4A3HA

2',4' dinitrophenyl-2-deoxy-2-fluro-b-d-cellobioside complex of the endoglucanase cel5a from bacillus agaradhaerens at 1.6 a resolution
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
300
structure length
300
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots along an enzymatic reaction coordinate: analysis of a retaining beta-glycoside hydrolase.
pubmed doi rcsb
source organism Bacillus agaradhaerens
molecule tags Hydrolase
molecule keywords PROTEIN (ENDOGLUCANASE)
total genus 122
structure length 300
sequence length 300
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 1998-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4a3hA00
4AW7A 2BNJA 3I3DA 3CZ8A 4OZOA 1WDPA 1HVQA 2J47A 3A4AA 1BSIA 4WSJA 1WCGA 2WZEA 1E9LA 3DHUA 3CTTA 4MB4A 2G4FA 3NDZA 5FL0A 4QCEA 3VIMA 1V6WA 4JFUA 2JFEX 3DC0A 1QI4A 1E40A 2WHJA 4AEEA 1C8YA 3AIBA 1BG4A 3WFLA 4UOZA 4PUEA 4BCEA 1UA7A 5IDIA 3W6LA 1AQMA 5I3DA 1KXVA 1V02A 4FLRA 1LL4A 4JFWA 1C93A 5M3WA 2CETA 4B15A 1QBAA 8A3HA 4UFHA 1NWRA 3WEMA 1E73M 1XSIA 4JHZA 2DT2A 4YHGA 5I2UA 1B1YA 2OYLA 1FHDA 4D6GA 1B9ZA 3SCWA 4H2CA 3IANA 4M56A 5M03A 5A95A 1VBRA 1HF6A 3APGA 3II1A 1W2VA 2WK2A 1JZ8A 3FW6A 2G3NA 2BXZA 2BVTA 2ZX7A 5A8QA 1EOMA 1R85A 2YIHA 5BXSA 5EFFA 3VIOA 1WB0A 3CO4A 4CD7A 2JF7A 3LPFA 4TTUA 3GXIA 2WMGA 3WD3A 3W29A 4J3TA 3A6OA 4RE4A 1UH2A 4X0NA 3ZMRA 1XV8A 1BGGA 3WELA 1JYVA 4GI8A 1J01A 4JFSA 3RIKA 4OOUA 4J27A 1EDQA 1GZJA 1TUXA 4D6IA 1US2A 3ZR6A 1HNYA 1CNVA 3CH9A 4TUFA 5FIPA 4CCDA 1KXHA 1VENA 2J4GA 4MNKA 4V28A 4A3HA 5ABEA 3RJYA 1ISYA 3FNDA 3DYPA 3MMWA 3W0KA 4ACZA 1W9DM 2QHAA 2YDSA 3RCNA 3GZAA 4J3SA 4AZCB 4AD4A 2D0GA 4J7RA 2WNWA 3MKKA 3VD5A 3A3HA 4U5KA 5A1AA 2E9LA 1J0YA 1GOWA 4D1JA 5IFPA 3N1AA 4Z2GA 5FD0A 4UTFA 4PMDA 1LLOA 5A3HA 3EMCA 3THCA 2DH2A 3S2CA 1CGXA 2ZUMA 4E2OA 2DGAA 2WPGA 2ZXAA 5LA0A 5HXMA 1BAGA 5M17A 3AMCA 4XUYA 3AYSA 3OZPA 2VZUA 1QI5A 1JAEA 2XPKA 4DWSD 1CPUA 2NT0A 4QCFA 4E8DA 1HJSA 1E56A 1PIGA 3QOMA 2CNCA 4AZGA 1E1EA 3L2LA 4CU6A 2CBJA 4B9ZA 2BV9A 3GYCA 4HOZA 3WH7A 2PWDA 2D23A 1JG9A 3AS2A 5KEZA 4J28A 2GSJA 1OGSA 2WHLA 3AZTA 4LYQA 1H09A 2JEQA 4Q7NA 3WQ4A 1OB0A 3PTQA 2RGLA 3WFZA 1V3IA 4X9YA 1E5JA 2QPSA 2VVSA 3VINA 1J0KA 4W87A 3SCSA 3TTYA 3OGVA 4TOQA 3BMVA 4PN2A 4FF5A 1RP9A 4W5UA 4B3KA 9CGTA 1CGUA 2CBUA 2VRJA 2XFRA 5EBAA 2D0HA 3GBEA 4IUGA 4CD5A 4RL3A 3AZRA 4TXEA 5ABHA 1HX0A 2WVVB 4PEEA 4NI3A 5CLTA 1CLXA 2UWFA 3ARPA 3NCOA 2EXOA 4Y7EA 1XH2A 4NF7A 3UG3A 2DIEA 3TP4A 2WKLA 1E72M 4D6DA 1VEOA 3THDA 2WSPA 2EPOA 5EB8A 1EA9C 3PTKA 1WDQA 3CHDA 3MMDA 3VD4A 3F5KA 4B9YA 1JL8A 1MVYA 1KFWA 4PUDA 3SEPA 5M5DA 4PRWA 1V3JA 1E0WA 1D2KA 3CHCA 4HMDA 3VIKA 1UKSA 1E3ZA 3MS8A 3OLEA 4UFKA 3OIHA 2J8FA 1B31A 2XFYA 3UEQA 1H1NA 4AD3A 2PB1A 4CD6A 4MDOA 4ZFMA 1XCXA 4DUXA 3BAXA 3VDAA 4J3UA 1UZ4A 2J78A 3SUUA 3GNOA 1UA3A 2XHYA 1G1YA 1QNPA 1UR2A 4V2XA 4ML4A 4P7LA 1W3KA 5ABFB 3AS3A 1FH7A 3WEOA 3W53A 1UD3A 2OWXA 3WH9A 4GIAA 1UD8A 1GJWA 3AIWA 4LGXA 3RDKA 5A8OA 1W1TA 3WD1A 4IISA 1GOMA 4HP5A 2BS9A 1XD0A 2WWCA 2CHNA 1V0LA 1ISVA 4QFUA 2BY0A 1I75A 4UQEA 3CUJA 3BMWA 3CMGA 3CZGA 4CCEA 4M81A 4JIEA 4W7WA 2XGBA 5GPRA 3WQVA 1P6WA 1UR8A 4JL1A 2ZXDA 3PZNA 2Y8VA 1YHTA 3NDYA 4Z2KA 5I5RA 1LG2A 2Y5EA 2OWCA 2UY2A 4PCTA 1W1PA 4MAVA 4MJ4A 1WZLA 2UY4A 2WCGA 5I24A 1ECEA 2UY3A 1Q6GA 2O92A 3TTSA 5A94A 1M7XA 1V0KA 3PZMA 2ZOXA 3T2QA 3NUKA 3N17A 2DSKA 2BXYA 5HPCA 2VRKA 2FH6A 1KQYA 2CPUA 4Q22A 7TAAA 3OGRA 2YL8A 1Q6DA 3WNPA 1MW1A 2NW0A 4CUCA 1DHKA 2D22A 2ZX9A 1NOUA 3SURA 1OCQA 3AHVA 1QNQA 1W3HA 4D6EA 4NRSA 3IK2A 3PZQA 1MXDA 2WMKA 2VRQA 3GXMA 4PMQA 1K9EA 3U5UA 1HJXA 3QHMA 4BA0A 5DFAA 2G8ZA 4UNIA 2JF6A 3AIRA 2GDUA 1OT1A 4HZ8A 2GJXA 4HPGA 3AHYA 4AISA 5E0FA 3AHTA 3FHQA 3WQ6A 1NARA 1E6QM 1ZBVA 4EK7A 2F61A 1U2YA 1ZBCA 2A3BA 2J75A 5I78A 3T2PA 1W2PA 4UFMA 3WN6A 1DWHM 2VT0A 1EHNA 2VR4A 1OSEA 1VFMA 1GOIA 1E4NA 4GO9A 1ZJBA 1W9XA 4CN1A 2E40A 5BXRA 5CSUA 3U7BA 3SCVA 1JNDA 2V38A 1K6AA 3CIVA 3VD3A 4AZBA 4S3KA 3F5LA 4HMEA 1B3VA 4AEFA 3BXWA 1UR1A 1QHOA 1JI1A 3L4ZA 1WE5A 3AMGA 4M80A 2Y8KA 3W37A 1C92A 1E0VA 1AMYA 1I1XA 1BYDA 4UOJA 2FHFA 2WB5A 5I0DA 1HL8A 2BY1A 5F7UA 3QR3A 5DF0A 4AZ7A 4B16A 3T2OA 1H11A 2PWFA 3AXXA 3I3BA 1CXHA 3WD0A 4GXPA 2G3IA 1ESWA 3VGHA 3CZJA 4QLKA 4ATWA 2D3LA 1J12A 1MXGA 4M82A 1H0GA 1ODUA 2YDQA 2YL5A 1QNSA 1OINA 2E0PA 4UFJA 2WCAA 1C3FA 3VO0A 1HT6A 5IFTA 1MW2A 3EDDA 3QGVA 2J8GA 1PX8A 3VTRA 3UR7A 2PF0A 2G41A 4W8LA 3UESA 1W9VA 1GHRA 1WPCA 4PMRA 1F4AA 2X0HA 1PIFA 4JL2A 3AMDA 1UG6A 3WUGA 1XGZA 1FFQA 2PWEA 2EBNA 1XHGA 5CJ5A 2BHYA 1A47A 4XX6A 3EMZA 4GO8A 3SIMA 4ACZB 1MW3A 1DWGM 1G5AA 1GOQA 3K46A 3WNNA 3PZVA 3NSXA 2EPKX 1MQRA 1HIZA 2YKKA 2WHKA 3CHFA 3WY1A 2G3MA 1UKPA 2CITA 3POCA 4PMXA 3PZGA 1W9UA 4AZHA 1C7SA 4QLLA 2XG9A 3TTOA 3FAWA 1QNRA 1SR0A 3L2MA 4HU8A 5CPQA 1LJYA 5AY7A 3GH7A 3OZOA 2GJPA 3TOPA 1TZ7A 3K8LA 2XSBA 5BWFA 1OGGA 1GQLA 1WKYA 4GI6A 1PEZA 2WBKA 2GUYA 1CXKA 2ZXQA 3BGAA 4WKHA 1ODZA 2VCBA 1RPKA 2XVLA 3CBWA 1R8LA 3UCQA 3ZQ9A 1BYAA 2YLLA 3L4WA 2MANA 1RP8A 2VR5A 1IT0A 4BQ2A 4QP0A 3A4XA 1OWQA 2DIJA 2XSAA 4W5ZA 3WD2A 3MUY1 3W38A 4QAWA 3WKZA 3AZSA 3ARSA 1SFSA 2D0FA 4NZCA 2V5CA 3EDFA 1VEPA 1QI0A 1QI2A 3M7SA 3WBEA 1CYGA 1E6ZA 2J7FA 6CGTA 5BXTA 3WIJA 2J7BA 3SCUA 1NOFA 4HMCA 1QI3A 3B9AA 3GXDA 3WNLA 4H8HA 3ZOAA 1WDSA 2X2YA 2VVNA 1FHLA 4JCMA 3EYPA 1JYWA 4H41A 1CTNA 3OLDA 2GFTA 1QPKA 5D9PA 4JFTA 1B90A 3UG5A 5TD4A 2X09A 5CLWA 2FGLA 3VPLA 1HVXA 4Z2LA 5D8ZA 3L4UA 1JF5A 4UQ9A 2BVYA 4MNMA 4UOQA 1B3WA 3PBGA 1BFNA 3VX0A 3K4AA 3BSHA 3WUFA 3VIFA 1O7AA 1UD4A 4MADA 4AD1A 4AXNA 5IXEA 4HOWA 1JZ6A 3ZT6A 3NYDA 1MWOA 4XB3A 5E9AA 2D24A 5EMYA 2CEQA 1A3HA 7A3HA 2VX6A 4MB3A 2WAGA 1HKMA 2NSXA 3BAIA 1IZJA 1PX4A 3AICA 3MV01 4HA1A 1HJWA 4WKFA 1KXTA 3U7VA 1DWIM 1CXEA 3BAKA 5A8PA 1JZ3A 1MQQA 1QHZA 3GBDA 2Y24A 2CBIA 3VDHA 1NQ6A 4H8UA 4MB5A 4TX6A 1BG9A 5C70A 3BH4A 2WC7A 3GTNA 4D6JA 1AVAA 3VNZA 2X0YA 4P8WA 1J0IA 3AIQA 1X6NA 4ATDA 3JUGA 1W91A 2BY3A 2UY5A 3WENA 4W88A 4W8BA 5A6BD 2CHOA 4OKDA 1EGZA 1V0NA 1EO7A 1NM9A 2C7FA 3W27A 2DSZA 3NSNA 1RD6A 1KGUA 1GHSA 4LYPA 3LPPA 4DUWA 2VZOA 1JZ5A 1J0HA 4LPCA 1H49A 4EKJA 2VO5A 1V3HA 4K68A 3B9EA 3L4VA 1CZ1A 5GNYA 3WF0A 4GQRA 1E70M 5LA2A 1B3YA 4AMCA 4GZJA 1UD6A 1E1FA 4AC1X 5BYWA 3WDPP 4NRRA 3O9NA 4PMNA 5D9NA 2VZSA 4A4AA 1PX3A 3SCTA 3IAQA 1G9HA 3AS0A 1Y7VA 3AMLA 3VD7A 4D71A 1H3GA 2YBUA 1V6UA 4M29A 2VZVA 3WMSA 2CKRA 4LXFA 5FOOA 1JI2A 2EPNA 1EDGA 1VIWA 3RM9A 1GNXA 2XM1A 4PSPA 1V6XA 1G0CA 3EDJA 4M8UA 3IJ8A 1I1WA 5AYBA 1H5VA 4X0VA 1JF6A 5DT7A 5D8WA 4Z2JA 1JNEA 3QHNA 4HTYA 5A69A 2ZUTA 1CECA 1JZ2A 1V08A 3RMEA 1Q6CA 4MNLA 1W3LA 1KB3A 4TVUA 1ZBKA 4CN6A 1MW0A 2YOCA 2XFFA 1ZJAA 3WBAA 3BSGA 3WNKA 2A3HA 2V3FA 3WSUA 1BF2A 3QHOA 1QBBA 1LL6A 3DYMA 1R87A 3FHAA 3ARRA 3VGEA 1B3XA 5A2CA 2ZWZA 1J0ZA 1AQ0A 5A8MA 4J3VA 3OLIA 5E0CA 2XJ7A 1FP8A 2WC4A 4KGLA 2DQXA 2CXGA 5A6SA 1GPFA 3VIHA 3OGSA 1OM0A 2VQTA 3SCPA 3AFBA 2YLAA 4AIUA 4ACYA 6TAAA 1CGTA 1E3XA 3CMJA 1TR1A 1E0XA 3ARZA 3FN9A 4EANA 3OG2A 1OIFA 1VRXA 1EH9A 3RM4A 4CCCA 1W9BM 2Y2WA 1JDAA 2BHUA 2VC9A 2PWGA 4W89A 2IXUA 4C7DA 2HVMA 3RM8A 1BPLB 2WHMA 3WH6A 1JAKA 3L4XA 4W86A 2DH3A 4KRUA 4D72A 3N12A 1ISXA 1GQJA 5JIWA 3VM7A 5BRPA 3AS1A 1LQ0A 3CZLA 2JIEA 2PWHA 5D9OA 1UH3A 1EIBA 4EAMA 3KL3A 5FCZA 3MUZ1 3ZSSA 2BVDA 5GQBA 1YQ2A 1J9YA 1UWRA 4F79A 4JKKA 4JKLA 2G3JA 1JDCA 1UD2A 4AZ5A 4UZSA 1DP0A 1L0PA 3RJXA 4MTVA 1NP2A 1VFOA 1UOKA 1CENA 2E9BA 2ZX5A 3ARUA 2W5FA 2EPMX 5JBFA 1B3ZA 4FLSA 3SCNA 1G94A 3HU7A 1TVNA 2B31A 2XGIA 4ZXOA 2FHCA 3W4RA 4FK9A 1GORA 2OSYA 2VOTA 3VIPA 3WQ5A 3ZT5A 1VFUA 2XVNA 1GVYA 2EQDA 1X6LA 2WMHA 4E8CA 1OBAA 4AD0A 1KGWA 1KCKA 3N9KA 2A3AA 3T08A 1GUVA 2OLHA 1UWSA 2WMIA 2DDXA 1UR4A 2XUCA 3AJ7A 5A6BA 3PN8A 3DYOA 1DWAM 2E3ZA 4JZ5A 1SYTA 1PAMA 4MB1A 1R86A 3WDJA 3CUHA 1JD9A 2Y4SA 1WDRA 2QMKA 1BTCA 4C7GA 3EBVA 4M1RA 2EO7A 4GQQA 2DT0A 3GDBA 1EXPA 4GKLA 1ZU8A 2C0HA 2W91A 4L4PA 4JFVA 4HA4A 1U30A 3WNOA 2OSWA 1VJSA 2CERA 2OYMA 1QW9A 1BLIA 3BAYA 4OBRA 4WK9A 1OD0A 4P8XA 2J25A 3ARXA 3ALGA 4KWUA 1QVBA 1SMDA 2EEXA 3F4VA 1NH6A 4TTGA 2AMGA 1KGXA 1HJUA 4CD8A 2ZICA 3IJ9A 2HISA 5DT5A 2J79A 4GINA 2D20A 5BRQA 2ZUUA 3AIUA 4W85A 1IV8A 3SUTA 2ZXBA 5A6MA 2GDVA 1E6NA 1UH4A 3BAWA 3M6DA 1V3LA 4P7NA 4HZ7A 1UKOA 1XSJA 1B30A 3TA9A 3MU7A 4KH2A 4RE3A 2WXDM 1SMAA 2DEPA 2DT1A 4KRTA 3MUIA 2F8QA 4U2ZA 4TX8A 1UWUA 2OWWA 3BLKA 2VUYA 3F5JA 2Z1KA 5DEZA 1U33A 2CKSA 3AIEA 2XM2A 3HN3A 1V0MA 4ZE4A 4KGJA 1CLVA 4F9JA 4LYRA 1V6YA 4U33A 3WUBA 1FH8A 1EQPA 2WMJA 2BFGA 2W66A 1O6IA 4MPKA 2CCRA 2D1ZA 4IM4A 1HJVA 2GK1B 1K9FA 2Z1SA 5A2BA 5I6SA 1BVNP 5HPOA 4R27A 1WZAA 1CWYA 1S46A 2XIIA 5LYRA 5CGMA 3TONA 2J7DA 3PTMA 4HPHA 3W26A 3WF2A 1MFVA 3KEHA 1TA3A 3BCFA 1KBBA 2FGZA 3GNRA 3LMYA 1WZKA 2PBOA 5HNNA 1F4HA 3WQ8A 4GZIA 2V3EA 1KR1A 3ZO9A 3PZ9A 3PHAA 4BQ3A 3MSDA 2YA0A 2XVPA 2W92A 3ZJKA 3VM5A 4YHEA 4AIEA 4ATLA 5AC4A 4ZXLA 1JXKA 1XC6A 1HKJA 1J10A 3WH8A 4PYSA 1FFRA 3SUVA 3DECA 2XIBA 4D6FA 3M46A 1K9DA 1B2YA 1BQCA 1EOKA 5JBDA 2V3DA 2ZUWA 2J62A 1M53A 4MDPA 2CESA 3MO4A 4BZYA 1M03A 1QW8A 1UUQA 1ZS2A 4PTXA 3VMNA 2E4TA 1UQZA 3B8SA 4CGTA 1BHGA 1W9PA 1JYNA 2PC8A 4LX4A 1E6PA 1WAWA 2JE8A 1HP5A 3K1DA 4OJYA 2WBGA 4EE9A 2W67A 4CVWA 1GW1A 2W62A 1JFHA 5E6ZA 1W32A 3ZSTA 1LF1A 2W63A 3EDEA 1N82A 2X1IA 1PJ9A 3UERA 1FOBA 1HKIA 1JD7A 2O9TA 3OA5A 3W81A 5CGTA 2VNCA 4PMYA 1CDGA 1ZB5A 2J7CA 5BROA 4W84A 3ARWA 1XRVA 3D5HA 3RO8A 3N13A 4B3LA 2QPUA 3AQUA 3B9DA 1D7FA 4N42A 3G6LA 4UQDA 2J7GA 2WVTA 5DO8A 2DSWA 1J11A 2O9PA 2BHZA 3KZSA 1CXFA 4F9DA 3VILA 1GOKA 3WMCA 1XYZA 2CYGA 3OLGA 4WLCA 4HOXA 4CU8A 1UWQA 3T09A 4DWSC 1MYRA 2ZX8A 1XSKA 1H0IA 1QHPA 3ZJ7A 3VUPA 3N15A 1TE1A 2GK1A 5FKYA 3POHA 4WJXA 5CSYA 4F8XA 3LPGA 1JYXA 2ZUSA 3WMBA 4L4OA 1EO5A 1UKQA 3CLWA 2VX5A 5IHSA 1V02E 4PMZA 2VCAA 1XH1A 3W25A 1UYQA 4NSBA 3SCOA 3BLPX 3A47A 4TVCA 1GCYA 4R5EA 4H7VA 2WM0A 2PBGA 2X8RA 4DM2A 4U2YA 3CUFA 4AZCA 2FHBA 3CUGA 1LWHA 4N0RA 3U57A 3ZJ6A 1TVPA 3VNYA 1OIMA 1MQPA 4WF7A 5I77A 2DPEA 4TVDA 2V5DA 3VGGA 4AYSA 1BGAA 1TG7A 3WF1A 4E4PA 2GJRA 2WVUA 1Z32X 1UKTA 7CGTA 2VL4A 4UFLA 3KL5A 5HBFA 4KMQA 1JZ7A 1Q6FA 4BQ4A 1KXQA 5I79A 3KE0A 1DWFM 3QOKA 4U3AA 2EJ1A 3ARVA 3VKKA 1PPIA 2YDRA 1FH9A 2VMFA 3WDQA 1KWGA 1IZKA 1ZBWA 4XV0A 4P7QA 4D6CA 4MAZA 5E6YA 3WH5A 3AOFA 3VOCA 2E9MA 5C8BB 1GVIA 5JBEA 1VFFA 4UQCA 2WLZA 4JHOA 1NWTA 3ECQA 1V3KA 4U3CA 5AYIA 2NT1A 3N11A 4UR9A 2VX7A 4J3WA 4GPNA 3MSGA 3VMPA 3W82A 4UFIA 3I3EA 1Q4NX 3VMOA 5LA1A 2J74A 1HL9A 2JIWA 4ZE5A 3IAPA 3WL1A 3OBAA 1VEMA 2IXVA 3CPUA 1CBGA 5BCAA 3MUAA 1WNOA 3KL0A 1VF8A 4PTVA 3VVGA 4CVUA 2XVGA 1HP4A 1BYBA 3WD4A 1UR9A 2YBTA 1V3MA 4JKMA 4U31A 5GNXA 5BXPA 2CIPA 4DWSA 3VX1A 3WEZA 3ARYA 4XZBA 2VI0A 2WZIA 4M24A 4PTWA 4BF7A 3WNMA 2AOSA 4YPJA 2WKGA 2WVVA 4FMVA 3GH5A 3WL0A 1CXIA 5A8NA 3LPOA 4A3YA 2Q8XA 3VGBA 1PZ3A 2QF8A 4U5IA 4JCLA 4D1IA 5I23A 3GM8A 2WANA 1UD5A 1ISWA 1GOOA 1JZ4A 2JEPA 3CZEA 1VBUA 5A6KA 1TMQA 4MNJA 5ABFA 2ESCA 4V27A 4W93A 3J7HA 3MV11 1G01A 1V03A 3WF3A 4PMVA 3M07A 1E4LA 4Z2HA 2VZTA 4BS0A 1GJUA 3WQWA 1TFVA 3AXIA 2E8ZA 3L4YA 2VQUA 4C7FA 3VIIA 1C8XA 1CXLA 5CQ1A 4HU0A 4UQBA 1UHVA 2YL9A 1DWJM 1VJZA 5FL1A 1E5NA 4ZENA 3WDHA 2OSXA 3PZOA 2E8YA 4ZEPA 3AROA 1CGWA 5EFDA 3A4WA 1XH0A 5D4YA 3ZJ8A 3PZTA 1E43A 2DT3A 3BCDA 1OT2A 3UR8A 3W24A 1US3A 4WSKA 2QMJA 4QDMA 1GQIA 1E15A 3FY1A 3O2LA 2F2HA 2VURA 4UQAA 1CIUA 5DMYA 1WZMA 1JGIA 3AISA 2WMFA 3DHPA 1R7AA 1LL7A 3RILA 3SUWA 1ITXA 1LWJA 1RH9A 3VIGA 3TTQA 1UR0A 1R7OA 2A3CA 2J77A 2ZUVA 2TAAA 2DSUA 4FLQA 3VGDA 3T0AA 3BC9A 3T0BA 1UWIA 4H04A 4J3XA 3WF4A 4P7OA 5E70A 3VU2A 1QNOA 2FDMA 5IHRA 2ZWYA 3BAJA 3MANA 3RPMA 1KWKA 1GQKA 2ZX6A 4UCFA 5A6JA 5CZKA 3G6MA 3CGTA 4MJ2A 2RGMA 1UZ1A 3KWXA 1NOWA 4HZ6A 4P8UA 4AWEA 2XTKA 3AHZA 4AD2A 3N18A 1K9TA 3WUEA 3NIYA 3CUIA 2WVSA 2YA1A 5C71A 4DUVA 2JALA 5CPTA 4W7UA 2YL6A 1B0IA 1HXJA 2VCCA 5A6LA 2X05A 1AQHA 1E4MM 4BQ5A 4AY1A 1XD1A 5HOSA 3IJ7A 4W7VA 4P8VA 3W28A 3ZT7A 2A3EA 3AIVA 5KZ6A 1TA3B 4F66A 3VD9A 5D9MA 1VAHA 4PCSA 4AZIA 2O9OA 1HN1A 3VGFA 1EQCA 4H8VA 1H4PA 2XVKA 3ZIZA 3VDBA 4DWSB 1W1VA 3D3AA 4AIOA 2GJXB 4UZUA 3K4DA 2WMIB 1OGBA 1JXJA 5ABGA 4CU7A 4PMUA 1E6SM 4HA3A 1NWSA 1KCLA 5A6AA 1V6VA 1ITCA 3ARTA 2ZE0A 1KQZA 3GXFA 4JAWA 2YJQA 3CHEA 1M04A 2WC3A 1PBGA 2ZIDA 3EMQA 1LG1A 3SUSA 3AYRA 4DM1A 2VTFA 1W3JA 4FLOA 2EPLX 1M01A 3S6TA 1E6RA 1H41A 3CZKA 2OYKA 3ARQA 1HKKA 1WP6A 4IPLA 1XYFA 1OD8A 3GH4A 1C8QA 1Q6EA 3FAXA 2J7HA 5JUVA 4OBSA 1C91A 1C7TA 2WW5A 1CGVA 5GNZA 3K8MA 4URIA 1ZL1A 2AAAA 3W6MA 5AC5A 4CN4A 3SCQA 5A2AA 1VB9A 1UWTA 4PSRA 1UQYA 1DEDA 1C90A 3VIJA 4IPNB 6A3HA 4AZ6A 2QLYA 1JFXA 3U5YA 1X1NA 2VJXA 3HJEA 2XYLA 5HDRA 2XWEA 1EDTA 2C8NA 4PBGA 2ZUNA 3EDKA 1NWUA 4CD4A 3WDIA 1JDDA 2WZHA 2YA2A 4W8AA 1CEOA 4LQ1A 4WKAA 1EHAA 2PI6A 5CG0A 4AD5A 2XWDA 4GZEA 2WLYA 3GNPA 3L4TA 1CGYA 3VDCA 2D3NA 2IUZA 4YN5A 3AMKA 3NJ3A 5CPSA 1E4IA 4OOZA 3SCRA 1H2JA 3E1F1 3UETA 5ECUA 3OB8A 3AI0A 1NP0A 2BY2A 3T0DA 2WCSA 3O6AA 1D3CA 3HMCA 2WYSA 1J18A 1MFUA 2W4XA 4GI9A 2V3GA 1HJQA 1WO2A 1J0JA 4OIFA 3FXYA 3ZR5A 5JIPA 2VX4A 1KBKA 2QV4A 1KR0A 1FA2A 4QLJA 2DSVA 1TCMA 3UG4A 4CKQA 3WDRA 1BYCA 1DTUA 2WSKA 4PTMA 1FP9A 3ALFA 3AHXA 3MMUA 4P7RA 1ISZA 3PZIA 3AXHA 1L8NA 2GVYA 2O9RA 2WWDA 4PMOA 1E55A 1QOXA 4WIWA 1JIBA 3NSMA 4OUEA 5E09A 1XCWA 4RE2A 3ZM8A 1E6XM 1PZ2A 2D2OA 2W61A 2J7EA 4Z2IA 4XZWA 3K8KA 1E71M 3PZUA 4S3JA 4D6HA 5CXPA 8CGTA 1W1YA 2CBVA 3N04A 1BVZA 2FH8A 1GONA
chains in the Genus database with same CATH superfamily
1GKPA 1E0UA 4YVPA 1Q63A 1UZDA 4MKSA 3MP3A 2L5HA 1ADOA 2G4FA 3TN4A 5FL0A 5JMUA 3VIMA 3NDOA 1HW6A 1E40A 4LWWA 4AEEA 1TPC1 4NAEA 3WFLA 3W1QA 5IDIA 2OQHA 4K3ZA 3AWNA 4DJFC 5I3DA 4NZJA 3TYDA 4FLRA 4JFWA 1C93A 4IMAA 3Q65A 3QC0A 1UPMB 2ZZ3A 4UFHA 5DRIA 4AMAA 1XSIA 4L5ZA 2QR6A 1VH7A 4YHGA 1A5LC 5I2UA 1F5ZA 2P3ZA 3SCWA 1TJRA 1O1ZA 4H2CA 2KZHA 3QV7A 4M56A 5M03A 5A95A 3GVVA 4NILA 2YXGA 1W2VA 1JZ8A 1KFJA 2ZX7A 1F6PA 4IMCA 1R3QA 4XZMX 5EFFA 3W2JA 3GVRA 3CXOA 2JF7A 3LPFA 4TTUA 2WMGA 5HWJA 1NELA 2DZPA 4UTHA 3A6OA 1H7NA 4O4VA 3ZMRA 1QR7A 1EDQA 2CZFA 4D6IA 3ATZA 3P5YA 3ZR6A 4HN4A 4DJDD 1NJJA 4G7EA 1VENA 2J4GA 4A3HA 3U2EA 4CCZA 3DYPA 4ACZA 3M1ZA 2YDSA 3IIOA 5FF7A 3GZAA 4H9UA 4AZCB 2D0GA 4O54A 1EC9A 3VZYA 2BOFX 3M4HA 4FSAA 3N2BA 2BMBA 3ZWTA 3TR9A 2GGEA 3W7CA 5HJXA 3LXCA 4V1XA 2G97A 2OEMA 5CZ0A 2H9AA 4CQDA 2VC6A 4PMDA 4M1BA 3EMCA 1ADSA 3THCA 4C6MA 2Y70A 3G24A 2DGAA 3BJFA 3HOJA 5LA0A 2GVGA 2GJLA 3AMCA 3TYEA 2J8TA 3AYSA 3L2IA 4KF1A 3NL6A 3OZPA 3HV9A 5DCDA 2POZA 2QV5A 4X61A 5CAKA 2I9EA 5DBUA 4AZGA 1OQFA 4C91A 4B9ZA 3GXNA 2PWDA 4L65A 3HO8A 2HVOA 3TR2A 1DPMA 4YXGA 3AS2A 3S5YA 4J28A 2DZXA 1X7FA 3GUWA 4XO7A 1H09A 2JEQA 1OB0A 3QN3A 1XBVA 2CZVA 5EMLA 3TDFA 3WFZA 1V3IA 1PDYA 3VFLA 2AMXA 2VVSA 3OGVA 4FF5A 4B3KA 4IFOA 1ICSA 5JXQA 2CBUA 2NUYA 4IUGA 2A1YA 4JS3A 3PB0A 1A3WA 3FEQA 1HX0A 3MZNA 3N9RA 3LI0A 3EOLA 3C3NA 3EEGA 1IEIA 5CLTA 2UWFA 3P82A 2EXOA 3W71A 4NF7A 3UG3A 2WKLA 2WSYA 3NQGA 4XTDA 1YTKA 2FYMA 3THDA 5FF4A 5EB8A 5MHBA 1UJPA 3SJ3A 2PDYA 4GUIA 1WXZA 3F5KA 3QLDA 4B9YA 1TQJA 3PPHA 1KFWA 1TPVA 1EJUC 1U1HA 4I8YA 4G9PA 4XSLA 4JOMA 3VIKA 1I8JA 3MS8A 3OLEA 1I60A 3P0XA 4ADTA 3DG6A 3UEQA 2YCLB 1YDYA 4ZFMA 3BAXA 6PTDA 4ZQMA 1NAL1 4FXRA 2J78A 1I6NA 2VEPA 1J6OA 2BOEX 2R1MA 3G1SA 3ITTA 4A8NA 2EG8A 3UVIA 4QAIA 5CKSA 4C1LA 2V82A 1Y5VA 3R0UA 5ABFB 3AS3A 1QWKA 4DO5A 4O1CA 3ITGA 4FXSA 3IPWA 4UC5A 2OWXA 3WH9A 1WKDA 1UD8A 1GJWA 3AIWA 1YMYA 3UD6A 5A8OA 1W1TA 4Y9PA 1M65A 2Z00A 2R9RA 4V33A 2WWCA 2JKPA 1ISVA 4QGCA 2UV8G 3W7GA 3RLGA 4RZ4A 5FA5A 3TROA 3MI2A 4UQEA 1OFOA 1JQXA 3SSJA 3BMWA 2FMNA 4O14A 3NFUA 4N4QA 2F38A 2ODOA 1JCXA 1YHTA 3U48A 3H2CA 4PCTA 4AIBA 3VOJA 2OX1A 1WZLA 2UY4A 3WZ0E 4RK8A 3VNIA 1Q6GA 2O92A 1DL3A 4X22A 3ANYA 2DJLA 5U7SA 5T9CE 1I0DA 1ZENA 2BXYA 4NNCA 3UPMA 1GYNA 3A3WA 1GKRA 3PTDA 3OGRA 3W83A 1TV5A 1XM3A 3TIMA 3BMXA 3L12A 3V75A 2D22A 3M0YA 4O0KA 3AHVA 1DQUA 1W3HA 3MJMA 3LSCA 3PG8A 8XIAA 4C65A 4BA0A 5DFAA 4YTRA 2OT0A 1LOSA 3R43A 4XBJA 4IIBA 1N7KA 1ZY9A 2GJXA 4AISA 3AHTA 5EKYA 3O63A 3B8IA 1ZBVA 2F61A 1TJ2A 1ZBCA 3T2PA 2VT0A 3M0KA 2VR4A 4ZB5A 3M64A 1OSEA 4ZCWA 1W9XA 3QPEA 5BXRA 3U7BA 1XLEA 2V38A 1LYXA 5F4SA 2C1IA 3LCLA 3O1NA 3K13A 4I7WA 3VD3A 2BX7A 4S3KA 3F5LA 1W1IE 2WNZA 3N9SA 3QPYA 4H00A 3L4ZA 4OV9A 1XYCA 4YCOA 2Y8KA 3MBFA 1S1RA 1AMYA 3DHFA 1I1XA 2WB5A 2BY1A 1X97A 3H26A 5AYXA 3QKZA 5DF0A 4AZ7A 3T2OA 5K9CA 1SZNA 3GR7A 3NGJA 4X3ZA 3ONCA 2UBPC 4PMJA 1LBFA 2ZZ4A 2HNEA 2G3IA 2YXXA 2PFHA 3Q58A 2ZTJA 4ATWA 5LGXA 2D3LA 3SB0A 1BKHA 2YDQA 3G77A 4FHAA 2BXVA 4XIMA 2J8GA 1PX8A 3ABSA 2NVDA 3H2AA 1GHRA 4DNHA 1CCWB 4GZ7A 2BG5A 4Q4OA 3HGJA 5FJRA 1UG6A 2TPSA 1XGZA 2ON3A 4IF2A 1XW8A 4HNNA 2BHYA 3QMSA 4XX6A 4C6CA 3W1PA 4FNQA 3CWHA 3SIMA 4ACZB 2XIJA 3W07A 3M0VA 4TX9A 1GOQA 3K46A 2QJIA 2O55A 2WHKA 3GVQA 3ID7A 1BXCA 3PWAA 3PM6A 3WY1A 2G3MA 2CITA 2FQIA 2PLMA 4ZBCA 4WXYA 1EFZA 1SM9A 1W9UA 1SFLA 2GOKA 4HMNA 3IS4A 1C7SA 3P62A 4QLLA 2XG9A 3FAWA 3B8DA 1SR0A 4IPJA 1X38A 1LJYA 5CPQA 3GH7A 1SW0A 1ZAIA 3MMTA 2GJPA 2NVCA 2VGFA 5FF0A 4F0KA 5BWFA 4JYEA 3VKCA 1WKYA 4G6CA 5I3JA 3GXPA 1PEZA 2WBKA 4WOQA 3E12A 3UR5A 3PPCA 2ZXQA 2PS2A 2F2KA 3GU1A 4JYFA 4QJ3B 1KM5A 3DCPA 3LMZA 4S23A 4QS5A 4MG4A 7ODCA 2VFHA 4L61A 3VOFA 3WKZA 3A5VA 3B0YA 1P7TA 1KFBA 4BI5A 1VEPA 3M7SA 1CYGA 1QT1A 2O0TA 2J7FA 3E02A 2RKXA 4HCHA 3W2LA 4XD3A 5CAHA 4S38A 4BKNA 1TMHA 2VGBA 2J7BA 3LHYA 4ASTA 3GXDA 4L7ZA 3V7PA 2VVNA 3BLOA 5BWAA 3EYPA 4H41A 3P61A 3OLDA 2GFTA 5D9PA 4GNVA 3UG5A 2WZMA 5TD4A 1EUAA 2ALDA 2FGLA 3EB3A 1JF5A 4UQ9A 4MNMA 3ITXA 1B3WA 3BSHA 4LRSA 5KZMA 3VIFA 1T40A 4YU1A 4ZQRA 4Y9MA 1SQ7A 1T7LA 4XB3A 1F3XA 2HWGA 5EMYA 2IPJA 3RCYA 4RR4A 7A3HA 3UNDA 4MB3A 3W2NA 1Z48A 1HKMA 1PX4A 3I4KA 3MV01 3EX4A 3K1GA 4WY0B 1TZ9A 4WKFA 3U7VA 3KRBA 3LRMA 2VDIA 3S2LA 3STEA 2Y24A 1XLCA 3VDHA 1NQ6A 4H8UA 4TX6A 1BG9A 2A85A 3C8FA 4D6JA 4CQ8A 2D2HA 3W2MA 4P8WA 1J0IA 2YPIA 3URBA 2ZRVA 2ZVIA 4W8BA 4WDUA 4GA8A 2CHOA 4L4MA 2HS8A 3NSNA 4LYPA 4DUWA 2VZOA 4H4IA 4M0XA 4HTBA 4R7JA 2G96A 1V3HA 4IGSA 3OODA 3B9EA 3L4VA 3BDKA 5GNYA 5FEXA 3IIZA 4NJJA 1Z44A 3UYCA 1Q6QA 3MZ2A 2FPVA 4PMNA 5D9NA 5HAOA 2XZ9A 1G9HA 3VC5A 3AMLA 3VD7A 2C3ZA 1RA0A 2PU0A 3WMSA 3L23A 4PTDA 4PUJA 4E3TA 2CKRA 5AHIA 2REQB 1FWGC 1VIWA 4ZQOA 2BOGX 4M8UA 1I1WA 3A23A 4I9TA 2CLLA 2FVKA 4X0VA 2YSWA 5LIYX 1PTDA 5D8WA 1V51A 1JNEA 3QHNA 4HTYA 5A69A 2ZUTA 1B57A 1CECA 3UXKA 1FDYA 3H4GA 1A50A 1KB3A 4CN6A 1TTJA 1MW0A 2PDFA 2YOCA 2F84A 4RV8A 3S4TA 4DI8A 4S3AA 3D47A 4ZSUA 2V3FA 4IIHA 4PL1A 3QHOA 3UZXA 3DEQA 1R87A 3ARRA 1Q7MA 5I09A 1KCXA 4D2JA 1N55A 4IG2B 4DX3A 5E0CA 1UMLA 2WNNA 4JR5A 1QFEA 1MMFA 2YLAA 3NNTA 5D05A 1CGTA 2PMQA 4I5RA 3W7EA 4M6QA 3FN9A 3OG2A 4HZMA 4TIMA 3FXGA 4NUWA 4EXQA 5C2CA 1XCFA 3DN5A 3STFA 4QJ1A 3KVMA 2VC9A 3WYZA 3LCFA 4L4LA 2IXUA 4BEQA 3R11A 2IKHA 2WHMA 1K7XA 4JY9A 1FUYA 3TC3A 3G0SA 5AZ0A 4H19A 1DJYA 3V0UA 4HVXA 2HXUA 1RD5A 3MSYA 3CAVA 5HJLA 5HQEA 5BRPA 3NM3A 1LQ0A 3EPMA 2FFCA 3A9IA 2PZNA 3MJYA 1SFTA 3V5CA 5BW6A 3ZLGA 1Y65A 1JPHA 4JN6A 5D2XA 2ZADA 1UIPA 3GDMA 3LCHA 4QNEA 5I02A 3HFYA 4AZ5A 4UZSA 5CGQA 3VFCA 2BZNA 3UGRA 4QXIA 4JTKA 4P61A 5FF3A 1DTNA 2EPMX 5I07A 1B3ZA 2GGGA 4GY0A 4FLSA 1ALDA 3W7MA 3HU7A 3LGDA 3MB9A 5TQLA 4FK9A 2OODA 5HANA 2VOTA 3WQ5A 1S38A 1I4NA 1VFUA 1XFBA 3QW3A 4JTDA 4O1FA 3GW3A 3D46A 2NLYA 2FTWA 2Y7GA 1WXJA 4AD0A 1KCKA 5MF5A 1TUFA 5LKYA 2OLHA 3BZJA 1UWSA 2WMIA 3H55A 1AW2A 3PUOA 1P7TB 2DDXA 5JU6A 4JTSA 4B4FA 2EPHA 3FVDA 3PN8A 3ZYZA 4JY8A 1DIKA 2E3ZA 3PUEA 3HURA 4GNKB 5A5WA 1NU5A 3WDJA 2P0OA 2Y4SA 1WDRA 3EX3A 3EBVA 4M1RA 3BLEA 2DT0A 1EXPA 4FIQA 2C0HA 2W91A 3QYSA 2BASA 4Q4KA 1DIOA 4HA4A 4A3RA 3IGXA 1P6CA 1RZMA 4PH6A 2CERA 1BLIA 3BAYA 4OBRA 4WK9A 3LENA 4P8XA 4PFMA 1AW1A 2P50A 4OHQA 1JCYA 4KWUA 1WBJA 1QVBA 4NZ3A 2OU4A 3F4VA 3PAOA 2GWGA 2GSEA 3A22A 3VA8A 5FACA 3CNYA 1HJUA 1I2RA 2ZICA 2ACSA 4CLMA 2DW7A 4NHVA 3AIUA 3P8IA 1OZMA 1P43A 2GDVA 4JTLA 3BAWA 2XFWA 1TKKA 1V3LA 4HZ7A 4LALA 1XSJA 5EMKA 3EWZA 2WXDM 2JBMA 4ROPA 4R88A 1XLMA 2F8QA 3NQVA 2BSLA 1KBLA 2HBVA 4U2ZA 2PUZA 3TX9A 4XKYA 4XVDA 2CKSA 1EL3A 3UGVA 1G7UA 4PCNA 2CHRA 4UTTA 4ZE4A 1CLVA 1O5KA 2DZTA 1YYAA 3GVWA 3LZ3A 1EQPA 4MYAA 1VJIA 3SM0A 1A0DA 4UCGA 1FQ0A 2WPBA 3CL7A 1LRNA 2HV5A 3T8QA 2DORA 4AWUA 3G2GA 3QJAA 4JIPA 3SSZA 3H2EA 4NYUA 3GNRA 2PBOA 3TQKA 4GZIA 2Z2AA 3PHAA 3Q37A 4O18A 3VM5A 1VFLA 4XKMA 4QQ3A 4S3CA 4YHEA 4UMCA 3HM7A 1YDNA 2XH2A 4WY0A 3UWEA 3MHGA 3ENLA 2QXWA 2XIBA 4D6FA 4XISA 1IIHA 1K9DA 1B2YA 3UA3A 4GQ0A 2J62A 4LF1A 2CESA 3UG8A 1DE6A 1QW8A 1BEUA 1UUQA 4XO6A 4PTXA 4IPPA 3WLQA 1MEHA 3B8SA 1T96A 3LCGA 1W9PA 1JYNA 1G67A 2CC0A 2JE8A 2KAUC 5A6TC 5F2IA 2RJGA 2XIOA 2W67A 1Z9AA 4LUTB 5E6ZA 2XINA 1L2QA 3ZSTA 1N82A 1LM1A 2GVJA 4LW7A 3JRKA 3W00A 4DJDC 1FOBA 4N9BA 4ZO6A 3DDMA 4HPNA 4WDXA 2O9TA 3OA5A 1OX6A 4ZQPA 3KBJA 1HKWA 4C6BA 4PMYA 2VDGA 5BRBA 1EWDA 1FKXA 3LTYA 3AQUA 3B9DA 3B0XA 3IUHA 3ME3A 4UQDA 2WVTA 3HMJG 2R14A 3S8HA 1J11A 3BTNA 1SZRA 4ZB0A 1GOKA 1XYZA 2G50A 3OLGA 3E6EA 4PUNA 4WLCA 4HOXA 4CU8A 3T09A 3U2CA 4BR1A 3ZJ7A 3POHA 4F8XA 4Q4MA 5CSYA 1TJ1A 4V1YA 3WMBA 4L4OA 1EO5A 1UKQA 5IHSA 2V2HA 2VCAA 3FX4A 5H8PA 3QTPA 3SCOA 2PDKA 4TVCA 4Y9NA 1K7FA 4Q8TA 2GZXA 3C0JA 1RJPA 1SO4A 4H7VA 3PJXA 4DM2A 1FWTA 4U2YA 3CUFA 4AZCA 1RJRA 2E1WA 1TVPA 3VNYA 1OIMA 3S2JA 2B7OA 1QK2A 2X16A 1F6YA 1SFJA 4WF7A 2W79A 4TVDA 1WV2A 2EKGA 1U83A 4L80A 1UKTA 3C56A 3TV8A 3P67A 4FZIA 3R12A 1QCWA 1W5NA 3KL5A 4E4UA 5HBFA 4HPJA 1X7IA 5I79A 3PULA 3KE0A 3QOKA 4U3AA 4XVEA 3SBFA 3VKKA 1KCZA 5F4XA 2YDRA 2GGHA 3KX6A 4AF0B 2FB3A 3AU2A 1ZBWA 3IJDA 2G95A 4MAZA 3FIGA 3AOFA 3U9IA 3CMFA 2CZ5A 1GVIA 1FBAA 1VFFA 3OZMA 2WLZA 2FZDA 2PTXA 3N11A 1REQA 4UR9A 5AC6A 1TV8A 1TPB1 3IJ6A 1IT7A 3MSGA 3I3EA 1YXDA 4X2RA 4HKPA 1YLVA 2QUMA 3NZPA 4R34A 2IXVA 5AVHA 4L6DA 5BCAA 2GJNA 4WJ8A 3VVGA 1HP4A 2QCLA 3WD4A 4JKMA 3NAVA 4U31A 3LI1A 1TMLA 2YGYA 4W9TA 2IKGA 4PFHA 5K3VA 4MY1A 4LVGA 4M7SA 3LPOA 4U5IA 2QF8A 4CEUC 3NYZA 5CC3A 1JZ4A 4AVNA 3C8NA 5BU6A 3BG3A 1KM6A 4AY7A 4W93A 3QSRA 4LEQA 5FEZA 1ZJHA 4JBRA 1G01A 1F3EA 4Z2HA 3WFAA 4BS0A 1PWMA 1SGJA 1A0EA 2X40A 4GGHA 2VQUA 1VFSA 2HDJA 4OECA 2ZRZA 3KVKA 5IBXC 3G0UA 3W7QA 1C8VA 2PGWA 3JW7A 3M44A 1VQTA 3TE9A 4DELA 3ZWSA 3PZOA 3OYZA 1IHIA 3LV6A 1CGWA 4J1OA 5D4YA 1NQKA 3JVAA 3GTHA 3ABZA 1Q8AA 3DC8A 1ONXA 1MRQA 1GQIA 1E15A 3SQMA 5G4HC 5HMDA 4LS2A 4UQAA 1CIUA 2VENA 1XGDA 4Q8MA 1XX1A 1UB3A 1UP3A 1ITXA 1LWJA 3IACA 4GYPA 3TTQA 3S1UA 5C54A 3GU2A 2TAAA 1KM3A 5C2GA 3T0AA 4KIRA 1UWIA 4O12A 4P7OA 1L6GA 4YS1A 5TIMA 3TNOA 3VU2A 5IHRA 3BAJA 3SQSA 1XISA 1FX6A 1JDEA 1KRAC 5CZKA 3FJ6A 4AAJA 1ZP3A 2NQ9A 1NOWA 2BDQA 4HZ6A 4P8UA 2CLIA 4RNJA 1F05A 1OFAA 3EPNA 4R9OA 2PA6A 3KS6A 2YBVA 1B0IA 2HE5A 2C1HA 2VCCA 3GKAA 5A6LA 5HOSA 4W7VA 1P6BA 3W28A 5ENLA 1F2JA 1W5MA 5KZ6A 3R8HA 3VD9A 1XIGA 4F2UA 1RVKA 4US5D 4DBEA 3CYVA 4XZHA 3QC3A 1V79A 4RZ5A 3WK2A 3GFXA 4UWMA 3PUGA 2DZUA 4KT2A 3VDBA 2FZBA 5MKGA 2PDPA 3VNJA 4DWSB 3D3AA 3KBMA 4PBFA 4DPPA 4MY8A 2QJGA 3V16A 1XIEA 1GVRA 3TFCA 5TNVA 1E6SM 2G37A 5A6AA 1KRCC 3LM3A 4Q8NA 1KQZA 1M04A 1IWPA 5AC8A 1TIMA 1PBGA 1RHCA 3QFWA 4O52A 2QAFA 4G5DA 4DM1A 4OFCA 4Q4PA 1MUWA 1HKKA 3SIZA 4RDYA 4ERIA 2V5LA 4KRZA 1BKSA 1XQKA 1VBHA 3W6MA 3LEPA 3XINA 3RHGA 5D38A 4PSRA 3ES7A 1OY0A 4FALA 1C90A 4KFOA 4F0RA 2HNHA 1H1ZA 1XR2A 3HJEA 2XYLA 4AYGA 3S2NA 3TYCA 2C8NA 2ZUNA 1NWUA 1JDDA 4Y6GA 4ZO9A 3IUIA 4W8AA 4LQ1A 1W5OA 3I65A 4KPLA 4GUHA 2PI6A 3RCMA 4PCFA 1VC4A 4HNUA 1ZP4A 2GLKA 4I8DA 2WLYA 4ZSTA 3CB3A 1NFPA 2QGYA 2D3NA 4YN5A 4WHBA 1DJNA 3AMKA 5CPSA 4J4KA 3UETA 3OB8A 1NP0A 3HMCA 3A24A 2WYSA 1IXPA 4OIFA 4A29A 1FA2A 3URNA 3NQ8A 3UG4A 3WDRA 1BYCA 2XSXA 4RX0A 3GHTA 3MBDA 3F2DA 2W3ZA 2DUXA 4RPQA 3OVRA 3MMUA 2I5GA 1O95A 4R33A 2PLJA 1WBHA 2GVYA 4AVOA 4PMOA 4C6NA 1GWJA 1JIBA 4OUEA 1K8ZA 1MXSA 2OOGA 1P1MA 3BUVA 1E6XM 1KRMA 1XS2A 1TV3A 3K8KA 1E71M 3PZUA 3REQB 1XIMA 2IMRA 3WK0A 3RUBL 5TF0A 2CBVA 5FEPA 3C2RA 2V9DA 1MO0A 2FKPA 1A5CA 2E5DA 2BNJA 1KBIA 1EJRC 4N2YA 3GDLA 4REQA 1WCGA 3PFMA 3L68A 3T78A 4Y96A 3E5BA 2JFEX 5FJOA 4V15A 3P7YA 4X63A 4MSSA 1QI4A 4IT1A 5HNTA 2WHJA 1LWIA 4KFPA 3AIBA 3GVGA 4PUEA 1FVPA 1UA7A 3W6LA 1GZ1A 1SO6A 3WJZA 1KXVA 2R82A 1LL4A 3DU0A 4B15A 4JHZA 4JDBA 1D9EA 1B1YA 2OYLA 4D6GA 2FZ8A 1F74A 1WYIA 2B4GA 4X60A 3FYYA 4G7FA 4H3DA 3CQKA 3APGA 1CLKA 1GT8A 2WK2A 5EY5A 3FW6A 2BXZA 3W1LA 5A8QA 2AQWA 1R85A 3VIOA 4YTSA 3CO4A 4H8NA 3GK0A 4HSHA 1UH2A 4X0NA 3SRDA 1BGGA 3SI9A 2E68A 1UW9A 4LAUA 1A4MA 1QATA 1EF2A 1US2A 2C18A 3WMLA 4PBEA 1NEYA 1R9YA 5FIPA 1KXHA 4B4HA 1AJ2A 3C0LA 4WOZA 1ISYA 3RJYA 1S1PA 4H7ZA 3W0KA 4FXFA 2OX4A 1W9DM 3CH0A 2QVNA 4AD4A 3MKKA 1PV8A 3A3HA 4RXFA 1W54A 1K8XA 5A1AA 3P93A 2E9LA 4GG9A 1TE6A 1EXBA 3VKJA 4D1JA 6XIAA 3N1AA 4GH3A 1EZ2A 3QRHA 3B0VC 5G2WA 2X2GA 2QUVA 4DJDA 1CGXA 4NJIA 2ZUMA 4E2OA 3B03A 3LQGA 3NOEA 3H6OA 2ZXAA 1T8QA 2V5KA 1IIGA 4EWJA 6XIMA 5HXMA 2DZWA 5M17A 5FSDC 2PTDA 3MPGA 4XUYA 1HGYA 1Z6KA 5AYYA 5GJMA 3N29A 1XIIA 3KHDA 4DWSD 3ZLFA 3EEZA 3UCDA 1Z69A 2ZC8A 2PCQA 4F0SA 2GL5A 2ASHA 2CNCA 2PDQA 2OELA 4H9ZA 2E1DA 3ITLA 4HOZA 3WH7A 2BB0A 2PDHA 2NXIA 1M68A 1EYWA 1O12A 2D23A 1DJIA 3PB2A 1UUMA 3NXLA 4X2PA 4HK5A 1JG9A 3RLVA 1TWDA 1OGSA 3NQ7A 4LYQA 4Q7NA 5C7VA 3VK5A 5XINA 4DJFA 3UT0A 1KV8A 2INZA 4X9YA 3VNLA 1J0KA 4W87A 1S5TA 2CLFA 4WGHA 4TOQA 3TTYA 4PN2A 1RP9A 1JJKA 1CGUA 3BICA 9CGTA 3KUMA 1EPXA 2VRJA 1PB0A 1L8PA 2XFRA 5EBAA 4KEMA 3GBEA 4CD5A 1LZOA 2NSOA 3AZRA 3HIJA 4TXEA 5LHEA 3TXZA 3SJNA 4PEEA 3ARPA 3NCOA 3W7LA 4JEJA 2ATSA 4MY9A 2QCEA 1YADA 1XH2A 4MZ1A 3H70A 4GYJA 2WSPA 2EPOA 5G1YA 3C2VA 1EA9C 3PTKA 4S3BA 1WDQA 3CHDA 3MMDA 3ZVIA 1V5XA 1JL8A 4PULA 1MVYA 3A13A 4PUDA 4PRWA 5D30A 1E0WA 3CHCA 3UWUA 1J79A 1E3ZA 4FR6A 4IMDA 4GHRA 2ADAA 4AD3A 3WLOA 4MDOA 3T07A 1EX1A 4J3UA 4FNTA 4K7VA 4DXVA 3C52A 3EWWA 1UP2A 1SW3A 3GNOA 1UA3A 3W7IA 2VFGA 1G1YA 1JUBA 1OFDA 2OT1A 3S5NA 1UR2A 4V2XA 1VFHA 3SZ8A 4O0ZA 5FEWA 2OR2A 3EWBX 3PAJA 3MT1A 3B97A 1A0CA 3R58A 4GIAA 4O28A 4WX2A 4YJ5A 2X41A 3WD1A 3YPIA 4IISA 1XD0A 5HJYA 2XH4A 1V0LA 1VPXA 2PDXA 4MKNA 4YTQA 1XICA 5BNKA 4BI7A 2JGQA 2ABBA 4ZGYA 1Q85A 3FKKA 3CMGA 4IXHA 3RR1A 4CCEA 1EBGA 4C5YA 4M81A 2A79A 9RUBA 4ALDA 3WQVA 1UR8A 3KOXA 4JL1A 4UTLA 2A0NA 4IIDA 3NDYA 3BV4A 2OWCA 5DXXA 3W84A 2UY2A 2AGTA 4ZO8A 3GHUA 2Y0FA 2WCGA 5I24A 1MRAA 3NVTA 3CHVA 5KZEA 4AY8A 3TTSA 1FWWA 5A94A 1V7AA 4EF8A 4KS0A 3T2QA 1B5TA 2DSKA 3TW9A 3PC0A 2I16A 5AHMA 1G6CA 5DLCA 1LRTA 1T99A 2RDWA 4JN7A 1XP3A 3BV7A 2ZRXA 2YL8A 1Q6DA 3WNPA 4BEUA 4Z42C 1E9ZB 1H7RA 3FYPA 3C4UA 1DHKA 3KBVA 4CUCA 3M0MA 1NOUA 3SURA 1BWKA 4FNPA 1QNQA 3SO7A 5I3GA 4NRSA 2YB1A 3IK2A 1MXDA 4KIEA 3U5UA 3RLUA 3EA1A 2EG6A 4AXKA 4GX8A 3GWQA 2GDUA 1PWLA 3F1QA 3QEZA 5AN7A 3MVTA 4WRHA 1BF6A 4FOKA 1VLIA 1AQFA 4E0CA 4RUBA 3WQ6A 4E2VA 1NARA 3GHSA 4JTHA 5DMLA 1U2YA 5EMJA 2A3BA 1RPXA 4KCWA 5I78A 3STPA 3REQA 3SN0A 2PGRA 1DWHM 1M7PA 3OVPA 1EHNA 1TPWA 4R7OA 5CC6A 1GOIA 2FJKA 3GAYA 4GO9A 3I6EA 1TWSA 2VEIA 3BURA 4ZFCA 4A22A 2Y1HA 4LU0A 1OC6A 3SN1A 4FB7A 4LB3A 3NQMA 2J88A 1K6AA 4R7WA 3MCNA 3S6DA 4HMEA 3KBWA 5C9RA 2AQVA 1JI1A 1WE5A 3W37A 1E0VA 2Y62A 2FHFA 3ZXWA 4IX2A 3L67A 3RITA 1KLZA 3QR3A 2FGBA 1H11A 3FV9A 3SY1A 1UPPA 3I3BA 3QW4B 1W17A 4GXPA 1DJHA 1YEYA 4L9YA 2OFJA 4LCRA 1VCGA 3HBLA 3PSWA 2YFOA 3VGHA 3CZJA 3N4FA 5IBXA 1GK8A 5AHLA 1J12A 1MXGA 2XGZA 4EWND 1H0GA 3STCA 1ODUA 1OINA 1XJBA 5EYWA 1C3FA 5CPOA 5IFTA 4X9SA 2QPXA 3EDDA 3S5ZA 2RUSA 1A5OC 3ORWA 1JCLA 4IFRA 4IQDA 3VTRA 3UR7A 3KOZA 3E2SA 2VUNA 2PF0A 3EWYA 2ZKMX 1R5YA 1W9VA 3P3BA 4HU4A 5F1VA 3EPOA 4I3GA 3F4DA 1K7EA 1PXGA 1S3TC 1S5WA 4PUUA 1FFQA 4E3VA 5AZ1A 1R3YA 1XYBA 3EMZA 4UTTC 2IKJA 2C15A 5CC5A 3NWRA 3WNNA 3FA4A 2VEMA 3NSXA 2EPKX 1MQRA 5AKQA 3TYZA 4M3PA 1S39A 3T8LA 1FTXA 1PKLA 4JHMA 1G7VA 4PMXA 1DJXA 3W22A 3NZRA 2GGJA 4F2TA 3QQ0A 1AG1O 4Y9OA 4PCPA 4YYFA 3OZOA 1TZ7A 2VR2A 3M43A 1F76A 2GQ9A 2DVTA 2I14A 2PC4A 1QU4A 2GUYA 3GQYA 1CXKA 4HPXA 3TSDA 3CLMA 5ABTA 2PP0A 3RRAA 3R5EA 3LB0A 2XVLA 1R8LA 2QVHA 3ZQ9A 1W31A 2YLLA 3L4WA 4GXMA 4BQ2A 5D33A 3ZVHB 1YX1A 4QP0A 3WD2A 1V8EA 3MUY1 3W38A 1DV7A 1SFSA 4Z08A 2D0FA 2V5CA 3M5VA 1QI0A 1QI2A 3WBEA 2WKJA 3Q4DA 1E6ZA 2NX3A 5I3HA 5IDZA 3BE7A 5BXTA 3WIJA 1KFKA 4IFKA 5LSMA 3SCUA 2PWUA 3N6HA 4ENLA 1WDSA 3LBOA 4P5UA 1JYWA 3VOIA 2NV2A 3RAOA 3W6YA 1QPKA 3L5MA 3IVTA 5CLWA 3UBPC 1HVXA 3D0CA 4Z2LA 1ITQA 3KOFA 3AAMA 3NPUA 1BFNA 2OZTA 1R3TA 2X1TA 1VKFA 1O7AA 3LNMA 2V63A 4AXNA 3K2GA 3SFKA 3NYDA 1AH4A 1MWOA 1OCJA 5E9AA 3E5PA 4KWOA 1K02A 1QAPA 4MVAA 5AVNA 1ZLPA 3SR7A 3JU2A 3BJSA 3BAIA 4JNYA 1ICPA 3S46A 4HA1A 3UVAA 2Z27A 4N6EA 3MDUA 2NQ5A 1EJ7L 1R3SA 1F8MA 1JZ3A 1MQQA 4B90A 5LIUX 1FWHC 3GSMA 1OFBA 2V8ZA 3F4NA 4KWVA 1AH3A 1AVAA 3LERA 2VD9A 1M41A 4KWWA 2VHLA 3AIQA 3BARA 3PPGA 1FY6A 2UY5A 3WENA 4W88A 2J9YA 1LUCB 1K8CA 1EGZA 2C7FA 1EO7A 1NM9A 2E7FA 1EYEA 4NZ1A 4JTQA 1RD6A 3WQGA 1GHSA 3TU9A 1L6WA 1VGAA 3P8JA 3UZZA 4FAMA 1J0HA 3KBNA 3TYBA 4LPCA 4EKJA 2GUBA 2VO5A 3E3HA 4FNRA 1PZ0A 4ZO7A 3WLKX 4HHHA 2WJEA 4MWAA 3DFHA 3WF0A 4GQRA 1X8FA 4AMCA 1IT8A 2MNRA 4S3DA 1JPMA 3LCWA 4NX0A 5BYWA 4YNGA 2YR1A 4A4AA 1MNZA 4YLWA 1R3VA 4NT0A 3IAQA 1L6FA 8XIMA 3CM4A 3N3MA 1Y7VA 4L64A 4D71A 2YBUA 4RNHA 2HQAA 2VZVA 1A5MC 4LXFA 5KITA 1KLYA 3RN6A 2YB4A 1GNXA 4ECLA 3EDJA 2JGYA 3OU8A 3M5ZA 4R85A 4Z2JA 4O13A 1KM0A 2GPTA 2ISWA 5KINA 4RLIA 3CC1A 1JZ2A 1JRBA 1V08A 1W5QA 3RRXA 4EXAA 3RMEA 1Q6CA 4MNLA 4JTUA 7TIMA 2XFFA 4HHMA 3U3HA 4O10A 2QYGA 3HQPA 3WSUA 2QCHA 3DYMA 3E0LA 3VGEA 1Q66A 4RJEA 3GLCA 1EKOA 1BQGA 1Y5XA 4QJ4B 2ZWZA 2FZMA 4AFYA 3RU6A 4HHLA 3S1GA 5A8MA 3F4WA 1W6TA 2FTPA 4J3VA 1XPYA 3OLIA 4N7QA 3GNDA 2Z4GA 1Q8JA 2WC4A 3O6YX 4KGLA 3C61A 3DG7A 2PPGA 3T1GA 1X1OA 3AFBA 4XAGA 4BY3A 2BGQA 3TUUA 3BL3A 2POTA 1E3XA 3N73A 1TR1A 1E0XA 1I2QA 3ARZA 4GIEA 4RNFA 3CUZA 4EACA 4NJHA 3LTSA 1VRXA 2OLAA 3MUXA 3QZAA 5I03A 4CCCA 3SRFA 1DJQA 3R89A 2QEZA 3G8RA 3NZ1A 3S47A 2GQAA 4W89A 5B80A 3QSTA 3OZYA 5HWMA 1BPLB 1RAKA 3WH6A 1JAKA 1TPDA 3EWXA 3CQ0A 4LAOA 4KRUA 4D72A 3GIQA 1VFTA 1WUEA 1XIBA 1XDMA 4NZ5A 2FZNA 3MC5A 4IQLA 5FCZA 2QULA 2VFDA 3TMLA 2BVDA 4JTEA 4G7EB 4C6EA 2J9XA 7REQA 1XKYA 4JIHA 1DHPA 3OVGA 3VCNA 3RJXA 1CENA 2ZX5A 2W5FA 5HINA 5B7YA 2PRMA 3O15A 3SCNA 5FAJA 3UF9A 4XUGA 2C14A 1J93A 2XGIA 1UOZA 2FHCA 2OZ0A 4HB7A 2OSYA 3VIPA 4MZ8A 1GYMA 3ZT5A 4FOUA 2QCDB 4I7VA 4REQB 4F0MA 3B4UA 2WMHA 1BWLA 1RBOB 1EIXA 1GUVA 4HJFA 1D7KA 4US6A 1TWZA 1MEWA 4HNOA 4MGGA 3R94A 5IOBA 1M5WA 5CPNA 4O19A 4H6RA 4RW5A 3TZFA 3WK1A 1T8XA 3DYOA 1XUZA 5D09A 1SYTA 2XZ7A 1K6WA 1AL8A 1MSSA 3OJGA 2ZYFA 1JD9A 1FKWA 4GQQA 3GDBA 3T05A 4L4PA 1RK5A 4JTCA 3NEHA 3WNOA 3HGRA 4OWGA 4B5XA 2OYMA 3TJXA 1D3GA 1KV5A 4O50A 5JH1A 4RE0A 3MKVA 1GVEA 3ALGA 4WGXA 1AODA 3B05A 2XIQA 4IL2A 3MCOA 4TTGA 3TN3A 2AMGA 3USBA 3DBNA 2DY3A 3BW4A 3IJ9A 4ML9A 4ZB2A 1NSJA 5DT5A 2D20A 5DELA 4QG9A 4W85A 3UP8A 1AH0A 1E6NA 2VC7A 3M6DA 4MF4A 3WJYA 1UKOA 4GK8A 3M5XA 3ZZ1A 1NDZA 4KH2A 4LVDA 1SMAA 2DZAA 5DQPA 3V36A 4TX8A 2X7VA 3DFTA 4JQ3A 3V0TA 4IP4A 3BLKA 4K2SA 1OADA 5D2TA 4IWWA 1FWBC 3AIEA 4GQBA 3LBMA 5DMMA 3TCEA 2GWNA 3VYLA 3HN3A 1V0MA 4O57A 3HPZA 8TIMA 1P0NA 4F9JA 4LYRA 2PD5A 3FVMA 3N2CA 1FH8A 2BFGA 1EJWC 3W7OA 4ROQA 2D1ZA 2OLSA 2VFIA 1K9FA 3RG6A 4E2BA 2Z1SA 4AHQA 1JUEA 5A2BA 1GVSA 3K30A 1Q5MA 2TMDA 3IIVA 5HPOA 4R27A 3GXTA 1WZAA 2Q3RA 5LYRA 3UYIA 5CGMA 2PU1A 2J7DA 1UC4A 1MFVA 3KEHA 3GU9A 1TA3A 1GQNA 3BCFA 1KBBA 3TWAA 1WZKA 1PYMA 3WQ8A 5CG7A 2ZZ1A 4N9CA 3W02A 2V3EA 3ZO9A 4BQ3A 3T44A 3TC7A 2W92A 3SRKA 3BGJA 4AG0A 4ATLA 3W7RA 3WBYA 1JXKA 1XC6A 4M6UA 3SUVA 3DECA 1PTGA 3R0KA 4CNPA 5JBDA 2ZUWA 4GI4A 4RZBA 4HBKA 1ZS2A 3TYAA 2E4TA 1OF8A 1YTEA 4IICA 4CGTA 5LNVA 4DXXA 4WJEA 2PC8A 1E6PA 1HP5A 4INFA 4XBSA 4JIRA 2WBGA 2CWXA 3VKAA 3RPTA 1JFHA 4LCSA 1ZHAA 3VOGA 1X39A 1YTDA 1W1B1 3EDEA 4IH3A 3GC5A 4KCUA 3O7UA 1RBAA 3UERA 2WJFA 1JD7A 4YWSA 3TXVA 3DESA 4ILSA 3W81A 3AXKA 3PBVA 4HJWA 2VNCA 3MDWA 1ZB5A 4OUIA 3S83A 4JQAA 5DY2A 3BQ6A 4LTSA 2P76A 3NEVA 1NFGA 3EOUA 1B4KA 1D7FA 4QISA 2FLIA 2DZSA 4N42A 5H91A 3G6LA 1W8GA 4FIRA 5F4WA 1A53A 3WLIA 4LBRA 4LH8A 2O9PA 3EKLA 3KLKA 2BHZA 1CXFA 4F9DA 3NTYA 3WMCA 3QGAC 3CS2A 5D04C 4DWSC 2ZX8A 4JQ2A 1T41A 1GKQA 2GK1A 4JN8A 1G4SA 5FKYA 4IQJA 4IMFA 1CX9A 4PMZA 2PCEA 3W1TA 1XH1A 4NSBA 3A47A 4WDTA 1GCYA 2OQYA 3G1XA 2WM0A 3VE9A 2PBGA 1MEIA 2X8RA 3N19B 3TSBA 2FHBA 3CUGA 1LWHA 2ZRUA 4AX6A 3ZJ6A 4QITA 4Z1BA 3QYQA 2F6UA 4GMEA 3N34A 4LVAA 2GJRA 3LLFA 1S5MA 2VL4A 1HL2A 4UXDA 2DUAA 1JZ7A 3LU2A 4Y90A 3MSRA 1KXQA 1YBQA 3QR1A 3NL3A 1OCBA 3UNTA 3DUGA 3ARVA 1Q2RA 3GNXA 3FDKA 1PPIA 3H4WA 3WDQA 1KWGA 3WLNA 1N8FA 4DZAA 4XV0A 4FXJA 2QCDA 4NNAA 2ACUA 2FMOA 3PJUA 4MJMA 2QJNA 2E9MA 1MDRA 4UUIA 4GJJA 4K8HA 2PGFA 4A8RA 4JHOA 1NWTA 4B5NA 5AYIA 1B3OA 4J2MA 3HG5A 5L9FA 3UR2A 5D03A 5B7ZA 3VMPA 2MUCA 1DVJA 3S5SA 4Q7BA 1Q4NX 3UWYA 3VMOA 4J5NA 3NZQA 4MIMA 2G3FA 3OBAA 4JXCA 1WNOA 3VC6A 1VF8A 2DIKA 1BYBA 2YBTA 2ZA2A 5BXPA 5GNXA 5MKGB 2PTZA 3W7DA 2OCZA 3VX1A 1ZUAX 1JVNA 3WEZA 4PTWA 5L6UA 2WKGA 3GH5A 1CXIA 3VGBA 1PZ3A 4N9EA 1S2UA 4NI8A 1J5TA 1EF3A 2I1OA 3GM8A 5JVLA 1UD5A 1U1UA 1RUSA 3CZEA 4GD0A 4EAYA 3R2GA 1ECQA 3J7HA 1OX5A 2Q8LA 3R8GA 1V03A 3M07A 1E4LA 1VYPX 1H1YA 3T55A 1GJUA 3AXIA 4WVXA 1A5KC 3VIIA 1ENUA 3T40A 1C8XA 1CXLA 4DRSA 1WQ5A 3QV8A 4OQVA 3OIXA 4JNZA 4PRTA 4UQBA 5CZSA 1UHVA 1PKMA 2XN2A 1VJZA 2YW3A 4RV3A 3A4JA 4ZENA 4J2PA 1OJXA 1Q7ZA 4ZEPA 3U4AA 1QW7A 2A2IA 3L5LA 4S2CA 3ZJ8A 4O15A 3RGTA 3BCDA 2V81A 5KZDA 3W24A 1US3A 3A64A 3FY1A 2I57A 3O2LA 1W3NA 4IIGA 1I2OA 4LC8A 4L6HA 2WJDA 2AKZA 4JTAA 2OEJA 2WMFA 3DHPA 1R7AA 1LL7A 1TJPA 3RILA 2GYIA 4M7TA 1RH9A 1S2VA 3H7UA 2WZTA 4ZTXA 4QRNA 5ECVA 4I90A 1R7OA 2A3CA 3E96A 2ZUVA 2DSUA 2YCIX 3T0BA 1B54A 3WF4A 2VGGA 4DJEC 1OCNA 3OW1A 5AYZA 3NL5A 4OVXA 1QNOA 1UIOA 2ZWYA 4WY0F 2Y61A 1KWKA 2ZX6A 4UCFA 4LT9A 3C2OA 4AWEA 1LP6A 3AHZA 4AD2A 3FK4A 3N18A 3U0HA 4KKXA 1J8VA 3WUEA 3NIYA 4L1XA 2YA1A 5C71A 4W7UA 1XIHA 1XG3A 1V93A 4C5ZA 2Q6ZA 3B9OA 4IJCA 1E9IA 3PJWA 1A5AA 1CT5A 4P8VA 3ZT7A 1TA3B 4F66A 1ZRQA 2QJHA 5CJNA 1TWIA 1J4EA 4A05A 4GJ1A 1VAHA 3MUCA 1C9DA 4PCSA 3E9AA 2O9OA 3T6CA 3VGFA 1DXFA 4Q8PA 2P0IA 4EIVA 3ICJA 4L6OA 2PDIA 2ABAA 1W1VA 3K4DA 2PSNA 2WMIB 3KXQA 3P80A 3H2OA 3FJLA 5CPMA 3L65A 3TH6A 1VP5A 4DB7A 3TTEA 4OT7A 3GFYA 1TV4A 4BJHA 3DFOA 1NWSA 3BGGA 1P4CA 2GUUA 1ITCA 4H9MA 1QPRA 2YJQA 3CHEA 3RFAA 1AK5A 2WC3A 2ZIDA 1EP2A 1LG1A 1XIJA 3AYRA 1XIDA 3H12A 4FLOA 3RMJA 3S6TA 1H41A 3CZKA 2OYKA 1H61A 3ARQA 4DF1A 4UMAA 1A4LA 1R9XA 1OD8A 4DZHA 2J66A 3GH4A 2X0SA 1Q6EA 1RCOB 2O4MA 4PEKA 5HR7A 3CAQA 5JUVA 1C7TA 3TYUA 2WW5A 3B0UX 1ZL1A 3CV6A 3TK7A 2AAAA 4YTTA 4FNSA 4S3FA 3VIJA 3G1YA 4I5UA 3IV8A 4AZ6A 4NY2A 1FXQA 1JFXA 4K1GA 2QDHA 3KZPA 3C3UA 2XWEA 1IWBA 4PBGA 3EDKA 4IG2A 2WZHA 2YA2A 1P0KA 4YCPA 3UWWA 3N3TA 3BO9A 3DIPA 4DBWA 2XWDA 3LZ5A 1V7YA 4GYFA 4GZEA 1KBJA 3V1PA 3L4TA 1CGYA 3CPGA 3HG4A 3NJ3A 2Y7DA 1E4IA 4JQ4A 1H2JA 4F0HA 4YYCA 2CWNA 4ZOAA 2HTMA 2W4XA 4C6FA 4GI9A 2V3GA 3MWAA 3URAA 1XINA 1R6WA 1OVDA 1DIEA 4F0LA 3LX9A 1RLCL 1KR0A 2CLMA 4QLJA 1W37A 4CKQA 4WQ6A 2XN0A 1DTUA 2WSKA 4PTMA 4R9XA 1FP9A 3KTXA 3ABRA 4WSHA 1E51A 3EAUA 3PZIA 4HD5A 3M0ZA 3AXMA 3M9YA 1FWDC 2WWDA 3IVUA 1E55A 2VP8A 4KEZA 4XAZA 1TWWA 1EJSC 1PZ2A 2W61A 2OZ3A 4Z2IA 4WR3A 3DFYA 4DWDA 3W72A 2P8CA 3R10A 1TPUA 1BVZA 2FH8A 1R3WA 2Y85A 3O06A 1AD4A 3WLTA 3S9ZA 2QT3A 3I3DA 3CZ8A 4OZOA 1WDPA 2J47A 3A4AA 3HTWA 4WSJA 2WZEA 1PVNA 1E9LA 2E28A 2VYOA 4O16A 3NDZA 4QCEA 1V6WA 4XAPA 4C1NB 3NA8A 1ICQA 3EWUA 4IFKB 5FI8A 1EJVC 1AQMA 3Q94A 3NQEA 1V02A 2V5JA 4NXKA 8A3HA 4GE8A 2E25A 4C6OA 2ZTKA 3WEMA 4IMEA 3GB6A 1WXYA 4PR4A 1B9ZA 2NXGA 1GVQA 5CBJA 1VBRA 1HF6A 1R2RA 3II1A 3LNPA 3HG2A 4MKVA 1FWFC 4L1WA 2G3NA 3UWVA 2BVTA 1H7XA 1M7OA 1Z3NA 2AKMA 3GG0A 5SWUA 1EOMA 2CLKA 1AJZA 5BXSA 2QIIA 3PK7A 1WB0A 2PDBA 3P6LA 3GXIA 1LORA 3VZZA 1RR2A 4J3TA 5LIWX 3EOOA 4RE4A 2V2DA 1XV8A 3WELA 4MUPA 4XD4A 3NPXA 4GI8A 4LV4A 3RIKA 3OP2A 4J27A 4XZNX 4HK6A 2RAGA 3PBUA 3CH9A 3NPWA 3EB2A 5ABEA 4V28A 5F2MA 1H62A 1VIZA 2QHAA 4NVTA 4G2DA 3CQIA 4J7RA 3MTWA 3TSMA 3HPXA 4GKTA 4UTKA 1J0YA 2C16A 5IFPA 3MI3A 4MMWA 3QZEA 1RCQA 3DX5A 5FD0A 4CNSA 1RSCA 4B5WA 2REQA 3UPWA 1SSDA 6ALDA 2WPGA 3KOWA 2A7NA 2NQZA 4PGLA 4MWAB 1EJTC 1F07A 1LRQA 2QUTA 4PB3A 2D73A 5KETA 1QI5A 1JAEA 2XPKA 2DVXA 1CPUA 2NT0A 3CUXA 1XUUA 3S9YA 1R2TA 1E56A 3GIPA 1PIGA 2AAMA 3QOMA 4MWAD 3SGUA 3VCCA 1E1EA 1MUMA 1FWSA 2BV9A 2PODA 3GYCA 4Q4QA 4FX7A 2H6RA 3SECA 4XG1A 4O1AA 2RH9A 2GSJA 2W0UA 2WHLA 3AZTA 3LXBA 4EPKA 4JYDA 1MZHA 3WQ4A 1WKEA 2NWSA 2DP3A 2RGLA 1TRIA 1E5JA 2QPSA 2FPYA 3VINA 3AYTA 3SCSA 3KP0A 3BMVA 3DFPA 1IEWA 4D8ZA 1ME7A 5KMYA 3ITCA 2D0HA 1ZJIA 1OK4A 4O8AA 4RL3A 4LUTA 1FCUA 3IGUA 4OV4A 3S3GA 4NI3A 1OHLA 2QUNA 3B3DA 3RX3A 2TODA 2VEKA 2WSRA 5CSSA 4D6DA 1VEOA 5D32A 4A21A 1W5PA 1R38A 1OYAA 1NDWA 3VD4A 1QOPA 5DCEA 2OO6A 1ZPTA 1D2KA 3UXLA 2D69A 3GTIA 4CD6A 2H9AB 1XCXA 3LGEA 3VDAA 2B0MA 3GAKA 5G4WA 1UZ4A 3NO3A 1SZEA 1P0BA 3U6WA 3RF9A 3BOLA 3NG3A 3W01A 3M16A 4ML4A 4P7LA 3ZVHA 5CZTA 6REQA 2FVLA 1FH7A 3WEOA 3W53A 3GIYA 4P2VA 1BTMA 3WQEA 4ORMA 1GOMA 2BS9A 3FA3A 3W7JA 1UP0A 5K2ZA 2B7PA 1US0A 3C2EA 3LN3A 1HQTA 1RQHA 1E0TA 1XBXA 1IXQA 1UMYA 3W7KA 3CZGA 3V4BA 4AEOA 4AHOA 1PCKA 4JIEA 4W7WA 1XWYA 4GRSA 4QEEA 1OC5A 1ZGDA 2YZRA 3PZNA 2HMCA 3H22A 4B3ZA 4HYVA 4QS6A 1UWAA 3UWQA 4Z2KA 3AU6A 1W1PA 2Z29A 4NYYA 1E1CA 1ECEA 2UY3A 1XKJA 4F2BA 3BVJA 3OG3A 1V0KA 3PZMA 2ZOXA 4GX9A 4IIEA 3NUKA 3FA5A 3N17A 3GG7A 4FO4A 3UFYA 5HPCA 4Z1DA 3N6JA 3JZEA 3PBYA 3Q2DA 3GR4A 4Q22A 3CEPA 3C2YA 3PR2A 4EVZA 1ZCOA 4A2SA 2F6XA 3VKBA 1MW1A 3A21A 3S0CA 4WEVX 3RNDA 4GFIA 5G5IA 2ZX9A 4H6QA 4PL2A 1OCQA 4FEZA 2H90A 2WMKA 2ZC1A 4CQBA 1IR1A 3VDGA 2WM1A 5DX7A 3QHMA 1BRLA 2G8ZA 5T26A 4GISA 4C1KA 1GG0A 3P2VA 4HNTA 1VCVA 4LBUA 4FNUA 4BWLC 4HZ8A 3NR0A 4HPGA 1NY1A 4FF7A 4HCLA 4S3EA 3USZA 5LHFA 4Y2WA 4QBXA 5E0FA 3FHQA 3C86A 1D3HA 3SAZA 1YNPA 5U4NA 2BGSA 4UFMA 3WN6A 1VFMA 3PBWA 1DORA 1E4NA 1PKYA 1R0MA 2Z6IA 4HSOA 2E40A 3M47A 3DENA 5CSUA 3DI0A 3I10A 3SCVA 1JNDA 4IJBA 3ATYA 2R8WA 3ZLHA 3CIVA 3L0KA 2HK0A 1CW2A 1PDZA 3G1RA 1UR1A 1QHOA 3FDGA 4M80A 2HK1A 1JPIA 1SW7A 1BYDA 4UOJA 4ZOCA 5F7UA 2BODX 3IJQA 3UXIA 4M5PA 4B16A 4POCA 4UTWA 2PWFA 3AXXA 1RK6A 2EAWA 4EPEC 1M6JA 1OFRA 4IPIA 3KCJA 1Q45A 3E49A 4M82A 1SO3A 1NF7A 2E77A 5C9UA 4JQ1A 2TYSA 2B81A 4UFJA 2WCAA 2QCGA 1HT6A 1DJGA 1LQAA 1O66A 3SQLA 3APYA 4AQLA 2XDFA 2G41A 4W8LA 3UESA 1XG4A 1F3WA 1WPCA 1F4AA 2X0HA 3WLMA 1PIFA 2V69A 1OYCA 3CV7A 3WUGA 4D8LA 2PAJA 2EBNA 1XHGA 1A47A 3G18A 1YPXA 4C60A 2QDEA 4GBUA 4LSBA 1FXPA 4L9XA 1YXCA 1G5AA 2JQXA 3PZVA 3H7VA 1HIZA 2YKKA 3IRDA 4PODA 1F73A 3CHFA 1UKPA 3POCA 1W3IA 3DXIA 4CNOA 3LG3A 4CQ9A 3LGGA 3GO2A 1OABA 2E6YA 5E0KA 3HPAA 3TTOA 5TBOA 1QNRA 2NLIA 3C0QA 5AY7A 4N9DA 2P88A 4Q3MA 3CWOX 4UTMA 3K8LA 3EA3A 4PUKA 3QZ6A 4TQTA 4FPSA 1TQXA 4B2DA 4RPPA 2H8XA 4XK2A 3BGAA 1AW5A 1LDCA 1A3XA 1GG1A 4WKHA 2VCBA 3KWSA 4UNLA 1BYAA 1DKWA 2MANA 1RP8A 1IT0A 1H63A 1S5NA 3LBCA 3A4XA 1KFLA 2DIJA 2ZRWA 3TZNA 5AFDA 3NZGA 3O0KA 4W5ZA 3SADA 1IZCA 4QAWA 2JKEA 1L6SA 1LQ2A 3ARSA 5DXYA 3EDFA 2Y88A 3BQ5A 1L6YA 2NQJA 6CGTA 3EXTA 3R79A 4LV9A 3I6TA 4ZTYA 1NOFA 4HMCA 3B9AA 4AWSA 3WNLA 3ZOAA 1TB3A 2X2YA 4H01A 1Z7AA 1K1DA 1CTNA 3TMQA 3JR2A 1H50A 2X09A 3VPLA 2BVYA 1H60A 1FWAC 3K4AA 2X1SA 3C0SA 4RDZA 3WUFA 3PSVA 3ZS4A 4ADUA 3PNZA 4HOWA 3ZT6A 3BPWA 3ABOA 3EWDA 1O5XA 2CEQA 3KCOA 1A3HA 2VX6A 2WAGA 1NDVA 2NSXA 4LNYA 3ITOA 4QSHA 3OYXA 2XN1A 3RO6A 1SJDA 1HJWA 1BXNA 1DWIM 4MPQA 1CXEA 3BAKA 1QHZA 1GW9A 3R7MA 5I3FA 4MB5A 5C70A 1GEQA 1Q6RA 2X0YA 2QJJA 3D3FA 3M0XA 3JUGA 5G2HA 1WOBA 1ELSA 4YTUA 2ZA3A 5A6BD 2CLPA 1EB3A 3ELFA 2Y7FA 3M0JA 1V0NA 3N4AA 4GWEA 3W27A 2DSZA 4Q4RA 1KGUA 2ZDRA 1EUNA 1TELA 1Y8BA 1U1JA 1H49A 2CU0A 4K68A 1CZ1A 4CEXC 1E70M 1VZWA 3PWIA 2NX9A 4GZJA 1UD6A 5CC7A 3NXFA 4AC1X 1KTNA 1XLDA 3WDPP 3H2MA 4NRRA 5FESA 1PX3A 3FEMA 1X98A 2O7SA 3KVJA 3BLFA 1QPOA 1TR9A 3RR4A 4DHGA 4OTKA 4LUSA 1H3GA 1SU5A 2Z25A 4M29A 9XIMA 1UZHA 1IR2A 3FS2A 1AFSA 2CLEA 3SFWA 2EPNA 3RM9A 2F6KA 3NPVA 3CV1A 1V6XA 1G0CA 3WQCA 3IJ8A 1C9WA 5AYBA 3LXAA 1JF6A 5DT7A 3EXSA 2HS6A 3W2KA 4CQAA 3OOQA 5T91A 3UY8A 2VD8A 2GVEA 2HZGA 3AYVA 5EMMA 1W3LA 2HROA 4IQEA 4F48A 2CXEA 4KCTA 1ZJAA 3LA4A 4XZLX 4Q8VA 1UR3M 3WNKA 4ZZ9A 3EWCA 4DJED 3TW7A 3FHAA 4GJIA 1QK0A 1SZGA 1J0ZA 1AQ0A 2Y8UA 4JTIA 5CCZA 4FA3A 2XJ7A 1DYSA 1MDLA 2DQXA 3WCZA 2CXGA 5A6SA 1GPFA 3VIHA 4GLEA 4AIUA 4ACYA 4GNJA 6TAAA 2ACQA 3UJSA 3V1HA 4M6PA 5I3IA 1EH9A 3RM4A 1W9BM 2HCVA 2Y2WA 3DZ1A 1JDAA 3DGBA 4O11A 4QE4A 4I7UA 1UC5A 2HPMA 5AOUA 5AHFA 4C7DA 1KRBC 2HVNA 3V5FA 3QKEA 3RYSA 3L4XA 4W86A 2DH3A 2QUUA 5H2ZA 1YW1A 2A7PA 3WBXA 2OPJA 5JIWA 2Y63A 3EOEA 1TREA 3BOFA 1L9WA 4NKCA 2JIEA 2PWHA 2GDQA 1UH3A 1EIBA 5EA9A 2OJPA 1W1ZA 3MUZ1 2OXNA 3ZSSA 5GQBA 1J9YA 4DZ5A 5HMFA 4JKKA 1QTWA 4Q8WA 1FHVA 5AB3A 1Y0EA 2G3JA 1VS1A 1UD2A 2RHGA 1TTQA 3OTRA 3WQOA 3GZ3A 4HQVA 3ARUA 3LLDA 5JBFA 4K8GA 1G94A 1TVNA 1OYBA 2B31A 3GNNA 4UTIA 3QVQA 3B9NA 3WX7A 4N02A 1ZCCA 3URQA 1TCDA 3UZYA 1GORA 1X1ZA 2GOUA 3DH7A 4DJFD 1JULA 2XVNA 2BBFA 4I5XA 3EKZA 4Q8OA 1ZQ5A 1X6LA 4LS0A 1OBAA 5C9WA 2NV1A 1K4GA 4DAIA 4ORIA 3WLSA 2A6NA 2XUCA 3UU0A 1UASA 1Q2SA 4RW3A 1DWAM 3I7SA 4GACA 1PAMA 4MB1A 3CUHA 2OQLA 1FWEC 1BTCA 4C7GA 3R6IA 2FZ9A 1PYFA 1S2CA 1LLZA 2EO7A 3PJTA 2AQOA 4IP5A 1KA9F 4JFVA 1UUOA 3G3DA 1U30A 4KQNA 1QW9A 1AA1B 1KM1A 1OD0A 3RU8X 1KKRA 1EGMA 1NDYA 4DO4A 2KX9A 2Z26A 1EPVA 4J35A 2EEXA 1SMDA 4QDPA 2E5BA 1NH6A 4IGHA