4A3HA

2',4' dinitrophenyl-2-deoxy-2-fluro-b-d-cellobioside complex of the endoglucanase cel5a from bacillus agaradhaerens at 1.6 a resolution
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
300
structure length
300
Chain Sequence
b'SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ENDOGLUCANASE)
publication title Snapshots along an enzymatic reaction coordinate: analysis of a retaining beta-glycoside hydrolase.
pubmed doi rcsb
source organism Bacillus agaradhaerens
molecule tags Hydrolase
total genus 122
structure length 300
sequence length 300
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 1998-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4a3hA00
3PTMA 5IDIA 3SUUA 3BSHA 1MXGA 3A6OA 1WAWA 1V0LA 4Z2IA 1MW2A 4B3KA 1HKMA 2A3HA 3GNPA 4YHEA 4OBRA 1Q6FA 2YL9A 3AS2A 3KE0A 1QNOA 2CYGA 1JDAA 2ZE0A 1UD3A 4PUEA 1OWQA 3CBWA 3HMCA 3HJEA 2RGLA 2XM1A 1X1NA 2W92A 1SFSA 2WCSA 1NWRA 4JFTA 2IXVA 5A8PA 1AMYA 1C92A 4CN6A 1CECA 2VCBA 5A3HA 3VX1A 2O9OA 3OLDA 3ARYA 1E0VA 1UHVA 3PZVA 3BAIA 1TZ7A 1UR4A 4UOJA 2Y8VA 2WHJA 4HTYA 2DT1A 1IT0A 1ISYA 3B9AA 4NF7A 2AOSA 4MNMA 3WQ4A 1VFUA 4Z2HA 2GJPA 4WJXA 4FF5A 4WKHA 3I3BA 4N0RA 1H1NA 3PZGA 1J10A 4UFIA 3CIVA 1H11A 2WKGA 1B9ZA 3CHDA 5ABFA 4OUEA 4DWSA 1CZ1A 1BFNA 1E1FA 1ZBVA 5AY7A 2Z1KA 1JYNA 1E15A 3N11A 1GORA 3GH5A 1ODZA 1XH2A 2VRJA 2OYLA 3II1A 1E4IA 4U31A 2PWHA 2V3DA 1GNXA 4Z2KA 4PMQA 3VO0A 1ZB5A 2EPNA 4HPGA 1UH3A 1HVQA 1E43A 1C91A 1E6PA 1FFQA 1GHSA 1ISZA 4CD8A 5A2CA 4U2ZA 1W1TA 2NSXA 4QLJA 2BHZA 3N9KA 3PZOA 4J3SA 2IXUA 1E70M 1P6WA 2PWEA 1G1YA 3TA9A 3VM5A 5AYIA 4P8XA 1QHOA 1VJZA 2WVSA 1DEDA 2BY1A 4PMDA 1CEOA 1JF6A 4GZEA 4JHOA 4BCEA 4QCEA 1TG7A 1EQCA 3IAPA 1HKKA 3KL3A 1CXLA 2ZUTA 2Y4SA 2J7BA 1B31A 2YDSA 3MO4A 3MSGA 5BXSA 4MJ2A 3SCWA 3DECA 4GPNA 3WENA 1J0YA 2DDXA 4D6DA 1KGWA 5CSYA 3CUGA 1O6IA 5CG0A 2WSPA 4MNJA 7A3HA 1AQHA 3WNNA 1LL4A 4AXNA 3ZR6A 4TVCA 4UOQA 1RP8A 4P8VA 3VILA 2WHKA 1E3XA 1UD4A 1CGYA 2XFYA 3A3HA 3L4YA 3AOFA 4WIWA 3ARXA 2YLLA 1JYXA 1GHRA 1H41A 1HJQA 4P7NA 9CGTA 5D8ZA 1HJUA 1NM9A 2UY3A 4J3UA 1M03A 1V02A 3CTTA 4KGJA 4X9YA 3RIKA 3NSMA 4IPNB 3D5HA 1H09A 4ZE4A 1OT1A 5EFDA 1WP6A 3RJXA 5CXPA 1CLXA 3BAJA 5I77A 1GVIA 2XSAA 1EO7A 2CBJA 3TTOA 3SCVA 1JYWA 5I3DA 2EO7A 2CBVA 4PSPA 4KWUA 1B3XA 3GYCA 4OKDA 4GINA 4X0NA 3ZO9A 2F61A 1PZ3A 1B30A 3W6LA 2WNWA 1NOUA 3VDHA 1XRVA 3NCOA 4GO9A 4V28A 5CPSA 5GNYA 3VD4A 1W2VA 3WF0A 4PTWA 5LA0A 3VX0A 2FHBA 1NOFA 3WELA 1DWAM 3WKZA 1E6XM 3WNOA 2XVPA 4AEEA 4JKLA 1OT2A 3WF4A 1HIZA 1V3LA 5A6BD 3PZTA 1JZ7A 1UWTA 4KGLA 2VJXA 1XSJA 3W53A 3WDJA 3KWXA 4PN2A 3S6TA 5A95A 3WF3A 4AZCB 2PC8A 2OSYA 1TUXA 3L2LA 4IM4A 3RMEA 1BF2A 2J74A 4CCCA 2EXOA 2W5FA 2CHOA 4PMUA 2D0HA 4H2CA 3HU7A 2E40A 3WNKA 3ZQ9A 1M53A 5HPOA 1V0MA 1J0JA 1GONA 1J0KA 1V3KA 2V5CA 4HMDA 4D6IA 2J7FA 1FFRA 4HOWA 3DYMA 5D9NA 2WB5A 1VB9A 4C7GA 4V2XA 4NSBA 4ACZB 1J18A 1UR8A 2XWDA 2BNJA 4PUDA 4V27A 1QW8A 2CBIA 3WD2A 3ZR5A 4AD3A 2G3MA 1GJUA 3AIQA 1U2YA 2VO5A 3N04A 3VNZA 1JZ8A 2ESCA 3APGA 1PZ2A 3ARTA 2J7GA 1YHTA 4AMCA 2VURA 5I0DA 4J3WA 2Y5EA 2QV4A 2GK1A 2J7EA 2WVVB 4HA3A 4BF7A 3EMQA 2YA0A 1J0IA 4JHZA 3ARRA 1H49A 1UZ4A 2D22A 1ZS2A 2PWGA 2BVDA 3N13A 4LYRA 1LG2A 1WCGA 5E09A 3SUSA 2OYKA 3ZT6A 4DUXA 3NSXA 1QOXA 1V6XA 4UNIA 1HJVA 2WMKA 3T0DA 1H0IA 2DGAA 2V3EA 1EOKA 4IISA 1B0IA 4P7OA 5I78A 1UWSA 4YHGA 1XSKA 3AIRA 7TAAA 1GW1A 5BYWA 2XM2A 2VZUA 3THDA 2DSUA 1NQ6A 3S2CA 4TVDA 4RE3A 4U3CA 1C93A 4W7VA 4EKJA 1E6NA 2XYLA 3AI0A 2WK2A 2BY3A 4WSJA 2J77A 4Z2LA 4TXEA 3WDQA 3GZAA 2VZSA 1KCLA 5I24A 1TCMA 1G9HA 1BVNP 2WANA 3CUHA 2F8QA 1Q6CA 2VZVA 1JAKA 2BY0A 4D6FA 2J75A 1WZKA 5I5RA 2G8ZA 1F4HA 1V6UA 3PZUA 1MW3A 3ZSTA 2WMFA 1KWGA 3ZIZA 1XV8A 3OLIA 3SCSA 4DM2A 2CNCA 3SUVA 5BCAA 2A3AA 4E2OA 1JZ2A 4AD5A 2DT3A 4K68A 4BS0A 2WYSA 4XX6A 3M07A 5FIPA 2W91A 1GOKA 1QW9A 4U33A 3ZJ7A 1MQPA 1BHGA 4PCTA 4CD7A 3DHUA 3M7SA 1L8NA 3B9DA 5CGTA 1CDGA 1W1PA 4MJ4A 3VMNA 5CJ5A 4CU6A 3WD4A 4D6GA 3POCA 3KEHA 3ZOAA 1UQYA 1V02E 3NDZA 2XGBA 3EDEA 1MFVA 1VBRA 2EJ1A 1J0ZA 3AS3A 3LMYA 1KR1A 1W3KA 5A8OA 3AMKA 2EBNA 1QNPA 2JALA 3WDRA 1GPFA 2ZWZA 3RO8A 3AXIA 3T0BA 2QLYA 1HL9A 5E0CA 3UR7A 1W3JA 3EDJA 1QI3A 2VVSA 4FLQA 1CLVA 1GZJA 3K8MA 3OA5A 5A94A 3GTNA 5D9PA 4BQ3A 5BXPA 5LA2A 4ATLA 3ZSSA 1VRXA 1ISWA 1MQRA 3J7HA 1OD0A 4AD1A 1JFXA 2VQUA 1GOMA 1JXKA 2FHCA 4Q22A 2YDQA 1OBAA 1WDQA 3GXFA 4D71A 5D9MA 1UD6A 3VGDA 1TVPA 3CZ8A 3BAXA 4PMYA 1WNOA 1EHAA 2E8YA 2UWFA 3EMZA 4YPJA 1ODUA 2XVLA 2Y8KA 3G6MA 1BGAA 4Z2JA 3MUIA 3BH4A 4W86A 1NP2A 4Q7NA 3VPLA 2IUZA 4W5ZA 5A2BA 3RM8A 4U3AA 1RPKA 2G4FA 4UTFA 1H3GA 1RP9A 2XVGA 4M1RA 3DYPA 2E9MA 4B9ZA 1OIMA 4MPKA 4JL2A 1R85A 2A3BA 1E4NA 1CTNA 3QOMA 4WKFA 5CLTA 1X6LA 3TP4A 5A6AA 4M82A 1GCYA 3PN8A 5FD0A 3IANA 5KEZA 2XFRA 2DT0A 2XVNA 5IXEA 3GXMA 1W91A 2BHUA 2XIBA 3VIJA 4JKMA 1LL6A 3D3AA 5E6ZA 4ATWA 4CGTA 1JAEA 3EYPA 4W8AA 2D3NA 2WC3A 3AZTA 1E55A 4XZWA 4CD6A 4B9YA 3BGAA 3L4XA 3AHXA 1NOWA 5D8WA 2G41A 3WUFA 1S46A 4B3LA 1UA3A 1OM0A 3MU7A 4XZBA 1CXFA 1BG4A 1BVZA 1W3HA 3WF1A 2FHFA 2W67A 5FL0A 1V3MA 1NARA 3A4XA 5FL1A 2GVYA 2D0FA 2EPMX 3F5LA 3GM8A 4W88A 4F8XA 1XD1A 1TFVA 2VZTA 2XVKA 3WBEA 4PMVA 3W81A 4DWSC 3WUGA 2OSWA 3T2QA 4YN5A 4U5KA 2JIWA 3BAWA 1M01A 3O6AA 3EDFA 3OGRA 4AD2A 2DSVA 1DWHM 1UWIA 1DWFM 1J0HA 2WBGA 4HZ8A 4JAWA 2BFGA 2WAGA 1VEPA 1PIGA 1UH2A 4KH2A 1E1EA 3W28A 3GDBA 1R8LA 5A2AA 2Y24A 5M03A 2ZUUA 3AIWA 3RILA 3DC0A 3AMCA 3F4VA 1OB0A 6CGTA 4JFVA 2NT0A 4GI9A 5IHRA 4PBGA 5DO8A 1W1YA 1MQQA 1E5JA 3WF2A 4CU8A 1B3ZA 3A4AA 4W8LA 4HOZA 4UQCA 2C8NA 5DEZA 1VENA 2ZICA 4XUYA 3M6DA 3PTKA 5EBAA 4AD0A 1JF5A 2J78A 4MTVA 4GI8A 3CUJA 2QPSA 3AIUA 4J3VA 4UR9A 2DQXA 5ABEA 3CZLA 3BAKA 2PWDA 3OG2A 2EPOA 3FXYA 4MB5A 1CXIA 3TONA 4HOXA 4AD4A 2VX4A 5LA1A 1RD6A 1YQ2A 1ITXA 4AISA 4AWEA 1V6VA 3IAQA 3N18A 3UR8A 1V03A 4AEFA 1PX4A 4B16A 2YA2A 1WDSA 2VR4A 3VDAA 1ZBKA 1H2JA 1W9DM 5CZKA 1H4PA 1C3FA 4PMXA 4EK7A 4PSRA 3WIJA 1JD9A 4P7RA 1FOBA 1XSIA 1FP9A 5HBFA 1WPCA 4H41A 4BZYA 4JFWA 3VD3A 5FOOA 2G3IA 3DYOA 5A8NA 3SCNA 4AZ7A 1BPLB 3NJ3A 3W38A 2E3ZA 1CENA 2PWFA 1V6YA 3QGVA 3E1F1 1HKIA 2CITA 1BYDA 3WD3A 2X0HA 3UEQA 2WWDA 4CU7A 3WMBA 3AQUA 1KXTA 5D4YA 4P8WA 5HPCA 1V3JA 2YBUA 1HJXA 3WFZA 2FDMA 2WXDM 2YL5A 3BXWA 1J11A 1D3CA 1QI0A 3WQ6A 3AMLA 4D1IA 3VGGA 1B3WA 1QI2A 5A6JA 1LQ0A 1TVNA 2CHNA 4F9DA 1KXHA 4AZCA 1XCWA 3UETA 1X6NA 1LL7A 3PZ9A 3LPPA 3AYRA 4WK9A 3WQWA 1Q6DA 2ZXBA 5GQBA 1JNDA 3GBDA 2VOTA 4URIA 4MADA 3BAYA 3WD1A 4CVUA 3RM4A 3W4RA 1UKTA 3BCDA 2QHAA 1HJSA 1W9XA 1MWOA 1K6AA 3I3EA 4GKLA 2VQTA 1E0WA 1UYQA 2VX5A 4OJYA 1HX0A 2WM0A 1E4MM 3SCUA 4D6JA 4ACZA 3FAXA 3W26A 1A47A 5CGMA 3ARWA 3WSUA 4ACYA 1PIFA 1MFUA 4GQQA 1JI1A 1TA3A 1KXQA 2W4XA 2RGMA 5E70A 5JIPA 1UG6A 3WFLA 1JDCA 2VR5A 1JDDA 4A3YA 2ZXQA 4GZIA 4PCSA 4NRSA 3AIVA 3WY1A 1AVAA 2ZX9A 2VUYA 3WBAA 2QPUA 1CGXA 2CERA 2WVVA 3VIFA 1V3IA 4UZUA 3FNDA 1L0PA 4M80A 3F5KA 5ABGA 4RE4A 4M81A 3A47A 4ML4A 1UR1A 1JNEA 4PTMA 3AHZA 3WH7A 4C7DA 1GOQA 1V08A 5C70A 2J8GA 2GJXB 4MAVA 4D6EA 5IFPA 1VBUA 1V0NA 3ALFA 2YDRA 3K8LA 1ZJAA 2BXYA 4AYSA 3AS0A 1JZ6A 1DWJM 1F4AA 4ZEPA 4FK9A 3GBEA 2WLZA 2JEPA 2G3JA 4S3JA 3K1DA 1ITCA 1UA7A 3VM7A 3OB8A 4XB3A 3AHVA 3AHTA 2VVNA 2E4TA 4E8DA 3THCA 1LF1A 3GXDA 2PB1A 4NI3A 3WEOA 3PZIA 4LQ1A 1D2KA 1EA9C 4MNKA 2EQDA 2YKKA 2WW5A 1JL8A 4BQ2A 1BTCA 2Q8XA 1XYFA 3U7VA 4CCDA 2VRKA 5M17A 5F7UA 4AZBA 3FHQA 3W29A 1EQPA 1GQLA 1E4LA 1NWUA 2ZWYA 3AIBA 4AZ5A 3G6LA 2WZIA 3QOKA 4UQBA 2D1ZA 2DSWA 3UG5A 1JD7A 1VIWA 3HN3A 4JL1A 3ARSA 1QNSA 1U33A 1W32A 2WZEA 1PJ9A 2WMGA 5A6KA 3F5JA 2J25A 2XFFA 3IK2A 1C7SA 1SMDA 4M29A 4L4PA 1TE1A 4W89A 3MUY1 4TOQA 4MNLA 2WC4A 2YJQA 1US2A 1K9EA 4E8CA 1ZJBA 2XSBA 3L4TA 5E9AA 5JBDA 3ALGA 2PF0A 1LWHA 1R87A 1C8XA 3CHFA 1E56A 1UH4A 2Y2WA 4D1JA 3CLWA 1V6WA 4FMVA 4LYPA 1KGXA 4Y7EA 4H7VA 2X05A 4BQ4A 1WZMA 1TMQA 1WE5A 3QHNA 2X2YA 1EDTA 1D7FA 1WO2A 3AZSA 3AS1A 1MW1A 2VNCA 5A1AA 4F66A 2GJRA 4FLOA 3OLEA 1E0XA 2YLAA 4EE9A 2DSKA 1Z32X 2A3EA 2ZX5A 4W5UA 3GH7A 3TOPA 1HVXA 2OWXA 3AMDA 5HNNA 3AICA 3PBGA 1SR0A 3LPGA 1FP8A 2AAAA 1EGZA 3NIYA 3WD0A 3WH8A 3VIOA 3U5UA 1J01A 2FH6A 1E71M 1UKPA 3VMPA 5E0FA 1EDQA 2HVMA 1CBGA 5GNZA 2XHYA 3N1AA 4R5EA 1E3ZA 2UY4A 3WDHA 1JXJA 1NWSA 3OIHA 4FLSA 4J3XA 3SCOA 4M8UA 5HDRA 5TD4A 3CH9A 4CCEA 4GIAA 1JGIA 1R7OA 4X0VA 2D23A 1QVBA 1XC6A 2WMIB 4XV0A 2QF8A 1GOWA 4TX6A 3CHCA 3SIMA 2XJ7A 1DTUA 1XYZA 1MW0A 4LXFA 2ZXAA 2E0PA 3AFBA 6A3HA 3RM9A 3ARQA 4ZENA 3WUBA 1KBBA 3WNPA 3ARPA 3VD9A 4AZIA 1KGUA 2YIHA 4H04A 5DT5A 3ZMRA 5IHSA 3I3DA 2OYMA 1WKYA 2CETA 2EEXA 1BSIA 1KBKA 3AZRA 4PMOA 4NZCA 2WWCA 1J9YA 3WH5A 5JBEA 2FH8A 1CXHA 2XGIA 2YOCA 3GNRA 3WMSA 3CUIA 2DEPA 2BVTA 4AIUA 1UWUA 3WH9A 4HA1A 2XPKA 5DMYA 4CN1A 3OBAA 2XWEA 2W66A 3CMJA 4BA0A 2OWWA 1CGUA 2D0GA 2VI0A 5AYBA 4TTGA 3RCNA 4H8HA 4CD4A 3WDIA 2VL4A 2F2HA 2JF6A 1WB0A 3W27A 4W84A 4OOZA 1WZLA 4EANA 2XIIA 3CPUA 2PI6A 4R27A 3FY1A 4MDPA 4AZ6A 3VIIA 2O9RA 2DT2A 1HP4A 1E40A 1I1XA 3ARZA 1CNVA 2JE8A 5BXTA 3CHEA 1HKJA 2D3LA 4JCMA 3TTYA 4PTXA 2WVUA 1G94A 3PZMA 1Q6EA 1NWTA 2ZUMA 3W24A 4UQAA 3NSNA 4F9JA 3L4ZA 2ZX6A 1UR2A 1UKSA 3PHAA 1CIUA 3BLPX 3K8KA 3UESA 4AIOA 2XTKA 1JG9A 1ISVA 1FH9A 2ZX8A 5A6MA 2DH3A 1IV8A 1BG9A 2NW0A 1QNRA 4PRWA 3IJ7A 3MUZ1 1E6QM 3L4UA 1VJSA 3W37A 1XH1A 4JCLA 3VINA 4N42A 1DP0A 1B3YA 3WMCA 1XH0A 2BS9A 2PBOA 5A8QA 1SMAA 2C7FA 2O9TA 1UR0A 1G0CA 4QLLA 1BQCA 3VVGA 4QAWA 5A6BA 3VDBA 1DWIM 3OGVA 1BAGA 1ESWA 1CGWA 2TAAA 3VIKA 3RPMA 2CKSA 3MMUA 2C0HA 1FA2A 1SYTA 1E6RA 5A8MA 5DT7A 1N82A 2YBTA 1BLIA 5BRQA 3ZJ8A 4WLCA 1OGBA 3CZJA 4PMNA 3VD7A 3PZQA 1Q4NX 5JBFA 5JIWA 5IFTA 3WQ8A 3KL5A 2WC7A 4PMRA 1OCQA 4W7UA 2WHMA 3OZOA 3T2OA 4A4AA 4BQ5A 7CGTA 2DIJA 4LX4A 1MXDA 4P8UA 4QLKA 1GOIA 2O92A 3EDDA 2CPUA 4QFUA 3U7BA 4MAZA 4GI6A 1OGGA 1ISXA 3WUEA 1VEMA 3NYDA 3BMWA 1HNYA 5DFAA 4D6HA 5CLWA 1JI2A 5DF0A 4UFLA 3SURA 3PZNA 2V5DA 3ARVA 2UY5A 1OSEA 4F79A 1UR9A 3VGBA 3ZM8A 5BWFA 2JEQA 1GOOA 3BSGA 1Q6GA 5FKYA 4QDMA 5A69A 3QR3A 2ZUWA 3AIEA 5C8BB 1W2PA 2CCRA 2BV9A 1OIFA 5CQ1A 3AJ7A 1B3VA 3VGFA 3VKKA 3SCQA 4L4OA 5AC4A 3WH6A 5HOSA 1JFHA 2OLHA 1W9PA 2J62A 4UFKA 4AZGA 3N12A 3U5YA 1UD5A 1K9TA 3NUKA 1FHDA 3SUTA 2WPGA 1HL8A 2WCAA 1GQKA 3LPFA 2J79A 2VC9A 1KFWA 1J12A 1Y7VA 4MB3A 2V3GA 3CO4A 4PMZA 2J7CA 3B9EA 4LGXA 5A6SA 4NRRA 1CPUA 5LYRA 2ZX7A 2XG9A 1FH8A 2OSXA 2E8ZA 1B90A 3AYSA 5ABFB 4DWSB 2WMJA 4WSKA 4OIFA 1FHLA 6TAAA 3LPOA 3MS8A 1GQIA 3UCQA 2XUCA 3IJ9A 1E73M 2O9PA 1PAMA 1KCKA 3CMGA 4J7RA 2YA1A 5KZ6A 2ZXDA 1HXJA 1EDGA 2GDVA 4M24A 3SCRA 4UQDA 1W9VA 3N17A 3OLGA 1BYCA 4JFSA 4W87A 3PTQA 1EHNA 1B1YA 1QI4A 5GPRA 3MMDA 4U5IA 4UFMA 1XHGA 1DWGM 3WEMA 3WNMA 1QBAA 1UKQA 4UFHA 4GZJA 3EBVA 2NT1A 4TX8A 4A3HA 3ZT5A 1ZBCA 2GDUA 1VFOA 1G01A 4J3TA 3WNLA 3W0KA 3AXXA 3QHOA 5GNXA 4OZOA 1WDPA 1NP0A 1I75A 2AMGA 5EMYA 1QHZA 1EIBA 1I1WA 1MVYA 3FN9A 1UWRA 4QP0A 2GJXA 3VIMA 3TTSA 2J7HA 4W7WA 3ZT7A 3CZKA 1R86A 2CXGA 2PBGA 8CGTA 1V3HA 4HPHA 1VFMA 5ECUA 4PTVA 1EO5A 4RE2A 5E6YA 4OOUA 5AC5A 4ZXOA 3OZPA 1H5VA 4J28A 2VMFA 2DSZA 1UKOA 1PEZA 4M56A 2YL6A 2CESA 1GVYA 1XD0A 5EB8A 5C71A 1WZAA 1NH6A 3WEZA 4HZ7A 1B2YA 1H0GA 4U2YA 1ZBWA 2J4GA 2B31A 2J8FA 1KQYA 3QHMA 1W1VA 2VTFA 3W25A 3FHAA 2DH2A 1E9LA 3CZEA 4D6CA 2QMKA 2VX6A 5CPTA 3O9NA 2V38A 3ARUA 5D9OA 3CZGA 1ZL1A 2DIEA 5EFFA 3BCFA 4UOZA 1IZKA 5CPQA 3AMGA 1BGGA 1OGSA 2D2OA 3MUAA 3VIGA 2OWCA 3KZSA 2EPKX 2X1IA 4CVWA 5BRPA 4S3KA 1TR1A 3W6MA 3UERA 5I2UA 1VAHA 3VGHA 2W61A 1JZ3A 4W93A 1CXKA 3MMWA 1RH9A 1TA3B 4DWSD 1EXPA 2ZIDA 4LYQA 2G3NA 3GH4A 4W8BA 1HF6A 1CGVA 4CN4A 2EPLX 3T09A 2ZUSA 2FGLA 2CKRA 2E9LA 3RJYA 5FCZA 1HJWA 5I79A 8A3HA 4HMEA 5I6SA 4DM1A 3M46A 1E6ZA 2Z1SA 3N15A 1XCXA 2VX7A 1E5NA 2DPEA 2UY2A 3FW6A 1U30A 1W9UA 3DHPA 1HN1A 1PPIA 3VIPA 2X0YA 3WN6A 3TTQA 1PX8A 2YL8A 1C8QA 2WMHA 4H8UA 4J27A 3K46A 1C90A 1PBGA 3GNOA 4RL3A 4EAMA 1C8YA 3EDKA 1UZ1A 4DUWA 4UZSA 1CWYA 2WLYA 2BVYA 4B15A 1K9FA 3EMCA 2WKLA 4AIEA 1CYGA 1OINA 2D20A 2D24A 3AISA 3AROA 3WL0A 4ZFMA 4C7FA 1VEOA 2BY2A 3GXIA 2X09A 2BXZA 4LPCA 1US3A 2GK1B 4WF7A 5CSUA 2GFTA 3VGEA 2WZHA 4AC1X 1QHPA 4PYSA 3VUPA 3VDCA 1O7AA 4GXPA 4DUVA 2WMIA 4ZE5A 4UQEA 3VIHA 3T08A 1UWQA 3BLKA 1KXVA 2VCCA 3UG4A 3AXHA 4KRUA 3BC9A 3T0AA 1V0KA 4QCFA 2VRQA 3SEPA 2J7DA 4AW7A 4IUGA 5ABHA 4HMCA 2ZUVA 3VMOA 5M3WA 1HP5A 3W82A 3IJ8A 2CIPA 4HP5A 1IZJA 3UG3A 4TUFA 3WDPP 4WKAA 3VU2A 4Z2GA 3T2PA 1KR0A 4UFJA 3A4WA 3POHA 1AQMA 4CUCA 1HT6A 1CXEA 1FH7A 1EH9A 3MKKA 1QBBA 4KMQA 1KQZA 1VFFA 4P7QA 2WVTA 3SUWA 1ZU8A 3KL0A 4OBSA 4P7LA 1AQ0A 1JIBA 4TTUA 1UUQA 5M5DA 3BMVA 2HISA 2MANA 3K4AA 4AZHA 3MSDA 1LG1A 1A3HA 3OGSA 3SCPA 3VOCA 4W85A 2WHLA 3CGTA 2VT0A 4ATDA 1W9BM 1JZ4A 4JKKA 3ECQA 2JF7A 4GO8A 2GUYA 1K9DA 1VF8A 1ECEA 1LJYA 2JIEA 4IPLA 3MV01 4D72A 2V3FA 2W63A 3VD5A 4E4PA 2X8RA 1BYAA 1KWKA 2J47A 4HU8A 1GJWA 3VTRA 1MYRA 1JYVA 1CGTA 1E72M 3WQVA 1WDRA 3L4VA 1C7TA 1UQZA 1UOKA 3NDYA 2ZUNA 4CD5A 4ZXLA 2FGZA 3B8SA 2CBUA 3ZJKA 1QPKA 4JFUA 2ZOXA 5BXRA 4JZ5A 3MANA 3WL1A 3FAWA 1R7AA 4TVUA 4CKQA 1UD2A 5BROA 2A3CA 1LWJA 2CEQA 4FLRA 1GQJA 5JUVA 3AHYA 2GSJA 4HU0A 1JZ5A 3ZJ6A 2VCAA 3WQ5A 3JUGA 1PX3A 1UD8A 2VZOA 3L2MA 5I23A 2WBKA 3U57A 3O2LA 1KB3A 3K4DA 4H8VA 2JFEX 1OD8A 2WCGA 3RDKA 4AY1A 4GQRA 1GUVA 4HA4A 1QNQA 1EOMA 4PEEA 4MB1A 1E6SM 4UCFA 1M7XA 1G5AA 1XGZA 2BHYA 2WSKA 5A6LA 5HXMA 4HZ6A 4MB4A 3L4WA 2E9BA 1DHKA 2QMJA 1M04A 4KRTA 3CUFA 1W3LA 1BYBA 4JIEA 3SCTA 2W62A 1LLOA 1QI5A 4MDOA 4UQ9A 3VNYA 3MV11
chains in the Genus database with same CATH superfamily
1MXGA 3A6OA 3KM8A 3SGGA 1WAWA 1V0LA 1R3SA 4Z2IA 1MW2A 2V68A 4HNNA 3GNPA 4N4QA 3B9NA 3KE0A 1ZAJA 1JDAA 5DRCA 1QWKA 3WQOA 1XBXA 1X1NA 3BW2A 4JFTA 3NOEA 2KZHA 4M6VA 4MFEA 5A3HA 3EPNA 4LVFA 1ICSA 1KTBA 2QUMA 4Q4KA 3PJXA 3PZVA 3BAIA 3DHFA 2VD9A 1TZ7A 3MP4A 3JRKA 4O8AA 7ODCA 4CNPA 2YCLA 4IMGA 4GCAA 4OBTA 3BL3A 1GKPA 4QNEA 3BG9A 2F2KA 3NGFA 1H1NA 2W79A 1CB7B 1K7XA 3C4UA 3E5BA 1F9CA 1CZ1A 1BFNA 1ZBVA 3M6YA 5AY7A 3KVMA 1U5JA 1L8PA 3P8JA 2B7NA 4FB7A 1W3IA 2YSWA 2VRJA 1DOSA 3IRSA 4E3TA 2PWHA 4ZQRA 4AHPA 2NQHA 1H62A 3MVIA 1CW2A 1ZB5A 2EPNA 4AEOA 3W1LA 1UH3A 2VGBA 2B81A 3W2LA 4JTCA 2FZBA 1C91A 4DEFA 1GHSA 2E77A 1GVQA 3TAKA 2HSAA 2P88A 2NSXA 1U5VA 1AFSA 5T91A 2BGQA 3G1RA 1P6WA 2R94A 2YW4A 4YTUA 1G1YA 3CL8A 3KVJA 1WOBA 3VM5A 4HNCA 1JF6A 2CZDA 4BCEA 2Y6ZA 2DQWA 1B31A 3RU8X 3DECA 4O19A 2C6QA 4GPNA 4D6DA 1KGWA 5CSYA 3CUGA 2WSPA 7A3HA 3WNNA 4Y8FA 4PULA 5T26A 4TVCA 1KFLA 4UOQA 1UIOA 2WHKA 1UD4A 1CGYA 1XIGA 1JYXA 3Q37A 1PTDA 1GGOA 4P7NA 9CGTA 1PZ0A 5D8ZA 1NM9A 3N2XA 3TXZA 5LIKX 1M03A 5JH1A 1OADA 1V02A 2NVCA 2OZTA 5FSEC 5REQA 4IPNB 4B3ZA 2Z7GA 1X96A 4J9JA 1Q7MA 4ZE4A 1OT1A 5CXPA 3KBMA 4HSOA 3E0VA 3THQA 4G6CA 4LUTA 1EO7A 2Y5JA 3TSDA 3SCVA 1LOSA 4PSPA 1JVNA 4Y9AA 4X9SA 3S5ZA 3GG0A 4JTLA 1B30A 3NM3A 2I1OA 3W6LA 1DJQA 3AXKA 3VDHA 3UZJA 1JPHA 3HQPA 3QMRA 2VFEA 3LERA 1XRVA 1UPPA 2IPGA 3MT1A 3LZ5A 1L9WA 1FDJA 2YBVA 3MHGA 2A79A 5LA0A 3H22A 3V4BA 3WELA 3WKZA 1EA0A 2XVPA 1J8VA 1OT2A 1X7IA 4XUGA 4MYXA 3TW9A 1VD6A 1HW6A 4WY0F 3W53A 3WDJA 3S6TA 5CAHA 5A95A 3WF3A 3K30A 4BF9A 3UJ2A 1X97A 3P60A 3CYVA 4O28A 1BF2A 5I00A 1YBQA 3PM6A 3M64A 4ZTXA 4CCCA 2EXOA 1PCWA 3S2LA 5I3KA 1WQ5A 2E40A 2O0TA 1FWRA 2QAPA 4RNJA 3WNKA 3UQNA 1M53A 3TNOA 3IGHX 4XO7A 2QCFA 5C5YA 1J0JA 1XGEA 3FDGA 4CQBA 4M7TA 1D3GA 3CV6A 1UC5A 1V3KA 2OOFA 3GYEA 4HMDA 2J7FA 4HOWA 1TV4A 4GD0A 4C7GA 3TJIA 4ACZB 3TCSA 4O54A 3ATZA 2XWDA 1YNQA 4LOCA 4PUDA 3EKZA 2CBIA 4C6BA 3WD2A 4AD3A 2I7GA 1IR1A 3ITGA 3N04A 1VRDA 2ESCA 3WBXA 4IMDA 1KC7A 3IGXA 5I0DA 3H2NA 5ECVA 4R85A 2QV4A 1J93A 3WO8A 4DHGA 4WSHA 2JKAA 4BF7A 5JQ9A 1H49A 3QGKC 2D22A 1ZS2A 4KERA 4LYRA 1WCGA 2GSHA 4LEFA 5C0QA 2Q8ZA 3VABA 4LVBA 3VFCA 1K7FA 3NG3A 1AMKA 3MCNA 2WMKA 4EXBA 2DGAA 4IISA 4ES4A 4P7OA 5LIYX 3KWSA 7TAAA 1EC8A 4XISA 2HJPA 2VZUA 4LBUA 4FAMA 3S2CA 4TVDA 2QQ6A 4EKJA 2RDWA 1H1YA 2NV9A 3AI0A 5CPMA 3U4AA 3C0LA 2FPYA 3EGJA 4Z2LA 1MXSA 3GZAA 2VZSA 3V1PA 1WBJA 5C9UA 3KP1A 2VGGA 2DW7A 2F8QA 1Q6CA 1JAKA 4C1KA 9RUBA 4D6FA 5HR6A 1OYCA 3CWHA 2QS8A 1OHLA 5KMYA 1NDVA 3M5XA 3ZSTA 4JTKA 5I3IA 2FJUB 2WMFA 3C2RA 1Z8AA 4MY1A 4UXDA 1RA5A 1XV8A 4HU4A 4ICMA 4DJFC 5CJNA 2B4GA 3MYOA 5EL1A 5BCAA 2ACRA 1AH4A 4MIMA 4AD5A 3HOJA 3BURA 3KOFA 4BS0A 3NM1A 1J5TA 4HZMA 3CIWA 2PRLA 1XIFA 4LVGA 2J88A 3M5ZA 2QDEA 1KFBA 1R47A 5D33A 1B3OA 3DBNA 3UZXA 3KBVA 3FVMA 3VMNA 4CU6A 2QCMA 2OO6A 3ZOAA 1IT8A 3EKGA 3Q58A 1V02E 2PP3A 4QJ3B 2XGBA 1EL3A 3U4FA 1OABA 1J0ZA 4H7ZA 3W70A 3OJGA 4C6EA 4L7ZA 4EIVA 5A8OA 5HNRA 2Z2AA 2OZ3A 2OGJA 2JALA 5F2MA 1GPFA 3OVQA 3MKCA 4LUJA 1I2OA 5E0CA 1W3JA 3EDJA 1GZJA 2OEMA 5RUBA 1TZ9A 2XZ7A 1PCKA 1FWSA 4PFHA 4YWIA 3E9AA 5LA2A 1PHWA 4HSNA 1G6CA 1VRXA 4R3UA 3PBMA 3GTHA 4MWAB 3I6EA 4GHRA 2YDQA 2QCLA 2ONEA 2ASHA 1R3TA 1IZCA 1BSLA 5LNWA 3C86A 3W7OA 2QDGA 3EMZA 4YPJA 5K9DA 5HINA 2XH7A 2Y8KA 1BGAA 4Z2JA 1T8XA 3W1UA 1KCZA 1IEQA 3MUIA 3TDFA 4W86A 2NXHA 4Q7NA 4JPGA 2IUZA 5CSSA 2VDGA 6TIMA 2NSOA 2NQZA 4DF0A 5HR7A 1TV5A 2G4FA 4UTFA 1RQHA 2ABAA 3DYPA 2E9MA 4B9ZA 3UZ5A 4JL2A 4LCSA 4L9XA 3ELFA 4M82A 3FEMA 3UWUA 2XFRA 1LLZA 1LLWA 4LY4A 3NQDA 3GXMA 1W91A 3HGRA 4JKMA 3D3AA 4JIPA 3GR8A 5E6ZA 2E5DA 3EYPA 3S1WA 3JVAA 4IOTA 2C14A 1KKOA 4LV9A 3L4XA 5D8WA 1JCMP 3NZPA 3S9ZA 1K3UA 3MU7A 2QJGA 3SM0A 1OG6A 2FHFA 4MVAA 5LSMA 1V3MA 1KM4A 5FL1A 1O95A 4W88A 2VZTA 3WUGA 2OSWA 3LNMA 1XWYA 5H6HA 4ZBCA 3LBMA 1RXOB 3CASA 3O6AA 3EDFA 4ILSA 4NAEB 1H63A 1MDRA 3WBYA 4HYRA 2G5WA 3LRLA 4DJEC 3SAZA 2J6VA 1O12A 2R14A 2BFGA 3S6OA 4R34A 3PG8A 1PIGA 4EPKA 1UH2A 4KH2A 2CLFA 2RHGA 4HU3A 5A2AA 2HWGA 4E2BA 3AIWA 2X40A 3VNLA 3S1VA 3H55A 4LVDA 2REQA 4GI9A 2V63A 5IHRA 3R13A 3A22A 4MWAD 1W1YA 3IIPA 1MQQA 5CBIA 2GUUA 2NWRA 1E5JA 4PBEA 3WF2A 1CLKA 3QTGA 5ABTA 5HJXA 4O53A 2J24A 3A4AA 2A5HA 3YPIA 2C8NA 2OX4A 5DEZA 2FQIA 4ENLA 2ZICA 4GX9A 3M6DA 2R1NA 2E1WA 2QPSA 3AIUA 2DZBA 4Y9PA 4UR9A 3OG2A 1B4KA 3FKKA 1ZFJA 3FXYA 3BLDA 4IWWA 3B8TA 2VX4A 3C2YA 4AWEA 2ABBA 4AEFA 1PX4A 4B16A 2YA2A 3GLCA 1WDSA 1SFJA 1W9DM 3HPAA 3E02A 4PMXA 2GVLA 3WIJA 4P5UA 3CAQA 2FZ9A 5CGQA 3VOIA 4C6DA 1JD9A 3CK5A 4P7RA 1NF0A 1FP9A 4BWLA 5E93A 3H24A 3KOYA 1Z7AA 3VD3A 5FOOA 2G3IA 3A21A 3SCNA 3KCLA 3BOLA 2QUTA 1FWWA 1XICA 3M41A 1V6YA 2VDIA 4GIEA 4UWMA 1LOLA 3F4CA 5HPCA 4TMBA 3E2RA 4KCTA 3E0IA 3V16A 1IT7A 3STFA 4L6HA 3UP8A 4RLIA 1NFGA 1XIJA 3OG3A 5DXXA 2IQDA 3WLRA 1J11A 5K2ZA 1F7BA 1R9XA 4IQDA 1NF7A 3VGGA 3EXTA 1EZ2A 1F07A 4F9DA 2OZ8A 1KXHA 3ISIX 4F2BA 3UETA 3QV9A 2MUCA 1X6NA 1H5YA 4QQ3A 1GG0A 4UTWA 1LP6A 1V8EA 3AYRA 2H8ZA 1YMYA 3WQWA 4IXHA 5GQBA 3TC7A 2W3ZA 3OW1A 3NZGA 4HT3A 1IGWA 3GBDA 2PWVA 4URIA 3BJSA 1TIWA 3WD1A 2ZBTA 3ID7A 4AWUA 1VFHA 3DG7A 1E0WA 4DBWA 5M1TA 2WM0A 3SCUA 3U2ZA 2Y89A 1LZOA 3WQDA 1SR9A 3WSUA 4GQQA 1DQWA 1MUCA 1TJPA 2P50A 2W4XA 3Q45A 4Q4RA 1TYGA 5E70A 2VR5A 4A3YA 3F4WA 1O94A 3N6QA 3WY1A 2ZX9A 2VUYA 1A0CA 3LGDA 4H9ZA 2E5BA 4TO8A 4I5RA 4ORIA 1EBGA 2WVVA 4LB4A 3VIFA 4A29A 3Q67A 3WLQA 1V3IA 1XCFA 3FNDA 5L6UA 4A3RA 3IWPA 4M81A 1UR1A 2HK0A 3D0CA 5C2XA 3L67A 4LEQA 2J8TA 3KOWA 3FLUA 1GOQA 2DZSA 4MAVA 1AUSL 1OVDA 1VBUA 3ALFA 2G95A 1PTGA 1ZJAA 4AYSA 2HS6A 1O5KA 4DJDA 2VFFA 3E5PA 3DKJA 4J2MA 4E2VA 7REQB 4F0RA 3EX1A 3S42A 2E4TA 4E8DA 2HXTA 1EJVC 4AC7C 1LF1A 3OU8A 3GXDA 1K70A 1Z89A 4LQ1A 5AZ0A 3RU6A 3HQ1A 1FUYA 4MNKA 1JL8A 3BVJA 4CQDA 3G0SA 4DPPA 2YFNA 4ZOCA 4HHPA 4PA8A 4DUOA 2QDDA 5M17A 3FHQA 3QRHA 1OX4A 1EQPA 3CEPA 1O5RA 1NWUA 1W56A 4QISA 1N8IA 2D1ZA 4I9JA 1QO5A 1V5XA 4N02A 4BI7A 4G7FA 3TYZA 2OU4A 4L4PA 1ZSXA 3H12A 5LNVA 1OX6A 4MNLA 3VZXA 1ZJBA 2XSBA 4E8CA 2PLCA 5GJMA 2G50A 3L0KA 2PF0A 1LWHA 3QVQA 1V6TA 3ATYA 1ME9A 3INPA 4F0KA 1XLIA 3GR4A 2YX0A 3LG3A 4YYCA 1UH4A 2Y2WA 4D1JA 4JTDA 2QV5A 3IUIA 1Q7QA 2P3ZA 1PL9A 2X05A 2OCZA 4BQ4A 2PDUA 1TPB1 1TMQA 1D7FA 2DVTA 1NEYA 3AS1A 4HK5A 4ERGA 1UMYA 3SDOA 2GJRA 3PPCA 5AOUA 4FLOA 1DE6A 3NQ6A 1Z32X 3A3XA 2A3EA 2ZX5A 3B04A 4M5PA 3PUEA 1IEVA 3N9SA 4I6VA 3AMDA 3AICA 2ZADA 2PMQA 3GIQA 4GQGA 1TTIA 1OYBA 2AAAA 1EGZA 5BOFA 1XYLA 2V2HA 4PE8A 1UUOA 1G7UA 3VMPA 1EDQA 5DRIA 1CBGA 1XUZA 5GNZA 4KEVA 4H9VA 3SO7A 2UY4A 2BP1A 1LBMA 1NWSA 4J3XA 3SJNA 1JPKA 5JMUA 3A12A 3BPWA 4XBJA 3L2IA 3LHWA 2D2HA 1XC6A 2WMIB 4XV0A 4A3UA 3F03K 1GOWA 4X61A 3UXDA 3CHCA 3AU6A 1DTUA 3S6DA 4DXKA 1GEHA 3BW3A 1X1ZA 3TNBA 4UMAA 2QJNA 4XVEA 2YIHA 5DT5A 1ENUA 4FX7A 4RXGA 4NZCA 1J9YA 4J35A 1SQ7A 2DUAA 4EF9A 5HMFA 3CUIA 4Z0JA 2DEPA 4XZHA 5DMYA 5AHEA 1RQBA 4AF0A 3U2CA 3UJFA 2I9EA 3LTSA 4QJ4B 3N2MA 3H7VA 3UT0A 3GDKA 3STGA 3QPEA 4RXFA 4PUJA 2CZVA 1VCFA 3N14A 2ON3A 3FXGA 1MO0A 4S2CA 2VL4A 2JF6A 3LSBA 1WB0A 3S83A 4W84A 4FI4A 4EANA 2I9UA 2PI6A 4R27A 3KRSA 2POTA 4MDPA 4WVXA 1I1XA 5BXTA 4Q7BA 4JEQA 4MUZA 4RX0A 4PTXA 4AHQA 3EWBX 4F9JA 3L4ZA 2ZX6A 3PHAA 3WBWA 3K8KA 1JG9A 1I9CB 4GLEA 2PA6A 1G4SA 3MKVA 3DG3A 3MJYA 1BG9A 2PLJA 3HV8A 2NW0A 1QNRA 3P5YA 1MUWA 3MUZ1 4H4IA 3W37A 4DZIA 4N42A 1FWIC 5A8QA 2O9TA 4QLLA 4FXJA 1BQCA 3SGZA 3P0XA 3PG9A 4QAWA 4BKNA 4B5SA 1BAGA 1ESWA 2H9AA 1ADSA 3U6WA 3R0DA 4AFYA 5D32A 3MMUA 2C0HA 1FA2A 4JGDA 3LI0A 1IWPA 3P81A 5G2WA 1Q4NX 5JIWA 1GQNA 4LBSA 4PMRA 2EG6A 4W7UA 2ANUA 1F3TA 3S46A 2IPJA 4PFMA 3EXSA 4LX4A 2G37A 3I7QA 1XUUA 4P8UA 2ZRVA 3NQMA 1QU4A 3IIVA 5I3GA 4QFUA 3U7BA 4MAZA 3UBPC 1OGGA 1MMFA 1IXQA 5C2GA 4MY9A 2HRWA 5AVNA 3RNDA 3TUUA 4C6FA 3KBJA 1FHUA 5CLWA 3AU2A 5B7ZA 5DF0A 5CZJA 1XBYA 3RFAA 2E7FA 3SURA 1L6YA 4ZA0A 2BXVA 1IHIA 2BLEA 3AIEA 4ICNA 1W2PA 3GU1A 1R9YA 3KW3A 3AJ7A 2EPHA 2F6KA 2CFFA 3SCQA 1P0DA 5I02A 4WJ8A 4L61A 2ZC8A 4XD6A 4TMCA 2WKJA 4JXCA 3LZ3A 1W9PA 4QE1A 1X39A 4LF1A 3TIMA 4PL1A 2YXOA 4AZGA 1FWDC 4NZFA 3DI1A 4H83A 2A4AA 1FCUA 1UD5A 1PDYA 5K9XA 1Q65A 4DXXA 3GHSA 2XINA 5FJIA 2V3GA 1Q45A 1Y5VA 3O1NA 4M51A 3B9EA 2YCLB 4LGXA 1CPUA 2BGSA 5DBUA 2PDGA 3W76A 2EJAA 3QKEA 4BY3A 1GJPA 3AYSA 3N4EA 1HKWA 1WUEA 2CC0A 1SJAA 3QFWA 1RY0A 3OEXA 4CLMA 3N2BA 5FF0A 4FXSA 1GQIA 1YDOA 3VOHA 2O9PA 4WUIA 1FWNA 5KZ6A 5EMKA 2ZXDA 3WLIA 1XPYA 4MY8A 3MW7A 4I7WA 1TTPA 5D2WA 3SCRA 3WJYA 4NZ1A 2CWXA 1BYCA 4JFSA 3W1MA 2PU0A 2V9DA 5JU6A 3QR0A 1XHGA 3WEMA 5G4EA 1UKQA 4E6MA 3HPXA 2VC7A 3TN5A 2I56A 2NT1A 3FA5A 4TX8A 2HVNA 4WGXA 2FB2A 4XKMA 4MJZA 5GNXA 3D6NA 5C7VA 4PCPA 2GUBA 3LGEA 4OZOA 1WDPA 1I75A 4B2DA 3M4HA 2O7SA 1J4EA 3KTSA 5EMYA 2QUUA 1I1WA 1TJ2A 1W5MA 3FN9A 5EBUA 3EB3A 4QP0A 3W1TA 4HKPA 1MUMA 3C8NA 3ZT7A 1S5MA 3CZKA 2CXGA 1LBFA 2IMRA 3B8WA 1VFMA 4GIYA 4PTVA 3C56A 4RE2A 3TYEA 1S2TA 3ITCA 2DJXA 4JN6A 2YL6A 3CPRA 1XD0A 5EB8A 4F40A 4HZ7A 1B2YA 3NR0A 5REQB 3MHUA 1H0GA 3V7PA 4NT0A 3TMLA 2XISA 1Z3NA 3W25A 3FHAA 2DH2A 3ITYA 1E9LA 3CZEA 9XIAA 3KZPA 5C9ZA 4IGMA 3CT7A 5HJLA 2Q6ZA 3O9NA 3GDLA 2V38A 5D9OA 4ZOBA 1RSCA 3ONCA 4GYKA 4PRTA 3BCFA 1XFBA 2VEFA 4AYGA 3A9IA 1XISA 1I2PA 1OGSA 4AY8A 3VZYA 5JVLA 4G7EA 4K7VA 4I6KA 3NO3A 4IIFA 2NLIA 5BRPA 2DZVA 2CXEA 3THAA 3W6MA 3UERA 3VC5A 4KFNA 3V5CA 1A5CA 4R7WA 4KS0A 3EX6A 3MMWA 1TA3B 3B05A 1EXPA 4YLWA 2G3NA 3GFXA 1CGVA 4IGNA 1L6SA 3PPHA 1YBQB 3T09A 1MZHA 1VKFA 2E9LA 5FCZA 3E0WA 4US5A 3N6HA 3WK1A 1S5WA 5CCZA 2Z1SA 2NQJA 2VFDA 3L5MA 2V67A 1OFRA 3N15A 4MWAC 3AAMA 5CAKA 4AX7A 1U30A 1TREA 3OO2A 2NUYA 3W01A 2BASA 3U3HA 4IFOA 3TTQA 1PX8A 2YL8A 1UP2A 3N19B 3ITOA 3UF9A 4H8UA 4HJWA 5D38A 3K46A 1PBGA 3GNOA 4RL3A 4AUBA 1C8YA 3E0FA 1QWGA 2BVYA 4GISA 1XLLA 3DZ1A 1ITQA 3H23A 4RPQA 5LNSA 3F2BA 1VP5A 4AIEA 4UMBA 2D20A 4QHRA 4LPCA 1KTNA 4Z1BA 4WF7A 4ZODA 1LUCA 3SRDA 3DESA 1QMLA 1KM5A 4GXPA 4GG9A 1QXLA 1QR7A 4H7CA 1YLVA 1F5ZA 4JTAA 2QCNA 1KXVA 3RX2A 1AH3A 1L2UA 3IS4A 3DFQA 4QCFA 2VRQA 4XK2A 1K8ZA 1S1RA 1DORA 1DIOA 5M3WA 1TVLA 3IJ8A 2X2GA 1DBTA 2W9MA 3GXPA 2AKMA 4A2SA 4EVZA 2GVEA 4MZ8A 1RJRA 3W7GA 2DZUA 1H7OA 3T2PA 1KR0A 2R1LA 3POHA 2IKGA 3SN4A 1EP1A 4LNYA 4LVAA 3BJTA 4LWWA 1PE1A 4UMCA 5TQLA 4KMQA 1A5LC 1KQZA 1S2CA 3B8DA 1ZU8A 3KL0A 4P7LA 3CWNA 1UUQA 2IW0A 4UIOA 4M1BA 2HISA 4AZHA 3I4KA 1EJRC 3IJLA 1XRSA 4KIEA 3PC0A 2WHLA 4ATDA 2VT0A 4DBUA 2JF7A 1SO6A 4GO8A 1VF8A 5D37A 3U0HA 1KCXA 2JIEA 3MV01 4D72A 2V3FA 4YNGA 3VD5A 2AQWA 1UP3A 4E4PA 2QW5A 5HJYA 4WDUA 4GA8A 1BYAA 3DU0A 2OKOA 3GVVA 3AWNA 4MZYA 4FNSA 4WDWA 1J2BA 1F05A 3PBUA 5BU9A 3VNKA 1WDRA 3RG6A 4F2TA 2NLYA 3L4VA 2NQ9A 1C7TA 2WQPA 1JQXA 3UR2A 1J6OA 1EKOA 5CPOA 2WNZA 2FJKA 4B5WA 4M3PA 5BXRA 3WL1A 2TPSA 3ABRA 3GHTA 3O6DA 3PS7A 5BROA 1LWJA 4KWWA 1GQJA 5JUVA 3NQFA 3H21A 5T9BG 5IRPA 3O05A 2WBKA 3U57A 1NFPA 5HANA 1KB3A 3OVRA 3K4DA 4H8VA 2JFEX 3RDKA 1VLWA 1XLDA 5FF4A 4O1FA 4UCFA 1M7XA 3P80A 1LQ2A 4Q6JA 3V5FA 1I0BA 2E9BA 2ISWA 1M04A 2O56A 4JTJA 5HMDA 1QI5A 4UQ9A 4UTTC 2QULA 4I9AA 3VNYA 3PTMA 3SUUA 4D2JA 5KZDA 4BF5A 4BI5A 1HKMA 2A6LA 4NJIA 4GUHA 4OBRA 4JX4A 1VZWA 1Q6FA 3MCMA 4DO6A 5H8PA 2CYGA 3UXAA 3CHVA 3CQIA 3NZ1A 2ZE0A 3T81A 3BE7A 3PULA 4PUEA 3HJEA 4DX3A 5HAOA 2AGKA 1I2NA 1VPYA 1AMYA 4N7QA 3CC1A 1I45A 3RR1A 4S3AA 3G0UA 3SR7A 5FEXA 1MI3A 2VCBA 1BWLA 5PTDA 5XIAA 1KV5A 2O9OA 1R2RA 3GW0A 4PMJA 1RJPA 4O0KA 4UOJA 1UR4A 3F2CA 3I10A 3PVFA 2WHJA 4PTDA 3OIXA 1ISYA 2F84A 2Z29A 4GQ0A 2AOSA 4MNMA 1VFUA 1VIZA 3I3BA 3R2GA 3HG5A 3PZGA 1H1ZA 1H11A 1A50A 4YVXA 3ABZA 5ABFA 4OUEA 4DWSA 2Z1KA 4HA0A 1JYNA 1E15A 3JZEA 2B7PA 2C71A 2HDJA 1XH2A 3CIXA 2OYLA 4TR9A 3L0NA 1UC4A 2OT0A 2GGIA 1AJ0A 4HPGA 5AFDA 4IXXA 2PWUA 4QEHA 3GDRA 3GC2A 4D8AA 4LBRA 5A2CA 4U2ZA 3C2EA 1O1HA 2WPBA 4QLJA 3NEHA 3LV6A 2REQB 2HBVA 3QSTA 2PWEA 3W3OA 4LB3A 1CI1A 3TA9A 4NL1A 1XJBA 4XZIA 4P8XA 3NO5A 1NSJA 3W07A 3F2DA 2WJEA 4GZEA 4YWSA 2E6YA 1VHNA 1A80A 3IAPA 3KL3A 1CXLA 4O50A 1F76A 2HPMA 3M16A 1S2AA 3KP0A 3MSGA 3NDOA 3MHFA 3O16A 1EGVA 3SBFA 1TE6A 4MNJA 1AQHA 1LL4A 4GVGA 2XIOA 4JYDA 3VILA 3PAOA 2YB4A 2XFYA 3A3HA 4A8IA 3QN3A 4WIWA 1GHRA 5HUOA 4Y9OA 5AYZA 4ML9A 2Z0IA 3GVGA 1EUAA 1TWWA 3V1HA 3O63A 3CTTA 5GJPA 3NSMA 2DV0A 3I4EA 4LFYA 1EJ7L 4RJEA 4O12A 2ZZ2A 1H09A 2C91A 3RJXA 2NXIA 1TSIA 1VQTA 2CZEA 5I77A 5L9FA 1AD4A 5F1VA 2XSAA 2CBJA 1IR2A 4KWUA 1B3XA 3GYCA 3LK6A 4GINA 3DGBA 3ZO9A 4GXWA 4UC5A 3ZWSA 3O06A 2B0MA 5CPSA 4J40A 1W2VA 1YE4A 4C6CA 3LHTA 3WF0A 2OQYA 4PTWA 3PR2A 3QY6A 1KM2A 1SZNA 1Z44A 3VX0A 5AHNA 4WJEA 2Z7KA 1DWAM 3WNOA 1YDVA 3WF4A 1V3LA 5AHIA 1UBPC 3PZTA 2UV8G 1JZ7A 4MKSA 3GUGA 4KGLA 4O10A 4IQEA 3KWXA 4PN2A 2E1DA 3TK7A 4JTUA 5FJTA 1ZPTA 4TIMA 2OSYA 2QJHA 4A2RA 1TUXA 3L2LA 4IM4A 2P53A 4EACA 4S3FA 2J74A 4MM1A 3GNNA 1SZRA 1KRMA 1EZWA 4PMUA 2GPTA 3HU7A 3MC5A 4KIRA 3DOPA 4OU1A 3TYBA 1GONA 5AC8A 1KBLA 1J0KA 3QYSA 5D9NA 3MVTA 1EP3A 3GQYA 2WB5A 1VB9A 1C9DA 3E38A 4V2XA 5LKYA 4CCZA 1SO5A 4KEZA 4XWUA 3MDWA 4D8LA 5I06A 3OVGA 1U1JA 1M6JA 1PDZA 3ZR5A 3CAKA 2IQTA 3T40A 1FX6A 3VNZA 3GVQA 1JZ8A 1IYXA 1H7NA 3APGA 3ARTA 2QYGA 2VURA 3AYTA 4LNCA 2O4MA 2WVVB 1SFTA 4JDYA 3TN4A 3NL2A 2PWGA 3TKFA 3ZFHA 1LG2A 1POJA 3W7PA 3SUSA 1IXOA 1WUFA 2YXGA 3ZT6A 1SGJA 4DUXA 1RVGA 4Z17A 2QCHA 1WXJA 5BYWA 3TX9A 1H7PA 1OY0A 4RE3A 4OTKA 3QEZA 3STPA 2XYLA 5KITA 2BY3A 2J77A 3VE7A 3WDQA 3MMTA 1KCLA 3V0UA 1TCMA 1JPMA 2WANA 3SN0A 3N2OA 3AXMA 1YPIA 4MLJA 1RV8A 2G8ZA 1PS9A 3PZUA 1MW3A 4MF4A 1T5AA 3DKLA 4ASTA 3AWOA 3OLIA 2XN2A 4UTIA 1O4UA 4PH6A 2R1MA 5C2CA 2QCGA 4NJHA 4K68A 3IIXA 2PGWA 3FKRA 1A5MC 4DPQA 1OX4B 2WYSA 4LC8A 3M07A 5FIPA 1SW0A 4HNLA 1QW9A 5AYYA 2PDNA 4FXFA 3UCCA 5G1TA 2ZCGA 1FCVA 1O5XA 4CD7A 3H4WA 2JK2A 4NJJA 4ZGYA 1UASA 1XLKA 1L8NA 5CGTA 1BWVA 1W1PA 4MJ4A 2X7VA 3WD4A 4D6GA 3POCA 3KEHA 3HO8A 3EDEA 1VBRA 2XZ9A 3GG8A 3BGJA 4C90A 1Y8BA 3W2MA 1KR1A 3IJQA 4GUJA 2EBNA 1BXBA 4POCA 1J5SA 2FB3A 2ZWZA 3H7RA 1S39A 3T0BA 1HL9A 1V79A 3WJXA 3EXRA 1QI3A 2ZRWA 3N4AA 2J9XA 2Q71A 3OA5A 2HE5A 4M19A 3M0YA 4DJFA 3BDKA 5D9PA 4NXSA 2JBMA 2OO0A 3NQAA 1ICQA 1JFXA 3MA8A 4LAMA 2VQUA 4OT7A 5C9XA 4Q22A 3S5YA 1ZCCA 3RCYA 3XISA 1OBAA 1MNSA 1FCQA 1KM3A 3GXFA 4FSAA 1FWHC 3VKDA 5J04A 1KFJA 3BAXA 4FF7A 3WLKX 2PZNA 1WNOA 1EHAA 2E8YA 4ZO9A 1REQA 2GJNA 1ODUA 2YCIX 3W87A 3S8HA 2A2IA 4EPDC 4Q8WA 3T44A 5M2FX 2PDHA 3HB9A 3VPLA 4PB4A 4Q3MA 4L1XA 4W5ZA 2AMXA 1RLDA 4HD5A 4U4MA 1NFBA 1KBJA 2PDLA 4RV3A 2R8WA 3LYEA 1QDSA 1H3GA 1M9HA 2XVGA 4M1RA 3BICA 5EPDA 1VJIA 3CV7A 1CTNA 5CLTA 3TP4A 5EGRA 1JCJA 5A6AA 4QGCA 1SW7A 2QZRA 3PN8A 5FD0A 5AC6A 3LHYA 4IFKA 2ATMA 2FTWA 2XIBA 3FEQA 5HQLA 2PCEA 3LGGA 1NIUA 4ATWA 4CGTA 3SZ8A 3LRKA 2D3NA 1BEUA 2E6DA 1BKSA 3PPFA 4XZWA 1AH0A 3AHXA 1NOWA 3WUFA 1OM0A 1EWEA 4XZBA 1CXFA 5FJOA 1BG4A 1SW3A 1L6FA 4AF0B 4CEUC 1BVZA 1W3HA 3WF1A 5FL0A 4CQCA 3EWWA 1XDLA 1DJZA 3GM8A 4PB3A 1D8CA 2XVKA 4S3EA 4GJ1A 4E38A 3OODA 1THFD 4U5KA 1M01A 1D7KA 4H6RA 4QE4A 4RK8A 3SECA 2VXNA 5DXYA 3G5EA 1A5UA 3DXIA 4GZ7A 4AQLA 4O0QA 3ABQA 4AD2A 4RDYA 2VEKA 2YYTA 1OZQA 4C6KA 1AL8A 2WBGA 2C1HA 2GJLA 4HZ8A 3KLKA 4JAWA 2A0NA 4JIRA 5GVJA 4AG0A 2WAGA 3JW7A 5EY5A 1E1EA 3W2JA 1PKYA 3W28A 5M03A 2ZUUA 4NP7A 1XM3A 3KHJA 2ISFA 3RILA 1XLMA 3O0KA 3F4VA 1AZ1A 1W37A 4Q33A 5B7YA 4Q8MA 3IVTA 3NYZA 3TN3A 4HPNA 1EJUC 3LMZA 3NXLA 4PBGA 3UG8A 3FVDA 4HIBA 3NPXA 4RR4A 4B5TA 4CU8A 1B3ZA 2H9AB 4HOZA 2VYOA 4PGLA 4DBDA 3R4IA 1TKKA 4IFRA 1Q7ZA 4DLMA 3BUVA 4AD0A 4ECLA 1JF5A 4MTVA 3BJFA 4QROA 3BLOA 1H50A 3CZLA 4DNHA 2PWDA 2BOFX 2EHHA 2EPOA 4NIRA 5BOOA 2ZFAA 3TU9A 3T78A 4DJEA 1OZMA 1OK4A 1RD6A 4AISA 1RR2A 3IAQA 4BK9A 3EZ4A 3UR8A 3EA2A 2IKIA 4WCJA 3VDAA 1ZBKA 3WJWA 3KBWA 4QIUA 1EP2A 4PSRA 4PUNA 4H9UA 4FS9A 1FOBA 1VLIA 7XIMA 5F4SA 2EG8A 3MSRA 3TC6A 1U83A 4JFWA 4UNLA 2GQ9A 4DELA 1A5SA 2BWGA 3EB4A 3NJ3A 3E96A 1E1CA 1H7XA 2YDAA 1VFTA 3QGVA 2VEIA 1BYDA 4IIGA 4S3GA 2WWDA 4CQ8A 3WMBA 3AQUA 5D4YA 4P8WA 3SY1A 3L21A 5CC3A 4GIRA 1HJXA 3Q65A 2FDMA 2WXDM 2YL5A 4ZVJA 1XYMA 4N9EA 2PUZA 1AK5A 3GUWA 3DIPA 4D1IA 3WQ6A 3AMLA 2CLKA 4WOZA 1FWAC 4YU1A 1TPH1 4B4FA 1TVNA 2CHNA 4AIBA 3PP7A 1P4CA 1LL7A 6XIMA 3PZ9A 3UVIA 3MWCA 3CU2A 2PLMA 1DXFA 3GTIA 1D8WA 4L9YA 3W75A 1JNDA 2BTMA 3WJZA 2VOTA 4AVNA 1KW1A 5CSRA 4XKYA 4GBDA 3VNDA 3RM4A 2G4JA 1W9XA 3NNTA 1OFDA 1MWOA 3CWOX 3TCEA 4GYPC 5EMUA 1K1DA 1HX0A 3G1FA 1VYSX 3WJSA 5J8LA 4D6JA 1A47A 5CGMA 3UPWA 1K7EA 4ACYA 1MFUA 4IH3A 3MZNA 1WXZA 2RGMA 1SM9A 1R6WA 3B0XA 1UG6A 2X41A 3WFLA 1DJYA 3C8FA 1FY6A 2EAWA 5T9CE 1VBGA 1JDDA 4PCSA 3DFYA 4MUPA 2GGHA 3AJXA 4ADTA 3LENA 1CGXA 2BVWA 5EU9A 1EBHA 1TV8A 4UZUA 1L0PA 3ABOA 2ZVRA 5ABGA 1R3VA 4LS1A 3P0WA 3CB3A 3UWYA 3N25A 4DN1A 8RUCA 4WZHA 1EC7A 4H9TA 3VKAA 2J8GA 1S5VA 1ZCOA 5IFPA 3T0CA 4CNUA 4A21A 3AS0A 1F4AA 5DMNA 2JEPA 4U10A 1ITCA 3VM7A 2I16A 1U22A 4IPIA 3AHVA 1JUKA 2VVNA 4HN4A 4NI3A 3HPSA 2OEJA 1LBLA 3AC0A 4H9MA 1D2KA 3R89A 3FYPA 5KSWA 4ZB5A 4GUIA 4UNKA 5LGXA 1XYFA 3U7VA 4XIMA 1Q6QA 3ONBA 3EWUA 2VRKA 5HMSA 4NZ4A 5F7UA 1XIBA 2GGEA 3H8AA 2GZXA 2ZWYA 3QOKA 4G7EB 2GWGA 3QW4B 3NVTA 2DSWA 1JD7A 4XD3A 3K13A 1VIWA 4YVVA 3WMLA 2QIIA 4JL1A 1QNSA 2QGYA 1PJ9A 2WMGA 1E0TA 2Y7FA 2J25A 2XFFA 3KVKA 1SMDA 4DYEA 4W89A 2G97A 3L4TA 1Z6KA 2WV8A 3ALGA 3B0UX 3G1VA 2X7WA 1PZ1A 1E56A 3EWXA 4OHQA 4FMVA 4GQBA 4LYPA 1KGXA 2Q3RA 4Y7EA 4H7VA 2CLOA 3AUJA 2V82A 1WE5A 4QSFA 3QHNA 2X2YA 1EDTA 2E5CA 5K3VA 3NQCA 5A1AA 4F66A 5TNVA 3B0YA 3DGRA 4EE9A 2Z27A 3IV3A 3GH7A 3TOPA 1UUMA 4C65A 1SR0A 3LPGA 3WD0A 2ISDA 4NUWA 3G1YA 1J01A 1BVWA 4C60A 2FH6A 2VEGA 1E71M 3ENLA 5LGZA 1BRLA 4G9PA 3UPMA 3KRZA 5E0FA 1NDWA 2ZA3A 4B2DD 2ZYFA 1XBZA 5CG7A 4I7UA 3GVRA 4QS6A 1RBAA 4FLSA 3SCOA 4HTBA 1KV8A 5K4XA 1K4HA 1LUCB 3N29A 3W1AA 4C6JA 3LY0A 4X0VA 2D23A 1OK6A 1J96A 3DBPA 1QVBA 1WV2A 1E51A 3P74A 4Y2WA 2ODOA 3SIMA 2XJ7A 1YTEA 1XYZA 1Z41A 5FF3A 4GJJA 2FVKA 2RH9A 3PBVA 4ZENA 1KBBA 3WNPA 2PGEA 3QJAA 3NL5A 5IHSA 3EWCA 1WKYA 1K03A 3FJ4A 3W22A 2DUXA 3W71A 1P7TA 4JNYA 4LAOA 3P67A 4JDBA 4A8LA 2FH8A 1CXHA 2DY3A 2QDHA 2VFGA 3ZXWA 2BVTA 2Z00A 1UWUA 3WH9A 4CN1A 3NQ8A 3VOGA 3O07A 1J2WA 4L1GA 2OWWA 1LRTA 1CGUA 5AYBA 3MY9A 4H8HA 5D03A 4DI9A 4UBPC 4KF1A 1K8XA 2FFCA 2F2HA 4JNZA 2XIJA 2GGGA 2R24A 1WZLA 2P76A 3FY1A 5I3JA 1PO9A 4AZ6A 3DAQA 3IJDA 3VIIA 4B5VA 3EAUA 1E40A 1CNVA 3CHEA 4JCMA 4HGXA 2NX3A 1R38A 1NWTA 2ZUMA 4UQAA 1FXPA 1S3HA 1UKSA 4V1YA 4FNUA 2C3ZA 3PSVA 1ISVA 3UYIA 4AY7A 1FH9A 1DPMA 3KOXA 3TSMA 3BV4A 1IV8A 5H91A 3R8GA 3IJ7A 1FHVA 3L4UA 2ACSA 3KDNA 3VINA 3GWQA 3CQKA 3W2UA 1B3YA 4XO6A 1BTMA 2SFPA 3CAWA 4AH7A 4L56A 4H01A 3VDBA 3WG6A 2TAAA 3MBDA 1QK2A 5AZ1A 5H2ZA 1FDZA 2CKSA 1A5OC 1RBOB 1BF6A 1O1ZA 2QCEA 1OC5A 2VWSA 3FGCA 1RZMA 1BLIA 2FVLA 3C0QA 2WC7A 3BZJA 1OCQA 1R3WA 1N8FA 4RUBA 1D9EA 3LV5A 3T2OA 3W1RA 1Q85A 4HCLA 4QLKA 1W1IE 4ZQPA 2CPUA 4ZR8A 3APTA 3I7SA 2DVUA 2PDPA 1VEMA 3BMWA 5BOEA 2DIKA 1HQTA 4YTSA 3QKZA 4K2SA 1YYAA 2V5DA 1P48A 1SVDA 1UR9A 5CPLA 3VGBA 3ZM8A 5KZMA 4B5UA 5FKYA 1Q6GA 3QR3A 2PFHA 2CCRA 2Y63A 1OIFA 5CQ1A 4E0CA 1B3VA 1HGYA 4L4OA 5AC4A 1KNWA 3LRMA 3PF3A 3WLOA 2HZGA 1JFHA 1JCTA 3KCOA 3R6IA 1L6GA 3N12A 4KW2A 4KWOA 3QW3A 3LDVA 1DE5A 3NUKA 3SUTA 1F8MA 2WPGA 4ZB0A 4XIAA 3VKBA 5MKGB 3JZUA 4RZ4A 1GQKA 2J79A 3LPFA 3CQ0A 1KFWA 2GVGA 1YXCA 1X38A 3PAJA 3CO4A 4O1DA 3DUGA 1GKRA 2J7CA 2R6OA 3K2GA 1QNVA 2Y7EA 3VCCA 3NPVA 3UJSA 4DI8A 3FS2A 3ZS4A 1FH8A 5KTLA 1GVEA 1WDWA 4S39A 5ABFB 4ZSTA 3MUCA 4DWSB 2RJHA 1X6UA 3IRDA 3UCQA 3ORWA 1E73M 4AMAA 2BOEX 4J7RA 2FZMA 3V75A 1HXJA 4M24A 1TWZA 2PZ0A 3N17A 1QOQA 3PTQA 1B1YA 3QSRA 4DRSA 5GPRA 4K1GA 4UFMA 4JQAA 4FNPA 3O6YX 3EBVA 2DP3A 3M1ZA 3S5OA 3C2FA 4A3HA 4DIAA 3PB2A 4JHMA 4S3BA 1SZGA 1R2TA 1RVKA 1SO4A 1VHCA 4MG4A 2GDUA 2P8CA 1VFOA 3QBUA 4J3TA 5C9RA 4FA3A 3AXXA 3QHOA 1W54A 1DQXA 4UCGA 1EJXC 4YYFA 2HBXA 3XIMA 1TQXA 2EKGA 3IPWA 3QMTA 2P8BA 1MVYA 1UWRA 3P62A 4Q8NA 2GJXA 3VIMA 3TTSA 2Z1XA 2V81A 3WLNA 8CGTA 1V3HA 1XYAA 5ECUA 1EO5A 3RF9A 4OOUA 1T99A 1Q6RA 3CTLA 2DSZA 4M56A 1QJWA 1WZAA 2R9RA 3DEQA 1LOQA 3WEZA 1DIKA 2FTYA 1K4GA 4X63A 4KCWA 1KQYA 1XIIA 5GJNA 3C2VA 3HA1A 2VTFA 3G24A 3MYPA 1AW2A 4D6CA 3CL6A 3KFTA 4M6PA 3ARUA 3CZGA 4NJKA 3M44A 5AKQA 1IZKA 4LT9A 4HBKA 4PZVA 4ICCX 1DIEA 1LQAA 2PRHA 1YADA 4RDVA 1ELSA 3NAVA 4OUIA 2DUZA 2Z2UA 2OWCA 1L2QA 3EOOA 3W7CA 2Z28A 2Z2BA 2HNEA 4A3QA 2IQ0A 4K37A 3R25A 2X0SA 3BQ5A 2PPGA 2W61A 4Z1CA 4C6PA 3S47A 7PTDA 4K8HA 4NZ3A 3MDUA 1N7KA 4DWSD 3GH4A 4W8BA 4TX9A 4IGHA 4CN4A 1F2JA 1TWDA 2CKRA 4XVDA 8A3HA 2OX1A 2W6RA 4GNJA 3K1GA 4DM1A 3EPOA 5FJPA 3HGSA 2DPEA 3FW6A 3LNPA 3DHPA 3VIPA 2QJMA 3K4WA 4NZ5A 1C8QA 1ZAHA 3CQHA 1XLBA 3LTPA 1P1MA 3H2OA 4J27A 2VUNA 1C90A 1DL3A 3H4XA 1DKWA 1UZ1A 1I6NA 3PBYA 2WLYA 1YRRA 1K9FA 2WKLA 1XDJA 4PEKA 1DJHA 5ENLA 3KBSA 2GVJA 3S2NA 4YTRA 3QQ0A 3V0TA 5XINA 3AROA 3WL0A 5F2GA 4ZFMA 4ZTYA 4ZQCA 1RCOB 4C7FA 3PBWA 1XIHA 4S23A 2PE4A 2WZHA 3BLEA 2Q3OA 4ZE5A 2OFJA 4AWTA 3WLPA 2ISVA 3NL6A 2VCCA 3H70A 2Z6IA 3T9PA 1Q8AA 4HNUA 4KRUA 3UXIA 3ME3A 1ITUA 3T0AA 3GS6A 2P0OA 3N3MA 2HNHA 4HMCA 2ZUVA 2PDJA 3W6YA 4C6LA 2F9RA 1R3YA 3UXKA 3G3DA 4NVTA 4HB7A 3HQOA 3U2OA 1EYEA 1A5KC 2ZTJA 5DBTA 1RLCL 3TJXA 3UG3A 4TUFA 1JDEA 3L9CA 1R5YA 3A4WA 3QC3A 1GK8A 3MI3A 3BWWA 4CUCA 1HT6A 1EUNA 1FH7A 2ICSA 1QBBA 4H2HA 4FPSA 1QPNA 4B5NA 3BW4A 2QCCA 4LUYA 3DHDA 1AQ0A 4TTUA 1GOXA 3P7YA 1A3HA 3RITA 4LCRA 1VFLA 1QFEA 4N4PA 3ECQA 3MCOA 4JBRA 2GUYA 1JCNA 3LTYA 4UTLA 1LJYA 1TJ1A 1OFBA 3OP2A 1TB3A 4FEZA 1W3TA 3ITXA 1UZHA 3E2QA 2DZTA 3VTRA 1OFAA 3TW6A 1V51A 3MB9A 1JYVA 1CGTA 3HF3A 3PJTA 3OPSA 4J3ZA 1UOKA 3FA4A 3NDYA 4JQ4A 5HK4A 4CD5A 4QXIA 3LLFA 3B8SA 3GU9A 4KKXA 1OEPA 1XINA 1QUMA 3ZJKA 1XXXA 2JGQA 3MANA 3FAWA 1R7AA 3BSMA 2IS7A 4AWSA 2NZLA 4CKQA 4KEMA 5C7HA 1MNZA 2A3LA 2CEQA 4F48A 3F4NA 3GAYA 3AHYA 1W1A1 2YPIA 1HFBA 2ALDA 2GSJA 3ZJ6A 5EYWA 4J4KA 2VZOA 3L2MA 3LEPA 4W4QA 5I23A 2CLEA 3O2LA 1REQB 4HA4A 1QNQA 4BEQA 1EOMA 3NXFA 3T0TA 1XGZA 1Z48A 2PDWA 5HXMA 4HZ6A 2BDQA 2QMJA 4FO4A 4QAIA 1BYBA 1AA1B 4JIEA 4NXKA 3LU2A 4OECA 2OB3A 2W62A 1F3EA 1RJQA 4GUFA 2WNNA 4LF2A 2NXGA 3HFTA 5IDIA 1I8JA 1OCBA 4L5ZA 4O4WA 3W7EA 4FP1A 2H3BA 3UWZA 4ZOEA 2A3HA 2RJGA 1T40A 3AS2A 4FR6A 1W3NA 1QNOA 5LHFA 2KAUC 1XRTA 3CBWA 2ACQA 2RGLA 2XM1A 2W92A 4XAFA 1NWRA 1D3HA 3A5FA 3QV7A 1QATA 5A8PA 3FIGA 4Z42C 2YCJA 4WDTA 1U1HA 2QF7A 1E0VA 3G8RA 4NU7A 1ZHAA 4JIHA 2Y8VA 4HTYA 1IT0A 5DLCA 3TR2A 4NF7A 3E12A 1O66A 3WQ4A 4Z2HA 2C18A 4WJXA 4FF5A 3V35A 4O57A 2DZXA 1AL7A 4V33A 4MWAE 3CIVA 3H2MA 1B9ZA 2WZMA 2FLIA 5A6TC 3GD6A 3RRXA 3N11A 3W74A 1SZFA 3GH5A 2QXWA 3GY1A 3TA6A 3II1A 1E4IA 4HHHA 2V3DA 1GNXA 4ZQNA 4HK7A 1ME7A 4IMCA 2PDFA 2DJLA 1HVQA 4TV6A 1E43A 1ISZA 1W1TA 3W1NA 2CWNA 3P2VA 4UTKA 4DZHA 3N9KA 4J3SA 2IXUA 1EX1A 3ZZ1A 3KXQA 3OBEA 3CQJA 4Q4QA 1P0KA 4HPXA 2NV1A 4JIQA 5AYIA 1QHOA 4PMDA 4GVHA 3GIPA 1KRCC 4CNTA 4JHOA 4NYYA 3H2CA 1G7VA 1HKKA 1ZALA 2ZUTA 3DFOA 2NUWA 4L9ZA 2J7BA 2TSYA 3NQ2A 1TCDA 1KFKA 2DDXA 1O6IA 3WYZA 4ROQA 4XAYA 1RP8A 4P8VA 1PV8A 3LCFA 1HGWA 3AOFA 4IG2A 2VDHA 1TO3A 3ARXA 2YLLA 1H41A 4Q6XA 4K3ZA 2PP1A 4IPJA 1HJUA 3DERA 3OZYA 2HQAA 2QNEA 2YR1A 3KHDA 1W1B1 4X9YA 3RIKA 1UJQA 3M0MA 4IP5A 3SSZA 1V4YA 4EP8C 3D5HA 2YZ5A 3B8VA 4IX2A 1WP6A 1OC7A 3EOLA 4LSBA 6XIAA 1GVIA 2Q02A 2HPIA 3LQGA 3LI1A 4GGBA 3TTOA 4AHOA 1E1CB 2NV2A 4AB4A 4OKDA 1UROA 6REQA 2F61A 3ANVA 5LHEA 2WNWA 1NOUA 2ZRZA 1EIXA 4EXAA 3NCOA 1RY8A 2I5GA 3A64A 4REQA 4V28A 3T4WA 5GNYA 1MZRA 1F6KA 3L12A 3P84A 3KS5A 1NOFA 4AEEA 1E6XM 1C8VA 1HIZA 5A6BD 3MP5A 1S5TA 2VJXA 1S3TC 1KLYA 1W5QA 2PC8A 3LX9A 1SJBA 2YFOA 3RMEA 1CCWB 3MPGA 3GZ3A 3LBCA 2VP8A 3S1XA 3UYCA 3ZQ9A 3SI9A 4M7SA 5HPOA 1YX1A 4XKYB 1AD1A 3MWAA 3W7JA 4K6AA 2POZA 3TWBA 1YNPA 2V5CA 3LHUA 2GQ3A 4LAUA 5IM51 4O1EA 5I09A 1Q2RA 3DYMA 2ZDRA 4LUSA 3RLGA 1LTDA 3KX6A 3HFYA 4JNMA 1L6WA 2BNJA 4WR3A 1QW8A 2NX1A 2G3MA 1GJUA 3AIQA 3RX3A 1U2YA 3HG3A 2L5HA 3OTRA 2VO5A 4EAYA 2FPTA 1LRQA 5D09A 1PZ2A 3WZ0E 1S2VA 3L68A 2FKPA 4J3WA 4QJ5B 2Y5EA 1F3WA 2J7EA 3EKLA 2E6FA 3TOYA 4JHZA 3ARRA 1FWCC 1LT7A 1UZ4A 3N13A 2BVDA 3W7IA 1KD0A 4DZ5A 1BXNA 2FIQA 1NDYA 2ALRA 3Q94A 3W23A 4UNIA 4F0MA 2WM1A 3TAOA 1X1OA 1H0IA 3GKAA 1B0IA 4IP4A 3WK3A 5I78A 1XSKA 1GW1A 4JOMA 5EMJA 2DSUA 1XLCA 3IACA 1ZJHA 1NQ6A 1GZ1A 4U3CA 1C93A 4JN7A 4R53A 4W7VA 1E6NA 2WK2A 3EOUA 3I68A 3GTFA 3TR9A 4G8TA 4IMEA 1QPRA 1P1XA 1BVNP 4N9CA 3GAKA 3CNYA 4JYEA 3GG7A 4ZZ9A 2PTDA 5BMXA 3MQTA 1F4HA 4O15A 2ZDSA 3QC0A 2J27A 1KWGA 4DM2A 2CNCA 3SUVA 4HMNA 2H3DA 3RN6A 1R30A 4IX0A 2AQVA 3LHZA 1FDYA 4C91A 4AAJA 3NO1A 2W91A 3R79A 2QUNA 4NASA 3UZYA 4U33A 1PKNA 1HG3A 3ZJ7A 4Q8OA 5AHFA 1IXPA 4PCTA 1F61A 1A5BA 1JRCA 1B5TA 5CJ5A 3M5YA 3TQ0A 4WGHA 3VOFA 2OOGA 3NDZA 3N9RA 1WOAA 5I07A 3LMYA 2VENA 1VYPX 4Q8TA 2HMCA 4MKNA 1W3KA 1OJXA 1QNPA 3WDRA 4ADSA 3AXIA 3UNDA 3CYJA 1GYNA 3W2KA 2VVSA 3K8MA 5A94A 2OQLA 4EOUA 5FAJA 4ATLA 4O16A 3ZSSA 1MQRA 3J7HA 1OD0A 4AD1A 4Y9NA 1ZZMA 4FNRA 2WO5A 4FHAA 1MEIA 1GOMA 3W72A 4D71A 1WA3A 1UD6A 4F3HA 3G1DA 1PB0A 5I3HA 2UWFA 1RQEA 2VELA 3AUOA 2QGHA 3IUDA 3G6MA 3BANA 3MTWA 3V5OA 2OQHA 2FMNA 3BH4A 1NP2A 1ZP4A 5A2BA 3RM8A 4N2YA 2HV5A 1A3XA 4U3AA 4NYUA 3V3WA 1TPEA 1Q8JA 3NL3A 4I8DA 8XIAA 1R85A 2A3BA 1IWAA 3G1HA 4KCUA 4WKFA 4JS3A 4G1KA 1GCYA 3DFHA 3IANA 5E1QA 4DXVA 3ZVHA 3VIJA 5LIWX 1T96A 3CMFA 1Q13A 4PUMA 3E2SA 3R10A 1JAEA 4W8AA 1P7TB 3E74A 2WC3A 3VXGA 4N6FA 1UBSA 4U28A 4CD6A 4B9YA 2G41A 3FYOA 4ZCWA 1MRAA 1BQGA 2WSRA 3NURA 2WOQA 5G1MA 4LS2A 3GFZA 1NARA 1KO0A 3A4XA 1M68A 2PTYA 4XAPA 5H8MA 3CUZA 2C15A 4F8XA 1XD1A 1TFVA 4YXGA 3GU2A 1JDFA 3R43A 3W81A 4DWSC 1U1UA 4MHBA 4E2DA 1W5NA 2PLKA 2VM8A 2GWNA 4ZO8A 4DWDA 4A8RA 3OGRA 3SY5A 4FNTA 1DWFM 1J0HA 3BG3A 1QPOA 4L4MA 4EXQA 1VEPA 1K8CA 4WY0A 1KM1A 3U8GA 3C0JA 3GDBA 2Y24A 3BLLA 2OXNA 3M43A 1OB0A 3R1ZA 4LRTA 4JFVA 2NT0A 2FYMA 2YB1A 1G4EA 3OQEA 5DO8A 2CLMA 4DF1A 4KRZA 3C0SA 2PODA 4Q4SA 4IF2A 4MOZA 5CJMA 2GOUA 4XUYA 8TIMA 3PSWA 4LH8A 3PTKA 3FGCB 2J78A 3CL7A 3CUJA 3UVAA 3TVAA 1R0MA 2DQXA 2GDQA 4PUKA 5HMEA 3QPYA 3LCGA 1HKVA 3TONA 7ENLA 2WJFA 4HOXA 1YQ2A 1ITXA 1V6VA 3N18A 1PYFA 3LLDA 3S9YA 1V03A 5I03A 5JH2A 3W9ZA 4A22A 2VR4A 1H2JA 2JGYA 1H4PA 1RK5A 3LCXA 4EK7A 2WNQA 2V5LA 5DQPA 3T07A 3S1UA 5HWNA 3UWEA 3CM4A 3W02A 1W6TA 2IPWA 4O4VA 4QSHA 4L80A 1CX9A 3RGTA 1AJ2A 5F1UA 3DYOA 4QBXA 1VBHA 1TR9A 1EXBA 4WX2A 5I7GA 4IIEA 3E1F1 4J1OA 4Z08A 3S2MA 2X0HA 2PURA 4CU7A 2DZPA 3KLLA 1BWKA 5CC7A 3EWZA 1V3JA 2INZA 2A7RA 5T8GA 1I2QA 2V2DA 2YBUA 5AECA 2DU2A 3GXTA 4NKCA 5FF2A 2AQOA 2PDQA 3BXWA 2WZTA 1D3CA 4RZBA 3WFAA 5EA9A 1B3WA 2PDYA 4X3ZA 4QJ1A 4RPPA 5AVHA 3QM3A 1GYMA 3QFEA 2XH4A 2HK1A 4AZCA 4K38A 1XCWA 6PTDA 1OF8A 1KRAC 2FGBA 3JU2A 3W84A 1QTWA 4A6GA 1DXIA 5FF7A 3EX2A 3HBLA 2CLIA 3PFRA 2GQ8A 4CVUA 3OZMA 3BCDA 2QHAA 1HJSA 1VH7A 3I3EA 1K6AA 4GKLA 2VQTA 2FZ8A 1UYQA 4I9MA 4OJYA 4PR4A 3PANA 3FAXA 3ARWA 1PIFA 3H53A 2AGTA 1TA3A 1IEWA 1QCWA 4Q8QA 1G4TA 3B4UA 4I5UA 1JDCA 3TZFA 4GZIA 4LV4A 4I9TA 5FEWA 4NRSA 4RE0A 1AVAA 3WBAA 2QPUA 3SN1A 3SJ3A 2CERA 2EGZA 1ZUAX 5G4WA 2OELA 3F5KA 4PB5A 1DYSA 2VR2A 4ML4A 1JNEA 4PTMA 1MEHA 1IE7C 4LUTB 3AHZA 3G22A 5A8GA 4C7DA 1M65A 5IBXA 2BG5A 2WQDA 3GC4A 1V08A 3IIOA 1P0NA 3STCA 2GJXB 4D6EA 2YDRA 1QK0A 2BXYA 4PC8A 3RO6A 4KWSA 1DWJM 2Z4GA 4FK9A 3GBEA 4ZMGA 2WLZA 1OG0A 4GYPA 1TWIA 1ZY9A 1CB2A 3M7WA 1NVMA 4GJIA 1UA7A 3VUSA 1DJIA 1ME8A 3OB8A 4WOQA 4XB3A 1HO1A 1P6CA 3AHTA 5D05A 4QDPA 3C5QA 5CC6A 4Z1YA 3WEOA 3PZIA 5C55A 5KETA 3SRFA 1TRIA 2WW5A 2ZZ4A 4GYFA 4BQ2A 3VKCA 1BXCA 2Q8XA 3TROA 4CCDA 1ML1A 4QS5A 4NI8A 4YL2A 3GXNA 2OT1A 1M7PA 4Q4OA 3G6LA 2WZIA 4WQ6A 4AZ5A 2Q8LA 2ZTKA 3ARSA 1W32A 2AKZA 1ZP3A 5A6KA 3P61A 4GK8A 3F5JA 1C7SA 1XLEA 1FWGC 4KPLA 4GNKB 3MUY1 3RMJA 1OX5A 1US2A 1LCOA 4GH1A 4MZ1A 3W86A 4KQNA 4XBSA 3QLDA 3CHFA 3TC3A 1UWAA 3W1PA 2RDXA 4C1NA 4XAGA 4R9OA 4DVOA 1WZMA 4XSMA 1WO2A 3LQLA 5U7SA 3V0SA 4YTTA 1MW1A 1H51A 2F7FA 1OFQA 1E0XA 2DSKA 3KCJA 4LS0A 4W5UA 4HHMA 1VBJA 1HVXA 4R33A 4WDXA 5G4HC 5HNNA 4FALA 3PBGA 1EGMA 3NIYA 4ZQOA 3VIOA 3U5UA 1Y5WA 3BK0A 3EOEA 1XYCA 1JJKA 3E0LA 2Y8UA 2OKTA 1ZRQA