4A3HA

2',4' dinitrophenyl-2-deoxy-2-fluro-b-d-cellobioside complex of the endoglucanase cel5a from bacillus agaradhaerens at 1.6 a resolution
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
300
structure length
300
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (ENDOGLUCANASE)
publication title Snapshots along an enzymatic reaction coordinate: analysis of a retaining beta-glycoside hydrolase.
pubmed doi rcsb
source organism Bacillus agaradhaerens
total genus 122
structure length 300
sequence length 300
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 1998-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4a3hA00
3ZQ9A 8CGTA 3UESA 3SURA 1AQMA 1ODZA 1E73M 1EH9A 2GUYA 3K4AA 3PZNA 2DSZA 2BY3A 1E3ZA 1QI4A 3CHFA 1R8LA 1G01A 1H4PA 1CBGA 2AOSA 2XVNA 2V3EA 3ARZA 4OBSA 3VNZA 4UOZA 4FLSA 3HJEA 4LPCA 1NP0A 1JF5A 1KXVA 5IHRA 4N0RA 3G6MA 3WUFA 3VGEA 4D6IA 2PBGA 1J9YA 5CPSA 1HVXA 2OWCA 1FHLA 1CECA 2VO5A 4JFUA 1E6NA 1P6WA 1OT1A 1GVIA 1C90A 1XV8A 1CGUA 1E40A 3RPMA 2VR5A 1UZ4A 3OLEA 4UCFA 1KWKA 1LJYA 2JF6A 4AZBA 1TZ7A 1U33A 2J7DA 2C7FA 4OBRA 2BY1A 1E5JA 1ITCA 1H5VA 1RH9A 4M56A 1PBGA 5IDIA 3ZOAA 1HT6A 1W2VA 4OKDA 1OGSA 3GZAA 1FH9A 1TA3B 1BF2A 2VQUA 1YHTA 1XSKA 1QW9A 1WDRA 4MDOA 3WQ4A 4B3KA 3U5YA 3AZSA 1CWYA 5M03A 1ZL1A 2J7BA 4TXEA 1US2A 1ZBCA 1EOKA 4KMQA 3NDZA 1CXHA 4QP0A 2BNJA 5I79A 2VCBA 3ZJKA 2AMGA 1QVBA 2BY0A 3PTMA 3NJ3A 4B3LA 4ACYA 3AMCA 1EHAA 2A3HA 1D3CA 3W28A 2JF7A 4XX6A 1VFOA 3THCA 2WMFA 2XSBA 3ZMRA 2CERA 4PUEA 2VTFA 5ABHA 3HU7A 3MO4A 1J11A 5IFTA 4E4PA 1OGGA 3EBVA 1OIFA 3EDEA 2YL9A 3AIVA 2YLAA 1BYDA 2EPLX 4U5IA 4B9ZA 3BLPX 4Z2KA 2WW5A 1MWOA 5GPRA 5HXMA 4OUEA 4RL3A 3WH5A 4AIUA 1JZ6A 3AXXA 4JZ5A 1CGTA 2WWDA 4BS0A 2NT1A 4UFMA 5BCAA 3O2LA 3CZGA 1TFVA 4PRWA 3QHMA 3AZTA 2QPUA 1JI2A 4J7RA 1VF8A 3PTQA 2ZE0A 4L4PA 2QMKA 2NW0A 4F8XA 3WEOA 3WEZA 3EDDA 5IFPA 1K9DA 4J28A 4MB5A 2WPGA 1JD9A 2FGZA 2CBUA 1QBAA 4PCSA 5GNYA 3VPLA 1HJXA 1S46A 2VZTA 3KL5A 2BVDA 1E72M 1UR1A 2F61A 3WENA 2Z1SA 3VDHA 1JL8A 4M1RA 1LQ0A 5BRQA 3DC0A 3MANA 2J7GA 2HVMA 4BQ4A 4M8UA 2XIBA 2F2HA 5BYWA 1JDAA 4JL2A 4AD3A 2WANA 4MNJA 1E6ZA 2DGAA 3AS0A 2J7FA 1ISVA 1GVYA 7A3HA 2J7CA 3GM8A 3ZJ8A 3OLGA 5EFDA 2WC7A 1JAKA 3L4XA 1MFVA 4DUWA 4W87A 1OD8A 3DYPA 4YPJA 3RM4A 5A6LA 3GH7A 1NWRA 1DWGM 1H09A 2YDQA 1ISZA 1XCWA 3A6OA 3L2LA 1V02E 4BQ5A 4UQAA 2W5FA 5JUVA 5I6SA 5EMYA 1OSEA 2YDSA 3M7SA 4Y7EA 2CYGA 4WSJA 3L4UA 3O6AA 3M6DA 5FKYA 8A3HA 2XWDA 5FCZA 4UZUA 2QPSA 5A8NA 3AXIA 3I3BA 3UR7A 2EJ1A 3SUVA 4UFJA 2ZUWA 5EB8A 2OYKA 3W37A 1NARA 4M80A 2WZIA 1IZJA 3OZOA 1EHNA 2Y8KA 3NCOA 4UOQA 1KR1A 2VX4A 1GZJA 3WQ6A 3CZKA 1E43A 9CGTA 2G8ZA 1C7SA 1UKTA 5I24A 1BSIA 2ZXDA 1XD0A 1V6UA 4EK7A 1FH7A 1G94A 2IXVA 3WH9A 4CCEA 1MW3A 1FOBA 3ZJ7A 3N04A 3O9NA 1CYGA 2VC9A 4J3UA 1BYBA 1WP6A 3CZJA 3BMWA 1HJUA 1V0NA 4PMDA 4CU6A 5DT5A 4MB1A 4OOUA 4AD2A 2PWGA 2DDXA 2UY4A 4AC1X 3N9KA 2EPNA 4NI3A 1OT2A 3WBAA 4UQDA 2VOTA 4DWSA 1JGIA 1QNRA 3ARTA 4URIA 4W93A 1E4NA 4KGLA 2ZX7A 4W7WA 4GZJA 1ZBWA 1DWFM 3PBGA 1OCQA 7TAAA 4RE4A 4WKAA 2WBKA 4WKFA 5ECUA 4PUDA 2XHYA 4GQRA 1QI0A 2WC4A 1WDPA 3IANA 2WZEA 3VGDA 3WQ5A 4W85A 2WK2A 5I0DA 2VZSA 3N12A 1J0HA 1RPKA 2WZHA 4D6CA 2DT0A 2W67A 4QFUA 4P8WA 3WEMA 1E55A 2ZOXA 2CKRA 2QV4A 4AWEA 1TVPA 5AC5A 2WVVA 1BPLB 4W86A 1CPUA 3ZO9A 2GJRA 1I1WA 5BXPA 2J78A 3ZJ6A 2GDUA 4AY1A 3WD2A 2D20A 4PMYA 2J74A 7CGTA 4AZGA 1UZ1A 3VIOA 2VQTA 4U3CA 1B30A 2WSPA 3ZT6A 2JFEX 4CCCA 1DWIM 4D6HA 3PHAA 1B31A 2WMIB 2GJXA 3GBDA 4HZ7A 5C8BB 5GQBA 2WKLA 3NDYA 1VFFA 4AYSA 6TAAA 1UHVA 1JFXA 3SCOA 2V3GA 4Z2HA 2F8QA 3ZT5A 2Y8VA 2DQXA 1GOIA 3CMGA 3AXHA 1FA2A 3WNKA 1GOMA 2YJQA 3VDBA 2E4TA 3KE0A 1E6SM 1Q6FA 2VMFA 4BZYA 2PF0A 3I3DA 2XTKA 4TTGA 4IPNB 5C71A 1UWRA 3BCDA 3GH4A 3AIUA 3GTNA 4CD6A 3VINA 3K8LA 4D71A 3OGVA 1GOKA 1GCYA 3RM9A 5E0CA 3VM5A 1DHKA 4PSPA 3VX1A 1XHGA 1LWHA 3CHCA 3ARYA 1E4MM 3FNDA 3WH8A 4CVUA 3CUHA 3VIMA 4BCEA 2D2OA 2G41A 4AXNA 3AS1A 4HPGA 4W89A 4M82A 2YA2A 1J0JA 1NQ6A 3WDHA 1ZB5A 3EDFA 3WD0A 3D3AA 3BCFA 3VD4A 1HP5A 3ARUA 2VCAA 2FH8A 1RD6A 4A3HA 1XGZA 1JZ2A 3GNRA 1CXKA 1HJVA 5CXPA 1NWUA 3VILA 3TTSA 4E8DA 5D8WA 4MB3A 2E9LA 4AEEA 3VVGA 2DSWA 3SUWA 1BHGA 1OIMA 1ZJAA 1VJZA 3AIEA 2BXZA 4MAZA 1KCLA 1WO2A 3NSNA 5CLTA 5A95A 4HMEA 3MMWA 1EDQA 2D3LA 1JYNA 4FLOA 4HOZA 2GVYA 3VGBA 3VGHA 1WZLA 4C7DA 2PI6A 2DIJA 2EBNA 3FAXA 4EKJA 1EGZA 2ZXBA 2YDRA 5CG0A 2YL8A 1LL6A 3I3EA 4YN5A 3L4YA 1G5AA 3GH5A 1LG1A 5TD4A 2FGLA 3CZLA 4U5KA 3U7BA 4CD4A 5ABFB 3W25A 1JXJA 1D7FA 2VUYA 1HKIA 3WL0A 4XB3A 3VIIA 4Z2IA 4TTUA 5A94A 4GI6A 1AMYA 2VRQA 3L2MA 4CU8A 4LQ1A 2A3BA 3N11A 3W6MA 3UERA 2WMKA 1JYXA 5LA0A 4P7RA 4QDMA 2DT1A 4QLKA 2QLYA 2OSYA 5A3HA 1NH6A 3CUJA 3B8SA 4TOQA 4UQEA 3AMLA 1GQIA 4B16A 2X1IA 4X9YA 2BFGA 3AIRA 1EDGA 4WJXA 1CENA 1GHSA 2D23A 2J79A 2NT0A 1VBRA 2PWEA 3OGRA 3UCQA 4BQ3A 4D6FA 3J7HA 2WNWA 1DP0A 4PMRA 1Q4NX 4TX6A 1UWIA 2VX5A 3KWXA 4P7LA 1NM9A 1PPIA 3MV01 1KXQA 3VD7A 4TVCA 2EPMX 1XH0A 2VR4A 1A47A 4JFSA 1TMQA 2GK1A 2GDVA 1PX8A 2CXGA 4YHGA 1ZBVA 2DH3A 4ATLA 4B15A 4J3SA 1E6QM 1Z32X 3B9DA 3AIWA 5CLWA 2O9RA 2BHZA 2VI0A 1MW2A 1MW0A 1BLIA 1WKYA 1MFUA 2J7HA 3PZVA 3VGGA 4W7VA 3ZIZA 4AZ5A 4JFTA 3ZR5A 1EO5A 1PIGA 1JAEA 4PEEA 3AI0A 2DSUA 4CD5A 3WMSA 1C8XA 1UH4A 2VNCA 1FHDA 3NSMA 4XUYA 5CSYA 3OIHA 1PJ9A 1E6PA 1LL4A 1Q6DA 1M03A 1NWTA 3PZQA 3A3HA 3GDBA 2MANA 1E3XA 3VMNA 1OD0A 5BRPA 3WF4A 4DWSC 1XRVA 3VMPA 5BROA 1CGWA 1M53A 2DIEA 2RGMA 3POCA 1JIBA 3ZSTA 3GXDA 4D6DA 3A4XA 4KRUA 3ZT7A 1AQHA 3NUKA 5DO8A 1KGXA 1W3HA 4D6GA 3PTKA 3ARXA 3PZIA 1WNOA 1MQPA 3AISA 4FF5A 3WF1A 3WDJA 3OLDA 4A3YA 4AIOA 3A47A 2XVLA 1L0PA 1AVAA 4AMCA 1YQ2A 2O92A 3TOPA 1UD5A 3AIBA 1U2YA 3SCRA 2ZXQA 2A3AA 2Y2WA 3AHVA 2J8GA 4X0NA 1SYTA 1V6YA 4HOXA 3OZPA 1DEDA 4AD4A 5I23A 2V3DA 4V2XA 3SUSA 2W61A 1L8NA 4P7OA 3IJ7A 4MADA 1AQ0A 2JIEA 1HP4A 1UWSA 1JFHA 3BC9A 3WNOA 4LXFA 5HDRA 4JFWA 4MAVA 4PMNA 3WN6A 2BS9A 1GOWA 4JHZA 4R5EA 2D0GA 4KGJA 1BG4A 3TA9A 2WLYA 1BGGA 1V3IA 4ML4A 1QBBA 3CUGA 3CZ8A 4DM1A 2J75A 1J18A 5AC4A 2YBTA 2ZUUA 1CLXA 4MTVA 2QF8A 1QI2A 2B31A 2GJPA 4NZCA 1JXKA 1CNVA 3MMUA 4U31A 4AZ6A 4QCFA 3T0AA 4P8XA 3LPFA 2VT0A 4UQBA 4PMUA 3BLKA 3OGSA 2TAAA 3T0BA 2RGLA 3WNMA 3QHOA 1DWJM 3WUEA 3PZOA 4QLLA 3ARVA 1M7XA 3DECA 3CUFA 6A3HA 3D5HA 5A69A 1H0GA 2FHCA 5D9OA 3VMOA 2XVKA 2XVPA 3QOKA 2DPEA 4NF7A 2YBUA 2J4GA 3K8MA 1W91A 3VIGA 3EMZA 3M46A 3WH7A 1HJWA 3T2OA 2WSKA 3F5LA 1G1YA 1HX0A 1SR0A 2V5CA 1UR8A 3WDQA 1Y7VA 1MQRA 1W3JA 3CLWA 3UG5A 4GO9A 3UETA 4W8AA 4XZBA 1BYCA 5C70A 2X0YA 3L4VA 1VJSA 4WKHA 5I3DA 4UQ9A 3MMDA 3W27A 1K9TA 4HZ6A 3TP4A 1C91A 1ODUA 2J25A 3QGVA 4CU7A 3KZSA 4AZCA 1KGWA 4CN6A 4U2YA 2XGIA 3CTTA 1W9UA 2OSXA 1IT0A 2X2YA 2ZUMA 5D9MA 2FDMA 1RP9A 3AMKA 4LYRA 3BSGA 3N18A 3WNNA 5A6BD 4JCLA 3SUTA 4FMVA 1VRXA 3TONA 4WF7A 4TVDA 2CBVA 1RP8A 2Z1KA 1EDTA 1C8QA 3K8KA 1ITXA 2OYLA 1FP9A 4PYSA 3RM8A 1HKJA 1E4LA 3MKKA 2WWCA 5CQ1A 4AD0A 5D8ZA 1GNXA 4ATDA 1VBUA 2CPUA 3EMQA 3AHYA 1GOOA 3QHNA 2XPKA 2BY2A 1MQQA 4AISA 4EANA 1QNSA 3BMVA 4GI8A 1CGXA 1NOWA 5EBAA 4H41A 4MB4A 4PMQA 2BVYA 1V3KA 2PB1A 3BAJA 3RJXA 4EE9A 1V02A 4GXPA 2D0FA 1XH1A 3GXMA 5E9AA 3WQVA 5A2CA 2UY5A 5I77A 1CEOA 3WF2A 4WK9A 2JEPA 3K46A 2VRKA 1NOFA 4JKLA 2V38A 1BVZA 1ECEA 2W62A 5IHSA 2GFTA 3SUUA 2WMGA 2CCRA 5DEZA 1QPKA 2VURA 3QOMA 1SMDA 4M24A 4QCEA 3F5KA 5CZKA 4S3KA 4LX4A 1ZU8A 3VOCA 1H41A 1EO7A 5BXSA 2ZUNA 1UA7A 1W9DM 3GXIA 4JAWA 2OWXA 3VKKA 3ARQA 4JHOA 1VAHA 1MXGA 2IUZA 2YOCA 4WLCA 2BV9A 4XZWA 3RMEA 3T08A 2W63A 1OINA 1JD7A 1WCGA 4PN2A 1JZ3A 5HPOA 2X0HA 3A4WA 1XYFA 3ZR6A 1PX3A 2J47A 3AJ7A 3SCNA 1NP2A 1KCKA 2PC8A 1BFNA 2DT3A 4H8UA 2ZWZA 2O9OA 3WELA 4DWSB 1W1VA 2ZUTA 3VU2A 1C92A 1UYQA 1EQPA 3BAKA 3VIJA 5CJ5A 5LYRA 4GI9A 3WQWA 3DHPA 5D9PA 3AHTA 2XUCA 4DWSD 1W1TA 1VEOA 4IPLA 1A3HA 1C7TA 1GONA 4S3JA 4JL1A 4GO8A 5CPTA 3FHQA 4W84A 4LYQA 1UWUA 3RDKA 3ARWA 2CESA 3VX0A 2WVVB 1CXFA 1XCXA 2WVUA 1KQZA 1J01A 1NOUA 2CNCA 1W2PA 1J0ZA 2XYLA 3S6TA 1GHRA 3FAWA 4MJ4A 2XVGA 1JZ8A 1UD3A 1R85A 4HMCA 2ZX8A 1CXIA 4UOJA 4Q22A 5GNZA 2G3NA 5CGTA 5E6YA 3PZMA 3AFBA 2ZWYA 3PZGA 1UD6A 1G0CA 3N13A 1VEMA 2WC3A 2FHFA 3WD1A 2GJXB 2ZXAA 1F4AA 1CGVA 4TVUA 2XGBA 4FK9A 3AMGA 5M3WA 4AIEA 3IAQA 4YHEA 1ISXA 3VNYA 3II1A 1VFUA 5HNNA 5CSUA 1UD4A 4J3TA 4LGXA 3BGAA 2EPKX 5A2AA 3WF0A 4W5ZA 2J8FA 3VD3A 5CPQA 1V6VA 2UY2A 3BSHA 2VVNA 1WAWA 4QAWA 1WZAA 2WHLA 2DSVA 4ACZB 1VEPA 4MNKA 2XM1A 1TE1A 1TVNA 2UY3A 3U7VA 1PX4A 2J7EA 2VX6A 2D3NA 4P7NA 2E9MA 5DMYA 3THDA 3WNLA 1XYZA 1V3JA 3NSXA 3UG3A 3AHXA 1OWQA 4QLJA 3SCSA 1E6RA 1QNOA 3WMBA 1BYAA 1UD2A 1J10A 3WQ8A 1JG9A 3EDJA 5KZ6A 2VL4A 3CPUA 4HPHA 4Q7NA 1TCMA 1UR4A 1E0WA 1UUQA 1OB0A 3VUPA 2VZOA 1PIFA 1V3LA 3NYDA 2Y24A 3VIPA 2BVTA 1PZ2A 1E6XM 1K6AA 1HL9A 1MVYA 2JALA 3U5UA 1BGAA 1OGBA 1VFMA 4Z2LA 5AYIA 2EO7A 4M81A 1R86A 1LL7A 2WCAA 3CHEA 4A4AA 1EXPA 2XFYA 4LYPA 4ZE5A 4P8VA 3VDCA 4F79A 5DF0A 1WPCA 1UR2A 1CIUA 4C7FA 4K68A 1W9PA 3GXFA 4UZSA 3FY1A 3G6LA 3CO4A 5FL0A 5FD0A 4ATWA 1JZ7A 4RE3A 3CUIA 5A6KA 4CD7A 1WDQA 1PAMA 1QNQA 2HISA 3MUAA 1MXDA 5IXEA 3AHZA 3WDRA 3RCNA 1E9LA 2NSXA 1B3XA 2W4XA 2OWWA 2ZX9A 3SCTA 3BH4A 1FH8A 1IZKA 1W9XA 4TUFA 1TUXA 3RILA 3WDPP 1J0KA 2XWEA 3OG2A 3W4RA 3EMCA 3DYOA 1NWSA 1TA3A 2OLHA 1V3MA 4CKQA 1CGYA 1BVNP 5A8PA 4PMOA 3TTYA 1JI1A 3K4DA 5A6SA 4HA1A 4CVWA 1JYWA 5E0FA 4GKLA 3PZ9A 1VENA 2DT2A 5EFFA 3L4TA 4GIAA 1E70M 1BTCA 1TG7A 4JFVA 5E09A 5BXRA 5E70A 1XC6A 2X09A 1U30A 1M01A 4HP5A 4GPNA 3T2QA 1QI3A 3BAIA 1UKSA 3CHDA 2CEQA 1HJSA 1EOMA 3W0KA 3EDKA 4MPKA 3ALFA 2J62A 1MYRA 1GUVA 5A6AA 1ZBKA 1X6NA 1ZS2A 1QNPA 4X0VA 1VIWA 4AZ7A 5FOOA 5D4YA 3W24A 2WMHA 2JEQA 1EA9C 5F7UA 1CXLA 4KWUA 3MUZ1 3WMCA 4UR9A 3VD5A 2WYSA 2EEXA 3VTRA 2GK1B 2YL5A 3CMJA 4HU8A 2VRJA 3OLIA 2X05A 4W5UA 1Q6EA 2C0HA 3WUGA 2V5DA 4P8UA 1SFSA 3MSDA 1E56A 4D6EA 3WD4A 4HMDA 3WD3A 3WF3A 2DSKA 2ZIDA 4Z2JA 4EAMA 3KL0A 3AS3A 1UKOA 3RIKA 1HIZA 3HMCA 3MSGA 5LA2A 1KXHA 3W38A 5JIPA 3OB8A 2WAGA 3F4VA 4F66A 2EPOA 1UKPA 2W92A 1MW1A 1E5NA 2JE8A 3FHAA 3B9EA 3IJ9A 4JKKA 2CIPA 1B3WA 2O9TA 2J77A 1H3GA 3WNPA 1W3KA 1K9EA 1WDSA 4CGTA 4D1IA 4PMVA 3MUIA 1GQKA 4B9YA 3MV11 2GSJA 1E4IA 3VO0A 3W53A 4PMXA 5AY7A 1WE5A 4BF7A 1EQCA 4UFLA 3DYMA 4UNIA 3MU7A 4J3VA 4WIWA 1UWTA 2PWFA 3WH6A 1GW1A 2XFFA 4KH2A 2IXUA 1UH3A 3SEPA 1JZ4A 1E71M 3VM7A 3EYPA 4U3AA 3LMYA 1KQYA 4U2ZA 3AZRA 4CN4A 1W9VA 1H11A 3ARSA 1HJQA 5A1AA 4DM2A 4AZIA 1ZJBA 3UEQA 2BXYA 1W32A 4L4OA 4M29A 1UD8A 2DEPA 1UR0A 4OZOA 4Z2GA 4ZE4A 3U57A 2XSAA 4ZENA 2CHNA 1UKQA 4AD5A 4BQ2A 1E1EA 2CETA 5D9NA 2WVTA 3PZTA 1DWHM 3WSUA 1HF6A 2BHUA 3T0DA 2WCGA 1UQZA 3MUY1 4CCDA 5A6BA 3VIKA 1CTNA 2VCCA 2C8NA 5AYBA 5HPCA 3ZM8A 3APGA 3WFLA 5A2BA 2D0HA 4C7GA 3KL3A 5A8OA 1CLVA 2E3ZA 1KB3A 4HU0A 3GYCA 2XG9A 2YLLA 1X1NA 4DUVA 2WHJA 3W26A 1UG6A 1V6WA 3UG4A 2XIIA 1KR0A 1UOKA 3LPGA 3PN8A 4XV0A 1KBBA 4N42A 3CBWA 4GINA 3ZSSA 4CUCA 1HXJA 1W9BM 4DUXA 2XM2A 2WCSA 5ABEA 5DT7A 3W82A 4AD1A 2ZX5A 1V0LA 3BAWA 3OBAA 4MNMA 1R87A 1KBKA 1V03A 1UA3A 2D1ZA 2JIWA 3UR8A 1JNDA 3AICA 5JIWA 1JDDA 3SCPA 2CKSA 2YKKA 2ZX6A 3SCUA 3WDIA 4H8HA 2E8YA 2YA1A 2UWFA 2XFRA 2W91A 4R27A 2W66A 4W88A 4ZXLA 4NSBA 3M07A 1J0IA 3AS2A 2WBGA 2E40A 4PBGA 2G4FA 1HN1A 4PTWA 2Y5EA 1D2KA 2Q8XA 3GNOA 1DTUA 4AZHA 2PWHA 3VD9A 1ESWA 4J27A 3AIQA 1LWJA 5JBEA 1V0KA 1WZMA 4OOZA 3VIFA 1JDCA 1KWGA 1FFRA 1F4HA 4HA3A 2G3IA 3VGFA 1BAGA 2O9PA 1E15A 2G3JA 5A6JA 1EIBA 4AZCB 2A3CA 4PTVA 1CZ1A 2Y4SA 2WHKA 3N1AA 4ZXOA 1Q6CA 2OSWA 4V27A 5A8QA 2WMIA 3WUBA 5E6ZA 1E1FA 1QW8A 3AYRA 1BG9A 4GZIA 3W81A 3AOFA 1V08A 2AAAA 1H1NA 1W1PA 4UFKA 4H7VA 1KFWA 4GQQA 5HOSA 4WSKA 1E0XA 2E8ZA 2VZUA 4UTFA 1W1YA 1UH2A 1O7AA 4CD8A 1UQYA 1KXTA 1XSJA 2VJXA 1R7OA 4MNLA 4JIEA 4FLQA 1CXEA 2X8RA 4H8VA 1US3A 3WBEA 5HBFA 4D72A 4J3WA 2EQDA 4TX8A 2OYMA 3FN9A 4D1JA 2CBJA 3RJYA 3L4WA 4HA4A 4UFIA 5DFAA 4F9JA 2ZUSA 4H2CA 3LPOA 3BAXA 3IJ8A 4NRRA 1UWQA 1Q6GA 4RE2A 3AROA 2WXDM 1LF1A 4ZFMA 1V6XA 5I2UA 3KEHA 1VB9A 1B3YA 1HKMA 1SMAA 1C93A 3CGTA 3TTOA 1O6IA 1B3ZA 1QHZA 1QHPA 2EXOA 3POHA 2G3MA 3W29A 1FP8A 1N82A 3CZEA 1E0VA 1CDGA 2YA0A 3FW6A 2VX7A 1QOXA 3WKZA 2QHAA 3SCWA 5JBFA 1C8YA 3OA5A 1H2JA 3IK2A 3IAPA 1B0IA 2E0PA 4CN1A 1J0YA 1I1XA 3RO8A 1B2YA 2FHBA 4E8CA 3SIMA 4UFHA 1FFQA 1LG2A 1GQLA 1PZ3A 3VIHA 4PCTA 1XSIA 3L4ZA 2CHOA 2WB5A 4PTXA 1GQJA 1V3HA 4ACZA 1G9HA 3T2PA 5KEZA 1V0MA 2PWDA 3ARRA 5LA1A 2DH2A 1DWAM 4ZEPA 1X6LA 2WLZA 3GNPA 1M04A 2YIHA 3CIVA 4W8BA 4E2OA 3K1DA 1ISYA 1GOQA 1PEZA 3A4AA 1HNYA 3SCQA 4HOWA 3S2CA 1JNEA 4JCMA 3WL1A 4PMZA 1K9FA 2YL6A 4IM4A 2VVSA 1WZKA 4P7QA 2FH6A 1W3LA 4MDPA 2ZICA 1B90A 5ABFA 5FL1A 2ZUVA 2WMJA 3ARPA 1OM0A 5M17A 4D6JA 1BQCA 1QHOA 3TTQA 1JF6A 5FIPA 1I75A 2CITA 4V28A 4GZEA 3N17A 4NRSA 3BXWA 4OIFA 5I78A 1WB0A 4J3XA 3HN3A 1H0IA 1GORA 3WFZA 1B1YA 1R7AA 2E9BA 3AYSA 5CGMA 2XJ7A 1XH2A 5M5DA 1C3FA 3WIJA 2QMJA 2WM0A 3AMDA 3WY1A 4PSRA 1B3VA 4OJYA 1LLOA 1GJUA 3NIYA 5I5RA 1QI5A 1TR1A 1GPFA 4AEFA 5JBDA 1JZ5A 4KRTA 4UQCA 1XD1A 1UR9A 4BA0A 2WHMA 3FXYA 2WVSA 1J12A 1HKKA 4IISA 4AW7A 4H04A 5BWFA 2D22A 3QR3A 3F5JA 1GJWA 3E1F1 1ISWA 4F9DA 4IUGA 3ECQA 1JYVA 4MJ2A 4W7UA 1HL8A 2CBIA 3GBEA 2VZVA 1B9ZA 5GNXA 3ALGA 3AQUA 2V3FA 4HTYA 5A6MA 2BHYA 3VDAA 3CH9A 3BAYA 1OBAA 1HVQA 4W8LA 2A3EA 3MS8A 3PZUA 1IV8A 6CGTA 3B9AA 3N15A 4U33A 2ESCA 1H49A 5BXTA 5ABGA 5A8MA 4HZ8A 2PBOA 1KGUA 2D24A 3DHUA 4JKMA 4PTMA 3LPPA 2WKGA 4FLRA 3W6LA 3JUGA 3SCVA 3T09A
chains in the Genus database with same CATH superfamily
3ZQ9A 3UESA 1TWWA 3SURA 4PZVA 1E73M 3K4AA 3KBMA 4V15A 2BY3A 1UB3A 4B2DD 1P6BA 4ALDA 1G01A 1CBGA 2AOSA 3N4FA 2XVNA 3UP8A 3OTRA 2V3EA 2A7RA 4YWSA 2Z1VA 1QO2A 1N8FA 1YRRA 2Y88A 5KSWA 3AWNA 5MF5A 1MNZA 4CCZA 4L65A 2J9YA 2VO5A 1P6WA 1AZ1A 1OT1A 4G7EA 4O19A 1O4UA 1UZ4A 4UCFA 1KWKA 1OJXA 3CAQA 4AZBA 1U33A 1OCBA 3URBA 4QE4A 1E0TA 3C3UA 2DJLA 2HCVA 1E5JA 3ISIX 1J2WA 1H5VA 1RH9A 4TQTA 2QCMA 3MT1A 2W3ZA 4OKDA 1TPFA 3P82A 3OP2A 4QSFA 4JDBA 1U83A 2FTPA 3EPOA 3N4AA 2Y61A 3LLFA 2CZEA 4B3KA 4Z1BA 2ZZ4A 1ZL1A 1AJ0A 1US2A 4WGHA 5HAOA 1CXHA 4O12A 1FY6A 4QP0A 4AY8A 3RAOA 1UOZA 1RBOB 4OBTA 4Q4KA 2AMGA 2E6AA 3PTMA 1YXDA 4B3LA 3AMCA 4GCXA 1XW8A 2DIKA 1Q65A 5FA5A 3RNDA 1X8CA 4NX0A 4PUEA 3BGJA 3BLEA 1J11A 4E4PA 1OIFA 5EMLA 2PP0A 3NA8A 1BYDA 2EPLX 4UTTA 4Q8VA 3SRKA 1YMYA 2IPJA 4JR5A 5MKGB 5GJMA 2Y0FA 5GPRA 3HPXA 4H9UA 5HXMA 2PDFA 4OUEA 5CBIA 2ZBTA 4MVAA 2OQHA 3WH5A 2GVJA 3NTYA 1JZ6A 2PDYA 3GYEA 3IJQA 2WWDA 2QW5A 4DAIA 3F2BA 2L5HA 3W7IA 4IMCA 1DJXA 2QVNA 3CZGA 4QAIA 2C71A 4XQ6A 3AZTA 2HVNA 2BX7A 4J7RA 3UG8A 3TUUA 2ZE0A 3ID7A 4ES4A 2QMKA 4KIRA 4NY2A 4GUHA 3WEOA 2FMNA 3WEZA 3EDDA 5XIAA 5IFPA 3S4TA 1K9DA 4FAMA 4J28A 1IQ8A 1I0DA 2FJKA 3R8HA 4MB5A 2FGZA 4DBUA 5HMFA 4PCSA 1MI3A 3DN5A 3LI1A 2VZTA 4IUOA 5K3VA 1E72M 2WV8A 5I07A 1JL8A 2WQDA 2FYMA 2RKXA 3L65A 3DC0A 3MANA 1PE1A 4XIMA 4BR1A 3FJ6A 4RXGA 1FHUA 2VFFA 3AS0A 2INFA 1Q63A 1ISVA 2ISFA 3M64A 3EPMA 5TQLA 5JU6A 4H7ZA 4ZOEA 1MFVA 1OD8A 3L2LA 2Y89A 4BQ5A 1OSEA 4TIMA 4DBSA 2CYGA 1K1DA 4KETA 3M6DA 1EJ7L 1XLAA 3WQGA 8A3HA 4UZUA 1A4LA 2QPSA 2R9RA 3I3BA 3EA1A 4UFJA 1YNQA 4KT2A 4OE7A 2WZIA 2QCDB 4MKSA 2CLFA 4B4FA 1REQB 4ASTA 1RQHA 1J8VA 4Q8PA 5D33A 3NZGA 1E43A 4GNJA 2G8ZA 1XUUA 1XD0A 1KFEA 1L2QA 1EBHA 2IXVA 4IJRA 2E77A 1FWNA 3ZYZA 2BSLA 1FOBA 2PDIA 1DOSA 3WQFA 1JQXA 1HZYA 1V4YA 1Z42A 3CZJA 1TPUA 1SFLA 4CU6A 5DT5A 5HQEA 3QY8A 2PWGA 3WBAA 3MBFA 4UQDA 2PEVA 1PTDA 4HNLA 5SWUA 2PGWA 3PWIA 2DUXA 3ARTA 3OPSA 1NFGA 3VCRA 1E4NA 3GAYA 3TCEA 4HKPA 4GZJA 1ZBWA 1DWFM 3KTXA 2BP1A 4NNAA 4S3CA 5KITA 1OCQA 4GH1A 4WKFA 2ZA2A 4GQRA 4AF0A 2WC4A 3BWWA 5HUOA 4W85A 3TW6A 2WZHA 3IJ6A 1OC5A 3S6OA 1IGSA 4NZ4A 4P8WA 3APTA 5T26A 2CKRA 3S83A 3W2MA 2WJZA 4W86A 1I1WA 1FKXA 2J78A 2GDUA 1FWJC 3LS9A 2O0TA 3SN1A 2VFGA 3QQWA 2J74A 3NZRA 1ADDA 4ICCX 1KA9F 4IQLA 1M65A 1UZ1A 3DFTA 3VIOA 3GXTA 1Q5MA 1WV2A 1JPIA 3K1GA 4FNQA 4PB5A 2VQTA 3ZVHB 1B30A 2JFEX 1THFD 1DWIM 4IPIA 4NUWA 4CNSA 1S2VA 1B31A 2GJXA 4KF1A 5C8BB 4B92A 5FSEC 3MP5A 3NNTA 5DBUA 1UHVA 3WCZA 1JFXA 3FIGA 1TSIA 3NOEA 3TR9A 2F8QA 2DZTA 4FI4A 3E3HA 3A12A 1E6SM 1QR7A 2PF0A 3QC0A 4TTGA 2XTKA 2YCKX 4IPNB 3SRFA 1HW6A 4NJIA 2CZDA 3AIUA 1NSJA 3SDOA 1Q85A 1WXYA 5T9CE 4IPJA 2GVGA 3B8TA 3NZPA 2NQ5A 3UJEA 4HZMA 2XZ9A 4QNEA 2W9MA 1GCYA 5E0CA 3S1VA 4F2BA 1XHGA 1VLIA 3CHCA 5I3IA 1E4MM 4Q8OA 1XQLA 1MSSA 3FNDA 3WH8A 5H6HA 3OVGA 2GVEA 2X7VA 4DB7A 9XIMA 3P67A 4BCEA 1GJPA 1LQ2A 2G41A 4C6KA 4GISA 2ZADA 4AXNA 5HWMA 4XAZA 3AS1A 4HPGA 4ECLA 4IH3A 4QQ3A 1QT1A 4IG2B 1J0JA 3TZNA 1SZEA 2OMAA 2PP1A 4GBUA 3WD0A 1VIZA 3BCFA 3DU0A 5CPMA 4HMNA 2VCAA 3BK0A 1GQNA 4HHLA 7PTDA 4A3HA 4YWIA 1CXKA 3TTSA 1NF0A 3MHUA 4MB3A 1W5QA 4YTTA 3FSUA 3AUOA 1VJZA 2WJDA 3G0XA 3NSNA 4HNTA 3NVTA 3THQA 2PDMA 5A95A 3FCPA 3CV6A 3GTFA 2XH0A 4CNTA 3EXSA 1JYNA 4FLOA 1GWJA 2GVYA 3VGHA 1WZLA 4GC4A 2EBNA 3FAXA 4Q6XA 4U28A 3GZ3A 1PZ1A 1YLVA 2YDRA 5REQB 2I16A 1LL6A 4B5SA 2BB0A 1V79A 3KOZA 1G5AA 1DL3A 4YTSA 2DZBA 2FGLA 4NHVA 3QV8A 3ZWTA 3U7BA 3LHVA 1YNYA 3KXQA 3RXZA 3QYQA 1D3GA 3V5CA 5T8GA 4OECA 1IEIA 1M9HA 5A94A 1AMYA 3NO3A 4ZL1A 3L2MA 3QBUA 3LX9A 4AAJA 4C1NB 2BWGA 3NOYA 4TO8A 5LGZA 4ZB0A 4XO7A 4NP7A 1M1BA 1XISA 2YYUA 3BG3A 2HBVA 3MHGA 5A3HA 1NH6A 3I6TA 4X60A 3KLLA 1VYPX 3PPHA 1NDYA 2BFGA 2FPYA 4QBXA 3K30A 4O14A 3QYSA 2C0AA 5J5RA 4O50A 2A3LA 2AL2A 2J79A 4PFHA 2VFHA 1VBRA 2NWSA 2C3ZA 3WLIA 4JTKA 4BQ3A 1ZALA 1FQ0A 3KFTA 2WNWA 3LYEA 1XS2A 3S1GA 3ES7A 3BSMA 1Q4NX 2X1RA 2F6KA 2PA6A 4ZTYA 3DFPA 4LOCA 3E2RA 1IXPA 4P7LA 3VD7A 3LY0A 5DRIA 3HGSA 1A47A 4JFSA 4JTAA 2GUUA 3JZUA 1PX8A 2CXGA 2O9RA 3EXTA 3GKAA 2W6RA 2VI0A 1TVLA 1MW2A 1I6NA 1MW0A 2HEJA 3DDMA 4NZ5A 1KTCA 3QPZA 2J7HA 3PZVA 3O0FA 3MKCA 1LWIA 4Y2WA 3ZR5A 1EO5A 3SB0A 4LAMA 2CLKA 2DSUA 5D02A 3T55A 5CSYA 3CO8A 3DIPA 3U4AA 4BWLC 1PJ9A 2REQB 4PUJA 1E6PA 4DWDA 4IL0A 2IKHA 1SSGA 2XU2A 2QUVA 1UP3A 3GDBA 3DBNA 3M4HA 1U5HA 3VMNA 4UTWA 3BICA 4BY3A 1F7BA 1ZRQA 2HRWA 4Y9OA 2GOKA 3VZXA 3VMPA 3EWDA 3QFWA 3CT7A 3ZSTA 1E51A 3A4XA 2OO0A 3GG8A 3FJNA 4KRUA 2A4AA 3NUKA 5DO8A 1Q7QA 3PTKA 3ARXA 3PZIA 3R7MA 4UNLA 3AISA 3WF1A 3H2EA 3NL6A 4Z1CA 1UP2A 4PTDA 4J35A 1AVAA 1YQ2A 6REQB 1U2YA 2HS6A 3KX6A 1QNVA 2Y2WA 4H19A 1T41A 4HIBA 4HOXA 1YYAA 4KKXA 3EX1A 5FESA 1XLMA 1XRFA 2RHGA 3L66A 5GJNA 1L8NA 3C2VA 1HP4A 2PDGA 1UWSA 2VELA 1R47A 1LLWA 2GWNA 2YZ5A 4PMNA 3IIOA 4Z17A 4KGJA 1BG4A 3XINA 3IRDA 4O11A 3T4WA 1QBBA 4DXXA 3FV9A 3MB9A 4UNKA 8TIMA 4KESA 2J75A 1J18A 2BLEA 2D69A 3GG7A 2ZUUA 1O66A 4NZCA 1JXKA 3ATYA 1CNVA 1JCXA 1XC4A 7XIMA 4QCFA 2O55A 3G8EA 4P8XA 3W7QA 1TJ2A 1FX6A 3P8JA 2VT0A 1AL7A 3KTSA 2Y1HA 3WNMA 3N19B 4PRTA 3WUEA 1XUZA 1LRNA 3FVDA 4QLLA 5EL1A 1HGWA 4XKMA 3ARVA 1M7XA 2IQ0A 2PAJA 4YNGA 3GFXA 5C9XA 6A3HA 1QXLA 4P61A 3FX4A 3B8UA 1QOQA 1QRQA 3E0VA 1UBSA 4EXBA 3K8MA 3EMZA 3WH7A 3C52A 3R13A 1G1YA 1XRSA 3TQ0A 1W31A 1UR8A 1MQRA 4JEQA 2NWRA 4W8AA 2W0UA 3L4VA 4ONVA 1DXEA 4ZSTA 4FEZA 3CH0A 2PTXA 1I2NA 3N3MA 5I3DA 1RJQA 1GEQA 1K4GA 5LIXX 3NWRA 1ODUA 4GQBA 2NZLA 2DQWA 3BLLA 3M7WA 3RLUA 3KZSA 1KGWA 1KNWA 3AWOA 2Q6ZA 4MLJA 3QZAA 5D9MA 2D2GA 1OX5A 4NAFA 2OKTA 3IUHA 2DVXA 3TONA 1R3TA 1KM3A 1HO1A 2E1DA 4TVDA 3GG1A 3K8KA 2QZRA 1S3TC 2VFDA 5DCEA 1HKJA 3C4UA 1AUSL 2XPKA 2BY2A 4EANA 1KO0A 3BMVA 4WX2A 4GYFA 4GI8A 5HQMA 2BVYA 1V3KA 2E6YA 2PB1A 3REQB 3Q94A 1XH1A 5EMKA 3SGUA 5A2CA 4F0RA 3C2YA 1TYGA 2NVAA 2VRKA 4KQNA 2I17A 4Q8MA 2V38A 2W62A 4IP5A 2CCRA 5E0KA 3RU8X 1SO3A 5DEZA 3ITVA 3UA3A 1SMDA 3DXIA 4A8LA 4XD5A 2NQZA 5EKYA 3W7EA 5CZKA 5I3GA 1Y5VA 2ZUNA 3W7DA 1W9DM 1EX5A 5B80A 4IT1A 2IUZA 2BV9A 4MY1A 3SECA 3T08A 1F8MA 4L6HA 2PURA 2VEPA 1OINA 3UQNA 1JD7A 2HNHA 5T9BG 2VP8A 4PN2A 3UWWA 3NQVA 4DYJA 3T8QA 2X0HA 4Q8UA 1TWSA 1XYFA 3AJ7A 1KCKA 2ZWZA 5IDZA 3W07A 2ZUTA 1C92A 1UYQA 1EQPA 3VIJA 5LYRA 3DHPA 4IGNA 1OX4B 1S5VA 3H2OA 4D9PA 3WLNA 2TMDA 1RCQA 4IQJA 4IPLA 2H9AA 3H7UA 5AHNA 3A64A 5I03A 3DESA 4FIRA 5CPTA 1EF3A 1UWUA 3GAKA 4X63A 3W2KA 5LIYX 3M0YA 3SY1A 1XCXA 3PSVA 4JQ2A 1A4MA 2CNCA 3C0QA 3P84A 4FNPA 1OFRA 3BUVA 4RZ4A 2PS2A 1GHRA 2XVGA 1JZ8A 1UD3A 4GYPA 1R85A 4HMCA 1CXIA 1OYBA 3XIMA 3E2SA 3WX7A 4HB7A 5CGTA 5E6YA 3W1AA 4C65A 1F6PA 3PZMA 2PDHA 1KM1A 3PZGA 3L21A 4LWWA 1G0CA 1VEMA 2WC3A 2FHFA 2ZYFA 3DFOA 2H8ZA 2CFFA 2ZRUA 2P0OA 4HYRA 2XGBA 3W23A 3Q37A 2D2HA 4AIEA 3HMJG 1ISXA 1T6MA 3NQBA 1KM0A 5HNNA 1UD4A 4LGXA 3CUXA 5D2WA 4GUFA 4O1AA 4DX3A 1IZCA 5D37A 4K1GA 2AKMA 5CPQA 3JU2A 5AHFA 1QWKA 4IHCA 4I7WA 4LUTB 3BSHA 3CUZA 2VVNA 4XZNX 2BGNE 1WAWA 3DG6A 1WZAA 1KFJA 3MCOA 1VEPA 4MNKA 1TVNA 2UY3A 4AVFA 3U7VA 5CC7A 2ZTJA 1PX4A 3V7PA 2D3NA 3WNLA 4S23A 3UFYA 1SO5A 3R6IA 4LALA 1UD2A 1JG9A 1Y0EA 5KZ6A 1XIBA 2VL4A 4H7CA 2Q8ZA 4GOAA 3CPUA 4RV8A 4HPHA 1TCMA 4G7FA 2PC4A 4ORIA 3ZLHA 3VUPA 2VZOA 1PIFA 5D04C 3OQEA 2QCCA 4H9ZA 1KFCA 1MVYA 1BGAA 2Q3RA 1VFMA 3FGCB 2BGSA 2OZ3A 1DE6A 1QO5A 4YJ5A 5LIKX 1Q13A 1EXPA 4HGXA 1ICPA 2CLIA 4LCRA 5DF0A 4JHMA 1WPCA 3ZS4A 2B7NA 3LERA 2PDJA 3PUGA 4K68A 4F0HA 1W9PA 2XSXA 3CEUA 3G6LA 3CO4A 4IFRA 3E0LA 4ZQNA 1MUMA 3CUIA 3FJLA 2QCLA 1SO4A 7ODCA 1QNQA 5IXEA 3OYZA 1A5MC 3W1RA 4KFNA 4QGCA 3WDRA 1RSCA 3MZNA 2QJMA 2W4XA 4R3UA 2OWWA 3QQ1A 3GD6A 4ERGA 1W54A 4Z1DA 2G96A 3OG3A 5LNWA 3W4RA 4JDYA 3EMCA 5DMNA 1NWSA 1V3MA 5LHEA 2YB4A 2D2JA 3OQ8A 4LCQA 1DTNA 1JYWA 3IV3A 4DQWA 3P14A 1E9ZB 1TJRA 1PYMA 1XR2A 3L4TA 1TRDA 3V16A 4GIAA 1E70M 2QCNA 4C5ZA 3B9NA 1GPWA 1TR9A 1WX0A 4JFVA 3Q2DA 3VOGA 4IIFA 3W1UA 2X09A 1M01A 4HP5A 1IR2A 5LGXA 4CEUC 4E38A 2PSNA 3S9IA 3BAIA 3WLMA 1UKSA 3MW7A 2BASA 1AL8A 3G22A 4MPKA 1CT5A 2BVWA 2QS8A 3R25A 3A23A 1Q3NA 4L64A 4YCPA 1ZBKA 3NVDA 5B7YA 2XH4A 1VIWA 3WLHA 3BDKA 4NX5A 2JGYA 1MZHA 2I1OA 3PG8A 1RQBA 5F4SA 1EA9C 3N3TA 3IGUA 4O53A 4KWUA 2Z7GA 2JBMA 2E5CA 3WMCA 4UTIA 3VD5A 2VGBA 3ZXWA 3I7QA 3KRSA 2GK1B 3W02A 3EPNA 4GJ1A 4P8UA 3MSDA 3FLUA 5CC6A 1A5NC 2JKPA 3WF3A 3M6YA 3NZ1A 1XDJA 3I4EA 2FFCA 2XINA 5F2GA 3MSGA 4S38A 3BW2A 2WAGA 1CCWB 3F4VA 1QPQA 1FWDC 3UWYA 1KBIA 2FFIA 2Z0IA 3RX4A 4F40A 3VOFA 2CLLA 3CPRA 4L7ZA 3H70A 3UR2A 1H3GA 5BWAA 1W3KA 2PDXA 1EYEA 4M1BA 4XUGA 2DUAA 1WDSA 3CQJA 3S8HA 5C7VA 1SJDA 4AXKA 4JN7A 1VFHA 4IWWA 5KZMA 4JYEA 2CU0A 4LAOA 4UFLA 3V0TA 3MU7A 1B9BA 4E4FA 2XFFA 4RDVA 2IXUA 4S3FA 1JZ4A 3PAJA 2VC7A 4U3AA 4U2ZA 3AZRA 4CN4A 3G3DA 3UEQA 2BXYA 4M29A 2DEPA 4Z2GA 1R3RA 5EMUA 3NPXA 4GVIA 2O4MA 3NR0A 3I65A 2HVOA 1F3WA 1X6UA 1DJWA 1E1EA 1XX1A 2BHUA 4O8AA 2WCGA 5H1WA 1KV5A 1XYMA 3IUIA 1W1ZA 1REQA 4N2YA 3WLLA 3PJWA 4GYJA 4WZHA 2VFEA 3FA5A 3TFXA 5A8OA 3BV7A 5FSDC 1XLKA 2XG9A 3CL6A 5K9CA 3N6QA 4ZSUA 1BXNA 5F2LA 2PDKA 4XD6A 4LB3A 3PN8A 3VABA 3R5EA 4XV0A 3VZZA 4QSHA 3QW3A 1S3HA 5ABEA 2CZVA 5DT7A 3ERPA 4QM1A 3VA8A 3W82A 4DJFC 5IRPA 1KBKA 1V03A 1O95A 4LY4A 4ORMA 4LVFA 1JNDA 1YDOA 5JIWA 1RY8A 3TNOA 1K8CA 3OHMB 2DY3A 4NAEB 1Y5WA 1XGEA 2AKZA 4O0ZA 2XFRA 2QUMA 2W66A 4IGSA 3QEZA 2G4FA 1ONWA 2Q8XA 1A0DA 4E0CA 3GNOA 3P5ZA 3ZLGA 3VD9A 3O15A 4J27A 2Z6IA 3KBSA 1GKPA 1DIOA 1FCBA 1DJNA 1FFRA 2V8ZA 4UMAA 4YXGA 3WO8A 3VGFA 1PYFA 2IKGA 2G3JA 3W87A 3UWQA 1F05A 3ZVHA 2WHKA 4ZXOA 3PP7A 3VE7A 1RCOB 2QUNA 1XIEA 4IXXA 1XIGA 1S1RA 1YBQB 4OQVA 4Y6GA 1QPOA 1E1FA 3AYRA 4GZIA 3GW3A 3R4IA 4UFKA 3OYXA 4GQQA 4IIDA 1OZMA 4UTFA 1UH2A 4JTJA 3GVWA 1KXTA 1I2RA 1ZCCA 1RUSA 4LCSA 3KAOA 2VJXA 1R7OA 3BZGA 4JIEA 4JNYA 5AVNA 3RJYA 3L4WA 1KFKA 3UJSA 2ZUSA 2X1SA 1MUCA 1UWQA 1Q6GA 1R2SA 3AROA 1ENUA 5HMEA 2WXDM 3VZYA 4ZFMA 3RR4A 1B3YA 3MSYA 3M1ZA 1XICA 2PODA 5JH2A 3POHA 1QPNA 1TWDA 1Z3NA 2QYGA 1BEUA 3KRUA 3QN3A 3AC0A 3CZEA 2PDCA 2HXTA 1E0VA 1CDGA 4IG2A 4GXMA 4TX9A 4QROA 5G4WA 2YA0A 1U1JA 1TQXA 1QOXA 2V2DA 1XYBA 3IK2A 2G0WA 1L6SA 4HD5A 4MZ1A 1A49A 4W9TA 1I1XA 1TV7A 3RO8A 3EOSA 4E8CA 1VPQA 4UFHA 1PZ3A 3VIHA 3L4ZA 2CHOA 4XTIA 3T2PA 2Z24A 3HF3A 3W1PA 3ABXA 3C0JA 2DH2A 1BSLA 4CLMA 3UR5A 1DHPA 3CIVA 4E2OA 1SR9A 4GJIA 3K1DA 4OV4A 1HNYA 3GC4A 4HQVA 4HOWA 5REQA 4FXJA 3S2CA 4Y9MA 3WL1A 1XG3A 5G1TA 1W56A 4EPEC 2YL6A 4IM4A 3W7MA 2E6FA 3GY1A 2VVSA 2A5HA 3TV8A 2FH6A 5CPOA 2GGGA 5FL1A 2GLKA 1BQCA 2ALRA 3NQMA 5FIPA 4GIYA 3H22A 5DMLA 4NRSA 3C8FA 3PPCA 1WB0A 1AJZA 4J3XA 4QHRA 2ASHA 3BO9A 5HK4A 3U0HA 2HE5A 3TC7A 1B1YA 1TO3A 2DV0A 3PM6A 3HGOA 1MEIA 1C3FA 3GTIA 1MRAA 1IR1A 3WIJA 1UR3M 2QMJA 5E9XA 3AMDA 3WY1A 4N4QA 1B3VA 2Y8UA 1V7YA 3W7KA 2WSRA 1TR1A 5EGRA 1DVJA 5JBDA 4IMDA 2OLAA 4I9JA 3FXYA 4H4IA 1HKKA 1PCKA 4IISA 5G5IA 4H04A 3DEQA 3A3WA 3QR3A 4GNKB 4GVHA 4UTUA 1X97A 4PGLA 4IUGA 5L6UA 2XISA 4FS9A 4LAUA 2X7WA 1VH7A 4TMCA 1WQ5A 3G1HA 1HL8A 4L4LA 3AQUA 2V3FA 4HTYA 6ALDA 3VDAA 1H62A 1OBAA 1HVQA 2OPJA 2Y7DA 1AFSA 2X41A 3QVQA 1B3OA 4WDUA 3B9AA 6CGTA 3TAKA 3G1SA 4U33A 4HZ8A 4LVBA 1KGUA 2D24A 3DHUA 3GU9A 4I6VA 4PTMA 2V30A 5HMDA 2V63A 4DBWA 3T09A 3HV8A 5AYYA 2DVUA 3LTSA 1U1UA 1AQMA 2REQA 1EH9A 2HBXA 4YVPA 3PR2A 1FWSA 3TIMA 1QI4A 3CHFA 5CZ0A 1R8LA 3H55A 4EX4A 2VEKA 2PDLA 3ANUA 4IMGA 3ARZA 2JKAA 4FLSA 4LPCA 1NP0A 4I5XA 5I7GA 1JF5A 5IHRA 2YCEA 1GVOA 3G6MA 3VGEA 4D6IA 5FI8A 1J9YA 4JQ1A 1HVXA 3O63A 3DX5A 1FHLA 3GHUA 2ZRXA 2CHRA 3CWOX 1CECA 4RNFA 3LCXA 1GVIA 1C90A 1LUCB 1XV8A 3RPMA 1I45A 6REQA 1LJYA 4LSBA 1TZ7A 3QLLA 1BWLA 2Y6ZA 4OBRA 2BY1A 1LDCA 3N73A 5HMSA 4E5TA 3SI9A 2NXHA 1P0BA 4K6AA 3ZOAA 3CMFA 1P48A 2RDWA 4LT9A 1FH9A 3RU6A 1BF2A 4MDOA 3U5YA 3AZSA 1CWYA 4B5WA 5FEXA 4WY0F 4C6PA 4TXEA 4F3HA 6ENLA 2BNJA 2V9DA 2R6OA 1PDYA 3SQSA 2BY0A 2F38A 3NJ3A 2OT1A 2Q09A 4UTMA 2VC5A 1TPB1 4AQLA 4XX6A 4HHMA 3L23A 2WMFA 1DBTA 3BOLA 2XSBA 2ZZ5A 1U1HA 4M51A 2O7SA 3EBVA 2YL9A 1X7IA 1J93A 2YLAA 2ADAA 2OVLA 1G7VA 4B9ZA 4UR8A 4LS1A 2WW5A 4XAGA 4RL3A 1KM2A 4GY1A 4LW7A 3UVAA 1DJQA 2O7QA 2G50A 1P6CA 2WM1A 3AXXA 4JZ5A 2MNRA 3NM1A 3IVSA 2OOFA 5BCAA 1PTAA 3LCIA 3S5OA 2ZE3A 3RITA 1TFVA 4PRWA 3QHMA 3W75A 3VNDA 4LUJA 5HWNA 1VF8A 1RK6A 4F8XA 1R2RA 3CQHA 3ORWA 1Y8BA 5D03A 2VGIA 1DIDA 4ZB5A 1NQKA 3DI1A 1S46A 1XIFA 4B90A 1XINA 1DQXA 2Z1SA 4GX8A 4QS6A 3B8IA 3I6RA 5BRQA 2OODA 3ABQA 3KOFA 2DZUA 3TZFA 4BQ4A 2OKOA 1QASA 3Q58A 2F2HA 4JTTA 4DPPA 1JDAA 4JL2A 1S5TA 2WANA 2HNEA 4MNJA 3QV7A 1N8WA 2J7FA 4RDWA 1GVYA 3GM8A 3ZJ8A 2WC7A 3DYPA 2EKCA 4YPJA 1EFZA 4ZA0A 5A6LA 3GH7A 1NWRA 3KOXA 3CAWA 1H09A 2P88A 2YDQA 1JUEA 1Z48A 5I6SA 3REQA 4Y7EA 3L4UA 3O6AA 3IIXA 4L80A 4PUMA 2PGRA 2XWDA 3M9YA 1ONXA 2FVKA 2GDQA 5CSSA 3AXIA 3RUBL 1QUMA 3UR7A 4UMBA 4DNMA 2ZUWA 5EB8A 3W37A 3C3NA 1TZZA 1KLZA 1IZJA 3OZOA 4MY9A 4C6MA 3D46A 4UOQA 3M5XA 2QCFA 9CGTA 1GZGA 1UKTA 3NPUA 1BSIA 4ZQCA 1V6UA 4EK7A 1FH7A 1G94A 5C9RA 3O0KA 1C9DA 3QTPA 4GUJA 2UZ9A 4JY8A 4RDYA 3O9NA 5FEZA 3H21A 3L5AA 4A8NA 3BMWA 4BWLA 3LRKA 3RK8A 3PUEA 4DF2A 3BGGA 1CI1A 3CAVA 2DDXA 2UY4A 4NI3A 1OT2A 4GFSA 3G3MA 5LIWX 2ZA3A 1JUBA 5D05A 2VKZG 2VOTA 3NGFA 1JGIA 4O0QA 4W93A 1GKQA 4W7WA 3N29A 3PBGA 3BW4A 4WKAA 1SPQA 1OX4A 5ECUA 1GYMA 3H53A 3QV9A 3C6CA 3VGDA 3W1LA 5HR6A 5I0DA 2VZSA 2OQYA 4QFUA 3AXMA 3WEMA 1E55A 1LOQA 5TBOA 2QV4A 3GHRA 1YDNA 5AC5A 5EPDA 2ZZ3A 4MFDA 1BPLB 3Q45A 3A5VA 3H7VA 4F0SA 3ZJ6A 5C9ZA 1W3TA 3VOJA 3P80A 1LLZA 2XH2A 2D20A 3SAZA 4AIBA 3CASA 2QVHA 2QJNA 1QPRA 2I5IA 4JQ3A 3DOPA 1DQWA 3PBVA 3PHAA 3BJFA 1YDYA 3DFNA 2ANUA 1VFFA 3Q65A 4LVDA 4IL2A 3AYTA 4O1FA 1O68A 2V3GA 4QEEA 4Z2HA 1VD6A 4ZFCA 3NZQA 3VDBA 3WK0A 1DJGA 4M6QA 3GC2A 2VMFA 3MI6A 5EY5A 3I3DA 5C71A 3BCDA 1M41A 1ELSA 4JX4A 1KTBA 4LUTA 1DJHA 3HG3A 1X96A 3QFEA 3TKFA 1MMFA 3RM9A 1K8XA 4D8AA 4GQ0A 3F2DA 3VX1A 2OFJA 2ACQA 2WO5A 4PCPA 2NUWA 3GXPA 3NPVA 3VFCA 4K7VA 5C7HA 1XLJA 3CUHA 1Y5XA 4LEQA 2D2OA 5I00A 1NFBA 2WNQA 3I4KA 4G5DA 3EA3A 4M82A 4UC5A 3HIJA 4UMCA 3CL7A 4PTNA 2BOFX 2AGKA 2EG7A 1RK5A 3EDFA 3O07A 4YVVA 4Z0JA 4NJJA 3GVRA 3ARUA 4GCAA 1RD6A 2OT0A 3CYVA 3URAA 3FGCA 1XGZA 1JZ2A 3CAKA 5CXPA 1NWUA 3KRZA 3T8LA 2ONEA 3O6CA 5IM51 5B7ZA 4S39A 2E9LA 1OIMA 1ZJAA 5A5WA 3ZWSA 3LRLA 1WO2A 5BOOA 3NQFA 4HMEA 3UY7A 4IXHA 2RUSA 2YDAA 5KMYA 1S2AA 3U8GA 1P7TB 2ZXBA 4QISA 1MZRA 3I3EA 3L4YA 3LCHA 1A3WA 1KKRA 3GH5A 3SQLA 4LBRA 3QZEA 2OU4A 1PUDA 4CD4A 1VQTA 2IPFA 1EEXA 1HQTA 3BL3A 4R7OA 1JXJA 4EF9A 3RGTA 4HCLA 2YW3A 4Q3MA 2DORA 2HXUA 3VKBA 3DFHA 1TMHA 1PIIA 3W71A 3UERA 4Q8TA 2WMKA 5H8UA 3V1PA 2QJHA 2P8BA 1E9YB 2WQPA 1OFEA 3PF3A 2OLSA 3N2CA 2DT1A 4JTGA 2QLYA 3F2CA 3I7RA 1B57A 3B8SA 5JQ9A 2FB2A 3AMLA 1GQIA 4X9YA 4DLFA 1EDGA 4HA0A 4O18A 1GW9A 1UMYA 4GGBA 4FSAA 3VOIA 2VC6A 1CENA 4RNIA 4IFOA 4NZJA 1OYCA 2NT0A 2IKIA 3UCQA 4D6FA 3EOOA 1Q4WA 1R9YA 1NM9A 1YE4A 1KXQA 3LBCA 2EPMX 4FNRA 2OZ0A 1TMQA 2GK1A 1OFPA 2IQDA 3SSZA 2DH3A 3EOLA 3G0SA 2BHZA 4IX2A 2C91A 4EIVA 1F6YA 4RKAA 2P50A 1WKYA 3H12A 4W7VA 3GO2A 4AZ5A 3W7GA 1PIGA 4PEEA 4CD5A 3WMSA 1C8XA 1Z6KA 3DFQA 1FHDA 2BTMA 4REQB 3WG6A 7TIMA 3M0KA 1FVPA 5K7JA 4EPDC 1EL3A 1M03A 1NWTA 5I06A 3KCOA 1PS9A 5CSRA 2MANA 1E3XA 5BRPA 3WF4A 4DWSC 4Y8EA 2H6RA 5A8GA 4ROPA 1CGWA 1M53A 3POCA 3H54A 2OG9A 2ALDA 3IJIA 1FWBC 3BCJA 2QIWA 1AQHA 3V35A 4S3DA 1N55A 5F2MA 4D6GA 2Y5JA 3OVPA 4EVZA 1MQPA 4LVGA 1EJRC 1JCTA 2XFWA 4AIOA 3WQOA 3M41A 3CC1A 1UD5A 3AIBA 3PPFA 2A3AA 1PB0A 2HTMA 2J8GA 3GE7A 4AD4A 1T8XA 2W61A 4GC3A 1AQ0A 4O4VA 3SY8A 3PS7A 4WDWA 4MAVA 4JHZA 3HGJA 2WLYA 1TREA 3IACA 4FOJA 4UTLA 2ISSA 1EP1A 3NQGA 3E2VA 5HNUA 2Z2AA 2QF8A 2WJFA 4B5XA 5AFDA 3MMUA 4TU1A 4N9BA 4U31A 4AVNA 5KZDA 2OEKA 4HN4A 3TLQA 3MVTA 1YXCA 1WOBA 1R5YA 4GI4A 3T44A 3W7PA 2DZWA 5HA7A 3V5FA 3LHWA 1PDZA 1R38A 4V33A 3G77A 1SVDA 5BU6A 2Z26A 4Y9NA 3DGRA 4RDZA 3DECA 3D5HA 5A69A 5C9UA 1H0GA 2FHCA 3SZ8A 5D9OA 3UYIA 3VMOA 2XVKA 4NF7A 4JY9A 3M46A 3I6EA 4C6EA 1HJWA 2WSKA 2QJJA 2PD9A 2GSEA 5AHIA 3WLRA 1SR0A 3H24A 1OK6A 1RD5A 3WDQA 1Y7VA 3FKKA 2E5BA 1EJUC 4FPSA 1UCWA 4XZBA 3L2IA 1NJJA 3RX3A 2X0YA 1I9CB 3M0JA 3K4WA 4NG3A 3EX4A 3W27A 1K9TA 1QK2A 3CQ0A 4JTIA 2GQAA 4IFKB 4CU7A 3ZVIA 4U2YA 3CTTA 4QJ4B 4OUIA 2QUTA 5HNTA 2F7FA 4LYRA 3AMKA 4O1DA 1YBQA 3WNNA 3JW7A 4AHPA 3TR2A 3SUTA 4JXCA 1VRXA 1M7JA 3C2FA 1EDTA 2GJNA 3RFAA 1C8QA 3QZ6A 1ITXA 1H61A 1FP9A 4L5ZA 5F1UA 3RM8A 2A2IA 3MKKA 3AHYA 2FQIA 1QNSA 1CGXA 1NOWA 4JIIX 4N7QA 1WKFA 4DEFA 1FRBA 4MB4A 4PMQA 5HULA 4X61A 3BAJA 3RJXA 5H8PA 3P5YA 1L6WA 1PCWA 2UY5A 1XLDA 5I77A 3A5FA 4D2JA 3TVAA 2JEPA 1GGOA 3BANA 4BKNA 3DHFA 1E9IA 1ECEA 2GFTA 2WMGA 4O57A 1NY1A 4O16A 3NQ2A 1A3XA 1QPKA 3QOMA 1AW1A 4M24A 4PB4A 3TLLA 3PVFA 4ML9A 3VOCA 1H41A 3TOYA 4CNPA 3P62A 3WJZA 2GGEA 1UA7A 1UBPC 3IK4A 5EA9A 3GXIA 3DBPA 2OWXA 4L9YA 3ARQA 2DW6A 3UZ5A 2QT3A 3RMEA 1B4KA 4NYUA 1WCGA 1JZ3A 5HPOA 2ZFAA 3QLDA 3ONCA 4J40A 3A4WA 4DLMA 2J47A 3M0IA 1H7WA 2MUCA 1AODA 4DWSB 1W1VA 2XDFA 3VU2A 2J9ZA 4JTHA 4PC8A 3H4GA 4GI9A 3WQWA 5D9PA 1W1TA 4IOTA 4OTKA 1VEOA 5LIUX 2ZTKA 4LU0A 1OABA 4NJHA 4HBKA 4WDTA 1A3HA 2SFPA 1OEPA 3ME3A 4LYQA 1F6KA 3RLGA 4ZQOA 4U10A 2Y70A 1CXFA 2VGGA 1KQZA 3TN6A 5U4NA 3EA2A 3KLKA 1W2PA 2PE4A 1A0CA 1J0ZA 4O1CA 3S6TA 1XLGA 1E0UA 4Q32A 3FAWA 3FJ4A 3ZLFA 4Q4QA 3E38A 2PZNA 5GNZA 3CS2A 1PKMA 2C6QA 2NX3A 2Y7FA 3A24A 1NTHA 4WJEA 3DHDA 1KFBA 2ZWYA 1UD6A 5KINA 3N13A 1YEYA 2QGYA 1F4AA 4TVUA 4GHRA 3UXIA 1GVEA 5TNVA 2NV1A 3ABSA 4O1BA 4YIWA 1Z41A 2X2GA 4PL1A 4JN8A 2POZA 1XIIA 4KIEA 3GDTA 1M68A 1XBZA 1ME8A 3BGAA 1GK8A 4W5ZA 2J8FA 3LBMA 1IT7A 4XD3A 1Q2SA 4QAWA 3UJRA 2WHLA 1P5BA 1Z8AA 2G95A 3EWZA 3E02A 4I7UA 4IICA 4BF9A 3EKLA 3VNIA 6TIMA 4P7NA 2E9MA 1JPKA 2PPGA 3WLTA 1A0EA 2OQLA 1FCUA 1V3JA 3M0LA 3AHXA 2Z7KA 1S5WA 1ME7A 4LANA 3B97A 1XPGA 4M6PA 3WMBA 1BYAA 2QKFA 3WQ8A 3WYZA 3NQ7A 2NLIA 5C54A 2DU2A 3B3DA 3KS6A 1E0WA 3ATZA 3HFTA 2ZZ1A 1GTHA 1QJWA 3NYDA 1PZ2A 3E49A 2V81A 3M0HA 1WOAA 3KHDA 3E9AA 4Z2LA 5AYIA 1R86A 1LL7A 2PCEA 2WCAA 3B0UX 4A4AA 2V5KA 1BVWA 3E0FA 4LYPA 4ZE5A 3KUMA 3R10A 1UR2A 1TUFA 2J27A 4C7FA 4KFPA 1RJRA 4EWJA 3FY1A 1JZ7A 5FL0A 5EMJA 4RE3A 2A6LA 5I3KA 1ZPTA 1PAMA 1MXDA 4YTUA 1LUCA 3QQ0A 1JCNA 1E9LA 4OGZA 4G8TA 2ZX9A 3SCTA 1OQFA 1FH8A 1IZKA 2ATMA 1NF7A 4H9XA 3OA3A 2ZDSA 1AW2A 1TUXA 1KD0A 4GQGA 1T40A 1J0KA 3OG2A 2HJPA 3DYOA 1FWHC 1HTIA 4HNVA 1YNPA 4MUZA 3K4DA 3N2XA 2NXIA 1PSCA 2X0SA 3CB8A 4GKLA 3PZ9A 2DT2A 1RJPA 2QULA 5AC7A 1BTCA 1EB3A 4KEMA 1TG7A 1XC6A 4S1FA 4J1OA 2FZNA 3MVIA 1IEQA 2PWVA 1KBJA 1MO0A 1HJSA 1EOMA 4AY7A 1EXBA 3EDKA 2V82A 3KBJA 3VUSA 3NL5A 1J4EA 1GUVA 2V5JA 1QNPA 2V69A 4N6EA 5K9XA 4AZ7A 3D6NA 5D4YA 3IIPA 4KWSA 3W24A 1CXLA 2FLIA 4R85A 4EF8A 3RO6A 3W01A 4LUSA 2QXWA 3MUZ1 2ISWA 4UR9A 4XKYB 2WYSA 2A21A 3RCYA 3P0WA 3VTRA 3WJWA 2YL5A 4RV3A 3CMJA 4EPKA 1VPXA 4W5UA 2ZRVA 2Z28A 1MEWA 3UWUA 1FWCC 1EZWA 3PULA 1E56A 3GKFA 2NUXA 3WD3A 1X38A 4LTSA 2HK1A 2ZIDA 2QCHA 4EAMA 3KP0A 4JOMA 1MUWA 1UKOA 3RIKA 1HIZA 2OO6A 5LA2A 4HK5A 3OB8A 3RN6A 2R14A 2EPOA 1UKPA 1H7RA 2ACUA 1GKRA 3S2NA 4DJED 1MW1A 3W72A 3GHTA 2JE8A 3FHAA 3B9EA 3IJ9A 3QXBA 1KM4A 3NPWA 3CNYA 1SZFA 3S9YA 3RCMA 4BHYA 3N2BA 3MQTA 3WNPA 2NQHA 4PRRA 1K9EA 2ABBA 3W7RA 2R82A 4D1IA 2A7NA 1TELA 1GQKA 2WKJA 3MV11 4K7YA 2GSJA 1E4IA 4XZHA 4LBUA 1W6TA 1XRTA 3VO0A 1XDLA 2BG5A 4ZTXA 3DYMA 4CQAA 2PWFA 5EBUA 2PFHA 1GW1A 3CK5A 3SEPA 1K3UA 3WK1A 3B0XA 3EYPA 4K2SA 1KQYA 1W9VA 5A1AA 4DM2A 1ZJBA 1A5BA 1W32A 2DW7A 3W73A 3GDKA 1UR0A 4G2DA 3EOEA 1EBGA 1BKHA 3D3FA 3KBVA 1FWGC 2NX9A 4ZENA 2CHNA 1UKQA 4BQ2A 4IZGA 5D9NA 3WSUA 3T0DA 3TWAA 1CTNA 1P1XA 4A22A 3ZM8A 3APGA 3W7HA 3WLJA 5DANA 2J13A 3EX2A 3PWAA 4I7VA 3UCDA 4I6KA 1ZZMA 4WHBA 4F2TA 3E12A 3S2JA 3BLDA 2XIJA 4QE5A 2YLLA 1KLYA 3UF9A 4DUVA 1ICQA 2WHJA 1UG6A 3TJ4A 1ADOA 3UG4A 1FDYA 1KR0A 1UOKA 4M7SA 2P0IA 1HXJA 3WLQA 1YPIA 3PSWA 4S3GA 4JYFA 2ZDRA 1TZ9A 3GXNA 3HG2A 3VE9A 1R87A 1A5LC 1GVSA 1R6WA 3N6HA 2VEMA 5HQLA 4RNHA 2V2HA 3AICA 4DO4A 5FEPA 4IMEA 1EPXA 2CKSA 1FWFC 3GNNA 3SCUA 3WDIA 3INPA 4LRSA 3LG3A 1W5OA 3R12A 5KZEA 2NSOA 4M7TA 4W88A 4ZXLA 1LZOA 5F4WA 3AS2A 3BJTA 3W7OA 1T96A 1HN1A 4PTWA 1D2KA 5BRBA 1DTUA 3UA4A 3GWQA 1ESWA 4NL1A 1V0KA 1SW7A 5IOBA 1W1IE 3SY5A 4EXQA 3VIFA 1JDCA 1W37A 1KWGA 2W27A 4HA3A 4G6CA 2G3IA 1BAGA 1OFDA 1E15A 3UZYA 1LP6A 3QR1A 3DENA 1K4HA 2POTA 3AYVA 1CZ1A 4PFMA 5I09A 1UIPA 3STFA 2OSWA 4K1WA 2PP3A 3W7JA 5A8QA 5XINA 4WSHA 3W81A 1V08A 2AAAA 4O52A 1ZP4A 5AHEA 1H1NA 4C6OA 3SW6A 5HJLA 3PNUA 4H83A 4TV5A 1XDMA 4EOUA 3R89A 2A79A 2VZUA 1W1YA 4WUIA 1D8WA 4CD8A 1EPVA 1MNSA 1Q2RA 3THAA 4FLQA 1CXEA 1NIUA 3UXAA 1NDVA 4H8VA 1US3A 5HBFA 5LNSA 3GK0A 5KTLA 3FN9A 3TSDA 2CBJA 3G1RA 4F9JA 4H2CA 3G0UA 3F7JA 3IJ8A 1FCQA 4NRRA 4HHHA 4G56A 1ZJHA 2PRHA 1JPDX 1M6JA 2D73A 1RCXB 3BARA 1R3SA 1VB9A 4AF0B 1HKMA 1SMAA 3CGTA 3LA4A 2GGHA 1B3ZA 1TQJA 4GY0A 2EXOA 4QIUA 4CNNA 3JVAA 3SFWA 3LMZA 4WQ6A 2PWUA 1WUFA 2C1IA 5AZ0A 3CLMA 3AO0A 2IW0A 1C8YA 1I8JA 1F61A 1H2JA 3NURA 5DX7A 3GIQA 3QMSA 3B4YA 4MIMA 2FHBA 1XLBA 5D30A 3MTWA 4NJKA 4MKVA 1FFQA 3PC0A 4IJCA 1XSIA 2LLEA 4YMZA 2WB5A 2Y5SA 4B5UA 2YYTA 2FZMA 4ACZA 4UXDA 3T0TA 1QMLA 3RLHA 3VCCA 4ZEPA 4FX7A 1X6LA 3GNPA 2YIHA 3GDRA 4LB4A 2ODOA 3CWHA 1FWWA 4XZIA 1P7TA 4HSOA 3SCQA 1IEWA 3L9CA 4YL2A 3GVVA 1WDWA 1WZKA 5ECVA 1W3LA 1TV3A 4NASA 3GTHA 4QS5A 1XBXA 4N9EA 1SQ7A 4D6JA 5AB3A 4H9YA 4IJBA 4V28A 3TCSA 1US0A 1WDDA 3WK2A 4E3TA 3O16A 3S9ZA 3OIXA 1A5CA 1KM6A 3GDLA 4OIFA 3WBXA 2FVLA 3HN3A 1RQEA 7ENLA 1IIHA 5G1MA 1GORA 3FYOA 3WFZA 1ZENA 4ERIA 5CGMA 4H01A 5M5DA 3UGRA 5AVHA 3MO7A 1RZMA 1LORA 2VD8A 2HDJA 2FZ8A 4OJYA 1KV8A 4CQ8A 1QI5A 5I5RA 1GPFA 5C2GA 1OG0A 3W86A 4UQCA 1UR9A 2R8WA 3MBDA 4YYCA 2QDGA 4BA0A 2VXNA 4GMEA 2FIQA 3O6DA 4NVTA 2C18A 4W4QA 4NZFA 5CAKA 2BODX 4WOZA 1GG1A 4B4HA 3P61A 3SADA 3GX9A 1JYVA 3IVTA 4NU7A 4UB9A 2CBIA 2CLHA 2VZVA 3ALGA 2BHYA 5HUPA 3W2LA 2QR6A 1GG0A 3IARA 4GRSA 4W8LA 4KW2A 3DH7A 3QTGA 3VNMA 3G5EA 4GWEA 3N15A 2F6UA 4PODA 3O8AA 1H49A 3M16A 3WZ0E 4KEUA 1TPH1 2WKGA 3N2OA 1Q8AA 5HJYA 8CGTA 1A5UA 1UASA 3IV8A 1WUEA 1ODZA 1LROA 2QEZA 5F2IA 1WXJA 1V7AA 1E3ZA 4LEFA 3LNMA 1H4PA 1UJQA 2G3FA 3B0YA 1I4NA 4OBSA 4UOZA 3HJEA 1KXVA 2OTDA 3KW3A 4H00A 4S3EA 3WUFA 2PBGA 2J66A 5CJMA 2IMRA 4IIBA 5HWJA 4JFUA 3H6OA 3MYPA 4LUIA 3W2UA 1CGUA 1PHQA 1I2OA 3T7VA 4EAYA 2VR5A 3OLEA 2JF6A 4DJEA 4Z1AA 3MPGA 3HPFA 3RX2A 2C7FA 3TN3A 4O0KA 1CB2A 3MI2A 1XKYA 1PBGA 3VC5A 1HT6A 1W2VA 3L12A 1OGSA 1EJVC 2PLCA 4HNUA 1YHTA 4HHPA 1QW9A 2EGZA 1WDRA 4WXZA 3ANVA 1XQKA 5DCDA 5M03A 1K7XA 2YFNA 2J7BA 4R9XA 1QOPA 1ZBCA 4KMQA 3NDZA 5I79A 3W84A 1PZ0A 1WBJA 1KKOA 3ZJKA 2OELA 1QW7A 4AX7A 4G9PA 3OU8A 1EHAA 2A3HA 3PBWA 2V5BA 3W28A 1G67A 4FNUA 2JF7A 3RPTA 3EEGA 1VFOA 1OFOA 3ZMRA 1TPWA 3E5PA 5ABHA 4H6KA 5IFTA 2WNZA 1OGGA 3AIVA 4U5IA 4LV9A 1VKFA 4INFA 3M43A 4Z2KA 1SSDA 4OWGA 5FJUA 1EA0A 2OEMA 3QW4B 1CGTA 4BS0A 4UFMA 4LNYA 3PFMA 2C79A 2CW6A 4AWTA 2NV9A 3O2LA 4RUBA 3LK6A 3S5YA 3M0ZA 2QPUA 1JI2A 4L4PA 3PY2A 4I8YA 1TKKA 4QDWA 3GR8A 2GOUA 4DYKA 3A22A 1SW0A 2GWGA 4F0LA 3OJGA 1JD9A 2CBUA 2B7OA 4RW3A 3VPLA 4C6JA 1HJXA 1I0BA 4JD4A 3KL5A 1FHVA 5AN7A 2FPTA 1VC4A 2A0NA 4O15A 3RMJA 3MUXA 4RK8A 1UR1A 2F61A 3W22A 3WENA 1OVDA 4GG9A 4M1RA 3LHUA 1LQ0A 3WJSA 2J7GA 2VDHA 4X3ZA 3LCWA 4CNUA 4M8UA 2XIBA 2VEGA 3MCMA 3V18A 3TN5A 4Q8QA 4AD3A 3PFRA 3PB0A 1H7PA 1E6ZA 1XWYA 3EKGA 7A3HA 2J7CA 4JTCA 4A35A 5EFDA 4S2BA 4DUWA 4N6FA 3R8RA 5E93A 3W1MA 4MUPA 2RH9A 1VS1A 1ISZA 1XCWA 4JGDA 4CQ9A 3A6OA 2QIIA 1V02E 4UQAA 3M7SA 2YDSA 3BG5A 1H1ZA 1XCFA 1ZAIA 4WSJA 4DF1A 5J5DA 2HE8A 5FKYA 1J5SA 1DXFA 3CIXA 5FCZA 4RNJA 3BV4A 4MYAA 1KCXA 2Q01A 3EOUA 5D2YA 1NARA 3DUGA 4PCFA 1F3XA 5TF0A 1GVQA 4XG1A 1QTWA 3BQ6A 3FXGA 1EHNA 4IIGA 1KR1A 1GZJA 4H3DA 3WQ6A 5D32A 2ZXDA 3CU2A 4GNVA 2R24A 2ZQ0A 4GACA 3WH9A 4CCEA 1MW3A 3LCGA 3N04A 5IBXA 1NFPA 4ZQMA 4GLEA 2VC9A 3H7RA 1U22A 1WP6A 1HJUA 1V0NA 3OZYA 4PMDA 3LGGA 1AJ2A 3TXZA 1DJYA 4FF7A 2JK2A 4UR7A 3A3XA 3TC6A 3FDKA 4DWSA 3BVJA 1ZLPA 4FO4A 1QNRA 1FBAA 1WKEA 4KGLA 3E5BA 3W70A 2WBKA 3W85A 1A5KC 4PUDA 2XHYA 2I57A 1QI0A 3IANA 2YFOA 4FIQA 1L2UA 4DPQA 1ZCOA 5EYWA 3N12A 2C15A 1RPKA 4OFCA 4D6CA 2DT0A 1ME9A 1TVPA 1W5MA 1CPUA 5JXQA 3ZO9A 2GJRA 5CZJA 5BXPA 3V1HA 5CAHA 2Z25A 1R30A 4L9XA 4AY1A 2ON3A 3WD2A 3TW7A 2RAGA 4PMYA 3UCCA 4J4KA 4GGHA 7CGTA 4C6QA 4AZGA 4MG4A 3GU1A 3AU2A 2PDQA 3HQPA 5G2IA 3ZT6A 4D6HA 4XD4A 1WAUA 5CBBA 2WMIB 1YTKA 3W74A 3M44A 4HZ7A 4B5TA 4FR1A 3NDYA 2J24A 3OVQA 3ITGA 4A21A 4E4UA 1RVGA 1VHCA 3SCOA 3W1QA 4AX6A 2QCGA 4S2CA 2Y8VA 2PCQA 1TX0A 1GOIA 1OF8A 3ABRA 4ZOBA 2PTZA 5LNVA 3AXHA 3WNKA 1GOMA 2YJQA 3OOQA 4ZO7A 3IUDA 1YIXA 1U5JA 4R34A 2ZVIA 3GH4A 3WLPA 4MJZA 3GTNA 4CD6A 3LV5A 3LCLA 2PTWA 3VINA 3WQPA 3FVMA 3KVLA 3OGVA 1GOKA 3MKVA 3TYZA 3QSTA 3VM5A 4A2SA 1UZHA 1DHKA 1JCYA 1TPEA 3ARYA 4E6MA 3M47A 1T99A 2XN0A 1TTPA 3NQ8A 1YW1A 4LVAA 3P81A 4I3GA 5CH9A 3TW9A 1EWEA 5GJPA 2Z2BA 3GB6A 1ZB5A 4RLIA 3A13A 1BRLB 2P76A 3D3AA 3WBYA 1HP5A 1ZHAA 4G1KA 2FH8A 4Q4SA 1YDVA 2QF7A 4IGHA 3GNRA 4HYWA 1EZ2A 4H6QA 1TWIA 3V36A 3C2RA 3ZFHA 1IXNA 2DSWA 1BHGA 1XIDA 2NVDA 5BW6A 2BXZA 3GU2A 3A4JA 4MAZA 1R9XA 3NQDA 2GQ8A 5CLTA 3RG6A 3WQDA 1EGVA 2ZKMX 1EDQA 2Z1BA 1H1YA 1YTEA 3W7LA 4HVXA 1JUKA 4YU1A 4C7DA 4A05A 2DIJA 4GKTA 1UJPA 4DIAA 1AQFA 4YN5A 2IS7A 3CZLA 1POJA 1L9WA 5CC3A 4AWSA 2NUYA 5FJIA 3B8DA 5ABFB 3E0IA 3W25A 3N6JA 1D7FA 1GVFA 1HKIA 3WL0A 2PTYA 4XB3A 5LNRA 1ECQA 4TTUA 3KS5A 1KRMA 3BQ5A 1Z44A 2QJGA 4CU8A 4LQ1A 2A3BA 3CIWA 3N11A 3W6MA 5I3HA 2GPTA 5LA0A 3PAOA 4HU4A 3W00A 4QDMA 2OSYA 3NAVA 4TOQA 4UQEA 1TV8A 2X1IA 3UPWA 1SJCA 4FZIA 4WJXA 5CEWA 1E1CB 1TPC1 4JN6A 1GHSA 3QH2A 3S1UA 5JH1A 1PTGA 4QG8A 2JKEA 3OGRA 2OOGA 4R9OA 1MDRA 1POKA 2TPSA 2V68A 1DP0A 4PMRA 5FF2A 5DELA 3KOWA 4XKYA 1PPIA 4LS2A 1FWEC 3QGAC 2VR4A 1H50A 3MYOA 3SR7A 2GDVA 2VGFA 4YHGA 1ZBVA 4XWUA 4ATLA 3P93A 4B15A 4J3SA 3B9DA 3AU6A 5CLWA 4QJ5B 3JS3A 4NXSA 1BLIA 3UNTA 3VGGA 5ABTA 3ZIZA 4CQBA 4JFTA 2P3EA 3HJZA 1JAEA 3AI0A 3EWBX 1XL9A 4Z0SA 5G1YA 2VNCA 3NSMA 4XUYA 3OIHA 1JJKA 2R91A 3DKJA 1HG3A 1LL4A 1Q6DA 4QRNA 5MKGA 3LM7A 4PUNA 4JTLA 5CZSA 4BF5A 1SO6A 1OD0A 1WKDA 3H2NA 3LHTA 1QWGA 1XRVA 3PUOA 4HPJA 3PBMA 5BROA 3S2MA 3LSCA 3GXDA 5FJOA 4D6DA 3EAUA 3TJIA 3NO1A 4XZ9A 1W3HA 3SJNA 4XISA 4AFYA 4O17A 4FF5A 3WDJA 4A3YA 4HNCA 3A47A 1L0PA 1O94A 1ZQ5A 2YGYA 3SCRA 2ZXQA 1DJIA 2HZGA 1X1ZA 3GUGA 1GYLA 4X0NA 3ITYA 3TJXA 3SN4A 1Z69A 1N8IA 5I23A 1VCFA 4JIRA 2V3DA 3SUSA 4P7OA 2YSWA 2JIEA 4B3ZA 3BC9A 1JFHA 3WNOA 4LXFA 5HDRA 2E5DA 3WN6A 1GOWA 2VDIA 1DXIA 3TA9A 1BGGA 1V3IA 2PUZA 2QDDA 3CZ8A 4DY1A 1EP2A 3KDOA 4NZ3A 4AHQA 4DM1A 5T91A 2P3ZA 3A21A 4MTVA 3ITXA 1AW5A 3KDNA 2QV5A 4ZR8A 1OF6A 5H2ZA 3T0AA 4ZCWA 4US6A 3LPFA 1IWBA 2OGYA 3MP4A 3KTCA 1ZY9A 1VBGA 4WD0A 3H26A 3OGSA 3T0BA 2RGLA 3B0PA 3TJLA 3MI3A 1SM9A 1W3NA 4WXYA 1ZFJA 3G1YA 3B05A 1A5OC 3C86A 3LCFA 5AKQA 4A6GA 1KC7A 4M3PA 3DFYA 1FWAC 1SGJA 4HNNA 1V93A 2QCDA 3QOKA 2YBUA 7REQB 3OVRA 1W91A 3VIGA 1OK4A 3T2OA 2V5CA 4BI7A 4Q33A 2Y85A 3OEXA 3CLWA 3SN0A 3UG5A 2J9XA 3C61A 5C70A 1DJZA 3OW1A 2FPVA 3MMTA 3SM0A 1QAPA 2ZVRA 4HK7A 3GNDA 3ABOA 4UQ9A 2VFIA 4HZ6A 3TP4A 1C91A 2J25A 3QGVA 3LXBA 3CB3A 1ML1A 4RZ6A 4CN6A 1EC8A 2XGIA 4EACA 4ZO9A 1K7EA 2OSXA 4ILSA 2ZUMA 4R33A 3T81A 3UGVA 4K3ZA 3TQVA 5A6BD 4JCLA 3KP1A 4NJGA 1IEXA 4WF7A 1RP8A 2Z1KA 3GC5A 5DQPA 3FEQA 2OYLA 4GBDA 3MY9A 5CQ1A 4PUWA 3R43A 4O1EA 1GOOA 1UMLA 3QHNA 2YCLB 3ITCA 2AQWA 2PDWA 5EBAA 2WZMA 2EJAA 5G4HC 3NXLA 1V02A 2D0FA 3GXMA 3CYJA 3WQVA 3WF2A 4WK9A 3K46A 3H2AA 3MWAA 1VFLA 1NOFA 4JKLA 3FSTA 1VRDA 1P0DA 2WPBA 2CLOA 1FDZA 1BVZA 5IHSA 3VKDA 4DZ5A 1ZUAX 1JRBA 1G7UA 4QCEA 3HTWA 3LLDA 4LX4A 1EO7A 3U6WA 1UROA 3N2MA 2I14A 4FNTA 4L6OA 3BURA 4A29A 1MXGA 2YOCA 4WLCA 2Z1XA 3S46A 4ZO8A 3G1FA 4FXRA 1ZNNA 6XIAA 1SJAA 3GTXA 4H8NA 4WY0B 3ZR6A 4ZZ9A 1PX3A 1Q66A 3SCNA 1TIWA 3FOKA 1IHIA 2DT3A 4H8UA 1CLKA 5E1QA 5I02A 2C16A 4AC7C 3BAKA 5CJ5A 5C6MA 3AHTA 4OT7A 3LHYA 3STGA 3T05A 2J88A 1DQUA 4A8RA 4ZGYA 1WBHA 3ARWA 3G2GA 2CESA 3VX0A 2Y7GA 3WBWA 2FDSA