA 4X60A 3NPVA 3AIVA 3UXAA 4H41A 3GC2A 5FSEC 4I7UA 2FZ8A 1MW0A 2QUVA 1I2OA 4GNJA 2UV8G 3DYPA 2ZADA 1X97A 5B7YA 3L7RA 2Z4GA 3HV9A 1QHOA 3UJEA 3AS2A 4W7VA 2P3EA 3SRKA 4JHZA 1TVLA 3WQ8A 3LZ3A 4MJ2A 1ZBCA 1MNSA 4RW5A 5AY7A 1R2SA 1FX6A 2VTFA 1OFBA 3SB0A 1V6VA 5HANA 5FACA 3LZ5A 4U28A 3MO4A 3RRAA 2CLOA 3UWVA 5AYIA 4QDMA 1Z3NA 5CCZA 4G56A 1GZGA 3GHTA 3B9EA 1HZYA 5D8ZA 1IEWA 1LWIA 1NTHA 3DFNA 3RCNA 3DUGA 1MSSA 3CC1A 3USZA 5T9BG 4WKFA 2W27A 3PB2A 1OC7A 1KWGA 1AJ2A 3CQJA 3E49A 4OVXA 3KLKA 3ITCA 4EXQA 2QAPA 3GM8A 2DUZA 4EK7A 4NUWA 4Y9AA 1YDVA 3F5LA 2WCAA 5IXEA 5DELA 1JYXA 3TOPA 1XG4A 1NM9A 2DEPA 1AL7A 3DECA 3QMSA 7PTDA 3HJEA 4DF2A 3E0VA 4JTJA 5K2ZA 3R89A 2OB3A 4JOMA 3LV6A 3BICA 3U57A 3MMUA 2ZX5A 3AXKA 4AD4A 4M51A 2PTZA 3LMYA 5DX7A 2QJGA 2FQIA 2J13A 3TMLA 3OGVA 3IEBA 4ZENA 3R0DA 2XGZA 4R88A 2J8GA 3KOFA 5DT7A 5CZSA 3K5XA 3TAKA 1J79A 3M0VA 3VUPA 1VEPA 3CM4A 4BF5A 1EA0A 1BF6A 5XIMA 2ZC8A 3BLEA 3BGJA 1EP1A 4R7OA 5F7UA 3VD7A 2F7FA 3JRKA 4O19A 2PMQA 4NIRA 3GXMA 2NVAA 1MYRA 2W63A 3ALFA 5EBAA 1KLZA 4J28A 1XLMA 3T42A 3E3HA 2GSHA 2VFGA 5EA9A 2JFEX 2R1MA 1US2A 2IKJA 1XINA 1L2QA 3RILA 3VFCA 2RKXA 2RJGA 4M6UA 4JAWA 4CCDA 1IZJA 3OODA 3AYTA 3NDOA 4URIA 5G1TA 4UR8A 3KBMA 2XWDA 3C6CA 6CGTA 3HPSA 1BVZA 3MA8A 1PV8A 3BAIA 4HZ8A 1R3VA 3H4GA 3W24A 3S9IA 4XD5A 4AIUA 4NASA 5F2IA 1Z69A 2B0MA 4ROQA 1S1RA 4N4PA 1KCZA 5H8UA 3OOQA 1L8PA 3DFQA 3OZPA 2QVNA 4AX7A 4BI7A 3WJSA 1V0KA 4BY3A 2NSOA 5KZMA 3LPOA 1S3HA 1MRQA 3C5QA 2DT0A 3RITA 1AQFA 2XVKA 4BQ3A 3EGJA 2OT1A 1QR7A 4OOUA 3ZVIA 1HF6A 3VGGA 2FB3A 4NJJA 1P4CA 1FXPA 4OU1A 4UCFA 3K13A 4JY8A 1V77A 2AKMA 4IICA 4ZQPA 5A2BA 4PUMA 4IIFA 3LSBA 1GQIA 2BXVA 5CAHA 1KB3A 1QJWA 1M68A 3U6WA 3WJXA 4QP0A 1QPOA 3KOWA 3G0SA 3NQMA 2X2GA 5H8PA 1SJDA 3ZLFA 1GVEA 3W7JA 4PMUA 4D6DA 3OIXA 2F6UA 1XR2A 2DJLA 3G0UA 5CKSA 5J04A 2RDXA 3G2GA 4HA4A 4HPNA 4GHRA 4LUSB 4CD5A 4UTKA 2O9OA 1H4PA 4HK5A 1L6GA 2C79A 3SURA 1VP5A 1RPXA 2BASA 4JR5A 1XWYA 4B15A 3EDJA 4G1KA 4KESA 1NJJA 2UY5A 1LTDA 3WF0A 1AODA 2C19A 5A8QA 4Y8EA 2VYOA 1UPPA 2ZRYA 4ZOBA 5AFDA 4UUIA 3VE7A 4CEXC 5C8BB 3CHFA 3L21A 3O6DA 1S5VA 1VFTA 1EWEA 3BDKA 1DWHM 3W83A 4H19A 2JF6A 4IGHA 4K37A 4IHCA 1P6CA 4NRSA 1Q6RA 2CBUA 2F6KA 4PMJA 3CZKA 1T40A 1T5AA 4PMOA 2G4FA 2B4GA 4HNOA 2CBJA 1N8WA 4HNNA 3CQIA 4C1NB 2PLKA 5U7SA 3B0XA 5HQMA 2DU2A 2P50A 3R6IA 2A7NA 1ZENA 1W91A 3N04A 2Z27A 1AK5A 4O10A 2ZWZA 3BXWA 4OBRA 1MEHA 3KXQA 3DYOA 2WMIA 4CNTA 3W75A 3ZWTA 4QHRA 1TJ0A 3HURA 1RV8A 4GQRA 2RUSA 4H9ZA 1N7KA 4X61A 3KVJA 1M7OA 2R9RA 4KKXA 4CQ8A 3PPCA 2ODOA 4AIOA 5G2HA 3F2DA 2FYMA 2TSYA 3EWDA 3WMBA 3V3WA 3S6OA 1OZQA 2HNHA 4MB5A 3HPAA 1K7EA 3N2BA 2ZDSA 4V28A 4DWDA 4MF4A 1BFNA 2O7SA 4U3CA 3STEA 5AN7A 2WM0A 4F9JA 2E40A 2FGZA 3FS2A 5C9XA 1EC7A 2Q8XA 3WD2A 3MJMA 2IPJA 4DO4A 4A8RA 1DJGA 5C2CA 3C2EA 1VJIA 1OF6A 5D38A 3AS1A 1DYSA 1BHGA 1D7KA 3VCNA 2D20A 4XAGA 3UZJA 4MLRA 4ZA0A 1HJVA 3PBVA 1PUDA 3KRZA 2QXWA 3NQ6A 2DSUA 4GINA 1KRCC 3VM7A 2CZVA 1JL8A 2ISWA 3KM8A 4CUCA 3TCEA 1GVQA 3WBYA 3FJ6A 4AZGA 3ZM8A 1E71M 3BCFA 3DN5A 1TIWA 3E9AA 3O0FA 4BWLC 2Z24A 4YLWA 1F3EA 1UR8A 3RAOA 4W88A 2CZ5A 3TR9A 1HGYA 1KGUA 4GYPA 1HKJA 3TFCA 3VO0A 1GJPA 1W32A 2GK1A 4AYGA 3OTRA 4KWOA 5C6MA 5BXRA 4A21A 4H8HA 4QDWA 3IJ9A 3WLKX 3VOIA 2CLPA 4KCWA 2ZRXA 3N25A 2XIJA 1UR9A 2CU0A 2QDEA 3VOJA 1US0A 1VPYA 1YDYA 4GO8A 1KKRA 1V7AA 3K1DA 4KWUA 2Z1VA 4QLJA 1RH9A 4IFRA 2VRJA 1DBTA 2AOSA 1IWAA 3WQWA 1JI2A 1H0GA 3WH6A 4O57A 2PA6A 2BOGX 2J27A 5BRPA 2ZZ4A 4D6CA 1EJTC 1MUMA 2QCDB 2GUYA 2VCBA 1V3JA 4G2DA 3T0TA 7XIMA 5D2YA 4EPEC 2E5BA 1YX1A 2CHOA 3A3WA 4IP5A 4PH6A 3E6EA 2CZDA 5EY5A 1OCNA 3PPGA 1JNEA 3PTKA 3TX9A 5FESA 3B9DA 3K46A 3RJYA 3DERA 4HOWA 1T6MA 3GQYA 5G4EA 3HPZA 4ZOCA 1KKOA 3QR0A 2I57A 2DZSA 4GNVA 1SJCA 3EA1A 3H6OA 4WKHA 1UZHA 1BG9A 2PTWA 1FCUA 4R9XA 3H2OA 4NKCA 4DUWA 3L4TA 3GHSA 4PSPA 3BAWA 1Z41A 3D3AA 5EBUA 1GVSA 1ZQ5A 1YTDA 2VXNA 1A80A 1W1TA 3TWAA 1IGSA 4MWAD 5DRIA 4LALA 5AZ0A 2VGBA 1ONWA 4O4VA 4LY4A 1OEPA 4H6QA 2ZA1A 1XS2A 4P7NA 2OELA 1UKOA 1TKKA 1SFTA 1QHZA 5A1AA 1VFLA 3VTRA 1FWRA 1M7XA 4CD7A 2J25A 5CPTA 5AVHA 2GVLA 2CKSA 3A9BA 3BLOA 1KM4A 2ZRUA 4ORMA 2Z2BA 3RIKA 3ABSA 2V2HA 1IT7A 3ANUA 3W7QA 3TE9A 2FHFA 1MI3A 3E96A 1EGMA 4XTIA 3G22A 2YBVA 3TNBA 1DTNA 2YW3A 3NQ2A 4AXNA 2G5WA 1GQKA 2UY2A 1JFXA 4LAZA 1LQ2A 3N6JA 1QI3A 3O0KA 1FP8A 4HPJA 3KEHA 5M03A 2WMKA 5HWJA 2PP3A 1WAUA 2YCIX 2DZWA 2ZUWA 1GK8A 3FAXA 3R0UA 1U22A 2PURA 1C7TA 1QNPA 4UNKA 3TNOA 2QCLA 4OTKA 4PR4A 1Q4WA 3BW3A 3SSZA 3IARA 2GUUA 4ZZ9A 1Y0EA 3HQOA 4MM1A 3BCDA 2X41A 1E9IA 3VOGA 2Q6ZA 1S3TC 3CT7A 1AG1O 3N14A 2WHLA 4M3PA 4M80A 4X63A 3FA5A 4FX7A 4NI8A 4TR9A 1CXIA 1Y5VA 1I6NA 2EPOA 3RU6A 1YE4A 4GE8A 4E2OA 4TVCA 3KL0A 5CGMA 1AW1A 2Y7FA 4ECLA 4LVAA 1E9LA 2C14A 1WDSA 2GVEA 3FHQA 1GOMA 3G0XA 3CMFA 4JIIX 3ZLHA 1ADOA 1FWEC 3T9PA 1S5MA 4NYUA 3AU2A 3RR1A 7REQB 4RV8A 5HR6A 2HMCA 1AJZA 5D33A 4AZIA 5I78A 1FH9A 1UKPA 3LA4A 1ICSA 2J7BA 4P7RA 4FNPA 4XISA 2FTYA 4YJ5A 1VFHA 3VGFA 3KDOA 2OZ3A 3LHVA 4KCVA 5I6SA 5HMSA 4QQ3A 1XICA 2YDQA 1YBQB 2ZXBA 4LV4A 5JQ9A 3T0DA 3UWYA 2EPNA 3L4WA 1C29A 5TQLA 1SZNA 2DSZA 1PHQA 3W28A 4ZQOA 4A22A 1RY8A 4Q8MA 4B92A 4O0ZA 2W9MA 3S4TA 4Q4SA 2EGZA 3P82A 2J77A 1A5AA 4M6QA 5JIWA 3W7NA 4OKDA 4WJEA 3DI1A 1PEZA 1C3FA 1J01A 3TC3A 1M04A 4NZ5A 4HNVA 4X0NA 1TCMA 2WZTA 1BLIA 1C8YA 4JIRA 1H3GA 1TTIA 5HOSA 1IXNA 3AXIA 4IOTA 3W72A 4Z1YA 4E2BA 1UQZA 4IPJA 4OIFA 5GNZA 4N6FA 2YLAA 3LOTA 1WE5A 2V69A 3VZYA 3BE7A 1QBAA 5C7VA 2IS7A 3HQNA 1H5YA 2HXTA 3C2RA 1X7FA 3W71A 4NI3A 2PLCA 3LLXA 3BSMA 1JI1A 2QNEA 4V1XA 1OYAA 2BY1A 4GQQA 1TWWA 3TYZA 2XIMA 3B8WA 4U10A 3E38A 4FOJA 3EX4A 3RMEA 2BV9A 2GK1B 1XLKA 1EPXA 3AS3A 4K3ZA 1PYMA 1MW3A 3WLQA 5K4XA 1BXBA 4S3GA 2CEQA 1EGZA 4DJDD 3R11A 4RE0A 3SRDA 5I3GA 4HT3A 1IEXA 3LY0A 3B8TA 1BRLB 3D46A 3CPRA 4NYYA 4KBXA 4M82A 1I1WA 3I68A 1D8CA 4PB4A 3A3XA 4JIEA 1NDWA 3THUA 3TC7A 5G4WA 4B5TA 4MB1A 1LWJA 1AW2A 1F6PA 1UJQA 1XL9A 1KR1A 3KOZA 3GTXA 1Q7MA 1GZJA 3SGUA 2Y0FA 3A4XA 3FA4A 1QRQA 4Z0SA 3SCRA 4QDPA 2X0YA 2P88A 4C90A 4K1GA 1QOQA 3A3HA 3MB9A 3VNLA 1KM2A 1Y8BA 3TMQA 3UGRA 4H00A 2CZFA 1H7OA 3C3UA 1JQVA 5BXPA 4ALDA 1B3YA 4GH1A 5F2GA 1REQA 2X8RA 3KUMA 1N2VA 3QKZA 3IVTA 3EB4A 3ZOAA 5A8NA 1C92A 3EXSA 1ZRQA 1BQGA 1LT7A 3A24A 3A47A 1JDFA 4E3VA 1PTAA 4GI4A 5DCDA 4JQAA 2Q3OA 2EPLX 2PF8A 4KW2A 4LTSA 4UMAA 4L64A 1R30A 4CN1A 2KAUC 1E0TA 2WMIB 4HKPA 5FI8A 1F3TA 4HQVA 3W1XA 4QX4A 3OVGA 3MVIA 2ZICA 3BMVA 2VURA 2E8YA 1ISWA 4F0HA 2KZHA 3HGRA 3D5HA 2FB2A 2OPJA 4AX6A 4F0SA 4DO7A 5I7GA 2WCSA 3GR8A 4O0QA 4GY1A 1H5VA 3KBJA 3H2NA 2P8BA 4J27A 2XH7A 1PCKA 2G3MA 3EKLA 4LRSA 2PZNA 4PA8A 2X16A 3HG5A 3W1MA 3T2OA 4KWSA 3WF1A 3QQ1A 3ANVA 4M1RA 4FF5A 1P0KA 2ZZ7A 3N9RA 4WVXA 1V3HA 2BODX 4QITA 5LHEA 1RP8A 2I16A 2ZXDA 3UZ5A 1XKJA 4BQ2A 1TPB1 2A79A 3KVMA 1G6CA 3IIVA 2G0WA 3SRHA 4R3UA 3IJ7A 3S46A 5KTLA 1EJXC 2QUUA 4A3UA 4Q6JA 3QY7A 2NWSA 4UNLA 3FLUA 4PTXA 2QIWA 3NQ8A 3WBXA 4W8AA 2F8QA 1V03A 1KM1A 2OEJA 1QI4A 4LUTA 2WKJA 4XZIA 2Y7EA 3CUFA 4LAMA 3KBNA 3AZTA 4HPXA 3U3HA 1GJUA 3NPWA 3E0IA 3BJFA 1C7SA 2ZQ0A 4GQGA 3GDLA 4IIBA 4AYSA 3B06A 5DBUA 3R10A 2ISFA 2JE8A 2A85A 4RLIA 4D6FA 3K2GA 4XV0A 1GWJA 1XX1A 1W9UA 4X22A 1JD7A 5L9FA 2NT1A 2V67A 4HHLA 3N2XA 2SFPA 2CHNA 2VX6A 1BWKA 3EOLA 3TH6A 4BWLA 2PTXA 3T05A 1K03A 2IQDA 1KXVA 4GZEA 4QEHA 2OQLA 3MUXA 2HCVA 3MVTA 3SFKA 8CGTA 1Y7VA 1IXPA 2G3NA 4DM1A 1CXLA 3WENA 4LNYA 5AYBA 2Z6IA 2BZNA 2WPGA 2V5CA 1F3WA 2XH4A 1XGZA 2F38A 3SN1A 4TX6A 1CT5A 4C6LA 3MP3A 1SW3A 4EF9A 4NU7A 1UZDA 3GVQA 4IISA 4ZTXA 2QPXA 3MCOA 3C0QA 3H7UA 4XG1A 3QLDA 3ZIZA 1XBYA 1MEWA 1SZGA 1OVDA 2WOQA 4O54A 3OB8A 4K68A 4GYJA 4GI6A 1J93A 1UZ1A 4LNCA 3H8AA 4ZR8A 3E0LA 1DHKA 1POJA 3BUVA 4RXFA 2D73A 3CHEA 1NVMA 4M56A 1TPEA 4GUFA 5CPOA 4ZO8A 2EQDA 1SMDA 1WKFA 4PEEA 2XJ7A 1TYGA 3DESA 4JS3A 2E5DA 1EYWA 2C13A 3LPGA 3KW3A 3M7SA 3ORWA 2NWRA 5FJIA 4UTWC 1JPIA 2G3JA 2H3DA 1LRNA 4HJFA 2XPKA 5IDIA 1ME7A 4PMQA 1LRTA 4ZE4A 5JBEA 2JF7A 1J0IA 4MIMA 3F4VA 3M6DA 3LG3A 2JQXA 4MOZA 4ZVJA 5D02A 4IMEA 3UYIA 1Q45A 4PRRA 2VC7A 3HIJA 2YGYA 5AVNA 2ZIDA 3B40A 3HQPA 4YVXA 6XIMA 1XLCA 2JGQA 1P43A 3SUTA 4RPQA 2HPMA 4FP1A 1GJWA 2VGIA 4FALA 2QHAA 2A2IA 2PWFA 5FJTA 4GABA 1E4IA 2BY3A 4MZ1A 1R85A 3B9NA 1MMFA 5GNXA 5LNUA 3HA1A 3REQB 5K4ZA 4R53A 2QCDA 2VFIA 4ZFCA 2P8CA 3N6QA 1UD6A 3M7WA 3T0AA 2NV9A 4DYEA 2Z25A 5H8MA 1CDGA 1F76A 1JCYA 3W22A 2PSNA 1U1JA 4E8GA 3A9IA 3WUFA 3LERA 4C6BA 4BCEA 2GWNA 4M1BA 1AMYA 4Y2WA 2A3AA 3PK7A 4AG0A 1I4NA 5LSMA 3WKZA 4YMZA 5CGTA 3VYLA 2BDQA 1B9BA 1EB3A 3WEOA 4HJWA 1NWTA 1XIDA 1HKVA 1X6LA 4XZWA 5K9CA 4HIBA 3H4XA 3PR2A 3IACA 1E1CA 3B8VA 1VH7A 1VKFA 3OLIA 4LYKA 5BNKA 4CQDA 3GTFA 4WK9A 4V33A 3UCCA 3M5XA 3PPHA 4A29A 3PF3A 3QR1A 1PKMA 3QY6A 1G0CA 3ZZ1A 3N19B 3AROA 4J3ZA 4QBXA 1H50A 3UJFA 3N29A 4HCHA 1KCLA 4B5WA 2J7EA 1XIGA 4XAYA 1FOBA 1JPMA 2CZEA 4J3UA 3TQKA 1TZ7A 4BHYA 3M0IA 1O94A 2PDJA 3F5JA 4YTUA 2JKEA 1TV2A 3URQA 3TA6A 3KS6A 2DT1A 1DQXA 2CFFA 1T99A 4GFSA 1KFCA 1A5LC 1SO4A 4C6MA 1A3XA 4BQ5A 3A23A 3NGJA 1YTEA 2BTMA 4IL0A 3V75A 1NOWA 4YU1A 4JNYA 1FRBA 3G1FA 4GJIA 1IIGA 3H4WA 5K7JA 3DFSA 3K8KA 4CN6A 1WO2A 1W0MA 4U5KA 4LBRA 4RZ4A 3M5VA 3EPOA 2J62A 2A5HA 3LM3A 4JFVA 3BZGA 3UG5A 4WXYA 3SQLA 1DXFA 2YL9A 4AU0A 2RHGA 2PZ0A 2G3FA 3GZ3A 4ILSA 4EXBA 5A6KA 3LPFA 1V02A 3GYEA 3FY1A 4DJDA 4YTSA 3SCQA 5G4HC 3TJIA 1BEUA 3UY8A 4YYCA 3EBVA 4M19A 4W7UA 3V1PA 1F05A 1UWRA 4EX4A 3M0KA 2Y63A 1W9DM 3FEMA 4GVHA 4ZO7A 1IZKA 3KS5A 2OGYA 3AHZA 2FJKA 2OZ0A 3L0GA 3LCIA 4LS2A 3TIMA 3CPGA 4DUXA 1V93A 2WZHA 3AOFA 1AH0A 4MADA 4F2BA 3HPFA 3DKLA 1HL2A 1XSIA 2O4QA 3PJWA 3KP1A 4G5DA 4MPKA 1QW9A 1VFOA 3M4HA 1E6ZA 3PTQA 5F4XA 4AY1A 3QSRA 1TMQA 1Q6QA 2TODA 4V1YA 1CGTA 1LG2A 1S5WA 1TIMA 1FH7A 3N73A 4IGSA 3WMSA 2X0SA 3CWNA 1OFPA 2D1ZA 3RYSA 2PEVA 3MU7A 3MYOA 4QCFA 4Y9MA 4J2PA 3M41A 3DFHA 1TWSA 1JXKA 2ZZ3A 3GZAA 3LCHA 1HXJA 2A6LA 3LSCA 1JYNA 1WZAA 4N4QA 4PRWA 1T8QA 2ATMA 3OQ8A 1WZKA 3N9SA 3QC0A 5ENLA 3URNA 2E68A 1YXDA 1U83A 4XO6A 2OODA 1O5KA 3P2VA 3CXOA 4UTTC 4CKQA 4PUWA 5I5RA 2VL4A 3DG3A 1OX5A 4FZIA 4EWJA 2Y4SA 4REQA 4MJMA 2ABAA 4O50A 3W6LA 3GBDA 4JFTA 5J5DA 1PWLA 2FJUB 3NUKA 3QV6A 3M0MA 5D2XA 3VMPA 3THDA 1XW8A 2QF8A 5D4YA 4GRSA 1EJUC 1GOWA 3LI1A 1XI3A 4S3JA 1KD0A 2W0UA 3PWAA 4L9XA 1PX8A 3WDHA 1GHSA 3CHDA 4ZL1A 3M0LA 4J5NA 2I7GA 1K77A 1A53A 1Q7QA 4KIRA 1JZ5A 2C15A 5DY3A 4NG3A 2VKZG 5CZKA 1IQ8A 3B4UA 2ANUA 2A3EA 4I9JA 3H7VA 4JX6A 3EEZA 5FF4A 4C91A 5GPRA 4IUOA 2QYGA 4G7FA 1LBMA 1U30A 2ZUTA 3DIPA 1JPKA 3DEQA 1G7UA 4HD5A 3BG5A 4FX8A 2GUBA 3VAVA 3SCUA 3W02A 2EBNA 4FS9A 3MI6A 3QMTA 3GXPA 4PYSA 7ODCA 3BLKA 4JNZA 2DZVA 4IX2A 4JEQA 3SY8A 1VLIA 1R3YA 4DXXA 5AC4A 3O6AA 4LFYA 4IP4A 2VZVA 1JPHA 1QASA 4UTJA 3CU2A 3MHFA 4M8UA 4JCLA 1H09A 4OZOA 5I79A 1KWKA 1ODZA 3DHFA 4ERIA 3P62A 5AKQA 3AIQA 3AALA 1SUXA 3BC9A 1B9ZA 1SSGA 5ABHA 4AUBA 1GKPA 3DAQA 1GONA 3E12A 3H2CA 4L65A 1V79A 4FNTA 2OTDA 3PC0A 2DDXA 2PFHA 2NZLA 4IZGA 5C2XA 2DZPA 3TZFA 5BOFA 3WQCA 5D04C 2HZGA 3H2EA 1DEDA 3UXLA 3P14A 3HGOA 1Z32X 3G1HA 2TPSA 3PTDA 2WSKA 4GC4A 2AL1A 3QGAC 4Q4KA 1HW6A 1EA9C 1H51A 5MHBA 3MBFA 2YL8A 4P7OA 3EAUA 3PBUA 3TLLA 1OINA 1NWUA 2WMFA 2IKIA 5DFAA 3DHUA 5FF7A 1TRDA 3TFXA 2ASHA 2I5QA 3EA3A 4ZGYA 4QE5A 4YWSA 1S2CA 2JK2A 4JY9A 3VNZA 3LX9A 1WDRA 2FHCA 1EXBA 2JEPA 1UYQA 1DWIM 1W31A 1OFRA 4LF1A 3W70A 3V4BA 1SM9A 3WLIA 3FK4A 3WIJA 4Q8QA 2X40A 1PZ2A 1X8FA 3BZJA 1HN1A 2BSLA 3DZ1A 4I5RA 4JN6A 3NOEA 1GG0A 2WVVA 1WBJA 1W1VA 3L2MA 4MNJA 3UPWA 1K70A 4XD3A 4DJDC 4Q8TA 1S2UA 3NO5A 1WUEA 4REQB 4IXXA 3NL3A 3E0WA 2J4GA 1YKWA 3V0TA 4QLKA 4GUHA 3PM6A 2VEGA 4CN4A 1UD2A 3MCNA 1TPFA 1Q6EA 1ZPTA 2V68A 1XLIA 4HNLA 4RNFA 1TE1A 4DBWA 3W29A 4O28A 1PIGA 2V2DA 4YNGA 5A6SA 3EX6A 5HMDA 3NXFA 4AF0B 2XZ7A 3LGDA 1KBKA 3GKAA 4B90A 1KM6A 4CGTA 1K1DA 4LH8A 4HNCA 2YKKA 2BFGA 4HVXA 2RDWA 5HNRA 4UQCA 4M7TA 2NQZA 4LXFA 2HEJA 1W9XA 4JTDA 3DFYA 1ZFJA 2OVLA 4FF7A 5LNRA 4GCXA 3AFBA 4Q4OA 3O07A 1H61A 1VF8A 3SUSA 4GO9A 4QJ4B 3WLNA 2TAAA 4EWND 5BOEA 3T44A 2DUAA 3AIUA 4NNAA 4I7VA 1R3QA 4UOZA 3U4AA 3VOHA 2DH2A 1D2KA 4EF8A 1F5ZA 4AZHA 1O95A 4JTIA 2ALDA 3G1RA 1XYCA 2C18A 3G1SA 1E43A 1M03A 2VFHA 2Y70A 5DRCA 3AHTA 3Q2DA 3QHMA 2ZCGA 4I8YA 1IV8A 1QWKA 3KL5A 5FJPA 3TOYA 2PBOA 1V6UA 1UC5A 1WXYA 2BHUA 7TIMA 3NSNA 4DLMA 1U5VA 1UPMB 3K8MA 3VNYA 3IUDA 3VX1A 5HJXA 4OECA 4GIYA 3W7OA 2WCGA 1UW9A 4J3WA 1KFJA 4A4AA 4PMVA 1OIMA 3P0WA 3L5LA 1GOIA 2E4TA 4XIAA 4LC6A 3UWZA 4P8UA 2D3NA 5HUOA 4O15A 5DMNA 4C6QA 2VGGA 2Y7DA 4D2JA 4E5TA 1RCXB 4PL1A 3R7MA 5I0DA 4GQBA 1LOLA 4TVDA 3PAOA 5M5DA 2O9TA 4AC7C 4AD5A 1FTXA 2I9UA 4KRUA 4OUIA 3NGFA 1US3A 1TVNA 4QISA 2PI6A 3RPTA 3IV3A 3AWNA 1KGXA 2VC9A 3ZYZA 1XLHA 2ACRA 4JHOA 4P8WA 1EX1A 1TUFA 4GBDA 4HN4A 2EKGA 4DIAA 1TZ9A 3W85A 3PZ9A 1DKWA 4DBEA 1ZU8A 2VOMA 4LYPA 1FH8A 4JFUA 1O68A 4U5IA 3AIEA 1SFSA 3VIJA 1QUMA 2ZRZA 3GTHA 3AMDA 4WDXA 4ACZA 1M9HA 1B57A 1E9YB 4ES4A 2CERA 3CWOX 1C9WA 1WZMA 3L4XA 1QAPA 4FX6M 2NX3A 1ISZA 4ZOEA 1Q5MA 2YA2A 4QGCA 5A6MA 2WLZA 3EB2A 5IHSA 3KRSA 1PB0A 4AMCA 4B2DD 1JNDA 1VCFA 3UWEA 4AZ7A 2VP8A 1G4SA 3W6YA 2Y8VA 4LCSA 1GNXA 1E70M 1EWDA 2VX7A 3VOFA 4G9PA 2XG9A 5D9MA 3B0UX 3I4EA 4HCDA 4RNJA 4ZQMA 1J8VA 4G7EB 2QJJA 3TQVA 1ME8A 1WZLA 4XSMA 1Y5XA 3M64A 1DWFM 3P84A 2GGEA 1OBAA 1E51A 3VCRA 1KTNA 4I9TA 3GIYA 2YFOA 3TJ4A 3AHVA 1FWHC 4B4FA 3RCMA 3S47A 1E0UA 1OGGA 1XRSA 4FXSA 4NNCA 4NILA 2AL2B 3ZQ9A 3NDZA 4PUDA 2QGHA 2Z28A 2O92A 3UCDA 5D03A 1K6WA 4XVDA 5MKGB 3PBMA 4IPLA 3AJXA 1E6NA 3FDKA 1BSIA 2V81A 6ENLA 4DRSA 2G50A 4HMNA 1A5CA 3T81A 3VDGA 1DIDA 4HU3A 1MFUA 1K9EA 4LUYA 1XH2A 4IFOA 3WLMA 4BF7A 1ZLPA 1XBZA 3OVPA 3OLGA 4W9TA 1RLDA 3UGVA 4GWEA 3TXZA 1E9ZB 1W3HA 2PBGA 2GJPA 2R24A 1NU5A 4K8EA 3WFLA 4ATWA 3VU2A 1AQHA 4C6FA 4H6EA 5G5IA 5CJ5A 1A3WA 4AWEA 3NPXA 3KCOA 4N42A 2ESCA 1G01A 3HQ1A 1PZ3A 4O52A 3RMJA 4DWSB 1XLFA 3MANA 1ITUA 2PAJA 1DIEA 1W3NA 4XVEA 4JIPA 4A3QA 2ZE0A 2WSYA 1FHLA 3M9YA 1H49A 3HPXA 1MZHA 2QF7A 3MI2A 3PULA 1NFPA 2R1KA 4GH3A 1SPQA 3HZ3A 2NW0A 3ARXA 2CLMA 4K38A 5LA1A 4ZB0A 3LXBA 3ZT6A 5EB8A 3T0CA 1LF1A 1UUQA 2E6FA 5CC5A 4B5VA 2Z0IA 2ZRWA 4F3HA 1EBGA 1IT8A 2XVGA 4ZE5A 3S1GA 1WNOA 2JKAA 2QUMA 4XZHA 2X0HA 3F4DA 1OB0A 2GJXB 1XCFA 1KBBA 4U4MA 4Q4RA 1NF0A 5C70A 4ZSTA 2AGKA 4F4RA 2Z29A 3IIXA 4RPPA 2ZX7A 4XZMX 3W0KA 2DIKA 4H9UA 5I3FA 2OFJA 4PFMA 4DN1A 1XDLA 3WQ5A 5D9PA 4Q8PA 4IIGA 1NFBA 2PDGA 2TYSA 4JTKA 2PDIA 3TA9A 1O6IA 1K8XA 1R9ZA 4CEUC 3T8QA 1SJAA 3GVRA 3I6RA 2E8ZA 5KZDA 1LBLA 3UXKA 3W2MA 2PRMA 1UIOA 1AW5A 2HS6A 5D32A 3RCYA 3W1UA 2DIEA 1YADA 1U5HA 1NP2A 2OYKA 3T4WA 3UPBA 3VMOA 1AA1B 3IVUA 3UR7A 3OZYA 4QJ5B 2CBVA 3S0CA 1WUFA 2ZTKA 4XAZA 1FWBC 1C93A 1FFQA 4DI8A 4OE7A 2FLIA 1D3CA 3DC8A 3ITVA 4IIDA 1R8LA 1EJVC 1HJSA 2WLYA 5FF0A 1ELSA 3BARA 5K9DA 1XD0A 3S83A 3FKRA 2A0NA 5EFDA 1Q85A 1EFZA 4AD0A 2CWNA 4H8UA 3WN6A 1EYEA 1IR1A 1EXPA 3IJQA 3M0XA 3YPIA 1VJSA 2OO6A 3LHYA 5DO8A 3PG9A 2AL2A 2J7DA 3E74A 3N17A 1I2PA 1FDJA 3KX6A 2OZTA 1TMLA 4FSAA 4MG4A 3MSYA 4O1BA 2JIEA 3QZEA 4H2CA 3KLLA 2VELA 5PTDA 3LENA 2PP0A 3QQWA 3M44A 4S2BA 3SIMA 3NM3A 3WMLA 4FLRA 3FEQA 3ZJ7A 4UQ9A 3ISIX 2J7FA 1WKDA 1TTPA 1W1B1 3EOUA 3LNMA 2BVTA 2RAGA 3WBWA 3EYPA 1XC6A 4PCTA 1K02A 3MZ2A 1JZ2A 1QPRA 3F2BA 1W9BM 1RVKA 3LCLA 1WKEA 1UR0A 3UXIA 2YCKX 4D6EA 3TSDA 1UR3M 3RXZA 4P8VA 3O8AA 1K9FA 4UIOA 3ZJ6A 1A50A 4EVZA 3BMWA 3VNKA 4LOCA 4GNKB 2WQPA 4JGDA 4K2SA 3BV7A 1XRVA 1R3SA 2CNCA 1GVIA 4PMNA 2E67A 2V5KA 4LEQA 1UMYA 3VC5A 1UMLA 3R0KA 3LTPA 4C1LA 3ITTA 3BLDA 3A4WA 4JBRA 1GYNA 1MFVA 1TJ2A 5CXPA 1UJPA 4O12A 4F9DA 2PDNA 3AS0A 1XJBA 1Q8JA 4JQ3A 2POZA 1V3LA 3DKJA 1KCXA 3N13A 5A8OA 3GDMA 3INPA 4ZOAA 2FZ9A 2WZEA 2XINA 3R58A 5EMMA 3GDRA 1I0BA 3WCZA 4LPCA 4FOKA 4Q8UA 3S2MA 4MWAC 3A5VA 5BRQA 4B3ZA 3BGGA 3MDWA 3A12A 4Z1DA 3ARZA 1JYWA 1V6WA 3S6DA 4H7VA 4DHGA 4JFSA 2H9AA 3LK6A 3CUGA 1AQMA 2F9RA 3AJ7A 3O05A 5TIMA 3CZLA 2Y24A 3T8LA 1FDZA 1EIXA 1W8GA 1NARA 5C71A 4DF1A 1J96A 1HVXA 2GVJA 3MHUA 4WR3A 3VKBA 1DWGM 3WLTA 3AHYA 1RA5A 4C60A 3OP2A 1VENA 2YJQA 3N2TA 4PBFA 4C6DA 3CUXA 4L4OA 2GL5A 1FWNA 4QE1A 3G8RA 5D30A 4FXFA 3WY1A 3F4NA 3M6YA 3SCSA 4CCEA 4DBDA 4KQNA 3B0PA 3QEZA 1XQLA 5CLWA 4Q8WA 3AO0A 1ZTVA 4Z2KA 2DPEA 2FZMA 3QN3A 1Z89A 2C71A 2VDIA 3WLLA 5GNYA 3HG2A 2R6OA 4LW7A 4DM2A 2HISA 4JTSA 3PUOA 2X42A 4IMAA 4UFHA 1C91A 5TNVA 3PSWA 3UR8A 4GD0A 1MO0A 1KXHA 1BXNA 4DELA 1CB7B 2GYIA 4J3XA 1YNYA 1FDYA 1EJ7L 4M7SA 3GDKA 2H8XA 1L2UA 1NAL1 1W56A 1Z42A 4HMEA 5AHFA 3WLPA 3UFYA 1UBPC 1ZAIA 4RNHA 1E15A 5T91A 5CBBA 3I6TA 3ABRA 1YXYA 5M2FX 2Q3RA 3K4DA 3BTNA 1UQYA 1PYFA 2V38A 3CIXA 4KGJA 1QU4A 2VM8A 3FGCA 1WDQA 3WQVA 2G37A 3W53A 1LZOA 4JDBA 3OGRA 2E77A 3TONA 3HMJG 2J9XA 2P1FA 3BG9A 1FXQA 3MPGA 1RVGA 3S1WA 5J5RA 5BWAA 3T0BA 5HJYA 3BOFA 4TXEA 1QT1A 1LUCB 1HO4A 4FR6A 4LQ1A 5DCBA 4JTCA 3W01A 1OCJA 3KHJA 3DGRA 1BKHA 4R33A 3VIMA 4H83A 5HNTA 1E3XA 3C3NA 1HP4A 3VCCA 5CZ0A 4X2RA 1LL7A 5I3KA 4CD8A 5JMUA 4UOQA 1EF3A 5AHMA 1A4LA 3P93A 1NH6A 4HBKA 3LI0A 4GGHA 1EO7A 4W86A 4W93A 1RPKA 3OZMA 3QQ0A 3KBVA 1S5TA 4YHEA 1FWCC 3SO7A 4QS6A 3TROA 2G95A 5HAOA 2ZZ6A 1JGIA 3WQDA 2GJNA 4M81A 4MY9A 3WDQA 1RQHA 4PODA 4LUIA 3I3DA 5CBJA 4F40A 8XIMA 1K8YA 4KEUA 4HA0A 3WF3A 1BSLA 1V6XA 4D6HA 3PZIA 1EDTA 8TIMA 1TQJA 3T2PA 3SADA 5XIAA 4L6OA 5G2IA 4PCNA 3QH2A 1XYBA 3TTSA 1D3GA 2EHHA 4E8CA 5I23A 4N6EA 4IMCA 3LHZA 1CGUA 3MUCA 4FA3A 2QJHA 4C6NA 3DFOA 3ME3A 5HK4A 1F74A 1W2VA 5E6ZA 1IR2A 3NO1A 2IQTA 1Q6FA 3LBCA 2XYLA 3WQGA 5FJJA 1XF0A 3FDGA 3VIHA 4DJEA 1T41A 4W84A 2VRKA 3PP7A 3TKFA 1SU5A 2PGWA 3TYAA 2D3LA 4JL2A 2DQWA 3COTA 2TRSA 1KC7A 2NUYA 4ZQNA 1M6JA 2QIIA 4NJGA 4XBSA 4KGLA 3WDPP 3M5ZA 4IT1A 3LDVA 5EMYA 1VB9A 4GUIA 4QE4A 3W87A 4Z2JA 3O7UA 3GVGA 2IUZA 3OW1A 5EPDA 4QIUA 3A5FA 1DWJM 1ECQA 2PTYA 2EKCA 4UTMA 1KGWA 4S3BA 4E8DA 3PZGA 1TPVA 3QXBA 4NT0A 1HUVA 3TQ0A 5CC6A 4ADTA 4WOQA 3UA4A 1LUCA 4CQCA 2HS8A 1FCVA 3E2RA 1VIZA 4Z17A 5D2WA 3R13A 4K8GA 3CUZA 2CLEA 3TSBA 1A0DA 3OBAA 1QI5A 5F4WA 4L9YA 2EXOA 4MTVA 1XPGA 3GBEA 1TWDA 1UH4A 4GGBA 3WG6A 1LOSA 1FFRA 1SZRA 5B7ZA 3WD1A 2HWGA 4GIRA 4I9AA 2VENA 1LLZA 1YYAA 4J40A 4PCSA 3CLMA 1WXJA 4O53A 1TUXA 3KWSA 3FAWA 3MSGA 4YYFA 1EDQA 3RU8X 2WJFA 4YHGA 1WXZA 1S2AA 3NPUA 4G8TA 4WKAA 3VIFA 5LIUX 3WNMA 4LT9A 4U31A 1J6OA 2FFIA 2PDWA 4H1ZA 2V82A 3BWWA 1SGJA 1V08A 3WLSA 3VGHA 1MXGA 2XSAA 3H54A 3CZJA 1JXJA 3T09A 4D9PA 4CNNA 5KETA 3DHPA 3GRIA 1SVDA 1DP0A 2QDGA 4WUIA 2FPTA 3MKVA 3W73A 4Y9OA 3ANYA 4A8LA 3HG4A 1UP2A 2ZUMA 5FEWA 1ADDA 1MQQA 2Y5SA 4KFOA 1EJSC 2BVWA 2PPGA 3A6OA 1TV3A 1J0ZA 3WLJA 4DXKA 4ML4A 1DJWA 3GC4A 4DZAA 5A6BA 3RUBL 4UQAA 4IIEA 4DBSA 3UA3A 4UQBA 3UF9A 2ZDRA 3ARSA 3NEHA 3NQDA 4FPSA 4MNKA 2I5IA 5TD4A 1DJNA 3JVAA 4GOAA 3B8IA 1E5NA 2JGYA 3WL1A 3SCWA 3W81A 8XIAA 2RGMA 4LX4A 1SFLA 2OKOA 3EWCA 2PDQA 1XP3A 3VD4A 1JZ6A 3GD6A 3EOOA 4M5PA 2XVLA 5EYWA 4O1CA 3NO3A 4IGMA 3KDNA 5E70A 5D2TA 1LYXA 1TB3A 2J66A 3ZJKA 3IK2A 2YZ5A 2OYLA 3NZRA 4MDPA 3T7VA 2I56A 3M07A 4BQ4A 3RLUA 6TAAA 1GPFA 3EKZA 1I1XA 1EO5A 2ZA3A 3STGA 1AFSA 1RCQA 3JUGA 4TO8A 3ZFHA 4L4LA 4QROA 2ZZ1A 3S2JA 1CLXA 4RDWA 3TVAA 2V3GA 2QEZA 4GIAA 2ZZ5A 2CESA 3IIZA 1XD1A 3ATYA 4KCUA 4LBUA 2PDUA 4YIWA 1HTIA 4AZCA 3WNPA 2VQTA 3WNKA 1VJZA 1U1HA 4IMDA 4JTLA 3R43A 1S38A 3ZT5A 3QKEA 3TTOA 4FO4A 2XM1A 3CL7A 4DF0A 1D3HA 1PCWA 3FYYA 2HROA 4DZIA 1IT0A 1UA3A 5E09A 1TRIA 2I5GA 1NDZA 4NX0A 2QCCA 1UC4A 5LKYA 4H04A 2YYTA 3SECA 1POKA 5CBIA 3FOKA 3NZ1A 2PE4A 4Q22A 1ITQA 3SCTA 1V0NA 2A3LA 3GU1A 1FA2A 5DMYA 1S46A 2KX9A 4GZIA 3UCQA 1P1MA 3P81A 4NJHA 5D09A 2QCFA 3BURA 4ERGA 3LCXA 3DGBA 3T2QA 1O66A 4DO6A 4TUFA 1X1OA 1MDRA 2GGJA 5CZTA 1X96A 3TYUA 4QR6A 2BY2A 5HNNA 2BLEA 3RFAA 4N9DA 4BEQA 4L56A 2QCHA 4GBUA 5CC3A 2GOUA 3VKDA 1YDOA 1R5YA 3W2LA 5AC6A 4J2MA 3WDRA 3NNTA 2WKLA 1M53A 2X30A 2GQAA 5AYZA 4I7WA 2C16A 4LYQA 1CB2A 5DT5A 3D6NA 5LGXA 4XUYA 3PUDA 3VXGA 4PZVA 1MEIA 1JYVA 2G97A 5CQ1A 1MWOA 1X8CA 4XX6A 1T96A 2BGNE 4KRTA 4MLJA 5CGQA 3TN6A 3MHGA 1J5TA 1OYCA 1FHUA 1GQJA 2JEQA 4TV6A 4O1AA 3W1RA 3UQNA 5DEZA 1D8WA 1B5TA 4AZCB 5HJLA 1K8ZA 5H6HA 4EAYA 1DJIA 3GR7A 4RXGA 5B80A 1DJQA 2YSWA 2XN2A 3GAKA 4FIQA 3M16A 2OZ8A 4EKJA 4IQJA 1GQNA 1Q7ZA 4GY7A 1RAKA 3TYCA 1XSKA 1JG9A 2Y61A 4HZ7A 2NLYA 3P80A 2WK2A 3PWIA 1OD0A 1MVYA 3HFYA 3OVRA 2DIJA 5KINA 1NP0A 5EFFA 2EPMX 4PUNA 3T55A 3E2SA 2A3CA 2NUXA 4S3CA 4C5ZA 4UFLA 3ZR5A 3TWBA 4W89A 1JZ7A 3E2QA 3V7PA 2DUXA 2PWUA 3B0YA 1CGYA 5IBXA 3GH7A 1HL9A 3W23A 1OZMA 3E2VA 4JNMA 3NR0A 3QTGA 3LGEA 1YRRA 3U8GA 4WGHA 3BSHA 3GDTA 5JUVA 1IEVA 1XBXA 1NEYA 4I6VA 5AC7A 1VAHA 1B2YA 4O14A 3UY7A 2MNRA 3IJLA 3MSDA 1YPIA 1W1A1 2DP3A 4LB3A 5BROA 1JFHA 3VNDA 3K1GA 3EWUA 2QUTA 3KAOA 2HK1A 4JDYA 1PHWA 4QLLA 4Q6XA 4TX9A 4RW3A 1YBQA 2HE5A 5JH2A 1KBJA 1UHVA 1XXXA 3ABXA 5I00A 1I2RA 4FHAA 2D2GA 4KETA 1IEQA 1A5SA 1J9YA 3GSMA 4AH7A 3I65A 4WLCA 1XIFA 3VUSA 1R38A 1P0DA 4S3AA 1UBSA 1XBVA 3DXIA 3CV6A 3MKKA 1PDYA 3NJ3A 4L1XA 3VIIA 2LLEA 1W9VA 2FIQA 3EPMA 1RD5A 3N3MA 2YIHA 1F9CA 5EMUA 5HQLA 2JALA 1M1BA 1EHAA 1PO9A 3RRXA 4C7FA 1Z7AA 4WD0A 3L4UA 2MUCA 1GYLA 4XBKA 5GJNA 3WUEA 3G1XA 2E25A 1OM0A 2O55A 1IHIA 5AB3A 5D8WA 1F61A 1SSDA 2GJLA 5EU9A 4TTUA 3G1DA 3VGEA 1KFBA 4NHVA 2GDQA 3SAZA 3SUVA 4AB4A 4ASTA 2D2HA 1BQCA 3ES7A 3C86A 3LHTA 2PLJA 1B31A 4LYRA 4PUEA 2QUNA 5BCAA 2ATSA 4E4PA 4ATLA 1V5XA 4QRNA 4DJED 1V3KA 3W7HA 2J74A 3TXVA 5AYXA 2GQ8A 1TR1A 1RJRA 4BS0A 4UR9A 2OT0A 4Q7IA 2CIPA 2J7HA 1BTCA 3HF3A 3PBYA 4IWWA 5C0QA 3IVSA 4HHMA 4MKSA 1S2TA 3M46A 3BV4A 3RNDA 3BLPX 1TMHA 1OJXA 1F7BA 1BXCA 2QPUA 3KRBA 4B5SA 1WV2A 3JS3A 2GPTA 1OX4A 2CITA 2XISA 4C6JA 2E1DA 4K7YA 2V30A 1E72M 3H23A 3LCWA 1JR1A 1M7JA 1H63A 3BVJA 4A3RA 5FAGA 5KZ6A 2ISSA 4GG9A 5LXEA 4LEFA 1ISXA 5T8GA 1X98A 4M6VA 2IW0A 3CV2A 1YE6A 2VEFA 2A1YA 2X09A 4FR1A 5IHRA 1GEQA 1KTCA 3ICJA 3CGTA 1AQ0A 1H60A 1PDZA 3PZMA 4JXCA 4Q8NA 1GEHA 1J12A 3DBPA 1DV7A 2ZC1A 4GXMA 5C2GA 2DSKA 2WZIA 5I24A 2WMJA 2GSJA 4A35A 3C52A 1CGXA 4C6IA 1CXHA 5ABFA 2DQXA 3Q4DA 1W5QA 2WVSA 4PC8A 3G6LA 4E0CA 3N2MA 3GW0A 4RDVA 4IP7A 4LRTA 4YPJA 3WDIA 4LS1A 5LA0A 3QRHA 1KRMA 3S1UA 3RM9A 4OWGA 1ZBWA 2Y8KA 4O1DA 3W3OA 3B05A 1IWPA 3N4AA 2QR6A 4E38A 4EPBC 5LIXX 3G1AA 4CCZA 3UBPC 3WNNA 1L6SA 4QJ3B 2P3ZA 2VFDA 2AGTA 2FH6A 3O63A 3AXHA 2VEKA 1V02E 4JN8A 2IMRA 4F0MA 1G4TA 4OBSA 2D0FA 2IPGA 2BOFX 1H7WA 1RD6A 3NTYA 5CEWA 4YCPA 3R79A 4AIEA 2PF0A 1P7TA 1RBAA 2C3ZA 4C1NA 1E4LA 1EJWC 2F61A 3HTWA 2ZA2A 3LS9A 2CLFA 4FNQA 1QMLA 3UG4A 1VBGA 4GKTA 5BMWA 1ZY9A 4PTNA 3OG2A 2XGIA 2J24A 3I10A 4F2UA 4JTUA 5FEPA 4BI5A 2OSXA 3IK4A 4DZHA 5CG0A 2XIOA 4HMDA 1GVFA 1REQB 1YEYA 1EJRC 4FNUA 1J11A 4WSHA 3CL6A 3P7YA 3CIVA 4F8XA 3Q94A 3MSRA 1MZRA 1BPLB 2BHYA 1OX6A 3VNIA 3VKAA 1J6PA 1P6BA 2VMFA 4RR4A 3RX2A 4RV3A 3P5YA 5HQEA 3E5PA 3EMZA 1TA3B 2PWEA 3NM1A 2ZYFA 3QW3A 2ZVIA 4IPPA 2ZVRA 4A3YA 3OPSA 5DLCA 9XIMA 3I6EA 3S5YA 4Z2LA 1BKSA 4ZQCA 1TFVA 4PMDA 3PUGA 3WK1A 2V8ZA 3M0JA 4IM4A 1Z9AA 5SWUA 3D0CA 5CSUA 2O56A 1BRLA 4GJJA 4YTTA 3CYJA 2VR4A 4FLSA 1AVAA 4JTFA 4AVFA 1KNWA 1JIBA 3FSTA 1CWYA 3M1ZA 4FNRA 3Q67A 5G2WA 4HZMA 5H91A 3T6CA 1GVRA 3NVDA 3QF0A 4X2PA 1EUNA 2NLIA 4NQ1A 2GQ9A 2J8FA 2VEIA 3UPMA 1XFBA 4RZ6A 2PP1A 2B7PA 2HE8A 2J6XA 5LGZA 3BJSA 4Q32A 2WYSA 4AD1A 4RUBA 1ISVA 3S2LA 3VE9A 4GCAA 3L23A 4ZQRA 1KRAC 2VWTA 3EMCA 1SZEA 3ZO9A 1DTUA 1H1YA 2WWCA 4OJYA 8A3HA 3GO2A 1RHCA 3S5NA 1VYRA 2OSWA 3FFSA 1DIOA 1L0PA 4W7WA 1R0MA 5BRBA 1NWSA 1TV7A 3SCNA 2F84A 5H1WA 4HN8A 1W2PA 3SQMA 3GHUA 5T9CE 4RKAA 1LL6A 2EPHA 5G1YA 1XIIA 2J7CA 4WX2A 4TOQA 5HPCA 1WP6A 3PPFA 2G41A 1F4AA 2XIBA 5AHNA 1VR6A 2V5LA 4QSHA 3RHGA 4OFCA 5LZLA 3HMCA 4OV4A 1VQTA 4FXRA 4C6PA 3TZNA 5AYYA 3DG7A 3APGA 3FKKA 2UZ9A 1TR9A 1T0OA 1UIPA 3S2CA 2BB0A 2FVMA 3CTLA 4S38A 1WDDA 4ORIA 2NT0A 3MI3A 7CGTA 3FYPA 1FWDC 2OQYA 2YCEA 4MB3A 2FTPA 2XHYA 3TCSA 1LLWA 2HVOA 1VYSX 3HJZA 1VFFA 1HG3A 2D22A 4IXHA 1L6FA 1XIEA 2W6RA 2F2HA